3WALA

Crystal structure of human lc3a_2-121
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
RPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Microtubule-associated proteins 1A/1B light chain 3A
publication title Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2013-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3walA00
2BYEA 3DVGY 1CMXB 5JHAA 4XZ4A 4MJSA 4ZRKA 2JZZA 2KC1A 3SHQA 2R2OA 2NBUA 1RRBA 2I1KA 1YX5B 1L2NA 2R2QA 3HM3A 4W9CA 3TBLD 1GC7A 3RULA 4MELA 2L7RA 5HKHA 2CHZA 1LM8B 3M3JA 3DBSA 2K25A 2KKCA 2C7NB 2KN5A 3IVFA 2QHOA 1WXMA 2FCMA 2LVPA 3VUYA 3L10B 3KUDB 2VRRB 3VAWA 4LCDE 1WXSA 2KJ6A 5D94A 4GB9A 4GOCA 2NR2A 3TL5A 4IWOA 1WMHB 4W9HA 3UQAA 2LWPA 1A5RA 2JT4B 3WANA 4MSQB 2KQSA 2EMTA 1KJTA 3BINA 3KUCB 3UGBB 4EZJA 3PRPB 3V6EB 4A3PA 2NPTB 1SGHA 3WAPA 4FN2A 1OTRB 2DZJA 4FBJB 4MDKE 4W9FA 4DHJB 4G11A 2D07B 4RM9A 2ZPYA 3ZDMC 4F1SA 1H4RA 2LJ5A 3OAWA 4GGQA 3VFKA 2CKHB 2N1WA 5D6JB 2BYVE 4IWQA 4PYUA 3APDA 3TIXA 4LJOB 4P7IA 3H7PB 2ZVOA 5J18A 2KO3A 3APCA 3UIOB 1WGGA 3ZTDA 3V60A 2NS5A 3DQVA 2IO1B 3ZNGC 2MA9B 3PRZA 1RAXA 2KFKB 2NCNA 3R7RA 5CX3A 2MRPA 4HK2A 5LLIA 4HXDA 1ZGUB 1YJ1A 3BY4B 2N9EB 4MJSB 5TR5A 2MWSB 2DZMA 4LJPB 2Z0EB 3T9LA 1L7YA 2MBQA 4CO7A 5JHBA 3T8MA 2V1YA 2JWZA 4KZCA 5FR6A 2RSUA 4NNJB 2JUOA 2FCQA 2C5LC 5L83A 1WM2A 1WY8A 3DDCB 3K9PB 3ZNID 2EKEC 3VTWA 3EC8A 2AWTA 3ECIA 3X0WA 2J0JA 1P1AA 4FJVB 4K1RB 2KLCA 2BWES 2DYOA 3QARA 4DK5A 3OLMD 2DAFA 2L0FA 3VTVA 4W9KA 3P2BA 3VH3B 4FHKA 5L95C 2KLGA 4AUQC 2N7EA 3V61A 2DX5B 4GIVA 1YQBA 3WAMA 3ZRCA 4IM2A 4OVUA 2KDEB 4LDTB 2M1MA 2NVUI 3PZDA 1V49A 1EUVB 1WR6E 4CYEA 5GMVA 3L16A 3NZUA 4AJYB 3W1SA 3IFWB 3SD5A 2LGXA 3GOEA 3NY5A 5EDSA 3EHVA 2AL6A 3DBRI 3DVNV 4II3B 4WQOB 5BO4B 3PLUA 1XQQA 3V6CB 4FULA 4YL8A 1UH6A 2WYQA 3AXCA 2PPHA 4ANXA 4XX5A 2JZ3B 2KMCA 3L13A 4MGYE 3UQBA 5G2NA 1T0YA 2CR5A 4W9JA 2CHWA 1NI2A 3ZKJC 1E7UA 3ZNHB 4EOYA 1EF5A 2YVCA 3TCAA 2DYBA 4DHZE 5AZFA 3CF6E 4IUMB 4ANWA 1GUAB 3X23A 3R7QA 5J17A 3CSFA 4IM0A 1E8ZA 3NZSA 2HE7A 2AL3A 2C9WB 3WA0A 2LD9A 2M8SA 4GXBA 3A4SC 2K8CA 4KVGB 3HM6X 4KIKB 2OJRA 2N7DA 1WE7A 3O65B 2RGFA 4W9DA 5DCNA 2CU1A 2O2VB 1P3QU 2BKFA 4RM8A 4HCNB 1J8CA 2N1VA 1Z2MA 2HD5B 3APFA 4G50A 2KWUB 1E5WA 3PHXB 1E8WA 3PS6A 2PJHA 3ZNZB 4URKA 4N9F4 4OVVA 4A20A 4EZLA 1WIAA 4KV2A 2KNBA 4NAWA 3H9DA 3VH4B 1MG8A 2GBMA 3PLVA 3GZNI 4K7UA 4WAAA 5JZEB 4FJYA 5KHOA 2L76A 3RUIB 1GNUA 2J0KA 1UGMA 2RR9A 2KWCA 2L0TA 3IG3A 4I6NB 3A9JA 4E74A 3M95A 2KD0A 4F7ZA 1M94A 4PS3A 1WRDB 1V80A 2FCNA 3QC8B 2W9NA 2PE9A 3PTFC 4J6IA 2ZPNA 1C3TA 2M4NA 4BKTA 2KWVB 1R4NI 4MGZE 4PS8A 2DZIA 2LGDA 4HCPB 4NJ7A 1WFYA 2D3GA 2G3QB 3HHMA 3DPDA 4GN1A 3NHEB 4X57B 2WDTB 2ZZPB 1WX8A 3M63B 2BWFA 3K9OB 4JIOU 1Y8RC 2NBVB 2C7MB 3VTUA 2AEHA 5AZHA 2J7QB 3KW5B 2C7HA 2MBHA 3ZTCA 1WYWB 3Q3FA 2KANA 1IPGA 1YIWA 1ZW7A 2M17A 2CS4A 1TTNA 3PPAA 1NBFC 2FNJB 2XEWA 3WAOA 4B95A 4E3CA 4W9IA 2FUHB 1KM7A 2C60A 2L00B 3QHTA 4KZ0A 1SIFA 1HE8A 2LVQA 4TV3A 1UZXB 2FIDA 2V3SA 1WF9A 4MM3A 3MJWA 4NPNA 3W1YA 2BKRB 1EO6A 3AU5A 4TUUA 4W9LA 3WALA 4ANVA 4B9KA 1E90A 2ZCBA 5DPTA 1WGHA 2A4ZA 4GDLA 4ZDVA 2K8BA 2LGYA 2G4DB 3ONSA 3QJZA 2BYFA 1IYFA 2L3ZA 3C0RB 3VUWA 2B3AA 2GBNA 3ML9A 1WXAA 2ZNVC 1UD7A 2Z0DB 2GOWA 5D7GA 1ZKHA 5C23A 1FXTB 1IP9A 2ZCCA 3ZVVA 3NOBA 4WJNA 4EKUA 3MHSD 4ICUA 1GJZA 3QWZB 1WX9A 4K7SA 1XT9B 3RZWC 3AU4A 3QCAA 3N30A 4II2B 1R4MI 4GSWA 4K81A 2L8JA 3JYUA 5IAAC 3ZRFA 2ZEQA 1WJ6A 4KDLB 2UYZB 1UBQA 2IO0B 2PEAA 3PHWB 4FLHA 4I6PA 2CHXA 1V5TA 4IM3A 4ZRJA 3VHTC 5DPSA 5LXHA 4HDOA 2K8HA 1EF1A 2KJHB 4WWNA 4AWJA 4B6WA 1I35A 4ZRIA 3OJ4B 3RD2A 3S2AA 4HDQA 2G4SA 4M0WB 1WGDA 2KFJA 5C1ZA 4TQ1A 3V62A 2NBWB 2LVOA 3H7SA 3PV1A 2KXJA 4M8NA 2MBOA 2JY6A 2XK5A 3B1LX 3EFUA 1V5OA 4AOFA 1P98A 2L05A 3PRMB 1J19A 5DPWA 2K6QA 3PGEA 4W9EA 3VDZA 4NJ6A 4EEWA 3VQIA 3CMMB 2GBRA 2WWZA 2M0XA 5J2RA 4MSMB 3RT3B 1P9DU 2JF5A 2HTHA 5AZGA 4I6LB 2WX0A 5KHQA 2PE6B 2ASQA 2IO3B 2IBIB 3VUXA 4DDGD 1VD2A 4BKGA 2J0MA 2K6DB 4ANUA 5E6NA 1E7VA 2REXA 1OQYA 1X1MA 3U7DA 2MP2A 3NS8A 3PSEB 2KDIA 2FCSA 2LASA 2GBKA 4PS7A 4DBGA 1UBIA 4DDID 5JH5C 3PREA 4NY0A 3ZLZA 3R3MA 2FIFA 3RYTA 3QK0A 1LFDA 4BBNC 2KOXA 3QIJA 3EECA 5AEKB 2KTRA 3QA8A 3AI5A 2RD0A 2GMIC 3A1QA 3ENEA 2HJ8A 1J0GA 4MH0E 3IBEA 2LXCA 2O6VA 4WJQA 4HLEA 4DHZB 1WGYA 4HPMB 3A9KA 4HPLB 1WJNA 2MX2A 1Q0WB 3PVLA 4WJOA 4IC7B 2BPSA 1NDDA 4GMVA 2MSED 2MQJA 2DAJA 4KSKC 4W9GA 2V4LA 1WGRA 3DBLI 3A33B 3RCZA 4BOSC 3DVGX 2XK5B 1TGZB 2O6VD 3L0WB 5DPRA 3JW0X 3N3KB 3N32A 3KYDD 2KZRA 3OJ3A 3ZW3A 2KX3A 2N4FA 2OOBB 1C1YB 1ISNA 1WJUA 1AARA 4DXAB 4GDKA 4TKNA 3QX1A 4KDIC 5CHWA 4F8CB 1WZ3A 2LI5A 3QAQA 4IG7B 4BFRA 4PYZA 1GC6A 3L08A 3JSVA 3TJPA 4DWFA 1XD3B 3SU8X 2DYMA 2JRHA 4BVUC 4K7WA 1U4AA 3DOWA 3WIMA 4HJKA 4FADA 2YLMA 2MP2B 1V6EA 1WR1A 2D10A 2IZVB 4AP4C 1LXDA 1S1QB 1V81A 4LDTD 1S3SG 3VXWA 4EUTA 4M8MA 3VVWB 3LJ3A 1VCBA 4A3OA 2IO2B 4JLCA 1V86A 3L17A 4RMAA 5E6OA 4FHJA 4TQ0A 2KX0A 4NAWB 2KTFA 1RLFA 1V9JA 2KVRA 5G55A 1G6JA 2MW5A 2KTRB 4NQKE 4ZYNA 2KJRA 3A1QB 4GU2A 3LDZE 2D2QA 2JVCA 2MCNB 2IY0B 1GG3A 5CTRC 2KDBA 1RFAA 3A9JB 3HIZA 2O6VB 3CSTA 2EMSA 3Q3JA 2KMAA 2FAZA 3A9KB 3KH0A 3R66C 4MGIE 4KIKA 2D11A 3SDLC 1Z5SB 4WJPA 2IY1B 1KLVA 2LZ6A 2JPHA 3QQ8B 3H6NA 2MBEA 2KC2A 2O2VA 2MBBB 4G3XB 4JGHB 4JL9A 2BGFA 3L54A 1KOTA 1WH3A 1E8YA 2AYOB 4E71A 4BKSA 2LUEA 2GBJA 1WXVA 4MGKE 2DZKA 4G0NB 1WM3A 2KQ7A 1SE9A 5D2MB 2LXAA 5CHVC 1H8CA 2KDFB 5E6PA 3ZDTA 2BF8B 3U8ZA 4GDKB 1TBEA 3B0AA 4WWPA 1YD8U 2I1JA 3HK0A 4CHKA 4IWPA 2K39A 2KHWB 3KUZA 4FJZA 2IYDB 3TMPB 2DENB 4WWOA 4BKSD 3ALBA 2UWQA 3JSVB 1PQSA 3KVFB 2ZNVB 1TZ1A 3AULA 1WE6A 1WMHA 2N9PC 2K1FA 3DBHI 4NQLB 3UIPB 3ZO5B 1JRUA 1YX6B 3JVZX 2RPQA 1K8RB 5IA7A 1Q1OA 3U30A 1D3ZA 2MLBA 3MTNB 1WI0A 1LQBA 3ZIMA 2WX1A 1P0RA 2Y5BB 3ZUNA 2NPTA 2Z59B 2XBBC 3M62B 4ICVA 5CHFA 4BBNF 4GDLB 2ZVNA 4KSLC 2LRUA 4ASWC 2KK8A 3I3TB 3D32A 2A5UA 3B08A 3KYCD 1OEYA 1E8XA 3A4RA 1WX7A 3UF8A 2G45B 2DHZA 4MEMA 2LRWA 3UINB 4EZKA 4HVBA 3H7PA 3W1SC 4AJWA 4BOZB 3ML8A 1BT0A 4HWIB 2ZJDA 1WJ4A 1UELA 1WZ0A 1I42A 1OEYJ 3PT2B 4EFOA 2N9XA 3DCGA 4IW0A 4DHJD 4XC2A 4FA6A 2JRIB 4JQWC 3DVNU 1QZEA 2KFKA 1V2YA 2JXXA 3RZFA 1F9JA 5LXIB 1OGWA 3IHPC 3H1UA 1Q5WB
chains in the Genus database with same CATH superfamily
3DVGY 2WXGA 2KC1A 3SHQA 1FXIA 2R2OA 1N5XA 4AS1A 1YX5B 1RM6C 1JCKB 3RULA 5HKHA 1LM8B 1HTOA 2FCMA 3KWLA 4RH6A 1WXSA 4WIPA 5D94A 1IGCA 2NR2A 2V0GA 4W9HA 2NMQA 3UQAA 1I4PA 3WANA 4MSQB 3RFZB 2EMTA 1PGBA 4A9AA 4FN2A 2DZJA 2KN4A 4G11A 5IKCM 4ARCA 1D5MC 2BVCA 2K3UA 1XLOA 1MPEA 3T3NA 1N6ZA 2WXHA 2NTSA 3H7PB 2ZVOA 3AE6B 3APCA 1WGGA 1DOXA 3NG0A 4MT5A 5LLIA 3Q3MC 1HZ5A 1QLBB 2Z0EB 1L7YA 4CO7A 5JHBA 2Y5PA 2MJEA 2Z8LA 1CJEA 5L83A 3AMZA 5EE3A 1SSNA 3VTWA 3EC8A 4ZYSA 2AWTA 3ECIA 1N62A 2BWES 3OLMD 3V05A 3P2BA 2LEKA 1HXYD 2N7EA 3C19A 4YTMB 4RGTA 3ZRCA 2M1MA 2NVUI 1E7PB 3RNBC 2I2YA 2I38A 3AEEB 3NZUA 3SD5A 3DVNV 4II3B 5BO4B 2WYQA 3BWUD 1ZPSA 2WHIA 2WXMA 1A70A 4ANXA 4MGYE 3FAHA 1I4QA 2CR5A 1ROEA 1BMLC 3R7QA 3NZSA 2HE7A 2KT7A 2SAKA 3BVMA 2LD9A 1J7CA 3A4SC 2K8CA 5GXGB 1KRHA 2CU1A 4OZAA 1FRDA 1P3QU 4XWWA 4RM8A 1WGKA 3APFA 2KWUB 3PHXB 1K52A 4URKA 4OVVA 4A20A 4EZLA 1WIAA 4KV2A 5MPOA 2GBMA 2INDC 3AE5B 3SFDB 1UF0A 2L76A 2X38A 1GNUA 1SXTA 2WDVB 2KD0A 4C80A 1MJDA 1M94A 4PS3A 2FCNA 2ON8A 1RWSA 1UGJA 4H2AA 1F77A 2LGDA 2D3GA 2G3QB 3DPDA 4GN1A 3NHEB 2C7MB 4XYCA 4D2KA 2AEHA 2J7QB 5C3JB 3KW5B 3N1ZC 1TIFA 1SEBD 2AQ1B 4WURA 1UZXB 2TSSA 3R2IA 5HHDG 1C4AA 4NPNA 2E3TA 1EO6A 1KFYB 3AU5A 4W9LA 2ZCBA 4A6QA 2K8BA 4OZCA 1L4ZB 2GBNA 3P1MA 4N58A 4YTPB 1WXAA 1ET9A 3W5UB 5C23A 1FXTB 1IP9A 1D5ZC 3NOBA 1C4CA 4II2B 3AE7B 2D3BA 4LNFA 3JYUA 4QAYA 2ZEQA 1IBXA 4KDLB 3PHWB 2PEAA 4ZRJA 4I6PA 3AEGB 1E9MA 4KGSA 1EF1A 4AWJA 4B6WA 3S2AA 2G4SA 3AE4B 5C1ZA 2XK5A 1V5OA 2WS3B 2M56B 3HUIA 3VDZA 1QOFA 5BYSA 4HEA1 4O1NA 3VQIA 4MSMB 5BYQA 1D6EC 2HTHA 1T6BX 2WX0A 1OFFA 2IO3B 2IBIB 4DDGD 1JQ4A 1IGDA 4BKGA 2J0MA 2K6DB 5E6NA 1F0ZA 1E7VA 2REXA 1X1MA 3U7DA 3EA6A 3NS8A 3PSEB 2FCSA 2LASA 2GBKA 4PS7A 1UBIA 3RNGC 4NY0A 3ZLZA 2MJDA 3BVZA 3RYTA 3QK0A 1LFDA 1NEKB 3AI5A 2HJ8A 4XWTA 1IBXB 3R8BA 1WGYA 3BK2A 1GB1A 4HPLB 4DQOC 3DHIC 3PVLA 4IC7B 1NDDA 4GMVA 4ZOHC 2DAJA 2V4LA 2BS4B 2XK5B 3L0WB 3JW0X 3OG5A 1LGRA 1JALA 2OOBB 4BAXA 1AARA 3Q8EA 2WXJA 3MFGA 5CHWA 3MP9A 5FKAC 1WZ3A 4IG7B 4DWFA 2DYMA 4K3CA 4XDDA 4PK1A 2QIEB 3DOWA 4R3DA 1HEZE 1AWDA 3EUB2 2D10A 4AP4C 1N60A 1S1QB 4LDTD 1FRRA 3MC8A 2QC8A 1JW9D 4RMAA 4FHJA 1RLFA 3Q69A 2WDQB 3RNFC 4P1BC 1Y56A 4GU2A 2JVCA 2IY0B 2YEPB 1T0RC 1OQRA 3CSTA 2KMAA 3ABVB 3R66C 1LO5D 4XDCA 1YN4A 2D11A 1Z5SB 4JE3B 2JPHA 4G3XB 5I4DA 4TMAB 3NUHB 1L6VA 4JGHB 4L23A 2QJLA 3N1XC 1WH3A 2HDEA 4BKSA 2LUEA 3N1YC 1WXVA 2WDRB 5D2MB 2LXAA 5CHVC 1H8CA 4REZA 3ZDTA 1ZDVA 1CQVA 2WXFA 4WWPA 2PTLA 1YOVB 4IWPA 4J3OD 4NJCA 2VH1A 3TMPB 3ALBA 2EKIA 3KVFB 3Q3OC 4NZLB 3JVZX 3SEBA 1I4HA 1XF5L 2LJIA 1WWTA 2MLBA 1ACCA 2R61A 2ZVNA 1TY2A 4KSLC 2KVZA 4KKIA 5LNK1 2G45B 2LRWA 4HVBA 1FM0D 4AJWA 3W1SC 2BB5A 1V8CA 1YQ4B 1OEYJ 2N9XA 4IW0A 1KLUD 4DHJD 4XC2A 1QZEA 3RZFA 1F9JA 1QT9A 4J6IA 2JZZA 1L2NA 2R2QA 3TBLD 3RNAC 2J4XA 2CHZA 4CQNA 4US8A 3DBSA 2K25A 2D3AA 2KKCA 1DOYA 2QHOA 3VUYA 1EWCA 1TKGA 3AH7A 1WSPA 1V97A 3VAWA 4RNAA 1MFWA 4C7YA 1A5RA 2MJ3A 3UGBB 3PRPB 4RCOA 1IUEA 3WAPA 4FBJB 4MDKE 2D07B 4RM9A 2LJ5A 4GGQA 1QOAA 2N1WA 2JWUA 4IWQA 3GP7A 1ESFA 2L1AA 3W2DA 5J18A 2KO3A 4HROA 2OEDA 4M0WA 4M01A 3ZNGC 2MA9B 5JXVA 1EU4A 3IT6B 2MRPA 4HK2A 2WXNA 2RPVA 1YJ1A 5TR5A 2MWSB 2V1YA 4AQ7A 2JUOA 3K9PB 3P4SB 4RGOS 1JWMD 2V3NA 3X0WA 2J0JA 4FJVB 3QARA 1TS2A 3H8HA 3VTVA 1FD6A 3VH3B 5L95C 2KLGA 4AUQC 2DX5B 2K22A 1R7SA 1YQBA 1C78A 1TS3A 5BMGA 3PZDA 1EUVB 1WR6E 3NY5A 4IKGA 3EHVA 4WQOB 3PLUA 2RMMA 1UH6A 3L13A 1T0YA 3IAM1 3PZ7A 2CHWA 5HFYA 3PO0A 2YVCA 4DHZE 2DYBA 3CF6E 1GUAB 3X23A 2MHJA 5HI1A 3WA0A 2M8SA 4GXBA 2G9HD 4KIKB 3DBRB 2INNE 1WE7A 5DCNA 2INPE 2BKFA 1I4XA 1XXGA 4HCNB 1J8CA 1FFUA 2N1VA 2WQYB 4K3BA 5IP4D 1E5WA 1UWMA 4DXFA 5HG2A 5EE9A 2D5GA 1JWSD 4NAWA 3VH4B 1MG8A 3PLVA 1JWAD 3U4EG 4K7UA 4WAAA 5JZEB 2RR9A 2SEBD 2KWCA 2L0TA 1C79A 1K53A 3A9JA 4I6NB 3AV8A 3ZXRA 2YEPF 4F7ZA 1WRDB 1V80A 1C3TA 3AE3B 2ONQA 2KWVB 2PLPA 3NVWA 1YN3A 3W9CB 4HCPB 3Q8CA 2AQ2B 2WXIA 4KGRA 2JZPA 4X57B 1C76A 2H89B 3GZNB 3HVZA 1TT5B 1C9FA 1C4PA 2CU3A 4LTUA 2BS2B 1SJHD 1V1PB 1IPGA 1YIWA 1ZW7A 2CS4A 1TTNA 3PPAA 2JQRB 3WAOA 2XEWA 1KM7A 2L00B 1R4NB 1SIFA 1HE8A 2RDHA 1WF9A 3MJWA 3W1YA 2BKRB 2KMMA 1E90A 2FBWB 4GDLA 2A4ZA 2G4DB 3QJZA 1EWYC 1IYFA 3VUWA 2B3AA 1BXTA 2J42A 1FXAA 2ZNVC 2Z0DB 1ZKHA 4A8XC 1SJED 2LGIA 4EKUA 3MHSD 1WX9A 4ARIA 3AU4A 3CWIA 3N9YC 4K81A 2L8JA 1F52A 5IAAC 3ZRFA 2MH7A 3GE8C 3U2SC 2UYZB 2IO0B 4ACFA 1I35A 1WGDA 3TEWA 4TQ1A 1AYFA 3H7SA 1GOZA 4M8NA 4MACA 1I7HA 3EFUA 1F1HA 3IXSA 3ZGZA 2L05A 1J19A 1R4MB 5DPWA 5D3IB 2ZW1A 4JX1C 2JF5A 2WXRA 5AZGA 2ASQA 2J53A 5FR3A 1SIJA 5G5GA 4PT5A 4ANUA 3BYYB 1OQYA 2MP2A 2KDIA 2WU2B 2M0AA 2MEKA 4IDIA 3N20C 4DDID 3P63A 3HRDD 2BW2A 1I4RA 3PREA 3R3MA 3QIJA 3QA8A 1QOBA 2PVGC 4B0MA 3NZ3A 4MH0E 2KQ4X 3IBEA 4HPMB 3A9KA 4OHJA 4WH4A 3AE9B 2MSED 3KWVA 1JWBD 5AUKA 3DBLI 1VZ8A 2LFIA 3N3KB 2X8XX 5AUIA 3KYDD 3OJ3A 1FIQA 2N4FA 1PFDA 4HKQA 1C1YB 3BIID 2ZW0A 4TKNA 3QX1A 3B2GA 4KDIC 4F8CB 2LI5A 3QAQA 4PYZA 2W3RA 3TJPA 4JWUC 2GRIA 1M4VA 1J7AA 1D5XC 3DHHC 2MP2B 1V6EA 1L0YB 1QKZA 3TEXA 2PMVA 3P42A 4A3OA 2IO2B 1V86A 1VR9A 5E6OA 4TQ0A 2KX0A 2GLSA 2KVRA 1V9JA 1G6JA 2MW5A 2NTTA 4A90A 5E6JA 3LDZE 2D2QA 2MCNB 1ZDXA 1RFAA 2FAZA 3A9KB 2RDBC 2GB1A 3EFCA 2WXOA 2MBEA 2O2VA 2MBBB 1FEHA 1NI3A 2BGFA 4JL9A 4E71A 4OVZA 2GBJA 1HQRD 4LK0M 1YN5A 4MGKE 1WM3A 2KQ7A 1SE9A 4C4VA 4US9A 2KDFB 1FNUA 2BF8B 3P4RB 3ETRA 2I1JA 3KUZA 1VJKA 2IYDB 2DENB 1KF6B 4S0RA 2UWQA 3OWEB 3AULA 1WMHA 3DBHI 4NQLB 3P4PB 5EE1A 1WYGA 2VZKD 1MG4A 2NPTA 3IAS1 3D32A 2A5UA 1T0SC 4N59A 1E8XA 2DHZA 4MEMA 3GB1A 4BOZB 4HWIB 2D3CA 1BUIC 2ZJDA 3Q8AA 1I42A 3DVNU 2DWQA 2V3PA 2JXXA 1ZXHA 1OGWA 3L17A 4Q2JA 1CMXB 4XZ4A 2WGSA 1PGXA 3LB8C 2PIAA 1RRBA 2DNFA 4GLSC 3HM3A 4W9CA 4C4VB 3M3JA 2C7NB 2KN5A 3RMKC 2JU6X 2QILA 3IVFA 1FNVA 2LVPA 2IGHA 2VRRB 4LCDE 1F2RC 2KJ6A 4IWOA 1WMHB 1ZUD2 2QCZA 2JXTA 1QILA 1TS4A 2JT4B 2KQSA 2CJNA 3BINA 4EZJA 3V6EB 4A3PA 2NPTB 1CK1A 4W9FA 4DHJB 2ZPYA 3ZDMC 2FE8A 1SE4A 3OAWA 2Q5WD 2BYVE 4PYUA 3TIXA 4P7IA 2BBCA 2PW9A 2V9HA 3UIOB 3ZTDA 2W3SA 2NS5A 2QSDA 2W82A 2BTEA 4YTNB 2DBYA 2NCNA 4HXDA 3BY4B 2N9EB 2K5PA 3T9LA 2MBQA 3T8MA 2IJ0A 5C2TB 1EM7A 2Y5CA 2C5LC 1WM2A 1WY8A 3V3XA 3RPFC 4L1BA 2EKEC 4K1RB 1P1AA 2KLCA 4DK5A 3LXFA 2L0FA 4W9KA 1NYQA 2LHDA 2V4IB 4ZRQA 3V61A 5H8YE 1YNTE 3TEYA 2JX5A 4OVUA 2KDEB 1V49A 1ZXIA 2LGSA 3L16A 4AJYB 3IFWB 1PUTA 1MI0A 5EDSA 4XE0A 3MJ5A 3V6CB 4FULA 3AXCA 3ZXVA 2KMCA 3UQBA 5G2NA 4W9JA 2HJ1A 1E7UA 5AZFA 4IUMB 4ANWA 3DHGC 5J17A 3CSFA 1E8ZA 1QOGA 1WRIA 2WXKA 3HM6X 2OJRA 2N7DA 4A55A 2N9KA 2RGFA 1T3QA 1ENFA 1ZE3D 3C8YA 1E8WA 3ZNZB 4N9F4 1MHXA 1T5XD 2AQ3B 3H9DA 4C00A 4OZBA 2B76B 3VRBB 4FJYA 5KHOA 5TSSA 1UGMA 4M00A 3IG3A 4E74A 3VRAB 3M95A 3QC8B 3AEFB 4LNNA 4BKTA 4RF1A 1F2RI 4PS8A 2DZIA 1WFYA 1YJIA 3HHMA 3NJTA 2ICIA 3M63B 1QF6A 2WP9B 4JIOU 1Y8RC 3CIRB 1RYJA 2NBVB 3VTUA 1SE2A 2C7HA 3ZTCA 1WYWB 2KANA 4YSXB 2KDMA 1NBFC 2FNJB 1T0QC 4USAA 4W9IA 2FUHB 3QHTA 4TV3A 3Q8BA 4MM3A 1C77A 4B9KA 3NS1A 5FK9C 5DPTA 1L0XB 1TKYA 2G1EA 4ZDVA 2LGYA 1JWUD 3ONSA 4KKJA 2L3ZA 3C0RB 1K51A 2WNMA 3ML9A 1UD7A 2GOWA 2ZCCA 1FMAD 4KX6B 4WJNA 1GJZA 1XT9B 3N30A 2GI9A 2IGGA 1N5WA 3GE3C 2WXQA 3TSSA 4FLHA 2CHXA 1V5TA 5DPSA 3ZJVA 4ZRIA 3RD2A 2K0PA 4M0WB 2KFJA 3BK1A 2KXJA 4JPSA 3U7ZA 1KLGD 4AOFA 1P98A 3PRMB 2WXPA 1TJEA 2K6QA 3PGEA 4NJ6A 3B9JA 1MHHE 2EELA 3CMMB 2GBRA 4MM3B 1KH0A 2LMCA 5J2RA 3VR9B 3RT3B 3ZJTA 1P9DU 1GAQB 3RNEC 3E9SA 4I6LB 2PE6B 1WXQA 3VUXA 1VRAB 1B9RA 3RN9C 3NRZA 4DBGA 2FIFA 4BBNC 2W55A 2RD0A 1J0GA 1VLBA 2LXCA 1FPYA 1WJNA 2E6XA 2MX2A 1Q0WB 3HVDA 4WJOA 1TS5A 1FCCC 4IOIE 4KSKC 3AM9A 4W9GA 1WGRA 2M19A 3DVGX 3Q8FA 1TGZB 3U52E 2O6VD 5DPRA 3N32A 2KZRA 4ZRPA 3AEAB 3ZW3A 2KX3A 3SR6A 1ISNA 3Q6BA 4DXAB 3AE8B 1TY0A 3IT4B 4EE2A 4ZHOA 2L52A 1XD3B 4BVUC 2IDYA 4K7WA 3WIMA 1TZOA 2IZVB 1LXDA 1V81A 1S3SG 3VXWA 4EUTA 3VVWB 2BB6A 3B2FA 3I5JC 4NAWB 3P4QB 5G55A 4LLGM 4ZYNA 3E56A 4M02A 1VDVA 1FCLA 2KDBA 3A9JB 3HIZA 4RF0A 3Q3JA 3KH0A 2N9LA 3MHZA 3RI7C 1CZPA 3SDLC 3Q14C 4P16A 3QQ8B 5IOIA 2KC2A 1L6UA 1KOTA 4FXCA 1FFVA 1E8YA 3PZ8A 1NYRA 2DZKA 3NVZA 4G0NB 3AEDB 2QDFA 2UU7A 3U8ZA 3B0AA 4YSZB 3HK0A 4TSSA 2INCC 4FJZA 4P1CC 4WWOA 3TEZA 1K50A 2KWDA 2N9PC 2K1FA 3UIPB 1NENB 1JRUA 3ZO5B 2RDGA 1Q1OA 3MTNB 1WI0A 2L32A 2WX1A 1P0RA 2Y5BB 1ET6A 4BBNF 2XBBC 3M62B 4ICVA 4WAFA 4GDLB 1P7EA 2LRUA 3I3TB 5H92C 3KYCD 1ZOYB 3UF8A 3UINB 4EZKA 3FKYA 2Y3AA 1L0VB 1WJ4A 1UELA 4HRSA 3PT2B 4EFOA 4FA6A 2JRIB 4JQWC 2L83A 3GS2A 2KFKA 1YQ3B 3H1UA 1STEA 2BYEA 5JHAA 4MJSA 4ZRKA 1HZ6A 5IO9A 2NBUA 2I1KA 3Q2AC 1GC7A 4MELA 2L7RA 2WLBA 4LNKA 5IN7A 2IPKD 3DWMA 4HJGE 2VZKB 1WXMA 2PKOA 3L10B 2CJOA 3J9CA 3KUDB 5G5HA 2JSVX 4GOCA 4GB9A 3TL5A 2LWPA 1JMLA 1KJTA 3KUCB 3L4PA 3R2TA 1TKEA 1SGHA 1OTRB 4F1SA 1H4RA 1KTKA 2BS3B 2JYEA 3VFKA 2CKHB 5D6JB 3APDA 4LJOB 1SE3A 3V60A 3DQVA 2IO1B 2FUG1 5D3DA 4UDUC 3PRZA 1RAXA 4KGTA 2KFKB 3R7RA 3ZYYX 5CX3A 1ZGUB 4MJSB 4WQMA 2DZMA 4LJPB 2JWZA 4KZCA 2JYTA 5FR6A 3Q3NC 2RSUA 4NNJB 2FCQA 3DDCB 3ZNID 2LUMA 1Q10A 2DYOA 2DAFA 4FHKA 4JWSC 1N63A 2N7JA 1AN8A 4GIVA 3AEBB 1UUPA 3WAMA 4IM2A 4LDTB 5T8IA 4RGMA 1XEEA 1XCQL 4CYEA 5GMVA 4DXGA 3W1SA 4ITKA 2LGXA 3GOEA 3I57A 2AL6A 3DBRI 2QEJC 1XQQA 1P7FA 3AE1B 4YL8A 4C56C 1E0ZA 1SBBB 2PPHA 4WWMA 4RFBA 4XX5A 2JZ3B 5BYRA 3KQ4A 3O13A 1NI2A 3ZKJC 2KYWA 3ZNHB 1EF5A 4EOYA 5BMIA 1EU3A 3TCAA 1NVID 4IM0A 4N6EB 2AL3A 2C9WB 2BT6A 3W5VB 1FO4A 4KVGB 4HKZE 4W9DA 3O65B 2O2VB 1GB4A 4B0EA 1Z2MA 2HD5B 3VR8B 4G50A 1UWXA 2PJHA 3PS6A 1PGAA 3KLSX 2KNBA 1SF0A 1XLQA 3GZNI 3RUIB 2J0KA 1V1OA 2W54A 2W9NA 2PE9A 3PTFC 2ZPNA 2M4NA 1DYQA 1B1ZA 1R4NI 1DOIA 4MGZE 4NJ7A 1JRPA 1L4DB 2WDTB 2ZZPB 1WX8A 2BWFA 3K9OB 5AZHA 2ACZB 2OJWA 3UI3A 2MBHA 3DWGC 3Q3FA 1SB3C 2M17A 4B95A 4E3CA 2C60A 4S17A 4KZ0A 2LVQA 2FIDA 2V3SA 1PDXA 1XLPA 1GPXA 3LYYA 4TUUA 3WALA 4ANVA 1L5PA 1WGHA 2BYFA 4BZAA 2QMTA 3TUOA 5D7GA 3MC0B 4RGNA 3ZVVA 4ICUA 3QWZB 4K7SA 3RNCC 3RZWC 3QCAA 1R4MI 4GSWA 5BMHA 4L2YA 1WJ6A 1UBQA 4IM3A 3URYA 5LXHA 3VHTC 4YSYB 4HDOA 2K8HA 2KJHB 4WWNA 3OJ4B 4HDQA 2BYTA 3V62A 2NBWB 2LVOA 3PV1A 2K9XA 2MBOA 2JY6A 3B1LX 2LHEA 2XN9C 4MH8A 4W9EA 3BYTB 1HTQA 2WWZA 2M0XA 3WCQA 1E10A 2BQQA 3AN1A 3NVVA 5KHQA 1TYGB 1VD2A 2VH2A 1E6EB 1RFKA 1YJJA 3NVYA 3EGRA 5JH5C 2KOXA 3EECA 5AEKB 2KTRA 2GMIC 3A1QA 3ENEA 1J7BA 2O6VA 4WJQA 4DHZB 4HLEA 3I63C 1N61A 2BPSA 3BVGA 2MQJA 1D4BA 3RCZA 3A33B 4BOSC 3FILA 4YXDB 3T3OA 1WJUA 2KAJA 4GDKA 1QQRA 5EE0A 3I9V1 2DLBA 4BFRA 1OQQA 3FC4A 1GC6A 3L08A 3JSVA 3SU8X 4HPPA 1YMHE 2JRHA 4LNOA 1AW7A 1U4AA 4HJKA 3DBLB 4FADA 2YLMA 1WR1A 1MVKA 4M8MA 3MC9A 4YT0B 3LJ3A 1VCBA 2H88B 4JLCA 2KTFA 2KTRB 2J52A 4NQKE 2KJRA 2KACA 3A1QB 1I4GA 1GG3A 2WXLA 2XNAC 5CTRC 3BZDB 2O6VB 2AX5A 1VZ6A 2EMSA 4MGIE 4KIKA 1KLVA 4WJPA 2IY1B 2LZ6A 1XLNA 3H6NA 2WU5B 4YWGG 2OHFA 3L54A 3FILB 2HTME 2AYOB 1JROA 3AECB 1DGJA 2PVOD 5E6PA 4P6VF 4GDKB 1TBEA 1YD8U 4CHKA 2K39A 2KHWB 4BKSD 3JSVB 1PQSA 2ZNVB 1TZ1A 1WE6A 4XGAB 1YX6B 1XO3A 2IGDA 2RPQA 3AB5A 1K8RB 5IA7A 3U30A 1D3ZA 3ZIMA 1LQBA 2N0SB 3ZJUA 3ZUNA 2Z59B 3SFEB 5CHFA 4ASWC 1UNSA 1FNWA 2KK8A 3ZQ4A 3B08A 1OEYA 1PYWD 3A4RA 1WX7A 4ZHPA 3H7PA 3ML8A 4LNIA 1BT0A 1WZ0A 3DBHB 3DCGA 4NAMA 1HA5A 1V1PA 4C7ZA 1ZP0B 1V2YA 5LXIB 1XCTL 3AE2B 4EEWA 4OW0A 3IHPC 1VZ7A 1Q5WB
chains in the Genus database with same CATH topology
2BYEA 3DVGY 1CMXB 5JHAA 4XZ4A 4MJSA 4ZRKA 2JZZA 2KC1A 3SHQA 2R2OA 2NBUA 1RRBA 2I1KA 1YX5B 1L2NA 2R2QA 3HM3A 4W9CA 3TBLD 1GC7A 3RULA 4MELA 2L7RA 5HKHA 2CHZA 1LM8B 3M3JA 3DBSA 2K25A 2KKCA 2C7NB 2KN5A 3IVFA 2QHOA 1WXMA 2FCMA 2LVPA 3VUYA 3L10B 3KUDB 2VRRB 3VAWA 4LCDE 1WXSA 2KJ6A 5D94A 4GB9A 4GOCA 2NR2A 3TL5A 4IWOA 1WMHB 4W9HA 3UQAA 2LWPA 1A5RA 2JT4B 3WANA 4MSQB 2KQSA 2EMTA 1KJTA 3BINA 3KUCB 3UGBB 4EZJA 3PRPB 3V6EB 4A3PA 2NPTB 1SGHA 3WAPA 4FN2A 1OTRB 2DZJA 4FBJB 4MDKE 4W9FA 4DHJB 4G11A 2D07B 4RM9A 2ZPYA 3ZDMC 4F1SA 1H4RA 2LJ5A 3OAWA 4GGQA 3VFKA 2CKHB 2N1WA 5D6JB 2BYVE 4IWQA 4PYUA 3APDA 3TIXA 4LJOB 4P7IA 3H7PB 2ZVOA 5J18A 2KO3A 3APCA 3UIOB 1WGGA 3ZTDA 3V60A 2NS5A 3DQVA 2IO1B 3ZNGC 2MA9B 3PRZA 1RAXA 2KFKB 2NCNA 3R7RA 5CX3A 2MRPA 4HK2A 5LLIA 4HXDA 1ZGUB 1YJ1A 3BY4B 2N9EB 4MJSB 5TR5A 2MWSB 2DZMA 4LJPB 2Z0EB 3T9LA 1L7YA 2MBQA 4CO7A 5JHBA 3T8MA 2V1YA 2JWZA 4KZCA 5FR6A 2RSUA 4NNJB 2JUOA 2FCQA 2C5LC 5L83A 1WM2A 1WY8A 3DDCB 3K9PB 3ZNID 2EKEC 3VTWA 3EC8A 2AWTA 3ECIA 3X0WA 2J0JA 1P1AA 4FJVB 4K1RB 2KLCA 2BWES 2DYOA 3QARA 4DK5A 3OLMD 2DAFA 2L0FA 3VTVA 4W9KA 3P2BA 3VH3B 4FHKA 5L95C 2KLGA 4AUQC 2N7EA 3V61A 2DX5B 4GIVA 1YQBA 3WAMA 3ZRCA 4IM2A 4OVUA 2KDEB 4LDTB 2M1MA 2NVUI 3PZDA 1V49A 1EUVB 1WR6E 4CYEA 5GMVA 3L16A 3NZUA 4AJYB 3W1SA 3IFWB 3SD5A 2LGXA 3GOEA 3NY5A 5EDSA 3EHVA 2AL6A 3DBRI 3DVNV 4II3B 4WQOB 5BO4B 3PLUA 1XQQA 3V6CB 4FULA 4YL8A 1UH6A 2WYQA 3AXCA 2PPHA 4ANXA 4XX5A 2JZ3B 2KMCA 3L13A 4MGYE 3UQBA 5G2NA 1T0YA 2CR5A 4W9JA 2CHWA 1NI2A 3ZKJC 1E7UA 3ZNHB 4EOYA 1EF5A 2YVCA 3TCAA 2DYBA 4DHZE 5AZFA 3CF6E 4IUMB 4ANWA 1GUAB 3X23A 3R7QA 5J17A 3CSFA 4IM0A 1E8ZA 3NZSA 2HE7A 2AL3A 2C9WB 3WA0A 2LD9A 2M8SA 4GXBA 3A4SC 2K8CA 4KVGB 3HM6X 4KIKB 2OJRA 2N7DA 1WE7A 3O65B 2RGFA 4W9DA 5DCNA 2CU1A 2O2VB 1P3QU 2BKFA 4RM8A 4HCNB 1J8CA 2N1VA 1Z2MA 2HD5B 3APFA 4G50A 2KWUB 1E5WA 3PHXB 1E8WA 3PS6A 2PJHA 3ZNZB 4URKA 4N9F4 4OVVA 4A20A 4EZLA 1WIAA 4KV2A 2KNBA 4NAWA 3H9DA 3VH4B 1MG8A 2GBMA 3PLVA 3GZNI 4K7UA 4WAAA 5JZEB 4FJYA 5KHOA 2L76A 3RUIB 1GNUA 2J0KA 1UGMA 2RR9A 2KWCA 2L0TA 3IG3A 4I6NB 3A9JA 4E74A 3M95A 2KD0A 4F7ZA 1M94A 4PS3A 1WRDB 1V80A 2FCNA 3QC8B 2W9NA 2PE9A 3PTFC 4J6IA 2ZPNA 1C3TA 2M4NA 4BKTA 2KWVB 1R4NI 4MGZE 4PS8A 2DZIA 2LGDA 4HCPB 4NJ7A 1WFYA 2D3GA 2G3QB 3HHMA 3DPDA 4GN1A 3NHEB 4X57B 2WDTB 2ZZPB 1WX8A 3M63B 2BWFA 3K9OB 4JIOU 1Y8RC 2NBVB 2C7MB 3VTUA 2AEHA 5AZHA 2J7QB 3KW5B 2C7HA 2MBHA 3ZTCA 1WYWB 3Q3FA 2KANA 1IPGA 1YIWA 1ZW7A 2M17A 2CS4A 1TTNA 3PPAA 1NBFC 2FNJB 2XEWA 3WAOA 4B95A 4E3CA 4W9IA 2FUHB 1KM7A 2C60A 2L00B 3QHTA 4KZ0A 1SIFA 1HE8A 2LVQA 4TV3A 1UZXB 2FIDA 2V3SA 1WF9A 4MM3A 3MJWA 4NPNA 3W1YA 2BKRB 1EO6A 3AU5A 4TUUA 4W9LA 3WALA 4ANVA 4B9KA 1E90A 2ZCBA 5DPTA 1WGHA 2A4ZA 4GDLA 4ZDVA 2K8BA 2LGYA 2G4DB 3ONSA 3QJZA 2BYFA 1IYFA 2L3ZA 3C0RB 3VUWA 2B3AA 2GBNA 3ML9A 1WXAA 2ZNVC 1UD7A 2Z0DB 2GOWA 5D7GA 1ZKHA 5C23A 1FXTB 1IP9A 2ZCCA 3ZVVA 3NOBA 4WJNA 4EKUA 3MHSD 4ICUA 1GJZA 3QWZB 1WX9A 4K7SA 1XT9B 3RZWC 3AU4A 3QCAA 3N30A 4II2B 1R4MI 4GSWA 4K81A 2L8JA 3JYUA 5IAAC 3ZRFA 2ZEQA 1WJ6A 4KDLB 2UYZB 1UBQA 2IO0B 2PEAA 3PHWB 4FLHA 4I6PA 2CHXA 1V5TA 4IM3A 4ZRJA 3VHTC 5DPSA 5LXHA 4HDOA 2K8HA 1EF1A 2KJHB 4WWNA 4AWJA 4B6WA 1I35A 4ZRIA 3OJ4B 3RD2A 3S2AA 4HDQA 2G4SA 4M0WB 1WGDA 2KFJA 5C1ZA 4TQ1A 3V62A 2NBWB 2LVOA 3H7SA 3PV1A 2KXJA 4M8NA 2MBOA 2JY6A 2XK5A 3B1LX 3EFUA 1V5OA 4AOFA 1P98A 2L05A 3PRMB 1J19A 5DPWA 2K6QA 3PGEA 4W9EA 3VDZA 4NJ6A 4EEWA 3VQIA 3CMMB 2GBRA 2WWZA 2M0XA 5J2RA 4MSMB 3RT3B 1P9DU 2JF5A 2HTHA 5AZGA 4I6LB 2WX0A 5KHQA 2PE6B 2ASQA 2IO3B 2IBIB 3VUXA 4DDGD 1VD2A 4BKGA 2J0MA 2K6DB 4ANUA 5E6NA 1E7VA 2REXA 1OQYA 1X1MA 3U7DA 2MP2A 3NS8A 3PSEB 2KDIA 2FCSA 2LASA 2GBKA 4PS7A 4DBGA 1UBIA 4DDID 5JH5C 3PREA 4NY0A 3ZLZA 3R3MA 2FIFA 3RYTA 3QK0A 1LFDA 4BBNC 2KOXA 3QIJA 3EECA 5AEKB 2KTRA 3QA8A 3AI5A 2RD0A 2GMIC 3A1QA 3ENEA 2HJ8A 1J0GA 4MH0E 3IBEA 2LXCA 2O6VA 4WJQA 4HLEA 4DHZB 1WGYA 4HPMB 3A9KA 4HPLB 1WJNA 2MX2A 1Q0WB 3PVLA 4WJOA 4IC7B 2BPSA 1NDDA 4GMVA 2MSED 2MQJA 2DAJA 4KSKC 4W9GA 2V4LA 1WGRA 3DBLI 3A33B 3RCZA 4BOSC 3DVGX 2XK5B 1TGZB 2O6VD 3L0WB 5DPRA 3JW0X 3N3KB 3N32A 3KYDD 2KZRA 3OJ3A 3ZW3A 2KX3A 2N4FA 2OOBB 1C1YB 1ISNA 1WJUA 1AARA 4DXAB 4GDKA 4TKNA 3QX1A 4KDIC 5CHWA 4F8CB 1WZ3A 2LI5A 3QAQA 4IG7B 4BFRA 4PYZA 1GC6A 3L08A 3JSVA 3TJPA 4DWFA 1XD3B 3SU8X 2DYMA 2JRHA 4BVUC 4K7WA 1U4AA 3DOWA 3WIMA 4HJKA 4FADA 2YLMA 2MP2B 1V6EA 1WR1A 2D10A 2IZVB 4AP4C 1LXDA 1S1QB 1V81A 4LDTD 1S3SG 3VXWA 4EUTA 4M8MA 3VVWB 3LJ3A 1VCBA 4A3OA 2IO2B 4JLCA 1V86A 3L17A 4RMAA 5E6OA 4FHJA 4TQ0A 2KX0A 4NAWB 2KTFA 1RLFA 1V9JA 2KVRA 5G55A 1G6JA 2MW5A 2KTRB 4NQKE 4ZYNA 2KJRA 3A1QB 4GU2A 3LDZE 2D2QA 2JVCA 2MCNB 2IY0B 1GG3A 5CTRC 2KDBA 1RFAA 3A9JB 3HIZA 2O6VB 3CSTA 2EMSA 3Q3JA 2KMAA 2FAZA 3A9KB 3KH0A 3R66C 4MGIE 4KIKA 2D11A 3SDLC 1Z5SB 4WJPA 2IY1B 1KLVA 2LZ6A 2JPHA 3QQ8B 3H6NA 2MBEA 2KC2A 2O2VA 2MBBB 4G3XB 4JGHB 4JL9A 2BGFA 3L54A 1KOTA 1WH3A 1E8YA 2AYOB 4E71A 4BKSA 2LUEA 2GBJA 1WXVA 4MGKE 2DZKA 4G0NB 1WM3A 2KQ7A 1SE9A 5D2MB 2LXAA 5CHVC 1H8CA 2KDFB 5E6PA 3ZDTA 2BF8B 3U8ZA 4GDKB 1TBEA 3B0AA 4WWPA 1YD8U 2I1JA 3HK0A 4CHKA 4IWPA 2K39A 2KHWB 3KUZA 4FJZA 2IYDB 3TMPB 2DENB 4WWOA 4BKSD 3ALBA 2UWQA 3JSVB 1PQSA 3KVFB 2ZNVB 1TZ1A 3AULA 1WE6A 1WMHA 2N9PC 2K1FA 3DBHI 4NQLB 3UIPB 3ZO5B 1JRUA 1YX6B 3JVZX 2RPQA 1K8RB 5IA7A 1Q1OA 3U30A 1D3ZA 2MLBA 3MTNB 1WI0A 1LQBA 3ZIMA 2WX1A 1P0RA 2Y5BB 3ZUNA 2NPTA 2Z59B 2XBBC 3M62B 4ICVA 5CHFA 4BBNF 4GDLB 2ZVNA 4KSLC 2LRUA 4ASWC 2KK8A 3I3TB 3D32A 2A5UA 3B08A 3KYCD 1OEYA 1E8XA 3A4RA 1WX7A 3UF8A 2G45B 2DHZA 4MEMA 2LRWA 3UINB 4EZKA 4HVBA 3H7PA 3W1SC 4AJWA 4BOZB 3ML8A 1BT0A 4HWIB 2ZJDA 1WJ4A 1UELA 1WZ0A 1I42A 1OEYJ 3PT2B 4EFOA 2N9XA 3DCGA 4IW0A 4DHJD 4XC2A 4FA6A 2JRIB 4JQWC 3DVNU 1QZEA 2KFKA 1V2YA 2JXXA 3RZFA 1F9JA 5LXIB 1OGWA 3IHPC 3H1UA 1Q5WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYE A;  3DVG Y;  1CMX B;  5JHA A;  4XZ4 A;  4MJS A;  4ZRK A;  2JZZ A;  2KC1 A;  3SHQ A;  2R2O A;  2NBU A;  1RRB A;  2I1K A;  1YX5 B;  1L2N A;  2R2Q A;  3HM3 A;  4W9C A;  3TBL D;  1GC7 A;  3RUL A;  4MEL A;  2L7R A;  5HKH A;  2CHZ A;  1LM8 B;  3M3J A;  3DBS A;  2K25 A;  2KKC A;  2C7N B;  2KN5 A;  3IVF A;  2QHO A;  1WXM A;  2FCM A;  2LVP A;  3VUY A;  3L10 B;  3KUD B;  2VRR B;  3VAW A;  4LCD E;  1WXS A;  2KJ6 A;  5D94 A;  4GB9 A;  4GOC A;  2NR2 A;  3TL5 A;  4IWO A;  1WMH B;  4W9H A;  3UQA A;  2LWP A;  1A5R A;  2JT4 B;  3WAN A;  4MSQ B;  2KQS A;  2EMT A;  1KJT A;  3BIN A;  3KUC B;  3UGB B;  4EZJ A;  3PRP B;  3V6E B;  4A3P A;  2NPT B;  1SGH A;  3WAP A;  4FN2 A;  1OTR B;  2DZJ A;  4FBJ B;  4MDK E;  4W9F A;  4DHJ B;  4G11 A;  2D07 B;  4RM9 A;  2ZPY A;  3ZDM C;  4F1S A;  1H4R A;  2LJ5 A;  3OAW A;  4GGQ A;  3VFK A;  2CKH B;  2N1W A;  5D6J B;  2BYV E;  4IWQ A;  4PYU A;  3APD A;  3TIX A;  4LJO B;  4P7I A;  3H7P B;  2ZVO A;  5J18 A;  2KO3 A;  3APC A;  3UIO B;  1WGG A;  3ZTD A;  3V60 A;  2NS5 A;  3DQV A;  2IO1 B;  3ZNG C;  2MA9 B;  3PRZ A;  1RAX A;  2KFK B;  2NCN A;  3R7R A;  5CX3 A;  2MRP A;  4HK2 A;  5LLI A;  4HXD A;  1ZGU B;  1YJ1 A;  3BY4 B;  2N9E B;  4MJS B;  5TR5 A;  2MWS B;  2DZM A;  4LJP B;  2Z0E B;  3T9L A;  1L7Y A;  2MBQ A;  4CO7 A;  5JHB A;  3T8M A;  2V1Y A;  2JWZ A;  4KZC A;  5FR6 A;  2RSU A;  4NNJ B;  2JUO A;  2FCQ A;  2C5L C;  5L83 A;  1WM2 A;  1WY8 A;  3DDC B;  3K9P B;  3ZNI D;  2EKE C;  3VTW A;  3EC8 A;  2AWT A;  3ECI A;  3X0W A;  2J0J A;  1P1A A;  4FJV B;  4K1R B;  2KLC A;  2BWE S;  2DYO A;  3QAR A;  4DK5 A;  3OLM D;  2DAF A;  2L0F A;  3VTV A;  4W9K A;  3P2B A;  3VH3 B;  4FHK A;  5L95 C;  2KLG A;  4AUQ C;  2N7E A;  3V61 A;  2DX5 B;  4GIV A;  1YQB A;  3WAM A;  3ZRC A;  4IM2 A;  4OVU A;  2KDE B;  4LDT B;  2M1M A;  2NVU I;  3PZD A;  1V49 A;  1EUV B;  1WR6 E;  4CYE A;  5GMV A;  3L16 A;  3NZU A;  4AJY B;  3W1S A;  3IFW B;  3SD5 A;  2LGX A;  3GOE A;  3NY5 A;  5EDS A;  3EHV A;  2AL6 A;  3DBR I;  3DVN V;  4II3 B;  4WQO B;  5BO4 B;  3PLU A;  1XQQ A;  3V6C B;  4FUL A;  4YL8 A;  1UH6 A;  2WYQ A;  3AXC A;  2PPH A;  4ANX A;  4XX5 A;  2JZ3 B;  2KMC A;  3L13 A;  4MGY E;  3UQB A;  5G2N A;  1T0Y A;  2CR5 A;  4W9J A;  2CHW A;  1NI2 A;  3ZKJ C;  1E7U A;  3ZNH B;  4EOY A;  1EF5 A;  2YVC A;  3TCA A;  2DYB A;  4DHZ E;  5AZF A;  3CF6 E;  4IUM B;  4ANW A;  1GUA B;  3X23 A;  3R7Q A;  5J17 A;  3CSF A;  4IM0 A;  1E8Z A;  3NZS A;  2HE7 A;  2AL3 A;  2C9W B;  3WA0 A;  2LD9 A;  2M8S A;  4GXB A;  3A4S C;  2K8C A;  4KVG B;  3HM6 X;  4KIK B;  2OJR A;  2N7D A;  1WE7 A;  3O65 B;  2RGF A;  4W9D A;  5DCN A;  2CU1 A;  2O2V B;  1P3Q U;  2BKF A;  4RM8 A;  4HCN B;  1J8C A;  2N1V A;  1Z2M A;  2HD5 B;  3APF A;  4G50 A;  2KWU B;  1E5W A;  3PHX B;  1E8W A;  3PS6 A;  2PJH A;  3ZNZ B;  4URK A;  4N9F 4;  4OVV A;  4A20 A;  4EZL A;  1WIA A;  4KV2 A;  2KNB A;  4NAW A;  3H9D A;  3VH4 B;  1MG8 A;  2GBM A;  3PLV A;  3GZN I;  4K7U A;  4WAA A;  5JZE B;  4FJY A;  5KHO A;  2L76 A;  3RUI B;  1GNU A;  2J0K A;  1UGM A;  2RR9 A;  2KWC A;  2L0T A;  3IG3 A;  4I6N B;  3A9J A;  4E74 A;  3M95 A;  2KD0 A;  4F7Z A;  1M94 A;  4PS3 A;  1WRD B;  1V80 A;  2FCN A;  3QC8 B;  2W9N A;  2PE9 A;  3PTF C;  4J6I A;  2ZPN A;  1C3T A;  2M4N A;  4BKT A;  2KWV B;  1R4N I;  4MGZ E;  4PS8 A;  2DZI A;  2LGD A;  4HCP B;  4NJ7 A;  1WFY A;  2D3G A;  2G3Q B;  3HHM A;  3DPD A;  4GN1 A;  3NHE B;  4X57 B;  2WDT B;  2ZZP B;  1WX8 A;  3M63 B;  2BWF A;  3K9O B;  4JIO U;  1Y8R C;  2NBV B;  2C7M B;  3VTU A;  2AEH A;  5AZH A;  2J7Q B;  3KW5 B;  2C7H A;  2MBH A;  3ZTC A;  1WYW B;  3Q3F A;  2KAN A;  1IPG A;  1YIW A;  1ZW7 A;  2M17 A;  2CS4 A;  1TTN A;  3PPA A;  1NBF C;  2FNJ B;  2XEW A;  3WAO A;  4B95 A;  4E3C A;  4W9I A;  2FUH B;  1KM7 A;  2C60 A;  2L00 B;  3QHT A;  4KZ0 A;  1SIF A;  1HE8 A;  2LVQ A;  4TV3 A;  1UZX B;  2FID A;  2V3S A;  1WF9 A;  4MM3 A;  3MJW A;  4NPN A;  3W1Y A;  2BKR B;  1EO6 A;  3AU5 A;  4TUU A;  4W9L A;  3WAL A;  4ANV A;  4B9K A;  1E90 A;  2ZCB A;  5DPT A;  1WGH A;  2A4Z A;  4GDL A;  4ZDV A;  2K8B A;  2LGY A;  2G4D B;  3ONS A;  3QJZ A;  2BYF A;  1IYF A;  2L3Z A;  3C0R B;  3VUW A;  2B3A A;  2GBN A;  3ML9 A;  1WXA A;  2ZNV C;  1UD7 A;  2Z0D B;  2GOW A;  5D7G A;  1ZKH A;  5C23 A;  1FXT B;  1IP9 A;  2ZCC A;  3ZVV A;  3NOB A;  4WJN A;  4EKU A;  3MHS D;  4ICU A;  1GJZ A;  3QWZ B;  1WX9 A;  4K7S A;  1XT9 B;  3RZW C;  3AU4 A;  3QCA A;  3N30 A;  4II2 B;  1R4M I;  4GSW A;  4K81 A;  2L8J A;  3JYU A;  5IAA C;  3ZRF A;  2ZEQ A;  1WJ6 A;  4KDL B;  2UYZ B;  1UBQ A;  2IO0 B;  2PEA A;  3PHW B;  4FLH A;  4I6P A;  2CHX A;  1V5T A;  4IM3 A;  4ZRJ A;  3VHT C;  5DPS A;  5LXH A;  4HDO A;  2K8H A;  1EF1 A;  2KJH B;  4WWN A;  4AWJ A;  4B6W A;  1I35 A;  4ZRI A;  3OJ4 B;  3RD2 A;  3S2A A;  4HDQ A;  2G4S A;  4M0W B;  1WGD A;  2KFJ A;  5C1Z A;  4TQ1 A;  3V62 A;  2NBW B;  2LVO A;  3H7S A;  3PV1 A;  2KXJ A;  4M8N A;  2MBO A;  2JY6 A;  2XK5 A;  3B1L X;  3EFU A;  1V5O A;  4AOF A;  1P98 A;  2L05 A;  3PRM B;  1J19 A;  5DPW A;  2K6Q A;  3PGE A;  4W9E A;  3VDZ A;  4NJ6 A;  4EEW A;  3VQI A;  3CMM B;  2GBR A;  2WWZ A;  2M0X A;  5J2R A;  4MSM B;  3RT3 B;  1P9D U;  2JF5 A;  2HTH A;  5AZG A;  4I6L B;  2WX0 A;  5KHQ A;  2PE6 B;  2ASQ A;  2IO3 B;  2IBI B;  3VUX A;  4DDG D;  1VD2 A;  4BKG A;  2J0M A;  2K6D B;  4ANU A;  5E6N A;  1E7V A;  2REX A;  1OQY A;  1X1M A;  3U7D A;  2MP2 A;  3NS8 A;  3PSE B;  2KDI A;  2FCS A;  2LAS A;  2GBK A;  4PS7 A;  4DBG A;  1UBI A;  4DDI D;  5JH5 C;  3PRE A;  4NY0 A;  3ZLZ A;  3R3M A;  2FIF A;  3RYT A;  3QK0 A;  1LFD A;  4BBN C;  2KOX A;  3QIJ A;  3EEC A;  5AEK B;  2KTR A;  3QA8 A;  3AI5 A;  2RD0 A;  2GMI C;  3A1Q A;  3ENE A;  2HJ8 A;  1J0G A;  4MH0 E;  3IBE A;  2LXC A;  2O6V A;  4WJQ A;  4HLE A;  4DHZ B;  1WGY A;  4HPM B;  3A9K A;  4HPL B;  1WJN A;  2MX2 A;  1Q0W B;  3PVL A;  4WJO A;  4IC7 B;  2BPS A;  1NDD A;  4GMV A;  2MSE D;  2MQJ A;  2DAJ A;  4KSK C;  4W9G A;  2V4L A;  1WGR A;  3DBL I;  3A33 B;  3RCZ A;  4BOS C;  3DVG X;  2XK5 B;  1TGZ B;  2O6V D;  3L0W B;  5DPR A;  3JW0 X;  3N3K B;  3N32 A;  3KYD D;  2KZR A;  3OJ3 A;  3ZW3 A;  2KX3 A;  2N4F A;  2OOB B;  1C1Y B;  1ISN A;  1WJU A;  1AAR A;  4DXA B;  4GDK A;  4TKN A;  3QX1 A;  4KDI C;  5CHW A;  4F8C B;  1WZ3 A;  2LI5 A;  3QAQ A;  4IG7 B;  4BFR A;  4PYZ A;  1GC6 A;  3L08 A;  3JSV A;  3TJP A;  4DWF A;  1XD3 B;  3SU8 X;  2DYM A;  2JRH A;  4BVU C;  4K7W A;  1U4A A;  3DOW A;  3WIM A;  4HJK A;  4FAD A;  2YLM A;  2MP2 B;  1V6E A;  1WR1 A;  2D10 A;  2IZV B;  4AP4 C;  1LXD A;  1S1Q B;  1V81 A;  4LDT D;  1S3S G;  3VXW A;  4EUT A;  4M8M A;  3VVW B;  3LJ3 A;  1VCB A;  4A3O A;  2IO2 B;  4JLC A;  1V86 A;  3L17 A;  4RMA A;  5E6O A;  4FHJ A;  4TQ0 A;  2KX0 A;  4NAW B;  2KTF A;  1RLF A;  1V9J A;  2KVR A;  5G55 A;  1G6J A;  2MW5 A;  2KTR B;  4NQK E;  4ZYN A;  2KJR A;  3A1Q B;  4GU2 A;  3LDZ E;  2D2Q A;  2JVC A;  2MCN B;  2IY0 B;  1GG3 A;  5CTR C;  2KDB A;  1RFA A;  3A9J B;  3HIZ A;  2O6V B;  3CST A;  2EMS A;  3Q3J A;  2KMA A;  2FAZ A;  3A9K B;  3KH0 A;  3R66 C;  4MGI E;  4KIK A;  2D11 A;  3SDL C;  1Z5S B;  4WJP A;  2IY1 B;  1KLV A;  2LZ6 A;  2JPH A;  3QQ8 B;  3H6N A;  2MBE A;  2KC2 A;  2O2V A;  2MBB B;  4G3X B;  4JGH B;  4JL9 A;  2BGF A;  3L54 A;  1KOT A;  1WH3 A;  1E8Y A;  2AYO B;  4E71 A;  4BKS A;  2LUE A;  2GBJ A;  1WXV A;  4MGK E;  2DZK A;  4G0N B;  1WM3 A;  2KQ7 A;  1SE9 A;  5D2M B;  2LXA A;  5CHV C;  1H8C A;  2KDF B;  5E6P A;  3ZDT A;  2BF8 B;  3U8Z A;  4GDK B;  1TBE A;  3B0A A;  4WWP A;  1YD8 U;  2I1J A;  3HK0 A;  4CHK A;  4IWP A;  2K39 A;  2KHW B;  3KUZ A;  4FJZ A;  2IYD B;  3TMP B;  2DEN B;  4WWO A;  4BKS D;  3ALB A;  2UWQ A;  3JSV B;  1PQS A;  3KVF B;  2ZNV B;  1TZ1 A;  3AUL A;  1WE6 A;  1WMH A;  2N9P C;  2K1F A;  3DBH I;  4NQL B;  3UIP B;  3ZO5 B;  1JRU A;  1YX6 B;  3JVZ X;  2RPQ A;  1K8R B;  5IA7 A;  1Q1O A;  3U30 A;  1D3Z A;  2MLB A;  3MTN B;  1WI0 A;  1LQB A;  3ZIM A;  2WX1 A;  1P0R A;  2Y5B B;  3ZUN A;  2NPT A;  2Z59 B;  2XBB C;  3M62 B;  4ICV A;  5CHF A;  4BBN F;  4GDL B;  2ZVN A;  4KSL C;  2LRU A;  4ASW C;  2KK8 A;  3I3T B;  3D32 A;  2A5U A;  3B08 A;  3KYC D;  1OEY A;  1E8X A;  3A4R A;  1WX7 A;  3UF8 A;  2G45 B;  2DHZ A;  4MEM A;  2LRW A;  3UIN B;  4EZK A;  4HVB A;  3H7P A;  3W1S C;  4AJW A;  4BOZ B;  3ML8 A;  1BT0 A;  4HWI B;  2ZJD A;  1WJ4 A;  1UEL A;  1WZ0 A;  1I42 A;  1OEY J;  3PT2 B;  4EFO A;  2N9X A;  3DCG A;  4IW0 A;  4DHJ D;  4XC2 A;  4FA6 A;  2JRI B;  4JQW C;  3DVN U;  1QZE A;  2KFK A;  1V2Y A;  2JXX A;  3RZF A;  1F9J A;  5LXI B;  1OGW A;  3IHP C;  3H1U A;  1Q5W B; 
#chains in the Genus database with same CATH topology
 3DVG Y;  2WXG A;  2KC1 A;  3SHQ A;  1FXI A;  2R2O A;  1N5X A;  4AS1 A;  1YX5 B;  1RM6 C;  1JCK B;  3RUL A;  5HKH A;  1LM8 B;  1HTO A;  2FCM A;  3KWL A;  4RH6 A;  1WXS A;  4WIP A;  5D94 A;  1IGC A;  2NR2 A;  2V0G A;  4W9H A;  2NMQ A;  3UQA A;  1I4P A;  3WAN A;  4MSQ B;  3RFZ B;  2EMT A;  1PGB A;  4A9A A;  4FN2 A;  2DZJ A;  2KN4 A;  4G11 A;  5IKC M;  4ARC A;  1D5M C;  2BVC A;  2K3U A;  1XLO A;  1MPE A;  3T3N A;  1N6Z A;  2WXH A;  2NTS A;  3H7P B;  2ZVO A;  3AE6 B;  3APC A;  1WGG A;  1DOX A;  3NG0 A;  4MT5 A;  5LLI A;  3Q3M C;  1HZ5 A;  1QLB B;  2Z0E B;  1L7Y A;  4CO7 A;  5JHB A;  2Y5P A;  2MJE A;  2Z8L A;  1CJE A;  5L83 A;  3AMZ A;  5EE3 A;  1SSN A;  3VTW A;  3EC8 A;  4ZYS A;  2AWT A;  3ECI A;  1N62 A;  2BWE S;  3OLM D;  3V05 A;  3P2B A;  2LEK A;  1HXY D;  2N7E A;  3C19 A;  4YTM B;  4RGT A;  3ZRC A;  2M1M A;  2NVU I;  1E7P B;  3RNB C;  2I2Y A;  2I38 A;  3AEE B;  3NZU A;  3SD5 A;  3DVN V;  4II3 B;  5BO4 B;  2WYQ A;  3BWU D;  1ZPS A;  2WHI A;  2WXM A;  1A70 A;  4ANX A;  4MGY E;  3FAH A;  1I4Q A;  2CR5 A;  1ROE A;  1BML C;  3R7Q A;  3NZS A;  2HE7 A;  2KT7 A;  2SAK A;  3BVM A;  2LD9 A;  1J7C A;  3A4S C;  2K8C A;  5GXG B;  1KRH A;  2CU1 A;  4OZA A;  1FRD A;  1P3Q U;  4XWW A;  4RM8 A;  1WGK A;  3APF A;  2KWU B;  3PHX B;  1K52 A;  4URK A;  4OVV A;  4A20 A;  4EZL A;  1WIA A;  4KV2 A;  5MPO A;  2GBM A;  2IND C;  3AE5 B;  3SFD B;  1UF0 A;  2L76 A;  2X38 A;  1GNU A;  1SXT A;  2WDV B;  2KD0 A;  4C80 A;  1MJD A;  1M94 A;  4PS3 A;  2FCN A;  2ON8 A;  1RWS A;  1UGJ A;  4H2A A;  1F77 A;  2LGD A;  2D3G A;  2G3Q B;  3DPD A;  4GN1 A;  3NHE B;  2C7M B;  4XYC A;  4D2K A;  2AEH A;  2J7Q B;  5C3J B;  3KW5 B;  3N1Z C;  1TIF A;  1SEB D;  2AQ1 B;  4WUR A;  1UZX B;  2TSS A;  3R2I A;  5HHD G;  1C4A A;  4NPN A;  2E3T A;  1EO6 A;  1KFY B;  3AU5 A;  4W9L A;  2ZCB A;  4A6Q A;  2K8B A;  4OZC A;  1L4Z B;  2GBN A;  3P1M A;  4N58 A;  4YTP B;  1WXA A;  1ET9 A;  3W5U B;  5C23 A;  1FXT B;  1IP9 A;  1D5Z C;  3NOB A;  1C4C A;  4II2 B;  3AE7 B;  2D3B A;  4LNF A;  3JYU A;  4QAY A;  2ZEQ A;  1IBX A;  4KDL B;  3PHW B;  2PEA A;  4ZRJ A;  4I6P A;  3AEG B;  1E9M A;  4KGS A;  1EF1 A;  4AWJ A;  4B6W A;  3S2A A;  2G4S A;  3AE4 B;  5C1Z A;  2XK5 A;  1V5O A;  2WS3 B;  2M56 B;  3HUI A;  3VDZ A;  1QOF A;  5BYS A;  4HEA 1;  4O1N A;  3VQI A;  4MSM B;  5BYQ A;  1D6E C;  2HTH A;  1T6B X;  2WX0 A;  1OFF A;  2IO3 B;  2IBI B;  4DDG D;  1JQ4 A;  1IGD A;  4BKG A;  2J0M A;  2K6D B;  5E6N A;  1F0Z A;  1E7V A;  2REX A;  1X1M A;  3U7D A;  3EA6 A;  3NS8 A;  3PSE B;  2FCS A;  2LAS A;  2GBK A;  4PS7 A;  1UBI A;  3RNG C;  4NY0 A;  3ZLZ A;  2MJD A;  3BVZ A;  3RYT A;  3QK0 A;  1LFD A;  1NEK B;  3AI5 A;  2HJ8 A;  4XWT A;  1IBX B;  3R8B A;  1WGY A;  3BK2 A;  1GB1 A;  4HPL B;  4DQO C;  3DHI C;  3PVL A;  4IC7 B;  1NDD A;  4GMV A;  4ZOH C;  2DAJ A;  2V4L A;  2BS4 B;  2XK5 B;  3L0W B;  3JW0 X;  3OG5 A;  1LGR A;  1JAL A;  2OOB B;  4BAX A;  1AAR A;  3Q8E A;  2WXJ A;  3MFG A;  5CHW A;  3MP9 A;  5FKA C;  1WZ3 A;  4IG7 B;  4DWF A;  2DYM A;  4K3C A;  4XDD A;  4PK1 A;  2QIE B;  3DOW A;  4R3D A;  1HEZ E;  1AWD A;  3EUB 2;  2D10 A;  4AP4 C;  1N60 A;  1S1Q B;  4LDT D;  1FRR A;  3MC8 A;  2QC8 A;  1JW9 D;  4RMA A;  4FHJ A;  1RLF A;  3Q69 A;  2WDQ B;  3RNF C;  4P1B C;  1Y56 A;  4GU2 A;  2JVC A;  2IY0 B;  2YEP B;  1T0R C;  1OQR A;  3CST A;  2KMA A;  3ABV B;  3R66 C;  1LO5 D;  4XDC A;  1YN4 A;  2D11 A;  1Z5S B;  4JE3 B;  2JPH A;  4G3X B;  5I4D A;  4TMA B;  3NUH B;  1L6V A;  4JGH B;  4L23 A;  2QJL A;  3N1X C;  1WH3 A;  2HDE A;  4BKS A;  2LUE A;  3N1Y C;  1WXV A;  2WDR B;  5D2M B;  2LXA A;  5CHV C;  1H8C A;  4REZ A;  3ZDT A;  1ZDV A;  1CQV A;  2WXF A;  4WWP A;  2PTL A;  1YOV B;  4IWP A;  4J3O D;  4NJC A;  2VH1 A;  3TMP B;  3ALB A;  2EKI A;  3KVF B;  3Q3O C;  4NZL B;  3JVZ X;  3SEB A;  1I4H A;  1XF5 L;  2LJI A;  1WWT A;  2MLB A;  1ACC A;  2R61 A;  2ZVN A;  1TY2 A;  4KSL C;  2KVZ A;  4KKI A;  5LNK 1;  2G45 B;  2LRW A;  4HVB A;  1FM0 D;  4AJW A;  3W1S C;  2BB5 A;  1V8C A;  1YQ4 B;  1OEY J;  2N9X A;  4IW0 A;  1KLU D;  4DHJ D;  4XC2 A;  1QZE A;  3RZF A;  1F9J A;  1QT9 A;  4J6I A;  2JZZ A;  1L2N A;  2R2Q A;  3TBL D;  3RNA C;  2J4X A;  2CHZ A;  4CQN A;  4US8 A;  3DBS A;  2K25 A;  2D3A A;  2KKC A;  1DOY A;  2QHO A;  3VUY A;  1EWC A;  1TKG A;  3AH7 A;  1WSP A;  1V97 A;  3VAW A;  4RNA A;  1MFW A;  4C7Y A;  1A5R A;  2MJ3 A;  3UGB B;  3PRP B;  4RCO A;  1IUE A;  3WAP A;  4FBJ B;  4MDK E;  2D07 B;  4RM9 A;  2LJ5 A;  4GGQ A;  1QOA A;  2N1W A;  2JWU A;  4IWQ A;  3GP7 A;  1ESF A;  2L1A A;  3W2D A;  5J18 A;  2KO3 A;  4HRO A;  2OED A;  4M0W A;  4M01 A;  3ZNG C;  2MA9 B;  5JXV A;  1EU4 A;  3IT6 B;  2MRP A;  4HK2 A;  2WXN A;  2RPV A;  1YJ1 A;  5TR5 A;  2MWS B;  2V1Y A;  4AQ7 A;  2JUO A;  3K9P B;  3P4S B;  4RGO S;  1JWM D;  2V3N A;  3X0W A;  2J0J A;  4FJV B;  3QAR A;  1TS2 A;  3H8H A;  3VTV A;  1FD6 A;  3VH3 B;  5L95 C;  2KLG A;  4AUQ C;  2DX5 B;  2K22 A;  1R7S A;  1YQB A;  1C78 A;  1TS3 A;  5BMG A;  3PZD A;  1EUV B;  1WR6 E;  3NY5 A;  4IKG A;  3EHV A;  4WQO B;  3PLU A;  2RMM A;  1UH6 A;  3L13 A;  1T0Y A;  3IAM 1;  3PZ7 A;  2CHW A;  5HFY A;  3PO0 A;  2YVC A;  4DHZ E;  2DYB A;  3CF6 E;  1GUA B;  3X23 A;  2MHJ A;  5HI1 A;  3WA0 A;  2M8S A;  4GXB A;  2G9H D;  4KIK B;  3DBR B;  2INN E;  1WE7 A;  5DCN A;  2INP E;  2BKF A;  1I4X A;  1XXG A;  4HCN B;  1J8C A;  1FFU A;  2N1V A;  2WQY B;  4K3B A;  5IP4 D;  1E5W A;  1UWM A;  4DXF A;  5HG2 A;  5EE9 A;  2D5G A;  1JWS D;  4NAW A;  3VH4 B;  1MG8 A;  3PLV A;  1JWA D;  3U4E G;  4K7U A;  4WAA A;  5JZE B;  2RR9 A;  2SEB D;  2KWC A;  2L0T A;  1C79 A;  1K53 A;  3A9J A;  4I6N B;  3AV8 A;  3ZXR A;  2YEP F;  4F7Z A;  1WRD B;  1V80 A;  1C3T A;  3AE3 B;  2ONQ A;  2KWV B;  2PLP A;  3NVW A;  1YN3 A;  3W9C B;  4HCP B;  3Q8C A;  2AQ2 B;  2WXI A;  4KGR A;  2JZP A;  4X57 B;  1C76 A;  2H89 B;  3GZN B;  3HVZ A;  1TT5 B;  1C9F A;  1C4P A;  2CU3 A;  4LTU A;  2BS2 B;  1SJH D;  1V1P B;  1IPG A;  1YIW A;  1ZW7 A;  2CS4 A;  1TTN A;  3PPA A;  2JQR B;  3WAO A;  2XEW A;  1KM7 A;  2L00 B;  1R4N B;  1SIF A;  1HE8 A;  2RDH A;  1WF9 A;  3MJW A;  3W1Y A;  2BKR B;  2KMM A;  1E90 A;  2FBW B;  4GDL A;  2A4Z A;  2G4D B;  3QJZ A;  1EWY C;  1IYF A;  3VUW A;  2B3A A;  1BXT A;  2J42 A;  1FXA A;  2ZNV C;  2Z0D B;  1ZKH A;  4A8X C;  1SJE D;  2LGI A;  4EKU A;  3MHS D;  1WX9 A;  4ARI A;  3AU4 A;  3CWI A;  3N9Y C;  4K81 A;  2L8J A;  1F52 A;  5IAA C;  3ZRF A;  2MH7 A;  3GE8 C;  3U2S C;  2UYZ B;  2IO0 B;  4ACF A;  1I35 A;  1WGD A;  3TEW A;  4TQ1 A;  1AYF A;  3H7S A;  1GOZ A;  4M8N A;  4MAC A;  1I7H A;  3EFU A;  1F1H A;  3IXS A;  3ZGZ A;  2L05 A;  1J19 A;  1R4M B;  5DPW A;  5D3I B;  2ZW1 A;  4JX1 C;  2JF5 A;  2WXR A;  5AZG A;  2ASQ A;  2J53 A;  5FR3 A;  1SIJ A;  5G5G A;  4PT5 A;  4ANU A;  3BYY B;  1OQY A;  2MP2 A;  2KDI A;  2WU2 B;  2M0A A;  2MEK A;  4IDI A;  3N20 C;  4DDI D;  3P63 A;  3HRD D;  2BW2 A;  1I4R A;  3PRE A;  3R3M A;  3QIJ A;  3QA8 A;  1QOB A;  2PVG C;  4B0M A;  3NZ3 A;  4MH0 E;  2KQ4 X;  3IBE A;  4HPM B;  3A9K A;  4OHJ A;  4WH4 A;  3AE9 B;  2MSE D;  3KWV A;  1JWB D;  5AUK A;  3DBL I;  1VZ8 A;  2LFI A;  3N3K B;  2X8X X;  5AUI A;  3KYD D;  3OJ3 A;  1FIQ A;  2N4F A;  1PFD A;  4HKQ A;  1C1Y B;  3BII D;  2ZW0 A;  4TKN A;  3QX1 A;  3B2G A;  4KDI C;  4F8C B;  2LI5 A;  3QAQ A;  4PYZ A;  2W3R A;  3TJP A;  4JWU C;  2GRI A;  1M4V A;  1J7A A;  1D5X C;  3DHH C;  2MP2 B;  1V6E A;  1L0Y B;  1QKZ A;  3TEX A;  2PMV A;  3P42 A;  4A3O A;  2IO2 B;  1V86 A;  1VR9 A;  5E6O A;  4TQ0 A;  2KX0 A;  2GLS A;  2KVR A;  1V9J A;  1G6J A;  2MW5 A;  2NTT A;  4A90 A;  5E6J A;  3LDZ E;  2D2Q A;  2MCN B;  1ZDX A;  1RFA A;  2FAZ A;  3A9K B;  2RDB C;  2GB1 A;  3EFC A;  2WXO A;  2MBE A;  2O2V A;  2MBB B;  1FEH A;  1NI3 A;  2BGF A;  4JL9 A;  4E71 A;  4OVZ A;  2GBJ A;  1HQR D;  4LK0 M;  1YN5 A;  4MGK E;  1WM3 A;  2KQ7 A;  1SE9 A;  4C4V A;  4US9 A;  2KDF B;  1FNU A;  2BF8 B;  3P4R B;  3ETR A;  2I1J A;  3KUZ A;  1VJK A;  2IYD B;  2DEN B;  1KF6 B;  4S0R A;  2UWQ A;  3OWE B;  3AUL A;  1WMH A;  3DBH I;  4NQL B;  3P4P B;  5EE1 A;  1WYG A;  2VZK D;  1MG4 A;  2NPT A;  3IAS 1;  3D32 A;  2A5U A;  1T0S C;  4N59 A;  1E8X A;  2DHZ A;  4MEM A;  3GB1 A;  4BOZ B;  4HWI B;  2D3C A;  1BUI C;  2ZJD A;  3Q8A A;  1I42 A;  3DVN U;  2DWQ A;  2V3P A;  2JXX A;  1ZXH A;  1OGW A;  3L17 A;  4Q2J A;  1CMX B;  4XZ4 A;  2WGS A;  1PGX A;  3LB8 C;  2PIA A;  1RRB A;  2DNF A;  4GLS C;  3HM3 A;  4W9C A;  4C4V B;  3M3J A;  2C7N B;  2KN5 A;  3RMK C;  2JU6 X;  2QIL A;  3IVF A;  1FNV A;  2LVP A;  2IGH A;  2VRR B;  4LCD E;  1F2R C;  2KJ6 A;  4IWO A;  1WMH B;  1ZUD 2;  2QCZ A;  2JXT A;  1QIL A;  1TS4 A;  2JT4 B;  2KQS A;  2CJN A;  3BIN A;  4EZJ A;  3V6E B;  4A3P A;  2NPT B;  1CK1 A;  4W9F A;  4DHJ B;  2ZPY A;  3ZDM C;  2FE8 A;  1SE4 A;  3OAW A;  2Q5W D;  2BYV E;  4PYU A;  3TIX A;  4P7I A;  2BBC A;  2PW9 A;  2V9H A;  3UIO B;  3ZTD A;  2W3S A;  2NS5 A;  2QSD A;  2W82 A;  2BTE A;  4YTN B;  2DBY A;  2NCN A;  4HXD A;  3BY4 B;  2N9E B;  2K5P A;  3T9L A;  2MBQ A;  3T8M A;  2IJ0 A;  5C2T B;  1EM7 A;  2Y5C A;  2C5L C;  1WM2 A;  1WY8 A;  3V3X A;  3RPF C;  4L1B A;  2EKE C;  4K1R B;  1P1A A;  2KLC A;  4DK5 A;  3LXF A;  2L0F A;  4W9K A;  1NYQ A;  2LHD A;  2V4I B;  4ZRQ A;  3V61 A;  5H8Y E;  1YNT E;  3TEY A;  2JX5 A;  4OVU A;  2KDE B;  1V49 A;  1ZXI A;  2LGS A;  3L16 A;  4AJY B;  3IFW B;  1PUT A;  1MI0 A;  5EDS A;  4XE0 A;  3MJ5 A;  3V6C B;  4FUL A;  3AXC A;  3ZXV A;  2KMC A;  3UQB A;  5G2N A;  4W9J A;  2HJ1 A;  1E7U A;  5AZF A;  4IUM B;  4ANW A;  3DHG C;  5J17 A;  3CSF A;  1E8Z A;  1QOG A;  1WRI A;  2WXK A;  3HM6 X;  2OJR A;  2N7D A;  4A55 A;  2N9K A;  2RGF A;  1T3Q A;  1ENF A;  1ZE3 D;  3C8Y A;  1E8W A;  3ZNZ B;  4N9F 4;  1MHX A;  1T5X D;  2AQ3 B;  3H9D A;  4C00 A;  4OZB A;  2B76 B;  3VRB B;  4FJY A;  5KHO A;  5TSS A;  1UGM A;  4M00 A;  3IG3 A;  4E74 A;  3VRA B;  3M95 A;  3QC8 B;  3AEF B;  4LNN A;  4BKT A;  4RF1 A;  1F2R I;  4PS8 A;  2DZI A;  1WFY A;  1YJI A;  3HHM A;  3NJT A;  2ICI A;  3M63 B;  1QF6 A;  2WP9 B;  4JIO U;  1Y8R C;  3CIR B;  1RYJ A;  2NBV B;  3VTU A;  1SE2 A;  2C7H A;  3ZTC A;  1WYW B;  2KAN A;  4YSX B;  2KDM A;  1NBF C;  2FNJ B;  1T0Q C;  4USA A;  4W9I A;  2FUH B;  3QHT A;  4TV3 A;  3Q8B A;  4MM3 A;  1C77 A;  4B9K A;  3NS1 A;  5FK9 C;  5DPT A;  1L0X B;  1TKY A;  2G1E A;  4ZDV A;  2LGY A;  1JWU D;  3ONS A;  4KKJ A;  2L3Z A;  3C0R B;  1K51 A;  2WNM A;  3ML9 A;  1UD7 A;  2GOW A;  2ZCC A;  1FMA D;  4KX6 B;  4WJN A;  1GJZ A;  1XT9 B;  3N30 A;  2GI9 A;  2IGG A;  1N5W A;  3GE3 C;  2WXQ A;  3TSS A;  4FLH A;  2CHX A;  1V5T A;  5DPS A;  3ZJV A;  4ZRI A;  3RD2 A;  2K0P A;  4M0W B;  2KFJ A;  3BK1 A;  2KXJ A;  4JPS A;  3U7Z A;  1KLG D;  4AOF A;  1P98 A;  3PRM B;  2WXP A;  1TJE A;  2K6Q A;  3PGE A;  4NJ6 A;  3B9J A;  1MHH E;  2EEL A;  3CMM B;  2GBR A;  4MM3 B;  1KH0 A;  2LMC A;  5J2R A;  3VR9 B;  3RT3 B;  3ZJT A;  1P9D U;  1GAQ B;  3RNE C;  3E9S A;  4I6L B;  2PE6 B;  1WXQ A;  3VUX A;  1VRA B;  1B9R A;  3RN9 C;  3NRZ A;  4DBG A;  2FIF A;  4BBN C;  2W55 A;  2RD0 A;  1J0G A;  1VLB A;  2LXC A;  1FPY A;  1WJN A;  2E6X A;  2MX2 A;  1Q0W B;  3HVD A;  4WJO A;  1TS5 A;  1FCC C;  4IOI E;  4KSK C;  3AM9 A;  4W9G A;  1WGR A;  2M19 A;  3DVG X;  3Q8F A;  1TGZ B;  3U52 E;  2O6V D;  5DPR A;  3N32 A;  2KZR A;  4ZRP A;  3AEA B;  3ZW3 A;  2KX3 A;  3SR6 A;  1ISN A;  3Q6B A;  4DXA B;  3AE8 B;  1TY0 A;  3IT4 B;  4EE2 A;  4ZHO A;  2L52 A;  1XD3 B;  4BVU C;  2IDY A;  4K7W A;  3WIM A;  1TZO A;  2IZV B;  1LXD A;  1V81 A;  1S3S G;  3VXW A;  4EUT A;  3VVW B;  2BB6 A;  3B2F A;  3I5J C;  4NAW B;  3P4Q B;  5G55 A;  4LLG M;  4ZYN A;  3E56 A;  4M02 A;  1VDV A;  1FCL A;  2KDB A;  3A9J B;  3HIZ A;  4RF0 A;  3Q3J A;  3KH0 A;  2N9L A;  3MHZ A;  3RI7 C;  1CZP A;  3SDL C;  3Q14 C;  4P16 A;  3QQ8 B;  5IOI A;  2KC2 A;  1L6U A;  1KOT A;  4FXC A;  1FFV A;  1E8Y A;  3PZ8 A;  1NYR A;  2DZK A;  3NVZ A;  4G0N B;  3AED B;  2QDF A;  2UU7 A;  3U8Z A;  3B0A A;  4YSZ B;  3HK0 A;  4TSS A;  2INC C;  4FJZ A;  4P1C C;  4WWO A;  3TEZ A;  1K50 A;  2KWD A;  2N9P C;  2K1F A;  3UIP B;  1NEN B;  1JRU A;  3ZO5 B;  2RDG A;  1Q1O A;  3MTN B;  1WI0 A;  2L32 A;  2WX1 A;  1P0R A;  2Y5B B;  1ET6 A;  4BBN F;  2XBB C;  3M62 B;  4ICV A;  4WAF A;  4GDL B;  1P7E A;  2LRU A;  3I3T B;  5H92 C;  3KYC D;  1ZOY B;  3UF8 A;  3UIN B;  4EZK A;  3FKY A;  2Y3A A;  1L0V B;  1WJ4 A;  1UEL A;  4HRS A;  3PT2 B;  4EFO A;  4FA6 A;  2JRI B;  4JQW C;  2L83 A;  3GS2 A;  2KFK A;  1YQ3 B;  3H1U A;  1STE A;  2BYE A;  5JHA A;  4MJS A;  4ZRK A;  1HZ6 A;  5IO9 A;  2NBU A;  2I1K A;  3Q2A C;  1GC7 A;  4MEL A;  2L7R A;  2WLB A;  4LNK A;  5IN7 A;  2IPK D;  3DWM A;  4HJG E;  2VZK B;  1WXM A;  2PKO A;  3L10 B;  2CJO A;  3J9C A;  3KUD B;  5G5H A;  2JSV X;  4GOC A;  4GB9 A;  3TL5 A;  2LWP A;  1JML A;  1KJT A;  3KUC B;  3L4P A;  3R2T A;  1TKE A;  1SGH A;  1OTR B;  4F1S A;  1H4R A;  1KTK A;  2BS3 B;  2JYE A;  3VFK A;  2CKH B;  5D6J B;  3APD A;  4LJO B;  1SE3 A;  3V60 A;  3DQV A;  2IO1 B;  2FUG 1;  5D3D A;  4UDU C;  3PRZ A;  1RAX A;  4KGT A;  2KFK B;  3R7R A;  3ZYY X;  5CX3 A;  1ZGU B;  4MJS B;  4WQM A;  2DZM A;  4LJP B;  2JWZ A;  4KZC A;  2JYT A;  5FR6 A;  3Q3N C;  2RSU A;  4NNJ B;  2FCQ A;  3DDC B;  3ZNI D;  2LUM A;  1Q10 A;  2DYO A;  2DAF A;  4FHK A;  4JWS C;  1N63 A;  2N7J A;  1AN8 A;  4GIV A;  3AEB B;  1UUP A;  3WAM A;  4IM2 A;  4LDT B;  5T8I A;  4RGM A;  1XEE A;  1XCQ L;  4CYE A;  5GMV A;  4DXG A;  3W1S A;  4ITK A;  2LGX A;  3GOE A;  3I57 A;  2AL6 A;  3DBR I;  2QEJ C;  1XQQ A;  1P7F A;  3AE1 B;  4YL8 A;  4C56 C;  1E0Z A;  1SBB B;  2PPH A;  4WWM A;  4RFB A;  4XX5 A;  2JZ3 B;  5BYR A;  3KQ4 A;  3O13 A;  1NI2 A;  3ZKJ C;  2KYW A;  3ZNH B;  1EF5 A;  4EOY A;  5BMI A;  1EU3 A;  3TCA A;  1NVI D;  4IM0 A;  4N6E B;  2AL3 A;  2C9W B;  2BT6 A;  3W5V B;  1FO4 A;  4KVG B;  4HKZ E;  4W9D A;  3O65 B;  2O2V B;  1GB4 A;  4B0E A;  1Z2M A;  2HD5 B;  3VR8 B;  4G50 A;  1UWX A;  2PJH A;  3PS6 A;  1PGA A;  3KLS X;  2KNB A;  1SF0 A;  1XLQ A;  3GZN I;  3RUI B;  2J0K A;  1V1O A;  2W54 A;  2W9N A;  2PE9 A;  3PTF C;  2ZPN A;  2M4N A;  1DYQ A;  1B1Z A;  1R4N I;  1DOI A;  4MGZ E;  4NJ7 A;  1JRP A;  1L4D B;  2WDT B;  2ZZP B;  1WX8 A;  2BWF A;  3K9O B;  5AZH A;  2ACZ B;  2OJW A;  3UI3 A;  2MBH A;  3DWG C;  3Q3F A;  1SB3 C;  2M17 A;  4B95 A;  4E3C A;  2C60 A;  4S17 A;  4KZ0 A;  2LVQ A;  2FID A;  2V3S A;  1PDX A;  1XLP A;  1GPX A;  3LYY A;  4TUU A;  3WAL A;  4ANV A;  1L5P A;  1WGH A;  2BYF A;  4BZA A;  2QMT A;  3TUO A;  5D7G A;  3MC0 B;  4RGN A;  3ZVV A;  4ICU A;  3QWZ B;  4K7S A;  3RNC C;  3RZW C;  3QCA A;  1R4M I;  4GSW A;  5BMH A;  4L2Y A;  1WJ6 A;  1UBQ A;  4IM3 A;  3URY A;  5LXH A;  3VHT C;  4YSY B;  4HDO A;  2K8H A;  2KJH B;  4WWN A;  3OJ4 B;  4HDQ A;  2BYT A;  3V62 A;  2NBW B;  2LVO A;  3PV1 A;  2K9X A;  2MBO A;  2JY6 A;  3B1L X;  2LHE A;  2XN9 C;  4MH8 A;  4W9E A;  3BYT B;  1HTQ A;  2WWZ A;  2M0X A;  3WCQ A;  1E10 A;  2BQQ A;  3AN1 A;  3NVV A;  5KHQ A;  1TYG B;  1VD2 A;  2VH2 A;  1E6E B;  1RFK A;  1YJJ A;  3NVY A;  3EGR A;  5JH5 C;  2KOX A;  3EEC A;  5AEK B;  2KTR A;  2GMI C;  3A1Q A;  3ENE A;  1J7B A;  2O6V A;  4WJQ A;  4DHZ B;  4HLE A;  3I63 C;  1N61 A;  2BPS A;  3BVG A;  2MQJ A;  1D4B A;  3RCZ A;  3A33 B;  4BOS C;  3FIL A;  4YXD B;  3T3O A;  1WJU A;  2KAJ A;  4GDK A;  1QQR A;  5EE0 A;  3I9V 1;  2DLB A;  4BFR A;  1OQQ A;  3FC4 A;  1GC6 A;  3L08 A;  3JSV A;  3SU8 X;  4HPP A;  1YMH E;  2JRH A;  4LNO A;  1AW7 A;  1U4A A;  4HJK A;  3DBL B;  4FAD A;  2YLM A;  1WR1 A;  1MVK A;  4M8M A;  3MC9 A;  4YT0 B;  3LJ3 A;  1VCB A;  2H88 B;  4JLC A;  2KTF A;  2KTR B;  2J52 A;  4NQK E;  2KJR A;  2KAC A;  3A1Q B;  1I4G A;  1GG3 A;  2WXL A;  2XNA C;  5CTR C;  3BZD B;  2O6V B;  2AX5 A;  1VZ6 A;  2EMS A;  4MGI E;  4KIK A;  1KLV A;  4WJP A;  2IY1 B;  2LZ6 A;  1XLN A;  3H6N A;  2WU5 B;  4YWG G;  2OHF A;  3L54 A;  3FIL B;  2HTM E;  2AYO B;  1JRO A;  3AEC B;  1DGJ A;  2PVO D;  5E6P A;  4P6V F;  4GDK B;  1TBE A;  1YD8 U;  4CHK A;  2K39 A;  2KHW B;  4BKS D;  3JSV B;  1PQS A;  2ZNV B;  1TZ1 A;  1WE6 A;  4XGA B;  1YX6 B;  1XO3 A;  2IGD A;  2RPQ A;  3AB5 A;  1K8R B;  5IA7 A;  3U30 A;  1D3Z A;  3ZIM A;  1LQB A;  2N0S B;  3ZJU A;  3ZUN A;  2Z59 B;  3SFE B;  5CHF A;  4ASW C;  1UNS A;  1FNW A;  2KK8 A;  3ZQ4 A;  3B08 A;  1OEY A;  1PYW D;  3A4R A;  1WX7 A;  4ZHP A;  3H7P A;  3ML8 A;  4LNI A;  1BT0 A;  1WZ0 A;  3DBH B;  3DCG A;  4NAM A;  1HA5 A;  1V1P A;  4C7Z A;  1ZP0 B;  1V2Y A;  5LXI B;  1XCT L;  3AE2 B;  4EEW A;  4OW0 A;  3IHP C;  1VZ7 A;  1Q5W B; 
#chains in the Genus database with same CATH homology
 2BYE A;  3DVG Y;  1CMX B;  5JHA A;  4XZ4 A;  4MJS A;  4ZRK A;  2JZZ A;  2KC1 A;  3SHQ A;  2R2O A;  2NBU A;  1RRB A;  2I1K A;  1YX5 B;  1L2N A;  2R2Q A;  3HM3 A;  4W9C A;  3TBL D;  1GC7 A;  3RUL A;  4MEL A;  2L7R A;  5HKH A;  2CHZ A;  1LM8 B;  3M3J A;  3DBS A;  2K25 A;  2KKC A;  2C7N B;  2KN5 A;  3IVF A;  2QHO A;  1WXM A;  2FCM A;  2LVP A;  3VUY A;  3L10 B;  3KUD B;  2VRR B;  3VAW A;  4LCD E;  1WXS A;  2KJ6 A;  5D94 A;  4GB9 A;  4GOC A;  2NR2 A;  3TL5 A;  4IWO A;  1WMH B;  4W9H A;  3UQA A;  2LWP A;  1A5R A;  2JT4 B;  3WAN A;  4MSQ B;  2KQS A;  2EMT A;  1KJT A;  3BIN A;  3KUC B;  3UGB B;  4EZJ A;  3PRP B;  3V6E B;  4A3P A;  2NPT B;  1SGH A;  3WAP A;  4FN2 A;  1OTR B;  2DZJ A;  4FBJ B;  4MDK E;  4W9F A;  4DHJ B;  4G11 A;  2D07 B;  4RM9 A;  2ZPY A;  3ZDM C;  4F1S A;  1H4R A;  2LJ5 A;  3OAW A;  4GGQ A;  3VFK A;  2CKH B;  2N1W A;  5D6J B;  2BYV E;  4IWQ A;  4PYU A;  3APD A;  3TIX A;  4LJO B;  4P7I A;  3H7P B;  2ZVO A;  5J18 A;  2KO3 A;  3APC A;  3UIO B;  1WGG A;  3ZTD A;  3V60 A;  2NS5 A;  3DQV A;  2IO1 B;  3ZNG C;  2MA9 B;  3PRZ A;  1RAX A;  2KFK B;  2NCN A;  3R7R A;  5CX3 A;  2MRP A;  4HK2 A;  5LLI A;  4HXD A;  1ZGU B;  1YJ1 A;  3BY4 B;  2N9E B;  4MJS B;  5TR5 A;  2MWS B;  2DZM A;  4LJP B;  2Z0E B;  3T9L A;  1L7Y A;  2MBQ A;  4CO7 A;  5JHB A;  3T8M A;  2V1Y A;  2JWZ A;  4KZC A;  5FR6 A;  2RSU A;  4NNJ B;  2JUO A;  2FCQ A;  2C5L C;  5L83 A;  1WM2 A;  1WY8 A;  3DDC B;  3K9P B;  3ZNI D;  2EKE C;  3VTW A;  3EC8 A;  2AWT A;  3ECI A;  3X0W A;  2J0J A;  1P1A A;  4FJV B;  4K1R B;  2KLC A;  2BWE S;  2DYO A;  3QAR A;  4DK5 A;  3OLM D;  2DAF A;  2L0F A;  3VTV A;  4W9K A;  3P2B A;  3VH3 B;  4FHK A;  5L95 C;  2KLG A;  4AUQ C;  2N7E A;  3V61 A;  2DX5 B;  4GIV A;  1YQB A;  3WAM A;  3ZRC A;  4IM2 A;  4OVU A;  2KDE B;  4LDT B;  2M1M A;  2NVU I;  3PZD A;  1V49 A;  1EUV B;  1WR6 E;  4CYE A;  5GMV A;  3L16 A;  3NZU A;  4AJY B;  3W1S A;  3IFW B;  3SD5 A;  2LGX A;  3GOE A;  3NY5 A;  5EDS A;  3EHV A;  2AL6 A;  3DBR I;  3DVN V;  4II3 B;  4WQO B;  5BO4 B;  3PLU A;  1XQQ A;  3V6C B;  4FUL A;  4YL8 A;  1UH6 A;  2WYQ A;  3AXC A;  2PPH A;  4ANX A;  4XX5 A;  2JZ3 B;  2KMC A;  3L13 A;  4MGY E;  3UQB A;  5G2N A;  1T0Y A;  2CR5 A;  4W9J A;  2CHW A;  1NI2 A;  3ZKJ C;  1E7U A;  3ZNH B;  4EOY A;  1EF5 A;  2YVC A;  3TCA A;  2DYB A;  4DHZ E;  5AZF A;  3CF6 E;  4IUM B;  4ANW A;  1GUA B;  3X23 A;  3R7Q A;  5J17 A;  3CSF A;  4IM0 A;  1E8Z A;  3NZS A;  2HE7 A;  2AL3 A;  2C9W B;  3WA0 A;  2LD9 A;  2M8S A;  4GXB A;  3A4S C;  2K8C A;  4KVG B;  3HM6 X;  4KIK B;  2OJR A;  2N7D A;  1WE7 A;  3O65 B;  2RGF A;  4W9D A;  5DCN A;  2CU1 A;  2O2V B;  1P3Q U;  2BKF A;  4RM8 A;  4HCN B;  1J8C A;  2N1V A;  1Z2M A;  2HD5 B;  3APF A;  4G50 A;  2KWU B;  1E5W A;  3PHX B;  1E8W A;  3PS6 A;  2PJH A;  3ZNZ B;  4URK A;  4N9F 4;  4OVV A;  4A20 A;  4EZL A;  1WIA A;  4KV2 A;  2KNB A;  4NAW A;  3H9D A;  3VH4 B;  1MG8 A;  2GBM A;  3PLV A;  3GZN I;  4K7U A;  4WAA A;  5JZE B;  4FJY A;  5KHO A;  2L76 A;  3RUI B;  1GNU A;  2J0K A;  1UGM A;  2RR9 A;  2KWC A;  2L0T A;  3IG3 A;  4I6N B;  3A9J A;  4E74 A;  3M95 A;  2KD0 A;  4F7Z A;  1M94 A;  4PS3 A;  1WRD B;  1V80 A;  2FCN A;  3QC8 B;  2W9N A;  2PE9 A;  3PTF C;  4J6I A;  2ZPN A;  1C3T A;  2M4N A;  4BKT A;  2KWV B;  1R4N I;  4MGZ E;  4PS8 A;  2DZI A;  2LGD A;  4HCP B;  4NJ7 A;  1WFY A;  2D3G A;  2G3Q B;  3HHM A;  3DPD A;  4GN1 A;  3NHE B;  4X57 B;  2WDT B;  2ZZP B;  1WX8 A;  3M63 B;  2BWF A;  3K9O B;  4JIO U;  1Y8R C;  2NBV B;  2C7M B;  3VTU A;  2AEH A;  5AZH A;  2J7Q B;  3KW5 B;  2C7H A;  2MBH A;  3ZTC A;  1WYW B;  3Q3F A;  2KAN A;  1IPG A;  1YIW A;  1ZW7 A;  2M17 A;  2CS4 A;  1TTN A;  3PPA A;  1NBF C;  2FNJ B;  2XEW A;  3WAO A;  4B95 A;  4E3C A;  4W9I A;  2FUH B;  1KM7 A;  2C60 A;  2L00 B;  3QHT A;  4KZ0 A;  1SIF A;  1HE8 A;  2LVQ A;  4TV3 A;  1UZX B;  2FID A;  2V3S A;  1WF9 A;  4MM3 A;  3MJW A;  4NPN A;  3W1Y A;  2BKR B;  1EO6 A;  3AU5 A;  4TUU A;  4W9L A;  3WAL A;  4ANV A;  4B9K A;  1E90 A;  2ZCB A;  5DPT A;  1WGH A;  2A4Z A;  4GDL A;  4ZDV A;  2K8B A;  2LGY A;  2G4D B;  3ONS A;  3QJZ A;  2BYF A;  1IYF A;  2L3Z A;  3C0R B;  3VUW A;  2B3A A;  2GBN A;  3ML9 A;  1WXA A;  2ZNV C;  1UD7 A;  2Z0D B;  2GOW A;  5D7G A;  1ZKH A;  5C23 A;  1FXT B;  1IP9 A;  2ZCC A;  3ZVV A;  3NOB A;  4WJN A;  4EKU A;  3MHS D;  4ICU A;  1GJZ A;  3QWZ B;  1WX9 A;  4K7S A;  1XT9 B;  3RZW C;  3AU4 A;  3QCA A;  3N30 A;  4II2 B;  1R4M I;  4GSW A;  4K81 A;  2L8J A;  3JYU A;  5IAA C;  3ZRF A;  2ZEQ A;  1WJ6 A;  4KDL B;  2UYZ B;  1UBQ A;  2IO0 B;  2PEA A;  3PHW B;  4FLH A;  4I6P A;  2CHX A;  1V5T A;  4IM3 A;  4ZRJ A;  3VHT C;  5DPS A;  5LXH A;  4HDO A;  2K8H A;  1EF1 A;  2KJH B;  4WWN A;  4AWJ A;  4B6W A;  1I35 A;  4ZRI A;  3OJ4 B;  3RD2 A;  3S2A A;  4HDQ A;  2G4S A;  4M0W B;  1WGD A;  2KFJ A;  5C1Z A;  4TQ1 A;  3V62 A;  2NBW B;  2LVO A;  3H7S A;  3PV1 A;  2KXJ A;  4M8N A;  2MBO A;  2JY6 A;  2XK5 A;  3B1L X;  3EFU A;  1V5O A;  4AOF A;  1P98 A;  2L05 A;  3PRM B;  1J19 A;  5DPW A;  2K6Q A;  3PGE A;  4W9E A;  3VDZ A;  4NJ6 A;  4EEW A;  3VQI A;  3CMM B;  2GBR A;  2WWZ A;  2M0X A;  5J2R A;  4MSM B;  3RT3 B;  1P9D U;  2JF5 A;  2HTH A;  5AZG A;  4I6L B;  2WX0 A;  5KHQ A;  2PE6 B;  2ASQ A;  2IO3 B;  2IBI B;  3VUX A;  4DDG D;  1VD2 A;  4BKG A;  2J0M A;  2K6D B;  4ANU A;  5E6N A;  1E7V A;  2REX A;  1OQY A;  1X1M A;  3U7D A;  2MP2 A;  3NS8 A;  3PSE B;  2KDI A;  2FCS A;  2LAS A;  2GBK A;  4PS7 A;  4DBG A;  1UBI A;  4DDI D;  5JH5 C;  3PRE A;  4NY0 A;  3ZLZ A;  3R3M A;  2FIF A;  3RYT A;  3QK0 A;  1LFD A;  4BBN C;  2KOX A;  3QIJ A;  3EEC A;  5AEK B;  2KTR A;  3QA8 A;  3AI5 A;  2RD0 A;  2GMI C;  3A1Q A;  3ENE A;  2HJ8 A;  1J0G A;  4MH0 E;  3IBE A;  2LXC A;  2O6V A;  4WJQ A;  4HLE A;  4DHZ B;  1WGY A;  4HPM B;  3A9K A;  4HPL B;  1WJN A;  2MX2 A;  1Q0W B;  3PVL A;  4WJO A;  4IC7 B;  2BPS A;  1NDD A;  4GMV A;  2MSE D;  2MQJ A;  2DAJ A;  4KSK C;  4W9G A;  2V4L A;  1WGR A;  3DBL I;  3A33 B;  3RCZ A;  4BOS C;  3DVG X;  2XK5 B;  1TGZ B;  2O6V D;  3L0W B;  5DPR A;  3JW0 X;  3N3K B;  3N32 A;  3KYD D;  2KZR A;  3OJ3 A;  3ZW3 A;  2KX3 A;  2N4F A;  2OOB B;  1C1Y B;  1ISN A;  1WJU A;  1AAR A;  4DXA B;  4GDK A;  4TKN A;  3QX1 A;  4KDI C;  5CHW A;  4F8C B;  1WZ3 A;  2LI5 A;  3QAQ A;  4IG7 B;  4BFR A;  4PYZ A;  1GC6 A;  3L08 A;  3JSV A;  3TJP A;  4DWF A;  1XD3 B;  3SU8 X;  2DYM A;  2JRH A;  4BVU C;  4K7W A;  1U4A A;  3DOW A;  3WIM A;  4HJK A;  4FAD A;  2YLM A;  2MP2 B;  1V6E A;  1WR1 A;  2D10 A;  2IZV B;  4AP4 C;  1LXD A;  1S1Q B;  1V81 A;  4LDT D;  1S3S G;  3VXW A;  4EUT A;  4M8M A;  3VVW B;  3LJ3 A;  1VCB A;  4A3O A;  2IO2 B;  4JLC A;  1V86 A;  3L17 A;  4RMA A;  5E6O A;  4FHJ A;  4TQ0 A;  2KX0 A;  4NAW B;  2KTF A;  1RLF A;  1V9J A;  2KVR A;  5G55 A;  1G6J A;  2MW5 A;  2KTR B;  4NQK E;  4ZYN A;  2KJR A;  3A1Q B;  4GU2 A;  3LDZ E;  2D2Q A;  2JVC A;  2MCN B;  2IY0 B;  1GG3 A;  5CTR C;  2KDB A;  1RFA A;  3A9J B;  3HIZ A;  2O6V B;  3CST A;  2EMS A;  3Q3J A;  2KMA A;  2FAZ A;  3A9K B;  3KH0 A;  3R66 C;  4MGI E;  4KIK A;  2D11 A;  3SDL C;  1Z5S B;  4WJP A;  2IY1 B;  1KLV A;  2LZ6 A;  2JPH A;  3QQ8 B;  3H6N A;  2MBE A;  2KC2 A;  2O2V A;  2MBB B;  4G3X B;  4JGH B;  4JL9 A;  2BGF A;  3L54 A;  1KOT A;  1WH3 A;  1E8Y A;  2AYO B;  4E71 A;  4BKS A;  2LUE A;  2GBJ A;  1WXV A;  4MGK E;  2DZK A;  4G0N B;  1WM3 A;  2KQ7 A;  1SE9 A;  5D2M B;  2LXA A;  5CHV C;  1H8C A;  2KDF B;  5E6P A;  3ZDT A;  2BF8 B;  3U8Z A;  4GDK B;  1TBE A;  3B0A A;  4WWP A;  1YD8 U;  2I1J A;  3HK0 A;  4CHK A;  4IWP A;  2K39 A;  2KHW B;  3KUZ A;  4FJZ A;  2IYD B;  3TMP B;  2DEN B;  4WWO A;  4BKS D;  3ALB A;  2UWQ A;  3JSV B;  1PQS A;  3KVF B;  2ZNV B;  1TZ1 A;  3AUL A;  1WE6 A;  1WMH A;  2N9P C;  2K1F A;  3DBH I;  4NQL B;  3UIP B;  3ZO5 B;  1JRU A;  1YX6 B;  3JVZ X;  2RPQ A;  1K8R B;  5IA7 A;  1Q1O A;  3U30 A;  1D3Z A;  2MLB A;  3MTN B;  1WI0 A;  1LQB A;  3ZIM A;  2WX1 A;  1P0R A;  2Y5B B;  3ZUN A;  2NPT A;  2Z59 B;  2XBB C;  3M62 B;  4ICV A;  5CHF A;  4BBN F;  4GDL B;  2ZVN A;  4KSL C;  2LRU A;  4ASW C;  2KK8 A;  3I3T B;  3D32 A;  2A5U A;  3B08 A;  3KYC D;  1OEY A;  1E8X A;  3A4R A;  1WX7 A;  3UF8 A;  2G45 B;  2DHZ A;  4MEM A;  2LRW A;  3UIN B;  4EZK A;  4HVB A;  3H7P A;  3W1S C;  4AJW A;  4BOZ B;  3ML8 A;  1BT0 A;  4HWI B;  2ZJD A;  1WJ4 A;  1UEL A;  1WZ0 A;  1I42 A;  1OEY J;  3PT2 B;  4EFO A;  2N9X A;  3DCG A;  4IW0 A;  4DHJ D;  4XC2 A;  4FA6 A;  2JRI B;  4JQW C;  3DVN U;  1QZE A;  2KFK A;  1V2Y A;  2JXX A;  3RZF A;  1F9J A;  5LXI B;  1OGW A;  3IHP C;  3H1U A;  1Q5W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...