3WALA

Crystal structure of human lc3a_2-121
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
RPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Microtubule-associated proteins 1A/1B light chain 3A
total genus 35
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2013-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3walA00
4K7WA 4KDLB 3R7RA 2KQ7A 3A4SC 3UIPB 1T0YA 3PLUA 1GNUA 2IO0B 2Z0DB 3VTWA 1RFAA 2MQJA 2Z59B 3SD5A 4F8CB 4IG7B 2LVOA 3JW0X 1ISNA 4ZRIA 4F1SA 1V2YA 2CHXA 2L0TA 5L83A 2IY1B 1EUVB 2GMIC 3TCAA 3AI5A 2XEWA 2DYMA 5C23A 4B9KA 2KVRA 2LRWA 1WX9A 4DDGD 5AZFA 3WANA 1WJ4A 1QZEA 3U8ZA 2KNBA 2MBBB 3NZUA 1M94A 4ZYNA 3N30A 1BT0A 4MGYE 1E5WA 3VDZA 5BO4B 3A9JA 3IFWB 4HLEA 3VFKA 4BKTA 2NBWB 4E74A 4W9CA 1WR1A 3L17A 4GDLB 1R4MI 4K7SA 4FULA 5CX3A 4CHKA 4MJSB 3SDLC 4KSKC 2NBVB 1A5RA 2KC1A 3DCGA 3VUWA 3U7DA 3HM3A 1WH3A 2MLBA 1ZKHA 2K25A 1WYWB 2N9XA 3L0WB 1WX8A 5JHAA 2GBJA 4X57B 2WX0A 2BWFA 3H7PA 1GC6A 2N9PC 2D07B 4WJQA 1NBFC 5D6JB 3R3MA 3ZNGC 4FADA 1NDDA 2LUEA 1P1AA 4GIVA 4FHJA 3DVGX 4IM2A 2MRPA 3H9DA 4WWOA 2CS4A 3GZNI 1RAXA 3C0RB 2FCNA 3W1SA 1CMXB 3RYTA 2AL6A 1WJUA 3UIOB 1UELA 5CTRC 1C1YB 2ASQA 3ML8A 4ANWA 3A1QB 4MM3A 2G4SA 1WMHA 2IZVB 2KC2A 3M63B 2NBUA 3QJZA 4IWPA 5E6PA 2M17A 5LXHA 4ICUA 1RLFA 4AOFA 4K7UA 3ZDTA 5KHOA 4ZRKA 3U30A 3V6CB 2WDTB 4IUMB 3PREA 2C9WB 3ZTCA 3NHEB 4EFOA 2ZCCA 3PRPB 2IO2B 4XZ4A 2JY6A 2KZRA 2IBIB 3BY4B 2KQSA 4IC7B 3IBEA 3Q3FA 2J0MA 4MGIE 3TJPA 5IA7A 2LZ6A 3IVFA 3Q3JA 3WAMA 4EZLA 2KWUB 4AJWA 3VUXA 4G11A 3V60A 2A4ZA 1WGGA 4ICVA 2XK5B 3MJWA 3B0AA 2AL3A 3APFA 2CHWA 2EKEC 4JLCA 4IWOA 4OVVA 4BBNC 2IO3B 4TUUA 4KV2A 4FBJB 5D94A 2C5LC 2DAJA 4GN1A 1V6EA 2KANA 1WJ6A 4BKSA 2GBRA 2RGFA 4RMAA 4MGZE 4DXAB 2J7QB 4I6PA 4W9DA 1E7VA 2J0JA 5JH5C 2HJ8A 2KJHB 4IW0A 3ZIMA 3VHTC 3ZNHB 4GMVA 4TKNA 2DYOA 4FJZA 2C7MB 2CU1A 2JZ3B 2WWZA 1L2NA 2LVPA 3KUZA 3I3TB 2MW5A 4HJKA 3TL5A 2BKRB 4K81A 4NNJB 1WXMA 1SE9A 4HXDA 2GBMA 5C1ZA 2NPTB 2PE6B 2MA9B 3WAPA 4DK5A 2DYBA 3KW5B 2GBKA 3HHMA 2N1WA 3PTFC 3V6EB 3ALBA 2O2VB 4GDKA 3LJ3A 2ZVNA 3DBSA 3PVLA 3NY5A 2M4NA 2JRHA 4URKA 2L05A 5J2RA 5CHWA 2LXCA 3OJ4B 2HE7A 5DPSA 3UGBB 4BVUC 2MBOA 3NZSA 3EHVA 2MWSB 2C60A 5D2MB 1R4NI 1I42A 3BINA 4MH0E 3RULA 2DZJA 2RPQA 2PE9A 2DZIA 2IY0B 2R2QA 4ASWC 1Y8RC 2KFJA 2OJRA 1YX5B 4PS8A 2LGYA 1P0RA 2MSED 4HWIB 2KXJA 2O6VB 4WJPA 2C7HA 2BYVE 2LWPA 3A9KB 3UQAA 4FJYA 4MSQB 4DHJB 1J0GA 1IPGA 4J6IA 4W9EA 1V5TA 3S2AA 1SGHA 2M1MA 4YL8A 5E6NA 3ONSA 4EOYA 3DVNU 2O6VD 1OEYJ 5J18A 1YD8U 4F7ZA 4G50A 5GMVA 2KJ6A 4KDIC 4B6WA 3PT2B 3QIJA 3NS8A 3HK0A 2KDFB 4RM9A 2G4DB 2DENB 4JIOU 4M8NA 1VCBA 2FNJB 3PHWB 4LJPB 3HM6X 2KD0A 2RD0A 4BKGA 1JRUA 4GU2A 4KIKA 4KZCA 1UH6A 1UGMA 1E8YA 3LDZE 3NOBA 3QX1A 2ZNVC 3W1SC 2LGXA 1PQSA 4AWJA 4ANUA 4EZKA 4BKSD 2K8CA 1EF1A 2FCQA 1WM2A 3DPDA 3VTUA 2BKFA 1KLVA 1GJZA 2MBQA 1K8RB 1WGDA 2L76A 3H6NA 3PS6A 4II3B 2N7DA 4KIKB 2JUOA 2FCMA 2BYFA 2IO1B 1WGRA 2K1FA 3IHPC 4BOSC 2ZNVB 3VXWA 3DQVA 4DWFA 3ZRFA 4EKUA 3L54A 3QC8B 4A3PA 2LVQA 5LXIB 1Q0WB 3VVWB 3B1LX 4FJVB 4TQ0A 1XQQA 5DPTA 2J0KA 1GC7A 5AZGA 3ZNID 5AEKB 1UBIA 2KKCA 2KX0A 3A1QA 2CHZA 2MBHA 1EO6A 2KK8A 1F9JA 3WIMA 2ZPNA 4GXBA 4OVUA 1OQYA 3K9OB 3RZFA 1LQBA 2L3ZA 2KFKA 2KFKB 2KLCA 1MG8A 4TV3A 4WJNA 3ZW3A 3B08A 5EDSA 4W9KA 1Z2MA 1Z5SB 4P7IA 3VQIA 4II2B 3JSVB 2KX3A 2JRIB 4NY0A 2JWZA 1WXVA 3EC8A 2ZPYA 3X0WA 5E6OA 2HD5B 3APCA 4W9GA 1VD2A 2KMCA 3PZDA 3ZDMC 2K8HA 1WM3A 3DDCB 3MTNB 1V81A 4NQKE 2A5UA 2UYZB 3RT3B 4HK2A 2KN5A 4XX5A 4B95A 1WRDB 1E90A 3DVNV 4W9HA 2G45B 3P2BA 4HCPB 4XC2A 3KVFB 1YX6B 1Q5WB 3QARA 2FIFA 1H8CA 2KTRA 2L7RA 1D3ZA 1IYFA 2KDIA 5LLIA 2G3QB 5IAAC 3OLMD 3OAWA 4MJSA 5D7GA 3VUYA 4CO7A 3QQ8B 2O2VA 3L10B 4GDKB 5G2NA 2ZJDA 1EF5A 5FR6A 5CHVC 1LXDA 3O65B 2YVCA 3X23A 1E8WA 4ANVA 3OJ3A 4AP4C 3CMMB 1YJ1A 1WE7A 4HDOA 2YLMA 1WE6A 4PS7A 1WY8A 3ML9A 1V49A 2JPHA 1WXSA 2D10A 2DHZA 2M0XA 3H1UA 2BPSA 2LGDA 2D3GA 2R2OA 4FHKA 4G0NB 4NPNA 4WAAA 3ZRCA 3V61A 5CHFA 2N4FA 1WJNA 4AUQC 2EMTA 2N7EA 3UF8A 4DDID 1E8ZA 2KOXA 3PHXB 3L13A 1WIAA 2AWTA 1SIFA 1J19A 1WF9A 4I6NB 4MSMB 4ZDVA 4KSLC 4N9F4 1LFDA 3N32A 2AEHA 3UQBA 3K9PB 4EUTA 5KHQA 3DOWA 1I35A 3DBHI 3MHSD 3JSVA 4W9IA 2V1YA 3EFUA 3N3KB 1WX7A 3VAWA 2ZZPB 1V9JA 1V86A 2CKHB 4IWQA 4NJ7A 2D11A 3QWZB 3PSEB 3TMPB 2KLGA 3A9JB 3M3JA 3WAOA 2NR2A 3PRMB 2O6VA 3TBLD 4AJYB 4DHZB 5AZHA 1P98A 2MP2A 2DAFA 4RM8A 2DX5B 3ZVVA 1TGZB 3R66C 2KDBA 2K8BA 2Y5BB 2KJRA 3IG3A 2LXAA 3ZKJC 4NAWA 4HPLB 4WWPA 3DVGY 1NI2A 1WI0A 3CF6E 1TZ1A 2L0FA 4GSWA 4WWNA 2AYOB 2GOWA 1UD7A 3KUCB 2KWVB 2JXXA 1GUAB 2MCNB 4E3CA 2I1JA 3PRZA 1KM7A 1V5OA 1V80A 4MEMA 2REXA 3H7SA 1TBEA 2QHOA 4M0WB 3KYCD 1LM8B 1UBQA 2FUHB 2LD9A 4GGQA 1X1MA 1WZ0A 3JVZX 4EEWA 4A3OA 1P3QU 3DBRI 3JYUA 5JHBA 3EECA 3WALA 2V4LA 4I6LB 1OEYA 3VH3B 2FAZA 4FLHA 3M95A 2BF8B 1XD3B 3AXCA 1WGHA 2HTHA 4BBNF 3ZNZB 1E8XA 1KJTA 2K6DB 2B3AA 5L95C 2L00B 4HVBA 2JVCA 2XBBC 2BYEA 4BOZB 3H7PB 2KTRB 3HIZA 2EMSA 2NCNA 4NJ6A 4W9JA 3RCZA 3R7QA 5G55A 3UINB 3SU8X 4IM0A 2I1KA 1P9DU 1FXTB 2DZMA 4JL9A 3A4RA 3PGEA 4DHJD 4HCNB 4M8MA 5DPRA 2JF5A 3QAQA 2GBNA 2NVUI 2UWQA 2KHWB 4NAWB 5HKHA 2KWCA 2CR5A 2PEAA 3ZUNA 3KH0A 4LCDE 3ENEA 3ECIA 2KMAA 4DHZE 2KTFA 3L08A 1S1QB 1U4AA 4GDLA 2JT4B 3D32A 4GOCA 3RUIB 1IP9A 4HDQA 2N1VA 3AU5A 2XK5A 2MBEA 2ZCBA 3CSTA 2KO3A 2V3SA 3A9KA 4JGHB 3CSFA 4ZRJA 3A33B 2FCSA 3WA0A 4G3XB 4LJOB 2L8JA 1KOTA 1ZGUB 4DBGA 3L16A 1WXAA 1WFYA 3VH4B 3SHQA 1E7UA 1OGWA 4KZ0A 2OOBB 5DCNA 1AARA 2ZEQA 5TR5A 1OTRB 3QCAA 3ZO5B 4MDKE 2PJHA 2K39A 2LASA 3DBLI 3PLVA 3QK0A 2JZZA 2M8SA 2W9NA 3QHTA 2BGFA 1G6JA 1L7YA 1XT9B 4W9LA 1WMHB 3AU4A 4IM3A 3PPAA 4NQLB 1S3SG 1RRBA 2NS5A 4W9FA 3VTVA 4A20A 4TQ1A 4MELA 2BWES 2MP2B 4EZJA 2K6QA 1GG3A 2KDEB 2LRUA 2WX1A 2N9EB 3APDA 2NPTA 2WYQA 4FA6A 3V62A 4E71A 3T9LA 4LDTB 2C7NB 3PV1A 2FIDA 2D2QA 4WQOB 1J8CA 1UZXB 3TIXA 3W1YA 1C3TA 4GB9A 4ANXA 4JQWC 3ZLZA 3ZTDA 3RD2A 1ZW7A 1YIWA 4WJOA 4PYZA 4K1RB 1HE8A 2RSUA 4MGKE 3T8MA 4BFRA 2IYDB 3AULA 1WGYA 4LDTD 1Q1OA 2MX2A 4CYEA 4PS3A 5DPWA 1H4RA 2LJ5A 1TTNA 2DZKA 3KUDB 1WR6E 4KVGB 3M62B 1WZ3A 3GOEA 3QA8A 3RZWC 2VRRB 4PYUA 4HPMB 2PPHA 4FN2A 2ZVOA 5J17A 5JZEB 2Z0EB 2RR9A 2LI5A 3KYDD 1YQBA
chains in the Genus database with same CATH superfamily
4KDLB 1T0QC 3UIPB 1E10A 2JYTA 2H89B 2V3PA 2WQYB 4HPPA 4RCOA 4F8CB 3JW0X 2GMIC 2XEWA 2CJNA 3ZQ4A 4C56C 1MHHE 1IBXA 2IGHA 3R2TA 1Q10A 4A55A 2WLBA 2PLPA 4DDGD 2ACZB 4K3BA 5AZFA 1QOFA 1QZEA 1KTKA 1BT0A 1E5WA 3AM9A 5BO4B 1ENFA 3IFWB 1EWCA 3HRDD 1R4MI 2WXOA 4AQ7A 4MJSB 2BQQA 2KC1A 4OVZA 3U7DA 2X8XX 3HVZA 1WH3A 1ZKHA 2WXPA 4X57B 3PO0A 1GC6A 2D07B 5D6JB 3R3MA 1NDDA 2LUEA 1P1AA 4FHJA 3DVGX 4IM2A 1YNTE 1YN4A 1DOYA 2CS4A 3GZNI 1VZ7A 3W1SA 2H88B 3RYTA 1D5XC 1C1YB 1ACCA 3ML8A 4ANWA 2B76B 2WDQB 1WMHA 2PKOA 3FC4A 4ICUA 1RLFA 4K7UA 3V05A 3DHHC 3PREA 3ZTCA 1TT5B 3PRPB 4N6EB 3TJPA 2LZ6A 3IT4B 4L23A 1HTOA 2RDGA 3V60A 2A4ZA 4ICVA 4ZRPA 3BZDB 2BB6A 3ZXVA 4OVVA 4TUUA 4FBJB 2C5LC 2DAJA 4GN1A 5EE9A 4NJCA 2GBRA 1GAQB 2WXHA 2OHFA 3VR8B 1TY0A 3VHTC 3ZNHB 2LVPA 3Q2AC 4LTUA 2GBMA 5C1ZA 3WAPA 3KW5B 3PTFC 3KLSX 3V6EB 2Q5WD 2ZVNA 4DXGA 3DBSA 3PVLA 3NY5A 2JRHA 3OJ4B 3UGBB 2MBOA 3EHVA 5D2MB 4IKGA 4C4VB 1TS3A 3BINA 2DZJA 3I57A 1TKEA 2OJRA 3UI3A 1FCCC 4PS8A 1NYRA 2MSED 2JZPA 4HWIB 5EE1A 1J0GA 1V1PA 1T5XD 4YL8A 5E6NA 3ONSA 4B0MA 4YSYB 3ABVB 3FILB 1OEYJ 2PVOD 3MJ5A 2KJ6A 4KDIC 3PT2B 2OJWA 2I2YA 4RM9A 2KDFB 3AE9B 4JIOU 1UWMA 2DENB 1GOZA 1VCBA 2RPVA 1HA5A 1JRUA 4QAYA 1UH6A 1E8YA 3NOBA 3QX1A 1PQSA 2LGXA 2BB5A 2EKIA 4KX6B 2K3UA 3VR9B 3AEAB 1JWBD 3DPDA 5I4DA 1YJIA 2BKFA 1UF0A 3H6NA 3W2DA 4II3B 1OQQA 2WXGA 2K1FA 4BOSC 2NTTA 1SF0A 1XXGA 3IHPC 4D2KA 3VXWA 4DWFA 2LVQA 3RMKC 4TQ0A 2MBHA 1DGJA 2KK8A 2QIEB 1V1PB 1ESFA 4OVUA 4YSXB 2L3ZA 2IGDA 2KFKB 4TV3A 4WJNA 1FM0D 3ZW3A 4W9KA 1Z5SB 3AEGB 4LK0M 4P7IA 2MJDA 2BTEA 2J52A 4BZAA 4NY0A 2Y3AA 1WXVA 1XLPA 5E6OA 3ZDMC 3MTNB 4C4VA 2UYZB 5MPOA 2BS4B 1E90A 1V8CA 3DVNV 3Q8AA 4W9HA 1F0ZA 2ZW0A 4XYCA 3Q3NC 1F1HA 2KTRA 1D3ZA 4B0EA 4CO7A 3QQ8B 5JXVA 1ZDXA 5FR6A 4HEA1 5CHVC 3O65B 2YVCA 1E8WA 3CMMB 2MH7A 1YJ1A 1WE7A 1WY8A 2D10A 1NEKB 2WXLA 3H1UA 1CZPA 2N4FA 4AUQC 1SIFA 5TSSA 3GE3C 4MSMB 4ZDVA 4KSLC 3N32A 2AEHA 3K9PB 5KHQA 3DOWA 5AUIA 3MHSD 1K52A 4W9IA 1WX7A 3AE2B 2ZZPB 1V9JA 4NJ7A 1PUTA 1KF6B 1I4GA 3GS2A 3A9JB 2D3CA 5AZHA 5BMGA 4A6QA 3R66C 2K8BA 1TKYA 3GE8C 4NAWA 1AW7A 1FXIA 1MVKA 4S17A 1TZ1A 4HRSA 2GOWA 1E9MA 1GUAB 2MCNB 4LNFA 3PRZA 4MEMA 1JROA 1WZ0A 1R7SA 3DBRI 3JYUA 3EECA 3WALA 2V4LA 1OEYA 2HJ1A 2K6DB 3KWVA 5L95C 4P6VF 2JVCA 1JALA 2PMVA 3HIZA 4W9JA 4NJ6A 5G55A 1FNVA 2IDYA 1PDXA 4JL9A 3T3NA 4RGNA 3QAQA 4NAWB 1UWXA 4H2AA 2KMAA 4DHZE 2KVZA 1U4AA 3BK2A 4HDQA 2N1VA 4OZCA 2KO3A 2V3SA 4TMAB 1JCKB 3CSFA 1JMLA 3N9YC 2FCSA 3WA0A 2D3BA 4G3XB 4LJOB 2L8JA 3RN9C 3L16A 1WXAA 3VH4B 5G5HA 2JU6X 4KZ0A 1IBXB 3Q8BA 3QCAA 5GXGB 2LASA 1RWSA 2W9NA 1G6JA 4W9LA 1BXTA 3VTVA 4W9FA 4EZJA 1KH0A 4PK1A 4WQOB 1J8CA 4ANXA 2LGSA 4JQWC 1ZW7A 1YIWA 1GPXA 3AN1A 2RSUA 1D4BA 4MGKE 3AULA 1Q1OA 4CYEA 4PS3A 5FK9C 1TTNA 3U7ZA 1TJEA 1VDVA 4N58A 1EU3A 4KGSA 3R7RA 4NAMA 3HVDA 2MQJA 2Z59B 2J4XA 2LVOA 3AE4B 1ISNA 2CHXA 2L0TA 2IY1B 1GB4A 1T0SC 3OG5A 2YEPF 3ETRA 3J9CA 1STEA 2KVRA 2LRWA 1WX9A 1ZPSA 1YQ4B 2LHEA 3FAHA 1WJ4A 3NZUA 1M94A 4ZYNA 3N30A 4MGYE 2INNE 1N62A 4HLEA 4YTPB 4E74A 1A70A 4K7SA 5BYSA 2LEKA 2WXQA 3CWIA 4KSKC 1ET6A 5IKCM 1R4NB 3L0WB 1CQVA 5C2TB 1FMAD 2BWFA 4WJQA 3ZNGC 3U4EG 3AE1B 4WWOA 2LHDA 2NTSA 3C0RB 1CMXB 2AL6A 2ON8A 3BK1A 5CTRC 2RMMA 3A1QB 2G4SA 2KC2A 3M63B 2NBUA 3AECB 3RNBC 4AOFA 3ZDTA 3B2FA 1JW9D 2DBYA 2ZCCA 4YTNB 4C80A 4IC7B 4WAFA 2J0MA 5IA7A 4XWWA 1KLUD 3VUXA 1WGGA 2L83A 2XN9C 3B0AA 2AL3A 1T6BX 3DWGC 2L52A 4JLCA 3I5JC 3VRAB 2IO3B 1OFFA 5D94A 1WJ6A 1HXYD 4DXAB 2J7QB 3P4RB 2RDHA 3NS1A 4W9DA 1C78A 5JH5C 2HJ8A 2KJHB 4IW0A 5HI1A 2E6XA 1AYFA 3ZIMA 2C7MB 1SSNA 2WWZA 1K51A 3I3TB 3IAS1 4HJKA 4MACA 3SFEB 3Q6BA 3Q3MC 2NPTB 2PE6B 2MA9B 2DYBA 2GBKA 3HHMA 3U52E 3ZJVA 3ALBA 4GDKA 5J2RA 2M4NA 4URKA 4JPSA 2W54A 2LXCA 2HE7A 5LNK1 3NVYA 1I42A 2DZIA 2LGYA 1JWMD 1KRHA 2C7HA 3A9KB 3MHZA 4WQMA 5H8YE 3UQAA 4DHJB 2QEJC 1IPGA 4J6IA 4IDIA 2M1MA 3AMZA 3NRZA 1YD8U 4G50A 2Y5PA 4B6WA 3HK0A 3P4SB 4FXCA 2INDC 3KWLA 4LLGM 2OEDA 4KZCA 4WH4A 3LDZE 4LNKA 2ZNVC 1TIFA 4ANUA 4BKSD 1E7PB 2AX5A 1EF1A 3MC8A 2SEBD 3MFGA 3PZ8A 3Q3OC 1K8RB 2L76A 2K9XA 3PS6A 2FCMA 2IO1B 1WGRA 2ZNVB 3TEYA 1F52A 3ZRFA 4EKUA 2W3SA 4HKZE 4A3PA 1Q0WB 3B1LX 3AB5A 1XQQA 3ZNID 5D3DA 1I7HA 1I4HA 2KKCA 2KX0A 3A1QA 1EO6A 2IJ0A 4LNNA 4GXBA 1OQYA 2KFKA 1PGAA 3N1XC 2M19A 2WXIA 1T0RC 4OZBA 5EDSA 4KGTA 2IGGA 3JSVB 2LFIA 1FNUA 2ZPYA 2I38A 4IOIE 3X0WA 3APCA 2K8HA 3DDCB 3T9LA 1XCQL 2KN5A 4HK2A 4XX5A 3LYYA 4ACFA 2G45B 4HCPB 4XC2A 1C9FA 1YX6B 1Q5WB 1H8CA 3O13A 2L7RA 4MT5A 2KDIA 5LLIA 3OLMD 5D7GA 3VUYA 4JWSC 2O2VA 3X23A 4GLSC 3OJ3A 2WGSA 3W5VB 1WE6A 3RPFC 1F2RC 2HTME 2JPHA 3SR6A 1WXSA 2M0XA 2LGDA 1N5XA 4FHKA 2XNAC 4WAAA 3V61A 1L0VB 1JRPA 3H8HA 1CJEA 3UF8A 3E56A 2KOXA 4ARCA 3PHXB 1WIAA 2RDBC 1WF9A 4I6NB 4N9F4 1LFDA 3DHGC 1I35A 1D5MC 3DBHI 3JSVA 3P42A 4CQNA 1VJKA 2V1YA 3EFUA 4HKQA 2CKHB 2KLGA 3M3JA 3PRMB 5E6JA 4DHZB 1P98A 2DAFA 4RM8A 5HHDG 3ZVVA 1SBBB 2GLSA 3AE8B 2QDFA 2LXAA 3BVMA 3DVGY 2JXTA 4WWNA 2AYOB 1UD7A 4KKJA 1KM7A 1ET9A 2QHOA 2WNMA 1LM8B 4GGQA 5IOIA 2QILA 3NVZA 4DXFA 2X38A 3ZNZB 1E8XA 4HVBA 1FFVA 3KQ4A 3H7PB 1SE4A 1XF5L 3UINB 2NCNA 3R7QA 3RCZA 2DZMA 3A4RA 4S0RA 5DPRA 2GBNA 1MG4A 2PEAA 4LCDE 3BYYB 1P7FA 3L08A 4GDLA 3RNEC 4GOCA 3RUIB 1I4RA 3SEBA 2MBEA 3A9KA 4JGHB 4ZRJA 3MC9A 3A33B 1ZGUB 1HZ5A 1WFYA 4RF1A 1E7UA 1OGWA 2OOBB 2D5GA 3ZO5B 3FKYA 3DBLI 3QHTA 4WWMA 1DOIA 1PGBA 1WMHB 4IM3A 3PPAA 3TEWA 4TQ1A 2BWES 2MHJA 3RFZB 2NPTA 3V62A 2C7NB 1I4XA 1UZXB 2QCZA 4XGAB 3ZXRA 4GB9A 3VRBB 5IO9A 3ZTDA 3RD2A 4XDDA 4ZHOA 1B9RA 1HE8A 3T8MA 2IYDB 2BS3B 4KGRA 2FBWB 3M62B 2VRRB 4PYUA 4HPMB 1VRAB 3IAM1 2GB1A 2ZVOA 4FN2A 2RR9A 2QSDA 1ZDVA 2N9KA 1YQBA 1ZXHA 1M4VA 4PT5A 3PLUA 2IO0B 3VTWA 1OQRA 3BVGA 1R4MB 1V97A 1QILA 3E9SA 1FD6A 3SD5A 1I4QA 2LGIA 2WXRA 4IG7B 1PGXA 3N20C 2J53A 5AUKA 4F1SA 1V2YA 5L83A 3L4PA 4ZOHC 3TCAA 1TKGA 3EUB2 4B9KA 4REZA 3I63C 3BWUD 1E0ZA 2KNBA 4YSZB 3VDZA 1L5PA 1SE2A 4A8XC 1C4CA 2SAKA 2JSVX 3VFKA 4W9CA 2KYWA 3L17A 5CX3A 1L4DB 1SIJA 1YOVB 3SDLC 1EM7A 1A5RA 3VUWA 4L1BA 2MLBA 1WYWB 4USAA 4RNAA 5JHAA 1IUEA 2WX0A 4YT0B 3AV8A 2N9PC 1NBFC 1WYGA 3CIRB 2ASQA 4MM3A 5E6PA 2M17A 1MJDA 5LXHA 1TYGB 5KHOA 2WDTB 4IUMB 2C9WB 3NHEB 2IO2B 1LGRA 2JY6A 1UUPA 1ZP0B 2KZRA 3IBEA 3Q3FA 3NJTA 2BVCA 3WAMA 2WXMA 4EZLA 1FIQA 2KWUB 4AJWA 2MJEA 1PFDA 5EE0A 2WXKA 2XK5B 2BS2B 3MJWA 2YEPB 1QT9A 3APFA 2CHWA 2EKEC 4A9AA 2BT6A 2K22A 4YWGG 4BBNC 5IN7A 4KV2A 1V6EA 3AEDB 2KANA 4HJGE 4BKSA 1MI0A 1E7VA 1C79A 2JQRB 4ARIA 4JWUC 3FILA 4FJZA 2JZ3B 3RNFC 2MW5A 1JWSD 3TL5A 2BKRB 1SE9A 3Q14C 1IGCA 2JX5A 4XDCA 4DK5A 1CK1A 4P16A 2JWUA 4BAXA 5CHWA 5DPSA 1TY2A 3NZSA 1XCTL 2C60A 3ZGZA 1R4NI 3RULA 2IY0B 1Y8RC 2KFJA 1YX5B 1JQ4A 1P0RA 3DBLB 2KXJA 2O6VB 4WJPA 1L6UA 2MJ3A 4FJYA 4MSQB 2G9HD 1QQRA 4W9EA 3S2AA 1SGHA 2WDRB 4EOYA 3DVNU 2O6VD 5J18A 4F7ZA 1AN8A 1WXQA 1VLBA 3NS8A 2WXFA 4LJPB 2KD0A 2D3AA 4BKGA 4KIKA 1SB3C 1Y56A 1UGMA 3W1SC 1N5WA 3BVZA 3NVWA 4EZKA 2K8CA 2M56B 1L6VA 3VTUA 1SE3A 1GJZA 4UDUC 2Z8LA 3I9V1 1RFKA 4KIKB 2N7DA 4XE0A 2G1EA 3QC8B 3LB8C 5LXIB 3VVWB 5DPTA 2J0KA 5AZGA 4KKIA 1FRRA 3WIMA 3K9OB 3RZFA 1BMLC 1LQBA 2KLCA 1MG8A 3B08A 4II2B 2KX3A 2JRIB 1FFUA 3EC8A 2BBCA 1P7EA 3PZDA 2KMCA 1LO5D 3N1YC 4NQKE 2A5UA 1WRDB 3KVFB 3QARA 3AEEB 2G3QB 4MJSA 3L10B 5G2NA 3RNGC 2ZJDA 1EF5A 1KFYB 1D5ZC 1QKZA 4AP4C 4ANVA 2KQ4X 4RGOS 3ML9A 1V49A 4L2YA 4JE3B 4YTMB 2DHZA 2BPSA 4G0NB 2D3GA 4NPNA 3MP9A 4M02A 3ZRCA 1B1ZA 2N7EA 1KLGD 2J42A 3BYTB 3MC0B 1WSPA 3L13A 1UGJA 1WWTA 3Q69A 3V3XA 3P4QB 4EUTA 3TUOA 2WHIA 2VH1A 1TS5A 3N3KB 3VAWA 1JWAD 4IWQA 2D11A 3TMPB 1NYQA 3WAOA 3TBLD 1TGZB 2KDBA 3EGRA 4HPLB 1NI2A 1WI0A 3CF6E 1DOXA 1XLQA 2L0FA 4M01A 3KUCB 2KWVB 2JXXA 4ZHPA 2QC8A 4E3CA 2I1JA 5D3IB 3R8BA 2N9LA 1TBEA 1ZXIA 4M0WB 3KYCD 3Q8CA 1X1MA 3JVZX 4A3OA 4US8A 2WS3B 2FAZA 1ZE3D 1FNWA 1WGHA 2HTHA 4RFBA 4BBNF 2PIAA 1KJTA 4M00A 1SXTA 3R2IA 1I4PA 2XBBC 2BYEA 4BOZB 3IXSA 2I1KA 1P9DU 1FXTB 2BYTA 2N7JA 4DHJD 4M8MA 2NVUI 2KHWB 5HKHA 1ZUD2 2KWCA 3ENEA 1XO3A 2KTFA 1FCLA 4OHJA 2JT4B 4EE2A 4LNOA 3GB1A 2V4IB 1QOBA 3CSTA 3RI7C 2Y5CA 1KOTA 1F2RI 4K3CA 3NZ3A 4DBGA 2AQ2B 3SHQA 5DCNA 1AARA 1OTRB 2K39A 3W5UB 2JZZA 2M8SA 4P1CC 2BGFA 1L7YA 1ROEA 1XT9B 3AU4A 4NQLB 1RRBA 2NS5A 3OWEB 4A20A 4MELA 2MP2B 2WX1A 5G5GA 2KDEB 2N9EB 4FA6A 4E71A 2E3TA 2D2QA 1C3TA 3ZLZA 1XEEA 4WJOA 4OW0A 4PYZA 4K1RB 3U2SC 4BFRA 5BYQA 2W3RA 5DPWA 1H4RA 2NMQA 1XLOA 1SJED 1WZ3A 3GOEA 3QA8A 2PPHA 5C3JB 5J17A 5JZEB 1RM6C 1XLNA 3AEFB 2Z0EB 1FXAA 1FPYA 2LI5A 4K7WA 2KQ7A 3C8YA 1YN3A 3A4SC 1T0YA 1GNUA 4WURA 2V3NA 2Z0DB 5HG2A 1SEBD 1RFAA 2INCC 2KT7A 2VH2A 3P4PB 2ICIA 2WXJA 4ZRIA 1QOGA 1EUVB 3AI5A 2DWQA 2DYMA 3LXFA 5C23A 4MH8A 2VZKB 4O1NA 3WANA 3U8ZA 2MBBB 4RH6A 3DWMA 4YXDB 3A9JA 1HTQA 4NZLB 4BKTA 2NBWB 4XWTA 1WR1A 4GDLB 1K50A 4FULA 2ZW1A 4CHKA 2CU3A 2W55A 2AQ3B 2NBVB 2TSSA 3P63A 3DCGA 3HM3A 2R61A 1NENB 2K25A 2N9XA 1WX8A 2GBJA 3H7PA 4FADA 1VZ6A 4GIVA 2MRPA 3H9DA 1RAXA 2FCNA 1FEHA 1WJUA 3UIOB 1UELA 3TEZA 2KDMA 1L0YB 2IZVB 3QJZA 3B2GA 4IWPA 3RNCC 4OZAA 2KACA 4ZRKA 3U30A 3V6CB 2IPKD 4EFOA 1FO4A 4XZ4A 3BY4B 2IBIB 2KQSA 5FKAC 4MGIE 3IVFA 3Q3JA 3RNAC 4G11A 2AQ1B 3PZ7A 4ZYSA 1J7AA 1F77A 2QMTA 4IWOA 4C7YA 3TEXA 2RGFA 4RMAA 4MGZE 1TS2A 2KWDA 2WU2B 4I6PA 5T8IA 2J0JA 2INPE 1TS4A 4GMVA 4TKNA 2DYOA 5EE3A 2CU1A 1WRIA 1L2NA 3KUZA 4K81A 4NNJB 1WXMA 3P1MA 5IP4D 4HXDA 1SJHD 1VZ8A 3NUHB 2N1WA 1C77A 4C00A 1QOAA 2O2VB 1RYJA 3LJ3A 3EA6A 2L05A 1HZ6A 2UU7A 4BVUC 1PYWD 5H92C 2MWSB 1K53A 4MH0E 2LUMA 2RPQA 2PE9A 2R2QA 4US9A 4ASWC 4MM3B 4ITKA 2W82A 4RGTA 2BYVE 2LWPA 1WGKA 2K0PA 1YJJA 1V5TA 3ZJTA 3GP7A 5BMIA 5GMVA 3QIJA 2PW9A 2WXNA 2G4DB 4M8NA 2FNJB 3PHWB 3HM6X 1UNSA 2RD0A 2M0AA 4GU2A 3B9JA 5FR3A 4AWJA 4DQOC 4P1BC 1V1OA 2FCQA 3WCQA 1WM2A 5HFYA 1N63A 1VR9A 1KLVA 2MBQA 3HUIA 3BIID 4RGMA 1N61A 1WGDA 2JUOA 2BYFA 1HEZE 1J7CA 1EU4A 3AE5B 3DQVA 3L54A 3AE6B 2DLBA 4FJVB 1L0XB 1GC7A 1QF6A 1MPEA 5AEKB 1UBIA 4HROA 2K5PA 2CHZA 3Q8EA 1QLBB 1F9JA 2ZPNA 4A90A 1Z2MA 3VQIA 1ZOYB 2JWZA 4WIPA 2HD5B 3DBHB 4W9GA 1D6EC 1VD2A 1WM3A 1V81A 3RT3B 4B95A 3P2BA 1NVID 2FIFA 1IGDA 1EWYC 3TSSA 1IYFA 1C76A 2MEKA 5IAAC 3OAWA 4GDKB 3URYA 1LXDA 2FE8A 1HQRD 3DHIC 2PVGC 1L4ZB 2L1AA 4HDOA 2YLMA 4PS7A 3AE7B 2KN4A 2R2OA 3C19A 1C4AA 2L32A 5CHFA 1WJNA 2BW2A 2EMTA 4DDID 1E8ZA 2AWTA 1J19A 2WDVB 3ZYYX 3UQBA 3EFCA 1N60A 4J3OD 3AH7A 2FUG1 1V86A 3QWZB 3PSEB 2GI9A 4C7ZA 2NR2A 1AWDA 2O6VA 2QJLA 4AJYB 2MP2A 2DX5B 4TSSA 2Y5BB 2EELA 2KJRA 3IG3A 3ZKJC 3ZJUA 4WWPA 4JX1C 2V9HA 2CJOA 2GRIA 1MFWA 4GSWA 3NVVA 4R3DA 1NI3A 1T3QA 1V5OA 1V80A 2REXA 3H7SA 1UBQA 2FUHB 2LD9A 4EEWA 1P3QU 3W9CB 5JHBA 2N0SB 4I6LB 3VH3B 1DYQA 4FLHA 3M95A 1C4PA 2BF8B 1BUIC 1XD3B 3AXCA 2B3AA 2L00B 2KTRB 2EMSA 3SU8X 4IM0A 3SFDB 1YQ3B 3PGEA 4HCNB 2JF5A 2UWQA 2CR5A 3ZUNA 3KH0A 3ECIA 1MHXA 1S1QB 3D32A 1IP9A 2JYEA 3AU5A 2XK5A 2ZCBA 2KAJA 2V0GA 3NG0A 3Q8FA 3GZNB 5BMHA 4LNIA 4M0WA 1N6ZA 1JWUD 1GB1A 5TR5A 2ZEQA 2DNFA 2LJIA 4MDKE 2PJHA 3PLVA 3QK0A 2KMMA 3AE3B 1S3SG 2WU5B 1TZOA 2K6QA 1GG3A 2LRUA 3APDA 4AS1A 2WYQA 1YMHE 4LDTB 2LMCA 2WP9B 4RF0A 4N59A 3PV1A 2FIDA 3N1ZC 1E6EB 3TIXA 3W1YA 2VZKD 1YN5A 3IT6B 3T3OA 2ONQA 1FRDA 4LDTD 1WGYA 2MX2A 4ZRQA 4Q2JA 2LJ5A 1J7BA 2DZKA 3KUDB 1WR6E 4KVGB 2HDEA 3AEBB 5BYRA 3RZWC 2PTLA 3KYDD 3DBRB
chains in the Genus database with same CATH topology
4K7WA 4KDLB 3R7RA 2KQ7A 3A4SC 3UIPB 1T0YA 3PLUA 1GNUA 2IO0B 2Z0DB 3VTWA 1RFAA 2MQJA 2Z59B 3SD5A 4F8CB 4IG7B 2LVOA 3JW0X 1ISNA 4ZRIA 4F1SA 1V2YA 2CHXA 2L0TA 5L83A 2IY1B 1EUVB 2GMIC 3TCAA 3AI5A 2XEWA 2DYMA 5C23A 4B9KA 2KVRA 2LRWA 1WX9A 4DDGD 5AZFA 3WANA 1WJ4A 1QZEA 3U8ZA 2KNBA 2MBBB 3NZUA 1M94A 4ZYNA 3N30A 1BT0A 4MGYE 1E5WA 3VDZA 5BO4B 3A9JA 3IFWB 4HLEA 3VFKA 4BKTA 2NBWB 4E74A 4W9CA 1WR1A 3L17A 4GDLB 1R4MI 4K7SA 4FULA 5CX3A 4CHKA 4MJSB 3SDLC 4KSKC 2NBVB 1A5RA 2KC1A 3DCGA 3VUWA 3U7DA 3HM3A 1WH3A 2MLBA 1ZKHA 2K25A 1WYWB 2N9XA 3L0WB 1WX8A 5JHAA 2GBJA 4X57B 2WX0A 2BWFA 3H7PA 1GC6A 2N9PC 2D07B 4WJQA 1NBFC 5D6JB 3R3MA 3ZNGC 4FADA 1NDDA 2LUEA 1P1AA 4GIVA 4FHJA 3DVGX 4IM2A 2MRPA 3H9DA 4WWOA 2CS4A 3GZNI 1RAXA 3C0RB 2FCNA 3W1SA 1CMXB 3RYTA 2AL6A 1WJUA 3UIOB 1UELA 5CTRC 1C1YB 2ASQA 3ML8A 4ANWA 3A1QB 4MM3A 2G4SA 1WMHA 2IZVB 2KC2A 3M63B 2NBUA 3QJZA 4IWPA 5E6PA 2M17A 5LXHA 4ICUA 1RLFA 4AOFA 4K7UA 3ZDTA 5KHOA 4ZRKA 3U30A 3V6CB 2WDTB 4IUMB 3PREA 2C9WB 3ZTCA 3NHEB 4EFOA 2ZCCA 3PRPB 2IO2B 4XZ4A 2JY6A 2KZRA 2IBIB 3BY4B 2KQSA 4IC7B 3IBEA 3Q3FA 2J0MA 4MGIE 3TJPA 5IA7A 2LZ6A 3IVFA 3Q3JA 3WAMA 4EZLA 2KWUB 4AJWA 3VUXA 4G11A 3V60A 2A4ZA 1WGGA 4ICVA 2XK5B 3MJWA 3B0AA 2AL3A 3APFA 2CHWA 2EKEC 4JLCA 4IWOA 4OVVA 4BBNC 2IO3B 4TUUA 4KV2A 4FBJB 5D94A 2C5LC 2DAJA 4GN1A 1V6EA 2KANA 1WJ6A 4BKSA 2GBRA 2RGFA 4RMAA 4MGZE 4DXAB 2J7QB 4I6PA 4W9DA 1E7VA 2J0JA 5JH5C 2HJ8A 2KJHB 4IW0A 3ZIMA 3VHTC 3ZNHB 4GMVA 4TKNA 2DYOA 4FJZA 2C7MB 2CU1A 2JZ3B 2WWZA 1L2NA 2LVPA 3KUZA 3I3TB 2MW5A 4HJKA 3TL5A 2BKRB 4K81A 4NNJB 1WXMA 1SE9A 4HXDA 2GBMA 5C1ZA 2NPTB 2PE6B 2MA9B 3WAPA 4DK5A 2DYBA 3KW5B 2GBKA 3HHMA 2N1WA 3PTFC 3V6EB 3ALBA 2O2VB 4GDKA 3LJ3A 2ZVNA 3DBSA 3PVLA 3NY5A 2M4NA 2JRHA 4URKA 2L05A 5J2RA 5CHWA 2LXCA 3OJ4B 2HE7A 5DPSA 3UGBB 4BVUC 2MBOA 3NZSA 3EHVA 2MWSB 2C60A 5D2MB 1R4NI 1I42A 3BINA 4MH0E 3RULA 2DZJA 2RPQA 2PE9A 2DZIA 2IY0B 2R2QA 4ASWC 1Y8RC 2KFJA 2OJRA 1YX5B 4PS8A 2LGYA 1P0RA 2MSED 4HWIB 2KXJA 2O6VB 4WJPA 2C7HA 2BYVE 2LWPA 3A9KB 3UQAA 4FJYA 4MSQB 4DHJB 1J0GA 1IPGA 4J6IA 4W9EA 1V5TA 3S2AA 1SGHA 2M1MA 4YL8A 5E6NA 3ONSA 4EOYA 3DVNU 2O6VD 1OEYJ 5J18A 1YD8U 4F7ZA 4G50A 5GMVA 2KJ6A 4KDIC 4B6WA 3PT2B 3QIJA 3NS8A 3HK0A 2KDFB 4RM9A 2G4DB 2DENB 4JIOU 4M8NA 1VCBA 2FNJB 3PHWB 4LJPB 3HM6X 2KD0A 2RD0A 4BKGA 1JRUA 4GU2A 4KIKA 4KZCA 1UH6A 1UGMA 1E8YA 3LDZE 3NOBA 3QX1A 2ZNVC 3W1SC 2LGXA 1PQSA 4AWJA 4ANUA 4EZKA 4BKSD 2K8CA 1EF1A 2FCQA 1WM2A 3DPDA 3VTUA 2BKFA 1KLVA 1GJZA 2MBQA 1K8RB 1WGDA 2L76A 3H6NA 3PS6A 4II3B 2N7DA 4KIKB 2JUOA 2FCMA 2BYFA 2IO1B 1WGRA 2K1FA 3IHPC 4BOSC 2ZNVB 3VXWA 3DQVA 4DWFA 3ZRFA 4EKUA 3L54A 3QC8B 4A3PA 2LVQA 5LXIB 1Q0WB 3VVWB 3B1LX 4FJVB 4TQ0A 1XQQA 5DPTA 2J0KA 1GC7A 5AZGA 3ZNID 5AEKB 1UBIA 2KKCA 2KX0A 3A1QA 2CHZA 2MBHA 1EO6A 2KK8A 1F9JA 3WIMA 2ZPNA 4GXBA 4OVUA 1OQYA 3K9OB 3RZFA 1LQBA 2L3ZA 2KFKA 2KFKB 2KLCA 1MG8A 4TV3A 4WJNA 3ZW3A 3B08A 5EDSA 4W9KA 1Z2MA 1Z5SB 4P7IA 3VQIA 4II2B 3JSVB 2KX3A 2JRIB 4NY0A 2JWZA 1WXVA 3EC8A 2ZPYA 3X0WA 5E6OA 2HD5B 3APCA 4W9GA 1VD2A 2KMCA 3PZDA 3ZDMC 2K8HA 1WM3A 3DDCB 3MTNB 1V81A 4NQKE 2A5UA 2UYZB 3RT3B 4HK2A 2KN5A 4XX5A 4B95A 1WRDB 1E90A 3DVNV 4W9HA 2G45B 3P2BA 4HCPB 4XC2A 3KVFB 1YX6B 1Q5WB 3QARA 2FIFA 1H8CA 2KTRA 2L7RA 1D3ZA 1IYFA 2KDIA 5LLIA 2G3QB 5IAAC 3OLMD 3OAWA 4MJSA 5D7GA 3VUYA 4CO7A 3QQ8B 2O2VA 3L10B 4GDKB 5G2NA 2ZJDA 1EF5A 5FR6A 5CHVC 1LXDA 3O65B 2YVCA 3X23A 1E8WA 4ANVA 3OJ3A 4AP4C 3CMMB 1YJ1A 1WE7A 4HDOA 2YLMA 1WE6A 4PS7A 1WY8A 3ML9A 1V49A 2JPHA 1WXSA 2D10A 2DHZA 2M0XA 3H1UA 2BPSA 2LGDA 2D3GA 2R2OA 4FHKA 4G0NB 4NPNA 4WAAA 3ZRCA 3V61A 5CHFA 2N4FA 1WJNA 4AUQC 2EMTA 2N7EA 3UF8A 4DDID 1E8ZA 2KOXA 3PHXB 3L13A 1WIAA 2AWTA 1SIFA 1J19A 1WF9A 4I6NB 4MSMB 4ZDVA 4KSLC 4N9F4 1LFDA 3N32A 2AEHA 3UQBA 3K9PB 4EUTA 5KHQA 3DOWA 1I35A 3DBHI 3MHSD 3JSVA 4W9IA 2V1YA 3EFUA 3N3KB 1WX7A 3VAWA 2ZZPB 1V9JA 1V86A 2CKHB 4IWQA 4NJ7A 2D11A 3QWZB 3PSEB 3TMPB 2KLGA 3A9JB 3M3JA 3WAOA 2NR2A 3PRMB 2O6VA 3TBLD 4AJYB 4DHZB 5AZHA 1P98A 2MP2A 2DAFA 4RM8A 2DX5B 3ZVVA 1TGZB 3R66C 2KDBA 2K8BA 2Y5BB 2KJRA 3IG3A 2LXAA 3ZKJC 4NAWA 4HPLB 4WWPA 3DVGY 1NI2A 1WI0A 3CF6E 1TZ1A 2L0FA 4GSWA 4WWNA 2AYOB 2GOWA 1UD7A 3KUCB 2KWVB 2JXXA 1GUAB 2MCNB 4E3CA 2I1JA 3PRZA 1KM7A 1V5OA 1V80A 4MEMA 2REXA 3H7SA 1TBEA 2QHOA 4M0WB 3KYCD 1LM8B 1UBQA 2FUHB 2LD9A 4GGQA 1X1MA 1WZ0A 3JVZX 4EEWA 4A3OA 1P3QU 3DBRI 3JYUA 5JHBA 3EECA 3WALA 2V4LA 4I6LB 1OEYA 3VH3B 2FAZA 4FLHA 3M95A 2BF8B 1XD3B 3AXCA 1WGHA 2HTHA 4BBNF 3ZNZB 1E8XA 1KJTA 2K6DB 2B3AA 5L95C 2L00B 4HVBA 2JVCA 2XBBC 2BYEA 4BOZB 3H7PB 2KTRB 3HIZA 2EMSA 2NCNA 4NJ6A 4W9JA 3RCZA 3R7QA 5G55A 3UINB 3SU8X 4IM0A 2I1KA 1P9DU 1FXTB 2DZMA 4JL9A 3A4RA 3PGEA 4DHJD 4HCNB 4M8MA 5DPRA 2JF5A 3QAQA 2GBNA 2NVUI 2UWQA 2KHWB 4NAWB 5HKHA 2KWCA 2CR5A 2PEAA 3ZUNA 3KH0A 4LCDE 3ENEA 3ECIA 2KMAA 4DHZE 2KTFA 3L08A 1S1QB 1U4AA 4GDLA 2JT4B 3D32A 4GOCA 3RUIB 1IP9A 4HDQA 2N1VA 3AU5A 2XK5A 2MBEA 2ZCBA 3CSTA 2KO3A 2V3SA 3A9KA 4JGHB 3CSFA 4ZRJA 3A33B 2FCSA 3WA0A 4G3XB 4LJOB 2L8JA 1KOTA 1ZGUB 4DBGA 3L16A 1WXAA 1WFYA 3VH4B 3SHQA 1E7UA 1OGWA 4KZ0A 2OOBB 5DCNA 1AARA 2ZEQA 5TR5A 1OTRB 3QCAA 3ZO5B 4MDKE 2PJHA 2K39A 2LASA 3DBLI 3PLVA 3QK0A 2JZZA 2M8SA 2W9NA 3QHTA 2BGFA 1G6JA 1L7YA 1XT9B 4W9LA 1WMHB 3AU4A 4IM3A 3PPAA 4NQLB 1S3SG 1RRBA 2NS5A 4W9FA 3VTVA 4A20A 4TQ1A 4MELA 2BWES 2MP2B 4EZJA 2K6QA 1GG3A 2KDEB 2LRUA 2WX1A 2N9EB 3APDA 2NPTA 2WYQA 4FA6A 3V62A 4E71A 3T9LA 4LDTB 2C7NB 3PV1A 2FIDA 2D2QA 4WQOB 1J8CA 1UZXB 3TIXA 3W1YA 1C3TA 4GB9A 4ANXA 4JQWC 3ZLZA 3ZTDA 3RD2A 1ZW7A 1YIWA 4WJOA 4PYZA 4K1RB 1HE8A 2RSUA 4MGKE 3T8MA 4BFRA 2IYDB 3AULA 1WGYA 4LDTD 1Q1OA 2MX2A 4CYEA 4PS3A 5DPWA 1H4RA 2LJ5A 1TTNA 2DZKA 3KUDB 1WR6E 4KVGB 3M62B 1WZ3A 3GOEA 3QA8A 3RZWC 2VRRB 4PYUA 4HPMB 2PPHA 4FN2A 2ZVOA 5J17A 5JZEB 2Z0EB 2RR9A 2LI5A 3KYDD 1YQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7W A;  4KDL B;  3R7R A;  2KQ7 A;  3A4S C;  3UIP B;  1T0Y A;  3PLU A;  1GNU A;  2IO0 B;  2Z0D B;  3VTW A;  1RFA A;  2MQJ A;  2Z59 B;  3SD5 A;  4F8C B;  4IG7 B;  2LVO A;  3JW0 X;  1ISN A;  4ZRI A;  4F1S A;  1V2Y A;  2CHX A;  2L0T A;  5L83 A;  2IY1 B;  1EUV B;  2GMI C;  3TCA A;  3AI5 A;  2XEW A;  2DYM A;  5C23 A;  4B9K A;  2KVR A;  2LRW A;  1WX9 A;  4DDG D;  5AZF A;  3WAN A;  1WJ4 A;  1QZE A;  3U8Z A;  2KNB A;  2MBB B;  3NZU A;  1M94 A;  4ZYN A;  3N30 A;  1BT0 A;  4MGY E;  1E5W A;  3VDZ A;  5BO4 B;  3A9J A;  3IFW B;  4HLE A;  3VFK A;  4BKT A;  2NBW B;  4E74 A;  4W9C A;  1WR1 A;  3L17 A;  4GDL B;  1R4M I;  4K7S A;  4FUL A;  5CX3 A;  4CHK A;  4MJS B;  3SDL C;  4KSK C;  2NBV B;  1A5R A;  2KC1 A;  3DCG A;  3VUW A;  3U7D A;  3HM3 A;  1WH3 A;  2MLB A;  1ZKH A;  2K25 A;  1WYW B;  2N9X A;  3L0W B;  1WX8 A;  5JHA A;  2GBJ A;  4X57 B;  2WX0 A;  2BWF A;  3H7P A;  1GC6 A;  2N9P C;  2D07 B;  4WJQ A;  1NBF C;  5D6J B;  3R3M A;  3ZNG C;  4FAD A;  1NDD A;  2LUE A;  1P1A A;  4GIV A;  4FHJ A;  3DVG X;  4IM2 A;  2MRP A;  3H9D A;  4WWO A;  2CS4 A;  3GZN I;  1RAX A;  3C0R B;  2FCN A;  3W1S A;  1CMX B;  3RYT A;  2AL6 A;  1WJU A;  3UIO B;  1UEL A;  5CTR C;  1C1Y B;  2ASQ A;  3ML8 A;  4ANW A;  3A1Q B;  4MM3 A;  2G4S A;  1WMH A;  2IZV B;  2KC2 A;  3M63 B;  2NBU A;  3QJZ A;  4IWP A;  5E6P A;  2M17 A;  5LXH A;  4ICU A;  1RLF A;  4AOF A;  4K7U A;  3ZDT A;  5KHO A;  4ZRK A;  3U30 A;  3V6C B;  2WDT B;  4IUM B;  3PRE A;  2C9W B;  3ZTC A;  3NHE B;  4EFO A;  2ZCC A;  3PRP B;  2IO2 B;  4XZ4 A;  2JY6 A;  2KZR A;  2IBI B;  3BY4 B;  2KQS A;  4IC7 B;  3IBE A;  3Q3F A;  2J0M A;  4MGI E;  3TJP A;  5IA7 A;  2LZ6 A;  3IVF A;  3Q3J A;  3WAM A;  4EZL A;  2KWU B;  4AJW A;  3VUX A;  4G11 A;  3V60 A;  2A4Z A;  1WGG A;  4ICV A;  2XK5 B;  3MJW A;  3B0A A;  2AL3 A;  3APF A;  2CHW A;  2EKE C;  4JLC A;  4IWO A;  4OVV A;  4BBN C;  2IO3 B;  4TUU A;  4KV2 A;  4FBJ B;  5D94 A;  2C5L C;  2DAJ A;  4GN1 A;  1V6E A;  2KAN A;  1WJ6 A;  4BKS A;  2GBR A;  2RGF A;  4RMA A;  4MGZ E;  4DXA B;  2J7Q B;  4I6P A;  4W9D A;  1E7V A;  2J0J A;  5JH5 C;  2HJ8 A;  2KJH B;  4IW0 A;  3ZIM A;  3VHT C;  3ZNH B;  4GMV A;  4TKN A;  2DYO A;  4FJZ A;  2C7M B;  2CU1 A;  2JZ3 B;  2WWZ A;  1L2N A;  2LVP A;  3KUZ A;  3I3T B;  2MW5 A;  4HJK A;  3TL5 A;  2BKR B;  4K81 A;  4NNJ B;  1WXM A;  1SE9 A;  4HXD A;  2GBM A;  5C1Z A;  2NPT B;  2PE6 B;  2MA9 B;  3WAP A;  4DK5 A;  2DYB A;  3KW5 B;  2GBK A;  3HHM A;  2N1W A;  3PTF C;  3V6E B;  3ALB A;  2O2V B;  4GDK A;  3LJ3 A;  2ZVN A;  3DBS A;  3PVL A;  3NY5 A;  2M4N A;  2JRH A;  4URK A;  2L05 A;  5J2R A;  5CHW A;  2LXC A;  3OJ4 B;  2HE7 A;  5DPS A;  3UGB B;  4BVU C;  2MBO A;  3NZS A;  3EHV A;  2MWS B;  2C60 A;  5D2M B;  1R4N I;  1I42 A;  3BIN A;  4MH0 E;  3RUL A;  2DZJ A;  2RPQ A;  2PE9 A;  2DZI A;  2IY0 B;  2R2Q A;  4ASW C;  1Y8R C;  2KFJ A;  2OJR A;  1YX5 B;  4PS8 A;  2LGY A;  1P0R A;  2MSE D;  4HWI B;  2KXJ A;  2O6V B;  4WJP A;  2C7H A;  2BYV E;  2LWP A;  3A9K B;  3UQA A;  4FJY A;  4MSQ B;  4DHJ B;  1J0G A;  1IPG A;  4J6I A;  4W9E A;  1V5T A;  3S2A A;  1SGH A;  2M1M A;  4YL8 A;  5E6N A;  3ONS A;  4EOY A;  3DVN U;  2O6V D;  1OEY J;  5J18 A;  1YD8 U;  4F7Z A;  4G50 A;  5GMV A;  2KJ6 A;  4KDI C;  4B6W A;  3PT2 B;  3QIJ A;  3NS8 A;  3HK0 A;  2KDF B;  4RM9 A;  2G4D B;  2DEN B;  4JIO U;  4M8N A;  1VCB A;  2FNJ B;  3PHW B;  4LJP B;  3HM6 X;  2KD0 A;  2RD0 A;  4BKG A;  1JRU A;  4GU2 A;  4KIK A;  4KZC A;  1UH6 A;  1UGM A;  1E8Y A;  3LDZ E;  3NOB A;  3QX1 A;  2ZNV C;  3W1S C;  2LGX A;  1PQS A;  4AWJ A;  4ANU A;  4EZK A;  4BKS D;  2K8C A;  1EF1 A;  2FCQ A;  1WM2 A;  3DPD A;  3VTU A;  2BKF A;  1KLV A;  1GJZ A;  2MBQ A;  1K8R B;  1WGD A;  2L76 A;  3H6N A;  3PS6 A;  4II3 B;  2N7D A;  4KIK B;  2JUO A;  2FCM A;  2BYF A;  2IO1 B;  1WGR A;  2K1F A;  3IHP C;  4BOS C;  2ZNV B;  3VXW A;  3DQV A;  4DWF A;  3ZRF A;  4EKU A;  3L54 A;  3QC8 B;  4A3P A;  2LVQ A;  5LXI B;  1Q0W B;  3VVW B;  3B1L X;  4FJV B;  4TQ0 A;  1XQQ A;  5DPT A;  2J0K A;  1GC7 A;  5AZG A;  3ZNI D;  5AEK B;  1UBI A;  2KKC A;  2KX0 A;  3A1Q A;  2CHZ A;  2MBH A;  1EO6 A;  2KK8 A;  1F9J A;  3WIM A;  2ZPN A;  4GXB A;  4OVU A;  1OQY A;  3K9O B;  3RZF A;  1LQB A;  2L3Z A;  2KFK A;  2KFK B;  2KLC A;  1MG8 A;  4TV3 A;  4WJN A;  3ZW3 A;  3B08 A;  5EDS A;  4W9K A;  1Z2M A;  1Z5S B;  4P7I A;  3VQI A;  4II2 B;  3JSV B;  2KX3 A;  2JRI B;  4NY0 A;  2JWZ A;  1WXV A;  3EC8 A;  2ZPY A;  3X0W A;  5E6O A;  2HD5 B;  3APC A;  4W9G A;  1VD2 A;  2KMC A;  3PZD A;  3ZDM C;  2K8H A;  1WM3 A;  3DDC B;  3MTN B;  1V81 A;  4NQK E;  2A5U A;  2UYZ B;  3RT3 B;  4HK2 A;  2KN5 A;  4XX5 A;  4B95 A;  1WRD B;  1E90 A;  3DVN V;  4W9H A;  2G45 B;  3P2B A;  4HCP B;  4XC2 A;  3KVF B;  1YX6 B;  1Q5W B;  3QAR A;  2FIF A;  1H8C A;  2KTR A;  2L7R A;  1D3Z A;  1IYF A;  2KDI A;  5LLI A;  2G3Q B;  5IAA C;  3OLM D;  3OAW A;  4MJS A;  5D7G A;  3VUY A;  4CO7 A;  3QQ8 B;  2O2V A;  3L10 B;  4GDK B;  5G2N A;  2ZJD A;  1EF5 A;  5FR6 A;  5CHV C;  1LXD A;  3O65 B;  2YVC A;  3X23 A;  1E8W A;  4ANV A;  3OJ3 A;  4AP4 C;  3CMM B;  1YJ1 A;  1WE7 A;  4HDO A;  2YLM A;  1WE6 A;  4PS7 A;  1WY8 A;  3ML9 A;  1V49 A;  2JPH A;  1WXS A;  2D10 A;  2DHZ A;  2M0X A;  3H1U A;  2BPS A;  2LGD A;  2D3G A;  2R2O A;  4FHK A;  4G0N B;  4NPN A;  4WAA A;  3ZRC A;  3V61 A;  5CHF A;  2N4F A;  1WJN A;  4AUQ C;  2EMT A;  2N7E A;  3UF8 A;  4DDI D;  1E8Z A;  2KOX A;  3PHX B;  3L13 A;  1WIA A;  2AWT A;  1SIF A;  1J19 A;  1WF9 A;  4I6N B;  4MSM B;  4ZDV A;  4KSL C;  4N9F 4;  1LFD A;  3N32 A;  2AEH A;  3UQB A;  3K9P B;  4EUT A;  5KHQ A;  3DOW A;  1I35 A;  3DBH I;  3MHS D;  3JSV A;  4W9I A;  2V1Y A;  3EFU A;  3N3K B;  1WX7 A;  3VAW A;  2ZZP B;  1V9J A;  1V86 A;  2CKH B;  4IWQ A;  4NJ7 A;  2D11 A;  3QWZ B;  3PSE B;  3TMP B;  2KLG A;  3A9J B;  3M3J A;  3WAO A;  2NR2 A;  3PRM B;  2O6V A;  3TBL D;  4AJY B;  4DHZ B;  5AZH A;  1P98 A;  2MP2 A;  2DAF A;  4RM8 A;  2DX5 B;  3ZVV A;  1TGZ B;  3R66 C;  2KDB A;  2K8B A;  2Y5B B;  2KJR A;  3IG3 A;  2LXA A;  3ZKJ C;  4NAW A;  4HPL B;  4WWP A;  3DVG Y;  1NI2 A;  1WI0 A;  3CF6 E;  1TZ1 A;  2L0F A;  4GSW A;  4WWN A;  2AYO B;  2GOW A;  1UD7 A;  3KUC B;  2KWV B;  2JXX A;  1GUA B;  2MCN B;  4E3C A;  2I1J A;  3PRZ A;  1KM7 A;  1V5O A;  1V80 A;  4MEM A;  2REX A;  3H7S A;  1TBE A;  2QHO A;  4M0W B;  3KYC D;  1LM8 B;  1UBQ A;  2FUH B;  2LD9 A;  4GGQ A;  1X1M A;  1WZ0 A;  3JVZ X;  4EEW A;  4A3O A;  1P3Q U;  3DBR I;  3JYU A;  5JHB A;  3EEC A;  3WAL A;  2V4L A;  4I6L B;  1OEY A;  3VH3 B;  2FAZ A;  4FLH A;  3M95 A;  2BF8 B;  1XD3 B;  3AXC A;  1WGH A;  2HTH A;  4BBN F;  3ZNZ B;  1E8X A;  1KJT A;  2K6D B;  2B3A A;  5L95 C;  2L00 B;  4HVB A;  2JVC A;  2XBB C;  2BYE A;  4BOZ B;  3H7P B;  2KTR B;  3HIZ A;  2EMS A;  2NCN A;  4NJ6 A;  4W9J A;  3RCZ A;  3R7Q A;  5G55 A;  3UIN B;  3SU8 X;  4IM0 A;  2I1K A;  1P9D U;  1FXT B;  2DZM A;  4JL9 A;  3A4R A;  3PGE A;  4DHJ D;  4HCN B;  4M8M A;  5DPR A;  2JF5 A;  3QAQ A;  2GBN A;  2NVU I;  2UWQ A;  2KHW B;  4NAW B;  5HKH A;  2KWC A;  2CR5 A;  2PEA A;  3ZUN A;  3KH0 A;  4LCD E;  3ENE A;  3ECI A;  2KMA A;  4DHZ E;  2KTF A;  3L08 A;  1S1Q B;  1U4A A;  4GDL A;  2JT4 B;  3D32 A;  4GOC A;  3RUI B;  1IP9 A;  4HDQ A;  2N1V A;  3AU5 A;  2XK5 A;  2MBE A;  2ZCB A;  3CST A;  2KO3 A;  2V3S A;  3A9K A;  4JGH B;  3CSF A;  4ZRJ A;  3A33 B;  2FCS A;  3WA0 A;  4G3X B;  4LJO B;  2L8J A;  1KOT A;  1ZGU B;  4DBG A;  3L16 A;  1WXA A;  1WFY A;  3VH4 B;  3SHQ A;  1E7U A;  1OGW A;  4KZ0 A;  2OOB B;  5DCN A;  1AAR A;  2ZEQ A;  5TR5 A;  1OTR B;  3QCA A;  3ZO5 B;  4MDK E;  2PJH A;  2K39 A;  2LAS A;  3DBL I;  3PLV A;  3QK0 A;  2JZZ A;  2M8S A;  2W9N A;  3QHT A;  2BGF A;  1G6J A;  1L7Y A;  1XT9 B;  4W9L A;  1WMH B;  3AU4 A;  4IM3 A;  3PPA A;  4NQL B;  1S3S G;  1RRB A;  2NS5 A;  4W9F A;  3VTV A;  4A20 A;  4TQ1 A;  4MEL A;  2BWE S;  2MP2 B;  4EZJ A;  2K6Q A;  1GG3 A;  2KDE B;  2LRU A;  2WX1 A;  2N9E B;  3APD A;  2NPT A;  2WYQ A;  4FA6 A;  3V62 A;  4E71 A;  3T9L A;  4LDT B;  2C7N B;  3PV1 A;  2FID A;  2D2Q A;  4WQO B;  1J8C A;  1UZX B;  3TIX A;  3W1Y A;  1C3T A;  4GB9 A;  4ANX A;  4JQW C;  3ZLZ A;  3ZTD A;  3RD2 A;  1ZW7 A;  1YIW A;  4WJO A;  4PYZ A;  4K1R B;  1HE8 A;  2RSU A;  4MGK E;  3T8M A;  4BFR A;  2IYD B;  3AUL A;  1WGY A;  4LDT D;  1Q1O A;  2MX2 A;  4CYE A;  4PS3 A;  5DPW A;  1H4R A;  2LJ5 A;  1TTN A;  2DZK A;  3KUD B;  1WR6 E;  4KVG B;  3M62 B;  1WZ3 A;  3GOE A;  3QA8 A;  3RZW C;  2VRR B;  4PYU A;  4HPM B;  2PPH A;  4FN2 A;  2ZVO A;  5J17 A;  5JZE B;  2Z0E B;  2RR9 A;  2LI5 A;  3KYD D;  1YQB A; 
#chains in the Genus database with same CATH topology
 4KDL B;  1T0Q C;  3UIP B;  1E10 A;  2JYT A;  2H89 B;  2V3P A;  2WQY B;  4HPP A;  4RCO A;  4F8C B;  3JW0 X;  2GMI C;  2XEW A;  2CJN A;  3ZQ4 A;  4C56 C;  1MHH E;  1IBX A;  2IGH A;  3R2T A;  1Q10 A;  4A55 A;  2WLB A;  2PLP A;  4DDG D;  2ACZ B;  4K3B A;  5AZF A;  1QOF A;  1QZE A;  1KTK A;  1BT0 A;  1E5W A;  3AM9 A;  5BO4 B;  1ENF A;  3IFW B;  1EWC A;  3HRD D;  1R4M I;  2WXO A;  4AQ7 A;  4MJS B;  2BQQ A;  2KC1 A;  4OVZ A;  3U7D A;  2X8X X;  3HVZ A;  1WH3 A;  1ZKH A;  2WXP A;  4X57 B;  3PO0 A;  1GC6 A;  2D07 B;  5D6J B;  3R3M A;  1NDD A;  2LUE A;  1P1A A;  4FHJ A;  3DVG X;  4IM2 A;  1YNT E;  1YN4 A;  1DOY A;  2CS4 A;  3GZN I;  1VZ7 A;  3W1S A;  2H88 B;  3RYT A;  1D5X C;  1C1Y B;  1ACC A;  3ML8 A;  4ANW A;  2B76 B;  2WDQ B;  1WMH A;  2PKO A;  3FC4 A;  4ICU A;  1RLF A;  4K7U A;  3V05 A;  3DHH C;  3PRE A;  3ZTC A;  1TT5 B;  3PRP B;  4N6E B;  3TJP A;  2LZ6 A;  3IT4 B;  4L23 A;  1HTO A;  2RDG A;  3V60 A;  2A4Z A;  4ICV A;  4ZRP A;  3BZD B;  2BB6 A;  3ZXV A;  4OVV A;  4TUU A;  4FBJ B;  2C5L C;  2DAJ A;  4GN1 A;  5EE9 A;  4NJC A;  2GBR A;  1GAQ B;  2WXH A;  2OHF A;  3VR8 B;  1TY0 A;  3VHT C;  3ZNH B;  2LVP A;  3Q2A C;  4LTU A;  2GBM A;  5C1Z A;  3WAP A;  3KW5 B;  3PTF C;  3KLS X;  3V6E B;  2Q5W D;  2ZVN A;  4DXG A;  3DBS A;  3PVL A;  3NY5 A;  2JRH A;  3OJ4 B;  3UGB B;  2MBO A;  3EHV A;  5D2M B;  4IKG A;  4C4V B;  1TS3 A;  3BIN A;  2DZJ A;  3I57 A;  1TKE A;  2OJR A;  3UI3 A;  1FCC C;  4PS8 A;  1NYR A;  2MSE D;  2JZP A;  4HWI B;  5EE1 A;  1J0G A;  1V1P A;  1T5X D;  4YL8 A;  5E6N A;  3ONS A;  4B0M A;  4YSY B;  3ABV B;  3FIL B;  1OEY J;  2PVO D;  3MJ5 A;  2KJ6 A;  4KDI C;  3PT2 B;  2OJW A;  2I2Y A;  4RM9 A;  2KDF B;  3AE9 B;  4JIO U;  1UWM A;  2DEN B;  1GOZ A;  1VCB A;  2RPV A;  1HA5 A;  1JRU A;  4QAY A;  1UH6 A;  1E8Y A;  3NOB A;  3QX1 A;  1PQS A;  2LGX A;  2BB5 A;  2EKI A;  4KX6 B;  2K3U A;  3VR9 B;  3AEA B;  1JWB D;  3DPD A;  5I4D A;  1YJI A;  2BKF A;  1UF0 A;  3H6N A;  3W2D A;  4II3 B;  1OQQ A;  2WXG A;  2K1F A;  4BOS C;  2NTT A;  1SF0 A;  1XXG A;  3IHP C;  4D2K A;  3VXW A;  4DWF A;  2LVQ A;  3RMK C;  4TQ0 A;  2MBH A;  1DGJ A;  2KK8 A;  2QIE B;  1V1P B;  1ESF A;  4OVU A;  4YSX B;  2L3Z A;  2IGD A;  2KFK B;  4TV3 A;  4WJN A;  1FM0 D;  3ZW3 A;  4W9K A;  1Z5S B;  3AEG B;  4LK0 M;  4P7I A;  2MJD A;  2BTE A;  2J52 A;  4BZA A;  4NY0 A;  2Y3A A;  1WXV A;  1XLP A;  5E6O A;  3ZDM C;  3MTN B;  4C4V A;  2UYZ B;  5MPO A;  2BS4 B;  1E90 A;  1V8C A;  3DVN V;  3Q8A A;  4W9H A;  1F0Z A;  2ZW0 A;  4XYC A;  3Q3N C;  1F1H A;  2KTR A;  1D3Z A;  4B0E A;  4CO7 A;  3QQ8 B;  5JXV A;  1ZDX A;  5FR6 A;  4HEA 1;  5CHV C;  3O65 B;  2YVC A;  1E8W A;  3CMM B;  2MH7 A;  1YJ1 A;  1WE7 A;  1WY8 A;  2D10 A;  1NEK B;  2WXL A;  3H1U A;  1CZP A;  2N4F A;  4AUQ C;  1SIF A;  5TSS A;  3GE3 C;  4MSM B;  4ZDV A;  4KSL C;  3N32 A;  2AEH A;  3K9P B;  5KHQ A;  3DOW A;  5AUI A;  3MHS D;  1K52 A;  4W9I A;  1WX7 A;  3AE2 B;  2ZZP B;  1V9J A;  4NJ7 A;  1PUT A;  1KF6 B;  1I4G A;  3GS2 A;  3A9J B;  2D3C A;  5AZH A;  5BMG A;  4A6Q A;  3R66 C;  2K8B A;  1TKY A;  3GE8 C;  4NAW A;  1AW7 A;  1FXI A;  1MVK A;  4S17 A;  1TZ1 A;  4HRS A;  2GOW A;  1E9M A;  1GUA B;  2MCN B;  4LNF A;  3PRZ A;  4MEM A;  1JRO A;  1WZ0 A;  1R7S A;  3DBR I;  3JYU A;  3EEC A;  3WAL A;  2V4L A;  1OEY A;  2HJ1 A;  2K6D B;  3KWV A;  5L95 C;  4P6V F;  2JVC A;  1JAL A;  2PMV A;  3HIZ A;  4W9J A;  4NJ6 A;  5G55 A;  1FNV A;  2IDY A;  1PDX A;  4JL9 A;  3T3N A;  4RGN A;  3QAQ A;  4NAW B;  1UWX A;  4H2A A;  2KMA A;  4DHZ E;  2KVZ A;  1U4A A;  3BK2 A;  4HDQ A;  2N1V A;  4OZC A;  2KO3 A;  2V3S A;  4TMA B;  1JCK B;  3CSF A;  1JML A;  3N9Y C;  2FCS A;  3WA0 A;  2D3B A;  4G3X B;  4LJO B;  2L8J A;  3RN9 C;  3L16 A;  1WXA A;  3VH4 B;  5G5H A;  2JU6 X;  4KZ0 A;  1IBX B;  3Q8B A;  3QCA A;  5GXG B;  2LAS A;  1RWS A;  2W9N A;  1G6J A;  4W9L A;  1BXT A;  3VTV A;  4W9F A;  4EZJ A;  1KH0 A;  4PK1 A;  4WQO B;  1J8C A;  4ANX A;  2LGS A;  4JQW C;  1ZW7 A;  1YIW A;  1GPX A;  3AN1 A;  2RSU A;  1D4B A;  4MGK E;  3AUL A;  1Q1O A;  4CYE A;  4PS3 A;  5FK9 C;  1TTN A;  3U7Z A;  1TJE A;  1VDV A;  4N58 A;  1EU3 A;  4KGS A;  3R7R A;  4NAM A;  3HVD A;  2MQJ A;  2Z59 B;  2J4X A;  2LVO A;  3AE4 B;  1ISN A;  2CHX A;  2L0T A;  2IY1 B;  1GB4 A;  1T0S C;  3OG5 A;  2YEP F;  3ETR A;  3J9C A;  1STE A;  2KVR A;  2LRW A;  1WX9 A;  1ZPS A;  1YQ4 B;  2LHE A;  3FAH A;  1WJ4 A;  3NZU A;  1M94 A;  4ZYN A;  3N30 A;  4MGY E;  2INN E;  1N62 A;  4HLE A;  4YTP B;  4E74 A;  1A70 A;  4K7S A;  5BYS A;  2LEK A;  2WXQ A;  3CWI A;  4KSK C;  1ET6 A;  5IKC M;  1R4N B;  3L0W B;  1CQV A;  5C2T B;  1FMA D;  2BWF A;  4WJQ A;  3ZNG C;  3U4E G;  3AE1 B;  4WWO A;  2LHD A;  2NTS A;  3C0R B;  1CMX B;  2AL6 A;  2ON8 A;  3BK1 A;  5CTR C;  2RMM A;  3A1Q B;  2G4S A;  2KC2 A;  3M63 B;  2NBU A;  3AEC B;  3RNB C;  4AOF A;  3ZDT A;  3B2F A;  1JW9 D;  2DBY A;  2ZCC A;  4YTN B;  4C80 A;  4IC7 B;  4WAF A;  2J0M A;  5IA7 A;  4XWW A;  1KLU D;  3VUX A;  1WGG A;  2L83 A;  2XN9 C;  3B0A A;  2AL3 A;  1T6B X;  3DWG C;  2L52 A;  4JLC A;  3I5J C;  3VRA B;  2IO3 B;  1OFF A;  5D94 A;  1WJ6 A;  1HXY D;  4DXA B;  2J7Q B;  3P4R B;  2RDH A;  3NS1 A;  4W9D A;  1C78 A;  5JH5 C;  2HJ8 A;  2KJH B;  4IW0 A;  5HI1 A;  2E6X A;  1AYF A;  3ZIM A;  2C7M B;  1SSN A;  2WWZ A;  1K51 A;  3I3T B;  3IAS 1;  4HJK A;  4MAC A;  3SFE B;  3Q6B A;  3Q3M C;  2NPT B;  2PE6 B;  2MA9 B;  2DYB A;  2GBK A;  3HHM A;  3U52 E;  3ZJV A;  3ALB A;  4GDK A;  5J2R A;  2M4N A;  4URK A;  4JPS A;  2W54 A;  2LXC A;  2HE7 A;  5LNK 1;  3NVY A;  1I42 A;  2DZI A;  2LGY A;  1JWM D;  1KRH A;  2C7H A;  3A9K B;  3MHZ A;  4WQM A;  5H8Y E;  3UQA A;  4DHJ B;  2QEJ C;  1IPG A;  4J6I A;  4IDI A;  2M1M A;  3AMZ A;  3NRZ A;  1YD8 U;  4G50 A;  2Y5P A;  4B6W A;  3HK0 A;  3P4S B;  4FXC A;  2IND C;  3KWL A;  4LLG M;  2OED A;  4KZC A;  4WH4 A;  3LDZ E;  4LNK A;  2ZNV C;  1TIF A;  4ANU A;  4BKS D;  1E7P B;  2AX5 A;  1EF1 A;  3MC8 A;  2SEB D;  3MFG A;  3PZ8 A;  3Q3O C;  1K8R B;  2L76 A;  2K9X A;  3PS6 A;  2FCM A;  2IO1 B;  1WGR A;  2ZNV B;  3TEY A;  1F52 A;  3ZRF A;  4EKU A;  2W3S A;  4HKZ E;  4A3P A;  1Q0W B;  3B1L X;  3AB5 A;  1XQQ A;  3ZNI D;  5D3D A;  1I7H A;  1I4H A;  2KKC A;  2KX0 A;  3A1Q A;  1EO6 A;  2IJ0 A;  4LNN A;  4GXB A;  1OQY A;  2KFK A;  1PGA A;  3N1X C;  2M19 A;  2WXI A;  1T0R C;  4OZB A;  5EDS A;  4KGT A;  2IGG A;  3JSV B;  2LFI A;  1FNU A;  2ZPY A;  2I38 A;  4IOI E;  3X0W A;  3APC A;  2K8H A;  3DDC B;  3T9L A;  1XCQ L;  2KN5 A;  4HK2 A;  4XX5 A;  3LYY A;  4ACF A;  2G45 B;  4HCP B;  4XC2 A;  1C9F A;  1YX6 B;  1Q5W B;  1H8C A;  3O13 A;  2L7R A;  4MT5 A;  2KDI A;  5LLI A;  3OLM D;  5D7G A;  3VUY A;  4JWS C;  2O2V A;  3X23 A;  4GLS C;  3OJ3 A;  2WGS A;  3W5V B;  1WE6 A;  3RPF C;  1F2R C;  2HTM E;  2JPH A;  3SR6 A;  1WXS A;  2M0X A;  2LGD A;  1N5X A;  4FHK A;  2XNA C;  4WAA A;  3V61 A;  1L0V B;  1JRP A;  3H8H A;  1CJE A;  3UF8 A;  3E56 A;  2KOX A;  4ARC A;  3PHX B;  1WIA A;  2RDB C;  1WF9 A;  4I6N B;  4N9F 4;  1LFD A;  3DHG C;  1I35 A;  1D5M C;  3DBH I;  3JSV A;  3P42 A;  4CQN A;  1VJK A;  2V1Y A;  3EFU A;  4HKQ A;  2CKH B;  2KLG A;  3M3J A;  3PRM B;  5E6J A;  4DHZ B;  1P98 A;  2DAF A;  4RM8 A;  5HHD G;  3ZVV A;  1SBB B;  2GLS A;  3AE8 B;  2QDF A;  2LXA A;  3BVM A;  3DVG Y;  2JXT A;  4WWN A;  2AYO B;  1UD7 A;  4KKJ A;  1KM7 A;  1ET9 A;  2QHO A;  2WNM A;  1LM8 B;  4GGQ A;  5IOI A;  2QIL A;  3NVZ A;  4DXF A;  2X38 A;  3ZNZ B;  1E8X A;  4HVB A;  1FFV A;  3KQ4 A;  3H7P B;  1SE4 A;  1XF5 L;  3UIN B;  2NCN A;  3R7Q A;  3RCZ A;  2DZM A;  3A4R A;  4S0R A;  5DPR A;  2GBN A;  1MG4 A;  2PEA A;  4LCD E;  3BYY B;  1P7F A;  3L08 A;  4GDL A;  3RNE C;  4GOC A;  3RUI B;  1I4R A;  3SEB A;  2MBE A;  3A9K A;  4JGH B;  4ZRJ A;  3MC9 A;  3A33 B;  1ZGU B;  1HZ5 A;  1WFY A;  4RF1 A;  1E7U A;  1OGW A;  2OOB B;  2D5G A;  3ZO5 B;  3FKY A;  3DBL I;  3QHT A;  4WWM A;  1DOI A;  1PGB A;  1WMH B;  4IM3 A;  3PPA A;  3TEW A;  4TQ1 A;  2BWE S;  2MHJ A;  3RFZ B;  2NPT A;  3V62 A;  2C7N B;  1I4X A;  1UZX B;  2QCZ A;  4XGA B;  3ZXR A;  4GB9 A;  3VRB B;  5IO9 A;  3ZTD A;  3RD2 A;  4XDD A;  4ZHO A;  1B9R A;  1HE8 A;  3T8M A;  2IYD B;  2BS3 B;  4KGR A;  2FBW B;  3M62 B;  2VRR B;  4PYU A;  4HPM B;  1VRA B;  3IAM 1;  2GB1 A;  2ZVO A;  4FN2 A;  2RR9 A;  2QSD A;  1ZDV A;  2N9K A;  1YQB A;  1ZXH A;  1M4V A;  4PT5 A;  3PLU A;  2IO0 B;  3VTW A;  1OQR A;  3BVG A;  1R4M B;  1V97 A;  1QIL A;  3E9S A;  1FD6 A;  3SD5 A;  1I4Q A;  2LGI A;  2WXR A;  4IG7 B;  1PGX A;  3N20 C;  2J53 A;  5AUK A;  4F1S A;  1V2Y A;  5L83 A;  3L4P A;  4ZOH C;  3TCA A;  1TKG A;  3EUB 2;  4B9K A;  4REZ A;  3I63 C;  3BWU D;  1E0Z A;  2KNB A;  4YSZ B;  3VDZ A;  1L5P A;  1SE2 A;  4A8X C;  1C4C A;  2SAK A;  2JSV X;  3VFK A;  4W9C A;  2KYW A;  3L17 A;  5CX3 A;  1L4D B;  1SIJ A;  1YOV B;  3SDL C;  1EM7 A;  1A5R A;  3VUW A;  4L1B A;  2MLB A;  1WYW B;  4USA A;  4RNA A;  5JHA A;  1IUE A;  2WX0 A;  4YT0 B;  3AV8 A;  2N9P C;  1NBF C;  1WYG A;  3CIR B;  2ASQ A;  4MM3 A;  5E6P A;  2M17 A;  1MJD A;  5LXH A;  1TYG B;  5KHO A;  2WDT B;  4IUM B;  2C9W B;  3NHE B;  2IO2 B;  1LGR A;  2JY6 A;  1UUP A;  1ZP0 B;  2KZR A;  3IBE A;  3Q3F A;  3NJT A;  2BVC A;  3WAM A;  2WXM A;  4EZL A;  1FIQ A;  2KWU B;  4AJW A;  2MJE A;  1PFD A;  5EE0 A;  2WXK A;  2XK5 B;  2BS2 B;  3MJW A;  2YEP B;  1QT9 A;  3APF A;  2CHW A;  2EKE C;  4A9A A;  2BT6 A;  2K22 A;  4YWG G;  4BBN C;  5IN7 A;  4KV2 A;  1V6E A;  3AED B;  2KAN A;  4HJG E;  4BKS A;  1MI0 A;  1E7V A;  1C79 A;  2JQR B;  4ARI A;  4JWU C;  3FIL A;  4FJZ A;  2JZ3 B;  3RNF C;  2MW5 A;  1JWS D;  3TL5 A;  2BKR B;  1SE9 A;  3Q14 C;  1IGC A;  2JX5 A;  4XDC A;  4DK5 A;  1CK1 A;  4P16 A;  2JWU A;  4BAX A;  5CHW A;  5DPS A;  1TY2 A;  3NZS A;  1XCT L;  2C60 A;  3ZGZ A;  1R4N I;  3RUL A;  2IY0 B;  1Y8R C;  2KFJ A;  1YX5 B;  1JQ4 A;  1P0R A;  3DBL B;  2KXJ A;  2O6V B;  4WJP A;  1L6U A;  2MJ3 A;  4FJY A;  4MSQ B;  2G9H D;  1QQR A;  4W9E A;  3S2A A;  1SGH A;  2WDR B;  4EOY A;  3DVN U;  2O6V D;  5J18 A;  4F7Z A;  1AN8 A;  1WXQ A;  1VLB A;  3NS8 A;  2WXF A;  4LJP B;  2KD0 A;  2D3A A;  4BKG A;  4KIK A;  1SB3 C;  1Y56 A;  1UGM A;  3W1S C;  1N5W A;  3BVZ A;  3NVW A;  4EZK A;  2K8C A;  2M56 B;  1L6V A;  3VTU A;  1SE3 A;  1GJZ A;  4UDU C;  2Z8L A;  3I9V 1;  1RFK A;  4KIK B;  2N7D A;  4XE0 A;  2G1E A;  3QC8 B;  3LB8 C;  5LXI B;  3VVW B;  5DPT A;  2J0K A;  5AZG A;  4KKI A;  1FRR A;  3WIM A;  3K9O B;  3RZF A;  1BML C;  1LQB A;  2KLC A;  1MG8 A;  3B08 A;  4II2 B;  2KX3 A;  2JRI B;  1FFU A;  3EC8 A;  2BBC A;  1P7E A;  3PZD A;  2KMC A;  1LO5 D;  3N1Y C;  4NQK E;  2A5U A;  1WRD B;  3KVF B;  3QAR A;  3AEE B;  2G3Q B;  4MJS A;  3L10 B;  5G2N A;  3RNG C;  2ZJD A;  1EF5 A;  1KFY B;  1D5Z C;  1QKZ A;  4AP4 C;  4ANV A;  2KQ4 X;  4RGO S;  3ML9 A;  1V49 A;  4L2Y A;  4JE3 B;  4YTM B;  2DHZ A;  2BPS A;  4G0N B;  2D3G A;  4NPN A;  3MP9 A;  4M02 A;  3ZRC A;  1B1Z A;  2N7E A;  1KLG D;  2J42 A;  3BYT B;  3MC0 B;  1WSP A;  3L13 A;  1UGJ A;  1WWT A;  3Q69 A;  3V3X A;  3P4Q B;  4EUT A;  3TUO A;  2WHI A;  2VH1 A;  1TS5 A;  3N3K B;  3VAW A;  1JWA D;  4IWQ A;  2D11 A;  3TMP B;  1NYQ A;  3WAO A;  3TBL D;  1TGZ B;  2KDB A;  3EGR A;  4HPL B;  1NI2 A;  1WI0 A;  3CF6 E;  1DOX A;  1XLQ A;  2L0F A;  4M01 A;  3KUC B;  2KWV B;  2JXX A;  4ZHP A;  2QC8 A;  4E3C A;  2I1J A;  5D3I B;  3R8B A;  2N9L A;  1TBE A;  1ZXI A;  4M0W B;  3KYC D;  3Q8C A;  1X1M A;  3JVZ X;  4A3O A;  4US8 A;  2WS3 B;  2FAZ A;  1ZE3 D;  1FNW A;  1WGH A;  2HTH A;  4RFB A;  4BBN F;  2PIA A;  1KJT A;  4M00 A;  1SXT A;  3R2I A;  1I4P A;  2XBB C;  2BYE A;  4BOZ B;  3IXS A;  2I1K A;  1P9D U;  1FXT B;  2BYT A;  2N7J A;  4DHJ D;  4M8M A;  2NVU I;  2KHW B;  5HKH A;  1ZUD 2;  2KWC A;  3ENE A;  1XO3 A;  2KTF A;  1FCL A;  4OHJ A;  2JT4 B;  4EE2 A;  4LNO A;  3GB1 A;  2V4I B;  1QOB A;  3CST A;  3RI7 C;  2Y5C A;  1KOT A;  1F2R I;  4K3C A;  3NZ3 A;  4DBG A;  2AQ2 B;  3SHQ A;  5DCN A;  1AAR A;  1OTR B;  2K39 A;  3W5U B;  2JZZ A;  2M8S A;  4P1C C;  2BGF A;  1L7Y A;  1ROE A;  1XT9 B;  3AU4 A;  4NQL B;  1RRB A;  2NS5 A;  3OWE B;  4A20 A;  4MEL A;  2MP2 B;  2WX1 A;  5G5G A;  2KDE B;  2N9E B;  4FA6 A;  4E71 A;  2E3T A;  2D2Q A;  1C3T A;  3ZLZ A;  1XEE A;  4WJO A;  4OW0 A;  4PYZ A;  4K1R B;  3U2S C;  4BFR A;  5BYQ A;  2W3R A;  5DPW A;  1H4R A;  2NMQ A;  1XLO A;  1SJE D;  1WZ3 A;  3GOE A;  3QA8 A;  2PPH A;  5C3J B;  5J17 A;  5JZE B;  1RM6 C;  1XLN A;  3AEF B;  2Z0E B;  1FXA A;  1FPY A;  2LI5 A;  4K7W A;  2KQ7 A;  3C8Y A;  1YN3 A;  3A4S C;  1T0Y A;  1GNU A;  4WUR A;  2V3N A;  2Z0D B;  5HG2 A;  1SEB D;  1RFA A;  2INC C;  2KT7 A;  2VH2 A;  3P4P B;  2ICI A;  2WXJ A;  4ZRI A;  1QOG A;  1EUV B;  3AI5 A;  2DWQ A;  2DYM A;  3LXF A;  5C23 A;  4MH8 A;  2VZK B;  4O1N A;  3WAN A;  3U8Z A;  2MBB B;  4RH6 A;  3DWM A;  4YXD B;  3A9J A;  1HTQ A;  4NZL B;  4BKT A;  2NBW B;  4XWT A;  1WR1 A;  4GDL B;  1K50 A;  4FUL A;  2ZW1 A;  4CHK A;  2CU3 A;  2W55 A;  2AQ3 B;  2NBV B;  2TSS A;  3P63 A;  3DCG A;  3HM3 A;  2R61 A;  1NEN B;  2K25 A;  2N9X A;  1WX8 A;  2GBJ A;  3H7P A;  4FAD A;  1VZ6 A;  4GIV A;  2MRP A;  3H9D A;  1RAX A;  2FCN A;  1FEH A;  1WJU A;  3UIO B;  1UEL A;  3TEZ A;  2KDM A;  1L0Y B;  2IZV B;  3QJZ A;  3B2G A;  4IWP A;  3RNC C;  4OZA A;  2KAC A;  4ZRK A;  3U30 A;  3V6C B;  2IPK D;  4EFO A;  1FO4 A;  4XZ4 A;  3BY4 B;  2IBI B;  2KQS A;  5FKA C;  4MGI E;  3IVF A;  3Q3J A;  3RNA C;  4G11 A;  2AQ1 B;  3PZ7 A;  4ZYS A;  1J7A A;  1F77 A;  2QMT A;  4IWO A;  4C7Y A;  3TEX A;  2RGF A;  4RMA A;  4MGZ E;  1TS2 A;  2KWD A;  2WU2 B;  4I6P A;  5T8I A;  2J0J A;  2INP E;  1TS4 A;  4GMV A;  4TKN A;  2DYO A;  5EE3 A;  2CU1 A;  1WRI A;  1L2N A;  3KUZ A;  4K81 A;  4NNJ B;  1WXM A;  3P1M A;  5IP4 D;  4HXD A;  1SJH D;  1VZ8 A;  3NUH B;  2N1W A;  1C77 A;  4C00 A;  1QOA A;  2O2V B;  1RYJ A;  3LJ3 A;  3EA6 A;  2L05 A;  1HZ6 A;  2UU7 A;  4BVU C;  1PYW D;  5H92 C;  2MWS B;  1K53 A;  4MH0 E;  2LUM A;  2RPQ A;  2PE9 A;  2R2Q A;  4US9 A;  4ASW C;  4MM3 B;  4ITK A;  2W82 A;  4RGT A;  2BYV E;  2LWP A;  1WGK A;  2K0P A;  1YJJ A;  1V5T A;  3ZJT A;  3GP7 A;  5BMI A;  5GMV A;  3QIJ A;  2PW9 A;  2WXN A;  2G4D B;  4M8N A;  2FNJ B;  3PHW B;  3HM6 X;  1UNS A;  2RD0 A;  2M0A A;  4GU2 A;  3B9J A;  5FR3 A;  4AWJ A;  4DQO C;  4P1B C;  1V1O A;  2FCQ A;  3WCQ A;  1WM2 A;  5HFY A;  1N63 A;  1VR9 A;  1KLV A;  2MBQ A;  3HUI A;  3BII D;  4RGM A;  1N61 A;  1WGD A;  2JUO A;  2BYF A;  1HEZ E;  1J7C A;  1EU4 A;  3AE5 B;  3DQV A;  3L54 A;  3AE6 B;  2DLB A;  4FJV B;  1L0X B;  1GC7 A;  1QF6 A;  1MPE A;  5AEK B;  1UBI A;  4HRO A;  2K5P A;  2CHZ A;  3Q8E A;  1QLB B;  1F9J A;  2ZPN A;  4A90 A;  1Z2M A;  3VQI A;  1ZOY B;  2JWZ A;  4WIP A;  2HD5 B;  3DBH B;  4W9G A;  1D6E C;  1VD2 A;  1WM3 A;  1V81 A;  3RT3 B;  4B95 A;  3P2B A;  1NVI D;  2FIF A;  1IGD A;  1EWY C;  3TSS A;  1IYF A;  1C76 A;  2MEK A;  5IAA C;  3OAW A;  4GDK B;  3URY A;  1LXD A;  2FE8 A;  1HQR D;  3DHI C;  2PVG C;  1L4Z B;  2L1A A;  4HDO A;  2YLM A;  4PS7 A;  3AE7 B;  2KN4 A;  2R2O A;  3C19 A;  1C4A A;  2L32 A;  5CHF A;  1WJN A;  2BW2 A;  2EMT A;  4DDI D;  1E8Z A;  2AWT A;  1J19 A;  2WDV B;  3ZYY X;  3UQB A;  3EFC A;  1N60 A;  4J3O D;  3AH7 A;  2FUG 1;  1V86 A;  3QWZ B;  3PSE B;  2GI9 A;  4C7Z A;  2NR2 A;  1AWD A;  2O6V A;  2QJL A;  4AJY B;  2MP2 A;  2DX5 B;  4TSS A;  2Y5B B;  2EEL A;  2KJR A;  3IG3 A;  3ZKJ C;  3ZJU A;  4WWP A;  4JX1 C;  2V9H A;  2CJO A;  2GRI A;  1MFW A;  4GSW A;  3NVV A;  4R3D A;  1NI3 A;  1T3Q A;  1V5O A;  1V80 A;  2REX A;  3H7S A;  1UBQ A;  2FUH B;  2LD9 A;  4EEW A;  1P3Q U;  3W9C B;  5JHB A;  2N0S B;  4I6L B;  3VH3 B;  1DYQ A;  4FLH A;  3M95 A;  1C4P A;  2BF8 B;  1BUI C;  1XD3 B;  3AXC A;  2B3A A;  2L00 B;  2KTR B;  2EMS A;  3SU8 X;  4IM0 A;  3SFD B;  1YQ3 B;  3PGE A;  4HCN B;  2JF5 A;  2UWQ A;  2CR5 A;  3ZUN A;  3KH0 A;  3ECI A;  1MHX A;  1S1Q B;  3D32 A;  1IP9 A;  2JYE A;  3AU5 A;  2XK5 A;  2ZCB A;  2KAJ A;  2V0G A;  3NG0 A;  3Q8F A;  3GZN B;  5BMH A;  4LNI A;  4M0W A;  1N6Z A;  1JWU D;  1GB1 A;  5TR5 A;  2ZEQ A;  2DNF A;  2LJI A;  4MDK E;  2PJH A;  3PLV A;  3QK0 A;  2KMM A;  3AE3 B;  1S3S G;  2WU5 B;  1TZO A;  2K6Q A;  1GG3 A;  2LRU A;  3APD A;  4AS1 A;  2WYQ A;  1YMH E;  4LDT B;  2LMC A;  2WP9 B;  4RF0 A;  4N59 A;  3PV1 A;  2FID A;  3N1Z C;  1E6E B;  3TIX A;  3W1Y A;  2VZK D;  1YN5 A;  3IT6 B;  3T3O A;  2ONQ A;  1FRD A;  4LDT D;  1WGY A;  2MX2 A;  4ZRQ A;  4Q2J A;  2LJ5 A;  1J7B A;  2DZK A;  3KUD B;  1WR6 E;  4KVG B;  2HDE A;  3AEB B;  5BYR A;  3RZW C;  2PTL A;  3KYD D;  3DBR B; 
#chains in the Genus database with same CATH homology
 4K7W A;  4KDL B;  3R7R A;  2KQ7 A;  3A4S C;  3UIP B;  1T0Y A;  3PLU A;  1GNU A;  2IO0 B;  2Z0D B;  3VTW A;  1RFA A;  2MQJ A;  2Z59 B;  3SD5 A;  4F8C B;  4IG7 B;  2LVO A;  3JW0 X;  1ISN A;  4ZRI A;  4F1S A;  1V2Y A;  2CHX A;  2L0T A;  5L83 A;  2IY1 B;  1EUV B;  2GMI C;  3TCA A;  3AI5 A;  2XEW A;  2DYM A;  5C23 A;  4B9K A;  2KVR A;  2LRW A;  1WX9 A;  4DDG D;  5AZF A;  3WAN A;  1WJ4 A;  1QZE A;  3U8Z A;  2KNB A;  2MBB B;  3NZU A;  1M94 A;  4ZYN A;  3N30 A;  1BT0 A;  4MGY E;  1E5W A;  3VDZ A;  5BO4 B;  3A9J A;  3IFW B;  4HLE A;  3VFK A;  4BKT A;  2NBW B;  4E74 A;  4W9C A;  1WR1 A;  3L17 A;  4GDL B;  1R4M I;  4K7S A;  4FUL A;  5CX3 A;  4CHK A;  4MJS B;  3SDL C;  4KSK C;  2NBV B;  1A5R A;  2KC1 A;  3DCG A;  3VUW A;  3U7D A;  3HM3 A;  1WH3 A;  2MLB A;  1ZKH A;  2K25 A;  1WYW B;  2N9X A;  3L0W B;  1WX8 A;  5JHA A;  2GBJ A;  4X57 B;  2WX0 A;  2BWF A;  3H7P A;  1GC6 A;  2N9P C;  2D07 B;  4WJQ A;  1NBF C;  5D6J B;  3R3M A;  3ZNG C;  4FAD A;  1NDD A;  2LUE A;  1P1A A;  4GIV A;  4FHJ A;  3DVG X;  4IM2 A;  2MRP A;  3H9D A;  4WWO A;  2CS4 A;  3GZN I;  1RAX A;  3C0R B;  2FCN A;  3W1S A;  1CMX B;  3RYT A;  2AL6 A;  1WJU A;  3UIO B;  1UEL A;  5CTR C;  1C1Y B;  2ASQ A;  3ML8 A;  4ANW A;  3A1Q B;  4MM3 A;  2G4S A;  1WMH A;  2IZV B;  2KC2 A;  3M63 B;  2NBU A;  3QJZ A;  4IWP A;  5E6P A;  2M17 A;  5LXH A;  4ICU A;  1RLF A;  4AOF A;  4K7U A;  3ZDT A;  5KHO A;  4ZRK A;  3U30 A;  3V6C B;  2WDT B;  4IUM B;  3PRE A;  2C9W B;  3ZTC A;  3NHE B;  4EFO A;  2ZCC A;  3PRP B;  2IO2 B;  4XZ4 A;  2JY6 A;  2KZR A;  2IBI B;  3BY4 B;  2KQS A;  4IC7 B;  3IBE A;  3Q3F A;  2J0M A;  4MGI E;  3TJP A;  5IA7 A;  2LZ6 A;  3IVF A;  3Q3J A;  3WAM A;  4EZL A;  2KWU B;  4AJW A;  3VUX A;  4G11 A;  3V60 A;  2A4Z A;  1WGG A;  4ICV A;  2XK5 B;  3MJW A;  3B0A A;  2AL3 A;  3APF A;  2CHW A;  2EKE C;  4JLC A;  4IWO A;  4OVV A;  4BBN C;  2IO3 B;  4TUU A;  4KV2 A;  4FBJ B;  5D94 A;  2C5L C;  2DAJ A;  4GN1 A;  1V6E A;  2KAN A;  1WJ6 A;  4BKS A;  2GBR A;  2RGF A;  4RMA A;  4MGZ E;  4DXA B;  2J7Q B;  4I6P A;  4W9D A;  1E7V A;  2J0J A;  5JH5 C;  2HJ8 A;  2KJH B;  4IW0 A;  3ZIM A;  3VHT C;  3ZNH B;  4GMV A;  4TKN A;  2DYO A;  4FJZ A;  2C7M B;  2CU1 A;  2JZ3 B;  2WWZ A;  1L2N A;  2LVP A;  3KUZ A;  3I3T B;  2MW5 A;  4HJK A;  3TL5 A;  2BKR B;  4K81 A;  4NNJ B;  1WXM A;  1SE9 A;  4HXD A;  2GBM A;  5C1Z A;  2NPT B;  2PE6 B;  2MA9 B;  3WAP A;  4DK5 A;  2DYB A;  3KW5 B;  2GBK A;  3HHM A;  2N1W A;  3PTF C;  3V6E B;  3ALB A;  2O2V B;  4GDK A;  3LJ3 A;  2ZVN A;  3DBS A;  3PVL A;  3NY5 A;  2M4N A;  2JRH A;  4URK A;  2L05 A;  5J2R A;  5CHW A;  2LXC A;  3OJ4 B;  2HE7 A;  5DPS A;  3UGB B;  4BVU C;  2MBO A;  3NZS A;  3EHV A;  2MWS B;  2C60 A;  5D2M B;  1R4N I;  1I42 A;  3BIN A;  4MH0 E;  3RUL A;  2DZJ A;  2RPQ A;  2PE9 A;  2DZI A;  2IY0 B;  2R2Q A;  4ASW C;  1Y8R C;  2KFJ A;  2OJR A;  1YX5 B;  4PS8 A;  2LGY A;  1P0R A;  2MSE D;  4HWI B;  2KXJ A;  2O6V B;  4WJP A;  2C7H A;  2BYV E;  2LWP A;  3A9K B;  3UQA A;  4FJY A;  4MSQ B;  4DHJ B;  1J0G A;  1IPG A;  4J6I A;  4W9E A;  1V5T A;  3S2A A;  1SGH A;  2M1M A;  4YL8 A;  5E6N A;  3ONS A;  4EOY A;  3DVN U;  2O6V D;  1OEY J;  5J18 A;  1YD8 U;  4F7Z A;  4G50 A;  5GMV A;  2KJ6 A;  4KDI C;  4B6W A;  3PT2 B;  3QIJ A;  3NS8 A;  3HK0 A;  2KDF B;  4RM9 A;  2G4D B;  2DEN B;  4JIO U;  4M8N A;  1VCB A;  2FNJ B;  3PHW B;  4LJP B;  3HM6 X;  2KD0 A;  2RD0 A;  4BKG A;  1JRU A;  4GU2 A;  4KIK A;  4KZC A;  1UH6 A;  1UGM A;  1E8Y A;  3LDZ E;  3NOB A;  3QX1 A;  2ZNV C;  3W1S C;  2LGX A;  1PQS A;  4AWJ A;  4ANU A;  4EZK A;  4BKS D;  2K8C A;  1EF1 A;  2FCQ A;  1WM2 A;  3DPD A;  3VTU A;  2BKF A;  1KLV A;  1GJZ A;  2MBQ A;  1K8R B;  1WGD A;  2L76 A;  3H6N A;  3PS6 A;  4II3 B;  2N7D A;  4KIK B;  2JUO A;  2FCM A;  2BYF A;  2IO1 B;  1WGR A;  2K1F A;  3IHP C;  4BOS C;  2ZNV B;  3VXW A;  3DQV A;  4DWF A;  3ZRF A;  4EKU A;  3L54 A;  3QC8 B;  4A3P A;  2LVQ A;  5LXI B;  1Q0W B;  3VVW B;  3B1L X;  4FJV B;  4TQ0 A;  1XQQ A;  5DPT A;  2J0K A;  1GC7 A;  5AZG A;  3ZNI D;  5AEK B;  1UBI A;  2KKC A;  2KX0 A;  3A1Q A;  2CHZ A;  2MBH A;  1EO6 A;  2KK8 A;  1F9J A;  3WIM A;  2ZPN A;  4GXB A;  4OVU A;  1OQY A;  3K9O B;  3RZF A;  1LQB A;  2L3Z A;  2KFK A;  2KFK B;  2KLC A;  1MG8 A;  4TV3 A;  4WJN A;  3ZW3 A;  3B08 A;  5EDS A;  4W9K A;  1Z2M A;  1Z5S B;  4P7I A;  3VQI A;  4II2 B;  3JSV B;  2KX3 A;  2JRI B;  4NY0 A;  2JWZ A;  1WXV A;  3EC8 A;  2ZPY A;  3X0W A;  5E6O A;  2HD5 B;  3APC A;  4W9G A;  1VD2 A;  2KMC A;  3PZD A;  3ZDM C;  2K8H A;  1WM3 A;  3DDC B;  3MTN B;  1V81 A;  4NQK E;  2A5U A;  2UYZ B;  3RT3 B;  4HK2 A;  2KN5 A;  4XX5 A;  4B95 A;  1WRD B;  1E90 A;  3DVN V;  4W9H A;  2G45 B;  3P2B A;  4HCP B;  4XC2 A;  3KVF B;  1YX6 B;  1Q5W B;  3QAR A;  2FIF A;  1H8C A;  2KTR A;  2L7R A;  1D3Z A;  1IYF A;  2KDI A;  5LLI A;  2G3Q B;  5IAA C;  3OLM D;  3OAW A;  4MJS A;  5D7G A;  3VUY A;  4CO7 A;  3QQ8 B;  2O2V A;  3L10 B;  4GDK B;  5G2N A;  2ZJD A;  1EF5 A;  5FR6 A;  5CHV C;  1LXD A;  3O65 B;  2YVC A;  3X23 A;  1E8W A;  4ANV A;  3OJ3 A;  4AP4 C;  3CMM B;  1YJ1 A;  1WE7 A;  4HDO A;  2YLM A;  1WE6 A;  4PS7 A;  1WY8 A;  3ML9 A;  1V49 A;  2JPH A;  1WXS A;  2D10 A;  2DHZ A;  2M0X A;  3H1U A;  2BPS A;  2LGD A;  2D3G A;  2R2O A;  4FHK A;  4G0N B;  4NPN A;  4WAA A;  3ZRC A;  3V61 A;  5CHF A;  2N4F A;  1WJN A;  4AUQ C;  2EMT A;  2N7E A;  3UF8 A;  4DDI D;  1E8Z A;  2KOX A;  3PHX B;  3L13 A;  1WIA A;  2AWT A;  1SIF A;  1J19 A;  1WF9 A;  4I6N B;  4MSM B;  4ZDV A;  4KSL C;  4N9F 4;  1LFD A;  3N32 A;  2AEH A;  3UQB A;  3K9P B;  4EUT A;  5KHQ A;  3DOW A;  1I35 A;  3DBH I;  3MHS D;  3JSV A;  4W9I A;  2V1Y A;  3EFU A;  3N3K B;  1WX7 A;  3VAW A;  2ZZP B;  1V9J A;  1V86 A;  2CKH B;  4IWQ A;  4NJ7 A;  2D11 A;  3QWZ B;  3PSE B;  3TMP B;  2KLG A;  3A9J B;  3M3J A;  3WAO A;  2NR2 A;  3PRM B;  2O6V A;  3TBL D;  4AJY B;  4DHZ B;  5AZH A;  1P98 A;  2MP2 A;  2DAF A;  4RM8 A;  2DX5 B;  3ZVV A;  1TGZ B;  3R66 C;  2KDB A;  2K8B A;  2Y5B B;  2KJR A;  3IG3 A;  2LXA A;  3ZKJ C;  4NAW A;  4HPL B;  4WWP A;  3DVG Y;  1NI2 A;  1WI0 A;  3CF6 E;  1TZ1 A;  2L0F A;  4GSW A;  4WWN A;  2AYO B;  2GOW A;  1UD7 A;  3KUC B;  2KWV B;  2JXX A;  1GUA B;  2MCN B;  4E3C A;  2I1J A;  3PRZ A;  1KM7 A;  1V5O A;  1V80 A;  4MEM A;  2REX A;  3H7S A;  1TBE A;  2QHO A;  4M0W B;  3KYC D;  1LM8 B;  1UBQ A;  2FUH B;  2LD9 A;  4GGQ A;  1X1M A;  1WZ0 A;  3JVZ X;  4EEW A;  4A3O A;  1P3Q U;  3DBR I;  3JYU A;  5JHB A;  3EEC A;  3WAL A;  2V4L A;  4I6L B;  1OEY A;  3VH3 B;  2FAZ A;  4FLH A;  3M95 A;  2BF8 B;  1XD3 B;  3AXC A;  1WGH A;  2HTH A;  4BBN F;  3ZNZ B;  1E8X A;  1KJT A;  2K6D B;  2B3A A;  5L95 C;  2L00 B;  4HVB A;  2JVC A;  2XBB C;  2BYE A;  4BOZ B;  3H7P B;  2KTR B;  3HIZ A;  2EMS A;  2NCN A;  4NJ6 A;  4W9J A;  3RCZ A;  3R7Q A;  5G55 A;  3UIN B;  3SU8 X;  4IM0 A;  2I1K A;  1P9D U;  1FXT B;  2DZM A;  4JL9 A;  3A4R A;  3PGE A;  4DHJ D;  4HCN B;  4M8M A;  5DPR A;  2JF5 A;  3QAQ A;  2GBN A;  2NVU I;  2UWQ A;  2KHW B;  4NAW B;  5HKH A;  2KWC A;  2CR5 A;  2PEA A;  3ZUN A;  3KH0 A;  4LCD E;  3ENE A;  3ECI A;  2KMA A;  4DHZ E;  2KTF A;  3L08 A;  1S1Q B;  1U4A A;  4GDL A;  2JT4 B;  3D32 A;  4GOC A;  3RUI B;  1IP9 A;  4HDQ A;  2N1V A;  3AU5 A;  2XK5 A;  2MBE A;  2ZCB A;  3CST A;  2KO3 A;  2V3S A;  3A9K A;  4JGH B;  3CSF A;  4ZRJ A;  3A33 B;  2FCS A;  3WA0 A;  4G3X B;  4LJO B;  2L8J A;  1KOT A;  1ZGU B;  4DBG A;  3L16 A;  1WXA A;  1WFY A;  3VH4 B;  3SHQ A;  1E7U A;  1OGW A;  4KZ0 A;  2OOB B;  5DCN A;  1AAR A;  2ZEQ A;  5TR5 A;  1OTR B;  3QCA A;  3ZO5 B;  4MDK E;  2PJH A;  2K39 A;  2LAS A;  3DBL I;  3PLV A;  3QK0 A;  2JZZ A;  2M8S A;  2W9N A;  3QHT A;  2BGF A;  1G6J A;  1L7Y A;  1XT9 B;  4W9L A;  1WMH B;  3AU4 A;  4IM3 A;  3PPA A;  4NQL B;  1S3S G;  1RRB A;  2NS5 A;  4W9F A;  3VTV A;  4A20 A;  4TQ1 A;  4MEL A;  2BWE S;  2MP2 B;  4EZJ A;  2K6Q A;  1GG3 A;  2KDE B;  2LRU A;  2WX1 A;  2N9E B;  3APD A;  2NPT A;  2WYQ A;  4FA6 A;  3V62 A;  4E71 A;  3T9L A;  4LDT B;  2C7N B;  3PV1 A;  2FID A;  2D2Q A;  4WQO B;  1J8C A;  1UZX B;  3TIX A;  3W1Y A;  1C3T A;  4GB9 A;  4ANX A;  4JQW C;  3ZLZ A;  3ZTD A;  3RD2 A;  1ZW7 A;  1YIW A;  4WJO A;  4PYZ A;  4K1R B;  1HE8 A;  2RSU A;  4MGK E;  3T8M A;  4BFR A;  2IYD B;  3AUL A;  1WGY A;  4LDT D;  1Q1O A;  2MX2 A;  4CYE A;  4PS3 A;  5DPW A;  1H4R A;  2LJ5 A;  1TTN A;  2DZK A;  3KUD B;  1WR6 E;  4KVG B;  3M62 B;  1WZ3 A;  3GOE A;  3QA8 A;  3RZW C;  2VRR B;  4PYU A;  4HPM B;  2PPH A;  4FN2 A;  2ZVO A;  5J17 A;  5JZE B;  2Z0E B;  2RR9 A;  2LI5 A;  3KYD D;  1YQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...