1HA5A

Structural features of a zinc-binding site in the superantigen streptococcal pyrogenic exotoxin a (spea1): implications for mhc class ii recognition.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
218
structure length
218
Chain Sequence
DPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHAGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYLTDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDSNTSQIEVYLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords STREPTOCOCCAL PYOGENIC EXOTOXIN A1
publication title Structural Features of a Zinc Binding Site in the Superantigen Strepococcal Pyrogenic Exotoxin a (Spea1): Implications for Mhc Class II Recognition.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Toxin
total genus 56
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ha5A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ha5A01
4DXGA 1JWMD 2O2LD 3MC0B 1HQRD 3DWQA 1KTKA 1ESFA 1XTCD 1DJRD 1EEID 5D3IB 1CK1A 1PZID 4OHJA 1BXTA 1I4XA 1SBBB 5ELFA 1SE2A 5D3DA 1SE4A 1LTAD 1PZKD 3SEBA 1STEA 2R61A 1PTOD 1KLUD 1RF2D 2RDHA 3EA6A 4BWGB 5I4DA 4RGNA 1YN4A 1LT5D 1LT3D 1EFID 1EU4A 1S5FD 1SXTA 4DXFA 1FNVA 4RFBA 1D5ZC 1SJED 1FGBD 1EU3A 3BVGA 4L63B 2TSSA 2NTSA 1ET6A 1I4RA 1LTRD 1HTLD 4C56C 1D5XC 1RDPD 2ICIA 1T5XD 1LT4D 1LT6D 1PYWD 1TY2A 1MD2D 3OWEB 2XRSD 1I4PA 1PRTB 1TY0A 1BCPB 5FKAC 1YN5A 2J4XA 3BYTB 1LTTD 3DWAA 1TS5A 5TSSA 4RH6A 1LTSD 1HXYD 5FK9C 1L0XB 1TS4A 3V05A 2IPKD 1F77A 1HA5A 5ELBA 1ET9A 1PRTC 1BCPC 1B44D 1PRTF 2CHBD 1BCPF 4RGMA 2Z8LA 1JWUD 1XXGA 1LLRD 4TSSA 3EFXD 1JWSD 2XN9C 4L6TB 4RHRA 2QILA 1KLGD 1S5ED 4K6LA 4O1NA 1LTBD 2RDGA 3BVMA 1PZJD 1RD9D 4UDUC 1PTOB 4RCOA 1AN8A 1SJHD 1FD7D 2AQ1B 1V1PB 1I4HA 1ENFA 1LTID 5ELEA 2WV6D 1QILA 1D5MC 1S5BD 2G9HD 1B1ZA 2NTTA 1PRTD 3GP7A 1BCPD 3R2TA 2QEJC 3DWPA 4RGTA 1S5DD 2IJ0A 3BZDB 1I4QA 5ELCA 1M4VA 2XNAC 1AW7A 1V1PA 1RCVD 1FNUA 1GOZA 5ELDA 3MFGA 1YN3A 1FNWA 1UUPA 1LO5D 4RHSA 1G8ZD 3TSSA 3URYA 1UNSA 1DYQA 1JCKB 1LTGD 3BYYB 1D6EC 1SE3A 3R8BA 2AQ2B 1CT1D 1L0YB 3O13A 2XRQD 3R2IA 4ZYSA 4Z9CB 1EWCA 1PTOH 1CQVA 1CHQD 2AQ3B 1PTOC 1S5CD 3BVZA 1PTOF 1I4GA 1CHPD 1SEBD 3KLSX 1TS2A 4NZLB 1V1OA 3W2DA 2SEBD 1EEFD 3CHBD 1JR0D 1JQYD 4RGOS 1TS3A
chains in the Genus database with same CATH superfamily
2NVYH 2PEAA 3CWIA 4HJAA 1Q8IA 4IWPA 4HAEA 3AFQA 4L5QA 4C3JB 3K57A 3CCVA 3PHWB 4GB9A 4DHZB 1HE8A 3BDOA 1CTMA 4C3IB 4I6PA 2Y0SE 3HOXG 1BXTA 4YTNB 4A3KH 1BNZA 2Z0SA 4IUNA 5D3DA 1WTPA 4JI7Q 1SE4A 2AL3A 2GMIC 2KT7A 2QC8A 1PZKD 4JI3Q 3N1XC 1IYFA 2KMAA 1KLUD 1SMYC 1R4MB 1VQBA 1LT3D 1Y1WG 3C19A 2E5LQ 2UUCL 3NJTA 1IKMA 3I7FA 5JH5C 2B2VC 2F0FA 1N5WA 4YXDB 2F0LA 3Q22A 1IGDA 5C0XH 3BY4B 4JL9A 4A90A 4B9KA 4GS3A 1C76A 4C4VA 3MVVA 2KWCA 2HUGA 3BINA 4UP8A 4NP5A 4RMAA 1HTQA 4DV4L 1W6KA 1WH3A 4BKTA 3HS0C 3T56B 3DQVA 4WAFA 4OZBA 2OEOA 4O0AA 4EZJA 3EN2A 4IOCA 2NN6G 4WJQA 4S17A 5CTRC 4ZKCB 5C1ZA 1EY0A 5DPSA 3AE6B 4OO1H 1GKHA 2UYZB 3ICEA 4B3SQ 2RBMA 3AV8A 4ASWC 1L1OC 1Z9FA 2WX1A 2AWOA 4MN3A 3RUIB 4JCVE 1HA6A 3NZSA 1HNWQ 3Q3MC 3N1ZC 3ML9A 4DFAA 3OJ3A 3PUYA 2Y0SB 3HOYH 1FM0D 1K50A 4LF4Q 1SYEA 2K8BA 3IL8A 1GUOA 2BF8B 1VQEA 2R92B 4GGQA 1VCBA 1R4NI 2DY8A 3QG1A 2AWTA 4DAPA 4G57A 5C5MA 2N55A 5M3FH 2UXCQ 2ZM6L 1D1IA 4PV1C 2PW9A 2Q2IA 4GKKQ 2RA4A 4EQPA 3BU2A 4LF7Q 2OQKA 1QILA 2CKZB 3VFKA 1TWGH 3GP7A 4FJVB 4DR5L 4WQOB 1OGWA 2Q8IB 1NBFC 2AMCB 2H4OA 1OQYA 4NAWB 1RODA 4DV3Q 3VA5A 1NR2A 4G0NB 1B3AA 4ID6A 4RAUC 3NXWA 4W9JA 1X3EA 4CJ2C 3NEMA 4XQNA 2J0KA 4CJ0B 2RPVA 1QG7A 3H7SA 4P75A 3L08A 2LRWA 2YTYA 3K7AH 1PHJA 3LB8C 1GOZA 3ZDTA 2N9LA 4TVAB 4X3UA 1UBIA 3APDA 3V60A 1DGSA 1E24A 1ICWA 4MJSB 2NVTB 4K0KQ 1PDXA 1G6PA 2EYOA 1BR9A 2QDLA 3FKIG 5E7NA 1SE9A 2F4VQ 1EF1A 1Q46A 1DOLA 2Z59B 3TQYA 3ZNZB 3UI3A 3ZJUA 1CKNA 4GIVA 2EJMA 4DKAC 1RJTA 3N9YC 3PIP3 3RD4A 1I50H 4CKEA 3BWUD 2N7DA 3S14B 4G7OC 3PUXA 5H1SE 2F0JA 3NBHB 3Q23A 4KV2A 4IN3A 2NVXH 2W82A 4FF3A 1CQFA 3B08A 1OXXK 1VQLA 4HMIA 3I4NG 2JA6G 1WCMB 2CJNA 1YNJD 3W5UB 2C60A 5GXGB 4A20A 3OMGA 1XTDA 2HCCA 4HCPB 4TQUS 1QJOA 1FR3A 5EKLA 2ALYB 3ZRCA 3DVNU 3C46A 1GUTA 3G6EA 1B3QA 1YD8U 4ILWA 2ZPNA 3N32A 1FIQA 4A3GH 4LFCQ 3IHPC 3G4SA 2F03A 4J6IA 5KYIA 2IWHA 1HHVA 4JV5L 2RDHA 2I2YA 5KNDA 1WXQA 5IT9E 1WR6E 4K8JA 2HJ1A 1EU4A 1FL0A 4LK0M 5IAAC 1HRJA 1CZGA 3PF4A 1WMHA 4NJ7A 1W2BA 4KKJA 1NAPA 2RHSB 2FIDA 1Q0WB 3AULA 1RWSA 5CHFA 5BYRA 1JORA 1GUSA 1T0QC 2N88A 4KJNA 3U30A 5DPWA 2NTSA 3U50C 2N1WA 2EYPA 2N7EA 5HFYA 3FDTA 5FO8B 3MP9A 4C80A 2NWGA 3DBSA 1VRAB 4XYOA 1O78A 2ZTCA 3CCRA 2MHVA 1N36Q 2MFIA 2V4DA 4R8NA 3R93A 2E74C 4X62L 2FIFA 3RD2A 5IP9G 1FYCA 5FKAC 4G7ZC 4C4VB 3ZRFA 2AUJD 2EDGA 2UUAQ 4A55A 1J19A 2K5VA 2O6VA 3N6RA 2M8SA 2Y5CA 1TS4A 3S1RB 1GUNA 2JA7G 1IBKL 3I2ZA 1PRTC 1VMPA 1B44D 2DNEA 2KWUB 1WY8A 4KGSA 1XXGA 2VW9A 1N60A 2LY7A 2M0XA 2XEWA 4ZUIA 2N3SA 4C3HH 3JAMi 3KUPA 3U4EG 4KD4A 3PIO3 2BWFA 4K6LA 1KC8C 4P74A 3IFTA 3I90A 4Q0FA 3F2DA 4BBSH 1ACCA 5LMNW 1LTBD 3J80L 1WR1A 4JI6Q 2WYQA 2QSDA 4DR2Q 1PH1A 2C5CA 3NPPA 1F9JA 2MBQA 1IL2A 2VZKB 4K8IA 3WAMA 2UUBL 3SR1A 2IT1A 5I6YA 1Q7YC 4PMWA 3GZNB 2VQEL 3RPFC 4OWXB 1GXDC 4WJOA 1CSPA 3ZKJC 1EY7A 1C0AA 4JI0L 1O7IA 3MJ5A 4NAMA 3UINB 3TEYA 2KC1A 3J80c 3TEHB 1RRBA 4R4TA 5ELCA 2A68C 2KJXA 1M4VA 2B2YA 2NZ1D 3AE1B 3VR9B 3HOVB 4I6NB 4IJHA 2FCMA 2JRIB 2E2DC 4P71A 1ICFB 5KHOA 2HQLA 4H44C 3RT3B 2BKRB 4NXNL 2WXPA 3AECB 3S2HH 5JPNC 2KFKA 3N3KB 3UIOB 4JOIA 1LQBA 1M8AA 1FRDA 1L0YB 4KHPL 2NZOA 1SIFA 3GTMH 4JI4Q 3CD6A 1O7ZA 2OF1A 3TRZA 3OAWA 3ZNHB 1I6HB 4OZAA 4ZKBB 5LMNL 2A6HD 2NCNA 3OYYA 1SNCA 1O7LA 2J0MA 5GMVA 2IY1B 4IPCA 2WDTB 3DHGC 3LNNA 2K0PA 3H8HA 2JT4B 3ULPA 1CKNB 1IW7D 2MPMA 5DM63 1CMXB 3AE4B 4PT5A 3S2DH 2ZJQA 3K8AA 3TUOA 1IBXB 1IKLA 1DJRD 4HEDA 4IALA 4YHHQ 2E2JH 4RKLA 4MEMA 4M0WA 2UU7A 4R3DA 1X3GA 3S16B 3D6WA 4OHJA 1I4XA 1E8XA 4A93H 2A5UA 1K3RA 2RVLA 2HHHQ 4KN7C 2D11A 1PTOD 3HG9A 5CC4A 4A3IB 3EQLC 2CFMA 1VQDA 3MXGA 4RGNA 3HOZH 3QCAA 4F87A 1DOIA 1GNUA 4YCVA 2K1FA 3VXWA 1NNXA 3GTLH 2XIWA 4M01A 4A3JB 2EXZA 4N9F4 4ZK9B 3F1ZA 2KEDA 1S4ZA 2M19A 1BBUA 2KHJA 3UDFA 2V4LA 4A3PA 4LJOB 3J81j 1ILPA 1F2YA 1T5XD 1AZPA 1XO3A 2VB3X 3NS1A 2K05A 3P1MA 5E6NA 1WMHB 1ZOYB 2K25A 5EGTA 3IKJA 3CCEA 2XRSD 1MJEA 1E6EB 2CHZA 1OFFA 4HCNB 4KIKB 1VCIA 5C44G 4DV6L 3KYCD 1EUJA 1GB4A 3M63B 3PO3H 3DBHI 1QB5D 2EJFC 4WIPA 2BW2A 4XQJA 5J2RA 5FR3A 3J81i 1VQFA 3S1MH 1TKYA 2KHIA 4BA2I 1DGJA 1KFYB 1WX9A 4K1RB 3U9OA 1DCZA 2JZZA 2K14A 3L3OC 3KW5B 3P1HA 2VY3A 3VYTA 1KM7A 2MBHA 1SYGA 3CQZB 4EQ5A 1KDCA 3AEVA 4BKSA 2BGFA 3RZFA 1Y8NB 5DLQE 3QWZB 3AU7A 3BJUA 1VQIA 1WJJA 2WWZA 2IGDA 5CHWA 1G6ZA 3Q14C 3RLOA 1MG8A 2B63G 1V8CA 5D14A 1II3A 4N8FA 2X6LA 2O5JC 3Q69A 3PPAA 1H9RA 3KWLA 4CDDC 2N9PC 2QW7A 4PMCA 4K2LA 4HIMA 3M4OH 1XD3B 3TEXA 3SK5A 4AQYL 2FUHB 1VQ7A 2I0QA 2F0EA 2Z0DB 1I3QH 1WZ0A 5HGQA 1Q82C 2QKIC 2Y3AA 3EFUA 2KUMA 2L12A 5IYDG 4X64L 2N4FA 4DDGD 1JOKA 2XWBB 1YHBA 4A3KB 2KDBA 5M5XH 4B0MA 5IKCM 1BMLC 2RCNA 3CCJA 2DLBA 2CH4W 2HDMA 2Q2UA 2KFJA 3A9KA 1UUPA 3HKSA 4CO7A 1PH3A 2YU9H 1ZUD2 2BTEA 5G5HA 2YVCA 1CZPA 1X3PA 4GN4B 1FPYA 4C3IG 2DWQA 4YT0B 4QIWB 1DONA 2D5GA 1STNA 3BYYB 3H6MA 1RTNA 3R8BA 4U673 2WFWA 4EX5A 2R7ZH 3NELA 1N61A 2KQ7A 4LF5L 1EWCA 1CQVA 1SROA 4NMZA 4OX9Q 2QDFA 4EFOA 5AFWA 2VZKD 4CDEC 2ZVNA 3TEZA 4A3BH 1QQRA 4B3ML 3J80E 2JWUA 3JW0X 3MTNB 2JE6I 5AZFA 4X62Q 3B2GA 5J18A 1JICA 2M0AA 4LCDE 1IYUA 3NE5B 1Q81C 3OW2A 4MELA 1VQHA 3MC0B 5C2TB 4PG3A 4LF8Q 1XLOA 1SYDA 1IYVA 1PGAA 4C7ZA 1TKGA 3NUCA 4G4KA 1ZYRD 3T53B 3P2BA 1EEID 3FAHA 2UWQA 3TEWA 3AE7B 4GN5A 1G291 1SB3C 1IBLL 1WSPA 1U0LA 4GN1A 4X3SA 4DR6L 3K59A 1QF6A 1WTWA 2N9EB 4E3CA 4P2CB 3ND8A 3VYRA 4M0WB 1EYDA 3PV1A 4BBRB 1SXTA 2E8GA 4LUOA 2LVPA 2ZW1A 4HKQA 1OQRA 3V6CB 3TP6A 3ZXRA 4P16A 2G4SA 2Y0SG 2I1KA 3HEJA 2D3CA 4CHKA 5IWAL 4GKJL 4KZCA 3L13A 1XPRA 4JI0Q 5BMGA 2LFNA 3ONSA 2R92G 2HIXA 1ASYA 4DV7Q 3I57A 2D9UA 1T6BX 1S3OA 1TWGB 2AX5A 1AYFA 1H95A 2FUG1 1ZXHA 2WXIA 2RCFA 1M1KC 1BCPB 4CHTB 3WCQA 2EYJA 2J4XA 2R7DA 1LTTD 1VQCA 3NWSA 1PH9A 2INCC 3HGBA 3OPOA 3EBEA 1UH6A 4LFAL 1F9QA 2KK8A 4ZRKA 5LXHA 4NXNQ 3CMEA 2CHBD 3U4ZA 5KNBA 4RGMA 3NHHA 1Y14B 4A3LG 2K32A 1D4BA 3Q2AC 4JBJA 1K83H 2IL8A 1A63A 3QC8B 1WFQA 3QQ8B 2CQOA 4JI8L 1EIYB 1YNJC 4NXML 3GTPH 1EWYC 1E8ZA 1FRRA 2Z6KC 3A56A 3HRDD 3HVZA 3S2AA 3U7DA 3RNCC 3AE9B 1JT8A 4LJPB 1IZ6A 5IP7H 1YNND 4AH6A 3TDQA 4NPSA 3E5SA 5E1FA 1F2LA 1L2NA 4X6AH 4YCUA 5AZGA 4YSZB 4EE2A 5BN5A 4YWLA 3K5LA 4DUYQ 3C1EA 2OWOA 4BOZB 4UP9A 3DM3A 4HSPA 3DHIC 5CR3A 4P72A 2UU9L 1W3SA 2MGSA 2YTVA 3HVDA 3SDLC 3BIID 4XDDA 3RI7C 1RCVD 2F0WA 3G71A 4BFRA 1WCMG 3VR6A 4N9PA 1WTHA 1K8OA 2O6VD 4ABNA 1VZ7A 4LMQD 1GC7A 4XE0A 3L2PA 3HFZB 1R4NB 3AEBB 2BA1A 4MDKE 1FGUA 2BE5C 3ZDMC 3M9BA 2EJGC 1CT1D 5K5PA 2GBKA 2JN4A 4DBGA 2V3NA 2I1JA 4ZYSA 1UBQA 1HTOA 1F0ZA 3PT2B 2QCZA 4ZRPA 2B29A 3W9CB 2K39A 5IYCG 2A69C 1SE8A 2I5MX 1VJKA 3A74A 1WI0A 2B2UA 4ZRQA 1JROA 2A6ED 2SEBD 2FNJB 1NR4A 3GTKH 2PJHA 1T9HA 2ZEQA 2KJRA 1UWMA 3AU4A 4FBJB 4DXGA 1EFWA 3T1YQ 1IYJB 1HCZA 4C2MB 2HT1A 2RHQB 3T9LA 2UXDL 3CF6E 3GD7A 3PO2H 1J7AA 2ZXRA 1N5XA 3PLUA 4FHKA 4K3BA 3GTQB 2ZXOA 4AYBE 1HUNA 2C9WB 3NHEB 2MLBA 1EQQA 4LFBQ 4A3EB 1HZ6A 1FCLA 2ZNVC 5EBCA 2P5ZX 3T4AC 1FCCC 2MX2A 1STEA 4KY5A 4M00A 3DCGA 5FJ8G 2NUCA 2F0VA 2IW3A 1ILQA 4KKTA 1HZ5A 1S5FD 2KANA 3BK2A 4TV3A 3ND9A 4HDOA 4BBSB 1FFVA 4W9GA 2G45B 4YSXB 4XGAB 2K5HA 3S15H 5HG2A 4R1JA 3RZOB 4D2KA 4EGVA 4A3MG 1XMQL 4FXCA 1EY8A 2F0MA 3Q8CA 4KTAA 4DAVA 1XCQL 2MEKA 3I70A 2KDIA 1MGSA 1TY2A 2LKVA 3GE8C 4JLCA 4MACA 2I46A 3IRBA 5C6AA 4NDXA 3IT6B 2DZMA 3HOUB 3NUHB 4ICVA 4JI5L 4WWOA 1OXUA 3WDNA 3LJ3A 4BY7B 4TQ1A 5BMIA 3F2CA 1TWAH 3GV6A 1F2ZA 1F77A 1HA5A 1DOKA 4XDCA 2ICEC 2WXHA 3IXSA 2F0OA 2GA4B 3VTWA 1YZ6A 1BBXC 3RN2A 1JWUD 2INNE 3CCUA 2L8JA 5JZEB 1EYCA 4KVGB 1E2ZA 2JEAI 2KXJA 4HPMB 4GLXA 1Q12A 5IP4D 1YIJA 1IW7C 3HOVG 1AZQA 4W9KA 3A8IE 4UHVA 4IUQA 3NTHA 3WAPA 4E74A 4HJ7A 1B9NA 2PNHA 2AYOB 5IN7A 3RZDH 1WVLA 3A8JE 2K75A 3NSWA 4JPBW 3E6ZX 5EPLA 2KWDA 2VH1A 2C5LC 4WJ4A 1OXVA 1J5EL 1VQKA 3KWVA 1ESRA 1KRSA 1MHXA 2L52A 1BCPD 4G3XB 3FMCA 3OIQA 1N33Q 1IBLQ 2NVUI 3S2DB 1A3UA 4NQKE 1KD1C 2IJ0A 2JZ3B 2V4IB 3HKZE 3PCOB 4KHVA 1PH4A 4DR6Q 2B76B 3DHQA 2IZVB 4EUTA 2BOSA 4A93B 2KCNA 2L3ZA 2V1YA 4GLAC 4J3OD 1CA6A 4KY7A 4I7ZC 4RG1A 4GOCA 1YN3A 4KK7A 1FNWA 3MHSD 4YTMB 3U58A 5IOIA 1CI3M 4V0BA 1Q8KA 4MNOA 2OEDA 1E10A 3R7QA 4NAWA 2Y5BB 4QJFA 1YI2A 5AZHA 2VH2A 2B2WA 1SYBA 3GTLB 3K5OA 1GB1A 1WTVA 4QUFA 4NW2A 2JK8A 2WS3B 1K3BC 3E3XA 3RFZB 3MEHA 4A3IG 1T0RC 2O2VA 1I4GA 1NEKB 1WJ6A 3H0GH 4BXXH 1TS2A 3UDXA 1TR5A 3BZCA 2G1EA 1XMOQ 4OVVA 3DBRB 2JZPA 4O42A 4A3JG 2PI2E 2Q2TA 3PGZA 2K6QA 1JOQA 2KWVB 3P4QB 5E6PA 5G5GA 1KTKA 2NN6I 5IA7A 3PV0A 2EKIA 1MIUA 1TWHB 4NKLA 1F1HA 2KN5A 1IUEA 2RD0A 2KQ3A 3PF5A 1Q1BA 4UY8C 2EIFA 3E0EA 3HKZB 4X66Q 2Z1CA 2IO3B 3TP7A 1VLBA 1KABA 1NTGA 3X3MA 2PW7A 1B9MA 4QF4A 5E3FA 3AE2B 4ULLA 4C00A 4FXKC 1J7BA 2GBNA 4DV2Q 4E6IA 2JA5H 1YVCA 1FGBD 5C3WA 1WXMA 4MM3B 1FJGL 2JXMB 1RHPA 2J7ZA 4QQBX 1E7VA 3DVNV 1R9TH 3ZW3A 4C56C 3ULLA 2A74C 2KQSA 2RMMA 5BMHA 1E7PB 4S0RA 2KVZA 1CKMA 3T1HL 2WB1E 1YQ3B 4K14A 5MPOA 4G11A 2E3TA 2PYKA 2OTLA 5I2XA 3KJOA 1HZAA 4MTNA 3TMPB 1LABA 4G7HC 3T13A 3FRPB 1NBWA 2G5DA 3I4OA 1X3QA 3W1GA 4GNXB 3H94A 1SFOB 1N32L 5M5YB 2PW5A 1YMHE 2V9HA 4P1CC 4WJNA 4HCSA 5M5XB 3ITPA 4JI1Q 1G6JA 1RKNA 1Y1WH 2YU9B 1FD6A 4L6TB 4MGZE 5M3MG 3TP8A 2M2LA 3QIJA 4WURA 5IE8A 4JWSC 1UEAB 3L16A 2Z6BA 4N6EB 3UIPB 5KGUA 4KKSA 2WLBA 3J9CA 4PZ8A 4EZLA 4K81A 1AN8A 5LHY1 3ULJA 4DXAB 3CCSA 2DUDA 3DEOA 2X6GA 1ISNA 4HJGE 1V1PB 3NVZA 4YL8A 1WD1A 1JQ4A 4MIUA 2WGSA 2NBUA 2V1CC 2MWSB 3ML8A 3STBD 3MXNB 2NN6H 2R3ZA 3TMEA 2QIEB 4KD3A 4OONA 2UXDQ 1RM6C 2OHFA 5CYUA 2ZCCA 2Q8RE 3AN1A 3PSIA 5D2MB 1XQQA 5HY6A 3SK6A 1QKZA 2KA7A 4NNJB 3A33B 2WAQG 4H7BA 2F0PA 1CJEA 3IFDA 1JE4A 2OJWA 2CU1A 5CBEE 2UXBL 2DNFA 1KAWA 2ZNVB 2CHWA 1XNQL 2AKWB 1XJVA 2YEPB 1ZE3D 4DK6C 1QNUA 2FCQA 1JCKB 2DAFA 4IUTA 4L5SA 1E5WA 4LWCA 1WGGA 1WE6A 4LF6Q 2XK5B 1BDOA 2D0PA 2A5HA 3O13A 5FLMG 3CIRB 1MSGA 2MO1A 3BG3A 2HE7A 1S5CD 2PNRC 3DXJC 2JF5A 3G48A 3HIZA 4PMBA 1QZEA 1TVXA 3AEAB 3DWMA 4BBRG 1E7ZA 3KLSX 3MWYW 3M85A 3I4MB 3S17B 4LLGM 4JI5Q 2O5IC 2QJLA 2R93H 4XTCS 4KSKC 3WALA 2LXAA 1IL8A 1E0BA 4HIKA 1JB7A 1SIJA 2B2VA 3P63A 1ML0D 4FA6A 1X3FA 2O2VB 3SK8A 1ESFA 1EIGA 4RM8A 4A3DB 3I8ZA 3Q8BA 5H92C 2KHWB 1V81A 4DPGA 2PTLA 3EGRA 2RSOA 1YNNC 1SE2A 1QOBA 1J9OA 2MQJA 3W1SA 1Y8OB 4FDBA 4JIOU 1K83B 2CJOA 5I4DA 4BBNC 1WGKA 2BT6A 4OW0A 1MJCA 2F0IA 1SNOA 5EBDA 2JU6X 3GTPB 4REZA 1ASZA 4X57B 1IBXA 3QIAA 3F2UA 3JYUA 5CMDA 4QAYA 3I72A 1L1OA 1J5EQ 3V96A 1L7YA 4NJ6A 3FPPA 3RNAC 1Y1VB 1KRHA 4DV5L 2F0TA 2I5HA 1LT4D 1VQ4A 2PZUA 3VR3A 3CC2A 1E8WA 1MD2D 2W3SA 1VD2A 2W55A 1I4PA 4MGIE 3AFPA 3K7UC 1NI3A 2NS5A 1KDAA 1JMCA 1YQ4B 2JSOA 1B4OA 1L0XB 1WYGA 2ACZB 3P7JA 4APVA 2MBOA 1QLBB 4P73A 5A2QL 3PS6A 5IYBG 4PZ7A 1WRIA 4KGRA 4JWUC 4FJZA 2MJDA 1TXYA 3QX1A 5I6WA 2Z9HA 4GOPB 1MFWA 3DBLI 4J8QA 4KIKA 1EQRA 4BY1H 1KNAA 4QUCA 4B3TQ 4O1NA 4WORA 2BS4B 3B1LX 2A73B 5J39A 4HJKA 2CKHB 4A3CG 1PZJD 3K9OB 2EZVA 1BVSA 5K36G 2IO0B 4LTUA 2J0TD 4B3RL 1C4PA 1U4AA 1F9SA 3ZNGC 1KJTA 4DQOC 5JJIA 4ZQ3A 3QJYA 2HD3A 4PS8A 3T8MA 5L83A 3CKIB 5ELEA 4HIOA 1YJJA 2K50A 2Z0EB 1K8GA 3D4RA 1C9FA 2VB2X 3ZLZA 2FMCA 2V3SA 3CC4A 2QEJC 3VQIA 5EE3A 2E75C 4LNFA 1EYAA 4JBMA 2D07B 3ETRA 3BZDB 2JA7H 1I4QA 4YCWA 3S1NH 1EL0A 2L7RA 2ENBA 4FN2A 3I3CA 1YX5B 3D31A 4JOIC 2E6XA 3A1QA 3HOWB 3L7ZC 2BYTA 1Z5SB 4UP7A 4XT1B 1LM8B 3R3MA 3ZJVA 4ZLTF 4USAA 4DR7L 3N1YC 3GTJH 1TJEA 4DAYB 3URYA 3EROA 3PRPB 1DYQA 1QNKA 1SSNA 3EECA 1LTGD 5JEAJ 3ER0A 1GM5A 1XT9B 4A3EG 1MVKA 2IGHA 4HPPA 3PMFA 3FKYA 3FP9A 3GE3C 2XGTA 1UGJA 3R66C 1PTOF 5I9OA 4LDTB 4OIKA 5EPJA 3V3XA 4KX6B 1D3ZA 1JRPA 4ME5A 1RL2A 1L5PA 4O2DA 4M8NA 3QR8A 1MI2A 1B2TA 5GAEC 4IO9A 3Q8EA 3GTGB 3ZJYC 3DWQA 3Q6BA 5L95C 2LD9A 4YY3L 2PE9A 4CKCA 2UUCQ 1TWAB 2M17A 4FP5D 1P98A 2EELA 3ERQA 1SBBB 3E9HA 5T1GA 4KDLB 3GTOH 3H9DA 5HI1A 2K04A 4N58A 3UF8A 4L23A 3HOUG 1XYIA 1AEXA 3VHTC 5J17A 3DUZA 2JPHA 4BY7G 2WDRB 2MCNB 4XIGS 2CS4A 5JVG3 1SN8A 4DV4Q 3E9SA 1DOYA 4M02A 2BB6A 1YHQA 2C7MB 4EZKA 1G51A 1NJIC 4XXEA 1YOVB 1D5ZC 3EUB2 4AWJA 4S3SA 1GG3A 2B2TC 2ZJRA 1L2FA 4QGUA 4L63B 1EWIA 4CGYB 1N62A 4RM9A 2WXOA 3R7RA 4CQNA 4JX1C 1NCVA 2HTME 2MHJA 1OEYA 3BDCA 1GJXA 4JW0A 4ZDVA 5C3EB 4JYAL 2KX0A 4A4IA 3I63C 4B0EA 3D32A 2ZVOA 1L1OB 2EXDA 4WH4A 3BDLA 3W5OA 2KTFA 2UXBQ 1DOXA 3GOEA 2DYOA 3MJWA 3RCZA 1ZKOA 3KLWA 4FXGC 1UEBA 4H02A 4IQZA 1GUGA 5ELBA 4MH8A 4H0LC 4DA2A 1I94L 2J0JA 3N52A 2K6DB 3U7ZA 1NMFA 4K7SA 3QB3A 1SNDA 5CV4A 4TSSA 1B7YB 2ZM6Q 2SOBA 5JJLA 2LRUA 2XSCA 2F52A 1VMCA 3PUWA 4CKBA 4PS7A 4DGZA 2BPSA 1MJDA 2F3IA 4A93G 1XLQA 2N7JA 3AEGB 3ERSX 5DPRA 2BKFA 4DR5Q 1K52A 3KDFB 2CW0C 2SNMA 2ON8A 3RMKC 4A3FH 4I6LB 1HR0W 1YX6B 1LM0A 4IFDJ 4IURA 1CM9A 4DUZL 2VUMB 1H4RA 1R4MI 1WXAA 2M1MA 3W1YA 3Q6SA 2LXJA 4UAIA 2N1VA 1D5MC 2K5NA 3KUDB 5C44H 2VQFL 4ANXA 2MO0A 2K3UA 1TT2A 2KZRA 1WTXA 5LNK1 2E2HB 1JMLA 5AUIA 5LMUL 2GVAA 3H1UA 3NQIA 1FXAA 2GVBA 5C4XB 2KEEA 1AW7A 2K8CA 4ALPA 5KYLA 4EQNA 1YJNA 1Q86C 3MFYA 3QOLA 1N34L 1WJNA 3NZ3A 2F0SA 2JA8B 3KFUA 1DOMA 1AE3A 2LFIA 2N49A 5A2QE 4FO2A 4LAAA 3FPUB 2G9DA 2EKEC 3A4SC 1A0IA 4QB4A 1X65A 1WYDA 1D6EC 1EYGA 2ES2A 3A1QB 1VQOA 1AARA 1I42A 2EYMA 3SXHA 4XC2A 4URKA 2J7QB 1BKBA 1W6JA 1EY6A 3HKZG 3CPWA 2B63H 1G91A 1JJCB 1S1QB 2KMMA 4IKGA 4Y7NH 1A70A 3LWUA 2NVYB 1R9TB 1KQSA 1S40A 4P7IA 3TJPA 1B8AA 3SHLA 1EEFD 1JJ2A 3HM6X 1HR0L 3U52E 2MNAA 1YJWA 1TS3A 1Q5WB 2RQXA 3SDZA 2C9OA 3A0JA 3QA8A 4W9FA 4DHJB 5AEKB 5IYDH 1HQRD 2EYLA 3KOJA 4JV5Q 3NWTA 1UWXA 2ZXPA 5M5WH 4IM0A 3A55A 2HTHA 4C3JG 1CFMA 3SFEB 1ZPSA 4ZAIA 3RMHA 5GAHC 1JB3A 3NRZA 4FF1A 4DR1L 5DNFA 3OW7A 2WNMA 3Q3JA 3QARA 1R4PB 4LNQA 1AWDA 2IYDB 4C3IH 2WU5B 1VQJA 2WKDA 3GDEA 5FO9B 5JVH3 3MC8A 2BCOA 3PO0A 4LJZC 3OOCA 1K0RA 2O4XA 1MG4A 3RNFC 2R6GA 3DM1A 1JW9D 2GBRA 3KYHC 4DXFA 5GROA 2K5DA 1YITA 2L32A 2DN8A 3QO2A 4LDTD 1EU3A 4WAAA 2L0TA 1HEZE 2WXMA 3AE8B 4EQOA 1P0RA 4ZHPA 4EKUA 1Y56A 2IHFA 4YWMA 4F8CB 1IBKQ 3QHTA 2WINB 1IPGA 2WACA 4HROA 4RNAA 4A9AA 4KKUA 4LW1A 2JQOA 1PFBA 3N30A 1PRTB 3ZYYX 2DNCA 4TKNA 4ARCA 1SMYD 3J80i 3U4VA 1EUVB 5TSSA 1K8AC 1L4DB 3H91A 3A7AB 3HOYB 4U68A 4DR7Q 3CSFA 2F0GA 4BBNF 2BYFA 5FR6A 4DK5A 3M3JA 3KH0A 3SE0A 4W9EA 1OEYJ 2PVOD 4MSQB 2UUBQ 5D7GA 2PCFB 3CRLC 3JC66 4A76A 4OWWB 1HUMA 2VQEQ 2F0KA 1NMGA 2Q8TA 5M3FB 1NSNS 1VF7A 2KYWA 3H3VI 5CV9A 4GDKB 3RLNA 1FMAD 1KLVA 2MBBB 1L6VA 4RCOA 1TYGB 1SJHD 1UWVA 1BT0A 1LXDA 1JE5A 2RSUA 2R92H 2KMCA 2AUKA 2FXQA 1MHWC 3TBIB 1LUZA 3UQAA 4R8IA 4LNIA 4XZ4A 2R93B 2JYEA 4POGA 2LS01 4EEWA 1XNRL 4Q2JA 1WD0A 1KL9A 2EVBA 1PH2A 3K7AB 2RF4A 5IOCA 4DR3L 2GOWA 2KACA 1BUIC 4FULA 3I4MG 1WGRA 2GN5A 3TP5A 4DNTB 3MZ5A 4A3LH 4KHPQ 2M56B 3L0WB 3T3OA 4DR4L 3UE1A 1E1TA 2WP8J 5IGFA 5EKKA 3GQBA 2B3GA 2ZCBA 5LMNQ 4A3DG 2DYBA 5IO9A 1I50B 5IGGA 3NK9A 1U4MA 4PZ6A 1JJGA 2JSVX 4NQLB 2CWAA 4ODGA 5EJWA 2NVXB 1PTOH 2JA9A 3RLFA 1I5FA 3L54A 2F0UA 4RA8A 1B53A 5T8IA 2K8HA 4PNYA 3Q3OC 3PTFC 2BH8A 2RPQA 1X6OA 3RNBC 3D3RA 3S14H 2VL6A 2RGFA 5AUKA 5IP7G 5EAYA 4A3GB 4B95A 1Y1VG 4AP4C 5D3IB 1CK1A 1PZID 2L0CA 2TMPA 1WCMH 5G3LF 5LL6S 1LGRA 2GRIA 2KN4A 2CR5A 1IP9A 4X65L 4R4IA 1V43A 3DLLA 2SNSA 5EDSA 1KAAA 2Y5PA 1V8QA 2WIIB 2Q5WD 3GV3A 1WTOA 3J7A5 1UF0A 3C1FA 3H3VH 1WGHA 5FLXL 4KGTA 1Q10A 1YN4A 2H1EA 2EY2A 1ROEA 2EOTA 4BY1B 4LNOA 1TT5B 3VH4B 5EQ0A 4X3KA 5IYCH 4DUZQ 3DVGY 1C4CA 1I35A 1WJ4A 4DV6Q 4JI3L 2B39A 5JHBA 1NYRA 2G3QB 2RR9A 2ZTDA 2PPBC 3V61A 1Y69U 5FLXc 4DHJD 3PGEA 2AL6A 2AEHA 2JQRB 2FAZA 1PYWD 2LEKA 3M4PA 3I73A 4F8MA 2C7HA 3FILB 2X69A 3NVWA 1BO0A 2LVOA 4II3B 2L11A 2Z6KA 4ZRZA 3UDIA 1X32A 1TKEA 5FK9C 4MM3A 1OO9B 4C3HB 4RCNA 3TN2A 5ELOA 3OMCA 1BCPF 1PYSB 4HTHA 1XLNA 1C79A 1WIAA 5FJ8H 2SAKA 3AMZA 4RWSC 4OVZA 1Y8PB 3VDZA 3MXPA 5CV7A 3S1RH 3S1QH 2DX5B 4GLVB 2FINB 2D0OA 3W3AA 3C0RB 2J53A 5KHQA 4B3SL 4AQYQ 3HOWG 4MGYE 4GNXA 1QVGA 4US8A 1VQPA 1ONLA 5G3LD 2PI2A 2L83A 5JEAG 1YHAA 5F2DA 2L5TA 4A3MH 2PQEA 4K6DA 5LL6X 1V2YA 4X64Q 4IDIA 4ARIA 3M4QA 1J7CA 1H9JA 1I4HA 1LACA 1ZXIA 4LF4L 3OJ4B 4A8XC 5J1ZA 1IXRA 2QEXA 4LK1C 3ZVVA 1ZGUB 2MW5A 5TR5A 2CU3A 1A15A 2LGYA 1PRTD 2HIVA 1QCBD 2NB0A 3CRKC 3L9AX 4L2YA 5E4WC 3TS0A 2BDNA 3ZO5B 2DJFC 2F3WA 2A6HC 2UXCL 2BB5A 3P4RB 1FFUA 3LWEA 1P1AA 1WXVA 4XX5A 3KBXA 2OT2A 5IIFA 4AYBB 4GKKL 1YNXA 2JYOA 3S2HB 3NOBA 1V1PA 4LF7L 2H5XA 3DBLB 4LF5Q 2Q2HA 3MXNA 5JXVA 1QOGA 4B3MQ 3TL5A 3BK1A 2WX0A 1E1OA 2ID0A 3M7GA 3KLSA 4DV3L 3GTMB 1WX8A 3U9SA 4AIMA 4R4CA 4IG7B 4FADA 4IZ8A 2XRQD 3TZUA 3N20C 3KK7A 1PTOC 3KYDD 1TQOA 4FHJA 4MZ9A 4YTPB 1V5OA 1WM3A 5CHVC 5G55A 3W1BA 4K0KL 4JE3B 3WAOA 3ZTCA 1X55A 3CHBD 4GXBA 1JR0D 1A6XA 1STAA 1PQSA 2E2JB 1SF0A 2F4VL 4I65A 1HZ9A 1T0YA 2BA0A 1I6HH 2HD5B 2CHXA 4ACFA 3OIPA 5BN4A 1PFSA 2XK5A 3K58A 3AMUA 5E6OA 3ZIMA 3VTUA 5DM73 2KCTA 5ELFA 2MRPA 2FFKB 5C3EG 4LNKA 1V1QA 3HOZB 1UE6A 4BVUC 4TQ0A 4CDCC 5ELNA 3FEWX 2R61A 5I9PA 3G7LA 5IWAQ 3S16H 4HN7A 4GKJQ 3J7ZC 1TZOA 2KQ4X 1QUQA 2D2CC 3H3VC 4NJCA 1EZ6A 4JK1C 1VR9A 1UE1A 1QE6A 3D8GA 1C9OA 2JP1A 1QZGA 1XEEA 3UE0A 3MEFA 3RNGC 1J0GA 4A3IH 3M3YH 1NDDA 2LWPA 4A3FB 4ICUA 4LFCL 1U4RA 3CXCA 2LUEA 1F9PA 2DAJA 1P8LA 4ZHOA 1NE3A 2YLMA 4BKGA 4B6WA 5E4XA 2W9NA 4LFAQ 4A3JH 4IFDG 3VR8B 2K01A 3PO3B 1M94A 4DR3Q 2JXTA 3ECIA 4ZYNA 1LTLA 2WDQB 3OWEB 4R4QA 1T5EA 5C4ZA 3S1MB 1R4QB 1QZHA 3QOJA 2HCIA 2BDOA 4JI8Q 1P7EA 1U4PA 2OXPA 4PQXA 4NXMQ 2VUMG 2IO2B 1HQMC 2N9KA 3DDCB 3NY5A 4K7UA 1N36L 1TIID 3HRZC 1N8RC 2BS3B 1PXUA 1K73C 1JWSD 1MKHA 4L5RC 3Q8AA 1C1YB 5AJ3L 1PYBA 1WGYA 3X0WA 1Y8RC 4KY6A 2UUAL 1P9DU 4YSYB 5FLXE 5C4XG 1KH0A 4W9IA 1EO6A 3MA2B 4M1UB 4A6QA 4JQWC 1UELA 3UDGA 4ZRJA 2JUOA 5BYSA 2JA8G 5KNCA 2B63B 1VDVA 2DHZA 4IWQA 3M4OB 4FJYA 3I56A 2UU9Q 4WWPA 4KZ0A 3EFCA 3Q3FA 5E6JA 1I3QB 2CWPA 3SVMA 2NVQH 2WV6D 3HOXH 1IGCA 5J22A 1RAXA 4GOPA 3A9JA 3AU5A 3D6CA 3R2TA 1KXLA 2I07B 3JAML 5IODA 1SYCA 4JI6L 2KTRB 3AB5A 1K8MA 1S5DD 4IPHA 4DK0A 4DR2L 5M5WB 4QCLA 1QVFA 1V80A 1H9KA 3C8YA 1ENCA 3IVFA 2ONQA 1XPOA 5ELDA 2H89B 5M3MH 4FF2A 2JWZA 4A3KG 1K51A 3TIXA 3SK4A 2JY6A 2J42A 5C23A 2R7ZB 3B9JA 2MJ8A 1K8RB 5CGKA 3LYYA 1ZYRC 3B0AA 3FHWA 3JAMc 3PZ8A 1Q1EA 2PE6B 4A3BB 3CAMA 5BYQA 3PRZA 1SRUA 5JOBA 3TCAA 1H9SA 1CZWA 1MBYA 2ASBA 3BVZA 4G50A 4AJWA 4HJ8A 3DBHB 1OXSC 3WIMA 5C0XG 1KF6B 4JPSA 1SEBD 1ZKHA 2K52A 4L5TA 1JQYD 4DAYA 2WB1B 1H9MA 4IUMB 3VDYA 2CCZA 2FCSA 5COYA 5IGBA 2REXA 2WXKA 1CA5A 4WJPA 5KRUA 4JI4L 4ZRIA 3W1SC 5J3BA 1XTCD 3Q8FA 1B70B 3BZKA 1RTOA 1ZW7A 4L1BA 4IW0A 4OO1G 1CKOA 4DNIA 2FCNA 1JOOA 4OEMB 3B2FA 3JVZX 4IOIE 2WP9B 1DZ1A 3AXCA 1HFGA 1LTAD 2E76C 4IM3A 2KVMA 1BQQT 1XMQQ 1RYJA 3DWGC 4BWGB 1Z6HA 1QOHA 3AYHB 2E2IH 2INPE 3AEDB 5FLMH 4YHHL 3HOYG 2IHEA 4CJ1B 4BAXA 4AQ7A 3DOWA 4MSMB 4I7AA 4WFN3 3LDZE 3RUZA 3WOEA 1TIFA 4BBRH 2HHHL 1QUQB 4DU9A 4YIJA 5GAGC 1HTLD 2D62A 1RDPD 2ICIA 4KLKA 2OOBB 1A62A 2MBEA 3UGBB 1G2TA 5M3FG 4OXPA 4TRDA 4OL7A 2KAJA 3CW2C 2IDYA 1FEHA 2J52A 4HJ9A 4NY0A 5KEEA 4GSWA 3PHXB 3MHZA 1GUAB 3PLVA 1ZDVA 3FKIH 3OTOL 2R93G 3UQBA 4R4OA 1K28A 2WKCA 5ISRA 4ANWA 2K28A 4W9DA 1Z2MA 1YIWA 3P42A 1JWBD 2OTJA 3A5ZB 2MQHA 1KLGD 1PLFA 1VQ8A 3WOFA 3S24A 2B3AA 2PVGC 2W54A 4R9WA 4F88A 2NZHA 4P1BC 2GBMA 2L55A 2LMCA 3I4NH 2JA6H 1PTOB 1QWYA 3OHXC 1EF5A 5HGTA 2PMVA 4ZCKA 1SSOA 1TZ1A 4ZUJA 5CX3A 2PQAA 3J81L 2L76A 3CSTA 5T1IA 4PK1A 4K5XA 4IWOA 1Z47A 1B1ZA 1KDBA 1RIPA 3DWPA 3Q8DA 4RGTA 3CCLA 4FLHA 2EPBA 1XX8A 3KDFA 4H2AA 5LLIA 4DWFA 2A6EC 4GN3B 4KJOA 3J81c 1HH2P 5IYBH 2LHEA 2IGGA 2N9XA 4WRDA 3A9JB 1SR3A 4V190 5JAVA 1L6UA 3M4YA 5CORA 1EIHA 3MFGA 1X1MA 2XWJB 3NG0A 2D10A 4ZOHC 2MP2A 3O65B 4A3GG 1NY4A 2K33A 1EZ8A 3TSSA 4LUZA 3EHVA 3PQIA 1WWTA 3W5VB 2ZW0A 4BS9A 1F9RA 5HKHA 5HHDG 3P75A 1HJPA 1SE3A 3EIVA 4A3CH 3DMUA 5K36H 4XYCA 4OGQC 1K53A 3GB1A 3GTKB 2YEPF 4XWTA 1SNQA 2K7VA 5IGDA 5IP9H 2B2YC 2WXJA 5BO4B 1KOTA 3MTSA 1STYA 2PPHA 3L10B 1CHPD 1UE5A 1EQTA 5CV8A 3F2BA 4QL5A 3PUVA 4BY1G 4F7XA 1WOCA 5KIXA 2GLSA 4QMGA 3M62B 2QMTA 4JC0A 3AM9A 3ZUNA 2I38A 1N9WA 3B6YA 3CCQA 1H9SB 3PO2B 1FO4A 2YYZA 1YQBA 4JG2A 1R7SA 4AJYB 4OX9L 2NR2A 2K6AA 1GUWA 1F2RI 3APFA 2F0HA 4DF7A 2X38A 2V0GA 3JAME 1PV4A 3E0JA 2L05A 2BE5D 1BUVT 5AJ3Q 3CC7A 4HEA1 2CQAA 4MH0E 4F1SA 5JPMC 4C2MH 1FJGQ 4K3CA 3SEBA 1XCTL 1PGBA 1TU2B 1E9MA 3S1QB 1HZCA 5C4JH 3X3NA 3GTQH 3K81C 4LF8L 2A69D 1HNZL 3H7PA 5C3XA 4N59A 4K2KA 3S15B 4A3EH 2DBYA 3T1HQ 1OTRB 3E9IA 4C3HG 3DEPA 2GB1A 3JSVA 4HPLB 4JGHB 1SJED 2C7NB 4JBWA 5EE0A 1FVIA 2KJ6A 1TWCH 4US9A 4DHZE 1WJUA 1VQNA 4XDXA 4A3MB 2LUMA 4BBSG 3FC4A 1TWFH 1N32Q 1LTRD 3NS8A 4TUUA 2A19A 3Q24A 2I5LX 2KDFB 2D3AA 3VAWA 4C7YA 4OZCA 1NUCA 1N63A 3NQTA 2B8FA 4DV0L 3RZOH 1FXIA 2KC2A 3U8ZA 2K1BA 4KN4C 2JVCA 1N6ZA 2XTIA 3KLRA 1U5KA 1WX7A 3NBIA 1FXTB 1MHHE 1MI0A 2GBJA 2PMZE 2RSNA 4KSLC 1X54A 3HOUH 1ET9A 1BCPC 4DV7L 2NPTA 4BY7H 3DBRI 3HHMA 1VZ6A 1WM2A 3QJZA 2K5WA 3R3OA 3VUYA 4F7ZA 2FMMA 2HDLA 1AFPA 2L1BA 5EE1A 3RZDB 1C4QA 4AYBG 1S5ED 1P7FA 1GHJA 4J15A 1IBML 4LF9L 1WXSA 2KDMA 4HVBA 3NVVA 1VQ5A 3RNEC 1FD7D 2V3PA 3EJIA 1EY9A 3HM3A 2EYFA 1VQGA 2WXRA 3L0OA 4YWKA 1XNQQ 1PH8A 3ZJTA 2PO4A 2KCMA 2LMCB 1PMRA 1AE2A 5GADC 4LNNA 2YV5A 1UD7A 3KVFB 2X8XX 2LXCA 1EY4A 1J8IA 2EMTA 5C4HA 4GDKA 2QHOA 1Q3LA 4X3TA 4FXDA 2PQAB 3SU8X 4ANVA 5IGCA 1GJZA 2FHTA 2AWNA 1KRTA 3NENA 1VQ6A 4GMVA 1FNUA 3ZTDA 4DUYL 1LO5D 2IX1A 4HR7B 5I2YA 3DPDA 1GAQB 1G8ZD 1GVPA 4KI0A 2PMZB 4J6HA 4GLSC 1UNSA 3HP3A 1A2TA 3LGJA 3WANA 1HZBA 2AQ2B 2EQSA 4IUUA 5CV6A 3H0GB 3CCMA 3HOZG 1AH9A 1NENB 3M3YB 2KD0A 2LJIA 3M95A 5D94A 2KBNA 2MP2B 1CHQD 1EOVA 2AQ3B 2QDBA 2KECA 1YJIA 4BOSC 1VDZA 3J7YW 1DXMA 3QAQA 2ZTEA 3KF6A 3SFDB 2NBFA 3OSOA 2BS2B 4IM2A 2Z4HA 3PREA 1H8CA 3J81E 4A3FG 1JWMD 2O2LD 4DAMA 1V97A 3LXFA 3M7NA 3OTOQ 4PYZA 3I55A 4AOFA 2M4NA 4II2B 4LUVA 1UZXB 2B2TA 3TREA 2OJRA 4N8X1 5EPKA 2JX5A 1A3TA 1MSHA 3VA7A 2QA4A 3PO3G 1OQQA 3ABVB 3VH3B 4KKIA 3ZGZA 1ZP0B 3CF5A 2L0FA 3T1YL 1TWHH 3NZUA 1EQVA 4DK3C 2JA5B 3D0FA 3IT4B 4DV5Q 1WI5A 3EC8A 1V9PA 4QIWE 1P3QU 5M9OA 3K9PB 4IUPA 2BYEA 4RFBA 1X56A 3RN5A 1WGDA 1Z7TA 2O6VB 1SLJA 1U9RA 4LFBL 4RMFA 3MHBA 2TSSA 3H7PB 1E2WA 1I4RA 2L9HA 3D4WA 3RN9C 1JWAD 1EM7A 3LX0A 2WAQE 4IPDA 2K22A 1PH6A 2NVQB 4DNRB 2LJ5A 2KCCA 3HK0A 1SNMA 2K5QA 3HOXB 1LT6D 3I3TB 2LZ6A 3JSVB 4XQQA 3Q3NC 2ZT9C 4M8MA 2NYZD 1STGA 2XVSA 2IBIB 1YEZA 4C3JH 1WE7A 3CMAA 1LTSD 2HDEA 1Y1WB 3STBC 4BA1I 4WJ3M 4RF1A 1UAPA 2F1MA 1S72A 5GQOA 5HURA 3Q0AA 2CVRA 2F0QA 2KLCA 2JEBI 5M3MB 4DV1L 4B3RQ 5M5YH 1SFOH 2K4KA 2KVRA 3CP0A 2GI9A 3AH7A 2M9VA 2JRHA 1XWEA 2QILA 5C0XJ 1P16A 2LGSA 3FILA 1GO3E 4OVUA 2R7FA 1HNXL 3HUIA 3IAYA 5CBAE 2NPTB 4CYEA 1A8VA 3VYSA 2R7ZG 2A8VA 4GZYC 1IHZA 2MP1A 3VUWA 3PUZA 4CDFC 1TTNA 4IJLA 5EE9A 2LASA 2N8NA 1PFDA 4OIJA 1RLFA 2YTXA 4A3BG 1V5TA 3U2SC 3AEEB 3VYUA 4FF4A 1F2RC 3SD5A 3SHQA 4IOAA 2KFKB 2BWES 2LGIA 2PIAA 1GC6A 2WAQB 2K9XA 3PRMB 3K0XA 1CSQA 3P20A 4XYQA 3H6NA 4HKZE 3WA0A 1JC7A 2XBBC 1V86A 5FO7B 3A4RA 1ENAA 4PYUA 4OELB 2WB1G 4DN4M 1HNZQ 2KOLA 4NPNA 3A7LA 2NMQA 5D65A 1C7YA 1N33L 2D2QA 3AEFB 4GU2A 2IX3A 2BBCA 1C3TA 2E2IB 4FYDA 3C2PA 2IY5B 4B9XA 1WF9A 4AUQC 2R2QA 1SYFA 4MTKA 2D5DA 2EMSA 3R2IA 2D3BA 4Z9CB 1C48A 3I5JC 3VUXA 4YY3Q 3I4LA 1SAPA 2MSED 1VZ8A 3I9V1 4K7WA 4HLEA 4DV0Q 2F0NA 2DYMA 5D6JB 1J6QA 2KHSA 4MGKE 3K80C 4RGOS 5C5LA 1BOSA 1YJ1A 1A5RA 1E3PA 1ZDXA 2F0DA 3L17A 4WJWA 1E22A 2LXKA 2K5PA 4K5WA 2FBWB 1E2VA 2Z4IA 3I4MH 3S17H 3CU7A 1XF5L 3VTVA 1QOFA 3KF6B 2VNUD 4A75A 2A4ZA 2OCEA 3FKIB 3DVGX 2DJGC 5LXIB 1WFYA 1PFNA 1SDFA 4TMAB 1YJ9A 1XMOL 3WWVA 4A3DH 1NVID 2B2UC 2K03A 3AE3B 1WTRA 2F4IA 2INDC 2ZZPB 4WQMA 5BR8L 1RF2D 2WXNA 3EA6A 2NVTH 1AP0A 1EFID 1IBMQ 4LF9Q 2EY5A 2EE1A 4JYAQ 2KKCA 1FNVA 2LGXA 5DAUA 3IAM1 4HWIB 4HDQA 2WHIA 1EIFA 4GDLA 1QOAA 3I4NB 2JA6B 4JI2L 3RULA 3OWFA 4Y52H 3T16A 1PH5A 4KV6A 1ET6A 4X66L 3NVYA 1RFAA 4OWTB 3IAS1 1D5XC 3F8TA 1VS0A 2F3VA 2PLPA 1STBA 3HZXA 3T51B 2C35B 3APCA 2QF7A 1I94Q 2BVCA 5H8YE 4DV2L 4XWWA 4HMJA 3AQQA 1Y1VH 1UGMA 5JHAA 2DZKA 3CPFA 3NP8A 1T3QA 1V49A 3DHHC 3E56A 2W3RA 3GZNI 2CH4A 1YN5A 1GPXA 2SDFA 4RH6A 2DY7A 3ONAB 1HXYD 2KNBA 1L0VB 2DZIA 3V05A 2IPKD 2R2OA 2MA9B 4TKOB 2MUYA 2WXFA 1PRTF 1F2MA 4GNXC 1LLRD 1SMXA 2DGYA 2KLGA 2XN9C 4H13C 1LYLA 1V9JA 3PSEB 1ZEQX 4UPAA 4JI7L 3K5NA 3KJPA 3K5MA 1E0ZA 3KF8A 2VQFQ 2ASQA 1SNPA 3BVMA 1RD9D 4UDUC 4JI1L 1C4AA 1EOTA 2E5LL 4KDIC 2JYTA 5LMUQ 2AQ1B 3PVLA 3P4PB 3NTIA 2OQ0A 1LTID 1DM0B 3A9KB 3I91A 3ZQ4A 3K0YA 2JA7B 1S5BD 2ATWA 1N34Q 3H15A 3S1NB 1D1KA 3QK0A 1BF4A 2LI5A 1T0SC 3TZDA 1E90A 4HRSA 3RR5A 1HFNA 3OLMD 1PVOA 3V2TA 1QVCA 4BZAA 1K0SA 1KHIA 4JBKA 2M00A 3A8KE 2XNAC 3GTJB 1JALA 3V6EB 3PO2G 3V62A 5FOBB 4HIDA 1C8CA 1E7UA 3VRBB 3RZWC 2JXXA 2ZPYA 2LVQA 5C4JB 1Q90A 2IX0A 1K9MC 2BYVE 4MT5A 3QWNA 3HOWH 4WWMA 2KO3A 3T3NA 3MC9A 1HNWL 1HR0Q 4QY7A 1G2SA 2L00B 1E8YA 2KTRA 5JEAH 5C3JB 1O80A 2A1AA 1NI2A 4ANUA 4DDID 4W9HA 1TWCB 2LHDA 3VR2A 3VR5A 1TWFB 3GS2A 4CBVA 4YWGG 2L1AA 4NZLB 1V1OA 2D3GA 1I7HA 1QT9A 3GO5A 2KDEB 3SGIA 1OXTA 4DR1Q 2MJ3A 4IFDI 1XLPA 4LF6L 1PFMA 2N0SB 1L0WA 4JVZA 3VRAB 2LSSA 2WXLA 3GTOB 2N78A 1UE7A 4EVOA 4P6VF 4L8JA 2B2WC 4ME3A 4DV1Q 2DENB 3GTGH 1XPUA 3P4SB 3HOVH 3OG5A 1HPCA 5A35A 2HQEA 3IFWB 2MJEA 1EY5A 4W9CA 1GD7A 3ALBA 2NBVB 2VS1A 1HNXQ 3K6OA 3KUZA 1WTQA 1RFKA 3IBEA 1LT5D 3J7AF 1TGZB 5L37A 3RYTA 1MPEA 3AI5A 4FVMA 1B50A 3ZNID 5JJKA 4B9WA 2LGDA 3VVWB 2JJQA 2QCPX 2A68D 3BVGA 1X9NA 4RF0A 2L4NA 3NTKA 3VR4A 4K5VA 3TS2A 4XT3B 1LFDA 3KUCB 1VQMA 1KNEA 1D7QA 3MAQA 1CUKA 2VXWA 3PZDA 1M90C 1VQ9A 1SGHA 2H88B 4GDLB 2IO1B 2ZJPA 2RDBC 2WXQA 4IPGA 1PDQA 4W9LA 1TY0A 3J7AV 1C77A 1C78A 3BYTB 4NB3A 3DWAA 1TS5A 2VZAA 4DK1A 5C3EH 3PIPA 4KHZA 2KENA 1V6EA 1PUTA 5EKIA 4HXDA 1D8LA 1D2BA 2EY6A 2Z8LA 5IGEA 5JJZA 1WYWB 3EFXD 2WQYB 4RHRA 1LV9A 4HJ5A 3KQ4A 4B08A 2ZJDA 3KBGA 2QGQA 3UI2A 2WU2B 4HCEA 1PH7A 5BN3A 2G4DB 1A3VA 4KMUC 2RKSA 1XNRQ 2BQQA 4HK2A 2RDGA 4N9TA 3C3LA 4GOPC 3RNUA 4Q5VA 3L4PA 1WRDB 3BS1A 2PKOA 4POFA 5C44B 4IFDH 4IC7B 1ENFA 2IY0B 5G2NA 4IUVA 5CV5A 3TBLD 1A2UA 2L15A 5C0XI 1O7YA 1YNTE 1TBEA 2RDFA 3KF8B 2WDVB 2G9HD 3H0GG 4B3TL 4DR4Q 4BXXG 2MH7A 2NTTA 4BKSD 2FJ2A 4MHEA 2AHOB 5DEHA 1BBWA 2EY1A 3G6JB 2VUMH 2PZWA 2VRRB 1VQAA 3IG3A 3X23A 4RKBA 1YBYA 4J1MA 4WWNA 1HTPA 4C1NI 2WXGA 1WZ3A 4MJSA 1J8CA 2FE8A 2KJHB 1L4ZB 3ZXVA 1Q1OA 5BR8Q 4FNFA 2PZTA 4C1NK 1DD2A 1VF5C 2E2HH 4OO1I 5DPTA 5DCNA 3SR6A 2CW0D 3CMMB 3D4DA 5IT9L 4RHSA 2B8GA 5IY0A 1STHA 1KIXA 3AE5B 3A54A 2EYHA 3FVQA 5C4XH 3A5UA 2KOXA 4AS1A 5NUCA 3NBHA 1TKWB 3MXUA 3CQZH 1I6VC 4JI2Q 4Y7NB 3PZ7A 2JA8H 4ITKA 2DZJA 3H09A 1PGXA 1GHKA 1F52A 4E71A 1PA6A 1EWHA 1JRUA 3ENEA 2NBWB 4PS3A 2HJ8A 1B9RA 2JA5G 1NYQA 1U4LA 3AB9A 3S9WA 1OTCA 5IT9c 4M8AA 4A3OA 2BH2A 1S3SG 2KX3A 3W2DA 1ZXTA 4X65Q 4HSVA 3EVQA 3PIOA 4EOYA
chains in the Genus database with same CATH topology
3CWIA 1Q8IA 4HAEA 4C3JB 3K57A 3BDOA 1CTMA 4C3IB 4YTNB 1BXTA 1BNZA 4IUNA 5D3DA 1WTPA 1SE4A 1PZKD 1KLUD 1SMYC 1LT3D 1IKMA 2B2VC 2F0FA 1N5WA 4YXDB 2F0LA 3Q22A 1IGDA 5C0XH 4A90A 1C76A 3MVVA 2HUGA 4NP5A 1W6KA 3HS0C 3T56B 4WAFA 4OZBA 2OEOA 2NN6G 4ZKCB 1EY0A 3AE6B 4OO1H 2RBMA 3AV8A 2AWOA 4MN3A 1HA6A 4DFAA 3PUYA 2Y0SB 1FM0D 1K50A 1SYEA 3IL8A 1GUOA 2R92B 2DY8A 3QG1A 4DAPA 4G57A 5C5MA 2N55A 1D1IA 4PV1C 2PW9A 2RA4A 4EQPA 1QILA 3GP7A 2Q8IB 4NAWB 2H4OA 1RODA 3VA5A 1NR2A 1B3AA 4ID6A 4RAUC 3NXWA 4CJ2C 2RPVA 4XQNA 4CJ0B 1QG7A 4A9AA 3LB8C 1GOZA 2N9LA 4X3UA 1ICWA 2NVTB 1PDXA 2EYOA 1BR9A 1DOLA 3UI3A 3ZJUA 2EJMA 1RJTA 3N9YC 3PIP3 3RD4A 4HSVA 4CKEA 3BWUD 3S14B 4G7OC 3PUXA 2F0JA 3Q23A 4IN3A 2W82A 4FF3A 1CQFA 1OXXK 4HMIA 2CJNA 1WCMB 1YNJD 3W5UB 5GXGB 3OMGA 2HCCA 4TQUS 1QJOA 1FR3A 5EKLA 3C46A 1GUTA 4ILWA 1FIQA 2F03A 5KYIA 2IWHA 1HHVA 2RDHA 2I2YA 5KNDA 1WXQA 5IT9E 4K8JA 1EU4A 4LK0M 1HRJA 1CZGA 4KKJA 1NAPA 5BYRA 1RWSA 1JORA 1GUSA 2N88A 4KJNA 2NTSA 2EYPA 5HFYA 3FDTA 5FO8B 3MP9A 4C80A 2NWGA 1VRAB 4XYOA 1O78A 2MHVA 2V4DA 4R8NA 3R93A 2E74C 4G7ZC 1FYCA 5FKAC 2AUJD 2EDGA 4A55A 3N6RA 2Y5CA 1TS4A 3S1RB 1GUNA 1PRTC 1VMPA 1B44D 2DNEA 4KGSA 1XXGA 1N60A 2LY7A 4ZUIA 3KUPA 3U4EG 4KD4A 3PIO3 4K6LA 1ACCA 3IFTA 3I90A 4Q0FA 1LTBD 3J80L 2QSDA 2C5CA 3NPPA 2VZKB 4K8IA 3SR1A 2IT1A 5I6YA 4PMWA 3RPFC 1GXDC 1EY7A 3MJ5A 4NAMA 3TEYA 5ELCA 2A68C 2KJXA 1M4VA 2B2YA 2NZ1D 3AE1B 3VR9B 3HOVB 2E2DC 4H44C 2WXPA 3AECB 5JPNC 1M8AA 1FRDA 1L0YB 1O7ZA 2OF1A 1I6HB 4OZAA 4ZKBB 2A6HD 1SNCA 1O7LA 3LNNA 2K0PA 3H8HA 1IW7D 2MPMA 5DM63 3AE4B 4PT5A 3TUOA 1IBXB 1IKLA 1DJRD 4HEDA 4IALA 4ARCA 4RKLA 4M0WA 4R3DA 3S16B 3D6WA 4OHJA 1I4XA 2RVLA 4KN7C 1PTOD 3HG9A 5CC4A 4A3IB 3EQLC 3MXGA 4RGNA 4F87A 1DOIA 2XIWA 4A3JB 2EXZA 4ZK9B 2KEDA 1S4ZA 2M19A 1ILPA 1F2YA 1T5XD 1AZPA 1XO3A 2VB3X 3NS1A 2K05A 3P1MA 1ZOYB 5EGTA 3IKJA 2XRSD 1E6EB 1OFFA 1VCIA 1GB4A 1QB5D 2EJFC 4WIPA 2BW2A 4XQJA 5FR3A 1TKYA 4BA2I 1DGJA 1KFYB 3U9OA 1DCZA 3L3OC 3P1HA 3VYTA 1SYGA 3CQZB 1KDCA 1Y8NB 3AU7A 2IGDA 1G6ZA 1V8CA 5D14A 1II3A 2X6LA 2O5JC 3Q69A 1H9RA 3KWLA 4PMCA 4K2LA 3TEXA 3SK5A 2F0EA 2QKIC 2Y3AA 2KUMA 2L12A 1JOKA 2XWBB 4A3KB 4B0MA 1BMLC 2DLBA 2HDMA 1UUPA 2BTEA 1ZUD2 5G5HA 1CZPA 1X3PA 2DWQA 4C3IG 4YT0B 4QIWB 1DONA 2D5GA 1STNA 3BYYB 3H6MA 1RTNA 3R8BA 4U673 1N61A 1EWCA 1CQVA 4NMZA 5AFWA 2VZKD 3TEZA 1QQRA 3J80E 2JWUA 2JE6I 3B2GA 1JICA 2M0AA 1IYUA 3NE5B 3MC0B 5C2TB 1XLOA 1SYDA 1IYVA 1PGAA 4C7ZA 1TKGA 3NUCA 4G4KA 1ZYRD 3T53B 1EEID 3FAHA 3AE7B 1G291 1SB3C 1WSPA 4X3SA 3K59A 1QF6A 1WTWA 4P2CB 3ND8A 3VYRA 1EYDA 4BBRB 1SXTA 2ZW1A 4HKQA 1OQRA 3TP6A 4P16A 3HEJA 5BMGA 2LFNA 3I57A 2D9UA 1T6BX 2AX5A 1TWGB 1AYFA 2FUG1 1ZXHA 2WXIA 1BCPB 4CHTB 3WCQA 2EYJA 2J4XA 1LTTD 3NWSA 3HGBA 3OPOA 1F9QA 2CHBD 5KNBA 4RGMA 3NHHA 2K32A 1D4BA 2IL8A 1YNJC 1EWYC 1FRRA 3A56A 3HRDD 3HVZA 3AE9B 1YNND 3TDQA 3E5SA 5E1FA 1F2LA 4YSZB 4EE2A 5BN5A 3K5LA 3C1EA 4HSPA 5CR3A 2MGSA 3HVDA 3BIID 4XDDA 1RCVD 2F0WA 3VR6A 4N9PA 1K8OA 4ABNA 1VZ7A 4LMQD 4XE0A 3AEBB 2BA1A 2BE5C 2EJGC 1CT1D 5K5PA 2V3NA 1F0ZA 4ZYSA 4ZRPA 3W9CB 2A69C 1VJKA 2B2UA 4ZRQA 1JROA 2A6ED 2SEBD 1NR4A 1UWMA 4DXGA 1HCZA 4C2MB 3GD7A 1J7AA 1N5XA 2ZXRA 3GTQB 2ZXOA 1HUNA 1HZ6A 4A3EB 5EBCA 3T4AC 1FCCC 1STEA 4KY5A 2NUCA 2F0VA 2IW3A 1ILQA 4KKTA 1HZ5A 1S5FD 3BK2A 3ND9A 4BBSB 1FFVA 4YSXB 5HG2A 3RZOB 4D2KA 4EGVA 4FXCA 1EY8A 2F0MA 3Q8CA 4KTAA 4DAVA 1XCQL 2MEKA 3I70A 1MGSA 1TY2A 2LKVA 4MACA 2I46A 5C6AA 3NUHB 4NDXA 3IT6B 3HOUB 1OXUA 3WDNA 4BY7B 4TQ1A 5BMIA 3GV6A 1F2ZA 1F77A 1HA5A 1DOKA 4XDCA 2ICEC 2WXHA 3IXSA 2F0OA 2GA4B 1BBXC 1JWUD 2INNE 1EYCA 1E2ZA 2JEAI 1Q12A 1IW7C 1AZQA 3A8IE 4IUQA 3NTHA 1B9NA 1WVLA 3A8JE 3NSWA 3E6ZX 5EPLA 2KWDA 1OXVA 3KWVA 1ESRA 1MHXA 2L52A 1BCPD 3FMCA 3OIQA 3S2DB 1A3UA 2IJ0A 2V4IB 4KHVA 2B76B 3DHQA 2BOSA 4A93B 2KCNA 4J3OD 1CA6A 4KY7A 4I7ZC 1YN3A 4KK7A 1FNWA 4YTMB 1CI3M 4V0BA 1E10A 2OEDA 2B2WA 1SYBA 3GTLB 3K5OA 1GB1A 1WTVA 4QUFA 4NW2A 2WS3B 3RFZB 3MEHA 1I4GA 1NEKB 1TS2A 1TR5A 2G1EA 2JZPA 4O42A 1JOQA 3P4QB 5G5GA 1KTKA 2NN6I 3PV0A 2EKIA 1TWHB 4NKLA 1IUEA 2KQ3A 1Q1BA 3HKZB 2Z1CA 3TP7A 1VLBA 1KABA 3X3MA 2PW7A 1B9MA 4QF4A 5E3FA 3AE2B 4ULLA 4FXKC 1J7BA 4E6IA 1FGBD 5C3WA 4MM3B 2JXMB 1RHPA 2J7ZA 4C56C 2A74C 2RMMA 5BMHA 1E7PB 1YQ3B 4K14A 5MPOA 2E3TA 2PYKA 5I2XA 1LABA 4G7HC 3T13A 3FRPB 1X3QA 1YMHE 5M5YB 3H94A 1SFOB 2PW5A 4HCSA 5M5XB 3ITPA 1RKNA 2YU9B 1FD6A 4L6TB 3TP8A 2M2LA 4WURA 4JWSC 1UEAB 4N6EB 5KGUA 4KKSA 2WLBA 3J9CA 1AN8A 5LHY1 4HJGE 3DEOA 2X6GA 1V1PB 3NVZA 1WD1A 1JQ4A 4MIUA 2NN6H 2R3ZA 3TMEA 2QIEB 4KD3A 1RM6C 2OHFA 5CYUA 2Q8RE 3AN1A 3SK6A 1QKZA 2KA7A 4H7BA 2F0PA 1CJEA 3IFDA 1JE4A 5CBEE 2YEPB 1ZE3D 1QNUA 1JCKB 4IUTA 1BDOA 3O13A 2A5HA 3CIRB 1MSGA 3BG3A 1S5CD 2PNRC 3DXJC 4PMBA 1TVXA 3AEAB 3DWMA 3KLSX 3MWYW 3M85A 3I4MB 3S17B 4LLGM 2O5IC 2QJLA 4XTCS 1IL8A 1E0BA 1SIJA 3P63A 2B2VA 1ML0D 3SK8A 1ESFA 1EIGA 4A3DB 3I8ZA 3Q8BA 5H92C 2PTLA 3EGRA 2RSOA 1YNNC 1SE2A 1QOBA 1J9OA 3W1SA 1Y8OB 1K83B 2CJOA 5I4DA 1WGKA 2BT6A 4OW0A 2F0IA 1SNOA 5EBDA 2JU6X 3GTPB 4REZA 1IBXA 3QIAA 3F2UA 5CMDA 3I72A 3V96A 3FPPA 1Y1VB 1KRHA 2F0TA 1LT4D 2PZUA 3VR3A 1MD2D 2W3SA 2W55A 1I4PA 1NI3A 1KDAA 1YQ4B 2JSOA 1B4OA 1L0XB 1WYGA 2ACZB 3P7JA 1QLBB 5A2QL 1WRIA 4KGRA 4JWUC 2MJDA 5I6WA 4J8QA 1KNAA 4QUCA 4O1NA 4WORA 2BS4B 2A73B 5J39A 1PZJD 2EZVA 5K36G 4LTUA 2J0TD 1C4PA 1F9SA 4DQOC 4ZQ3A 3QJYA 3CKIB 5ELEA 1YJJA 3D4RA 1C9FA 2VB2X 2FMCA 3VQIA 2QEJC 5EE3A 2E75C 1EYAA 3ETRA 3BZDB 1I4QA 1EL0A 2ENBA 3I3CA 3D31A 2E6XA 3HOWB 3L7ZC 2BYTA 4XT1B 3ZJVA 4ZLTF 4USAA 1TJEA 3URYA 3EROA 1DYQA 1QNKA 1SSNA 1LTGD 5JEAJ 2IGHA 1MVKA 3PMFA 1UGJA 1PTOF 5I9OA 4OIKA 5EPJA 3V3XA 4KX6B 1JRPA 4ME5A 1L5PA 1MI2A 1B2TA 3Q8EA 3GTGB 3DWQA 4CKCA 1TWAB 4FP5D 2EELA 3ERQA 1SBBB 5T1GA 5HI1A 2K04A 4N58A 4L23A 1XYIA 1AEXA 3DUZA 2WDRB 4XIGS 5JVG3 1DOYA 3E9SA 2BB6A 4XXEA 1D5ZC 3EUB2 4S3SA 2B2TC 4L63B 4CGYB 1N62A 2WXOA 4CQNA 4JX1C 1NCVA 2HTME 3BDCA 1GJXA 5C3EB 4B0EA 4WH4A 3BDLA 1DOXA 2DYOA 1ZKOA 4FXGC 4IQZA 4MH8A 1GUGA 5ELBA 4H0LC 4DA2A 3N52A 3U7ZA 3QB3A 1SNDA 5CV4A 4TSSA 2SOBA 2XSCA 1VMCA 3PUWA 4CKBA 4DGZA 1XLQA 2N7JA 3AEGB 1K52A 2CW0C 2SNMA 2ON8A 4IFDJ 4IURA 1CM9A 2VUMB 3Q6SA 4UAIA 1D5MC 2K3UA 1TT2A 1WTXA 5LNK1 2E2HB 1JMLA 5AUIA 3NQIA 1FXAA 5C4XB 2KEEA 1AW7A 5KYLA 4EQNA 3MFYA 3QOLA 3NZ3A 2F0SA 2JA8B 1DOMA 2LFIA 5A2QE 4FO2A 4LAAA 3FPUB 2G9DA 4QB4A 1D6EC 2EYMA 3SXHA 1W6JA 1EY6A 1G91A 4IKGA 2KMMA 1A70A 3LWUA 2NVYB 1R9TB 3SHLA 1EEFD 3U52E 1TS3A 3SDZA 2RQXA 2C9OA 1HQRD 2EYLA 3NWTA 1UWXA 2ZXPA 3A55A 4C3JG 1CFMA 3SFEB 1ZPSA 4ZAIA 3RMHA 1JB3A 3NRZA 4FF1A 5DNFA 3OW7A 2WNMA 1R4PB 1AWDA 2WU5B 3PO0A 2WKDA 5FO9B 5JVH3 2BCOA 4LJZC 3OOCA 2O4XA 2R6GA 3DM1A 1JW9D 4DXFA 2K5DA 2L32A 2DN8A 3QO2A 1EU3A 1HEZE 2WXMA 3AE8B 4EQOA 4ZHPA 1Y56A 2WINB 2WACA 4HROA 4RNAA 4KKUA 1PFBA 1PRTB 3ZYYX 2DNCA 1SMYD 5TSSA 1L4DB 3H91A 3A7AB 3HOYB 4U68A 2F0GA 3SE0A 2PVOD 5D7GA 2PCFB 3CRLC 1HUMA 2F0KA 2Q8TA 5M3FB 1NSNS 1VF7A 5CV9A 4GDKB 1FMAD 1L6VA 4RCOA 1TYGB 1SJHD 2AUKA 3TBIB 4R8IA 2R93B 2JYEA 2LS01 4Q2JA 1WD0A 2EVBA 3K7AB 5IOCA 2KACA 1BUIC 3TP5A 4DNTB 3MZ5A 2M56B 3T3OA 2WP8J 5IGFA 5EKKA 3GQBA 1I50B 5IGGA 3NK9A 1U4MA 2JSVX 4ODGA 5EJWA 2NVXB 1PTOH 3RLFA 2F0UA 4RA8A 1B53A 5T8IA 4PNYA 3D3RA 5AUKA 4A3GB 5D3IB 1CK1A 1PZID 2L0CA 2TMPA 5G3LF 5LL6S 2KN4A 2GRIA 1V43A 2SNSA 1KAAA 2Y5PA 1V8QA 2WIIB 2Q5WD 3GV3A 1WTOA 3C1FA 5FLXL 4KGTA 1Q10A 1YN4A 2H1EA 2EY2A 1ROEA 2EOTA 4BY1B 5EQ0A 4X3KA 1C4CA 2B39A 1NYRA 2PPBC 1Y69U 2JQRB 1PYWD 2LEKA 3I73A 4F8MA 3FILB 3NVWA 2X69A 1BO0A 2L11A 4ZRZA 1TKEA 1X32A 5FK9C 1OO9B 4C3HB 4RCNA 3TN2A 3OMCA 1BCPF 2SAKA 4HTHA 1XLNA 1C79A 3AMZA 4OVZA 3TEWA 4RWSC 1Y8PB 3MXPA 5CV7A 2FINB 3W3AA 4US8A 1ONLA 5G3LD 2L83A 5JEAG 5F2DA 2L5TA 2PQEA 4K6DA 5LL6X 4IDIA 4ARIA 1J7CA 1H9JA 1I4HA 1LACA 1ZXIA 4A8XC 5J1ZA 4LK1C 2CU3A 1A15A 1PRTD 2NB0A 1QCBD 3CRKC 3L9AX 4L2YA 5E4WC 2BDNA 2F3WA 2A6HC 2BB5A 3P4RB 1FFUA 3LWEA 3KBXA 2OT2A 5IIFA 4AYBB 2JYOA 3S2HB 1V1PA 3MXNA 5JXVA 1QOGA 3BK1A 2ID0A 3M7GA 3KLSA 3GTMB 3U9SA 4IZ8A 2XRQD 3TZUA 3KK7A 1PTOC 1TQOA 4YTPB 4JE3B 3CHBD 1JR0D 1A6XA 1STAA 2E2JB 1SF0A 4I65A 2BA0A 3OIPA 5BN4A 3K58A 3AMUA 5DM73 5ELFA 2FFKB 3HOZB 4TQ0A 3FEWX 2R61A 5I9PA 3G7LA 1TZOA 2J53A 4HN7A 2KQ4X 3H3VC 2D2CC 4NJCA 1EZ6A 4JK1C 1VR9A 1QE6A 3D8GA 2JP1A 1XEEA 4A3FB 4ZHOA 1U4RA 1F9PA 5E4XA 4IFDG 3VR8B 2K01A 3PO3B 2JXTA 2WDQB 3OWEB 1T5EA 5C4ZA 3S1MB 1R4QB 3QOJA 2HCIA 2BDOA 1P7EA 1U4PA 4PQXA 2OXPA 2N9KA 1HQMC 1TIID 3HRZC 2BS3B 1PXUA 1JWSD 3Q8AA 4KY6A 4YSYB 5FLXE 1KH0A 3MA2B 4M1UB 4A6QA 5BYSA 5KNCA 2B63B 1VDVA 3M4OB 5E6JA 1I3QB 3SVMA 2WV6D 1IGCA 5J22A 3D6CA 3R2TA 2I07B 3JAML 5IODA 1SYCA 3AB5A 1K8MA 1S5DD 4DK0A 5M5WB 4QCLA 1H9KA 3C8YA 1ENCA 2ONQA 5ELDA 2H89B 4FF2A 1K51A 3SK4A 2J42A 2R7ZB 3B9JA 2MJ8A 5CGKA 3LYYA 1ZYRC 3PZ8A 1Q1EA 4A3BB 5BYQA 5JOBA 1H9SA 1CZWA 1MBYA 3BVZA 1OXSC 5C0XG 1KF6B 4JPSA 1SEBD 1JQYD 4DAYA 2WB1B 1H9MA 5COYA 5IGBA 2WXKA 1CA5A 5KRUA 1XTCD 3Q8FA 1RTOA 4L1BA 4OO1G 3B2FA 1JOOA 4IOIE 2WP9B 1DZ1A 1HFGA 1LTAD 2E76C 2KVMA 1BQQT 1RYJA 3DWGC 4BWGB 1Z6HA 1QOHA 3AEDB 2INPE 4CJ1B 4AQ7A 4WFN3 3RUZA 3WOEA 4DU9A 4YIJA 1HTLD 2D62A 1RDPD 2ICIA 1G2TA 4TRDA 4OL7A 2KAJA 2IDYA 1FEHA 2J52A 5KEEA 3MHZA 1ZDVA 2WKCA 5ISRA 2K28A 3P42A 1JWBD 1KLGD 1PLFA 2PVGC 3WOFA 2W54A 4R9WA 4F88A 2L55A 2LMCA 1PTOB 1QWYA 3OHXC 5HGTA 2PMVA 1SSOA 4ZUJA 3J81L 5T1IA 4K5XA 1Z47A 1B1ZA 1KDBA 3DWPA 4RGTA 4H2AA 2EPBA 1XX8A 2A6EC 4KJOA 2LHEA 2IGGA 4WRDA 4V190 5JAVA 1L6UA 3M4YA 5CORA 1EIHA 3MFGA 4ZOHC 2XWJB 2K33A 1EZ8A 3TSSA 1WWTA 3W5VB 2ZW0A 4BS9A 1F9RA 5HHDG 3P75A 1SE3A 3DMUA 5K36H 4OGQC 1K53A 3GB1A 3GTKB 2YEPF 4XWTA 1SNQA 2K7VA 5IGDA 2B2YC 2WXJA 3MTSA 1STYA 1CHPD 1EQTA 5CV8A 5KIXA 3PUVA 4F7XA 4QMGA 2QMTA 3AM9A 2I38A 1H9SB 3PO2B 1FO4A 2YYZA 1R7SA 2K6AA 1GUWA 1F2RI 2F0HA 4DF7A 2X38A 2V0GA 3JAME 3E0JA 2BE5D 1BUVT 4HEA1 2CQAA 5JPMC 3SEBA 1XCTL 1PGBA 1TU2B 1E9MA 3S1QB 3X3NA 2A69D 4N59A 5C3XA 4K2KA 3S15B 2DBYA 2GB1A 4C3HG 3DEPA 1SJED 5EE0A 4JBWA 4US9A 2LUMA 4XDXA 4A3MB 3FC4A 1LTRD 3Q24A 4C7YA 4OZCA 1NUCA 1N63A 3NQTA 2B8FA 1FXIA 2K1BA 4KN4C 3KLRA 3NBIA 1MHHE 1MI0A 2RSNA 1ET9A 1BCPC 1VZ6A 2K5WA 3R3OA 2FMMA 2HDLA 1AFPA 2L1BA 5EE1A 3RZDB 1C4QA 1S5ED 1P7FA 1GHJA 2KDMA 3NVVA 1FD7D 2V3PA 3EJIA 1EY9A 2EYFA 2WXRA 3ZJTA 2PO4A 2LMCB 1PMRA 1EY4A 1J8IA 5C4HA 1Q3LA 4X3TA 4FXDA 5IGCA 2FHTA 2AWNA 1FNUA 1LO5D 2IX1A 4HR7B 5I2YA 1GAQB 1G8ZD 4KI0A 2PMZB 4J6HA 4GLSC 1UNSA 3HP3A 1A2TA 2AQ2B 5CV6A 4IUUA 1NENB 3H0GB 3M3YB 2LJIA 1CHQD 2AQ3B 2QDBA 1YJIA 2KECA 1VDZA 3J7YW 1DXMA 3SFDB 2NBFA 3OSOA 2BS2B 2Z4HA 3J81E 1JWMD 2O2LD 1V97A 3LXFA 3M7NA 2B2TA 5EPKA 2JX5A 1A3TA 1MSHA 3VA7A 1OQQA 3ABVB 4KKIA 3ZGZA 1ZP0B 1EQVA 2JA5B 3IT4B 5M9OA 4IUPA 4RFBA 1Z7TA 1U9RA 3MHBA 2TSSA 1E2WA 1I4RA 2L9HA 3D4WA 1JWAD 1EM7A 3LX0A 2K22A 2NVQB 4DNRB 2KCCA 1SNMA 2K5QA 3HOXB 1LT6D 4XQQA 2ZT9C 2NYZD 1STGA 2XVSA 1LTSD 2HDEA 1Y1WB 4BA1I 4RF1A 1UAPA 2F1MA 5HURA 3Q0AA 2CVRA 2F0QA 2JEBI 5M3MB 2GI9A 3AH7A 2M9VA 1XWEA 2QILA 5C0XJ 3FILA 3HUIA 3IAYA 5CBAE 3VYSA 4GZYC 1IHZA 2MP1A 3PUZA 5EE9A 1PFDA 4OIJA 3U2SC 3AEEB 3VYUA 4FF4A 1F2RC 2LGIA 2PIAA 2WAQB 2K9XA 3P20A 4XYQA 4HKZE 1JC7A 5FO7B 1ENAA 4DN4M 2KOLA 3A7LA 2NMQA 5D65A 3AEFB 2IX3A 2BBCA 2E2IB 4FYDA 3C2PA 4B9XA 1SYFA 2D5DA 3R2IA 4Z9CB 1C48A 3I4LA 1SAPA 1VZ8A 3I9V1 2F0NA 2DYMA 2KHSA 4RGOS 5C5LA 1BOSA 1ZDXA 2F0DA 4WJWA 2K5PA 4K5WA 2FBWB 1E2VA 2Z4IA 1XF5L 3CU7A 1QOFA 2VNUD 3FKIB 1PFNA 1SDFA 4TMAB 1NVID 2B2UC 2K03A 3AE3B 1WTRA 2F4IA 4WQMA 1FCLA 1RF2D 2WXNA 3EA6A 1AP0A 1EFID 2EY5A 2EE1A 3IAM1 1FNVA 5DAUA 1QOAA 3I4NB 2JA6B 3OWFA 3T16A 4KV6A 1ET6A 3NVYA 3IAS1 1D5XC 2F3VA 2PLPA 1STBA 3HZXA 3T51B 2QF7A 5H8YE 4XWWA 4HMJA 3NP8A 1T3QA 3E56A 1GPXA 2W3RA 1YN5A 2SDFA 4RH6A 2DY7A 3ONAB 1HXYD 1L0VB 3V05A 2IPKD 2MUYA 2WXFA 1PRTF 1F2MA 1LLRD 2XN9C 4H13C 1ZEQX 3K5NA 3K5MA 1E0ZA 3KF8A 1SNPA 3BVMA 1RD9D 4UDUC 1C4AA 1EOTA 2JYTA 2AQ1B 3P4PB 3NTIA 1LTID 1DM0B 3I91A 3ZQ4A 3K0YA 2JA7B 1S5BD 3S1NB 1D1KA 1BF4A 3TZDA 4HRSA 1HFNA 3V2TA 2M00A 3A8KE 2XNAC 3GTJB 1JALA 5FOBB 1C8CA 3VRBB 5C4JB 1Q90A 2IX0A 4MT5A 4WWMA 3QWNA 3T3NA 1G2SA 5JEAH 5C3JB 1O80A 1TWCB 2LHDA 3VR2A 3VR5A 1TWFB 3GS2A 4CBVA 4YWGG 2L1AA 4NZLB 1V1OA 1I7HA 1QT9A 3GO5A 1OXTA 2MJ3A 4IFDI 1XLPA 2N0SB 1PFMA 3VRAB 2WXLA 3GTOB 4EVOA 4P6VF 4L8JA 2B2WC 3P4SB 1HPCA 5A35A 2HQEA 2MJEA 1EY5A 3K6OA 1WTQA 1RFKA 1LT5D 3J7AF 1MPEA 4FVMA 1B50A 4B9WA 2QCPX 2A68D 3BVGA 4RF0A 2L4NA 3NTKA 3VR4A 4K5VA 4XT3B 1KNEA 3MAQA 2VXWA 2H88B 4GDLB 2WXQA 1PDQA 1TY0A 3J7AV 1C77A 1C78A 3BYTB 4DK1A 3DWAA 1TS5A 4KHZA 1PUTA 5EKIA 1D2BA 2EY6A 5IGEA 2Z8LA 5JJZA 3EFXD 2WQYB 4RHRA 1LV9A 3KQ4A 4B08A 3KBGA 3UI2A 2WU2B 4HCEA 5BN3A 1A3VA 4KMUC 2RKSA 2RDGA 4N9TA 3C3LA 4Q5VA 3L4PA 3BS1A 2PKOA 4IFDH 5C44B 1ENFA 4IUVA 5CV5A 1A2UA 5C0XI 1O7YA 1YNTE