1HA5A

Structural features of a zinc-binding site in the superantigen streptococcal pyrogenic exotoxin a (spea1): implications for mhc class ii recognition.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
218
structure length
218
Chain Sequence
DPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHAGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYLTDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDSNTSQIEVYLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Features of a Zinc Binding Site in the Superantigen Strepococcal Pyrogenic Exotoxin a (Spea1): Implications for Mhc Class II Recognition.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Toxin
molecule keywords STREPTOCOCCAL PYOGENIC EXOTOXIN A1
total genus 56
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ha5A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ha5A01
2R61A 1AW7A 1PTOC 4RCOA 1LTID 1TS3A 4ZYSA 1S5FD 3EA6A 5ELDA 1FNUA 1YN3A 1RD9D 1TY2A 3BZDB 3CHBD 2TSSA 2QILA 1LLRD 3BVGA 1PYWD 1M4VA 1SE2A 1YN4A 1RDPD 1LT6D 1EU3A 1CHQD 2AQ3B 2RDHA 2WV6D 1I4QA 2IPKD 4RGMA 1SBBB 5ELBA 1ET6A 1BXTA 1JQYD 1CHPD 2J4XA 1I4XA 1YN5A 1GOZA 1TS5A 1PZKD 2G9HD 2O2LD 3SEBA 1EWCA 1D5ZC 1EFID 2ICIA 1PTOD 1FD7D 3R8BA 1D6EC 3MFGA 4Z9CB 1XXGA 1KTKA 1I4PA 4OHJA 1S5BD 2AQ1B 1JR0D 1DYQA 1SE3A 1PTOB 1I4HA 1BCPC 1D5MC 4O1NA 4RGOS 1PZJD 2XN9C 1STEA 3V05A 5ELEA 1SJHD 3BYYB 2NTTA 5D3IB 5FKAC 3W2DA 5ELFA 2AQ2B 1RF2D 1PTOF 1ENFA 1S5DD 1JWUD 3URYA 1MD2D 4K6LA 1HQRD 1TY0A 1EU4A 1SXTA 1KLUD 1LTBD 1FNWA 1F77A 1I4GA 4RGTA 1S5CD 1LO5D 1D5XC 2NTSA 1PTOH 2Z8LA 4DXGA 1BCPB 1LT4D 3GP7A 4RGNA 1LTAD 1PRTD 2XNAC 4BWGB 1G8ZD 1B44D 1HTLD 1BCPF 1UNSA 2CHBD 5TSSA 3TSSA 2IJ0A 1HA5A 1LTGD 3BYTB 1BCPD 1PRTB 1QILA 3DWAA 1HXYD 1ET9A 1ESFA 1FGBD 1SE4A 1V1PA 2QEJC 4RH6A 1LTTD 5ELCA 3R2TA 1EEID 1LTSD 1JWMD 1KLGD 1RCVD 1T5XD 3BVMA 1L0YB 1B1ZA 1SEBD 1LTRD 1XTCD 3O13A 2RDGA 1L0XB 4RHSA 4UDUC 3KLSX 1PRTC 4L63B 1JWSD 1EEFD 1CK1A 4L6TB 1LT5D 1TS2A 1UUPA 3MC0B 4TSSA 5FK9C 1PZID 4RFBA 1V1PB 1I4RA 3DWQA 1LT3D 2SEBD 4RHRA 2XRQD 1DJRD 3R2IA 5I4DA 1CT1D 1SJED 3OWEB 1FNVA 1S5ED 3BVZA 1AN8A 1PRTF 1TS4A 1JCKB 1V1OA 3EFXD 5D3DA 4NZLB 3DWPA 1CQVA 2XRSD 4C56C 4DXFA
chains in the Genus database with same CATH superfamily
3KF8A 5KHQA 3VA5A 1GUWA 1LTID 2B2UA 4FXKC 1ESRA 1TS3A 1WYDA 1H4RA 4M8MA 4HKQA 2X6LA 1WTVA 4PMBA 2EYMA 3FPPA 4FO2A 5J1ZA 3IRBA 4BVUC 3GTOH 3K8AA 2KQ3A 1RM6C 1KDBA 4K6DA 4LWCA 2WXKA 3SFDB 4YL8A 1O80A 3PO2B 3RULA 2WINB 5ELOA 1LT6D 1XWEA 2ZXRA 4QAYA 3TUOA 2FMCA 2NUCA 1JJGA 2LXAA 2WU2B 2MW5A 4IALA 1W6JA 3I72A 5AFWA 3NEMA 3SK4A 4CJ1B 1EIHA 1MJEA 1PV4A 4LF5Q 3FC4A 1YN5A 4WURA 2KDEB 4A3EG 3KBXA 2CR5A 3RNUA 3BZKA 1YX6B 4NMZA 5J22A 1TBEA 4J6HA 3I57A 1PH5A 4WWPA 3ZQ4A 3A9KB 1EF5A 1N60A 2VNUD 3WAOA 2G5DA 4U68A 2KAJA 4BBSH 2L5TA 1FXAA 1K8RB 4EUTA 1K50A 3GD7A 4DAPA 3EGRA 2OF1A 2N1VA 5KNBA 1E0BA 4N59A 4IOIE 3GDEA 5IKCM 3BDCA 1NBFC 2WDRB 1J8IA 4TRDA 5IYDG 2BWES 3VHTC 1XQQA 2GRIA 5D3IB 1HFNA 1EQVA 2JVCA 5ELFA 2CWAA 4ZUIA 1I94Q 2XGTA 4ZQ3A 2WXIA 4EQNA 5IODA 1WXVA 1I4GA 1QOBA 2N9XA 2PEAA 3W3AA 3S1RH 3OPOA 2NR2A 1MKHA 1HQMC 3KLRA 2EJGC 4OX9Q 2VUMG 1YQ3B 2CWPA 2GBMA 5DLQE 4JV5Q 1ILQA 2MO0A 2KTFA 2HIXA 3WOFA 1A2TA 1HUMA 3U4VA 1ZEQX 4F87A 4DXAB 3ZW3A 3C2PA 4F1SA 4CBVA 3MVVA 1HA5A 2KQSA 1H9SB 2MEKA 4HR7B 2UXBL 4A3BB 1Y8RC 2K33A 4ANXA 2V9HA 3N20C 4CHTB 1HNXQ 1NUCA 5C4XB 3DMUA 1YX5B 2R2QA 3R2TA 2NS5A 3MTSA 4HJ9A 4A3CH 2W54A 2CS4A 4IWQA 2OHFA 2PPBC 2BWFA 1LTSD 1S40A 2K04A 4DV6L 2NZHA 2V1YA 4RMAA 1U4LA 4ALPA 2WFWA 2MJDA 1A5RA 1U9RA 4DV5L 2XEWA 4TKNA 4DR7L 1FD6A 3BDOA 4A3IB 2BE5D 4A3DB 2EVBA 4Y7NH 1KLVA 2E2JB 3PRMB 5EE9A 5GAGC 2IY5B 3RZFA 4WJ4A 1TVXA 3D0FA 4A3KH 1FM0D 4PT5A 4IM2A 4IPHA 3CIRB 3I4NB 4C3IG 3KUDB 4YWKA 2ZCCA 1JOOA 1HZ6A 2LKVA 2G9DA 3CD6A 2UU7A 4RKLA 3X3MA 3K9PB 1O7ZA 3VUXA 4DNIA 5EAYA 2CHXA 4HKZE 1VQ4A 5COYA 2QEXA 3STBC 3VR2A 4LF8Q 4NXML 1SNOA 3KUZA 1MHXA 1JCKB 2E2HB 5C44G 4JYAQ 3AM9A 1JWBD 4B9KA 3FVQA 3SK8A 4MEMA 3VR5A 2UXCL 2ENBA 2DNEA 1UGMA 2BE5C 1TU2B 2PMZE 2LMCA 3ABVB 2M9VA 1VCBA 1V5OA 2E6XA 4IG7B 5CC4A 4P75A 1VQ5A 3V60A 3CF5A 1DGJA 2R93G 1LGRA 1YMHE 1P1AA 5L95C 1PDQA 2UXCQ 3K80C 1YBYA 1F0ZA 4CKCA 2J0TD 3J7AV 4BOZB 4JGHB 2RSUA 1YNJC 5KGUA 3BIID 1QUQA 3LDZE 3QWNA 3C8YA 1ML0D 1LV9A 1J5EL 4HPLB 4H13C 3W5OA 1YJ1A 2CKHB 2V3SA 3PPAA 2WACA 5J3BA 4AJWA 2DZMA 1DOKA 2B8FA 1GOZA 2O6VB 4K0KL 1PZKD 4BA1I 1FIQA 4ZRIA 4G7HC 3Q8DA 1K83H 4KMUC 2JA9A 4OHJA 3NQIA 5BMHA 4LJOB 2OQKA 4FNFA 3T4AC 4ACFA 2F0EA 1EWHA 2C5LC 1E22A 1HHVA 3S15B 1G6PA 1XLNA 3SU8X 2DUDA 1C4QA 2KTRB 1STEA 1E7PB 4DV5Q 2DLBA 4LJPB 3PF5A 1SE9A 2K22A 2ALYB 5FLMH 5ISRA 3JC66 2RHSB 2CHZA 3OYYA 4IW0A 4KHPL 4TUUA 1L4ZB 5IGCA 2BT6A 3KLSA 1TWGB 2VB2X 2HJ1A 5IP9H 4AQYQ 2ZVNA 3OIPA 1LT4D 2KJHB 3KW5B 1CI3M 2XSCA 2ZEQA 1QE6A 2ZT9C 4K1RB 3HKZG 1A6XA 2KOLA 3RLOA 1VS0A 2RQXA 2BVCA 2YYZA 4IC7B 4W9DA 3AU5A 1X56A 3GO5A 1QCBD 3AYHB 3QARA 3EROA 2HQEA 1EY6A 4XIGS 2M00A 2LVOA 3TP6A 3T3OA 4JBMA 5HY6A 2C35B 1XF5L 5E6NA 3APDA 3CWIA 2MJ3A 2TMPA 2LRWA 2X8XX 3ALBA 4WJNA 1J0GA 4GU2A 3N9YC 1GXDC 2F0OA 3GV6A 3QCAA 4R3DA 1Q7YC 1ACCA 1WD0A 1LTRD 2JF5A 2PO4A 3KDFB 3J7A5 1X32A 1PH8A 3O65B 3KLSX 4A3JB 2GA4B 2I2YA 4X62L 3P4RB 2WAQB 4DAVA 3A54A 5M5YB 1QZEA 4IKGA 1STHA 2PMVA 5T1IA 1VF7A 2BDNA 3VH3B 5J2RA 4A3FH 2SEBD 2MCNB 1F9QA 2XWJB 3HGBA 4RHRA 4LJZC 1CKNA 1AP0A 1WF9A 3PUVA 3DBLB 3T51B 4OL7A 3HOVB 5LHY1 4XWTA 4PZ8A 4A3MH 1VD2A 3A9KA 3ZJVA 4TVAB 1P16A 1TJEA 4S3SA 3DHQA 2IHFA 2KFKB 1V97A 4A93B 4B3TQ 4RF0A 4XDXA 2EXDA 2K6QA 3ZLZA 4DV2Q 5J17A 5CV9A 3L9AX 2XIWA 2PVOD 3BDLA 2F0PA 4ZRQA 1VQ8A 2JA6B 3VTUA 3CHBD 1KNEA 1WD1A 3JVZX 3V96A 3UGBB 1B3QA 2K75A 4CJ0B 1P7FA 2V3PA 4ZDVA 3F8TA 1DOLA 3HS0C 2L76A 1N33Q 2L7RA 1IL8A 1CHQD 3NXWA 2R92H 2LUMA 4MH8A 2NVTH 1UBQA 4GIVA 1CTMA 4OXPA 1MJCA 2CVRA 4NKLA 1N5XA 3Q3FA 1HTQA 3HOUG 1L4DB 2A5UA 5CHVC 2F0GA 3KF8B 5HURA 3AMUA 4KIKB 1WSPA 1T0SC 3NPPA 3OOCA 4C1NI 4JYAL 2KVZA 3C19A 2Z1CA 3M7NA 3S1MH 5CORA 4G11A 1VQ9A 3H3VH 1GKHA 4BKGA 1UE6A 4YSYB 1D1IA 3J80L 3ZDTA 3EECA 3ZKJC 4B0MA 3BY4B 4JI5L 4EZKA 1D5MC 3I3TB 3UE1A 2JA5H 2NZ1D 4M8NA 5IGGA 2F4IA 2RMMA 4DDGD 2HJ8A 2EPBA 2JA6G 1SYGA 4B3RL 3NE5B 2JA8H 2ZZPB 3VRBB 1PH1A 4HVBA 3DEOA 1PFSA 1NI2A 5D7GA 1PTOF 3URYA 3Q6BA 2W55A 3U9OA 4US9A 2VRRB 3K7AH 3ZNID 3N52A 4QMGA 1F77A 3HP3A 3T1YQ 2D5GA 2OCEA 4N8FA 5FLMG 2XBBC 2NTSA 4FDBA 3AEBB 2RF4A 4WQMA 4LK1C 1FL0A 1KL9A 2C9OA 4POFA 1HTLD 4NP5A 3SHLA 2ZTCA 2AHOB 1UNSA 3KJPA 2DZJA 4OONA 3NUHB 1ZOYB 5I6YA 3BINA 5HG2A 1H8CA 5FLXE 4XXEA 4DR3L 1Z9FA 1BCPD 1YJWA 1QVFA 1HNWQ 2L00B 1LM8B 2M8SA 2N8NA 1GAQB 4B9XA 4MTKA 1R9TH 4HJ8A 3H6MA 1V2YA 2N3SA 2HCIA 4BBRB 1OQRA 3RZDB 5M5WH 2IO1B 2Q2TA 4A3CG 2FCMA 2EYPA 2A69C 1SSNA 4IJLA 4DA2A 3P4PB 2EY2A 4YHHL 1J19A 4DUZQ 3JW0X 4A4IA 2EXZA 4HIOA 1SEBD 4A3LH 1IL2A 4OVZA 2BYEA 1B8AA 4N6EB 4MSQB 2XK5B 5CHFA 4L63B 3S9WA 2R7ZB 1Q10A 1MIUA 2IGDA 2K8HA 2ON8A 4EOYA 1EEFD 1CK1A 1TWAB 1N34L 2I5HA 3I4MH 1L7YA 2JQOA 1B9NA 3K5LA 2LVQA 2L55A 3IKJA 2IGGA 2KVMA 4LFAQ 2QDFA 4MH0E 3CC7A 2A74C 4X3TA 1I50B 3Q3OC 4RFBA 4ANVA 1WCMH 1TT2A 2KXJA 3QOLA 4LUOA 1YZ6A 5KYLA 1KRHA 2UUAL 2AWOA 2Q2UA 1DJRD 3TREA 4B3RQ 1OFFA 2AUJD 1PH7A 4JOIA 5C44H 2EMSA 1SYBA 2MSED 1PLFA 4KGRA 4XDDA 2EYHA 4KIKA 2A4ZA 3L2PA 3H9DA 1ZP0B 1MGSA 4DR4L 2JA8G 1PDXA 3UINB 5HFYA 5AJ3Q 1YN3A 4N8X1 2NZOA 2X69A 3GTQB 4C3JB 3QO2A 2B63G 1YNTE 5C0XG 4A3IG 4AYBE 4JI6Q 4A3KG 1D2BA 4OVVA 1SE2A 4QY7A 4DUYL 1I5FA 3M4OB 3R93A 1JQ4A 1JE5A 1A15A 1XT9B 4RGMA 4AQ7A 2IW3A 2AL6A 2NVYH 1OEYA 1WTOA 1JQYD 4L5TA 1BUIC 1YQ4B 5IGBA 2DY8A 2QDLA 2QF7A 3SE0A 3J81j 2NVQB 3B0AA 2JXMB 4AIMA 3S17B 3PLVA 1UE5A 1Q3LA 3NENA 1UE1A 2HDLA 5DAUA 5IOCA 2G9HD 2MH7A 2R92G 3Q8BA 3MXPA 2FCNA 3MXNB 2F52A 2ZNVB 1RHPA 1K3BC 3OW7A 5C3EH 2BKRB 4A3BG 3H8HA 4YWMA 1SYFA 5IP9G 3PUZA 5J39A 2KLCA 3N32A 3WDNA 1I6VC 4ZHOA 5EDSA 2V4DA 1PGAA 5C4HA 2R93H 1N5WA 4J15A 4G57A 2FAZA 2MP1A 2PNHA 3J7YW 1XNQQ 1IPGA 5GMVA 1OTRB 4N58A 2F0KA 3ZIMA 2I1KA 2L9HA 3F2CA 2KX0A 2N7DA 1OEYJ 3WA0A 2ACZB 3LX0A 5K36G 4DXGA 2N9LA 4K8IA 2G1EA 1PRTD 2B2YA 1WJ4A 2KHJA 2XTIA 3CC2A 2DENB 2LASA 3CF6E 4ZHPA 3GTMH 1RFKA 2KENA 1PFNA 4DBGA 2KWUB 4BY1H 3GTKH 1TKYA 3VUYA 4WWNA 3DLLA 1QILA 4XQNA 4MELA 1ISNA 1FFVA 2KWDA 1IYVA 4R9WA 2K32A 2JYOA 4P74A 5FLXL 1X54A 1E8ZA 3ML9A 2B8GA 4I7AA 3KF6A 4H44C 5IGFA 2ASQA 3HOYB 2ZXOA 5EE3A 2O4XA 2CU3A 2JEBI 2J53A 5C6AA 2ZJPA 2JYTA 3T1HQ 4KGSA 2DZIA 1SN8A 3QJYA 1VLBA 2PLPA 1WTPA 3TRZA 3ZUNA 3PCOB 3LWUA 3R66C 4XYCA 2FCSA 1KDAA 2AEHA 2RCNA 3K0XA 5IP7H 1KD1C 4LW1A 1TS2A 1N33L 1PZID 2KDMA 2D3GA 3LXFA 2H1EA 2KUMA 3HM3A 1P98A 1PFDA 3RD2A 4WJ3M 5AZGA 1EIFA 2OEDA 3M4YA 1W3SA 3BG3A 3MXGA 4KD3A 4DV1Q 1VZ8A 5E6JA 2L0CA 3A7AB 4GNXA 1EIGA 1WYWB 3GB1A 3GE3C 4IUQA 2LFNA 2IO2B 1TWHB 3RUIB 3TEHB 5KEEA 3NQTA 1WE6A 2KFJA 3FKYA 4LF7L 4LF4L 3TP8A 2JP1A 2B63H 2EY6A 4DUZL 4H2AA 4GLVB 2EY1A 1H9SA 5I2YA 5KNCA 3IFDA 2F0VA 1LABA 1S4ZA 4JOIC 4ZYSA 3OTOL 1OO9B 3CCMA 4RKBA 4G7ZC 2L4NA 3UDFA 2GMIC 4GMVA 4R4IA 2FFKB 1UE7A 3NZSA 4EVOA 3KQ4A 4WJOA 1GUGA 3H0GH 2N9EB 1WXSA 1EFWA 3U4EG 4ZLTF 1JRUA 4BKSA 3CMEA 4Q0FA 1K8AC 4AUQC 2K05A 4C00A 2INNE 3P4QB 3E9HA 4EFOA 2O2LD 1RFAA 4DV7Q 2F0MA 1PTOD 1PH3A 2DN8A 2B2TC 3S24A 1C9OA 2KNBA 5EBCA 4BBSG 3X0WA 3AI5A 3H0GG 3SR6A 5C3XA 1WXAA 2AQ1B 1K8OA 2LHEA 4X62Q 2LXJA 3PO2G 4NQKE 3GQBA 1KABA 1YHQA 3ERQA 3K5OA 3CQZH 1O7IA 1STAA 5FO8B 2G4DB 1EZ8A 1FRRA 3AE1B 3PZDA 3NWSA 4B6WA 3CU7A 3NHHA 4HIDA 1JMLA 3VVWB 1IW7D 3CW2C 3AEGB 3ZDMC 5LXIB 1IGDA 3TQYA 4CJ2C 1GHKA 1S5DD 4CDDC 4JI1L 4FF4A 1CFMA 1MHWC 2B2VA 1SFOB 2IO3B 2CQOA 1KDCA 2D62A 2AWTA 3TN2A 3L0WB 1PTOH 3A1QA 5C3WA 2VUMH 2VS1A 3AE7B 1CKMA 2INPE 4A3KB 1G8ZD 2J0MA 4US8A 1EWIA 2SNMA 1IBMQ 4C3IH 2YU9B 2A8VA 3NRZA 2EJMA 4OO1I 1FJGQ 3BK1A 4DR7Q 2N4FA 5DCNA 1SYCA 1QQRA 4AQYL 1M94A 3RNBC 1HXYD 2K5VA 5C5LA 1IBKL 2EQSA 1RLFA 1R4QB 1XPRA 3HVZA 4GGQA 2WKCA 4BXXH 1UWVA 5EPJA 4I6LB 1CA5A 3TDQA 2K3UA 4TQ0A 1GC6A 1WGRA 2BB5A 3GS2A 4K3BA 5M3MH 1I6HH 4LDTD 1V81A 2A6HC 3P42A 2CW0D 1HTPA 2RDFA 2L52A 2FHTA 2JN4A 3VR6A 3RD4A 2E3TA 4A3GH 4V0BA 5IWAQ 1E7VA 4K2KA 3VYSA 1KFYB 1NY4A 3HOXH 2L0FA 5JZEB 1STYA 1GPXA 3P75A 4BY1G 4BBRH 4J3OD 3IAM1 4DK0A 2A1AA 5M5WB 2GVBA 2VH1A 1V1PB 3W1SA 1Q90A 4I6PA 4K5VA 4CDFC 5D94A 3CCSA 2K52A 2VQFL 3MHZA 1IZ6A 1XMQL 4ZAIA 4JL9A 4W9JA 5G3LD 4X57B 1L1OC 4XX5A 2P5ZX 1AN8A 3NP8A 1P0RA 4ITKA 1NTGA 3GTPH 2D0PA 3HOVG 4WAFA 4DHZE 1DOMA 4DXFA 4FXCA 1UF0A 4PS3A 4MN3A 5JH5C 1A3TA 4KY5A 1QZHA 2BF8B 1VMCA 3L13A 2DYOA 3CMAA 3M95A 4M02A 3RN9C 1D7QA 1QF6A 4P2CB 3SHQA 4FVMA 3ECIA 4DV4Q 2ICEC 1D1KA 1AEXA 3MHBA 4YY3Q 4AP4C 3FAHA 3Q8AA 1LLRD 1CZPA 4GKKL 1BDOA 2Q2HA 4HCEA 3I55A 4HJKA 5C3EG 2YEPF 3NVWA 1B7YB 2WV6D 3S1RB 1PA6A 3JYUA 2FE8A 1J7CA 4K7WA 1PHJA 4TKOB 3PF4A 4A3MG 2RVLA 2WHIA 2J4XA 1X3EA 2JXXA 1I4XA 2WB1G 3NBIA 1C76A 1SE8A 4B95A 4N9TA 4ICUA 3DXJC 3AE8B 2V1CC 2CCZA 1WFQA 4KZCA 2B39A 3BJUA 3RZOB 2LSSA 3FP9A 1FD7D 3NUCA 4ILWA 2K7VA 1SIJA 3Q14C 3N1ZC 1IBML 2RBMA 1P3QU 2QGQA 4DV1L 1N9WA 4IPCA 1GUAB 1JR0D 3A9JB 2LY7A 3ZXRA 2Z9HA 3ZNHB 2MHVA 1G2SA 2F0IA 1NR2A 3IFTA 2VQEL 4IUNA 3M3JA 1C7YA 4PYUA 2MFIA 4NY0A 1PMRA 2NTTA 1K73C 1U4RA 1UWXA 5E7NA 4JG2A 1IBLL 2AQ2B 1RF2D 5CV7A 4Y7NB 4K6LA 4GXBA 5BYRA 4JBKA 1B4OA 3T1HL 3D6WA 4A3JH 1G2TA 2PZWA 3ZO5B 4K0KQ 4KI0A 3L54A 5CV4A 2CH4A 5EKLA 2UXBQ 2N0SB 1HEZE 3SDLC 4DU9A 4OO1G 2NN6G 2PW9A 3N1XC 4L1BA 2BA1A 1JWAD 2OJRA 1K0RA 2GVAA 2NBVB 4EQ5A 2KDBA 1QOAA 5AUKA 3VFKA 5TSSA 4KHVA 2IT1A 3B2GA 1KRTA 3Q23A 1QVGA 3T53B 2C7MB 4X66Q 3Q6SA 5EBDA 2GOWA 1V1PA 3Q22A 1YD8U 2IO0B 3RYTA 2OWOA 5FR6A 2KZRA 5CMDA 3ULJA 1OXXK 3G6EA 5BN5A 2QCZA 3P63A 1DOIA 3EC8A 3B9JA 2WIIB 1Y1VB 2MLBA 1XLQA 3CC4A 2KACA 2LXCA 3Q69A 4IOAA 3QC8B 3U8ZA 3FKIH 1NEKB 4UDUC 3PV0A 1P8LA 5HGQA 1OXTA 2PQEA 3WCQA 1QNUA 2A19A 3NG0A 5I2XA 2G3QB 4DWFA 4BY1B 3K59A 3Q8EA 1TZ1A 4B3TL 2WWZA 3S16H 1PGBA 1VQBA 1K3RA 4TSSA 4FXDA 3EBEA 1TIFA 4IURA 4G0NB 2NMQA 3DWQA 2Z59B 3VTWA 1WMHA 3JAML 2UUCQ 3QAQA 1SJED 2WU5B 3I8ZA 1S5ED 2LGSA 3J81i 4AWJA 2J42A 1YHAA 1VQIA 1K28A 5M3MG 4J1MA 2IWHA 3DM3A 1NCVA 2GN5A 2WB1B 1Q82C 4WJPA 5JEAG 2KJXA 4DK1A 3MC9A 4G3XB 4PYZA 3K57A 2ZPYA 1DOYA 3HOWB 3JAMi 2NB0A 4EZJA 2Q2IA 3MXUA 5G5HA 1YHBA 4DFAA 1FXIA 2QILA 1WTWA 3VXWA 2EJFC 1WMHB 4LK0M 4XT3B 4DV3L 1VQNA 1QJOA 3CCUA 2KKCA 1HZBA 1FRDA 5LL6S 1IW7C 1I35A 1I4QA 5DPSA 1VQ6A 3GTLB 3G6JB 3G71A 5HGTA 2MO1A 5LMNL 1M1KC 1GM5A 4LF9Q 2YTXA 4R4TA 1BVSA 3SK6A 2ID0A 1UBIA 1YIWA 1IBXB 2NVXB 1EQTA 2A6ED 2ZCBA 4OWWB 4ASWC 1MFWA 2LJ5A 3EFCA 5M3FB 2SNSA 2LUEA 1TTNA 5I9OA 3CCLA 3K7UC 3Q0AA 5LMNW 1D6EC 1CA6A 1FFUA 2LGXA 4DKAC 4GLAC 3DHIC 1NE3A 3WOEA 1U4MA 2WXNA 1R9TB 1T0QC 3J7AF 4LNNA 2SDFA 1IKLA 2N49A 5NUCA 4RGOS 1WR1A 2F0WA 3H0GB 4NXNL 2J52A 1XPOA 3AEFB 1EY8A 3KOJA 2PE6B 1V6EA 4IWOA 4GKKQ 4DHJD 4HIMA 3RLNA 4MJSB 4DR6L 4GDLB 1I3QB 4W9EA 1JROA 5H8YE 1R7SA 4IUUA 3DWGC 4JWUC 3S2DH 2WXGA 4EKUA 1UEAB 2KQ7A 4NPSA 5I9PA 4KKTA 2IX1A 4RGTA 2JUOA 4LTUA 3PO3H 3IBEA 3W1YA 1D5XC 1E1OA 1ZDVA 3QIJA 2K8BA 3LYYA 5EPLA 2B2WA 2EYFA 4GLSC 5T8IA 2N9KA 5C3JB 2HQLA 3W9CB 1DM0B 1STGA 2Y5PA 4C3HH 4G4KA 1VQAA 1CUKA 1SR3A 3ZTDA 1SIFA 1ESFA 2E2JH 1RRBA 4ZKBB 1LTTD 2L11A 3HFZB 3M9BA 1N32Q 1GNUA 4IFDI 2GBRA 2WXHA 3H94A 2HT1A 4IN3A 1K0SA 4A3EB 2QMTA 4HLEA 1IBLQ 2LMCB 1Y1WB 2EKIA 3PVLA 1B70B 3ML8A 3UF8A 4JI6L 4HROA 1FYCA 2KMMA 4DGZA 4A76A 3TBLD 2VQEQ 2R7DA 1OTCA 4IWPA 2HHHL 2F1MA 2MUYA 2BCOA 4N9F4 4DV6Q 4NAMA 1YJIA 3TEYA 4HMIA 1N8RC 4FADA 1O7YA 1WFYA 1UUPA 5C4XH 3T9LA 2YTVA 2JY6A 1VR9A 2WXRA 1B3AA 4DUYQ 1WCMG 5EQ0A 4GN1A 4JI1Q 3OWFA 5E4XA 4JIOU 1UAPA 1IKMA 4DK6C 3DCGA 3DUZA 3LGJA 1CT1D 3LNNA 3OWEB 4A55A 4BY7B 5AEKB 3FEWX 1JC7A 1MBYA 4NZLB 1Q5WB 1UELA 3BS1A 4JI2L 3DQVA 4L5RC 1B53A 1E24A 3D4DA 3GTGH 2EMTA 1JRPA 3AE2B 2RHQB 2L8JA 2B2TA 1VMPA 1FNUA 4UAIA 3NTKA 2JA8B 3BZDB 2L1AA 4OZAA 4WH4A 5EE0A 1JE4A 4MSMB 1IUEA 3DM1A 4ID6A 1V9PA 4X65Q 3HVDA 4BZAA 2IPKD 2V4IB 1NBWA 1FCCC 4JCVE 1LM0A 1Z6HA 4KV6A 3W5VB 1N34Q 1CHPD 1A62A 2F0SA 4KV2A 2BH8A 5K36H 4MM3B 2RGFA 1I7HA 3BK2A 5JHBA 3AE3B 3I4OA 5I6WA 4KGTA 1OXUA 2KFKA 2B2WC 2GI9A 4P71A 3DBRI 1ICWA 4LDTB 3BZCA 3V62A 1TYGB 3S14B 2MQJA 4B3ML 3K5MA 4B3MQ 2V3NA 3TEWA 5BR8L 2B3AA 3CSFA 1NSNS 3DVGY 1Q8IA 5T1GA 1MHHE 2MGSA 3BU2A 3OLMD 1JW9D 3KH0A 4Q5VA 4HPPA 1KNAA 1VQEA 1Y8PB 2ZM6L 1YJ9A 1C79A 4QGUA 2DNFA 1Z47A 1ZXTA 2AKWB 3APCA 5MPOA 1WX8A 3TS0A 4X3KA 3U52E 4W9FA 3RMKC 1L6VA 3GTOB 2JX5A 2D3BA 4O2DA 3T56B 4D2KA 4ZUJA 4M0WB 1LTLA 3APFA 4BBRG 3T8MA 2IY0B 1KOTA 2LD9A 4OWTB 4FLHA 1J6QA 1K83B 1E90A 4O0AA 4XDCA 1YNXA 3TEXA 1LTAD 5EJWA 3T16A 3TCAA 4WJQA 1EOTA 1BCPF 1X9NA 1C1YB 1NYRA 1ZGUB 1RKNA 3AH7A 3RNEC 2OOBB 2N1WA 4MIUA 3S15H 2BB6A 3DBSA 4KDLB 1GB1A 1ZE3D 2C7HA 4UP8A 2LZ6A 4C2MH 4DDID 3B08A 1WGHA 2CHWA 3KUPA 4FYDA 1DONA 2O2VA 1WGYA 4NJ7A 3PT2B 1HE8A 2ZVOA 1L0VB 1DGSA 4GB9A 1S72A 4P72A 2WLBA 4FJVB 1T5XD 1V8QA 2K28A 3SVMA 1A2UA 5IYCG 2QKIC 4PMCA 5M9OA 3RT3B 3K6OA 3PIPA 2WXMA 4KLKA 4LMQD 4KX6B 2XVSA 4HSVA 4MTNA 1AH9A 3M7GA 2NBUA 2B2YC 4XYOA 4JI8Q 1NYQA 2CH4W 3UI3A 4KD4A 3K0YA 2B3GA 5D14A 3A1QB 4MT5A 3H6NA 3NBHA 2NVYB 3PMFA 3KVFB 3ZJUA 2Y5CA 2MQHA 2REXA 1QZGA 1XLOA 3J80E 1WJ6A 2RCFA 5FK9C 5IT9c 1HNZQ 5BYSA 2OTJA 2FNJB 3CCEA 1QG7A 2JQRB 3M3YB 3HOUB 4RNAA 3L10B 1VQHA 3I9V1 1BF4A 3OIQA 3C0RB 3I2ZA 4ANUA 4FF3A 2L83A 2JRIB 4A3BH 1K8MA 5KYIA 1V1OA 3EN2A 5C3EB 2K8CA 2A73B 2XRSD 1EIYB 2KX3A 5CV5A 1TKGA 2JJQA 3NVZA 1C9FA 1V1QA 3C46A 2M0AA 5FOBB 2RD0A 5H1SE 3HIZA 4LNOA 4YWGG 1F9SA 1WI5A 3NOBA 5JJIA 3ONAB 1E6EB 2RPQA 2W9NA 4ANWA 1UD7A 1VZ7A 5JEAJ 4BKTA 1FEHA 5DPWA 4WJWA 1T9HA 3KLWA 3RZWC 3Q3NC 1VQJA 2OT2A 3HOZH 4DNRB 4A8XC 4OELB 1U0LA 1VQDA 1SYEA 4IM0A 4E71A 4NNJB 1CSPA 3KYDD 4DK5A 4WRDA 1T0YA 4HTHA 2ZJDA 4HMJA 3CAMA 1KHIA 3P1MA 3R3MA 2OEOA 3Q2AC 4DV0L 1TWCB 3KJOA 3TP5A 4L5QA 3J7ZC 1NENB 4REZA 5JAVA 3LWEA 4YT0B 1C4PA 5GADC 3H91A 2F4VL 4JX1C 4Z9CB 4QUCA 4DQOC 3HRDD 4F8MA 1I4PA 4GN5A 4LF8L 3KF6B 4R8NA 2MPMA 5BMIA 3D4WA 4KN4C 2BGFA 5JVH3 2JWUA 3TIXA 4YCWA 2CKZB 4LUZA 1FCLA 3VR4A 2JWZA 2M4NA 2H88B 4KTAA 4NW2A 2WXQA 2UUBL 5ELEA 4ARIA 4B08A 1HPCA 3A55A 1NMGA 2K1BA 4NXMQ 3NY5A 4LNIA 2Z6BA 2EY5A 1NDDA 4LUVA 5C5MA 5M3MB 3MTNB 3QB3A 1NAPA 1RJTA 1TY0A 2L1BA 3MZ5A 1KLUD 2QCPX 1LTBD 2DJGC 4P16A 3ZXVA 1VQFA 1S5CD 5C0XH 4A3IH 4LFAL 5JPMC 3NS8A 3TBIB 1J8CA 2A5HA 2DNCA 2L3ZA 3Q3JA 1SSOA 4RF1A 2KMAA 4WQOB 5IYBG 1RWSA 2BOSA 1EQRA 1XD3B 5M5XH 1SMXA 1ZKHA 3RCZA 1N32L 3PRPB 3SK5A 4XTCS 1HTOA 3SFEB 1NVID 1WX9A 3QR8A 4HCPB 3WALA 2BS4B 3QA8A 1G6JA 2AYOB 1JT8A 4ZOHC 1BBUA 1XYIA 2RSNA 3I56A 2PI2A 4EX5A 3RMHA 1E7ZA 3STBD 5CGKA 2JXTA 1ZDXA 3PLUA 3RNGC 3A8IE 2RR9A 3IL8A 4F88A 1KM7A 1N61A 3Q3MC 3ONSA 5IGDA 3QOJA 1XTCD 1B1ZA 2PE9A 2UU9L 4HEA1 3UIPB 1SMYC 1K53A 1AE2A 2KC1A 4JWSC 2DWQA 3PO2H 4CDEC 3EIVA 2E5LL 3N30A 2WGSA 2AL3A 4L6TB 2L0TA 1SNDA 4X65L 1QB5D 1I4RA 3NZ3A 4BS9A 1PUTA 2DYBA 3NBHB 1UWMA 1WJJA 4MM3A 2GBKA 3VYRA 3UDGA 4FXGC 2WS3B 3W1SC 2IX3A 3OW2A 1O78A 3H3VI 1UH6A 2FIDA 3UIOB 2C7NB 1PRTF 2MJEA 1TS4A 4P73A 1HR0L 1VQLA 1CQFA 2LGIA 1QOFA 3FILB 1GJXA 1V5TA 1HRJA 1T6BX 4OGQC 3VDZA 3KWVA 1Y56A 3CMMB 4IO9A 2KANA 2M1MA 3H7PA 1B9MA 3S2HH 4RCOA 3TJPA 1IHZA 4DR1L 2J7QB 3U30A 1EY9A 3SXHA 3D3RA 1L6UA 4JI3L 2TSSA 2EELA 4DV3Q 1C4AA 2I38A 2H5XA 1M4VA 3G7LA 3MC8A 3TL5A 3F2BA 2F0FA 1YEZA 5C44B 5BN4A 1XEEA 2O6VD 4PK1A 1AYFA 4ICVA 1SF0A 3NTIA 4KKSA 2QA4A 1AFPA 3HM6X 1XMOL 2LVPA 2PQAB 2WDTB 2WYQA 1X6OA 4R4CA 1TS5A 4OEMB 4WWOA 3PGZA 4YSXB 5TR5A 2BBCA 3N3KB 1D5ZC 2KC2A 1OGWA 3HOVH 5G55A 3S1QH 4KSLC 1WJUA 5KNDA 4A3PA 4G50A 1FO4A 1MG4A 5IN7A 4OZCA 3L7ZC 2MNAA 3TZUA 1J9OA 3CCQA 2D2QA 1SE3A 3HUIA 2LGYA 3NELA 2I07B 4DK3C 4NB3A 2UU9Q 1V8CA 3V05A 2O5IC 3AU4A 3HOYG 3GOEA 2FXQA 5EKIA 2CU1A 2F0HA 4DR3Q 1HNWL 5D65A 4DN4M 1T3QA 2YEPB 5CV8A 4FJYA 2JYEA 1Y1VH 1EM7A 3PS6A 1AZQA 4O42A 5C4XG 5KIXA 1DD2A 3IVFA 2KTRA 3PGEA 4EQOA 4KY6A 3MFYA 1YIJA 3P20A 1TIID 3GP7A 2FUG1 4CDCC 4DF7A 3HOYH 3NVYA 3S16B 5GQOA 2D5DA 5A35A 2D3AA 3AB9A 1EYAA 4X3SA 2E2DC 2KECA 1LTGD 3J81E 1M8AA 2K5WA 1STNA 1SE4A 3OMGA 1WM2A 4WIPA 3DDCB 3EUB2 2AWNA 4W9IA 1EEID 4IPDA 2W3SA 2KCNA 4IUMB 1RCVD 1WRDB 4GOPC 3S1NB 2K5PA 2QHOA 4LF6L 5IYCH 1II3A 3DPDA 4ZKCB 1D3ZA 3ER0A 4G7OC 1L0XB 3GTKB 1K51A 2GB1A 4S0RA 4W9CA 2ZXPA 1PRTC 5L37A 4FULA 4XE0A 4AJYB 1B2TA 4GS3A 4UHVA 4C2MB 1PH6A 2Q8RE 1RIPA 1X3QA 3J80c 1ZXIA 2MBOA 2WXOA 4FHKA 3ZNGC 1XNRQ 3RNFC 1LT5D 4M8AA 3KUCB 1MI2A 4EZLA 2WXFA 3A5ZB 2B2VC 4GOPB 2NVTB 1U4AA 1XCQL 2Z4IA 2JSVX 2ZW0A 2E74C 4HCNB 3RZOH 3ZNZB 4QJFA 4ZRZA 5I4DA 4LF9L 4LFCL 4X64L 4GKJQ 2FUHB 1EY5A 2ZTDA 2NBFA 2HHHQ 3OJ3A 2MRPA 3TEZA 2K5QA 4XYQA 1Y69U 5IP7G 5K5PA 3MAQA 2VZKD 1V49A 5JHAA 1HH2P 1L2FA 3ND8A 3AQQA 5DM73 1FJGL 1WRIA 2HD5B 2KT7A 1IYJB 3H15A 2KHWB 1VQMA 3DOWA 4GZYC 2QW7A 1KAWA 3OSOA 1DOXA 2CJOA 3VAWA 1IYFA 3VYTA 3AU7A 3EQLC 4N9PA 4NDXA 1B50A 5JOBA 1YN4A 3D8GA 2IZVB 2AQ3B 2N78A 5ELBA 2Y3AA 1F2RI 3M62B 3DWMA 1BXTA 2UUCL 2KEDA 1STBA 2SAKA 3ZRFA 3QQ8B 4NAWA 2PCFB 4HWIB 3QHTA 4QB4A 2UWQA 2BPSA 4MGKE 4W9LA 3MFGA 1WM3A 4ZRPA 3ULPA 1KTKA 2BW2A 3P4SB 4Q2JA 5GROA 2NBWB 4HCSA 3S2AA 1C0AA 1WY8A 3ZJTA 1BCPC 2BS2B 4NJ6A 1UGJA 1SB3C 3EFUA 1VJKA 4C3IB 3BYYB 4GNXC 3I4NG 1BBXC 5FKAC 4EE2A 1EL0A 5JVG3 2KBNA 4C3JH 1SLJA 5AJ3L 5LMNQ 4FF2A 3E9SA 2R92B 4A3DG 5HI1A 1WWTA 3IT6B 1CMXB 4QIWB 4BY7G 1LO5D 2PW5A 4K14A 1YI2A 4IDIA 1SMYD 4JI2Q 1BCPB 1U5KA 2E2IB 1Z5SB 2XNAC 4DR2L 3I4MB 2D11A 4CQNA 4F8CB 3L17A 2VZAA 5AZHA 1WCMB 1VQCA 4IM3A 2LS01 3CCJA 2WDVB 3QG1A 2EKEC 5IY0A 4KKJA 2B29A 2JK8A 3DWAA 4RH6A 4RAUC 2KLGA 2RA4A 1MSGA 1YQBA 2KCCA 1TWFH 4BXXG 1DCZA 1FPYA 2HCCA 2LGDA 2V4LA 2NVUI 1KLGD 4X64Q 3PIOA 2HTME 3OHXC 3VQIA 2EYJA 4YWLA 2F0LA 4XQQA 2UXDQ 1HZ5A 1LFDA 2K0PA 1WXMA 3W5UB 1PQSA 1J7BA 2EYOA 1N63A 1P9DU 2JPHA 3AULA 2J0KA 2K39A 1X65A 1TXYA 1E0ZA 4M0WA 1JWSD 4W9HA 1PXUA 3GTQH 1JORA 1R4NI 4IPGA 2MWSB 3GTPB 5LNK1 2Z6KA 2DX5B 5C4JB 2UUBQ 3FHWA 4JBJA 4GOPA 1OQYA 5EE1A 1XJVA 1F2RC 5FJ8H 2PIAA 2PPHA 3I5JC 1KXLA 1JJCB 4LF6Q 1XNRL 1I94L 2GBNA 3ETRA 3AFQA 3TZDA 2JRHA 2LJIA 4K3CA 3HKZE 5ELNA 2A69D 3E5SA 3MWYW 2UUAQ 1XCTL 1C78A 2N7EA 4FHJA 2NPTA 1SROA 3KBGA 4R4OA 2VY3A 3HG9A 3M4QA 5EKKA 5IE8A 2JEAI 1SGHA 4AOFA 3HOXB 2V0GA 2DJFC 4PS7A 4YTMB 3I4NH 3IXSA 2K9XA 1HCZA 1YNNC 3T1YL 5IA7A 1HFGA 1SNMA 2J7ZA 2I46A 1R4MB 3H1UA 1TZOA 1R4PB 4NPNA 5AZFA 2XK5A 3VH4B 2R7ZH 5BMGA 1XMQQ 2DZKA 2VQFQ 5E1FA 4GOCA 4KSKC 2H89B 2KOXA 1WGGA 3DHHC 4KKIA 2M19A 1W6KA 2ONQA 2I0QA 2J0JA 5C0XI 1EOVA 3J81c 3FKIG 3K5NA 1K52A 4YCVA 3W1BA 1PH9A 1JJ2A 3UQBA 3KYCD 4J6IA 5FO7B 3PRZA 3CXCA 1N36L 1EY4A 1VCIA 1O7LA 5M3FG 5IT9E 1E8WA 4P6VF 5C23A 2KHIA 3VDYA 3HHMA 4HRSA 5CV6A 1CZWA 3DBLI 4C3HG 3NWTA 4OO1H 4LF7Q 4IQZA 4A3FG 4JLCA 3ZGZA 4C7ZA 3KDFA 1EFID 3M4PA 4S17A 4YTNB 4C4VA 1FXTB 2D10A 3PHWB 2JT4B 3OTOQ 2JA7B 1E8XA 1LYLA 1N62A 4ABNA 3NTHA 2DY7A 2KDIA 1R4NB 1ZXHA 4U673 2L12A 4LF4Q 3PV1A 2F0UA 4L2YA 3E3XA 2XN9C 1SNCA 3HOWG 2LRUA 4B0EA 4WFN3 1A8VA 1G6ZA 3UDIA 2C5CA 1DXMA 2ZTEA 3MEFA 3BWUD 4HDOA 2CJNA 3PZ7A 3W2DA 3CKIB 1IBXA 1KIXA 4JI8L 4UY8C 1QWYA 2WNMA 3M85A 2K1FA 1XPUA 1M90C 4CKEA 4BFRA 2JA5G 3ENEA 1HQRD 3B2FA 1CSQA 2D9UA 1VDVA 1QOHA 1RAXA 1KRSA 1LQBA 2ATWA 3VUWA 4JI5Q 1MJDA 1QNKA 5IP4D 4TQUS 2AMCB 4HJGE 1TKWB 1CM9A 1TR5A 3TP7A 4DR5Q 4H0LC 2F0TA 1CZGA 2SOBA 3V6EB 4C4VB 4PZ6A 2F3VA 3J9CA 5KRUA 4OX9L 4OIJA 5DPRA 2R6GA 1ET9A 5E4WC 2IGHA 1E2VA 3X3NA 3FILA 3VRAB 1A0IA 2Z0EB 4A3LG 2M17A 4BBNC 3MJWA 3A7LA 2KVRA 2MBHA 2PTLA 1L2NA 5IGEA 4A3FB 3MP9A 3PTFC 1QKZA 2BQQA 1C8CA 1HZCA 2IX0A 4LLGM 4L23A 3TMPB 1EUVB 1P7EA 5L83A 2N9PC 2Y0SE 2KN5A 1HR0W 4RHSA 2K4KA 4B9WA 2K6AA 4CHKA 1MPEA 4HEDA 4APVA 3U2SC 4C1NK 1SFOH 4KDIC 1WTQA 2E5LQ 4HAEA 4DV2L 3HOZG 2WP9B 4IZ8A 2PKOA 1BO0A 3OJ4B 3L3OC 3MC0B 1L1OA 3FPUB 4DHJB 1S1QB 2LEKA 3S17H 4XT1B 1LT3D 1Q12A 4R4QA 2DYMA 4EQPA 3HOXG 2WKDA 4A3JG 5IYDH 1A3UA 1SNQA 2JE6I 1FNVA 3BVZA 3DBRB 5IIFA 1PGXA 3V3XA 3G4SA 3EFXD 4II3B 4K81A 2NCNA 1CQVA 2LHDA 1IBKQ 3CRLC 3T13A 4CGYB 3PSIA 2R61A 4HK2A 3WANA 1PTOC 4MNOA 3NHEB 2HDEA 2KJRA 2BA0A 2R93B 3MHSD 3RNAC 3EJIA 1V86A 1FMAD 3HK0A 4FN2A 3T3NA 4GNXB 5C2TB 4DHZB 1TY2A 3IAS1 4C7YA 4B3SL 4IUVA 2GLSA 3DVNU 4YCUA 1VZ6A 3M63B 3A33B 4YSZB 3BVGA 4A9AA 3PUYA 5D2MB 3AN1A 1NI3A 1JB3A 3HKZB 3GZNI 4RG1A 3CP0A 3AMZA 1AE3A 4DNTB 2PNRC 3D31A 4JI0L 2YLMA 2F0QA 4W9KA 2F3WA 1EY0A 1X3FA 3CRKC 3QK0A 4DR4Q 1DZ1A 4CO7A 3CCRA 2NWGA 1E2WA 3AV8A 3VA7A 1NNXA 4MGYE 2JA6H 3ZRCA 1BKBA 1EO6A 1EY7A 3KYHC 4USAA 1WZ0A 1WZ3A 3IT4B 3RI7C 1RODA 3I91A 2NN6H 3R3OA 2JZ3B 2E2HH 2FINB 1V9JA 2O5JC 1JALA 3RNCC 3N1YC 3GTLH 3E0EA 4KVGB 1EYCA 3IHPC 3EVQA 1I4HA 4LFBQ 1ZYRD 3L0OA 1XO3A 4DV7L 5A2QL 2FMMA 3K58A 2W82A 1Q1OA 5JJKA 3K9OB 2BH2A 3L08A 4C3HB 4DV4L 4A93G 2Q8TA 3UDXA 2IL8A 3A5UA 2DAFA 2FJ2A 2IDYA 3U58A 5D6JB 2E76C 4MZ9A 4PQXA 3ND9A 1SXTA 2WP8J 4HJAA 1FNWA 1VDZA 4A90A 3ZTCA 1BUVT 4MGIE 2A6HD 1E8YA 5C0XJ 2N55A 4YHHQ 3B1LX 4RGNA 4A3EH 5A2QE 1A63A 4ZCKA 4KKUA 3PO0A 3AE5B 4P1BC 2BS3B 2CHBD 1ZW7A 4BKSD 4QIWE 3F1ZA 4BBSB 4PV1C 1LUZA 3ULLA 3C3LA 3BYTB 4OZBA 2X6GA 3C1FA 3E56A 1TWAH 2PZUA 2WDQB 5BYQA 3PHXB 3K7AB 4JQWC 2PVGC 5ELCA 4ZYNA 1I50H 4R8IA 4GSWA 3GE8C 2MP2A 4EEWA 2WQYB 5CR3A 2R2OA 2CQAA 2KCTA 3ERSX 5IWAL 1XNQL 1E1TA 2D07B 3DBHI 2VXWA 4XC2A 2F0DA 2Z6KC 4YXDB 2KYWA 3O13A 1HA6A 2MBQA 3NS1A 4JC0A 4HPMB 1EZ6A 4II2B 4LNKA 1GB4A 1EYDA 2ZJQA 2PZTA 1QT9A 2MBBB 1TWGH 2KJ6A 1X3PA 2E8GA 2JZZA 3PSEB 3RZDH 5LL6X 4GDKB 3A0JA 1RL2A 5DEHA 2G4SA 1MG8A 3MXNA 4M01A 1WI0A 1Y1WH 1TWFB 5H92C 3QIAA 2Z0DB 4XGAB 1G291 1MSHA 1TWCH 1RYJA 4RWSC 4BA2I 4JI3Q 1XMOQ 1PH4A 2YV5A 2XRQD 3KK7A 3R2IA 2MX2A 1LXDA 4ZRKA 4AH6A 1Q81C 2X38A 1UZXB 5J18A 3I3CA 3RPFC 3U9SA 2RDBC 4OIKA 1PYSB 2BYTA 3E9IA 1YVCA 4FP5D 3HZXA 2B76B 5E6PA 1F9RA 3FMCA 1S5FD 2BDOA 3A8KE 5C4JH 2NVQH 5ELDA 4XZ4A 1VQGA 3PREA 1AARA 4A3DH 2F4VQ 1Q86C 3UE0A 1S3SG 1WX7A 3FKIB 1J7AA 3OAWA 4HDQA 2KD0A 3I4MG 1YOVB 2KCMA 5G3LF 3AEEB 1RDPD 1F2ZA 1IGCA 2RDHA 3I7FA 1C77A 3AXCA 1E7UA 4M00A 4A20A 3WAPA 3DHGC 2M56B 1ET6A 4GLXA 4KHPQ 3IAYA 2VUMB 1BMLC 3MA2B 4JVZA 3MJ5A 3WAMA 5EPKA 3GTGB 2YU9H 1X55A 3I90A 1MI0A 2I1JA 3R7RA 1WH3A 4QL5A 4JI7Q 4MGZE 1YNND 3D4RA 3E0JA 3GV3A 1ICFB 1F1HA 2A68C 4AYBG 4ME5A 1S5BD 3W1GA 2GBJA 3B6YA 1Y14B 1DYQA 1JOKA 2RKSA 3AE4B 2M0XA 4JI7L 1ENCA 2KN4A 3I73A 4NJCA 3K81C 1SJHD 1GO3E 4ZK9B 1PH2A 3IFWB 3PO3G 2VB3X 3CCVA 3A4RA 1PFBA 3AEAB 5DPTA 1KC8C 1ENFA 1J5EQ 1BQQT 2ES2A 2BYFA 1MD2D 3V6CB 3RN2A 1EU4A 4LNFA 1ZKOA 3GTJH 3E6ZX 2D2CC 2JSOA 5FR3A 2IYDB 1OXSC 2Z8LA 4HN7A 2JU6X 1FGUA 4XQJA 1WXQA 2KEEA 3RUZA 2NVXH 2Q5WD 1JICA 1ZUD2 4W9GA 4LFCQ 4GKJL 3VTVA 4FA6A 4H7BA 3ZYYX 4A6QA 2O2VB 4KHZA 4K2LA 1PRTB 1U4PA 3S1MB 2YVCA 4UP7A 4X66L 1FGBD 4LAAA 2LXKA 1EQQA 2VH2A 3AEDB 4YTPB 3VR9B 5C4ZA 1G51A 1WVLA 5G2NA 4BOSC 1EUJA 2I5LX 1TGZB 2IY1B 1E10A 4K5WA 1EWYC 4GDKA 3G48A 5KHOA 3KWLA 1RTOA 3VR3A 2CFMA 4YIJA 3P2BA 3GTMB 1ZPSA 2G45B 1WTHA 1GC7A 4XWWA 2B2UC 4HJ7A 1F2LA 1HR0Q 1Y1WG 4DV0Q 1KJTA 3NVVA 1VQ7A 1WTXA 5CBEE 3F2DA 4C3JG 2B63B 4KJOA 3S2DB 2E75C 5LMUL 3CSTA 3JSVA 4PS8A 3Q24A 3TMEA 2Q8IB 1BOSA 1F9PA 3PO3B 3PUXA 2QIEB 3D32A 2EOTA 1HZ9A 4DAYA 2ZJRA 1JB7A 1KF6B 1TT5B 5JEAH 2WXJA 5HHDG 3AE9B 1FR3A 1OXVA 2FIFA 2O6VA 1GUTA 4X6AH 2ZW1A 4X3UA 5DM63 3EHVA 2BTEA 1A3VA 1MVKA 1LACA 4QCLA 4FF1A 2W3RA 1IP9A 1KAAA 1QUQB 1GVPA 1BR9A 2PW7A 3A56A 1XTDA 4UPAA 5D3DA 4AYBB 1AZPA 1Q0WB 5BN3A 1WJNA 3HKSA 1E2ZA 2M2LA 1F2MA 2INCC 3LB8C 3NK9A 4BBNF 4PG3A 2N88A 2F3IA 4ME3A 2EDGA 3U50C 1WOCA 3N6RA 4IFDJ 4QQBX 2KHSA 3M3YH 4HXDA 1WGKA 5JJLA 4JV5L 4HJ5A 4E6IA 1WIAA 2HIVA 2ASBA 1ZYRC 2EZVA 1YITA 1S3OA 1TWHH 2F03A 2RSOA 3WWVA 2LWPA 1TQOA 4A3GG 3L16A 2L32A 1SBBB 2MP2B 1SNPA 3L4PA 5CHWA 2VL6A 1Y1VG 4HIKA 1SRUA 2AUKA 3CQZB 4LCDE 2DBYA 4F7XA 2K01A 3ZVVA 1SAPA 5JXVA 2DHZA 2WXLA 4A75A 1F2YA 4JK1C 3SGIA 2DAJA 2Z0SA 2N7JA 1SDFA 3PIP3 1R4MI 4C80A 5FJ8G 3LJ3A 5DNFA 2C9WB 1QLBB 2MBEA 1D8LA 2ICIA 4MHEA 5EGTA 3R8BA 4LFBL 1E9MA 1XXGA 1H9MA 3HOZB 1KH0A 3DVGX 4KY7A 5LMUQ 3SR1A 4GN4B 5FO9B 2HE7A 5AUIA 1PTOB 4O1NA 4BAXA 1EF1A 2K03A 1UEBA 3D6CA 1FVIA 2YTYA 4TV3A 3S1NH 4RM8A 4L5SA 1TKEA 2Y0SG 2Y5BB 4E3CA 1VQPA 1BT0A 1V43A 4K8JA 4LF5L 3P7JA 3H3VC 5IO9A 5JJZA 3JAMc 2K50A 4QUFA 2L05A 2FBWB 3F2UA 4IFDH 2KDFB 4WWMA 2KA7A 4I7ZC 4EGVA 4P1CC 2A6EC 3QJZA 1GUNA 1E3PA 2K5DA 3M4OH 4DR1Q 1H9RA 2OQ0A 1K9MC 1X1MA 4KZ0A 3U7DA 2KMCA 2ZNVC 4KK7A 1ILPA 3QX1A 2I5MX 1BBWA 3AB5A 2CW0C 1T0RC 2PQAA 3X23A 1I6HB 5C1ZA 2UXDL 1I42A 1PFMA 4JPBW 3I63C 1H9JA 2WX0A 2IJ0A 4JBWA 2K14A 1Q1EA 2LI5A 3DVNV 4JW0A 3DEPA 2ZPNA 2QEJC 2R7ZG 3S14H 5FLXc 2AX5A 1L1OB 2JA5B 4ULLA 4JI4L 1JWMD 5LXHA 3PIO3 1H9KA 4DR2Q 5BO4B 2R7FA 1CKNB 1F52A 1I3QH 2KWVB 2MHJA 3V2TA 4WAAA 3BVMA 2WX1A 3HOWH 1L0YB 3MEHA 1K8GA 1Y8NB 1VRAB 4JPSA 1C4CA 2L15A 1QOGA 1ASZA 3OMCA 1OQQA 2K5NA 5CX3A 5CYUA 1Q1BA 4IOCA 5BR8Q 1HJPA 2D3CA 5GXGB 2HD3A 1N36Q 3UQAA 4MJSA 4AS1A 5F2DA 4I65A 4FBJB 3PQIA 3S2HB 4P7IA 4PZ7A 4NQLB 4E74A 2FCQA 1IXRA 2HTHA 2EE1A 5M3FH 1YNJD 2NPTB 3RFZB 4MACA 3SD5A 1KQSA 2NN6I 1JOQA 3AEVA 2QC8A 2BKFA 4OW0A 1GUSA 4A3GB 1BNZA 1A70A 1ENAA 3PUWA 1Q46A 5JPNC 4URKA 4M1UB 5IYBH 3WIMA 1YJNA 1AW7A 1IYUA 1WTRA 4ZRJA 4RCNA 2VW9A 2F0NA 3PZ8A 5IOIA 5HKHA 2A68D 2RPVA 1Y8OB 2WB1E 3Q8FA 4OWXB 3U7ZA 3EA6A 5GAHC 1VQOA 1RD9D 1ASYA 3HRZC 1W2BA 4FJZA 1NMFA 2JZPA 2Z4HA 2QSDA 1D4BA 1VF5C 1PYWD 2PI2E 1CJEA 1WGDA 3NSWA 2KQ4X 1L0WA 1EU3A 3GZNB 3P1HA 2OJWA 3ZJYC 3A8JE 1WE7A 4JI0Q 1WR6E 2LFIA 2KK8A 2E2IH 4DR5L 4H02A 3JSVB 1GJZA 2OXPA 4R1JA 3NJTA 1NJIC 1H95A 3NZUA 4K7UA 4BY7H 1HUNA 2QDBA 3SEBA 2PMZB 1EWCA 1Z7TA 3RR5A 3AECB 2WAQE 2DGYA 4PNYA 5E3FA 4CKBA 5CTRC 2Y0SB 4L8JA 4Y52H 3H7PB 2INDC 2H4OA 2IHEA 1GG3A 3AE6B 3QWZB 4F7ZA 2C60A 1V80A 5IT9L 2JA7G 4IJHA 4MDKE 1PZJD 1HNXL 2ZM6Q 3TS2A 1Z2MA 2PJHA 1NR4A 4DAMA 3UI2A 1YJJA 3H09A 3KFUA 1AWDA 2EYLA 2MA9B 2KWCA 3J80i 1JWUD 1F9JA 1N6ZA 3S1QB 2KO3A 4K7SA 1GUOA 5G5GA 2WXPA 3VR8B 3Q8CA 4LNQA 3OG5A 5LLIA 2OTLA 2K5HA 4HSPA 1XLPA 3I70A 1HZAA 1CKOA 4BWGB 3CPFA 1B44D 1JMCA 4J8QA 2XWBB 4DPGA 3TSSA 5E6OA 2BYVE 1WYGA 4TQ1A 2EIFA 5CBAE 5M5YH 1VQKA 3FRPB 4DR6Q 3HOUH 3ITPA 1SYDA 3RLFA 3C1EA 3H7SA 4CYEA 1PYBA 4PMWA 2WAQG 3A4SC 4K5XA 2IBIB 4NAWB 4YY3L 4ARCA 4NXNQ 4IUTA 5GAEC 4POGA 3ICEA 2QJLA 4TMAB 4I6NB 3A74A 4RA8A 3GTJB 2UYZB 3VYUA 3U4ZA 1EYGA 3RN5A 3DBHB 4KJNA 4OVUA 3R7QA 2F0JA 1XX8A 1T5EA 3JAME 4A3MB 2D0OA 2RDGA 1ONLA 1G91A 3HEJA 1E5WA 1RTNA 3I4LA 1C3TA 4WORA 1Q8KA 1GHJA 4A93H 3IG3A 3FDTA 4ODGA 2K6DB 4GDLA 2PYKA 1X3GA 3V61A 4QF4A 4KN7C 1L5PA 2NYZD 1B9RA 2HUGA 1ROEA 3SDZA 3J81L 4UP9A 4V190 4JE3B 5M5XB 3A9JA 2MJ8A 4RMFA 5IAAC 1PVOA 4B3SQ 2VZKB 4A3OA 4RM9A 4JI4Q 4IUPA 3AFPA 3CPWA 2JA7H 3DWPA 1HNZL 4IFDG 1QVCA 1C48A 1GD7A 2HDMA 4C56C 4GN3B 4DAYB 2R3ZA 2K25A
chains in the Genus database with same CATH topology
3KF8A 3VA5A 1GUWA 1LTID 2B2UA 4FXKC 1ESRA 1TS3A 2X6LA 1WTVA 4PMBA 2EYMA 3FPPA 4FO2A 5J1ZA 2KQ3A 1RM6C 1KDBA 4K6DA 2WXKA 3SFDB 1O80A 3PO2B 2WINB 1LT6D 1XWEA 2ZXRA 3TUOA 2FMCA 2NUCA 2WU2B 4IALA 1W6JA 3I72A 5AFWA 4CJ1B 3SK4A 1EIHA 3FC4A 4WURA 1YN5A 3KBXA 3ZQ4A 4NMZA 5J22A 4J6HA 3I57A 1N60A 2VNUD 4U68A 2KAJA 2L5TA 1FXAA 1K50A 3GD7A 4DAPA 3EGRA 2OF1A 5KNBA 1E0BA 4N59A 4IOIE 3BDCA 2WDRB 1J8IA 4TRDA 2GRIA 5D3IB 1HFNA 1EQVA 5ELFA 4ZUIA 4ZQ3A 2WXIA 4EQNA 5IODA 1I4GA 1QOBA 3W3AA 3OPOA 1HQMC 3KLRA 2EJGC 1YQ3B 1ILQA 3WOFA 1A2TA 1HUMA 4F87A 1ZEQX 3C2PA 4CBVA 3MVVA 1HA5A 1H9SB 2MEKA 4HR7B 4A3BB 2K33A 4CHTB 1NUCA 5C4XB 3DMUA 3R2TA 3MTSA 2W54A 2OHFA 2PPBC 1LTSD 2K04A 1U4LA 2MJDA 1U9RA 1FD6A 3BDOA 4A3IB 2BE5D 4A3DB 2EVBA 2E2JB 5EE9A 1TVXA 1FM0D 4PT5A 3CIRB 3I4NB 4C3IG 1JOOA 1HZ6A 2LKVA 2G9DA 4RKLA 3X3MA 1O7ZA 4HKZE 5COYA 3VR2A 1SNOA 1MHXA 1JCKB 2E2HB 3AM9A 1JWBD 3FVQA 3SK8A 3VR5A 2ENBA 2DNEA 2BE5C 1TU2B 2LMCA 3ABVB 2M9VA 2E6XA 5CC4A 1DGJA 1YMHE 1PDQA 1F0ZA 4CKCA 2J0TD 3J7AV 1YNJC 5KGUA 3BIID 3QWNA 3C8YA 1ML0D 1LV9A 4H13C 2WACA 1DOKA 2B8FA 1GOZA 1PZKD 4BA1I 1FIQA 4G7HC 4KMUC 4OHJA 3NQIA 5BMHA 4FNFA 3T4AC 2F0EA 1EWHA 1HHVA 3S15B 1XLNA 1C4QA 1STEA 1E7PB 2DLBA 2K22A 5ISRA 1L4ZB 5IGCA 2BT6A 3KLSA 1TWGB 2VB2X 3OIPA 1LT4D 1CI3M 2XSCA 1QE6A 2ZT9C 1A6XA 2KOLA 2RQXA 2YYZA 3GO5A 1QCBD 3EROA 2HQEA 1EY6A 4XIGS 2M00A 3TP6A 3T3OA 1XF5L 3CWIA 2MJ3A 2TMPA 3N9YC 1GXDC 2F0OA 3GV6A 4R3DA 1ACCA 1WD0A 1LTRD 2PO4A 1X32A 3KLSX 4A3JB 2GA4B 2I2YA 3P4RB 2WAQB 4DAVA 3A54A 5M5YB 4IKGA 1STHA 2PMVA 5T1IA 1VF7A 2BDNA 2SEBD 1F9QA 2XWJB 3HGBA 4RHRA 4LJZC 1AP0A 3PUVA 3T51B 4OL7A 3HOVB 5LHY1 4XWTA 3ZJVA 1TJEA 4S3SA 3DHQA 1V97A 4A93B 4RF0A 4XDXA 5CV9A 3L9AX 2XIWA 2PVOD 3BDLA 2F0PA 4ZRQA 2JA6B 3CHBD 1KNEA 1WD1A 3V96A 4CJ0B 1P7FA 2V3PA 1DOLA 3HS0C 2LUMA 1IL8A 1CHQD 3NXWA 4MH8A 1CTMA 2CVRA 4NKLA 1N5XA 1L4DB 2F0GA 5HURA 3AMUA 1WSPA 3NPPA 3OOCA 4C1NI 2Z1CA 3M7NA 5CORA 4YSYB 1D1IA 3J80L 4B0MA 1D5MC 2NZ1D 5IGGA 2F4IA 2RMMA 2EPBA 1SYGA 3NE5B 3VRBB 3DEOA 5D7GA 1PTOF 3URYA 2W55A 3U9OA 4US9A 3N52A 4QMGA 1F77A 3HP3A 2D5GA 4WQMA 2NTSA 3AEBB 4LK1C 2C9OA 1HTLD 4NP5A 3SHLA 1UNSA 3NUHB 1ZOYB 5I6YA 5HG2A 5FLXE 4XXEA 1BCPD 4OZBA 1GAQB 4B9XA 3H6MA 4BBRB 2HCIA 1OQRA 3RZDB 2EYPA 2A69C 1SSNA 4DA2A 3P4PB 2EY2A 2EXZA 1SEBD 4OVZA 4N6EB 4L63B 3S9WA 2R7ZB 1Q10A 2ON8A 2IGDA 1EEFD 1CK1A 1TWAB 1B9NA 3K5LA 2L55A 3IKJA 2IGGA 2KVMA 2A74C 4X3TA 1I50B 4RFBA 1TT2A 3QOLA 5KYLA 1KRHA 2AWOA 1DJRD 1OFFA 2AUJD 1SYBA 1PLFA 4KGRA 4XDDA 2EYHA 1ZP0B 1MGSA 1PDXA 5HFYA 1YN3A 2X69A 3GTQB 4C3JB 3QO2A 1YNTE 5C0XG 1D2BA 1SE2A 3M4OB 3R93A 1JQ4A 1A15A 4RGMA 4AQ7A 2IW3A 1WTOA 1JQYD 1YQ4B 1BUIC 5IGBA 2DY8A 2QF7A 3SE0A 2NVQB 2JXMB 3S17B 5IOCA 1Q3LA 2HDLA 5DAUA 3Q8BA 2G9HD 2MH7A 3MXPA 1RHPA 3OW7A 3H8HA 5J39A 1SYFA 4ZHOA 3PUZA 3WDNA 1I6VC 2V4DA 1PGAA 5C4HA 1N5WA 4G57A 2MP1A 3J7YW 4N58A 2F0KA 2L9HA 2ACZB 3LX0A 5K36G 4DXGA 2N9LA 4K8IA 2G1EA 1PRTD 2B2YA 4ZHPA 1RFKA 1PFNA 1TKYA 1QILA 4XQNA 2KWDA 1FFVA 1IYVA 4R9WA 2K32A 2JYOA 5FLXL 2B8GA 4H44C 5IGFA 3HOYB 2ZXOA 5EE3A 2O4XA 2CU3A 2JEBI 2J53A 5C6AA 2JYTA 4KGSA 3QJYA 1VLBA 2PLPA 1WTPA 3LWUA 1KDAA 1TS2A 1PZID 2KDMA 3LXFA 2H1EA 2KUMA 1PFDA 2OEDA 3M4YA 3MXGA 3BG3A 4KD3A 1VZ8A 5E6JA 2L0CA 3A7AB 1EIGA 3GB1A 4IUQA 2LFNA 1TWHB 5KEEA 3NQTA 3TP8A 2JP1A 2EY6A 4H2AA 2EY1A 1H9SA 5I2YA 5KNCA 3IFDA 2F0VA 1LABA 1S4ZA 4ZYSA 1OO9B 4RKBA 4G7ZC 2L4NA 2FFKB 4EVOA 3KQ4A 1GUGA 3U4EG 4ZLTF 4Q0FA 2K05A 2INNE 3P4QB 2O2LD 2F0MA 1PTOD 2DN8A 2B2TC 5EBCA 3SR6A 5C3XA 2AQ1B 1K8OA 2LHEA 3GQBA 1KABA 3ERQA 3K5OA 5FO8B 1STAA 3AE1B 1EZ8A 1FRRA 3NWSA 3CU7A 3NHHA 1JMLA 1IW7D 3AEGB 1IGDA 4CJ2C 1GHKA 1S5DD 4FF4A 1CFMA 2B2VA 1SFOB 1KDCA 2D62A 3TN2A 1PTOH 5C3WA 3AE7B 2INPE 4A3KB 1G8ZD 4US8A 2SNMA 2YU9B 3NRZA 2EJMA 4OO1I 3BK1A 1SYCA 1QQRA 1HXYD 5C5LA 1R4QB 3HVZA 2WKCA 5EPJA 1CA5A 3TDQA 2K3UA 4TQ0A 2BB5A 3GS2A 2A6HC 3P42A 2CW0D 1HTPA 2RDFA 2L52A 2FHTA 3VR6A 3RD4A 2E3TA 4V0BA 4K2KA 3VYSA 1KFYB 1STYA 1GPXA 3P75A 4J3OD 3IAM1 4DK0A 5M5WB 3W1SA 1V1PB 1Q90A 4K5VA 3MHZA 4ZAIA 5G3LD 1AN8A 3NP8A 4ITKA 4WAFA 1DOMA 4DXFA 4FXCA 4MN3A 1A3TA 4KY5A 1VMCA 2DYOA 4P2CB 4FVMA 2ICEC 1D1KA 1AEXA 3MHBA 3FAHA 3Q8AA 1LLRD 1CZPA 1BDOA 4HCEA 2YEPF 3NVWA 2WV6D 3S1RB 2FE8A 1J7CA 4TKOB 2RVLA 2J4XA 1I4XA 3NBIA 1C76A 4N9TA 3DXJC 3AE8B 2B39A 3RZOB 4ILWA 1FD7D 3NUCA 1SIJA 2K7VA 2RBMA 1JR0D 2LY7A 2MHVA 1G2SA 2F0IA 1NR2A 3IFTA 4IUNA 1PMRA 2NTTA 1U4RA 1UWXA 2AQ2B 1RF2D 5CV7A 4Y7NB 4K6LA 5BYRA 1B4OA 3D6WA 1G2TA 2PZWA 4KI0A 5CV4A 5EKLA 2N0SB 1HEZE 4DU9A 4OO1G 2NN6G 2PW9A 4L1BA 2BA1A 1JWAD 5AUKA 1QOAA 5TSSA 4KHVA 2IT1A 3B2GA 3Q23A 3T53B 3Q6SA 5EBDA 1V1PA 3Q22A 5CMDA 1OXXK 5BN5A 3P63A 1DOIA 3B9JA 2WIIB 1Y1VB 1XLQA 2KACA 3Q69A 1NEKB 4UDUC 3PV0A 3WCQA 1OXTA 2PQEA 1QNUA 5I2XA 4BY1B 3K59A 3Q8EA 1PGBA 4TSSA 4FXDA 4IURA 2NMQA 3DWQA 3JAML 1SJED 2WU5B 3I8ZA 1S5ED 2J42A 4J1MA 2IWHA 1NCVA 2WB1B 5JEAG 2KJXA 4DK1A 1DOYA 3K57A 3HOWB 2NB0A 5G5HA 3MXUA 4DFAA 1FXIA 2QILA 1WTWA 2EJFC 4LK0M 4XT3B 1QJOA 1FRDA 5LL6S 1IW7C 1I4QA 3GTLB 3G6JB 5HGTA 3SK6A 2ID0A 1IBXB 2NVXB 1EQTA 2A6ED 5M3FB 2SNSA 5I9OA 3Q0AA 1D6EC 1CA6A 1FFUA 3WOEA 1U4MA 2WXNA 1R9TB 3J7AF 2SDFA 1IKLA 5NUCA 2J52A 4RGOS 2F0WA 3H0GB 3AEFB 1EY8A 4GDLB 1I3QB 1JROA 5H8YE 1R7SA 4IUUA 3DWGC 4JWUC 2WXGA 1UEAB 5I9PA 4KKTA 2IX1A 4RGTA 4LTUA 1D5XC 1ZDVA 3LYYA 5EPLA 2B2WA 2EYFA 4GLSC 5T8IA 2N9KA 5C3JB 3W9CB 1DM0B 1STGA 2Y5PA 4G4KA 1ESFA 4ZKBB 1LTTD 2L11A 4IFDI 2WXHA 3H94A 4IN3A 2QMTA 4A3EB 2EKIA 2LMCB 1Y1WB 4HROA 1FYCA 2KMMA 4DGZA 2F1MA 2MUYA 2BCOA 4NAMA 1YJIA 3TEYA 4HMIA 1O7YA 1UUPA 1VR9A 2WXRA 1B3AA 5EQ0A 3OWFA 5E4XA 1UAPA 1IKMA 3DUZA 1CT1D 3LNNA 3OWEB 4A55A 4BY7B 3FEWX 1JC7A 1MBYA 4NZLB 3BS1A 1B53A 3D4DA 1JRPA 3AE2B 2B2TA 1VMPA 1FNUA 4UAIA 3NTKA 2JA8B 3BZDB 2L1AA 4OZAA 4WH4A 5EE0A 1JE4A 1IUEA 3DM1A 4ID6A 3HVDA 2IPKD 2V4IB 1FCCC 4KV6A 3W5VB 1Z6HA 1CHPD 2F0SA 5K36H 4MM3B 3BK2A 1I7HA 3AE3B 5I6WA 4KGTA 1OXUA 2B2WC 2GI9A 1ICWA 1TYGB 3S14B 3K5MA 2V3NA 3TEWA 1NSNS 1Q8IA 5T1GA 1MHHE 2MGSA 1JW9D 4Q5VA 1KNAA 1C79A 1Y8PB 1Z47A 1ZXTA 5MPOA 4X3KA 3U52E 1L6VA 3GTOB 2JX5A 3T56B 4D2KA 4ZUJA 1K83B 4XDCA 3TEXA 1LTAD 5EJWA 3T16A 1EOTA 1BCPF 1NYRA 3AH7A 4A90A 1RKNA 1GB1A 4MIUA 2BB6A 1ZE3D 3KUPA 4FYDA 1DONA 1L0VB 2WLBA 1T5XD 1V8QA 2K28A 3SVMA 1A2UA 2QKIC 4PMCA 5M9OA 3K6OA 2WXMA 4LMQD 4KX6B 2XVSA 4HSVA 3M7GA 2B2YC 4XYOA 1NYQA 3UI3A 4KD4A 3K0YA 5D14A 4MT5A 3NBHA 2NVYB 3PMFA 3ZJUA 2Y5CA 1XLOA 3J80E 5FK9C 5BYSA 2JQRB 1QG7A 4RNAA 3M3YB 3HOUB 3I9V1 1BF4A 3OIQA 4FF3A 2L83A 1K8MA 5KYIA 1V1OA 5C3EB 2A73B 2XRSD 5CV5A 1TKGA 3NVZA 1C9FA 3C46A 2M0AA 5FOBB 4YWGG 1F9SA 3ONAB 1E6EB 1VZ7A 5JEAJ 1FEHA 4WJWA 2OT2A 4DNRB 4A8XC 1SYEA 4WRDA 4HTHA 4HMJA 3P1MA 2OEOA 1TWCB 3TP5A 1NENB 4REZA 5JAVA 3LWEA 4YT0B 1C4PA 3H91A 4DQOC 4JX1C 4Z9CB 4QUCA 3HRDD 4F8MA 1I4PA 4R8NA 2MPMA 5BMIA 3D4WA 4KN4C 5JVH3 2JWUA 1FCLA 3VR4A 2H88B 4KTAA 4NW2A 2WXQA 5ELEA 4ARIA 4B08A 1HPCA 3A55A 2K1BA 2EY5A 5C5MA 5M3MB 2L1BA 1NAPA 1TY0A 1RJTA 3QB3A 3MZ5A 1KLUD 2QCPX 1LTBD 4P16A 5C0XH 1S5CD 5JPMC 3TBIB 2A5HA 2DNCA 4RF1A 1SSOA 1RWSA 2BOSA 3SK5A 4XTCS 3SFEB 1NVID 2BS4B 4ZOHC 1XYIA 2RSNA 3VRAB 3RMHA 5CGKA 2JXTA 1ZDXA 3A8IE 3IL8A 4F88A 1N61A 5IGDA 3QOJA 1XTCD 1B1ZA 4HEA1 1SMYC 1K53A 4JWSC 2DWQA 4L6TB 1SNDA 1QB5D 1I4RA 3NZ3A 4BS9A 1PUTA 1UWMA 3VYRA 4FXGC 2WS3B 2IX3A 1O78A 1PRTF 2MJEA 1TS4A 2LGIA 1CQFA 3FILB 1QOFA 1GJXA 1HRJA 1T6BX 4OGQC 3KWVA 1Y56A 1B9MA 4RCOA 1IHZA 1EY9A 3SXHA 3D3RA 1L6UA 2TSSA 2EELA 1C4AA 2I38A 1M4VA 3G7LA 2F0FA 1XEEA 5C44B 5BN4A 1AYFA 1SF0A 3NTIA 4KKSA 1AFPA 1TS5A 4YSXB 2BBCA 1D5ZC 5KNDA 1FO4A 4OZCA 3L7ZC 3HUIA 3TZUA 1J9OA 1SE3A 2I07B 1V8CA 3V05A 2O5IC 5EKIA 2F0HA 5D65A 4DN4M 1T3QA 2YEPB 5CV8A 2JYEA 1EM7A 1AZQA 4O42A 1DD2A 5KIXA 4EQOA 4KY6A 3MFYA 3P20A 1TIID 3GP7A 2FUG1 4DF7A 3NVYA 3S16B 2D5DA 5A35A 3AB9A 1EYAA 4X3SA 2E2DC 2KECA 1LTGD 3J81E 1M8AA 2K5WA 1STNA 1SE4A 3OMGA 4WIPA 3EUB2 2AWNA 1EEID 2W3SA 2KCNA 1RCVD 3S1NB 2K5PA 1II3A 4ZKCB 4G7OC 1L0XB 3GTKB 1K51A 2GB1A 4XE0A 2ZXPA 1PRTC 1B2TA 4C2MB 2Q8RE 1X3QA 1ZXIA 2WXOA 1LT5D 4M8AA 1MI2A 2WXFA 2B2VC 2NVTB 1XCQL 2ZW0A 2Z4IA 2JSVX 2E74C 4ZRZA 5I4DA 1EY5A 2NBFA 3TEZA 1Y69U 2K5QA 4XYQA 5K5PA 3MAQA 2VZKD 3ND8A 5DM73 1WRIA 4GZYC 3OSOA 1DOXA 2CJOA 3VYTA 3AU7A 3EQLC 4N9PA 4NDXA 1B50A 5JOBA 1YN4A 3D8GA 2AQ3B 5ELBA 2Y3AA 1F2RI 3DWMA 1BXTA 2KEDA 1STBA 2SAKA 2PCFB 4QB4A 3MFGA 4ZRPA 1KTKA 2BW2A 3P4SB 4Q2JA 4HCSA 3ZJTA 1BCPC 2BS2B 1UGJA 1SB3C 1VJKA 4C3IB 3BYYB 1BBXC 5FKAC 4EE2A 1EL0A 5JVG3 4FF2A 3E9SA 2R92B 5HI1A 1WWTA 3IT6B 4QIWB 1LO5D 2PW5A 4K14A 4IDIA 1SMYD 2E2IB 1BCPB 2XNAC 3I4MB 4CQNA 1WCMB 2LS01 2WDVB 3QG1A 4KKJA 3DWAA 4RH6A 4RAUC 2RA4A 1MSGA 2KCCA 1DCZA 2HCCA 1KLGD 2HTME 3OHXC 3VQIA 2EYJA 2F0LA 4XQQA 1HZ5A 2K0PA 3W5UB 1J7BA 2EYOA 1N63A 1E0ZA 4M0WA 1JWSD 1PXUA 1JORA 3GTPB 5LNK1 5C4JB 5EE1A 1F2RC 2PIAA 3ETRA 3TZDA 2LJIA 2A69D 3E5SA 3MWYW 1XCTL 1C78A 3KBGA 3HG9A 5EKKA 2JEAI 2V0GA 3HOXB 4YTMB 3IXSA 2K9XA 1HCZA 1YNNC 1HFGA 1SNMA 2J7ZA 2I46A 1TZOA 1R4PB 5BMGA 5E1FA 2H89B 4KKIA 2M19A 1W6KA 2ONQA 5C0XI 3K5NA 1K52A 5FO7B 1EY4A 1VCIA 1O7LA 5IT9E 4P6VF 4HRSA 5CV6A 1CZWA 4C3HG 3NWTA 4OO1H 3ZGZA 4IQZA 4C7ZA 1EFID 4YTNB 2JA7B 1N62A 4ABNA 3NTHA 2DY7A 1ZXHA 4U673 2L12A 2F0UA 4L2YA 2XN9C 1SNCA 4B0EA 4WFN3 1G6ZA 3BWUD 2C5CA 1DXMA 2CJNA 3PZ7A 3W2DA 3CKIB 1IBXA 1QWYA 2WNMA 3M85A 4CKEA 1HQRD 3B2FA 2D9UA 1VDVA 1QOHA 1QNKA 4TQUS 4HJGE 1TKWB 1CM9A 1TR5A 3TP7A 4H0LC 2F0TA 1CZGA 2SOBA 3J9CA 2F3VA 5KRUA 4OIJA 2R6GA 1ET9A 5E4WC 2IGHA 1E2VA 3X3NA 3FILA 3A7LA 2PTLA 5IGEA 4A3FB 3MP9A 1QKZA 1C8CA 2IX0A 4LLGM 4L23A 1P7EA 4RHSA 4B9WA 2K6AA 1MPEA 4HEDA 3U2SC 4C1NK 1WTQA 4HAEA 2WP9B 4IZ8A 2PKOA 1BO0A 3L3OC 3MC0B 3FPUB 2LEKA 4XT1B 1LT3D 1Q12A 2DYMA 4EQPA 2WKDA 1A3UA 1SNQA 2JE6I 1FNVA 3BVZA 3V3XA 5IIFA 1PGXA 3EFXD 1CQVA 2LHDA 4CGYB 3T13A 3CRLC 2R61A 1PTOC 2HDEA 2BA0A 2R93B 3EJIA 1FMAD 3T3NA 5C2TB 1TY2A 3IAS1 4C7YA 4IUVA 1VZ6A 4YSZB 3BVGA 4A9AA 3PUYA 3AN1A 1NI3A 1JB3A 3HKZB 3AMZA 4DNTB 2PNRC 3D31A 2F0QA 2F3WA 1EY0A 3CRKC 1DZ1A 2NWGA 1E2WA 3AV8A 3VA7A 1EY7A 4USAA 3IT4B 1RODA 3I91A 2NN6H 3R3OA 2FINB 2O5JC 1JALA 1EYCA 3EVQA 1I4HA 1ZYRD 1XO3A 5A2QL 2FMMA 3K58A 2W82A 4C3HB 2Q8TA 2IL8A 2IDYA 2FJ2A 2E76C 4PQXA 3ND9A 1SXTA 2WP8J 1FNWA 1VDZA 1BUVT 2A6HD 5C0XJ 2N55A 4RGNA 5A2QE 4KKUA 3PO0A 3AE5B 2BS3B 2CHBD 4BBSB 4PV1C 3C3LA 3BYTB 2X6GA 3C1FA 3E56A 2PZUA 2WDQB 5BYQA 3K7AB 2PVGC 5ELCA 4R8IA 2WQYB 5CR3A 2CQAA 2VXWA 2F0DA 4YXDB 3O13A 1HA6A 3NS1A 1EZ6A 1GB4A 1EYDA 2PZTA 1QT9A 1X3PA 5LL6X 4GDKB 5DEHA 3MXNA 1TWFB 5H92C 3QIAA 1G291 1MSHA 1RYJA 4RWSC 4BA2I 3KK7A 2XRQD 3R2IA 2X38A 3I3CA 3RPFC 3U9SA 4OIKA 2BYTA 4FP5D 3HZXA 2B76B 1F9RA 3FMCA 1S5FD 2BDOA 3A8KE 5ELDA 3FKIB 1J7AA 3AEEB 5G3LF 1RDPD 1F2ZA 1IGCA 2RDHA 1C77A 2M56B 1ET6A 2VUMB 3IAYA 1BMLC 3MA2B 3MJ5A 5EPKA 3GTGB 3I90A 1MI0A 1YNND 3D4RA 3E0JA 3GV3A 2A68C 4ME5A 1S5BD 1DYQA 1JOKA 2RKSA 3AE4B 1ENCA 2KN4A 3I73A 4NJCA 4ZK9B 1SJHD 2VB3X 1PFBA 3AEAB 1ENFA 1BQQT 1MD2D 1EU4A 1ZKOA 5FR3A 3E6ZX 2D2CC 2JSOA 1OXSC 2Z8LA 4HN7A 2JU6X 4XQJA 1WXQA 2KEEA 3RUZA 2Q5WD 1JICA 1ZUD2 4H7BA 3ZYYX 4A6QA 4KHZA 4K2LA 1PRTB 1U4PA 3S1MB 3VR9B 1FGBD 4LAAA 3AEDB 4YTPB 1QF6A 5C4ZA 1WVLA 1E10A 4K5WA 1EWYC 3KWLA 1RTOA 3VR3A 4YIJA 3GTMB 1ZPSA 4XWWA 2B2UC 1F2LA 3NVVA 1WTXA 5CBEE 3S2DB 4C3JG 2B63B 4KJOA 2E75C 3Q24A 3TMEA 2Q8IB 1BOSA 1F9PA 3PO3B 3PUXA 2QIEB 2EOTA 1KF6B 4DAYA 5HHDG 2WXJA 5JEAH 3AE9B 1FR3A 1OXVA 1GUTA 2ZW1A 4X3UA 5DM63 2BTEA 1A3VA 1MVKA 1LACA 4QCLA 4FF1A 2W3RA 1KAAA 4AYBB 1BR9A 2PW7A 3A56A 5D3DA 1AZPA 5BN3A 1E2ZA 2M2LA 1F2MA 3LB8C 3NK9A 2N88A 2EDGA 3N6RA 4IFDJ 2KHSA 1WGKA 4E6IA 1ZYRC 2EZVA 2F03A 2RSOA 1TQOA 2L32A 1SBBB 1SNPA 3L4PA 2AUKA 3CQZB 2DBYA 4F7XA 2K01A 1SAPA 5JXVA 4HKQA 2WXLA 1F2YA 4JK1C 2N7JA 4C80A 1SDFA 3PIP3 5DNFA 1QLBB 2ICIA 5EGTA 4MHEA 3R8BA 1E9MA 1XXGA 1H9MA 3HOZB 1KH0A 4KY7A 3SR1A 5FO9B 5AUIA 1PTOB 4O1NA 2K03A 3D6CA 1TKEA 1V43A 4K8JA 3H3VC 3P7JA 5JJZA 4QUFA 4WWMA 2FBWB 3F2UA 4IFDH 2KA7A 4I7ZC 4EGVA 2A6EC 1GUNA 2K5DA 1H9RA 4KK7A 1ILPA 3AB5A 2CW0C 1I6HB 1PFMA 1H9JA 2IJ0A 4JBWA 1Q1EA 3DEPA 2QEJC 2AX5A 2JA5B 4ULLA 1JWMD 3PIO3 1H9KA 3V2TA 3BVMA 1L0YB 3MEHA 1VRAB 1Y8NB 4JPSA 1C4CA 1QOGA 3OMCA 1OQQA 5CYUA 1Q1BA 5GXGB 4AS1A 5F2DA 4I65A 3S2HB 2EE1A 1YNJD 3RFZB 4MACA 2NN6I 1JOQA 4OW0A 1GUSA 4A3GB 1BNZA 1A70A 1ENAA 3PUWA 5JPNC 4M1UB 1AW7A 1IYUA 1WTRA 4RCNA 2F0NA 3PZ8A 2A68D 2RPVA 1Y8OB 3Q8FA 3U7ZA 3EA6A 1RD9D 3HRZC 2JZPA 2Z4HA 2QSDA 1D4BA 1VF5C 1PYWD 1CJEA 2KQ4X 3NSWA 1EU3A 3P1HA 3A8JE 2LFIA 2OXPA 1HUNA 2QDBA 3SEBA 2PMZB 1EWCA 1Z7TA 3AECB 4PNYA 5E3FA 4CKBA 2Y0SB 4L8JA 2H4OA 3AE6B 5IT9L 1PZJD 1NR4A 3UI2A 1YJJA 3H09A 1AWDA 2EYLA 1JWUD 3S1QB 5G5GA 1GUOA 3VR8B 2WXPA 3Q8CA 4HSPA 1XLPA 3I70A 4BWGB 1B44D 4J8QA