1HA5A

Structural features of a zinc-binding site in the superantigen streptococcal pyrogenic exotoxin a (spea1): implications for mhc class ii recognition.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
218
structure length
218
Chain Sequence
b'DPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHAGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYLTDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDSNTSQIEVYLTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords STREPTOCOCCAL PYOGENIC EXOTOXIN A1
publication title Structural Features of a Zinc Binding Site in the Superantigen Strepococcal Pyrogenic Exotoxin a (Spea1): Implications for Mhc Class II Recognition.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Toxin
total genus 56
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ha5A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ha5A01
1D6EC 1HTLD 1JQYD 1FNVA 3BVGA 1S5DD 1ESFA 2RDHA 3R2TA 1PYWD 2SEBD 1HXYD 1MD2D 1PRTC 4DXFA 4RFBA 3V05A 1PTOB 1RF2D 1CQVA 1FD7D 1XTCD 2AQ3B 1LTTD 1SJHD 3TSSA 4RHSA 2O2LD 1I4RA 1EEID 1LTSD 1XXGA 2XRSD 1LTGD 5ELCA 1CT1D 1PRTB 1V1PA 4Z9CB 3MC0B 1TY2A 1FNWA 1LT4D 4K6LA 4RGMA 1EU3A 2IPKD 1BCPD 3KLSX 2NTSA 1TS3A 3MFGA 1I4GA 1PTOD 2G9HD 3BVMA 1PZJD 1S5CD 1SE3A 3DWQA 1B1ZA 4DXGA 1SXTA 2IJ0A 5ELDA 4UDUC 4RGNA 3R8BA 4RCOA 2CHBD 2NTTA 1YN3A 1FNUA 1S5FD 1CK1A 1UNSA 1CHQD 2XRQD 5TSSA 1LTAD 3OWEB 1G8ZD 1TS4A 2AQ2B 3GP7A 4RGOS 1AN8A 1EEFD 1BCPF 4L6TB 1KTKA 2XN9C 3BZDB 1LTID 1BXTA 4L63B 1PTOF 2R61A 3CHBD 1RCVD 1EFID 1S5BD 1I4PA 1T5XD 1QILA 4NZLB 4ZYSA 1LTBD 1AW7A 5FK9C 1KLUD 3EFXD 1YN5A 1F77A 1L0XB 1ENFA 1JCKB 1SEBD 4BWGB 5ELFA 1KLGD 2WV6D 1PZID 3DWAA 2J4XA 1LT5D 1TY0A 1I4XA 5ELBA 1PRTD 1V1OA 3EA6A 1JWUD 4RHRA 2TSSA 1SE4A 1V1PB 5FKAC 3BYYB 1RD9D 1TS2A 1FGBD 1DJRD 4C56C 5I4DA 1JWMD 1DYQA 1PZKD 1TS5A 1RDPD 1S5ED 1SE2A 2AQ1B 3DWPA 1D5MC 1LT6D 2Z8LA 4TSSA 1L0YB 1I4HA 1BCPB 1PTOH 2XNAC 1JR0D 1LO5D 2ICIA 3W2DA 4RGTA 4RH6A 1EWCA 1HQRD 1SBBB 1PRTF 1EU4A 1CHPD 1GOZA 1ET9A 5D3IB 1LTRD 5D3DA 4OHJA 1LT3D 1SJED 1D5XC 3BVZA 4O1NA 3SEBA 2QILA 3R2IA 2RDGA 3URYA 1ET6A 1HA5A 1B44D 1STEA 2QEJC 3BYTB 1BCPC 1JWSD 5ELEA 1D5ZC 1UUPA 1LLRD 1M4VA 1PTOC 1I4QA 1YN4A 3O13A
chains in the Genus database with same CATH superfamily
2SDFA 1JQYD 2PCFB 1P7EA 3BVGA 2NVTH 3VH3B 2BYEA 1IYVA 4ZCKA 4JI3Q 3HK0A 1RWSA 1GPXA 3HOVG 1HXYD 2KXJA 1X9NA 4Y7NH 5CV5A 4FDBA 1V49A 4DAVA 2BH8A 3KF6A 4GLVB 2V3SA 3NG0A 4UPAA 4A3KG 3N1YC 3VUWA 4DV0L 1HCZA 2RGFA 1K3RA 2GBJA 2JA6G 3TP6A 3ZNGC 3DBSA 2LXAA 4A3JH 1DOIA 2PI2E 2YV5A 4K2LA 2HDEA 3CAMA 2CQAA 1N60A 3VR4A 2K04A 1V1PA 2JA5B 4HWIB 1JORA 5C3EG 1TWHH 2JA7G 4KK7A 4FXGC 3HOXB 1IW7C 1WYWB 2GB1A 5CV4A 4DV5Q 4TV3A 3T9LA 3SDZA 5C3WA 5BN4A 1FPYA 3AU5A 1U4PA 2DY7A 2ZZPB 3TIXA 1WGKA 3RNBC 2J52A 5DM63 4DF7A 4ASWC 2K6QA 5ELDA 1TR5A 3J80L 3WAPA 2K8CA 1BF4A 5JH5C 4BY1B 4Y52H 4L5RC 3L10B 2PPBC 3H0GH 4CJ1B 1STYA 1L2FA 1KC8C 2AL6A 2BKRB 2BS2B 4XTCS 1EQRA 1I5FA 3H8HA 4ZRJA 3DMUA 3AE9B 5DAUA 4REZA 2CU1A 4JPSA 2J0TD 1HNZQ 3FC4A 3B9JA 4WWOA 2MBEA 4B3TL 1EIFA 4KV6A 2C7NB 2UWQA 2RD0A 2QW7A 1YNJC 5GQOA 4XDCA 1X55A 3SGIA 3NRZA 2LD9A 2KNBA 3ML9A 4NZLB 3I91A 2IHFA 1A3VA 1KAWA 1A0IA 2LMCA 1D1IA 1EM7A 4OXPA 3KF6B 4K5XA 4A3LG 3VTWA 4NXNL 2O2VA 5EE3A 2FCQA 5KYLA 3GTMB 4J6IA 2F0IA 2IY5B 3ZUNA 1R4QB 1OFFA 1KJTA 3W5OA 4PS8A 1EY5A 3GTOB 2I5MX 4O0AA 2TSSA 1V1PB 3L08A 2BWES 2JA5G 1X3FA 1RD9D 4B3RQ 2AMCB 1WX7A 3X3MA 4LW1A 1DYQA 1TS5A 1OXUA 2PZUA 1Z2MA 1SNCA 1VQLA 1SE2A 4PQXA 4S0RA 1VQOA 3LYYA 5G3LF 3ZJYC 2Z8LA 5IE8A 1QVFA 4KHVA 3CCUA 1BCPB 3QX1A 4GOCA 3PSIA 3UI2A 1X3PA 3S14H 4IPGA 2ICIA 1FXIA 1SE9A 3HFZB 4FHKA 4PK1A 3TEZA 4DA2A 3T1YL 4X62L 4L1BA 1YVCA 2OF1A 1IL8A 3QG1A 2DJFC 3L9AX 4LFBQ 1IXRA 2QDLA 4BY1G 1IBKL 3PV0A 5D3IB 3TZUA 1YNNC 1AE3A 5JJIA 2LGXA 2M0XA 3IFTA 1KRTA 2VQEQ 2K32A 3HEJA 1PH3A 3PPAA 1E2WA 4IO9A 4JI8Q 2D10A 2TMPA 1I94L 3EJIA 2CHXA 4ITKA 5EGTA 1OTCA 2INCC 2WXIA 4LUOA 4C3IH 1Z6HA 3MJWA 5DCNA 3LWEA 4K8IA 4A9AA 3H09A 2PNRC 4NKLA 3CCRA 2DZMA 3AE1B 3RCZA 3O13A 4M00A 3AN1A 1E0ZA 5EPJA 2LMCB 1XNQQ 4WJOA 5I9OA 5BMGA 4R4TA 3R2TA 3OTOL 1CJEA 2O6VB 4DR1L 2B2TC 4RNAA 4DV6L 1RJTA 4AIMA 2PLPA 4KDIC 5AZGA 2O2VB 2OOBB 4B9XA 4BA2I 1VJKA 4K7SA 4PYZA 1CQVA 2AQ3B 4ZLTF 2I1KA 2NVXH 4N59A 1E7ZA 3PUYA 4OX9L 3S2DH 2F0WA 5IAAC 3OJ4B 3W9CB 4RAUC 4BXXG 1N9WA 3SVMA 3NELA 4A3GB 2I1JA 2A69D 4DV3Q 4H02A 2HIXA 2BS3B 5C1ZA 3RNEC 4NAWA 4CHTB 1F9RA 5C4XG 4ME5A 3GTJH 1XT9B 4NQKE 1WTPA 1GC7A 1L1OA 4TQUS 1N62A 4EGVA 4RF0A 5KNDA 1HZ9A 4DFAA 1VZ7A 4GN1A 1S5CD 4FULA 2ZXPA 3HGBA 4AQYL 1HJPA 3J80c 3S16B 3R8BA 3AEFB 4WAAA 3GTKH 4KKJA 3DUZA 2FFKB 2IL8A 2EYMA 4II2B 4LF5L 5CORA 3T51B 2EYFA 2F3VA 4ZRPA 1VQGA 3PF5A 2E76C 3S17B 2M9VA 2AQ2B 1OXTA 2K5WA 2VUMH 1AN8A 1GUAB 1XCTL 1F0ZA 1K83H 2F0PA 5FO7B 4WJNA 5A35A 1NUCA 2OT2A 2XN9C 5AFWA 3LJ3A 1BXTA 1EWHA 5JJKA 3BZCA 3CKIB 3GB1A 1YX5B 3NUHB 4GGQA 4MHEA 5CR3A 4ARIA 1MPEA 4R4IA 1F2MA 1J9OA 1JCKB 4URKA 4P6VF 1KLGD 2VY3A 4CDEC 4DK3C 2W3RA 1Q3LA 2MCNB 1PV4A 3ZVVA 1C9OA 2Z59B 4HSVA 4NAWB 1PGXA 2FE8A 4IPHA 4X64L 4S3SA 1FJGL 2LGDA 4OELB 1VQ5A 2XEWA 2V3PA 1QOGA 3HRDD 1YQBA 2QDFA 2V3NA 5DEHA 2Z1CA 2XIWA 1QT9A 4E71A 3AH7A 3Q22A 3I56A 2V9HA 1VMPA 1YITA 5ELOA 1YJ9A 5FLMG 4F8MA 2L1AA 2C5CA 3CU7A 4HR7B 4IZ8A 2GBMA 2L9HA 2WINB 1SMXA 5EAYA 3PO2B 3HVZA 5C0XH 3J81L 2WXJA 2E2IH 2HJ8A 3IL8A 1ET9A 4Q5VA 1PHJA 1WRDB 2MRPA 5C5LA 2MW5A 3N3KB 5C0XI 2N7EA 4ALPA 1P0RA 2MO0A 1A8VA 4JOIC 3S1MB 3PSEB 4C2MB 4YIJA 4QF4A 1EO6A 3PIPA 1TVXA 4EX5A 3NVYA 4IM2A 3CMMB 4OIKA 4R4OA 4EQOA 3RZDB 4DHZB 3QWZB 4W9CA 3HOUH 4JL9A 4RM8A 2LSSA 3HKZE 2WB1G 4BBNC 3WA0A 4LF4Q 5J17A 4D2KA 4DDID 1HPCA 3IHPC 2CS4A 4QIWE 2BWFA 3AEDB 3QO2A 1T3QA 4OWTB 2RDHA 1HTPA 2E2HH 4DWFA 2XSCA 4FA6A 2JYTA 2ON8A 1NBWA 3K0YA 4KN7C 1L4ZB 5G5HA 1CSQA 5IWAL 4PG3A 1PTOB 2KJHB 1ZDXA 3KW5B 1QJOA 1XQQA 2L7RA 5C4XH 4X65L 4BBSG 2WLBA 2RA4A 2WU2B 2D9UA 2ACZB 3G4SA 3CMAA 2LKVA 1XXGA 1UEAB 4W9KA 2PVOD 1MJEA 2EIFA 5KEEA 5JOBA 4K6LA 3S1NH 2J0KA 2WGSA 4FJZA 1B9MA 4BFRA 2MJ8A 1EU3A 1VF7A 1F9JA 2WP9B 2K5HA 3BK1A 4K7UA 1YNXA 1I4GA 3SK6A 1JOQA 3S2HB 4ANWA 1EIHA 4FF4A 1F9SA 1X54A 4DQOC 2PE9A 4X66L 4HLEA 4GOPA 1MSGA 3I57A 2HT1A 2XRQD 4GNXA 3LXFA 2B2VA 5BYQA 2FXQA 3QR8A 2F0LA 4A3CH 4KIKA 1ASYA 4L6TB 1JMLA 2SAKA 1VQAA 5C3XA 1WGDA 1NSNS 3K59A 1A3TA 1W3SA 2VQFL 3Q2AC 4KDLB 4BBNF 4US8A 3L0OA 3S9WA 4M8MA 2B8FA 3TBLD 3RLFA 4DR4L 3NQIA 2LVOA 1LTBD 3MHBA 3GTGB 4YXDB 5BMHA 2B76B 4YT0B 1SEBD 4CDCC 2C9OA 4OL7A 2DYMA 3GS2A 2R92H 3CIRB 2WXQA 1QVCA 1LT5D 1VDZA 3PZ7A 2RSUA 4I6LB 2MX2A 1I4XA 3V3XA 1V1OA 1SIJA 3MXGA 3ZKJC 1JWUD 1X32A 4LF8L 2RPQA 4YTMB 5CV8A 5FKAC 4K7WA 2V1CC 4LK1C 1E90A 2ZCBA 2HIVA 2F0SA 4IM3A 1C1YB 2NZHA 2AL3A 1GB1A 4A3DH 4OZCA 1RDPD 1S5ED 1SLJA 1AH9A 1EF5A 4IUMB 3VR9B 2EOTA 3IG3A 2XK5B 2ZVOA 3AB5A 2IW3A 1TWAH 2RCNA 3BZKA 3MC8A 1OQYA 3KDFA 3H9DA 1WD0A 2CCZA 4GOPB 2WFWA 2WXHA 5IP9H 2EELA 4A3IB 1KXLA 2W9NA 4W9JA 1L6VA 1GOZA 4GNXB 4HJKA 2KJXA 5IA7A 4KY5A 4LLGM 2K33A 3C2PA 2EY6A 4HEA1 1WGHA 1CSPA 1UGMA 3FKYA 1ZDVA 4W9EA 3D4WA 4LF7Q 4NXML 1NYRA 5C5MA 1XLOA 1H9KA 3WWVA 1YQ3B 3EBEA 1BCPC 1U5KA 3ZYYX 1K8GA 3ZNID 1EIGA 2MJ3A 1V9PA 1XEEA 1EY4A 1STHA 3I55A 1ZW7A 2WAQB 2UXCQ 3VH4B 4EZJA 1K0SA 4MN3A 2INDC 1JB7A 4M0WA 2EYHA 4ABNA 4OO1H 3Q8CA 2UU9Q 1NJIC 4BBSH 3OW7A 1PRTC 2RHSB 1EY6A 2FUHB 2NZ1D 4DUYQ 1NENB 5IT9c 5M5WH 1L7YA 3N6RA 5FJ8H 2O2LD 2A5UA 1XMOQ 4DR7Q 4ZKBB 1YIJA 2VZKB 4HAEA 4LF9Q 5M9OA 3RD2A 1KRSA 4RKLA 1Y8RC 1EQTA 5LXIB 4GN5A 1CFMA 3JAMc 1K28A 4KJOA 2ZJQA 4IFDG 1FXTB 4FF2A 3Q3JA 1C77A 1TS3A 3TBIB 3K5LA 2BVCA 4K5WA 3ZO5B 3VR6A 4ANUA 3DXJC 4HIKA 3G6EA 2WIIB 1WCMH 1ZP0B 1SXTA 3HP3A 1WF9A 2JQRB 1UEBA 1SYGA 3JAMi 3M9BA 3DBRI 1YX6B 2Q8RE 4MGZE 4YHHQ 2BF8B 3DPDA 3AEAB 3AEBB 5TSSA 2Z4IA 4LFAQ 1JOOA 4ILWA 4N58A 2AKWB 1V8QA 3ER0A 5D94A 5JPNC 3VUYA 3DVNV 4YCUA 4BY7G 4E3CA 4DGZA 1BCPF 1TKYA 4NB3A 3UF8A 3U30A 1KTKA 3GQBA 1YJNA 4CJ0B 2GRIA 2MA9B 2JRHA 2WAQG 1HNXL 5JZEB 1EUJA 3CCSA 4KHPQ 1B50A 2DYBA 3PO0A 2WXNA 3FAHA 4DV1L 4ULLA 3BK2A 3VA7A 3TREA 1XTDA 2HD5B 4JIOU 2HDLA 1RFKA 5C4JH 4GS3A 4W9IA 1GUTA 1VQFA 3HOWB 2F4VL 1C8CA 2UUAL 1TU2B 3NVZA 2LRUA 1K73C 4MDKE 5T8IA 5GAEC 5ELFA 4RMAA 3DWAA 3SFDB 1OO9B 2DNCA 2CH4A 2XGTA 2K9XA 4EVOA 4DV0Q 3SR6A 5IYDG 1JT8A 4RHRA 2NVUI 4WWPA 3OW2A 1ZYRC 2Y5PA 2LEKA 4QAYA 1SSOA 2NYZD 4DDGD 3CRKC 3HG9A 2D3CA 1PUTA 1S72A 3IKJA 3BDLA 4TVAB 1WFYA 1JOKA 3QARA 2LXCA 1IBXA 5F2DA 1FO4A 3UINB 2M2LA 1ZE3D 2HD3A 4A3FB 2ASQA 1SN8A 1XPUA 3A55A 5EPKA 3BU2A 1K53A 4EQNA 4A3MH 1P1AA 4OVVA 3AQQA 1L1OC 2RKSA 5IP7G 2KK8A 1M90C 2WXPA 2LGIA 2QC8A 2F4IA 4W9GA 1DOLA 1NY4A 2OCEA 4H13C 1WGYA 1VQCA 1B44D 2HE7A 3GZNI 4A8XC 1Y1WB 4LNOA 4NAMA 4BZAA 1SE8A 3OHXC 3K57A 4B3TQ 2LFIA 4WJWA 1MHWC 5C0XJ 3HUIA 4X6AH 1Z9FA 3K9PB 4ANVA 1B9NA 4QB4A 2IY1B 1N34L 1G2SA 4DXFA 4RFBA 3WAMA 3B0AA 1X56A 4NXNQ 2KVRA 2GVAA 2K50A 1E8ZA 1QUQB 4L2YA 1KH0A 1H9SA 1UELA 5COYA 3DM3A 1R4NI 3RMKC 5K36G 2PKOA 1UE6A 1CKNB 3OLMD 4A3JB 1CT1D 2OHFA 3PS6A 5EDSA 2DY8A 3KWLA 3NZSA 3N20C 3GTLB 4RGMA 1HUMA 2IPKD 3NEMA 2O6VD 5L95C 5AUIA 4ZUIA 1IYUA 4EQPA 1QCBD 1N32Q 4JI1L 4ZQ3A 3Q6BA 1SR3A 4HJ7A 4YCVA 2F0MA 1QG7A 2KQ3A 4NNJB 3UE1A 4G4KA 5MPOA 2F0NA 1LGRA 2C60A 3T1YQ 2KWVB 4LJZC 2NBVB 4HSPA 4RCOA 1OTRB 1YN3A 1WYGA 2MBOA 2QMTA 3L4PA 2F0HA 3Q69A 4OONA 3NSWA 4A3EG 2DENB 1UGJA 4DK1A 1GVPA 5CC4A 3HOYG 1C79A 3NPPA 3HOZH 4KX6B 2PO4A 4N8X1 4A75A 1I94Q 1YI2A 1Q10A 4ICVA 4USAA 4KD4A 3W1GA 2NN6G 3CC2A 2KFJA 2H4OA 4NW2A 2JZZA 4W9HA 4FHJA 3UDGA 1BNZA 3CHBD 1TWGH 1VF5C 5FOBB 3RNUA 2Q5WD 4IQZA 4HVBA 5EKIA 3EECA 1Y8PB 1RM6C 3ZJVA 4K0KL 2N0SB 3APDA 4MZ9A 2XTIA 1RLFA 5ELNA 3T13A 4DR1Q 4DV6Q 3UIOB 1ILPA 3L54A 4RKBA 4LTUA 1JC7A 4PMWA 3ZIMA 1O78A 4AWJA 3A9JB 2J4XA 3S1QH 4OX9Q 3CD6A 1KRHA 2YVCA 3CCJA 4ZOHC 3A74A 3MEHA 2B39A 2DAFA 1IYFA 4C3HB 3U58A 3BG3A 2DUDA 1MJCA 2J42A 1WR1A 1OGWA 1GJZA 2HJ1A 1EYCA 4MTKA 4RM9A 5JEAH 3J7AV 4OVZA 1A3UA 4GZYC 4M8NA 2E2JH 2EVBA 1E7UA 4GXBA 5JJLA 4PYUA 3IAM1 3NZUA 2LHDA 1H9JA 1TT2A 1NYQA 4KI0A 2K5NA 3AU7A 4HIDA 1Q86C 1JQ4A 4JC0A 5E7NA 3IFDA 3I4NH 1K8OA 4AQYQ 5M3FB 4FVMA 3S14B 4P74A 4I7AA 3CCLA 5EPLA 4JBMA 2IYDB 2LASA 3CF6E 1LTRD 5D3DA 4DV4L 4DR5Q 3D3RA 1D5XC 3BVZA 4LF5Q 1C4AA 4GDLA 4C00A 1AFPA 3I4MG 2RMMA 4U673 2CH4W 5M5YB 3O65B 2F0VA 1STEA 2K5VA 4FXDA 1WTVA 2KX3A 4OZAA 3RNCC 3U50C 1VQJA 1PH4A 4IWOA 3MTNB 4NY0A 5LLIA 3DCGA 3FEWX 4O2DA 2YTVA 3KBXA 4GOPC 2EKEC 4H0LC 3UI3A 1Y14B 4LFCL 1RYJA 2PZWA 3NHEB 2EQSA 2A1AA 4GNXC 2OTJA 3SU8X 2JZPA 2B2VC 3RUZA 4AJWA 3N9YC 2M1MA 3RT3B 4MM3B 2KTFA 1PQSA 3ULPA 3RZOH 1MD2D 4NJCA 4I7ZC 3RR5A 1XTCD 2G3QB 2INNE 1Q1OA 3B2FA 3GOEA 2R93H 4CQNA 1MI2A 1I50H 4C3HG 1EEID 1Q1EA 1SRUA 4G57A 5IY0A 2BBCA 1IUEA 4YCWA 3ERQA 2R7ZB 4M01A 3Q8AA 4BKGA 2BE5D 1FJGQ 5LMNW 1VQKA 4G0NB 2IX0A 3AECB 2CR5A 1GAQB 4A90A 2D0PA 4IC7B 4DR2L 4GKJL 1NR2A 2V4DA 1AARA 2KDIA 2ZW0A 4CDFC 5HKHA 1LABA 3P42A 2BOSA 1PTOD 2CWAA 4QY7A 1PH2A 5ISRA 4DXGA 2NWGA 3PHXB 2JF5A 3T8MA 3ZXVA 3IFWB 3HOYH 1OXVA 1HRJA 1WR6E 1S5FD 3TZDA 4GDLB 1PH5A 4JI6Q 4V0BA 1YOVB 4QQBX 1QF6A 3Q8FA 3SDLC 2NN6H 2WB1E 4XXEA 2Q2UA 1WY8A 3RFZB 1SROA 5EE9A 4XWTA 2OQKA 5GROA 4KHZA 4OVUA 1V9JA 3FKIH 4IUTA 3AE5B 5DPRA 3K8AA 2RCFA 3BZDB 5GMVA 3VRBB 3ZTCA 4EUTA 4UP8A 3ZJTA 3LDZE 1H4RA 2HTHA 2J0JA 1E8YA 3ZTDA 3H91A 1RCVD 4KKSA 2NVQB 3H7SA 5HGQA 2FINB 3K81C 1SF0A 5DPWA 4HN7A 4JK1C 3JYUA 1UWMA 2EKIA 2MBQA 2F52A 4APVA 4KMUC 3GO5A 2EDGA 3RMHA 1QE6A 1F77A 5C44H 3PREA 4C7YA 3IAS1 2M0AA 5IWAQ 1IBMQ 5AJ3L 2KDEB 1WXAA 4IW0A 3CMEA 3QOJA 3TN2A 1T0RC 4X65Q 2F0UA 3RZFA 5H1SE 4AYBE 4EOYA 2D62A 2ZTDA 5CV7A 1PA6A 2R7ZG 5EE1A 2D11A 1STGA 3MWYW 1J19A 5CTRC 2WXMA 1G51A 4ZRKA 1X65A 3T1HL 1IKLA 1VQ9A 4WH4A 2OEOA 3SFEB 3DWPA 1D5MC 3M7NA 2ZW1A 3I4LA 4WJQA 4TQ1A 1ML0D 2LXJA 3OOCA 4QL5A 2OTLA 1I4HA 1FGUA 3EFCA 3P63A 2IGGA 4RGTA 4G11A 3BINA 4MNOA 3ECIA 1HQRD 3H7PA 4X66Q 3PO3H 4YY3L 1NBFC 3J7YW 1CKMA 2PYKA 2L83A 2JYOA 4AQ7A 3PMFA 4KZCA 1H9RA 4O1NA 5M3MB 3W5UB 4GMVA 2PNHA 3VHTC 1ZUD2 5E1FA 3R7RA 5IN7A 2I5LX 1CZWA 2ZVNA 4P1CC 4A76A 1WZ0A 3HOXG 2VQFQ 2DZIA 2JSVX 4XGAB 1S5DD 1G291 4CKEA 4DUZL 4DR4Q 2A68C 4A3BH 3DLLA 2KMAA 3EHVA 3PZ8A 3Q14C 2BYTA 2AEHA 4PS7A 3ZRFA 2KCCA 4ARCA 3PUVA 3SHLA 4HDOA 3M4OH 3ZDTA 3MXPA 3C1FA 1R9TB 4XX5A 4RHSA 1F2RI 3VYTA 1EZ6A 1CA5A 2EJMA 3AE4B 5KYIA 3KK7A 3KJOA 2FCMA 4LF8Q 2BA0A 5ELCA 3DOWA 3L16A 2PQEA 1PRTB 4R4QA 2E8GA 2E75C 4JI7L 1UAPA 1QNKA 1UWXA 2IY0B 2LY7A 2MO1A 2ZTCA 4X3TA 5CV6A 1N6ZA 1HNWL 1V81A 1T5EA 2WP8J 3HOVH 4BKSD 3S1NB 2WKDA 3OIQA 3DWGC 2I38A 3P1HA 3MXUA 3OYYA 4WRDA 1VLBA 2KDBA 1SFOH 3K80C 3DVGX 3PTFC 4A3KH 3DWQA 3H7PB 4DK5A 4YSXB 2W55A 1U4AA 2JA6H 1WTHA 4JI2L 5HGTA 2N9EB 4II3B 1E5WA 3FDTA 2H1EA 3WCQA 1GB4A 2VZKD 2NVYH 2RHQB 3KLWA 3H6MA 1V1QA 3E9IA 2B63B 2F3WA 2IBIB 4CGYB 1I3QB 1Q1BA 2WKCA 4B9KA 3V60A 5C3EH 3ZW3A 2JA7H 1EYGA 4NXMQ 4IUUA 2WACA 3M3YH 4IUVA 1IHZA 4JVZA 4HJ8A 4I6PA 4B3ML 2KKCA 1KNEA 1AZPA 2PI2A 2IHEA 5JVH3 2FNJB 3DEPA 1EFWA 1FVIA 2EY5A 2DZJA 4FBJB 1T5XD 2IO3B 2UXBL 2YYZA 2K75A 4DK0A 3NP8A 4XYQA 3PVLA 1V5OA 4F7ZA 4L5SA 3SR1A 5G3LD 3S15B 5FLXE 3D8GA 1VZ6A 5CHVC 1B7YB 1E8XA 4K1RB 4H44C 2D2QA 2WQYB 1NTGA 5BN3A 2L5TA 1GJXA 3V96A 1A15A 1TY0A 2RBMA 1T0SC 3D4RA 4FLHA 3TDQA 2K03A 1QNUA 2H5XA 1NI3A 1TS2A 2K0PA 2C5LC 4BKTA 2CJOA 3J80i 5LMUL 1A62A 1CZGA 4RMFA 2JA8B 1NDDA 5EQ0A 2L52A 2JWZA 3M95A 2MLBA 4FJYA 5FR3A 1YJJA 2K01A 2B29A 1FRDA 4JLCA 4YL8A 2YEPB 1PGAA 1VQPA 2KWDA 4HCPB 3ALBA 4A3LH 2OJRA 3AEVA 1O7YA 2IWHA 2JXXA 2KWUB 2XNAC 1WOCA 4XDDA 1SB3C 1YNJD 1N61A 2CKHB 2JEAI 3RULA 1TWAB 2FIDA 1E2ZA 1B3AA 3NENA 3MJ5A 1AP0A 4DAMA 1B2TA 1DXMA 4JW0A 4JI5L 4F88A 2B63G 2QJLA 2N1WA 2JA5H 4P7IA 4A3GG 3SEBA 2GLSA 4IDIA 2WAQE 4WFN3 5JEAJ 4EQ5A 2LVPA 2HQEA 1VQ7A 3GV6A 3BYTB 1SNDA 1L1OB 2NB0A 2ZXRA 3P7JA 3OIPA 4UAIA 3W5VB 3E0EA 2JXTA 3T53B 3U7DA 1FCLA 4K2KA 2Q8TA 2Y3AA 1QZEA 2BB5A 1UH6A 1ESFA 4DV1Q 4KGSA 3JSVA 5J18A 5M5XB 4BY1H 1DOKA 2L11A 2HUGA 1GD7A 2LS01 4ID6A 2F1MA 2F4VQ 1J7BA 2BT6A 2JE6I 4G7OC 4HCEA 1XYIA 1N5WA 4XZ4A 3VR2A 2PW7A 3CC7A 4LNNA 4XQNA 1D3ZA 3APFA 2K5PA 3KUDB 1I4RA 2OQ0A 2NMQA 4A6QA 4DHJD 1WXQA 3ZGZA 4ZHPA 1JJGA 4PT5A 4GLSC 1LTGD 3QB3A 1GUNA 2EMSA 1QKZA 3D6CA 4XWWA 2JA8G 4P1BC 4DR6Q 1GHKA 4N8FA 3X0WA 2A6HD 3DBHI 3MC9A 1U9RA 3ITPA 2PE6B 2INPE 1S3OA 4GLAC 3A9KA 3Q8BA 5C4HA 3U4VA 2L1BA 1VQIA 3M63B 1PZJD 4US9A 1B1ZA 3GTMH 1B8AA 1PYSB 4DK6C 3TJPA 3I3TB 4RGNA 4BXXH 1DCZA 1WH3A 3DBRB 1UE1A 3GTOH 3FRPB 1KLVA 1LM8B 1CK1A 1M1KC 5T1IA 4XIGS 1XMQL 2PZTA 1NAPA 2O5JC 1X3EA 1RKNA 1WXVA 2K3UA 3RLNA 2JJQA 3LWUA 1NEKB 3HM3A 3R7QA 4MH0E 3ULLA 3N30A 2KOLA 3CQZB 3WALA 3NK9A 2BS4B 3ZNHB 4WJ3M 2LVQA 2N49A 5AZFA 1WTXA 2WX0A 3AEEB 3MEFA 4RCNA 3UDIA 3QC8B 4S17A 5IYCG 4Q2JA 1S5BD 2EXDA 4YWGG 3B2GA 1CM9A 5EJWA 3DBLI 4JQWC 2BA1A 1HH2P 3LX0A 4YWKA 1N34Q 3PO2G 1YN5A 2WXKA 1D8LA 2KLGA 2R2OA 3JW0X 1ZXHA 5EBCA 2WXGA 1JB3A 1SDFA 3F2BA 3M7GA 4PZ6A 1Q7YC 1M94A 3LB8C 5G2NA 2BCOA 3S1RB 2AYOB 2EZVA 5C6AA 3K0XA 4NQLB 3OMGA 1J7AA 3PQIA 2QF7A 4A93B 4B95A 2QCZA 1Z7TA 1ESRA 4CO7A 2MQHA 1LTLA 2NBUA 3I8ZA 4CKBA 3Q3MC 1HFGA 3FPPA 3M3JA 3PZDA 4ZDVA 2C35B 3A9KB 2PMZE 1FYCA 3M4PA 1SNQA 4MEMA 3P4RB 3N32A 3HVDA 5E3FA 5IGGA 1I42A 1J8CA 2PQAA 4B3SL 2VXWA 5KRUA 1EWCA 3F8TA 2D0OA 1GKHA 1K3BC 4C1NK 4A3MB 1TKWB 4K5VA 1TWFH 4EZLA 4RG1A 4JYAL 1FCCC 3CXCA 5GAGC 3DM1A 4RWSC 4IJLA 2D07B 1LM0A 4HRSA 2Y5BB 3G71A 1H8CA 4LDTD 3URYA 3GZNB 1RODA 2CWPA 3E0JA 3EQLC 3RNFC 3IT6B 3ONSA 2L15A 3P2BA 4MACA 3W1SA 1ACCA 4CYEA 5BYSA 5FLMH 4JV5L 3EN2A 1TZOA 1I4QA 1YN4A 4MGIE 1V5TA 3MVVA 3TS2A 4I6NB 3Q6SA 4EEWA 2N78A 1F9QA 1MKHA 3C3LA 1ROEA 2MBBB 4K0KQ 2ENBA 3ZRCA 4HDQA 3FMCA 4LFBL 2IGDA 4LNKA 3MHSD 3J81c 2Q2IA 4HCSA 4KD3A 3VA5A 4UY8C 4DV7Q 2CVRA 3S17H 1QZHA 4NDXA 3PUZA 5KGUA 1R4NB 1GHJA 1L0WA 1E7PB 3FILA 2K22A 3VTUA 4LNIA 4KIKB 3W1YA 4A93G 1CMXB 4JBJA 1SGHA 3U4ZA 3J81i 2D2CC 4KVGB 2FMCA 1S1QB 1AEXA 1S3SG 1F2YA 1JRPA 4GDKA 3TUOA 3G7LA 2FAZA 2ICEC 1L6UA 2J7ZA 4ZUJA 2MNAA 1WGRA 2K39A 5IYBG 4C80A 1Q81C 2KHIA 1V80A 1VQBA 5IIFA 1TXYA 1WTWA 2LFNA 1PVOA 5KNCA 5DM73 1IPGA 1C3TA 2RPVA 4JI4Q 2EYLA 3OMCA 3C8YA 5HI1A 2D3GA 4TKOB 1SMYC 1ZEQX 4OWXB 1DGJA 4OO1I 2UUCL 2FUG1 2MP2A 1IBLL 4HEDA 4DV3L 1HR0W 4UHVA 1E22A 3TP7A 2DZKA 2X38A 4DXAB 2QKIC 2CQOA 4W9FA 1HR0L 1EEFD 1QVGA 5GADC 1K9MC 2D3AA 2R6GA 4HIOA 2M8SA 3HM6X 3PRZA 3RNGC 3P1MA 3F2DA 1MI0A 1XCQL 2KDFB 3NTHA 4LFCQ 1EFID 2CFMA 4C3JB 3K9OB 3EROA 1JWAD 4NJ7A 1EYDA 1QILA 4XQJA 1TWGB 3KDFB 4PNYA 1JWBD 3K7AH 1VQ4A 1FR3A 2C7HA 1XLQA 5D7GA 2AUJD 2Y0SE 5FK9C 1SIFA 1F2ZA 2DWQA 4X3UA 1WXSA 2KD0A 2WX1A 4IOCA 3S1MH 4C2MH 4A3IG 4DAYA 1PZID 1GM5A 2EJGC 1WE7A 4GSWA 2KA7A 3V61A 2JUOA 2WDVB 1Y1VB 4J15A 1J5EL 1TWCH 3RZDH 5J22A 5G5GA 4BVUC 3B6YA 1E0BA 1J0GA 2VZAA 2AUKA 2KYWA 4G3XB 3JC66 1RFAA 1N36L 1CKOA 1KDAA 3VRAB 3UGBB 2ONQA 4GDKB 1I6HB 2WWZA 4BBRB 4DR2Q 4GKJQ 3V6EB 3OG5A 3PV1A 4JCVE 4YSYB 1XX8A 1VQDA 4RA8A 3SXHA 1E10A 4M0WB 1PTOH 1NR4A 2VS1A 1A6XA 3NVVA 4GIVA 4XDXA 3HKZB 4RH6A 4ZKCB 1PFDA 1CI3M 4QGUA 3RN9C 1PRTF 2KEDA 4QIWB 2VH2A 2XBBC 4LJOB 4L23A 1JICA 3AV8A 4TQ0A 4L5QA 3L2PA 2LJIA 4AP4C 5NUCA 1SYBA 1CUKA 1YQ4B 2GMIC 3TCAA 1HA5A 1L5PA 2YU9B 3MFYA 2BKFA 2REXA 1D5ZC 1UUPA 3DQVA 5CX3A 1LLRD 4P2CB 4N6EB 4WWNA 2J0MA 4C3JG 5CGKA 1WTOA 2XWJB 2FJ2A 2B2WA 1TQOA 2JRIB 3QIJA 5FLXL 1XWEA 4POGA 1K8RB 3MTSA 1KOTA 3CCMA 1MSHA 3PIO3 1T6BX 2W54A 2HCIA 2RSNA 3RZOB 5AJ3Q 3I3CA 3TSSA 1TZ1A 1P16A 1JMCA 1AWDA 3Q8DA 5FR6A 1J7CA 4J1MA 1RRBA 3MA2B 2R93B 4KN4C 1P98A 5LNK1 4R8IA 1TKGA 2L12A 2AWNA 1TY2A 1WGGA 4BBRG 4KGTA 3T1HQ 1BCPD 2ID0A 3I9V1 1HZBA 1VMCA 2CHZA 2I07B 3DVGY 3GTPB 2A6EC 2E6XA 4HROA 1BVSA 1G91A 1NI2A 2B2UC 1YHQA 3HOWG 2NVTB 3AU4A 1K0RA 2ZNVC 2I46A 1SYEA 2NTTA 2Q2HA 1FNUA 2VB2X 3EUB2 1UBIA 2GBNA 2KWCA 2VRRB 2WXOA 4Y7NB 3T3OA 1EUVB 3H3VH 2YEPF 1HZCA 5A2QE 1J8IA 1YZ6A 2KACA 2RR9A 4GN3B 1AE2A 4IFDH 1G6ZA 3KOJA 1FL0A 4KZ0A 3H3VI 1U4LA 2WXLA 1QOAA 1WJNA 2K5DA 2M56B 4QUFA 4F8CB 4JGHB 4P16A 3E9HA 3VDZA 4LUVA 1XJVA 1IBXB 1VR9A 2Z6KC 1TWHB 3ONAB 1EQVA 1Y56A 2DAJA 3ZDMC 4A3FG 2FBWB 1I6VC 3EIVA 4HJGE 2IO2B 4NMZA 3A1QA 1P7FA 3STBC 3CP0A 1V2YA 3I7FA 5I2YA 1WZ3A 4X62Q 1DONA 3UQBA 5C44B 2HTME 1K51A 5C2TB 1IBKQ 2G9DA 3GDEA 4BY7H 2L8JA 5CHFA 3U2SC 3M4QA 1WSPA 1R4MI 2KFKA 1WE6A 3V6CB 1T0YA 1E2VA 5C4ZA 2F0DA 5AEKB 4R8NA 3H0GB 3SK8A 4OWWB 1K50A 1KDCA 3A56A 2Z6BA 1Y1WG 4JI7Q 4LF6L 2PW9A 4BA1I 1WM3A 1J6QA 2WYQA 2JXMB 1K8MA 1L4DB 3KVFB 3R3MA 1FFUA 2KZRA 3I90A 3QCAA 1XO3A 5C3JB 2MH7A 3VYUA 2MUYA 1KDBA 1CTMA 2MQJA 2HHHL 3HRZC 3TRZA 3ZLZA 2K28A 3OTOQ 4P73A 1U4RA 2KC1A 5IYDH 4J3OD 3PCOB 4IG7B 4AUQC 2JVCA 1E24A 4DN4M 3HZXA 5E4XA 1H9SB 3PO3B 5KHQA 5KIXA 2UYZB 4IUPA 2ZTEA 4ZRQA 1H95A 4JE3B 5D14A 3FP9A 4A3JG 4HPLB 1W2BA 1ZXTA 1EL0A 1TTNA 3OAWA 4GB9A 4HK2A 1PH1A 2K7VA 4HMJA 2EYPA 1BUIC 1YJ1A 1SYFA 1ZYRD 4B3MQ 4MJSA 2HQLA 2B3GA 2RSOA 1WMHA 2OEDA 2HCCA 5IP7H 3AE3B 3A5ZB 1WX8A 1N8RC 4GU2A 5BR8L 3NHHA 1EWYC 1XNRL 4A3BB 3W1BA 2F0QA 3V05A 1TKEA 3MP9A 4MELA 2L3ZA 3VAWA 1F52A 3MZ5A 3L0WB 2QGQA 4LK0M 2L76A 3GTQH 4FADA 1PH6A 4AS1A 2F3IA 5IKCM 2KHSA 2KFKB 1UE5A 3ZNZB 4FF1A 3DHQA 1CA6A 5JHAA 4FNFA 2OJWA 3H0GG 1XD3B 4CKCA 1ILQA 2IO0B 5LMUQ 2A5HA 1PLFA 2ALYB 4LNQA 1A70A 3D0FA 1HEZE 3NJTA 5DPTA 5IGBA 2UU7A 4C3IB 2C9WB 3BVMA 4YWMA 2EJFC 2K05A 1P3QU 2ZPNA 2VH1A 4WIPA 4DUYL 4P75A 2NBWB 3DEOA 3BDCA 3TEYA 1KM7A 3D31A 3NWSA 1PXUA 5K36H 1TYGB 1ZOYB 4JI5Q 2GBRA 2JA6B 3NWTA 2Q8IB 1V43A 3WDNA 5GAHC 3U8ZA 4DR7L 4KGRA 2NVXB 2NUCA 1G8ZD 3S2DB 5IT9E 2BDOA 2N9PC 1O7IA 3BDOA 4X64Q 4WJPA 1KF6B 5IGDA 2JA7B 3RN2A 2BQQA 2I0QA 4KY7A 4MJSB 2WHIA 1E3PA 2A74C 3C19A 4TKNA 3SD5A 5LMNL 3GTJB 1WMHB 5HURA 2CKZB 3DHGC 1IZ6A 1SNPA 1WJJA 1D7QA 3JAME 3I63C 1G6JA 3B08A 4YSZB 2Z0EB 3PLVA 2QIEB 1F2LA 4B6WA 4QJFA 1FRRA 1MFWA 1LACA 2IDYA 2V4LA 3I72A 1ENCA 2KHJA 5M3FG 4A3EH 4A3PA 4YHHL 2K6DB 4FO2A 3W1SC 3VFKA 3F2CA 4J6HA 1C7YA 4MSMB 4HKZE 1WJ4A 3CF5A 2FCSA 3VQIA 3GTKB 4ZYNA 4PZ8A 1RTNA 1WIAA 1JJ2A 2NN6I 3CWIA 1L0VB 3I4OA 2VUMB 4DNTB 4KHPL 3KUPA 3ERSX 1K83B 4C3IG 2L4NA 4KSLC 1LT6D 3Q24A 1FFVA 5L83A 1E9MA 2EMTA 5AUKA 4H7BA 2P5ZX 2BB6A 4H2AA 3NS8A 1C48A 1RTOA 4G50A 5EBDA 5DNFA 5JPMC 3KBGA 2CW0D 2E5LL 1GUGA 1OXXK 1QB5D 2A69C 4L8JA 4OGQC 4PMCA 3QQ8B 4EFOA 3IBEA 3LGJA 1LT3D 1XMQQ 3KQ4A 4CDDC 4WWMA 4DR3L 1HTOA 1A63A 1QOBA 3A0JA 3R2IA 3GTLH 1YBYA 1X3GA 3E6ZX 5T1GA 3TS0A 1F1HA 2IZVB 2KMCA 2KVMA 4AH6A 2LHEA 5ELEA 1EIYB 2PJHA 5I6YA 3ND8A 4HJ5A 1KD1C 3RI7C 2UXDL 2KCNA 2SOBA 1Q5WB 3AMUA 3DVNU 1HTLD 2UUBL 4AOFA 1OQQA 2WU5B 1OEYJ 4PMBA 4ME3A 3N1ZC 4G7HC 3AULA 4GKKL 2SEBD 4M8AA 3J7AF 3F2UA 2KHWB 4IOIE 3A8JE 1SJHD 3I4MH 3PHWB 3X23A 4F1SA 3QJYA 4DHZE 2G4SA 2JSOA 1Q8IA 2E2IB 1CQFA 2N55A 3AFQA 2B8GA 5CV9A 1QOFA 1V86A 2MEKA 4K3CA 3DHHC 1EY9A 3T56B 5I6WA 3E56A 1EY8A 1STNA 2N9KA 1ENAA 1GC6A 2JX5A 2NR2A 2G45B 2VUMG 3DBHB 4DBGA 2VNUD 3CCEA 3S24A 1SYDA 2CJNA 2H88B 4BAXA 1U0LA 2DLBA 4IWPA 3KLSX 2NTSA 3HOUB 4DKAC 3AE7B 2WXRA 4UP7A 2SNSA 3T16A 3R93A 1X6OA 3PRPB 1UWVA 1YHBA 2O6VA 1KABA 2IJ0A 4B3SQ 1QZGA 1XLNA 2L0CA 1RAXA 1KQSA 1NVID 2M00A 4K14A 3P4QB 2E2HB 4C3HH 2Z9HA 1EY7A 2A8VA 2ATWA 2NCNA 3A4SC 1Y69U 4POFA 4K81A 2BDNA 4JYAQ 4KLKA 1PGBA 4MGKE 1PDQA 2ZM6L 2KCMA 3TL5A 1JE4A 4ZAIA 4FP5D 5C4XB 1ZXIA 1GNUA 2M4NA 2W3SA 1LTID 2KENA 1BBUA 2N4FA 4JV5Q 4JX1C 1N32L 2IGHA 2KECA 1EWIA 1VZ8A 5M3FH 2W82A 3NXWA 3NS1A 3NBHA 3AI5A 1N33L 2MGSA 3QHTA 1SNMA 3RN5A 3DBLB 5BO4B 1G2TA 3EFXD 4K3BA 4X57B 3MHZA 4NJ6A 4BWGB 2ZPYA 1CZPA 1B3QA 3P4PB 5M5YH 1E8WA 2IO1B 4IFDJ 4Q0FA 5C0XG 1IYJB 4M02A 2JT4B 2B2WC 5ELBA 4JI0L 2GBKA 2KAJA 2KJRA 4N9F4 5M3MG 5IGEA 4C4VA 2A6HC 3CSTA 3VR8B 1F9PA 1HZAA 4FYDA 2LZ6A 4LCDE 3LNNA 1HHVA 4C56C 5LHY1 2KQSA 3PT2B 3SE0A 5I4DA 2JZ3B 3E9SA 2D5DA 3MAQA 1WI5A 2AQ1B 1O7ZA 2K5QA 3HOUG 2N3SA 1FM0D 1SSNA 4BOSC 3C0RB 1MGSA 1LUZA 1BDOA 1IW7D 1HZ6A 2JU6X 1LO5D 2AHOB 1Q82C 1KFYB 3A7AB 3D6WA 4U68A 1WXMA 2CHWA 4JBWA 3P20A 2V1YA 1SBBB 5A2QL 3ICEA 4J8QA 3UQAA 1K8AC 2UUCQ 2R7ZH 4OHJA 4ZRZA 1PFBA 2EYOA 4O42A 3KJPA 1IBLQ 3QAQA 4WURA 1H9MA 3M4YA 1TWFB 5LL6X 2R92B 1NCVA 1DM0B 3CCQA 5CBEE 3K5NA 2L00B 2B2UA 1HR0Q 3GE3C 4MH8A 5KHOA 1D1KA 2M17A 4EKUA 3KYHC 3PIP3 1M4VA 1BT0A 2GA4B 1ZKOA 3KWVA 1EZ8A 3NBHB 5CYUA 4TUUA 3AYHB 3SK4A 4ODGA 4HJ9A 2GN5A 3TEHB 4A3DB 2BPSA 3NVWA 1VQ8A 2EPBA 3TMEA 1MVKA 1G6PA 4MT5A 3AB9A 1PH8A 2K4KA 4XC2A 2K52A 1UE7A 3K5OA 3VXWA 4FXCA 1RF2D 1LTTD 1UBQA 4DR5L 3CW2C 1L2NA 2J7QB 3RD4A 2AX5A 4C4VB 2DGYA 2Z6KA 1J5EQ 2L55A 1U4MA 1LYLA 1LTSD 4E74A 4R3DA 3HOXH 2NVQH 1EOTA 1N36Q 1KIXA 2ES2A 4HJAA 3OPOA 1FNWA 1GUSA 2BGFA 3NOBA 4A3CG 2WB1B 2LRWA 1ZPSA 4A20A 2KJ6A 4ANXA 1HNXQ 1ICWA 4TMAB 1B9RA 3KLSA 1F2RC 2MJEA 2QHOA 3P75A 2AWOA 4X3KA 1EF1A 3DDCB 2JY6A 2ZT9C 4UDUC 4E6IA 4QUCA 1TIID 2A68D 2UUAQ 2K8HA 4XQQA 4DV2L 3M62B 3H94A 2KOXA 1UNSA 1SAPA 2KQ4X 2LWPA 3KUZA 3ULJA 4BBSB 4XYOA 4WAFA 4A55A 2JA9A 2J53A 2R92G 2KQ7A 2M19A 3CPWA 1OEYA 4HXDA 3TEWA 2KUMA 5M5WB 1R7SA 5CBAE 4RGOS 1YNND 3EC8A 5GXGB 2WNMA 2ZNVB 3NUCA 5JJZA 2Q2TA 2KN5A 3HIZA 1YHAA 3NTKA 5E6JA 4AYBB 1DOYA 5I9PA 2R61A 4IPCA 4YTPB 2MBHA 1TBEA 1BQQT 3A4RA 1HFNA 4YTNB 4A3DG 4PS3A 2PPHA 4OZBA 1VS0A 4JI3L 5DLQE 3U7ZA 1NE3A 1L0XB 5FO9B 5IOIA 3EGRA 3K7AB 1BOSA 2WV6D 5M3MH 4JI6L 1IGDA 4WQMA 3KUCB 1WCMB 3UDXA 2Z4HA 2B2YA 1PYBA 5IP9G 3Q23A 1X1MA 2JK8A 2LI5A 2LXKA 2FHTA 2H89B 2O5IC 1B70B 1TWCB 2G5DA 2EYJA 2F0JA 3OWFA 3TP8A 5IGFA 3C1EA 1PFNA 2DX5B 3RPFC 2F0KA 2F0EA 3GD7A 4LMQD 4DV5L 4GLXA 1HQMC 5HG2A 3AM9A 4AJYB 2I2YA 4K6DA 2DJGC 3JSVB 3QWNA 3IT4B 3J7ZC 1Q0WB 1P9DU 1NNXA 1R9TH 1IBML 1HUNA 5FO8B 5D2MB 1STBA 4OO1G 1YMHE 5IT9L 5C4JB 4KV2A 4B0MA 1D2BA 3KFUA 2WDRB 1TT5B 3TP5A 1LFDA 2QILA 3RLOA 3WAOA 1ET6A 2DBYA 1Q8KA 5FJ8G 1VRAB 3JAML 1GXDC 2PW5A 1HNZL 1KL9A 2DN8A 2PMVA 1A2TA 2A4ZA 4AYBG 2BYVE 3A7LA 1BBWA 3K6OA 4C1NI 2NS5A 4CBVA 4B0EA 5LXHA 1E1TA 2RF4A 1FNVA 1QQRA 2XK5A 2NBFA 2BH2A 4JI1Q 1E6EB 5TR5A 1KAAA 1WWTA 1K52A 1T9HA 2B63H 1C78A 2BYFA 2D3BA 4NPNA 1I3QH 3OSOA 4DNRB 1YNTE 3Q3OC 4LNFA 1FD7D 4A3GH 5AZHA 1WCMG 4MSQB 3T3NA 2KO3A 3FVQA 3DWMA 1V6EA 5HFYA 2WDQB 1MHXA 1XPRA 3PLUA 4FN2A 1S4ZA 1NMGA 1RL2A 4B3RL 2PIAA 1Q12A 3WIMA 1AYFA 2MHJA 2ZJPA 1YJWA 4LF6Q 1N5XA 3RNAC 1JROA 3PUXA 3OJ3A 4TRDA 3VVWB 3MFGA 1R4PB 3PGZA 3S15H 1HTQA 4V190 3HKSA 3S16H 4HKQA 1XF5L 5EKLA 4P71A 3FPUB 4HCNB 4ZRIA 2HHHQ 2DNEA 2XVSA 4L5TA 3H15A 1PFMA 5J3BA 1WRIA 3DHIC 4BKSA 4BOZB 2KVZA 2CHBD 1BR9A 3AMZA 3KLRA 2L0TA 1VQNA 1YIWA 4KY6A 1B4OA 1CHQD 2VQEL 4R4CA 3OWEB 1BKBA 1M8AA 2OWOA 4JPBW 2JA8H 4R9WA 4JI8L 5EKKA 3U9OA 3ZXRA 2QA4A 2I5HA 4DPGA 4FF3A 3H1UA 1HE8A 3VYSA 2F03A 2FMMA 2X69A 4X3SA 1EOVA 4PV1C 1WTQA 1FEHA 2MPMA 1XLPA 1C9FA 1DOMA 4XT1B 4BS9A 5BYRA 4OIJA 1I4PA 1XNQL 4XT3B 1WTRA 2RDBC 2KX0A 4JWSC 2PQAB 5CHWA 3I5JC 3AFPA 3H6NA 1FMAD 2ZCCA 3NQTA 5BR8Q 1ENFA 1XNRQ 4N9PA 1BO0A 4A3MG 3K7UC 3G6JB 3CRLC 5E6NA 4DV4Q 1R4MB 1O7LA 1VCBA 1WVLA 1JJCB 4BY7B 2KDMA 3WOFA 4DAPA 1Y8OB 1PDXA 1DJRD 3PF4A 3IAYA 1GG3A 3T4AC 5IYCH 3HOZB 1UD7A 1A5RA 3J9CA 5M5XH 3KYDD 4HPMB 2KMMA 2L32A 4C7ZA 1IKMA 5DPSA 1PMRA 3PO2H 5IODA 3GE8C 3U52E 2YTXA 1JR0D 3HS0C 3E3XA 3D4DA 1BMLC 2KEEA 3QK0A 1Z47A 2QCPX 1MG8A 1MIUA 1VD2A 1CHPD 4F7XA 1T0QC 5IOCA 3VYRA 3NE5B 4RF1A 3FILB 3UIPB 1OXSC 1QOHA 3J80E 2QEXA 1PH9A 3S1QB 1JW9D 1ASZA 3CC4A 3BIID 1VCIA 3A54A 1FXAA 3MXNA 5E6OA 5H8YE 3N1XC 5D6JB 3KYCD 3A33B 1C4CA 3ENEA 3L13A 3Q3FA 5LMNQ 2KT7A 3UE0A 4NP5A 4NPSA 3J81j 2OXPA 4MTNA 1WYDA 1W6JA 1SYCA 2Z0SA 4LUZA 2IT1A 4DNIA 5D65A 2JPHA 1PYWD 3BY4B 2E2JB 5JAVA 2N8NA 1LQBA 1SNOA 2F0GA 3B1LX 3IVFA 4A3OA 4IJHA 2YTYA 2N7DA 2MP2B 3I4NB 2F0OA 4FJVB 2JYEA 4KKIA 3CQZH 2BTEA 2LJ5A 3R66C 1I35A 2XRSD 3GTQB 1WX9A 4IN3A 2R2QA 1YJIA 4Z9CB 4MIUA 1VQMA 2RDFA 3HOZG 4JWUC 2Y5CA 3WANA 5CMDA 1WD1A 5J1ZA 2AWTA 3X3NA 2JEBI 2GI9A 4B08A 1STAA 3S2HH 2BW2A 3ML8A 2G9HD 1SE3A 4KSKC 4MGYE 1HZ5A 2XWBB 2KN4A 5HHDG 4DAYB 5I2XA 4JG2A 1MBYA 3S1RH 2R3ZA 3I2ZA 2E5LQ 1MHHE 1TIFA 2MFIA 1A2UA 4W9DA 1QUQA 1Y1VG 4G7ZC 1C4QA 3U9SA 3BJUA 4K8JA 4A93H 4DR3Q 3MXNB 4HIMA 5G55A 2B2TA 3GP7A 2L05A 3V62A 1CKNA 4HTHA 3CPFA 1QWYA 2X8XX 4DR6L 3ETRA 1I50B 1HA6A 4DU9A 5BN5A 5IYBH 4LF4L 4LJPB 3R3OA 1IP9A 2UXDQ 3WOEA 2Z0DB 3GTGH 2UUBQ 3AE6B 5JEAG 2KTRA 1EQQA 4ZYSA 3KF8A 3I73A 2E74C 5HY6A 1ONLA 3E5SA 3HKZG 5KNBA 4GKKQ 3PRMB 2X6GA 2GVBA 2JN4A 1TJEA 3PGEA 3P4SB 2PMZB 4XYCA 3RUIB 2V4IB 3TMPB 3I4NG 4YY3Q 4A3EB 2A19A 1AZQA 1V8CA 2PTLA 4GN4B 1UF0A 4W9LA 2IX3A 5EE0A 1SMYD 1PRTD 3SK5A 2SNMA 3Q0AA 3HOYB 5BMIA 3EA6A 1BUVT 1LV9A 1IL2A 4CHKA 1SE4A 4PZ7A 4DHJB 1DZ1A 2JWUA 1VQHA 2A73B 2NZOA 1DGSA 1KNAA 4UP9A 1JWMD 1ISNA 2GOWA 4KKUA 2MP1A 3C46A 1OQRA 4IKGA 2EY1A 4IFDI 3FKIB 2ZEQA 3HHMA 3U4EG 2K1FA 2N7JA 3F1ZA 2MJDA 2ZJRA 2N9LA 1L0YB 1ICFB 4HPPA 5K5PA 1LXDA 3Q3NC 2JP1A 4A3IH 1GUOA 3W2DA 4DUZQ 1B53A 2DYOA 2EXZA 3CCVA 1II3A 4EE2A 1EU4A 2MWSB 4KJNA 3A9JA 4IWQA 2BE5C 1Q46A 2FCNA 5LL6S 4LAAA 1E1OA 3NTIA 3PUWA 3L3OC 5IP4D 2PVGC 2RDGA 2ZM6Q 4LWCA 2R93G 2KLCA 2D5GA 2RQXA 3NBIA 4QCLA 4HMIA 1EY0A 3VR3A 1WM2A 3VTVA 3EVQA 2MSED 1PTOC 4WORA 2WS3B 5J2RA 3L7ZC 2O4XA 1D6EC 1WJUA 2LGYA 2KTRB 3PIOA 1HNWQ 3KF8B 1N33Q 5E6PA 3ABVB 1KHIA 1GO3E 1MG4A 1DD2A 1WI0A 2N9XA 5JVG3 3UDFA 4CJ2C 3QOLA 2LUMA 4WQOB 4KKTA 1FIQA 2KBNA 4ZK9B 2PEAA 2K6AA 3QA8A 3A8KE 3D32A 1W6KA 3M85A 1IGCA 2DHZA 1JRUA 4JI2Q 4IUNA 1S40A 3S2AA 1FD6A 2E3TA 2MHVA 5L37A 4IM0A 3IRBA 3ZJUA 2RVLA 4JI0Q 3I4MB 4ICUA 3TEXA 3KH0A 3NY5A 4IALA 2G1EA 2K25A 2LGSA 3MC0B 4C3JH 3NZ3A 2ZXOA 3ZQ4A 2YLMA 1LT4D 4XE0A 4WJ4A 3K58A 5JHBA 3EFUA 3FKIG 3G48A 4R1JA 3V2TA 2NPTA 2FIFA 3AE8B 3N52A 3VR5A 4KTAA 2B2YC 2CW0C 4JOIA 2QSDA 1D4BA 3VUXA 1RIPA 2CU3A 3RZWC 5FLXc 5IO9A 2VL6A 3A8IE 2IX1A 2KCTA 2B3AA 5J39A 4MM3A 3RYTA 2UXBQ 3A1QB 1Y1VH 2DNFA 2F0FA 1WFQA 4DV7L 1MJDA 1ZKHA 1EYAA 2F0TA 1RHPA 4YWLA 5C44G 3VDYA 4JBKA 1Q90A 1C76A 2LUEA 2V0GA 2VB3X 3QJZA 1LTAD 2Y0SB 3I70A 3J81E 1GUWA 4ZHOA 2N1VA 4LF7L 3M4OB 1I6HH 4BBRH 1TS4A 3Q8EA 2X6LA 4LDTB 2E2DC 4L63B 2EE1A 1PTOF 4N9TA 2K8BA 5C23A 1NMFA 2G4DB 3BS1A 3A5UA 2UXCL 2K14A 1C0AA 3HOWH 4FXKC 4B9WA 2KC2A 1X3QA 2UU9L 4JI4L 3J7A5 3HOVB 1AW7A 4ACFA 1KLUD 2K1BA 3L17A 4IPDA 2KANA 2QDBA 1VQ6A 2A6ED 1SFOB 3H3VC 4P72A 2N88A 4A3KB 4IOAA 4OW0A 3FHWA 2YU9H 1PH7A 3TQYA 1E7VA 3IXSA 3PO3G 3APCA 1XMOL 1Y8NB 4IURA 1DOXA 2R7DA 4LF9L 1YEZA 2NVYB 1VQEA 2EY2A 3BYYB 1FGBD 4EZKA 2JQOA 5E4WC 1C4PA 1WJ6A 1P8LA 5C3EB 1ZGUB 2WXFA 1PZKD 2NPTB 4QMGA 1JE5A 3JVZX 3ND9A 1VDVA 2HDMA 4A3FH 5IGCA 3M3YB 5H92C 4TSSA 1Z5SB 4IUQA 3AXCA 1PFSA 1BBXC 2C7MB 5JXVA 3K5MA 1JALA 4A3BG 2WDTB 3GV3A 3QIAA 3BWUD 4DV2Q 1YD8U 4OEMB 3STBD 1V97A 3AEGB 1SJED 2Y0SG 4LFAL 2ZJDA 2ASBA 3CSFA 3SHQA 1QLBB 2L0FA 4I65A 1UZXB 2QEJC 1Y1WH 2VW9A 1N63A 1JWSD 1O80A 1XPOA 2R7FA 4M1UB 1I7HA 4A4IA 3AE2B 3GTPH 4F87A 1TGZB 3W3AA
chains in the Genus database with same CATH topology
2SDFA 1JQYD 2PCFB 1P7EA 3BVGA 1IYVA 1RWSA 1GPXA 1HXYD 5CV5A 4DAVA 1HCZA 3TP6A 1DOIA 4K2LA 2HDEA 2CQAA 1N60A 3VR4A 2K04A 1V1PA 2JA5B 1JORA 4KK7A 4FXGC 3HOXB 1IW7C 2GB1A 5CV4A 3SDZA 5C3WA 5BN4A 1U4PA 2DY7A 1WGKA 2J52A 5DM63 4DF7A 5ELDA 1TR5A 3J80L 1BF4A 4BY1B 2PPBC 4CJ1B 1STYA 2BS2B 4XTCS 3H8HA 3DMUA 3AE9B 5DAUA 4REZA 4JPSA 2J0TD 3FC4A 3B9JA 4KV6A 4XDCA 1YNJC 3NRZA 4NZLB 3I91A 1A3VA 2LMCA 1D1IA 1EM7A 4K5XA 5EE3A 5KYLA 3GTMB 2F0IA 1R4QB 1OFFA 1EY5A 3GTOB 2TSSA 1V1PB 1RD9D 3X3MA 1DYQA 1TS5A 1OXUA 2PZUA 1SNCA 1SE2A 4PQXA 3LYYA 5G3LF 2Z8LA 4KHVA 1BCPB 3UI2A 1X3PA 2ICIA 1FXIA 3TEZA 4DA2A 4L1BA 2OF1A 1IL8A 3QG1A 3L9AX 3PV0A 5D3IB 3TZUA 1YNNC 4WIPA 3IFTA 2K32A 3HEJA 1E2WA 2TMPA 3EJIA 4ITKA 5EGTA 2WXIA 1Z6HA 4A9AA 3LWEA 4K8IA 3H09A 2PNRC 4NKLA 3AE1B 3O13A 3AN1A 1E0ZA 5EPJA 2LMCB 5I9OA 5BMGA 3R2TA 1CJEA 2B2TC 4RNAA 1RJTA 2PLPA 4B9XA 4BA2I 1VJKA 1CQVA 2AQ3B 4ZLTF 4N59A 3PUYA 2F0WA 3W9CB 4RAUC 3SVMA 4A3GB 2A69D 2BS3B 4CHTB 1F9RA 4ME5A 1WTPA 4TQUS 1N62A 4EGVA 4RF0A 5KNDA 4DFAA 1VZ7A 1S5CD 2ZXPA 3HGBA 3S16B 3R8BA 3AEFB 4KKJA 3DUZA 2FFKB 2IL8A 2EYMA 5CORA 3T51B 2EYFA 2F3VA 4ZRPA 2E76C 3S17B 2M9VA 2AQ2B 1OXTA 2K5WA 1XCTL 1AN8A 2F0PA 5FO7B 5A35A 1NUCA 2OT2A 2XN9C 5AFWA 1BXTA 1EWHA 3CKIB 3GB1A 3NUHB 4MHEA 5CR3A 4ARIA 1MPEA 1F2MA 1J9OA 1JCKB 4P6VF 1KLGD 2W3RA 1Q3LA 4HSVA 4NAWB 1PGXA 2FE8A 4S3SA 3HRDD 2V3PA 1QOGA 2V3NA 5DEHA 2Z1CA 2XIWA 1QT9A 3AH7A 3Q22A 1VMPA 4F8MA 2L1AA 2C5CA 3CU7A 4HR7B 4IZ8A 2L9HA 2WINB 3PO2B 3HVZA 5C0XH 3J81L 2WXJA 3IL8A 1ET9A 4Q5VA 5C5LA 5C0XI 3S1MB 4C2MB 4YIJA 4QF4A 3NVYA 1TVXA 4OIKA 4EQOA 3RZDB 4D2KA 1HPCA 3AEDB 3QO2A 1T3QA 2RDHA 1HTPA 2XSCA 2JYTA 2ON8A 3K0YA 4KN7C 1L4ZB 5G5HA 1PTOB 1ZDXA 1QJOA 2WLBA 2RA4A 2WU2B 2D9UA 2ACZB 2LKVA 1XXGA 1UEAB 2PVOD 5KEEA 5JOBA 4K6LA 1B9MA 2MJ8A 1EU3A 1VF7A 2WP9B 3BK1A 1I4GA 3SK6A 1JOQA 3S2HB 1EIHA 4FF4A 1F9SA 4DQOC 1MSGA 3I57A 2XRQD 3LXFA 2B2VA 5BYQA 2F0LA 1JMLA 4L6TB 2SAKA 5C3XA 1NSNS 3K59A 1A3TA 4US8A 3S9WA 2B8FA 3RLFA 3NQIA 1LTBD 3MHBA 3GTGB 4YXDB 5BMHA 2B76B 4YT0B 1SEBD 2C9OA 4OL7A 2DYMA 3GS2A 3CIRB 2WXQA 1LT5D 1VDZA 3PZ7A 1I4XA 3V3XA 1V1OA 1SIJA 3MXGA 1JWUD 1X32A 4YTMB 5CV8A 5FKAC 4LK1C 2F0SA 1GB1A 4OZCA 1RDPD 1S5ED 3VR9B 2EOTA 3AB5A 2IW3A 1WD0A 2WXHA 2EELA 4A3IB 1L6VA 1GOZA 2KJXA 4KY5A 4LLGM 2K33A 3C2PA 2EY6A 4HEA1 1ZDVA 3D4WA 1XLOA 1NYRA 5C5MA 1YQ3B 1H9KA 1BCPC 3ZYYX 1EIGA 2MJ3A 1XEEA 1EY4A 1STHA 2WAQB 4MN3A 4M0WA 2EYHA 4ABNA 4OO1H 3Q8CA 3OW7A 1PRTC 1EY6A 2NZ1D 1NENB 3N6RA 2O2LD 4ZKBB 2VZKB 4HAEA 5M9OA 4RKLA 1EQTA 1CFMA 4KJOA 4IFDG 4FF2A 1C77A 1TS3A 3TBIB 3K5LA 4K5WA 3VR6A 3DXJC 2WIIB 1ZP0B 1SXTA 3HP3A 2JQRB 1SYGA 2Q8RE 3AEAB 3AEBB 5TSSA 2Z4IA 1JOOA 4ILWA 4N58A 1V8QA 5JPNC 4DGZA 1BCPF 1TKYA 1KTKA 3GQBA 4CJ0B 2GRIA 3PO0A 1B50A 2WXNA 3FAHA 4ULLA 3BK2A 3VA7A 2HDLA 1RFKA 1GUTA 3HOWB 1C8CA 1TU2B 3NVZA 5T8IA 5ELFA 3DWAA 3SFDB 1OO9B 2DNCA 2K9XA 4EVOA 3SR6A 4RHRA 1ZYRC 2Y5PA 2LEKA 1SSOA 2NYZD 3CRKC 3HG9A 1PUTA 3IKJA 3BDLA 1JOKA 1IBXA 5F2DA 1FO4A 2M2LA 1ZE3D 4A3FB 3A55A 5EPKA 1K53A 4EQNA 2RKSA 2WXPA 2LGIA 2F4IA 1DOLA 4H13C 1B44D 4A8XC 1Y1WB 4NAMA 3OHXC 3K57A 2LFIA 4WJWA 5C0XJ 3HUIA 1B9NA 4QB4A 1G2SA 4DXFA 4RFBA 4L2YA 1KH0A 1H9SA 5COYA 5K36G 2PKOA 4A3JB 1CT1D 2OHFA 2DY8A 3KWLA 3GTLB 4RGMA 1HUMA 2IPKD 5AUIA 4ZUIA 1IYUA 4EQPA 1QCBD 4ZQ3A 2F0MA 1QG7A 2KQ3A 5MPOA 4G4KA 2F0NA 4LJZC 4HSPA 4RCOA 1WYGA 1YN3A 2QMTA 3L4PA 3Q69A 2F0HA 3NSWA 1UGJA 4DK1A 5CC4A 1C79A 3NPPA 4KX6B 2PO4A 1Q10A 4USAA 4KD4A 2NN6G 2H4OA 4NW2A 1BNZA 3CHBD 1VF5C 5FOBB 2Q5WD 4IQZA 5EKIA 1Y8PB 1RM6C 3ZJVA 2N0SB 3T13A 1ILPA 4RKBA 4LTUA 1JC7A 4PMWA 1O78A 2J4XA 1KRHA 4ZOHC 3MEHA 2B39A 4C3HB 3BG3A 2J42A 1EYCA 5JEAH 3J7AV 4OVZA 1A3UA 4GZYC 2EVBA 3IAM1 2LHDA 1H9JA 1TT2A 1NYQA 4KI0A 3AU7A 1K8OA 3IFDA 5M3FB 4FVMA 3S14B 5EPLA 1LTRD 5D3DA 3D3RA 1D5XC 3BVZA 1C4AA 1AFPA 2RMMA 4U673 5M5YB 2F0VA 1STEA 4FXDA 4OZAA 1WTVA 3FEWX 3KBXA 4H0LC 3UI3A 1RYJA 2PZWA 2JZPA 2B2VC 3RUZA 3N9YC 4MM3B 1MD2D 4NJCA 4I7ZC 1XTCD 2INNE 3B2FA 4CQNA 1MI2A 4C3HG 1EEID 1Q1EA 4G57A 1F0ZA 2BBCA 1IUEA 3ERQA 2R7ZB 3Q8AA 2BE5D 2IX0A 3AECB 1GAQB 4A90A 1NR2A 2V4DA 2ZW0A 1LABA 3P42A 2BOSA 1PTOD 5ISRA 4DXGA 2NWGA 1OXVA 1HRJA 1S5FD 3TZDA 4GDLB 4V0BA 1QF6A 3Q8FA 2NN6H 4XXEA 3RFZB 5EE9A 4XWTA 4KHZA 4IUTA 3AE5B 3BZDB 3VRBB 3ZJTA 3H91A 1RCVD 4KKSA 2NVQB 2FINB 1SF0A 4HN7A 4JK1C 1UWMA 2EKIA 4KMUC 3GO5A 2EDGA 3RMHA 1QE6A 1F77A 4C7YA 3IAS1 2M0AA 3QOJA 3TN2A 2F0UA 2D62A 5CV7A 5EE1A 1STGA 3MWYW 2WXMA 1IKLA 4WH4A 2OEOA 3SFEB 3DWPA 1D5MC 3M7NA 2ZW1A 3I4LA 4TQ1A 1ML0D 3OOCA 1I4HA 3P63A 2IGGA 4RGTA 1HQRD 3J7YW 2PYKA 2L83A 2JYOA 4AQ7A 3PMFA 1H9RA 4O1NA 5M3MB 3W5UB 1ZUD2 5E1FA 1CZWA 2JSVX 1S5DD 1G291 4CKEA 2A68C 3PZ8A 2BYTA 4ARCA 2KCCA 3PUVA 3SHLA 3MXPA 3C1FA 1R9TB 4RHSA 1F2RI 3VYTA 1EZ6A 1CA5A 2EJMA 3AE4B 5KYIA 3KK7A 2BA0A 5ELCA 2PQEA 1PRTB 2E75C 1UAPA 1QNKA 1UWXA 2LY7A 5CV6A 4X3TA 1T5EA 2WP8J 3S1NB 2WKDA 3OIQA 3DWGC 2I38A 3P1HA 3MXUA 4WRDA 1VLBA 3DWQA 4YSXB 2W55A 5HGTA 3WCQA 1GB4A 3FDTA 2H1EA 2VZKD 3H6MA 2B63B 2F3WA 4CGYB 1I3QB 1Q1BA 2WKCA 4IUUA 2WACA 4IUVA 1IHZA 1KNEA 1AZPA 5JVH3 3DEPA 2EY5A 1T5XD 2YYZA 4DK0A 3NP8A 4XYQA 3SR1A 5G3LD 3S15B 5FLXE 3D8GA 1VZ6A 4H44C 2WQYB 5BN3A 2L5TA 1GJXA 3V96A 1A15A 1TY0A 2RBMA 3D4RA 3TDQA 2K03A 1QNUA 1NI3A 1TS2A 2K0PA 2CJOA 2L52A 1CZGA 2JA8B 5FR3A 5EQ0A 1YJJA 2K01A 1FRDA 2YEPB 1PGAA 2KWDA 1O7YA 2IWHA 4XDDA 2XNAC 1SB3C 1YNJD 1N61A 2JEAI 1TWAB 1E2ZA 1B3AA 3MJ5A 1AP0A 1B2TA 1DXMA 4F88A 2QJLA 3SEBA 4IDIA 4WFN3 5JEAJ 2HQEA 3BYTB 3GV6A 1SNDA 2NB0A 2ZXRA 3P7JA 3OIPA 4UAIA 3W5VB 2JXTA 3T53B 1FCLA 4K2KA 2Q8TA 2Y3AA 2BB5A 1ESFA 4KGSA 5M5XB 1DOKA 2L11A 2HUGA 2LS01 4ID6A 2F1MA 1J7BA 2BT6A 2JE6I 4G7OC 4HCEA 1XYIA 1N5WA 3VR2A 2PW7A 4XQNA 2K5PA 4A6QA 1I4RA 3ZGZA 2NMQA 1WXQA 4ZHPA 4PT5A 4GLSC 1LTGD 3QB3A 1GUNA 1QKZA 3D6CA 4XWWA 1GHKA 2A6HD 1U9RA 3ITPA 2INPE 3Q8BA 5C4HA 2L1BA 4US9A 1PZJD 1B1ZA 4RGNA 1DCZA 3FRPB 1CK1A 5T1IA 4XIGS 2PZTA 1NAPA 2O5JC 1RKNA 2K3UA 3LWUA 1NEKB 2KOLA 3CQZB 3NK9A 2BS4B 1WTXA 3AEEB 4RCNA 4YWGG 4Q2JA 1S5BD 3B2GA 1CM9A 5EJWA 2BA1A 3LX0A 2WXKA 1YN5A 1ZXHA 5EBCA 2WXGA 1JB3A 1SDFA 3M7GA 3LB8C 2BCOA 3S1RB 2EZVA 5C6AA 3OMGA 1J7AA 2QF7A 4A93B 1Z7TA 1ESRA 3I8ZA 4CKBA 1HFGA 3FPPA 1FYCA 1SNQA 3P4RB 3HVDA 5E3FA 5IGGA 2VXWA 5KRUA 1EWCA 4C1NK 4A3MB 1TKWB 4K5VA 1FCCC 3DM1A 4RWSC 4HRSA 3URYA 1RODA 3E0JA 3EQLC 3IT6B 4MACA 3W1SA 5BYSA 1ACCA 1TZOA 1I4QA 1YN4A 3MVVA 3Q6SA 1F9QA 3C3LA 1ROEA 2ENBA 3FMCA 2IGDA 4HCSA 4KD3A 3VA5A 2CVRA 4NDXA 3PUZA 5KGUA 1GHJA 1E7PB 3FILA 2K22A 2D2CC 2FMCA 3TUOA 1AEXA 1F2YA 1JRPA 3G7LA 2ICEC 1L6UA 2J7ZA 4ZUJA 4C80A 5IIFA 1WTWA 2LFNA 5KNCA 5DM73 1JQ4A 2RPVA 3C8YA 2EYLA 3OMCA 5HI1A 4TKOB 1SMYC 1ZEQX 1DGJA 4OO1I 2FUG1 4HEDA 3TP7A 2X38A 2QKIC 1EEFD 2R6GA 3P1MA 1MI0A 1XCQL 3NTHA 1EFID 4C3JB 3EROA 1JWAD 1EYDA 1QILA 4XQJA 1TWGB 4PNYA 1JWBD 1FR3A 1XLQA 5D7GA 2AUJD 5FK9C 1F2ZA 2DWQA 4X3UA 4DAYA 1PZID 2EJGC 2KA7A 2WDVB 1Y1VB 5J22A 5G5GA 1E0BA 2AUKA 1KDAA 3VRAB 2ONQA 4GDKB 1I6HB 4BBRB 4YSYB 1XX8A 4RA8A 3SXHA 1E10A 1PTOH 1NR4A 1A6XA 3NVVA 4XDXA 3HKZB 4RH6A 4ZKCB 1PFDA 1CI3M 1PRTF 2KEDA 4QIWB 4TQ0A 4L23A 1JICA 3AV8A 2LJIA 5NUCA 1SYBA 1YQ4B 1HA5A 1L5PA 2YU9B 3MFYA 1D5ZC 1UUPA 1LLRD 4P2CB 4N6EB 4C3JG 5CGKA 1WTOA 2XWJB 2FJ2A 2B2WA 1TQOA 5FLXL 1XWEA 3MTSA 1MSHA 3PIO3 1T6BX 2W54A 2HCIA 2RSNA 3RZOB 3I3CA 3TSSA 1AWDA 1J7CA 4J1MA 3MA2B 2R93B 4KN4C 5LNK1 4R8IA 1TKGA 2L12A 2AWNA 1TY2A 4KGTA 1BCPD 2ID0A 3I9V1 1VMCA 2I07B 3GTPB 2A6EC 2E6XA 4HROA 1G91A 2B2UC 2NVTB 2I46A 1SYEA 2NTTA 1FNUA 2VB2X 3EUB2 3T3OA 2WXOA 4Y7NB 2YEPF 1J8IA 5A2QE 2KACA 4IFDH 1G6ZA 1U4LA 2WXLA 1QOAA 2K5DA 2M56B 4QUFA 4P16A 1IBXB 1VR9A 1TWHB 3ONAB 1EQVA 1Y56A 2FBWB 1I6VC 4HJGE 4NMZA 1P7FA 5I2YA 1DONA 5C44B 2HTME 1K51A 5C2TB 2G9DA 3U2SC 1WSPA 1E2VA 5C4ZA 2F0DA 4R8NA 3H0GB 3SK8A 1K50A 1KDCA 3A56A 2PW9A 4BA1I 2JXMB 1K8MA 1L4DB 1FFUA 5C3JB 3I90A 1XO3A 2MH7A 3VYUA 2MUYA 1KDBA 1CTMA 3HRZC 2K28A 1U4RA 4J3OD 4DN4M 3HZXA 5E4XA 1H9SB 3PO3B 5KIXA 4IUPA 4ZRQA 4JE3B 5D14A 1ZXTA 1EL0A 2K7VA 4HMJA 2EYPA 1BUIC 1SYFA 1ZYRD 2RSOA 2OEDA 2HCCA 3AE3B 1EWYC 3NHHA 4A3BB 2F0QA 3V05A 1TKEA 3MP9A 3MZ5A 4LK0M 4AS1A 2KHSA 4FF1A 3DHQA 1CA6A 4FNFA 4CKCA 1ILQA 2A5HA 1PLFA 1A70A 1HEZE 5IGBA 4C3IB 3BVMA 2EJFC 2K05A 3DEOA 3BDCA 3TEYA 3D31A 3NWSA 1PXUA 5K36H 1TYGB 1ZOYB 2JA6B 3NWTA 2Q8IB 1V43A 3WDNA 4KGRA 2NVXB 2NUCA 1G8ZD 3S2DB 5IT9E 2BDOA 3BDOA 1KF6B 5IGDA 2JA7B 4KY7A 2A74C 3GTJB 5HURA 1SNPA 3JAME 4YSZB 2QIEB 1F2LA 1FRRA 2IDYA 1LACA 3I72A 1ENCA 4FO2A 4J6HA 4HKZE 3VQIA 3GTKB 1RTNA 2NN6I 3CWIA 1L0VB 2VUMB 4DNTB 3KUPA 1K83B 4C3IG 2L4NA 1LT6D 3Q24A 1FFVA 1E9MA 5AUKA 4H7BA 2BB6A 4H2AA 1C48A 1RTOA 5EBDA 5DNFA 5JPMC 3KBGA 2CW0D 1GUGA 1OXXK 1QB5D 2A69C 4L8JA 4OGQC 4PMCA 1LT3D 3KQ4A 4WWMA 1QOBA 3R2IA 3E6ZX 5T1GA 2LHEA 2KVMA 5ELEA 5I6YA 3ND8A 2KCNA 2SOBA 3AMUA 1HTLD 1OQQA 2WU5B 4PMBA 4G7HC 2SEBD 4M8AA 3J7AF 3F2UA 4IOIE 3A8JE 1SJHD 3QJYA 2JSOA 1Q8IA 2E2IB 1CQFA 2N55A 5CV9A 2B8GA 2MEKA 1QOFA 1EY9A 3T56B 5I6WA 3E56A 1EY8A 1STNA 2N9KA 1ENAA 2JX5A 2VNUD 2CJNA 1SYDA 2H88B 2DLBA 3KLSX 2NTSA 3HOUB 3AE7B 2WXRA 2SNSA 3T16A 3R93A 1KABA 2IJ0A 1XLNA 2L0CA 3P4QB 1NVID 2M00A 4K14A 2E2HB 1EY7A 1Y69U 2BDNA 1PGBA 1PDQA 1JE4A 4ZAIA 4FP5D 5C4XB 1ZXIA 2W3SA 1LTID 4JX1C 2IGHA 2KECA 1VZ8A 2W82A 3NXWA 3NS1A 3NBHA 2MGSA 1SNMA 1G2TA 3EFXD 3MHZA 4BWGB 1CZPA 3P4PB 4IFDJ 4Q0FA 5C0XG 2KAJA 2B2WC 5ELBA 5IGEA 2A6HC 3VR8B 1F9PA 4FYDA 3LNNA 1HHVA 4C56C 5LHY1 3SE0A 5I4DA 3E9SA 2D5DA 3MAQA 2AQ1B 1O7ZA 2K5QA 1SSNA 1FM0D 1MGSA 1BDOA 1IW7D 1HZ6A 2JU6X 1LO5D 1KFYB 3A7AB 3D6WA 4U68A 4JBWA 3P20A 1SBBB 5A2QL 4J8QA 4OHJA 4ZRZA 1PFBA 2EYOA 4O42A 4WURA 1H9MA 3M4YA 1TWFB 5LL6X 2R92B 1NCVA 1DM0B 5CBEE 3K5NA 2B2UA 4MH8A 1D1KA 3PIP3 1M4VA 2GA4B 1ZKOA 3KWVA 1EZ8A 5CYUA 3SK4A 4ODGA 4A3DB 3NVWA 2EPBA 3TMEA 1MVKA 4MT5A 3AB9A 3K5OA 4FXCA 1RF2D 1LTTD 3RD4A 2AX5A 2L55A 1U4MA 1LTSD 4R3DA 1EOTA 3OPOA 1FNWA 1GUSA 2WB1B 1ZPSA 1ICWA 4TMAB 1B9RA 3KLSA 1F2RC 2MJEA 3P75A 2AWOA 4X3KA 2ZT9C 4UDUC 4E6IA 4QUCA 1TIID 2A68D 4XQQA 3H94A 1UNSA 1SAPA 2KQ4X 4BBSB 4XYOA 4WAFA 4A55A 2J53A 2M19A 3TEWA 2KUMA 5M5WB 1R7SA 5CBAE 4RGOS 1YNND 5GXGB 2WNMA 3NUCA 5JJZA 5E6JA 3NTKA 4AYBB 1DOYA 5I9PA 2R61A 4YTPB 1BQQT 4YTNB 1HFNA 4OZBA 3U7ZA 1L0XB 5FO9B 3EGRA 3K7AB 1BOSA 2WV6D 1IGDA 4WQMA 1WCMB 2Z4HA 2B2YA 3Q23A 2FHTA 2H89B 2O5IC 3OWFA 1TWCB 2EYJA 2F0JA 3TP8A 5IGFA 3RPFC 3C1EA 1PFNA 2F0KA 2F0EA 3GD7A 4LMQD 5HG2A 1HQMC 3AM9A 2I2YA 4K6DA 3QWNA 3IT4B 1HUNA 5FO8B 1STBA 4OO1G 1YMHE 5IT9L 5C4JB 4B0MA 1D2BA 2WDRB 3TP5A 2QILA 1ET6A 2DBYA 1VRAB 3JAML 1GXDC 2PW5A 2PMVA 2DN8A 1A2TA 3A7LA 3K6OA 4C1NI 4CBVA 4B0EA 1FNVA 1QQRA 2NBFA 1E6EB 1KAAA 1WWTA 1K52A 1C78A 3OSOA 1YNTE 4DNRB 1FD7D 3T3NA 3FVQA 3DWMA 5HFYA 2WDQB 1MHXA 1S4ZA 2PIAA 1Q12A 1AYFA 1N5XA 1JROA 3PUXA 4TRDA 3MFGA 1R4PB 4V190 4HKQA 1XF5L 5EKLA 3FPUB 2DNEA 2XVSA 1WRIA 1PFMA 2CHBD 1BR9A 3AMZA 3KLRA 4KY6A 1B4OA 1CHQD 3OWEB 1M8AA 4R9WA 5EKKA 3U9OA 4FF3A 3VYSA 2F03A 2FMMA 2X69A 4X3SA 1WTQA 4PV1C 1FEHA 2MPMA 1XLPA 1C9FA 1DOMA 4XT1B 4BS9A 5BYRA 4OIJA 1I4PA 4XT3B 1WTRA 4JWSC 1FMAD 3NQTA 1ENFA 4N9PA 1BO0A 3G6JB 3CRLC 1O7LA 1WVLA 4BY7B 2KDMA 3WOFA 4DAPA 1Y8OB 1PDXA 1DJRD 3IAYA 3T4AC 3HOZB 3J9CA 2KMMA 2L32A 4C7ZA 1IKMA 1PMRA 5IODA 3U52E 1JR0D 3HS0C 3D4DA 1BMLC 2KEEA 1Z47A 2QCPX 1CHPD 4F7XA 5IOCA 3VYRA 3NE5B 4RF1A 3FILB 1OXSC 1QOHA 3J80E 3S1QB 1JW9D 3BIID 1VCIA 3A54A 1FXAA 3MXNA 5H8YE 1C4CA 4NP5A 2OXPA 1W6JA 1SYCA 2IT1A 5D65A 1PYWD 2E2JB 5JAVA 1SNOA 2F0GA 3I4NB 2F0OA 4KKIA 2JYEA 2BTEA 2XRSD 3GTQB 4IN3A 1YJIA 4Z9CB 4MIUA 2RDFA 4JWUC 2Y5CA 5CMDA 1WD1A 5J1ZA 3X3NA 2JEBI 2GI9A 4B08A 1STAA 2BW2A 2G9HD 1SE3A 1HZ5A 2XWBB 2KN4A 5HHDG 5I2XA 1MBYA 1MHHE 2R3ZA 1A2UA 4G7ZC 1C4QA 3U9SA 4K8JA 2B2TA 3GP7A 4HTHA 1QWYA 3ETRA 1I50B 1HA6A 4DU9A 5BN5A 3R3OA 3WOEA 3AE6B 5JEAG 4ZYSA 3KF8A 3I73A 2E74C 1ONLA 3E5SA 5KNBA 2X6GA 1TJEA 3P4SB 2PMZB 2V4IB 4A3EB 1AZQA 1V8CA 2PTLA 5EE0A 2IX3A 1SMYD 1PRTD 3SK5A 2SNMA 3Q0AA 3HOYB 5BMIA 3EA6A 1BUVT 1LV9A 1SE4A 1DZ1A 2JWUA 2A73B 1KNAA 1JWMD 4KKUA 2MP1A 3C46A 1OQRA 4IKGA 2EY1A 4IFDI 3FKIB 3U4EG 2N7JA 2MJDA 2N9LA 1L0YB 5K5PA 2JP1A 1GUOA 3W2DA 1B53A 2DYOA 2EXZA 1II3A 4EE2A 1EU4A 4KJNA 2BE5C 5LL6S 4LAAA 3NTIA 3PUWA 3L3OC 2PVGC 2RDGA 2D5GA 2RQXA 3NBIA 4QCLA 4HMIA 1EY0A 3VR3A 3EVQA 1PTOC 4WORA 2WS3B 3L7ZC 2O4XA 1D6EC 3ABVB 1DD2A 5JVG3 4CJ2C 2LUMA 3QOLA 4KKTA 1FIQA 4ZK9B 2K6AA 3A8KE 1W6KA 3M85A 1IGCA 4IUNA 1FD6A 2E3TA 2MHVA 3ZJUA 2RVLA 3I4MB 3TEXA 4IALA 2G1EA 3NZ3A 3MC0B 2ZXOA 3ZQ4A 1LT4D 4XE0A 3K58A 3V2TA 3AE8B 3N52A 3VR5A 4KTAA 2B2YC 2CW0C 2QSDA 1D4BA 2CU3A 3A8IE 2IX1A 5J39A 2F0FA 1EYAA 2F0TA 1RHPA 1C76A 1Q90A 2V0GA 2VB3X 1LTAD 2Y0SB 3I70A 3J81E 1GUWA 4ZHOA 3M4OB 1TS4A 3Q8EA 2X6LA 2E2DC 4L63B 2EE1A 1PTOF 4N9TA