1HA5A

Structural features of a zinc-binding site in the superantigen streptococcal pyrogenic exotoxin a (spea1): implications for mhc class ii recognition.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
218
structure length
218
Chain Sequence
DPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHAGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYLTDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDSNTSQIEVYLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords STREPTOCOCCAL PYOGENIC EXOTOXIN A1
publication title Structural Features of a Zinc Binding Site in the Superantigen Strepococcal Pyrogenic Exotoxin a (Spea1): Implications for Mhc Class II Recognition.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Toxin
total genus 56
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ha5A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ha5A01
1D6EC 1SE4A 1LTAD 1STEA 1TS2A 1S5ED 1EU3A 1SJHD 2NTTA 3BYYB 4DXFA 2WV6D 1S5DD 1CQVA 5ELDA 4O1NA 1L0XB 2RDHA 3O13A 2RDGA 4RFBA 1I4HA 1PTOF 4RGNA 5ELEA 1B1ZA 2J4XA 1TS3A 2SEBD 4RGOS 1PRTB 1DJRD 1RDPD 1PZJD 3R2TA 1AW7A 1KLUD 2R61A 1YN5A 1TS5A 4RH6A 1I4RA 1LT4D 1I4XA 1EFID 2G9HD 1ESFA 4K6LA 1EWCA 3BVMA 1BXTA 1SXTA 1PRTC 5D3DA 3BVZA 1CHQD 1HXYD 2QILA 3EFXD 1ENFA 4TSSA 1EU4A 1CK1A 1SJED 1PRTD 4DXGA 1LO5D 4RHSA 1PTOD 4UDUC 1PTOH 1BCPF 1G8ZD 3DWQA 1YN4A 1TY2A 5D3IB 1JQYD 1S5FD 1UUPA 1V1PB 1DYQA 2AQ3B 4L63B 1PTOB 1B44D 2XRQD 1LT5D 1BCPB 1FD7D 3DWAA 1XXGA 3CHBD 3SEBA 1ET9A 1AN8A 1LTRD 1LTID 1HQRD 1JCKB 2XN9C 1EEFD 1LTSD 1I4QA 1D5XC 1PZID 2AQ2B 1CHPD 3OWEB 1V1PA 1KTKA 2O2LD 4Z9CB 1PTOC 1T5XD 2AQ1B 1S5BD 1FNUA 1I4GA 1D5MC 3TSSA 1BCPC 1RCVD 1RD9D 1YN3A 3URYA 1LT3D 1PZKD 1BCPD 1SE3A 1CT1D 3R8BA 4RGMA 1ET6A 1JR0D 1SE2A 4RHRA 4ZYSA 3KLSX 3BYTB 1KLGD 5TSSA 3MFGA 5ELFA 4RGTA 1LLRD 1I4PA 1JWUD 2IPKD 3R2IA 1JWSD 1SEBD 2ICIA 1EEID 3BVGA 3EA6A 1XTCD 1PYWD 2QEJC 5I4DA 2NTSA 5FK9C 1RF2D 3MC0B 3GP7A 1QILA 1SBBB 1PRTF 1MD2D 3W2DA 4BWGB 5ELBA 1LT6D 2TSSA 2CHBD 2XNAC 1TS4A 1LTGD 4L6TB 3DWPA 1GOZA 1HA5A 4C56C 1HTLD 1FNVA 1M4VA 1JWMD 1FGBD 1LTBD 1S5CD 4RCOA 5FKAC 1L0YB 1LTTD 1UNSA 5ELCA 2IJ0A 3V05A 2Z8LA 3BZDB 1D5ZC 1V1OA 4NZLB 4OHJA 1TY0A 2XRSD 1FNWA 1F77A
chains in the Genus database with same CATH superfamily
3PUVA 1HH2P 1NBFC 1RTOA 3PRMB 3ULPA 1C76A 1T9HA 4JI2Q 4G0NB 4N9F4 3G4SA 2KN5A 2RDHA 1GUSA 5JEAH 3G7LA 3KUPA 3K58A 4PQXA 2AL6A 4IM0A 3VHTC 5HGTA 3H3VI 1STNA 2MLBA 3NELA 1Y56A 2RSNA 2K0PA 1X6OA 3AQQA 5JPMC 3CCUA 3UIOB 2B2TA 4C7ZA 5L83A 1UH6A 3KYDD 3T4AC 4E6IA 1BNZA 4YY3Q 2FE8A 3DEOA 1SDFA 1TS5A 1YEZA 4WJQA 4K14A 2Y0SE 1PUTA 2M9VA 4YCUA 3HVZA 3GQBA 4LFAQ 3M7NA 1C1YB 3PUWA 2RGFA 4XTCS 2WX1A 4HPLB 1TWGH 2AWNA 3CC7A 5IYBG 4UY8C 2JA6H 1IBMQ 2MBQA 3Q8DA 1K83H 1LV9A 3PSIA 2R2OA 4YTMB 4JI5Q 1NVID 2F0DA 2JEAI 1GJXA 3KLSA 2NBUA 5E3FA 1Y1VH 1GUWA 4ABNA 5AEKB 1RLFA 1CZWA 1G91A 4JLCA 4X62Q 2PMZE 5BMHA 3PRZA 4K81A 2I07B 1YN4A 4DFAA 2D5DA 2L9HA 3D8GA 3MAQA 1WTVA 2Z1CA 2NS5A 1JROA 3P4RB 2FINB 1J19A 4GOPB 2DZJA 1WTWA 2WX0A 1XWEA 3EN2A 1XNQQ 1MGSA 4MHEA 2JA7G 4M8NA 3U7ZA 3U8ZA 3SEBA 4DDGD 2CFMA 1K0SA 3A4SC 1OEYJ 2M1MA 5C6AA 5IP9H 2G4SA 2PVOD 3PO0A 1ZGUB 1V1PA 2FCSA 1YZ6A 4CJ0B 3MC8A 4ZK9B 2BBCA 3VH4B 2BOSA 1J5EQ 2ZEQA 2HDMA 3BK2A 4QUCA 5IGEA 3A5ZB 3T1YL 5LXHA 4DNRB 4P7IA 4P72A 4CYEA 1JALA 3PO3B 4CGYB 1L1OC 2AMCB 3W1GA 1SROA 3A0JA 3HOUG 4L23A 5M5YB 2MSED 4IPCA 5HG2A 4P6VF 4QIWB 1UGJA 2ZXOA 2RMMA 5KRUA 1PH5A 3GTMB 3MHBA 1WCMB 4EVOA 3M4OB 1PYWD 1G2TA 3D4RA 1XMQQ 3N32A 1S40A 5FK9C 1UE1A 3B9JA 3X3MA 5E6NA 4H7BA 2O2VA 2NWGA 5CV5A 4IUTA 4A3EH 4JI1Q 1GUTA 1X32A 2PQAB 4DK1A 1GC6A 2LGYA 1QWYA 3AN1A 2DLBA 3KWVA 1XLNA 3OW2A 2Z0DB 5JEAG 1G51A 2JWZA 2E2HH 2C60A 4DUZL 3NUHB 2HUGA 4TRDA 5AFWA 4A3DH 1SF0A 4HIDA 2AKWB 3U58A 1XCQL 3OSOA 3S1RH 2CW0C 3F2UA 2B63B 4GDLA 4B3MQ 3NP8A 1R4PB 2K8BA 4ZRQA 3C46A 3PIP3 4I65A 2UUAL 2RCFA 1F2MA 1LTAD 4K8IA 3TEXA 2JA6G 2B2UC 2QGQA 3ULLA 2NTTA 3ENEA 4WIPA 2WU2B 1XCTL 1WJJA 1C78A 4JI3Q 1TWAB 4JVZA 3PPAA 3X0WA 2Z9HA 4KHPQ 2A6HC 2A73B 1Y1VG 1HFGA 4O0AA 4HROA 3G71A 1ESRA 2W82A 1WTPA 2CHXA 2J4XA 2M2LA 1LM0A 2R92H 3S15H 4WJ3M 1DJRD 4B0EA 3ZO5B 4UAIA 2N0SB 5BR8L 4HMJA 3TRZA 3FMCA 4LDTB 4K3BA 3PUXA 4RH6A 4K7UA 4II2B 3K5LA 4WAFA 1GB4A 2DYMA 2WB1B 3M4PA 1K8RB 2K05A 4DV7L 5IWAL 3TMPB 2F0WA 1SE9A 4KK7A 4M02A 3NENA 1T3QA 4LCDE 4DQOC 4NKLA 1MSGA 3BVZA 5IP9G 2MNAA 3GTKH 2GBJA 2KA7A 3GV3A 4DXGA 4KGSA 1BF4A 1S72A 1LO5D 2WP9B 4ARCA 1PTOD 4ZRZA 2FNJB 5JZEB 3SHQA 1WMHB 1HZCA 3TP6A 4B9WA 3AECB 4PS8A 1U4PA 1SAPA 1E9MA 1FCCC 2EVBA 5JXVA 1DYQA 1UBQA 3VTWA 1L1OA 1EQQA 2MO0A 5IIFA 1F2ZA 2DYBA 2XGTA 4G7ZC 2L8JA 3TUOA 4PMWA 3PUZA 4GDKB 1JW9D 5C1ZA 4MTKA 3SDLC 5JHBA 4X65Q 4HK2A 4RKBA 1WTXA 1V97A 1QZEA 3CQZH 3HRZC 5KYLA 1MVKA 2VL6A 3OWEB 2ZTCA 4ICVA 1WJ6A 1PFMA 1KTKA 1H9SB 4IUVA 2RBMA 2IY0B 4ZYNA 4OVZA 2YU9H 4OZAA 3DWMA 1RFAA 4A3EG 2I0QA 1TVXA 1EY8A 3VA7A 2KC2A 4M8MA 5IYDH 1ACCA 3NZUA 2J0JA 1V43A 4A3CH 5LMNW 3AV8A 1KDBA 1MJEA 4DXAB 2L0TA 5CHVC 1E2WA 1CZGA 2H89B 3ZLZA 4KMUC 1FEHA 4A3DG 2EYOA 1SEBD 3KDFB 1I94Q 1HUNA 3RZFA 1PDQA 1XTCD 3PZ7A 1E22A 4NW2A 2B2UA 2M4NA 1NMGA 2EPBA 1F9RA 2PEAA 1V5OA 3GE3C 3HRDD 4KKUA 3HFZB 1K8MA 4AJYB 3NE5B 3HP3A 1WVLA 4J1MA 2BA0A 2WFWA 1TWHB 3J7AV 3WA0A 3NK9A 1VQPA 1GOZA 2MH7A 3SR6A 4DV3L 4FF2A 1HZAA 2L1AA 2VUMB 4TQ1A 2ZXRA 3APCA 1SNCA 2X6LA 2B8GA 2HJ1A 2BYFA 3VR3A 3KK7A 1JICA 2L00B 3KF8A 4GS3A 3T8MA 1AYFA 1QOFA 2MQJA 4MGKE 4N6EB 1NR4A 1NCVA 4DV5L 4B3RQ 1SE4A 4MELA 3LNNA 1YNND 4KN7C 1MPEA 4A90A 4FDBA 2IX0A 2VQEL 3WOFA 1JMLA 1LFDA 2IYDB 2OJWA 2EYMA 3MXPA 4R4OA 1K3RA 5C23A 2RDGA 1QKZA 3NS1A 3HS0C 1GXDC 4HVBA 1YNJD 2ZTDA 4A3MH 1WRIA 2SEBD 4YHHL 2KVRA 1PRTB 3TS0A 1MG8A 3HHMA 1A8VA 1K8GA 4QF4A 2BS2B 2JU6X 2KQSA 1E8WA 2KHIA 3K0YA 2Q8RE 2VB3X 3RUZA 2CWPA 5KYIA 1IGCA 3T1YQ 1I4XA 2MJDA 2KC1A 4BXXH 3PHWB 3I4NB 4EQ5A 4X66L 2D10A 1XNRL 5CHWA 1C7YA 1K3BC 4NDXA 1P9DU 2LHEA 5D7GA 1PMRA 1IHZA 3AE7B 5M3MH 2RVLA 4X3UA 4BY7H 3I5JC 2ATWA 1NDDA 1WTQA 1KLVA 1PTOH 2OXPA 3D6WA 4FXGC 2FFKB 2K5WA 3CD6A 5CC4A 5E7NA 5EKLA 1K8OA 3WALA 2IDYA 3K7AB 4W9DA 2K39A 1AZQA 2Q8TA 4A3CG 3VFKA 3S17B 4EOYA 5C4ZA 2JA7B 1NNXA 3DWAA 2E2IB 4DUZQ 5BMIA 4IWPA 2ALYB 4IFDH 3FAHA 2RHQB 3TJPA 4FADA 2Q2UA 4HSVA 4JI4Q 2NVXH 3LJ3A 2E2JH 3IFTA 3DBLB 4XQJA 1G6ZA 3NBHA 2BWFA 3GB1A 1WGYA 4M0WA 4YCVA 1C4PA 4B0MA 1UZXB 5HY6A 3CC4A 4DAVA 3OTOL 3ICEA 3U7DA 1WGGA 3VTUA 2ZNVB 4EEWA 4ZHPA 2JSVX 1AE2A 3LXFA 4P73A 1PZKD 2KBNA 2LHDA 2MWSB 3IAYA 1JWBD 2K01A 5IGBA 5KGUA 4IN3A 3QIJA 4TQ0A 2XWJB 1J6QA 1BVSA 2NUCA 3S1MB 3FP9A 1N9WA 2JY6A 3QWZB 4I6LB 4F1SA 1O7IA 2WAQE 1ICWA 3W1BA 1STAA 1CUKA 2PNRC 1JOQA 5GROA 1KLGD 1SRUA 3PZ8A 1LQBA 4JBMA 4PS7A 1U4MA 2CH4W 3HOUB 1VDVA 3TCAA 3R2IA 2WDRB 2EY1A 1KRHA 1ZXHA 2AYOB 4DNTB 2WHIA 2FUG1 1VQKA 3QB3A 1E2ZA 2CQAA 2C9OA 4A3BB 2LS01 4XC2A 1SBBB 1PRTF 3ZXRA 2ID0A 1U4RA 1NEKB 3S1QB 4FF1A 4X57B 5I6WA 1SYCA 1RYJA 4PYUA 2KMMA 5HI1A 4FBJB 5GAGC 4MSQB 3VVWB 2QF7A 2PE6B 1ZP0B 4IM3A 1HJPA 4A3MG 4DK6C 2LXCA 2HDLA 2F0KA 1KRSA 3RMHA 1WJNA 1ZDVA 2I38A 2H1EA 3CF6E 5J18A 4HEDA 5M3FH 3A9JA 3WAMA 2V1CC 2Z8LA 4PG3A 1ZXIA 3BG3A 3UDXA 4L5QA 1A3UA 1V1OA 1B3QA 1YNNC 4DR1Q 3AEVA 3C19A 2I5LX 4NJ7A 2KCNA 2FHTA 3PO2H 4BXXG 1HQMC 2OCEA 5CGKA 1C0AA 2GBMA 1TWGB 1IBXA 2B3AA 2V0GA 1EU3A 2JA6B 4ITKA 1YJIA 4AYBG 2ZJPA 3M3JA 4IUMB 4L2YA 2F0PA 1YNJC 2N3SA 4ARIA 5HHDG 2DWQA 2NPTA 3CPFA 4KSKC 1PFBA 4BA1I 5M3MG 2D2CC 2Q5WD 4RGOS 4BY7G 2DNCA 3W5OA 4YTNB 3N1ZC 3RMKC 4AWJA 1YNXA 3U9SA 3I55A 1L0VB 1Q5WB 4KJNA 3S24A 4P1CC 4RNAA 2EJFC 3KWLA 1LT4D 2RHSB 2GOWA 3P63A 3L4PA 5EE3A 4APVA 2F4VL 4PZ8A 4OEMB 2Y5PA 5DCNA 2C5CA 2WNMA 3A5UA 3H7SA 4YCWA 4IFDG 1SXTA 5CR3A 5J22A 1GG3A 1O80A 2QC8A 2WXFA 4YXDB 4PMCA 3TBIB 5IGGA 1E24A 1EU4A 2K8CA 3ML9A 4GN3B 2K5DA 2IO2B 1VQHA 2JYTA 1SIFA 4LF4L 2WINB 4HIKA 2NMQA 1A3VA 2BT6A 4OGQC 3VYUA 1S1QB 4UDUC 1VMCA 3BDOA 1H95A 4ZLTF 1BMLC 4B9KA 4YTPB 3ZJUA 2KEEA 2AQ3B 2MP2A 2WGSA 1VF5C 4AQYQ 1HA6A 3ZDTA 3ZW3A 3C2PA 1KM7A 4AIMA 4FJZA 4HWIB 1U4AA 1SNOA 4K5WA 1D1IA 1H9KA 2H5XA 1TT2A 2VH2A 3CHBD 4HJAA 1OEYA 1Y8NB 4V0BA 3J80E 1AZPA 3BINA 4IOCA 1E90A 1EEFD 5I2YA 4QQBX 1LXDA 2IY1B 1E7UA 4MIUA 4XQNA 5LNK1 2BA1A 3RZOH 1L1OB 3NHEB 4DV5Q 3DHIC 1T5XD 3DBLI 1I4GA 1RIPA 3SHLA 4KKTA 4LF8L 4KV2A 3V6EB 1DOXA 4JI8L 3G6EA 1JQ4A 2QEXA 1YVCA 1XQQA 2MRPA 1Z9FA 1C4CA 3A9KA 3QO2A 3R7RA 1EOVA 4QGUA 4DR3L 5DM63 1L2NA 1II3A 3CPWA 4JG2A 4YHHQ 4HSPA 2YEPB 1WSPA 4F8CB 2WLBA 3N3KB 1LLRD 1XO3A 1IYVA 2L0CA 1LTLA 5M3FG 4A3DB 3KJOA 2DZKA 4N8X1 1EEID 1QG7A 3S1RB 3J7AF 4PMBA 3EBEA 3TEZA 1F2RC 2EXDA 2CR5A 3PO2G 4X66Q 2NZHA 3C1FA 4BWGB 2LXJA 4C7YA 1FCLA 4X6AH 2DBYA 3T1HL 2RDBC 4NPNA 3H8HA 2BH2A 4QAYA 3ZQ4A 1E10A 3DWPA 1TKEA 3T51B 1X9NA 4K2KA 4DGZA 2MBOA 3RCZA 1M4VA 2L11A 4FXCA 2B3GA 2ZJQA 2Z6BA 3MWYW 1FRRA 2R92B 3S15B 5ELCA 1HNXL 2YVCA 3AB5A 4GZYC 2KDFB 1WXAA 2KTFA 4OL7A 5AUIA 2KOXA 1YJ9A 3U4ZA 1SFOH 2A6ED 3N20C 3TP8A 2EY6A 4EZJA 2XTIA 1L2FA 3RNFC 3Q8BA 1MKHA 5T8IA 1NI2A 1JMCA 3GTKB 5NUCA 3I90A 2NVUI 4RFBA 4JC0A 2J7ZA 2MHJA 4HXDA 3NWTA 2F0FA 3P20A 3OTOQ 1VQBA 2WXHA 3H1UA 1SB3C 1ZUD2 3UE0A 3MXUA 3DVNV 1XNQL 2OT2A 1C79A 4KZ0A 3RNBC 2B2YC 4A76A 4V190 5CBEE 4XQQA 3SVMA 2EIFA 5C3XA 1I4RA 3J80L 1TYGB 4ZOHC 5HKHA 3NVYA 4LAAA 4CQNA 2BW2A 1HR0W 3U9OA 1BBWA 3I3CA 3Q3NC 5J17A 2EXZA 2QILA 1HXYD 3JC66 2ZPYA 1ENFA 3NTHA 5G5GA 2BS4B 2I1KA 2LFIA 3CQZB 1DGJA 1KRTA 2VH1A 1OO9B 1BBXC 1S3SG 2VZAA 1WX9A 3HUIA 3GO5A 3R93A 3DBHB 1Q8IA 3S2HH 2YEPF 1J8CA 4BA2I 1IBLL 1KNAA 1P0RA 2NBFA 1CKOA 1W6JA 2N88A 2RPQA 2IBIB 3AXCA 2ONQA 3RULA 1I42A 2ZZPB 3F2DA 2F0VA 2F0SA 1ZPSA 4XYQA 1ZYRC 1WD1A 1JRPA 3IVFA 3HOYH 4RKLA 2KWVB 1V5TA 5BYRA 5AZGA 3FRPB 3M7GA 1EM7A 1XMQL 1IYJB 4GLVB 4DR4L 4LJOB 2A5UA 1WMHA 5KEEA 1UD7A 3M62B 1WFYA 3WANA 2DNFA 2D0PA 5K36G 2PJHA 1V80A 3KH0A 2INDC 4FHKA 5E6PA 5JJZA 4TKOB 5G3LD 2FAZA 5F2DA 4PZ6A 3D4DA 3QCAA 5C4XH 1Q82C 1SGHA 4GDKA 3URYA 1QNUA 3N1XC 5C5MA 1NUCA 1B9MA 1DOMA 4CKCA 2EZVA 3DVGY 4MEMA 4KY6A 1EUVB 3KW5B 4ZYSA 2JX5A 2HHHQ 3HOWH 4DV1L 4B3ML 1I6HB 1QT9A 2I2YA 2L1BA 4IZ8A 4TVAB 2KFKB 3PGEA 1ISNA 1I4PA 5I6YA 3CCMA 2IGHA 1IW7D 5DPRA 3ZJTA 1KH0A 4YSXB 2CKHB 5D14A 4R8NA 2NTSA 1AARA 5ELOA 2PPHA 1VQEA 2E75C 1K8AC 3PIPA 4GLSC 2QDFA 5C3WA 3MA2B 3AE5B 1QILA 5D65A 2LUMA 2JEBI 3Q8FA 2BYTA 2LMCB 1RL2A 1Q1EA 2EMTA 2KK8A 2CJOA 4GKKL 2A4ZA 2UYZB 2WXLA 2F0OA 3DLLA 3KDFA 3E9HA 3OJ3A 3J7A5 1C9OA 1EYGA 4L8JA 4A3MB 3AH7A 3L7ZC 3K57A 1E8YA 4W9HA 2IJ0A 1JORA 3Q14C 3V05A 3D0FA 3Q6SA 4W9CA 3RNAC 2EELA 2A6EC 2F1MA 1SYFA 1D7QA 2WQYB 2VW9A 4NZLB 2R7ZB 5DEHA 5IGFA 1PVOA 3JAML 1KOTA 2QJLA 4A3GH 1N5WA 4QY7A 1JJCB 4AYBB 1HFNA 2RQXA 1ROEA 2N4FA 4R1JA 1N32Q 2KDEB 1HZ9A 2FJ2A 4IOAA 2A68D 4LF8Q 1SLJA 5M3MB 3RZWC 3BS1A 4BY7B 1IBXB 4JI8Q 2J0TD 4DUYL 4A3KH 4L5TA 1N60A 4DHJD 2SDFA 2K28A 4AH6A 4C4VA 3EFCA 3J7ZC 5EBDA 4DR3Q 1C4AA 1XLOA 2M56B 1N36L 4K6LA 1WI0A 5KNDA 3HOYG 1TJEA 4DR6L 2NPTB 2KHWB 2V3NA 4XYOA 3EGRA 3VQIA 4E71A 4EFOA 1D8LA 5D3DA 3CP0A 3EFXD 1RJTA 2Y0SG 2G9DA 3TZDA 4JI6L 3TEHB 2KWUB 1J0GA 4FNFA 2NVXB 4CO7A 2B2WC 4GKJL 2E2JB 4IJHA 2JK8A 1MG4A 1ZKHA 4B6WA 4BZAA 2I1JA 4ANXA 1WY8A 4DKAC 3ZJYC 5FLXc 4ZKCB 4A3FB 5C4XG 1C9FA 2JP1A 4NPSA 1BCPF 3DQVA 1UF0A 3DBHI 3T1HQ 4S0RA 4TUUA 4FA6A 4YL8A 3I8ZA 4OO1H 4IFDJ 2LEKA 2PKOA 4BKSD 3I57A 3RN2A 1I94L 2KD0A 4DHZB 4ZCKA 3HOWG 2LY7A 1YD8U 1HTPA 3TMEA 4WQOB 4A20A 4ANVA 4K5XA 2PPBC 3PT2B 1XD3B 2EQSA 2WXRA 1HNXQ 2R6GA 4B3SL 2BE5C 3AI5A 2L52A 1DOYA 2XN9C 4BBRH 3KYHC 3EC8A 4G50A 2JXMB 3I91A 3CF5A 4LK0M 2MP2B 1AFPA 4JE3B 2F3WA 1C8CA 1Y8RC 3ZNZB 3I72A 3VA5A 2G45B 3CMEA 3RNCC 2B29A 3HG9A 4KLKA 5D6JB 1YJWA 4EKUA 5DPTA 1XT9B 2R93H 4MGIE 4JK1C 3IAM1 3I4MB 3KLSX 2CU1A 4RMAA 4WWNA 4PV1C 1E7VA 1IW7C 2BKFA 3Q8AA 2EKIA 2WXPA 4HDQA 1ILQA 5D94A 4HKQA 5M3FB 4B3RL 2M19A 3R3MA 3EA6A 4XX5A 3NY5A 2K9XA 4OVVA 3A9KB 3RNUA 2NBWB 1QVFA 1Q10A 1JT8A 2LWPA 1P98A 3PO2B 1FXIA 1ENCA 4K7WA 3RLOA 3RFZB 3UDFA 3EVQA 2KENA 4NXML 2JXXA 3IT6B 4A3GG 3LB8C 1I35A 3SXHA 4IDIA 2TSSA 4MN3A 2CHBD 4JBJA 1LTGD 1HA5A 1VF7A 3CCJA 2IGGA 1LUZA 2PMVA 3SK4A 2QCZA 3VUXA 1HTLD 3GTJH 3APFA 5H8YE 4YSZB 1IBLQ 3ZKJC 4A3KG 1UNSA 1E5WA 1JE4A 2RPVA 5G55A 1YQ3B 2CH4A 2OEOA 5J3BA 1TZ1A 3FKIH 1SE8A 2WIIB 1CA5A 1UE6A 4FO2A 1MFWA 2PLPA 1GJZA 1EIFA 1AWDA 1H4RA 2DHZA 3RN9C 4W9KA 1A15A 1S5ED 4DR4Q 2HJ8A 2JJQA 1OTRB 5JAVA 1L6VA 2M0AA 2ZJDA 2EDGA 3Q3MC 1MIUA 4QB4A 4A3IG 2EMSA 3BK1A 4GN1A 2IHEA 2CU3A 4USAA 1H9RA 2UUBQ 1DXMA 1UAPA 1K51A 1MI0A 2JRHA 5IOIA 3A4RA 5IN7A 4F87A 5IYCH 2BGFA 5FO7B 1CJEA 2HD5B 4XDCA 1P7FA 3HVDA 2MHVA 1Y1WH 2EYHA 4GLAC 1S3OA 2V3PA 1SYBA 4OW0A 4R4QA 4OO1G 1DONA 2INPE 1QQRA 3CW2C 2J52A 1JOKA 4JI4L 2WKCA 1RODA 4DV1Q 1K52A 3QARA 4GB9A 4RM8A 4ZRKA 3TL5A 1VQAA 2QHOA 1IGDA 3OJ4B 4OZBA 4WURA 4X3SA 4S17A 3HOZH 3VXWA 1VQNA 2K1BA 4BBRG 1VQ5A 5GXGB 4JPSA 4IFDI 4P1BC 1XPRA 2K1FA 3QOLA 1WXQA 3RZOB 3IL8A 4ME3A 4P74A 1DOKA 3CIRB 4CDEC 2W55A 3NVVA 4A3PA 4ACFA 4KZCA 2HDEA 2V4DA 4GKKQ 3L0OA 1XYIA 1UUPA 2JT4B 5L37A 1WXSA 2JA8H 3ZTCA 2EY5A 4US8A 4WJWA 2R93G 1PYSB 1EY4A 2E3TA 3B08A 3A74A 4CJ2C 4BBNC 1WM2A 1K53A 5CTRC 1ET9A 2F0LA 4YWMA 4AOFA 1LTID 4A8XC 1FD6A 1PH9A 1VQ6A 4POGA 3PREA 1PZID 5T1IA 4M01A 3TN2A 5IA7A 1V1QA 1F9SA 1QZGA 4HRSA 4I6PA 4EX5A 1EIYB 5FR6A 4G11A 1WOCA 4B08A 2AQ1B 3H6NA 3TSSA 4NY0A 1D5MC 3N9YC 3VDYA 2PTLA 2WYQA 3APDA 1J7BA 5DPSA 3IKJA 4DAPA 1KAAA 2JE6I 4A3JH 5AZHA 1OQQA 3Q22A 1A63A 1X3PA 1JR0D 3WOEA 1F1HA 1V49A 1CSQA 1SE2A 3I3TB 3VH3B 3FEWX 1R4NB 2HD3A 1VDZA 4KJOA 4K2LA 2DX5B 2VZKD 4DUYQ 1P3QU 2X69A 5ELFA 4RGTA 1ZEQX 1UWVA 1TWFH 4DR1L 3MHSD 4IC7B 5BMGA 1PV4A 3NG0A 2RCNA 4BBSH 3FKIG 3GDEA 4MSMB 1N36Q 4MGZE 1RF2D 4DR6Q 4K8JA 3W1SC 4RG1A 3ALBA 4YSYB 3UQAA 2IY5B 5K5PA 4DV0Q 1NTGA 1MD2D 2K5VA 1BBUA 4JI6Q 4C80A 1F9JA 3I9V1 4WJ4A 1YITA 1TQOA 4GKJQ 4GIVA 1FPYA 3G48A 1N62A 3GS2A 1EIHA 2NR2A 1V8CA 3K81C 5IYCG 3O65B 5FKAC 2ZJRA 2L76A 3AYHB 1FIQA 2E76C 3RLNA 1Y1WG 2D62A 4DWFA 4MACA 1OXSC 1WYGA 2GLSA 4MDKE 1QOBA 2BVCA 2DN8A 4DR5L 4DR7L 3GTGH 2PW9A 2IPKD 5CHFA 5BN3A 3T3NA 5GADC 4B3SQ 1T0QC 4WRDA 3HOZG 4JPBW 2NBVB 2WDQB 2L32A 1RAXA 4HJGE 2O5IC 2JA5H 1BDOA 4KN4C 4H2AA 4X3KA 4LF6L 3VYSA 3KFUA 3OG5A 1E0ZA 2GVBA 2NZOA 4AQYL 1VQOA 5IODA 3S2HB 4N9TA 4LF9Q 3L54A 4WJOA 3PQIA 5E4XA 5FLMH 4BOZB 3TS2A 4C3IB 3Q8CA 4LFBQ 4XWWA 3SGIA 1Y8OB 1VCIA 2CWAA 4REZA 4R4IA 3ETRA 2JA8G 2MJEA 3LX0A 1OGWA 1V81A 1B2TA 1U5KA 1P16A 3DEPA 1BQQT 1Q8KA 2IW3A 1NYQA 4BKGA 2IX3A 2HE7A 3J81i 2IGDA 5C44B 1MHWC 1TIID 2F0UA 1CHQD 1P7EA 1WR1A 5CV4A 2OTLA 2Y0SB 4H44C 2G5DA 4C4VB 1V2YA 2AX5A 4JOIC 4DK3C 5C0XH 3CKIB 1Z47A 5M5WH 1O7ZA 4RHSA 2WXJA 2A74C 3NVWA 3OAWA 1Q86C 2LJIA 3FILB 3QAQA 5E4WC 4NXMQ 1X3GA 5DAUA 2BB6A 5C4XB 2DAJA 3ER0A 3MVVA 3RZDH 2KCCA 3NQTA 4I6NB 3Q3FA 3RUIB 2X6GA 4A3JG 1WXVA 3L16A 1HE8A 4R9WA 1SMYD 5EE9A 2LXAA 5TR5A 2BB5A 3H7PA 1FM0D 1A0IA 2M17A 2PMZB 1FD7D 1VQCA 2K14A 2PW7A 4YWKA 4HIMA 3HOWB 1WGRA 2LGIA 4LLGM 1W2BA 1XXGA 5T1GA 2A5HA 3UE1A 3TP7A 4DF7A 1KJTA 4G7HC 3T9LA 1PH1A 1C48A 1SSNA 1I4QA 1WTOA 1ONLA 2KMCA 3EHVA 3VR6A 3W1SA 2IWHA 4BBSG 2KJ6A 1PTOC 1VLBA 2ZT9C 4FF3A 4A3LH 4OIJA 2F0QA 4POFA 4TMAB 3KBXA 1SE3A 2JZPA 3GTLH 3DM3A 3VUYA 2KHJA 2YTXA 1PQSA 3V60A 1QUQA 3VDZA 3KBGA 1YJNA 4PZ7A 1XTDA 2MBHA 4W9FA 1EY6A 1F2RI 3CCQA 2AEHA 3J81E 3ITPA 3MFGA 4JL9A 1RWSA 4NQKE 4P16A 1R4NI 5LLIA 5KIXA 3PV0A 2F0GA 3DHHC 3M9BA 1RHPA 1T5EA 2LRWA 3MP9A 1CMXB 2QEJC 4HEA1 2WAQG 3HEJA 3K5MA 1EY9A 2KLGA 1BR9A 4I7AA 5JJKA 1QNKA 2HT1A 3GE8C 2VB2X 2MJ8A 3K59A 5IT9E 3DHQA 2KFKA 2B2VC 3L08A 3RI7C 4LNNA 4C3JH 4DK0A 4BOSC 3T53B 3KUCB 2KTRB 2Q8IB 4HDOA 1LABA 2JA5G 2KJXA 4HPMB 3R3OA 2F52A 1VQ4A 3BJUA 3S1NH 2NVTH 2INCC 2K3UA 4A3KB 5FLMG 1K0RA 2ZVOA 1PLFA 2FCNA 2I5HA 2LMCA 2O6VD 2KEDA 3H6MA 2C7HA 2QSDA 5D2MB 1SN8A 2NYZD 2XRSD 3ZIMA 2BQQA 3AEDB 2QCPX 3CU7A 3V61A 3EFUA 3H0GH 1G6PA 4U68A 2JPHA 5IGDA 3GV6A 5C0XG 2KN4A 2LUEA 4LDTD 2KOLA 4XDDA 1VQFA 1TT5B 3TBLD 2HTME 3QHTA 1CA6A 5EPKA 3LYYA 2UUCQ 1F2LA 1PZJD 2KT7A 5IP4D 1YHAA 3ONAB 4DV6L 1A62A 4LNFA 4N8FA 2M00A 2GB1A 3E3XA 3KQ4A 1WYDA 3HKZE 2PZTA 3AMZA 3NOBA 5EE0A 3AEAB 4KV6A 4KI0A 3A56A 4K5VA 1PA6A 3SK8A 1CK1A 1KNEA 1K83B 2N1VA 2WP8J 3CC2A 4A3LG 2UXCL 2AL3A 3J81L 1Y1VB 5IGCA 1E0BA 4LK1C 2E2DC 2HHHL 1SMYC 1JQYD 2M8SA 3OPOA 4TQUS 1HEZE 3B2FA 1B70B 1WI5A 4FXDA 1WXMA 3RNEC 4EQOA 2R93B 1IYFA 4O2DA 3ZXVA 1WRDB 1FVIA 1VQMA 3Q69A 3PTFC 5LXIB 3D32A 1KAWA 1PH8A 5IT9L 2MP1A 5CV8A 5CORA 1CHPD 2ZM6L 3PMFA 2O2LD 4DR5Q 4DR7Q 3ZYYX 2C7MB 3IAS1 3P42A 3M63B 1KF6B 3KLRA 1FYCA 4KD3A 1X3FA 3QOJA 3CSFA 1XJVA 3LWEA 4N59A 3UF8A 1V9PA 2BTEA 1WFQA 4FXKC 3ZJVA 5A2QE 1QOHA 3VR5A 4C3JG 4C2MH 2B76B 2QA4A 1QZHA 2V4LA 3JYUA 3OOCA 5M5XH 3M3YH 1O7LA 1RFKA 4LF6Q 2KFJA 1K73C 1UEBA 3DXJC 1YJJA 3GTJB 4OX9Q 1WCMH 2L4NA 5C3EH 2NB0A 3LWUA 3M4OH 4MH8A 3DDCB 4WWOA 4FJVB 5COYA 5H92C 3DPDA 3ULJA 1PGBA 3GTOH 5EBCA 2KQ4X 2KZRA 3TP5A 3JW0X 3CMMB 3OHXC 4DPGA 3MC0B 3GP7A 4CDCC 4GN5A 1N32L 1OFFA 2QDBA 5ELBA 3H0GG 1MBYA 3MJ5A 1I3QH 1QVCA 3K7UC 4DA2A 3Q23A 4A3EB 3EQLC 2CHZA 4W9IA 4M1UB 2JWUA 5G2NA 5AZFA 3AFPA 4RCOA 2BCOA 2J53A 1K50A 5I9OA 2RSOA 1L0YB 2NVQH 3GTPH 2MGSA 4G57A 1Y8PB 2GVAA 3X3NA 2KO3A 3VR8B 1FO4A 2PZWA 2PI2A 3FDTA 2E2HB 1QVGA 2V4IB 1GKHA 2EJGC 3K9PB 1TXYA 4JI7L 4DHJB 3H15A 3NZ3A 2RKSA 4RAUC 3A7AB 1YIJA 5ISRA 3S2DH 4AJWA 2PCFB 2E8GA 2BH8A 1EQTA 1EZ8A 5K36H 3SU8X 4DXFA 3S9WA 1S5DD 5KHQA 1PH2A 4ZUIA 4DHZE 3HOZB 1STYA 3Q0AA 3IG3A 4QMGA 4RGNA 1TBEA 3BZCA 5EPJA 3RR5A 4J8QA 4IURA 1LGRA 1OXXK 2LVPA 3W5VB 5EPLA 4KIKB 2MW5A 1RTNA 3UI3A 4P75A 1Q12A 3N52A 2G9HD 2JA8B 1TKYA 2K5QA 2Y5CA 1WZ3A 3GTQH 4KKIA 2F3IA 4OO1I 2BKRB 4HJ9A 2XWBB 1BXTA 1VQ7A 1YQ4B 2QMTA 3AE9B 4TSSA 1B4OA 1GUOA 1UELA 4HMIA 2XIWA 1VQ9A 4CDFC 5A2QL 3ZRFA 3AEEB 3L0WB 5GMVA 1ZE3D 1Q7YC 3B6YA 3E6ZX 1A3TA 4ZRPA 4G4KA 2ZXPA 2MUYA 4RWSC 1VZ6A 3TEYA 4UP9A 4NP5A 3M85A 3M4QA 1RM6C 5BYQA 1S5FD 3P7JA 1L4DB 4IWQA 3QK0A 4A3JB 1KFYB 1YQBA 4GXBA 3CWIA 2QDLA 3TDQA 5KNBA 4KY5A 2N8NA 5KNCA 2L0FA 2N1WA 2N9PC 1PH4A 1WCMG 5C3EG 3MTNB 2YTVA 4BKTA 4JX1C 1TWFB 3PF5A 3ND8A 2JQRB 3ABVB 2MQHA 1VD2A 4DR2L 1LTSD 1HNWQ 3EROA 4BBSB 1N6ZA 1CKNA 1TIFA 1Q1BA 1ZOYB 1FNUA 1GNUA 1R4MB 3H7PB 1JB7A 4KD4A 4EQNA 1T6BX 1RD9D 2VXWA 1QLBB 2HTHA 3VRAB 1NJIC 1J7AA 4PNYA 4QIWE 2YU9B 1CT1D 4KX6B 1QOAA 3PS6A 4I7ZC 2F0MA 2KACA 2F0JA 1VJKA 1D3ZA 1QJOA 3PGZA 3ZNID 4NAMA 5JPNC 1NR2A 2BYVE 3STBD 3QG1A 1NSNS 1STBA 1IBKL 3SK5A 2BDNA 5JOBA 2Q2TA 2ZCBA 3VR9B 4TV3A 1DD2A 3RYTA 4DV6Q 5JHAA 4WWMA 2C9WB 5I4DA 2WAQB 1KC8C 4KGTA 1QUQB 1J8IA 4LUOA 4JI0L 4EE2A 1E7ZA 1N61A 4IO9A 1TKGA 2UUBL 4Q0FA 2BF8B 2RD0A 5C4JH 3PVLA 2VUMH 3HM3A 1TS4A 2DY8A 4DV2Q 3QWNA 4LNOA 1N8RC 2V1YA 1KABA 1OXUA 1PHJA 1Q81C 2JA5B 2UXCQ 4CJ1B 5FO9B 1JWMD 5HGQA 1KXLA 3AULA 1JRUA 3CCSA 4WFN3 2IX1A 2KDIA 4CHTB 1FL0A 2QKIC 1EF5A 4PT5A 3BZDB 3S14H 1GAQB 1N5XA 4M8AA 4LMQD 1TY0A 4BBNF 2CVRA 3J9CA 4XWTA 4F8MA 3DBSA 1U9RA 1UBIA 4ANWA 1F9QA 1OXVA 3WAOA 4O1NA 3AFQA 1BUIC 1WYWB 4P71A 2ZM6Q 2YV5A 1XMOL 5ELEA 5MPOA 1B1ZA 2EJMA 2V3SA 2WB1E 4RM9A 1TS3A 4A6QA 1SYDA 2V9HA 2B2TC 1EY0A 1L4ZB 1QCBD 1EYDA 3RZDB 1YN5A 1SIJA 1O7YA 2B2YA 5FO8B 3T56B 3I4NH 1IP9A 4HLEA 3HIZA 4A93H 4NJ6A 4J6HA 2JSOA 1MJCA 1GC7A 2DJFC 2XVSA 4L5SA 1L7YA 5C0XJ 3J80c 2AUKA 2FMMA 3UINB 1ASZA 5J1ZA 4IM2A 2A69D 1MHXA 4J15A 2N7JA 1E8XA 3C8YA 1TU2B 2LRUA 1CTMA 4LFCQ 4G3XB 4GGQA 4CKEA 3HOXH 1QOGA 3K7AH 3BDCA 2R2QA 2E5LL 2UXDQ 3QIAA 2GN5A 2KDMA 3UGBB 1PTOB 2DENB 3Q8EA 4MZ9A 2LJ5A 1EIGA 4FYDA 1T0RC 1G6JA 3U4VA 1C3TA 1OQRA 4ZKBB 3FILA 1ASYA 2AWTA 3LDZE 2C7NB 2RA4A 1DGSA 4IG7B 1JOOA 2VZKB 3VAWA 3TEWA 1D5XC 2AQ2B 4DV0L 4JI7Q 4FHJA 2P5ZX 4O42A 2KKCA 1MJDA 4A3IH 2IZVB 3R7QA 4DN4M 4QJFA 2ZVNA 2IL8A 3OW7A 5EKIA 3H94A 3ERQA 1KDCA 1R4MI 3NS8A 2VUMG 3E0JA 4JIOU 3DMUA 5AJ3L 1XPOA 3OIPA 5IKCM 4QUFA 1WTRA 3STBC 3MJWA 3RLFA 3NTKA 3V2TA 4XDXA 3U30A 3AB9A 2MX2A 3IXSA 3NJTA 4II3B 3S1NB 2NVTB 1VQGA 2CW0D 4FLHA 1X65A 4A3BH 1TTNA 1ENAA 4A9AA 2K50A 2FCMA 2WS3B 2K4KA 1SNDA 3S1QH 3A8JE 4J6IA 1N63A 4PYZA 1JJGA 1SR3A 3A1QA 5GQOA 1HNZL 3RN5A 4C3HH 4ZHOA 2WKDA 4Y7NH 2BDOA 5KHOA 3H0GB 2A1AA 4MNOA 4LF9L 2A6HD 2IO0B 3ZRCA 4LFBL 3DBRB 2OF1A 4K7SA 3BIID 1ILPA 1YJ1A 3I56A 3OLMD 1EYCA 2EOTA 4ULLA 5I2XA 2LGXA 1Q90A 3GOEA 1LTTD 2I5MX 1HRJA 5FOBB 2E74C 2XBBC 3I4NG 1VRAB 4A93G 2KYWA 2SNMA 3EUB2 4ANUA 1YBYA 3UI2A 1FFUA 2KTRA 2MFIA 3JSVA 1MHHE 2RDFA 2YLMA 3B2GA 3F2CA 1CSPA 2K5HA 2FIDA 2IO3B 4MJSA 5E1FA 1STGA 2CCZA 3UQBA 4HJ7A 1WD0A 4NAWA 4DR2Q 5JJIA 3O13A 4GLXA 3C3LA 3JAMc 2K6DB 3UDIA 1PTOF 2WXKA 4L1BA 1WJUA 3HOXG 1CM9A 3U50C 5C0XI 3TZUA 3PLVA 3U4EG 4AQ7A 2K5NA 3I63C 4W9GA 4J3OD 4YWLA 3D6CA 3CMAA 3RD2A 4HPPA 1IZ6A 3CRKC 1TWCH 2KAJA 3QA8A 2A69C 5CX3A 2HCCA 3ZGZA 3WWVA 4OXPA 3D31A 3RNGC 3W3AA 1GUAB 2B8FA 4XT1B 4LJPB 1IBKQ 3NEMA 5C5LA 4BAXA 2EE1A 2EYJA 4X64L 3A54A 3J7YW 2WXGA 3L2PA 2DNEA 3FPUB 2D3AA 2MO1A 4DDID 2B2WA 1V6EA 4IOIE 3U2SC 3P1MA 1MSHA 4JI0Q 2A68C 1BO0A 2DJGC 4OONA 5IP7H 5LMNL 1X1MA 3DHGC 4CDDC 4K6DA 5JVG3 1TY2A 4XT3B 3NXWA 1WWTA 2FBWB 4E74A 5H1SE 1MI2A 3Q24A 2GRIA 4L63B 4C2MB 3KUZA 1LT5D 5M5XB 3M3YB 1HTOA 1XEEA 2K8HA 4K1RB 3HOVH 2K04A 5C3EB 3PIO3 3A7LA 1TZOA 3IT4B 4HJKA 1G291 3MHZA 4A3BG 1DCZA 1V86A 4Q2JA 4ALPA 3GTOB 4Z9CB 1GPXA 1U4LA 1GM5A 4A55A 3EJIA 5EDSA 3FPPA 1FJGL 4U673 3P1HA 1YN3A 5EQ0A 4C3HG 2H88B 1BCPD 3AM9A 4ME5A 2XK5B 3MEHA 4NB3A 1TR5A 2Z0SA 1BKBA 1E8ZA 1I3QB 1XMOQ 4OVUA 4N9PA 1IXRA 4RA8A 1EZ6A 4LUZA 3BYTB 1CKNB 3V62A 4HCEA 4XGAB 1TKWB 5EGTA 1YX6B 2ZW0A 3VUWA 3GTPB 1D1KA 1OTCA 2NVQB 4EZLA 2D3CA 5C4HA 4MT5A 2H4OA 2PNHA 1NI3A 2ICIA 1GB1A 3K9OB 2SNSA 2ASQA 4ZRIA 4OWXB 1X3EA 2O6VB 3RD4A 4WJPA 4JBKA 1EY5A 1KL9A 4BY1H 3S2DB 2HQEA 2KHSA 2VS1A 2Z4HA 2D3BA 3W2DA 4IWOA 5G5HA 4OWTB 1ZXTA 4URKA 2UU9L 2G3QB 1IYUA 3QQ8B 1IKLA 2C5LC 4AUQC 4KTAA 3T13A 4ID6A 1PDXA 2NN6H 3NPPA 1ZW7A 2UUCL 4RF0A 2D0OA 3ZNGC 1A70A 2K52A 2VQFL 3AE4B 4KDLB 3DBRI 4DNIA 4RMFA 1X56A 2E5LQ 5JVH3 2JVCA 3SDZA 4FJYA 3SFDB 3SK6A 4JCVE 4WH4A 3UDGA 1FMAD 2D2QA 3DM1A 1YMHE 2GBRA 3C0RB 1D6EC 4IPHA 3GTQB 1IUEA 4F7XA 1EWYC 3DVGX 3TIXA 3D4WA 1NMFA 1UEAB 2K32A 5DPWA 5EKKA 3NWSA 2WV6D 4GMVA 5ELNA 5I9PA 1SFOB 2TMPA 2REXA 3KYCD 2N9XA 2ACZB 2PE9A 3FHWA 2VY3A 1WH3A 4LF5L 1M94A 3MXNA 5IP7G 2NVYH 3E5SA 4WORA 3IFWB 1QF6A 2KVMA 4KHVA 1VQLA 2RF4A 3F8TA 1F2YA 3R2TA 1AW7A 1KLUD 4YWGG 3K80C 3K6OA 5BN4A 3Q6BA 3V6CB 4M00A 3H3VC 5AJ3Q 4JYAQ 2O5JC 1EFID 1X55A 1PH6A 4LF7Q 1IL2A 2N49A 1VQ8A 2MA9B 3MC9A 3HOVG 2LASA 3BVMA 3S16H 1E6EB 1W6KA 2AWOA 3ECIA 2YYZA 3H3VH 2LGDA 3WAPA 5CV7A 4L5RC 1Z2MA 4KIKA 1PH7A 4C1NI 4DAYB 3ONSA 2OHFA 5HURA 3AE3B 1OQYA 1J7CA 2L12A 2L55A 4YT0B 4BFRA 4K0KL 3RPFC 3KJPA 1HNZQ 4NJCA 1G8ZD 3E0EA 4MH0E 4BKSA 3E9SA 1NY4A 4OX9L 2JF5A 1YI2A 4GNXB 4RCNA 2HCIA 4JV5L 1NENB 2LZ6A 4NQLB 1I7HA 5LMUL 5C2TB 1AN8A 1HQRD 3HOYB 3I4LA 3S2AA 1R9TH 2D11A 3KOJA 1YNTE 3EECA 4JWUC 2EY2A 2L7RA 2CHWA 3KF6B 3A8KE 4G7OC 2ASBA 3NHHA 2N55A 1S5BD 2WACA 3GD7A 1K9MC 3AU4A 1BCPC 4JBWA 4BY1G 2QIEB 3LGJA 3VR4A 4B3TL 1WE7A 1WX7A 1U0LA 2XSCA 5IOCA 3DWGC 2VNUD 4D2KA 1LT3D 5BO4B 5C4JB 1NBWA 1I6HH 1P8LA 1JE5A 2AHOB 2K75A 2NN6G 4RHRA 2R92G 1PGAA 2E6XA 1L5PA 3BU2A 2WXNA 4K3CA 5DLQE 5A35A 4WQMA 3P2BA 4KKJA 4HR7B 2KQ3A 2LD9A 1BOSA 1SNPA 3S14B 3HK0A 1KIXA 1VZ7A 1SYGA 4A4IA 4R3DA 5E6JA 4ILWA 1I50H 3D3RA 3G6JB 3PLUA 4X64Q 4WJNA 4DV4L 2DZMA 2JQOA 2FXQA 2K22A 2NCNA 1X54A 4DAMA 1PFDA 3B0AA 4FN2A 2K5PA 2R7DA 5LMNQ 4GSWA 1FNVA 3P75A 1LTBD 1FGBD 3K5OA 1KD1C 1T0YA 4R4CA 2OWOA 3A1QB 1OXTA 2GMIC 2R7ZH 1UGMA 3P4QB 1GUNA 4XE0A 4W9EA 2INNE 2WXMA 1D5ZC 2JXTA 4A93B 2LFNA 4OHJA 2KLCA 2WXIA 3EIVA 1LYLA 3QJYA 5GAEC 1LM8B 2WXOA 3RT3B 1HTQA 1SJHD 4EQPA 1O78A 3OMGA 1UE5A 2JZZA 3CCRA 2G1EA 2KWCA 4JWSC 4FULA 1HPCA 4IJLA 5EJWA 1SNQA 3PUYA 1M90C 5JH5C 1IKMA 4A3GB 5LHY1 1HCZA 1EQRA 2KX3A 2DUDA 2W3RA 3SFEB 3DOWA 4GNXC 1FJGQ 3L10B 2PYKA 3HOXB 3JSVB 3T16A 4ZUJA 5IYDG 2Q2IA 2EYPA 2BYEA 2UXBL 4MJSB 4LW1A 3IBEA 1F9PA 3AE8B 1VCBA 3QR8A 3H9DA 1F52A 4NAWB 4XXEA 2F4IA 1Z7TA 3HM6X 1ESFA 3NTIA 4UHVA 2MPMA 1WIAA 1UWMA 2KMAA 1C77A 2PZUA 3TREA 1HNWL 4MM3A 4KGRA 2EYLA 1GD7A 2LVQA 5EE1A 1EQVA 3ZDMC 2MJ3A 2BS3B 1BUVT 3Q3OC 2UUAQ 1EUJA 2FMCA 3F1ZA 4NMZA 1SJED 2Q2HA 2QW7A 2SOBA 4JOIA 4A3FH 5CV6A 5J39A 3HKZG 3P4SB 4A3IB 3PRPB 5M9OA 2D5GA 2L05A 2N9LA 1EWIA 1EL0A 2KVZA 2ES2A 3QX1A 4C1NK 1N34L 5D3IB 2UU9Q 3IFDA 4IUQA 3VYTA 2FIFA 2KQ7A 1V1PB 3PSEB 1GHKA 4ICUA 5BYSA 2F0EA 5BR8Q 2VQFQ 2BPSA 2JUOA 4ZRJA 4LUVA 3KUDB 4YIJA 2FCQA 5J2RA 2D07B 2KX0A 4N58A 2DY7A 4DV7Q 2I46A 2EKEC 5IWAQ 4IKGA 3M4YA 5FJ8H 1D2BA 3NBIA 4ZQ3A 5IO9A 3X23A 1B53A 2DGYA 4GOPC 3ZUNA 4BBRB 4BVUC 1H8CA 4DV2L 2DYOA 2KDBA 1GO3E 1RCVD 5BN5A 1VQJA 1C4QA 3I4MH 3GZNB 1JJ2A 4C3HB 1EFWA 4Y7NB 1IL8A 4KSLC 2EYFA 3N30A 4CHKA 2MBBB 3H91A 2OTJA 1ET6A 2F3VA 3MZ5A 4LF5Q 3K5NA 2O2VB 2C35B 4MTNA 2N78A 5TSSA 1WE6A 2HIVA 3FC4A 4BS9A 4IUPA 1A2UA 1VQDA 2R7ZG 3N6RA 1EF1A 5C3JB 3BVGA 5JEAJ 3IHPC 2R3ZA 2J0KA 2J42A 1G2SA 1WTHA 2KNBA 1A5RA 4LWCA 4UPAA 3J80i 4GDLB 2AUJD 2B2VA 2JYOA 2LKVA 4L6TB 4GU2A 1UE7A 4OELB 1PFNA 4C56C 3K0XA 3OIQA 4GNXA 3NRZA 3PO3H 3MXGA 2HQLA 3I70A 4ZAIA 2F0IA 2J7QB 2KCMA 4K0KQ 5M5YH 4A75A 1VR9A 1HR0L 2D3GA 4IPGA 1UWXA 1GUGA 4AYBE 3GTMH 1Q0WB 1J9OA 1JC7A 1FFVA 2F0HA 4H0LC 3PF4A 2CS4A 4JV5Q 3AEGB 1NYRA 2Z4IA 2MEKA 2G4DB 3AE2B 1TWCB 1FNWA 1F77A 1E3PA 5LMUQ 5CYUA 1STEA 2F03A 2W54A 3FKIB 1KHIA 4LFCL 3MEFA 3BYYB 3SE0A 1CI3M 4EGVA 5ELDA 1YHQA 2IHFA 1GHJA 2L3ZA 2KJHB 4XYCA 4A3FG 1I4HA 4HCSA 4F7ZA 2UXDL 5EAYA 2VRRB 4H02A 1N33L 2ZCCA 4XZ4A 4CKBA 4B3TQ 4XIGS 5FR3A 3NQIA 4DV3Q 1WR6E 1YX5B 2R61A 2B63H 5JJLA 1HZ6A 2N9EB 2ZPNA 1AP0A 3FKYA 1HHVA 1FRDA 4US9A 4DBGA 3PV1A 4DU9A 1ZYRD 5E6OA 1Y1WB 1Z5SB 3ERSX 1WM3A 3BY4B 1EOTA 1T0SC 3HOVB 4EZKA 3MXNB 4R8IA 2WXQA 5DM73 3J81j 2PVGC 2UWQA 1TWAH 1Z6HA 1YIWA 3JVZX 3L17A 1VS0A 4GOPA 4NXNL 1PRTD 1B50A 2K6AA 4RF1A 1QE6A 5FJ8G 2F0TA 2VQEQ 1W3SA 5G3LF 4LJZC 1WJ4A 3KVFB 2PW5A 4IPDA 2MCNB 1DOIA 1V8QA 4UP7A 4JQWC 3DWQA 4DV4Q 2XEWA 3I4MG 1V9JA 2UU7A 3NZSA 2KANA 3CAMA 3CCEA 1VQIA 1DZ1A 3Q2AC 2W9NA 3J81c 4OIKA 1B44D 4CBVA 2X8XX 3QJZA 1PYBA 2J0MA 1B7YB 3NUCA 5LL6S 2JZ3B 2OOBB 2Z0EB 1LTRD 3KLWA 5DNFA 3AMUA 1L6UA 2RSUA 4F88A 2WDVB 3BWUD 4GOCA 1PXUA 4JI2L 3OWFA 3R66C 2IO1B 4KDIC 1GVPA 2HIXA 1XNRQ 1XLQA 1ZKOA 2IT1A 1CZPA 4W9JA 1F0ZA 3BDLA 5IT9c 3AU5A 1WGKA 2JRIB 1FR3A 3ZTDA 1KQSA 3AE6B 4HTHA 3VYRA 4BY1B 3NSWA 1STHA 1ZDXA 4ASWC 2CKZB 4YY3L 4KY7A 3K8AA 5FLXE 1AE3A 1QB5D 3MTSA 3R8BA 4RGMA 1FXAA 2LI5A 1SNMA 1KDAA 1EWHA 3GZNI 4W9LA 4QCLA 1H9MA 4LFAL 3JAMi 2M0XA 3PO3G 5CV9A 3AEBB 1D4BA 1WGHA 2PQAA 4FF4A 1FXTB 4ODGA 4KVGB 1I5FA 2PI2E 1IBML 3UIPB 2UXBQ 3I7FA 4B95A 2RR9A 2L15A 2PQEA 3IRBA 4JI5L 2Y5BB 1HZ5A 2OJRA 1E1TA 2XK5A 3WDNA 2KECA 4HAEA 2CJNA 3E56A 4X62L 3V3XA 2Z6KC 3L3OC 1EO6A 2BWES 1CQFA 3AEFB 1LT6D 2JA9A 3HZXA 3N1YC 2PIAA 3KF8B 1A2TA 2XNAC 2A19A 4LNQA 1PGXA 3V96A 1PH3A 1P1AA 1S5CD 3CCVA 1Y14B 2FUHB 2WDTB 3U52E 2O6VA 4IW0A 3VTVA 2NVYB 2X38A 1N34Q 1SYEA 2B63G 2F0NA 3CRLC 1JWAD 4FVMA 2KJRA 2KCTA 1YOVB 5L95C 2KWDA 3TQYA 2OQKA 1I6VC 2ICEC 4IUUA 3B1LX 1JB3A 1TS2A 4HCNB 4HJ8A 2DAFA 4OZCA 3S16B 1B3AA 3GTGB 5CBAE 3WIMA 1K28A 1CQVA 1TWHH 4IALA 2K7VA 1L0XB 3VR2A 1J5EL 2N9KA 2ON8A 3W9CB 4C00A 1YHBA 3L9AX 1EY7A 3JAME 2MBEA 3DVNU 3WCQA 3AU7A 1TGZB 4EUTA 4C3IH 1HUMA 4HJ5A 2YTYA 4LNIA 4JW0A 1B9NA 1WGDA 4TKNA 3H09A 1RDPD 3ZVVA 2WU5B 3OYYA 4A3OA 3CCLA 2WB1G 5C44H 3HGBA 4UP8A 4LNKA 4JGHB 1NE3A 1ICFB 1XX8A 1EWCA 1B8AA 2WWZA 1EYAA 1PRTC 4JI1L 1VMPA 3PIOA 2BE5D 1WZ0A 3I4OA 1R9TB 4LTUA 1ML0D 5FLXL 3DUZA 5LL6X 1M1KC 3HKSA 3SD5A 1Q3LA 3P4PB 1DM0B 3HKZB 3PCOB 4PS3A 2LSSA 4MM3B 1L0WA 1R4QB 1E1OA 4KHZA 5M5WB 2LGSA 1HZBA 1IPGA 3NBHB 4Q5VA 3M95A 1H9SA 2W3SA 4HN7A 4M0WB 2OQ0A 2DZIA 1Q1OA 1NAPA 2R7FA 2XRQD 2Y3AA 5IE8A 3DCGA 3ZNHB 4KKSA 1BCPB 4DAYA 2K03A 4AP4C 2GI9A 1FGUA 3I73A 2CQOA 4X3TA 5IYBH 2K33A 5CMDA 3QC8B 3Q3JA 1A6XA 1HR0Q 4PK1A 1JCKB 3OMCA 2F4VQ 1AH9A 2L83A 2A8VA 4JI3L 1DOLA 1XPUA 3BZKA 4MGYE 4KHPL 2Z6KA 4IQZA 1AEXA 3MFYA 5GAHC 4OWWB 3AE1B 3L13A 4Y52H 2K25A 3A8IE 1I50B 2ZW1A 1Q46A 4R4TA 4LF4Q 1XF5L 2GBNA 1PFSA 2LXKA 4FP5D 2JN4A 1R7SA 2KUMA 2L5TA 4IUNA 4HIOA 1VZ8A 1H9JA 1CFMA 4H13C 3S17H 4QL5A 2Z59B 5HFYA 1CKMA 3F2BA 2JA7H 4NNJB 2E2IH 1N33Q 3KF6A 4WAAA 2O4XA 3GTLB 1S4ZA 4P2CB 2NN6I 2ZTEA 1BT0A 1JWUD 2GA4B 1E7PB 3C1EA 1XLPA 3ML8A 1JWSD 2ZNVC 3SR1A 2LVOA 3PHXB 3VRBB 3ND9A 2D9UA 2N7DA 5AUKA 1WF9A 1WX8A 2K6QA 3T3OA 3W5UB 1SMXA 2OEDA 2NZ1D 3PZDA 2SAKA 1B9RA 4E3CA 3W1YA 3A9JB 1Y69U 2N7EA 1RRBA 3FVQA 4GN4B 2JYEA 2KXJA 4WWPA 4DK5A 4NXNQ 3S1MH 5IY0A 1RKNA 3A33B 4C3IG 1M8AA 3CSTA 4C3JB 4JYAL 3HOUH 4ZDVA 1X3QA 1LACA 2PO4A 2GBKA 4HCPB 4LF7L 2B39A 4X65L 4HKZE 1SSOA 2ENBA 4AS1A 4B9XA 3NVZA 3CXCA 3E9IA 4S3SA 1E2VA 5IAAC 5C44G 3A55A 3I2ZA
chains in the Genus database with same CATH topology
3PUVA 1RTOA 1C76A 2RDHA 1GUSA 5JEAH 3G7LA 3KUPA 3K58A 4PQXA 5HGTA 1STNA 1Y56A 2RSNA 2K0PA 5JPMC 4C7ZA 2B2TA 3T4AC 4E6IA 1BNZA 2FE8A 3DEOA 1SDFA 1TS5A 4K14A 1PUTA 2M9VA 3GQBA 3M7NA 3PUWA 4XTCS 2AWNA 1LV9A 4YTMB 1NVID 2F0DA 2JEAI 1GJXA 3KLSA 5E3FA 1GUWA 4ABNA 1CZWA 1G91A 5BMHA 2I07B 1YN4A 4DFAA 2D5DA 2L9HA 3D8GA 3MAQA 1WTVA 2Z1CA 1JROA 3P4RB 2FINB 1WTWA 1XWEA 1MGSA 4MHEA 3U7ZA 3SEBA 5C6AA 2PVOD 3PO0A 1V1PA 4CJ0B 4ZK9B 2BBCA 2BOSA 2HDMA 3BK2A 4QUCA 5IGEA 4DNRB 1JALA 3PO3B 4CGYB 4L23A 5HG2A 5M5YB 4P6VF 4QIWB 1UGJA 2ZXOA 2RMMA 5KRUA 3GTMB 3MHBA 1WCMB 4EVOA 3M4OB 1PYWD 1G2TA 3D4RA 5FK9C 3B9JA 3X3MA 4H7BA 2NWGA 5CV5A 4IUTA 4DK1A 1GUTA 1X32A 3AN1A 1QWYA 3KWVA 2DLBA 1XLNA 5JEAG 3NUHB 2HUGA 4TRDA 5AFWA 1SF0A 1XCQL 3OSOA 2CW0C 3F2UA 2B63B 3NP8A 1R4PB 4ZRQA 3C46A 3PIP3 4I65A 1F2MA 1LTAD 4K8IA 3TEXA 2B2UC 2NTTA 4WIPA 2WU2B 1XCTL 1C78A 1TWAB 2A6HC 2A73B 4HROA 1HFGA 2W82A 1ESRA 1WTPA 2J4XA 2M2LA 1DJRD 4B0EA 4UAIA 2N0SB 4HMJA 3FMCA 3PUXA 4RH6A 3K5LA 4WAFA 1GB4A 2DYMA 2WB1B 2K05A 2F0WA 4KK7A 1T3QA 4DQOC 4NKLA 1MSGA 3BVZA 2KA7A 3GV3A 4DXGA 4KGSA 1BF4A 4ARCA 1LO5D 2WP9B 1PTOD 4ZRZA 3TP6A 4B9WA 3AECB 1U4PA 1SAPA 1E9MA 1FCCC 2EVBA 5JXVA 1DYQA 5IIFA 1F2ZA 3TUOA 4G7ZC 4PMWA 3PUZA 4GDKB 1JW9D 4RKBA 1WTXA 1V97A 3HRZC 5KYLA 1MVKA 3OWEB 1PFMA 1KTKA 1H9SB 4IUVA 2RBMA 4OVZA 4OZAA 3DWMA 1TVXA 1EY8A 3VA7A 1ACCA 1V43A 3AV8A 1KDBA 1E2WA 1CZGA 2H89B 4KMUC 1FEHA 2EYOA 1SEBD 1HUNA 1PDQA 1XTCD 3PZ7A 4NW2A 2B2UA 2EPBA 1F9RA 3HRDD 4KKUA 1K8MA 3NE5B 3HP3A 1WVLA 4J1MA 2BA0A 1TWHB 3J7AV 3NK9A 1GOZA 2MH7A 3SR6A 4FF2A 2L1AA 2VUMB 4TQ1A 2ZXRA 1SNCA 2X6LA 2B8GA 3VR3A 3KK7A 1JICA 3KF8A 1AYFA 1QOFA 4N6EB 1NR4A 1NCVA 1SE4A 3LNNA 1YNND 4KN7C 1MPEA 4A90A 2IX0A 3WOFA 1JMLA 2EYMA 3MXPA 2RDGA 1QKZA 3NS1A 3HS0C 1GXDC 1YNJD 1WRIA 2SEBD 1PRTB 4QF4A 2BS2B 2JU6X 3K0YA 2Q8RE 2VB3X 3RUZA 5KYIA 1IGCA 1I4XA 2MJDA 3I4NB 4NDXA 2LHEA 5D7GA 1PMRA 1IHZA 3AE7B 2RVLA 4X3UA 1WTQA 1PTOH 2OXPA 3D6WA 4FXGC 2FFKB 2K5WA 5CC4A 1K8OA 5EKLA 2IDYA 3K7AB 1AZQA 2Q8TA 3S17B 5C4ZA 2JA7B 3DWAA 2E2IB 5BMIA 4IFDH 3FAHA 4HSVA 3IFTA 4XQJA 1G6ZA 3NBHA 3GB1A 4M0WA 1C4PA 4B0MA 4DAVA 2JSVX 3LXFA 1PZKD 2LHDA 3IAYA 1JWBD 5KGUA 2K01A 5IGBA 4IN3A 4TQ0A 2XWJB 3S1MB 2NUCA 1ICWA 1JOQA 1STAA 2PNRC 1KLGD 3PZ8A 1U4MA 3HOUB 1VDVA 3R2IA 2WDRB 2EY1A 1KRHA 1ZXHA 4DNTB 2FUG1 3QB3A 1E2ZA 2CQAA 2C9OA 4A3BB 2LS01 1SBBB 1PRTF 2ID0A 1U4RA 1NEKB 3S1QB 4FF1A 5I6WA 1SYCA 1RYJA 5HI1A 2KMMA 2QF7A 1ZP0B 2HDLA 2F0KA 3RMHA 1ZDVA 2I38A 2H1EA 4HEDA 2Z8LA 1ZXIA 3BG3A 1A3UA 1V1OA 1YNNC 2KCNA 2FHTA 1HQMC 5CGKA 1IBXA 1TWGB 2V0GA 1EU3A 2JA6B 4ITKA 1YJIA 4L2YA 2F0PA 1YNJC 4ARIA 5HHDG 2DWQA 1PFBA 4BA1I 2D2CC 2Q5WD 4RGOS 4YTNB 2DNCA 3U9SA 1L0VB 4KJNA 4RNAA 2EJFC 3KWLA 1LT4D 3P63A 3L4PA 5EE3A 2Y5PA 2C5CA 2WNMA 4IFDG 1SXTA 5CR3A 5J22A 2WXFA 1O80A 4YXDB 5IGGA 4PMCA 3TBIB 1EU4A 2K5DA 2JYTA 2WINB 2NMQA 1A3VA 2BT6A 4OGQC 3VYUA 4UDUC 1VMCA 3BDOA 4ZLTF 1BMLC 4YTPB 3ZJUA 2KEEA 2AQ3B 1VF5C 1HA6A 3C2PA 1SNOA 4K5WA 1D1IA 1H9KA 1TT2A 3CHBD 1Y8NB 4V0BA 3J80E 1AZPA 1EEFD 5I2YA 4MIUA 4XQNA 5LNK1 2BA1A 1T5XD 1I4GA 3SHLA 4KKTA 1DOXA 1JQ4A 1C4CA 3QO2A 5DM63 1II3A 4HSPA 2YEPB 1WSPA 2WLBA 1LLRD 1XO3A 1IYVA 2L0CA 4A3DB 1EEID 1QG7A 3S1RB 3J7AF 4PMBA 3TEZA 1F2RC 3C1FA 4BWGB 4C7YA 1FCLA 1E10A 2DBYA 3ZQ4A 3H8HA 3DWPA 1TKEA 3T51B 4K2KA 4DGZA 1M4VA 2L11A 4FXCA 1FRRA 3MWYW 2R92B 3S15B 5ELCA 3AB5A 4GZYC 4OL7A 5AUIA 2A6ED 3TP8A 2EY6A 3Q8BA 5T8IA 3GTKB 5NUCA 3I90A 4RFBA 2J7ZA 3NWTA 2F0FA 3P20A 2WXHA 1SB3C 1ZUD2 3MXUA 2OT2A 1C79A 2B2YC 4V190 5CBEE 4XQQA 3SVMA 5C3XA 3J80L 1I4RA 1TYGB 4ZOHC 4CQNA 3NVYA 4LAAA 2BW2A 3U9OA 3I3CA 2EXZA 2QILA 1HXYD 1ENFA 3NTHA 5G5GA 2BS4B 2LFIA 3CQZB 1DGJA 1OO9B 1BBXC 3HUIA 3GO5A 3R93A 1Q8IA 2YEPF 4BA2I 1KNAA 2NBFA 1W6JA 2N88A 2ONQA 2F0VA 2F0SA 1ZPSA 4XYQA 1ZYRC 1WD1A 1JRPA 4RKLA 5BYRA 3FRPB 3M7GA 1EM7A 5KEEA 5K36G 5JJZA 4TKOB 5G3LD 5F2DA 3D4DA 3URYA 1QNUA 5C5MA 1NUCA 1B9MA 1DOMA 4CKCA 2EZVA 4KY6A 4ZYSA 2JX5A 1I6HB 1QT9A 2I2YA 2L1BA 4IZ8A 1I4PA 5I6YA 2IGHA 1IW7D 3ZJTA 1KH0A 4YSXB 5D14A 4R8NA 2NTSA 2E75C 4GLSC 5C3WA 3MA2B 3AE5B 1QILA 5D65A 2LUMA 2JEBI 3Q8FA 2BYTA 2LMCB 1Q1EA 2CJOA 2WXLA 2F0OA 4L8JA 4A3MB 3AH7A 3L7ZC 3K57A 2IJ0A 1JORA 3V05A 3Q6SA 2EELA 2A6EC 2F1MA 1SYFA 2WQYB 4NZLB 2R7ZB 5DEHA 5IGFA 3JAML 2QJLA 1N5WA 4AYBB 1HFNA 2RQXA 1ROEA 2FJ2A 2A68D 5M3MB 3BS1A 4BY7B 1IBXB 1N60A 2J0TD 2SDFA 2K28A 5EBDA 1C4AA 1XLOA 2M56B 4K6LA 5KNDA 1TJEA 2V3NA 4XYOA 3EGRA 3VQIA 5D3DA 3EFXD 1RJTA 2G9DA 3TZDA 4FNFA 2NVXB 2B2WC 2E2JB 4A3FB 4ZKCB 1C9FA 2JP1A 1BCPF 3I8ZA 4OO1H 4IFDJ 2LEKA 2PKOA 3I57A 2LY7A 1HTPA 3TMEA 4K5XA 2PPBC 2WXRA 2R6GA 2BE5C 2L52A 1DOYA 2XN9C 2JXMB 3I91A 4LK0M 1AFPA 4JE3B 2F3WA 1C8CA 3I72A 3VA5A 3HG9A 4JK1C 3IAM1 3I4MB 3KLSX 4PV1C 1IW7C 3Q8AA 2EKIA 2WXPA 1ILQA 4HKQA 5M3FB 2M19A 3EA6A 2K9XA 1Q10A 3PO2B 1FXIA 1ENCA 3RFZB 3EVQA 3IT6B 3LB8C 3SXHA 4IDIA 4MN3A 2TSSA 2CHBD 1LTGD 1HA5A 1VF7A 2IGGA 2PMVA 3SK4A 1HTLD 5H8YE 4YSZB 1UNSA 1JE4A 2RPVA 1YQ3B 2OEOA 2WIIB 1CA5A 4FO2A 2PLPA 1AWDA 1A15A 1S5ED 5JAVA 1L6VA 2M0AA 2EDGA 4QB4A 3BK1A 2CU3A 4USAA 1H9RA 1DXMA 1UAPA 1K51A 1MI0A 4F87A 5FO7B 1CJEA 4XDCA 1P7FA 3HVDA 2MHVA 2EYHA 2V3PA 1SYBA 4OW0A 4OO1G 1DONA 2INPE 1QQRA 2J52A 1JOKA 2WKCA 1RODA 1K52A 1IGDA 4WURA 4OZBA 4X3SA 2K1BA 5GXGB 4JPSA 4IFDI 3QOLA 1WXQA 3RZOB 3IL8A 1DOKA 3CIRB 2W55A 3NVVA 2HDEA 2V4DA 1XYIA 1UUPA 2EY5A 4US8A 4WJWA 2E3TA 1EY4A 4CJ2C 1K53A 1ET9A 2F0LA 1FD6A 1LTID 4A8XC 1PZID 5T1IA 3TN2A 1F9SA 4HRSA 4B08A 2AQ1B 3TSSA 1D5MC 3N9YC 2PTLA 1J7BA 3IKJA 4DAPA 1KAAA 2JE6I 1OQQA 3Q22A 1X3PA 3WOEA 1JR0D 1SE2A 3FEWX 1VDZA 4KJOA 4K2LA 2VZKD 2X69A 5ELFA 4RGTA 1ZEQX 5BMGA 1RF2D 4K8JA 4YSYB 5K5PA 1MD2D 4C80A 3I9V1 1TQOA 1N62A 3GS2A 1EIHA 1V8CA 5FKAC 1FIQA 2E76C 2D62A 4MACA 1OXSC 1WYGA 1QOBA 2DN8A 2PW9A 2IPKD 5BN3A 3T3NA 4WRDA 2WDQB 2L32A 4HJGE 2O5IC 1BDOA 4KN4C 4H2AA 4X3KA 3VYSA 1E0ZA 3S2HB 5IODA 4N9TA 5E4XA 4XWWA 4C3IB 3Q8CA 1Y8OB 1VCIA 4REZA 3ETRA 2MJEA 3LX0A 1B2TA 3DEPA 1BQQT 2IW3A 1NYQA 2IX3A 2IGDA 5C44B 1TIID 2F0UA 1CHQD 1P7EA 5CV4A 2Y0SB 4H44C 2AX5A 5C0XH 3CKIB 1Z47A 1O7ZA 4RHSA 2WXJA 2A74C 3NVWA 2LJIA 3FILB 5E4WC 5DAUA 2BB6A 5C4XB 3MVVA 2KCCA 3NQTA 2X6GA 4R9WA 1SMYD 5EE9A 2BB5A 1FM0D 1FD7D 2PMZB 2LGIA 2PW7A 3HOWB 4WH4A 4LLGM 1XXGA 5T1GA 2A5HA 3TP7A 4DF7A 4G7HC 1SSNA 1C48A 1I4QA 1WTOA 1ONLA 3W1SA 3VR6A 2IWHA 1PTOC 1VLBA 2ZT9C 4FF3A 4OIJA 2F0QA 4TMAB 3KBXA 1SE3A 2JZPA 3KBGA 1EY6A 1F2RI 3J81E 3ITPA 3MFGA 4P16A 1RWSA 5KIXA 3PV0A 2F0GA 1RHPA 1T5EA 3MP9A 2QEJC 4HEA1 3HEJA 3K5MA 1EY9A 1BR9A 1QNKA 2VB2X 2MJ8A 3K59A 5IT9E 3DHQA 2B2VC 4DK0A 3T53B 2Q8IB 1LABA 2KJXA 3R3OA 2K3UA 4A3KB 1PLFA 2LMCA 2KEDA 3H6MA 2QSDA 2NYZD 2XRSD 3AEDB 2QCPX 3CU7A 4U68A 5IGDA 3GV6A 5C0XG 2KN4A 2KOLA 4XDDA 2HTME 1CA6A 5EPKA 3LYYA 1F2LA 1PZJD 3ONAB 2M00A 2GB1A 3KQ4A 2PZTA 3AMZA 5EE0A 3AEAB 4KV6A 4KI0A 3A56A 4K5VA 3SK8A 1CK1A 1KNEA 1K83B 2WP8J 3J81L 1Y1VB 5IGCA 1E0BA 4LK1C 2E2DC 1SMYC 1JQYD 3OPOA 4TQUS 1HEZE 3B2FA 4FXDA 4EQOA 2R93B 3Q69A 5IT9L 2MP1A 5CV8A 5CORA 1CHPD 3PMFA 2O2LD 3P42A 3ZYYX 3IAS1 1KF6B 3KLRA 1FYCA 4KD3A 3QOJA 3LWEA 4N59A 2BTEA 4FXKC 3ZJVA 5A2QE 1QOHA 3VR5A 4C3JG 2B76B 3OOCA 1O7LA 1RFKA 3DXJC 1YJJA 3GTJB 2L4NA 2NB0A 3LWUA 4MH8A 5COYA 5H92C 1PGBA 5EBCA 2KQ4X 3TP5A 3OHXC 3MC0B 3GP7A 1OFFA 2QDBA 5ELBA 1MBYA 3MJ5A 4DA2A 3Q23A 4A3EB 3EQLC 4M1UB 2JWUA 4RCOA 2BCOA 2J53A 1K50A 5I9OA 2RSOA 1L0YB 2MGSA 4G57A 1Y8PB 3X3NA 3VR8B 1FO4A 2PZWA 3FDTA 2E2HB 2V4IB 3NZ3A 2RKSA 4RAUC 3A7AB 5ISRA 2PCFB 1EQTA 1EZ8A 5K36H 4DXFA 3S9WA 1S5DD 4ZUIA 3HOZB 1STYA 3Q0AA 4QMGA 4RGNA 5EPJA 4J8QA 4IURA 1OXXK 3W5VB 5EPLA 1RTNA 3UI3A 1Q12A 3N52A 2G9HD 2JA8B 1TKYA 2K5QA 2Y5CA 4KKIA 4OO1I 2XWBB 1BXTA 1YQ4B 2QMTA 3AE9B 4TSSA 1B4OA 1GUOA 4HMIA 2XIWA 5A2QL 3AEEB 1ZE3D 3E6ZX 1A3TA 4ZRPA 4G4KA 2ZXPA 2MUYA 4RWSC 1VZ6A 3TEYA 4NP5A 3M85A 1RM6C 5BYQA 1S5FD 3P7JA 1L4DB 4A3JB 1KFYB 3CWIA 3TDQA 5KNBA 4KY5A 5KNCA 4JX1C 1TWFB 3ND8A 2JQRB 3ABVB 1LTSD 3EROA 4BBSB 1Q1BA 1ZOYB 1FNUA 4KD4A 4EQNA 1T6BX 1RD9D 2VXWA 1QLBB 3VRAB 1J7AA 4PNYA 2YU9B 1CT1D 4KX6B 1QOAA 4I7ZC 2F0MA 2KACA 2F0JA 1VJKA 1QJOA 4NAMA 5JPNC 1NR2A 3QG1A 1NSNS 1STBA 3SK5A 2BDNA 5JOBA 3VR9B 1DD2A 4WWMA 5I4DA 2WAQB 4KGTA 1J8IA 4EE2A 1N61A 1TKGA 4Q0FA 1TS4A 2DY8A 3QWNA 1KABA 1OXUA 2JA5B 4CJ1B 5FO9B 1JWMD 4WFN3 2IX1A 4CHTB 2QKIC 4PT5A 3BZDB 1GAQB 1N5XA 4M8AA 4LMQD 1TY0A 2CVRA 3J9CA 4XWTA 4F8MA 1U9RA 1F9QA 1OXVA 4O1NA 1BUIC 5ELEA 5MPOA 1B1ZA 2EJMA 4A6QA 1TS3A 1SYDA 2B2TC 1EY0A 1L4ZB 1QCBD 1EYDA 3RZDB 1YN5A 1SIJA 1O7YA 2B2YA 5FO8B 3T56B 4J6HA 2JSOA 2XVSA 5C0XJ 2AUKA 2FMMA 5J1ZA 2A69D 1MHXA 2N7JA 3C8YA 1TU2B 1CTMA 4CKEA 1QOGA 3BDCA 3QIAA 2KDMA 1PTOB 3Q8EA 1EIGA 4FYDA 1OQRA 4ZKBB 3FILA 2RA4A 1JOOA 2VZKB 3TEWA 1D5XC 2AQ2B 4O42A 4DN4M 2IL8A 3OW7A 5EKIA 3H94A 3ERQA 1KDCA 3E0JA 3DMUA 3OIPA 4QUFA 1WTRA 3RLFA 3NTKA 3V2TA 4XDXA 3AB9A 3IXSA 3S1NB 2NVTB 2CW0D 1ENAA 4A9AA 2WS3B 1SNDA 3A8JE 1N63A 4ZHOA 2WKDA 2BDOA 3H0GB 2A6HD 2OF1A 3BIID 1ILPA 1EYCA 2EOTA 4ULLA 5I2XA 1Q90A 1LTTD 1HRJA 5FOBB 2E74C 1VRAB 3EUB2 2SNMA 3UI2A 1FFUA 1MHHE 2RDFA 3B2GA 5E1FA 1STGA 1WD0A 3O13A 3C3LA 1PTOF 2WXKA 4L1BA 1CM9A 5C0XI 3TZUA 3U4EG 4AQ7A 4J3OD 3D6CA 3CRKC 2KAJA 2A69C 2HCCA 3ZGZA 3D31A 3W3AA 2B8FA 4XT1B 5C5LA 2EE1A 2EYJA 3J7YW 3A54A 2WXGA 2DNEA 3FPUB 2B2WA 4IOIE 3U2SC 3P1MA 1MSHA 2A68C 1BO0A 4K6DA 5JVG3 1TY2A 4XT3B 3NXWA 1WWTA 2FBWB 1MI2A 3Q24A 2GRIA 4L63B 4C2MB 1LT5D 5M5XB 3M3YB 1XEEA 2K04A 5C3EB 3PIO3 3A7LA 1TZOA 3IT4B 1G291 3MHZA 1DCZA 4Q2JA 3GTOB 4Z9CB 1GPXA 1U4LA 4A55A 3EJIA 3FPPA 4U673 3P1HA 1YN3A 5EQ0A 4C3HG 2H88B 1BCPD 3AM9A 4ME5A 3MEHA 1TR5A 1I3QB 4N9PA 4RA8A 1EZ6A 3BYTB 4HCEA 1TKWB 5EGTA 2ZW0A 3GTPB 1D1KA 2NVQB 5C4HA 4MT5A 2H4OA 1NI3A 2ICIA 1GB1A 2SNSA 3RD4A 1EY5A 3S2DB 2HQEA 2KHSA 2Z4HA 5G5HA 3W2DA 1ZXTA 1IYUA 1IKLA 4KTAA 3T13A 4ID6A 1PDXA 2NN6H 3NPPA 4RF0A 1A70A 3AE4B 5JVH3 3SDZA 3SFDB 3SK6A 1FMAD 3DM1A 1YMHE 1D6EC 3GTQB 1IUEA 4F7XA 1EWYC 3D4WA 1UEAB 2K32A 5EKKA 3NWSA 2WV6D 5I9PA 1SFOB 2TMPA 2ACZB 3MXNA 3E5SA 4WORA 1QF6A 2KVMA 4KHVA 1F2YA 3R2TA 1AW7A 1KLUD 4YWGG 5BN4A 3K6OA 3H3VC 2O5JC 1EFID 3BVMA 1E6EB 1W6KA 2AWOA 2YYZA 5CV7A 4C1NI 2OHFA 5HURA 3AE3B 1J7CA 2L12A 2L55A 4YT0B 3RPFC 4NJCA 1G8ZD 3E9SA 1NENB 4RCNA 2HCIA 1I7HA 5C2TB 1AN8A 1HQRD 3HOYB 3I4LA 4JWUC 1YNTE 2EY2A 3A8KE 4G7OC 3NHHA 2N55A 1S5BD 2WACA 3GD7A 3HVZA 1BCPC 4JBWA 2QIEB 3VR4A 2XSCA 5IOCA 3DWGC 2VNUD 4D2KA 1LT3D 5C4JB 2E6XA 2NN6G 4RHRA 1PGAA 4ZHPA 1L5PA 2WXNA 5A35A 4WQMA 4KKJA 4HR7B 2KQ3A 1BOSA 1SNPA 3S14B 1VZ7A 1SYGA 4R3DA 5E6JA 4ILWA 3G6JB 3D3RA 2K22A 1PFDA 2K5PA 1FNVA 3P75A 1LTBD 1FGBD 3K5OA 1OXTA 3P4QB 1GUNA 4XE0A 2INNE 2WXMA 1D5ZC 2JXTA 4A93B 2LFNA 4OHJA 2WXIA 3QJYA 2WXOA 1SJHD 4EQPA 1O78A 3OMGA 2G1EA 4JWSC 1HPCA 5EJWA 1SNQA 3PUYA 1IKMA 4A3GB 5LHY1 1HCZA 2W3RA 3SFEB 2PYKA 3HOXB 3T16A 4ZUJA 2EYPA 1F9PA 3AE8B 4NAWB 4XXEA 2F4IA 1Z7TA 1ESFA 3NTIA 2MPMA 1UWMA 1C77A 2PZUA 4KGRA 2EYLA 5EE1A 1EQVA 2MJ3A 2BS3B 1BUVT 2FMCA 4NMZA 1SJED 2SOBA 5CV6A 5J39A 3P4SB 4A3IB 5M9OA 2D5GA 2N9LA 1EL0A 4C1NK 5D3IB 3IFDA 4IUQA 3VYTA 1V1PB 1GHKA 5BYSA 2F0EA 4YIJA 4N58A 2DY7A 2I46A 4IKGA 3M4YA 1D2BA 3NBIA 4ZQ3A 1B53A 4BBRB 2DYOA 1RCVD 5BN5A 1C4QA 4C3HB 4Y7NB 1IL8A 2EYFA 3H91A 1ET6A 2F3VA 3MZ5A 3K5NA 5TSSA 3FC4A 4BS9A 4IUPA 1A2UA 3N6RA 5C3JB 3BVGA 5JEAJ 2R3ZA 2J42A 1G2SA 4GDLB 2AUJD 2B2VA 2JYOA 2LKVA 4L6TB 4C56C 1PFNA 3NRZA 3OIQA 3MXGA 3I70A 4ZAIA 2F0IA 1VR9A 1UWXA 1GUGA 1J9OA 1JC7A 1FFVA 2F0HA 4H0LC 3AEGB 1NYRA 2Z4IA 2MEKA 3AE2B 1TWCB 1FNWA 1F77A 5CYUA 1STEA 2F03A 2W54A 3FKIB 3BYYB 3SE0A 1CI3M 4EGVA 5ELDA 1GHJA 1I4HA 4HCSA 4CKBA 4XIGS 5FR3A 3NQIA 2R61A 1HZ6A 4US9A 1AP0A 1HHVA 1FRDA 4DU9A 1ZYRD 1Y1WB 1EOTA 3HOVB 4R8IA 2WXQA 5DM73 2PVGC 1Z6HA 1PRTD 1B50A 2K6AA 4RF1A 1QE6A 2F0TA 5G3LF 4LJZC 2PW5A 1DOIA 1V8QA 3DWQA 1DZ1A 4OIKA 1B44D 4CBVA 5LL6S 3NUCA 1LTRD 5DNFA 3AMUA 1L6UA 3BWUD 4F88A 2WDVB 1PXUA 3OWFA 1XLQA 1ZKOA 2IT1A 1CZPA 1F0ZA 3BDLA 1WGKA 1FR3A 3AE6B 4HTHA 3VYRA 4BY1B 3NSWA 1STHA 1ZDXA 4KY7A 5FLXE 3MTSA 1QB5D 3R8BA 4RGMA 1FXAA 1SNMA 1KDAA 1EWHA 4QCLA 1H9MA 5CV9A 3AEBB 1D4BA 4FF4A 4ODGA 2PQEA 1HZ5A 3WDNA 2KECA 4HAEA 2CJNA 3E56A 3V3XA 3L3OC 1CQFA 3AEFB 1LT6D 3HZXA 2PIAA 1A2TA 2XNAC 1PGXA 3V96A 1S5CD 3U52E 2NVYB 2X38A 1SYEA 2F0NA 3CRLC 1JWAD 4FVMA 2KWDA 1I6VC 2ICEC 4IUUA 1JB3A 1TS2A 4OZCA 3S16B 1B3AA 3GTGB 5CBAE 1CQVA 3VR2A 4IALA 2K7VA 1L0XB 2ON8A 2N9KA 3W9CB 3JAME 3L9AX 1EY7A 3WCQA 3AU7A 1HUMA 1B9NA 3H09A 1RDPD 2WU5B 3HGBA 1XX8A 1EWCA 1EYAA 1PRTC 1VMPA 2BE5D 1R9TB 4LTUA 1ML0D 5FLXL 3DUZA 5LL6X 1Q3LA 3P4PB 1DM0B 3HKZB 4MM3B 1R4QB 4KHZA 5M5WB 4Q5VA 1H9SA 2W3SA 4HN7A 1NAPA 2Y3AA 2XRQD 4DAYA 4KKSA 1BCPB 2K03A 2GI9A 3I73A 4X3TA 2K33A 5CMDA 1A6XA 1JCKB 3OMCA 2L83A 1DOLA 4IQZA 1AEXA 3MFYA