1HA5A

Structural features of a zinc-binding site in the superantigen streptococcal pyrogenic exotoxin a (spea1): implications for mhc class ii recognition.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
218
structure length
218
Chain Sequence
DPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHAGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYLTDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDSNTSQIEVYLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Toxin
molecule keywords STREPTOCOCCAL PYOGENIC EXOTOXIN A1
publication title Structural Features of a Zinc Binding Site in the Superantigen Strepococcal Pyrogenic Exotoxin a (Spea1): Implications for Mhc Class II Recognition.
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 56
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ha5A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ha5A01
3BYTB 1I4PA 1EFID 3BVMA 1S5BD 1HTLD 1PTOB 1BCPF 1RF2D 1CQVA 3EFXD 1TS3A 1FD7D 2RDGA 1PTOF 1M4VA 3OWEB 5ELEA 1LT5D 3BYYB 4RGMA 4RH6A 1CT1D 1XTCD 3GP7A 1JWMD 1LTGD 1JCKB 1PZID 1LTRD 1TY0A 4RGTA 1HQRD 1LLRD 4BWGB 1LT4D 1HA5A 1SJHD 4UDUC 1DJRD 1EU3A 1CK1A 1XXGA 2XN9C 3BZDB 3SEBA 3TSSA 3V05A 1PRTF 4RFBA 1RD9D 4RCOA 3URYA 2XNAC 3R8BA 2AQ3B 1RDPD 1SE4A 3CHBD 1FGBD 2AQ2B 1LTAD 2J4XA 1I4GA 5FKAC 1PTOH 1EEID 1V1PB 2AQ1B 4Z9CB 5ELCA 1AW7A 1TS5A 4O1NA 1D5XC 1S5FD 1DYQA 1ET6A 1I4XA 1SE3A 5I4DA 2QEJC 1TY2A 1STEA 1PZKD 1V1PA 1L0XB 1S5CD 5ELDA 1FNWA 4OHJA 3R2TA 1D6EC 1I4HA 3BVZA 1CHQD 4ZYSA 4RGNA 2XRQD 2SEBD 2O2LD 1UUPA 1I4QA 1S5DD 4TSSA 1CHPD 1PZJD 1SE2A 3DWQA 1LO5D 3R2IA 1BCPC 2RDHA 1SXTA 1D5ZC 1FNUA 1JWSD 1UNSA 1TS2A 1YN3A 1JQYD 1JR0D 1T5XD 1RCVD 1EEFD 1GOZA 1L0YB 1SEBD 2ICIA 5ELBA 1LT6D 1LTID 4C56C 1LTTD 1EU4A 2TSSA 1EWCA 1QILA 4RGOS 3DWPA 1HXYD 1PYWD 1MD2D 1V1OA 1F77A 1PRTD 1PRTC 3KLSX 4RHSA 4DXGA 2WV6D 2NTTA 2G9HD 4K6LA 2Z8LA 1B44D 1BCPB 3EA6A 5FK9C 1BCPD 1ET9A 1S5ED 1KLGD 1D5MC 1TS4A 1JWUD 4RHRA 1PTOD 1PTOC 4L63B 1ENFA 1ESFA 3MC0B 1FNVA 1LTSD 1AN8A 1G8ZD 5D3DA 4L6TB 4NZLB 1KLUD 1KTKA 1YN5A 2IPKD 1B1ZA 1PRTB 3O13A 1YN4A 1SJED 3W2DA 2XRSD 1LTBD 1BXTA 2IJ0A 5D3IB 5ELFA 1LT3D 2QILA 2R61A 3BVGA 3DWAA 2CHBD 4DXFA 1I4RA 1SBBB 3MFGA 5TSSA 2NTSA
chains in the Genus database with same CATH superfamily
3H3VH 2CU3A 1S5BD 3C1FA 1DCZA 3DMUA 1PHJA 4DV5Q 1RWSA 4OZBA 4WWOA 3UIPB 1HTLD 3TJPA 2UUCQ 1P0RA 4DV1L 3GTGH 3N1XC 4BY1H 4EGVA 3F8TA 4RNAA 5I2XA 1MFWA 2KYWA 3TMEA 1HZCA 2ID0A 4BA2I 4A3CG 2MWSB 1IKMA 2IW3A 2RQXA 3GZNB 4TKNA 3TUOA 4JWSC 4LJPB 4W9KA 2CCZA 4ABNA 5G2NA 1GB1A 3MTSA 4Q5VA 2DNFA 1RIPA 2IHEA 2L0CA 3CCJA 4LF8Q 2XN9C 4GKJQ 1J8CA 1RFAA 2ENBA 5IIFA 3AE8B 4OWWB 2BYVE 3IXSA 4JYAL 3UE1A 1DOLA 2E2JH 1FPYA 1L7YA 3NHEB 3WIMA 2IX0A 2DENB 4LF9Q 3R8BA 3A1QB 1HUMA 2WWZA 4JPBW 2MBBB 2WXMA 2A8VA 2R92G 4AH6A 3S15B 3NHHA 1E0BA 1UE6A 2IX3A 1EQQA 2OHFA 5IGCA 4LCDE 1D5XC 1WGRA 2QDFA 1F2YA 2DN8A 1XPOA 1JORA 3K5OA 3T1YQ 2QMTA 2ZVNA 2KANA 1KNEA 4FXGC 3D4WA 4H13C 3KFUA 2KMAA 4MDKE 2A4ZA 3V6EB 3I7FA 1GUTA 1KLVA 2YVCA 2R93G 1D6EC 2RCFA 4DR2L 5M5WB 1FRDA 1YZ6A 3VRAB 4RGNA 3J80E 4LFBL 2D3BA 2G4SA 4W9IA 1X3FA 5CV6A 5EKKA 4NAWB 3CPWA 3EHVA 4EZLA 2J7ZA 4MHEA 2N88A 1PZJD 3DWQA 3T53B 3X0WA 2PZTA 4NW2A 1TT2A 1WRDB 2JE6I 2L15A 4W9EA 5LMNW 1STYA 4BBRG 2RVLA 1E7PB 4KIKA 3QG1A 3PRPB 4TVAB 4KVGB 3VYRA 1VQBA 1SEBD 3HOZG 2LRUA 1LM0A 1LTID 3WAOA 4BY7G 1VQHA 4B3ML 3AEFB 2NCNA 5M3FB 1CKNB 1QILA 5I9OA 3DWPA 1A8VA 1OXTA 1OXUA 1AFPA 5BMIA 3LX0A 3OTOL 2QCPX 1WM2A 3O65B 2E2HH 1WD0A 4KV6A 4BXXH 2JWZA 1GVPA 2RKSA 5FO9B 3GE3C 1Q90A 3M4PA 1UEBA 3ZNID 1KF6B 2Z8LA 2LHEA 2LJIA 2WAQE 1K0SA 4NJ6A 4YT0B 4KTAA 1STNA 1JB7A 1GO3E 3KF8B 1XNQL 1SE9A 3ZTCA 1PFBA 1WCMG 2KHIA 1C1YB 4NAMA 2NVXH 1N36Q 3HOUG 3GTGB 2DAFA 4BY1B 4MGIE 2M0XA 1F0ZA 3MFYA 3KWVA 1GB4A 2HHHQ 5E6JA 3L08A 4GMVA 2C7MB 4B3RQ 1F9JA 3VQIA 4EFOA 1LABA 1B9MA 5A2QL 2IZVB 3V61A 3TL5A 1N62A 1NYRA 4XQJA 3AE9B 3BINA 1N63A 2KOLA 4GLSC 1C9OA 1WJNA 2NR2A 5CV4A 2HJ1A 3PZDA 2E2JB 4F87A 3J81L 4JCVE 3A5UA 4IM2A 1LM8B 2F4VQ 2KDIA 5C0XG 2NVTH 3L2PA 3PIPA 1E2ZA 5I9PA 1UGJA 3EFXD 1CM9A 4G11A 3JAML 4HDOA 4GN4B 2F0NA 3TEZA 1FR3A 3BZKA 2NZOA 4X62L 1IBMQ 1P7FA 3NTIA 3MC9A 1M4VA 5ELEA 1NI2A 3JYUA 3RD2A 1RTNA 3PO0A 2LGXA 2FE8A 2QSDA 4DV2Q 5C4XH 1GM5A 4GDKB 1XNRL 2PZUA 4BBNF 1BQQT 1VQ7A 2ONQA 1SJHD 4LMQD 1QF6A 3ZJTA 2JU6X 1IPGA 4HPPA 4Q2JA 2OTLA 1U5KA 4NPNA 2ZJRA 4DK3C 2NN6H 3DPDA 2K5DA 1XYIA 4JI2Q 4A4IA 1T5EA 1BUIC 2XNAC 4DV5L 4LF4Q 2KTRA 4XC2A 3S1MH 2I5HA 3K7UC 2UUCL 1MHHE 3SR1A 4YCUA 1V1PB 5COYA 1WXVA 5C3EB 3KDFB 2M2LA 3PIP3 3RN9C 2ZJDA 1ACCA 3VH4B 3VXWA 2JA7G 1NJIC 2WLBA 4M0WB 1XMQQ 2KWDA 1PH7A 1E5WA 3MJ5A 4WQMA 2Y5PA 1VQDA 2VH2A 2WXGA 4LF8L 4WRDA 4GKJL 1I4HA 4K5VA 4J15A 1Q7YC 5IAAC 5BYQA 2SAKA 2E2HB 1R4MB 5C3XA 1TWAB 4LF9L 3DM1A 3U4VA 1WF9A 2ZNVC 1CMXB 3CXCA 3HOYG 4P72A 4A3MH 3M63B 4J3OD 5CV5A 1O7ZA 4IOAA 2NVUI 4CDCC 2KHJA 4NJ7A 4KI0A 2J52A 3ZYYX 5DAUA 3UQBA 1MI0A 1YBYA 3T1YL 2K28A 2NVXB 3TN2A 2J42A 2E76C 4XDCA 3HKZG 4OL7A 5ELBA 1IBLQ 1G291 1ZKHA 1IW7C 4C56C 1XCTL 3D4DA 4P2CB 1HZBA 1UWMA 4DF7A 5IYBG 2NWGA 3QO2A 1NEKB 5IP7G 4K5WA 2G3QB 3IL8A 2N0SB 3V3XA 3RLOA 2UXCQ 2PJHA 2OJRA 4RHSA 2KNBA 2MJEA 2Y5CA 4ZRQA 1SYCA 4HIOA 4LNNA 2JA8H 3OJ3A 4N8FA 1NTGA 2KQ3A 1YQ3B 1SNPA 3NBHA 2WYQA 3N3KB 3EQLC 1U0LA 3TS2A 4DHJB 4G3XB 3A7LA 5C4HA 4HPMB 3EECA 4IKGA 3GE8C 1JJ2A 4K3CA 3PRMB 3WOEA 1A15A 5EPJA 2AL6A 3AU5A 4LWCA 3KF6A 3NVWA 4G50A 3G6JB 3A4RA 1NBWA 1MJEA 4KN4C 1AP0A 4C3JH 2OT2A 1WTXA 2ZW0A 4N6EB 4GGQA 4OVVA 1KOTA 3MP9A 5C4JH 4DXAB 5C4XB 4G7ZC 1F9RA 2PKOA 4CDEC 1L1OA 1A70A 4NXNQ 3Q69A 3HGBA 4ULLA 2WB1E 5EAYA 1K9MC 4USAA 1Z6HA 4BKSA 3KLRA 1I6VC 2UU9L 3W1GA 1BXTA 4UAIA 3N9YC 4ANWA 1E7VA 4APVA 2MA9B 3AE2B 4A93B 3U4EG 2B3GA 3ER0A 1Q8IA 3TEHB 5EKIA 3GTKB 3S1MB 2BYFA 1FD6A 3CC4A 1N36L 4HJ9A 4II3B 4DAVA 3RN2A 5G3LF 3I2ZA 3OWEB 4B3RL 3Q22A 2JY6A 1J9OA 3KK7A 4BOZB 3CMAA 2MGSA 1WTVA 1QG7A 1HQRD 2QDLA 1U4MA 2K6DB 4CGYB 5JJZA 3N52A 1L0VB 4LF5Q 1ZXHA 2PIAA 2FUHB 2QCZA 5C4ZA 2Y0SB 2LGIA 3CMEA 2F4VL 1STAA 3RNBC 4FBJB 2CWAA 2RR9A 5IYDG 4XQNA 2JVCA 2F0VA 2MHJA 3ZNZB 1M90C 2LGDA 4PQXA 1K8OA 3AV8A 5AZFA 3S2AA 3PVLA 4DV2L 5IT9L 4ZUIA 4RA8A 2CHZA 4I6LB 3RMHA 4YSXB 3R66C 1DXMA 1UE7A 2JPHA 4GN1A 1K51A 3ZXRA 2AMCB 1IZ6A 4DUYQ 1V5TA 3W1YA 1SROA 3QIAA 2JA8B 3HEJA 1VQ4A 4LF4L 2RA4A 2D2QA 1VF7A 2EOTA 1N5XA 4A3PA 1ISNA 4YWMA 2N9EB 4A3GH 5KNDA 4MN3A 5G3LD 2KO3A 2MQJA 1R4NB 2L76A 5M5YB 1FNUA 4DR6Q 3IG3A 2AUKA 4MTKA 2JJQA 1P1AA 2A73B 3VA7A 1QUQA 3PO2H 1Z5SB 2MRPA 3AE3B 5C4JB 3BDOA 1IKLA 4MGZE 3VR6A 1SNQA 1Q86C 4A3FB 4A3BH 1JALA 3QHTA 2K39A 5J17A 3MXGA 4R3DA 1SYBA 2B8GA 4XT3B 4HTHA 4MIUA 3MTNB 3ZJVA 1P8LA 2RBMA 3L54A 5LMUQ 1HZ6A 2KN4A 3DBSA 4KKIA 4MGYE 4DR5Q 2D5GA 1WZ0A 4BOSC 5GAEC 2BYTA 3U9SA 1EM7A 3J7YW 4RM9A 1NI3A 5CMDA 1IBLL 2FCQA 2Z4HA 3TCAA 1DOXA 2PW7A 2WXRA 1NVID 2QKIC 4KY5A 3UI2A 1VLBA 4XYQA 2PE6B 3KBGA 1KTKA 4J8QA 2DZKA 1D3ZA 3GTOB 2KTRB 4HEDA 3HOVG 5GXGB 1E9MA 5JZEB 3O13A 2MBEA 4LFCQ 1SJED 1O7LA 2H5XA 4R4OA 3AE4B 2EYOA 3IFWB 2OWOA 1K53A 5HY6A 2NS5A 2X38A 3P2BA 5E6NA 4PZ6A 2JSOA 5ELFA 1LT3D 2BWFA 2TMPA 1TQOA 2B2YC 3BG3A 4R4CA 4G57A 2A74C 5TSSA 5CHVC 3NZSA 1I4PA 3BVMA 4YXDB 2K03A 3M3YH 2O6VA 3Q8EA 4HWIB 3W1SA 3ZTDA 4AYBE 1RHPA 4HJ8A 2WDQB 3WA0A 1EZ8A 3OSOA 1WX9A 5D65A 1WGGA 1G6ZA 5IOCA 1WRIA 2EQSA 1PTOF 2K4KA 5DPRA 1QWYA 2Z9HA 4GIVA 1C4CA 1ENCA 2L32A 3AH7A 2EYHA 2HTME 1D8LA 4NXNL 4FJZA 2BW2A 5FR6A 1O7IA 2XK5B 4RGTA 1T0YA 1BUVT 2B63G 1T0QC 1UBIA 4YWKA 2LD9A 3H1UA 2EYFA 4JIOU 1HCZA 2KFKA 5G55A 2WXFA 1L0WA 4HROA 2WQYB 2H88B 3NZ3A 1EY4A 2A6ED 1NMGA 3GV6A 4WWNA 5LHY1 4MNOA 1VDZA 5BN5A 3DBHB 4A3GB 1RDPD 3S24A 2BCOA 4HXDA 1QOAA 2F0GA 4NY0A 1C4QA 2M9VA 3CAMA 3AEEB 5K36H 3QQ8B 4POFA 1SGHA 3HHMA 1PH1A 4IWQA 1WGDA 2VZKB 3HRZC 4HKQA 4OO1H 2PPHA 4II2B 2L00B 4ZQ3A 4XDXA 3T1HL 3KVFB 4JI5Q 3H0GB 3C3LA 3PO2B 4FJYA 4MSMB 1R7SA 1PZKD 4H02A 2JYEA 2O5JC 2MBHA 1WYDA 5KHQA 5JHAA 2CS4A 5IP9G 4LF5L 4A3BB 4OWXB 2IO0B 2ZPYA 2NMQA 3FRPB 4ICVA 2H4OA 1FO4A 3K5MA 2R7ZG 1TYGB 1WH3A 2L05A 1S5DD 2KECA 3KF6B 4KGRA 4WAAA 2ZZPB 1FYCA 2CR5A 2INPE 5GMVA 1ZYRC 4CBVA 3EC8A 2F0TA 4A3LG 2ZT9C 3TBLD 4RG1A 1V5OA 4AUQC 5C44B 3OOCA 1L1OB 2H1EA 2FNJB 1WTQA 3OLMD 1TWGH 4IWPA 5DEHA 4C7ZA 5AEKB 1STHA 1JQYD 1MI2A 1RCVD 4DWFA 1V8QA 1LT6D 4HKZE 1PH8A 4MTNA 2WDTB 4HJ7A 3K81C 4DUYL 1PH2A 5D94A 3AEDB 3PIOA 3CSTA 5D6JB 3I72A 1Q81C 4DNTB 3Q3OC 2QDBA 1PFMA 1HFGA 2F0UA 2WV6D 2C9OA 5GAHC 1Y1WG 1H9MA 2K05A 3AMZA 2VL6A 4K6LA 1B44D 2K8HA 1XWEA 4C3IG 4DR6L 2M19A 2V9HA 3L0WB 2LXKA 1I3QH 2BGFA 4N8X1 1YMHE 3MHSD 3PLUA 3PPAA 1DGSA 5FLXc 1SNMA 4NQKE 1U9RA 2EYMA 1X65A 3J81j 1CTMA 4M8NA 4TMAB 1FFUA 2LRWA 3IBEA 1E0ZA 3NZUA 2KUMA 5IGEA 1QZHA 2QC8A 3A9JA 2CU1A 2JXXA 2I1JA 4HSPA 1MGSA 4A3DB 2UU7A 4S17A 1CZGA 1J6QA 1VZ6A 1GUSA 3A7AB 1KD1C 2KLCA 1JRPA 2C9WB 2PE9A 4HDQA 4JI4Q 2QGQA 1VQ8A 2JYTA 5LMUL 3PIO3 3HK0A 4X65Q 4DR5L 5KYIA 1TWCH 5HKHA 3I70A 1IHZA 4F1SA 2KQ4X 3D0FA 3BYYB 1QOHA 4LUVA 5CORA 4FF1A 5IY0A 1VJKA 3RZWC 2SDFA 3TEWA 1MJDA 2HDLA 2J0TD 3FILA 2JRHA 4GDLB 2BT6A 3VR9B 4H0LC 1E7ZA 3DHGC 1O80A 2WGSA 3H7PA 4MACA 1BBWA 3HOXB 4RGMA 1SYEA 1WJUA 1T9HA 2HD5B 4DK1A 4LFCL 1I94L 3NOBA 1EY5A 1X56A 2UYZB 1YHAA 4K7SA 3X23A 1I42A 1HZ5A 4DR7Q 4C4VB 1H9JA 4LUZA 4DPGA 4IFDG 2R93H 4Y52H 2L0TA 1NE3A 4BZAA 4LNOA 2LVQA 3TSSA 2YYZA 2E74C 2F0IA 3NUCA 4FP5D 3I91A 2MH7A 3KYHC 4I7ZC 4OEMB 1QUQB 3I56A 2AQ3B 2Z6KC 1T0RC 3CRKC 5BN3A 4IPHA 2K5QA 2E6XA 1TWGB 1DM0B 1SNOA 4GZYC 2B2YA 1CFMA 1WI5A 3AXCA 5AUKA 4B9WA 2KCMA 2BA0A 3UDFA 3MWYW 1VQIA 3HOZH 1TY2A 2O5IC 3V2TA 4BY7H 2N7DA 1STEA 1SNDA 4J6IA 3CCRA 4IUNA 2Q2IA 1W6JA 5JPMC 4JI3Q 2JA6G 3K59A 4ZCKA 1V9PA 3L13A 4IG7B 1VQEA 3BU2A 4F7XA 3OHXC 1FIQA 1C0AA 2HE7A 2D5DA 4AS1A 1CHPD 5IOIA 3U2SC 4FYDA 3RD4A 2FINB 2KBNA 1I3QB 4P1BC 1DD2A 1YNND 4A3EG 2VUMG 2IY0B 5FJ8H 3TP7A 3UIOB 3FPPA 1WCMH 1WX7A 4JI5L 5E3FA 3HOUH 1TIFA 3QJZA 3NSWA 4X66Q 2FBWB 4MELA 1VCBA 5AJ3L 4B9XA 2O6VB 3MEFA 1PRTC 3T13A 4XQQA 1XF5L 2KMMA 4DHZB 3J80i 4KKSA 1SDFA 3SGIA 3NS1A 2JQRB 5FLMH 2E2IH 1IUEA 1BCPB 3P1HA 4GN5A 5FLXE 3AM9A 4DUZQ 2IGGA 4LJZC 4WWMA 3EROA 4KN7C 2R92B 5C0XH 1WXMA 2N4FA 1WGKA 4RHRA 3S1RB 3OJ4B 4KX6B 1L5PA 4XE0A 1U4PA 1K83H 2R6GA 2WKDA 1QVFA 1GJXA 2D3CA 2HQEA 2L1AA 1KLUD 1JOOA 3TP5A 2BDOA 4V0BA 4R4TA 4P7IA 4EVOA 2KOXA 3I8ZA 3DBLI 1YN4A 4G4KA 5M5XH 2R93B 3APFA 5M5WH 4XXEA 4K6DA 2ZJPA 1OEYA 2KHWB 2QHOA 3I5JC 2A69D 3KW5B 4FVMA 4YSYB 3U8ZA 3QAQA 1IL8A 2EJFC 2XIWA 1EF1A 2CHBD 4X3UA 2KWUB 1EY7A 1I6HH 3J81i 5E7NA 4ODGA 2XWBB 3IKJA 4DU9A 3GTPB 2KEDA 1JRUA 2WXQA 4CKEA 4JWUC 1OO9B 3H9DA 4HJ5A 4BBRB 1E8ZA 2KN5A 3J81c 3VUWA 1M94A 3T8MA 2ZVOA 1JWAD 3HOZB 4X62Q 4IALA 4BY7B 2HCCA 3F2UA 3JAMc 3ABVB 3Q8FA 1SYGA 4JI4L 3QK0A 2K5VA 2MHVA 4FADA 4X65L 4KY6A 3T3NA 4MZ9A 1S3OA 5C2TB 5IWAL 1XNRQ 2HCIA 3CF6E 3SK6A 1TT5B 3VFKA 1TWHB 1C3TA 2GRIA 3NXWA 3TDQA 1YIJA 3URYA 2ATWA 2C5CA 2K5NA 3RNAC 2F0OA 5DPWA 1OGWA 1E7UA 3CHBD 4DK0A 5EPLA 4ARCA 4A3IG 1YNNC 2REXA 2V1YA 3DWMA 3FP9A 3H3VI 1WCMB 2XSCA 1QOBA 5H8YE 4F8MA 1ET6A 1WD1A 3HOUB 4EUTA 2PZWA 3QOJA 4Q0FA 4RM8A 2I1KA 2I5LX 5EBCA 1X54A 1ROEA 3MXPA 4DR7L 1L2NA 3VDYA 4YCWA 5IYBH 1V86A 3FVQA 5M3MG 5IP7H 2I5MX 3BVZA 3FKIG 2HD3A 2MFIA 1I7HA 1PFDA 1WI0A 3TQYA 3R7RA 1KDCA 3GD7A 1E6EB 2PI2E 2M0AA 4N9F4 4GNXA 2E2IB 1PMRA 1M8AA 1VQFA 2B2WA 4GOPC 3GQBA 1GUAB 2NYZD 3HM3A 3A9JB 3RN5A 1YNXA 4HJKA 2PVGC 1TIID 1XLNA 4DHZE 4QUCA 5CV8A 1WR1A 5DCNA 5H92C 1E10A 4KKTA 3SVMA 3E0EA 4KD4A 2MP2A 1K83B 3HS0C 3AQQA 4POGA 1XTDA 2FAZA 2Z1CA 4JI3L 5I2YA 1P9DU 3PUXA 1YOVB 4KSLC 3AFPA 3J7ZC 1HTOA 1JOKA 2JEBI 1Q1EA 2IWHA 2IO2B 2FMCA 3OIPA 2F0HA 3LWEA 3CCSA 3BK1A 5M5XB 2L9HA 3D6WA 2WINB 2L0FA 3MZ5A 3M4YA 2WU5B 3DUZA 1SB3C 3OW7A 3H7PB 1CA5A 3RI7C 4CJ1B 1VQJA 1I6HB 1KDBA 2PPBC 2L8JA 3N1ZC 4HIMA 3ML8A 2N78A 3E9HA 1CQFA 3DHIC 5C0XJ 1Y8NB 2GBJA 1GHKA 2XVSA 2NB0A 3K57A 3OYYA 2E8GA 5C3EH 1TKEA 1ZEQX 4X66L 1BR9A 3M9BA 2H89B 1VQCA 2JA7B 3DVNV 2B2TC 1NDDA 5DPSA 2EYLA 3HOWG 2LHDA 4XZ4A 4ZRJA 1IBXB 1EO6A 4BFRA 3UQAA 1UD7A 1H9KA 3HM6X 5LNK1 1HFNA 1TKWB 4DV6Q 4GSWA 3HP3A 1OXVA 4IUPA 4JOIA 4N9TA 2LXCA 2R61A 1TWAH 4DUZL 3R3MA 4B0EA 4B9KA 3K58A 4OXPA 2UU9Q 2EIFA 3S2HH 2N9KA 3LJ3A 3J81E 3HOYB 3G6EA 2D0OA 4M1UB 1JMCA 4X3KA 2Q8RE 1BCPF 2EYJA 1TS3A 1B50A 2GOWA 3JAME 1DOKA 4R8IA 2ZTDA 3PSIA 3M85A 3HKZB 3UF8A 2KJHB 1J5EQ 1XTCD 4URKA 2WAQG 3NP8A 2YTYA 1RRBA 3A55A 4JBJA 4HVBA 4FHJA 4LK0M 5HI1A 3EBEA 1QQRA 2KCNA 3BZDB 3AB5A 3V05A 4NP5A 1R4QB 2NBFA 2AYOB 1HRJA 3A9KA 1HNXQ 1N5WA 5GQOA 3HFZB 4QCLA 3V96A 3ZXVA 4NNJB 1HZAA 5CR3A 4A75A 3LWUA 3ZIMA 2BB5A 1PTOH 3VR5A 2LFNA 1V1QA 3PO3G 4EE2A 1N33L 2FCMA 2ZW1A 3UI3A 1TS5A 1VQ9A 2BKFA 4I6NB 5I4DA 2LUEA 4C3HG 2QEJC 5LXHA 1ESRA 4IOIE 1G51A 1PLFA 4BS9A 4PV1C 4CDDC 2LGSA 1SRUA 3K7AH 3J9CA 1IGCA 5IT9c 1ZW7A 1PFSA 2ES2A 2PMZB 3J7AV 3PUVA 2O2LD 1JE4A 4LNKA 2GMIC 4C2MH 1E90A 4JV5L 4TSSA 4WFN3 2N9XA 3VR3A 4A93H 2CHXA 3LB8C 2K5WA 4DKAC 3APCA 2NN6I 4LW1A 1GJZA 2GVBA 3GTKH 3KWLA 1ICWA 4FXDA 2K25A 3I63C 2J0MA 3A56A 1YN3A 4IN3A 2D9UA 2K01A 2WFWA 5BR8Q 1HNZQ 2RGFA 1O78A 2RHQB 3RNCC 2D0PA 4HN7A 1L0YB 1VQLA 2IBIB 2TSSA 3X3MA 1YJJA 1QVGA 1TU2B 1V9JA 4RGOS 1B2TA 5BYSA 2BTEA 1IXRA 1ZXIA 2BS4B 5E4XA 1QOFA 1F77A 2BVCA 4NPSA 4GS3A 3M3JA 4DAMA 2BQQA 1XD3B 1BKBA 4DK6C 3G4SA 1GD7A 3CMMB 4UP8A 1NAPA 1F2ZA 2CW0D 1U4AA 1WM3A 3S2HB 4JK1C 4H2AA 2KA7A 3MAQA 2KVMA 4P16A 2LASA 4RMAA 4N58A 1EYAA 1NUCA 2K22A 1K73C 1SN8A 2LY7A 4MJSA 2IGDA 2IO1B 3HIZA 3KUPA 3N30A 4GOPA 1OEYJ 1KDAA 4B0MA 1FNVA 1AARA 3M7NA 3MC8A 2YTVA 3GOEA 2PTLA 3AB9A 5FO7B 4HJAA 1JROA 2A1AA 1C4AA 2F3IA 3VR8B 1WYGA 5T8IA 1VQGA 4KD3A 3W2DA 4G7OC 4FDBA 3HKZE 2ZPNA 1CSPA 1FJGL 1HR0L 4PS7A 3DCGA 3BVGA 2K8CA 4DV3L 4DV4L 2YU9H 5CTRC 4A20A 2NTSA 1YQ4B 1KRTA 1T3QA 1V49A 2INDC 4JI0Q 3DBRB 5FR3A 2NUCA 2EY1A 4ME3A 3X3NA 5K5PA 4C7YA 1PTOB 5M5YH 2DNCA 1SSOA 4KJOA 1Q10A 1ZP0B 4IURA 1KQSA 5LL6X 1R4NI 3E56A 2K50A 3IFDA 5JJLA 3ZGZA 1LT5D 5KYLA 3SR6A 4ZYNA 1PA6A 3CW2C 4GNXB 4UP9A 1KRSA 1LTRD 3VR2A 1HEZE 4WJQA 3LYYA 4DV6L 2Z0SA 3K7AB 3EUB2 4W9FA 4A3FH 3ZNHB 5IP9H 4WJWA 2B2VC 1SMYD 3SFEB 3H15A 1WTPA 1TBEA 3ONSA 1JT8A 5JPNC 2R7ZH 5I6WA 4C2MB 4LF7Q 2I38A 2HUGA 1QZGA 3ZUNA 2FCSA 1ZOYB 3B0AA 4A3LH 4B08A 2MX2A 2PMZE 2XTIA 1I4GA 1PYBA 3KQ4A 2B8FA 2FCNA 2AQ1B 2WB1G 4Z9CB 3PRZA 1X9NA 1J5EL 2UUBQ 4FF3A 5J1ZA 3B1LX 1NBFC 2NBUA 2M1MA 5IT9E 2CJOA 3CF5A 3HVDA 2VRRB 3NELA 4ZRPA 4TQ0A 3DEPA 2LVPA 3PV0A 1JW9D 3KLSA 3T1HQ 2WX1A 4FXKC 2UXDQ 4NJCA 3GTOH 1XQQA 1FNWA 4YIJA 3PV1A 4CYEA 4DGZA 4MSQB 3HOVB 1CHQD 3ENEA 4UPAA 2JRIB 1HNXL 2L4NA 4KIKB 4I7AA 1GKHA 1YHBA 1FEHA 1Y1WH 3WWVA 1W2BA 4OW0A 5JOBA 4WWPA 2BB6A 1L4ZB 3KYCD 2HDEA 3RNFC 4OIJA 2LZ6A 1YNJD 4OONA 1PQSA 3U58A 4C3IH 4J6HA 2FXQA 3P42A 3T16A 3Q6BA 5CHWA 1JR0D 4FNFA 4FF2A 3QX1A 4WIPA 4JI7Q 4XGAB 5HG2A 2QEXA 4N9PA 2XGTA 2Z4IA 5FOBB 4OVUA 1K0RA 3M7GA 3ZJYC 3UDXA 1HXYD 1S1QB 2INNE 2B63B 1STGA 1V1OA 2JN4A 4IUMB 3T51B 3A0JA 5CGKA 2VQFQ 5LL6S 3SE0A 4HCEA 3P20A 2RDFA 2D11A 2V3SA 1V43A 1V6EA 4L23A 1TJEA 3SK5A 4WJNA 2YU9B 1YJ9A 3RULA 3EA6A 4CJ0B 2NVYB 4DK5A 1LGRA 4F88A 3RZFA 5BR8L 1H9RA 1HNZL 2N3SA 5JVH3 3DBHI 2WXOA 3I4NG 5I6YA 5C3JB 2A68D 1LTSD 5L83A 1AN8A 3W5VB 4ZOHC 4ARIA 3PUWA 2KEEA 1ASYA 3A9KB 3H0GH 2X6GA 2F0FA 3ZJUA 1DZ1A 2RF4A 3Q8BA 4KHZA 3Q8DA 2A5UA 1C79A 4HIDA 1K8AC 2KWCA 4TRDA 2OOBB 3VTUA 2DZMA 2JA5G 3PTFC 1EZ6A 5HGQA 2C35B 3BK2A 2R7ZB 1KHIA 2IY1B 5KNBA 2MJDA 4MH8A 4YSZB 4TQUS 4WORA 1WXSA 3PF4A 2CH4A 5BO4B 4IPDA 2DWQA 1XJVA 3HVZA 3RYTA 1EOTA 1F9SA 5C44H 4LNQA 2DZJA 1H9SA 2LXJA 4FHKA 3MJWA 1NMFA 4D2KA 4A55A 3T3OA 3TP6A 1STBA 3OW2A 1F9PA 4LFAQ 2JA6H 3CSFA 1YNTE 4P73A 2VW9A 4IOCA 2ZEQA 4XX5A 3I4OA 3VYTA 1I94Q 2NN6G 2XBBC 3MXNA 2RHSB 1Z9FA 2SOBA 3UDGA 3NVVA 3F2CA 1MVKA 4RAUC 4K7WA 1Y1WB 2PCFB 4JI0L 1X3QA 2BE5D 5GROA 4JPSA 3CQZB 1XMOQ 2AQ2B 4C3IB 2J4XA 3VTVA 5DLQE 1JC7A 1AW7A 3ND8A 4LLGM 2B3AA 2Y0SE 1DYQA 1I4XA 5HGTA 2DYOA 4LJOB 2SNMA 4IUVA 5IGGA 2D2CC 1MG8A 2HDMA 4XYCA 3CU7A 3V62A 1PH3A 2Y3AA 1JQ4A 2PEAA 4A3DH 4AYBG 2N9LA 5J2RA 3FEWX 4LF7L 3OG5A 2QA4A 3BWUD 4ME5A 4GOCA 4XDDA 1I4QA 4A3MG 4US9A 1Q1OA 4K2LA 1EY8A 4EX5A 5EE3A 1WTOA 2Z6BA 3FHWA 3A54A 5E6PA 5JXVA 2B39A 1FL0A 4LUOA 5C6AA 3H3VC 2E3TA 1D5ZC 2UUBL 1EIGA 1IBKL 2BBCA 3B2FA 3DOWA 3VYSA 4ANXA 1T5XD 2BF8B 4JQWC 1EEFD 1OXXK 2B29A 3KUCB 3Q3NC 2AL3A 3HOXH 1HHVA 2KDBA 2UXDL 1HH2P 1RKNA 1J7CA 3NBHB 4TQ1A 4OO1I 1B3QA 3DHQA 1XLQA 3UINB 2KJRA 2KDFB 4A3JG 3N20C 1EWIA 2F0MA 3QCAA 3E0JA 1VF5C 2IGHA 4EQNA 3AEAB 5IN7A 5JEAG 2OQ0A 5AJ3Q 1ASZA 2L11A 1SFOB 4HMJA 2NTTA 1TKYA 1ML0D 1MIUA 2RSOA 3I57A 1PV4A 4IQZA 2O4XA 3QR8A 3W1BA 2DLBA 2NBWB 1YX6B 4K81A 3V60A 5FK9C 1WYWB 3NVYA 2RSNA 2BH2A 1S5ED 3PF5A 4DHJD 1D5MC 1CKOA 2ZTEA 1EIYB 2KTFA 3GB1A 2BPSA 1BVSA 1PTOD 1FCLA 1F1HA 4C3JG 4JI7L 2HJ8A 1C78A 2Z59B 3L4PA 2K32A 4EOYA 1FM0D 4DV0Q 1MPEA 4KZCA 1B9RA 2AUJD 3L10B 2IPKD 4KHPQ 2VQFL 2JA6B 2PW9A 4FLHA 2QF7A 1B4OA 2EMSA 4IFDJ 1LTBD 3ZO5B 1WXAA 1E8XA 5G5HA 3P1MA 4GU2A 1WGYA 1F2LA 3NE5B 3SDZA 4N59A 4QQBX 2D10A 1PFNA 1J19A 3LXFA 1UWVA 3NY5A 2AHOB 3Q24A 1GAQB 2KZRA 2KENA 4KLKA 1KAAA 4CO7A 4RF0A 2F4IA 3EGRA 3R3OA 4ZDVA 4CJ2C 4A3EB 2VUMB 2ACZB 4YWLA 1VRAB 3Q2AC 4P1CC 1MHWC 2AWTA 2C7HA 4L5RC 2W3RA 3STBD 1LTGD 1AEXA 1Q3LA 3P75A 5HURA 4B3SQ 4GLXA 3PHXB 4MM3A 2EXZA 1AZQA 3PLVA 1CSQA 1SYDA 3T56B 4A3CH 3UE0A 1W6KA 5M3MH 2RSUA 3I90A 4AOFA 4Y7NH 1WMHA 2DBYA 1W3SA 2LKVA 2A6EC 2F0PA 1PYSB 4CHTB 5IWAQ 1WY8A 4I6PA 1HQMC 1B3AA 2DX5B 2CKHB 2ASBA 1EL0A 2R92H 3S1RH 1X6OA 2EELA 3ZRFA 4IO9A 2KJ6A 3SXHA 3K5LA 2WXJA 1QZEA 2K8BA 4PNYA 2V4IB 2EXDA 3CCQA 4LFAL 3K0YA 2OEDA 1TZOA 1TVXA 1G91A 3GO5A 3FC4A 5AZHA 2P5ZX 4YHHQ 1L6UA 1BMLC 1SNCA 2MO1A 4FO2A 4ZYSA 1CJEA 1V8CA 2AEHA 1ILPA 3H8HA 2SEBD 1PH4A 4TV3A 1XMOL 4PYUA 2MUYA 4PYZA 3F1ZA 2PO4A 3R2IA 1MKHA 2EJGC 2RDHA 1X1MA 3E6ZX 3GTPH 1QB5D 2FJ2A 1TS2A 1J8IA 4BBRH 2X6LA 1S3SG 2FIDA 1VMPA 4R9WA 3TS0A 4AQYQ 1QNUA 2AKWB 1S4ZA 4V190 1VQ5A 1PVOA 1R4PB 2MBOA 2F3VA 3HOWH 1H4RA 2KACA 2KVRA 3SU8X 2HIVA 2K1BA 3GTLH 5DM63 1UAPA 1RL2A 2ZNVB 4M8AA 1WIAA 1TWHH 1H9SB 4ZK9B 3KOJA 2NBVB 2VY3A 3ZLZA 1VCIA 2F0QA 3D4RA 3T4AC 3DXJC 4L5SA 1KLGD 1CI3M 1IL2A 3Q8CA 1JWUD 4J1MA 1WOCA 4A3IB 4DDID 3ZVVA 3RR5A 2RDBC 4A6QA 2Q8TA 4HEA1 3ERQA 3MXNB 3CC2A 1G8ZD 3STBC 3LGJA 3RNEC 1QNKA 1X3PA 2Q2TA 1GUWA 1O7YA 3KF8A 5EBDA 4ITKA 2BKRB 4YTNB 3C8YA 4IJHA 5IYCG 2CKZB 3JC66 4XTCS 2L52A 2LWPA 1EQRA 2BS3B 1ZPSA 1VZ8A 5M3MB 3H91A 3FKIB 2WIIB 3GZNI 4Y7NB 3ETRA 2A6HD 4CQNA 3I73A 3DM3A 3QB3A 1EOVA 3NUHB 3SHLA 4W9GA 1SR3A 3ERSX 1CZPA 2VZAA 2IY5B 1RF2D 4OELB 4BA1I 1VD2A 1Q46A 4OIKA 2Z0EB 3PO3H 1SSNA 1N6ZA 2KFKB 4DV0L 1I5FA 3IAS1 5C0XI 3A33B 1A3UA 2LFIA 4M02A 5BMGA 4ANVA 4BBSG 4KHPL 2CJNA 1EYDA 4JC0A 1X3GA 4KY7A 4A3KG 1B8AA 1TY0A 4LK1C 4BWGB 3I3TB 1VQAA 1R9TB 1CKMA 1HA5A 2LSSA 2DYMA 2JZPA 4PMCA 5IP4D 2BH8A 2KCTA 1SF0A 1Q8KA 2VB3X 3ALBA 3L3OC 5EKLA 1N9WA 2B2UC 3SK4A 1RD9D 2VB2X 4JX1C 2C7NB 4AP4C 4L8JA 4YTMB 4L2YA 2K6QA 4KSKC 1EWYC 2KKCA 1FXAA 2XEWA 3TEXA 3SFDB 5AZGA 1NNXA 1E8YA 2GBMA 5CYUA 4OO1G 1NY4A 2KD0A 3AEGB 1LV9A 3DLLA 4O1NA 3JAMi 2E5LQ 4KK7A 1JJGA 4NQLB 2HTHA 3ZW3A 1BT0A 2MNAA 4B3SL 2VZKD 1N33Q 2KXJA 2JA7H 3L17A 4QIWB 3H94A 1V1PA 2A5HA 5LXIB 3KDFA 3HOWB 1IYJB 4CDFC 2JYOA 3GTLB 1NR2A 3A5ZB 1Q12A 1UF0A 3APDA 5EE1A 1EY9A 4I65A 2PYKA 3MEHA 4IZ8A 2LI5A 4FA6A 2MSED 3ML9A 4EKUA 2LEKA 4C80A 3HOYH 4JV5Q 3M62B 4A3OA 3BZCA 4MT5A 5EE0A 4NDXA 3I3CA 4K8IA 1F2RI 4BKSD 5DNFA 1LTTD 5JJIA 2D3AA 2K04A 2PMVA 3ULLA 2KAJA 2W54A 3EJIA 4YHHL 3RPFC 3NPPA 1Y8PB 3N1YC 2WAQB 2MJ8A 3VUXA 1BOSA 1KFYB 2K0PA 4JI6Q 1V80A 2Q8IB 4DXGA 3DEOA 1GUGA 3S1QH 2I46A 3PGEA 3QA8A 2WXHA 4XWTA 1NENB 5BMHA 3NTHA 3FKYA 3Q14C 3RZDH 3PREA 3KLWA 1EF5A 3H6MA 2M17A 5KRUA 3ONAB 2JXTA 3B6YA 2KWVB 1B7YB 1F52A 4DNRB 4QUFA 4B3TQ 1ENAA 4KV2A 2KX0A 4MM3B 2NVQB 4DR1L 4AQYL 3PO3B 2J53A 1EY0A 2LXAA 3BDCA 3MC0B 1SIJA 1WMHB 3P7JA 4HR7B 2W9NA 1GPXA 5BN4A 2WXIA 2Z6KA 4C3HB 4NZLB 3R7QA 2VH1A 2VXWA 4GXBA 1BDOA 1EIFA 1YN5A 3S2DH 1OQRA 2JZZA 3S1NH 4NMZA 4HK2A 2G9DA 1HA6A 3KUZA 1GC7A 3LDZE 4NXMQ 3QARA 2EZVA 5KGUA 4G0NB 5IODA 2K33A 1WVLA 1CUKA 3FILB 2A69C 4K5XA 5CX3A 2IJ0A 4GLVB 2KHSA 1VDVA 3IHPC 1C48A 4ICUA 4FULA 1HPCA 4IM0A 4DXFA 3U30A 1I4RA 1SBBB 3MFGA 1RYJA 1FJGQ 1HR0Q 2EKIA 1EFID 4C1NK 1WTWA 3IRBA 3F2DA 4DV3Q 4DV4Q 3P4SB 4E71A 2VQEQ 2K9XA 1WXQA 4A8XC 1HE8A 1L6VA 2V1CC 1SMXA 1DGJA 2IDYA 1U4LA 3AU7A 3WOFA 5IGBA 3CCEA 2F0WA 2AWOA 1S40A 1LXDA 3DBLB 2JQOA 2WHIA 3WALA 3GP7A 1Y1VG 3RLFA 5EDSA 1LT4D 2EPBA 3M95A 5IA7A 2KDEB 1WE7A 5A2QE 5D7GA 2KQ7A 1EU3A 5JAVA 4CHKA 2NPTA 4GKKQ 2F03A 2KVZA 4JI1Q 1KNAA 2IX1A 1T6BX 4QIWE 5NUCA 3L0OA 2J7QB 3H09A 4GN3B 2OEOA 5A35A 1N32Q 5C23A 4HJGE 1VQ6A 1R4MI 3E5SA 1YITA 1HTQA 1N61A 3RT3B 3C0RB 4FJVB 3K80C 3I4MG 2FHTA 1L1OC 3MA2B 5IYDH 3AEVA 5ELCA 2RMMA 2YEPB 4KGSA 4H44C 1CZWA 1YX5B 2E2DC 1S5FD 5DPTA 2CHWA 4NB3A 2WP8J 2Y5BB 1E24A 2WXNA 2ZCBA 4AJYB 4HCPB 4OWTB 1A63A 3QWZB 4X64Q 2KLGA 1H8CA 2L7RA 4OZCA 3JVZX 1PGXA 2B76B 4US8A 1E22A 4TKOB 4EQOA 2K3UA 5CHFA 3K6OA 4NKLA 3J80L 2KJXA 4QL5A 2K1FA 1CA6A 4DNIA 3AN1A 1GHJA 3RUIB 4JG2A 5JVG3 1KC8C 1YEZA 1UE5A 4LF6Q 3S1QB 1TWFB 3IAM1 5TR5A 1FGUA 1J7AA 3D3RA 2ZCCA 1FXTB 4QAYA 5E6OA 3RZDB 2WKCA 4HCSA 3FMCA 3ULPA 2PQAA 5FJ8G 3CCUA 2ZM6Q 2E5LL 3PCOB 2R3ZA 2B2UA 1OFFA 4W9HA 1QE6A 3NQIA 3DBRI 3I4NH 1D1KA 2HQLA 2PNRC 2F0JA 2M4NA 1JICA 3AE7B 1IW7D 2WX0A 1A5RA 5EQ0A 3QIJA 1EU4A 1ZUD2 3A74A 1FFVA 1EYCA 2DYBA 2JUOA 1F2MA 3S2DB 3S1NB 5HHDG 3BS1A 3MXUA 4XIGS 5EPKA 2M8SA 1EY6A 2RCNA 5EJWA 2CH4W 3FPUB 3TP8A 4UP7A 2O6VD 3P63A 3U7DA 3VTWA 5FLMG 2ICEC 2JA5H 2W55A 1D4BA 1KJTA 4KZ0A 1VQNA 1D7QA 5EGTA 3TRZA 1JJCB 1Y8RC 1BCPD 1RTOA 2N8NA 3CCMA 3EIVA 4X6AH 4PT5A 3ZNGC 1NR4A 1TS4A 4BKGA 5T1IA 3I4LA 4QMGA 1C76A 1S72A 3HG9A 1QJOA 4H7BA 2WB1B 2YTXA 3J7A5 2BOSA 2AX5A 1HNWQ 2L83A 4PZ8A 4L5TA 2BS2B 2R2OA 4A90A 4U68A 1SYFA 3Q3FA 4OGQC 1EUJA 2IO3B 3WCQA 4AQ7A 2BWES 2A19A 3A4SC 4JI6L 3WANA 4P75A 1KAWA 4R4QA 2JX5A 2WS3B 4K14A 3HOVH 1P3QU 1G6JA 2XWJB 3Q3MC 5C1ZA 1G6PA 2DAJA 2JWUA 3DWAA 3NQTA 3K5NA 4YY3Q 1VZ7A 2NZHA 1E1OA 4X3SA 3ZKJC 3W5UB 3RLNA 4B3TL 5CC4A 2WU2B 4IM3A 3VDZA 2JK8A 2N49A 2OCEA 1PH5A 3PQIA 3W3AA 3PZ7A 2WNMA 4ZUJA 1ZDVA 1JE5A 1EQVA 1I50H 4BKTA 3K0XA 1FVIA 2ZXPA 1A3VA 1MG4A 2MQHA 2KFJA 5M3FG 2EKEC 4EEWA 3BIID 2WDRB 1JWMD 2O2VA 1XLPA 5L37A 2MLBA 1BF4A 4NXML 1LFDA 2ZXRA 1LLRD 2KC2A 2MBQA 2OTJA 4JBKA 4UDUC 4MH0E 2I2YA 4OX9Q 2B63H 2E75C 2EYPA 4JL9A 2J0JA 2F3WA 4CKCA 1YJ1A 4RFBA 1PDQA 2VS1A 2XK5A 2D07B 2ZXOA 4PS3A 2VQEL 1NCVA 2I0QA 3FAHA 2EY2A 1Q0WB 1N8RC 2NVYH 1LTAD 1I35A 3OMCA 1A2UA 2KCCA 2LVOA 4MEMA 1K8RB 3EFUA 3I4NB 4BY1G 1SE3A 1YVCA 1XCQL 3D31A 1DOMA 2DJFC 3AYHB 4BAXA 4DR3Q 3D6CA 3AULA 1PXUA 2CFMA 2K52A 3GTMH 4ZAIA 1WR6E 3GDEA 4S3SA 4GKKL 2G4DB 3NWSA 4A3JH 4JI1L 1Y69U 1PH9A 3NVZA 3W1SC 1NSNS 5CBAE 4PG3A 1Q82C 5JEAH 4HIKA 3PGZA 1N32L 2JA5B 2EMTA 2KDMA 1MJCA 2B2TA 3ND9A 2MP2B 4FXCA 3RZOH 2W3SA 2JF5A 1BCPC 3SHQA 2NVTB 1XT9B 5J3BA 4LDTB 4IPGA 1X32A 1YJIA 1EIHA 4ID6A 4KJNA 1UNSA 1OQQA 3NK9A 2C5LC 1UE1A 2LS01 1LTLA 1GOZA 4QJFA 1II3A 4X64L 1IBKQ 2N9PC 1AYFA 2WP9B 2IYDB 2YEPF 4A76A 3H7SA 1LYLA 2QJLA 4O42A 3KJOA 1XPRA 2L5TA 1PYWD 1MD2D 1Y14B 3KLSX 4YCVA 4FN2A 4LF6L 2K5HA 4XYOA 2Q2HA 2LMCA 2JZ3B 3TZDA 4DR4Q 2CW0C 2GN5A 1XPUA 4L5QA 2ZM6L 3PSEB 3CQZH 1V2YA 3PZ8A 1ET9A 4B95A 2JEAI 4KGTA 1P98A 2YV5A 5C3EG 5HFYA 4PZ7A 5ELOA 3SK8A 1VQMA 4R4IA 2HHHL 4JI8Q 4DV7Q 1I50B 4KDIC 1PGBA 2NPTB 3KYDD 5KIXA 4HAEA 3Q6SA 5D3DA 4LAAA 3D32A 2J0KA 5CBEE 4BBNC 4K8JA 1JB3A 1KIXA 3W9CB 5T1GA 3RFZB 4BVUC 3HZXA 1F9QA 3VA5A 1PRTB 2KT7A 2HT1A 3AE5B 1IGDA 4JW0A 4BXXG 4K7UA 1QOGA 2JXMB 2XRSD 4AYBB 4XWWA 1FCCC 2M00A 5IGFA 1SAPA 3G48A 2QILA 3AU4A 1UBQA 4W9LA 4A3MB 4IDIA 3T9LA 3QJYA 2GB1A 5M9OA 3CP0A 3M4OH 2M56B 2K7VA 4IJLA 1IBML 2GI9A 1QT9A 2K75A 2KMCA 2N1WA 2MCNB 1GXDC 3F2BA 4JBWA 1D1IA 1HNWL 2LJ5A 1FD7D 3K9PB 1WJJA 3Q23A 2PLPA 5BYRA 2DY8A 2F1MA 3DHHC 3H6NA 4AIMA 1YHQA 2PVOD 4X57B 1TXYA 1BBUA 1YI2A 1ZE3D 1PZID 1C77A 2OXPA 4GDLA 3E9IA 4X3TA 1HR0W 3GTMB 1E8WA 1WTRA 2UWQA 2WXPA 3EVQA 2PQAB 4O2DA 5E4WC 4A3JB 1YJNA 1CK1A 4DN4M 3C2PA 3KUDB 4JI2L 2G1EA 3L16A 4IUQA 1SMYC 3MHBA 3I9V1 4YY3L 4QGUA 3OAWA 4IFDH 1SFOH 1PGAA 3C46A 3RZOB 3DVGY 4IFDI 1P16A 4JLCA 4M01A 1L4DB 3CC7A 4C4VA 1FGBD 4O0AA 3TIXA 4F8CB 4U673 3HKSA 2N7JA 1YJWA 1V81A 1XMQL 4K0KQ 1PUTA 4C3JB 3TEYA 1JWBD 3S14H 5LLIA 1E1TA 2C60A 5C4XG 3PS6A 2DHZA 3GV3A 4LNIA 3D8GA 4OX9L 1HTPA 4GLAC 3NENA 3RCZA 2OQKA 4DFAA 4G7HC 2JSVX 1GUNA 4PMWA 4A9AA 2ASQA 4QY7A 5JEAJ 3NG0A 3U7ZA 3ZDMC 1DOIA 1YD8U 1Z2MA 4A93G 2SNSA 2GVAA 1ZYRD 3U9OA 2GA4B 2BDNA 1BNZA 2JP1A 2MP1A 5GADC 1EFWA 2DJGC 1B9NA 1YNJC 1JMLA 1ZDXA 3MHZA 2EE1A 1QVCA 3IT6B 3IT4B 3CIRB 1HJPA 2UXBQ 1A6XA 2EY5A 2F0SA 4A3EH 2VUMH 1WX8A 2ICIA 3VHTC 1OXSC 1RM6C 5F2DA 4DR3L 1K52A 1UELA 2INCC 3CPFA 3N6RA 4JGHB 1VS0A 3BDLA 5J22A 1WWTA 3GTJH 2UXCL 4YTPB 3UGBB 1KXLA 3LNNA 4R1JA 2G5DA 1C7YA 5IYCH 3A8JE 4HPLB 1HZ9A 3AECB 1BO0A 1UZXB 1EYGA 4HCNB 2Y0SG 3S9WA 3CCVA 1PDXA 2G9HD 3JW0X 2PI2A 1LQBA 1RODA 3QC8B 4ASWC 4GOPB 1J0GA 3CKIB 2JT4B 5H1SE 3KH0A 4PMBA 2D62A 4LTUA 3M4OB 1D2BA 2O2VB 4JBMA 1VMCA 3Q0AA 2B2VA 3NEMA 4ALPA 5CV7A 3VH3B 3C19A 1F2RC 2Q2UA 3A8IE 2X69A 3U4ZA 1ENFA 2V3NA 1N34Q 2A68C 4W9DA 1SIFA 1LACA 1QCBD 1BBXC 1XLOA 3OMGA 4BBSH 1WGHA 3TBIB 1AE3A 1XX8A 3DDCB 1A62A 5KNCA 2D3GA 4A3KH 3B2GA 3VRBB 5D14A 3S16H 3HUIA 3NTKA 4WH4A 4UHVA 2JA8G 2Q5WD 4DR4L 3WAPA 1NYQA 2GBNA 3JSVA 1K3BC 1VQOA 1QKZA 3CWIA 4DAYA 4HLEA 4IUUA 3B9JA 3IVFA 4RWSC 1Y56A 4JI8L 4DV7L 1TKGA 2LGYA 4W9JA 3RUZA 1T0SC 4TUUA 4P71A 4RMFA 3S14B 2FMMA 4E74A 3VVWB 5L95C 4RH6A 3P4PB 1CT1D 3AEBB 1JOQA 2DY7A 1JCKB 4KMUC 1Q5WB 4A3FG 2W82A 3KJPA 1XEEA 3Q8AA 3K8AA 2ALYB 4PS8A 1ZGUB 2LUMA 2KK8A 3AFQA 1XXGA 1GC6A 2I07B 2MW5A 4QB4A 1PRTF 5JJKA 1P7EA 4WQOB 3Q3JA 4RCOA 2BE5C 3QWNA 2IL8A 3DWGC 3L7ZC 1AWDA 5AUIA 2WACA 5IO9A 4ZHPA 3IAYA 4LDTD 5FKAC 1SLJA 1EEID 3NJTA 4A3IH 2N55A 1WE6A 1DOYA 3QOLA 1AH9A 4WAFA 2RPQA 2K14A 2LMCB 4EZKA 4DDGD 2X8XX 4B6WA 5LMNQ 1Y8OB 1G2SA 3GTJB 4RCNA 4P6VF 3PMFA 1EQTA 3AI5A 2V4DA 1S5CD 5ELDA 5C5MA 4S0RA 4HMIA 1B53A 1IYFA 4IW0A 4LNFA 2XRQD 3N32A 1WTHA 1KM7A 3FKIH 1UUPA 2AWNA 1K8GA 1Z7TA 1ONLA 2KQSA 4CKBA 2PQEA 4DA2A 3U50C 2PW5A 3BY4B 4L1BA 1LO5D 2N1VA 3OIQA 3M3YB 3A8KE 1IYVA 2OJWA 1SXTA 3K9OB 4AWJA 1GNUA 2MO0A 4K0KL 1HUNA 1JWSD 1Q1BA 1WSPA 3V6CB 2IT1A 2QW7A 4FF4A 1K8MA 1OTCA 2K6AA 3AMUA 3DQVA 1QLBB 1X3EA 4KHVA 3NWTA 2DZIA 3EFCA 4ZRZA 4JVZA 3A1QA 4ZHOA 3C1EA 5IKCM 3IFTA 4BBSB 2CQOA 4A3KB 3ITPA 3S16B 3OPOA 1RFKA 1R9TH 1VQKA 5CV9A 5ELNA 1PRTD 3W5OA 1M1KC 5IE8A 1A0IA 4DAPA 5MPOA 2G45B 3RMKC 2L1BA 2ZJQA 5AFWA 1DONA 3P4RB 3MVVA 5C5LA 4R8NA 2UUAQ 2MEKA 1MHXA 5G5GA 5JHBA 2MJ3A 3ICEA 2F52A 4A3GG 4MGKE 4ZRKA 2UXBL 3WDNA 1UWXA 1XO3A 4WJOA 4DBGA 3ZDTA 3U52E 4E3CA 1C8CA 1PTOC 3ZQ4A 2EDGA 3VR4A 4NAWA 5ISRA 3S17H 1ESFA 3CD6A 2Z0DB 4WURA 3E3XA 3G7LA 3H0GG 3PO2G 4DV1Q 4DR1Q 2NZ1D 2GBKA 4PK1A 4ZKBB 2CQAA 2K5PA 4GNXC 1WJ6A 3GS2A 4JE3B 1Y1VH 4KKJA 4RF1A 4A3BG 2B2WC 1SE8A 2R2QA 1UGMA 3GTQH 1B1ZA 2IHFA 1ZXTA 1MBYA 4IC7B 4RKLA 4EQ5A 2L55A 3VAWA 3CCLA 1MSHA 4MJSB 1TR5A 2PNHA 3TREA 4UY8C 1CKNA 2V3PA 3SD5A 2EJMA 1IBXA 3BYTB 3RNUA 3DVNU 4ANUA 2DUDA 3J7AF 5C44G 5KEEA 1AZPA 4JYAQ 1C4PA 1PH6A 4IPCA 1N34L 3NS8A 1CQVA 1KABA 3I4MH 4F7ZA 2RDGA 1RLFA 2RD0A 1VQPA 1E3PA 1V97A 5EE9A 2FIFA 2WXKA 1C9FA 1G2TA 1OTRB 4WJ3M 4W9CA 1L2FA 1MSGA 1IYUA 5GAGC 1DJRD 1TGZB 3G71A 2KX3A 1GG3A 2KC1A 3OWFA 2F0KA 3SEBA 4DR2Q 1WFYA 1Z47A 1LUZA 5JH5C 2BA1A 3EN2A 1ICFB 2MPMA 3AE1B 4LFBQ 2EVBA 4K1RB 5D2MB 1UH6A 4ZRIA 3SDLC 4K2KA 1SE4A 1RAXA 5C3WA 1K28A 4AJWA 4EQPA 1FXIA 2F0EA 4IWOA 2NVQH 1OQYA 4QF4A 3ULJA 2GLSA 1J7BA 2VNUD 1VR9A 1GUOA 2DGYA 4JOIC 4ZKCB 3VYUA 3TZUA 4C3HH 4A3DG 1FMAD 4K3BA 1N60A 1L0XB 1KRHA 4B3MQ 2OF1A 4OHJA 2BYEA 3R2TA 5DM73 1TTNA 4OVZA 1FRRA 1K3RA 4GB9A 2RPVA 3UDIA 2N7EA 1TWCB 2DNEA 3OTOQ 1SE2A 4WJPA 4GDKA 1YQBA 2EY6A 3J80c 5FO8B 4RKBA 3P4QB 3S15H 4M00A 5K36G 2GBRA 1RJTA 2V4LA 4OZAA 1AE2A 1U4RA 2F0DA 3CRLC 1XNQQ 5KHOA 2ZTCA 3S17B 2L3ZA 3TMPB 3HOXG 4EZJA 5LMNL 1UEAB 2FFKB 3JSVB 2FUG1 4IUTA 1IP9A 1EWCA 4DAYB 4ACFA 1Y1VB 3R93A 3PUYA 3RNGC 1E2WA 3GTQB 3B08A 2HIXA 1A3TA 4M0WA 2R7DA 1A2TA 5J39A 1KL9A 1KH0A 1ILQA 2ON8A 3FDTA 5FLXL 4XT1B 1WZ3A 3ZRCA 5IGDA 4E6IA 2QIEB 4YL8A 1B70B 3WAMA 4REZA 2JA9A 1WFQA 1E2VA 3PHWB 2R7FA 4HSVA 3I4MB 4L63B 4DQOC 3KBXA 3PT2B 4ILWA 4YWGG 3HRDD 4WJ4A 3NBIA 1TZ1A 3NRZA 5E1FA 4L6TB 4C1NI 3VUYA 1X55A 3BJUA 2YLMA 5M3FH 2CWPA 3L9AX 4KDLB 2L12A 1EUVB 4HRSA 3DVGX 4P74A 3E9SA 1WJ4A 1YIWA 2CVRA 3ECIA 3M4QA 3PUZA 1H95A 2UUAL 4M8MA 5J18A 5D3IB 3AE6B 2A6HC 1K50A 1EWHA 2WDVB 1ZKOA 2WXLA 2V0GA 1TWFH 4C00A 2F0LA 3I55A 4KKUA 4ZLTF
chains in the Genus database with same CATH topology
2CU3A 1S5BD 3C1FA 1DCZA 3DMUA 4OZBA 1RWSA 1HTLD 4EGVA 4RNAA 5I2XA 3TMEA 2ID0A 4BA2I 1IKMA 2IW3A 2RQXA 3TUOA 4JWSC 4ABNA 1GB1A 3MTSA 4Q5VA 2L0CA 2XN9C 2ENBA 5IIFA 3AE8B 3IXSA 1DOLA 2IX0A 3R8BA 1HUMA 2WXMA 3S15B 3NHHA 1E0BA 2IX3A 2OHFA 5IGCA 1D5XC 1F2YA 2DN8A 2QMTA 1JORA 3K5OA 1KNEA 4FXGC 3D4WA 4H13C 1GUTA 1D6EC 1FRDA 5M5WB 3VRAB 4RGNA 3J80E 5CV6A 5EKKA 4NAWB 2J7ZA 4MHEA 2N88A 1PZJD 3DWQA 3T53B 2PZTA 4NW2A 1TT2A 2JE6I 1STYA 2RVLA 1E7PB 3QG1A 3VYRA 1SEBD 1LTID 3AEFB 5M3FB 1QILA 5I9OA 3DWPA 1OXTA 1OXUA 1AFPA 5BMIA 3LX0A 2QCPX 1WD0A 4KV6A 2RKSA 5FO9B 1Q90A 1KF6B 2Z8LA 2LHEA 2LJIA 4YT0B 4KTAA 1STNA 1PFBA 4NAMA 3GTGB 4BY1B 1F0ZA 3MFYA 3KWVA 1GB4A 5E6JA 3VQIA 1LABA 1B9MA 5A2QL 1N62A 1NYRA 4XQJA 3AE9B 1N63A 2KOLA 4GLSC 5CV4A 2E2JB 4F87A 3J81L 5C0XG 1E2ZA 5I9PA 1UGJA 3EFXD 1CM9A 3JAML 3TEZA 2F0NA 1FR3A 1P7FA 3NTIA 1M4VA 5ELEA 1RTNA 3PO0A 2FE8A 2QSDA 4GDKB 2PZUA 1BQQT 2ONQA 1SJHD 4LMQD 1QF6A 3ZJTA 2JU6X 4Q2JA 2NN6H 2K5DA 1XYIA 1BUIC 1T5EA 2XNAC 1MHHE 3SR1A 1V1PB 5COYA 5C3EB 2M2LA 3PIP3 1ACCA 2WLBA 2KWDA 3MJ5A 4WQMA 2Y5PA 2WXGA 4WRDA 1I4HA 4K5VA 5BYQA 2SAKA 2E2HB 5C3XA 1TWAB 3DM1A 4J3OD 5CV5A 1O7ZA 4KI0A 2J52A 3ZYYX 5DAUA 1MI0A 2K28A 2NVXB 3TN2A 2J42A 2E76C 4XDCA 4OL7A 5ELBA 1G291 1IW7C 4C56C 1XCTL 3D4DA 4P2CB 1UWMA 4DF7A 2NWGA 3QO2A 1NEKB 4K5WA 3IL8A 2N0SB 3V3XA 2Y5CA 4RHSA 2MJEA 4ZRQA 1SYCA 2KQ3A 1YQ3B 1SNPA 3NBHA 3EQLC 3A7LA 5C4HA 4IKGA 3WOEA 1A15A 5EPJA 3NVWA 3G6JB 4KN4C 1AP0A 4N6EB 2OT2A 1WTXA 2ZW0A 3MP9A 5C4XB 4G7ZC 1F9RA 2PKOA 1A70A 3Q69A 3HGBA 4ULLA 4USAA 1Z6HA 3KLRA 1I6VC 1BXTA 4UAIA 3N9YC 3AE2B 4A93B 3U4EG 1Q8IA 3GTKB 5EKIA 3S1MB 1FD6A 4DAVA 5G3LF 3OWEB 3Q22A 1J9OA 3KK7A 2MGSA 1WTVA 1QG7A 1HQRD 1U4MA 4CGYB 5JJZA 3N52A 1L0VB 1ZXHA 2PIAA 5C4ZA 2Y0SB 2LGIA 1STAA 4XQNA 2F0VA 4PQXA 1K8OA 3AV8A 5IT9L 4ZUIA 4RA8A 3RMHA 4YSXB 1DXMA 1K51A 3QIAA 2JA8B 3HEJA 2RA4A 1VF7A 2EOTA 1N5XA 5KNDA 4MN3A 5G3LD 5M5YB 1FNUA 2AUKA 2A73B 3VA7A 3AE3B 5C4JB 3BDOA 1IKLA 3VR6A 1SNQA 4A3FB 1JALA 3MXGA 4R3DA 1SYBA 2B8GA 4XT3B 4HTHA 4MIUA 3ZJVA 2RBMA 1HZ6A 4KKIA 2KN4A 2D5GA 2BYTA 3U9SA 1EM7A 3J7YW 1NI3A 5CMDA 2Z4HA 1DOXA 2PW7A 2WXRA 1NVID 2QKIC 4KY5A 3UI2A 1VLBA 4XYQA 3KBGA 1KTKA 4J8QA 3GTOB 4HEDA 5GXGB 1E9MA 3O13A 1SJED 1O7LA 3AE4B 2EYOA 1K53A 2X38A 5ELFA 2JSOA 1LT3D 2TMPA 1TQOA 2B2YC 3BG3A 4G57A 2A74C 5TSSA 1I4PA 3BVMA 4YXDB 2K03A 3Q8EA 3W1SA 2WDQB 1RHPA 1EZ8A 3OSOA 5D65A 1G6ZA 5IOCA 1WRIA 1PTOF 1QWYA 1C4CA 1ENCA 2L32A 3AH7A 2EYHA 2HTME 2BW2A 4RGTA 1BUVT 2EYFA 1HCZA 2WXFA 4HROA 2WQYB 2H88B 3NZ3A 1EY4A 2A6ED 3GV6A 5LHY1 1VDZA 5BN5A 4A3GB 1RDPD 2BCOA 1QOAA 2F0GA 1C4QA 2M9VA 3AEEB 5K36H 2VZKB 3HRZC 4HKQA 4OO1H 4ZQ3A 4XDXA 3H0GB 3C3LA 3PO2B 1R7SA 1PZKD 2JYEA 2O5JC 4A3BB 2NMQA 3FRPB 2H4OA 1FO4A 3K5MA 1TYGB 1S5DD 2KECA 4KGRA 1FYCA 2INPE 1ZYRC 4CBVA 2F0TA 2ZT9C 5C44B 3OOCA 2H1EA 1WTQA 5DEHA 4C7ZA 1STHA 1JQYD 1MI2A 1RCVD 1V8QA 1LT6D 4HKZE 3AEDB 3I72A 4DNTB 2QDBA 1PFMA 1HFGA 2F0UA 2WV6D 2C9OA 1H9MA 2K05A 3AMZA 4K6LA 1B44D 1XWEA 4C3IG 2M19A 1YMHE 1SNMA 1U9RA 2EYMA 1CTMA 4TMAB 1FFUA 1E0ZA 2KUMA 5IGEA 4HSPA 1MGSA 4A3DB 1CZGA 1VZ6A 1GUSA 3A7AB 1JRPA 2JYTA 3PIO3 5KYIA 3I70A 1IHZA 2KQ4X 3BYYB 1QOHA 5CORA 4FF1A 1VJKA 2SDFA 3TEWA 2HDLA 2J0TD 3FILA 4GDLB 2BT6A 3VR9B 4H0LC 1O80A 4MACA 3HOXB 4RGMA 1SYEA 4DK1A 1EY5A 1HZ5A 1H9JA 4IFDG 3TSSA 2YYZA 2E74C 2F0IA 3NUCA 4FP5D 3I91A 2MH7A 4I7ZC 2AQ3B 3CRKC 5BN3A 2K5QA 2E6XA 1TWGB 1DM0B 1SNOA 4GZYC 2B2YA 1CFMA 5AUKA 4B9WA 2BA0A 3MWYW 1TY2A 2O5IC 3V2TA 1STEA 1SNDA 4IUNA 1W6JA 5JPMC 3K59A 4F7XA 1FIQA 3OHXC 2D5DA 4AS1A 1CHPD 3U2SC 4FYDA 3RD4A 2FINB 1I3QB 1DD2A 1YNND 3TP7A 3FPPA 5E3FA 3NSWA 2FBWB 4B9XA 1PRTC 3T13A 4XQQA 1XF5L 2KMMA 3NS1A 4KKSA 1SDFA 2JQRB 1IUEA 1BCPB 3P1HA 5FLXE 3AM9A 2IGGA 4LJZC 4WWMA 3EROA 4KN7C 2R92B 5C0XH 1WGKA 4RHRA 3S1RB 4KX6B 4XE0A 1L5PA 1U4PA 2R6GA 2WKDA 1GJXA 2HQEA 2L1AA 1KLUD 1JOOA 3TP5A 2BDOA 4V0BA 4EVOA 3I8ZA 1YN4A 4G4KA 2R93B 4XXEA 4K6DA 4YSYB 2A69D 4FVMA 1IL8A 2EJFC 2XIWA 2CHBD 4X3UA 1EY7A 4ODGA 2XWBB 3IKJA 4DU9A 3GTPB 2KEDA 2WXQA 4CKEA 4JWUC 1OO9B 4BBRB 1JWAD 3HOZB 4IALA 4BY7B 2HCCA 3F2UA 3Q8FA 3ABVB 1SYGA 2MHVA 4KY6A 3T3NA 5C2TB 2HCIA 3SK6A 1TWHB 2GRIA 3NXWA 3TDQA 3URYA 2C5CA 2F0OA 3CHBD 4DK0A 5EPLA 4ARCA 1YNNC 3DWMA 1WCMB 2XSCA 1QOBA 5H8YE 4F8MA 1ET6A 1WD1A 3HOUB 2PZWA 3QOJA 4Q0FA 5EBCA 1ROEA 3MXPA 3FVQA 3BVZA 1PFDA 1I7HA 1KDCA 3GD7A 1E6EB 2M0AA 2E2IB 1PMRA 1M8AA 2B2WA 3GQBA 2NYZD 2PVGC 1TIID 1XLNA 4QUCA 5CV8A 5H92C 1E10A 4KKTA 3SVMA 4KD4A 1K83B 3HS0C 2Z1CA 5I2YA 3PUXA 1JOKA 2JEBI 1Q1EA 2IWHA 2FMCA 3OIPA 2F0HA 3LWEA 3BK1A 5M5XB 2L9HA 3D6WA 2WINB 3MZ5A 3M4YA 2WU5B 3DUZA 1SB3C 3OW7A 1CA5A 4CJ1B 1I6HB 1KDBA 2PPBC 1CQFA 5C0XJ 1Y8NB 1GHKA 2XVSA 2NB0A 3K57A 1TKEA 1ZEQX 1BR9A 2H89B 2JA7B 2B2TC 2EYLA 2LHDA 1IBXB 5LNK1 1H9KA 1HFNA 1TKWB 3HP3A 1OXVA 4IUPA 4N9TA 2R61A 4B0EA 3K58A 2N9KA 3J81E 3HOYB 4M1UB 4X3KA 2Q8RE 1BCPF 2EYJA 1TS3A 1B50A 3JAME 1DOKA 4R8IA 3M85A 3HKZB 1XTCD 3NP8A 3A55A 4LK0M 5HI1A 1QQRA 2KCNA 3BZDB 3AB5A 3V05A 4NP5A 1R4QB 2NBFA 1HRJA 1N5WA 4QCLA 3V96A 5CR3A 3LWUA 2BB5A 1PTOH 3VR5A 2LFNA 4EE2A 2ZW1A 3UI3A 1TS5A 5I4DA 4C3HG 2QEJC 1ESRA 4IOIE 1PLFA 4BS9A 4PV1C 3J9CA 1IGCA 2PMZB 3J7AV 3PUVA 2O2LD 1JE4A 4TSSA 4WFN3 3VR3A 3LB8C 2K5WA 2NN6I 3KWLA 1ICWA 4FXDA 3A56A 1YN3A 4IN3A 2D9UA 2K01A 1O78A 4HN7A 1L0YB 2TSSA 3X3MA 1YJJA 1TU2B 4RGOS 1B2TA 5BYSA 2BTEA 1ZXIA 2BS4B 5E4XA 1QOFA 1F77A 1NAPA 1F2ZA 2CW0D 3S2HB 4JK1C 4H2AA 2KA7A 3MAQA 2KVMA 4P16A 4N58A 1EYAA 1NUCA 2K22A 2LY7A 2IGDA 3KUPA 4B0MA 1KDAA 1FNVA 3M7NA 2PTLA 3AB9A 5FO7B 1JROA 1C4AA 3VR8B 1WYGA 5T8IA 4KD3A 3W2DA 4G7OC 3BVGA 2NTSA 1YQ4B 1T3QA 5FR3A 2NUCA 2EY1A 3X3NA 5K5PA 4C7YA 1PTOB 2DNCA 1SSOA 4KJOA 1Q10A 1ZP0B 4IURA 5LL6X 3E56A 3IFDA 3ZGZA 1LT5D 5KYLA 3SR6A 1LTRD 3VR2A 1HEZE 3LYYA 3K7AB 3EUB2 4WJWA 2B2VC 1SMYD 3SFEB 1WTPA 5JPNC 5I6WA 4C2MB 2I38A 2HUGA 1ZOYB 4B08A 3KQ4A 1I4GA 2B8FA 2AQ1B 4Z9CB 4FF3A 5J1ZA 5IT9E 2CJOA 3HVDA 4ZRPA 4TQ0A 3DEPA 3PV0A 1JW9D 3KLSA 4FXKC 4NJCA 1FNWA 4YIJA 4DGZA 3HOVB 1CHQD 2L4NA 1FEHA 4OW0A 5JOBA 2BB6A 1L4ZB 2HDEA 4OIJA 1YNJD 4J6HA 3P42A 3T16A 1JR0D 4FNFA 4FF2A 4WIPA 5HG2A 4N9PA 2Z4IA 5FOBB 3M7GA 1HXYD 2INNE 2B63B 1STGA 1V1OA 3T51B 5CGKA 5LL6S 3SE0A 4HCEA 3P20A 2RDFA 1V43A 4L23A 1TJEA 3SK5A 2YU9B 3EA6A 4CJ0B 2NVYB 4F88A 1H9RA 5JVH3 2WXOA 5I6YA 5C3JB 2A68D 1LTSD 1AN8A 3W5VB 4ZOHC 4ARIA 3PUWA 2KEEA 2X6GA 2F0FA 3ZJUA 1DZ1A 3Q8BA 4KHZA 1C79A 4TRDA 1EZ6A 3BK2A 2R7ZB 2MJDA 4MH8A 5KNBA 4YSZB 4TQUS 4WORA 2DWQA 3HVZA 1EOTA 1F9SA 1H9SA 4D2KA 4A55A 3T3OA 3TP6A 1STBA 1F9PA 1YNTE 3VYTA 2NN6G 3MXNA 2SOBA 3NVVA 1MVKA 4RAUC 1Y1WB 2PCFB 4JPSA 1X3QA 2BE5D 3CQZB 2AQ2B 4C3IB 2J4XA 1JC7A 1AW7A 3ND8A 4LLGM 1DYQA 1I4XA 5HGTA 2DYOA 2SNMA 4IUVA 5IGGA 2D2CC 2HDMA 3CU7A 2Y3AA 1JQ4A 2N9LA 3FEWX 3BWUD 4ME5A 4XDDA 4US9A 1I4QA 4K2LA 1EY8A 5EE3A 1WTOA 3A54A 5JXVA 2B39A 2E3TA 5C6AA 3H3VC 1D5ZC 1EIGA 2BBCA 3B2FA 3VYSA 1T5XD 1EEFD 1OXXK 1HHVA 1RKNA 4TQ1A 1J7CA 4OO1I 3DHQA 1XLQA 2F0MA 3E0JA 1VF5C 2IGHA 4EQNA 3AEAB 5JEAG 2L11A 1SFOB 4HMJA 2NTTA 1TKYA 1ML0D 3I57A 2RSOA 4IQZA 2O4XA 2DLBA 5FK9C 3NVYA 2RSNA 1S5ED 1D5MC 3GB1A 1PTOD 1FCLA 4C3JG 1C78A 3L4PA 2K32A 1FM0D 1MPEA 1B9RA 2AUJD 2IPKD 2JA6B 2PW9A 2QF7A 1B4OA 4IFDJ 1LTBD 5G5HA 3P1MA 1F2LA 3NE5B 3SDZA 4N59A 1PFNA 3LXFA 3Q24A 1GAQB 1KAAA 4RF0A 2F4IA 3EGRA 3R3OA 4CJ2C 4A3EB 2VUMB 2ACZB 1VRAB 2W3RA 1LTGD 1AEXA 1Q3LA 3P75A 5HURA 2EXZA 1AZQA 1SYDA 3T56B 1W6KA 3I90A 2DBYA 2LKVA 2A6EC 2F0PA 4CHTB 1HQMC 1B3AA 1EL0A 2EELA 3SXHA 3K5LA 2WXJA 4PNYA 2V4IB 3K0YA 2OEDA 1TZOA 1TVXA 1G91A 3GO5A 3FC4A 1L6UA 1BMLC 1SNCA 4ZYSA 4FO2A 1CJEA 1V8CA 3H8HA 1ILPA 2SEBD 2MUYA 2PO4A 3R2IA 2EJGC 2RDHA 3E6ZX 1QB5D 2FJ2A 1TS2A 1J8IA 2X6LA 1VMPA 4R9WA 1QNUA 1S4ZA 4V190 1R4PB 2F3VA 2KACA 2K1BA 5DM63 1UAPA 4M8AA 4ZK9B 1H9SB 1VCIA 2F0QA 3D4RA 3T4AC 3DXJC 1KLGD 1CI3M 3Q8CA 1JWUD 4J1MA 4A3IB 4A6QA 2Q8TA 4HEA1 3ERQA 1G8ZD 1QNKA 1X3PA 1GUWA 1O7YA 3KF8A 5EBDA 4ITKA 4YTNB 3C8YA 4XTCS 2L52A 2BS3B 1ZPSA 1VZ8A 5M3MB 3H91A 3FKIB 2WIIB 4Y7NB 3ETRA 2A6HD 4CQNA 3I73A 3QB3A 3NUHB 3SHLA 1CZPA 1RF2D 4BA1I 4OIKA 1SSNA 3IAS1 5C0XI 1A3UA 2LFIA 5BMGA 2CJNA 1EYDA 4KY7A 1TY0A 4LK1C 4BWGB 1R9TB 1HA5A 2DYMA 2JZPA 4PMCA 1SF0A 2VB3X 3L3OC 5EKLA 3SK4A 2B2UC 1RD9D 2VB2X 4JX1C 4L8JA 4YTMB 4L2YA 1EWYC 1FXAA 3TEXA 3SFDB 5CYUA 4OO1G 3AEGB 1LV9A 4O1NA 4KK7A 2VZKD 4QIWB 3H94A 1V1PA 2A5HA 3HOWB 2JYOA 3GTLB 1NR2A 1Q12A 5EE1A 1EY9A 4I65A 2PYKA 3MEHA 4IZ8A 2LEKA 4C80A 4MT5A 5EE0A 4NDXA 3I3CA 4K8IA 1F2RI 5DNFA 1LTTD 2K04A 2PMVA 2KAJA 2W54A 3EJIA 3RPFC 3NPPA 1Y8PB 2WAQB 2MJ8A 1BOSA 1KFYB 2K0PA 2Q8IB 4DXGA 3DEOA 1GUGA 4XWTA 2I46A 5BMHA 2WXHA 1NENB 3NTHA 3H6MA 5KRUA 3ONAB 2JXTA 4DNRB 4QUFA 4MM3B 1ENAA 2NVQB 3PO3B 2J53A 1EY0A 3BDCA 3MC0B 1SIJA 3P7JA 4HR7B 1GPXA 5BN4A 2WXIA 4C3HB 4NZLB 2VXWA 1BDOA 1YN5A 1OQRA 4NMZA 2G9DA 1HA6A 2EZVA 5KGUA 5IODA 2K33A 1WVLA 3FILB 2A69C 4K5XA 2IJ0A 2KHSA 1VDVA 1C48A 1HPCA 4DXFA 1I4RA 1SBBB 3MFGA 1RYJA 2EKIA 1EFID 4C1NK 1WTWA 3P4SB 2K9XA 1WXQA 4A8XC 1L6VA 1DGJA 2IDYA 1U4LA 3AU7A 3WOFA 5IGBA 2F0WA 2AWOA 3GP7A 3RLFA 1LT4D 2EPBA 5D7GA 5A2QE 1EU3A 5JAVA 2F03A 1KNAA 2IX1A 1T6BX 5NUCA 3H09A 2OEOA 5A35A 4HJGE 3E5SA 1N61A 2FHTA 2RMMA 3MA2B 5ELCA 2YEPB 4KGSA 4H44C 1CZWA 2E2DC 1S5FD 2WP8J 2WXNA 4OZCA 1PGXA 2B76B 4US8A 4TKOB 4EQOA 2K3UA 3K6OA 4NKLA 3J80L 2KJXA 1CA6A 3AN1A 1GHJA 5JVG3 3S1QB 3IAM1 1TWFB 1J7AA 3D3RA 3RZDB 2WKCA 4HCSA 3FMCA 2R3ZA 2B2UA 1OFFA 1QE6A 3NQIA 1D1KA 2PNRC 2F0JA 3AE7B 1JICA 1IW7D 5EQ0A 1EU4A 1ZUD2 1FFVA 1EYCA 1F2MA 3S2DB 3S1NB 5HHDG 3BS1A 3MXUA 4XIGS 5EPKA 1EY6A 5EJWA 3TP8A 3FPUB 3P63A 2ICEC 2W55A 1D4BA 5EGTA 1BCPD 1RTOA 4PT5A 1NR4A 1TS4A 5T1IA 3I4LA 4QMGA 1C76A 3HG9A 1QJOA 4H7BA 2WB1B 2AX5A 2BOSA 2L83A 2BS2B 4A90A 4U68A 1SYFA 4OGQC 3WCQA 4AQ7A 2JX5A 2WS3B 4K14A 2XWJB 2JWUA 3DWAA 3NQTA 3K5NA 1VZ7A 4X3SA 3W5UB 5CC4A 2WU2B 3W3AA 3PZ7A 2WNMA 4ZUJA 1ZDVA 1EQVA 2ZXPA 1A3VA 3BIID 2WDRB 1JWMD 1XLPA 1BF4A 2ZXRA 1LLRD 4UDUC 2I2YA 2E75C 2EYPA 2F3WA 4CKCA 4RFBA 1PDQA 2ZXOA 1NCVA 3FAHA 2EY2A 1LTAD 3OMCA 1A2UA 2KCCA 3I4NB 1SE3A 1XCQL 3D31A 1DOMA 3D6CA 1PXUA 4ZAIA 4S3SA 3NWSA 1Y69U 3NVZA 1NSNS 5CBAE 5JEAH 2JA5B 2KDMA 2B2TA 3ND9A 4FXCA 2W3SA 1BCPC 2NVTB 1X32A 1YJIA 1EIHA 4ID6A 4KJNA 1UNSA 1OQQA 3NK9A 2LS01 1GOZA 1II3A 1AYFA 2WP9B 2YEPF 2QJLA 4O42A 2L5TA 1PYWD 1MD2D 3KLSX 4XYOA 2LMCA 3TZDA 2CW0C 3PZ8A 1ET9A 2JEAI 4KGTA 5HFYA 3SK8A 1I50B 1PGBA 5KIXA 4HAEA 3Q6SA 5D3DA 4LAAA 5CBEE 4K8JA 1JB3A 3W9CB 5T1GA 3RFZB 3HZXA 1F9QA 3VA5A 1PRTB 3AE5B 1IGDA 1QOGA 2JXMB 2XRSD 4AYBB 4XWWA 1FCCC 2M00A 5IGFA 1SAPA 2QILA 4A3MB 4IDIA 3QJYA 2GB1A 5M9OA 2M56B 2K7VA 2GI9A 1QT9A 1GXDC 4JBWA 1D1IA 1FD7D 5BYRA 3Q23A 2PLPA 2DY8A 2F1MA 2PVOD 1ZE3D 1PZID 1C77A 2OXPA 4X3TA 3GTMB 1WTRA 2WXPA 3EVQA 4A3JB 3C2PA 5E4WC 1CK1A 4DN4M 2G1EA 4IUQA 1SMYC 3MHBA 3I9V1 4IFDH 1PGAA 3C46A 3RZOB 4IFDI 1L4DB 1FGBD 4U673 2N7JA 1PUTA 4C3JB 3TEYA 1JWBD 3GV3A 3D8GA 1HTPA 4G7HC 4DFAA 2JSVX 1GUNA 4PMWA 4A9AA 5JEAJ 3U7ZA 1DOIA 2SNSA 3U9OA 1ZYRD 2GA4B 2BDNA 1BNZA 2JP1A 2MP1A 1B9NA 1YNJC 1JMLA 1ZDXA 3MHZA 2EE1A 3IT4B 3IT6B 3CIRB 1A6XA 2EY5A 2F0SA 2ICIA 1OXSC 1RM6C 5F2DA 1K52A 3N6RA 5J22A 3BDLA 1WWTA 4YTPB 3LNNA 3A8JE 3AECB 1BO0A 3S9WA 1PDXA 2G9HD 1RODA 3CKIB 4PMBA 2D62A 4LTUA 3M4OB 1D2BA 1VMCA 3Q0AA 2B2VA 5CV7A 1F2RC 3A8IE 2X69A 1ENFA 2V3NA 2A68C 1LACA 1QCBD 1BBXC 1XLOA 3OMGA 3TBIB 1XX8A 3VRBB 5KNCA 3B2GA 5D14A 3HUIA 3NTKA 4WH4A 2Q5WD 1NYQA 1QKZA 3CWIA 4DAYA 4IUUA 3B9JA 4RWSC 1Y56A 1TKGA 3RUZA 3S14B 2FMMA 4RH6A 3P4PB 1CT1D 3AEBB 1JOQA 2DY7A 1JCKB 4KMUC 2W82A 3Q8AA 1XEEA 2LUMA 1XXGA 2I07B 4QB4A 1PRTF 1P7EA 4RCOA 2BE5C 3QWNA 2IL8A 3DWGC 3L7ZC 1AWDA 5AUIA 2WACA 4ZHPA 3IAYA 5FKAC 1EEID 2N55A 1DOYA 3QOLA 4WAFA 2LMCB 1Y8OB 1G2SA 3GTJB 4RCNA 4P6VF 3PMFA 1EQTA 2V4DA 1S5CD 5ELDA 5C5MA 4HMIA 1B53A 2XRQD 1UUPA 2AWNA 1Z7TA 1ONLA 4CKBA 2PQEA 4DA2A 2PW5A 4L1BA 1LO5D 3OIQA 3M3YB 3A8KE 1IYVA 1SXTA 1HUNA 1JWSD 1Q1BA 1WSPA 2IT1A 4FF4A 1K8MA 2K6AA 3AMUA 1QLBB 4KHVA 3NWTA 4ZRZA 4ZHOA 3C1EA 3IFTA 4BBSB 4A3KB 3ITPA 3S16B 3OPOA 1RFKA 5CV9A 1PRTD 4DAPA 5MPOA 2L1BA 1DONA 5AFWA 3P4RB 3MVVA 5C5LA 4R8NA 5G5GA 2MEKA 1MHXA 2MJ3A 3WDNA 1UWXA 1XO3A 3U52E 1C8CA 1PTOC 3ZQ4A 2EDGA 3VR4A 5ISRA 1ESFA 4WURA 3G7LA 2NZ1D 4ZKBB 2CQAA 2K5PA 4JE3B 3GS2A 4KKJA 4RF1A 2B2WC 1B1ZA 1ZXTA 1MBYA 4RKLA 2L55A 1MSHA 1TR5A 2V3PA 2EJMA 1IBXA 3BYTB 3J7AF 5KEEA 1AZPA 1C4PA 1CQVA 1KABA 2RDGA 1V97A 5EE9A 2WXKA 1C9FA 1G2TA 1MSGA 1IYUA 1DJRD 3OWFA 2F0KA 3SEBA 1Z47A 2BA1A 2MPMA 3AE1B 2EVBA 4K2KA 1SE4A 5C3WA 4EQPA 1FXIA 2F0EA 4QF4A 1J7BA 2VNUD 1VR9A 1GUOA 4ZKCB 3VYUA 3TZUA 1FMAD 1N60A 1L0XB 1KRHA 2OF1A 4OHJA 3R2TA 5DM73 4OVZA 1FRRA 2RPVA 1TWCB 2DNEA 1SE2A 2EY6A 5FO8B 4RKBA 3P4QB 5K36G 1RJTA 4OZAA 2F0DA 1U4RA