1HA5A

Structural features of a zinc-binding site in the superantigen streptococcal pyrogenic exotoxin a (spea1): implications for mhc class ii recognition.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
218
structure length
218
Chain Sequence
DPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHAGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYLTDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDSNTSQIEVYLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Features of a Zinc Binding Site in the Superantigen Strepococcal Pyrogenic Exotoxin a (Spea1): Implications for Mhc Class II Recognition.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Toxin
molecule keywords STREPTOCOCCAL PYOGENIC EXOTOXIN A1
total genus 56
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ha5A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ha5A01
1LT3D 1M4VA 1D6EC 3CHBD 1FD7D 4BWGB 1F77A 5ELBA 1UUPA 1I4GA 3O13A 1PTOB 1SJHD 4K6LA 1FNVA 5FK9C 1HA5A 2XRSD 1BXTA 1BCPB 4DXFA 1FNWA 4RCOA 1I4HA 1HQRD 1EFID 2QILA 2NTSA 1UNSA 1JWMD 1EU4A 1I4RA 5ELEA 2SEBD 5FKAC 1D5MC 1CQVA 1LTGD 1LTID 1S5BD 1QILA 2AQ1B 1AN8A 1TS3A 2IPKD 1XTCD 1PTOD 3MC0B 4OHJA 3EA6A 1S5ED 2WV6D 1EWCA 5TSSA 2IJ0A 1ENFA 3DWQA 4RGTA 2CHBD 1FNUA 1LTTD 3URYA 1CHPD 1SE4A 1FGBD 1LTSD 1LO5D 4RGNA 1RCVD 1PYWD 1EEFD 1B1ZA 4RGOS 1ESFA 1G8ZD 1S5FD 4UDUC 3OWEB 1MD2D 5ELCA 1D5ZC 5I4DA 1V1OA 1DYQA 1JCKB 2R61A 1KTKA 1PZKD 1LT6D 1PRTD 1JWSD 1JR0D 1RDPD 3MFGA 1LTBD 1YN5A 1LT5D 2TSSA 1PRTB 1V1PA 3BYTB 1I4XA 3V05A 2O2LD 1CT1D 2XN9C 3BVZA 1TS2A 3W2DA 3GP7A 4RGMA 1SE2A 1PZID 3BVGA 1PTOF 1S5DD 1PRTC 4TSSA 1JQYD 2Z8LA 2AQ3B 1TY0A 3BVMA 4L63B 1CK1A 1PRTF 4RHSA 1GOZA 1JWUD 2XRQD 2J4XA 1HXYD 1B44D 1PTOH 1KLUD 4NZLB 1TY2A 1YN4A 4C56C 3KLSX 1T5XD 1AW7A 1XXGA 1V1PB 3EFXD 1RD9D 1S5CD 1HTLD 1SBBB 3BZDB 1LTRD 1KLGD 4Z9CB 1I4QA 5D3IB 1L0YB 2G9HD 2ICIA 2XNAC 2NTTA 1EU3A 1STEA 4RH6A 2QEJC 3R2TA 3SEBA 3BYYB 1ET9A 1EEID 5ELFA 3DWAA 1BCPD 2AQ2B 1SE3A 5D3DA 2RDHA 1PZJD 1BCPC 1SJED 3R8BA 1L0XB 4O1NA 1CHQD 4RHRA 4DXGA 3R2IA 1PTOC 1I4PA 1SEBD 1BCPF 1DJRD 4RFBA 1YN3A 1RF2D 1D5XC 1SXTA 4ZYSA 3DWPA 1LT4D 1LTAD 2RDGA 1LLRD 1TS5A 4L6TB 5ELDA 1TS4A 3TSSA 1ET6A
chains in the Genus database with same CATH superfamily
3D31A 3DBHI 1I6VC 3A55A 3I9V1 3S15H 4MM3A 4H13C 5D6JB 3A7AB 2PW7A 1E90A 3P42A 1TVXA 1QT9A 1NYQA 5CV7A 1C4AA 1P7EA 3IXSA 4RKLA 2MCNB 2YU9B 2K52A 1A3TA 2XRSD 3B6YA 4WJ4A 2ZNVB 1JW9D 4A6QA 2NS5A 2JXXA 4BBRH 4FXCA 4GLSC 2MPMA 5J39A 5DNFA 3ICEA 2IDYA 2DYOA 4X65L 2MQHA 1HNXQ 4USAA 4KKTA 3VR5A 3KYHC 3UGBB 3ZIMA 4WAAA 2WB1G 4GKJL 1NR4A 4FJZA 2C7HA 1WGDA 3AEFB 1FXAA 5DPRA 4LNIA 4R3DA 4WURA 5BR8Q 3CD6A 3W1SA 3LWEA 1TKEA 2DY8A 1RCVD 1U0LA 4DUYQ 4I7ZC 1E2VA 4IFDJ 1X32A 2K04A 5IYCH 4YHHL 2EOTA 4DR2Q 1Q1OA 2N9XA 4C80A 1FVIA 5A35A 2DBYA 2O2VA 4FYDA 3PSEB 4LK0M 4JI0Q 3I56A 3VR8B 4A20A 4K8JA 4MJSA 1FCCC 5C3EB 1PFMA 1JWAD 2AUKA 4HROA 3AE6B 4YCVA 3AH7A 3QOJA 3PTFC 2JT4B 1WXVA 1FPYA 4DAVA 3F2BA 1TWFB 2Z1CA 4X3SA 2B2VA 1N33L 4A90A 4DV6L 2R92B 1TWGB 3CCSA 3CF6E 2UXBL 3FILB 4JI6Q 4NZLB 1RODA 4J15A 3VTVA 2M00A 1YN4A 4DAYB 1YQ4B 5IYBH 3V60A 1C7YA 5JZEB 3AE7B 2I2YA 2A68C 3OTOL 3I4NG 1TT5B 4ALPA 1KLGD 2DNEA 4XQJA 5J2RA 4BBRG 5E6PA 1TWHH 1L5PA 4FP5D 4JL9A 3VHTC 1VQ9A 4S3SA 3RZDH 2JEAI 1KDAA 4LUVA 3SDLC 1N32Q 3DHHC 3EBEA 4DBGA 1ET9A 1IYFA 3KDFB 2ZTCA 1AYFA 4CYEA 5CHVC 2P5ZX 4KY6A 3AEDB 2BA1A 4POFA 3K59A 5TR5A 4IALA 2L8JA 1KL9A 1YJNA 3N30A 4CKBA 1K50A 4O1NA 1VLBA 1WD1A 2K28A 1YNJD 1EZ8A 1HNZL 2PTLA 4EEWA 1QNKA 3M9BA 2LWPA 3ZTCA 2XGTA 3G6JB 1C48A 4A3EG 1RF2D 1IUEA 1VD2A 3BDOA 3W5OA 5JVH3 1VMPA 2DLBA 2DNFA 2Y5PA 1EIHA 5M5YH 3J7A5 3KH0A 3D3RA 1YJIA 2BOSA 3NY5A 1VCIA 3K0YA 2JJQA 1LLRD 2VUMH 2EKIA 4L6TB 2D3AA 4KVGB 2F0VA 5JH5C 2ID0A 3T4AC 1UGMA 1GUSA 2KMAA 3OTOQ 3CIRB 3BZCA 3NJTA 4FN2A 1LQBA 3P2BA 5E6JA 1UUPA 1OTRB 2UU7A 2KDIA 5IP7G 1S1QB 1VRAB 1SJHD 3OHXC 1WTQA 2G4SA 2GLSA 2ZVOA 4A93G 4IUTA 2B63H 2ZM6L 1OQYA 1V97A 4JE3B 2LHEA 5LLIA 4LDTB 1GXDC 2R7ZH 3NOBA 3TUOA 2QCPX 4LNQA 1Y56A 3HOUH 1LTGD 1QILA 1YBYA 4JI2Q 4A3DG 4JI3L 1SSNA 5AUIA 1EQRA 1L1OA 4HKQA 2NN6I 3L16A 4RMAA 4HMJA 4RGTA 2CH4A 1HNWL 2O6VA 3NS8A 2F0PA 2D5DA 4MIUA 4A3MG 2MX2A 4LUOA 2R92G 3C8YA 2F0SA 1EEFD 1QE6A 1OTCA 4P72A 1G8ZD 1CZPA 2J42A 2LRWA 1VQMA 3A1QB 1S72A 1K51A 4KGTA 1D5ZC 1YIWA 4YHHQ 4HJAA 4DR2L 1C4CA 1NI2A 5LMUL 2FIDA 1E7PB 4GOCA 1PRTD 4CDEC 1RDPD 3W1GA 3KF6A 3SU8X 4H44C 2L7RA 1HFGA 4XIGS 2EYOA 5L83A 1V1PA 3U50C 1YITA 1XWEA 1S40A 2JA6B 5FO7B 1NE3A 3H15A 1KFYB 3CCQA 3AMZA 1MPEA 4WJPA 3EN2A 4ZQ3A 3P7JA 2PI2A 4DF7A 3H6NA 2EZVA 1YNTE 1QVGA 4A3JB 2F1MA 2F0JA 3M4OB 2EYFA 4TSSA 1KLVA 4PZ7A 1ML0D 1C9OA 3NRZA 5K36G 2MSED 1GPXA 3TRZA 2WU2B 4PMBA 5E6NA 2B2TA 2IT1A 3RULA 4PQXA 3GE8C 2KCMA 3SK6A 1V9JA 4MGZE 4KZ0A 3IT4B 1XD3B 2UXBQ 1XQQA 1ZKHA 1YQ3B 5KYLA 1KRHA 1ENAA 3D8GA 4A3LG 4XC2A 2WB1B 1BBWA 4YWLA 3W1SC 3U58A 4ZRPA 1JJCB 1KAWA 2H88B 4JPSA 4XGAB 1VQHA 5DLQE 2XNAC 3I4LA 4OXPA 3OOCA 2KN4A 5DPTA 2ON8A 4JI3Q 2JA6H 2HDMA 2ZEQA 4W9EA 2HIXA 1FD6A 1SLJA 1RWSA 5J17A 4QUFA 1E7UA 1B7YB 5C4JB 2GVBA 1BUVT 1OXXK 1GAQB 1VJKA 4WJWA 1MHWC 2PLPA 3NTIA 1YMHE 1JB7A 2NVTB 4JV5Q 2FXQA 5I9OA 5EE0A 2XK5A 4IPGA 2KJXA 2UWQA 1IW7C 3HKZB 3MXNA 4B0EA 1RFKA 1WMHB 3TCAA 1PTOC 3S2HH 4OO1H 3N1YC 5CX3A 1BCPF 1ZPSA 4TKOB 1IL2A 2OQ0A 5CV9A 2WXOA 3S16B 5BO4B 1SXTA 2NN6H 1O7LA 3UDXA 1S3SG 3D32A 2JA9A 4U68A 1V1QA 3Q0AA 5KRUA 1I7HA 3RNCC 1N9WA 3HOZH 3DBLI 2K32A 5DM63 4IWQA 1B9RA 4IQZA 4HIDA 4ME5A 4K2KA 4BY1B 3TMPB 4LFAQ 3DUZA 1LGRA 1WJ6A 2F0UA 2KFKB 1PDXA 1W6KA 3I70A 4CHTB 3PO2G 4JGHB 3N3KB 2DJGC 1C4PA 1JRPA 4EX5A 3JAMc 5JXVA 2FJ2A 3Q8CA 1Y14B 1ZDVA 1LUZA 1SGHA 3S1NB 1C79A 2MP2A 1V43A 1W3SA 1ZYRC 2REXA 3HKZG 1T0RC 1D3ZA 2Z4IA 4HIKA 4XT3B 3I63C 3U2SC 5ELEA 4HJ7A 1J0GA 4ZYSA 1CQVA 1WFQA 3MHBA 4DV2Q 5GQOA 1C77A 1AN8A 4JI1Q 1XTCD 3DVNV 4MJSB 3CCRA 2EQSA 4ZAIA 4AQYL 3QG1A 4JI7Q 3HOYG 4LFCQ 4IOCA 1MJDA 2HHHL 1IZ6A 1XNQQ 1WR6E 4KHPL 5ELNA 3PVLA 3BS1A 3KUZA 2A1AA 1WD0A 1EQVA 2QGQA 2L3ZA 1EY9A 4UP8A 1WGKA 2MHJA 3VVWB 1B1ZA 3CW2C 4PZ8A 1QVCA 1OFFA 4Y52H 1WRDB 5IP9G 2W82A 2UXDL 1VQJA 3W9CB 3A0JA 1P0RA 2AWTA 4ZCKA 1CA6A 4LFAL 2F0IA 4N6EB 4ID6A 2HD5B 3Q8AA 5LNK1 2KBNA 4N9TA 2IL8A 3A8JE 3TZUA 4C1NI 1ASYA 3NTKA 2K22A 2LRUA 2EJGC 4DV0Q 4LF4Q 3V62A 4MDKE 3DCGA 2KXJA 2WXHA 1HTPA 5C0XI 1H9MA 2QF7A 3CF5A 1P98A 3KYDD 4GGQA 4UAIA 1Y1VB 3VAWA 4OW0A 3BK1A 5C44H 3Q69A 1PZID 2CKHB 4M02A 2IY5B 4F87A 5AUKA 1WTOA 2A6HD 3FEWX 4B3MQ 2E6XA 3HOYB 2ES2A 1A6XA 4HAEA 4O42A 5JEAJ 1FFVA 3S1QB 2MJEA 2B3AA 4ZRJA 2AQ3B 4M8MA 3M3JA 3BVMA 4IUMB 3GTJB 4AQYQ 3I4NB 1OXSC 1F9RA 2V4IB 3GTOH 2H5XA 2BPSA 3DBLB 5EJWA 4C56C 1XXGA 2PYKA 4G7HC 5JVG3 4IJLA 4UP7A 1P8LA 5F2DA 4ZLTF 2KTRB 3Q3OC 2VNUD 2JX5A 2KC2A 2RPVA 3X23A 2KUMA 2Z6KC 4KKSA 5C44G 4JBMA 2BB6A 4DR7Q 1RTOA 5C3EH 4A3MB 3NSWA 3E3XA 4R1JA 5FJ8G 3R93A 3J81j 4M0WA 2EDGA 3C1FA 2A19A 4OVZA 3RNBC 3VH3B 3DDCB 1B3QA 3AXCA 3K81C 1HRJA 1YNXA 1SAPA 4DV3Q 2WLBA 3IFWB 1Y1WH 1PFDA 3CU7A 2K25A 1Q1EA 4JYAL 2F52A 3MXUA 2KWUB 3Q3JA 5EE1A 3PGEA 3OWFA 4IFDG 2ZNVC 1FXTB 4M00A 1EYAA 1T9HA 1JMLA 1Y8NB 3DHIC 1UD7A 1WH3A 3ML9A 1SEBD 2PNRC 4LJPB 3J9CA 3EHVA 5IOIA 4APVA 4M8NA 3DEOA 1TWAB 1QOAA 1HZ9A 4K81A 2E3TA 3SVMA 3NUHB 4DDID 1LT4D 4A3OA 3RZDB 3PZ7A 5J18A 4MTNA 3KLSA 4G50A 1XNRQ 3KUDB 2JA5G 1EOTA 4NW2A 4MACA 4P7IA 4JQWC 1SR3A 4JWUC 2Z6BA 4C4VA 4K6LA 1HTOA 1N33Q 2MJ8A 3L9AX 4RM8A 2JN4A 2J0TD 4DQOC 4ZUIA 3TL5A 1I50B 4FF1A 1NY4A 5JHBA 1X3EA 4IUNA 3S1MB 5IP7H 2MRPA 3ECIA 4KK7A 3UIPB 4A3LH 3DWGC 1HZAA 4DA2A 4UP9A 1I4RA 3J7ZC 2AQ1B 1S5BD 4ZUJA 3AN1A 2KECA 1QJOA 1YHQA 1XNQL 4IG7B 2LXJA 3JAME 1ZUD2 3GQBA 2RMMA 1G2TA 2LJ5A 2VUMG 1JMCA 2NCNA 1BF4A 3AMUA 2N55A 1PFBA 3URYA 3PF4A 1MHHE 4FULA 2KJHB 4H02A 4KHPQ 3DVGX 3MC8A 2KA7A 4R8IA 2IZVB 3AEEB 2F0OA 1HQMC 2MW5A 4WQMA 1Z2MA 4A93H 3APFA 3C19A 1B8AA 4EVOA 2FIFA 2L1AA 4I6PA 3ND9A 4PK1A 2JVCA 2LXCA 2JXTA 3M3YB 3WALA 1LTBD 4JBWA 1LT5D 4IFDI 4GNXA 3ZJTA 3CCLA 4XDXA 1ROEA 2C5CA 3RMKC 1N36Q 2N0SB 1H9KA 1NTGA 1TS2A 3AEGB 2JA7G 3QQ8B 1QNUA 4IPCA 3ULJA 5IYCG 2CU3A 3OLMD 1J5EL 3T16A 1Q10A 1SDFA 2E2DC 1H9SB 2A6EC 1FXIA 2JSOA 2V3NA 1CK1A 5MPOA 1IYUA 1AZPA 2F3IA 1B44D 1E1TA 2L55A 4ZYNA 5BYSA 4ZKBB 4L5RC 1KDCA 3MEHA 2PCFB 4J8QA 1TXYA 2CJNA 2NPTB 3AE3B 2LS01 3P4PB 3ZRFA 2KTFA 3A9KB 4OL7A 1WCMB 1SBBB 3G7LA 4FA6A 2BCOA 3EECA 1VDZA 2BE5C 1SRUA 5M5WH 4YT0B 1WYDA 4HPLB 2G9HD 3LDZE 2CCZA 3H3VH 2WU5B 5G55A 2E2JH 4II2B 1Y8OB 3Q6BA 3GTKB 1KABA 2GRIA 4RA8A 4Q0FA 1WGYA 2DAFA 5CV5A 2M0XA 3MJWA 3BYYB 1FYCA 2DZJA 1X3FA 1EEID 4A8XC 3IHPC 5EDSA 1J8IA 4YCUA 3PQIA 1L0WA 2DZKA 1U4PA 5AZHA 1ZE3D 3S24A 2K8CA 2BWFA 2X6LA 1WF9A 1I4PA 1PYSB 2N9PC 5IT9c 3I4NH 1TWCH 2KCNA 4RFBA 5E1FA 1GO3E 2F0EA 1R4MB 3C3LA 5LXIB 3VRAB 1VMCA 4KLKA 2MBEA 2MWSB 1Q46A 1B53A 1VQIA 2BDNA 5FLMG 4JYAQ 2KWVB 2UUAQ 5IYDH 2LKVA 3HOUG 5K36H 4OZAA 2SDFA 2WAQE 1E7ZA 4YY3Q 1IBMQ 3L13A 5ELBA 5EKKA 3TP6A 4C3IH 1SSOA 3A8KE 3NBHB 4OX9Q 3SK5A 1F9SA 3HOWH 2BYVE 3I91A 1UE1A 2KFJA 2QSDA 4NJ7A 1TT2A 3A4RA 4HJ9A 3J81L 2DUDA 1K53A 1EL0A 1UE7A 4MT5A 4C7YA 3OW7A 1DOMA 3S1RH 3CXCA 2KVZA 1GG3A 3ZLZA 4BVUC 1HJPA 4HDOA 5CORA 5EPJA 4KD4A 2FFKB 3L17A 3H6MA 3E9HA 2H89B 2LVOA 1KOTA 5I2YA 1MI0A 1WX9A 1NI3A 1ENFA 3DWQA 5T1IA 2LEKA 2MO1A 1FMAD 4TQ0A 1JT8A 3UDGA 2J52A 2CHBD 2KHIA 5JOBA 3W3AA 3HRDD 2W54A 1E10A 5EGTA 1K0RA 3IRBA 3QR8A 2WNMA 4FHKA 3W5UB 2OCEA 3R3OA 4C2MB 4DV7Q 3L0WB 3F8TA 5JEAH 2QC8A 3DOWA 3H7PA 2F4VL 3TS0A 4TQUS 3A1QA 4L2YA 1WXMA 1GUAB 3RLOA 3HKSA 1MD2D 3A74A 3F2CA 1ZKOA 1U4LA 3TZDA 1MGSA 1LT6D 4YTMB 5M5XB 2C9OA 3MXNB 2EJMA 3A8IE 2KACA 4OX9L 1QOBA 1PRTB 5IGBA 1A2TA 1F2RI 4G4KA 4JVZA 1WXAA 3QA8A 2K5WA 3SK8A 2SNMA 3V96A 1WE7A 2IO0B 1WTWA 4DR4Q 2YLMA 4RGMA 1SMYC 2ZVNA 3MTNB 2SNSA 3I57A 2F0DA 3A5ZB 1K73C 1QZEA 5E4XA 5JEAG 1TU2B 4A3FG 4AJYB 4KN4C 1V81A 5LMNW 2HQEA 2AUJD 4GU2A 2X8XX 2N1VA 3PO3G 2NBVB 1JALA 2L9HA 2ZJQA 2R93H 1TY0A 4YWGG 4ANXA 2E74C 4UHVA 3NVZA 2WP9B 1AFPA 1JJ2A 3CC7A 3E6ZX 1TY2A 3TP5A 3OW2A 4P73A 1JRUA 2WACA 2LI5A 4OWXB 1LM8B 1NSNS 1G6ZA 4LFBL 4DHJD 3KQ4A 1C3TA 1G6PA 1FGUA 2A5UA 4XX5A 2HDLA 2K4KA 3DBRI 2R93B 1QUQA 2HQLA 3PIPA 3GDEA 3KWVA 4MH8A 3PZ8A 1UBQA 3K5LA 1GM5A 2UXCL 1PA6A 1MBYA 3IAYA 1AE2A 1XLNA 2QKIC 1UEAB 2UU9Q 1TKWB 1BCPD 2B2WC 4X3UA 1X56A 1E6EB 2L32A 3OJ3A 3FKIB 2DZIA 1V80A 3QWNA 2VZKD 3L54A 1L0XB 1JORA 2FCQA 2CQAA 2QJLA 3U4EG 1MJCA 1HCZA 4K5XA 2NYZD 1LABA 3ITPA 2BYTA 3K5MA 3QARA 1HR0W 3H94A 3UE1A 5IYDG 5IWAL 1NMFA 2AWNA 2KANA 2L1BA 4Y7NB 3AEVA 1QCBD 5IKCM 1ZEQX 1VQBA 2D0PA 1EYGA 2BH8A 4GZYC 1T6BX 3F2DA 3K58A 4A3IB 1CSPA 4LWCA 1EY0A 2I07B 4H0LC 2B2YC 1Q1BA 4QIWE 1SFOH 3J81E 3AE4B 3MC9A 2CH4W 3SDZA 3MHSD 4BKGA 3IL8A 1F2LA 5FK9C 1KQSA 4HEDA 4MGIE 1E24A 4WJ3M 3JVZX 4RF0A 2DGYA 5GAGC 4OWWB 4TV3A 2ZCCA 4BOSC 5IOCA 3J7YW 2V1CC 2Y5CA 4KV2A 1MSGA 1JB3A 4HJ8A 1XCTL 1JWMD 2NB0A 2IGDA 1EU4A 2JU6X 3I73A 2D62A 1O78A 2SEBD 3H9DA 3T3OA 4XYCA 1C78A 1TS3A 1QWYA 1WTRA 2NMQA 1WX7A 3EA6A 2WV6D 5C0XJ 3S1QH 3FKYA 4WH4A 2EY1A 1V5TA 2XIWA 2BYFA 2NZ1D 1PQSA 1A8VA 3Q24A 1QZGA 1WX8A 3A33B 4N58A 4DR6L 5EKIA 3NXWA 2C7NB 2NVTH 3A9KA 1STGA 2KCTA 4NXML 2PPHA 4I65A 4HSPA 1ESFA 1H8CA 4XWWA 1IKLA 1C0AA 4ZHOA 1KTKA 4M1UB 1SYFA 3PHXB 1SMYD 4K7SA 4F7ZA 4URKA 4EFOA 3AU5A 2K03A 3C1EA 3NZ3A 1MI2A 3PIP3 1VZ6A 4ZOHC 3D4RA 1HHVA 3CMEA 3SHQA 3OIPA 2VB2X 2XN9C 4DV7L 4JI6L 2KDBA 2JE6I 1FRRA 1J7BA 3QIJA 3HVDA 1A5RA 1XTDA 3CRLC 3ZJVA 4IUVA 4JOIC 1TGZB 3NZUA 4KIKA 2OHFA 2LGIA 4NPSA 4GS3A 2M2LA 4A3DB 2YYZA 2ACZB 1IYVA 1VF7A 1NEKB 1WWTA 2F3WA 1PGAA 3QIAA 3RCZA 2NVXH 1V8CA 4N8FA 1PH4A 1PTOH 2I1KA 1WZ0A 2NR2A 1IBKQ 1X6OA 3KLSX 3FMCA 2KTRA 1TKYA 5H8YE 2RA4A 3OMGA 3EVQA 1STAA 1N61A 2KT7A 4QJFA 4II3B 3VXWA 1EWHA 1XJVA 1XCQL 3NELA 1NBWA 1EY7A 2HHHQ 4OWTB 4HJKA 2AYOB 5E6OA 1UE6A 4XTCS 1XLOA 4K5WA 2KQSA 2GVAA 1FFUA 3ZJYC 3KUPA 2ZJRA 4A3KH 2K5VA 3E5SA 2Y0SB 4G57A 3I4OA 1K8AC 1QQRA 4RAUC 1V8QA 4DFAA 1F2MA 2F4IA 2Y5BB 3T3NA 2BBCA 3NQTA 2XEWA 4LFBQ 4BKSA 3U9OA 1T0YA 4MSMB 1QF6A 4B3RL 1ZXTA 3E9SA 5C6AA 1C76A 5L37A 4DAPA 4FLHA 4JI1L 5JJKA 2LJIA 3C46A 2NPTA 1J9OA 2WIIB 3MWYW 4GXBA 3NUCA 4PMWA 5KNCA 4GIVA 3AI5A 4L23A 3TEZA 4EQ5A 4LK1C 1N32L 3M7GA 1Q5WB 1W2BA 1EIFA 2EYHA 4KHZA 2ENBA 2GN5A 3DWPA 3ERQA 4P2CB 3KVFB 5I6WA 4IM0A 1B9MA 4IUUA 4DR5L 4GDKA 1F2YA 1TWGH 1WGGA 1M8AA 3VYUA 4YTPB 1T0QC 3K8AA 3AE5B 2I0QA 4NMZA 2V0GA 2BS4B 2KZRA 4IDIA 4B95A 4DV0L 1EZ6A 2KVMA 4LF4L 1I35A 2Z0EB 3PRZA 5I6YA 1EIGA 3AE8B 4KKJA 3GTMH 4GDKB 4XYOA 2CWPA 2Z4HA 2JY6A 5HGQA 5KGUA 5KYIA 2N9KA 2F0GA 1WJNA 2G3QB 2PEAA 1BUIC 4QQBX 2SAKA 1MKHA 3H3VC 2Z0SA 3U8ZA 1WCMG 1GNUA 1E1OA 4IN3A 3S9WA 2INNE 4EOYA 1EWCA 3ZXRA 2HCCA 4HCSA 3FKIH 4A3PA 4NXMQ 1GB1A 2PE6B 1JE5A 3KDFA 1VQPA 3AECB 1BO0A 1LO5D 3D6CA 4C3JB 2M9VA 3DBRB 1PYWD 2M56B 3MFYA 1EF1A 4ARIA 3QB3A 3VR2A 4DR5Q 2BKFA 3NVWA 5KNDA 3J81i 1EF5A 1V1OA 2K6DB 2LXKA 1NVID 5DPWA 4JPBW 1JWSD 2OF1A 4LNNA 1HR0Q 4K7WA 4LMQD 4DR6Q 5LMUQ 2D3GA 1N60A 5BYQA 2DY7A 4FXDA 3EJIA 1NYRA 3VYTA 1I50H 3DPDA 4KX6B 4LNOA 3BVZA 1KDBA 4A76A 4XWTA 2F0TA 1L4ZB 3RZOH 1SE2A 2R7DA 1F52A 4TQ1A 3R3MA 3TEXA 3AE9B 1V9PA 4MNOA 3TP7A 3HIZA 1T3QA 1PRTC 1CTMA 1H9SA 1SNMA 3DXJC 2R3ZA 1WTPA 1JQYD 3I90A 5C0XH 4FF3A 2ZW0A 5IGEA 2KKCA 2UUCQ 3VR4A 2K50A 3I7FA 4GKJQ 3DQVA 2PVOD 5IT9L 2D2QA 1GOZA 2KVRA 2J4XA 2RGFA 1KHIA 2ZPYA 3ZO5B 4MH0E 1BOSA 2K6QA 4EE2A 2N7JA 2B2TC 2LZ6A 3X0WA 3GTMB 1E9MA 3KYCD 2CQOA 4R4QA 3P4RB 1RD9D 1PH3A 1UF0A 1CA5A 2WXRA 4Z9CB 3RZFA 1BMLC 3GTQH 3PS6A 1SROA 2JXMB 1F2ZA 2RKSA 4S17A 3HM6X 3JSVB 2DN8A 1RHPA 4XQQA 4PYZA 1PH5A 2VUMB 1MFWA 3NS1A 1XMOQ 4GOPB 2E2IH 4GN5A 3CC4A 2KHSA 4RG1A 1UAPA 5KNBA 2JA5B 3M85A 3BZKA 4F1SA 4KMUC 3EROA 5HURA 3AU7A 3ZNZB 1RTNA 2XWBB 2PVGC 3GV6A 1R9TH 4XE0A 2WXMA 1YOVB 1DXMA 1HTQA 5JPNC 3AB9A 2GOWA 1J7AA 3PLVA 2RD0A 4A3MH 2RDBC 1V2YA 2JQOA 2WGSA 4WWMA 2BDOA 1VQOA 3VDZA 3ZNHB 2IX3A 2JQRB 1EYDA 1HPCA 1FIQA 1TZ1A 2GMIC 4GN1A 2DAJA 1O7IA 4DK1A 2F0KA 2KWDA 2KYWA 4KIKB 1XT9B 3UQAA 4GLVB 4DR4L 1EIYB 2K5DA 4B9KA 1XLQA 1DGSA 4J1MA 1NCVA 4ZRZA 3WAMA 1I4GA 1LM0A 2WAQB 4L8JA 2JYEA 1CZGA 4PS3A 4MZ9A 1AE3A 5T1GA 5M3FG 2KMMA 1YX5B 2EIFA 5H1SE 2BW2A 1TJEA 2MO0A 2KJRA 3DMUA 3AB5A 4C3IB 3FAHA 3RNGC 1QVFA 1EFID 1A15A 2QILA 1XO3A 4TRDA 3P75A 1F9JA 2E5LQ 3OJ4B 2N9LA 2MP2B 3OAWA 4ICVA 3HEJA 2R2QA 3T1YL 4E74A 2J0KA 3KFUA 1ZYRD 3MC0B 3HS0C 4LF5L 4P6VF 1VQCA 1RYJA 1I42A 2BE5D 1E8ZA 3MZ5A 3H0GH 4N59A 4DHZE 2RDFA 5J3BA 2LGSA 1STYA 4BXXH 3A5UA 3B9JA 2OTJA 2K75A 2K5QA 4RGNA 4JCVE 4X65Q 2KHJA 3I3TB 4A3FH 1DOIA 1K28A 4X3KA 3P63A 1XMOL 3ENEA 1NAPA 1LV9A 1DGJA 5GAEC 1PDQA 4WJQA 1YX6B 1V5OA 3AFPA 3HOVG 4Q2JA 1JR0D 2WS3B 2VH1A 2C9WB 1VQEA 1VDVA 1K83H 3FPUB 3VA5A 4JI4L 1WM3A 2O6VD 3H1UA 2CHZA 2R2OA 5C44B 3WDNA 3HZXA 2ZM6Q 3CRKC 4LF9Q 1F9PA 2XK5B 1CKMA 4FF4A 2Q2IA 1CKOA 4KZCA 1DOLA 3SK4A 1WZ3A 4G0NB 3FPPA 2VL6A 2R92H 5EPLA 4XDDA 2N1WA 2N7DA 4W9HA 3GTPB 3JAML 1M94A 4A3KB 2HDEA 4CJ2C 5FO8B 4DUZQ 2R6GA 2UUCL 2EXDA 4WIPA 4AS1A 2EYJA 4DAMA 3S2DB 2O6VB 4FF2A 4R4TA 3MAQA 2WDQB 1RKNA 2KK8A 4MELA 5M3FB 3ULLA 3AULA 2N49A 3PV0A 1PH2A 1ZDXA 4JX1C 2B2VC 4MGYE 5EE3A 1U9RA 2HD3A 4HXDA 2WAQG 3VRBB 5CV6A 5C3XA 4LF6Q 3GTGH 2NZOA 2L15A 2IX1A 2M17A 3RUZA 2YV5A 3MVVA 1OXUA 4NNJB 4A3DH 3G71A 2OEDA 2NBFA 2EYMA 1K8RB 3I5JC 1B4OA 4AIMA 1E7VA 2J0MA 3IT6B 3RZWC 1CUKA 4LF9L 3RZOB 1Q12A 3WIMA 2AQ2B 1WRIA 2MJDA 3PHWB 4HJ5A 1FJGQ 2KAJA 3HG9A 1Q8IA 4IPHA 4GKKQ 4ULLA 3QHTA 4NP5A 1IBLQ 2BTEA 2B63G 1Z5SB 2A69C 3KF8A 4OZBA 2Q8IB 4JI8L 5EAYA 2LVPA 2F0FA 1YN3A 2JWZA 2VS1A 4DKAC 1YJ9A 4HWIB 4C3HB 4IC7B 2ZT9C 5JJZA 1HE8A 1TS5A 4IOIE 4X66L 1N5XA 3TJPA 1FR3A 1ESRA 2E2HH 2G1EA 4LF7Q 3PUZA 4R4OA 4JK1C 1AP0A 2KNBA 3NHEB 1ZOYB 4ABNA 4P74A 5G3LD 3Q22A 4N9F4 5EQ0A 2JYOA 1X3PA 1A63A 3NPPA 1LYLA 2L4NA 3SE0A 3AEBB 3MJ5A 4C3HH 3T56B 3CQZH 1WM2A 2RCFA 2Z59B 2C60A 3I3CA 2B8GA 3CMMB 1R4NB 2RF4A 3HOXB 4KSKC 1FJGL 2OQKA 2BF8B 3ZYYX 1GKHA 1IBLL 5HKHA 3AE1B 1GUOA 2DWQA 3EQLC 1WR1A 5CYUA 4B3SQ 3M62B 4AQ7A 1BVSA 2PW5A 1VCBA 4LF8Q 1B9NA 1CHPD 5JJLA 4GOPA 1VQFA 2E2JB 3T1HL 3WANA 3S17B 2K05A 1SF0A 4I6NB 1SE8A 2XSCA 4BS9A 3P20A 2IW3A 4JW0A 5I4DA 1PH9A 1YQBA 3K9OB 1Y69U 3JSVA 3NZSA 1SYBA 4WJNA 3OPOA 3MXGA 4L5QA 3HGBA 3J80c 1EO6A 1YJWA 2QDLA 1MG4A 4XQNA 2N3SA 2RSUA 5JAVA 3ZNID 5IGDA 4IUPA 1CSQA 1YNJC 1L7YA 1EY6A 3GP7A 4C1NK 2BYEA 3CSTA 1E0ZA 2BS3B 1FO4A 2MNAA 2KHWB 1PGBA 3ETRA 2IWHA 1GUNA 1BKBA 5IODA 4BOZB 1S5DD 1OGWA 2C7MB 1K9MC 3F2UA 4KGRA 1SIFA 2DENB 3ZDMC 4KJNA 1TTNA 1N62A 1HXYD 1PH1A 3U4VA 1SNQA 1UGJA 4DR1L 1IBXB 4K3BA 5IGCA 5BMIA 1GC7A 5C4ZA 2MP1A 1Y1WB 2YU9H 3NEMA 1XNRL 2JZZA 5M3MB 1S5CD 3KF6B 2D10A 1SE9A 1UELA 2IGHA 4C3HG 2CJOA 3VTUA 3K0XA 1PGXA 1SYGA 1EM7A 2ICIA 1IL8A 2NTTA 1O7ZA 1D1KA 4FNFA 2EY6A 2NBWB 3ER0A 3TQYA 3QX1A 3WAOA 2YTVA 3AV8A 1A62A 2NWGA 2KEEA 3QJYA 4GNXC 2KO3A 1K0SA 4LF8L 2MH7A 2A68D 4JIOU 3KOJA 4NY0A 4X62L 4HN7A 5GMVA 2FNJB 3M4QA 1TWCB 1WJ4A 2PE9A 3S2AA 3ZTDA 3N20C 2JZ3B 1CHQD 4RHRA 3W1YA 3SFEB 3T8MA 4R8NA 2CHWA 1A3VA 2JA8G 2FMCA 1DJRD 1JOQA 3KK7A 3Q3NC 3RMHA 3LWUA 2ATWA 2RR9A 4GDLB 1BNZA 4B6WA 2X6GA 4GSWA 1D5XC 5IE8A 3JAMi 4DPGA 3PRPB 4G7ZC 1Q3LA 3CWIA 1DOYA 1N6ZA 3Q8BA 1RLFA 4IKGA 1UEBA 1G91A 4YWMA 4XXEA 5C4HA 4Q5VA 1B50A 1FM0D 2BGFA 3T9LA 3PZDA 2ZXOA 1SYDA 3RLNA 2KD0A 4ZRQA 1GJXA 1FNVA 1XYIA 4A9AA 5HHDG 3P4SB 3E56A 2RPQA 2F0WA 3DM1A 3KJPA 1I3QB 1MSHA 4AOFA 4X64Q 3LYYA 4A3EB 4HSVA 5E3FA 3IVFA 1BQQT 3HOWG 3UF8A 2N4FA 4QIWB 1H95A 2D07B 2HUGA 4BBRB 2INCC 1EQTA 1GUTA 3W5VB 5NUCA 5BMGA 2DJFC 4FDBA 2RHQB 4D2KA 2WFWA 1C8CA 2VRRB 3SD5A 1CJEA 2PMVA 3S17H 1PV4A 1L6VA 2IBIB 4CKCA 1FGBD 3A7LA 3BJUA 1VR9A 4HIOA 2UYZB 3FC4A 2KCCA 3P4QB 4RGOS 4ZKCB 4UDUC 4HKZE 4DV3L 2HTHA 5AEKB 1STHA 3M95A 4AH6A 1Y1WG 4LUZA 3CPWA 1KF6B 5D94A 3R7RA 1K8GA 4AYBB 2Y3AA 5DPSA 3MXPA 1LXDA 1UWMA 2Q2HA 4IUQA 1NUCA 2QEXA 2K5HA 5JJIA 5G2NA 4C4VB 1K8MA 2O2LD 2A8VA 1G2SA 2K14A 4CDDC 3OMCA 2BVCA 1M1KC 4BKSD 4A3CH 3W2DA 4A55A 2HIVA 2O4XA 3VQIA 4MM3B 3NBIA 1WVLA 2WWZA 4C3IG 3PUYA 3GTOB 1PH7A 4W9LA 5IA7A 4BY1G 1CM9A 5KEEA 4A3BG 1Y1VH 1N34Q 3QAQA 4L1BA 4AUQC 1PRTF 4A3IH 1II3A 4CQNA 2KLGA 3HOYH 2A4ZA 5C5MA 1WJJA 1K83B 1IYJB 3QJZA 1CI3M 3E0JA 1CMXB 2RVLA 4QUCA 1RM6C 3TEHB 5AJ3L 4GNXB 1XEEA 4B3ML 5I2XA 1K3RA 3GZNI 4JOIA 4LNKA 1NMGA 1KH0A 1RJTA 4KN7C 5C3EG 3H0GG 2QCZA 3ABVB 4PS8A 1EY5A 1QOHA 1L4DB 3SFDB 4M0WB 4KKIA 1ICFB 1XX8A 2LMCB 1R4PB 1F1HA 1HUMA 1YHBA 1WTHA 2GBNA 3PPAA 3PO2H 2MFIA 3PO0A 2AL3A 5L95C 3H7SA 4OVVA 3LGJA 2D11A 1ASZA 2VB3X 4CDCC 1VQ4A 2NVYB 4POGA 1HEZE 2INDC 1WSPA 4C3JG 1GD7A 4A3JG 3PF5A 1L2NA 2WXIA 2WQYB 2QDBA 4OGQC 3P1MA 3EC8A 2NN6G 2WXQA 4A3GB 1YHAA 4DU9A 1MVKA 3TEWA 4BXXG 2UXCQ 2KFKA 5FR6A 4BY7H 4DHZB 2N7EA 4GMVA 3M4PA 2ASBA 2WXNA 3X3NA 4RMFA 5LL6S 1LTAD 4JBJA 3LX0A 4X3TA 3BDCA 2BT6A 3L4PA 4EGVA 4E3CA 1WMHA 2L5TA 1N36L 2LY7A 1DCZA 3JW0X 3ONSA 2PQAB 3JC66 5A2QL 3N1XC 4W9GA 3VFKA 2KEDA 3U4ZA 3K7UC 4ANUA 2D3CA 1AWDA 1WXQA 4BAXA 5IGFA 4A4IA 3VR6A 2EMSA 2D2CC 2JA7H 1TKGA 2PI2E 3HP3A 5EE9A 4J6HA 4DXFA 4JLCA 1HA6A 3UIOB 2V3SA 2OT2A 4AYBG 2QIEB 3FHWA 4DNIA 1BR9A 3BIID 4NDXA 2NTSA 4YL8A 3PT2B 2B2UC 2NVXB 3H3VI 1Z6HA 1HZCA 1LTID 4XZ4A 3M4OH 2HT1A 2JUOA 1QUQB 2IHFA 2GBRA 2IJ0A 4K8IA 3NK9A 4A3FB 5IT9E 2KX0A 4NAWA 2JRHA 2R7FA 5C0XG 1Y1VG 4A93B 4KY7A 2ASQA 3GD7A 3U9SA 4GN4B 4IO9A 4CO7A 4DNTB 2PZWA 4LLGM 1S5FD 1E2ZA 1GB4A 5C1ZA 1WFYA 4DHJB 1PZKD 2A74C 2Y0SG 3LJ3A 2YEPB 1S4ZA 2B2UA 3FP9A 1Y8RC 2HE7A 2MBQA 3QC8B 3U7DA 4HMIA 4C7ZA 2OEOA 5J22A 2Q8RE 3UE0A 4MEMA 4IJHA 2G4DB 4MTKA 2LUMA 1HZ6A 1U4AA 3RNFC 4B08A 3EUB2 1YZ6A 1PFSA 3IFDA 4MHEA 4LCDE 3E0EA 5FLXL 3CCVA 1PTOF 3H91A 2DYBA 1S3OA 5C4XH 4JI5Q 2JA5H 2NVUI 4ITKA 4AP4C 5LHY1 4EQOA 3K7AH 1KRSA 1MIUA 5FO9B 4F8MA 2K5PA 3D0FA 5IP9H 2MUYA 3PCOB 2KDMA 2JA8B 2B29A 2K39A 3HM3A 3HOUB 4P16A 4M8AA 3T1YQ 4DUYL 1J8CA 3ZKJC 1OEYJ 2NVQH 2IO3B 1X65A 3PGZA 4BY1H 2WDRB 2K3UA 3CCEA 2WXGA 3BY4B 3CSFA 1LTRD 1ZP0B 4KSLC 3VUWA 3ZNGC 1YVCA 2ZXRA 2W3RA 1MJEA 3J80L 3B0AA 2KOXA 3HKZE 5CGKA 3EIVA 4ANWA 4P1CC 4A3CG 1KIXA 4JI0L 4CKEA 2KENA 2EXZA 4JBKA 2MHVA 3B2GA 2YTXA 5COYA 4K7UA 4BBSH 2YEPF 3MA2B 2WYQA 1CKNB 1PVOA 1SYEA 4B3TL 3DWAA 1Y8PB 4ASWC 1IXRA 4AJWA 3HOZG 3JYUA 5T8IA 4BA2I 3DVNU 3MEFA 4B3RQ 5G3LF 1C4QA 2PO4A 4RNAA 1BBUA 4B9WA 4EZLA 4DV6Q 4A3EH 1FRDA 3QOLA 2FHTA 1I3QH 1GHKA 3BINA 1ISNA 1RL2A 2GA4B 2EMTA 3CC2A 2WXFA 4ILWA 2OWOA 3NHHA 4YXDB 3S14H 2UUBL 2BB5A 2B76B 2ZPNA 5H92C 4QB4A 3CPFA 4DN4M 3A56A 1FD7D 4RCNA 3KJOA 4BWGB 1I6HH 1EWYC 2OOBB 3ZGZA 2M0AA 1D1IA 3O13A 3H0GB 1W6JA 4HCPB 5C4XG 1D8LA 2FUG1 2LFNA 4JI5L 5FLXE 3S1RB 1EWIA 2V4DA 3GTKH 3ZXVA 2IGGA 4O0AA 1K8OA 2PMZB 3V6CB 1I4HA 1WOCA 2HTME 4LJOB 4PV1C 2PKOA 1Q90A 2B8FA 4J3OD 4ZRIA 3AQQA 2BQQA 1D5MC 1XPRA 5BMHA 1YD8U 1OO9B 5IY0A 5BR8L 1X3QA 3R66C 4KTAA 4ANVA 3ALBA 4MSQB 2IO1B 2PJHA 2K5NA 3IBEA 2BH2A 2Q5WD 1XMQQ 2WKDA 2DX5B 1SE4A 4KGSA 2Z0DB 3Q14C 3RNUA 3RT3B 1TWHB 3J80E 3QWZB 2KOLA 3FKIG 2ZJPA 4P1BC 2K1BA 2OXPA 2RHSB 2DHZA 5DEHA 3BU2A 2JYTA 2FBWB 3GB1A 4B3TQ 3SR6A 1J19A 2LHDA 1H4RA 1HR0L 1JWBD 2R61A 1LTLA 1TR5A 2ZTEA 1O7YA 4A3BH 1KM7A 2G5DA 4RKBA 3ZDTA 3A9JA 3BYTB 4B0MA 2L0TA 3N32A 5A2QE 2D0OA 1Q8KA 2QMTA 1VQAA 2X69A 3NENA 3S15B 3DWMA 3PSIA 4OIJA 4OZCA 2D9UA 1TWFH 2QDFA 3L08A 3A4SC 4US9A 1NBFC 1B3AA 2E75C 3CCMA 2O2VB 2PW9A 4OEMB 3RYTA 4WJOA 2Z8LA 4HK2A 1X1MA 4V0BA 3U30A 3HHMA 1STNA 1JOKA 2JWUA 4W9FA 3CMAA 3PO3B 2CKZB 1BDOA 1A2UA 2NVQB 2A73B 1SB3C 2L76A 4A3GG 4X66Q 1IPGA 1T5XD 1UBIA 5ISRA 4BY7G 1Q86C 5C2TB 1V1PB 4ARCA 2L05A 1CKNA 2B63B 4JC0A 4LF7L 4OO1G 2FCMA 2R7ZG 3BZDB 4A3BB 5FR3A 2WXKA 5IN7A 3K5OA 4PZ6A 1ACCA 1IHZA 1EU3A 2KJ6A 2KWCA 4K6DA 3AE2B 2I5LX 4EUTA 3M63B 4W9CA 1ENCA 1X55A 1KAAA 2QA4A 3LNNA 4O2DA 5CV8A 2EY5A 2BWES 5IP4D 3UQBA 4ACFA 1JQ4A 3STBD 5FOBB 1QZHA 2UXDQ 1PMRA 5FLXc 2K0PA 2RDHA 4KJOA 2WXJA 3KUCB 3APDA 5EKLA 1BCPC 2Z6KA 4TVAB 3IAM1 1VQ5A 2MBHA 3ND8A 2W9NA 3FILA 1TIFA 2JEBI 1Z7TA 1F0ZA 3IFTA 1HNZQ 2VY3A 1V6EA 3UDIA 4YIJA 1K52A 3CKIB 2OTLA 3DM3A 1QOGA 4DNRB 4KDLB 1JOOA 3IG3A 2L12A 4CJ1B 5IIFA 1U4MA 2C35B 5IGGA 5M3MH 5D7GA 3NP8A 1ET6A 1IGDA 2VH2A 3RI7C 1ZXHA 1G6JA 2FMMA 4NAWB 4K2LA 2WDVB 4Y7NH 1WTVA 2WXPA 3SHLA 1D2BA 3S1MH 1J6QA 3O65B 4DR1Q 1HA5A 2JK8A 3BG3A 2OJWA 1FNWA 2EKEC 3STBC 4QMGA 2INPE 2I1JA 2L0FA 2LMCA 2LFIA 1HQRD 2RCNA 3TDQA 2CW0C 1UNSA 2RBMA 4PMCA 4DGZA 5CBAE 2Q2TA 4V190 1TYGB 2IPKD 1RIPA 3NQIA 4LW1A 3GTLH 3KLRA 5LMNL 3S2DH 4JV5L 1T0SC 2D5GA 1PTOD 3J7AV 5BYRA 4KDIC 1S5ED 2EJFC 3GE3C 3RR5A 3IAS1 4S0RA 5D2MB 3J80i 1E8WA 4JWSC 3GTJH 4JI4Q 5E4WC 2LGXA 4DV4Q 3Q23A 3WOEA 4WWOA 2MQJA 2PIAA 3N6RA 4BFRA 1I94L 5IYBG 4LNFA 3FDTA 4DV1Q 4X6AH 4CHKA 1GHJA 4JI2L 2HJ8A 1EYCA 2BKRB 2VQEQ 3MHZA 4AWJA 3I8ZA 1TZOA 1JC7A 2FUHB 2RSOA 4DWFA 1KNEA 2N8NA 3PLUA 3ZQ4A 5KHOA 3KWLA 1I4XA 3ZUNA 3EFCA 3HOVH 3TMEA 4RF1A 3M4YA 2DNCA 2J7ZA 4P75A 3GTPH 2LGYA 2ZW1A 4ICUA 3BVGA 2BA0A 3PUXA 4A75A 4G3XB 1IBXA 4PS7A 1WGRA 3BK2A 1HZBA 4U673 1CZWA 1A3UA 4DV2L 2WB1E 1P7FA 4I6LB 4L63B 1P9DU 4OIKA 2I38A 4A3GH 1WYGA 5M3MG 1KXLA 2KC1A 2PMZE 2M8SA 4OO1I 3PRMB 4IW0A 2DYMA 5EPKA 3V61A 1KRTA 2VZKB 2R93G 3H8HA 5EBDA 3WWVA 2K8BA 1JJGA 1F9QA 4NB3A 3NE5B 3OIQA 4R4IA 1BBXC 4DV5Q 3ZJUA 4HIMA 2QHOA 5D3IB 3PO2B 4BKTA 1L0YB 4IM3A 3L3OC 1D7QA 2KX3A 3NWTA 4FVMA 1TQOA 2RSNA 2ZJDA 4FHJA 1WI5A 1P16A 3R2TA 3SEBA 2PNHA 4RWSC 5ELFA 4GDLA 1E8XA 2X38A 4DV4L 5HGTA 2WX1A 1Q81C 1R4MI 1PZJD 1ZW7A 5FLMH 2F0NA 1WYWB 4NJ6A 4HJGE 1I94Q 1HZ5A 3Q8FA 4KV6A 2I5MX 1U5KA 3Q6SA 3A9JB 2EE1A 3KBGA 2JPHA 4PNYA 2GB1A 3D4WA 1UWXA 4EQNA 5HI1A 2O5IC 3DBHB 1H9JA 3VA7A 5JPMC 1DM0B 2GBJA 4ZRKA 4BBSB 1WJUA 2CVRA 4NXNL 2W3SA 3F1ZA 4W9JA 4BY7B 2LXAA 1MG8A 3UDFA 1QLBB 3PO3H 2QW7A 1KC8C 2B3GA 1WTXA 4BBSG 3EFUA 4HPMB 1EY4A 1D4BA 3CCUA 4HR7B 4LFCL 4OVUA 4EKUA 4B3SL 1DOKA 1L1OB 5M3FH 3K9PB 2ZXPA 2EYLA 5AJ3Q 2MJ3A 2IX0A 4H2AA 3T13A 1VQDA 3T1HQ 2J53A 1J5EQ 4B9XA 3SR1A 2A6ED 3RLFA 4YTNB 2PQEA 3VDYA 1SIJA 3D4DA 4BA1I 1N34L 1VQ7A 1NDDA 4KKUA 4DUZL 5TSSA 4DV5L 1ILPA 1P3QU 2LGDA 4US8A 2LD9A 4FJVB 4K3CA 1V49A 1LTTD 2J0JA 1E0BA 3K5NA 3TS2A 2K8HA 3MP9A 2NVYH 3VUXA 3VUYA 1PLFA 5DM73 1O80A 5M9OA 4HVBA 4M01A 2ZZPB 4IZ8A 1RRBA 2MA9B 3EGRA 3S2HB 4HDQA 3ZRCA 4I7AA 2L83A 2VQEL 3HFZB 4WWPA 4DXAB 1L1OC 4BBNC 5ELCA 2EELA 4C2MH 2C5LC 3HOXG 2Q2UA 4DV1L 1TIID 5G5GA 3PMFA 2ALYB 2IYDB 3N9YC 2I5HA 1V86A 2XVSA 1JE4A 5K5PA 1TBEA 3V05A 5BN3A 1LACA 1Q82C 3GO5A 5GAHC 1ZXIA 2AX5A 1NENB 1FCLA 3FVQA 4IPDA 3V6EB 5CTRC 3VYSA 1E8YA 2KLCA 4QCLA 2OJRA 4UY8C 3TIXA 2K9XA 1X54A 4JI8Q 4XYQA 2EVBA 2I46A 1XPOA 2IHEA 5I9PA 3DHGC 5LXHA 2D3BA 5C4XB 1WI0A 1PYBA 4IFDH 1JWUD 1T5EA 4KD3A 1WXSA 2AMCB 2TMPA 1G291 4NKLA 3WAPA 3T53B 1EQQA 1SYCA 5LL6X 4GOPC 3BWUD 1AW7A 1SNCA 2UU9L 3EFXD 1WIAA 3HK0A 2W55A 3X3MA 5C3JB 1IW7D 4YY3L 1IBML 1YNND 4R9WA 5C3WA 2R7ZB 1OQQA 2E5LL 1I4QA 1R7SA 2N88A 2CW0D 1I6HB 2NBUA 3OG5A 4WQOB 3I4MH 4NQLB 3WOFA 3A54A 5C23A 4HPPA 2CU1A 3TP8A 4R4CA 1E3PA 2RQXA 3U7ZA 5BN5A 1XMQL 2Q8TA 2FAZA 3K80C 2ZCBA 2ZTDA 3RUIB 2A69D 2SOBA 3R7QA 1SJED 4X62Q 3HOVB 3VR3A 3K57A 5M5WB 4DR7L 2CFMA 3R2IA 3SXHA 4K0KL 1AEXA 1IGCA 2WDTB 3E9IA 3AFQA 3NG0A 1UH6A 4REZA 5IO9A 4LDTD 4TKNA 3U52E 2WHIA 2NUCA 4NXNQ 1ZGUB 4LTUA 2RDGA 3M3YH 2KDEB 2F4VQ 5C4JH 4HEA1 4J6IA 1H9RA 1VQ6A 1SNDA 3AM9A 2BS2B 3Q3FA 2L00B 4HCNB 2V3PA 1X3GA 4HTHA 4UPAA 3RN2A 1D6EC 1EUVB 3H09A 4W9DA 4GLAC 1UZXB 2GBKA 2M1MA 2V4LA 3ML8A 2NZHA 1LFDA 2AL6A 2IY1B 1WGHA 3OYYA 2F03A 3HVZA 4IM2A 3DBSA 4XT1B 1BXTA 3TN2A 2PZUA 3PIOA 3VR9B 4FADA 1C1YB 3L2PA 4RCOA 3DEPA 4YWKA 4L5SA 3WA0A 2EY2A 3SGIA 3B1LX 2L0CA 4X64L 3BDLA 4ZDVA 4PT5A 3P1HA 5AFWA 3CCJA 4N9PA 4WRDA 3TBLD 5CBEE 4OHJA 1BT0A 3C0RB 1IKMA 2CR5A 4JG2A 3GS2A 3APCA 4MGKE 4LAAA 3QK0A 2J7QB 3Q2AC 4LF6L 4E6IA 2JF5A 1WCMH 4A3IG 1HH2P 4K5VA 1N5WA 3GZNB 1FNUA 3L7ZC 4OELB 1LTSD 2A5HA 4FXKC 1WE6A 3S14B 2HJ1A 3V3XA 2Z9HA 4GB9A 3VTWA 1YIJA 3OWEB 3KW5B 3G6EA 4LF5Q 1TWAH 2V9HA 1PXUA 5AZFA 1DYQA 1YNNC 2AWOA 1YJJA 1PUTA 4QGUA 1I5FA 1XLPA 4F88A 3TBIB 1P1AA 2FINB 1L6UA 4HRSA 4YSZB 4DR3L 3N52A 3WCQA 1QG7A 1YN5A 3KF8B 2TSSA 3RPFC 3RD2A 2K7VA 5FJ8H 1CT1D 2CWAA 3AU4A 2WKCA 3QCAA 1OXTA 3DLLA 1HFNA 3L10B 3I4MG 1YI2A 2VZAA 1E22A 2B2WA 1VZ8A 2MLBA 1VS0A 2F0HA 1U4RA 1NJIC 2VW9A 3I2ZA 4FBJB 4QY7A 2O5JC 3ERSX 4FO2A 3H7PB 3V2TA 3VYRA 4QF4A 2E2HB 2M4NA 4L5TA 4G11A 5C5LA 4ME3A 1VF5C 4A3JH 3RN5A 5CC4A 2V1YA 4E71A 2VXWA 2A6HC 2EYPA 4PG3A 2M19A 1EY8A 5EBCA 5IWAQ 3PUVA 1PHJA 4G7OC 4FXGC 3L0OA 4CBVA 5KIXA 2JA7B 3NVVA 2F0MA 3Q8DA 3UI3A 4DDGD 1HTLD 4NJCA 3CQZB 3T51B 1YJ1A 2FCSA 3J81c 2JA6G 1HNWQ 2E76C 2KN5A 4F7XA 1OXVA 3HRZC 5LMNQ 2H4OA 2GI9A 4F8CB 3Q3MC 3PIO3 1XF5L 4EZJA 2LUEA 1R4QB 1M90C 1L2FA 2GBMA 3MTSA 4QAYA 5HG2A 1SE3A 5D3DA 2JZPA 2KDFB 2WP8J 4K0KQ 2WX0A 4P71A 1DZ1A 2MGSA 3R8BA 4DAYA 2AEHA 2IO2B 1K3BC 1SNOA 2EPBA 1XPUA 2FE8A 3QO2A 1EOVA 5CHWA 3AYHB 3ONAB 1EUJA 1PH8A 3GTQB 1DD2A 4FJYA 4YSXB 1CFMA 1VQLA 1MHXA 4DR3Q 4DK6C 2XBBC 1QKZA 1WY8A 1PFNA 4DK3C 4N8X1 2XWJB 1SNPA 4GKKL 3TSSA 2JSVX 3OSOA 4IWOA 1LT3D 4GN3B 1M4VA 3HOWB 3LXFA 3CHBD 4YCWA 4W9KA 1F77A 3NVYA 3I4MB 2B2YA 5D14A 1X9NA 5GXGB 1C9FA 1PTOB 5ELOA 3Q8EA 4K1RB 4H7BA 1BCPB 1ONLA 2PZTA 1VZ7A 4CDFC 5E7NA 3GOEA 3GTGB 2G45B 2MEKA 2YTYA 3K6OA 1YEZA 5M5YB 1EFWA 2UUAL 1QB5D 2LSSA 1KJTA 2VQFL 1ICWA 4MN3A 1ILQA 3AEAB 5FKAC 5GROA 1GJZA 1B70B 3NBHA 1GUGA 4A3KG 1VQKA 3I55A 2IY0B 1IP9A 2LVQA 3TEYA 5JHAA 3UINB 2B39A 1E5WA 2N9EB 2KMCA 1JROA 3J7AF 1GVPA 2MBOA 2L52A 5DAUA 1SN8A 1VQNA 4RM9A 2LASA 3HOZB 4XDCA 2DZMA 4KI0A 1HUNA 2ONQA 2YVCA 3ZVVA 4W9IA 2JP1A 3KBXA 1QOFA 4C3JH 2K01A 5CR3A 5AZGA 3ZW3A 2AKWB 4WORA 1JCKB 4LJZC 2E2IB 1F2RC 3DHQA 1OEYA 1DOXA 3MFGA 3PUWA 4BZAA 3M7NA 4OONA 5D65A 4IOAA 3HUIA 3B08A 3PV1A 1N63A 4DK0A 1KNAA 5M5XH 1CQFA 3C2PA 3S1NH 4YSYB 1OQRA 4WAFA 3RNEC 2H1EA 4CGYB 2MBBB 3D6WA 5G5HA 3VH4B 1AH9A 4EZKA 2ICEC 4BBNF 3RFZB 4EQPA 1JICA 2VQFQ 3LB8C 2PPBC 1SMXA 1NNXA 2K33A 3UI2A 3W1BA 5BN4A 1PH6A 4DK5A 3NTHA 4RHSA 1AZQA 1R4NI 1AARA 1GC6A 4ZK9B 2XRQD 3HOXH 4ODGA 2AHOB 1RAXA 2F3VA 2HCIA 3CP0A 1Q0WB 3GV3A 1KLUD 2FCNA 4TUUA 1SFOB 2PQAA 4WFN3 1E2WA 3IKJA 3K7AB 4IURA 1HNXL 1VQ8A 3GTLB 2CS4A 5IAAC 1G51A 4HCEA 1L0VB 5DCNA 2G9DA 1A0IA 2JA8H 5CV4A 3KLWA 5CHFA 4JI7L 4AYBE 2K6AA 1DONA 1NR2A 5KHQA 4NPNA 4K14A 3S16H 3B2FA 4GLXA 1STEA 3FRPB 2CHXA 4RH6A 1KD1C 2QEJC 5HFYA 4KY5A 2E8GA 2N78A 4NAMA 1J7CA 1FL0A 4CJ0B 4QL5A 1Q7YC 2K1FA 2XTIA 4KHVA 2F0QA 3G48A 4X57B 5CMDA 2KQ7A 1STBA 3DVGY 1Z47A 3N1ZC 1VQGA 4WWNA 3CAMA 4DXGA 3G4SA 1B2TA 4ZHPA 1RFAA 1UWVA 3ULPA 3NWSA 3RD4A 3RNAC 1FEHA 2F0LA 5HY6A 2WXLA 4IWPA 1Z9FA 2KQ4X 2JRIB 2Y0SE 2WINB 1R9TB 2UUBQ 5GADC 1GUWA 1A70A 2L11A 3RN9C 4HLEA 2KQ3A 3TREA 1IBKL 3I72A 1N8RC 4TMAB 4C00A 1UE5A 5ELDA 1TS4A 3PREA 4NQKE 5J1ZA 4PYUA
chains in the Genus database with same CATH topology
3D31A 1I6VC 3A55A 3I9V1 4H13C 3A7AB 2PW7A 3P42A 1TVXA 1QT9A 1NYQA 5CV7A 1C4AA 1P7EA 3IXSA 4RKLA 2YU9B 1A3TA 2XRSD 1JW9D 4A6QA 4FXCA 4GLSC 2MPMA 5J39A 5DNFA 2IDYA 2DYOA 4USAA 4KKTA 3VR5A 1NR4A 3AEFB 1FXAA 4R3DA 4WURA 3W1SA 3LWEA 1TKEA 2DY8A 1RCVD 4I7ZC 1E2VA 4IFDJ 1X32A 2K04A 2EOTA 4C80A 5A35A 2DBYA 4FYDA 4LK0M 3VR8B 4K8JA 1FCCC 5C3EB 1PFMA 1JWAD 2AUKA 4HROA 3AE6B 3AH7A 3QOJA 4DAVA 1TWFB 2Z1CA 4X3SA 2B2VA 4A90A 2R92B 1TWGB 3FILB 4NZLB 1RODA 2M00A 1YN4A 1YQ4B 3AE7B 2I2YA 2A68C 1KLGD 2DNEA 4XQJA 1L5PA 4FP5D 4S3SA 2JEAI 1KDAA 1ET9A 1AYFA 4KY6A 3AEDB 2BA1A 3K59A 4IALA 4CKBA 1K50A 4O1NA 1VLBA 1WD1A 2K28A 1YNJD 1EZ8A 2PTLA 1QNKA 3G6JB 1C48A 1IUEA 1RF2D 3BDOA 5JVH3 1VMPA 2DLBA 2Y5PA 1EIHA 3D3RA 1YJIA 2BOSA 1VCIA 3K0YA 2EKIA 1LLRD 4L6TB 2F0VA 2ID0A 3T4AC 1GUSA 3CIRB 5E6JA 1UUPA 1VRAB 1SJHD 3OHXC 1WTQA 4IUTA 1V97A 4JE3B 2LHEA 1GXDC 3TUOA 2QCPX 1Y56A 1LTGD 1QILA 5AUIA 1SSNA 4HKQA 2NN6I 4HMJA 4RGTA 2F0PA 2D5DA 4MIUA 3C8YA 2F0SA 1EEFD 1QE6A 1G8ZD 1CZPA 2J42A 1K51A 4KGTA 1D5ZC 1C4CA 1E7PB 1PRTD 1RDPD 4H44C 1HFGA 4XIGS 2EYOA 1V1PA 1XWEA 2JA6B 5FO7B 1KFYB 3AMZA 1MPEA 4ZQ3A 3P7JA 4DF7A 2EZVA 1YNTE 4A3JB 2F1MA 2F0JA 3M4OB 2EYFA 4TSSA 1ML0D 3NRZA 5K36G 1GPXA 2WU2B 4PMBA 2B2TA 2IT1A 4PQXA 3SK6A 3IT4B 1YQ3B 5KYLA 1KRHA 1ENAA 3D8GA 2WB1B 4ZRPA 2H88B 4JPSA 2XNAC 3I4LA 3OOCA 2KN4A 2ON8A 2HDMA 1FD6A 1RWSA 4QUFA 5C4JB 1BUVT 1OXXK 1GAQB 1VJKA 4WJWA 2PLPA 3NTIA 1YMHE 2NVTB 5I9OA 5EE0A 2KJXA 1IW7C 3HKZB 3MXNA 4B0EA 1RFKA 1PTOC 4OO1H 1BCPF 1ZPSA 4TKOB 5CV9A 2WXOA 3S16B 1SXTA 2NN6H 1O7LA 4U68A 3Q0AA 5KRUA 1I7HA 2K32A 5DM63 1B9RA 4IQZA 4BY1B 4ME5A 4K2KA 3DUZA 2F0UA 1PDXA 1W6KA 3I70A 4CHTB 1C4PA 1JRPA 5JXVA 2FJ2A 3Q8CA 1ZDVA 3S1NB 1C79A 1V43A 1ZYRC 2Z4IA 3U2SC 4XT3B 5ELEA 4ZYSA 1CQVA 3MHBA 1C77A 1AN8A 1XTCD 4ZAIA 3QG1A 3BS1A 1WD0A 1EQVA 1EY9A 1WGKA 1B1ZA 1OFFA 2W82A 3W9CB 1CA6A 4N6EB 2F0IA 4ID6A 5LNK1 3Q8AA 3TZUA 2IL8A 3A8JE 4N9TA 4C1NI 2K22A 3NTKA 2EJGC 2WXHA 1HTPA 5C0XI 1H9MA 2QF7A 4UAIA 1Y1VB 4OW0A 3BK1A 3Q69A 1PZID 4F87A 5AUKA 1WTOA 2A6HD 3FEWX 2E6XA 3HOYB 1A6XA 4HAEA 4O42A 5JEAJ 1FFVA 3S1QB 2MJEA 2AQ3B 3BVMA 3GTJB 3I4NB 1OXSC 1F9RA 2V4IB 5EJWA 4C56C 1XXGA 2PYKA 4G7HC 5JVG3 4ZLTF 5F2DA 2VNUD 2JX5A 2RPVA 2KUMA 4KKSA 2BB6A 1RTOA 4A3MB 3NSWA 4M0WA 3R93A 2EDGA 3C1FA 4OVZA 1HRJA 1SAPA 2WLBA 1PFDA 3CU7A 1Q1EA 3MXUA 5EE1A 3OWFA 4IFDG 1EYAA 1JMLA 1Y8NB 1SEBD 2PNRC 3J9CA 3DEOA 1TWAB 1QOAA 2E3TA 3SVMA 3NUHB 1LT4D 3RZDB 3PZ7A 3KLSA 1EOTA 4NW2A 4MACA 4JWUC 4K6LA 2MJ8A 3L9AX 2J0TD 4DQOC 4ZUIA 1I50B 4FF1A 4IUNA 3S1MB 4KK7A 3DWGC 4DA2A 1I4RA 2AQ1B 1S5BD 4ZUJA 3AN1A 2KECA 1QJOA 4A9AA 2RMMA 3JAME 1ZUD2 3GQBA 1G2TA 1BF4A 3AMUA 2N55A 1PFBA 3URYA 1MHHE 2KA7A 4R8IA 3AEEB 2F0OA 1HQMC 4WQMA 4EVOA 2L1AA 3ND9A 2JXTA 3M3YB 1LTBD 4JBWA 1LT5D 4IFDI 3ZJTA 4XDXA 1ROEA 2C5CA 2N0SB 1H9KA 1TS2A 3AEGB 1QNUA 2CU3A 3T16A 1Q10A 1SDFA 2E2DC 1H9SB 2A6EC 1FXIA 2JSOA 2V3NA 1CK1A 5MPOA 1IYUA 1AZPA 1B44D 2L55A 5BYSA 4ZKBB 2CJNA 1KDCA 3MEHA 2PCFB 4J8QA 3AE3B 2LS01 3P4PB 4OL7A 1WCMB 1SBBB 3G7LA 2BCOA 1VDZA 2BE5C 4YT0B 2G9HD 2WU5B 1Y8OB 3GTKB 1KABA 2GRIA 4RA8A 4Q0FA 5CV5A 3BYYB 1FYCA 1EEID 4A8XC 1J8IA 1U4PA 1ZE3D 2X6LA 1I4PA 2KCNA 4RFBA 5E1FA 2F0EA 3C3LA 3VRAB 1VMCA 1B53A 2BDNA 2LKVA 5K36H 4OZAA 2SDFA 5ELBA 5EKKA 3TP6A 1SSOA 3A8KE 3SK5A 1F9SA 3I91A 2QSDA 1TT2A 3J81L 1K53A 1EL0A 4MT5A 4C7YA 3OW7A 1DOMA 5CORA 5EPJA 4KD4A 2FFKB 3H6MA 2H89B 5I2YA 1MI0A 1NI3A 1ENFA 3DWQA 5T1IA 2LEKA 1FMAD 4TQ0A 2J52A 2CHBD 5JOBA 3W3AA 3HRDD 2W54A 1E10A 5EGTA 2WNMA 3W5UB 4C2MB 3R3OA 5JEAH 4L2YA 4TQUS 1MD2D 1ZKOA 1U4LA 3TZDA 1MGSA 1LT6D 4YTMB 5M5XB 2C9OA 2EJMA 3A8IE 2KACA 1QOBA 1PRTB 5IGBA 1A2TA 1F2RI 4G4KA 2K5WA 3SK8A 2SNMA 3V96A 1WTWA 4RGMA 1SMYC 2SNSA 3I57A 2F0DA 5E4XA 5JEAG 1TU2B 4KN4C 2HQEA 2AUJD 1JALA 2L9HA 1TY0A 4YWGG 2E74C 3NVZA 2WP9B 1AFPA 3E6ZX 1TY2A 3TP5A 2WACA 1NSNS 1G6ZA 3KQ4A 2HDLA 2R93B 3KWVA 3PZ8A 3K5LA 1MBYA 3IAYA 1XLNA 2QKIC 1UEAB 1TKWB 1BCPD 2B2WC 4X3UA 1E6EB 2L32A 3FKIB 3QWNA 2VZKD 1L0XB 1JORA 3U4EG 2CQAA 2QJLA 1HCZA 4K5XA 2NYZD 1LABA 3ITPA 2BYTA 3K5MA 3H94A 2AWNA 2L1BA 4Y7NB 1QCBD 1ZEQX 4GZYC 1T6BX 4A3IB 3K58A 1EY0A 2I07B 4H0LC 2B2YC 1Q1BA 3AE4B 3J81E 3SDZA 3IL8A 1F2LA 5FK9C 4HEDA 4RF0A 5IOCA 3J7YW 2Y5CA 1MSGA 1JB3A 1XCTL 1JWMD 2NB0A 2IGDA 1EU4A 2JU6X 3I73A 2D62A 1O78A 2SEBD 3T3OA 1C78A 1TS3A 1QWYA 1WTRA 2NMQA 3EA6A 2WV6D 5C0XJ 4WH4A 2EY1A 2XIWA 2NZ1D 3Q24A 4N58A 5EKIA 3NXWA 1STGA 4I65A 4HSPA 1ESFA 4XWWA 1IKLA 4ZHOA 1KTKA 4M1UB 1SYFA 1SMYD 2K03A 3C1EA 3NZ3A 1MI2A 3PIP3 1VZ6A 4ZOHC 3D4RA 1HHVA 3OIPA 2VB2X 2XN9C 2JE6I 1FRRA 1J7BA 3HVDA 3CRLC 3ZJVA 4IUVA 2OHFA 2LGIA 2M2LA 4A3DB 2YYZA 2ACZB 1IYVA 1VF7A 1NEKB 1WWTA 2F3WA 1PGAA 3QIAA 1V8CA 1PTOH 3KLSX 3FMCA 5H8YE 1TKYA 2RA4A 3OMGA 3EVQA 1STAA 1N61A 1EWHA 1XCQL 1EY7A 1XLOA 4XTCS 4K5WA 1FFUA 3KUPA 3E5SA 2Y0SB 4G57A 1QQRA 4RAUC 1V8QA 4DFAA 1F2MA 2F4IA 3T3NA 2BBCA 3NQTA 3U9OA 1QF6A 1ZXTA 3E9SA 5C6AA 1C76A 4DAPA 2LJIA 3C46A 1J9OA 2WIIB 3MWYW 3NUCA 4PMWA 5KNCA 4L23A 3TEZA 4LK1C 3M7GA 2EYHA 4KHZA 2ENBA 3DWPA 3ERQA 4P2CB 5I6WA 1B9MA 4IUUA 1F2YA 1M8AA 3VYUA 4YTPB 3AE5B 4NMZA 2V0GA 2BS4B 4IDIA 1EZ6A 2KVMA 5I6YA 1EIGA 3AE8B 4KKJA 4GDKB 4XYOA 2Z4HA 5KGUA 2N9KA 5KYIA 2F0GA 1BUIC 2SAKA 3H3VC 4IN3A 3S9WA 2INNE 1EWCA 2HCCA 4HCSA 3AECB 1BO0A 1LO5D 4C3JB 3D6CA 2M9VA 1PYWD 2M56B 3MFYA 4ARIA 3QB3A 3VR2A 3NVWA 5KNDA 1V1OA 1NVID 1JWSD 2OF1A 4LMQD 5BYQA 1N60A 2DY7A 4FXDA 3EJIA 1NYRA 3VYTA 4KX6B 3BVZA 1KDBA 4XWTA 2F0TA 1L4ZB 4TQ1A 1SE2A 3TEXA 3AE9B 3TP7A 1T3QA 1PRTC 1CTMA 1H9SA 1SNMA 3DXJC 2R3ZA 4FF3A 1JQYD 3I90A 5C0XH 1WTPA 2ZW0A 5IGEA 3VR4A 2PVOD 5IT9L 1GOZA 2J4XA 1BOSA 4EE2A 2N7JA 2B2TC 3GTMB 1E9MA 3P4RB 1RD9D 1CA5A 2WXRA 4Z9CB 1BMLC 2JXMB 1F2ZA 2RKSA 2DN8A 1RHPA 4XQQA 2VUMB 3NS1A 2KHSA 1UAPA 5KNBA 2JA5B 3M85A 4KMUC 3EROA 5HURA 3AU7A 1RTNA 2XWBB 2PVGC 3GV6A 4XE0A 2WXMA 1DXMA 5JPNC 3AB9A 1J7AA 4WWMA 2BDOA 2IX3A 2JQRB 1EYDA 1HPCA 1FIQA 4DK1A 2F0KA 2KWDA 2K5DA 1XLQA 4J1MA 1NCVA 4ZRZA 1I4GA 2WAQB 4L8JA 2JYEA 1CZGA 2KMMA 5T1GA 2BW2A 3FAHA 1TJEA 3DMUA 3AB5A 4C3IB 1EFID 1A15A 2QILA 1XO3A 4TRDA 3P75A 2N9LA 3HEJA 1ZYRD 3MC0B 3HS0C 4P6VF 1RYJA 2BE5D 3MZ5A 4N59A 2RDFA 1STYA 3B9JA 4RGNA 2K5QA 1DOIA 4X3KA 3P63A 1NAPA 1LV9A 1DGJA 1PDQA 4Q2JA 1JR0D 2WS3B 1VDVA 3FPUB 3VA5A 5C44B 3WDNA 3HZXA 3CRKC 1F9PA 4FF4A 1DOLA 3SK4A 3FPPA 5EPLA 4XDDA 3GTPB 3JAML 4A3KB 2HDEA 4CJ2C 5FO8B 2R6GA 4WIPA 4AS1A 2EYJA 3S2DB 4FF2A 3MAQA 2WDQB 1RKNA 5M3FB 3PV0A 4JX1C 1ZDXA 5EE3A 2B2VC 3VRBB 1U9RA 5CV6A 5C3XA 2IX1A 3RUZA 3MVVA 1OXUA 2OEDA 2NBFA 2EYMA 1B4OA 3IT6B 3RZOB 1Q12A 2AQ2B 1WRIA 2MJDA 2KAJA 3HG9A 1Q8IA 4ULLA 4NP5A 2BTEA 2A69C 3KF8A 4OZBA 2Q8IB 2F0FA 1YN3A 4C3HB 2ZT9C 5JJZA 1TS5A 4IOIE 1N5XA 1FR3A 1ESRA 2G1EA 3PUZA 4JK1C 1AP0A 1ZOYB 4ABNA 5G3LD 3Q22A 5EQ0A 2JYOA 1X3PA 3NPPA 2L4NA 3SE0A 3AEBB 3MJ5A 3T56B 3I3CA 2B8GA 3HOXB 3ZYYX 3AE1B 1GUOA 2DWQA 3EQLC 5CYUA 4AQ7A 2PW5A 1B9NA 1CHPD 2E2JB 3S17B 2K05A 1SF0A 2XSCA 4BS9A 3P20A 2IW3A 5I4DA 1Y69U 1SYBA 3OPOA 3MXGA 3HGBA 4XQNA 5JAVA 5IGDA 4IUPA 1E0ZA 1YNJC 1EY6A 3GP7A 4C1NK 2BS3B 1FO4A 1PGBA 3ETRA 2IWHA 1GUNA 5IODA 1S5DD 3F2UA 4KGRA 4KJNA 1N62A 1HXYD 1UGJA 1SNQA 1IBXB 5IGCA 5BMIA 5C4ZA 2MP1A 1Y1WB 5M3MB 1S5CD 2IGHA 4C3HG 2CJOA 1PGXA 1SYGA 1EM7A 2ICIA 1IL8A 2NTTA 1O7ZA 1D1KA 4FNFA 2EY6A 3AV8A 2NWGA 2KEEA 3QJYA 2MH7A 2A68D 4HN7A 1TWCB 1CHQD 4RHRA 3SFEB 4R8NA 1A3VA 2FMCA 1DJRD 1JOQA 3KK7A 4MH8A 3RMHA 3LWUA 4GDLB 1BNZA 2X6GA 1D5XC 4G7ZC 1Q3LA 3CWIA 1DOYA 3Q8BA 4IKGA 1G91A 5C4HA 4XXEA 4Q5VA 1B50A 1FM0D 2ZXOA 1SYDA 4ZRQA 1GJXA 1FNVA 1XYIA 5HHDG 3P4SB 3E56A 2F0WA 3DM1A 1I3QB 1MSHA 3LYYA 4A3EB 4HSVA 5E3FA 1BQQT 4QIWB 2HUGA 4BBRB 3W5VB 1EQTA 1GUTA 5NUCA 5BMGA 4D2KA 1C8CA 1CJEA 2PMVA 1L6VA 4CKCA 1FGBD 3A7LA 1VR9A 3FC4A 3P4QB 2KCCA 4RGOS 4ZKCB 4UDUC 4HKZE 1STHA 1KF6B 2Y3AA 4AYBB 3MXPA 1UWMA 4IUQA 1NUCA 1K8MA 2O2LD 1G2SA 3OMCA 3W2DA 4A55A 2O4XA 3VQIA 4MM3B 3NBIA 1WVLA 4C3IG 3PUYA 3GTOB 5KEEA 1CM9A 4L1BA 1PRTF 1II3A 4CQNA 5C5MA 1K83B 1CI3M 3E0JA 2RVLA 4QUCA 1RM6C 1XEEA 5I2XA 1KH0A 1RJTA 4KN7C 3ABVB 1EY5A 1QOHA 1L4DB 3SFDB 4KKIA 1XX8A 2LMCB 1R4PB 1HUMA 3PO0A 1HEZE 2VB3X 2NVYB 1WSPA 4C3JG 2WXIA 2WQYB 2QDBA 4OGQC 3P1MA 2NN6G 2WXQA 4A3GB 4DU9A 1MVKA 3TEWA 2WXNA 3X3NA 5LL6S 1LTAD 3LX0A 4X3TA 3BDCA 2BT6A 3L4PA 4EGVA 2L5TA 2LY7A 1DCZA 5A2QL 2KEDA 1AWDA 1WXQA 5IGFA 3VR6A 2D2CC 1TKGA 3HP3A 5EE9A 4J6HA 4DXFA 1HA6A 2OT2A 2QIEB 1BR9A 3BIID 4NDXA 2NTSA 2B2UC 2NVXB 1Z6HA 1LTID 2IJ0A 4K8IA 3NK9A 4A3FB 5IT9E 5C0XG 4A93B 4KY7A 3GD7A 3U9SA 4DNTB 2PZWA 4LLGM 1S5FD 1E2ZA 1GB4A 1PZKD 2A74C 2YEPB 1S4ZA 2B2UA 4HMIA 4C7ZA 2OEOA 5J22A 2Q8RE 2LUMA 1HZ6A 4B08A 3EUB2 4MHEA 3IFDA 5FLXL 1PTOF 3H91A 4ITKA 5LHY1 4EQOA 5FO9B 4F8MA 2K5PA 2MUYA 2KDMA 2JA8B 3HOUB 4P16A 4M8AA 2WDRB 2WXGA 2K3UA 1LTRD 1ZP0B 2W3RA 2ZXRA 3J80L 5CGKA 4CKEA 2EXZA 3B2GA 2MHVA 5COYA 2YEPF 3MA2B 1SYEA 3DWAA 1Y8PB 5T8IA 4BA2I 5G3LF 1C4QA 2PO4A 4RNAA 4B9WA 1FRDA 3QOLA 2FHTA 1GHKA 2GA4B 2WXFA 4ILWA 3NHHA 4YXDB 2BB5A 2B76B 5H92C 4QB4A 4DN4M 3A56A 1FD7D 4RCNA 1EWYC 4BWGB 3ZGZA 2M0AA 1D1IA 3O13A 3H0GB 1W6JA 2FUG1 2LFNA 5FLXE 3S1RB 2V4DA 2IGGA 1K8OA 2PMZB 1I4HA 2HTME 4PV1C 2PKOA 1Q90A 2B8FA 4J3OD 1D5MC 5BMHA 1OO9B 1X3QA 4KTAA 2Q5WD 2WKDA 1SE4A 4KGSA 1TWHB 3J80E 2KOLA 2K1BA 2OXPA 2JYTA 5DEHA 2FBWB 3GB1A 3SR6A 2LHDA 1JWBD 2R61A 1TR5A 1O7YA 4RKBA 3BYTB 4B0MA 5A2QE 2QMTA 2X69A 3S15B 3DWMA 4OIJA 4OZCA 2D9UA 4US9A 1B3AA 2E75C 2PW9A 2Z8LA 4V0BA 1STNA 1JOKA 2JWUA 3PO3B 1SB3C 1BDOA 1A2UA 2NVQB 2A73B 1T5XD 5C2TB 5ISRA 4ARCA 1V1PB 2B63B 4OO1G 3BZDB 4A3BB 5FR3A 2WXKA 3K5OA 1ACCA 1IHZA 1EU3A 3AE2B 4K6DA 1ENCA 1KAAA 3LNNA 5CV8A 2EY5A 5FOBB 1PMRA 2K0PA 2RDHA 4KJOA 2WXJA 5EKLA 1BCPC 3IAM1 3ND8A 3FILA 2JEBI 1Z7TA 1F0ZA 3IFTA 4YIJA 1K52A 3CKIB 1QOGA 4DNRB 1JOOA 2L12A 4CJ1B 5IIFA 1U4MA 5IGGA 5D7GA 3NP8A 1ET6A 1IGDA 1ZXHA 2FMMA 4NAWB 4K2LA 2WDVB 1WTVA 2WXPA 3SHLA 1D2BA 1HA5A 3BG3A 1FNWA 4QMGA 2INPE 2LMCA 2LFIA 1HQRD 3TDQA 2CW0C 1UNSA 2RBMA 4PMCA 4DGZA 5CBAE 4V190 1TYGB 2IPKD 3NQIA 1GB1A 3KLRA 2D5GA 1PTOD 3J7AV 5BYRA 1S5ED 2EJFC 3IAS1 4JWSC 5E4WC 3Q23A 3WOEA 2PIAA 3N6RA 3FDTA 1GHJA 1EYCA 3MHZA 3I8ZA 1TZOA 1JC7A 2RSOA 1KNEA 3ZQ4A 3KWLA 1I4XA 3TMEA 4RF1A 3M4YA 2DNCA 2J7ZA 2ZW1A 3BVGA 2BA0A 3PUXA 1IBXA 3BK2A 4U673 1P7FA 1CZWA 1A3UA 4L63B 4OIKA 2I38A 1WYGA 4OO1I 2DYMA 5EPKA 2VZKB 3H8HA 5EBDA 1F9QA 3NE5B 3OIQA 1BBXC 3ZJUA 5D3IB 3PO2B 1L0YB 3L3OC 3NWTA 4FVMA 1TQOA 2RSNA 3R2TA 3SEBA 4RWSC 5ELFA 2X38A 5HGTA 1PZJD 2F0NA 4HJGE 1HZ5A 3Q8FA 4KV6A 3Q6SA 2EE1A 3KBGA 4PNYA 2GB1A 3D4WA 1UWXA 4EQNA 5HI1A 2O5IC 1H9JA 3VA7A 5JPMC 1DM0B 4BBSB 2CVRA 2W3SA 4BY7B 1QLBB 1WTXA 1EY4A 1D4BA 4HR7B 1DOKA 2ZXPA 2EYLA 2MJ3A 2IX0A 4H2AA 3T13A 2J53A 4B9XA 3SR1A 2A6ED 3RLFA 4YTNB 2PQEA 1SIJA 3D4DA 4BA1I 4KKUA 5TSSA 1ILPA 4US8A 1LTTD 3MP9A 1E0BA 3K5NA 1PLFA 5DM73 1O80A 5M9OA 4IZ8A 3EGRA 3S2HB 2L83A 5ELCA 2EELA 1TIID 5G5GA 3PMFA 3N9YC 2XVSA 1JE4A 5K5PA 3V05A 5BN3A 1LACA 3GO5A 1ZXIA 2AX5A 1NENB 1FCLA 3FVQA 3VYSA 4QCLA 2K9XA 4XYQA 2EVBA 2I46A 5I9PA 5C4XB 4IFDH 1JWUD 1T5EA 4KD3A 2TMPA 1G291 4NKLA 3T53B 1SYCA 5LL6X 3BWUD 1AW7A 1SNCA 3EFXD 5C3JB 2W55A 3X3MA 1IW7D 1YNND 4R9WA 5C3WA 2R7ZB 1OQQA 1I4QA 1R7SA 2N88A 2CW0D 1I6HB 3WOFA 3A54A 3TP8A 2RQXA 3U7ZA 5BN5A 2Q8TA 2A69D 2SOBA 1SJED 3HOVB 3VR3A 3K57A 5M5WB 1IGCA 3R2IA 3SXHA 1AEXA 4REZA 3U52E 2NUCA 4LTUA 2RDGA 4HEA1 1H9RA 1SNDA 3AM9A 2BS2B 2V3PA 4HTHA 1D6EC 3H09A 2F03A 3HVZA 1JQ4A 4XT1B 1BXTA 3TN2A 2PZUA 3VR9B 4RCOA 3DEPA 2EY2A 2L0CA 3BDLA 4PT5A 3P1HA 5AFWA 4N9PA 4WRDA 5CBEE 4OHJA 1IKMA 3GS2A 4LAAA 4E6IA 4K5VA 1N5WA 1FNUA 3L7ZC 1LTSD 2A5HA 4FXKC 3S14B 3V3XA 3OWEB 1PXUA 1DYQA 1YNNC 2AWOA 1YJJA 1PUTA 1XLPA 4F88A 3TBIB 4HRSA 2FINB 1L6UA 4YSZB 3WCQA 3N52A 1QG7A 1YN5A 2TSSA 3RPFC 2K7VA 1CT1D 2WKCA 1OXTA 1HFNA 2B2WA 1VZ8A 2F0HA 1U4RA 2O5JC 4FO2A 3V2TA 3VYRA 4QF4A 2E2HB 5C5LA 1VF5C 5CC4A 2VXWA 2A6HC 2EYPA 2M19A 1EY8A 5EBCA 3PUVA 4G7OC 4FXGC 4CBVA 5KIXA 2JA7B 3NVVA 2F0MA 3UI3A 1HTLD 4NJCA 3CQZB 3T51B 2E76C 4F7XA 1OXVA 3HRZC 2H4OA 2GI9A 3PIO3 1XF5L 1R4QB 3MTSA 5HG2A 1SE3A 5D3DA 2JZPA 2WP8J 1DZ1A 2MGSA 3R8BA 4DAYA 1SNOA 2EPBA 2FE8A 3QO2A 3ONAB 1DD2A 4YSXB 3GTQB 1CFMA 1MHXA 1QKZA 1PFNA 2XWJB 1SNPA 3TSSA 2JSVX 3OSOA 1LT3D 1M4VA 3HOWB 3LXFA 3CHBD 1F77A 3NVYA 3I4MB 2B2YA 5D14A 5GXGB 1C9FA 1PTOB 3Q8EA 4H7BA 1BCPB 1ONLA 2PZTA 1VZ7A 3GTGB 2MEKA 3K6OA 5M5YB 1QB5D 1ICWA 4MN3A 1ILQA 3AEAB 5FKAC 3NBHA 1GUGA 3TEYA 2B39A 1JROA 3J7AF 2L52A 5DAUA 4XDCA 3HOZB 4KI0A 1HUNA 2ONQA 2JP1A 3KBXA 1QOFA 2K01A 5CR3A 4WORA 1JCKB 4LJZC 2E2IB 1F2RC 3DHQA 1DOXA 3MFGA 3PUWA 3M7NA 3HUIA 5D65A 1N63A 4DK0A 1KNAA 1CQFA 3C2PA 4YSYB 1OQRA 4WAFA 2H1EA 4CGYB 3D6WA 5G5HA 2ICEC 3RFZB 4EQPA 1JICA 3LB8C 2PPBC 3UI2A 2K33A 5BN4A 3NTHA 4RHSA