3B2FA

Maize ferredoxin 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Ferredoxin-1, chloroplastic
publication title A new structural insight into differential interaction of cyanobacterial and plant ferredoxins with nitrite reductase as revealed by NMR and X-ray crystallographic studies
pubmed doi rcsb
source organism Zea mays
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3b2fA00
3BIID 1QLBB 3P1MA 4FXCA 3LB8C 3RPFC 3VR9B 3KWLA 1J7BA 3NVZA 1N62A 3ETRA 4US9A 1FM0D 2JX5A 3AEAB 4YT0B 3NVVA 3P4PB 4KX6B 1NYRA 4YSZB 1F0ZA 1PDXA 3HUIA 3AECB 5AUKA 1RYJA 2QIEB 1QOBA 2M19A 1B9RA 1DOXA 2LEKA 3AMZA 3AE6B 2K22A 3AM9A 1A70A 3P4SB 1PFDA 4A9AA 2PVOD 3AH7A 3AEGB 1XLOA 3ABVB 2WU5B 3AE4B 3AEFB 3DWGC 4US8A 3LXFA 1NENB 2K5PA 2W3RA 1JWAD 1JROA 1YJJA 1JWBD 2W3SA 3AB5A 2WQYB 1FMAD 2CJOA 3P4QB 1JQ4A 1JW9D 2ACZB 1N63A 3AEDB 1E0ZA 3B2GA 3W5UB 4YTMB 2WU2B 4P6VF 1DOIA 3VR8B 5C2TB 1XLQA 1QF6A 2DWQA 2Y5CA 3CWIA 1VJKA 2L83A 2M56B 1PUTA 1QOAA 3EUB2 3AN1A 1WGKA 2E3TA 5AUIA 1TKEA 1NYQA 2Q5WD 3P4RB 5MPOA 1NI3A 1OFFA 1N60A 1ZUD2 4JWUC 1FXIA 3ZYYX 1EWYC 2JQRB 4C80A 1GAQB 1YQ3B 3AE8B 3WCQA 4C7ZA 2PKOA 1E9MA 4N6EB 4LTUA 3W9CB 1KFYB 1V8CA 3AV8A 3HVZA 4YTPB 3B2FA 4IDIA 1SB3C 2WDQB 5H8YE 1TJEA 2WS3B 4YTNB 1KF6B 2PIAA 1TYGB 5C3JB 1XLPA 3VRAB 3AE7B 2WP9B 4ZOHC 5EE0A 1WWTA 3AE5B 1FRRA 1KRHA 3FC4A 3SFEB 4ZHPA 3FAHA 1AYFA 3SFDB 1VLBA 1E7PB 1ROEA 1WYGA 1IUEA 1JALA 1JRPA 1N61A 1N5XA 1VDVA 2G1EA 1GPXA 1RFKA 3AE2B 1TKYA 2PVGC 2WDRB 3SR6A 1J7AA 1WRIA 1DGJA 1AWDA 2QJLA 4WQMA 5GXGB 1RWSA 1XLNA 2WLBA 4N59A 4N58A 5G5HA 1NVID 1OQQA 1T3QA 1ZOYB 2AX5A 2FBWB 5H92C 2KMMA 3P63A 4YSXB 1QOGA 1RM6C 2K9XA 1V97A 2CJNA 1E10A 1N5WA 2MH7A 1OQRA 2BS2B 3NVYA 2OHFA 3AEEB 1QOFA 2H89B 3W5VB 3AEBB 1FRDA 3AE3B 2MJDA 1L5PA 1QT9A 1L0VB 1R7SA 1TKGA 1WXQA 1FFUA 1CZPA 2HTME 2WDVB 3B9JA 3PO0A 4USAA 3AE1B 4ITKA 1FXAA 2N0SB 5EE3A 2MJEA 3VRBB 2MJ3A 2L52A 2W54A 4JX1C 1UWMA 1FFVA 1XO3A 5EE1A 2CU3A 1ZP0B 1E6EB 1SIJA 1FIQA 2B76B 2H88B 2DBYA 2KAJA 3CIRB 1FO4A 4YXDB 2EKIA 5G5GA 1L6VA 1YQ4B 4HRSA 2BS4B 3NVWA 4ZHOA 1ZXIA 3HRDD 1CJEA 5EE9A 3NS1A 3L4PA 3AE9B 1I7HA 1NEKB 1DOYA 3DWMA 3NRZA 4HROA 2BS3B 4YSYB 1L6UA 4C7YA 4WWMA 1J7CA 1YJIA 1SF0A 4JWSC 2W55A 2BT6A
chains in the Genus database with same CATH superfamily
3JYUA 4IW0A 2KFJA 5IKCM 4ANWA 4JL9A 4JQWC 5BMGA 3U52E 3EFCA 3HUIA 4QAYA 2QIEB 1DOXA 1KLUD 5HFYA 2DNFA 4US8A 2JYTA 1NENB 2ON8A 3UINB 2W9NA 1YJJA 4MACA 1BMLC 3P4QB 2ACZB 1KH0A 3NZUA 3ZXRA 3GP7A 2WXFA 2BYTA 3SU8X 1UNSA 4BZAA 3DVGY 4OVUA 3RNBC 1KLGD 2A5UA 2D3AA 1EWYC 1ISNA 2IGDA 2RDHA 3W9CB 3AV8A 4MGYE 2PTLA 2CU1A 4RGMA 3R3MA 2WS3B 4PYZA 1QZEA 5JHBA 4TQ0A 5DPTA 1XQQA 4GDKB 1WFYA 4J6IA 3PPAA 2K39A 2MWSB 4C00A 3BVMA 3OJ4B 5G5HA 4FJZA 3ZKJC 4DHZB 5G2NA 1CMXB 2WXKA 3W2DA 1XD3B 3Q2AC 5E6NA 1L5PA 1UGJA 3H7PB 5EE1A 1STEA 2SEBD 4ITKA 1Y8RC 3RT3B 5J2RA 1ENFA 2K8HA 2L3ZA 1E7UA 4ICUA 5G5GA 3NVWA 3TIXA 1E8ZA 1XCTL 2XNAC 2BWES 1L4DB 3QK0A 3QJZA 1L6UA 3DCGA 4TMAB 4ZOHC 2DZMA 3NVZA 2JRIB 4US9A 3AEAB 3VVWB 2N7JA 3TMPB 4RGNA 4YSZB 1WR6E 3DBSA 1RYJA 4B0MA 3ABVB 2KOXA 3H1UA 4C4VA 3UQBA 4REZA 3I63C 1C1YB 1E0ZA 4RFBA 4FULA 1Z5SB 1L0YB 3JW0X 1N60A 1ZUD2 2KD0A 4G11A 2JQRB 3APCA 1E9MA 1YNTE 2BTEA 2BBCA 2MQJA 3DBRI 3IG3A 2KLCA 1R4NB 1KF6B 2NTTA 1EM7A 3TUOA 2L05A 4GDKA 2V3SA 4M01A 1WYGA 2DLBA 1C3TA 4RH6A 4FADA 3H9DA 2WXPA 1UUPA 2IYDB 1KTKA 1NVID 1ZOYB 4YWGG 1P9DU 2Z59B 3H7PA 3T9LA 1ET9A 2HE7A 4KDLB 2DZKA 3Q8FA 3HVDA 3PLUA 2M4NA 1U4AA 1Q1OA 3B9JA 3RNAC 1CZPA 1TY0A 4NAMA 2N0SB 3BVZA 3K9PB 5CX3A 2K3UA 4DWFA 1H4RA 3Q3MC 4TKNA 1E6EB 4HRSA 3N9YC 3Q3FA 3PRMB 1H8CA 3KWVA 2GRIA 4KZCA 5T8IA 2D3CA 1V5TA 4WWMA 1WXMA 3TL5A 1YJIA 1WXAA 2JUOA 4KKIA 1TS3A 2GI9A 1JMLA 4LJOB 4KX6B 3HM3A 2KQ4X 1QOBA 2G45B 1IYFA 2J0MA 2V3NA 1JWBD 4B95A 1HZ5A 1JQ4A 1WX7A 1N63A 3W5UB 4FN2A 2L8JA 2LUMA 2OEDA 1P1AA 5D3IB 4AJWA 2PKOA 2KC1A 4ASWC 3HVZA 4IG7B 3RI7C 2FNJB 5IOIA 1OGWA 4IUMB 4ANXA 2MX2A 5GMVA 2BB5A 3P2BA 2QILA 1RFKA 3SR6A 5J18A 3JVZX 1RFAA 1WM3A 2MBEA 3GE3C 4A8XC 4WJPA 2CHXA 3ZJUA 5JHAA 3QC8B 4ARIA 2J53A 2UWQA 2NMQA 3P63A 1QOGA 2K9XA 1EU3A 2K25A 5DCNA 2FCNA 1HZ6A 1J8CA 3GS2A 1FNWA 5C23A 1L0VB 3PGEA 3AE1B 5DPRA 4ZRQA 2WNMA 4JX1C 2G4DB 4HJGE 2CU3A 2WXRA 1FNUA 3VQIA 2KVRA 3ZUNA 1EU4A 1WX8A 2C5LC 4IKGA 4AJYB 3AE9B 4OVVA 4MH8A 5HI1A 1PGBA 4YSYB 2JXXA 3QWZB 4MH0E 2Z8LA 3ZGZA 1J7BA 1FM0D 1AN8A 4B0EA 1NYRA 2RPVA 5HKHA 2LZ6A 3ZW3A 2JF5A 1ZXHA 3ZIMA 2J4XA 2R61A 3W1SC 2WX0A 1YOVB 5JH5C 4PS7A 2K6QA 2DWQA 3CWIA 1AARA 4K7SA 4M8NA 2M0AA 1R4MB 4EEWA 4HLEA 2VH1A 3ZYYX 2CR5A 1I4XA 4WURA 2V4IB 4MM3B 2ZW1A 2RDBC 1SB3C 2K1FA 4RGOS 1SGHA 2JWZA 1RLFA 3ZNGC 1SXTA 2NR2A 2YEPB 2IO2B 1FRRA 3E56A 1AYFA 3V3XA 4RMAA 4HDOA 1JWSD 3AE2B 3CSFA 1HEZE 4LNOA 1NI2A 1MHHE 1VD2A 2FUHB 4HCPB 4BAXA 3RNGC 4NNJB 3VAWA 4AWJA 3N1ZC 3N3KB 4I6PA 2KTRB 4IM0A 3RNCC 3GZNI 3PHXB 2D3BA 1LQBA 4AQ7A 1TZ1A 2YEPF 2BWFA 1XO3A 3L0WB 3PRPB 4LLGM 2C60A 2N9LA 1TY2A 2HDEA 2D07B 2JPHA 2NBUA 1F9JA 4LNFA 2V0GA 3CMMB 4S17A 3DVGX 2LRUA 4WAAA 5IAAC 1PDXA 1B9RA 1CQVA 3APDA 3TJPA 3ZTCA 1A70A 4FJVB 3L13A 2LXAA 1SSNA 2GOWA 2K5PA 1JWAD 1ESFA 2HJ1A 4DXGA 3EC8A 1ZE3D 1FMAD 3RZWC 5J17A 2BB6A 1QQRA 2LVPA 3GE8C 2MBOA 4MM3A 1WGKA 1MG8A 1E5WA 1SE2A 4GSWA 4GIVA 2KTFA 3DBHB 1GOZA 5L83A 2PMVA 3N20C 2AL3A 3PVLA 2KDMA 1RWSA 2WXQA 3VUXA 3ML9A 1V86A 5D2MB 2RGFA 2KTRA 2QCZA 4NQLB 5EDSA 1ZDVA 2HTME 1V9JA 4R3DA 5BMIA 3T3OA 2KC2A 4F1SA 1ET6A 2FCSA 1MHXA 1E8XA 1YQ4B 4LNKA 2BS4B 1C77A 4N9F4 4ZRPA 4HCNB 2JSVX 1NEKB 4MSMB 3MHSD 3IXSA 4PS8A 5E6OA 2XBBC 2G4SA 5AZFA 3NVVA 3DBLI 4FHKA 4S0RA 2BYFA 3Q69A 2TSSA 1CK1A 2LEKA 1MJDA 3DWGC 4CYEA 4EE2A 3LXFA 3LYYA 2DAFA 1XXGA 3EA6A 3AB5A 4TQ1A 3EHVA 4TUUA 2WU2B 1JWUD 3APFA 4BFRA 2MP2B 1K50A 1EO6A 3E9SA 2ASQA 2JZPA 3A4SC 3P4RB 3VTVA 3S2AA 2JZ3B 2N7EA 2WHIA 1SEBD 3NZ3A 1VZ7A 1E90A 4KIKA 1C4PA 3QIJA 3FAHA 1N61A 2KWCA 4F7ZA 2INCC 2PVGC 2ZPNA 4A3OA 1EF5A 2GMIC 2OOBB 4XE0A 3OJ3A 1YMHE 2JY6A 1XLNA 1WMHB 4CHKA 3KYCD 3H8HA 3Q3OC 2ZNVB 2N7DA 4MGIE 3A33B 3TEWA 1VRAB 2H89B 3WAPA 1K51A 4HPLB 2JVCA 4W9KA 2OJRA 2KT7A 4X57B 1S1QB 4ACFA 1T5XD 1WX9A 4JIOU 3KW5B 4IC7B 3U4EG 3OG5A 2KQ7A 5BO4B 3IAM1 2O2VB 2M1MA 1ZKHA 3L08A 1L6VA 2K8BA 1LFDA 1CJEA 3PTFC 2AYOB 4W9CA 1MG4A 1PGAA 2AQ2B 3DWMA 3BY4B 2E6XA 4FXCA 1WZ3A 4CO7A 3M3JA 1K52A 4OW0A 3ETRA 1BXTA 1FNVA 4G50A 4XC2A 2KX0A 3RNEC 3W1SA 2HD5B 2PLPA 3IAS1 4LDTB 3P4SB 2KWUB 4XDDA 3QQ8B 1ZDXA 1TIFA 2KX3A 5AZHA 1K8RB 2CHWA 4MSQB 5BYRA 2MP2A 1UH6A 5JXVA 2ZEQA 3I9V1 1C4AA 3PZDA 5IO9A 3A9KB 4EUTA 3VHTC 2L7RA 4AS1A 1NI3A 1FEHA 1Q0WB 4LTUA 3K9OB 2FIFA 5IA7A 5DPWA 2IJ0A 2PW9A 5LLIA 2QDFA 1IGDA 3SFDB 5G55A 1WMHA 3RUIB 4FBJB 1B1ZA 1J7AA 2QJLA 3TEZA 1VZ6A 2L0FA 2FUG1 4N59A 3PZ7A 4XWWA 2AX5A 2FBWB 3LDZE 2CJNA 1N5WA 3J9CA 2BS2B 2JYEA 3GOEA 2LJIA 1ZGUB 2NS5A 1GC6A 2O2VA 3RCZA 2MA9B 1FO4A 3V61A 2H88B 2KAJA 3CSTA 4YXDB 3RNFC 2RPQA 2JXTA 1IBXB 4II2B 5D3DA 1HTOA 4EFOA 5EE9A 3L4PA 1V6EA 4W9FA 3MFGA 1KLVA 1K53A 4B9KA 3LB8C 2D2QA 3KWLA 1N62A 3JSVB 4P7IA 3BK1A 1GC7A 2OJWA 1IPGA 4P1BC 2KVZA 4O1NA 3ZRFA 3QCAA 2MBHA 4M02A 1XLOA 4KVGB 3A9KA 4XWTA 4JPSA 1V1PB 2G9HD 4P6VF 4RF1A 4FJYA 4K3BA 1QF6A 3RYTA 4LNNA 2KJRA 3OWEB 1WI0A 3A4RA 3KVFB 3AN1A 2KDBA 1I4RA 1GAQB 1FPYA 1UWXA 2O6VB 3WCQA 2WXHA 4C7ZA 2GBMA 2QC8A 3R8BA 4YTPB 1HTQA 1LGRA 5H8YE 2HTHA 4G0NB 1EF1A 1OEYA 1MVKA 1TYGB 2DYOA 4OZCA 3AE5B 1LM8B 2ZW0A 2KMAA 3Q8CA 2ICIA 1GPXA 3DVNV 1TKYA 3I3TB 5AZGA 3D32A 2N1VA 4E71A 2ZCBA 4IWPA 1F77A 4DXFA 4KGTA 5LXHA 1OQQA 3Q6BA 4YSXB 1T0RC 2D3GA 3I5JC 2INPE 2UU7A 2BPSA 4MELA 1JWMD 3KH0A 2LJ5A 1WGGA 4P16A 1BUIC 4ANVA 2INNE 2J42A 1ZPSA 3AEBB 4BKGA 3HIZA 3O13A 4EKUA 2DX5B 3R2TA 4NJ7A 1SIFA 4MGZE 4DQOC 1IBXA 1FIQA 3Q8AA 1L7YA 2C7MB 3V62A 3NG0A 3HRDD 1OEYJ 2WX1A 3VFKA 3AU4A 1M94A 3BINA 3NS1A 2K6DB 3DHHC 2R2QA 3N30A 1FXTB 4NQKE 3P4PB 4K7WA 2VRRB 1UBIA 3VXWA 1D5ZC 5D94A 3AMZA 3O65B 5JZEB 2AQ3B 1MFWA 2C7NB 2PVOD 3AEGB 2WU5B 3AE4B 1V1PA 4DK5A 3ZLZA 2SAKA 3AI5A 3UGBB 3AEDB 4YTMB 2VZKB 2REXA 1V2YA 4DDID 2O6VA 3L17A 1C4CA 1QOAA 2FIDA 4M00A 1OFFA 4JWUC 2JWUA 2MCNB 2N4FA 4II3B 4RCOA 3B2FA 4FA6A 1TJEA 2BYVE 1KJTA 2K8CA 3Q8EA 3DDCB 4B6WA 4ZHPA 2M8SA 3T8MA 4GDLB 1X1MA 4HPPA 4GB9A 2YVCA 3X0WA 1WRIA 1AWDA 5GXGB 2ZVNA 4N58A 2KN4A 1PGXA 4I6LB 1YX5B 2KN5A 1P0RA 2Y5PA 3SEBA 1QT9A 4USAA 1F1HA 3VRBB 1SE3A 2PJHA 5KHOA 1JCKB 2L1AA 3ECIA 3OLMD 3N1YC 4NPNA 4HDQA 4HKZE 1SF0A 1V5OA 2LGYA 2BT6A 1QLBB 3VR9B 3TBLD 4A3PA 4KV2A 3BVGA 3KUCB 1V49A 4WIPA 4HVBA 4GU2A 5KHQA 1SE9A 1PFDA 1UZXB 3TEYA 2GBNA 2B3AA 4YL8A 5C1ZA 4ZRJA 2ZJDA 2R2OA 2MHJA 1WE7A 1SBBB 5C2TB 4KZ0A 2WXLA 4XYCA 2RR9A 1UELA 4NY0A 3B1LX 3RMKC 3NS8A 2BKRB 3URYA 2A4ZA 2I2YA 4N6EB 1V8CA 3N32A 3NJTA 1VR9A 4D2KA 4FHJA 4GDLA 5C3JB 3VDZA 1T0SC 3C19A 4LDTD 2MSED 2KJHB 4OVZA 4HK2A 2LGSA 1UGMA 4WQMA 2KWDA 2CKHB 1TS2A 2NTSA 4LNIA 2ONQA 1IGCA 4ICVA 4BOSC 1F52A 2C7HA 2RSUA 3ZNID 1I4HA 1WSPA 3IVFA 4HEA1 2OHFA 2JRHA 3PSEB 3ZDTA 3SD5A 4RM9A 3U7DA 2CS4A 3QX1A 2WGSA 1WXQA 2I1JA 1FFUA 2I38A 3PS6A 3A9JB 2MJEA 2L52A 3DBLB 3HK0A 3DVNU 2EMSA 1WY8A 3RZFA 2WXIA 1GNUA 2KHWB 2M0XA 1DOYA 3WALA 2BS3B 2EKEC 1D5XC 2W55A 4XZ4A 3FKYA 2INDC 4HWIB 2X8XX 1SJED 2BW2A 3PREA 2LD9A 3C8YA 1V1OA 2KXJA 2LUEA 3R7QA 2PEAA 2W3RA 4GGQA 2PE6B 1D3ZA 2CJOA 3FILB 2IPKD 2QEJC 3V05A 3SDLC 4K3CA 4LCDE 2J52A 4DHZE 5L95C 2E3TA 3PLVA 2Q5WD 4L23A 5MPOA 2BGFA 4PT5A 3MTNB 3DBHI 1KFYB 3QARA 2IZVB 2VH2A 3PV1A 3AE7B 3HM6X 2WP9B 1KRHA 2BF8B 1ROEA 1IUEA 1JALA 4OHJA 5D6JB 5HG2A 4W9HA 3BYYB 3NZSA 4GLSC 3KUZA 4EZKA 3DQVA 2LFIA 5IN7A 3A9JA 3AEEB 3MJ5A 2O6VD 3KQ4A 2LASA 4JE3B 2WDVB 3BWUD 1JRUA 1FXAA 4PK1A 1UWMA 5LNK1 4MDKE 2B76B 3IHPC 2AL6A 4XDCA 2N9EB 1WXSA 4DBGA 2NBVB 2DZJA 1I7HA 2KWVB 4C4VB 3BIID 4PYUA 2IO0B 4A55A 3RPFC 3R66C 4J3OD 4YT0B 1YN4A 1HQRD 4RF0A 3RFZB 3IFWB 3ZXVA 4A9AA 3AH7A 4WJOA 2LHEA 2BKFA 3FILA 2LWPA 4WAFA 3VUYA 2LGIA 1WGYA 4HJKA 1KM7A 1J0GA 4ZYNA 2D11A 1XEEA 2L83A 2C9WB 1TKEA 1NYQA 5BMHA 1WH3A 1F2RI 3M63B 2QHOA 4ANUA 3RD2A 3PT2B 3L16A 5E6JA 3Q3NC 3ZNZB 2PIAA 2KZRA 3DBRB 1YIWA 2FE8A 1AW7A 2J0KA 3MC0B 1WWTA 3TEXA 1UD7A 3FC4A 2KDEB 2Z0DB 4OZAA 3ALBA 3B08A 1FD6A 2G1EA 1S3SG 1D6EC 2N9PC 2DYBA 2IO1B 1VCBA 2ZCCA 2FCQA 2VZKD 3MP9A 1C78A 1J19A 1N6ZA 2LXCA 4GN1A 1WM2A 1HXYD 1WRDB 2KLGA 4L1BA 1I42A 3EGRA 1WF9A 3T3NA 2WDTB 3LJ3A 3OAWA 3MHZA 4HKQA 4IWOA 2DYMA 2DAJA 4WWNA 2KJ6A 4P1CC 2KKCA 3DHIC 1TTNA 4TV3A 4AP4C 4W9IA 3MJWA 2D10A 4MJSB 1WJUA 3U8ZA 3ZO5B 4WJNA 5E6PA 3TCAA 2LMCA 2HJ8A 5BYQA 1P3QU 2X38A 4WWPA 4LJPB 1EWCA 3AECB 2PE9A 5AUKA 1YX6B 3CF6E 4ARCA 3MC9A 3EECA 2V9HA 3I57A 4KGRA 5TSSA 4BKSA 2W3SA 2QMTA 1A5RA 2XEWA 2GLSA 1P7FA 1XLQA 2JU6X 3ZJTA 3EUB2 5AUIA 4OZBA 1FXIA 1MPEA 3AE8B 4IOIE 4IDIA 1IP9A 3QHTA 2UYZB 5CHVC 3PZ8A 1PQSA 4C56C 4EZLA 3UIPB 4M0WB 1E7PB 1C9FA 1JRPA 1VDVA 4URKA 2IGHA 2J0JA 1WR1A 4AUQC 3NY5A 3ZJVA 4DHJB 2WLBA 3H6NA 3PHWB 4WQOB 3V6EB 2LRWA 1LXDA 1T3QA 3GB1A 1R4NI 5H92C 1OTRB 3WANA 1RM6C 1I35A 1HE8A 1V97A 3NUHB 5FK9C 1E10A 2MH7A 2MRPA 4Q2JA 2QSDA 4PS3A 1T0QC 1WJ4A 4XX5A 1TKGA 1I4GA 3ZRCA 2IY0B 1C79A 2KACA 4CQNA 3M95A 1GB4A 2IBIB 1NBFC 3CIRB 2XN9C 1RAXA 2DBYA 3ZDMC 3M62B 2LI5A 4MJSA 3NOBA 3R7RA 4NJ6A 2RD0A 4L2YA 3DPDA 2AEHA 4HXDA 4WH4A 4JWSC 1V81A 1TS4A 3PRZA 1GUAB 1Y56A 4E3CA 1T0YA 3A1QB 1F0ZA 2IY1B 3QA8A 4A20A 1GG3A 4BBNC 3IT6B 4XGAB 4UDUC 2M17A 4ZRKA 1WGDA 2IGGA 2WQYB 1YN5A 2BVCA 3ONSA 3JSVA 3B0AA 3B2GA 1SJHD 3VR8B 3IT4B 3Q3JA 2J7QB 2GBKA 2JZZA 2Y3AA 2YLMA 2BYEA 3AU5A 2W82A 3Q14C 5FKAC 2G3QB 3KLSX 4KSLC 2NBWB 4MGKE 4M0WA 4W9GA 4GXBA 1XLPA 1TT5B 3UIOB 4BKTA 3SFEB 2ZVOA 5CHFA 1BT0A 2WXJA 2WXMA 1N5XA 1KOTA 3TSSA 1OQYA 2FCMA 4LK0M 2LGXA 4KKJA 3QAQA 4TSSA 4JLCA 3VH4B 4W9DA 1HA5A 1I4QA 2XK5B 2N9KA 3UI3A 3BZDB 3W5VB 1FRDA 3V6CB 2MJDA 2KK8A 1R7SA 3VTWA 5EE3A 3VTUA 2MJ3A 3AXCA 3GZNB 4W9EA 1SIJA 3WAOA 1WGRA 4NZLB 1VZ8A 3DHGC 3ENEA 1ZXIA 2EMTA 3SHQA 1EUVB 4DDGD 2KYWA 3NRZA 4G3XB 3L54A 3A1QA 3P1MA 1XCQL 4AOFA 2DZIA 2NPTB 3WAMA 3AE6B 2K22A 1D4BA 1QKZA 2L32A 1F2RC 2WXNA 4RGTA 1JROA 2KANA 3ZNHB 1UF0A 2KFKB 4F8CB 1WGHA 1TS5A 1GJZA 4NAWB 1DOIA 1E7VA 1Q5WB 4A6QA 4BVUC 4K7UA 2N9XA 2M56B 3EFUA 1PUTA 5LXIB 1DYQA 1YD8U 5AEKB 2Z0EB 4KSKC 5DPSA 2ZNVC 4BOZB 3L10B 1ZW7A 4YTNB 1UBQA 2NVUI 2L0TA 4IM3A 1YJ1A 2KQSA 1WIAA 2L76A 1V80A 4MEMA 3VRAB 5EE0A 2RMMA 3AULA 5CTRC 1XT9B 4EZJA 1VLBA 1R4MI 5FR3A 2WDRB 1DGJA 1XF5L 4KDIC 3VH3B 3MC8A 2WYQA 1E8WA 2WXGA 2V4LA 4M8MA 4BKSD 2XK5A 3BK2A 1GB1A 1FCLA 1WYWB 2MBBB 1QOFA 3AE3B 2CHZA 2L00B 2NCNA 3PO0A 2MW5A 3RULA 2JT4B 3KYDD 1FFVA 2IO3B 1L0XB 1L2NA 1ZP0B 1Z2MA 3UQAA 4E74A 1I4PA 1Q10A 2EELA 2LVOA 3DOWA 4ZHOA 3ZVVA 1WE6A 1TBEA 3WIMA 2MEKA 1RRBA 4FLHA 4HROA 2RDGA 3H7SA 1J7CA 3WA0A 3ML8A 1TGZB 4ZYSA 1C76A 2ZPYA 2NPTA 2DENB 2Y5BB 2JX5A 2KMCA 2GB1A 4RM8A 1MI0A 2PPHA 2M19A 4ZRIA 3AM9A 5D7GA 1PYWD 2GBJA 3AEFB 2KFKA 3VUWA 4NAWA 1JW9D 1QILA 3IBEA 2D5GA 4KIKB 3U2SC 2Y5CA 4MT5A 1VJKA 2IDYA 1P7EA 3RN9C 1D5MC 2MBQA 2KO3A 3U30A 3X23A 4W9JA 4A90A 1G6JA 5IP4D 1WJ6A 1TZOA 2FAZA 4C80A 2LGDA 1YQ3B 2KNBA 4KGSA 4GMVA 5HHDG 5I4DA 1ACCA 2WDQB 4K1RB 1M4VA 4BBNF 1L4ZB 4K81A 3Q8BA 4WWOA 4DXAB 3NHEB 4RNAA 2V1YA 1NDDA 3HHMA 2ZZPB 1WXVA 3BYTB 1P98A 3U7ZA 2N1WA 1WZ0A 2AQ1B 4NJCA 3N1XC 5TR5A 2GBRA 4WJQA 2KMMA 2LVQA 4ZDVA 4I6NB 4W9LA 3W1YA 4H2AA 1LO5D 5CHWA 3ZTDA 1WJNA 1FCCC 1OQRA 3C0RB 3NVYA 4HPMB 2BQQA 2WWZA 2KDFB 5BYSA 3R2IA 3ZQ4A 2K0PA 2W54A 3V60A 2MLBA 4IM2A 4IWQA 2AWTA 2EKIA 3UF8A 1E8YA 3KUDB 2I1KA 2V3PA 1YQBA 2WXOA 1YN3A 4GOCA 3P42A 4JGHB 4DHJD 2DHZA 1T6BX 4EOYA 2LHDA 4C7YA 5FR6A 1SE4A 2KDIA
chains in the Genus database with same CATH topology
5BYQA 2X38A 3P4PB 5BMGA 3U52E 1EWCA 1PDXA 3HUIA 3AECB 5AUKA 2QIEB 1CQVA 1D5ZC 1B9RA 1DOXA 4ARCA 3AMZA 1KLUD 2AQ3B 5HFYA 1A70A 2PVOD 4US8A 3AEGB 2WU5B 3AE4B 3I57A 1SSNA 1V1PA 2JYTA 4KGRA 1NENB 2K5PA 2ON8A 1JWAD 5TSSA 1ESFA 1YJJA 2SAKA 2W3SA 4MACA 1BMLC 2QMTA 4DXGA 1ZE3D 1FMAD 3P4QB 2ACZB 2BB6A 3AEDB 1QQRA 4YTMB 2VZKB 1KH0A 1P7FA 1XLQA 3GP7A 2WXFA 2BYTA 1UNSA 1C4CA 2JU6X 3ZJTA 3EUB2 1QOAA 1WGKA 5AUIA 4OZBA 1KLGD 1OFFA 4JWUC 1FXIA 2JWUA 1EWYC 1SE2A 1MPEA 3AE8B 2IGDA 4IOIE 2RDHA 4RCOA 3W9CB 3AV8A 3B2FA 4IDIA 2PTLA 4RGMA 1TJEA 2WS3B 1GOZA 3Q8EA 3PZ8A 4C56C 4ZHPA 2PMVA 4GDLB 4TQ0A 1E7PB 1C9FA 1JRPA 1VDVA 2KDMA 1WRIA 1AWDA 2IGHA 4GDKB 5GXGB 3ZJVA 1RWSA 2WLBA 2WXQA 4N58A 2KN4A 1PGXA 3BVMA 5G5HA 1T3QA 3GB1A 5H92C 1RM6C 1V97A 3NUHB 5FK9C 1E10A 2MH7A 2WXKA 3W2DA 2Y5PA 4Q2JA 2QSDA 3SEBA 1L5PA 1UGJA 1QT9A 5EE1A 1I4GA 1STEA 1TKGA 1ZDVA 2HTME 4USAA 2SEBD 4ITKA 4R3DA 3VRBB 1C79A 5BMIA 1SE3A 2KACA 4CQNA 3T3OA 1GB4A 1ENFA 1ET6A 1MHXA 2XN9C 3CIRB 1JCKB 2DBYA 2L1AA 5G5GA 1YQ4B 2BS4B 1C77A 3NVWA 1XCTL 2XNAC 4ZRPA 4L2YA 2JSVX 1L4DB 1NEKB 4HKZE 1L6UA 4WH4A 1SF0A 4JWSC 4TMAB 3IXSA 2BT6A 4ZOHC 1QLBB 3VR9B 3NVZA 4US9A 1TS4A 3AEAB 3BVGA 3NVVA 2N7JA 4RGNA 1Y56A 4YSZB 4WIPA 1F0ZA 3Q69A 1RYJA 2TSSA 1CK1A 2LEKA 1PFDA 3TEYA 4B0MA 3DWGC 4EE2A 3ABVB 3IT6B 3LXFA 3LYYA 1XXGA 4UDUC 3EA6A 4REZA 3AB5A 2IGGA 2WQYB 1YN5A 4TQ1A 1E0ZA 3B2GA 1SJHD 2WU2B 4RFBA 1JWUD 3VR8B 1SBBB 5C2TB 3IT4B 2WXLA 1K50A 3E9SA 2Y3AA 1L0YB 3URYA 2JZPA 3P4RB 1N60A 1ZUD2 2W82A 2JQRB 5FKAC 2I2YA 1SEBD 1E9MA 1YNTE 4N6EB 2BTEA 1VZ7A 1V8CA 2BBCA 3KLSX 3NZ3A 1VR9A 4D2KA 1C4PA 4M0WA 1KF6B 2NTTA 5C3JB 1XLPA 1EM7A 3TUOA 3SFEB 3FAHA 4OVZA 2WXJA 2WXMA 1WYGA 2DLBA 1N5XA 1N61A 3TSSA 4RH6A 2PVGC 4WQMA 2KWDA 4LK0M 4XE0A 2WXPA 1TS2A 1YMHE 1XLNA 1UUPA 2NTSA 2ONQA 1IGCA 4KKJA 1KTKA 1NVID 4TSSA 1ZOYB 4YWGG 1I4HA 3H8HA 1WSPA 1HA5A 1I4QA 2N9KA 3TEWA 4HEA1 3BZDB 1VRAB 3UI3A 2OHFA 1ET9A 2H89B 1K51A 3W5VB 1FRDA 2MJDA 3Q8FA 3HVDA 1WXQA 1R7SA 3B9JA 1FFUA 1CZPA 1TY0A 2I38A 4NAMA 5EE3A 2N0SB 2MJEA 2MJ3A 1T5XD 3BVZA 2L52A 3U4EG 2K3UA 1E6EB 1SIJA 3IAM1 1L6VA 4HRSA 3N9YC 4NZLB 1VZ8A 2WXIA 1ZXIA 1CJEA 3KWVA 1PGAA 2AQ2B 3DWMA 3NRZA 2GRIA 1DOYA 2BS3B 5T8IA 4WWMA 1YJIA 1D5XC 2E6XA 2W55A 4FXCA 3P1MA 4KKIA 1TS3A 1K52A 2GI9A 4OW0A 3ETRA 1SJED 1JMLA 1BXTA 2BW2A 1XCQL 1FNVA 4KX6B 2KQ4X 3W1SA 3C8YA 1V1OA 2PLPA 3IAS1 1QOBA 3AE6B 2K22A 3P4SB 1D4BA 1QKZA 2L32A 4XDDA 1F2RC 1ZDXA 2WXNA 2W3RA 4RGTA 1JROA 2V3NA 1JWBD 5BYRA 1HZ5A 2CJOA 5JXVA 1JQ4A 1N63A 3FILB 1TS5A 3W5UB 3I9V1 1C4AA 2LUMA 2IPKD 1DOIA 2QEJC 4NAWB 3V05A 2J52A 4A6QA 2OEDA 2M56B 1PUTA 2E3TA 2Q5WD 1DYQA 4L23A 5D3IB 5MPOA 4AS1A 1NI3A 4PT5A 1FEHA 2PKOA 4LTUA 1KFYB 3HVZA 4YTNB 2IJ0A 2PW9A 3VRAB 3AE7B 2WP9B 5EE0A 2RMMA 1KRHA 1IGDA 3SFDB 1VLBA 1ROEA 2BB5A 5FR3A 1IUEA 1JALA 4OHJA 2QILA 1RFKA 3SR6A 2WDRB 5HG2A 1B1ZA 1J7AA 2QJLA 1DGJA 1XF5L 3TEZA 1VZ6A 4A8XC 3BYYB 2FUG1 4GLSC 4N59A 3PZ7A 3ZJUA 2WXGA 4ARIA 2J53A 3BK2A 4XWWA 1GB1A 1FCLA 2AX5A 2FBWB 2NMQA 3P63A 1QOGA 2K9XA 1EU3A 2CJNA 1N5WA 3J9CA 2LFIA 2BS2B 2JYEA 1HZ6A 3AEEB 3MJ5A 1QOFA 2LJIA 3AE3B 3KQ4A 3GS2A 4JE3B 1FNWA 2WDVB 1L0VB 3PO0A 3BWUD 3AE1B 1FXAA 4ZRQA 2WNMA 4JX1C 1UWMA 4HJGE 1FFVA 5LNK1 1L0XB 2CU3A 1ZP0B 1FO4A 2B76B 2WXRA 2H88B 2KAJA 1FNUA 4YXDB 3VQIA 1I4PA 4XDCA 1Q10A 2EELA 4ZHOA 2JXTA 1IBXB 5D3DA 1EU4A 5EE9A 4IKGA 3L4PA 3AE9B 2MEKA 1I7HA 3MFGA 4MH8A 4HROA 1PGBA 2RDGA 5HI1A 4YSYB 1J7CA 4ZYSA 2Z8LA 1C76A 3BIID 1K53A 4A55A 3ZGZA 3LB8C 3RPFC 3KWLA 1J7BA 1N62A 4J3OD 1FM0D 2JX5A 4YT0B 1AN8A 2GB1A 4B0EA 1NYRA 3BK1A 1YN4A 1HQRD 2RPVA 1MI0A 4RF0A 4O1NA 3RFZB 2M19A 1ZXHA 2J4XA 3AM9A 5D7GA 1PYWD 4A9AA 2R61A 3AH7A 1XLOA 3AEFB 2LHEA 3FILA 4WAFA 2LGIA 1JW9D 1QILA 4XWTA 4JPSA 1V1PB 2G9HD 2D5GA 4P6VF 4RF1A 3U2SC 1QF6A 2DWQA 2Y5CA 3CWIA 4MT5A 1VJKA 3OWEB 2IDYA 1P7EA 1D5MC 1XEEA 2L83A 2M0AA 3AN1A 1TKEA 4A90A 1NYQA 5BMHA 1TZOA 3ZYYX 4C80A 1F2RI 1I4XA 1I4RA 1GAQB 1UWXA 1YQ3B 4WURA 3WCQA 2V4IB 2WXHA 4KGSA 4MM3B 4C7ZA 5HHDG 5E6JA 3R8BA 2ZW1A 5I4DA 4YTPB 1ACCA 1SB3C 2WDQB 4RGOS 5H8YE 2PIAA 1MVKA 1TYGB 1M4VA 1SXTA 1L4ZB 3Q8BA 2FE8A 1AW7A 3MC0B 1WWTA 2DYOA 2YEPB 4OZCA 3AE5B 1FRRA 3E56A 3FC4A 3TEXA 1AYFA 4RNAA 2ZW0A 4OZAA 3Q8CA 2ICIA 1FD6A 2G1EA 1GPXA 3V3XA 1D6EC 3BYTB 3U7ZA 1JWSD 3AE2B 1TKYA 1HEZE 2AQ1B 4NJCA 2VZKD 3MP9A 1F77A 1C78A 4DXFA 1MHHE 4KGTA 1HXYD 1OQQA 2KMMA 4YSXB 2INPE 1JWMD 4H2AA 1LO5D 1FCCC 1OQRA 3NVYA 4L1BA 1BUIC 4P16A 2INNE 2J42A 1ZPSA 3AEBB 3EGRA 3T3NA 5BYSA 4AQ7A 3R2IA 3MHZA 3ZQ4A 3O13A 2K0PA 2W54A 4HKQA 3R2TA 2YEPF 1XO3A 2DYMA 4DQOC 1IBXA 1FIQA 4LLGM 2EKIA 3Q8AA 2N9LA 1TY2A 3HRDD 2V3PA 2HDEA 3NS1A 2WXOA 1YN3A 3P42A 1T6BX 2LHDA 4C7YA 1SE4A 2V0GA 2LMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BII D;  1QLB B;  3P1M A;  4FXC A;  3LB8 C;  3RPF C;  3VR9 B;  3KWL A;  1J7B A;  3NVZ A;  1N62 A;  3ETR A;  4US9 A;  1FM0 D;  2JX5 A;  3AEA B;  4YT0 B;  3NVV A;  3P4P B;  4KX6 B;  1NYR A;  4YSZ B;  1F0Z A;  1PDX A;  3HUI A;  3AEC B;  5AUK A;  1RYJ A;  2QIE B;  1QOB A;  2M19 A;  1B9R A;  1DOX A;  2LEK A;  3AMZ A;  3AE6 B;  2K22 A;  3AM9 A;  1A70 A;  3P4S B;  1PFD A;  4A9A A;  2PVO D;  3AH7 A;  3AEG B;  1XLO A;  3ABV B;  2WU5 B;  3AE4 B;  3AEF B;  3DWG C;  4US8 A;  3LXF A;  1NEN B;  2K5P A;  2W3R A;  1JWA D;  1JRO A;  1YJJ A;  1JWB D;  2W3S A;  3AB5 A;  2WQY B;  1FMA D;  2CJO A;  3P4Q B;  1JQ4 A;  1JW9 D;  2ACZ B;  1N63 A;  3AED B;  1E0Z A;  3B2G A;  3W5U B;  4YTM B;  2WU2 B;  4P6V F;  1DOI A;  3VR8 B;  5C2T B;  1XLQ A;  1QF6 A;  2DWQ A;  2Y5C A;  3CWI A;  1VJK A;  2L83 A;  2M56 B;  1PUT A;  1QOA A;  3EUB 2;  3AN1 A;  1WGK A;  2E3T A;  5AUI A;  1TKE A;  1NYQ A;  2Q5W D;  3P4R B;  5MPO A;  1NI3 A;  1OFF A;  1N60 A;  1ZUD 2;  4JWU C;  1FXI A;  3ZYY X;  1EWY C;  2JQR B;  4C80 A;  1GAQ B;  1YQ3 B;  3AE8 B;  3WCQ A;  4C7Z A;  2PKO A;  1E9M A;  4N6E B;  4LTU A;  3W9C B;  1KFY B;  1V8C A;  3AV8 A;  3HVZ A;  4YTP B;  3B2F A;  4IDI A;  1SB3 C;  2WDQ B;  5H8Y E;  1TJE A;  2WS3 B;  4YTN B;  1KF6 B;  2PIA A;  1TYG B;  5C3J B;  1XLP A;  3VRA B;  3AE7 B;  2WP9 B;  4ZOH C;  5EE0 A;  1WWT A;  3AE5 B;  1FRR A;  1KRH A;  3FC4 A;  3SFE B;  4ZHP A;  3FAH A;  1AYF A;  3SFD B;  1VLB A;  1E7P B;  1ROE A;  1WYG A;  1IUE A;  1JAL A;  1JRP A;  1N61 A;  1N5X A;  1VDV A;  2G1E A;  1GPX A;  1RFK A;  3AE2 B;  1TKY A;  2PVG C;  2WDR B;  3SR6 A;  1J7A A;  1WRI A;  1DGJ A;  1AWD A;  2QJL A;  4WQM A;  5GXG B;  1RWS A;  1XLN A;  2WLB A;  4N59 A;  4N58 A;  5G5H A;  1NVI D;  1OQQ A;  1T3Q A;  1ZOY B;  2AX5 A;  2FBW B;  5H92 C;  2KMM A;  3P63 A;  4YSX B;  1QOG A;  1RM6 C;  2K9X A;  1V97 A;  2CJN A;  1E10 A;  1N5W A;  2MH7 A;  1OQR A;  2BS2 B;  3NVY A;  2OHF A;  3AEE B;  1QOF A;  2H89 B;  3W5V B;  3AEB B;  1FRD A;  3AE3 B;  2MJD A;  1L5P A;  1QT9 A;  1L0V B;  1R7S A;  1TKG A;  1WXQ A;  1FFU A;  1CZP A;  2HTM E;  2WDV B;  3B9J A;  3PO0 A;  4USA A;  3AE1 B;  4ITK A;  1FXA A;  2N0S B;  5EE3 A;  2MJE A;  3VRB B;  2MJ3 A;  2L52 A;  2W54 A;  4JX1 C;  1UWM A;  1FFV A;  1XO3 A;  5EE1 A;  2CU3 A;  1ZP0 B;  1E6E B;  1SIJ A;  1FIQ A;  2B76 B;  2H88 B;  2DBY A;  2KAJ A;  3CIR B;  1FO4 A;  4YXD B;  2EKI A;  5G5G A;  1L6V A;  1YQ4 B;  4HRS A;  2BS4 B;  3NVW A;  4ZHO A;  1ZXI A;  3HRD D;  1CJE A;  5EE9 A;  3NS1 A;  3L4P A;  3AE9 B;  1I7H A;  1NEK B;  1DOY A;  3DWM A;  3NRZ A;  4HRO A;  2BS3 B;  4YSY B;  1L6U A;  4C7Y A;  4WWM A;  1J7C A;  1YJI A;  1SF0 A;  4JWS C;  2W55 A;  2BT6 A; 
#chains in the Genus database with same CATH topology
 3JYU A;  4IW0 A;  2KFJ A;  5IKC M;  4ANW A;  4JL9 A;  4JQW C;  5BMG A;  3U52 E;  3EFC A;  3HUI A;  4QAY A;  2QIE B;  1DOX A;  1KLU D;  5HFY A;  2DNF A;  4US8 A;  2JYT A;  1NEN B;  2ON8 A;  3UIN B;  2W9N A;  1YJJ A;  4MAC A;  1BML C;  3P4Q B;  2ACZ B;  1KH0 A;  3NZU A;  3ZXR A;  3GP7 A;  2WXF A;  2BYT A;  3SU8 X;  1UNS A;  4BZA A;  3DVG Y;  4OVU A;  3RNB C;  1KLG D;  2A5U A;  2D3A A;  1EWY C;  1ISN A;  2IGD A;  2RDH A;  3W9C B;  3AV8 A;  4MGY E;  2PTL A;  2CU1 A;  4RGM A;  3R3M A;  2WS3 B;  4PYZ A;  1QZE A;  5JHB A;  4TQ0 A;  5DPT A;  1XQQ A;  4GDK B;  1WFY A;  4J6I A;  3PPA A;  2K39 A;  2MWS B;  4C00 A;  3BVM A;  3OJ4 B;  5G5H A;  4FJZ A;  3ZKJ C;  4DHZ B;  5G2N A;  1CMX B;  2WXK A;  3W2D A;  1XD3 B;  3Q2A C;  5E6N A;  1L5P A;  1UGJ A;  3H7P B;  5EE1 A;  1STE A;  2SEB D;  4ITK A;  1Y8R C;  3RT3 B;  5J2R A;  1ENF A;  2K8H A;  2L3Z A;  1E7U A;  4ICU A;  5G5G A;  3NVW A;  3TIX A;  1E8Z A;  1XCT L;  2XNA C;  2BWE S;  1L4D B;  3QK0 A;  3QJZ A;  1L6U A;  3DCG A;  4TMA B;  4ZOH C;  2DZM A;  3NVZ A;  2JRI B;  4US9 A;  3AEA B;  3VVW B;  2N7J A;  3TMP B;  4RGN A;  4YSZ B;  1WR6 E;  3DBS A;  1RYJ A;  4B0M A;  3ABV B;  2KOX A;  3H1U A;  4C4V A;  3UQB A;  4REZ A;  3I63 C;  1C1Y B;  1E0Z A;  4RFB A;  4FUL A;  1Z5S B;  1L0Y B;  3JW0 X;  1N60 A;  1ZUD 2;  2KD0 A;  4G11 A;  2JQR B;  3APC A;  1E9M A;  1YNT E;  2BTE A;  2BBC A;  2MQJ A;  3DBR I;  3IG3 A;  2KLC A;  1R4N B;  1KF6 B;  2NTT A;  1EM7 A;  3TUO A;  2L05 A;  4GDK A;  2V3S A;  4M01 A;  1WYG A;  2DLB A;  1C3T A;  4RH6 A;  4FAD A;  3H9D A;  2WXP A;  1UUP A;  2IYD B;  1KTK A;  1NVI D;  1ZOY B;  4YWG G;  1P9D U;  2Z59 B;  3H7P A;  3T9L A;  1ET9 A;  2HE7 A;  4KDL B;  2DZK A;  3Q8F A;  3HVD A;  3PLU A;  2M4N A;  1U4A A;  1Q1O A;  3B9J A;  3RNA C;  1CZP A;  1TY0 A;  4NAM A;  2N0S B;  3BVZ A;  3K9P B;  5CX3 A;  2K3U A;  4DWF A;  1H4R A;  3Q3M C;  4TKN A;  1E6E B;  4HRS A;  3N9Y C;  3Q3F A;  3PRM B;  1H8C A;  3KWV A;  2GRI A;  4KZC A;  5T8I A;  2D3C A;  1V5T A;  4WWM A;  1WXM A;  3TL5 A;  1YJI A;  1WXA A;  2JUO A;  4KKI A;  1TS3 A;  2GI9 A;  1JML A;  4LJO B;  4KX6 B;  3HM3 A;  2KQ4 X;  1QOB A;  2G45 B;  1IYF A;  2J0M A;  2V3N A;  1JWB D;  4B95 A;  1HZ5 A;  1JQ4 A;  1WX7 A;  1N63 A;  3W5U B;  4FN2 A;  2L8J A;  2LUM A;  2OED A;  1P1A A;  5D3I B;  4AJW A;  2PKO A;  2KC1 A;  4ASW C;  3HVZ A;  4IG7 B;  3RI7 C;  2FNJ B;  5IOI A;  1OGW A;  4IUM B;  4ANX A;  2MX2 A;  5GMV A;  2BB5 A;  3P2B A;  2QIL A;  1RFK A;  3SR6 A;  5J18 A;  3JVZ X;  1RFA A;  1WM3 A;  2MBE A;  3GE3 C;  4A8X C;  4WJP A;  2CHX A;  3ZJU A;  5JHA A;  3QC8 B;  4ARI A;  2J53 A;  2UWQ A;  2NMQ A;  3P63 A;  1QOG A;  2K9X A;  1EU3 A;  2K25 A;  5DCN A;  2FCN A;  1HZ6 A;  1J8C A;  3GS2 A;  1FNW A;  5C23 A;  1L0V B;  3PGE A;  3AE1 B;  5DPR A;  4ZRQ A;  2WNM A;  4JX1 C;  2G4D B;  4HJG E;  2CU3 A;  2WXR A;  1FNU A;  3VQI A;  2KVR A;  3ZUN A;  1EU4 A;  1WX8 A;  2C5L C;  4IKG A;  4AJY B;  3AE9 B;  4OVV A;  4MH8 A;  5HI1 A;  1PGB A;  4YSY B;  2JXX A;  3QWZ B;  4MH0 E;  2Z8L A;  3ZGZ A;  1J7B A;  1FM0 D;  1AN8 A;  4B0E A;  1NYR A;  2RPV A;  5HKH A;  2LZ6 A;  3ZW3 A;  2JF5 A;  1ZXH A;  3ZIM A;  2J4X A;  2R61 A;  3W1S C;  2WX0 A;  1YOV B;  5JH5 C;  4PS7 A;  2K6Q A;  2DWQ A;  3CWI A;  1AAR A;  4K7S A;  4M8N A;  2M0A A;  1R4M B;  4EEW A;  4HLE A;  2VH1 A;  3ZYY X;  2CR5 A;  1I4X A;  4WUR A;  2V4I B;  4MM3 B;  2ZW1 A;  2RDB C;  1SB3 C;  2K1F A;  4RGO S;  1SGH A;  2JWZ A;  1RLF A;  3ZNG C;  1SXT A;  2NR2 A;  2YEP B;  2IO2 B;  1FRR A;  3E56 A;  1AYF A;  3V3X A;  4RMA A;  4HDO A;  1JWS D;  3AE2 B;  3CSF A;  1HEZ E;  4LNO A;  1NI2 A;  1MHH E;  1VD2 A;  2FUH B;  4HCP B;  4BAX A;  3RNG C;  4NNJ B;  3VAW A;  4AWJ A;  3N1Z C;  3N3K B;  4I6P A;  2KTR B;  4IM0 A;  3RNC C;  3GZN I;  3PHX B;  2D3B A;  1LQB A;  4AQ7 A;  1TZ1 A;  2YEP F;  2BWF A;  1XO3 A;  3L0W B;  3PRP B;  4LLG M;  2C60 A;  2N9L A;  1TY2 A;  2HDE A;  2D07 B;  2JPH A;  2NBU A;  1F9J A;  4LNF A;  2V0G A;  3CMM B;  4S17 A;  3DVG X;  2LRU A;  4WAA A;  5IAA C;  1PDX A;  1B9R A;  1CQV A;  3APD A;  3TJP A;  3ZTC A;  1A70 A;  4FJV B;  3L13 A;  2LXA A;  1SSN A;  2GOW A;  2K5P A;  1JWA D;  1ESF A;  2HJ1 A;  4DXG A;  3EC8 A;  1ZE3 D;  1FMA D;  3RZW C;  5J17 A;  2BB6 A;  1QQR A;  2LVP A;  3GE8 C;  2MBO A;  4MM3 A;  1WGK A;  1MG8 A;  1E5W A;  1SE2 A;  4GSW A;  4GIV A;  2KTF A;  3DBH B;  1GOZ A;  5L83 A;  2PMV A;  3N20 C;  2AL3 A;  3PVL A;  2KDM A;  1RWS A;  2WXQ A;  3VUX A;  3ML9 A;  1V86 A;  5D2M B;  2RGF A;  2KTR A;  2QCZ A;  4NQL B;  5EDS A;  1ZDV A;  2HTM E;  1V9J A;  4R3D A;  5BMI A;  3T3O A;  2KC2 A;  4F1S A;  1ET6 A;  2FCS A;  1MHX A;  1E8X A;  1YQ4 B;  4LNK A;  2BS4 B;  1C77 A;  4N9F 4;  4ZRP A;  4HCN B;  2JSV X;  1NEK B;  4MSM B;  3MHS D;  3IXS A;  4PS8 A;  5E6O A;  2XBB C;  2G4S A;  5AZF A;  3NVV A;  3DBL I;  4FHK A;  4S0R A;  2BYF A;  3Q69 A;  2TSS A;  1CK1 A;  2LEK A;  1MJD A;  3DWG C;  4CYE A;  4EE2 A;  3LXF A;  3LYY A;  2DAF A;  1XXG A;  3EA6 A;  3AB5 A;  4TQ1 A;  3EHV A;  4TUU A;  2WU2 B;  1JWU D;  3APF A;  4BFR A;  2MP2 B;  1K50 A;  1EO6 A;  3E9S A;  2ASQ A;  2JZP A;  3A4S C;  3P4R B;  3VTV A;  3S2A A;  2JZ3 B;  2N7E A;  2WHI A;  1SEB D;  3NZ3 A;  1VZ7 A;  1E90 A;  4KIK A;  1C4P A;  3QIJ A;  3FAH A;  1N61 A;  2KWC A;  4F7Z A;  2INC C;  2PVG C;  2ZPN A;  4A3O A;  1EF5 A;  2GMI C;  2OOB B;  4XE0 A;  3OJ3 A;  1YMH E;  2JY6 A;  1XLN A;  1WMH B;  4CHK A;  3KYC D;  3H8H A;  3Q3O C;  2ZNV B;  2N7D A;  4MGI E;  3A33 B;  3TEW A;  1VRA B;  2H89 B;  3WAP A;  1K51 A;  4HPL B;  2JVC A;  4W9K A;  2OJR A;  2KT7 A;  4X57 B;  1S1Q B;  4ACF A;  1T5X D;  1WX9 A;  4JIO U;  3KW5 B;  4IC7 B;  3U4E G;  3OG5 A;  2KQ7 A;  5BO4 B;  3IAM 1;  2O2V B;  2M1M A;  1ZKH A;  3L08 A;  1L6V A;  2K8B A;  1LFD A;  1CJE A;  3PTF C;  2AYO B;  4W9C A;  1MG4 A;  1PGA A;  2AQ2 B;  3DWM A;  3BY4 B;  2E6X A;  4FXC A;  1WZ3 A;  4CO7 A;  3M3J A;  1K52 A;  4OW0 A;  3ETR A;  1BXT A;  1FNV A;  4G50 A;  4XC2 A;  2KX0 A;  3RNE C;  3W1S A;  2HD5 B;  2PLP A;  3IAS 1;  4LDT B;  3P4S B;  2KWU B;  4XDD A;  3QQ8 B;  1ZDX A;  1TIF A;  2KX3 A;  5AZH A;  1K8R B;  2CHW A;  4MSQ B;  5BYR A;  2MP2 A;  1UH6 A;  5JXV A;  2ZEQ A;  3I9V 1;  1C4A A;  3PZD A;  5IO9 A;  3A9K B;  4EUT A;  3VHT C;  2L7R A;  4AS1 A;  1NI3 A;  1FEH A;  1Q0W B;  4LTU A;  3K9O B;  2FIF A;  5IA7 A;  5DPW A;  2IJ0 A;  2PW9 A;  5LLI A;  2QDF A;  1IGD A;  3SFD B;  5G55 A;  1WMH A;  3RUI B;  4FBJ B;  1B1Z A;  1J7A A;  2QJL A;  3TEZ A;  1VZ6 A;  2L0F A;  2FUG 1;  4N59 A;  3PZ7 A;  4XWW A;  2AX5 A;  2FBW B;  3LDZ E;  2CJN A;  1N5W A;  3J9C A;  2BS2 B;  2JYE A;  3GOE A;  2LJI A;  1ZGU B;  2NS5 A;  1GC6 A;  2O2V A;  3RCZ A;  2MA9 B;  1FO4 A;  3V61 A;  2H88 B;  2KAJ A;  3CST A;  4YXD B;  3RNF C;  2RPQ A;  2JXT A;  1IBX B;  4II2 B;  5D3D A;  1HTO A;  4EFO A;  5EE9 A;  3L4P A;  1V6E A;  4W9F A;  3MFG A;  1KLV A;  1K53 A;  4B9K A;  3LB8 C;  2D2Q A;  3KWL A;  1N62 A;  3JSV B;  4P7I A;  3BK1 A;  1GC7 A;  2OJW A;  1IPG A;  4P1B C;  2KVZ A;  4O1N A;  3ZRF A;  3QCA A;  2MBH A;  4M02 A;  1XLO A;  4KVG B;  3A9K A;  4XWT A;  4JPS A;  1V1P B;  2G9H D;  4P6V F;  4RF1 A;  4FJY A;  4K3B A;  1QF6 A;  3RYT A;  4LNN A;  2KJR A;  3OWE B;  1WI0 A;  3A4R A;  3KVF B;  3AN1 A;  2KDB A;  1I4R A;  1GAQ B;  1FPY A;  1UWX A;  2O6V B;  3WCQ A;  2WXH A;  4C7Z A;  2GBM A;  2QC8 A;  3R8B A;  4YTP B;  1HTQ A;  1LGR A;  5H8Y E;  2HTH A;  4G0N B;  1EF1 A;  1OEY A;  1MVK A;  1TYG B;  2DYO A;  4OZC A;  3AE5 B;  1LM8 B;  2ZW0 A;  2KMA A;  3Q8C A;  2ICI A;  1GPX A;  3DVN V;  1TKY A;  3I3T B;  5AZG A;  3D32 A;  2N1V A;  4E71 A;  2ZCB A;  4IWP A;  1F77 A;  4DXF A;  4KGT A;  5LXH A;  1OQQ A;  3Q6B A;  4YSX B;  1T0R C;  2D3G A;  3I5J C;  2INP E;  2UU7 A;  2BPS A;  4MEL A;  1JWM D;  3KH0 A;  2LJ5 A;  1WGG A;  4P16 A;  1BUI C;  4ANV A;  2INN E;  2J42 A;  1ZPS A;  3AEB B;  4BKG A;  3HIZ A;  3O13 A;  4EKU A;  2DX5 B;  3R2T A;  4NJ7 A;  1SIF A;  4MGZ E;  4DQO C;  1IBX A;  1FIQ A;  3Q8A A;  1L7Y A;  2C7M B;  3V62 A;  3NG0 A;  3HRD D;  1OEY J;  2WX1 A;  3VFK A;  3AU4 A;  1M94 A;  3BIN A;  3NS1 A;  2K6D B;  3DHH C;  2R2Q A;  3N30 A;  1FXT B;  4NQK E;  3P4P B;  4K7W A;  2VRR B;  1UBI A;  3VXW A;  1D5Z C;  5D94 A;  3AMZ A;  3O65 B;  5JZE B;  2AQ3 B;  1MFW A;  2C7N B;  2PVO D;  3AEG B;  2WU5 B;  3AE4 B;  1V1P A;  4DK5 A;  3ZLZ A;  2SAK A;  3AI5 A;  3UGB B;  3AED B;  4YTM B;  2VZK B;  2REX A;  1V2Y A;  4DDI D;  2O6V A;  3L17 A;  1C4C A;  1QOA A;  2FID A;  4M00 A;  1OFF A;  4JWU C;  2JWU A;  2MCN B;  2N4F A;  4II3 B;  4RCO A;  3B2F A;  4FA6 A;  1TJE A;  2BYV E;  1KJT A;  2K8C A;  3Q8E A;  3DDC B;  4B6W A;  4ZHP A;  2M8S A;  3T8M A;  4GDL B;  1X1M A;  4HPP A;  4GB9 A;  2YVC A;  3X0W A;  1WRI A;  1AWD A;  5GXG B;  2ZVN A;  4N58 A;  2KN4 A;  1PGX A;  4I6L B;  1YX5 B;  2KN5 A;  1P0R A;  2Y5P A;  3SEB A;  1QT9 A;  4USA A;  1F1H A;  3VRB B;  1SE3 A;  2PJH A;  5KHO A;  1JCK B;  2L1A A;  3ECI A;  3OLM D;  3N1Y C;  4NPN A;  4HDQ A;  4HKZ E;  1SF0 A;  1V5O A;  2LGY A;  2BT6 A;  1QLB B;  3VR9 B;  3TBL D;  4A3P A;  4KV2 A;  3BVG A;  3KUC B;  1V49 A;  4WIP A;  4HVB A;  4GU2 A;  5KHQ A;  1SE9 A;  1PFD A;  1UZX B;  3TEY A;  2GBN A;  2B3A A;  4YL8 A;  5C1Z A;  4ZRJ A;  2ZJD A;  2R2O A;  2MHJ A;  1WE7 A;  1SBB B;  5C2T B;  4KZ0 A;  2WXL A;  4XYC A;  2RR9 A;  1UEL A;  4NY0 A;  3B1L X;  3RMK C;  3NS8 A;  2BKR B;  3URY A;  2A4Z A;  2I2Y A;  4N6E B;  1V8C A;  3N32 A;  3NJT A;  1VR9 A;  4D2K A;  4FHJ A;  4GDL A;  5C3J B;  3VDZ A;  1T0S C;  3C19 A;  4LDT D;  2MSE D;  2KJH B;  4OVZ A;  4HK2 A;  2LGS A;  1UGM A;  4WQM A;  2KWD A;  2CKH B;  1TS2 A;  2NTS A;  4LNI A;  2ONQ A;  1IGC A;  4ICV A;  4BOS C;  1F52 A;  2C7H A;  2RSU A;  3ZNI D;  1I4H A;  1WSP A;  3IVF A;  4HEA 1;  2OHF A;  2JRH A;  3PSE B;  3ZDT A;  3SD5 A;  4RM9 A;  3U7D A;  2CS4 A;  3QX1 A;  2WGS A;  1WXQ A;  2I1J A;  1FFU A;  2I38 A;  3PS6 A;  3A9J B;  2MJE A;  2L52 A;  3DBL B;  3HK0 A;  3DVN U;  2EMS A;  1WY8 A;  3RZF A;  2WXI A;  1GNU A;  2KHW B;  2M0X A;  1DOY A;  3WAL A;  2BS3 B;  2EKE C;  1D5X C;  2W55 A;  4XZ4 A;  3FKY A;  2IND C;  4HWI B;  2X8X X;  1SJE D;  2BW2 A;  3PRE A;  2LD9 A;  3C8Y A;  1V1O A;  2KXJ A;  2LUE A;  3R7Q A;  2PEA A;  2W3R A;  4GGQ A;  2PE6 B;  1D3Z A;  2CJO A;  3FIL B;  2IPK D;  2QEJ C;  3V05 A;  3SDL C;  4K3C A;  4LCD E;  2J52 A;  4DHZ E;  5L95 C;  2E3T A;  3PLV A;  2Q5W D;  4L23 A;  5MPO A;  2BGF A;  4PT5 A;  3MTN B;  3DBH I;  1KFY B;  3QAR A;  2IZV B;  2VH2 A;  3PV1 A;  3AE7 B;  3HM6 X;  2WP9 B;  1KRH A;  2BF8 B;  1ROE A;  1IUE A;  1JAL A;  4OHJ A;  5D6J B;  5HG2 A;  4W9H A;  3BYY B;  3NZS A;  4GLS C;  3KUZ A;  4EZK A;  3DQV A;  2LFI A;  5IN7 A;  3A9J A;  3AEE B;  3MJ5 A;  2O6V D;  3KQ4 A;  2LAS A;  4JE3 B;  2WDV B;  3BWU D;  1JRU A;  1FXA A;  4PK1 A;  1UWM A;  5LNK 1;  4MDK E;  2B76 B;  3IHP C;  2AL6 A;  4XDC A;  2N9E B;  1WXS A;  4DBG A;  2NBV B;  2DZJ A;  1I7H A;  2KWV B;  4C4V B;  3BII D;  4PYU A;  2IO0 B;  4A55 A;  3RPF C;  3R66 C;  4J3O D;  4YT0 B;  1YN4 A;  1HQR D;  4RF0 A;  3RFZ B;  3IFW B;  3ZXV A;  4A9A A;  3AH7 A;  4WJO A;  2LHE A;  2BKF A;  3FIL A;  2LWP A;  4WAF A;  3VUY A;  2LGI A;  1WGY A;  4HJK A;  1KM7 A;  1J0G A;  4ZYN A;  2D11 A;  1XEE A;  2L83 A;  2C9W B;  1TKE A;  1NYQ A;  5BMH A;  1WH3 A;  1F2R I;  3M63 B;  2QHO A;  4ANU A;  3RD2 A;  3PT2 B;  3L16 A;  5E6J A;  3Q3N C;  3ZNZ B;  2PIA A;  2KZR A;  3DBR B;  1YIW A;  2FE8 A;  1AW7 A;  2J0K A;  3MC0 B;  1WWT A;  3TEX A;  1UD7 A;  3FC4 A;  2KDE B;  2Z0D B;  4OZA A;  3ALB A;  3B08 A;  1FD6 A;  2G1E A;  1S3S G;  1D6E C;  2N9P C;  2DYB A;  2IO1 B;  1VCB A;  2ZCC A;  2FCQ A;  2VZK D;  3MP9 A;  1C78 A;  1J19 A;  1N6Z A;  2LXC A;  4GN1 A;  1WM2 A;  1HXY D;  1WRD B;  2KLG A;  4L1B A;  1I42 A;  3EGR A;  1WF9 A;  3T3N A;  2WDT B;  3LJ3 A;  3OAW A;  3MHZ A;  4HKQ A;  4IWO A;  2DYM A;  2DAJ A;  4WWN A;  2KJ6 A;  4P1C C;  2KKC A;  3DHI C;  1TTN A;  4TV3 A;  4AP4 C;  4W9I A;  3MJW A;  2D10 A;  4MJS B;  1WJU A;  3U8Z A;  3ZO5 B;  4WJN A;  5E6P A;  3TCA A;  2LMC A;  2HJ8 A;  5BYQ A;  1P3Q U;  2X38 A;  4WWP A;  4LJP B;  1EWC A;  3AEC B;  2PE9 A;  5AUK A;  1YX6 B;  3CF6 E;  4ARC A;  3MC9 A;  3EEC A;  2V9H A;  3I57 A;  4KGR A;  5TSS A;  4BKS A;  2W3S A;  2QMT A;  1A5R A;  2XEW A;  2GLS A;  1P7F A;  1XLQ A;  2JU6 X;  3ZJT A;  3EUB 2;  5AUI A;  4OZB A;  1FXI A;  1MPE A;  3AE8 B;  4IOI E;  4IDI A;  1IP9 A;  3QHT A;  2UYZ B;  5CHV C;  3PZ8 A;  1PQS A;  4C56 C;  4EZL A;  3UIP B;  4M0W B;  1E7P B;  1C9F A;  1JRP A;  1VDV A;  4URK A;  2IGH A;  2J0J A;  1WR1 A;  4AUQ C;  3NY5 A;  3ZJV A;  4DHJ B;  2WLB A;  3H6N A;  3PHW B;  4WQO B;  3V6E B;  2LRW A;  1LXD A;  1T3Q A;  3GB1 A;  1R4N I;  5H92 C;  1OTR B;  3WAN A;  1RM6 C;  1I35 A;  1HE8 A;  1V97 A;  3NUH B;  5FK9 C;  1E10 A;  2MH7 A;  2MRP A;  4Q2J A;  2QSD A;  4PS3 A;  1T0Q C;  1WJ4 A;  4XX5 A;  1TKG A;  1I4G A;  3ZRC A;  2IY0 B;  1C79 A;  2KAC A;  4CQN A;  3M95 A;  1GB4 A;  2IBI B;  1NBF C;  3CIR B;  2XN9 C;  1RAX A;  2DBY A;  3ZDM C;  3M62 B;  2LI5 A;  4MJS A;  3NOB A;  3R7R A;  4NJ6 A;  2RD0 A;  4L2Y A;  3DPD A;  2AEH A;  4HXD A;  4WH4 A;  4JWS C;  1V81 A;  1TS4 A;  3PRZ A;  1GUA B;  1Y56 A;  4E3C A;  1T0Y A;  3A1Q B;  1F0Z A;  2IY1 B;  3QA8 A;  4A20 A;  1GG3 A;  4BBN C;  3IT6 B;  4XGA B;  4UDU C;  2M17 A;  4ZRK A;  1WGD A;  2IGG A;  2WQY B;  1YN5 A;  2BVC A;  3ONS A;  3JSV A;  3B0A A;  3B2G A;  1SJH D;  3VR8 B;  3IT4 B;  3Q3J A;  2J7Q B;  2GBK A;  2JZZ A;  2Y3A A;  2YLM A;  2BYE A;  3AU5 A;  2W82 A;  3Q14 C;  5FKA C;  2G3Q B;  3KLS X;  4KSL C;  2NBW B;  4MGK E;  4M0W A;  4W9G A;  4GXB A;  1XLP A;  1TT5 B;  3UIO B;  4BKT A;  3SFE B;  2ZVO A;  5CHF A;  1BT0 A;  2WXJ A;  2WXM A;  1N5X A;  1KOT A;  3TSS A;  1OQY A;  2FCM A;  4LK0 M;  2LGX A;  4KKJ A;  3QAQ A;  4TSS A;  4JLC A;  3VH4 B;  4W9D A;  1HA5 A;  1I4Q A;  2XK5 B;  2N9K A;  3UI3 A;  3BZD B;  3W5V B;  1FRD A;  3V6C B;  2MJD A;  2KK8 A;  1R7S A;  3VTW A;  5EE3 A;  3VTU A;  2MJ3 A;  3AXC A;  3GZN B;  4W9E A;  1SIJ A;  3WAO A;  1WGR A;  4NZL B;  1VZ8 A;  3DHG C;  3ENE A;  1ZXI A;  2EMT A;  3SHQ A;  1EUV B;  4DDG D;  2KYW A;  3NRZ A;  4G3X B;  3L54 A;  3A1Q A;  3P1M A;  1XCQ L;  4AOF A;  2DZI A;  2NPT B;  3WAM A;  3AE6 B;  2K22 A;  1D4B A;  1QKZ A;  2L32 A;  1F2R C;  2WXN A;  4RGT A;  1JRO A;  2KAN A;  3ZNH B;  1UF0 A;  2KFK B;  4F8C B;  1WGH A;  1TS5 A;  1GJZ A;  4NAW B;  1DOI A;  1E7V A;  1Q5W B;  4A6Q A;  4BVU C;  4K7U A;  2N9X A;  2M56 B;  3EFU A;  1PUT A;  5LXI B;  1DYQ A;  1YD8 U;  5AEK B;  2Z0E B;  4KSK C;  5DPS A;  2ZNV C;  4BOZ B;  3L10 B;  1ZW7 A;  4YTN B;  1UBQ A;  2NVU I;  2L0T A;  4IM3 A;  1YJ1 A;  2KQS A;  1WIA A;  2L76 A;  1V80 A;  4MEM A;  3VRA B;  5EE0 A;  2RMM A;  3AUL A;  5CTR C;  1XT9 B;  4EZJ A;  1VLB A;  1R4M I;  5FR3 A;  2WDR B;  1DGJ A;  1XF5 L;  4KDI C;  3VH3 B;  3MC8 A;  2WYQ A;  1E8W A;  2WXG A;  2V4L A;  4M8M A;  4BKS D;  2XK5 A;  3BK2 A;  1GB1 A;  1FCL A;  1WYW B;  2MBB B;  1QOF A;  3AE3 B;  2CHZ A;  2L00 B;  2NCN A;  3PO0 A;  2MW5 A;  3RUL A;  2JT4 B;  3KYD D;  1FFV A;  2IO3 B;  1L0X B;  1L2N A;  1ZP0 B;  1Z2M A;  3UQA A;  4E74 A;  1I4P A;  1Q10 A;  2EEL A;  2LVO A;  3DOW A;  4ZHO A;  3ZVV A;  1WE6 A;  1TBE A;  3WIM A;  2MEK A;  1RRB A;  4FLH A;  4HRO A;  2RDG A;  3H7S A;  1J7C A;  3WA0 A;  3ML8 A;  1TGZ B;  4ZYS A;  1C76 A;  2ZPY A;  2NPT A;  2DEN B;  2Y5B B;  2JX5 A;  2KMC A;  2GB1 A;  4RM8 A;  1MI0 A;  2PPH A;  2M19 A;  4ZRI A;  3AM9 A;  5D7G A;  1PYW D;  2GBJ A;  3AEF B;  2KFK A;  3VUW A;  4NAW A;  1JW9 D;  1QIL A;  3IBE A;  2D5G A;  4KIK B;  3U2S C;  2Y5C A;  4MT5 A;  1VJK A;  2IDY A;  1P7E A;  3RN9 C;  1D5M C;  2MBQ A;  2KO3 A;  3U30 A;  3X23 A;  4W9J A;  4A90 A;  1G6J A;  5IP4 D;  1WJ6 A;  1TZO A;  2FAZ A;  4C80 A;  2LGD A;  1YQ3 B;  2KNB A;  4KGS A;  4GMV A;  5HHD G;  5I4D A;  1ACC A;  2WDQ B;  4K1R B;  1M4V A;  4BBN F;  1L4Z B;  4K81 A;  3Q8B A;  4WWO A;  4DXA B;  3NHE B;  4RNA A;  2V1Y A;  1NDD A;  3HHM A;  2ZZP B;  1WXV A;  3BYT B;  1P98 A;  3U7Z A;  2N1W A;  1WZ0 A;  2AQ1 B;  4NJC A;  3N1X C;  5TR5 A;  2GBR A;  4WJQ A;  2KMM A;  2LVQ A;  4ZDV A;  4I6N B;  4W9L A;  3W1Y A;  4H2A A;  1LO5 D;  5CHW A;  3ZTD A;  1WJN A;  1FCC C;  1OQR A;  3C0R B;  3NVY A;  4HPM B;  2BQQ A;  2WWZ A;  2KDF B;  5BYS A;  3R2I A;  3ZQ4 A;  2K0P A;  2W54 A;  3V60 A;  2MLB A;  4IM2 A;  4IWQ A;  2AWT A;  2EKI A;  3UF8 A;  1E8Y A;  3KUD B;  2I1K A;  2V3P A;  1YQB A;  2WXO A;  1YN3 A;  4GOC A;  3P42 A;  4JGH B;  4DHJ D;  2DHZ A;  1T6B X;  4EOY A;  2LHD A;  4C7Y A;  5FR6 A;  1SE4 A;  2KDI A; 
#chains in the Genus database with same CATH homology
 5BYQ A;  2X38 A;  3P4P B;  5BMG A;  3U52 E;  1EWC A;  1PDX A;  3HUI A;  3AEC B;  5AUK A;  2QIE B;  1CQV A;  1D5Z C;  1B9R A;  1DOX A;  4ARC A;  3AMZ A;  1KLU D;  2AQ3 B;  5HFY A;  1A70 A;  2PVO D;  4US8 A;  3AEG B;  2WU5 B;  3AE4 B;  3I57 A;  1SSN A;  1V1P A;  2JYT A;  4KGR A;  1NEN B;  2K5P A;  2ON8 A;  1JWA D;  5TSS A;  1ESF A;  1YJJ A;  2SAK A;  2W3S A;  4MAC A;  1BML C;  2QMT A;  4DXG A;  1ZE3 D;  1FMA D;  3P4Q B;  2ACZ B;  2BB6 A;  3AED B;  1QQR A;  4YTM B;  2VZK B;  1KH0 A;  1P7F A;  1XLQ A;  3GP7 A;  2WXF A;  2BYT A;  1UNS A;  1C4C A;  2JU6 X;  3ZJT A;  3EUB 2;  1QOA A;  1WGK A;  5AUI A;  4OZB A;  1KLG D;  1OFF A;  4JWU C;  1FXI A;  2JWU A;  1EWY C;  1SE2 A;  1MPE A;  3AE8 B;  2IGD A;  4IOI E;  2RDH A;  4RCO A;  3W9C B;  3AV8 A;  3B2F A;  4IDI A;  2PTL A;  4RGM A;  1TJE A;  2WS3 B;  1GOZ A;  3Q8E A;  3PZ8 A;  4C56 C;  4ZHP A;  2PMV A;  4GDL B;  4TQ0 A;  1E7P B;  1C9F A;  1JRP A;  1VDV A;  2KDM A;  1WRI A;  1AWD A;  2IGH A;  4GDK B;  5GXG B;  3ZJV A;  1RWS A;  2WLB A;  2WXQ A;  4N58 A;  2KN4 A;  1PGX A;  3BVM A;  5G5H A;  1T3Q A;  3GB1 A;  5H92 C;  1RM6 C;  1V97 A;  3NUH B;  5FK9 C;  1E10 A;  2MH7 A;  2WXK A;  3W2D A;  2Y5P A;  4Q2J A;  2QSD A;  3SEB A;  1L5P A;  1UGJ A;  1QT9 A;  5EE1 A;  1I4G A;  1STE A;  1TKG A;  1ZDV A;  2HTM E;  4USA A;  2SEB D;  4ITK A;  4R3D A;  3VRB B;  1C79 A;  5BMI A;  1SE3 A;  2KAC A;  4CQN A;  3T3O A;  1GB4 A;  1ENF A;  1ET6 A;  1MHX A;  2XN9 C;  3CIR B;  1JCK B;  2DBY A;  2L1A A;  5G5G A;  1YQ4 B;  2BS4 B;  1C77 A;  3NVW A;  1XCT L;  2XNA C;  4ZRP A;  4L2Y A;  2JSV X;  1L4D B;  1NEK B;  4HKZ E;  1L6U A;  4WH4 A;  1SF0 A;  4JWS C;  4TMA B;  3IXS A;  2BT6 A;  4ZOH C;  1QLB B;  3VR9 B;  3NVZ A;  4US9 A;  1TS4 A;  3AEA B;  3BVG A;  3NVV A;  2N7J A;  4RGN A;  1Y56 A;  4YSZ B;  4WIP A;  1F0Z A;  3Q69 A;  1RYJ A;  2TSS A;  1CK1 A;  2LEK A;  1PFD A;  3TEY A;  4B0M A;  3DWG C;  4EE2 A;  3ABV B;  3IT6 B;  3LXF A;  3LYY A;  1XXG A;  4UDU C;  3EA6 A;  4REZ A;  3AB5 A;  2IGG A;  2WQY B;  1YN5 A;  4TQ1 A;  1E0Z A;  3B2G A;  1SJH D;  2WU2 B;  4RFB A;  1JWU D;  3VR8 B;  1SBB B;  5C2T B;  3IT4 B;  2WXL A;  1K50 A;  3E9S A;  2Y3A A;  1L0Y B;  3URY A;  2JZP A;  3P4R B;  1N60 A;  1ZUD 2;  2W82 A;  2JQR B;  5FKA C;  2I2Y A;  1SEB D;  1E9M A;  1YNT E;  4N6E B;  2BTE A;  1VZ7 A;  1V8C A;  2BBC A;  3KLS X;  3NZ3 A;  1VR9 A;  4D2K A;  1C4P A;  4M0W A;  1KF6 B;  2NTT A;  5C3J B;  1XLP A;  1EM7 A;  3TUO A;  3SFE B;  3FAH A;  4OVZ A;  2WXJ A;  2WXM A;  1WYG A;  2DLB A;  1N5X A;  1N61 A;  3TSS A;  4RH6 A;  2PVG C;  4WQM A;  2KWD A;  4LK0 M;  4XE0 A;  2WXP A;  1TS2 A;  1YMH E;  1XLN A;  1UUP A;  2NTS A;  2ONQ A;  1IGC A;  4KKJ A;  1KTK A;  1NVI D;  4TSS A;  1ZOY B;  4YWG G;  1I4H A;  3H8H A;  1WSP A;  1HA5 A;  1I4Q A;  2N9K A;  3TEW A;  4HEA 1;  3BZD B;  1VRA B;  3UI3 A;  2OHF A;  1ET9 A;  2H89 B;  1K51 A;  3W5V B;  1FRD A;  2MJD A;  3Q8F A;  3HVD A;  1WXQ A;  1R7S A;  3B9J A;  1FFU A;  1CZP A;  1TY0 A;  2I38 A;  4NAM A;  5EE3 A;  2N0S B;  2MJE A;  2MJ3 A;  1T5X D;  3BVZ A;  2L52 A;  3U4E G;  2K3U A;  1E6E B;  1SIJ A;  3IAM 1;  1L6V A;  4HRS A;  3N9Y C;  4NZL B;  1VZ8 A;  2WXI A;  1ZXI A;  1CJE A;  3KWV A;  1PGA A;  2AQ2 B;  3DWM A;  3NRZ A;  2GRI A;  1DOY A;  2BS3 B;  5T8I A;  4WWM A;  1YJI A;  1D5X C;  2E6X A;  2W55 A;  4FXC A;  3P1M A;  4KKI A;  1TS3 A;  1K52 A;  2GI9 A;  4OW0 A;  3ETR A;  1SJE D;  1JML A;  1BXT A;  2BW2 A;  1XCQ L;  1FNV A;  4KX6 B;  2KQ4 X;  3W1S A;  3C8Y A;  1V1O A;  2PLP A;  3IAS 1;  1QOB A;  3AE6 B;  2K22 A;  3P4S B;  1D4B A;  1QKZ A;  2L32 A;  4XDD A;  1F2R C;  1ZDX A;  2WXN A;  2W3R A;  4RGT A;  1JRO A;  2V3N A;  1JWB D;  5BYR A;  1HZ5 A;  2CJO A;  5JXV A;  1JQ4 A;  1N63 A;  3FIL B;  1TS5 A;  3W5U B;  3I9V 1;  1C4A A;  2LUM A;  2IPK D;  1DOI A;  2QEJ C;  4NAW B;  3V05 A;  2J52 A;  4A6Q A;  2OED A;  2M56 B;  1PUT A;  2E3T A;  2Q5W D;  1DYQ A;  4L23 A;  5D3I B;  5MPO A;  4AS1 A;  1NI3 A;  4PT5 A;  1FEH A;  2PKO A;  4LTU A;  1KFY B;  3HVZ A;  4YTN B;  2IJ0 A;  2PW9 A;  3VRA B;  3AE7 B;  2WP9 B;  5EE0 A;  2RMM A;  1KRH A;  1IGD A;  3SFD B;  1VLB A;  1ROE A;  2BB5 A;  5FR3 A;  1IUE A;  1JAL A;  4OHJ A;  2QIL A;  1RFK A;  3SR6 A;  2WDR B;  5HG2 A;  1B1Z A;  1J7A A;  2QJL A;  1DGJ A;  1XF5 L;  3TEZ A;  1VZ6 A;  4A8X C;  3BYY B;  2FUG 1;  4GLS C;  4N59 A;  3PZ7 A;  3ZJU A;  2WXG A;  4ARI A;  2J53 A;  3BK2 A;  4XWW A;  1GB1 A;  1FCL A;  2AX5 A;  2FBW B;  2NMQ A;  3P63 A;  1QOG A;  2K9X A;  1EU3 A;  2CJN A;  1N5W A;  3J9C A;  2LFI A;  2BS2 B;  2JYE A;  1HZ6 A;  3AEE B;  3MJ5 A;  1QOF A;  2LJI A;  3AE3 B;  3KQ4 A;  3GS2 A;  4JE3 B;  1FNW A;  2WDV B;  1L0V B;  3PO0 A;  3BWU D;  3AE1 B;  1FXA A;  4ZRQ A;  2WNM A;  4JX1 C;  1UWM A;  4HJG E;  1FFV A;  5LNK 1;  1L0X B;  2CU3 A;  1ZP0 B;  1FO4 A;  2B76 B;  2WXR A;  2H88 B;  2KAJ A;  1FNU A;  4YXD B;  3VQI A;  1I4P A;  4XDC A;  1Q10 A;  2EEL A;  4ZHO A;  2JXT A;  1IBX B;  5D3D A;  1EU4 A;  5EE9 A;  4IKG A;  3L4P A;  3AE9 B;  2MEK A;  1I7H A;  3MFG A;  4MH8 A;  4HRO A;  1PGB A;  2RDG A;  5HI1 A;  4YSY B;  1J7C A;  4ZYS A;  2Z8L A;  1C76 A;  3BII D;  1K53 A;  4A55 A;  3ZGZ A;  3LB8 C;  3RPF C;  3KWL A;  1J7B A;  1N62 A;  4J3O D;  1FM0 D;  2JX5 A;  4YT0 B;  1AN8 A;  2GB1 A;  4B0E A;  1NYR A;  3BK1 A;  1YN4 A;  1HQR D;  2RPV A;  1MI0 A;  4RF0 A;  4O1N A;  3RFZ B;  2M19 A;  1ZXH A;  2J4X A;  3AM9 A;  5D7G A;  1PYW D;  4A9A A;  2R61 A;  3AH7 A;  1XLO A;  3AEF B;  2LHE A;  3FIL A;  4WAF A;  2LGI A;  1JW9 D;  1QIL A;  4XWT A;  4JPS A;  1V1P B;  2G9H D;  2D5G A;  4P6V F;  4RF1 A;  3U2S C;  1QF6 A;  2DWQ A;  2Y5C A;  3CWI A;  4MT5 A;  1VJK A;  3OWE B;  2IDY A;  1P7E A;  1D5M C;  1XEE A;  2L83 A;  2M0A A;  3AN1 A;  1TKE A;  4A90 A;  1NYQ A;  5BMH A;  1TZO A;  3ZYY X;  4C80 A;  1F2R I;  1I4X A;  1I4R A;  1GAQ B;  1UWX A;  1YQ3 B;  4WUR A;  3WCQ A;  2V4I B;  2WXH A;  4KGS A;  4MM3 B;  4C7Z A;  5HHD G;  5E6J A;  3R8B A;  2ZW1 A;  5I4D A;  4YTP B;  1ACC A;  1SB3 C;  2WDQ B;  4RGO S;  5H8Y E;  2PIA A;  1MVK A;  1TYG B;  1M4V A;  1SXT A;  1L4Z B;  3Q8B A;  2FE8 A;  1AW7 A;  3MC0 B;  1WWT A;  2DYO A;  2YEP B;  4OZC A;  3AE5 B;  1FRR A;  3E56 A;  3FC4 A;  3TEX A;  1AYF A;  4RNA A;  2ZW0 A;  4OZA A;  3Q8C A;  2ICI A;  1FD6 A;  2G1E A;  1GPX A;  3V3X A;  1D6E C;  3BYT B;  3U7Z A;  1JWS D;  3AE2 B;  1TKY A;  1HEZ E;  2AQ1 B;  4NJC A;  2VZK D;  3MP9 A;  1F77 A;  1C78 A;  4DXF A;  1MHH E;  4KGT A;  1HXY D;  1OQQ A;  2KMM A;  4YSX B;  2INP E;  1JWM D;  4H2A A;  1LO5 D;  1FCC C;  1OQR A;  3NVY A;  4L1B A;  1BUI C;  4P16 A;  2INN E;  2J42 A;  1ZPS A;  3AEB B;  3EGR A;  3T3N A;  5BYS A;  4AQ7 A;  3R2I A;  3MHZ A;  3ZQ4 A;  3O13 A;  2K0P A;  2W54 A;  4HKQ A;  3R2T A;  2YEP F;  1XO3 A;  2DYM A;  4DQO C;  1IBX A;  1FIQ A;  4LLG M;  2EKI A;  3Q8A A;  2N9L A;  1TY2 A;  3HRD D;  2V3P A;  2HDE A;  3NS1 A;  2WXO A;  1YN3 A;  3P42 A;  1T6B X;  2LHD A;  4C7Y A;  1SE4 A;  2V0G A;  2LMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...