3B2FA

Maize ferredoxin 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
b'ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-1, chloroplastic
publication title A new structural insight into differential interaction of cyanobacterial and plant ferredoxins with nitrite reductase as revealed by NMR and X-ray crystallographic studies
pubmed doi rcsb
source organism Zea mays
molecule tags Electron transport
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3b2fA00
3B9JA 1VDVA 2PVOD 2M56B 4N6EB 3EUB2 3BIID 2K9XA 1UWMA 1DOYA 4YTNB 3AE3B 4WQMA 3P4QB 3VR9B 1FO4A 3P63A 1JW9D 1RYJA 2B76B 1YQ4B 1F0ZA 4YTPB 1WGKA 1KF6B 1XLPA 2BT6A 3W5UB 1E9MA 3P1MA 1FXIA 2CU3A 1XLQA 4N59A 1TJEA 1TKGA 3FC4A 4ZOHC 3NVYA 1TKYA 1QOAA 1NVID 1NYRA 5G5HA 2WDVB 4YSYB 1L0VB 3AH7A 2M19A 2ACZB 2MH7A 3AE9B 2H89B 2W54A 2EKIA 4A9AA 1QOBA 1J7CA 3B2GA 5G5GA 2BS3B 2MJEA 3AEGB 3AEFB 3VR8B 4ZHPA 3SFDB 4C80A 1FFVA 1GPXA 1CZPA 3HUIA 4YSXB 1OQRA 2PKOA 3LB8C 1B9RA 1NEKB 4C7YA 4HRSA 2PVGC 3AV8A 1A70A 1JWAD 3AE4B 2AX5A 1RM6C 1JRPA 3W5VB 1I7HA 1PDXA 1OQQA 1QOFA 5EE9A 1RWSA 1N5XA 5C2TB 3RPFC 3SR6A 1ZP0B 3AN1A 1R7SA 1E10A 2MJ3A 2K22A 1FIQA 2WS3B 3ABVB 3AEBB 2OHFA 5GXGB 1L5PA 3NS1A 1V97A 2H88B 5MPOA 1EWYC 1DOXA 1T3QA 1E7PB 2L52A 3P4RB 3P4SB 1NYQA 1V8CA 2Q5WD 2W3SA 1JWBD 1GAQB 1OFFA 2BS2B 2LEKA 1N60A 4ITKA 1L6VA 3AECB 1SIJA 2WU5B 2QIEB 4FXCA 3AE7B 4HROA 1N61A 1NI3A 1WWTA 3NRZA 3NVVA 1QF6A 1E0ZA 4ZHOA 1WRIA 2BS4B 2DBYA 3CIRB 1JALA 2WDRB 3PO0A 5EE0A 1ZOYB 5AUIA 1WXQA 1FFUA 3AE5B 3AE6B 5H8YE 5EE3A 3ZYYX 1SB3C 3AEEB 3FAHA 4USAA 1XLNA 5H92C 2KMMA 2MJDA 1XLOA 3AEDB 2JQRB 1N63A 2WLBA 1AYFA 3DWMA 3HRDD 1FRRA 1QLBB 1FXAA 4YXDB 1KRHA 4YSZB 2HTME 4JWUC 4LTUA 1PUTA 5C3JB 5EE1A 2PIAA 1SF0A 1DOIA 3ETRA 4YTMB 3AE8B 1YJJA 3CWIA 1XO3A 3P4PB 1E6EB 4IDIA 3NVWA 1ZUD2 1AWDA 2FBWB 4WWMA 1NENB 2W3RA 3KWLA 3SFEB 2WQYB 1QT9A 1QOGA 4P6VF 1VJKA 1DGJA 1PFDA 1TYGB 2QJLA 3NVZA 4JWSC 4YT0B 1TKEA 4KX6B 5AUKA 2Y5CA 1ZXIA 2E3TA 2L83A 2K5PA 2WU2B 3AE1B 3HVZA 1IUEA 1WYGA 2W55A 3AE2B 3AMZA 1JROA 4N58A 3VRAB 2JX5A 2WP9B 3AB5A 1YQ3B 3W9CB 1RFKA 4US9A 2CJOA 1ROEA 3AM9A 2N0SB 4JX1C 1N62A 4US8A 3DWGC 1YJIA 1L6UA 1J7AA 1N5WA 2KAJA 3WCQA 1FRDA 3AEAB 1FM0D 3L4PA 3B2FA 1FMAD 1KFYB 1VLBA 2CJNA 2DWQA 1J7BA 1CJEA 2WDQB 3LXFA 1JQ4A 4C7ZA 3VRBB 2G1EA
chains in the Genus database with same CATH superfamily
2RPVA 4REZA 1FXTB 1UUPA 2B76B 5JHAA 1Q1OA 2HE7A 1KLUD 2BT6A 3UQBA 2JRIB 2UYZB 1S3SG 1XLQA 4II2B 1TKGA 4ZOHC 2PE6B 3ZIMA 5L95C 5FKAC 1SE3A 1TY2A 2JWUA 1UELA 4W9LA 1WY8A 2NMQA 3BINA 4A20A 1NEKB 1FNVA 1E5WA 1S1QB 2AL3A 5EE9A 3T3OA 3RCZA 1U4AA 4JL9A 1WR1A 5AZHA 3L16A 2C5LC 4B6WA 3TCAA 3GS2A 2WX1A 3I57A 4AOFA 3U8ZA 1T6BX 3EFUA 1VZ8A 5AUIA 1EU4A 5H8YE 3ZJTA 3N3KB 3FAHA 1A5RA 4UDUC 3QQ8B 1I4XA 1OQYA 1XLOA 1AYFA 1WJUA 2KKCA 1EO6A 2NR2A 3CSFA 4A8XC 2KQSA 1SF0A 1D4BA 3ML9A 3CWIA 5HHDG 2LXAA 1XCQL 2LUMA 2N7JA 3KWLA 1R4NI 2MHJA 2C7HA 4WJPA 5AUKA 3VXWA 1EF5A 2WXHA 1N62A 4NAWB 3T3NA 4BKSA 2FAZA 1YN5A 3WCQA 3DBHI 2JRHA 1FMAD 2BBCA 1H8CA 3R3MA 5FR3A 1HE8A 2M56B 3S2AA 2MRPA 4IG7B 3NOBA 4DWFA 5IN7A 3QIJA 4IKGA 2D3CA 4L23A 4IW0A 2RDGA 2RDHA 3W5UB 4A55A 3W1SA 1B1ZA 3ZGZA 2FCMA 2HJ8A 2K8CA 2GBNA 4DXGA 1WH3A 3FKYA 1BMLC 4XGAB 2RGFA 1F2RC 4RM8A 4XWWA 4C7YA 2LGSA 3A9KB 3DBRI 1QKZA 1R7SA 1XCTL 5GXGB 1WYWB 4ARIA 2AQ2B 1DOXA 3OJ3A 2Z0EB 4EOYA 2MSED 1N60A 4L2YA 3NZ3A 3DHIC 4OVZA 2LRUA 5TSSA 5EE0A 5DPSA 3Q8AA 1ZDXA 2ZNVB 1I4GA 2PMVA 5IP4D 2I1JA 2C9WB 5IO9A 1RFAA 4XE0A 5IKCM 2NBWB 4FBJB 3EGRA 2BYVE 3NVWA 1KLVA 2W3RA 2V3NA 3NVZA 4HK2A 4HDOA 1OGWA 1UBQA 1J19A 4S17A 4MGIE 3EA6A 5BMGA 1HZ5A 2KAJA 2D07B 1KTKA 2L0FA 3PZ8A 2EKEC 2WDQB 1STEA 4HJGE 4B9KA 4DHJB 5CX3A 4OW0A 2R2OA 3O13A 3A1QB 5DPRA 1UWMA 3PT2B 1DOYA 4DDGD 3APCA 1GG3A 2FIFA 3H1UA 4RM9A 2MBHA 3DHHC 3L13A 4GDLA 1JWSD 4MELA 4DDID 3RNAC 2MH7A 2QDFA 2W54A 1YN3A 5D7GA 2KLGA 4A9AA 2BB5A 4ZHPA 2WXGA 1C76A 1TS2A 3TEWA 4G11A 2L8JA 1HQRD 3PLUA 4FJVB 4MJSB 3C8YA 1VCBA 3FILA 3I9V1 1WE7A 2G3QB 3APFA 2V4IB 4FLHA 4P16A 1T0YA 1C77A 3R66C 2GB1A 1CQVA 1V8CA 2K3UA 3RN9C 3ZDMC 2IPKD 2O6VD 3W1YA 3AE7B 4ZHOA 4C80A 4G0NB 1E8WA 1FFUA 3RI7C 5EE3A 5AZFA 1XLNA 1VZ6A 1YMHE 2WNMA 4HLEA 5IA7A 4PS8A 2JQRB 1UD7A 1QLBB 2JWZA 4GDLB 3H9DA 2V1YA 1E7UA 2ZNVC 4OVVA 1VJKA 1L4ZB 2E3TA 2K5PA 4GB9A 4CHKA 2M0XA 3AE2B 4N58A 4HWIB 3PSEB 4DHJD 5BYRA 5G55A 5KHQA 1YJIA 3L08A 1WX9A 2ICIA 4HJKA 2YEPB 2YLMA 2ZZPB 4J3OD 2N9EB 1T0QC 4C7ZA 2Z0DB 4II3B 1OEYA 1P3QU 3DBLI 1LGRA 1R4NB 1TBEA 2M4NA 3RT3B 2KC2A 3R2IA 4LJPB 4TQ0A 3HM3A 5GMVA 4YTPB 4TQ1A 4K7SA 2L32A 1IYFA 2Y3AA 5DPWA 1HA5A 1NYRA 2RDBC 3IG3A 3A4SC 4AUQC 1E8XA 1UZXB 3DBHB 3JVZX 5CTRC 2KANA 3M95A 3AEGB 3IAM1 2KJRA 2LWPA 2PKOA 4F7ZA 2LVQA 4GOCA 4MGKE 2FUG1 1WE6A 4JQWC 3Q8BA 2KACA 2L3ZA 3R7QA 3JSVB 5J2RA 2N4FA 2KLCA 1GAQB 2UWQA 2V0GA 3NJTA 1X1MA 5AEKB 3UGBB 4TSSA 2IGHA 1ESFA 3VVWB 3ZW3A 2KMMA 5JXVA 1I35A 4NPNA 3DBRB 1C78A 5J18A 2N7DA 2DAJA 5BO4B 4YSZB 1NDDA 3N9YC 4ZRQA 3DVGY 4XWTA 1D5MC 1ZXHA 2XNAC 4WH4A 2FCNA 3KUDB 2KNBA 2K1FA 2MBBB 2ON8A 2QILA 3V05A 3RUIB 1IUEA 1V9JA 3AMZA 4DXAB 2KWUB 3HHMA 4KGRA 4XYCA 1L6UA 1YX5B 1WGGA 1V5TA 1JQ4A 1XQQA 2DZMA 2PTLA 3TL5A 3N1XC 1LM8B 4ZRIA 1YD8U 2JYEA 2FE8A 2KQ4X 2O2VA 3NVYA 1P98A 3URYA 3T8MA 4NQLB 2BYEA 2AYOB 2I1KA 2KQ7A 4ARCA 1OEYJ 3N1YC 2PVGC 3AV8A 4PK1A 1Y8RC 1QOFA 2IY0B 3BWUD 4MDKE 4GGQA 2WXFA 2BKRB 1LO5D 2G4SA 1YIWA 2LXCA 2L7RA 1K51A 1L6VA 4BKTA 3Q69A 4RCOA 2BVCA 3TJPA 2RD0A 2BS4B 3RZFA 4AWJA 1K52A 3GZNI 3LYYA 1CMXB 3RMKC 1VZ7A 3NS8A 3ZJVA 3X23A 4WQOB 5D94A 3DVNV 1FXAA 5E6JA 1KH0A 3N1ZC 4RH6A 3NZUA 2LHEA 3A9JA 2UU7A 1WF9A 1WJ6A 1PFDA 3BYTB 2KWCA 2ASQA 4JGHB 2W55A 4BVUC 1V2YA 2Z59B 5CHVC 1J7AA 3AU5A 4KIKA 2XEWA 3AEAB 3L4PA 3ZRFA 5BYSA 2K6DB 4LK0M 1XT9B 2GOWA 3RULA 3R2TA 1C4PA 3GB1A 3PZDA 4TUUA 3W2DA 2JY6A 1LXDA 1FD6A 2J42A 3A9JB 3UF8A 4TMAB 2EKIA 2D5GA 2K8BA 2WXPA 3KYDD 4ZRKA 2WYQA 3QA8A 3OG5A 3HUIA 2GRIA 4E3CA 4HDQA 3DBLB 2KOXA 1A70A 1JWAD 2WXRA 1JRPA 4DBGA 1I7HA 3ZLZA 1N5XA 1ZP0B 1E10A 2AL6A 1Q0WB 2GBMA 4B0EA 3BK2A 1TZ1A 2RPQA 2KDEB 1TZOA 1SE9A 3B08A 4K81A 3Q3FA 1GB1A 3M63B 3NVVA 3PRPB 1XEEA 2OJWA 1V86A 1WX7A 3KVFB 4FJYA 3ZYYX 3H8HA 5I4DA 1TS4A 2Y5BB 2V9HA 2J0MA 1FCLA 1C9FA 3BYYB 4AP4C 1Q10A 3QX1A 1Q5WB 2KT7A 1SBBB 4HXDA 4JWSC 4RF1A 3HVZA 5C1ZA 1SJHD 1WYGA 2XBBC 4KVGB 3VRAB 2WP9B 1J8CA 3VUWA 2IY1B 4FADA 3C0RB 2JYTA 2SEBD 1N5WA 2ZCCA 1EM7A 1FRDA 3TEXA 5IOIA 2NTTA 3UIOB 1I4HA 1K53A 2G1EA 2MP2A 4N6EB 3VFKA 2J4XA 1EU3A 2DNFA 4W9EA 4IOIE 3RYTA 4WQMA 1NBFC 1RYJA 3GE8C 1YQ4B 1F0ZA 4CO7A 4LNFA 4KKJA 1PGAA 2CHZA 2G9HD 4LNOA 1TJEA 3FC4A 2KX0A 4W9CA 2IBIB 3V61A 3B1LX 2MJEA 2KN4A 1SSNA 3VHTC 2VH2A 1MPEA 3LB8C 2CHXA 3KYCD 2A4ZA 4FULA 2NVUI 3E9SA 3HK0A 4M8NA 1TY0A 4ASWC 3ZO5B 4ZYNA 2OHFA 4MM3A 2BB6A 4JLCA 3RNBC 3V60A 2H88B 2N7EA 2SAKA 1E7PB 2WWZA 4NAMA 3D32A 4WWNA 4AS1A 4ITKA 3QARA 3AECB 4OHJA 2MP2B 2NS5A 3HVDA 4J6IA 2BYFA 1MFWA 3PREA 3AU4A 3WAOA 4P1BC 1WR6E 1UGMA 1N63A 3ZVVA 3HRDD 2BF8B 4JWUC 3ZJUA 2JZPA 2M0AA 4C4VA 2GBKA 2J7QB 2NBUA 2QJLA 1TYGB 3L10B 3PRZA 2J0JA 3OLMD 2M1MA 1WGYA 2L83A 3IAS1 1UWXA 1WXMA 3W9CB 2LGYA 3GZNB 5LNK1 2B3AA 1V1OA 1I4QA 4RGTA 3GE3C 4RNAA 3MJ5A 4HPPA 4IM3A 3RNCC 2CJNA 1HTQA 2KDIA 2I2YA 3SD5A 2G45B 3BY4B 4LDTB 3H7SA 5TR5A 3PV1A 3AE3B 3KQ4A 3P4QB 1FO4A 4A3PA 5G2NA 1PQSA 2ZW0A 2KMCA 1L0YB 2D2QA 2NBVB 1KJTA 1FXIA 3PS6A 3L0WB 3QJZA 2E6XA 2LGDA 3P42A 4HPMB 2H89B 5EDSA 5G5GA 4B95A 3IT6B 2AQ3B 4HKZE 1D5XC 4GMVA 3WAPA 2MW5A 2QSDA 4IWPA 1R4MI 3VTVA 3ZQ4A 1SIFA 4MGZE 1L5PA 2LVOA 4MSMB 1EWYC 2K8HA 4YWGG 4IWQA 5LXIB 4EE2A 2WU5B 3RD2A 1FPYA 2CU1A 4RFBA 2RSUA 1NI3A 1AN8A 3I5JC 1QF6A 4BKSD 3I3TB 2DBYA 2AWTA 4LJOB 4WWPA 3TEZA 1WMHA 4RGOS 3ZNHB 3KWVA 1P7EA 2N1VA 1UGJA 4OZAA 5C3JB 4KDIC 1XO3A 4NY0A 1TT5B 4HEA1 4EZKA 1NENB 2WXQA 1QT9A 2DYMA 2IO3B 2Y5CA 3U30A 2X38A 3DQVA 3EFCA 2X8XX 4XDCA 1BUIC 2MEKA 4GXBA 1AARA 1WGHA 3EC8A 4WWOA 1YQ3B 3H7PA 2YEPF 1ROEA 4LDTD 5FR6A 5JH5C 1F52A 2N9PC 4KZCA 1KFYB 1WRDB 4I6NB 4W9IA 3W1SC 3VDZA 3ZNID 1J0GA 2BKFA 2RMMA 2FCSA 2KVZA 4EFOA 3TMPB 2WDTB 1V1PA 3P63A 2ZVNA 2PJHA 1TS3A 2I38A 1E9MA 3FILB 2WXOA 3P1MA 1BXTA 1WSPA 3PGEA 3UINB 2LZ6A 3VR8B 2JZZA 1ZKHA 4BKGA 4XC2A 1B9RA 1C3TA 2HJ1A 2CHWA 4W9FA 4ACFA 3H7PB 4IC7B 4LNNA 5D2MB 1GC6A 4FHKA 3IVFA 2ONQA 1IPGA 1ZE3D 2L05A 4MSQB 4OZCA 1N6ZA 4E74A 2W3SA 2LEKA 2NPTA 4NJ7A 4CYEA 2ZEQA 1WRIA 5DCNA 1JALA 2WDRB 1C79A 2BWFA 4A3OA 2AQ1B 1SB3C 2JXXA 4WURA 5BMIA 1VRAB 2LUEA 3AEDB 2DENB 3RNFC 2DLBA 2WLBA 3DWMA 5HG2A 4HVBA 1V6EA 2CS4A 3U7ZA 5EE1A 3ETRA 2YVCA 3TIXA 3WA0A 3SHQA 1F9JA 4IDIA 4GN1A 2XK5A 2GBRA 3ZRCA 3ZDTA 2LGIA 3PHWB 1XF5L 1C1YB 1JROA 1HTOA 2KFKA 1GB4A 1JRUA 1WGDA 3AM9A 5D3DA 1ACCA 3OWEB 3M62B 4ZRPA 2KDMA 4D2KA 2NTSA 1PYWD 2NPTB 4ZDVA 4ZRJA 4KV2A 3MHZA 3DVNU 1TS5A 1SE2A 3R8BA 1EF1A 1JWUD 3VUYA 4GU2A 2K0PA 1T0RC 4NZLB 4BAXA 2JF5A 2L00B 3VAWA 3BVMA 3C19A 2LHDA 4F1SA 3CMMB 4AJWA 1L0XB 2PLPA 3B2GA 4F8CB 2BYTA 3AEFB 3Q3OC 2KN5A 1FFVA 2QEJC 2OJRA 3SU8X 3AE4B 1RM6C 4A6QA 3DBSA 4Q2JA 2BGFA 3RPFC 2GI9A 1P7FA 1V80A 3NS1A 2HDEA 1V97A 1T3QA 3RNGC 1G6JA 3IXSA 1JWBD 1WJNA 4JIOU 3WAMA 1GC7A 1WIAA 3WANA 3NRZA 2KX3A 1H4RA 2CKHB 3AE5B 3AE6B 4ICUA 1KLGD 1FNUA 4USAA 4R3DA 2MCNB 1R4MB 4ANXA 2M8SA 3V6CB 2PIAA 4YTMB 3AE8B 2HD5B 3ZNZB 2FBWB 2KC1A 2IO1B 4W9HA 3I63C 2N1WA 2PE9A 3AE1B 5BMHA 3EHVA 3Q6BA 4HKQA 4G3XB 4PS7A 1MJDA 1SJED 3BK1A 4JX1C 4K1RB 5D3IB 4EZLA 3T9LA 2O2VB 3MC0B 2IJ0A 2JUOA 3VRBB 2REXA 1VDVA 2M17A 1Z5SB 4TV3A 4PYUA 2DYOA 4YTNB 2KVRA 3MHSD 4WJQA 4FA6A 1IBXA 2CR5A 3O65B 4PS3A 1YX6B 3AXCA 1KOTA 1VD2A 1TKYA 1QOAA 5G5HA 2DZJA 3AULA 2DX5B 2PEAA 3AE9B 5KHOA 3ZTCA 1SXTA 2C7NB 4KSKC 2MQJA 1CZPA 3ECIA 5AZGA 1E90A 3JYUA 2DAFA 2XN9C 2IYDB 2IO2B 1PDXA 1RWSA 4NQKE 4KGTA 3CF6E 1WZ3A 1PGXA 5MPOA 3PVLA 1SIJA 2DZKA 2WXLA 1JWMD 3PO0A 1BT0A 4YL8A 4BBNC 1ZOYB 4W9DA 3N32A 2KHWB 1C4CA 4LLGM 4MEMA 1P9DU 3Q3JA 4M8MA 4KIKB 1I4RA 1PUTA 3HIZA 1QZEA 3CSTA 3DHGC 1UBIA 2V3SA 1E6EB 1MHHE 1AWDA 3QK0A 3X0WA 3OJ4B 2WQYB 4P6VF 3VH3B 1ZXIA 4PYZA 2C7MB 2WU2B 4BZAA 3KLSX 3MC9A 2MWSB 5HI1A 2IGDA 1FM0D 5DPTA 4KSLC 3N20C 2LASA 1K8RB 4BOSC 2WXJA 4KZ0A 3DOWA 5LLIA 3MJWA 4MH0E 3BIID 4AQ7A 4OVUA 4WIPA 3Q8FA 4NNJB 3VR9B 5D6JB 4W9KA 1RAXA 2KFJA 1SE4A 3MFGA 4NAWA 3BVGA 3PPAA 4YSYB 1D6EC 3GP7A 4BOZB 2TSSA 3BVZA 1MHXA 4PT5A 1E8ZA 1GPXA 2LMCA 2JPHA 2K6QA 3V6EB 3WIMA 2WXKA 2AX5A 3KH0A 1GNUA 4WAFA 2KZRA 1TGZB 2J0KA 1FEHA 1WFYA 1YN4A 1WZ0A 1ZDVA 1ISNA 2JVCA 2GLSA 2BS2B 2ZW1A 2QIEB 2V3PA 2KD0A 1WWTA 3PLVA 3V3XA 1V81A 2V4LA 4K7UA 3A9KA 4C56C 4N9F4 2IGGA 2WXNA 2MJDA 3V62A 1FNWA 2KXJA 4KKIA 4XX5A 2JU6X 3VH4B 1WGRA 4MGYE 1ZW7A 2C60A 5L83A 4IM2A 1L4DB 4O1NA 3ML8A 5C23A 3VUXA 2MA9B 2JX5A 2O6VA 3QAQA 4US9A 4X57B 2LVPA 4I6PA 2WX0A 1T5XD 1M94A 3Q3NC 3QHTA 1JCKB 4RF0A 2JXTA 4ANVA 2LGXA 2D3BA 3QC8B 3B9JA 2J52A 2A5UA 5IAAC 2NCNA 2VH1A 3TBLD 1NI2A 2DYBA 1WGKA 1KF6B 2LJIA 3ZXRA 4MM3B 4N59A 3ZTDA 3ZNGC 1NVID 1TTNA 1WM3A 4CQNA 1QOBA 4ICVA 1WXSA 1CK1A 1P0RA 1SGHA 3SFDB 2JZ3B 3A1QA 2INPE 3IBEA 3PHXB 4HRSA 3Q2AC 1D5ZC 4WJNA 1AW7A 1OQQA 2O6VB 3SR6A 1VR9A 2EELA 3AEBB 3ABVB 1QQRA 2QHOA 3KW5B 4MT5A 2ZPYA 2MBEA 4M00A 3IT4B 4DXFA 2J53A 5E6OA 1NYQA 4GLSC 3U4EG 1OFFA 4FHJA 1WXVA 2N9XA 4C4VB 5J17A 1E0ZA 4IM0A 1WXQA 2GMIC 2N9LA 4HCPB 4LNIA 4MJSA 1UNSA 2QCZA 4GDKA 2W9NA 1GJZA 1KM7A 4FJZA 1WM2A 3UQAA 4KGSA 1Z2MA 3A33B 1D3ZA 1WX8A 1ZUD2 4W9GA 3UIPB 1MVKA 4XDDA 3KUZA 3N30A 4M0WA 1RRBA 4RMAA 5E6NA 1EUVB 3NY5A 4US8A 1ET6A 4EUTA 4MH8A 5T8IA 4QAYA 3B2FA 2INDC 2DWQA 4TKNA 1QILA 3EUB2 3M3JA 2VRRB 2BPSA 1V49A 1JW9D 4GDKB 4M02A 3ENEA 1HZ6A 5CHFA 2LJ5A 3RNEC 1L0VB 3DCGA 2ACZB 3SEBA 4WAAA 1IGCA 1EWCA 1YOVB 3RZWC 3Q14C 1RLFA 3R7RA 1F1HA 4M0WB 4YSXB 3DVGX 1L7YA 2KO3A 2LRWA 4IUMB 2WHIA 1I4PA 3AN1A 1WMHB 2MJ3A 1DYQA 1FIQA 3QCAA 3QWZB 1E8YA 4BFRA 2L52A 4DHZB 2QMTA 2Q5WD 4G50A 1IP9A 4L1BA 2KJHB 3MC8A 4HROA 3VQIA 1M4VA 2L76A 3AEEB 2QC8A 1T0SC 2IO0B 2JT4B 2PPHA 1LQBA 4EEWA 4XZ4A 1ENFA 4DK5A 2L1AA 1FRRA 3JSVA 3PZ7A 1WJ4A 3TEYA 4A90A 1F77A 2WGSA 1DOIA 2Y5PA 2FCQA 3P4PB 1MI0A 2LFIA 2AEHA 2KTRA 3ONSA 4WWMA 2ZCBA 4M01A 1DGJA 3UI3A 2RR9A 2EMSA 3ZUNA 3WALA 1Y56A 1V1PB 1RFKA 2CJOA 1WI0A 1E7VA 3DWGC 3U52E 2D3AA 2R2QA 5JZEB 3Q8CA 1F2RI 1ZGUB 4ANUA 1VLBA 1CJEA 1GOZA 3SDLC 2HTHA 3KUCB 4ANWA 3NG0A 2ZPNA 1XLPA 1TIFA 4URKA 3A4RA 2OEDA 2WXMA 2WDVB 2LD9A 4FN2A 1J7CA 2KTRB 2BS3B 3TSSA 4LNKA 2VZKB 1OTRB 2KK8A 1MG8A 3AI5A 1UF0A 5C2TB 2K22A 2GBJA 4BBNF 1UH6A 3LJ3A 1ZPSA 4JPSA 2JSVX 1JMLA 2PW9A 2FIDA 4NJ6A 1IGDA 2G4DB 3P4RB 3B0AA 4RGMA 4KDLB 1ET9A 3ZKJC 2FNJB 2KYWA 2XK5B 4B0MA 2KWDA 2MLBA 4LCDE 4NJCA 3CIRB 5H92C 2KFKB 2DHZA 2DZIA 3EECA 3NUHB 1KRHA 2HTME 4GIVA 4EZJA 4OZBA 3VTWA 5HFYA 2OOBB 3E56A 3NZSA 4JE3B 1YNTE 4YT0B 3NHEB 2MBQA 4KX6B 4AJYB 2BQQA 3IHPC 3U7DA 5BYQA 1XD3B 1L2NA 3P2BA 3J9CA 1YQBA 2IDYA 2INCC 2LI5A 2ZJDA 1XXGA 2MBOA 2BWES 1FCCC 2L0TA 2N9KA 1J7BA 3OAWA 3DDCB 3PTFC 5CHWA 2IZVB 2PVOD 3PRMB 4K7WA 2K9XA 4P7IA 3BZDB 3Q3MC 2BTEA 2R61A 2CU3A 5LXHA 3HM6X 1SEBD 4P1CC 2D10A 2VZKD 3MP9A 3AH7A 2M19A 1YJ1A 3MTNB 1K50A 2WXIA 5HKHA 1OQRA 1V5OA 4ZYSA 3DPDA 3W5VB 4K3BA 3L54A 1I42A 2W82A 2WS3B 3K9PB 2ZVOA 3H6NA 4EKUA 1LFDA 3P4SB 3TUOA 3ALBA 3IFWB 2Z8LA 2FUHB 1HEZE 1WXAA 4FXCA 2K39A 3JW0X 1N61A 2KJ6A 3LDZE 2INNE 4RGNA 2KTFA 3L17A 2KDBA 4HPLB 1P1AA 2D11A 1PGBA 3RFZB 2D3GA 3VTUA 3K9OB 4YXDB 2K25A 4E71A 2KDFB 4LTUA 2EMTA 4DQOC 3ZXVA 1HXYD 1YJJA 4K3CA 2MX2A 3SFEB 3GOEA 1QOGA 1C4AA 5FK9C 4HCNB 1TKEA 4C00A 2KMAA 4IWOA 4W9JA 3AB5A 3U2SC 1MG4A 2KWVB 2N0SB 1IBXB 4DHZE 5E6PA 3Q8EA 4H2AA 5JHBA 3APDA 4S0RA 4I6LB 4MACA 3LXFA 1GUAB 2BW2A 4WJOA 4GSWA
chains in the Genus database with same CATH topology
3B9JA 2J52A 2RPVA 4REZA 2RMMA 1UUPA 1V1PA 3P63A 2PTLA 2B76B 1TS3A 2I38A 1KLUD 1WGKA 1KF6B 2BT6A 2LJIA 1E9MA 3FILB 2WXOA 3P1MA 1BXTA 1XLQA 1WSPA 2JYEA 4MM3B 4N59A 2FE8A 2KQ4X 1TKGA 4ZOHC 3NVYA 1NVID 5FKAC 1SE3A 1TY2A 4CQNA 1QOBA 2JWUA 3URYA 3VR8B 1CK1A 3SFDB 2NMQA 2INPE 4ARCA 1B9RA 1NEKB 4HRSA 2PVGC 1FNVA 3AV8A 1D5ZC 1AW7A 1OQQA 1QOFA 5EE9A 3T3OA 3SR6A 1VR9A 3BWUD 2EELA 3AEBB 3ABVB 1QQRA 2WXFA 4MT5A 1LO5D 2ONQA 1ZE3D 3IT4B 4DXFA 2J53A 4OZCA 1NYQA 4GLSC 2W3SA 3U4EG 3GS2A 1OFFA 2LEKA 1K51A 1L6VA 3I57A 3Q69A 4RCOA 1T6BX 1E0ZA 1WRIA 1VZ8A 2BS4B 5AUIA 1JALA 2WDRB 1C79A 1EU4A 1WXQA 2N9LA 5H8YE 2AQ1B 3ZJTA 1SB3C 4WURA 1K52A 3FAHA 3LYYA 1UNSA 4UDUC 5BMIA 1VRAB 1I4XA 1VZ7A 1XLOA 3AEDB 3ZJVA 2DLBA 2WLBA 1AYFA 3DWMA 5HG2A 1FXAA 4A8XC 5E6JA 1KH0A 4RH6A 4KGSA 2LHEA 3U7ZA 5EE1A 1SF0A 3ETRA 1D4BA 3CWIA 5HHDG 1XCQL 4IDIA 1ZUD2 2LUMA 2N7JA 3KWLA 1MVKA 4XDDA 3BYTB 1PFDA 2LGIA 4M0WA 5AUKA 1XF5L 2W55A 1JROA 1GB4A 2WXHA 3AM9A 1N62A 4US8A 1ET6A 4NAWB 3T3NA 5D3DA 1ACCA 4MH8A 1J7AA 3OWEB 5T8IA 4ZRPA 1YN5A 3WCQA 3AEAB 2KDMA 3L4PA 3B2FA 1FMAD 2BBCA 4D2KA 2DWQA 2NTSA 1PYWD 5BYSA 5FR3A 4LK0M 1QILA 2M56B 3EUB2 3R2TA 1C4PA 3MHZA 1TS5A 1SE2A 3GB1A 4IKGA 3R8BA 1JWUD 1JW9D 2K0PA 2RDGA 4GDKB 4L23A 1HZ6A 2RDHA 4NZLB 3W2DA 3W5UB 4A55A 3W1SA 1B1ZA 3ZGZA 3BVMA 1FD6A 2J42A 2LHDA 1L0VB 2ACZB 3SEBA 1IGCA 1EWCA 2EKIA 2D5GA 4TMAB 4DXGA 1L0XB 2PLPA 2WXPA 3B2GA 2BYTA 3AEFB 1FFVA 1BMLC 2QEJC 3HUIA 1F2RC 4YSXB 2GRIA 4XWWA 4C7YA 1A70A 1JWAD 3AE4B 1RM6C 1JRPA 2WXRA 1I7HA 4A6QA 4Q2JA 3RPFC 1N5XA 1I4PA 1ZP0B 1QKZA 1R7SA 1XCTL 3AN1A 1E10A 2MJ3A 1DYQA 1FIQA 5GXGB 2GI9A 4ARIA 1P7FA 2AQ2B 3NS1A 2HDEA 1V97A 1DOXA 1T3QA 2L52A 4B0EA 2QMTA 2Q5WD 3BK2A 3IXSA 1JWBD 1N60A 4L2YA 4L1BA 1TZOA 3NZ3A 4HROA 1GB1A 3NRZA 3VQIA 3NVVA 4OVZA 1XEEA 5TSSA 5EE0A 1M4VA 3AE5B 3AE6B 3ZYYX 3AEEB 3H8HA 1KLGD 1FNUA 3Q8AA 4USAA 5I4DA 4R3DA 1TS4A 1ZDXA 1ENFA 2L1AA 1I4GA 1FRRA 2PMVA 3PZ7A 3TEYA 4A90A 1FCLA 1C9FA 4XE0A 1F77A 2PIAA 1DOIA 3BYYB 4YTMB 2Y5PA 3AE8B 3P4PB 1Q10A 1MI0A 2LFIA 3EGRA 3NVWA 2FBWB 4WWMA 2W3RA 1SBBB 1DGJA 2V3NA 3NVZA 4JWSC 4RF1A 3UI3A 3HVZA 3AE1B 5BMHA 1SJHD 1Y56A 1V1PB 1WYGA 3VRAB 2WP9B 4HKQA 1RFKA 2CJOA 1SJED 3BK1A 4JX1C 3EA6A 5BMGA 3DWGC 2JYTA 1HZ5A 2SEBD 5D3IB 1N5WA 2KAJA 3U52E 1KTKA 1EM7A 1FRDA 3Q8CA 1F2RI 3MC0B 2IJ0A 1VLBA 3TEXA 1CJEA 3PZ8A 1GOZA 2NTTA 2WDQB 1STEA 3VRBB 1I4HA 4HJGE 1K53A 2G1EA 1VDVA 4OW0A 4N6EB 2J4XA 3O13A 1EU3A 1UWMA 1DOYA 2DYOA 4YTNB 4IOIE 4WQMA 1RYJA 1YQ4B 1F0ZA 1XLPA 1IBXA 4KKJA 1PGAA 2G9HD 2OEDA 1TJEA 2WXMA 3FC4A 1TKYA 1QOAA 1JWSD 5G5HA 2WDVB 2MH7A 3AE9B 2W54A 1SXTA 1YN3A 5D7GA 4A9AA 1J7CA 2BB5A 4ZHPA 2BS3B 2MJEA 2WXGA 2KN4A 1SSNA 3TSSA 1CZPA 1C76A 1MPEA 3LB8C 2VZKB 1TS2A 2XN9C 3TEWA 1HQRD 1PDXA 3E9SA 1RWSA 3C8YA 5C2TB 4KGTA 1TY0A 3FILA 2K22A 3I9V1 2OHFA 2V4IB 1ZPSA 2BB6A 4JPSA 2JSVX 1JMLA 2PW9A 4P16A 1C77A 1IGDA 1PGXA 2H88B 2SAKA 2GB1A 5MPOA 1E7PB 3P4RB 4RGMA 1CQVA 4NAMA 1V8CA 1ET9A 2K3UA 4AS1A 4ITKA 2IPKD 3AECB 1SIJA 2WXLA 4OHJA 4B0MA 3AE7B 2KWDA 1JWMD 3HVDA 4NJCA 4ZHOA 3PO0A 4C80A 3CIRB 1ZOYB 1FFUA 5EE3A 1XLNA 1VZ6A 1YMHE 2WNMA 5H92C 1C4CA 2JQRB 4LLGM 1N63A 3HRDD 1QLBB 4GDLB 3NUHB 1KRHA 2HTME 4JWUC 1I4RA 1PUTA 3ZJUA 4OZBA 2JZPA 5HFYA 2M0AA 3E56A 1E6EB 1MHHE 1AWDA 4JE3B 2WQYB 1YNTE 4P6VF 1VJKA 2QJLA 4YT0B 1TYGB 4KX6B 1L4ZB 1ZXIA 2E3TA 2L83A 5BYQA 2K5PA 2WU2B 3IAS1 3KLSX 1UWXA 3AE2B 4N58A 3J9CA 3W9CB 5HI1A 2IDYA 5LNK1 1V1OA 2IGDA 5BYRA 1YJIA 1I4QA 4RGTA 1XXGA 4RNAA 3MJ5A 2ICIA 1FCCC 1FM0D 2N9KA 2YEPB 2CJNA 1J7BA 2WXJA 4J3OD 4C7ZA 2I2YA 2PVOD 4AQ7A 3BIID 2K9XA 4WIPA 3Q8FA 3AE3B 3KQ4A 3P4QB 3VR9B 1FO4A 3BZDB 3R2IA 4TQ0A 2ZW0A 1L0YB 4YTPB 2BTEA 4TQ1A 1SE4A 2R61A 3MFGA 3BVGA 1FXIA 2CU3A 2L32A 1SEBD 2Y3AA 1HA5A 2VZKD 2E6XA 3MP9A 1NYRA 4YSYB 1D6EC 3GP7A 3AH7A 2M19A 2TSSA 3P42A 2H89B 3BVZA 1MHXA 4PT5A 1K50A 5G5GA 3AEGB 3IAM1 3IT6B 2WXIA 1GPXA 2AQ3B 2LMCA 4HKZE 1D5XC 1OQRA 2PKOA 4ZYSA 2WXKA 2QSDA 2AX5A 3W5VB 3ZQ4A 2FUG1 2W82A 3Q8BA 4WAFA 2WS3B 1L5PA 2KACA 1FEHA 1EWYC 1YN4A 1ZDVA 3P4SB 4YWGG 3TUOA 1GAQB 2BS2B 2ZW1A 4EE2A 2Z8LA 1HEZE 2WU5B 2V0GA 2QIEB 4FXCA 2V3PA 4RFBA 1N61A 1NI3A 1WWTA 1AN8A 1QF6A 4TSSA 2IGHA 3V3XA 2DBYA 2INNE 4RGNA 1ESFA 3TEZA 4C56C 2KMMA 5JXVA 2IGGA 2WXNA 2MJDA 4RGOS 1FNWA 3KWVA 1C78A 1P7EA 1PGBA 3RFZB 1UGJA 4KKIA 4YXDB 2JU6X 4YSZB 4OZAA 4LTUA 3N9YC 5C3JB 4DQOC 4ZRQA 1HXYD 4XWTA 1D5MC 1YJJA 1ZXHA 1XO3A 2XNAC 4WH4A 4HEA1 1NENB 3SFEB 2WXQA 1QT9A 1QOGA 1C4AA 2DYMA 5FK9C 4O1NA 1L4DB 1TKEA 2Y5CA 2ON8A 2QILA 3V05A 2X38A 4XDCA 1IUEA 1BUIC 2MEKA 3AMZA 2JX5A 3AB5A 1YQ3B 3U2SC 4US9A 2YEPF 1ROEA 2N0SB 1IBXB 4KGRA 1L6UA 1T5XD 3Q8EA 4H2AA 1JCKB 4RF0A 2JXTA 1KFYB 4MACA 3LXFA 1JQ4A 2BW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B9J A;  1VDV A;  2PVO D;  2M56 B;  4N6E B;  3EUB 2;  3BII D;  2K9X A;  1UWM A;  1DOY A;  4YTN B;  3AE3 B;  4WQM A;  3P4Q B;  3VR9 B;  1FO4 A;  3P63 A;  1JW9 D;  1RYJ A;  2B76 B;  1YQ4 B;  1F0Z A;  4YTP B;  1WGK A;  1KF6 B;  1XLP A;  2BT6 A;  3W5U B;  1E9M A;  3P1M A;  1FXI A;  2CU3 A;  1XLQ A;  4N59 A;  1TJE A;  1TKG A;  3FC4 A;  4ZOH C;  3NVY A;  1TKY A;  1QOA A;  1NVI D;  1NYR A;  5G5H A;  2WDV B;  4YSY B;  1L0V B;  3AH7 A;  2M19 A;  2ACZ B;  2MH7 A;  3AE9 B;  2H89 B;  2W54 A;  2EKI A;  4A9A A;  1QOB A;  1J7C A;  3B2G A;  5G5G A;  2BS3 B;  2MJE A;  3AEG B;  3AEF B;  3VR8 B;  4ZHP A;  3SFD B;  4C80 A;  1FFV A;  1GPX A;  1CZP A;  3HUI A;  4YSX B;  1OQR A;  2PKO A;  3LB8 C;  1B9R A;  1NEK B;  4C7Y A;  4HRS A;  2PVG C;  3AV8 A;  1A70 A;  1JWA D;  3AE4 B;  2AX5 A;  1RM6 C;  1JRP A;  3W5V B;  1I7H A;  1PDX A;  1OQQ A;  1QOF A;  5EE9 A;  1RWS A;  1N5X A;  5C2T B;  3RPF C;  3SR6 A;  1ZP0 B;  3AN1 A;  1R7S A;  1E10 A;  2MJ3 A;  2K22 A;  1FIQ A;  2WS3 B;  3ABV B;  3AEB B;  2OHF A;  5GXG B;  1L5P A;  3NS1 A;  1V97 A;  2H88 B;  5MPO A;  1EWY C;  1DOX A;  1T3Q A;  1E7P B;  2L52 A;  3P4R B;  3P4S B;  1NYQ A;  1V8C A;  2Q5W D;  2W3S A;  1JWB D;  1GAQ B;  1OFF A;  2BS2 B;  2LEK A;  1N60 A;  4ITK A;  1L6V A;  3AEC B;  1SIJ A;  2WU5 B;  2QIE B;  4FXC A;  3AE7 B;  4HRO A;  1N61 A;  1NI3 A;  1WWT A;  3NRZ A;  3NVV A;  1QF6 A;  1E0Z A;  4ZHO A;  1WRI A;  2BS4 B;  2DBY A;  3CIR B;  1JAL A;  2WDR B;  3PO0 A;  5EE0 A;  1ZOY B;  5AUI A;  1WXQ A;  1FFU A;  3AE5 B;  3AE6 B;  5H8Y E;  5EE3 A;  3ZYY X;  1SB3 C;  3AEE B;  3FAH A;  4USA A;  1XLN A;  5H92 C;  2KMM A;  2MJD A;  1XLO A;  3AED B;  2JQR B;  1N63 A;  2WLB A;  1AYF A;  3DWM A;  3HRD D;  1FRR A;  1QLB B;  1FXA A;  4YXD B;  1KRH A;  4YSZ B;  2HTM E;  4JWU C;  4LTU A;  1PUT A;  5C3J B;  5EE1 A;  2PIA A;  1SF0 A;  1DOI A;  3ETR A;  4YTM B;  3AE8 B;  1YJJ A;  3CWI A;  1XO3 A;  3P4P B;  1E6E B;  4IDI A;  3NVW A;  1ZUD 2;  1AWD A;  2FBW B;  4WWM A;  1NEN B;  2W3R A;  3KWL A;  3SFE B;  2WQY B;  1QT9 A;  1QOG A;  4P6V F;  1VJK A;  1DGJ A;  1PFD A;  1TYG B;  2QJL A;  3NVZ A;  4JWS C;  4YT0 B;  1TKE A;  4KX6 B;  5AUK A;  2Y5C A;  1ZXI A;  2E3T A;  2L83 A;  2K5P A;  2WU2 B;  3AE1 B;  3HVZ A;  1IUE A;  1WYG A;  2W55 A;  3AE2 B;  3AMZ A;  1JRO A;  4N58 A;  3VRA B;  2JX5 A;  2WP9 B;  3AB5 A;  1YQ3 B;  3W9C B;  1RFK A;  4US9 A;  2CJO A;  1ROE A;  3AM9 A;  2N0S B;  4JX1 C;  1N62 A;  4US8 A;  3DWG C;  1YJI A;  1L6U A;  1J7A A;  1N5W A;  2KAJ A;  3WCQ A;  1FRD A;  3AEA B;  1FM0 D;  3L4P A;  3B2F A;  1FMA D;  1KFY B;  1VLB A;  2CJN A;  2DWQ A;  1J7B A;  1CJE A;  2WDQ B;  3LXF A;  1JQ4 A;  4C7Z A;  3VRB B;  2G1E A; 
#chains in the Genus database with same CATH topology
 2RPV A;  4REZ A;  1FXT B;  1UUP A;  2B76 B;  5JHA A;  1Q1O A;  2HE7 A;  1KLU D;  2BT6 A;  3UQB A;  2JRI B;  2UYZ B;  1S3S G;  1XLQ A;  4II2 B;  1TKG A;  4ZOH C;  2PE6 B;  3ZIM A;  5L95 C;  5FKA C;  1SE3 A;  1TY2 A;  2JWU A;  1UEL A;  4W9L A;  1WY8 A;  2NMQ A;  3BIN A;  4A20 A;  1NEK B;  1FNV A;  1E5W A;  1S1Q B;  2AL3 A;  5EE9 A;  3T3O A;  3RCZ A;  1U4A A;  4JL9 A;  1WR1 A;  5AZH A;  3L16 A;  2C5L C;  4B6W A;  3TCA A;  3GS2 A;  2WX1 A;  3I57 A;  4AOF A;  3U8Z A;  1T6B X;  3EFU A;  1VZ8 A;  5AUI A;  1EU4 A;  5H8Y E;  3ZJT A;  3N3K B;  3FAH A;  1A5R A;  4UDU C;  3QQ8 B;  1I4X A;  1OQY A;  1XLO A;  1AYF A;  1WJU A;  2KKC A;  1EO6 A;  2NR2 A;  3CSF A;  4A8X C;  2KQS A;  1SF0 A;  1D4B A;  3ML9 A;  3CWI A;  5HHD G;  2LXA A;  1XCQ L;  2LUM A;  2N7J A;  3KWL A;  1R4N I;  2MHJ A;  2C7H A;  4WJP A;  5AUK A;  3VXW A;  1EF5 A;  2WXH A;  1N62 A;  4NAW B;  3T3N A;  4BKS A;  2FAZ A;  1YN5 A;  3WCQ A;  3DBH I;  2JRH A;  1FMA D;  2BBC A;  1H8C A;  3R3M A;  5FR3 A;  1HE8 A;  2M56 B;  3S2A A;  2MRP A;  4IG7 B;  3NOB A;  4DWF A;  5IN7 A;  3QIJ A;  4IKG A;  2D3C A;  4L23 A;  4IW0 A;  2RDG A;  2RDH A;  3W5U B;  4A55 A;  3W1S A;  1B1Z A;  3ZGZ A;  2FCM A;  2HJ8 A;  2K8C A;  2GBN A;  4DXG A;  1WH3 A;  3FKY A;  1BML C;  4XGA B;  2RGF A;  1F2R C;  4RM8 A;  4XWW A;  4C7Y A;  2LGS A;  3A9K B;  3DBR I;  1QKZ A;  1R7S A;  1XCT L;  5GXG B;  1WYW B;  4ARI A;  2AQ2 B;  1DOX A;  3OJ3 A;  2Z0E B;  4EOY A;  2MSE D;  1N60 A;  4L2Y A;  3NZ3 A;  3DHI C;  4OVZ A;  2LRU A;  5TSS A;  5EE0 A;  5DPS A;  3Q8A A;  1ZDX A;  2ZNV B;  1I4G A;  2PMV A;  5IP4 D;  2I1J A;  2C9W B;  5IO9 A;  1RFA A;  4XE0 A;  5IKC M;  2NBW B;  4FBJ B;  3EGR A;  2BYV E;  3NVW A;  1KLV A;  2W3R A;  2V3N A;  3NVZ A;  4HK2 A;  4HDO A;  1OGW A;  1UBQ A;  1J19 A;  4S17 A;  4MGI E;  3EA6 A;  5BMG A;  1HZ5 A;  2KAJ A;  2D07 B;  1KTK A;  2L0F A;  3PZ8 A;  2EKE C;  2WDQ B;  1STE A;  4HJG E;  4B9K A;  4DHJ B;  5CX3 A;  4OW0 A;  2R2O A;  3O13 A;  3A1Q B;  5DPR A;  1UWM A;  3PT2 B;  1DOY A;  4DDG D;  3APC A;  1GG3 A;  2FIF A;  3H1U A;  4RM9 A;  2MBH A;  3DHH C;  3L13 A;  4GDL A;  1JWS D;  4MEL A;  4DDI D;  3RNA C;  2MH7 A;  2QDF A;  2W54 A;  1YN3 A;  5D7G A;  2KLG A;  4A9A A;  2BB5 A;  4ZHP A;  2WXG A;  1C76 A;  1TS2 A;  3TEW A;  4G11 A;  2L8J A;  1HQR D;  3PLU A;  4FJV B;  4MJS B;  3C8Y A;  1VCB A;  3FIL A;  3I9V 1;  1WE7 A;  2G3Q B;  3APF A;  2V4I B;  4FLH A;  4P16 A;  1T0Y A;  1C77 A;  3R66 C;  2GB1 A;  1CQV A;  1V8C A;  2K3U A;  3RN9 C;  3ZDM C;  2IPK D;  2O6V D;  3W1Y A;  3AE7 B;  4ZHO A;  4C80 A;  4G0N B;  1E8W A;  1FFU A;  3RI7 C;  5EE3 A;  5AZF A;  1XLN A;  1VZ6 A;  1YMH E;  2WNM A;  4HLE A;  5IA7 A;  4PS8 A;  2JQR B;  1UD7 A;  1QLB B;  2JWZ A;  4GDL B;  3H9D A;  2V1Y A;  1E7U A;  2ZNV C;  4OVV A;  1VJK A;  1L4Z B;  2E3T A;  2K5P A;  4GB9 A;  4CHK A;  2M0X A;  3AE2 B;  4N58 A;  4HWI B;  3PSE B;  4DHJ D;  5BYR A;  5G55 A;  5KHQ A;  1YJI A;  3L08 A;  1WX9 A;  2ICI A;  4HJK A;  2YEP B;  2YLM A;  2ZZP B;  4J3O D;  2N9E B;  1T0Q C;  4C7Z A;  2Z0D B;  4II3 B;  1OEY A;  1P3Q U;  3DBL I;  1LGR A;  1R4N B;  1TBE A;  2M4N A;  3RT3 B;  2KC2 A;  3R2I A;  4LJP B;  4TQ0 A;  3HM3 A;  5GMV A;  4YTP B;  4TQ1 A;  4K7S A;  2L32 A;  1IYF A;  2Y3A A;  5DPW A;  1HA5 A;  1NYR A;  2RDB C;  3IG3 A;  3A4S C;  4AUQ C;  1E8X A;  1UZX B;  3DBH B;  3JVZ X;  5CTR C;  2KAN A;  3M95 A;  3AEG B;  3IAM 1;  2KJR A;  2LWP A;  2PKO A;  4F7Z A;  2LVQ A;  4GOC A;  4MGK E;  2FUG 1;  1WE6 A;  4JQW C;  3Q8B A;  2KAC A;  2L3Z A;  3R7Q A;  3JSV B;  5J2R A;  2N4F A;  2KLC A;  1GAQ B;  2UWQ A;  2V0G A;  3NJT A;  1X1M A;  5AEK B;  3UGB B;  4TSS A;  2IGH A;  1ESF A;  3VVW B;  3ZW3 A;  2KMM A;  5JXV A;  1I35 A;  4NPN A;  3DBR B;  1C78 A;  5J18 A;  2N7D A;  2DAJ A;  5BO4 B;  4YSZ B;  1NDD A;  3N9Y C;  4ZRQ A;  3DVG Y;  4XWT A;  1D5M C;  1ZXH A;  2XNA C;  4WH4 A;  2FCN A;  3KUD B;  2KNB A;  2K1F A;  2MBB B;  2ON8 A;  2QIL A;  3V05 A;  3RUI B;  1IUE A;  1V9J A;  3AMZ A;  4DXA B;  2KWU B;  3HHM A;  4KGR A;  4XYC A;  1L6U A;  1YX5 B;  1WGG A;  1V5T A;  1JQ4 A;  1XQQ A;  2DZM A;  2PTL A;  3TL5 A;  3N1X C;  1LM8 B;  4ZRI A;  1YD8 U;  2JYE A;  2FE8 A;  2KQ4 X;  2O2V A;  3NVY A;  1P98 A;  3URY A;  3T8M A;  4NQL B;  2BYE A;  2AYO B;  2I1K A;  2KQ7 A;  4ARC A;  1OEY J;  3N1Y C;  2PVG C;  3AV8 A;  4PK1 A;  1Y8R C;  1QOF A;  2IY0 B;  3BWU D;  4MDK E;  4GGQ A;  2WXF A;  2BKR B;  1LO5 D;  2G4S A;  1YIW A;  2LXC A;  2L7R A;  1K51 A;  1L6V A;  4BKT A;  3Q69 A;  4RCO A;  2BVC A;  3TJP A;  2RD0 A;  2BS4 B;  3RZF A;  4AWJ A;  1K52 A;  3GZN I;  3LYY A;  1CMX B;  3RMK C;  1VZ7 A;  3NS8 A;  3ZJV A;  3X23 A;  4WQO B;  5D94 A;  3DVN V;  1FXA A;  5E6J A;  1KH0 A;  3N1Z C;  4RH6 A;  3NZU A;  2LHE A;  3A9J A;  2UU7 A;  1WF9 A;  1WJ6 A;  1PFD A;  3BYT B;  2KWC A;  2ASQ A;  4JGH B;  2W55 A;  4BVU C;  1V2Y A;  2Z59 B;  5CHV C;  1J7A A;  3AU5 A;  4KIK A;  2XEW A;  3AEA B;  3L4P A;  3ZRF A;  5BYS A;  2K6D B;  4LK0 M;  1XT9 B;  2GOW A;  3RUL A;  3R2T A;  1C4P A;  3GB1 A;  3PZD A;  4TUU A;  3W2D A;  2JY6 A;  1LXD A;  1FD6 A;  2J42 A;  3A9J B;  3UF8 A;  4TMA B;  2EKI A;  2D5G A;  2K8B A;  2WXP A;  3KYD D;  4ZRK A;  2WYQ A;  3QA8 A;  3OG5 A;  3HUI A;  2GRI A;  4E3C A;  4HDQ A;  3DBL B;  2KOX A;  1A70 A;  1JWA D;  2WXR A;  1JRP A;  4DBG A;  1I7H A;  3ZLZ A;  1N5X A;  1ZP0 B;  1E10 A;  2AL6 A;  1Q0W B;  2GBM A;  4B0E A;  3BK2 A;  1TZ1 A;  2RPQ A;  2KDE B;  1TZO A;  1SE9 A;  3B08 A;  4K81 A;  3Q3F A;  1GB1 A;  3M63 B;  3NVV A;  3PRP B;  1XEE A;  2OJW A;  1V86 A;  1WX7 A;  3KVF B;  4FJY A;  3ZYY X;  3H8H A;  5I4D A;  1TS4 A;  2Y5B B;  2V9H A;  2J0M A;  1FCL A;  1C9F A;  3BYY B;  4AP4 C;  1Q10 A;  3QX1 A;  1Q5W B;  2KT7 A;  1SBB B;  4HXD A;  4JWS C;  4RF1 A;  3HVZ A;  5C1Z A;  1SJH D;  1WYG A;  2XBB C;  4KVG B;  3VRA B;  2WP9 B;  1J8C A;  3VUW A;  2IY1 B;  4FAD A;  3C0R B;  2JYT A;  2SEB D;  1N5W A;  2ZCC A;  1EM7 A;  1FRD A;  3TEX A;  5IOI A;  2NTT A;  3UIO B;  1I4H A;  1K53 A;  2G1E A;  2MP2 A;  4N6E B;  3VFK A;  2J4X A;  1EU3 A;  2DNF A;  4W9E A;  4IOI E;  3RYT A;  4WQM A;  1NBF C;  1RYJ A;  3GE8 C;  1YQ4 B;  1F0Z A;  4CO7 A;  4LNF A;  4KKJ A;  1PGA A;  2CHZ A;  2G9H D;  4LNO A;  1TJE A;  3FC4 A;  2KX0 A;  4W9C A;  2IBI B;  3V61 A;  3B1L X;  2MJE A;  2KN4 A;  1SSN A;  3VHT C;  2VH2 A;  1MPE A;  3LB8 C;  2CHX A;  3KYC D;  2A4Z A;  4FUL A;  2NVU I;  3E9S A;  3HK0 A;  4M8N A;  1TY0 A;  4ASW C;  3ZO5 B;  4ZYN A;  2OHF A;  4MM3 A;  2BB6 A;  4JLC A;  3RNB C;  3V60 A;  2H88 B;  2N7E A;  2SAK A;  1E7P B;  2WWZ A;  4NAM A;  3D32 A;  4WWN A;  4AS1 A;  4ITK A;  3QAR A;  3AEC B;  4OHJ A;  2MP2 B;  2NS5 A;  3HVD A;  4J6I A;  2BYF A;  1MFW A;  3PRE A;  3AU4 A;  3WAO A;  4P1B C;  1WR6 E;  1UGM A;  1N63 A;  3ZVV A;  3HRD D;  2BF8 B;  4JWU C;  3ZJU A;  2JZP A;  2M0A A;  4C4V A;  2GBK A;  2J7Q B;  2NBU A;  2QJL A;  1TYG B;  3L10 B;  3PRZ A;  2J0J A;  3OLM D;  2M1M A;  1WGY A;  2L83 A;  3IAS 1;  1UWX A;  1WXM A;  3W9C B;  2LGY A;  3GZN B;  5LNK 1;  2B3A A;  1V1O A;  1I4Q A;  4RGT A;  3GE3 C;  4RNA A;  3MJ5 A;  4HPP A;  4IM3 A;  3RNC C;  2CJN A;  1HTQ A;  2KDI A;  2I2Y A;  3SD5 A;  2G45 B;  3BY4 B;  4LDT B;  3H7S A;  5TR5 A;  3PV1 A;  3AE3 B;  3KQ4 A;  3P4Q B;  1FO4 A;  4A3P A;  5G2N A;  1PQS A;  2ZW0 A;  2KMC A;  1L0Y B;  2D2Q A;  2NBV B;  1KJT A;  1FXI A;  3PS6 A;  3L0W B;  3QJZ A;  2E6X A;  2LGD A;  3P42 A;  4HPM B;  2H89 B;  5EDS A;  5G5G A;  4B95 A;  3IT6 B;  2AQ3 B;  4HKZ E;  1D5X C;  4GMV A;  3WAP A;  2MW5 A;  2QSD A;  4IWP A;  1R4M I;  3VTV A;  3ZQ4 A;  1SIF A;  4MGZ E;  1L5P A;  2LVO A;  4MSM B;  1EWY C;  2K8H A;  4YWG G;  4IWQ A;  5LXI B;  4EE2 A;  2WU5 B;  3RD2 A;  1FPY A;  2CU1 A;  4RFB A;  2RSU A;  1NI3 A;  1AN8 A;  3I5J C;  1QF6 A;  4BKS D;  3I3T B;  2DBY A;  2AWT A;  4LJO B;  4WWP A;  3TEZ A;  1WMH A;  4RGO S;  3ZNH B;  3KWV A;  1P7E A;  2N1V A;  1UGJ A;  4OZA A;  5C3J B;  4KDI C;  1XO3 A;  4NY0 A;  1TT5 B;  4HEA 1;  4EZK A;  1NEN B;  2WXQ A;  1QT9 A;  2DYM A;  2IO3 B;  2Y5C A;  3U30 A;  2X38 A;  3DQV A;  3EFC A;  2X8X X;  4XDC A;  1BUI C;  2MEK A;  4GXB A;  1AAR A;  1WGH A;  3EC8 A;  4WWO A;  1YQ3 B;  3H7P A;  2YEP F;  1ROE A;  4LDT D;  5FR6 A;  5JH5 C;  1F52 A;  2N9P C;  4KZC A;  1KFY B;  1WRD B;  4I6N B;  4W9I A;  3W1S C;  3VDZ A;  3ZNI D;  1J0G A;  2BKF A;  2RMM A;  2FCS A;  2KVZ A;  4EFO A;  3TMP B;  2WDT B;  1V1P A;  3P63 A;  2ZVN A;  2PJH A;  1TS3 A;  2I38 A;  1E9M A;  3FIL B;  2WXO A;  3P1M A;  1BXT A;  1WSP A;  3PGE A;  3UIN B;  2LZ6 A;  3VR8 B;  2JZZ A;  1ZKH A;  4BKG A;  4XC2 A;  1B9R A;  1C3T A;  2HJ1 A;  2CHW A;  4W9F A;  4ACF A;  3H7P B;  4IC7 B;  4LNN A;  5D2M B;  1GC6 A;  4FHK A;  3IVF A;  2ONQ A;  1IPG A;  1ZE3 D;  2L05 A;  4MSQ B;  4OZC A;  1N6Z A;  4E74 A;  2W3S A;  2LEK A;  2NPT A;  4NJ7 A;  4CYE A;  2ZEQ A;  1WRI A;  5DCN A;  1JAL A;  2WDR B;  1C79 A;  2BWF A;  4A3O A;  2AQ1 B;  1SB3 C;  2JXX A;  4WUR A;  5BMI A;  1VRA B;  2LUE A;  3AED B;  2DEN B;  3RNF C;  2DLB A;  2WLB A;  3DWM A;  5HG2 A;  4HVB A;  1V6E A;  2CS4 A;  3U7Z A;  5EE1 A;  3ETR A;  2YVC A;  3TIX A;  3WA0 A;  3SHQ A;  1F9J A;  4IDI A;  4GN1 A;  2XK5 A;  2GBR A;  3ZRC A;  3ZDT A;  2LGI A;  3PHW B;  1XF5 L;  1C1Y B;  1JRO A;  1HTO A;  2KFK A;  1GB4 A;  1JRU A;  1WGD A;  3AM9 A;  5D3D A;  1ACC A;  3OWE B;  3M62 B;  4ZRP A;  2KDM A;  4D2K A;  2NTS A;  1PYW D;  2NPT B;  4ZDV A;  4ZRJ A;  4KV2 A;  3MHZ A;  3DVN U;  1TS5 A;  1SE2 A;  3R8B A;  1EF1 A;  1JWU D;  3VUY A;  4GU2 A;  2K0P A;  1T0R C;  4NZL B;  4BAX A;  2JF5 A;  2L00 B;  3VAW A;  3BVM A;  3C19 A;  2LHD A;  4F1S A;  3CMM B;  4AJW A;  1L0X B;  2PLP A;  3B2G A;  4F8C B;  2BYT A;  3AEF B;  3Q3O C;  2KN5 A;  1FFV A;  2QEJ C;  2OJR A;  3SU8 X;  3AE4 B;  1RM6 C;  4A6Q A;  3DBS A;  4Q2J A;  2BGF A;  3RPF C;  2GI9 A;  1P7F A;  1V80 A;  3NS1 A;  2HDE A;  1V97 A;  1T3Q A;  3RNG C;  1G6J A;  3IXS A;  1JWB D;  1WJN A;  4JIO U;  3WAM A;  1GC7 A;  1WIA A;  3WAN A;  3NRZ A;  2KX3 A;  1H4R A;  2CKH B;  3AE5 B;  3AE6 B;  4ICU A;  1KLG D;  1FNU A;  4USA A;  4R3D A;  2MCN B;  1R4M B;  4ANX A;  2M8S A;  3V6C B;  2PIA A;  4YTM B;  3AE8 B;  2HD5 B;  3ZNZ B;  2FBW B;  2KC1 A;  2IO1 B;  4W9H A;  3I63 C;  2N1W A;  2PE9 A;  3AE1 B;  5BMH A;  3EHV A;  3Q6B A;  4HKQ A;  4G3X B;  4PS7 A;  1MJD A;  1SJE D;  3BK1 A;  4JX1 C;  4K1R B;  5D3I B;  4EZL A;  3T9L A;  2O2V B;  3MC0 B;  2IJ0 A;  2JUO A;  3VRB B;  2REX A;  1VDV A;  2M17 A;  1Z5S B;  4TV3 A;  4PYU A;  2DYO A;  4YTN B;  2KVR A;  3MHS D;  4WJQ A;  4FA6 A;  1IBX A;  2CR5 A;  3O65 B;  4PS3 A;  1YX6 B;  3AXC A;  1KOT A;  1VD2 A;  1TKY A;  1QOA A;  5G5H A;  2DZJ A;  3AUL A;  2DX5 B;  2PEA A;  3AE9 B;  5KHO A;  3ZTC A;  1SXT A;  2C7N B;  4KSK C;  2MQJ A;  1CZP A;  3ECI A;  5AZG A;  1E90 A;  3JYU A;  2DAF A;  2XN9 C;  2IYD B;  2IO2 B;  1PDX A;  1RWS A;  4NQK E;  4KGT A;  3CF6 E;  1WZ3 A;  1PGX A;  5MPO A;  3PVL A;  1SIJ A;  2DZK A;  2WXL A;  1JWM D;  3PO0 A;  1BT0 A;  4YL8 A;  4BBN C;  1ZOY B;  4W9D A;  3N32 A;  2KHW B;  1C4C A;  4LLG M;  4MEM A;  1P9D U;  3Q3J A;  4M8M A;  4KIK B;  1I4R A;  1PUT A;  3HIZ A;  1QZE A;  3CST A;  3DHG C;  1UBI A;  2V3S A;  1E6E B;  1MHH E;  1AWD A;  3QK0 A;  3X0W A;  3OJ4 B;  2WQY B;  4P6V F;  3VH3 B;  1ZXI A;  4PYZ A;  2C7M B;  2WU2 B;  4BZA A;  3KLS X;  3MC9 A;  2MWS B;  5HI1 A;  2IGD A;  1FM0 D;  5DPT A;  4KSL C;  3N20 C;  2LAS A;  1K8R B;  4BOS C;  2WXJ A;  4KZ0 A;  3DOW A;  5LLI A;  3MJW A;  4MH0 E;  3BII D;  4AQ7 A;  4OVU A;  4WIP A;  3Q8F A;  4NNJ B;  3VR9 B;  5D6J B;  4W9K A;  1RAX A;  2KFJ A;  1SE4 A;  3MFG A;  4NAW A;  3BVG A;  3PPA A;  4YSY B;  1D6E C;  3GP7 A;  4BOZ B;  2TSS A;  3BVZ A;  1MHX A;  4PT5 A;  1E8Z A;  1GPX A;  2LMC A;  2JPH A;  2K6Q A;  3V6E B;  3WIM A;  2WXK A;  2AX5 A;  3KH0 A;  1GNU A;  4WAF A;  2KZR A;  1TGZ B;  2J0K A;  1FEH A;  1WFY A;  1YN4 A;  1WZ0 A;  1ZDV A;  1ISN A;  2JVC A;  2GLS A;  2BS2 B;  2ZW1 A;  2QIE B;  2V3P A;  2KD0 A;  1WWT A;  3PLV A;  3V3X A;  1V81 A;  2V4L A;  4K7U A;  3A9K A;  4C56 C;  4N9F 4;  2IGG A;  2WXN A;  2MJD A;  3V62 A;  1FNW A;  2KXJ A;  4KKI A;  4XX5 A;  2JU6 X;  3VH4 B;  1WGR A;  4MGY E;  1ZW7 A;  2C60 A;  5L83 A;  4IM2 A;  1L4D B;  4O1N A;  3ML8 A;  5C23 A;  3VUX A;  2MA9 B;  2JX5 A;  2O6V A;  3QAQ A;  4US9 A;  4X57 B;  2LVP A;  4I6P A;  2WX0 A;  1T5X D;  1M94 A;  3Q3N C;  3QHT A;  1JCK B;  4RF0 A;  2JXT A;  4ANV A;  2LGX A;  2D3B A;  3QC8 B;  3B9J A;  2J52 A;  2A5U A;  5IAA C;  2NCN A;  2VH1 A;  3TBL D;  1NI2 A;  2DYB A;  1WGK A;  1KF6 B;  2LJI A;  3ZXR A;  4MM3 B;  4N59 A;  3ZTD A;  3ZNG C;  1NVI D;  1TTN A;  1WM3 A;  4CQN A;  1QOB A;  4ICV A;  1WXS A;  1CK1 A;  1P0R A;  1SGH A;  3SFD B;  2JZ3 B;  3A1Q A;  2INP E;  3IBE A;  3PHX B;  4HRS A;  3Q2A C;  1D5Z C;  4WJN A;  1AW7 A;  1OQQ A;  2O6V B;  3SR6 A;  1VR9 A;  2EEL A;  3AEB B;  3ABV B;  1QQR A;  2QHO A;  3KW5 B;  4MT5 A;  2ZPY A;  2MBE A;  4M00 A;  3IT4 B;  4DXF A;  2J53 A;  5E6O A;  1NYQ A;  4GLS C;  3U4E G;  1OFF A;  4FHJ A;  1WXV A;  2N9X A;  4C4V B;  5J17 A;  1E0Z A;  4IM0 A;  1WXQ A;  2GMI C;  2N9L A;  4HCP B;  4LNI A;  4MJS A;  1UNS A;  2QCZ A;  4GDK A;  2W9N A;  1GJZ A;  1KM7 A;  4FJZ A;  1WM2 A;  3UQA A;  4KGS A;  1Z2M A;  3A33 B;  1D3Z A;  1WX8 A;  1ZUD 2;  4W9G A;  3UIP B;  1MVK A;  4XDD A;  3KUZ A;  3N30 A;  4M0W A;  1RRB A;  4RMA A;  5E6N A;  1EUV B;  3NY5 A;  4US8 A;  1ET6 A;  4EUT A;  4MH8 A;  5T8I A;  4QAY A;  3B2F A;  2IND C;  2DWQ A;  4TKN A;  1QIL A;  3EUB 2;  3M3J A;  2VRR B;  2BPS A;  1V49 A;  1JW9 D;  4GDK B;  4M02 A;  3ENE A;  1HZ6 A;  5CHF A;  2LJ5 A;  3RNE C;  1L0V B;  3DCG A;  2ACZ B;  3SEB A;  4WAA A;  1IGC A;  1EWC A;  1YOV B;  3RZW C;  3Q14 C;  1RLF A;  3R7R A;  1F1H A;  4M0W B;  4YSX B;  3DVG X;  1L7Y A;  2KO3 A;  2LRW A;  4IUM B;  2WHI A;  1I4P A;  3AN1 A;  1WMH B;  2MJ3 A;  1DYQ A;  1FIQ A;  3QCA A;  3QWZ B;  1E8Y A;  4BFR A;  2L52 A;  4DHZ B;  2QMT A;  2Q5W D;  4G50 A;  1IP9 A;  4L1B A;  2KJH B;  3MC8 A;  4HRO A;  3VQI A;  1M4V A;  2L76 A;  3AEE B;  2QC8 A;  1T0S C;  2IO0 B;  2JT4 B;  2PPH A;  1LQB A;  4EEW A;  4XZ4 A;  1ENF A;  4DK5 A;  2L1A A;  1FRR A;  3JSV A;  3PZ7 A;  1WJ4 A;  3TEY A;  4A90 A;  1F77 A;  2WGS A;  1DOI A;  2Y5P A;  2FCQ A;  3P4P B;  1MI0 A;  2LFI A;  2AEH A;  2KTR A;  3ONS A;  4WWM A;  2ZCB A;  4M01 A;  1DGJ A;  3UI3 A;  2RR9 A;  2EMS A;  3ZUN A;  3WAL A;  1Y56 A;  1V1P B;  1RFK A;  2CJO A;  1WI0 A;  1E7V A;  3DWG C;  3U52 E;  2D3A A;  2R2Q A;  5JZE B;  3Q8C A;  1F2R I;  1ZGU B;  4ANU A;  1VLB A;  1CJE A;  1GOZ A;  3SDL C;  2HTH A;  3KUC B;  4ANW A;  3NG0 A;  2ZPN A;  1XLP A;  1TIF A;  4URK A;  3A4R A;  2OED A;  2WXM A;  2WDV B;  2LD9 A;  4FN2 A;  1J7C A;  2KTR B;  2BS3 B;  3TSS A;  4LNK A;  2VZK B;  1OTR B;  2KK8 A;  1MG8 A;  3AI5 A;  1UF0 A;  5C2T B;  2K22 A;  2GBJ A;  4BBN F;  1UH6 A;  3LJ3 A;  1ZPS A;  4JPS A;  2JSV X;  1JML A;  2PW9 A;  2FID A;  4NJ6 A;  1IGD A;  2G4D B;  3P4R B;  3B0A A;  4RGM A;  4KDL B;  1ET9 A;  3ZKJ C;  2FNJ B;  2KYW A;  2XK5 B;  4B0M A;  2KWD A;  2MLB A;  4LCD E;  4NJC A;  3CIR B;  5H92 C;  2KFK B;  2DHZ A;  2DZI A;  3EEC A;  3NUH B;  1KRH A;  2HTM E;  4GIV A;  4EZJ A;  4OZB A;  3VTW A;  5HFY A;  2OOB B;  3E56 A;  3NZS A;  4JE3 B;  1YNT E;  4YT0 B;  3NHE B;  2MBQ A;  4KX6 B;  4AJY B;  2BQQ A;  3IHP C;  3U7D A;  5BYQ A;  1XD3 B;  1L2N A;  3P2B A;  3J9C A;  1YQB A;  2IDY A;  2INC C;  2LI5 A;  2ZJD A;  1XXG A;  2MBO A;  2BWE S;  1FCC C;  2L0T A;  2N9K A;  1J7B A;  3OAW A;  3DDC B;  3PTF C;  5CHW A;  2IZV B;  2PVO D;  3PRM B;  4K7W A;  2K9X A;  4P7I A;  3BZD B;  3Q3M C;  2BTE A;  2R61 A;  2CU3 A;  5LXH A;  3HM6 X;  1SEB D;  4P1C C;  2D10 A;  2VZK D;  3MP9 A;  3AH7 A;  2M19 A;  1YJ1 A;  3MTN B;  1K50 A;  2WXI A;  5HKH A;  1OQR A;  1V5O A;  4ZYS A;  3DPD A;  3W5V B;  4K3B A;  3L54 A;  1I42 A;  2W82 A;  2WS3 B;  3K9P B;  2ZVO A;  3H6N A;  4EKU A;  1LFD A;  3P4S B;  3TUO A;  3ALB A;  3IFW B;  2Z8L A;  2FUH B;  1HEZ E;  1WXA A;  4FXC A;  2K39 A;  3JW0 X;  1N61 A;  2KJ6 A;  3LDZ E;  2INN E;  4RGN A;  2KTF A;  3L17 A;  2KDB A;  4HPL B;  1P1A A;  2D11 A;  1PGB A;  3RFZ B;  2D3G A;  3VTU A;  3K9O B;  4YXD B;  2K25 A;  4E71 A;  2KDF B;  4LTU A;  2EMT A;  4DQO C;  3ZXV A;  1HXY D;  1YJJ A;  4K3C A;  2MX2 A;  3SFE B;  3GOE A;  1QOG A;  1C4A A;  5FK9 C;  4HCN B;  1TKE A;  4C00 A;  2KMA A;  4IWO A;  4W9J A;  3AB5 A;  3U2S C;  1MG4 A;  2KWV B;  2N0S B;  1IBX B;  4DHZ E;  5E6P A;  3Q8E A;  4H2A A;  5JHB A;  3APD A;  4S0R A;  4I6L B;  4MAC A;  3LXF A;  1GUA B;  2BW2 A;  4WJO A;  4GSW A; 
#chains in the Genus database with same CATH homology
 3B9J A;  2J52 A;  2RPV A;  4REZ A;  2RMM A;  1UUP A;  1V1P A;  3P63 A;  2PTL A;  2B76 B;  1TS3 A;  2I38 A;  1KLU D;  1WGK A;  1KF6 B;  2BT6 A;  2LJI A;  1E9M A;  3FIL B;  2WXO A;  3P1M A;  1BXT A;  1XLQ A;  1WSP A;  2JYE A;  4MM3 B;  4N59 A;  2FE8 A;  2KQ4 X;  1TKG A;  4ZOH C;  3NVY A;  1NVI D;  5FKA C;  1SE3 A;  1TY2 A;  4CQN A;  1QOB A;  2JWU A;  3URY A;  3VR8 B;  1CK1 A;  3SFD B;  2NMQ A;  2INP E;  4ARC A;  1B9R A;  1NEK B;  4HRS A;  2PVG C;  1FNV A;  3AV8 A;  1D5Z C;  1AW7 A;  1OQQ A;  1QOF A;  5EE9 A;  3T3O A;  3SR6 A;  1VR9 A;  3BWU D;  2EEL A;  3AEB B;  3ABV B;  1QQR A;  2WXF A;  4MT5 A;  1LO5 D;  2ONQ A;  1ZE3 D;  3IT4 B;  4DXF A;  2J53 A;  4OZC A;  1NYQ A;  4GLS C;  2W3S A;  3U4E G;  3GS2 A;  1OFF A;  2LEK A;  1K51 A;  1L6V A;  3I57 A;  3Q69 A;  4RCO A;  1T6B X;  1E0Z A;  1WRI A;  1VZ8 A;  2BS4 B;  5AUI A;  1JAL A;  2WDR B;  1C79 A;  1EU4 A;  1WXQ A;  2N9L A;  5H8Y E;  2AQ1 B;  3ZJT A;  1SB3 C;  4WUR A;  1K52 A;  3FAH A;  3LYY A;  1UNS A;  4UDU C;  5BMI A;  1VRA B;  1I4X A;  1VZ7 A;  1XLO A;  3AED B;  3ZJV A;  2DLB A;  2WLB A;  1AYF A;  3DWM A;  5HG2 A;  1FXA A;  4A8X C;  5E6J A;  1KH0 A;  4RH6 A;  4KGS A;  2LHE A;  3U7Z A;  5EE1 A;  1SF0 A;  3ETR A;  1D4B A;  3CWI A;  5HHD G;  1XCQ L;  4IDI A;  1ZUD 2;  2LUM A;  2N7J A;  3KWL A;  1MVK A;  4XDD A;  3BYT B;  1PFD A;  2LGI A;  4M0W A;  5AUK A;  1XF5 L;  2W55 A;  1JRO A;  1GB4 A;  2WXH A;  3AM9 A;  1N62 A;  4US8 A;  1ET6 A;  4NAW B;  3T3N A;  5D3D A;  1ACC A;  4MH8 A;  1J7A A;  3OWE B;  5T8I A;  4ZRP A;  1YN5 A;  3WCQ A;  3AEA B;  2KDM A;  3L4P A;  3B2F A;  1FMA D;  2BBC A;  4D2K A;  2DWQ A;  2NTS A;  1PYW D;  5BYS A;  5FR3 A;  4LK0 M;  1QIL A;  2M56 B;  3EUB 2;  3R2T A;  1C4P A;  3MHZ A;  1TS5 A;  1SE2 A;  3GB1 A;  4IKG A;  3R8B A;  1JWU D;  1JW9 D;  2K0P A;  2RDG A;  4GDK B;  4L23 A;  1HZ6 A;  2RDH A;  4NZL B;  3W2D A;  3W5U B;  4A55 A;  3W1S A;  1B1Z A;  3ZGZ A;  3BVM A;  1FD6 A;  2J42 A;  2LHD A;  1L0V B;  2ACZ B;  3SEB A;  1IGC A;  1EWC A;  2EKI A;  2D5G A;  4TMA B;  4DXG A;  1L0X B;  2PLP A;  2WXP A;  3B2G A;  2BYT A;  3AEF B;  1FFV A;  1BML C;  2QEJ C;  3HUI A;  1F2R C;  4YSX B;  2GRI A;  4XWW A;  4C7Y A;  1A70 A;  1JWA D;  3AE4 B;  1RM6 C;  1JRP A;  2WXR A;  1I7H A;  4A6Q A;  4Q2J A;  3RPF C;  1N5X A;  1I4P A;  1ZP0 B;  1QKZ A;  1R7S A;  1XCT L;  3AN1 A;  1E10 A;  2MJ3 A;  1DYQ A;  1FIQ A;  5GXG B;  2GI9 A;  4ARI A;  1P7F A;  2AQ2 B;  3NS1 A;  2HDE A;  1V97 A;  1DOX A;  1T3Q A;  2L52 A;  4B0E A;  2QMT A;  2Q5W D;  3BK2 A;  3IXS A;  1JWB D;  1N60 A;  4L2Y A;  4L1B A;  1TZO A;  3NZ3 A;  4HRO A;  1GB1 A;  3NRZ A;  3VQI A;  3NVV A;  4OVZ A;  1XEE A;  5TSS A;  5EE0 A;  1M4V A;  3AE5 B;  3AE6 B;  3ZYY X;  3AEE B;  3H8H A;  1KLG D;  1FNU A;  3Q8A A;  4USA A;  5I4D A;  4R3D A;  1TS4 A;  1ZDX A;  1ENF A;  2L1A A;  1I4G A;  1FRR A;  2PMV A;  3PZ7 A;  3TEY A;  4A90 A;  1FCL A;  1C9F A;  4XE0 A;  1F77 A;  2PIA A;  1DOI A;  3BYY B;  4YTM B;  2Y5P A;  3AE8 B;  3P4P B;  1Q10 A;  1MI0 A;  2LFI A;  3EGR A;  3NVW A;  2FBW B;  4WWM A;  2W3R A;  1SBB B;  1DGJ A;  2V3N A;  3NVZ A;  4JWS C;  4RF1 A;  3UI3 A;  3HVZ A;  3AE1 B;  5BMH A;  1SJH D;  1Y56 A;  1V1P B;  1WYG A;  3VRA B;  2WP9 B;  4HKQ A;  1RFK A;  2CJO A;  1SJE D;  3BK1 A;  4JX1 C;  3EA6 A;  5BMG A;  3DWG C;  2JYT A;  1HZ5 A;  2SEB D;  5D3I B;  1N5W A;  2KAJ A;  3U52 E;  1KTK A;  1EM7 A;  1FRD A;  3Q8C A;  1F2R I;  3MC0 B;  2IJ0 A;  1VLB A;  3TEX A;  1CJE A;  3PZ8 A;  1GOZ A;  2NTT A;  2WDQ B;  1STE A;  3VRB B;  1I4H A;  4HJG E;  1K53 A;  2G1E A;  1VDV A;  4OW0 A;  4N6E B;  2J4X A;  3O13 A;  1EU3 A;  1UWM A;  1DOY A;  2DYO A;  4YTN B;  4IOI E;  4WQM A;  1RYJ A;  1YQ4 B;  1F0Z A;  1XLP A;  1IBX A;  4KKJ A;  1PGA A;  2G9H D;  2OED A;  1TJE A;  2WXM A;  3FC4 A;  1TKY A;  1QOA A;  1JWS D;  5G5H A;  2WDV B;  2MH7 A;  3AE9 B;  2W54 A;  1SXT A;  1YN3 A;  5D7G A;  4A9A A;  1J7C A;  2BB5 A;  4ZHP A;  2BS3 B;  2MJE A;  2WXG A;  2KN4 A;  1SSN A;  3TSS A;  1CZP A;  1C76 A;  1MPE A;  3LB8 C;  2VZK B;  1TS2 A;  2XN9 C;  3TEW A;  1HQR D;  1PDX A;  3E9S A;  1RWS A;  3C8Y A;  5C2T B;  4KGT A;  1TY0 A;  3FIL A;  2K22 A;  3I9V 1;  2OHF A;  2V4I B;  1ZPS A;  2BB6 A;  4JPS A;  2JSV X;  1JML A;  2PW9 A;  4P16 A;  1C77 A;  1IGD A;  1PGX A;  2H88 B;  2SAK A;  2GB1 A;  5MPO A;  1E7P B;  3P4R B;  4RGM A;  1CQV A;  4NAM A;  1V8C A;  1ET9 A;  2K3U A;  4AS1 A;  4ITK A;  2IPK D;  3AEC B;  1SIJ A;  2WXL A;  4OHJ A;  4B0M A;  3AE7 B;  2KWD A;  1JWM D;  3HVD A;  4NJC A;  4ZHO A;  3PO0 A;  4C80 A;  3CIR B;  1ZOY B;  1FFU A;  5EE3 A;  1XLN A;  1VZ6 A;  1YMH E;  2WNM A;  5H92 C;  1C4C A;  2JQR B;  4LLG M;  1N63 A;  3HRD D;  1QLB B;  4GDL B;  3NUH B;  1KRH A;  2HTM E;  4JWU C;  1I4R A;  1PUT A;  3ZJU A;  4OZB A;  2JZP A;  5HFY A;  2M0A A;  3E56 A;  1E6E B;  1MHH E;  1AWD A;  4JE3 B;  2WQY B;  1YNT E;  4P6V F;  1VJK A;  2QJL A;  4YT0 B;  1TYG B;  4KX6 B;  1L4Z B;  1ZXI A;  2E3T A;  2L83 A;  5BYQ A;  2K5P A;  2WU2 B;  3IAS 1;  3KLS X;  1UWX A;  3AE2 B;  4N58 A;  3J9C A;  3W9C B;  5HI1 A;  2IDY A;  5LNK 1;  1V1O A;  2IGD A;  5BYR A;  1YJI A;  1I4Q A;  4RGT A;  1XXG A;  4RNA A;  3MJ5 A;  2ICI A;  1FCC C;  1FM0 D;  2N9K A;  2YEP B;  2CJN A;  1J7B A;  2WXJ A;  4J3O D;  4C7Z A;  2I2Y A;  2PVO D;  4AQ7 A;  3BII D;  2K9X A;  4WIP A;  3Q8F A;  3AE3 B;  3KQ4 A;  3P4Q B;  3VR9 B;  1FO4 A;  3BZD B;  3R2I A;  4TQ0 A;  2ZW0 A;  1L0Y B;  4YTP B;  2BTE A;  4TQ1 A;  1SE4 A;  2R61 A;  3MFG A;  3BVG A;  1FXI A;  2CU3 A;  2L32 A;  1SEB D;  2Y3A A;  1HA5 A;  2VZK D;  2E6X A;  3MP9 A;  1NYR A;  4YSY B;  1D6E C;  3GP7 A;  3AH7 A;  2M19 A;  2TSS A;  3P42 A;  2H89 B;  3BVZ A;  1MHX A;  4PT5 A;  1K50 A;  5G5G A;  3AEG B;  3IAM 1;  3IT6 B;  2WXI A;  1GPX A;  2AQ3 B;  2LMC A;  4HKZ E;  1D5X C;  1OQR A;  2PKO A;  4ZYS A;  2WXK A;  2QSD A;  2AX5 A;  3W5V B;  3ZQ4 A;  2FUG 1;  2W82 A;  3Q8B A;  4WAF A;  2WS3 B;  1L5P A;  2KAC A;  1FEH A;  1EWY C;  1YN4 A;  1ZDV A;  3P4S B;  4YWG G;  3TUO A;  1GAQ B;  2BS2 B;  2ZW1 A;  4EE2 A;  2Z8L A;  1HEZ E;  2WU5 B;  2V0G A;  2QIE B;  4FXC A;  2V3P A;  4RFB A;  1N61 A;  1NI3 A;  1WWT A;  1AN8 A;  1QF6 A;  4TSS A;  2IGH A;  3V3X A;  2DBY A;  2INN E;  4RGN A;  1ESF A;  3TEZ A;  4C56 C;  2KMM A;  5JXV A;  2IGG A;  2WXN A;  2MJD A;  4RGO S;  1FNW A;  3KWV A;  1C78 A;  1P7E A;  1PGB A;  3RFZ B;  1UGJ A;  4KKI A;  4YXD B;  2JU6 X;  4YSZ B;  4OZA A;  4LTU A;  3N9Y C;  5C3J B;  4DQO C;  4ZRQ A;  1HXY D;  4XWT A;  1D5M C;  1YJJ A;  1ZXH A;  1XO3 A;  2XNA C;  4WH4 A;  4HEA 1;  1NEN B;  3SFE B;  2WXQ A;  1QT9 A;  1QOG A;  1C4A A;  2DYM A;  5FK9 C;  4O1N A;  1L4D B;  1TKE A;  2Y5C A;  2ON8 A;  2QIL A;  3V05 A;  2X38 A;  4XDC A;  1IUE A;  1BUI C;  2MEK A;  3AMZ A;  2JX5 A;  3AB5 A;  1YQ3 B;  3U2S C;  4US9 A;  2YEP F;  1ROE A;  2N0S B;  1IBX B;  4KGR A;  1L6U A;  1T5X D;  3Q8E A;  4H2A A;  1JCK B;  4RF0 A;  2JXT A;  1KFY B;  4MAC A;  3LXF A;  1JQ4 A;  2BW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...