3B2FA

Maize ferredoxin 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-1, chloroplastic
publication title A new structural insight into differential interaction of cyanobacterial and plant ferredoxins with nitrite reductase as revealed by NMR and X-ray crystallographic studies
pubmed doi rcsb
source organism Zea mays
molecule tags Electron transport
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3b2fA00
4US9A 4LTUA 4YTNB 4C7YA 1FRRA 3HRDD 3PO0A 2DWQA 3NVWA 1QF6A 1JW9D 3B9JA 1NI3A 4HRSA 5C2TB 2WDQB 1L6VA 2WDRB 2WP9B 1E10A 1N5XA 1J7CA 1B9RA 1N60A 1DOIA 2Y5CA 1RFKA 1QOBA 3FC4A 1AYFA 1I7HA 3P4PB 5EE3A 5AUIA 1FXAA 5GXGB 1CJEA 2M19A 2PIAA 2EKIA 2BT6A 2K5PA 1N62A 2PVOD 1ZP0B 1E7PB 3VR9B 2N0SB 4N6EB 1TKEA 5G5GA 4US8A 3NVVA 1E9MA 1EWYC 1FFVA 2WU2B 3VRAB 4KX6B 1ZOYB 2MJEA 3FAHA 5EE9A 1NEKB 4JWSC 1J7BA 1FMAD 1WXQA 4HROA 3AE2B 1JQ4A 1FM0D 4YSYB 3P1MA 3W5VB 2WLBA 3AEGB 1PUTA 3NVZA 1NENB 1SIJA 1VLBA 2BS2B 3LB8C 2HTME 3AMZA 3AE6B 3DWMA 1N63A 1QOAA 1UWMA 1VJKA 3AN1A 4JX1C 2QJLA 3ABVB 2W55A 1GPXA 2W54A 2CJNA 1E6EB 1PFDA 4YTMB 2BS3B 3HVZA 4ZHOA 4ZHPA 3AE7B 4P6VF 3B2GA 1QOFA 1DOXA 2B76B 1QOGA 1VDVA 2L52A 5H92C 2QIEB 4N58A 1YJIA 2KAJA 3P4RB 2JQRB 3CIRB 2MH7A 3AM9A 4FXCA 1A70A 2Q5WD 1L0VB 1V8CA 3WCQA 2G1EA 2WS3B 2AX5A 1FIQA 1SB3C 3NVYA 1RYJA 1DOYA 3W5UB 1GAQB 3ETRA 3P4SB 1WRIA 3AB5A 1CZPA 1RWSA 1L5PA 1OQQA 1WGKA 2PVGC 1J7AA 2WDVB 3CWIA 4YSXB 3AEEB 1QLBB 1R7SA 3NS1A 1IUEA 1V97A 3P4QB 1TKYA 1L6UA 1FFUA 3AH7A 4YSZB 4YXDB 1DGJA 1AWDA 3AV8A 1N61A 2CU3A 3VR8B 3AE3B 1FRDA 2OHFA 2JX5A 1T3QA 2W3SA 3AEDB 4ZOHC 3KWLA 3HUIA 5C3JB 1PDXA 1YQ3B 2M56B 2E3TA 4JWUC 3AE4B 3AE1B 3AECB 1KF6B 3SFEB 2ACZB 1TKGA 2H88B 3L4PA 1NYRA 2LEKA 4C7ZA 1FO4A 1N5WA 1QT9A 2K9XA 1WYGA 3W9CB 1XO3A 1ZXIA 1KRHA 1JWAD 1TYGB 5G5HA 2WQYB 2MJDA 4ITKA 3SFDB 1ZUD2 3AEBB 1OFFA 1NYQA 1JROA 4YT0B 3RPFC 1XLOA 2BS4B 2L83A 1YQ4B 1OQRA 4C80A 4A9AA 3P63A 1JALA 1TJEA 1SF0A 5MPOA 3DWGC 1RM6C 1WWTA 1E0ZA 1FXIA 3LXFA 3ZYYX 5AUKA 1ROEA 2K22A 5EE1A 3BIID 5EE0A 3SR6A 2MJ3A 4WQMA 4N59A 3VRBB 1F0ZA 1KFYB 3AE5B 2W3RA 3AEAB 4USAA 4YTPB 3B2FA 5H8YE 1XLQA 2KMMA 3AE9B 1XLNA 2PKOA 3AE8B 2DBYA 2WU5B 2FBWB 3NRZA 1JWBD 4WWMA 2H89B 1XLPA 3EUB2 1NVID 3AEFB 2CJOA 4IDIA 1JRPA 1YJJA
chains in the Genus database with same CATH superfamily
1GUAB 1JW9D 3B9JA 3PT2B 1ZW7A 1WYWB 1DOIA 2CHWA 1V5OA 2JRIB 2YVCA 1BXTA 1YOVB 1E9MA 1C78A 4R3DA 1MPEA 1FMAD 1V49A 1FCCC 1Y56A 2RDBC 2LXCA 3NVZA 2WX1A 3OLMD 1KTKA 3HM3A 3AE6B 1I4QA 4IKGA 4JX1C 1AARA 2CJNA 3U4EG 4KGRA 3RI7C 4P6VF 2IGHA 1A70A 3M62B 1YX5B 3ETRA 2BKFA 2R61A 3RMKC 2DENB 5E6JA 2BB6A 4LNKA 2B3AA 1BMLC 2AQ3B 4MSMB 1L2NA 2WXOA 2JF5A 4NQLB 1I4HA 3CSFA 1V6EA 1KF6B 1SGHA 2WDTB 1OQYA 1MJDA 3W9CB 1XO3A 2BYVE 1MHXA 1P98A 3UQAA 1XLOA 2Z8LA 4ZRIA 4C80A 1SF0A 5HFYA 3ECIA 2LJ5A 4BZAA 1RAXA 3PRZA 1C79A 3DHGC 2WXNA 3V05A 3DBLB 2OEDA 2PKOA 3NS8A 4WJOA 2L0TA 1YN4A 4W9EA 3FILB 3BVZA 1IGDA 1R4NI 2H89B 3APDA 1WR1A 3KUZA 4B0EA 1YNTE 2K8BA 3LDZE 2PEAA 2PTLA 2WXQA 4KVGB 1UH6A 1B9RA 1QOBA 4PS8A 3E56A 4W9KA 2J7QB 4NAMA 4M00A 4G0NB 3PRMB 1EWYC 3VRAB 2MJEA 2C60A 4WURA 4BKGA 1WGHA 4ANXA 1FNWA 1N63A 2MP2A 3ML9A 2QJLA 3ABVB 2BYTA 1PFDA 4A8XC 3ZVVA 4JPSA 1I42A 2ZCBA 2QIEB 1SE2A 1N6ZA 1IP9A 4ZRQA 1L0VB 2NBUA 2ASQA 1SB3C 2KTRB 1RYJA 3V61A 3MC8A 1WRIA 1WGKA 2LI5A 4I6NB 2JWZA 2KD0A 1TKYA 4K81A 1SE3A 1EF5A 1Q0WB 2KC1A 2W3SA 5D7GA 3BZDB 4GMVA 5AZHA 2M17A 3IT4B 3AE4B 3AECB 2CR5A 3BINA 2BWFA 4PS3A 3RNCC 4ANUA 4C7ZA 4KZCA 4MJSB 2BS4B 1V86A 1X1MA 1WIAA 1B1ZA 3ZTDA 4B95A 3JSVB 1XEEA 2MBOA 1GB1A 3QIJA 1C1YB 2D11A 2DHZA 2G4DB 4DDGD 2JY6A 1XF5L 4OVZA 5AZFA 4GIVA 2NBWB 2N7EA 3R7RA 4A20A 3H8HA 1YN5A 4ZDVA 2AL3A 2KXJA 1WZ0A 3N9YC 4NY0A 4MH0E 1V9JA 1FRRA 3ZKJC 4WH4A 2AQ1B 5KHQA 4AQ7A 1DYQA 3FKYA 2PIAA 3M63B 1ZP0B 4IWOA 3NJTA 1L7YA 4KKJA 2NR2A 2WU2B 3FAHA 1KOTA 1WXQA 2LFIA 3RN9C 2FCMA 2KOXA 3MFGA 3I63C 1TZ1A 1HZ6A 3H7PB 2MA9B 1WJ6A 4KV2A 2FCQA 1OEYJ 1WGDA 3AN1A 1VJKA 3R3MA 1GPXA 3VTVA 4FJYA 4PYZA 1P7FA 5C1ZA 2AL6A 1DOXA 2B76B 3ZRCA 5IA7A 4JIOU 5AEKB 4N58A 2LGYA 4JE3B 3UIPB 3V6EB 5FR3A 2JT4B 2AX5A 4ICVA 3BVGA 1L5PA 1RWSA 1OQQA 2BBCA 3AEEB 4ZRPA 5BMGA 3P42A 3KVFB 5D94A 3P4QB 2LGXA 4GDKB 2WGSA 3TMPB 2KANA 4ICUA 2G3QB 2J52A 3N32A 5FR6A 3Q3FA 5G2NA 2CU1A 2K9XA 1WE6A 2KYWA 1ZXIA 1CQVA 3OWEB 2BQQA 1ZPSA 1TIFA 4L23A 1C3TA 2GRIA 1H8CA 2L83A 1ESFA 1ENFA 2CHXA 2ZEQA 3GZNI 3P63A 4W9GA 1RLFA 3VUWA 2BGFA 3ZYYX 4KSKC 4XZ4A 2MLBA 5AUKA 4KDLB 5EE1A 5EE0A 1EM7A 3R66C 4WWPA 2BYFA 4K3CA 2GBKA 3MC9A 2FIDA 4W9HA 3QJZA 2FBWB 2BPSA 3LJ3A 4RM9A 1L4ZB 2GB1A 3EUB2 1WM3A 3VR8B 4BAXA 3T3NA 1YJ1A 4WJQA 3ZW3A 4IW0A 3L17A 1RFKA 4RGTA 5AUIA 4MJSA 4II2B 1E7PB 1LO5D 2WXRA 4KX6B 3PV1A 4HROA 3JSVA 1C77A 4O1NA 3AI5A 4X57B 2V4IB 3N1ZC 3AMZA 2D10A 2V3PA 1FNUA 1NI2A 4HJKA 5L83A 3R7QA 3AULA 2LVOA 4A55A 2KVZA 1L4DB 1VDVA 4I6LB 2WXPA 4FXCA 1P9DU 2KDIA 2G1EA 1TY2A 2E6XA 2WHIA 4GOCA 4UDUC 2BKRB 2CU3A 3ZUNA 2ON8A 3ZO5B 2LRWA 4C56C 3H7PA 4ANWA 3SFEB 3VTUA 4FHKA 1XXGA 1OTRB 1ZDVA 5G5HA 5GMVA 1NYQA 4A3OA 4WAFA 3DWGC 3RNAC 3Q8FA 3RZWC 1L0XB 5J2RA 2J0JA 5HI1A 1ROEA 3UIOB 3MHZA 2OOBB 4C4VB 2MW5A 4F7ZA 4YWGG 4YTPB 4GDKA 1R4MB 2V9HA 1ZXHA 3W2DA 1EUVB 2LGSA 2UWQA 5C23A 3RNGC 2VH1A 1UELA 4E3CA 2FIFA 5C2TB 2QDFA 3TBLD 3APFA 1I7HA 1IYFA 4HPPA 2LVQA 2YLMA 4N6EB 3TEYA 2W9NA 4RGMA 1FM0D 5JXVA 2L0FA 3W5VB 2KVRA 1VLBA 2KHWB 5D3DA 2PE6B 1QZEA 3DWMA 4CQNA 2JPHA 2M1MA 1PQSA 2CS4A 1V1OA 3AE7B 3KUDB 3U52E 4WWOA 3KUCB 3AU5A 2ZW0A 2DYOA 3AM9A 3ZLZA 3WCQA 2I1KA 2KJ6A 4FHJA 4K7SA 3RZFA 3VHTC 4HJGE 3QA8A 1RFAA 2MEKA 1H4RA 1WJNA 1CMXB 2KNBA 3RULA 1UBIA 2PW9A 3DVNU 1S3SG 3URYA 1E8WA 2IZVB 1T0RC 1ET9A 3KWLA 3MTNB 4G3XB 2E3TA 5HG2A 1GG3A 3KYDD 2WQYB 4BBNF 1UF0A 5HKHA 2J42A 2PMVA 3LXFA 3QK0A 1Q10A 2BWES 5DPTA 3M95A 3SR6A 1VZ8A 2A4ZA 1F0ZA 2W3RA 3AEAB 3B08A 3AU4A 2RPQA 3L0WB 3TUOA 2V3SA 4HXDA 4GXBA 3NRZA 3R2IA 4EKUA 4W9DA 3AE3B 3J9CA 2M56B 4RF1A 3BY4B 1E8ZA 2DWQA 1QF6A 2FCSA 2A5UA 3NZSA 1J7CA 5EE3A 1J8CA 4M01A 3QARA 3WA0A 2IO1B 4FLHA 1FD6A 4IM2A 1TKEA 2QSDA 2ICIA 2MBBB 2KQ7A 3DBLI 4B0MA 1NEKB 2MP2B 3ZRFA 4ASWC 4J3OD 5J18A 3V3XA 2NVUI 4C4VA 5IAAC 4DDID 1XT9B 2N1VA 1F2RC 3W1YA 4DXGA 2AWTA 1UWMA 3ZDMC 3DDCB 4RMAA 2JWUA 3U8ZA 1NBFC 2K1FA 4XWWA 4WAAA 1XD3B 3N3KB 3Q3JA 3K9OB 3CWIA 3K9PB 1UGJA 1QLBB 2MX2A 1N61A 4NZLB 3ZQ4A 2HJ8A 5C3JB 3SEBA 3AE1B 3DHHC 2WXJA 1NYRA 2J53A 2R2QA 2D5GA 3SFDB 1ZUD2 4HVBA 3I57A 2L7RA 3N1XC 4AOFA 2L8JA 1WWTA 3N30A 4MACA 4HCNB 1GB4A 1XQQA 2DX5B 2K6DB 3BWUD 1G6JA 4MGIE 1JWSD 2N7DA 3IVFA 1LM8B 1WXVA 4DXAB 1HEZE 3GB1A 3NUHB 3OAWA 1E8XA 4WWMA 3L4PA 4US9A 4C7YA 5G55A 1KLVA 4HPMB 3PSEB 1TS4A 1WGRA 1GC7A 5GXGB 2EKIA 1PGAA 3R2TA 2WYQA 1WXAA 3WAOA 4MSQB 4TQ0A 1HXYD 3P1MA 3VAWA 1PUTA 3LB8C 2N9KA 3ZGZA 1WGYA 2OJRA 1MG8A 1WR6E 1OEYA 4GLSC 2K8HA 2WXFA 2ZVOA 3MP9A 5LNK1 4M0WB 3Q8EA 2Y3AA 3EECA 3L54A 3UQBA 3VUXA 4AWJA 4E71A 1Q5WB 1TY0A 2D2QA 3EFUA 1GOZA 5JHAA 3SU8X 2WWZA 2C7MB 4MT5A 3P4RB 4BKSD 3Q3OC 4II3B 3TCAA 2JU6X 5HHDG 3W5UB 2DYMA 5FKAC 2IYDB 2RSUA 4A90A 2QILA 3AV8A 4S17A 2OHFA 2QMTA 3PLVA 4AS1A 4BKSA 1PDXA 2N9XA 2JSVX 3ZTCA 3VH3B 1MI0A 1TKGA 2L05A 1F9JA 2LEKA 2KKCA 3BVMA 2GBNA 3DOWA 4JQWC 3DVNV 1CK1A 1EU3A 2J0MA 4FJVB 3DHIC 3HVDA 4GU2A 4RNAA 1D5MC 2BB5A 5JHBA 3UINB 4HWIB 2M4NA 3ZIMA 2Z59B 3BIID 2VH2A 4WQMA 1HTQA 5H8YE 1WX9A 4KSLC 2C7NB 2KMMA 2KWCA 4IWQA 1QILA 4TV3A 4TMAB 2MSED 1C4PA 4RM8A 2DAFA 1WX7A 2MWSB 1D5ZC 1L6VA 1WE7A 4CYEA 3H7SA 2L3ZA 3DVGY 4L1BA 1IGCA 4URKA 3RFZB 4ACFA 3IFWB 1LGRA 1XCQL 3ONSA 4OHJA 2IO3B 3TEWA 1ZOYB 4JWSC 1T0SC 3AE2B 3GE3C 3H9DA 4HDOA 2D3AA 1SIFA 1IPGA 2JZZA 4JLCA 3JW0X 1AW7A 1L0YB 4WQOB 4RH6A 1ZKHA 1YN3A 3NHEB 2KAJA 1WM2A 4LNOA 3HK0A 3WALA 3IAS1 4BOZB 3QWZB 2KMAA 3C19A 2K6QA 2ZW1A 4KGTA 3W1SC 3UF8A 5CTRC 2CKHB 4QAYA 4ZOHC 2NBVB 4M8MA 3TSSA 1F52A 2N9EB 4BOSC 1QT9A 2KDBA 4M0WA 1HZ5A 1AN8A 1F1HA 3A9KB 2KLCA 4EEWA 3I9V1 1V2YA 3CF6E 1I4PA 3ALBA 4NAWB 2K22A 1FCLA 3VH4B 2SEBD 3VRBB 2JYEA 3A9JB 3B2FA 3T8MA 2INCC 3KQ4A 1K8RB 3Q2AC 1XLPA 4YSYB 2QCZA 3ZXRA 1WXSA 3QX1A 3WANA 1WSPA 2DLBA 5EDSA 2KWVB 1KLUD 1WJ4A 2JXTA 1E7VA 2OJWA 4TSSA 2D3CA 1R4MI 2KQ4X 3PREA 3DPDA 4F8CB 3QQ8B 2GBJA 2FNJB 1HA5A 1UNSA 3UGBB 2K39A 5I4DA 2ZZPB 3RT3B 1C76A 3X0WA 3C8YA 4P1BC 4EOYA 1JCKB 2TSSA 4EZLA 2FUHB 3MJWA 1M94A 4XDCA 2DAJA 1T6BX 2KJHB 2MH7A 2LHDA 1EWCA 1IBXB 2LD9A 3P4SB 2C7HA 4IOIE 5CX3A 4WWNA 3SHQA 4DK5A 3ZDTA 2V4LA 3ZNHB 1J19A 4WJPA 1R7SA 3V62A 1WGGA 1WY8A 5BMHA 5BYRA 3AH7A 1DGJA 2LVPA 3VQIA 4ZRJA 2INPE 2WX0A 1N5WA 2DYBA 1TYGB 2LRUA 3M3JA 3VXWA 2I38A 3RPFC 3E9SA 3ENEA 1VRAB 2NPTA 2EMSA 2MRPA 4OW0A 2J4XA 4MH8A 4IUMB 2KX0A 4N59A 1E90A 1WRDB 4W9CA 2EKEC 2ZJDA 2KJRA 3AE8B 2Z0EB 3NZUA 4RF0A 4TKNA 4A6QA 2VZKB 4CHKA 1TT5B 1P1AA 4XX5A 4OZBA 4YTNB 4W9LA 4W9FA 2L76A 5LXHA 3Q69A 3A9KA 1FXAA 3I3TB 3PZDA 3NOBA 2SAKA 3VR9B 2DZMA 5DPRA 1J7BA 2JZPA 4NAWA 1JQ4A 1RRBA 3RNFC 3AEGB 2KFKB 2HTME 3A9JA 5BO4B 3TEZA 2ZNVB 2K8CA 5J17A 1SEBD 3CMMB 3ZJVA 1E6EB 2EMTA 2BS3B 3HVZA 5LLIA 3B2GA 5TR5A 2RMMA 2KK8A 3VUYA 1C9FA 4I6PA 3IT6B 3VDZA 1P0RA 1V8CA 1ZGUB 2NTSA 1FIQA 5BYQA 3BYTB 1DOYA 2DZKA 3DQVA 4EUTA 4YSXB 4MGYE 3L10B 4YSZB 3UI3A 2N1WA 4MDKE 2MHJA 4MELA 3DVGX 3L16A 1UWXA 2XK5B 3BK1A 3C0RB 2H88B 1D3ZA 1WYGA 3R8BA 1WMHA 3AEBB 3L08A 2KT7A 4RCOA 4A9AA 1QQRA 4NJ6A 1E0ZA 1IBXA 1YMHE 4GN1A 3VFKA 2LGDA 4A3PA 3RNEC 3VVWB 1WFYA 2MCNB 2JVCA 1JWBD 3Q14C 4LTUA 4NPNA 2KFJA 2LZ6A 1NI3A 4K3BA 1E10A 2KWDA 2BTEA 1N5XA 1KM7A 4LNIA 3V60A 2D07B 2FAZA 2BT6A 2WXGA 3GP7A 3RD2A 2M0AA 4US8A 3D32A 2VZKD 3DBRB 5DPWA 1D4BA 1J0GA 2GBRA 2LWPA 2WLBA 1TS3A 2BS2B 4P1CC 3TEXA 5JZEB 2O2VB 4K7UA 1QOAA 4FADA 2GMIC 2Y5BB 4BFRA 1KH0A 3PZ8A 2KC2A 1ACCA 4PK1A 3RCZA 4WJNA 2LMCA 3OG5A 4J6IA 1E7UA 3KW5B 2PVGC 2WDVB 4HLEA 1J7AA 2UYZB 3IHPC 3NS1A 2QHOA 4RGNA 4KZ0A 4YXDB 2KDFB 2QEJC 4GB9A 1MG4A 3T3OA 1TBEA 2HD5B 2BVCA 2KFKA 3AEDB 2J0KA 5D6JB 3HUIA 1ISNA 1K51A 3QAQA 2ZVNA 4MGZE 1FO4A 4XDDA 3Q3MC 2D3BA 2N7JA 2V3NA 2BW2A 1LXDA 4AP4C 2K3UA 1I35A 2RDGA 2LJIA 4TUUA 1Z2MA 2ZCCA 3GOEA 5E6OA 5IN7A 3AE9B 1VCBA 1V80A 2HTHA 2I1JA 3VTWA 3PS6A 4B9KA 5D3IB 2XK5A 4OVUA 3IBEA 2IO2B 4M02A 5KHOA 1FXTB 4GDLB 2WNMA 3FC4A 1CJEA 1VZ7A 1JMLA 2RD0A 1FPYA 2BF8B 3CSTA 2LASA 3OJ4B 1T0YA 4B6WA 4W9JA 1SIJA 3TJPA 3RUIB 5CHFA 4MEMA 2L32A 4FJZA 2KWUB 2W54A 2PE9A 3HIZA 3P2BA 1KJTA 2NCNA 3EC8A 2AEHA 1QOGA 1SBBB 1SE4A 3PHXB 4IC7B 5TSSA 4AUQC 4DHJD 3DCGA 2JQRB 5BMIA 2M8SA 2BYEA 1V81A 4HDQA 4ARIA 4KGSA 3U2SC 3ZJUA 3Q8BA 4PT5A 1Y8RC 2KN4A 2G45B 4HPLB 3TIXA 2GI9A 3NY5A 5IOIA 1WX8A 2JXXA 4C00A 1D6EC 2DZJA 4JWUC 3A4SC 2KO3A 1WF9A 2O2VA 1MFWA 4LDTD 2ACZB 1EO6A 3BK2A 1F77A 2JRHA 1YD8U 1KRHA 3H6NA 1OFFA 1JROA 2O6VB 3A4RA 2X38A 1JALA 1FXIA 3SDLC 2MBQA 3JYUA 3EGRA 4USAA 1E5WA 4HCPB 2C5LC 2Y5PA 4KIKB 1TTNA 3N1YC 1T0QC 3JVZX 3HRDD 3PO0A 2AQ2B 2WP9B 2KLGA 3PTFC 2FUG1 3P4PB 3Q8CA 1SXTA 4EE2A 3QCAA 3KYCD 4OVVA 1N62A 1HQRD 3EA6A 3NVVA 1HE8A 2INDC 3MJ5A 4EZKA 5IP4D 2NS5A 5BYSA 4MM3B 1PGXA 4XE0A 2N4FA 2FCNA 3U30A 4K1RB 3KH0A 5T8IA 4Q2JA 4DXFA 4YTMB 4ZHOA 1PGBA 4ZHPA 4XC2A 1ZE3D 4HEA1 2G9HD 2WXKA 2L52A 3AXCA 3DBHI 4IWPA 3HHMA 4GDLA 2Q5WD 2WS3B 3I5JC 3ML8A 1KLGD 1NDDA 5DCNA 3IXSA 4HKZE 1FFUA 4K7WA 4LCDE 1FEHA 1FRDA 1D5XC 4KDIC 4HK2A 2LHEA 1SJHD 2NPTB 2MJDA 4ITKA 1R4NB 4BVUC 4S0RA 1UGMA 1I4XA 4RFBA 2IDYA 3HM6X 4RGOS 4HKQA 3Q6BA 2RGFA 2MJ3A 2N9PC 3TL5A 2WXMA 1WZ3A 3KLSX 3O65B 4EZJA 2O6VD 1BT0A 4PS7A 5AZGA 2WXHA 5IKCM 1NVID 2CJOA 5H92C 1YJJA 5CHWA 4REZA 3KWVA 1HTOA 1K53A 2WDQB 3A33B 2Y5CA 3FILA 3WAMA 1OGWA 2IY1B 3RNBC 1WI0A 3W1SA 2O6VA 1SSNA 2PLPA 1U4AA 1FFVA 5E6NA 3A1QB 5EE9A 2LXAA 1FNVA 2REXA 1I4GA 2L1AA 4CO7A 2W82A 1NENB 2DZIA 4N9F4 2MBEA 4W9IA 2YEPB 2IY0B 3OJ3A 1S1QB 1K52A 4KIKA 4WIPA 2I2YA 4ARCA 3S2AA 1QOFA 3O13A 3DBHB 5FK9C 2DNFA 2IJ0A 3CIRB 2K0PA 3L13A 4DQOC 2ZPNA 1VR9A 1K50A 3AB5A 1CZPA 3ZJTA 3PRPB 4YL8A 1IUEA 1C4CA 1YX6B 1STEA 2KTRA 4ZRKA 1AWDA 3MHSD 4AJWA 2IBIB 2NTTA 1WMHB 4OZAA 4P7IA 2KMCA 1YQ3B 4MM3A 3ZNGC 2L00B 3PZ7A 1F2RI 2HJ1A 1E8YA 1I4RA 2IGGA 1LFDA 3V6CB 4LK0M 4JGHB 5LXIB 1UD7A 2AYOB 2LGIA 5L95C 5IO9A 3N20C 4DBGA 1YIWA 1GC6A 2INNE 4ZYSA 3ZNZB 3H1UA 2M0XA 1TGZB 3PHWB 1XLNA 4FN2A 3X23A 2WU5B 4DHZE 1ET6A 3AEFB 1JRPA 4G50A 1M4VA 3NVWA 5E6PA 4HRSA 1YQBA 4ZYNA 4XGAB 2EELA 2XBBC 2GOWA 2M19A 1MHHE 1TS5A 2PVOD 2N0SB 4KKIA 5G5GA 2GLSA 4G11A 1SE9A 1V5TA 1V1PB 3Q8AA 2KACA 1TS2A 1WJUA 1MVKA 2JZ3B 1EU4A 4BBNC 4NJ7A 4BKTA 3LYYA 2KX3A 3ZXVA 4E74A 4NQKE 1BUIC 2PJHA 3DBRI 4LLGM 2LUMA 4XYCA 2K25A 2QC8A 2ZPYA 1WH3A 2WXLA 1LQBA 3PPAA 2ONQA 2RDHA 1WXMA 3A1QA 2C9WB 3GZNB 1JRUA 1L6UA 4XWTA 3ZNID 2XN9C 4JL9A 3U7ZA 5D2MB 4NNJB 2VRRB 2KDMA 1QKZA 3PGEA 4LJPB 1SJED 4H2AA 1VD2A 1JWUD 3PLUA 3QC8B 4YT0B 1YQ4B 1XCTL 5MPOA 1RM6C 4L2YA 2V1YA 2Z0DB 1C4AA 4FULA 2IGDA 4IG7B 4GGQA 2XEWA 2JYTA 2KTFA 2HE7A 1P7EA 1KFYB 4TQ1A 2FE8A 2KZRA 4PYUA 2MQJA 2PPHA 4OZCA 1A5RA 1YJIA 4FA6A 3RYTA 2JUOA 4GSWA 2HDEA 2WDRB 3BYYB 1TZOA 3WAPA 1N60A 2D3GA 2IPKD 1AYFA 3MC0B 1GJZA 2K5PA 1Q1OA 4DHZB 2XNAC 4M8NA 3APCA 3GE8C 4MGKE 2MBHA 1EF1A 3B0AA 5CHVC 2R2OA 3SD5A 1UUPA 4FBJB 3IG3A 4LNFA 2W55A 4LNNA 3U7DA 4EFOA 1PYWD 3T9LA 4NJCA 2X8XX 4D2KA 4LJOB 1VZ6A 2IO0B 1GAQB 2RPVA 2RR9A 1UZXB 1Z5SB 4DHJB 4DWFA 3IAM1 2V0GA 3WIMA 1V97A 4ANVA 3B1LX 3EFCA 2UU7A 4IM0A 4F1SA 2JX5A 1V1PA 1T3QA 2YEPF 2WXIA 3Q3NC 1ZDXA 2KQSA 4AJYB 2CHZA 1JWAD 4LDTB 2G4SA 2KDEB 1P3QU 3NG0A 3DBSA 5DPSA 1OQRA 1T5XD 1TJEA 1UBQA 4IM3A 3GS2A 3QHTA 2LUEA 1JWMD 4P16A 2ZNVC 5JH5C 3AE5B 3PVLA 3EHVA 1GNUA 1XLQA 2KN5A 2DBYA 2N9LA 2GBMA 3NZ3A 2NMQA 3NVYA 4IDIA
chains in the Genus database with same CATH topology
3HRDD 3PO0A 1JW9D 2AQ2B 3B9JA 5C2TB 2WP9B 2FUG1 1DOIA 3P4PB 3Q8CA 1WSPA 1I7HA 1SXTA 2DLBA 4EE2A 1KLUD 2JXTA 1N62A 1HQRD 4N6EB 1BXTA 4TSSA 3TEYA 3EA6A 3NVVA 1E9MA 1C78A 2KQ4X 4R3DA 1MPEA 3MJ5A 1FMAD 1FCCC 1Y56A 4RGMA 1FM0D 5JXVA 3W5VB 3NVZA 1VLBA 1HA5A 1UNSA 5D3DA 5BYSA 1KTKA 4MM3B 5I4DA 1PGXA 3AE6B 3DWMA 4XE0A 4CQNA 1I4QA 1C76A 4IKGA 4JX1C 3C8YA 4Q2JA 5T8IA 1V1OA 2CJNA 3U4EG 4DXFA 4YTMB 4ZHOA 1PGBA 4ZHPA 4KGRA 1JCKB 3AE7B 4P6VF 2TSSA 1ZE3D 4HEA1 3U52E 2G9HD 2WXKA 2L52A 4XDCA 2IGHA 1T6BX 2ZW0A 2DYOA 2MH7A 3AM9A 2LHDA 1A70A 2Q5WD 1EWCA 3WCQA 1IBXB 2WS3B 3ETRA 3P4SB 2R61A 4IOIE 4HJGE 2MEKA 1R7SA 5E6JA 2BB6A 1KLGD 5BMHA 5BYRA 3IXSA 4HKZE 1FFUA 2PW9A 3AH7A 1DGJA 1FEHA 1BMLC 2AQ3B 1FRDA 3URYA 1D5XC 3VQIA 1ET9A 3KWLA 2INPE 2WXOA 2E3TA 1I4HA 5HG2A 2LHEA 1SJHD 1KF6B 1N5WA 3W9CB 1XO3A 1TYGB 1MHXA 2WQYB 2MJDA 4ITKA 2I38A 3RPFC 3E9SA 1XLOA 2Z8LA 4C80A 1SF0A 2J42A 2PMVA 1VRAB 5HFYA 3LXFA 1Q10A 1I4XA 4RFBA 2IDYA 4OW0A 2J4XA 4RGOS 4HKQA 1C79A 4MH8A 3SR6A 1VZ8A 2MJ3A 4N59A 1F0ZA 2WXNA 2W3RA 2WXMA 3AEAB 3KLSX 3V05A 3TUOA 2OEDA 2PKOA 3AE8B 4RF0A 3NRZA 4A6QA 1YN4A 3FILB 2VZKB 3BVZA 3R2IA 1IGDA 2WXHA 2H89B 3AE3B 1NVID 2CJOA 3J9CA 2M56B 1YJJA 4RF1A 5H92C 4OZBA 4YTNB 4REZA 4B0EA 1YNTE 2DWQA 1QF6A 3KWVA 1K53A 2WDQB 2WXQA 2PTLA 1J7CA 3Q69A 1B9RA 2Y5CA 3FILA 1QOBA 5EE3A 1FXAA 3E56A 3W1SA 4NAMA 1FD6A 1SSNA 2SAKA 2PLPA 3VR9B 1TKEA 2QSDA 1FFVA 1EWYC 2ICIA 3VRAB 2MJEA 5EE9A 4B0MA 1NEKB 1J7BA 4WURA 2JZPA 1JQ4A 1FNVA 4YSYB 4J3OD 3AEGB 1I4GA 2L1AA 3V3XA 2W82A 1NENB 2HTME 1FNWA 1N63A 3TEZA 1F2RC 4DXGA 1SEBD 1UWMA 2QJLA 3ABVB 2YEPB 2BYTA 3ZJVA 1E6EB 1PFDA 2BS3B 3HVZA 1K52A 4A8XC 4WIPA 2I2YA 4ARCA 3B2GA 1QOFA 2JWUA 4JPSA 3O13A 2RMMA 1C9FA 2QIEB 4XWWA 5FK9C 1SE2A 2IJ0A 3IT6B 3CIRB 4ZRQA 1L0VB 1V8CA 2K0PA 2NTSA 1FIQA 1SB3C 5BYQA 1RYJA 3BYTB 1DOYA 4DQOC 1VR9A 1K50A 1WRIA 3AB5A 1CZPA 1WGKA 3ZJTA 3CWIA 4YSXB 1UGJA 1QLBB 1IUEA 1TKYA 1C4CA 1SE3A 4YSZB 3UI3A 1STEA 1AWDA 1N61A 4NZLB 3ZQ4A 2NTTA 2W3SA 5D7GA 3BZDB 5C3JB 4OZAA 1UWXA 3SEBA 1YQ3B 3IT4B 3AE4B 3AE1B 3AECB 3BK1A 2WXJA 2H88B 3PZ7A 1NYRA 1F2RI 4C7ZA 1WYGA 1I4RA 2J53A 3R8BA 2IGGA 2D5GA 3SFDB 1ZUD2 3AEBB 4LK0M 3I57A 2BS4B 4RCOA 4A9AA 1QQRA 1B1ZA 2LGIA 1WWTA 1E0ZA 4MACA 1GB4A 1IBXA 1XEEA 1GB1A 3BWUD 1YMHE 2INNE 4ZYSA 1JWSD 1XF5L 4OVZA 1XLNA 1HEZE 2WU5B 1ET6A 3GB1A 3H8HA 3NUHB 1YN5A 1JWBD 3N9YC 4WWMA 3AEFB 1JRPA 3L4PA 4US9A 4LTUA 4C7YA 1FRRA 1M4VA 3NVWA 4WH4A 4HRSA 1NI3A 1E10A 2KWDA 2BTEA 1N5XA 1TS4A 2AQ1B 4AQ7A 2EELA 1DYQA 5GXGB 2M19A 1MHHE 1TS5A 1PGAA 2BT6A 2EKIA 2PIAA 1ZP0B 2PVOD 2WXGA 3R2TA 3GP7A 2N0SB 2M0AA 4KKIA 5G5GA 2VZKD 4KKJA 4US8A 2WU2B 3FAHA 1WXQA 1D4BA 4TQ0A 2LFIA 1HXYD 3P1MA 2WLBA 1V1PB 1PUTA 3Q8AA 3MFGA 1TS3A 2KACA 1TS2A 2BS2B 3LB8C 2N9KA 3ZGZA 1HZ6A 1MVKA 1EU4A 3TEXA 4GLSC 2WXFA 1QOAA 1VJKA 3AN1A 1GPXA 3MP9A 5LNK1 1P7FA 3LYYA 1KH0A 3Q8EA 2Y3AA 3PZ8A 1DOXA 2B76B 1BUIC 1TY0A 1ACCA 1GOZA 4LLGM 4N58A 2LUMA 4JE3B 4MT5A 3P4RB 2LMCA 5FR3A 2JU6X 5HHDG 2AX5A 3W5UB 2DYMA 5FKAC 3BVGA 2PVGC 1L5PA 1RWSA 1OQQA 2WDVB 1J7AA 2BBCA 2WXLA 3AEEB 4ZRPA 3NS1A 5BMGA 3P42A 2ONQA 2RDHA 3P4QB 4RGNA 4GDKB 4A90A 1L6UA 4YXDB 2QEJC 2QILA 3AV8A 4XWTA 3T3OA 2OHFA 2QMTA 4AS1A 2XN9C 2J52A 3AEDB 3HUIA 1PDXA 2JSVX 1K51A 3U7ZA 1MI0A 1TKGA 2KDMA 1QKZA 2LEKA 1FO4A 2K9XA 4XDDA 3BVMA 1SJED 1ZXIA 1CQVA 4H2AA 3OWEB 1ZPSA 4L23A 2GRIA 1JWUD 2N7JA 2V3NA 4YT0B 1CK1A 2L83A 1EU3A 1ESFA 1YQ4B 2BW2A 3HVDA 1ENFA 3P63A 1XCTL 5MPOA 1RM6C 4RNAA 1D5MC 4L2YA 2BB5A 3ZYYX 1C4AA 2IGDA 5AUKA 2K3UA 5EE1A 2RDGA 2LJIA 3BIID 5EE0A 2JYTA 1EM7A 4WQMA 1P7EA 1KFYB 5H8YE 2KMMA 3AE9B 2FBWB 1QILA 4TQ1A 2FE8A 4TMAB 4OZCA 1C4PA 1L4ZB 2GB1A 1YJIA 3EUB2 3VR8B 5D3IB 3T3NA 1D5ZC 1L6VA 2HDEA 2WDRB 3BYYB 1TZOA 4GDLB 2WNMA 1N60A 2IPKD 1RFKA 3FC4A 1AYFA 4RGTA 5AUIA 3MC0B 1CJEA 4L1BA 1IGCA 2K5PA 1VZ7A 1JMLA 1E7PB 3RFZB 1LO5D 1XCQL 4OHJA 3TEWA 2WXRA 2XNAC 4KX6B 1ZOYB 4JWSC 4HROA 1C77A 3AE2B 4O1NA 2V4IB 1SIJA 2L32A 3AMZA 2V3PA 1FNUA 1UUPA 2W55A 2W54A 4A55A 1AW7A 1L0YB 1L4DB 4RH6A 1QOGA 1PYWD 1SBBB 1SE4A 1VDVA 1YN3A 5TSSA 4NJCA 2KAJA 2WXPA 2JQRB 4FXCA 4D2KA 5BMIA 1VZ6A 2G1EA 1TY2A 4ARIA 4KGSA 3U2SC 3ZJUA 1GAQB 2E6XA 2RPVA 3Q8BA 3IAS1 3IAM1 2V0GA 4PT5A 1V97A 4UDUC 2ZW1A 4KGTA 2KN4A 2CU3A 2GI9A 2JX5A 1V1PA 2ON8A 1T3QA 2YEPF 4ZOHC 3TSSA 1D6EC 4C56C 4JWUC 2WXIA 1ZDXA 3SFEB 2ACZB 1QT9A 1XXGA 3BK2A 4M0WA 1HZ5A 1ZDVA 1AN8A 1F77A 1KRHA 1JWAD 5G5HA 1OFFA 1JROA 1NYQA 2X38A 4WAFA 1OQRA 1T5XD 1JALA 1TJEA 3DWGC 1FXIA 3GS2A 3I9V1 3Q8FA 1I4PA 4NAWB 1L0XB 5HI1A 1JWMD 4P16A 1ROEA 2K22A 1FCLA 3EGRA 2SEBD 3MHZA 3VRBB 2JYEA 4YWGG 3AE5B 4YTPB 4USAA 3B2FA 1XLQA 3KQ4A 1ZXHA 2DBYA 3W2DA 2N9LA 2Y5PA 3NZ3A 2NMQA 1XLPA 3NVYA 4IDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4US9 A;  4LTU A;  4YTN B;  4C7Y A;  1FRR A;  3HRD D;  3PO0 A;  2DWQ A;  3NVW A;  1QF6 A;  1JW9 D;  3B9J A;  1NI3 A;  4HRS A;  5C2T B;  2WDQ B;  1L6V A;  2WDR B;  2WP9 B;  1E10 A;  1N5X A;  1J7C A;  1B9R A;  1N60 A;  1DOI A;  2Y5C A;  1RFK A;  1QOB A;  3FC4 A;  1AYF A;  1I7H A;  3P4P B;  5EE3 A;  5AUI A;  1FXA A;  5GXG B;  1CJE A;  2M19 A;  2PIA A;  2EKI A;  2BT6 A;  2K5P A;  1N62 A;  2PVO D;  1ZP0 B;  1E7P B;  3VR9 B;  2N0S B;  4N6E B;  1TKE A;  5G5G A;  4US8 A;  3NVV A;  1E9M A;  1EWY C;  1FFV A;  2WU2 B;  3VRA B;  4KX6 B;  1ZOY B;  2MJE A;  3FAH A;  5EE9 A;  1NEK B;  4JWS C;  1J7B A;  1FMA D;  1WXQ A;  4HRO A;  3AE2 B;  1JQ4 A;  1FM0 D;  4YSY B;  3P1M A;  3W5V B;  2WLB A;  3AEG B;  1PUT A;  3NVZ A;  1NEN B;  1SIJ A;  1VLB A;  2BS2 B;  3LB8 C;  2HTM E;  3AMZ A;  3AE6 B;  3DWM A;  1N63 A;  1QOA A;  1UWM A;  1VJK A;  3AN1 A;  4JX1 C;  2QJL A;  3ABV B;  2W55 A;  1GPX A;  2W54 A;  2CJN A;  1E6E B;  1PFD A;  4YTM B;  2BS3 B;  3HVZ A;  4ZHO A;  4ZHP A;  3AE7 B;  4P6V F;  3B2G A;  1QOF A;  1DOX A;  2B76 B;  1QOG A;  1VDV A;  2L52 A;  5H92 C;  2QIE B;  4N58 A;  1YJI A;  2KAJ A;  3P4R B;  2JQR B;  3CIR B;  2MH7 A;  3AM9 A;  4FXC A;  1A70 A;  2Q5W D;  1L0V B;  1V8C A;  3WCQ A;  2G1E A;  2WS3 B;  2AX5 A;  1FIQ A;  1SB3 C;  3NVY A;  1RYJ A;  1DOY A;  3W5U B;  1GAQ B;  3ETR A;  3P4S B;  1WRI A;  3AB5 A;  1CZP A;  1RWS A;  1L5P A;  1OQQ A;  1WGK A;  2PVG C;  1J7A A;  2WDV B;  3CWI A;  4YSX B;  3AEE B;  1QLB B;  1R7S A;  3NS1 A;  1IUE A;  1V97 A;  3P4Q B;  1TKY A;  1L6U A;  1FFU A;  3AH7 A;  4YSZ B;  4YXD B;  1DGJ A;  1AWD A;  3AV8 A;  1N61 A;  2CU3 A;  3VR8 B;  3AE3 B;  1FRD A;  2OHF A;  2JX5 A;  1T3Q A;  2W3S A;  3AED B;  4ZOH C;  3KWL A;  3HUI A;  5C3J B;  1PDX A;  1YQ3 B;  2M56 B;  2E3T A;  4JWU C;  3AE4 B;  3AE1 B;  3AEC B;  1KF6 B;  3SFE B;  2ACZ B;  1TKG A;  2H88 B;  3L4P A;  1NYR A;  2LEK A;  4C7Z A;  1FO4 A;  1N5W A;  1QT9 A;  2K9X A;  1WYG A;  3W9C B;  1XO3 A;  1ZXI A;  1KRH A;  1JWA D;  1TYG B;  5G5H A;  2WQY B;  2MJD A;  4ITK A;  3SFD B;  1ZUD 2;  3AEB B;  1OFF A;  1NYQ A;  1JRO A;  4YT0 B;  3RPF C;  1XLO A;  2BS4 B;  2L83 A;  1YQ4 B;  1OQR A;  4C80 A;  4A9A A;  3P63 A;  1JAL A;  1TJE A;  1SF0 A;  5MPO A;  3DWG C;  1RM6 C;  1WWT A;  1E0Z A;  1FXI A;  3LXF A;  3ZYY X;  5AUK A;  1ROE A;  2K22 A;  5EE1 A;  3BII D;  5EE0 A;  3SR6 A;  2MJ3 A;  4WQM A;  4N59 A;  3VRB B;  1F0Z A;  1KFY B;  3AE5 B;  2W3R A;  3AEA B;  4USA A;  4YTP B;  3B2F A;  5H8Y E;  1XLQ A;  2KMM A;  3AE9 B;  1XLN A;  2PKO A;  3AE8 B;  2DBY A;  2WU5 B;  2FBW B;  3NRZ A;  1JWB D;  4WWM A;  2H89 B;  1XLP A;  3EUB 2;  1NVI D;  3AEF B;  2CJO A;  4IDI A;  1JRP A;  1YJJ A; 
#chains in the Genus database with same CATH topology
 1GUA B;  1JW9 D;  3B9J A;  3PT2 B;  1ZW7 A;  1WYW B;  1DOI A;  2CHW A;  1V5O A;  2JRI B;  2YVC A;  1BXT A;  1YOV B;  1E9M A;  1C78 A;  4R3D A;  1MPE A;  1FMA D;  1V49 A;  1FCC C;  1Y56 A;  2RDB C;  2LXC A;  3NVZ A;  2WX1 A;  3OLM D;  1KTK A;  3HM3 A;  3AE6 B;  1I4Q A;  4IKG A;  4JX1 C;  1AAR A;  2CJN A;  3U4E G;  4KGR A;  3RI7 C;  4P6V F;  2IGH A;  1A70 A;  3M62 B;  1YX5 B;  3ETR A;  2BKF A;  2R61 A;  3RMK C;  2DEN B;  5E6J A;  2BB6 A;  4LNK A;  2B3A A;  1BML C;  2AQ3 B;  4MSM B;  1L2N A;  2WXO A;  2JF5 A;  4NQL B;  1I4H A;  3CSF A;  1V6E A;  1KF6 B;  1SGH A;  2WDT B;  1OQY A;  1MJD A;  3W9C B;  1XO3 A;  2BYV E;  1MHX A;  1P98 A;  3UQA A;  1XLO A;  2Z8L A;  4ZRI A;  4C80 A;  1SF0 A;  5HFY A;  3ECI A;  2LJ5 A;  4BZA A;  1RAX A;  3PRZ A;  1C79 A;  3DHG C;  2WXN A;  3V05 A;  3DBL B;  2OED A;  2PKO A;  3NS8 A;  4WJO A;  2L0T A;  1YN4 A;  4W9E A;  3FIL B;  3BVZ A;  1IGD A;  1R4N I;  2H89 B;  3APD A;  1WR1 A;  3KUZ A;  4B0E A;  1YNT E;  2K8B A;  3LDZ E;  2PEA A;  2PTL A;  2WXQ A;  4KVG B;  1UH6 A;  1B9R A;  1QOB A;  4PS8 A;  3E56 A;  4W9K A;  2J7Q B;  4NAM A;  4M00 A;  4G0N B;  3PRM B;  1EWY C;  3VRA B;  2MJE A;  2C60 A;  4WUR A;  4BKG A;  1WGH A;  4ANX A;  1FNW A;  1N63 A;  2MP2 A;  3ML9 A;  2QJL A;  3ABV B;  2BYT A;  1PFD A;  4A8X C;  3ZVV A;  4JPS A;  1I42 A;  2ZCB A;  2QIE B;  1SE2 A;  1N6Z A;  1IP9 A;  4ZRQ A;  1L0V B;  2NBU A;  2ASQ A;  1SB3 C;  2KTR B;  1RYJ A;  3V61 A;  3MC8 A;  1WRI A;  1WGK A;  2LI5 A;  4I6N B;  2JWZ A;  2KD0 A;  1TKY A;  4K81 A;  1SE3 A;  1EF5 A;  1Q0W B;  2KC1 A;  2W3S A;  5D7G A;  3BZD B;  4GMV A;  5AZH A;  2M17 A;  3IT4 B;  3AE4 B;  3AEC B;  2CR5 A;  3BIN A;  2BWF A;  4PS3 A;  3RNC C;  4ANU A;  4C7Z A;  4KZC A;  4MJS B;  2BS4 B;  1V86 A;  1X1M A;  1WIA A;  1B1Z A;  3ZTD A;  4B95 A;  3JSV B;  1XEE A;  2MBO A;  1GB1 A;  3QIJ A;  1C1Y B;  2D11 A;  2DHZ A;  2G4D B;  4DDG D;  2JY6 A;  1XF5 L;  4OVZ A;  5AZF A;  4GIV A;  2NBW B;  2N7E A;  3R7R A;  4A20 A;  3H8H A;  1YN5 A;  4ZDV A;  2AL3 A;  2KXJ A;  1WZ0 A;  3N9Y C;  4NY0 A;  4MH0 E;  1V9J A;  1FRR A;  3ZKJ C;  4WH4 A;  2AQ1 B;  5KHQ A;  4AQ7 A;  1DYQ A;  3FKY A;  2PIA A;  3M63 B;  1ZP0 B;  4IWO A;  3NJT A;  1L7Y A;  4KKJ A;  2NR2 A;  2WU2 B;  3FAH A;  1KOT A;  1WXQ A;  2LFI A;  3RN9 C;  2FCM A;  2KOX A;  3MFG A;  3I63 C;  1TZ1 A;  1HZ6 A;  3H7P B;  2MA9 B;  1WJ6 A;  4KV2 A;  2FCQ A;  1OEY J;  1WGD A;  3AN1 A;  1VJK A;  3R3M A;  1GPX A;  3VTV A;  4FJY A;  4PYZ A;  1P7F A;  5C1Z A;  2AL6 A;  1DOX A;  2B76 B;  3ZRC A;  5IA7 A;  4JIO U;  5AEK B;  4N58 A;  2LGY A;  4JE3 B;  3UIP B;  3V6E B;  5FR3 A;  2JT4 B;  2AX5 A;  4ICV A;  3BVG A;  1L5P A;  1RWS A;  1OQQ A;  2BBC A;  3AEE B;  4ZRP A;  5BMG A;  3P42 A;  3KVF B;  5D94 A;  3P4Q B;  2LGX A;  4GDK B;  2WGS A;  3TMP B;  2KAN A;  4ICU A;  2G3Q B;  2J52 A;  3N32 A;  5FR6 A;  3Q3F A;  5G2N A;  2CU1 A;  2K9X A;  1WE6 A;  2KYW A;  1ZXI A;  1CQV A;  3OWE B;  2BQQ A;  1ZPS A;  1TIF A;  4L23 A;  1C3T A;  2GRI A;  1H8C A;  2L83 A;  1ESF A;  1ENF A;  2CHX A;  2ZEQ A;  3GZN I;  3P63 A;  4W9G A;  1RLF A;  3VUW A;  2BGF A;  3ZYY X;  4KSK C;  4XZ4 A;  2MLB A;  5AUK A;  4KDL B;  5EE1 A;  5EE0 A;  1EM7 A;  3R66 C;  4WWP A;  2BYF A;  4K3C A;  2GBK A;  3MC9 A;  2FID A;  4W9H A;  3QJZ A;  2FBW B;  2BPS A;  3LJ3 A;  4RM9 A;  1L4Z B;  2GB1 A;  3EUB 2;  1WM3 A;  3VR8 B;  4BAX A;  3T3N A;  1YJ1 A;  4WJQ A;  3ZW3 A;  4IW0 A;  3L17 A;  1RFK A;  4RGT A;  5AUI A;  4MJS A;  4II2 B;  1E7P B;  1LO5 D;  2WXR A;  4KX6 B;  3PV1 A;  4HRO A;  3JSV A;  1C77 A;  4O1N A;  3AI5 A;  4X57 B;  2V4I B;  3N1Z C;  3AMZ A;  2D10 A;  2V3P A;  1FNU A;  1NI2 A;  4HJK A;  5L83 A;  3R7Q A;  3AUL A;  2LVO A;  4A55 A;  2KVZ A;  1L4D B;  1VDV A;  4I6L B;  2WXP A;  4FXC A;  1P9D U;  2KDI A;  2G1E A;  1TY2 A;  2E6X A;  2WHI A;  4GOC A;  4UDU C;  2BKR B;  2CU3 A;  3ZUN A;  2ON8 A;  3ZO5 B;  2LRW A;  4C56 C;  3H7P A;  4ANW A;  3SFE B;  3VTU A;  4FHK A;  1XXG A;  1OTR B;  1ZDV A;  5G5H A;  5GMV A;  1NYQ A;  4A3O A;  4WAF A;  3DWG C;  3RNA C;  3Q8F A;  3RZW C;  1L0X B;  5J2R A;  2J0J A;  5HI1 A;  1ROE A;  3UIO B;  3MHZ A;  2OOB B;  4C4V B;  2MW5 A;  4F7Z A;  4YWG G;  4YTP B;  4GDK A;  1R4M B;  2V9H A;  1ZXH A;  3W2D A;  1EUV B;  2LGS A;  2UWQ A;  5C23 A;  3RNG C;  2VH1 A;  1UEL A;  4E3C A;  2FIF A;  5C2T B;  2QDF A;  3TBL D;  3APF A;  1I7H A;  1IYF A;  4HPP A;  2LVQ A;  2YLM A;  4N6E B;  3TEY A;  2W9N A;  4RGM A;  1FM0 D;  5JXV A;  2L0F A;  3W5V B;  2KVR A;  1VLB A;  2KHW B;  5D3D A;  2PE6 B;  1QZE A;  3DWM A;  4CQN A;  2JPH A;  2M1M A;  1PQS A;  2CS4 A;  1V1O A;  3AE7 B;  3KUD B;  3U52 E;  4WWO A;  3KUC B;  3AU5 A;  2ZW0 A;  2DYO A;  3AM9 A;  3ZLZ A;  3WCQ A;  2I1K A;  2KJ6 A;  4FHJ A;  4K7S A;  3RZF A;  3VHT C;  4HJG E;  3QA8 A;  1RFA A;  2MEK A;  1H4R A;  1WJN A;  1CMX B;  2KNB A;  3RUL A;  1UBI A;  2PW9 A;  3DVN U;  1S3S G;  3URY A;  1E8W A;  2IZV B;  1T0R C;  1ET9 A;  3KWL A;  3MTN B;  4G3X B;  2E3T A;  5HG2 A;  1GG3 A;  3KYD D;  2WQY B;  4BBN F;  1UF0 A;  5HKH A;  2J42 A;  2PMV A;  3LXF A;  3QK0 A;  1Q10 A;  2BWE S;  5DPT A;  3M95 A;  3SR6 A;  1VZ8 A;  2A4Z A;  1F0Z A;  2W3R A;  3AEA B;  3B08 A;  3AU4 A;  2RPQ A;  3L0W B;  3TUO A;  2V3S A;  4HXD A;  4GXB A;  3NRZ A;  3R2I A;  4EKU A;  4W9D A;  3AE3 B;  3J9C A;  2M56 B;  4RF1 A;  3BY4 B;  1E8Z A;  2DWQ A;  1QF6 A;  2FCS A;  2A5U A;  3NZS A;  1J7C A;  5EE3 A;  1J8C A;  4M01 A;  3QAR A;  3WA0 A;  2IO1 B;  4FLH A;  1FD6 A;  4IM2 A;  1TKE A;  2QSD A;  2ICI A;  2MBB B;  2KQ7 A;  3DBL I;  4B0M A;  1NEK B;  2MP2 B;  3ZRF A;  4ASW C;  4J3O D;  5J18 A;  3V3X A;  2NVU I;  4C4V A;  5IAA C;  4DDI D;  1XT9 B;  2N1V A;  1F2R C;  3W1Y A;  4DXG A;  2AWT A;  1UWM A;  3ZDM C;  3DDC B;  4RMA A;  2JWU A;  3U8Z A;  1NBF C;  2K1F A;  4XWW A;  4WAA A;  1XD3 B;  3N3K B;  3Q3J A;  3K9O B;  3CWI A;  3K9P B;  1UGJ A;  1QLB B;  2MX2 A;  1N61 A;  4NZL B;  3ZQ4 A;  2HJ8 A;  5C3J B;  3SEB A;  3AE1 B;  3DHH C;  2WXJ A;  1NYR A;  2J53 A;  2R2Q A;  2D5G A;  3SFD B;  1ZUD 2;  4HVB A;  3I57 A;  2L7R A;  3N1X C;  4AOF A;  2L8J A;  1WWT A;  3N30 A;  4MAC A;  4HCN B;  1GB4 A;  1XQQ A;  2DX5 B;  2K6D B;  3BWU D;  1G6J A;  4MGI E;  1JWS D;  2N7D A;  3IVF A;  1LM8 B;  1WXV A;  4DXA B;  1HEZ E;  3GB1 A;  3NUH B;  3OAW A;  1E8X A;  4WWM A;  3L4P A;  4US9 A;  4C7Y A;  5G55 A;  1KLV A;  4HPM B;  3PSE B;  1TS4 A;  1WGR A;  1GC7 A;  5GXG B;  2EKI A;  1PGA A;  3R2T A;  2WYQ A;  1WXA A;  3WAO A;  4MSQ B;  4TQ0 A;  1HXY D;  3P1M A;  3VAW A;  1PUT A;  3LB8 C;  2N9K A;  3ZGZ A;  1WGY A;  2OJR A;  1MG8 A;  1WR6 E;  1OEY A;  4GLS C;  2K8H A;  2WXF A;  2ZVO A;  3MP9 A;  5LNK 1;  4M0W B;  3Q8E A;  2Y3A A;  3EEC A;  3L54 A;  3UQB A;  3VUX A;  4AWJ A;  4E71 A;  1Q5W B;  1TY0 A;  2D2Q A;  3EFU A;  1GOZ A;  5JHA A;  3SU8 X;  2WWZ A;  2C7M B;  4MT5 A;  3P4R B;  4BKS D;  3Q3O C;  4II3 B;  3TCA A;  2JU6 X;  5HHD G;  3W5U B;  2DYM A;  5FKA C;  2IYD B;  2RSU A;  4A90 A;  2QIL A;  3AV8 A;  4S17 A;  2OHF A;  2QMT A;  3PLV A;  4AS1 A;  4BKS A;  1PDX A;  2N9X A;  2JSV X;  3ZTC A;  3VH3 B;  1MI0 A;  1TKG A;  2L05 A;  1F9J A;  2LEK A;  2KKC A;  3BVM A;  2GBN A;  3DOW A;  4JQW C;  3DVN V;  1CK1 A;  1EU3 A;  2J0M A;  4FJV B;  3DHI C;  3HVD A;  4GU2 A;  4RNA A;  1D5M C;  2BB5 A;  5JHB A;  3UIN B;  4HWI B;  2M4N A;  3ZIM A;  2Z59 B;  3BII D;  2VH2 A;  4WQM A;  1HTQ A;  5H8Y E;  1WX9 A;  4KSL C;  2C7N B;  2KMM A;  2KWC A;  4IWQ A;  1QIL A;  4TV3 A;  4TMA B;  2MSE D;  1C4P A;  4RM8 A;  2DAF A;  1WX7 A;  2MWS B;  1D5Z C;  1L6V A;  1WE7 A;  4CYE A;  3H7S A;  2L3Z A;  3DVG Y;  4L1B A;  1IGC A;  4URK A;  3RFZ B;  4ACF A;  3IFW B;  1LGR A;  1XCQ L;  3ONS A;  4OHJ A;  2IO3 B;  3TEW A;  1ZOY B;  4JWS C;  1T0S C;  3AE2 B;  3GE3 C;  3H9D A;  4HDO A;  2D3A A;  1SIF A;  1IPG A;  2JZZ A;  4JLC A;  3JW0 X;  1AW7 A;  1L0Y B;  4WQO B;  4RH6 A;  1ZKH A;  1YN3 A;  3NHE B;  2KAJ A;  1WM2 A;  4LNO A;  3HK0 A;  3WAL A;  3IAS 1;  4BOZ B;  3QWZ B;  2KMA A;  3C19 A;  2K6Q A;  2ZW1 A;  4KGT A;  3W1S C;  3UF8 A;  5CTR C;  2CKH B;  4QAY A;  4ZOH C;  2NBV B;  4M8M A;  3TSS A;  1F52 A;  2N9E B;  4BOS C;  1QT9 A;  2KDB A;  4M0W A;  1HZ5 A;  1AN8 A;  1F1H A;  3A9K B;  2KLC A;  4EEW A;  3I9V 1;  1V2Y A;  3CF6 E;  1I4P A;  3ALB A;  4NAW B;  2K22 A;  1FCL A;  3VH4 B;  2SEB D;  3VRB B;  2JYE A;  3A9J B;  3B2F A;  3T8M A;  2INC C;  3KQ4 A;  1K8R B;  3Q2A C;  1XLP A;  4YSY B;  2QCZ A;  3ZXR A;  1WXS A;  3QX1 A;  3WAN A;  1WSP A;  2DLB A;  5EDS A;  2KWV B;  1KLU D;  1WJ4 A;  2JXT A;  1E7V A;  2OJW A;  4TSS A;  2D3C A;  1R4M I;  2KQ4 X;  3PRE A;  3DPD A;  4F8C B;  3QQ8 B;  2GBJ A;  2FNJ B;  1HA5 A;  1UNS A;  3UGB B;  2K39 A;  5I4D A;  2ZZP B;  3RT3 B;  1C76 A;  3X0W A;  3C8Y A;  4P1B C;  4EOY A;  1JCK B;  2TSS A;  4EZL A;  2FUH B;  3MJW A;  1M94 A;  4XDC A;  2DAJ A;  1T6B X;  2KJH B;  2MH7 A;  2LHD A;  1EWC A;  1IBX B;  2LD9 A;  3P4S B;  2C7H A;  4IOI E;  5CX3 A;  4WWN A;  3SHQ A;  4DK5 A;  3ZDT A;  2V4L A;  3ZNH B;  1J19 A;  4WJP A;  1R7S A;  3V62 A;  1WGG A;  1WY8 A;  5BMH A;  5BYR A;  3AH7 A;  1DGJ A;  2LVP A;  3VQI A;  4ZRJ A;  2INP E;  2WX0 A;  1N5W A;  2DYB A;  1TYG B;  2LRU A;  3M3J A;  3VXW A;  2I38 A;  3RPF C;  3E9S A;  3ENE A;  1VRA B;  2NPT A;  2EMS A;  2MRP A;  4OW0 A;  2J4X A;  4MH8 A;  4IUM B;  2KX0 A;  4N59 A;  1E90 A;  1WRD B;  4W9C A;  2EKE C;  2ZJD A;  2KJR A;  3AE8 B;  2Z0E B;  3NZU A;  4RF0 A;  4TKN A;  4A6Q A;  2VZK B;  4CHK A;  1TT5 B;  1P1A A;  4XX5 A;  4OZB A;  4YTN B;  4W9L A;  4W9F A;  2L76 A;  5LXH A;  3Q69 A;  3A9K A;  1FXA A;  3I3T B;  3PZD A;  3NOB A;  2SAK A;  3VR9 B;  2DZM A;  5DPR A;  1J7B A;  2JZP A;  4NAW A;  1JQ4 A;  1RRB A;  3RNF C;  3AEG B;  2KFK B;  2HTM E;  3A9J A;  5BO4 B;  3TEZ A;  2ZNV B;  2K8C A;  5J17 A;  1SEB D;  3CMM B;  3ZJV A;  1E6E B;  2EMT A;  2BS3 B;  3HVZ A;  5LLI A;  3B2G A;  5TR5 A;  2RMM A;  2KK8 A;  3VUY A;  1C9F A;  4I6P A;  3IT6 B;  3VDZ A;  1P0R A;  1V8C A;  1ZGU B;  2NTS A;  1FIQ A;  5BYQ A;  3BYT B;  1DOY A;  2DZK A;  3DQV A;  4EUT A;  4YSX B;  4MGY E;  3L10 B;  4YSZ B;  3UI3 A;  2N1W A;  4MDK E;  2MHJ A;  4MEL A;  3DVG X;  3L16 A;  1UWX A;  2XK5 B;  3BK1 A;  3C0R B;  2H88 B;  1D3Z A;  1WYG A;  3R8B A;  1WMH A;  3AEB B;  3L08 A;  2KT7 A;  4RCO A;  4A9A A;  1QQR A;  4NJ6 A;  1E0Z A;  1IBX A;  1YMH E;  4GN1 A;  3VFK A;  2LGD A;  4A3P A;  3RNE C;  3VVW B;  1WFY A;  2MCN B;  2JVC A;  1JWB D;  3Q14 C;  4LTU A;  4NPN A;  2KFJ A;  2LZ6 A;  1NI3 A;  4K3B A;  1E10 A;  2KWD A;  2BTE A;  1N5X A;  1KM7 A;  4LNI A;  3V60 A;  2D07 B;  2FAZ A;  2BT6 A;  2WXG A;  3GP7 A;  3RD2 A;  2M0A A;  4US8 A;  3D32 A;  2VZK D;  3DBR B;  5DPW A;  1D4B A;  1J0G A;  2GBR A;  2LWP A;  2WLB A;  1TS3 A;  2BS2 B;  4P1C C;  3TEX A;  5JZE B;  2O2V B;  4K7U A;  1QOA A;  4FAD A;  2GMI C;  2Y5B B;  4BFR A;  1KH0 A;  3PZ8 A;  2KC2 A;  1ACC A;  4PK1 A;  3RCZ A;  4WJN A;  2LMC A;  3OG5 A;  4J6I A;  1E7U A;  3KW5 B;  2PVG C;  2WDV B;  4HLE A;  1J7A A;  2UYZ B;  3IHP C;  3NS1 A;  2QHO A;  4RGN A;  4KZ0 A;  4YXD B;  2KDF B;  2QEJ C;  4GB9 A;  1MG4 A;  3T3O A;  1TBE A;  2HD5 B;  2BVC A;  2KFK A;  3AED B;  2J0K A;  5D6J B;  3HUI A;  1ISN A;  1K51 A;  3QAQ A;  2ZVN A;  4MGZ E;  1FO4 A;  4XDD A;  3Q3M C;  2D3B A;  2N7J A;  2V3N A;  2BW2 A;  1LXD A;  4AP4 C;  2K3U A;  1I35 A;  2RDG A;  2LJI A;  4TUU A;  1Z2M A;  2ZCC A;  3GOE A;  5E6O A;  5IN7 A;  3AE9 B;  1VCB A;  1V80 A;  2HTH A;  2I1J A;  3VTW A;  3PS6 A;  4B9K A;  5D3I B;  2XK5 A;  4OVU A;  3IBE A;  2IO2 B;  4M02 A;  5KHO A;  1FXT B;  4GDL B;  2WNM A;  3FC4 A;  1CJE A;  1VZ7 A;  1JML A;  2RD0 A;  1FPY A;  2BF8 B;  3CST A;  2LAS A;  3OJ4 B;  1T0Y A;  4B6W A;  4W9J A;  1SIJ A;  3TJP A;  3RUI B;  5CHF A;  4MEM A;  2L32 A;  4FJZ A;  2KWU B;  2W54 A;  2PE9 A;  3HIZ A;  3P2B A;  1KJT A;  2NCN A;  3EC8 A;  2AEH A;  1QOG A;  1SBB B;  1SE4 A;  3PHX B;  4IC7 B;  5TSS A;  4AUQ C;  4DHJ D;  3DCG A;  2JQR B;  5BMI A;  2M8S A;  2BYE A;  1V81 A;  4HDQ A;  4ARI A;  4KGS A;  3U2S C;  3ZJU A;  3Q8B A;  4PT5 A;  1Y8R C;  2KN4 A;  2G45 B;  4HPL B;  3TIX A;  2GI9 A;  3NY5 A;  5IOI A;  1WX8 A;  2JXX A;  4C00 A;  1D6E C;  2DZJ A;  4JWU C;  3A4S C;  2KO3 A;  1WF9 A;  2O2V A;  1MFW A;  4LDT D;  2ACZ B;  1EO6 A;  3BK2 A;  1F77 A;  2JRH A;  1YD8 U;  1KRH A;  3H6N A;  1OFF A;  1JRO A;  2O6V B;  3A4R A;  2X38 A;  1JAL A;  1FXI A;  3SDL C;  2MBQ A;  3JYU A;  3EGR A;  4USA A;  1E5W A;  4HCP B;  2C5L C;  2Y5P A;  4KIK B;  1TTN A;  3N1Y C;  1T0Q C;  3JVZ X;  3HRD D;  3PO0 A;  2AQ2 B;  2WP9 B;  2KLG A;  3PTF C;  2FUG 1;  3P4P B;  3Q8C A;  1SXT A;  4EE2 A;  3QCA A;  3KYC D;  4OVV A;  1N62 A;  1HQR D;  3EA6 A;  3NVV A;  1HE8 A;  2IND C;  3MJ5 A;  4EZK A;  5IP4 D;  2NS5 A;  5BYS A;  4MM3 B;  1PGX A;  4XE0 A;  2N4F A;  2FCN A;  3U30 A;  4K1R B;  3KH0 A;  5T8I A;  4Q2J A;  4DXF A;  4YTM B;  4ZHO A;  1PGB A;  4ZHP A;  4XC2 A;  1ZE3 D;  4HEA 1;  2G9H D;  2WXK A;  2L52 A;  3AXC A;  3DBH I;  4IWP A;  3HHM A;  4GDL A;  2Q5W D;  2WS3 B;  3I5J C;  3ML8 A;  1KLG D;  1NDD A;  5DCN A;  3IXS A;  4HKZ E;  1FFU A;  4K7W A;  4LCD E;  1FEH A;  1FRD A;  1D5X C;  4KDI C;  4HK2 A;  2LHE A;  1SJH D;  2NPT B;  2MJD A;  4ITK A;  1R4N B;  4BVU C;  4S0R A;  1UGM A;  1I4X A;  4RFB A;  2IDY A;  3HM6 X;  4RGO S;  4HKQ A;  3Q6B A;  2RGF A;  2MJ3 A;  2N9P C;  3TL5 A;  2WXM A;  1WZ3 A;  3KLS X;  3O65 B;  4EZJ A;  2O6V D;  1BT0 A;  4PS7 A;  5AZG A;  2WXH A;  5IKC M;  1NVI D;  2CJO A;  5H92 C;  1YJJ A;  5CHW A;  4REZ A;  3KWV A;  1HTO A;  1K53 A;  2WDQ B;  3A33 B;  2Y5C A;  3FIL A;  3WAM A;  1OGW A;  2IY1 B;  3RNB C;  1WI0 A;  3W1S A;  2O6V A;  1SSN A;  2PLP A;  1U4A A;  1FFV A;  5E6N A;  3A1Q B;  5EE9 A;  2LXA A;  1FNV A;  2REX A;  1I4G A;  2L1A A;  4CO7 A;  2W82 A;  1NEN B;  2DZI A;  4N9F 4;  2MBE A;  4W9I A;  2YEP B;  2IY0 B;  3OJ3 A;  1S1Q B;  1K52 A;  4KIK A;  4WIP A;  2I2Y A;  4ARC A;  3S2A A;  1QOF A;  3O13 A;  3DBH B;  5FK9 C;  2DNF A;  2IJ0 A;  3CIR B;  2K0P A;  3L13 A;  4DQO C;  2ZPN A;  1VR9 A;  1K50 A;  3AB5 A;  1CZP A;  3ZJT A;  3PRP B;  4YL8 A;  1IUE A;  1C4C A;  1YX6 B;  1STE A;  2KTR A;  4ZRK A;  1AWD A;  3MHS D;  4AJW A;  2IBI B;  2NTT A;  1WMH B;  4OZA A;  4P7I A;  2KMC A;  1YQ3 B;  4MM3 A;  3ZNG C;  2L00 B;  3PZ7 A;  1F2R I;  2HJ1 A;  1E8Y A;  1I4R A;  2IGG A;  1LFD A;  3V6C B;  4LK0 M;  4JGH B;  5LXI B;  1UD7 A;  2AYO B;  2LGI A;  5L95 C;  5IO9 A;  3N20 C;  4DBG A;  1YIW A;  1GC6 A;  2INN E;  4ZYS A;  3ZNZ B;  3H1U A;  2M0X A;  1TGZ B;  3PHW B;  1XLN A;  4FN2 A;  3X23 A;  2WU5 B;  4DHZ E;  1ET6 A;  3AEF B;  1JRP A;  4G50 A;  1M4V A;  3NVW A;  5E6P A;  4HRS A;  1YQB A;  4ZYN A;  4XGA B;  2EEL A;  2XBB C;  2GOW A;  2M19 A;  1MHH E;  1TS5 A;  2PVO D;  2N0S B;  4KKI A;  5G5G A;  2GLS A;  4G11 A;  1SE9 A;  1V5T A;  1V1P B;  3Q8A A;  2KAC A;  1TS2 A;  1WJU A;  1MVK A;  2JZ3 B;  1EU4 A;  4BBN C;  4NJ7 A;  4BKT A;  3LYY A;  2KX3 A;  3ZXV A;  4E74 A;  4NQK E;  1BUI C;  2PJH A;  3DBR I;  4LLG M;  2LUM A;  4XYC A;  2K25 A;  2QC8 A;  2ZPY A;  1WH3 A;  2WXL A;  1LQB A;  3PPA A;  2ONQ A;  2RDH A;  1WXM A;  3A1Q A;  2C9W B;  3GZN B;  1JRU A;  1L6U A;  4XWT A;  3ZNI D;  2XN9 C;  4JL9 A;  3U7Z A;  5D2M B;  4NNJ B;  2VRR B;  2KDM A;  1QKZ A;  3PGE A;  4LJP B;  1SJE D;  4H2A A;  1VD2 A;  1JWU D;  3PLU A;  3QC8 B;  4YT0 B;  1YQ4 B;  1XCT L;  5MPO A;  1RM6 C;  4L2Y A;  2V1Y A;  2Z0D B;  1C4A A;  4FUL A;  2IGD A;  4IG7 B;  4GGQ A;  2XEW A;  2JYT A;  2KTF A;  2HE7 A;  1P7E A;  1KFY B;  4TQ1 A;  2FE8 A;  2KZR A;  4PYU A;  2MQJ A;  2PPH A;  4OZC A;  1A5R A;  1YJI A;  4FA6 A;  3RYT A;  2JUO A;  4GSW A;  2HDE A;  2WDR B;  3BYY B;  1TZO A;  3WAP A;  1N60 A;  2D3G A;  2IPK D;  1AYF A;  3MC0 B;  1GJZ A;  2K5P A;  1Q1O A;  4DHZ B;  2XNA C;  4M8N A;  3APC A;  3GE8 C;  4MGK E;  2MBH A;  1EF1 A;  3B0A A;  5CHV C;  2R2O A;  3SD5 A;  1UUP A;  4FBJ B;  3IG3 A;  4LNF A;  2W55 A;  4LNN A;  3U7D A;  4EFO A;  1PYW D;  3T9L A;  4NJC A;  2X8X X;  4D2K A;  4LJO B;  1VZ6 A;  2IO0 B;  1GAQ B;  2RPV A;  2RR9 A;  1UZX B;  1Z5S B;  4DHJ B;  4DWF A;  3IAM 1;  2V0G A;  3WIM A;  1V97 A;  4ANV A;  3B1L X;  3EFC A;  2UU7 A;  4IM0 A;  4F1S A;  2JX5 A;  1V1P A;  1T3Q A;  2YEP F;  2WXI A;  3Q3N C;  1ZDX A;  2KQS A;  4AJY B;  2CHZ A;  1JWA D;  4LDT B;  2G4S A;  2KDE B;  1P3Q U;  3NG0 A;  3DBS A;  5DPS A;  1OQR A;  1T5X D;  1TJE A;  1UBQ A;  4IM3 A;  3GS2 A;  3QHT A;  2LUE A;  1JWM D;  4P16 A;  2ZNV C;  5JH5 C;  3AE5 B;  3PVL A;  3EHV A;  1GNU A;  1XLQ A;  2KN5 A;  2DBY A;  2N9L A;  2GBM A;  3NZ3 A;  2NMQ A;  3NVY A;  4IDI A; 
#chains in the Genus database with same CATH homology
 3HRD D;  3PO0 A;  1JW9 D;  2AQ2 B;  3B9J A;  5C2T B;  2WP9 B;  2FUG 1;  1DOI A;  3P4P B;  3Q8C A;  1WSP A;  1I7H A;  1SXT A;  2DLB A;  4EE2 A;  1KLU D;  2JXT A;  1N62 A;  1HQR D;  4N6E B;  1BXT A;  4TSS A;  3TEY A;  3EA6 A;  3NVV A;  1E9M A;  1C78 A;  2KQ4 X;  4R3D A;  1MPE A;  3MJ5 A;  1FMA D;  1FCC C;  1Y56 A;  4RGM A;  1FM0 D;  5JXV A;  3W5V B;  3NVZ A;  1VLB A;  1HA5 A;  1UNS A;  5D3D A;  5BYS A;  1KTK A;  4MM3 B;  5I4D A;  1PGX A;  3AE6 B;  3DWM A;  4XE0 A;  4CQN A;  1I4Q A;  1C76 A;  4IKG A;  4JX1 C;  3C8Y A;  4Q2J A;  5T8I A;  1V1O A;  2CJN A;  3U4E G;  4DXF A;  4YTM B;  4ZHO A;  1PGB A;  4ZHP A;  4KGR A;  1JCK B;  3AE7 B;  4P6V F;  2TSS A;  1ZE3 D;  4HEA 1;  3U52 E;  2G9H D;  2WXK A;  2L52 A;  4XDC A;  2IGH A;  1T6B X;  2ZW0 A;  2DYO A;  2MH7 A;  3AM9 A;  2LHD A;  1A70 A;  2Q5W D;  1EWC A;  3WCQ A;  1IBX B;  2WS3 B;  3ETR A;  3P4S B;  2R61 A;  4IOI E;  4HJG E;  2MEK A;  1R7S A;  5E6J A;  2BB6 A;  1KLG D;  5BMH A;  5BYR A;  3IXS A;  4HKZ E;  1FFU A;  2PW9 A;  3AH7 A;  1DGJ A;  1FEH A;  1BML C;  2AQ3 B;  1FRD A;  3URY A;  1D5X C;  3VQI A;  1ET9 A;  3KWL A;  2INP E;  2WXO A;  2E3T A;  1I4H A;  5HG2 A;  2LHE A;  1SJH D;  1KF6 B;  1N5W A;  3W9C B;  1XO3 A;  1TYG B;  1MHX A;  2WQY B;  2MJD A;  4ITK A;  2I38 A;  3RPF C;  3E9S A;  1XLO A;  2Z8L A;  4C80 A;  1SF0 A;  2J42 A;  2PMV A;  1VRA B;  5HFY A;  3LXF A;  1Q10 A;  1I4X A;  4RFB A;  2IDY A;  4OW0 A;  2J4X A;  4RGO S;  4HKQ A;  1C79 A;  4MH8 A;  3SR6 A;  1VZ8 A;  2MJ3 A;  4N59 A;  1F0Z A;  2WXN A;  2W3R A;  2WXM A;  3AEA B;  3KLS X;  3V05 A;  3TUO A;  2OED A;  2PKO A;  3AE8 B;  4RF0 A;  3NRZ A;  4A6Q A;  1YN4 A;  3FIL B;  2VZK B;  3BVZ A;  3R2I A;  1IGD A;  2WXH A;  2H89 B;  3AE3 B;  1NVI D;  2CJO A;  3J9C A;  2M56 B;  1YJJ A;  4RF1 A;  5H92 C;  4OZB A;  4YTN B;  4REZ A;  4B0E A;  1YNT E;  2DWQ A;  1QF6 A;  3KWV A;  1K53 A;  2WDQ B;  2WXQ A;  2PTL A;  1J7C A;  3Q69 A;  1B9R A;  2Y5C A;  3FIL A;  1QOB A;  5EE3 A;  1FXA A;  3E56 A;  3W1S A;  4NAM A;  1FD6 A;  1SSN A;  2SAK A;  2PLP A;  3VR9 B;  1TKE A;  2QSD A;  1FFV A;  1EWY C;  2ICI A;  3VRA B;  2MJE A;  5EE9 A;  4B0M A;  1NEK B;  1J7B A;  4WUR A;  2JZP A;  1JQ4 A;  1FNV A;  4YSY B;  4J3O D;  3AEG B;  1I4G A;  2L1A A;  3V3X A;  2W82 A;  1NEN B;  2HTM E;  1FNW A;  1N63 A;  3TEZ A;  1F2R C;  4DXG A;  1SEB D;  1UWM A;  2QJL A;  3ABV B;  2YEP B;  2BYT A;  3ZJV A;  1E6E B;  1PFD A;  2BS3 B;  3HVZ A;  1K52 A;  4A8X C;  4WIP A;  2I2Y A;  4ARC A;  3B2G A;  1QOF A;  2JWU A;  4JPS A;  3O13 A;  2RMM A;  1C9F A;  2QIE B;  4XWW A;  5FK9 C;  1SE2 A;  2IJ0 A;  3IT6 B;  3CIR B;  4ZRQ A;  1L0V B;  1V8C A;  2K0P A;  2NTS A;  1FIQ A;  1SB3 C;  5BYQ A;  1RYJ A;  3BYT B;  1DOY A;  4DQO C;  1VR9 A;  1K50 A;  1WRI A;  3AB5 A;  1CZP A;  1WGK A;  3ZJT A;  3CWI A;  4YSX B;  1UGJ A;  1QLB B;  1IUE A;  1TKY A;  1C4C A;  1SE3 A;  4YSZ B;  3UI3 A;  1STE A;  1AWD A;  1N61 A;  4NZL B;  3ZQ4 A;  2NTT A;  2W3S A;  5D7G A;  3BZD B;  5C3J B;  4OZA A;  1UWX A;  3SEB A;  1YQ3 B;  3IT4 B;  3AE4 B;  3AE1 B;  3AEC B;  3BK1 A;  2WXJ A;  2H88 B;  3PZ7 A;  1NYR A;  1F2R I;  4C7Z A;  1WYG A;  1I4R A;  2J53 A;  3R8B A;  2IGG A;  2D5G A;  3SFD B;  1ZUD 2;  3AEB B;  4LK0 M;  3I57 A;  2BS4 B;  4RCO A;  4A9A A;  1QQR A;  1B1Z A;  2LGI A;  1WWT A;  1E0Z A;  4MAC A;  1GB4 A;  1IBX A;  1XEE A;  1GB1 A;  3BWU D;  1YMH E;  2INN E;  4ZYS A;  1JWS D;  1XF5 L;  4OVZ A;  1XLN A;  1HEZ E;  2WU5 B;  1ET6 A;  3GB1 A;  3H8H A;  3NUH B;  1YN5 A;  1JWB D;  3N9Y C;  4WWM A;  3AEF B;  1JRP A;  3L4P A;  4US9 A;  4LTU A;  4C7Y A;  1FRR A;  1M4V A;  3NVW A;  4WH4 A;  4HRS A;  1NI3 A;  1E10 A;  2KWD A;  2BTE A;  1N5X A;  1TS4 A;  2AQ1 B;  4AQ7 A;  2EEL A;  1DYQ A;  5GXG B;  2M19 A;  1MHH E;  1TS5 A;  1PGA A;  2BT6 A;  2EKI A;  2PIA A;  1ZP0 B;  2PVO D;  2WXG A;  3R2T A;  3GP7 A;  2N0S B;  2M0A A;  4KKI A;  5G5G A;  2VZK D;  4KKJ A;  4US8 A;  2WU2 B;  3FAH A;  1WXQ A;  1D4B A;  4TQ0 A;  2LFI A;  1HXY D;  3P1M A;  2WLB A;  1V1P B;  1PUT A;  3Q8A A;  3MFG A;  1TS3 A;  2KAC A;  1TS2 A;  2BS2 B;  3LB8 C;  2N9K A;  3ZGZ A;  1HZ6 A;  1MVK A;  1EU4 A;  3TEX A;  4GLS C;  2WXF A;  1QOA A;  1VJK A;  3AN1 A;  1GPX A;  3MP9 A;  5LNK 1;  1P7F A;  3LYY A;  1KH0 A;  3Q8E A;  2Y3A A;  3PZ8 A;  1DOX A;  2B76 B;  1BUI C;  1TY0 A;  1ACC A;  1GOZ A;  4LLG M;  4N58 A;  2LUM A;  4JE3 B;  4MT5 A;  3P4R B;  2LMC A;  5FR3 A;  2JU6 X;  5HHD G;  2AX5 A;  3W5U B;  2DYM A;  5FKA C;  3BVG A;  2PVG C;  1L5P A;  1RWS A;  1OQQ A;  2WDV B;  1J7A A;  2BBC A;  2WXL A;  3AEE B;  4ZRP A;  3NS1 A;  5BMG A;  3P42 A;  2ONQ A;  2RDH A;  3P4Q B;  4RGN A;  4GDK B;  4A90 A;  1L6U A;  4YXD B;  2QEJ C;  2QIL A;  3AV8 A;  4XWT A;  3T3O A;  2OHF A;  2QMT A;  4AS1 A;  2XN9 C;  2J52 A;  3AED B;  3HUI A;  1PDX A;  2JSV X;  1K51 A;  3U7Z A;  1MI0 A;  1TKG A;  2KDM A;  1QKZ A;  2LEK A;  1FO4 A;  2K9X A;  4XDD A;  3BVM A;  1SJE D;  1ZXI A;  1CQV A;  4H2A A;  3OWE B;  1ZPS A;  4L23 A;  2GRI A;  1JWU D;  2N7J A;  2V3N A;  4YT0 B;  1CK1 A;  2L83 A;  1EU3 A;  1ESF A;  1YQ4 B;  2BW2 A;  3HVD A;  1ENF A;  3P63 A;  1XCT L;  5MPO A;  1RM6 C;  4RNA A;  1D5M C;  4L2Y A;  2BB5 A;  3ZYY X;  1C4A A;  2IGD A;  5AUK A;  2K3U A;  5EE1 A;  2RDG A;  2LJI A;  3BII D;  5EE0 A;  2JYT A;  1EM7 A;  4WQM A;  1P7E A;  1KFY B;  5H8Y E;  2KMM A;  3AE9 B;  2FBW B;  1QIL A;  4TQ1 A;  2FE8 A;  4TMA B;  4OZC A;  1C4P A;  1L4Z B;  2GB1 A;  1YJI A;  3EUB 2;  3VR8 B;  5D3I B;  3T3N A;  1D5Z C;  1L6V A;  2HDE A;  2WDR B;  3BYY B;  1TZO A;  4GDL B;  2WNM A;  1N60 A;  2IPK D;  1RFK A;  3FC4 A;  1AYF A;  4RGT A;  5AUI A;  3MC0 B;  1CJE A;  4L1B A;  1IGC A;  2K5P A;  1VZ7 A;  1JML A;  1E7P B;  3RFZ B;  1LO5 D;  1XCQ L;  4OHJ A;  3TEW A;  2WXR A;  2XNA C;  4KX6 B;  1ZOY B;  4JWS C;  4HRO A;  1C77 A;  3AE2 B;  4O1N A;  2V4I B;  1SIJ A;  2L32 A;  3AMZ A;  2V3P A;  1FNU A;  1UUP A;  2W55 A;  2W54 A;  4A55 A;  1AW7 A;  1L0Y B;  1L4D B;  4RH6 A;  1QOG A;  1PYW D;  1SBB B;  1SE4 A;  1VDV A;  1YN3 A;  5TSS A;  4NJC A;  2KAJ A;  2WXP A;  2JQR B;  4FXC A;  4D2K A;  5BMI A;  1VZ6 A;  2G1E A;  1TY2 A;  4ARI A;  4KGS A;  3U2S C;  3ZJU A;  1GAQ B;  2E6X A;  2RPV A;  3Q8B A;  3IAS 1;  3IAM 1;  2V0G A;  4PT5 A;  1V97 A;  4UDU C;  2ZW1 A;  4KGT A;  2KN4 A;  2CU3 A;  2GI9 A;  2JX5 A;  1V1P A;  2ON8 A;  1T3Q A;  2YEP F;  4ZOH C;  3TSS A;  1D6E C;  4C56 C;  4JWU C;  2WXI A;  1ZDX A;  3SFE B;  2ACZ B;  1QT9 A;  1XXG A;  3BK2 A;  4M0W A;  1HZ5 A;  1ZDV A;  1AN8 A;  1F77 A;  1KRH A;  1JWA D;  5G5H A;  1OFF A;  1JRO A;  1NYQ A;  2X38 A;  4WAF A;  1OQR A;  1T5X D;  1JAL A;  1TJE A;  3DWG C;  1FXI A;  3GS2 A;  3I9V 1;  3Q8F A;  1I4P A;  4NAW B;  1L0X B;  5HI1 A;  1JWM D;  4P16 A;  1ROE A;  2K22 A;  1FCL A;  3EGR A;  2SEB D;  3MHZ A;  3VRB B;  2JYE A;  4YWG G;  3AE5 B;  4YTP B;  4USA A;  3B2F A;  1XLQ A;  3KQ4 A;  1ZXH A;  2DBY A;  3W2D A;  2N9L A;  2Y5P A;  3NZ3 A;  2NMQ A;  1XLP A;  3NVY A;  4IDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...