3PZ7A

Crystal structure of ccd1-dix domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
86
structure length
86
Chain Sequence
PHMSSTCTKVLYFTDRSLTPFMVNIPKRLEEVTLKDFKAAIDREGNHRYHFKAMDPEFGTVKEEIFHDDDAIPGWEGKIVAWVEED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Dixin
publication title Molecular basis of WNT Activation via the DIX-domain protein CCD1
rcsb
source organism Homo sapiens
total genus 17
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00778 DIX DIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.380 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3pz7A00
3PZ7A 2D5GA 1WSPA 3PZ8A 4WIPA
chains in the Genus database with same CATH superfamily
3VR9B 1XLOA 4WWNA 3H9DA 4YXDB 5L83A 3H7SA 2B76B 3RNAC 3VAWA 5EE0A 2KDMA 2LXCA 4IWPA 1HTQA 4A6QA 2AEHA 1HQRD 4B0MA 1XLPA 1TT5B 2DAJA 2M4NA 2Y5PA 2Z8LA 4TMAB 4EFOA 1TZ1A 3AU5A 1FMAD 2W9NA 1STEA 3L08A 3UINB 3B9JA 5EE1A 2LGYA 2OEDA 1T6BX 1SE9A 2LVOA 1OGWA 5D3DA 3IT4B 5G55A 3ZJUA 3JVZX 3NOBA 2PE6B 2QDFA 2LVPA 4FA6A 5C1ZA 4IKGA 2K8HA 3B2GA 1HE8A 3SDLC 4F7ZA 2MCNB 2QC8A 2L32A 4EZKA 1P7FA 2LJIA 3ZXRA 3QC8B 5L95C 1SEBD 2INDC 3W2DA 2N9EB 1WXAA 5H92C 2LMCA 4RNAA 2WNMA 4GSWA 1K52A 2PTLA 2IPKD 2PE9A 2BBCA 2WX1A 4IWOA 5FK9C 4G3XB 1EUVB 2MBQA 1NI2A 2INPE 3DBHI 4K1RB 3A33B 1I4XA 3APDA 3EGRA 3Q6BA 1ET9A 2JSVX 1OFFA 2LVQA 1YJ1A 4OVUA 1PFDA 1UGMA 2DNFA 3AH7A 4N9F4 3DOWA 1DYQA 4OHJA 1QF6A 2QMTA 2KT7A 3I9V1 2JZPA 2NBVB 2PEAA 1L0VB 2D07B 4M0WB 2FE8A 3NS8A 3AE2B 3WANA 3Q3FA 3Q8AA 4K7SA 5BMIA 2XK5B 2MH7A 3A1QA 4KVGB 4EOYA 3VUXA 3AN1A 2M0XA 3RNFC 1T0SC 1ZDVA 4II2B 2Y5CA 5G2NA 4JX1C 4I6PA 2QCZA 4NAWB 1MG8A 2MEKA 1E7PB 2O6VD 3QIJA 1I42A 3B0AA 4MT5A 3VH3B 3UQBA 1WIAA 2MSED 2PKOA 3A9JA 4FXCA 1TTNA 1SBBB 2L1AA 3R2TA 2UU7A 4LDTB 4HK2A 4RGMA 4RGNA 3OJ3A 4YTPB 2N7JA 3TJPA 1C9FA 1WJ6A 1C4CA 3V05A 1RRBA 1SE4A 3T8MA 1KOTA 4WH4A 5HFYA 3BVGA 4US9A 4RM8A 1D3ZA 3Q8EA 1E5WA 2WXIA 1JRUA 3C0RB 2IGHA 4YSYB 3NG0A 3Q3OC 1MVKA 4RF1A 4XE0A 2C7MB 5E6JA 1F2RI 2FBWB 3ZRCA 2WXQA 1QOFA 2X8XX 1IGCA 2JZ3B 4IWQA 1N63A 2WQYB 4JGHB 1UUPA 2ZW1A 3B08A 1QQRA 1E10A 1PQSA 2VZKB 3AULA 1L4DB 3DBLI 4BFRA 2ZNVB 1WGDA 3AU4A 1SJED 2WDRB 1WR1A 1ESFA 3AEFB 2RSUA 3H8HA 3ZYYX 2TSSA 4HCNB 2KVRA 1GC7A 2FAZA 1XLQA 4XGAB 2W55A 4WJOA 3KWLA 1JWAD 2L76A 4W9KA 2JPHA 2HDEA 4F8CB 4WURA 3ONSA 4LDTD 3U7ZA 1PYWD 2M17A 3WAPA 3GS2A 3CSTA 3NUHB 1XT9B 2ZVNA 4N58A 1YD8U 1QOAA 3EC8A 1T3QA 5G5HA 4WIPA 1LM8B 4M01A 1YOVB 2IY0B 1Q5WB 2BS4B 2JRHA 3AM9A 4HRSA 4C00A 1JMLA 4HJKA 2L52A 3N3KB 1C4AA 3C8YA 4IG7B 4YL8A 1EO6A 2DZKA 2EELA 4W9LA 5FKAC 1GAQB 4JPSA 2KMAA 2IO3B 4KZ0A 4HVBA 4WJNA 3RNCC 2BB6A 2QHOA 1GB4A 1NDDA 3FKYA 3TCAA 3LJ3A 2MW5A 1MI0A 3Q8FA 3ZJTA 1SE2A 2VZKD 2KO3A 4HPPA 4LK0M 3VR8B 2KDEB 2WP9B 1F2RC 4YT0B 3SFDB 1ET6A 1T0QC 3NVWA 4P6VF 4FHJA 1NENB 3VDZA 1WXQA 4IM2A 5BO4B 3RULA 3A9KB 4ZRQA 3WAMA 2YEPF 2VRRB 1GPXA 4BKSA 2D10A 3N1XC 2BYEA 3KUDB 3SD5A 2KX3A 3WIMA 2LGSA 1YX6B 3EFUA 4AOFA 2MLBA 4GDKB 2QILA 1XCQL 4IUMB 1L0YB 3NHEB 3MJWA 1B1ZA 3A9JB 4NJCA 1L7YA 3VTUA 1A5RA 1EWYC 2X38A 4ACFA 3P2BA 1LGRA 1WE7A 1H4RA 2E6XA 1C78A 4MDKE 3MHSD 1CK1A 5LXHA 1WGRA 2JXTA 4AS1A 2RDGA 4P1CC 1F0ZA 1ISNA 2I1KA 3PV1A 4IM3A 1NEKB 1CQVA 4KKJA 2QIEB 1WMHA 3ZVVA 1C79A 2C7HA 2WXHA 3RUIB 1WRDB 4KZCA 1KF6B 3ZNHB 4DDID 1JWSD 4KIKA 5J2RA 5LXIB 1JCKB 4B9KA 2BB5A 3QARA 5HI1A 3DHIC 3RFZB 2EMTA 1E9MA 2JXXA 2L00B 4HCPB 3A4SC 2LXAA 4E3CA 1HZ5A 1OQYA 2JYEA 3DWGC 3RZFA 4AWJA 1BXTA 2KVZA 2BTEA 3JYUA 3PZDA 4FJYA 3LXFA 2N9LA 2WXPA 5IN7A 2BVCA 4ANXA 1JWUD 2XEWA 3M62B 1S3SG 1FXTB 2C9WB 3AEBB 2MBEA 3W5VB 1OQRA 1LO5D 2LD9A 4FULA 5J18A 2N9XA 4X57B 5BMGA 4CO7A 1D5XC 3RI7C 3JW0X 1N6ZA 2IBIB 3AMZA 3RNEC 5E6OA 4KX6B 2G9HD 4BAXA 1M4VA 2RMMA 4D2KA 3ZW3A 2D11A 3TBLD 4EZLA 3AEGB 5JHAA 4C4VA 1PGAA 1HA5A 2O6VA 2LUMA 2LI5A 5E6PA 4URKA 1A70A 3DHGC 5IAAC 3AE8B 5D6JB 4JQWC 4RGOS 2JYTA 1J7CA 1P1AA 1V2YA 2ZCBA 3VHTC 2Y3AA 2NTSA 2N9PC 2M8SA 2H88B 3PT2B 2V1YA 4JWUC 2BF8B 4BOSC 2LGIA 4HKQA 3CWIA 4K3CA 1JQ4A 2NCNA 3C19A 2KWDA 4WQOB 1WWTA 4ZOHC 2RD0A 1XXGA 3M3JA 2K22A 2MQJA 2LASA 3U7DA 3TEXA 2BGFA 1I35A 1WXVA 1TKYA 2DHZA 5E6NA 5BMHA 3IAM1 2REXA 2NVUI 1FRDA 2KYWA 3VRAB 3KUCB 2DBYA 2K3UA 2WXLA 3RZWC 2A5UA 2LRUA 1ACCA 2DENB 1FCCC 2CR5A 3W1YA 1VRAB 4DXAB 3QWZB 2KACA 2A4ZA 3Q2AC 3ENEA 3MC8A 2KN4A 3AE1B 2L0TA 2IZVB 1IYFA 4L2YA 2AL6A 1KH0A 4LNIA 5DPSA 3NZUA 5C3JB 1X1MA 2RGFA 1C3TA 3HK0A 3WCQA 2Q5WD 3P63A 4K7WA 2JWZA 3OWEB 3TEYA 1WMHB 4RGTA 5GMVA 2GI9A 1YIWA 1EM7A 3H7PA 3X0WA 5LLIA 2KQ7A 2K5PA 3ML9A 4MACA 2B3AA 1UZXB 3T3OA 3P1MA 1UBIA 4E71A 1E7VA 1XCTL 1KM7A 5TR5A 4JIOU 2W54A 1IPGA 2NR2A 4OZBA 3AEEB 4IDIA 3PHXB 1PGXA 1MFWA 1WJUA 2IY1B 1WGKA 2HD5B 2KLGA 4Q2JA 3AE3B 4W9IA 2FUG1 4W9JA 1JROA 2JZZA 3BYTB 4DDGD 3DBHB 4RCOA 2G3QB 3AE9B 1ZP0B 4PS3A 2HTME 3TL5A 4ARIA 3BWUD 3U4EG 3HM6X 2E3TA 3LB8C 5AZGA 5MPOA 4H2AA 2ICIA 1J0GA 2M1MA 4W9DA 3N32A 2BKFA 2KDBA 2GMIC 1ZUD2 2PPHA 2KWCA 2V3PA 3DCGA 2FUHB 2LHDA 2MBOA 3RCZA 4YTNB 2OJRA 3AV8A 2EKEC 4XDDA 3M63B 3VVWB 2JQRB 2IGGA 3VH4B 2ZVOA 4GDLB 1WI0A 4MGYE 2JX5A 3RPFC 2K6DB 3ZXVA 2JVCA 5FR6A 3P4PB 2AYOB 2YEPB 5J17A 3WAOA 1TIFA 4TQ1A 4BKTA 2K25A 1HXYD 2ACZB 2K0PA 1JW9D 4O1NA 4HLEA 2WLBA 1UF0A 2FCMA 2O2VB 1JALA 2RDHA 5DPWA 1WFYA 1QT9A 1FFVA 4ASWC 2I38A 1YQ3B 4UDUC 3N30A 2SEBD 3QJZA 1F9JA 4KKIA 3TIXA 3CIRB 3GZNB 1V5OA 3HM3A 3Q8BA 3FC4A 2IO1B 4XDCA 3VFKA 3UQAA 2PVOD 3H6NA 2KX0A 1YN3A 2FIFA 1L0XB 1NVID 5GXGB 5D3IB 4EZJA 2BWES 1CMXB 4KSLC 1NYRA 2OHFA 1Q1OA 4HDOA 1VR9A 2ZCCA 1VDVA 1XEEA 1S1QB 2IO0B 4LNKA 3R8BA 1V6EA 1FIQA 1SIJA 3MFGA 2KTRA 4FJZA 5AUIA 2J53A 3EECA 2LWPA 2MA9B 3DBLB 3GE8C 3ZUNA 3VQIA 1R4MI 2QSDA 3ZGZA 1K53A 2AQ3B 1TJEA 3DBRI 5DPRA 2MP2A 4LJPB 1ENFA 1V80A 2NPTA 3H7PB 1IBXA 2C5LC 1FO4A 1DOXA 1FEHA 3FAHA 2N0SB 4YSXB 1E90A 3NZSA 2KTFA 5CTRC 2M19A 5DCNA 1EU4A 1DOYA 3O13A 3BINA 1YQ4B 2ASQA 3MTNB 4JLCA 3ZNID 2CHZA 3AE5B 2V4LA 4KV2A 3UIPB 3L13A 2IO2B 1TY2A 1LFDA 2W3RA 3EHVA 1CZPA 2LFIA 2BT6A 2G45B 2LEKA 1HZ6A 2ZZPB 1RFAA 3KVFB 4US8A 1EU3A 2DZJA 4ICUA 2PMVA 3VUWA 2L7RA 2N1VA 1FXAA 1CJEA 1WH3A 5HKHA 1V1PA 2G1EA 1MG4A 1U4AA 1PGBA 2K39A 2L83A 2R2OA 4DXGA 4MJSA 4AJWA 4LTUA 4WAAA 5BYQA 4GB9A 4DBGA 3PLVA 2V4IB 3TEWA 1KLUD 3DVGX 5JZEB 1WM2A 1FCLA 4MSQB 1E8XA 3EA6A 2BPSA 4PYZA 2WXGA 2GBMA 5AUKA 4KGRA 5IA7A 3V60A 4P16A 5JXVA 4ANWA 2NS5A 1V86A 5HG2A 2BYVE 4NJ7A 4EEWA 1WJNA 4RMAA 3GOEA 3LDZE 3W9CB 5JHBA 4A55A 4II3B 3APCA 3FILA 5KHOA 5BYSA 3M95A 3P4SB 3K9PB 2KJRA 4GLSC 5D2MB 3ETRA 3Q8CA 3ZNZB 1J19A 2KC1A 1YJJA 5IP4D 3MJ5A 2KK8A 1TS5A 2WXRA 3J9CA 1C1YB 2Z59B 1WRIA 4JE3B 3N20C 3A1QB 1KJTA 2NMQA 4IC7B 3RNGC 1RFKA 3R66C 4PYUA 2KFKA 3V61A 3IXSA 4NZLB 1F52A 3ZTCA 3S2AA 3RYTA 2DZMA 4C80A 5H8YE 3PRZA 4WJQA 1AW7A 5D7GA 4A3OA 4J6IA 3NVZA 4NQLB 4DHJB 1VZ7A 1WGGA 2M56B 1WXMA 4EE2A 1N62A 2UYZB 3MC0B 1WR6E 2IJ0A 1J7BA 2BYFA 5EE9A 1I7HA 1KFYB 1WYWB 3ZNGC 1KLVA 3QA8A 4ANVA 3Q14C 1D5ZC 1KRHA 1YQBA 3WALA 1E7UA 1V5TA 1H8CA 2D3AA 2AQ1B 4HPLB 4BBNF 4S17A 2XN9C 1NI3A 1SXTA 2G4DB 4HEA1 1GUAB 2WDQB 2BW2A 3HUIA 1AYFA 1VD2A 3V3XA 1I4QA 2KD0A 3IAS1 1OQQA 1XLNA 3ZDMC 1WM3A 1P98A 4XC2A 1P9DU 2LGXA 3DQVA 3QAQA 2DAFA 2V0GA 2D5GA 1TGZB 1WX7A 2FCSA 3I57A 3ZLZA 2J42A 4A20A 4TV3A 1WGYA 2CU1A 3BVZA 4M8NA 4KDIC 1MHHE 3PZ7A 3I63C 3RMKC 1R4NI 2BQQA 4DK5A 3AXCA 1FRRA 4FADA 1QILA 1FM0D 4IW0A 1WX9A 2RR9A 1BT0A 1XO3A 2FIDA 4WAFA 1GC6A 1T0YA 3TEZA 4NJ6A 1RYJA 3NRZA 2KN5A 4ZRJA 4QAYA 3N1YC 4M8MA 2EMSA 1OEYA 1Z5SB 1TY0A 2H89B 1P0RA 1QLBB 2IYDB 4BKGA 2GBNA 2PIAA 2QEJC 5JH5C 2PJHA 3X23A 2LGDA 1WYGA 1TYGB 1C4PA 3TUOA 2EKIA 4DHZB 4F1SA 4KDLB 1V9JA 1E8YA 2GLSA 1MJDA 4AJYB 2KQSA 2JF5A 2CHWA 2WU5B 2KMMA 2C60A 5C2TB 3SU8X 4A9AA 3AECB 1EWCA 1RWSA 3T3NA 3VTWA 1E8ZA 4TQ0A 1GG3A 3FILB 3D32A 2LRWA 2YLMA 4MH8A 3R7RA 1SIFA 2V3NA 4USAA 4HXDA 1SGHA 2WXOA 4FLHA 1T0RC 3LYYA 3DHHC 1AARA 1MPEA 1WE6A 1F77A 1WJ4A 4ICVA 4YWGG 1L2NA 1SE3A 1C76A 4G50A 3ZQ4A 2KFKB 4IM0A 3IHPC 1UWMA 1YJIA 2HJ8A 4M0WA 3GP7A 1D6EC 1SF0A 2BKRB 3UGBB 3SHQA 2G4SA 2XK5A 3NS1A 1XD3B 4ZDVA 3H1UA 3ALBA 3HRDD 3P4QB 3URYA 1K51A 4PT5A 4W9EA 2KQ4X 3NJTA 4NAWA 2W82A 4JWSC 1UWXA 4IOIE 1TBEA 3QCAA 1LXDA 1SJHD 2AWTA 2WYQA 1ZOYB 4N59A 1NBFC 4K7UA 2JRIB 2KWVB 3GB1A 1FFUA 4DQOC 4BZAA 4RFBA 4A8XC 2GBKA 4GIVA 5T8IA 2HJ1A 1YN5A 4KIKB 4ANUA 2LUEA 2K9XA 1NYQA 3IVFA 1MHXA 3OAWA 3KWVA 1WX8A 4EUTA 3RT3B 4NY0A 3W1SA 4NQKE 1ZE3D 5AZHA 2SAKA 4C56C 1HEZE 4OVVA 5BYRA 4BKSD 4K81A 3U30A 3BZDB 3DPDA 1Z2MA 2KOXA 3ABVB 2NBUA 2ON8A 1FXIA 4B6WA 3DBSA 4AQ7A 1E8WA 3O65B 3KYDD 2JT4B 4B95A 4J3OD 3Q3NC 1EF5A 3OLMD 1FPYA 3PLUA 3L16A 4G0NB 2D2QA 1GJZA 3KH0A 4NAMA 1WZ3A 3CF6E 2JUOA 4I6NB 1R7SA 2DLBA 1DOIA 4KGSA 4RM9A 2GB1A 3KW5B 3CSFA 4B0EA 2LZ6A 5D94A 2MRPA 4PS8A 2KANA 3Q69A 4C4VB 1UELA 3BYYB 4MEMA 4W9GA 4WWOA 1V8CA 4LLGM 4FHKA 4CYEA 2O6VB 1BMLC 2GOWA 1UD7A 2AL3A 1KLGD 3VRBB 4G11A 1VJKA 3EUB2 2WDTB 2K8CA 3KQ4A 2KXJA 1FNUA 2KHWB 1AWDA 2MBHA 3AB5A 2KC2A 2K8BA 1EF1A 1ZXHA 3GE3C 3N1ZC 1XF5L 4C7ZA 2D3GA 3HIZA 4P7IA 4YTMB 2D3CA 1YN4A 1KTKA 3BK1A 1R4MB 3PRPB 1GB1A 3DDCB 3AEAB 3VUYA 1HTOA 3DBRB 5CHVC 1E6EB 2HE7A 4ZRPA 1TKEA 3UIOB 4FJVB 3ZKJC 3A9KA 1YX5B 4E74A 2INCC 1N5XA 3HVDA 2KDIA 4ZHOA 4BOZB 1SSNA 1GOZA 2D3BA 5TSSA 4GDKA 3NY5A 3VTVA 4GMVA 1IGDA 4XWTA 3VXWA 2N7EA 3IG3A 2J0JA 1WY8A 2DYBA 3Q3MC 4XYCA 4LNOA 4XWWA 2OJWA 3E56A 4WWPA 4ZRIA 1Y8RC 1TS3A 1N60A 1C77A 2WHIA 4EKUA 1G6JA 4I6LB 4PS7A 2ZJDA 2AX5A 4XZ4A 2DWQA 4LNFA 3U52E 3SFEB 2PW9A 4NPNA 3DVGY 4KSKC 2CU3A 2J4XA 2MX2A 2YVCA 3GZNI 4DXFA 3JSVA 1AN8A 1E0ZA 1LQBA 3U2SC 1ROEA 2INNE 3PSEB 1K8RB 3L54A 4C7YA 2ONQA 5IO9A 1VLBA 4GN1A 2DX5B 3K9OB 1RM6C 1WZ0A 4LJOB 3I3TB 3DVNU 1WXSA 4ZRKA 2KFJA 2KNBA 2HTHA 3WA0A 3EFCA 4CHKA 2KJ6A 3QK0A 3N9YC 2PLPA 4TSSA 2N7DA 2MWSB 2V9HA 5IOIA 3BY4B 1PUTA 1OEYJ 1TS2A 2LHEA 5CHFA 1GNUA 2FCQA 1YNTE 1L6VA 1OTRB 3QQ8B 3ZTDA 3SR6A 2GRIA 2MJEA 4M00A 2WX0A 3RN9C 5EDSA 3PREA 1IUEA 1WGHA 4LCDE 3MP9A 2RPQA 1QOGA 2W3SA 4MM3A 2GBRA 2WGSA 1L4ZB 1JWBD 1ZKHA 4ZYNA 2KKCA 2AQ2B 3T9LA 2FNJB 2WXFA 3W5UB 1ZPSA 3NVYA 1VZ8A 2R2QA 3IT6B 3V6EB 3ML8A 3PTFC 1RLFA 2BWFA 2DYMA 1Q0WB 4KGTA 4HPMB 4S0RA 1I4RA 1Q10A 1M94A 3L17A 4HWIB 3PS6A 3R3MA 2MJDA 4TUUA 2N9KA 1FNVA 4WQMA 1UH6A 4W9CA 4YSZB 2IGDA 2KWUB 3QHTA 2CS4A 3IBEA 3QX1A 4BBNC 3PHWB 4AUQC 5G5GA 2XNAC 2WDVB 1QOBA 4REZA 2M0AA 1RAXA 1JWMD 2CHXA 2KLCA 1SB3C 2K1FA 4ZHPA 3B2FA 4DWFA 1Y56A 2V3SA 2J52A 3MHZA 1V97A 2L0FA 2PVGC 2ZW0A 1I4PA 2FCNA 4FBJB 2RPVA 1L6UA 1ZGUB 3MC9A 4M02A 3W1SC 2I2YA 2KTRB 3L0WB 3PPAA 4MGZE 4WJPA 4A90A 3I5JC 2DZIA 3AE7B 2RDBC 4OZAA 5FR3A 1I4GA 4JL9A 1R4NB 5KHQA 4OVZA 4ARCA 2L05A 2WXNA 2J0MA 2MP2B 4MELA 1P3QU 5EE3A 1WF9A 4LNNA 2NPTB 4OW0A 4R3DA 1IBXB 2ZNVC 3JSVB 3UF8A 1J7AA 1K50A 1UBQA 3DWMA 3A4RA 4WWMA 2KAJA 1VZ6A 3HVZA 2BS3B 1D5MC 3BIID 2WU2B 2Y5BB 3AE4B 1J8CA 4K3BA 1BUIC 2WXJA 1JRPA 5HHDG 3ZJVA 5I4DA 1TZOA 2GBJA 3IFWB 3R7QA 1TS4A 1WSPA 1UGJA 5CX3A 4DHZE 4DHJD 1T5XD 2IDYA 4P1BC 2ZPNA 3ZRFA 5CHWA 4OZCA 2N4FA 3AE6B 4XX5A 3P4RB 1V1PB 2L3ZA 3U8ZA 1V1OA 4FN2A 2DYOA 3BVMA 4GOCA 4CQNA 3DVNV 2JY6A 2N1WA 4MJSB 2J0KA 3RNBC 1FNWA 4MM3B 3PGEA 3PVLA 3OG5A 1ZW7A 1B9RA 5IKCM 4PK1A 2WS3B 1PDXA 1V81A 1YMHE 5C23A 3E9SA 3PO0A 4MGIE 3OJ4B 3TMPB 3KUZA 1F1HA 3B1LX 2Z0EB 3KYCD 2K6QA 2R61A 2CJNA 2VH1A 2MJ3A 3APFA 2JWUA 4GDLA 4BVUC 2JU6X 3BK2A 3P42A 4MH0E 2CJOA 1DGJA 3PRMB 3TSSA 4A3PA 2C7NB 4MGKE 2XBBC 5LNK1 1N5WA 2KZRA 2LJ5A 1ZXIA 2WXMA 1D4BA 4HDQA 4TKNA 3ZDTA 4MSMB 4HJGE 2MBBB 3ECIA 4N6EB 1QZEA 3V6CB 2L8JA 2Z0DB 2O2VA 2WXKA 1IP9A 3ZO5B 1TKGA 2OOBB 4HKZE 3AI5A 1ZDXA 4ZYSA 4GU2A 3UI3A 2J7QB 1I4HA 3R2IA 5AEKB 1FD6A 4GXBA 4HROA 4W9FA 3L10B 4AP4C 4RF0A 3HHMA 2NBWB 2ZEQA 1XQQA 2KMCA 2BS2B 4GGQA 2MHJA 3RD2A 2WWZA 2ZPYA 1VCBA 2UWQA 3NVVA 1QKZA 4W9HA 5DPTA 3AEDB 3L4PA 1UNSA 2NTTA 2VH2A 2CKHB 1L5PA 3NZ3A 3ZIMA 2QJLA 1P7EA 2I1JA 2KJHB 4RH6A 3KLSX 4ITKA 1V49A 2BYTA 3V62A 1N61A 3Q3JA 3PZ8A 3CMMB 4L23A 3SEBA 5AZFA 4NNJB 2KDFB 4L1BA
chains in the Genus database with same CATH topology
3VR9B 1SSNA 1GOZA 1D5XC 5TSSA 1XLOA 5BYSA 4YXDB 3AMZA 3P4SB 1IGDA 4XWTA 4GLSC 4KX6B 2G9HD 1M4VA 3ETRA 3Q8CA 2B76B 2RMMA 5EE0A 2KDMA 4D2KA 1YJJA 4XWWA 3E56A 3MJ5A 4A6QA 4B0MA 1HQRD 1TS5A 1XLPA 2WXRA 1TS3A 3J9CA 1N60A 1C77A 3AEGB 2Y5PA 2Z8LA 4TMAB 1WRIA 4JE3B 1PGAA 2NMQA 2AX5A 1FMAD 1HA5A 1RFKA 1STEA 2DWQA 3U52E 3B9JA 2LUMA 5EE1A 3SFEB 2PW9A 1A70A 2OEDA 3IXSA 3AE8B 4NZLB 4C80A 2CU3A 2J4XA 1T6BX 2JYTA 1J7CA 4RGOS 5H8YE 1E0ZA 4DXFA 1AN8A 2Y3AA 2NTSA 5D3DA 3U2SC 3IT4B 3ZJUA 1ROEA 2H88B 2INNE 1AW7A 5D7GA 4JWUC 3NVZA 1VZ7A 2M56B 4C7YA 2LGIA 2ONQA 4IKGA 1VLBA 1N62A 4EE2A 3MC0B 4HKQA 3B2GA 3CWIA 1RM6C 2IJ0A 1J7BA 2L32A 1JQ4A 1P7FA 2KWDA 2LJIA 5EE9A 1WWTA 4ZOHC 1XXGA 1SEBD 1I7HA 1KFYB 2K22A 3W2DA 1D5ZC 1KRHA 5H92C 2LMCA 4RNAA 3TEXA 2WNMA 1K52A 3N9YC 2PTLA 1TKYA 2PLPA 5BMHA 4TSSA 3IAM1 1FRDA 2IPKD 1PUTA 2AQ1B 3VRAB 2BBCA 2DBYA 2XN9C 5FK9C 1TS2A 2LHEA 2K3UA 2WXLA 1YNTE 1NI3A 1SXTA 4HEA1 2INPE 2WDQB 1L6VA 2BW2A 1ACCA 3HUIA 1FCCC 2GRIA 1AYFA 3SR6A 2MJEA 1I4QA 3V3XA 1I4XA 3IAS1 1OQQA 1VRAB 1XLNA 3EGRA 1ET9A 2KACA 2JSVX 1IUEA 3MP9A 1OFFA 1QOGA 2W3SA 1PFDA 2KN4A 3AE1B 1L4ZB 3AH7A 1DYQA 1JWBD 2AQ2B 4L2YA 4OHJA 2V0GA 1QF6A 2D5GA 2QMTA 1KH0A 3I9V1 2WXFA 3I57A 3W5UB 1ZPSA 2J42A 5C3JB 2JZPA 3NVYA 3BVZA 1VZ8A 1L0VB 3IT6B 1MHHE 2DYMA 2FE8A 3PZ7A 2Q5WD 3WCQA 3P63A 3AE2B 4KGTA 3Q8AA 3OWEB 5BMIA 3TEYA 2MH7A 1FRRA 1I4RA 1QILA 1FM0D 1Q10A 3AN1A 4RGTA 1XO3A 4WAFA 1ZDVA 2GI9A 2Y5CA 1EM7A 2MJDA 4JX1C 3TEZA 2N9KA 1FNVA 4WQMA 1RYJA 2K5PA 3NRZA 4NAWB 4YSZB 2MEKA 1E7PB 2IGDA 4MACA 4MT5A 1TY0A 2H89B 2PKOA 3T3OA 3P1MA 1QLBB 2PIAA 2QEJC 4FXCA 1XCTL 5G5GA 1SBBB 1WYGA 2XNAC 2L1AA 1TYGB 1C4PA 2WDVB 2W54A 3R2TA 4OZBA 1QOBA 3AEEB 3TUOA 4REZA 2M0AA 4IDIA 2EKIA 1JWMD 1PGXA 1SB3C 4RGMA 4ZHPA 1WGKA 3B2FA 4RGNA 1Y56A 4Q2JA 4YTPB 2N7JA 3AE3B 2FUG1 2J52A 1JROA 3MHZA 1C9FA 2WU5B 2KMMA 3BYTB 1C4CA 3V05A 1SE4A 5C2TB 4RCOA 1V97A 4A9AA 3AE9B 3AECB 1ZP0B 4ARIA 2HTME 1EWCA 4WH4A 5HFYA 1RWSA 2PVGC 3BVGA 2ZW0A 1I4PA 4US9A 3BWUD 3T3NA 4TQ0A 3U4EG 3Q8EA 2WXIA 2E3TA 3FILB 2RPVA 2IGHA 3LB8C 1L6UA 4YSYB 5MPOA 4H2AA 2ICIA 4MH8A 1MVKA 4RF1A 4XE0A 2I2YA 2V3NA 4USAA 5E6JA 1F2RI 2FBWB 1ZUD2 2WXQA 1QOFA 2WXOA 4A90A 3LYYA 1IGCA 3AE7B 1N63A 2WQYB 4OZAA 2V3PA 1UUPA 2ZW1A 5FR3A 1MPEA 1I4GA 1QQRA 2LHDA 1E10A 1F77A 2VZKB 1L4DB 4OVZA 4ARCA 4YWGG 2WXNA 4YTNB 3AV8A 1SE3A 1SJED 1C76A 2WDRB 3ZQ4A 3AEFB 1ESFA 4XDDA 5EE3A 3H8HA 3ZYYX 2TSSA 1UWMA 1YJIA 2JQRB 4M0WA 4OW0A 3GP7A 2IGGA 1D6EC 1SF0A 4R3DA 4GDLB 1IBXB 2JX5A 3NS1A 1XLQA 3RPFC 1J7AA 1K50A 2W55A 3DWMA 4WWMA 2KAJA 3HRDD 1VZ6A 3KWLA 3P4QB 3HVZA 3P4PB 1K51A 4PT5A 3URYA 2YEPB 1JWAD 2BS3B 2KQ4X 1D5MC 2HDEA 2WU2B 3BIID 4TQ1A 2W82A 4JWSC 3AE4B 4WURA 1HXYD 3U7ZA 2ACZB 2K0PA 1JW9D 1UWXA 4IOIE 4O1NA 1PYWD 2WLBA 1BUIC 3GS2A 1JALA 2WXJA 2RDHA 1JRPA 5HHDG 1QT9A 1FFVA 3ZJVA 2I38A 1YQ3B 5I4DA 4UDUC 1SJHD 1TZOA 1ZOYB 2SEBD 3NUHB 4KKIA 4N59A 4N58A 3GB1A 1FFUA 1QOAA 1TS4A 1WSPA 1UGJA 3CIRB 4DQOC 1T3QA 1T5XD 5G5HA 2IDYA 4RFBA 4WIPA 4A8XC 3Q8BA 4OZCA 5T8IA 3AE6B 3FC4A 1YN5A 4XDCA 2BS4B 3AM9A 3P4RB 1V1PB 4HRSA 2PVOD 2K9XA 1JMLA 1NYQA 1YN3A 2L52A 1V1OA 1MHXA 1C4AA 3C8YA 3KWVA 2DYOA 1L0XB 2EELA 3BVMA 1NVID 5FKAC 5GXGB 5D3IB 1GAQB 4JPSA 4CQNA 1NYRA 2BB6A 2OHFA 3W1SA 1GB4A 1ZE3D 1FNWA 4MM3B 2SAKA 4C56C 1VR9A 1HEZE 1B9RA 5BYRA 1MI0A 1VDVA 3Q8FA 1XEEA 3ZJTA 3R8BA 1SE2A 2WS3B 2VZKD 1PDXA 1YMHE 1FIQA 1SIJA 4LK0M 3VR8B 3BZDB 2WP9B 4YT0B 1F2RC 3MFGA 3SFDB 1ET6A 2J53A 5AUIA 3NVWA 4P6VF 3ABVB 1NENB 2ON8A 3VQIA 1FXIA 2QSDA 1WXQA 3E9SA 4AQ7A 3ZGZA 3PO0A 1K53A 4ZRQA 2AQ3B 2YEPF 1TJEA 1GPXA 2R61A 1ENFA 2CJNA 4J3OD 2MJ3A 2JWUA 4GDKB 4NAMA 1IBXA 1FO4A 1DOXA 2QILA 2JU6X 3BK2A 3P42A 2CJOA 1DGJA 3TSSA 1FEHA 1R7SA 2DLBA 1XCQL 1DOIA 3FAHA 2N0SB 4KGSA 2GB1A 5LNK1 1N5WA 4B0EA 4YSXB 1L0YB 1ZXIA 2WXMA 2M19A 1D4BA 1EU4A 4NJCA 1B1ZA 1DOYA 4HJGE 3Q69A 1EWYC 4N6EB 3O13A 2X38A 3BYYB 1V8CA 4LLGM 2E6XA 1YQ4B 1C78A 2WXKA 3AE5B 1BMLC 1CK1A 2JXTA 4AS1A 1TKGA 2RDGA 4HKZE 1TY2A 2W3RA 1F0ZA 1KLGD 3VRBB 1CZPA 1VJKA 2LFIA 1ZDXA 3EUB2 1NEKB 1CQVA 2BT6A 4ZYSA 2LEKA 4KKJA 1HZ6A 2QIEB 3UI3A 3KQ4A 1I4HA 1FNUA 3R2IA 1C79A 1AWDA 2WXHA 1FD6A 4HROA 1KF6B 4US8A 1EU3A 2PMVA 1JWSD 1FXAA 3AB5A 1CJEA 4RF0A 1JCKB 1V1PA 2G1EA 2BB5A 1ZXHA 1PGBA 5HI1A 2BS2B 3RFZB 2L83A 1E9MA 1XF5L 4DXGA 4C7ZA 4LTUA 5BYQA 1HZ5A 4YTMB 2JYEA 1YN4A 3DWGC 1KTKA 2V4IB 3TEWA 1KLUD 1BXTA 3NVVA 1QKZA 3BK1A 1GB1A 3AEDB 3L4PA 1FCLA 3AEAB 2BTEA 3LXFA 2N9LA 2WXPA 3EA6A 2WXGA 1UNSA 2NTTA 1L5PA 1JWUD 5AUKA 3NZ3A 4KGRA 4P16A 1E6EB 5JXVA 2QJLA 1P7EA 4RH6A 3KLSX 4ITKA 4ZRPA 1TKEA 2BYTA 3AEBB 5HG2A 1N61A 3W5VB 1OQRA 3PZ8A 4L23A 3SEBA 1N5XA 3HVDA 1LO5D 4ZHOA 3W9CB 4L1BA 4A55A 3FILA 5BMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZ7 A;  2D5G A;  1WSP A;  3PZ8 A;  4WIP A; 
#chains in the Genus database with same CATH topology
 3VR9 B;  1XLO A;  4WWN A;  3H9D A;  4YXD B;  5L83 A;  3H7S A;  2B76 B;  3RNA C;  3VAW A;  5EE0 A;  2KDM A;  2LXC A;  4IWP A;  1HTQ A;  4A6Q A;  2AEH A;  1HQR D;  4B0M A;  1XLP A;  1TT5 B;  2DAJ A;  2M4N A;  2Y5P A;  2Z8L A;  4TMA B;  4EFO A;  1TZ1 A;  3AU5 A;  1FMA D;  2W9N A;  1STE A;  3L08 A;  3UIN B;  3B9J A;  5EE1 A;  2LGY A;  2OED A;  1T6B X;  1SE9 A;  2LVO A;  1OGW A;  5D3D A;  3IT4 B;  5G55 A;  3ZJU A;  3JVZ X;  3NOB A;  2PE6 B;  2QDF A;  2LVP A;  4FA6 A;  5C1Z A;  4IKG A;  2K8H A;  3B2G A;  1HE8 A;  3SDL C;  4F7Z A;  2MCN B;  2QC8 A;  2L32 A;  4EZK A;  1P7F A;  2LJI A;  3ZXR A;  3QC8 B;  5L95 C;  1SEB D;  2IND C;  3W2D A;  2N9E B;  1WXA A;  5H92 C;  2LMC A;  4RNA A;  2WNM A;  4GSW A;  1K52 A;  2PTL A;  2IPK D;  2PE9 A;  2BBC A;  2WX1 A;  4IWO A;  5FK9 C;  4G3X B;  1EUV B;  2MBQ A;  1NI2 A;  2INP E;  3DBH I;  4K1R B;  3A33 B;  1I4X A;  3APD A;  3EGR A;  3Q6B A;  1ET9 A;  2JSV X;  1OFF A;  2LVQ A;  1YJ1 A;  4OVU A;  1PFD A;  1UGM A;  2DNF A;  3AH7 A;  4N9F 4;  3DOW A;  1DYQ A;  4OHJ A;  1QF6 A;  2QMT A;  2KT7 A;  3I9V 1;  2JZP A;  2NBV B;  2PEA A;  1L0V B;  2D07 B;  4M0W B;  2FE8 A;  3NS8 A;  3AE2 B;  3WAN A;  3Q3F A;  3Q8A A;  4K7S A;  5BMI A;  2XK5 B;  2MH7 A;  3A1Q A;  4KVG B;  4EOY A;  3VUX A;  3AN1 A;  2M0X A;  3RNF C;  1T0S C;  1ZDV A;  4II2 B;  2Y5C A;  5G2N A;  4JX1 C;  4I6P A;  2QCZ A;  4NAW B;  1MG8 A;  2MEK A;  1E7P B;  2O6V D;  3QIJ A;  1I42 A;  3B0A A;  4MT5 A;  3VH3 B;  3UQB A;  1WIA A;  2MSE D;  2PKO A;  3A9J A;  4FXC A;  1TTN A;  1SBB B;  2L1A A;  3R2T A;  2UU7 A;  4LDT B;  4HK2 A;  4RGM A;  4RGN A;  3OJ3 A;  4YTP B;  2N7J A;  3TJP A;  1C9F A;  1WJ6 A;  1C4C A;  3V05 A;  1RRB A;  1SE4 A;  3T8M A;  1KOT A;  4WH4 A;  5HFY A;  3BVG A;  4US9 A;  4RM8 A;  1D3Z A;  3Q8E A;  1E5W A;  2WXI A;  1JRU A;  3C0R B;  2IGH A;  4YSY B;  3NG0 A;  3Q3O C;  1MVK A;  4RF1 A;  4XE0 A;  2C7M B;  5E6J A;  1F2R I;  2FBW B;  3ZRC A;  2WXQ A;  1QOF A;  2X8X X;  1IGC A;  2JZ3 B;  4IWQ A;  1N63 A;  2WQY B;  4JGH B;  1UUP A;  2ZW1 A;  3B08 A;  1QQR A;  1E10 A;  1PQS A;  2VZK B;  3AUL A;  1L4D B;  3DBL I;  4BFR A;  2ZNV B;  1WGD A;  3AU4 A;  1SJE D;  2WDR B;  1WR1 A;  1ESF A;  3AEF B;  2RSU A;  3H8H A;  3ZYY X;  2TSS A;  4HCN B;  2KVR A;  1GC7 A;  2FAZ A;  1XLQ A;  4XGA B;  2W55 A;  4WJO A;  3KWL A;  1JWA D;  2L76 A;  4W9K A;  2JPH A;  2HDE A;  4F8C B;  4WUR A;  3ONS A;  4LDT D;  3U7Z A;  1PYW D;  2M17 A;  3WAP A;  3GS2 A;  3CST A;  3NUH B;  1XT9 B;  2ZVN A;  4N58 A;  1YD8 U;  1QOA A;  3EC8 A;  1T3Q A;  5G5H A;  4WIP A;  1LM8 B;  4M01 A;  1YOV B;  2IY0 B;  1Q5W B;  2BS4 B;  2JRH A;  3AM9 A;  4HRS A;  4C00 A;  1JML A;  4HJK A;  2L52 A;  3N3K B;  1C4A A;  3C8Y A;  4IG7 B;  4YL8 A;  1EO6 A;  2DZK A;  2EEL A;  4W9L A;  5FKA C;  1GAQ B;  4JPS A;  2KMA A;  2IO3 B;  4KZ0 A;  4HVB A;  4WJN A;  3RNC C;  2BB6 A;  2QHO A;  1GB4 A;  1NDD A;  3FKY A;  3TCA A;  3LJ3 A;  2MW5 A;  1MI0 A;  3Q8F A;  3ZJT A;  1SE2 A;  2VZK D;  2KO3 A;  4HPP A;  4LK0 M;  3VR8 B;  2KDE B;  2WP9 B;  1F2R C;  4YT0 B;  3SFD B;  1ET6 A;  1T0Q C;  3NVW A;  4P6V F;  4FHJ A;  1NEN B;  3VDZ A;  1WXQ A;  4IM2 A;  5BO4 B;  3RUL A;  3A9K B;  4ZRQ A;  3WAM A;  2YEP F;  2VRR B;  1GPX A;  4BKS A;  2D10 A;  3N1X C;  2BYE A;  3KUD B;  3SD5 A;  2KX3 A;  3WIM A;  2LGS A;  1YX6 B;  3EFU A;  4AOF A;  2MLB A;  4GDK B;  2QIL A;  1XCQ L;  4IUM B;  1L0Y B;  3NHE B;  3MJW A;  1B1Z A;  3A9J B;  4NJC A;  1L7Y A;  3VTU A;  1A5R A;  1EWY C;  2X38 A;  4ACF A;  3P2B A;  1LGR A;  1WE7 A;  1H4R A;  2E6X A;  1C78 A;  4MDK E;  3MHS D;  1CK1 A;  5LXH A;  1WGR A;  2JXT A;  4AS1 A;  2RDG A;  4P1C C;  1F0Z A;  1ISN A;  2I1K A;  3PV1 A;  4IM3 A;  1NEK B;  1CQV A;  4KKJ A;  2QIE B;  1WMH A;  3ZVV A;  1C79 A;  2C7H A;  2WXH A;  3RUI B;  1WRD B;  4KZC A;  1KF6 B;  3ZNH B;  4DDI D;  1JWS D;  4KIK A;  5J2R A;  5LXI B;  1JCK B;  4B9K A;  2BB5 A;  3QAR A;  5HI1 A;  3DHI C;  3RFZ B;  2EMT A;  1E9M A;  2JXX A;  2L00 B;  4HCP B;  3A4S C;  2LXA A;  4E3C A;  1HZ5 A;  1OQY A;  2JYE A;  3DWG C;  3RZF A;  4AWJ A;  1BXT A;  2KVZ A;  2BTE A;  3JYU A;  3PZD A;  4FJY A;  3LXF A;  2N9L A;  2WXP A;  5IN7 A;  2BVC A;  4ANX A;  1JWU D;  2XEW A;  3M62 B;  1S3S G;  1FXT B;  2C9W B;  3AEB B;  2MBE A;  3W5V B;  1OQR A;  1LO5 D;  2LD9 A;  4FUL A;  5J18 A;  2N9X A;  4X57 B;  5BMG A;  4CO7 A;  1D5X C;  3RI7 C;  3JW0 X;  1N6Z A;  2IBI B;  3AMZ A;  3RNE C;  5E6O A;  4KX6 B;  2G9H D;  4BAX A;  1M4V A;  2RMM A;  4D2K A;  3ZW3 A;  2D11 A;  3TBL D;  4EZL A;  3AEG B;  5JHA A;  4C4V A;  1PGA A;  1HA5 A;  2O6V A;  2LUM A;  2LI5 A;  5E6P A;  4URK A;  1A70 A;  3DHG C;  5IAA C;  3AE8 B;  5D6J B;  4JQW C;  4RGO S;  2JYT A;  1J7C A;  1P1A A;  1V2Y A;  2ZCB A;  3VHT C;  2Y3A A;  2NTS A;  2N9P C;  2M8S A;  2H88 B;  3PT2 B;  2V1Y A;  4JWU C;  2BF8 B;  4BOS C;  2LGI A;  4HKQ A;  3CWI A;  4K3C A;  1JQ4 A;  2NCN A;  3C19 A;  2KWD A;  4WQO B;  1WWT A;  4ZOH C;  2RD0 A;  1XXG A;  3M3J A;  2K22 A;  2MQJ A;  2LAS A;  3U7D A;  3TEX A;  2BGF A;  1I35 A;  1WXV A;  1TKY A;  2DHZ A;  5E6N A;  5BMH A;  3IAM 1;  2REX A;  2NVU I;  1FRD A;  2KYW A;  3VRA B;  3KUC B;  2DBY A;  2K3U A;  2WXL A;  3RZW C;  2A5U A;  2LRU A;  1ACC A;  2DEN B;  1FCC C;  2CR5 A;  3W1Y A;  1VRA B;  4DXA B;  3QWZ B;  2KAC A;  2A4Z A;  3Q2A C;  3ENE A;  3MC8 A;  2KN4 A;  3AE1 B;  2L0T A;  2IZV B;  1IYF A;  4L2Y A;  2AL6 A;  1KH0 A;  4LNI A;  5DPS A;  3NZU A;  5C3J B;  1X1M A;  2RGF A;  1C3T A;  3HK0 A;  3WCQ A;  2Q5W D;  3P63 A;  4K7W A;  2JWZ A;  3OWE B;  3TEY A;  1WMH B;  4RGT A;  5GMV A;  2GI9 A;  1YIW A;  1EM7 A;  3H7P A;  3X0W A;  5LLI A;  2KQ7 A;  2K5P A;  3ML9 A;  4MAC A;  2B3A A;  1UZX B;  3T3O A;  3P1M A;  1UBI A;  4E71 A;  1E7V A;  1XCT L;  1KM7 A;  5TR5 A;  4JIO U;  2W54 A;  1IPG A;  2NR2 A;  4OZB A;  3AEE B;  4IDI A;  3PHX B;  1PGX A;  1MFW A;  1WJU A;  2IY1 B;  1WGK A;  2HD5 B;  2KLG A;  4Q2J A;  3AE3 B;  4W9I A;  2FUG 1;  4W9J A;  1JRO A;  2JZZ A;  3BYT B;  4DDG D;  3DBH B;  4RCO A;  2G3Q B;  3AE9 B;  1ZP0 B;  4PS3 A;  2HTM E;  3TL5 A;  4ARI A;  3BWU D;  3U4E G;  3HM6 X;  2E3T A;  3LB8 C;  5AZG A;  5MPO A;  4H2A A;  2ICI A;  1J0G A;  2M1M A;  4W9D A;  3N32 A;  2BKF A;  2KDB A;  2GMI C;  1ZUD 2;  2PPH A;  2KWC A;  2V3P A;  3DCG A;  2FUH B;  2LHD A;  2MBO A;  3RCZ A;  4YTN B;  2OJR A;  3AV8 A;  2EKE C;  4XDD A;  3M63 B;  3VVW B;  2JQR B;  2IGG A;  3VH4 B;  2ZVO A;  4GDL B;  1WI0 A;  4MGY E;  2JX5 A;  3RPF C;  2K6D B;  3ZXV A;  2JVC A;  5FR6 A;  3P4P B;  2AYO B;  2YEP B;  5J17 A;  3WAO A;  1TIF A;  4TQ1 A;  4BKT A;  2K25 A;  1HXY D;  2ACZ B;  2K0P A;  1JW9 D;  4O1N A;  4HLE A;  2WLB A;  1UF0 A;  2FCM A;  2O2V B;  1JAL A;  2RDH A;  5DPW A;  1WFY A;  1QT9 A;  1FFV A;  4ASW C;  2I38 A;  1YQ3 B;  4UDU C;  3N30 A;  2SEB D;  3QJZ A;  1F9J A;  4KKI A;  3TIX A;  3CIR B;  3GZN B;  1V5O A;  3HM3 A;  3Q8B A;  3FC4 A;  2IO1 B;  4XDC A;  3VFK A;  3UQA A;  2PVO D;  3H6N A;  2KX0 A;  1YN3 A;  2FIF A;  1L0X B;  1NVI D;  5GXG B;  5D3I B;  4EZJ A;  2BWE S;  1CMX B;  4KSL C;  1NYR A;  2OHF A;  1Q1O A;  4HDO A;  1VR9 A;  2ZCC A;  1VDV A;  1XEE A;  1S1Q B;  2IO0 B;  4LNK A;  3R8B A;  1V6E A;  1FIQ A;  1SIJ A;  3MFG A;  2KTR A;  4FJZ A;  5AUI A;  2J53 A;  3EEC A;  2LWP A;  2MA9 B;  3DBL B;  3GE8 C;  3ZUN A;  3VQI A;  1R4M I;  2QSD A;  3ZGZ A;  1K53 A;  2AQ3 B;  1TJE A;  3DBR I;  5DPR A;  2MP2 A;  4LJP B;  1ENF A;  1V80 A;  2NPT A;  3H7P B;  1IBX A;  2C5L C;  1FO4 A;  1DOX A;  1FEH A;  3FAH A;  2N0S B;  4YSX B;  1E90 A;  3NZS A;  2KTF A;  5CTR C;  2M19 A;  5DCN A;  1EU4 A;  1DOY A;  3O13 A;  3BIN A;  1YQ4 B;  2ASQ A;  3MTN B;  4JLC A;  3ZNI D;  2CHZ A;  3AE5 B;  2V4L A;  4KV2 A;  3UIP B;  3L13 A;  2IO2 B;  1TY2 A;  1LFD A;  2W3R A;  3EHV A;  1CZP A;  2LFI A;  2BT6 A;  2G45 B;  2LEK A;  1HZ6 A;  2ZZP B;  1RFA A;  3KVF B;  4US8 A;  1EU3 A;  2DZJ A;  4ICU A;  2PMV A;  3VUW A;  2L7R A;  2N1V A;  1FXA A;  1CJE A;  1WH3 A;  5HKH A;  1V1P A;  2G1E A;  1MG4 A;  1U4A A;  1PGB A;  2K39 A;  2L83 A;  2R2O A;  4DXG A;  4MJS A;  4AJW A;  4LTU A;  4WAA A;  5BYQ A;  4GB9 A;  4DBG A;  3PLV A;  2V4I B;  3TEW A;  1KLU D;  3DVG X;  5JZE B;  1WM2 A;  1FCL A;  4MSQ B;  1E8X A;  3EA6 A;  2BPS A;  4PYZ A;  2WXG A;  2GBM A;  5AUK A;  4KGR A;  5IA7 A;  3V60 A;  4P16 A;  5JXV A;  4ANW A;  2NS5 A;  1V86 A;  5HG2 A;  2BYV E;  4NJ7 A;  4EEW A;  1WJN A;  4RMA A;  3GOE A;  3LDZ E;  3W9C B;  5JHB A;  4A55 A;  4II3 B;  3APC A;  3FIL A;  5KHO A;  5BYS A;  3M95 A;  3P4S B;  3K9P B;  2KJR A;  4GLS C;  5D2M B;  3ETR A;  3Q8C A;  3ZNZ B;  1J19 A;  2KC1 A;  1YJJ A;  5IP4 D;  3MJ5 A;  2KK8 A;  1TS5 A;  2WXR A;  3J9C A;  1C1Y B;  2Z59 B;  1WRI A;  4JE3 B;  3N20 C;  3A1Q B;  1KJT A;  2NMQ A;  4IC7 B;  3RNG C;  1RFK A;  3R66 C;  4PYU A;  2KFK A;  3V61 A;  3IXS A;  4NZL B;  1F52 A;  3ZTC A;  3S2A A;  3RYT A;  2DZM A;  4C80 A;  5H8Y E;  3PRZ A;  4WJQ A;  1AW7 A;  5D7G A;  4A3O A;  4J6I A;  3NVZ A;  4NQL B;  4DHJ B;  1VZ7 A;  1WGG A;  2M56 B;  1WXM A;  4EE2 A;  1N62 A;  2UYZ B;  3MC0 B;  1WR6 E;  2IJ0 A;  1J7B A;  2BYF A;  5EE9 A;  1I7H A;  1KFY B;  1WYW B;  3ZNG C;  1KLV A;  3QA8 A;  4ANV A;  3Q14 C;  1D5Z C;  1KRH A;  1YQB A;  3WAL A;  1E7U A;  1V5T A;  1H8C A;  2D3A A;  2AQ1 B;  4HPL B;  4BBN F;  4S17 A;  2XN9 C;  1NI3 A;  1SXT A;  2G4D B;  4HEA 1;  1GUA B;  2WDQ B;  2BW2 A;  3HUI A;  1AYF A;  1VD2 A;  3V3X A;  1I4Q A;  2KD0 A;  3IAS 1;  1OQQ A;  1XLN A;  3ZDM C;  1WM3 A;  1P98 A;  4XC2 A;  1P9D U;  2LGX A;  3DQV A;  3QAQ A;  2DAF A;  2V0G A;  2D5G A;  1TGZ B;  1WX7 A;  2FCS A;  3I57 A;  3ZLZ A;  2J42 A;  4A20 A;  4TV3 A;  1WGY A;  2CU1 A;  3BVZ A;  4M8N A;  4KDI C;  1MHH E;  3PZ7 A;  3I63 C;  3RMK C;  1R4N I;  2BQQ A;  4DK5 A;  3AXC A;  1FRR A;  4FAD A;  1QIL A;  1FM0 D;  4IW0 A;  1WX9 A;  2RR9 A;  1BT0 A;  1XO3 A;  2FID A;  4WAF A;  1GC6 A;  1T0Y A;  3TEZ A;  4NJ6 A;  1RYJ A;  3NRZ A;  2KN5 A;  4ZRJ A;  4QAY A;  3N1Y C;  4M8M A;  2EMS A;  1OEY A;  1Z5S B;  1TY0 A;  2H89 B;  1P0R A;  1QLB B;  2IYD B;  4BKG A;  2GBN A;  2PIA A;  2QEJ C;  5JH5 C;  2PJH A;  3X23 A;  2LGD A;  1WYG A;  1TYG B;  1C4P A;  3TUO A;  2EKI A;  4DHZ B;  4F1S A;  4KDL B;  1V9J A;  1E8Y A;  2GLS A;  1MJD A;  4AJY B;  2KQS A;  2JF5 A;  2CHW A;  2WU5 B;  2KMM A;  2C60 A;  5C2T B;  3SU8 X;  4A9A A;  3AEC B;  1EWC A;  1RWS A;  3T3N A;  3VTW A;  1E8Z A;  4TQ0 A;  1GG3 A;  3FIL B;  3D32 A;  2LRW A;  2YLM A;  4MH8 A;  3R7R A;  1SIF A;  2V3N A;  4USA A;  4HXD A;  1SGH A;  2WXO A;  4FLH A;  1T0R C;  3LYY A;  3DHH C;  1AAR A;  1MPE A;  1WE6 A;  1F77 A;  1WJ4 A;  4ICV A;  4YWG G;  1L2N A;  1SE3 A;  1C76 A;  4G50 A;  3ZQ4 A;  2KFK B;  4IM0 A;  3IHP C;  1UWM A;  1YJI A;  2HJ8 A;  4M0W A;  3GP7 A;  1D6E C;  1SF0 A;  2BKR B;  3UGB B;  3SHQ A;  2G4S A;  2XK5 A;  3NS1 A;  1XD3 B;  4ZDV A;  3H1U A;  3ALB A;  3HRD D;  3P4Q B;  3URY A;  1K51 A;  4PT5 A;  4W9E A;  2KQ4 X;  3NJT A;  4NAW A;  2W82 A;  4JWS C;  1UWX A;  4IOI E;  1TBE A;  3QCA A;  1LXD A;  1SJH D;  2AWT A;  2WYQ A;  1ZOY B;  4N59 A;  1NBF C;  4K7U A;  2JRI B;  2KWV B;  3GB1 A;  1FFU A;  4DQO C;  4BZA A;  4RFB A;  4A8X C;  2GBK A;  4GIV A;  5T8I A;  2HJ1 A;  1YN5 A;  4KIK B;  4ANU A;  2LUE A;  2K9X A;  1NYQ A;  3IVF A;  1MHX A;  3OAW A;  3KWV A;  1WX8 A;  4EUT A;  3RT3 B;  4NY0 A;  3W1S A;  4NQK E;  1ZE3 D;  5AZH A;  2SAK A;  4C56 C;  1HEZ E;  4OVV A;  5BYR A;  4BKS D;  4K81 A;  3U30 A;  3BZD B;  3DPD A;  1Z2M A;  2KOX A;  3ABV B;  2NBU A;  2ON8 A;  1FXI A;  4B6W A;  3DBS A;  4AQ7 A;  1E8W A;  3O65 B;  3KYD D;  2JT4 B;  4B95 A;  4J3O D;  3Q3N C;  1EF5 A;  3OLM D;  1FPY A;  3PLU A;  3L16 A;  4G0N B;  2D2Q A;  1GJZ A;  3KH0 A;  4NAM A;  1WZ3 A;  3CF6 E;  2JUO A;  4I6N B;  1R7S A;  2DLB A;  1DOI A;  4KGS A;  4RM9 A;  2GB1 A;  3KW5 B;  3CSF A;  4B0E A;  2LZ6 A;  5D94 A;  2MRP A;  4PS8 A;  2KAN A;  3Q69 A;  4C4V B;  1UEL A;  3BYY B;  4MEM A;  4W9G A;  4WWO A;  1V8C A;  4LLG M;  4FHK A;  4CYE A;  2O6V B;  1BML C;  2GOW A;  1UD7 A;  2AL3 A;  1KLG D;  3VRB B;  4G11 A;  1VJK A;  3EUB 2;  2WDT B;  2K8C A;  3KQ4 A;  2KXJ A;  1FNU A;  2KHW B;  1AWD A;  2MBH A;  3AB5 A;  2KC2 A;  2K8B A;  1EF1 A;  1ZXH A;  3GE3 C;  3N1Z C;  1XF5 L;  4C7Z A;  2D3G A;  3HIZ A;  4P7I A;  4YTM B;  2D3C A;  1YN4 A;  1KTK A;  3BK1 A;  1R4M B;  3PRP B;  1GB1 A;  3DDC B;  3AEA B;  3VUY A;  1HTO A;  3DBR B;  5CHV C;  1E6E B;  2HE7 A;  4ZRP A;  1TKE A;  3UIO B;  4FJV B;  3ZKJ C;  3A9K A;  1YX5 B;  4E74 A;  2INC C;  1N5X A;  3HVD A;  2KDI A;  4ZHO A;  4BOZ B;  1SSN A;  1GOZ A;  2D3B A;  5TSS A;  4GDK A;  3NY5 A;  3VTV A;  4GMV A;  1IGD A;  4XWT A;  3VXW A;  2N7E A;  3IG3 A;  2J0J A;  1WY8 A;  2DYB A;  3Q3M C;  4XYC A;  4LNO A;  4XWW A;  2OJW A;  3E56 A;  4WWP A;  4ZRI A;  1Y8R C;  1TS3 A;  1N60 A;  1C77 A;  2WHI A;  4EKU A;  1G6J A;  4I6L B;  4PS7 A;  2ZJD A;  2AX5 A;  4XZ4 A;  2DWQ A;  4LNF A;  3U52 E;  3SFE B;  2PW9 A;  4NPN A;  3DVG Y;  4KSK C;  2CU3 A;  2J4X A;  2MX2 A;  2YVC A;  3GZN I;  4DXF A;  3JSV A;  1AN8 A;  1E0Z A;  1LQB A;  3U2S C;  1ROE A;  2INN E;  3PSE B;  1K8R B;  3L54 A;  4C7Y A;  2ONQ A;  5IO9 A;  1VLB A;  4GN1 A;  2DX5 B;  3K9O B;  1RM6 C;  1WZ0 A;  4LJO B;  3I3T B;  3DVN U;  1WXS A;  4ZRK A;  2KFJ A;  2KNB A;  2HTH A;  3WA0 A;  3EFC A;  4CHK A;  2KJ6 A;  3QK0 A;  3N9Y C;  2PLP A;  4TSS A;  2N7D A;  2MWS B;  2V9H A;  5IOI A;  3BY4 B;  1PUT A;  1OEY J;  1TS2 A;  2LHE A;  5CHF A;  1GNU A;  2FCQ A;  1YNT E;  1L6V A;  1OTR B;  3QQ8 B;  3ZTD A;  3SR6 A;  2GRI A;  2MJE A;  4M00 A;  2WX0 A;  3RN9 C;  5EDS A;  3PRE A;  1IUE A;  1WGH A;  4LCD E;  3MP9 A;  2RPQ A;  1QOG A;  2W3S A;  4MM3 A;  2GBR A;  2WGS A;  1L4Z B;  1JWB D;  1ZKH A;  4ZYN A;  2KKC A;  2AQ2 B;  3T9L A;  2FNJ B;  2WXF A;  3W5U B;  1ZPS A;  3NVY A;  1VZ8 A;  2R2Q A;  3IT6 B;  3V6E B;  3ML8 A;  3PTF C;  1RLF A;  2BWF A;  2DYM A;  1Q0W B;  4KGT A;  4HPM B;  4S0R A;  1I4R A;  1Q10 A;  1M94 A;  3L17 A;  4HWI B;  3PS6 A;  3R3M A;  2MJD A;  4TUU A;  2N9K A;  1FNV A;  4WQM A;  1UH6 A;  4W9C A;  4YSZ B;  2IGD A;  2KWU B;  3QHT A;  2CS4 A;  3IBE A;  3QX1 A;  4BBN C;  3PHW B;  4AUQ C;  5G5G A;  2XNA C;  2WDV B;  1QOB A;  4REZ A;  2M0A A;  1RAX A;  1JWM D;  2CHX A;  2KLC A;  1SB3 C;  2K1F A;  4ZHP A;  3B2F A;  4DWF A;  1Y56 A;  2V3S A;  2J52 A;  3MHZ A;  1V97 A;  2L0F A;  2PVG C;  2ZW0 A;  1I4P A;  2FCN A;  4FBJ B;  2RPV A;  1L6U A;  1ZGU B;  3MC9 A;  4M02 A;  3W1S C;  2I2Y A;  2KTR B;  3L0W B;  3PPA A;  4MGZ E;  4WJP A;  4A90 A;  3I5J C;  2DZI A;  3AE7 B;  2RDB C;  4OZA A;  5FR3 A;  1I4G A;  4JL9 A;  1R4N B;  5KHQ A;  4OVZ A;  4ARC A;  2L05 A;  2WXN A;  2J0M A;  2MP2 B;  4MEL A;  1P3Q U;  5EE3 A;  1WF9 A;  4LNN A;  2NPT B;  4OW0 A;  4R3D A;  1IBX B;  2ZNV C;  3JSV B;  3UF8 A;  1J7A A;  1K50 A;  1UBQ A;  3DWM A;  3A4R A;  4WWM A;  2KAJ A;  1VZ6 A;  3HVZ A;  2BS3 B;  1D5M C;  3BII D;  2WU2 B;  2Y5B B;  3AE4 B;  1J8C A;  4K3B A;  1BUI C;  2WXJ A;  1JRP A;  5HHD G;  3ZJV A;  5I4D A;  1TZO A;  2GBJ A;  3IFW B;  3R7Q A;  1TS4 A;  1WSP A;  1UGJ A;  5CX3 A;  4DHZ E;  4DHJ D;  1T5X D;  2IDY A;  4P1B C;  2ZPN A;  3ZRF A;  5CHW A;  4OZC A;  2N4F A;  3AE6 B;  4XX5 A;  3P4R B;  1V1P B;  2L3Z A;  3U8Z A;  1V1O A;  4FN2 A;  2DYO A;  3BVM A;  4GOC A;  4CQN A;  3DVN V;  2JY6 A;  2N1W A;  4MJS B;  2J0K A;  3RNB C;  1FNW A;  4MM3 B;  3PGE A;  3PVL A;  3OG5 A;  1ZW7 A;  1B9R A;  5IKC M;  4PK1 A;  2WS3 B;  1PDX A;  1V81 A;  1YMH E;  5C23 A;  3E9S A;  3PO0 A;  4MGI E;  3OJ4 B;  3TMP B;  3KUZ A;  1F1H A;  3B1L X;  2Z0E B;  3KYC D;  2K6Q A;  2R61 A;  2CJN A;  2VH1 A;  2MJ3 A;  3APF A;  2JWU A;  4GDL A;  4BVU C;  2JU6 X;  3BK2 A;  3P42 A;  4MH0 E;  2CJO A;  1DGJ A;  3PRM B;  3TSS A;  4A3P A;  2C7N B;  4MGK E;  2XBB C;  5LNK 1;  1N5W A;  2KZR A;  2LJ5 A;  1ZXI A;  2WXM A;  1D4B A;  4HDQ A;  4TKN A;  3ZDT A;  4MSM B;  4HJG E;  2MBB B;  3ECI A;  4N6E B;  1QZE A;  3V6C B;  2L8J A;  2Z0D B;  2O2V A;  2WXK A;  1IP9 A;  3ZO5 B;  1TKG A;  2OOB B;  4HKZ E;  3AI5 A;  1ZDX A;  4ZYS A;  4GU2 A;  3UI3 A;  2J7Q B;  1I4H A;  3R2I A;  5AEK B;  1FD6 A;  4GXB A;  4HRO A;  4W9F A;  3L10 B;  4AP4 C;  4RF0 A;  3HHM A;  2NBW B;  2ZEQ A;  1XQQ A;  2KMC A;  2BS2 B;  4GGQ A;  2MHJ A;  3RD2 A;  2WWZ A;  2ZPY A;  1VCB A;  2UWQ A;  3NVV A;  1QKZ A;  4W9H A;  5DPT A;  3AED B;  3L4P A;  1UNS A;  2NTT A;  2VH2 A;  2CKH B;  1L5P A;  3NZ3 A;  3ZIM A;  2QJL A;  1P7E A;  2I1J A;  2KJH B;  4RH6 A;  3KLS X;  4ITK A;  1V49 A;  2BYT A;  3V62 A;  1N61 A;  3Q3J A;  3PZ8 A;  3CMM B;  4L23 A;  3SEB A;  5AZF A;  4NNJ B;  2KDF B;  4L1B A; 
#chains in the Genus database with same CATH homology
 3VR9 B;  1SSN A;  1GOZ A;  1D5X C;  5TSS A;  1XLO A;  5BYS A;  4YXD B;  3AMZ A;  3P4S B;  1IGD A;  4XWT A;  4GLS C;  4KX6 B;  2G9H D;  1M4V A;  3ETR A;  3Q8C A;  2B76 B;  2RMM A;  5EE0 A;  2KDM A;  4D2K A;  1YJJ A;  4XWW A;  3E56 A;  3MJ5 A;  4A6Q A;  4B0M A;  1HQR D;  1TS5 A;  1XLP A;  2WXR A;  1TS3 A;  3J9C A;  1N60 A;  1C77 A;  3AEG B;  2Y5P A;  2Z8L A;  4TMA B;  1WRI A;  4JE3 B;  1PGA A;  2NMQ A;  2AX5 A;  1FMA D;  1HA5 A;  1RFK A;  1STE A;  2DWQ A;  3U52 E;  3B9J A;  2LUM A;  5EE1 A;  3SFE B;  2PW9 A;  1A70 A;  2OED A;  3IXS A;  3AE8 B;  4NZL B;  4C80 A;  2CU3 A;  2J4X A;  1T6B X;  2JYT A;  1J7C A;  4RGO S;  5H8Y E;  1E0Z A;  4DXF A;  1AN8 A;  2Y3A A;  2NTS A;  5D3D A;  3U2S C;  3IT4 B;  3ZJU A;  1ROE A;  2H88 B;  2INN E;  1AW7 A;  5D7G A;  4JWU C;  3NVZ A;  1VZ7 A;  2M56 B;  4C7Y A;  2LGI A;  2ONQ A;  4IKG A;  1VLB A;  1N62 A;  4EE2 A;  3MC0 B;  4HKQ A;  3B2G A;  3CWI A;  1RM6 C;  2IJ0 A;  1J7B A;  2L32 A;  1JQ4 A;  1P7F A;  2KWD A;  2LJI A;  5EE9 A;  1WWT A;  4ZOH C;  1XXG A;  1SEB D;  1I7H A;  1KFY B;  2K22 A;  3W2D A;  1D5Z C;  1KRH A;  5H92 C;  2LMC A;  4RNA A;  3TEX A;  2WNM A;  1K52 A;  3N9Y C;  2PTL A;  1TKY A;  2PLP A;  5BMH A;  4TSS A;  3IAM 1;  1FRD A;  2IPK D;  1PUT A;  2AQ1 B;  3VRA B;  2BBC A;  2DBY A;  2XN9 C;  5FK9 C;  1TS2 A;  2LHE A;  2K3U A;  2WXL A;  1YNT E;  1NI3 A;  1SXT A;  4HEA 1;  2INP E;  2WDQ B;  1L6V A;  2BW2 A;  1ACC A;  3HUI A;  1FCC C;  2GRI A;  1AYF A;  3SR6 A;  2MJE A;  1I4Q A;  3V3X A;  1I4X A;  3IAS 1;  1OQQ A;  1VRA B;  1XLN A;  3EGR A;  1ET9 A;  2KAC A;  2JSV X;  1IUE A;  3MP9 A;  1OFF A;  1QOG A;  2W3S A;  1PFD A;  2KN4 A;  3AE1 B;  1L4Z B;  3AH7 A;  1DYQ A;  1JWB D;  2AQ2 B;  4L2Y A;  4OHJ A;  2V0G A;  1QF6 A;  2D5G A;  2QMT A;  1KH0 A;  3I9V 1;  2WXF A;  3I57 A;  3W5U B;  1ZPS A;  2J42 A;  5C3J B;  2JZP A;  3NVY A;  3BVZ A;  1VZ8 A;  1L0V B;  3IT6 B;  1MHH E;  2DYM A;  2FE8 A;  3PZ7 A;  2Q5W D;  3WCQ A;  3P63 A;  3AE2 B;  4KGT A;  3Q8A A;  3OWE B;  5BMI A;  3TEY A;  2MH7 A;  1FRR A;  1I4R A;  1QIL A;  1FM0 D;  1Q10 A;  3AN1 A;  4RGT A;  1XO3 A;  4WAF A;  1ZDV A;  2GI9 A;  2Y5C A;  1EM7 A;  2MJD A;  4JX1 C;  3TEZ A;  2N9K A;  1FNV A;  4WQM A;  1RYJ A;  2K5P A;  3NRZ A;  4NAW B;  4YSZ B;  2MEK A;  1E7P B;  2IGD A;  4MAC A;  4MT5 A;  1TY0 A;  2H89 B;  2PKO A;  3T3O A;  3P1M A;  1QLB B;  2PIA A;  2QEJ C;  4FXC A;  1XCT L;  5G5G A;  1SBB B;  1WYG A;  2XNA C;  2L1A A;  1TYG B;  1C4P A;  2WDV B;  2W54 A;  3R2T A;  4OZB A;  1QOB A;  3AEE B;  3TUO A;  4REZ A;  2M0A A;  4IDI A;  2EKI A;  1JWM D;  1PGX A;  1SB3 C;  4RGM A;  4ZHP A;  1WGK A;  3B2F A;  4RGN A;  1Y56 A;  4Q2J A;  4YTP B;  2N7J A;  3AE3 B;  2FUG 1;  2J52 A;  1JRO A;  3MHZ A;  1C9F A;  2WU5 B;  2KMM A;  3BYT B;  1C4C A;  3V05 A;  1SE4 A;  5C2T B;  4RCO A;  1V97 A;  4A9A A;  3AE9 B;  3AEC B;  1ZP0 B;  4ARI A;  2HTM E;  1EWC A;  4WH4 A;  5HFY A;  1RWS A;  2PVG C;  3BVG A;  2ZW0 A;  1I4P A;  4US9 A;  3BWU D;  3T3N A;  4TQ0 A;  3U4E G;  3Q8E A;  2WXI A;  2E3T A;  3FIL B;  2RPV A;  2IGH A;  3LB8 C;  1L6U A;  4YSY B;  5MPO A;  4H2A A;  2ICI A;  4MH8 A;  1MVK A;  4RF1 A;  4XE0 A;  2I2Y A;  2V3N A;  4USA A;  5E6J A;  1F2R I;  2FBW B;  1ZUD 2;  2WXQ A;  1QOF A;  2WXO A;  4A90 A;  3LYY A;  1IGC A;  3AE7 B;  1N63 A;  2WQY B;  4OZA A;  2V3P A;  1UUP A;  2ZW1 A;  5FR3 A;  1MPE A;  1I4G A;  1QQR A;  2LHD A;  1E10 A;  1F77 A;  2VZK B;  1L4D B;  4OVZ A;  4ARC A;  4YWG G;  2WXN A;  4YTN B;  3AV8 A;  1SE3 A;  1SJE D;  1C76 A;  2WDR B;  3ZQ4 A;  3AEF B;  1ESF A;  4XDD A;  5EE3 A;  3H8H A;  3ZYY X;  2TSS A;  1UWM A;  1YJI A;  2JQR B;  4M0W A;  4OW0 A;  3GP7 A;  2IGG A;  1D6E C;  1SF0 A;  4R3D A;  4GDL B;  1IBX B;  2JX5 A;  3NS1 A;  1XLQ A;  3RPF C;  1J7A A;  1K50 A;  2W55 A;  3DWM A;  4WWM A;  2KAJ A;  3HRD D;  1VZ6 A;  3KWL A;  3P4Q B;  3HVZ A;  3P4P B;  1K51 A;  4PT5 A;  3URY A;  2YEP B;  1JWA D;  2BS3 B;  2KQ4 X;  1D5M C;  2HDE A;  2WU2 B;  3BII D;  4TQ1 A;  2W82 A;  4JWS C;  3AE4 B;  4WUR A;  1HXY D;  3U7Z A;  2ACZ B;  2K0P A;  1JW9 D;  1UWX A;  4IOI E;  4O1N A;  1PYW D;  2WLB A;  1BUI C;  3GS2 A;  1JAL A;  2WXJ A;  2RDH A;  1JRP A;  5HHD G;  1QT9 A;  1FFV A;  3ZJV A;  2I38 A;  1YQ3 B;  5I4D A;  4UDU C;  1SJH D;  1TZO A;  1ZOY B;  2SEB D;  3NUH B;  4KKI A;  4N59 A;  4N58 A;  3GB1 A;  1FFU A;  1QOA A;  1TS4 A;  1WSP A;  1UGJ A;  3CIR B;  4DQO C;  1T3Q A;  1T5X D;  5G5H A;  2IDY A;  4RFB A;  4WIP A;  4A8X C;  3Q8B A;  4OZC A;  5T8I A;  3AE6 B;  3FC4 A;  1YN5 A;  4XDC A;  2BS4 B;  3AM9 A;  3P4R B;  1V1P B;  4HRS A;  2PVO D;  2K9X A;  1JML A;  1NYQ A;  1YN3 A;  2L52 A;  1V1O A;  1MHX A;  1C4A A;  3C8Y A;  3KWV A;  2DYO A;  1L0X B;  2EEL A;  3BVM A;  1NVI D;  5FKA C;  5GXG B;  5D3I B;  1GAQ B;  4JPS A;  4CQN A;  1NYR A;  2BB6 A;  2OHF A;  3W1S A;  1GB4 A;  1ZE3 D;  1FNW A;  4MM3 B;  2SAK A;  4C56 C;  1VR9 A;  1HEZ E;  1B9R A;  5BYR A;  1MI0 A;  1VDV A;  3Q8F A;  1XEE A;  3ZJT A;  3R8B A;  1SE2 A;  2WS3 B;  2VZK D;  1PDX A;  1YMH E;  1FIQ A;  1SIJ A;  4LK0 M;  3VR8 B;  3BZD B;  2WP9 B;  4YT0 B;  1F2R C;  3MFG A;  3SFD B;  1ET6 A;  2J53 A;  5AUI A;  3NVW A;  4P6V F;  3ABV B;  1NEN B;  2ON8 A;  3VQI A;  1FXI A;  2QSD A;  1WXQ A;  3E9S A;  4AQ7 A;  3ZGZ A;  3PO0 A;  1K53 A;  4ZRQ A;  2AQ3 B;  2YEP F;  1TJE A;  1GPX A;  2R61 A;  1ENF A;  2CJN A;  4J3O D;  2MJ3 A;  2JWU A;  4GDK B;  4NAM A;  1IBX A;  1FO4 A;  1DOX A;  2QIL A;  2JU6 X;  3BK2 A;  3P42 A;  2CJO A;  1DGJ A;  3TSS A;  1FEH A;  1R7S A;  2DLB A;  1XCQ L;  1DOI A;  3FAH A;  2N0S B;  4KGS A;  2GB1 A;  5LNK 1;  1N5W A;  4B0E A;  4YSX B;  1L0Y B;  1ZXI A;  2WXM A;  2M19 A;  1D4B A;  1EU4 A;  4NJC A;  1B1Z A;  1DOY A;  4HJG E;  3Q69 A;  1EWY C;  4N6E B;  3O13 A;  2X38 A;  3BYY B;  1V8C A;  4LLG M;  2E6X A;  1YQ4 B;  1C78 A;  2WXK A;  3AE5 B;  1BML C;  1CK1 A;  2JXT A;  4AS1 A;  1TKG A;  2RDG A;  4HKZ E;  1TY2 A;  2W3R A;  1F0Z A;  1KLG D;  3VRB B;  1CZP A;  1VJK A;  2LFI A;  1ZDX A;  3EUB 2;  1NEK B;  1CQV A;  2BT6 A;  4ZYS A;  2LEK A;  4KKJ A;  1HZ6 A;  2QIE B;  3UI3 A;  3KQ4 A;  1I4H A;  1FNU A;  3R2I A;  1C79 A;  1AWD A;  2WXH A;  1FD6 A;  4HRO A;  1KF6 B;  4US8 A;  1EU3 A;  2PMV A;  1JWS D;  1FXA A;  3AB5 A;  1CJE A;  4RF0 A;  1JCK B;  1V1P A;  2G1E A;  2BB5 A;  1ZXH A;  1PGB A;  5HI1 A;  2BS2 B;  3RFZ B;  2L83 A;  1E9M A;  1XF5 L;  4DXG A;  4C7Z A;  4LTU A;  5BYQ A;  1HZ5 A;  4YTM B;  2JYE A;  1YN4 A;  3DWG C;  1KTK A;  2V4I B;  3TEW A;  1KLU D;  1BXT A;  3NVV A;  1QKZ A;  3BK1 A;  1GB1 A;  3AED B;  3L4P A;  1FCL A;  3AEA B;  2BTE A;  3LXF A;  2N9L A;  2WXP A;  3EA6 A;  2WXG A;  1UNS A;  2NTT A;  1L5P A;  1JWU D;  5AUK A;  3NZ3 A;  4KGR A;  4P16 A;  1E6E B;  5JXV A;  2QJL A;  1P7E A;  4RH6 A;  3KLS X;  4ITK A;  4ZRP A;  1TKE A;  2BYT A;  3AEB B;  5HG2 A;  1N61 A;  3W5V B;  1OQR A;  3PZ8 A;  4L23 A;  3SEB A;  1N5X A;  3HVD A;  1LO5 D;  4ZHO A;  3W9C B;  4L1B A;  4A55 A;  3FIL A;  5BMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...