3PZ7A

Crystal structure of ccd1-dix domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
86
structure length
86
Chain Sequence
PHMSSTCTKVLYFTDRSLTPFMVNIPKRLEEVTLKDFKAAIDREGNHRYHFKAMDPEFGTVKEEIFHDDDAIPGWEGKIVAWVEED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of WNT Activation via the DIX-domain protein CCD1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Dixin
total genus 17
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00778 DIX DIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.380 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3pz7A00
1WSPA 3PZ7A 3PZ8A 2D5GA 4WIPA
chains in the Genus database with same CATH superfamily
5LNK1 2ZEQA 4FXCA 3H9DA 3NZSA 1JWUD 3DVNU 3OWEB 2PJHA 3RULA 1EU3A 3NG0A 4ZHPA 3OJ3A 1FMAD 1FRRA 5G2NA 1C9FA 1L0VB 3TIXA 1V49A 3Q8AA 1AARA 1AN8A 3VH3B 1RRBA 1UWMA 1WXVA 3R7RA 1FNUA 4LNKA 3VAWA 2RSUA 3AV8A 1XLPA 5H8YE 3VVWB 4IOIE 1YX5B 2CHXA 1SXTA 2HD5B 1CJEA 2H89B 3NOBA 4US8A 4LDTD 1C79A 1YMHE 1L0XB 4C7YA 4EOYA 2AEHA 3BYTB 2MBOA 2J53A 4GDLA 2L0TA 3J9CA 3N3KB 3VRBB 3PGEA 2DHZA 1A70A 2M17A 2FE8A 3PO0A 1Q0WB 2QSDA 2M56B 1GB1A 5J17A 2WQYB 1KFYB 1HA5A 1SIJA 3HK0A 3ZUNA 4EEWA 4W9GA 2SEBD 3FILA 4YL8A 1PUTA 3R2IA 3RZFA 2MX2A 4YWGG 1N60A 4FJZA 2TSSA 3C8YA 2X8XX 3P2BA 3R8BA 4IWPA 3VUWA 1TTNA 1ET9A 1TY0A 4HJGE 1TS4A 2WHIA 3V3XA 2FIDA 4II2B 3IFWB 4KDIC 3DBSA 1STEA 1ZDVA 3VR9B 4DWFA 1VZ7A 4HWIB 5EE3A 4TQ0A 4OZBA 3ZJTA 2IO0B 4K81A 2IO1B 2AYOB 2KWCA 2LWPA 1JROA 2D2QA 3PREA 2CHZA 1V9JA 4LNNA 2KJRA 4BAXA 2ZW1A 2WXGA 1OFFA 3KVFB 1NI3A 1FXAA 1KLVA 3U7DA 4A3OA 2KTRA 2BKRB 2BW2A 3PRPB 2KHWB 5AUKA 3OJ4B 1I4HA 2K6QA 2KN5A 1QOBA 4RFBA 4BKGA 4YTMB 4E74A 5D7GA 1RAXA 2DYMA 2JZ3B 3GZNI 4Q2JA 5CX3A 1N5XA 3AN1A 3MFGA 5D6JB 1LFDA 2AX5A 3RNCC 1F9JA 1C77A 2L83A 2Y5PA 5IP4D 3TJPA 4C7ZA 2LMCA 4DXAB 1JW9D 3A1QB 4WJPA 1TYGB 1FXTB 4LNOA 3AEBB 2ZVOA 1JWMD 1YQBA 2KTFA 1QZEA 2Z59B 1HXYD 2BS2B 3Q3OC 1XD3B 2M4NA 1J7CA 3QK0A 1FRDA 1KF6B 2MH7A 4FHJA 1VJKA 4I6PA 3W9CB 4KX6B 1J0GA 1ZPSA 3PLUA 3B08A 1U4AA 1XLNA 1WGYA 4K7UA 3DHIC 3CMMB 1OQYA 2PKOA 2AWTA 2N9PC 5CHFA 5G55A 4GU2A 1WM2A 1XO3A 4C56C 3AEGB 4MELA 4RGNA 2NVUI 2MBBB 2R61A 4XZ4A 2QEJC 3H6NA 4WWPA 3IAS1 3Q3JA 2JYTA 4JL9A 2J42A 1YN3A 3ONSA 1Y56A 2JX5A 3RI7C 2JVCA 5IA7A 1QILA 2KWVB 1UELA 2K8CA 1V2YA 4K1RB 1D5XC 3P1MA 2ZPYA 5TSSA 2GMIC 1FM0D 2WXNA 4OZCA 3SEBA 4N9F4 3U52E 4EZLA 4LCDE 4GDKB 2G4DB 3MC9A 3MJ5A 1A5RA 2WXFA 1WE7A 1BT0A 5DCNA 2KWDA 2XK5B 1CK1A 2IPKD 4N6EB 1UUPA 2Y5CA 2L76A 2BYFA 2C5LC 1YQ3B 4C4VA 3I57A 4HK2A 2INPE 1E6EB 1I7HA 5GXGB 1QLBB 4WWNA 4O1NA 3N32A 3GOEA 3PV1A 4MGKE 4YSZB 2V9HA 3AE5B 3R3MA 3QWZB 3V6EB 2WP9B 3R2TA 4EUTA 3D32A 4IKGA 2INNE 4KZ0A 4ICVA 5DPWA 2JWUA 3A9JB 3ML9A 3URYA 2CU1A 2NBVB 2BB5A 4LNFA 3C19A 3W1YA 4B9KA 2XNAC 5CHWA 4NNJB 2WDRB 3WAOA 2LGYA 1WX8A 2V4IB 1AWDA 2KZRA 3Q3NC 1UGJA 1EO6A 3IT4B 5EE0A 3N20C 2KQ7A 4OHJA 3EC8A 3W2DA 4WURA 1Q10A 4HPMB 4IM2A 1WJ6A 2R2QA 1YQ4B 4RH6A 3K9OB 3ZVVA 1HEZE 1WR6E 4G0NB 2WU2B 4CHKA 2YLMA 3DDCB 4W9DA 1C4PA 3ZGZA 4PYZA 2JZPA 1GNUA 2EMSA 1F1HA 1ZOYB 1L6VA 4JLCA 2BF8B 4KKJA 4ANVA 1I4GA 3NVWA 4JQWC 4IW0A 1ESFA 3AE2B 3ZTDA 4YTPB 1M4VA 1JWBD 1PGAA 3UQAA 2DZIA 1XQQA 4MJSA 1E0ZA 3N9YC 5IO9A 1L2NA 1CQVA 4BVUC 4E3CA 2FCQA 4ZDVA 5KHOA 1L4DB 2ASQA 3DBRB 3I5JC 3RZWC 2N9KA 4US9A 2WGSA 5JXVA 2KDFB 2J0JA 2PVOD 4YSYB 2K9XA 4WWMA 1XLOA 3W1SC 1K53A 3N1ZC 3DHGC 3QAQA 1KM7A 1P7FA 1XLQA 1WY8A 4GN1A 1OEYA 3H7PB 3SHQA 2KT7A 2BS3B 1T3QA 3MTNB 3AE8B 4HEA1 1DOYA 1V5OA 2AL3A 3P4SB 2Z0EB 2KAJA 2Y5BB 3PRZA 3GE8C 3QJZA 1JQ4A 4BKTA 1WI0A 2QJLA 1RFKA 3E9SA 2RDHA 2LUMA 2KOXA 4AJWA 2YEPB 3DBRI 2DBYA 2MWSB 2CHWA 4A9AA 4JGHB 4FN2A 1L6UA 3AEAB 5EE9A 4A6QA 4TQ1A 2LXCA 5E6OA 1C3TA 2XEWA 2BYTA 2FCNA 5AEKB 3NHEB 5J2RA 2ZNVC 1IYFA 1EM7A 4HKZE 4D2KA 1V97A 2BVCA 2WNMA 3LJ3A 2PW9A 4MH8A 1BXTA 5FR3A 1T5XD 4NY0A 3SU8X 3LXFA 2CU3A 4IUMB 1GOZA 4P16A 4TKNA 5D3IB 3CIRB 1ENFA 2ZNVB 4ICUA 2I1KA 2R2OA 3L54A 4YXDB 2CS4A 4KGSA 3PZDA 1WMHB 1E7PB 1HE8A 4FADA 2Y3AA 2BKFA 1K8RB 4NAWA 4M0WB 4JIOU 2EELA 4LTUA 1C78A 1WRDB 3QHTA 1LM8B 4DBGA 1ZP0B 2MBEA 3DQVA 2PTLA 3KWLA 2KK8A 1KOTA 1J7AA 2WX1A 3PTFC 4RF1A 1UF0A 1V86A 4M01A 1KTKA 3ALBA 4DHZB 3PRMB 4HDQA 2N7EA 3AEFB 3KUDB 3O65B 3TMPB 2LHDA 5H92C 5BYRA 4W9CA 2ON8A 2RPQA 3BVGA 3SFEB 3SDLC 4DDGD 2NMQA 2EKEC 3TSSA 4HLEA 2IGDA 1OQQA 3BK1A 2KDBA 2LRUA 3IVFA 2KN4A 3IG3A 1FCLA 4XWTA 2D07B 4M00A 3NS8A 1FNWA 1EF1A 3DBLB 4ZRQA 1HZ5A 2W3SA 4BBNF 3BIID 1L5PA 1V80A 1GUAB 1XF5L 2FCSA 2WXQA 1SJHD 2C7MB 2MP2A 3DPDA 5C3JB 2AQ3B 3EHVA 4ZRJA 1PFDA 5T8IA 4B95A 2IGGA 2DAFA 4KGTA 5DPTA 2WWZA 1TIFA 2WXHA 4GB9A 2VRRB 3NVVA 1IUEA 1J7BA 1PQSA 4ARCA 2GLSA 1ISNA 5L95C 4AWJA 2KFJA 3EUB2 3IXSA 1VZ8A 3M62B 1LGRA 1F52A 3ZNHB 3B2GA 3U30A 2INDC 1D5ZC 2QDFA 2K1FA 3PS6A 2J0KA 1TKYA 4M8NA 4OVUA 4UDUC 1GC6A 3EGRA 1V6EA 1PGBA 5IN7A 3ZNGC 3VQIA 1MG4A 2B76B 3L13A 4MJSB 2D5GA 1PDXA 4M02A 2IO3B 4KZCA 4DXGA 1IPGA 1WMHA 3ZKJC 1XCTL 1Z5SB 4RGOS 1GPXA 1ZGUB 4GXBA 1WYWB 3ZRCA 2BPSA 5FKAC 4ZRKA 1PGXA 2NPTB 3TCAA 3TEZA 5AZFA 3BZDB 1C4CA 2XK5A 3LDZE 3N1XC 4A20A 2UYZB 4A90A 2JF5A 3DHHC 4WQOB 4ANWA 3BVMA 2EKIA 1BMLC 5BMGA 4WJOA 4P1CC 3VH4B 4KV2A 2MEKA 3Q8CA 2JRIB 2N7JA 3P4RB 4HVBA 4J3OD 2BBCA 2FNJB 1MFWA 2OHFA 2Q5WD 4EZJA 5DPRA 3ZXRA 2JXTA 1I42A 4RNAA 3LB8C 1R4NB 1P3QU 2JZZA 1I4PA 2M0AA 2I1JA 2PLPA 3AM9A 4GDKA 1UH6A 3T3OA 2NTTA 1UNSA 3BY4B 2WDVB 2K8BA 2W9NA 4M0WA 3S2AA 3PVLA 1ACCA 5E6PA 4GOCA 3VTUA 1UBIA 2WXIA 3MJWA 4AS1A 3QX1A 3HVZA 1R4NI 3Q3FA 3PLVA 3NZUA 2IO2B 2GI9A 1FCCC 4HPPA 5G5HA 3WAPA 3R66C 3MC8A 2GBMA 3ECIA 1WR1A 1WZ3A 1C1YB 4X57B 2WXKA 3KUCB 1NI2A 1WGGA 2PMVA 4H2AA 1C76A 5IAAC 4NJCA 5C23A 4XYCA 2KDMA 3K9PB 2DLBA 4B0EA 3JVZX 4OVZA 3AECB 2KX0A 3OLMD 5BMIA 1LQBA 5BO4B 4RM9A 4K3BA 4KIKA 1XT9B 3AU4A 3NZ3A 2QMTA 1L7YA 4W9LA 1WXAA 3BVZA 1K52A 2A4ZA 2V0GA 2K0PA 3N1YC 1GB4A 1TBEA 2HJ8A 1K51A 3TL5A 1J19A 3NVZA 2N1VA 2C7NB 4XDCA 2HE7A 4HDOA 3IT6B 1K50A 1NDDA 2PE9A 2NPTA 1S1QB 1WXSA 3APFA 3E56A 3TEXA 2LGIA 2JUOA 3GZNB 2L32A 4BBNC 3PSEB 4TV3A 1BUIC 5MPOA 2QILA 4OZAA 1WGRA 1ZUD2 1QQRA 5LXHA 4WAFA 1RLFA 1CMXB 1KLUD 3DBHI 3Q14C 2LHEA 2V3NA 1B1ZA 1N5WA 1C4AA 3RPFC 3DWMA 3TUOA 4GLSC 3EA6A 4XDDA 5HHDG 1D3ZA 1TS2A 1WFYA 1ZE3D 4RMAA 2KANA 1TY2A 3AE3B 4NPNA 2KWUB 4J6IA 2V4LA 4C4VB 4I6NB 3RNBC 3DBLI 2L0FA 3QCAA 5E6NA 4MM3B 4ITKA 4W9EA 3VFKA 3ZXVA 2LGXA 2DAJA 2ZVNA 1MPEA 5AZHA 2OJRA 3VTWA 3QIJA 4MDKE 1D4BA 3A9KA 1MJDA 4IWQA 3AMZA 4C80A 1VDVA 3DVGX 1R4MI 4RGMA 1SSNA 2MCNB 3VUYA 2W3RA 4BKSD 1E8WA 1WX9A 2WU5B 4IG7B 3RNAC 2BYVE 3QQ8B 3CSFA 3RD2A 2DZJA 3I3TB 4RF0A 4NQKE 2JQRB 4GGQA 1QT9A 2ACZB 1P98A 2LUEA 4EFOA 1KRHA 3B1LX 1WZ0A 2WX0A 1ET6A 1AW7A 2K22A 4JWSC 2KDIA 1F2RC 2JPHA 2FAZA 1R7SA 1YJ1A 2G45B 1D6EC 3AEEB 3PHXB 3QARA 1OEYJ 4CO7A 3WANA 3ZDTA 2KNBA 1V8CA 5D3DA 4EZKA 2O2VB 1ROEA 2CJNA 2ZJDA 3A9JA 1YIWA 1HTQA 4JX1C 1RYJA 2JRHA 1L4ZB 4HROA 3IBEA 3H1UA 2L05A 4N59A 3A4SC 4CQNA 4KKIA 3QC8B 2MSED 4W9HA 2LXAA 4M8MA 2PPHA 4MGZE 4YT0B 2K3UA 2W54A 3HVDA 3DOWA 3GP7A 5GMVA 3MP9A 1WYGA 2A5UA 4FULA 2MBQA 1MHXA 1TGZB 4MGYE 1E9MA 3SFDB 2ZCBA 4QAYA 3CF6E 4OW0A 1SGHA 3NVYA 1QKZA 2RR9A 2KTRB 2VZKB 4HRSA 2Z8LA 3PT2B 3DCGA 2C9WB 5C1ZA 3HIZA 5KHQA 5DPSA 1SEBD 4DQOC 4MGIE 3HM3A 5BYSA 3ZJVA 3ZW3A 1XEEA 1IGDA 2VH2A 1T0YA 1VCBA 2N1WA 3UINB 3V05A 1MVKA 3M3JA 2L7RA 3ENEA 2C60A 1HZ6A 1OTRB 4BKSA 1EU4A 2QIEB 3PZ7A 1PYWD 1J8CA 2BB6A 4USAA 1VRAB 1WSPA 2KMCA 4E71A 4KIKB 2IY1B 4HXDA 5AUIA 3IHPC 2UWQA 4MACA 1SE4A 1SE9A 4F7ZA 2AQ1B 3X23A 3T9LA 2GBRA 3V6CB 1QOAA 3ZIMA 3EFCA 1UBQA 3Q8EA 4DHJB 1DGJA 3ZNZB 3ZNID 1IBXA 4MSMB 4AJYB 1EWCA 4IM0A 2EMTA 4K7WA 1F77A 1WGDA 2OEDA 5CTRC 2D10A 3TEWA 2SAKA 3SR6A 3EFUA 3LYYA 2FIFA 2X38A 2DWQA 4ACFA 5JHAA 2DZMA 4C00A 3HHMA 4P7IA 3L4PA 1P0RA 1Y8RC 3AB5A 1B9RA 2BWES 2KQ4X 5E6JA 4W9JA 4ARIA 5BMHA 1WGHA 1X1MA 1DOXA 2L3ZA 4TMAB 3GS2A 3UIOB 1VR9A 4L2YA 2WLBA 1P1AA 2M0XA 3L17A 4G3XB 5FK9C 3H7SA 2IDYA 4KVGB 2KD0A 4NAWB 4ANUA 1JRPA 4AOFA 4L23A 5D94A 2KLCA 4MH0E 2GBJA 3GE3C 3JSVB 2HTHA 2G1EA 3RNFC 3WA0A 3U4EG 3V61A 2KJHB 4WWOA 1IP9A 3HUIA 4BZAA 1TZ1A 2FBWB 2MJ3A 5EE1A 5BYQA 4P6VF 3VTVA 1TS5A 5JHBA 4AP4C 2WDQB 4A3PA 3L0WB 2M19A 4W9KA 3W1SA 4EKUA 2NBWB 3L16A 3L08A 4PS7A 2MQJA 3OAWA 2B3AA 3AI5A 2LFIA 3GB1A 4LNIA 1FIQA 2FCMA 1MG8A 3O13A 5FR6A 1GJZA 1Q1OA 2JU6X 2I2YA 3V62A 1DOIA 3RCZA 2IJ0A 3BYYB 1FD6A 2KYWA 2NR2A 2ZCCA 5IOIA 5HKHA 4S0RA 1V1PB 4AQ7A 1UGMA 3UQBA 3DBHB 4I6LB 3RMKC 1YJJA 1QF6A 1WF9A 3AE9B 3RFZB 2LD9A 4DHJD 1EUVB 3A33B 2KFKB 1IBXB 2RPVA 2JWZA 4URKA 2BWFA 2N4FA 4NJ7A 1YD8U 1Z2MA 1YJIA 2GOWA 3CWIA 2KO3A 4TSSA 3VHTC 2NBUA 1SE2A 2PIAA 1D5MC 1E90A 3KH0A 4ZYNA 4HCPB 3WCQA 4S17A 2CR5A 4KSLC 3ZRFA 2O6VA 3WALA 3CSTA 1VLBA 2WXLA 2QCZA 4RCOA 1E8ZA 2DENB 1ZXHA 2N0SB 2MJDA 2V1YA 3HM6X 1YNTE 2GRIA 4MM3A 4ZHOA 5HG2A 1E8YA 2KQSA 2PEAA 2JT4B 3HRDD 2RDBC 4FHKA 3A1QA 4ZYSA 1E5WA 3QA8A 4DHZE 2WXJA 2NTSA 2O6VB 3PZ8A 4REZA 2FUG1 1WXQA 3AH7A 2G4SA 4N58A 4KDLB 4NAMA 2KVRA 1YN4A 2WXRA 4XE0A 2REXA 1KJTA 1L0YB 1SBBB 1WM3A 3UIPB 1GG3A 4KSKC 4IWOA 3KUZA 3U8ZA 2O6VD 3JYUA 3APCA 3VRAB 2KDEB 2L52A 5G5GA 2KFKA 1RM6C 2KJ6A 4F1SA 3BK2A 2YEPF 3W5UB 2J0MA 3P63A 4WJQA 2W82A 2JYEA 3OG5A 2NCNA 4NZLB 4WAAA 4ASWC 3FILB 4XGAB 3AE1B 3A9KB 1ZDXA 2KC1A 3AEDB 4HJKA 3KWVA 2JSVX 3NRZA 2MHJA 3BWUD 2YVCA 1T0RC 2D3CA 1FFVA 1HTOA 1NYQA 4FJVB 4HCNB 2QHOA 3APDA 2IZVB 4ANXA 2KXJA 1YN5A 2LEKA 2V3SA 1R4MB 1S3SG 2GBNA 1VZ6A 2D3AA 2J7QB 3IAM1 3KLSX 4BFRA 5LLIA 2L00B 3ZJUA 2ICIA 2J4XA 3RUIB 2H88B 3KW5B 1GC7A 2K5PA 2INCC 5HI1A 3H7PA 4P1BC 2DZKA 1NBFC 2FUHB 4IM3A 3VR8B 3R7QA 2ONQA 4DK5A 2O2VA 2RD0A 3VUXA 1JCKB 1E8XA 1FFUA 1I4QA 3RNGC 3P4PB 3KQ4A 4TUUA 3MHSD 4K3CA 4YTNB 1WGKA 3Q8BA 2G3QB 1RFAA 1V1OA 1VD2A 3NJTA 2AL6A 3AE4B 4GIVA 4DXFA 1E7VA 1FEHA 2LVQA 3ABVB 1GAQB 1RWSA 3VDZA 3M63B 4PK1A 2VH1A 1FXIA 2IBIB 5C2TB 5IKCM 2M1MA 2LI5A 4PS3A 4W9IA 3NUHB 1P7EA 4XX5A 4GSWA 1ZW7A 3L10B 5HFYA 5LXIB 1WH3A 2CKHB 3T8MA 4LK0M 2GBKA 2K25A 3I9V1 1FNVA 2D11A 2MW5A 3WIMA 2MP2B 2XBBC 1IGCA 3M95A 4PT5A 3UI3A 1G6JA 3Q6BA 2D3BA 4ZRIA 4B0MA 1M94A 2KMMA 1F2RI 1JRUA 1CZPA 3NY5A 2XN9C 4A55A 3UF8A 1V81A 3B2FA 1TKGA 2W55A 3X0WA 1E10A 1JWAD 3Q8FA 1MI0A 2V3PA 4R3DA 3ZO5B 2DYOA 2LZ6A 4EE2A 4OVVA 1OGWA 3P4QB 3NS1A 2Z0DB 2GB1A 2LVPA 2MLBA 1ZXIA 5I4DA 1XCQL 1TJEA 1WWTA 4KGRA 4XC2A 5JZEB 4GDLB 1N62A 3DVGY 1JALA 4DDID 2LJ5A 4WQMA 1WIAA 3ML8A 4L1BA 3MHZA 3RNEC 2LVOA 4FJYA 2WXMA 4LLGM 1SIFA 4MSQB 2DNFA 2ZPNA 3PHWB 2BYEA 1MHHE 1V5TA 3FC4A 2MRPA 3KYDD 1WXMA 4IC7B 4WIPA 1KLGD 1I4RA 4F8CB 2N7DA 4BOZB 3ZYYX 3AE6B 4JE3B 1NVID 3JSVA 1WJNA 3AXCA 3UGBB 4FA6A 2C7HA 1E7UA 1YOVB 2IYDB 3A4RA 5J18A 3B9JA 1SB3C 4NQLB 2KACA 1WE6A 2K39A 2LJIA 3DVNV 1ZKHA 2J52A 3AU5A 1FO4A 4G11A 2L1AA 4WH4A 2WS3B 4A8XC 2CJOA 3P42A 1N63A 2BGFA 4FBJB 2OOBB 2WXOA 2OJWA 3WAMA 3FAHA 2KVZA 2IY0B 3ETRA 2E6XA 2WXPA 4HKQA 2KMAA 1TZOA 4RGTA 3RT3B 3N30A 4IDIA 5EDSA 4MEMA 1T0QC 3ZQ4A 1QOFA 2M8SA 2BT6A 2DX5B 1I35A 2K6DB 5L83A 4II3B 1T0SC 2RMMA 1SJED 1LO5D 2D3GA 4PS8A 5AZGA 2VZKD 4CYEA 2LASA 2LGDA 1I4XA 1V1PA 1F0ZA 1QOGA 2MA9B 2LRWA 2WYQA 4ZRPA 3U7ZA 2KC2A 2HDEA 4NJ6A 5JH5C 3ZDMC 3TEYA 1SE3A 4XWWA 3Q69A 4ZOHC 2I38A 4GMVA 2JXXA 3TBLD 1DYQA 2RGFA 2MJEA 4LDTB 2K8HA 3RYTA 2HTME 2KLGA 3FKYA 3BINA 1JMLA 2PE6B 1EWYC 2AQ2B 2E3TA 1KH0A 3PPAA 1T6BX 3AE7B 4RM8A 1WJ4A 1YX6B 4JWUC 1NYRA 5CHVC 1WRIA 4FLHA 2UU7A 2DYBA 5TR5A 3T3NA 4BOSC 3V60A 2RDGA 2PVGC 4HPLB 3RN9C 2G9HD 2WDTB 1JWSD 1SF0A 3W5VB 2KKCA 2IGHA 4PYUA 4LJPB 2JY6A 1EF5A 1NEKB 1WJUA 1UWXA 3B0AA 1FPYA 1H4RA 3U2SC 2BQQA 2N9XA 4G50A 3SD5A 3Q2AC 4JPSA 4YSXB 1TKEA 1UD7A 3AULA 1OQRA 2N9LA 1NENB 3Q3MC 1LXDA 4W9FA 3I63C 4K7SA 2QC8A 1HQRD 4LJOB 2ZZPB 2NS5A 3ZLZA 1N6ZA 1XXGA 1H8CA 2LGSA 1WX7A 3ZTCA 2MBHA 3EECA 3MC0B 3KYCD 5D2MB 1Q5WB 2L8JA 1TS3A 3DWGC 3JW0X 3H8HA 4WJNA 2BS4B 2ZW0A 1N61A 1AYFA 1TT5B 3C0RB 2BTEA 1UZXB 2KX3A 2HJ1A 4MT5A 4AUQC 1P9DU 3VXWA 4B6WA 2N9EB
chains in the Genus database with same CATH topology
3AE8B 4HEA1 5LNK1 2ONQA 1DOYA 1KRHA 4FXCA 3P4SB 1JWUD 1JCKB 1FFUA 2KAJA 1I4QA 3OWEB 1EU3A 1JQ4A 1ET6A 1AW7A 2K22A 4JWSC 2QJLA 1RFKA 3E9SA 2RDHA 2LUMA 1F2RC 4ZHPA 2YEPB 3P4PB 3KQ4A 2DBYA 1FMAD 1FRRA 1R7SA 1C9FA 1L0VB 3Q8AA 4A9AA 1AN8A 1UWMA 1D6EC 1L6UA 3AEEB 3AEAB 5EE9A 4A6QA 4TQ1A 4YTNB 1FNUA 1WGKA 3Q8BA 2BYTA 1V8CA 5D3DA 3AV8A 1V1OA 1XLPA 5H8YE 1ROEA 3AE4B 4IOIE 4DXFA 2CJNA 1SXTA 1EM7A 1FEHA 4HKZE 4D2KA 1CJEA 1V97A 2WNMA 3ABVB 4JX1C 2H89B 2PW9A 4MH8A 1GAQB 1RYJA 1RWSA 4US8A 1BXTA 5FR3A 1L4ZB 1T5XD 4HROA 1FXIA 3LXFA 1C79A 1YMHE 2CU3A 4N59A 1GOZA 4P16A 1L0XB 5D3IB 5C2TB 3CIRB 1ENFA 4C7YA 4CQNA 3BYTB 4KKIA 2J53A 3J9CA 3VRBB 4YXDB 4YT0B 2K3UA 2W54A 4KGSA 3HVDA 1E7PB 3GP7A 1A70A 2Y3AA 3NUHB 2FE8A 3MP9A 3PO0A 1P7EA 2QSDA 1WYGA 2M56B 1GB1A 5HFYA 1MHXA 2EELA 1KFYB 1E9MA 2WQYB 1HA5A 1SIJA 3SFDB 4LTUA 1C78A 4OW0A 2SEBD 4LK0M 3NVYA 1ZP0B 3FILA 1QKZA 2PTLA 3I9V1 3KWLA 1FNVA 1PUTA 3R2IA 1J7AA 2VZKB 4HRSA 1IGCA 2Z8LA 4PT5A 1N60A 4YWGG 2TSSA 3C8YA 3R8BA 3UI3A 4RF1A 1ET9A 1TY0A 1KTKA 1TS4A 4HJGE 1SEBD 4DQOC 3V3XA 5BYSA 4B0MA 3ZJVA 1XEEA 2KMMA 3AEFB 1F2RI 1STEA 1IGDA 1ZDVA 2LHDA 5H92C 1VZ7A 5BYRA 3VR9B 1CZPA 2ON8A 2XN9C 4A55A 5EE3A 4TQ0A 3BVGA 4OZBA 3SFEB 3V05A 2NMQA 1MVKA 1TKGA 3B2FA 3ZJTA 2W55A 3TSSA 1JWAD 1E10A 1HZ6A 3Q8FA 2IGDA 1MI0A 1OQQA 3BK1A 1EU4A 2QIEB 2V3PA 1PYWD 3PZ7A 4R3DA 2BB6A 4USAA 2DYOA 1VRAB 1JROA 4EE2A 1WSPA 2KN4A 1FCLA 3P4QB 4XWTA 5AUIA 2ZW1A 1FNWA 2WXGA 3NS1A 2GB1A 1OFFA 4MACA 4ZRQA 1ZXIA 1HZ5A 2W3SA 5I4DA 1NI3A 1FXAA 1XCQL 1SE4A 3BIID 1TJEA 1WWTA 1L5PA 2AQ1B 2BW2A 4KGRA 1XF5L 2WXQA 1SJHD 4GDLB 1QOAA 5C3JB 5AUKA 2AQ3B 1N62A 1I4HA 1JALA 1PFDA 4WQMA 5T8IA 4L1BA 3Q8EA 2IGGA 1DGJA 4KGTA 1QOBA 3MHZA 1IBXA 4RFBA 4YTMB 1EWCA 5D7GA 2WXHA 1F77A 2OEDA 2DYMA 2WXMA 4LLGM 4Q2JA 3TEWA 2SAKA 3SR6A 3NVVA 1IUEA 1J7BA 1N5XA 4ARCA 3LYYA 2X38A 3AN1A 1MHHE 2DWQA 3MFGA 3FC4A 2AX5A 1C77A 2L83A 2Y5PA 4WIPA 1KLGD 3EUB2 3IXSA 1VZ8A 1I4RA 4C7ZA 2LMCA 1JW9D 3L4PA 1TYGB 3B2GA 3AB5A 3AEBB 3ZYYX 1B9RA 3AE6B 1D5ZC 1JWMD 4JE3B 1NVID 2KQ4X 5E6JA 1TKYA 4UDUC 4ARIA 3EGRA 1HXYD 1PGBA 2BS2B 5BMHA 1DOXA 3VQIA 1J7CA 2B76B 4TMAB 3GS2A 1FRDA 1KF6B 1VR9A 4L2YA 2WLBA 2MH7A 5FK9C 2D5GA 1PDXA 3B9JA 1SB3C 4DXGA 1VJKA 3W9CB 2IDYA 2KACA 4KX6B 1XCTL 4RGOS 1ZPSA 4NAWB 1JRPA 2LJIA 1XLNA 2J52A 4L23A 1GPXA 1FO4A 2L1AA 4WH4A 2PKOA 2WS3B 2G1EA 4A8XC 5FKAC 3U4EG 2CJOA 1PGXA 3TEZA 3P42A 1N63A 1XO3A 3BZDB 4C56C 1C4CA 3AEGB 4RGNA 4A90A 2R61A 2WXOA 2QEJC 3HUIA 2FBWB 2MJ3A 3FAHA 3IAS1 5EE1A 5BYQA 4P6VF 3ETRA 1TS5A 2E6XA 2JYTA 2WXPA 2J42A 3BVMA 2EKIA 4HKQA 2WDQB 1BMLC 1YN3A 5BMGA 1Y56A 2JX5A 2M19A 1TZOA 4RGTA 2MEKA 3W1SA 3Q8CA 2N7JA 3P4RB 1QILA 2BBCA 4J3OD 4IDIA 2OHFA 2Q5WD 2LFIA 3GB1A 3ZQ4A 1FIQA 2JXTA 1QOFA 4RNAA 2BT6A 1D5XC 3LB8C 3P1MA 5TSSA 3O13A 2JU6X 1FM0D 2WXNA 4OZCA 3SEBA 2M0AA 1I4PA 2I2YA 3U52E 2RMMA 1DOIA 2PLPA 3AM9A 3T3OA 2IJ0A 4GDKB 3BYYB 1SJED 2NTTA 1UNSA 1LO5D 1FD6A 2WDVB 3MJ5A 2VZKD 4M0WA 1ACCA 1I4XA 1V1PA 2WXFA 1V1PB 1F0ZA 1QOGA 2KWDA 4AQ7A 2WXIA 1CK1A 2IPKD 4ZRPA 3U7ZA 4AS1A 4N6EB 2HDEA 1YJJA 3HVZA 1UUPA 2Y5CA 1QF6A 3TEYA 3AE9B 1SE3A 3RFZB 4XWWA 3Q69A 1YQ3B 4ZOHC 2GI9A 1FCCC 3I57A 5G5HA 1IBXB 2I38A 2RPVA 2INPE 1E6EB 1I7HA 1DYQA 5GXGB 2MJEA 1YJIA 1QLBB 2WXKA 3CWIA 2PMVA 4O1NA 2HTME 4H2AA 1C76A 4NJCA 4TSSA 2KDMA 2DLBA 4B0EA 1SE2A 2PIAA 4YSZB 1D5MC 4OVZA 3AECB 1JMLA 3AE5B 3WCQA 5BMIA 1EWYC 2AQ2B 2E3TA 1VLBA 1KH0A 2WP9B 2WXLA 3R2TA 4RCOA 1T6BX 3NZ3A 4IKGA 2INNE 2QMTA 1ZXHA 2N0SB 3AE7B 2JWUA 3URYA 3BVZA 2MJDA 1K52A 2BB5A 1YNTE 4JWUC 1NYRA 2GRIA 4ZHOA 2V0GA 5HG2A 2K0PA 1WRIA 1GB4A 2XNAC 3HRDD 3T3NA 2WDRB 2V4IB 4ZYSA 2RDGA 1K51A 2PVGC 2WXJA 2NTSA 2G9HD 3PZ8A 4REZA 1AWDA 1JWSD 1SF0A 2FUG1 3NVZA 1UGJA 1WXQA 3W5VB 3AH7A 3IT4B 2IGHA 4XDCA 5EE0A 4OHJA 4N58A 3W2DA 3IT6B 1K50A 4WURA 1Q10A 4NAMA 1YN4A 2WXRA 4XE0A 1L0YB 1SBBB 3E56A 1NEKB 1UWXA 3TEXA 2LGIA 1YQ4B 4RH6A 2L32A 1HEZE 3VRAB 1BUIC 5MPOA 2QILA 2WU2B 2L52A 3U2SC 4OZAA 5G5GA 1ZUD2 1C4PA 1RM6C 3ZGZA 1QQRA 2JZPA 1ZOYB 1L6VA 4WAFA 3BK2A 2YEPF 4KKJA 3W5UB 1I4GA 3NVWA 1KLUD 3P63A 2LHEA 1ESFA 2W82A 2V3NA 3AE2B 2JYEA 1B1ZA 4NZLB 1N5WA 1C4AA 4JPSA 3RPFC 4YSXB 3FILB 4YTPB 1M4VA 3DWMA 1TKEA 1JWBD 1PGAA 1OQRA 3TUOA 2N9LA 4GLSC 3AE1B 3EA6A 1ZDXA 3AEDB 4XDDA 5HHDG 1NENB 1TS2A 1ZE3D 1TY2A 3AE3B 3KWVA 1E0ZA 2JSVX 3NRZA 3BWUD 1FFVA 3N9YC 1NYQA 1HQRD 1CQVA 4MM3B 1YN5A 4ITKA 2LEKA 1L4DB 1XXGA 1MPEA 2N9KA 4US9A 1VZ6A 5JXVA 1D4BA 3MC0B 3AMZA 4C80A 1VDVA 3KLSX 3IAM1 4RGMA 3ZJUA 1SSNA 2PVOD 1TS3A 2ICIA 3DWGC 3H8HA 4YSYB 2BS4B 2K9XA 2ZW0A 2J4XA 4WWMA 2W3RA 1N61A 1XLOA 1AYFA 2WU5B 1K53A 2H88B 2BTEA 2K5PA 1P7FA 1XLQA 5HI1A 4RF0A 4MT5A 2JQRB 1QT9A 2ACZB 2BS3B 1T3QA 3VR8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WSP A;  3PZ7 A;  3PZ8 A;  2D5G A;  4WIP A; 
#chains in the Genus database with same CATH topology
 5LNK 1;  2ZEQ A;  4FXC A;  3H9D A;  3NZS A;  1JWU D;  3DVN U;  3OWE B;  2PJH A;  3RUL A;  1EU3 A;  3NG0 A;  4ZHP A;  3OJ3 A;  1FMA D;  1FRR A;  5G2N A;  1C9F A;  1L0V B;  3TIX A;  1V49 A;  3Q8A A;  1AAR A;  1AN8 A;  3VH3 B;  1RRB A;  1UWM A;  1WXV A;  3R7R A;  1FNU A;  4LNK A;  3VAW A;  2RSU A;  3AV8 A;  1XLP A;  5H8Y E;  3VVW B;  4IOI E;  1YX5 B;  2CHX A;  1SXT A;  2HD5 B;  1CJE A;  2H89 B;  3NOB A;  4US8 A;  4LDT D;  1C79 A;  1YMH E;  1L0X B;  4C7Y A;  4EOY A;  2AEH A;  3BYT B;  2MBO A;  2J53 A;  4GDL A;  2L0T A;  3J9C A;  3N3K B;  3VRB B;  3PGE A;  2DHZ A;  1A70 A;  2M17 A;  2FE8 A;  3PO0 A;  1Q0W B;  2QSD A;  2M56 B;  1GB1 A;  5J17 A;  2WQY B;  1KFY B;  1HA5 A;  1SIJ A;  3HK0 A;  3ZUN A;  4EEW A;  4W9G A;  2SEB D;  3FIL A;  4YL8 A;  1PUT A;  3R2I A;  3RZF A;  2MX2 A;  4YWG G;  1N60 A;  4FJZ A;  2TSS A;  3C8Y A;  2X8X X;  3P2B A;  3R8B A;  4IWP A;  3VUW A;  1TTN A;  1ET9 A;  1TY0 A;  4HJG E;  1TS4 A;  2WHI A;  3V3X A;  2FID A;  4II2 B;  3IFW B;  4KDI C;  3DBS A;  1STE A;  1ZDV A;  3VR9 B;  4DWF A;  1VZ7 A;  4HWI B;  5EE3 A;  4TQ0 A;  4OZB A;  3ZJT A;  2IO0 B;  4K81 A;  2IO1 B;  2AYO B;  2KWC A;  2LWP A;  1JRO A;  2D2Q A;  3PRE A;  2CHZ A;  1V9J A;  4LNN A;  2KJR A;  4BAX A;  2ZW1 A;  2WXG A;  1OFF A;  3KVF B;  1NI3 A;  1FXA A;  1KLV A;  3U7D A;  4A3O A;  2KTR A;  2BKR B;  2BW2 A;  3PRP B;  2KHW B;  5AUK A;  3OJ4 B;  1I4H A;  2K6Q A;  2KN5 A;  1QOB A;  4RFB A;  4BKG A;  4YTM B;  4E74 A;  5D7G A;  1RAX A;  2DYM A;  2JZ3 B;  3GZN I;  4Q2J A;  5CX3 A;  1N5X A;  3AN1 A;  3MFG A;  5D6J B;  1LFD A;  2AX5 A;  3RNC C;  1F9J A;  1C77 A;  2L83 A;  2Y5P A;  5IP4 D;  3TJP A;  4C7Z A;  2LMC A;  4DXA B;  1JW9 D;  3A1Q B;  4WJP A;  1TYG B;  1FXT B;  4LNO A;  3AEB B;  2ZVO A;  1JWM D;  1YQB A;  2KTF A;  1QZE A;  2Z59 B;  1HXY D;  2BS2 B;  3Q3O C;  1XD3 B;  2M4N A;  1J7C A;  3QK0 A;  1FRD A;  1KF6 B;  2MH7 A;  4FHJ A;  1VJK A;  4I6P A;  3W9C B;  4KX6 B;  1J0G A;  1ZPS A;  3PLU A;  3B08 A;  1U4A A;  1XLN A;  1WGY A;  4K7U A;  3DHI C;  3CMM B;  1OQY A;  2PKO A;  2AWT A;  2N9P C;  5CHF A;  5G55 A;  4GU2 A;  1WM2 A;  1XO3 A;  4C56 C;  3AEG B;  4MEL A;  4RGN A;  2NVU I;  2MBB B;  2R61 A;  4XZ4 A;  2QEJ C;  3H6N A;  4WWP A;  3IAS 1;  3Q3J A;  2JYT A;  4JL9 A;  2J42 A;  1YN3 A;  3ONS A;  1Y56 A;  2JX5 A;  3RI7 C;  2JVC A;  5IA7 A;  1QIL A;  2KWV B;  1UEL A;  2K8C A;  1V2Y A;  4K1R B;  1D5X C;  3P1M A;  2ZPY A;  5TSS A;  2GMI C;  1FM0 D;  2WXN A;  4OZC A;  3SEB A;  4N9F 4;  3U52 E;  4EZL A;  4LCD E;  4GDK B;  2G4D B;  3MC9 A;  3MJ5 A;  1A5R A;  2WXF A;  1WE7 A;  1BT0 A;  5DCN A;  2KWD A;  2XK5 B;  1CK1 A;  2IPK D;  4N6E B;  1UUP A;  2Y5C A;  2L76 A;  2BYF A;  2C5L C;  1YQ3 B;  4C4V A;  3I57 A;  4HK2 A;  2INP E;  1E6E B;  1I7H A;  5GXG B;  1QLB B;  4WWN A;  4O1N A;  3N32 A;  3GOE A;  3PV1 A;  4MGK E;  4YSZ B;  2V9H A;  3AE5 B;  3R3M A;  3QWZ B;  3V6E B;  2WP9 B;  3R2T A;  4EUT A;  3D32 A;  4IKG A;  2INN E;  4KZ0 A;  4ICV A;  5DPW A;  2JWU A;  3A9J B;  3ML9 A;  3URY A;  2CU1 A;  2NBV B;  2BB5 A;  4LNF A;  3C19 A;  3W1Y A;  4B9K A;  2XNA C;  5CHW A;  4NNJ B;  2WDR B;  3WAO A;  2LGY A;  1WX8 A;  2V4I B;  1AWD A;  2KZR A;  3Q3N C;  1UGJ A;  1EO6 A;  3IT4 B;  5EE0 A;  3N20 C;  2KQ7 A;  4OHJ A;  3EC8 A;  3W2D A;  4WUR A;  1Q10 A;  4HPM B;  4IM2 A;  1WJ6 A;  2R2Q A;  1YQ4 B;  4RH6 A;  3K9O B;  3ZVV A;  1HEZ E;  1WR6 E;  4G0N B;  2WU2 B;  4CHK A;  2YLM A;  3DDC B;  4W9D A;  1C4P A;  3ZGZ A;  4PYZ A;  2JZP A;  1GNU A;  2EMS A;  1F1H A;  1ZOY B;  1L6V A;  4JLC A;  2BF8 B;  4KKJ A;  4ANV A;  1I4G A;  3NVW A;  4JQW C;  4IW0 A;  1ESF A;  3AE2 B;  3ZTD A;  4YTP B;  1M4V A;  1JWB D;  1PGA A;  3UQA A;  2DZI A;  1XQQ A;  4MJS A;  1E0Z A;  3N9Y C;  5IO9 A;  1L2N A;  1CQV A;  4BVU C;  4E3C A;  2FCQ A;  4ZDV A;  5KHO A;  1L4D B;  2ASQ A;  3DBR B;  3I5J C;  3RZW C;  2N9K A;  4US9 A;  2WGS A;  5JXV A;  2KDF B;  2J0J A;  2PVO D;  4YSY B;  2K9X A;  4WWM A;  1XLO A;  3W1S C;  1K53 A;  3N1Z C;  3DHG C;  3QAQ A;  1KM7 A;  1P7F A;  1XLQ A;  1WY8 A;  4GN1 A;  1OEY A;  3H7P B;  3SHQ A;  2KT7 A;  2BS3 B;  1T3Q A;  3MTN B;  3AE8 B;  4HEA 1;  1DOY A;  1V5O A;  2AL3 A;  3P4S B;  2Z0E B;  2KAJ A;  2Y5B B;  3PRZ A;  3GE8 C;  3QJZ A;  1JQ4 A;  4BKT A;  1WI0 A;  2QJL A;  1RFK A;  3E9S A;  2RDH A;  2LUM A;  2KOX A;  4AJW A;  2YEP B;  3DBR I;  2DBY A;  2MWS B;  2CHW A;  4A9A A;  4JGH B;  4FN2 A;  1L6U A;  3AEA B;  5EE9 A;  4A6Q A;  4TQ1 A;  2LXC A;  5E6O A;  1C3T A;  2XEW A;  2BYT A;  2FCN A;  5AEK B;  3NHE B;  5J2R A;  2ZNV C;  1IYF A;  1EM7 A;  4HKZ E;  4D2K A;  1V97 A;  2BVC A;  2WNM A;  3LJ3 A;  2PW9 A;  4MH8 A;  1BXT A;  5FR3 A;  1T5X D;  4NY0 A;  3SU8 X;  3LXF A;  2CU3 A;  4IUM B;  1GOZ A;  4P16 A;  4TKN A;  5D3I B;  3CIR B;  1ENF A;  2ZNV B;  4ICU A;  2I1K A;  2R2O A;  3L54 A;  4YXD B;  2CS4 A;  4KGS A;  3PZD A;  1WMH B;  1E7P B;  1HE8 A;  4FAD A;  2Y3A A;  2BKF A;  1K8R B;  4NAW A;  4M0W B;  4JIO U;  2EEL A;  4LTU A;  1C78 A;  1WRD B;  3QHT A;  1LM8 B;  4DBG A;  1ZP0 B;  2MBE A;  3DQV A;  2PTL A;  3KWL A;  2KK8 A;  1KOT A;  1J7A A;  2WX1 A;  3PTF C;  4RF1 A;  1UF0 A;  1V86 A;  4M01 A;  1KTK A;  3ALB A;  4DHZ B;  3PRM B;  4HDQ A;  2N7E A;  3AEF B;  3KUD B;  3O65 B;  3TMP B;  2LHD A;  5H92 C;  5BYR A;  4W9C A;  2ON8 A;  2RPQ A;  3BVG A;  3SFE B;  3SDL C;  4DDG D;  2NMQ A;  2EKE C;  3TSS A;  4HLE A;  2IGD A;  1OQQ A;  3BK1 A;  2KDB A;  2LRU A;  3IVF A;  2KN4 A;  3IG3 A;  1FCL A;  4XWT A;  2D07 B;  4M00 A;  3NS8 A;  1FNW A;  1EF1 A;  3DBL B;  4ZRQ A;  1HZ5 A;  2W3S A;  4BBN F;  3BII D;  1L5P A;  1V80 A;  1GUA B;  1XF5 L;  2FCS A;  2WXQ A;  1SJH D;  2C7M B;  2MP2 A;  3DPD A;  5C3J B;  2AQ3 B;  3EHV A;  4ZRJ A;  1PFD A;  5T8I A;  4B95 A;  2IGG A;  2DAF A;  4KGT A;  5DPT A;  2WWZ A;  1TIF A;  2WXH A;  4GB9 A;  2VRR B;  3NVV A;  1IUE A;  1J7B A;  1PQS A;  4ARC A;  2GLS A;  1ISN A;  5L95 C;  4AWJ A;  2KFJ A;  3EUB 2;  3IXS A;  1VZ8 A;  3M62 B;  1LGR A;  1F52 A;  3ZNH B;  3B2G A;  3U30 A;  2IND C;  1D5Z C;  2QDF A;  2K1F A;  3PS6 A;  2J0K A;  1TKY A;  4M8N A;  4OVU A;  4UDU C;  1GC6 A;  3EGR A;  1V6E A;  1PGB A;  5IN7 A;  3ZNG C;  3VQI A;  1MG4 A;  2B76 B;  3L13 A;  4MJS B;  2D5G A;  1PDX A;  4M02 A;  2IO3 B;  4KZC A;  4DXG A;  1IPG A;  1WMH A;  3ZKJ C;  1XCT L;  1Z5S B;  4RGO S;  1GPX A;  1ZGU B;  4GXB A;  1WYW B;  3ZRC A;  2BPS A;  5FKA C;  4ZRK A;  1PGX A;  2NPT B;  3TCA A;  3TEZ A;  5AZF A;  3BZD B;  1C4C A;  2XK5 A;  3LDZ E;  3N1X C;  4A20 A;  2UYZ B;  4A90 A;  2JF5 A;  3DHH C;  4WQO B;  4ANW A;  3BVM A;  2EKI A;  1BML C;  5BMG A;  4WJO A;  4P1C C;  3VH4 B;  4KV2 A;  2MEK A;  3Q8C A;  2JRI B;  2N7J A;  3P4R B;  4HVB A;  4J3O D;  2BBC A;  2FNJ B;  1MFW A;  2OHF A;  2Q5W D;  4EZJ A;  5DPR A;  3ZXR A;  2JXT A;  1I42 A;  4RNA A;  3LB8 C;  1R4N B;  1P3Q U;  2JZZ A;  1I4P A;  2M0A A;  2I1J A;  2PLP A;  3AM9 A;  4GDK A;  1UH6 A;  3T3O A;  2NTT A;  1UNS A;  3BY4 B;  2WDV B;  2K8B A;  2W9N A;  4M0W A;  3S2A A;  3PVL A;  1ACC A;  5E6P A;  4GOC A;  3VTU A;  1UBI A;  2WXI A;  3MJW A;  4AS1 A;  3QX1 A;  3HVZ A;  1R4N I;  3Q3F A;  3PLV A;  3NZU A;  2IO2 B;  2GI9 A;  1FCC C;  4HPP A;  5G5H A;  3WAP A;  3R66 C;  3MC8 A;  2GBM A;  3ECI A;  1WR1 A;  1WZ3 A;  1C1Y B;  4X57 B;  2WXK A;  3KUC B;  1NI2 A;  1WGG A;  2PMV A;  4H2A A;  1C76 A;  5IAA C;  4NJC A;  5C23 A;  4XYC A;  2KDM A;  3K9P B;  2DLB A;  4B0E A;  3JVZ X;  4OVZ A;  3AEC B;  2KX0 A;  3OLM D;  5BMI A;  1LQB A;  5BO4 B;  4RM9 A;  4K3B A;  4KIK A;  1XT9 B;  3AU4 A;  3NZ3 A;  2QMT A;  1L7Y A;  4W9L A;  1WXA A;  3BVZ A;  1K52 A;  2A4Z A;  2V0G A;  2K0P A;  3N1Y C;  1GB4 A;  1TBE A;  2HJ8 A;  1K51 A;  3TL5 A;  1J19 A;  3NVZ A;  2N1V A;  2C7N B;  4XDC A;  2HE7 A;  4HDO A;  3IT6 B;  1K50 A;  1NDD A;  2PE9 A;  2NPT A;  1S1Q B;  1WXS A;  3APF A;  3E56 A;  3TEX A;  2LGI A;  2JUO A;  3GZN B;  2L32 A;  4BBN C;  3PSE B;  4TV3 A;  1BUI C;  5MPO A;  2QIL A;  4OZA A;  1WGR A;  1ZUD 2;  1QQR A;  5LXH A;  4WAF A;  1RLF A;  1CMX B;  1KLU D;  3DBH I;  3Q14 C;  2LHE A;  2V3N A;  1B1Z A;  1N5W A;  1C4A A;  3RPF C;  3DWM A;  3TUO A;  4GLS C;  3EA6 A;  4XDD A;  5HHD G;  1D3Z A;  1TS2 A;  1WFY A;  1ZE3 D;  4RMA A;  2KAN A;  1TY2 A;  3AE3 B;  4NPN A;  2KWU B;  4J6I A;  2V4L A;  4C4V B;  4I6N B;  3RNB C;  3DBL I;  2L0F A;  3QCA A;  5E6N A;  4MM3 B;  4ITK A;  4W9E A;  3VFK A;  3ZXV A;  2LGX A;  2DAJ A;  2ZVN A;  1MPE A;  5AZH A;  2OJR A;  3VTW A;  3QIJ A;  4MDK E;  1D4B A;  3A9K A;  1MJD A;  4IWQ A;  3AMZ A;  4C80 A;  1VDV A;  3DVG X;  1R4M I;  4RGM A;  1SSN A;  2MCN B;  3VUY A;  2W3R A;  4BKS D;  1E8W A;  1WX9 A;  2WU5 B;  4IG7 B;  3RNA C;  2BYV E;  3QQ8 B;  3CSF A;  3RD2 A;  2DZJ A;  3I3T B;  4RF0 A;  4NQK E;  2JQR B;  4GGQ A;  1QT9 A;  2ACZ B;  1P98 A;  2LUE A;  4EFO A;  1KRH A;  3B1L X;  1WZ0 A;  2WX0 A;  1ET6 A;  1AW7 A;  2K22 A;  4JWS C;  2KDI A;  1F2R C;  2JPH A;  2FAZ A;  1R7S A;  1YJ1 A;  2G45 B;  1D6E C;  3AEE B;  3PHX B;  3QAR A;  1OEY J;  4CO7 A;  3WAN A;  3ZDT A;  2KNB A;  1V8C A;  5D3D A;  4EZK A;  2O2V B;  1ROE A;  2CJN A;  2ZJD A;  3A9J A;  1YIW A;  1HTQ A;  4JX1 C;  1RYJ A;  2JRH A;  1L4Z B;  4HRO A;  3IBE A;  3H1U A;  2L05 A;  4N59 A;  3A4S C;  4CQN A;  4KKI A;  3QC8 B;  2MSE D;  4W9H A;  2LXA A;  4M8M A;  2PPH A;  4MGZ E;  4YT0 B;  2K3U A;  2W54 A;  3HVD A;  3DOW A;  3GP7 A;  5GMV A;  3MP9 A;  1WYG A;  2A5U A;  4FUL A;  2MBQ A;  1MHX A;  1TGZ B;  4MGY E;  1E9M A;  3SFD B;  2ZCB A;  4QAY A;  3CF6 E;  4OW0 A;  1SGH A;  3NVY A;  1QKZ A;  2RR9 A;  2KTR B;  2VZK B;  4HRS A;  2Z8L A;  3PT2 B;  3DCG A;  2C9W B;  5C1Z A;  3HIZ A;  5KHQ A;  5DPS A;  1SEB D;  4DQO C;  4MGI E;  3HM3 A;  5BYS A;  3ZJV A;  3ZW3 A;  1XEE A;  1IGD A;  2VH2 A;  1T0Y A;  1VCB A;  2N1W A;  3UIN B;  3V05 A;  1MVK A;  3M3J A;  2L7R A;  3ENE A;  2C60 A;  1HZ6 A;  1OTR B;  4BKS A;  1EU4 A;  2QIE B;  3PZ7 A;  1PYW D;  1J8C A;  2BB6 A;  4USA A;  1VRA B;  1WSP A;  2KMC A;  4E71 A;  4KIK B;  2IY1 B;  4HXD A;  5AUI A;  3IHP C;  2UWQ A;  4MAC A;  1SE4 A;  1SE9 A;  4F7Z A;  2AQ1 B;  3X23 A;  3T9L A;  2GBR A;  3V6C B;  1QOA A;  3ZIM A;  3EFC A;  1UBQ A;  3Q8E A;  4DHJ B;  1DGJ A;  3ZNZ B;  3ZNI D;  1IBX A;  4MSM B;  4AJY B;  1EWC A;  4IM0 A;  2EMT A;  4K7W A;  1F77 A;  1WGD A;  2OED A;  5CTR C;  2D10 A;  3TEW A;  2SAK A;  3SR6 A;  3EFU A;  3LYY A;  2FIF A;  2X38 A;  2DWQ A;  4ACF A;  5JHA A;  2DZM A;  4C00 A;  3HHM A;  4P7I A;  3L4P A;  1P0R A;  1Y8R C;  3AB5 A;  1B9R A;  2BWE S;  2KQ4 X;  5E6J A;  4W9J A;  4ARI A;  5BMH A;  1WGH A;  1X1M A;  1DOX A;  2L3Z A;  4TMA B;  3GS2 A;  3UIO B;  1VR9 A;  4L2Y A;  2WLB A;  1P1A A;  2M0X A;  3L17 A;  4G3X B;  5FK9 C;  3H7S A;  2IDY A;  4KVG B;  2KD0 A;  4NAW B;  4ANU A;  1JRP A;  4AOF A;  4L23 A;  5D94 A;  2KLC A;  4MH0 E;  2GBJ A;  3GE3 C;  3JSV B;  2HTH A;  2G1E A;  3RNF C;  3WA0 A;  3U4E G;  3V61 A;  2KJH B;  4WWO A;  1IP9 A;  3HUI A;  4BZA A;  1TZ1 A;  2FBW B;  2MJ3 A;  5EE1 A;  5BYQ A;  4P6V F;  3VTV A;  1TS5 A;  5JHB A;  4AP4 C;  2WDQ B;  4A3P A;  3L0W B;  2M19 A;  4W9K A;  3W1S A;  4EKU A;  2NBW B;  3L16 A;  3L08 A;  4PS7 A;  2MQJ A;  3OAW A;  2B3A A;  3AI5 A;  2LFI A;  3GB1 A;  4LNI A;  1FIQ A;  2FCM A;  1MG8 A;  3O13 A;  5FR6 A;  1GJZ A;  1Q1O A;  2JU6 X;  2I2Y A;  3V62 A;  1DOI A;  3RCZ A;  2IJ0 A;  3BYY B;  1FD6 A;  2KYW A;  2NR2 A;  2ZCC A;  5IOI A;  5HKH A;  4S0R A;  1V1P B;  4AQ7 A;  1UGM A;  3UQB A;  3DBH B;  4I6L B;  3RMK C;  1YJJ A;  1QF6 A;  1WF9 A;  3AE9 B;  3RFZ B;  2LD9 A;  4DHJ D;  1EUV B;  3A33 B;  2KFK B;  1IBX B;  2RPV A;  2JWZ A;  4URK A;  2BWF A;  2N4F A;  4NJ7 A;  1YD8 U;  1Z2M A;  1YJI A;  2GOW A;  3CWI A;  2KO3 A;  4TSS A;  3VHT C;  2NBU A;  1SE2 A;  2PIA A;  1D5M C;  1E90 A;  3KH0 A;  4ZYN A;  4HCP B;  3WCQ A;  4S17 A;  2CR5 A;  4KSL C;  3ZRF A;  2O6V A;  3WAL A;  3CST A;  1VLB A;  2WXL A;  2QCZ A;  4RCO A;  1E8Z A;  2DEN B;  1ZXH A;  2N0S B;  2MJD A;  2V1Y A;  3HM6 X;  1YNT E;  2GRI A;  4MM3 A;  4ZHO A;  5HG2 A;  1E8Y A;  2KQS A;  2PEA A;  2JT4 B;  3HRD D;  2RDB C;  4FHK A;  3A1Q A;  4ZYS A;  1E5W A;  3QA8 A;  4DHZ E;  2WXJ A;  2NTS A;  2O6V B;  3PZ8 A;  4REZ A;  2FUG 1;  1WXQ A;  3AH7 A;  2G4S A;  4N58 A;  4KDL B;  4NAM A;  2KVR A;  1YN4 A;  2WXR A;  4XE0 A;  2REX A;  1KJT A;  1L0Y B;  1SBB B;  1WM3 A;  3UIP B;  1GG3 A;  4KSK C;  4IWO A;  3KUZ A;  3U8Z A;  2O6V D;  3JYU A;  3APC A;  3VRA B;  2KDE B;  2L52 A;  5G5G A;  2KFK A;  1RM6 C;  2KJ6 A;  4F1S A;  3BK2 A;  2YEP F;  3W5U B;  2J0M A;  3P63 A;  4WJQ A;  2W82 A;  2JYE A;  3OG5 A;  2NCN A;  4NZL B;  4WAA A;  4ASW C;  3FIL B;  4XGA B;  3AE1 B;  3A9K B;  1ZDX A;  2KC1 A;  3AED B;  4HJK A;  3KWV A;  2JSV X;  3NRZ A;  2MHJ A;  3BWU D;  2YVC A;  1T0R C;  2D3C A;  1FFV A;  1HTO A;  1NYQ A;  4FJV B;  4HCN B;  2QHO A;  3APD A;  2IZV B;  4ANX A;  2KXJ A;  1YN5 A;  2LEK A;  2V3S A;  1R4M B;  1S3S G;  2GBN A;  1VZ6 A;  2D3A A;  2J7Q B;  3IAM 1;  3KLS X;  4BFR A;  5LLI A;  2L00 B;  3ZJU A;  2ICI A;  2J4X A;  3RUI B;  2H88 B;  3KW5 B;  1GC7 A;  2K5P A;  2INC C;  5HI1 A;  3H7P A;  4P1B C;  2DZK A;  1NBF C;  2FUH B;  4IM3 A;  3VR8 B;  3R7Q A;  2ONQ A;  4DK5 A;  2O2V A;  2RD0 A;  3VUX A;  1JCK B;  1E8X A;  1FFU A;  1I4Q A;  3RNG C;  3P4P B;  3KQ4 A;  4TUU A;  3MHS D;  4K3C A;  4YTN B;  1WGK A;  3Q8B A;  2G3Q B;  1RFA A;  1V1O A;  1VD2 A;  3NJT A;  2AL6 A;  3AE4 B;  4GIV A;  4DXF A;  1E7V A;  1FEH A;  2LVQ A;  3ABV B;  1GAQ B;  1RWS A;  3VDZ A;  3M63 B;  4PK1 A;  2VH1 A;  1FXI A;  2IBI B;  5C2T B;  5IKC M;  2M1M A;  2LI5 A;  4PS3 A;  4W9I A;  3NUH B;  1P7E A;  4XX5 A;  4GSW A;  1ZW7 A;  3L10 B;  5HFY A;  5LXI B;  1WH3 A;  2CKH B;  3T8M A;  4LK0 M;  2GBK A;  2K25 A;  3I9V 1;  1FNV A;  2D11 A;  2MW5 A;  3WIM A;  2MP2 B;  2XBB C;  1IGC A;  3M95 A;  4PT5 A;  3UI3 A;  1G6J A;  3Q6B A;  2D3B A;  4ZRI A;  4B0M A;  1M94 A;  2KMM A;  1F2R I;  1JRU A;  1CZP A;  3NY5 A;  2XN9 C;  4A55 A;  3UF8 A;  1V81 A;  3B2F A;  1TKG A;  2W55 A;  3X0W A;  1E10 A;  1JWA D;  3Q8F A;  1MI0 A;  2V3P A;  4R3D A;  3ZO5 B;  2DYO A;  2LZ6 A;  4EE2 A;  4OVV A;  1OGW A;  3P4Q B;  3NS1 A;  2Z0D B;  2GB1 A;  2LVP A;  2MLB A;  1ZXI A;  5I4D A;  1XCQ L;  1TJE A;  1WWT A;  4KGR A;  4XC2 A;  5JZE B;  4GDL B;  1N62 A;  3DVG Y;  1JAL A;  4DDI D;  2LJ5 A;  4WQM A;  1WIA A;  3ML8 A;  4L1B A;  3MHZ A;  3RNE C;  2LVO A;  4FJY A;  2WXM A;  4LLG M;  1SIF A;  4MSQ B;  2DNF A;  2ZPN A;  3PHW B;  2BYE A;  1MHH E;  1V5T A;  3FC4 A;  2MRP A;  3KYD D;  1WXM A;  4IC7 B;  4WIP A;  1KLG D;  1I4R A;  4F8C B;  2N7D A;  4BOZ B;  3ZYY X;  3AE6 B;  4JE3 B;  1NVI D;  3JSV A;  1WJN A;  3AXC A;  3UGB B;  4FA6 A;  2C7H A;  1E7U A;  1YOV B;  2IYD B;  3A4R A;  5J18 A;  3B9J A;  1SB3 C;  4NQL B;  2KAC A;  1WE6 A;  2K39 A;  2LJI A;  3DVN V;  1ZKH A;  2J52 A;  3AU5 A;  1FO4 A;  4G11 A;  2L1A A;  4WH4 A;  2WS3 B;  4A8X C;  2CJO A;  3P42 A;  1N63 A;  2BGF A;  4FBJ B;  2OOB B;  2WXO A;  2OJW A;  3WAM A;  3FAH A;  2KVZ A;  2IY0 B;  3ETR A;  2E6X A;  2WXP A;  4HKQ A;  2KMA A;  1TZO A;  4RGT A;  3RT3 B;  3N30 A;  4IDI A;  5EDS A;  4MEM A;  1T0Q C;  3ZQ4 A;  1QOF A;  2M8S A;  2BT6 A;  2DX5 B;  1I35 A;  2K6D B;  5L83 A;  4II3 B;  1T0S C;  2RMM A;  1SJE D;  1LO5 D;  2D3G A;  4PS8 A;  5AZG A;  2VZK D;  4CYE A;  2LAS A;  2LGD A;  1I4X A;  1V1P A;  1F0Z A;  1QOG A;  2MA9 B;  2LRW A;  2WYQ A;  4ZRP A;  3U7Z A;  2KC2 A;  2HDE A;  4NJ6 A;  5JH5 C;  3ZDM C;  3TEY A;  1SE3 A;  4XWW A;  3Q69 A;  4ZOH C;  2I38 A;  4GMV A;  2JXX A;  3TBL D;  1DYQ A;  2RGF A;  2MJE A;  4LDT B;  2K8H A;  3RYT A;  2HTM E;  2KLG A;  3FKY A;  3BIN A;  1JML A;  2PE6 B;  1EWY C;  2AQ2 B;  2E3T A;  1KH0 A;  3PPA A;  1T6B X;  3AE7 B;  4RM8 A;  1WJ4 A;  1YX6 B;  4JWU C;  1NYR A;  5CHV C;  1WRI A;  4FLH A;  2UU7 A;  2DYB A;  5TR5 A;  3T3N A;  4BOS C;  3V60 A;  2RDG A;  2PVG C;  4HPL B;  3RN9 C;  2G9H D;  2WDT B;  1JWS D;  1SF0 A;  3W5V B;  2KKC A;  2IGH A;  4PYU A;  4LJP B;  2JY6 A;  1EF5 A;  1NEK B;  1WJU A;  1UWX A;  3B0A A;  1FPY A;  1H4R A;  3U2S C;  2BQQ A;  2N9X A;  4G50 A;  3SD5 A;  3Q2A C;  4JPS A;  4YSX B;  1TKE A;  1UD7 A;  3AUL A;  1OQR A;  2N9L A;  1NEN B;  3Q3M C;  1LXD A;  4W9F A;  3I63 C;  4K7S A;  2QC8 A;  1HQR D;  4LJO B;  2ZZP B;  2NS5 A;  3ZLZ A;  1N6Z A;  1XXG A;  1H8C A;  2LGS A;  1WX7 A;  3ZTC A;  2MBH A;  3EEC A;  3MC0 B;  3KYC D;  5D2M B;  1Q5W B;  2L8J A;  1TS3 A;  3DWG C;  3JW0 X;  3H8H A;  4WJN A;  2BS4 B;  2ZW0 A;  1N61 A;  1AYF A;  1TT5 B;  3C0R B;  2BTE A;  1UZX B;  2KX3 A;  2HJ1 A;  4MT5 A;  4AUQ C;  1P9D U;  3VXW A;  4B6W A;  2N9E B; 
#chains in the Genus database with same CATH homology
 3AE8 B;  4HEA 1;  5LNK 1;  2ONQ A;  1DOY A;  1KRH A;  4FXC A;  3P4S B;  1JWU D;  1JCK B;  1FFU A;  2KAJ A;  1I4Q A;  3OWE B;  1EU3 A;  1JQ4 A;  1ET6 A;  1AW7 A;  2K22 A;  4JWS C;  2QJL A;  1RFK A;  3E9S A;  2RDH A;  2LUM A;  1F2R C;  4ZHP A;  2YEP B;  3P4P B;  3KQ4 A;  2DBY A;  1FMA D;  1FRR A;  1R7S A;  1C9F A;  1L0V B;  3Q8A A;  4A9A A;  1AN8 A;  1UWM A;  1D6E C;  1L6U A;  3AEE B;  3AEA B;  5EE9 A;  4A6Q A;  4TQ1 A;  4YTN B;  1FNU A;  1WGK A;  3Q8B A;  2BYT A;  1V8C A;  5D3D A;  3AV8 A;  1V1O A;  1XLP A;  5H8Y E;  1ROE A;  3AE4 B;  4IOI E;  4DXF A;  2CJN A;  1SXT A;  1EM7 A;  1FEH A;  4HKZ E;  4D2K A;  1CJE A;  1V97 A;  2WNM A;  3ABV B;  4JX1 C;  2H89 B;  2PW9 A;  4MH8 A;  1GAQ B;  1RYJ A;  1RWS A;  4US8 A;  1BXT A;  5FR3 A;  1L4Z B;  1T5X D;  4HRO A;  1FXI A;  3LXF A;  1C79 A;  1YMH E;  2CU3 A;  4N59 A;  1GOZ A;  4P16 A;  1L0X B;  5D3I B;  5C2T B;  3CIR B;  1ENF A;  4C7Y A;  4CQN A;  3BYT B;  4KKI A;  2J53 A;  3J9C A;  3VRB B;  4YXD B;  4YT0 B;  2K3U A;  2W54 A;  4KGS A;  3HVD A;  1E7P B;  3GP7 A;  1A70 A;  2Y3A A;  3NUH B;  2FE8 A;  3MP9 A;  3PO0 A;  1P7E A;  2QSD A;  1WYG A;  2M56 B;  1GB1 A;  5HFY A;  1MHX A;  2EEL A;  1KFY B;  1E9M A;  2WQY B;  1HA5 A;  1SIJ A;  3SFD B;  4LTU A;  1C78 A;  4OW0 A;  2SEB D;  4LK0 M;  3NVY A;  1ZP0 B;  3FIL A;  1QKZ A;  2PTL A;  3I9V 1;  3KWL A;  1FNV A;  1PUT A;  3R2I A;  1J7A A;  2VZK B;  4HRS A;  1IGC A;  2Z8L A;  4PT5 A;  1N60 A;  4YWG G;  2TSS A;  3C8Y A;  3R8B A;  3UI3 A;  4RF1 A;  1ET9 A;  1TY0 A;  1KTK A;  1TS4 A;  4HJG E;  1SEB D;  4DQO C;  3V3X A;  5BYS A;  4B0M A;  3ZJV A;  1XEE A;  2KMM A;  3AEF B;  1F2R I;  1STE A;  1IGD A;  1ZDV A;  2LHD A;  5H92 C;  1VZ7 A;  5BYR A;  3VR9 B;  1CZP A;  2ON8 A;  2XN9 C;  4A55 A;  5EE3 A;  4TQ0 A;  3BVG A;  4OZB A;  3SFE B;  3V05 A;  2NMQ A;  1MVK A;  1TKG A;  3B2F A;  3ZJT A;  2W55 A;  3TSS A;  1JWA D;  1E10 A;  1HZ6 A;  3Q8F A;  2IGD A;  1MI0 A;  1OQQ A;  3BK1 A;  1EU4 A;  2QIE B;  2V3P A;  1PYW D;  3PZ7 A;  4R3D A;  2BB6 A;  4USA A;  2DYO A;  1VRA B;  1JRO A;  4EE2 A;  1WSP A;  2KN4 A;  1FCL A;  3P4Q B;  4XWT A;  5AUI A;  2ZW1 A;  1FNW A;  2WXG A;  3NS1 A;  2GB1 A;  1OFF A;  4MAC A;  4ZRQ A;  1ZXI A;  1HZ5 A;  2W3S A;  5I4D A;  1NI3 A;  1FXA A;  1XCQ L;  1SE4 A;  3BII D;  1TJE A;  1WWT A;  1L5P A;  2AQ1 B;  2BW2 A;  4KGR A;  1XF5 L;  2WXQ A;  1SJH D;  4GDL B;  1QOA A;  5C3J B;  5AUK A;  2AQ3 B;  1N62 A;  1I4H A;  1JAL A;  1PFD A;  4WQM A;  5T8I A;  4L1B A;  3Q8E A;  2IGG A;  1DGJ A;  4KGT A;  1QOB A;  3MHZ A;  1IBX A;  4RFB A;  4YTM B;  1EWC A;  5D7G A;  2WXH A;  1F77 A;  2OED A;  2DYM A;  2WXM A;  4LLG M;  4Q2J A;  3TEW A;  2SAK A;  3SR6 A;  3NVV A;  1IUE A;  1J7B A;  1N5X A;  4ARC A;  3LYY A;  2X38 A;  3AN1 A;  1MHH E;  2DWQ A;  3MFG A;  3FC4 A;  2AX5 A;  1C77 A;  2L83 A;  2Y5P A;  4WIP A;  1KLG D;  3EUB 2;  3IXS A;  1VZ8 A;  1I4R A;  4C7Z A;  2LMC A;  1JW9 D;  3L4P A;  1TYG B;  3B2G A;  3AB5 A;  3AEB B;  3ZYY X;  1B9R A;  3AE6 B;  1D5Z C;  1JWM D;  4JE3 B;  1NVI D;  2KQ4 X;  5E6J A;  1TKY A;  4UDU C;  4ARI A;  3EGR A;  1HXY D;  1PGB A;  2BS2 B;  5BMH A;  1DOX A;  3VQI A;  1J7C A;  2B76 B;  4TMA B;  3GS2 A;  1FRD A;  1KF6 B;  1VR9 A;  4L2Y A;  2WLB A;  2MH7 A;  5FK9 C;  2D5G A;  1PDX A;  3B9J A;  1SB3 C;  4DXG A;  1VJK A;  3W9C B;  2IDY A;  2KAC A;  4KX6 B;  1XCT L;  4RGO S;  1ZPS A;  4NAW B;  1JRP A;  2LJI A;  1XLN A;  2J52 A;  4L23 A;  1GPX A;  1FO4 A;  2L1A A;  4WH4 A;  2PKO A;  2WS3 B;  2G1E A;  4A8X C;  5FKA C;  3U4E G;  2CJO A;  1PGX A;  3TEZ A;  3P42 A;  1N63 A;  1XO3 A;  3BZD B;  4C56 C;  1C4C A;  3AEG B;  4RGN A;  4A90 A;  2R61 A;  2WXO A;  2QEJ C;  3HUI A;  2FBW B;  2MJ3 A;  3FAH A;  3IAS 1;  5EE1 A;  5BYQ A;  4P6V F;  3ETR A;  1TS5 A;  2E6X A;  2JYT A;  2WXP A;  2J42 A;  3BVM A;  2EKI A;  4HKQ A;  2WDQ B;  1BML C;  1YN3 A;  5BMG A;  1Y56 A;  2JX5 A;  2M19 A;  1TZO A;  4RGT A;  2MEK A;  3W1S A;  3Q8C A;  2N7J A;  3P4R B;  1QIL A;  2BBC A;  4J3O D;  4IDI A;  2OHF A;  2Q5W D;  2LFI A;  3GB1 A;  3ZQ4 A;  1FIQ A;  2JXT A;  1QOF A;  4RNA A;  2BT6 A;  1D5X C;  3LB8 C;  3P1M A;  5TSS A;  3O13 A;  2JU6 X;  1FM0 D;  2WXN A;  4OZC A;  3SEB A;  2M0A A;  1I4P A;  2I2Y A;  3U52 E;  2RMM A;  1DOI A;  2PLP A;  3AM9 A;  3T3O A;  2IJ0 A;  4GDK B;  3BYY B;  1SJE D;  2NTT A;  1UNS A;  1LO5 D;  1FD6 A;  2WDV B;  3MJ5 A;  2VZK D;  4M0W A;  1ACC A;  1I4X A;  1V1P A;  2WXF A;  1V1P B;  1F0Z A;  1QOG A;  2KWD A;  4AQ7 A;  2WXI A;  1CK1 A;  2IPK D;  4ZRP A;  3U7Z A;  4AS1 A;  4N6E B;  2HDE A;  1YJJ A;  3HVZ A;  1UUP A;  2Y5C A;  1QF6 A;  3TEY A;  3AE9 B;  1SE3 A;  3RFZ B;  4XWW A;  3Q69 A;  1YQ3 B;  4ZOH C;  2GI9 A;  1FCC C;  3I57 A;  5G5H A;  1IBX B;  2I38 A;  2RPV A;  2INP E;  1E6E B;  1I7H A;  1DYQ A;  5GXG B;  2MJE A;  1YJI A;  1QLB B;  2WXK A;  3CWI A;  2PMV A;  4O1N A;  2HTM E;  4H2A A;  1C76 A;  4NJC A;  4TSS A;  2KDM A;  2DLB A;  4B0E A;  1SE2 A;  2PIA A;  4YSZ B;  1D5M C;  4OVZ A;  3AEC B;  1JML A;  3AE5 B;  3WCQ A;  5BMI A;  1EWY C;  2AQ2 B;  2E3T A;  1VLB A;  1KH0 A;  2WP9 B;  2WXL A;  3R2T A;  4RCO A;  1T6B X;  3NZ3 A;  4IKG A;  2INN E;  2QMT A;  1ZXH A;  2N0S B;  3AE7 B;  2JWU A;  3URY A;  3BVZ A;  2MJD A;  1K52 A;  2BB5 A;  1YNT E;  4JWU C;  1NYR A;  2GRI A;  4ZHO A;  2V0G A;  5HG2 A;  2K0P A;  1WRI A;  1GB4 A;  2XNA C;  3HRD D;  3T3N A;  2WDR B;  2V4I B;  4ZYS A;  2RDG A;  1K51 A;  2PVG C;  2WXJ A;  2NTS A;  2G9H D;  3PZ8 A;  4REZ A;  1AWD A;  1JWS D;  1SF0 A;  2FUG 1;  3NVZ A;  1UGJ A;  1WXQ A;  3W5V B;  3AH7 A;  3IT4 B;  2IGH A;  4XDC A;  5EE0 A;  4OHJ A;  4N58 A;  3W2D A;  3IT6 B;  1K50 A;  4WUR A;  1Q10 A;  4NAM A;  1YN4 A;  2WXR A;  4XE0 A;  1L0Y B;  1SBB B;  3E56 A;  1NEK B;  1UWX A;  3TEX A;  2LGI A;  1YQ4 B;  4RH6 A;  2L32 A;  1HEZ E;  3VRA B;  1BUI C;  5MPO A;  2QIL A;  2WU2 B;  2L52 A;  3U2S C;  4OZA A;  5G5G A;  1ZUD 2;  1C4P A;  1RM6 C;  3ZGZ A;  1QQR A;  2JZP A;  1ZOY B;  1L6V A;  4WAF A;  3BK2 A;  2YEP F;  4KKJ A;  3W5U B;  1I4G A;  3NVW A;  1KLU D;  3P63 A;  2LHE A;  1ESF A;  2W82 A;  2V3N A;  3AE2 B;  2JYE A;  1B1Z A;  4NZL B;  1N5W A;  1C4A A;  4JPS A;  3RPF C;  4YSX B;  3FIL B;  4YTP B;  1M4V A;  3DWM A;  1TKE A;  1JWB D;  1PGA A;  1OQR A;  3TUO A;  2N9L A;  4GLS C;  3AE1 B;  3EA6 A;  1ZDX A;  3AED B;  4XDD A;  5HHD G;  1NEN B;  1TS2 A;  1ZE3 D;  1TY2 A;  3AE3 B;  3KWV A;  1E0Z A;  2JSV X;  3NRZ A;  3BWU D;  1FFV A;  3N9Y C;  1NYQ A;  1HQR D;  1CQV A;  4MM3 B;  1YN5 A;  4ITK A;  2LEK A;  1L4D B;  1XXG A;  1MPE A;  2N9K A;  4US9 A;  1VZ6 A;  5JXV A;  1D4B A;  3MC0 B;  3AMZ A;  4C80 A;  1VDV A;  3KLS X;  3IAM 1;  4RGM A;  3ZJU A;  1SSN A;  2PVO D;  1TS3 A;  2ICI A;  3DWG C;  3H8H A;  4YSY B;  2BS4 B;  2K9X A;  2ZW0 A;  2J4X A;  4WWM A;  2W3R A;  1N61 A;  1XLO A;  1AYF A;  2WU5 B;  1K53 A;  2H88 B;  2BTE A;  2K5P A;  1P7F A;  1XLQ A;  5HI1 A;  4RF0 A;  4MT5 A;  2JQR B;  1QT9 A;  2ACZ B;  2BS3 B;  1T3Q A;  3VR8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...