3PZ7A

Crystal structure of ccd1-dix domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
86
structure length
86
Chain Sequence
PHMSSTCTKVLYFTDRSLTPFMVNIPKRLEEVTLKDFKAAIDREGNHRYHFKAMDPEFGTVKEEIFHDDDAIPGWEGKIVAWVEED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dixin
publication title Molecular basis of WNT Activation via the DIX-domain protein CCD1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 17
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00778 DIX DIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.380 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3pz7A00
3PZ7A 4WIPA 1WSPA 3PZ8A 2D5GA
chains in the Genus database with same CATH superfamily
2INCC 2JZZA 1C9FA 1WGHA 4XX5A 3EECA 3OJ4B 1N6ZA 3KUDB 4B0MA 1VZ8A 1QOGA 4GOCA 2NTTA 4W9DA 2ZW0A 4FJYA 2ZJDA 1I4QA 3APFA 4EZLA 5C23A 4FJZA 1IGDA 1UELA 3TEXA 4BKSA 5T8IA 1OQQA 4A6QA 1E8YA 3VAWA 2BKRB 4TUUA 1E8WA 3CMMB 3TEWA 4IM3A 1FEHA 2UU7A 4BOSC 2I1KA 2DENB 3ZVVA 3A1QB 3AE6B 1HZ5A 1WRIA 3AEGB 1EU4A 3H9DA 3L0WB 2L1AA 1ZDXA 1GJZA 1FCCC 4EEWA 1MI0A 1SBBB 1TY0A 2SEBD 2ZNVC 4KGRA 2NPTA 5AUIA 2JUOA 2FCNA 2OEDA 3BYTB 4L1BA 3VUXA 3CIRB 2IBIB 3BWUD 1QILA 3M3JA 4AJYB 3ECIA 3R7QA 4MGKE 3WAPA 4ZRPA 2ZPNA 1QLBB 2ICIA 3VXWA 3R66C 4YT0B 2D2QA 4MDKE 1M94A 3KQ4A 3PSEB 4W9EA 2FCQA 5L95C 3EA6A 2DWQA 1JRUA 1K52A 2D07B 5E6OA 4GDLA 1ET9A 3ZJUA 4FN2A 5AZGA 4Q2JA 4HJKA 3DBSA 4BZAA 4KVGB 4HPPA 1YJIA 2EMTA 2D10A 4BKTA 1AW7A 2W55A 4K3BA 2N9EB 1FMAD 3RT3B 3B9JA 3H1UA 4YL8A 3AEDB 4PS8A 2MX2A 1V5TA 3KUZA 4ASWC 2BGFA 3AB5A 3GE3C 4MGIE 4WJPA 2AWTA 1T5XD 3RCZA 2KFKA 2B3AA 2KVRA 2KMMA 2FCSA 1RYJA 1AYFA 1T0SC 2KTRA 2WX1A 2WXFA 2N7DA 1C79A 2IO0B 4IM0A 4YTNB 1FXTB 2V3SA 2LHEA 3NHEB 4ZHOA 3PT2B 2AL3A 3X23A 3V05A 3Q3OC 2GI9A 4WJQA 2OHFA 3JYUA 1ZGUB 4B95A 1R7SA 3ZW3A 3IT6B 3VVWB 4HVBA 3BIID 5MPOA 4A8XC 1HZ6A 2KQ7A 2K39A 4HKZE 2JYTA 4L2YA 3NVZA 2JRHA 3AI5A 3RUIB 1TYGB 1IUEA 3FC4A 4W9GA 1E0ZA 3FAHA 1WGRA 4HK2A 5J17A 3AE8B 2KVZA 4WWNA 3AECB 4ANVA 1XCQL 2PTLA 2DYOA 2KD0A 3UF8A 2BYTA 3CF6E 3QIJA 2LVPA 2XK5B 4LNNA 2IO3B 3ZO5B 2BPSA 1LFDA 1ZKHA 2L3ZA 1UWXA 1PYWD 4IWOA 1SEBD 2UYZB 3Q8BA 1SE3A 3B0AA 5E6JA 4KIKA 1JWSD 1GG3A 2N9PC 4CYEA 1JQ4A 3MC9A 2KWCA 2ZCCA 5HI1A 2A5UA 4CHKA 3IVFA 3K9PB 1V5OA 3IXSA 3ABVB 1V2YA 1BUIC 1WXSA 3O65B 3OWEB 2L05A 2QJLA 4M01A 1Y8RC 3N1XC 1ZW7A 2M1MA 2Z59B 1UD7A 1GUAB 3ZXRA 2NBVB 3EFCA 1B9RA 1MPEA 1F0ZA 4XC2A 3ONSA 1I4PA 2JU6X 1JALA 2KAJA 2WXOA 1C76A 5BMHA 2J4XA 3DBHI 3DVNV 2C9WB 2WQYB 3BINA 1QOBA 4PYZA 1DOYA 3TCAA 3CSFA 4ANWA 4NQLB 3C8YA 3TUOA 1WSPA 2ACZB 1Q0WB 1RRBA 3LDZE 3M62B 2CS4A 1ZPSA 2O6VD 2CHZA 1K8RB 4AWJA 4HKQA 3J9CA 5CHWA 4KKJA 4W9CA 1WMHB 3P1MA 4NPNA 1SB3C 5HG2A 2X8XX 4RF1A 1WXMA 5BYSA 2WDVB 4M00A 2WXRA 1YX6B 2Z0EB 1V86A 1WR1A 3PO0A 3PHXB 2D5GA 2M8SA 3PZDA 4N58A 1WWTA 2LGDA 1ISNA 3C19A 1TZ1A 3PRZA 3K9OB 3D32A 1CZPA 3SFDB 4DHZE 2WDQB 4USAA 1YN4A 2FE8A 4W9LA 2MH7A 1SXTA 4YSZB 4ARCA 1ZUD2 3ML9A 1N5XA 1YQBA 4C00A 2AQ2B 4OVUA 3WCQA 1KH0A 1AARA 3VH3B 2KDBA 4TMAB 5IP4D 1L6UA 1R4NB 2VZKD 3V60A 3VHTC 4H2AA 3UIPB 2D11A 2N1WA 1L0XB 3URYA 1LXDA 2BTEA 5FKAC 2WNMA 4M0WA 1D5MC 3MC8A 3ZNID 4DDGD 4K81A 4URKA 1TKEA 2WX0A 1TS3A 3JSVA 5JHAA 5HKHA 2IO2B 3PTFC 3NUHB 3ZTDA 2MWSB 2K3UA 1XD3B 2OJWA 3RULA 1PGXA 1WGKA 2GOWA 4KZ0A 1LM8B 4RGNA 3AH7A 3ETRA 1RLFA 3AE5B 4AS1A 1H8CA 2WHIA 3WAMA 1UBIA 3A9JB 4UDUC 5CTRC 2KMCA 2RGFA 4JWSC 1PGAA 1VD2A 3X0WA 4HCPB 1MVKA 2K6DB 3HVZA 2GBMA 1L7YA 3GE8C 2IPKD 4ZDVA 4NJ6A 2NVUI 1TZOA 4FXCA 3I57A 2DYMA 3VDZA 1FCLA 4US9A 3BVGA 2LI5A 1WJUA 5IAAC 4WWMA 2MA9B 3Q69A 4M02A 3BK2A 4LK0M 4YSYB 4ZHPA 3DHHC 4TSSA 3PRPB 2BW2A 3AE2B 2LRUA 4M8MA 4GU2A 1D4BA 4WAFA 4JLCA 2KC2A 2K5PA 2L0FA 1DYQA 1EWCA 3PREA 1XT9B 3W2DA 2PMVA 3UI3A 2BYVE 5AZFA 2RSUA 1YOVB 1H4RA 2KT7A 5C1ZA 2KNBA 2NCNA 5DPWA 4WJNA 2L32A 4XWTA 3MC0B 3ZNGC 4DDID 3VRBB 2JF5A 3NVVA 4B6WA 2KX3A 4P6VF 4LDTB 3IBEA 1HXYD 1UGJA 1OQYA 4ANXA 1I4GA 1JRPA 3RFZB 1UUPA 2INNE 4WQOB 4ZRKA 1IBXA 4GDLB 2ZEQA 2MP2A 1J7CA 2IYDB 2LJIA 2MSED 3PRMB 4DK5A 1YN3A 4ICVA 1K51A 3ZUNA 3ZYYX 4JX1C 1VCBA 2R2OA 3VR8B 4DHJD 5GXGB 1D5XC 1HTOA 1KFYB 1RFKA 5LXIB 3WAOA 2QIEB 1QQRA 2LXAA 3GP7A 4OZAA 4NAWA 3SHQA 1PDXA 3AV8A 2ZCBA 5CX3A 3N1YC 5BO4B 1QZEA 5G5GA 1TTNA 4WAAA 4MACA 1LQBA 4GLSC 1E7PB 3N30A 1GB1A 3L13A 2MBQA 5FR6A 2WXMA 4HLEA 5C3JB 2VH2A 2WXLA 1EO6A 3PS6A 2EKEC 3FILB 3A9KA 1E90A 1RM6C 2MW5A 1OEYJ 2AL6A 2BB5A 4LJPB 2CR5A 2JXTA 2NBUA 4IUMB 5TR5A 1XLOA 1L4ZB 4JL9A 1MJDA 2PE6B 2JSVX 3R3MA 2NTSA 2KACA 4KGTA 2Y5CA 3PLVA 2GBNA 2V4LA 2BWFA 3W9CB 4E71A 1GPXA 3NVWA 3DDCB 3AE9B 4LNOA 1KJTA 4N6EB 5J2RA 4FULA 1WGDA 1L2NA 4MJSA 2JYEA 3AU4A 2JZ3B 4FA6A 4MGZE 2ZW1A 3B2FA 4PT5A 2KJRA 5L83A 4BKSD 3V6EB 3Q3MC 2IY0B 3L08A 3APDA 3TJPA 4OVVA 1SJHD 2LEKA 2WWZA 3Q6BA 1D5ZC 1YJJA 2H88B 1IGCA 4N59A 1FFVA 1T3QA 2MLBA 2JWUA 3QQ8B 2BF8B 5EE1A 2MCNB 3BY4B 2UWQA 1CMXB 1AN8A 1GNUA 1VDVA 1WYGA 2L7RA 1KM7A 1UH6A 5AUKA 3IAM1 1L4DB 2O2VB 2DNFA 5C2TB 1J0GA 4EKUA 1UWMA 4DHZB 2GMIC 4OZCA 1V8CA 5AEKB 4MM3B 2GLSA 2QSDA 1WYWB 3U2SC 1P1AA 2MJ3A 2FAZA 2J7QB 3HVDA 3RN9C 1L6VA 1XLPA 2O6VB 2Z8LA 3EHVA 2MJEA 3PZ8A 4AUQC 2IGDA 4GMVA 2PE9A 5FR3A 1MG4A 4RM8A 2JT4B 2QHOA 2WP9B 1MHHE 2IJ0A 4PS3A 2V3NA 4KZCA 3P4RB 3B08A 3PHWB 5D3DA 4LNFA 2LGYA 2G9HD 2QEJC 2WGSA 3PV1A 1YJ1A 3DPDA 1FNVA 3KYCD 2JWZA 3BVZA 4KDIC 1Q10A 3P4QB 3QAQA 1V80A 4O1NA 1WXAA 3N32A 5HFYA 5E6PA 3OG5A 2E6XA 4DBGA 3PVLA 2MEKA 4KDLB 4P16A 2WXKA 2WLBA 2QMTA 3TMPB 5E6NA 4ZRQA 4AQ7A 4ZRJA 3B1LX 4II2B 3MTNB 3L10B 3E56A 4HWIB 1WE6A 5H8YE 2CU1A 5D2MB 2XBBC 2PLPA 3Q8AA 1ZOYB 2TSSA 1WX7A 2WU2B 1NI3A 2DZIA 1YQ4B 2KFJA 4WWOA 5KHOA 2DAJA 4NQKE 3ALBA 1FRDA 4NZLB 1CQVA 2NS5A 2XNAC 3R8BA 3JSVB 4S0RA 3RNAC 4K7UA 5EDSA 1E8XA 2BB6A 5TSSA 2KQSA 1JMLA 4KX6B 5AZHA 2W9NA 2J52A 2Y3AA 4W9IA 4FHJA 2IO1B 4BBNF 1OQRA 4C7YA 1WZ3A 1WX8A 2L8JA 4FBJB 1PUTA 4C56C 3QHTA 1SIJA 1HQRD 2V0GA 3UQBA 3TSSA 2Y5BB 3KWVA 1VJKA 2K0PA 1SE9A 4MSQB 3RNFC 1WGYA 1J19A 4L23A 2WXQA 2WXPA 1ET6A 3RPFC 4IDIA 3DBLB 3EFUA 1GOZA 2LFIA 3IFWB 3MHZA 4MH0E 1FRRA 4LTUA 3EUB2 3VQIA 3U7DA 4DXGA 2HTHA 3W1SC 3A1QA 2G1EA 2MBBB 1E9MA 3U30A 2HDEA 2MQJA 1I42A 1EF5A 1JWMD 3I3TB 2J42A 1NVID 4NNJB 5CHVC 2WU5B 3LYYA 2MHJA 2M0AA 5DPSA 2PIAA 1TKGA 1TS4A 3VFKA 5G55A 3HRDD 4AOFA 2JZPA 2LUEA 2WS3B 4RNAA 2DBYA 3NRZA 3QCAA 2Y5PA 2C7MB 3L54A 3VUYA 4HJGE 3ZNZB 3KH0A 4MH8A 2B76B 3QA8A 4LLGM 4DXFA 1OGWA 3A33B 1C4AA 2KDIA 4C4VB 1P7FA 3T8MA 5BMGA 2C7HA 5EE3A 1F1HA 1M4VA 4D2KA 2W82A 3QC8B 1QF6A 3ZDTA 1WM3A 2W54A 3U7ZA 1UNSA 4I6NB 4DHJB 1VLBA 2G4SA 3ZQ4A 4J3OD 5DPRA 2RDGA 1LGRA 4RGTA 2X38A 1P0RA 2QCZA 2QC8A 2BYFA 3H7SA 1IP9A 3T9LA 3L17A 2GBRA 4CO7A 1XLNA 2R2QA 1SSNA 1BXTA 5D3IB 3T3NA 2AQ3B 3NS1A 1ZXHA 4ZRIA 1S1QB 2Q5WD 2DYBA 3H7PB 3LB8C 5GMVA 3NY5A 2FUHB 2ZZPB 1V1PB 2E3TA 3QJZA 2KO3A 1KOTA 1UF0A 4I6LB 1TKYA 3Q8CA 3BZDB 2JVCA 3IG3A 4MELA 1TT5B 1RAXA 4JE3B 3N9YC 2Z0DB 2WXGA 1CK1A 2MJDA 4EOYA 3RNEC 2KWUB 3UINB 3AE7B 2KN4A 2LWPA 2LVQA 3RNGC 2XEWA 1HTQA 3NS8A 3NOBA 1DOXA 4YWGG 4JGHB 1F2RC 2HJ8A 1R4NI 4MJSB 1WH3A 1WX9A 3EGRA 4BKGA 1C1YB 5LLIA 2PJHA 1NBFC 4J6IA 1U4AA 2IGGA 1ZXIA 4EZKA 4K7SA 3ZLZA 4I6PA 5BYRA 3DHIC 4YSXB 3EC8A 4XWWA 3KUCB 5D6JB 1WY8A 1EM7A 2PVGC 4XDCA 3V3XA 5BYQA 3DHGC 2N0SB 4ANUA 2DHZA 3P4SB 3ZDMC 2YEPB 1E5WA 4EFOA 1ACCA 2JXXA 3P63A 3HHMA 5G2NA 1XEEA 4G0NB 4K7WA 3RD2A 3U4EG 2RDHA 3HM6X 5LNK1 2DAFA 3I63C 1KTKA 4S17A 2RMMA 1XO3A 1WXQA 3RI7C 4DQOC 2I1JA 2H89B 1T0RC 2J53A 3APCA 1I35A 3HIZA 1WIAA 2KJHB 2NPTB 2RD0A 1T0YA 3I9V1 2WDRB 1J7AA 1P7EA 1A70A 3SFEB 5D7GA 3DBRB 3W5UB 3RZWC 1I7HA 4IKGA 1L5PA 2LGXA 1NYRA 3TIXA 1SJED 3GB1A 2RR9A 2KYWA 1WMHA 2N9KA 4A9AA 3AEEB 1SE4A 3AM9A 2KKCA 2LMCA 1V1OA 2C60A 1PFDA 1J7BA 3W5VB 1EUVB 3VUWA 1NYQA 2M19A 2K8HA 3AEAB 1N61A 3V62A 2IZVB 4TKNA 4BFRA 5IA7A 3QARA 4YXDB 1JWAD 2KFKB 2MRPA 2D3GA 2KZRA 1V9JA 3JW0X 3HM3A 2KTRB 4OHJA 3BK1A 1PQSA 3Q2AC 2RPVA 1RFAA 3GOEA 3R2IA 4KSLC 3DCGA 1TS2A 2K22A 2KWVB 1CJEA 2LRWA 1F9JA 3WIMA 3TL5A 1D3ZA 1S3SG 2M17A 3N3KB 1WM2A 2EKIA 1JW9D 4G11A 4DXAB 1N5WA 4IWPA 5HHDG 1FIQA 3ZRCA 1XF5L 3PLUA 4AJWA 1ZP0B 2BQQA 1WJ6A 3UQAA 1TY2A 1EF1A 2M4NA 1BMLC 1L0YB 1RWSA 4XYCA 1MHXA 5JHBA 3AU5A 4GN1A 2ZPYA 4BVUC 3PZ7A 4WIPA 1KLGD 4US8A 4KGSA 1WJNA 4CQNA 4RGMA 3UIOB 3A9JA 4KIKB 2J0KA 2G45B 2M0XA 1FO4A 2WDTB 1G6JA 1ROEA 2EELA 4A20A 2EMSA 4P1CC 2KQ4X 3AULA 4WWPA 2PEAA 2OJRA 3IHPC 2PVOD 3N1ZC 4W9JA 3V6CB 3DQVA 1UBQA 2QILA 1WZ0A 3CWIA 3AE4B 3IT4B 3DVGX 4JPSA 3AXCA 3P2BA 2LASA 3ML8A 1WRDB 2ZVNA 4GB9A 3JVZX 3QWZB 3MFGA 2YEPF 2WXHA 1FPYA 1OFFA 3MHSD 3PGEA 3GZNB 1MFWA 4ZOHC 5H92C 2FIDA 2V9HA 3ZTCA 4FHKA 2DZKA 4WURA 4A3PA 4LCDE 5I4DA 2J0JA 3AEBB 2HJ1A 4II3B 3VTVA 2BVCA 1SE2A 3AE1B 3SD5A 5EE9A 2FIFA 3SEBA 1FNWA 3W1SA 4C80A 1YD8U 2GBKA 4LDTD 1WJ4A 1SIFA 2KANA 2IDYA 3V61A 3QK0A 4XZ4A 2L76A 1XCTL 1WGGA 4WJOA 2NMQA 5IN7A 1F2RI 2AX5A 1K50A 2NBWB 3MP9A 2VRRB 3ZIMA 4E3CA 1C4CA 4K1RB 2HE7A 4FLHA 2V4IB 4MEMA 3MJ5A 2FCMA 1B1ZA 1XXGA 3A4RA 4NY0A 2LJ5A 1N60A 5LXHA 3KWLA 3I5JC 1T0QC 1E6EB 1JWBD 1GC6A 3GZNI 4OZBA 4IM2A 1Z5SB 4G3XB 1EWYC 2C7NB 1GB4A 4ICUA 1SGHA 4HROA 4HXDA 4ITKA 1OEYA 2JQRB 3NG0A 3O13A 1F77A 1ZE3D 1JCKB 2D3BA 2MBEA 2K8CA 4HEA1 3P4PB 2VZKB 4OW0A 1JWUD 4KSKC 1STEA 2KTFA 1VR9A 1KRHA 3HUIA 3CSTA 3N20C 2BS4B 1NEKB 4M0WB 3U52E 3FILA 4AP4C 3DOWA 1Q1OA 3KVFB 1D6EC 1SF0A 1FD6A 4TQ0A 3AMZA 5BMIA 1BT0A 4GDKA 1VZ6A 2BS3B 4WH4A 5D94A 2KC1A 4RCOA 1QKZA 3QX1A 4M8NA 4W9HA 2L52A 1V49A 1ZDVA 4B0EA 2XN9C 4IG7B 3AN1A 4KKIA 4EZJA 1PGBA 3VR9B 1ESFA 3WA0A 3VRAB 3WALA 3ENEA 3BYYB 2DX5B 3RNCC 2AQ1B 3R2TA 2CU3A 1J8CA 4HDOA 3DBHB 4C7ZA 1WXVA 2KLCA 4GSWA 1E7VA 2FUG1 3AEFB 3Q8FA 2KJ6A 1YX5B 4FJVB 5G5HA 3W1YA 3TEZA 4X57B 2L00B 1N63A 3ZKJC 4FADA 2JX5A 2JPHA 2WXIA 1TS5A 2REXA 4RMAA 4N9F4 4HDQA 3ZJVA 3NVYA 2L0TA 1DOIA 2I2YA 5DCNA 2RPQA 2LUMA 2WXNA 2R61A 4P1BC 1C77A 3ZXVA 4P7IA 2MBOA 3VTWA 2AEHA 4RM9A 2WXJA 2PKOA 3ZNHB 2O2VA 1E8ZA 1YQ3B 1KF6B 2BBCA 2LZ6A 2KN5A 1ENFA 2K8BA 1E7UA 4IC7B 4MM3A 2N9LA 2RDBC 5IO9A 4XDDA 2KHWB 3ZJTA 2PW9A 2LD9A 2CJOA 2BS2B 4MT5A 2O6VA 3DBLI 2GB1A 4NAMA 2W3SA 2BYEA 4RGOS 3Q3NC 3WANA 4F7ZA 1QT9A 1IBXB 1I4XA 5DPTA 1FFUA 3AE3B 2KX0A 2MP2B 1UGMA 2KXJA 4PK1A 4XE0A 1UZXB 2ZNVB 2KWDA 1Z2MA 1L0VB 1V6EA 3SU8X 3GS2A 2QDFA 4GGQA 2LHDA 2L83A 2AYOB 2YLMA 2DLBA 1NENB 4ZYNA 1TJEA 2G4DB 4WQMA 4NAWB 1R4MB 1X1MA 3VH4B 3Q14C 3Q3JA 3S2AA 4BOZB 1QOFA 1I4HA 5IOIA 4BBNC 4RFBA 1FM0D 2K1FA 1XQQA 2CJNA 4RF0A 1WE7A 2K6QA 4MSMB 2KDFB 3M95A 1C4PA 3DWMA 2WYQA 5FK9C 1TGZB 4W9FA 2ONQA 4E74A 1P98A 3SDLC 3A9KB 2C5LC 2D3AA 1FXIA 1K53A 3RYTA 2N4FA 4IOIE 4HRSA 1QOAA 2DZMA 4YTMB 1WFYA 4YTPB 3DVGY 4REZA 2VH1A 3SR6A 2NR2A 1R4MI 2XK5A 4TQ1A 1XLQA 4ZYSA 1YMHE 2BT6A 2D3CA 4W9KA 4ACFA 2PPHA 1KLVA 2JY6A 4K3CA 1NI2A 3HK0A 1P3QU 1WI0A 3M63B 4KV2A 5J18A 4LJOB 3KW5B 3P42A 4EUTA 2CHXA 2HD5B 3NZUA 2INDC 2V1YA 4R3DA 1NDDA 4DWFA 4HPLB 4A55A 1VZ7A 1WR6E 2GRIA 5JZEB 2V3PA 2KDEB 3B2GA 3OJ3A 5JH5C 4ARIA 1WF9A 2GBJA 3UGBB 1YNTE 3RMKC 4PS7A 1HE8A 1OTRB 1V81A 3LXFA 2IY1B 1C78A 2KOXA 3T3OA 1GC7A 2LGSA 1FXAA 3ZGZA 2A4ZA 1MG8A 4A3OA 3L16A 4B9KA 3MJWA 3OLMD 3NZ3A 1FNUA 4EE2A 2ASQA 4LNKA 3KYDD 1V97A 2INPE 4JWUC 2G3QB 2BWES 1VRAB 2ZVOA 1P9DU 5IKCM 4GIVA 1N62A 3FKYA 3DWGC 1EU3A 2KK8A 2ON8A 5EE0A 4F1SA 2FBWB 1T6BX 3U8ZA 2LGIA 4NJCA 2CKHB 1GAQB 1TIFA 1E10A 4IWQA 2KMAA 3BVMA 3A4SC 1LO5D 4BAXA 2J0MA 4C4VA 2W3RA 3H6NA 3IAS1 5KHQA 1DGJA 3L4PA 2BKFA 3H8HA 3Q3FA 1AWDA 2N1VA 5CHFA 4HCNB 1TBEA 4QAYA 3LJ3A 2N7JA 3C0RB 3DBRI 4OVZA 4RH6A 1YIWA 4G50A 2KLGA 3PPAA 4JQWC 2N9XA 2SAKA 2DZJA 4IW0A 2KDMA 1JROA 2YVCA 1IYFA 1Q5WB 1IPGA 2CHWA 1KLUD 2JRIB 2K9XA 4MGYE 3DVNU 4HPMB 2MBHA 3VTUA 2FNJB 1I4RA 3KLSX 2OOBB 2N7EA 1F52A 3H7PA 3R7RA 4XGAB 4LNIA 3TEYA 3Q8EA 1HA5A 1Y56A 2K25A 1YN5A 4PYUA 3OAWA 1V1PA 5JXVA 4TV3A 3ZRFA 3RZFA 1C3TA 3NZSA 4NJ7A 2I38A 4F8CB 4JIOU 3TBLD 2M56B 2HTME 2LVOA 1HEZE 2IGHA 4A90A 1A5RA 3E9SA 3RNBC 3NJTA 2LXCA 4GDKB 4GXBA
chains in the Genus database with same CATH topology
2Y5PA 1C9FA 4HJGE 3Q69A 2JQRB 3O13A 1F77A 1ZE3D 4MH8A 2B76B 3BK2A 4LK0M 1JCKB 4LLGM 4YSYB 4DXFA 4ZHPA 4HEA1 3P4PB 4TSSA 1C4AA 2VZKB 4B0MA 1P7FA 4OW0A 2BW2A 1VZ8A 1QOGA 1JWUD 3AE2B 2NTTA 5BMGA 1STEA 5EE3A 2ZW0A 1VR9A 1KRHA 3HUIA 1M4VA 4D2KA 2W82A 1QF6A 2BS4B 1D4BA 1NEKB 4WAFA 1I4QA 3U52E 2K5PA 2W54A 3U7ZA 1DYQA 1EWCA 1UNSA 3W2DA 3FILA 2PMVA 3UI3A 1IGDA 3TEXA 1VLBA 5T8IA 1OQQA 4A6QA 1D6EC 3ZQ4A 4J3OD 1SF0A 1FD6A 4TQ0A 3AMZA 2L32A 5BMIA 2RDGA 4XWTA 3TEWA 3MC0B 1FEHA 3VRBB 4RGTA 1VZ6A 2BS3B 3NVVA 4WH4A 2X38A 4RCOA 1QKZA 4P6VF 1HXYD 1UGJA 2L52A 1ZDVA 4B0EA 1I4GA 2XN9C 3AN1A 1JRPA 4KKIA 1XLNA 1PGBA 3VR9B 3RFZB 1SSNA 1ESFA 1UUPA 3AE6B 1BXTA 1HZ5A 2INNE 1WRIA 5D3IB 3VRAB 3T3NA 4GDLB 3BYYB 1IBXA 2AQ3B 3NS1A 1ZXHA 3AEGB 1EU4A 2AQ1B 3R2TA 2CU3A 1J7CA 2LJIA 2L1AA 2Q5WD 1ZDXA 4C7ZA 1FCCC 1YN3A 1MI0A 3LB8C 1SBBB 1TY0A 2SEBD 1K51A 4KGRA 3ZYYX 4JX1C 2FUG1 3VR8B 3AEFB 3Q8FA 5AUIA 5GXGB 1D5XC 1V1PB 2OEDA 3BYTB 4L1BA 2E3TA 1KFYB 1RFKA 5G5HA 3CIRB 3TEZA 2QIEB 3BWUD 1QQRA 1QILA 1N63A 1TKYA 3GP7A 4OZAA 2JX5A 3Q8CA 3BZDB 2WXIA 4ZRPA 1PDXA 1QLBB 2ICIA 1TS5A 3AV8A 4YT0B 4JE3B 3N9YC 3KQ4A 2WXGA 3ZJVA 1CK1A 3EA6A 3NVYA 2DWQA 2MJDA 1DOIA 1K52A 5G5GA 2I2YA 3AE7B 2KN4A 2LUMA 2WXNA 1ET9A 4MACA 2R61A 3ZJUA 1C77A 4GLSC 1E7PB 4Q2JA 1GB1A 1DOXA 4YWGG 1F2RC 1YJIA 2WXJA 2WXMA 2PKOA 1AW7A 5C3JB 2W55A 3EGRA 1FMAD 2WXLA 3B9JA 2IGGA 1ZXIA 3AEDB 3FILB 1YQ3B 1KF6B 2BBCA 1RM6C 5BYRA 1ENFA 3AB5A 2BB5A 4YSXB 2JXTA 1T5XD 4XWWA 1XLOA 2N9LA 1EM7A 2PVGC 4XDCA 1L4ZB 3V3XA 5BYQA 2KMMA 2N0SB 2JSVX 4XDDA 1RYJA 1AYFA 2NTSA 3ZJTA 2PW9A 2CJOA 2WXFA 1C79A 4YTNB 2BS2B 2KACA 4KGTA 4MT5A 3P4SB 2Y5CA 2GB1A 2LHEA 4NAMA 3W9CB 4ZHOA 2W3SA 2YEPB 1GPXA 3NVWA 3V05A 3AE9B 1ACCA 4RGOS 2GI9A 3P63A 4N6EB 1QT9A 2OHFA 1XEEA 1IBXB 1I4XA 1FFUA 3AE3B 3U4EG 2RDHA 1R7SA 5LNK1 4XE0A 1KTKA 2JYEA 3IT6B 2RMMA 3BIID 5MPOA 4A8XC 1XO3A 1WXQA 2KWDA 4DQOC 2H89B 2ZW1A 1HZ6A 2J53A 3B2FA 4PT5A 1L0VB 4HKZE 3GS2A 2JYTA 4L2YA 3NVZA 2LHDA 3I9V1 2L83A 2WDRB 1J7AA 1P7EA 1A70A 1TYGB 1IUEA 2DLBA 3FC4A 3SFEB 5D7GA 1NENB 1E0ZA 1TJEA 4WQMA 3W5UB 3FAHA 4NAWB 1SJHD 2LEKA 1I7HA 3AE8B 4IKGA 1L5PA 1D5ZC 1NYRA 1YJJA 1QOFA 1I4HA 1SJED 3AECB 3GB1A 1XCQL 2H88B 2PTLA 4RFBA 2DYOA 1FM0D 1IGCA 4N59A 1FFVA 1T3QA 2N9KA 4A9AA 2BYTA 2JWUA 3AEEB 1SE4A 5EE1A 2CJNA 4RF0A 3AM9A 1C4PA 3DWMA 1AN8A 2LMCA 1VDVA 1V1OA 1PFDA 1J7BA 1WYGA 5FK9C 3W5VB 5AUKA 1UWXA 1PYWD 3IAM1 1SEBD 2ONQA 3Q8BA 1L4DB 1NYQA 2M19A 3AEAB 5E6JA 1N61A 1FXIA 1K53A 1JWSD 5C2TB 4IOIE 1JQ4A 4YXDB 4HRSA 1QOAA 1UWMA 4OZCA 1JWAD 1V8CA 4MM3B 5HI1A 2QSDA 4YTMB 4YTPB 3U2SC 4REZA 3IXSA 3ABVB 2MJ3A 1BUIC 3OWEB 4OHJA 3BK1A 3HVDA 3SR6A 1L6VA 1XLPA 2RPVA 2QJLA 2Z8LA 3R2IA 4TQ1A 1XLQA 2MJEA 4ZYSA 1TS2A 1YMHE 2BT6A 2K22A 3PZ8A 1CJEA 2IGDA 1B9RA 5FR3A 1MPEA 1F0ZA 2WP9B 1MHHE 2IJ0A 1I4PA 2JU6X 1JALA 2V3NA 3P4RB 2KAJA 2WXOA 3P42A 1C76A 5BMHA 2J4XA 2EKIA 5D3DA 2G9HD 2QEJC 2WQYB 1QOBA 1DOYA 1FNVA 1JW9D 3BVZA 1N5WA 1Q10A 3P4QB 5HHDG 1FIQA 4R3DA 3C8YA 1XF5L 4O1NA 1WSPA 3TUOA 4A55A 2ACZB 1VZ7A 5HFYA 1ZP0B 1ZPSA 2GRIA 2V3PA 3B2GA 4HKQA 3J9CA 4ARIA 2E6XA 1TY2A 2MEKA 4P16A 1YNTE 4KKJA 2WXKA 2WLBA 2QMTA 1BMLC 1L0YB 1RWSA 3P1MA 3LXFA 1MHXA 4ZRQA 1SB3C 1C78A 4AQ7A 5HG2A 3T3OA 4RF1A 5BYSA 1FXAA 3E56A 3PZ7A 3ZGZA 4WIPA 1KLGD 2WDVB 4US8A 4KGSA 2WXRA 4CQNA 5H8YE 4RGMA 2PLPA 3NZ3A 3PO0A 3Q8AA 2D5GA 1FNUA 1ZOYB 2TSSA 4EE2A 4N58A 1WWTA 2WU2B 1NI3A 1FO4A 1ROEA 2EELA 1YQ4B 1V97A 2INPE 4JWUC 1CZPA 3SFDB 1VRAB 1FRDA 2KQ4X 1N62A 2WDQB 4NZLB 4USAA 1YN4A 1CQVA 3DWGC 2XNAC 3R8BA 1EU3A 2FE8A 2ON8A 2PVOD 5EE0A 2FBWB 2BB6A 5TSSA 1T6BX 1JMLA 4KX6B 2LGIA 1SXTA 2MH7A 4YSZB 2QILA 4NJCA 3CWIA 4ARCA 3AE4B 1GAQB 1ZUD2 3IT4B 1E10A 4JPSA 1N5XA 2J52A 2AQ2B 2Y3AA 3BVMA 3WCQA 1KH0A 1LO5D 4TMAB 1OQRA 4C7YA 3MFGA 1L6UA 2VZKD 2W3RA 2YEPF 3IAS1 2WXHA 1PUTA 4H2AA 4C56C 1OFFA 1SIJA 1HQRD 1DGJA 1L0XB 3L4PA 3URYA 2BTEA 2V0GA 5FKAC 2WNMA 3H8HA 4M0WA 1D5MC 4ZOHC 5H92C 3TSSA 1AWDA 1TKEA 3KWVA 1VJKA 1TS3A 2K0PA 4WURA 5I4DA 3AEBB 2N7JA 3NUHB 4L23A 4OVZA 2WXQA 2WXPA 4RH6A 1ET6A 3RPFC 4IDIA 1SE2A 3AE1B 2K3UA 1GOZA 2LFIA 5EE9A 3MHZA 3SEBA 1FNWA 3W1SA 1FRRA 4LTUA 4C80A 3EUB2 3VQIA 1PGXA 1WGKA 4DXGA 2SAKA 2IDYA 2KDMA 1XCTL 1JROA 2G1EA 4RGNA 3AH7A 3ETRA 2NMQA 3AE5B 1E9MA 1F2RI 2AX5A 4AS1A 1K50A 3MP9A 1KLUD 2K9XA 2HDEA 1I4RA 3KLSX 1JWMD 2J42A 1C4CA 1NVID 4UDUC 2V4IB 3TEYA 3Q8EA 1PGAA 1HA5A 3MJ5A 4JWSC 2WU5B 1B1ZA 1XXGA 1Y56A 1YN5A 3LYYA 1MVKA 1V1PA 3HVZA 1N60A 5JXVA 2IPKD 3KWLA 2M0AA 1TZOA 1E6EB 1JWBD 2PIAA 4FXCA 3I57A 1TKGA 2DYMA 2I38A 4OZBA 1TS4A 2M56B 2HTME 1FCLA 1HEZE 1EWYC 2IGHA 3HRDD 4US9A 4A90A 3BVGA 3E9SA 2JZPA 2WS3B 4RNAA 1GB4A 2DBYA 4GDKB 4HROA 3NRZA 4WWMA 4ITKA 1SE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZ7 A;  4WIP A;  1WSP A;  3PZ8 A;  2D5G A; 
#chains in the Genus database with same CATH topology
 2INC C;  2JZZ A;  1C9F A;  1WGH A;  4XX5 A;  3EEC A;  3OJ4 B;  1N6Z A;  3KUD B;  4B0M A;  1VZ8 A;  1QOG A;  4GOC A;  2NTT A;  4W9D A;  2ZW0 A;  4FJY A;  2ZJD A;  1I4Q A;  3APF A;  4EZL A;  5C23 A;  4FJZ A;  1IGD A;  1UEL A;  3TEX A;  4BKS A;  5T8I A;  1OQQ A;  4A6Q A;  1E8Y A;  3VAW A;  2BKR B;  4TUU A;  1E8W A;  3CMM B;  3TEW A;  4IM3 A;  1FEH A;  2UU7 A;  4BOS C;  2I1K A;  2DEN B;  3ZVV A;  3A1Q B;  3AE6 B;  1HZ5 A;  1WRI A;  3AEG B;  1EU4 A;  3H9D A;  3L0W B;  2L1A A;  1ZDX A;  1GJZ A;  1FCC C;  4EEW A;  1MI0 A;  1SBB B;  1TY0 A;  2SEB D;  2ZNV C;  4KGR A;  2NPT A;  5AUI A;  2JUO A;  2FCN A;  2OED A;  3BYT B;  4L1B A;  3VUX A;  3CIR B;  2IBI B;  3BWU D;  1QIL A;  3M3J A;  4AJY B;  3ECI A;  3R7Q A;  4MGK E;  3WAP A;  4ZRP A;  2ZPN A;  1QLB B;  2ICI A;  3VXW A;  3R66 C;  4YT0 B;  2D2Q A;  4MDK E;  1M94 A;  3KQ4 A;  3PSE B;  4W9E A;  2FCQ A;  5L95 C;  3EA6 A;  2DWQ A;  1JRU A;  1K52 A;  2D07 B;  5E6O A;  4GDL A;  1ET9 A;  3ZJU A;  4FN2 A;  5AZG A;  4Q2J A;  4HJK A;  3DBS A;  4BZA A;  4KVG B;  4HPP A;  1YJI A;  2EMT A;  2D10 A;  4BKT A;  1AW7 A;  2W55 A;  4K3B A;  2N9E B;  1FMA D;  3RT3 B;  3B9J A;  3H1U A;  4YL8 A;  3AED B;  4PS8 A;  2MX2 A;  1V5T A;  3KUZ A;  4ASW C;  2BGF A;  3AB5 A;  3GE3 C;  4MGI E;  4WJP A;  2AWT A;  1T5X D;  3RCZ A;  2KFK A;  2B3A A;  2KVR A;  2KMM A;  2FCS A;  1RYJ A;  1AYF A;  1T0S C;  2KTR A;  2WX1 A;  2WXF A;  2N7D A;  1C79 A;  2IO0 B;  4IM0 A;  4YTN B;  1FXT B;  2V3S A;  2LHE A;  3NHE B;  4ZHO A;  3PT2 B;  2AL3 A;  3X23 A;  3V05 A;  3Q3O C;  2GI9 A;  4WJQ A;  2OHF A;  3JYU A;  1ZGU B;  4B95 A;  1R7S A;  3ZW3 A;  3IT6 B;  3VVW B;  4HVB A;  3BII D;  5MPO A;  4A8X C;  1HZ6 A;  2KQ7 A;  2K39 A;  4HKZ E;  2JYT A;  4L2Y A;  3NVZ A;  2JRH A;  3AI5 A;  3RUI B;  1TYG B;  1IUE A;  3FC4 A;  4W9G A;  1E0Z A;  3FAH A;  1WGR A;  4HK2 A;  5J17 A;  3AE8 B;  2KVZ A;  4WWN A;  3AEC B;  4ANV A;  1XCQ L;  2PTL A;  2DYO A;  2KD0 A;  3UF8 A;  2BYT A;  3CF6 E;  3QIJ A;  2LVP A;  2XK5 B;  4LNN A;  2IO3 B;  3ZO5 B;  2BPS A;  1LFD A;  1ZKH A;  2L3Z A;  1UWX A;  1PYW D;  4IWO A;  1SEB D;  2UYZ B;  3Q8B A;  1SE3 A;  3B0A A;  5E6J A;  4KIK A;  1JWS D;  1GG3 A;  2N9P C;  4CYE A;  1JQ4 A;  3MC9 A;  2KWC A;  2ZCC A;  5HI1 A;  2A5U A;  4CHK A;  3IVF A;  3K9P B;  1V5O A;  3IXS A;  3ABV B;  1V2Y A;  1BUI C;  1WXS A;  3O65 B;  3OWE B;  2L05 A;  2QJL A;  4M01 A;  1Y8R C;  3N1X C;  1ZW7 A;  2M1M A;  2Z59 B;  1UD7 A;  1GUA B;  3ZXR A;  2NBV B;  3EFC A;  1B9R A;  1MPE A;  1F0Z A;  4XC2 A;  3ONS A;  1I4P A;  2JU6 X;  1JAL A;  2KAJ A;  2WXO A;  1C76 A;  5BMH A;  2J4X A;  3DBH I;  3DVN V;  2C9W B;  2WQY B;  3BIN A;  1QOB A;  4PYZ A;  1DOY A;  3TCA A;  3CSF A;  4ANW A;  4NQL B;  3C8Y A;  3TUO A;  1WSP A;  2ACZ B;  1Q0W B;  1RRB A;  3LDZ E;  3M62 B;  2CS4 A;  1ZPS A;  2O6V D;  2CHZ A;  1K8R B;  4AWJ A;  4HKQ A;  3J9C A;  5CHW A;  4KKJ A;  4W9C A;  1WMH B;  3P1M A;  4NPN A;  1SB3 C;  5HG2 A;  2X8X X;  4RF1 A;  1WXM A;  5BYS A;  2WDV B;  4M00 A;  2WXR A;  1YX6 B;  2Z0E B;  1V86 A;  1WR1 A;  3PO0 A;  3PHX B;  2D5G A;  2M8S A;  3PZD A;  4N58 A;  1WWT A;  2LGD A;  1ISN A;  3C19 A;  1TZ1 A;  3PRZ A;  3K9O B;  3D32 A;  1CZP A;  3SFD B;  4DHZ E;  2WDQ B;  4USA A;  1YN4 A;  2FE8 A;  4W9L A;  2MH7 A;  1SXT A;  4YSZ B;  4ARC A;  1ZUD 2;  3ML9 A;  1N5X A;  1YQB A;  4C00 A;  2AQ2 B;  4OVU A;  3WCQ A;  1KH0 A;  1AAR A;  3VH3 B;  2KDB A;  4TMA B;  5IP4 D;  1L6U A;  1R4N B;  2VZK D;  3V60 A;  3VHT C;  4H2A A;  3UIP B;  2D11 A;  2N1W A;  1L0X B;  3URY A;  1LXD A;  2BTE A;  5FKA C;  2WNM A;  4M0W A;  1D5M C;  3MC8 A;  3ZNI D;  4DDG D;  4K81 A;  4URK A;  1TKE A;  2WX0 A;  1TS3 A;  3JSV A;  5JHA A;  5HKH A;  2IO2 B;  3PTF C;  3NUH B;  3ZTD A;  2MWS B;  2K3U A;  1XD3 B;  2OJW A;  3RUL A;  1PGX A;  1WGK A;  2GOW A;  4KZ0 A;  1LM8 B;  4RGN A;  3AH7 A;  3ETR A;  1RLF A;  3AE5 B;  4AS1 A;  1H8C A;  2WHI A;  3WAM A;  1UBI A;  3A9J B;  4UDU C;  5CTR C;  2KMC A;  2RGF A;  4JWS C;  1PGA A;  1VD2 A;  3X0W A;  4HCP B;  1MVK A;  2K6D B;  3HVZ A;  2GBM A;  1L7Y A;  3GE8 C;  2IPK D;  4ZDV A;  4NJ6 A;  2NVU I;  1TZO A;  4FXC A;  3I57 A;  2DYM A;  3VDZ A;  1FCL A;  4US9 A;  3BVG A;  2LI5 A;  1WJU A;  5IAA C;  4WWM A;  2MA9 B;  3Q69 A;  4M02 A;  3BK2 A;  4LK0 M;  4YSY B;  4ZHP A;  3DHH C;  4TSS A;  3PRP B;  2BW2 A;  3AE2 B;  2LRU A;  4M8M A;  4GU2 A;  1D4B A;  4WAF A;  4JLC A;  2KC2 A;  2K5P A;  2L0F A;  1DYQ A;  1EWC A;  3PRE A;  1XT9 B;  3W2D A;  2PMV A;  3UI3 A;  2BYV E;  5AZF A;  2RSU A;  1YOV B;  1H4R A;  2KT7 A;  5C1Z A;  2KNB A;  2NCN A;  5DPW A;  4WJN A;  2L32 A;  4XWT A;  3MC0 B;  3ZNG C;  4DDI D;  3VRB B;  2JF5 A;  3NVV A;  4B6W A;  2KX3 A;  4P6V F;  4LDT B;  3IBE A;  1HXY D;  1UGJ A;  1OQY A;  4ANX A;  1I4G A;  1JRP A;  3RFZ B;  1UUP A;  2INN E;  4WQO B;  4ZRK A;  1IBX A;  4GDL B;  2ZEQ A;  2MP2 A;  1J7C A;  2IYD B;  2LJI A;  2MSE D;  3PRM B;  4DK5 A;  1YN3 A;  4ICV A;  1K51 A;  3ZUN A;  3ZYY X;  4JX1 C;  1VCB A;  2R2O A;  3VR8 B;  4DHJ D;  5GXG B;  1D5X C;  1HTO A;  1KFY B;  1RFK A;  5LXI B;  3WAO A;  2QIE B;  1QQR A;  2LXA A;  3GP7 A;  4OZA A;  4NAW A;  3SHQ A;  1PDX A;  3AV8 A;  2ZCB A;  5CX3 A;  3N1Y C;  5BO4 B;  1QZE A;  5G5G A;  1TTN A;  4WAA A;  4MAC A;  1LQB A;  4GLS C;  1E7P B;  3N30 A;  1GB1 A;  3L13 A;  2MBQ A;  5FR6 A;  2WXM A;  4HLE A;  5C3J B;  2VH2 A;  2WXL A;  1EO6 A;  3PS6 A;  2EKE C;  3FIL B;  3A9K A;  1E90 A;  1RM6 C;  2MW5 A;  1OEY J;  2AL6 A;  2BB5 A;  4LJP B;  2CR5 A;  2JXT A;  2NBU A;  4IUM B;  5TR5 A;  1XLO A;  1L4Z B;  4JL9 A;  1MJD A;  2PE6 B;  2JSV X;  3R3M A;  2NTS A;  2KAC A;  4KGT A;  2Y5C A;  3PLV A;  2GBN A;  2V4L A;  2BWF A;  3W9C B;  4E71 A;  1GPX A;  3NVW A;  3DDC B;  3AE9 B;  4LNO A;  1KJT A;  4N6E B;  5J2R A;  4FUL A;  1WGD A;  1L2N A;  4MJS A;  2JYE A;  3AU4 A;  2JZ3 B;  4FA6 A;  4MGZ E;  2ZW1 A;  3B2F A;  4PT5 A;  2KJR A;  5L83 A;  4BKS D;  3V6E B;  3Q3M C;  2IY0 B;  3L08 A;  3APD A;  3TJP A;  4OVV A;  1SJH D;  2LEK A;  2WWZ A;  3Q6B A;  1D5Z C;  1YJJ A;  2H88 B;  1IGC A;  4N59 A;  1FFV A;  1T3Q A;  2MLB A;  2JWU A;  3QQ8 B;  2BF8 B;  5EE1 A;  2MCN B;  3BY4 B;  2UWQ A;  1CMX B;  1AN8 A;  1GNU A;  1VDV A;  1WYG A;  2L7R A;  1KM7 A;  1UH6 A;  5AUK A;  3IAM 1;  1L4D B;  2O2V B;  2DNF A;  5C2T B;  1J0G A;  4EKU A;  1UWM A;  4DHZ B;  2GMI C;  4OZC A;  1V8C A;  5AEK B;  4MM3 B;  2GLS A;  2QSD A;  1WYW B;  3U2S C;  1P1A A;  2MJ3 A;  2FAZ A;  2J7Q B;  3HVD A;  3RN9 C;  1L6V A;  1XLP A;  2O6V B;  2Z8L A;  3EHV A;  2MJE A;  3PZ8 A;  4AUQ C;  2IGD A;  4GMV A;  2PE9 A;  5FR3 A;  1MG4 A;  4RM8 A;  2JT4 B;  2QHO A;  2WP9 B;  1MHH E;  2IJ0 A;  4PS3 A;  2V3N A;  4KZC A;  3P4R B;  3B08 A;  3PHW B;  5D3D A;  4LNF A;  2LGY A;  2G9H D;  2QEJ C;  2WGS A;  3PV1 A;  1YJ1 A;  3DPD A;  1FNV A;  3KYC D;  2JWZ A;  3BVZ A;  4KDI C;  1Q10 A;  3P4Q B;  3QAQ A;  1V80 A;  4O1N A;  1WXA A;  3N32 A;  5HFY A;  5E6P A;  3OG5 A;  2E6X A;  4DBG A;  3PVL A;  2MEK A;  4KDL B;  4P16 A;  2WXK A;  2WLB A;  2QMT A;  3TMP B;  5E6N A;  4ZRQ A;  4AQ7 A;  4ZRJ A;  3B1L X;  4II2 B;  3MTN B;  3L10 B;  3E56 A;  4HWI B;  1WE6 A;  5H8Y E;  2CU1 A;  5D2M B;  2XBB C;  2PLP A;  3Q8A A;  1ZOY B;  2TSS A;  1WX7 A;  2WU2 B;  1NI3 A;  2DZI A;  1YQ4 B;  2KFJ A;  4WWO A;  5KHO A;  2DAJ A;  4NQK E;  3ALB A;  1FRD A;  4NZL B;  1CQV A;  2NS5 A;  2XNA C;  3R8B A;  3JSV B;  4S0R A;  3RNA C;  4K7U A;  5EDS A;  1E8X A;  2BB6 A;  5TSS A;  2KQS A;  1JML A;  4KX6 B;  5AZH A;  2W9N A;  2J52 A;  2Y3A A;  4W9I A;  4FHJ A;  2IO1 B;  4BBN F;  1OQR A;  4C7Y A;  1WZ3 A;  1WX8 A;  2L8J A;  4FBJ B;  1PUT A;  4C56 C;  3QHT A;  1SIJ A;  1HQR D;  2V0G A;  3UQB A;  3TSS A;  2Y5B B;  3KWV A;  1VJK A;  2K0P A;  1SE9 A;  4MSQ B;  3RNF C;  1WGY A;  1J19 A;  4L23 A;  2WXQ A;  2WXP A;  1ET6 A;  3RPF C;  4IDI A;  3DBL B;  3EFU A;  1GOZ A;  2LFI A;  3IFW B;  3MHZ A;  4MH0 E;  1FRR A;  4LTU A;  3EUB 2;  3VQI A;  3U7D A;  4DXG A;  2HTH A;  3W1S C;  3A1Q A;  2G1E A;  2MBB B;  1E9M A;  3U30 A;  2HDE A;  2MQJ A;  1I42 A;  1EF5 A;  1JWM D;  3I3T B;  2J42 A;  1NVI D;  4NNJ B;  5CHV C;  2WU5 B;  3LYY A;  2MHJ A;  2M0A A;  5DPS A;  2PIA A;  1TKG A;  1TS4 A;  3VFK A;  5G55 A;  3HRD D;  4AOF A;  2JZP A;  2LUE A;  2WS3 B;  4RNA A;  2DBY A;  3NRZ A;  3QCA A;  2Y5P A;  2C7M B;  3L54 A;  3VUY A;  4HJG E;  3ZNZ B;  3KH0 A;  4MH8 A;  2B76 B;  3QA8 A;  4LLG M;  4DXF A;  1OGW A;  3A33 B;  1C4A A;  2KDI A;  4C4V B;  1P7F A;  3T8M A;  5BMG A;  2C7H A;  5EE3 A;  1F1H A;  1M4V A;  4D2K A;  2W82 A;  3QC8 B;  1QF6 A;  3ZDT A;  1WM3 A;  2W54 A;  3U7Z A;  1UNS A;  4I6N B;  4DHJ B;  1VLB A;  2G4S A;  3ZQ4 A;  4J3O D;  5DPR A;  2RDG A;  1LGR A;  4RGT A;  2X38 A;  1P0R A;  2QCZ A;  2QC8 A;  2BYF A;  3H7S A;  1IP9 A;  3T9L A;  3L17 A;  2GBR A;  4CO7 A;  1XLN A;  2R2Q A;  1SSN A;  1BXT A;  5D3I B;  3T3N A;  2AQ3 B;  3NS1 A;  1ZXH A;  4ZRI A;  1S1Q B;  2Q5W D;  2DYB A;  3H7P B;  3LB8 C;  5GMV A;  3NY5 A;  2FUH B;  2ZZP B;  1V1P B;  2E3T A;  3QJZ A;  2KO3 A;  1KOT A;  1UF0 A;  4I6L B;  1TKY A;  3Q8C A;  3BZD B;  2JVC A;  3IG3 A;  4MEL A;  1TT5 B;  1RAX A;  4JE3 B;  3N9Y C;  2Z0D B;  2WXG A;  1CK1 A;  2MJD A;  4EOY A;  3RNE C;  2KWU B;  3UIN B;  3AE7 B;  2KN4 A;  2LWP A;  2LVQ A;  3RNG C;  2XEW A;  1HTQ A;  3NS8 A;  3NOB A;  1DOX A;  4YWG G;  4JGH B;  1F2R C;  2HJ8 A;  1R4N I;  4MJS B;  1WH3 A;  1WX9 A;  3EGR A;  4BKG A;  1C1Y B;  5LLI A;  2PJH A;  1NBF C;  4J6I A;  1U4A A;  2IGG A;  1ZXI A;  4EZK A;  4K7S A;  3ZLZ A;  4I6P A;  5BYR A;  3DHI C;  4YSX B;  3EC8 A;  4XWW A;  3KUC B;  5D6J B;  1WY8 A;  1EM7 A;  2PVG C;  4XDC A;  3V3X A;  5BYQ A;  3DHG C;  2N0S B;  4ANU A;  2DHZ A;  3P4S B;  3ZDM C;  2YEP B;  1E5W A;  4EFO A;  1ACC A;  2JXX A;  3P63 A;  3HHM A;  5G2N A;  1XEE A;  4G0N B;  4K7W A;  3RD2 A;  3U4E G;  2RDH A;  3HM6 X;  5LNK 1;  2DAF A;  3I63 C;  1KTK A;  4S17 A;  2RMM A;  1XO3 A;  1WXQ A;  3RI7 C;  4DQO C;  2I1J A;  2H89 B;  1T0R C;  2J53 A;  3APC A;  1I35 A;  3HIZ A;  1WIA A;  2KJH B;  2NPT B;  2RD0 A;  1T0Y A;  3I9V 1;  2WDR B;  1J7A A;  1P7E A;  1A70 A;  3SFE B;  5D7G A;  3DBR B;  3W5U B;  3RZW C;  1I7H A;  4IKG A;  1L5P A;  2LGX A;  1NYR A;  3TIX A;  1SJE D;  3GB1 A;  2RR9 A;  2KYW A;  1WMH A;  2N9K A;  4A9A A;  3AEE B;  1SE4 A;  3AM9 A;  2KKC A;  2LMC A;  1V1O A;  2C60 A;  1PFD A;  1J7B A;  3W5V B;  1EUV B;  3VUW A;  1NYQ A;  2M19 A;  2K8H A;  3AEA B;  1N61 A;  3V62 A;  2IZV B;  4TKN A;  4BFR A;  5IA7 A;  3QAR A;  4YXD B;  1JWA D;  2KFK B;  2MRP A;  2D3G A;  2KZR A;  1V9J A;  3JW0 X;  3HM3 A;  2KTR B;  4OHJ A;  3BK1 A;  1PQS A;  3Q2A C;  2RPV A;  1RFA A;  3GOE A;  3R2I A;  4KSL C;  3DCG A;  1TS2 A;  2K22 A;  2KWV B;  1CJE A;  2LRW A;  1F9J A;  3WIM A;  3TL5 A;  1D3Z A;  1S3S G;  2M17 A;  3N3K B;  1WM2 A;  2EKI A;  1JW9 D;  4G11 A;  4DXA B;  1N5W A;  4IWP A;  5HHD G;  1FIQ A;  3ZRC A;  1XF5 L;  3PLU A;  4AJW A;  1ZP0 B;  2BQQ A;  1WJ6 A;  3UQA A;  1TY2 A;  1EF1 A;  2M4N A;  1BML C;  1L0Y B;  1RWS A;  4XYC A;  1MHX A;  5JHB A;  3AU5 A;  4GN1 A;  2ZPY A;  4BVU C;  3PZ7 A;  4WIP A;  1KLG D;  4US8 A;  4KGS A;  1WJN A;  4CQN A;  4RGM A;  3UIO B;  3A9J A;  4KIK B;  2J0K A;  2G45 B;  2M0X A;  1FO4 A;  2WDT B;  1G6J A;  1ROE A;  2EEL A;  4A20 A;  2EMS A;  4P1C C;  2KQ4 X;  3AUL A;  4WWP A;  2PEA A;  2OJR A;  3IHP C;  2PVO D;  3N1Z C;  4W9J A;  3V6C B;  3DQV A;  1UBQ A;  2QIL A;  1WZ0 A;  3CWI A;  3AE4 B;  3IT4 B;  3DVG X;  4JPS A;  3AXC A;  3P2B A;  2LAS A;  3ML8 A;  1WRD B;  2ZVN A;  4GB9 A;  3JVZ X;  3QWZ B;  3MFG A;  2YEP F;  2WXH A;  1FPY A;  1OFF A;  3MHS D;  3PGE A;  3GZN B;  1MFW A;  4ZOH C;  5H92 C;  2FID A;  2V9H A;  3ZTC A;  4FHK A;  2DZK A;  4WUR A;  4A3P A;  4LCD E;  5I4D A;  2J0J A;  3AEB B;  2HJ1 A;  4II3 B;  3VTV A;  2BVC A;  1SE2 A;  3AE1 B;  3SD5 A;  5EE9 A;  2FIF A;  3SEB A;  1FNW A;  3W1S A;  4C80 A;  1YD8 U;  2GBK A;  4LDT D;  1WJ4 A;  1SIF A;  2KAN A;  2IDY A;  3V61 A;  3QK0 A;  4XZ4 A;  2L76 A;  1XCT L;  1WGG A;  4WJO A;  2NMQ A;  5IN7 A;  1F2R I;  2AX5 A;  1K50 A;  2NBW B;  3MP9 A;  2VRR B;  3ZIM A;  4E3C A;  1C4C A;  4K1R B;  2HE7 A;  4FLH A;  2V4I B;  4MEM A;  3MJ5 A;  2FCM A;  1B1Z A;  1XXG A;  3A4R A;  4NY0 A;  2LJ5 A;  1N60 A;  5LXH A;  3KWL A;  3I5J C;  1T0Q C;  1E6E B;  1JWB D;  1GC6 A;  3GZN I;  4OZB A;  4IM2 A;  1Z5S B;  4G3X B;  1EWY C;  2C7N B;  1GB4 A;  4ICU A;  1SGH A;  4HRO A;  4HXD A;  4ITK A;  1OEY A;  2JQR B;  3NG0 A;  3O13 A;  1F77 A;  1ZE3 D;  1JCK B;  2D3B A;  2MBE A;  2K8C A;  4HEA 1;  3P4P B;  2VZK B;  4OW0 A;  1JWU D;  4KSK C;  1STE A;  2KTF A;  1VR9 A;  1KRH A;  3HUI A;  3CST A;  3N20 C;  2BS4 B;  1NEK B;  4M0W B;  3U52 E;  3FIL A;  4AP4 C;  3DOW A;  1Q1O A;  3KVF B;  1D6E C;  1SF0 A;  1FD6 A;  4TQ0 A;  3AMZ A;  5BMI A;  1BT0 A;  4GDK A;  1VZ6 A;  2BS3 B;  4WH4 A;  5D94 A;  2KC1 A;  4RCO A;  1QKZ A;  3QX1 A;  4M8N A;  4W9H A;  2L52 A;  1V49 A;  1ZDV A;  4B0E A;  2XN9 C;  4IG7 B;  3AN1 A;  4KKI A;  4EZJ A;  1PGB A;  3VR9 B;  1ESF A;  3WA0 A;  3VRA B;  3WAL A;  3ENE A;  3BYY B;  2DX5 B;  3RNC C;  2AQ1 B;  3R2T A;  2CU3 A;  1J8C A;  4HDO A;  3DBH B;  4C7Z A;  1WXV A;  2KLC A;  4GSW A;  1E7V A;  2FUG 1;  3AEF B;  3Q8F A;  2KJ6 A;  1YX5 B;  4FJV B;  5G5H A;  3W1Y A;  3TEZ A;  4X57 B;  2L00 B;  1N63 A;  3ZKJ C;  4FAD A;  2JX5 A;  2JPH A;  2WXI A;  1TS5 A;  2REX A;  4RMA A;  4N9F 4;  4HDQ A;  3ZJV A;  3NVY A;  2L0T A;  1DOI A;  2I2Y A;  5DCN A;  2RPQ A;  2LUM A;  2WXN A;  2R61 A;  4P1B C;  1C77 A;  3ZXV A;  4P7I A;  2MBO A;  3VTW A;  2AEH A;  4RM9 A;  2WXJ A;  2PKO A;  3ZNH B;  2O2V A;  1E8Z A;  1YQ3 B;  1KF6 B;  2BBC A;  2LZ6 A;  2KN5 A;  1ENF A;  2K8B A;  1E7U A;  4IC7 B;  4MM3 A;  2N9L A;  2RDB C;  5IO9 A;  4XDD A;  2KHW B;  3ZJT A;  2PW9 A;  2LD9 A;  2CJO A;  2BS2 B;  4MT5 A;  2O6V A;  3DBL I;  2GB1 A;  4NAM A;  2W3S A;  2BYE A;  4RGO S;  3Q3N C;  3WAN A;  4F7Z A;  1QT9 A;  1IBX B;  1I4X A;  5DPT A;  1FFU A;  3AE3 B;  2KX0 A;  2MP2 B;  1UGM A;  2KXJ A;  4PK1 A;  4XE0 A;  1UZX B;  2ZNV B;  2KWD A;  1Z2M A;  1L0V B;  1V6E A;  3SU8 X;  3GS2 A;  2QDF A;  4GGQ A;  2LHD A;  2L83 A;  2AYO B;  2YLM A;  2DLB A;  1NEN B;  4ZYN A;  1TJE A;  2G4D B;  4WQM A;  4NAW B;  1R4M B;  1X1M A;  3VH4 B;  3Q14 C;  3Q3J A;  3S2A A;  4BOZ B;  1QOF A;  1I4H A;  5IOI A;  4BBN C;  4RFB A;  1FM0 D;  2K1F A;  1XQQ A;  2CJN A;  4RF0 A;  1WE7 A;  2K6Q A;  4MSM B;  2KDF B;  3M95 A;  1C4P A;  3DWM A;  2WYQ A;  5FK9 C;  1TGZ B;  4W9F A;  2ONQ A;  4E74 A;  1P98 A;  3SDL C;  3A9K B;  2C5L C;  2D3A A;  1FXI A;  1K53 A;  3RYT A;  2N4F A;  4IOI E;  4HRS A;  1QOA A;  2DZM A;  4YTM B;  1WFY A;  4YTP B;  3DVG Y;  4REZ A;  2VH1 A;  3SR6 A;  2NR2 A;  1R4M I;  2XK5 A;  4TQ1 A;  1XLQ A;  4ZYS A;  1YMH E;  2BT6 A;  2D3C A;  4W9K A;  4ACF A;  2PPH A;  1KLV A;  2JY6 A;  4K3C A;  1NI2 A;  3HK0 A;  1P3Q U;  1WI0 A;  3M63 B;  4KV2 A;  5J18 A;  4LJO B;  3KW5 B;  3P42 A;  4EUT A;  2CHX A;  2HD5 B;  3NZU A;  2IND C;  2V1Y A;  4R3D A;  1NDD A;  4DWF A;  4HPL B;  4A55 A;  1VZ7 A;  1WR6 E;  2GRI A;  5JZE B;  2V3P A;  2KDE B;  3B2G A;  3OJ3 A;  5JH5 C;  4ARI A;  1WF9 A;  2GBJ A;  3UGB B;  1YNT E;  3RMK C;  4PS7 A;  1HE8 A;  1OTR B;  1V81 A;  3LXF A;  2IY1 B;  1C78 A;  2KOX A;  3T3O A;  1GC7 A;  2LGS A;  1FXA A;  3ZGZ A;  2A4Z A;  1MG8 A;  4A3O A;  3L16 A;  4B9K A;  3MJW A;  3OLM D;  3NZ3 A;  1FNU A;  4EE2 A;  2ASQ A;  4LNK A;  3KYD D;  1V97 A;  2INP E;  4JWU C;  2G3Q B;  2BWE S;  1VRA B;  2ZVO A;  1P9D U;  5IKC M;  4GIV A;  1N62 A;  3FKY A;  3DWG C;  1EU3 A;  2KK8 A;  2ON8 A;  5EE0 A;  4F1S A;  2FBW B;  1T6B X;  3U8Z A;  2LGI A;  4NJC A;  2CKH B;  1GAQ B;  1TIF A;  1E10 A;  4IWQ A;  2KMA A;  3BVM A;  3A4S C;  1LO5 D;  4BAX A;  2J0M A;  4C4V A;  2W3R A;  3H6N A;  3IAS 1;  5KHQ A;  1DGJ A;  3L4P A;  2BKF A;  3H8H A;  3Q3F A;  1AWD A;  2N1V A;  5CHF A;  4HCN B;  1TBE A;  4QAY A;  3LJ3 A;  2N7J A;  3C0R B;  3DBR I;  4OVZ A;  4RH6 A;  1YIW A;  4G50 A;  2KLG A;  3PPA A;  4JQW C;  2N9X A;  2SAK A;  2DZJ A;  4IW0 A;  2KDM A;  1JRO A;  2YVC A;  1IYF A;  1Q5W B;  1IPG A;  2CHW A;  1KLU D;  2JRI B;  2K9X A;  4MGY E;  3DVN U;  4HPM B;  2MBH A;  3VTU A;  2FNJ B;  1I4R A;  3KLS X;  2OOB B;  2N7E A;  1F52 A;  3H7P A;  3R7R A;  4XGA B;  4LNI A;  3TEY A;  3Q8E A;  1HA5 A;  1Y56 A;  2K25 A;  1YN5 A;  4PYU A;  3OAW A;  1V1P A;  5JXV A;  4TV3 A;  3ZRF A;  3RZF A;  1C3T A;  3NZS A;  4NJ7 A;  2I38 A;  4F8C B;  4JIO U;  3TBL D;  2M56 B;  2HTM E;  2LVO A;  1HEZ E;  2IGH A;  4A90 A;  1A5R A;  3E9S A;  3RNB C;  3NJT A;  2LXC A;  4GDK B;  4GXB A; 
#chains in the Genus database with same CATH homology
 2Y5P A;  1C9F A;  4HJG E;  3Q69 A;  2JQR B;  3O13 A;  1F77 A;  1ZE3 D;  4MH8 A;  2B76 B;  3BK2 A;  4LK0 M;  1JCK B;  4LLG M;  4YSY B;  4DXF A;  4ZHP A;  4HEA 1;  3P4P B;  4TSS A;  1C4A A;  2VZK B;  4B0M A;  1P7F A;  4OW0 A;  2BW2 A;  1VZ8 A;  1QOG A;  1JWU D;  3AE2 B;  2NTT A;  5BMG A;  1STE A;  5EE3 A;  2ZW0 A;  1VR9 A;  1KRH A;  3HUI A;  1M4V A;  4D2K A;  2W82 A;  1QF6 A;  2BS4 B;  1D4B A;  1NEK B;  4WAF A;  1I4Q A;  3U52 E;  2K5P A;  2W54 A;  3U7Z A;  1DYQ A;  1EWC A;  1UNS A;  3W2D A;  3FIL A;  2PMV A;  3UI3 A;  1IGD A;  3TEX A;  1VLB A;  5T8I A;  1OQQ A;  4A6Q A;  1D6E C;  3ZQ4 A;  4J3O D;  1SF0 A;  1FD6 A;  4TQ0 A;  3AMZ A;  2L32 A;  5BMI A;  2RDG A;  4XWT A;  3TEW A;  3MC0 B;  1FEH A;  3VRB B;  4RGT A;  1VZ6 A;  2BS3 B;  3NVV A;  4WH4 A;  2X38 A;  4RCO A;  1QKZ A;  4P6V F;  1HXY D;  1UGJ A;  2L52 A;  1ZDV A;  4B0E A;  1I4G A;  2XN9 C;  3AN1 A;  1JRP A;  4KKI A;  1XLN A;  1PGB A;  3VR9 B;  3RFZ B;  1SSN A;  1ESF A;  1UUP A;  3AE6 B;  1BXT A;  1HZ5 A;  2INN E;  1WRI A;  5D3I B;  3VRA B;  3T3N A;  4GDL B;  3BYY B;  1IBX A;  2AQ3 B;  3NS1 A;  1ZXH A;  3AEG B;  1EU4 A;  2AQ1 B;  3R2T A;  2CU3 A;  1J7C A;  2LJI A;  2L1A A;  2Q5W D;  1ZDX A;  4C7Z A;  1FCC C;  1YN3 A;  1MI0 A;  3LB8 C;  1SBB B;  1TY0 A;  2SEB D;  1K51 A;  4KGR A;  3ZYY X;  4JX1 C;  2FUG 1;  3VR8 B;  3AEF B;  3Q8F A;  5AUI A;  5GXG B;  1D5X C;  1V1P B;  2OED A;  3BYT B;  4L1B A;  2E3T A;  1KFY B;  1RFK A;  5G5H A;  3CIR B;  3TEZ A;  2QIE B;  3BWU D;  1QQR A;  1QIL A;  1N63 A;  1TKY A;  3GP7 A;  4OZA A;  2JX5 A;  3Q8C A;  3BZD B;  2WXI A;  4ZRP A;  1PDX A;  1QLB B;  2ICI A;  1TS5 A;  3AV8 A;  4YT0 B;  4JE3 B;  3N9Y C;  3KQ4 A;  2WXG A;  3ZJV A;  1CK1 A;  3EA6 A;  3NVY A;  2DWQ A;  2MJD A;  1DOI A;  1K52 A;  5G5G A;  2I2Y A;  3AE7 B;  2KN4 A;  2LUM A;  2WXN A;  1ET9 A;  4MAC A;  2R61 A;  3ZJU A;  1C77 A;  4GLS C;  1E7P B;  4Q2J A;  1GB1 A;  1DOX A;  4YWG G;  1F2R C;  1YJI A;  2WXJ A;  2WXM A;  2PKO A;  1AW7 A;  5C3J B;  2W55 A;  3EGR A;  1FMA D;  2WXL A;  3B9J A;  2IGG A;  1ZXI A;  3AED B;  3FIL B;  1YQ3 B;  1KF6 B;  2BBC A;  1RM6 C;  5BYR A;  1ENF A;  3AB5 A;  2BB5 A;  4YSX B;  2JXT A;  1T5X D;  4XWW A;  1XLO A;  2N9L A;  1EM7 A;  2PVG C;  4XDC A;  1L4Z B;  3V3X A;  5BYQ A;  2KMM A;  2N0S B;  2JSV X;  4XDD A;  1RYJ A;  1AYF A;  2NTS A;  3ZJT A;  2PW9 A;  2CJO A;  2WXF A;  1C79 A;  4YTN B;  2BS2 B;  2KAC A;  4KGT A;  4MT5 A;  3P4S B;  2Y5C A;  2GB1 A;  2LHE A;  4NAM A;  3W9C B;  4ZHO A;  2W3S A;  2YEP B;  1GPX A;  3NVW A;  3V05 A;  3AE9 B;  1ACC A;  4RGO S;  2GI9 A;  3P63 A;  4N6E B;  1QT9 A;  2OHF A;  1XEE A;  1IBX B;  1I4X A;  1FFU A;  3AE3 B;  3U4E G;  2RDH A;  1R7S A;  5LNK 1;  4XE0 A;  1KTK A;  2JYE A;  3IT6 B;  2RMM A;  3BII D;  5MPO A;  4A8X C;  1XO3 A;  1WXQ A;  2KWD A;  4DQO C;  2H89 B;  2ZW1 A;  1HZ6 A;  2J53 A;  3B2F A;  4PT5 A;  1L0V B;  4HKZ E;  3GS2 A;  2JYT A;  4L2Y A;  3NVZ A;  2LHD A;  3I9V 1;  2L83 A;  2WDR B;  1J7A A;  1P7E A;  1A70 A;  1TYG B;  1IUE A;  2DLB A;  3FC4 A;  3SFE B;  5D7G A;  1NEN B;  1E0Z A;  1TJE A;  4WQM A;  3W5U B;  3FAH A;  4NAW B;  1SJH D;  2LEK A;  1I7H A;  3AE8 B;  4IKG A;  1L5P A;  1D5Z C;  1NYR A;  1YJJ A;  1QOF A;  1I4H A;  1SJE D;  3AEC B;  3GB1 A;  1XCQ L;  2H88 B;  2PTL A;  4RFB A;  2DYO A;  1FM0 D;  1IGC A;  4N59 A;  1FFV A;  1T3Q A;  2N9K A;  4A9A A;  2BYT A;  2JWU A;  3AEE B;  1SE4 A;  5EE1 A;  2CJN A;  4RF0 A;  3AM9 A;  1C4P A;  3DWM A;  1AN8 A;  2LMC A;  1VDV A;  1V1O A;  1PFD A;  1J7B A;  1WYG A;  5FK9 C;  3W5V B;  5AUK A;  1UWX A;  1PYW D;  3IAM 1;  1SEB D;  2ONQ A;  3Q8B A;  1L4D B;  1NYQ A;  2M19 A;  3AEA B;  5E6J A;  1N61 A;  1FXI A;  1K53 A;  1JWS D;  5C2T B;  4IOI E;  1JQ4 A;  4YXD B;  4HRS A;  1QOA A;  1UWM A;  4OZC A;  1JWA D;  1V8C A;  4MM3 B;  5HI1 A;  2QSD A;  4YTM B;  4YTP B;  3U2S C;  4REZ A;  3IXS A;  3ABV B;  2MJ3 A;  1BUI C;  3OWE B;  4OHJ A;  3BK1 A;  3HVD A;  3SR6 A;  1L6V A;  1XLP A;  2RPV A;  2QJL A;  2Z8L A;  3R2I A;  4TQ1 A;  1XLQ A;  2MJE A;  4ZYS A;  1TS2 A;  1YMH E;  2BT6 A;  2K22 A;  3PZ8 A;  1CJE A;  2IGD A;  1B9R A;  5FR3 A;  1MPE A;  1F0Z A;  2WP9 B;  1MHH E;  2IJ0 A;  1I4P A;  2JU6 X;  1JAL A;  2V3N A;  3P4R B;  2KAJ A;  2WXO A;  3P42 A;  1C76 A;  5BMH A;  2J4X A;  2EKI A;  5D3D A;  2G9H D;  2QEJ C;  2WQY B;  1QOB A;  1DOY A;  1FNV A;  1JW9 D;  3BVZ A;  1N5W A;  1Q10 A;  3P4Q B;  5HHD G;  1FIQ A;  4R3D A;  3C8Y A;  1XF5 L;  4O1N A;  1WSP A;  3TUO A;  4A55 A;  2ACZ B;  1VZ7 A;  5HFY A;  1ZP0 B;  1ZPS A;  2GRI A;  2V3P A;  3B2G A;  4HKQ A;  3J9C A;  4ARI A;  2E6X A;  1TY2 A;  2MEK A;  4P16 A;  1YNT E;  4KKJ A;  2WXK A;  2WLB A;  2QMT A;  1BML C;  1L0Y B;  1RWS A;  3P1M A;  3LXF A;  1MHX A;  4ZRQ A;  1SB3 C;  1C78 A;  4AQ7 A;  5HG2 A;  3T3O A;  4RF1 A;  5BYS A;  1FXA A;  3E56 A;  3PZ7 A;  3ZGZ A;  4WIP A;  1KLG D;  2WDV B;  4US8 A;  4KGS A;  2WXR A;  4CQN A;  5H8Y E;  4RGM A;  2PLP A;  3NZ3 A;  3PO0 A;  3Q8A A;  2D5G A;  1FNU A;  1ZOY B;  2TSS A;  4EE2 A;  4N58 A;  1WWT A;  2WU2 B;  1NI3 A;  1FO4 A;  1ROE A;  2EEL A;  1YQ4 B;  1V97 A;  2INP E;  4JWU C;  1CZP A;  3SFD B;  1VRA B;  1FRD A;  2KQ4 X;  1N62 A;  2WDQ B;  4NZL B;  4USA A;  1YN4 A;  1CQV A;  3DWG C;  2XNA C;  3R8B A;  1EU3 A;  2FE8 A;  2ON8 A;  2PVO D;  5EE0 A;  2FBW B;  2BB6 A;  5TSS A;  1T6B X;  1JML A;  4KX6 B;  2LGI A;  1SXT A;  2MH7 A;  4YSZ B;  2QIL A;  4NJC A;  3CWI A;  4ARC A;  3AE4 B;  1GAQ B;  1ZUD 2;  3IT4 B;  1E10 A;  4JPS A;  1N5X A;  2J52 A;  2AQ2 B;  2Y3A A;  3BVM A;  3WCQ A;  1KH0 A;  1LO5 D;  4TMA B;  1OQR A;  4C7Y A;  3MFG A;  1L6U A;  2VZK D;  2W3R A;  2YEP F;  3IAS 1;  2WXH A;  1PUT A;  4H2A A;  4C56 C;  1OFF A;  1SIJ A;  1HQR D;  1DGJ A;  1L0X B;  3L4P A;  3URY A;  2BTE A;  2V0G A;  5FKA C;  2WNM A;  3H8H A;  4M0W A;  1D5M C;  4ZOH C;  5H92 C;  3TSS A;  1AWD A;  1TKE A;  3KWV A;  1VJK A;  1TS3 A;  2K0P A;  4WUR A;  5I4D A;  3AEB B;  2N7J A;  3NUH B;  4L23 A;  4OVZ A;  2WXQ A;  2WXP A;  4RH6 A;  1ET6 A;  3RPF C;  4IDI A;  1SE2 A;  3AE1 B;  2K3U A;  1GOZ A;  2LFI A;  5EE9 A;  3MHZ A;  3SEB A;  1FNW A;  3W1S A;  1FRR A;  4LTU A;  4C80 A;  3EUB 2;  3VQI A;  1PGX A;  1WGK A;  4DXG A;  2SAK A;  2IDY A;  2KDM A;  1XCT L;  1JRO A;  2G1E A;  4RGN A;  3AH7 A;  3ETR A;  2NMQ A;  3AE5 B;  1E9M A;  1F2R I;  2AX5 A;  4AS1 A;  1K50 A;  3MP9 A;  1KLU D;  2K9X A;  2HDE A;  1I4R A;  3KLS X;  1JWM D;  2J42 A;  1C4C A;  1NVI D;  4UDU C;  2V4I B;  3TEY A;  3Q8E A;  1PGA A;  1HA5 A;  3MJ5 A;  4JWS C;  2WU5 B;  1B1Z A;  1XXG A;  1Y56 A;  1YN5 A;  3LYY A;  1MVK A;  1V1P A;  3HVZ A;  1N60 A;  5JXV A;  2IPK D;  3KWL A;  2M0A A;  1TZO A;  1E6E B;  1JWB D;  2PIA A;  4FXC A;  3I57 A;  1TKG A;  2DYM A;  2I38 A;  4OZB A;  1TS4 A;  2M56 B;  2HTM E;  1FCL A;  1HEZ E;  1EWY C;  2IGH A;  3HRD D;  4US9 A;  4A90 A;  3BVG A;  3E9S A;  2JZP A;  2WS3 B;  4RNA A;  1GB4 A;  2DBY A;  4GDK B;  4HRO A;  3NRZ A;  4WWM A;  4ITK A;  1SE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...