4WJNA

Crystal structure of sumo1 in complex with phosphorylated pml
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
EGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/signaling protein
molecule keywords Small ubiquitin-related modifier 1
publication title Structural and Functional Characterization of the Phosphorylation-Dependent Interaction between PML and SUMO1.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4wjnA00
4FJVB 1YX6B 1V49A 2Z0EB 5TR5A 3DBLI 1M94A 1IYFA 2N4FA 2MP2A 4ZRKA 4ZRIA 2I1KA 3A9JB 3WA0A 1ZW7A 5JZEB 1OEYA 2KKCA 4ANXA 3UIOB 1V9JA 3HHMA 4IUMB 4TQ0A 1WJUA 4BBNF 3N30A 5CX3A 4FJZA 1LXDA 2ZVOA 3PVLA 4GDLA 5HKHA 2KLCA 2L0TA 2KTRA 2KDFB 4JLCA 1NBFC 1WGYA 1GNUA 2D3GA 3QA8A 4IC7B 2G4DB 2JUOA 1LM8B 4WWOA 2M17A 3QQ8B 2KX3A 4PS8A 3RT3B 5JHBA 3DDCB 3DCGA 1ZGUB 4X57B 5JH5C 4MJSB 3RYTA 3QX1A 5G2NA 2JVCA 3OAWA 2REXA 4BKSA 1EUVB 4J6IA 1WE7A 2C7MB 3TJPA 3QJZA 3AULA 2LVQA 3ZKJC 1KM7A 5JHAA 5E6NA 3OJ3A 4IWOA 2ASQA 3RZWC 1WGRA 2OOBB 1WGGA 2EMTA 3ECIA 4ANUA 3L17A 3V6EB 1VCBA 2K39A 2ZNVC 1UBIA 2DYOA 4HDQA 2M8SA 1WX8A 4ZDVA 2CHWA 4LDTD 4JGHB 2Y5BB 4ASWC 2VRRB 2GBNA 4W9EA 1WXAA 4BBNC 3B1LX 2BF8B 3U30A 3KYCD 4E3CA 2IO1B 3AI5A 3W1SC 3HM6X 3M62B 2K25A 3SHQA 3VHTC 2NBVB 5LLIA 3DVNU 3A1QA 2N1WA 3L0WB 4I6NB 4OVUA 2KN5A 1UH6A 2LGXA 5E6PA 1PQSA 4F1SA 3WANA 4HWIB 3VQIA 3PHWB 4A3OA 1V5TA 2N9PC 3VDZA 5D2MB 1RFAA 4HCNB 1P98A 3AU5A 2DZIA 1WMHA 2GMIC 2PPHA 3DVGY 1IP9A 5DPSA 2JRIB 3QARA 4XX5A 2L8JA 3PGEA 4WJQA 4WJNA 1GC7A 4EUTA 1KJTA 4MGKE 3TIXA 3UGBB 4LCDE 2LVOA 2BYEA 3PV1A 2LRWA 4KIKB 2MBBB 4HJKA 4NJ7A 5C1ZA 2G45B 2UYZB 1G6JA 2MLBA 4KDLB 2GBJA 2PE9A 3QWZB 4W9JA 3RZFA 4AWJA 2KLGA 4GB9A 4FADA 3KVFB 2C5LC 2EKEC 1XQQA 2N9EB 4MEMA 2CHZA 2EMSA 3H9DA 3L10B 4LJOB 4HCPB 3JYUA 3T9LA 4DHJB 3PT2B 1K8RB 1ZKHA 2RD0A 3ZDTA 2K8BA 1WXVA 4F8CB 4BOSC 1UELA 1SIFA 4FJYA 3S2AA 1LFDA 2KNBA 2LVPA 1AARA 3ZRFA 2FCNA 2WWZA 3CF6E 2J0MA 2RSUA 4NQLB 2O2VA 1WH3A 3U7DA 4W9DA 1GJZA 1UGMA 1TGZB 1WMHB 2DZKA 2IZVB 2N7EA 1WJ6A 4I6LB 3VH3B 1VD2A 5G55A 3VTWA 3VTVA 4MDKE 4MGIE 4XC2A 4HPLB 3APFA 2BKRB 4MELA 1A5RA 1F9JA 4K1RB 3OJ4B 5AZGA 5CHWA 4URKA 4JL9A 4II2B 4PS3A 4LDTB 3SD5A 1H8CA 1KOTA 3NY5A 4MM3A 3ZNHB 3QIJA 4KZCA 1V6EA 4W9HA 2O6VD 3WAMA 4GGQA 1WI0A 2KWVB 1V81A 2MW5A 5AZFA 1WX7A 5J18A 1FXTB 3W1SA 4BOZB 3UIPB 3JW0X 4CO7A 4F7ZA 4LJPB 2KANA 1NI2A 3VXWA 5AEKB 3ZNZB 3R3MA 4HLEA 3IFWB 3CMMB 1RAXA 2MRPA 2KOXA 4BKSD 4DBGA 3IVFA 4FLHA 2NBWB 4K7SA 3PRMB 2B3AA 2JT4B 3Q3FA 4YL8A 3R7QA 3JSVA 1YD8U 2AEHA 3A4SC 2DYBA 3L13A 3ZNGC 2J0KA 3V6CB 4WAAA 3ZTCA 4ICUA 4CYEA 3RUIB 2KQSA 3IHPC 1WX9A 2IY0B 3DVNV 3HK0A 4GDKB 2KFKA 2D11A 4HVBA 5EDSA 2GBRA 1EO6A 1T0YA 2L00B 4HDOA 2MBQA 3TMPB 4MSMB 2K6DB 2FIFA 3X0WA 2XEWA 2O6VA 1ISNA 4NAWA 5C23A 1E90A 4G0NB 1C1YB 1UD7A 4I6PA 1OEYJ 4DHZB 4FBJB 5L95C 4B9KA 2J7QB 2C7NB 4HXDA 3EC8A 3KUZA 3ONSA 3ZO5B 4IW0A 2Z0DB 3RD2A 1YQBA 1WR1A 2PE6B 3DPDA 2XK5A 3ML9A 3I3TB 1UZXB 4FULA 4TQ1A 3N32A 2LGYA 1P0RA 2MP2B 2N7DA 2K6QA 2WYQA 3VH4B 2M0XA 2KQ7A 2ZVNA 4E74A 2AL6A 2JY6A 4KSLC 2NR2A 3T8MA 3AU4A 3ENEA 2GBMA 3C0RB 3P2BA 4E71A 3PRPB 2MA9B 2N1VA 2NS5A 1WM3A 2A4ZA 2BGFA 4BKTA 2NPTA 5E6OA 2MBEA 2IY1B 2JWZA 1P9DU 2L76A 3W1YA 2MBHA 3CSFA 4GDLB 4RM8A 3WALA 4EKUA 1WR6E 2AYOB 2KTRB 2ZPNA 2LXAA 2NCNA 1LQBA 4W9CA 2XBBC 3WAPA 3AXCA 2G3QB 3NOBA 4NAWB 4NJ6A 3PZDA 2M1MA 4GN1A 5L83A 3M95A 2FNJB 3WAOA 4AJWA 2IO0B 3IG3A 5KHQA 4WWNA 3ZIMA 2JPHA 2MX2A 2XK5B 3K9PB 3HIZA 1GUAB 4AJYB 2C9WB 1Q1OA 3KUDB 4GXBA 2G4SA 4II3B 2W9NA 3PTFC 2KJHB 5J2RA 2N9XA 1WE6A 3UF8A 2KX0A 1XD3B 4HPMB 2D10A 3ZTDA 3VUXA 1TTNA 4MGZE 5D6JB 2AL3A 3TCAA 2HD5B 4PYUA 5KHOA 2L3ZA 3N3KB 2V1YA 2DAFA 2KDEB 4MGYE 1TBEA 3A1QB 2YVCA 5GMVA 2HTHA 4OVVA 4NNJB 1IPGA 2FAZA 4KDIC 2RGFA 2J0JA 5LXIB 1V5OA 1E8ZA 2KO3A 3A9KA 2I1JA 4EZJA 4W9IA 4B95A 3O65B 5J17A 3SDLC 1WIAA 3VUWA 2IO2B 4EFOA 2LRUA 3PLUA 4IM2A 2IBIB 3QK0A 2JRHA 3GOEA 4WWPA 3DBRI 2AWTA 3UQAA 2CR5A 2JZZA 4EOYA 3RCZA 1J8CA 2KVRA 1EF5A 4M8MA 1R4MI 2CKHB 1OGWA 4W9FA 3NHEB 1Q5WB 3ALBA 2DAJA 5D7GA 3UINB 3NS8A 2L0FA 3H1UA 1KLVA 3R7RA 2GBKA 2NBUA 2KJ6A 1Q0WB 2BWES 4TV3A 1WJNA 2A5UA 1WM2A 2D2QA 3VVWB 3DBHI 4JIOU 2L7RA 4K81A 4BKGA 3A9JA 3V60A 4KV2A 4DDGD 3IBEA 1WGHA 2KMAA 3MTNB 2DYMA 1WY8A 2D07B 2KXJA 2WX0A 1Y8RC 2FIDA 2CHXA 1UBQA 3KH0A 1RRBA 1U4AA 2HE7A 2V4LA 3VFKA 3L08A 3B0AA 1MG8A 4G3XB 2LUEA 2Z59B 1WXSA 1S3SG 2K8HA 2CS4A 2GOWA 2O2VB 1V2YA 2KDBA 1J19A 3ZLZA 1YJ1A 2FUHB 4KSKC 5IA7A 1XT9B 3PSEB 2K8CA 2V3SA 3DBSA 4AUQC 4AOFA 2YLMA 1C3TA 3DVGX 1E8XA 2JZ3B 2KWUB 1E7VA 2FCQA 2RR9A 3L54A 4MJSA 4IG7B 3BINA 2ZNVB 4BFRA 4DK5A 2KC1A 1V86A 2LD9A 3ZUNA 3LJ3A 2IO3B 4HK2A 1P1AA 4JQWC 3ZNID 2IYDB 1HE8A 4IWQA 2KFJA 3DQVA 4K7UA 1WZ3A 4RM9A 3TL5A 4TUUA 4PS7A 1I42A 1CMXB 4K7WA 3R66C 4ZRJA 4M0WB 5DPWA 2KJRA 5LXHA 3JSVB 3A4RA 3K9OB 5DPRA 4W9KA 4NQKE 2BPSA 2ZCBA 1WRDB 3JVZX 4GIVA 1YX5B 3WIMA 4DHJD 2R2QA 2KD0A 3RULA 1QZEA 2K1FA 1P3QU 2L05A 3H6NA 2ZEQA 3APDA 5DCNA 3EFUA 3LDZE 2MCNB 3ZW3A 2QHOA 3D32A 2KFKB 2LASA 1E7UA 2KTFA 2C60A 1WZ0A 2CU1A 2OJRA 4CHKA 4A20A 1WYWB 1X1MA 3VTUA 4GOCA 5DPTA 4NPNA 4FA6A 4XZ4A 2O6VB 4AP4C 3QHTA 4ICVA 3CSTA 2BYVE 3U8ZA 3ZDMC 3KUCB 3TBLD 4M8NA 4W9LA 1R4NI 2LJ5A 2C7HA 2ZPYA 1NDDA 3QAQA 2PEAA 4FHJA 4KIKA 2KZRA 5BO4B 2MWSB 1L7YA 3MJWA 3VAWA 2KK8A 2BWFA 2HJ8A 1E8WA 1YIWA 4FN2A 2JF5A 4FHKA 4NY0A 2NVUI 2PJHA 4W9GA 3MHSD 4P7IA 5CTRC 4EZKA 1WFYA 4WJOA 3EECA 5CHVC 3UQBA 4DXAB 3X23A 2NPTB 2LWPA 2BYFA 2ZCCA 1J0GA 1Z2MA 5FR6A 3BY4B 1GC6A 2R2OA 4ZYNA 3M3JA 3SU8X 2DENB 4DHZE 5AZHA 1H4RA 1Z5SB 4EZLA 4IWPA 2M4NA 2KMCA 1TZ1A 3PPAA 2LI5A 4EEWA 1V80A 1BT0A 1SGHA 3H7PA 1OQYA 1WXMA 3KYDD 3NZUA 2UWQA 3OLMD 2RPQA 1OTRB 2MSED 1GG3A 3ML8A 2FCSA 1WF9A 4GMVA 3B08A 4N9F4 1WJ4A 4WJPA 4GU2A 5IAAC 2DHZA 3H7SA 3QCAA 2KC2A 3EHVA 3PRZA 2ZZPB 3QC8B 3GZNI 2DZMA 2MQJA 2LXCA 3APCA 2FCMA 2BKFA 4DWFA 3HM3A 4GSWA 4IM0A 2LZ6A 1SE9A 4A3PA 2DX5B 3ZRCA 1WGDA 3PREA 3PS6A 1S1QB 4ANVA 2KHWB 4KZ0A 4PYZA 4TKNA 3PHXB 4ANWA 1E8YA 4WQOB 1RLFA 3ZVVA 5CHFA 3VUYA 3H7PB 3V62A 1D3ZA 2DZJA 3A9KB 2LGDA 4MH0E 2WDTB 4B6WA 1EF1A 4GDKA 2KWCA 2MBOA 3Q3JA 3V61A 2KDIA 4G50A 3DOWA 4BVUC 2JXXA 5D94A 3KW5B 3L16A 4G11A 4KVGB 4RMAA 3M63B 4IM3A 2ZJDA 4MSQB 3PLVA 3A33B 2WX1A 1L2NA 1E5WA 3NZSA 1JRUA 4DDID 1I35A
chains in the Genus database with same CATH superfamily
4QAYA 1YX6B 1M94A 1P7EA 4ZRKA 2KKCA 3HHMA 4IUMB 4BBNF 4N59A 1LXDA 4GDLA 3C8YA 1NBFC 1WGYA 2D3GA 3QA8A 4YWGG 2M17A 2G1EA 3QQ8B 3RT3B 2IDYA 4MJSB 2RDGA 3RYTA 2WP9B 1EUVB 2BBCA 1UGJA 3TJPA 3AULA 3N1YC 2LVQA 3ZKJC 1N6ZA 3OJ3A 2ASQA 4WQMA 2DYOA 1WX8A 1XLPA 2K3UA 3B1LX 3KYCD 4E3CA 3AI5A 2JX5A 5IO9A 5LLIA 4XDCA 2N1WA 1EWYC 4I6NB 4OVUA 3Q3OC 5IP4D 1PQSA 1I4XA 3PHWB 1V5TA 3VRBB 3EFCA 3VR8B 1FNUA 2DZIA 2GMIC 2PPHA 1IP9A 3QARA 4WJQA 1GC7A 2V4IB 2LVOA 3LB8C 5D3IB 3BYYB 2G45B 2UYZB 2PVGC 3QWZB 2KLGA 4ARIA 4FADA 1XQQA 3RI7C 4TSSA 4DHJB 1K8RB 3ZDTA 4M01A 1UELA 4JWSC 3S2AA 2LVPA 2FCNA 2J0MA 3FKYA 4NQLB 3U7DA 2H88B 4W9DA 1E6EB 3TEXA 1WMHB 3VH3B 2BS3B 4GLSC 4REZA 1FIQA 2Z8LA 3VTVA 4XC2A 1F9JA 4JPSA 3V3XA 4LDTB 3AB5A 3SD5A 4ARCA 3RN9C 2KMMA 4O1NA 4MM3A 3ZNHB 3PO0A 1V6EA 2KAJA 3I63C 1V81A 1WX7A 5J18A 4BOZB 3UIPB 3JW0X 1FO4A 1V97A 1FMAD 3R3MA 1QOBA 1VLBA 2WXHA 3TSSA 4M0WA 1C78A 3ZJVA 2J0KA 2K5PA 1OQQA 2KQSA 2D11A 4HVBA 3V05A 1EO6A 1HTOA 4HDOA 2MBQA 2K6DB 3X0WA 2I2YA 3CWIA 5C23A 4DHZB 1MPEA 1UD7A 3Q2AC 1D5ZC 4IW0A 3RD2A 1F77A 4FULA 1UZXB 3P4PB 2LGYA 2MP2B 2N7DA 4JX1C 2KQ7A 1QOGA 4S17A 1LGRA 3P2BA 3PRPB 2DBYA 2NS5A 4BKTA 1WM3A 2J42A 2IY1B 4C80A 2L76A 2MBHA 4RM8A 3WALA 1N60A 2KTRB 2ZPNA 1J7AA 2NCNA 3O13A 3AXCA 1ZDXA 3W5VB 3Q6BA 4NAWB 4NJ6A 1IGDA 4GN1A 2KN4A 3WAOA 1B1ZA 2XK5B 1GUAB 2C9WB 4UDUC 5J2RA 2N9XA 2KYWA 1WE6A 1XD3B 2OEDA 3ZTDA 3BK1A 3VUXA 2VH2A 1K53A 1GAQB 2BS4B 4PYUA 1I4GA 4MGYE 1L6VA 2LGIA 1BMLC 1IBXA 1EU3A 5G5HA 1T3QA 5LXIB 1E8ZA 3O65B 1WIAA 3AE1B 2IO2B 4EFOA 2L52A 3PLUA 3QK0A 2AWTA 2CR5A 4LNOA 1R4MI 3ALBA 2DAJA 3NS8A 3SEBA 3R7RA 2KJ6A 3C19A 2D2QA 3VVWB 2L7RA 4BKGA 2LUMA 3A9JA 3V60A 4DDGD 3IBEA 3MTNB 5AUIA 2D07B 2FIDA 1UBQA 2KDMA 1RRBA 2V4LA 1FEHA 3B0AA 2LUEA 2O2VB 1N5WA 3ZLZA 1YJ1A 1QT9A 2LGSA 4HRSA 3MFGA 2KT7A 1C3TA 1E8XA 2JZ3B 4KGTA 1CJEA 4RF1A 1V86A 2IO3B 4JQWC 2IYDB 1D5MC 4IWQA 3DQVA 2QEJC 1UWMA 3E9SA 4TUUA 1I42A 2Q5WD 4ZRJA 5DPWA 2KJRA 3JSVB 5DPRA 1CK1A 3BK2A 4NQKE 2BPSA 4GIVA 1YN5A 1SXTA 1V1PB 1P3QU 3H6NA 3ZW3A 2LASA 2INNE 3P1MA 4P1BC 2WU5B 4XE0A 4CHKA 4A20A 1WYWB 1X1MA 4FA6A 3LXFA 2O6VB 2IGDA 3CSTA 3U8ZA 1ZDVA 2H89B 3KUCB 3TBLD 1FNVA 3WA0A 3ZO5B 2C7HA 4KIKA 3VAWA 2JF5A 2NMQA 3AEBB 4XDDA 1CQVA 4WJOA 3UQBA 2ZCCA 1J0GA 1TY0A 5FR6A 4OZBA 2Y5PA 4ZYNA 3SU8X 4ZHPA 1V80A 1A70A 1SGHA 1OQYA 1WXMA 3NZUA 3OLMD 2RPQA 1ZP0B 2AQ2B 5GXGB 4GU2A 5IAAC 1TS5A 1XLOA 1NENB 3GZNI 3N9YC 3APCA 1BUIC 4YSXB 5FK9C 2M0AA 4MT5A 4USAA 3J9CA 1WGDA 1S1QB 4TKNA 2WU2B 3NZ3A 2RMMA 1C4CA 2IGGA 4MH0E 2WDTB 3B9JA 2Y5CA 1EF1A 3Q3JA 5EE9A 2KDIA 4G50A 4BVUC 3L16A 4RMAA 3M63B 1C9FA 1E5WA 3NZSA 1JRUA 2FE8A 4DDID 1QILA 2WXIA 4FJVB 4OZCA 2CJOA 1V49A 1ZOYB 1E10A 3DBLI 1RM6C 4XYCA 2I1KA 1ZW7A 5JZEB 1OEYA 2G9HD 2N9LA 5CX3A 3T3NA 4N58A 2WDRB 3PVLA 4OHJA 2KLCA 4L1BA 2V3PA 3P42A 1VR9A 2KX3A 5JH5C 5G2NA 2JVCA 3TEWA 2REXA 4J6IA 1HA5A 4ZYSA 4KKJA 4IWOA 4CQNA 2EMTA 2I38A 2VH1A 1VCBA 1UBIA 2VZKD 2CHWA 2Y5BB 4W9EA 1WXAA 3Q3MC 2BF8B 3U30A 2IO1B 3HM6X 2K25A 4ZRQA 3VHTC 2NBVB 3DVNU 2MJEA 1N61A 3L0WB 3Q8FA 4HWIB 4A3OA 5D2MB 4HCNB 3AU5A 1ZXIA 1C4PA 2JRIB 3PGEA 2X8XX 4MGKE 3UGBB 3PV1A 3RNCC 5IKCM 3AE9B 2MLBA 4KDLB 2GBJA 4C56C 4GB9A 3KVFB 2EKEC 3NRZA 2N9EB 2W54A 3H9DA 3L10B 5FKAC 3JYUA 3PT2B 2RD0A 1SIFA 2JYTA 2KNBA 3ZRFA 5FR3A 2QC8A 2WWZA 3CF6E 2RSUA 3URYA 1TKEA 1WH3A 2K22A 4EE2A 1AWDA 2DZKA 3I5JC 1WJ6A 4MDKE 3WCQA 5AZGA 1C76A 1KLGD 2WNMA 1VRAB 4P1CC 5AUKA 1L4DB 4W9HA 1ESFA 1WI0A 2KWVB 3W2DA 4CO7A 2J4XA 4LJPB 2KANA 5AEKB 3VXWA 3ZNZB 4K3BA 4A9AA 1KLUD 4K7SA 4YL8A 2QSDA 3FILA 3A4SC 4B0MA 3L13A 3ZTCA 4OW0A 3IHPC 3SFEB 2BS2B 4M02A 4LTUA 4GDKB 2KFKA 5EDSA 1T0YA 3TMPB 3RNGC 2FIFA 4MM3B 3NVWA 4G0NB 1OEYJ 4FBJB 3HVDA 1YQBA 2PE6B 3DPDA 5HHDG 2JWUA 3N32A 2K6QA 2WYQA 2AL6A 1L5PA 2GBMA 2JZPA 1SB3C 4E71A 2WXKA 5E6OA 1QQRA 4HROA 4LNNA 3AEFB 3CSFA 2YEPF 4BAXA 1WR6E 2ICIA 2G3QB 1HZ6A 3M95A 2FNJB 2IO0B 2DLBA 1T6BX 3AEGB 3ZIMA 2MX2A 3K9PB 1HTQA 2PLPA 3BVMA 2KX0A 1L4ZB 1D6EC 2SEBD 2AL3A 1K50A 2HD5B 2V1YA 1TBEA 3RNAC 4C4VB 4IKGA 3A1QB 2YVCA 2QMTA 4NNJB 2WDQB 3AEAB 4OZAA 1DOXA 4W9IA 3SDLC 4IM2A 4US9A 4WWPA 3DBRI 1BXTA 1IGCA 4LLGM 2JZZA 1J8CA 3RCZA 4LNKA 4M8MA 2CKHB 4W9FA 1OGWA 2V3NA 1JWUD 2L0FA 2NBUA 2BWES 4TV3A 1L0XB 1PYWD 1QLBB 4KV2A 1I4PA 4A6QA 2WX0A 1IUEA 1Y8RC 4D2KA 1GPXA 2CHXA 3KH0A 1U4AA 1TS2A 3L08A 2K0PA 1MG8A 5H8YE 1WXSA 1S3SG 2GOWA 2JXTA 4KSKC 1YJIA 4DQOC 3FAHA 5IOIA 2K8CA 3SR6A 3DVGX 2KWUB 2RR9A 1E7VA 2FCQA 3ZXRA 3L54A 4MJSA 4IG7B 3AE5B 2ZNVB 2LD9A 3ZUNA 1TYGB 2HDEA 4WURA 1P1AA 3U7ZA 1WWTA 3ZNID 4N6EB 1P7FA 2KFJA 3Q69A 3TL5A 5C3JB 4J3OD 1PGBA 5LXHA 3K9OB 3A4RA 4W9KA 3JVZX 3WIMA 4DHJD 1YX5B 4HJGE 3BVZA 2OHFA 2KD0A 1QZEA 2L05A 4A55A 3EFUA 1FNWA 4DXFA 1E7UA 1QF6A 2UU7A 2CU1A 1FCCC 3BWUD 4GOCA 5DPTA 4NPNA 3TEYA 4YTNB 4AP4C 3QHTA 4ICVA 2BYVE 2LJ5A 3N1ZC 2PEAA 1KRHA 3MJWA 1L6UA 2QIEB 4FN2A 1ZPSA 4L2YA 4W9GA 4EZKA 1N5XA 4DXAB 2NPTB 1ZXHA 2ONQA 1XCQL 2DENB 1XF5L 1H4RA 4P16A 2N7JA 4EEWA 2LHDA 1BT0A 3H7PA 1KFYB 3KYDD 1PGAA 1F2RC 1GG3A 2BW2A 3ML8A 2FCSA 4A8XC 3R2TA 2WS3B 3HRDD 3ZGZA 4JWUC 3EHVA 4US8A 5H92C 2V9HA 5T8IA 3IAM1 3AE7B 2LXCA 1WGKA 4DWFA 4DXGA 4WWMA 2LZ6A 1SE9A 2DX5B 3ZRCA 3NVYA 2HJ1A 3BVGA 4ANWA 1RLFA 3VUYA 2DZJA 3A9KB 1JWSD 2LGDA 2L1AA 5MPOA 3EGRA 2MEKA 4IM3A 2ZJDA 4MSQB 4ZOHC 1QOAA 3PLVA 2WX1A 3BZDB 2ZW0A 4ACFA 2RPVA 1FM0D 1YN4A 2Z0EB 1IYFA 2DNFA 2N4FA 2BB6A 1J7BA 2MP2A 3L4PA 2RDBC 3KLSX 4RFBA 3GB1A 4RF0A 4ANXA 4TQ0A 3KWLA 1MHXA 4FJZA 1SIJA 2L0TA 3ZXVA 2KTRA 3AH7A 4JLCA 2W55A 4IC7B 2N9KA 4K3CA 3TEZA 4XGAB 2G4DB 3Q8BA 2JUOA 1LM8B 4WWOA 3SFDB 5JHBA 3DDCB 3DCGA 3MHZA 1ZGUB 3DHHC 3MC9A 4BKSA 2C7MB 3QJZA 5BMHA 2PTLA 5BMGA 5E6NA 1WRIA 3RZWC 3MC0B 1M4VA 2OOBB 1GOZA 1PFDA 3ABVB 4ANUA 2TSSA 3L17A 2YEPB 2K39A 5TSSA 4ZDVA 3GE8C 4BBNC 2W3SA 2BVCA 3SHQA 1E0ZA 1MJDA 1FXIA 1VDVA 3UI3A 2LGXA 5E6PA 4F1SA 1KF6B 2N9PC 3RPFC 1RFAA 1P98A 3NS1A 3DVGY 2GI9A 3DBHB 2AX5A 2L8JA 4WJNA 4XWTA 4EUTA 2WLBA 4LCDE 2BYEA 4S0RA 3ETRA 2J53A 2MBBB 4KGSA 1G6JA 4W9JA 1FPYA 2PE9A 2EKIA 3RZFA 4AWJA 1E7PB 2C5LC 4MEMA 2CHZA 1T5XD 4LJOB 4HCPB 2D3AA 2K8BA 1WXVA 4BOSC 4IDIA 4FJYA 1LFDA 1N63A 4HKZE 2WXQA 1YN3A 2O2VA 4JE3B 1UGMA 1TGZB 1SJHD 2IZVB 2N7EA 1VD2A 2NTSA 5G55A 2BB5A 3VTWA 1SF0A 4KGRA 4MGIE 1XCTL 4HPLB 1ZE3D 4TMAB 1A5RA 3OJ4B 4URKA 4JL9A 4II2B 4PS3A 1STEA 3GE3C 4KZCA 2O6VD 1YMHE 1DGJA 1FXTB 4F7ZA 4MH8A 1NI2A 2PKOA 3IFWB 3CMMB 1RAXA 2L83A 4LNIA 4RH6A 1E9MA 2NBWB 3PRMB 2JT4B 3Q3FA 3R7QA 2LEKA 3JSVA 2AEHA 3ZNGC 1JCKB 4ICUA 1EU4A 1V1PA 1YOVB 5EE3A 3HK0A 4MACA 4KX6B 2KQ4X 1R4NB 3ZJTA 1NYRA 1Q10A 4OVZA 1K51A 2XEWA 2O6VA 1PUTA 5LNK1 1E90A 1C1YB 4I6PA 1HQRD 3AE8B 4HXDA 3KUZA 3ONSA 4YT0B 2ON8A 3I3TB 1P0RA 2ZVNA 4KSLC 2NR2A 5BYSA 1TS3A 3AU4A 3C0RB 2QCZA 3Q8AA 3VRAB 2MBEA 1ET9A 2JWZA 3U4EG 4GDLB 3NG0A 4LNFA 2AYOB 5HG2A 1LQBA 4W9CA 4YTPB 5D3DA 4IOIE 3IG3A 2BTEA 2JPHA 2RDHA 3HIZA 3KUDB 2G4SA 2W9NA 4ZHOA 3UF8A 3LYYA 4NZLB 4MGZE 5D6JB 3TCAA 2SAKA 1R7SA 2WXMA 1LO5D 2L3ZA 3N3KB 2DAFA 2KDEB 3OG5A 1IPGA 2W3RA 2RGFA 2J0JA 4RGOS 1F0ZA 4B95A 5J17A 3VUWA 2XN9C 2IBIB 2JRHA 3GOEA 5EE1A 4HEA1 1JW9D 3P63A 4EOYA 2K9XA 3ZYYX 3UINB 1Q5WB 5D7GA 4BZAA 2GBKA 1L0YB 4C00A 1Q0WB 2INPE 2A5UA 5BMIA 1VZ7A 5EE0A 1C77A 3AEEB 1WGHA 1HZ5A 2KXJA 2WQYB 2HE7A 3DWGC 3E56A 4G3XB 2K8HA 5HI1A 2KDBA 1RWSA 1XXGA 2FUHB 3TUOA 1YNTE 2V3SA 2M56B 1T0RC 3DBSA 2YLMA 4AUQC 2LFIA 4AOFA 4B0EA 1FRDA 1SE3A 1KH0A 3EA6A 3BINA 1T0QC 4DK5A 3LJ3A 5I4DA 4K7UA 4AS1A 3GP7A 1CMXB 3R66C 1EWCA 3Q3NC 4M0WB 2R61A 1FRRA 1T0SC 1WRDB 1AW7A 2ZEQA 2GLSA 5DCNA 2IGHA 1DYQA 2MCNB 3ZJUA 1OQRA 2KTFA 2C60A 2OJRA 2V0GA 4NAMA 2JQRB 4RGMA 5JXVA 2WHIA 3VTUA 2WXGA 4XZ4A 3PZ8A 1FFVA 4M8NA 4W9LA 5BYRA 2ZPYA 1I4RA 1NDDA 1ROEA 2WXPA 5BO4B 2KZRA 1L7YA 2HJ8A 2NVUI 2KVZA 2PJHA 3MHSD 3EECA 5CHVC 3DBRB 3X23A 2BYFA 1GC6A 2R2OA 1JRPA 2PW9A 1L0VB 5AZHA 1JROA 1C79A 2M4NA 1YQ3B 1TZ1A 4M00A 2AQ3B 3PPAA 2WGSA 3RFZB 1TJEA 2AQ1B 3N20C 2UWQA 4L23A 1MHHE 1VZ8A 4WJPA 4N9F4 1SBBB 2DHZA 3H7SA 3QCAA 2KC2A 1JALA 1XLNA 4PT5A 4PK1A 2ZZPB 3QC8B 2MQJA 2FCMA 3HM3A 3ZQ4A 1UF0A 1YQ4B 3PS6A 2KHWB 4KZ0A 2NTTA 3PHXB 3IT6B 4WQOB 2CU3A 1IBXB 2BYTA 3H7PB 3V62A 1D3ZA 2WXOA 5BYQA 3GS2A 1HXYD 1AYFA 4GDKA 2KWCA 3V61A 1V8CA 1FXAA 3KW5B 4G11A 4KVGB 4YSYB 1DOYA 3RNFC 2WXLA 1N62A 2WXNA 5TR5A 2LHEA 2D3CA 3P4QB 4ZRIA 3A9JB 3R8BA 3AEDB 3UIOB 1V9JA 3P4SB 3PZ7A 1JWBD 1WJUA 4KKIA 3N30A 4WAFA 2ZVOA 3Q14C 5HKHA 2HTME 2KDFB 1GNUA 4PS8A 1CZPA 4YTMB 4X57B 1JQ4A 3QX1A 3OAWA 1JWMD 1WE7A 3RMKC 1KM7A 5JHAA 3AE4B 1WGRA 1WGGA 3ECIA 3V6EB 2ZNVC 4HDQA 4AQ7A 2M8SA 4LDTD 4JGHB 4ASWC 1TT5B 2VRRB 2GBNA 4H2AA 1NVID 1SE4A 3W1SC 3M62B 2PVOD 1SE2A 4C4VA 3AE2B 2N0SB 3A1QA 2FUG1 2KN5A 1UH6A 3T3OA 1R4MB 3NJTA 3WANA 3KWVA 3VQIA 3VDZA 1JMLA 1WMHA 1HEZE 2CJNA 5DPSA 4XX5A 3NVZA 1GB4A 2W82A 1KJTA 3TIXA 2E6XA 2LRWA 1MFWA 2X38A 4KIKB 4NJ7A 4HJKA 2JYEA 5C1ZA 1F2RI 4RCOA 2IJ0A 3AMZA 1TS4A 3N1XC 4RGNA 1VZ6A 2EMSA 3T9LA 1ZKHA 4F8CB 3VR9B 4R3DA 1AARA 3AV8A 1ACCA 1GJZA 4I6LB 4HPPA 1UUPA 1VJKA 1QOFA 2JSVX 3APFA 2BKRB 4MELA 4K1RB 5CHWA 1RFKA 5G5GA 1ENFA 1H8CA 3NY5A 1KOTA 2BQQA 3QIJA 3WAMA 4GGQA 2MW5A 3MP9A 5AZFA 1QKZA 3W1SA 4P6VF 3Q8CA 1NYQA 4HLEA 1TZOA 1KTKA 2MRPA 2KOXA 4BKSD 4DBGA 3IVFA 1WSPA 4FLHA 2MJ3A 2B3AA 1MVKA 1YD8U 3BYTB 2DYBA 1XLQA 3V6CB 4WAAA 4CYEA 2WXFA 3NUHB 3W9CB 3RUIB 1WYGA 1WX9A 2IY0B 2WXJA 3DVNV 2E3TA 2JU6X 2GBRA 2L00B 1I4HA 4C7YA 1OFFA 4MSMB 1ISNA 4NAWA 2BT6A 2MH7A 5L95C 4B9KA 2J7QB 2C7NB 3BIID 3EC8A 2M19A 2Z0DB 1WR1A 4YSZB 2XK5A 3ML9A 4TQ1A 1UNSA 3MC8A 1RYJA 5C2TB 3VH4B 1D4BA 2M0XA 4E74A 4XWWA 3EUB2 2JY6A 1MI0A 2MHJA 3T8MA 3ENEA 2MA9B 2N1VA 2A4ZA 2BGFA 2ACZB 2NPTA 2XNAC 1P9DU 3W1YA 1PDXA 4EKUA 3P4RB 2LXAA 3Q8EA 2XBBC 3IT4B 4ITKA 3WAPA 3NOBA 2IPKD 3PZDA 2M1MA 5L83A 3GZNB 3DWMA 3I57A 4AJWA 4ZRPA 2LJIA 5KHQA 4WWNA 4Q2JA 4FXCA 3HVZA 1SJED 4AJYB 4HKQA 1Q1OA 4GXBA 3KQ4A 4II3B 3PTFC 2KJHB 1TKYA 1D5XC 1F52A 4HPMB 2D10A 1NEKB 1TTNA 2D3BA 1J7CA 5KHOA 5GMVA 1XO3A 2Y3AA 2HTHA 4OVVA 2FAZA 2DWQA 4KDIC 1GB1A 2WDVB 4LK0M 1V5OA 2KO3A 3A9KA 2I1JA 4EZJA 3DHGC 2ZW1A 1PGXA 2LRUA 3DBLB 1DOIA 3B2GA 3DHIC 3CIRB 3UQAA 2KVRA 1EF5A 2L32A 3NHEB 3H1UA 1KLVA 2VZKB 1WJNA 1WM2A 1JWAD 2WXRA 3DBHI 4JIOU 2GRIA 4K81A 2PMVA 1FCLA 2KMAA 2INDC 2DYMA 1WY8A 1I7HA 3VFKA 1UWXA 4RNAA 1FD6A 2Z59B 2CS4A 1V2YA 4NJCA 1J19A 5IA7A 1XT9B 3PSEB 1C4AA 1EM7A 1B9RA 4BFRA 1WXQA 1XEEA 5E6JA 2KC1A 3I9V1 3IXSA 3AECB 4HK2A 1V1OA 3U2SC 3RNBC 1HE8A 1WZ3A 4RM9A 4PS7A 4K7WA 3FILB 1MG4A 1TKGA 2ZCBA 2FBWB 2R2QA 3RULA 2K1FA 4YXDB 3APDA 3NVVA 3LDZE 2QHOA 3D32A 2KFKB 3FC4A 1WZ0A 5HFYA 4WH4A 1YJJA 2EELA 3ZDMC 3MJ5A 4WIPA 1R4NI 3B2FA 3QAQA 4FHJA 1TY2A 2MWSB 1SEBD 3IAS1 2KK8A 3R2IA 2BWFA 1E8WA 1YIWA 4FHKA 4NY0A 4A90A 4P7IA 5CTRC 1AN8A 1WFYA 4RGTA 1NI3A 1TIFA 2LWPA 3RNEC 1Z2MA 3BY4B 1I4QA 3H8HA 3W5UB 2D5GA 3M3JA 2J52A 4DHZE 2GB1A 1Z5SB 2QDFA 4IWPA 4EZLA 2KMCA 2LI5A 2QJLA 2B76B 1FFUA 1OTRB 2KACA 2MSED 1ZUD2 2MJDA 1WF9A 2OJWA 4GMVA 2QILA 3B08A 1WJ4A 1Y56A 2LMCA 3PRZA 1SSNA 2DZMA 2PIAA 2KWDA 2BKFA 4GSWA 4IM0A 4A3PA 3PREA 4ANVA 4PYZA 3AE6B 1E8YA 3AM9A 3HUIA 2INCC 3ZVVA 5CHFA 4B6WA 4C7ZA 2MBOA 3AE3B 3U52E 3DOWA 5IN7A 2JXXA 5D94A 1ET6A 3OWEB 1F1HA 3A33B 1K52A 1L2NA 3AN1A 1I35A
chains in the Genus database with same CATH topology
4FJVB 1YX6B 1V49A 2Z0EB 5TR5A 3DBLI 1M94A 1IYFA 2N4FA 2MP2A 4ZRKA 4ZRIA 2I1KA 3A9JB 3WA0A 1ZW7A 5JZEB 1OEYA 2KKCA 4ANXA 3UIOB 1V9JA 3HHMA 4IUMB 4TQ0A 1WJUA 4BBNF 3N30A 5CX3A 4FJZA 1LXDA 2ZVOA 3PVLA 4GDLA 5HKHA 2KLCA 2L0TA 2KTRA 2KDFB 4JLCA 1NBFC 1WGYA 1GNUA 2D3GA 3QA8A 4IC7B 2G4DB 2JUOA 1LM8B 4WWOA 2M17A 3QQ8B 2KX3A 4PS8A 3RT3B 5JHBA 3DDCB 3DCGA 1ZGUB 4X57B 5JH5C 4MJSB 3RYTA 3QX1A 5G2NA 2JVCA 3OAWA 2REXA 4BKSA 1EUVB 4J6IA 1WE7A 2C7MB 3TJPA 3QJZA 3AULA 2LVQA 3ZKJC 1KM7A 5JHAA 5E6NA 3OJ3A 4IWOA 2ASQA 3RZWC 1WGRA 2OOBB 1WGGA 2EMTA 3ECIA 4ANUA 3L17A 3V6EB 1VCBA 2K39A 2ZNVC 1UBIA 2DYOA 4HDQA 2M8SA 1WX8A 4ZDVA 2CHWA 4LDTD 4JGHB 2Y5BB 4ASWC 2VRRB 2GBNA 4W9EA 1WXAA 4BBNC 3B1LX 2BF8B 3U30A 3KYCD 4E3CA 2IO1B 3AI5A 3W1SC 3HM6X 3M62B 2K25A 3SHQA 3VHTC 2NBVB 5LLIA 3DVNU 3A1QA 2N1WA 3L0WB 4I6NB 4OVUA 2KN5A 1UH6A 2LGXA 5E6PA 1PQSA 4F1SA 3WANA 4HWIB 3VQIA 3PHWB 4A3OA 1V5TA 2N9PC 3VDZA 5D2MB 1RFAA 4HCNB 1P98A 3AU5A 2DZIA 1WMHA 2GMIC 2PPHA 3DVGY 1IP9A 5DPSA 2JRIB 3QARA 4XX5A 2L8JA 3PGEA 4WJQA 4WJNA 1GC7A 4EUTA 1KJTA 4MGKE 3TIXA 3UGBB 4LCDE 2LVOA 2BYEA 3PV1A 2LRWA 4KIKB 2MBBB 4HJKA 4NJ7A 5C1ZA 2G45B 2UYZB 1G6JA 2MLBA 4KDLB 2GBJA 2PE9A 3QWZB 4W9JA 3RZFA 4AWJA 2KLGA 4GB9A 4FADA 3KVFB 2C5LC 2EKEC 1XQQA 2N9EB 4MEMA 2CHZA 2EMSA 3H9DA 3L10B 4LJOB 4HCPB 3JYUA 3T9LA 4DHJB 3PT2B 1K8RB 1ZKHA 2RD0A 3ZDTA 2K8BA 1WXVA 4F8CB 4BOSC 1UELA 1SIFA 4FJYA 3S2AA 1LFDA 2KNBA 2LVPA 1AARA 3ZRFA 2FCNA 2WWZA 3CF6E 2J0MA 2RSUA 4NQLB 2O2VA 1WH3A 3U7DA 4W9DA 1GJZA 1UGMA 1TGZB 1WMHB 2DZKA 2IZVB 2N7EA 1WJ6A 4I6LB 3VH3B 1VD2A 5G55A 3VTWA 3VTVA 4MDKE 4MGIE 4XC2A 4HPLB 3APFA 2BKRB 4MELA 1A5RA 1F9JA 4K1RB 3OJ4B 5AZGA 5CHWA 4URKA 4JL9A 4II2B 4PS3A 4LDTB 3SD5A 1H8CA 1KOTA 3NY5A 4MM3A 3ZNHB 3QIJA 4KZCA 1V6EA 4W9HA 2O6VD 3WAMA 4GGQA 1WI0A 2KWVB 1V81A 2MW5A 5AZFA 1WX7A 5J18A 1FXTB 3W1SA 4BOZB 3UIPB 3JW0X 4CO7A 4F7ZA 4LJPB 2KANA 1NI2A 3VXWA 5AEKB 3ZNZB 3R3MA 4HLEA 3IFWB 3CMMB 1RAXA 2MRPA 2KOXA 4BKSD 4DBGA 3IVFA 4FLHA 2NBWB 4K7SA 3PRMB 2B3AA 2JT4B 3Q3FA 4YL8A 3R7QA 3JSVA 1YD8U 2AEHA 3A4SC 2DYBA 3L13A 3ZNGC 2J0KA 3V6CB 4WAAA 3ZTCA 4ICUA 4CYEA 3RUIB 2KQSA 3IHPC 1WX9A 2IY0B 3DVNV 3HK0A 4GDKB 2KFKA 2D11A 4HVBA 5EDSA 2GBRA 1EO6A 1T0YA 2L00B 4HDOA 2MBQA 3TMPB 4MSMB 2K6DB 2FIFA 3X0WA 2XEWA 2O6VA 1ISNA 4NAWA 5C23A 1E90A 4G0NB 1C1YB 1UD7A 4I6PA 1OEYJ 4DHZB 4FBJB 5L95C 4B9KA 2J7QB 2C7NB 4HXDA 3EC8A 3KUZA 3ONSA 3ZO5B 4IW0A 2Z0DB 3RD2A 1YQBA 1WR1A 2PE6B 3DPDA 2XK5A 3ML9A 3I3TB 1UZXB 4FULA 4TQ1A 3N32A 2LGYA 1P0RA 2MP2B 2N7DA 2K6QA 2WYQA 3VH4B 2M0XA 2KQ7A 2ZVNA 4E74A 2AL6A 2JY6A 4KSLC 2NR2A 3T8MA 3AU4A 3ENEA 2GBMA 3C0RB 3P2BA 4E71A 3PRPB 2MA9B 2N1VA 2NS5A 1WM3A 2A4ZA 2BGFA 4BKTA 2NPTA 5E6OA 2MBEA 2IY1B 2JWZA 1P9DU 2L76A 3W1YA 2MBHA 3CSFA 4GDLB 4RM8A 3WALA 4EKUA 1WR6E 2AYOB 2KTRB 2ZPNA 2LXAA 2NCNA 1LQBA 4W9CA 2XBBC 3WAPA 3AXCA 2G3QB 3NOBA 4NAWB 4NJ6A 3PZDA 2M1MA 4GN1A 5L83A 3M95A 2FNJB 3WAOA 4AJWA 2IO0B 3IG3A 5KHQA 4WWNA 3ZIMA 2JPHA 2MX2A 2XK5B 3K9PB 3HIZA 1GUAB 4AJYB 2C9WB 1Q1OA 3KUDB 4GXBA 2G4SA 4II3B 2W9NA 3PTFC 2KJHB 5J2RA 2N9XA 1WE6A 3UF8A 2KX0A 1XD3B 4HPMB 2D10A 3ZTDA 3VUXA 1TTNA 4MGZE 5D6JB 2AL3A 3TCAA 2HD5B 4PYUA 5KHOA 2L3ZA 3N3KB 2V1YA 2DAFA 2KDEB 4MGYE 1TBEA 3A1QB 2YVCA 5GMVA 2HTHA 4OVVA 4NNJB 1IPGA 2FAZA 4KDIC 2RGFA 2J0JA 5LXIB 1V5OA 1E8ZA 2KO3A 3A9KA 2I1JA 4EZJA 4W9IA 4B95A 3O65B 5J17A 3SDLC 1WIAA 3VUWA 2IO2B 4EFOA 2LRUA 3PLUA 4IM2A 2IBIB 3QK0A 2JRHA 3GOEA 4WWPA 3DBRI 2AWTA 3UQAA 2CR5A 2JZZA 4EOYA 3RCZA 1J8CA 2KVRA 1EF5A 4M8MA 1R4MI 2CKHB 1OGWA 4W9FA 3NHEB 1Q5WB 3ALBA 2DAJA 5D7GA 3UINB 3NS8A 2L0FA 3H1UA 1KLVA 3R7RA 2GBKA 2NBUA 2KJ6A 1Q0WB 2BWES 4TV3A 1WJNA 2A5UA 1WM2A 2D2QA 3VVWB 3DBHI 4JIOU 2L7RA 4K81A 4BKGA 3A9JA 3V60A 4KV2A 4DDGD 3IBEA 1WGHA 2KMAA 3MTNB 2DYMA 1WY8A 2D07B 2KXJA 2WX0A 1Y8RC 2FIDA 2CHXA 1UBQA 3KH0A 1RRBA 1U4AA 2HE7A 2V4LA 3VFKA 3L08A 3B0AA 1MG8A 4G3XB 2LUEA 2Z59B 1WXSA 1S3SG 2K8HA 2CS4A 2GOWA 2O2VB 1V2YA 2KDBA 1J19A 3ZLZA 1YJ1A 2FUHB 4KSKC 5IA7A 1XT9B 3PSEB 2K8CA 2V3SA 3DBSA 4AUQC 4AOFA 2YLMA 1C3TA 3DVGX 1E8XA 2JZ3B 2KWUB 1E7VA 2FCQA 2RR9A 3L54A 4MJSA 4IG7B 3BINA 2ZNVB 4BFRA 4DK5A 2KC1A 1V86A 2LD9A 3ZUNA 3LJ3A 2IO3B 4HK2A 1P1AA 4JQWC 3ZNID 2IYDB 1HE8A 4IWQA 2KFJA 3DQVA 4K7UA 1WZ3A 4RM9A 3TL5A 4TUUA 4PS7A 1I42A 1CMXB 4K7WA 3R66C 4ZRJA 4M0WB 5DPWA 2KJRA 5LXHA 3JSVB 3A4RA 3K9OB 5DPRA 4W9KA 4NQKE 2BPSA 2ZCBA 1WRDB 3JVZX 4GIVA 1YX5B 3WIMA 4DHJD 2R2QA 2KD0A 3RULA 1QZEA 2K1FA 1P3QU 2L05A 3H6NA 2ZEQA 3APDA 5DCNA 3EFUA 3LDZE 2MCNB 3ZW3A 2QHOA 3D32A 2KFKB 2LASA 1E7UA 2KTFA 2C60A 1WZ0A 2CU1A 2OJRA 4CHKA 4A20A 1WYWB 1X1MA 3VTUA 4GOCA 5DPTA 4NPNA 4FA6A 4XZ4A 2O6VB 4AP4C 3QHTA 4ICVA 3CSTA 2BYVE 3U8ZA 3ZDMC 3KUCB 3TBLD 4M8NA 4W9LA 1R4NI 2LJ5A 2C7HA 2ZPYA 1NDDA 3QAQA 2PEAA 4FHJA 4KIKA 2KZRA 5BO4B 2MWSB 1L7YA 3MJWA 3VAWA 2KK8A 2BWFA 2HJ8A 1E8WA 1YIWA 4FN2A 2JF5A 4FHKA 4NY0A 2NVUI 2PJHA 4W9GA 3MHSD 4P7IA 5CTRC 4EZKA 1WFYA 4WJOA 3EECA 5CHVC 3UQBA 4DXAB 3X23A 2NPTB 2LWPA 2BYFA 2ZCCA 1J0GA 1Z2MA 5FR6A 3BY4B 1GC6A 2R2OA 4ZYNA 3M3JA 3SU8X 2DENB 4DHZE 5AZHA 1H4RA 1Z5SB 4EZLA 4IWPA 2M4NA 2KMCA 1TZ1A 3PPAA 2LI5A 4EEWA 1V80A 1BT0A 1SGHA 3H7PA 1OQYA 1WXMA 3KYDD 3NZUA 2UWQA 3OLMD 2RPQA 1OTRB 2MSED 1GG3A 3ML8A 2FCSA 1WF9A 4GMVA 3B08A 4N9F4 1WJ4A 4WJPA 4GU2A 5IAAC 2DHZA 3H7SA 3QCAA 2KC2A 3EHVA 3PRZA 2ZZPB 3QC8B 3GZNI 2DZMA 2MQJA 2LXCA 3APCA 2FCMA 2BKFA 4DWFA 3HM3A 4GSWA 4IM0A 2LZ6A 1SE9A 4A3PA 2DX5B 3ZRCA 1WGDA 3PREA 3PS6A 1S1QB 4ANVA 2KHWB 4KZ0A 4PYZA 4TKNA 3PHXB 4ANWA 1E8YA 4WQOB 1RLFA 3ZVVA 5CHFA 3VUYA 3H7PB 3V62A 1D3ZA 2DZJA 3A9KB 2LGDA 4MH0E 2WDTB 4B6WA 1EF1A 4GDKA 2KWCA 2MBOA 3Q3JA 3V61A 2KDIA 4G50A 3DOWA 4BVUC 2JXXA 5D94A 3KW5B 3L16A 4G11A 4KVGB 4RMAA 3M63B 4IM3A 2ZJDA 4MSQB 3PLVA 3A33B 2WX1A 1L2NA 1E5WA 3NZSA 1JRUA 4DDID 1I35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJV B;  1YX6 B;  1V49 A;  2Z0E B;  5TR5 A;  3DBL I;  1M94 A;  1IYF A;  2N4F A;  2MP2 A;  4ZRK A;  4ZRI A;  2I1K A;  3A9J B;  3WA0 A;  1ZW7 A;  5JZE B;  1OEY A;  2KKC A;  4ANX A;  3UIO B;  1V9J A;  3HHM A;  4IUM B;  4TQ0 A;  1WJU A;  4BBN F;  3N30 A;  5CX3 A;  4FJZ A;  1LXD A;  2ZVO A;  3PVL A;  4GDL A;  5HKH A;  2KLC A;  2L0T A;  2KTR A;  2KDF B;  4JLC A;  1NBF C;  1WGY A;  1GNU A;  2D3G A;  3QA8 A;  4IC7 B;  2G4D B;  2JUO A;  1LM8 B;  4WWO A;  2M17 A;  3QQ8 B;  2KX3 A;  4PS8 A;  3RT3 B;  5JHB A;  3DDC B;  3DCG A;  1ZGU B;  4X57 B;  5JH5 C;  4MJS B;  3RYT A;  3QX1 A;  5G2N A;  2JVC A;  3OAW A;  2REX A;  4BKS A;  1EUV B;  4J6I A;  1WE7 A;  2C7M B;  3TJP A;  3QJZ A;  3AUL A;  2LVQ A;  3ZKJ C;  1KM7 A;  5JHA A;  5E6N A;  3OJ3 A;  4IWO A;  2ASQ A;  3RZW C;  1WGR A;  2OOB B;  1WGG A;  2EMT A;  3ECI A;  4ANU A;  3L17 A;  3V6E B;  1VCB A;  2K39 A;  2ZNV C;  1UBI A;  2DYO A;  4HDQ A;  2M8S A;  1WX8 A;  4ZDV A;  2CHW A;  4LDT D;  4JGH B;  2Y5B B;  4ASW C;  2VRR B;  2GBN A;  4W9E A;  1WXA A;  4BBN C;  3B1L X;  2BF8 B;  3U30 A;  3KYC D;  4E3C A;  2IO1 B;  3AI5 A;  3W1S C;  3HM6 X;  3M62 B;  2K25 A;  3SHQ A;  3VHT C;  2NBV B;  5LLI A;  3DVN U;  3A1Q A;  2N1W A;  3L0W B;  4I6N B;  4OVU A;  2KN5 A;  1UH6 A;  2LGX A;  5E6P A;  1PQS A;  4F1S A;  3WAN A;  4HWI B;  3VQI A;  3PHW B;  4A3O A;  1V5T A;  2N9P C;  3VDZ A;  5D2M B;  1RFA A;  4HCN B;  1P98 A;  3AU5 A;  2DZI A;  1WMH A;  2GMI C;  2PPH A;  3DVG Y;  1IP9 A;  5DPS A;  2JRI B;  3QAR A;  4XX5 A;  2L8J A;  3PGE A;  4WJQ A;  4WJN A;  1GC7 A;  4EUT A;  1KJT A;  4MGK E;  3TIX A;  3UGB B;  4LCD E;  2LVO A;  2BYE A;  3PV1 A;  2LRW A;  4KIK B;  2MBB B;  4HJK A;  4NJ7 A;  5C1Z A;  2G45 B;  2UYZ B;  1G6J A;  2MLB A;  4KDL B;  2GBJ A;  2PE9 A;  3QWZ B;  4W9J A;  3RZF A;  4AWJ A;  2KLG A;  4GB9 A;  4FAD A;  3KVF B;  2C5L C;  2EKE C;  1XQQ A;  2N9E B;  4MEM A;  2CHZ A;  2EMS A;  3H9D A;  3L10 B;  4LJO B;  4HCP B;  3JYU A;  3T9L A;  4DHJ B;  3PT2 B;  1K8R B;  1ZKH A;  2RD0 A;  3ZDT A;  2K8B A;  1WXV A;  4F8C B;  4BOS C;  1UEL A;  1SIF A;  4FJY A;  3S2A A;  1LFD A;  2KNB A;  2LVP A;  1AAR A;  3ZRF A;  2FCN A;  2WWZ A;  3CF6 E;  2J0M A;  2RSU A;  4NQL B;  2O2V A;  1WH3 A;  3U7D A;  4W9D A;  1GJZ A;  1UGM A;  1TGZ B;  1WMH B;  2DZK A;  2IZV B;  2N7E A;  1WJ6 A;  4I6L B;  3VH3 B;  1VD2 A;  5G55 A;  3VTW A;  3VTV A;  4MDK E;  4MGI E;  4XC2 A;  4HPL B;  3APF A;  2BKR B;  4MEL A;  1A5R A;  1F9J A;  4K1R B;  3OJ4 B;  5AZG A;  5CHW A;  4URK A;  4JL9 A;  4II2 B;  4PS3 A;  4LDT B;  3SD5 A;  1H8C A;  1KOT A;  3NY5 A;  4MM3 A;  3ZNH B;  3QIJ A;  4KZC A;  1V6E A;  4W9H A;  2O6V D;  3WAM A;  4GGQ A;  1WI0 A;  2KWV B;  1V81 A;  2MW5 A;  5AZF A;  1WX7 A;  5J18 A;  1FXT B;  3W1S A;  4BOZ B;  3UIP B;  3JW0 X;  4CO7 A;  4F7Z A;  4LJP B;  2KAN A;  1NI2 A;  3VXW A;  5AEK B;  3ZNZ B;  3R3M A;  4HLE A;  3IFW B;  3CMM B;  1RAX A;  2MRP A;  2KOX A;  4BKS D;  4DBG A;  3IVF A;  4FLH A;  2NBW B;  4K7S A;  3PRM B;  2B3A A;  2JT4 B;  3Q3F A;  4YL8 A;  3R7Q A;  3JSV A;  1YD8 U;  2AEH A;  3A4S C;  2DYB A;  3L13 A;  3ZNG C;  2J0K A;  3V6C B;  4WAA A;  3ZTC A;  4ICU A;  4CYE A;  3RUI B;  2KQS A;  3IHP C;  1WX9 A;  2IY0 B;  3DVN V;  3HK0 A;  4GDK B;  2KFK A;  2D11 A;  4HVB A;  5EDS A;  2GBR A;  1EO6 A;  1T0Y A;  2L00 B;  4HDO A;  2MBQ A;  3TMP B;  4MSM B;  2K6D B;  2FIF A;  3X0W A;  2XEW A;  2O6V A;  1ISN A;  4NAW A;  5C23 A;  1E90 A;  4G0N B;  1C1Y B;  1UD7 A;  4I6P A;  1OEY J;  4DHZ B;  4FBJ B;  5L95 C;  4B9K A;  2J7Q B;  2C7N B;  4HXD A;  3EC8 A;  3KUZ A;  3ONS A;  3ZO5 B;  4IW0 A;  2Z0D B;  3RD2 A;  1YQB A;  1WR1 A;  2PE6 B;  3DPD A;  2XK5 A;  3ML9 A;  3I3T B;  1UZX B;  4FUL A;  4TQ1 A;  3N32 A;  2LGY A;  1P0R A;  2MP2 B;  2N7D A;  2K6Q A;  2WYQ A;  3VH4 B;  2M0X A;  2KQ7 A;  2ZVN A;  4E74 A;  2AL6 A;  2JY6 A;  4KSL C;  2NR2 A;  3T8M A;  3AU4 A;  3ENE A;  2GBM A;  3C0R B;  3P2B A;  4E71 A;  3PRP B;  2MA9 B;  2N1V A;  2NS5 A;  1WM3 A;  2A4Z A;  2BGF A;  4BKT A;  2NPT A;  5E6O A;  2MBE A;  2IY1 B;  2JWZ A;  1P9D U;  2L76 A;  3W1Y A;  2MBH A;  3CSF A;  4GDL B;  4RM8 A;  3WAL A;  4EKU A;  1WR6 E;  2AYO B;  2KTR B;  2ZPN A;  2LXA A;  2NCN A;  1LQB A;  4W9C A;  2XBB C;  3WAP A;  3AXC A;  2G3Q B;  3NOB A;  4NAW B;  4NJ6 A;  3PZD A;  2M1M A;  4GN1 A;  5L83 A;  3M95 A;  2FNJ B;  3WAO A;  4AJW A;  2IO0 B;  3IG3 A;  5KHQ A;  4WWN A;  3ZIM A;  2JPH A;  2MX2 A;  2XK5 B;  3K9P B;  3HIZ A;  1GUA B;  4AJY B;  2C9W B;  1Q1O A;  3KUD B;  4GXB A;  2G4S A;  4II3 B;  2W9N A;  3PTF C;  2KJH B;  5J2R A;  2N9X A;  1WE6 A;  3UF8 A;  2KX0 A;  1XD3 B;  4HPM B;  2D10 A;  3ZTD A;  3VUX A;  1TTN A;  4MGZ E;  5D6J B;  2AL3 A;  3TCA A;  2HD5 B;  4PYU A;  5KHO A;  2L3Z A;  3N3K B;  2V1Y A;  2DAF A;  2KDE B;  4MGY E;  1TBE A;  3A1Q B;  2YVC A;  5GMV A;  2HTH A;  4OVV A;  4NNJ B;  1IPG A;  2FAZ A;  4KDI C;  2RGF A;  2J0J A;  5LXI B;  1V5O A;  1E8Z A;  2KO3 A;  3A9K A;  2I1J A;  4EZJ A;  4W9I A;  4B95 A;  3O65 B;  5J17 A;  3SDL C;  1WIA A;  3VUW A;  2IO2 B;  4EFO A;  2LRU A;  3PLU A;  4IM2 A;  2IBI B;  3QK0 A;  2JRH A;  3GOE A;  4WWP A;  3DBR I;  2AWT A;  3UQA A;  2CR5 A;  2JZZ A;  4EOY A;  3RCZ A;  1J8C A;  2KVR A;  1EF5 A;  4M8M A;  1R4M I;  2CKH B;  1OGW A;  4W9F A;  3NHE B;  1Q5W B;  3ALB A;  2DAJ A;  5D7G A;  3UIN B;  3NS8 A;  2L0F A;  3H1U A;  1KLV A;  3R7R A;  2GBK A;  2NBU A;  2KJ6 A;  1Q0W B;  2BWE S;  4TV3 A;  1WJN A;  2A5U A;  1WM2 A;  2D2Q A;  3VVW B;  3DBH I;  4JIO U;  2L7R A;  4K81 A;  4BKG A;  3A9J A;  3V60 A;  4KV2 A;  4DDG D;  3IBE A;  1WGH A;  2KMA A;  3MTN B;  2DYM A;  1WY8 A;  2D07 B;  2KXJ A;  2WX0 A;  1Y8R C;  2FID A;  2CHX A;  1UBQ A;  3KH0 A;  1RRB A;  1U4A A;  2HE7 A;  2V4L A;  3VFK A;  3L08 A;  3B0A A;  1MG8 A;  4G3X B;  2LUE A;  2Z59 B;  1WXS A;  1S3S G;  2K8H A;  2CS4 A;  2GOW A;  2O2V B;  1V2Y A;  2KDB A;  1J19 A;  3ZLZ A;  1YJ1 A;  2FUH B;  4KSK C;  5IA7 A;  1XT9 B;  3PSE B;  2K8C A;  2V3S A;  3DBS A;  4AUQ C;  4AOF A;  2YLM A;  1C3T A;  3DVG X;  1E8X A;  2JZ3 B;  2KWU B;  1E7V A;  2FCQ A;  2RR9 A;  3L54 A;  4MJS A;  4IG7 B;  3BIN A;  2ZNV B;  4BFR A;  4DK5 A;  2KC1 A;  1V86 A;  2LD9 A;  3ZUN A;  3LJ3 A;  2IO3 B;  4HK2 A;  1P1A A;  4JQW C;  3ZNI D;  2IYD B;  1HE8 A;  4IWQ A;  2KFJ A;  3DQV A;  4K7U A;  1WZ3 A;  4RM9 A;  3TL5 A;  4TUU A;  4PS7 A;  1I42 A;  1CMX B;  4K7W A;  3R66 C;  4ZRJ A;  4M0W B;  5DPW A;  2KJR A;  5LXH A;  3JSV B;  3A4R A;  3K9O B;  5DPR A;  4W9K A;  4NQK E;  2BPS A;  2ZCB A;  1WRD B;  3JVZ X;  4GIV A;  1YX5 B;  3WIM A;  4DHJ D;  2R2Q A;  2KD0 A;  3RUL A;  1QZE A;  2K1F A;  1P3Q U;  2L05 A;  3H6N A;  2ZEQ A;  3APD A;  5DCN A;  3EFU A;  3LDZ E;  2MCN B;  3ZW3 A;  2QHO A;  3D32 A;  2KFK B;  2LAS A;  1E7U A;  2KTF A;  2C60 A;  1WZ0 A;  2CU1 A;  2OJR A;  4CHK A;  4A20 A;  1WYW B;  1X1M A;  3VTU A;  4GOC A;  5DPT A;  4NPN A;  4FA6 A;  4XZ4 A;  2O6V B;  4AP4 C;  3QHT A;  4ICV A;  3CST A;  2BYV E;  3U8Z A;  3ZDM C;  3KUC B;  3TBL D;  4M8N A;  4W9L A;  1R4N I;  2LJ5 A;  2C7H A;  2ZPY A;  1NDD A;  3QAQ A;  2PEA A;  4FHJ A;  4KIK A;  2KZR A;  5BO4 B;  2MWS B;  1L7Y A;  3MJW A;  3VAW A;  2KK8 A;  2BWF A;  2HJ8 A;  1E8W A;  1YIW A;  4FN2 A;  2JF5 A;  4FHK A;  4NY0 A;  2NVU I;  2PJH A;  4W9G A;  3MHS D;  4P7I A;  5CTR C;  4EZK A;  1WFY A;  4WJO A;  3EEC A;  5CHV C;  3UQB A;  4DXA B;  3X23 A;  2NPT B;  2LWP A;  2BYF A;  2ZCC A;  1J0G A;  1Z2M A;  5FR6 A;  3BY4 B;  1GC6 A;  2R2O A;  4ZYN A;  3M3J A;  3SU8 X;  2DEN B;  4DHZ E;  5AZH A;  1H4R A;  1Z5S B;  4EZL A;  4IWP A;  2M4N A;  2KMC A;  1TZ1 A;  3PPA A;  2LI5 A;  4EEW A;  1V80 A;  1BT0 A;  1SGH A;  3H7P A;  1OQY A;  1WXM A;  3KYD D;  3NZU A;  2UWQ A;  3OLM D;  2RPQ A;  1OTR B;  2MSE D;  1GG3 A;  3ML8 A;  2FCS A;  1WF9 A;  4GMV A;  3B08 A;  4N9F 4;  1WJ4 A;  4WJP A;  4GU2 A;  5IAA C;  2DHZ A;  3H7S A;  3QCA A;  2KC2 A;  3EHV A;  3PRZ A;  2ZZP B;  3QC8 B;  3GZN I;  2DZM A;  2MQJ A;  2LXC A;  3APC A;  2FCM A;  2BKF A;  4DWF A;  3HM3 A;  4GSW A;  4IM0 A;  2LZ6 A;  1SE9 A;  4A3P A;  2DX5 B;  3ZRC A;  1WGD A;  3PRE A;  3PS6 A;  1S1Q B;  4ANV A;  2KHW B;  4KZ0 A;  4PYZ A;  4TKN A;  3PHX B;  4ANW A;  1E8Y A;  4WQO B;  1RLF A;  3ZVV A;  5CHF A;  3VUY A;  3H7P B;  3V62 A;  1D3Z A;  2DZJ A;  3A9K B;  2LGD A;  4MH0 E;  2WDT B;  4B6W A;  1EF1 A;  4GDK A;  2KWC A;  2MBO A;  3Q3J A;  3V61 A;  2KDI A;  4G50 A;  3DOW A;  4BVU C;  2JXX A;  5D94 A;  3KW5 B;  3L16 A;  4G11 A;  4KVG B;  4RMA A;  3M63 B;  4IM3 A;  2ZJD A;  4MSQ B;  3PLV A;  3A33 B;  2WX1 A;  1L2N A;  1E5W A;  3NZS A;  1JRU A;  4DDI D;  1I35 A; 
#chains in the Genus database with same CATH topology
 4QAY A;  1YX6 B;  1M94 A;  1P7E A;  4ZRK A;  2KKC A;  3HHM A;  4IUM B;  4BBN F;  4N59 A;  1LXD A;  4GDL A;  3C8Y A;  1NBF C;  1WGY A;  2D3G A;  3QA8 A;  4YWG G;  2M17 A;  2G1E A;  3QQ8 B;  3RT3 B;  2IDY A;  4MJS B;  2RDG A;  3RYT A;  2WP9 B;  1EUV B;  2BBC A;  1UGJ A;  3TJP A;  3AUL A;  3N1Y C;  2LVQ A;  3ZKJ C;  1N6Z A;  3OJ3 A;  2ASQ A;  4WQM A;  2DYO A;  1WX8 A;  1XLP A;  2K3U A;  3B1L X;  3KYC D;  4E3C A;  3AI5 A;  2JX5 A;  5IO9 A;  5LLI A;  4XDC A;  2N1W A;  1EWY C;  4I6N B;  4OVU A;  3Q3O C;  5IP4 D;  1PQS A;  1I4X A;  3PHW B;  1V5T A;  3VRB B;  3EFC A;  3VR8 B;  1FNU A;  2DZI A;  2GMI C;  2PPH A;  1IP9 A;  3QAR A;  4WJQ A;  1GC7 A;  2V4I B;  2LVO A;  3LB8 C;  5D3I B;  3BYY B;  2G45 B;  2UYZ B;  2PVG C;  3QWZ B;  2KLG A;  4ARI A;  4FAD A;  1XQQ A;  3RI7 C;  4TSS A;  4DHJ B;  1K8R B;  3ZDT A;  4M01 A;  1UEL A;  4JWS C;  3S2A A;  2LVP A;  2FCN A;  2J0M A;  3FKY A;  4NQL B;  3U7D A;  2H88 B;  4W9D A;  1E6E B;  3TEX A;  1WMH B;  3VH3 B;  2BS3 B;  4GLS C;  4REZ A;  1FIQ A;  2Z8L A;  3VTV A;  4XC2 A;  1F9J A;  4JPS A;  3V3X A;  4LDT B;  3AB5 A;  3SD5 A;  4ARC A;  3RN9 C;  2KMM A;  4O1N A;  4MM3 A;  3ZNH B;  3PO0 A;  1V6E A;  2KAJ A;  3I63 C;  1V81 A;  1WX7 A;  5J18 A;  4BOZ B;  3UIP B;  3JW0 X;  1FO4 A;  1V97 A;  1FMA D;  3R3M A;  1QOB A;  1VLB A;  2WXH A;  3TSS A;  4M0W A;  1C78 A;  3ZJV A;  2J0K A;  2K5P A;  1OQQ A;  2KQS A;  2D11 A;  4HVB A;  3V05 A;  1EO6 A;  1HTO A;  4HDO A;  2MBQ A;  2K6D B;  3X0W A;  2I2Y A;  3CWI A;  5C23 A;  4DHZ B;  1MPE A;  1UD7 A;  3Q2A C;  1D5Z C;  4IW0 A;  3RD2 A;  1F77 A;  4FUL A;  1UZX B;  3P4P B;  2LGY A;  2MP2 B;  2N7D A;  4JX1 C;  2KQ7 A;  1QOG A;  4S17 A;  1LGR A;  3P2B A;  3PRP B;  2DBY A;  2NS5 A;  4BKT A;  1WM3 A;  2J42 A;  2IY1 B;  4C80 A;  2L76 A;  2MBH A;  4RM8 A;  3WAL A;  1N60 A;  2KTR B;  2ZPN A;  1J7A A;  2NCN A;  3O13 A;  3AXC A;  1ZDX A;  3W5V B;  3Q6B A;  4NAW B;  4NJ6 A;  1IGD A;  4GN1 A;  2KN4 A;  3WAO A;  1B1Z A;  2XK5 B;  1GUA B;  2C9W B;  4UDU C;  5J2R A;  2N9X A;  2KYW A;  1WE6 A;  1XD3 B;  2OED A;  3ZTD A;  3BK1 A;  3VUX A;  2VH2 A;  1K53 A;  1GAQ B;  2BS4 B;  4PYU A;  1I4G A;  4MGY E;  1L6V A;  2LGI A;  1BML C;  1IBX A;  1EU3 A;  5G5H A;  1T3Q A;  5LXI B;  1E8Z A;  3O65 B;  1WIA A;  3AE1 B;  2IO2 B;  4EFO A;  2L52 A;  3PLU A;  3QK0 A;  2AWT A;  2CR5 A;  4LNO A;  1R4M I;  3ALB A;  2DAJ A;  3NS8 A;  3SEB A;  3R7R A;  2KJ6 A;  3C19 A;  2D2Q A;  3VVW B;  2L7R A;  4BKG A;  2LUM A;  3A9J A;  3V60 A;  4DDG D;  3IBE A;  3MTN B;  5AUI A;  2D07 B;  2FID A;  1UBQ A;  2KDM A;  1RRB A;  2V4L A;  1FEH A;  3B0A A;  2LUE A;  2O2V B;  1N5W A;  3ZLZ A;  1YJ1 A;  1QT9 A;  2LGS A;  4HRS A;  3MFG A;  2KT7 A;  1C3T A;  1E8X A;  2JZ3 B;  4KGT A;  1CJE A;  4RF1 A;  1V86 A;  2IO3 B;  4JQW C;  2IYD B;  1D5M C;  4IWQ A;  3DQV A;  2QEJ C;  1UWM A;  3E9S A;  4TUU A;  1I42 A;  2Q5W D;  4ZRJ A;  5DPW A;  2KJR A;  3JSV B;  5DPR A;  1CK1 A;  3BK2 A;  4NQK E;  2BPS A;  4GIV A;  1YN5 A;  1SXT A;  1V1P B;  1P3Q U;  3H6N A;  3ZW3 A;  2LAS A;  2INN E;  3P1M A;  4P1B C;  2WU5 B;  4XE0 A;  4CHK A;  4A20 A;  1WYW B;  1X1M A;  4FA6 A;  3LXF A;  2O6V B;  2IGD A;  3CST A;  3U8Z A;  1ZDV A;  2H89 B;  3KUC B;  3TBL D;  1FNV A;  3WA0 A;  3ZO5 B;  2C7H A;  4KIK A;  3VAW A;  2JF5 A;  2NMQ A;  3AEB B;  4XDD A;  1CQV A;  4WJO A;  3UQB A;  2ZCC A;  1J0G A;  1TY0 A;  5FR6 A;  4OZB A;  2Y5P A;  4ZYN A;  3SU8 X;  4ZHP A;  1V80 A;  1A70 A;  1SGH A;  1OQY A;  1WXM A;  3NZU A;  3OLM D;  2RPQ A;  1ZP0 B;  2AQ2 B;  5GXG B;  4GU2 A;  5IAA C;  1TS5 A;  1XLO A;  1NEN B;  3GZN I;  3N9Y C;  3APC A;  1BUI C;  4YSX B;  5FK9 C;  2M0A A;  4MT5 A;  4USA A;  3J9C A;  1WGD A;  1S1Q B;  4TKN A;  2WU2 B;  3NZ3 A;  2RMM A;  1C4C A;  2IGG A;  4MH0 E;  2WDT B;  3B9J A;  2Y5C A;  1EF1 A;  3Q3J A;  5EE9 A;  2KDI A;  4G50 A;  4BVU C;  3L16 A;  4RMA A;  3M63 B;  1C9F A;  1E5W A;  3NZS A;  1JRU A;  2FE8 A;  4DDI D;  1QIL A;  2WXI A;  4FJV B;  4OZC A;  2CJO A;  1V49 A;  1ZOY B;  1E10 A;  3DBL I;  1RM6 C;  4XYC A;  2I1K A;  1ZW7 A;  5JZE B;  1OEY A;  2G9H D;  2N9L A;  5CX3 A;  3T3N A;  4N58 A;  2WDR B;  3PVL A;  4OHJ A;  2KLC A;  4L1B A;  2V3P A;  3P42 A;  1VR9 A;  2KX3 A;  5JH5 C;  5G2N A;  2JVC A;  3TEW A;  2REX A;  4J6I A;  1HA5 A;  4ZYS A;  4KKJ A;  4IWO A;  4CQN A;  2EMT A;  2I38 A;  2VH1 A;  1VCB A;  1UBI A;  2VZK D;  2CHW A;  2Y5B B;  4W9E A;  1WXA A;  3Q3M C;  2BF8 B;  3U30 A;  2IO1 B;  3HM6 X;  2K25 A;  4ZRQ A;  3VHT C;  2NBV B;  3DVN U;  2MJE A;  1N61 A;  3L0W B;  3Q8F A;  4HWI B;  4A3O A;  5D2M B;  4HCN B;  3AU5 A;  1ZXI A;  1C4P A;  2JRI B;  3PGE A;  2X8X X;  4MGK E;  3UGB B;  3PV1 A;  3RNC C;  5IKC M;  3AE9 B;  2MLB A;  4KDL B;  2GBJ A;  4C56 C;  4GB9 A;  3KVF B;  2EKE C;  3NRZ A;  2N9E B;  2W54 A;  3H9D A;  3L10 B;  5FKA C;  3JYU A;  3PT2 B;  2RD0 A;  1SIF A;  2JYT A;  2KNB A;  3ZRF A;  5FR3 A;  2QC8 A;  2WWZ A;  3CF6 E;  2RSU A;  3URY A;  1TKE A;  1WH3 A;  2K22 A;  4EE2 A;  1AWD A;  2DZK A;  3I5J C;  1WJ6 A;  4MDK E;  3WCQ A;  5AZG A;  1C76 A;  1KLG D;  2WNM A;  1VRA B;  4P1C C;  5AUK A;  1L4D B;  4W9H A;  1ESF A;  1WI0 A;  2KWV B;  3W2D A;  4CO7 A;  2J4X A;  4LJP B;  2KAN A;  5AEK B;  3VXW A;  3ZNZ B;  4K3B A;  4A9A A;  1KLU D;  4K7S A;  4YL8 A;  2QSD A;  3FIL A;  3A4S C;  4B0M A;  3L13 A;  3ZTC A;  4OW0 A;  3IHP C;  3SFE B;  2BS2 B;  4M02 A;  4LTU A;  4GDK B;  2KFK A;  5EDS A;  1T0Y A;  3TMP B;  3RNG C;  2FIF A;  4MM3 B;  3NVW A;  4G0N B;  1OEY J;  4FBJ B;  3HVD A;  1YQB A;  2PE6 B;  3DPD A;  5HHD G;  2JWU A;  3N32 A;  2K6Q A;  2WYQ A;  2AL6 A;  1L5P A;  2GBM A;  2JZP A;  1SB3 C;  4E71 A;  2WXK A;  5E6O A;  1QQR A;  4HRO A;  4LNN A;  3AEF B;  3CSF A;  2YEP F;  4BAX A;  1WR6 E;  2ICI A;  2G3Q B;  1HZ6 A;  3M95 A;  2FNJ B;  2IO0 B;  2DLB A;  1T6B X;  3AEG B;  3ZIM A;  2MX2 A;  3K9P B;  1HTQ A;  2PLP A;  3BVM A;  2KX0 A;  1L4Z B;  1D6E C;  2SEB D;  2AL3 A;  1K50 A;  2HD5 B;  2V1Y A;  1TBE A;  3RNA C;  4C4V B;  4IKG A;  3A1Q B;  2YVC A;  2QMT A;  4NNJ B;  2WDQ B;  3AEA B;  4OZA A;  1DOX A;  4W9I A;  3SDL C;  4IM2 A;  4US9 A;  4WWP A;  3DBR I;  1BXT A;  1IGC A;  4LLG M;  2JZZ A;  1J8C A;  3RCZ A;  4LNK A;  4M8M A;  2CKH B;  4W9F A;  1OGW A;  2V3N A;  1JWU D;  2L0F A;  2NBU A;  2BWE S;  4TV3 A;  1L0X B;  1PYW D;  1QLB B;  4KV2 A;  1I4P A;  4A6Q A;  2WX0 A;  1IUE A;  1Y8R C;  4D2K A;  1GPX A;  2CHX A;  3KH0 A;  1U4A A;  1TS2 A;  3L08 A;  2K0P A;  1MG8 A;  5H8Y E;  1WXS A;  1S3S G;  2GOW A;  2JXT A;  4KSK C;  1YJI A;  4DQO C;  3FAH A;  5IOI A;  2K8C A;  3SR6 A;  3DVG X;  2KWU B;  2RR9 A;  1E7V A;  2FCQ A;  3ZXR A;  3L54 A;  4MJS A;  4IG7 B;  3AE5 B;  2ZNV B;  2LD9 A;  3ZUN A;  1TYG B;  2HDE A;  4WUR A;  1P1A A;  3U7Z A;  1WWT A;  3ZNI D;  4N6E B;  1P7F A;  2KFJ A;  3Q69 A;  3TL5 A;  5C3J B;  4J3O D;  1PGB A;  5LXH A;  3K9O B;  3A4R A;  4W9K A;  3JVZ X;  3WIM A;  4DHJ D;  1YX5 B;  4HJG E;  3BVZ A;  2OHF A;  2KD0 A;  1QZE A;  2L05 A;  4A55 A;  3EFU A;  1FNW A;  4DXF A;  1E7U A;  1QF6 A;  2UU7 A;  2CU1 A;  1FCC C;  3BWU D;  4GOC A;  5DPT A;  4NPN A;  3TEY A;  4YTN B;  4AP4 C;  3QHT A;  4ICV A;  2BYV E;  2LJ5 A;  3N1Z C;  2PEA A;  1KRH A;  3MJW A;  1L6U A;  2QIE B;  4FN2 A;  1ZPS A;  4L2Y A;  4W9G A;  4EZK A;  1N5X A;  4DXA B;  2NPT B;  1ZXH A;  2ONQ A;  1XCQ L;  2DEN B;  1XF5 L;  1H4R A;  4P16 A;  2N7J A;  4EEW A;  2LHD A;  1BT0 A;  3H7P A;  1KFY B;  3KYD D;  1PGA A;  1F2R C;  1GG3 A;  2BW2 A;  3ML8 A;  2FCS A;  4A8X C;  3R2T A;  2WS3 B;  3HRD D;  3ZGZ A;  4JWU C;  3EHV A;  4US8 A;  5H92 C;  2V9H A;  5T8I A;  3IAM 1;  3AE7 B;  2LXC A;  1WGK A;  4DWF A;  4DXG A;  4WWM A;  2LZ6 A;  1SE9 A;  2DX5 B;  3ZRC A;  3NVY A;  2HJ1 A;  3BVG A;  4ANW A;  1RLF A;  3VUY A;  2DZJ A;  3A9K B;  1JWS D;  2LGD A;  2L1A A;  5MPO A;  3EGR A;  2MEK A;  4IM3 A;  2ZJD A;  4MSQ B;  4ZOH C;  1QOA A;  3PLV A;  2WX1 A;  3BZD B;  2ZW0 A;  4ACF A;  2RPV A;  1FM0 D;  1YN4 A;  2Z0E B;  1IYF A;  2DNF A;  2N4F A;  2BB6 A;  1J7B A;  2MP2 A;  3L4P A;  2RDB C;  3KLS X;  4RFB A;  3GB1 A;  4RF0 A;  4ANX A;  4TQ0 A;  3KWL A;  1MHX A;  4FJZ A;  1SIJ A;  2L0T A;  3ZXV A;  2KTR A;  3AH7 A;  4JLC A;  2W55 A;  4IC7 B;  2N9K A;  4K3C A;  3TEZ A;  4XGA B;  2G4D B;  3Q8B A;  2JUO A;  1LM8 B;  4WWO A;  3SFD B;  5JHB A;  3DDC B;  3DCG A;  3MHZ A;  1ZGU B;  3DHH C;  3MC9 A;  4BKS A;  2C7M B;  3QJZ A;  5BMH A;  2PTL A;  5BMG A;  5E6N A;  1WRI A;  3RZW C;  3MC0 B;  1M4V A;  2OOB B;  1GOZ A;  1PFD A;  3ABV B;  4ANU A;  2TSS A;  3L17 A;  2YEP B;  2K39 A;  5TSS A;  4ZDV A;  3GE8 C;  4BBN C;  2W3S A;  2BVC A;  3SHQ A;  1E0Z A;  1MJD A;  1FXI A;  1VDV A;  3UI3 A;  2LGX A;  5E6P A;  4F1S A;  1KF6 B;  2N9P C;  3RPF C;  1RFA A;  1P98 A;  3NS1 A;  3DVG Y;  2GI9 A;  3DBH B;  2AX5 A;  2L8J A;  4WJN A;  4XWT A;  4EUT A;  2WLB A;  4LCD E;  2BYE A;  4S0R A;  3ETR A;  2J53 A;  2MBB B;  4KGS A;  1G6J A;  4W9J A;  1FPY A;  2PE9 A;  2EKI A;  3RZF A;  4AWJ A;  1E7P B;  2C5L C;  4MEM A;  2CHZ A;  1T5X D;  4LJO B;  4HCP B;  2D3A A;  2K8B A;  1WXV A;  4BOS C;  4IDI A;  4FJY A;  1LFD A;  1N63 A;  4HKZ E;  2WXQ A;  1YN3 A;  2O2V A;  4JE3 B;  1UGM A;  1TGZ B;  1SJH D;  2IZV B;  2N7E A;  1VD2 A;  2NTS A;  5G55 A;  2BB5 A;  3VTW A;  1SF0 A;  4KGR A;  4MGI E;  1XCT L;  4HPL B;  1ZE3 D;  4TMA B;  1A5R A;  3OJ4 B;  4URK A;  4JL9 A;  4II2 B;  4PS3 A;  1STE A;  3GE3 C;  4KZC A;  2O6V D;  1YMH E;  1DGJ A;  1FXT B;  4F7Z A;  4MH8 A;  1NI2 A;  2PKO A;  3IFW B;  3CMM B;  1RAX A;  2L83 A;  4LNI A;  4RH6 A;  1E9M A;  2NBW B;  3PRM B;  2JT4 B;  3Q3F A;  3R7Q A;  2LEK A;  3JSV A;  2AEH A;  3ZNG C;  1JCK B;  4ICU A;  1EU4 A;  1V1P A;  1YOV B;  5EE3 A;  3HK0 A;  4MAC A;  4KX6 B;  2KQ4 X;  1R4N B;  3ZJT A;  1NYR A;  1Q10 A;  4OVZ A;  1K51 A;  2XEW A;  2O6V A;  1PUT A;  5LNK 1;  1E90 A;  1C1Y B;  4I6P A;  1HQR D;  3AE8 B;  4HXD A;  3KUZ A;  3ONS A;  4YT0 B;  2ON8 A;  3I3T B;  1P0R A;  2ZVN A;  4KSL C;  2NR2 A;  5BYS A;  1TS3 A;  3AU4 A;  3C0R B;  2QCZ A;  3Q8A A;  3VRA B;  2MBE A;  1ET9 A;  2JWZ A;  3U4E G;  4GDL B;  3NG0 A;  4LNF A;  2AYO B;  5HG2 A;  1LQB A;  4W9C A;  4YTP B;  5D3D A;  4IOI E;  3IG3 A;  2BTE A;  2JPH A;  2RDH A;  3HIZ A;  3KUD B;  2G4S A;  2W9N A;  4ZHO A;  3UF8 A;  3LYY A;  4NZL B;  4MGZ E;  5D6J B;  3TCA A;  2SAK A;  1R7S A;  2WXM A;  1LO5 D;  2L3Z A;  3N3K B;  2DAF A;  2KDE B;  3OG5 A;  1IPG A;  2W3R A;  2RGF A;  2J0J A;  4RGO S;  1F0Z A;  4B95 A;  5J17 A;  3VUW A;  2XN9 C;  2IBI B;  2JRH A;  3GOE A;  5EE1 A;  4HEA 1;  1JW9 D;  3P63 A;  4EOY A;  2K9X A;  3ZYY X;  3UIN B;  1Q5W B;  5D7G A;  4BZA A;  2GBK A;  1L0Y B;  4C00 A;  1Q0W B;  2INP E;  2A5U A;  5BMI A;  1VZ7 A;  5EE0 A;  1C77 A;  3AEE B;  1WGH A;  1HZ5 A;  2KXJ A;  2WQY B;  2HE7 A;  3DWG C;  3E56 A;  4G3X B;  2K8H A;  5HI1 A;  2KDB A;  1RWS A;  1XXG A;  2FUH B;  3TUO A;  1YNT E;  2V3S A;  2M56 B;  1T0R C;  3DBS A;  2YLM A;  4AUQ C;  2LFI A;  4AOF A;  4B0E A;  1FRD A;  1SE3 A;  1KH0 A;  3EA6 A;  3BIN A;  1T0Q C;  4DK5 A;  3LJ3 A;  5I4D A;  4K7U A;  4AS1 A;  3GP7 A;  1CMX B;  3R66 C;  1EWC A;  3Q3N C;  4M0W B;  2R61 A;  1FRR A;  1T0S C;  1WRD B;  1AW7 A;  2ZEQ A;  2GLS A;  5DCN A;  2IGH A;  1DYQ A;  2MCN B;  3ZJU A;  1OQR A;  2KTF A;  2C60 A;  2OJR A;  2V0G A;  4NAM A;  2JQR B;  4RGM A;  5JXV A;  2WHI A;  3VTU A;  2WXG A;  4XZ4 A;  3PZ8 A;  1FFV A;  4M8N A;  4W9L A;  5BYR A;  2ZPY A;  1I4R A;  1NDD A;  1ROE A;  2WXP A;  5BO4 B;  2KZR A;  1L7Y A;  2HJ8 A;  2NVU I;  2KVZ A;  2PJH A;  3MHS D;  3EEC A;  5CHV C;  3DBR B;  3X23 A;  2BYF A;  1GC6 A;  2R2O A;  1JRP A;  2PW9 A;  1L0V B;  5AZH A;  1JRO A;  1C79 A;  2M4N A;  1YQ3 B;  1TZ1 A;  4M00 A;  2AQ3 B;  3PPA A;  2WGS A;  3RFZ B;  1TJE A;  2AQ1 B;  3N20 C;  2UWQ A;  4L23 A;  1MHH E;  1VZ8 A;  4WJP A;  4N9F 4;  1SBB B;  2DHZ A;  3H7S A;  3QCA A;  2KC2 A;  1JAL A;  1XLN A;  4PT5 A;  4PK1 A;  2ZZP B;  3QC8 B;  2MQJ A;  2FCM A;  3HM3 A;  3ZQ4 A;  1UF0 A;  1YQ4 B;  3PS6 A;  2KHW B;  4KZ0 A;  2NTT A;  3PHX B;  3IT6 B;  4WQO B;  2CU3 A;  1IBX B;  2BYT A;  3H7P B;  3V62 A;  1D3Z A;  2WXO A;  5BYQ A;  3GS2 A;  1HXY D;  1AYF A;  4GDK A;  2KWC A;  3V61 A;  1V8C A;  1FXA A;  3KW5 B;  4G11 A;  4KVG B;  4YSY B;  1DOY A;  3RNF C;  2WXL A;  1N62 A;  2WXN A;  5TR5 A;  2LHE A;  2D3C A;  3P4Q B;  4ZRI A;  3A9J B;  3R8B A;  3AED B;  3UIO B;  1V9J A;  3P4S B;  3PZ7 A;  1JWB D;  1WJU A;  4KKI A;  3N30 A;  4WAF A;  2ZVO A;  3Q14 C;  5HKH A;  2HTM E;  2KDF B;  1GNU A;  4PS8 A;  1CZP A;  4YTM B;  4X57 B;  1JQ4 A;  3QX1 A;  3OAW A;  1JWM D;  1WE7 A;  3RMK C;  1KM7 A;  5JHA A;  3AE4 B;  1WGR A;  1WGG A;  3ECI A;  3V6E B;  2ZNV C;  4HDQ A;  4AQ7 A;  2M8S A;  4LDT D;  4JGH B;  4ASW C;  1TT5 B;  2VRR B;  2GBN A;  4H2A A;  1NVI D;  1SE4 A;  3W1S C;  3M62 B;  2PVO D;  1SE2 A;  4C4V A;  3AE2 B;  2N0S B;  3A1Q A;  2FUG 1;  2KN5 A;  1UH6 A;  3T3O A;  1R4M B;  3NJT A;  3WAN A;  3KWV A;  3VQI A;  3VDZ A;  1JML A;  1WMH A;  1HEZ E;  2CJN A;  5DPS A;  4XX5 A;  3NVZ A;  1GB4 A;  2W82 A;  1KJT A;  3TIX A;  2E6X A;  2LRW A;  1MFW A;  2X38 A;  4KIK B;  4NJ7 A;  4HJK A;  2JYE A;  5C1Z A;  1F2R I;  4RCO A;  2IJ0 A;  3AMZ A;  1TS4 A;  3N1X C;  4RGN A;  1VZ6 A;  2EMS A;  3T9L A;  1ZKH A;  4F8C B;  3VR9 B;  4R3D A;  1AAR A;  3AV8 A;  1ACC A;  1GJZ A;  4I6L B;  4HPP A;  1UUP A;  1VJK A;  1QOF A;  2JSV X;  3APF A;  2BKR B;  4MEL A;  4K1R B;  5CHW A;  1RFK A;  5G5G A;  1ENF A;  1H8C A;  3NY5 A;  1KOT A;  2BQQ A;  3QIJ A;  3WAM A;  4GGQ A;  2MW5 A;  3MP9 A;  5AZF A;  1QKZ A;  3W1S A;  4P6V F;  3Q8C A;  1NYQ A;  4HLE A;  1TZO A;  1KTK A;  2MRP A;  2KOX A;  4BKS D;  4DBG A;  3IVF A;  1WSP A;  4FLH A;  2MJ3 A;  2B3A A;  1MVK A;  1YD8 U;  3BYT B;  2DYB A;  1XLQ A;  3V6C B;  4WAA A;  4CYE A;  2WXF A;  3NUH B;  3W9C B;  3RUI B;  1WYG A;  1WX9 A;  2IY0 B;  2WXJ A;  3DVN V;  2E3T A;  2JU6 X;  2GBR A;  2L00 B;  1I4H A;  4C7Y A;  1OFF A;  4MSM B;  1ISN A;  4NAW A;  2BT6 A;  2MH7 A;  5L95 C;  4B9K A;  2J7Q B;  2C7N B;  3BII D;  3EC8 A;  2M19 A;  2Z0D B;  1WR1 A;  4YSZ B;  2XK5 A;  3ML9 A;  4TQ1 A;  1UNS A;  3MC8 A;  1RYJ A;  5C2T B;  3VH4 B;  1D4B A;  2M0X A;  4E74 A;  4XWW A;  3EUB 2;  2JY6 A;  1MI0 A;  2MHJ A;  3T8M A;  3ENE A;  2MA9 B;  2N1V A;  2A4Z A;  2BGF A;  2ACZ B;  2NPT A;  2XNA C;  1P9D U;  3W1Y A;  1PDX A;  4EKU A;  3P4R B;  2LXA A;  3Q8E A;  2XBB C;  3IT4 B;  4ITK A;  3WAP A;  3NOB A;  2IPK D;  3PZD A;  2M1M A;  5L83 A;  3GZN B;  3DWM A;  3I57 A;  4AJW A;  4ZRP A;  2LJI A;  5KHQ A;  4WWN A;  4Q2J A;  4FXC A;  3HVZ A;  1SJE D;  4AJY B;  4HKQ A;  1Q1O A;  4GXB A;  3KQ4 A;  4II3 B;  3PTF C;  2KJH B;  1TKY A;  1D5X C;  1F52 A;  4HPM B;  2D10 A;  1NEK B;  1TTN A;  2D3B A;  1J7C A;  5KHO A;  5GMV A;  1XO3 A;  2Y3A A;  2HTH A;  4OVV A;  2FAZ A;  2DWQ A;  4KDI C;  1GB1 A;  2WDV B;  4LK0 M;  1V5O A;  2KO3 A;  3A9K A;  2I1J A;  4EZJ A;  3DHG C;  2ZW1 A;  1PGX A;  2LRU A;  3DBL B;  1DOI A;  3B2G A;  3DHI C;  3CIR B;  3UQA A;  2KVR A;  1EF5 A;  2L32 A;  3NHE B;  3H1U A;  1KLV A;  2VZK B;  1WJN A;  1WM2 A;  1JWA D;  2WXR A;  3DBH I;  4JIO U;  2GRI A;  4K81 A;  2PMV A;  1FCL A;  2KMA A;  2IND C;  2DYM A;  1WY8 A;  1I7H A;  3VFK A;  1UWX A;  4RNA A;  1FD6 A;  2Z59 B;  2CS4 A;  1V2Y A;  4NJC A;  1J19 A;  5IA7 A;  1XT9 B;  3PSE B;  1C4A A;  1EM7 A;  1B9R A;  4BFR A;  1WXQ A;  1XEE A;  5E6J A;  2KC1 A;  3I9V 1;  3IXS A;  3AEC B;  4HK2 A;  1V1O A;  3U2S C;  3RNB C;  1HE8 A;  1WZ3 A;  4RM9 A;  4PS7 A;  4K7W A;  3FIL B;  1MG4 A;  1TKG A;  2ZCB A;  2FBW B;  2R2Q A;  3RUL A;  2K1F A;  4YXD B;  3APD A;  3NVV A;  3LDZ E;  2QHO A;  3D32 A;  2KFK B;  3FC4 A;  1WZ0 A;  5HFY A;  4WH4 A;  1YJJ A;  2EEL A;  3ZDM C;  3MJ5 A;  4WIP A;  1R4N I;  3B2F A;  3QAQ A;  4FHJ A;  1TY2 A;  2MWS B;  1SEB D;  3IAS 1;  2KK8 A;  3R2I A;  2BWF A;  1E8W A;  1YIW A;  4FHK A;  4NY0 A;  4A90 A;  4P7I A;  5CTR C;  1AN8 A;  1WFY A;  4RGT A;  1NI3 A;  1TIF A;  2LWP A;  3RNE C;  1Z2M A;  3BY4 B;  1I4Q A;  3H8H A;  3W5U B;  2D5G A;  3M3J A;  2J52 A;  4DHZ E;  2GB1 A;  1Z5S B;  2QDF A;  4IWP A;  4EZL A;  2KMC A;  2LI5 A;  2QJL A;  2B76 B;  1FFU A;  1OTR B;  2KAC A;  2MSE D;  1ZUD 2;  2MJD A;  1WF9 A;  2OJW A;  4GMV A;  2QIL A;  3B08 A;  1WJ4 A;  1Y56 A;  2LMC A;  3PRZ A;  1SSN A;  2DZM A;  2PIA A;  2KWD A;  2BKF A;  4GSW A;  4IM0 A;  4A3P A;  3PRE A;  4ANV A;  4PYZ A;  3AE6 B;  1E8Y A;  3AM9 A;  3HUI A;  2INC C;  3ZVV A;  5CHF A;  4B6W A;  4C7Z A;  2MBO A;  3AE3 B;  3U52 E;  3DOW A;  5IN7 A;  2JXX A;  5D94 A;  1ET6 A;  3OWE B;  1F1H A;  3A33 B;  1K52 A;  1L2N A;  3AN1 A;  1I35 A; 
#chains in the Genus database with same CATH homology
 4FJV B;  1YX6 B;  1V49 A;  2Z0E B;  5TR5 A;  3DBL I;  1M94 A;  1IYF A;  2N4F A;  2MP2 A;  4ZRK A;  4ZRI A;  2I1K A;  3A9J B;  3WA0 A;  1ZW7 A;  5JZE B;  1OEY A;  2KKC A;  4ANX A;  3UIO B;  1V9J A;  3HHM A;  4IUM B;  4TQ0 A;  1WJU A;  4BBN F;  3N30 A;  5CX3 A;  4FJZ A;  1LXD A;  2ZVO A;  3PVL A;  4GDL A;  5HKH A;  2KLC A;  2L0T A;  2KTR A;  2KDF B;  4JLC A;  1NBF C;  1WGY A;  1GNU A;  2D3G A;  3QA8 A;  4IC7 B;  2G4D B;  2JUO A;  1LM8 B;  4WWO A;  2M17 A;  3QQ8 B;  2KX3 A;  4PS8 A;  3RT3 B;  5JHB A;  3DDC B;  3DCG A;  1ZGU B;  4X57 B;  5JH5 C;  4MJS B;  3RYT A;  3QX1 A;  5G2N A;  2JVC A;  3OAW A;  2REX A;  4BKS A;  1EUV B;  4J6I A;  1WE7 A;  2C7M B;  3TJP A;  3QJZ A;  3AUL A;  2LVQ A;  3ZKJ C;  1KM7 A;  5JHA A;  5E6N A;  3OJ3 A;  4IWO A;  2ASQ A;  3RZW C;  1WGR A;  2OOB B;  1WGG A;  2EMT A;  3ECI A;  4ANU A;  3L17 A;  3V6E B;  1VCB A;  2K39 A;  2ZNV C;  1UBI A;  2DYO A;  4HDQ A;  2M8S A;  1WX8 A;  4ZDV A;  2CHW A;  4LDT D;  4JGH B;  2Y5B B;  4ASW C;  2VRR B;  2GBN A;  4W9E A;  1WXA A;  4BBN C;  3B1L X;  2BF8 B;  3U30 A;  3KYC D;  4E3C A;  2IO1 B;  3AI5 A;  3W1S C;  3HM6 X;  3M62 B;  2K25 A;  3SHQ A;  3VHT C;  2NBV B;  5LLI A;  3DVN U;  3A1Q A;  2N1W A;  3L0W B;  4I6N B;  4OVU A;  2KN5 A;  1UH6 A;  2LGX A;  5E6P A;  1PQS A;  4F1S A;  3WAN A;  4HWI B;  3VQI A;  3PHW B;  4A3O A;  1V5T A;  2N9P C;  3VDZ A;  5D2M B;  1RFA A;  4HCN B;  1P98 A;  3AU5 A;  2DZI A;  1WMH A;  2GMI C;  2PPH A;  3DVG Y;  1IP9 A;  5DPS A;  2JRI B;  3QAR A;  4XX5 A;  2L8J A;  3PGE A;  4WJQ A;  4WJN A;  1GC7 A;  4EUT A;  1KJT A;  4MGK E;  3TIX A;  3UGB B;  4LCD E;  2LVO A;  2BYE A;  3PV1 A;  2LRW A;  4KIK B;  2MBB B;  4HJK A;  4NJ7 A;  5C1Z A;  2G45 B;  2UYZ B;  1G6J A;  2MLB A;  4KDL B;  2GBJ A;  2PE9 A;  3QWZ B;  4W9J A;  3RZF A;  4AWJ A;  2KLG A;  4GB9 A;  4FAD A;  3KVF B;  2C5L C;  2EKE C;  1XQQ A;  2N9E B;  4MEM A;  2CHZ A;  2EMS A;  3H9D A;  3L10 B;  4LJO B;  4HCP B;  3JYU A;  3T9L A;  4DHJ B;  3PT2 B;  1K8R B;  1ZKH A;  2RD0 A;  3ZDT A;  2K8B A;  1WXV A;  4F8C B;  4BOS C;  1UEL A;  1SIF A;  4FJY A;  3S2A A;  1LFD A;  2KNB A;  2LVP A;  1AAR A;  3ZRF A;  2FCN A;  2WWZ A;  3CF6 E;  2J0M A;  2RSU A;  4NQL B;  2O2V A;  1WH3 A;  3U7D A;  4W9D A;  1GJZ A;  1UGM A;  1TGZ B;  1WMH B;  2DZK A;  2IZV B;  2N7E A;  1WJ6 A;  4I6L B;  3VH3 B;  1VD2 A;  5G55 A;  3VTW A;  3VTV A;  4MDK E;  4MGI E;  4XC2 A;  4HPL B;  3APF A;  2BKR B;  4MEL A;  1A5R A;  1F9J A;  4K1R B;  3OJ4 B;  5AZG A;  5CHW A;  4URK A;  4JL9 A;  4II2 B;  4PS3 A;  4LDT B;  3SD5 A;  1H8C A;  1KOT A;  3NY5 A;  4MM3 A;  3ZNH B;  3QIJ A;  4KZC A;  1V6E A;  4W9H A;  2O6V D;  3WAM A;  4GGQ A;  1WI0 A;  2KWV B;  1V81 A;  2MW5 A;  5AZF A;  1WX7 A;  5J18 A;  1FXT B;  3W1S A;  4BOZ B;  3UIP B;  3JW0 X;  4CO7 A;  4F7Z A;  4LJP B;  2KAN A;  1NI2 A;  3VXW A;  5AEK B;  3ZNZ B;  3R3M A;  4HLE A;  3IFW B;  3CMM B;  1RAX A;  2MRP A;  2KOX A;  4BKS D;  4DBG A;  3IVF A;  4FLH A;  2NBW B;  4K7S A;  3PRM B;  2B3A A;  2JT4 B;  3Q3F A;  4YL8 A;  3R7Q A;  3JSV A;  1YD8 U;  2AEH A;  3A4S C;  2DYB A;  3L13 A;  3ZNG C;  2J0K A;  3V6C B;  4WAA A;  3ZTC A;  4ICU A;  4CYE A;  3RUI B;  2KQS A;  3IHP C;  1WX9 A;  2IY0 B;  3DVN V;  3HK0 A;  4GDK B;  2KFK A;  2D11 A;  4HVB A;  5EDS A;  2GBR A;  1EO6 A;  1T0Y A;  2L00 B;  4HDO A;  2MBQ A;  3TMP B;  4MSM B;  2K6D B;  2FIF A;  3X0W A;  2XEW A;  2O6V A;  1ISN A;  4NAW A;  5C23 A;  1E90 A;  4G0N B;  1C1Y B;  1UD7 A;  4I6P A;  1OEY J;  4DHZ B;  4FBJ B;  5L95 C;  4B9K A;  2J7Q B;  2C7N B;  4HXD A;  3EC8 A;  3KUZ A;  3ONS A;  3ZO5 B;  4IW0 A;  2Z0D B;  3RD2 A;  1YQB A;  1WR1 A;  2PE6 B;  3DPD A;  2XK5 A;  3ML9 A;  3I3T B;  1UZX B;  4FUL A;  4TQ1 A;  3N32 A;  2LGY A;  1P0R A;  2MP2 B;  2N7D A;  2K6Q A;  2WYQ A;  3VH4 B;  2M0X A;  2KQ7 A;  2ZVN A;  4E74 A;  2AL6 A;  2JY6 A;  4KSL C;  2NR2 A;  3T8M A;  3AU4 A;  3ENE A;  2GBM A;  3C0R B;  3P2B A;  4E71 A;  3PRP B;  2MA9 B;  2N1V A;  2NS5 A;  1WM3 A;  2A4Z A;  2BGF A;  4BKT A;  2NPT A;  5E6O A;  2MBE A;  2IY1 B;  2JWZ A;  1P9D U;  2L76 A;  3W1Y A;  2MBH A;  3CSF A;  4GDL B;  4RM8 A;  3WAL A;  4EKU A;  1WR6 E;  2AYO B;  2KTR B;  2ZPN A;  2LXA A;  2NCN A;  1LQB A;  4W9C A;  2XBB C;  3WAP A;  3AXC A;  2G3Q B;  3NOB A;  4NAW B;  4NJ6 A;  3PZD A;  2M1M A;  4GN1 A;  5L83 A;  3M95 A;  2FNJ B;  3WAO A;  4AJW A;  2IO0 B;  3IG3 A;  5KHQ A;  4WWN A;  3ZIM A;  2JPH A;  2MX2 A;  2XK5 B;  3K9P B;  3HIZ A;  1GUA B;  4AJY B;  2C9W B;  1Q1O A;  3KUD B;  4GXB A;  2G4S A;  4II3 B;  2W9N A;  3PTF C;  2KJH B;  5J2R A;  2N9X A;  1WE6 A;  3UF8 A;  2KX0 A;  1XD3 B;  4HPM B;  2D10 A;  3ZTD A;  3VUX A;  1TTN A;  4MGZ E;  5D6J B;  2AL3 A;  3TCA A;  2HD5 B;  4PYU A;  5KHO A;  2L3Z A;  3N3K B;  2V1Y A;  2DAF A;  2KDE B;  4MGY E;  1TBE A;  3A1Q B;  2YVC A;  5GMV A;  2HTH A;  4OVV A;  4NNJ B;  1IPG A;  2FAZ A;  4KDI C;  2RGF A;  2J0J A;  5LXI B;  1V5O A;  1E8Z A;  2KO3 A;  3A9K A;  2I1J A;  4EZJ A;  4W9I A;  4B95 A;  3O65 B;  5J17 A;  3SDL C;  1WIA A;  3VUW A;  2IO2 B;  4EFO A;  2LRU A;  3PLU A;  4IM2 A;  2IBI B;  3QK0 A;  2JRH A;  3GOE A;  4WWP A;  3DBR I;  2AWT A;  3UQA A;  2CR5 A;  2JZZ A;  4EOY A;  3RCZ A;  1J8C A;  2KVR A;  1EF5 A;  4M8M A;  1R4M I;  2CKH B;  1OGW A;  4W9F A;  3NHE B;  1Q5W B;  3ALB A;  2DAJ A;  5D7G A;  3UIN B;  3NS8 A;  2L0F A;  3H1U A;  1KLV A;  3R7R A;  2GBK A;  2NBU A;  2KJ6 A;  1Q0W B;  2BWE S;  4TV3 A;  1WJN A;  2A5U A;  1WM2 A;  2D2Q A;  3VVW B;  3DBH I;  4JIO U;  2L7R A;  4K81 A;  4BKG A;  3A9J A;  3V60 A;  4KV2 A;  4DDG D;  3IBE A;  1WGH A;  2KMA A;  3MTN B;  2DYM A;  1WY8 A;  2D07 B;  2KXJ A;  2WX0 A;  1Y8R C;  2FID A;  2CHX A;  1UBQ A;  3KH0 A;  1RRB A;  1U4A A;  2HE7 A;  2V4L A;  3VFK A;  3L08 A;  3B0A A;  1MG8 A;  4G3X B;  2LUE A;  2Z59 B;  1WXS A;  1S3S G;  2K8H A;  2CS4 A;  2GOW A;  2O2V B;  1V2Y A;  2KDB A;  1J19 A;  3ZLZ A;  1YJ1 A;  2FUH B;  4KSK C;  5IA7 A;  1XT9 B;  3PSE B;  2K8C A;  2V3S A;  3DBS A;  4AUQ C;  4AOF A;  2YLM A;  1C3T A;  3DVG X;  1E8X A;  2JZ3 B;  2KWU B;  1E7V A;  2FCQ A;  2RR9 A;  3L54 A;  4MJS A;  4IG7 B;  3BIN A;  2ZNV B;  4BFR A;  4DK5 A;  2KC1 A;  1V86 A;  2LD9 A;  3ZUN A;  3LJ3 A;  2IO3 B;  4HK2 A;  1P1A A;  4JQW C;  3ZNI D;  2IYD B;  1HE8 A;  4IWQ A;  2KFJ A;  3DQV A;  4K7U A;  1WZ3 A;  4RM9 A;  3TL5 A;  4TUU A;  4PS7 A;  1I42 A;  1CMX B;  4K7W A;  3R66 C;  4ZRJ A;  4M0W B;  5DPW A;  2KJR A;  5LXH A;  3JSV B;  3A4R A;  3K9O B;  5DPR A;  4W9K A;  4NQK E;  2BPS A;  2ZCB A;  1WRD B;  3JVZ X;  4GIV A;  1YX5 B;  3WIM A;  4DHJ D;  2R2Q A;  2KD0 A;  3RUL A;  1QZE A;  2K1F A;  1P3Q U;  2L05 A;  3H6N A;  2ZEQ A;  3APD A;  5DCN A;  3EFU A;  3LDZ E;  2MCN B;  3ZW3 A;  2QHO A;  3D32 A;  2KFK B;  2LAS A;  1E7U A;  2KTF A;  2C60 A;  1WZ0 A;  2CU1 A;  2OJR A;  4CHK A;  4A20 A;  1WYW B;  1X1M A;  3VTU A;  4GOC A;  5DPT A;  4NPN A;  4FA6 A;  4XZ4 A;  2O6V B;  4AP4 C;  3QHT A;  4ICV A;  3CST A;  2BYV E;  3U8Z A;  3ZDM C;  3KUC B;  3TBL D;  4M8N A;  4W9L A;  1R4N I;  2LJ5 A;  2C7H A;  2ZPY A;  1NDD A;  3QAQ A;  2PEA A;  4FHJ A;  4KIK A;  2KZR A;  5BO4 B;  2MWS B;  1L7Y A;  3MJW A;  3VAW A;  2KK8 A;  2BWF A;  2HJ8 A;  1E8W A;  1YIW A;  4FN2 A;  2JF5 A;  4FHK A;  4NY0 A;  2NVU I;  2PJH A;  4W9G A;  3MHS D;  4P7I A;  5CTR C;  4EZK A;  1WFY A;  4WJO A;  3EEC A;  5CHV C;  3UQB A;  4DXA B;  3X23 A;  2NPT B;  2LWP A;  2BYF A;  2ZCC A;  1J0G A;  1Z2M A;  5FR6 A;  3BY4 B;  1GC6 A;  2R2O A;  4ZYN A;  3M3J A;  3SU8 X;  2DEN B;  4DHZ E;  5AZH A;  1H4R A;  1Z5S B;  4EZL A;  4IWP A;  2M4N A;  2KMC A;  1TZ1 A;  3PPA A;  2LI5 A;  4EEW A;  1V80 A;  1BT0 A;  1SGH A;  3H7P A;  1OQY A;  1WXM A;  3KYD D;  3NZU A;  2UWQ A;  3OLM D;  2RPQ A;  1OTR B;  2MSE D;  1GG3 A;  3ML8 A;  2FCS A;  1WF9 A;  4GMV A;  3B08 A;  4N9F 4;  1WJ4 A;  4WJP A;  4GU2 A;  5IAA C;  2DHZ A;  3H7S A;  3QCA A;  2KC2 A;  3EHV A;  3PRZ A;  2ZZP B;  3QC8 B;  3GZN I;  2DZM A;  2MQJ A;  2LXC A;  3APC A;  2FCM A;  2BKF A;  4DWF A;  3HM3 A;  4GSW A;  4IM0 A;  2LZ6 A;  1SE9 A;  4A3P A;  2DX5 B;  3ZRC A;  1WGD A;  3PRE A;  3PS6 A;  1S1Q B;  4ANV A;  2KHW B;  4KZ0 A;  4PYZ A;  4TKN A;  3PHX B;  4ANW A;  1E8Y A;  4WQO B;  1RLF A;  3ZVV A;  5CHF A;  3VUY A;  3H7P B;  3V62 A;  1D3Z A;  2DZJ A;  3A9K B;  2LGD A;  4MH0 E;  2WDT B;  4B6W A;  1EF1 A;  4GDK A;  2KWC A;  2MBO A;  3Q3J A;  3V61 A;  2KDI A;  4G50 A;  3DOW A;  4BVU C;  2JXX A;  5D94 A;  3KW5 B;  3L16 A;  4G11 A;  4KVG B;  4RMA A;  3M63 B;  4IM3 A;  2ZJD A;  4MSQ B;  3PLV A;  3A33 B;  2WX1 A;  1L2N A;  1E5W A;  3NZS A;  1JRU A;  4DDI D;  1I35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...