2BPSA

Ubiquitin-like protein yukd of bacillus subtilis
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
b'HGSYIDITIDLKHYNGSVFDLRLSDYHPVKKVIDIAWQAQSVSMPPREGHWIRVVNKDKVFSGECKLSDCGITNGDRLEIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YUKD PROTEIN
publication title Crystal Structure of Ubiquitin-Like Protein Yukd from Bacillus Subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ubiquitin
total genus 22
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08817 YukD WXG100 protein secretion system (Wss), protein YukD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2bpsA00
2C9WB 4EEWA 1FXTB 3PREA 4RM8A 2MWSB 2KWVB 3CF6E 2J0MA 2LVPA 1YX6B 3JSVB 3N3KB 1ZGUB 3NHEB 5D2MB 3H7SA 5GMVA 4W9FA 5J18A 1WX9A 3AU4A 4HVBA 3ZW3A 2QHOA 3WIMA 4BKGA 1WM2A 2EMSA 4HJKA 2UWQA 4W9IA 3WA0A 4ANXA 5JH5C 4NJ7A 5JHAA 2L00B 2YLMA 4GMVA 3AI5A 4M0WB 3NZSA 2JPHA 2MQJA 2J0KA 2LRUA 2AEHA 3A9KB 4P7IA 2O2VA 4DHJB 2KZRA 2FCNA 2LVOA 3I3TB 4BOSC 2KQ7A 4OVUA 4FHJA 2BKRB 3M3JA 4LCDE 4DHZE 1Q5WB 3PS6A 2JRHA 3S2AA 1K8RB 1YQBA 2GBNA 3KYDD 2EKEC 3H7PB 2MP2A 4IG7B 1LXDA 1ISNA 2KN5A 5BO4B 4BBNC 2JVCA 1AARA 3QIJA 3VFKA 1QZEA 3LDZE 4DWFA 4NJ6A 3ZUNA 4KIKA 2J7QB 2C60A 3VTUA 3KW5B 4FBJB 4MDKE 3A33B 1H4RA 2XK5B 2JZZA 5E6OA 4IM2A 4HDOA 3PLUA 2REXA 4BFRA 5EDSA 4HK2A 2L76A 3VAWA 1Z5SB 3QJZA 4AP4C 2CHZA 2DZJA 2D3GA 4IUMB 4MJSA 1V9JA 4GIVA 4NQKE 3U8ZA 5LXHA 1R4NI 2IY1B 2KKCA 3RT3B 1E8YA 4WWNA 3RD2A 3DBLI 3QK0A 1S3SG 2FIDA 2LXAA 3APCA 2LI5A 3WALA 1WGYA 1YIWA 2M17A 4KSKC 5AZGA 3VH4B 2D2QA 4JQWC 3VTWA 2NR2A 1A5RA 2LVQA 3R66C 1WX7A 3MJWA 1V81A 3PRZA 2UYZB 3H1UA 3KUDB 2O2VB 1UZXB 3MHSD 1I35A 3DCGA 4W9JA 5LXIB 1GC6A 5CHVC 3QC8B 3KVFB 4EFOA 2DX5B 2JRIB 4BKSD 2MP2B 4F8CB 1M94A 3UIPB 2R2QA 2NPTA 3A9JA 1WGDA 1J19A 3V61A 4JLCA 4PYUA 4XC2A 3ZO5B 2PE9A 4HDQA 4KIKB 2XEWA 1UD7A 5CTRC 4NY0A 4W9LA 3ZLZA 4ZRIA 3SDLC 5AEKB 3N30A 2LASA 2AWTA 4NAWA 3RCZA 2EMTA 2ZCBA 5JHBA 2OJRA 3UQBA 1C3TA 4HLEA 4XZ4A 4W9HA 2KTRA 3PHXB 3DBHI 1F9JA 1SE9A 5DPTA 1OEYJ 2KC2A 3R3MA 2KDFB 4K7WA 2KO3A 2Y5BB 4MJSB 2WWZA 4ICVA 1KLVA 1UGMA 1WXVA 2WYQA 4FA6A 2N9EB 4B95A 4M8NA 3EC8A 3L16A 2MBHA 3TIXA 2HTHA 4F7ZA 3B1LX 4II3B 2KMCA 4E74A 3L17A 5L83A 3JW0X 3QARA 1OGWA 4LJPB 5JZEB 4FADA 1V80A 1OTRB 5KHQA 1E7VA 2J0JA 2KOXA 2V3SA 2MBOA 3QCAA 1IP9A 1EO6A 4DK5A 2M1MA 4EKUA 1WI0A 3RZFA 1VCBA 4NPNA 2MW5A 3VHTC 3ZNZB 4A3OA 1GNUA 1VD2A 4AOFA 3UQAA 1L7YA 2MA9B 3OLMD 2FCQA 2NPTB 2L0FA 3A9JB 1EF5A 4EZKA 2NBVB 2WDTB 3V60A 4GDLA 4FULA 2K6DB 4F1SA 4MGZE 2I1KA 1YD8U 4KV2A 4WJPA 2IO3B 3VXWA 2M8SA 2KTFA 4NAWB 2O6VD 1TZ1A 2HD5B 4GB9A 4JGHB 2K8HA 2L05A 4ANUA 2IY0B 2G4SA 2KTRB 4ZDVA 1V49A 4BKSA 4BVUC 2VRRB 1WE6A 2MBQA 3DOWA 3L0WB 1PQSA 1WX8A 3DBSA 1EUVB 2L7RA 4DHZB 2KX3A 3ZVVA 1NBFC 4IWPA 3ZRFA 4WJQA 2DHZA 4KZ0A 3M62B 4HWIB 2DAJA 3LJ3A 3IVFA 5D7GA 2N7DA 3BINA 2LXCA 4CO7A 3JYUA 4EZLA 3PVLA 4WWPA 2OOBB 3SD5A 3ECIA 3PPAA 1UH6A 2KLGA 4GOCA 2C7NB 2B3AA 5E6PA 3VUYA 3ZNGC 5DPWA 2DZKA 3PSEB 2KWUB 3ML9A 1WIAA 3QQ8B 1G6JA 2KX0A 3VUWA 2NVUI 4W9DA 4DHJD 5D94A 1IYFA 2BYEA 4FJYA 1HE8A 2BF8B 3APDA 3VTVA 3K9OB 3W1SC 4WJOA 4RMAA 2BWFA 1LQBA 1V5OA 4KDIC 4ICUA 2D11A 3QAQA 1WH3A 3GZNI 1YJ1A 4FJZA 4GXBA 3RULA 2KHWB 3T8MA 4DBGA 4A3PA 2NBWB 2N7EA 1P3QU 1TBEA 2PE6B 4WQOB 4IC7B 2LUEA 2L3ZA 2RGFA 4GDLB 1Q1OA 2IBIB 1CMXB 2N1WA 3RUIB 5HKHA 1IPGA 1UBQA 1E8ZA 1UBIA 1WYWB 2NCNA 3RZWC 4I6NB 3VUXA 1NDDA 4G50A 2KK8A 5LLIA 3SU8X 5AZHA 4DXAB 3TCAA 4IWOA 2JZ3B 2DYMA 2CHWA 2BYFA 3A4SC 5TR5A 2MBBB 5IAAC 3ZIMA 5D6JB 3PHWB 1XD3B 2GOWA 3KYCD 1RFAA 4G11A 5E6NA 3WANA 4IW0A 1LFDA 4EOYA 1C1YB 3WAMA 2KFKA 3KUZA 3DVGX 1WR1A 2ZNVC 2O6VA 2DAFA 2KDEB 3OJ3A 2BKFA 2RD0A 2FCMA 5AZFA 3UGBB 4K7UA 2G3QB 2NBUA 2AL3A 4KSLC 4URKA 3C0RB 4HCNB 4WWOA 4E3CA 3V6EB 4AJYB 4MM3A 4RM9A 2A5UA 2KJRA 4CYEA 1E8XA 2LRWA 1SGHA 1WE7A 5CHFA 5C1ZA 1XQQA 1WGRA 3R7QA 3CSTA 1RLFA 3L08A 2K39A 4KVGB 2M4NA 3ZNHB 2BYVE 5L95C 3AXCA 3JVZX 2IO1B 3L13A 3CMMB 2IZVB 1P98A 3IFWB 3CSFA 3HM3A 2KD0A 3Q3FA 4BBNF 1J0GA 5FR6A 2AYOB 2R2OA 4LDTD 4N9F4 3PRMB 1WGHA 2KWCA 1L2NA 2ZZPB 4W9CA 2IO2B 2KJ6A 3AU5A 3UIOB 2JWZA 1KM7A 1GG3A 2YVCA 2MLBA 3ZNID 1Y8RC 5J17A 1NI2A 1E7UA 1GUAB 1WJ4A 3QA8A 4BKTA 2PEAA 3RYTA 2LGXA 4MGYE 2NS5A 2LZ6A 3D32A 1P0RA 1P9DU 2Z0EB 3NY5A 2KFKB 3OAWA 2C7HA 1T0YA 4PS3A 3P2BA 2RR9A 1KOTA 1X1MA 2O6VB 4NQLB 3UF8A 2G45B 3NZUA 2D10A 3TJPA 2K8CA 4G0NB 4ZYNA 2KJHB 4II2B 2JT4B 2BGFA 2KANA 4CHKA 3ENEA 3IBEA 3NOBA 4GN1A 2RSUA 4W9EA 2GBKA 4TQ0A 1EF1A 1WF9A 4B6WA 2DYBA 2K6QA 2N1VA 3IG3A 4ANVA 3A4RA 2KMAA 2LGDA 4GGQA 4GDKA 1WJ6A 2GBRA 3R7RA 3KUCB 4WJNA 3APFA 4B9KA 4X57B 1J8CA 2K8BA 1WR6E 1WRDB 3W1YA 4ASWC 2V1YA 3ZRCA 3O65B 1ZW7A 2MBEA 4MGIE 4MELA 4MH0E 4TUUA 3V62A 3TL5A 4A20A 3DBRI 2DENB 3T9LA 5J2RA 2KDBA 4JIOU 1WJUA 2CHXA 1E5WA 3VH3B 2KFJA 3M95A 1WXSA 1WJNA 3V6CB 4K1RB 3IHPC 2ZPNA 3DVNV 4FN2A 4J6IA 2BWES 5G2NA 2I1JA 2FIFA 2GBMA 2M0XA 3KH0A 3ZTCA 4K7SA 1E8WA 2L0TA 3SHQA 3VQIA 4W9KA 2MCNB 1U4AA 1WXMA 2MRPA 1KJTA 2ZVNA 3ONSA 4FLHA 3QWZB 2AL6A 2K25A 1TTNA 2KQSA 4ANWA 1WXAA 4XX5A 1V5TA 2JY6A 4MGKE 5C23A 2ZNVB 3DVNU 3U30A 2ASQA 4PS8A 2N4FA 2GMIC 1E90A 4BOZB 1RAXA 4W9GA 1WMHA 2CKHB 1V2YA 3WAOA 4PS7A 1V6EA 5DCNA 2N9PC 3VDZA 2G4DB 4WAAA 2FCSA 2MX2A 1JRUA 2PPHA 3UINB 1BT0A 2ZEQA 2HJ8A 3ALBA 1OQYA 3ZDMC 2LD9A 4MSMB 1S1QB 2KLCA 1I42A 2WX1A 3DQVA 1GJZA 3ML8A 1Q0WB 3H6NA 2JUOA 2DZMA 3A1QA 4I6LB 2MSED 3VVWB 3L54A 3HIZA 4GDKB 5DPRA 1UELA 3DDCB 2W9NA 4M8MA 4OVVA 4PYZA 5KHOA 2LGYA 3PLVA 2V4LA 3ZDTA 4KDLB 4I6PA 2CR5A 4MEMA 3MTNB 1R4MI 2C7MB 3ZKJC 4FHKA 3EFUA 2FUHB 2IYDB 3L10B 3M63B 1WGGA 2N9XA 3DVGY 2HE7A 5CX3A 1SIFA 2WX0A 3PGEA 3X0WA 4NNJB 3X23A 1MG8A 2DZIA 2C5LC 2ZPYA 4TKNA 4DDID 4FJVB 2JF5A 3W1SA 2K1FA 3JSVA 1GC7A 3WAPA 3DPDA 1XT9B 1WM3A 4K81A 2DYOA 3GOEA 4ZRKA 2BPSA 4EZJA 1V86A 3PTFC 3ZTDA 2JXXA 4TQ1A 5CHWA 3TBLD 3B08A 2LJ5A 3QHTA 4IWQA 2KDIA 4IM0A 1Z2MA 1WY8A 3HM6X 5DPSA 2CS4A 3PT2B 4E71A 1RRBA 2RPQA 2XBBC 1WFYA 3A9KA 4HCPB 4G3XB 4HPLB 4TV3A 1WMHB 2KXJA 4LDTB 3QX1A 2PJHA 4AUQC 3K9PB 4KZCA 2KVRA 2KC1A 2KNBA 2LWPA 4HPMB 4IM3A 2FNJB 1D3ZA 2ZCCA 1P1AA 4HXDA 4GU2A 3NS8A 1TGZB 5G55A 2A4ZA 3HK0A 3H7PA 3N32A 4DDGD 1WZ3A 2L8JA 3OJ4B 1OEYA 3AULA 4LJOB 4YL8A 3A1QB 2FAZA 3U7DA 4EUTA 1YX5B 1ZKHA 3B0AA 3PV1A 2CU1A 4ZRJA 1LM8B 3PRPB 2IO0B 3EHVA 1H8CA 3HHMA 3H9DA 2GBJA 3Q3JA 4AWJA 2D07B 3BY4B 4JL9A 3TMPB 4AJWA 1WZ0A 5IA7A 4MSQB 2Z0DB 2Z59B 2XK5A 2ZJDA 3PZDA 2ZVOA 4GSWA 3EECA
chains in the Genus database with same CATH superfamily
3P4SB 4A8XC 4M01A 3PREA 3CF6E 1TZOA 2LVPA 3JSVB 1F2RI 4YSXB 1N63A 1ZGUB 2MJEA 5D2MB 3MHZA 5LNK1 3WIMA 2BYTA 2EMSA 2UWQA 1N5WA 3ZJVA 3NVVA 3LYYA 3DHGC 4GMVA 3AI5A 2MQJA 4C7ZA 3A9KB 2O2VA 2KZRA 2FCNA 3I5JC 4R3DA 2BKRB 3M3JA 3KWVA 3PS6A 2JRHA 1K8RB 2GBNA 3KYDD 2EKEC 3H7PB 1LXDA 2KN5A 2RDBC 5BO4B 4BBNC 2WDRB 3QIJA 4NJ6A 5H92C 3U7ZA 3ZUNA 4FBJB 5E6OA 2WXKA 3TSSA 2H89B 2RMMA 3P1MA 3CWIA 3QJZA 2H88B 2D3GA 4MJSA 3U8ZA 5LXHA 1K53A 2KKCA 4A55A 3RT3B 4N59A 1S3SG 2LXAA 1WGYA 5AZGA 3AE6B 2ACZB 1KRHA 1A5RA 2LVQA 3R66C 4YTMB 5IO9A 2UYZB 3CIRB 2DLBA 1HQRD 4UDUC 3Q3NC 4W9JA 2V3NA 1F2RC 4L1BA 3AE7B 5CHVC 1XLPA 3FILA 3KVFB 4S0RA 3AEBB 3RPFC 2JRIB 4XYCA 4BKSD 2MP2B 3UIPB 3I63C 3V61A 4PYUA 1C78A 1EWYC 1UD7A 1NYRA 1B1ZA 5AEKB 2AWTA 1C3TA 4W9HA 4Q2JA 2KTRA 3DBHI 1F9JA 1OEYJ 4K7WA 2J42A 4ICVA 1UGMA 4RCOA 3ZYYX 4M8NA 2HTHA 3B1LX 1Q10A 1RYJA 1R4MB 4LNNA 5L83A 1J7AA 1OGWA 3NJTA 2LHDA 1OTRB 3AE5B 4M00A 1FD6A 1EO6A 3HVDA 3AE3B 2MW5A 3ZNZB 3AEAB 5BYQA 3OLMD 4N58A 3Q6BA 3BWUD 1JW9D 4GDLA 2K6DB 5HI1A 1SIJA 4WJPA 3TEYA 2QC8A 1SB3C 2HD5B 3KWLA 2G4SA 4BKSA 5BYRA 1WE6A 3L0WB 2L7RA 2KX3A 3GE8C 4WJQA 1STEA 1CZPA 2DAJA 3IVFA 4WIPA 2N7DA 2LXCA 4EZLA 1FEHA 3PVLA 4WWPA 3PPAA 2L1AA 1UH6A 2KLGA 5DPWA 3PSEB 3ZJTA 1G6JA 5FK9C 2V3PA 5G5HA 2NVUI 1FCCC 2BYEA 2RPVA 3NVYA 3VTVA 3K9OB 4WJOA 4RMAA 1LQBA 4ICUA 3RULA 3GZNI 4DBGA 3C8YA 1P3QU 1MHHE 2PKOA 3TEZA 4IC7B 4ITKA 2N1WA 1IPGA 1UBQA 1UBIA 4I6NB 4TMAB 1NDDA 4G50A 1AYFA 2KK8A 5AZHA 4HKZE 4DXFA 3A4SC 5TR5A 2KN4A 2MBBB 2WHIA 1FM0D 4A90A 3BYTB 3KYCD 1LFDA 1OFFA 2MJ3A 2KFKA 4KGSA 1WR1A 2ZNVC 1BMLC 2DAFA 3OJ3A 5AZFA 1GB1A 4B0MA 4C00A 3EGRA 3PZ8A 4RM9A 2DWQA 2A5UA 4CYEA 1XLOA 5IKCM 1SF0A 1D5MC 2L83A 1WGRA 2K3UA 3L08A 3Q3OC 3BVMA 2XNAC 2BYVE 2MJDA 5L95C 1YOVB 2IZVB 3IFWB 1M4VA 1TS4A 2KD0A 4BBNF 1J0GA 4XDDA 2AYOB 4LDTD 2ZZPB 1KM7A 2YVCA 2I38A 3RN9C 3NG0A 5J17A 1NI2A 3RYTA 1HTQA 2XN9C 4MGYE 2LZ6A 2C7HA 4PS3A 1KOTA 1L4ZB 1X1MA 2O6VB 3TEXA 2KJHB 3IBEA 4LK0M 4W9EA 2K6QA 4MM3B 4GGQA 3KUCB 4X57B 2GLSA 5BMIA 4BZAA 4ASWC 3ZRCA 1ZW7A 2MBEA 4A20A 3DBRI 3VR8B 2V4IB 2M19A 4JIOU 1YNTE 3RNAC 1T0QC 1XCQL 3V6CB 4J3OD 4J6IA 3KH0A 3ETRA 3VQIA 3ZJUA 1GOZA 1AWDA 2MCNB 2QMTA 4C4VA 2MRPA 3AEDB 1KJTA 3NVZA 1FNWA 2AL6A 3AMZA 2KQSA 4WURA 2GMIC 3IXSA 1E90A 3R2TA 1WMHA 4PS7A 2CJNA 5D3IB 4ZHOA 4WAAA 2MX2A 1B9RA 2G1EA 1S1QB 1GJZA 3SFDB 4I6LB 3VVWB 3L54A 3HIZA 1GB4A 2R61A 5DPRA 4OW0A 1C76A 1SE4A 4PYZA 4I6PA 4MEMA 4L2YA 4DXGA 3EFUA 4WQMA 3L10B 3M63B 2JX5A 2HE7A 4NNJB 4TKNA 4DDID 2JF5A 3W1SA 2JXTA 1SBBB 3WAPA 3DPDA 1QQRA 1D4BA 4EZJA 2BPSA 3PTFC 1AN8A 1DGJA 4KKJA 2LJ5A 1Z2MA 2HDEA 1C4PA 1CQVA 4M0WA 3P4PB 1UNSA 4TV3A 2LHEA 4D2KA 1IBXA 1WGKA 2KVRA 3BZDB 2WXNA 4HJGE 2KDMA 2ZCCA 1I4GA 4DDGD 1L6UA 5H8YE 3U7DA 4ZRJA 3NUHB 3EHVA 2QILA 3HHMA 5G5GA 5EE1A 1NYQA 3TMPB 4MSQB 2Z59B 2ZJDA 1E0ZA 4GSWA 4FA6A 3SR6A 2C9WB 4TSSA 2J0MA 1YX6B 3NHEB 5GMVA 5J18A 1WX9A 3AU4A 2IPKD 3ZW3A 4BKGA 2SAKA 1WM2A 4EE2A 5JH5C 4RGNA 5FR3A 5JHAA 1FFVA 2JPHA 2J0KA 4P7IA 2G9HD 3Q14C 2LVOA 4BOSC 2BS3B 2HJ1A 4FHJA 4LCDE 1Q5WB 1FCLA 1EU4A 1ISNA 3VFKA 1FO4A 4KIKA 1L0YB 1EM7A 2C60A 3VTUA 4MDKE 3A33B 2XK5B 2JZZA 1L4DB 2KQ4X 3PLUA 1YQ4B 2B76B 5EDSA 1FXIA 3R2IA 4HK2A 2L76A 1Z5SB 2CHZA 2WXJA 2JU6X 4GIVA 2QIEB 3GE3C 3DBLI 5BMHA 1N61A 3APCA 3HRDD 2M17A 4KSKC 3VTWA 1VZ6A 2L32A 3PRZA 4AQ7A 3KUDB 2O2VB 3DCGA 2N9LA 2JZPA 3QC8B 1J7BA 1QOGA 3O13A 4OZAA 2YEPF 2WNMA 3A9JA 1WGDA 4JLCA 4XC2A 2BB6A 3ZO5B 5T8IA 2PE9A 4JWSC 2AX5A 3ZLZA 2GI9A 2ZCBA 1JWBD 4KGTA 4MACA 2KO3A 2Y5BB 4MJSB 1BUIC 1WYGA 2JSVX 3BIID 1N5XA 2KMCA 1V1OA 3I57A 4IDIA 3L17A 1XEEA 4REZA 5JZEB 1YMHE 2KOXA 1YN3A 2RDHA 3FILB 1VDVA 2BTEA 4A3OA 3LB8C 1GNUA 4AOFA 2MA9B 1KTKA 2BT6A 1NENB 1YD8U 4OHJA 3U52E 1JWMD 2WXPA 2VZKD 1K51A 1QOAA 4JGHB 2K8HA 1WXQA 3MC0B 2IY0B 2KTRB 4ANUA 4ZDVA 1V49A 4BVUC 2MBQA 3AEFB 3DOWA 1PQSA 1GAQB 3URYA 4ZRQA 3BYYB 3E56A 4DHZB 1ZE3D 3ZVVA 1ZDXA 1ZOYB 5IOIA 4KZ0A 5D7GA 4HWIB 2X38A 1XXGA 2PW9A 4YSYB 3SD5A 4GOCA 5E6PA 2C7NB 2B3AA 2DZKA 1JQ4A 3VR9B 3ZXVA 3VUWA 2KMMA 1EWCA 1IYFA 1HE8A 2BWFA 3Q8EA 1V5OA 3QAQA 4FJZA 1YJ1A 4ARCA 2KHWB 3E9SA 4A3PA 2N7EA 1I4RA 1QILA 3H8HA 4GDLB 1I4PA 3EUB2 2D3CA 2LUMA 4DXAB 5LLIA 4YTNB 4KX6B 2CHWA 5HHDG 3C19A 1PGBA 3HVZA 3ZIMA 5D6JB 1P7FA 3PHWB 3RFZB 3WANA 4G11A 2WXFA 5MPOA 2AQ2B 1C1YB 1SSNA 1QT9A 3LXFA 2PIAA 4AS1A 2LMCA 2NMQA 3Q69A 4XE0A 2LFIA 3GB1A 1IGCA 3AM9A 4K7UA 2NBUA 3TEWA 1CK1A 4AJYB 2QDFA 2ZW0A 1E8XA 2LRWA 5HG2A 3RNCC 4KVGB 1VJKA 2IO1B 1TS3A 3L13A 3CMMB 3HM3A 1T5XD 4O1NA 3HUIA 3P4QB 1HA5A 4N9F4 1VZ8A 4HROA 2WXMA 3AE8B 1TY0A 4WAFA 1LO5D 4HRSA 3ZNID 3QA8A 1GUAB 4BKTA 1VLBA 2LGXA 1P9DU 2Z0EB 3NY5A 2KFKB 3OAWA 4XGAB 1T0YA 3FC4A 1XLNA 2KAJA 4NQLB 3UF8A 1I4XA 3Q8BA 3U4EG 3DBHB 2KANA 4CHKA 3P42A 3NOBA 2IGHA 1EU3A 1WF9A 1ZP0B 3IG3A 3A4RA 2KMAA 4GDKA 3R7RA 1J8CA 1DOYA 1QF6A 1KFYB 2V1YA 3SEBA 3O65B 2LGIA 4MGIE 1DOIA 3V62A 3TL5A 2DENB 3T9LA 5J2RA 1WJUA 1F1HA 2CHXA 3VH3B 5C3JB 3M95A 1SE3A 1WJNA 5IN7A 1N6ZA 1PDXA 2ZPNA 2BWES 2M0XA 4K7SA 1E8WA 2L0TA 3SHQA 1U4AA 2ZVNA 3RNFC 2BB5A 1WXAA 1V5TA 4HKQA 3BVZA 2J53A 2ZNVB 2VH2A 4PS8A 4BOZB 1RAXA 2N9PC 1QKZA 3ZDMC 2WX1A 3A1QA 2DZMA 1MJDA 1T3QA 2W9NA 4M8MA 4OVVA 5KHOA 1V1PA 2LGYA 4KDLB 2IYDB 4YTPB 3DVGY 3X23A 1MG8A 2C5LC 2ZPYA 4FJVB 1F0ZA 5BMGA 3GZNB 3UI3A 1GC7A 1WM3A 4C4VB 1V86A 2JXXA 4TQ1A 1KLGD 4IM0A 3HM6X 2CS4A 2RPQA 2XBBC 4HCPB 1WMHB 4LDTB 3QX1A 4ZRPA 4AUQC 3K9PB 2KC1A 2DNFA 1D3ZA 1P1AA 4HXDA 4GU2A 3NS8A 1TGZB 1WZ3A 2L8JA 3AULA 2E3TA 1YX5B 1ZKHA 3B0AA 1LM8B 1D6EC 3PRPB 3W2DA 2D07B 1E6EB 1JROA 5IA7A 2Z0DB 1FXTB 2KWVB 4HEA1 1FRRA 1QOBA 3H7SA 2OHFA 3VRAB 2INDC 4HJKA 3WA0A 1V97A 2WLBA 4NJ7A 2L00B 1HZ6A 4JX1C 4M0WB 3NZSA 1TJEA 1NVID 4DHJB 1HXYD 1IBXB 3I3TB 2KQ7A 4OVUA 1RM6C 4L23A 4DHZE 2KWDA 3RMKC 1PGAA 1D5XC 4DWFA 4H2AA 2J7QB 2WXLA 1PYWD 3BVGA 2NTSA 3AE1B 1OQQA 4IM2A 4HDOA 1XLQA 1VRAB 3VAWA 3W5UB 2E6XA 3GP7A 3U2SC 1VR9A 1V9JA 1MG4A 4YXDB 4RGOS 1R4NI 2IY1B 1FIQA 1E8YA 3RD2A 3QK0A 1HEZE 3WALA 1YIWA 4P16A 2D2QA 3DBRB 2DBYA 1WX7A 3MJWA 1V8CA 4ARIA 1I7HA 2IGGA 1UZXB 3EA6A 1I35A 5LXIB 1GC6A 1TKGA 2EKIA 2K22A 4EFOA 4C7YA 1Y56A 1N60A 4F8CB 2J4XA 2NPTA 1J19A 2L52A 2JYTA 3IAM1 1JCKB 4HDQA 4KIKB 2XEWA 2NTTA 1YN4A 3RNEC 1FRDA 3N30A 2KACA 1MPEA 4NAWA 2EMTA 5JHBA 2OJRA 3UQBA 1SE9A 5DPTA 5E6JA 2KC2A 3R3MA 4RGMA 2WWZA 1WXVA 3RNGC 1BXTA 3DWGC 2V0GA 3L16A 2MBHA 3TIXA 4F7ZA 5C2TB 4II3B 2TSSA 4WH4A 3JW0X 3QARA 4LJPB 2GB1A 2EELA 4FADA 5KHQA 1UF0A 4XWWA 1JMLA 1T0SC 4DK5A 4EKUA 1WI0A 2D3BA 1VCBA 4NPNA 3MP9A 1VD2A 1L7YA 2FCQA 3A9JB 2L0FA 1L5PA 3AECB 4EZKA 3EFCA 2WDTB 2BS2B 3IAS1 2WDVB 4FULA 4YWGG 2I1KA 1XCTL 5BYSA 3B2FA 1WRIA 2M8SA 2WXGA 2ONQA 1TZ1A 2MEKA 1GPXA 1WX8A 1EUVB 2GRIA 2LGSA 4ZYSA 2DHZA 2IGDA 5EE3A 3LJ3A 3AH7A 1WSPA 2MH7A 2VH1A 4CO7A 2KT7A 3ECIA 2W82A 3ZNGC 3VUYA 1WWTA 2KWUB 3ML9A 1WIAA 2WQYB 3QQ8B 2JWUA 3BK1A 1FXAA 2Y5CA 5TSSA 4FJYA 3APDA 1PFDA 4KDIC 4ZOHC 3FAHA 4GXBA 2LEKA 3T8MA 2N0SB 2NBWB 3ZGZA 2PE6B 2LUEA 1CMXB 3RUIB 5D3DA 2PTLA 1E8ZA 1MFWA 1CJEA 3SFEB 3Q8AA 3SU8X 1QLBB 3DWMA 2BYFA 3RI7C 1XD3B 3NZ3A 1RFAA 1XO3A 4ZHPA 5EE9A 4EOYA 3KUZA 3DVGX 2RD0A 3N1YC 2FCMA 4NZLB 3UGBB 2G3QB 1YQ3B 2AL3A 4KSLC 2WXHA 4URKA 4HCNB 3WCQA 3P63A 1AW7A 3MC9A 3DBLB 5C1ZA 1WE7A 5CHFA 2JQRB 3R7QA 2MHJA 1C4CA 4KGRA 3JVZX 2ON8A 2BVCA 3AE2B 4GLSC 1P98A 3CSFA 3Q3FA 2W3SA 3V3XA 5FR6A 2R2OA 2KWCA 1L2NA 5FKAC 2IO2B 2KJ6A 3UIOB 2JWZA 1E7PB 2MLBA 5JXVA 3KLSX 1E7UA 2PEAA 1K52A 2NS5A 3D32A 3P2BA 2RR9A 2PMVA 2G45B 2VZKB 2D10A 3NZUA 2K8CA 4II2B 4HPPA 4YT0B 2BGFA 4K3BA 3ENEA 1SJHD 1YN5A 5AUKA 2GBKA 3B2GA 1EF1A 4TQ0A 4B6WA 2N1VA 1VZ7A 2LGDA 2GBRA 4WJNA 1SE2A 2K8BA 1WR6E 1C4AA 3OG5A 2FBWB 4TUUA 2X8XX 4WWMA 1K50A 2KDBA 1C77A 1RFKA 1E5WA 2KFJA 1C9FA 4K1RB 4JWUC 4FN2A 2FIFA 2GBMA 2IDYA 1F77A 5I4DA 3ONSA 1TKYA 4LLGM 1P7EA 2K25A 1A70A 2OJWA 3DHHC 4FXCA 4ANWA 4XX5A 3MJ5A 1E9MA 4MGKE 5C23A 3U30A 2ASQA 2N4FA 1TIFA 3MC8A 3VDZA 2G4DB 1JRUA 2ZEQA 3ALBA 1R7SA 3IT6B 2KLCA 3W9CB 2UU7A 3Q2AC 3ML8A 3H6NA 2MSED 2WDQB 4GDKB 1UELA 3DDCB 2FUG1 1L0VB 2ZW1A 3PLVA 2V4LA 3ZDTA 2CR5A 3MTNB 1R4MI 1QOFA 2K5PA 4FHKA 3ZKJC 2FUHB 3KQ4A 2WXOA 1WGGA 2N9XA 4RNAA 2WXQA 3JSVA 4K81A 1YJJA 2DYOA 3GOEA 1ET6A 4USAA 3ZTDA 1TY2A 1WY8A 3Q8CA 1RRBA 1ZUD2 2CJOA 2W3RA 1WFYA 3A9KA 4HPLB 4G3XB 2KXJA 4N6EB 4KZCA 4KKIA 4HPMB 2RDGA 3AV8A 3GS2A 2A4ZA 3N32A 3H7PA 3OJ4B 1PUTA 3A1QB 2FAZA 3Q8FA 1OQRA 4EUTA 3PV1A 2CU1A 1H8CA 1V1PB 3H9DA 4AWJA 3TUOA 4AJWA 3UINB 3QCAA 2BBCA 1JWUD 1I4QA 1FNUA 4EEWA 3ZQ4A 4RM8A 2MWSB 3N3KB 2W55A 4W9FA 3OWEB 4HVBA 1KH0A 2QHOA 2Y5PA 2INPE 4W9IA 4ANXA 3ZXRA 3DHIC 2YLMA 2KYWA 4IOIE 2LRUA 2AEHA 4QAYA 4P1CC 1XF5L 1MHXA 3IT4B 4P1BC 3S2AA 1YQBA 2MP2A 4IG7B 1L6VA 2JVCA 1AARA 1QZEA 3LDZE 1JRPA 4NAMA 2KVZA 4PT5A 1DYQA 3KW5B 2PLPA 1TT5B 1NI3A 1H4RA 2HTME 1L0XB 2PVOD 2REXA 4BFRA 3FKYA 4AP4C 2DZJA 4IUMB 1LGRA 1FMAD 4NQKE 2WXIA 3N9YC 1ZDVA 4WWNA 2QJLA 3T3OA 2FIDA 2INCC 3P4RB 2AQ3B 2LI5A 3VH4B 2D5GA 1F52A 4JQWC 2NR2A 1FFUA 1V81A 2QEJC 3H1UA 5EE0A 2WU5B 3MHSD 1PGXA 2N9KA 2DX5B 2M0AA 1M94A 2R2QA 1KLUD 1UUPA 3N1XC 5CTRC 4NY0A 4W9LA 4ZRIA 3SDLC 2LASA 2YEPB 3RCZA 1C79A 1TS2A 4HLEA 4XZ4A 3V05A 3PHXB 4NJCA 3BK2A 2BW2A 2KDFB 3AEEB 2JYEA 1KLVA 2WXRA 2WYQA 3MFGA 2N9EB 4B95A 1FPYA 3EC8A 1ZXIA 1HTOA 4E74A 3L4PA 1N62A 1J7CA 1V80A 1E7VA 2J0JA 2V3SA 4US9A 2MBOA 2K9XA 1IP9A 2W54A 4IKGA 4A6QA 2M1MA 3RZFA 2N7JA 2M56B 3VHTC 3UQAA 3AE4B 1UWMA 2NPTB 1EF5A 2NBVB 3NVWA 1ROEA 3V60A 4F1SA 4MGZE 4KV2A 2J52A 2IO3B 3VXWA 2KTFA 4NAWB 2O6VD 4GB9A 2CU3A 2L05A 4LNFA 2VRRB 4LNKA 4A9AA 3DBSA 3AEGB 1NBFC 4IWPA 3NS1A 3ZRFA 3M62B 3BINA 3JYUA 2LJIA 2OOBB 2OEDA 3W5VB 1ET9A 2V9HA 1JWAD 1IGDA 4DQOC 2KX0A 4OZBA 4B0EA 4W9DA 4DHJD 5D94A 4CQNA 2BF8B 3W1SC 2D11A 1WH3A 2K0PA 3N1ZC 4MH8A 1TBEA 1TKEA 2WP9B 4P6VF 2QSDA 4WQOB 4JPSA 2L3ZA 2RGFA 1Q1OA 2IBIB 1ZPSA 5HKHA 4M02A 3VRBB 1WYWB 2NCNA 3RZWC 4XDCA 3VUXA 3T3NA 3TCAA 4IWOA 2JZ3B 2BS4B 2DYMA 4RF1A 2SEBD 2FE8A 5IAAC 1ACCA 2GOWA 1JWSD 5E6NA 4IW0A 3WAMA 1JALA 1UGJA 1T6BX 1I4HA 3NRZA 2O6VA 2KDEB 2BKFA 4OVZA 2BQQA 3C0RB 4WWOA 1R4NB 4S17A 4E3CA 3V6EB 2PVGC 4JE3B 4MM3A 1D5ZC 2KJRA 1SGHA 1XQQA 2QCZA 4K3CA 3CSTA 1RLFA 2K39A 4YSZB 3ZNHB 2M4NA 2I2YA 3AXCA 4LNIA 5GXGB 3J9CA 4RH6A 1HZ5A 3PZ7A 3PRMB 1WGHA 4W9CA 1FNVA 3AU5A 4C80A 1GG3A 5AUIA 2Z8LA 1Y8RC 4ACFA 1WJ4A 1P0RA 2Q5WD 4OZCA 3R8BA 1NEKB 1E10A 1ZXHA 1RWSA 3TJPA 4G0NB 4ZYNA 2JT4B 2WS3B 4GN1A 2RSUA 1T0RC 4MT5A 2DYBA 2WGSA 3RNBC 4ANVA 4LTUA 1WJ6A 4B9KA 3APFA 4RGTA 1WRDB 3W1YA 3B9JA 4LNOA 1TYGB 3AB5A 3N20C 4MELA 4MH0E 1MVKA 1TS5A 1WXSA 3ABVB 3IHPC 3DVNV 5G2NA 2I1JA 3ZTCA 4BAXA 4W9KA 1ENFA 5HFYA 1IUEA 1WXMA 4C56C 2D3AA 4FLHA 2Y3AA 3QWZB 1TTNA 1KF6B 2JY6A 3DVNU 4W9GA 2CKHB 1V2YA 3WAOA 1V6EA 5DCNA 2FCSA 2PPHA 1BT0A 2HJ8A 1OQYA 2LD9A 4MSMB 1I42A 3DQVA 4RFBA 1Q0WB 1YJIA 2JUOA 1MI0A 4US8A 3AN1A 2C7MB 1UWXA 5CX3A 1SIFA 2WX0A 3PGEA 3X0WA 4PK1A 2DZIA 1ESFA 1SEBD 2WU2B 2K1FA 1SXTA 1DOXA 2INNE 1XT9B 4ZRKA 5IP4D 5CHWA 3TBLD 3B08A 3QHTA 4IWQA 2KDIA 5DPSA 3PT2B 4E71A 3I9V1 4XWTA 2PJHA 3AE9B 2KNBA 2LWPA 3Q3MC 4IM3A 4RF0A 2FNJB 2AQ1B 5G55A 3HK0A 4LJOB 1OEYA 4YL8A 2IJ0A 2IO0B 2ICIA 2GBJA 3Q3JA 3BY4B 4JL9A 3PO0A 1WZ0A 1SJED 2XK5A 3PZDA 2ZVOA 3EECA
chains in the Genus database with same CATH topology
2C9WB 4EEWA 1FXTB 3PREA 4RM8A 2MWSB 2KWVB 3CF6E 2J0MA 2LVPA 1YX6B 3JSVB 3N3KB 1ZGUB 3NHEB 5D2MB 3H7SA 5GMVA 4W9FA 5J18A 1WX9A 3AU4A 4HVBA 3ZW3A 2QHOA 3WIMA 4BKGA 1WM2A 2EMSA 4HJKA 2UWQA 4W9IA 3WA0A 4ANXA 5JH5C 4NJ7A 5JHAA 2L00B 2YLMA 4GMVA 3AI5A 4M0WB 3NZSA 2JPHA 2MQJA 2J0KA 2LRUA 2AEHA 3A9KB 4P7IA 2O2VA 4DHJB 2KZRA 2FCNA 2LVOA 3I3TB 4BOSC 2KQ7A 4OVUA 4FHJA 2BKRB 3M3JA 4LCDE 4DHZE 1Q5WB 3PS6A 2JRHA 3S2AA 1K8RB 1YQBA 2GBNA 3KYDD 2EKEC 3H7PB 2MP2A 4IG7B 1LXDA 1ISNA 2KN5A 5BO4B 4BBNC 2JVCA 1AARA 3QIJA 3VFKA 1QZEA 3LDZE 4DWFA 4NJ6A 3ZUNA 4KIKA 2J7QB 2C60A 3VTUA 3KW5B 4FBJB 4MDKE 3A33B 1H4RA 2XK5B 2JZZA 5E6OA 4IM2A 4HDOA 3PLUA 2REXA 4BFRA 5EDSA 4HK2A 2L76A 3VAWA 1Z5SB 3QJZA 4AP4C 2CHZA 2DZJA 2D3GA 4IUMB 4MJSA 1V9JA 4GIVA 4NQKE 3U8ZA 5LXHA 1R4NI 2IY1B 2KKCA 3RT3B 1E8YA 4WWNA 3RD2A 3DBLI 3QK0A 1S3SG 2FIDA 2LXAA 3APCA 2LI5A 3WALA 1WGYA 1YIWA 2M17A 4KSKC 5AZGA 3VH4B 2D2QA 4JQWC 3VTWA 2NR2A 1A5RA 2LVQA 3R66C 1WX7A 3MJWA 1V81A 3PRZA 2UYZB 3H1UA 3KUDB 2O2VB 1UZXB 3MHSD 1I35A 3DCGA 4W9JA 5LXIB 1GC6A 5CHVC 3QC8B 3KVFB 4EFOA 2DX5B 2JRIB 4BKSD 2MP2B 4F8CB 1M94A 3UIPB 2R2QA 2NPTA 3A9JA 1WGDA 1J19A 3V61A 4JLCA 4PYUA 4XC2A 3ZO5B 2PE9A 4HDQA 4KIKB 2XEWA 1UD7A 5CTRC 4NY0A 4W9LA 3ZLZA 4ZRIA 3SDLC 5AEKB 3N30A 2LASA 2AWTA 4NAWA 3RCZA 2EMTA 2ZCBA 5JHBA 2OJRA 3UQBA 1C3TA 4HLEA 4XZ4A 4W9HA 2KTRA 3PHXB 3DBHI 1F9JA 1SE9A 5DPTA 1OEYJ 2KC2A 3R3MA 2KDFB 4K7WA 2KO3A 2Y5BB 4MJSB 2WWZA 4ICVA 1KLVA 1UGMA 1WXVA 2WYQA 4FA6A 2N9EB 4B95A 4M8NA 3EC8A 3L16A 2MBHA 3TIXA 2HTHA 4F7ZA 3B1LX 4II3B 2KMCA 4E74A 3L17A 5L83A 3JW0X 3QARA 1OGWA 4LJPB 5JZEB 4FADA 1V80A 1OTRB 5KHQA 1E7VA 2J0JA 2KOXA 2V3SA 2MBOA 3QCAA 1IP9A 1EO6A 4DK5A 2M1MA 4EKUA 1WI0A 3RZFA 1VCBA 4NPNA 2MW5A 3VHTC 3ZNZB 4A3OA 1GNUA 1VD2A 4AOFA 3UQAA 1L7YA 2MA9B 3OLMD 2FCQA 2NPTB 2L0FA 3A9JB 1EF5A 4EZKA 2NBVB 2WDTB 3V60A 4GDLA 4FULA 2K6DB 4F1SA 4MGZE 2I1KA 1YD8U 4KV2A 4WJPA 2IO3B 3VXWA 2M8SA 2KTFA 4NAWB 2O6VD 1TZ1A 2HD5B 4GB9A 4JGHB 2K8HA 2L05A 4ANUA 2IY0B 2G4SA 2KTRB 4ZDVA 1V49A 4BKSA 4BVUC 2VRRB 1WE6A 2MBQA 3DOWA 3L0WB 1PQSA 1WX8A 3DBSA 1EUVB 2L7RA 4DHZB 2KX3A 3ZVVA 1NBFC 4IWPA 3ZRFA 4WJQA 2DHZA 4KZ0A 3M62B 4HWIB 2DAJA 3LJ3A 3IVFA 5D7GA 2N7DA 3BINA 2LXCA 4CO7A 3JYUA 4EZLA 3PVLA 4WWPA 2OOBB 3SD5A 3ECIA 3PPAA 1UH6A 2KLGA 4GOCA 2C7NB 2B3AA 5E6PA 3VUYA 3ZNGC 5DPWA 2DZKA 3PSEB 2KWUB 3ML9A 1WIAA 3QQ8B 1G6JA 2KX0A 3VUWA 2NVUI 4W9DA 4DHJD 5D94A 1IYFA 2BYEA 4FJYA 1HE8A 2BF8B 3APDA 3VTVA 3K9OB 3W1SC 4WJOA 4RMAA 2BWFA 1LQBA 1V5OA 4KDIC 4ICUA 2D11A 3QAQA 1WH3A 3GZNI 1YJ1A 4FJZA 4GXBA 3RULA 2KHWB 3T8MA 4DBGA 4A3PA 2NBWB 2N7EA 1P3QU 1TBEA 2PE6B 4WQOB 4IC7B 2LUEA 2L3ZA 2RGFA 4GDLB 1Q1OA 2IBIB 1CMXB 2N1WA 3RUIB 5HKHA 1IPGA 1UBQA 1E8ZA 1UBIA 1WYWB 2NCNA 3RZWC 4I6NB 3VUXA 1NDDA 4G50A 2KK8A 5LLIA 3SU8X 5AZHA 4DXAB 3TCAA 4IWOA 2JZ3B 2DYMA 2CHWA 2BYFA 3A4SC 5TR5A 2MBBB 5IAAC 3ZIMA 5D6JB 3PHWB 1XD3B 2GOWA 3KYCD 1RFAA 4G11A 5E6NA 3WANA 4IW0A 1LFDA 4EOYA 1C1YB 3WAMA 2KFKA 3KUZA 3DVGX 1WR1A 2ZNVC 2O6VA 2DAFA 2KDEB 3OJ3A 2BKFA 2RD0A 2FCMA 5AZFA 3UGBB 4K7UA 2G3QB 2NBUA 2AL3A 4KSLC 4URKA 3C0RB 4HCNB 4WWOA 4E3CA 3V6EB 4AJYB 4MM3A 4RM9A 2A5UA 2KJRA 4CYEA 1E8XA 2LRWA 1SGHA 1WE7A 5CHFA 5C1ZA 1XQQA 1WGRA 3R7QA 3CSTA 1RLFA 3L08A 2K39A 4KVGB 2M4NA 3ZNHB 2BYVE 5L95C 3AXCA 3JVZX 2IO1B 3L13A 3CMMB 2IZVB 1P98A 3IFWB 3CSFA 3HM3A 2KD0A 3Q3FA 4BBNF 1J0GA 5FR6A 2AYOB 2R2OA 4LDTD 4N9F4 3PRMB 1WGHA 2KWCA 1L2NA 2ZZPB 4W9CA 2IO2B 2KJ6A 3AU5A 3UIOB 2JWZA 1KM7A 1GG3A 2YVCA 2MLBA 3ZNID 1Y8RC 5J17A 1NI2A 1E7UA 1GUAB 1WJ4A 3QA8A 4BKTA 2PEAA 3RYTA 2LGXA 4MGYE 2NS5A 2LZ6A 3D32A 1P0RA 1P9DU 2Z0EB 3NY5A 2KFKB 3OAWA 2C7HA 1T0YA 4PS3A 3P2BA 2RR9A 1KOTA 1X1MA 2O6VB 4NQLB 3UF8A 2G45B 3NZUA 2D10A 3TJPA 2K8CA 4G0NB 4ZYNA 2KJHB 4II2B 2JT4B 2BGFA 2KANA 4CHKA 3ENEA 3IBEA 3NOBA 4GN1A 2RSUA 4W9EA 2GBKA 4TQ0A 1EF1A 1WF9A 4B6WA 2DYBA 2K6QA 2N1VA 3IG3A 4ANVA 3A4RA 2KMAA 2LGDA 4GGQA 4GDKA 1WJ6A 2GBRA 3R7RA 3KUCB 4WJNA 3APFA 4B9KA 4X57B 1J8CA 2K8BA 1WR6E 1WRDB 3W1YA 4ASWC 2V1YA 3ZRCA 3O65B 1ZW7A 2MBEA 4MGIE 4MELA 4MH0E 4TUUA 3V62A 3TL5A 4A20A 3DBRI 2DENB 3T9LA 5J2RA 2KDBA 4JIOU 1WJUA 2CHXA 1E5WA 3VH3B 2KFJA 3M95A 1WXSA 1WJNA 3V6CB 4K1RB 3IHPC 2ZPNA 3DVNV 4FN2A 4J6IA 2BWES 5G2NA 2I1JA 2FIFA 2GBMA 2M0XA 3KH0A 3ZTCA 4K7SA 1E8WA 2L0TA 3SHQA 3VQIA 4W9KA 2MCNB 1U4AA 1WXMA 2MRPA 1KJTA 2ZVNA 3ONSA 4FLHA 3QWZB 2AL6A 2K25A 1TTNA 2KQSA 4ANWA 1WXAA 4XX5A 1V5TA 2JY6A 4MGKE 5C23A 2ZNVB 3DVNU 3U30A 2ASQA 4PS8A 2N4FA 2GMIC 1E90A 4BOZB 1RAXA 4W9GA 1WMHA 2CKHB 1V2YA 3WAOA 4PS7A 1V6EA 5DCNA 2N9PC 3VDZA 2G4DB 4WAAA 2FCSA 2MX2A 1JRUA 2PPHA 3UINB 1BT0A 2ZEQA 2HJ8A 3ALBA 1OQYA 3ZDMC 2LD9A 4MSMB 1S1QB 2KLCA 1I42A 2WX1A 3DQVA 1GJZA 3ML8A 1Q0WB 3H6NA 2JUOA 2DZMA 3A1QA 4I6LB 2MSED 3VVWB 3L54A 3HIZA 4GDKB 5DPRA 1UELA 3DDCB 2W9NA 4M8MA 4OVVA 4PYZA 5KHOA 2LGYA 3PLVA 2V4LA 3ZDTA 4KDLB 4I6PA 2CR5A 4MEMA 3MTNB 1R4MI 2C7MB 3ZKJC 4FHKA 3EFUA 2FUHB 2IYDB 3L10B 3M63B 1WGGA 2N9XA 3DVGY 2HE7A 5CX3A 1SIFA 2WX0A 3PGEA 3X0WA 4NNJB 3X23A 1MG8A 2DZIA 2C5LC 2ZPYA 4TKNA 4DDID 4FJVB 2JF5A 3W1SA 2K1FA 3JSVA 1GC7A 3WAPA 3DPDA 1XT9B 1WM3A 4K81A 2DYOA 3GOEA 4ZRKA 2BPSA 4EZJA 1V86A 3PTFC 3ZTDA 2JXXA 4TQ1A 5CHWA 3TBLD 3B08A 2LJ5A 3QHTA 4IWQA 2KDIA 4IM0A 1Z2MA 1WY8A 3HM6X 5DPSA 2CS4A 3PT2B 4E71A 1RRBA 2RPQA 2XBBC 1WFYA 3A9KA 4HCPB 4G3XB 4HPLB 4TV3A 1WMHB 2KXJA 4LDTB 3QX1A 2PJHA 4AUQC 3K9PB 4KZCA 2KVRA 2KC1A 2KNBA 2LWPA 4HPMB 4IM3A 2FNJB 1D3ZA 2ZCCA 1P1AA 4HXDA 4GU2A 3NS8A 1TGZB 5G55A 2A4ZA 3HK0A 3H7PA 3N32A 4DDGD 1WZ3A 2L8JA 3OJ4B 1OEYA 3AULA 4LJOB 4YL8A 3A1QB 2FAZA 3U7DA 4EUTA 1YX5B 1ZKHA 3B0AA 3PV1A 2CU1A 4ZRJA 1LM8B 3PRPB 2IO0B 3EHVA 1H8CA 3HHMA 3H9DA 2GBJA 3Q3JA 4AWJA 2D07B 3BY4B 4JL9A 3TMPB 4AJWA 1WZ0A 5IA7A 4MSQB 2Z0DB 2Z59B 2XK5A 2ZJDA 3PZDA 2ZVOA 4GSWA 3EECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C9W B;  4EEW A;  1FXT B;  3PRE A;  4RM8 A;  2MWS B;  2KWV B;  3CF6 E;  2J0M A;  2LVP A;  1YX6 B;  3JSV B;  3N3K B;  1ZGU B;  3NHE B;  5D2M B;  3H7S A;  5GMV A;  4W9F A;  5J18 A;  1WX9 A;  3AU4 A;  4HVB A;  3ZW3 A;  2QHO A;  3WIM A;  4BKG A;  1WM2 A;  2EMS A;  4HJK A;  2UWQ A;  4W9I A;  3WA0 A;  4ANX A;  5JH5 C;  4NJ7 A;  5JHA A;  2L00 B;  2YLM A;  4GMV A;  3AI5 A;  4M0W B;  3NZS A;  2JPH A;  2MQJ A;  2J0K A;  2LRU A;  2AEH A;  3A9K B;  4P7I A;  2O2V A;  4DHJ B;  2KZR A;  2FCN A;  2LVO A;  3I3T B;  4BOS C;  2KQ7 A;  4OVU A;  4FHJ A;  2BKR B;  3M3J A;  4LCD E;  4DHZ E;  1Q5W B;  3PS6 A;  2JRH A;  3S2A A;  1K8R B;  1YQB A;  2GBN A;  3KYD D;  2EKE C;  3H7P B;  2MP2 A;  4IG7 B;  1LXD A;  1ISN A;  2KN5 A;  5BO4 B;  4BBN C;  2JVC A;  1AAR A;  3QIJ A;  3VFK A;  1QZE A;  3LDZ E;  4DWF A;  4NJ6 A;  3ZUN A;  4KIK A;  2J7Q B;  2C60 A;  3VTU A;  3KW5 B;  4FBJ B;  4MDK E;  3A33 B;  1H4R A;  2XK5 B;  2JZZ A;  5E6O A;  4IM2 A;  4HDO A;  3PLU A;  2REX A;  4BFR A;  5EDS A;  4HK2 A;  2L76 A;  3VAW A;  1Z5S B;  3QJZ A;  4AP4 C;  2CHZ A;  2DZJ A;  2D3G A;  4IUM B;  4MJS A;  1V9J A;  4GIV A;  4NQK E;  3U8Z A;  5LXH A;  1R4N I;  2IY1 B;  2KKC A;  3RT3 B;  1E8Y A;  4WWN A;  3RD2 A;  3DBL I;  3QK0 A;  1S3S G;  2FID A;  2LXA A;  3APC A;  2LI5 A;  3WAL A;  1WGY A;  1YIW A;  2M17 A;  4KSK C;  5AZG A;  3VH4 B;  2D2Q A;  4JQW C;  3VTW A;  2NR2 A;  1A5R A;  2LVQ A;  3R66 C;  1WX7 A;  3MJW A;  1V81 A;  3PRZ A;  2UYZ B;  3H1U A;  3KUD B;  2O2V B;  1UZX B;  3MHS D;  1I35 A;  3DCG A;  4W9J A;  5LXI B;  1GC6 A;  5CHV C;  3QC8 B;  3KVF B;  4EFO A;  2DX5 B;  2JRI B;  4BKS D;  2MP2 B;  4F8C B;  1M94 A;  3UIP B;  2R2Q A;  2NPT A;  3A9J A;  1WGD A;  1J19 A;  3V61 A;  4JLC A;  4PYU A;  4XC2 A;  3ZO5 B;  2PE9 A;  4HDQ A;  4KIK B;  2XEW A;  1UD7 A;  5CTR C;  4NY0 A;  4W9L A;  3ZLZ A;  4ZRI A;  3SDL C;  5AEK B;  3N30 A;  2LAS A;  2AWT A;  4NAW A;  3RCZ A;  2EMT A;  2ZCB A;  5JHB A;  2OJR A;  3UQB A;  1C3T A;  4HLE A;  4XZ4 A;  4W9H A;  2KTR A;  3PHX B;  3DBH I;  1F9J A;  1SE9 A;  5DPT A;  1OEY J;  2KC2 A;  3R3M A;  2KDF B;  4K7W A;  2KO3 A;  2Y5B B;  4MJS B;  2WWZ A;  4ICV A;  1KLV A;  1UGM A;  1WXV A;  2WYQ A;  4FA6 A;  2N9E B;  4B95 A;  4M8N A;  3EC8 A;  3L16 A;  2MBH A;  3TIX A;  2HTH A;  4F7Z A;  3B1L X;  4II3 B;  2KMC A;  4E74 A;  3L17 A;  5L83 A;  3JW0 X;  3QAR A;  1OGW A;  4LJP B;  5JZE B;  4FAD A;  1V80 A;  1OTR B;  5KHQ A;  1E7V A;  2J0J A;  2KOX A;  2V3S A;  2MBO A;  3QCA A;  1IP9 A;  1EO6 A;  4DK5 A;  2M1M A;  4EKU A;  1WI0 A;  3RZF A;  1VCB A;  4NPN A;  2MW5 A;  3VHT C;  3ZNZ B;  4A3O A;  1GNU A;  1VD2 A;  4AOF A;  3UQA A;  1L7Y A;  2MA9 B;  3OLM D;  2FCQ A;  2NPT B;  2L0F A;  3A9J B;  1EF5 A;  4EZK A;  2NBV B;  2WDT B;  3V60 A;  4GDL A;  4FUL A;  2K6D B;  4F1S A;  4MGZ E;  2I1K A;  1YD8 U;  4KV2 A;  4WJP A;  2IO3 B;  3VXW A;  2M8S A;  2KTF A;  4NAW B;  2O6V D;  1TZ1 A;  2HD5 B;  4GB9 A;  4JGH B;  2K8H A;  2L05 A;  4ANU A;  2IY0 B;  2G4S A;  2KTR B;  4ZDV A;  1V49 A;  4BKS A;  4BVU C;  2VRR B;  1WE6 A;  2MBQ A;  3DOW A;  3L0W B;  1PQS A;  1WX8 A;  3DBS A;  1EUV B;  2L7R A;  4DHZ B;  2KX3 A;  3ZVV A;  1NBF C;  4IWP A;  3ZRF A;  4WJQ A;  2DHZ A;  4KZ0 A;  3M62 B;  4HWI B;  2DAJ A;  3LJ3 A;  3IVF A;  5D7G A;  2N7D A;  3BIN A;  2LXC A;  4CO7 A;  3JYU A;  4EZL A;  3PVL A;  4WWP A;  2OOB B;  3SD5 A;  3ECI A;  3PPA A;  1UH6 A;  2KLG A;  4GOC A;  2C7N B;  2B3A A;  5E6P A;  3VUY A;  3ZNG C;  5DPW A;  2DZK A;  3PSE B;  2KWU B;  3ML9 A;  1WIA A;  3QQ8 B;  1G6J A;  2KX0 A;  3VUW A;  2NVU I;  4W9D A;  4DHJ D;  5D94 A;  1IYF A;  2BYE A;  4FJY A;  1HE8 A;  2BF8 B;  3APD A;  3VTV A;  3K9O B;  3W1S C;  4WJO A;  4RMA A;  2BWF A;  1LQB A;  1V5O A;  4KDI C;  4ICU A;  2D11 A;  3QAQ A;  1WH3 A;  3GZN I;  1YJ1 A;  4FJZ A;  4GXB A;  3RUL A;  2KHW B;  3T8M A;  4DBG A;  4A3P A;  2NBW B;  2N7E A;  1P3Q U;  1TBE A;  2PE6 B;  4WQO B;  4IC7 B;  2LUE A;  2L3Z A;  2RGF A;  4GDL B;  1Q1O A;  2IBI B;  1CMX B;  2N1W A;  3RUI B;  5HKH A;  1IPG A;  1UBQ A;  1E8Z A;  1UBI A;  1WYW B;  2NCN A;  3RZW C;  4I6N B;  3VUX A;  1NDD A;  4G50 A;  2KK8 A;  5LLI A;  3SU8 X;  5AZH A;  4DXA B;  3TCA A;  4IWO A;  2JZ3 B;  2DYM A;  2CHW A;  2BYF A;  3A4S C;  5TR5 A;  2MBB B;  5IAA C;  3ZIM A;  5D6J B;  3PHW B;  1XD3 B;  2GOW A;  3KYC D;  1RFA A;  4G11 A;  5E6N A;  3WAN A;  4IW0 A;  1LFD A;  4EOY A;  1C1Y B;  3WAM A;  2KFK A;  3KUZ A;  3DVG X;  1WR1 A;  2ZNV C;  2O6V A;  2DAF A;  2KDE B;  3OJ3 A;  2BKF A;  2RD0 A;  2FCM A;  5AZF A;  3UGB B;  4K7U A;  2G3Q B;  2NBU A;  2AL3 A;  4KSL C;  4URK A;  3C0R B;  4HCN B;  4WWO A;  4E3C A;  3V6E B;  4AJY B;  4MM3 A;  4RM9 A;  2A5U A;  2KJR A;  4CYE A;  1E8X A;  2LRW A;  1SGH A;  1WE7 A;  5CHF A;  5C1Z A;  1XQQ A;  1WGR A;  3R7Q A;  3CST A;  1RLF A;  3L08 A;  2K39 A;  4KVG B;  2M4N A;  3ZNH B;  2BYV E;  5L95 C;  3AXC A;  3JVZ X;  2IO1 B;  3L13 A;  3CMM B;  2IZV B;  1P98 A;  3IFW B;  3CSF A;  3HM3 A;  2KD0 A;  3Q3F A;  4BBN F;  1J0G A;  5FR6 A;  2AYO B;  2R2O A;  4LDT D;  4N9F 4;  3PRM B;  1WGH A;  2KWC A;  1L2N A;  2ZZP B;  4W9C A;  2IO2 B;  2KJ6 A;  3AU5 A;  3UIO B;  2JWZ A;  1KM7 A;  1GG3 A;  2YVC A;  2MLB A;  3ZNI D;  1Y8R C;  5J17 A;  1NI2 A;  1E7U A;  1GUA B;  1WJ4 A;  3QA8 A;  4BKT A;  2PEA A;  3RYT A;  2LGX A;  4MGY E;  2NS5 A;  2LZ6 A;  3D32 A;  1P0R A;  1P9D U;  2Z0E B;  3NY5 A;  2KFK B;  3OAW A;  2C7H A;  1T0Y A;  4PS3 A;  3P2B A;  2RR9 A;  1KOT A;  1X1M A;  2O6V B;  4NQL B;  3UF8 A;  2G45 B;  3NZU A;  2D10 A;  3TJP A;  2K8C A;  4G0N B;  4ZYN A;  2KJH B;  4II2 B;  2JT4 B;  2BGF A;  2KAN A;  4CHK A;  3ENE A;  3IBE A;  3NOB A;  4GN1 A;  2RSU A;  4W9E A;  2GBK A;  4TQ0 A;  1EF1 A;  1WF9 A;  4B6W A;  2DYB A;  2K6Q A;  2N1V A;  3IG3 A;  4ANV A;  3A4R A;  2KMA A;  2LGD A;  4GGQ A;  4GDK A;  1WJ6 A;  2GBR A;  3R7R A;  3KUC B;  4WJN A;  3APF A;  4B9K A;  4X57 B;  1J8C A;  2K8B A;  1WR6 E;  1WRD B;  3W1Y A;  4ASW C;  2V1Y A;  3ZRC A;  3O65 B;  1ZW7 A;  2MBE A;  4MGI E;  4MEL A;  4MH0 E;  4TUU A;  3V62 A;  3TL5 A;  4A20 A;  3DBR I;  2DEN B;  3T9L A;  5J2R A;  2KDB A;  4JIO U;  1WJU A;  2CHX A;  1E5W A;  3VH3 B;  2KFJ A;  3M95 A;  1WXS A;  1WJN A;  3V6C B;  4K1R B;  3IHP C;  2ZPN A;  3DVN V;  4FN2 A;  4J6I A;  2BWE S;  5G2N A;  2I1J A;  2FIF A;  2GBM A;  2M0X A;  3KH0 A;  3ZTC A;  4K7S A;  1E8W A;  2L0T A;  3SHQ A;  3VQI A;  4W9K A;  2MCN B;  1U4A A;  1WXM A;  2MRP A;  1KJT A;  2ZVN A;  3ONS A;  4FLH A;  3QWZ B;  2AL6 A;  2K25 A;  1TTN A;  2KQS A;  4ANW A;  1WXA A;  4XX5 A;  1V5T A;  2JY6 A;  4MGK E;  5C23 A;  2ZNV B;  3DVN U;  3U30 A;  2ASQ A;  4PS8 A;  2N4F A;  2GMI C;  1E90 A;  4BOZ B;  1RAX A;  4W9G A;  1WMH A;  2CKH B;  1V2Y A;  3WAO A;  4PS7 A;  1V6E A;  5DCN A;  2N9P C;  3VDZ A;  2G4D B;  4WAA A;  2FCS A;  2MX2 A;  1JRU A;  2PPH A;  3UIN B;  1BT0 A;  2ZEQ A;  2HJ8 A;  3ALB A;  1OQY A;  3ZDM C;  2LD9 A;  4MSM B;  1S1Q B;  2KLC A;  1I42 A;  2WX1 A;  3DQV A;  1GJZ A;  3ML8 A;  1Q0W B;  3H6N A;  2JUO A;  2DZM A;  3A1Q A;  4I6L B;  2MSE D;  3VVW B;  3L54 A;  3HIZ A;  4GDK B;  5DPR A;  1UEL A;  3DDC B;  2W9N A;  4M8M A;  4OVV A;  4PYZ A;  5KHO A;  2LGY A;  3PLV A;  2V4L A;  3ZDT A;  4KDL B;  4I6P A;  2CR5 A;  4MEM A;  3MTN B;  1R4M I;  2C7M B;  3ZKJ C;  4FHK A;  3EFU A;  2FUH B;  2IYD B;  3L10 B;  3M63 B;  1WGG A;  2N9X A;  3DVG Y;  2HE7 A;  5CX3 A;  1SIF A;  2WX0 A;  3PGE A;  3X0W A;  4NNJ B;  3X23 A;  1MG8 A;  2DZI A;  2C5L C;  2ZPY A;  4TKN A;  4DDI D;  4FJV B;  2JF5 A;  3W1S A;  2K1F A;  3JSV A;  1GC7 A;  3WAP A;  3DPD A;  1XT9 B;  1WM3 A;  4K81 A;  2DYO A;  3GOE A;  4ZRK A;  2BPS A;  4EZJ A;  1V86 A;  3PTF C;  3ZTD A;  2JXX A;  4TQ1 A;  5CHW A;  3TBL D;  3B08 A;  2LJ5 A;  3QHT A;  4IWQ A;  2KDI A;  4IM0 A;  1Z2M A;  1WY8 A;  3HM6 X;  5DPS A;  2CS4 A;  3PT2 B;  4E71 A;  1RRB A;  2RPQ A;  2XBB C;  1WFY A;  3A9K A;  4HCP B;  4G3X B;  4HPL B;  4TV3 A;  1WMH B;  2KXJ A;  4LDT B;  3QX1 A;  2PJH A;  4AUQ C;  3K9P B;  4KZC A;  2KVR A;  2KC1 A;  2KNB A;  2LWP A;  4HPM B;  4IM3 A;  2FNJ B;  1D3Z A;  2ZCC A;  1P1A A;  4HXD A;  4GU2 A;  3NS8 A;  1TGZ B;  5G55 A;  2A4Z A;  3HK0 A;  3H7P A;  3N32 A;  4DDG D;  1WZ3 A;  2L8J A;  3OJ4 B;  1OEY A;  3AUL A;  4LJO B;  4YL8 A;  3A1Q B;  2FAZ A;  3U7D A;  4EUT A;  1YX5 B;  1ZKH A;  3B0A A;  3PV1 A;  2CU1 A;  4ZRJ A;  1LM8 B;  3PRP B;  2IO0 B;  3EHV A;  1H8C A;  3HHM A;  3H9D A;  2GBJ A;  3Q3J A;  4AWJ A;  2D07 B;  3BY4 B;  4JL9 A;  3TMP B;  4AJW A;  1WZ0 A;  5IA7 A;  4MSQ B;  2Z0D B;  2Z59 B;  2XK5 A;  2ZJD A;  3PZD A;  2ZVO A;  4GSW A;  3EEC A; 
#chains in the Genus database with same CATH topology
 3P4S B;  4A8X C;  4M01 A;  3PRE A;  3CF6 E;  1TZO A;  2LVP A;  3JSV B;  1F2R I;  4YSX B;  1N63 A;  1ZGU B;  2MJE A;  5D2M B;  3MHZ A;  5LNK 1;  3WIM A;  2BYT A;  2EMS A;  2UWQ A;  1N5W A;  3ZJV A;  3NVV A;  3LYY A;  3DHG C;  4GMV A;  3AI5 A;  2MQJ A;  4C7Z A;  3A9K B;  2O2V A;  2KZR A;  2FCN A;  3I5J C;  4R3D A;  2BKR B;  3M3J A;  3KWV A;  3PS6 A;  2JRH A;  1K8R B;  2GBN A;  3KYD D;  2EKE C;  3H7P B;  1LXD A;  2KN5 A;  2RDB C;  5BO4 B;  4BBN C;  2WDR B;  3QIJ A;  4NJ6 A;  5H92 C;  3U7Z A;  3ZUN A;  4FBJ B;  5E6O A;  2WXK A;  3TSS A;  2H89 B;  2RMM A;  3P1M A;  3CWI A;  3QJZ A;  2H88 B;  2D3G A;  4MJS A;  3U8Z A;  5LXH A;  1K53 A;  2KKC A;  4A55 A;  3RT3 B;  4N59 A;  1S3S G;  2LXA A;  1WGY A;  5AZG A;  3AE6 B;  2ACZ B;  1KRH A;  1A5R A;  2LVQ A;  3R66 C;  4YTM B;  5IO9 A;  2UYZ B;  3CIR B;  2DLB A;  1HQR D;  4UDU C;  3Q3N C;  4W9J A;  2V3N A;  1F2R C;  4L1B A;  3AE7 B;  5CHV C;  1XLP A;  3FIL A;  3KVF B;  4S0R A;  3AEB B;  3RPF C;  2JRI B;  4XYC A;  4BKS D;  2MP2 B;  3UIP B;  3I63 C;  3V61 A;  4PYU A;  1C78 A;  1EWY C;  1UD7 A;  1NYR A;  1B1Z A;  5AEK B;  2AWT A;  1C3T A;  4W9H A;  4Q2J A;  2KTR A;  3DBH I;  1F9J A;  1OEY J;  4K7W A;  2J42 A;  4ICV A;  1UGM A;  4RCO A;  3ZYY X;  4M8N A;  2HTH A;  3B1L X;  1Q10 A;  1RYJ A;  1R4M B;  4LNN A;  5L83 A;  1J7A A;  1OGW A;  3NJT A;  2LHD A;  1OTR B;  3AE5 B;  4M00 A;  1FD6 A;  1EO6 A;  3HVD A;  3AE3 B;  2MW5 A;  3ZNZ B;  3AEA B;  5BYQ A;  3OLM D;  4N58 A;  3Q6B A;  3BWU D;  1JW9 D;  4GDL A;  2K6D B;  5HI1 A;  1SIJ A;  4WJP A;  3TEY A;  2QC8 A;  1SB3 C;  2HD5 B;  3KWL A;  2G4S A;  4BKS A;  5BYR A;  1WE6 A;  3L0W B;  2L7R A;  2KX3 A;  3GE8 C;  4WJQ A;  1STE A;  1CZP A;  2DAJ A;  3IVF A;  4WIP A;  2N7D A;  2LXC A;  4EZL A;  1FEH A;  3PVL A;  4WWP A;  3PPA A;  2L1A A;  1UH6 A;  2KLG A;  5DPW A;  3PSE B;  3ZJT A;  1G6J A;  5FK9 C;  2V3P A;  5G5H A;  2NVU I;  1FCC C;  2BYE A;  2RPV A;  3NVY A;  3VTV A;  3K9O B;  4WJO A;  4RMA A;  1LQB A;  4ICU A;  3RUL A;  3GZN I;  4DBG A;  3C8Y A;  1P3Q U;  1MHH E;  2PKO A;  3TEZ A;  4IC7 B;  4ITK A;  2N1W A;  1IPG A;  1UBQ A;  1UBI A;  4I6N B;  4TMA B;  1NDD A;  4G50 A;  1AYF A;  2KK8 A;  5AZH A;  4HKZ E;  4DXF A;  3A4S C;  5TR5 A;  2KN4 A;  2MBB B;  2WHI A;  1FM0 D;  4A90 A;  3BYT B;  3KYC D;  1LFD A;  1OFF A;  2MJ3 A;  2KFK A;  4KGS A;  1WR1 A;  2ZNV C;  1BML C;  2DAF A;  3OJ3 A;  5AZF A;  1GB1 A;  4B0M A;  4C00 A;  3EGR A;  3PZ8 A;  4RM9 A;  2DWQ A;  2A5U A;  4CYE A;  1XLO A;  5IKC M;  1SF0 A;  1D5M C;  2L83 A;  1WGR A;  2K3U A;  3L08 A;  3Q3O C;  3BVM A;  2XNA C;  2BYV E;  2MJD A;  5L95 C;  1YOV B;  2IZV B;  3IFW B;  1M4V A;  1TS4 A;  2KD0 A;  4BBN F;  1J0G A;  4XDD A;  2AYO B;  4LDT D;  2ZZP B;  1KM7 A;  2YVC A;  2I38 A;  3RN9 C;  3NG0 A;  5J17 A;  1NI2 A;  3RYT A;  1HTQ A;  2XN9 C;  4MGY E;  2LZ6 A;  2C7H A;  4PS3 A;  1KOT A;  1L4Z B;  1X1M A;  2O6V B;  3TEX A;  2KJH B;  3IBE A;  4LK0 M;  4W9E A;  2K6Q A;  4MM3 B;  4GGQ A;  3KUC B;  4X57 B;  2GLS A;  5BMI A;  4BZA A;  4ASW C;  3ZRC A;  1ZW7 A;  2MBE A;  4A20 A;  3DBR I;  3VR8 B;  2V4I B;  2M19 A;  4JIO U;  1YNT E;  3RNA C;  1T0Q C;  1XCQ L;  3V6C B;  4J3O D;  4J6I A;  3KH0 A;  3ETR A;  3VQI A;  3ZJU A;  1GOZ A;  1AWD A;  2MCN B;  2QMT A;  4C4V A;  2MRP A;  3AED B;  1KJT A;  3NVZ A;  1FNW A;  2AL6 A;  3AMZ A;  2KQS A;  4WUR A;  2GMI C;  3IXS A;  1E90 A;  3R2T A;  1WMH A;  4PS7 A;  2CJN A;  5D3I B;  4ZHO A;  4WAA A;  2MX2 A;  1B9R A;  2G1E A;  1S1Q B;  1GJZ A;  3SFD B;  4I6L B;  3VVW B;  3L54 A;  3HIZ A;  1GB4 A;  2R61 A;  5DPR A;  4OW0 A;  1C76 A;  1SE4 A;  4PYZ A;  4I6P A;  4MEM A;  4L2Y A;  4DXG A;  3EFU A;  4WQM A;  3L10 B;  3M63 B;  2JX5 A;  2HE7 A;  4NNJ B;  4TKN A;  4DDI D;  2JF5 A;  3W1S A;  2JXT A;  1SBB B;  3WAP A;  3DPD A;  1QQR A;  1D4B A;  4EZJ A;  2BPS A;  3PTF C;  1AN8 A;  1DGJ A;  4KKJ A;  2LJ5 A;  1Z2M A;  2HDE A;  1C4P A;  1CQV A;  4M0W A;  3P4P B;  1UNS A;  4TV3 A;  2LHE A;  4D2K A;  1IBX A;  1WGK A;  2KVR A;  3BZD B;  2WXN A;  4HJG E;  2KDM A;  2ZCC A;  1I4G A;  4DDG D;  1L6U A;  5H8Y E;  3U7D A;  4ZRJ A;  3NUH B;  3EHV A;  2QIL A;  3HHM A;  5G5G A;  5EE1 A;  1NYQ A;  3TMP B;  4MSQ B;  2Z59 B;  2ZJD A;  1E0Z A;  4GSW A;  4FA6 A;  3SR6 A;  2C9W B;  4TSS A;  2J0M A;  1YX6 B;  3NHE B;  5GMV A;  5J18 A;  1WX9 A;  3AU4 A;  2IPK D;  3ZW3 A;  4BKG A;  2SAK A;  1WM2 A;  4EE2 A;  5JH5 C;  4RGN A;  5FR3 A;  5JHA A;  1FFV A;  2JPH A;  2J0K A;  4P7I A;  2G9H D;  3Q14 C;  2LVO A;  4BOS C;  2BS3 B;  2HJ1 A;  4FHJ A;  4LCD E;  1Q5W B;  1FCL A;  1EU4 A;  1ISN A;  3VFK A;  1FO4 A;  4KIK A;  1L0Y B;  1EM7 A;  2C60 A;  3VTU A;  4MDK E;  3A33 B;  2XK5 B;  2JZZ A;  1L4D B;  2KQ4 X;  3PLU A;  1YQ4 B;  2B76 B;  5EDS A;  1FXI A;  3R2I A;  4HK2 A;  2L76 A;  1Z5S B;  2CHZ A;  2WXJ A;  2JU6 X;  4GIV A;  2QIE B;  3GE3 C;  3DBL I;  5BMH A;  1N61 A;  3APC A;  3HRD D;  2M17 A;  4KSK C;  3VTW A;  1VZ6 A;  2L32 A;  3PRZ A;  4AQ7 A;  3KUD B;  2O2V B;  3DCG A;  2N9L A;  2JZP A;  3QC8 B;  1J7B A;  1QOG A;  3O13 A;  4OZA A;  2YEP F;  2WNM A;  3A9J A;  1WGD A;  4JLC A;  4XC2 A;  2BB6 A;  3ZO5 B;  5T8I A;  2PE9 A;  4JWS C;  2AX5 A;  3ZLZ A;  2GI9 A;  2ZCB A;  1JWB D;  4KGT A;  4MAC A;  2KO3 A;  2Y5B B;  4MJS B;  1BUI C;  1WYG A;  2JSV X;  3BII D;  1N5X A;  2KMC A;  1V1O A;  3I57 A;  4IDI A;  3L17 A;  1XEE A;  4REZ A;  5JZE B;  1YMH E;  2KOX A;  1YN3 A;  2RDH A;  3FIL B;  1VDV A;  2BTE A;  4A3O A;  3LB8 C;  1GNU A;  4AOF A;  2MA9 B;  1KTK A;  2BT6 A;  1NEN B;  1YD8 U;  4OHJ A;  3U52 E;  1JWM D;  2WXP A;  2VZK D;  1K51 A;  1QOA A;  4JGH B;  2K8H A;  1WXQ A;  3MC0 B;  2IY0 B;  2KTR B;  4ANU A;  4ZDV A;  1V49 A;  4BVU C;  2MBQ A;  3AEF B;  3DOW A;  1PQS A;  1GAQ B;  3URY A;  4ZRQ A;  3BYY B;  3E56 A;  4DHZ B;  1ZE3 D;  3ZVV A;  1ZDX A;  1ZOY B;  5IOI A;  4KZ0 A;  5D7G A;  4HWI B;  2X38 A;  1XXG A;  2PW9 A;  4YSY B;  3SD5 A;  4GOC A;  5E6P A;  2C7N B;  2B3A A;  2DZK A;  1JQ4 A;  3VR9 B;  3ZXV A;  3VUW A;  2KMM A;  1EWC A;  1IYF A;  1HE8 A;  2BWF A;  3Q8E A;  1V5O A;  3QAQ A;  4FJZ A;  1YJ1 A;  4ARC A;  2KHW B;  3E9S A;  4A3P A;  2N7E A;  1I4R A;  1QIL A;  3H8H A;  4GDL B;  1I4P A;  3EUB 2;  2D3C A;  2LUM A;  4DXA B;  5LLI A;  4YTN B;  4KX6 B;  2CHW A;  5HHD G;  3C19 A;  1PGB A;  3HVZ A;  3ZIM A;  5D6J B;  1P7F A;  3PHW B;  3RFZ B;  3WAN A;  4G11 A;  2WXF A;  5MPO A;  2AQ2 B;  1C1Y B;  1SSN A;  1QT9 A;  3LXF A;  2PIA A;  4AS1 A;  2LMC A;  2NMQ A;  3Q69 A;  4XE0 A;  2LFI A;  3GB1 A;  1IGC A;  3AM9 A;  4K7U A;  2NBU A;  3TEW A;  1CK1 A;  4AJY B;  2QDF A;  2ZW0 A;  1E8X A;  2LRW A;  5HG2 A;  3RNC C;  4KVG B;  1VJK A;  2IO1 B;  1TS3 A;  3L13 A;  3CMM B;  3HM3 A;  1T5X D;  4O1N A;  3HUI A;  3P4Q B;  1HA5 A;  4N9F 4;  1VZ8 A;  4HRO A;  2WXM A;  3AE8 B;  1TY0 A;  4WAF A;  1LO5 D;  4HRS A;  3ZNI D;  3QA8 A;  1GUA B;  4BKT A;  1VLB A;  2LGX A;  1P9D U;  2Z0E B;  3NY5 A;  2KFK B;  3OAW A;  4XGA B;  1T0Y A;  3FC4 A;  1XLN A;  2KAJ A;  4NQL B;  3UF8 A;  1I4X A;  3Q8B A;  3U4E G;  3DBH B;  2KAN A;  4CHK A;  3P42 A;  3NOB A;  2IGH A;  1EU3 A;  1WF9 A;  1ZP0 B;  3IG3 A;  3A4R A;  2KMA A;  4GDK A;  3R7R A;  1J8C A;  1DOY A;  1QF6 A;  1KFY B;  2V1Y A;  3SEB A;  3O65 B;  2LGI A;  4MGI E;  1DOI A;  3V62 A;  3TL5 A;  2DEN B;  3T9L A;  5J2R A;  1WJU A;  1F1H A;  2CHX A;  3VH3 B;  5C3J B;  3M95 A;  1SE3 A;  1WJN A;  5IN7 A;  1N6Z A;  1PDX A;  2ZPN A;  2BWE S;  2M0X A;  4K7S A;  1E8W A;  2L0T A;  3SHQ A;  1U4A A;  2ZVN A;  3RNF C;  2BB5 A;  1WXA A;  1V5T A;  4HKQ A;  3BVZ A;  2J53 A;  2ZNV B;  2VH2 A;  4PS8 A;  4BOZ B;  1RAX A;  2N9P C;  1QKZ A;  3ZDM C;  2WX1 A;  3A1Q A;  2DZM A;  1MJD A;  1T3Q A;  2W9N A;  4M8M A;  4OVV A;  5KHO A;  1V1P A;  2LGY A;  4KDL B;  2IYD B;  4YTP B;  3DVG Y;  3X23 A;  1MG8 A;  2C5L C;  2ZPY A;  4FJV B;  1F0Z A;  5BMG A;  3GZN B;  3UI3 A;  1GC7 A;  1WM3 A;  4C4V B;  1V86 A;  2JXX A;  4TQ1 A;  1KLG D;  4IM0 A;  3HM6 X;  2CS4 A;  2RPQ A;  2XBB C;  4HCP B;  1WMH B;  4LDT B;  3QX1 A;  4ZRP A;  4AUQ C;  3K9P B;  2KC1 A;  2DNF A;  1D3Z A;  1P1A A;  4HXD A;  4GU2 A;  3NS8 A;  1TGZ B;  1WZ3 A;  2L8J A;  3AUL A;  2E3T A;  1YX5 B;  1ZKH A;  3B0A A;  1LM8 B;  1D6E C;  3PRP B;  3W2D A;  2D07 B;  1E6E B;  1JRO A;  5IA7 A;  2Z0D B;  1FXT B;  2KWV B;  4HEA 1;  1FRR A;  1QOB A;  3H7S A;  2OHF A;  3VRA B;  2IND C;  4HJK A;  3WA0 A;  1V97 A;  2WLB A;  4NJ7 A;  2L00 B;  1HZ6 A;  4JX1 C;  4M0W B;  3NZS A;  1TJE A;  1NVI D;  4DHJ B;  1HXY D;  1IBX B;  3I3T B;  2KQ7 A;  4OVU A;  1RM6 C;  4L23 A;  4DHZ E;  2KWD A;  3RMK C;  1PGA A;  1D5X C;  4DWF A;  4H2A A;  2J7Q B;  2WXL A;  1PYW D;  3BVG A;  2NTS A;  3AE1 B;  1OQQ A;  4IM2 A;  4HDO A;  1XLQ A;  1VRA B;  3VAW A;  3W5U B;  2E6X A;  3GP7 A;  3U2S C;  1VR9 A;  1V9J A;  1MG4 A;  4YXD B;  4RGO S;  1R4N I;  2IY1 B;  1FIQ A;  1E8Y A;  3RD2 A;  3QK0 A;  1HEZ E;  3WAL A;  1YIW A;  4P16 A;  2D2Q A;  3DBR B;  2DBY A;  1WX7 A;  3MJW A;  1V8C A;  4ARI A;  1I7H A;  2IGG A;  1UZX B;  3EA6 A;  1I35 A;  5LXI B;  1GC6 A;  1TKG A;  2EKI A;  2K22 A;  4EFO A;  4C7Y A;  1Y56 A;  1N60 A;  4F8C B;  2J4X A;  2NPT A;  1J19 A;  2L52 A;  2JYT A;  3IAM 1;  1JCK B;  4HDQ A;  4KIK B;  2XEW A;  2NTT A;  1YN4 A;  3RNE C;  1FRD A;  3N30 A;  2KAC A;  1MPE A;  4NAW A;  2EMT A;  5JHB A;  2OJR A;  3UQB A;  1SE9 A;  5DPT A;  5E6J A;  2KC2 A;  3R3M A;  4RGM A;  2WWZ A;  1WXV A;  3RNG C;  1BXT A;  3DWG C;  2V0G A;  3L16 A;  2MBH A;  3TIX A;  4F7Z A;  5C2T B;  4II3 B;  2TSS A;  4WH4 A;  3JW0 X;  3QAR A;  4LJP B;  2GB1 A;  2EEL A;  4FAD A;  5KHQ A;  1UF0 A;  4XWW A;  1JML A;  1T0S C;  4DK5 A;  4EKU A;  1WI0 A;  2D3B A;  1VCB A;  4NPN A;  3MP9 A;  1VD2 A;  1L7Y A;  2FCQ A;  3A9J B;  2L0F A;  1L5P A;  3AEC B;  4EZK A;  3EFC A;  2WDT B;  2BS2 B;  3IAS 1;  2WDV B;  4FUL A;  4YWG G;  2I1K A;  1XCT L;  5BYS A;  3B2F A;  1WRI A;  2M8S A;  2WXG A;  2ONQ A;  1TZ1 A;  2MEK A;  1GPX A;  1WX8 A;  1EUV B;  2GRI A;  2LGS A;  4ZYS A;  2DHZ A;  2IGD A;  5EE3 A;  3LJ3 A;  3AH7 A;  1WSP A;  2MH7 A;  2VH1 A;  4CO7 A;  2KT7 A;  3ECI A;  2W82 A;  3ZNG C;  3VUY A;  1WWT A;  2KWU B;  3ML9 A;  1WIA A;  2WQY B;  3QQ8 B;  2JWU A;  3BK1 A;  1FXA A;  2Y5C A;  5TSS A;  4FJY A;  3APD A;  1PFD A;  4KDI C;  4ZOH C;  3FAH A;  4GXB A;  2LEK A;  3T8M A;  2N0S B;  2NBW B;  3ZGZ A;  2PE6 B;  2LUE A;  1CMX B;  3RUI B;  5D3D A;  2PTL A;  1E8Z A;  1MFW A;  1CJE A;  3SFE B;  3Q8A A;  3SU8 X;  1QLB B;  3DWM A;  2BYF A;  3RI7 C;  1XD3 B;  3NZ3 A;  1RFA A;  1XO3 A;  4ZHP A;  5EE9 A;  4EOY A;  3KUZ A;  3DVG X;  2RD0 A;  3N1Y C;  2FCM A;  4NZL B;  3UGB B;  2G3Q B;  1YQ3 B;  2AL3 A;  4KSL C;  2WXH A;  4URK A;  4HCN B;  3WCQ A;  3P63 A;  1AW7 A;  3MC9 A;  3DBL B;  5C1Z A;  1WE7 A;  5CHF A;  2JQR B;  3R7Q A;  2MHJ A;  1C4C A;  4KGR A;  3JVZ X;  2ON8 A;  2BVC A;  3AE2 B;  4GLS C;  1P98 A;  3CSF A;  3Q3F A;  2W3S A;  3V3X A;  5FR6 A;  2R2O A;  2KWC A;  1L2N A;  5FKA C;  2IO2 B;  2KJ6 A;  3UIO B;  2JWZ A;  1E7P B;  2MLB A;  5JXV A;  3KLS X;  1E7U A;  2PEA A;  1K52 A;  2NS5 A;  3D32 A;  3P2B A;  2RR9 A;  2PMV A;  2G45 B;  2VZK B;  2D10 A;  3NZU A;  2K8C A;  4II2 B;  4HPP A;  4YT0 B;  2BGF A;  4K3B A;  3ENE A;  1SJH D;  1YN5 A;  5AUK A;  2GBK A;  3B2G A;  1EF1 A;  4TQ0 A;  4B6W A;  2N1V A;  1VZ7 A;  2LGD A;  2GBR A;  4WJN A;  1SE2 A;  2K8B A;  1WR6 E;  1C4A A;  3OG5 A;  2FBW B;  4TUU A;  2X8X X;  4WWM A;  1K50 A;  2KDB A;  1C77 A;  1RFK A;  1E5W A;  2KFJ A;  1C9F A;  4K1R B;  4JWU C;  4FN2 A;  2FIF A;  2GBM A;  2IDY A;  1F77 A;  5I4D A;  3ONS A;  1TKY A;  4LLG M;  1P7E A;  2K25 A;  1A70 A;  2OJW A;  3DHH C;  4FXC A;  4ANW A;  4XX5 A;  3MJ5 A;  1E9M A;  4MGK E;  5C23 A;  3U30 A;  2ASQ A;  2N4F A;  1TIF A;  3MC8 A;  3VDZ A;  2G4D B;  1JRU A;  2ZEQ A;  3ALB A;  1R7S A;  3IT6 B;  2KLC A;  3W9C B;  2UU7 A;  3Q2A C;  3ML8 A;  3H6N A;  2MSE D;  2WDQ B;  4GDK B;  1UEL A;  3DDC B;  2FUG 1;  1L0V B;  2ZW1 A;  3PLV A;  2V4L A;  3ZDT A;  2CR5 A;  3MTN B;  1R4M I;  1QOF A;  2K5P A;  4FHK A;  3ZKJ C;  2FUH B;  3KQ4 A;  2WXO A;  1WGG A;  2N9X A;  4RNA A;  2WXQ A;  3JSV A;  4K81 A;  1YJJ A;  2DYO A;  3GOE A;  1ET6 A;  4USA A;  3ZTD A;  1TY2 A;  1WY8 A;  3Q8C A;  1RRB A;  1ZUD 2;  2CJO A;  2W3R A;  1WFY A;  3A9K A;  4HPL B;  4G3X B;  2KXJ A;  4N6E B;  4KZC A;  4KKI A;  4HPM B;  2RDG A;  3AV8 A;  3GS2 A;  2A4Z A;  3N32 A;  3H7P A;  3OJ4 B;  1PUT A;  3A1Q B;  2FAZ A;  3Q8F A;  1OQR A;  4EUT A;  3PV1 A;  2CU1 A;  1H8C A;  1V1P B;  3H9D A;  4AWJ A;  3TUO A;  4AJW A;  3UIN B;  3QCA A;  2BBC A;  1JWU D;  1I4Q A;  1FNU A;  4EEW A;  3ZQ4 A;  4RM8 A;  2MWS B;  3N3K B;  2W55 A;  4W9F A;  3OWE B;  4HVB A;  1KH0 A;  2QHO A;  2Y5P A;  2INP E;  4W9I A;  4ANX A;  3ZXR A;  3DHI C;  2YLM A;  2KYW A;  4IOI E;  2LRU A;  2AEH A;  4QAY A;  4P1C C;  1XF5 L;  1MHX A;  3IT4 B;  4P1B C;  3S2A A;  1YQB A;  2MP2 A;  4IG7 B;  1L6V A;  2JVC A;  1AAR A;  1QZE A;  3LDZ E;  1JRP A;  4NAM A;  2KVZ A;  4PT5 A;  1DYQ A;  3KW5 B;  2PLP A;  1TT5 B;  1NI3 A;  1H4R A;  2HTM E;  1L0X B;  2PVO D;  2REX A;  4BFR A;  3FKY A;  4AP4 C;  2DZJ A;  4IUM B;  1LGR A;  1FMA D;  4NQK E;  2WXI A;  3N9Y C;  1ZDV A;  4WWN A;  2QJL A;  3T3O A;  2FID A;  2INC C;  3P4R B;  2AQ3 B;  2LI5 A;  3VH4 B;  2D5G A;  1F52 A;  4JQW C;  2NR2 A;  1FFU A;  1V81 A;  2QEJ C;  3H1U A;  5EE0 A;  2WU5 B;  3MHS D;  1PGX A;  2N9K A;  2DX5 B;  2M0A A;  1M94 A;  2R2Q A;  1KLU D;  1UUP A;  3N1X C;  5CTR C;  4NY0 A;  4W9L A;  4ZRI A;  3SDL C;  2LAS A;  2YEP B;  3RCZ A;  1C79 A;  1TS2 A;  4HLE A;  4XZ4 A;  3V05 A;  3PHX B;  4NJC A;  3BK2 A;  2BW2 A;  2KDF B;  3AEE B;  2JYE A;  1KLV A;  2WXR A;  2WYQ A;  3MFG A;  2N9E B;  4B95 A;  1FPY A;  3EC8 A;  1ZXI A;  1HTO A;  4E74 A;  3L4P A;  1N62 A;  1J7C A;  1V80 A;  1E7V A;  2J0J A;  2V3S A;  4US9 A;  2MBO A;  2K9X A;  1IP9 A;  2W54 A;  4IKG A;  4A6Q A;  2M1M A;  3RZF A;  2N7J A;  2M56 B;  3VHT C;  3UQA A;  3AE4 B;  1UWM A;  2NPT B;  1EF5 A;  2NBV B;  3NVW A;  1ROE A;  3V60 A;  4F1S A;  4MGZ E;  4KV2 A;  2J52 A;  2IO3 B;  3VXW A;  2KTF A;  4NAW B;  2O6V D;  4GB9 A;  2CU3 A;  2L05 A;  4LNF A;  2VRR B;  4LNK A;  4A9A A;  3DBS A;  3AEG B;  1NBF C;  4IWP A;  3NS1 A;  3ZRF A;  3M62 B;  3BIN A;  3JYU A;  2LJI A;  2OOB B;  2OED A;  3W5V B;  1ET9 A;  2V9H A;  1JWA D;  1IGD A;  4DQO C;  2KX0 A;  4OZB A;  4B0E A;  4W9D A;  4DHJ D;  5D94 A;  4CQN A;  2BF8 B;  3W1S C;  2D11 A;  1WH3 A;  2K0P A;  3N1Z C;  4MH8 A;  1TBE A;  1TKE A;  2WP9 B;  4P6V F;  2QSD A;  4WQO B;  4JPS A;  2L3Z A;  2RGF A;  1Q1O A;  2IBI B;  1ZPS A;  5HKH A;  4M02 A;  3VRB B;  1WYW B;  2NCN A;  3RZW C;  4XDC A;  3VUX A;  3T3N A;  3TCA A;  4IWO A;  2JZ3 B;  2BS4 B;  2DYM A;  4RF1 A;  2SEB D;  2FE8 A;  5IAA C;  1ACC A;  2GOW A;  1JWS D;  5E6N A;  4IW0 A;  3WAM A;  1JAL A;  1UGJ A;  1T6B X;  1I4H A;  3NRZ A;  2O6V A;  2KDE B;  2BKF A;  4OVZ A;  2BQQ A;  3C0R B;  4WWO A;  1R4N B;  4S17 A;  4E3C A;  3V6E B;  2PVG C;  4JE3 B;  4MM3 A;  1D5Z C;  2KJR A;  1SGH A;  1XQQ A;  2QCZ A;  4K3C A;  3CST A;  1RLF A;  2K39 A;  4YSZ B;  3ZNH B;  2M4N A;  2I2Y A;  3AXC A;  4LNI A;  5GXG B;  3J9C A;  4RH6 A;  1HZ5 A;  3PZ7 A;  3PRM B;  1WGH A;  4W9C A;  1FNV A;  3AU5 A;  4C80 A;  1GG3 A;  5AUI A;  2Z8L A;  1Y8R C;  4ACF A;  1WJ4 A;  1P0R A;  2Q5W D;  4OZC A;  3R8B A;  1NEK B;  1E10 A;  1ZXH A;  1RWS A;  3TJP A;  4G0N B;  4ZYN A;  2JT4 B;  2WS3 B;  4GN1 A;  2RSU A;  1T0R C;  4MT5 A;  2DYB A;  2WGS A;  3RNB C;  4ANV A;  4LTU A;  1WJ6 A;  4B9K A;  3APF A;  4RGT A;  1WRD B;  3W1Y A;  3B9J A;  4LNO A;  1TYG B;  3AB5 A;  3N20 C;  4MEL A;  4MH0 E;  1MVK A;  1TS5 A;  1WXS A;  3ABV B;  3IHP C;  3DVN V;  5G2N A;  2I1J A;  3ZTC A;  4BAX A;  4W9K A;  1ENF A;  5HFY A;  1IUE A;  1WXM A;  4C56 C;  2D3A A;  4FLH A;  2Y3A A;  3QWZ B;  1TTN A;  1KF6 B;  2JY6 A;  3DVN U;  4W9G A;  2CKH B;  1V2Y A;  3WAO A;  1V6E A;  5DCN A;  2FCS A;  2PPH A;  1BT0 A;  2HJ8 A;  1OQY A;  2LD9 A;  4MSM B;  1I42 A;  3DQV A;  4RFB A;  1Q0W B;  1YJI A;  2JUO A;  1MI0 A;  4US8 A;  3AN1 A;  2C7M B;  1UWX A;  5CX3 A;  1SIF A;  2WX0 A;  3PGE A;  3X0W A;  4PK1 A;  2DZI A;  1ESF A;  1SEB D;  2WU2 B;  2K1F A;  1SXT A;  1DOX A;  2INN E;  1XT9 B;  4ZRK A;  5IP4 D;  5CHW A;  3TBL D;  3B08 A;  3QHT A;  4IWQ A;  2KDI A;  5DPS A;  3PT2 B;  4E71 A;  3I9V 1;  4XWT A;  2PJH A;  3AE9 B;  2KNB A;  2LWP A;  3Q3M C;  4IM3 A;  4RF0 A;  2FNJ B;  2AQ1 B;  5G55 A;  3HK0 A;  4LJO B;  1OEY A;  4YL8 A;  2IJ0 A;  2IO0 B;  2ICI A;  2GBJ A;  3Q3J A;  3BY4 B;  4JL9 A;  3PO0 A;  1WZ0 A;  1SJE D;  2XK5 A;  3PZD A;  2ZVO A;  3EEC A; 
#chains in the Genus database with same CATH homology
 2C9W B;  4EEW A;  1FXT B;  3PRE A;  4RM8 A;  2MWS B;  2KWV B;  3CF6 E;  2J0M A;  2LVP A;  1YX6 B;  3JSV B;  3N3K B;  1ZGU B;  3NHE B;  5D2M B;  3H7S A;  5GMV A;  4W9F A;  5J18 A;  1WX9 A;  3AU4 A;  4HVB A;  3ZW3 A;  2QHO A;  3WIM A;  4BKG A;  1WM2 A;  2EMS A;  4HJK A;  2UWQ A;  4W9I A;  3WA0 A;  4ANX A;  5JH5 C;  4NJ7 A;  5JHA A;  2L00 B;  2YLM A;  4GMV A;  3AI5 A;  4M0W B;  3NZS A;  2JPH A;  2MQJ A;  2J0K A;  2LRU A;  2AEH A;  3A9K B;  4P7I A;  2O2V A;  4DHJ B;  2KZR A;  2FCN A;  2LVO A;  3I3T B;  4BOS C;  2KQ7 A;  4OVU A;  4FHJ A;  2BKR B;  3M3J A;  4LCD E;  4DHZ E;  1Q5W B;  3PS6 A;  2JRH A;  3S2A A;  1K8R B;  1YQB A;  2GBN A;  3KYD D;  2EKE C;  3H7P B;  2MP2 A;  4IG7 B;  1LXD A;  1ISN A;  2KN5 A;  5BO4 B;  4BBN C;  2JVC A;  1AAR A;  3QIJ A;  3VFK A;  1QZE A;  3LDZ E;  4DWF A;  4NJ6 A;  3ZUN A;  4KIK A;  2J7Q B;  2C60 A;  3VTU A;  3KW5 B;  4FBJ B;  4MDK E;  3A33 B;  1H4R A;  2XK5 B;  2JZZ A;  5E6O A;  4IM2 A;  4HDO A;  3PLU A;  2REX A;  4BFR A;  5EDS A;  4HK2 A;  2L76 A;  3VAW A;  1Z5S B;  3QJZ A;  4AP4 C;  2CHZ A;  2DZJ A;  2D3G A;  4IUM B;  4MJS A;  1V9J A;  4GIV A;  4NQK E;  3U8Z A;  5LXH A;  1R4N I;  2IY1 B;  2KKC A;  3RT3 B;  1E8Y A;  4WWN A;  3RD2 A;  3DBL I;  3QK0 A;  1S3S G;  2FID A;  2LXA A;  3APC A;  2LI5 A;  3WAL A;  1WGY A;  1YIW A;  2M17 A;  4KSK C;  5AZG A;  3VH4 B;  2D2Q A;  4JQW C;  3VTW A;  2NR2 A;  1A5R A;  2LVQ A;  3R66 C;  1WX7 A;  3MJW A;  1V81 A;  3PRZ A;  2UYZ B;  3H1U A;  3KUD B;  2O2V B;  1UZX B;  3MHS D;  1I35 A;  3DCG A;  4W9J A;  5LXI B;  1GC6 A;  5CHV C;  3QC8 B;  3KVF B;  4EFO A;  2DX5 B;  2JRI B;  4BKS D;  2MP2 B;  4F8C B;  1M94 A;  3UIP B;  2R2Q A;  2NPT A;  3A9J A;  1WGD A;  1J19 A;  3V61 A;  4JLC A;  4PYU A;  4XC2 A;  3ZO5 B;  2PE9 A;  4HDQ A;  4KIK B;  2XEW A;  1UD7 A;  5CTR C;  4NY0 A;  4W9L A;  3ZLZ A;  4ZRI A;  3SDL C;  5AEK B;  3N30 A;  2LAS A;  2AWT A;  4NAW A;  3RCZ A;  2EMT A;  2ZCB A;  5JHB A;  2OJR A;  3UQB A;  1C3T A;  4HLE A;  4XZ4 A;  4W9H A;  2KTR A;  3PHX B;  3DBH I;  1F9J A;  1SE9 A;  5DPT A;  1OEY J;  2KC2 A;  3R3M A;  2KDF B;  4K7W A;  2KO3 A;  2Y5B B;  4MJS B;  2WWZ A;  4ICV A;  1KLV A;  1UGM A;  1WXV A;  2WYQ A;  4FA6 A;  2N9E B;  4B95 A;  4M8N A;  3EC8 A;  3L16 A;  2MBH A;  3TIX A;  2HTH A;  4F7Z A;  3B1L X;  4II3 B;  2KMC A;  4E74 A;  3L17 A;  5L83 A;  3JW0 X;  3QAR A;  1OGW A;  4LJP B;  5JZE B;  4FAD A;  1V80 A;  1OTR B;  5KHQ A;  1E7V A;  2J0J A;  2KOX A;  2V3S A;  2MBO A;  3QCA A;  1IP9 A;  1EO6 A;  4DK5 A;  2M1M A;  4EKU A;  1WI0 A;  3RZF A;  1VCB A;  4NPN A;  2MW5 A;  3VHT C;  3ZNZ B;  4A3O A;  1GNU A;  1VD2 A;  4AOF A;  3UQA A;  1L7Y A;  2MA9 B;  3OLM D;  2FCQ A;  2NPT B;  2L0F A;  3A9J B;  1EF5 A;  4EZK A;  2NBV B;  2WDT B;  3V60 A;  4GDL A;  4FUL A;  2K6D B;  4F1S A;  4MGZ E;  2I1K A;  1YD8 U;  4KV2 A;  4WJP A;  2IO3 B;  3VXW A;  2M8S A;  2KTF A;  4NAW B;  2O6V D;  1TZ1 A;  2HD5 B;  4GB9 A;  4JGH B;  2K8H A;  2L05 A;  4ANU A;  2IY0 B;  2G4S A;  2KTR B;  4ZDV A;  1V49 A;  4BKS A;  4BVU C;  2VRR B;  1WE6 A;  2MBQ A;  3DOW A;  3L0W B;  1PQS A;  1WX8 A;  3DBS A;  1EUV B;  2L7R A;  4DHZ B;  2KX3 A;  3ZVV A;  1NBF C;  4IWP A;  3ZRF A;  4WJQ A;  2DHZ A;  4KZ0 A;  3M62 B;  4HWI B;  2DAJ A;  3LJ3 A;  3IVF A;  5D7G A;  2N7D A;  3BIN A;  2LXC A;  4CO7 A;  3JYU A;  4EZL A;  3PVL A;  4WWP A;  2OOB B;  3SD5 A;  3ECI A;  3PPA A;  1UH6 A;  2KLG A;  4GOC A;  2C7N B;  2B3A A;  5E6P A;  3VUY A;  3ZNG C;  5DPW A;  2DZK A;  3PSE B;  2KWU B;  3ML9 A;  1WIA A;  3QQ8 B;  1G6J A;  2KX0 A;  3VUW A;  2NVU I;  4W9D A;  4DHJ D;  5D94 A;  1IYF A;  2BYE A;  4FJY A;  1HE8 A;  2BF8 B;  3APD A;  3VTV A;  3K9O B;  3W1S C;  4WJO A;  4RMA A;  2BWF A;  1LQB A;  1V5O A;  4KDI C;  4ICU A;  2D11 A;  3QAQ A;  1WH3 A;  3GZN I;  1YJ1 A;  4FJZ A;  4GXB A;  3RUL A;  2KHW B;  3T8M A;  4DBG A;  4A3P A;  2NBW B;  2N7E A;  1P3Q U;  1TBE A;  2PE6 B;  4WQO B;  4IC7 B;  2LUE A;  2L3Z A;  2RGF A;  4GDL B;  1Q1O A;  2IBI B;  1CMX B;  2N1W A;  3RUI B;  5HKH A;  1IPG A;  1UBQ A;  1E8Z A;  1UBI A;  1WYW B;  2NCN A;  3RZW C;  4I6N B;  3VUX A;  1NDD A;  4G50 A;  2KK8 A;  5LLI A;  3SU8 X;  5AZH A;  4DXA B;  3TCA A;  4IWO A;  2JZ3 B;  2DYM A;  2CHW A;  2BYF A;  3A4S C;  5TR5 A;  2MBB B;  5IAA C;  3ZIM A;  5D6J B;  3PHW B;  1XD3 B;  2GOW A;  3KYC D;  1RFA A;  4G11 A;  5E6N A;  3WAN A;  4IW0 A;  1LFD A;  4EOY A;  1C1Y B;  3WAM A;  2KFK A;  3KUZ A;  3DVG X;  1WR1 A;  2ZNV C;  2O6V A;  2DAF A;  2KDE B;  3OJ3 A;  2BKF A;  2RD0 A;  2FCM A;  5AZF A;  3UGB B;  4K7U A;  2G3Q B;  2NBU A;  2AL3 A;  4KSL C;  4URK A;  3C0R B;  4HCN B;  4WWO A;  4E3C A;  3V6E B;  4AJY B;  4MM3 A;  4RM9 A;  2A5U A;  2KJR A;  4CYE A;  1E8X A;  2LRW A;  1SGH A;  1WE7 A;  5CHF A;  5C1Z A;  1XQQ A;  1WGR A;  3R7Q A;  3CST A;  1RLF A;  3L08 A;  2K39 A;  4KVG B;  2M4N A;  3ZNH B;  2BYV E;  5L95 C;  3AXC A;  3JVZ X;  2IO1 B;  3L13 A;  3CMM B;  2IZV B;  1P98 A;  3IFW B;  3CSF A;  3HM3 A;  2KD0 A;  3Q3F A;  4BBN F;  1J0G A;  5FR6 A;  2AYO B;  2R2O A;  4LDT D;  4N9F 4;  3PRM B;  1WGH A;  2KWC A;  1L2N A;  2ZZP B;  4W9C A;  2IO2 B;  2KJ6 A;  3AU5 A;  3UIO B;  2JWZ A;  1KM7 A;  1GG3 A;  2YVC A;  2MLB A;  3ZNI D;  1Y8R C;  5J17 A;  1NI2 A;  1E7U A;  1GUA B;  1WJ4 A;  3QA8 A;  4BKT A;  2PEA A;  3RYT A;  2LGX A;  4MGY E;  2NS5 A;  2LZ6 A;  3D32 A;  1P0R A;  1P9D U;  2Z0E B;  3NY5 A;  2KFK B;  3OAW A;  2C7H A;  1T0Y A;  4PS3 A;  3P2B A;  2RR9 A;  1KOT A;  1X1M A;  2O6V B;  4NQL B;  3UF8 A;  2G45 B;  3NZU A;  2D10 A;  3TJP A;  2K8C A;  4G0N B;  4ZYN A;  2KJH B;  4II2 B;  2JT4 B;  2BGF A;  2KAN A;  4CHK A;  3ENE A;  3IBE A;  3NOB A;  4GN1 A;  2RSU A;  4W9E A;  2GBK A;  4TQ0 A;  1EF1 A;  1WF9 A;  4B6W A;  2DYB A;  2K6Q A;  2N1V A;  3IG3 A;  4ANV A;  3A4R A;  2KMA A;  2LGD A;  4GGQ A;  4GDK A;  1WJ6 A;  2GBR A;  3R7R A;  3KUC B;  4WJN A;  3APF A;  4B9K A;  4X57 B;  1J8C A;  2K8B A;  1WR6 E;  1WRD B;  3W1Y A;  4ASW C;  2V1Y A;  3ZRC A;  3O65 B;  1ZW7 A;  2MBE A;  4MGI E;  4MEL A;  4MH0 E;  4TUU A;  3V62 A;  3TL5 A;  4A20 A;  3DBR I;  2DEN B;  3T9L A;  5J2R A;  2KDB A;  4JIO U;  1WJU A;  2CHX A;  1E5W A;  3VH3 B;  2KFJ A;  3M95 A;  1WXS A;  1WJN A;  3V6C B;  4K1R B;  3IHP C;  2ZPN A;  3DVN V;  4FN2 A;  4J6I A;  2BWE S;  5G2N A;  2I1J A;  2FIF A;  2GBM A;  2M0X A;  3KH0 A;  3ZTC A;  4K7S A;  1E8W A;  2L0T A;  3SHQ A;  3VQI A;  4W9K A;  2MCN B;  1U4A A;  1WXM A;  2MRP A;  1KJT A;  2ZVN A;  3ONS A;  4FLH A;  3QWZ B;  2AL6 A;  2K25 A;  1TTN A;  2KQS A;  4ANW A;  1WXA A;  4XX5 A;  1V5T A;  2JY6 A;  4MGK E;  5C23 A;  2ZNV B;  3DVN U;  3U30 A;  2ASQ A;  4PS8 A;  2N4F A;  2GMI C;  1E90 A;  4BOZ B;  1RAX A;  4W9G A;  1WMH A;  2CKH B;  1V2Y A;  3WAO A;  4PS7 A;  1V6E A;  5DCN A;  2N9P C;  3VDZ A;  2G4D B;  4WAA A;  2FCS A;  2MX2 A;  1JRU A;  2PPH A;  3UIN B;  1BT0 A;  2ZEQ A;  2HJ8 A;  3ALB A;  1OQY A;  3ZDM C;  2LD9 A;  4MSM B;  1S1Q B;  2KLC A;  1I42 A;  2WX1 A;  3DQV A;  1GJZ A;  3ML8 A;  1Q0W B;  3H6N A;  2JUO A;  2DZM A;  3A1Q A;  4I6L B;  2MSE D;  3VVW B;  3L54 A;  3HIZ A;  4GDK B;  5DPR A;  1UEL A;  3DDC B;  2W9N A;  4M8M A;  4OVV A;  4PYZ A;  5KHO A;  2LGY A;  3PLV A;  2V4L A;  3ZDT A;  4KDL B;  4I6P A;  2CR5 A;  4MEM A;  3MTN B;  1R4M I;  2C7M B;  3ZKJ C;  4FHK A;  3EFU A;  2FUH B;  2IYD B;  3L10 B;  3M63 B;  1WGG A;  2N9X A;  3DVG Y;  2HE7 A;  5CX3 A;  1SIF A;  2WX0 A;  3PGE A;  3X0W A;  4NNJ B;  3X23 A;  1MG8 A;  2DZI A;  2C5L C;  2ZPY A;  4TKN A;  4DDI D;  4FJV B;  2JF5 A;  3W1S A;  2K1F A;  3JSV A;  1GC7 A;  3WAP A;  3DPD A;  1XT9 B;  1WM3 A;  4K81 A;  2DYO A;  3GOE A;  4ZRK A;  2BPS A;  4EZJ A;  1V86 A;  3PTF C;  3ZTD A;  2JXX A;  4TQ1 A;  5CHW A;  3TBL D;  3B08 A;  2LJ5 A;  3QHT A;  4IWQ A;  2KDI A;  4IM0 A;  1Z2M A;  1WY8 A;  3HM6 X;  5DPS A;  2CS4 A;  3PT2 B;  4E71 A;  1RRB A;  2RPQ A;  2XBB C;  1WFY A;  3A9K A;  4HCP B;  4G3X B;  4HPL B;  4TV3 A;  1WMH B;  2KXJ A;  4LDT B;  3QX1 A;  2PJH A;  4AUQ C;  3K9P B;  4KZC A;  2KVR A;  2KC1 A;  2KNB A;  2LWP A;  4HPM B;  4IM3 A;  2FNJ B;  1D3Z A;  2ZCC A;  1P1A A;  4HXD A;  4GU2 A;  3NS8 A;  1TGZ B;  5G55 A;  2A4Z A;  3HK0 A;  3H7P A;  3N32 A;  4DDG D;  1WZ3 A;  2L8J A;  3OJ4 B;  1OEY A;  3AUL A;  4LJO B;  4YL8 A;  3A1Q B;  2FAZ A;  3U7D A;  4EUT A;  1YX5 B;  1ZKH A;  3B0A A;  3PV1 A;  2CU1 A;  4ZRJ A;  1LM8 B;  3PRP B;  2IO0 B;  3EHV A;  1H8C A;  3HHM A;  3H9D A;  2GBJ A;  3Q3J A;  4AWJ A;  2D07 B;  3BY4 B;  4JL9 A;  3TMP B;  4AJW A;  1WZ0 A;  5IA7 A;  4MSQ B;  2Z0D B;  2Z59 B;  2XK5 A;  2ZJD A;  3PZD A;  2ZVO A;  4GSW A;  3EEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...