2BPSA

Ubiquitin-like protein yukd of bacillus subtilis
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
HGSYIDITIDLKHYNGSVFDLRLSDYHPVKKVIDIAWQAQSVSMPPREGHWIRVVNKDKVFSGECKLSDCGITNGDRLEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ubiquitin
molecule keywords YUKD PROTEIN
publication title Crystal Structure of Ubiquitin-Like Protein Yukd from Bacillus Subtilis
pubmed doi rcsb
source organism Bacillus subtilis
total genus 22
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08817 YukD WXG100 protein secretion system (Wss), protein YukD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2bpsA00
5CTRC 4BOSC 4W9JA 3WANA 2RD0A 3ML8A 2JXXA 3VTWA 2C7MB 3A9JB 3U30A 3N32A 3EECA 1UBQA 2C5LC 2IO2B 2EMSA 2IO3B 3KYDD 2WDTB 1P1AA 2K6QA 4EZLA 4CYEA 2C60A 3HIZA 2IO0B 2GBKA 4DXAB 1L2NA 3R3MA 2BYEA 5DPRA 4W9IA 4AP4C 3TL5A 3CF6E 2FCNA 1WRDB 3H7SA 3OJ3A 2N1WA 4GOCA 3PTFC 2KQSA 2KJ6A 2NBUA 3ECIA 3H7PB 4ANWA 5LLIA 1YJ1A 3RUIB 2ZZPB 2AL3A 4IM2A 1WXMA 3RZWC 1OTRB 2LRUA 4W9GA 2PE6B 4X57B 3IVFA 2KXJA 4AJWA 3NZSA 3UQBA 4DBGA 2BWES 4F8CB 1E5WA 2KDFB 2M17A 4B6WA 3QJZA 3VH4B 1J19A 4FLHA 4HPLB 3V6EB 3ONSA 2FCMA 4IM3A 3M62B 5DPWA 2DZMA 3T8MA 2K1FA 2MRPA 2UYZB 2ZCBA 1A5RA 2KKCA 4K81A 2RPQA 2RGFA 2XK5B 2KTRA 2MBEA 2G4SA 3K9PB 3QK0A 3LJ3A 3PV1A 2Z0EB 2PE9A 4M8NA 2VRRB 4BOZB 3V61A 3KUDB 4IC7B 1V86A 3B08A 4N9F4 3PLVA 3WALA 1IYFA 2LXCA 2ZPNA 4ICUA 2I1KA 2IO1B 4E71A 5HKHA 2JPHA 2GBRA 4MSQB 4XZ4A 1E8ZA 4FA6A 2M4NA 4KDIC 3DVNV 3A9KB 3BINA 3IFWB 4W9FA 2CU1A 3VQIA 2R2QA 2DYBA 4G11A 2LUEA 3VUYA 4DHJD 1RLFA 2YVCA 1WX8A 3KUZA 3NOBA 4K7UA 4JL9A 1WJNA 3OJ4B 3PREA 2NPTA 3AXCA 1UZXB 4IM0A 2J0KA 2Z59B 1WFYA 4ASWC 4FJYA 4HLEA 4KZ0A 3KH0A 2GMIC 4GMVA 2JZ3B 3PS6A 2O2VA 4TQ1A 1OEYA 5AZHA 2K8HA 2Z0DB 2RR9A 4RM8A 1EF1A 2DZJA 2PJHA 3PPAA 4HDQA 4JIOU 1QZEA 1SGHA 3AU5A 3L08A 3QCAA 2XBBC 1XQQA 2KWVB 1YQBA 2IY0B 4IWPA 2BYFA 3IHPC 2GBJA 4WJPA 2PEAA 2J0MA 1YX6B 3A1QA 2NBWB 4MJSA 2DAJA 2MP2A 1E8WA 3T9LA 1LQBA 1GJZA 2D07B 1JRUA 2JF5A 3N30A 3DVGY 1WXVA 1XD3B 3Q3JA 2IBIB 3ZUNA 3ZDTA 5LXIB 3QC8B 1GC6A 3NY5A 4G50A 3ENEA 4LCDE 3L54A 2NVUI 3H1UA 3QHTA 2CR5A 4MDKE 1E7UA 4WJNA 4NAWB 3L0WB 3OLMD 4MH0E 2C7HA 4KZCA 1WM3A 4NY0A 4GGQA 4WQOB 4MGZE 5G55A 4W9KA 2FAZA 3EC8A 4BBNC 3M3JA 4MSMB 2KD0A 1P3QU 2UWQA 2LVOA 2Y5BB 3DDCB 5E6PA 4ANXA 5J2RA 4DHJB 2DAFA 1WMHB 2FUHB 4HXDA 4ZYNA 1E7VA 2YLMA 5IAAC 1WGHA 4TUUA 2C9WB 3PHWB 1HE8A 2JRHA 2HTHA 4MM3A 2IY1B 3ZNZB 2LGXA 2MW5A 3QARA 3VHTC 2IYDB 2LI5A 1WE7A 2HJ8A 1WM2A 2AYOB 2HD5B 4MGIE 4GIVA 1J0GA 4EEWA 2LWPA 4BKSA 2JUOA 4J6IA 4A3OA 2KX0A 4P7IA 3CSFA 5G2NA 2A5UA 3CMMB 3R66C 4I6PA 2D2QA 2BKRB 2KDEB 3UGBB 1PQSA 3R7RA 1WR1A 2NR2A 3DVNU 4OVUA 4JGHB 4BKTA 4NJ7A 4KIKA 3JYUA 3M95A 5J17A 2MQJA 2D11A 3SHQA 3TMPB 3L17A 1WX9A 3U8ZA 4K7WA 1D3ZA 2BKFA 1WJ6A 4HK2A 4AUQC 2CHZA 4DHZB 3L10B 3ALBA 4BBNF 3VTUA 2FCQA 4M0WB 5C23A 1OGWA 2N4FA 2KC2A 2JRIB 4ZRIA 2KWUB 1TBEA 2KMAA 3KW5B 3PT2B 3QWZB 2MA9B 3K9OB 2DZKA 2N1VA 1KLVA 1TTNA 2BYVE 3U7DA 2L0FA 3PRPB 5D7GA 3VUWA 2N9XA 1GUAB 1GNUA 1UBIA 3EHVA 3KYCD 3MHSD 4ZDVA 3TIXA 3ZNGC 3X0WA 1Z5SB 2JVCA 4E3CA 3APCA 2KQ7A 1WX7A 1LM8B 3MTNB 2ZCCA 2ZEQA 4KDLB 1H8CA 1CMXB 4A3PA 2KLGA 1Q5WB 2L8JA 4KSKC 1YIWA 3VFKA 3IBEA 2KANA 3ZVVA 4DDGD 2KTFA 3W1YA 1WH3A 2KFJA 2KVRA 4NQKE 4KVGB 2JWZA 2A4ZA 3WIMA 2B3AA 4EKUA 1E90A 3NS8A 3PHXB 3A33B 3WAMA 1EF5A 2CHWA 2KTRB 4II3B 2MSED 3ZTCA 3P2BA 2O6VA 4EOYA 1P9DU 1H4RA 4OVVA 4W9CA 2D3GA 1V5OA 4GU2A 2V1YA 3L13A 3DBHI 3O65B 4MEMA 3L16A 2KJRA 4TKNA 2WX0A 4GDKA 4PS7A 2D10A 1AARA 4W9HA 4GDLA 5JH5C 4I6NB 5CHVC 2ZVNA 1VD2A 1Z2MA 5JZEB 2AWTA 2KMCA 5E6NA 2JT4B 4ICVA 4NPNA 1KOTA 2KFKA 4HPMB 2L76A 2KWCA 4IW0A 3ZRCA 2KDIA 1NBFC 1S3SG 3W1SA 1WF9A 4PYUA 2CS4A 3TJPA 2NPTB 4EUTA 2M1MA 1V2YA 3EFUA 2NBVB 3JVZX 2FCSA 3VXWA 1EO6A 1KJTA 2ASQA 1G6JA 1WGYA 2MLBA 1UELA 2O2VB 3JSVA 3SDLC 2LGDA 4AJYB 2LD9A 3QX1A 3IG3A 1V80A 4WWNA 2L00B 1WYWB 4JQWC 5AEKB 5JHBA 2C7NB 1UH6A 5DPSA 1X1MA 1K8RB 2BF8B 2MBQA 3APFA 3HHMA 3QIJA 2DENB 4NNJB 4FADA 4BKSD 2KX3A 1WXAA 4PS3A 2OOBB 2N7EA 3A4SC 3QA8A 1UD7A 4F1SA 4EZJA 2WYQA 1WJUA 3WAPA 3RCZA 4DWFA 3WA0A 3A1QB 3GZNI 4MGKE 4WWPA 4DDID 2LXAA 1T0YA 2XEWA 4MJSB 2NCNA 2MP2B 4HCNB 5BO4B 4AWJA 1R4MI 2LRWA 2V3SA 1C3TA 2G45B 2W9NA 3MJWA 1WGRA 1SIFA 3A9JA 5TR5A 1Q1OA 1YD8U 2REXA 2BGFA 3UF8A 2KNBA 4GSWA 3D32A 2NS5A 1Q0WB 1I35A 3DPDA 4WJOA 3CSTA 4WWOA 4DHZE 2J0JA 3DBSA 3NZUA 4FHJA 3RYTA 3ML9A 2I1JA 4CO7A 4FJVB 1RRBA 4FN2A 2J7QB 3V62A 2G3QB 1WR6E 4EZKA 3C0RB 1I42A 2MBHA 1WIAA 2AL6A 3H7PA 3ZDMC 3M63B 1S1QB 2LZ6A 4LJOB 5EDSA 1LXDA 1WGDA 3AI5A 4KV2A 1ISNA 1WXSA 4IG7B 4ANUA 5IA7A 4B95A 1IPGA 3Q3FA 4TQ0A 2R2OA 2GOWA 3A4RA 4MGYE 5C1ZA 4ANVA 2L0TA 3W1SC 3ZNID 2PPHA 5E6OA 2QHOA 5JHAA 5FR6A 3VTVA 1TZ1A 2L05A 3PZDA 1KM7A 3AU4A 3BY4B 1RFAA 1NI2A 5CX3A 5D94A 2XK5A 4FJZA 4G0NB 4AOFA 1C1YB 3GOEA 4JLCA 4NQLB 2KC1A 2FIFA 4BVUC 3SU8X 2N9EB 2M0XA 3H6NA 4F7ZA 2O6VD 1P98A 1V9JA 2BWFA 2MBBB 4CHKA 4BFRA 3N3KB 2JZZA 1VCBA 3KVFB 2JY6A 4HDOA 4KIKB 4HCPB 3ZLZA 4I6LB 4PS8A 2ZNVB 1WJ4A 3LDZE 1XT9B 2WX1A 3KUCB 5LXHA 4WAAA 4MELA 3X23A 2LASA 4IWOA 4M8MA 3A9KA 3AULA 3VH3B 3ZO5B 1V81A 1WE6A 3ZKJC 3RD2A 1WZ0A 3HM3A 4G3XB 1FXTB 3V60A 2RSUA 4W9DA 3DQVA 1LFDA 3HM6X 3RZFA 2DZIA 2KOXA 4RMAA 2KJHB 3ZW3A 4B9KA 2GBMA 3HK0A 4HWIB 3NHEB 2DYMA 5AZGA 1M94A 1IP9A 2V4LA 2K39A 3APDA 3ZTDA 4PYZA 4WJQA 2K25A 4XX5A 1WZ3A 2DX5B 2G4DB 4FBJB 1BT0A 4K7SA 5DCNA 2OJRA 3I3TB 2BPSA 1WY8A 2MWSB 2KK8A 4KSLC 2KHWB 4LDTD 4HJKA 2K8CA 3DCGA 5L83A 2IZVB 2FIDA 4IWQA 5KHOA 2AEHA 1Y8RC 2MBOA 3ZNHB 4BKGA 2ZJDA 5CHWA 3VUXA 1E8YA 3TBLD 5KHQA 3PSEB 1GC7A 5J18A 4FULA 2ZNVC 1WI0A 2O6VB 2LJ5A 3RT3B 2FNJB 1UGMA 1J8CA 4ZRJA 1L7YA 2HE7A 3RULA 3OAWA 1V49A 1ZGUB 1ZKHA 4EFOA 2LVQA 3WAOA 1V5TA 1MG8A 4YL8A 2GBNA 1RAXA 3PRZA 1F9JA 1V6EA 4GDKB 4NAWA 4HVBA 2KDBA 2DYOA 3UQAA 4W9EA 4GDLB 4ZRKA 5L95C 3V6CB 4GXBA 1E8XA 3ZIMA 3UINB 2M8SA 4XC2A 2LGYA 2MCNB 2KFKB 5D6JB 1WMHA 3DBRI 3VVWB 3VAWA 3UIOB 2N9PC 1P0RA 3PLUA 3R7QA 3DVGX 3TCAA 2EKEC 3B1LX 1GG3A 2CHXA 4NJ6A 4GN1A 2K8BA 2MX2A 2EMTA 1WGGA 4URKA 1OQYA 2ZVOA 1NDDA 2KN5A 2LVPA 3H9DA 4GB9A 4DK5A 2WWZA 5D2MB 5AZFA 3DOWA 4W9LA 3JSVB 3PGEA 4A20A 3PRMB 3QQ8B 4E74A 2L3ZA 1U4AA 2KO3A 3ZRFA 3B0AA 5CHFA 3JW0X 1SE9A 5DPTA 1OEYJ 2L7RA 2KZRA 4RM9A 3UIPB 4FHKA 4LDTB 4IUMB 3VDZA 5GMVA 1ZW7A 3SD5A 3S2AA 3DBLI 4II2B 1TGZB 1YX5B 4TV3A 2K6DB 2KLCA 1R4NI 3QAQA 4K1RB 3PVLA 4LJPB 2CKHB 1EUVB 2N7DA 2ZPYA 2DHZA
chains in the Genus database with same CATH superfamily
5CTRC 1JCKB 2C7MB 3A9JB 2EMSA 1RM6C 4EZLA 3HIZA 2BYEA 2JX5A 2N1WA 4C80A 2KJ6A 4ANWA 1YJ1A 3DHIC 3RZWC 2N9LA 2PE6B 4X57B 3J9CA 2IDYA 3NZSA 4P16A 4HROA 3UQBA 2BWES 1V1PB 3FKYA 4B6WA 2M17A 3QJZA 4FLHA 3ONSA 1Y56A 3I5JC 3M62B 3ZJTA 1BXTA 3PZ7A 4GLSC 2G4SA 3K9PB 3P42A 3NUHB 2JU6X 4N9F4 1V86A 3PLVA 1IYFA 2ZPNA 3T3NA 2V9HA 1SB3C 2I1KA 2JPHA 1QILA 1V97A 3Q8CA 4FA6A 4YWGG 3DVNV 4TSSA 3IFWB 2CU1A 2JSVX 4PT5A 1AN8A 4DHJD 1T5XD 3NOBA 4JL9A 3AE9B 3AXCA 2Y5CA 1UZXB 4RGNA 4FJYA 4ZHPA 5HFYA 3N1XC 2XNAC 4RGMA 2O2VA 1OEYA 5AZHA 2BTEA 4RM8A 1EF1A 3MC0B 1QT9A 4HDQA 4JIOU 1SGHA 3L08A 1FEHA 4XGAB 2W3RA 2KWVB 1YQBA 3TSSA 1XLQA 2GBJA 4WJPA 5IOIA 2WXGA 4MJSA 4R3DA 4USAA 2D07B 1E9MA 2JF5A 1TZOA 1XD3B 3Q3JA 3QC8B 2H88B 3L54A 2NVUI 3QHTA 1UF0A 3OLMD 3AE6B 4MGZE 1VLBA 4BBNC 3KWVA 2KD0A 1TS5A 2Y5BB 3NVVA 3DDCB 4ANXA 4IKGA 4DHJB 1WMHB 2FUHB 5EE0A 1MI0A 2C9WB 3PHWB 1DOYA 2HTHA 4M02A 2LGXA 2LI5A 2DBYA 2WDRB 2WU5B 1WM2A 4MGIE 1J0GA 4BKSA 4J6IA 4A3OA 1UGJA 3R66C 3CMMB 2L32A 2D2QA 1VRAB 4WURA 1WR1A 4OVUA 4BKTA 4NJ7A 2BB5A 2WXLA 4KIKA 3M95A 5J17A 4KX6B 2ZW0A 2RMMA 3L17A 1YN3A 1WJ6A 4AUQC 2K3UA 1WSPA 1HXYD 3RN9C 3RNEC 3PT2B 2Q5WD 2DZKA 3K9OB 1GOZA 2N9XA 3ZNGC 4E3CA 3APCA 4M01A 3U2SC 1C76A 1CMXB 4WAFA 1AW7A 2KLGA 1Q5WB 4KSKC 4B0MA 3ZVVA 3IBEA 5I4DA 2I2YA 4ZYSA 4AQ7A 1WH3A 2GI9A 2KFJA 4NQKE 4S17A 3B9JA 4EKUA 3PHXB 1JW9D 3WAMA 4II3B 3ZTCA 1L5PA 4EOYA 2X8XX 2KACA 1P9DU 2BS3B 2D3GA 4GU2A 4YSZB 5HHDG 3DBHI 1K51A 3L16A 2KJRA 4TKNA 4PS7A 2D10A 3BVGA 1AARA 1ZP0B 3DWMA 5JH5C 2ZVNA 1VD2A 1I4RA 2AWTA 3NJTA 4ICVA 4NPNA 2L52A 1VR9A 4HPMB 2ACZB 1N5WA 2L83A 2LMCA 1S3SG 1WF9A 3LYYA 1FCCC 2K0PA 2LGSA 3EFUA 1YNTE 3JVZX 2FCSA 1KJTA 2ASQA 1FXAA 1UELA 2O2VB 3SDLC 3IG3A 4WWNA 4JQWC 4XE0A 5C3JB 1X1MA 1K8RB 4BKSD 2WXOA 2N7EA 4EZJA 4RFBA 3WAPA 3P1MA 2WXHA 4MGKE 1FMAD 1T0YA 1PUTA 4MJSB 4HCNB 2BS2B 3I9V1 2G45B 2W9NA 3AE5B 5G5GA 3CWIA 2REXA 2BGFA 4C00A 2M0AA 2KNBA 1ZOYB 1PDXA 2J0JA 4FHJA 2OJWA 3RYTA 2IGDA 1RRBA 2I38A 4FN2A 3V62A 1I42A 2K5PA 3ZDMC 3M63B 1S1QB 1L4DB 4LJOB 5EDSA 4KV2A 4IG7B 1SSNA 4O1NA 2YEPB 2LHDA 3Q3FA 1ROEA 4TQ0A 4MGYE 5C1ZA 4ANVA 4QAYA 3VTVA 1T0RC 2L05A 2LEKA 4JWUC 4YT0B 1NYQA 1RFAA 2XK5A 4FJZA 1C1YB 3EUB2 2D5GA 3SU8X 3H6NA 1C4AA 5E6JA 4KGRA 5AUIA 2JZZA 4HDOA 2JY6A 4KIKB 1XT9B 2WX1A 2KYWA 3KUCB 4A8XC 4IWOA 3A9KA 1V81A 3ZKJC 1TYGB 1N5XA 4G3XB 1FXTB 2RSUA 1LFDA 1TJEA 2DZIA 1DGJA 1FM0D 1E0ZA 3NHEB 2DYMA 5AZGA 2QDFA 2K39A 3ZTDA 3RI7C 3SFEB 1FIQA 3I3TB 2KVZA 2BPSA 2WXKA 2KHWB 4LDTD 1BMLC 4IWQA 3VR8B 2MBOA 1Y8RC 3NZ3A 2BS4B 3SEBA 1EWYC 3LXFA 4FULA 2AQ2B 2ZNVC 1WI0A 2IGHA 1J8CA 1GAQB 1UGMA 4ZRJA 3W2DA 3PO0A 3OAWA 1I4QA 1ZGUB 4EFOA 1V5TA 1MG8A 4YL8A 1RAXA 1V6EA 1F52A 4ZRKA 5L95C 3UINB 4HKQA 2M8SA 1GB1A 3UIOB 2LJIA 2N9PC 4L23A 1KH0A 3TCAA 1GG3A 4CQNA 2EMTA 1WGGA 4URKA 2W55A 2HDEA 1OQYA 2ZVOA 1NDDA 5D2MB 3DOWA 4W9LA 2RDHA 1NVID 3QQ8B 2L3ZA 1U4AA 1XXGA 1SE9A 1QF6A 1OEYJ 2KZRA 4LDTB 5GMVA 1YX5B 2K6DB 2DWQA 2KLCA 1R4NI 4K1RB 1GB4A 3PVLA 5HI1A 5BMGA 5EE3A 3W9CB 4W9JA 4N58A 1N61A 3EECA 2IO3B 2RDGA 3ZJUA 2WDTB 1P1AA 2K6QA 2C60A 4P1CC 4M0WA 4DXAB 5DPRA 4OZBA 1LO5D 3OJ3A 1ZXHA 3PTFC 3ECIA 3MJ5A 2EKIA 2ZZPB 4IM2A 1WXMA 4L2YA 2MH7A 2MEKA 1KLGD 3ZGZA 4DBGA 1E5WA 2KDFB 3V6EB 3I57A 4DQOC 3UI3A 4JX1C 4K81A 2XK5B 4MH8A 2KTRA 2K22A 2MBEA 4P1BC 1GPXA 2PE9A 2LFIA 2M19A 1B1ZA 2IO1B 4E71A 2M4NA 4KDIC 3A9KB 1SJHD 3AEFB 4OZCA 3DBLB 1KFYB 2J42A 2LUEA 1M4VA 1RLFA 3KQ4A 2N9KA 4K7UA 1P7EA 2NPTA 4C56C 1Q10A 1IGCA 4ASWC 4HLEA 2K9XA 4KZ0A 4WQMA 3RFZB 2Z0DB 5D3DA 2PJHA 3PPAA 3AU5A 1F2RI 1JWMD 2XBBC 2IPKD 3IHPC 2NBWB 1UWMA 2DAJA 3T9LA 1FNVA 2KQ4X 3DVGY 1WXVA 3GE3C 3ZUNA 3AECB 1GC6A 4LCDE 1E7UA 4MSMB 5E6PA 1P3QU 4LNIA 2J53A 4XYCA 3RNBC 2SEBD 4ZYNA 1WGHA 1RWSA 5BYRA 2IY1B 3ZNZB 4YTMB 1PGBA 3WCQA 3QARA 3VHTC 1WE7A 2AYOB 3VR9B 4EEWA 2LWPA 4P7IA 3CSFA 1ZXIA 3UGBB 1BUIC 2AQ3B 3JYUA 2BB6A 2D11A 3TMPB 1WX9A 3U8ZA 2BKFA 1IGDA 1XCTL 2N0SB 1EU4A 3VRAB 4BBNF 3LB8C 4M0WB 2N4FA 4TMAB 2KN4A 2KMAA 5EE9A 5D3IB 1KLVA 3PRPB 5D7GA 3RNFC 1ZDVA 2GRIA 1UBIA 3MHSD 2BW2A 2JVCA 4WIPA 2CJNA 4KDLB 1H8CA 2VH1A 1NYRA 1C79A 1K53A 3Q6BA 3AB5A 4A55A 3VFKA 4KVGB 2KMMA 2A4ZA 1L0YB 1XF5L 1FO4A 5G5HA 1EF5A 2CHWA 2KTRB 2O6VA 2KAJA 4W9CA 2VZKD 1VZ8A 2WX0A 2ZW1A 1TKGA 4W9HA 4I6NB 5CHVC 4WWMA 4ZHOA 2KFKA 1VJKA 3ZRCA 1NBFC 3W1SA 3Q3NC 1MPEA 2NPTB 4EUTA 2PIAA 4C7ZA 1EO6A 2PW9A 3BZDB 1G6JA 2LGDA 3OG5A 3QX1A 2L00B 1WWTA 1UH6A 4ACFA 3APFA 1QOGA 2KX3A 4PS3A 2OOBB 3QA8A 4LK0M 4XDCA 3IAS1 4F1SA 2WYQA 3RCZA 4DWFA 3GZNI 4WWPA 1SE4A 3IT4B 2NCNA 2V3SA 3O13A 2BYTA 2BBCA 3HVZA 1WGRA 2VZKB 5TR5A 3AE7B 2WXJA 4GSWA 3D32A 3RNAC 2KDMA 1I35A 5H92C 1D5MC 1L6UA 1N63A 3ML9A 2I1JA 1ET6A 4EZKA 4ZOHC 1F1HA 2MBHA 1WIAA 3H7PA 3L4PA 3RNGC 2LZ6A 2WDQB 1PYWD 1WXSA 4B95A 4LTUA 2R2OA 3ETRA 1I7HA 1T0SC 3ZXRA 1SEBD 3ZNID 3TEZA 2Z8LA 3PZDA 1KM7A 5CX3A 1NI2A 4JPSA 5D94A 3GOEA 2KC1A 4F7ZA 2O6VD 1TT5B 3KVFB 4MT5A 4I6LB 2ZNVB 3X23A 4M8MA 3AULA 3VH3B 3ZO5B 1WE6A 3RD2A 3V60A 1TY0A 3HM6X 3RZFA 3ZQ4A 1JRPA 4RMAA 2WQYB 1HZ5A 4B9KA 1J7AA 2UU7A 5JXVA 3HK0A 3AEAB 3PZ8A 3FAHA 1IP9A 2V4LA 1E7PB 1P7FA 4WJQA 3U4EG 1DOXA 1UNSA 1C4PA 1WZ3A 4FBJB 1BT0A 2JYEA 1JWBD 2MWSB 4KSLC 2K8CA 3DCGA 5L83A 1YOVB 5BYSA 4BKGA 2ZJDA 3VUXA 2NMQA 3BK2A 5J18A 2O6VB 2LJ5A 1C77A 1JWUD 2HE7A 1V49A 1ZKHA 2QSDA 3WAOA 1F9JA 2KDBA 4GXBA 4YXDB 1SBBB 3P4QB 2KFKB 1FXIA 3NS1A 3PLUA 4K3CA 3R7QA 3DVGX 2EKEC 3B1LX 3TEWA 2INNE 3MHZA 1E6EB 4B0EA 5H8YE 1I4XA 3PRMB 4E74A 3ZRFA 3B0AA 5DPTA 3IT6B 3FILA 3UIPB 1AYFA 2GB1A 4FHKA 3VDZA 2J52A 3AE3B 3SD5A 3DBLI 3DWGC 2N7DA 2ZPYA 5BMIA 4BOSC 1TY2A 3NVYA 3ML8A 3U30A 3N32A 1ESFA 4WH4A 1UBQA 2IO2B 4S0RA 3KYDD 2DNFA 2WXQA 4CYEA 2IO0B 4IDIA 1L2NA 2WGSA 4W9IA 4AP4C 3ABVB 1WRDB 3H7SA 3Q8FA 3H8HA 3H7PB 3ZJVA 2AL3A 2LRUA 4W9GA 2KXJA 2QIEB 2QCZA 4F8CB 1HTOA 1F77A 1J19A 4HPLB 3DBRB 5DPWA 2MRPA 4HEA1 3AMZA 1EU3A 1JMLA 1UUPA 2RPQA 3AEEB 1D4BA 1QLBB 1MVKA 2RGFA 3QK0A 3LJ3A 4M8NA 4RCOA 3V61A 4IC7B 3B08A 4YTNB 4ICUA 1YMHE 5HKHA 1TKEA 4XZ4A 2MHJA 5T8IA 1LGRA 2R2QA 2DYBA 1WX8A 4AS1A 3OJ4B 3Q2AC 4Q2JA 3TEYA 1L6VA 4IM0A 3E56A 3NVZA 2J0KA 2Z59B 1F2RC 1V1OA 1WFYA 1QKZA 4LNNA 1XLPA 2IY0B 2BYFA 2SAKA 1YX6B 4BZAA 4RF1A 1JRUA 1NI3A 3ZDTA 1VZ7A 3ENEA 3H1UA 4ZRQA 2G1EA 2CR5A 2OHFA 3L0WB 4MH0E 2C7HA 1FNWA 1WM3A 1DOIA 4NY0A 4GGQA 2WDVB 4WQOB 3Q14C 3EC8A 3M3JA 1GJZA 2UWQA 2LVOA 5BMHA 1TS3A 4HXDA 1E7VA 4TUUA 3KLSX 4K3BA 4MM3A 1HTQA 3NVWA 2MW5A 1CQVA 3MC9A 3FC4A 1YN5A 3FILB 4C7YA 2JUOA 3AEGB 4YSXB 5G2NA 2A5UA 5IO9A 3DBHB 2BKRB 2KDEB 2ICIA 3R7RA 2NR2A 3IXSA 1QQRA 2V0GA 1EM7A 1I4PA 1KRHA 1JQ4A 2NTTA 4K7WA 2X38A 4DHZB 3HRDD 3ALBA 2WXFA 2E6XA 3VTUA 2FCQA 5C23A 4HKZE 2KC2A 4ZRIA 2KWUB 1TBEA 4C4VA 3EA6A 3QWZB 4H2AA 3N1ZC 2MA9B 1TTNA 2BYVE 1FD6A 1GNUA 3KYCD 3EHVA 3TIXA 1ZDXA 1WX7A 1LM8B 3MTNB 4OW0A 1D6EC 4A3PA 4DDGD 2KTFA 4RGTA 2KVRA 1KTKA 2JWZA 1YJIA 1E90A 5GXGB 2EELA 1SIJA 3A33B 2GLSA 2G9HD 3P2BA 1H4RA 1SJED 3L13A 1STEA 4ZRPA 4MEMA 1L4ZB 1K52A 2W3SA 1ZPSA 3EGRA 2BQQA 2JWUA 1NEKB 2FBWB 2ON8A 3N1YC 1Z2MA 5JZEB 1C9FA 1XLOA 3KWLA 2KMCA 3BYTB 3E9SA 1KOTA 2L76A 4IW0A 2INCC 2KWCA 5FK9C 3P63A 4LLGM 1V8CA 1A70A 3TJPA 3AN1A 4RH6A 2RDBC 2QC8A 1WGYA 3JSVA 4AJYB 3Q3OC 2LD9A 1V80A 5JHBA 2PTLA 2C7NB 2BF8B 1TKYA 2MBQA 1KLUD 1MHHE 1UD7A 1WJUA 4P6VF 4A9AA 2WXMA 2LXAA 5BO4B 4AWJA 1OQQA 2LRWA 3CIRB 1C3TA 2INPE 1SIFA 2V3NA 1YD8U 3W5VB 4EE2A 2AX5A 2HTME 4LNKA 5EE1A 3MFGA 2NS5A 1Q0WB 3DPDA 4RGOS 2JQRB 4WJOA 3GS2A 4WWOA 4DHZE 3DBSA 4RNAA 2BT6A 2LUMA 3AV8A 1VDVA 1FFVA 1LXDA 1I4HA 3AI5A 3TEXA 5IA7A 4MM3B 1IPGA 4HJGE 2GOWA 3RNCC 5JHAA 5FR6A 2W82A 3AU4A 3BY4B 2D3CA 4NQLB 2FIFA 4L1BA 2N9EB 1P98A 1V9JA 2BWFA 2MBBB 4BFRA 3C8YA 1T0QC 1VCBA 3NG0A 2WXRA 3Q8EA 2CU3A 5LXHA 1WJ4A 3LDZE 4MELA 1FNUA 1TIFA 2LASA 3OWEB 4BAXA 1SXTA 1WYGA 1WZ0A 3HM3A 4J3OD 4C4VB 5HG2A 1R4MB 2KJHB 1FFUA 2GBMA 4HWIB 4A6QA 2IGGA 1M94A 4JWSC 4PYZA 1T6BX 4XX5A 2DX5B 5BYQA 2AQ1B 2JYTA 1WY8A 3AEBB 4HJKA 2IZVB 1IBXA 1R4NB 5KHOA 2AEHA 3ZNHB 1UWXA 1B9RA 1E8YA 4MACA 5KHQA 1GC7A 3HUIA 2LGIA 1KF6B 3RULA 2LVQA 4HVBA 2PLPA 3PRZA 4NAWA 4NJCA 3UQAA 2DYOA 4XWTA 2FUG1 1YQ3B 4XC2A 2MCNB 2QEJC 3DBRI 3VVWB 1RFKA 3W5UB 4HRSA 4YSYB 2MX2A 2L1AA 3H9DA 4GB9A 3TUOA 4DK5A 2WWZA 3BVZA 1ENFA 3JSVB 3PGEA 4A20A 2KO3A 3JW0X 1ACCA 2TSSA 2M56B 4IUMB 1ZW7A 3P4SB 3S2AA 4II2B 3QAQA 1F0ZA 4LJPB 2CKHB 3EFCA 3WANA 2RD0A 2JXXA 3VTWA 1D5ZC 2Y3AA 2C5LC 1HEZE 1VZ6A 2GBKA 3R3MA 4UDUC 3TL5A 2E3TA 3CF6E 2FCNA 2KT7A 1XEEA 2PVGC 4GOCA 2KQSA 1YJJA 2NBUA 5LLIA 3RUIB 1T3QA 1OTRB 1QOAA 3IVFA 3ZXVA 4AJWA 4ARCA 3P4RB 3VH4B 3BWUD 2D3AA 1JALA 2FCMA 4IM3A 1YN4A 2DZMA 3T8MA 2K1FA 2UYZB 2ZCBA 1A5RA 2KKCA 1HA5A 2QJLA 1SE2A 1L0VB 2V3PA 3PV1A 2Z0EB 2HJ1A 1NENB 2VRRB 4BOZB 2WXPA 2WP9B 3KUDB 3VRBB 3WALA 5FR3A 2LXCA 3AE4B 1K50A 3BVMA 2GBRA 4A90A 4MSQB 1E8ZA 2B76B 3SR6A 5C2TB 3BINA 4W9FA 3VQIA 4G11A 3VUYA 2WHIA 3DHGC 2YVCA 3KUZA 3BK1A 1WJNA 3PREA 3URYA 1RYJA 2QILA 1CK1A 3KH0A 2GMIC 4GMVA 2WLBA 2JZ3B 3PS6A 4NZLB 4N59A 4TQ1A 4US8A 3B2FA 2K8HA 1WGKA 3R2IA 2RR9A 3GP7A 2DZJA 1QZEA 3QCAA 2N7JA 1XQQA 3DHHC 1N6ZA 1IBXB 3NRZA 4IWPA 1R7SA 1ZE3D 2FE8A 2PEAA 2J0MA 3A1QA 2IJ0A 4ARIA 2MP2A 1E8WA 5TSSA 1LQBA 4RF0A 1TS2A 3N30A 1MHXA 1CZPA 5LXIB 2IBIB 4DXGA 4NAMA 3NY5A 4G50A 3U7ZA 1FRDA 4MDKE 4WJNA 4NAWB 4KZCA 5G55A 4REZA 4W9KA 2FAZA 1IUEA 3R8BA 2VH2A 5J2RA 2DAFA 3AE1B 1N62A 2YLMA 5IAAC 3RPFC 1HE8A 1MFWA 1PGXA 2JRHA 2JXTA 2WXIA 2IYDB 2HJ8A 4LNOA 3MP9A 2HD5B 2LHEA 4GIVA 5LNK1 1XO3A 3GE8C 2KX0A 2PKOA 2WNMA 4I6PA 1EWCA 1PQSA 3DVNU 4D2KA 4JGHB 2MQJA 5IN7A 1AWDA 3SHQA 1D3ZA 4OZAA 2BVCA 4HK2A 2CHZA 3L10B 4KGTA 2J4XA 1XLNA 2QMTA 4LNFA 1OGWA 2JRIB 2ONQA 3KW5B 5AUKA 2N1VA 1C4CA 1C78A 3U7DA 2L0FA 2WS3B 3VUWA 1GUAB 1QOBA 4ZDVA 3X0WA 1Z5SB 1L0XB 2KQ7A 2ZCCA 2ZEQA 3HVDA 2L8JA 1QOFA 1YIWA 2KANA 3W1YA 3N9YC 3WIMA 2B3AA 3GZNB 1I4GA 3NS8A 1D5XC 2DLBA 4XDDA 2MSED 1WRIA 4OVVA 1ZUD2 2H89B 1V5OA 2V1YA 3O65B 4GDKA 4GDLA 2D3BA 4FXCA 1J7BA 1SE3A 3BYYB 5E6NA 2JT4B 3U52E 2KDIA 1FPYA 4PYUA 2WU2B 2CS4A 1JWSD 4M00A 2M1MA 2RPVA 1V2YA 2NBVB 2PVOD 3VXWA 3P4PB 2MLBA 1WYWB 2CJOA 1XCQL 3I63C 5AEKB 3C19A 5DPSA 4FADA 2XN9C 3HHMA 3QIJA 4NNJB 2DENB 1WXAA 3A4SC 2YEPF 3V3XA 3WA0A 3A1QB 3N20C 4DDID 2XEWA 2MP2B 1R4MI 1CJEA 3MJWA 3A9JA 1Q1OA 2W54A 3UF8A 3AH7A 1JWAD 3RMKC 2V4IB 4KKJA 5IKCM 3B2GA 4DXFA 3CSTA 3NZUA 4CO7A 4FJVB 2JZPA 2J7QB 2G3QB 1WR6E 3C0RB 2PMVA 2AL6A 3BIID 2MJDA 4KGSA 1WGDA 1ISNA 4PK1A 4ANUA 2NTSA 4US9A 3AM9A 1V1PA 3A4RA 3Q69A 1HQRD 2L0TA 3W1SC 1WXQA 2PPHA 5E6OA 2QHOA 1TZ1A 4AOFA 1PGAA 4G0NB 4IOIE 1SF0A 4JLCA 5IP4D 4BVUC 1PFDA 2M0XA 4CHKA 1FRRA 1E10A 3N3KB 3T3OA 4HCPB 3ZLZA 4YTPB 4PS8A 1J7CA 1MJDA 4WAAA 3AEDB 4W9DA 1ET9A 3DQVA 2MJ3A 1FCLA 2KOXA 2OEDA 2Y5PA 3ZW3A 1OFFA 3Q8BA 2R61A 3APDA 1OQRA 1YQ4B 2K25A 2G4DB 1DYQA 4K7SA 5DCNA 4XWWA 2OJRA 3Q8AA 2KK8A 4ITKA 2FIDA 4N6EB 3GB1A 1HZ6A 5CHWA 2WXNA 3TBLD 3PSEB 5MPOA 3RT3B 2FNJB 5FKAC 1L7YA 3SFDB 3V05A 2GBNA 4GDKB 4OHJA 4W9EA 4GDLB 3V6CB 1E8XA 3ZIMA 2LGYA 5D6JB 1WMHA 3VAWA 1P0RA 2MJEA 4HPPA 2CHXA 4NJ6A 4GN1A 2K8BA 1TS4A 2KN5A 2LVPA 1MG4A 2INDC 5AZFA 4KKIA 3Q3MC 1N60A 5CHFA 3AE2B 2L7RA 2KWDA 4RM9A 4JE3B 3IAM1 3AE8B 1TGZB 4OVZA 4TV3A 3ZYYX 1JROA 3R2TA 1EUVB 3MC8A 2DHZA
chains in the Genus database with same CATH topology
5CTRC 4BOSC 4W9JA 3WANA 2RD0A 3ML8A 2JXXA 3VTWA 2C7MB 3A9JB 3U30A 3N32A 3EECA 1UBQA 2C5LC 2IO2B 2EMSA 2IO3B 3KYDD 2WDTB 1P1AA 2K6QA 4EZLA 4CYEA 2C60A 3HIZA 2IO0B 2GBKA 4DXAB 1L2NA 3R3MA 2BYEA 5DPRA 4W9IA 4AP4C 3TL5A 3CF6E 2FCNA 1WRDB 3H7SA 3OJ3A 2N1WA 4GOCA 3PTFC 2KQSA 2KJ6A 2NBUA 3ECIA 3H7PB 4ANWA 5LLIA 1YJ1A 3RUIB 2ZZPB 2AL3A 4IM2A 1WXMA 3RZWC 1OTRB 2LRUA 4W9GA 2PE6B 4X57B 3IVFA 2KXJA 4AJWA 3NZSA 3UQBA 4DBGA 2BWES 4F8CB 1E5WA 2KDFB 2M17A 4B6WA 3QJZA 3VH4B 1J19A 4FLHA 4HPLB 3V6EB 3ONSA 2FCMA 4IM3A 3M62B 5DPWA 2DZMA 3T8MA 2K1FA 2MRPA 2UYZB 2ZCBA 1A5RA 2KKCA 4K81A 2RPQA 2RGFA 2XK5B 2KTRA 2MBEA 2G4SA 3K9PB 3QK0A 3LJ3A 3PV1A 2Z0EB 2PE9A 4M8NA 2VRRB 4BOZB 3V61A 3KUDB 4IC7B 1V86A 3B08A 4N9F4 3PLVA 3WALA 1IYFA 2LXCA 2ZPNA 4ICUA 2I1KA 2IO1B 4E71A 5HKHA 2JPHA 2GBRA 4MSQB 4XZ4A 1E8ZA 4FA6A 2M4NA 4KDIC 3DVNV 3A9KB 3BINA 3IFWB 4W9FA 2CU1A 3VQIA 2R2QA 2DYBA 4G11A 2LUEA 3VUYA 4DHJD 1RLFA 2YVCA 1WX8A 3KUZA 3NOBA 4K7UA 4JL9A 1WJNA 3OJ4B 3PREA 2NPTA 3AXCA 1UZXB 4IM0A 2J0KA 2Z59B 1WFYA 4ASWC 4FJYA 4HLEA 4KZ0A 3KH0A 2GMIC 4GMVA 2JZ3B 3PS6A 2O2VA 4TQ1A 1OEYA 5AZHA 2K8HA 2Z0DB 2RR9A 4RM8A 1EF1A 2DZJA 2PJHA 3PPAA 4HDQA 4JIOU 1QZEA 1SGHA 3AU5A 3L08A 3QCAA 2XBBC 1XQQA 2KWVB 1YQBA 2IY0B 4IWPA 2BYFA 3IHPC 2GBJA 4WJPA 2PEAA 2J0MA 1YX6B 3A1QA 2NBWB 4MJSA 2DAJA 2MP2A 1E8WA 3T9LA 1LQBA 1GJZA 2D07B 1JRUA 2JF5A 3N30A 3DVGY 1WXVA 1XD3B 3Q3JA 2IBIB 3ZUNA 3ZDTA 5LXIB 3QC8B 1GC6A 3NY5A 4G50A 3ENEA 4LCDE 3L54A 2NVUI 3H1UA 3QHTA 2CR5A 4MDKE 1E7UA 4WJNA 4NAWB 3L0WB 3OLMD 4MH0E 2C7HA 4KZCA 1WM3A 4NY0A 4GGQA 4WQOB 4MGZE 5G55A 4W9KA 2FAZA 3EC8A 4BBNC 3M3JA 4MSMB 2KD0A 1P3QU 2UWQA 2LVOA 2Y5BB 3DDCB 5E6PA 4ANXA 5J2RA 4DHJB 2DAFA 1WMHB 2FUHB 4HXDA 4ZYNA 1E7VA 2YLMA 5IAAC 1WGHA 4TUUA 2C9WB 3PHWB 1HE8A 2JRHA 2HTHA 4MM3A 2IY1B 3ZNZB 2LGXA 2MW5A 3QARA 3VHTC 2IYDB 2LI5A 1WE7A 2HJ8A 1WM2A 2AYOB 2HD5B 4MGIE 4GIVA 1J0GA 4EEWA 2LWPA 4BKSA 2JUOA 4J6IA 4A3OA 2KX0A 4P7IA 3CSFA 5G2NA 2A5UA 3CMMB 3R66C 4I6PA 2D2QA 2BKRB 2KDEB 3UGBB 1PQSA 3R7RA 1WR1A 2NR2A 3DVNU 4OVUA 4JGHB 4BKTA 4NJ7A 4KIKA 3JYUA 3M95A 5J17A 2MQJA 2D11A 3SHQA 3TMPB 3L17A 1WX9A 3U8ZA 4K7WA 1D3ZA 2BKFA 1WJ6A 4HK2A 4AUQC 2CHZA 4DHZB 3L10B 3ALBA 4BBNF 3VTUA 2FCQA 4M0WB 5C23A 1OGWA 2N4FA 2KC2A 2JRIB 4ZRIA 2KWUB 1TBEA 2KMAA 3KW5B 3PT2B 3QWZB 2MA9B 3K9OB 2DZKA 2N1VA 1KLVA 1TTNA 2BYVE 3U7DA 2L0FA 3PRPB 5D7GA 3VUWA 2N9XA 1GUAB 1GNUA 1UBIA 3EHVA 3KYCD 3MHSD 4ZDVA 3TIXA 3ZNGC 3X0WA 1Z5SB 2JVCA 4E3CA 3APCA 2KQ7A 1WX7A 1LM8B 3MTNB 2ZCCA 2ZEQA 4KDLB 1H8CA 1CMXB 4A3PA 2KLGA 1Q5WB 2L8JA 4KSKC 1YIWA 3VFKA 3IBEA 2KANA 3ZVVA 4DDGD 2KTFA 3W1YA 1WH3A 2KFJA 2KVRA 4NQKE 4KVGB 2JWZA 2A4ZA 3WIMA 2B3AA 4EKUA 1E90A 3NS8A 3PHXB 3A33B 3WAMA 1EF5A 2CHWA 2KTRB 4II3B 2MSED 3ZTCA 3P2BA 2O6VA 4EOYA 1P9DU 1H4RA 4OVVA 4W9CA 2D3GA 1V5OA 4GU2A 2V1YA 3L13A 3DBHI 3O65B 4MEMA 3L16A 2KJRA 4TKNA 2WX0A 4GDKA 4PS7A 2D10A 1AARA 4W9HA 4GDLA 5JH5C 4I6NB 5CHVC 2ZVNA 1VD2A 1Z2MA 5JZEB 2AWTA 2KMCA 5E6NA 2JT4B 4ICVA 4NPNA 1KOTA 2KFKA 4HPMB 2L76A 2KWCA 4IW0A 3ZRCA 2KDIA 1NBFC 1S3SG 3W1SA 1WF9A 4PYUA 2CS4A 3TJPA 2NPTB 4EUTA 2M1MA 1V2YA 3EFUA 2NBVB 3JVZX 2FCSA 3VXWA 1EO6A 1KJTA 2ASQA 1G6JA 1WGYA 2MLBA 1UELA 2O2VB 3JSVA 3SDLC 2LGDA 4AJYB 2LD9A 3QX1A 3IG3A 1V80A 4WWNA 2L00B 1WYWB 4JQWC 5AEKB 5JHBA 2C7NB 1UH6A 5DPSA 1X1MA 1K8RB 2BF8B 2MBQA 3APFA 3HHMA 3QIJA 2DENB 4NNJB 4FADA 4BKSD 2KX3A 1WXAA 4PS3A 2OOBB 2N7EA 3A4SC 3QA8A 1UD7A 4F1SA 4EZJA 2WYQA 1WJUA 3WAPA 3RCZA 4DWFA 3WA0A 3A1QB 3GZNI 4MGKE 4WWPA 4DDID 2LXAA 1T0YA 2XEWA 4MJSB 2NCNA 2MP2B 4HCNB 5BO4B 4AWJA 1R4MI 2LRWA 2V3SA 1C3TA 2G45B 2W9NA 3MJWA 1WGRA 1SIFA 3A9JA 5TR5A 1Q1OA 1YD8U 2REXA 2BGFA 3UF8A 2KNBA 4GSWA 3D32A 2NS5A 1Q0WB 1I35A 3DPDA 4WJOA 3CSTA 4WWOA 4DHZE 2J0JA 3DBSA 3NZUA 4FHJA 3RYTA 3ML9A 2I1JA 4CO7A 4FJVB 1RRBA 4FN2A 2J7QB 3V62A 2G3QB 1WR6E 4EZKA 3C0RB 1I42A 2MBHA 1WIAA 2AL6A 3H7PA 3ZDMC 3M63B 1S1QB 2LZ6A 4LJOB 5EDSA 1LXDA 1WGDA 3AI5A 4KV2A 1ISNA 1WXSA 4IG7B 4ANUA 5IA7A 4B95A 1IPGA 3Q3FA 4TQ0A 2R2OA 2GOWA 3A4RA 4MGYE 5C1ZA 4ANVA 2L0TA 3W1SC 3ZNID 2PPHA 5E6OA 2QHOA 5JHAA 5FR6A 3VTVA 1TZ1A 2L05A 3PZDA 1KM7A 3AU4A 3BY4B 1RFAA 1NI2A 5CX3A 5D94A 2XK5A 4FJZA 4G0NB 4AOFA 1C1YB 3GOEA 4JLCA 4NQLB 2KC1A 2FIFA 4BVUC 3SU8X 2N9EB 2M0XA 3H6NA 4F7ZA 2O6VD 1P98A 1V9JA 2BWFA 2MBBB 4CHKA 4BFRA 3N3KB 2JZZA 1VCBA 3KVFB 2JY6A 4HDOA 4KIKB 4HCPB 3ZLZA 4I6LB 4PS8A 2ZNVB 1WJ4A 3LDZE 1XT9B 2WX1A 3KUCB 5LXHA 4WAAA 4MELA 3X23A 2LASA 4IWOA 4M8MA 3A9KA 3AULA 3VH3B 3ZO5B 1V81A 1WE6A 3ZKJC 3RD2A 1WZ0A 3HM3A 4G3XB 1FXTB 3V60A 2RSUA 4W9DA 3DQVA 1LFDA 3HM6X 3RZFA 2DZIA 2KOXA 4RMAA 2KJHB 3ZW3A 4B9KA 2GBMA 3HK0A 4HWIB 3NHEB 2DYMA 5AZGA 1M94A 1IP9A 2V4LA 2K39A 3APDA 3ZTDA 4PYZA 4WJQA 2K25A 4XX5A 1WZ3A 2DX5B 2G4DB 4FBJB 1BT0A 4K7SA 5DCNA 2OJRA 3I3TB 2BPSA 1WY8A 2MWSB 2KK8A 4KSLC 2KHWB 4LDTD 4HJKA 2K8CA 3DCGA 5L83A 2IZVB 2FIDA 4IWQA 5KHOA 2AEHA 1Y8RC 2MBOA 3ZNHB 4BKGA 2ZJDA 5CHWA 3VUXA 1E8YA 3TBLD 5KHQA 3PSEB 1GC7A 5J18A 4FULA 2ZNVC 1WI0A 2O6VB 2LJ5A 3RT3B 2FNJB 1UGMA 1J8CA 4ZRJA 1L7YA 2HE7A 3RULA 3OAWA 1V49A 1ZGUB 1ZKHA 4EFOA 2LVQA 3WAOA 1V5TA 1MG8A 4YL8A 2GBNA 1RAXA 3PRZA 1F9JA 1V6EA 4GDKB 4NAWA 4HVBA 2KDBA 2DYOA 3UQAA 4W9EA 4GDLB 4ZRKA 5L95C 3V6CB 4GXBA 1E8XA 3ZIMA 3UINB 2M8SA 4XC2A 2LGYA 2MCNB 2KFKB 5D6JB 1WMHA 3DBRI 3VVWB 3VAWA 3UIOB 2N9PC 1P0RA 3PLUA 3R7QA 3DVGX 3TCAA 2EKEC 3B1LX 1GG3A 2CHXA 4NJ6A 4GN1A 2K8BA 2MX2A 2EMTA 1WGGA 4URKA 1OQYA 2ZVOA 1NDDA 2KN5A 2LVPA 3H9DA 4GB9A 4DK5A 2WWZA 5D2MB 5AZFA 3DOWA 4W9LA 3JSVB 3PGEA 4A20A 3PRMB 3QQ8B 4E74A 2L3ZA 1U4AA 2KO3A 3ZRFA 3B0AA 5CHFA 3JW0X 1SE9A 5DPTA 1OEYJ 2L7RA 2KZRA 4RM9A 3UIPB 4FHKA 4LDTB 4IUMB 3VDZA 5GMVA 1ZW7A 3SD5A 3S2AA 3DBLI 4II2B 1TGZB 1YX5B 4TV3A 2K6DB 2KLCA 1R4NI 3QAQA 4K1RB 3PVLA 4LJPB 2CKHB 1EUVB 2N7DA 2ZPYA 2DHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CTR C;  4BOS C;  4W9J A;  3WAN A;  2RD0 A;  3ML8 A;  2JXX A;  3VTW A;  2C7M B;  3A9J B;  3U30 A;  3N32 A;  3EEC A;  1UBQ A;  2C5L C;  2IO2 B;  2EMS A;  2IO3 B;  3KYD D;  2WDT B;  1P1A A;  2K6Q A;  4EZL A;  4CYE A;  2C60 A;  3HIZ A;  2IO0 B;  2GBK A;  4DXA B;  1L2N A;  3R3M A;  2BYE A;  5DPR A;  4W9I A;  4AP4 C;  3TL5 A;  3CF6 E;  2FCN A;  1WRD B;  3H7S A;  3OJ3 A;  2N1W A;  4GOC A;  3PTF C;  2KQS A;  2KJ6 A;  2NBU A;  3ECI A;  3H7P B;  4ANW A;  5LLI A;  1YJ1 A;  3RUI B;  2ZZP B;  2AL3 A;  4IM2 A;  1WXM A;  3RZW C;  1OTR B;  2LRU A;  4W9G A;  2PE6 B;  4X57 B;  3IVF A;  2KXJ A;  4AJW A;  3NZS A;  3UQB A;  4DBG A;  2BWE S;  4F8C B;  1E5W A;  2KDF B;  2M17 A;  4B6W A;  3QJZ A;  3VH4 B;  1J19 A;  4FLH A;  4HPL B;  3V6E B;  3ONS A;  2FCM A;  4IM3 A;  3M62 B;  5DPW A;  2DZM A;  3T8M A;  2K1F A;  2MRP A;  2UYZ B;  2ZCB A;  1A5R A;  2KKC A;  4K81 A;  2RPQ A;  2RGF A;  2XK5 B;  2KTR A;  2MBE A;  2G4S A;  3K9P B;  3QK0 A;  3LJ3 A;  3PV1 A;  2Z0E B;  2PE9 A;  4M8N A;  2VRR B;  4BOZ B;  3V61 A;  3KUD B;  4IC7 B;  1V86 A;  3B08 A;  4N9F 4;  3PLV A;  3WAL A;  1IYF A;  2LXC A;  2ZPN A;  4ICU A;  2I1K A;  2IO1 B;  4E71 A;  5HKH A;  2JPH A;  2GBR A;  4MSQ B;  4XZ4 A;  1E8Z A;  4FA6 A;  2M4N A;  4KDI C;  3DVN V;  3A9K B;  3BIN A;  3IFW B;  4W9F A;  2CU1 A;  3VQI A;  2R2Q A;  2DYB A;  4G11 A;  2LUE A;  3VUY A;  4DHJ D;  1RLF A;  2YVC A;  1WX8 A;  3KUZ A;  3NOB A;  4K7U A;  4JL9 A;  1WJN A;  3OJ4 B;  3PRE A;  2NPT A;  3AXC A;  1UZX B;  4IM0 A;  2J0K A;  2Z59 B;  1WFY A;  4ASW C;  4FJY A;  4HLE A;  4KZ0 A;  3KH0 A;  2GMI C;  4GMV A;  2JZ3 B;  3PS6 A;  2O2V A;  4TQ1 A;  1OEY A;  5AZH A;  2K8H A;  2Z0D B;  2RR9 A;  4RM8 A;  1EF1 A;  2DZJ A;  2PJH A;  3PPA A;  4HDQ A;  4JIO U;  1QZE A;  1SGH A;  3AU5 A;  3L08 A;  3QCA A;  2XBB C;  1XQQ A;  2KWV B;  1YQB A;  2IY0 B;  4IWP A;  2BYF A;  3IHP C;  2GBJ A;  4WJP A;  2PEA A;  2J0M A;  1YX6 B;  3A1Q A;  2NBW B;  4MJS A;  2DAJ A;  2MP2 A;  1E8W A;  3T9L A;  1LQB A;  1GJZ A;  2D07 B;  1JRU A;  2JF5 A;  3N30 A;  3DVG Y;  1WXV A;  1XD3 B;  3Q3J A;  2IBI B;  3ZUN A;  3ZDT A;  5LXI B;  3QC8 B;  1GC6 A;  3NY5 A;  4G50 A;  3ENE A;  4LCD E;  3L54 A;  2NVU I;  3H1U A;  3QHT A;  2CR5 A;  4MDK E;  1E7U A;  4WJN A;  4NAW B;  3L0W B;  3OLM D;  4MH0 E;  2C7H A;  4KZC A;  1WM3 A;  4NY0 A;  4GGQ A;  4WQO B;  4MGZ E;  5G55 A;  4W9K A;  2FAZ A;  3EC8 A;  4BBN C;  3M3J A;  4MSM B;  2KD0 A;  1P3Q U;  2UWQ A;  2LVO A;  2Y5B B;  3DDC B;  5E6P A;  4ANX A;  5J2R A;  4DHJ B;  2DAF A;  1WMH B;  2FUH B;  4HXD A;  4ZYN A;  1E7V A;  2YLM A;  5IAA C;  1WGH A;  4TUU A;  2C9W B;  3PHW B;  1HE8 A;  2JRH A;  2HTH A;  4MM3 A;  2IY1 B;  3ZNZ B;  2LGX A;  2MW5 A;  3QAR A;  3VHT C;  2IYD B;  2LI5 A;  1WE7 A;  2HJ8 A;  1WM2 A;  2AYO B;  2HD5 B;  4MGI E;  4GIV A;  1J0G A;  4EEW A;  2LWP A;  4BKS A;  2JUO A;  4J6I A;  4A3O A;  2KX0 A;  4P7I A;  3CSF A;  5G2N A;  2A5U A;  3CMM B;  3R66 C;  4I6P A;  2D2Q A;  2BKR B;  2KDE B;  3UGB B;  1PQS A;  3R7R A;  1WR1 A;  2NR2 A;  3DVN U;  4OVU A;  4JGH B;  4BKT A;  4NJ7 A;  4KIK A;  3JYU A;  3M95 A;  5J17 A;  2MQJ A;  2D11 A;  3SHQ A;  3TMP B;  3L17 A;  1WX9 A;  3U8Z A;  4K7W A;  1D3Z A;  2BKF A;  1WJ6 A;  4HK2 A;  4AUQ C;  2CHZ A;  4DHZ B;  3L10 B;  3ALB A;  4BBN F;  3VTU A;  2FCQ A;  4M0W B;  5C23 A;  1OGW A;  2N4F A;  2KC2 A;  2JRI B;  4ZRI A;  2KWU B;  1TBE A;  2KMA A;  3KW5 B;  3PT2 B;  3QWZ B;  2MA9 B;  3K9O B;  2DZK A;  2N1V A;  1KLV A;  1TTN A;  2BYV E;  3U7D A;  2L0F A;  3PRP B;  5D7G A;  3VUW A;  2N9X A;  1GUA B;  1GNU A;  1UBI A;  3EHV A;  3KYC D;  3MHS D;  4ZDV A;  3TIX A;  3ZNG C;  3X0W A;  1Z5S B;  2JVC A;  4E3C A;  3APC A;  2KQ7 A;  1WX7 A;  1LM8 B;  3MTN B;  2ZCC A;  2ZEQ A;  4KDL B;  1H8C A;  1CMX B;  4A3P A;  2KLG A;  1Q5W B;  2L8J A;  4KSK C;  1YIW A;  3VFK A;  3IBE A;  2KAN A;  3ZVV A;  4DDG D;  2KTF A;  3W1Y A;  1WH3 A;  2KFJ A;  2KVR A;  4NQK E;  4KVG B;  2JWZ A;  2A4Z A;  3WIM A;  2B3A A;  4EKU A;  1E90 A;  3NS8 A;  3PHX B;  3A33 B;  3WAM A;  1EF5 A;  2CHW A;  2KTR B;  4II3 B;  2MSE D;  3ZTC A;  3P2B A;  2O6V A;  4EOY A;  1P9D U;  1H4R A;  4OVV A;  4W9C A;  2D3G A;  1V5O A;  4GU2 A;  2V1Y A;  3L13 A;  3DBH I;  3O65 B;  4MEM A;  3L16 A;  2KJR A;  4TKN A;  2WX0 A;  4GDK A;  4PS7 A;  2D10 A;  1AAR A;  4W9H A;  4GDL A;  5JH5 C;  4I6N B;  5CHV C;  2ZVN A;  1VD2 A;  1Z2M A;  5JZE B;  2AWT A;  2KMC A;  5E6N A;  2JT4 B;  4ICV A;  4NPN A;  1KOT A;  2KFK A;  4HPM B;  2L76 A;  2KWC A;  4IW0 A;  3ZRC A;  2KDI A;  1NBF C;  1S3S G;  3W1S A;  1WF9 A;  4PYU A;  2CS4 A;  3TJP A;  2NPT B;  4EUT A;  2M1M A;  1V2Y A;  3EFU A;  2NBV B;  3JVZ X;  2FCS A;  3VXW A;  1EO6 A;  1KJT A;  2ASQ A;  1G6J A;  1WGY A;  2MLB A;  1UEL A;  2O2V B;  3JSV A;  3SDL C;  2LGD A;  4AJY B;  2LD9 A;  3QX1 A;  3IG3 A;  1V80 A;  4WWN A;  2L00 B;  1WYW B;  4JQW C;  5AEK B;  5JHB A;  2C7N B;  1UH6 A;  5DPS A;  1X1M A;  1K8R B;  2BF8 B;  2MBQ A;  3APF A;  3HHM A;  3QIJ A;  2DEN B;  4NNJ B;  4FAD A;  4BKS D;  2KX3 A;  1WXA A;  4PS3 A;  2OOB B;  2N7E A;  3A4S C;  3QA8 A;  1UD7 A;  4F1S A;  4EZJ A;  2WYQ A;  1WJU A;  3WAP A;  3RCZ A;  4DWF A;  3WA0 A;  3A1Q B;  3GZN I;  4MGK E;  4WWP A;  4DDI D;  2LXA A;  1T0Y A;  2XEW A;  4MJS B;  2NCN A;  2MP2 B;  4HCN B;  5BO4 B;  4AWJ A;  1R4M I;  2LRW A;  2V3S A;  1C3T A;  2G45 B;  2W9N A;  3MJW A;  1WGR A;  1SIF A;  3A9J A;  5TR5 A;  1Q1O A;  1YD8 U;  2REX A;  2BGF A;  3UF8 A;  2KNB A;  4GSW A;  3D32 A;  2NS5 A;  1Q0W B;  1I35 A;  3DPD A;  4WJO A;  3CST A;  4WWO A;  4DHZ E;  2J0J A;  3DBS A;  3NZU A;  4FHJ A;  3RYT A;  3ML9 A;  2I1J A;  4CO7 A;  4FJV B;  1RRB A;  4FN2 A;  2J7Q B;  3V62 A;  2G3Q B;  1WR6 E;  4EZK A;  3C0R B;  1I42 A;  2MBH A;  1WIA A;  2AL6 A;  3H7P A;  3ZDM C;  3M63 B;  1S1Q B;  2LZ6 A;  4LJO B;  5EDS A;  1LXD A;  1WGD A;  3AI5 A;  4KV2 A;  1ISN A;  1WXS A;  4IG7 B;  4ANU A;  5IA7 A;  4B95 A;  1IPG A;  3Q3F A;  4TQ0 A;  2R2O A;  2GOW A;  3A4R A;  4MGY E;  5C1Z A;  4ANV A;  2L0T A;  3W1S C;  3ZNI D;  2PPH A;  5E6O A;  2QHO A;  5JHA A;  5FR6 A;  3VTV A;  1TZ1 A;  2L05 A;  3PZD A;  1KM7 A;  3AU4 A;  3BY4 B;  1RFA A;  1NI2 A;  5CX3 A;  5D94 A;  2XK5 A;  4FJZ A;  4G0N B;  4AOF A;  1C1Y B;  3GOE A;  4JLC A;  4NQL B;  2KC1 A;  2FIF A;  4BVU C;  3SU8 X;  2N9E B;  2M0X A;  3H6N A;  4F7Z A;  2O6V D;  1P98 A;  1V9J A;  2BWF A;  2MBB B;  4CHK A;  4BFR A;  3N3K B;  2JZZ A;  1VCB A;  3KVF B;  2JY6 A;  4HDO A;  4KIK B;  4HCP B;  3ZLZ A;  4I6L B;  4PS8 A;  2ZNV B;  1WJ4 A;  3LDZ E;  1XT9 B;  2WX1 A;  3KUC B;  5LXH A;  4WAA A;  4MEL A;  3X23 A;  2LAS A;  4IWO A;  4M8M A;  3A9K A;  3AUL A;  3VH3 B;  3ZO5 B;  1V81 A;  1WE6 A;  3ZKJ C;  3RD2 A;  1WZ0 A;  3HM3 A;  4G3X B;  1FXT B;  3V60 A;  2RSU A;  4W9D A;  3DQV A;  1LFD A;  3HM6 X;  3RZF A;  2DZI A;  2KOX A;  4RMA A;  2KJH B;  3ZW3 A;  4B9K A;  2GBM A;  3HK0 A;  4HWI B;  3NHE B;  2DYM A;  5AZG A;  1M94 A;  1IP9 A;  2V4L A;  2K39 A;  3APD A;  3ZTD A;  4PYZ A;  4WJQ A;  2K25 A;  4XX5 A;  1WZ3 A;  2DX5 B;  2G4D B;  4FBJ B;  1BT0 A;  4K7S A;  5DCN A;  2OJR A;  3I3T B;  2BPS A;  1WY8 A;  2MWS B;  2KK8 A;  4KSL C;  2KHW B;  4LDT D;  4HJK A;  2K8C A;  3DCG A;  5L83 A;  2IZV B;  2FID A;  4IWQ A;  5KHO A;  2AEH A;  1Y8R C;  2MBO A;  3ZNH B;  4BKG A;  2ZJD A;  5CHW A;  3VUX A;  1E8Y A;  3TBL D;  5KHQ A;  3PSE B;  1GC7 A;  5J18 A;  4FUL A;  2ZNV C;  1WI0 A;  2O6V B;  2LJ5 A;  3RT3 B;  2FNJ B;  1UGM A;  1J8C A;  4ZRJ A;  1L7Y A;  2HE7 A;  3RUL A;  3OAW A;  1V49 A;  1ZGU B;  1ZKH A;  4EFO A;  2LVQ A;  3WAO A;  1V5T A;  1MG8 A;  4YL8 A;  2GBN A;  1RAX A;  3PRZ A;  1F9J A;  1V6E A;  4GDK B;  4NAW A;  4HVB A;  2KDB A;  2DYO A;  3UQA A;  4W9E A;  4GDL B;  4ZRK A;  5L95 C;  3V6C B;  4GXB A;  1E8X A;  3ZIM A;  3UIN B;  2M8S A;  4XC2 A;  2LGY A;  2MCN B;  2KFK B;  5D6J B;  1WMH A;  3DBR I;  3VVW B;  3VAW A;  3UIO B;  2N9P C;  1P0R A;  3PLU A;  3R7Q A;  3DVG X;  3TCA A;  2EKE C;  3B1L X;  1GG3 A;  2CHX A;  4NJ6 A;  4GN1 A;  2K8B A;  2MX2 A;  2EMT A;  1WGG A;  4URK A;  1OQY A;  2ZVO A;  1NDD A;  2KN5 A;  2LVP A;  3H9D A;  4GB9 A;  4DK5 A;  2WWZ A;  5D2M B;  5AZF A;  3DOW A;  4W9L A;  3JSV B;  3PGE A;  4A20 A;  3PRM B;  3QQ8 B;  4E74 A;  2L3Z A;  1U4A A;  2KO3 A;  3ZRF A;  3B0A A;  5CHF A;  3JW0 X;  1SE9 A;  5DPT A;  1OEY J;  2L7R A;  2KZR A;  4RM9 A;  3UIP B;  4FHK A;  4LDT B;  4IUM B;  3VDZ A;  5GMV A;  1ZW7 A;  3SD5 A;  3S2A A;  3DBL I;  4II2 B;  1TGZ B;  1YX5 B;  4TV3 A;  2K6D B;  2KLC A;  1R4N I;  3QAQ A;  4K1R B;  3PVL A;  4LJP B;  2CKH B;  1EUV B;  2N7D A;  2ZPY A;  2DHZ A; 
#chains in the Genus database with same CATH topology
 5CTR C;  1JCK B;  2C7M B;  3A9J B;  2EMS A;  1RM6 C;  4EZL A;  3HIZ A;  2BYE A;  2JX5 A;  2N1W A;  4C80 A;  2KJ6 A;  4ANW A;  1YJ1 A;  3DHI C;  3RZW C;  2N9L A;  2PE6 B;  4X57 B;  3J9C A;  2IDY A;  3NZS A;  4P16 A;  4HRO A;  3UQB A;  2BWE S;  1V1P B;  3FKY A;  4B6W A;  2M17 A;  3QJZ A;  4FLH A;  3ONS A;  1Y56 A;  3I5J C;  3M62 B;  3ZJT A;  1BXT A;  3PZ7 A;  4GLS C;  2G4S A;  3K9P B;  3P42 A;  3NUH B;  2JU6 X;  4N9F 4;  1V86 A;  3PLV A;  1IYF A;  2ZPN A;  3T3N A;  2V9H A;  1SB3 C;  2I1K A;  2JPH A;  1QIL A;  1V97 A;  3Q8C A;  4FA6 A;  4YWG G;  3DVN V;  4TSS A;  3IFW B;  2CU1 A;  2JSV X;  4PT5 A;  1AN8 A;  4DHJ D;  1T5X D;  3NOB A;  4JL9 A;  3AE9 B;  3AXC A;  2Y5C A;  1UZX B;  4RGN A;  4FJY A;  4ZHP A;  5HFY A;  3N1X C;  2XNA C;  4RGM A;  2O2V A;  1OEY A;  5AZH A;  2BTE A;  4RM8 A;  1EF1 A;  3MC0 B;  1QT9 A;  4HDQ A;  4JIO U;  1SGH A;  3L08 A;  1FEH A;  4XGA B;  2W3R A;  2KWV B;  1YQB A;  3TSS A;  1XLQ A;  2GBJ A;  4WJP A;  5IOI A;  2WXG A;  4MJS A;  4R3D A;  4USA A;  2D07 B;  1E9M A;  2JF5 A;  1TZO A;  1XD3 B;  3Q3J A;  3QC8 B;  2H88 B;  3L54 A;  2NVU I;  3QHT A;  1UF0 A;  3OLM D;  3AE6 B;  4MGZ E;  1VLB A;  4BBN C;  3KWV A;  2KD0 A;  1TS5 A;  2Y5B B;  3NVV A;  3DDC B;  4ANX A;  4IKG A;  4DHJ B;  1WMH B;  2FUH B;  5EE0 A;  1MI0 A;  2C9W B;  3PHW B;  1DOY A;  2HTH A;  4M02 A;  2LGX A;  2LI5 A;  2DBY A;  2WDR B;  2WU5 B;  1WM2 A;  4MGI E;  1J0G A;  4BKS A;  4J6I A;  4A3O A;  1UGJ A;  3R66 C;  3CMM B;  2L32 A;  2D2Q A;  1VRA B;  4WUR A;  1WR1 A;  4OVU A;  4BKT A;  4NJ7 A;  2BB5 A;  2WXL A;  4KIK A;  3M95 A;  5J17 A;  4KX6 B;  2ZW0 A;  2RMM A;  3L17 A;  1YN3 A;  1WJ6 A;  4AUQ C;  2K3U A;  1WSP A;  1HXY D;  3RN9 C;  3RNE C;  3PT2 B;  2Q5W D;  2DZK A;  3K9O B;  1GOZ A;  2N9X A;  3ZNG C;  4E3C A;  3APC A;  4M01 A;  3U2S C;  1C76 A;  1CMX B;  4WAF A;  1AW7 A;  2KLG A;  1Q5W B;  4KSK C;  4B0M A;  3ZVV A;  3IBE A;  5I4D A;  2I2Y A;  4ZYS A;  4AQ7 A;  1WH3 A;  2GI9 A;  2KFJ A;  4NQK E;  4S17 A;  3B9J A;  4EKU A;  3PHX B;  1JW9 D;  3WAM A;  4II3 B;  3ZTC A;  1L5P A;  4EOY A;  2X8X X;  2KAC A;  1P9D U;  2BS3 B;  2D3G A;  4GU2 A;  4YSZ B;  5HHD G;  3DBH I;  1K51 A;  3L16 A;  2KJR A;  4TKN A;  4PS7 A;  2D10 A;  3BVG A;  1AAR A;  1ZP0 B;  3DWM A;  5JH5 C;  2ZVN A;  1VD2 A;  1I4R A;  2AWT A;  3NJT A;  4ICV A;  4NPN A;  2L52 A;  1VR9 A;  4HPM B;  2ACZ B;  1N5W A;  2L83 A;  2LMC A;  1S3S G;  1WF9 A;  3LYY A;  1FCC C;  2K0P A;  2LGS A;  3EFU A;  1YNT E;  3JVZ X;  2FCS A;  1KJT A;  2ASQ A;  1FXA A;  1UEL A;  2O2V B;  3SDL C;  3IG3 A;  4WWN A;  4JQW C;  4XE0 A;  5C3J B;  1X1M A;  1K8R B;  4BKS D;  2WXO A;  2N7E A;  4EZJ A;  4RFB A;  3WAP A;  3P1M A;  2WXH A;  4MGK E;  1FMA D;  1T0Y A;  1PUT A;  4MJS B;  4HCN B;  2BS2 B;  3I9V 1;  2G45 B;  2W9N A;  3AE5 B;  5G5G A;  3CWI A;  2REX A;  2BGF A;  4C00 A;  2M0A A;  2KNB A;  1ZOY B;  1PDX A;  2J0J A;  4FHJ A;  2OJW A;  3RYT A;  2IGD A;  1RRB A;  2I38 A;  4FN2 A;  3V62 A;  1I42 A;  2K5P A;  3ZDM C;  3M63 B;  1S1Q B;  1L4D B;  4LJO B;  5EDS A;  4KV2 A;  4IG7 B;  1SSN A;  4O1N A;  2YEP B;  2LHD A;  3Q3F A;  1ROE A;  4TQ0 A;  4MGY E;  5C1Z A;  4ANV A;  4QAY A;  3VTV A;  1T0R C;  2L05 A;  2LEK A;  4JWU C;  4YT0 B;  1NYQ A;  1RFA A;  2XK5 A;  4FJZ A;  1C1Y B;  3EUB 2;  2D5G A;  3SU8 X;  3H6N A;  1C4A A;  5E6J A;  4KGR A;  5AUI A;  2JZZ A;  4HDO A;  2JY6 A;  4KIK B;  1XT9 B;  2WX1 A;  2KYW A;  3KUC B;  4A8X C;  4IWO A;  3A9K A;  1V81 A;  3ZKJ C;  1TYG B;  1N5X A;  4G3X B;  1FXT B;  2RSU A;  1LFD A;  1TJE A;  2DZI A;  1DGJ A;  1FM0 D;  1E0Z A;  3NHE B;  2DYM A;  5AZG A;  2QDF A;  2K39 A;  3ZTD A;  3RI7 C;  3SFE B;  1FIQ A;  3I3T B;  2KVZ A;  2BPS A;  2WXK A;  2KHW B;  4LDT D;  1BML C;  4IWQ A;  3VR8 B;  2MBO A;  1Y8R C;  3NZ3 A;  2BS4 B;  3SEB A;  1EWY C;  3LXF A;  4FUL A;  2AQ2 B;  2ZNV C;  1WI0 A;  2IGH A;  1J8C A;  1GAQ B;  1UGM A;  4ZRJ A;  3W2D A;  3PO0 A;  3OAW A;  1I4Q A;  1ZGU B;  4EFO A;  1V5T A;  1MG8 A;  4YL8 A;  1RAX A;  1V6E A;  1F52 A;  4ZRK A;  5L95 C;  3UIN B;  4HKQ A;  2M8S A;  1GB1 A;  3UIO B;  2LJI A;  2N9P C;  4L23 A;  1KH0 A;  3TCA A;  1GG3 A;  4CQN A;  2EMT A;  1WGG A;  4URK A;  2W55 A;  2HDE A;  1OQY A;  2ZVO A;  1NDD A;  5D2M B;  3DOW A;  4W9L A;  2RDH A;  1NVI D;  3QQ8 B;  2L3Z A;  1U4A A;  1XXG A;  1SE9 A;  1QF6 A;  1OEY J;  2KZR A;  4LDT B;  5GMV A;  1YX5 B;  2K6D B;  2DWQ A;  2KLC A;  1R4N I;  4K1R B;  1GB4 A;  3PVL A;  5HI1 A;  5BMG A;  5EE3 A;  3W9C B;  4W9J A;  4N58 A;  1N61 A;  3EEC A;  2IO3 B;  2RDG A;  3ZJU A;  2WDT B;  1P1A A;  2K6Q A;  2C60 A;  4P1C C;  4M0W A;  4DXA B;  5DPR A;  4OZB A;  1LO5 D;  3OJ3 A;  1ZXH A;  3PTF C;  3ECI A;  3MJ5 A;  2EKI A;  2ZZP B;  4IM2 A;  1WXM A;  4L2Y A;  2MH7 A;  2MEK A;  1KLG D;  3ZGZ A;  4DBG A;  1E5W A;  2KDF B;  3V6E B;  3I57 A;  4DQO C;  3UI3 A;  4JX1 C;  4K81 A;  2XK5 B;  4MH8 A;  2KTR A;  2K22 A;  2MBE A;  4P1B C;  1GPX A;  2PE9 A;  2LFI A;  2M19 A;  1B1Z A;  2IO1 B;  4E71 A;  2M4N A;  4KDI C;  3A9K B;  1SJH D;  3AEF B;  4OZC A;  3DBL B;  1KFY B;  2J42 A;  2LUE A;  1M4V A;  1RLF A;  3KQ4 A;  2N9K A;  4K7U A;  1P7E A;  2NPT A;  4C56 C;  1Q10 A;  1IGC A;  4ASW C;  4HLE A;  2K9X A;  4KZ0 A;  4WQM A;  3RFZ B;  2Z0D B;  5D3D A;  2PJH A;  3PPA A;  3AU5 A;  1F2R I;  1JWM D;  2XBB C;  2IPK D;  3IHP C;  2NBW B;  1UWM A;  2DAJ A;  3T9L A;  1FNV A;  2KQ4 X;  3DVG Y;  1WXV A;  3GE3 C;  3ZUN A;  3AEC B;  1GC6 A;  4LCD E;  1E7U A;  4MSM B;  5E6P A;  1P3Q U;  4LNI A;  2J53 A;  4XYC A;  3RNB C;  2SEB D;  4ZYN A;  1WGH A;  1RWS A;  5BYR A;  2IY1 B;  3ZNZ B;  4YTM B;  1PGB A;  3WCQ A;  3QAR A;  3VHT C;  1WE7 A;  2AYO B;  3VR9 B;  4EEW A;  2LWP A;  4P7I A;  3CSF A;  1ZXI A;  3UGB B;  1BUI C;  2AQ3 B;  3JYU A;  2BB6 A;  2D11 A;  3TMP B;  1WX9 A;  3U8Z A;  2BKF A;  1IGD A;  1XCT L;  2N0S B;  1EU4 A;  3VRA B;  4BBN F;  3LB8 C;  4M0W B;  2N4F A;  4TMA B;  2KN4 A;  2KMA A;  5EE9 A;  5D3I B;  1KLV A;  3PRP B;  5D7G A;  3RNF C;  1ZDV A;  2GRI A;  1UBI A;  3MHS D;  2BW2 A;  2JVC A;  4WIP A;  2CJN A;  4KDL B;  1H8C A;  2VH1 A;  1NYR A;  1C79 A;  1K53 A;  3Q6B A;  3AB5 A;  4A55 A;  3VFK A;  4KVG B;  2KMM A;  2A4Z A;  1L0Y B;  1XF5 L;  1FO4 A;  5G5H A;  1EF5 A;  2CHW A;  2KTR B;  2O6V A;  2KAJ A;  4W9C A;  2VZK D;  1VZ8 A;  2WX0 A;  2ZW1 A;  1TKG A;  4W9H A;  4I6N B;  5CHV C;  4WWM A;  4ZHO A;  2KFK A;  1VJK A;  3ZRC A;  1NBF C;  3W1S A;  3Q3N C;  1MPE A;  2NPT B;  4EUT A;  2PIA A;  4C7Z A;  1EO6 A;  2PW9 A;  3BZD B;  1G6J A;  2LGD A;  3OG5 A;  3QX1 A;  2L00 B;  1WWT A;  1UH6 A;  4ACF A;  3APF A;  1QOG A;  2KX3 A;  4PS3 A;  2OOB B;  3QA8 A;  4LK0 M;  4XDC A;  3IAS 1;  4F1S A;  2WYQ A;  3RCZ A;  4DWF A;  3GZN I;  4WWP A;  1SE4 A;  3IT4 B;  2NCN A;  2V3S A;  3O13 A;  2BYT A;  2BBC A;  3HVZ A;  1WGR A;  2VZK B;  5TR5 A;  3AE7 B;  2WXJ A;  4GSW A;  3D32 A;  3RNA C;  2KDM A;  1I35 A;  5H92 C;  1D5M C;  1L6U A;  1N63 A;  3ML9 A;  2I1J A;  1ET6 A;  4EZK A;  4ZOH C;  1F1H A;  2MBH A;  1WIA A;  3H7P A;  3L4P A;  3RNG C;  2LZ6 A;  2WDQ B;  1PYW D;  1WXS A;  4B95 A;  4LTU A;  2R2O A;  3ETR A;  1I7H A;  1T0S C;  3ZXR A;  1SEB D;  3ZNI D;  3TEZ A;  2Z8L A;  3PZD A;  1KM7 A;  5CX3 A;  1NI2 A;  4JPS A;  5D94 A;  3GOE A;  2KC1 A;  4F7Z A;  2O6V D;  1TT5 B;  3KVF B;  4MT5 A;  4I6L B;  2ZNV B;  3X23 A;  4M8M A;  3AUL A;  3VH3 B;  3ZO5 B;  1WE6 A;  3RD2 A;  3V60 A;  1TY0 A;  3HM6 X;  3RZF A;  3ZQ4 A;  1JRP A;  4RMA A;  2WQY B;  1HZ5 A;  4B9K A;  1J7A A;  2UU7 A;  5JXV A;  3HK0 A;  3AEA B;  3PZ8 A;  3FAH A;  1IP9 A;  2V4L A;  1E7P B;  1P7F A;  4WJQ A;  3U4E G;  1DOX A;  1UNS A;  1C4P A;  1WZ3 A;  4FBJ B;  1BT0 A;  2JYE A;  1JWB D;  2MWS B;  4KSL C;  2K8C A;  3DCG A;  5L83 A;  1YOV B;  5BYS A;  4BKG A;  2ZJD A;  3VUX A;  2NMQ A;  3BK2 A;  5J18 A;  2O6V B;  2LJ5 A;  1C77 A;  1JWU D;  2HE7 A;  1V49 A;  1ZKH A;  2QSD A;  3WAO A;  1F9J A;  2KDB A;  4GXB A;  4YXD B;  1SBB B;  3P4Q B;  2KFK B;  1FXI A;  3NS1 A;  3PLU A;  4K3C A;  3R7Q A;  3DVG X;  2EKE C;  3B1L X;  3TEW A;  2INN E;  3MHZ A;  1E6E B;  4B0E A;  5H8Y E;  1I4X A;  3PRM B;  4E74 A;  3ZRF A;  3B0A A;  5DPT A;  3IT6 B;  3FIL A;  3UIP B;  1AYF A;  2GB1 A;  4FHK A;  3VDZ A;  2J52 A;  3AE3 B;  3SD5 A;  3DBL I;  3DWG C;  2N7D A;  2ZPY A;  5BMI A;  4BOS C;  1TY2 A;  3NVY A;  3ML8 A;  3U30 A;  3N32 A;  1ESF A;  4WH4 A;  1UBQ A;  2IO2 B;  4S0R A;  3KYD D;  2DNF A;  2WXQ A;  4CYE A;  2IO0 B;  4IDI A;  1L2N A;  2WGS A;  4W9I A;  4AP4 C;  3ABV B;  1WRD B;  3H7S A;  3Q8F A;  3H8H A;  3H7P B;  3ZJV A;  2AL3 A;  2LRU A;  4W9G A;  2KXJ A;  2QIE B;  2QCZ A;  4F8C B;  1HTO A;  1F77 A;  1J19 A;  4HPL B;  3DBR B;  5DPW A;  2MRP A;  4HEA 1;  3AMZ A;  1EU3 A;  1JML A;  1UUP A;  2RPQ A;  3AEE B;  1D4B A;  1QLB B;  1MVK A;  2RGF A;  3QK0 A;  3LJ3 A;  4M8N A;  4RCO A;  3V61 A;  4IC7 B;  3B08 A;  4YTN B;  4ICU A;  1YMH E;  5HKH A;  1TKE A;  4XZ4 A;  2MHJ A;  5T8I A;  1LGR A;  2R2Q A;  2DYB A;  1WX8 A;  4AS1 A;  3OJ4 B;  3Q2A C;  4Q2J A;  3TEY A;  1L6V A;  4IM0 A;  3E56 A;  3NVZ A;  2J0K A;  2Z59 B;  1F2R C;  1V1O A;  1WFY A;  1QKZ A;  4LNN A;  1XLP A;  2IY0 B;  2BYF A;  2SAK A;  1YX6 B;  4BZA A;  4RF1 A;  1JRU A;  1NI3 A;  3ZDT A;  1VZ7 A;  3ENE A;  3H1U A;  4ZRQ A;  2G1E A;  2CR5 A;  2OHF A;  3L0W B;  4MH0 E;  2C7H A;  1FNW A;  1WM3 A;  1DOI A;  4NY0 A;  4GGQ A;  2WDV B;  4WQO B;  3Q14 C;  3EC8 A;  3M3J A;  1GJZ A;  2UWQ A;  2LVO A;  5BMH A;  1TS3 A;  4HXD A;  1E7V A;  4TUU A;  3KLS X;  4K3B A;  4MM3 A;  1HTQ A;  3NVW A;  2MW5 A;  1CQV A;  3MC9 A;  3FC4 A;  1YN5 A;  3FIL B;  4C7Y A;  2JUO A;  3AEG B;  4YSX B;  5G2N A;  2A5U A;  5IO9 A;  3DBH B;  2BKR B;  2KDE B;  2ICI A;  3R7R A;  2NR2 A;  3IXS A;  1QQR A;  2V0G A;  1EM7 A;  1I4P A;  1KRH A;  1JQ4 A;  2NTT A;  4K7W A;  2X38 A;  4DHZ B;  3HRD D;  3ALB A;  2WXF A;  2E6X A;  3VTU A;  2FCQ A;  5C23 A;  4HKZ E;  2KC2 A;  4ZRI A;  2KWU B;  1TBE A;  4C4V A;  3EA6 A;  3QWZ B;  4H2A A;  3N1Z C;  2MA9 B;  1TTN A;  2BYV E;  1FD6 A;  1GNU A;  3KYC D;  3EHV A;  3TIX A;  1ZDX A;  1WX7 A;  1LM8 B;  3MTN B;  4OW0 A;  1D6E C;  4A3P A;  4DDG D;  2KTF A;  4RGT A;  2KVR A;  1KTK A;  2JWZ A;  1YJI A;  1E90 A;  5GXG B;  2EEL A;  1SIJ A;  3A33 B;  2GLS A;  2G9H D;  3P2B A;  1H4R A;  1SJE D;  3L13 A;  1STE A;  4ZRP A;  4MEM A;  1L4Z B;  1K52 A;  2W3S A;  1ZPS A;  3EGR A;  2BQQ A;  2JWU A;  1NEK B;  2FBW B;  2ON8 A;  3N1Y C;  1Z2M A;  5JZE B;  1C9F A;  1XLO A;  3KWL A;  2KMC A;  3BYT B;  3E9S A;  1KOT A;  2L76 A;  4IW0 A;  2INC C;  2KWC A;  5FK9 C;  3P63 A;  4LLG M;  1V8C A;  1A70 A;  3TJP A;  3AN1 A;  4RH6 A;  2RDB C;  2QC8 A;  1WGY A;  3JSV A;  4AJY B;  3Q3O C;  2LD9 A;  1V80 A;  5JHB A;  2PTL A;  2C7N B;  2BF8 B;  1TKY A;  2MBQ A;  1KLU D;  1MHH E;  1UD7 A;  1WJU A;  4P6V F;  4A9A A;  2WXM A;  2LXA A;  5BO4 B;  4AWJ A;  1OQQ A;  2LRW A;  3CIR B;  1C3T A;  2INP E;  1SIF A;  2V3N A;  1YD8 U;  3W5V B;  4EE2 A;  2AX5 A;  2HTM E;  4LNK A;  5EE1 A;  3MFG A;  2NS5 A;  1Q0W B;  3DPD A;  4RGO S;  2JQR B;  4WJO A;  3GS2 A;  4WWO A;  4DHZ E;  3DBS A;  4RNA A;  2BT6 A;  2LUM A;  3AV8 A;  1VDV A;  1FFV A;  1LXD A;  1I4H A;  3AI5 A;  3TEX A;  5IA7 A;  4MM3 B;  1IPG A;  4HJG E;  2GOW A;  3RNC C;  5JHA A;  5FR6 A;  2W82 A;  3AU4 A;  3BY4 B;  2D3C A;  4NQL B;  2FIF A;  4L1B A;  2N9E B;  1P98 A;  1V9J A;  2BWF A;  2MBB B;  4BFR A;  3C8Y A;  1T0Q C;  1VCB A;  3NG0 A;  2WXR A;  3Q8E A;  2CU3 A;  5LXH A;  1WJ4 A;  3LDZ E;  4MEL A;  1FNU A;  1TIF A;  2LAS A;  3OWE B;  4BAX A;  1SXT A;  1WYG A;  1WZ0 A;  3HM3 A;  4J3O D;  4C4V B;  5HG2 A;  1R4M B;  2KJH B;  1FFU A;  2GBM A;  4HWI B;  4A6Q A;  2IGG A;  1M94 A;  4JWS C;  4PYZ A;  1T6B X;  4XX5 A;  2DX5 B;  5BYQ A;  2AQ1 B;  2JYT A;  1WY8 A;  3AEB B;  4HJK A;  2IZV B;  1IBX A;  1R4N B;  5KHO A;  2AEH A;  3ZNH B;  1UWX A;  1B9R A;  1E8Y A;  4MAC A;  5KHQ A;  1GC7 A;  3HUI A;  2LGI A;  1KF6 B;  3RUL A;  2LVQ A;  4HVB A;  2PLP A;  3PRZ A;  4NAW A;  4NJC A;  3UQA A;  2DYO A;  4XWT A;  2FUG 1;  1YQ3 B;  4XC2 A;  2MCN B;  2QEJ C;  3DBR I;  3VVW B;  1RFK A;  3W5U B;  4HRS A;  4YSY B;  2MX2 A;  2L1A A;  3H9D A;  4GB9 A;  3TUO A;  4DK5 A;  2WWZ A;  3BVZ A;  1ENF A;  3JSV B;  3PGE A;  4A20 A;  2KO3 A;  3JW0 X;  1ACC A;  2TSS A;  2M56 B;  4IUM B;  1ZW7 A;  3P4S B;  3S2A A;  4II2 B;  3QAQ A;  1F0Z A;  4LJP B;  2CKH B;  3EFC A;  3WAN A;  2RD0 A;  2JXX A;  3VTW A;  1D5Z C;  2Y3A A;  2C5L C;  1HEZ E;  1VZ6 A;  2GBK A;  3R3M A;  4UDU C;  3TL5 A;  2E3T A;  3CF6 E;  2FCN A;  2KT7 A;  1XEE A;  2PVG C;  4GOC A;  2KQS A;  1YJJ A;  2NBU A;  5LLI A;  3RUI B;  1T3Q A;  1OTR B;  1QOA A;  3IVF A;  3ZXV A;  4AJW A;  4ARC A;  3P4R B;  3VH4 B;  3BWU D;  2D3A A;  1JAL A;  2FCM A;  4IM3 A;  1YN4 A;  2DZM A;  3T8M A;  2K1F A;  2UYZ B;  2ZCB A;  1A5R A;  2KKC A;  1HA5 A;  2QJL A;  1SE2 A;  1L0V B;  2V3P A;  3PV1 A;  2Z0E B;  2HJ1 A;  1NEN B;  2VRR B;  4BOZ B;  2WXP A;  2WP9 B;  3KUD B;  3VRB B;  3WAL A;  5FR3 A;  2LXC A;  3AE4 B;  1K50 A;  3BVM A;  2GBR A;  4A90 A;  4MSQ B;  1E8Z A;  2B76 B;  3SR6 A;  5C2T B;  3BIN A;  4W9F A;  3VQI A;  4G11 A;  3VUY A;  2WHI A;  3DHG C;  2YVC A;  3KUZ A;  3BK1 A;  1WJN A;  3PRE A;  3URY A;  1RYJ A;  2QIL A;  1CK1 A;  3KH0 A;  2GMI C;  4GMV A;  2WLB A;  2JZ3 B;  3PS6 A;  4NZL B;  4N59 A;  4TQ1 A;  4US8 A;  3B2F A;  2K8H A;  1WGK A;  3R2I A;  2RR9 A;  3GP7 A;  2DZJ A;  1QZE A;  3QCA A;  2N7J A;  1XQQ A;  3DHH C;  1N6Z A;  1IBX B;  3NRZ A;  4IWP A;  1R7S A;  1ZE3 D;  2FE8 A;  2PEA A;  2J0M A;  3A1Q A;  2IJ0 A;  4ARI A;  2MP2 A;  1E8W A;  5TSS A;  1LQB A;  4RF0 A;  1TS2 A;  3N30 A;  1MHX A;  1CZP A;  5LXI B;  2IBI B;  4DXG A;  4NAM A;  3NY5 A;  4G50 A;  3U7Z A;  1FRD A;  4MDK E;  4WJN A;  4NAW B;  4KZC A;  5G55 A;  4REZ A;  4W9K A;  2FAZ A;  1IUE A;  3R8B A;  2VH2 A;  5J2R A;  2DAF A;  3AE1 B;  1N62 A;  2YLM A;  5IAA C;  3RPF C;  1HE8 A;  1MFW A;  1PGX A;  2JRH A;  2JXT A;  2WXI A;  2IYD B;  2HJ8 A;  4LNO A;  3MP9 A;  2HD5 B;  2LHE A;  4GIV A;  5LNK 1;  1XO3 A;  3GE8 C;  2KX0 A;  2PKO A;  2WNM A;  4I6P A;  1EWC A;  1PQS A;  3DVN U;  4D2K A;  4JGH B;  2MQJ A;  5IN7 A;  1AWD A;  3SHQ A;  1D3Z A;  4OZA A;  2BVC A;  4HK2 A;  2CHZ A;  3L10 B;  4KGT A;  2J4X A;  1XLN A;  2QMT A;  4LNF A;  1OGW A;  2JRI B;  2ONQ A;  3KW5 B;  5AUK A;  2N1V A;  1C4C A;  1C78 A;  3U7D A;  2L0F A;  2WS3 B;  3VUW A;  1GUA B;  1QOB A;  4ZDV A;  3X0W A;  1Z5S B;  1L0X B;  2KQ7 A;  2ZCC A;  2ZEQ A;  3HVD A;  2L8J A;  1QOF A;  1YIW A;  2KAN A;  3W1Y A;  3N9Y C;  3WIM A;  2B3A A;  3GZN B;  1I4G A;  3NS8 A;  1D5X C;  2DLB A;  4XDD A;  2MSE D;  1WRI A;  4OVV A;  1ZUD 2;  2H89 B;  1V5O A;  2V1Y A;  3O65 B;  4GDK A;  4GDL A;  2D3B A;  4FXC A;  1J7B A;  1SE3 A;  3BYY B;  5E6N A;  2JT4 B;  3U52 E;  2KDI A;  1FPY A;  4PYU A;  2WU2 B;  2CS4 A;  1JWS D;  4M00 A;  2M1M A;  2RPV A;  1V2Y A;  2NBV B;  2PVO D;  3VXW A;  3P4P B;  2MLB A;  1WYW B;  2CJO A;  1XCQ L;  3I63 C;  5AEK B;  3C19 A;  5DPS A;  4FAD A;  2XN9 C;  3HHM A;  3QIJ A;  4NNJ B;  2DEN B;  1WXA A;  3A4S C;  2YEP F;  3V3X A;  3WA0 A;  3A1Q B;  3N20 C;  4DDI D;  2XEW A;  2MP2 B;  1R4M I;  1CJE A;  3MJW A;  3A9J A;  1Q1O A;  2W54 A;  3UF8 A;  3AH7 A;  1JWA D;  3RMK C;  2V4I B;  4KKJ A;  5IKC M;  3B2G A;  4DXF A;  3CST A;  3NZU A;  4CO7 A;  4FJV B;  2JZP A;  2J7Q B;  2G3Q B;  1WR6 E;  3C0R B;  2PMV A;  2AL6 A;  3BII D;  2MJD A;  4KGS A;  1WGD A;  1ISN A;  4PK1 A;  4ANU A;  2NTS A;  4US9 A;  3AM9 A;  1V1P A;  3A4R A;  3Q69 A;  1HQR D;  2L0T A;  3W1S C;  1WXQ A;  2PPH A;  5E6O A;  2QHO A;  1TZ1 A;  4AOF A;  1PGA A;  4G0N B;  4IOI E;  1SF0 A;  4JLC A;  5IP4 D;  4BVU C;  1PFD A;  2M0X A;  4CHK A;  1FRR A;  1E10 A;  3N3K B;  3T3O A;  4HCP B;  3ZLZ A;  4YTP B;  4PS8 A;  1J7C A;  1MJD A;  4WAA A;  3AED B;  4W9D A;  1ET9 A;  3DQV A;  2MJ3 A;  1FCL A;  2KOX A;  2OED A;  2Y5P A;  3ZW3 A;  1OFF A;  3Q8B A;  2R61 A;  3APD A;  1OQR A;  1YQ4 B;  2K25 A;  2G4D B;  1DYQ A;  4K7S A;  5DCN A;  4XWW A;  2OJR A;  3Q8A A;  2KK8 A;  4ITK A;  2FID A;  4N6E B;  3GB1 A;  1HZ6 A;  5CHW A;  2WXN A;  3TBL D;  3PSE B;  5MPO A;  3RT3 B;  2FNJ B;  5FKA C;  1L7Y A;  3SFD B;  3V05 A;  2GBN A;  4GDK B;  4OHJ A;  4W9E A;  4GDL B;  3V6C B;  1E8X A;  3ZIM A;  2LGY A;  5D6J B;  1WMH A;  3VAW A;  1P0R A;  2MJE A;  4HPP A;  2CHX A;  4NJ6 A;  4GN1 A;  2K8B A;  1TS4 A;  2KN5 A;  2LVP A;  1MG4 A;  2IND C;  5AZF A;  4KKI A;  3Q3M C;  1N60 A;  5CHF A;  3AE2 B;  2L7R A;  2KWD A;  4RM9 A;  4JE3 B;  3IAM 1;  3AE8 B;  1TGZ B;  4OVZ A;  4TV3 A;  3ZYY X;  1JRO A;  3R2T A;  1EUV B;  3MC8 A;  2DHZ A; 
#chains in the Genus database with same CATH homology
 5CTR C;  4BOS C;  4W9J A;  3WAN A;  2RD0 A;  3ML8 A;  2JXX A;  3VTW A;  2C7M B;  3A9J B;  3U30 A;  3N32 A;  3EEC A;  1UBQ A;  2C5L C;  2IO2 B;  2EMS A;  2IO3 B;  3KYD D;  2WDT B;  1P1A A;  2K6Q A;  4EZL A;  4CYE A;  2C60 A;  3HIZ A;  2IO0 B;  2GBK A;  4DXA B;  1L2N A;  3R3M A;  2BYE A;  5DPR A;  4W9I A;  4AP4 C;  3TL5 A;  3CF6 E;  2FCN A;  1WRD B;  3H7S A;  3OJ3 A;  2N1W A;  4GOC A;  3PTF C;  2KQS A;  2KJ6 A;  2NBU A;  3ECI A;  3H7P B;  4ANW A;  5LLI A;  1YJ1 A;  3RUI B;  2ZZP B;  2AL3 A;  4IM2 A;  1WXM A;  3RZW C;  1OTR B;  2LRU A;  4W9G A;  2PE6 B;  4X57 B;  3IVF A;  2KXJ A;  4AJW A;  3NZS A;  3UQB A;  4DBG A;  2BWE S;  4F8C B;  1E5W A;  2KDF B;  2M17 A;  4B6W A;  3QJZ A;  3VH4 B;  1J19 A;  4FLH A;  4HPL B;  3V6E B;  3ONS A;  2FCM A;  4IM3 A;  3M62 B;  5DPW A;  2DZM A;  3T8M A;  2K1F A;  2MRP A;  2UYZ B;  2ZCB A;  1A5R A;  2KKC A;  4K81 A;  2RPQ A;  2RGF A;  2XK5 B;  2KTR A;  2MBE A;  2G4S A;  3K9P B;  3QK0 A;  3LJ3 A;  3PV1 A;  2Z0E B;  2PE9 A;  4M8N A;  2VRR B;  4BOZ B;  3V61 A;  3KUD B;  4IC7 B;  1V86 A;  3B08 A;  4N9F 4;  3PLV A;  3WAL A;  1IYF A;  2LXC A;  2ZPN A;  4ICU A;  2I1K A;  2IO1 B;  4E71 A;  5HKH A;  2JPH A;  2GBR A;  4MSQ B;  4XZ4 A;  1E8Z A;  4FA6 A;  2M4N A;  4KDI C;  3DVN V;  3A9K B;  3BIN A;  3IFW B;  4W9F A;  2CU1 A;  3VQI A;  2R2Q A;  2DYB A;  4G11 A;  2LUE A;  3VUY A;  4DHJ D;  1RLF A;  2YVC A;  1WX8 A;  3KUZ A;  3NOB A;  4K7U A;  4JL9 A;  1WJN A;  3OJ4 B;  3PRE A;  2NPT A;  3AXC A;  1UZX B;  4IM0 A;  2J0K A;  2Z59 B;  1WFY A;  4ASW C;  4FJY A;  4HLE A;  4KZ0 A;  3KH0 A;  2GMI C;  4GMV A;  2JZ3 B;  3PS6 A;  2O2V A;  4TQ1 A;  1OEY A;  5AZH A;  2K8H A;  2Z0D B;  2RR9 A;  4RM8 A;  1EF1 A;  2DZJ A;  2PJH A;  3PPA A;  4HDQ A;  4JIO U;  1QZE A;  1SGH A;  3AU5 A;  3L08 A;  3QCA A;  2XBB C;  1XQQ A;  2KWV B;  1YQB A;  2IY0 B;  4IWP A;  2BYF A;  3IHP C;  2GBJ A;  4WJP A;  2PEA A;  2J0M A;  1YX6 B;  3A1Q A;  2NBW B;  4MJS A;  2DAJ A;  2MP2 A;  1E8W A;  3T9L A;  1LQB A;  1GJZ A;  2D07 B;  1JRU A;  2JF5 A;  3N30 A;  3DVG Y;  1WXV A;  1XD3 B;  3Q3J A;  2IBI B;  3ZUN A;  3ZDT A;  5LXI B;  3QC8 B;  1GC6 A;  3NY5 A;  4G50 A;  3ENE A;  4LCD E;  3L54 A;  2NVU I;  3H1U A;  3QHT A;  2CR5 A;  4MDK E;  1E7U A;  4WJN A;  4NAW B;  3L0W B;  3OLM D;  4MH0 E;  2C7H A;  4KZC A;  1WM3 A;  4NY0 A;  4GGQ A;  4WQO B;  4MGZ E;  5G55 A;  4W9K A;  2FAZ A;  3EC8 A;  4BBN C;  3M3J A;  4MSM B;  2KD0 A;  1P3Q U;  2UWQ A;  2LVO A;  2Y5B B;  3DDC B;  5E6P A;  4ANX A;  5J2R A;  4DHJ B;  2DAF A;  1WMH B;  2FUH B;  4HXD A;  4ZYN A;  1E7V A;  2YLM A;  5IAA C;  1WGH A;  4TUU A;  2C9W B;  3PHW B;  1HE8 A;  2JRH A;  2HTH A;  4MM3 A;  2IY1 B;  3ZNZ B;  2LGX A;  2MW5 A;  3QAR A;  3VHT C;  2IYD B;  2LI5 A;  1WE7 A;  2HJ8 A;  1WM2 A;  2AYO B;  2HD5 B;  4MGI E;  4GIV A;  1J0G A;  4EEW A;  2LWP A;  4BKS A;  2JUO A;  4J6I A;  4A3O A;  2KX0 A;  4P7I A;  3CSF A;  5G2N A;  2A5U A;  3CMM B;  3R66 C;  4I6P A;  2D2Q A;  2BKR B;  2KDE B;  3UGB B;  1PQS A;  3R7R A;  1WR1 A;  2NR2 A;  3DVN U;  4OVU A;  4JGH B;  4BKT A;  4NJ7 A;  4KIK A;  3JYU A;  3M95 A;  5J17 A;  2MQJ A;  2D11 A;  3SHQ A;  3TMP B;  3L17 A;  1WX9 A;  3U8Z A;  4K7W A;  1D3Z A;  2BKF A;  1WJ6 A;  4HK2 A;  4AUQ C;  2CHZ A;  4DHZ B;  3L10 B;  3ALB A;  4BBN F;  3VTU A;  2FCQ A;  4M0W B;  5C23 A;  1OGW A;  2N4F A;  2KC2 A;  2JRI B;  4ZRI A;  2KWU B;  1TBE A;  2KMA A;  3KW5 B;  3PT2 B;  3QWZ B;  2MA9 B;  3K9O B;  2DZK A;  2N1V A;  1KLV A;  1TTN A;  2BYV E;  3U7D A;  2L0F A;  3PRP B;  5D7G A;  3VUW A;  2N9X A;  1GUA B;  1GNU A;  1UBI A;  3EHV A;  3KYC D;  3MHS D;  4ZDV A;  3TIX A;  3ZNG C;  3X0W A;  1Z5S B;  2JVC A;  4E3C A;  3APC A;  2KQ7 A;  1WX7 A;  1LM8 B;  3MTN B;  2ZCC A;  2ZEQ A;  4KDL B;  1H8C A;  1CMX B;  4A3P A;  2KLG A;  1Q5W B;  2L8J A;  4KSK C;  1YIW A;  3VFK A;  3IBE A;  2KAN A;  3ZVV A;  4DDG D;  2KTF A;  3W1Y A;  1WH3 A;  2KFJ A;  2KVR A;  4NQK E;  4KVG B;  2JWZ A;  2A4Z A;  3WIM A;  2B3A A;  4EKU A;  1E90 A;  3NS8 A;  3PHX B;  3A33 B;  3WAM A;  1EF5 A;  2CHW A;  2KTR B;  4II3 B;  2MSE D;  3ZTC A;  3P2B A;  2O6V A;  4EOY A;  1P9D U;  1H4R A;  4OVV A;  4W9C A;  2D3G A;  1V5O A;  4GU2 A;  2V1Y A;  3L13 A;  3DBH I;  3O65 B;  4MEM A;  3L16 A;  2KJR A;  4TKN A;  2WX0 A;  4GDK A;  4PS7 A;  2D10 A;  1AAR A;  4W9H A;  4GDL A;  5JH5 C;  4I6N B;  5CHV C;  2ZVN A;  1VD2 A;  1Z2M A;  5JZE B;  2AWT A;  2KMC A;  5E6N A;  2JT4 B;  4ICV A;  4NPN A;  1KOT A;  2KFK A;  4HPM B;  2L76 A;  2KWC A;  4IW0 A;  3ZRC A;  2KDI A;  1NBF C;  1S3S G;  3W1S A;  1WF9 A;  4PYU A;  2CS4 A;  3TJP A;  2NPT B;  4EUT A;  2M1M A;  1V2Y A;  3EFU A;  2NBV B;  3JVZ X;  2FCS A;  3VXW A;  1EO6 A;  1KJT A;  2ASQ A;  1G6J A;  1WGY A;  2MLB A;  1UEL A;  2O2V B;  3JSV A;  3SDL C;  2LGD A;  4AJY B;  2LD9 A;  3QX1 A;  3IG3 A;  1V80 A;  4WWN A;  2L00 B;  1WYW B;  4JQW C;  5AEK B;  5JHB A;  2C7N B;  1UH6 A;  5DPS A;  1X1M A;  1K8R B;  2BF8 B;  2MBQ A;  3APF A;  3HHM A;  3QIJ A;  2DEN B;  4NNJ B;  4FAD A;  4BKS D;  2KX3 A;  1WXA A;  4PS3 A;  2OOB B;  2N7E A;  3A4S C;  3QA8 A;  1UD7 A;  4F1S A;  4EZJ A;  2WYQ A;  1WJU A;  3WAP A;  3RCZ A;  4DWF A;  3WA0 A;  3A1Q B;  3GZN I;  4MGK E;  4WWP A;  4DDI D;  2LXA A;  1T0Y A;  2XEW A;  4MJS B;  2NCN A;  2MP2 B;  4HCN B;  5BO4 B;  4AWJ A;  1R4M I;  2LRW A;  2V3S A;  1C3T A;  2G45 B;  2W9N A;  3MJW A;  1WGR A;  1SIF A;  3A9J A;  5TR5 A;  1Q1O A;  1YD8 U;  2REX A;  2BGF A;  3UF8 A;  2KNB A;  4GSW A;  3D32 A;  2NS5 A;  1Q0W B;  1I35 A;  3DPD A;  4WJO A;  3CST A;  4WWO A;  4DHZ E;  2J0J A;  3DBS A;  3NZU A;  4FHJ A;  3RYT A;  3ML9 A;  2I1J A;  4CO7 A;  4FJV B;  1RRB A;  4FN2 A;  2J7Q B;  3V62 A;  2G3Q B;  1WR6 E;  4EZK A;  3C0R B;  1I42 A;  2MBH A;  1WIA A;  2AL6 A;  3H7P A;  3ZDM C;  3M63 B;  1S1Q B;  2LZ6 A;  4LJO B;  5EDS A;  1LXD A;  1WGD A;  3AI5 A;  4KV2 A;  1ISN A;  1WXS A;  4IG7 B;  4ANU A;  5IA7 A;  4B95 A;  1IPG A;  3Q3F A;  4TQ0 A;  2R2O A;  2GOW A;  3A4R A;  4MGY E;  5C1Z A;  4ANV A;  2L0T A;  3W1S C;  3ZNI D;  2PPH A;  5E6O A;  2QHO A;  5JHA A;  5FR6 A;  3VTV A;  1TZ1 A;  2L05 A;  3PZD A;  1KM7 A;  3AU4 A;  3BY4 B;  1RFA A;  1NI2 A;  5CX3 A;  5D94 A;  2XK5 A;  4FJZ A;  4G0N B;  4AOF A;  1C1Y B;  3GOE A;  4JLC A;  4NQL B;  2KC1 A;  2FIF A;  4BVU C;  3SU8 X;  2N9E B;  2M0X A;  3H6N A;  4F7Z A;  2O6V D;  1P98 A;  1V9J A;  2BWF A;  2MBB B;  4CHK A;  4BFR A;  3N3K B;  2JZZ A;  1VCB A;  3KVF B;  2JY6 A;  4HDO A;  4KIK B;  4HCP B;  3ZLZ A;  4I6L B;  4PS8 A;  2ZNV B;  1WJ4 A;  3LDZ E;  1XT9 B;  2WX1 A;  3KUC B;  5LXH A;  4WAA A;  4MEL A;  3X23 A;  2LAS A;  4IWO A;  4M8M A;  3A9K A;  3AUL A;  3VH3 B;  3ZO5 B;  1V81 A;  1WE6 A;  3ZKJ C;  3RD2 A;  1WZ0 A;  3HM3 A;  4G3X B;  1FXT B;  3V60 A;  2RSU A;  4W9D A;  3DQV A;  1LFD A;  3HM6 X;  3RZF A;  2DZI A;  2KOX A;  4RMA A;  2KJH B;  3ZW3 A;  4B9K A;  2GBM A;  3HK0 A;  4HWI B;  3NHE B;  2DYM A;  5AZG A;  1M94 A;  1IP9 A;  2V4L A;  2K39 A;  3APD A;  3ZTD A;  4PYZ A;  4WJQ A;  2K25 A;  4XX5 A;  1WZ3 A;  2DX5 B;  2G4D B;  4FBJ B;  1BT0 A;  4K7S A;  5DCN A;  2OJR A;  3I3T B;  2BPS A;  1WY8 A;  2MWS B;  2KK8 A;  4KSL C;  2KHW B;  4LDT D;  4HJK A;  2K8C A;  3DCG A;  5L83 A;  2IZV B;  2FID A;  4IWQ A;  5KHO A;  2AEH A;  1Y8R C;  2MBO A;  3ZNH B;  4BKG A;  2ZJD A;  5CHW A;  3VUX A;  1E8Y A;  3TBL D;  5KHQ A;  3PSE B;  1GC7 A;  5J18 A;  4FUL A;  2ZNV C;  1WI0 A;  2O6V B;  2LJ5 A;  3RT3 B;  2FNJ B;  1UGM A;  1J8C A;  4ZRJ A;  1L7Y A;  2HE7 A;  3RUL A;  3OAW A;  1V49 A;  1ZGU B;  1ZKH A;  4EFO A;  2LVQ A;  3WAO A;  1V5T A;  1MG8 A;  4YL8 A;  2GBN A;  1RAX A;  3PRZ A;  1F9J A;  1V6E A;  4GDK B;  4NAW A;  4HVB A;  2KDB A;  2DYO A;  3UQA A;  4W9E A;  4GDL B;  4ZRK A;  5L95 C;  3V6C B;  4GXB A;  1E8X A;  3ZIM A;  3UIN B;  2M8S A;  4XC2 A;  2LGY A;  2MCN B;  2KFK B;  5D6J B;  1WMH A;  3DBR I;  3VVW B;  3VAW A;  3UIO B;  2N9P C;  1P0R A;  3PLU A;  3R7Q A;  3DVG X;  3TCA A;  2EKE C;  3B1L X;  1GG3 A;  2CHX A;  4NJ6 A;  4GN1 A;  2K8B A;  2MX2 A;  2EMT A;  1WGG A;  4URK A;  1OQY A;  2ZVO A;  1NDD A;  2KN5 A;  2LVP A;  3H9D A;  4GB9 A;  4DK5 A;  2WWZ A;  5D2M B;  5AZF A;  3DOW A;  4W9L A;  3JSV B;  3PGE A;  4A20 A;  3PRM B;  3QQ8 B;  4E74 A;  2L3Z A;  1U4A A;  2KO3 A;  3ZRF A;  3B0A A;  5CHF A;  3JW0 X;  1SE9 A;  5DPT A;  1OEY J;  2L7R A;  2KZR A;  4RM9 A;  3UIP B;  4FHK A;  4LDT B;  4IUM B;  3VDZ A;  5GMV A;  1ZW7 A;  3SD5 A;  3S2A A;  3DBL I;  4II2 B;  1TGZ B;  1YX5 B;  4TV3 A;  2K6D B;  2KLC A;  1R4N I;  3QAQ A;  4K1R B;  3PVL A;  4LJP B;  2CKH B;  1EUV B;  2N7D A;  2ZPY A;  2DHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...