1WGRA

Solution structure of the ra domain of human grb7 protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
100
structure length
100
Chain Sequence
GSSGSSGRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSDETWGLVECHPHLALERGLEDHESVVEVQAAWPVGGDSRFVFRKNFASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Growth factor receptor-bound protein 7
publication title Solution Structure of the RA Domain of Human Grb7 Protein
rcsb
source organism Homo sapiens
total genus 9
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wgrA01
2AWTA 1WXAA 5LXIB 2LUEA 2KC2A 1SIFA 2D10A 1TZ1A 2HD5B 1WE6A 2KMAA 2NPTB 1WGDA 4G0NB 3MTNB 1P9DU 3VHTC 3ML8A 2RD0A 3U30A 4EZKA 3PLVA 5JZEB 2G45B 4WJOA 2GBMA 2N9EB 2BWFA 3ENEA 4MGIE 2XK5A 2PE6B 3LJ3A 1WXVA 1YX6B 2M4NA 3PREA 2ASQA 4ICVA 4CYEA 2KDIA 4ANUA 1WR6E 3QK0A 4LJOB 2OJRA 1WFYA 3QX1A 1WX7A 3R3MA 4HK2A 2KK8A 2PPHA 5EDSA 1IP9A 4KSKC 4JL9A 4ASWC 1EUVB 2WWZA 4WJNA 3NHEB 1V81A 3ZTCA 3ZRFA 3QQ8B 5BO4B 5G2NA 4FHKA 5C1ZA 2IO0B 4E3CA 1IYFA 4M0WB 4BOZB 1S3SG 2V4LA 1Q5WB 4GU2A 4AJWA 2XBBC 2MP2B 2FIDA 2D11A 1OTRB 2LGXA 1WI0A 4FADA 4FJZA 1WXMA 1WJUA 2L8JA 4ZRIA 4HCPB 3KVFB 5CHWA 3VTVA 4GDLB 1WJNA 1U4AA 1YQBA 3ZNGC 2NS5A 2L05A 1XT9B 4WWPA 4F1SA 2O2VB 4W9JA 1KLVA 2KDFB 4DWFA 4B95A 4ZRKA 2NBVB 2K6QA 4DK5A 4I6LB 1I35A 4FJYA 1LXDA 1WF9A 4HWIB 4ANWA 3EECA 4JIOU 3KW5B 3S2AA 3CSTA 2I1KA 1Y8RC 2KTRA 5GMVA 4EOYA 2N7EA 2EMSA 2LXCA 3PZDA 5JHBA 4OVVA 1ISNA 4OVUA 3PVLA 2KWCA 1V5TA 4IWQA 4M8MA 3DBHI 3QAQA 2MBHA 1CMXB 2L76A 1E8XA 3KH0A 3W1SA 3L08A 4GN1A 4A3OA 3WIMA 3DBSA 3QIJA 2KVRA 2R2OA 5DPRA 2FNJB 3V62A 3MHSD 5DPTA 4I6PA 2KANA 1E8ZA 2OOBB 1WGHA 2KQ7A 2ZCCA 1WRDB 1ZW7A 4WJQA 1G6JA 4WWOA 4HPLB 2DAFA 3HIZA 4FULA 1WJ6A 1V80A 5E6NA 2G4SA 3QC8B 4DHZB 3ZUNA 4BVUC 2ZVNA 2MW5A 5CHFA 4B9KA 1UGMA 1UD7A 3A1QB 4MM3A 3O65B 4RM9A 2AEHA 3MJWA 3ZTDA 4IW0A 2O6VA 4GIVA 2KLGA 3L10B 3M62B 2LRUA 2ZPYA 4W9CA 2KKCA 2KHWB 2JXXA 4FA6A 3KUDB 4JGHB 3U7DA 3K9OB 2JZZA 3PTFC 1A5RA 5L83A 3ZIMA 2FCQA 4E71A 2K1FA 1YJ1A 4K7SA 2LWPA 1WGGA 1P0RA 1V5OA 1V6EA 4IWPA 4NQKE 3TJPA 3N32A 2M1MA 3JVZX 3QHTA 3VH3B 1TGZB 5D6JB 4GSWA 3IBEA 3L54A 1MG8A 4IM3A 2JUOA 1K8RB 2IO2B 3A9JB 2ZNVB 3W1YA 5CTRC 4FBJB 3QJZA 4W9LA 3UINB 2JT4B 4XX5A 2Z59B 3DDCB 3CMMB 2C7MB 1WMHB 4XC2A 3ZO5B 2M8SA 4BKGA 3PS6A 3H7SA 3U8ZA 4BFRA 1WZ0A 4W9FA 1WE7A 2IY1B 4LDTD 2RR9A 3A4RA 4HJKA 3V60A 4GDKB 3UQBA 3WAMA 1RFAA 4TQ1A 1F9JA 3RZFA 3TL5A 2Z0EB 4M8NA 2LRWA 2N7DA 3HK0A 2ZNVC 4K1RB 4KDLB 2L0TA 1TBEA 4IM0A 1WIAA 2CKHB 2LZ6A 2ZCBA 3HHMA 2C7NB 2KQSA 3JW0X 3AI5A 4P7IA 4GOCA 2NBUA 2N9PC 3PV1A 5E6PA 3VVWB 2K8HA 3R66C 4TQ0A 4RMAA 1UZXB 2DZJA 2XK5B 2YVCA 3PRZA 2K6DB 3V6CB 4K81A 4BKSD 2KX0A 3A9KA 2LASA 5AEKB 2LI5A 3PT2B 4AOFA 4IUMB 3PLUA 1Q0WB 4PS8A 3TBLD 4KZ0A 2K8CA 1PQSA 1Z2MA 1FXTB 4WAAA 2UYZB 2L00B 3ZRCA 3DQVA 2Z0DB 4NPNA 2R2QA 3PSEB 2MBBB 2MBOA 3AULA 3NS8A 3OAWA 4II2B 4F8CB 4CHKA 5AZFA 4EUTA 2LGDA 2KJHB 2LVPA 1KOTA 1OGWA 2J0JA 4NJ7A 3ZDMC 4LJPB 4DHZE 3B0AA 4KZCA 1EO6A 1V9JA 1Z5SB 4MJSA 2BYEA 5TR5A 2KX3A 3TMPB 2IBIB 1C3TA 2MBQA 1SGHA 2C9WB 3Q3FA 4AP4C 3QA8A 2KJ6A 4NY0A 4URKA 2CHZA 3UIPB 2MBEA 3L17A 5JH5C 2BWES 4NQLB 1C1YB 1SE9A 3RZWC 4G11A 3ALBA 4WQOB 5DPSA 3VFKA 4CO7A 2DAJA 2KTRB 1E8YA 4GXBA 1WZ3A 2KMCA 4J6IA 2JF5A 5HKHA 2PJHA 3N3KB 4NJ6A 2N1VA 3VAWA 3VUWA 2JVCA 2IYDB 1VCBA 2HJ8A 4I6NB 2GOWA 3H1UA 4AUQC 2GBNA 2EMTA 1IPGA 4W9DA 4II3B 4MGZE 4FLHA 3VDZA 3ZW3A 2HTHA 3ZKJC 3VQIA 2D07B 2K39A 5JHAA 3DVNU 2LVOA 4ZRJA 3ZNZB 3NZSA 4AJYB 4EEWA 3R7RA 2REXA 4GGQA 4EFOA 1J0GA 1T0YA 3GOEA 1WGYA 4NAWA 4MDKE 3VTWA 3W1SC 1I42A 1P98A 3VTUA 3IFWB 2KFKA 2MRPA 2O6VB 1XD3B 2KO3A 5KHQA 1WY8A 2D3GA 4HDQA 1TTNA 2MQJA 2KFJA 1RLFA 2C60A 5J18A 2LXAA 2M0XA 1XQQA 3OJ3A 5D94A 3M95A 1NDDA 3HM6X 1QZEA 4NNJB 4DXAB 4K7WA 4W9GA 2BKRB 2C5LC 2CU1A 2O6VD 4WWNA 3IG3A 2MLBA 4AWJA 2A5UA 2KOXA 3RULA 3OLMD 4PS3A 2LGYA 3ZNHB 2WDTB 3EHVA 3UF8A 1E8WA 1YIWA 4YL8A 1V2YA 1WM3A 2IY0B 4DBGA 5DPWA 3JSVA 2JZ3B 3RT3B 5C23A 4W9KA 1UBIA 2BYFA 4FHJA 3ML9A 2AL6A 4BBNF 4FN2A 2DYMA 1GG3A 3RUIB 5J2RA 3AU4A 3DVGY 3IHPC 2AYOB 2FIFA 2KLCA 3SDLC 3D32A 2FCNA 4F7ZA 4JLCA 2DZIA 1R4MI 2G4DB 4HCNB 3KYCD 3DCGA 1LFDA 3RCZA 3PGEA 3TIXA 4KDIC 2N1WA 4RM8A 4ZDVA 3PPAA 2HE7A 5AZHA 2FCMA 4TV3A 1WYWB 3DBRI 1V86A 3CF6E 3KUZA 3BY4B 3H7PA 1WH3A 5G55A 4G3XB 2GBRA 3K9PB 3VXWA 5IAAC 1P3QU 3ZDTA 2XEWA 1GC7A 1OEYA 1NBFC 2DZMA 4HLEA 2DENB 3L0WB 3PHWB 2RSUA 1WJ4A 1WM2A 3BINA 2MA9B 2CHXA 1V49A 2KWVB 3TCAA 2Y5BB 3V61A 4E74A 3A9KB 5CHVC 2MWSB 2CHWA 4EZJA 3VH4B 3UGBB 2FCSA 1LQBA 4N9F4 1AARA 1GNUA 2MSED 1UBQA 2K25A 2KC1A 2A4ZA 5D2MB 2BYVE 3DPDA 4BKSA 2VRRB 3V6EB 2NPTA 5L95C 4HXDA 3WANA 4MEMA 3NY5A 4A20A 1L7YA 4HDOA 3QARA 1E5WA 3UQAA 2PEAA 3SU8X 4FJVB 5D7GA 4MGYE 4DDGD 2KWUB 1WGRA 1GC6A 2KN5A 1WR1A 4K7UA 2RGFA 4MJSB 3GZNI 1BT0A 5LLIA 2MCNB 3T8MA 3QWZB 1JRUA 1E7UA 2UWQA 4B6WA 2ZZPB 1GUAB 2DYBA 2JPHA 2FAZA 3VUXA 1GJZA 1ZKHA 3RD2A 4W9IA 2AL3A 1L2NA 2V3SA 4A3PA 3ECIA 3AU5A 5E6OA 5FR6A 3L16A 3A4SC 4BBNC 2NCNA 3M3JA 4MGKE 2KDBA 3SD5A 2DX5B 4ICUA 2MP2A 3ZLZA 4X57B 2BPSA 2D2QA 2J0MA 3OJ4B 2JWZA 2ZEQA 4WJPA 4IG7B 5CX3A 3M63B 2NBWB 4GDLA 3C0RB 2LJ5A 4ANVA 1WXSA 3KUCB 4JQWC 2BF8B 3WAPA 2O2VA 2GBKA 5KHOA 1KM7A 3WALA 2KJRA 2WX0A 1KJTA 3PRPB 4ANXA 2GBJA 4KSLC 2IZVB 2L0FA 3DVNV 2JRHA 3JYUA 2WYQA 3X0WA 4IWOA 1WX9A 2IO3B 2ZVOA 2KZRA 1UELA 3ZNID 2J7QB 2NR2A 2B3AA 3DVGX 4W9EA 3DOWA 1X1MA 3RYTA 4DDID 4PYUA 2L3ZA 1NI2A 1OQYA 2PE9A 3B1LX 5DCNA 2YLMA 1H8CA 5J17A 1J19A 3CSFA 1RRBA 1UH6A 3H6NA 3EFUA 4NAWB 2DZKA 4W9HA 2W9NA 5AZGA 4BKTA 2NVUI 1LM8B 3B08A 4KIKB 2KFKB 2WX1A 2CR5A 4KIKA 3QCAA 1S1QB 4KV2A 2KDEB 3HM3A 1E90A 2N9XA 1Q1OA 3A33B 4PYZA 1EF5A 3SHQA 4MELA 1YX5B 4TKNA 2ZPNA 1RAXA 2N4FA 3L13A 4MSMB 4ZYNA 1J8CA 3WAOA 3APCA 3LDZE 3AXCA 4IM2A 2DYOA 3PRMB 3I3TB 1H4RA 2J0KA 2KTFA 4EKUA 1P1AA 3NOBA 3A1QA 2KD0A 1VD2A 2EKEC 3EC8A 3H9DA 3JSVB 4KVGB 1OEYJ 3APDA 2DHZA 4GB9A 1ZGUB 4G50A 3NZUA 4MH0E 2FUHB 2JY6A 4XZ4A 4BOSC 3APFA 2QHOA 4GMVA 3PHXB 3N30A 5IA7A 2MX2A 2GMIC 4EZLA 1M94A 3DBLI 3X23A 3P2BA 2M17A 2BGFA 3KYDD 4MSQB 3R7QA 2I1JA 2RPQA 3T9LA 1EF1A 4TUUA 1WX8A 4HVBA 2G3QB 4LCDE 4IC7B 4LDTB 4PS7A 4DHJB 3A9JA 2LVQA 2C7HA 4HPMB 2K8BA 3UIOB 3H7PB 3ONSA 2L7RA 2LD9A 2ZJDA 5LXHA 2JRIB 1WMHA 2V1YA 2KXJA 3Q3JA 3IVFA 2CS4A 2KNBA 3ZVVA 4DHJD 1HE8A 4GDKA 2IO1B 1R4NI 1YD8U 1E7VA 3WA0A 1D3ZA 2BKFA 3VUYA
chains in the Genus database with same CATH superfamily
5LXIB 3W5VB 2PW9A 2FUG1 2KMAA 3VHTC 2NPTB 1HZ5A 3RMKC 1ZOYB 2RD0A 1VJKA 3OG5A 5JZEB 2BT6A 2BWFA 2XK5A 3PREA 2ASQA 2KDIA 3QK0A 1FNUA 5EDSA 1WFYA 2PPHA 4KSKC 4ASWC 3R8BA 2WWZA 3ZQ4A 3ZRFA 5BO4B 5C1ZA 1IYFA 4B0MA 4AJWA 1WI0A 3LYYA 2LGSA 3KVFB 3Q8FA 5CHWA 1WJNA 1F0ZA 2GI9A 1GPXA 3TEZA 4W9JA 4XYCA 4B95A 2K5PA 1YJJA 1D4BA 1QQRA 2WHIA 3NG0A 3EECA 1Q10A 1RFKA 3CSTA 2I1KA 2KTRA 5GMVA 4EOYA 1ISNA 4ZOHC 1FRRA 1XCQL 2IPKD 1JROA 4A3OA 3DBSA 2PKOA 3Q3NC 4I6PA 2KANA 2KQ7A 3P4PB 2M0AA 3HIZA 5E6NA 3QC8B 3ZUNA 1JQ4A 3A1QB 5C2TB 4NZLB 3FAHA 1V8CA 1DOYA 3BVZA 2PIAA 3L10B 3M62B 3DWMA 1N5XA 3U7DA 3ZYYX 2FCQA 1YJ1A 2LWPA 5T8IA 1P0RA 1V6EA 4IWPA 3N32A 2BVCA 3L54A 1MG8A 4IM3A 2JUOA 1BMLC 4YSZB 2ZNVB 3FC4A 2YEPB 4W9LA 3UINB 2JT4B 5G5GA 1WMHB 2M8SA 4XWTA 1WE7A 2IY1B 4LDTD 2RR9A 3A4RA 3SFEB 4GDKB 4TQ1A 1F9JA 3EA6A 2IGDA 3HK0A 2ZNVC 4IM0A 1XLQA 1KF6B 4RGNA 5IOIA 3ZJTA 4GOCA 1UZXB 3PRZA 3V6CB 4K81A 1EU3A 1QOGA 3PLUA 3B2FA 2QSDA 1OGWA 4NJ7A 4DHZE 4MJSA 1SJED 2WU2B 4URKA 3NVWA 3SR6A 3BK1A 3ALBA 3VFKA 5C3JB 3B9JA 1PUTA 2CJOA 4GXBA 1WZ3A 4M00A 2N1VA 2IYDB 2GOWA 2Y3AA 3H1UA 2GBNA 4LNIA 1T3QA 4FLHA 3VDZA 3ZKJC 2WXHA 1V1PB 3I9V1 4YSXB 4ARIA 2LVOA 4ZRJA 4AJYB 5IP4D 2IJ0A 2REXA 2J53A 4GGQA 4EFOA 1J0GA 4L23A 1T0YA 1N60A 3W1SC 3GS2A 2MRPA 4XE0A 1D5MC 1I4RA 2VZKB 2C60A 2LXAA 1XQQA 3VR9B 1NDDA 1R4MB 2N7JA 2CU1A 4WWNA 1NEKB 3LXFA 2KOXA 1K53A 3ZNHB 2WXFA 1E8WA 3NVZA 1YIWA 2OEDA 3I57A 2ON8A 3JSVA 3RNGC 2JZ3B 3RT3B 2WS3B 1VZ7A 2QMTA 2RPVA 5C23A 1UBIA 2IDYA 1I4PA 3ML9A 2AL6A 2DYMA 2M56B 1YJIA 4P6VF 3N1XC 2ONQA 3IHPC 1WGKA 2MHJA 4WWMA 4HCNB 3RCZA 3TIXA 4RGTA 2N1WA 1F2RI 3PPAA 2OHFA 4OW0A 1V86A 3CF6E 1N6ZA 2W3SA 2GBRA 1VLBA 1R7SA 3ZDTA 2XEWA 4J3OD 2DZMA 2DENB 3L0WB 3PHWB 3RPFC 1WM2A 2WXNA 2CHXA 2KWVB 2MWSB 2DLBA 3UGBB 4HPPA 1GNUA 2MSED 1UBQA 1SE4A 4YT0B 2INPE 3PZ8A 2NPTA 3MHZA 3WANA 4MEMA 4YTNB 4A20A 3UQAA 2PEAA 2KYWA 1B9RA 1ET6A 1GC6A 2V3PA 1JRUA 3ECIA 3AU5A 5FR6A 3L16A 4YXDB 4MGKE 2ICIA 4X57B 2BPSA 2D2QA 5CX3A 1T6BX 3C19A 3GE3C 2LJ5A 4ANVA 1WXSA 3KUCB 4JQWC 2BF8B 2KJRA 4ANXA 2L0FA 2WLBA 5HFYA 1WX9A 2J7QB 2NR2A 1X1MA 2G1EA 1NI2A 5DCNA 3B1LX 5FK9C 5J17A 5AZGA 2XN9C 2WX1A 3BWUD 4KIKA 4KGTA 5D3DA 3T3OA 1YN5A 3U4EG 1Q1OA 3A33B 4MELA 1I4XA 3L13A 1OQRA 4MSMB 3AXCA 4US9A 4DXGA 1MFWA 3PRMB 3A1QA 2KD0A 4KVGB 1OEYJ 2WXRA 3APDA 3IT6B 4XZ4A 1SXTA 5IA7A 2MX2A 3MJ5A 3DBLI 2I2YA 3T9LA 1F2RC 2JYEA 1P7EA 4KKJA 4DHJB 3OWEB 2KDMA 2LVQA 2LGIA 3H7PB 3ONSA 2D5GA 2JRIB 1WMHA 2LFIA 2WXQA 4GDKA 1E7VA 4NPNA 2BKFA 2AWTA 4MT5A 2LUEA 1PGBA 2UU7A 2KC2A 3P42A 2D10A 4G0NB 2HD5B 3MTNB 1P9DU 5G5HA 4EZKA 1QT9A 3PLVA 4C00A 2GBMA 2KT7A 3WCQA 4CQNA 1WXVA 4CYEA 1D5ZC 1L0XB 4HK2A 1AN8A 5BMIA 4JL9A 5BMGA 1V81A 3ZTCA 4FHKA 4E3CA 4M0WB 1I4HA 2VH1A 1JWUD 1TS4A 2XBBC 1EWYC 4FJZA 4O1NA 4GDLB 2NS5A 4WWPA 1XT9B 4F1SA 3FKYA 2O2VB 1KLVA 1NENB 2X38A 4JE3B 4DK5A 1T0RC 3Q8CA 1LXDA 1WF9A 4ANWA 3AECB 3V3XA 1FPYA 2N7EA 5JHBA 2Q5WD 4OVUA 1K51A 3PVLA 2KWCA 2PTLA 4M8MA 3QAQA 2L76A 3W1SA 2YEPF 3WIMA 3QIJA 1V1PA 5DPRA 1E8ZA 2ZCCA 2LHEA 1G6JA 4HPLB 2DAFA 1WJ6A 5CHFA 2K9XA 2AEHA 3N20C 2LRUA 3Q8EA 4FA6A 2KHWB 1TIFA 3KUDB 4JGHB 2JZZA 3PTFC 2WU5B 4N58A 1JCKB 4YSYB 1YOVB 4H2AA 5AUKA 4NQKE 3TJPA 1NI3A 1L4ZB 2QCZA 3SFDB 3QHTA 5D6JB 1ZPSA 1TS2A 3IBEA 1TYGB 1K8RB 3A9JB 1NYQA 1OQQA 4FBJB 4XX5A 4S0RA 2C7MB 3SEBA 3EFCA 3ZXVA 1HZ6A 3MC8A 3B2GA 1WZ0A 4A55A 3V60A 3IAS1 1JW9D 4N59A 1TS3A 1XLOA 3U7ZA 1TY2A 4L2YA 4OZAA 4M8NA 1FCLA 2E6XA 1TBEA 3ZJVA 1PDXA 2CKHB 2LEKA 5BYRA 2LZ6A 2KQSA 3JW0X 3AI5A 2NBUA 3KWVA 5E6PA 3VVWB 4DXFA 4TQ0A 2YVCA 2BS3B 1FNWA 2LASA 5AEKB 1M4VA 1MHXA 2V9HA 1FO4A 1QLBB 4LNFA 1Q0WB 4PS8A 2K8CA 1PQSA 4WAAA 2Z8LA 3ZRCA 2Z0DB 1SF0A 2MBOA 3AULA 4F8CB 3P63A 4CHKA 5AZFA 2KJHB 1KOTA 3HVZA 3Q3MC 4FXCA 2EKIA 3ZDMC 1XEEA 3B0AA 1V9JA 1Z5SB 1FNVA 2BYEA 4S17A 2IBIB 1SGHA 3TEYA 3Q3FA 4IOIE 2BTEA 2KJ6A 3L17A 5JH5C 1SE9A 4G11A 5DPSA 2DAJA 3DWGC 1VRAB 2KMCA 2RDGA 3N3KB 3VAWA 1C77A 4ZRPA 2WDQB 3LB8C 4ZRQA 4RGOS 3ZW3A 1L5PA 1I7HA 2K39A 2D3CA 3RNEC 3ZNZB 3R7RA 1YQ3B 4MH8A 1WGYA 4MM3B 4WH4A 1P98A 2JSVX 3VTUA 3IFWB 3W2DA 5KHQA 2MJEA 2JX5A 2KFJA 2RMMA 3BVMA 5D94A 2K3UA 3HM6X 4DXAB 1RWSA 2BKRB 2O6VD 1SSNA 4LNOA 4YL8A 5DPWA 5EE0A 1AW7A 4W9KA 2BYFA 1L4DB 4FN2A 1GG3A 5J2RA 2MJDA 1MVKA 1HTQA 5H92C 3D32A 4F7ZA 3NVYA 1R4MI 2G4DB 2ZW1A 3KYCD 3DCGA 4KDIC 4ZDVA 1JWMD 2HE7A 4TV3A 3H7PA 5D3IB 5G55A 3Q8BA 1OEYA 1NBFC 3GP7A 3VH4B 2FCSA 4N9F4 2NMQA 2KC1A 2A4ZA 3AE8B 1KH0A 3DPDA 1KLGD 2VRRB 4HXDA 4HDOA 1E5WA 5BMHA 1KFYB 2KWUB 1WGRA 2QIEB 1WR1A 2MJ3A 1BT0A 3QWZB 1E7UA 1GUAB 2DYBA 2GB1A 1C9FA 1AYFA 2MH7A 2V3SA 3L4PA 4A3PA 2GLSA 1XCTL 3J9CA 4M0WA 3AEAB 3DHGC 3SD5A 2BB5A 4RF1A 2KVZA 5EE1A 4BAXA 4M01A 2JWZA 2W3RA 3NUHB 2ZEQA 1QOAA 2PVOD 1IGDA 3U52E 2KQ4X 4GDLA 3WAPA 2O2VA 2GBKA 2BYTA 1ACCA 4RH6A 2IZVB 2LJIA 3X0WA 2IO3B 3AMZA 4JX1C 1UELA 3ZNID 1HTOA 1J7BA 1H8CA 3RNAC 1J19A 3CSFA 1RRBA 4W9HA 2W9NA 4BKTA 1E6EB 1LM8B 3B08A 2KFKB 2CR5A 3QCAA 3HM3A 2LMCA 2N9XA 4PYZA 3Q6BA 2ZPNA 3BYYB 3WAOA 3APCA 3KQ4A 4IM2A 2DYOA 3ZGZA 3W5UB 4C7ZA 2KTFA 3GE8C 4HJGE 5AUIA 1VD2A 2W55A 2EKEC 3EC8A 3H9DA 2AQ3B 1VZ6A 1ZDXA 4G50A 3NZUA 3RFZB 3AE9B 1IUEA 3APFA 3PHXB 4EZLA 1R4NB 4KGRA 2PLPA 4C7YA 1JRPA 2I1JA 2KAJA 2G3QB 4A90A 4US8A 3A9JA 2J52A 2H88B 1SBBB 2L7RA 3KLSX 4A9AA 5LXHA 2V1YA 2JZPA 2KXJA 3IVFA 2CS4A 4N6EB 4ACFA 1FFVA 4XWWA 1D3ZA 1WXAA 1SIFA 1TZ1A 1WGDA 3ML8A 3AM9A 2G45B 2N9EB 3O13A 1OFFA 1F52A 1YX6B 4ICVA 4ANUA 3MFGA 4LJOB 1TT5B 2OJRA 3QX1A 1WX7A 3R3MA 1EUVB 3DHIC 3P4QB 3AE6B 4WJNA 3CIRB 4DQOC 1SB3C 1CQVA 1HA5A 3QQ8B 1TKEA 5G2NA 5BYSA 2IO0B 1KRHA 2WXOA 3BK2A 1MI0A 3Q69A 1S3SG 1KTKA 2V4LA 5LNK1 2MP2B 2FIDA 2LGXA 1OTRB 4C80A 4YTPB 1WXMA 3DBHB 3VTVA 1U4AA 2L05A 2WDRB 2NBVB 1K50A 4I6LB 1I35A 4OVZA 1DOIA 2BS4B 2WXLA 3S2AA 1Y8RC 2BW2A 2LXCA 4ITKA 4OVVA 1FXAA 2D3AA 4RF0A 3N1ZC 1E8XA 3L08A 4GN1A 5E6JA 2W82A 2KVRA 2R2OA 3VR8B 3V62A 1ZDVA 2JWUA 1MHHE 1C4AA 1WRDB 4WWOA 1UF0A 1V80A 2G4SA 4DHZB 1E10A 2MW5A 2GRIA 2FBWB 1UGMA 1UD7A 4MM3A 4RM9A 3O65B 3ZTDA 1XLPA 4IW0A 1UGJA 4GIVA 2ZPYA 2KKCA 5L83A 3ZIMA 4E71A 2K1FA 1FFUA 1V5OA 1XO3A 4OZBA 2LUMA 2M1MA 2AQ2B 3JVZX 1FMAD 1TGZB 2KMMA 1FEHA 2IO2B 2W54A 2Z59B 3DDCB 3CMMB 3N1YC 3H7SA 4BFRA 4C56C 2IGHA 4JWUC 3E56A 4HJKA 5IKCM 3WAMA 3Q3OC 4NAMA 2LRWA 2N7DA 4K1RB 1TJEA 2ZW0A 4KDLB 2L0TA 1XXGA 1WIAA 2KWDA 3HRDD 2AX5A 2ZCBA 4KX6B 2L83A 3HHMA 4P7IA 1L0YB 2N9PC 1ENFA 3R66C 4RMAA 2DZJA 2KACA 2FE8A 1EU4A 2WDVB 2LI5A 3PT2B 1SE2A 4IUMB 4KZ0A 1FXTB 1F77A 1C76A 2B76B 2R2QA 2G9HD 1UNSA 3PSEB 2MBBB 3OAWA 1VDVA 3NS8A 4II2B 4EUTA 2LGDA 2E3TA 1C4CA 2Y5CA 4LJPB 4KZCA 4P16A 5TR5A 2KX3A 3TMPB 1C3TA 2C9WB 1J7AA 1BXTA 4AP4C 1ZUD2 3QA8A 4NY0A 2MBEA 4NQLB 1C1YB 1WXQA 3RZWC 4MACA 4CO7A 4HROA 1E8YA 4J6IA 1YN4A 1ZP0B 2PJHA 3VUWA 1HXYD 1VCBA 2HJ8A 3AV8A 4AUQC 2EMTA 1QILA 1IPGA 3NVVA 4W9DA 4MGZE 2RDBC 1TKGA 1B1ZA 3IT4B 3NZSA 4D2KA 5HHDG 3MP9A 3VTWA 4MDKE 1I42A 2MEKA 1FM0D 1QKZA 2KFKA 2O6VB 1T0QC 1XD3B 2KO3A 1WY8A 2IGGA 2D3GA 4USAA 4HDQA 1TTNA 1E0ZA 5FKAC 3Q8AA 4WAFA 2M0XA 3OJ3A 1QZEA 4NNJB 4IKGA 2C5LC 2MLBA 2QILA 2A5UA 3RULA 4PS3A 2WDTB 3AEBB 3EHVA 2I38A 1V2YA 1WM3A 3DBRB 2WXGA 4FHJA 1N62A 3RUIB 4R3DA 5JXVA 4UDUC 2FIFA 2DNFA 2FCNA 1TKYA 4JLCA 1IBXB 3PGEA 1RYJA 4HRSA 2BBCA 1GAQB 5AZHA 1WYWB 3KUZA 4B0EA 2DWQA 4G3XB 1SIJA 1PGAA 2RDHA 1YQ4B 2KN4A 2RSUA 3BINA 2MA9B 1V49A 2V4IB 3GZNB 1LGRA 3A9KB 4E74A 1LQBA 1C78A 2WXJA 5D2MB 2BYVE 2M19A 3V6EB 2H89B 1BUIC 5L95C 4RCOA 3QARA 1D6EC 1V97A 4P1CC 4FJVB 1GB1A 5D7GA 4DDGD 4OZCA 1GB4A 3CWIA 3T8MA 3W9CB 3RNCC 2V0GA 2ZZPB 2JPHA 4L1BA 1A70A 2FAZA 3VUXA 1GJZA 1ZKHA 2AL3A 2J4XA 3A4SC 4BBNC 2XNAC 2DX5B 4ICUA 3R2TA 2MP2A 1HQRD 4IG7B 2J42A 1EM7A 4HKZE 1KM7A 3WALA 1KJTA 2GBJA 2JRHA 3JYUA 2L52A 2ZVOA 1NVID 2B3AA 1STEA 4W9EA 3DOWA 4LTUA 4JPSA 1OQYA 2PE9A 3P1MA 2YLMA 1UH6A 2EELA 2K22A 3EFUA 1ZXIA 4NAWB 1JWBD 2WXKA 1FD6A 3TSSA 1C4PA 4KIKB 3FILB 3RN9C 3AEEB 3SHQA 4TKNA 2N4FA 1SE3A 1J8CA 1CZPA 3LDZE 3AE3B 2JXTA 2N9KA 2NTTA 3AE4B 3I3TB 4XGAB 1IGCA 1H4RA 2J0KA 3NOBA 4XDDA 2DHZA 4GB9A 4WIPA 4RFBA 2FUHB 2LHDA 4BOSC 2QHOA 2GMIC 1M94A 2VH2A 2DBYA 5GXGB 1MPEA 1XLNA 2RPQA 1EF1A 4TUUA 4GLSC 4LCDE 4IC7B 1WSPA 4PS7A 2SEBD 4A8XC 2WGSA 4HPMB 2C7HA 3UIOB 1YN3A 2LD9A 3NRZA 4ARCA 3Q2AC 3Q3JA 2CJNA 3ZVVA 1HE8A 2IO1B 1R4NI 2BQQA 4C4VB 1YD8U 3Q14C 4IDIA 3WA0A 1QOFA 1YMHE 3VUYA 1AWDA 4PT5A 3RI7C 1ROEA 1WE6A 1XF5L 3DHHC 3U30A 2WP9B 1SEBD 4ZHOA 5FR3A 4WJOA 3ENEA 4MGIE 2PE6B 3LJ3A 2JYTA 1TY0A 2M4NA 1MG4A 1WR6E 3AE7B 1IP9A 2KK8A 2X8XX 2K0PA 2NTSA 5HI1A 3NHEB 3N9YC 4LLGM 4BOZB 3MC9A 1Q5WB 4GU2A 5I4DA 4NJCA 2D11A 2INCC 2N9LA 4FADA 3BYTB 1WJUA 2L8JA 4ZRIA 5EE3A 4HCPB 2WXPA 3I63C 2JQRB 1YQBA 3ZNGC 1C79A 2KDFB 3P4RB 4DWFA 2AQ1B 4ZRKA 1KLUD 2K6QA 4FJYA 4HWIB 4JIOU 3KW5B 4YTMB 3NZ3A 2EMSA 3PZDA 4LNNA 1V5TA 4IWQA 1LO5D 2BB6A 3DBHI 2MBHA 1CMXB 1RM6C 3KH0A 4P1BC 1JMLA 4AS1A 2PVGC 2FNJB 3MHSD 5DPTA 2OOBB 1WGHA 1ZW7A 4WJQA 1MJDA 4FULA 4RGMA 4BVUC 2ZVNA 4B9KA 1T0SC 3MJWA 4LNKA 2O6VA 2KLGA 2Y5PA 4W9CA 2BS2B 2JXXA 3K9OB 1A5RA 4ZYSA 1HEZE 1F1HA 4K7SA 1D5XC 3URYA 1DGJA 1WGGA 4PK1A 3AN1A 3ZJUA 3VH3B 2V3NA 4GSWA 3W1YA 5CTRC 3QJZA 4XC2A 3ZO5B 4BKGA 3PS6A 3U8ZA 4W9FA 3UQBA 1RFAA 3RZFA 1IBXA 3TL5A 2Z0EB 3UI3A 3RNFC 4YWGG 1SJHD 2C7NB 3PV1A 2K8HA 1VZ8A 2XK5B 1PGXA 3AE2B 2K6DB 4BKSD 2QC8A 2KX0A 3A9KA 2N0SB 2L1AA 3HUIA 4AOFA 3TBLD 1Z2MA 2UYZB 2L00B 1ZXHA 3DQVA 1FXIA 1N5WA 5IN7A 1E9MA 2WQYB 4HKQA 2LVPA 2J0JA 1FRDA 1EO6A 3H8HA 1L6VA 1UWMA 2MBQA 3AH7A 3P4SB 3PZ7A 2CHZA 3HVDA 3UIPB 3NS1A 2BWES 2QEJC 4WQOB 2KTRB 2QJLA 3IAM1 5HKHA 1P7FA 2JF5A 3R2IA 4NJ6A 2JVCA 3BIID 1I4GA 4I6NB 3EUB2 1E7PB 4II3B 1WRIA 2HTHA 3VQIA 2D07B 5JHAA 1CJEA 3DVNU 4XDCA 4EEWA 1V1OA 1FIQA 3GOEA 4NAWA 3T3NA 2JU6X 3FILA 4KGSA 2MQJA 1TZOA 1RLFA 5TSSA 5J18A 1TS5A 4K3BA 3M95A 4KKIA 2R61A 1UWXA 2CU3A 4K7WA 4W9GA 4AWJA 3IG3A 3AEDB 3U2SC 3OLMD 2LGYA 1CK1A 3UF8A 1UUPA 2VZKD 2IY0B 4DBGA 3PO0A 2HDEA 4BBNF 1QOBA 4AQ7A 3AU4A 1WWTA 2QDFA 5HG2A 3DVGY 1N63A 2AYOB 2KLCA 2WXMA 3SDLC 3TEWA 1ESFA 3NJTA 2DZIA 4QAYA 3VRBB 3ABVB 1ZE3D 1LFDA 4RM8A 4JWSC 2FCMA 3DBRI 3BY4B 1WH3A 3AB5A 3K9PB 1NYRA 3VXWA 5IAAC 1P3QU 1GC7A 3BZDB 1ET9A 4HLEA 1L6UA 1WJ4A 3TCAA 2Y5BB 3V61A 5CHVC 1I4QA 4C4VA 2CHWA 4EZJA 1GOZA 1AARA 2K25A 2TSSA 1VR9A 4LK0M 4OHJA 3IXSA 1J7CA 4BKSA 5H8YE 3NY5A 1L7YA 5BYQA 5MPOA 3SU8X 4M02A 1JWAD 4MGYE 4MJSB 4K7UA 2KN5A 2MCNB 2RGFA 5LLIA 3GZNI 3KWLA 2UWQA 4B6WA 1YNTE 3AE5B 5EE9A 3RD2A 4W9IA 1L2NA 5E6OA 3RNBC 2NCNA 3M3JA 2KDBA 3VRAB 3EGRA 2ACZB 3ZLZA 2WXIA 4REZA 2J0MA 3OJ4B 4K3CA 4WJPA 1QF6A 3M63B 2NBWB 3AEGB 3C0RB 1DYQA 5KHOA 2WX0A 3PRPB 4KSLC 3DVNV 2WYQA 3ETRA 4A6QA 3BVGA 4IWOA 3AEFB 2KZRA 4WQMA 3MC0B 3DVGX 4DDID 3RYTA 4PYUA 2L3ZA 2HTME 3H6NA 2DZKA 3E9SA 2NVUI 2WNMA 1T5XD 3AE1B 4KV2A 3ZXRA 3V05A 3TUOA 2KDEB 1E90A 1N61A 4Q2JA 2SAKA 1EF5A 1YX5B 3DBLB 1Y56A 1RAXA 2D3BA 4ZHPA 4ZYNA 4EKUA 1P1AA 2HJ1A 3JSVB 1ZGUB 4RNAA 4MH0E 1EWCA 4TSSA 2L32A 2JY6A 1JALA 4WURA 4HEA1 4GMVA 3N30A 3X23A 3P2BA 1DOXA 2M17A 2BGFA 3KYDD 4MSQB 3R7QA 1L0VB 1WX8A 4HVBA 1K52A 4TMAB 4LDTB 2INNE 2OJWA 3I5JC 2INDC 1PYWD 2K8BA 1WYGA 3GB1A 2ZJDA 3C8YA 5IO9A 1FCCC 1JWSD 2KNBA 4DHJD 4BZAA 4EE2A 1PFDA 3TEXA 2PMVA 1S1QB
chains in the Genus database with same CATH topology
2AWTA 1WXAA 5LXIB 2LUEA 2KC2A 1SIFA 2D10A 1TZ1A 2HD5B 1WE6A 2KMAA 2NPTB 1WGDA 4G0NB 3MTNB 1P9DU 3VHTC 3ML8A 2RD0A 3U30A 4EZKA 3PLVA 5JZEB 2G45B 4WJOA 2GBMA 2N9EB 2BWFA 3ENEA 4MGIE 2XK5A 2PE6B 3LJ3A 1WXVA 1YX6B 2M4NA 3PREA 2ASQA 4ICVA 4CYEA 2KDIA 4ANUA 1WR6E 3QK0A 4LJOB 2OJRA 1WFYA 3QX1A 1WX7A 3R3MA 4HK2A 2KK8A 2PPHA 5EDSA 1IP9A 4KSKC 4JL9A 4ASWC 1EUVB 2WWZA 4WJNA 3NHEB 1V81A 3ZTCA 3ZRFA 3QQ8B 5BO4B 5G2NA 4FHKA 5C1ZA 2IO0B 4E3CA 1IYFA 4M0WB 4BOZB 1S3SG 2V4LA 1Q5WB 4GU2A 4AJWA 2XBBC 2MP2B 2FIDA 2D11A 1OTRB 2LGXA 1WI0A 4FADA 4FJZA 1WXMA 1WJUA 2L8JA 4ZRIA 4HCPB 3KVFB 5CHWA 3VTVA 4GDLB 1WJNA 1U4AA 1YQBA 3ZNGC 2NS5A 2L05A 1XT9B 4WWPA 4F1SA 2O2VB 4W9JA 1KLVA 2KDFB 4DWFA 4B95A 4ZRKA 2NBVB 2K6QA 4DK5A 4I6LB 1I35A 4FJYA 1LXDA 1WF9A 4HWIB 4ANWA 3EECA 4JIOU 3KW5B 3S2AA 3CSTA 2I1KA 1Y8RC 2KTRA 5GMVA 4EOYA 2N7EA 2EMSA 2LXCA 3PZDA 5JHBA 4OVVA 1ISNA 4OVUA 3PVLA 2KWCA 1V5TA 4IWQA 4M8MA 3DBHI 3QAQA 2MBHA 1CMXB 2L76A 1E8XA 3KH0A 3W1SA 3L08A 4GN1A 4A3OA 3WIMA 3DBSA 3QIJA 2KVRA 2R2OA 5DPRA 2FNJB 3V62A 3MHSD 5DPTA 4I6PA 2KANA 1E8ZA 2OOBB 1WGHA 2KQ7A 2ZCCA 1WRDB 1ZW7A 4WJQA 1G6JA 4WWOA 4HPLB 2DAFA 3HIZA 4FULA 1WJ6A 1V80A 5E6NA 2G4SA 3QC8B 4DHZB 3ZUNA 4BVUC 2ZVNA 2MW5A 5CHFA 4B9KA 1UGMA 1UD7A 3A1QB 4MM3A 3O65B 4RM9A 2AEHA 3MJWA 3ZTDA 4IW0A 2O6VA 4GIVA 2KLGA 3L10B 3M62B 2LRUA 2ZPYA 4W9CA 2KKCA 2KHWB 2JXXA 4FA6A 3KUDB 4JGHB 3U7DA 3K9OB 2JZZA 3PTFC 1A5RA 5L83A 3ZIMA 2FCQA 4E71A 2K1FA 1YJ1A 4K7SA 2LWPA 1WGGA 1P0RA 1V5OA 1V6EA 4IWPA 4NQKE 3TJPA 3N32A 2M1MA 3JVZX 3QHTA 3VH3B 1TGZB 5D6JB 4GSWA 3IBEA 3L54A 1MG8A 4IM3A 2JUOA 1K8RB 2IO2B 3A9JB 2ZNVB 3W1YA 5CTRC 4FBJB 3QJZA 4W9LA 3UINB 2JT4B 4XX5A 2Z59B 3DDCB 3CMMB 2C7MB 1WMHB 4XC2A 3ZO5B 2M8SA 4BKGA 3PS6A 3H7SA 3U8ZA 4BFRA 1WZ0A 4W9FA 1WE7A 2IY1B 4LDTD 2RR9A 3A4RA 4HJKA 3V60A 4GDKB 3UQBA 3WAMA 1RFAA 4TQ1A 1F9JA 3RZFA 3TL5A 2Z0EB 4M8NA 2LRWA 2N7DA 3HK0A 2ZNVC 4K1RB 4KDLB 2L0TA 1TBEA 4IM0A 1WIAA 2CKHB 2LZ6A 2ZCBA 3HHMA 2C7NB 2KQSA 3JW0X 3AI5A 4P7IA 4GOCA 2NBUA 2N9PC 3PV1A 5E6PA 3VVWB 2K8HA 3R66C 4TQ0A 4RMAA 1UZXB 2DZJA 2XK5B 2YVCA 3PRZA 2K6DB 3V6CB 4K81A 4BKSD 2KX0A 3A9KA 2LASA 5AEKB 2LI5A 3PT2B 4AOFA 4IUMB 3PLUA 1Q0WB 4PS8A 3TBLD 4KZ0A 2K8CA 1PQSA 1Z2MA 1FXTB 4WAAA 2UYZB 2L00B 3ZRCA 3DQVA 2Z0DB 4NPNA 2R2QA 3PSEB 2MBBB 2MBOA 3AULA 3NS8A 3OAWA 4II2B 4F8CB 4CHKA 5AZFA 4EUTA 2LGDA 2KJHB 2LVPA 1KOTA 1OGWA 2J0JA 4NJ7A 3ZDMC 4LJPB 4DHZE 3B0AA 4KZCA 1EO6A 1V9JA 1Z5SB 4MJSA 2BYEA 5TR5A 2KX3A 3TMPB 2IBIB 1C3TA 2MBQA 1SGHA 2C9WB 3Q3FA 4AP4C 3QA8A 2KJ6A 4NY0A 4URKA 2CHZA 3UIPB 2MBEA 3L17A 5JH5C 2BWES 4NQLB 1C1YB 1SE9A 3RZWC 4G11A 3ALBA 4WQOB 5DPSA 3VFKA 4CO7A 2DAJA 2KTRB 1E8YA 4GXBA 1WZ3A 2KMCA 4J6IA 2JF5A 5HKHA 2PJHA 3N3KB 4NJ6A 2N1VA 3VAWA 3VUWA 2JVCA 2IYDB 1VCBA 2HJ8A 4I6NB 2GOWA 3H1UA 4AUQC 2GBNA 2EMTA 1IPGA 4W9DA 4II3B 4MGZE 4FLHA 3VDZA 3ZW3A 2HTHA 3ZKJC 3VQIA 2D07B 2K39A 5JHAA 3DVNU 2LVOA 4ZRJA 3ZNZB 3NZSA 4AJYB 4EEWA 3R7RA 2REXA 4GGQA 4EFOA 1J0GA 1T0YA 3GOEA 1WGYA 4NAWA 4MDKE 3VTWA 3W1SC 1I42A 1P98A 3VTUA 3IFWB 2KFKA 2MRPA 2O6VB 1XD3B 2KO3A 5KHQA 1WY8A 2D3GA 4HDQA 1TTNA 2MQJA 2KFJA 1RLFA 2C60A 5J18A 2LXAA 2M0XA 1XQQA 3OJ3A 5D94A 3M95A 1NDDA 3HM6X 1QZEA 4NNJB 4DXAB 4K7WA 4W9GA 2BKRB 2C5LC 2CU1A 2O6VD 4WWNA 3IG3A 2MLBA 4AWJA 2A5UA 2KOXA 3RULA 3OLMD 4PS3A 2LGYA 3ZNHB 2WDTB 3EHVA 3UF8A 1E8WA 1YIWA 4YL8A 1V2YA 1WM3A 2IY0B 4DBGA 5DPWA 3JSVA 2JZ3B 3RT3B 5C23A 4W9KA 1UBIA 2BYFA 4FHJA 3ML9A 2AL6A 4BBNF 4FN2A 2DYMA 1GG3A 3RUIB 5J2RA 3AU4A 3DVGY 3IHPC 2AYOB 2FIFA 2KLCA 3SDLC 3D32A 2FCNA 4F7ZA 4JLCA 2DZIA 1R4MI 2G4DB 4HCNB 3KYCD 3DCGA 1LFDA 3RCZA 3PGEA 3TIXA 4KDIC 2N1WA 4RM8A 4ZDVA 3PPAA 2HE7A 5AZHA 2FCMA 4TV3A 1WYWB 3DBRI 1V86A 3CF6E 3KUZA 3BY4B 3H7PA 1WH3A 5G55A 4G3XB 2GBRA 3K9PB 3VXWA 5IAAC 1P3QU 3ZDTA 2XEWA 1GC7A 1OEYA 1NBFC 2DZMA 4HLEA 2DENB 3L0WB 3PHWB 2RSUA 1WJ4A 1WM2A 3BINA 2MA9B 2CHXA 1V49A 2KWVB 3TCAA 2Y5BB 3V61A 4E74A 3A9KB 5CHVC 2MWSB 2CHWA 4EZJA 3VH4B 3UGBB 2FCSA 1LQBA 4N9F4 1AARA 1GNUA 2MSED 1UBQA 2K25A 2KC1A 2A4ZA 5D2MB 2BYVE 3DPDA 4BKSA 2VRRB 3V6EB 2NPTA 5L95C 4HXDA 3WANA 4MEMA 3NY5A 4A20A 1L7YA 4HDOA 3QARA 1E5WA 3UQAA 2PEAA 3SU8X 4FJVB 5D7GA 4MGYE 4DDGD 2KWUB 1WGRA 1GC6A 2KN5A 1WR1A 4K7UA 2RGFA 4MJSB 3GZNI 1BT0A 5LLIA 2MCNB 3T8MA 3QWZB 1JRUA 1E7UA 2UWQA 4B6WA 2ZZPB 1GUAB 2DYBA 2JPHA 2FAZA 3VUXA 1GJZA 1ZKHA 3RD2A 4W9IA 2AL3A 1L2NA 2V3SA 4A3PA 3ECIA 3AU5A 5E6OA 5FR6A 3L16A 3A4SC 4BBNC 2NCNA 3M3JA 4MGKE 2KDBA 3SD5A 2DX5B 4ICUA 2MP2A 3ZLZA 4X57B 2BPSA 2D2QA 2J0MA 3OJ4B 2JWZA 2ZEQA 4WJPA 4IG7B 5CX3A 3M63B 2NBWB 4GDLA 3C0RB 2LJ5A 4ANVA 1WXSA 3KUCB 4JQWC 2BF8B 3WAPA 2O2VA 2GBKA 5KHOA 1KM7A 3WALA 2KJRA 2WX0A 1KJTA 3PRPB 4ANXA 2GBJA 4KSLC 2IZVB 2L0FA 3DVNV 2JRHA 3JYUA 2WYQA 3X0WA 4IWOA 1WX9A 2IO3B 2ZVOA 2KZRA 1UELA 3ZNID 2J7QB 2NR2A 2B3AA 3DVGX 4W9EA 3DOWA 1X1MA 3RYTA 4DDID 4PYUA 2L3ZA 1NI2A 1OQYA 2PE9A 3B1LX 5DCNA 2YLMA 1H8CA 5J17A 1J19A 3CSFA 1RRBA 1UH6A 3H6NA 3EFUA 4NAWB 2DZKA 4W9HA 2W9NA 5AZGA 4BKTA 2NVUI 1LM8B 3B08A 4KIKB 2KFKB 2WX1A 2CR5A 4KIKA 3QCAA 1S1QB 4KV2A 2KDEB 3HM3A 1E90A 2N9XA 1Q1OA 3A33B 4PYZA 1EF5A 3SHQA 4MELA 1YX5B 4TKNA 2ZPNA 1RAXA 2N4FA 3L13A 4MSMB 4ZYNA 1J8CA 3WAOA 3APCA 3LDZE 3AXCA 4IM2A 2DYOA 3PRMB 3I3TB 1H4RA 2J0KA 2KTFA 4EKUA 1P1AA 3NOBA 3A1QA 2KD0A 1VD2A 2EKEC 3EC8A 3H9DA 3JSVB 4KVGB 1OEYJ 3APDA 2DHZA 4GB9A 1ZGUB 4G50A 3NZUA 4MH0E 2FUHB 2JY6A 4XZ4A 4BOSC 3APFA 2QHOA 4GMVA 3PHXB 3N30A 5IA7A 2MX2A 2GMIC 4EZLA 1M94A 3DBLI 3X23A 3P2BA 2M17A 2BGFA 3KYDD 4MSQB 3R7QA 2I1JA 2RPQA 3T9LA 1EF1A 4TUUA 1WX8A 4HVBA 2G3QB 4LCDE 4IC7B 4LDTB 4PS7A 4DHJB 3A9JA 2LVQA 2C7HA 4HPMB 2K8BA 3UIOB 3H7PB 3ONSA 2L7RA 2LD9A 2ZJDA 5LXHA 2JRIB 1WMHA 2V1YA 2KXJA 3Q3JA 3IVFA 2CS4A 2KNBA 3ZVVA 4DHJD 1HE8A 4GDKA 2IO1B 1R4NI 1YD8U 1E7VA 3WA0A 1D3ZA 2BKFA 3VUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWT A;  1WXA A;  5LXI B;  2LUE A;  2KC2 A;  1SIF A;  2D10 A;  1TZ1 A;  2HD5 B;  1WE6 A;  2KMA A;  2NPT B;  1WGD A;  4G0N B;  3MTN B;  1P9D U;  3VHT C;  3ML8 A;  2RD0 A;  3U30 A;  4EZK A;  3PLV A;  5JZE B;  2G45 B;  4WJO A;  2GBM A;  2N9E B;  2BWF A;  3ENE A;  4MGI E;  2XK5 A;  2PE6 B;  3LJ3 A;  1WXV A;  1YX6 B;  2M4N A;  3PRE A;  2ASQ A;  4ICV A;  4CYE A;  2KDI A;  4ANU A;  1WR6 E;  3QK0 A;  4LJO B;  2OJR A;  1WFY A;  3QX1 A;  1WX7 A;  3R3M A;  4HK2 A;  2KK8 A;  2PPH A;  5EDS A;  1IP9 A;  4KSK C;  4JL9 A;  4ASW C;  1EUV B;  2WWZ A;  4WJN A;  3NHE B;  1V81 A;  3ZTC A;  3ZRF A;  3QQ8 B;  5BO4 B;  5G2N A;  4FHK A;  5C1Z A;  2IO0 B;  4E3C A;  1IYF A;  4M0W B;  4BOZ B;  1S3S G;  2V4L A;  1Q5W B;  4GU2 A;  4AJW A;  2XBB C;  2MP2 B;  2FID A;  2D11 A;  1OTR B;  2LGX A;  1WI0 A;  4FAD A;  4FJZ A;  1WXM A;  1WJU A;  2L8J A;  4ZRI A;  4HCP B;  3KVF B;  5CHW A;  3VTV A;  4GDL B;  1WJN A;  1U4A A;  1YQB A;  3ZNG C;  2NS5 A;  2L05 A;  1XT9 B;  4WWP A;  4F1S A;  2O2V B;  4W9J A;  1KLV A;  2KDF B;  4DWF A;  4B95 A;  4ZRK A;  2NBV B;  2K6Q A;  4DK5 A;  4I6L B;  1I35 A;  4FJY A;  1LXD A;  1WF9 A;  4HWI B;  4ANW A;  3EEC A;  4JIO U;  3KW5 B;  3S2A A;  3CST A;  2I1K A;  1Y8R C;  2KTR A;  5GMV A;  4EOY A;  2N7E A;  2EMS A;  2LXC A;  3PZD A;  5JHB A;  4OVV A;  1ISN A;  4OVU A;  3PVL A;  2KWC A;  1V5T A;  4IWQ A;  4M8M A;  3DBH I;  3QAQ A;  2MBH A;  1CMX B;  2L76 A;  1E8X A;  3KH0 A;  3W1S A;  3L08 A;  4GN1 A;  4A3O A;  3WIM A;  3DBS A;  3QIJ A;  2KVR A;  2R2O A;  5DPR A;  2FNJ B;  3V62 A;  3MHS D;  5DPT A;  4I6P A;  2KAN A;  1E8Z A;  2OOB B;  1WGH A;  2KQ7 A;  2ZCC A;  1WRD B;  1ZW7 A;  4WJQ A;  1G6J A;  4WWO A;  4HPL B;  2DAF A;  3HIZ A;  4FUL A;  1WJ6 A;  1V80 A;  5E6N A;  2G4S A;  3QC8 B;  4DHZ B;  3ZUN A;  4BVU C;  2ZVN A;  2MW5 A;  5CHF A;  4B9K A;  1UGM A;  1UD7 A;  3A1Q B;  4MM3 A;  3O65 B;  4RM9 A;  2AEH A;  3MJW A;  3ZTD A;  4IW0 A;  2O6V A;  4GIV A;  2KLG A;  3L10 B;  3M62 B;  2LRU A;  2ZPY A;  4W9C A;  2KKC A;  2KHW B;  2JXX A;  4FA6 A;  3KUD B;  4JGH B;  3U7D A;  3K9O B;  2JZZ A;  3PTF C;  1A5R A;  5L83 A;  3ZIM A;  2FCQ A;  4E71 A;  2K1F A;  1YJ1 A;  4K7S A;  2LWP A;  1WGG A;  1P0R A;  1V5O A;  1V6E A;  4IWP A;  4NQK E;  3TJP A;  3N32 A;  2M1M A;  3JVZ X;  3QHT A;  3VH3 B;  1TGZ B;  5D6J B;  4GSW A;  3IBE A;  3L54 A;  1MG8 A;  4IM3 A;  2JUO A;  1K8R B;  2IO2 B;  3A9J B;  2ZNV B;  3W1Y A;  5CTR C;  4FBJ B;  3QJZ A;  4W9L A;  3UIN B;  2JT4 B;  4XX5 A;  2Z59 B;  3DDC B;  3CMM B;  2C7M B;  1WMH B;  4XC2 A;  3ZO5 B;  2M8S A;  4BKG A;  3PS6 A;  3H7S A;  3U8Z A;  4BFR A;  1WZ0 A;  4W9F A;  1WE7 A;  2IY1 B;  4LDT D;  2RR9 A;  3A4R A;  4HJK A;  3V60 A;  4GDK B;  3UQB A;  3WAM A;  1RFA A;  4TQ1 A;  1F9J A;  3RZF A;  3TL5 A;  2Z0E B;  4M8N A;  2LRW A;  2N7D A;  3HK0 A;  2ZNV C;  4K1R B;  4KDL B;  2L0T A;  1TBE A;  4IM0 A;  1WIA A;  2CKH B;  2LZ6 A;  2ZCB A;  3HHM A;  2C7N B;  2KQS A;  3JW0 X;  3AI5 A;  4P7I A;  4GOC A;  2NBU A;  2N9P C;  3PV1 A;  5E6P A;  3VVW B;  2K8H A;  3R66 C;  4TQ0 A;  4RMA A;  1UZX B;  2DZJ A;  2XK5 B;  2YVC A;  3PRZ A;  2K6D B;  3V6C B;  4K81 A;  4BKS D;  2KX0 A;  3A9K A;  2LAS A;  5AEK B;  2LI5 A;  3PT2 B;  4AOF A;  4IUM B;  3PLU A;  1Q0W B;  4PS8 A;  3TBL D;  4KZ0 A;  2K8C A;  1PQS A;  1Z2M A;  1FXT B;  4WAA A;  2UYZ B;  2L00 B;  3ZRC A;  3DQV A;  2Z0D B;  4NPN A;  2R2Q A;  3PSE B;  2MBB B;  2MBO A;  3AUL A;  3NS8 A;  3OAW A;  4II2 B;  4F8C B;  4CHK A;  5AZF A;  4EUT A;  2LGD A;  2KJH B;  2LVP A;  1KOT A;  1OGW A;  2J0J A;  4NJ7 A;  3ZDM C;  4LJP B;  4DHZ E;  3B0A A;  4KZC A;  1EO6 A;  1V9J A;  1Z5S B;  4MJS A;  2BYE A;  5TR5 A;  2KX3 A;  3TMP B;  2IBI B;  1C3T A;  2MBQ A;  1SGH A;  2C9W B;  3Q3F A;  4AP4 C;  3QA8 A;  2KJ6 A;  4NY0 A;  4URK A;  2CHZ A;  3UIP B;  2MBE A;  3L17 A;  5JH5 C;  2BWE S;  4NQL B;  1C1Y B;  1SE9 A;  3RZW C;  4G11 A;  3ALB A;  4WQO B;  5DPS A;  3VFK A;  4CO7 A;  2DAJ A;  2KTR B;  1E8Y A;  4GXB A;  1WZ3 A;  2KMC A;  4J6I A;  2JF5 A;  5HKH A;  2PJH A;  3N3K B;  4NJ6 A;  2N1V A;  3VAW A;  3VUW A;  2JVC A;  2IYD B;  1VCB A;  2HJ8 A;  4I6N B;  2GOW A;  3H1U A;  4AUQ C;  2GBN A;  2EMT A;  1IPG A;  4W9D A;  4II3 B;  4MGZ E;  4FLH A;  3VDZ A;  3ZW3 A;  2HTH A;  3ZKJ C;  3VQI A;  2D07 B;  2K39 A;  5JHA A;  3DVN U;  2LVO A;  4ZRJ A;  3ZNZ B;  3NZS A;  4AJY B;  4EEW A;  3R7R A;  2REX A;  4GGQ A;  4EFO A;  1J0G A;  1T0Y A;  3GOE A;  1WGY A;  4NAW A;  4MDK E;  3VTW A;  3W1S C;  1I42 A;  1P98 A;  3VTU A;  3IFW B;  2KFK A;  2MRP A;  2O6V B;  1XD3 B;  2KO3 A;  5KHQ A;  1WY8 A;  2D3G A;  4HDQ A;  1TTN A;  2MQJ A;  2KFJ A;  1RLF A;  2C60 A;  5J18 A;  2LXA A;  2M0X A;  1XQQ A;  3OJ3 A;  5D94 A;  3M95 A;  1NDD A;  3HM6 X;  1QZE A;  4NNJ B;  4DXA B;  4K7W A;  4W9G A;  2BKR B;  2C5L C;  2CU1 A;  2O6V D;  4WWN A;  3IG3 A;  2MLB A;  4AWJ A;  2A5U A;  2KOX A;  3RUL A;  3OLM D;  4PS3 A;  2LGY A;  3ZNH B;  2WDT B;  3EHV A;  3UF8 A;  1E8W A;  1YIW A;  4YL8 A;  1V2Y A;  1WM3 A;  2IY0 B;  4DBG A;  5DPW A;  3JSV A;  2JZ3 B;  3RT3 B;  5C23 A;  4W9K A;  1UBI A;  2BYF A;  4FHJ A;  3ML9 A;  2AL6 A;  4BBN F;  4FN2 A;  2DYM A;  1GG3 A;  3RUI B;  5J2R A;  3AU4 A;  3DVG Y;  3IHP C;  2AYO B;  2FIF A;  2KLC A;  3SDL C;  3D32 A;  2FCN A;  4F7Z A;  4JLC A;  2DZI A;  1R4M I;  2G4D B;  4HCN B;  3KYC D;  3DCG A;  1LFD A;  3RCZ A;  3PGE A;  3TIX A;  4KDI C;  2N1W A;  4RM8 A;  4ZDV A;  3PPA A;  2HE7 A;  5AZH A;  2FCM A;  4TV3 A;  1WYW B;  3DBR I;  1V86 A;  3CF6 E;  3KUZ A;  3BY4 B;  3H7P A;  1WH3 A;  5G55 A;  4G3X B;  2GBR A;  3K9P B;  3VXW A;  5IAA C;  1P3Q U;  3ZDT A;  2XEW A;  1GC7 A;  1OEY A;  1NBF C;  2DZM A;  4HLE A;  2DEN B;  3L0W B;  3PHW B;  2RSU A;  1WJ4 A;  1WM2 A;  3BIN A;  2MA9 B;  2CHX A;  1V49 A;  2KWV B;  3TCA A;  2Y5B B;  3V61 A;  4E74 A;  3A9K B;  5CHV C;  2MWS B;  2CHW A;  4EZJ A;  3VH4 B;  3UGB B;  2FCS A;  1LQB A;  4N9F 4;  1AAR A;  1GNU A;  2MSE D;  1UBQ A;  2K25 A;  2KC1 A;  2A4Z A;  5D2M B;  2BYV E;  3DPD A;  4BKS A;  2VRR B;  3V6E B;  2NPT A;  5L95 C;  4HXD A;  3WAN A;  4MEM A;  3NY5 A;  4A20 A;  1L7Y A;  4HDO A;  3QAR A;  1E5W A;  3UQA A;  2PEA A;  3SU8 X;  4FJV B;  5D7G A;  4MGY E;  4DDG D;  2KWU B;  1WGR A;  1GC6 A;  2KN5 A;  1WR1 A;  4K7U A;  2RGF A;  4MJS B;  3GZN I;  1BT0 A;  5LLI A;  2MCN B;  3T8M A;  3QWZ B;  1JRU A;  1E7U A;  2UWQ A;  4B6W A;  2ZZP B;  1GUA B;  2DYB A;  2JPH A;  2FAZ A;  3VUX A;  1GJZ A;  1ZKH A;  3RD2 A;  4W9I A;  2AL3 A;  1L2N A;  2V3S A;  4A3P A;  3ECI A;  3AU5 A;  5E6O A;  5FR6 A;  3L16 A;  3A4S C;  4BBN C;  2NCN A;  3M3J A;  4MGK E;  2KDB A;  3SD5 A;  2DX5 B;  4ICU A;  2MP2 A;  3ZLZ A;  4X57 B;  2BPS A;  2D2Q A;  2J0M A;  3OJ4 B;  2JWZ A;  2ZEQ A;  4WJP A;  4IG7 B;  5CX3 A;  3M63 B;  2NBW B;  4GDL A;  3C0R B;  2LJ5 A;  4ANV A;  1WXS A;  3KUC B;  4JQW C;  2BF8 B;  3WAP A;  2O2V A;  2GBK A;  5KHO A;  1KM7 A;  3WAL A;  2KJR A;  2WX0 A;  1KJT A;  3PRP B;  4ANX A;  2GBJ A;  4KSL C;  2IZV B;  2L0F A;  3DVN V;  2JRH A;  3JYU A;  2WYQ A;  3X0W A;  4IWO A;  1WX9 A;  2IO3 B;  2ZVO A;  2KZR A;  1UEL A;  3ZNI D;  2J7Q B;  2NR2 A;  2B3A A;  3DVG X;  4W9E A;  3DOW A;  1X1M A;  3RYT A;  4DDI D;  4PYU A;  2L3Z A;  1NI2 A;  1OQY A;  2PE9 A;  3B1L X;  5DCN A;  2YLM A;  1H8C A;  5J17 A;  1J19 A;  3CSF A;  1RRB A;  1UH6 A;  3H6N A;  3EFU A;  4NAW B;  2DZK A;  4W9H A;  2W9N A;  5AZG A;  4BKT A;  2NVU I;  1LM8 B;  3B08 A;  4KIK B;  2KFK B;  2WX1 A;  2CR5 A;  4KIK A;  3QCA A;  1S1Q B;  4KV2 A;  2KDE B;  3HM3 A;  1E90 A;  2N9X A;  1Q1O A;  3A33 B;  4PYZ A;  1EF5 A;  3SHQ A;  4MEL A;  1YX5 B;  4TKN A;  2ZPN A;  1RAX A;  2N4F A;  3L13 A;  4MSM B;  4ZYN A;  1J8C A;  3WAO A;  3APC A;  3LDZ E;  3AXC A;  4IM2 A;  2DYO A;  3PRM B;  3I3T B;  1H4R A;  2J0K A;  2KTF A;  4EKU A;  1P1A A;  3NOB A;  3A1Q A;  2KD0 A;  1VD2 A;  2EKE C;  3EC8 A;  3H9D A;  3JSV B;  4KVG B;  1OEY J;  3APD A;  2DHZ A;  4GB9 A;  1ZGU B;  4G50 A;  3NZU A;  4MH0 E;  2FUH B;  2JY6 A;  4XZ4 A;  4BOS C;  3APF A;  2QHO A;  4GMV A;  3PHX B;  3N30 A;  5IA7 A;  2MX2 A;  2GMI C;  4EZL A;  1M94 A;  3DBL I;  3X23 A;  3P2B A;  2M17 A;  2BGF A;  3KYD D;  4MSQ B;  3R7Q A;  2I1J A;  2RPQ A;  3T9L A;  1EF1 A;  4TUU A;  1WX8 A;  4HVB A;  2G3Q B;  4LCD E;  4IC7 B;  4LDT B;  4PS7 A;  4DHJ B;  3A9J A;  2LVQ A;  2C7H A;  4HPM B;  2K8B A;  3UIO B;  3H7P B;  3ONS A;  2L7R A;  2LD9 A;  2ZJD A;  5LXH A;  2JRI B;  1WMH A;  2V1Y A;  2KXJ A;  3Q3J A;  3IVF A;  2CS4 A;  2KNB A;  3ZVV A;  4DHJ D;  1HE8 A;  4GDK A;  2IO1 B;  1R4N I;  1YD8 U;  1E7V A;  3WA0 A;  1D3Z A;  2BKF A;  3VUY A; 
#chains in the Genus database with same CATH topology
 5LXI B;  3W5V B;  2PW9 A;  2FUG 1;  2KMA A;  3VHT C;  2NPT B;  1HZ5 A;  3RMK C;  1ZOY B;  2RD0 A;  1VJK A;  3OG5 A;  5JZE B;  2BT6 A;  2BWF A;  2XK5 A;  3PRE A;  2ASQ A;  2KDI A;  3QK0 A;  1FNU A;  5EDS A;  1WFY A;  2PPH A;  4KSK C;  4ASW C;  3R8B A;  2WWZ A;  3ZQ4 A;  3ZRF A;  5BO4 B;  5C1Z A;  1IYF A;  4B0M A;  4AJW A;  1WI0 A;  3LYY A;  2LGS A;  3KVF B;  3Q8F A;  5CHW A;  1WJN A;  1F0Z A;  2GI9 A;  1GPX A;  3TEZ A;  4W9J A;  4XYC A;  4B95 A;  2K5P A;  1YJJ A;  1D4B A;  1QQR A;  2WHI A;  3NG0 A;  3EEC A;  1Q10 A;  1RFK A;  3CST A;  2I1K A;  2KTR A;  5GMV A;  4EOY A;  1ISN A;  4ZOH C;  1FRR A;  1XCQ L;  2IPK D;  1JRO A;  4A3O A;  3DBS A;  2PKO A;  3Q3N C;  4I6P A;  2KAN A;  2KQ7 A;  3P4P B;  2M0A A;  3HIZ A;  5E6N A;  3QC8 B;  3ZUN A;  1JQ4 A;  3A1Q B;  5C2T B;  4NZL B;  3FAH A;  1V8C A;  1DOY A;  3BVZ A;  2PIA A;  3L10 B;  3M62 B;  3DWM A;  1N5X A;  3U7D A;  3ZYY X;  2FCQ A;  1YJ1 A;  2LWP A;  5T8I A;  1P0R A;  1V6E A;  4IWP A;  3N32 A;  2BVC A;  3L54 A;  1MG8 A;  4IM3 A;  2JUO A;  1BML C;  4YSZ B;  2ZNV B;  3FC4 A;  2YEP B;  4W9L A;  3UIN B;  2JT4 B;  5G5G A;  1WMH B;  2M8S A;  4XWT A;  1WE7 A;  2IY1 B;  4LDT D;  2RR9 A;  3A4R A;  3SFE B;  4GDK B;  4TQ1 A;  1F9J A;  3EA6 A;  2IGD A;  3HK0 A;  2ZNV C;  4IM0 A;  1XLQ A;  1KF6 B;  4RGN A;  5IOI A;  3ZJT A;  4GOC A;  1UZX B;  3PRZ A;  3V6C B;  4K81 A;  1EU3 A;  1QOG A;  3PLU A;  3B2F A;  2QSD A;  1OGW A;  4NJ7 A;  4DHZ E;  4MJS A;  1SJE D;  2WU2 B;  4URK A;  3NVW A;  3SR6 A;  3BK1 A;  3ALB A;  3VFK A;  5C3J B;  3B9J A;  1PUT A;  2CJO A;  4GXB A;  1WZ3 A;  4M00 A;  2N1V A;  2IYD B;  2GOW A;  2Y3A A;  3H1U A;  2GBN A;  4LNI A;  1T3Q A;  4FLH A;  3VDZ A;  3ZKJ C;  2WXH A;  1V1P B;  3I9V 1;  4YSX B;  4ARI A;  2LVO A;  4ZRJ A;  4AJY B;  5IP4 D;  2IJ0 A;  2REX A;  2J53 A;  4GGQ A;  4EFO A;  1J0G A;  4L23 A;  1T0Y A;  1N60 A;  3W1S C;  3GS2 A;  2MRP A;  4XE0 A;  1D5M C;  1I4R A;  2VZK B;  2C60 A;  2LXA A;  1XQQ A;  3VR9 B;  1NDD A;  1R4M B;  2N7J A;  2CU1 A;  4WWN A;  1NEK B;  3LXF A;  2KOX A;  1K53 A;  3ZNH B;  2WXF A;  1E8W A;  3NVZ A;  1YIW A;  2OED A;  3I57 A;  2ON8 A;  3JSV A;  3RNG C;  2JZ3 B;  3RT3 B;  2WS3 B;  1VZ7 A;  2QMT A;  2RPV A;  5C23 A;  1UBI A;  2IDY A;  1I4P A;  3ML9 A;  2AL6 A;  2DYM A;  2M56 B;  1YJI A;  4P6V F;  3N1X C;  2ONQ A;  3IHP C;  1WGK A;  2MHJ A;  4WWM A;  4HCN B;  3RCZ A;  3TIX A;  4RGT A;  2N1W A;  1F2R I;  3PPA A;  2OHF A;  4OW0 A;  1V86 A;  3CF6 E;  1N6Z A;  2W3S A;  2GBR A;  1VLB A;  1R7S A;  3ZDT A;  2XEW A;  4J3O D;  2DZM A;  2DEN B;  3L0W B;  3PHW B;  3RPF C;  1WM2 A;  2WXN A;  2CHX A;  2KWV B;  2MWS B;  2DLB A;  3UGB B;  4HPP A;  1GNU A;  2MSE D;  1UBQ A;  1SE4 A;  4YT0 B;  2INP E;  3PZ8 A;  2NPT A;  3MHZ A;  3WAN A;  4MEM A;  4YTN B;  4A20 A;  3UQA A;  2PEA A;  2KYW A;  1B9R A;  1ET6 A;  1GC6 A;  2V3P A;  1JRU A;  3ECI A;  3AU5 A;  5FR6 A;  3L16 A;  4YXD B;  4MGK E;  2ICI A;  4X57 B;  2BPS A;  2D2Q A;  5CX3 A;  1T6B X;  3C19 A;  3GE3 C;  2LJ5 A;  4ANV A;  1WXS A;  3KUC B;  4JQW C;  2BF8 B;  2KJR A;  4ANX A;  2L0F A;  2WLB A;  5HFY A;  1WX9 A;  2J7Q B;  2NR2 A;  1X1M A;  2G1E A;  1NI2 A;  5DCN A;  3B1L X;  5FK9 C;  5J17 A;  5AZG A;  2XN9 C;  2WX1 A;  3BWU D;  4KIK A;  4KGT A;  5D3D A;  3T3O A;  1YN5 A;  3U4E G;  1Q1O A;  3A33 B;  4MEL A;  1I4X A;  3L13 A;  1OQR A;  4MSM B;  3AXC A;  4US9 A;  4DXG A;  1MFW A;  3PRM B;  3A1Q A;  2KD0 A;  4KVG B;  1OEY J;  2WXR A;  3APD A;  3IT6 B;  4XZ4 A;  1SXT A;  5IA7 A;  2MX2 A;  3MJ5 A;  3DBL I;  2I2Y A;  3T9L A;  1F2R C;  2JYE A;  1P7E A;  4KKJ A;  4DHJ B;  3OWE B;  2KDM A;  2LVQ A;  2LGI A;  3H7P B;  3ONS A;  2D5G A;  2JRI B;  1WMH A;  2LFI A;  2WXQ A;  4GDK A;  1E7V A;  4NPN A;  2BKF A;  2AWT A;  4MT5 A;  2LUE A;  1PGB A;  2UU7 A;  2KC2 A;  3P42 A;  2D10 A;  4G0N B;  2HD5 B;  3MTN B;  1P9D U;  5G5H A;  4EZK A;  1QT9 A;  3PLV A;  4C00 A;  2GBM A;  2KT7 A;  3WCQ A;  4CQN A;  1WXV A;  4CYE A;  1D5Z C;  1L0X B;  4HK2 A;  1AN8 A;  5BMI A;  4JL9 A;  5BMG A;  1V81 A;  3ZTC A;  4FHK A;  4E3C A;  4M0W B;  1I4H A;  2VH1 A;  1JWU D;  1TS4 A;  2XBB C;  1EWY C;  4FJZ A;  4O1N A;  4GDL B;  2NS5 A;  4WWP A;  1XT9 B;  4F1S A;  3FKY A;  2O2V B;  1KLV A;  1NEN B;  2X38 A;  4JE3 B;  4DK5 A;  1T0R C;  3Q8C A;  1LXD A;  1WF9 A;  4ANW A;  3AEC B;  3V3X A;  1FPY A;  2N7E A;  5JHB A;  2Q5W D;  4OVU A;  1K51 A;  3PVL A;  2KWC A;  2PTL A;  4M8M A;  3QAQ A;  2L76 A;  3W1S A;  2YEP F;  3WIM A;  3QIJ A;  1V1P A;  5DPR A;  1E8Z A;  2ZCC A;  2LHE A;  1G6J A;  4HPL B;  2DAF A;  1WJ6 A;  5CHF A;  2K9X A;  2AEH A;  3N20 C;  2LRU A;  3Q8E A;  4FA6 A;  2KHW B;  1TIF A;  3KUD B;  4JGH B;  2JZZ A;  3PTF C;  2WU5 B;  4N58 A;  1JCK B;  4YSY B;  1YOV B;  4H2A A;  5AUK A;  4NQK E;  3TJP A;  1NI3 A;  1L4Z B;  2QCZ A;  3SFD B;  3QHT A;  5D6J B;  1ZPS A;  1TS2 A;  3IBE A;  1TYG B;  1K8R B;  3A9J B;  1NYQ A;  1OQQ A;  4FBJ B;  4XX5 A;  4S0R A;  2C7M B;  3SEB A;  3EFC A;  3ZXV A;  1HZ6 A;  3MC8 A;  3B2G A;  1WZ0 A;  4A55 A;  3V60 A;  3IAS 1;  1JW9 D;  4N59 A;  1TS3 A;  1XLO A;  3U7Z A;  1TY2 A;  4L2Y A;  4OZA A;  4M8N A;  1FCL A;  2E6X A;  1TBE A;  3ZJV A;  1PDX A;  2CKH B;  2LEK A;  5BYR A;  2LZ6 A;  2KQS A;  3JW0 X;  3AI5 A;  2NBU A;  3KWV A;  5E6P A;  3VVW B;  4DXF A;  4TQ0 A;  2YVC A;  2BS3 B;  1FNW A;  2LAS A;  5AEK B;  1M4V A;  1MHX A;  2V9H A;  1FO4 A;  1QLB B;  4LNF A;  1Q0W B;  4PS8 A;  2K8C A;  1PQS A;  4WAA A;  2Z8L A;  3ZRC A;  2Z0D B;  1SF0 A;  2MBO A;  3AUL A;  4F8C B;  3P63 A;  4CHK A;  5AZF A;  2KJH B;  1KOT A;  3HVZ A;  3Q3M C;  4FXC A;  2EKI A;  3ZDM C;  1XEE A;  3B0A A;  1V9J A;  1Z5S B;  1FNV A;  2BYE A;  4S17 A;  2IBI B;  1SGH A;  3TEY A;  3Q3F A;  4IOI E;  2BTE A;  2KJ6 A;  3L17 A;  5JH5 C;  1SE9 A;  4G11 A;  5DPS A;  2DAJ A;  3DWG C;  1VRA B;  2KMC A;  2RDG A;  3N3K B;  3VAW A;  1C77 A;  4ZRP A;  2WDQ B;  3LB8 C;  4ZRQ A;  4RGO S;  3ZW3 A;  1L5P A;  1I7H A;  2K39 A;  2D3C A;  3RNE C;  3ZNZ B;  3R7R A;  1YQ3 B;  4MH8 A;  1WGY A;  4MM3 B;  4WH4 A;  1P98 A;  2JSV X;  3VTU A;  3IFW B;  3W2D A;  5KHQ A;  2MJE A;  2JX5 A;  2KFJ A;  2RMM A;  3BVM A;  5D94 A;  2K3U A;  3HM6 X;  4DXA B;  1RWS A;  2BKR B;  2O6V D;  1SSN A;  4LNO A;  4YL8 A;  5DPW A;  5EE0 A;  1AW7 A;  4W9K A;  2BYF A;  1L4D B;  4FN2 A;  1GG3 A;  5J2R A;  2MJD A;  1MVK A;  1HTQ A;  5H92 C;  3D32 A;  4F7Z A;  3NVY A;  1R4M I;  2G4D B;  2ZW1 A;  3KYC D;  3DCG A;  4KDI C;  4ZDV A;  1JWM D;  2HE7 A;  4TV3 A;  3H7P A;  5D3I B;  5G55 A;  3Q8B A;  1OEY A;  1NBF C;  3GP7 A;  3VH4 B;  2FCS A;  4N9F 4;  2NMQ A;  2KC1 A;  2A4Z A;  3AE8 B;  1KH0 A;  3DPD A;  1KLG D;  2VRR B;  4HXD A;  4HDO A;  1E5W A;  5BMH A;  1KFY B;  2KWU B;  1WGR A;  2QIE B;  1WR1 A;  2MJ3 A;  1BT0 A;  3QWZ B;  1E7U A;  1GUA B;  2DYB A;  2GB1 A;  1C9F A;  1AYF A;  2MH7 A;  2V3S A;  3L4P A;  4A3P A;  2GLS A;  1XCT L;  3J9C A;  4M0W A;  3AEA B;  3DHG C;  3SD5 A;  2BB5 A;  4RF1 A;  2KVZ A;  5EE1 A;  4BAX A;  4M01 A;  2JWZ A;  2W3R A;  3NUH B;  2ZEQ A;  1QOA A;  2PVO D;  1IGD A;  3U52 E;  2KQ4 X;  4GDL A;  3WAP A;  2O2V A;  2GBK A;  2BYT A;  1ACC A;  4RH6 A;  2IZV B;  2LJI A;  3X0W A;  2IO3 B;  3AMZ A;  4JX1 C;  1UEL A;  3ZNI D;  1HTO A;  1J7B A;  1H8C A;  3RNA C;  1J19 A;  3CSF A;  1RRB A;  4W9H A;  2W9N A;  4BKT A;  1E6E B;  1LM8 B;  3B08 A;  2KFK B;  2CR5 A;  3QCA A;  3HM3 A;  2LMC A;  2N9X A;  4PYZ A;  3Q6B A;  2ZPN A;  3BYY B;  3WAO A;  3APC A;  3KQ4 A;  4IM2 A;  2DYO A;  3ZGZ A;  3W5U B;  4C7Z A;  2KTF A;  3GE8 C;  4HJG E;  5AUI A;  1VD2 A;  2W55 A;  2EKE C;  3EC8 A;  3H9D A;  2AQ3 B;  1VZ6 A;  1ZDX A;  4G50 A;  3NZU A;  3RFZ B;  3AE9 B;  1IUE A;  3APF A;  3PHX B;  4EZL A;  1R4N B;  4KGR A;  2PLP A;  4C7Y A;  1JRP A;  2I1J A;  2KAJ A;  2G3Q B;  4A90 A;  4US8 A;  3A9J A;  2J52 A;  2H88 B;  1SBB B;  2L7R A;  3KLS X;  4A9A A;  5LXH A;  2V1Y A;  2JZP A;  2KXJ A;  3IVF A;  2CS4 A;  4N6E B;  4ACF A;  1FFV A;  4XWW A;  1D3Z A;  1WXA A;  1SIF A;  1TZ1 A;  1WGD A;  3ML8 A;  3AM9 A;  2G45 B;  2N9E B;  3O13 A;  1OFF A;  1F52 A;  1YX6 B;  4ICV A;  4ANU A;  3MFG A;  4LJO B;  1TT5 B;  2OJR A;  3QX1 A;  1WX7 A;  3R3M A;  1EUV B;  3DHI C;  3P4Q B;  3AE6 B;  4WJN A;  3CIR B;  4DQO C;  1SB3 C;  1CQV A;  1HA5 A;  3QQ8 B;  1TKE A;  5G2N A;  5BYS A;  2IO0 B;  1KRH A;  2WXO A;  3BK2 A;  1MI0 A;  3Q69 A;  1S3S G;  1KTK A;  2V4L A;  5LNK 1;  2MP2 B;  2FID A;  2LGX A;  1OTR B;  4C80 A;  4YTP B;  1WXM A;  3DBH B;  3VTV A;  1U4A A;  2L05 A;  2WDR B;  2NBV B;  1K50 A;  4I6L B;  1I35 A;  4OVZ A;  1DOI A;  2BS4 B;  2WXL A;  3S2A A;  1Y8R C;  2BW2 A;  2LXC A;  4ITK A;  4OVV A;  1FXA A;  2D3A A;  4RF0 A;  3N1Z C;  1E8X A;  3L08 A;  4GN1 A;  5E6J A;  2W82 A;  2KVR A;  2R2O A;  3VR8 B;  3V62 A;  1ZDV A;  2JWU A;  1MHH E;  1C4A A;  1WRD B;  4WWO A;  1UF0 A;  1V80 A;  2G4S A;  4DHZ B;  1E10 A;  2MW5 A;  2GRI A;  2FBW B;  1UGM A;  1UD7 A;  4MM3 A;  4RM9 A;  3O65 B;  3ZTD A;  1XLP A;  4IW0 A;  1UGJ A;  4GIV A;  2ZPY A;  2KKC A;  5L83 A;  3ZIM A;  4E71 A;  2K1F A;  1FFU A;  1V5O A;  1XO3 A;  4OZB A;  2LUM A;  2M1M A;  2AQ2 B;  3JVZ X;  1FMA D;  1TGZ B;  2KMM A;  1FEH A;  2IO2 B;  2W54 A;  2Z59 B;  3DDC B;  3CMM B;  3N1Y C;  3H7S A;  4BFR A;  4C56 C;  2IGH A;  4JWU C;  3E56 A;  4HJK A;  5IKC M;  3WAM A;  3Q3O C;  4NAM A;  2LRW A;  2N7D A;  4K1R B;  1TJE A;  2ZW0 A;  4KDL B;  2L0T A;  1XXG A;  1WIA A;  2KWD A;  3HRD D;  2AX5 A;  2ZCB A;  4KX6 B;  2L83 A;  3HHM A;  4P7I A;  1L0Y B;  2N9P C;  1ENF A;  3R66 C;  4RMA A;  2DZJ A;  2KAC A;  2FE8 A;  1EU4 A;  2WDV B;  2LI5 A;  3PT2 B;  1SE2 A;  4IUM B;  4KZ0 A;  1FXT B;  1F77 A;  1C76 A;  2B76 B;  2R2Q A;  2G9H D;  1UNS A;  3PSE B;  2MBB B;  3OAW A;  1VDV A;  3NS8 A;  4II2 B;  4EUT A;  2LGD A;  2E3T A;  1C4C A;  2Y5C A;  4LJP B;  4KZC A;  4P16 A;  5TR5 A;  2KX3 A;  3TMP B;  1C3T A;  2C9W B;  1J7A A;  1BXT A;  4AP4 C;  1ZUD 2;  3QA8 A;  4NY0 A;  2MBE A;  4NQL B;  1C1Y B;  1WXQ A;  3RZW C;  4MAC A;  4CO7 A;  4HRO A;  1E8Y A;  4J6I A;  1YN4 A;  1ZP0 B;  2PJH A;  3VUW A;  1HXY D;  1VCB A;  2HJ8 A;  3AV8 A;  4AUQ C;  2EMT A;  1QIL A;  1IPG A;  3NVV A;  4W9D A;  4MGZ E;  2RDB C;  1TKG A;  1B1Z A;  3IT4 B;  3NZS A;  4D2K A;  5HHD G;  3MP9 A;  3VTW A;  4MDK E;  1I42 A;  2MEK A;  1FM0 D;  1QKZ A;  2KFK A;  2O6V B;  1T0Q C;  1XD3 B;  2KO3 A;  1WY8 A;  2IGG A;  2D3G A;  4USA A;  4HDQ A;  1TTN A;  1E0Z A;  5FKA C;  3Q8A A;  4WAF A;  2M0X A;  3OJ3 A;  1QZE A;  4NNJ B;  4IKG A;  2C5L C;  2MLB A;  2QIL A;  2A5U A;  3RUL A;  4PS3 A;  2WDT B;  3AEB B;  3EHV A;  2I38 A;  1V2Y A;  1WM3 A;  3DBR B;  2WXG A;  4FHJ A;  1N62 A;  3RUI B;  4R3D A;  5JXV A;  4UDU C;  2FIF A;  2DNF A;  2FCN A;  1TKY A;  4JLC A;  1IBX B;  3PGE A;  1RYJ A;  4HRS A;  2BBC A;  1GAQ B;  5AZH A;  1WYW B;  3KUZ A;  4B0E A;  2DWQ A;  4G3X B;  1SIJ A;  1PGA A;  2RDH A;  1YQ4 B;  2KN4 A;  2RSU A;  3BIN A;  2MA9 B;  1V49 A;  2V4I B;  3GZN B;  1LGR A;  3A9K B;  4E74 A;  1LQB A;  1C78 A;  2WXJ A;  5D2M B;  2BYV E;  2M19 A;  3V6E B;  2H89 B;  1BUI C;  5L95 C;  4RCO A;  3QAR A;  1D6E C;  1V97 A;  4P1C C;  4FJV B;  1GB1 A;  5D7G A;  4DDG D;  4OZC A;  1GB4 A;  3CWI A;  3T8M A;  3W9C B;  3RNC C;  2V0G A;  2ZZP B;  2JPH A;  4L1B A;  1A70 A;  2FAZ A;  3VUX A;  1GJZ A;  1ZKH A;  2AL3 A;  2J4X A;  3A4S C;  4BBN C;  2XNA C;  2DX5 B;  4ICU A;  3R2T A;  2MP2 A;  1HQR D;  4IG7 B;  2J42 A;  1EM7 A;  4HKZ E;  1KM7 A;  3WAL A;  1KJT A;  2GBJ A;  2JRH A;  3JYU A;  2L52 A;  2ZVO A;  1NVI D;  2B3A A;  1STE A;  4W9E A;  3DOW A;  4LTU A;  4JPS A;  1OQY A;  2PE9 A;  3P1M A;  2YLM A;  1UH6 A;  2EEL A;  2K22 A;  3EFU A;  1ZXI A;  4NAW B;  1JWB D;  2WXK A;  1FD6 A;  3TSS A;  1C4P A;  4KIK B;  3FIL B;  3RN9 C;  3AEE B;  3SHQ A;  4TKN A;  2N4F A;  1SE3 A;  1J8C A;  1CZP A;  3LDZ E;  3AE3 B;  2JXT A;  2N9K A;  2NTT A;  3AE4 B;  3I3T B;  4XGA B;  1IGC A;  1H4R A;  2J0K A;  3NOB A;  4XDD A;  2DHZ A;  4GB9 A;  4WIP A;  4RFB A;  2FUH B;  2LHD A;  4BOS C;  2QHO A;  2GMI C;  1M94 A;  2VH2 A;  2DBY A;  5GXG B;  1MPE A;  1XLN A;  2RPQ A;  1EF1 A;  4TUU A;  4GLS C;  4LCD E;  4IC7 B;  1WSP A;  4PS7 A;  2SEB D;  4A8X C;  2WGS A;  4HPM B;  2C7H A;  3UIO B;  1YN3 A;  2LD9 A;  3NRZ A;  4ARC A;  3Q2A C;  3Q3J A;  2CJN A;  3ZVV A;  1HE8 A;  2IO1 B;  1R4N I;  2BQQ A;  4C4V B;  1YD8 U;  3Q14 C;  4IDI A;  3WA0 A;  1QOF A;  1YMH E;  3VUY A;  1AWD A;  4PT5 A;  3RI7 C;  1ROE A;  1WE6 A;  1XF5 L;  3DHH C;  3U30 A;  2WP9 B;  1SEB D;  4ZHO A;  5FR3 A;  4WJO A;  3ENE A;  4MGI E;  2PE6 B;  3LJ3 A;  2JYT A;  1TY0 A;  2M4N A;  1MG4 A;  1WR6 E;  3AE7 B;  1IP9 A;  2KK8 A;  2X8X X;  2K0P A;  2NTS A;  5HI1 A;  3NHE B;  3N9Y C;  4LLG M;  4BOZ B;  3MC9 A;  1Q5W B;  4GU2 A;  5I4D A;  4NJC A;  2D11 A;  2INC C;  2N9L A;  4FAD A;  3BYT B;  1WJU A;  2L8J A;  4ZRI A;  5EE3 A;  4HCP B;  2WXP A;  3I63 C;  2JQR B;  1YQB A;  3ZNG C;  1C79 A;  2KDF B;  3P4R B;  4DWF A;  2AQ1 B;  4ZRK A;  1KLU D;  2K6Q A;  4FJY A;  4HWI B;  4JIO U;  3KW5 B;  4YTM B;  3NZ3 A;  2EMS A;  3PZD A;  4LNN A;  1V5T A;  4IWQ A;  1LO5 D;  2BB6 A;  3DBH I;  2MBH A;  1CMX B;  1RM6 C;  3KH0 A;  4P1B C;  1JML A;  4AS1 A;  2PVG C;  2FNJ B;  3MHS D;  5DPT A;  2OOB B;  1WGH A;  1ZW7 A;  4WJQ A;  1MJD A;  4FUL A;  4RGM A;  4BVU C;  2ZVN A;  4B9K A;  1T0S C;  3MJW A;  4LNK A;  2O6V A;  2KLG A;  2Y5P A;  4W9C A;  2BS2 B;  2JXX A;  3K9O B;  1A5R A;  4ZYS A;  1HEZ E;  1F1H A;  4K7S A;  1D5X C;  3URY A;  1DGJ A;  1WGG A;  4PK1 A;  3AN1 A;  3ZJU A;  3VH3 B;  2V3N A;  4GSW A;  3W1Y A;  5CTR C;  3QJZ A;  4XC2 A;  3ZO5 B;  4BKG A;  3PS6 A;  3U8Z A;  4W9F A;  3UQB A;  1RFA A;  3RZF A;  1IBX A;  3TL5 A;  2Z0E B;  3UI3 A;  3RNF C;  4YWG G;  1SJH D;  2C7N B;  3PV1 A;  2K8H A;  1VZ8 A;  2XK5 B;  1PGX A;  3AE2 B;  2K6D B;  4BKS D;  2QC8 A;  2KX0 A;  3A9K A;  2N0S B;  2L1A A;  3HUI A;  4AOF A;  3TBL D;  1Z2M A;  2UYZ B;  2L00 B;  1ZXH A;  3DQV A;  1FXI A;  1N5W A;  5IN7 A;  1E9M A;  2WQY B;  4HKQ A;  2LVP A;  2J0J A;  1FRD A;  1EO6 A;  3H8H A;  1L6V A;  1UWM A;  2MBQ A;  3AH7 A;  3P4S B;  3PZ7 A;  2CHZ A;  3HVD A;  3UIP B;  3NS1 A;  2BWE S;  2QEJ C;  4WQO B;  2KTR B;  2QJL A;  3IAM 1;  5HKH A;  1P7F A;  2JF5 A;  3R2I A;  4NJ6 A;  2JVC A;  3BII D;  1I4G A;  4I6N B;  3EUB 2;  1E7P B;  4II3 B;  1WRI A;  2HTH A;  3VQI A;  2D07 B;  5JHA A;  1CJE A;  3DVN U;  4XDC A;  4EEW A;  1V1O A;  1FIQ A;  3GOE A;  4NAW A;  3T3N A;  2JU6 X;  3FIL A;  4KGS A;  2MQJ A;  1TZO A;  1RLF A;  5TSS A;  5J18 A;  1TS5 A;  4K3B A;  3M95 A;  4KKI A;  2R61 A;  1UWX A;  2CU3 A;  4K7W A;  4W9G A;  4AWJ A;  3IG3 A;  3AED B;  3U2S C;  3OLM D;  2LGY A;  1CK1 A;  3UF8 A;  1UUP A;  2VZK D;  2IY0 B;  4DBG A;  3PO0 A;  2HDE A;  4BBN F;  1QOB A;  4AQ7 A;  3AU4 A;  1WWT A;  2QDF A;  5HG2 A;  3DVG Y;  1N63 A;  2AYO B;  2KLC A;  2WXM A;  3SDL C;  3TEW A;  1ESF A;  3NJT A;  2DZI A;  4QAY A;  3VRB B;  3ABV B;  1ZE3 D;  1LFD A;  4RM8 A;  4JWS C;  2FCM A;  3DBR I;  3BY4 B;  1WH3 A;  3AB5 A;  3K9P B;  1NYR A;  3VXW A;  5IAA C;  1P3Q U;  1GC7 A;  3BZD B;  1ET9 A;  4HLE A;  1L6U A;  1WJ4 A;  3TCA A;  2Y5B B;  3V61 A;  5CHV C;  1I4Q A;  4C4V A;  2CHW A;  4EZJ A;  1GOZ A;  1AAR A;  2K25 A;  2TSS A;  1VR9 A;  4LK0 M;  4OHJ A;  3IXS A;  1J7C A;  4BKS A;  5H8Y E;  3NY5 A;  1L7Y A;  5BYQ A;  5MPO A;  3SU8 X;  4M02 A;  1JWA D;  4MGY E;  4MJS B;  4K7U A;  2KN5 A;  2MCN B;  2RGF A;  5LLI A;  3GZN I;  3KWL A;  2UWQ A;  4B6W A;  1YNT E;  3AE5 B;  5EE9 A;  3RD2 A;  4W9I A;  1L2N A;  5E6O A;  3RNB C;  2NCN A;  3M3J A;  2KDB A;  3VRA B;  3EGR A;  2ACZ B;  3ZLZ A;  2WXI A;  4REZ A;  2J0M A;  3OJ4 B;  4K3C A;  4WJP A;  1QF6 A;  3M63 B;  2NBW B;  3AEG B;  3C0R B;  1DYQ A;  5KHO A;  2WX0 A;  3PRP B;  4KSL C;  3DVN V;  2WYQ A;  3ETR A;  4A6Q A;  3BVG A;  4IWO A;  3AEF B;  2KZR A;  4WQM A;  3MC0 B;  3DVG X;  4DDI D;  3RYT A;  4PYU A;  2L3Z A;  2HTM E;  3H6N A;  2DZK A;  3E9S A;  2NVU I;  2WNM A;  1T5X D;  3AE1 B;  4KV2 A;  3ZXR A;  3V05 A;  3TUO A;  2KDE B;  1E90 A;  1N61 A;  4Q2J A;  2SAK A;  1EF5 A;  1YX5 B;  3DBL B;  1Y56 A;  1RAX A;  2D3B A;  4ZHP A;  4ZYN A;  4EKU A;  1P1A A;  2HJ1 A;  3JSV B;  1ZGU B;  4RNA A;  4MH0 E;  1EWC A;  4TSS A;  2L32 A;  2JY6 A;  1JAL A;  4WUR A;  4HEA 1;  4GMV A;  3N30 A;  3X23 A;  3P2B A;  1DOX A;  2M17 A;  2BGF A;  3KYD D;  4MSQ B;  3R7Q A;  1L0V B;  1WX8 A;  4HVB A;  1K52 A;  4TMA B;  4LDT B;  2INN E;  2OJW A;  3I5J C;  2IND C;  1PYW D;  2K8B A;  1WYG A;  3GB1 A;  2ZJD A;  3C8Y A;  5IO9 A;  1FCC C;  1JWS D;  2KNB A;  4DHJ D;  4BZA A;  4EE2 A;  1PFD A;  3TEX A;  2PMV A;  1S1Q B; 
#chains in the Genus database with same CATH homology
 2AWT A;  1WXA A;  5LXI B;  2LUE A;  2KC2 A;  1SIF A;  2D10 A;  1TZ1 A;  2HD5 B;  1WE6 A;  2KMA A;  2NPT B;  1WGD A;  4G0N B;  3MTN B;  1P9D U;  3VHT C;  3ML8 A;  2RD0 A;  3U30 A;  4EZK A;  3PLV A;  5JZE B;  2G45 B;  4WJO A;  2GBM A;  2N9E B;  2BWF A;  3ENE A;  4MGI E;  2XK5 A;  2PE6 B;  3LJ3 A;  1WXV A;  1YX6 B;  2M4N A;  3PRE A;  2ASQ A;  4ICV A;  4CYE A;  2KDI A;  4ANU A;  1WR6 E;  3QK0 A;  4LJO B;  2OJR A;  1WFY A;  3QX1 A;  1WX7 A;  3R3M A;  4HK2 A;  2KK8 A;  2PPH A;  5EDS A;  1IP9 A;  4KSK C;  4JL9 A;  4ASW C;  1EUV B;  2WWZ A;  4WJN A;  3NHE B;  1V81 A;  3ZTC A;  3ZRF A;  3QQ8 B;  5BO4 B;  5G2N A;  4FHK A;  5C1Z A;  2IO0 B;  4E3C A;  1IYF A;  4M0W B;  4BOZ B;  1S3S G;  2V4L A;  1Q5W B;  4GU2 A;  4AJW A;  2XBB C;  2MP2 B;  2FID A;  2D11 A;  1OTR B;  2LGX A;  1WI0 A;  4FAD A;  4FJZ A;  1WXM A;  1WJU A;  2L8J A;  4ZRI A;  4HCP B;  3KVF B;  5CHW A;  3VTV A;  4GDL B;  1WJN A;  1U4A A;  1YQB A;  3ZNG C;  2NS5 A;  2L05 A;  1XT9 B;  4WWP A;  4F1S A;  2O2V B;  4W9J A;  1KLV A;  2KDF B;  4DWF A;  4B95 A;  4ZRK A;  2NBV B;  2K6Q A;  4DK5 A;  4I6L B;  1I35 A;  4FJY A;  1LXD A;  1WF9 A;  4HWI B;  4ANW A;  3EEC A;  4JIO U;  3KW5 B;  3S2A A;  3CST A;  2I1K A;  1Y8R C;  2KTR A;  5GMV A;  4EOY A;  2N7E A;  2EMS A;  2LXC A;  3PZD A;  5JHB A;  4OVV A;  1ISN A;  4OVU A;  3PVL A;  2KWC A;  1V5T A;  4IWQ A;  4M8M A;  3DBH I;  3QAQ A;  2MBH A;  1CMX B;  2L76 A;  1E8X A;  3KH0 A;  3W1S A;  3L08 A;  4GN1 A;  4A3O A;  3WIM A;  3DBS A;  3QIJ A;  2KVR A;  2R2O A;  5DPR A;  2FNJ B;  3V62 A;  3MHS D;  5DPT A;  4I6P A;  2KAN A;  1E8Z A;  2OOB B;  1WGH A;  2KQ7 A;  2ZCC A;  1WRD B;  1ZW7 A;  4WJQ A;  1G6J A;  4WWO A;  4HPL B;  2DAF A;  3HIZ A;  4FUL A;  1WJ6 A;  1V80 A;  5E6N A;  2G4S A;  3QC8 B;  4DHZ B;  3ZUN A;  4BVU C;  2ZVN A;  2MW5 A;  5CHF A;  4B9K A;  1UGM A;  1UD7 A;  3A1Q B;  4MM3 A;  3O65 B;  4RM9 A;  2AEH A;  3MJW A;  3ZTD A;  4IW0 A;  2O6V A;  4GIV A;  2KLG A;  3L10 B;  3M62 B;  2LRU A;  2ZPY A;  4W9C A;  2KKC A;  2KHW B;  2JXX A;  4FA6 A;  3KUD B;  4JGH B;  3U7D A;  3K9O B;  2JZZ A;  3PTF C;  1A5R A;  5L83 A;  3ZIM A;  2FCQ A;  4E71 A;  2K1F A;  1YJ1 A;  4K7S A;  2LWP A;  1WGG A;  1P0R A;  1V5O A;  1V6E A;  4IWP A;  4NQK E;  3TJP A;  3N32 A;  2M1M A;  3JVZ X;  3QHT A;  3VH3 B;  1TGZ B;  5D6J B;  4GSW A;  3IBE A;  3L54 A;  1MG8 A;  4IM3 A;  2JUO A;  1K8R B;  2IO2 B;  3A9J B;  2ZNV B;  3W1Y A;  5CTR C;  4FBJ B;  3QJZ A;  4W9L A;  3UIN B;  2JT4 B;  4XX5 A;  2Z59 B;  3DDC B;  3CMM B;  2C7M B;  1WMH B;  4XC2 A;  3ZO5 B;  2M8S A;  4BKG A;  3PS6 A;  3H7S A;  3U8Z A;  4BFR A;  1WZ0 A;  4W9F A;  1WE7 A;  2IY1 B;  4LDT D;  2RR9 A;  3A4R A;  4HJK A;  3V60 A;  4GDK B;  3UQB A;  3WAM A;  1RFA A;  4TQ1 A;  1F9J A;  3RZF A;  3TL5 A;  2Z0E B;  4M8N A;  2LRW A;  2N7D A;  3HK0 A;  2ZNV C;  4K1R B;  4KDL B;  2L0T A;  1TBE A;  4IM0 A;  1WIA A;  2CKH B;  2LZ6 A;  2ZCB A;  3HHM A;  2C7N B;  2KQS A;  3JW0 X;  3AI5 A;  4P7I A;  4GOC A;  2NBU A;  2N9P C;  3PV1 A;  5E6P A;  3VVW B;  2K8H A;  3R66 C;  4TQ0 A;  4RMA A;  1UZX B;  2DZJ A;  2XK5 B;  2YVC A;  3PRZ A;  2K6D B;  3V6C B;  4K81 A;  4BKS D;  2KX0 A;  3A9K A;  2LAS A;  5AEK B;  2LI5 A;  3PT2 B;  4AOF A;  4IUM B;  3PLU A;  1Q0W B;  4PS8 A;  3TBL D;  4KZ0 A;  2K8C A;  1PQS A;  1Z2M A;  1FXT B;  4WAA A;  2UYZ B;  2L00 B;  3ZRC A;  3DQV A;  2Z0D B;  4NPN A;  2R2Q A;  3PSE B;  2MBB B;  2MBO A;  3AUL A;  3NS8 A;  3OAW A;  4II2 B;  4F8C B;  4CHK A;  5AZF A;  4EUT A;  2LGD A;  2KJH B;  2LVP A;  1KOT A;  1OGW A;  2J0J A;  4NJ7 A;  3ZDM C;  4LJP B;  4DHZ E;  3B0A A;  4KZC A;  1EO6 A;  1V9J A;  1Z5S B;  4MJS A;  2BYE A;  5TR5 A;  2KX3 A;  3TMP B;  2IBI B;  1C3T A;  2MBQ A;  1SGH A;  2C9W B;  3Q3F A;  4AP4 C;  3QA8 A;  2KJ6 A;  4NY0 A;  4URK A;  2CHZ A;  3UIP B;  2MBE A;  3L17 A;  5JH5 C;  2BWE S;  4NQL B;  1C1Y B;  1SE9 A;  3RZW C;  4G11 A;  3ALB A;  4WQO B;  5DPS A;  3VFK A;  4CO7 A;  2DAJ A;  2KTR B;  1E8Y A;  4GXB A;  1WZ3 A;  2KMC A;  4J6I A;  2JF5 A;  5HKH A;  2PJH A;  3N3K B;  4NJ6 A;  2N1V A;  3VAW A;  3VUW A;  2JVC A;  2IYD B;  1VCB A;  2HJ8 A;  4I6N B;  2GOW A;  3H1U A;  4AUQ C;  2GBN A;  2EMT A;  1IPG A;  4W9D A;  4II3 B;  4MGZ E;  4FLH A;  3VDZ A;  3ZW3 A;  2HTH A;  3ZKJ C;  3VQI A;  2D07 B;  2K39 A;  5JHA A;  3DVN U;  2LVO A;  4ZRJ A;  3ZNZ B;  3NZS A;  4AJY B;  4EEW A;  3R7R A;  2REX A;  4GGQ A;  4EFO A;  1J0G A;  1T0Y A;  3GOE A;  1WGY A;  4NAW A;  4MDK E;  3VTW A;  3W1S C;  1I42 A;  1P98 A;  3VTU A;  3IFW B;  2KFK A;  2MRP A;  2O6V B;  1XD3 B;  2KO3 A;  5KHQ A;  1WY8 A;  2D3G A;  4HDQ A;  1TTN A;  2MQJ A;  2KFJ A;  1RLF A;  2C60 A;  5J18 A;  2LXA A;  2M0X A;  1XQQ A;  3OJ3 A;  5D94 A;  3M95 A;  1NDD A;  3HM6 X;  1QZE A;  4NNJ B;  4DXA B;  4K7W A;  4W9G A;  2BKR B;  2C5L C;  2CU1 A;  2O6V D;  4WWN A;  3IG3 A;  2MLB A;  4AWJ A;  2A5U A;  2KOX A;  3RUL A;  3OLM D;  4PS3 A;  2LGY A;  3ZNH B;  2WDT B;  3EHV A;  3UF8 A;  1E8W A;  1YIW A;  4YL8 A;  1V2Y A;  1WM3 A;  2IY0 B;  4DBG A;  5DPW A;  3JSV A;  2JZ3 B;  3RT3 B;  5C23 A;  4W9K A;  1UBI A;  2BYF A;  4FHJ A;  3ML9 A;  2AL6 A;  4BBN F;  4FN2 A;  2DYM A;  1GG3 A;  3RUI B;  5J2R A;  3AU4 A;  3DVG Y;  3IHP C;  2AYO B;  2FIF A;  2KLC A;  3SDL C;  3D32 A;  2FCN A;  4F7Z A;  4JLC A;  2DZI A;  1R4M I;  2G4D B;  4HCN B;  3KYC D;  3DCG A;  1LFD A;  3RCZ A;  3PGE A;  3TIX A;  4KDI C;  2N1W A;  4RM8 A;  4ZDV A;  3PPA A;  2HE7 A;  5AZH A;  2FCM A;  4TV3 A;  1WYW B;  3DBR I;  1V86 A;  3CF6 E;  3KUZ A;  3BY4 B;  3H7P A;  1WH3 A;  5G55 A;  4G3X B;  2GBR A;  3K9P B;  3VXW A;  5IAA C;  1P3Q U;  3ZDT A;  2XEW A;  1GC7 A;  1OEY A;  1NBF C;  2DZM A;  4HLE A;  2DEN B;  3L0W B;  3PHW B;  2RSU A;  1WJ4 A;  1WM2 A;  3BIN A;  2MA9 B;  2CHX A;  1V49 A;  2KWV B;  3TCA A;  2Y5B B;  3V61 A;  4E74 A;  3A9K B;  5CHV C;  2MWS B;  2CHW A;  4EZJ A;  3VH4 B;  3UGB B;  2FCS A;  1LQB A;  4N9F 4;  1AAR A;  1GNU A;  2MSE D;  1UBQ A;  2K25 A;  2KC1 A;  2A4Z A;  5D2M B;  2BYV E;  3DPD A;  4BKS A;  2VRR B;  3V6E B;  2NPT A;  5L95 C;  4HXD A;  3WAN A;  4MEM A;  3NY5 A;  4A20 A;  1L7Y A;  4HDO A;  3QAR A;  1E5W A;  3UQA A;  2PEA A;  3SU8 X;  4FJV B;  5D7G A;  4MGY E;  4DDG D;  2KWU B;  1WGR A;  1GC6 A;  2KN5 A;  1WR1 A;  4K7U A;  2RGF A;  4MJS B;  3GZN I;  1BT0 A;  5LLI A;  2MCN B;  3T8M A;  3QWZ B;  1JRU A;  1E7U A;  2UWQ A;  4B6W A;  2ZZP B;  1GUA B;  2DYB A;  2JPH A;  2FAZ A;  3VUX A;  1GJZ A;  1ZKH A;  3RD2 A;  4W9I A;  2AL3 A;  1L2N A;  2V3S A;  4A3P A;  3ECI A;  3AU5 A;  5E6O A;  5FR6 A;  3L16 A;  3A4S C;  4BBN C;  2NCN A;  3M3J A;  4MGK E;  2KDB A;  3SD5 A;  2DX5 B;  4ICU A;  2MP2 A;  3ZLZ A;  4X57 B;  2BPS A;  2D2Q A;  2J0M A;  3OJ4 B;  2JWZ A;  2ZEQ A;  4WJP A;  4IG7 B;  5CX3 A;  3M63 B;  2NBW B;  4GDL A;  3C0R B;  2LJ5 A;  4ANV A;  1WXS A;  3KUC B;  4JQW C;  2BF8 B;  3WAP A;  2O2V A;  2GBK A;  5KHO A;  1KM7 A;  3WAL A;  2KJR A;  2WX0 A;  1KJT A;  3PRP B;  4ANX A;  2GBJ A;  4KSL C;  2IZV B;  2L0F A;  3DVN V;  2JRH A;  3JYU A;  2WYQ A;  3X0W A;  4IWO A;  1WX9 A;  2IO3 B;  2ZVO A;  2KZR A;  1UEL A;  3ZNI D;  2J7Q B;  2NR2 A;  2B3A A;  3DVG X;  4W9E A;  3DOW A;  1X1M A;  3RYT A;  4DDI D;  4PYU A;  2L3Z A;  1NI2 A;  1OQY A;  2PE9 A;  3B1L X;  5DCN A;  2YLM A;  1H8C A;  5J17 A;  1J19 A;  3CSF A;  1RRB A;  1UH6 A;  3H6N A;  3EFU A;  4NAW B;  2DZK A;  4W9H A;  2W9N A;  5AZG A;  4BKT A;  2NVU I;  1LM8 B;  3B08 A;  4KIK B;  2KFK B;  2WX1 A;  2CR5 A;  4KIK A;  3QCA A;  1S1Q B;  4KV2 A;  2KDE B;  3HM3 A;  1E90 A;  2N9X A;  1Q1O A;  3A33 B;  4PYZ A;  1EF5 A;  3SHQ A;  4MEL A;  1YX5 B;  4TKN A;  2ZPN A;  1RAX A;  2N4F A;  3L13 A;  4MSM B;  4ZYN A;  1J8C A;  3WAO A;  3APC A;  3LDZ E;  3AXC A;  4IM2 A;  2DYO A;  3PRM B;  3I3T B;  1H4R A;  2J0K A;  2KTF A;  4EKU A;  1P1A A;  3NOB A;  3A1Q A;  2KD0 A;  1VD2 A;  2EKE C;  3EC8 A;  3H9D A;  3JSV B;  4KVG B;  1OEY J;  3APD A;  2DHZ A;  4GB9 A;  1ZGU B;  4G50 A;  3NZU A;  4MH0 E;  2FUH B;  2JY6 A;  4XZ4 A;  4BOS C;  3APF A;  2QHO A;  4GMV A;  3PHX B;  3N30 A;  5IA7 A;  2MX2 A;  2GMI C;  4EZL A;  1M94 A;  3DBL I;  3X23 A;  3P2B A;  2M17 A;  2BGF A;  3KYD D;  4MSQ B;  3R7Q A;  2I1J A;  2RPQ A;  3T9L A;  1EF1 A;  4TUU A;  1WX8 A;  4HVB A;  2G3Q B;  4LCD E;  4IC7 B;  4LDT B;  4PS7 A;  4DHJ B;  3A9J A;  2LVQ A;  2C7H A;  4HPM B;  2K8B A;  3UIO B;  3H7P B;  3ONS A;  2L7R A;  2LD9 A;  2ZJD A;  5LXH A;  2JRI B;  1WMH A;  2V1Y A;  2KXJ A;  3Q3J A;  3IVF A;  2CS4 A;  2KNB A;  3ZVV A;  4DHJ D;  1HE8 A;  4GDK A;  2IO1 B;  1R4N I;  1YD8 U;  1E7V A;  3WA0 A;  1D3Z A;  2BKF A;  3VUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...