1WGRA

Solution structure of the ra domain of human grb7 protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
100
structure length
100
Chain Sequence
GSSGSSGRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSDETWGLVECHPHLALERGLEDHESVVEVQAAWPVGGDSRFVFRKNFASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth factor receptor-bound protein 7
publication title Solution Structure of the RA Domain of Human Grb7 Protein
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 9
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wgrA01
2KMAA 2FCQA 4IC7B 1A5RA 4AWJA 2EMTA 2AL3A 4LCDE 2BPSA 5J18A 1Q5WB 1WMHB 4XX5A 2DZJA 4IM0A 3X23A 1C3TA 4GMVA 1R4NI 1E8ZA 4FJYA 2MBOA 5L95C 3H9DA 3R7QA 4KSKC 2CHWA 5JHAA 1PQSA 4MGYE 5DPTA 2XEWA 4EZJA 1GUAB 1WX9A 4GDLA 1RLFA 2BF8B 2NS5A 3OJ4B 3OLMD 3EFUA 4IM3A 2W9NA 2FCSA 3DVNU 4K1RB 3B0AA 3PRPB 4GIVA 3IHPC 2MBBB 4A20A 1WGDA 2KLCA 3N30A 3KW5B 3VTUA 4LJOB 2Z0EB 2DYMA 5CX3A 2RPQA 4KSLC 4EKUA 2K8BA 3H6NA 3ONSA 1GG3A 3AULA 2KO3A 3VXWA 4HDOA 2LWPA 4F7ZA 1UD7A 2ZPYA 4P7IA 5CHWA 3QARA 4OVUA 3ZLZA 3DVNV 4EOYA 3VVWB 4FHJA 5GMVA 5TR5A 1NBFC 5J2RA 4NNJB 4W9JA 5DPSA 1WGYA 3WAPA 3V62A 1IYFA 2NBWB 4PYZA 1E5WA 2C7NB 1Q1OA 2K8HA 1MG8A 1WJ4A 4MH0E 2J7QB 3VQIA 4BKSD 5LLIA 1WMHA 4GU2A 1D3ZA 2LZ6A 2ZVNA 2IO3B 4G0NB 2WX0A 4KDLB 2MCNB 1KM7A 3DBHI 4IWOA 1RAXA 2JT4B 3MJWA 3A9JB 2GBKA 5KHQA 1F9JA 3DBSA 2DX5B 4G50A 4WJNA 1WM3A 4TUUA 1V6EA 1X1MA 2IY1B 1KLVA 1TTNA 1UZXB 1WXSA 3GOEA 4IM2A 4FN2A 3PS6A 5IA7A 3H1UA 1OGWA 3R7RA 3U8ZA 4HVBA 1WM2A 4NQLB 2KD0A 3VUXA 3QJZA 4MGKE 1WJUA 2DENB 4FJZA 3ZRFA 2LGYA 3QC8B 2KC1A 3KUDB 1YQBA 4ICVA 2WX1A 2WYQA 1EO6A 3AU5A 3PLUA 3VTVA 4BKTA 3RZFA 5E6NA 2LD9A 4DHZB 4EZLA 2JWZA 2OJRA 1V5OA 2LVOA 3VUWA 2NPTA 2DAJA 3CF6E 1LQBA 2J0JA 1RFAA 1V81A 3QK0A 2B3AA 2RD0A 3APFA 3DVGX 4YL8A 2MQJA 1J19A 1YIWA 2HE7A 3AU4A 4KIKA 3SD5A 5LXIB 1OEYJ 3A4SC 4J6IA 2IO0B 5E6PA 5C23A 2PPHA 1EF5A 1G6JA 3APDA 2FIDA 1GNUA 3EECA 4G11A 2N9XA 3A9KA 2JF5A 3ZNZB 4W9FA 3RYTA 2WDTB 4HLEA 2A5UA 1SGHA 3QX1A 1Q0WB 2CKHB 3GZNI 1TBEA 2YVCA 1E90A 3DDCB 2K6QA 2I1KA 2LRWA 3ZNGC 4MDKE 2Z0DB 3L16A 1SE9A 1WRDB 3R66C 3TCAA 4FBJB 4PYUA 3VHTC 3JYUA 4AP4C 2AL6A 3WAMA 2FAZA 2KJRA 2KMCA 4HDQA 4DDID 2LXCA 2BWES 2HTHA 3OAWA 3RT3B 3VAWA 3W1YA 3VFKA 1J8CA 3ZUNA 2DZMA 2LGDA 2PE6B 4ANUA 2JXXA 4NAWB 4IW0A 4MEMA 4AJWA 1GC7A 4BKSA 1OQYA 4G3XB 2LGXA 4W9CA 1KOTA 2K39A 4AJYB 2D3GA 3R3MA 2L0TA 2FNJB 2KX0A 4ZDVA 2D2QA 2G4SA 4BOSC 2MWSB 2M4NA 1WGGA 3DCGA 4ZRKA 2KNBA 1R4MI 4WWNA 3Q3JA 4XZ4A 2O6VD 3ZDTA 2NBUA 4II2B 2KTRB 1V86A 1Z5SB 2KJHB 4K7UA 4EZKA 1P3QU 3LJ3A 4FA6A 1J0GA 5D7GA 5D6JB 2QHOA 3M63B 4K7WA 3UIOB 1RRBA 1WXAA 2KK8A 2V4LA 2MRPA 2KFKA 3VH4B 5AZFA 2A4ZA 1LFDA 2XBBC 4TV3A 5JH5C 3WA0A 1S3SG 4ASWC 5EDSA 3H7PA 1WX8A 1WR1A 2GBMA 1WJNA 3PREA 3VTWA 1CMXB 1VCBA 2GBRA 3QIJA 1YX5B 4WWPA 5D94A 3V60A 4W9KA 2LJ5A 3I3TB 4ZYNA 3W1SC 5KHOA 3L0WB 3IG3A 5C1ZA 1H8CA 3UQBA 4GN1A 2R2OA 1V80A 3A4RA 3NS8A 3KYDD 3ZRCA 4TQ0A 2KTRA 2M1MA 2KDBA 3RUIB 3VDZA 2ZCBA 4HPLB 2N4FA 1Z2MA 2OOBB 3DPDA 3DBLI 3ZIMA 2N9PC 1AARA 2XK5B 3M95A 4TQ1A 4WJQA 3DBRI 3PT2B 2V1YA 4F1SA 4I6PA 5L83A 1P1AA 1L2NA 1UGMA 2O6VB 2KQ7A 3X0WA 2ASQA 4BVUC 1NDDA 3P2BA 4WWOA 1S1QB 2REXA 3CMMB 4HXDA 1E8YA 2MSED 3KUCB 3QCAA 4HJKA 4EEWA 3JSVB 3HK0A 1XT9B 3M3JA 4IUMB 4DDGD 2WWZA 1T0YA 4MJSB 5AZGA 2L0FA 4CO7A 2C7MB 3T9LA 4F8CB 1IPGA 3HHMA 3RULA 2GBNA 2NR2A 1YJ1A 4KZ0A 3N3KB 5D2MB 3PRMB 2CU1A 2JUOA 2BWFA 4RMAA 2EKEC 3QQ8B 2KVRA 4GDKB 2N7EA 2XK5A 2L76A 3A9JA 2MBHA 2L8JA 1L7YA 2GBJA 2RSUA 4X57B 3H7SA 2IZVB 4EUTA 3ZW3A 2O6VA 4RM9A 3SU8X 2BKFA 3WAOA 1WXMA 3ML9A 4WQOB 2EMSA 3ZTDA 2KWUB 3JVZX 5FR6A 3KUZA 3HIZA 4EFOA 3BINA 3DOWA 3L10B 2BYEA 3W1SA 1Y8RC 4NPNA 4M8MA 3ALBA 4I6NB 1H4RA 3S2AA 4MSMB 4FULA 2ZVOA 1OEYA 3ZTCA 4W9HA 1ZW7A 2ZJDA 2L3ZA 2KDEB 3V6EB 1WGHA 3ZDMC 2K6DB 3CSFA 2KX3A 4HCPB 4MM3A 4AOFA 5AZHA 4DHZE 2N9EB 2BYFA 2L05A 1V5TA 1M94A 4II3B 3V6CB 4DHJD 2IO2B 3QAQA 1LM8B 1WGRA 2AWTA 3PGEA 5G55A 4HCNB 4XC2A 3VH3B 2R2QA 3A1QB 2DAFA 4M0WB 4FHKA 2O2VB 3O65B 2G45B 2GMIC 4CHKA 2D11A 5DPRA 1P9DU 4JQWC 2C60A 4E71A 3KVFB 3PV1A 2KDIA 1SIFA 2MLBA 2K8CA 1WXVA 5DPWA 4ZRJA 1WE7A 4GSWA 2KLGA 3L17A 2CHZA 4ANXA 3WALA 3ZKJC 4GDLB 3PPAA 1V9JA 3TL5A 4GB9A 3QHTA 5JHBA 3LDZE 4PS8A 2G3QB 1WF9A 2IO1B 3L13A 3MHSD 3IFWB 2DZIA 4JL9A 4AUQC 3UF8A 3KYCD 4FADA 3TIXA 3ZNHB 5G2NA 2FUHB 5LXHA 2KQSA 1LXDA 2MBEA 2Y5BB 1K8RB 2KFJA 3C0RB 1GC6A 2JZ3B 4MELA 4URKA 3A1QA 4NAWA 3B08A 2UYZB 2O2VA 2LVPA 2PEAA 4DXAB 3PHWB 2VRRB 1XD3B 1YX6B 4GOCA 3EC8A 3VUYA 1V49A 2CHXA 4GXBA 4HPMB 1WZ3A 4W9EA 1OTRB 2LRUA 3L54A 4E3CA 3TBLD 3QWZB 3B1LX 1WH3A 4DWFA 2DYOA 3NZSA 4DHJB 3NOBA 4DBGA 3UQAA 2ZPNA 4LDTB 1WR6E 2MW5A 4MSQB 2JRHA 1HE8A 2M17A 2N1WA 2JZZA 1XQQA 3HM6X 3SHQA 1WIAA 2HD5B 2IY0B 3D32A 2D07B 3K9OB 1NI2A 2K25A 4M8NA 3IVFA 2IBIB 3PSEB 3U7DA 5CHFA 1WYWB 2J0KA 1EUVB 1FXTB 1I35A 3U30A 2JY6A 2FCMA 1P98A 1TZ1A 4NJ7A 1EF1A 1V2YA 2NCNA 2ZNVB 2KN5A 5AEKB 1JRUA 3Q3FA 3MTNB 2NVUI 2KTFA 1UH6A 2CR5A 5IAAC 4BFRA 3N32A 2LVQA 4JLCA 3DVGY 2G4DB 2K1FA 1WE6A 5CHVC 3EHVA 5DCNA 2KWVB 2NPTB 3BY4B 4RM8A 2MBQA 4PS3A 4BOZB 5HKHA 2YLMA 2KWCA 1ISNA 1I42A 2V3SA 4I6LB 4KIKB 4LJPB 2JVCA 3PVLA 2LASA 3TJPA 3NY5A 2M8SA 1E7VA 2LUEA 1ZKHA 3NHEB 1QZEA 5JZEB 3A9KB 3UINB 1E8WA 4ZRIA 4KZCA 2CS4A 2D10A 1WX7A 3JW0X 1WI0A 2GOWA 4B9KA 1ZGUB 4W9DA 3ZNID 1BT0A 2L00B 4KVGB 4IWPA 4WJOA 2L7RA 4A3PA 3RCZA 3AXCA 3UGBB 2J0MA 3M62B 4ANVA 2KJ6A 3ECIA 4IWQA 3CSTA 3JSVA 2RR9A 3A33B 1E7UA 2RGFA 2PJHA 2AEHA 3ENEA 4MJSA 4ANWA 2ZZPB 1UBQA 2IYDB 3T8MA 4NJ6A 4B95A 2JPHA 4WAAA 4KV2A 2LI5A 3WANA 1IP9A 3L08A 2KHWB 1TGZB 3AI5A 2M0XA 4WJPA 4GDKA 3ML8A 3PHXB 4MGZE 4PS7A 2NBVB 4HK2A 3PLVA 4LDTD 3IBEA 4A3OA 4DK5A 3ZVVA 3TMPB 2JRIB 4BBNC 2KZRA 3UIPB 2UWQA 1VD2A 2I1JA 1KJTA 4ICUA 1YD8U 5BO4B 1C1YB 4JGHB 4BKGA 3QA8A 2MP2B 4NQKE 4MGIE 2FIFA 2PE9A 5CTRC 3K9PB 4BBNF 3PTFC 2LXAA 1UBIA 4CYEA 1WFYA 4HWIB 2ZCCA 2ZEQA 3RZWC 2FCNA 2HJ8A 4K7SA 4NY0A 1WY8A 1E8XA 2MX2A 2KDFB 1GJZA 2N1VA 4GGQA 4K81A 4KDIC 2BGFA 2KOXA 2C5LC 2BYVE 3HM3A 3OJ3A 2KFKB 3RD2A 2DZKA 3NZUA 2KC2A 1UELA 4FLHA 4OVVA 2BKRB 4W9LA 4FJVB 3DQVA 2C9WB 2DHZA 2KXJA 1U4AA 4IG7B 3H7PB 4W9IA 4JIOU 1WJ6A 4TKNA 1WZ0A 2MA9B 3APCA 2C7HA 2DYBA 3WIMA 3ZO5B 5J17A 3PRZA 4N9F4 2KANA 2AYOB 3KH0A 5E6OA 1P0RA 2N7DA 2MP2A 2ZNVC 3V61A 3PZDA 4B6WA 2KKCA 4W9GA 3SDLC 4E74A 2Z59B
chains in the Genus database with same CATH superfamily
2FCQA 2W3RA 1I7HA 4AWJA 2EMTA 2AL3A 4LCDE 1K51A 2BPSA 5J18A 1Q5WB 4XX5A 2DZJA 1C3TA 4OZBA 1RYJA 1ET9A 3R7QA 4KSKC 5DPTA 3MC0B 4LNOA 3BVZA 4OZCA 1WX9A 2QIEB 1XLQA 3OLMD 1WWTA 1ACCA 2IGGA 3PRPB 3IHPC 3DWMA 3P4QB 4A20A 1QOBA 2Z0EB 5CX3A 4KSLC 4EKUA 3VR9B 1ZPSA 3VXWA 3AULA 2LWPA 4P7IA 2JQRB 2DNFA 2WU5B 3IT6B 1FRRA 1NBFC 4NNJB 4W9JA 1IYFA 1EU4A 2C7NB 2K8HA 4RFBA 1QOFA 1D5ZC 5LLIA 2LZ6A 3ZJTA 2WX0A 1KM7A 1RAXA 1JWAD 4LTUA 4ZRPA 3A9JB 2GBKA 2CJOA 1PFDA 1KH0A 4IM2A 1XLOA 1FFUA 4NQLB 1CJEA 3QJZA 1JROA 1XLNA 3RZFA 2LD9A 1C79A 4RGOS 2JWZA 5BYRA 2LVOA 2NPTA 1LQBA 2J0JA 1V81A 1TT5B 4YSYB 2HE7A 1VDVA 3W5UB 1QKZA 3A4SC 4J6IA 2IO0B 5E6PA 3HVDA 1SJED 5C2TB 1EF5A 1G6JA 1TKYA 3EECA 2WU2B 3A9KA 2JF5A 2A5UA 1SGHA 3P4SB 3TUOA 2I2YA 1N5XA 2K6QA 2LRWA 1ZXHA 4MDKE 2Z0DB 4HROA 2OEDA 3TCAA 3JYUA 2WXGA 4N6EB 2FAZA 3MFGA 1TJEA 1C4PA 1E0ZA 2JYEA 4YXDB 3ABVB 3ZUNA 2BTEA 4NAWB 1GC7A 2AQ1B 2LGXA 5AUKA 2NTSA 1F2RC 1C4AA 4C7YA 2G4SA 4BOSC 2M4NA 1WGGA 2RPVA 1R4MI 3ZJUA 2O6VD 4RNAA 2KTRB 4EZKA 1J0GA 2K0PA 1I4PA 2V4LA 2MRPA 4K3BA 1LFDA 2DLBA 1S3SG 5EDSA 4NJCA 4IOIE 1WJNA 1VCBA 1GB4A 2BYTA 3V60A 4W9KA 2LJ5A 3W1SC 4HKZE 2LGSA 4KKJA 3RN9C 3UQBA 4GN1A 2X8XX 3NS8A 4YSZB 4TQ0A 2KTRA 2KDBA 5AUIA 4HPLB 1ZDXA 1V1PB 3NVVA 3M95A 4WJQA 2WLBA 3PT2B 2V1YA 4F1SA 3T3OA 3X0WA 2ASQA 3DHGC 1NDDA 1S1QB 4NAMA 1ZUD2 2V3PA 2JWUA 4HXDA 1YN3A 2QJLA 3JSVB 2WWZA 3NRZA 2L0FA 3Q3NC 4CO7A 2C7MB 1IPGA 1SIJA 3KWVA 1YJ1A 4KZ0A 4YTMB 3HUIA 2JUOA 4RMAA 1ZDVA 4GDKB 3KLSX 3ZYYX 1IBXB 1L7YA 2GBJA 4LLGM 5IKCM 4EUTA 3SEBA 1F77A 3WAOA 1WXMA 3B2GA 4WQOB 2EMSA 2VZKB 2NTTA 2ACZB 1N61A 4M8MA 3ALBA 1OEYA 4W9HA 3VRBB 1ZW7A 3P42A 3BK2A 2PMVA 2Y3AA 5JXVA 4MM3A 4P6VF 4DHZE 2N9EB 1FCLA 4XWTA 2BYFA 2L05A 1NI3A 1WRIA 3GZNB 1IBXA 2JYTA 4KGRA 3U7ZA 2O2VB 2G45B 2M56B 4HJGE 2D3CA 4WQMA 3RNBC 5BMGA 1FNWA 4GDLB 3TL5A 1V9JA 1T6BX 3KYCD 2MBEA 1YQ3B 4URKA 2JZ3B 2K3UA 2ON8A 2O2VA 3AEFB 1XD3B 4ZHOA 3VUYA 2CHXA 4GXBA 1YMHE 1OTRB 3L54A 4E3CA 1WH3A 2DYOA 4DHJB 1OQRA 3AE1B 4XWWA 3I5JC 1F2RI 2M17A 2N1WA 1MFWA 3HM6X 1GPXA 4OW0A 1L0YB 1GAQB 2VZKD 2D07B 3K9OB 3V3XA 4UDUC 3N9YC 4PT5A 1XEEA 3PO0A 2HDEA 1JW9D 1EUVB 3Q3MC 2JY6A 2KN4A 1EF1A 2NCNA 1QOGA 5HHDG 3MTNB 2BB5A 2CR5A 3DBLB 3P63A 2G4DB 5TSSA 4P1BC 1WE6A 5CHVC 5DCNA 4RM8A 4BOZB 4BZAA 4DXGA 2LASA 1E7VA 1DOXA 1ZKHA 1DOIA 3PZ8A 5I4DA 3UINB 3HRDD 4ZRIA 2WXKA 2CS4A 2MJ3A 3DHIC 2GOWA 3ZNID 1BT0A 1HTQA 2QDFA 1ZOYB 2BT6A 1I4GA 3UGBB 1OQQA 2J0MA 1ZXIA 2KJ6A 1SE3A 1VJKA 2LGIA 2RGFA 3ENEA 2LMCA 4MJSA 2ZZPB 4CQNA 3RNAC 1MVKA 2JPHA 2LI5A 3WANA 1JALA 3L08A 2KHWB 3AH7A 4MGZE 4PS7A 2WP9B 4ZHPA 2MHJA 1YN5A 2KZRA 1VD2A 5FK9C 5CTRC 3I57A 4BBNF 1DYQA 1WFYA 4HWIB 2ZEQA 3ZXRA 1WY8A 1GJZA 2N1VA 4GGQA 5G5HA 2BGFA 2KOXA 3OG5A 2DZKA 3TEYA 4W9LA 4FJVB 3DQVA 1MJDA 1TY2A 1WJ6A 4TKNA 2MA9B 2DYBA 1WXQA 5E6OA 1UWMA 1TS3A 2QSDA 2WS3B 4M02A 4HPPA 4JX1C 1WMHB 2J52A 1MI0A 1PQSA 4KGSA 4MGYE 3RPFC 4EZJA 1RLFA 3EFUA 4IM3A 1V8CA 3DVNU 4OZAA 1F0ZA 2MBBB 1WGDA 4A55A 1FCCC 1STEA 1KRHA 3ONSA 4HDOA 1UD7A 2ZPYA 4D2KA 5BMHA 4OVUA 4EOYA 5J2RA 5DPSA 3E56A 4BKSD 4ARCA 1WMHA 1PDXA 2ZVNA 2IJ0A 4XYCA 1J7BA 1YOVB 4IWOA 1FEHA 2JT4B 1C78A 4C00A 5KHQA 2KKCA 1F1HA 2DX5B 4G50A 3BZDB 3HVZA 4TUUA 1X1MA 1L4ZB 1UZXB 1WXSA 1I4RA 4FN2A 3NVYA 3PS6A 3U8ZA 1OGWA 2KD0A 2DENB 3ZXVA 3KUDB 1YQBA 2E6XA 2WX1A 3AU5A 3PLUA 1NENB 2PIAA 4DHZB 1V5OA 3BYTB 2DAJA 2RD0A 4YL8A 1E7PB 3NG0A 1K53A 2ZW1A 2ICIA 3ZQ4A 2J42A 3AU4A 1OEYJ 2K5PA 3CIRB 2YEPF 1SXTA 1FRDA 2GRIA 5FKAC 4EE2A 3APDA 4G11A 2N9XA 3ZNZB 3P4PB 4W9FA 4HLEA 1Q0WB 5BYQA 2FE8A 3GZNI 2YVCA 1UNSA 1I4HA 2I1KA 2R61A 3RNEC 1SE9A 3R66C 4FBJB 3ZGZA 2ZW0A 4AP4C 3WAMA 2KJRA 2KMCA 4TMAB 3GS2A 2W3SA 2KYWA 4DDID 2LXCA 3OAWA 3W1YA 4ANUA 2JXXA 4IW0A 1HA5A 4MEMA 5D3DA 1OQYA 4G3XB 4OHJA 1KOTA 2K39A 4AJYB 2L0TA 2KX0A 4ZDVA 2D2QA 3KQ4A 2KACA 3ZDTA 4ZRQA 3AMZA 4A6QA 1V86A 4K7UA 3LJ3A 3EUB2 3MC8A 5D6JB 3GB1A 1IGDA 2QHOA 2MJDA 3M63B 3UIOB 1WXAA 1YNTE 4XGAB 3VH4B 2KFKA 4US9A 3AEBB 1RM6C 3WA0A 4IKGA 3H7PA 1WR1A 2GBMA 3PREA 1R4NB 2GBRA 4WWPA 1TS5A 3C19A 1YJIA 1H8CA 5C1ZA 4OVZA 2R2OA 4JWUC 4GLSC 3ZRCA 4LK0M 2M1MA 3VDZA 2KVZA 2N4FA 2OOBB 2Q5WD 3DBLI 3DPDA 2BS2B 3IT4B 2Y5PA 1I4XA 1R7SA 3KWLA 4TQ1A 1C9FA 4I6PA 1P1AA 1B1ZA 1JRPA 2O6VB 2EELA 4ARIA 3VRAB 1N62A 1BMLC 3Q8FA 3CMMB 5T8IA 1QQRA 3QCAA 1MHXA 2JZPA 1QOAA 3M3JA 5EE1A 4DDGD 4HKQA 5AZGA 2JXTA 3Q8CA 2GBNA 3CWIA 3AE2B 3MP9A 1D6EC 5D2MB 2BWFA 3QQ8B 4LNFA 2BVCA 2WHIA 4AS1A 3A9JA 2H89B 3ZW3A 2O6VA 3ZTDA 1D4BA 5FR6A 2MH7A 3HIZA 3BINA 3DOWA 3L10B 2BYEA 3W1SA 2OJWA 4I6NB 3ZTCA 2KDEB 1WGHA 3ZDMC 3CSFA 1QT9A 2KX3A 1EWYC 5AZHA 3AE3B 3R2IA 2NMQA 4HEA1 1VLBA 1L0VB 4XC2A 4M0WB 4FHKA 3U52E 2GMIC 1M4VA 2MLBA 2QC8A 2INNE 2CHZA 1GOZA 3WALA 4Q2JA 3PPAA 1WF9A 4J3OD 3MHSD 4YWGG 3ZNHB 2FUHB 1NVID 3C0RB 1K8RB 2KFJA 2Y5BB 4NAWA 3B08A 4M0WA 2WXOA 2LVPA 2XNAC 3EC8A 1YJJA 1WZ3A 3AE6B 4W9EA 3TBLD 3QWZB 4DBGA 1TKEA 2MW5A 1ZE3D 3SHQA 3D32A 2K25A 3IVFA 2IBIB 3P4RB 1WYWB 3BVGA 1PGBA 4ITKA 1XCTL 1I35A 2FCMA 1TZ1A 2PVOD 2KN5A 1HTOA 2KTFA 5IAAC 3AE8B 4BFRA 3B9JA 3DVGY 4REZA 1ROEA 2MBQA 4PS3A 1ISNA 1I42A 2V3SA 4I6LB 4KIKB 4LJPB 3NJTA 3PVLA 1V1PA 3LYYA 2SAKA 4S0RA 1E8WA 1WX7A 3JW0X 2L00B 1SBBB 3JSVA 2WXHA 2PJHA 4A8XC 3T8MA 4NJ6A 3IAM1 1B9RA 4WAFA 5D3IB 1IP9A 3H8HA 4P1CC 5GXGB 3AI5A 4K3CA 2M0XA 4GDKA 3ML8A 3FILB 3PHXB 4DK5A 3NVZA 3PLVA 4BBNC 4BKGA 1FFVA 1UBIA 1YQ4B 1MPEA 2FCNA 3AEEB 4K7SA 5LNK1 3NS1A 4K81A 2YEPB 1L4DB 3NZUA 4FLHA 4OVVA 2BKRB 2C9WB 1U4AA 4WH4A 4W9IA 2DBYA 1MG4A 3L4PA 4N9F4 2SEBD 3KH0A 3Q69A 4MACA 4W9GA 4C80A 2Z59B 2KMAA 4IC7B 1A5RA 3BK1A 4IM0A 4GMVA 1R4NI 2CHWA 5JHAA 2XEWA 4GDLA 5H8YE 3OJ4B 2NS5A 2LHEA 2W9NA 1OFFA 2B76B 1UF0A 4K1RB 1AWDA 3B0AA 1T3QA 1NYRA 1ENFA 2WXRA 4GIVA 2KLCA 3KW5B 4LJOB 2DYMA 3NVWA 1GG3A 2KO3A 2WXMA 3ZLZA 3DVNV 2PTLA 3VVWB 4FHJA 3T3NA 5TR5A 1JWMD 3V62A 1E5WA 1WJ4A 2J7QB 4JWSC 4GU2A 1D3ZA 2IO3B 3AE5B 1F9JA 2BS4B 3DBSA 3TEWA 3AV8A 5IN7A 3TEZA 2IY1B 4MT5A 1KLVA 3GOEA 5IA7A 3H1UA 4HVBA 3R7RA 4MGKE 4FJZA 3ZRFA 3QC8B 5EE9A 3E9SA 2WGSA 3VTVA 1TS2A 5E6NA 2BQQA 2TSSA 4EZLA 2OJRA 3W5VB 3VUWA 3NUHB 1RFAA 3QK0A 2MQJA 5C23A 4JE3B 2PPHA 3LB8C 2FIDA 3RYTA 4N59A 3FAHA 2PVGC 1TBEA 4HRSA 1E90A 3EFCA 3DDCB 3ZNGC 1DOYA 3L16A 1Y56A 4A9AA 2PKOA 2INDC 2AL6A 3DWGC 4HDQA 2BWES 2HTHA 3RT3B 3VAWA 2BW2A 2DZMA 2LGDA 2PE6B 4B0EA 2W55A 4AJWA 4BKSA 4MH8A 4W9CA 3NZ3A 1L0XB 2D3GA 1KF6B 4C4VB 1TZOA 1VRAB 4ZRKA 4WWNA 4YT0B 4XZ4A 1GB1A 1FO4A 4RCOA 1P3QU 4N58A 4K7WA 2N9KA 4NZLB 1WGKA 5AZFA 2A4ZA 4B6WA 5JH5C 1P7EA 4ASWC 1HEZE 2XN9C 2J4XA 1N5WA 3VTWA 1SB3C 3QIJA 2RDHA 5D94A 3U2SC 4IDIA 5G5GA 3I3TB 1N63A 2WNMA 1EWCA 1YN4A 3A4RA 3RUIB 1C4CA 4YSXB 1Z2MA 3ZIMA 2N9PC 1KLGD 1QF6A 2XK5B 4P16A 1XXGA 2IPKD 1QILA 1FM0D 4BVUC 1PYWD 3P2BA 2REXA 2H88B 1E8YA 2MSED 3KUCB 4EEWA 1XT9B 3AN1A 3T9LA 4F8CB 1UWXA 2NR2A 3BIID 3N3KB 2CU1A 2EKEC 2M0AA 3Q14C 2KVRA 3BWUD 5H92C 3AEGB 2XK5A 2RSUA 3H7SA 2WDVB 2IZVB 3SU8X 2PLPA 1NEKB 2KWUB 3JVZX 3IXSA 2WXIA 1FIQA 3KUZA 4JPSA 3AEDB 3S2AA 4MSMB 1CZPA 2ZJDA 3WCQA 1XCQL 3V6EB 1XF5L 2K6DB 2KAJA 4AOFA 1M94A 2IO2B 3QAQA 1LM8B 1WGRA 1FNUA 2AWTA 3PGEA 4BAXA 4O1NA 3A1QB 2DAFA 1L5PA 2L1AA 2W54A 2D3BA 5MPOA 1P9DU 4JQWC 4E71A 1DGJA 3KVFB 2KDIA 2Y5CA 4WWMA 3R2TA 5IOIA 1WE7A 4GSWA 2KLGA 3L17A 1KFYB 5JHBA 2G3QB 3L13A 3IFWB 2DZIA 1VZ8A 3UF8A 2J53A 3AE7B 1E9MA 3TIXA 5G2NA 2KQSA 1WYGA 4MELA 3A1QA 3RI7C 4DXAB 1IUEA 3PHWB 5C3JB 2WDRB 3Q3OC 1SJHD 4HPMB 2LRUA 3B1LX 4DWFA 3UQAA 3NZSA 2ZPNA 4LDTB 1WR6E 2JRHA 1JWUD 1TS4A 1WIAA 3GE3C 1PGXA 5EE0A 2HD5B 1FD6A 2FUG1 1NI2A 5HI1A 3O13A 2INCC 4M8NA 3URYA 3PSEB 3MJ5A 1C77A 4QAYA 3U30A 4NJ7A 2UU7A 2ZNVB 5AEKB 1JRUA 4H2AA 3Q3FA 2NVUI 1UH6A 1D5XC 2MEKA 3AEAB 3N32A 4JLCA 2WDQB 2K1FA 2WQYB 3GE8C 3EGRA 2NPTB 3DBRB 3Q8AA 3UI3A 2OHFA 2YLMA 2KWCA 3N1XC 4WIPA 1FXAA 3ZJVA 4ZOHC 3TJPA 2LUEA 3N1YC 3A9KB 4KZCA 2K22A 2D10A 1WI0A 4B9KA 2HTME 4A3PA 2X38A 3AXCA 3RCZA 4DXFA 4ANVA 3M62B 1C76A 1T0RC 3ECIA 3CSTA 2RR9A 1E7UA 2AQ2B 1UBQA 1I4QA 1AYFA 2QCZA 4WAAA 2RMMA 1TGZB 2EKIA 1KLUD 4WJPA 2NBVB 4LDTD 1VZ6A 3IBEA 3ZVVA 3V05A 2JRIB 3UIPB 2UWQA 4ANXA 1KJTA 1YD8U 4JGHB 2FIFA 1TYGB 4M00A 2QILA 4RGNA 4CYEA 1V97A 2ZCCA 3RZWC 2HJ8A 4NY0A 1E8XA 5FR3A 2KDFB 2C5LC 2BYVE 3HM3A 1L6VA 1JQ4A 2KMMA 1FXIA 1UELA 2KXJA 4JIOU 1ESFA 1WZ0A 3ZO5B 2C7HA 3WIMA 3BYYB 3TSSA 2AYOB 4L2YA 2ZNVC 2AX5A 4E74A 2WXPA 2IGDA 3X23A 1E8ZA 4FJYA 2MBOA 5L95C 3H9DA 1UGJA 3PZ7A 1GUAB 2BF8B 2FCSA 4C56C 5HFYA 3BVMA 1SE4A 3N30A 4ACFA 3VTUA 2RPQA 2V9HA 2K8BA 3H6NA 4F7ZA 5CHWA 3QARA 2I38A 5GMVA 1E10A 1WGYA 3WAPA 2NBWB 4PYZA 1Q1OA 4MH0E 1MG8A 2V4IB 3VQIA 4WURA 4G0NB 4KDLB 2MCNB 3DBHI 1AW7A 3MJWA 4WJNA 1XLPA 1WM3A 2MJEA 2K9XA 1V6EA 1IGCA 1TTNA 2RDBC 1K52A 1WM2A 3N20C 3VUXA 1WJUA 3R8BA 2LGYA 2KC1A 1LGRA 2W82A 4ICVA 2GB1A 2WYQA 1EO6A 4BKTA 3W9CB 2DWQA 4MM3B 3CF6E 2B3AA 3DVGX 3APFA 2CU3A 1J19A 1YIWA 2JSVX 3SD5A 4KIKA 5LXIB 2PW9A 1EU3A 3DHHC 1GNUA 1F52A 2BB6A 2WDTB 3QX1A 4C7ZA 2CKHB 1ZP0B 1BUIC 4DQOC 2L52A 4M01A 1WRDB 4XE0A 4PYUA 3VHTC 5BYSA 2HJ1A 2LEKA 3AE9B 2VH1A 3VFKA 1J8CA 3FC4A 1EM7A 5IP4D 3FILA 3Q8BA 1WSPA 3P1MA 3R3MA 1N6ZA 2FNJB 3FKYA 2MWSB 3AECB 2LFIA 3DCGA 1JCKB 2KNBA 3J9CA 3Q3JA 1TY0A 2NBUA 1VR9A 4II2B 1Z5SB 2KJHB 5HG2A 4FA6A 1MHHE 5D7GA 1FNVA 3RFZB 3OWEB 4B0MA 1RRBA 2KK8A 3GP7A 4XDCA 4AQ7A 2XBBC 4TV3A 4RF0A 2KT7A 1L6UA 3MC9A 4LNIA 3B2FA 4KGTA 1WX8A 1V1OA 3N1ZC 1CMXB 1YX5B 5BMIA 5E6JA 4ZYNA 2VH2A 5KHOA 2KWDA 1PGAA 3L0WB 3IG3A 1V80A 3KYDD 3C8YA 2RDGA 2WXLA 2ZCBA 2E3TA 1AARA 1J7CA 3DBRI 4US8A 4USAA 4R3DA 5L83A 1L2NA 1UGMA 2KQ7A 4WWOA 5EE3A 5IO9A 2L32A 4HJKA 2L83A 3HK0A 4IUMB 1T0YA 3Q2AC 4MJSB 1BXTA 3I63C 3W2DA 3HHMA 3RULA 2V3NA 3RNGC 3PRMB 3SDLC 2N7EA 2L76A 3AB5A 1P7FA 2MBHA 2L8JA 4X57B 2LJIA 4RM9A 2N9LA 2BKFA 3ML9A 1KTKA 1T0SC 1HQRD 2LUMA 4EFOA 1E6EB 1XO3A 1Y8RC 4NPNA 1H4RA 4FULA 2ZVOA 4S17A 2L3ZA 2G1EA 1SF0A 1FMAD 4LNNA 2FBWB 4HCPB 4L1BA 1UUPA 1V5TA 4II3B 3V6CB 4DHJD 1QLBB 5G55A 3RMKC 4HCNB 3VH3B 2R2QA 2IGHA 3O65B 4CHKA 2D11A 5DPRA 2C60A 3RNFC 4PK1A 3PV1A 1SIFA 1N60A 2K8CA 1WXVA 5DPWA 4ZRJA 2D3AA 4LNKA 2BBCA 3ZKJC 1JWSD 3VR8B 3EA6A 4GB9A 3QHTA 3LDZE 4PS8A 2IO1B 2AQ3B 4JL9A 4TSSA 4AUQC 1D5MC 3I9V1 1LXDA 2BS3B 1GC6A 1R4MB 2UYZB 2PEAA 1K50A 1AN8A 2VRRB 1YX6B 4GOCA 1V49A 1J7AA 1NYQA 3AE4B 4C4VA 3NOBA 4MSQB 4XDDA 1HE8A 2JZZA 1XQQA 2INPE 3Q6BA 2D5GA 4RGTA 2N0SB 2IY0B 1JMLA 2QEJC 4FXCA 4YTNB 2V0GA 1CQVA 3U7DA 5CHFA 1VZ7A 2J0KA 1FXTB 1P98A 2M19A 2CJNA 2WXNA 1V2YA 1Q10A 2LVQA 4L23A 4ZYSA 1CK1A 3DBHB 3EHVA 2KWVB 3BY4B 4RF1A 1RFKA 1T0QC 2WXJA 5HKHA 1HZ5A 3LXFA 2JVCA 1JWBD 2IDYA 4KX6B 3NY5A 2M8SA 3NHEB 1QZEA 5JZEB 1SE2A 3SFDB 4YTPB 1ZGUB 4W9DA 4WJOA 4KVGB 2KDMA 4IWPA 1HZ6A 2L7RA 3Q8EA 4IWQA 1SEBD 3A33B 2AEHA 2WXFA 3AM9A 4ANWA 2IYDB 1PUTA 4B95A 4KV2A 2WXQA 2Z8LA 3U4EG 3SR6A 1TIFA 1A70A 3MHZA 2KQ4X 4HK2A 4A3OA 3ETRA 3TMPB 4FADA 2QMTA 4ICUA 2I1JA 5BO4B 5LXHA 4RGMA 1C1YB 3QA8A 2MP2B 4NQKE 4MGIE 4RH6A 2JU6X 2PE9A 3K9PB 1LO5D 2LXAA 3PTFC 4KKIA 1SSNA 2MX2A 2N7JA 1TKGA 4KDIC 3RNCC 3OJ3A 2KFKB 3RD2A 2KC2A 1ET6A 3TEXA 2GLSA 4A90A 2DHZA 1T5XD 3IAS1 2JX5A 4IG7B 3H7PB 3APCA 5J17A 3PRZA 2GI9A 2KANA 2ONQA 1RWSA 1P0RA 2LHDA 2MP2A 1FPYA 3V61A 3PZDA 3SFEB 2N7DA 1HXYD 2G9HD
chains in the Genus database with same CATH topology
2KMAA 2FCQA 4IC7B 1A5RA 4AWJA 2EMTA 2AL3A 4LCDE 2BPSA 5J18A 1Q5WB 1WMHB 4XX5A 2DZJA 4IM0A 3X23A 1C3TA 4GMVA 1R4NI 1E8ZA 4FJYA 2MBOA 5L95C 3H9DA 3R7QA 4KSKC 2CHWA 5JHAA 1PQSA 4MGYE 5DPTA 2XEWA 4EZJA 1GUAB 1WX9A 4GDLA 1RLFA 2BF8B 2NS5A 3OJ4B 3OLMD 3EFUA 4IM3A 2W9NA 2FCSA 3DVNU 4K1RB 3B0AA 3PRPB 4GIVA 3IHPC 2MBBB 4A20A 1WGDA 2KLCA 3N30A 3KW5B 3VTUA 4LJOB 2Z0EB 2DYMA 5CX3A 2RPQA 4KSLC 4EKUA 2K8BA 3H6NA 3ONSA 1GG3A 3AULA 2KO3A 3VXWA 4HDOA 2LWPA 4F7ZA 1UD7A 2ZPYA 4P7IA 5CHWA 3QARA 4OVUA 3ZLZA 3DVNV 4EOYA 3VVWB 4FHJA 5GMVA 5TR5A 1NBFC 5J2RA 4NNJB 4W9JA 5DPSA 1WGYA 3WAPA 3V62A 1IYFA 2NBWB 4PYZA 1E5WA 2C7NB 1Q1OA 2K8HA 1MG8A 1WJ4A 4MH0E 2J7QB 3VQIA 4BKSD 5LLIA 1WMHA 4GU2A 1D3ZA 2LZ6A 2ZVNA 2IO3B 4G0NB 2WX0A 4KDLB 2MCNB 1KM7A 3DBHI 4IWOA 1RAXA 2JT4B 3MJWA 3A9JB 2GBKA 5KHQA 1F9JA 3DBSA 2DX5B 4G50A 4WJNA 1WM3A 4TUUA 1V6EA 1X1MA 2IY1B 1KLVA 1TTNA 1UZXB 1WXSA 3GOEA 4IM2A 4FN2A 3PS6A 5IA7A 3H1UA 1OGWA 3R7RA 3U8ZA 4HVBA 1WM2A 4NQLB 2KD0A 3VUXA 3QJZA 4MGKE 1WJUA 2DENB 4FJZA 3ZRFA 2LGYA 3QC8B 2KC1A 3KUDB 1YQBA 4ICVA 2WX1A 2WYQA 1EO6A 3AU5A 3PLUA 3VTVA 4BKTA 3RZFA 5E6NA 2LD9A 4DHZB 4EZLA 2JWZA 2OJRA 1V5OA 2LVOA 3VUWA 2NPTA 2DAJA 3CF6E 1LQBA 2J0JA 1RFAA 1V81A 3QK0A 2B3AA 2RD0A 3APFA 3DVGX 4YL8A 2MQJA 1J19A 1YIWA 2HE7A 3AU4A 4KIKA 3SD5A 5LXIB 1OEYJ 3A4SC 4J6IA 2IO0B 5E6PA 5C23A 2PPHA 1EF5A 1G6JA 3APDA 2FIDA 1GNUA 3EECA 4G11A 2N9XA 3A9KA 2JF5A 3ZNZB 4W9FA 3RYTA 2WDTB 4HLEA 2A5UA 1SGHA 3QX1A 1Q0WB 2CKHB 3GZNI 1TBEA 2YVCA 1E90A 3DDCB 2K6QA 2I1KA 2LRWA 3ZNGC 4MDKE 2Z0DB 3L16A 1SE9A 1WRDB 3R66C 3TCAA 4FBJB 4PYUA 3VHTC 3JYUA 4AP4C 2AL6A 3WAMA 2FAZA 2KJRA 2KMCA 4HDQA 4DDID 2LXCA 2BWES 2HTHA 3OAWA 3RT3B 3VAWA 3W1YA 3VFKA 1J8CA 3ZUNA 2DZMA 2LGDA 2PE6B 4ANUA 2JXXA 4NAWB 4IW0A 4MEMA 4AJWA 1GC7A 4BKSA 1OQYA 4G3XB 2LGXA 4W9CA 1KOTA 2K39A 4AJYB 2D3GA 3R3MA 2L0TA 2FNJB 2KX0A 4ZDVA 2D2QA 2G4SA 4BOSC 2MWSB 2M4NA 1WGGA 3DCGA 4ZRKA 2KNBA 1R4MI 4WWNA 3Q3JA 4XZ4A 2O6VD 3ZDTA 2NBUA 4II2B 2KTRB 1V86A 1Z5SB 2KJHB 4K7UA 4EZKA 1P3QU 3LJ3A 4FA6A 1J0GA 5D7GA 5D6JB 2QHOA 3M63B 4K7WA 3UIOB 1RRBA 1WXAA 2KK8A 2V4LA 2MRPA 2KFKA 3VH4B 5AZFA 2A4ZA 1LFDA 2XBBC 4TV3A 5JH5C 3WA0A 1S3SG 4ASWC 5EDSA 3H7PA 1WX8A 1WR1A 2GBMA 1WJNA 3PREA 3VTWA 1CMXB 1VCBA 2GBRA 3QIJA 1YX5B 4WWPA 5D94A 3V60A 4W9KA 2LJ5A 3I3TB 4ZYNA 3W1SC 5KHOA 3L0WB 3IG3A 5C1ZA 1H8CA 3UQBA 4GN1A 2R2OA 1V80A 3A4RA 3NS8A 3KYDD 3ZRCA 4TQ0A 2KTRA 2M1MA 2KDBA 3RUIB 3VDZA 2ZCBA 4HPLB 2N4FA 1Z2MA 2OOBB 3DPDA 3DBLI 3ZIMA 2N9PC 1AARA 2XK5B 3M95A 4TQ1A 4WJQA 3DBRI 3PT2B 2V1YA 4F1SA 4I6PA 5L83A 1P1AA 1L2NA 1UGMA 2O6VB 2KQ7A 3X0WA 2ASQA 4BVUC 1NDDA 3P2BA 4WWOA 1S1QB 2REXA 3CMMB 4HXDA 1E8YA 2MSED 3KUCB 3QCAA 4HJKA 4EEWA 3JSVB 3HK0A 1XT9B 3M3JA 4IUMB 4DDGD 2WWZA 1T0YA 4MJSB 5AZGA 2L0FA 4CO7A 2C7MB 3T9LA 4F8CB 1IPGA 3HHMA 3RULA 2GBNA 2NR2A 1YJ1A 4KZ0A 3N3KB 5D2MB 3PRMB 2CU1A 2JUOA 2BWFA 4RMAA 2EKEC 3QQ8B 2KVRA 4GDKB 2N7EA 2XK5A 2L76A 3A9JA 2MBHA 2L8JA 1L7YA 2GBJA 2RSUA 4X57B 3H7SA 2IZVB 4EUTA 3ZW3A 2O6VA 4RM9A 3SU8X 2BKFA 3WAOA 1WXMA 3ML9A 4WQOB 2EMSA 3ZTDA 2KWUB 3JVZX 5FR6A 3KUZA 3HIZA 4EFOA 3BINA 3DOWA 3L10B 2BYEA 3W1SA 1Y8RC 4NPNA 4M8MA 3ALBA 4I6NB 1H4RA 3S2AA 4MSMB 4FULA 2ZVOA 1OEYA 3ZTCA 4W9HA 1ZW7A 2ZJDA 2L3ZA 2KDEB 3V6EB 1WGHA 3ZDMC 2K6DB 3CSFA 2KX3A 4HCPB 4MM3A 4AOFA 5AZHA 4DHZE 2N9EB 2BYFA 2L05A 1V5TA 1M94A 4II3B 3V6CB 4DHJD 2IO2B 3QAQA 1LM8B 1WGRA 2AWTA 3PGEA 5G55A 4HCNB 4XC2A 3VH3B 2R2QA 3A1QB 2DAFA 4M0WB 4FHKA 2O2VB 3O65B 2G45B 2GMIC 4CHKA 2D11A 5DPRA 1P9DU 4JQWC 2C60A 4E71A 3KVFB 3PV1A 2KDIA 1SIFA 2MLBA 2K8CA 1WXVA 5DPWA 4ZRJA 1WE7A 4GSWA 2KLGA 3L17A 2CHZA 4ANXA 3WALA 3ZKJC 4GDLB 3PPAA 1V9JA 3TL5A 4GB9A 3QHTA 5JHBA 3LDZE 4PS8A 2G3QB 1WF9A 2IO1B 3L13A 3MHSD 3IFWB 2DZIA 4JL9A 4AUQC 3UF8A 3KYCD 4FADA 3TIXA 3ZNHB 5G2NA 2FUHB 5LXHA 2KQSA 1LXDA 2MBEA 2Y5BB 1K8RB 2KFJA 3C0RB 1GC6A 2JZ3B 4MELA 4URKA 3A1QA 4NAWA 3B08A 2UYZB 2O2VA 2LVPA 2PEAA 4DXAB 3PHWB 2VRRB 1XD3B 1YX6B 4GOCA 3EC8A 3VUYA 1V49A 2CHXA 4GXBA 4HPMB 1WZ3A 4W9EA 1OTRB 2LRUA 3L54A 4E3CA 3TBLD 3QWZB 3B1LX 1WH3A 4DWFA 2DYOA 3NZSA 4DHJB 3NOBA 4DBGA 3UQAA 2ZPNA 4LDTB 1WR6E 2MW5A 4MSQB 2JRHA 1HE8A 2M17A 2N1WA 2JZZA 1XQQA 3HM6X 3SHQA 1WIAA 2HD5B 2IY0B 3D32A 2D07B 3K9OB 1NI2A 2K25A 4M8NA 3IVFA 2IBIB 3PSEB 3U7DA 5CHFA 1WYWB 2J0KA 1EUVB 1FXTB 1I35A 3U30A 2JY6A 2FCMA 1P98A 1TZ1A 4NJ7A 1EF1A 1V2YA 2NCNA 2ZNVB 2KN5A 5AEKB 1JRUA 3Q3FA 3MTNB 2NVUI 2KTFA 1UH6A 2CR5A 5IAAC 4BFRA 3N32A 2LVQA 4JLCA 3DVGY 2G4DB 2K1FA 1WE6A 5CHVC 3EHVA 5DCNA 2KWVB 2NPTB 3BY4B 4RM8A 2MBQA 4PS3A 4BOZB 5HKHA 2YLMA 2KWCA 1ISNA 1I42A 2V3SA 4I6LB 4KIKB 4LJPB 2JVCA 3PVLA 2LASA 3TJPA 3NY5A 2M8SA 1E7VA 2LUEA 1ZKHA 3NHEB 1QZEA 5JZEB 3A9KB 3UINB 1E8WA 4ZRIA 4KZCA 2CS4A 2D10A 1WX7A 3JW0X 1WI0A 2GOWA 4B9KA 1ZGUB 4W9DA 3ZNID 1BT0A 2L00B 4KVGB 4IWPA 4WJOA 2L7RA 4A3PA 3RCZA 3AXCA 3UGBB 2J0MA 3M62B 4ANVA 2KJ6A 3ECIA 4IWQA 3CSTA 3JSVA 2RR9A 3A33B 1E7UA 2RGFA 2PJHA 2AEHA 3ENEA 4MJSA 4ANWA 2ZZPB 1UBQA 2IYDB 3T8MA 4NJ6A 4B95A 2JPHA 4WAAA 4KV2A 2LI5A 3WANA 1IP9A 3L08A 2KHWB 1TGZB 3AI5A 2M0XA 4WJPA 4GDKA 3ML8A 3PHXB 4MGZE 4PS7A 2NBVB 4HK2A 3PLVA 4LDTD 3IBEA 4A3OA 4DK5A 3ZVVA 3TMPB 2JRIB 4BBNC 2KZRA 3UIPB 2UWQA 1VD2A 2I1JA 1KJTA 4ICUA 1YD8U 5BO4B 1C1YB 4JGHB 4BKGA 3QA8A 2MP2B 4NQKE 4MGIE 2FIFA 2PE9A 5CTRC 3K9PB 4BBNF 3PTFC 2LXAA 1UBIA 4CYEA 1WFYA 4HWIB 2ZCCA 2ZEQA 3RZWC 2FCNA 2HJ8A 4K7SA 4NY0A 1WY8A 1E8XA 2MX2A 2KDFB 1GJZA 2N1VA 4GGQA 4K81A 4KDIC 2BGFA 2KOXA 2C5LC 2BYVE 3HM3A 3OJ3A 2KFKB 3RD2A 2DZKA 3NZUA 2KC2A 1UELA 4FLHA 4OVVA 2BKRB 4W9LA 4FJVB 3DQVA 2C9WB 2DHZA 2KXJA 1U4AA 4IG7B 3H7PB 4W9IA 4JIOU 1WJ6A 4TKNA 1WZ0A 2MA9B 3APCA 2C7HA 2DYBA 3WIMA 3ZO5B 5J17A 3PRZA 4N9F4 2KANA 2AYOB 3KH0A 5E6OA 1P0RA 2N7DA 2MP2A 2ZNVC 3V61A 3PZDA 4B6WA 2KKCA 4W9GA 3SDLC 4E74A 2Z59B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KMA A;  2FCQ A;  4IC7 B;  1A5R A;  4AWJ A;  2EMT A;  2AL3 A;  4LCD E;  2BPS A;  5J18 A;  1Q5W B;  1WMH B;  4XX5 A;  2DZJ A;  4IM0 A;  3X23 A;  1C3T A;  4GMV A;  1R4N I;  1E8Z A;  4FJY A;  2MBO A;  5L95 C;  3H9D A;  3R7Q A;  4KSK C;  2CHW A;  5JHA A;  1PQS A;  4MGY E;  5DPT A;  2XEW A;  4EZJ A;  1GUA B;  1WX9 A;  4GDL A;  1RLF A;  2BF8 B;  2NS5 A;  3OJ4 B;  3OLM D;  3EFU A;  4IM3 A;  2W9N A;  2FCS A;  3DVN U;  4K1R B;  3B0A A;  3PRP B;  4GIV A;  3IHP C;  2MBB B;  4A20 A;  1WGD A;  2KLC A;  3N30 A;  3KW5 B;  3VTU A;  4LJO B;  2Z0E B;  2DYM A;  5CX3 A;  2RPQ A;  4KSL C;  4EKU A;  2K8B A;  3H6N A;  3ONS A;  1GG3 A;  3AUL A;  2KO3 A;  3VXW A;  4HDO A;  2LWP A;  4F7Z A;  1UD7 A;  2ZPY A;  4P7I A;  5CHW A;  3QAR A;  4OVU A;  3ZLZ A;  3DVN V;  4EOY A;  3VVW B;  4FHJ A;  5GMV A;  5TR5 A;  1NBF C;  5J2R A;  4NNJ B;  4W9J A;  5DPS A;  1WGY A;  3WAP A;  3V62 A;  1IYF A;  2NBW B;  4PYZ A;  1E5W A;  2C7N B;  1Q1O A;  2K8H A;  1MG8 A;  1WJ4 A;  4MH0 E;  2J7Q B;  3VQI A;  4BKS D;  5LLI A;  1WMH A;  4GU2 A;  1D3Z A;  2LZ6 A;  2ZVN A;  2IO3 B;  4G0N B;  2WX0 A;  4KDL B;  2MCN B;  1KM7 A;  3DBH I;  4IWO A;  1RAX A;  2JT4 B;  3MJW A;  3A9J B;  2GBK A;  5KHQ A;  1F9J A;  3DBS A;  2DX5 B;  4G50 A;  4WJN A;  1WM3 A;  4TUU A;  1V6E A;  1X1M A;  2IY1 B;  1KLV A;  1TTN A;  1UZX B;  1WXS A;  3GOE A;  4IM2 A;  4FN2 A;  3PS6 A;  5IA7 A;  3H1U A;  1OGW A;  3R7R A;  3U8Z A;  4HVB A;  1WM2 A;  4NQL B;  2KD0 A;  3VUX A;  3QJZ A;  4MGK E;  1WJU A;  2DEN B;  4FJZ A;  3ZRF A;  2LGY A;  3QC8 B;  2KC1 A;  3KUD B;  1YQB A;  4ICV A;  2WX1 A;  2WYQ A;  1EO6 A;  3AU5 A;  3PLU A;  3VTV A;  4BKT A;  3RZF A;  5E6N A;  2LD9 A;  4DHZ B;  4EZL A;  2JWZ A;  2OJR A;  1V5O A;  2LVO A;  3VUW A;  2NPT A;  2DAJ A;  3CF6 E;  1LQB A;  2J0J A;  1RFA A;  1V81 A;  3QK0 A;  2B3A A;  2RD0 A;  3APF A;  3DVG X;  4YL8 A;  2MQJ A;  1J19 A;  1YIW A;  2HE7 A;  3AU4 A;  4KIK A;  3SD5 A;  5LXI B;  1OEY J;  3A4S C;  4J6I A;  2IO0 B;  5E6P A;  5C23 A;  2PPH A;  1EF5 A;  1G6J A;  3APD A;  2FID A;  1GNU A;  3EEC A;  4G11 A;  2N9X A;  3A9K A;  2JF5 A;  3ZNZ B;  4W9F A;  3RYT A;  2WDT B;  4HLE A;  2A5U A;  1SGH A;  3QX1 A;  1Q0W B;  2CKH B;  3GZN I;  1TBE A;  2YVC A;  1E90 A;  3DDC B;  2K6Q A;  2I1K A;  2LRW A;  3ZNG C;  4MDK E;  2Z0D B;  3L16 A;  1SE9 A;  1WRD B;  3R66 C;  3TCA A;  4FBJ B;  4PYU A;  3VHT C;  3JYU A;  4AP4 C;  2AL6 A;  3WAM A;  2FAZ A;  2KJR A;  2KMC A;  4HDQ A;  4DDI D;  2LXC A;  2BWE S;  2HTH A;  3OAW A;  3RT3 B;  3VAW A;  3W1Y A;  3VFK A;  1J8C A;  3ZUN A;  2DZM A;  2LGD A;  2PE6 B;  4ANU A;  2JXX A;  4NAW B;  4IW0 A;  4MEM A;  4AJW A;  1GC7 A;  4BKS A;  1OQY A;  4G3X B;  2LGX A;  4W9C A;  1KOT A;  2K39 A;  4AJY B;  2D3G A;  3R3M A;  2L0T A;  2FNJ B;  2KX0 A;  4ZDV A;  2D2Q A;  2G4S A;  4BOS C;  2MWS B;  2M4N A;  1WGG A;  3DCG A;  4ZRK A;  2KNB A;  1R4M I;  4WWN A;  3Q3J A;  4XZ4 A;  2O6V D;  3ZDT A;  2NBU A;  4II2 B;  2KTR B;  1V86 A;  1Z5S B;  2KJH B;  4K7U A;  4EZK A;  1P3Q U;  3LJ3 A;  4FA6 A;  1J0G A;  5D7G A;  5D6J B;  2QHO A;  3M63 B;  4K7W A;  3UIO B;  1RRB A;  1WXA A;  2KK8 A;  2V4L A;  2MRP A;  2KFK A;  3VH4 B;  5AZF A;  2A4Z A;  1LFD A;  2XBB C;  4TV3 A;  5JH5 C;  3WA0 A;  1S3S G;  4ASW C;  5EDS A;  3H7P A;  1WX8 A;  1WR1 A;  2GBM A;  1WJN A;  3PRE A;  3VTW A;  1CMX B;  1VCB A;  2GBR A;  3QIJ A;  1YX5 B;  4WWP A;  5D94 A;  3V60 A;  4W9K A;  2LJ5 A;  3I3T B;  4ZYN A;  3W1S C;  5KHO A;  3L0W B;  3IG3 A;  5C1Z A;  1H8C A;  3UQB A;  4GN1 A;  2R2O A;  1V80 A;  3A4R A;  3NS8 A;  3KYD D;  3ZRC A;  4TQ0 A;  2KTR A;  2M1M A;  2KDB A;  3RUI B;  3VDZ A;  2ZCB A;  4HPL B;  2N4F A;  1Z2M A;  2OOB B;  3DPD A;  3DBL I;  3ZIM A;  2N9P C;  1AAR A;  2XK5 B;  3M95 A;  4TQ1 A;  4WJQ A;  3DBR I;  3PT2 B;  2V1Y A;  4F1S A;  4I6P A;  5L83 A;  1P1A A;  1L2N A;  1UGM A;  2O6V B;  2KQ7 A;  3X0W A;  2ASQ A;  4BVU C;  1NDD A;  3P2B A;  4WWO A;  1S1Q B;  2REX A;  3CMM B;  4HXD A;  1E8Y A;  2MSE D;  3KUC B;  3QCA A;  4HJK A;  4EEW A;  3JSV B;  3HK0 A;  1XT9 B;  3M3J A;  4IUM B;  4DDG D;  2WWZ A;  1T0Y A;  4MJS B;  5AZG A;  2L0F A;  4CO7 A;  2C7M B;  3T9L A;  4F8C B;  1IPG A;  3HHM A;  3RUL A;  2GBN A;  2NR2 A;  1YJ1 A;  4KZ0 A;  3N3K B;  5D2M B;  3PRM B;  2CU1 A;  2JUO A;  2BWF A;  4RMA A;  2EKE C;  3QQ8 B;  2KVR A;  4GDK B;  2N7E A;  2XK5 A;  2L76 A;  3A9J A;  2MBH A;  2L8J A;  1L7Y A;  2GBJ A;  2RSU A;  4X57 B;  3H7S A;  2IZV B;  4EUT A;  3ZW3 A;  2O6V A;  4RM9 A;  3SU8 X;  2BKF A;  3WAO A;  1WXM A;  3ML9 A;  4WQO B;  2EMS A;  3ZTD A;  2KWU B;  3JVZ X;  5FR6 A;  3KUZ A;  3HIZ A;  4EFO A;  3BIN A;  3DOW A;  3L10 B;  2BYE A;  3W1S A;  1Y8R C;  4NPN A;  4M8M A;  3ALB A;  4I6N B;  1H4R A;  3S2A A;  4MSM B;  4FUL A;  2ZVO A;  1OEY A;  3ZTC A;  4W9H A;  1ZW7 A;  2ZJD A;  2L3Z A;  2KDE B;  3V6E B;  1WGH A;  3ZDM C;  2K6D B;  3CSF A;  2KX3 A;  4HCP B;  4MM3 A;  4AOF A;  5AZH A;  4DHZ E;  2N9E B;  2BYF A;  2L05 A;  1V5T A;  1M94 A;  4II3 B;  3V6C B;  4DHJ D;  2IO2 B;  3QAQ A;  1LM8 B;  1WGR A;  2AWT A;  3PGE A;  5G55 A;  4HCN B;  4XC2 A;  3VH3 B;  2R2Q A;  3A1Q B;  2DAF A;  4M0W B;  4FHK A;  2O2V B;  3O65 B;  2G45 B;  2GMI C;  4CHK A;  2D11 A;  5DPR A;  1P9D U;  4JQW C;  2C60 A;  4E71 A;  3KVF B;  3PV1 A;  2KDI A;  1SIF A;  2MLB A;  2K8C A;  1WXV A;  5DPW A;  4ZRJ A;  1WE7 A;  4GSW A;  2KLG A;  3L17 A;  2CHZ A;  4ANX A;  3WAL A;  3ZKJ C;  4GDL B;  3PPA A;  1V9J A;  3TL5 A;  4GB9 A;  3QHT A;  5JHB A;  3LDZ E;  4PS8 A;  2G3Q B;  1WF9 A;  2IO1 B;  3L13 A;  3MHS D;  3IFW B;  2DZI A;  4JL9 A;  4AUQ C;  3UF8 A;  3KYC D;  4FAD A;  3TIX A;  3ZNH B;  5G2N A;  2FUH B;  5LXH A;  2KQS A;  1LXD A;  2MBE A;  2Y5B B;  1K8R B;  2KFJ A;  3C0R B;  1GC6 A;  2JZ3 B;  4MEL A;  4URK A;  3A1Q A;  4NAW A;  3B08 A;  2UYZ B;  2O2V A;  2LVP A;  2PEA A;  4DXA B;  3PHW B;  2VRR B;  1XD3 B;  1YX6 B;  4GOC A;  3EC8 A;  3VUY A;  1V49 A;  2CHX A;  4GXB A;  4HPM B;  1WZ3 A;  4W9E A;  1OTR B;  2LRU A;  3L54 A;  4E3C A;  3TBL D;  3QWZ B;  3B1L X;  1WH3 A;  4DWF A;  2DYO A;  3NZS A;  4DHJ B;  3NOB A;  4DBG A;  3UQA A;  2ZPN A;  4LDT B;  1WR6 E;  2MW5 A;  4MSQ B;  2JRH A;  1HE8 A;  2M17 A;  2N1W A;  2JZZ A;  1XQQ A;  3HM6 X;  3SHQ A;  1WIA A;  2HD5 B;  2IY0 B;  3D32 A;  2D07 B;  3K9O B;  1NI2 A;  2K25 A;  4M8N A;  3IVF A;  2IBI B;  3PSE B;  3U7D A;  5CHF A;  1WYW B;  2J0K A;  1EUV B;  1FXT B;  1I35 A;  3U30 A;  2JY6 A;  2FCM A;  1P98 A;  1TZ1 A;  4NJ7 A;  1EF1 A;  1V2Y A;  2NCN A;  2ZNV B;  2KN5 A;  5AEK B;  1JRU A;  3Q3F A;  3MTN B;  2NVU I;  2KTF A;  1UH6 A;  2CR5 A;  5IAA C;  4BFR A;  3N32 A;  2LVQ A;  4JLC A;  3DVG Y;  2G4D B;  2K1F A;  1WE6 A;  5CHV C;  3EHV A;  5DCN A;  2KWV B;  2NPT B;  3BY4 B;  4RM8 A;  2MBQ A;  4PS3 A;  4BOZ B;  5HKH A;  2YLM A;  2KWC A;  1ISN A;  1I42 A;  2V3S A;  4I6L B;  4KIK B;  4LJP B;  2JVC A;  3PVL A;  2LAS A;  3TJP A;  3NY5 A;  2M8S A;  1E7V A;  2LUE A;  1ZKH A;  3NHE B;  1QZE A;  5JZE B;  3A9K B;  3UIN B;  1E8W A;  4ZRI A;  4KZC A;  2CS4 A;  2D10 A;  1WX7 A;  3JW0 X;  1WI0 A;  2GOW A;  4B9K A;  1ZGU B;  4W9D A;  3ZNI D;  1BT0 A;  2L00 B;  4KVG B;  4IWP A;  4WJO A;  2L7R A;  4A3P A;  3RCZ A;  3AXC A;  3UGB B;  2J0M A;  3M62 B;  4ANV A;  2KJ6 A;  3ECI A;  4IWQ A;  3CST A;  3JSV A;  2RR9 A;  3A33 B;  1E7U A;  2RGF A;  2PJH A;  2AEH A;  3ENE A;  4MJS A;  4ANW A;  2ZZP B;  1UBQ A;  2IYD B;  3T8M A;  4NJ6 A;  4B95 A;  2JPH A;  4WAA A;  4KV2 A;  2LI5 A;  3WAN A;  1IP9 A;  3L08 A;  2KHW B;  1TGZ B;  3AI5 A;  2M0X A;  4WJP A;  4GDK A;  3ML8 A;  3PHX B;  4MGZ E;  4PS7 A;  2NBV B;  4HK2 A;  3PLV A;  4LDT D;  3IBE A;  4A3O A;  4DK5 A;  3ZVV A;  3TMP B;  2JRI B;  4BBN C;  2KZR A;  3UIP B;  2UWQ A;  1VD2 A;  2I1J A;  1KJT A;  4ICU A;  1YD8 U;  5BO4 B;  1C1Y B;  4JGH B;  4BKG A;  3QA8 A;  2MP2 B;  4NQK E;  4MGI E;  2FIF A;  2PE9 A;  5CTR C;  3K9P B;  4BBN F;  3PTF C;  2LXA A;  1UBI A;  4CYE A;  1WFY A;  4HWI B;  2ZCC A;  2ZEQ A;  3RZW C;  2FCN A;  2HJ8 A;  4K7S A;  4NY0 A;  1WY8 A;  1E8X A;  2MX2 A;  2KDF B;  1GJZ A;  2N1V A;  4GGQ A;  4K81 A;  4KDI C;  2BGF A;  2KOX A;  2C5L C;  2BYV E;  3HM3 A;  3OJ3 A;  2KFK B;  3RD2 A;  2DZK A;  3NZU A;  2KC2 A;  1UEL A;  4FLH A;  4OVV A;  2BKR B;  4W9L A;  4FJV B;  3DQV A;  2C9W B;  2DHZ A;  2KXJ A;  1U4A A;  4IG7 B;  3H7P B;  4W9I A;  4JIO U;  1WJ6 A;  4TKN A;  1WZ0 A;  2MA9 B;  3APC A;  2C7H A;  2DYB A;  3WIM A;  3ZO5 B;  5J17 A;  3PRZ A;  4N9F 4;  2KAN A;  2AYO B;  3KH0 A;  5E6O A;  1P0R A;  2N7D A;  2MP2 A;  2ZNV C;  3V61 A;  3PZD A;  4B6W A;  2KKC A;  4W9G A;  3SDL C;  4E74 A;  2Z59 B; 
#chains in the Genus database with same CATH topology
 2FCQ A;  2W3R A;  1I7H A;  4AWJ A;  2EMT A;  2AL3 A;  4LCD E;  1K51 A;  2BPS A;  5J18 A;  1Q5W B;  4XX5 A;  2DZJ A;  1C3T A;  4OZB A;  1RYJ A;  1ET9 A;  3R7Q A;  4KSK C;  5DPT A;  3MC0 B;  4LNO A;  3BVZ A;  4OZC A;  1WX9 A;  2QIE B;  1XLQ A;  3OLM D;  1WWT A;  1ACC A;  2IGG A;  3PRP B;  3IHP C;  3DWM A;  3P4Q B;  4A20 A;  1QOB A;  2Z0E B;  5CX3 A;  4KSL C;  4EKU A;  3VR9 B;  1ZPS A;  3VXW A;  3AUL A;  2LWP A;  4P7I A;  2JQR B;  2DNF A;  2WU5 B;  3IT6 B;  1FRR A;  1NBF C;  4NNJ B;  4W9J A;  1IYF A;  1EU4 A;  2C7N B;  2K8H A;  4RFB A;  1QOF A;  1D5Z C;  5LLI A;  2LZ6 A;  3ZJT A;  2WX0 A;  1KM7 A;  1RAX A;  1JWA D;  4LTU A;  4ZRP A;  3A9J B;  2GBK A;  2CJO A;  1PFD A;  1KH0 A;  4IM2 A;  1XLO A;  1FFU A;  4NQL B;  1CJE A;  3QJZ A;  1JRO A;  1XLN A;  3RZF A;  2LD9 A;  1C79 A;  4RGO S;  2JWZ A;  5BYR A;  2LVO A;  2NPT A;  1LQB A;  2J0J A;  1V81 A;  1TT5 B;  4YSY B;  2HE7 A;  1VDV A;  3W5U B;  1QKZ A;  3A4S C;  4J6I A;  2IO0 B;  5E6P A;  3HVD A;  1SJE D;  5C2T B;  1EF5 A;  1G6J A;  1TKY A;  3EEC A;  2WU2 B;  3A9K A;  2JF5 A;  2A5U A;  1SGH A;  3P4S B;  3TUO A;  2I2Y A;  1N5X A;  2K6Q A;  2LRW A;  1ZXH A;  4MDK E;  2Z0D B;  4HRO A;  2OED A;  3TCA A;  3JYU A;  2WXG A;  4N6E B;  2FAZ A;  3MFG A;  1TJE A;  1C4P A;  1E0Z A;  2JYE A;  4YXD B;  3ABV B;  3ZUN A;  2BTE A;  4NAW B;  1GC7 A;  2AQ1 B;  2LGX A;  5AUK A;  2NTS A;  1F2R C;  1C4A A;  4C7Y A;  2G4S A;  4BOS C;  2M4N A;  1WGG A;  2RPV A;  1R4M I;  3ZJU A;  2O6V D;  4RNA A;  2KTR B;  4EZK A;  1J0G A;  2K0P A;  1I4P A;  2V4L A;  2MRP A;  4K3B A;  1LFD A;  2DLB A;  1S3S G;  5EDS A;  4NJC A;  4IOI E;  1WJN A;  1VCB A;  1GB4 A;  2BYT A;  3V60 A;  4W9K A;  2LJ5 A;  3W1S C;  4HKZ E;  2LGS A;  4KKJ A;  3RN9 C;  3UQB A;  4GN1 A;  2X8X X;  3NS8 A;  4YSZ B;  4TQ0 A;  2KTR A;  2KDB A;  5AUI A;  4HPL B;  1ZDX A;  1V1P B;  3NVV A;  3M95 A;  4WJQ A;  2WLB A;  3PT2 B;  2V1Y A;  4F1S A;  3T3O A;  3X0W A;  2ASQ A;  3DHG C;  1NDD A;  1S1Q B;  4NAM A;  1ZUD 2;  2V3P A;  2JWU A;  4HXD A;  1YN3 A;  2QJL A;  3JSV B;  2WWZ A;  3NRZ A;  2L0F A;  3Q3N C;  4CO7 A;  2C7M B;  1IPG A;  1SIJ A;  3KWV A;  1YJ1 A;  4KZ0 A;  4YTM B;  3HUI A;  2JUO A;  4RMA A;  1ZDV A;  4GDK B;  3KLS X;  3ZYY X;  1IBX B;  1L7Y A;  2GBJ A;  4LLG M;  5IKC M;  4EUT A;  3SEB A;  1F77 A;  3WAO A;  1WXM A;  3B2G A;  4WQO B;  2EMS A;  2VZK B;  2NTT A;  2ACZ B;  1N61 A;  4M8M A;  3ALB A;  1OEY A;  4W9H A;  3VRB B;  1ZW7 A;  3P42 A;  3BK2 A;  2PMV A;  2Y3A A;  5JXV A;  4MM3 A;  4P6V F;  4DHZ E;  2N9E B;  1FCL A;  4XWT A;  2BYF A;  2L05 A;  1NI3 A;  1WRI A;  3GZN B;  1IBX A;  2JYT A;  4KGR A;  3U7Z A;  2O2V B;  2G45 B;  2M56 B;  4HJG E;  2D3C A;  4WQM A;  3RNB C;  5BMG A;  1FNW A;  4GDL B;  3TL5 A;  1V9J A;  1T6B X;  3KYC D;  2MBE A;  1YQ3 B;  4URK A;  2JZ3 B;  2K3U A;  2ON8 A;  2O2V A;  3AEF B;  1XD3 B;  4ZHO A;  3VUY A;  2CHX A;  4GXB A;  1YMH E;  1OTR B;  3L54 A;  4E3C A;  1WH3 A;  2DYO A;  4DHJ B;  1OQR A;  3AE1 B;  4XWW A;  3I5J C;  1F2R I;  2M17 A;  2N1W A;  1MFW A;  3HM6 X;  1GPX A;  4OW0 A;  1L0Y B;  1GAQ B;  2VZK D;  2D07 B;  3K9O B;  3V3X A;  4UDU C;  3N9Y C;  4PT5 A;  1XEE A;  3PO0 A;  2HDE A;  1JW9 D;  1EUV B;  3Q3M C;  2JY6 A;  2KN4 A;  1EF1 A;  2NCN A;  1QOG A;  5HHD G;  3MTN B;  2BB5 A;  2CR5 A;  3DBL B;  3P63 A;  2G4D B;  5TSS A;  4P1B C;  1WE6 A;  5CHV C;  5DCN A;  4RM8 A;  4BOZ B;  4BZA A;  4DXG A;  2LAS A;  1E7V A;  1DOX A;  1ZKH A;  1DOI A;  3PZ8 A;  5I4D A;  3UIN B;  3HRD D;  4ZRI A;  2WXK A;  2CS4 A;  2MJ3 A;  3DHI C;  2GOW A;  3ZNI D;  1BT0 A;  1HTQ A;  2QDF A;  1ZOY B;  2BT6 A;  1I4G A;  3UGB B;  1OQQ A;  2J0M A;  1ZXI A;  2KJ6 A;  1SE3 A;  1VJK A;  2LGI A;  2RGF A;  3ENE A;  2LMC A;  4MJS A;  2ZZP B;  4CQN A;  3RNA C;  1MVK A;  2JPH A;  2LI5 A;  3WAN A;  1JAL A;  3L08 A;  2KHW B;  3AH7 A;  4MGZ E;  4PS7 A;  2WP9 B;  4ZHP A;  2MHJ A;  1YN5 A;  2KZR A;  1VD2 A;  5FK9 C;  5CTR C;  3I57 A;  4BBN F;  1DYQ A;  1WFY A;  4HWI B;  2ZEQ A;  3ZXR A;  1WY8 A;  1GJZ A;  2N1V A;  4GGQ A;  5G5H A;  2BGF A;  2KOX A;  3OG5 A;  2DZK A;  3TEY A;  4W9L A;  4FJV B;  3DQV A;  1MJD A;  1TY2 A;  1WJ6 A;  4TKN A;  2MA9 B;  2DYB A;  1WXQ A;  5E6O A;  1UWM A;  1TS3 A;  2QSD A;  2WS3 B;  4M02 A;  4HPP A;  4JX1 C;  1WMH B;  2J52 A;  1MI0 A;  1PQS A;  4KGS A;  4MGY E;  3RPF C;  4EZJ A;  1RLF A;  3EFU A;  4IM3 A;  1V8C A;  3DVN U;  4OZA A;  1F0Z A;  2MBB B;  1WGD A;  4A55 A;  1FCC C;  1STE A;  1KRH A;  3ONS A;  4HDO A;  1UD7 A;  2ZPY A;  4D2K A;  5BMH A;  4OVU A;  4EOY A;  5J2R A;  5DPS A;  3E56 A;  4BKS D;  4ARC A;  1WMH A;  1PDX A;  2ZVN A;  2IJ0 A;  4XYC A;  1J7B A;  1YOV B;  4IWO A;  1FEH A;  2JT4 B;  1C78 A;  4C00 A;  5KHQ A;  2KKC A;  1F1H A;  2DX5 B;  4G50 A;  3BZD B;  3HVZ A;  4TUU A;  1X1M A;  1L4Z B;  1UZX B;  1WXS A;  1I4R A;  4FN2 A;  3NVY A;  3PS6 A;  3U8Z A;  1OGW A;  2KD0 A;  2DEN B;  3ZXV A;  3KUD B;  1YQB A;  2E6X A;  2WX1 A;  3AU5 A;  3PLU A;  1NEN B;  2PIA A;  4DHZ B;  1V5O A;  3BYT B;  2DAJ A;  2RD0 A;  4YL8 A;  1E7P B;  3NG0 A;  1K53 A;  2ZW1 A;  2ICI A;  3ZQ4 A;  2J42 A;  3AU4 A;  1OEY J;  2K5P A;  3CIR B;  2YEP F;  1SXT A;  1FRD A;  2GRI A;  5FKA C;  4EE2 A;  3APD A;  4G11 A;  2N9X A;  3ZNZ B;  3P4P B;  4W9F A;  4HLE A;  1Q0W B;  5BYQ A;  2FE8 A;  3GZN I;  2YVC A;  1UNS A;  1I4H A;  2I1K A;  2R61 A;  3RNE C;  1SE9 A;  3R66 C;  4FBJ B;  3ZGZ A;  2ZW0 A;  4AP4 C;  3WAM A;  2KJR A;  2KMC A;  4TMA B;  3GS2 A;  2W3S A;  2KYW A;  4DDI D;  2LXC A;  3OAW A;  3W1Y A;  4ANU A;  2JXX A;  4IW0 A;  1HA5 A;  4MEM A;  5D3D A;  1OQY A;  4G3X B;  4OHJ A;  1KOT A;  2K39 A;  4AJY B;  2L0T A;  2KX0 A;  4ZDV A;  2D2Q A;  3KQ4 A;  2KAC A;  3ZDT A;  4ZRQ A;  3AMZ A;  4A6Q A;  1V86 A;  4K7U A;  3LJ3 A;  3EUB 2;  3MC8 A;  5D6J B;  3GB1 A;  1IGD A;  2QHO A;  2MJD A;  3M63 B;  3UIO B;  1WXA A;  1YNT E;  4XGA B;  3VH4 B;  2KFK A;  4US9 A;  3AEB B;  1RM6 C;  3WA0 A;  4IKG A;  3H7P A;  1WR1 A;  2GBM A;  3PRE A;  1R4N B;  2GBR A;  4WWP A;  1TS5 A;  3C19 A;  1YJI A;  1H8C A;  5C1Z A;  4OVZ A;  2R2O A;  4JWU C;  4GLS C;  3ZRC A;  4LK0 M;  2M1M A;  3VDZ A;  2KVZ A;  2N4F A;  2OOB B;  2Q5W D;  3DBL I;  3DPD A;  2BS2 B;  3IT4 B;  2Y5P A;  1I4X A;  1R7S A;  3KWL A;  4TQ1 A;  1C9F A;  4I6P A;  1P1A A;  1B1Z A;  1JRP A;  2O6V B;  2EEL A;  4ARI A;  3VRA B;  1N62 A;  1BML C;  3Q8F A;  3CMM B;  5T8I A;  1QQR A;  3QCA A;  1MHX A;  2JZP A;  1QOA A;  3M3J A;  5EE1 A;  4DDG D;  4HKQ A;  5AZG A;  2JXT A;  3Q8C A;  2GBN A;  3CWI A;  3AE2 B;  3MP9 A;  1D6E C;  5D2M B;  2BWF A;  3QQ8 B;  4LNF A;  2BVC A;  2WHI A;  4AS1 A;  3A9J A;  2H89 B;  3ZW3 A;  2O6V A;  3ZTD A;  1D4B A;  5FR6 A;  2MH7 A;  3HIZ A;  3BIN A;  3DOW A;  3L10 B;  2BYE A;  3W1S A;  2OJW A;  4I6N B;  3ZTC A;  2KDE B;  1WGH A;  3ZDM C;  3CSF A;  1QT9 A;  2KX3 A;  1EWY C;  5AZH A;  3AE3 B;  3R2I A;  2NMQ A;  4HEA 1;  1VLB A;  1L0V B;  4XC2 A;  4M0W B;  4FHK A;  3U52 E;  2GMI C;  1M4V A;  2MLB A;  2QC8 A;  2INN E;  2CHZ A;  1GOZ A;  3WAL A;  4Q2J A;  3PPA A;  1WF9 A;  4J3O D;  3MHS D;  4YWG G;  3ZNH B;  2FUH B;  1NVI D;  3C0R B;  1K8R B;  2KFJ A;  2Y5B B;  4NAW A;  3B08 A;  4M0W A;  2WXO A;  2LVP A;  2XNA C;  3EC8 A;  1YJJ A;  1WZ3 A;  3AE6 B;  4W9E A;  3TBL D;  3QWZ B;  4DBG A;  1TKE A;  2MW5 A;  1ZE3 D;  3SHQ A;  3D32 A;  2K25 A;  3IVF A;  2IBI B;  3P4R B;  1WYW B;  3BVG A;  1PGB A;  4ITK A;  1XCT L;  1I35 A;  2FCM A;  1TZ1 A;  2PVO D;  2KN5 A;  1HTO A;  2KTF A;  5IAA C;  3AE8 B;  4BFR A;  3B9J A;  3DVG Y;  4REZ A;  1ROE A;  2MBQ A;  4PS3 A;  1ISN A;  1I42 A;  2V3S A;  4I6L B;  4KIK B;  4LJP B;  3NJT A;  3PVL A;  1V1P A;  3LYY A;  2SAK A;  4S0R A;  1E8W A;  1WX7 A;  3JW0 X;  2L00 B;  1SBB B;  3JSV A;  2WXH A;  2PJH A;  4A8X C;  3T8M A;  4NJ6 A;  3IAM 1;  1B9R A;  4WAF A;  5D3I B;  1IP9 A;  3H8H A;  4P1C C;  5GXG B;  3AI5 A;  4K3C A;  2M0X A;  4GDK A;  3ML8 A;  3FIL B;  3PHX B;  4DK5 A;  3NVZ A;  3PLV A;  4BBN C;  4BKG A;  1FFV A;  1UBI A;  1YQ4 B;  1MPE A;  2FCN A;  3AEE B;  4K7S A;  5LNK 1;  3NS1 A;  4K81 A;  2YEP B;  1L4D B;  3NZU A;  4FLH A;  4OVV A;  2BKR B;  2C9W B;  1U4A A;  4WH4 A;  4W9I A;  2DBY A;  1MG4 A;  3L4P A;  4N9F 4;  2SEB D;  3KH0 A;  3Q69 A;  4MAC A;  4W9G A;  4C80 A;  2Z59 B;  2KMA A;  4IC7 B;  1A5R A;  3BK1 A;  4IM0 A;  4GMV A;  1R4N I;  2CHW A;  5JHA A;  2XEW A;  4GDL A;  5H8Y E;  3OJ4 B;  2NS5 A;  2LHE A;  2W9N A;  1OFF A;  2B76 B;  1UF0 A;  4K1R B;  1AWD A;  3B0A A;  1T3Q A;  1NYR A;  1ENF A;  2WXR A;  4GIV A;  2KLC A;  3KW5 B;  4LJO B;  2DYM A;  3NVW A;  1GG3 A;  2KO3 A;  2WXM A;  3ZLZ A;  3DVN V;  2PTL A;  3VVW B;  4FHJ A;  3T3N A;  5TR5 A;  1JWM D;  3V62 A;  1E5W A;  1WJ4 A;  2J7Q B;  4JWS C;  4GU2 A;  1D3Z A;  2IO3 B;  3AE5 B;  1F9J A;  2BS4 B;  3DBS A;  3TEW A;  3AV8 A;  5IN7 A;  3TEZ A;  2IY1 B;  4MT5 A;  1KLV A;  3GOE A;  5IA7 A;  3H1U A;  4HVB A;  3R7R A;  4MGK E;  4FJZ A;  3ZRF A;  3QC8 B;  5EE9 A;  3E9S A;  2WGS A;  3VTV A;  1TS2 A;  5E6N A;  2BQQ A;  2TSS A;  4EZL A;  2OJR A;  3W5V B;  3VUW A;  3NUH B;  1RFA A;  3QK0 A;  2MQJ A;  5C23 A;  4JE3 B;  2PPH A;  3LB8 C;  2FID A;  3RYT A;  4N59 A;  3FAH A;  2PVG C;  1TBE A;  4HRS A;  1E90 A;  3EFC A;  3DDC B;  3ZNG C;  1DOY A;  3L16 A;  1Y56 A;  4A9A A;  2PKO A;  2IND C;  2AL6 A;  3DWG C;  4HDQ A;  2BWE S;  2HTH A;  3RT3 B;  3VAW A;  2BW2 A;  2DZM A;  2LGD A;  2PE6 B;  4B0E A;  2W55 A;  4AJW A;  4BKS A;  4MH8 A;  4W9C A;  3NZ3 A;  1L0X B;  2D3G A;  1KF6 B;  4C4V B;  1TZO A;  1VRA B;  4ZRK A;  4WWN A;  4YT0 B;  4XZ4 A;  1GB1 A;  1FO4 A;  4RCO A;  1P3Q U;  4N58 A;  4K7W A;  2N9K A;  4NZL B;  1WGK A;  5AZF A;  2A4Z A;  4B6W A;  5JH5 C;  1P7E A;  4ASW C;  1HEZ E;  2XN9 C;  2J4X A;  1N5W A;  3VTW A;  1SB3 C;  3QIJ A;  2RDH A;  5D94 A;  3U2S C;  4IDI A;  5G5G A;  3I3T B;  1N63 A;  2WNM A;  1EWC A;  1YN4 A;  3A4R A;  3RUI B;  1C4C A;  4YSX B;  1Z2M A;  3ZIM A;  2N9P C;  1KLG D;  1QF6 A;  2XK5 B;  4P16 A;  1XXG A;  2IPK D;  1QIL A;  1FM0 D;  4BVU C;  1PYW D;  3P2B A;  2REX A;  2H88 B;  1E8Y A;  2MSE D;  3KUC B;  4EEW A;  1XT9 B;  3AN1 A;  3T9L A;  4F8C B;  1UWX A;  2NR2 A;  3BII D;  3N3K B;  2CU1 A;  2EKE C;  2M0A A;  3Q14 C;  2KVR A;  3BWU D;  5H92 C;  3AEG B;  2XK5 A;  2RSU A;  3H7S A;  2WDV B;  2IZV B;  3SU8 X;  2PLP A;  1NEK B;  2KWU B;  3JVZ X;  3IXS A;  2WXI A;  1FIQ A;  3KUZ A;  4JPS A;  3AED B;  3S2A A;  4MSM B;  1CZP A;  2ZJD A;  3WCQ A;  1XCQ L;  3V6E B;  1XF5 L;  2K6D B;  2KAJ A;  4AOF A;  1M94 A;  2IO2 B;  3QAQ A;  1LM8 B;  1WGR A;  1FNU A;  2AWT A;  3PGE A;  4BAX A;  4O1N A;  3A1Q B;  2DAF A;  1L5P A;  2L1A A;  2W54 A;  2D3B A;  5MPO A;  1P9D U;  4JQW C;  4E71 A;  1DGJ A;  3KVF B;  2KDI A;  2Y5C A;  4WWM A;  3R2T A;  5IOI A;  1WE7 A;  4GSW A;  2KLG A;  3L17 A;  1KFY B;  5JHB A;  2G3Q B;  3L13 A;  3IFW B;  2DZI A;  1VZ8 A;  3UF8 A;  2J53 A;  3AE7 B;  1E9M A;  3TIX A;  5G2N A;  2KQS A;  1WYG A;  4MEL A;  3A1Q A;  3RI7 C;  4DXA B;  1IUE A;  3PHW B;  5C3J B;  2WDR B;  3Q3O C;  1SJH D;  4HPM B;  2LRU A;  3B1L X;  4DWF A;  3UQA A;  3NZS A;  2ZPN A;  4LDT B;  1WR6 E;  2JRH A;  1JWU D;  1TS4 A;  1WIA A;  3GE3 C;  1PGX A;  5EE0 A;  2HD5 B;  1FD6 A;  2FUG 1;  1NI2 A;  5HI1 A;  3O13 A;  2INC C;  4M8N A;  3URY A;  3PSE B;  3MJ5 A;  1C77 A;  4QAY A;  3U30 A;  4NJ7 A;  2UU7 A;  2ZNV B;  5AEK B;  1JRU A;  4H2A A;  3Q3F A;  2NVU I;  1UH6 A;  1D5X C;  2MEK A;  3AEA B;  3N32 A;  4JLC A;  2WDQ B;  2K1F A;  2WQY B;  3GE8 C;  3EGR A;  2NPT B;  3DBR B;  3Q8A A;  3UI3 A;  2OHF A;  2YLM A;  2KWC A;  3N1X C;  4WIP A;  1FXA A;  3ZJV A;  4ZOH C;  3TJP A;  2LUE A;  3N1Y C;  3A9K B;  4KZC A;  2K22 A;  2D10 A;  1WI0 A;  4B9K A;  2HTM E;  4A3P A;  2X38 A;  3AXC A;  3RCZ A;  4DXF A;  4ANV A;  3M62 B;  1C76 A;  1T0R C;  3ECI A;  3CST A;  2RR9 A;  1E7U A;  2AQ2 B;  1UBQ A;  1I4Q A;  1AYF A;  2QCZ A;  4WAA A;  2RMM A;  1TGZ B;  2EKI A;  1KLU D;  4WJP A;  2NBV B;  4LDT D;  1VZ6 A;  3IBE A;  3ZVV A;  3V05 A;  2JRI B;  3UIP B;  2UWQ A;  4ANX A;  1KJT A;  1YD8 U;  4JGH B;  2FIF A;  1TYG B;  4M00 A;  2QIL A;  4RGN A;  4CYE A;  1V97 A;  2ZCC A;  3RZW C;  2HJ8 A;  4NY0 A;  1E8X A;  5FR3 A;  2KDF B;  2C5L C;  2BYV E;  3HM3 A;  1L6V A;  1JQ4 A;  2KMM A;  1FXI A;  1UEL A;  2KXJ A;  4JIO U;  1ESF A;  1WZ0 A;  3ZO5 B;  2C7H A;  3WIM A;  3BYY B;  3TSS A;  2AYO B;  4L2Y A;  2ZNV C;  2AX5 A;  4E74 A;  2WXP A;  2IGD A;  3X23 A;  1E8Z A;  4FJY A;  2MBO A;  5L95 C;  3H9D A;  1UGJ A;  3PZ7 A;  1GUA B;  2BF8 B;  2FCS A;  4C56 C;  5HFY A;  3BVM A;  1SE4 A;  3N30 A;  4ACF A;  3VTU A;  2RPQ A;  2V9H A;  2K8B A;  3H6N A;  4F7Z A;  5CHW A;  3QAR A;  2I38 A;  5GMV A;  1E10 A;  1WGY A;  3WAP A;  2NBW B;  4PYZ A;  1Q1O A;  4MH0 E;  1MG8 A;  2V4I B;  3VQI A;  4WUR A;  4G0N B;  4KDL B;  2MCN B;  3DBH I;  1AW7 A;  3MJW A;  4WJN A;  1XLP A;  1WM3 A;  2MJE A;  2K9X A;  1V6E A;  1IGC A;  1TTN A;  2RDB C;  1K52 A;  1WM2 A;  3N20 C;  3VUX A;  1WJU A;  3R8B A;  2LGY A;  2KC1 A;  1LGR A;  2W82 A;  4ICV A;  2GB1 A;  2WYQ A;  1EO6 A;  4BKT A;  3W9C B;  2DWQ A;  4MM3 B;  3CF6 E;  2B3A A;  3DVG X;  3APF A;  2CU3 A;  1J19 A;  1YIW A;  2JSV X;  3SD5 A;  4KIK A;  5LXI B;  2PW9 A;  1EU3 A;  3DHH C;  1GNU A;  1F52 A;  2BB6 A;  2WDT B;  3QX1 A;  4C7Z A;  2CKH B;  1ZP0 B;  1BUI C;  4DQO C;  2L52 A;  4M01 A;  1WRD B;  4XE0 A;  4PYU A;  3VHT C;  5BYS A;  2HJ1 A;  2LEK A;  3AE9 B;  2VH1 A;  3VFK A;  1J8C A;  3FC4 A;  1EM7 A;  5IP4 D;  3FIL A;  3Q8B A;  1WSP A;  3P1M A;  3R3M A;  1N6Z A;  2FNJ B;  3FKY A;  2MWS B;  3AEC B;  2LFI A;  3DCG A;  1JCK B;  2KNB A;  3J9C A;  3Q3J A;  1TY0 A;  2NBU A;  1VR9 A;  4II2 B;  1Z5S B;  2KJH B;  5HG2 A;  4FA6 A;  1MHH E;  5D7G A;  1FNV A;  3RFZ B;  3OWE B;  4B0M A;  1RRB A;  2KK8 A;  3GP7 A;  4XDC A;  4AQ7 A;  2XBB C;  4TV3 A;  4RF0 A;  2KT7 A;  1L6U A;  3MC9 A;  4LNI A;  3B2F A;  4KGT A;  1WX8 A;  1V1O A;  3N1Z C;  1CMX B;  1YX5 B;  5BMI A;  5E6J A;  4ZYN A;  2VH2 A;  5KHO A;  2KWD A;  1PGA A;  3L0W B;  3IG3 A;  1V80 A;  3KYD D;  3C8Y A;  2RDG A;  2WXL A;  2ZCB A;  2E3T A;  1AAR A;  1J7C A;  3DBR I;  4US8 A;  4USA A;  4R3D A;  5L83 A;  1L2N A;  1UGM A;  2KQ7 A;  4WWO A;  5EE3 A;  5IO9 A;  2L32 A;  4HJK A;  2L83 A;  3HK0 A;  4IUM B;  1T0Y A;  3Q2A C;  4MJS B;  1BXT A;  3I63 C;  3W2D A;  3HHM A;  3RUL A;  2V3N A;  3RNG C;  3PRM B;  3SDL C;  2N7E A;  2L76 A;  3AB5 A;  1P7F A;  2MBH A;  2L8J A;  4X57 B;  2LJI A;  4RM9 A;  2N9L A;  2BKF A;  3ML9 A;  1KTK A;  1T0S C;  1HQR D;  2LUM A;  4EFO A;  1E6E B;  1XO3 A;  1Y8R C;  4NPN A;  1H4R A;  4FUL A;  2ZVO A;  4S17 A;  2L3Z A;  2G1E A;  1SF0 A;  1FMA D;  4LNN A;  2FBW B;  4HCP B;  4L1B A;  1UUP A;  1V5T A;  4II3 B;  3V6C B;  4DHJ D;  1QLB B;  5G55 A;  3RMK C;  4HCN B;  3VH3 B;  2R2Q A;  2IGH A;  3O65 B;  4CHK A;  2D11 A;  5DPR A;  2C60 A;  3RNF C;  4PK1 A;  3PV1 A;  1SIF A;  1N60 A;  2K8C A;  1WXV A;  5DPW A;  4ZRJ A;  2D3A A;  4LNK A;  2BBC A;  3ZKJ C;  1JWS D;  3VR8 B;  3EA6 A;  4GB9 A;  3QHT A;  3LDZ E;  4PS8 A;  2IO1 B;  2AQ3 B;  4JL9 A;  4TSS A;  4AUQ C;  1D5M C;  3I9V 1;  1LXD A;  2BS3 B;  1GC6 A;  1R4M B;  2UYZ B;  2PEA A;  1K50 A;  1AN8 A;  2VRR B;  1YX6 B;  4GOC A;  1V49 A;  1J7A A;  1NYQ A;  3AE4 B;  4C4V A;  3NOB A;  4MSQ B;  4XDD A;  1HE8 A;  2JZZ A;  1XQQ A;  2INP E;  3Q6B A;  2D5G A;  4RGT A;  2N0S B;  2IY0 B;  1JML A;  2QEJ C;  4FXC A;  4YTN B;  2V0G A;  1CQV A;  3U7D A;  5CHF A;  1VZ7 A;  2J0K A;  1FXT B;  1P98 A;  2M19 A;  2CJN A;  2WXN A;  1V2Y A;  1Q10 A;  2LVQ A;  4L23 A;  4ZYS A;  1CK1 A;  3DBH B;  3EHV A;  2KWV B;  3BY4 B;  4RF1 A;  1RFK A;  1T0Q C;  2WXJ A;  5HKH A;  1HZ5 A;  3LXF A;  2JVC A;  1JWB D;  2IDY A;  4KX6 B;  3NY5 A;  2M8S A;  3NHE B;  1QZE A;  5JZE B;  1SE2 A;  3SFD B;  4YTP B;  1ZGU B;  4W9D A;  4WJO A;  4KVG B;  2KDM A;  4IWP A;  1HZ6 A;  2L7R A;  3Q8E A;  4IWQ A;  1SEB D;  3A33 B;  2AEH A;  2WXF A;  3AM9 A;  4ANW A;  2IYD B;  1PUT A;  4B95 A;  4KV2 A;  2WXQ A;  2Z8L A;  3U4E G;  3SR6 A;  1TIF A;  1A70 A;  3MHZ A;  2KQ4 X;  4HK2 A;  4A3O A;  3ETR A;  3TMP B;  4FAD A;  2QMT A;  4ICU A;  2I1J A;  5BO4 B;  5LXH A;  4RGM A;  1C1Y B;  3QA8 A;  2MP2 B;  4NQK E;  4MGI E;  4RH6 A;  2JU6 X;  2PE9 A;  3K9P B;  1LO5 D;  2LXA A;  3PTF C;  4KKI A;  1SSN A;  2MX2 A;  2N7J A;  1TKG A;  4KDI C;  3RNC C;  3OJ3 A;  2KFK B;  3RD2 A;  2KC2 A;  1ET6 A;  3TEX A;  2GLS A;  4A90 A;  2DHZ A;  1T5X D;  3IAS 1;  2JX5 A;  4IG7 B;  3H7P B;  3APC A;  5J17 A;  3PRZ A;  2GI9 A;  2KAN A;  2ONQ A;  1RWS A;  1P0R A;  2LHD A;  2MP2 A;  1FPY A;  3V61 A;  3PZD A;  3SFE B;  2N7D A;  1HXY D;  2G9H D; 
#chains in the Genus database with same CATH homology
 2KMA A;  2FCQ A;  4IC7 B;  1A5R A;  4AWJ A;  2EMT A;  2AL3 A;  4LCD E;  2BPS A;  5J18 A;  1Q5W B;  1WMH B;  4XX5 A;  2DZJ A;  4IM0 A;  3X23 A;  1C3T A;  4GMV A;  1R4N I;  1E8Z A;  4FJY A;  2MBO A;  5L95 C;  3H9D A;  3R7Q A;  4KSK C;  2CHW A;  5JHA A;  1PQS A;  4MGY E;  5DPT A;  2XEW A;  4EZJ A;  1GUA B;  1WX9 A;  4GDL A;  1RLF A;  2BF8 B;  2NS5 A;  3OJ4 B;  3OLM D;  3EFU A;  4IM3 A;  2W9N A;  2FCS A;  3DVN U;  4K1R B;  3B0A A;  3PRP B;  4GIV A;  3IHP C;  2MBB B;  4A20 A;  1WGD A;  2KLC A;  3N30 A;  3KW5 B;  3VTU A;  4LJO B;  2Z0E B;  2DYM A;  5CX3 A;  2RPQ A;  4KSL C;  4EKU A;  2K8B A;  3H6N A;  3ONS A;  1GG3 A;  3AUL A;  2KO3 A;  3VXW A;  4HDO A;  2LWP A;  4F7Z A;  1UD7 A;  2ZPY A;  4P7I A;  5CHW A;  3QAR A;  4OVU A;  3ZLZ A;  3DVN V;  4EOY A;  3VVW B;  4FHJ A;  5GMV A;  5TR5 A;  1NBF C;  5J2R A;  4NNJ B;  4W9J A;  5DPS A;  1WGY A;  3WAP A;  3V62 A;  1IYF A;  2NBW B;  4PYZ A;  1E5W A;  2C7N B;  1Q1O A;  2K8H A;  1MG8 A;  1WJ4 A;  4MH0 E;  2J7Q B;  3VQI A;  4BKS D;  5LLI A;  1WMH A;  4GU2 A;  1D3Z A;  2LZ6 A;  2ZVN A;  2IO3 B;  4G0N B;  2WX0 A;  4KDL B;  2MCN B;  1KM7 A;  3DBH I;  4IWO A;  1RAX A;  2JT4 B;  3MJW A;  3A9J B;  2GBK A;  5KHQ A;  1F9J A;  3DBS A;  2DX5 B;  4G50 A;  4WJN A;  1WM3 A;  4TUU A;  1V6E A;  1X1M A;  2IY1 B;  1KLV A;  1TTN A;  1UZX B;  1WXS A;  3GOE A;  4IM2 A;  4FN2 A;  3PS6 A;  5IA7 A;  3H1U A;  1OGW A;  3R7R A;  3U8Z A;  4HVB A;  1WM2 A;  4NQL B;  2KD0 A;  3VUX A;  3QJZ A;  4MGK E;  1WJU A;  2DEN B;  4FJZ A;  3ZRF A;  2LGY A;  3QC8 B;  2KC1 A;  3KUD B;  1YQB A;  4ICV A;  2WX1 A;  2WYQ A;  1EO6 A;  3AU5 A;  3PLU A;  3VTV A;  4BKT A;  3RZF A;  5E6N A;  2LD9 A;  4DHZ B;  4EZL A;  2JWZ A;  2OJR A;  1V5O A;  2LVO A;  3VUW A;  2NPT A;  2DAJ A;  3CF6 E;  1LQB A;  2J0J A;  1RFA A;  1V81 A;  3QK0 A;  2B3A A;  2RD0 A;  3APF A;  3DVG X;  4YL8 A;  2MQJ A;  1J19 A;  1YIW A;  2HE7 A;  3AU4 A;  4KIK A;  3SD5 A;  5LXI B;  1OEY J;  3A4S C;  4J6I A;  2IO0 B;  5E6P A;  5C23 A;  2PPH A;  1EF5 A;  1G6J A;  3APD A;  2FID A;  1GNU A;  3EEC A;  4G11 A;  2N9X A;  3A9K A;  2JF5 A;  3ZNZ B;  4W9F A;  3RYT A;  2WDT B;  4HLE A;  2A5U A;  1SGH A;  3QX1 A;  1Q0W B;  2CKH B;  3GZN I;  1TBE A;  2YVC A;  1E90 A;  3DDC B;  2K6Q A;  2I1K A;  2LRW A;  3ZNG C;  4MDK E;  2Z0D B;  3L16 A;  1SE9 A;  1WRD B;  3R66 C;  3TCA A;  4FBJ B;  4PYU A;  3VHT C;  3JYU A;  4AP4 C;  2AL6 A;  3WAM A;  2FAZ A;  2KJR A;  2KMC A;  4HDQ A;  4DDI D;  2LXC A;  2BWE S;  2HTH A;  3OAW A;  3RT3 B;  3VAW A;  3W1Y A;  3VFK A;  1J8C A;  3ZUN A;  2DZM A;  2LGD A;  2PE6 B;  4ANU A;  2JXX A;  4NAW B;  4IW0 A;  4MEM A;  4AJW A;  1GC7 A;  4BKS A;  1OQY A;  4G3X B;  2LGX A;  4W9C A;  1KOT A;  2K39 A;  4AJY B;  2D3G A;  3R3M A;  2L0T A;  2FNJ B;  2KX0 A;  4ZDV A;  2D2Q A;  2G4S A;  4BOS C;  2MWS B;  2M4N A;  1WGG A;  3DCG A;  4ZRK A;  2KNB A;  1R4M I;  4WWN A;  3Q3J A;  4XZ4 A;  2O6V D;  3ZDT A;  2NBU A;  4II2 B;  2KTR B;  1V86 A;  1Z5S B;  2KJH B;  4K7U A;  4EZK A;  1P3Q U;  3LJ3 A;  4FA6 A;  1J0G A;  5D7G A;  5D6J B;  2QHO A;  3M63 B;  4K7W A;  3UIO B;  1RRB A;  1WXA A;  2KK8 A;  2V4L A;  2MRP A;  2KFK A;  3VH4 B;  5AZF A;  2A4Z A;  1LFD A;  2XBB C;  4TV3 A;  5JH5 C;  3WA0 A;  1S3S G;  4ASW C;  5EDS A;  3H7P A;  1WX8 A;  1WR1 A;  2GBM A;  1WJN A;  3PRE A;  3VTW A;  1CMX B;  1VCB A;  2GBR A;  3QIJ A;  1YX5 B;  4WWP A;  5D94 A;  3V60 A;  4W9K A;  2LJ5 A;  3I3T B;  4ZYN A;  3W1S C;  5KHO A;  3L0W B;  3IG3 A;  5C1Z A;  1H8C A;  3UQB A;  4GN1 A;  2R2O A;  1V80 A;  3A4R A;  3NS8 A;  3KYD D;  3ZRC A;  4TQ0 A;  2KTR A;  2M1M A;  2KDB A;  3RUI B;  3VDZ A;  2ZCB A;  4HPL B;  2N4F A;  1Z2M A;  2OOB B;  3DPD A;  3DBL I;  3ZIM A;  2N9P C;  1AAR A;  2XK5 B;  3M95 A;  4TQ1 A;  4WJQ A;  3DBR I;  3PT2 B;  2V1Y A;  4F1S A;  4I6P A;  5L83 A;  1P1A A;  1L2N A;  1UGM A;  2O6V B;  2KQ7 A;  3X0W A;  2ASQ A;  4BVU C;  1NDD A;  3P2B A;  4WWO A;  1S1Q B;  2REX A;  3CMM B;  4HXD A;  1E8Y A;  2MSE D;  3KUC B;  3QCA A;  4HJK A;  4EEW A;  3JSV B;  3HK0 A;  1XT9 B;  3M3J A;  4IUM B;  4DDG D;  2WWZ A;  1T0Y A;  4MJS B;  5AZG A;  2L0F A;  4CO7 A;  2C7M B;  3T9L A;  4F8C B;  1IPG A;  3HHM A;  3RUL A;  2GBN A;  2NR2 A;  1YJ1 A;  4KZ0 A;  3N3K B;  5D2M B;  3PRM B;  2CU1 A;  2JUO A;  2BWF A;  4RMA A;  2EKE C;  3QQ8 B;  2KVR A;  4GDK B;  2N7E A;  2XK5 A;  2L76 A;  3A9J A;  2MBH A;  2L8J A;  1L7Y A;  2GBJ A;  2RSU A;  4X57 B;  3H7S A;  2IZV B;  4EUT A;  3ZW3 A;  2O6V A;  4RM9 A;  3SU8 X;  2BKF A;  3WAO A;  1WXM A;  3ML9 A;  4WQO B;  2EMS A;  3ZTD A;  2KWU B;  3JVZ X;  5FR6 A;  3KUZ A;  3HIZ A;  4EFO A;  3BIN A;  3DOW A;  3L10 B;  2BYE A;  3W1S A;  1Y8R C;  4NPN A;  4M8M A;  3ALB A;  4I6N B;  1H4R A;  3S2A A;  4MSM B;  4FUL A;  2ZVO A;  1OEY A;  3ZTC A;  4W9H A;  1ZW7 A;  2ZJD A;  2L3Z A;  2KDE B;  3V6E B;  1WGH A;  3ZDM C;  2K6D B;  3CSF A;  2KX3 A;  4HCP B;  4MM3 A;  4AOF A;  5AZH A;  4DHZ E;  2N9E B;  2BYF A;  2L05 A;  1V5T A;  1M94 A;  4II3 B;  3V6C B;  4DHJ D;  2IO2 B;  3QAQ A;  1LM8 B;  1WGR A;  2AWT A;  3PGE A;  5G55 A;  4HCN B;  4XC2 A;  3VH3 B;  2R2Q A;  3A1Q B;  2DAF A;  4M0W B;  4FHK A;  2O2V B;  3O65 B;  2G45 B;  2GMI C;  4CHK A;  2D11 A;  5DPR A;  1P9D U;  4JQW C;  2C60 A;  4E71 A;  3KVF B;  3PV1 A;  2KDI A;  1SIF A;  2MLB A;  2K8C A;  1WXV A;  5DPW A;  4ZRJ A;  1WE7 A;  4GSW A;  2KLG A;  3L17 A;  2CHZ A;  4ANX A;  3WAL A;  3ZKJ C;  4GDL B;  3PPA A;  1V9J A;  3TL5 A;  4GB9 A;  3QHT A;  5JHB A;  3LDZ E;  4PS8 A;  2G3Q B;  1WF9 A;  2IO1 B;  3L13 A;  3MHS D;  3IFW B;  2DZI A;  4JL9 A;  4AUQ C;  3UF8 A;  3KYC D;  4FAD A;  3TIX A;  3ZNH B;  5G2N A;  2FUH B;  5LXH A;  2KQS A;  1LXD A;  2MBE A;  2Y5B B;  1K8R B;  2KFJ A;  3C0R B;  1GC6 A;  2JZ3 B;  4MEL A;  4URK A;  3A1Q A;  4NAW A;  3B08 A;  2UYZ B;  2O2V A;  2LVP A;  2PEA A;  4DXA B;  3PHW B;  2VRR B;  1XD3 B;  1YX6 B;  4GOC A;  3EC8 A;  3VUY A;  1V49 A;  2CHX A;  4GXB A;  4HPM B;  1WZ3 A;  4W9E A;  1OTR B;  2LRU A;  3L54 A;  4E3C A;  3TBL D;  3QWZ B;  3B1L X;  1WH3 A;  4DWF A;  2DYO A;  3NZS A;  4DHJ B;  3NOB A;  4DBG A;  3UQA A;  2ZPN A;  4LDT B;  1WR6 E;  2MW5 A;  4MSQ B;  2JRH A;  1HE8 A;  2M17 A;  2N1W A;  2JZZ A;  1XQQ A;  3HM6 X;  3SHQ A;  1WIA A;  2HD5 B;  2IY0 B;  3D32 A;  2D07 B;  3K9O B;  1NI2 A;  2K25 A;  4M8N A;  3IVF A;  2IBI B;  3PSE B;  3U7D A;  5CHF A;  1WYW B;  2J0K A;  1EUV B;  1FXT B;  1I35 A;  3U30 A;  2JY6 A;  2FCM A;  1P98 A;  1TZ1 A;  4NJ7 A;  1EF1 A;  1V2Y A;  2NCN A;  2ZNV B;  2KN5 A;  5AEK B;  1JRU A;  3Q3F A;  3MTN B;  2NVU I;  2KTF A;  1UH6 A;  2CR5 A;  5IAA C;  4BFR A;  3N32 A;  2LVQ A;  4JLC A;  3DVG Y;  2G4D B;  2K1F A;  1WE6 A;  5CHV C;  3EHV A;  5DCN A;  2KWV B;  2NPT B;  3BY4 B;  4RM8 A;  2MBQ A;  4PS3 A;  4BOZ B;  5HKH A;  2YLM A;  2KWC A;  1ISN A;  1I42 A;  2V3S A;  4I6L B;  4KIK B;  4LJP B;  2JVC A;  3PVL A;  2LAS A;  3TJP A;  3NY5 A;  2M8S A;  1E7V A;  2LUE A;  1ZKH A;  3NHE B;  1QZE A;  5JZE B;  3A9K B;  3UIN B;  1E8W A;  4ZRI A;  4KZC A;  2CS4 A;  2D10 A;  1WX7 A;  3JW0 X;  1WI0 A;  2GOW A;  4B9K A;  1ZGU B;  4W9D A;  3ZNI D;  1BT0 A;  2L00 B;  4KVG B;  4IWP A;  4WJO A;  2L7R A;  4A3P A;  3RCZ A;  3AXC A;  3UGB B;  2J0M A;  3M62 B;  4ANV A;  2KJ6 A;  3ECI A;  4IWQ A;  3CST A;  3JSV A;  2RR9 A;  3A33 B;  1E7U A;  2RGF A;  2PJH A;  2AEH A;  3ENE A;  4MJS A;  4ANW A;  2ZZP B;  1UBQ A;  2IYD B;  3T8M A;  4NJ6 A;  4B95 A;  2JPH A;  4WAA A;  4KV2 A;  2LI5 A;  3WAN A;  1IP9 A;  3L08 A;  2KHW B;  1TGZ B;  3AI5 A;  2M0X A;  4WJP A;  4GDK A;  3ML8 A;  3PHX B;  4MGZ E;  4PS7 A;  2NBV B;  4HK2 A;  3PLV A;  4LDT D;  3IBE A;  4A3O A;  4DK5 A;  3ZVV A;  3TMP B;  2JRI B;  4BBN C;  2KZR A;  3UIP B;  2UWQ A;  1VD2 A;  2I1J A;  1KJT A;  4ICU A;  1YD8 U;  5BO4 B;  1C1Y B;  4JGH B;  4BKG A;  3QA8 A;  2MP2 B;  4NQK E;  4MGI E;  2FIF A;  2PE9 A;  5CTR C;  3K9P B;  4BBN F;  3PTF C;  2LXA A;  1UBI A;  4CYE A;  1WFY A;  4HWI B;  2ZCC A;  2ZEQ A;  3RZW C;  2FCN A;  2HJ8 A;  4K7S A;  4NY0 A;  1WY8 A;  1E8X A;  2MX2 A;  2KDF B;  1GJZ A;  2N1V A;  4GGQ A;  4K81 A;  4KDI C;  2BGF A;  2KOX A;  2C5L C;  2BYV E;  3HM3 A;  3OJ3 A;  2KFK B;  3RD2 A;  2DZK A;  3NZU A;  2KC2 A;  1UEL A;  4FLH A;  4OVV A;  2BKR B;  4W9L A;  4FJV B;  3DQV A;  2C9W B;  2DHZ A;  2KXJ A;  1U4A A;  4IG7 B;  3H7P B;  4W9I A;  4JIO U;  1WJ6 A;  4TKN A;  1WZ0 A;  2MA9 B;  3APC A;  2C7H A;  2DYB A;  3WIM A;  3ZO5 B;  5J17 A;  3PRZ A;  4N9F 4;  2KAN A;  2AYO B;  3KH0 A;  5E6O A;  1P0R A;  2N7D A;  2MP2 A;  2ZNV C;  3V61 A;  3PZD A;  4B6W A;  2KKC A;  4W9G A;  3SDL C;  4E74 A;  2Z59 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...