1YNTE

Structure of the monomeric form of t. gondii sag1 surface antigen bound to a human fab
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
b'EVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYADLLAKVNGEYTADLEDGGNHMNIKFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4F11E12 Fab variable light chain region
publication title Crystal structure of the complex between the monomeric form of Toxoplasma gondii surface antigen 1 (SAG1) and a monoclonal antibody that mimics the human immune response
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 9
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2005-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yntE00
1IBXA 2KWDA 2J53A 1D4BA 1PGAA 2LUMA 2KACA 2ONQA 2LHDA 4KGRA 1UWXA 1IBXB 2JZPA 1EM7A 1HZ6A 1P7FA 1IGCA 4WH4A 4OZBA 2PW9A 1XCQL 2PLPA 2IGDA 1FCCC 2JXTA 2KN4A 2JSVX 5HHDG 5BMHA 1MPEA 1YNTE 2JU6X 2JWUA 4OZAA 2EELA 2LHEA 4HJGE 1F2RI 2N7JA 2N9KA 2PTLA 2J52A 5HFYA 1K50A 1JMLA 2K0PA 1KH0A 2QMTA 4HKZE 1PGXA 2LGIA 5HG2A 1F2RC 1HZ5A 1IGDA 1MHHE 3GB1A 5BMGA 1QKZA 3MP9A 1MHXA 3FILA 5HI1A 1K51A 2NMQA 2IGHA 4D2KA 2GB1A 2ON8A 4OZCA 1XF5L 5JXVA 1MI0A 1Q10A 2IGGA 2KQ4X 2ZW0A 3FILB 4KGTA 2KDMA 1XCTL 2I38A 5BMIA 2GI9A 3UI3A 1P7EA 2RMMA 2OEDA 2ZW1A 1GB1A 1GB4A 4GLSC 2I2YA 4IOIE 1PGBA 1MVKA 1K53A 1FD6A 1FCLA 1K52A 1HEZE 2RPVA 1ZXHA 3V3XA 2N9LA 4MACA 1YMHE 1C9FA 4IKGA 4KGSA 2QSDA
chains in the Genus database with same CATH superfamily
2Q5WD 4JL9A 2G4SA 3PRPB 2LUEA 1T0QC 1TJEA 4L2YA 4ANWA 1ROEA 1XLNA 1C3TA 4NY0A 5IP4D 1E5WA 2BW2A 3AU4A 1I7HA 5AUKA 5L95C 4W9FA 4GIVA 1FM0D 4ZHPA 4HXDA 1YQ4B 2WXLA 3KWLA 3MJWA 4FHJA 3ZNID 2KWVB 3MC8A 2AQ3B 4OZAA 3VUXA 4QAYA 1WRIA 2BWES 3U52E 3HM6X 1ESFA 1YN4A 4FN2A 1WJ6A 3RNGC 1I4HA 1WGRA 3PSEB 5C2TB 3SU8X 1FRRA 1V97A 4HKZE 2D5GA 3JYUA 3IFWB 4DXAB 4AOFA 4IC7B 3H7PB 3RCZA 2NPTA 1WXVA 5G2NA 4XWWA 1L4DB 2LASA 1SXTA 4WJPA 1GNUA 4HPPA 3DDCB 5LLIA 4IG7B 4ACFA 3ZRFA 3V6EB 3IVFA 4TKNA 2ZEQA 2R2OA 3VRAB 5KHQA 2FUG1 2I38A 5BMIA 3RNCC 2KMMA 4DXFA 1ZPSA 2QIEB 1FMAD 2IBIB 1AYFA 3PHXB 4L1BA 2LD9A 3QX1A 3EFUA 1TS4A 4IW0A 1YOVB 4W9IA 1GC6A 3CSTA 2LGXA 2RPVA 4YTMB 4JX1C 1STEA 4EKUA 2C7NB 1OFFA 4JQWC 2AQ1B 4P1BC 2HTHA 3N1ZC 2QSDA 4C4VA 1J7CA 2INPE 3V05A 2PPHA 2CHZA 4GU2A 2KOXA 4P16A 5D7GA 4IDIA 4FHKA 1EWCA 4G11A 1L2NA 4ARIA 2L05A 4GGQA 3U4EG 5KHOA 4HROA 2MP2B 4W9JA 2PVOD 1TBEA 1K8RB 2CHWA 3V62A 1YNTE 1WGYA 2NS5A 2GBKA 1YD8U 3NY5A 4IWQA 5MPOA 2L0FA 3V61A 3M63B 1WY8A 1L7YA 3VTWA 2PMVA 3KWVA 4ZRKA 3RT3B 5AEKB 3QK0A 4RCOA 2CJNA 2C7MB 4XE0A 5HG2A 4NPNA 1XD3B 1QT9A 4A55A 1MHHE 3U8ZA 4HCPB 3ZRCA 2MBQA 2W3SA 1SE3A 2IGGA 2YVCA 1V86A 2M56B 3NOBA 2FBWB 4O1NA 3DBHI 2IZVB 3L0WB 3VH3B 2DHZA 4I6PA 1K53A 1FCLA 1QOGA 3R7QA 2KJRA 2KDBA 4XGAB 2CR5A 2NTTA 4GOCA 4FA6A 3A4RA 4AJYB 1N5XA 1UBIA 3I9V1 3O13A 2V3SA 1EM7A 3WANA 4GSWA 2O6VD 2DX5B 2LI5A 2R2QA 1BMLC 2N9XA 2KVRA 1FFVA 1SF0A 4KSKC 1FCCC 4GDKB 4II2B 2G1EA 1OTRB 2J7QB 2QILA 2LFIA 2JRHA 2J4XA 2KWUB 1E9MA 2KFKA 1QOAA 2IPKD 3MTNB 1D5ZC 4XC2A 3ZLZA 4DDGD 2VZKD 1VZ8A 1Q5WB 3QARA 1NI2A 2BQQA 1V5OA 4OVVA 4LJPB 1ET6A 2VZKB 1UF0A 1NEKB 3MP9A 4JLCA 1M94A 2AYOB 4LNNA 3GE8C 3K9PB 2LVQA 4D2KA 2ON8A 3R2TA 2L52A 2WXRA 2N1VA 3AV8A 4ZDVA 2LVPA 4HDOA 4NZLB 3ZQ4A 2MW5A 1I4GA 3RUIB 4A3OA 3HVDA 2KJHB 2YEPF 4ICUA 3AI5A 1J8CA 4MH8A 1KTKA 3PZ7A 4LNOA 2CU3A 3B2FA 3RPFC 2N4FA 1CZPA 3L13A 4GMVA 4NAWA 3L17A 4DHJB 2KVZA 3CF6E 3IG3A 2INNE 2LHDA 1FIQA 2MBBB 4LNFA 4W9CA 5I4DA 1IGCA 2CU1A 2LWPA 3CWIA 2B3AA 3U2SC 2DYBA 2QDFA 2BS4B 3QCAA 3X0WA 2DYMA 4RGOS 4C80A 1PFDA 2DBYA 3VUYA 2INDC 1Y8RC 2M4NA 4JIOU 4S0RA 2EELA 2KZRA 2OJWA 3DBRB 3L10B 1A5RA 4BVUC 2O2VB 3LXFA 2BYVE 4KKIA 3AB5A 2EMSA 4LK0M 3PREA 3OWEB 1J7BA 2LGIA 2LGYA 3B9JA 3P42A 1DOYA 3W1YA 3ETRA 3TJPA 3MC9A 4TV3A 3P4PB 2KMCA 3UGBB 4LCDE 1TIFA 4L23A 3E9SA 4NQKE 4YSXB 2KTFA 3N20C 3GP7A 3EC8A 2CHXA 1P7EA 1ZKHA 4N9F4 4G0NB 4BKSA 4FADA 2XN9C 1T0SC 1H4RA 3B1LX 1R4NB 2L00B 4UDUC 2KO3A 3EECA 3V6CB 2VRRB 2FCMA 3W9CB 2WQYB 5E6NA 4DXGA 5C1ZA 4MGIE 3Q3JA 1H8CA 3SEBA 4H2AA 1C76A 4GDLA 1PGAA 3TBLD 2KACA 2IJ0A 2C60A 4BZAA 4MT5A 2BYFA 4M8NA 3KUCB 2DAJA 2HDEA 1P0RA 2WX1A 4MEMA 3IAM1 2B76B 2KANA 4IM0A 1DOIA 1V6EA 3P63A 3RULA 4AUQC 4MDKE 4NJ7A 3HK0A 2N7DA 2JSVX 1RWSA 1ZE3D 1VDVA 3UIOB 1XT9B 2LRWA 2JU6X 1LXDA 3TEWA 4PYUA 3DBLB 2N7EA 2VH2A 3AULA 2NPTB 3AEBB 3W1SC 5E6PA 2K8BA 2WXKA 4HEA1 3Q8CA 2VH1A 1JMLA 1JWAD 4K3CA 4NAMA 2GMIC 3IBEA 2BKFA 2Y3AA 2Y5BB 1FXTB 2WNMA 5JHBA 1NBFC 3QWZB 1WWTA 3BIID 4HJKA 1SE4A 1F2RC 3RNBC 3ZKJC 4DHZE 1NENB 3DWMA 3Q2AC 4NJ6A 4CQNA 3T8MA 4M0WB 4AQ7A 2QHOA 4MSMB 4DDID 2KDMA 3ENEA 4XWTA 2EKIA 2AQ2B 5GMVA 3ECIA 3DWGC 2RMMA 4XX5A 1JCKB 1IPGA 3PTFC 3HRDD 2KC1A 1YJIA 1TS5A 2LGDA 3R2IA 1RFKA 4WQMA 1OQRA 2MJ3A 2PIAA 1I35A 4A3PA 3N32A 1V1PA 4HKQA 3WAMA 4KGSA 2KT7A 5EDSA 2WP9B 1R4MB 1F1HA 2LEKA 3OJ3A 4C00A 1HTQA 1WFYA 3E56A 1I4QA 3PZ8A 3GOEA 2KJ6A 2JZ3B 3QHTA 2NR2A 1DOXA 3ZTCA 2REXA 2DZMA 2WDQB 4BAXA 2JZZA 2IO0B 2XBBC 2DYOA 3WAPA 1GPXA 4MM3B 2K39A 1WE7A 4A90A 5D3DA 2V0GA 3NS8A 4R3DA 4DBGA 2D07B 1SB3C 4IWPA 1SIFA 5BMHA 1GAQB 3CMMB 2AX5A 1ZUD2 1D6EC 2FNJB 1KJTA 4N58A 1F2RI 5D2MB 1HE8A 2GBRA 5BO4B 3PS6A 3BK2A 1NVID 4HPLB 3Q14C 3Q3NC 4KDIC 2L83A 1MG8A 4N59A 2PJHA 3ZNGC 1GC7A 1LGRA 5CX3A 1PQSA 2BS2B 1ZDVA 5DPWA 2MA9B 4OZCA 1WJUA 4RM8A 2DZJA 2E6XA 2BBCA 1Z2MA 3H8HA 3NUHB 2GI9A 3AE2B 1WSPA 3UI3A 2WX0A 1L6VA 4PK1A 4YSZB 2E3TA 3OLMD 4RF1A 1YQ3B 4K7SA 3SDLC 1PDXA 4TQ0A 1L0VB 1UGJA 1JWSD 3GS2A 3DBSA 3ML9A 2K6QA 2Z59B 4J3OD 1SGHA 1ZXHA 4XYCA 2XNAC 3LDZE 3N3KB 2J53A 2N1WA 1CQVA 2KKCA 5FR3A 4KGRA 1BT0A 3DBRI 4NQLB 1IBXB 4ANVA 5J2RA 5C3JB 3P2BA 4DQOC 4RH6A 4US8A 2RDHA 1YJ1A 1ENFA 2JXTA 2PE9A 2WDRB 4YT0B 1G6JA 3T9LA 1D3ZA 1B1ZA 1WF9A 1MG4A 2C9WB 4RGNA 1WMHA 3ZJVA 1I4PA 2MSED 3ZUNA 1T3QA 3MHSD 1K50A 4IM2A 4ANUA 2SAKA 1DGJA 1TZOA 4G50A 3QJZA 2WXQA 4KV2A 4K3BA 4KVGB 2K3UA 1GG3A 5D6JB 2OHFA 2N9PC 3M95A 2IYDB 2PKOA 3I5JC 2KTRA 1T5XD 4X57B 1VD2A 5LXHA 1QOFA 4B9KA 4ZYSA 4YTPB 3AEGB 5IO9A 5JXVA 1MI0A 2LXAA 1JWMD 3TL5A 3VR9B 2NVUI 2IY1B 4FJVB 4C7YA 4YTNB 1M4VA 2WLBA 2D3GA 3ML8A 1EF5A 4MGZE 3Q69A 3VAWA 1E90A 2DWQA 4IOIE 4M00A 1C79A 4LLGM 4B6WA 2KN5A 1UNSA 4CYEA 3QQ8B 2LGSA 3P4SB 2MQJA 3HIZA 2N9LA 4MACA 1YMHE 4JPSA 3A9KB 2WDVB 3BVMA 3QIJA 3UF8A 1FNUA 2JVCA 2MJDA 3LJ3A 5IN7A 3CIRB 1AARA 1KRHA 4WWNA 4EOYA 4ARCA 5LNK1 2PVGC 2Y5CA 3ZNHB 2FE8A 2FCQA 3VUWA 3U30A 2K1FA 1FNWA 1WGDA 5DPTA 2N0SB 2WXNA 2IO2B 2YLMA 1VLBA 3N9YC 4KSLC 1JROA 1IP9A 3VQIA 1VJKA 2NBWB 1CJEA 2NCNA 4LJOB 4RF0A 1XEEA 3JSVB 3NJTA 3H7PA 4PS8A 3EUB2 3KVFB 2C7HA 3QAQA 1EU3A 3Q8AA 2KNBA 2WGSA 3ZDMC 1C4PA 1IGDA 2JWZA 3Q8EA 5CTRC 4M01A 1V5TA 3R7RA 2Y5PA 3SD5A 1SJED 2L3ZA 3NZ3A 3GZNI 3DVGX 4Q2JA 5TR5A 1WGHA 4PS3A 4GB9A 4EFOA 3B08A 1T0RC 2MX2A 3FILB 2ZW0A 4US9A 1XCTL 1TKGA 4OW0A 2HJ1A 1E7UA 3AE5B 3D32A 3DQVA 2NBUA 1R4MI 2BPSA 4G3XB 4ZRIA 2I2YA 1N62A 1XLPA 4KIKB 4RFBA 4B0EA 3VTVA 1HTOA 2LMCA 2LZ6A 2MHJA 4TQ1A 1JW9D 1OQQA 2J0MA 3APDA 2WS3B 2EMTA 4TUUA 3PLUA 2LXCA 2WDTB 1WM2A 2K8HA 1I4RA 2KWDA 3AXCA 5T8IA 2DZIA 1PYWD 5BYRA 3ZW3A 2Z0DB 1EU4A 5EE3A 1Q0WB 3NVWA 3OAWA 4DHJD 3QA8A 2JRIB 3BY4B 4WWOA 2PLPA 1RFAA 4KZCA 4A9AA 4RNAA 1NI3A 1KLUD 2BF8B 4EZLA 1F0ZA 3NZUA 4M02A 1JQ4A 4KX6B 4WJOA 1HXYD 3Q8BA 3HUIA 1V49A 2N7JA 2I1KA 1WRDB 1YJJA 3VRBB 1WR1A 3AEEB 1KH0A 3VVWB 4MJSB 4KKJA 1PGXA 3LYYA 2RSUA 5L83A 1HZ5A 2UWQA 3GB1A 3H7SA 2AL6A 4RMAA 1E8XA 3WAOA 4YXDB 3AE4B 1IYFA 3B2GA 1FXIA 2ZPYA 1A70A 1ZP0B 2GB1A 4XZ4A 1T6BX 2JT4B 1LO5D 1TY0A 2KAJA 2CKHB 4JWSC 1V1PB 4PT5A 3BYTB 4GLSC 1EUVB 1JWBD 2ZNVB 4EE2A 1MVKA 3TMPB 3NRZA 3Q3FA 3PHWB 1K52A 4HRSA 4ZHOA 4OHJA 1WI0A 4JGHB 5EE0A 3IAS1 2LVOA 1WXQA 4FJZA 2QEJC 1WX8A 4E74A 3AEFB 3PPAA 1UWXA 1WE6A 1FXAA 4BOSC 4FXCA 3TSSA 1XXGA 2BWFA 2JQRB 3A1QA 3ZNZB 2IGDA 2FIFA 1NYQA 2HTME 5IAAC 3AE7B 2O6VA 2OOBB 3L4PA 2MBOA 3WCQA 5IA7A 2K6DB 3RYTA 1MPEA 4BBNC 4A6QA 1EO6A 3PV1A 5JZEB 5AZFA 2V4LA 3W1SA 1WGGA 2G4DB 3TEZA 2N9KA 2G9HD 2ICIA 2KQSA 5G55A 1AWDA 1QLBB 1ACCA 2G45B 2V9HA 3GE3C 2JF5A 1TS2A 1WXMA 2RDBC 3A9JA 1DYQA 4W9HA 1C1YB 4GXBA 4MELA 2WXOA 1LQBA 2BT6A 2DLBA 2W82A 5EE1A 3ALBA 2L1AA 1TGZB 1GOZA 1AW7A 3NVZA 4IM3A 3DHIC 4ASWC 2BB5A 1I4XA 3AH7A 1C4AA 3N1YC 4S17A 4EEWA 2KQ4X 1VZ6A 2K25A 3VDZA 2JYEA 4MGKE 3NS1A 1WXSA 3WIMA 1TKYA 2KQ7A 4J6IA 3KYCD 3DBHB 1GB4A 5JH5C 3RI7C 3H1UA 3KW5B 3VFKA 1KLGD 3HHMA 3FC4A 3HM3A 1JRUA 4LNKA 1UZXB 3U7DA 2FAZA 4GN1A 3BVZA 4WWPA 3W5UB 3MHZA 3UQAA 5DPRA 3ZYYX 4OVZA 1SEBD 4II3B 3SFEB 3ZTDA 4C4VB 3ONSA 4LTUA 3V60A 2D11A 4ZRJA 2WWZA 3R66C 3SR6A 5J18A 3URYA 5BYQA 1FRDA 1TY2A 1E0ZA 3X23A 4HK2A 1JWUD 5BYSA 1RYJA 2IO3B 3BWUD 2O2VA 5AZGA 3PT2B 2V1YA 1FPYA 1QILA 3UINB 2TSSA 1N5WA 3ZVVA 3KYDD 1WXAA 2KDEB 3TUOA 3W5VB 1KLVA 4WJQA 1VCBA 4F1SA 4CHKA 1V2YA 5CHVC 1UELA 4ZRQA 1WYGA 1K51A 2KYWA 1RAXA 2Z0EB 2FIDA 3NZSA 1D5XC 3VXWA 1WX7A 1XF5L 3JW0X 4KZ0A 2J42A 1RLFA 4W9GA 2L7RA 1WZ0A 2XEWA 3A33B 4BKTA 2KLGA 2ZNVC 3MC0B 3T3OA 3TEXA 3P4QB 2KX3A 3RN9C 4ZRPA 1PGBA 3PRMB 1MJDA 3DVNU 2ACZB 3R8BA 3PZDA 1TS3A 4HPMB 3RNEC 3DVNV 3P4RB 4NNJB 1T0YA 2K22A 1V1OA 2IY0B 1D4BA 4E71A 1L4ZB 3TIXA 1HZ6A 4REZA 3NG0A 4WH4A 5E6JA 4P7IA 4W9KA 4FULA 1E8WA 4HWIB 3Q6BA 2BKRB 2MH7A 2L76A 2KN4A 2PEAA 1NYRA 2H89B 2RPQA 3M3JA 1ZDXA 4WJNA 3BYYB 3AEAB 3O65B 1SBBB 2WXGA 2K5PA 5H92C 1WYWB 2N9EB 2UU7A 2KFKB 1SSNA 3RNFC 2LRUA 2QC8A 3AEDB 2KLCA 1C77A 5FKAC 2L8JA 5GXGB 2FCSA 4A8XC 4AP4C 1SE2A 4M0WA 1QKZA 3AM9A 2KDFB 3ZJTA 3RNAC 1MHXA 3UQBA 1UBQA 3R3MA 1YQBA 1KOTA 2KXJA 1QQRA 4YL8A 2LJIA 4P1CC 1N60A 2GBNA 3EGRA 3JVZX 1E7VA 5DCNA 4TMAB 4WQOB 1WX9A 2J0KA 3ZIMA 1XLQA 2CJOA 2XK5A 1BXTA 1R4NI 5TSSA 3I3TB 5E6OA 3OG5A 2OJRA 1OQYA 2WXJA 3RZFA 1NDDA 3PRZA 1HEZE 1L0XB 2M8SA 3IHPC 2R61A 2D3CA 3Q8FA 2YEPB 4M8MA 1YX6B 1V9JA 5C23A 4IKGA 1EWYC 5DPSA 4AWJA 2KHWB 2NBVB 1S3SG 3Q3MC 5IKCM 4K7UA 3AE8B 3C8YA 2LUMA 1QF6A 1FEHA 1E10A 3Q3OC 2BB6A 2JPHA 3AE1B 2DAFA 4BOZB 1TYGB 4NAWB 3C19A 4MM3A 5EE9A 1P7FA 3SFDB 1LFDA 1FNVA 2WXIA 3N30A 3MFGA 1XCQL 1YX5B 2GRIA 2D10A 2L0TA 1E7PB 3RD2A 4AJWA 3AN1A 3L54A 1UUPA 3A4SC 2JUOA 3CSFA 4F7ZA 1WH3A 2LHEA 2WXPA 2FUHB 3L08A 1ZXIA 2KFJA 5G5GA 5AZHA 3IXSA 3RFZB 2INCC 2MBHA 3DBLI 4F8CB 5D3IB 3DOWA 2BS3B 3TEYA 1WJNA 4P6VF 1KM7A 2WU5B 2IO1B 2M0XA 1VZ7A 1P98A 1QOBA 5HI1A 3N1XC 1SJHD 2DZKA 2IGHA 1L0YB 2MJEA 1JRPA 3VH4B 1WM3A 4BKSD 2QJLA 3ZDTA 4XDDA 1WZ3A 1WIAA 1TTNA 2ZW1A 1GB1A 4W9DA 3AMZA 3B0AA 2W54A 2ASQA 3FAHA 1UH6A 3ZGZA 3I63C 4DK5A 1FO4A 1I42A 1CK1A 4DHZB 2WU2B 4BKGA 1HQRD 1P1AA 1SE9A 2KDIA 4LNIA 4EZJA 3A1QB 1WGKA 1C9FA 1KFYB 3C0RB 3NVYA 3EHVA 1IBXA 1YIWA 2O6VB 5AUIA 1WR6E 2BYEA 2WXFA 4RGTA 2ZZPB 4K7WA 1F77A 3AU5A 4GDLB 3ZJUA 3I57A 3S2AA 2RDGA 4OZBA 1C4CA 1R7SA 1IUEA 3ZO5B 2MLBA 5H8YE 1TZ1A 2JYTA 3L16A 3AE9B 3A9JB 2FCNA 2W3RA 2AWTA 1YN3A 4URKA 2M19A 3IT4B 4HJGE 2V3PA 1S1QB 2MP2A 2GLSA 2PTLA 3OJ4B 1HA5A 5HFYA 4ICVA 2A4ZA 2BVCA 4BFRA 2K0PA 2X38A 2BGFA 2MRPA 2JX5A 2JXXA 4CO7A 4PS7A 3W2DA 3H9DA 1VRAB 4K81A 1N6ZA 3VR8B 4B95A 1UD7A 3DPDA 2KWCA 2NMQA 3RZWC 4MGYE 2A5UA 4N6EB 2KK8A 4YWGG 2J0JA 2ZVOA 4ITKA 4KGTA 4I6LB 1BUIC 3AECB 3EFCA 1ET9A 2RGFA 3NVVA 3IT6B 1VR9A 4IUMB 2MCNB 2M1MA 3DHHC 2EKEC 2HJ8A 3DVGY 4YSYB 2ZJDA 1D5MC 3A9KA 3DHGC 3FKYA 1X1MA 2RR9A 2WHIA 5G5HA 2KMAA 3ZXVA 2K9XA 3VTUA 3WALA 2ONQA 1J7AA 2I1JA 2W55A 3AE3B 2ZCBA 4WAAA 1QZEA 2M0AA 3H6NA 4ZYNA 1Y56A 1LM8B 4HCNB 3NHEB 1E8YA 2H88B 4C56C 2D3BA 5HHDG 1RM6C 4BBNF 3SHQA 4B0MA 3K9OB 2KD0A 1P9DU 4RGMA 2JWUA 4I6NB 3KH0A 3KLSX 4JE3B 3U7ZA 2LJ5A 2RD0A 3JSVA 2D3AA 4K1RB 1P3QU 2J52A 4GDKA 2KC2A 3PVLA 4WAFA 4AS1A 1GUAB 4KDLB 2W9NA 3BVGA 2QMTA 1GJZA 5IOIA 4WIPA 2Z8LA 3WA0A 4MH0E 4C7ZA 2BTEA 1U4AA 2QCZA 3LB8C 1FFUA 3FILA 1L5PA 5CHFA 1V8CA 2L32A 4WWMA 1Q10A 3ZXRA 3RMKC 1ISNA 3M62B 4LDTD 1UGMA 3BK1A 2K8CA 4HVBA 1TT5B 4KIKA 2GBMA 3P1MA 1OEYA 2GOWA 1OGWA 1ZGUB 1C78A 3KQ4A 5J17A 4HDQA 4LDTB 2G3QB 3HVZA 1FD6A 1N63A 2WYQA 3UIPB 2IDYA 3V3XA 1ZW7A 5D94A 1Q1OA 2D2QA 2V3NA 4W9LA 4TSSA 2C5LC 3BZDB 4ZOHC 1OEYJ 2PE6B 4ANXA 2JZPA 3MJ5A 1ZOYB 4W9EA 5LXIB 2PW9A 1EF1A 4USAA 1TKEA 1XLOA 3QC8B 4PYZA 3AE6B 2HE7A 1F52A 4EZKA 1J0GA 5FK9C 4DWFA 2ZPNA 1RRBA 1PUTA 1N61A 1B9RA 1Z5SB 2ZVNA 1MFWA 2M17A 4MJSA 2X8XX 1XO3A 2HD5B 3T3NA 1WMHB 1XQQA 2SEBD 4EUTA 2WXHA 5CHWA 3BINA 2NTSA 3KUDB 4JWUC 3PGEA 2CS4A 1SIJA 2AL3A 4XDCA 3ABVB 2ZCCA 2KX0A 2AEHA 3APFA 1J19A 4FLHA 1WJ4A 5BMGA 2DENB 3GZNB 2MWSB 1YN5A 2XK5B 2MEKA 2GBJA 3KUZA 2WXMA 2KTRB 5FR6A 4NJCA 1L6UA 4MSQB 3J9CA 5JHAA 3PLVA 1E8ZA 4E3CA 1CMXB 3DCGA 2OEDA 3EA6A 1E6EB 2DNFA 1F9JA 4IWOA 3TCAA 1AN8A 2UYZB 2V4IB 4OVUA 1JALA 3PO0A 4WURA 1UWMA 1KF6B 1V81A 3APCA 3VHTC 4FJYA 4A20A 4RM9A 4FBJB 5HKHA 2JY6A 2MBEA 4HLEA 2BYTA 1V80A
chains in the Genus database with same CATH topology
2Q5WD 2KWDA 3AE8B 1C76A 5T8IA 3C8YA 1PGAA 2LUMA 2KACA 1PYWD 2IJ0A 1FEHA 1QF6A 1E10A 1TJEA 5BYRA 4MT5A 4L2YA 2BB6A 3AE1B 1ROEA 1XLNA 1EU4A 5EE3A 1TYGB 4NAWB 5EE9A 1P7FA 3NVWA 2HDEA 3SFDB 2BW2A 1FNVA 1I7HA 5AUKA 2WXIA 1FM0D 3MFGA 3IAM1 2B76B 4ZHPA 1XCQL 1YQ4B 2GRIA 1DOIA 2PLPA 2WXLA 3P63A 4A9AA 4RNAA 1E7PB 1NI3A 1KLUD 3KWLA 3AN1A 2JSVX 1RWSA 1UUPA 1ZE3D 1F0ZA 1VDVA 1JQ4A 2AQ3B 2JU6X 4KX6B 4OZAA 3TEWA 2LHEA 1HXYD 2WXPA 1WRIA 1ZXIA 3Q8BA 3HUIA 3U52E 2N7JA 5G5GA 3IXSA 1ESFA 3RFZB 3AEBB 1YJJA 3VRBB 1YN4A 2WXKA 4HEA1 3Q8CA 5D3IB 1JMLA 1JWAD 3AEEB 4NAMA 1I4HA 2Y3AA 5C2TB 1KH0A 1FRRA 2WNMA 1V97A 4HKZE 2D5GA 1PGXA 3LYYA 1WWTA 4KKJA 3BIID 2BS3B 3TEYA 1SE4A 1F2RC 1HZ5A 4P6VF 2WU5B 3GB1A 1VZ7A 4XWWA 1NENB 3DWMA 1L4DB 4YXDB 1QOBA 5HI1A 3AE4B 4CQNA 3B2GA 1SJHD 1SXTA 1FXIA 2IGHA 1A70A 1ZP0B 4AQ7A 2GB1A 1L0YB 2MJEA 1JRPA 2KDMA 1T6BX 4XWTA 2QJLA 3VRAB 2EKIA 4XDDA 2FUG1 2I38A 2AQ2B 5BMIA 1LO5D 2KMMA 3DWGC 4DXFA 1TY0A 2KAJA 1ZPSA 2QIEB 2RMMA 1FMAD 4JWSC 1V1PB 1AYFA 2ZW1A 4L1BA 1GB1A 1JCKB 4PT5A 3BYTB 4GLSC 3AMZA 3HRDD 1JWBD 1YJIA 2W54A 1TS5A 3FAHA 3ZGZA 4EE2A 1TS4A 1MVKA 3NRZA 3R2IA 1RFKA 4WQMA 1FO4A 1K52A 1CK1A 1OQRA 2MJ3A 2WU2B 4HRSA 2PIAA 2RPVA 1HQRD 4OHJA 4ZHOA 4YTMB 4JX1C 1STEA 4HKQA 1OFFA 1V1PA 1WGKA 2AQ1B 1C9FA 1KFYB 3NVYA 4KGSA 5EE0A 2QSDA 3IAS1 1J7CA 1IBXA 1WXQA 2INPE 3V05A 2QEJC 2WP9B 5AUIA 2WXFA 2LEKA 3AEFB 4P16A 4RGTA 5D7GA 4IDIA 1EWCA 1UWXA 3E56A 1I4QA 3PZ8A 1FXAA 1F77A 4GDLB 3ZJUA 4ARIA 3I57A 1DOXA 2RDGA 4FXCA 3TSSA 4OZBA 1C4CA 1XXGA 1R7SA 2JQRB 2WDQB 1IUEA 3U4EG 2DYOA 1GPXA 5H8YE 4MM3B 2IGDA 4HROA 4A90A 5D3DA 1NYQA 2HTME 2JYTA 2V0GA 3AE7B 4R3DA 3L4PA 3WCQA 3AE9B 1SB3C 2PVOD 5BMHA 1GAQB 1MPEA 2W3RA 4A6QA 1YN3A 1YNTE 2M19A 2AX5A 3IT4B 1ZUD2 1D6EC 4HJGE 4N58A 5MPOA 1F2RI 3W1SA 2V3PA 3TEZA 2N9KA 2PTLA 2G9HD 1HA5A 2ICIA 1AWDA 5HFYA 1QLBB 2PMVA 1ACCA 1TS2A 1DYQA 3KWVA 2K0PA 2X38A 2WXOA 4RCOA 2JX5A 2BT6A 3BK2A 1NVID 2CJNA 2DLBA 2W82A 4XE0A 3W2DA 5HG2A 2L83A 5EE1A 1VRAB 4N59A 1QT9A 4A55A 1MHHE 3VR8B 2L1AA 1GOZA 1AW7A 2BS2B 1ZDVA 3NVZA 2NMQA 2W3SA 2BB5A 4N6EB 1SE3A 4YWGG 1I4XA 3AH7A 1C4AA 4OZCA 2IGGA 4ITKA 2KQ4X 4KGTA 2E6XA 2BBCA 1VZ6A 1BUIC 2M56B 3H8HA 3AECB 2JYEA 3NUHB 2GI9A 3AE2B 3NS1A 1WSPA 1ET9A 3UI3A 1TKYA 2FBWB 1L6VA 3NVVA 4YSZB 3IT6B 2E3TA 4RF1A 1GB4A 1VR9A 1YQ3B 4O1NA 1PDXA 4TQ0A 1KLGD 4YSYB 1L0VB 3FC4A 1UGJA 1JWSD 1D5MC 3GS2A 1K53A 1FCLA 4J3OD 1QOGA 1ZXHA 2XNAC 5G5HA 3BVZA 2NTTA 3W5UB 3MHZA 2J53A 2K9XA 1CQVA 3ZYYX 1N5XA 4OVZA 1SEBD 2ONQA 1J7AA 2W55A 3SFEB 5FR3A 3AE3B 3I9V1 4KGRA 3O13A 4LTUA 1IBXB 1EM7A 2M0AA 1Y56A 3SR6A 3URYA 5BYQA 5C3JB 1FRDA 4DQOC 1TY2A 4RH6A 1BMLC 4US8A 1E0ZA 2RDHA 2H88B 1FFVA 1SF0A 1JWUD 1ENFA 4C56C 1FCCC 2JXTA 4GDKB 5BYSA 2G1EA 5HHDG 1RM6C 2WDRB 4B0MA 1RYJA 4YT0B 2QILA 3BWUD 1B1ZA 2LFIA 4RGMA 2J4XA 2JWUA 3KLSX 4RGNA 4JE3B 3U7ZA 1E9MA 3ZJVA 1QILA 1I4PA 1QOAA 2IPKD 1T3QA 1D5ZC 2TSSA 2J52A 2VZKD 1N5WA 1K50A 1VZ8A 2SAKA 1DGJA 1TZOA 4WAFA 3TUOA 4AS1A 3W5VB 2WXQA 3BVGA 2QMTA 4WIPA 2K3UA 2Z8LA 2OHFA 1ET6A 4C7ZA 2VZKB 2BTEA 2PKOA 3LB8C 4ZRQA 1T5XD 1NEKB 1WYGA 3MP9A 1FFUA 3FILA 1K51A 1L5PA 1V8CA 2L32A 1QOFA 4WWMA 4ZYSA 4YTPB 1D5XC 3AEGB 4D2KA 5JXVA 2ON8A 1XF5L 1MI0A 1Q10A 3R2TA 2J42A 2L52A 1JWMD 3VR9B 2WXRA 3AV8A 3BK1A 4C7YA 4YTNB 1M4VA 2WLBA 3P1MA 4NZLB 3Q69A 1C78A 3ZQ4A 3MC0B 2DWQA 3T3OA 1I4GA 4IOIE 3TEXA 1C79A 3P4QB 4ZRPA 3KQ4A 1PGBA 3HVDA 4LLGM 1UNSA 2YEPF 3HVZA 1FD6A 2ACZB 1N63A 3R8BA 3P4SB 4MH8A 2IDYA 3V3XA 1KTKA 2N9LA 1TS3A 3PZ7A 4MACA 2CU3A 3B2FA 1YMHE 3P4RB 4JPSA 2WDVB 3BVMA 3RPFC 2V3NA 1CZPA 2K22A 1V1OA 1FNUA 1D4BA 2MJDA 1L4ZB 4TSSA 3CIRB 3BZDB 4ZOHC 1KRHA 2INNE 1FIQA 2LHDA 2JZPA 5LNK1 2PVGC 4ARCA 1HZ6A 2Y5CA 3MJ5A 5I4DA 1ZOYB 1IGCA 2FE8A 4REZA 3CWIA 4WH4A 5E6JA 2PW9A 3U2SC 2BS4B 4USAA 1TKEA 1XLOA 2MH7A 1FNWA 2DYMA 4RGOS 4C80A 3AE6B 1PFDA 2KN4A 2N0SB 2DBYA 2WXNA 1NYRA 2H89B 1VLBA 3N9YC 1ZDXA 3BYYB 1JROA 5FK9C 2EELA 3VQIA 3AEAB 1VJKA 1PUTA 1SBBB 1CJEA 2WXGA 1N61A 1B9RA 3LXFA 4KKIA 2K5PA 3AB5A 5H92C 1XO3A 4RF0A 3T3NA 2SEBD 1XEEA 2WXHA 4LK0M 1SSNA 2NTSA 3EUB2 3OWEB 4JWUC 3AEDB 1J7BA 1EU3A 2LGIA 3Q8AA 1SIJA 4XDCA 1C77A 1C4PA 3ABVB 1IGDA 3B9JA 3P42A 5FKAC 5GXGB 1SE2A 4A8XC 1DOYA 3ETRA 3Q8EA 4M0WA 5BMGA 2Y5PA 1QKZA 3AM9A 3P4PB 3ZJTA 1SJED 1MHXA 3NZ3A 1YN5A 4Q2JA 2MEKA 2WXMA 4NJCA 1L6UA 1QQRA 3FILB 2ZW0A 2LJIA 4L23A 3E9SA 3J9CA 4US9A 1N60A 1XCTL 3EGRA 4YSXB 1TKGA 3GP7A 4OW0A 4TMAB 1P7EA 2XN9C 3AE5B 2OEDA 3EA6A 1XLQA 2CJOA 2I2YA 1E6EB 1N62A 4UDUC 1XLPA 4RFBA 4B0EA 1BXTA 5TSSA 2LMCA 1AN8A 2V4IB 2WQYB 4TQ1A 3W9CB 1JALA 1JW9D 3PO0A 1OQQA 4WURA 4DXGA 1UWMA 2WXJA 1KF6B 2WS3B 1HEZE 1L0XB 2R61A 3Q8FA 2YEPB 3SEBA 4H2AA 4IKGA 1EWYC 2BYTA 1I4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBX A;  2KWD A;  2J53 A;  1D4B A;  1PGA A;  2LUM A;  2KAC A;  2ONQ A;  2LHD A;  4KGR A;  1UWX A;  1IBX B;  2JZP A;  1EM7 A;  1HZ6 A;  1P7F A;  1IGC A;  4WH4 A;  4OZB A;  2PW9 A;  1XCQ L;  2PLP A;  2IGD A;  1FCC C;  2JXT A;  2KN4 A;  2JSV X;  5HHD G;  5BMH A;  1MPE A;  1YNT E;  2JU6 X;  2JWU A;  4OZA A;  2EEL A;  2LHE A;  4HJG E;  1F2R I;  2N7J A;  2N9K A;  2PTL A;  2J52 A;  5HFY A;  1K50 A;  1JML A;  2K0P A;  1KH0 A;  2QMT A;  4HKZ E;  1PGX A;  2LGI A;  5HG2 A;  1F2R C;  1HZ5 A;  1IGD A;  1MHH E;  3GB1 A;  5BMG A;  1QKZ A;  3MP9 A;  1MHX A;  3FIL A;  5HI1 A;  1K51 A;  2NMQ A;  2IGH A;  4D2K A;  2GB1 A;  2ON8 A;  4OZC A;  1XF5 L;  5JXV A;  1MI0 A;  1Q10 A;  2IGG A;  2KQ4 X;  2ZW0 A;  3FIL B;  4KGT A;  2KDM A;  1XCT L;  2I38 A;  5BMI A;  2GI9 A;  3UI3 A;  1P7E A;  2RMM A;  2OED A;  2ZW1 A;  1GB1 A;  1GB4 A;  4GLS C;  2I2Y A;  4IOI E;  1PGB A;  1MVK A;  1K53 A;  1FD6 A;  1FCL A;  1K52 A;  1HEZ E;  2RPV A;  1ZXH A;  3V3X A;  2N9L A;  4MAC A;  1YMH E;  1C9F A;  4IKG A;  4KGS A;  2QSD A; 
#chains in the Genus database with same CATH topology
 2Q5W D;  4JL9 A;  2G4S A;  3PRP B;  2LUE A;  1T0Q C;  1TJE A;  4L2Y A;  4ANW A;  1ROE A;  1XLN A;  1C3T A;  4NY0 A;  5IP4 D;  1E5W A;  2BW2 A;  3AU4 A;  1I7H A;  5AUK A;  5L95 C;  4W9F A;  4GIV A;  1FM0 D;  4ZHP A;  4HXD A;  1YQ4 B;  2WXL A;  3KWL A;  3MJW A;  4FHJ A;  3ZNI D;  2KWV B;  3MC8 A;  2AQ3 B;  4OZA A;  3VUX A;  4QAY A;  1WRI A;  2BWE S;  3U52 E;  3HM6 X;  1ESF A;  1YN4 A;  4FN2 A;  1WJ6 A;  3RNG C;  1I4H A;  1WGR A;  3PSE B;  5C2T B;  3SU8 X;  1FRR A;  1V97 A;  4HKZ E;  2D5G A;  3JYU A;  3IFW B;  4DXA B;  4AOF A;  4IC7 B;  3H7P B;  3RCZ A;  2NPT A;  1WXV A;  5G2N A;  4XWW A;  1L4D B;  2LAS A;  1SXT A;  4WJP A;  1GNU A;  4HPP A;  3DDC B;  5LLI A;  4IG7 B;  4ACF A;  3ZRF A;  3V6E B;  3IVF A;  4TKN A;  2ZEQ A;  2R2O A;  3VRA B;  5KHQ A;  2FUG 1;  2I38 A;  5BMI A;  3RNC C;  2KMM A;  4DXF A;  1ZPS A;  2QIE B;  1FMA D;  2IBI B;  1AYF A;  3PHX B;  4L1B A;  2LD9 A;  3QX1 A;  3EFU A;  1TS4 A;  4IW0 A;  1YOV B;  4W9I A;  1GC6 A;  3CST A;  2LGX A;  2RPV A;  4YTM B;  4JX1 C;  1STE A;  4EKU A;  2C7N B;  1OFF A;  4JQW C;  2AQ1 B;  4P1B C;  2HTH A;  3N1Z C;  2QSD A;  4C4V A;  1J7C A;  2INP E;  3V05 A;  2PPH A;  2CHZ A;  4GU2 A;  2KOX A;  4P16 A;  5D7G A;  4IDI A;  4FHK A;  1EWC A;  4G11 A;  1L2N A;  4ARI A;  2L05 A;  4GGQ A;  3U4E G;  5KHO A;  4HRO A;  2MP2 B;  4W9J A;  2PVO D;  1TBE A;  1K8R B;  2CHW A;  3V62 A;  1YNT E;  1WGY A;  2NS5 A;  2GBK A;  1YD8 U;  3NY5 A;  4IWQ A;  5MPO A;  2L0F A;  3V61 A;  3M63 B;  1WY8 A;  1L7Y A;  3VTW A;  2PMV A;  3KWV A;  4ZRK A;  3RT3 B;  5AEK B;  3QK0 A;  4RCO A;  2CJN A;  2C7M B;  4XE0 A;  5HG2 A;  4NPN A;  1XD3 B;  1QT9 A;  4A55 A;  1MHH E;  3U8Z A;  4HCP B;  3ZRC A;  2MBQ A;  2W3S A;  1SE3 A;  2IGG A;  2YVC A;  1V86 A;  2M56 B;  3NOB A;  2FBW B;  4O1N A;  3DBH I;  2IZV B;  3L0W B;  3VH3 B;  2DHZ A;  4I6P A;  1K53 A;  1FCL A;  1QOG A;  3R7Q A;  2KJR A;  2KDB A;  4XGA B;  2CR5 A;  2NTT A;  4GOC A;  4FA6 A;  3A4R A;  4AJY B;  1N5X A;  1UBI A;  3I9V 1;  3O13 A;  2V3S A;  1EM7 A;  3WAN A;  4GSW A;  2O6V D;  2DX5 B;  2LI5 A;  2R2Q A;  1BML C;  2N9X A;  2KVR A;  1FFV A;  1SF0 A;  4KSK C;  1FCC C;  4GDK B;  4II2 B;  2G1E A;  1OTR B;  2J7Q B;  2QIL A;  2LFI A;  2JRH A;  2J4X A;  2KWU B;  1E9M A;  2KFK A;  1QOA A;  2IPK D;  3MTN B;  1D5Z C;  4XC2 A;  3ZLZ A;  4DDG D;  2VZK D;  1VZ8 A;  1Q5W B;  3QAR A;  1NI2 A;  2BQQ A;  1V5O A;  4OVV A;  4LJP B;  1ET6 A;  2VZK B;  1UF0 A;  1NEK B;  3MP9 A;  4JLC A;  1M94 A;  2AYO B;  4LNN A;  3GE8 C;  3K9P B;  2LVQ A;  4D2K A;  2ON8 A;  3R2T A;  2L52 A;  2WXR A;  2N1V A;  3AV8 A;  4ZDV A;  2LVP A;  4HDO A;  4NZL B;  3ZQ4 A;  2MW5 A;  1I4G A;  3RUI B;  4A3O A;  3HVD A;  2KJH B;  2YEP F;  4ICU A;  3AI5 A;  1J8C A;  4MH8 A;  1KTK A;  3PZ7 A;  4LNO A;  2CU3 A;  3B2F A;  3RPF C;  2N4F A;  1CZP A;  3L13 A;  4GMV A;  4NAW A;  3L17 A;  4DHJ B;  2KVZ A;  3CF6 E;  3IG3 A;  2INN E;  2LHD A;  1FIQ A;  2MBB B;  4LNF A;  4W9C A;  5I4D A;  1IGC A;  2CU1 A;  2LWP A;  3CWI A;  2B3A A;  3U2S C;  2DYB A;  2QDF A;  2BS4 B;  3QCA A;  3X0W A;  2DYM A;  4RGO S;  4C80 A;  1PFD A;  2DBY A;  3VUY A;  2IND C;  1Y8R C;  2M4N A;  4JIO U;  4S0R A;  2EEL A;  2KZR A;  2OJW A;  3DBR B;  3L10 B;  1A5R A;  4BVU C;  2O2V B;  3LXF A;  2BYV E;  4KKI A;  3AB5 A;  2EMS A;  4LK0 M;  3PRE A;  3OWE B;  1J7B A;  2LGI A;  2LGY A;  3B9J A;  3P42 A;  1DOY A;  3W1Y A;  3ETR A;  3TJP A;  3MC9 A;  4TV3 A;  3P4P B;  2KMC A;  3UGB B;  4LCD E;  1TIF A;  4L23 A;  3E9S A;  4NQK E;  4YSX B;  2KTF A;  3N20 C;  3GP7 A;  3EC8 A;  2CHX A;  1P7E A;  1ZKH A;  4N9F 4;  4G0N B;  4BKS A;  4FAD A;  2XN9 C;  1T0S C;  1H4R A;  3B1L X;  1R4N B;  2L00 B;  4UDU C;  2KO3 A;  3EEC A;  3V6C B;  2VRR B;  2FCM A;  3W9C B;  2WQY B;  5E6N A;  4DXG A;  5C1Z A;  4MGI E;  3Q3J A;  1H8C A;  3SEB A;  4H2A A;  1C76 A;  4GDL A;  1PGA A;  3TBL D;  2KAC A;  2IJ0 A;  2C60 A;  4BZA A;  4MT5 A;  2BYF A;  4M8N A;  3KUC B;  2DAJ A;  2HDE A;  1P0R A;  2WX1 A;  4MEM A;  3IAM 1;  2B76 B;  2KAN A;  4IM0 A;  1DOI A;  1V6E A;  3P63 A;  3RUL A;  4AUQ C;  4MDK E;  4NJ7 A;  3HK0 A;  2N7D A;  2JSV X;  1RWS A;  1ZE3 D;  1VDV A;  3UIO B;  1XT9 B;  2LRW A;  2JU6 X;  1LXD A;  3TEW A;  4PYU A;  3DBL B;  2N7E A;  2VH2 A;  3AUL A;  2NPT B;  3AEB B;  3W1S C;  5E6P A;  2K8B A;  2WXK A;  4HEA 1;  3Q8C A;  2VH1 A;  1JML A;  1JWA D;  4K3C A;  4NAM A;  2GMI C;  3IBE A;  2BKF A;  2Y3A A;  2Y5B B;  1FXT B;  2WNM A;  5JHB A;  1NBF C;  3QWZ B;  1WWT A;  3BII D;  4HJK A;  1SE4 A;  1F2R C;  3RNB C;  3ZKJ C;  4DHZ E;  1NEN B;  3DWM A;  3Q2A C;  4NJ6 A;  4CQN A;  3T8M A;  4M0W B;  4AQ7 A;  2QHO A;  4MSM B;  4DDI D;  2KDM A;  3ENE A;  4XWT A;  2EKI A;  2AQ2 B;  5GMV A;  3ECI A;  3DWG C;  2RMM A;  4XX5 A;  1JCK B;  1IPG A;  3PTF C;  3HRD D;  2KC1 A;  1YJI A;  1TS5 A;  2LGD A;  3R2I A;  1RFK A;  4WQM A;  1OQR A;  2MJ3 A;  2PIA A;  1I35 A;  4A3P A;  3N32 A;  1V1P A;  4HKQ A;  3WAM A;  4KGS A;  2KT7 A;  5EDS A;  2WP9 B;  1R4M B;  1F1H A;  2LEK A;  3OJ3 A;  4C00 A;  1HTQ A;  1WFY A;  3E56 A;  1I4Q A;  3PZ8 A;  3GOE A;  2KJ6 A;  2JZ3 B;  3QHT A;  2NR2 A;  1DOX A;  3ZTC A;  2REX A;  2DZM A;  2WDQ B;  4BAX A;  2JZZ A;  2IO0 B;  2XBB C;  2DYO A;  3WAP A;  1GPX A;  4MM3 B;  2K39 A;  1WE7 A;  4A90 A;  5D3D A;  2V0G A;  3NS8 A;  4R3D A;  4DBG A;  2D07 B;  1SB3 C;  4IWP A;  1SIF A;  5BMH A;  1GAQ B;  3CMM B;  2AX5 A;  1ZUD 2;  1D6E C;  2FNJ B;  1KJT A;  4N58 A;  1F2R I;  5D2M B;  1HE8 A;  2GBR A;  5BO4 B;  3PS6 A;  3BK2 A;  1NVI D;  4HPL B;  3Q14 C;  3Q3N C;  4KDI C;  2L83 A;  1MG8 A;  4N59 A;  2PJH A;  3ZNG C;  1GC7 A;  1LGR A;  5CX3 A;  1PQS A;  2BS2 B;  1ZDV A;  5DPW A;  2MA9 B;  4OZC A;  1WJU A;  4RM8 A;  2DZJ A;  2E6X A;  2BBC A;  1Z2M A;  3H8H A;  3NUH B;  2GI9 A;  3AE2 B;  1WSP A;  3UI3 A;  2WX0 A;  1L6V A;  4PK1 A;  4YSZ B;  2E3T A;  3OLM D;  4RF1 A;  1YQ3 B;  4K7S A;  3SDL C;  1PDX A;  4TQ0 A;  1L0V B;  1UGJ A;  1JWS D;  3GS2 A;  3DBS A;  3ML9 A;  2K6Q A;  2Z59 B;  4J3O D;  1SGH A;  1ZXH A;  4XYC A;  2XNA C;  3LDZ E;  3N3K B;  2J53 A;  2N1W A;  1CQV A;  2KKC A;  5FR3 A;  4KGR A;  1BT0 A;  3DBR I;  4NQL B;  1IBX B;  4ANV A;  5J2R A;  5C3J B;  3P2B A;  4DQO C;  4RH6 A;  4US8 A;  2RDH A;  1YJ1 A;  1ENF A;  2JXT A;  2PE9 A;  2WDR B;  4YT0 B;  1G6J A;  3T9L A;  1D3Z A;  1B1Z A;  1WF9 A;  1MG4 A;  2C9W B;  4RGN A;  1WMH A;  3ZJV A;  1I4P A;  2MSE D;  3ZUN A;  1T3Q A;  3MHS D;  1K50 A;  4IM2 A;  4ANU A;  2SAK A;  1DGJ A;  1TZO A;  4G50 A;  3QJZ A;  2WXQ A;  4KV2 A;  4K3B A;  4KVG B;  2K3U A;  1GG3 A;  5D6J B;  2OHF A;  2N9P C;  3M95 A;  2IYD B;  2PKO A;  3I5J C;  2KTR A;  1T5X D;  4X57 B;  1VD2 A;  5LXH A;  1QOF A;  4B9K A;  4ZYS A;  4YTP B;  3AEG B;  5IO9 A;  5JXV A;  1MI0 A;  2LXA A;  1JWM D;  3TL5 A;  3VR9 B;  2NVU I;  2IY1 B;  4FJV B;  4C7Y A;  4YTN B;  1M4V A;  2WLB A;  2D3G A;  3ML8 A;  1EF5 A;  4MGZ E;  3Q69 A;  3VAW A;  1E90 A;  2DWQ A;  4IOI E;  4M00 A;  1C79 A;  4LLG M;  4B6W A;  2KN5 A;  1UNS A;  4CYE A;  3QQ8 B;  2LGS A;  3P4S B;  2MQJ A;  3HIZ A;  2N9L A;  4MAC A;  1YMH E;  4JPS A;  3A9K B;  2WDV B;  3BVM A;  3QIJ A;  3UF8 A;  1FNU A;  2JVC A;  2MJD A;  3LJ3 A;  5IN7 A;  3CIR B;  1AAR A;  1KRH A;  4WWN A;  4EOY A;  4ARC A;  5LNK 1;  2PVG C;  2Y5C A;  3ZNH B;  2FE8 A;  2FCQ A;  3VUW A;  3U30 A;  2K1F A;  1FNW A;  1WGD A;  5DPT A;  2N0S B;  2WXN A;  2IO2 B;  2YLM A;  1VLB A;  3N9Y C;  4KSL C;  1JRO A;  1IP9 A;  3VQI A;  1VJK A;  2NBW B;  1CJE A;  2NCN A;  4LJO B;  4RF0 A;  1XEE A;  3JSV B;  3NJT A;  3H7P A;  4PS8 A;  3EUB 2;  3KVF B;  2C7H A;  3QAQ A;  1EU3 A;  3Q8A A;  2KNB A;  2WGS A;  3ZDM C;  1C4P A;  1IGD A;  2JWZ A;  3Q8E A;  5CTR C;  4M01 A;  1V5T A;  3R7R A;  2Y5P A;  3SD5 A;  1SJE D;  2L3Z A;  3NZ3 A;  3GZN I;  3DVG X;  4Q2J A;  5TR5 A;  1WGH A;  4PS3 A;  4GB9 A;  4EFO A;  3B08 A;  1T0R C;  2MX2 A;  3FIL B;  2ZW0 A;  4US9 A;  1XCT L;  1TKG A;  4OW0 A;  2HJ1 A;  1E7U A;  3AE5 B;  3D32 A;  3DQV A;  2NBU A;  1R4M I;  2BPS A;  4G3X B;  4ZRI A;  2I2Y A;  1N62 A;  1XLP A;  4KIK B;  4RFB A;  4B0E A;  3VTV A;  1HTO A;  2LMC A;  2LZ6 A;  2MHJ A;  4TQ1 A;  1JW9 D;  1OQQ A;  2J0M A;  3APD A;  2WS3 B;  2EMT A;  4TUU A;  3PLU A;  2LXC A;  2WDT B;  1WM2 A;  2K8H A;  1I4R A;  2KWD A;  3AXC A;  5T8I A;  2DZI A;  1PYW D;  5BYR A;  3ZW3 A;  2Z0D B;  1EU4 A;  5EE3 A;  1Q0W B;  3NVW A;  3OAW A;  4DHJ D;  3QA8 A;  2JRI B;  3BY4 B;  4WWO A;  2PLP A;  1RFA A;  4KZC A;  4A9A A;  4RNA A;  1NI3 A;  1KLU D;  2BF8 B;  4EZL A;  1F0Z A;  3NZU A;  4M02 A;  1JQ4 A;  4KX6 B;  4WJO A;  1HXY D;  3Q8B A;  3HUI A;  1V49 A;  2N7J A;  2I1K A;  1WRD B;  1YJJ A;  3VRB B;  1WR1 A;  3AEE B;  1KH0 A;  3VVW B;  4MJS B;  4KKJ A;  1PGX A;  3LYY A;  2RSU A;  5L83 A;  1HZ5 A;  2UWQ A;  3GB1 A;  3H7S A;  2AL6 A;  4RMA A;  1E8X A;  3WAO A;  4YXD B;  3AE4 B;  1IYF A;  3B2G A;  1FXI A;  2ZPY A;  1A70 A;  1ZP0 B;  2GB1 A;  4XZ4 A;  1T6B X;  2JT4 B;  1LO5 D;  1TY0 A;  2KAJ A;  2CKH B;  4JWS C;  1V1P B;  4PT5 A;  3BYT B;  4GLS C;  1EUV B;  1JWB D;  2ZNV B;  4EE2 A;  1MVK A;  3TMP B;  3NRZ A;  3Q3F A;  3PHW B;  1K52 A;  4HRS A;  4ZHO A;  4OHJ A;  1WI0 A;  4JGH B;  5EE0 A;  3IAS 1;  2LVO A;  1WXQ A;  4FJZ A;  2QEJ C;  1WX8 A;  4E74 A;  3AEF B;  3PPA A;  1UWX A;  1WE6 A;  1FXA A;  4BOS C;  4FXC A;  3TSS A;  1XXG A;  2BWF A;  2JQR B;  3A1Q A;  3ZNZ B;  2IGD A;  2FIF A;  1NYQ A;  2HTM E;  5IAA C;  3AE7 B;  2O6V A;  2OOB B;  3L4P A;  2MBO A;  3WCQ A;  5IA7 A;  2K6D B;  3RYT A;  1MPE A;  4BBN C;  4A6Q A;  1EO6 A;  3PV1 A;  5JZE B;  5AZF A;  2V4L A;  3W1S A;  1WGG A;  2G4D B;  3TEZ A;  2N9K A;  2G9H D;  2ICI A;  2KQS A;  5G55 A;  1AWD A;  1QLB B;  1ACC A;  2G45 B;  2V9H A;  3GE3 C;  2JF5 A;  1TS2 A;  1WXM A;  2RDB C;  3A9J A;  1DYQ A;  4W9H A;  1C1Y B;  4GXB A;  4MEL A;  2WXO A;  1LQB A;  2BT6 A;  2DLB A;  2W82 A;  5EE1 A;  3ALB A;  2L1A A;  1TGZ B;  1GOZ A;  1AW7 A;  3NVZ A;  4IM3 A;  3DHI C;  4ASW C;  2BB5 A;  1I4X A;  3AH7 A;  1C4A A;  3N1Y C;  4S17 A;  4EEW A;  2KQ4 X;  1VZ6 A;  2K25 A;  3VDZ A;  2JYE A;  4MGK E;  3NS1 A;  1WXS A;  3WIM A;  1TKY A;  2KQ7 A;  4J6I A;  3KYC D;  3DBH B;  1GB4 A;  5JH5 C;  3RI7 C;  3H1U A;  3KW5 B;  3VFK A;  1KLG D;  3HHM A;  3FC4 A;  3HM3 A;  1JRU A;  4LNK A;  1UZX B;  3U7D A;  2FAZ A;  4GN1 A;  3BVZ A;  4WWP A;  3W5U B;  3MHZ A;  3UQA A;  5DPR A;  3ZYY X;  4OVZ A;  1SEB D;  4II3 B;  3SFE B;  3ZTD A;  4C4V B;  3ONS A;  4LTU A;  3V60 A;  2D11 A;  4ZRJ A;  2WWZ A;  3R66 C;  3SR6 A;  5J18 A;  3URY A;  5BYQ A;  1FRD A;  1TY2 A;  1E0Z A;  3X23 A;  4HK2 A;  1JWU D;  5BYS A;  1RYJ A;  2IO3 B;  3BWU D;  2O2V A;  5AZG A;  3PT2 B;  2V1Y A;  1FPY A;  1QIL A;  3UIN B;  2TSS A;  1N5W A;  3ZVV A;  3KYD D;  1WXA A;  2KDE B;  3TUO A;  3W5V B;  1KLV A;  4WJQ A;  1VCB A;  4F1S A;  4CHK A;  1V2Y A;  5CHV C;  1UEL A;  4ZRQ A;  1WYG A;  1K51 A;  2KYW A;  1RAX A;  2Z0E B;  2FID A;  3NZS A;  1D5X C;  3VXW A;  1WX7 A;  1XF5 L;  3JW0 X;  4KZ0 A;  2J42 A;  1RLF A;  4W9G A;  2L7R A;  1WZ0 A;  2XEW A;  3A33 B;  4BKT A;  2KLG A;  2ZNV C;  3MC0 B;  3T3O A;  3TEX A;  3P4Q B;  2KX3 A;  3RN9 C;  4ZRP A;  1PGB A;  3PRM B;  1MJD A;  3DVN U;  2ACZ B;  3R8B A;  3PZD A;  1TS3 A;  4HPM B;  3RNE C;  3DVN V;  3P4R B;  4NNJ B;  1T0Y A;  2K22 A;  1V1O A;  2IY0 B;  1D4B A;  4E71 A;  1L4Z B;  3TIX A;  1HZ6 A;  4REZ A;  3NG0 A;  4WH4 A;  5E6J A;  4P7I A;  4W9K A;  4FUL A;  1E8W A;  4HWI B;  3Q6B A;  2BKR B;  2MH7 A;  2L76 A;  2KN4 A;  2PEA A;  1NYR A;  2H89 B;  2RPQ A;  3M3J A;  1ZDX A;  4WJN A;  3BYY B;  3AEA B;  3O65 B;  1SBB B;  2WXG A;  2K5P A;  5H92 C;  1WYW B;  2N9E B;  2UU7 A;  2KFK B;  1SSN A;  3RNF C;  2LRU A;  2QC8 A;  3AED B;  2KLC A;  1C77 A;  5FKA C;  2L8J A;  5GXG B;  2FCS A;  4A8X C;  4AP4 C;  1SE2 A;  4M0W A;  1QKZ A;  3AM9 A;  2KDF B;  3ZJT A;  3RNA C;  1MHX A;  3UQB A;  1UBQ A;  3R3M A;  1YQB A;  1KOT A;  2KXJ A;  1QQR A;  4YL8 A;  2LJI A;  4P1C C;  1N60 A;  2GBN A;  3EGR A;  3JVZ X;  1E7V A;  5DCN A;  4TMA B;  4WQO B;  1WX9 A;  2J0K A;  3ZIM A;  1XLQ A;  2CJO A;  2XK5 A;  1BXT A;  1R4N I;  5TSS A;  3I3T B;  5E6O A;  3OG5 A;  2OJR A;  1OQY A;  2WXJ A;  3RZF A;  1NDD A;  3PRZ A;  1HEZ E;  1L0X B;  2M8S A;  3IHP C;  2R61 A;  2D3C A;  3Q8F A;  2YEP B;  4M8M A;  1YX6 B;  1V9J A;  5C23 A;  4IKG A;  1EWY C;  5DPS A;  4AWJ A;  2KHW B;  2NBV B;  1S3S G;  3Q3M C;  5IKC M;  4K7U A;  3AE8 B;  3C8Y A;  2LUM A;  1QF6 A;  1FEH A;  1E10 A;  3Q3O C;  2BB6 A;  2JPH A;  3AE1 B;  2DAF A;  4BOZ B;  1TYG B;  4NAW B;  3C19 A;  4MM3 A;  5EE9 A;  1P7F A;  3SFD B;  1LFD A;  1FNV A;  2WXI A;  3N30 A;  3MFG A;  1XCQ L;  1YX5 B;  2GRI A;  2D10 A;  2L0T A;  1E7P B;  3RD2 A;  4AJW A;  3AN1 A;  3L54 A;  1UUP A;  3A4S C;  2JUO A;  3CSF A;  4F7Z A;  1WH3 A;  2LHE A;  2WXP A;  2FUH B;  3L08 A;  1ZXI A;  2KFJ A;  5G5G A;  5AZH A;  3IXS A;  3RFZ B;  2INC C;  2MBH A;  3DBL I;  4F8C B;  5D3I B;  3DOW A;  2BS3 B;  3TEY A;  1WJN A;  4P6V F;  1KM7 A;  2WU5 B;  2IO1 B;  2M0X A;  1VZ7 A;  1P98 A;  1QOB A;  5HI1 A;  3N1X C;  1SJH D;  2DZK A;  2IGH A;  1L0Y B;  2MJE A;  1JRP A;  3VH4 B;  1WM3 A;  4BKS D;  2QJL A;  3ZDT A;  4XDD A;  1WZ3 A;  1WIA A;  1TTN A;  2ZW1 A;  1GB1 A;  4W9D A;  3AMZ A;  3B0A A;  2W54 A;  2ASQ A;  3FAH A;  1UH6 A;  3ZGZ A;  3I63 C;  4DK5 A;  1FO4 A;  1I42 A;  1CK1 A;  4DHZ B;  2WU2 B;  4BKG A;  1HQR D;  1P1A A;  1SE9 A;  2KDI A;  4LNI A;  4EZJ A;  3A1Q B;  1WGK A;  1C9F A;  1KFY B;  3C0R B;  3NVY A;  3EHV A;  1IBX A;  1YIW A;  2O6V B;  5AUI A;  1WR6 E;  2BYE A;  2WXF A;  4RGT A;  2ZZP B;  4K7W A;  1F77 A;  3AU5 A;  4GDL B;  3ZJU A;  3I57 A;  3S2A A;  2RDG A;  4OZB A;  1C4C A;  1R7S A;  1IUE A;  3ZO5 B;  2MLB A;  5H8Y E;  1TZ1 A;  2JYT A;  3L16 A;  3AE9 B;  3A9J B;  2FCN A;  2W3R A;  2AWT A;  1YN3 A;  4URK A;  2M19 A;  3IT4 B;  4HJG E;  2V3P A;  1S1Q B;  2MP2 A;  2GLS A;  2PTL A;  3OJ4 B;  1HA5 A;  5HFY A;  4ICV A;  2A4Z A;  2BVC A;  4BFR A;  2K0P A;  2X38 A;  2BGF A;  2MRP A;  2JX5 A;  2JXX A;  4CO7 A;  4PS7 A;  3W2D A;  3H9D A;  1VRA B;  4K81 A;  1N6Z A;  3VR8 B;  4B95 A;  1UD7 A;  3DPD A;  2KWC A;  2NMQ A;  3RZW C;  4MGY E;  2A5U A;  4N6E B;  2KK8 A;  4YWG G;  2J0J A;  2ZVO A;  4ITK A;  4KGT A;  4I6L B;  1BUI C;  3AEC B;  3EFC A;  1ET9 A;  2RGF A;  3NVV A;  3IT6 B;  1VR9 A;  4IUM B;  2MCN B;  2M1M A;  3DHH C;  2EKE C;  2HJ8 A;  3DVG Y;  4YSY B;  2ZJD A;  1D5M C;  3A9K A;  3DHG C;  3FKY A;  1X1M A;  2RR9 A;  2WHI A;  5G5H A;  2KMA A;  3ZXV A;  2K9X A;  3VTU A;  3WAL A;  2ONQ A;  1J7A A;  2I1J A;  2W55 A;  3AE3 B;  2ZCB A;  4WAA A;  1QZE A;  2M0A A;  3H6N A;  4ZYN A;  1Y56 A;  1LM8 B;  4HCN B;  3NHE B;  1E8Y A;  2H88 B;  4C56 C;  2D3B A;  5HHD G;  1RM6 C;  4BBN F;  3SHQ A;  4B0M A;  3K9O B;  2KD0 A;  1P9D U;  4RGM A;  2JWU A;  4I6N B;  3KH0 A;  3KLS X;  4JE3 B;  3U7Z A;  2LJ5 A;  2RD0 A;  3JSV A;  2D3A A;  4K1R B;  1P3Q U;  2J52 A;  4GDK A;  2KC2 A;  3PVL A;  4WAF A;  4AS1 A;  1GUA B;  4KDL B;  2W9N A;  3BVG A;  2QMT A;  1GJZ A;  5IOI A;  4WIP A;  2Z8L A;  3WA0 A;  4MH0 E;  4C7Z A;  2BTE A;  1U4A A;  2QCZ A;  3LB8 C;  1FFU A;  3FIL A;  1L5P A;  5CHF A;  1V8C A;  2L32 A;  4WWM A;  1Q10 A;  3ZXR A;  3RMK C;  1ISN A;  3M62 B;  4LDT D;  1UGM A;  3BK1 A;  2K8C A;  4HVB A;  1TT5 B;  4KIK A;  2GBM A;  3P1M A;  1OEY A;  2GOW A;  1OGW A;  1ZGU B;  1C78 A;  3KQ4 A;  5J17 A;  4HDQ A;  4LDT B;  2G3Q B;  3HVZ A;  1FD6 A;  1N63 A;  2WYQ A;  3UIP B;  2IDY A;  3V3X A;  1ZW7 A;  5D94 A;  1Q1O A;  2D2Q A;  2V3N A;  4W9L A;  4TSS A;  2C5L C;  3BZD B;  4ZOH C;  1OEY J;  2PE6 B;  4ANX A;  2JZP A;  3MJ5 A;  1ZOY B;  4W9E A;  5LXI B;  2PW9 A;  1EF1 A;  4USA A;  1TKE A;  1XLO A;  3QC8 B;  4PYZ A;  3AE6 B;  2HE7 A;  1F52 A;  4EZK A;  1J0G A;  5FK9 C;  4DWF A;  2ZPN A;  1RRB A;  1PUT A;  1N61 A;  1B9R A;  1Z5S B;  2ZVN A;  1MFW A;  2M17 A;  4MJS A;  2X8X X;  1XO3 A;  2HD5 B;  3T3N A;  1WMH B;  1XQQ A;  2SEB D;  4EUT A;  2WXH A;  5CHW A;  3BIN A;  2NTS A;  3KUD B;  4JWU C;  3PGE A;  2CS4 A;  1SIJ A;  2AL3 A;  4XDC A;  3ABV B;  2ZCC A;  2KX0 A;  2AEH A;  3APF A;  1J19 A;  4FLH A;  1WJ4 A;  5BMG A;  2DEN B;  3GZN B;  2MWS B;  1YN5 A;  2XK5 B;  2MEK A;  2GBJ A;  3KUZ A;  2WXM A;  2KTR B;  5FR6 A;  4NJC A;  1L6U A;  4MSQ B;  3J9C A;  5JHA A;  3PLV A;  1E8Z A;  4E3C A;  1CMX B;  3DCG A;  2OED A;  3EA6 A;  1E6E B;  2DNF A;  1F9J A;  4IWO A;  3TCA A;  1AN8 A;  2UYZ B;  2V4I B;  4OVU A;  1JAL A;  3PO0 A;  4WUR A;  1UWM A;  1KF6 B;  1V81 A;  3APC A;  3VHT C;  4FJY A;  4A20 A;  4RM9 A;  4FBJ B;  5HKH A;  2JY6 A;  2MBE A;  4HLE A;  2BYT A;  1V80 A; 
#chains in the Genus database with same CATH homology
 2Q5W D;  2KWD A;  3AE8 B;  1C76 A;  5T8I A;  3C8Y A;  1PGA A;  2LUM A;  2KAC A;  1PYW D;  2IJ0 A;  1FEH A;  1QF6 A;  1E10 A;  1TJE A;  5BYR A;  4MT5 A;  4L2Y A;  2BB6 A;  3AE1 B;  1ROE A;  1XLN A;  1EU4 A;  5EE3 A;  1TYG B;  4NAW B;  5EE9 A;  1P7F A;  3NVW A;  2HDE A;  3SFD B;  2BW2 A;  1FNV A;  1I7H A;  5AUK A;  2WXI A;  1FM0 D;  3MFG A;  3IAM 1;  2B76 B;  4ZHP A;  1XCQ L;  1YQ4 B;  2GRI A;  1DOI A;  2PLP A;  2WXL A;  3P63 A;  4A9A A;  4RNA A;  1E7P B;  1NI3 A;  1KLU D;  3KWL A;  3AN1 A;  2JSV X;  1RWS A;  1UUP A;  1ZE3 D;  1F0Z A;  1VDV A;  1JQ4 A;  2AQ3 B;  2JU6 X;  4KX6 B;  4OZA A;  3TEW A;  2LHE A;  1HXY D;  2WXP A;  1WRI A;  1ZXI A;  3Q8B A;  3HUI A;  3U52 E;  2N7J A;  5G5G A;  3IXS A;  1ESF A;  3RFZ B;  3AEB B;  1YJJ A;  3VRB B;  1YN4 A;  2WXK A;  4HEA 1;  3Q8C A;  5D3I B;  1JML A;  1JWA D;  3AEE B;  4NAM A;  1I4H A;  2Y3A A;  5C2T B;  1KH0 A;  1FRR A;  2WNM A;  1V97 A;  4HKZ E;  2D5G A;  1PGX A;  3LYY A;  1WWT A;  4KKJ A;  3BII D;  2BS3 B;  3TEY A;  1SE4 A;  1F2R C;  1HZ5 A;  4P6V F;  2WU5 B;  3GB1 A;  1VZ7 A;  4XWW A;  1NEN B;  3DWM A;  1L4D B;  4YXD B;  1QOB A;  5HI1 A;  3AE4 B;  4CQN A;  3B2G A;  1SJH D;  1SXT A;  1FXI A;  2IGH A;  1A70 A;  1ZP0 B;  4AQ7 A;  2GB1 A;  1L0Y B;  2MJE A;  1JRP A;  2KDM A;  1T6B X;  4XWT A;  2QJL A;  3VRA B;  2EKI A;  4XDD A;  2FUG 1;  2I38 A;  2AQ2 B;  5BMI A;  1LO5 D;  2KMM A;  3DWG C;  4DXF A;  1TY0 A;  2KAJ A;  1ZPS A;  2QIE B;  2RMM A;  1FMA D;  4JWS C;  1V1P B;  1AYF A;  2ZW1 A;  4L1B A;  1GB1 A;  1JCK B;  4PT5 A;  3BYT B;  4GLS C;  3AMZ A;  3HRD D;  1JWB D;  1YJI A;  2W54 A;  1TS5 A;  3FAH A;  3ZGZ A;  4EE2 A;  1TS4 A;  1MVK A;  3NRZ A;  3R2I A;  1RFK A;  4WQM A;  1FO4 A;  1K52 A;  1CK1 A;  1OQR A;  2MJ3 A;  2WU2 B;  4HRS A;  2PIA A;  2RPV A;  1HQR D;  4OHJ A;  4ZHO A;  4YTM B;  4JX1 C;  1STE A;  4HKQ A;  1OFF A;  1V1P A;  1WGK A;  2AQ1 B;  1C9F A;  1KFY B;  3NVY A;  4KGS A;  5EE0 A;  2QSD A;  3IAS 1;  1J7C A;  1IBX A;  1WXQ A;  2INP E;  3V05 A;  2QEJ C;  2WP9 B;  5AUI A;  2WXF A;  2LEK A;  3AEF B;  4P16 A;  4RGT A;  5D7G A;  4IDI A;  1EWC A;  1UWX A;  3E56 A;  1I4Q A;  3PZ8 A;  1FXA A;  1F77 A;  4GDL B;  3ZJU A;  4ARI A;  3I57 A;  1DOX A;  2RDG A;  4FXC A;  3TSS A;  4OZB A;  1C4C A;  1XXG A;  1R7S A;  2JQR B;  2WDQ B;  1IUE A;  3U4E G;  2DYO A;  1GPX A;  5H8Y E;  4MM3 B;  2IGD A;  4HRO A;  4A90 A;  5D3D A;  1NYQ A;  2HTM E;  2JYT A;  2V0G A;  3AE7 B;  4R3D A;  3L4P A;  3WCQ A;  3AE9 B;  1SB3 C;  2PVO D;  5BMH A;  1GAQ B;  1MPE A;  2W3R A;  4A6Q A;  1YN3 A;  1YNT E;  2M19 A;  2AX5 A;  3IT4 B;  1ZUD 2;  1D6E C;  4HJG E;  4N58 A;  5MPO A;  1F2R I;  3W1S A;  2V3P A;  3TEZ A;  2N9K A;  2PTL A;  2G9H D;  1HA5 A;  2ICI A;  1AWD A;  5HFY A;  1QLB B;  2PMV A;  1ACC A;  1TS2 A;  1DYQ A;  3KWV A;  2K0P A;  2X38 A;  2WXO A;  4RCO A;  2JX5 A;  2BT6 A;  3BK2 A;  1NVI D;  2CJN A;  2DLB A;  2W82 A;  4XE0 A;  3W2D A;  5HG2 A;  2L83 A;  5EE1 A;  1VRA B;  4N59 A;  1QT9 A;  4A55 A;  1MHH E;  3VR8 B;  2L1A A;  1GOZ A;  1AW7 A;  2BS2 B;  1ZDV A;  3NVZ A;  2NMQ A;  2W3S A;  2BB5 A;  4N6E B;  1SE3 A;  4YWG G;  1I4X A;  3AH7 A;  1C4A A;  4OZC A;  2IGG A;  4ITK A;  2KQ4 X;  4KGT A;  2E6X A;  2BBC A;  1VZ6 A;  1BUI C;  2M56 B;  3H8H A;  3AEC B;  2JYE A;  3NUH B;  2GI9 A;  3AE2 B;  3NS1 A;  1WSP A;  1ET9 A;  3UI3 A;  1TKY A;  2FBW B;  1L6V A;  3NVV A;  4YSZ B;  3IT6 B;  2E3T A;  4RF1 A;  1GB4 A;  1VR9 A;  1YQ3 B;  4O1N A;  1PDX A;  4TQ0 A;  1KLG D;  4YSY B;  1L0V B;  3FC4 A;  1UGJ A;  1JWS D;  1D5M C;  3GS2 A;  1K53 A;  1FCL A;  4J3O D;  1QOG A;  1ZXH A;  2XNA C;  5G5H A;  3BVZ A;  2NTT A;  3W5U B;  3MHZ A;  2J53 A;  2K9X A;  1CQV A;  3ZYY X;  1N5X A;  4OVZ A;  1SEB D;  2ONQ A;  1J7A A;  2W55 A;  3SFE B;  5FR3 A;  3AE3 B;  3I9V 1;  4KGR A;  3O13 A;  4LTU A;  1IBX B;  1EM7 A;  2M0A A;  1Y56 A;  3SR6 A;  3URY A;  5BYQ A;  5C3J B;  1FRD A;  4DQO C;  1TY2 A;  4RH6 A;  1BML C;  4US8 A;  1E0Z A;  2RDH A;  2H88 B;  1FFV A;  1SF0 A;  1JWU D;  1ENF A;  4C56 C;  1FCC C;  2JXT A;  4GDK B;  5BYS A;  2G1E A;  5HHD G;  1RM6 C;  2WDR B;  4B0M A;  1RYJ A;  4YT0 B;  2QIL A;  3BWU D;  1B1Z A;  2LFI A;  4RGM A;  2J4X A;  2JWU A;  3KLS X;  4RGN A;  4JE3 B;  3U7Z A;  1E9M A;  3ZJV A;  1QIL A;  1I4P A;  1QOA A;  2IPK D;  1T3Q A;  1D5Z C;  2TSS A;  2J52 A;  2VZK D;  1N5W A;  1K50 A;  1VZ8 A;  2SAK A;  1DGJ A;  1TZO A;  4WAF A;  3TUO A;  4AS1 A;  3W5V B;  2WXQ A;  3BVG A;  2QMT A;  4WIP A;  2K3U A;  2Z8L A;  2OHF A;  1ET6 A;  4C7Z A;  2VZK B;  2BTE A;  2PKO A;  3LB8 C;  4ZRQ A;  1T5X D;  1NEK B;  1WYG A;  3MP9 A;  1FFU A;  3FIL A;  1K51 A;  1L5P A;  1V8C A;  2L32 A;  1QOF A;  4WWM A;  4ZYS A;  4YTP B;  1D5X C;  3AEG B;  4D2K A;  5JXV A;  2ON8 A;  1XF5 L;  1MI0 A;  1Q10 A;  3R2T A;  2J42 A;  2L52 A;  1JWM D;  3VR9 B;  2WXR A;  3AV8 A;  3BK1 A;  4C7Y A;  4YTN B;  1M4V A;  2WLB A;  3P1M A;  4NZL B;  3Q69 A;  1C78 A;  3ZQ4 A;  3MC0 B;  2DWQ A;  3T3O A;  1I4G A;  4IOI E;  3TEX A;  1C79 A;  3P4Q B;  4ZRP A;  3KQ4 A;  1PGB A;  3HVD A;  4LLG M;  1UNS A;  2YEP F;  3HVZ A;  1FD6 A;  2ACZ B;  1N63 A;  3R8B A;  3P4S B;  4MH8 A;  2IDY A;  3V3X A;  1KTK A;  2N9L A;  1TS3 A;  3PZ7 A;  4MAC A;  2CU3 A;  3B2F A;  1YMH E;  3P4R B;  4JPS A;  2WDV B;  3BVM A;  3RPF C;  2V3N A;  1CZP A;  2K22 A;  1V1O A;  1FNU A;  1D4B A;  2MJD A;  1L4Z B;  4TSS A;  3CIR B;  3BZD B;  4ZOH C;  1KRH A;  2INN E;  1FIQ A;  2LHD A;  2JZP A;  5LNK 1;  2PVG C;  4ARC A;  1HZ6 A;  2Y5C A;  3MJ5 A;  5I4D A;  1ZOY B;  1IGC A;  2FE8 A;  4REZ A;  3CWI A;  4WH4 A;  5E6J A;  2PW9 A;  3U2S C;  2BS4 B;  4USA A;  1TKE A;  1XLO A;  2MH7 A;  1FNW A;  2DYM A;  4RGO S;  4C80 A;  3AE6 B;  1PFD A;  2KN4 A;  2N0S B;  2DBY A;  2WXN A;  1NYR A;  2H89 B;  1VLB A;  3N9Y C;  1ZDX A;  3BYY B;  1JRO A;  5FK9 C;  2EEL A;  3VQI A;  3AEA B;  1VJK A;  1PUT A;  1SBB B;  1CJE A;  2WXG A;  1N61 A;  1B9R A;  3LXF A;  4KKI A;  2K5P A;  3AB5 A;  5H92 C;  1XO3 A;  4RF0 A;  3T3N A;  2SEB D;  1XEE A;  2WXH A;  4LK0 M;  1SSN A;  2NTS A;  3EUB 2;  3OWE B;  4JWU C;  3AED B;  1J7B A;  1EU3 A;  2LGI A;  3Q8A A;  1SIJ A;  4XDC A;  1C77 A;  1C4P A;  3ABV B;  1IGD A;  3B9J A;  3P42 A;  5FKA C;  5GXG B;  1SE2 A;  4A8X C;  1DOY A;  3ETR A;  3Q8E A;  4M0W A;  5BMG A;  2Y5P A;  1QKZ A;  3AM9 A;  3P4P B;  3ZJT A;  1SJE D;  1MHX A;  3NZ3 A;  1YN5 A;  4Q2J A;  2MEK A;  2WXM A;  4NJC A;  1L6U A;  1QQR A;  3FIL B;  2ZW0 A;  2LJI A;  4L23 A;  3E9S A;  3J9C A;  4US9 A;  1N60 A;  1XCT L;  3EGR A;  4YSX B;  1TKG A;  3GP7 A;  4OW0 A;  4TMA B;  1P7E A;  2XN9 C;  3AE5 B;  2OED A;  3EA6 A;  1XLQ A;  2CJO A;  2I2Y A;  1E6E B;  1N62 A;  4UDU C;  1XLP A;  4RFB A;  4B0E A;  1BXT A;  5TSS A;  2LMC A;  1AN8 A;  2V4I B;  2WQY B;  4TQ1 A;  3W9C B;  1JAL A;  1JW9 D;  3PO0 A;  1OQQ A;  4WUR A;  4DXG A;  1UWM A;  2WXJ A;  1KF6 B;  2WS3 B;  1HEZ E;  1L0X B;  2R61 A;  3Q8F A;  2YEP B;  3SEB A;  4H2A A;  4IKG A;  1EWY C;  2BYT A;  1I4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...