1YNTE

Structure of the monomeric form of t. gondii sag1 surface antigen bound to a human fab
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
EVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYADLLAKVNGEYTADLEDGGNHMNIKFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4F11E12 Fab variable light chain region
publication title Crystal structure of the complex between the monomeric form of Toxoplasma gondii surface antigen 1 (SAG1) and a monoclonal antibody that mimics the human immune response
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 9
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2005-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yntE00
2PW9A 1K53A 2IGGA 1D4BA 1K51A 2KACA 1FCCC 1IGCA 2JXTA 4GLSC 4OZAA 1GB1A 2PLPA 2LHEA 1P7FA 2I38A 3FILA 1XCTL 1KH0A 2IGHA 1PGBA 5BMGA 1F2RI 1PGAA 2KWDA 3FILB 2JSVX 1K50A 1ZXHA 2RMMA 2KQ4X 3UI3A 1PGXA 4MACA 2QSDA 4KGTA 1MPEA 2JU6X 5JXVA 1P7EA 2ZW1A 4IKGA 1K52A 2RPVA 1C9FA 4OZBA 1MI0A 2QMTA 2J52A 2LHDA 2N9KA 2N9LA 2N7JA 5HHDG 2KDMA 5BMIA 1QKZA 2EELA 3MP9A 5HG2A 1YMHE 4D2KA 1XF5L 5HI1A 1HZ6A 1MHHE 2LGIA 2PTLA 2ONQA 1GB4A 2K0PA 4HKZE 4IOIE 2J53A 2JZPA 1MVKA 3GB1A 1HZ5A 4KGSA 1FCLA 1IBXA 2JWUA 4OZCA 1HEZE 5HFYA 5BMHA 2LUMA 2I2YA 1IBXB 2KN4A 1UWXA 2ON8A 1XCQL 3V3XA 1IGDA 1Q10A 2GB1A 4KGRA 1MHXA 2OEDA 1YNTE 2NMQA 1EM7A 2IGDA 1FD6A 4HJGE 1F2RC 1JMLA 2GI9A 4WH4A 2ZW0A
chains in the Genus database with same CATH superfamily
2LRWA 3W9CB 2UYZB 3AE8B 3N1XC 1E90A 5FR6A 3AEDB 4RGOS 3RN9C 2KQ7A 3RNBC 3QJZA 1J7AA 5IAAC 2JWZA 1R4MB 3DQVA 3H7SA 1VLBA 1GOZA 3GE3C 2G45B 2DZMA 3B9JA 3ZDMC 1TZ1A 3FILA 4BKSA 3UGBB 2HJ8A 3PV1A 1YX5B 5E6NA 2KOXA 4A6QA 3PS6A 3OJ4B 3P4SB 1UWMA 2WDRB 3HVZA 5LLIA 3SEBA 4ZOHC 2PKOA 1K52A 3L0WB 1E8YA 1H4RA 2MCNB 2FIFA 3TCAA 1MI0A 2K8HA 2MWSB 1CK1A 1V80A 4K81A 2OOBB 2N9LA 2N7JA 2XNAC 1JWSD 3AEEB 5T8IA 1Q0WB 2MBQA 2MP2B 1I42A 3VH4B 2YVCA 5BYRA 4MEMA 2CJOA 3VTWA 1STEA 1WXMA 2PTLA 2WXGA 1P1AA 3V62A 2L05A 1R4NI 3ZVVA 4WQMA 5L83A 1UNSA 1PQSA 2K3UA 1KFYB 2MBEA 1NI3A 1WZ0A 1AW7A 2DYOA 3UINB 1IBXA 2Z0DB 2JWUA 3DBLB 1RAXA 2SEBD 2L83A 4M8NA 1XD3B 4YSYB 3K9PB 2LGSA 2LRUA 3QA8A 2AL6A 2O6VA 1E6EB 3VVWB 3X0WA 2KWVB 4HCPB 2WP9B 1V1OA 3BYTB 2CKHB 5H8YE 1E8XA 4GU2A 3AE9B 1EM7A 3L13A 1X1MA 2O2VA 2LGXA 1L4ZB 4N6EB 2DYBA 4W9DA 3U7DA 3M63B 3Q6BA 1XT9B 2JX5A 4W9HA 2PJHA 3KQ4A 4EZKA 2GBNA 2W82A 3TBLD 3AU5A 2KFKB 3QARA 4BVUC 2PLPA 2KXJA 2L7RA 1SXTA 3V61A 5E6OA 5H92C 4NJ6A 2ZCCA 5BMGA 1IUEA 1HXYD 1ZXHA 2RD0A 1V81A 4PT5A 2LXAA 1D5XC 1EWCA 1Z2MA 2XK5B 1SGHA 2GRIA 2FBWB 1YQ4B 1V8CA 2QCZA 2LHDA 4FJYA 5EE9A 2BYFA 4JWUC 1OGWA 4JX1C 1N61A 4MSMB 3SR6A 1L6VA 3NG0A 1SE4A 4MJSA 1WMHB 5HG2A 2XN9C 1TS5A 2RDGA 4GDKA 2Y5BB 4ZDVA 4HWIB 3B08A 3RULA 3B1LX 1A5RA 3PSEB 3W1SC 3KUCB 2JT4B 4HXDA 3TSSA 3WAOA 2FCMA 2M19A 4EEWA 3LXFA 3HVDA 3VQIA 1FCLA 2BS4B 4RGTA 3B0AA 4L1BA 1OTRB 4XGAB 2I1KA 1GUAB 1FO4A 3RPFC 3QAQA 3KW5B 4LNFA 4AJWA 2WXIA 4IW0A 1QILA 4XE0A 3RD2A 2DAFA 1J7CA 2JYTA 2D11A 3NOBA 4KKJA 2WXMA 4YTPB 4KIKB 1ZOYB 4B95A 1FCCC 1DOXA 2VH1A 2BF8B 1F52A 1NYRA 3TEXA 1D5MC 3BIID 1V9JA 4EUTA 4J3OD 4XDDA 3MTNB 1XO3A 1TY2A 4BKGA 2JRIB 2LJIA 4DK5A 1WE7A 1UZXB 3R2IA 3AE2B 3WA0A 2N7DA 4GDLB 3AULA 2IO1B 3ZQ4A 1J0GA 2RDHA 1SJHD 3ZNHB 2L1AA 2NBUA 3EGRA 3VAWA 4EZJA 2N9KA 1QT9A 1E7UA 4RF0A 3ENEA 2OHFA 2V4IB 2DENB 2JVCA 1VZ7A 1E7PB 1V2YA 1C77A 1FNWA 1TZOA 2W3SA 1YIWA 1TKGA 2L32A 3JW0X 3AECB 3ZXRA 1P98A 3N20C 2IY1B 3DHGC 5HFYA 4YL8A 5TR5A 4MDKE 2JXXA 4NPNA 4KGRA 4C00A 4II3B 3H1UA 4RH6A 1ROEA 2DAJA 4II2B 4KSKC 3IXSA 1KJTA 2KJ6A 4HPMB 3P2BA 1HTQA 4XC2A 4DHJB 1NYQA 2HJ1A 4PYZA 1ZW7A 2Y5CA 2QILA 1DOIA 4FHJA 2NTTA 4C4VB 3CSFA 1J8CA 2GBRA 1MG8A 1N62A 3HM3A 2C9WB 2RGFA 3MC0B 2DHZA 4DXFA 1GPXA 2K39A 3AEAB 2EKIA 1KH0A 4ZRJA 1K8RB 2C7NB 2KWDA 2RSUA 1K50A 4A90A 2N0SB 1FXIA 3VH3B 3HM6X 2K1FA 2KMMA 1ET9A 3WCQA 4K7SA 1VRAB 2MP2A 5HHDG 3CIRB 4BKTA 2KX0A 1CQVA 1R4NB 4TUUA 4KZCA 4FADA 2W54A 4KDLB 3RYTA 1XF5L 2G4DB 4IWPA 1VZ8A 2DWQA 3APDA 1MHHE 2D2QA 4WWNA 4CQNA 1MJDA 3Q3JA 2MQJA 2ZNVB 2BB6A 2D3AA 4JPSA 1FPYA 4M0WB 3SHQA 3LJ3A 1EU3A 3PO0A 1E8ZA 3ZKJC 2G9HD 4FBJB 2CHWA 3TUOA 2KN4A 2L52A 2Z0EB 2DLBA 2J0JA 3DVNU 3DVGY 5CTRC 4W9IA 2C7MB 3L4PA 3JYUA 2K5PA 2M4NA 4C56C 2D10A 1ZP0B 2ZCBA 3A1QB 4ITKA 4HJGE 3WIMA 1RM6C 1WX7A 3DVNV 3SFEB 1N5WA 2J0KA 4NAMA 2PPHA 4FN2A 1DYQA 1WSPA 1OQRA 3NVYA 4NY0A 1PUTA 3ZDTA 1CMXB 2KFKA 4K3BA 3AN1A 3BVZA 2JZ3B 4K3CA 3P4QB 2MSED 3I57A 5AEKB 2B76B 3ZNZB 1YOVB 4P16A 2INNE 2SAKA 3NJTA 2NVUI 2ZPNA 2XK5A 4EZLA 2L0TA 2QSDA 4BKSD 1RRBA 1C9FA 3P1MA 4ANWA 3ETRA 3VR9B 2MH7A 4ZRKA 2LFIA 2X38A 3I9V1 1VCBA 1ZPSA 1WMHA 3T3NA 1L4DB 1WXAA 2AL3A 1WRIA 1JCKB 1HZ6A 4LJPB 2ZVOA 4NJCA 3Q8BA 1XLPA 3P42A 1GG3A 2K0PA 4P7IA 3DWGC 1OEYA 2K9XA 1C4AA 3BINA 2LWPA 2INPE 4MGKE 3PTFC 2WNMA 1NEKB 2KDFB 1C4PA 1WR6E 2V3PA 1BT0A 3LYYA 4LNOA 2N1WA 1WGYA 1WI0A 2LGYA 1I4GA 3DHHC 3DBHI 1TBEA 3VUWA 4AP4C 4IM3A 4GMVA 3ZRFA 5FKAC 5J18A 1KF6B 1ZDXA 3FKYA 4ZRPA 4FHKA 4WH4A 3ZNID 4L2YA 2BW2A 2IO0B 1J7BA 3P4PB 1JRUA 4KIKA 2I1JA 4N58A 3ML9A 1L7YA 3VRBB 2KACA 4AJYB 1WGGA 1MG4A 2KN5A 2HTME 3IFWB 4B9KA 3RFZB 4I6PA 4WWOA 1KLGD 1C4CA 3Q14C 3OLMD 1V86A 1F77A 2QEJC 4DQOC 3LB8C 3U4EG 2NPTB 4HPLB 2WXNA 2RMMA 2ACZB 1MFWA 1H8CA 4GDLA 1PGXA 1LGRA 3TL5A 1MPEA 5IKCM 2MW5A 5MPOA 5JXVA 1F0ZA 1AYFA 3AE7B 1D3ZA 3BWUD 1M94A 2K8BA 4OVUA 3Q8FA 2KX3A 4C7YA 4P1BC 2BVCA 2PEAA 4OHJA 4JQWC 1HE8A 2LGDA 3QWZB 2LUEA 4FJVB 4FJZA 3OG5A 4ZHPA 3IT4B 4PS3A 2BKRB 2JYEA 4ARCA 2LJ5A 5JHBA 1JALA 3ZO5B 4HK2A 3QHTA 5E6JA 3O65B 3AE5B 4WJQA 5J17A 1KTKA 1E8WA 2Y3AA 3PLUA 3AE3B 3CMMB 2L3ZA 4GXBA 2NCNA 2QHOA 1PDXA 1QOFA 2ZEQA 4ANXA 3T8MA 4PK1A 3KLSX 3GZNI 4EOYA 2WXLA 4DDGD 4RGMA 3HHMA 3JSVB 3PVLA 4A3PA 3EFUA 2KC1A 3QC8B 5D2MB 4C4VA 4O1NA 1Y8RC 1KLUD 4CHKA 1SEBD 2FE8A 2Z8LA 3DBSA 4HKQA 1SE9A 3AEFB 3IAM1 3NHEB 5AZGA 1EF1A 3ZIMA 1FNUA 4OZAA 3UIOB 1WGHA 4P1CC 2KANA 1P7FA 3CSTA 2IGHA 5HKHA 2KLGA 1LM8B 3V05A 3W5UB 2WXFA 3VFKA 4A20A 1SBBB 4LTUA 1RWSA 1FIQA 1WXVA 3NS1A 2DZJA 4DHZE 2WDQB 4BZAA 3IBEA 2EKEC 3X23A 4MSQB 2DBYA 1V1PB 4H2AA 5BO4B 2JUOA 4W9JA 1OFFA 1UF0A 2J4XA 2J7QB 4AQ7A 2FAZA 3HIZA 5GXGB 5HI1A 4KV2A 3W5VB 1L6UA 3MHSD 2A4ZA 1SIJA 4HKZE 4M0WA 2KLCA 1KRHA 4A55A 3WANA 3A9JB 4WURA 1HZ5A 1QOAA 3ONSA 3RI7C 3BY4B 4I6NB 4HRSA 3RNEC 2IY0B 5JH5C 1WWTA 3V3XA 4M01A 1IGDA 2VZKD 2JRHA 4LCDE 3A1QA 3T9LA 1G6JA 4B0MA 1OEYJ 2LVQA 2ICIA 1ACCA 2GI9A 4XWWA 1WM3A 1V5TA 4K7UA 2J42A 1K53A 3KUZA 2WLBA 4JGHB 3BVGA 1JWMD 2BS2B 3NVZA 5C23A 1GJZA 3IG3A 5IA7A 4S0RA 2AQ2B 4P6VF 5IN7A 2B3AA 3M3JA 4MM3A 2E6XA 2I38A 2NBWB 4LDTB 3ECIA 3ZTCA 2BB5A 5KHOA 3NVVA 2X8XX 2WYQA 4E71A 4DXGA 3MJ5A 4AWJA 2VRRB 1I4QA 2INDC 4JL9A 3H7PB 2WDVB 2KD0A 1YN4A 4I6LB 4IUMB 4YWGG 1JROA 1QOBA 1JRPA 2YEPF 3PT2B 1JWAD 2QMTA 2J52A 2WXPA 5EE3A 1JQ4A 2V9HA 1NVID 2KDMA 1SE3A 2BPSA 2JPHA 2AX5A 3V6EB 1GAQB 1AN8A 1WZ3A 1VR9A 4RCOA 4LNKA 1GB4A 2IYDB 3U30A 4WAFA 4B6WA 3Q8CA 1MVKA 1VJKA 4MGIE 1V5OA 3E56A 3W1YA 3DBHB 2L00B 3Q3FA 4MELA 1QQRA 2D3GA 2NTSA 4HEA1 4KDIC 4ZHOA 2XBBC 4KVGB 4GGQA 5C1ZA 5FR3A 2KDEB 2C7HA 1R4MI 4JWSC 4E3CA 4RM9A 4LNNA 4DXAB 3PRZA 5D6JB 4JE3B 4NQKE 2DX5B 3L54A 4HLEA 4IM0A 3VXWA 1DOYA 1D4BA 1KM7A 3NVWA 3ZJUA 4GSWA 2KDBA 4IM2A 3AMZA 3VUXA 3AM9A 2C60A 2FUG1 3Q3OC 4FA6A 3QK0A 2NPTA 1IPGA 1GB1A 4BBNC 2N9EB 5DPRA 1GNUA 3ZW3A 1NENB 1PGBA 3AXCA 2NS5A 3ALBA 3EA6A 4EE2A 2W3RA 3NY5A 1T6BX 3UI3A 4MACA 3UQAA 2N7EA 1V6EA 2K25A 1VDVA 3KWVA 3E9SA 1HTOA 1B1ZA 2H88B 3ZJTA 4AUQC 3N1YC 4USAA 2EELA 3R8BA 3DBLI 2ONQA 4ZRQA 1I35A 1OQQA 3QCAA 1WYGA 2J53A 2JZPA 3PPAA 4AS1A 4E74A 2O2VB 3R7RA 1XLQA 5DPWA 3DDCB 1YX6B 4XYCA 1HEZE 3GZNB 2DZKA 4ZYNA 2MBHA 4TQ0A 2ON8A 1XCQL 4KKIA 4PS7A 1BMLC 2VH2A 1WJ4A 3M62B 3L16A 2IGDA 1JMLA 3P63A 2OJWA 2PVGC 5CHFA 4WIPA 2KWCA 4GOCA 1WF9A 2V0GA 3TJPA 4RMAA 1ZUD2 4W9KA 4ANUA 3C19A 3VHTC 1IP9A 4PYUA 3PZ7A 3ZTDA 2LXCA 2N9XA 3NZ3A 2JXTA 1YJ1A 3R7QA 4A3OA 1ESFA 1XXGA 3UF8A 2GLSA 3P4RB 2D3CA 1UGJA 4WJNA 2WQYB 4CYEA 3V6CB 1V49A 2KQ4X 3AH7A 5G5HA 3JVZX 2D5GA 4YT0B 1XLNA 1NBFC 4KSLC 4F7ZA 2WXQA 1V1PA 3N30A 1UH6A 2LASA 4HDQA 4FXCA 4ARIA 4NJ7A 4C80A 3Q2AC 5C2TB 5JZEB 2BYVE 2IO2B 2LEKA 2M0AA 2NR2A 1IYFA 1QKZA 3D32A 3H6NA 3NS8A 5AZHA 2LD9A 4JIOU 1FMAD 1ISNA 1P9DU 4G0NB 3N3KB 2KJRA 1WGDA 2KC2A 2PIAA 3N9YC 3L17A 3UQBA 3VUYA 2ZVNA 4US9A 2V3SA 3A9JA 4MH0E 4W9FA 4XX5A 2BT6A 3KWLA 1I4RA 4A8XC 5G2NA 4ACFA 3IAS1 4CO7A 3TIXA 3A9KB 1TYGB 4YSXB 2LMCA 1UWXA 2N4FA 1L2NA 2GB1A 2V4LA 2QIEB 2OEDA 1YNTE 2G1EA 1TKYA 2NMQA 2FCNA 3R2TA 3C0RB 3EUB2 3AE6B 2Q5WD 2KKCA 3PRMB 1RFAA 4RNAA 3MJWA 4ICUA 3KVFB 3DBRI 5G5GA 4HCNB 3R66C 4XWTA 4DHJD 3RUIB 2WWZA 3CWIA 4YTMB 2KWUB 1QF6A 5IO9A 3PGEA 2ZPYA 4XZ4A 3RT3B 4W9EA 1C78A 1NI2A 2O6VD 5CHVC 5D94A 2JF5A 3APCA 4HJKA 3H7PA 4JLCA 1T0SC 2JU6X 4M8MA 2FUHB 4S17A 4IKGA 2RPVA 1T5XD 2BKFA 4GB9A 2PVOD 2BBCA 4RFBA 4FLHA 2BWES 2R61A 2UWQA 1OQYA 2WXHA 2ZZPB 3EECA 3OWEB 1T3QA 2LGIA 5EDSA 3ZLZA 4TV3A 2EMTA 3T3OA 3WAPA 3IHPC 3SFDB 2INCC 3AI5A 2CHZA 4Q2JA 2WXKA 2KK8A 2CJNA 3GB1A 2MJ3A 1LO5D 1Z5SB 1TGZB 2IPKD 2WX1A 4KGSA 3AEGB 4IC7B 4BAXA 3L10B 2YEPB 2I2YA 2WU5B 3TMPB 4BFRA 3NZSA 3APFA 1Q10A 1UBIA 2KZRA 3ZNGC 1T0RC 1Y56A 1B9RA 2PW9A 2R2OA 2MLBA 4ANVA 3W1SA 2BWFA 3KUDB 3VTUA 3U7ZA 2MRPA 1JW9D 1EWYC 1TS2A 5BYSA 3B2FA 3NZUA 2W9NA 5E6PA 3DWMA 4W9CA 2L8JA 3RNCC 4BBNF 4WWMA 3DCGA 3RNGC 1D6EC 1WIAA 4B0EA 5DPSA 3OAWA 3U8ZA 2MA9B 4IWOA 2WXJA 2MJEA 2RR9A 1NDDA 5DPTA 4OZBA 3VTVA 5LNK1 1UELA 2GBKA 3AEBB 3Q69A 4IG7B 2LVPA 4TKNA 1A70A 1L5PA 3U2SC 2GOWA 4A9AA 2QDFA 4BOSC 2PE6B 4DDID 3VR8B 2KVRA 1SF0A 3QQ8B 5LXHA 2NBVB 3H9DA 3KYDD 1KOTA 1PFDA 1LQBA 3VDZA 3AB5A 1L0YB 4ICVA 5D3IB 1SSNA 1V97A 2WXOA 1R7SA 1TY0A 4YTNB 2BQQA 3Q3NC 2CU3A 2KTRB 3WALA 3DHIC 1T0QC 2K6DB 1FRRA 4RGNA 4G11A 3PHWB 2WU2B 4HROA 2JZZA 3C8YA 3ZRCA 3BYYB 2KT7A 3ZYYX 1P0RA 1WRDB 4ASWC 1K51A 5JHAA 2K6QA 4NAWB 2HTHA 2H89B 2KFJA 2E3TA 5GMVA 1TJEA 1N63A 4IWQA 1S3SG 2L76A 4WAAA 2M8SA 1FFUA 3RNFC 1XCTL 2DYMA 1JWUD 5LXIB 2A5UA 4W9LA 4MGZE 3A4RA 2WHIA 4MT5A 2CS4A 4NQLB 2PMVA 1QZEA 4RM8A 4KGTA 1P3QU 2MHJA 2BYEA 4R3DA 3ZXVA 3AE1B 4NZLB 1E7VA 3RMKC 2KAJA 1QOGA 2LVOA 2CHXA 3A4SC 5BMIA 3MFGA 4FULA 3ML8A 3GS2A 5FK9C 2WXRA 1XQQA 3KYCD 5J2RA 3GOEA 3AV8A 3RZFA 2MBBB 1Q1OA 2KTFA 3Q3MC 4OW0A 4MH8A 3A9KA 4ZYSA 2LZ6A 2LI5A 3BZDB 2C5LC 2LUMA 1N60A 1UGMA 4REZA 1WGKA 3MC8A 1N6ZA 4YXDB 1YN5A 1XLOA 1ZKHA 4DWFA 2TSSA 3DBRB 3DVGX 2GBJA 1E9MA 1TS4A 3Q8AA 5EE0A 3U52E 1E10A 4GN1A 1BXTA 1ZDVA 1WX9A 1YN3A 2QJLA 2JQRB 1CZPA 2G4SA 3DPDA 3MHZA 4OVZA 3SD5A 4WJOA 1L0XB 2MBOA 4URKA 4XDCA 4GLSC 1C1YB 1ENFA 3RZWC 2YLMA 1J19A 4G50A 5I4DA 2ZNVC 2WS3B 1F2RI 3PZDA 4AOFA 3FILB 1HA5A 2JSVX 2MX2A 1EU4A 2BYTA 3ZJVA 5D7GA 3FC4A 3IT6B 4TSSA 5AUIA 2IJ0A 3UIPB 1TS3A 3NRZA 4BOZB 2AQ1B 4TMAB 2AWTA 4OVVA 1ZXIA 2KMCA 4F1SA 3ZUNA 2CR5A 2ASQA 3N1ZC 1VZ6A 3PREA 3MP9A 1WGRA 1ET6A 4LNIA 2M56B 5CX3A 2D3BA 5KHQA 2K8CA 1I4PA 2JY6A 1UD7A 1WFYA 3PRPB 1L0VB 3FAHA 4QAYA 4WQOB 1WY8A 4RF1A 1SIFA 3AE4B 2KHWB 4LK0M 2FNJB 4NNJB 4PS8A 5TSSA 1IBXB 3DOWA 1DGJA 3BVMA 1E0ZA 4M00A 3QIJA 2O6VB 2AQ3B 2BS3B 1EF5A 1HQRD 1FD6A 2ZW0A 1SE2A 1WJNA 1FM0D 5G55A 3URYA 3SDLC 1I4XA 1UUPA 2N1VA 2N9PC 4EKUA 5IOIA 2FIDA 2HDEA 1WM2A 4LJOB 2J0MA 1M4VA 1IGCA 3I5JC 4WWPA 2HD5B 3JSVA 2LHEA 5BYQA 1I7HA 3AU4A 2KQSA 2EMSA 3TEWA 2M17A 1FEHA 3N32A 4LDTD 4WJPA 4M02A 2KNBA 2G3QB 2UU7A 2KVZA 3OJ3A 4HDOA 2V1YA 2XEWA 2ZW1A 1Q5WB 5EE1A 1FRDA 4C7ZA 2MJDA 2IO3B 2M0XA 3LDZE 4X57B 1TIFA 1RYJA 1BUIC 4N59A 3MC9A 3HRDD 3IVFA 1FNVA 4KZ0A 4W9GA 3TEZA 2GMIC 3L08A 3PHXB 1D5ZC 1GC6A 1CJEA 3GE8C 4D2KA 3CF6E 1YQ3B 4UDUC 1AWDA 4G3XB 4GIVA 4MJSB 5C3JB 4HVBA 5IP4D 4GDKB 1YJJA 4IOIE 3B2GA 1LXDA 1ZE3D 1U4AA 4EFOA 1FXAA 2KTRA 3I63C 2ZJDA 5CHWA 2R2QA 2DNFA 3EFCA 4LLGM 4OZCA 3WAMA 1KLVA 3K9OB 1F1HA 1RLFA 1N5XA 1YQBA 2WDTB 1JWBD 3RNAC 2D07B 1MHXA 1WXSA 4K1RB 1TT5B 3PLVA 2PE9A 1F2RC 3BK2A 3KH0A 1RFKA 3A33B 2CU1A 1E5WA 4MM3B 2FCQA 3ABVB 4NAWA 3I3TB 1SB3C 2IGGA 1FFVA 4US8A 3H8HA 5AZFA 4ZRIA 1F9JA 3EHVA 3QX1A 2AYOB 2Z59B 1WX8A 1WYWB 2AEHA 1C76A 1C79A 5L95C 1WXQA 1WJUA 4DBGA 2BTEA 1XEEA 3ZGZA 2BGFA 1FXTB 1ZGUB 2MEKA 4TQ1A 3HUIA 3EC8A 1VD2A 1WH3A 3R3MA 3NUHB 4IDIA 5DCNA 1PGAA 3BK1A 1WR1A 1S1QB 2V3NA 1SJED 3VRAB 1PYWD 1WJ6A 1I4HA 1QLBB 2FCSA 2KYWA 4J6IA 1P7EA 2WX0A 3M95A 4MGYE 1AARA 3O13A 1T0YA 1GC7A 2GBMA 3TEYA 3RCZA 3PZ8A 2IDYA 2REXA 2IZVB 4F8CB 2KMAA 5D3DA 1YMHE 3J9CA 4HPPA 2M1MA 4YSZB 1EUVB 2KDIA 4L23A 1C3TA 2KO3A 2K22A 2RPQA 4K7WA 1TTNA 3W2DA 1WE6A 2IBIB 1LFDA 3GP7A 4DHZB 3Q8EA 4N9F4 3SU8X 2OJRA 5AUKA 2VZKB 2QC8A 5BMHA 4KX6B 1UBQA 2RDBC 3V60A 1EO6A 2HE7A 1TKEA 2Y5PA 1YJIA 3S2AA 2L0FA 1YD8U 2W55A 2DZIA 2WGSA 2KJHB 3HK0A
chains in the Genus database with same CATH topology
3W9CB 3BYYB 4JE3B 3SFEB 3AE8B 1N5WA 4NAMA 3AEDB 4RGOS 3ZYYX 1DOYA 1DYQA 1D4BA 1WSPA 1K51A 3NVWA 4NAWB 1J7AA 1OQRA 2H89B 3NVYA 3ZJUA 2E3TA 1PUTA 3AMZA 3AM9A 1TJEA 1VLBA 2FUG1 3AN1A 3BVZA 1GOZA 1N63A 3P4QB 3I57A 1GB1A 3B9JA 1FFUA 2B76B 1XCTL 3FILA 1NENB 1PGBA 4P16A 2DYMA 1JWUD 3EA6A 2INNE 2SAKA 4A6QA 4EE2A 2W3RA 4MT5A 1T6BX 3P4SB 3UI3A 4MACA 1UWMA 2QSDA 2WDRB 3HVZA 2PMVA 3SEBA 4KGTA 1VDVA 4R3DA 4ZOHC 3AE1B 2PKOA 1K52A 1C9FA 4NZLB 3P1MA 3ETRA 3KWVA 3VR9B 2MH7A 3E9SA 1MI0A 2KAJA 1B1ZA 2LFIA 2H88B 2X38A 3I9V1 1QOGA 1CK1A 3ZJTA 1ZPSA 2N9LA 2N7JA 2XNAC 3T3NA 1L4DB 1JWSD 3AEEB 5T8IA 5BMIA 4USAA 2EELA 3MFGA 3R8BA 1WRIA 5BYRA 1JCKB 3GS2A 2CJOA 1HZ6A 5FK9C 2WXRA 1STEA 4NJCA 2PTLA 3Q8BA 2WXGA 1XLPA 2ONQA 4ZRQA 3P42A 2K0PA 1OQQA 3DWGC 3AV8A 4WQMA 1UNSA 1WYGA 2J53A 2K9XA 2K3UA 1C4AA 2JZPA 2INPE 4AS1A 1KFYB 2WNMA 1NEKB 1NI3A 4MH8A 4OW0A 1XLQA 1C4PA 1AW7A 2DYOA 4ZYSA 2V3PA 1IBXA 2JWUA 2SEBD 2L83A 3LYYA 1HEZE 3BZDB 4YSYB 2LUMA 4TQ0A 1N60A 1I4GA 4REZA 1E6EB 1WGKA 1XCQL 2ON8A 2WP9B 4KKIA 1V1OA 1BMLC 3BYTB 4YXDB 5H8YE 1YN5A 3AE9B 1EM7A 1XLOA 2TSSA 5FKAC 1KF6B 1ZDXA 2IGDA 4ZRPA 1JMLA 3P63A 1L4ZB 4N6EB 1E9MA 4WH4A 2PVGC 4L2YA 2BW2A 4WIPA 1J7BA 1TS4A 2V0GA 3Q8AA 2JX5A 3P4PB 5EE0A 3U52E 1E10A 1BXTA 1ZDVA 1ZUD2 4N58A 3VRBB 2KACA 1YN3A 2QJLA 3KQ4A 2JQRB 1CZPA 3MHZA 2HTME 4OVZA 3RFZB 1L0XB 3PZ7A 2W82A 1KLGD 1C4CA 3NZ3A 2JXTA 4GLSC 4XDCA 2PLPA 1ENFA 1F77A 1SXTA 2QEJC 4DQOC 3LB8C 5I4DA 3U4EG 5H92C 1ESFA 1XXGA 3P4RB 2WS3B 2WXNA 1F2RI 5BMGA 1UGJA 1IUEA 1HXYD 2WQYB 3FILB 1HA5A 2JSVX 1ZXHA 1EU4A 2RMMA 2KQ4X 2ACZB 3AH7A 4PT5A 2BYTA 3ZJVA 5D7GA 5G5HA 3FC4A 1PGXA 2D5GA 4YT0B 1D5XC 1EWCA 1XLNA 3IT6B 4TSSA 5AUIA 1MPEA 2IJ0A 1TS3A 5MPOA 3NRZA 5JXVA 1F0ZA 2GRIA 1AYFA 2WXQA 1V1PA 2FBWB 3AE7B 3BWUD 2AQ1B 1YQ4B 4FXCA 4ARIA 1V8CA 4TMAB 4C80A 3Q8FA 5C2TB 4C7YA 2LHDA 1ZXIA 4OHJA 5EE9A 2LEKA 2M0AA 4JWUC 4JX1C 1N61A 3SR6A 1QKZA 1L6VA 1VZ6A 4ZHPA 1SE4A 3IT4B 2JYEA 4ARCA 3MP9A 5HG2A 2XN9C 1JALA 1ET6A 1FMAD 1TS5A 2M56B 2RDGA 5E6JA 2PIAA 3AE5B 3N9YC 4US9A 1I4PA 1KTKA 1L0VB 3FAHA 3TSSA 2Y3AA 2BT6A 3AE3B 3KWLA 2M19A 1I4RA 4A8XC 3LXFA 3HVDA 4RF1A 3VQIA 1FCLA 3IAS1 2BS4B 3AE4B 1PDXA 4LK0M 4RGTA 4L1BA 1QOFA 1TYGB 5TSSA 1IBXB 1FO4A 3RPFC 2LMCA 4YSXB 1DGJA 1UWXA 3BVMA 1E0ZA 2GB1A 2WXIA 2QIEB 2OEDA 1YNTE 2AQ3B 2G1EA 1TKYA 2BS3B 2NMQA 3KLSX 2WXLA 1QILA 3R2TA 3EUB2 4RGMA 1HQRD 1FD6A 3AE6B 4XE0A 2ZW0A 2Q5WD 1SE2A 1FM0D 1J7CA 3URYA 2JYTA 4RNAA 4O1NA 1I4XA 1UUPA 1KLUD 1SEBD 4KKJA 2FE8A 2WXMA 2Z8LA 5G5GA 4HKQA 4XWTA 4YTPB 3CWIA 4YTMB 1ZOYB 3AEFB 1FCCC 2HDEA 1DOXA 3IAM1 1M4VA 1IGCA 1QF6A 1NYRA 1FNUA 3TEXA 4OZAA 1D5MC 3BIID 2LHEA 5BYQA 1P7FA 1I7HA 1C78A 2IGHA 4J3OD 4XDDA 3TEWA 1FEHA 1XO3A 1TY2A 2LJIA 3V05A 3W5UB 2WXFA 3R2IA 1SBBB 2JU6X 4LTUA 1RWSA 1FIQA 3AE2B 3NS1A 4GDLB 2WDQB 2ZW1A 4IKGA 5EE1A 2RPVA 1T5XD 1FRDA 3ZQ4A 4C7ZA 2DBYA 2RDHA 1SJHD 2MJDA 2L1AA 1V1PB 3EGRA 4H2AA 1RYJA 1BUIC 2PVOD 4N59A 2BBCA 1OFFA 3HRDD 2N9KA 4RFBA 1FNVA 1QT9A 3TEZA 4RF0A 2J4XA 2R61A 2OHFA 1D5ZC 4AQ7A 2V4IB 2WXHA 1CJEA 4D2KA 3OWEB 5GXGB 1T3QA 1VZ7A 1YQ3B 5HI1A 1E7PB 4UDUC 1C77A 1AWDA 1FNWA 1TZOA 2LGIA 3W5VB 5C3JB 2W3SA 1L6UA 1SIJA 4HKZE 4GDKB 1YJJA 4IOIE 4M0WA 3T3OA 3B2GA 1KRHA 3SFDB 1TKGA 4Q2JA 1ZE3D 2WXKA 2L32A 2CJNA 4A55A 3GB1A 1FXAA 2MJ3A 3AECB 4WURA 1LO5D 1HZ5A 2IPKD 4KGSA 1QOAA 4OZCA 4LLGM 3AEGB 5HFYA 2YEPB 2I2YA 4HRSA 2WU5B 1N5XA 1WWTA 3V3XA 1JWBD 1IGDA 2VZKD 1Q10A 4KGRA 1MHXA 4B0MA 4RH6A 1ROEA 2ICIA 1ACCA 1F2RC 3BK2A 2GI9A 3IXSA 1RFKA 4XWWA 2J42A 4MM3B 1Y56A 1B9RA 2PW9A 1K53A 3ABVB 2WLBA 1NYQA 1SB3C 1FFVA 2IGGA 3BVGA 4US8A 1JWMD 2Y5CA 2QILA 3H8HA 1DOIA 3W1SA 2NTTA 2BS2B 3NVZA 3U7ZA 1JW9D 1EWYC 1C76A 1C79A 2AQ2B 1TS2A 1WXQA 1N62A 4P6VF 5BYSA 3B2FA 2BTEA 1XEEA 3DWMA 3MC0B 3ZGZA 2E6XA 2I38A 4DXFA 2MEKA 3AEAB 1GPXA 4TQ1A 3HUIA 2EKIA 1KH0A 2BB5A 4WWMA 3NUHB 1D6EC 4IDIA 3NVVA 1PGAA 3BK1A 2KWDA 1K50A 2V3NA 1SJED 3VRAB 4A90A 2N0SB 1FXIA 4B0EA 4DXGA 1PYWD 3MJ5A 1I4HA 1QLBB 1I4QA 2WXJA 2MJEA 2WDVB 1P7EA 1YN4A 4YWGG 3O13A 1JROA 2KMMA 1ET9A 1QOBA 1JRPA 2YEPF 3TEYA 4OZBA 1JWAD 2QMTA 5LNK1 3WCQA 3PZ8A 2J52A 2IDYA 1VRAB 3AEBB 3Q69A 2WXPA 5EE3A 1JQ4A 5HHDG 3CIRB 1NVID 2KDMA 1SE3A 1CQVA 2AX5A 2W54A 5D3DA 1A70A 1L5PA 1GAQB 1AN8A 1YMHE 3J9CA 3U2SC 1VR9A 1XF5L 4A9AA 4YSZB 1VZ8A 2DWQA 4RCOA 1MHHE 4L23A 3VR8B 4CQNA 1GB4A 1SF0A 2K22A 2BB6A 4JPSA 4WAFA 3W2DA 1PFDA 3Q8CA 1MVKA 3AB5A 1VJKA 1L0YB 3E56A 3GP7A 3Q8EA 5D3IB 1SSNA 1V97A 2WXOA 1R7SA 1QQRA 2NTSA 4HEA1 1EU3A 1TY0A 3PO0A 4YTNB 5AUKA 2VZKB 4ZHOA 2G9HD 2CU3A 5BMHA 4KX6B 3TUOA 2KN4A 2L52A 1FRRA 2DLBA 4RGNA 5FR3A 1TKEA 2Y5PA 3L4PA 2K5PA 1YJIA 2WU2B 4C56C 1ZP0B 4ITKA 4HJGE 2W55A 4HROA 4JWSC 3C8YA 1RM6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PW9 A;  1K53 A;  2IGG A;  1D4B A;  1K51 A;  2KAC A;  1FCC C;  1IGC A;  2JXT A;  4GLS C;  4OZA A;  1GB1 A;  2PLP A;  2LHE A;  1P7F A;  2I38 A;  3FIL A;  1XCT L;  1KH0 A;  2IGH A;  1PGB A;  5BMG A;  1F2R I;  1PGA A;  2KWD A;  3FIL B;  2JSV X;  1K50 A;  1ZXH A;  2RMM A;  2KQ4 X;  3UI3 A;  1PGX A;  4MAC A;  2QSD A;  4KGT A;  1MPE A;  2JU6 X;  5JXV A;  1P7E A;  2ZW1 A;  4IKG A;  1K52 A;  2RPV A;  1C9F A;  4OZB A;  1MI0 A;  2QMT A;  2J52 A;  2LHD A;  2N9K A;  2N9L A;  2N7J A;  5HHD G;  2KDM A;  5BMI A;  1QKZ A;  2EEL A;  3MP9 A;  5HG2 A;  1YMH E;  4D2K A;  1XF5 L;  5HI1 A;  1HZ6 A;  1MHH E;  2LGI A;  2PTL A;  2ONQ A;  1GB4 A;  2K0P A;  4HKZ E;  4IOI E;  2J53 A;  2JZP A;  1MVK A;  3GB1 A;  1HZ5 A;  4KGS A;  1FCL A;  1IBX A;  2JWU A;  4OZC A;  1HEZ E;  5HFY A;  5BMH A;  2LUM A;  2I2Y A;  1IBX B;  2KN4 A;  1UWX A;  2ON8 A;  1XCQ L;  3V3X A;  1IGD A;  1Q10 A;  2GB1 A;  4KGR A;  1MHX A;  2OED A;  1YNT E;  2NMQ A;  1EM7 A;  2IGD A;  1FD6 A;  4HJG E;  1F2R C;  1JML A;  2GI9 A;  4WH4 A;  2ZW0 A; 
#chains in the Genus database with same CATH topology
 2LRW A;  3W9C B;  2UYZ B;  3AE8 B;  3N1X C;  1E90 A;  5FR6 A;  3AED B;  4RGO S;  3RN9 C;  2KQ7 A;  3RNB C;  3QJZ A;  1J7A A;  5IAA C;  2JWZ A;  1R4M B;  3DQV A;  3H7S A;  1VLB A;  1GOZ A;  3GE3 C;  2G45 B;  2DZM A;  3B9J A;  3ZDM C;  1TZ1 A;  3FIL A;  4BKS A;  3UGB B;  2HJ8 A;  3PV1 A;  1YX5 B;  5E6N A;  2KOX A;  4A6Q A;  3PS6 A;  3OJ4 B;  3P4S B;  1UWM A;  2WDR B;  3HVZ A;  5LLI A;  3SEB A;  4ZOH C;  2PKO A;  1K52 A;  3L0W B;  1E8Y A;  1H4R A;  2MCN B;  2FIF A;  3TCA A;  1MI0 A;  2K8H A;  2MWS B;  1CK1 A;  1V80 A;  4K81 A;  2OOB B;  2N9L A;  2N7J A;  2XNA C;  1JWS D;  3AEE B;  5T8I A;  1Q0W B;  2MBQ A;  2MP2 B;  1I42 A;  3VH4 B;  2YVC A;  5BYR A;  4MEM A;  2CJO A;  3VTW A;  1STE A;  1WXM A;  2PTL A;  2WXG A;  1P1A A;  3V62 A;  2L05 A;  1R4N I;  3ZVV A;  4WQM A;  5L83 A;  1UNS A;  1PQS A;  2K3U A;  1KFY B;  2MBE A;  1NI3 A;  1WZ0 A;  1AW7 A;  2DYO A;  3UIN B;  1IBX A;  2Z0D B;  2JWU A;  3DBL B;  1RAX A;  2SEB D;  2L83 A;  4M8N A;  1XD3 B;  4YSY B;  3K9P B;  2LGS A;  2LRU A;  3QA8 A;  2AL6 A;  2O6V A;  1E6E B;  3VVW B;  3X0W A;  2KWV B;  4HCP B;  2WP9 B;  1V1O A;  3BYT B;  2CKH B;  5H8Y E;  1E8X A;  4GU2 A;  3AE9 B;  1EM7 A;  3L13 A;  1X1M A;  2O2V A;  2LGX A;  1L4Z B;  4N6E B;  2DYB A;  4W9D A;  3U7D A;  3M63 B;  3Q6B A;  1XT9 B;  2JX5 A;  4W9H A;  2PJH A;  3KQ4 A;  4EZK A;  2GBN A;  2W82 A;  3TBL D;  3AU5 A;  2KFK B;  3QAR A;  4BVU C;  2PLP A;  2KXJ A;  2L7R A;  1SXT A;  3V61 A;  5E6O A;  5H92 C;  4NJ6 A;  2ZCC A;  5BMG A;  1IUE A;  1HXY D;  1ZXH A;  2RD0 A;  1V81 A;  4PT5 A;  2LXA A;  1D5X C;  1EWC A;  1Z2M A;  2XK5 B;  1SGH A;  2GRI A;  2FBW B;  1YQ4 B;  1V8C A;  2QCZ A;  2LHD A;  4FJY A;  5EE9 A;  2BYF A;  4JWU C;  1OGW A;  4JX1 C;  1N61 A;  4MSM B;  3SR6 A;  1L6V A;  3NG0 A;  1SE4 A;  4MJS A;  1WMH B;  5HG2 A;  2XN9 C;  1TS5 A;  2RDG A;  4GDK A;  2Y5B B;  4ZDV A;  4HWI B;  3B08 A;  3RUL A;  3B1L X;  1A5R A;  3PSE B;  3W1S C;  3KUC B;  2JT4 B;  4HXD A;  3TSS A;  3WAO A;  2FCM A;  2M19 A;  4EEW A;  3LXF A;  3HVD A;  3VQI A;  1FCL A;  2BS4 B;  4RGT A;  3B0A A;  4L1B A;  1OTR B;  4XGA B;  2I1K A;  1GUA B;  1FO4 A;  3RPF C;  3QAQ A;  3KW5 B;  4LNF A;  4AJW A;  2WXI A;  4IW0 A;  1QIL A;  4XE0 A;  3RD2 A;  2DAF A;  1J7C A;  2JYT A;  2D11 A;  3NOB A;  4KKJ A;  2WXM A;  4YTP B;  4KIK B;  1ZOY B;  4B95 A;  1FCC C;  1DOX A;  2VH1 A;  2BF8 B;  1F52 A;  1NYR A;  3TEX A;  1D5M C;  3BII D;  1V9J A;  4EUT A;  4J3O D;  4XDD A;  3MTN B;  1XO3 A;  1TY2 A;  4BKG A;  2JRI B;  2LJI A;  4DK5 A;  1WE7 A;  1UZX B;  3R2I A;  3AE2 B;  3WA0 A;  2N7D A;  4GDL B;  3AUL A;  2IO1 B;  3ZQ4 A;  1J0G A;  2RDH A;  1SJH D;  3ZNH B;  2L1A A;  2NBU A;  3EGR A;  3VAW A;  4EZJ A;  2N9K A;  1QT9 A;  1E7U A;  4RF0 A;  3ENE A;  2OHF A;  2V4I B;  2DEN B;  2JVC A;  1VZ7 A;  1E7P B;  1V2Y A;  1C77 A;  1FNW A;  1TZO A;  2W3S A;  1YIW A;  1TKG A;  2L32 A;  3JW0 X;  3AEC B;  3ZXR A;  1P98 A;  3N20 C;  2IY1 B;  3DHG C;  5HFY A;  4YL8 A;  5TR5 A;  4MDK E;  2JXX A;  4NPN A;  4KGR A;  4C00 A;  4II3 B;  3H1U A;  4RH6 A;  1ROE A;  2DAJ A;  4II2 B;  4KSK C;  3IXS A;  1KJT A;  2KJ6 A;  4HPM B;  3P2B A;  1HTQ A;  4XC2 A;  4DHJ B;  1NYQ A;  2HJ1 A;  4PYZ A;  1ZW7 A;  2Y5C A;  2QIL A;  1DOI A;  4FHJ A;  2NTT A;  4C4V B;  3CSF A;  1J8C A;  2GBR A;  1MG8 A;  1N62 A;  3HM3 A;  2C9W B;  2RGF A;  3MC0 B;  2DHZ A;  4DXF A;  1GPX A;  2K39 A;  3AEA B;  2EKI A;  1KH0 A;  4ZRJ A;  1K8R B;  2C7N B;  2KWD A;  2RSU A;  1K50 A;  4A90 A;  2N0S B;  1FXI A;  3VH3 B;  3HM6 X;  2K1F A;  2KMM A;  1ET9 A;  3WCQ A;  4K7S A;  1VRA B;  2MP2 A;  5HHD G;  3CIR B;  4BKT A;  2KX0 A;  1CQV A;  1R4N B;  4TUU A;  4KZC A;  4FAD A;  2W54 A;  4KDL B;  3RYT A;  1XF5 L;  2G4D B;  4IWP A;  1VZ8 A;  2DWQ A;  3APD A;  1MHH E;  2D2Q A;  4WWN A;  4CQN A;  1MJD A;  3Q3J A;  2MQJ A;  2ZNV B;  2BB6 A;  2D3A A;  4JPS A;  1FPY A;  4M0W B;  3SHQ A;  3LJ3 A;  1EU3 A;  3PO0 A;  1E8Z A;  3ZKJ C;  2G9H D;  4FBJ B;  2CHW A;  3TUO A;  2KN4 A;  2L52 A;  2Z0E B;  2DLB A;  2J0J A;  3DVN U;  3DVG Y;  5CTR C;  4W9I A;  2C7M B;  3L4P A;  3JYU A;  2K5P A;  2M4N A;  4C56 C;  2D10 A;  1ZP0 B;  2ZCB A;  3A1Q B;  4ITK A;  4HJG E;  3WIM A;  1RM6 C;  1WX7 A;  3DVN V;  3SFE B;  1N5W A;  2J0K A;  4NAM A;  2PPH A;  4FN2 A;  1DYQ A;  1WSP A;  1OQR A;  3NVY A;  4NY0 A;  1PUT A;  3ZDT A;  1CMX B;  2KFK A;  4K3B A;  3AN1 A;  3BVZ A;  2JZ3 B;  4K3C A;  3P4Q B;  2MSE D;  3I57 A;  5AEK B;  2B76 B;  3ZNZ B;  1YOV B;  4P16 A;  2INN E;  2SAK A;  3NJT A;  2NVU I;  2ZPN A;  2XK5 A;  4EZL A;  2L0T A;  2QSD A;  4BKS D;  1RRB A;  1C9F A;  3P1M A;  4ANW A;  3ETR A;  3VR9 B;  2MH7 A;  4ZRK A;  2LFI A;  2X38 A;  3I9V 1;  1VCB A;  1ZPS A;  1WMH A;  3T3N A;  1L4D B;  1WXA A;  2AL3 A;  1WRI A;  1JCK B;  1HZ6 A;  4LJP B;  2ZVO A;  4NJC A;  3Q8B A;  1XLP A;  3P42 A;  1GG3 A;  2K0P A;  4P7I A;  3DWG C;  1OEY A;  2K9X A;  1C4A A;  3BIN A;  2LWP A;  2INP E;  4MGK E;  3PTF C;  2WNM A;  1NEK B;  2KDF B;  1C4P A;  1WR6 E;  2V3P A;  1BT0 A;  3LYY A;  4LNO A;  2N1W A;  1WGY A;  1WI0 A;  2LGY A;  1I4G A;  3DHH C;  3DBH I;  1TBE A;  3VUW A;  4AP4 C;  4IM3 A;  4GMV A;  3ZRF A;  5FKA C;  5J18 A;  1KF6 B;  1ZDX A;  3FKY A;  4ZRP A;  4FHK A;  4WH4 A;  3ZNI D;  4L2Y A;  2BW2 A;  2IO0 B;  1J7B A;  3P4P B;  1JRU A;  4KIK A;  2I1J A;  4N58 A;  3ML9 A;  1L7Y A;  3VRB B;  2KAC A;  4AJY B;  1WGG A;  1MG4 A;  2KN5 A;  2HTM E;  3IFW B;  4B9K A;  3RFZ B;  4I6P A;  4WWO A;  1KLG D;  1C4C A;  3Q14 C;  3OLM D;  1V86 A;  1F77 A;  2QEJ C;  4DQO C;  3LB8 C;  3U4E G;  2NPT B;  4HPL B;  2WXN A;  2RMM A;  2ACZ B;  1MFW A;  1H8C A;  4GDL A;  1PGX A;  1LGR A;  3TL5 A;  1MPE A;  5IKC M;  2MW5 A;  5MPO A;  5JXV A;  1F0Z A;  1AYF A;  3AE7 B;  1D3Z A;  3BWU D;  1M94 A;  2K8B A;  4OVU A;  3Q8F A;  2KX3 A;  4C7Y A;  4P1B C;  2BVC A;  2PEA A;  4OHJ A;  4JQW C;  1HE8 A;  2LGD A;  3QWZ B;  2LUE A;  4FJV B;  4FJZ A;  3OG5 A;  4ZHP A;  3IT4 B;  4PS3 A;  2BKR B;  2JYE A;  4ARC A;  2LJ5 A;  5JHB A;  1JAL A;  3ZO5 B;  4HK2 A;  3QHT A;  5E6J A;  3O65 B;  3AE5 B;  4WJQ A;  5J17 A;  1KTK A;  1E8W A;  2Y3A A;  3PLU A;  3AE3 B;  3CMM B;  2L3Z A;  4GXB A;  2NCN A;  2QHO A;  1PDX A;  1QOF A;  2ZEQ A;  4ANX A;  3T8M A;  4PK1 A;  3KLS X;  3GZN I;  4EOY A;  2WXL A;  4DDG D;  4RGM A;  3HHM A;  3JSV B;  3PVL A;  4A3P A;  3EFU A;  2KC1 A;  3QC8 B;  5D2M B;  4C4V A;  4O1N A;  1Y8R C;  1KLU D;  4CHK A;  1SEB D;  2FE8 A;  2Z8L A;  3DBS A;  4HKQ A;  1SE9 A;  3AEF B;  3IAM 1;  3NHE B;  5AZG A;  1EF1 A;  3ZIM A;  1FNU A;  4OZA A;  3UIO B;  1WGH A;  4P1C C;  2KAN A;  1P7F A;  3CST A;  2IGH A;  5HKH A;  2KLG A;  1LM8 B;  3V05 A;  3W5U B;  2WXF A;  3VFK A;  4A20 A;  1SBB B;  4LTU A;  1RWS A;  1FIQ A;  1WXV A;  3NS1 A;  2DZJ A;  4DHZ E;  2WDQ B;  4BZA A;  3IBE A;  2EKE C;  3X23 A;  4MSQ B;  2DBY A;  1V1P B;  4H2A A;  5BO4 B;  2JUO A;  4W9J A;  1OFF A;  1UF0 A;  2J4X A;  2J7Q B;  4AQ7 A;  2FAZ A;  3HIZ A;  5GXG B;  5HI1 A;  4KV2 A;  3W5V B;  1L6U A;  3MHS D;  2A4Z A;  1SIJ A;  4HKZ E;  4M0W A;  2KLC A;  1KRH A;  4A55 A;  3WAN A;  3A9J B;  4WUR A;  1HZ5 A;  1QOA A;  3ONS A;  3RI7 C;  3BY4 B;  4I6N B;  4HRS A;  3RNE C;  2IY0 B;  5JH5 C;  1WWT A;  3V3X A;  4M01 A;  1IGD A;  2VZK D;  2JRH A;  4LCD E;  3A1Q A;  3T9L A;  1G6J A;  4B0M A;  1OEY J;  2LVQ A;  2ICI A;  1ACC A;  2GI9 A;  4XWW A;  1WM3 A;  1V5T A;  4K7U A;  2J42 A;  1K53 A;  3KUZ A;  2WLB A;  4JGH B;  3BVG A;  1JWM D;  2BS2 B;  3NVZ A;  5C23 A;  1GJZ A;  3IG3 A;  5IA7 A;  4S0R A;  2AQ2 B;  4P6V F;  5IN7 A;  2B3A A;  3M3J A;  4MM3 A;  2E6X A;  2I38 A;  2NBW B;  4LDT B;  3ECI A;  3ZTC A;  2BB5 A;  5KHO A;  3NVV A;  2X8X X;  2WYQ A;  4E71 A;  4DXG A;  3MJ5 A;  4AWJ A;  2VRR B;  1I4Q A;  2IND C;  4JL9 A;  3H7P B;  2WDV B;  2KD0 A;  1YN4 A;  4I6L B;  4IUM B;  4YWG G;  1JRO A;  1QOB A;  1JRP A;  2YEP F;  3PT2 B;  1JWA D;  2QMT A;  2J52 A;  2WXP A;  5EE3 A;  1JQ4 A;  2V9H A;  1NVI D;  2KDM A;  1SE3 A;  2BPS A;  2JPH A;  2AX5 A;  3V6E B;  1GAQ B;  1AN8 A;  1WZ3 A;  1VR9 A;  4RCO A;  4LNK A;  1GB4 A;  2IYD B;  3U30 A;  4WAF A;  4B6W A;  3Q8C A;  1MVK A;  1VJK A;  4MGI E;  1V5O A;  3E56 A;  3W1Y A;  3DBH B;  2L00 B;  3Q3F A;  4MEL A;  1QQR A;  2D3G A;  2NTS A;  4HEA 1;  4KDI C;  4ZHO A;  2XBB C;  4KVG B;  4GGQ A;  5C1Z A;  5FR3 A;  2KDE B;  2C7H A;  1R4M I;  4JWS C;  4E3C A;  4RM9 A;  4LNN A;  4DXA B;  3PRZ A;  5D6J B;  4JE3 B;  4NQK E;  2DX5 B;  3L54 A;  4HLE A;  4IM0 A;  3VXW A;  1DOY A;  1D4B A;  1KM7 A;  3NVW A;  3ZJU A;  4GSW A;  2KDB A;  4IM2 A;  3AMZ A;  3VUX A;  3AM9 A;  2C60 A;  2FUG 1;  3Q3O C;  4FA6 A;  3QK0 A;  2NPT A;  1IPG A;  1GB1 A;  4BBN C;  2N9E B;  5DPR A;  1GNU A;  3ZW3 A;  1NEN B;  1PGB A;  3AXC A;  2NS5 A;  3ALB A;  3EA6 A;  4EE2 A;  2W3R A;  3NY5 A;  1T6B X;  3UI3 A;  4MAC A;  3UQA A;  2N7E A;  1V6E A;  2K25 A;  1VDV A;  3KWV A;  3E9S A;  1HTO A;  1B1Z A;  2H88 B;  3ZJT A;  4AUQ C;  3N1Y C;  4USA A;  2EEL A;  3R8B A;  3DBL I;  2ONQ A;  4ZRQ A;  1I35 A;  1OQQ A;  3QCA A;  1WYG A;  2J53 A;  2JZP A;  3PPA A;  4AS1 A;  4E74 A;  2O2V B;  3R7R A;  1XLQ A;  5DPW A;  3DDC B;  1YX6 B;  4XYC A;  1HEZ E;  3GZN B;  2DZK A;  4ZYN A;  2MBH A;  4TQ0 A;  2ON8 A;  1XCQ L;  4KKI A;  4PS7 A;  1BML C;  2VH2 A;  1WJ4 A;  3M62 B;  3L16 A;  2IGD A;  1JML A;  3P63 A;  2OJW A;  2PVG C;  5CHF A;  4WIP A;  2KWC A;  4GOC A;  1WF9 A;  2V0G A;  3TJP A;  4RMA A;  1ZUD 2;  4W9K A;  4ANU A;  3C19 A;  3VHT C;  1IP9 A;  4PYU A;  3PZ7 A;  3ZTD A;  2LXC A;  2N9X A;  3NZ3 A;  2JXT A;  1YJ1 A;  3R7Q A;  4A3O A;  1ESF A;  1XXG A;  3UF8 A;  2GLS A;  3P4R B;  2D3C A;  1UGJ A;  4WJN A;  2WQY B;  4CYE A;  3V6C B;  1V49 A;  2KQ4 X;  3AH7 A;  5G5H A;  3JVZ X;  2D5G A;  4YT0 B;  1XLN A;  1NBF C;  4KSL C;  4F7Z A;  2WXQ A;  1V1P A;  3N30 A;  1UH6 A;  2LAS A;  4HDQ A;  4FXC A;  4ARI A;  4NJ7 A;  4C80 A;  3Q2A C;  5C2T B;  5JZE B;  2BYV E;  2IO2 B;  2LEK A;  2M0A A;  2NR2 A;  1IYF A;  1QKZ A;  3D32 A;  3H6N A;  3NS8 A;  5AZH A;  2LD9 A;  4JIO U;  1FMA D;  1ISN A;  1P9D U;  4G0N B;  3N3K B;  2KJR A;  1WGD A;  2KC2 A;  2PIA A;  3N9Y C;  3L17 A;  3UQB A;  3VUY A;  2ZVN A;  4US9 A;  2V3S A;  3A9J A;  4MH0 E;  4W9F A;  4XX5 A;  2BT6 A;  3KWL A;  1I4R A;  4A8X C;  5G2N A;  4ACF A;  3IAS 1;  4CO7 A;  3TIX A;  3A9K B;  1TYG B;  4YSX B;  2LMC A;  1UWX A;  2N4F A;  1L2N A;  2GB1 A;  2V4L A;  2QIE B;  2OED A;  1YNT E;  2G1E A;  1TKY A;  2NMQ A;  2FCN A;  3R2T A;  3C0R B;  3EUB 2;  3AE6 B;  2Q5W D;  2KKC A;  3PRM B;  1RFA A;  4RNA A;  3MJW A;  4ICU A;  3KVF B;  3DBR I;  5G5G A;  4HCN B;  3R66 C;  4XWT A;  4DHJ D;  3RUI B;  2WWZ A;  3CWI A;  4YTM B;  2KWU B;  1QF6 A;  5IO9 A;  3PGE A;  2ZPY A;  4XZ4 A;  3RT3 B;  4W9E A;  1C78 A;  1NI2 A;  2O6V D;  5CHV C;  5D94 A;  2JF5 A;  3APC A;  4HJK A;  3H7P A;  4JLC A;  1T0S C;  2JU6 X;  4M8M A;  2FUH B;  4S17 A;  4IKG A;  2RPV A;  1T5X D;  2BKF A;  4GB9 A;  2PVO D;  2BBC A;  4RFB A;  4FLH A;  2BWE S;  2R61 A;  2UWQ A;  1OQY A;  2WXH A;  2ZZP B;  3EEC A;  3OWE B;  1T3Q A;  2LGI A;  5EDS A;  3ZLZ A;  4TV3 A;  2EMT A;  3T3O A;  3WAP A;  3IHP C;  3SFD B;  2INC C;  3AI5 A;  2CHZ A;  4Q2J A;  2WXK A;  2KK8 A;  2CJN A;  3GB1 A;  2MJ3 A;  1LO5 D;  1Z5S B;  1TGZ B;  2IPK D;  2WX1 A;  4KGS A;  3AEG B;  4IC7 B;  4BAX A;  3L10 B;  2YEP B;  2I2Y A;  2WU5 B;  3TMP B;  4BFR A;  3NZS A;  3APF A;  1Q10 A;  1UBI A;  2KZR A;  3ZNG C;  1T0R C;  1Y56 A;  1B9R A;  2PW9 A;  2R2O A;  2MLB A;  4ANV A;  3W1S A;  2BWF A;  3KUD B;  3VTU A;  3U7Z A;  2MRP A;  1JW9 D;  1EWY C;  1TS2 A;  5BYS A;  3B2F A;  3NZU A;  2W9N A;  5E6P A;  3DWM A;  4W9C A;  2L8J A;  3RNC C;  4BBN F;  4WWM A;  3DCG A;  3RNG C;  1D6E C;  1WIA A;  4B0E A;  5DPS A;  3OAW A;  3U8Z A;  2MA9 B;  4IWO A;  2WXJ A;  2MJE A;  2RR9 A;  1NDD A;  5DPT A;  4OZB A;  3VTV A;  5LNK 1;  1UEL A;  2GBK A;  3AEB B;  3Q69 A;  4IG7 B;  2LVP A;  4TKN A;  1A70 A;  1L5P A;  3U2S C;  2GOW A;  4A9A A;  2QDF A;  4BOS C;  2PE6 B;  4DDI D;  3VR8 B;  2KVR A;  1SF0 A;  3QQ8 B;  5LXH A;  2NBV B;  3H9D A;  3KYD D;  1KOT A;  1PFD A;  1LQB A;  3VDZ A;  3AB5 A;  1L0Y B;  4ICV A;  5D3I B;  1SSN A;  1V97 A;  2WXO A;  1R7S A;  1TY0 A;  4YTN B;  2BQQ A;  3Q3N C;  2CU3 A;  2KTR B;  3WAL A;  3DHI C;  1T0Q C;  2K6D B;  1FRR A;  4RGN A;  4G11 A;  3PHW B;  2WU2 B;  4HRO A;  2JZZ A;  3C8Y A;  3ZRC A;  3BYY B;  2KT7 A;  3ZYY X;  1P0R A;  1WRD B;  4ASW C;  1K51 A;  5JHA A;  2K6Q A;  4NAW B;  2HTH A;  2H89 B;  2KFJ A;  2E3T A;  5GMV A;  1TJE A;  1N63 A;  4IWQ A;  1S3S G;  2L76 A;  4WAA A;  2M8S A;  1FFU A;  3RNF C;  1XCT L;  2DYM A;  1JWU D;  5LXI B;  2A5U A;  4W9L A;  4MGZ E;  3A4R A;  2WHI A;  4MT5 A;  2CS4 A;  4NQL B;  2PMV A;  1QZE A;  4RM8 A;  4KGT A;  1P3Q U;  2MHJ A;  2BYE A;  4R3D A;  3ZXV A;  3AE1 B;  4NZL B;  1E7V A;  3RMK C;  2KAJ A;  1QOG A;  2LVO A;  2CHX A;  3A4S C;  5BMI A;  3MFG A;  4FUL A;  3ML8 A;  3GS2 A;  5FK9 C;  2WXR A;  1XQQ A;  3KYC D;  5J2R A;  3GOE A;  3AV8 A;  3RZF A;  2MBB B;  1Q1O A;  2KTF A;  3Q3M C;  4OW0 A;  4MH8 A;  3A9K A;  4ZYS A;  2LZ6 A;  2LI5 A;  3BZD B;  2C5L C;  2LUM A;  1N60 A;  1UGM A;  4REZ A;  1WGK A;  3MC8 A;  1N6Z A;  4YXD B;  1YN5 A;  1XLO A;  1ZKH A;  4DWF A;  2TSS A;  3DBR B;  3DVG X;  2GBJ A;  1E9M A;  1TS4 A;  3Q8A A;  5EE0 A;  3U52 E;  1E10 A;  4GN1 A;  1BXT A;  1ZDV A;  1WX9 A;  1YN3 A;  2QJL A;  2JQR B;  1CZP A;  2G4S A;  3DPD A;  3MHZ A;  4OVZ A;  3SD5 A;  4WJO A;  1L0X B;  2MBO A;  4URK A;  4XDC A;  4GLS C;  1C1Y B;  1ENF A;  3RZW C;  2YLM A;  1J19 A;  4G50 A;  5I4D A;  2ZNV C;  2WS3 B;  1F2R I;  3PZD A;  4AOF A;  3FIL B;  1HA5 A;  2JSV X;  2MX2 A;  1EU4 A;  2BYT A;  3ZJV A;  5D7G A;  3FC4 A;  3IT6 B;  4TSS A;  5AUI A;  2IJ0 A;  3UIP B;  1TS3 A;  3NRZ A;  4BOZ B;  2AQ1 B;  4TMA B;  2AWT A;  4OVV A;  1ZXI A;  2KMC A;  4F1S A;  3ZUN A;  2CR5 A;  2ASQ A;  3N1Z C;  1VZ6 A;  3PRE A;  3MP9 A;  1WGR A;  1ET6 A;  4LNI A;  2M56 B;  5CX3 A;  2D3B A;  5KHQ A;  2K8C A;  1I4P A;  2JY6 A;  1UD7 A;  1WFY A;  3PRP B;  1L0V B;  3FAH A;  4QAY A;  4WQO B;  1WY8 A;  4RF1 A;  1SIF A;  3AE4 B;  2KHW B;  4LK0 M;  2FNJ B;  4NNJ B;  4PS8 A;  5TSS A;  1IBX B;  3DOW A;  1DGJ A;  3BVM A;  1E0Z A;  4M00 A;  3QIJ A;  2O6V B;  2AQ3 B;  2BS3 B;  1EF5 A;  1HQR D;  1FD6 A;  2ZW0 A;  1SE2 A;  1WJN A;  1FM0 D;  5G55 A;  3URY A;  3SDL C;  1I4X A;  1UUP A;  2N1V A;  2N9P C;  4EKU A;  5IOI A;  2FID A;  2HDE A;  1WM2 A;  4LJO B;  2J0M A;  1M4V A;  1IGC A;  3I5J C;  4WWP A;  2HD5 B;  3JSV A;  2LHE A;  5BYQ A;  1I7H A;  3AU4 A;  2KQS A;  2EMS A;  3TEW A;  2M17 A;  1FEH A;  3N32 A;  4LDT D;  4WJP A;  4M02 A;  2KNB A;  2G3Q B;  2UU7 A;  2KVZ A;  3OJ3 A;  4HDO A;  2V1Y A;  2XEW A;  2ZW1 A;  1Q5W B;  5EE1 A;  1FRD A;  4C7Z A;  2MJD A;  2IO3 B;  2M0X A;  3LDZ E;  4X57 B;  1TIF A;  1RYJ A;  1BUI C;  4N59 A;  3MC9 A;  3HRD D;  3IVF A;  1FNV A;  4KZ0 A;  4W9G A;  3TEZ A;  2GMI C;  3L08 A;  3PHX B;  1D5Z C;  1GC6 A;  1CJE A;  3GE8 C;  4D2K A;  3CF6 E;  1YQ3 B;  4UDU C;  1AWD A;  4G3X B;  4GIV A;  4MJS B;  5C3J B;  4HVB A;  5IP4 D;  4GDK B;  1YJJ A;  4IOI E;  3B2G A;  1LXD A;  1ZE3 D;  1U4A A;  4EFO A;  1FXA A;  2KTR A;  3I63 C;  2ZJD A;  5CHW A;  2R2Q A;  2DNF A;  3EFC A;  4LLG M;  4OZC A;  3WAM A;  1KLV A;  3K9O B;  1F1H A;  1RLF A;  1N5X A;  1YQB A;  2WDT B;  1JWB D;  3RNA C;  2D07 B;  1MHX A;  1WXS A;  4K1R B;  1TT5 B;  3PLV A;  2PE9 A;  1F2R C;  3BK2 A;  3KH0 A;  1RFK A;  3A33 B;  2CU1 A;  1E5W A;  4MM3 B;  2FCQ A;  3ABV B;  4NAW A;  3I3T B;  1SB3 C;  2IGG A;  1FFV A;  4US8 A;  3H8H A;  5AZF A;  4ZRI A;  1F9J A;  3EHV A;  3QX1 A;  2AYO B;  2Z59 B;  1WX8 A;  1WYW B;  2AEH A;  1C76 A;  1C79 A;  5L95 C;  1WXQ A;  1WJU A;  4DBG A;  2BTE A;  1XEE A;  3ZGZ A;  2BGF A;  1FXT B;  1ZGU B;  2MEK A;  4TQ1 A;  3HUI A;  3EC8 A;  1VD2 A;  1WH3 A;  3R3M A;  3NUH B;  4IDI A;  5DCN A;  1PGA A;  3BK1 A;  1WR1 A;  1S1Q B;  2V3N A;  1SJE D;  3VRA B;  1PYW D;  1WJ6 A;  1I4H A;  1QLB B;  2FCS A;  2KYW A;  4J6I A;  1P7E A;  2WX0 A;  3M95 A;  4MGY E;  1AAR A;  3O13 A;  1T0Y A;  1GC7 A;  2GBM A;  3TEY A;  3RCZ A;  3PZ8 A;  2IDY A;  2REX A;  2IZV B;  4F8C B;  2KMA A;  5D3D A;  1YMH E;  3J9C A;  4HPP A;  2M1M A;  4YSZ B;  1EUV B;  2KDI A;  4L23 A;  1C3T A;  2KO3 A;  2K22 A;  2RPQ A;  4K7W A;  1TTN A;  3W2D A;  1WE6 A;  2IBI B;  1LFD A;  3GP7 A;  4DHZ B;  3Q8E A;  4N9F 4;  3SU8 X;  2OJR A;  5AUK A;  2VZK B;  2QC8 A;  5BMH A;  4KX6 B;  1UBQ A;  2RDB C;  3V60 A;  1EO6 A;  2HE7 A;  1TKE A;  2Y5P A;  1YJI A;  3S2A A;  2L0F A;  1YD8 U;  2W55 A;  2DZI A;  2WGS A;  2KJH B;  3HK0 A; 
#chains in the Genus database with same CATH homology
 3W9C B;  3BYY B;  4JE3 B;  3SFE B;  3AE8 B;  1N5W A;  4NAM A;  3AED B;  4RGO S;  3ZYY X;  1DOY A;  1DYQ A;  1D4B A;  1WSP A;  1K51 A;  3NVW A;  4NAW B;  1J7A A;  1OQR A;  2H89 B;  3NVY A;  3ZJU A;  2E3T A;  1PUT A;  3AMZ A;  3AM9 A;  1TJE A;  1VLB A;  2FUG 1;  3AN1 A;  3BVZ A;  1GOZ A;  1N63 A;  3P4Q B;  3I57 A;  1GB1 A;  3B9J A;  1FFU A;  2B76 B;  1XCT L;  3FIL A;  1NEN B;  1PGB A;  4P16 A;  2DYM A;  1JWU D;  3EA6 A;  2INN E;  2SAK A;  4A6Q A;  4EE2 A;  2W3R A;  4MT5 A;  1T6B X;  3P4S B;  3UI3 A;  4MAC A;  1UWM A;  2QSD A;  2WDR B;  3HVZ A;  2PMV A;  3SEB A;  4KGT A;  1VDV A;  4R3D A;  4ZOH C;  3AE1 B;  2PKO A;  1K52 A;  1C9F A;  4NZL B;  3P1M A;  3ETR A;  3KWV A;  3VR9 B;  2MH7 A;  3E9S A;  1MI0 A;  2KAJ A;  1B1Z A;  2LFI A;  2H88 B;  2X38 A;  3I9V 1;  1QOG A;  1CK1 A;  3ZJT A;  1ZPS A;  2N9L A;  2N7J A;  2XNA C;  3T3N A;  1L4D B;  1JWS D;  3AEE B;  5T8I A;  5BMI A;  4USA A;  2EEL A;  3MFG A;  3R8B A;  1WRI A;  5BYR A;  1JCK B;  3GS2 A;  2CJO A;  1HZ6 A;  5FK9 C;  2WXR A;  1STE A;  4NJC A;  2PTL A;  3Q8B A;  2WXG A;  1XLP A;  2ONQ A;  4ZRQ A;  3P42 A;  2K0P A;  1OQQ A;  3DWG C;  3AV8 A;  4WQM A;  1UNS A;  1WYG A;  2J53 A;  2K9X A;  2K3U A;  1C4A A;  2JZP A;  2INP E;  4AS1 A;  1KFY B;  2WNM A;  1NEK B;  1NI3 A;  4MH8 A;  4OW0 A;  1XLQ A;  1C4P A;  1AW7 A;  2DYO A;  4ZYS A;  2V3P A;  1IBX A;  2JWU A;  2SEB D;  2L83 A;  3LYY A;  1HEZ E;  3BZD B;  4YSY B;  2LUM A;  4TQ0 A;  1N60 A;  1I4G A;  4REZ A;  1E6E B;  1WGK A;  1XCQ L;  2ON8 A;  2WP9 B;  4KKI A;  1V1O A;  1BML C;  3BYT B;  4YXD B;  5H8Y E;  1YN5 A;  3AE9 B;  1EM7 A;  1XLO A;  2TSS A;  5FKA C;  1KF6 B;  1ZDX A;  2IGD A;  4ZRP A;  1JML A;  3P63 A;  1L4Z B;  4N6E B;  1E9M A;  4WH4 A;  2PVG C;  4L2Y A;  2BW2 A;  4WIP A;  1J7B A;  1TS4 A;  2V0G A;  3Q8A A;  2JX5 A;  3P4P B;  5EE0 A;  3U52 E;  1E10 A;  1BXT A;  1ZDV A;  1ZUD 2;  4N58 A;  3VRB B;  2KAC A;  1YN3 A;  2QJL A;  3KQ4 A;  2JQR B;  1CZP A;  3MHZ A;  2HTM E;  4OVZ A;  3RFZ B;  1L0X B;  3PZ7 A;  2W82 A;  1KLG D;  1C4C A;  3NZ3 A;  2JXT A;  4GLS C;  4XDC A;  2PLP A;  1ENF A;  1F77 A;  1SXT A;  2QEJ C;  4DQO C;  3LB8 C;  5I4D A;  3U4E G;  5H92 C;  1ESF A;  1XXG A;  3P4R B;  2WS3 B;  2WXN A;  1F2R I;  5BMG A;  1UGJ A;  1IUE A;  1HXY D;  2WQY B;  3FIL B;  1HA5 A;  2JSV X;  1ZXH A;  1EU4 A;  2RMM A;  2KQ4 X;  2ACZ B;  3AH7 A;  4PT5 A;  2BYT A;  3ZJV A;  5D7G A;  5G5H A;  3FC4 A;  1PGX A;  2D5G A;  4YT0 B;  1D5X C;  1EWC A;  1XLN A;  3IT6 B;  4TSS A;  5AUI A;  1MPE A;  2IJ0 A;  1TS3 A;  5MPO A;  3NRZ A;  5JXV A;  1F0Z A;  2GRI A;  1AYF A;  2WXQ A;  1V1P A;  2FBW B;  3AE7 B;  3BWU D;  2AQ1 B;  1YQ4 B;  4FXC A;  4ARI A;  1V8C A;  4TMA B;  4C80 A;  3Q8F A;  5C2T B;  4C7Y A;  2LHD A;  1ZXI A;  4OHJ A;  5EE9 A;  2LEK A;  2M0A A;  4JWU C;  4JX1 C;  1N61 A;  3SR6 A;  1QKZ A;  1L6V A;  1VZ6 A;  4ZHP A;  1SE4 A;  3IT4 B;  2JYE A;  4ARC A;  3MP9 A;  5HG2 A;  2XN9 C;  1JAL A;  1ET6 A;  1FMA D;  1TS5 A;  2M56 B;  2RDG A;  5E6J A;  2PIA A;  3AE5 B;  3N9Y C;  4US9 A;  1I4P A;  1KTK A;  1L0V B;  3FAH A;  3TSS A;  2Y3A A;  2BT6 A;  3AE3 B;  3KWL A;  2M19 A;  1I4R A;  4A8X C;  3LXF A;  3HVD A;  4RF1 A;  3VQI A;  1FCL A;  3IAS 1;  2BS4 B;  3AE4 B;  1PDX A;  4LK0 M;  4RGT A;  4L1B A;  1QOF A;  1TYG B;  5TSS A;  1IBX B;  1FO4 A;  3RPF C;  2LMC A;  4YSX B;  1DGJ A;  1UWX A;  3BVM A;  1E0Z A;  2GB1 A;  2WXI A;  2QIE B;  2OED A;  1YNT E;  2AQ3 B;  2G1E A;  1TKY A;  2BS3 B;  2NMQ A;  3KLS X;  2WXL A;  1QIL A;  3R2T A;  3EUB 2;  4RGM A;  1HQR D;  1FD6 A;  3AE6 B;  4XE0 A;  2ZW0 A;  2Q5W D;  1SE2 A;  1FM0 D;  1J7C A;  3URY A;  2JYT A;  4RNA A;  4O1N A;  1I4X A;  1UUP A;  1KLU D;  1SEB D;  4KKJ A;  2FE8 A;  2WXM A;  2Z8L A;  5G5G A;  4HKQ A;  4XWT A;  4YTP B;  3CWI A;  4YTM B;  1ZOY B;  3AEF B;  1FCC C;  2HDE A;  1DOX A;  3IAM 1;  1M4V A;  1IGC A;  1QF6 A;  1NYR A;  1FNU A;  3TEX A;  4OZA A;  1D5M C;  3BII D;  2LHE A;  5BYQ A;  1P7F A;  1I7H A;  1C78 A;  2IGH A;  4J3O D;  4XDD A;  3TEW A;  1FEH A;  1XO3 A;  1TY2 A;  2LJI A;  3V05 A;  3W5U B;  2WXF A;  3R2I A;  1SBB B;  2JU6 X;  4LTU A;  1RWS A;  1FIQ A;  3AE2 B;  3NS1 A;  4GDL B;  2WDQ B;  2ZW1 A;  4IKG A;  5EE1 A;  2RPV A;  1T5X D;  1FRD A;  3ZQ4 A;  4C7Z A;  2DBY A;  2RDH A;  1SJH D;  2MJD A;  2L1A A;  1V1P B;  3EGR A;  4H2A A;  1RYJ A;  1BUI C;  2PVO D;  4N59 A;  2BBC A;  1OFF A;  3HRD D;  2N9K A;  4RFB A;  1FNV A;  1QT9 A;  3TEZ A;  4RF0 A;  2J4X A;  2R61 A;  2OHF A;  1D5Z C;  4AQ7 A;  2V4I B;  2WXH A;  1CJE A;  4D2K A;  3OWE B;  5GXG B;  1T3Q A;  1VZ7 A;  1YQ3 B;  5HI1 A;  1E7P B;  4UDU C;  1C77 A;  1AWD A;  1FNW A;  1TZO A;  2LGI A;  3W5V B;  5C3J B;  2W3S A;  1L6U A;  1SIJ A;  4HKZ E;  4GDK B;  1YJJ A;  4IOI E;  4M0W A;  3T3O A;  3B2G A;  1KRH A;  3SFD B;  1TKG A;  4Q2J A;  1ZE3 D;  2WXK A;  2L32 A;  2CJN A;  4A55 A;  3GB1 A;  1FXA A;  2MJ3 A;  3AEC B;  4WUR A;  1LO5 D;  1HZ5 A;  2IPK D;  4KGS A;  1QOA A;  4OZC A;  4LLG M;  3AEG B;  5HFY A;  2YEP B;  2I2Y A;  4HRS A;  2WU5 B;  1N5X A;  1WWT A;  3V3X A;  1JWB D;  1IGD A;  2VZK D;  1Q10 A;  4KGR A;  1MHX A;  4B0M A;  4RH6 A;  1ROE A;  2ICI A;  1ACC A;  1F2R C;  3BK2 A;  2GI9 A;  3IXS A;  1RFK A;  4XWW A;  2J42 A;  4MM3 B;  1Y56 A;  1B9R A;  2PW9 A;  1K53 A;  3ABV B;  2WLB A;  1NYQ A;  1SB3 C;  1FFV A;  2IGG A;  3BVG A;  4US8 A;  1JWM D;  2Y5C A;  2QIL A;  3H8H A;  1DOI A;  3W1S A;  2NTT A;  2BS2 B;  3NVZ A;  3U7Z A;  1JW9 D;  1EWY C;  1C76 A;  1C79 A;  2AQ2 B;  1TS2 A;  1WXQ A;  1N62 A;  4P6V F;  5BYS A;  3B2F A;  2BTE A;  1XEE A;  3DWM A;  3MC0 B;  3ZGZ A;  2E6X A;  2I38 A;  4DXF A;  2MEK A;  3AEA B;  1GPX A;  4TQ1 A;  3HUI A;  2EKI A;  1KH0 A;  2BB5 A;  4WWM A;  3NUH B;  1D6E C;  4IDI A;  3NVV A;  1PGA A;  3BK1 A;  2KWD A;  1K50 A;  2V3N A;  1SJE D;  3VRA B;  4A90 A;  2N0S B;  1FXI A;  4B0E A;  4DXG A;  1PYW D;  3MJ5 A;  1I4H A;  1QLB B;  1I4Q A;  2WXJ A;  2MJE A;  2WDV B;  1P7E A;  1YN4 A;  4YWG G;  3O13 A;  1JRO A;  2KMM A;  1ET9 A;  1QOB A;  1JRP A;  2YEP F;  3TEY A;  4OZB A;  1JWA D;  2QMT A;  5LNK 1;  3WCQ A;  3PZ8 A;  2J52 A;  2IDY A;  1VRA B;  3AEB B;  3Q69 A;  2WXP A;  5EE3 A;  1JQ4 A;  5HHD G;  3CIR B;  1NVI D;  2KDM A;  1SE3 A;  1CQV A;  2AX5 A;  2W54 A;  5D3D A;  1A70 A;  1L5P A;  1GAQ B;  1AN8 A;  1YMH E;  3J9C A;  3U2S C;  1VR9 A;  1XF5 L;  4A9A A;  4YSZ B;  1VZ8 A;  2DWQ A;  4RCO A;  1MHH E;  4L23 A;  3VR8 B;  4CQN A;  1GB4 A;  1SF0 A;  2K22 A;  2BB6 A;  4JPS A;  4WAF A;  3W2D A;  1PFD A;  3Q8C A;  1MVK A;  3AB5 A;  1VJK A;  1L0Y B;  3E56 A;  3GP7 A;  3Q8E A;  5D3I B;  1SSN A;  1V97 A;  2WXO A;  1R7S A;  1QQR A;  2NTS A;  4HEA 1;  1EU3 A;  1TY0 A;  3PO0 A;  4YTN B;  5AUK A;  2VZK B;  4ZHO A;  2G9H D;  2CU3 A;  5BMH A;  4KX6 B;  3TUO A;  2KN4 A;  2L52 A;  1FRR A;  2DLB A;  4RGN A;  5FR3 A;  1TKE A;  2Y5P A;  3L4P A;  2K5P A;  1YJI A;  2WU2 B;  4C56 C;  1ZP0 B;  4ITK A;  4HJG E;  2W55 A;  4HRO A;  4JWS C;  3C8Y A;  1RM6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...