1YNTE

Structure of the monomeric form of t. gondii sag1 surface antigen bound to a human fab
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
EVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYADLLAKVNGEYTADLEDGGNHMNIKFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex between the monomeric form of Toxoplasma gondii surface antigen 1 (SAG1) and a monoclonal antibody that mimics the human immune response
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
molecule keywords 4F11E12 Fab variable light chain region
total genus 9
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2005-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yntE00
1D4BA 2GB1A 1HEZE 2JSVX 2JWUA 2N9KA 2N9LA 2I2YA 4KGRA 1K52A 1XCTL 1MHXA 1HZ5A 1FD6A 2KDMA 1K53A 2LUMA 2ZW0A 1IGDA 1IGCA 4OZBA 1PGXA 2N7JA 2GI9A 1FCLA 2LHEA 1EM7A 1UWXA 2PTLA 1IBXA 5JXVA 2RMMA 1C9FA 1ZXHA 1F2RI 1P7EA 2KWDA 2OEDA 2ON8A 1MHHE 2KQ4X 1IBXB 1MPEA 5HFYA 2LGIA 1XCQL 2JXTA 2K0PA 5HHDG 2LHDA 5BMHA 4IKGA 4HJGE 4IOIE 2ZW1A 1GB1A 1P7FA 1JMLA 5HG2A 2RPVA 2IGDA 3UI3A 2ONQA 5BMIA 2JZPA 2PW9A 4HKZE 4OZCA 4D2KA 1XF5L 2EELA 2KN4A 2QSDA 4OZAA 1QKZA 1YMHE 1KH0A 1HZ6A 2NMQA 1YNTE 5HI1A 1FCCC 2PLPA 1Q10A 2J53A 3GB1A 1PGAA 1PGBA 4WH4A 1K51A 2JU6X 1K50A 3FILB 2IGGA 1MVKA 2QMTA 2I38A 4MACA 2KACA 1MI0A 3FILA 4KGTA 3V3XA 3MP9A 1F2RC 5BMGA 4KGSA 2J52A 4GLSC 2IGHA 1GB4A
chains in the Genus database with same CATH superfamily
1JCKB 3WCQA 3CF6E 2BVCA 3KUZA 1I4PA 1P3QU 5LXHA 1QOFA 2LASA 1TZ1A 2MA9B 2YEPB 2AEHA 2BB6A 1I4RA 4MJSA 3ZGZA 2WXQA 2BS4B 2VH1A 3VUWA 1TT5B 3SFEB 1Q5WB 3N32A 4W9DA 5E6PA 4P1CC 1R7SA 3Q3OC 3PRPB 4PS8A 1T5XD 2IO2B 4RGMA 2X38A 2J7QB 3AE4B 1KLVA 1VJKA 1PDXA 4K7WA 2WXMA 2NR2A 1YIWA 3PTFC 3FKYA 4J6IA 1SIFA 4FHJA 2KQ4X 4B6WA 3Q69A 1XO3A 3DHHC 1EU3A 4CYEA 3ZJUA 2KD0A 1I4QA 2J42A 4JPSA 3GE3C 3AE6B 3A1QA 1ZGUB 5JHBA 1TY0A 3IAM1 2D2QA 5HKHA 4HKQA 3VHTC 1GC6A 1WGKA 4W9JA 1XLPA 3ECIA 1CQVA 1V5TA 2RDGA 2WXOA 1RAXA 1SE3A 1FRDA 3MC8A 2KK8A 2L3ZA 4FLHA 2SEBD 1KH0A 4ZRKA 2KQ7A 5AUKA 4ZYSA 2Z59B 3M63B 3AV8A 4REZA 1K51A 3OAWA 2ZVNA 2FCMA 4PK1A 3T3OA 2KACA 2OOBB 3MP9A 4FADA 2RDHA 2MEKA 3VVWB 1TS3A 3AE8B 3APFA 1TKGA 4WJNA 1NI3A 1E9MA 1FPYA 2B76B 1D4BA 1XXGA 1K8RB 1Y8RC 2LUEA 2INPE 1WWTA 1XCTL 1HE8A 3C19A 4US8A 2BYTA 1WXSA 4L23A 3NY5A 4LNIA 1BT0A 1RWSA 4R3DA 2KO3A 2WXPA 2KC1A 2CU3A 4E71A 4IWPA 3TIXA 3VQIA 2LRWA 3AMZA 1JRPA 4A55A 1IBXA 3PT2B 1N63A 4F8CB 4GDLA 1RFKA 3ONSA 3BZDB 1DOIA 1VRAB 4EFOA 2KWDA 3RZFA 3LJ3A 3Q8CA 3BY4B 1WX9A 1MPEA 2NPTB 4IW0A 2MJDA 2JZ3B 3A9KB 1GG3A 1S1QB 1LXDA 2AQ1B 4IWOA 3P4PB 3R2IA 2Q5WD 4KDIC 3AB5A 4ICVA 3DHGC 4DXAB 2JXXA 1WFYA 2MH7A 1KLGD 4W9GA 4HEA1 3ZJVA 4KKJA 1WYGA 3ML9A 3HIZA 4TV3A 3ZW3A 2PW9A 1P1AA 4P7IA 2QSDA 5FR3A 3ZXVA 5E6OA 1J19A 4BBNC 2BT6A 3QWZB 4PYUA 3NS8A 3NOBA 3VH3B 1FRRA 4ZDVA 3Q2AC 1FMAD 2AQ2B 5CX3A 2M4NA 2WU2B 2RGFA 3RULA 3D32A 2K22A 3H6NA 2JPHA 2KVRA 3UIOB 3GOEA 3L08A 3W5VB 4A8XC 4B9KA 4MSQB 3TEXA 2KKCA 2CHWA 3H7SA 2BWFA 4MGKE 4ARIA 1HA5A 2V4IB 2V3PA 4FJZA 4W9KA 2A4ZA 4A9AA 1WR6E 2KMMA 2Y5PA 4AJWA 1NYQA 1K53A 3RNGC 1TJEA 2K3UA 2KN5A 2BKRB 2Z8LA 2DZJA 3DBRB 3PO0A 3BIID 2WX0A 1E8ZA 3ZXRA 2CU1A 3ZNHB 2V3NA 1H4RA 3ZNGC 5GXGB 2BQQA 3C0RB 4MH0E 2KHWB 5GMVA 5JH5C 3X23A 1FXAA 5KHQA 1MFWA 3I9V1 5BMHA 3AE1B 3I63C 2L7RA 5IKCM 1V1PB 3AU4A 2LRUA 4RF0A 3ZNID 1KRHA 3P4QB 3WA0A 1TGZB 3ZVVA 2AX5A 5KHOA 4DHZB 3B08A 2IO0B 5DPTA 4YWGG 1WM3A 1YN3A 2A5UA 4B0EA 2W3RA 2X8XX 2WYQA 5DPWA 2N9PC 3BYTB 4GOCA 4S17A 4XC2A 2ACZB 4MM3B 1R4NI 3ZUNA 1PGBA 4PS3A 4WH4A 3GP7A 1V6EA 4I6NB 1TBEA 4GDLB 2N9XA 1MVKA 1ZPSA 2I1JA 1XD3B 2GLSA 2RSUA 4NZLB 2N9EB 4GU2A 3IVFA 3V6CB 4M0WA 4RNAA 1NENB 5CTRC 1I4HA 2KAJA 1WM2A 3AULA 1TZOA 3E9SA 4W9FA 4DBGA 2D3BA 5EDSA 1WF9A 2K1FA 2LGXA 4QAYA 2NPTA 1CK1A 1KLUD 2C7NB 2C7HA 1GNUA 1B9RA 1UNSA 1HTOA 1SEBD 2L32A 3Q3NC 4LDTB 4ANXA 3AM9A 4GN1A 4DHZE 2HJ8A 1T0YA 1N6ZA 1MHHE 3NUHB 2L00B 4ZRQA 4DHJD 2IYDB 2KDEB 4XX5A 3NZ3A 2D11A 2JYEA 3BINA 3V05A 1WXQA 5CHWA 1OQYA 4WURA 1NDDA 3OWEB 2KQSA 2D3AA 1VZ6A 2I1KA 3ETRA 1JMLA 2O2VB 4FHKA 2MBEA 4LLGM 2LWPA 4ZRJA 2GBJA 1XQQA 2D10A 1WMHA 2FE8A 2M56B 5L83A 2KN4A 1JW9D 2N1VA 2MHJA 4B95A 1QKZA 4UDUC 4AP4C 3ZTCA 4IM3A 1F52A 4GGQA 2MSED 1HQRD 2PLPA 5G5HA 2VZKB 1PGAA 3I57A 1D5ZC 1BXTA 3KVFB 2M0XA 2Y5CA 2AWTA 1UD7A 2FUHB 1UBQA 1I42A 1RYJA 4XGAB 1WMHB 2NBVB 1PYWD 2J52A 4HK2A 2DAFA 1Q1OA 1L5PA 3W1SA 3TEYA 4G0NB 5DPRA 3VUXA 1NI2A 3KLSX 3H7PB 5L95C 4NQLB 1JROA 1YJIA 4KV2A 1C78A 4BKSA 2FAZA 1WZ3A 2Y5BB 2REXA 2QCZA 1ET9A 4HCNB 2HE7A 4GDKB 3A4RA 2DYBA 5BO4B 3A9KA 2PEAA 2EKIA 4YSZB 3TCAA 1GUAB 2E3TA 3Q8EA 4JIOU 1YQBA 4YTNB 4HVBA 1VZ8A 2KFKA 3UQBA 5CHVC 3W9CB 2ZVOA 1VCBA 4DDID 3N3KB 2IDYA 1Y56A 1LFDA 3PHXB 2DZMA 2JYTA 4IOIE 4PS7A 2L76A 4OVUA 5G5GA 1E0ZA 5C23A 1AN8A 2L0FA 2LGSA 2KDIA 3ZTDA 4D2KA 4EOYA 4GIVA 2ASQA 3AECB 1QZEA 1L6UA 3DCGA 5CHFA 2KNBA 1T0QC 2NVUI 5AZHA 4RGTA 5BYRA 3RZWC 4ZHOA 2WDVB 2FCQA 2NCNA 1ROEA 4ANVA 3Q8AA 3PS6A 2QMTA 1YX5B 4K1RB 2K8BA 1C4PA 2M17A 3SR6A 2HJ1A 4GDKA 5I4DA 4DXGA 2O6VD 2WXJA 2C9WB 2KJRA 3NJTA 3DBHB 1M4VA 3ZDTA 1K52A 2KZRA 3AEFB 4TUUA 3AEBB 2W9NA 2KDMA 3H7PA 3ML8A 4FJVB 4FXCA 1IGCA 4WWMA 2GI9A 3DQVA 2OHFA 4F7ZA 2CJNA 1ET6A 2KWCA 2LGDA 3A1QB 2LGYA 4MELA 3Q3FA 2ZEQA 2BKFA 2IPKD 1E7VA 2LVOA 3IAS1 2KTFA 5D2MB 1P7EA 1ACCA 2ZCCA 3Q3MC 2K25A 1YN5A 1ZKHA 4W9HA 4Q2JA 1J0GA 3QHTA 3DBSA 3B1LX 4MH8A 1QOGA 1IYFA 2K0PA 1X1MA 5HHDG 2LMCA 4C7YA 3HVZA 2KX3A 3P2BA 2FUG1 2D5GA 3DBRI 4MJSB 5HG2A 1GJZA 3Q14C 2EMSA 4KDLB 1V49A 5BYQA 3QQ8B 1L0YB 3OLMD 4P1BC 5FK9C 1N5WA 1YMHE 2FCNA 3GZNB 4TKNA 1V2YA 3W1YA 1NBFC 1V5OA 2IY0B 1D5MC 4A90A 1TKEA 2MBOA 3KYDD 2W82A 4K3BA 1JALA 3E56A 2L8JA 1XEEA 3H8HA 4JQWC 3WAOA 2L1AA 4GLSC 3UQAA 3J9CA 3BVZA 3IXSA 3IBEA 1WXAA 3ZQ4A 2K6DB 5D7GA 1SJED 2WU5B 3TUOA 3IHPC 5LXIB 3PGEA 2IBIB 2LUMA 2UWQA 3DOWA 1PGXA 2CS4A 1FCLA 2G4SA 2QIEB 1EM7A 3MHSD 3NVWA 3R3MA 1SF0A 2MCNB 2EKEC 2WP9B 4WQOB 4EUTA 5IO9A 3PLUA 4DHJB 1WR1A 3ZYYX 3DVNV 3A4SC 2XK5A 1MG8A 4WJOA 1TKYA 2AL6A 4C80A 2D07B 1XCQL 2V9HA 3W1SC 2QC8A 1E6EB 2JXTA 1UELA 1Z2MA 4M02A 4MGYE 3KW5B 4A3OA 2G1EA 3EHVA 4YXDB 1V1OA 3AU5A 3X0WA 2IO3B 1SJHD 3IG3A 5JHAA 3AI5A 2M1MA 3HUIA 4MT5A 3OG5A 2OJRA 1IUEA 4HKZE 2KLCA 3LDZE 4FBJB 4XDDA 1WJUA 3P4SB 4KZCA 4RF1A 5HI1A 4TQ0A 2KOXA 3H1UA 4DWFA 1HTQA 1CJEA 2EMTA 1OTRB 2J53A 2N1WA 1F77A 1GPXA 3N1ZC 1YQ3B 1KOTA 2CKHB 3FILB 2AQ3B 2MP2B 5H8YE 4AWJA 4KKIA 2KC2A 3DDCB 2G9HD 4ASWC 4HCPB 1SB3C 5J18A 2MBQA 1TS4A 1E10A 4KVGB 3C8YA 1OFFA 1QOBA 1TYGB 4WWNA 3VUYA 4KGRA 5IOIA 1EF1A 4GXBA 4ARCA 4M8NA 4OZBA 4USAA 4BVUC 4NJ6A 4BZAA 4HLEA 3L17A 4RGNA 4HXDA 2WGSA 2KWUB 3U2SC 2N7EA 4LJOB 3P1MA 1WIAA 1Q0WB 2GBKA 3KWLA 2KX0A 5E6NA 1V9JA 4A20A 1CMXB 3WIMA 2WDTB 2CHZA 2KXJA 2OJWA 4G11A 1FNVA 4WWOA 2LGIA 5G55A 3AE2B 1R4NB 4EZKA 2W54A 4OW0A 3AE3B 2V3SA 2G3QB 4BAXA 4ACFA 3QX1A 4L2YA 3B2FA 4A6QA 2IJ0A 1RFAA 1OGWA 5EE0A 3IT6B 3U7DA 4BOZB 4LK0M 2PVGC 4J3OD 2L05A 3EC8A 4HROA 4M0WB 3U52E 2WWZA 4BKSD 1N62A 4IWQA 2L52A 1HZ6A 4LNKA 3AE9B 1NYRA 2GOWA 4AJYB 1QQRA 3ZO5B 3ZRFA 2VZKD 2N0SB 1FIQA 2GRIA 5FKAC 1LGRA 2NTTA 2WDRB 3EGRA 2H88B 3QAQA 5BMGA 4XYCA 3TEWA 3QK0A 4JX1C 1GB4A 2ICIA 4KIKB 1FNWA 2JWUA 1ZUD2 2GBRA 3I3TB 2FCSA 3DPDA 2JY6A 4IUMB 1FEHA 4FA6A 2R2OA 1AW7A 2INNE 2DWQA 4K7SA 5C3JB 1TS2A 2KFKB 3NVVA 2K39A 3MFGA 1SSNA 3UGBB 3MC9A 2Z0EB 3B2GA 3NVYA 3PZDA 1E8XA 2IY1B 1YOVB 2BBCA 5AUIA 4FJYA 2FIFA 1L2NA 4BFRA 3OJ3A 4P16A 5EE3A 3CIRB 3DBHI 4BKTA 2MX2A 4WAAA 2G4DB 3WAPA 3PRZA 3U7ZA 1YJJA 4RMAA 5DCNA 1D3ZA 4HWIB 4OVZA 2K5PA 3DVNU 1S3SG 3Q3JA 4JLCA 2WXLA 1ISNA 2MJEA 2MWSB 1I4GA 3RYTA 5EE9A 2FBWB 2O6VA 2KLGA 3QA8A 2BYVE 2RPQA 1FM0D 4AUQC 4JWSC 5D94A 1UH6A 1YNTE 2LVPA 4RH6A 4IDIA 1XLNA 4YT0B 2BPSA 3T3NA 1K50A 1C4CA 3VH4B 1ZOYB 4E3CA 1MI0A 3IT4B 4RGOS 2NS5A 2KMCA 4BBNF 3LB8C 1VD2A 3N1YC 2LZ6A 2WXRA 5IAAC 1WGYA 1TS5A 3RNBC 1WGRA 4XWTA 2N9KA 2I2YA 4LDTD 3SHQA 5J17A 1DGJA 3M95A 3FC4A 3PPAA 1L4DB 1MJDA 1E90A 1V97A 2TSSA 4EEWA 2K6QA 1J7AA 3QIJA 1WSPA 4ICUA 1WRIA 5D6JB 3VR9B 3H9DA 3RNFC 3SD5A 2DZKA 1WXVA 2RMMA 1UGMA 1WJNA 2WQYB 3GE8C 3PLVA 4W9EA 1QT9A 1C3TA 4C00A 2K9XA 3SEBA 2JRIB 1RRBA 2DZIA 3W5UB 4LNOA 2J0KA 2VH2A 1AWDA 2JRHA 3HK0A 2DYOA 4RFBA 2LHDA 1DYQA 2JQRB 5IA7A 3PRMB 1A70A 3UIPB 3ZJTA 4WQMA 1T3QA 3A33B 3L4PA 3NHEB 3AE7B 2C5LC 4N58A 2MJ3A 2M8SA 4TMAB 1YN4A 1XLOA 1ZDXA 3TL5A 2ZNVC 1FNUA 2Z0DB 5H92C 2VRRB 3PZ7A 4GSWA 2BW2A 1EO6A 1QF6A 2J0MA 2MW5A 3DHIC 1P0RA 2WXHA 1RLFA 3APCA 2IZVB 3B9JA 4ZRIA 2BGFA 3VRAB 3EFCA 1SXTA 3VTVA 4NJCA 2NBWB 1YX6B 2N9LA 3CMMB 3EUB2 5C2TB 4NAWA 4JWUC 4HJKA 1HZ5A 1UUPA 1IGDA 1HXYD 2LD9A 4YSXB 4NAWB 3RNCC 5AEKB 2KWVB 5JZEB 4BKGA 1C4AA 3RI7C 1T0SC 3AXCA 3R66C 1C77A 1N61A 4LCDE 2UU7A 4FN2A 1KM7A 4TSSA 1ZXHA 3ABVB 1YJ1A 1QOAA 1WJ4A 3RNEC 4AOFA 2ON8A 1JWUD 2BYEA 1ZDVA 3NZSA 1MG4A 5AZGA 3EFUA 2QEJC 3R7QA 1J7CA 3L10B 3R8BA 2LXCA 3L0WB 2WXKA 3NG0A 1E5WA 4CO7A 1SE4A 3DWGC 3JVZX 4LNFA 3V60A 2V4LA 4ITKA 2BB5A 4II3B 3AEAB 3N20C 3N30A 1GAQB 1EUVB 2YEPF 4DXFA 2N7DA 3ZKJC 1B1ZA 2L83A 4EKUA 3BVGA 4WAFA 1ZW7A 2XNAC 1WY8A 4NQKE 4IC7B 4L1BA 1N5XA 3PV1A 3BK2A 3EECA 1IPGA 1L0VB 1ZE3D 4KGTA 2XBBC 2HTME 3RT3B 3LYYA 4E74A 3CSTA 3JSVA 3KH0A 2HTHA 1HEZE 3T8MA 2JSVX 4JGHB 1E7UA 3UF8A 3JSVB 4I6LB 1MHXA 2WNMA 1OEYA 3JW0X 2LJIA 2ZPNA 3VDZA 2ZW0A 4MGIE 1WX8A 2BS2B 4C4VA 2CJOA 4RM8A 1ZP0B 3B0AA 1J7BA 1VZ7A 3V6EB 1JWBD 4NY0A 1WYWB 5E6JA 2BYFA 4KSLC 2J4XA 5JXVA 3PVLA 1OQRA 2D3GA 4B0MA 2DENB 3QCAA 3V62A 1F2RI 4C7ZA 3HRDD 1ZXIA 3KUCB 3AE5B 4ZYNA 3BWUD 2W55A 3Q6BA 5AZFA 1WGGA 3V61A 2V1YA 3BVMA 3U4EG 4G3XB 1PQSA 3M3JA 4BOSC 4IKGA 4HJGE 3U8ZA 4S0RA 3BYYB 3JYUA 3T9LA 3K9PB 1XT9B 2KJHB 3ENEA 4M00A 3RMKC 2O6VB 1JWMD 1YD8U 3L13A 1AYFA 1NEKB 3QJZA 1PFDA 1XF5L 3KYCD 4ZOHC 4K7UA 4ZRPA 2BS3B 2N4FA 3W2DA 3P63A 4HDQA 2FNJB 4W9LA 3AN1A 1WZ0A 4DQOC 5IP4D 5TR5A 4W9CA 1V80A 1WXMA 2FIDA 4JL9A 3N9YC 3PZ8A 4YTMB 5EE1A 3TSSA 2IGGA 5C1ZA 2D3CA 4MACA 3V3XA 4KZ0A 3NRZA 2ZJDA 2KMAA 4KGSA 2BWES 1JRUA 4TQ1A 5T8IA 1YQ4B 2H89B 2LFIA 1D5XC 5TSSA 2G45B 4IG7B 5G2NA 4DK5A 1L6VA 1VLBA 1D6EC 2O2VA 4US9A 2BF8B 1AARA 2DBYA 2M0AA 2RDBC 1JQ4A 2HD5B 3VXWA 3WALA 3M62B 2YVCA 2QJLA 1UWXA 2LJ5A 4ANUA 2AL3A 1C1YB 2SAKA 2CR5A 2WXIA 3N1XC 4I6PA 4NPNA 2WHIA 2OEDA 1E7PB 4HPMB 3KUDB 4JE3B 3A9JA 5D3IB 4OHJA 1EU4A 4N9F4 4EZJA 1SBBB 2PIAA 2L0TA 1SE2A 4II2B 2K8CA 1R4MB 3AH7A 5DPSA 3L16A 3ZRCA 4AS1A 1V81A 4X57B 1V8CA 1ENFA 4W9IA 1DOXA 1WJ6A 3TBLD 4YTPB 4C56C 4HRSA 3RUIB 3SFDB 1F0ZA 4EE2A 4URKA 3VFKA 3A9JB 4MM3A 2NMQA 3VTWA 2M19A 3HM3A 3PHWB 2KJ6A 2V0GA 1Q10A 3GB1A 2QDFA 4XDCA 2LVQA 1TY2A 1LO5D 1GOZA 3O65B 3VRBB 1LQBA 1CZPA 1F2RC 1P98A 1WE7A 3KWVA 2ZNVB 3WAMA 4PYZA 2QILA 2R61A 3WANA 3DVGY 2GB1A 2PKOA 1IP9A 2E6XA 1FFVA 2KDBA 3RCZA 5BYSA 5MPOA 2DX5B 2HDEA 4EZLA 4NNJB 3NZUA 4XZ4A 1UBIA 4RM9A 2INDC 2IO1B 2ZZPB 4DDGD 3DVGX 1XLQA 2BTEA 4H2AA 5FR6A 3URYA 4IM0A 1T6BX 4IM2A 2PE9A 3P4RB 4NAMA 3AEGB 2INCC 2Y3AA 3SDLC 3ZDMC 3Q8BA 5HFYA 1KF6B 1I4XA 3NS1A 2JVCA 2GMIC 1V86A 3NVZA 3U30A 3MTNB 1QLBB 4LTUA 2B3AA 1WGHA 1I35A 1GB1A 3MHZA 2C60A 2LEKA 2RPVA 1OQQA 3I5JC 2WLBA 1SE9A 2ONQA 2JZPA 2PPHA 2JF5A 3RN9C 2MLBA 3K9OB 3VTUA 2JZZA 3P42A 2JWZA 3RD2A 4A3PA 1G6JA 3CWIA 2WX1A 1JWSD 3LXFA 4RCOA 4C4VB 1ESFA 1DOYA 3AEDB 2JT4B 2KFJA 1WI0A 1VDVA 2R2QA 2DNFA 1U4AA 2RR9A 4OVVA 1F1HA 4K81A 1I7HA 1KFYB 4K3CA 3RPFC 2W3SA 4N59A 3ZNZB 2KTRA 4O1NA 1EWCA 3DBLB 1FD6A 2K8HA 1BMLC 2AYOB 2LHEA 1FFUA 2XK5B 2RD0A 4F1SA 1QILA 2XN9C 3MC0B 1F9JA 3CSFA 1OEYJ 3PSEB 3HVDA 4M01A 4NJ7A 1WH3A 1L0XB 3TMPB 2KYWA 1M94A 3RNAC 3ZIMA 3IFWB 1IBXB 3OJ4B 4MGZE 1UZXB 1JWAD 3RFZB 3HM6X 3VAWA 4GB9A 5D3DA 4LNNA 1SIJA 1FXTB 3MJWA 3QARA 1P7FA 3APDA 3ZLZA 2KVZA 3ALBA 3KQ4A 2GBMA 1UWMA 1V1PA 3AEEB 2PJHA 2MRPA 4OZCA 4ANWA 2ZPYA 2EELA 1STEA 2DLBA 4HDOA 3PREA 4GMVA 1L7YA 1A5RA 4YSYB 4WWPA 1E8YA 3O13A 5LLIA 1GC7A 4XE0A 4YL8A 1PUTA 1T0RC 1FXIA 4MSMB 3Q8FA 1P9DU 4FULA 2MQJA 1H8CA 3FILA 2PE6B 4HPLB 1WE6A 3FAHA 4WJQA 3S2AA 2ZCBA 2LXAA 4N6EB 4AQ7A 2WXNA 4G50A 2IGHA 1LM8B 1L4ZB 3TJPA 1UGJA 1Z5SB 1J8CA 2KANA 1WX7A 2PMVA 4ZHPA 2KDFB 4HPPA 2WXFA 2WXGA 1WGDA 2UYZB 2N7JA 2MP2A 5J2RA 3TEZA 2QHOA 3BK1A 3R7RA 2DHZA 1SGHA 3DWMA 2PTLA 3GS2A 2C7MB 2MBHA 2YLMA 3GZNI 2DYMA 4MEMA 1C9FA 3VR8B 2NTSA 1EWYC 2KT7A 4P6VF 1N60A 2XEWA 2WS3B 2DAJA 2J0JA 4XWWA 4CHKA 1KTKA 3QC8B 4WIPA 1BUIC 4WJPA 3R2TA 2ZW1A 4KX6B 1C76A 5IN7A 4KIKA 2MBBB 3L54A 2IGDA 4KSKC 2GBNA 5LNK1 2JUOA 3UI3A 5BMIA 1EF5A 4LJPB 3UINB 4M8MA 3DBLI 3EA6A 1TIFA 4OZAA 2WDQB 1FO4A 1TTNA 1VR9A 3HHMA 3SU8X 1FCCC 1UF0A 2LI5A 2JX5A 3MJ5A 4PT5A 2CHXA 2PVOD 1E8WA 2JU6X 1KJTA 1R4MI 2I38A 1WRDB 1NVID 4CQNA 4MDKE 1C79A 2KTRB 1RM6C 2NBUA
chains in the Genus database with same CATH topology
3W1SA 1JCKB 4TQ1A 3WCQA 3TEYA 5T8IA 1I4PA 1FNWA 1YQ4B 2H89B 1QOFA 2LFIA 3KLSX 1D5XC 2JWUA 5TSSA 1JROA 1YJIA 1C78A 1ZUD2 2YEPB 1L6VA 1VLBA 1D6EC 1I4RA 2BB6A 4US9A 3ZGZA 1ET9A 2BS4B 2DBYA 2M0AA 2WXQA 1FEHA 3SFEB 1JQ4A 4GDKB 1AW7A 1R7SA 2INNE 2DWQA 5C3JB 1TS2A 2EKIA 4YSZB 3NVVA 3MFGA 1T5XD 2QJLA 1UWXA 4RGMA 1SSNA 2X38A 3AE4B 3B2GA 1VJKA 2E3TA 3NVYA 2SAKA 1PDXA 2WXIA 3Q8EA 2WXMA 4YTNB 2OEDA 1VZ8A 2KQ4X 2BBCA 5AUIA 3Q69A 1XO3A 1E7PB 1EU3A 3W9CB 4P16A 5EE3A 4JE3B 3CIRB 5D3IB 3ZJUA 2IDYA 1Y56A 4OHJA 1I4QA 3U7ZA 1EU4A 1SBBB 1YJJA 2PIAA 2JYTA 4IOIE 2J42A 1SE2A 4JPSA 3AE6B 3AH7A 4OVZA 5G5GA 1E0ZA 4AS1A 2K5PA 1V8CA 1AN8A 1TY0A 1ENFA 3IAM1 1DOXA 4HKQA 2WXLA 1WGKA 2MJEA 1XLPA 1I4GA 4YTPB 4C56C 4D2KA 1CQVA 2RDGA 2WXOA 4HRSA 5EE9A 1SE3A 2FBWB 1FRDA 3SFDB 1F0ZA 1FM0D 4EE2A 3AECB 2SEBD 1KH0A 4JWSC 1L6UA 2NMQA 1YNTE 5AUKA 4RH6A 2M19A 4ZYSA 4RGTA 4IDIA 2V0GA 1Q10A 3GB1A 5BYRA 1XLNA 4ZHOA 3AV8A 2WDVB 4REZA 4YT0B 1K51A 1ROEA 3Q8AA 4XDCA 3T3NA 1K50A 1C4CA 2QMTA 1TY2A 1LO5D 1ZOYB 1GOZA 3T3OA 2KACA 1MI0A 3IT4B 4RGOS 3VRBB 3MP9A 1CZPA 1F2RC 3KWVA 2RDHA 2MEKA 3LB8C 1C4PA 1TS3A 3AE8B 3SR6A 1TKGA 2QILA 1NI3A 2R61A 5I4DA 2WXRA 1E9MA 2B76B 1D4BA 2GB1A 1XXGA 2PKOA 4DXGA 1TS5A 2E6XA 1FFVA 4XWTA 2N9KA 2WXJA 5BYSA 5MPOA 2I2YA 1M4VA 2INPE 1K52A 3AEFB 1DGJA 1WWTA 2HDEA 1XCTL 3FC4A 4US8A 3AEBB 2KDMA 1L4DB 2BYTA 4L23A 1V97A 4FXCA 1IGCA 2TSSA 4WWMA 1J7AA 2GI9A 1RWSA 2OHFA 2CJNA 4R3DA 2WXPA 1ET6A 1WSPA 1WRIA 3VR9B 2CU3A 3VQIA 2IPKD 3AMZA 1XLQA 1JRPA 4A55A 1IBXA 2BTEA 2RMMA 1N63A 4H2AA 3URYA 1T6BX 1RFKA 3BZDB 1DOIA 1VRAB 3IAS1 3P4RB 1P7EA 2WQYB 2KWDA 3AEGB 4NAMA 1ACCA 2Y3AA 3Q8CA 1YN5A 1MPEA 1QT9A 3Q8BA 4Q2JA 2K9XA 5HFYA 3SEBA 1KF6B 1I4XA 3NS1A 3W5UB 2MJDA 1AWDA 4MH8A 1QOGA 3NVZA 2K0PA 5HHDG 2LMCA 1QLBB 2DYOA 4RFBA 2LHDA 1DYQA 4LTUA 4C7YA 2JQRB 2AQ1B 3P4PB 3HVZA 3R2IA 2Q5WD 1A70A 1GB1A 3AB5A 2FUG1 2MH7A 3ZJTA 1KLGD 2D5GA 3MHZA 5HG2A 2LEKA 2RPVA 1OQQA 1T3QA 4WQMA 4HEA1 3ZJVA 3L4PA 4KKJA 1WYGA 2WLBA 2ONQA 2JZPA 3AE7B 5BYQA 2PW9A 4N58A 2MJ3A 1L0YB 4TMAB 1YN4A 1XLOA 2QSDA 5FK9C 5FR3A 1ZDXA 3P42A 1N5WA 1YMHE 1FNUA 5H92C 2BT6A 3CWIA 3PZ7A 2BW2A 1D5MC 1JWSD 1FRRA 3LXFA 4A90A 1FMAD 1TKEA 2AQ2B 1QF6A 2WU2B 4RCOA 2W82A 1ESFA 2WXHA 1DOYA 3AEDB 2K22A 1JALA 3E56A 1VDVA 1XEEA 3B9JA 3H8HA 3W5VB 4A8XC 2L1AA 3TEXA 4GLSC 3J9CA 3VRAB 3BVZA 3IXSA 1I7HA 1SXTA 1KFYB 4NJCA 4ARIA 3RPFC 2W3SA 1HA5A 4N59A 3ZQ4A 2V4IB 2N9LA 2V3PA 3EUB2 5D7GA 5C2TB 1SJED 2WU5B 3TUOA 4JWUC 4A9AA 4O1NA 1EWCA 2KMMA 1HZ5A 2Y5PA 1FD6A 1NYQA 1K53A 2LUMA 1UUPA 1BMLC 1TJEA 1IGDA 1HXYD 1PGXA 2K3UA 4YSXB 1FCLA 2LHEA 4NAWB 1FFUA 2Z8LA 3PO0A 3BIID 2QIEB 1EM7A 1C4AA 1QILA 1SF0A 2XN9C 3NVWA 2WP9B 3MC0B 1C77A 3HVDA 1L0XB 1N61A 2V3NA 4TSSA 1ZXHA 5GXGB 3ZYYX 3ABVB 1QOAA 2ON8A 1IBXB 1TKYA 1JWUD 4C80A 1ZDVA 1XCQL 1JWAD 3RFZB 1FXAA 5D3DA 1E6EB 2JXTA 2QEJC 3I9V1 2G1EA 1J7CA 4YXDB 5BMHA 1V1OA 1SIJA 3AE1B 3R8BA 1SJHD 1P7FA 1V1PB 2WXKA 4RF0A 3HUIA 1KRHA 4MT5A 3KQ4A 3P4QB 1SE4A 3DWGC 1UWMA 1IUEA 1V1PA 2AX5A 3AEEB 4ITKA 4HKZE 4OZCA 2BB5A 3AEAB 2EELA 1STEA 2DLBA 1GAQB 2YEPF 4DXFA 4YWGG 1YN3A 4B0EA 4XDDA 2W3RA 1B1ZA 2L83A 3BVGA 4YSYB 3P4SB 4WAFA 4RF1A 5HI1A 3O13A 2XNAC 4TQ0A 3BYTB 2ACZB 4XE0A 1CJEA 4MM3B 1PUTA 2J53A 4L1BA 1PGBA 1F77A 4WH4A 1GPXA 3GP7A 1N5XA 1FXIA 1YQ3B 3Q8FA 3BK2A 3FILB 2AQ3B 4GDLB 5H8YE 1MVKA 1ZPSA 1L0VB 1ZE3D 4KKIA 3FILA 4KGTA 4NZLB 3FAHA 2HTME 2G9HD 3LYYA 1SB3C 4N6EB 4AQ7A 2WXNA 1TS4A 4M0WA 4RNAA 2IGHA 1NENB 1E10A 1HEZE 1L4ZB 3C8YA 2JSVX 1OFFA 1I4HA 1QOBA 1TYGB 1UGJA 2KAJA 4KGRA 2PMVA 4ZHPA 2WNMA 1MHXA 1TZOA 3E9SA 2WXFA 2LJIA 2WXGA 4ARCA 2ZW0A 1CK1A 4OZBA 2BS2B 2CJOA 2N7JA 1ZP0B 4USAA 1J7BA 1VZ7A 1KLUD 3TEZA 3BK1A 1JWBD 4RGNA 1B9RA 3DWMA 3U2SC 1UNSA 5E6JA 2PTLA 3GS2A 2J4XA 3P1MA 1SEBD 2L32A 5JXVA 2DYMA 1C9FA 1OQRA 3VR8B 4B0MA 3AM9A 2NTSA 3KWLA 1F2RI 4C7ZA 1EWYC 3HRDD 1ZXIA 4P6VF 1N60A 3AE5B 1MHHE 3NUHB 3BWUD 2WS3B 2W55A 4ZRQA 1FNVA 3BVMA 3U4EG 2LGIA 3AE2B 3NZ3A 2JYEA 3V05A 4XWWA 1WXQA 4WURA 2W54A 4OW0A 3AE3B 1KTKA 4IKGA 4HJGE 4WIPA 3OWEB 1BUIC 3R2TA 4L2YA 2ZW1A 1VZ6A 3B2FA 1C76A 3BYYB 3ETRA 1JMLA 4KX6B 4A6QA 2IJ0A 4LLGM 5EE0A 3IT6B 1JWMD 4LK0M 2IGDA 2PVGC 5LNK1 1AYFA 3UI3A 5BMIA 1NEKB 2FE8A 4J3OD 1PFDA 1XF5L 2M56B 3EA6A 2KN4A 4ZOHC 4HROA 4OZAA 1JW9D 4ZRPA 2WDQB 2BS3B 3U52E 1FO4A 3W2DA 1QKZA 4UDUC 3P63A 1N62A 1VR9A 2L52A 1HZ6A 3AE9B 3AN1A 1NYRA 4DQOC 1HQRD 1FCCC 2PLPA 5G5HA 2VZKB 2JX5A 3MJ5A 1PGAA 3N9YC 3I57A 4PT5A 1QQRA 2PVOD 2VZKD 2N0SB 1D5ZC 2JU6X 3PZ8A 4YTMB 5EE1A 3TSSA 1BXTA 2IGGA 1FIQA 2GRIA 5FKAC 2Y5CA 2I38A 4MACA 2NTTA 2WDRB 3V3XA 1NVID 1RYJA 3EGRA 2H88B 3NRZA 5BMGA 4KGSA 4CQNA 1PYWD 1C79A 2J52A 3TEWA 1RM6C 1L5PA 4JX1C 1GB4A 2ICIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D4B A;  2GB1 A;  1HEZ E;  2JSV X;  2JWU A;  2N9K A;  2N9L A;  2I2Y A;  4KGR A;  1K52 A;  1XCT L;  1MHX A;  1HZ5 A;  1FD6 A;  2KDM A;  1K53 A;  2LUM A;  2ZW0 A;  1IGD A;  1IGC A;  4OZB A;  1PGX A;  2N7J A;  2GI9 A;  1FCL A;  2LHE A;  1EM7 A;  1UWX A;  2PTL A;  1IBX A;  5JXV A;  2RMM A;  1C9F A;  1ZXH A;  1F2R I;  1P7E A;  2KWD A;  2OED A;  2ON8 A;  1MHH E;  2KQ4 X;  1IBX B;  1MPE A;  5HFY A;  2LGI A;  1XCQ L;  2JXT A;  2K0P A;  5HHD G;  2LHD A;  5BMH A;  4IKG A;  4HJG E;  4IOI E;  2ZW1 A;  1GB1 A;  1P7F A;  1JML A;  5HG2 A;  2RPV A;  2IGD A;  3UI3 A;  2ONQ A;  5BMI A;  2JZP A;  2PW9 A;  4HKZ E;  4OZC A;  4D2K A;  1XF5 L;  2EEL A;  2KN4 A;  2QSD A;  4OZA A;  1QKZ A;  1YMH E;  1KH0 A;  1HZ6 A;  2NMQ A;  1YNT E;  5HI1 A;  1FCC C;  2PLP A;  1Q10 A;  2J53 A;  3GB1 A;  1PGA A;  1PGB A;  4WH4 A;  1K51 A;  2JU6 X;  1K50 A;  3FIL B;  2IGG A;  1MVK A;  2QMT A;  2I38 A;  4MAC A;  2KAC A;  1MI0 A;  3FIL A;  4KGT A;  3V3X A;  3MP9 A;  1F2R C;  5BMG A;  4KGS A;  2J52 A;  4GLS C;  2IGH A;  1GB4 A; 
#chains in the Genus database with same CATH topology
 1JCK B;  3WCQ A;  3CF6 E;  2BVC A;  3KUZ A;  1I4P A;  1P3Q U;  5LXH A;  1QOF A;  2LAS A;  1TZ1 A;  2MA9 B;  2YEP B;  2AEH A;  2BB6 A;  1I4R A;  4MJS A;  3ZGZ A;  2WXQ A;  2BS4 B;  2VH1 A;  3VUW A;  1TT5 B;  3SFE B;  1Q5W B;  3N32 A;  4W9D A;  5E6P A;  4P1C C;  1R7S A;  3Q3O C;  3PRP B;  4PS8 A;  1T5X D;  2IO2 B;  4RGM A;  2X38 A;  2J7Q B;  3AE4 B;  1KLV A;  1VJK A;  1PDX A;  4K7W A;  2WXM A;  2NR2 A;  1YIW A;  3PTF C;  3FKY A;  4J6I A;  1SIF A;  4FHJ A;  2KQ4 X;  4B6W A;  3Q69 A;  1XO3 A;  3DHH C;  1EU3 A;  4CYE A;  3ZJU A;  2KD0 A;  1I4Q A;  2J42 A;  4JPS A;  3GE3 C;  3AE6 B;  3A1Q A;  1ZGU B;  5JHB A;  1TY0 A;  3IAM 1;  2D2Q A;  5HKH A;  4HKQ A;  3VHT C;  1GC6 A;  1WGK A;  4W9J A;  1XLP A;  3ECI A;  1CQV A;  1V5T A;  2RDG A;  2WXO A;  1RAX A;  1SE3 A;  1FRD A;  3MC8 A;  2KK8 A;  2L3Z A;  4FLH A;  2SEB D;  1KH0 A;  4ZRK A;  2KQ7 A;  5AUK A;  4ZYS A;  2Z59 B;  3M63 B;  3AV8 A;  4REZ A;  1K51 A;  3OAW A;  2ZVN A;  2FCM A;  4PK1 A;  3T3O A;  2KAC A;  2OOB B;  3MP9 A;  4FAD A;  2RDH A;  2MEK A;  3VVW B;  1TS3 A;  3AE8 B;  3APF A;  1TKG A;  4WJN A;  1NI3 A;  1E9M A;  1FPY A;  2B76 B;  1D4B A;  1XXG A;  1K8R B;  1Y8R C;  2LUE A;  2INP E;  1WWT A;  1XCT L;  1HE8 A;  3C19 A;  4US8 A;  2BYT A;  1WXS A;  4L23 A;  3NY5 A;  4LNI A;  1BT0 A;  1RWS A;  4R3D A;  2KO3 A;  2WXP A;  2KC1 A;  2CU3 A;  4E71 A;  4IWP A;  3TIX A;  3VQI A;  2LRW A;  3AMZ A;  1JRP A;  4A55 A;  1IBX A;  3PT2 B;  1N63 A;  4F8C B;  4GDL A;  1RFK A;  3ONS A;  3BZD B;  1DOI A;  1VRA B;  4EFO A;  2KWD A;  3RZF A;  3LJ3 A;  3Q8C A;  3BY4 B;  1WX9 A;  1MPE A;  2NPT B;  4IW0 A;  2MJD A;  2JZ3 B;  3A9K B;  1GG3 A;  1S1Q B;  1LXD A;  2AQ1 B;  4IWO A;  3P4P B;  3R2I A;  2Q5W D;  4KDI C;  3AB5 A;  4ICV A;  3DHG C;  4DXA B;  2JXX A;  1WFY A;  2MH7 A;  1KLG D;  4W9G A;  4HEA 1;  3ZJV A;  4KKJ A;  1WYG A;  3ML9 A;  3HIZ A;  4TV3 A;  3ZW3 A;  2PW9 A;  1P1A A;  4P7I A;  2QSD A;  5FR3 A;  3ZXV A;  5E6O A;  1J19 A;  4BBN C;  2BT6 A;  3QWZ B;  4PYU A;  3NS8 A;  3NOB A;  3VH3 B;  1FRR A;  4ZDV A;  3Q2A C;  1FMA D;  2AQ2 B;  5CX3 A;  2M4N A;  2WU2 B;  2RGF A;  3RUL A;  3D32 A;  2K22 A;  3H6N A;  2JPH A;  2KVR A;  3UIO B;  3GOE A;  3L08 A;  3W5V B;  4A8X C;  4B9K A;  4MSQ B;  3TEX A;  2KKC A;  2CHW A;  3H7S A;  2BWF A;  4MGK E;  4ARI A;  1HA5 A;  2V4I B;  2V3P A;  4FJZ A;  4W9K A;  2A4Z A;  4A9A A;  1WR6 E;  2KMM A;  2Y5P A;  4AJW A;  1NYQ A;  1K53 A;  3RNG C;  1TJE A;  2K3U A;  2KN5 A;  2BKR B;  2Z8L A;  2DZJ A;  3DBR B;  3PO0 A;  3BII D;  2WX0 A;  1E8Z A;  3ZXR A;  2CU1 A;  3ZNH B;  2V3N A;  1H4R A;  3ZNG C;  5GXG B;  2BQQ A;  3C0R B;  4MH0 E;  2KHW B;  5GMV A;  5JH5 C;  3X23 A;  1FXA A;  5KHQ A;  1MFW A;  3I9V 1;  5BMH A;  3AE1 B;  3I63 C;  2L7R A;  5IKC M;  1V1P B;  3AU4 A;  2LRU A;  4RF0 A;  3ZNI D;  1KRH A;  3P4Q B;  3WA0 A;  1TGZ B;  3ZVV A;  2AX5 A;  5KHO A;  4DHZ B;  3B08 A;  2IO0 B;  5DPT A;  4YWG G;  1WM3 A;  1YN3 A;  2A5U A;  4B0E A;  2W3R A;  2X8X X;  2WYQ A;  5DPW A;  2N9P C;  3BYT B;  4GOC A;  4S17 A;  4XC2 A;  2ACZ B;  4MM3 B;  1R4N I;  3ZUN A;  1PGB A;  4PS3 A;  4WH4 A;  3GP7 A;  1V6E A;  4I6N B;  1TBE A;  4GDL B;  2N9X A;  1MVK A;  1ZPS A;  2I1J A;  1XD3 B;  2GLS A;  2RSU A;  4NZL B;  2N9E B;  4GU2 A;  3IVF A;  3V6C B;  4M0W A;  4RNA A;  1NEN B;  5CTR C;  1I4H A;  2KAJ A;  1WM2 A;  3AUL A;  1TZO A;  3E9S A;  4W9F A;  4DBG A;  2D3B A;  5EDS A;  1WF9 A;  2K1F A;  2LGX A;  4QAY A;  2NPT A;  1CK1 A;  1KLU D;  2C7N B;  2C7H A;  1GNU A;  1B9R A;  1UNS A;  1HTO A;  1SEB D;  2L32 A;  3Q3N C;  4LDT B;  4ANX A;  3AM9 A;  4GN1 A;  4DHZ E;  2HJ8 A;  1T0Y A;  1N6Z A;  1MHH E;  3NUH B;  2L00 B;  4ZRQ A;  4DHJ D;  2IYD B;  2KDE B;  4XX5 A;  3NZ3 A;  2D11 A;  2JYE A;  3BIN A;  3V05 A;  1WXQ A;  5CHW A;  1OQY A;  4WUR A;  1NDD A;  3OWE B;  2KQS A;  2D3A A;  1VZ6 A;  2I1K A;  3ETR A;  1JML A;  2O2V B;  4FHK A;  2MBE A;  4LLG M;  2LWP A;  4ZRJ A;  2GBJ A;  1XQQ A;  2D10 A;  1WMH A;  2FE8 A;  2M56 B;  5L83 A;  2KN4 A;  1JW9 D;  2N1V A;  2MHJ A;  4B95 A;  1QKZ A;  4UDU C;  4AP4 C;  3ZTC A;  4IM3 A;  1F52 A;  4GGQ A;  2MSE D;  1HQR D;  2PLP A;  5G5H A;  2VZK B;  1PGA A;  3I57 A;  1D5Z C;  1BXT A;  3KVF B;  2M0X A;  2Y5C A;  2AWT A;  1UD7 A;  2FUH B;  1UBQ A;  1I42 A;  1RYJ A;  4XGA B;  1WMH B;  2NBV B;  1PYW D;  2J52 A;  4HK2 A;  2DAF A;  1Q1O A;  1L5P A;  3W1S A;  3TEY A;  4G0N B;  5DPR A;  3VUX A;  1NI2 A;  3KLS X;  3H7P B;  5L95 C;  4NQL B;  1JRO A;  1YJI A;  4KV2 A;  1C78 A;  4BKS A;  2FAZ A;  1WZ3 A;  2Y5B B;  2REX A;  2QCZ A;  1ET9 A;  4HCN B;  2HE7 A;  4GDK B;  3A4R A;  2DYB A;  5BO4 B;  3A9K A;  2PEA A;  2EKI A;  4YSZ B;  3TCA A;  1GUA B;  2E3T A;  3Q8E A;  4JIO U;  1YQB A;  4YTN B;  4HVB A;  1VZ8 A;  2KFK A;  3UQB A;  5CHV C;  3W9C B;  2ZVO A;  1VCB A;  4DDI D;  3N3K B;  2IDY A;  1Y56 A;  1LFD A;  3PHX B;  2DZM A;  2JYT A;  4IOI E;  4PS7 A;  2L76 A;  4OVU A;  5G5G A;  1E0Z A;  5C23 A;  1AN8 A;  2L0F A;  2LGS A;  2KDI A;  3ZTD A;  4D2K A;  4EOY A;  4GIV A;  2ASQ A;  3AEC B;  1QZE A;  1L6U A;  3DCG A;  5CHF A;  2KNB A;  1T0Q C;  2NVU I;  5AZH A;  4RGT A;  5BYR A;  3RZW C;  4ZHO A;  2WDV B;  2FCQ A;  2NCN A;  1ROE A;  4ANV A;  3Q8A A;  3PS6 A;  2QMT A;  1YX5 B;  4K1R B;  2K8B A;  1C4P A;  2M17 A;  3SR6 A;  2HJ1 A;  4GDK A;  5I4D A;  4DXG A;  2O6V D;  2WXJ A;  2C9W B;  2KJR A;  3NJT A;  3DBH B;  1M4V A;  3ZDT A;  1K52 A;  2KZR A;  3AEF B;  4TUU A;  3AEB B;  2W9N A;  2KDM A;  3H7P A;  3ML8 A;  4FJV B;  4FXC A;  1IGC A;  4WWM A;  2GI9 A;  3DQV A;  2OHF A;  4F7Z A;  2CJN A;  1ET6 A;  2KWC A;  2LGD A;  3A1Q B;  2LGY A;  4MEL A;  3Q3F A;  2ZEQ A;  2BKF A;  2IPK D;  1E7V A;  2LVO A;  3IAS 1;  2KTF A;  5D2M B;  1P7E A;  1ACC A;  2ZCC A;  3Q3M C;  2K25 A;  1YN5 A;  1ZKH A;  4W9H A;  4Q2J A;  1J0G A;  3QHT A;  3DBS A;  3B1L X;  4MH8 A;  1QOG A;  1IYF A;  2K0P A;  1X1M A;  5HHD G;  2LMC A;  4C7Y A;  3HVZ A;  2KX3 A;  3P2B A;  2FUG 1;  2D5G A;  3DBR I;  4MJS B;  5HG2 A;  1GJZ A;  3Q14 C;  2EMS A;  4KDL B;  1V49 A;  5BYQ A;  3QQ8 B;  1L0Y B;  3OLM D;  4P1B C;  5FK9 C;  1N5W A;  1YMH E;  2FCN A;  3GZN B;  4TKN A;  1V2Y A;  3W1Y A;  1NBF C;  1V5O A;  2IY0 B;  1D5M C;  4A90 A;  1TKE A;  2MBO A;  3KYD D;  2W82 A;  4K3B A;  1JAL A;  3E56 A;  2L8J A;  1XEE A;  3H8H A;  4JQW C;  3WAO A;  2L1A A;  4GLS C;  3UQA A;  3J9C A;  3BVZ A;  3IXS A;  3IBE A;  1WXA A;  3ZQ4 A;  2K6D B;  5D7G A;  1SJE D;  2WU5 B;  3TUO A;  3IHP C;  5LXI B;  3PGE A;  2IBI B;  2LUM A;  2UWQ A;  3DOW A;  1PGX A;  2CS4 A;  1FCL A;  2G4S A;  2QIE B;  1EM7 A;  3MHS D;  3NVW A;  3R3M A;  1SF0 A;  2MCN B;  2EKE C;  2WP9 B;  4WQO B;  4EUT A;  5IO9 A;  3PLU A;  4DHJ B;  1WR1 A;  3ZYY X;  3DVN V;  3A4S C;  2XK5 A;  1MG8 A;  4WJO A;  1TKY A;  2AL6 A;  4C80 A;  2D07 B;  1XCQ L;  2V9H A;  3W1S C;  2QC8 A;  1E6E B;  2JXT A;  1UEL A;  1Z2M A;  4M02 A;  4MGY E;  3KW5 B;  4A3O A;  2G1E A;  3EHV A;  4YXD B;  1V1O A;  3AU5 A;  3X0W A;  2IO3 B;  1SJH D;  3IG3 A;  5JHA A;  3AI5 A;  2M1M A;  3HUI A;  4MT5 A;  3OG5 A;  2OJR A;  1IUE A;  4HKZ E;  2KLC A;  3LDZ E;  4FBJ B;  4XDD A;  1WJU A;  3P4S B;  4KZC A;  4RF1 A;  5HI1 A;  4TQ0 A;  2KOX A;  3H1U A;  4DWF A;  1HTQ A;  1CJE A;  2EMT A;  1OTR B;  2J53 A;  2N1W A;  1F77 A;  1GPX A;  3N1Z C;  1YQ3 B;  1KOT A;  2CKH B;  3FIL B;  2AQ3 B;  2MP2 B;  5H8Y E;  4AWJ A;  4KKI A;  2KC2 A;  3DDC B;  2G9H D;  4ASW C;  4HCP B;  1SB3 C;  5J18 A;  2MBQ A;  1TS4 A;  1E10 A;  4KVG B;  3C8Y A;  1OFF A;  1QOB A;  1TYG B;  4WWN A;  3VUY A;  4KGR A;  5IOI A;  1EF1 A;  4GXB A;  4ARC A;  4M8N A;  4OZB A;  4USA A;  4BVU C;  4NJ6 A;  4BZA A;  4HLE A;  3L17 A;  4RGN A;  4HXD A;  2WGS A;  2KWU B;  3U2S C;  2N7E A;  4LJO B;  3P1M A;  1WIA A;  1Q0W B;  2GBK A;  3KWL A;  2KX0 A;  5E6N A;  1V9J A;  4A20 A;  1CMX B;  3WIM A;  2WDT B;  2CHZ A;  2KXJ A;  2OJW A;  4G11 A;  1FNV A;  4WWO A;  2LGI A;  5G55 A;  3AE2 B;  1R4N B;  4EZK A;  2W54 A;  4OW0 A;  3AE3 B;  2V3S A;  2G3Q B;  4BAX A;  4ACF A;  3QX1 A;  4L2Y A;  3B2F A;  4A6Q A;  2IJ0 A;  1RFA A;  1OGW A;  5EE0 A;  3IT6 B;  3U7D A;  4BOZ B;  4LK0 M;  2PVG C;  4J3O D;  2L05 A;  3EC8 A;  4HRO A;  4M0W B;  3U52 E;  2WWZ A;  4BKS D;  1N62 A;  4IWQ A;  2L52 A;  1HZ6 A;  4LNK A;  3AE9 B;  1NYR A;  2GOW A;  4AJY B;  1QQR A;  3ZO5 B;  3ZRF A;  2VZK D;  2N0S B;  1FIQ A;  2GRI A;  5FKA C;  1LGR A;  2NTT A;  2WDR B;  3EGR A;  2H88 B;  3QAQ A;  5BMG A;  4XYC A;  3TEW A;  3QK0 A;  4JX1 C;  1GB4 A;  2ICI A;  4KIK B;  1FNW A;  2JWU A;  1ZUD 2;  2GBR A;  3I3T B;  2FCS A;  3DPD A;  2JY6 A;  4IUM B;  1FEH A;  4FA6 A;  2R2O A;  1AW7 A;  2INN E;  2DWQ A;  4K7S A;  5C3J B;  1TS2 A;  2KFK B;  3NVV A;  2K39 A;  3MFG A;  1SSN A;  3UGB B;  3MC9 A;  2Z0E B;  3B2G A;  3NVY A;  3PZD A;  1E8X A;  2IY1 B;  1YOV B;  2BBC A;  5AUI A;  4FJY A;  2FIF A;  1L2N A;  4BFR A;  3OJ3 A;  4P16 A;  5EE3 A;  3CIR B;  3DBH I;  4BKT A;  2MX2 A;  4WAA A;  2G4D B;  3WAP A;  3PRZ A;  3U7Z A;  1YJJ A;  4RMA A;  5DCN A;  1D3Z A;  4HWI B;  4OVZ A;  2K5P A;  3DVN U;  1S3S G;  3Q3J A;  4JLC A;  2WXL A;  1ISN A;  2MJE A;  2MWS B;  1I4G A;  3RYT A;  5EE9 A;  2FBW B;  2O6V A;  2KLG A;  3QA8 A;  2BYV E;  2RPQ A;  1FM0 D;  4AUQ C;  4JWS C;  5D94 A;  1UH6 A;  1YNT E;  2LVP A;  4RH6 A;  4IDI A;  1XLN A;  4YT0 B;  2BPS A;  3T3N A;  1K50 A;  1C4C A;  3VH4 B;  1ZOY B;  4E3C A;  1MI0 A;  3IT4 B;  4RGO S;  2NS5 A;  2KMC A;  4BBN F;  3LB8 C;  1VD2 A;  3N1Y C;  2LZ6 A;  2WXR A;  5IAA C;  1WGY A;  1TS5 A;  3RNB C;  1WGR A;  4XWT A;  2N9K A;  2I2Y A;  4LDT D;  3SHQ A;  5J17 A;  1DGJ A;  3M95 A;  3FC4 A;  3PPA A;  1L4D B;  1MJD A;  1E90 A;  1V97 A;  2TSS A;  4EEW A;  2K6Q A;  1J7A A;  3QIJ A;  1WSP A;  4ICU A;  1WRI A;  5D6J B;  3VR9 B;  3H9D A;  3RNF C;  3SD5 A;  2DZK A;  1WXV A;  2RMM A;  1UGM A;  1WJN A;  2WQY B;  3GE8 C;  3PLV A;  4W9E A;  1QT9 A;  1C3T A;  4C00 A;  2K9X A;  3SEB A;  2JRI B;  1RRB A;  2DZI A;  3W5U B;  4LNO A;  2J0K A;  2VH2 A;  1AWD A;  2JRH A;  3HK0 A;  2DYO A;  4RFB A;  2LHD A;  1DYQ A;  2JQR B;  5IA7 A;  3PRM B;  1A70 A;  3UIP B;  3ZJT A;  4WQM A;  1T3Q A;  3A33 B;  3L4P A;  3NHE B;  3AE7 B;  2C5L C;  4N58 A;  2MJ3 A;  2M8S A;  4TMA B;  1YN4 A;  1XLO A;  1ZDX A;  3TL5 A;  2ZNV C;  1FNU A;  2Z0D B;  5H92 C;  2VRR B;  3PZ7 A;  4GSW A;  2BW2 A;  1EO6 A;  1QF6 A;  2J0M A;  2MW5 A;  3DHI C;  1P0R A;  2WXH A;  1RLF A;  3APC A;  2IZV B;  3B9J A;  4ZRI A;  2BGF A;  3VRA B;  3EFC A;  1SXT A;  3VTV A;  4NJC A;  2NBW B;  1YX6 B;  2N9L A;  3CMM B;  3EUB 2;  5C2T B;  4NAW A;  4JWU C;  4HJK A;  1HZ5 A;  1UUP A;  1IGD A;  1HXY D;  2LD9 A;  4YSX B;  4NAW B;  3RNC C;  5AEK B;  2KWV B;  5JZE B;  4BKG A;  1C4A A;  3RI7 C;  1T0S C;  3AXC A;  3R66 C;  1C77 A;  1N61 A;  4LCD E;  2UU7 A;  4FN2 A;  1KM7 A;  4TSS A;  1ZXH A;  3ABV B;  1YJ1 A;  1QOA A;  1WJ4 A;  3RNE C;  4AOF A;  2ON8 A;  1JWU D;  2BYE A;  1ZDV A;  3NZS A;  1MG4 A;  5AZG A;  3EFU A;  2QEJ C;  3R7Q A;  1J7C A;  3L10 B;  3R8B A;  2LXC A;  3L0W B;  2WXK A;  3NG0 A;  1E5W A;  4CO7 A;  1SE4 A;  3DWG C;  3JVZ X;  4LNF A;  3V60 A;  2V4L A;  4ITK A;  2BB5 A;  4II3 B;  3AEA B;  3N20 C;  3N30 A;  1GAQ B;  1EUV B;  2YEP F;  4DXF A;  2N7D A;  3ZKJ C;  1B1Z A;  2L83 A;  4EKU A;  3BVG A;  4WAF A;  1ZW7 A;  2XNA C;  1WY8 A;  4NQK E;  4IC7 B;  4L1B A;  1N5X A;  3PV1 A;  3BK2 A;  3EEC A;  1IPG A;  1L0V B;  1ZE3 D;  4KGT A;  2XBB C;  2HTM E;  3RT3 B;  3LYY A;  4E74 A;  3CST A;  3JSV A;  3KH0 A;  2HTH A;  1HEZ E;  3T8M A;  2JSV X;  4JGH B;  1E7U A;  3UF8 A;  3JSV B;  4I6L B;  1MHX A;  2WNM A;  1OEY A;  3JW0 X;  2LJI A;  2ZPN A;  3VDZ A;  2ZW0 A;  4MGI E;  1WX8 A;  2BS2 B;  4C4V A;  2CJO A;  4RM8 A;  1ZP0 B;  3B0A A;  1J7B A;  1VZ7 A;  3V6E B;  1JWB D;  4NY0 A;  1WYW B;  5E6J A;  2BYF A;  4KSL C;  2J4X A;  5JXV A;  3PVL A;  1OQR A;  2D3G A;  4B0M A;  2DEN B;  3QCA A;  3V62 A;  1F2R I;  4C7Z A;  3HRD D;  1ZXI A;  3KUC B;  3AE5 B;  4ZYN A;  3BWU D;  2W55 A;  3Q6B A;  5AZF A;  1WGG A;  3V61 A;  2V1Y A;  3BVM A;  3U4E G;  4G3X B;  1PQS A;  3M3J A;  4BOS C;  4IKG A;  4HJG E;  3U8Z A;  4S0R A;  3BYY B;  3JYU A;  3T9L A;  3K9P B;  1XT9 B;  2KJH B;  3ENE A;  4M00 A;  3RMK C;  2O6V B;  1JWM D;  1YD8 U;  3L13 A;  1AYF A;  1NEK B;  3QJZ A;  1PFD A;  1XF5 L;  3KYC D;  4ZOH C;  4K7U A;  4ZRP A;  2BS3 B;  2N4F A;  3W2D A;  3P63 A;  4HDQ A;  2FNJ B;  4W9L A;  3AN1 A;  1WZ0 A;  4DQO C;  5IP4 D;  5TR5 A;  4W9C A;  1V80 A;  1WXM A;  2FID A;  4JL9 A;  3N9Y C;  3PZ8 A;  4YTM B;  5EE1 A;  3TSS A;  2IGG A;  5C1Z A;  2D3C A;  4MAC A;  3V3X A;  4KZ0 A;  3NRZ A;  2ZJD A;  2KMA A;  4KGS A;  2BWE S;  1JRU A;  4TQ1 A;  5T8I A;  1YQ4 B;  2H89 B;  2LFI A;  1D5X C;  5TSS A;  2G45 B;  4IG7 B;  5G2N A;  4DK5 A;  1L6V A;  1VLB A;  1D6E C;  2O2V A;  4US9 A;  2BF8 B;  1AAR A;  2DBY A;  2M0A A;  2RDB C;  1JQ4 A;  2HD5 B;  3VXW A;  3WAL A;  3M62 B;  2YVC A;  2QJL A;  1UWX A;  2LJ5 A;  4ANU A;  2AL3 A;  1C1Y B;  2SAK A;  2CR5 A;  2WXI A;  3N1X C;  4I6P A;  4NPN A;  2WHI A;  2OED A;  1E7P B;  4HPM B;  3KUD B;  4JE3 B;  3A9J A;  5D3I B;  4OHJ A;  1EU4 A;  4N9F 4;  4EZJ A;  1SBB B;  2PIA A;  2L0T A;  1SE2 A;  4II2 B;  2K8C A;  1R4M B;  3AH7 A;  5DPS A;  3L16 A;  3ZRC A;  4AS1 A;  1V81 A;  4X57 B;  1V8C A;  1ENF A;  4W9I A;  1DOX A;  1WJ6 A;  3TBL D;  4YTP B;  4C56 C;  4HRS A;  3RUI B;  3SFD B;  1F0Z A;  4EE2 A;  4URK A;  3VFK A;  3A9J B;  4MM3 A;  2NMQ A;  3VTW A;  2M19 A;  3HM3 A;  3PHW B;  2KJ6 A;  2V0G A;  1Q10 A;  3GB1 A;  2QDF A;  4XDC A;  2LVQ A;  1TY2 A;  1LO5 D;  1GOZ A;  3O65 B;  3VRB B;  1LQB A;  1CZP A;  1F2R C;  1P98 A;  1WE7 A;  3KWV A;  2ZNV B;  3WAM A;  4PYZ A;  2QIL A;  2R61 A;  3WAN A;  3DVG Y;  2GB1 A;  2PKO A;  1IP9 A;  2E6X A;  1FFV A;  2KDB A;  3RCZ A;  5BYS A;  5MPO A;  2DX5 B;  2HDE A;  4EZL A;  4NNJ B;  3NZU A;  4XZ4 A;  1UBI A;  4RM9 A;  2IND C;  2IO1 B;  2ZZP B;  4DDG D;  3DVG X;  1XLQ A;  2BTE A;  4H2A A;  5FR6 A;  3URY A;  4IM0 A;  1T6B X;  4IM2 A;  2PE9 A;  3P4R B;  4NAM A;  3AEG B;  2INC C;  2Y3A A;  3SDL C;  3ZDM C;  3Q8B A;  5HFY A;  1KF6 B;  1I4X A;  3NS1 A;  2JVC A;  2GMI C;  1V86 A;  3NVZ A;  3U30 A;  3MTN B;  1QLB B;  4LTU A;  2B3A A;  1WGH A;  1I35 A;  1GB1 A;  3MHZ A;  2C60 A;  2LEK A;  2RPV A;  1OQQ A;  3I5J C;  2WLB A;  1SE9 A;  2ONQ A;  2JZP A;  2PPH A;  2JF5 A;  3RN9 C;  2MLB A;  3K9O B;  3VTU A;  2JZZ A;  3P42 A;  2JWZ A;  3RD2 A;  4A3P A;  1G6J A;  3CWI A;  2WX1 A;  1JWS D;  3LXF A;  4RCO A;  4C4V B;  1ESF A;  1DOY A;  3AED B;  2JT4 B;  2KFJ A;  1WI0 A;  1VDV A;  2R2Q A;  2DNF A;  1U4A A;  2RR9 A;  4OVV A;  1F1H A;  4K81 A;  1I7H A;  1KFY B;  4K3C A;  3RPF C;  2W3S A;  4N59 A;  3ZNZ B;  2KTR A;  4O1N A;  1EWC A;  3DBL B;  1FD6 A;  2K8H A;  1BML C;  2AYO B;  2LHE A;  1FFU A;  2XK5 B;  2RD0 A;  4F1S A;  1QIL A;  2XN9 C;  3MC0 B;  1F9J A;  3CSF A;  1OEY J;  3PSE B;  3HVD A;  4M01 A;  4NJ7 A;  1WH3 A;  1L0X B;  3TMP B;  2KYW A;  1M94 A;  3RNA C;  3ZIM A;  3IFW B;  1IBX B;  3OJ4 B;  4MGZ E;  1UZX B;  1JWA D;  3RFZ B;  3HM6 X;  3VAW A;  4GB9 A;  5D3D A;  4LNN A;  1SIJ A;  1FXT B;  3MJW A;  3QAR A;  1P7F A;  3APD A;  3ZLZ A;  2KVZ A;  3ALB A;  3KQ4 A;  2GBM A;  1UWM A;  1V1P A;  3AEE B;  2PJH A;  2MRP A;  4OZC A;  4ANW A;  2ZPY A;  2EEL A;  1STE A;  2DLB A;  4HDO A;  3PRE A;  4GMV A;  1L7Y A;  1A5R A;  4YSY B;  4WWP A;  1E8Y A;  3O13 A;  5LLI A;  1GC7 A;  4XE0 A;  4YL8 A;  1PUT A;  1T0R C;  1FXI A;  4MSM B;  3Q8F A;  1P9D U;  4FUL A;  2MQJ A;  1H8C A;  3FIL A;  2PE6 B;  4HPL B;  1WE6 A;  3FAH A;  4WJQ A;  3S2A A;  2ZCB A;  2LXA A;  4N6E B;  4AQ7 A;  2WXN A;  4G50 A;  2IGH A;  1LM8 B;  1L4Z B;  3TJP A;  1UGJ A;  1Z5S B;  1J8C A;  2KAN A;  1WX7 A;  2PMV A;  4ZHP A;  2KDF B;  4HPP A;  2WXF A;  2WXG A;  1WGD A;  2UYZ B;  2N7J A;  2MP2 A;  5J2R A;  3TEZ A;  2QHO A;  3BK1 A;  3R7R A;  2DHZ A;  1SGH A;  3DWM A;  2PTL A;  3GS2 A;  2C7M B;  2MBH A;  2YLM A;  3GZN I;  2DYM A;  4MEM A;  1C9F A;  3VR8 B;  2NTS A;  1EWY C;  2KT7 A;  4P6V F;  1N60 A;  2XEW A;  2WS3 B;  2DAJ A;  2J0J A;  4XWW A;  4CHK A;  1KTK A;  3QC8 B;  4WIP A;  1BUI C;  4WJP A;  3R2T A;  2ZW1 A;  4KX6 B;  1C76 A;  5IN7 A;  4KIK A;  2MBB B;  3L54 A;  2IGD A;  4KSK C;  2GBN A;  5LNK 1;  2JUO A;  3UI3 A;  5BMI A;  1EF5 A;  4LJP B;  3UIN B;  4M8M A;  3DBL I;  3EA6 A;  1TIF A;  4OZA A;  2WDQ B;  1FO4 A;  1TTN A;  1VR9 A;  3HHM A;  3SU8 X;  1FCC C;  1UF0 A;  2LI5 A;  2JX5 A;  3MJ5 A;  4PT5 A;  2CHX A;  2PVO D;  1E8W A;  2JU6 X;  1KJT A;  1R4M I;  2I38 A;  1WRD B;  1NVI D;  4CQN A;  4MDK E;  1C79 A;  2KTR B;  1RM6 C;  2NBU A; 
#chains in the Genus database with same CATH homology
 3W1S A;  1JCK B;  4TQ1 A;  3WCQ A;  3TEY A;  5T8I A;  1I4P A;  1FNW A;  1YQ4 B;  2H89 B;  1QOF A;  2LFI A;  3KLS X;  1D5X C;  2JWU A;  5TSS A;  1JRO A;  1YJI A;  1C78 A;  1ZUD 2;  2YEP B;  1L6V A;  1VLB A;  1D6E C;  1I4R A;  2BB6 A;  4US9 A;  3ZGZ A;  1ET9 A;  2BS4 B;  2DBY A;  2M0A A;  2WXQ A;  1FEH A;  3SFE B;  1JQ4 A;  4GDK B;  1AW7 A;  1R7S A;  2INN E;  2DWQ A;  5C3J B;  1TS2 A;  2EKI A;  4YSZ B;  3NVV A;  3MFG A;  1T5X D;  2QJL A;  1UWX A;  4RGM A;  1SSN A;  2X38 A;  3AE4 B;  3B2G A;  1VJK A;  2E3T A;  3NVY A;  2SAK A;  1PDX A;  2WXI A;  3Q8E A;  2WXM A;  4YTN B;  2OED A;  1VZ8 A;  2KQ4 X;  2BBC A;  5AUI A;  3Q69 A;  1XO3 A;  1E7P B;  1EU3 A;  3W9C B;  4P16 A;  5EE3 A;  4JE3 B;  3CIR B;  5D3I B;  3ZJU A;  2IDY A;  1Y56 A;  4OHJ A;  1I4Q A;  3U7Z A;  1EU4 A;  1SBB B;  1YJJ A;  2PIA A;  2JYT A;  4IOI E;  2J42 A;  1SE2 A;  4JPS A;  3AE6 B;  3AH7 A;  4OVZ A;  5G5G A;  1E0Z A;  4AS1 A;  2K5P A;  1V8C A;  1AN8 A;  1TY0 A;  1ENF A;  3IAM 1;  1DOX A;  4HKQ A;  2WXL A;  1WGK A;  2MJE A;  1XLP A;  1I4G A;  4YTP B;  4C56 C;  4D2K A;  1CQV A;  2RDG A;  2WXO A;  4HRS A;  5EE9 A;  1SE3 A;  2FBW B;  1FRD A;  3SFD B;  1F0Z A;  1FM0 D;  4EE2 A;  3AEC B;  2SEB D;  1KH0 A;  4JWS C;  1L6U A;  2NMQ A;  1YNT E;  5AUK A;  4RH6 A;  2M19 A;  4ZYS A;  4RGT A;  4IDI A;  2V0G A;  1Q10 A;  3GB1 A;  5BYR A;  1XLN A;  4ZHO A;  3AV8 A;  2WDV B;  4REZ A;  4YT0 B;  1K51 A;  1ROE A;  3Q8A A;  4XDC A;  3T3N A;  1K50 A;  1C4C A;  2QMT A;  1TY2 A;  1LO5 D;  1ZOY B;  1GOZ A;  3T3O A;  2KAC A;  1MI0 A;  3IT4 B;  4RGO S;  3VRB B;  3MP9 A;  1CZP A;  1F2R C;  3KWV A;  2RDH A;  2MEK A;  3LB8 C;  1C4P A;  1TS3 A;  3AE8 B;  3SR6 A;  1TKG A;  2QIL A;  1NI3 A;  2R61 A;  5I4D A;  2WXR A;  1E9M A;  2B76 B;  1D4B A;  2GB1 A;  1XXG A;  2PKO A;  4DXG A;  1TS5 A;  2E6X A;  1FFV A;  4XWT A;  2N9K A;  2WXJ A;  5BYS A;  5MPO A;  2I2Y A;  1M4V A;  2INP E;  1K52 A;  3AEF B;  1DGJ A;  1WWT A;  2HDE A;  1XCT L;  3FC4 A;  4US8 A;  3AEB B;  2KDM A;  1L4D B;  2BYT A;  4L23 A;  1V97 A;  4FXC A;  1IGC A;  2TSS A;  4WWM A;  1J7A A;  2GI9 A;  1RWS A;  2OHF A;  2CJN A;  4R3D A;  2WXP A;  1ET6 A;  1WSP A;  1WRI A;  3VR9 B;  2CU3 A;  3VQI A;  2IPK D;  3AMZ A;  1XLQ A;  1JRP A;  4A55 A;  1IBX A;  2BTE A;  2RMM A;  1N63 A;  4H2A A;  3URY A;  1T6B X;  1RFK A;  3BZD B;  1DOI A;  1VRA B;  3IAS 1;  3P4R B;  1P7E A;  2WQY B;  2KWD A;  3AEG B;  4NAM A;  1ACC A;  2Y3A A;  3Q8C A;  1YN5 A;  1MPE A;  1QT9 A;  3Q8B A;  4Q2J A;  2K9X A;  5HFY A;  3SEB A;  1KF6 B;  1I4X A;  3NS1 A;  3W5U B;  2MJD A;  1AWD A;  4MH8 A;  1QOG A;  3NVZ A;  2K0P A;  5HHD G;  2LMC A;  1QLB B;  2DYO A;  4RFB A;  2LHD A;  1DYQ A;  4LTU A;  4C7Y A;  2JQR B;  2AQ1 B;  3P4P B;  3HVZ A;  3R2I A;  2Q5W D;  1A70 A;  1GB1 A;  3AB5 A;  2FUG 1;  2MH7 A;  3ZJT A;  1KLG D;  2D5G A;  3MHZ A;  5HG2 A;  2LEK A;  2RPV A;  1OQQ A;  1T3Q A;  4WQM A;  4HEA 1;  3ZJV A;  3L4P A;  4KKJ A;  1WYG A;  2WLB A;  2ONQ A;  2JZP A;  3AE7 B;  5BYQ A;  2PW9 A;  4N58 A;  2MJ3 A;  1L0Y B;  4TMA B;  1YN4 A;  1XLO A;  2QSD A;  5FK9 C;  5FR3 A;  1ZDX A;  3P42 A;  1N5W A;  1YMH E;  1FNU A;  5H92 C;  2BT6 A;  3CWI A;  3PZ7 A;  2BW2 A;  1D5M C;  1JWS D;  1FRR A;  3LXF A;  4A90 A;  1FMA D;  1TKE A;  2AQ2 B;  1QF6 A;  2WU2 B;  4RCO A;  2W82 A;  1ESF A;  2WXH A;  1DOY A;  3AED B;  2K22 A;  1JAL A;  3E56 A;  1VDV A;  1XEE A;  3B9J A;  3H8H A;  3W5V B;  4A8X C;  2L1A A;  3TEX A;  4GLS C;  3J9C A;  3VRA B;  3BVZ A;  3IXS A;  1I7H A;  1SXT A;  1KFY B;  4NJC A;  4ARI A;  3RPF C;  2W3S A;  1HA5 A;  4N59 A;  3ZQ4 A;  2V4I B;  2N9L A;  2V3P A;  3EUB 2;  5D7G A;  5C2T B;  1SJE D;  2WU5 B;  3TUO A;  4JWU C;  4A9A A;  4O1N A;  1EWC A;  2KMM A;  1HZ5 A;  2Y5P A;  1FD6 A;  1NYQ A;  1K53 A;  2LUM A;  1UUP A;  1BML C;  1TJE A;  1IGD A;  1HXY D;  1PGX A;  2K3U A;  4YSX B;  1FCL A;  2LHE A;  4NAW B;  1FFU A;  2Z8L A;  3PO0 A;  3BII D;  2QIE B;  1EM7 A;  1C4A A;  1QIL A;  1SF0 A;  2XN9 C;  3NVW A;  2WP9 B;  3MC0 B;  1C77 A;  3HVD A;  1L0X B;  1N61 A;  2V3N A;  4TSS A;  1ZXH A;  5GXG B;  3ZYY X;  3ABV B;  1QOA A;  2ON8 A;  1IBX B;  1TKY A;  1JWU D;  4C80 A;  1ZDV A;  1XCQ L;  1JWA D;  3RFZ B;  1FXA A;  5D3D A;  1E6E B;  2JXT A;  2QEJ C;  3I9V 1;  2G1E A;  1J7C A;  4YXD B;  5BMH A;  1V1O A;  1SIJ A;  3AE1 B;  3R8B A;  1SJH D;  1P7F A;  1V1P B;  2WXK A;  4RF0 A;  3HUI A;  1KRH A;  4MT5 A;  3KQ4 A;  3P4Q B;  1SE4 A;  3DWG C;  1UWM A;  1IUE A;  1V1P A;  2AX5 A;  3AEE B;  4ITK A;  4HKZ E;  4OZC A;  2BB5 A;  3AEA B;  2EEL A;  1STE A;  2DLB A;  1GAQ B;  2YEP F;  4DXF A;  4YWG G;  1YN3 A;  4B0E A;  4XDD A;  2W3R A;  1B1Z A;  2L83 A;  3BVG A;  4YSY B;  3P4S B;  4WAF A;  4RF1 A;  5HI1 A;  3O13 A;  2XNA C;  4TQ0 A;  3BYT B;  2ACZ B;  4XE0 A;  1CJE A;  4MM3 B;  1PUT A;  2J53 A;  4L1B A;  1PGB A;  1F77 A;  4WH4 A;  1GPX A;  3GP7 A;  1N5X A;  1FXI A;  1YQ3 B;  3Q8F A;  3BK2 A;  3FIL B;  2AQ3 B;  4GDL B;  5H8Y E;  1MVK A;  1ZPS A;  1L0V B;  1ZE3 D;  4KKI A;  3FIL A;  4KGT A;  4NZL B;  3FAH A;  2HTM E;  2G9H D;  3LYY A;  1SB3 C;  4N6E B;  4AQ7 A;  2WXN A;  1TS4 A;  4M0W A;  4RNA A;  2IGH A;  1NEN B;  1E10 A;  1HEZ E;  1L4Z B;  3C8Y A;  2JSV X;  1OFF A;  1I4H A;  1QOB A;  1TYG B;  1UGJ A;  2KAJ A;  4KGR A;  2PMV A;  4ZHP A;  2WNM A;  1MHX A;  1TZO A;  3E9S A;  2WXF A;  2LJI A;  2WXG A;  4ARC A;  2ZW0 A;  1CK1 A;  4OZB A;  2BS2 B;  2CJO A;  2N7J A;  1ZP0 B;  4USA A;  1J7B A;  1VZ7 A;  1KLU D;  3TEZ A;  3BK1 A;  1JWB D;  4RGN A;  1B9R A;  3DWM A;  3U2S C;  1UNS A;  5E6J A;  2PTL A;  3GS2 A;  2J4X A;  3P1M A;  1SEB D;  2L32 A;  5JXV A;  2DYM A;  1C9F A;  1OQR A;  3VR8 B;  4B0M A;  3AM9 A;  2NTS A;  3KWL A;  1F2R I;  4C7Z A;  1EWY C;  3HRD D;  1ZXI A;  4P6V F;  1N60 A;  3AE5 B;  1MHH E;  3NUH B;  3BWU D;  2WS3 B;  2W55 A;  4ZRQ A;  1FNV A;  3BVM A;  3U4E G;  2LGI A;  3AE2 B;  3NZ3 A;  2JYE A;  3V05 A;  4XWW A;  1WXQ A;  4WUR A;  2W54 A;  4OW0 A;  3AE3 B;  1KTK A;  4IKG A;  4HJG E;  4WIP A;  3OWE B;  1BUI C;  3R2T A;  4L2Y A;  2ZW1 A;  1VZ6 A;  3B2F A;  1C76 A;  3BYY B;  3ETR A;  1JML A;  4KX6 B;  4A6Q A;  2IJ0 A;  4LLG M;  5EE0 A;  3IT6 B;  1JWM D;  4LK0 M;  2IGD A;  2PVG C;  5LNK 1;  1AYF A;  3UI3 A;  5BMI A;  1NEK B;  2FE8 A;  4J3O D;  1PFD A;  1XF5 L;  2M56 B;  3EA6 A;  2KN4 A;  4ZOH C;  4HRO A;  4OZA A;  1JW9 D;  4ZRP A;  2WDQ B;  2BS3 B;  3U52 E;  1FO4 A;  3W2D A;  1QKZ A;  4UDU C;  3P63 A;  1N62 A;  1VR9 A;  2L52 A;  1HZ6 A;  3AE9 B;  3AN1 A;  1NYR A;  4DQO C;  1HQR D;  1FCC C;  2PLP A;  5G5H A;  2VZK B;  2JX5 A;  3MJ5 A;  1PGA A;  3N9Y C;  3I57 A;  4PT5 A;  1QQR A;  2PVO D;  2VZK D;  2N0S B;  1D5Z C;  2JU6 X;  3PZ8 A;  4YTM B;  5EE1 A;  3TSS A;  1BXT A;  2IGG A;  1FIQ A;  2GRI A;  5FKA C;  2Y5C A;  2I38 A;  4MAC A;  2NTT A;  2WDR B;  3V3X A;  1NVI D;  1RYJ A;  3EGR A;  2H88 B;  3NRZ A;  5BMG A;  4KGS A;  4CQN A;  1PYW D;  1C79 A;  2J52 A;  3TEW A;  1RM6 C;  1L5P A;  4JX1 C;  1GB4 A;  2ICI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...