1YNTE

Structure of the monomeric form of t. gondii sag1 surface antigen bound to a human fab
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
EVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYADLLAKVNGEYTADLEDGGNHMNIKFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex between the monomeric form of Toxoplasma gondii surface antigen 1 (SAG1) and a monoclonal antibody that mimics the human immune response
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
molecule keywords 4F11E12 Fab variable light chain region
total genus 9
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2005-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yntE00
1MHHE 2EELA 1IGCA 2NMQA 1KH0A 1F2RI 2ZW0A 3GB1A 1YNTE 1K53A 2ZW1A 1P7FA 5BMHA 1HEZE 2KQ4X 2QSDA 1Q10A 2LHEA 1MHXA 2KDMA 2N7JA 2IGHA 3V3XA 4KGRA 1GB4A 1IBXA 2JSVX 2K0PA 4IKGA 3MP9A 2KWDA 1D4BA 2GI9A 1MPEA 2I2YA 1HZ5A 3FILA 5HHDG 2JU6X 3UI3A 1XCTL 1FCCC 1JMLA 4HKZE 5BMIA 1F2RC 1FD6A 2KACA 1K52A 2ONQA 1FCLA 1PGBA 5BMGA 1ZXHA 1IBXB 2PTLA 1P7EA 2J52A 4KGTA 1XCQL 1PGXA 4OZAA 3FILB 4MACA 2JWUA 5HI1A 2RPVA 5JXVA 2RMMA 2I38A 1C9FA 2LUMA 2JZPA 4GLSC 2J53A 2IGDA 4D2KA 1YMHE 1IGDA 2N9KA 4HJGE 2PW9A 2QMTA 4OZBA 2JXTA 2OEDA 1HZ6A 4OZCA 1PGAA 2PLPA 5HFYA 4IOIE 4WH4A 2LGIA 2KN4A 1MI0A 2GB1A 1K50A 1QKZA 5HG2A 2N9LA 1XF5L 2LHDA 2IGGA 1EM7A 4KGSA 1GB1A 1UWXA 2ON8A 1MVKA 1K51A
chains in the Genus database with same CATH superfamily
2IBIB 1JWAD 3LJ3A 2HDEA 4W9EA 1KH0A 3ZDMC 2L83A 3BINA 1WH3A 1L7YA 4B9KA 1SBBB 3QWZB 2MBEA 4YTMB 3E56A 4AJWA 1SIJA 3DCGA 3VDZA 3PRZA 2GMIC 1AARA 4HPMB 1LFDA 3P2BA 4KDIC 4W9CA 4WURA 2VH1A 4R3DA 1ZKHA 1FXTB 2O6VA 1L4DB 2GI9A 4ZRPA 1E10A 3CSTA 5J2RA 3N9YC 2FAZA 5HHDG 1BMLC 2HE7A 4CHKA 1KJTA 2DAFA 2WXLA 4JQWC 1I4XA 4TQ0A 2MLBA 1WGGA 1JMLA 2WHIA 3SHQA 3TEYA 3NVVA 3T3NA 1FRDA 4TSSA 2QCZA 4EZKA 1XLNA 2BWFA 3EUB2 2CR5A 4KZ0A 3EC8A 2BB5A 4KIKB 3VR9B 5IAAC 2BBCA 4PT5A 3DVGY 1NEKB 3ZTDA 2NTTA 2WLBA 2J42A 4RMAA 2LUMA 2JZPA 5L95C 4XWTA 2KVRA 4IWPA 4JWUC 3TEWA 2WXGA 2AQ3B 4BKSD 1JRPA 1TZ1A 1MI0A 2A5UA 1DOYA 4HCPB 2PKOA 1P1AA 2KZRA 2BYTA 2J0JA 4HVBA 4DHZB 2KYWA 4II2B 2HTME 3CWIA 4NZLB 2K9XA 1GPXA 1LO5D 4DDID 1C3TA 4XX5A 3NS8A 1L0XB 4GU2A 2KKCA 3WALA 4L1BA 3BY4B 1OTRB 5AUIA 4HPPA 5AZGA 5G2NA 3KQ4A 4YTPB 3IHPC 2RPQA 4PS7A 1SE2A 3ZTCA 1RFKA 3T8MA 1YOVB 4C80A 1C78A 1KLGD 2I2YA 1WXAA 3DBRB 3GZNB 4MDKE 4S0RA 4EOYA 1P0RA 2ZCBA 1FFUA 3P1MA 1NI2A 3AE7B 3NZSA 1V5TA 1EU4A 2Y5CA 2R2QA 4RM9A 5J18A 1C77A 4DHJB 3OWEB 4W9LA 2WXJA 3MJ5A 2D11A 2NR2A 4P7IA 1J7BA 2IY0B 5CX3A 4CYEA 5J17A 4Q2JA 4A8XC 1C9FA 3ZDTA 4EKUA 1EWCA 4KVGB 4FN2A 2FCQA 4ANUA 1ET9A 3U7DA 3CMMB 1EU3A 4URKA 1I4PA 2D3BA 4EFOA 4LDTB 2DENB 1FXIA 3ZW3A 4BZAA 3PHXB 3MHSD 3GE3C 1V6EA 4KSKC 3TIXA 3WIMA 3VVWB 4ARIA 1SE3A 2K8BA 3RNFC 5GMVA 5D3IB 1K51A 1NVID 4QAYA 4IM3A 2KQSA 3GE8C 2HJ8A 4ZRIA 2WXPA 4XC2A 3AN1A 3PRMB 4DXAB 4LJOB 1C4AA 2L52A 1V8CA 2K6QA 4MGIE 3H8HA 4GN1A 1OEYJ 3V3XA 4IG7B 4KZCA 3ECIA 1N5WA 2YVCA 1GUAB 3VUWA 4P16A 3AE9B 4HRSA 2BYEA 2BVCA 1V5OA 2KWCA 2WU5B 2C7NB 2LWPA 2N4FA 2JQRB 5D3DA 3R2TA 2LXAA 3B2FA 4HWIB 4PYUA 1C1YB 2M0XA 3PREA 4HCNB 2WNMA 1MG4A 5BMGA 4WJNA 3HHMA 2LVQA 4N58A 1VZ6A 3CF6E 3DDCB 2KC1A 2KWVB 3KUDB 1TGZB 1XT9B 3L54A 2MBOA 2M0AA 3ZNGC 2FNJB 1R4MI 3V61A 2YEPB 2TSSA 2KJRA 2WX1A 1Y8RC 4IOIE 1YQ4B 3VFKA 1QKZA 2N9LA 3OG5A 3DWMA 1TS2A 1E7PB 2D3AA 1LQBA 4W9FA 4FULA 2N1VA 1DYQA 2JVCA 2ZPYA 3FAHA 3CSFA 1MVKA 2DWQA 5DPWA 1LXDA 3I9V1 2UWQA 3Q14C 2WXIA 2QIEB 3ZGZA 3NJTA 3ZQ4A 4N59A 2W3RA 1Q10A 2ZPNA 4USAA 1Q0WB 1CZPA 4ITKA 4EZLA 2WXQA 1VR9A 1NDDA 4RGOS 4NQLB 4K81A 5DCNA 1Z2MA 1SE9A 3UI3A 3L08A 3IT6B 4EUTA 1E8YA 3DVNU 4GXBA 2I1KA 2A4ZA 3VH4B 4YXDB 1Z5SB 2KVZA 1N62A 1RYJA 2KACA 4LNNA 3R7RA 2FUHB 1FCLA 3H7PB 3KUCB 3PZDA 3AEEB 4RGNA 1QOFA 2V1YA 1WR1A 2RPVA 1KM7A 4MM3A 2PVGC 4OVVA 4P6VF 1GNUA 3UINB 1ZDVA 2N9KA 3AE4B 2LZ6A 2OEDA 1E5WA 3SD5A 2E6XA 4MGZE 2ZEQA 1H8CA 4GIVA 3ZIMA 2JRHA 4WWNA 1FMAD 4L23A 4BOZB 2QEJC 3DHGC 1K50A 1WXSA 1EF5A 1YN3A 1FXAA 4XDDA 1C4CA 4YSXB 1M94A 2M56B 2MP2B 2NPTB 1ZGUB 4C56C 3PRPB 4XWWA 3UIPB 3AEDB 1KRHA 2N7EA 4J3OD 3N3KB 1UBQA 2CKHB 2ZW1A 1ESFA 4TKNA 4BVUC 1I7HA 4NPNA 3A4SC 2PIAA 2O6VB 4K7UA 1BUIC 3AI5A 1SJED 4NAMA 1SIFA 3TEZA 1LGRA 5CTRC 1MHXA 4JPSA 4HJKA 3T9LA 3ZJTA 4FA6A 2BKFA 4ARCA 1HA5A 2M4NA 3URYA 1L6UA 4KGRA 4AUQC 1RWSA 3EA6A 1D4BA 2Q5WD 1UGJA 2NTSA 2L0FA 2NBWB 2RR9A 3Q8AA 4IW0A 4K3CA 5IKCM 3ZJUA 3QC8B 1FIQA 3PTFC 3H9DA 3IAM1 2MBBB 3Q8EA 3AU5A 4US8A 1WRIA 3T3OA 1HE8A 2LVPA 3ZNZB 4XYCA 4S17A 3O13A 4AJYB 3RD2A 2J52A 1WGDA 1JWUD 1R4MB 4KKIA 1C76A 3AEGB 1TKYA 2D07B 4HDQA 2LUEA 4MACA 3LB8C 3H7PA 1KFYB 2RMMA 1R4NB 2J53A 3ENEA 2MEKA 1SJHD 4WIPA 2WS3B 5EE3A 4ZDVA 1QLBB 3MTNB 3UQBA 2WGSA 3U8ZA 3AEAB 3JSVA 3MJWA 4X57B 4WJOA 2OHFA 2L3ZA 2GBMA 2DZKA 2LGIA 2CJOA 3AE1B 1K8RB 2WXOA 5CHWA 1EM7A 3P42A 3R7QA 3U2SC 2K3UA 3QJZA 4ASWC 5C1ZA 3AECB 1MHHE 2M1MA 4TV3A 2KK8A 2Z0EB 2INNE 3OJ4B 2L32A 1K53A 3VTWA 1PFDA 1FNVA 4W9JA 2LASA 2IO2B 2XBBC 1TY2A 1SB3C 2LRWA 1ZPSA 1WFYA 4ZRQA 2BKRB 3SEBA 3MP9A 3WAPA 4N9F4 1RRBA 3BYYB 1IUEA 4JL9A 4DHJD 3M62B 1GAQB 3VTUA 5DPRA 2W55A 2Y5PA 3C8YA 5C3JB 3VXWA 1UF0A 1J7CA 2AX5A 3DVNV 2DZJA 3C19A 1N63A 4WQOB 2KNBA 3SU8X 3ZJVA 4FJYA 1YD8U 2V4LA 1I4HA 1UELA 3U7ZA 4GDKB 2MHJA 3APDA 4ANVA 1XQQA 3UIOB 1Q5WB 3K9PB 1R7SA 4YT0B 2BS2B 2BQQA 4K7SA 4XE0A 1FNUA 1I4GA 1PUTA 3H7SA 2Z0DB 2KTRA 2DHZA 2GBRA 1PQSA 1VLBA 4OVUA 4B0EA 2NPTA 3DBSA 5E6NA 1NI3A 4C00A 2G9HD 2IGGA 2KMAA 1WGKA 3FKYA 3ZVVA 2KWUB 3PGEA 2QJLA 4YSZB 2G45B 3BVMA 1CK1A 1WMHB 1WGHA 3Q3JA 2AYOB 4W9IA 3V62A 1E7VA 1SSNA 3A1QA 1SXTA 2WDQB 4W9GA 3ZKJC 4FBJB 4M0WA 1V97A 3VQIA 5G5HA 1TKGA 2DNFA 3IG3A 2W9NA 2IY1B 4NNJB 1E6EB 4DDGD 3UF8A 3A4RA 5LXIB 1HZ5A 3W1SC 3LYYA 3R3MA 3HK0A 2BYFA 1E8WA 1L0VB 2JPHA 4K7WA 3AB5A 2L7RA 1V81A 1VD2A 5EE0A 2DYMA 1UZXB 2IZVB 1TY0A 4MT5A 2ZVOA 5AZFA 1WX7A 4ZHPA 1AN8A 1KTKA 1NYQA 3AXCA 2GBKA 2KQ7A 1C4PA 4NQKE 3UGBB 1WRDB 2BW2A 2Y3AA 3KYDD 1S1QB 1WR6E 2KDFB 2K25A 5EDSA 2I38A 1TKEA 4II3B 4J6IA 3QX1A 2K22A 4DHZE 1T0QC 3EFCA 2JXTA 4E3CA 3GP7A 4JWSC 1PGAA 1T6BX 4XGAB 1D6EC 1DOIA 3PHWB 4RNAA 1V86A 4G50A 2LHDA 3UQAA 3PO0A 3ML8A 1QT9A 3DBHB 4HLEA 2ON8A 4WJPA 2C5LC 4H2AA 4E71A 2QILA 2L00B 2C7HA 3WAOA 4C7YA 2I1JA 5FR3A 2M8SA 3U4EG 4C7ZA 4CQNA 1P7FA 3AH7A 1MFWA 3DOWA 5I4DA 5G5GA 3MFGA 2MBQA 1YIWA 2BGFA 2YEPF 4GGQA 3HIZA 4YWGG 2R2OA 1WJ6A 1D5ZC 4JGHB 1WE6A 1RFAA 3J9CA 2KJHB 3BYTB 4MSMB 3U30A 4L2YA 5IO9A 3NVYA 1RAXA 4JIOU 4C4VA 2LMCA 3Q8FA 1P9DU 1WSPA 2VZKD 1FPYA 3DHIC 4GDLA 4BKTA 2MA9B 3N1XC 4HPLB 2MW5A 5FR6A 4FLHA 3MC0B 1ZXHA 1FO4A 1P7EA 1A5RA 1J8CA 1ZE3D 4ZHOA 2EMTA 3RT3B 4W9DA 2ZNVC 4LNIA 5AZHA 2FE8A 1ROEA 5TR5A 1T0SC 3NOBA 4NJ6A 2L8JA 1L2NA 1JWSD 1EWYC 2G3QB 3L10B 5HFYA 2X8XX 2G4SA 3S2AA 1LM8B 3DHHC 4PS8A 2GB1A 3NUHB 2KJ6A 2GBJA 3H6NA 4TUUA 2V3PA 3JVZX 3P4PB 1KOTA 4ANXA 1EF1A 2JYTA 4GMVA 1YJJA 2BS3B 1GOZA 2D3GA 2N9PC 4UDUC 2C9WB 3GS2A 1YNTE 3MHZA 3RNCC 2CU1A 3QA8A 1NBFC 2GOWA 1TJEA 3NRZA 2K1FA 5C2TB 3JSVB 3I3TB 1Y56A 2CHZA 4DXGA 1OGWA 4MEMA 1WX8A 4MELA 1IBXA 1WE7A 2C7MB 3IXSA 3PZ8A 3HUIA 1GC6A 1YJ1A 2KMCA 1WZ3A 3QK0A 2AQ1B 4YL8A 1P98A 2V9HA 3VUYA 2WXRA 1QZEA 5JH5C 1F2RC 4M8NA 3RMKC 1K52A 1SE4A 4IWOA 3DPDA 2LGSA 1M4VA 1TIFA 2KTRB 1YQBA 1ENFA 3ZNHB 3SFEB 1E8ZA 3ONSA 4A3OA 1J0GA 3FC4A 1H4RA 1XO3A 1IP9A 5BYQA 2QHOA 5AUKA 1YJIA 4MGYE 1WM3A 3KWVA 2MRPA 1HZ6A 4FADA 3N32A 3KH0A 3W9CB 4M8MA 3DBLB 2OJWA 2JZ3B 1E8XA 2FIFA 2E3TA 2ZZPB 2K8CA 2KAJA 2D10A 3HVDA 3W5UB 1FFVA 1GB1A 1AWDA 5C23A 1RM6C 3MC8A 2L05A 2X38A 1N60A 1NENB 3H1UA 4MSQB 3RZWC 3R8BA 4GB9A 1UD7A 3HVZA 3VAWA 3N1YC 3O65B 3APCA 1BXTA 2AL6A 2DLBA 5BMHA 3ZRCA 4RGTA 3W1SA 2UU7A 1SEBD 2K8HA 2QSDA 3BK1A 4KX6B 1WYWB 1WXMA 2J7QB 2J0MA 2MX2A 5LLIA 2INCC 3AULA 3PT2B 4IKGA 3RPFC 2XEWA 1ZUD2 2JZZA 3PZ7A 2JYEA 1PDXA 1YX5B 1N61A 2R61A 3IT4B 5BYRA 1FCCC 5KHQA 4HKQA 2G1EA 1WXQA 4AWJA 2MJEA 2BS4B 2N1WA 2IJ0A 1DGJA 3L4PA 4OZAA 2WXMA 3ZXRA 3Q3OC 5HI1A 4HXDA 3TUOA 3AMZA 5JXVA 3NS1A 2VRRB 2AWTA 1ZP0B 2KTFA 3NVWA 3APFA 1FEHA 2MP2A 2V3SA 3Q69A 4HJGE 2WP9B 4PK1A 4IDIA 5JZEB 3AE2B 2JXXA 1OFFA 4WH4A 3RULA 2HTHA 2KN4A 1JALA 4NAWA 2XNAC 1XEEA 4EZJA 1YX6B 2WXNA 1HTOA 2W3SA 3OJ3A 2V4IB 1ACCA 4EE2A 2NCNA 5T8IA 4M01A 3ZYYX 3Q3MC 2NBVB 4IUMB 2JF5A 2IO1B 2PE9A 2PPHA 1ZXIA 2LI5A 3KWLA 3JYUA 2DZIA 1VJKA 2INPE 1T5XD 5D2MB 3BVZA 1IGCA 2NMQA 4TMAB 3OLMD 1RLFA 2IYDB 3Q2AC 1DOXA 4OVZA 1A70A 3KLSX 4RFBA 1CQVA 2WXKA 4PS3A 3X0WA 1WIAA 3Q8CA 2DBYA 2WXFA 4FJVB 1E90A 2INDC 2KT7A 4ZRJA 3AE5B 3KW5B 5CHFA 5TSSA 4IC7B 1WMHA 1SF0A 4IM0A 3L13A 3V60A 1JROA 3DWGC 3B2GA 3PV1A 1TS5A 2KDEB 3EECA 1F52A 1UWMA 2KHWB 1G6JA 2LGXA 4N6EB 5HKHA 1B9RA 2BT6A 2V0GA 2D3CA 3TEXA 3FILB 3IVFA 1OQRA 1OQQA 2KN5A 4BOSC 2LRUA 3PS6A 2LJ5A 4LNFA 4FXCA 1WJ4A 2PMVA 2JRIB 2BPSA 2J0KA 1JRUA 4KSLC 4C4VB 2KLGA 2CU3A 2PEAA 4B6WA 2B3AA 5GXGB 1OEYA 5E6OA 3RNAC 2WDTB 3BWUD 3QIJA 2N9EB 1UUPA 5E6JA 2H89B 1UWXA 4WWOA 5BO4B 4ZOHC 3PLUA 2MJDA 1HXYD 2OJRA 1V80A 4JLCA 4IM2A 2DYBA 2O2VB 3BK2A 3JW0X 4O1NA 2AL3A 2EELA 3ABVB 4AOFA 3U52E 4GSWA 3E9SA 1VDVA 3TMPB 4AP4C 1E9MA 4LK0M 3NZUA 3NG0A 4DWFA 1QOGA 3PSEB 3AEBB 3B1LX 2QC8A 4DXFA 1AW7A 1KLUD 2CHXA 4KIKA 1QOBA 3V05A 2KC2A 3IAS1 1NYRA 1X1MA 5IOIA 1TS3A 3R2IA 4XDCA 3A33B 1PYWD 2KMMA 2JU6X 3ZLZA 3KYCD 1SGHA 2O2VA 2RDHA 2Z59B 5JHAA 1OQYA 4YSYB 2M19A 2WDVB 4AQ7A 2EKEC 2RDGA 1XLOA 3QHTA 5E6PA 2N7DA 2REXA 2AEHA 1WY8A 2YLMA 5MPOA 1UGMA 4K3BA 1I42A 3V6EB 5FKAC 4KGTA 1ET6A 5JHBA 2MWSB 3RN9C 1L0YB 3VR8B 3AU4A 3DBLI 3TBLD 4TQ1A 4MGKE 3ALBA 3MC9A 2PW9A 2W54A 1V9JA 2K5PA 2QMTA 3P4QB 5IA7A 2IO3B 2KFKB 2VH2A 2GRIA 4K1RB 4A6QA 4BBNF 2BF8B 3K9OB 1MJDA 4LDTD 4F1SA 2QDFA 4HDOA 3A1QB 3VUXA 1JW9D 4HROA 5D94A 4DK5A 1T0RC 1GC7A 1B1ZA 1N5XA 2OOBB 5DPTA 1HTQA 4BKGA 4FHJA 1WGRA 4CO7A 2M17A 4M02A 3NY5A 1F2RI 2ZW0A 2IDYA 3RCZA 2KLCA 5EE1A 2XN9C 4US9A 2KQ4X 5BYSA 1IYFA 4WAAA 2LHEA 4A55A 2RGFA 2KDMA 2N7JA 1KF6B 3ZNID 1C79A 3Q8BA 2Y5BB 3I5JC 2L0TA 4LCDE 3W1YA 4BFRA 4WWPA 4MJSB 4B95A 4LLGM 1F0ZA 1XXGA 3M3JA 4A90A 5H92C 2WYQA 3RYTA 3BVGA 1V1PA 3WCQA 4ZYNA 5EE9A 1N6ZA 2FBWB 5IN7A 4NJCA 1E7UA 2ACZB 2J4XA 3A9KA 1PGBA 1R4NI 2VZKB 2MJ3A 2FIDA 4W9HA 3ZO5B 2MH7A 3EFUA 1TT5B 2IPKD 1XCQL 3OAWA 4NAWB 4G11A 2KDIA 2ICIA 2LD9A 1WXVA 3HRDD 5H8YE 5LXHA 5AEKB 3SFDB 4E74A 2H88B 2G4DB 3P4RB 1GG3A 3V6CB 4F7ZA 2KDBA 1KLVA 3L17A 5LNK1 3L0WB 3A9JA 2WX0A 3LXFA 2KXJA 1XF5L 1F1HA 4GDKA 3NVZA 3CIRB 3TSSA 2ZVNA 4M00A 1D3ZA 4ICVA 3TJPA 3AM9A 4FJZA 1F9JA 2FCNA 3VRAB 1EUVB 2LXCA 2ZCCA 4LNOA 3Q3FA 1TBEA 2MQJA 1QILA 3QARA 1J7AA 2UYZB 3HM6X 2ASQA 1F77A 1HEZE 3N20C 3RFZB 1TYGB 2EKIA 4ICUA 3RNGC 4ANWA 5D7GA 3QAQA 3WANA 4FHKA 1UH6A 1GB4A 4P1CC 2K0PA 4RM8A 3DVGX 1YN4A 2KWDA 3KVFB 3VH3B 5IP4D 1FNWA 4LJPB 3VRBB 1QF6A 3M63B 1J19A 4P1BC 3QQ8B 2L1AA 3X23A 3FILA 1I35A 4A3PA 2L76A 4A20A 3Q3NC 3I63C 3TL5A 1WF9A 3PPAA 1IPGA 1XCTL 1ZW7A 2C60A 2HD5B 4I6NB 1WI0A 2D5GA 4BKSA 3Q6BA 2WU2B 2LGDA 3QCAA 1WM2A 2IO0B 3L16A 3ETRA 4AS1A 2JUOA 2V3NA 4DQOC 4BAXA 2DYOA 4OHJA 2JWUA 3DBHI 3P63A 2FCMA 2PE6B 3AE6B 3W5VB 4D2KA 3KUZA 1D5MC 1T0YA 3EGRA 3TCAA 2ZJDA 4LNKA 4OZCA 2MSED 1P3QU 3SDLC 2B76B 3NHEB 2N0SB 4ZYSA 3R66C 2DX5B 4M0WB 4BBNC 1T3QA 1JQ4A 5KHOA 2KFJA 4MH0E 3RZFA 2SEBD 3ML9A 4ACFA 2KX0A 1BT0A 1U4AA 3I57A 2LVOA 4HK2A 4NJ7A 3VTVA 3IFWB 1V1OA 1UBIA 2CJNA 2N9XA 3B0AA 3AE8B 1XLQA 3GB1A 1VZ7A 2HJ1A 3HM3A 1XD3B 2O6VD 2RSUA 1I4QA 1V49A 4XZ4A 2JX5A 3RI7C 3NZ3A 1YQ3B 3GZNI 5FK9C 4IWQA 2IGHA 2K39A 3ZUNA 2XK5A 1ZDXA 1TZOA 3B08A 2JSVX 1MPEA 3WA0A 2BTEA 2LGYA 4RH6A 2W82A 2MBHA 4YTNB 1I4RA 1WJUA 3RNBC 4KKJA 2CHWA 2NS5A 2BYVE 3A9KB 1WGYA 5BMIA 5CHVC 1MG8A 4EEWA 2JWZA 1VRAB 2MCNB 2PTLA 1QQRA 1PGXA 2RDBC 1E0ZA 3SR6A 4ZRKA 4B0MA 2DAJA 2NVUI 4GLSC 2IGDA 2D2QA 3W2DA 1YMHE 3VHTC 4WAFA 2JY6A 1D5XC 3A9JB 2PJHA 2LJIA 3IBEA 1ISNA 1EO6A 5L83A 2Z8LA 1JWMD 4REZA 2GBNA 4MH8A 2BB6A 2FCSA 2LFIA 1STEA 2WXHA 4RF1A 1L4ZB 1WJNA 4PYZA 2ZNVB 3P4SB 3AV8A 4A9AA 1GJZA 5DPSA 5G55A 2KX3A 3WAMA 3D32A 3PVLA 4MJSA 2WDRB 4LTUA 4GDLB 4F8CB 3M95A 1WZ0A 1QOAA 4JE3B 1YN5A 1HQRD 3PLVA 2DZMA 5D6JB 1VZ8A 1AYFA 4G3XB 3ZRFA 4JX1C 4GOCA 1S3SG 1UNSA 2XK5B 4WQMA 1WX9A 2BWES 3N30A 4KV2A 4MM3B 4I6LB 4NY0A 1V1PB 4HEA1 3LDZE 2LEKA 2JT4B 4WJQA 3N1ZC 2PVOD 4G0NB 1VCBA 4HKZE 3ZXVA 1CJEA 3DBRI 1FD6A 1WYGA 1XLPA 3DQVA 2AQ2B 2ONQA 1Q1OA 1IBXB 2GLSA 4OW0A 4I6PA 1CMXB 4RF0A 3AE3B 2KFKA 2FUG1 2CS4A 3RUIB 2KO3A 2NBUA 1ZOYB 3B9JA 3GOEA 2KOXA 1IGDA 1JWBD 4RGMA 3RNEC 4OZBA 1FRRA 4DBGA 2KANA 1FM0D 3AEFB 1TS4A 2PLPA 4WWMA 1L6VA 2K6DB 1L5PA 3BZDB 5HG2A 2SAKA 2EMSA 3BIID 3C0RB 1WWTA 4KDLB 1TTNA 2WQYB 1JCKB 4KGSA 2KD0A 2WWZA 3EHVA 1V2YA 2RD0A 4W9KA 4RCOA
chains in the Genus database with same CATH topology
1YJJA 2BS3B 3AEDB 1JWAD 1GOZA 2HDEA 1KRHA 4UDUC 1KH0A 4J3OD 1F2RI 2ZW0A 2IDYA 2L83A 3GS2A 1YNTE 3MHZA 2ZW1A 1ESFA 1I7HA 5EE1A 1SBBB 2PIAA 4YTMB 3E56A 1BUIC 1SIJA 2XN9C 1SJED 1TJEA 4US9A 4NAMA 3NRZA 3TEZA 2KQ4X 5C2TB 5BYSA 2LHEA 1Y56A 1MHXA 4JPSA 4DXGA 4A55A 3ZJTA 2KDMA 2N7JA 4ARCA 1HA5A 1KF6B 3URYA 1L6UA 1C79A 3Q8BA 4KGRA 4WURA 1RWSA 3EA6A 4R3DA 1IBXA 3IXSA 1D4BA 1L4DB 2GI9A 2Q5WD 3PZ8A 4ZRPA 1E10A 1UGJA 2NTSA 4LLGM 3HUIA 1F0ZA 3N9YC 1XXGA 3Q8AA 5HHDG 1BMLC 2WXLA 4A90A 5H92C 3BVGA 1V1PA 3WCQA 2AQ1B 3ZJUA 1I4XA 1FIQA 4TQ0A 1JMLA 3TEYA 5EE9A 3IAM1 3NVVA 2WXRA 3Q8EA 4US8A 1WRIA 3T3NA 1F2RC 1FRDA 2FBWB 4TSSA 4NJCA 1K52A 1SE4A 2ACZB 2J4XA 3T3OA 1XLNA 1PGBA 3EUB2 1M4VA 2VZKB 3O13A 2MJ3A 2BB5A 2J52A 2MH7A 3VR9B 2BBCA 2IPKD 4PT5A 1JWUD 1XCQL 4NAWB 1NEKB 4KKIA 2NTTA 1C76A 2WLBA 1ENFA 1TKYA 3AEGB 4MACA 3SFEB 3LB8C 2ICIA 2J42A 3FC4A 1KFYB 2RMMA 2LUMA 2JZPA 2J53A 1XO3A 4WIPA 2MEKA 1SJHD 4XWTA 2WS3B 3HRDD 5EE3A 5BYQA 4JWUC 5H8YE 1QLBB 5AUKA 3SFDB 1YJIA 2H88B 3TEWA 2WXGA 3P4RB 3KWVA 2AQ3B 1HZ6A 3AEAB 2OHFA 3W9CB 5LNK1 1JRPA 2LGIA 2CJOA 1MI0A 3AE1B 2E3TA 3LXFA 1XF5L 1DOYA 2KAJA 2WXOA 3HVDA 3W5UB 2PKOA 1EM7A 3P42A 1FFVA 3NVZA 1GB1A 3U2SC 3CIRB 2K3UA 3TSSA 1AWDA 1RM6C 2BYTA 3AM9A 2X38A 1N60A 1NENB 3AECB 1MHHE 3VRAB 2HTME 3R8BA 3CWIA 4NZLB 2K9XA 1GPXA 2INNE 1QILA 1LO5D 2L32A 1K53A 1PFDA 3HVZA 1J7AA 1FNVA 1L0XB 1BXTA 4L1BA 2DLBA 5BMHA 1F77A 4RGTA 3W1SA 5AUIA 1HEZE 1SEBD 1TY2A 2QSDA 1SB3C 3RFZB 1TYGB 3BK1A 3KQ4A 2EKIA 4YTPB 4KX6B 1ZPSA 1SE2A 4ZRQA 5D7GA 1RFKA 1GB4A 2K0PA 4C80A 3SEBA 4IKGA 1YN4A 3MP9A 3RPFC 1C78A 1KLGD 2KWDA 1FNWA 3VRBB 1QF6A 1ZUD2 3BYYB 3PZ7A 2I2YA 2JYEA 1IUEA 1PDXA 2L1AA 3FILA 1GAQB 2W55A 1N61A 2R61A 2Y5PA 1XCTL 1FFUA 3C8YA 3IT4B 5BYRA 3P1MA 1FCCC 3AE7B 4HKQA 2D5GA 2Y5CA 1EU4A 2G1EA 5C3JB 1J7CA 2AX5A 1WXQA 1C77A 2WU2B 3OWEB 1N63A 2MJEA 2BS4B 3ETRA 2WXJA 3MJ5A 2IJ0A 1DGJA 3ZJVA 3L4PA 2V3NA 4AS1A 1J7BA 4DQOC 4OZAA 2WXMA 2DYOA 1I4HA 4OHJA 2JWUA 5HI1A 3TUOA 3P63A 3AMZA 4Q2JA 5JXVA 4A8XC 1C9FA 3U7ZA 3NS1A 4GDKB 3AE6B 1EWCA 3W5VB 4D2KA 1ZP0B 1ET9A 3NVWA 1FEHA 3Q69A 4HJGE 1D5MC 2WP9B 4IDIA 1R7SA 4YT0B 2BS2B 3EGRA 3AE2B 4XE0A 4OZCA 1FNUA 1I4GA 1EU3A 1I4PA 1PUTA 1OFFA 4WH4A 2KN4A 2B76B 1JALA 1FXIA 2N0SB 4ZYSA 2XNAC 1XEEA 1VLBA 2WXNA 2W3SA 4B0EA 1T3QA 1JQ4A 2V4IB 1NI3A 1ACCA 4EE2A 2G9HD 2IGGA 5T8IA 3ZYYX 2SEBD 1WGKA 3I57A 1ZXIA 4ARIA 3KWLA 1SE3A 1V1OA 2QJLA 4YSZB 1VJKA 5D3IB 1K51A 1NVID 2INPE 3BVMA 1T5XD 1CK1A 2CJNA 3BVZA 1IGCA 2NMQA 3AE8B 4TMAB 2WXPA 1DOXA 3AN1A 1XLQA 4OVZA 3GB1A 1SSNA 1VZ7A 1C4AA 1SXTA 1A70A 3KLSX 4RFBA 2L52A 2WDQB 1V8CA 1CQVA 1I4QA 2WXKA 3H8HA 2JX5A 4M0WA 1V97A 3VQIA 3NZ3A 3Q8CA 2DBYA 1YQ3B 2WXFA 5FK9C 5G5HA 1TKGA 2IGHA 3V3XA 3AE5B 1ZDXA 1TZOA 1E6EB 2JSVX 1N5WA 5TSSA 1MPEA 1SF0A 4P16A 3AE9B 4HRSA 2BTEA 1HZ5A 4RH6A 3LYYA 2W82A 4YTNB 2WU5B 1L0VB 1I4RA 3AB5A 1JROA 3DWGC 3B2GA 4KKJA 1TS5A 5EE0A 2JQRB 2DYMA 5D3DA 3R2TA 5BMIA 3B2FA 1TY0A 4MT5A 1UWMA 4ZHPA 1AN8A 1KTKA 1VRAB 2WNMA 1NYQA 4N6EB 5BMGA 1C4PA 2PTLA 4N58A 1B9RA 2BT6A 2BW2A 2Y3AA 2V0GA 1QQRA 1PGXA 1VZ6A 3FILB 3TEXA 1E0ZA 3SR6A 1OQRA 1OQQA 4B0MA 2I38A 4GLSC 2IGDA 1TKEA 3W2DA 2M0AA 1YMHE 2K22A 4WAFA 1D5XC 2YEPB 2TSSA 4FXCA 2JXTA 2PMVA 3GP7A 4JWSC 2LJIA 1PGAA 1T6BX 1D6EC 4IOIE 1DOIA 1YQ4B 2Z8LA 2CU3A 1JWMD 4REZA 1QKZA 4MH8A 2BB6A 2N9LA 4RNAA 5GXGB 3DWMA 1TS2A 2LFIA 2LHDA 1STEA 1E7PB 2WXHA 3BWUD 3PO0A 4RF1A 1L4ZB 1QT9A 1UUPA 5E6JA 2H89B 1UWXA 3P4SB 4ZOHC 3AV8A 2ON8A 2MJDA 1HXYD 4A9AA 1DYQA 3FAHA 2DWQA 1MVKA 4O1NA 3BK2A 4H2AA 3I9V1 2EELA 3ABVB 2QILA 2WXIA 2QIEB 3ZGZA 3U52E 3E9SA 1VDVA 4C7YA 5FR3A 3ZQ4A 3U4EG 4C7ZA 4N59A 4CQNA 2WDRB 4LTUA 1E9MA 4LK0M 1P7FA 4GDLB 3AH7A 5I4DA 1QOAA 2W3RA 1QOGA 3MFGA 3AEBB 4JE3B 5G5GA 1Q10A 4DXFA 1AW7A 1KLUD 4USAA 1YN5A 2YEPF 1HQRD 1CZPA 4ITKA 4YWGG 1QOBA 1VZ8A 1AYFA 3V05A 4JX1C 2WXQA 1VR9A 3IAS1 1D5ZC 1NYRA 4RGOS 1UNSA 1TS3A 3R2IA 4XDCA 3J9CA 3BYTB 4WQMA 1PYWD 4L2YA 3NVYA 2KMMA 2JU6X 4MM3B 1V1PB 4HEA1 3UI3A 2LEKA 3IT6B 2LMCA 2RDHA 3Q8FA 2PVOD 1WSPA 2VZKD 4HKZE 4YSYB 2M19A 2WDVB 4AQ7A 1CJEA 4YXDB 2RDGA 1XLOA 1N62A 1FD6A 1RYJA 1WYGA 2KACA 1XLPA 2AQ2B 5MPOA 2ONQA 1FCLA 3MC0B 1IBXB 1ZXHA 4OW0A 1FO4A 1P7EA 5FKAC 4RF0A 3AEEB 3AE3B 4RGNA 4KGTA 1ET6A 1ZE3D 1QOFA 2FUG1 4ZHOA 3B9JA 1ZOYB 2RPVA 1L0YB 3VR8B 2PVGC 2FE8A 1ROEA 4P6VF 1ZDVA 4TQ1A 1IGDA 2N9KA 3AE4B 1JWBD 2PW9A 2W54A 4RGMA 2K5PA 2QMTA 1FRRA 3P4QB 4OZBA 2OEDA 1FM0D 1JWSD 1EWYC 1TS4A 3AEFB 2GRIA 2E6XA 4A6QA 2PLPA 5HFYA 4WWMA 1FMAD 4L23A 2QEJC 2GB1A 1L6VA 3NUHB 1K50A 1L5PA 3BZDB 5HG2A 2SAKA 3BIID 1JW9D 1WWTA 1YN3A 4HROA 1FXAA 2WQYB 4XDDA 1C4CA 1JCKB 4YSXB 4KGSA 2M56B 2V3PA 3P4PB 1B1ZA 1N5XA 2JYTA 4C56C 4XWWA 4RCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHH E;  2EEL A;  1IGC A;  2NMQ A;  1KH0 A;  1F2R I;  2ZW0 A;  3GB1 A;  1YNT E;  1K53 A;  2ZW1 A;  1P7F A;  5BMH A;  1HEZ E;  2KQ4 X;  2QSD A;  1Q10 A;  2LHE A;  1MHX A;  2KDM A;  2N7J A;  2IGH A;  3V3X A;  4KGR A;  1GB4 A;  1IBX A;  2JSV X;  2K0P A;  4IKG A;  3MP9 A;  2KWD A;  1D4B A;  2GI9 A;  1MPE A;  2I2Y A;  1HZ5 A;  3FIL A;  5HHD G;  2JU6 X;  3UI3 A;  1XCT L;  1FCC C;  1JML A;  4HKZ E;  5BMI A;  1F2R C;  1FD6 A;  2KAC A;  1K52 A;  2ONQ A;  1FCL A;  1PGB A;  5BMG A;  1ZXH A;  1IBX B;  2PTL A;  1P7E A;  2J52 A;  4KGT A;  1XCQ L;  1PGX A;  4OZA A;  3FIL B;  4MAC A;  2JWU A;  5HI1 A;  2RPV A;  5JXV A;  2RMM A;  2I38 A;  1C9F A;  2LUM A;  2JZP A;  4GLS C;  2J53 A;  2IGD A;  4D2K A;  1YMH E;  1IGD A;  2N9K A;  4HJG E;  2PW9 A;  2QMT A;  4OZB A;  2JXT A;  2OED A;  1HZ6 A;  4OZC A;  1PGA A;  2PLP A;  5HFY A;  4IOI E;  4WH4 A;  2LGI A;  2KN4 A;  1MI0 A;  2GB1 A;  1K50 A;  1QKZ A;  5HG2 A;  2N9L A;  1XF5 L;  2LHD A;  2IGG A;  1EM7 A;  4KGS A;  1GB1 A;  1UWX A;  2ON8 A;  1MVK A;  1K51 A; 
#chains in the Genus database with same CATH topology
 2IBI B;  1JWA D;  3LJ3 A;  2HDE A;  4W9E A;  1KH0 A;  3ZDM C;  2L83 A;  3BIN A;  1WH3 A;  1L7Y A;  4B9K A;  1SBB B;  3QWZ B;  2MBE A;  4YTM B;  3E56 A;  4AJW A;  1SIJ A;  3DCG A;  3VDZ A;  3PRZ A;  2GMI C;  1AAR A;  4HPM B;  1LFD A;  3P2B A;  4KDI C;  4W9C A;  4WUR A;  2VH1 A;  4R3D A;  1ZKH A;  1FXT B;  2O6V A;  1L4D B;  2GI9 A;  4ZRP A;  1E10 A;  3CST A;  5J2R A;  3N9Y C;  2FAZ A;  5HHD G;  1BML C;  2HE7 A;  4CHK A;  1KJT A;  2DAF A;  2WXL A;  4JQW C;  1I4X A;  4TQ0 A;  2MLB A;  1WGG A;  1JML A;  2WHI A;  3SHQ A;  3TEY A;  3NVV A;  3T3N A;  1FRD A;  4TSS A;  2QCZ A;  4EZK A;  1XLN A;  2BWF A;  3EUB 2;  2CR5 A;  4KZ0 A;  3EC8 A;  2BB5 A;  4KIK B;  3VR9 B;  5IAA C;  2BBC A;  4PT5 A;  3DVG Y;  1NEK B;  3ZTD A;  2NTT A;  2WLB A;  2J42 A;  4RMA A;  2LUM A;  2JZP A;  5L95 C;  4XWT A;  2KVR A;  4IWP A;  4JWU C;  3TEW A;  2WXG A;  2AQ3 B;  4BKS D;  1JRP A;  1TZ1 A;  1MI0 A;  2A5U A;  1DOY A;  4HCP B;  2PKO A;  1P1A A;  2KZR A;  2BYT A;  2J0J A;  4HVB A;  4DHZ B;  2KYW A;  4II2 B;  2HTM E;  3CWI A;  4NZL B;  2K9X A;  1GPX A;  1LO5 D;  4DDI D;  1C3T A;  4XX5 A;  3NS8 A;  1L0X B;  4GU2 A;  2KKC A;  3WAL A;  4L1B A;  3BY4 B;  1OTR B;  5AUI A;  4HPP A;  5AZG A;  5G2N A;  3KQ4 A;  4YTP B;  3IHP C;  2RPQ A;  4PS7 A;  1SE2 A;  3ZTC A;  1RFK A;  3T8M A;  1YOV B;  4C80 A;  1C78 A;  1KLG D;  2I2Y A;  1WXA A;  3DBR B;  3GZN B;  4MDK E;  4S0R A;  4EOY A;  1P0R A;  2ZCB A;  1FFU A;  3P1M A;  1NI2 A;  3AE7 B;  3NZS A;  1V5T A;  1EU4 A;  2Y5C A;  2R2Q A;  4RM9 A;  5J18 A;  1C77 A;  4DHJ B;  3OWE B;  4W9L A;  2WXJ A;  3MJ5 A;  2D11 A;  2NR2 A;  4P7I A;  1J7B A;  2IY0 B;  5CX3 A;  4CYE A;  5J17 A;  4Q2J A;  4A8X C;  1C9F A;  3ZDT A;  4EKU A;  1EWC A;  4KVG B;  4FN2 A;  2FCQ A;  4ANU A;  1ET9 A;  3U7D A;  3CMM B;  1EU3 A;  4URK A;  1I4P A;  2D3B A;  4EFO A;  4LDT B;  2DEN B;  1FXI A;  3ZW3 A;  4BZA A;  3PHX B;  3MHS D;  3GE3 C;  1V6E A;  4KSK C;  3TIX A;  3WIM A;  3VVW B;  4ARI A;  1SE3 A;  2K8B A;  3RNF C;  5GMV A;  5D3I B;  1K51 A;  1NVI D;  4QAY A;  4IM3 A;  2KQS A;  3GE8 C;  2HJ8 A;  4ZRI A;  2WXP A;  4XC2 A;  3AN1 A;  3PRM B;  4DXA B;  4LJO B;  1C4A A;  2L52 A;  1V8C A;  2K6Q A;  4MGI E;  3H8H A;  4GN1 A;  1OEY J;  3V3X A;  4IG7 B;  4KZC A;  3ECI A;  1N5W A;  2YVC A;  1GUA B;  3VUW A;  4P16 A;  3AE9 B;  4HRS A;  2BYE A;  2BVC A;  1V5O A;  2KWC A;  2WU5 B;  2C7N B;  2LWP A;  2N4F A;  2JQR B;  5D3D A;  3R2T A;  2LXA A;  3B2F A;  4HWI B;  4PYU A;  1C1Y B;  2M0X A;  3PRE A;  4HCN B;  2WNM A;  1MG4 A;  5BMG A;  4WJN A;  3HHM A;  2LVQ A;  4N58 A;  1VZ6 A;  3CF6 E;  3DDC B;  2KC1 A;  2KWV B;  3KUD B;  1TGZ B;  1XT9 B;  3L54 A;  2MBO A;  2M0A A;  3ZNG C;  2FNJ B;  1R4M I;  3V61 A;  2YEP B;  2TSS A;  2KJR A;  2WX1 A;  1Y8R C;  4IOI E;  1YQ4 B;  3VFK A;  1QKZ A;  2N9L A;  3OG5 A;  3DWM A;  1TS2 A;  1E7P B;  2D3A A;  1LQB A;  4W9F A;  4FUL A;  2N1V A;  1DYQ A;  2JVC A;  2ZPY A;  3FAH A;  3CSF A;  1MVK A;  2DWQ A;  5DPW A;  1LXD A;  3I9V 1;  2UWQ A;  3Q14 C;  2WXI A;  2QIE B;  3ZGZ A;  3NJT A;  3ZQ4 A;  4N59 A;  2W3R A;  1Q10 A;  2ZPN A;  4USA A;  1Q0W B;  1CZP A;  4ITK A;  4EZL A;  2WXQ A;  1VR9 A;  1NDD A;  4RGO S;  4NQL B;  4K81 A;  5DCN A;  1Z2M A;  1SE9 A;  3UI3 A;  3L08 A;  3IT6 B;  4EUT A;  1E8Y A;  3DVN U;  4GXB A;  2I1K A;  2A4Z A;  3VH4 B;  4YXD B;  1Z5S B;  2KVZ A;  1N62 A;  1RYJ A;  2KAC A;  4LNN A;  3R7R A;  2FUH B;  1FCL A;  3H7P B;  3KUC B;  3PZD A;  3AEE B;  4RGN A;  1QOF A;  2V1Y A;  1WR1 A;  2RPV A;  1KM7 A;  4MM3 A;  2PVG C;  4OVV A;  4P6V F;  1GNU A;  3UIN B;  1ZDV A;  2N9K A;  3AE4 B;  2LZ6 A;  2OED A;  1E5W A;  3SD5 A;  2E6X A;  4MGZ E;  2ZEQ A;  1H8C A;  4GIV A;  3ZIM A;  2JRH A;  4WWN A;  1FMA D;  4L23 A;  4BOZ B;  2QEJ C;  3DHG C;  1K50 A;  1WXS A;  1EF5 A;  1YN3 A;  1FXA A;  4XDD A;  1C4C A;  4YSX B;  1M94 A;  2M56 B;  2MP2 B;  2NPT B;  1ZGU B;  4C56 C;  3PRP B;  4XWW A;  3UIP B;  3AED B;  1KRH A;  2N7E A;  4J3O D;  3N3K B;  1UBQ A;  2CKH B;  2ZW1 A;  1ESF A;  4TKN A;  4BVU C;  1I7H A;  4NPN A;  3A4S C;  2PIA A;  2O6V B;  4K7U A;  1BUI C;  3AI5 A;  1SJE D;  4NAM A;  1SIF A;  3TEZ A;  1LGR A;  5CTR C;  1MHX A;  4JPS A;  4HJK A;  3T9L A;  3ZJT A;  4FA6 A;  2BKF A;  4ARC A;  1HA5 A;  2M4N A;  3URY A;  1L6U A;  4KGR A;  4AUQ C;  1RWS A;  3EA6 A;  1D4B A;  2Q5W D;  1UGJ A;  2NTS A;  2L0F A;  2NBW B;  2RR9 A;  3Q8A A;  4IW0 A;  4K3C A;  5IKC M;  3ZJU A;  3QC8 B;  1FIQ A;  3PTF C;  3H9D A;  3IAM 1;  2MBB B;  3Q8E A;  3AU5 A;  4US8 A;  1WRI A;  3T3O A;  1HE8 A;  2LVP A;  3ZNZ B;  4XYC A;  4S17 A;  3O13 A;  4AJY B;  3RD2 A;  2J52 A;  1WGD A;  1JWU D;  1R4M B;  4KKI A;  1C76 A;  3AEG B;  1TKY A;  2D07 B;  4HDQ A;  2LUE A;  4MAC A;  3LB8 C;  3H7P A;  1KFY B;  2RMM A;  1R4N B;  2J53 A;  3ENE A;  2MEK A;  1SJH D;  4WIP A;  2WS3 B;  5EE3 A;  4ZDV A;  1QLB B;  3MTN B;  3UQB A;  2WGS A;  3U8Z A;  3AEA B;  3JSV A;  3MJW A;  4X57 B;  4WJO A;  2OHF A;  2L3Z A;  2GBM A;  2DZK A;  2LGI A;  2CJO A;  3AE1 B;  1K8R B;  2WXO A;  5CHW A;  1EM7 A;  3P42 A;  3R7Q A;  3U2S C;  2K3U A;  3QJZ A;  4ASW C;  5C1Z A;  3AEC B;  1MHH E;  2M1M A;  4TV3 A;  2KK8 A;  2Z0E B;  2INN E;  3OJ4 B;  2L32 A;  1K53 A;  3VTW A;  1PFD A;  1FNV A;  4W9J A;  2LAS A;  2IO2 B;  2XBB C;  1TY2 A;  1SB3 C;  2LRW A;  1ZPS A;  1WFY A;  4ZRQ A;  2BKR B;  3SEB A;  3MP9 A;  3WAP A;  4N9F 4;  1RRB A;  3BYY B;  1IUE A;  4JL9 A;  4DHJ D;  3M62 B;  1GAQ B;  3VTU A;  5DPR A;  2W55 A;  2Y5P A;  3C8Y A;  5C3J B;  3VXW A;  1UF0 A;  1J7C A;  2AX5 A;  3DVN V;  2DZJ A;  3C19 A;  1N63 A;  4WQO B;  2KNB A;  3SU8 X;  3ZJV A;  4FJY A;  1YD8 U;  2V4L A;  1I4H A;  1UEL A;  3U7Z A;  4GDK B;  2MHJ A;  3APD A;  4ANV A;  1XQQ A;  3UIO B;  1Q5W B;  3K9P B;  1R7S A;  4YT0 B;  2BS2 B;  2BQQ A;  4K7S A;  4XE0 A;  1FNU A;  1I4G A;  1PUT A;  3H7S A;  2Z0D B;  2KTR A;  2DHZ A;  2GBR A;  1PQS A;  1VLB A;  4OVU A;  4B0E A;  2NPT A;  3DBS A;  5E6N A;  1NI3 A;  4C00 A;  2G9H D;  2IGG A;  2KMA A;  1WGK A;  3FKY A;  3ZVV A;  2KWU B;  3PGE A;  2QJL A;  4YSZ B;  2G45 B;  3BVM A;  1CK1 A;  1WMH B;  1WGH A;  3Q3J A;  2AYO B;  4W9I A;  3V62 A;  1E7V A;  1SSN A;  3A1Q A;  1SXT A;  2WDQ B;  4W9G A;  3ZKJ C;  4FBJ B;  4M0W A;  1V97 A;  3VQI A;  5G5H A;  1TKG A;  2DNF A;  3IG3 A;  2W9N A;  2IY1 B;  4NNJ B;  1E6E B;  4DDG D;  3UF8 A;  3A4R A;  5LXI B;  1HZ5 A;  3W1S C;  3LYY A;  3R3M A;  3HK0 A;  2BYF A;  1E8W A;  1L0V B;  2JPH A;  4K7W A;  3AB5 A;  2L7R A;  1V81 A;  1VD2 A;  5EE0 A;  2DYM A;  1UZX B;  2IZV B;  1TY0 A;  4MT5 A;  2ZVO A;  5AZF A;  1WX7 A;  4ZHP A;  1AN8 A;  1KTK A;  1NYQ A;  3AXC A;  2GBK A;  2KQ7 A;  1C4P A;  4NQK E;  3UGB B;  1WRD B;  2BW2 A;  2Y3A A;  3KYD D;  1S1Q B;  1WR6 E;  2KDF B;  2K25 A;  5EDS A;  2I38 A;  1TKE A;  4II3 B;  4J6I A;  3QX1 A;  2K22 A;  4DHZ E;  1T0Q C;  3EFC A;  2JXT A;  4E3C A;  3GP7 A;  4JWS C;  1PGA A;  1T6B X;  4XGA B;  1D6E C;  1DOI A;  3PHW B;  4RNA A;  1V86 A;  4G50 A;  2LHD A;  3UQA A;  3PO0 A;  3ML8 A;  1QT9 A;  3DBH B;  4HLE A;  2ON8 A;  4WJP A;  2C5L C;  4H2A A;  4E71 A;  2QIL A;  2L00 B;  2C7H A;  3WAO A;  4C7Y A;  2I1J A;  5FR3 A;  2M8S A;  3U4E G;  4C7Z A;  4CQN A;  1P7F A;  3AH7 A;  1MFW A;  3DOW A;  5I4D A;  5G5G A;  3MFG A;  2MBQ A;  1YIW A;  2BGF A;  2YEP F;  4GGQ A;  3HIZ A;  4YWG G;  2R2O A;  1WJ6 A;  1D5Z C;  4JGH B;  1WE6 A;  1RFA A;  3J9C A;  2KJH B;  3BYT B;  4MSM B;  3U30 A;  4L2Y A;  5IO9 A;  3NVY A;  1RAX A;  4JIO U;  4C4V A;  2LMC A;  3Q8F A;  1P9D U;  1WSP A;  2VZK D;  1FPY A;  3DHI C;  4GDL A;  4BKT A;  2MA9 B;  3N1X C;  4HPL B;  2MW5 A;  5FR6 A;  4FLH A;  3MC0 B;  1ZXH A;  1FO4 A;  1P7E A;  1A5R A;  1J8C A;  1ZE3 D;  4ZHO A;  2EMT A;  3RT3 B;  4W9D A;  2ZNV C;  4LNI A;  5AZH A;  2FE8 A;  1ROE A;  5TR5 A;  1T0S C;  3NOB A;  4NJ6 A;  2L8J A;  1L2N A;  1JWS D;  1EWY C;  2G3Q B;  3L10 B;  5HFY A;  2X8X X;  2G4S A;  3S2A A;  1LM8 B;  3DHH C;  4PS8 A;  2GB1 A;  3NUH B;  2KJ6 A;  2GBJ A;  3H6N A;  4TUU A;  2V3P A;  3JVZ X;  3P4P B;  1KOT A;  4ANX A;  1EF1 A;  2JYT A;  4GMV A;  1YJJ A;  2BS3 B;  1GOZ A;  2D3G A;  2N9P C;  4UDU C;  2C9W B;  3GS2 A;  1YNT E;  3MHZ A;  3RNC C;  2CU1 A;  3QA8 A;  1NBF C;  2GOW A;  1TJE A;  3NRZ A;  2K1F A;  5C2T B;  3JSV B;  3I3T B;  1Y56 A;  2CHZ A;  4DXG A;  1OGW A;  4MEM A;  1WX8 A;  4MEL A;  1IBX A;  1WE7 A;  2C7M B;  3IXS A;  3PZ8 A;  3HUI A;  1GC6 A;  1YJ1 A;  2KMC A;  1WZ3 A;  3QK0 A;  2AQ1 B;  4YL8 A;  1P98 A;  2V9H A;  3VUY A;  2WXR A;  1QZE A;  5JH5 C;  1F2R C;  4M8N A;  3RMK C;  1K52 A;  1SE4 A;  4IWO A;  3DPD A;  2LGS A;  1M4V A;  1TIF A;  2KTR B;  1YQB A;  1ENF A;  3ZNH B;  3SFE B;  1E8Z A;  3ONS A;  4A3O A;  1J0G A;  3FC4 A;  1H4R A;  1XO3 A;  1IP9 A;  5BYQ A;  2QHO A;  5AUK A;  1YJI A;  4MGY E;  1WM3 A;  3KWV A;  2MRP A;  1HZ6 A;  4FAD A;  3N32 A;  3KH0 A;  3W9C B;  4M8M A;  3DBL B;  2OJW A;  2JZ3 B;  1E8X A;  2FIF A;  2E3T A;  2ZZP B;  2K8C A;  2KAJ A;  2D10 A;  3HVD A;  3W5U B;  1FFV A;  1GB1 A;  1AWD A;  5C23 A;  1RM6 C;  3MC8 A;  2L05 A;  2X38 A;  1N60 A;  1NEN B;  3H1U A;  4MSQ B;  3RZW C;  3R8B A;  4GB9 A;  1UD7 A;  3HVZ A;  3VAW A;  3N1Y C;  3O65 B;  3APC A;  1BXT A;  2AL6 A;  2DLB A;  5BMH A;  3ZRC A;  4RGT A;  3W1S A;  2UU7 A;  1SEB D;  2K8H A;  2QSD A;  3BK1 A;  4KX6 B;  1WYW B;  1WXM A;  2J7Q B;  2J0M A;  2MX2 A;  5LLI A;  2INC C;  3AUL A;  3PT2 B;  4IKG A;  3RPF C;  2XEW A;  1ZUD 2;  2JZZ A;  3PZ7 A;  2JYE A;  1PDX A;  1YX5 B;  1N61 A;  2R61 A;  3IT4 B;  5BYR A;  1FCC C;  5KHQ A;  4HKQ A;  2G1E A;  1WXQ A;  4AWJ A;  2MJE A;  2BS4 B;  2N1W A;  2IJ0 A;  1DGJ A;  3L4P A;  4OZA A;  2WXM A;  3ZXR A;  3Q3O C;  5HI1 A;  4HXD A;  3TUO A;  3AMZ A;  5JXV A;  3NS1 A;  2VRR B;  2AWT A;  1ZP0 B;  2KTF A;  3NVW A;  3APF A;  1FEH A;  2MP2 A;  2V3S A;  3Q69 A;  4HJG E;  2WP9 B;  4PK1 A;  4IDI A;  5JZE B;  3AE2 B;  2JXX A;  1OFF A;  4WH4 A;  3RUL A;  2HTH A;  2KN4 A;  1JAL A;  4NAW A;  2XNA C;  1XEE A;  4EZJ A;  1YX6 B;  2WXN A;  1HTO A;  2W3S A;  3OJ3 A;  2V4I B;  1ACC A;  4EE2 A;  2NCN A;  5T8I A;  4M01 A;  3ZYY X;  3Q3M C;  2NBV B;  4IUM B;  2JF5 A;  2IO1 B;  2PE9 A;  2PPH A;  1ZXI A;  2LI5 A;  3KWL A;  3JYU A;  2DZI A;  1VJK A;  2INP E;  1T5X D;  5D2M B;  3BVZ A;  1IGC A;  2NMQ A;  4TMA B;  3OLM D;  1RLF A;  2IYD B;  3Q2A C;  1DOX A;  4OVZ A;  1A70 A;  3KLS X;  4RFB A;  1CQV A;  2WXK A;  4PS3 A;  3X0W A;  1WIA A;  3Q8C A;  2DBY A;  2WXF A;  4FJV B;  1E90 A;  2IND C;  2KT7 A;  4ZRJ A;  3AE5 B;  3KW5 B;  5CHF A;  5TSS A;  4IC7 B;  1WMH A;  1SF0 A;  4IM0 A;  3L13 A;  3V60 A;  1JRO A;  3DWG C;  3B2G A;  3PV1 A;  1TS5 A;  2KDE B;  3EEC A;  1F52 A;  1UWM A;  2KHW B;  1G6J A;  2LGX A;  4N6E B;  5HKH A;  1B9R A;  2BT6 A;  2V0G A;  2D3C A;  3TEX A;  3FIL B;  3IVF A;  1OQR A;  1OQQ A;  2KN5 A;  4BOS C;  2LRU A;  3PS6 A;  2LJ5 A;  4LNF A;  4FXC A;  1WJ4 A;  2PMV A;  2JRI B;  2BPS A;  2J0K A;  1JRU A;  4KSL C;  4C4V B;  2KLG A;  2CU3 A;  2PEA A;  4B6W A;  2B3A A;  5GXG B;  1OEY A;  5E6O A;  3RNA C;  2WDT B;  3BWU D;  3QIJ A;  2N9E B;  1UUP A;  5E6J A;  2H89 B;  1UWX A;  4WWO A;  5BO4 B;  4ZOH C;  3PLU A;  2MJD A;  1HXY D;  2OJR A;  1V80 A;  4JLC A;  4IM2 A;  2DYB A;  2O2V B;  3BK2 A;  3JW0 X;  4O1N A;  2AL3 A;  2EEL A;  3ABV B;  4AOF A;  3U52 E;  4GSW A;  3E9S A;  1VDV A;  3TMP B;  4AP4 C;  1E9M A;  4LK0 M;  3NZU A;  3NG0 A;  4DWF A;  1QOG A;  3PSE B;  3AEB B;  3B1L X;  2QC8 A;  4DXF A;  1AW7 A;  1KLU D;  2CHX A;  4KIK A;  1QOB A;  3V05 A;  2KC2 A;  3IAS 1;  1NYR A;  1X1M A;  5IOI A;  1TS3 A;  3R2I A;  4XDC A;  3A33 B;  1PYW D;  2KMM A;  2JU6 X;  3ZLZ A;  3KYC D;  1SGH A;  2O2V A;  2RDH A;  2Z59 B;  5JHA A;  1OQY A;  4YSY B;  2M19 A;  2WDV B;  4AQ7 A;  2EKE C;  2RDG A;  1XLO A;  3QHT A;  5E6P A;  2N7D A;  2REX A;  2AEH A;  1WY8 A;  2YLM A;  5MPO A;  1UGM A;  4K3B A;  1I42 A;  3V6E B;  5FKA C;  4KGT A;  1ET6 A;  5JHB A;  2MWS B;  3RN9 C;  1L0Y B;  3VR8 B;  3AU4 A;  3DBL I;  3TBL D;  4TQ1 A;  4MGK E;  3ALB A;  3MC9 A;  2PW9 A;  2W54 A;  1V9J A;  2K5P A;  2QMT A;  3P4Q B;  5IA7 A;  2IO3 B;  2KFK B;  2VH2 A;  2GRI A;  4K1R B;  4A6Q A;  4BBN F;  2BF8 B;  3K9O B;  1MJD A;  4LDT D;  4F1S A;  2QDF A;  4HDO A;  3A1Q B;  3VUX A;  1JW9 D;  4HRO A;  5D94 A;  4DK5 A;  1T0R C;  1GC7 A;  1B1Z A;  1N5X A;  2OOB B;  5DPT A;  1HTQ A;  4BKG A;  4FHJ A;  1WGR A;  4CO7 A;  2M17 A;  4M02 A;  3NY5 A;  1F2R I;  2ZW0 A;  2IDY A;  3RCZ A;  2KLC A;  5EE1 A;  2XN9 C;  4US9 A;  2KQ4 X;  5BYS A;  1IYF A;  4WAA A;  2LHE A;  4A55 A;  2RGF A;  2KDM A;  2N7J A;  1KF6 B;  3ZNI D;  1C79 A;  3Q8B A;  2Y5B B;  3I5J C;  2L0T A;  4LCD E;  3W1Y A;  4BFR A;  4WWP A;  4MJS B;  4B95 A;  4LLG M;  1F0Z A;  1XXG A;  3M3J A;  4A90 A;  5H92 C;  2WYQ A;  3RYT A;  3BVG A;  1V1P A;  3WCQ A;  4ZYN A;  5EE9 A;  1N6Z A;  2FBW B;  5IN7 A;  4NJC A;  1E7U A;  2ACZ B;  2J4X A;  3A9K A;  1PGB A;  1R4N I;  2VZK B;  2MJ3 A;  2FID A;  4W9H A;  3ZO5 B;  2MH7 A;  3EFU A;  1TT5 B;  2IPK D;  1XCQ L;  3OAW A;  4NAW B;  4G11 A;  2KDI A;  2ICI A;  2LD9 A;  1WXV A;  3HRD D;  5H8Y E;  5LXH A;  5AEK B;  3SFD B;  4E74 A;  2H88 B;  2G4D B;  3P4R B;  1GG3 A;  3V6C B;  4F7Z A;  2KDB A;  1KLV A;  3L17 A;  5LNK 1;  3L0W B;  3A9J A;  2WX0 A;  3LXF A;  2KXJ A;  1XF5 L;  1F1H A;  4GDK A;  3NVZ A;  3CIR B;  3TSS A;  2ZVN A;  4M00 A;  1D3Z A;  4ICV A;  3TJP A;  3AM9 A;  4FJZ A;  1F9J A;  2FCN A;  3VRA B;  1EUV B;  2LXC A;  2ZCC A;  4LNO A;  3Q3F A;  1TBE A;  2MQJ A;  1QIL A;  3QAR A;  1J7A A;  2UYZ B;  3HM6 X;  2ASQ A;  1F77 A;  1HEZ E;  3N20 C;  3RFZ B;  1TYG B;  2EKI A;  4ICU A;  3RNG C;  4ANW A;  5D7G A;  3QAQ A;  3WAN A;  4FHK A;  1UH6 A;  1GB4 A;  4P1C C;  2K0P A;  4RM8 A;  3DVG X;  1YN4 A;  2KWD A;  3KVF B;  3VH3 B;  5IP4 D;  1FNW A;  4LJP B;  3VRB B;  1QF6 A;  3M63 B;  1J19 A;  4P1B C;  3QQ8 B;  2L1A A;  3X23 A;  3FIL A;  1I35 A;  4A3P A;  2L76 A;  4A20 A;  3Q3N C;  3I63 C;  3TL5 A;  1WF9 A;  3PPA A;  1IPG A;  1XCT L;  1ZW7 A;  2C60 A;  2HD5 B;  4I6N B;  1WI0 A;  2D5G A;  4BKS A;  3Q6B A;  2WU2 B;  2LGD A;  3QCA A;  1WM2 A;  2IO0 B;  3L16 A;  3ETR A;  4AS1 A;  2JUO A;  2V3N A;  4DQO C;  4BAX A;  2DYO A;  4OHJ A;  2JWU A;  3DBH I;  3P63 A;  2FCM A;  2PE6 B;  3AE6 B;  3W5V B;  4D2K A;  3KUZ A;  1D5M C;  1T0Y A;  3EGR A;  3TCA A;  2ZJD A;  4LNK A;  4OZC A;  2MSE D;  1P3Q U;  3SDL C;  2B76 B;  3NHE B;  2N0S B;  4ZYS A;  3R66 C;  2DX5 B;  4M0W B;  4BBN C;  1T3Q A;  1JQ4 A;  5KHO A;  2KFJ A;  4MH0 E;  3RZF A;  2SEB D;  3ML9 A;  4ACF A;  2KX0 A;  1BT0 A;  1U4A A;  3I57 A;  2LVO A;  4HK2 A;  4NJ7 A;  3VTV A;  3IFW B;  1V1O A;  1UBI A;  2CJN A;  2N9X A;  3B0A A;  3AE8 B;  1XLQ A;  3GB1 A;  1VZ7 A;  2HJ1 A;  3HM3 A;  1XD3 B;  2O6V D;  2RSU A;  1I4Q A;  1V49 A;  4XZ4 A;  2JX5 A;  3RI7 C;  3NZ3 A;  1YQ3 B;  3GZN I;  5FK9 C;  4IWQ A;  2IGH A;  2K39 A;  3ZUN A;  2XK5 A;  1ZDX A;  1TZO A;  3B08 A;  2JSV X;  1MPE A;  3WA0 A;  2BTE A;  2LGY A;  4RH6 A;  2W82 A;  2MBH A;  4YTN B;  1I4R A;  1WJU A;  3RNB C;  4KKJ A;  2CHW A;  2NS5 A;  2BYV E;  3A9K B;  1WGY A;  5BMI A;  5CHV C;  1MG8 A;  4EEW A;  2JWZ A;  1VRA B;  2MCN B;  2PTL A;  1QQR A;  1PGX A;  2RDB C;  1E0Z A;  3SR6 A;  4ZRK A;  4B0M A;  2DAJ A;  2NVU I;  4GLS C;  2IGD A;  2D2Q A;  3W2D A;  1YMH E;  3VHT C;  4WAF A;  2JY6 A;  1D5X C;  3A9J B;  2PJH A;  2LJI A;  3IBE A;  1ISN A;  1EO6 A;  5L83 A;  2Z8L A;  1JWM D;  4REZ A;  2GBN A;  4MH8 A;  2BB6 A;  2FCS A;  2LFI A;  1STE A;  2WXH A;  4RF1 A;  1L4Z B;  1WJN A;  4PYZ A;  2ZNV B;  3P4S B;  3AV8 A;  4A9A A;  1GJZ A;  5DPS A;  5G55 A;  2KX3 A;  3WAM A;  3D32 A;  3PVL A;  4MJS A;  2WDR B;  4LTU A;  4GDL B;  4F8C B;  3M95 A;  1WZ0 A;  1QOA A;  4JE3 B;  1YN5 A;  1HQR D;  3PLV A;  2DZM A;  5D6J B;  1VZ8 A;  1AYF A;  4G3X B;  3ZRF A;  4JX1 C;  4GOC A;  1S3S G;  1UNS A;  2XK5 B;  4WQM A;  1WX9 A;  2BWE S;  3N30 A;  4KV2 A;  4MM3 B;  4I6L B;  4NY0 A;  1V1P B;  4HEA 1;  3LDZ E;  2LEK A;  2JT4 B;  4WJQ A;  3N1Z C;  2PVO D;  4G0N B;  1VCB A;  4HKZ E;  3ZXV A;  1CJE A;  3DBR I;  1FD6 A;  1WYG A;  1XLP A;  3DQV A;  2AQ2 B;  2ONQ A;  1Q1O A;  1IBX B;  2GLS A;  4OW0 A;  4I6P A;  1CMX B;  4RF0 A;  3AE3 B;  2KFK A;  2FUG 1;  2CS4 A;  3RUI B;  2KO3 A;  2NBU A;  1ZOY B;  3B9J A;  3GOE A;  2KOX A;  1IGD A;  1JWB D;  4RGM A;  3RNE C;  4OZB A;  1FRR A;  4DBG A;  2KAN A;  1FM0 D;  3AEF B;  1TS4 A;  2PLP A;  4WWM A;  1L6V A;  2K6D B;  1L5P A;  3BZD B;  5HG2 A;  2SAK A;  2EMS A;  3BII D;  3C0R B;  1WWT A;  4KDL B;  1TTN A;  2WQY B;  1JCK B;  4KGS A;  2KD0 A;  2WWZ A;  3EHV A;  1V2Y A;  2RD0 A;  4W9K A;  4RCO A; 
#chains in the Genus database with same CATH homology
 1YJJ A;  2BS3 B;  3AED B;  1JWA D;  1GOZ A;  2HDE A;  1KRH A;  4UDU C;  1KH0 A;  4J3O D;  1F2R I;  2ZW0 A;  2IDY A;  2L83 A;  3GS2 A;  1YNT E;  3MHZ A;  2ZW1 A;  1ESF A;  1I7H A;  5EE1 A;  1SBB B;  2PIA A;  4YTM B;  3E56 A;  1BUI C;  1SIJ A;  2XN9 C;  1SJE D;  1TJE A;  4US9 A;  4NAM A;  3NRZ A;  3TEZ A;  2KQ4 X;  5C2T B;  5BYS A;  2LHE A;  1Y56 A;  1MHX A;  4JPS A;  4DXG A;  4A55 A;  3ZJT A;  2KDM A;  2N7J A;  4ARC A;  1HA5 A;  1KF6 B;  3URY A;  1L6U A;  1C79 A;  3Q8B A;  4KGR A;  4WUR A;  1RWS A;  3EA6 A;  4R3D A;  1IBX A;  3IXS A;  1D4B A;  1L4D B;  2GI9 A;  2Q5W D;  3PZ8 A;  4ZRP A;  1E10 A;  1UGJ A;  2NTS A;  4LLG M;  3HUI A;  1F0Z A;  3N9Y C;  1XXG A;  3Q8A A;  5HHD G;  1BML C;  2WXL A;  4A90 A;  5H92 C;  3BVG A;  1V1P A;  3WCQ A;  2AQ1 B;  3ZJU A;  1I4X A;  1FIQ A;  4TQ0 A;  1JML A;  3TEY A;  5EE9 A;  3IAM 1;  3NVV A;  2WXR A;  3Q8E A;  4US8 A;  1WRI A;  3T3N A;  1F2R C;  1FRD A;  2FBW B;  4TSS A;  4NJC A;  1K52 A;  1SE4 A;  2ACZ B;  2J4X A;  3T3O A;  1XLN A;  1PGB A;  3EUB 2;  1M4V A;  2VZK B;  3O13 A;  2MJ3 A;  2BB5 A;  2J52 A;  2MH7 A;  3VR9 B;  2BBC A;  2IPK D;  4PT5 A;  1JWU D;  1XCQ L;  4NAW B;  1NEK B;  4KKI A;  2NTT A;  1C76 A;  2WLB A;  1ENF A;  1TKY A;  3AEG B;  4MAC A;  3SFE B;  3LB8 C;  2ICI A;  2J42 A;  3FC4 A;  1KFY B;  2RMM A;  2LUM A;  2JZP A;  2J53 A;  1XO3 A;  4WIP A;  2MEK A;  1SJH D;  4XWT A;  2WS3 B;  3HRD D;  5EE3 A;  5BYQ A;  4JWU C;  5H8Y E;  1QLB B;  5AUK A;  3SFD B;  1YJI A;  2H88 B;  3TEW A;  2WXG A;  3P4R B;  3KWV A;  2AQ3 B;  1HZ6 A;  3AEA B;  2OHF A;  3W9C B;  5LNK 1;  1JRP A;  2LGI A;  2CJO A;  1MI0 A;  3AE1 B;  2E3T A;  3LXF A;  1XF5 L;  1DOY A;  2KAJ A;  2WXO A;  3HVD A;  3W5U B;  2PKO A;  1EM7 A;  3P42 A;  1FFV A;  3NVZ A;  1GB1 A;  3U2S C;  3CIR B;  2K3U A;  3TSS A;  1AWD A;  1RM6 C;  2BYT A;  3AM9 A;  2X38 A;  1N60 A;  1NEN B;  3AEC B;  1MHH E;  3VRA B;  2HTM E;  3R8B A;  3CWI A;  4NZL B;  2K9X A;  1GPX A;  2INN E;  1QIL A;  1LO5 D;  2L32 A;  1K53 A;  1PFD A;  3HVZ A;  1J7A A;  1FNV A;  1L0X B;  1BXT A;  4L1B A;  2DLB A;  5BMH A;  1F77 A;  4RGT A;  3W1S A;  5AUI A;  1HEZ E;  1SEB D;  1TY2 A;  2QSD A;  1SB3 C;  3RFZ B;  1TYG B;  3BK1 A;  3KQ4 A;  2EKI A;  4YTP B;  4KX6 B;  1ZPS A;  1SE2 A;  4ZRQ A;  5D7G A;  1RFK A;  1GB4 A;  2K0P A;  4C80 A;  3SEB A;  4IKG A;  1YN4 A;  3MP9 A;  3RPF C;  1C78 A;  1KLG D;  2KWD A;  1FNW A;  3VRB B;  1QF6 A;  1ZUD 2;  3BYY B;  3PZ7 A;  2I2Y A;  2JYE A;  1IUE A;  1PDX A;  2L1A A;  3FIL A;  1GAQ B;  2W55 A;  1N61 A;  2R61 A;  2Y5P A;  1XCT L;  1FFU A;  3C8Y A;  3IT4 B;  5BYR A;  3P1M A;  1FCC C;  3AE7 B;  4HKQ A;  2D5G A;  2Y5C A;  1EU4 A;  2G1E A;  5C3J B;  1J7C A;  2AX5 A;  1WXQ A;  1C77 A;  2WU2 B;  3OWE B;  1N63 A;  2MJE A;  2BS4 B;  3ETR A;  2WXJ A;  3MJ5 A;  2IJ0 A;  1DGJ A;  3ZJV A;  3L4P A;  2V3N A;  4AS1 A;  1J7B A;  4DQO C;  4OZA A;  2WXM A;  2DYO A;  1I4H A;  4OHJ A;  2JWU A;  5HI1 A;  3TUO A;  3P63 A;  3AMZ A;  4Q2J A;  5JXV A;  4A8X C;  1C9F A;  3U7Z A;  3NS1 A;  4GDK B;  3AE6 B;  1EWC A;  3W5V B;  4D2K A;  1ZP0 B;  1ET9 A;  3NVW A;  1FEH A;  3Q69 A;  4HJG E;  1D5M C;  2WP9 B;  4IDI A;  1R7S A;  4YT0 B;  2BS2 B;  3EGR A;  3AE2 B;  4XE0 A;  4OZC A;  1FNU A;  1I4G A;  1EU3 A;  1I4P A;  1PUT A;  1OFF A;  4WH4 A;  2KN4 A;  2B76 B;  1JAL A;  1FXI A;  2N0S B;  4ZYS A;  2XNA C;  1XEE A;  1VLB A;  2WXN A;  2W3S A;  4B0E A;  1T3Q A;  1JQ4 A;  2V4I B;  1NI3 A;  1ACC A;  4EE2 A;  2G9H D;  2IGG A;  5T8I A;  3ZYY X;  2SEB D;  1WGK A;  3I57 A;  1ZXI A;  4ARI A;  3KWL A;  1SE3 A;  1V1O A;  2QJL A;  4YSZ B;  1VJK A;  5D3I B;  1K51 A;  1NVI D;  2INP E;  3BVM A;  1T5X D;  1CK1 A;  2CJN A;  3BVZ A;  1IGC A;  2NMQ A;  3AE8 B;  4TMA B;  2WXP A;  1DOX A;  3AN1 A;  1XLQ A;  4OVZ A;  3GB1 A;  1SSN A;  1VZ7 A;  1C4A A;  1SXT A;  1A70 A;  3KLS X;  4RFB A;  2L52 A;  2WDQ B;  1V8C A;  1CQV A;  1I4Q A;  2WXK A;  3H8H A;  2JX5 A;  4M0W A;  1V97 A;  3VQI A;  3NZ3 A;  3Q8C A;  2DBY A;  1YQ3 B;  2WXF A;  5FK9 C;  5G5H A;  1TKG A;  2IGH A;  3V3X A;  3AE5 B;  1ZDX A;  1TZO A;  1E6E B;  2JSV X;  1N5W A;  5TSS A;  1MPE A;  1SF0 A;  4P16 A;  3AE9 B;  4HRS A;  2BTE A;  1HZ5 A;  4RH6 A;  3LYY A;  2W82 A;  4YTN B;  2WU5 B;  1L0V B;  1I4R A;  3AB5 A;  1JRO A;  3DWG C;  3B2G A;  4KKJ A;  1TS5 A;  5EE0 A;  2JQR B;  2DYM A;  5D3D A;  3R2T A;  5BMI A;  3B2F A;  1TY0 A;  4MT5 A;  1UWM A;  4ZHP A;  1AN8 A;  1KTK A;  1VRA B;  2WNM A;  1NYQ A;  4N6E B;  5BMG A;  1C4P A;  2PTL A;  4N58 A;  1B9R A;  2BT6 A;  2BW2 A;  2Y3A A;  2V0G A;  1QQR A;  1PGX A;  1VZ6 A;  3FIL B;  3TEX A;  1E0Z A;  3SR6 A;  1OQR A;  1OQQ A;  4B0M A;  2I38 A;  4GLS C;  2IGD A;  1TKE A;  3W2D A;  2M0A A;  1YMH E;  2K22 A;  4WAF A;  1D5X C;  2YEP B;  2TSS A;  4FXC A;  2JXT A;  2PMV A;  3GP7 A;  4JWS C;  2LJI A;  1PGA A;  1T6B X;  1D6E C;  4IOI E;  1DOI A;  1YQ4 B;  2Z8L A;  2CU3 A;  1JWM D;  4REZ A;  1QKZ A;  4MH8 A;  2BB6 A;  2N9L A;  4RNA A;  5GXG B;  3DWM A;  1TS2 A;  2LFI A;  2LHD A;  1STE A;  1E7P B;  2WXH A;  3BWU D;  3PO0 A;  4RF1 A;  1L4Z B;  1QT9 A;  1UUP A;  5E6J A;  2H89 B;  1UWX A;  3P4S B;  4ZOH C;  3AV8 A;  2ON8 A;  2MJD A;  1HXY D;  4A9A A;  1DYQ A;  3FAH A;  2DWQ A;  1MVK A;  4O1N A;  3BK2 A;  4H2A A;  3I9V 1;  2EEL A;  3ABV B;  2QIL A;  2WXI A;  2QIE B;  3ZGZ A;  3U52 E;  3E9S A;  1VDV A;  4C7Y A;  5FR3 A;  3ZQ4 A;  3U4E G;  4C7Z A;  4N59 A;  4CQN A;  2WDR B;  4LTU A;  1E9M A;  4LK0 M;  1P7F A;  4GDL B;  3AH7 A;  5I4D A;  1QOA A;  2W3R A;  1QOG A;  3MFG A;  3AEB B;  4JE3 B;  5G5G A;  1Q10 A;  4DXF A;  1AW7 A;  1KLU D;  4USA A;  1YN5 A;  2YEP F;  1HQR D;  1CZP A;  4ITK A;  4YWG G;  1QOB A;  1VZ8 A;  1AYF A;  3V05 A;  4JX1 C;  2WXQ A;  1VR9 A;  3IAS 1;  1D5Z C;  1NYR A;  4RGO S;  1UNS A;  1TS3 A;  3R2I A;  4XDC A;  3J9C A;  3BYT B;  4WQM A;  1PYW D;  4L2Y A;  3NVY A;  2KMM A;  2JU6 X;  4MM3 B;  1V1P B;  4HEA 1;  3UI3 A;  2LEK A;  3IT6 B;  2LMC A;  2RDH A;  3Q8F A;  2PVO D;  1WSP A;  2VZK D;  4HKZ E;  4YSY B;  2M19 A;  2WDV B;  4AQ7 A;  1CJE A;  4YXD B;  2RDG A;  1XLO A;  1N62 A;  1FD6 A;  1RYJ A;  1WYG A;  2KAC A;  1XLP A;  2AQ2 B;  5MPO A;  2ONQ A;  1FCL A;  3MC0 B;  1IBX B;  1ZXH A;  4OW0 A;  1FO4 A;  1P7E A;  5FKA C;  4RF0 A;  3AEE B;  3AE3 B;  4RGN A;  4KGT A;  1ET6 A;  1ZE3 D;  1QOF A;  2FUG 1;  4ZHO A;  3B9J A;  1ZOY B;  2RPV A;  1L0Y B;  3VR8 B;  2PVG C;  2FE8 A;  1ROE A;  4P6V F;  1ZDV A;  4TQ1 A;  1IGD A;  2N9K A;  3AE4 B;  1JWB D;  2PW9 A;  2W54 A;  4RGM A;  2K5P A;  2QMT A;  1FRR A;  3P4Q B;  4OZB A;  2OED A;  1FM0 D;  1JWS D;  1EWY C;  1TS4 A;  3AEF B;  2GRI A;  2E6X A;  4A6Q A;  2PLP A;  5HFY A;  4WWM A;  1FMA D;  4L23 A;  2QEJ C;  2GB1 A;  1L6V A;  3NUH B;  1K50 A;  1L5P A;  3BZD B;  5HG2 A;  2SAK A;  3BII D;  1JW9 D;  1WWT A;  1YN3 A;  4HRO A;  1FXA A;  2WQY B;  4XDD A;  1C4C A;  1JCK B;  4YSX B;  4KGS A;  2M56 B;  2V3P A;  3P4P B;  1B1Z A;  1N5X A;  2JYT A;  4C56 C;  4XWW A;  4RCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...