1YNTE

Structure of the monomeric form of t. gondii sag1 surface antigen bound to a human fab
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
EVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYADLLAKVNGEYTADLEDGGNHMNIKFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 4F11E12 Fab variable light chain region
publication title Crystal structure of the complex between the monomeric form of Toxoplasma gondii surface antigen 1 (SAG1) and a monoclonal antibody that mimics the human immune response
pubmed doi rcsb
source organism Finegoldia magna
total genus 9
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2005-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yntE00
2QSDA 2JXTA 4KGSA 5HI1A 2LHDA 2NMQA 4KGTA 5JXVA 1MVKA 2K0PA 2RMMA 1JMLA 4IOIE 3GB1A 2IGDA 1YMHE 2KN4A 1P7FA 3FILB 1EM7A 4OZCA 2GI9A 2J52A 2PTLA 4MACA 1XF5L 1QKZA 2JU6X 1C9FA 1HEZE 2QMTA 4WH4A 1HZ5A 2ON8A 1UWXA 1YNTE 1MHXA 1KH0A 2ZW0A 1FCCC 1K52A 2I38A 1XCTL 1F2RI 2KQ4X 2KACA 2RPVA 2JZPA 2KDMA 4HJGE 1GB4A 1MI0A 1IBXA 4OZBA 1MPEA 5BMIA 1F2RC 4IKGA 2PW9A 1FD6A 3MP9A 2LUMA 2IGGA 2ONQA 2PLPA 2OEDA 4D2KA 1K51A 1PGXA 1K50A 1IGDA 2ZW1A 1P7EA 1D4BA 1IGCA 5HFYA 1HZ6A 2JSVX 2KWDA 3V3XA 2JWUA 1IBXB 4HKZE 4GLSC 2IGHA 4OZAA 2N7JA 1Q10A 3UI3A 1PGBA 5BMGA 5BMHA 2GB1A 5HHDG 2LHEA 1XCQL 2EELA 2J53A 2N9LA 1PGAA 1GB1A 4KGRA 1ZXHA 2LGIA 3FILA 1K53A 1MHHE 1FCLA 2I2YA 2N9KA 5HG2A
chains in the Genus database with same CATH superfamily
3PPAA 3AE1B 4WIPA 1FFVA 5HI1A 3DBHB 1TTNA 2LEKA 4JLCA 2MP2A 1ENFA 4CO7A 2R2QA 1YQBA 2D3CA 4BFRA 4YSZB 1ZE3D 1R4NI 1SE3A 2HJ8A 3DHIC 2WLBA 1L0YB 1HTQA 1EUVB 3ZGZA 1PYWD 2CHXA 2DYMA 1JWAD 3CSTA 1D3ZA 3H7PA 4TQ1A 3KW5B 1WFYA 4MGYE 4W9HA 2L7RA 3Q8EA 2L8JA 3W5VB 1SJHD 2L83A 3PSEB 4XZ4A 1LXDA 2LUMA 4BKSA 2OEDA 3DVNU 2IO2B 2KDBA 2KJRA 4EOYA 1CJEA 2KX0A 4DWFA 4GIVA 2RR9A 1R4MI 3BK2A 2M19A 4NJCA 2LGSA 1I4RA 3HHMA 5FK9C 3CWIA 1KRHA 5HHDG 4LDTD 1XLQA 3QARA 2WXMA 2D3GA 2LMCA 2J53A 3NVVA 2KWVB 1N60A 2LGIA 2L0FA 2WXFA 2WU2B 3EHVA 4ACFA 4EEWA 3Q3OC 2C7NB 3EFCA 5CTRC 2INDC 5FR6A 2INPE 3MJ5A 2I2YA 4ZYNA 4JQWC 3A9JA 3Q8FA 4MJSB 4GB9A 2KQSA 2N1WA 5AZFA 1V1PB 1MJDA 4B6WA 4LNIA 1UNSA 1WYWB 3TEXA 2WXPA 5JHBA 1FFUA 3EFUA 4AJYB 2V4LA 3Q3JA 1J19A 3PREA 3Q69A 2G45B 3RZWC 1TIFA 3R7QA 3A4RA 2KTFA 4ZOHC 3ZNID 1VRAB 3AEDB 3NY5A 1VZ8A 3C19A 3RZFA 2BYFA 2ZCCA 4I6LB 4MSQB 3R8BA 5KHOA 1XLOA 2UU7A 4I6NB 2LFIA 2K39A 2KDMA 2RPVA 4FLHA 3TBLD 4J3OD 1TKGA 3AE5B 4GMVA 2MRPA 3DVGX 3BZDB 3O13A 3DBLB 3IFWB 3RT3B 2Y5PA 4GDKA 4NQLB 3DHGC 2D2QA 4BZAA 4KDLB 3RCZA 2KXJA 2DENB 1LO5D 1NVID 1C1YB 2M0XA 3IAM1 4RGMA 1WXQA 3BK1A 2NBUA 4NAWA 4EZKA 4HLEA 3UQAA 2IPKD 3BVGA 2CHZA 3WCQA 1CK1A 1QILA 2KFKA 3E56A 4FJVB 4ZRKA 1NI2A 3FILA 4RF0A 3MHZA 3AEGB 2IYDB 3ZKJC 2LUEA 3RMKC 4RFBA 4C00A 2K0PA 4XDCA 2BVCA 3QCAA 2O2VB 2KK8A 2N9EB 2W9NA 1I4XA 2AQ3B 4HCNB 1ET9A 1VZ6A 3HM6X 4G3XB 1WE6A 4HPPA 2N7EA 1R4NB 4DHZB 3URYA 2D07B 1MG4A 3L10B 2NPTA 1UBIA 2BWES 4LNOA 3U7DA 4N59A 2CR5A 5AEKB 2BKFA 4IM3A 4NY0A 3NZ3A 1V2YA 2MHJA 2N1VA 3C0RB 4YSXB 4MEMA 2N4FA 2C60A 1RLFA 1P0RA 1JWMD 1P1AA 3TIXA 1DYQA 2DWQA 2BW2A 2KQ4X 1Y8RC 3NVZA 2AX5A 2SAKA 4HJGE 4WAFA 3AXCA 3O65B 4KDIC 3VTVA 2LI5A 5AUKA 4O1NA 5G5GA 3W1SC 4FHKA 1EF5A 3L0WB 5C23A 2Z59B 3M3JA 1I4GA 4YWGG 2FCQA 3CF6E 2JY6A 1AWDA 2DAJA 2BGFA 4N58A 2B3AA 3PS6A 4LNFA 1N5WA 4KIKB 1SJED 1HZ6A 3MHSD 3PZ7A 2QDFA 2PEAA 1R4MB 3VUWA 5E6JA 3HUIA 2KQ7A 4KZCA 4PS3A 3RN9C 2ZJDA 5EE1A 4FBJB 1WZ0A 4IDIA 5LXIB 3L16A 4JPSA 1FEHA 3PHXB 5MPOA 4LTUA 2KDEB 1YIWA 4XWWA 4G11A 1WE7A 2N9PC 3QA8A 3ZXRA 3V05A 4YL8A 1V80A 1E8ZA 2PPHA 4BOSC 2MH7A 2C7HA 1NEKB 1UWMA 2GBRA 1H8CA 4BOZB 4GOCA 1WJ6A 2CU1A 2HTHA 2CU3A 4US9A 2BYTA 3PT2B 2CHWA 3DVGY 3PTFC 5G2NA 3RNBC 4IOIE 2KOXA 1T0YA 3DOWA 5EDSA 2UYZB 4M8NA 2KJ6A 4OZCA 2HTME 1MG8A 5E6OA 4WJPA 2JUOA 2WXLA 1I35A 2GBJA 2PVGC 2MBQA 1SEBD 1QQRA 2IO3B 2XK5A 2L1AA 5BYQA 2K6DB 2WXKA 3QX1A 3VH3B 1MHXA 2ZW0A 4EE2A 1GUAB 3OAWA 3U7ZA 2FIDA 4C4VB 4RCOA 3K9OB 2AYOB 2LGXA 1YX6B 4IKGA 4RM9A 4XGAB 3GE8C 1FD6A 3ZDTA 4YXDB 2QILA 3NJTA 4DQOC 1EWYC 2VH2A 3VRBB 1E10A 1K50A 4XDDA 4LLGM 3N1YC 2J4XA 5DPTA 4HWIB 3BVZA 1IBXB 2K3UA 3QAQA 4HKQA 1WM2A 2V3NA 4AQ7A 2Z0EB 3AN1A 1JQ4A 4YT0B 1LFDA 2DYBA 4LDTB 1MFWA 1HXYD 3TSSA 2FUHB 5IN7A 2M1MA 4WURA 3IHPC 4K81A 3E9SA 3B2GA 4HVBA 3NRZA 3JW0X 4C80A 2RDHA 4I6PA 4L1BA 1SF0A 2LHDA 1V5TA 3VQIA 2WS3B 3EA6A 1P9DU 1SSNA 3BVMA 1SIFA 2FUG1 2K22A 5I4DA 4IW0A 1TZOA 4YTPB 2N7DA 5L83A 1N61A 1XF5L 1WMHA 1ZDVA 1ZUD2 3ZXVA 1HEZE 2JPHA 5E6PA 1WR1A 2BWFA 4TUUA 4HCPB 3VTWA 2DZIA 2OJWA 2RD0A 3Q3FA 2BPSA 4FHJA 5IAAC 2O6VA 4MM3A 2J0JA 3FC4A 3ML8A 3W5UB 2DBYA 3KWVA 4M0WB 2G1EA 2LVOA 3ZW3A 4F1SA 4HRSA 1WF9A 1WM3A 3KVFB 3AE9B 2JZPA 1ZOYB 2LASA 2CJOA 5BO4B 3ZYYX 1EO6A 4D2KA 2E6XA 4ICUA 2V0GA 1D5XC 1TY2A 3RNAC 1YD8U 1BUIC 4ZRPA 3SU8X 2KWDA 3U52E 1J7BA 4US8A 1NYRA 1PGBA 4DDGD 2MCNB 1KFYB 4F7ZA 1S1QB 1UBQA 3L4PA 2ZPNA 4NQKE 4WQOB 2K1FA 1Z5SB 2D5GA 4RGNA 2QCZA 2ZPYA 4N9F4 1T0RC 1AN8A 2JXTA 3TMPB 1SE9A 1GG3A 2V9HA 1QOFA 1KM7A 2WWZA 3ZJVA 3A1QA 3PV1A 1UGMA 2RDBC 4F8CB 4URKA 4RH6A 1JRUA 3W1YA 4WWPA 1QZEA 1ZPSA 1WWTA 4P1CC 2NCNA 2KLCA 1SE4A 1HZ5A 2AWTA 5C3JB 4IG7B 2WNMA 2NVUI 1UZXB 3DDCB 3PVLA 3JYUA 3UIPB 1NYQA 3RNGC 2KNBA 3N1ZC 4W9CA 1NI3A 1YNTE 3BYTB 1YJIA 2HDEA 4WQMA 1GAQB 4ANUA 2JX5A 5DCNA 4K7SA 3I9V1 1VJKA 4MT5A 3CIRB 2Q5WD 3CMMB 1OTRB 2JYEA 4C7YA 4MSMB 1XEEA 1WGYA 2JZ3B 3WANA 4YTNB 1F77A 3N32A 4OVUA 2NBVB 1WGHA 5TR5A 1OEYJ 1AW7A 2CJNA 2JYTA 2JRIB 1V5OA 2ZCBA 1Q10A 2NTSA 3AV8A 2GB1A 4ZDVA 2DHZA 1E0ZA 1D6EC 4Q2JA 4TMAB 5L95C 1A70A 2WXOA 3MFGA 2LXCA 1WGDA 2KC1A 3AE3B 3VFKA 1ISNA 1CQVA 4MGIE 2BQQA 5DPSA 1N6ZA 2WU5B 3ZTDA 2QEJC 5HG2A 1FMAD 4BBNF 4ITKA 5JH5C 2BB6A 4W9JA 4IWQA 2G3QB 1I7HA 4E74A 2K8CA 1YQ3B 2OOBB 4B0EA 3GB1A 4K3BA 1YMHE 3AEAB 2ZEQA 2LRUA 2KTRB 2H88B 4WWMA 1Q1OA 3AE7B 2XBBC 2XEWA 2L52A 1F1HA 3SEBA 1DOYA 2Y3AA 3TL5A 5AZGA 3VHTC 1OFFA 2J7QB 2DNFA 2R61A 2L00B 4P6VF 4TKNA 3SD5A 2ASQA 2KVZA 3W9CB 4LJPB 1K52A 2QIEB 1WX8A 2V3PA 2Y5CA 1FPYA 1F2RI 1F52A 2M17A 4GGQA 4IM0A 2WYQA 3TCAA 4OHJA 1I42A 4M00A 4NJ6A 2PE9A 2CKHB 1WYGA 4IWOA 1L6UA 4ZRIA 1C4PA 4A55A 2IJ0A 1XXGA 3RFZB 3ML9A 4B95A 3VR8B 1YN5A 1L2NA 4HKZE 1WR6E 2N7JA 4MJSA 2J0KA 4DHJD 2WXIA 1WGKA 1TT5B 5CHFA 1YX5B 4WJQA 2MBOA 3AEBB 3TEWA 1V1PA 2MEKA 3TEZA 2GBNA 2D3AA 4PYUA 1WSPA 2W55A 3N30A 3HM3A 1TS3A 4K3CA 2D11A 1L4ZB 1WX9A 2HD5B 1WXSA 3RNEC 1M4VA 1KLVA 4GXBA 3U4EG 1C4CA 2QSDA 2L3ZA 1N63A 3ZLZA 2ZNVC 1FM0D 3A4SC 1E8XA 3I57A 1VCBA 2QHOA 3R2IA 2KYWA 4B0MA 4W9EA 1L6VA 1N62A 2XNAC 1QLBB 2H89B 3ENEA 3DBRI 2M56B 2GI9A 4ZHOA 4DK5A 2BYEA 2EKEC 1QKZA 2J42A 1V9JA 1M94A 5H92C 3UINB 2MW5A 1WX7A 4DDID 4R3DA 1QOGA 2WHIA 3OLMD 2GLSA 4P1BC 4DXAB 3ECIA 5H8YE 5C2TB 5D2MB 3AULA 3SHQA 4NAMA 1C4AA 2MJEA 1GB4A 2G4SA 3H6NA 3C8YA 2FNJB 1F2RC 5C1ZA 4OVVA 3NVWA 5IOIA 3RUIB 2WDVB 3GE3C 3ZNHB 4FN2A 4ZRJA 1OQYA 1OQQA 1LGRA 2QC8A 5D6JB 4PT5A 3V6EB 5J2RA 4RGOS 2JWUA 3P4RB 1SXTA 2K8HA 3ZJUA 4BKSD 4GLSC 1E5WA 1HA5A 3P42A 4REZA 2M8SA 3PHWB 4AWJA 1R7SA 1VZ7A 1E9MA 4M02A 1J7CA 3VR9B 2FAZA 4UDUC 2DYOA 2O2VA 4EFOA 4KGRA 3Q3MC 3RULA 3W2DA 2NS5A 3SFDB 2ZNVB 2KHWB 4W9IA 1XQQA 4HPLB 2N9KA 4JWSC 2KDIA 4OVZA 2V1YA 1XT9B 2KO3A 1L5PA 4HPMB 4JGHB 2RMMA 4G50A 4KZ0A 3N20C 4NZLB 3U2SC 4W9LA 3N3KB 1SB3C 3EECA 1XO3A 3APFA 1WXAA 2WP9B 4MACA 1WXMA 3VVWB 4A3PA 3BWUD 3WA0A 5J18A 3U30A 4GDLB 3A9KB 1GPXA 4FADA 2JXXA 2QJLA 3WALA 2WXQA 3IAS1 4LCDE 1JWBD 3ZRFA 2KWCA 2DLBA 1PQSA 4W9FA 4KIKA 4C56C 3V6CB 1NENB 1V49A 3VH4B 3CSFA 2HJ1A 3AE4B 2WXRA 3ALBA 2PW9A 4W9KA 1ESFA 1BMLC 3KUDB 2PLPA 4L2YA 2YEPB 3DQVA 2KWUB 3KYDD 1JRPA 1BT0A 4BVUC 3BIID 1PGXA 3ETRA 5D3DA 2E3TA 2JSVX 5LXHA 1CZPA 1OGWA 2M4NA 2MWSB 4ZYSA 3WAPA 3M63B 2PKOA 1E8YA 3GS2A 3DBSA 4HEA1 5LNK1 1I4QA 3AEEB 1IP9A 4DXGA 3PGEA 2FBWB 3V61A 4LJOB 4MH8A 3BY4B 3AE2B 2PIAA 1I4HA 2G4DB 1TS5A 3AU4A 2YEPF 1RYJA 4YTMB 4XWTA 3T3NA 1J0GA 1EM7A 3SFEB 3H1UA 3IT6B 2PTLA 3X0WA 3DBRB 4LNKA 3W1SA 2K9XA 2WDTB 2WX0A 4C4VA 2IO0B 5AUIA 3T9LA 2WXJA 3AEFB 4II2B 3R7RA 2OJRA 1FO4A 4IC7B 4CQNA 1PDXA 1FCCC 4W9DA 3OJ3A 2KD0A 3AH7A 4M8MA 2AL3A 2KACA 2X38A 2WX1A 3Q6BA 1TKYA 3L17A 1IBXA 4FA6A 3NZSA 1ACCA 4MH0E 1JCKB 3BINA 3JSVB 1CMXB 1ZKHA 4H2AA 2IGGA 2V3SA 4ZRQA 1V86A 1FNUA 2L32A 4YSYB 5CX3A 2L05A 2K6QA 3VXWA 1E90A 3ZNGC 2PMVA 1A5RA 1P7EA 4E3CA 2JF5A 2ZVOA 4K7WA 4BKGA 4BBNC 4TV3A 4DHJB 2WXHA 3QQ8B 2NTTA 3B2FA 3BYYB 2JQRB 3IVFA 1QF6A 1FRDA 3DPDA 1E8WA 1SGHA 1AYFA 3VDZA 3V62A 2ICIA 5BYRA 2FIFA 2HE7A 3PZDA 1WJ4A 2A4ZA 1F0ZA 1FRRA 1RFKA 2IGDA 1FNVA 2UWQA 1EWCA 4S17A 4B9KA 1P7FA 3NZUA 2XN9C 2KMAA 4M0WA 3QIJA 3ZO5B 4J6IA 2QMTA 3OWEB 1FIQA 2B76B 3GOEA 1TJEA 1GC6A 4ANWA 1K8RB 1S3SG 2IBIB 2MP2B 2JT4B 3MC9A 3NVYA 4MGZE 3N1XC 3IG3A 4II3B 4P7IA 1TBEA 1JALA 3APCA 3P63A 4C7ZA 2DZKA 3ZNZB 1U4AA 5JHAA 2FCMA 2Z0DB 1YN4A 1PFDA 5E6NA 4IM2A 1IUEA 3HK0A 1UUPA 3H7PB 2VH1A 1DGJA 2GRIA 1IGCA 3Q2AC 1UGJA 1X1MA 1V81A 1T5XD 2OHFA 3AE6B 1WRIA 2REXA 3NUHB 2KMMA 1SIJA 4KKJA 1KJTA 2JRHA 2I1KA 4AJWA 3RNFC 4ASWC 1UELA 1PGAA 1ZXHA 2EMSA 1JWSD 2BS3B 4BAXA 2C7MB 3Q14C 4EZJA 2GMIC 3RNCC 3V60A 3AI5A 2WXNA 1QOBA 3DHHC 5DPRA 2VRRB 2YVCA 3LB8C 3ZJTA 1LM8B 2I1JA 2PJHA 4ANVA 4RGTA 3H9DA 1WJNA 1L7YA 1RAXA 2BS2B 2KC2A 4HROA 4AUQC 1VDVA 3I63C 1ZDXA 3A9JB 2X8XX 4IWPA 2MBHA 1Z2MA 1EU4A 4AP4C 4JWUC 4MGKE 2MSED 4FULA 3UQBA 2YLMA 2LVQA 3X23A 3EGRA 3RPFC 5G5HA 1L4DB 3GZNI 2GBMA 4RNAA 2L0TA 1MI0A 3TUOA 1L0XB 3ZUNA 2O6VD 1G6JA 2BF8B 2WXGA 3PO0A 3UIOB 3KUZA 4NPNA 3B0AA 2KFJA 4K1RB 3VUYA 3PRZA 1RRBA 2KAJA 1NDDA 1Q0WB 1IGDA 2ZW1A 4JX1C 3MC8A 5JZEB 3ABVB 1V8CA 1ZGUB 2DX5B 1TS4A 2LVPA 1Q5WB 5EE9A 1KLUD 4ARIA 2BTEA 1SE2A 1WY8A 2NBWB 3Q8AA 4GDKB 1GB1A 1E7PB 2IY1B 5G55A 2KTRA 3RI7C 3L54A 3B1LX 1WGGA 2MJDA 2JWZA 4PS7A 3VTUA 3IXSA 3PRPB 1WH3A 3HRDD 1HQRD 4NJ7A 4NAWB 4KGTA 1E7VA 3D32A 1HE8A 2JVCA 1JMLA 2KFKB 2G9HD 1FXIA 3R2TA 1YJ1A 2RDGA 3FILB 3L08A 2VZKD 2N9XA 3R66C 3Q3NC 4E71A 1C79A 4CYEA 4NNJB 5D3IB 4A20A 2ZVNA 3S2AA 4WH4A 1FXTB 2Y5BB 2LRWA 2AL6A 2DZMA 2LGDA 1JWUD 5AZHA 4A6QA 4GSWA 4W9GA 4LNNA 1TY0A 3L13A 3PZ8A 4XC2A 4EUTA 3RD2A 1DOXA 1V97A 4HK2A 3MJWA 4HXDA 3WAOA 3Q8CA 2L76A 4KSKC 4KX6B 3ZRCA 1KLGD 4A9AA 2NPTB 2WDQB 2PE6B 3HVZA 2JZZA 2BBCA 1LQBA 4JL9A 3MTNB 3Q8BA 2M0AA 4N6EB 1TS2A 3IBEA 3AM9A 1WGRA 4BKTA 3NS8A 4GU2A 1H4RA 2IGHA 4OZAA 2KN5A 1YJJA 2LXAA 4A90A 2LJ5A 3P1MA 2LHEA 4FJYA 3A33B 1WXVA 3KLSX 3HIZA 3DWGC 1GC7A 4LK0M 1IPGA 1GNUA 3NOBA 2LWPA 5CHVC 1XLNA 1K53A 2MBEA 3P4SB 5T8IA 1YQ4B 1EF1A 5EE0A 3T8MA 2K25A 4HDOA 1E7UA 4WJOA 3FKYA 4KGSA 4XE0A 2C5LC 2NMQA 2KX3A 3VUXA 1TKEA 1F9JA 5GXGB 2D3BA 4K7UA 4QAYA 1KOTA 3QJZA 1SBBB 2W82A 1QT9A 3NS1A 3UF8A 2J52A 4WWNA 3P4QB 3QHTA 3U8ZA 2ON8A 3MC0B 4RM8A 1C78A 2IO1B 1UH6A 4RF1A 2BS4B 3HVDA 3SR6A 4KKIA 1KH0A 1XD3B 4AS1A 3EC8A 2WGSA 3ZQ4A 1OQRA 3GZNB 5HKHA 5EE3A 1JROA 1J8CA 1MPEA 5BMIA 4A3OA 3OJ4B 2XK5B 3UGBB 3MP9A 1UD7A 3OG5A 2BKRB 4KV2A 2KVRA 2W3SA 1YN3A 2BYVE 3P4PB 4MELA 3ZVVA 4KVGB 3KYCD 3SDLC 1RFAA 2A5UA 5IKCM 4ARCA 5IO9A 1RWSA 3ZIMA 3AE8B 3I3TB 2N0SB 4RMAA 2BB5A 2N9LA 3LXFA 3N9YC 4USAA 2RSUA 3AECB 1KF6B 3AMZA 1TGZB 4HJKA 1MHHE 2NR2A 4G0NB 2Z8LA 1I4PA 3QK0A 3DVNV 1TYGB 2FE8A 1DOIA 5DPWA 3DBHI 4GDLA 3A9KA 4L23A 2FCSA 3LJ3A 1WJUA 2DZJA 4FXCA 2KN4A 2MLBA 4EKUA 4PS8A 4KSLC 2FCNA 3FAHA 2J0MA 3J9CA 3NG0A 1VR9A 5FR3A 2LD9A 1WI0A 5BYSA 4CHKA 3KH0A 2JU6X 5D7GA 4X57B 2KLGA 1VLBA 1D5MC 2DAFA 4DXFA 3K9PB 2ACZB 2RPQA 3KQ4A 3WIMA 1TZ1A 2KANA 3LDZE 4IUMB 4WWOA 2IY0B 1N5XA 2EKIA 4ZHPA 2LJIA 3JVZX 3QC8B 1NBFC 4MDKE 2INCC 1WMHB 1V6EA 2D10A 2WDRB 2MA9B 3PLUA 4OZBA 1P3QU 3NHEB 1ET6A 1GOZA 3VAWA 4OW0A 2SEBD 1KTKA 1T3QA 3H8HA 1PUTA 2IZVB 2ONQA 1FNWA 4S0RA 3M62B 2IDYA 1K51A 3VRAB 2O6VB 4MM3B 3KUCB 1ZW7A 2AEHA 3LYYA 4PK1A 2PVOD 2AQ2B 3KWLA 5HFYA 1D5ZC 2GBKA 3WAMA 2EMTA 3V3XA 1T6BX 1T0SC 1VD2A 1AARA 1P98A 2KKCA 3UI3A 1V1OA 5BMHA 4GN1A 1OEYA 4XX5A 2LGYA 3TEYA 1WIAA 3IT4B 1EU3A 1ROEA 3ZDMC 1FXAA 1FCLA 2KDFB 4JIOU 2ZZPB 2W3RA 1WRDB 4ICVA 4AOFA 5KHQA 5JXVA 2V4IB 1MVKA 1E6EB 3PLVA 1ZP0B 2KMCA 3B08A 2K5PA 4TQ0A 3DWMA 4FJZA 2MJ3A 1RM6C 4PYZA 1Y56A 1L0VB 2VZKB 1C9FA 2WQYB 5GMVA 2W54A 3JSVA 2RGFA 1JW9D 3GP7A 3P2BA 3M95A 1STEA 3A1QB 1QOAA 1UWXA 1ZXIA 1WZ3A 1GJZA 5LLIA 2KT7A 5IP4D 4TSSA 4P16A 2I38A 2K8BA 2TSSA 1XCTL 4A8XC 3QWZB 5D94A 4WAAA 2LZ6A 4XYCA 2MQJA 3B9JA 3APDA 2AQ1B 2C9WB 4ANXA 4M01A 3ZTCA 1C3TA 1C77A 3H7SA 1XLPA 5CHWA 2MBBB 3AB5A 3DBLI 1YOVB 4DHZE 5FKAC 1UF0A 4EZLA 1C76A 2BT6A 3RYTA 1T0QC 2CS4A 3TJPA 2R2OA 2KZRA 1D4BA 3R3MA 4WJNA 4DBGA 3ONSA 1J7AA 2KJHB 1IYFA 3DCGA 5J17A 5BMGA 1B9RA 5TSSA 2INNE 1XCQL 2EELA 3AU5A 3T3OA 2MX2A 1B1ZA 2GOWA 3EUB2 1HTOA 4HDQA 5IA7A 3PRMB 4JE3B 3I5JC 1BXTA
chains in the Genus database with same CATH topology
4C80A 3AE1B 2RDHA 4L1BA 1HQRD 4WIPA 1FFVA 1SF0A 5HI1A 4NAWB 2LHDA 4KGTA 3VQIA 1L5PA 2LEKA 2RMMA 2WS3B 3EA6A 1JMLA 1SSNA 2G9HD 1ENFA 4NZLB 3U2SC 1FXIA 3BVMA 3R2TA 1SB3C 2FUG1 2K22A 5I4DA 2RDGA 3FILB 1XO3A 1TZOA 4YTPB 4YSZB 2VZKD 1ZE3D 1SE3A 2WP9B 4MACA 1C79A 1N61A 2WLBA 1XF5L 1L0YB 1ZDVA 1ZUD2 5D3IB 1HEZE 3ZGZA 4WH4A 1PYWD 3BWUD 4GDLB 1JWUD 2DYMA 1JWAD 1GPXA 2QJLA 4A6QA 2WXQA 3IAS1 1TY0A 1JWBD 3PZ8A 1DOXA 1V97A 4TQ1A 2DLBA 3FC4A 3W5UB 2DBYA 3KWVA 2G1EA 3Q8CA 4HRSA 4C56C 4KX6B 1NENB 2JZPA 3AE9B 1KLGD 3Q8EA 1ZOYB 4A9AA 2CJOA 3W5VB 1SJHD 2L83A 3AE4B 2WDQB 2WXRA 3HVZA 2PW9A 3ZYYX 1ESFA 1BMLC 2BBCA 2LUMA 2PLPA 4L2YA 2YEPB 2OEDA 1JRPA 3Q8BA 4D2KA 3BIID 2E6XA 1PGXA 3ETRA 2M0AA 1CJEA 2V0GA 1D5XC 1TY2A 4N6EB 5D3DA 1TS2A 2E3TA 1BUIC 4ZRPA 2JSVX 2KWDA 3AM9A 3BK2A 3U52E 1J7BA 1CZPA 2M19A 4NJCA 1I4RA 2IGHA 4OZAA 5FK9C 3CWIA 4US8A 1NYRA 1PGBA 1KFYB 4ZYSA 1KRHA 1YJJA 5HHDG 4A90A 3P1MA 1XLQA 2LHEA 3L4PA 2PKOA 2WXMA 2LMCA 3KLSX 2J53A 3NVVA 3DWGC 3GS2A 4LK0M 1N60A 2LGIA 2D5GA 2WXFA 2WU2B 4RGNA 1XLNA 1K53A 3P4SB 4HEA1 5LNK1 5T8IA 1YQ4B 1I4QA 2INPE 3MJ5A 2I2YA 5EE0A 3AEEB 4DXGA 1AN8A 2JXTA 3Q8FA 4XE0A 4KGSA 2FBWB 4MH8A 1QOFA 2NMQA 3AE2B 1TKEA 2PIAA 3ZJVA 5GXGB 1V1PB 1I4HA 1TS5A 1UNSA 2YEPF 1SBBB 1RYJA 4YTMB 4XWTA 3T3NA 1EM7A 2W82A 4RH6A 3SFEB 3TEXA 2WXPA 1QT9A 3NS1A 3IT6B 2J52A 2PTLA 1ZPSA 3W1SA 1WWTA 2K9XA 1FFUA 3P4QB 1SE4A 1HZ5A 2ON8A 5AUIA 3MC0B 5C3JB 3Q69A 2WNMA 1C78A 2WXJA 3AEFB 1NYQA 1NI3A 4RF1A 2BS4B 3HVDA 1YNTE 4ZOHC 1VRAB 3SR6A 3AEDB 1FO4A 3BYTB 4KKIA 1KH0A 4CQNA 1PDXA 1VZ8A 1FCCC 1YJIA 4AS1A 2HDEA 4WQMA 3R8BA 3AH7A 1XLOA 1GAQB 3ZQ4A 2KACA 2X38A 2LFIA 2RPVA 2KDMA 1OQRA 1TKYA 2JX5A 5EE3A 1IBXA 1JROA 4J3OD 1ACCA 1MPEA 5BMIA 1JCKB 1VJKA 3I9V1 4MT5A 1TKGA 3AE5B 3CIRB 4H2AA 3MP9A 2Q5WD 2IGGA 4C7YA 2JYEA 3BZDB 4ZRQA 3O13A 1FNUA 1XEEA 2L32A 4YSYB 4YTNB 1F77A 2W3SA 2Y5PA 1YN3A 3P4PB 2PMVA 1P7EA 1AW7A 2CJNA 2JYTA 1LO5D 1NVID 4ARCA 1RWSA 3IAM1 1Q10A 2NTSA 4RGMA 1WXQA 3AV8A 3BK1A 2GB1A 3AE8B 2IPKD 3BVGA 1E0ZA 1D6EC 4Q2JA 3WCQA 1CK1A 2N0SB 1QILA 2BB5A 4TMAB 3E56A 2N9LA 1A70A 2WXHA 3LXFA 2WXOA 3N9YC 4USAA 2NTTA 3AECB 3MFGA 3FILA 3B2FA 3BYYB 1KF6B 3AE3B 3AMZA 4RF0A 1MHHE 1CQVA 2JQRB 2WU5B 3MHZA 2QEJC 5HG2A 2Z8LA 3AEGB 1QF6A 1I4PA 1FMAD 1FRDA 4ITKA 1TYGB 2FE8A 1AYFA 1DOIA 2BB6A 4L23A 4RFBA 1I7HA 2ICIA 1YQ3B 2K0PA 4XDCA 5BYRA 4B0EA 1F0ZA 4FXCA 1FRRA 1RFKA 3GB1A 2IGDA 1FNVA 1EWCA 1YMHE 2KN4A 3AEAB 1I4XA 1P7FA 2AQ3B 2H88B 3FAHA 4WWMA 1ET9A 1VZ6A 3AE7B 2XN9C 3J9CA 4M0WA 1VR9A 5FR3A 2L52A 5BYSA 3URYA 2JU6X 5D7GA 3SEBA 1DOYA 1VLBA 1D5MC 2QMTA 2Y3AA 3OWEB 1FIQA 2B76B 4DXFA 1OFFA 4N59A 2ACZB 2R61A 4P6VF 3KQ4A 1TJEA 3NZ3A 4YSXB 3NVYA 1N5XA 2EKIA 4ZHPA 2LJIA 3W9CB 1JWMD 1K52A 2QIEB 2V3PA 1DYQA 2DWQA 2Y5CA 2BW2A 1JALA 1F2RI 2KQ4X 3NVZA 3P63A 4C7ZA 2AX5A 2SAKA 4HJGE 4WAFA 2WDRB 4OZBA 1YN4A 5AUKA 1PFDA 4O1NA 5G5GA 4OHJA 1IUEA 1ET6A 1GOZA 4OW0A 1WYGA 1UUPA 1KTKA 1T3QA 2SEBD 1PUTA 3H8HA 1I4GA 2ONQA 4YWGG 1FNWA 1L6UA 2IDYA 1C4PA 4A55A 1K51A 3VRAB 2IJ0A 4MM3B 1XXGA 1AWDA 1DGJA 2GRIA 4N58A 3RFZB 3LYYA 1N5WA 2AQ2B 2PVOD 1IGCA 3KWLA 1SJED 1UGJA 3VR8B 1D5ZC 1HZ6A 5HFYA 1YN5A 3PZ7A 3V3XA 1T5XD 1T6BX 4HKZE 2OHFA 5E6JA 3AE6B 3HUIA 2N7JA 1WRIA 3UI3A 2WXIA 1V1OA 3NUHB 1WGKA 5BMHA 2KMMA 1SIJA 4KKJA 5EE1A 3AEBB 3TEWA 4IDIA 3TEYA 1V1PA 2MEKA 3TEZA 1WSPA 2W55A 1PGAA 1FEHA 1EU3A 3IT4B 4JPSA 1ROEA 1ZXHA 1TS3A 4LTUA 5MPOA 1FXAA 1JWSD 1L4ZB 2BS3B 4XWWA 3V05A 1FCLA 1M4VA 3U4EG 1C4CA 2W3RA 2QSDA 2WXNA 1QOBA 1N63A 2MH7A 1NEKB 1UWMA 1FM0D 5JXVA 2CU3A 3LB8C 4US9A 2V4IB 2BYTA 1MVKA 3ZJTA 3I57A 1E6EB 1ZP0B 4IOIE 3R2IA 4RGTA 4B0MA 2K5PA 4TQ0A 1L6VA 1N62A 2XNAC 1QLBB 2H89B 3DWMA 4OZCA 2HTME 2GI9A 2M56B 4ZHOA 2BS2B 4HROA 1VDVA 1QKZA 2J42A 2WXLA 5H92C 1ZDXA 2MJ3A 1RM6C 2PVGC 1Y56A 1L0VB 2VZKB 1C9FA 1SEBD 2WQYB 2W54A 3GP7A 1JW9D 1QQRA 1EU4A 5BYQA 2L1AA 4JWUC 4R3DA 1QOGA 1STEA 1QOAA 1UWXA 1ZXIA 2WXKA 1MHXA 4TSSA 4P16A 5H8YE 2ZW0A 5C2TB 4EE2A 2I38A 2TSSA 3EGRA 1XCTL 3U7ZA 3RPFC 4A8XC 4NAMA 5G5HA 1L4DB 1C4AA 4RNAA 2MJEA 3B9JA 1GB4A 4RCOA 1MI0A 2AQ1B 3TUOA 1L0XB 3C8YA 1F2RC 4IKGA 1C77A 1FD6A 1XLPA 3AB5A 4YXDB 2QILA 4DQOC 2WXGA 3PO0A 3NVWA 1EWYC 2WDVB 3VRBB 5FKAC 1E10A 1C76A 1K50A 2BT6A 2KAJA 1OQQA 4XDDA 1IGDA 2ZW1A 4JX1C 4LLGM 1D4BA 4PT5A 2J4XA 4RGOS 2JWUA 3BVZA 3ABVB 1SXTA 3P4RB 2K3UA 1IBXB 3ZJUA 1J7AA 4GLSC 1V8CA 1HA5A 3P42A 4REZA 4HKQA 1TS4A 5BMGA 1R7SA 2V3NA 4AQ7A 1B9RA 1VZ7A 1E9MA 5EE9A 5TSSA 1KLUD 3AN1A 1J7CA 3VR9B 2INNE 1XCQL 4ARIA 1JQ4A 2BTEA 4YT0B 2EELA 3T3OA 1SE2A 3Q8AA 4UDUC 2DYOA 1B1ZA 4GDKB 1GB1A 1E7PB 4KGRA 3EUB2 1HXYD 3TSSA 4WURA 3W2DA 3SFDB 3E9SA 2MJDA 3B2GA 2N9KA 3NRZA 3IXSA 4JE3B 4JWSC 3HRDD 4OVZA 1BXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QSD A;  2JXT A;  4KGS A;  5HI1 A;  2LHD A;  2NMQ A;  4KGT A;  5JXV A;  1MVK A;  2K0P A;  2RMM A;  1JML A;  4IOI E;  3GB1 A;  2IGD A;  1YMH E;  2KN4 A;  1P7F A;  3FIL B;  1EM7 A;  4OZC A;  2GI9 A;  2J52 A;  2PTL A;  4MAC A;  1XF5 L;  1QKZ A;  2JU6 X;  1C9F A;  1HEZ E;  2QMT A;  4WH4 A;  1HZ5 A;  2ON8 A;  1UWX A;  1YNT E;  1MHX A;  1KH0 A;  2ZW0 A;  1FCC C;  1K52 A;  2I38 A;  1XCT L;  1F2R I;  2KQ4 X;  2KAC A;  2RPV A;  2JZP A;  2KDM A;  4HJG E;  1GB4 A;  1MI0 A;  1IBX A;  4OZB A;  1MPE A;  5BMI A;  1F2R C;  4IKG A;  2PW9 A;  1FD6 A;  3MP9 A;  2LUM A;  2IGG A;  2ONQ A;  2PLP A;  2OED A;  4D2K A;  1K51 A;  1PGX A;  1K50 A;  1IGD A;  2ZW1 A;  1P7E A;  1D4B A;  1IGC A;  5HFY A;  1HZ6 A;  2JSV X;  2KWD A;  3V3X A;  2JWU A;  1IBX B;  4HKZ E;  4GLS C;  2IGH A;  4OZA A;  2N7J A;  1Q10 A;  3UI3 A;  1PGB A;  5BMG A;  5BMH A;  2GB1 A;  5HHD G;  2LHE A;  1XCQ L;  2EEL A;  2J53 A;  2N9L A;  1PGA A;  1GB1 A;  4KGR A;  1ZXH A;  2LGI A;  3FIL A;  1K53 A;  1MHH E;  1FCL A;  2I2Y A;  2N9K A;  5HG2 A; 
#chains in the Genus database with same CATH topology
 3PPA A;  3AE1 B;  4WIP A;  1FFV A;  5HI1 A;  3DBH B;  1TTN A;  2LEK A;  4JLC A;  2MP2 A;  1ENF A;  4CO7 A;  2R2Q A;  1YQB A;  2D3C A;  4BFR A;  4YSZ B;  1ZE3 D;  1R4N I;  1SE3 A;  2HJ8 A;  3DHI C;  2WLB A;  1L0Y B;  1HTQ A;  1EUV B;  3ZGZ A;  1PYW D;  2CHX A;  2DYM A;  1JWA D;  3CST A;  1D3Z A;  3H7P A;  4TQ1 A;  3KW5 B;  1WFY A;  4MGY E;  4W9H A;  2L7R A;  3Q8E A;  2L8J A;  3W5V B;  1SJH D;  2L83 A;  3PSE B;  4XZ4 A;  1LXD A;  2LUM A;  4BKS A;  2OED A;  3DVN U;  2IO2 B;  2KDB A;  2KJR A;  4EOY A;  1CJE A;  2KX0 A;  4DWF A;  4GIV A;  2RR9 A;  1R4M I;  3BK2 A;  2M19 A;  4NJC A;  2LGS A;  1I4R A;  3HHM A;  5FK9 C;  3CWI A;  1KRH A;  5HHD G;  4LDT D;  1XLQ A;  3QAR A;  2WXM A;  2D3G A;  2LMC A;  2J53 A;  3NVV A;  2KWV B;  1N60 A;  2LGI A;  2L0F A;  2WXF A;  2WU2 B;  3EHV A;  4ACF A;  4EEW A;  3Q3O C;  2C7N B;  3EFC A;  5CTR C;  2IND C;  5FR6 A;  2INP E;  3MJ5 A;  2I2Y A;  4ZYN A;  4JQW C;  3A9J A;  3Q8F A;  4MJS B;  4GB9 A;  2KQS A;  2N1W A;  5AZF A;  1V1P B;  1MJD A;  4B6W A;  4LNI A;  1UNS A;  1WYW B;  3TEX A;  2WXP A;  5JHB A;  1FFU A;  3EFU A;  4AJY B;  2V4L A;  3Q3J A;  1J19 A;  3PRE A;  3Q69 A;  2G45 B;  3RZW C;  1TIF A;  3R7Q A;  3A4R A;  2KTF A;  4ZOH C;  3ZNI D;  1VRA B;  3AED B;  3NY5 A;  1VZ8 A;  3C19 A;  3RZF A;  2BYF A;  2ZCC A;  4I6L B;  4MSQ B;  3R8B A;  5KHO A;  1XLO A;  2UU7 A;  4I6N B;  2LFI A;  2K39 A;  2KDM A;  2RPV A;  4FLH A;  3TBL D;  4J3O D;  1TKG A;  3AE5 B;  4GMV A;  2MRP A;  3DVG X;  3BZD B;  3O13 A;  3DBL B;  3IFW B;  3RT3 B;  2Y5P A;  4GDK A;  4NQL B;  3DHG C;  2D2Q A;  4BZA A;  4KDL B;  3RCZ A;  2KXJ A;  2DEN B;  1LO5 D;  1NVI D;  1C1Y B;  2M0X A;  3IAM 1;  4RGM A;  1WXQ A;  3BK1 A;  2NBU A;  4NAW A;  4EZK A;  4HLE A;  3UQA A;  2IPK D;  3BVG A;  2CHZ A;  3WCQ A;  1CK1 A;  1QIL A;  2KFK A;  3E56 A;  4FJV B;  4ZRK A;  1NI2 A;  3FIL A;  4RF0 A;  3MHZ A;  3AEG B;  2IYD B;  3ZKJ C;  2LUE A;  3RMK C;  4RFB A;  4C00 A;  2K0P A;  4XDC A;  2BVC A;  3QCA A;  2O2V B;  2KK8 A;  2N9E B;  2W9N A;  1I4X A;  2AQ3 B;  4HCN B;  1ET9 A;  1VZ6 A;  3HM6 X;  4G3X B;  1WE6 A;  4HPP A;  2N7E A;  1R4N B;  4DHZ B;  3URY A;  2D07 B;  1MG4 A;  3L10 B;  2NPT A;  1UBI A;  2BWE S;  4LNO A;  3U7D A;  4N59 A;  2CR5 A;  5AEK B;  2BKF A;  4IM3 A;  4NY0 A;  3NZ3 A;  1V2Y A;  2MHJ A;  2N1V A;  3C0R B;  4YSX B;  4MEM A;  2N4F A;  2C60 A;  1RLF A;  1P0R A;  1JWM D;  1P1A A;  3TIX A;  1DYQ A;  2DWQ A;  2BW2 A;  2KQ4 X;  1Y8R C;  3NVZ A;  2AX5 A;  2SAK A;  4HJG E;  4WAF A;  3AXC A;  3O65 B;  4KDI C;  3VTV A;  2LI5 A;  5AUK A;  4O1N A;  5G5G A;  3W1S C;  4FHK A;  1EF5 A;  3L0W B;  5C23 A;  2Z59 B;  3M3J A;  1I4G A;  4YWG G;  2FCQ A;  3CF6 E;  2JY6 A;  1AWD A;  2DAJ A;  2BGF A;  4N58 A;  2B3A A;  3PS6 A;  4LNF A;  1N5W A;  4KIK B;  1SJE D;  1HZ6 A;  3MHS D;  3PZ7 A;  2QDF A;  2PEA A;  1R4M B;  3VUW A;  5E6J A;  3HUI A;  2KQ7 A;  4KZC A;  4PS3 A;  3RN9 C;  2ZJD A;  5EE1 A;  4FBJ B;  1WZ0 A;  4IDI A;  5LXI B;  3L16 A;  4JPS A;  1FEH A;  3PHX B;  5MPO A;  4LTU A;  2KDE B;  1YIW A;  4XWW A;  4G11 A;  1WE7 A;  2N9P C;  3QA8 A;  3ZXR A;  3V05 A;  4YL8 A;  1V80 A;  1E8Z A;  2PPH A;  4BOS C;  2MH7 A;  2C7H A;  1NEK B;  1UWM A;  2GBR A;  1H8C A;  4BOZ B;  4GOC A;  1WJ6 A;  2CU1 A;  2HTH A;  2CU3 A;  4US9 A;  2BYT A;  3PT2 B;  2CHW A;  3DVG Y;  3PTF C;  5G2N A;  3RNB C;  4IOI E;  2KOX A;  1T0Y A;  3DOW A;  5EDS A;  2UYZ B;  4M8N A;  2KJ6 A;  4OZC A;  2HTM E;  1MG8 A;  5E6O A;  4WJP A;  2JUO A;  2WXL A;  1I35 A;  2GBJ A;  2PVG C;  2MBQ A;  1SEB D;  1QQR A;  2IO3 B;  2XK5 A;  2L1A A;  5BYQ A;  2K6D B;  2WXK A;  3QX1 A;  3VH3 B;  1MHX A;  2ZW0 A;  4EE2 A;  1GUA B;  3OAW A;  3U7Z A;  2FID A;  4C4V B;  4RCO A;  3K9O B;  2AYO B;  2LGX A;  1YX6 B;  4IKG A;  4RM9 A;  4XGA B;  3GE8 C;  1FD6 A;  3ZDT A;  4YXD B;  2QIL A;  3NJT A;  4DQO C;  1EWY C;  2VH2 A;  3VRB B;  1E10 A;  1K50 A;  4XDD A;  4LLG M;  3N1Y C;  2J4X A;  5DPT A;  4HWI B;  3BVZ A;  1IBX B;  2K3U A;  3QAQ A;  4HKQ A;  1WM2 A;  2V3N A;  4AQ7 A;  2Z0E B;  3AN1 A;  1JQ4 A;  4YT0 B;  1LFD A;  2DYB A;  4LDT B;  1MFW A;  1HXY D;  3TSS A;  2FUH B;  5IN7 A;  2M1M A;  4WUR A;  3IHP C;  4K81 A;  3E9S A;  3B2G A;  4HVB A;  3NRZ A;  3JW0 X;  4C80 A;  2RDH A;  4I6P A;  4L1B A;  1SF0 A;  2LHD A;  1V5T A;  3VQI A;  2WS3 B;  3EA6 A;  1P9D U;  1SSN A;  3BVM A;  1SIF A;  2FUG 1;  2K22 A;  5I4D A;  4IW0 A;  1TZO A;  4YTP B;  2N7D A;  5L83 A;  1N61 A;  1XF5 L;  1WMH A;  1ZDV A;  1ZUD 2;  3ZXV A;  1HEZ E;  2JPH A;  5E6P A;  1WR1 A;  2BWF A;  4TUU A;  4HCP B;  3VTW A;  2DZI A;  2OJW A;  2RD0 A;  3Q3F A;  2BPS A;  4FHJ A;  5IAA C;  2O6V A;  4MM3 A;  2J0J A;  3FC4 A;  3ML8 A;  3W5U B;  2DBY A;  3KWV A;  4M0W B;  2G1E A;  2LVO A;  3ZW3 A;  4F1S A;  4HRS A;  1WF9 A;  1WM3 A;  3KVF B;  3AE9 B;  2JZP A;  1ZOY B;  2LAS A;  2CJO A;  5BO4 B;  3ZYY X;  1EO6 A;  4D2K A;  2E6X A;  4ICU A;  2V0G A;  1D5X C;  1TY2 A;  3RNA C;  1YD8 U;  1BUI C;  4ZRP A;  3SU8 X;  2KWD A;  3U52 E;  1J7B A;  4US8 A;  1NYR A;  1PGB A;  4DDG D;  2MCN B;  1KFY B;  4F7Z A;  1S1Q B;  1UBQ A;  3L4P A;  2ZPN A;  4NQK E;  4WQO B;  2K1F A;  1Z5S B;  2D5G A;  4RGN A;  2QCZ A;  2ZPY A;  4N9F 4;  1T0R C;  1AN8 A;  2JXT A;  3TMP B;  1SE9 A;  1GG3 A;  2V9H A;  1QOF A;  1KM7 A;  2WWZ A;  3ZJV A;  3A1Q A;  3PV1 A;  1UGM A;  2RDB C;  4F8C B;  4URK A;  4RH6 A;  1JRU A;  3W1Y A;  4WWP A;  1QZE A;  1ZPS A;  1WWT A;  4P1C C;  2NCN A;  2KLC A;  1SE4 A;  1HZ5 A;  2AWT A;  5C3J B;  4IG7 B;  2WNM A;  2NVU I;  1UZX B;  3DDC B;  3PVL A;  3JYU A;  3UIP B;  1NYQ A;  3RNG C;  2KNB A;  3N1Z C;  4W9C A;  1NI3 A;  1YNT E;  3BYT B;  1YJI A;  2HDE A;  4WQM A;  1GAQ B;  4ANU A;  2JX5 A;  5DCN A;  4K7S A;  3I9V 1;  1VJK A;  4MT5 A;  3CIR B;  2Q5W D;  3CMM B;  1OTR B;  2JYE A;  4C7Y A;  4MSM B;  1XEE A;  1WGY A;  2JZ3 B;  3WAN A;  4YTN B;  1F77 A;  3N32 A;  4OVU A;  2NBV B;  1WGH A;  5TR5 A;  1OEY J;  1AW7 A;  2CJN A;  2JYT A;  2JRI B;  1V5O A;  2ZCB A;  1Q10 A;  2NTS A;  3AV8 A;  2GB1 A;  4ZDV A;  2DHZ A;  1E0Z A;  1D6E C;  4Q2J A;  4TMA B;  5L95 C;  1A70 A;  2WXO A;  3MFG A;  2LXC A;  1WGD A;  2KC1 A;  3AE3 B;  3VFK A;  1ISN A;  1CQV A;  4MGI E;  2BQQ A;  5DPS A;  1N6Z A;  2WU5 B;  3ZTD A;  2QEJ C;  5HG2 A;  1FMA D;  4BBN F;  4ITK A;  5JH5 C;  2BB6 A;  4W9J A;  4IWQ A;  2G3Q B;  1I7H A;  4E74 A;  2K8C A;  1YQ3 B;  2OOB B;  4B0E A;  3GB1 A;  4K3B A;  1YMH E;  3AEA B;  2ZEQ A;  2LRU A;  2KTR B;  2H88 B;  4WWM A;  1Q1O A;  3AE7 B;  2XBB C;  2XEW A;  2L52 A;  1F1H A;  3SEB A;  1DOY A;  2Y3A A;  3TL5 A;  5AZG A;  3VHT C;  1OFF A;  2J7Q B;  2DNF A;  2R61 A;  2L00 B;  4P6V F;  4TKN A;  3SD5 A;  2ASQ A;  2KVZ A;  3W9C B;  4LJP B;  1K52 A;  2QIE B;  1WX8 A;  2V3P A;  2Y5C A;  1FPY A;  1F2R I;  1F52 A;  2M17 A;  4GGQ A;  4IM0 A;  2WYQ A;  3TCA A;  4OHJ A;  1I42 A;  4M00 A;  4NJ6 A;  2PE9 A;  2CKH B;  1WYG A;  4IWO A;  1L6U A;  4ZRI A;  1C4P A;  4A55 A;  2IJ0 A;  1XXG A;  3RFZ B;  3ML9 A;  4B95 A;  3VR8 B;  1YN5 A;  1L2N A;  4HKZ E;  1WR6 E;  2N7J A;  4MJS A;  2J0K A;  4DHJ D;  2WXI A;  1WGK A;  1TT5 B;  5CHF A;  1YX5 B;  4WJQ A;  2MBO A;  3AEB B;  3TEW A;  1V1P A;  2MEK A;  3TEZ A;  2GBN A;  2D3A A;  4PYU A;  1WSP A;  2W55 A;  3N30 A;  3HM3 A;  1TS3 A;  4K3C A;  2D11 A;  1L4Z B;  1WX9 A;  2HD5 B;  1WXS A;  3RNE C;  1M4V A;  1KLV A;  4GXB A;  3U4E G;  1C4C A;  2QSD A;  2L3Z A;  1N63 A;  3ZLZ A;  2ZNV C;  1FM0 D;  3A4S C;  1E8X A;  3I57 A;  1VCB A;  2QHO A;  3R2I A;  2KYW A;  4B0M A;  4W9E A;  1L6V A;  1N62 A;  2XNA C;  1QLB B;  2H89 B;  3ENE A;  3DBR I;  2M56 B;  2GI9 A;  4ZHO A;  4DK5 A;  2BYE A;  2EKE C;  1QKZ A;  2J42 A;  1V9J A;  1M94 A;  5H92 C;  3UIN B;  2MW5 A;  1WX7 A;  4DDI D;  4R3D A;  1QOG A;  2WHI A;  3OLM D;  2GLS A;  4P1B C;  4DXA B;  3ECI A;  5H8Y E;  5C2T B;  5D2M B;  3AUL A;  3SHQ A;  4NAM A;  1C4A A;  2MJE A;  1GB4 A;  2G4S A;  3H6N A;  3C8Y A;  2FNJ B;  1F2R C;  5C1Z A;  4OVV A;  3NVW A;  5IOI A;  3RUI B;  2WDV B;  3GE3 C;  3ZNH B;  4FN2 A;  4ZRJ A;  1OQY A;  1OQQ A;  1LGR A;  2QC8 A;  5D6J B;  4PT5 A;  3V6E B;  5J2R A;  4RGO S;  2JWU A;  3P4R B;  1SXT A;  2K8H A;  3ZJU A;  4BKS D;  4GLS C;  1E5W A;  1HA5 A;  3P42 A;  4REZ A;  2M8S A;  3PHW B;  4AWJ A;  1R7S A;  1VZ7 A;  1E9M A;  4M02 A;  1J7C A;  3VR9 B;  2FAZ A;  4UDU C;  2DYO A;  2O2V A;  4EFO A;  4KGR A;  3Q3M C;  3RUL A;  3W2D A;  2NS5 A;  3SFD B;  2ZNV B;  2KHW B;  4W9I A;  1XQQ A;  4HPL B;  2N9K A;  4JWS C;  2KDI A;  4OVZ A;  2V1Y A;  1XT9 B;  2KO3 A;  1L5P A;  4HPM B;  4JGH B;  2RMM A;  4G50 A;  4KZ0 A;  3N20 C;  4NZL B;  3U2S C;  4W9L A;  3N3K B;  1SB3 C;  3EEC A;  1XO3 A;  3APF A;  1WXA A;  2WP9 B;  4MAC A;  1WXM A;  3VVW B;  4A3P A;  3BWU D;  3WA0 A;  5J18 A;  3U30 A;  4GDL B;  3A9K B;  1GPX A;  4FAD A;  2JXX A;  2QJL A;  3WAL A;  2WXQ A;  3IAS 1;  4LCD E;  1JWB D;  3ZRF A;  2KWC A;  2DLB A;  1PQS A;  4W9F A;  4KIK A;  4C56 C;  3V6C B;  1NEN B;  1V49 A;  3VH4 B;  3CSF A;  2HJ1 A;  3AE4 B;  2WXR A;  3ALB A;  2PW9 A;  4W9K A;  1ESF A;  1BML C;  3KUD B;  2PLP A;  4L2Y A;  2YEP B;  3DQV A;  2KWU B;  3KYD D;  1JRP A;  1BT0 A;  4BVU C;  3BII D;  1PGX A;  3ETR A;  5D3D A;  2E3T A;  2JSV X;  5LXH A;  1CZP A;  1OGW A;  2M4N A;  2MWS B;  4ZYS A;  3WAP A;  3M63 B;  2PKO A;  1E8Y A;  3GS2 A;  3DBS A;  4HEA 1;  5LNK 1;  1I4Q A;  3AEE B;  1IP9 A;  4DXG A;  3PGE A;  2FBW B;  3V61 A;  4LJO B;  4MH8 A;  3BY4 B;  3AE2 B;  2PIA A;  1I4H A;  2G4D B;  1TS5 A;  3AU4 A;  2YEP F;  1RYJ A;  4YTM B;  4XWT A;  3T3N A;  1J0G A;  1EM7 A;  3SFE B;  3H1U A;  3IT6 B;  2PTL A;  3X0W A;  3DBR B;  4LNK A;  3W1S A;  2K9X A;  2WDT B;  2WX0 A;  4C4V A;  2IO0 B;  5AUI A;  3T9L A;  2WXJ A;  3AEF B;  4II2 B;  3R7R A;  2OJR A;  1FO4 A;  4IC7 B;  4CQN A;  1PDX A;  1FCC C;  4W9D A;  3OJ3 A;  2KD0 A;  3AH7 A;  4M8M A;  2AL3 A;  2KAC A;  2X38 A;  2WX1 A;  3Q6B A;  1TKY A;  3L17 A;  1IBX A;  4FA6 A;  3NZS A;  1ACC A;  4MH0 E;  1JCK B;  3BIN A;  3JSV B;  1CMX B;  1ZKH A;  4H2A A;  2IGG A;  2V3S A;  4ZRQ A;  1V86 A;  1FNU A;  2L32 A;  4YSY B;  5CX3 A;  2L05 A;  2K6Q A;  3VXW A;  1E90 A;  3ZNG C;  2PMV A;  1A5R A;  1P7E A;  4E3C A;  2JF5 A;  2ZVO A;  4K7W A;  4BKG A;  4BBN C;  4TV3 A;  4DHJ B;  2WXH A;  3QQ8 B;  2NTT A;  3B2F A;  3BYY B;  2JQR B;  3IVF A;  1QF6 A;  1FRD A;  3DPD A;  1E8W A;  1SGH A;  1AYF A;  3VDZ A;  3V62 A;  2ICI A;  5BYR A;  2FIF A;  2HE7 A;  3PZD A;  1WJ4 A;  2A4Z A;  1F0Z A;  1FRR A;  1RFK A;  2IGD A;  1FNV A;  2UWQ A;  1EWC A;  4S17 A;  4B9K A;  1P7F A;  3NZU A;  2XN9 C;  2KMA A;  4M0W A;  3QIJ A;  3ZO5 B;  4J6I A;  2QMT A;  3OWE B;  1FIQ A;  2B76 B;  3GOE A;  1TJE A;  1GC6 A;  4ANW A;  1K8R B;  1S3S G;  2IBI B;  2MP2 B;  2JT4 B;  3MC9 A;  3NVY A;  4MGZ E;  3N1X C;  3IG3 A;  4II3 B;  4P7I A;  1TBE A;  1JAL A;  3APC A;  3P63 A;  4C7Z A;  2DZK A;  3ZNZ B;  1U4A A;  5JHA A;  2FCM A;  2Z0D B;  1YN4 A;  1PFD A;  5E6N A;  4IM2 A;  1IUE A;  3HK0 A;  1UUP A;  3H7P B;  2VH1 A;  1DGJ A;  2GRI A;  1IGC A;  3Q2A C;  1UGJ A;  1X1M A;  1V81 A;  1T5X D;  2OHF A;  3AE6 B;  1WRI A;  2REX A;  3NUH B;  2KMM A;  1SIJ A;  4KKJ A;  1KJT A;  2JRH A;  2I1K A;  4AJW A;  3RNF C;  4ASW C;  1UEL A;  1PGA A;  1ZXH A;  2EMS A;  1JWS D;  2BS3 B;  4BAX A;  2C7M B;  3Q14 C;  4EZJ A;  2GMI C;  3RNC C;  3V60 A;  3AI5 A;  2WXN A;  1QOB A;  3DHH C;  5DPR A;  2VRR B;  2YVC A;  3LB8 C;  3ZJT A;  1LM8 B;  2I1J A;  2PJH A;  4ANV A;  4RGT A;  3H9D A;  1WJN A;  1L7Y A;  1RAX A;  2BS2 B;  2KC2 A;  4HRO A;  4AUQ C;  1VDV A;  3I63 C;  1ZDX A;  3A9J B;  2X8X X;  4IWP A;  2MBH A;  1Z2M A;  1EU4 A;  4AP4 C;  4JWU C;  4MGK E;  2MSE D;  4FUL A;  3UQB A;  2YLM A;  2LVQ A;  3X23 A;  3EGR A;  3RPF C;  5G5H A;  1L4D B;  3GZN I;  2GBM A;  4RNA A;  2L0T A;  1MI0 A;  3TUO A;  1L0X B;  3ZUN A;  2O6V D;  1G6J A;  2BF8 B;  2WXG A;  3PO0 A;  3UIO B;  3KUZ A;  4NPN A;  3B0A A;  2KFJ A;  4K1R B;  3VUY A;  3PRZ A;  1RRB A;  2KAJ A;  1NDD A;  1Q0W B;  1IGD A;  2ZW1 A;  4JX1 C;  3MC8 A;  5JZE B;  3ABV B;  1V8C A;  1ZGU B;  2DX5 B;  1TS4 A;  2LVP A;  1Q5W B;  5EE9 A;  1KLU D;  4ARI A;  2BTE A;  1SE2 A;  1WY8 A;  2NBW B;  3Q8A A;  4GDK B;  1GB1 A;  1E7P B;  2IY1 B;  5G55 A;  2KTR A;  3RI7 C;  3L54 A;  3B1L X;  1WGG A;  2MJD A;  2JWZ A;  4PS7 A;  3VTU A;  3IXS A;  3PRP B;  1WH3 A;  3HRD D;  1HQR D;  4NJ7 A;  4NAW B;  4KGT A;  1E7V A;  3D32 A;  1HE8 A;  2JVC A;  1JML A;  2KFK B;  2G9H D;  1FXI A;  3R2T A;  1YJ1 A;  2RDG A;  3FIL B;  3L08 A;  2VZK D;  2N9X A;  3R66 C;  3Q3N C;  4E71 A;  1C79 A;  4CYE A;  4NNJ B;  5D3I B;  4A20 A;  2ZVN A;  3S2A A;  4WH4 A;  1FXT B;  2Y5B B;  2LRW A;  2AL6 A;  2DZM A;  2LGD A;  1JWU D;  5AZH A;  4A6Q A;  4GSW A;  4W9G A;  4LNN A;  1TY0 A;  3L13 A;  3PZ8 A;  4XC2 A;  4EUT A;  3RD2 A;  1DOX A;  1V97 A;  4HK2 A;  3MJW A;  4HXD A;  3WAO A;  3Q8C A;  2L76 A;  4KSK C;  4KX6 B;  3ZRC A;  1KLG D;  4A9A A;  2NPT B;  2WDQ B;  2PE6 B;  3HVZ A;  2JZZ A;  2BBC A;  1LQB A;  4JL9 A;  3MTN B;  3Q8B A;  2M0A A;  4N6E B;  1TS2 A;  3IBE A;  3AM9 A;  1WGR A;  4BKT A;  3NS8 A;  4GU2 A;  1H4R A;  2IGH A;  4OZA A;  2KN5 A;  1YJJ A;  2LXA A;  4A90 A;  2LJ5 A;  3P1M A;  2LHE A;  4FJY A;  3A33 B;  1WXV A;  3KLS X;  3HIZ A;  3DWG C;  1GC7 A;  4LK0 M;  1IPG A;  1GNU A;  3NOB A;  2LWP A;  5CHV C;  1XLN A;  1K53 A;  2MBE A;  3P4S B;  5T8I A;  1YQ4 B;  1EF1 A;  5EE0 A;  3T8M A;  2K25 A;  4HDO A;  1E7U A;  4WJO A;  3FKY A;  4KGS A;  4XE0 A;  2C5L C;  2NMQ A;  2KX3 A;  3VUX A;  1TKE A;  1F9J A;  5GXG B;  2D3B A;  4K7U A;  4QAY A;  1KOT A;  3QJZ A;  1SBB B;  2W82 A;  1QT9 A;  3NS1 A;  3UF8 A;  2J52 A;  4WWN A;  3P4Q B;  3QHT A;  3U8Z A;  2ON8 A;  3MC0 B;  4RM8 A;  1C78 A;  2IO1 B;  1UH6 A;  4RF1 A;  2BS4 B;  3HVD A;  3SR6 A;  4KKI A;  1KH0 A;  1XD3 B;  4AS1 A;  3EC8 A;  2WGS A;  3ZQ4 A;  1OQR A;  3GZN B;  5HKH A;  5EE3 A;  1JRO A;  1J8C A;  1MPE A;  5BMI A;  4A3O A;  3OJ4 B;  2XK5 B;  3UGB B;  3MP9 A;  1UD7 A;  3OG5 A;  2BKR B;  4KV2 A;  2KVR A;  2W3S A;  1YN3 A;  2BYV E;  3P4P B;  4MEL A;  3ZVV A;  4KVG B;  3KYC D;  3SDL C;  1RFA A;  2A5U A;  5IKC M;  4ARC A;  5IO9 A;  1RWS A;  3ZIM A;  3AE8 B;  3I3T B;  2N0S B;  4RMA A;  2BB5 A;  2N9L A;  3LXF A;  3N9Y C;  4USA A;  2RSU A;  3AEC B;  1KF6 B;  3AMZ A;  1TGZ B;  4HJK A;  1MHH E;  2NR2 A;  4G0N B;  2Z8L A;  1I4P A;  3QK0 A;  3DVN V;  1TYG B;  2FE8 A;  1DOI A;  5DPW A;  3DBH I;  4GDL A;  3A9K A;  4L23 A;  2FCS A;  3LJ3 A;  1WJU A;  2DZJ A;  4FXC A;  2KN4 A;  2MLB A;  4EKU A;  4PS8 A;  4KSL C;  2FCN A;  3FAH A;  2J0M A;  3J9C A;  3NG0 A;  1VR9 A;  5FR3 A;  2LD9 A;  1WI0 A;  5BYS A;  4CHK A;  3KH0 A;  2JU6 X;  5D7G A;  4X57 B;  2KLG A;  1VLB A;  1D5M C;  2DAF A;  4DXF A;  3K9P B;  2ACZ B;  2RPQ A;  3KQ4 A;  3WIM A;  1TZ1 A;  2KAN A;  3LDZ E;  4IUM B;  4WWO A;  2IY0 B;  1N5X A;  2EKI A;  4ZHP A;  2LJI A;  3JVZ X;  3QC8 B;  1NBF C;  4MDK E;  2INC C;  1WMH B;  1V6E A;  2D10 A;  2WDR B;  2MA9 B;  3PLU A;  4OZB A;  1P3Q U;  3NHE B;  1ET6 A;  1GOZ A;  3VAW A;  4OW0 A;  2SEB D;  1KTK A;  1T3Q A;  3H8H A;  1PUT A;  2IZV B;  2ONQ A;  1FNW A;  4S0R A;  3M62 B;  2IDY A;  1K51 A;  3VRA B;  2O6V B;  4MM3 B;  3KUC B;  1ZW7 A;  2AEH A;  3LYY A;  4PK1 A;  2PVO D;  2AQ2 B;  3KWL A;  5HFY A;  1D5Z C;  2GBK A;  3WAM A;  2EMT A;  3V3X A;  1T6B X;  1T0S C;  1VD2 A;  1AAR A;  1P98 A;  2KKC A;  3UI3 A;  1V1O A;  5BMH A;  4GN1 A;  1OEY A;  4XX5 A;  2LGY A;  3TEY A;  1WIA A;  3IT4 B;  1EU3 A;  1ROE A;  3ZDM C;  1FXA A;  1FCL A;  2KDF B;  4JIO U;  2ZZP B;  2W3R A;  1WRD B;  4ICV A;  4AOF A;  5KHQ A;  5JXV A;  2V4I B;  1MVK A;  1E6E B;  3PLV A;  1ZP0 B;  2KMC A;  3B08 A;  2K5P A;  4TQ0 A;  3DWM A;  4FJZ A;  2MJ3 A;  1RM6 C;  4PYZ A;  1Y56 A;  1L0V B;  2VZK B;  1C9F A;  2WQY B;  5GMV A;  2W54 A;  3JSV A;  2RGF A;  1JW9 D;  3GP7 A;  3P2B A;  3M95 A;  1STE A;  3A1Q B;  1QOA A;  1UWX A;  1ZXI A;  1WZ3 A;  1GJZ A;  5LLI A;  2KT7 A;  5IP4 D;  4TSS A;  4P16 A;  2I38 A;  2K8B A;  2TSS A;  1XCT L;  4A8X C;  3QWZ B;  5D94 A;  4WAA A;  2LZ6 A;  4XYC A;  2MQJ A;  3B9J A;  3APD A;  2AQ1 B;  2C9W B;  4ANX A;  4M01 A;  3ZTC A;  1C3T A;  1C77 A;  3H7S A;  1XLP A;  5CHW A;  2MBB B;  3AB5 A;  3DBL I;  1YOV B;  4DHZ E;  5FKA C;  1UF0 A;  4EZL A;  1C76 A;  2BT6 A;  3RYT A;  1T0Q C;  2CS4 A;  3TJP A;  2R2O A;  2KZR A;  1D4B A;  3R3M A;  4WJN A;  4DBG A;  3ONS A;  1J7A A;  2KJH B;  1IYF A;  3DCG A;  5J17 A;  5BMG A;  1B9R A;  5TSS A;  2INN E;  1XCQ L;  2EEL A;  3AU5 A;  3T3O A;  2MX2 A;  1B1Z A;  2GOW A;  3EUB 2;  1HTO A;  4HDQ A;  5IA7 A;  3PRM B;  4JE3 B;  3I5J C;  1BXT A; 
#chains in the Genus database with same CATH homology
 4C80 A;  3AE1 B;  2RDH A;  4L1B A;  1HQR D;  4WIP A;  1FFV A;  1SF0 A;  5HI1 A;  4NAW B;  2LHD A;  4KGT A;  3VQI A;  1L5P A;  2LEK A;  2RMM A;  2WS3 B;  3EA6 A;  1JML A;  1SSN A;  2G9H D;  1ENF A;  4NZL B;  3U2S C;  1FXI A;  3BVM A;  3R2T A;  1SB3 C;  2FUG 1;  2K22 A;  5I4D A;  2RDG A;  3FIL B;  1XO3 A;  1TZO A;  4YTP B;  4YSZ B;  2VZK D;  1ZE3 D;  1SE3 A;  2WP9 B;  4MAC A;  1C79 A;  1N61 A;  2WLB A;  1XF5 L;  1L0Y B;  1ZDV A;  1ZUD 2;  5D3I B;  1HEZ E;  3ZGZ A;  4WH4 A;  1PYW D;  3BWU D;  4GDL B;  1JWU D;  2DYM A;  1JWA D;  1GPX A;  2QJL A;  4A6Q A;  2WXQ A;  3IAS 1;  1TY0 A;  1JWB D;  3PZ8 A;  1DOX A;  1V97 A;  4TQ1 A;  2DLB A;  3FC4 A;  3W5U B;  2DBY A;  3KWV A;  2G1E A;  3Q8C A;  4HRS A;  4C56 C;  4KX6 B;  1NEN B;  2JZP A;  3AE9 B;  1KLG D;  3Q8E A;  1ZOY B;  4A9A A;  2CJO A;  3W5V B;  1SJH D;  2L83 A;  3AE4 B;  2WDQ B;  2WXR A;  3HVZ A;  2PW9 A;  3ZYY X;  1ESF A;  1BML C;  2BBC A;  2LUM A;  2PLP A;  4L2Y A;  2YEP B;  2OED A;  1JRP A;  3Q8B A;  4D2K A;  3BII D;  2E6X A;  1PGX A;  3ETR A;  2M0A A;  1CJE A;  2V0G A;  1D5X C;  1TY2 A;  4N6E B;  5D3D A;  1TS2 A;  2E3T A;  1BUI C;  4ZRP A;  2JSV X;  2KWD A;  3AM9 A;  3BK2 A;  3U52 E;  1J7B A;  1CZP A;  2M19 A;  4NJC A;  1I4R A;  2IGH A;  4OZA A;  5FK9 C;  3CWI A;  4US8 A;  1NYR A;  1PGB A;  1KFY B;  4ZYS A;  1KRH A;  1YJJ A;  5HHD G;  4A90 A;  3P1M A;  1XLQ A;  2LHE A;  3L4P A;  2PKO A;  2WXM A;  2LMC A;  3KLS X;  2J53 A;  3NVV A;  3DWG C;  3GS2 A;  4LK0 M;  1N60 A;  2LGI A;  2D5G A;  2WXF A;  2WU2 B;  4RGN A;  1XLN A;  1K53 A;  3P4S B;  4HEA 1;  5LNK 1;  5T8I A;  1YQ4 B;  1I4Q A;  2INP E;  3MJ5 A;  2I2Y A;  5EE0 A;  3AEE B;  4DXG A;  1AN8 A;  2JXT A;  3Q8F A;  4XE0 A;  4KGS A;  2FBW B;  4MH8 A;  1QOF A;  2NMQ A;  3AE2 B;  1TKE A;  2PIA A;  3ZJV A;  5GXG B;  1V1P B;  1I4H A;  1TS5 A;  1UNS A;  2YEP F;  1SBB B;  1RYJ A;  4YTM B;  4XWT A;  3T3N A;  1EM7 A;  2W82 A;  4RH6 A;  3SFE B;  3TEX A;  2WXP A;  1QT9 A;  3NS1 A;  3IT6 B;  2J52 A;  2PTL A;  1ZPS A;  3W1S A;  1WWT A;  2K9X A;  1FFU A;  3P4Q B;  1SE4 A;  1HZ5 A;  2ON8 A;  5AUI A;  3MC0 B;  5C3J B;  3Q69 A;  2WNM A;  1C78 A;  2WXJ A;  3AEF B;  1NYQ A;  1NI3 A;  4RF1 A;  2BS4 B;  3HVD A;  1YNT E;  4ZOH C;  1VRA B;  3SR6 A;  3AED B;  1FO4 A;  3BYT B;  4KKI A;  1KH0 A;  4CQN A;  1PDX A;  1VZ8 A;  1FCC C;  1YJI A;  4AS1 A;  2HDE A;  4WQM A;  3R8B A;  3AH7 A;  1XLO A;  1GAQ B;  3ZQ4 A;  2KAC A;  2X38 A;  2LFI A;  2RPV A;  2KDM A;  1OQR A;  1TKY A;  2JX5 A;  5EE3 A;  1IBX A;  1JRO A;  4J3O D;  1ACC A;  1MPE A;  5BMI A;  1JCK B;  1VJK A;  3I9V 1;  4MT5 A;  1TKG A;  3AE5 B;  3CIR B;  4H2A A;  3MP9 A;  2Q5W D;  2IGG A;  4C7Y A;  2JYE A;  3BZD B;  4ZRQ A;  3O13 A;  1FNU A;  1XEE A;  2L32 A;  4YSY B;  4YTN B;  1F77 A;  2W3S A;  2Y5P A;  1YN3 A;  3P4P B;  2PMV A;  1P7E A;  1AW7 A;  2CJN A;  2JYT A;  1LO5 D;  1NVI D;  4ARC A;  1RWS A;  3IAM 1;  1Q10 A;  2NTS A;  4RGM A;  1WXQ A;  3AV8 A;  3BK1 A;  2GB1 A;  3AE8 B;  2IPK D;  3BVG A;  1E0Z A;  1D6E C;  4Q2J A;  3WCQ A;  1CK1 A;  2N0S B;  1QIL A;  2BB5 A;  4TMA B;  3E56 A;  2N9L A;  1A70 A;  2WXH A;  3LXF A;  2WXO A;  3N9Y C;  4USA A;  2NTT A;  3AEC B;  3MFG A;  3FIL A;  3B2F A;  3BYY B;  1KF6 B;  3AE3 B;  3AMZ A;  4RF0 A;  1MHH E;  1CQV A;  2JQR B;  2WU5 B;  3MHZ A;  2QEJ C;  5HG2 A;  2Z8L A;  3AEG B;  1QF6 A;  1I4P A;  1FMA D;  1FRD A;  4ITK A;  1TYG B;  2FE8 A;  1AYF A;  1DOI A;  2BB6 A;  4L23 A;  4RFB A;  1I7H A;  2ICI A;  1YQ3 B;  2K0P A;  4XDC A;  5BYR A;  4B0E A;  1F0Z A;  4FXC A;  1FRR A;  1RFK A;  3GB1 A;  2IGD A;  1FNV A;  1EWC A;  1YMH E;  2KN4 A;  3AEA B;  1I4X A;  1P7F A;  2AQ3 B;  2H88 B;  3FAH A;  4WWM A;  1ET9 A;  1VZ6 A;  3AE7 B;  2XN9 C;  3J9C A;  4M0W A;  1VR9 A;  5FR3 A;  2L52 A;  5BYS A;  3URY A;  2JU6 X;  5D7G A;  3SEB A;  1DOY A;  1VLB A;  1D5M C;  2QMT A;  2Y3A A;  3OWE B;  1FIQ A;  2B76 B;  4DXF A;  1OFF A;  4N59 A;  2ACZ B;  2R61 A;  4P6V F;  3KQ4 A;  1TJE A;  3NZ3 A;  4YSX B;  3NVY A;  1N5X A;  2EKI A;  4ZHP A;  2LJI A;  3W9C B;  1JWM D;  1K52 A;  2QIE B;  2V3P A;  1DYQ A;  2DWQ A;  2Y5C A;  2BW2 A;  1JAL A;  1F2R I;  2KQ4 X;  3NVZ A;  3P63 A;  4C7Z A;  2AX5 A;  2SAK A;  4HJG E;  4WAF A;  2WDR B;  4OZB A;  1YN4 A;  5AUK A;  1PFD A;  4O1N A;  5G5G A;  4OHJ A;  1IUE A;  1ET6 A;  1GOZ A;  4OW0 A;  1WYG A;  1UUP A;  1KTK A;  1T3Q A;  2SEB D;  1PUT A;  3H8H A;  1I4G A;  2ONQ A;  4YWG G;  1FNW A;  1L6U A;  2IDY A;  1C4P A;  4A55 A;  1K51 A;  3VRA B;  2IJ0 A;  4MM3 B;  1XXG A;  1AWD A;  1DGJ A;  2GRI A;  4N58 A;  3RFZ B;  3LYY A;  1N5W A;  2AQ2 B;  2PVO D;  1IGC A;  3KWL A;  1SJE D;  1UGJ A;  3VR8 B;  1D5Z C;  1HZ6 A;  5HFY A;  1YN5 A;  3PZ7 A;  3V3X A;  1T5X D;  1T6B X;  4HKZ E;  2OHF A;  5E6J A;  3AE6 B;  3HUI A;  2N7J A;  1WRI A;  3UI3 A;  2WXI A;  1V1O A;  3NUH B;  1WGK A;  5BMH A;  2KMM A;  1SIJ A;  4KKJ A;  5EE1 A;  3AEB B;  3TEW A;  4IDI A;  3TEY A;  1V1P A;  2MEK A;  3TEZ A;  1WSP A;  2W55 A;  1PGA A;  1FEH A;  1EU3 A;  3IT4 B;  4JPS A;  1ROE A;  1ZXH A;  1TS3 A;  4LTU A;  5MPO A;  1FXA A;  1JWS D;  1L4Z B;  2BS3 B;  4XWW A;  3V05 A;  1FCL A;  1M4V A;  3U4E G;  1C4C A;  2W3R A;  2QSD A;  2WXN A;  1QOB A;  1N63 A;  2MH7 A;  1NEK B;  1UWM A;  1FM0 D;  5JXV A;  2CU3 A;  3LB8 C;  4US9 A;  2V4I B;  2BYT A;  1MVK A;  3ZJT A;  3I57 A;  1E6E B;  1ZP0 B;  4IOI E;  3R2I A;  4RGT A;  4B0M A;  2K5P A;  4TQ0 A;  1L6V A;  1N62 A;  2XNA C;  1QLB B;  2H89 B;  3DWM A;  4OZC A;  2HTM E;  2GI9 A;  2M56 B;  4ZHO A;  2BS2 B;  4HRO A;  1VDV A;  1QKZ A;  2J42 A;  2WXL A;  5H92 C;  1ZDX A;  2MJ3 A;  1RM6 C;  2PVG C;  1Y56 A;  1L0V B;  2VZK B;  1C9F A;  1SEB D;  2WQY B;  2W54 A;  3GP7 A;  1JW9 D;  1QQR A;  1EU4 A;  5BYQ A;  2L1A A;  4JWU C;  4R3D A;  1QOG A;  1STE A;  1QOA A;  1UWX A;  1ZXI A;  2WXK A;  1MHX A;  4TSS A;  4P16 A;  5H8Y E;  2ZW0 A;  5C2T B;  4EE2 A;  2I38 A;  2TSS A;  3EGR A;  1XCT L;  3U7Z A;  3RPF C;  4A8X C;  4NAM A;  5G5H A;  1L4D B;  1C4A A;  4RNA A;  2MJE A;  3B9J A;  1GB4 A;  4RCO A;  1MI0 A;  2AQ1 B;  3TUO A;  1L0X B;  3C8Y A;  1F2R C;  4IKG A;  1C77 A;  1FD6 A;  1XLP A;  3AB5 A;  4YXD B;  2QIL A;  4DQO C;  2WXG A;  3PO0 A;  3NVW A;  1EWY C;  2WDV B;  3VRB B;  5FKA C;  1E10 A;  1C76 A;  1K50 A;  2BT6 A;  2KAJ A;  1OQQ A;  4XDD A;  1IGD A;  2ZW1 A;  4JX1 C;  4LLG M;  1D4B A;  4PT5 A;  2J4X A;  4RGO S;  2JWU A;  3BVZ A;  3ABV B;  1SXT A;  3P4R B;  2K3U A;  1IBX B;  3ZJU A;  1J7A A;  4GLS C;  1V8C A;  1HA5 A;  3P42 A;  4REZ A;  4HKQ A;  1TS4 A;  5BMG A;  1R7S A;  2V3N A;  4AQ7 A;  1B9R A;  1VZ7 A;  1E9M A;  5EE9 A;  5TSS A;  1KLU D;  3AN1 A;  1J7C A;  3VR9 B;  2INN E;  1XCQ L;  4ARI A;  1JQ4 A;  2BTE A;  4YT0 B;  2EEL A;  3T3O A;  1SE2 A;  3Q8A A;  4UDU C;  2DYO A;  1B1Z A;  4GDK B;  1GB1 A;  1E7P B;  4KGR A;  3EUB 2;  1HXY D;  3TSS A;  4WUR A;  3W2D A;  3SFD B;  3E9S A;  2MJD A;  3B2G A;  2N9K A;  3NRZ A;  3IXS A;  4JE3 B;  4JWS C;  3HRD D;  4OVZ A;  1BXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...