1SE4A

Staphylococcal enterotoxin b complexed with lactose
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
239
structure length
239
Chain Sequence
b'ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN B
publication title Residues defining V beta specificity in staphylococcal enterotoxins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 66
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 1997-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1se4A01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1se4A02
1EFID 1EEFD 1SXTA 1CHQD 1HA5A 1ET9A 1FD7D 1CHPD 1I4QA 1G8ZD 1ESFA 1LT4D 1SEBD 4RGMA 3DWQA 1B44D 1EU4A 3MC0B 2AQ2B 1TS5A 1HTLD 2QILA 1FNWA 1CQVA 2RDHA 1HQRD 4O1NA 1LTSD 2R61A 4Z9CB 5ELCA 1B1ZA 1BCPD 3R2IA 1I4HA 1KLGD 4ZYSA 1YN3A 1BXTA 1SBBB 1JWMD 1CK1A 1BCPB 3EFXD 2WV6D 2NTTA 1S5BD 1S5DD 1L0YB 4L63B 4UDUC 3OWEB 5D3IB 1LTTD 1D5ZC 4RGTA 1F77A 1PTOH 2RDGA 1DJRD 1FNVA 1LO5D 2SEBD 4RGNA 1D6EC 1YN4A 1LT6D 5ELEA 5ELDA 1DYQA 1JWSD 1L0XB 1LTGD 3V05A 1T5XD 1PTOD 5D3DA 1BCPC 1EWCA 5TSSA 2O2LD 1UNSA 3O13A 5FK9C 4TSSA 1TY0A 1HXYD 3URYA 2Z8LA 2XRSD 4RGOS 1BCPF 1PTOB 3DWAA 1AW7A 1LTAD 3EA6A 1I4RA 1CT1D 1LTRD 2AQ3B 4BWGB 1TY2A 1ENFA 1LT5D 3BVZA 2IPKD 1PYWD 1AN8A 3MFGA 1M4VA 1V1PA 3GP7A 4L6TB 1YN5A 4RH6A 3TSSA 4K6LA 4DXFA 1PZJD 1JR0D 3BZDB 1D5XC 1EEID 2QEJC 1FNUA 4NZLB 1PTOC 3BYYB 5ELBA 1PZKD 3R2TA 3SEBA 1QILA 1PRTD 1TS2A 1PRTF 1PTOF 2J4XA 1KTKA 1SE2A 1SE3A 2IJ0A 4RFBA 1PRTB 1GOZA 1S5ED 1I4GA 1JQYD 4DXGA 2CHBD 4RHSA 4RHRA 3BYTB 1MD2D 1FGBD 1I4PA 3BVGA 1V1PB 1RCVD 1JCKB 4RCOA 1D5MC 1SJED 1EU3A 1LT3D 2G9HD 3KLSX 5FKAC 5I4DA 1LTID 1KLUD 2XNAC 1PRTC 1UUPA 1PZID 2ICIA 3CHBD 1I4XA 4C56C 4OHJA 3DWPA 1V1OA 2TSSA 5ELFA 1S5CD 2NTSA 1SE4A 2XN9C 1LLRD 1ET6A 1RD9D 1STEA 3BVMA 1RDPD 1TS4A 1XXGA 3W2DA 1RF2D 1XTCD 1SJHD 1S5FD 2XRQD 2AQ1B 1JWUD 3R8BA 1LTBD 1TS3A
chains in the Genus database with same CATH superfamily
1SXTA 4ZAIA 3CF5A 1ET9A 3K5MA 2O2VA 2Z6KA 1SEBD 4BBSG 3VAWA 3W9CB 3AULA 2KVMA 2PYKA 1EU4A 2NVYH 2JA6G 1QOGA 1GUNA 1QUQB 3PSIA 3HOZH 4MT5A 1NMFA 1TWCH 5E4WC 4PMCA 5G3LF 4O1NA 4A3KB 3IL8A 4LUZA 5ELCA 5KYLA 4LNQA 2D07B 3A9JA 4DV4L 1SN8A 4TQ1A 4CBVA 2R93B 4JQWC 4TKOB 2AWOA 3ZJTA 2LXCA 1UE6A 2OF1A 3PT2B 3SK4A 2CFMA 1VQAA 1T0SC 3VHTC 1S5BD 2V0GA 5C2TB 2DBYA 3SK6A 1SNQA 4RAUC 5IP7G 2PQEA 4BFRA 2Q2IA 3OWEB 4PMBA 1AZQA 4IPGA 1Q5WB 3CU7A 5C0XJ 5FO7B 1WM2A 4LNKA 1NSNS 4Y52H 1IYVA 3HHMA 3NUHB 1B3QA 3NJTA 4BBSH 3Q3MC 4AIMA 4OVVA 5AJ3L 3AXCA 3K5LA 2JA6H 4M8MA 3BG3A 4W9FA 4FHJA 5J3BA 3O65B 5ELDA 5FLXE 3ZYYX 1N32L 2ZTDA 3N9YC 5IODA 2YTVA 2MQHA 4YCVA 1S72A 4NQKE 1QOAA 4IUUA 3R3MA 2ZXOA 3MA2B 4DV7L 3S2HH 5JXVA 4PS7A 3J81i 3K58A 3RNUA 4JI4L 1EIHA 5EKIA 1ZGUB 4JLCA 3RNEC 4AUQC 1AFPA 4FXCA 5IP7H 5LXHA 1C4AA 4U68A 2WXLA 1TY2A 3M4OH 2CU3A 4Q2JA 3ZRFA 1WTOA 3DWGC 5I9OA 3S17B 1EQVA 4JWUC 4ICUA 2FHTA 1SNMA 5C44G 5E6PA 1V8CA 3KQ4A 3M4QA 3BZDB 1XD3B 1N33L 2XEWA 3VUYA 2VB3X 3P42A 1SIJA 1KAWA 1ML0D 2F4IA 2K4KA 3TS0A 5IT9L 3X23A 2M2LA 4X62Q 2EELA 1SMXA 3HM6X 4DR7Q 3VTUA 4A90A 1TWFH 1PGBA 5AZGA 1V6EA 1PQSA 1YZ6A 2IJ0A 1F2ZA 2KHIA 4I7AA 4X64L 1XF5L 2M0AA 3S16H 4MN3A 1MSGA 3J9CA 4N9TA 4Q0FA 2X6GA 1WTPA 2O5IC 1BUIC 2N78A 3BYTB 3FPPA 5J1ZA 2K9XA 4R4IA 2RMMA 4JI8L 3MZ5A 2M0XA 1UEAB 3UDXA 5C44H 4LFCQ 4XDDA 3ERSX 3TP5A 4DR1L 2L8JA 1AE3A 3MEHA 1EU3A 5JOBA 4IOAA 1EY0A 3TREA 2R7ZH 2MLBA 3Q3JA 5J18A 5C3WA 3GTLH 1VMPA 2AX5A 2Z0DB 2L83A 3U52E 3L0OA 4IALA 1SSOA 2D10A 1V1OA 4YHHQ 1YEZA 1S5CD 4PK1A 2IO1B 5IGGA 3NZ3A 3A7LA 1L0VB 4K1RB 2AKWB 2I5HA 4QF4A 2B2TC 1TS4A 2I1KA 3K0YA 1R9TH 2LVOA 3RLFA 4JK1C 2ENBA 2J0MA 2CHZA 3Q22A 3KF6A 2KFKA 1CJEA 2WGSA 2K75A 3RUZA 4WWOA 1F9SA 1QZEA 1YVCA 1CA6A 5CHFA 3RD2A 3OTOL 1WGGA 1EYAA 2L0CA 4A3KG 4AQYQ 2UUBL 1WRDB 3RCZA 4DV1L 3VRBB 4NJ6A 4B3TQ 1ZW7A 2ALYB 4GN4B 2A1AA 4A3LG 3PO2B 2MJ3A 3PZ8A 2KHWB 1Q86C 1CQVA 3A9KA 1H9RA 4R4CA 4ID6A 5HI1A 2NR2A 3VR8B 1EFWA 2BB5A 5EGTA 4LF4L 1IYUA 3U4VA 1CKNB 4DR3L 4BY7G 2RBMA 2WXKA 5I9PA 1O7ZA 1ZUD2 1JWMD 1KM7A 2EYLA 4DV2L 3AEEB 4X3SA 2EJGC 2KDFB 1U4LA 1S5DD 4K5VA 3ITPA 4HIOA 2PVGC 2K5HA 2ZW1A 5GADC 5IGBA 4A3KH 2PI2A 1N6ZA 3A4RA 1B50A 3S1RB 3KFUA 1F9PA 2RDGA 3I57A 3QJYA 1TZ1A 4JOIC 5D2MB 1WIAA 2NMQA 1D6EC 2XWBB 3A74A 3W3AA 4WORA 4A3FB 2N9LA 2BVCA 5LMNW 5HY6A 3T51B 4CGYB 1WGDA 2WB1G 4DV5L 3SHLA 4NAWB 1WGKA 5CV9A 4BY7H 4JI1Q 1PGAA 3K9PB 4DA2A 1L2NA 1O80A 3K6OA 2K5PA 2EJMA 3HKZB 3T56B 2RHSB 5JJZA 2G3QB 2R92G 4B3RL 1GAQB 1HJPA 3B2GA 1SE8A 4B3SQ 1RLFA 3E6ZX 4K7SA 3QWZB 1KC8C 1YX6B 2BQQA 4FXDA 2K03A 4NDXA 4DHZE 1K8MA 1Q1EA 1P9DU 1Q1OA 1WJUA 1WXVA 2MJ8A 2KUMA 5BO4B 2K32A 1A5RA 4GN3B 1H9SB 1WYWB 1EQTA 4YWKA 2HD3A 4DHJD 3QOLA 4H13C 4KGRA 3VDYA 1XJVA 3Q0AA 3S17H 2MJDA 4HPPA 2HDEA 5HURA 5EDSA 3TP7A 3A8IE 1YJJA 1GJZA 3AMZA 4GZYC 1C78A 1WXMA 1FM0D 4IM3A 2XIWA 3HFZB 2PW5A 3OG5A 3SFEB 2UUCL 1NJIC 1I42A 1V9JA 1BBWA 3I4LA 4JI7Q 1C8CA 4JYAL 3AE7B 3LDZE 1Q90A 2EXDA 2KA7A 3T1YL 3S15B 3HP3A 1XPUA 3B1LX 1V1PB 2MW5A 3KK7A 1RCVD 3FC4A 3K8AA 4I7ZC 4XDCA 4G4KA 1XNRQ 1FXIA 5JHBA 3JAML 3A54A 3QARA 3QOJA 3FVQA 3RZDB 2WX1A 3A56A 3UDIA 1C9FA 2MH7A 4H0LC 2LRWA 2JSVX 1CSQA 1NY4A 4QIWB 3GTGB 5AUIA 1TWAB 1EZ8A 4IUPA 3BU2A 1HNZL 2RGFA 2ZW0A 1E6EB 4GOPB 1ASYA 1B9MA 1Z5SB 1D8LA 2RD0A 3U30A 5CHWA 3PTFC 1NNXA 5TR5A 1DCZA 1SJHD 2C7HA 2L32A 3IBEA 2NB0A 1TT2A 2VS1A 3VR5A 4EVOA 5EE1A 1TYGB 3QQ8B 5J22A 2EYPA 1MJEA 4A93B 3TZDA 4DKAC 3VFKA 4OGQC 3W1BA 1S3SG 2FIFA 1HTPA 3LX0A 4BKSA 2ZTCA 2QILA 3FILA 4IKGA 3S2DB 5LXIB 1AYFA 2AL6A 3H7PB 2H4OA 2QCZA 3KH0A 3DOWA 3X3NA 1GB1A 1O7LA 4H44C 2JVCA 5A2QL 1UGJA 3AI5A 4JI2L 4A20A 4GLXA 1Q10A 4DK5A 3ZDMC 5FLXc 3MP9A 4MACA 1KRHA 2BWFA 2IDYA 4A3MB 1KLVA 4UDUC 1PH9A 4JI3Q 2SNSA 4J1MA 4B08A 5HGTA 2JX5A 3JW0X 5HKHA 2KXJA 2CQAA 2KJ6A 2D62A 5CV6A 3C19A 5LMNQ 1F77A 4JL9A 4ANVA 3M95A 2NN6G 5AFWA 2F0GA 1WMHA 1PFBA 1B9NA 2IT1A 1N63A 2WAQG 3KVFB 2KLGA 2C60A 3E9HA 1YD8U 3CCRA 3IRBA 4TMAB 1OXTA 1UNSA 3HKZG 4YIJA 2WKDA 4LNOA 1E0ZA 3L13A 3A0JA 3W1GA 3T1HQ 3S1RH 4NQLB 1UD7A 2XGTA 4ODGA 5M9OA 1JOQA 2V9HA 4PS8A 1ZEQX 3OHXC 1JOKA 3AE6B 2UU9Q 1LT5D 3D4WA 3EJIA 5M3MB 2UWQA 3PZ7A 3FDTA 2DYOA 3GP7A 2WWZA 2PMZE 2VZAA 4LMQD 4DAPA 1H9KA 2NN6H 5JVG3 4RH6A 2LUEA 2VUMG 2B29A 1JR0D 3M4PA 1N36L 1D5XC 2K5NA 2DGYA 2PQAB 4LF7L 1JALA 2WDQB 2Y5BB 3EFCA 1SLJA 5ELBA 4W9GA 2VB2X 4LFAQ 2B63G 1QILA 1LABA 1A2TA 2DJGC 4B3ML 4GGQA 2JA7G 3JC66 1GXDC 4LDTB 2F0NA 4ZRKA 3HZXA 4BBRG 3HIZA 4BOZB 1OQQA 1V81A 3I72A 1SFOB 2PPHA 1PRTB 4NNJB 4A3OA 3PIP3 2ZXPA 1CKOA 2PI2E 2IY1B 1Y1VB 5NUCA 1PFDA 4HJKA 2E2IH 3T4AC 1GNUA 3ZW3A 1MD2D 3FEWX 4KLKA 2EYFA 5AJ3Q 3JVZX 2NBUA 4LFBL 2Y0SB 3SU8X 2VUMH 1VR9A 1Q12A 4LJPB 2BS4B 3ZDTA 2K1FA 1N32Q 3GOEA 5IY0A 3HOVB 1MBYA 2HCIA 4KJNA 3N1YC 4IDIA 1WTXA 2VH1A 2LS01 2JA7H 1CI3M 4HTHA 5K36H 2WAQE 2BF8B 2D0PA 4JI4Q 4F87A 4JVZA 4FVMA 4ILWA 4BBRH 3G6EA 3E5SA 2NTSA 2WP8J 1PUTA 2INCC 4G7OC 2CHXA 5I2XA 5C0XG 2KO3A 1VQBA 2AEHA 1IXRA 1WX9A 1GUTA 3NTHA 3DHQA 3Q8FA 1N60A 5M5XB 3RZDH 4US9A 4KZ0A 3MVVA 1WGHA 4A93G 2D2QA 1K3RA 4MJSB 2XTIA 1G2TA 1OQRA 3NSWA 2L00B 1TWAH 1HA6A 2L4NA 1CHQD 3IAYA 1VQ4A 4WJNA 2IHFA 4HWIB 5G5HA 1JWAD 1KQSA 3DBHI 2LMCB 2A8VA 2J7QB 5C3EB 2QDBA 1TS5A 3F8TA 2R7FA 2Y3AA 1YOVB 5DPSA 3JYUA 2PZWA 3SR1A 1SE9A 4AYBE 2W3SA 4YTPB 4EFOA 2KENA 2F0SA 1X3GA 1VQKA 4MH0E 1X56A 1TQOA 1PXUA 3U9SA 4QJFA 1ZOYB 3UE1A 1N34Q 5COYA 2KZRA 3CMMB 1KNAA 4K8IA 1CUKA 4FF1A 1KABA 3KOJA 4JI8Q 3NBHA 5LMUQ 3PIO3 4A93H 2GI9A 2QGQA 1MJDA 3S1QH 2UXCQ 2B8GA 1UH6A 4DR1Q 3MHSD 4FJVB 5E7NA 4RGTA 4HIDA 3WAOA 1ZPSA 4HIKA 1C7YA 1PTOH 1HFGA 4H2AA 3KJPA 2QMTA 4DAYA 4A3PA 4HLEA 2V3PA 3MC8A 2UYZB 3ZGZA 1MHWC 2HTHA 4XQJA 3K5NA 4NJ7A 3BY4B 3ZTDA 5J17A 1DYQA 1LTGD 2OJRA 4IUVA 1BCPC 1EWCA 3VH3B 1DOMA 4N9PA 1CQFA 4FHKA 2Y5CA 4M01A 2UU7A 4YTNB 2PO4A 4HCPB 1AW7A 4X62L 2L11A 4DR7L 1X65A 3P4PB 2AHOB 2XK5B 4QGUA 3T8MA 3WCQA 1BBUA 1N9WA 2LASA 2OEOA 4GKKQ 2DWQA 3EROA 2IPKD 1OXUA 3CW2C 4S0RA 4WURA 3I63C 3IFTA 4RCNA 4NKLA 4AP4C 2CWPA 2O4XA 1K73C 1E10A 1RJTA 2VXWA 4YL8A 4V0BA 3Q3OC 3GE3C 2JT4B 2CKZB 2J0TD 1PTOC 4LFCL 2MWSB 4L23A 5L95C 2YEPF 4XQQA 2BDOA 2JY6A 4GIVA 1CZGA 4LTUA 4MGKE 1S3OA 2BT6A 1Y1VG 1K83H 3I56A 1S4ZA 4RNAA 4WWPA 4DV2Q 2Y0SG 4XWTA 3RNCC 4YHHL 1SR3A 3MJWA 3SXHA 4JI6Q 3U9OA 2INNE 1XEEA 4IG7B 4NP5A 4M00A 2BA1A 3I8ZA 4X65Q 4MGZE 1PFSA 2JK8A 3H09A 1WJ6A 3QO2A 4DK1A 4H02A 1GUAB 2GBNA 4ITKA 4JPSA 4YY3L 5IIFA 4YWMA 3OIPA 1K8RB 4IPDA 1NEKB 1VRAB 2JXMB 2NZ1D 1K52A 1LTID 3WAPA 3VUXA 1YX5B 1UUPA 4PYUA 1Y1VH 4POGA 4LF5Q 3A1QB 3TMPB 3WALA 4AQYL 2F52A 1E7UA 3I2ZA 4GB9A 4YT0B 1LM0A 1SE4A 1FIQA 4P1CC 3OPOA 4N9F4 3APFA 4C3HG 4LJZC 1EYDA 2YTYA 4NPNA 4HJ5A 3M3YH 5CTRC 1BOSA 2VW9A 1YHBA 1QB5D 1KRSA 3HOUB 4KIKB 1XTCD 2F0UA 2KKCA 3B9JA 1LUZA 3ONAB 4US8A 2IX3A 4JI5Q 5C3EG 3AFPA 1HQMC 2SDFA 4II3B 1VQ6A 4E3CA 1EO6A 3J81L 4DR6Q 2C5LC 3LXFA 4C4VB 1E22A 4KHPL 2FCMA 4RMAA 4W9LA 1G6JA 1WCMB 2QC8A 1VLBA 2WS3B 3X0WA 2RCNA 5M5XH 1YJWA 3M63B 1FNWA 2FMCA 2JXXA 4C3HH 1LTSD 3K0XA 3EC8A 1VQIA 4I6NB 1WH3A 4W9CA 2KNBA 2E3TA 1BXTA 3Q2AC 4WIPA 3ONSA 4XYOA 3ZNHB 3ZQ4A 4JYAQ 3EFXD 5D14A 4KJOA 3FAHA 3KYHC 4JI1L 2ZCCA 1GHJA 3VR9B 3HOZB 5C3EH 1FFVA 5CR3A 3N1ZC 1ZP0B 3OW2A 1NUCA 1TWCB 1RWSA 3N3KB 4MELA 2BBCA 4ZRPA 2E8GA 5IT9E 1JT8A 1WI5A 2J53A 2B2YA 2A68D 2H89B 2KWUB 4IJLA 4RGNA 4MEMA 1ZE3D 1BT0A 5LHY1 3AH7A 3RLNA 5JVH3 2CJOA 3KDFA 3F1ZA 3PUVA 2B39A 3CC4A 1HZ9A 2DHZA 1BF4A 3MXUA 2EY5A 1BCPF 1W6JA 5IA7A 1LTAD 4OWXB 3NHHA 2A19A 3S1MH 2M9VA 5CC4A 4GN1A 2JA6B 1QKZA 3GTMB 1RIPA 2ASQA 4WRDA 1WFYA 1PH4A 1J5EQ 1QLBB 1UGMA 3NRZA 1AZPA 3H9DA 3D8GA 4IPHA 1WWTA 2A6ED 4CDDC 3S2HB 5DPTA 4DR4L 1TKWB 4OO1I 2BE5D 4JI7L 4JE3B 2KACA 3KYCD 4OZBA 1Y1WG 2PZTA 4BZAA 1M90C 3M7NA 2D3BA 4BY1G 2Z6BA 2L7RA 4Q5VA 3VYUA 4U673 3WIMA 1PTOF 3PF5A 1VQLA 3D3RA 4R3DA 3AEVA 2F0EA 1ILPA 3APDA 1HH2P 4ASWC 3IHPC 2V3SA 3OMCA 1JQYD 4ZDVA 3F2CA 2WDVB 1JWBD 3ZJYC 1TWFB 3Q3FA 2MX2A 4CDFC 2RPQA 2RA4A 3VXWA 4DQOC 1OGWA 3S16B 2G9HD 4BY1H 1N61A 1KDCA 3GTJB 3K59A 4QUFA 4PZ8A 1CA5A 1DZ1A 5KNDA 1Q46A 2GA4B 3M3JA 2JXTA 3HOUG 2ZCBA 1Q7YC 3PUXA 1STEA 1I35A 3UQAA 3NHEB 3GE8C 5D6JB 1IBXB 1LACA 4JBKA 2B76B 2WX0A 4P75A 4C3JG 1QNUA 3GTLB 4XXEA 1WCMG 2G9DA 5CMDA 2E2HB 1JWUD 1KL9A 4IFDI 2BKFA 3TEXA 4J15A 1I50H 4X6AH 1GC6A 4LF7Q 1BDOA 3I5JC 4ZYNA 3SD5A 1LT4D 2OTLA 4MSMB 4JI3L 4A4IA 4X3UA 1R9TB 4RF0A 5LMNL 1KH0A 2O6VD 4CYEA 3HOUH 4HDOA 3FP9A 1B70B 3F2BA 4W9IA 2FNJB 2K6AA 2F0OA 2ZM6L 3R2IA 2PPBC 1F0ZA 1FXAA 3NS1A 5IYCG 1YIWA 4JV5Q 2A6HD 2CKHB 1PH6A 2M17A 4B9XA 4A3BG 4QMGA 2M19A 3NQIA 2EOTA 3CCSA 3ZLZA 1WCMH 3T1HL 2D5GA 1T9HA 1ZYRD 1KXLA 3IAS1 2E5LQ 2MP2A 2JA5G 4XWWA 1EYGA 1Z47A 3VQIA 4EEWA 2UU9L 1L1OA 1PH1A 5EBCA 2O2VB 1YHQA 1HR0W 3E9SA 1L0XB 4HJ9A 4C3IG 2QF7A 2WACA 1EL0A 1WZ0A 1C79A 4CKBA 4L2YA 2F0PA 5IYCH 2KVZA 2NPTA 3W5OA 3GZNB 3NOBA 2DN8A 1EYCA 4A3BH 2LHEA 5F2DA 4LFAL 2VZKB 3A55A 1U4RA 4MSQB 1WOCA 2B3AA 3M9BA 4DV6Q 1BBXC 5FO9B 2JWZA 2VH2A 3SVMA 3IVFA 2GVAA 3KUZA 4WJ3M 1LTRD 1DOXA 2AQ3B 1VMCA 2JA5H 3TMEA 4LF8L 3JAME 5E4XA 4BA1I 2HTME 2KHSA 1AN8A 1M4VA 2X8XX 4BY7B 2NN6I 1X6OA 4RWSC 2KCNA 4K0KL 3EUB2 2AUJD 5EE9A 1GG3A 3GTMH 3OAWA 4A3DB 1K0SA 3J80i 1B3AA 3H3VH 3P4RB 2MQJA 2KQ7A 2C7MB 3S24A 4ZRJA 2CR5A 2NYZD 5A35A 4IWOA 1GUWA 3CCMA 3N30A 4WAFA 1U0LA 2QCPX 4LWCA 1WTWA 4EZLA 3NG0A 3SDZA 2DNCA 3A5UA 2JF5A 4AJWA 4IJHA 5IP9G 2WB1B 4WFN3 2B2YC 4L5QA 4LNIA 1I4PA 4O2DA 2GBRA 1Q1BA 1EF1A 2PLPA 4EX5A 4IC7B 2ZNVC 3ZXVA 3TL5A 2HQEA 2F0VA 3CQZH 1IL8A 1YQ4B 4KY7A 2R92B 3AU4A 1QZGA 2F0TA 4DNIA 1XLNA 3PGZA 5A2QE 2IYDB 3VR4A 3QC8B 4G3XB 4W9DA 3VYSA 5IN7A 4DPGA 3MXNA 3CCQA 4FF4A 3H3VC 4QY7A 4UY8C 1OXXK 3MFYA 4X3TA 4LNNA 4DFAA 2EMSA 2KX0A 5IP9H 2KJXA 5BR8Q 4CKCA 3H0GG 1EOVA 3B0AA 1TKEA 1A3TA 3GTJH 1ZKHA 2JJQA 4DN4M 1UWMA 2EVBA 1N34L 4MM3A 5M5YH 1S5FD 2Q8TA 1JORA 2ZVNA 2N1VA 5LMUL 3QHTA 3E0EA 4MTNA 1EY7A 4HIMA 3RPFC 3ULPA 2UXCL 2N49A 4HRSA 3ZRCA 2FFKB 4ACFA 5KYIA 1Y14B 5G5GA 3NUCA 2H5XA 3ML8A 3H15A 1V1QA 4ABNA 3WAMA 1U4PA 4O42A 3J81j 5DCNA 3OSOA 3U4ZA 5BYRA 2Y5PA 3RZWC 3M4YA 4ZCKA 2E2HH 2DZJA 3OW7A 5IT9c 3H0GH 2NVQH 2HQLA 2HDMA 5I2YA 4TUUA 1D7QA 4OELB 3Q8BA 3L3OC 4XQNA 4YY3Q 1UE1A 1EM7A 2NBVB 3GTKH 4FN2A 2B2WA 2HJ1A 1IYFA 3KF6B 4K14A 2KFKB 1HR0Q 3NVYA 2QA4A 1GC7A 1OTRB 2Q8RE 3AE9B 1QZHA 3SK5A 3TBLD 1FL0A 4GKKL 5IGCA 4X57B 3TQYA 3P1HA 4M1UB 2K3UA 5E3FA 3ABVB 1JJCB 1YBYA 2CHWA 3ZTCA 3PCOB 2PMZB 3JSVA 1XWEA 1T5XD 2DY8A 4YSXB 4RM8A 2INPE 1V49A 1I6VC 1LYLA 3CPFA 2DZMA 5KEEA 3A9KB 2MO0A 1HXYD 4KSLC 4OVUA 3SHQA 1XPOA 2L0FA 4HROA 2LXAA 3AEFB 3ZIMA 1WM3A 1E1TA 1QG7A 3L17A 1I4RA 2IGGA 3VA5A 2JEBI 1JJGA 4WH4A 2F4VL 2K8CA 4EZJA 3D4RA 3HOXG 1TTNA 2R6GA 4A3DG 2D11A 1S40A 4JI6L 4KHPQ 2GBMA 5IYBG 4X65L 4BA2I 2WHIA 1PGXA 1NBWA 1V2YA 4WAAA 3K57A 4A3LH 3CCEA 4NZLB 2L52A 1OXVA 5CBAE 3CMAA 3RYTA 1STHA 4F88A 1Q81C 2K1BA 2WFWA 2IO0B 1A3UA 3IFDA 2IO2B 4LJOB 2JYTA 4EUTA 4LF9Q 1BNZA 4LF5L 3QAQA 5IE8A 2LFIA 4OVZA 4F8CB 4ZUJA 2WAQB 1J7CA 3HOXH 1A8VA 2Q2UA 5KNCA 4A3DH 2QSDA 2EDGA 1L1OC 4UHVA 3RMHA 1FGBD 4JPBW 5IYBH 4JI0Q 3TP6A 2Z6KC 2JQOA 3HOYG 4F8MA 4QCLA 1WYGA 1C3TA 1XCQL 3PO3G 5ELOA 3DLLA 1T5EA 1EY6A 3DWMA 4JI5L 2MUYA 5EAYA 2LHDA 4UAIA 2F0WA 2IBIB 3MXGA 5IWAQ 2Z59B 1C4PA 2E2IB 1QNKA 5FOBB 1TJEA 2INDC 1I4XA 4DR6L 1E2VA 3FRPB 1K8OA 2KAJA 1G51A 2BWES 4NY0A 2NZOA 2VUMB 1IW7D 3DBLB 1TWGH 1GD7A 3DXJC 3UF8A 3RI7C 1WE7A 2B63B 1F2RC 1IZ6A 3W2DA 2SOBA 2R92H 3L4PA 4XZ4A 2JA7B 1JRUA 2ZPYA 3HOYH 4CO7A 1CSPA 4FP5D 3W1YA 3MTNB 2N7JA 5L83A 1VDVA 2XRQD 3A7AB 3KBXA 3HRZC 4FO2A 3R8BA 4BBRB 3CD6A 4DR4Q 4IW0A 2ASBA 3J7AF 3DM3A 2MEKA 1SNCA 2MRPA 1P7EA 4YCUA 1DGSA 1F9QA 3DWQA 3Q3NC 2M8SA 3D32A 2BKRB 1XMOQ 4A3GG 1PVOA 3RD4A 4ZHOA 1HTLD 4H7BA 2K8HA 3I9V1 3U58A 1X3EA 5IAAC 2I46A 3NVVA 3Q6SA 2LD9A 2WDRB 2K39A 2PW7A 4ME5A 2BYTA 3R7RA 3I4MG 2W82A 1T0QC 3RNBC 1BCPB 3KWLA 2CS4A 3GTQH 1OEYJ 2Z1CA 1JOOA 2A73B 1NI2A 4ME3A 4G7HC 4DU9A 2F1MA 1W6KA 3VUWA 1J5EL 2JA9A 4OIJA 1LO5D 4FNFA 4A3GH 3GQBA 4QL5A 2A4ZA 5I6WA 2NZHA 4XTCS 4A3IB 2L1BA 3JAMc 3S1QB 3DVGX 1MG8A 3AN1A 3FILB 4PZ7A 3O13A 2B2VA 1TY0A 4PZ6A 4G57A 3PMFA 4GS3A 4A76A 2H1EA 1I94L 3I4MH 1PTOB 2V4DA 5GAEC 3AB9A 1X3PA 1YJNA 2KQ4X 3OMGA 4DNRB 1E8WA 1B2TA 4B9KA 4WWNA 1A63A 1GUOA 2AUKA 2D3GA 3PHXB 3M7GA 1YN5A 2E2JH 2EYMA 1G91A 1O7YA 5C3XA 2D0OA 2QEJC 1EEID 4RKBA 3X3MA 3UGBB 5LNK1 5JPMC 1WMHB 1IP9A 2K52A 2YYZA 3U4EG 1WF9A 1R4PB 2ZM6Q 2LGIA 4NAMA 2KEEA 4DK3C 4HJ7A 4WJPA 2MA9B 4ZRZA 1MI2A 3I91A 1SE3A 1MHHE 4KX6B 3CCVA 2B2WC 5HGQA 1NYRA 3MXPA 3Q6BA 4ZRQA 1S5ED 2HIVA 2KQSA 4EQOA 1I4GA 5LL6X 2LGXA 3PS6A 1A3VA 3I70A 1E7VA 5IO9A 3S2AA 1J0GA 3J81E 4RHSA 3H7SA 1JW9D 1S1QB 2E74C 3EN2A 2HD5B 5FLMG 4XT3B 4IO9A 1K83B 4GDLB 4BS9A 2M00A 4DUZQ 1KF6B 4A3JG 1KAAA 3NVWA 1SRUA 4RCOA 1SJED 1EWHA 2EY2A 2F3WA 1PYBA 4UP7A 5IGFA 2XBBC 4CDCC 4OW0A 1W3SA 5CHVC 3DVGY 2F0LA 3GD7A 2BH2A 5IOCA 4AYBG 1SB3C 5CBEE 3L10B 3SE0A 4EQ5A 2O6VA 4A3EG 3P1MA 3ZO5B 4NXML 2XN9C 3GS2A 2AMCB 2HUGA 1WZ3A 4M8AA 3E56A 3NK9A 3L7ZC 4LF8Q 1YJIA 1XXGA 3KLRA 4BKGA 1PFMA 2NBFA 1HNXL 1FFUA 2G4SA 3MWYW 3CCUA 2JUOA 4E71A 5JH5C 5FLMH 3G6JB 4JV5L 4K0KQ 2JRHA 4A3JH 4P6VF 1VQCA 2LXKA 3DCGA 1KHIA 2ZJRA 3HOWG 4YWLA 4DK0A 2DLBA 1GHKA 2IGDA 1U4MA 1CHPD 2E5LL 2PEAA 2KMCA 4F7ZA 3M3YB 3VYTA 4DK6C 2B63H 1ZXHA 2YLMA 3P2BA 4DGZA 1U9RA 2MPMA 2OQKA 3PVLA 4A3EH 1X1MA 4B0MA 1EY5A 3K81C 5C6AA 2DY7A 1P7FA 1RYJA 1E3PA 4WQOB 1B1ZA 5G55A 3VTWA 4FF3A 3RZFA 2CH4A 2EPBA 2Z9HA 2XVSA 3ALBA 3AECB 4QB4A 2WXMA 2D3CA 5GQOA 3DUZA 1L4ZB 4MGIE 3RMKC 3NTKA 2NTTA 1P0RA 3SFDB 5T8IA 2I07B 3GTOH 5KGUA 4DV6L 5JJIA 3HOWH 2BH8A 2R2OA 2N55A 4C3HB 1KFYB 2NCNA 1WYDA 4A3IG 4X3KA 4NB3A 4DR2Q 1WTQA 4KKSA 2KWVB 3KJOA 3OOCA 1SYCA 4ZHPA 1IBKQ 3NENA 1D4BA 3EGRA 1LT6D 3BDLA 4J6HA 1CKMA 2OXPA 4KK7A 5EPJA 5D3DA 4ARCA 5IYDG 2DYMA 3CIRB 1C48A 2K5WA 2LSSA 4HJ8A 5C0XH 2EZVA 2YV5A 2BYFA 1ZXIA 1VZ8A 1OFFA 1HFNA 1NR4A 5H92C 5C4JH 1WTVA 1UAPA 1Y8NB 1R4NB 3NBHB 3PRPB 2ES2A 3HK0A 5CORA 4A3IH 1FVIA 3MJ5A 5HG2A 2WXOA 2A68C 5BN5A 3A4SC 1PH2A 1T0RC 3S1MB 1XYIA 4DAYB 4LNFA 3ZNID 4ZQ3A 3QA8A 1CFMA 5IYDH 3R2TA 3C8YA 2KJHB 3UI3A 2RDFA 1MIUA 1JROA 3N6RA 1VF7A 4P16A 3WDNA 3DHIC 2J4XA 2DJFC 2RR9A 4N8FA 1SE2A 1CM9A 2L9HA 1N5XA 1EUVB 3BZKA 5T1IA 3WANA 3AE2B 1STBA 1JRPA 2EYJA 3K7AH 1IKMA 1FXTB 4YSZB 3E3XA 3GV3A 4GNXA 4RHRA 3R3OA 4IURA 3QK0A 2A6EC 3E0JA 3SK8A 4CJ2C 5BR8L 1RHPA 4IZ8A 1KIXA 1KJTA 3ND9A 5K5PA 3HEJA 1L2FA 1EIGA 2BE5C 3ND8A 1GKHA 1YHAA 2F03A 1CZPA 1D5MC 5DAUA 4GDKA 2B2VC 1B9RA 2ONQA 4GSWA 2KTRA 3E9IA 3FHWA 4P2CB 2ZT9C 5AUKA 5KIXA 3D6WA 4A75A 3DPDA 1DOKA 4OHJA 2JRIB 1E5WA 2LFNA 2PIAA 5ELFA 4ZKBB 4A55A 1JE5A 3NY5A 1H8CA 1XLPA 1VQGA 1Y1WB 2MNAA 3BS1A 2F4VQ 1IUEA 3B2FA 1J9OA 1RDPD 4J6IA 4YSYB 4WJOA 4BY1B 2MJEA 4IM2A 3IT6B 3BK2A 1OEYA 3PHWB 1GB4A 1DXMA 1TXYA 5C4ZA 1CTMA 1HNWQ 1YJ1A 5CV7A 2BB6A 3VA7A 5CGKA 3DQVA 3ZNGC 5BN4A 4FULA 1Y69U 1X54A 2K5VA 2VQEL 3QX1A 2N9PC 1PH7A 1F9RA 1WD1A 2R3ZA 2JYOA 4FF2A 1I6HH 1HR0L 2LVPA 3AE4B 1VQ5A 2H88B 2W54A 4HCEA 1PH3A 4OZAA 4MGYE 1NE3A 2CQOA 3VR3A 1IBMQ 1EY8A 1X3FA 5LL6S 3MC9A 4CJ0B 2R61A 4M8NA 5FJ8G 1I50B 2BDNA 4WQMA 2MBEA 3CAMA 3G7LA 1PV4A 2HE7A 3AE5B 3G48A 1F1HA 1YN3A 2G5DA 2MO1A 5C4HA 2ZVOA 3KUDB 2RHQB 2DENB 5BYSA 1FPYA 2X69A 1FJGQ 3I4NG 4WWMA 4DV3Q 1V5TA 1JB3A 1K3BC 4IQZA 3J80L 1JJ2A 2OT2A 3UDFA 3C3LA 3VH4B 2K0PA 2MBQA 3K9OB 3NZUA 1DOLA 2RQXA 4OX9Q 4Y7NH 3OIQA 4JC0A 4TKNA 4ARIA 2JSOA 4C3JB 1PHJA 3IG3A 1AH9A 1YN4A 2JA8G 5DLQE 2FJ2A 1DONA 2YTXA 3V05A 4TVAB 2UUAQ 1NTGA 1AP0A 4KKJA 5FJ8H 1GM5A 1V80A 1Z2MA 5HFYA 1X3QA 3PRMB 4HN7A 5BMGA 2A6HC 1PFNA 1RFAA 4ALPA 2N1WA 2XRSD 2FXQA 3ZUNA 5C1ZA 2KOLA 3J7YW 4ZLTF 3PGEA 3NS8A 5AEKB 1JQ4A 1L6UA 1LV9A 3I4NH 3IXSA 1ZYRC 3NZSA 3UDGA 4LF9L 2D5DA 1WE6A 2BW2A 2K33A 2EIFA 5DM73 3G71A 5DPRA 2ICEC 4O0AA 3J7ZC 4BXXG 1QE6A 4CQNA 4OWTB 2QHOA 3GZNI 1XO3A 4FLHA 4C4VA 4A3BB 2MP1A 1C4CA 4IUTA 4M0WB 2JA8H 1TKGA 4E74A 4GXBA 4JI0L 3LWEA 1Y8RC 5G2NA 4UP9A 5EE0A 2BA0A 3BYYB 4G11A 3AEDB 2A74C 2JA5B 1XCTL 3J81c 3VVWB 2OJWA 2EXZA 3S1NH 4TQ0A 2ZNVB 1G291 1SMYD 1EIYB 2EY1A 3KDFB 4PMWA 1WX8A 2DZKA 5IWAL 2F0KA 4KDLB 5EKKA 2BYEA 1XTDA 2C5CA 4DHJB 4RKLA 3KF8A 2RPVA 5IOIA 3FKIG 4HAEA 3FMCA 4C3IB 4NMZA 1TGZB 2OCEA 4BXXH 2IWHA 3C46A 3Q23A 2KANA 2AWTA 2K01A 3NPPA 2K6QA 2MBOA 3HGBA 1RL2A 2QDFA 4LAAA 1YNJD 1GPXA 4IPCA 4MNOA 1UF0A 3KLSX 5I4DA 1FR3A 2MBBB 2WXFA 1I5FA 1KLUD 2KMAA 1QCBD 3PUWA 4A6QA 1NYQA 1I94Q 2ICIA 1HPCA 3PV0A 4IFDJ 1VQ8A 1RTNA 5AZFA 2K28A 1UBIA 1XNQQ 2W9NA 4PT5A 1XMOL 1ET6A 1F52A 4B6WA 3BVMA 3CQZB 3FKIH 3RNAC 3ETRA 3G4SA 1YNND 5D94A 4KMUC 3KLWA 4JG2A 1HZ6A 2J42A 3L16A 1NAPA 1VF5C 4IOCA 2OEDA 2AQ1B 1EWIA 1LTBD 5CV4A 1TS3A 4KHZA 1IPGA 2LRUA 1I4QA 1Y1WH 4NXNQ 1G8ZD 1P16A 1SYFA 2KCCA 3STBD 5ELNA 2NBWB 5C5LA 2JZ3B 2L12A 1FD6A 2F0HA 2OOBB 5M5YB 1BR9A 3MAQA 1WRIA 1LM8B 2EKEC 2JU6X 2RSOA 4GNXC 2CW0C 4OIKA 3GTPB 4ZYSA 4C80A 4EKUA 3I3TB 1C0AA 1VJKA 2WV6D 2BOSA 4TQUS 4JBMA 2PZUA 2X6LA 1ASZA 2E75C 4L63B 4V190 1HZCA 1IHZA 1YI2A 4WJWA 2ACZB 3P4QB 3Q14C 4NJCA 1HTOA 3Q24A 1DJRD 3H0GB 4G50A 2NVQB 2BGFA 1K51A 1WGYA 1RFKA 4FJYA 3TCAA 3KLSA 2HHHQ 4KD3A 1XMQQ 3DEPA 2E76C 4XC2A 1J8CA 2M1MA 4NXMQ 5EPKA 2ZZPB 3GTKB 1H9JA 5FK9C 3AFQA 1PH8A 1L7YA 4YWGG 5M3FG 5M5WB 4X66L 2Z8LA 1HNXQ 3U50C 1YNTE 3EA6A 4HEDA 4OZCA 3CRKC 4HJAA 3LYYA 4C3JH 1L4DB 3GDEA 3TDQA 1STGA 4BWGB 1MKHA 4BAXA 3CCJA 1WVLA 3EHVA 2PNRC 4RM9A 4QQBX 1PYWD 1NENB 1V97A 2LEKA 2Z0SA 1O7IA 2MP2B 4YXDB 3GB1A 4F7XA 5BMHA 4B9WA 1KNEA 3RR5A 1SYDA 1QQRA 2FUG1 3W5VB 3RN5A 1L1OB 5JJKA 2DX5B 1B53A 1YMHE 4LDTD 1B4OA 3RULA 5MPOA 4DUZL 2HIXA 1SIFA 2IHEA 1PRTD 5M3FH 1PRTF 3EBEA 2SAKA 4DHZB 3I90A 1LXDA 2NPTB 4FDBA 4R8IA 1VQNA 1EUJA 2HT1A 3A9JB 4XDXA 2FINB 4MIUA 1I7HA 1Z7TA 4POFA 3EVQA 1NMGA 4DXGA 2DAFA 4HPLB 1WXAA 2VNUD 4FADA 5DEHA 2V3NA 3CMEA 1OO9B 2PE9A 1J7AA 2NVTH 3BVGA 1BO0A 1JC7A 1A62A 1JCKB 1D2BA 3RNGC 1YITA 4A9AA 3UE0A 3J7A5 2KC1A 3T3NA 1Q82C 2FAZA 2N9KA 3HOXB 5C4XB 2G4DB 1QUQA 1QVGA 3PF4A 3EECA 2FBWB 4C3IH 3CF6E 3MHBA 3CHBD 5G3LD 2JP1A 2UXBQ 3DWPA 1D1KA 1DGJA 2GBJA 1I3QB 4C2MB 5CX3A 2W3RA 1UBQA 4KGSA 4CDEC 2D2CC 1ONLA 3UIOB 3A8JE 2F0DA 2EMTA 1PLFA 3ERQA 1ENCA 1RF2D 1WXSA 3Q8AA 2LKVA 2WINB 3T13A 1WJ4A 3TUOA 4D2KA 4LK1C 2OWOA 2WXPA 4CKEA 4XE0A 4OEMB 4P73A 3NWSA 1CMXB 1VCBA 2WP9B 3DBLI 1FD7D 1TWGB 2WXGA 4HDQA 2GN5A 3K80C 3ER0A 5IKCM 1IKLA 4DR2L 4HPMB 3L08A 3HOYB 1IBKL 3PO3B 3PO0A 2V1YA 1IW7C 4UP8A 3TP8A 4XGAB 3BZCA 4AQ7A 3QR8A 1WXQA 2GRIA 2QEXA 1I4HA 3MXNB 4XIGS 2K5DA 4K5XA 4P74A 2ZPNA 2RKSA 2CW0D 1CK1A 1YQ3B 1JB7A 3P4SB 4P1BC 1NI3A 2FE8A 4ZRIA 1ICWA 1L0YB 4ICVA 4ANUA 2FUHB 4IUQA 1E90A 4RF1A 3MTSA 4UPAA 2LGSA 3DDCB 4MM3B 1UEBA 2WXQA 2KX3A 2MBHA 3Q8EA 3GTPH 4EE2A 3BJUA 4K5WA 2KWCA 2L3ZA 2QW7A 3TZUA 5JAVA 2JEAI 2K5QA 3PQIA 5J2RA 1ZKOA 4K7UA 2R7ZG 3GTQB 5C5MA 2I5LX 2CCZA 2NVXB 2LGDA 3C0RB 2LXJA 2NWGA 3BDOA 2WKCA 2F3IA 4L5RC 3PRZA 2RF4A 5C0XI 1MVKA 4KKUA 1R4QB 3DWAA 1Q3LA 4HCNB 1EZ6A 1Y56A 2BCOA 4PG3A 5FO8B 4A3GB 1L5PA 3TRZA 1E8XA 1V43A 1EY4A 2J0JA 3A8KE 2A69D 2JE6I 5FR6A 4WJ4A 3KUCB 2VQEQ 2LZ6A 3HUIA 3SDLC 2J0KA 1TWHH 4FXKC 1M8AA 4B95A 5M5WH 2G1EA 2HDLA 3I7FA 3P75A 3TSSA 1KDBA 3I4MB 2RSUA 1SDFA 3DVNU 4GMVA 3DMUA 4MH8A 4R8NA 1II3A 2BS2B 4E6IA 1AARA 2X38A 3IAM1 4TRDA 1RKNA 2N88A 3NP8A 3JSVB 2IX1A 1E7ZA 3AB5A 4LLGM 2YEPB 2PE6B 2PCFB 1GJXA 2E2JB 3TEYA 1MSHA 1GOZA 1QOHA 3ICEA 4DDGD 3PZDA 4GLVB 1F9JA 2N7DA 2PVOD 3M62B 5KHQA 5C4XG 3QJZA 1FMAD 1LQBA 3DBRB 3D0FA 4DUYQ 2IZVB 3LGJA 2K7VA 1UZXB 4XYQA 2L1AA 2FMMA 4FXGC 1ROEA 3PSEB 1HNWL 3S14H 4IUMB 5FKAC 2K6DB 2CVRA 1F2MA 2R93G 3NEMA 3AEBB 2F0JA 3I73A 3NTIA 4R4TA 1QOFA 2PW9A 3RFZB 2JWUA 1SSNA 2LWPA 4C56C 4GKJQ 1WR6E 2WXNA 2I2YA 1R4MB 3ZJUA 4HR7B 4NPSA 3VRAB 1CKNA 1PDQA 1RD9D 4GLAC 3DHGC 1IBML 3HS0C 1WSPA 1YQBA 1O78A 3DEOA 4EGVA 3GV6A 5C4XH 4DV0L 3NVZA 2KFJA 3QIAA 2DNFA 1SNDA 1I3QH 4C2MH 3UIPB 1HCZA 4EOYA 3NXWA 1EFID 2SNMA 1FJGL 1KRTA 4DV3L 2R93H 3HG9A 2LI5A 4EZKA 1EQRA 4OO1G 1G2SA 1T0YA 1QVCA 3RZOB 2FCNA 3EIVA 5DPWA 4OX9L 3DBSA 3PV1A 3OLMD 3TBIB 4URKA 2DUDA 1VZ7A 4NAWA 4KHVA 4A3JB 1FCLA 1HQRD 4LF6Q 4I6LB 1OQYA 1QT9A 5IP4D 3C2PA 2UUAL 4HSPA 5E6OA 3V2TA 2PTLA 2KN4A 4JIOU 2GB1A 2KVRA 2GBKA 1HZBA 4AYBB 1RAXA 1ACCA 1P98A 4A3EB 3V96A 5D3IB 4K81A 3PO3H 4N59A 3AEAB 2L0TA 3CSTA 1H95A 3K5OA 5JEAJ 2KDBA 1MGSA 4OO1H 1FNVA 3TEZA 2J7ZA 4IN3A 2P5ZX 2O5JC 1EWYC 2W55A 1H9SA 4KV2A 2K04A 3TN2A 3GTOB 3CXCA 4ULLA 3M85A 3PUZA 1HZAA 3HOWB 1K50A 3C1EA 2ID0A 5JHAA 2L55A 4JCVE 3URYA 3NBIA 1VQ7A 2WQYB 1VDZA 2GVBA 3ULJA 5CV5A 1G6PA 2KK8A 1WI0A 2KQ3A 1E8YA 2JZZA 2GLSA 1V8QA 1ISNA 2VQFQ 2B8FA 2NVXH 1RTOA 1V1PA 3J7AV 2CJNA 3GO5A 3EFUA 1E8ZA 2PMVA 4IFDG 1Z6HA 4GN5A 1F2YA 3BK1A 2Z0EB 3AV8A 1VQ9A 4LUOA 2C9OA 4W9EA 1FNUA 3D6CA 1IBLQ 5C4JB 2RDBC 1PZKD 3BWUD 2Q5WD 1BUVT 1R4NI 1B8AA 1TS2A 3QWNA 3PIPA 1ENAA 4J8QA 2WB1E 2NVUI 4II2B 4ZOHC 3TIXA 2E2DC 2Z4IA 5JPNC 2ZEQA 4RFBA 5FLXL 4F1SA 4GOPA 4LCDE 2MHVA 1SYEA 2F0MA 1VQMA 1MI0A 1ZDXA 3B08A 3LJ3A 1XNQL 4MDKE 2D9UA 1TR5A 1XLOA 4KDIC 4KGTA 1E9MA 1Y8OB 1M1KC 4L8JA 3PO2G 4IFDH 4IWPA 1A15A 5GAHC 2K05A 2Q2HA 1V86A 2UXDL 3APCA 1SGHA 3KBGA 1E2WA 2KTFA 5KRUA 3K7AB 4BKTA 2ZXRA 5EJWA 4X66Q 1STNA 4NXNL 3AMUA 1NVID 2I38A 3H7PA 4JGHB 3UQBA 1HRJA 3P63A 1SYBA 2OTJA 1WFQA 2CH4W 3QB3A 3J80E 1OXSC 4L5SA 3H6MA 3ZNZB 1EIFA 2KEDA 4HCSA 1DOIA 3T9LA 4KI0A 1T6BX 2HCCA 3PO2H 2A5UA 4A3FG 3CRLC 4R4QA 3U2SC 1V5OA 5J39A 1PYSB 4KVGB 2A5HA 3H91A 1J19A 2JPHA 3PLUA 4G7ZC 1TZOA 1EEFD 4RGMA 3RNFC 5GAGC 5EQ0A 4AS1A 3W5UB 1H9MA 1J8IA 3MC0B 2B2UA 2L76A 3Q69A 3I4OA 2JN4A 3I3CA 3IKJA 2JYEA 1F2LA 4Z9CB 4DNTB 2KT7A 4HVBA 2HHHL 2VL6A 1XMQL 3PIOA 1VQOA 2O6VB 2C7NB 3LB8C 4KZCA 1KLGD 4K2KA 2F0QA 1H4RA 5C3JB 1I6HB 2JQRB 1Q8IA 4A3FH 2I0QA 5C23A 3ML9A 3RZOH 4EQNA 3IFWB 3RN9C 4GDLA 2EE1A 3NQTA 1J7BA 4HK2A 4MHEA 4B0EA 2VRRB 3DVNV 2L05A 3RLOA 1C76A 1QWYA 4I65A 4KD4A 5KHOA 4IWQA 3R66C 2PQAA 2K25A 4C1NI 4LW1A 2SEBD 2K14A 5ELEA 3FKYA 1JWSD 4DV4Q 2VZKD 2KYWA 4OONA 1WTRA 5K36G 4K3CA 5E6NA 4TSSA 4S3SA 1MPEA 3PREA 3UINB 4Y7NB 2IL8A 1SNOA 1CT1D 2KN5A 1NBFC 1K8GA 2M56B 4PYZA 4OL7A 3ZXRA 4MTKA 3ULLA 4HSVA 4QUCA 1YJ9A 5GXGB 1ENFA 4CHKA 4IUNA 5BN3A 2RVLA 3MHZA 3MFGA 1C1YB 2BYVE 3W1SA 5E1FA 4DR5L 3D4DA 2Q8IB 2WLBA 4L5TA 4KN4C 3OWFA 4CHTB 1QF6A 4KKIA 4DXFA 2KDMA 1ZXTA 4MZ9A 4DV7Q 3I4NB 3OJ3A 1VZ6A 2Q2TA 4C7YA 1KD1C 3Q8CA 2MGSA 5BYQA 4DF7A 3S15H 3HKZE 3F2UA 1FGUA 5EPLA 1D3ZA 2KC2A 1VCIA 1N5WA 2NS5A 3L0WB 3L2PA 1FYCA 3R93A 2JA8B 2LJIA 4K2LA 2UXBL 2N4FA 1C77A 3ZVVA 1JE4A 2R7DA 1K28A 4RA8A 4R4OA 3VR6A 2PKOA 2CHBD 4MJSA 1FO4A 3S1NB 3N1XC 3GTGH 1N33Q 2IY0B 1P1AA 4J3OD 4W9JA 3NWTA 4AWJA 5EE3A 2M4NA 3OYYA 3FPUB 1HHVA 1MHXA 5E6JA 2LMCA 2IX0A 5T1GA 2BPSA 5EBDA 3AE3B 3AEGB 2YU9B 4ZK9B 4PQXA 3F2DA 1SMYC 4BOSC 4DDID 3ECIA 4X64Q 1PZID 2EJFC 2F0FA 1VQEA 2K8BA 3H3VI 1WX7A 3V6EB 1W2BA 2TSSA 3CCLA 2WXJA 4M02A 1C4QA 4A3MG 2EKIA 4CJ1B 3S9WA 4W9HA 1TBEA 1X9NA 1GVPA 1XPRA 2TMPA 4KV6A 1TIFA 4GNXB 1HZ5A 2GOWA 3S2DH 3MEFA 4HKQA 4DAMA 1YNJC 4N58A 2LUMA 4QIWE 2C9WB 1HA5A 1FRDA 3FKIB 2EYOA 4GDKB 2DAJA 5DNFA 3AYHB 3AE1B 3N20C 1B44D 1JICA 1DD2A 1TT5B 3CSFA 3H8HA 3QIJA 2ZJPA 2PJHA 3L54A 2F0IA 2IW3A 3I55A 4GOPC 4A3MH 1MG4A 1WR1A 1K8AC 2KTRB 3AM9A 2RDHA 3N32A 3U7DA 2N3SA 1JMLA 5GROA 5KNBA 2OHFA 5I6YA 5M3MG 1YNXA 3JAMi 1TU2B 4KY5A 2N9XA 2LGYA 4I6PA 2XK5A 2JZPA 3WWVA 1YNNC 4K6DA 1VQFA 1SBBB 4LUVA 3VDZA 5FR3A 4ZKCB 3OTOQ 2N0SB 2WU5B 2UUBQ 1C9OA 4A3CG 1HEZE 4DV1Q 1UWVA 1LTTD 2QIEB 1D5ZC 2WXIA 4ANWA 5BMIA 3A33B 1BKBA 4L1BA 5LLIA 1E24A 1QJOA 3EQLC 2WNMA 1VQJA 3STBC 4KY6A 2I1JA 2WU2B 1E2ZA 3OJ4B 4FA6A 4QAYA 1HTQA 4W9KA 3WA0A 2K50A 4LF4Q 5AZHA 4DR3Q 1T3QA 2LVQA 5M3MH 1QOBA 2ZJDA 2O2LD 4K7WA 3NELA 3SR6A 3Q8DA 3WOFA 2FCQA 5CYUA 1RODA 1FCCC 1HUMA 4DV0Q 1LGRA 2MFIA 2N9EB 4HKZE 1LFDA 1STAA 3ZJVA 4A3CH 2BTEA 3HOVG 1VQHA 2QDLA 1CZWA 4RG1A 3BVZA 4TV3A 4FBJB 1GO3E 3U7ZA 3TS2A 2B2UC 4YTMB 1WJJA 4L6TB 5D65A 4GU2A 1SFOH 4K6LA 3N52A 2LJ5A 4GOCA 1Z9FA 4DAVA 5JJLA 1UE7A 4DV5Q 1L6VA 1KOTA 3A1QA 4DUYL 4C00A 1U5KA 4GLSC 3T3OA 3SEBA 4KTAA 4YCWA 4B3TL 1KDAA 3DM1A 1ZDVA 1KTKA 4HJGE 1AEXA 2MHJA 2B3GA 3KYDD 4ANXA 2IO3B 4B3RQ 1PDXA 1D1IA 1XT9B 1IGDA 3HOVH 4N6EB 4GKJL 4KIKA 4REZA 4FJZA 4USAA 1K0RA 2F3VA 3C1FA 5DM63 3VYRA 4XT1B 4XX5A 5M3FB 1TIID 1TKYA 3VR2A 4KN7C 2KJRA 1STYA 3CPWA 2RCFA 4C7ZA 3PUYA 3J80c 3TEWA 3CKIB 2IY5B 3TEHB 2AL3A 2PNHA 3CWIA 1PRTC 3A5ZB 4HMIA 2LY7A 1SAPA 2YVCA 3V61A 2XWJB 2VY3A 4JX1C 1IL2A 5HHDG 5JZEB 2WYQA 1VD2A 2WXRA 3BINA 2NVTB 2MCNB 2L5TA 3CC7A 1LLRD 2UUCQ 2BS3B 1F2RI 2WDTB 2V1CC 4IM0A 5GMVA 3RT3B 3H1UA 2Y0SE 4HMJA 4P72A 3W1SC 3T1YQ 5JEAG 4LF6L 2NVYB 2EYHA 3DBHB 1L0WA 4G0NB 4DWFA 3KF8B 1UE5A 4ZUIA 2YU9H 4DBGA 2EY6A 1HUNA 2G45B 4NW2A 1N8RC 2OQ0A 2N8NA 3D31A 1PA6A 1M94A 1UELA 2J52A 2KBNA 2KDIA 1XLQA 4M0WA 3QG1A 3P7JA 4JW0A 4BVUC 4PS3A 3IT4B 4B3SL 3PLVA 4JWSC 1ESFA 5L37A 1Q8KA 2KLCA 2RSNA 2R2QA 1YIJA 4BBNC 4AOFA 1EY9A 2AQ2B 2KCTA 1HNZQ 1G6ZA 1B7YB 3AU5A 3RUIB 2C35B 2AYOB 1BCPD 4BBSB 3T16A 2EQSA 3WOEA 5JEAH 3HRDD 3SGIA 3PPAA 3HKSA 3CC2A 2KWDA 1VQPA 2CWAA 1X55A 1DM0B 2HJ8A 4S17A 3ZKJC 1A70A 2GMIC 2DNEA 1JMCA 2UXDQ 1R7SA 1VS0A 1GUSA 4PV1C 4RMFA 1SYGA 3NE5B 4FYDA 2AWNA 3T53B 1QVFA 4APVA 2DZIA 1NDDA 1A6XA 4R9WA 2VQFL 1A2UA 3L9AX 2KMMA 4BKSD 2E6XA 1TVXA 3P20A 3HVZA 3M4OB 3B6YA 5CV8A 1IGCA 3H6NA 1A0IA 1XNRL 2WXHA 1WY8A 1PTOD 1V9PA 2Z4HA 5TSSA 1E0BA 1IBLL 4JI2Q 1FRRA 4RGOS 3BDCA 4N8X1 3V62A 5EKLA 3V6CB 1RM6C 3AE8B 4JBJA 1OTCA 2FCSA 2ZTEA 2QJLA 4K8JA 2KDEB 1UWXA 3DHHC 4XYCA 1VQDA 2B2TA 2XSCA 3LNNA 4KKTA 1ICFB 1K9MC 4BBNF 1GUGA 5H1SE 2ON8A 2MSED 2I5MX 4AJYB 1E7PB 1J6QA 3TJPA 1PZJD 5IGEA 5ISRA 1PH5A 1EQQA 2IGHA 1FEHA 2N7EA 5D7GA 1WJNA 2DYBA 2FIDA 1WTHA 4EQPA 1XX8A 4OXPA 1P3QU 2CU1A 5C44B 4HXDA 1TWHB 4LK0M 4P7IA 2WIIB 2KD0A 3V60A 1N62A 1IBXA 1U4AA 1SROA 2R7ZB 1Y8PB 3ENEA 2A69C 3K7UC 1DOYA 1ESRA 1WGRA 1NR2A 5IGDA 1E1OA 3HM3A 3U8ZA 4A8XC 3BIID 4K3BA 3AQQA 4OWWB 2NUCA 4C1NK 1N36Q 4IOIE 3VTVA 3RN2A 3R7QA 2KECA 1BQQT 1ILQA 4B3MQ 5H8YE 1LT3D 1LTLA 1IYJB 1EF5A 3KWVA 1WD0A 2XNAC 1Q0WB 1XQQA 1EOTA 2D3AA 4WJQA 3KUPA 2V4LA 2KHJA 4JOIA 4AH6A 3QCAA 3V3XA 3HOZG 2REXA 3DBRI 2L15A 1AE2A 1X32A 3LWUA 1MJCA 4P71A 2V4IB 2K22A 2KOXA 1NCVA 1HE8A 3KW5B 1SF0A 2QKIC 3S14B 4HEA1 1P8LA 1K53A 4LFBQ 3H94A 4DXAB 1RRBA 1PMRA 2ATWA 1SNPA 3CP0A 1BVSA 4DR5Q 1AWDA 3AU7A 4R1JA 1MFWA 1BMLC 2ZJQA 4JBWA 3HVDA 3UI2A 4KSKC 2KCMA 1R4MI 4PNYA
chains in the Genus database with same CATH topology
1SXTA 4ZAIA 1ET9A 3K5MA 1SEBD 3W9CB 2KVMA 2PYKA 1EU4A 1QOGA 1GUNA 4MT5A 5E4WC 4A3KB 4PMCA 5G3LF 4O1NA 3IL8A 5ELCA 5KYLA 4TQ1A 4CBVA 2R93B 4TKOB 2AWOA 3ZJTA 2OF1A 3SK4A 1S5BD 2V0GA 5C2TB 2DBYA 3SK6A 1SNQA 4RAUC 2PQEA 3OWEB 4PMBA 2H88B 1AZQA 3CU7A 5C0XJ 5FO7B 1NSNS 1IYVA 3NUHB 3K5LA 3BG3A 5ELDA 5FLXE 3ZYYX 3N9YC 5IODA 1QOAA 4IUUA 2ZXOA 3MA2B 5JXVA 3K58A 1EIHA 5EKIA 1AFPA 4FXCA 1C4AA 4U68A 2WXLA 1TY2A 2CU3A 4Q2JA 1WTOA 3DWGC 5I9OA 3S17B 1EQVA 4JWUC 2FHTA 1SNMA 1V8CA 3KQ4A 3BZDB 2VB3X 3P42A 1SIJA 1ML0D 2F4IA 5IT9L 2M2LA 2EELA 4A90A 1PGBA 2IJ0A 1F2ZA 1XF5L 2M0AA 4MN3A 1MSGA 3J9CA 4N9TA 4Q0FA 2X6GA 1WTPA 2O5IC 1BUIC 3BYTB 3FPPA 5J1ZA 2K9XA 2RMMA 3MZ5A 1UEAB 4XDDA 3TP5A 3MEHA 1EU3A 5JOBA 1EY0A 5C3WA 1VMPA 2AX5A 3U52E 2L83A 4IALA 1SSOA 1V1OA 1S5CD 5IGGA 3NZ3A 3A7LA 1L0VB 4QF4A 2B2TC 1TS4A 3K0YA 3RLFA 4JK1C 2ENBA 3Q22A 1CJEA 3RUZA 1F9SA 1CA6A 1EYAA 2L0CA 2MJ3A 3PO2B 3PZ8A 1CQVA 1H9RA 4ID6A 5HI1A 3VR8B 2BB5A 5EGTA 1IYUA 2WXKA 2RBMA 5I9PA 1O7ZA 1ZUD2 1JWMD 2EYLA 3AEEB 4X3SA 2EJGC 1U4LA 1S5DD 4K5VA 3ITPA 2PVGC 2ZW1A 5IGBA 1B50A 3S1RB 1F9PA 2RDGA 3I57A 3QJYA 2NMQA 1D6EC 2XWBB 3W3AA 4WORA 4A3FB 2N9LA 3T51B 4CGYB 3SHLA 4NAWB 1WGKA 5CV9A 1PGAA 4DA2A 1O80A 3K6OA 2K5PA 2EJMA 3HKZB 3T56B 5JJZA 1GAQB 3B2GA 3E6ZX 4FXDA 2K03A 4NDXA 1K8MA 1Q1EA 2MJ8A 2KUMA 2K32A 1H9SB 1EQTA 3QOLA 4H13C 4KGRA 2MJDA 3Q0AA 2HDEA 5HURA 3TP7A 3A8IE 1YJJA 3AMZA 4GZYC 1C78A 1FM0D 2XIWA 2PW5A 3SFEB 3AE7B 3I4LA 1C8CA 1Q90A 2KA7A 3S15B 3HP3A 1V1PB 3KK7A 1RCVD 3FC4A 4I7ZC 4XDCA 4G4KA 1FXIA 3JAML 3A54A 3QOJA 3FVQA 3RZDB 1C9FA 3A56A 2MH7A 4H0LC 2JSVX 4QIWB 3GTGB 5AUIA 1TWAB 1EZ8A 4IUPA 2ZW0A 1E6EB 1B9MA 1DCZA 1SJHD 2L32A 2NB0A 1TT2A 3VR5A 4EVOA 5EE1A 1TYGB 5J22A 2EYPA 4A93B 3TZDA 4OGQC 1HTPA 3LX0A 3FILA 2QILA 4IKGA 3S2DB 1AYFA 2H4OA 1GB1A 3X3NA 1O7LA 4H44C 5A2QL 1UGJA 1Q10A 3MP9A 4MACA 1KRHA 2IDYA 4A3MB 4UDUC 2SNSA 4J1MA 4B08A 5HGTA 2JX5A 2CQAA 2D62A 5CV6A 1F77A 2NN6G 5AFWA 2F0GA 1PFBA 1B9NA 2IT1A 1N63A 4TMAB 1OXTA 1UNSA 4YIJA 2WKDA 1E0ZA 5M9OA 4ODGA 1JOQA 1ZEQX 3OHXC 1JOKA 3AE6B 1LT5D 3D4WA 3EJIA 5M3MB 3PZ7A 3FDTA 2DYOA 3GP7A 4LMQD 4DAPA 1H9KA 2NN6H 5JVG3 4RH6A 1JR0D 1D5XC 2WDQB 1JALA 5ELBA 2VB2X 1QILA 1LABA 1A2TA 1GXDC 2F0NA 3HZXA 1OQQA 3I72A 1SFOB 1PRTB 3PIP3 2ZXPA 1Y1VB 5NUCA 1PFDA 3T4AC 1MD2D 3FEWX 2EYFA 2Y0SB 1VR9A 1Q12A 2BS4B 3HOVB 1MBYA 2HCIA 4KJNA 4IDIA 1WTXA 2LS01 1CI3M 4HTHA 5K36H 4F87A 4FVMA 4ILWA 3E5SA 2NTSA 2WP8J 1PUTA 4G7OC 5I2XA 5C0XG 1GUTA 3NTHA 3DHQA 3Q8FA 1N60A 5M5XB 4US9A 3MVVA 1G2TA 1OQRA 3NSWA 1HA6A 2L4NA 1CHQD 3IAYA 5G5HA 1JWAD 2LMCB 5C3EB 2QDBA 1TS5A 2Y3AA 2PZWA 3SR1A 4YTPB 2W3SA 2F0SA 1TQOA 1PXUA 3U9SA 1ZOYB 5COYA 1KNAA 4K8IA 4FF1A 1KABA 2GI9A 3NBHA 3PIO3 2B8GA 4RGTA 1ZPSA 1PTOH 1HFGA 4H2AA 2QMTA 4DAYA 2V3PA 3ZGZA 4XQJA 3K5NA 1DYQA 1LTGD 4IUVA 1BCPC 1EWCA 1DOMA 4N9PA 1CQFA 2Y5CA 4YTNB 2PO4A 1AW7A 2L11A 3P4PB 3WCQA 2OEOA 2DWQA 3EROA 2IPKD 1OXUA 4WURA 3IFTA 4RCNA 4NKLA 2O4XA 1E10A 1RJTA 2VXWA 4V0BA 2J0TD 1PTOC 4L23A 2YEPF 4XQQA 2BDOA 1CZGA 4LTUA 2BT6A 4RNAA 1S4ZA 4XWTA 3SXHA 3U9OA 2INNE 1XEEA 4CQNA 4NP5A 2BA1A 3I8ZA 3H09A 3QO2A 4DK1A 4ITKA 4JPSA 5IIFA 3OIPA 1NEKB 1VRAB 2JXMB 2NZ1D 1K52A 1LTID 1UUPA 4YT0B 1SE4A 1FIQA 3OPOA 4C3HG 4LJZC 1EYDA 1BOSA 1QB5D 3HOUB 1XTCD 2F0UA 3B9JA 3ONAB 2IX3A 1HQMC 2SDFA 3J81L 3LXFA 1WCMB 1VLBA 2WS3B 1FNWA 2FMCA 1LTSD 2E3TA 1BXTA 4WIPA 3ZQ4A 4XYOA 3FAHA 3EFXD 5D14A 4KJOA 1GHJA 3VR9B 3HOZB 1FFVA 5CR3A 1ZP0B 1NUCA 1TWCB 1RWSA 2BBCA 4ZRPA 5IT9E 2J53A 2B2YA 2A68D 2H89B 4RGNA 1ZE3D 5LHY1 3AH7A 5JVH3 2CJOA 3PUVA 2B39A 1BF4A 3MXUA 2EY5A 1BCPF 1W6JA 1LTAD 3NHHA 2M9VA 5CC4A 2JA6B 1QKZA 3GTMB 4WRDA 3NRZA 1QLBB 1AZPA 3D8GA 1WWTA 2A6ED 3S2HB 4OO1I 1TKWB 2BE5D 4JE3B 2KACA 4OZBA 2PZTA 3M7NA 4Q5VA 3VYUA 4U673 1PTOF 3D3RA 4R3DA 2F0EA 1ILPA 3OMCA 1JQYD 2WDVB 1JWBD 1TWFB 2RA4A 4DQOC 3S16B 2G9HD 1N61A 1KDCA 3GTJB 3K59A 4QUFA 1CA5A 1DZ1A 5KNDA 2GA4B 2JXTA 3PUXA 1STEA 1IBXB 1LACA 2B76B 4C3JG 1QNUA 3GTLB 4XXEA 2G9DA 5CMDA 2E2HB 1JWUD 4IFDI 3TEXA 1BDOA 1LT4D 4X3UA 1R9TB 4RF0A 1KH0A 2K6AA 2F0OA 2PPBC 3R2IA 1F0ZA 1FXAA 3NS1A 2A6HD 4B9XA 4QMGA 2M19A 3NQIA 2EOTA 2D5GA 1ZYRD 3IAS1 4XWWA 1Z47A 3VQIA 5EBCA 3E9SA 1L0XB 4C3IG 2QF7A 2WACA 1EL0A 1C79A 4CKBA 4L2YA 2F0PA 2DN8A 1EYCA 2LHEA 5F2DA 2VZKB 3W5UB 3A55A 1U4RA 1BBXC 5FO9B 3SVMA 1DOXA 1LTRD 2AQ3B 1VMCA 3TMEA 3JAME 5E4XA 4BA1I 2HTME 2KHSA 1AN8A 1M4VA 4BY7B 2NN6I 3EUB2 4RWSC 2KCNA 2AUJD 5EE9A 4A3DB 1B3AA 3P4RB 2NYZD 5A35A 1GUWA 4WAFA 2QCPX 1WTWA 3SDZA 2DNCA 2WB1B 4WFN3 2B2YC 1I4PA 1Q1BA 2PLPA 2HQEA 2F0VA 1IL8A 1YQ4B 4KY7A 2R92B 2F0TA 1XLNA 5A2QE 3VR4A 3VYSA 3MXNA 4FF4A 3H3VC 1OXXK 3MFYA 4X3TA 4DFAA 2KJXA 4CKCA 1TKEA 1A3TA 4DN4M 1UWMA 2EVBA 1S5FD 2Q8TA 1JORA 1EY7A 3RPFC 4HRSA 2FFKB 5KYIA 5G5GA 3NUCA 4ABNA 1U4PA 4O42A 3OSOA 5BYRA 2Y5PA 3M4YA 3OW7A 5I2YA 2HDMA 3Q8BA 3L3OC 4XQNA 1EM7A 2B2WA 4K14A 3NVYA 2Q8RE 3AE9B 3SK5A 5IGCA 3P1HA 4M1UB 2K3UA 5E3FA 3ABVB 2PMZB 1XWEA 1T5XD 2DY8A 4YSXB 2INPE 1I6VC 5KEEA 1HXYD 4HROA 3AEFB 1QG7A 1I4RA 2IGGA 3VA5A 2JEBI 4WH4A 3D4RA 2R6GA 4BA2I 1PGXA 3K57A 4NZLB 2L52A 1OXVA 5CBAE 4F88A 1STHA 2K1BA 1A3UA 3IFDA 2JYTA 1BNZA 2LFIA 4OVZA 4ZUJA 2WAQB 1J7CA 5KNCA 2QSDA 2EDGA 3RMHA 1FGBD 4QCLA 3TP6A 4F8MA 1WYGA 1XCQL 1T5EA 1EY6A 3DWMA 2MUYA 2LHDA 4UAIA 2F0WA 3MXGA 1C4PA 2E2IB 1QNKA 5FOBB 1TJEA 1I4XA 1E2VA 3FRPB 1K8OA 2KAJA 2VUMB 1IW7D 3DXJC 2B63B 1F2RC 3W2DA 2SOBA 3L4PA 2JA7B 4FP5D 2N7JA 1VDVA 2XRQD 3A7AB 3KBXA 3HRZC 4FO2A 3R8BA 4BBRB 3VRBB 3J7AF 2MEKA 1SNCA 1P7EA 1F9QA 3DWQA 3RD4A 4ZHOA 1HTLD 4H7BA 3I9V1 2I46A 3NVVA 3Q6SA 2WDRB 2PW7A 4ME5A 2BYTA 2W82A 1BCPB 3KWLA 2Z1CA 1JOOA 2A73B 4G7HC 4DU9A 2F1MA 1W6KA 4OIJA 1LO5D 4FNFA 3GQBA 5I6WA 4XTCS 4A3IB 2L1BA 3S1QB 3AN1A 3FILB 3O13A 2B2VA 1TY0A 4G57A 3PMFA 2H1EA 1PTOB 2V4DA 3AB9A 1X3PA 2KQ4X 3OMGA 4DNRB 1B2TA 1GUOA 2AUKA 3M7GA 1YN5A 2EYMA 1G91A 1O7YA 5C3XA 5LNK1 2QEJC 1EEID 4RKBA 3X3MA 5JPMC 2YYZA 3U4EG 1R4PB 2LGIA 4NAMA 2KEEA 4ZRZA 1MI2A 3I91A 1SE3A 1MHHE 4KX6B 4ZRQA 2B2WC 1NYRA 3MXPA 1S5ED 4EQOA 1I4GA 5LL6X 1A3VA 3I70A 3J81E 4RHSA 1JW9D 2E74C 4XT3B 1K83B 4GDLB 4BS9A 2M00A 1KF6B 3NVWA 1KAAA 4RCOA 1SJED 1EWHA 2EY2A 2F3WA 5IGFA 4OW0A 2F0LA 3GD7A 5IOCA 1SB3C 5CBEE 3P1MA 3SE0A 2XN9C 3GS2A 2HUGA 3E56A 4M8AA 3NK9A 3L7ZC 1YJIA 1XXGA 3KLRA 1PFMA 2NBFA 1FFUA 3MWYW 3G6JB 4P6VF 4DK0A 2DLBA 1GHKA 2IGDA 1U4MA 1CHPD 3M3YB 3VYTA 1ZXHA 4DGZA 1U9RA 2MPMA 4B0MA 1EY5A 5C6AA 1RYJA 2DY7A 1P7FA 1B1ZA 4FF3A 2EPBA 2XVSA 3AECB 4QB4A 2WXMA 3DUZA 1L4ZB 3NTKA 2NTTA 3SFDB 5T8IA 2I07B 5KGUA 2N55A 4C3HB 1KFYB 4X3KA 1WTQA 4KKSA 3OOCA 1SYCA 4ZHPA 1D4BA 3EGRA 1LT6D 3BDLA 4J6HA 2OXPA 4KK7A 5EPJA 5D3DA 4ARCA 2DYMA 3CIRB 1C48A 2K5WA 2EZVA 5C0XH 1ZXIA 1VZ8A 1OFFA 1HFNA 1NR4A 5H92C 1WTVA 1UAPA 1Y8NB 5CORA 3MJ5A 5HG2A 2WXOA 2A68C 5BN5A 3S1MB 1XYIA 4ZQ3A 1CFMA 3C8YA 3R2TA 3UI3A 2RDFA 1JROA 3N6RA 1VF7A 4P16A 3WDNA 2J4XA 1SE2A 1CM9A 2L9HA 1N5XA 5T1IA 3AE2B 1STBA 1JRPA 2EYJA 1IKMA 4YSZB 3GV3A 4RHRA 3R3OA 4IURA 2A6EC 3E0JA 3SK8A 4CJ2C 1RHPA 4IZ8A 3ND9A 5K5PA 3HEJA 3ND8A 1EIGA 2BE5C 2F03A 1CZPA 1D5MC 5DAUA 2B2VC 1B9RA 2ONQA 4P2CB 2ZT9C 5AUKA 5KIXA 3D6WA 1DOKA 4OHJA 2LFNA 2PIAA 5ELFA 4ZKBB 4A55A 1XLPA 1Y1WB 3BS1A 1IUEA 3B2FA 1J9OA 1RDPD 4YSYB 4BY1B 2MJEA 3IT6B 3BK2A 1GB4A 1DXMA 5C4ZA 1CTMA 2BB6A 5CV7A 3VA7A 5CGKA 5BN4A 1Y69U 1F9RA 1WD1A 2R3ZA 2JYOA 4FF2A 3AE4B 2W54A 4HCEA 4OZAA 3VR3A 1EY8A 5LL6S 4CJ0B 2R61A 1I50B 2BDNA 4WQMA 3G7LA 3AE5B 1YN3A 5C4HA 5BYSA 2X69A 4WWMA 1JB3A 4IQZA 3J80L 2OT2A 3C3LA 2K0PA 1DOLA 2RQXA 3OIQA 4ARIA 2JSOA 4C3JB 1YN4A 1DONA 2FJ2A 3V05A 1AP0A 4KKJA 5HFYA 1X3QA 4HN7A 5BMGA 2A6HC 1PFNA 2XRSD 1JQ4A 2KOLA 3J7YW 4ZLTF 1L6UA 1LV9A 3IXSA 1ZYRC 2D5DA 2BW2A 2K33A 5DM73 2ICEC 1QE6A 1XO3A 4A3BB 2MP1A 1C4CA 4IUTA 1TKGA 3LWEA 5EE0A 2BA0A 3BYYB 3AEDB 2A74C 2JA5B 1XCTL 2EXZA 4TQ0A 1G291 1SMYD 2EY1A 4PMWA 2F0KA 5EKKA 2C5CA 4RKLA 3KF8A 2RPVA 4C3IB 4HAEA 3FMCA 4NMZA 2IWHA 3C46A 3Q23A 2K01A 3NPPA 3HGBA 4LAAA 1YNJD 1GPXA 3KLSX 5I4DA 1FR3A 2WXFA 1KLUD 1QCBD 3PUWA 4A6QA 1NYQA 2ICIA 1HPCA 3PV0A 4IFDJ 1RTNA 2K28A 4PT5A 1ET6A 3BVMA 3CQZB 3ETRA 1YNND 4KMUC 2J42A 1HZ6A 1NAPA 1VF5C 2OEDA 2AQ1B 1LTBD 5CV4A 1TS3A 4KHZA 1I4QA 1G8ZD 1SYFA 2KCCA 5C5LA 2L12A 1FD6A 2F0HA 5M5YB 1BR9A 3MAQA 1WRIA 2JU6X 2RSOA 2CW0C 4OIKA 3GTPB 4ZYSA 4C80A 1VJKA 2WV6D 2BOSA 4TQUS 2PZUA 2X6LA 2E75C 4L63B 4V190 1IHZA 4WJWA 2ACZB 3P4QB 4NJCA 3Q24A 1DJRD 3H0GB 2NVQB 1K51A 1RFKA 3KLSA 4KD3A 3DEPA 2E76C 5EPKA 3GTKB 1H9JA 5FK9C 4YWGG 5M5WB 2Z8LA 1YNTE 3EA6A 4HEDA 4OZCA 3CRKC 3LYYA 1L4DB 3TDQA 1STGA 4BWGB 1WVLA 2PNRC 1PYWD 1NENB 1V97A 2LEKA 4YXDB 3GB1A 4F7XA 5BMHA 4B9WA 1KNEA 1SYDA 1QQRA 2FUG1 3W5VB 4US8A 5MPOA 1B53A 1YMHE 1B4OA 1PRTD 1PRTF 2SAKA 3I90A 4R8IA 4XDXA 2FINB 4MIUA 1I7HA 1Z7TA 3EVQA 4DXGA 2VNUD 5DEHA 2V3NA 1OO9B 1J7AA 3BVGA 1BO0A 1JC7A 1JCKB 1D2BA 4A9AA 3T3NA 2N9KA 3HOXB 5C4XB 2FBWB 3CHBD 3MHBA 5G3LD 2JP1A 3DWPA 1D1KA 1DGJA 1I3QB 4C2MB 2W3RA 4KGSA 2D2CC 1ONLA 3A8JE 2F0DA 1PLFA 3ERQA 1ENCA 1RF2D 3Q8AA 2LKVA 2WINB 3T13A 3TUOA 4D2KA 4LK1C 2WXPA 4XE0A 4CKEA 3NWSA 2WP9B 1FD7D 1TWGB 2WXGA 1IKLA 3HOYB 3PO3B 3PO0A 1IW7C 3TP8A 4AQ7A 1WXQA 2GRIA 1I4HA 4XIGS 2K5DA 4K5XA 2RKSA 2CW0D 1CK1A 1YQ3B 3P4SB 1NI3A 2FE8A 1ICWA 1L0YB 4IUQA 4RF1A 3MTSA 4MM3B 2WXQA 3Q8EA 4EE2A 4K5WA 3TZUA 5JAVA 2JEAI 2K5QA 1ZKOA 3GTQB 5C5MA 2NVXB 2NWGA 3BDOA 2WKCA 5C0XI 1MVKA 4KKUA 1R4QB 3DWAA 1Q3LA 1EZ6A 1Y56A 2BCOA 5FO8B 4A3GB 1L5PA 1V43A 1EY4A 3A8KE 2A69D 2JE6I 3HUIA 4FXKC 1M8AA 2G1EA 2HDLA 3P75A 3TSSA 3I4MB 1KDBA 1SDFA 3DMUA 4MH8A 4R8NA 1II3A 2BS2B 4E6IA 2X38A 3IAM1 4TRDA 1RKNA 2N88A 3NP8A 2IX1A 3AB5A 4LLGM 2YEPB 2PCFB 1GJXA 2E2JB 3TEYA 1MSHA 1GOZA 1QOHA 2PVOD 1FMAD 2K7VA 2L1AA 4XYQA 2FMMA 4FXGC 1ROEA 5FKAC 2CVRA 1F2MA 3AEBB 2F0JA 3I73A 3NTIA 1QOFA 2PW9A 3RFZB 2JWUA 1SSNA 4C56C 2WXNA 2I2YA 3ZJUA 4HR7B 3VRAB 1PDQA 1RD9D 1WSPA 3HS0C 1O78A 3DEOA 4EGVA 3GV6A 3NVZA 3QIAA 1SNDA 1HCZA 3NXWA 1EFID 2SNMA 3HG9A 4OO1G 1G2SA 3RZOB 3TBIB 1VZ7A 4KHVA 4A3JB 1FCLA 1HQRD 1QT9A 3C2PA 4HSPA 3V2TA 2PTLA 2KN4A 2GB1A 4AYBB 1ACCA 4A3EB 3V96A 5D3IB 4N59A 3AEAB 3K5OA 5JEAJ 1MGSA 4OO1H 1FNVA 3TEZA 2J7ZA 4IN3A 2O5JC 1EWYC 2W55A 1H9SA 2K04A 3TN2A 3GTOB 4ULLA 3M85A 3PUZA 3HOWB 1K50A 3C1EA 2ID0A 2L55A 3URYA 3NBIA 2WQYB 1VDZA 5CV5A 2KQ3A 1V8QA 2B8FA 3J7AV 1RTOA 1V1PA 2CJNA 3GO5A 2PMVA 4IFDG 1Z6HA 1F2YA 3BK1A 3AV8A 2C9OA 1FNUA 3D6CA 5C4JB 1PZKD 3BWUD 2Q5WD 1BUVT 1TS2A 3QWNA 1ENAA 4J8QA 4ZOHC 2E2DC 2Z4IA 5JPNC 4RFBA 5FLXL 2MHVA 1SYEA 2F0MA 1MI0A 1ZDXA 2D9UA 1TR5A 1XLOA 4KGTA 1E9MA 1Y8OB 4L8JA 4IFDH 1A15A 2K05A 3KBGA 1E2WA 5KRUA 3K7AB 2ZXRA 5EJWA 1NVID 1STNA 3AMUA 2I38A 1HRJA 3P63A 1SYBA 3QB3A 3J80E 1OXSC 3H6MA 2KEDA 4HCSA 1DOIA 4KI0A 1T6BX 2HCCA 3CRLC 3U2SC 5J39A 2A5HA 3H91A 4G7ZC 1TZOA 1EEFD 4RGMA 5EQ0A 4AS1A 1H9MA 1J8IA 3MC0B 2B2UA 3Q69A 3I3CA 3IKJA 2JYEA 1F2LA 4Z9CB 4DNTB 3LB8C 1KLGD 4K2KA 2F0QA 5C3JB 1I6HB 2JQRB 1Q8IA 4EQNA 2EE1A 3NQTA 1J7BA 4MHEA 4B0EA 1C76A 1QWYA 4I65A 4KD4A 4C1NI 2SEBD 5ELEA 1JWSD 2VZKD 1WTRA 5K36G 4TSSA 4S3SA 1MPEA 4Y7NB 2IL8A 1SNOA 1CT1D 2M56B 4OL7A 4HSVA 4QUCA 5GXGB 1ENFA 4IUNA 5BN3A 2RVLA 3MHZA 3MFGA 3W1SA 5E1FA 3D4DA 2Q8IB 2WLBA 1QF6A 4KN4C 3OWFA 4CHTB 4KKIA 4DXFA 2KDMA 1ZXTA 3I4NB 1VZ6A 4C7YA 3Q8CA 2MGSA 5BYQA 4DF7A 3F2UA 5EPLA 1VCIA 1N5WA 1FYCA 3R93A 2JA8B 2LJIA 4K2LA 1C77A 1JE4A 4RA8A 3VR6A 2PKOA 2CHBD 1FO4A 3S1NB 4J3OD 3NWTA 5EE3A 3FPUB 1HHVA 1MHXA 5E6JA 2LMCA 2IX0A 5T1GA 3AE3B 5EBDA 3AEGB 2YU9B 4ZK9B 4PQXA 1SMYC 1PZID 2EJFC 2F0FA 2TSSA 2WXJA 1C4QA 2EKIA 4CJ1B 3S9WA 2TMPA 4KV6A 1HZ5A 4HKQA 1YNJC 4N58A 2LUMA 1HA5A 1FRDA 3FKIB 2EYOA 4GDKB 5DNFA 3AE1B 1B44D 1JICA 1DD2A 3H8HA 2F0IA 2IW3A 3AM9A 2RDHA 1JMLA 5KNBA 2OHFA 5I6YA 1TU2B 4KY5A 2JZPA 1YNNC 4K6DA 1SBBB 5FR3A 4ZKCB 2N0SB 2WU5B 1HEZE 2QIEB 1LTTD 2WXIA 1D5ZC 5BMIA 4L1BA 1QJOA 3EQLC 2WNMA 4KY6A 2WU2B 1E2ZA 1T3QA 1QOBA 2O2LD 3SR6A 3WOFA 5CYUA 1RODA 1FCCC 1HUMA 4HKZE 1STAA 3ZJVA 2BTEA 1CZWA 3BVZA 3U7ZA 2B2UC 4YTMB 4L6TB 5D65A 4K6LA 3N52A 4DAVA 1L6VA 3T3OA 4GLSC 3SEBA 4KTAA 1KDAA 3DM1A 1ZDVA 1KTKA 4HJGE 1AEXA 1PDXA 1D1IA 1IGDA 4N6EB 4REZA 4USAA 2F3VA 3C1FA 5DM63 3VYRA 4XT1B 5M3FB 1TIID 1TKYA 3VR2A 4KN7C 1STYA 4C7ZA 3PUYA 3TEWA 3CKIB 3CWIA 1PRTC 4HMIA 2LY7A 1SAPA 2XWJB 4JX1C 5HHDG 2WXRA 2NVTB 2L5TA 1LLRD 2BS3B 1F2RI 4HMJA 5JEAG 2NVYB 2EYHA 4ZUIA 2EY6A 1HUNA 4NW2A 3D31A 2J52A 4M0WA 1XLQA 3QG1A 3P7JA 3IT4B 4JWSC 1ESFA 2RSNA 1EY9A 2AQ2B 1G6ZA 1BCPD 4BBSB 3T16A 3WOEA 5JEAH 3HRDD 2KWDA 1DM0B 1A70A 2DNEA 1R7SA 1GUSA 4PV1C 1SYGA 3NE5B 4FYDA 2AWNA 3T53B 1A6XA 4R9WA 1A2UA 3L9AX 2KMMA 2E6XA 1TVXA 3P20A 3HVZA 3M4OB 5CV8A 1IGCA 2WXHA 1PTOD 2Z4HA 5TSSA 1E0BA 1FRRA 4RGOS 3BDCA 5EKLA 1RM6C 3AE8