1SE4A

Staphylococcal enterotoxin b complexed with lactose
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
239
structure length
239
Chain Sequence
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN B
publication title Residues defining V beta specificity in staphylococcal enterotoxins.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 66
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 1997-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1se4A01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1se4A02
5FKAC 1UUPA 1LLRD 1BXTA 3R2TA 4BWGB 1JWSD 1HTLD 3GP7A 1DYQA 2WV6D 1RD9D 2QEJC 4RGTA 1EU3A 1S5CD 1FNWA 1F77A 1I4RA 1JCKB 1XXGA 4O1NA 1TY2A 1D5ZC 2NTTA 1JWMD 3DWPA 1BCPB 2XN9C 3EFXD 1HQRD 4ZYSA 1V1OA 1LT3D 1FNUA 4DXFA 1V1PB 1AW7A 2XRQD 1S5FD 2AQ1B 3TSSA 2SEBD 1ET9A 1LTBD 1PRTC 3BZDB 2TSSA 3DWAA 2XRSD 1LTSD 1CT1D 1EFID 1LTID 1PRTD 1BCPF 4RCOA 1EWCA 3R2IA 1YN4A 3EA6A 1PTOC 1B1ZA 3BVZA 1I4GA 1V1PA 2J4XA 3V05A 5ELEA 4RFBA 1EEFD 1I4HA 1PZID 1PTOD 3MC0B 2RDHA 1BCPC 2IJ0A 1PYWD 1SE2A 1KLGD 1D6EC 4TSSA 1LTTD 4Z9CB 3BVMA 1FD7D 1PZJD 1XTCD 1LT5D 3OWEB 2Z8LA 1I4QA 1CQVA 1EU4A 1PTOH 1B44D 3CHBD 4K6LA 1STEA 1KTKA 3DWQA 2CHBD 1LT4D 4RGNA 1DJRD 1SXTA 4RHSA 5D3DA 1EEID 1TS5A 1S5BD 1LTRD 1SBBB 1LT6D 3URYA 1PZKD 2R61A 2XNAC 1SE3A 4RHRA 1M4VA 2O2LD 2AQ2B 5ELFA 4UDUC 5ELCA 5I4DA 5ELDA 1AN8A 1L0YB 1LTAD 4RGOS 1BCPD 2IPKD 1D5XC 1HXYD 1TS2A 1MD2D 1T5XD 1HA5A 1S5DD 3KLSX 3O13A 1S5ED 3W2DA 1LTGD 3BVGA 1RF2D 1YN5A 1JQYD 1TY0A 5TSSA 5FK9C 1TS3A 1RDPD 2RDGA 1I4XA 1LO5D 1PRTB 1RCVD 5ELBA 2ICIA 1ESFA 1UNSA 4DXGA 2G9HD 1FGBD 4L6TB 4RH6A 1KLUD 1PTOB 1ENFA 1JR0D 2NTSA 3BYTB 1JWUD 2QILA 1YN3A 1CK1A 1PRTF 1SJED 3SEBA 2AQ3B 1FNVA 3R8BA 1D5MC 1SE4A 3BYYB 4C56C 4L63B 1I4PA 1QILA 1SJHD 1G8ZD 1PTOF 1CHPD 1CHQD 4NZLB 1GOZA 1SEBD 4OHJA 1ET6A 3MFGA 5D3IB 4RGMA 1L0XB 1TS4A
chains in the Genus database with same CATH superfamily
1O80A 4OVZA 1JWSD 5M5XB 1FEHA 2YU9H 2IO0B 5LMNQ 5IYCH 2KLCA 1RD9D 4N8FA 4N8X1 4RGTA 2LXAA 2W82A 4R4QA 4DAVA 5KNBA 2KDFB 2VB3X 1XLPA 1FNWA 1F77A 1N5WA 1I50B 2C5CA 5C4XB 3JC66 5J1ZA 2WWZA 2MPMA 1T0RC 4ZYSA 3PRPB 4MT5A 3VRBB 4DR6L 1WGDA 5AJ3Q 1RKNA 3QOJA 4A3BH 1TIFA 3U8ZA 1GUNA 2ZJPA 4EQ5A 4R1JA 3GB1A 1IBXB 2Z4HA 2LJIA 3T16A 2QHOA 4TMAB 3PO2B 1KH0A 2MSED 1EFID 1BCPF 3KBGA 1SNDA 2ZPNA 3EA6A 2FJ2A 2R7FA 4GOCA 2JYOA 4HSVA 5C4ZA 4OZAA 2F0MA 1IBXA 3RN5A 2DZIA 2PJHA 4C3IB 2QC8A 1NVID 1ASZA 2HIVA 1VQFA 1WR1A 2PEAA 4BKGA 3A54A 4GN5A 3JW0X 1R7SA 1BBUA 3OTOL 3FPUB 2BH2A 1WZ0A 3I9V1 2JA8B 4XC2A 2VNUD 2LUEA 5CHVC 3EJIA 1PH6A 3MZ5A 1ZEQX 1IYJB 4DAMA 2J0JA 2L8JA 1C79A 2L05A 3U2SC 1X3QA 3NWTA 3U4ZA 2EYMA 4LF6L 3I4NH 5KGUA 4ABNA 3DPDA 3PHWB 5HI1A 5CV6A 4OIKA 1SROA 4HN7A 1CMXB 5CBAE 4H02A 4DR7Q 1RHPA 1M1KC 1GUTA 1VLBA 1XLOA 2RSNA 5J18A 5M3FH 1ILQA 1PGAA 2WXNA 2DENB 2GBKA 1OXXK 3DOWA 1XLQA 1PH4A 2E2IH 1F2ZA 4UDUC 5LHY1 1C77A 1J5EL 3V96A 2UYZB 3OHXC 4JOIC 5ELDA 5C5LA 1FRRA 3F2UA 1I6HH 3M62B 2LUMA 4XQJA 3RNAC 2X6LA 2LS01 1N34L 3ULLA 1H95A 1C76A 1EF5A 1HXYD 2JZ3B 3SK8A 1TXYA 2ZTDA 4B9WA 2KUMA 2BWES 2WXIA 3NOBA 3W2DA 3MWYW 5M5YH 3PRMB 2NVYH 2ON8A 2AKWB 4D2KA 2L9HA 2IX3A 1NDDA 1G6JA 3GTJB 3KQ4A 1C4PA 3UQAA 2FBWB 3HOYG 2Q2HA 3PO2G 4ODGA 3KLWA 4HR7B 3SVMA 2Y0SE 3DLLA 2F0DA 4HWIB 4E3CA 2I2YA 3RR5A 4RKLA 3ULJA 4A3FH 1CI3M 2UUAL 1BUVT 1JWUD 1YX5B 3PUVA 4ZK9B 4EVOA 3S1NB 4C3IG 2JA5G 1PH2A 4LF8L 3FMCA 3VUXA 4KKTA 2JUOA 5IGGA 5AJ3L 3S14H 3KYHC 3K7AB 4Q5VA 2CS4A 2BA0A 1LM8B 4C1NI 4W9LA 2LY7A 2CH4W 4IW0A 3CCSA 5AZGA 1TS4A 3M85A 1RJTA 4CHTB 2JZZA 2L83A 1SYCA 2A68D 4JX1C 2WV6D 4MJSB 1K8OA 2I1JA 5IGDA 4DHJD 3DVGY 3H3VC 4MH0E 4HROA 1YNJC 3HEJA 3GE3C 3Q24A 1WTPA 4BY1H 2KBNA 1L6UA 4KHVA 4MJSA 1KJTA 1OQRA 1HQRD 3OW7A 2D0PA 1L5PA 1FNUA 3KYDD 2ZJQA 4N58A 4ZUIA 4K2LA 2B63B 5LL6S 1LTBD 3DXJC 4PZ8A 4C3JH 3HZXA 1LXDA 5M3MB 3L0OA 1BF4A 3GTMB 1CT1D 2KHJA 3JYUA 3VUYA 2EDGA 4AJWA 3GD7A 1C3TA 4A3DB 3IG3A 3EGRA 5IYDG 2KFJA 1GUSA 2LWPA 3WANA 3HS0C 4DV7Q 1XPRA 4YL8A 5L95C 5IO9A 2FXQA 4XYOA 4PS3A 2RDHA 5AZFA 2D2QA 5C1ZA 1D6EC 2A1AA 1C7YA 1A5RA 4YT0B 5I9PA 3PUZA 2PVOD 5A2QE 1VQIA 4OL7A 4Q0FA 2BKRB 1ACCA 1U4MA 1N61A 4JQWC 5BN5A 4CKBA 1DOXA 2OEOA 1TIID 4XE0A 3EFCA 1A3VA 1OTCA 3NTKA 5DNFA 4NXNQ 4KGRA 1VQ5A 4GN1A 4ZRJA 3VR9B 4CGYB 4XTCS 2WXKA 3NVZA 1Z5SB 4A3JB 1DGJA 2HE7A 5C3XA 4JWSC 4DV5Q 1JWBD 5FLMG 3MVVA 2F4VQ 1XO3A 4DV2L 2UXCQ 4RMAA 2AQ2B 1ZXTA 5GQOA 2HDLA 1IBLQ 1KL9A 3MJWA 1EOVA 3CF5A 1HTOA 2KJXA 1TBEA 4BBSB 2H5XA 2Y0SB 2IPKD 5T8IA 2LEKA 1QVFA 4ANWA 4TQ0A 4BA1I 4JI5Q 4NAWB 3CSTA 3ND8A 3O13A 2BYTA 1T9HA 3NSWA 1LTGD 3BVGA 4KD3A 3NELA 1JQYD 2J52A 2B63G 1ZOYB 4IPGA 2E2HH 2Q2TA 1XMQL 3KYCD 4XQQA 5BO4B 2ICIA 1D7QA 3I2ZA 1VR9A 3MXUA 1YD8U 2LVQA 5M3MG 4NAWA 1OEYJ 4UP9A 4IOCA 1WTHA 3PIO3 1OXSC 4I6NB 1JW9D 1E24A 4DV4Q 3VYUA 2B3GA 2DZMA 1NR2A 3KUZA 2Y5PA 4FXKC 3KBXA 5IP7G 4ID6A 4WWMA 2HT1A 1E5WA 5CHWA 3G7LA 3KUDB 4YTNB 4NJCA 4HVBA 3S15H 2EY6A 1QILA 1XMOQ 4FN2A 4WWNA 2F0WA 2CU3A 4GN4B 5IWAQ 2WU2B 3P4QB 3RZOH 1XNRQ 3M4OB 3HK0A 3AB9A 2J0MA 1SSOA 3LX0A 3QC8B 2F0JA 3G48A 3HKZE 2KVZA 4GSWA 4HPLB 2DN8A 1TYGB 4DFAA 4K5VA 3GV6A 3WOFA 3I4MH 2D3BA 1CUKA 1E10A 2QIEB 3J7ZC 2JP1A 4P72A 2K22A 3VDYA 3DBSA 3PSEB 4CO7A 2QDLA 1LM0A 1KFYB 4EZLA 1C1YB 4JC0A 1TKWB 2L00B 3D3RA 1JRUA 3U9SA 4YCUA 2VW9A 3UIOB 1RM6C 5IT9c 2IY0B 2KTFA 1HJPA 2RBMA 3NWSA 4QMGA 1WGGA 1TQOA 4IUVA 1PUTA 2JT4B 2WU5B 4DQOC 1ZPSA 1W6KA 3GTLB 3KF6B 2F1MA 2UU9Q 2L0FA 5IY0A 4P2CB 4DF7A 3ECIA 4YSXB 3CKIB 1C48A 1Q1BA 3T56B 5C3EH 4DR3L 3OIQA 1PGBA 1PFDA 1UBQA 3V05A 3BVZA 3D31A 1EIGA 2NPTB 3KF6A 1X54A 1RWSA 3J81i 4YCWA 3RNBC 2WNMA 1YHQA 3Q8BA 4ZKBB 1XX8A 2WP8J 4OW0A 2HDEA 4ILWA 4LNKA 1V97A 3CSFA 5FLXE 2KX0A 3NP8A 2DGYA 4JI1L 1ZKHA 1STEA 2K39A 1YNXA 4LF4L 2PVGC 5LL6X 2MO1A 5G2NA 3RD2A 3RZWC 2IT1A 5C6AA 5JOBA 3L4PA 3NZSA 1TTNA 4MHEA 2G4DB 1SYDA 1TZ1A 3I90A 1E8YA 1LYLA 2HHHL 2MP2B 4U673 3T3OA 5GXGB 2MHVA 2EY1A 3IFWB 3DHGC 1YJNA 1Z9FA 1S40A 1M90C 1C4AA 4HMJA 1Q12A 2EMTA 2B8FA 5DPSA 1P0RA 3TCAA 4FLHA 5DPRA 3T1YQ 2MNAA 2W54A 4LF7L 2MP2A 5D14A 1Y1VB 2KHIA 1D5XC 5D6JB 1IL8A 2K8CA 2K04A 1NAPA 4GLVB 4I7ZC 1FMAD 1MD2D 2WP9B 1H9MA 4KK7A 3ZNID 1GUAB 3S1MH 5BN4A 2E75C 2B76B 3RCZA 1X3EA 2UUBL 3RZDH 1TY0A 1AYFA 3C2PA 3PGZA 1RCVD 4DK3C 4IPDA 4DV0Q 5JPNC 1GXDC 1EQQA 2JA6G 4GKJQ 1QCBD 1Q81C 2R6GA 2ZCCA 3A7LA 4CJ2C 4DK1A 3TP5A 3T53B 1SFOH 4RH6A 3HOZH 1KLUD 2GBMA 3AE7B 3ZW3A 1PTOB 1WY8A 1WGYA 4UHVA 4MGIE 1CSPA 3ND9A 1YN3A 3U58A 2WXOA 2EYLA 4G4KA 2AQ3B 2CW0D 4WQMA 2EE1A 4B3TQ 1N62A 4R4TA 2UU9L 4WJQA 5ELNA 1WTRA 1G8ZD 4X65Q 1CHPD 1ICWA 1FJGL 1EY4A 5HG2A 3W9CB 3MXPA 2IDYA 2IX0A 4OHJA 3JAML 1D1KA 1ET6A 2K9XA 3AN1A 3DHQA 1Z6HA 1PH3A 1R4MB 2ZT9C 3R2TA 2QJLA 2E6XA 2EVBA 1IBKL 3DBHI 3TP6A 1YQ4B 5FLXc 2A8VA 4AQYL 1UF0A 2G5DA 5CV4A 4K0KQ 2D3AA 3B2FA 2KCMA 4LNIA 3ZQ4A 4YCVA 2LXKA 2QF7A 3ERSX 2BW2A 2WINB 4HCPB 3V6CB 3GTPH 2RA4A 3FHWA 1V80A 1GC6A 1A3UA 2G9DA 1D5ZC 4A3IB 3IL8A 3X3MA 2HJ1A 4EQPA 4G3XB 2EYJA 1Z2MA 2IL8A 1J19A 3L17A 2YU9B 4A3CH 1PA6A 2M0AA 3F2DA 1NBFC 3T9LA 1UE6A 3VTWA 1Y1VG 4QJFA 1FYCA 3F2CA 3VQIA 2RCFA 2MHJA 4FF4A 1L0WA 3DHHC 4XDXA 5K36H 1CQFA 4GMVA 1LTID 1PRTD 1S1QB 1U4RA 3S2DB 2DAJA 4DPGA 1ESRA 3S2HH 2YEPF 3LYYA 4TVAB 1A8VA 4X64L 5KNCA 4LAAA 4HJ8A 1JRPA 4FXGC 2IYDB 2K6QA 3HIZA 4ANXA 2MBEA 3V6EB 2WAQB 2IJ0A 4H13C 2FMCA 1C4QA 4OXPA 4L5RC 1UE1A 2PIAA 3E9HA 5G3LD 4CBVA 3TS2A 1LGRA 2LD9A 2MX2A 4AH6A 4A75A 2H1EA 5KRUA 1H9SB 2SAKA 4OZCA 1EY9A 1RYJA 5EE1A 1EU4A 2F0VA 2BDNA 4MZ9A 5J22A 2DNEA 4OEMB 2LMCB 2AL6A 4S0RA 2EKEC 4QGUA 2LGIA 1UEAB 4IALA 2E74C 4RWSC 1H9SA 1WYDA 4BY7G 4JPSA 1EEID 1VQKA 2JEAI 2SNMA 4EQNA 5LLIA 3M3JA 2B2VA 3VH4B 2INDC 2F0HA 1KM7A 1FXAA 1V8QA 1NEKB 3M7GA 1Y56A 3NENA 2LMCA 3I4NB 1B4OA 4X66Q 3V3XA 1LACA 3FKIG 5KIXA 4LW1A 2B2WA 1P9DU 3H9DA 2ZVNA 3OMGA 4EGVA 4EX5A 1IW7D 4JI7L 4DWFA 4DR4Q 2I5LX 2EIFA 4HTHA 4YTPB 5IP9G 4BBRH 4ZLTF 2Q8TA 1WYWB 3NUHB 3U50C 2BE5C 5E3FA 4A3IG 1YI2A 4KKUA 4GS3A 4BKSA 1HR0W 2RF4A 3EVQA 1F9PA 2H89B 1XNQL 5IYCG 2IY1B 5IN7A 3M4PA 2WXGA 4X3SA 2DYBA 1Q46A 1NTGA 4K8JA 5CC4A 4OO1G 4HJKA 2E76C 1VJKA 2EY2A 3B08A 4K0KL 1UGJA 1WMHB 3DQVA 3AMUA 4JV5Q 2CHWA 3EN2A 1WM3A 1ENFA 1SDFA 3D0FA 1F52A 2C7NB 1X55A 1LUZA 2QKIC 1KC8C 3SDZA 4YTMB 3D4WA 2WAQG 3HGBA 4A3BG 3NRZA 3ZTDA 1T3QA 1GM5A 4YXDB 2ACZB 4U68A 1WMHA 4A3MB 2KDBA 2JZPA 3A4RA 2BPSA 3EBEA 3ML9A 1BMLC 1WR6E 1XQQA 4NDXA 4EUTA 1A62A 1CKNB 2F0KA 2R7ZH 2N7EA 1GOZA 1JJGA 2Q8IB 2FINB 1ZP0B 3MHZA 1D8LA 3Q6BA 3TS0A 4A3LH 2MEKA 3AEBB 3S24A 5HY6A 2OTJA 1XPOA 1CKMA 3GP7A 2NR2A 2AMCB 2SNSA 1CKNA 4KKSA 5BR8Q 2AYOB 2ZXPA 2QEJC 3STBC 2KLGA 2MBQA 4IWQA 4HMIA 1DOIA 2K5NA 4L23A 3LNNA 1HZCA 4URKA 2MP1A 1SNCA 5GAHC 1WM2A 4MACA 3E9IA 1WZ3A 3I4NG 1EQTA 4XWTA 2NTTA 1F2RI 1K53A 2KK8A 2LJ5A 1PFBA 4JBKA 2XN9C 1DCZA 4A3GH 2INCC 1N33Q 3TL5A 1AE2A 3QX1A 5JZEB 3AU4A 5FO8B 4W9FA 3DWAA 5M3FG 3BWUD 1STAA 2KCCA 4JPBW 1CA6A 1KXLA 1PTOC 3P1HA 5CYUA 3BS1A 2IO2B 3PLVA 1E1TA 4RFBA 3ZVVA 4DHJB 1I4HA 5I6YA 1GUWA 3GV3A 3MC0B 3E3XA 3SR6A 3CCLA 3WAPA 3UI2A 4N9PA 2P5ZX 1Y1WH 3CMAA 1BVSA 3I5JC 4PYUA 2VH2A 2NVXH 3TRZA 4QAYA 3V61A 4JL9A 1V43A 2ZXRA 4P71A 2IGGA 3TP8A 1X3GA 4GOPB 3AH7A 4A3MG 5HGQA 4OONA 3FVQA 4HCEA 3S1RH 3M3YH 1ZW7A 3DDCB 2PNRC 3MTNB 3U7ZA 4YWKA 4OGQC 4ZQ3A 2J7QB 2F3VA 1ZYRD 1VQ7A 4OWXB 4A3FG 3NTHA 4JV5L 4WORA 4DN4M 4PT5A 2BDOA 1PZKD 4GOPA 1M4VA 2C60A 2VZKD 2ZNVB 4B6WA 2Z6KC 1W3SA 2ONQA 4W9GA 1PDXA 3K5OA 1EWHA 5ELCA 4TUUA 3N30A 4E74A 2QEXA 1TWCB 2EJGC 3VR3A 1SSNA 1QE6A 2A6HC 2O6VD 3FPPA 3F8TA 1MBYA 4G11A 5JAVA 2N9XA 1AZPA 1EQVA 1GG3A 3BJUA 3Q23A 4AOFA 1PDQA 4G7HC 2CHXA 1QNUA 3TZUA 4DR6Q 4ANUA 4JE3B 2RQXA 2HQLA 4K6DA 5C3JB 2RDGA 1ZKOA 1TWGH 2A4ZA 1O7ZA 2JU6X 1SAPA 3HKSA 1W2BA 2FCMA 2J53A 1VF7A 2RMMA 3PUWA 3ONSA 3DBRI 1KIXA 1K50A 4A76A 3KW5B 3SEBA 2R92H 1N33L 2BS2B 3L08A 2FCNA 3CMMB 3B0AA 2B2VC 1J8CA 2JA9A 5F2DA 4C3JG 4B08A 2Q2UA 4GLSC 1R9TH 4HJ7A 3OTOQ 4AQ7A 1E2VA 4OWTB 1I4PA 4FYDA 3TEZA 4PYZA 1PTOF 4GDKB 2B2WC 3CPFA 3EC8A 1WJ6A 2RR9A 3W5VB 2OQ0A 4F8MA 1OXVA 1C9FA 1QWYA 4ICVA 2N4FA 4B3SL 1I3QH 2PZWA 4MEMA 4ZRKA 3HM3A 5C3WA 3V2TA 2NMQA 4JCVE 2B2UA 2LRWA 2ZJRA 4GDKA 1B9MA 3S15B 4ZUJA 2NS5A 3FEWX 2CFMA 2MFIA 1JMCA 3X0WA 2V3PA 5HURA 2FAZA 4HPPA 2WXQA 4BBNF 3QHTA 2PZTA 1VZ7A 1XTDA 2KOLA 2F0UA 1JCKB 1LQBA 2YTVA 2GMIC 2ENBA 3GZNI 3FDTA 2B29A 5COYA 1WTOA 4A9AA 1J5EQ 4LDTD 2JK8A 3I7FA 3RLOA 2UUCQ 2TMPA 2KKCA 2L1BA 4DXFA 1AARA 3NZ3A 1E7VA 1AW7A 1S5FD 4W9HA 1N34Q 2NYZD 3ZDMC 2ZXOA 2KJRA 3D4DA 5C0XI 2PTLA 3KDFB 3CQZB 2DNFA 5G5HA 4KV2A 1T5EA 3AYHB 3BU2A 5DAUA 1PH8A 1ENAA 3PTFC 3PF4A 4ZHOA 3MEFA 3AE9B 1IXRA 2MJ8A 1EEFD 4ME3A 3RN9C 4A3EH 4C1NK 1FD6A 4FO2A 4K3CA 2D3GA 4JG2A 3SU8X 3S9WA 4B3RL 3GOEA 2UUAQ 3OWEB 5J3BA 3EHVA 3QR8A 3L0WB 4LF8Q 5H8YE 3MFYA 3MA2B 4FVMA 3J81L 1WFYA 2VXWA 3HOYB 4LUOA 3GE8C 5D3DA 1UEBA 1U9RA 2NN6I 3KJOA 2OEDA 3VR6A 5FJ8H 2N49A 3D6WA 5JJIA 4MSMB 3SR1A 2F0OA 4POFA 1VS0A 1EIYB 2JQRB 2OQKA 1VQAA 1FL0A 2JA5B 4IFDI 1Q0WB 2CKHB 4IM0A 1YJ9A 4HK2A 2WXHA 2PI2E 2RSUA 2ZZPB 3K5MA 4W9IA 4DUYL 4YSYB 4HCNB 1BCPD 3NEMA 1NMFA 2INNE 2E3TA 5IAAC 1K3BC 1EYGA 1JWAD 3KFUA 1TKEA 4W9KA 3OSOA 5I2YA 5EE0A 3VA5A 3ICEA 4AP4C 2K32A 2A68C 1EQRA 5GADC 3I4MG 1GUGA 1SIFA 1YMHE 4IUMB 1PVOA 3CCEA 2EELA 2KJ6A 3TIXA 2JWZA 4BXXH 4O2DA 1TR5A 3FAHA 1YJ1A 4FULA 4L6TB 4IG7B 5JHAA 1V5OA 2K1BA 4FHKA 4HEDA 1T0SC 3A9KB 3I3TB 3M95A 2MJ3A 3NE5B 1O7LA 4DR2L 4OWWB 4G7ZC 2IW3A 1WXQA 2UUCL 1B7YB 3UE1A 3S1QH 2KWDA 3UDXA 4HJGE 4K7SA 3UF8A 2HJ8A 4GOPC 1HUMA 2I0QA 2Z59B 1STBA 4UP8A 5D65A 5DLQE 5C3EG 4A3KH 2PE9A 3A9KA 4F8CB 2M19A 3RMHA 3J9CA 4NZLB 2VY3A 2HD5B 3VYSA 3Q8AA 3HOXH 2JA7H 3ETRA 5AZHA 2PMVA 4JI0L 1YJIA 4IUQA 2AWTA 1HCZA 1XLNA 2ZNVC 4OVVA 2N55A 1BR9A 1Y69U 2BKFA 4UY8C 3Q3FA 1EU3A 1O7YA 1ILPA 2D5DA 2A5UA 4CDFC 1E7PB 4L5SA 1LFDA 1K3RA 2M00A 2L12A 5BYSA 4DV2Q 3K81C 4MDKE 2M1MA 3DWPA 1SE8A 1WX8A 1BNZA 5EGTA 3H6MA 1ICFB 2V4IB 2ZCBA 4A55A 5C4JH 1KNEA 2DBYA 3A56A 4PZ7A 3BZDB 4TKOB 2BGFA 2NCNA 4HIKA 2KWVB 2NVQH 2IY5B 3H09A 3K5LA 2DHZA 2GBJA 2Z0DB 4JYAQ 3L3OC 1J8IA 4WWOA 2J7ZA 5EE3A 1WJNA 1WGHA 1PV4A 1H9JA 2CHZA 4HXDA 3L2PA 1Y8RC 3VR8B 4C4VB 1MSHA 2B2YA 2F4IA 2PYKA 4KIKB 4M1UB 1XMQQ 3ZRCA 1PYSB 1NCVA 2M2LA 3HOUH 3P2BA 4GN3B 2CQOA 2JYEA 3MC9A 2H4OA 3L7ZC 1L4DB 2ZVOA 3H15A 4HEA1 2VUMH 4A6QA 4ZYNA 2B2UC 1K83H 5C0XH 1O78A 4C4VA 3MXNB 3C1FA 4KIKA 4WAFA 1XJVA 3P63A 1X1MA 3SHLA 3BZKA 1WCMH 1VQPA 3L54A 4BAXA 3U52E 5IGCA 2MQJA 2Q5WD 1I94Q 3O65B 2VZAA 3HRZC 3RUIB 5IT9L 3J80L 2CU1A 3NJTA 2K5VA 3MXNA 5KYLA 1IYVA 2KQSA 3JVZX 1IBML 5IOCA 3PIPA 1RFAA 2PW7A 1GD7A 2YV5A 4KGSA 2PI2A 2A74C 4P73A 3H6NA 4HIOA 1XT9B 4WJWA 1EWYC 3G4SA 5ELFA 2GA4B 2EYOA 5EPKA 4CKEA 4ZKCB 2HD3A 1TJEA 4RF0A 2UU7A 4R8NA 1LTAD 2AWOA 2DJGC 3TBIB 1G51A 2N1WA 2D2CC 3RULA 2A73B 4J15A 2NN6H 3X23A 1JROA 1EY6A 5HHDG 4A93H 2KFKB 1QZHA 4NPSA 1FO4A 3RNGC 4CHKA 1ZDVA 2LHDA 1F2YA 4JBMA 5D94A 3BINA 1T6BX 4IFDH 4WFN3 1GVPA 4YWMA 2WXPA 1Q1OA 4DR1Q 2KFKA 3AB5A 2L4NA 2F0TA 3W5OA 4DK0A 4HDOA 1JJCB 2KHWB 2QA4A 4DR3Q 1IGDA 4RMFA 1VD2A 1NE3A 3OJ4B 1J0GA 3HOWH 4A3CG 3Q6SA 2BBCA 5T1GA 1RL2A 1CK1A 3AU5A 2LI5A 3RNUA 1QZGA 3R8BA 4EZJA 1G2SA 1TWHH 1VQCA 4LF5Q 3S16B 3VHTC 1YBYA 5K36G 5NUCA 1F1HA 4XQNA 1F9JA 5KNDA 1QQRA 4DKAC 1VQ4A 4MNOA 2F0EA 2C7HA 1DM0B 4JYAL 1FFUA 4GLXA 5FO9B 3CRLC 3I72A 1PH9A 1QOAA 2D9UA 4JI1Q 3H7SA 2IZVB 4B9KA 1EWIA 1SIJA 5BMHA 4LF4Q 4P7IA 2X69A 4JI6Q 4BA2I 2XGTA 4KMUC 3AMZA 5G5GA 1EL0A 3BG3A 3M9BA 2HHHQ 2N9EB 3R3MA 1VQBA 4M01A 1DOMA 2K14A 1JOOA 2OCEA 2LGYA 4O1NA 3Q3MC 4KTAA 5JXVA 2AWNA 4KDLB 3DUZA 1YNJD 1UZXB 2LHEA 3AQQA 3D6CA 2Q2IA 1YQ3B 4R4OA 2MLBA 3OG5A 2UXDL 1I94L 1FXIA 4LJOB 3QO2A 4IN3A 3WWVA 4LF7Q 4J8QA 3Q22A 3KK7A 3QJZA 4A90A 1YHBA 2GBRA 4BOZB 1TWAH 3SGIA 1DONA 1K0RA 4FA6A 2KJHB 4LUZA 2WDQB 2GRIA 4LJZC 4Y7NH 4J6IA 2UUBQ 3RN2A 2L55A 1I4GA 3ZNHB 1K8RB 1DD2A 3W5UB 3PUXA 3PO3H 2REXA 2Y3AA 4Y52H 1J7CA 2BYVE 5EE9A 3VUWA 1HZAA 5AFWA 1E7ZA 4BBRG 3KWVA 2D0OA 2K5WA 2JY6A 4Z9CB 2Z9HA 3G6EA 2M17A 4DUZQ 1A0IA 1PZJD 1TU2B 4OIJA 3P42A 1MKHA 1FCLA 4WWPA 3QA8A 2EPBA 4C2MH 1RODA 2JE6I 5J17A 1YIJA 2V3NA 1KOTA 4DR1L 1V6EA 1C9OA 4RGNA 4TQ1A 5M5WH 1SXTA 2JA6B 4JVZA 4KY5A 1SN8A 2RHQB 4PQXA 1FJGQ 4NAMA 5IP4D 5E6NA 3H91A 4YY3L 2F03A 1YJJA 3GTOB 2KYWA 1S3SG 3SFEB 1SGHA 4XDDA 2DJFC 1STNA 1QOGA 3KLSA 2K75A 2NVTB 1IBKQ 3W1BA 2PCFB 3WIMA 4M8NA 3NQIA 4LF5L 2MWSB 2R7ZG 4AQYQ 4RGOS 1L2NA 5M5XH 2B2YC 2FUHB 1VMCA 1WTQA 3ENEA 3IT6B 4V0BA 1YNND 2NPTA 4II2B 4PMCA 4O0AA 1AEXA 1J9OA 1P98A 4APVA 4A3LG 1WJ4A 3F2BA 4NQKE 3WA0A 2WFWA 1WXAA 4I7AA 2QGQA 1I50H 2PQEA 2Z0SA 1HA6A 5C4XH 2KHSA 2UWQA 1D4BA 4QCLA 3GO5A 3L10B 4AWJA 1CKOA 1PHJA 3Q69A 3VA7A 4DR5L 4KKJA 4JI6L 1Q82C 4WH4A 4A3OA 2WAQE 1LO5D 1HNXQ 4S3SA 2M0XA 3RLFA 3D4RA 1CM9A 4L1BA 1KRTA 1Z47A 3WOEA 2M8SA 3LWEA 3M4QA 5JJKA 1ZXHA 1ISNA 4ARIA 2OTLA 2R3ZA 2IGHA 2BTEA 3DEPA 3ZIMA 1Q1EA 1JR0D 4F88A 4A3GG 2FUG1 1SYFA 1G6PA 4X64Q 4KVGB 1WTVA 2PW5A 1PH1A 1SJED 3IAM1 2B2TA 1IYFA 4LLGM 4DDGD 1BDOA 1AWDA 4B3ML 3CAMA 2KAJA 5CX3A 4MN3A 5M9OA 3C3LA 3BYYB 1FRDA 1EM7A 3TBLD 5BYRA 1SJHD 3OOCA 1E8WA 1CHQD 4L5QA 2AL3A 4US9A 3A8KE 1GC7A 2KQ3A 4NP5A 2CJOA 2JA8H 3N20C 1KDCA 3MHBA 4NPNA 1BUIC 2R92B 3FC4A 5FKAC 1SMYD 2GVAA 3M4YA 3APCA 1RLFA 3OPOA 4IJLA 1Y1WG 1C78A 2N78A 2WXLA 3P4RB 3ITPA 1AP0A 1L2FA 1VQ6A 2W3SA 4AYBG 4H0LC 4ZAIA 1ZE3D 4DUZL 4ZDVA 1KABA 1I42A 4ULLA 1K8AC 1EUVB 1X6OA 2AUKA 1TY2A 3UI3A 3E6ZX 1QZEA 1OTRB 4US8A 1I35A 4CDCC 2LFNA 3TQYA 4OX9L 1IZ6A 4JI7Q 4MTKA 4BZAA 1YVCA 3QAQA 5IKCM 2JVCA 4GDLB 2K33A 1AFPA 3N9YC 2XK5B 4HCSA 4LNQA 4BY7B 1RIPA 3ZJTA 3HG9A 3GTGB 2WKDA 1S3OA 4GLAC 1XWEA 4LFCL 4LFAL 4NXML 3NQTA 4WJ3M 1HUNA 3AXCA 3I70A 1XNQQ 4N59A 3LJ3A 3FKIB 4GDLA 4AUQC 3VR5A 4JW0A 1G2TA 1P7FA 2XK5A 1IW7C 2ES2A 1WH3A 3H8HA 3IHPC 4K7UA 2AHOB 2JSVX 3HOVH 3DBLB 2IWHA 3GTJH 1WVLA 4DAYB 2D5GA 2HDMA 3I8ZA 2FMMA 2Z0EB 2MBBB 4LDTB 4FNFA 3U4EG 3VFKA 2K52A 5EBDA 2PMZB 4PG3A 3CHBD 1S72A 2ZW1A 3PIP3 2ATWA 2VL6A 5CV9A 4A3EB 3Q0AA 1NENB 1B8AA 4DAYA 1HNXL 1UWXA 4X57B 3S1NH 4LNNA 1NSNS 4ZRIA 3NPPA 2Z6KA 3TZDA 4K14A 3A33B 3PPAA 5JEAH 3IAYA 5JH5C 3PCOB 1EYDA 3K7AH 3R93A 2R61A 2R7DA 4KHZA 2R92G 3AEFB 2MJEA 2R93H 3UDIA 2HIXA 4HIMA 1WE6A 2CR5A 2J42A 4A3BB 1B2TA 3RT3B 4F1SA 1B9NA 3MJ5A 3PZ8A 3C1EA 3HFZB 2O2VB 2GN5A 4IC7B 1TVXA 3CD6A 1MVKA 1WGKA 1J7AA 4LCDE 4NJ6A 3A0JA 3S17H 1R4NB 3PREA 1SB3C 5HKHA 1E22A 1VQOA 1STGA 2IX1A 2ZJDA 1JT8A 3J81j 1IYUA 1G91A 1YN5A 2A6ED 3JAME 1MG8A 2O2VA 4PZ6A 2N7JA 2KOXA 3T1HQ 3BY4B 1I4XA 5DCNA 1UE7A 5HFYA 2RHSB 4P74A 2QDBA 4LJPB 3NUCA 3VR4A 4JI8L 1JOQA 4ARCA 3RMKC 4JI3L 3V62A 5BN3A 2F0PA 4MGZE 1WWTA 2HCIA 5M3MH 3RNEC 5HGTA 3GTMH 1UD7A 3DMUA 4GB9A 4ZRPA 2E2JH 4A3DH 2A69C 3A7AB 1DZ1A 1FNVA 2DUDA 3KLRA 2CH4A 4HAEA 2MBHA 3PVLA 3A9JB 2BB5A 5C2TB 4LNFA 5M3FB 5LNK1 4IWPA 1QNKA 2XVSA 5EQ0A 2G1EA 4ZOHC 2YTXA 4KJNA 3PSIA 2E2IB 4A20A 2IHEA 2PPBC 4A3EG 2CWPA 3A9JA 5E4WC 4BWGB 1I6HB 2E8GA 3PS6A 3UIPB 5DPWA 1PFMA 3ZNZB 2NVUI 2BB6A 5LMUL 1V9PA 2WXMA 1F9QA 1DOLA 1HQMC 5EPLA 1YJWA 2KEDA 5M5YB 3HOXB 3GDEA 2NVYB 2Y5CA 3CP0A 4A3JH 1WGRA 1F0ZA 3DBRB 3VVWB 2X8XX 2L0TA 3VTUA 4A3PA 4XGAB 1L1OB 4LUVA 2JQOA 3I57A 3TEXA 3CW2C 3SFDB 1V1OA 4R8IA 1SMXA 1V1PB 1ZYRC 2ALYB 3TSSA 5IGEA 2SEBD 5FJ8G 3DCGA 3PGEA 3Q3JA 2B2TC 1CZWA 4IO9A 4A3FB 4RG1A 2DYMA 2ZTEA 4BBSH 1FR3A 1YITA 1NI2A 1WX9A 2OJWA 1L1OA 4F87A 3K9PB 1SYGA 2F0GA 3VYRA 3GQBA 5CV5A 3IT4B 2XIWA 4DA2A 2M4NA 1V1PA 3UGBB 3T8MA 1B3AA 4DNTB 2RDFA 1A6XA 2KMAA 1K8GA 1PLFA 5C4JB 3S14B 1AH9A 1N6ZA 4Q2JA 5K5PA 3CC2A 5CORA 4GNXB 3Q8FA 3A5UA 2WDVB 3Q14C 2K50A 3AE3B 1IKLA 3B6YA 1XTCD 1EYCA 4FJVB 3JAMc 4RNAA 2M56B 2L76A 3TMPB 3K59A 3TUOA 3AFQA 4FF2A 4XXEA 1V86A 1JE4A 4BXXG 5AUKA 4GNXA 3T1HL 3I55A 1SNPA 4BVUC 1UGMA 1JMLA 4GIVA 1QF6A 3A74A 4HJAA 3QOLA 1QG7A 2KVMA 4YWLA 2K4KA 4BY1B 1XCQL 3IFDA 1HR0Q 4ZHPA 3IRBA 4B3SQ 4IKGA 3E0EA 2F52A 2MGSA 1EFWA 1JQ4A 3M4OH 3B2GA 4J1MA 3TN2A 1X9NA 2C9OA 2K28A 2C35B 3PMFA 1VQNA 1MHXA 3F1ZA 2KWUB 1E6EB 5EPJA 2JF5A 4USAA 4C3JB 5C44H 5EKLA 4A3KG 2BOSA 1VDVA 2WX0A 3AE6B 3N1XC 4FXCA 1VQJA 4BOSC 2V1CC 1A70A 3HOXG 2KECA 2JA7G 1XCTL 3H1UA 5C23A 3L9AX 2NWGA 4RF1A 4MTNA 4TRDA 3SE0A 1EOTA 3R3OA 5CBEE 5KEEA 1HZ5A 4KSLC 1WXVA 3CCJA 3VRAB 2BE5D 2KXJA 3VTVA 1VQDA 3P20A 2MW5A 1WJJA 1YHAA 1QVGA 1WX7A 4K5XA 5EAYA 3K0YA 5ELBA 3IAS1 2IGDA 3DM3A 1MPEA 2LGDA 4K7WA 4K8IA 5E1FA 4A93B 3GTLH 4J6HA 5IA7A 1FGBD 3VAWA 3E5SA 5IODA 2JXTA 1ZDXA 2I07B 1QUQB 4K2KA 3K0XA 2WXRA 3ZTCA 3MC8A 4LFBL 3CF6E 2K25A 3R7RA 1HNWL 3P75A 5IGBA 1N8RC 1X32A 3AM9A 4C56C 5EBCA 1B9RA 2D62A 3PLUA 1VQMA 3J7YW 4B3RQ 1QUQA 1II3A 3ER0A 3HHMA 3I3CA 2V1YA 2GI9A 4I6PA 3U9OA 3CCRA 3C46A 1ASYA 4HDQA 3ZXVA 3HOUG 2KMMA 1BXTA 3DWGC 4N9TA 3AE4B 1DOKA 5C4HA 4DNRB 3A8JE 2CCZA 2DZJA 3WAMA 2VUMG 1V9JA 3NHHA 5C0XG 3NY5A 5DPTA 4S17A 1YIWA 4BY1G 4XT1B 1QVCA 3CU7A 4HPMB 1WCMG 2N1VA 4RA8A 3PT2B 4M0WB 1JWMD 2E2HB 1SLJA 3W1YA 1EIFA 4MGKE 2GOWA 1XEEA 4DUYQ 2BVCA 4P16A 3ZLZA 1W6JA 1EO6A 5IIFA 4ALPA 5LMNW 3D8GA 3AE1B 5DM63 3Q2AC 4M0WA 1HR0L 1U4PA 3LGJA 4GKKL 3HVDA 3P4SB 1WOCA 3R2IA 3Q8DA 1RTOA 2KDIA 2DNCA 3AI5A 4EZKA 4XYQA 1PTOD 1BCPC 3N52A 2NN6G 4TSSA 2SDFA 3RZOB 4A93G 1MG4A 3M63B 1LTTD 3N3KB 4X62L 2EYHA 3BK1A 5KHQA 1WI0A 1FD7D 4EE2A 2WDRB 3EUB2 3FP9A 4DR2Q 5E6JA 4CQNA 3ZKJC 3NBHB 4IFDG 1CQVA 1JE5A 1L6VA 3IFTA 1PTOH 1B44D 2JJQA 3I4MB 3MAQA 1G6ZA 4N6EB 1SYBA 4W9CA 4CKCA 1KTKA 3TMEA 1Y14B 3PZDA 2XSCA 4CDDC 3NTIA 1B3QA 4RHSA 2IO3B 2MRPA 4PS7A 3ZDTA 3NBHA 4W9DA 1OO9B 2ICEC 4LF9Q 2NB0A 4JI0Q 3HOWG 3RFZB 2DYOA 2VRRB 1BO0A 2NBWB 3C19A 2A19A 4RHRA 2RDBC 2ZTCA 3ZJVA 1SNQA 3JAMi 1L1OC 3KDFA 3TREA 1Y8NB 4IPCA 4JI2L 4RM8A 5JJZA 2N0SB 1AN8A 4HIDA 1E1OA 1HNZQ 2HUGA 1HFNA 4IDIA 2F3IA 5C3EB 4DV6L 3T51B 1J7BA 2LRUA 1HE8A 4KY7A 3L13A 2A6HD 3KOJA 4K81A 2Z6BA 5IP9H 1EYAA 1U5KA 1GO3E 5JVG3 3AEGB 4FADA 1QB5D 2F0SA 4LK0M 1TS3A 4A3IH 3QIJA 2LFIA 1Q3LA 1A2TA 2AUJD 1GPXA 4FF3A 1ESFA 2AX5A 2KVRA 2WB1B 2R2OA 4KY6A 4GNXC 3CRKC 4OO1H 3WDNA 2AEHA 4JIOU 4DXAB 3BYTB 1AZQA 4MIUA 2JWUA 5CMDA 2V3SA 5EJWA 3C8YA 1E7UA 3S2DH 3CCQA 1BQQT 5JPMC 2L11A 4IURA 1FVIA 5ELOA 4M00A 5BYQA 2Z4IA 1ML0D 1SE4A 2CVRA 3H0GH 3VH3B 2L7RA 4HJ5A 2FE8A 1STYA 4K3BA 4DV3L 2WXFA 1GAQB 2B3AA 4L5TA 3CPWA 2LVPA 3AFPA 1UH6A 4RM9A 3DEOA 1WTWA 3PO3G 4KX6B 2F0QA 4RGMA 2BCOA 4ME5A 1L0XB 3AE2B 2RVLA 1UUPA 4R9WA 1NJIC 2NZOA 3HP3A 4YIJA 1DYQA 4LMQD 2C5LC 5ISRA 3OJ3A 4CYEA 1IBMQ 1VQEA 1R4PB 1S5CD 4CJ1B 3Q3OC 3I56A 3S1MB 4BKSD 1Q86C 1CJEA 3DVNV 4A8XC 5IYBH 1A63A 2HTME 1FIQA 1VDZA 3RZDB 4RAUC 2KT7A 3QWNA 2X6GA 2VQEL 3CWIA 2K6DB 1HTQA 2QSDA 1Q7YC 1H9RA 3UDGA 1E0ZA 3I4LA 3OIPA 1B53A 2M9VA 1MHHE 3J81E 3FKYA 3KWLA 3HOZB 2L0CA 1V1QA 1SFOB 4EFOA 5I9OA 3TEYA 4JI4Q 2O4XA 3VDZA 5J2RA 2K6AA 4F7ZA 1ZXIA 1MJCA 2XTIA 3QG1A 4LF9L 3A1QB 3HRDD 3TJPA 1BKBA 2F0LA 1EWCA 3LXFA 3S2AA 3ZGZA 1X56A 4L8JA 1DOYA 1B1ZA 2OT2A 4H44C 4E6IA 4IPHA 1PZID 3GTQH 1DXMA 2HCCA 1GKHA 1PYWD 1EY5A 1LV9A 2WB1G 1HNZL 3H3VI 2LGSA 3A1QA 1MHWC 5FR3A 2YTYA 1SRUA 1U0LA 1GB1A 2KC2A 2KCTA 2NBFA 4C3HH 1LT5D 5C4XG 2PPHA 2ZW0A 1TWFH 2Y5BB 3P4PB 2N9KA 4WJPA 2OWOA 4YHHL 3ZXRA 3K80C 2PNHA 4HSPA 2OOBB 3R66C 5D2MB 1IGCA 3NVVA 3NZUA 2QW7A 3HOVB 1FGUA 1S4ZA 1EZ8A 5LMNL 2QCZA 5AEKB 3AECB 1F2MA 5C5MA 4A3MH 3GTPB 2BF8B 4ICUA 1S5BD 3KVFB 2BH8A 1SBBB 4ASWC 5JJLA 3URYA 3OAWA 4C80A 3OMCA 2I5HA 2JYTA 4UP7A 3FILB 2OJRA 4R3DA 1Q8IA 2EZVA 2X38A 1EY0A 5I4DA 1WIAA 5A2QL 1EUJA 2RPVA 3QB3A 3K6OA 1XF5L 3RZFA 2RSOA 3NVWA 5BMGA 3S2HB 1K8MA 1TS2A 2JA8G 2KQ7A 3FILA 2HQEA 3P7JA 1HA5A 2KEEA 1ROEA 4O42A 2R93B 4QIWE 2UXDQ 4QQBX 1EZ6A 1IUEA 4PNYA 5FK9C 1WJUA 4G0NB 3HOZG 1N63A 1RAXA 1PRTB 2Z1CA 3NS8A 1GUOA 2KACA 2B39A 2WKCA 3S17B 2QCPX 1HZBA 1A3TA 2PE6B 1RTNA 2QILA 3J81c 1R4QB 2ZEQA 3OW2A 3A55A 4WURA 3EIVA 1KRHA 3IXSA 2YEPB 3AEDB 1HPCA 3D32A 4L63B 3ZO5B 4OVUA 4JI4L 2ASBA 1P8LA 4AYBE 4DR7L 1FCCC 4XX5A 2K5PA 3T4AC 3M7NA 1CZGA 2K8BA 2E2JB 2MJDA 1MI0A 1E90A 1EY7A 3J7A5 3HOVG 4H2AA 1NUCA 1SR3A 2ZPYA 1N60A 3W1GA 5MPOA 4X3TA 4BBRB 4M8AA 4YY3Q 3PV0A 1X3FA 2WX1A 3QJYA 1IKMA 2ID0A 1Q5WB 1YQBA 3UINB 3K9OB 2F0IA 2JX5A 4QUCA 4II3B 3SK5A 1E3PA 4NMZA 1LT3D 4P75A 1JJ2A 3CC4A 1E0BA 2MH7A 2HTHA 3J7AF 2XWBB 5E4XA 5JEAG 3AULA 5GROA 5C0XJ 5IT9E 1PQSA 3J80E 1UELA 1AE3A 2K5DA 1LTLA 1TWCH 2XEWA 5TR5A 1P3QU 4DK5A 2R93G 4BS9A 1MFWA 3E56A 4ACFA 2EYPA 1UWVA 4DR5Q 1KLVA 2PQAB 3TDQA 2A5HA 4W9EA 4KLKA 1VZ8A 2G4SA 3RD4A 2R7ZB 3OLMD 1YNNC 4FBJB 1BBXC 2FCQA 3CC7A 4W9JA 2MQHA 1SF0A 1L4ZB 3HUIA 3BVMA 1E2ZA 4JBWA 4M8MA 1WXMA 3QARA 2PQAA 4X6AH 3KJPA 1NBWA 1BBWA 2N9LA 1VF5C 1E2WA 4B3MQ 4K6LA 3APFA 4IJHA 1SE9A 1STHA 2N7DA 3DWQA 1Q10A 1V5TA 2BT6A 3H3VH 3KH0A 4DAPA 3PZ7A 4KZCA 4NQLB 2LKVA 2EYFA 3ZYYX 1LTRD 2YYZA 4A3DG 2XNAC 4QIWB 1DGSA 4A3GB 2IO1B 4HRSA 2LXJA 4DBGA 1MSGA 4IUUA 4A4IA 4IFDJ 1KF6B 1ZUD2 3K8AA 3AE5B 3DBHB 4J3OD 2NZHA 2XBBC 2VH1A 4IM2A 4KN7C 5CV7A 2L52A 5FLXL 3R7QA 1JC7A 4NJ7A 4POGA 2OXPA 4I65A 3KLSX 3PQIA 1IL2A 1QKZA 2EMSA 4WIPA 4EOYA 2N9PC 4OX9Q 3ALBA 3GTKH 1SMYC 2OHFA 2W9NA 1WRIA 1VQGA 4G57A 2BS4B 3ZNGC 5C44B 1KHIA 4DV7L 4PMWA 1Y1WB 5JVH3 1MI2A 3UQBA 1F9SA 1UNSA 1VQ8A 1WE7A 4AYBB 2NVXB 2I38A 4A3JG 4LFCQ 2RD0A 4LFAQ 1MIUA 4NXMQ 2O5IC 1KD1C 2NTSA 2FIFA 2D10A 3BK2A 2PMZE 3CQZH 2CW0C 3S1RB 3M3YB 1ONLA 4PK1A 2UXBQ 3J80c 1E8ZA 5LXIB 3CMEA 1K9MC 2F0FA 3GS2A 1HH2P 4NXNL 1E9MA 1HRJA 1UBIA 2R2QA 1H8CA 4BBSG 2GVBA 2Y0SG 1VRAB 1VCBA 3ERQA 4F7XA 4YWGG 3I73A 3MP9A 1UAPA 4GZYC 3RPFC 1WD1A 4IM3A 2KD0A 2YLMA 5D3IB 5D7GA 4DV5L 2KN4A 2F4VL 4M02A 2N8NA 2NBVB 3QCAA 3U30A 1XPUA 3TEWA 2UXCL 5IE8A 1HTLD 1SNOA 2VB2X 3CCUA 4K1RB 4WQOB 1IBLL 3SHQA 4AJYB 1J6QA 5L83A 2VZKB 3HOYH 2W3RA 3WCQA 1I4RA 2E5LQ 1RFKA 1GHJA 4UPAA 3PO2H 4REZA 2V9HA 4GXBA 4KGTA 1WI5A 3T3NA 1JB3A 1XXGA 4JI5L 4XT3B 4MM3B 1TWGB 1TGZB 3EFXD 2RCNA 1N36Q 3ONAB 2C9WB 2O6VB 3OYYA 3K57A 2D11A 1MGSA 5H1SE 1NI3A 4C3IH 2JA5H 1PGXA 3DWMA 4C7ZA 1QJOA 1PRTC 3KF8B 4IUNA 2WGSA 4L2YA 3TEHB 1NYRA 1WFQA 3PRZA 1YZ6A 5I6WA 3QIAA 4MM3A 4RKBA 1QOHA 1RRBA 4RCOA 2O6VA 1KDAA 4DV4L 2KWCA 3U7DA 2J4XA 3SK6A 1D2BA 5IOIA 5BMIA 5C44G 5FO7B 2KANA 4EEWA 4KV6A 1R9TB 1KNAA 3KF8A 2KCNA 1A15A 4JI8Q 1N5XA 4BKTA 2L15A 4JI3Q 1XMOL 4FF1A 3CXCA 1I3QB 5IWAL 5GMVA 3EROA 4NB3A 1XNRL 3BZCA 5A35A 2A6EC 3ZJUA 1FM0D 1OFFA 5G55A 3UDFA 5DEHA 1F2LA 2F3WA 4QUFA 2CHBD 1TT5B 4CDEC 2BQQA 1BOSA 3N1ZC 2SOBA 4DDID 1C4CA 2K1FA 3EFUA 3QK0A 1LT6D 3HKZB 4OELB 4ZRQA 1SE3A 3RYTA 1WYGA 2K01A 2W55A 1Q90A 4JBJA 2J0KA 1NMGA 2LVOA 3ZJYC 5IYDH 2UXBL 2PW9A 3BDCA 1PXUA 3I63C 2K7VA 5LMUQ 3FRPB 4KHPQ 1K28A 2K03A 2DWQA 5IGFA 4WJNA 4RCNA 2JRHA 3NHEB 3PV1A 3SDLC 4B0EA 3PO0A 1C0AA 2LSSA 2GLSA 2QMTA 3NG0A 1HZ9A 3PF5A 2NUCA 1OQQA 2KC1A 1WRDB 1I6VC 2WYQA 1XD3B 1NY4A 1RF2D 1QLBB 3KUCB 4ZRZA 5E6OA 4G7OC 2DY7A 2VQFQ 4X3UA 4G50A 4I6LB 4IWOA 4IUPA 4TQUS 1G291 2WDTB 1VQHA 3A8IE 3E9SA 3I91A 4WAAA 2PLPA 2CKZB 2JXXA 2FFKB 5EKIA 4DXGA 3ABVB 1JOKA 2G9HD 2E5LL 4R4IA 4ITKA 3BDOA 4PV1C 4XZ4A 4NNJB 3SD5A 1HHVA 4HLEA 1V8CA 3L16A 1K52A 1PRTF 2NBUA 5FLMH 4KD4A 1N36L 1P1AA 2JSOA 1WD0A 3W1SA 1GB4A 4XWWA 1H4RA 3HM6X 1OXTA 4MH8A 3MEHA 4V190 1JICA 4H7BA 5E6PA 2BYEA 4DHZE 1LABA 2K5QA 5G3LF 4B9XA 3K7UC 3P1MA 5E7NA 4AIMA 1I7HA 1WF9A 3X3NA 2DY8A 3H0GB 1KAWA 4QB4A 3NK9A 1OGWA 2L1AA 4XDCA 1Z7TA 3VR2A 1K73C 2B63H 1V49A 1O7IA 2KA7A 3T1YL 4TV3A 3UE0A 3J80i 1GHKA 2CJNA 3HKZG 4ANVA 3DVGX 1HFGA 3CCMA 3RNFC 4MGYE 1BCPB 2MA9B 1YX6B 3BDLA 3CIRB 4GGQA 3LB8C 3G6JB 1N9WA 5IP7H 4NY0A 1VQ9A 2JRIB 2EY5A 2XRQD 3MXGA 5T1IA 1IPGA 1ET9A 5DM73 2TSSA 4DV0L 2KTRB 4GKJL 2KDMA 2YVCA 2XRSD 1LTSD 2CQAA 1B70B 1PMRA 3I4OA 2B8GA 3C0RB 4OZBA 4EQOA 1PH5A 3VYTA 1EIHA 1F9RA 3S1QB 2D07B 2WACA 3EQLC 4PMBA 4MELA 2J0TD 3RLNA 2K8HA 1CSQA 4X3KA 4FJZA 1CA5A 2V0GA 2KTRA 1H9KA 1D3ZA 3RUZA 4A3KB 4KHPL 3Q8CA 4JLCA 1CFMA 2C7MB 3KUPA 5JEAJ 4B3TL 2KMCA 3DHIC 4GU2A 2JA7B 2EKIA 2E2DC 4X65L 1L7YA 1HTPA 2MUYA 4LFBQ 2K05A 1I4QA 2IHFA 1I5FA 1HNWQ 4IQZA 2KDEB 3PHXB 4YSZB 1M8AA 2VQFL 3GTQB 4WJ4A 1LT4D 4MSQB 1CTMA 4N9F4 1HZ6A 3NBIA 4FJYA 1JALA 2EJMA 3S16H 4C3HB 1TS5A 4FXDA 1N32Q 1TWFB 4HKQA 1UE5A 2NZ1D 1E8XA 2KO3A 4LWCA 4PS8A 4LTUA 4P1BC 1PYBA 2O2LD 4IOAA 4KSKC 2WIIB 1HEZE 3H0GG 2K3UA 1NNXA 2RGFA 2RPQA 2IBIB 2NVQB 1L0YB 5LXHA 4EKUA 2EQSA 3ULPA 2ZM6Q 1WSPA 2KZRA 1PFSA 2JEBI 1T5XD 3W3AA 2GB1A 3GZNB 5AUIA 1S5DD 2PKOA 4JK1C 5CV8A 3IBEA 2DAFA 2EOTA 4QL5A 4IZ8A 1YEZA 2DZKA 3HOUB 1WTXA 1Y8OB 3MTSA 2GBNA 1R4MI 4B95A 1KRSA 5TSSA 4R4CA 4FDBA 1SNMA 1PH7A 2VUMB 1IHZA 1K83B 3VXWA 3ZRFA 1L0VB 5IYBG 4FP5D 3H94A 3DBLI 4GKKQ 3V60A 5KHOA 4DHZB 1VMPA 1WCMB 3TP7A 5CGKA 1VZ6A 2LZ6A 1FFVA 2LXCA 2WLBA 5JHBA 5CR3A 1QOBA 1K0SA 3K58A 4KKIA 2VS1A 2MO0A 1YOVB 4NW2A 1D5MC 3JSVB 1GJXA 2K5HA 3B1LX 4X62Q 2A69D 3DM1A 2L32A 4OO1I 4KZ0A 1Y8PB 4E71A 2JN4A 1SEBD 4XIGS 4BFRA 3MFGA 4UAIA 3JSVA 1T0YA 4TKNA 1LLRD 4FHJA 2Q8RE 4K5WA 4X66L 1IP9A 3K5NA 2G3QB 4LNOA 2RKSA 3AEVA 2I1KA 2CWAA 2EXZA 4C3HG 2FHTA 4KJOA 3Q8EA 4DR4L 4C7YA 2JA6H 3EECA 1TT2A 3PUYA 1Q8KA 1V81A 5L37A 1F2RC 1R4NI 3HVZA 4WRDA 4KI0A 3CCVA 4JI2Q 1KDBA 3U4VA 3GTOH 2QDFA 3LWUA 4WJOA 4BBNC 1WXSA 2EXDA 1OEYA 2BS3B 1D1IA 1U4LA 2F0NA 5GAEC 2NVTH 2DLBA 2AQ1B 3SK4A 4DV6Q 1X3PA 2L5TA 2WB1E 4JGHB 2BYFA 1N32L 3AE8B 2DX5B 5FR6A 3ZUNA 3W1SC 3HOWB 1V2YA 4DV1Q 3WALA 3AU7A 3NXWA 4DK6C 2PZUA 3LDZE 4JOIA 1VCIA 1YN4A 2MBOA 4DGZA 2N88A 1OQYA 1TKYA 2V4LA 1TWHB 5ELEA 3H7PB 4AS1A 2ASQA 1ENCA 5EDSA 1EY8A 1MJEA 1P7EA 2D3CA 2KX3A 1SE2A 3ML8A 2LGXA 1KLGD 4LK1C 2ZM6L 3STBD 1OXUA 1TKGA 4IUTA 1JORA 2OF1A 2LASA 3H7PA 1PFNA 3QQ8B 5EKKA 2Z8LA 1T0QC 2WXJA 1GJZA 5GAGC 2V4DA 3QWZB 3OWFA 2XWJB 1BT0A 2K0PA 1GNUA 1DJRD 1KAAA 4IOIE 4CJ0B 5BR8L 4DV3Q 1P16A 1Y1VH 3J7AV 2PO4A 4DU9A 3E0JA 1XYIA 1YNTE 3RNCC 4QY7A 4HKZE 4HJ9A 1A2UA 1MJDA 1NYQA 1KQSA 3N32A 4NKLA 1ZGUB 1TWAB 2FCSA 5H92C 2JXMB 3RI7C 5KYIA 3AEAB 4Y7NB 4ZCKA 5CTRC 2KENA 4QF4A 1QT9A 3B9JA 2WHIA 4P6VF 2KN5A 2G45B 5J39A 2I46A 2BA1A 2VQEQ 1S5ED 1VQLA 3PO3B 1EF1A 2KNBA 3AEEB 3A4SC 3SXHA 3BIID 2WQYB 1X65A 4LF6Q 3IVFA 2KQ4X 3MHSD 1SYEA 1FXTB 2MCNB 1RDPD 2FNJB 2L3ZA 5I2XA 1K51A 4P1CC 3NS1A 4KDIC 3AV8A 2WS3B 2EJFC 2I5MX 3APDA 1QOFA 3IKJA 1FPYA 1M94A 3G71A 1TZOA 3N6RA 2FIDA 4C2MB 1B50A 4BY7H 5CHFA 4B0MA 3N1YC 4KN4C 3GTKB 2O5JC 3GTGH 1JB7A 2JPHA 4DNIA 2INPE 3PIOA 1NR4A 5M5WB 3Q3NC 2N3SA 3FKIH 3WAOA 3NVYA 2H88B 3A5ZB 1C8CA 2BWFA 4JWUC 4DV1L 4YHHQ 1CZPA 1UWMA 4C00A 1U4AA 5FOBB 4XYCA 3T13A 3DVNU
chains in the Genus database with same CATH topology
1O80A 4OVZA 1JWSD 5M5XB 1FEHA 1RD9D 4RGTA 2W82A 4DAVA 5KNBA 2VB3X 1XLPA 1FNWA 1F77A 1N5WA 1I50B 2C5CA 5C4XB 5J1ZA 2MPMA 4ZYSA 4MT5A 3VRBB 1RKNA 3QOJA 1GUNA 1IBXB 3GB1A 2Z4HA 2LJIA 3T16A 4TMAB 3PO2B 1KH0A 1EFID 1BCPF 3KBGA 1SNDA 3EA6A 2FJ2A 2JYOA 4HSVA 5C4ZA 4OZAA 2F0MA 1IBXA 4C3IB 1NVID 3A54A 1R7SA 3FPUB 3I9V1 2JA8B 2VNUD 3EJIA 3MZ5A 1ZEQX 1C79A 3U2SC 1X3QA 3NWTA 5HI1A 2EYMA 5KGUA 4ABNA 5CV6A 4OIKA 4HN7A 5CBAE 1RHPA 1VLBA 1GUTA 1XLOA 2RSNA 1ILQA 1PGAA 2WXNA 1OXXK 1XLQA 1F2ZA 4UDUC 5LHY1 1C77A 3V96A 3OHXC 5ELDA 5C5LA 1FRRA 3F2UA 2LUMA 4XQJA 2X6LA 2LS01 1C76A 1HXYD 3SK8A 4B9WA 2KUMA 2WXIA 3W2DA 3MWYW 2ON8A 4D2KA 2L9HA 2IX3A 3GTJB 3KQ4A 1C4PA 2FBWB 4ODGA 4HR7B 3SVMA 2F0DA 2I2YA 4RKLA 1CI3M 1BUVT 1JWUD 3PUVA 4ZK9B 4EVOA 3S1NB 4C3IG 3FMCA 4KKTA 5IGGA 3K7AB 4Q5VA 2BA0A 4C1NI 2LY7A 1TS4A 3M85A 1RJTA 4CHTB 2L83A 1SYCA 2A68D 4JX1C 2WV6D 1K8OA 5IGDA 3H3VC 4HROA 1YNJC 3HEJA 3Q24A 1WTPA 1L6UA 4KHVA 1OQRA 1HQRD 3OW7A 1L5PA 1FNUA 4N58A 4ZUIA 4K2LA 2B63B 5LL6S 1LTBD 3DXJC 3HZXA 5M3MB 1BF4A 3GTMB 1CT1D 2EDGA 3GD7A 4A3DB 3EGRA 1GUSA 3HS0C 4XYOA 2RDHA 1D6EC 4YT0B 5I9PA 3PUZA 2PVOD 5A2QE 4OL7A 4Q0FA 1ACCA 1U4MA 1N61A 5BN5A 4CKBA 1DOXA 2OEOA 1TIID 4XE0A 1A3VA 4KGRA 3NTKA 5DNFA 3VR9B 4CGYB 4XTCS 2WXKA 3NVZA 4A3JB 1DGJA 5C3XA 4JWSC 1JWBD 3MVVA 1XO3A 2AQ2B 1ZXTA 2HDLA 2KJXA 4BBSB 2Y0SB 2IPKD 5T8IA 2LEKA 4TQ0A 4BA1I 4NAWB 3ND8A 3O13A 2BYTA 3NSWA 1LTGD 3BVGA 4KD3A 1JQYD 2J52A 1ZOYB 4XQQA 2ICIA 1VR9A 3MXUA 3PIO3 1OXSC 1JW9D 3VYUA 1NR2A 2Y5PA 4FXKC 3KBXA 4ID6A 4WWMA 3G7LA 4YTNB 4NJCA 2EY6A 1QILA 2F0WA 2CU3A 2WU2B 3P4QB 3M4OB 3AB9A 1SSOA 3LX0A 2F0JA 2DN8A 1TYGB 4DFAA 4K5VA 3GV6A 3WOFA 1E10A 2QIEB 2K22A 2JP1A 1KFYB 1TKWB 3D3RA 3U9SA 1RM6C 3NWSA 2RBMA 4QMGA 1TQOA 4IUVA 1PUTA 2WU5B 4DQOC 1ZPSA 1W6KA 3GTLB 2F1MA 4P2CB 4DF7A 4YSXB 3CKIB 1C48A 1Q1BA 3T56B 3OIQA 1PGBA 1PFDA 3V05A 3BVZA 3D31A 1EIGA 1RWSA 2WNMA 3Q8BA 4ZKBB 1XX8A 2WP8J 4OW0A 2HDEA 4ILWA 1V97A 5FLXE 3NP8A 1STEA 2PVGC 5LL6X 2IT1A 5C6AA 5JOBA 3L4PA 4MHEA 1SYDA 3I90A 3T3OA 4U673 5GXGB 2MHVA 2EY1A 1C4AA 4HMJA 1Q12A 2B8FA 2W54A 5D14A 1Y1VB 1D5XC 1IL8A 2K04A 1NAPA 4I7ZC 1FMAD 1MD2D 2WP9B 1H9MA 4KK7A 5BN4A 2E75C 2B76B 1TY0A 1AYFA 3C2PA 1RCVD 5JPNC 1GXDC 1QCBD 2R6GA 3A7LA 4CJ2C 4DK1A 3TP5A 3T53B 4RH6A 1KLUD 3AE7B 1PTOB 3ND9A 1YN3A 2WXOA 2EYLA 4G4KA 2AQ3B 2CW0D 4WQMA 2EE1A 1N62A 1WTRA 1G8ZD 1CHPD 1ICWA 3W9CB 1EY4A 5HG2A 3MXPA 2IDYA 2IX0A 4OHJA 3JAML 1D1KA 1ET6A 2K9XA 3AN1A 3DHQA 1Z6HA 2ZT9C 3R2TA 2QJLA 2E6XA 2EVBA 3TP6A 1YQ4B 5CV4A 3ZQ4A 3B2FA 2QF7A 2BW2A 2WINB 2RA4A 1A3UA 2G9DA 1D5ZC 4A3IB 3X3MA 3IL8A 5C3JB 4EQPA 2EYJA 2IL8A 2YU9B 2M0AA 1FYCA 3VQIA 4FF4A 4XDXA 5K36H 1CQFA 1LTID 1PRTD 1U4RA 3S2DB 1ESRA 2YEPF 3LYYA 5KNCA 4LAAA 1JRPA 4FXGC 2WAQB 2IJ0A 4H13C 2FMCA 1C4QA 2PIAA 5G3LD 4CBVA 2H1EA 5KRUA 1H9SB 2SAKA 4OZCA 1EY9A 1RYJA 5EE1A 1EU4A 2F0VA 2BDNA 5J22A 2DNEA 2LMCB 2LGIA 1UEAB 4IALA 2E74C 4RWSC 1H9SA 4JPSA 1EEID 2JEAI 2SNMA 4EQNA 2B2VA 2F0HA 3C8YA 1FXAA 1V8QA 1NEKB 3M7GA 1Y56A 2LMCA 3I4NB 1B4OA 3V3XA 1LACA 5KIXA 2B2WA 3OMGA 4EGVA 1IW7D 4YTPB 4HTHA 4ZLTF 2Q8TA 3NUHB 2BE5C 5E3FA 4KKUA 3EVQA 2H89B 1F9PA 2WXGA 4X3SA 4K8JA 5CC4A 4OO1G 2E76C 1VJKA 2EY2A 1UGJA 3AMUA 1ENFA 1SDFA 2QKIC 3SDZA 4YTMB 3D4WA 3HGBA 3NRZA 4YXDB 1T3QA 2ACZB 4U68A 4A3MB 2JZPA 1BMLC 4NDXA 2F0KA 1GOZA 2Q8IB 2FINB 1ZP0B 3MHZA 2MEKA 3AEBB 3GP7A 2SNSA 4KKSA 2ZXPA 2QEJC 4HMIA 1DOIA 4L23A 3LNNA 2MP1A 1SNCA 4MACA 1EQTA 4XWTA 2NTTA 1F2RI 1K53A 1PFBA 2XN9C 1DCZA 5FO8B 3DWAA 3BWUD 1STAA 2KCCA 1CA6A 1PTOC 3P1HA 5CYUA 3BS1A 4RFBA 1I4HA 5I6YA 1GUWA 3GV3A 3MC0B 3SR6A 3UI2A 4N9PA 1V43A 2ZXRA 2IGGA 3TP8A 3AH7A 3U7ZA 3FVQA 4HCEA 2PNRC 4OGQC 4ZQ3A 2F3VA 1ZYRD 3NTHA 4WORA 4DN4M 4PT5A 2BDOA 1PZKD 1M4VA 2VZKD 2ONQA 1PDXA 3K5OA 1EWHA 5ELCA 1TWCB 2EJGC 3VR3A 1SSNA 1QE6A 2A6HC 3FPPA 1MBYA 5JAVA 1AZPA 1EQVA 3Q23A 1PDQA 4G7HC 1QNUA 3TZUA 4JE3B 2RQXA 4K6DA 2RDGA 1ZKOA 1O7ZA 2JU6X 1SAPA 2J53A 1VF7A 2RMMA 3PUWA 1K50A 3SEBA 2BS2B 2B2VC 5F2DA 4C3JG 4B08A 4GLSC 4AQ7A 1E2VA 4FYDA 1I4PA 3TEZA 1PTOF 4GDKB 2B2WC 3W5VB 4F8MA 1OXVA 1C9FA 1QWYA 2PZWA 5C3WA 3V2TA 2NMQA 2B2UA 1B9MA 3S15B 4ZUJA 3FEWX 2V3PA 5HURA 2WXQA 2PZTA 1VZ7A 2KOLA 2F0UA 1JCKB 2ENBA 3FDTA 5COYA 1WTOA 4A9AA 2TMPA 2L1BA 4DXFA 3NZ3A 1AW7A 1S5FD 2NYZD 2ZXOA 3D4DA 5C0XI 2PTLA 3CQZB 5G5HA 1T5EA 5DAUA 1ENAA 4ZHOA 3AE9B 2MJ8A 1EEFD 4C1NK 1FD6A 4FO2A 3S9WA 3OWEB 5H8YE 3MFYA 3MA2B 4FVMA 3J81L 2VXWA 3HOYB 5D3DA 1U9RA 2NN6I 2OEDA 3VR6A 3D6WA 3SR1A 2F0OA 2JQRB 2JA5B 4IFDI 2WXHA 3K5MA 4YSYB 1BCPD 2INNE 2E3TA 1JWAD 1TKEA 3OSOA 5I2YA 5EE0A 3VA5A 2K32A 2A68C 1GUGA 1YMHE 2EELA 1TR5A 3FAHA 4L6TB 2K1BA 4HEDA 2MJ3A 3NE5B 1O7LA 4G7ZC 2IW3A 1WXQA 2KWDA 4HJGE 1HUMA 1STBA 5D65A 2M19A 3RMHA 3J9CA 4NZLB 3VYSA 3Q8AA 3ETRA 2PMVA 1YJIA 4IUQA 1HCZA 1XLNA 2N55A 1BR9A 1Y69U 1EU3A 1O7YA 1ILPA 2D5DA 1E7PB 2M00A 2L12A 5BYSA 3DWPA 1BNZA 5EGTA 3H6MA 2V4IB 4A55A 1KNEA 2DBYA 3A56A 3BZDB 4TKOB 3H09A 3K5LA 5EE3A 3L3OC 1J8IA 2J7ZA 1H9JA 3VR8B 1MSHA 2B2YA 2F4IA 2PYKA 4M1UB 1NCVA 2M2LA 2JYEA 2H4OA 3L7ZC 1L4DB 4HEA1 4A6QA 2B2UC 5C0XH 1O78A 3C1FA 4WAFA 3P63A 3SHLA 3U52E 5IGCA 2Q5WD 3HRZC 5IT9L 3J80L 3MXNA 5KYLA 1IYVA 5IOCA 2PW7A 4KGSA 2A74C 4WJWA 1EWYC 5ELFA 2GA4B 2EYOA 5EPKA 4CKEA 4ZKCB 1TJEA 4RF0A 4R8NA 1LTAD 2AWOA 3TBIB 2D2CC 2A73B 2NN6H 1JROA 1EY6A 5HHDG 1FO4A 1ZDVA 2LHDA 1F2YA 1T6BX 4IFDH 4WFN3 2WXPA 3AB5A 2L4NA 2F0TA 4DK0A 1IGDA 3Q6SA 2BBCA 5T1GA 1CK1A 3R8BA 1G2SA 3S16B 5K36G 5NUCA 4XQNA 5KNDA 1QQRA 2F0EA 1DM0B 1FFUA 5FO9B 3CRLC 3I72A 1QOAA 2D9UA 1SIJA 5BMHA 2X69A 4BA2I 4KMUC 3AMZA 5G5GA 1EL0A 3BG3A 1DOMA 1JOOA 4O1NA 4KTAA 5JXVA 2AWNA 3DUZA 1YNJD 2LHEA 1YQ3B 3D6CA 1FXIA 4IN3A 3QO2A 4J8QA 3Q22A 3KK7A 4A90A 1DONA 2WDQB 2GRIA 4LJZC 2L55A 1I4GA 1DD2A 3W5UB 3PUXA 2Y3AA 1J7CA 5EE9A 5AFWA 3KWVA 2K5WA 4Z9CB 3P42A 1PZJD 1TU2B 4OIJA 1FCLA 2EPBA 1RODA 2JE6I 2V3NA 4RGNA 4TQ1A 1SXTA 2JA6B 4KY5A 4PQXA 4NAMA 3H91A 2F03A 1YJJA 3GTOB 3SFEB 4XDDA 1STNA 1QOGA 3KLSA 2NVTB 2PCFB 3NQIA 4RGOS 2B2YC 1VMCA 1WTQA 3IT6B 4V0BA 1YNND 4PMCA 1AEXA 1J9OA 2PQEA 1HA6A 1D4BA 2KHSA 4QCLA 3GO5A 4KKJA 3Q69A 3VA7A 4WH4A 1LO5D 4S3SA 3RLFA 3D4RA 1CM9A 4L1BA 1Z47A 3WOEA 3LWEA 1ZXHA 4ARIA 2R3ZA 2IGHA 2BTEA 3DEPA 1Q1EA 1JR0D 4F88A 2FUG1 1SYFA 1WTVA 2PW5A 1SJED 3IAM1 2B2TA 4LLGM 1BDOA 1AWDA 2KAJA 4MN3A 5M9OA 3C3LA 3BYYB 1FRDA 1EM7A 5BYRA 1SJHD 3OOCA 1CHQD 4US9A 3A8KE 2KQ3A 4NP5A 2CJOA 1KDCA 3MHBA 1BUIC 2R92B 3FC4A 5FKAC 1SMYD 3M4YA 3OPOA 1C78A 2WXLA 3P4RB 3ITPA 1AP0A 2W3SA 4H0LC 4ZAIA 1ZE3D 1KABA 4ULLA 2AUKA 1TY2A 3UI3A 3E6ZX 4US8A 2LFNA 4GDLB 2K33A 1AFPA 3N9YC 4HCSA 4BY7B 3ZJTA 3HG9A 3GTGB 2WKDA 1XWEA 3NQTA 1HUNA 3I70A 4N59A 3FKIB 3VR5A 1G2TA 1P7FA 1IW7C 3H8HA 2JSVX 2IWHA 1WVLA 2D5GA 2HDMA 3I8ZA 2FMMA 4FNFA 3U4EG 5EBDA 2PMZB 3CHBD 2ZW1A 3PIP3 5CV9A 4A3EB 3Q0AA 1NENB 4DAYA 1UWXA 1NSNS 3NPPA 3TZDA 4K14A 5JEAH 3IAYA 1EYDA 3R93A 2R61A 4KHZA 3AEFB 2MJEA 2J42A 4A3BB 1B2TA 1B9NA 3MJ5A 3PZ8A 3C1EA 1TVXA 1MVKA 1WGKA 1J7AA 1SB3C 2IX1A 1STGA 1IYUA 1G91A 1YN5A 2A6ED 3JAME 2N7JA 1I4XA 5HFYA 2QDBA 3NUCA 3VR4A 1JOQA 4ARCA 5BN3A 2F0PA 1WWTA 2HCIA 5HGTA 3DMUA 4ZRPA 2A69C 3A7AB 1DZ1A 1FNVA 3KLRA 4HAEA 5C2TB 2BB5A 5M3FB 5LNK1 1QNKA 2XVSA 5EQ0A 2G1EA 4ZOHC 4KJNA 2E2IB 2PPBC 5E4WC 4BWGB 1I6HB 1PFMA 2BB6A 2WXMA 1F9QA 1DOLA 1HQMC 5EPLA 2KEDA 5M5YB 3HOXB 2NVYB 2Y5CA 1F0ZA 3TEXA 3I57A 3SFDB 1V1OA 4R8IA 1V1PB 1ZYRC 3TSSA 5IGEA 2SEBD 2B2TC 1CZWA 4A3FB 2DYMA 1FR3A 4F87A 1SYGA 2F0GA 3VYRA 3GQBA 5CV5A 3IT4B 2XIWA 4DA2A 1V1PA 1B3AA 4DNTB 2RDFA 1A6XA 1DOYA 1PLFA 5C4JB 3S14B 4Q2JA 5K5PA 5CORA 3Q8FA 2WDVB 3AE3B 1IKLA 1XTCD 1EYCA 4RNAA 2M56B 3K59A 3TUOA 4FF2A 4XXEA 1JE4A 5AUKA 1SNPA 1JMLA 1QF6A 3QOLA 1QG7A 2KVMA 4BY1B 1XCQL 3IFDA 4ZHPA 4IKGA 2MGSA 1JQ4A 3B2GA 4J1MA 3TN2A 2C9OA 2K28A 3PMFA 1MHXA 1E6EB 5EPJA 4USAA 4C3JB 1VDVA 5EKLA 3AE6B 2BOSA 4FXCA 1A70A 1XCTL 2KECA 3L9AX 2NWGA 4RF1A 4TRDA 3SE0A 1EOTA 3R3OA 5CBEE 5KEEA 1HZ5A 3VRAB 2BE5D 3P20A 4K5XA 3K0YA 5ELBA 3IAS1 2IGDA 1MPEA 4K8IA 5E1FA 4A93B 4J6HA 1FGBD 3E5SA 5IODA 2JXTA 1ZDXA 2I07B 4K2KA 2WXRA 3P75A 5IGBA 1X32A 3AM9A 4C56C 5EBCA 1B9RA 2D62A 3J7YW 1II3A 3I3CA 2GI9A 3U9OA 3C46A 2KMMA 1BXTA 3DWGC 4N9TA 3AE4B 1DOKA 5C4HA 4DNRB 3A8JE 3NHHA 5C0XG 4XT1B 3CU7A 4RA8A 1JWMD 2E2HB 1XEEA 4P16A 1W6JA 5IIFA 3D8GA 3AE1B 5DM63 4M0WA 1U4PA 3P4SB 3HVDA 3R2IA 1RTOA 2DNCA 4XYQA 1PTOD 1BCPC 3N52A 2NN6G 4TSSA 2SDFA 3RZOB 1LTTD 3BK1A 2EYHA 1FD7D 4EE2A 2WDRB 3EUB2 5E6JA 4CQNA 4IFDG 1CQVA 1L6VA 3IFTA 1PTOH 1B44D 3I4MB 1G6ZA 3MAQA 4N6EB 1SYBA 4CKCA 1KTKA 3TMEA 2XSCA 3NTIA 4RHSA 3NBHA 1OO9B 2ICEC 2NB0A 3RFZB 2DYOA 1BO0A 4RHRA 3ZJVA 1SNQA 1Y8NB 5JJZA 2N0SB 1AN8A 1HFNA 2HUGA 4IDIA 5C3EB 3T51B 1J7BA 4KY7A 2A6HD 1EYAA 5JVG3 3AEGB 1QB5D 2F0SA 4LK0M 1TS3A 1GPXA 2LFIA 1Q3LA 1A2TA 2AUJD 4FF3A 1ESFA 2AX5A 2WB1B 4KY6A 3CRKC 4OO1H 3WDNA 3BYTB 1AZQA 4MIUA 2JWUA 5CMDA 5EJWA 1BQQT 5JPMC 2L11A 4IURA 5BYQA 2Z4IA 1ML0D 1SE4A 2CVRA 2FE8A 1STYA 2WXFA 1GAQB 3DEOA 1WTWA 4KX6B 2F0QA 4RGMA 2BCOA 4ME5A 1L0XB 3AE2B 2RVLA 1UUPA 4R9WA 3HP3A 4YIJA 1DYQA 4LMQD 5ISRA 1R4PB 1S5CD 4CJ1B 3S1MB 1CJEA 4A8XC 2HTME 1FIQA 1VDZA 3RZDB 4RAUC 3QWNA 2X6GA 3CWIA 2QSDA 1H9RA 1E0ZA 3I4LA 3OIPA 1B53A 2M9VA 1MHHE 3J81E 3KWLA 3HOZB 2L0CA 1SFOB 3TEYA 5I9OA 2O4XA 2K6AA 1ZXIA 3QG1A 3HRDD 2F0LA 3LXFA 1EWCA 3ZGZA 4L8JA 1B1ZA 2OT2A 4H44C 4E6IA 1PZID 1DXMA 2HCCA 1PYWD 1EY5A 1LV9A 5FR3A 1GB1A 2NBFA 1LT5D 2ZW0A 3P4PB 2N9KA 4HSPA 1IGCA 3NVVA 3HOVB 1S4ZA 1EZ8A 3AECB 1F2MA 5C5MA 3GTPB 1S5BD 1SBBB 4C80A 3URYA 3OMCA 2JYTA 3FILB 4R3DA 1Q8IA 2EZVA 2X38A 1EY0A 5I4DA 5A2QL 2RPVA 3QB3A 3K6OA 1XF5L 2RSOA 3NVWA 5BMGA 3S2HB 1K8MA 1TS2A 3FILA 2HQEA 3P7JA 1HA5A 2KEEA 1ROEA 4O42A 2R93B 1EZ6A 1IUEA 4PNYA 5FK9C 1N63A 1PRTB 2Z1CA 1GUOA 2KACA 2B39A 2WKCA 3S17B 2QCPX 1A3TA 1RTNA 2QILA 1R4QB 3A55A 4WURA 1KRHA 3IXSA 2YEPB 3AEDB 1HPCA 4L63B 1FCCC 2K5PA 3T4AC 3M7NA 1CZGA 2MJDA 2E2JB 1MI0A 1EY7A 4H2AA 1NUCA 1N60A 5MPOA 4X3TA 4BBRB 4M8AA 3PV0A 3QJYA 1IKMA 2ID0A 2F0IA 2JX5A 4QUCA 3SK5A 4NMZA 1LT3D 1E0BA 2MH7A 3J7AF 2XWBB 5E4XA 5JEAG 5C0XJ 5IT9E 3J80E 2K5DA 4BS9A 3E56A 2EYPA 3TDQA 2A5HA 1VZ8A 3RD4A 2R7ZB 1YNNC 1BBXC 1SF0A 1L4ZB 3HUIA 3BVMA 1E2ZA 4JBWA 2N9LA 1VF5C 1E2WA 4K6LA 1STHA 3DWQA 1Q10A 2BT6A 3PZ7A 4DAPA 2LKVA 2EYFA 3ZYYX 1LTRD 2YYZA 4A3GB 2XNAC 4QIWB 4HRSA 1MSGA 4IUUA 1KF6B 4IFDJ 1ZUD2 3AE5B 4J3OD 4KN7C 5CV7A 2L52A 5FLXL 1JC7A 2OXPA 4I65A 3KLSX 1QKZA 4WIPA 1SMYC 2OHFA 1WRIA 2BS4B 4G57A 5C44B 4PMWA 1Y1WB 5JVH3 1MI2A 1F9SA 1UNSA 4AYBB 2NVXB 2I38A 2O5IC 2NTSA 3BK2A 3S1RB 2CW0C 3M3YB 1ONLA 2F0FA 3GS2A 1E9MA 1HRJA 1VRAB 3ERQA 4F7XA 4YWGG 3I73A 3MP9A 1UAPA 4GZYC 3RPFC 1WD1A 5D3IB 5D7GA 2KN4A 3TEWA 1HTLD 1SNOA 2VB2X 2VZKB 2W3RA 3WCQA 1I4RA 1RFKA 1GHJA 4REZA 3T3NA 4KGTA 1JB3A 1XXGA 4XT3B 4MM3B 1TWGB 3EFXD 3ONAB 3K57A 1MGSA 1NI3A 1PGXA 3DWMA 4C7ZA 1QJOA 1PRTC 4IUNA 4L2YA 1NYRA 5I6WA 3QIAA 4RKBA 1QOHA 4RCOA 1KDAA 2J4XA 3SK6A 1D2BA 5BMIA 5FO7B 4KV6A 1R9TB 1KNAA 3KF8A 2KCNA 1A15A 1N5XA 4FF1A 1I3QB 3EROA 5A35A 2A6EC 3ZJUA 1FM0D 1OFFA 5DEHA 1F2LA 2F3WA 4QUFA 2CHBD 1BOSA 2SOBA 1C4CA 1LT6D 3HKZB 4ZRQA 1SE3A 1WYGA 2K01A 2W55A 1Q90A 2PW9A 3BDCA 1PXUA 2K7VA 3FRPB 2K03A 2DWQA 5IGFA 4B0EA 4RCNA 3PO0A 2QMTA 2NUCA 1OQQA 1I6VC 1RF2D 1QLBB 4ZRZA 4G7OC 2DY7A 4X3UA 4IUPA 4TQUS 1G291 3A8IE 3E9SA 3I91A 2PLPA 2FFKB 5EKIA 4DXGA 3ABVB 1JOKA 2G9HD 4ITKA 3BDOA 4PV1C 1HHVA 1V8CA 1K52A 1PRTF 4KD4A 2JSOA 1WD0A 3W1SA 1GB4A 4XWWA 1OXTA 4MH8A 3MEHA 4V190 1JICA 4H7BA 1LABA 2K5QA 5G3LF 4B9XA 3P1MA 1I7HA 3X3NA 2DY8A 3H0GB 4QB4A 4XDCA 3NK9A 2L1AA 1Z7TA 3VR2A 2KA7A 1GHKA 2CJNA 1HFGA 1BCPB 3CIRB 3BDLA 3LB8C 3G6JB 2EY5A 2XRQD 3MXGA 5T1IA 1ET9A 5DM73 2TSSA 2KDMA 2XRSD 1LTSD 2CQAA 1PMRA 2B8GA 4OZBA 4EQOA 3VYTA 1EIHA 1F9RA 3S1QB 2WACA 3EQLC 4PMBA 2J0TD 4X3KA 1CA5A 2V0GA 1H9KA 3RUZA 4A3KB 3Q8CA 1CFMA 3KUPA 5JEAJ 2JA7B 2EKIA 2E2DC 1HTPA 2MUYA 2K05A 1I4QA 4IQZA 4YSZB 1M8AA 3GTQB 1LT4D 1CTMA 1HZ6A 3NBIA 1JALA 2EJMA 4C3HB 1TS5A 4FXDA 4HKQA 1TWFB 2NZ1D 4LTUA 2O2LD 2WIIB 1HEZE 2K3UA 2NVQB 1L0YB 1WSPA 2JEBI 1T5XD 3W3AA 2GB1A 5AUIA 1S5DD 2PKOA 4JK1C 5CV8A 2EOTA 4IZ8A 3HOUB 1WTXA 1Y8OB 3MTSA 5TSSA 1SNMA 2VUMB 1IHZA 1K83B 1L0VB 4FP5D 3H94A 1VMPA 1WCMB 3TP7A 5CGKA 1VZ6A 1FFVA 2WLBA 5CR3A 1QOBA 3K58A 4KKIA 4NW2A 1D5MC 1GJXA 2A69D 3DM1A 2L32A 4OO1I 1Y8PB 4XIGS 1SEBD 3MFGA 4UAIA 1LLRD 2Q8RE 4K5WA 3K5NA 2RKSA 2EXZA 4C3HG 2FHTA 4KJOA 3Q8EA 4C7YA 1TT2A 3PUYA 1F2RC 3HVZA 4WRDA 4KI0A 1KDBA 3LWUA 2BS3B 1D1IA 1U4LA 2F0NA 2DLBA 2AQ1B 3SK4A 1X3PA 2L5TA 3AE8B 3HOWB 3AU7A 3NXWA 2PZUA 1YN4A 1VCIA 4DGZA 2N88A 1TKYA 4AS1A 1TWHB 5ELEA 1ENCA 1EY8A 1P7EA 1SE2A 1KLGD 4LK1C 1OXUA 1TKGA 4IUTA 1JORA 2OF1A 1PFNA 5EKKA 2Z8LA 2