1SE4A

Staphylococcal enterotoxin b complexed with lactose
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
239
structure length
239
Chain Sequence
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN B
publication title Residues defining V beta specificity in staphylococcal enterotoxins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 66
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 1997-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1se4A01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1se4A02
1PRTC 1BXTA 1RCVD 4DXGA 1I4XA 3DWPA 1LTTD 1PYWD 1STEA 2AQ3B 4RGTA 1HXYD 1SEBD 1EU3A 1JWMD 1LT5D 1T5XD 4RHRA 2R61A 3MC0B 1MD2D 1B1ZA 1L0YB 1JWSD 1V1OA 1DYQA 2IPKD 3W2DA 1TS4A 3BYYB 4RGOS 3CHBD 1DJRD 2AQ2B 2NTTA 1I4PA 1F77A 2XRSD 5ELEA 1SE4A 4K6LA 4DXFA 1EEID 5ELCA 3DWQA 3BYTB 1CQVA 1FNUA 1TY2A 1YN4A 1LLRD 5FK9C 1JCKB 1EFID 1ET6A 3BZDB 4L6TB 3BVGA 1FNVA 1RF2D 1S5ED 3EA6A 4C56C 1G8ZD 5ELDA 1BCPB 1SBBB 1CHPD 1LTSD 1ENFA 1CK1A 3V05A 1BCPC 1I4QA 4UDUC 1FD7D 1TS3A 2ICIA 1SXTA 1PZKD 5D3IB 1JQYD 1S5CD 1LT6D 1KTKA 4Z9CB 1PZID 3R2TA 1TS5A 3URYA 1LTRD 3TSSA 2J4XA 1FGBD 1YN5A 3BVZA 1UNSA 1PTOH 1PZJD 1HA5A 1LO5D 1RDPD 3EFXD 4RGNA 1S5FD 1S5BD 2CHBD 2O2LD 4ZYSA 4L63B 1AN8A 1XTCD 4RGMA 1LTAD 1SE3A 5TSSA 1D6EC 1SE2A 3BVMA 1B44D 1I4RA 1TY0A 1KLGD 1SJED 3MFGA 1BCPF 1I4GA 1FNWA 2QILA 4RCOA 1D5ZC 2G9HD 4BWGB 1ESFA 1CHQD 2RDGA 2SEBD 1UUPA 1KLUD 1I4HA 1V1PB 2TSSA 1YN3A 3GP7A 1RD9D 5I4DA 1PTOD 1TS2A 2IJ0A 1EEFD 1PRTD 2NTSA 3R2IA 1CT1D 4RFBA 3SEBA 1JWUD 2RDHA 3KLSX 1L0XB 2Z8LA 1HQRD 5ELBA 2QEJC 1LT3D 1HTLD 1JR0D 2XN9C 2XRQD 4RH6A 4TSSA 1LT4D 1AW7A 1D5XC 1XXGA 4OHJA 1SJHD 1S5DD 5ELFA 1LTGD 3R8BA 2XNAC 1LTBD 5D3DA 1D5MC 1EWCA 3O13A 1ET9A 1QILA 5FKAC 1EU4A 2AQ1B 3DWAA 1PTOB 1PTOF 1PRTB 4NZLB 1GOZA 4RHSA 1PRTF 1M4VA 3OWEB 1PTOC 1V1PA 1BCPD 2WV6D 1LTID 4O1NA
chains in the Genus database with same CATH superfamily
1GUGA 3PO2B 4LNKA 3T16A 1PH1A 5EPLA 4MGIE 3R93A 3RNBC 2TMPA 1PYWD 3ERSX 3KF6A 4PS7A 4RKLA 1FFUA 2BTEA 1TU2B 3EFCA 2KK8A 3MC0B 5EKIA 3ZDTA 4N8X1 3DHIC 4HEDA 4C3JH 4DK6C 5ISRA 1HCZA 4P72A 3K8AA 5KHQA 2SOBA 4BBRB 5J3BA 1CMXB 1MIUA 2Q2IA 3A56A 3RLFA 1N9WA 2Q2HA 3S17B 3QWNA 1J7AA 2IY1B 4CHKA 1VZ7A 2A68C 3LWEA 4FN2A 3RFZB 4B3TQ 1WD1A 2ASQA 1CZPA 2NVYH 3MC9A 1SROA 2NYZD 2LGXA 4I6NB 3SFEB 1WZ0A 3PO2H 3EC8A 2XGTA 4R4CA 1WGHA 1J19A 3W9CB 4MACA 3RD2A 4HVBA 3R7RA 3VTWA 5C5LA 2ZTDA 3RUIB 1KM7A 1ML0D 4BVUC 3CU7A 4IM0A 4JI6L 1SNCA 4PV1C 2N9XA 1H9MA 2B39A 2JSOA 4KHPQ 5AZGA 5D3IB 1JJCB 5KRUA 4A3MB 1IYFA 3VQIA 3S17H 1SYBA 1IL8A 4H13C 1Y56A 3PRMB 2BQQA 3PZDA 3TMPB 2J4XA 1ZPSA 3JW0X 2R2QA 2UUAQ 1P1AA 1B9NA 1HA5A 5C44B 2DGYA 3FP9A 4EOYA 2DY8A 2K39A 5LMUL 4QCLA 3PGZA 2M4NA 1WI5A 3VYSA 1WH3A 4HPLB 1EYGA 2MLBA 3BY4B 4JC0A 5C23A 1WJ6A 5NUCA 2UU9Q 1KJTA 2L83A 3VTUA 3L7ZC 4IQZA 1JMCA 5DM73 3DCGA 3WDNA 3OJ4B 3SK8A 2JA6B 4RCOA 1H95A 2QMTA 2C35B 1EM7A 2HD3A 4XYCA 3ZGZA 4IPDA 4A3DH 1UUPA 1EUVB 1KLUD 3Q8DA 2IHEA 3HOZG 2MJEA 3ML9A 1B9RA 2F0SA 1EY8A 2YTYA 2MPMA 1BOSA 2JA5B 3P42A 4HCEA 2CJOA 2RGFA 3DVGX 1CA6A 1EQRA 2LGDA 4Y7NB 2Q8IB 4YSZB 3HGBA 1P0RA 2CHZA 2BOSA 3QARA 4HJKA 4OZCA 5IP9H 1IP9A 2QKIC 1PVOA 3HEJA 4DK0A 1WD0A 1ACCA 2JA6H 3PSEB 2BWES 2OOBB 3U8ZA 4WJ4A 3ZJVA 1CUKA 5ELFA 1XX8A 4DUYQ 4MJSA 2R92G 4FXCA 3GTKH 1KAWA 3ZUNA 3R8BA 2V3SA 1EF1A 2J0MA 2JA5H 2A8VA 3KLSA 4AJWA 1K83B 4B9KA 5IYCH 2Q2TA 5JH5C 1VLBA 2A6HD 3NWSA 1XNQQ 2KACA 2D3GA 2IX3A 5G2NA 2A69C 2PEAA 3P7JA 1HR0L 4A3OA 1VQ7A 1EL0A 1KIXA 5LMNQ 4A3CG 1PTOC 2ZXPA 1A3TA 1BCPD 3NE5B 2LMCA 2EVBA 1VCBA 4IG7B 3ZIMA 3GTJH 1PQSA 5FO7B 1QQRA 1QUQA 2PIAA 5KHOA 1LTTD 2V1CC 4OX9Q 3I4LA 3AULA 3DBRB 2M8SA 2VW9A 2OCEA 1LT5D 3Q8CA 2L0TA 1WIAA 3DWGC 3ZXVA 4DAPA 1L0YB 1V1OA 3AN1A 1AZQA 1VQHA 4QIWE 4BAXA 2VH1A 2NTTA 1C4CA 2EDGA 1F77A 2XRSD 1KQSA 3I70A 3KW5B 4DV6L 2E8GA 4W9LA 4K6LA 3UDIA 4X66L 3S16B 4IPHA 3FILB 3BYTB 4IM2A 4DK1A 2KOXA 1WFYA 3L10B 4MSMB 2FJ2A 4QY7A 1K0SA 1BKBA 4KHZA 4DF7A 1F9PA 2CWPA 2K04A 2Z6KA 3NXWA 4XDCA 2ZJDA 2N8NA 2L4NA 1HZCA 1E8YA 2N9LA 3M62B 3CCEA 2JX5A 3KJOA 1SNDA 3FKIH 1PFBA 1ENFA 2WAQB 1RRBA 3W5OA 3QR8A 4B0MA 4KKSA 1AEXA 3CW2C 3NQIA 3JSVA 3CMMB 4K8IA 3M3YB 3P4RB 5KYLA 4Z9CB 2LZ6A 3EHVA 5C6AA 1TS5A 3M4PA 2JSVX 2BVCA 1RFAA 1FGBD 2N3SA 1EFWA 2R7ZG 5C3EG 2F0OA 1UNSA 3S2DB 3TEHB 3T3NA 1XLNA 2ZPYA 3I3CA 3QK0A 2QGQA 3DDCB 1K50A 1Y1WB 3AU7A 2WP8J 4RGNA 3AYHB 3SK5A 1S5FD 1EOTA 2O2LD 3SK4A 4ZYSA 5J39A 4FO2A 1PFMA 1A6XA 4G11A 1XCQL 1LTAD 2QIEB 4GZYC 1SE2A 2E76C 2F0GA 1N63A 2IO0B 2JA8B 1R4NB 1I6HH 2M00A 5I2XA 2G9HD 3LNNA 1BDOA 2LEKA 3H7PB 1ESFA 3M3YH 4PK1A 4US8A 5M3FG 2JU6X 3F2DA 3RNGC 3NP8A 1KD1C 2PVGC 3E3XA 1FL0A 1TWAB 2ZW1A 2F52A 1GHJA 2D0OA 3K81C 4JBWA 1NI3A 4IUQA 4HDQA 3I5JC 4LNIA 2FAZA 1E2VA 1IW7D 4DR5Q 2WLBA 2B2TA 2WWZA 1L2NA 3K80C 4OONA 4GLXA 3RNUA 2E2HH 1KRHA 5CC4A 4RWSC 3DBSA 1D4BA 1JWUD 1N32Q 4P6VF 5AFWA 4MH0E 1SYCA 3NENA 2CQAA 5FLMG 1SAPA 1EIHA 2DN8A 3N6RA 4BY1G 3X3NA 4JE3B 2I2YA 4MM3A 2JA8H 2BF8B 5GAGC 4FJZA 2PE9A 4HJAA 2K6AA 4TSSA 4B3ML 4PMCA 1J7BA 2DENB 5EPJA 2L11A 3TP5A 1D5XC 3SHLA 3NVYA 1V80A 3EN2A 4LF6L 2H89B 5M5XH 1LTBD 5D3DA 1YX6B 5D65A 5EE1A 3P63A 1SB3C 1E2ZA 5IGBA 4GDLB 1EU4A 1TWGH 4R1JA 1N62A 1SF0A 3AMZA 2KTRB 2KOLA 1IBLL 2K5HA 4UY8C 1QG7A 2HIVA 3KDFA 5DLQE 3VR6A 1OXVA 3PT2B 2CKZB 3IL8A 2L5TA 1ONLA 2EXZA 3G48A 3MXUA 4I7ZC 3VA5A 5IP7H 2JRHA 1PRTC 3AB5A 4QUCA 3KJPA 1STEA 1L7YA 1JICA 1Z2MA 1UF0A 2HQEA 3UE1A 3HOYB 1EY7A 1RAXA 2KC2A 5E7NA 2HUGA 2B2TC 1XMOL 4XE0A 5IY0A 1PYSB 1TS4A 2KNBA 3STBC 5CHVC 1MI2A 2NVQH 5IAAC 4NMZA 5EQ0A 5L83A 3X23A 4LCDE 5ELOA 5CGKA 1PFNA 3NEMA 2D10A 2KEEA 4KGRA 1FXTB 1WJ4A 4FF4A 1HNWQ 1D3ZA 2RKSA 5C4XG 4OVUA 1EZ8A 2IHFA 4C3HB 4MN3A 3UDGA 1D1KA 5D14A 5IGDA 3BZDB 3SE0A 4LK0M 4B0EA 1KDBA 2OQ0A 1RF2D 1UWVA 1E7PB 1TWCH 1TR5A 3WWVA 3HOYH 3J7AF 2PMVA 3B08A 3UINB 2NUCA 2K22A 5EE9A 5C3WA 3P4SB 3ZVVA 4F1SA 4KX6B 4MELA 2PE6B 2LXKA 2K5DA 3AE6B 2K50A 1FD7D 3EUB2 3U2SC 1SXTA 1LXDA 4JBMA 1JQ4A 1X65A 2KWUB 4TUUA 4JBJA 5KNDA 4KLKA 4V190 2R7FA 4X62L 5A2QL 1PH6A 4JI4L 1R4NI 4YWLA 2L7RA 2GN5A 1KH0A 3L4PA 3A9JA 1C77A 1PDQA 2EY6A 4X6AH 3AB9A 3AXCA 3KUZA 5TR5A 4YHHL 2DZJA 5IKCM 1Q0WB 3EFXD 4XZ4A 5IYBG 4LDTB 3L0OA 3SVMA 1IL2A 2INNE 2MBOA 2VZAA 3TZUA 1L6VA 3KK7A 4R4QA 1WXAA 2RD0A 3GQBA 1I4RA 1TY0A 4HIDA 3LDZE 3C8YA 2B3GA 4E3CA 4FA6A 3GTGB 4X3SA 1I6VC 5FLXc 3BK1A 2F0IA 3B0AA 2RCFA 1YHAA 4A3JB 1LFDA 2K3UA 2RDBC 5C3JB 3P2BA 4GKKQ 4TVAB 1YVCA 2MGSA 5IGEA 4OO1H 4K5VA 1PFDA 1RD9D 4PZ7A 2IZVB 3CP0A 1KHIA 2EE1A 5GXGB 4HJGE 4I65A 4PZ6A 1VS0A 2Z1CA 1N5WA 2BB6A 4WQMA 5D94A 2I5LX 4NXNL 3RCZA 1D8LA 1V5TA 4DUZQ 1VQOA 4B3TL 3ZNID 3T1HL 2Y0SG 1HQRD 2HHHL 3ZTDA 4HSVA 2JF5A 3J81c 3OOCA 3VR9B 1V86A 4XGAB 3J81E 4BY7B 4IUNA 1Z47A 3CF5A 3HKZE 1SFOB 3HOXB 1G2TA 2MX2A 2AWTA 4GXBA 4OHJA 2NBUA 3N3KB 1L6UA 5C4ZA 2KLGA 3HS0C 1UAPA 2H4OA 1KXLA 4XWTA 2WXNA 4DHZE 1A3VA 3N30A 2JA9A 5DPTA 1PLFA 2CH4W 2A1AA 5M5WB 4IOIE 3OYYA 1FRRA 3GB1A 5J17A 3JAMc 4LNFA 3PO0A 4K7WA 2WX0A 1LM0A 1C79A 3HRDD 3VR8B 4L8JA 4DAVA 2DAFA 2ZW0A 3ENEA 3EFUA 3WOEA 1WTXA 4KGSA 5C5MA 3DUZA 4B3SQ 1M4VA 3OWEB 1Q81C 3DEOA 1IHZA 1X32A 2PW9A 2Q5WD 3TZDA 4EQOA 2G4DB 2V4IB 4W9JA 1K8OA 3ZW3A 1XTDA 2WXHA 3S1NB 3R7QA 3HOXH 3HFZB 3NZSA 5CV6A 1T0RC 1Q5WB 2LUMA 4H2AA 4RHRA 3HOZH 2F0UA 3SR1A 5M5WH 1STBA 3TMEA 2AQ2B 1I4PA 5GADC 4BBRG 4CDDC 4DV5L 2PZTA 5JAVA 1HTOA 1SE9A 2FHTA 4GS3A 1YIWA 5DEHA 5FK9C 3KWLA 1EY9A 1GVPA 3L54A 3QQ8B 1EWHA 2X6LA 3LWUA 4UPAA 4DV2L 3PV1A 3W1YA 1G8ZD 4LF8Q 2UXCL 4OVZA 2R92H 2Z6BA 4GIVA 4GLAC 1SNMA 1XNRL 2KN4A 1XLQA 1ENCA 1XLPA 1RWSA 4DUYL 3S2HB 3A9KB 3ND9A 4MNOA 3WOFA 2GLSA 1UGJA 4WQOB 3A0JA 4A3MG 4M01A 3M63B 2OT2A 2ZM6Q 3BU2A 2UUBQ 2IGHA 4A8XC 1XNQL 3NUHB 4A3CH 5C44G 3A1QB 2OTJA 2OWOA 2WDVB 5LMNL 4K0KQ 3MJ5A 4ZRQA 2GB1A 1D6EC 4BA2I 1QZGA 3I9V1 3N9YC 1K9MC 4KDIC 5IP9G 2B2UA 5HGQA 3TRZA 1HUNA 4K3CA 5HG2A 2LWPA 3E5SA 2ACZB 2WXQA 3TL5A 2K75A 3S2HH 1GD7A 2LGIA 1CHQD 3B1LX 2SEBD 2GVBA 1YOVB 4I7AA 1EY5A 1HFGA 1B3QA 3NSWA 2VNUD 2L55A 1TVXA 2JA5G 3FPUB 1R4MB 4ANWA 2F0VA 4QB4A 4IM3A 4K2LA 3DOWA 2F0WA 1L0XB 4J6HA 2D11A 3EGRA 3R66C 4TKNA 4ZRJA 2JE6I 4JI1Q 2SNSA 2QEXA 1UWMA 2D5GA 1LT3D 1NSNS 2I5MX 1M1KC 4X64Q 3A33B 1F1HA 3APFA 2K01A 1H9SB 2NPTA 3LGJA 2F0HA 1CKNB 4DNRB 3J80c 1QKZA 1WZ3A 2MP2A 5JEAJ 1FFVA 2K5PA 3T8MA 1CZWA 3J80E 2MBEA 3NOBA 1EF5A 3E56A 3A54A 4A3KG 5C3EH 2PCFB 3FVQA 3R3OA 5FO8B 2UU7A 2HJ8A 4B3RL 2JP1A 2WDTB 1E2WA 4OGQC 1SMYD 1PTOB 2IW3A 5CV4A 3OIPA 1R9TB 4JI2L 4RHSA 2PPHA 4C4VB 2KKCA 2A6ED 1KF6B 4PMWA 2KECA 1RCVD 3DWPA 5A2QE 1S72A 4S0RA 4DAYB 4KMUC 1OXUA 3Q3NC 3PUWA 2F4IA 1SEBD 2K1BA 1EU3A 2HJ1A 1JWMD 4XT3B 2KXJA 5M3FH 3KLWA 3WALA 4IUUA 3MXNB 4JI0L 2R61A 3GS2A 3UDFA 5LNK1 4AQYQ 4W9GA 1DYQA 1A63A 1TIID 3S1QB 3ZTCA 1UEAB 1GPXA 1FJGL 3S15B 5GAEC 3GTMH 1LV9A 2WXFA 5ELCA 3GZNI 3F2UA 4ICUA 3WAPA 3B9JA 1KLVA 5FLMH 3AFQA 2IX0A 3G6JB 3WANA 2YU9B 5E6JA 3ULJA 4DR3L 4BY1H 2MWSB 1SNOA 3OMCA 3G7LA 4O2DA 3NTIA 3NBHB 1UD7A 1HNZQ 2XVSA 1G2SA 4A3PA 2N55A 2E6XA 4L5QA 4OWWB 2KHJA 2WAQG 3QIAA 5C3XA 2N1VA 1X3QA 1WTWA 2CCZA 2KUMA 4Q2JA 1STHA 3CC4A 2M0AA 3WAOA 5G3LF 3PV0A 1UE7A 1WJJA 1Z9FA 1S5CD 2LS01 5J1ZA 3S15H 5IYDH 1MVKA 3FDTA 4MZ9A 1TKGA 2CHWA 2GBJA 1QUQB 4DV1L 3PLVA 3PRPB 4P1CC 4YXDB 1G6PA 4GOPA 3Q0AA 1D2BA 2F0LA 1WGGA 1N61A 3TP8A 1SNQA 2F0MA 2QDBA 1X55A 4NB3A 2NR2A 1BO0A 2OTLA 2KQ4X 1Y1WG 4YWGG 1GUNA 4KVGB 4LUZA 2G3QB 1HFNA 2QC8A 3IAM1 1BQQT 1VDZA 3LX0A 1KLGD 1N5XA 3K7AH 3MEHA 1OTRB 2ZXOA 1P16A 2EYJA 2VQEQ 3CCRA 4II2B 5BYRA 1PGXA 3IAS1 4A75A 4C00A 2LGSA 3NZUA 2OEOA 1QOFA 2BB5A 2C9OA 3UQAA 4ZRKA 3BJUA 2B63B 1S1QB 2EJGC 1SSNA 1TS2A 2CKHB 3SU8X 5C4XH 4KSKC 1LABA 1SLJA 2NTSA 4URKA 3AE8B 1YNJC 3UI3A 2L15A 2IO2B 4TRDA 1YIJA 3A8JE 1IBML 4DQOC 4GN4B 3D31A 4WJWA 5ELBA 1JJGA 3F2BA 4JI7Q 1JB7A 1I5FA 4J1MA 2I1KA 3B2GA 1WY8A 2LKVA 2RQXA 3CMEA 3HIZA 3M4OH 2JZPA 2VXWA 2UXBL 2VUMB 2JWUA 4S3SA 3KUCB 2M0XA 4GOPC 1XPRA 1UZXB 2F3IA 4KKJA 2JZZA 1XJVA 3KYHC 4QMGA 1TJEA 3A4SC 1NBFC 3AEVA 5H1SE 3ZJTA 2WX1A 4RKBA 3G71A 1E8XA 1CA5A 4W9CA 3IHPC 1YHBA 3W1GA 5IYBH 3CCUA 1YQ4B 2K14A 1DOKA 3PO3B 1PRTB 1WE6A 4PYUA 1GOZA 2Y0SB 3VYRA 3RPFC 1E1TA 2RVLA 4GN3B 1E90A 2N9KA 4WAAA 3WA0A 1PDXA 2PMZE 3L9AX 2ZJPA 4FADA 4EX5A 1VQ6A 4PNYA 4XTCS 2N9EB 2PNHA 4KKUA 1L0VB 1HXYD 3VRBB 1ZXIA 1C7YA 4JV5Q 4LW1A 3HOYG 2AWOA 4LFCQ 3PIP3 2RDFA 4KK7A 1E7VA 3BWUD 3T1YQ 1C8CA 3ZKJC 2BA0A 1HRJA 1NDDA 3ZNHB 4A90A 3GDEA 4GKKL 2KVRA 4DR4Q 4E74A 4WURA 1IYVA 3HUIA 4K7SA 3BDLA 3PO3H 1AWDA 4LDTD 3MTSA 4DBGA 1YJIA 2MBBB 3ZYYX 1JCKB 1G291 4IZ8A 3QC8B 1WMHB 3H6NA 4C3HG 2LSSA 3BVGA 4IUTA 4K14A 4GNXC 2F4VL 3NRZA 1V2YA 1Y8NB 4MSQB 1G6ZA 3HK0A 3RYTA 4C56C 3S14B 1R4QB 2BS3B 1PGBA 3GTPH 1IBKQ 2EJMA 3S1MB 5E6NA 4BKSA 1LTSD 3UQBA 2N4FA 2B2VA 4DPGA 3MC8A 5EDSA 3KDFB 1KC8C 1K28A 4H7BA 5I6YA 4AYBB 1LTLA 2K8HA 1HZ9A 1X1MA 1RJTA 2O5IC 1LT6D 5JEAG 1BF4A 1J6QA 1F2MA 4X65Q 3PIO3 4G7OC 1IBXB 3TSSA 3PTFC 4PYZA 3LB8C 1TGZB 1VQJA 4OO1G 2CHXA 1HNXL 2DWQA 3V6EB 3FPPA 4HMIA 3QAQA 4HIMA 2VH2A 3OAWA 2BE5C 1RDPD 3PQIA 1Y1VB 4WJQA 2PPBC 5M9OA 1P8LA 2BDNA 3T56B 1NCVA 5JVG3 2WNMA 2DHZA 2DYBA 4QL5A 2BBCA 4W9KA 4JOIC 4X3UA 2IYDB 4TV3A 1SJED 3TCAA 1J5EQ 4IW0A 4JX1C 4FJYA 2W55A 5G5GA 4A3JG 1KDCA 3D4RA 2EY1A 3KVFB 2OF1A 3GD7A 4BBRH 5AJ3Q 3DBHB 2RPQA 3RN2A 5M5YB 1VQFA 2DZIA 4EVOA 4B6WA 5CBAE 2GOWA 2REXA 2X38A 1XYIA 2MW5A 1E7UA 1U4AA 3OHXC 3R2IA 4DV4L 1PHJA 4IWOA 4RFBA 5C4JB 1Y1VH 4JYAL 5G5HA 1MG4A 2KX0A 2OQKA 3DHGC 3H1UA 3I3TB 4GKJQ 3RNAC 2SAKA 3E9SA 3L0WB 2D3BA 5LLIA 5E4WC 1XEEA 3FEWX 3AM9A 3TQYA 3VYTA 3OIQA 3K5MA 4TQ1A 2NS5A 4ZCKA 2CW0C 4BY7G 2QHOA 4LF8L 2BH2A 4O42A 4JGHB 3HOXG 2EKEC 4LTUA 1TYGB 4RM9A 2A68D 5IWAQ 1VDVA 2IX1A 1WGKA 2IDYA 2IGDA 1XD3B 4A3MH 2E3TA 1EYCA 4M8AA 3OJ3A 5M5YH 2WGSA 4GSWA 3TBIB 3MWYW 1E6EB 2WXGA 2X8XX 3EIVA 3CKIB 3MAQA 2EIFA 1N33Q 5C44H 5C4JH 2C5CA 2EQSA 2DNFA 1JC7A 3M7GA 4M02A 5KYIA 3NVWA 3TS0A 1Y8PB 4QQBX 1N34L 1HPCA 1MHXA 1V1PA 3CIRB 1MJEA 1VJKA 2EXDA 1ICFB 2KA7A 4GN1A 2VY3A 5JJKA 1UWXA 4ZRIA 2HCIA 3ZRCA 4BKGA 2KVMA 4JG2A 3AEGB 4DWFA 1J7CA 2F0QA 1GB1A 2WB1E 3A5ZB 4CDCC 4DR7L 2KFJA 3VXWA 3BYYB 4A3KB 1PH3A 1AE2A 1DOMA 1AARA 2D07B 4K5WA 1WCMB 3TEZA 1OEYJ 2CWAA 2CR5A 1N36Q 1YNNC 3QOLA 3V2TA 4Y7NH 1XPOA 1F2RI 3DWQA 1WSPA 4MH8A 3NVVA 2Y5BB 3D32A 2HDMA 2M1MA 4G0NB 3VUYA 2MBHA 4C7YA 1JMLA 1P3QU 5FLXL 4LFBQ 1ET6A 4ANVA 4B9WA 2KWVB 2HTME 3KF8B 2CS4A 5EE0A 1PGAA 2KWCA 4WWPA 4FP5D 4FJVB 1L1OA 3NTHA 3D4WA 4XIGS 1K73C 1CK1A 4HMJA 4LF7L 2WXLA 5CYUA 3EVQA 3PUYA 4L5RC 2ZZPB 4A3KH 3Q22A 1RYJA 4DV0L 1N6ZA 2KN5A 2NZHA 3AE7B 4NAWB 2J53A 1K83H 1EZ6A 1CM9A 4KIKA 1NI2A 4EQNA 3DPDA 2R93B 3CF6E 3DVGY 3ZDMC 1SYEA 4EQ5A 5CBEE 1KNAA 3J81L 4DV7Q 1YJ9A 3GTLB 1FO4A 3ZRFA 3RZFA 4LF4Q 4WWMA 5H92C 4FVMA 4ZUJA 2BYFA 3QJYA 2D0PA 4IPCA 2GBRA 1AN8A 4DA2A 2YEPF 4E71A 1A15A 1KDAA 1C9FA 1I3QB 2L12A 1WXQA 1QOBA 1ESRA 5HGTA 3JAML 1WI0A 4DR1Q 3P1MA 4M8NA 4M8MA 4PG3A 2PO4A 3GTOB 1STGA 4NXMQ 3RZWC 3I63C 4AQYL 2A69D 3H3VC 2R93H 1PTOD 4BFRA 2BGFA 3S16H 3HKZG 1C4AA 5LL6S 1EYDA 4JI5Q 4FF1A 5C1ZA 3K5NA 3UGBB 2I46A 2L3ZA 4HK2A 1FR3A 3C3LA 1BVSA 4RH6A 4BOZB 2GVAA 3I4NB 1XMQQ 5CV7A 2QDFA 3IG3A 4GDKA 4LF9L 1HHVA 2JEBI 2M17A 4RCNA 5LL6X 1LTGD 2K5WA 2NB0A 4A6QA 5CMDA 1H9RA 4XQJA 2XNAC 5GAHC 1NAPA 2E5LL 1EWCA 5D6JB 1KRTA 4ASWC 5K5PA 5FKAC 4JI3Q 2UXDL 1PMRA 3DHHC 3F2CA 3MXPA 2Z6KC 3S2DH 2O2VB 4MEMA 3CQZB 4DR2Q 1JROA 4ZRPA 4DK5A 1JB3A 1Y1WH 2KFKB 1YQ3B 4A3EB 2WXKA 2K6DB 4JWSC 1LACA 3I4NH 2BDOA 1RIPA 4HJ7A 2NBWB 4OIKA 1STAA 4A4IA 2W54A 2FMCA 4ARIA 5JOBA 4LFAQ 4DV3Q 4KDLB 1QJOA 1JT8A 3VHTC 3L2PA 1J8IA 2JVCA 4XQQA 3V62A 1GUWA 1TWAH 2MQHA 1VQAA 1GNUA 5IYDG 3DBRI 4BZAA 1ZEQX 1EEID 3TUOA 3SGIA 1F9SA 2LD9A 3SFDB 2YEPB 4QIWB 3I2ZA 2W9NA 2VQFQ 4ARCA 4KN4C 3UDXA 4A3LG 2L0FA 4HN7A 2K52A 2B2YA 2KANA 5EE3A 1FXAA 4KY7A 4NKLA 2N78A 3IBEA 1JE4A 1HQMC 3PUZA 3OTOL 1C78A 2VL6A 3QJZA 4M0WA 4K6DA 2ICIA 2CU3A 2O6VA 1G6JA 1OXTA 1HTPA 4A55A 1F52A 2FFKB 4XXEA 3DM1A 1WYDA 3BVZA 1YX5B 1DOYA 3ONAB 4P74A 1FEHA 4JBKA 2WS3B 1KRSA 4F8MA 3KQ4A 1ZKOA 3FAHA 1O7ZA 2GBKA 5KIXA 5E1FA 4P7IA 3J80L 1UBIA 4L1BA 2KBNA 3PLUA 4W9DA 2PQAB 1FMAD 3CD6A 1EY6A 1II3A 2D3CA 2LVOA 4OZAA 4CYEA 4IPGA 5IP4D 2ZXRA 4APVA 4BWGB 3MHSD 4XYOA 4HWIB 2E2JB 4HAEA 1QVCA 1GG3A 2KDFB 1C3TA 2NVXB 4LFCL 2MCNB 4P1BC 3NJTA 2B63G 1BUVT 1PRTD 4IJHA 2VZKB 3J9CA 3K0XA 1YJNA 3VR2A 1HR0W 5IIFA 3BZKA 4BXXG 5K36G 1C1YB 4C3HH 2J42A 2KWDA 3EBEA 5J22A 5CHFA 5DM63 1EIYB 2Z8LA 2N88A 2V3NA 4UP9A 2XEWA 1EO6A 3BINA 3STBD 1F2YA 1ZDXA 4HKQA 1WOCA 1B53A 3TDQA 1ZYRC 1BUIC 2DZMA 3W5VB 1WFQA 1XXGA 5JHBA 1SJHD 4EE2A 1WRDB 5J18A 2VUMG 5E6PA 1TKWB 1W6KA 4JI8Q 4C1NK 4CDFC 1NE3A 5JEAH 5FLXE 3P1HA 4EZJA 1ZP0B 1JOQA 2K4KA 1MJDA 5IODA 2NN6G 3KYCD 3VDYA 2F3VA 5EBDA 4KZCA 3ICEA 1EWYC 1H8CA 4WWNA 3J81i 3HZXA 3AMUA 1X56A 4K81A 2MRPA 4CKCA 2Q8TA 1VQNA 3PO3G 3HRZC 1XO3A 3CCJA 1C0AA 3TREA 3H94A 1Q46A 1BXTA 5C4HA 4DAMA 4DXGA 1DGSA 1Q3LA 3GTGH 3ZJUA 2EYFA 4HROA 4KHVA 2LHEA 2V3PA 4A3JH 2JYTA 3JAMi 3H0GB 4YCVA 1J5EL 1VZ8A 2LHDA 1NR2A 2IPKD 2ZJQA 3HKSA 5JXVA 3I90A 4HIOA 3S1RB 1WGRA 4A76A 1T9HA 4MTNA 4K5XA 4KHPL 2ZCBA 4EEWA 1GC6A 2XWJB 2EMSA 2YLMA 3ABVB 3IFDA 1FCLA 1LUZA 4GNXB 1CQVA 1FNUA 3JAME 4WFN3 2WU5B 4OVVA 2UUAL 1L5PA 2JA7B 1WR6E 3IVFA 3K9OB 2EYHA 3T4AC 4R3DA 3T9LA 1YJWA 4P16A 1OXXK 3PRZA 5BN4A 2QCPX 4ME3A 4BY7H 1JORA 2L1BA 2PZUA 1RM6C 4YSXB 1SFOH 2UU9L 1QWYA 3QWZB 4CHTB 2A74C 2ZEQA 5E4XA 4FNFA 1K3RA 3OLMD 2XWBB 1WR1A 4NNJB 1C76A 2HE7A 4JPBW 1TTNA 4U68A 1E9MA 4U673 4YL8A 3S1RH 5IWAL 4AYBG 2B29A 2LXCA 1Q1EA 4JVZA 3DHQA 4G3XB 1GXDC 4BKTA 1N33L 2DAJA 2D9UA 1V5OA 3QHTA 1ENAA 4YIJA 3RMHA 5GMVA 2JJQA 1A2TA 3RNCC 4ABNA 5H8YE 4IDIA 1E1OA 2DY7A 2EYPA 4ANUA 4IFDJ 2G1EA 2JXXA 2KVZA 4A93G 1Y1VG 4XQNA 3S1NH 2ZNVC 4WIPA 3BVMA 3U4EG 4A3FB 4PMBA 4JI6Q 4OO1I 1Q8IA 1YBYA 2MHJA 1VCIA 3FILA 4X57B 4NPNA 1FNWA 2QILA 3QG1A 1R7SA 1F9JA 2XK5B 4YT0B 4IOCA 2LRUA 1UE1A 3TS2A 3BDOA 4NDXA 3P20A 2F0EA 3U9OA 3KF6B 1ZXTA 2DJFC 3Q24A 4K3BA 2Y3AA 1X3GA 3A5UA 1ZW7A 2JY6A 1EUJA 3CCMA 2M9VA 3HOWB 1Q1BA 1U4RA 2F0JA 4F88A 4A3FH 4A3IB 4LFBL 1O7YA 3L16A 4NJ6A 4ZKCB 1JWBD 1LYLA 1SYDA 2HDLA 1PFSA 1VQMA 2MSED 3C19A 5LXHA 5C0XJ 4OX9L 3AEDB 3EECA 1JRUA 2IL8A 2FMMA 3ECIA 4Y52H 5JHAA 3I7FA 4TKOB 3PCOB 2WP9B 1ZKHA 4A20A 1SRUA 3HKZB 1FCCC 3DWAA 1NYRA 2GMIC 3KUDB 4R4TA 1E10A 2CQOA 3MHBA 1G91A 3H7PA 3Q3FA 1QOHA 4CQNA 3HOWH 4LUVA 4LF4L 4DHZB 1B8AA 1CZGA 3PF5A 2WHIA 1ILQA 2KMMA 3TEWA 2LY7A 2KMAA 3J80i 3TP7A 1M90C 2MBQA 2AWNA 5HURA 2FCQA 4WH4A 3IXSA 2V1YA 4DK3C 3Q3OC 3SXHA 1QOGA 4LNOA 1STYA 2VS1A 3X3MA 3L08A 2N0SB 1T5XD 3AQQA 1IZ6A 2UUCQ 2N9PC 5DPWA 1MGSA 3V3XA 2L00B 2D2CC 2F3WA 3L13A 3AE3B 1F9RA 3RI7C 1NUCA 5DNFA 4QJFA 3UIOB 4HCNB 5ELEA 2QW7A 2RSNA 2J0JA 2XIWA 1WCMG 1PYBA 3RT3B 1HR0Q 2C7NB 2KQ7A 3RZOB 1YHQA 3WIMA 4DKAC 3AEEB 1LLRD 4LJOB 4IURA 4BBSG 4LJPB 2FCNA 2B2UC 1STNA 2Y5PA 2B2WA 3J81j 2K32A 3NS1A 4L6TB 2MJDA 2PQEA 5FR6A 2W3RA 3QA8A 4GDLA 1Y14B 4PT5A 1J0GA 2ZTCA 1WTOA 2KTRA 1SBBB 3PHWB 1M8AA 4GMVA 5HKHA 2Y5CA 3NZ3A 2HCCA 2IGGA 1PZKD 5BMGA 2KDEB 2V4LA 5AEKB 5HFYA 1TZOA 2WQYB 4KD3A 2KCNA 1M94A 1SYFA 1QZHA 1B9MA 5BN3A 4JI3L 1AZPA 2R93G 1IGDA 1PTOH 3S9WA 2KZRA 1R9TH 2C9WB 4MJSB 1BR9A 4DR5L 3I8ZA 4DR2L 4WJ3M 2RSOA 1UH6A 2BYVE 2BYTA 1UBQA 2MO1A 3KYDD 1N32L 3KFUA 1SE3A 3NVZA 3S24A 2Z0SA 3M95A 3I57A 5IGGA 4NAMA 3Q6SA 4JQWC 4FF2A 2WKCA 1WGDA 1BBXC 2R6GA 2JXTA 3E0EA 2V0GA 4HLEA 4LFAL 1W2BA 4OXPA 4DV3L 3B6YA 4LK1C 4ME5A 3C2PA 3PIPA 1PH4A 3S1QH 2ZCCA 2GI9A 2LMCB 3AEFB 3DVNU 3AV8A 2MQJA 4G50A 4LNNA 2B2WC 1HZBA 4G4KA 5KEEA 3CRKC 3MFYA 2KX3A 3CCLA 1NEKB 1E8WA 4KJOA 4KZ0A 2YU9H 2RDHA 3KLSX 1Q1OA 1FRDA 4A3LH 2HDEA 3G6EA 1WXMA 2KQ3A 5HI1A 1J8CA 2HIXA 1RHPA 1HTLD 1JR0D 4L23A 5JJLA 4N59A 1S3SG 3APDA 4KTAA 2KD0A 3H3VH 5JJZA 3MXGA 1BBWA 3I4NG 1R4MI 1AW7A 1AYFA 2INDC 1SMXA 4LMQD 3WCQA 2OJRA 4ZHPA 1QNUA 4OEMB 2RPVA 1A0IA 3QX1A 4OZBA 2VB2X 4WWOA 4ZYNA 2N1WA 4IUMB 1YNTE 3HOVB 1GHKA 1GUSA 3BZCA 1MPEA 1UGMA 3MHZA 3PIOA 4P2CB 4Q5VA 4N6EB 2KCCA 5GQOA 4KD4A 2B8GA 2WYQA 2MJ3A 5IA7A 4P71A 3RN9C 3W1SA 1ZOYB 5AUIA 1VMPA 1A2UA 1HNWL 3JSVB 3M4QA 1TIFA 3LYYA 4A3EG 2E2IB 4DXAB 1T0SC 4QGUA 4B3MQ 3GTQB 4IFDG 4PZ8A 1I50B 4RMFA 3U4ZA 2ATWA 1Q7YC 2O4XA 2K7VA 1KL9A 4LF6Q 4DR6Q 4FYDA 3PREA 3D0FA 2H88B 3F8TA 2SDFA 2NCNA 1O7IA 4X3TA 4OWXB 3RZDB 1EY0A 3H9DA 4REZA 1S3OA 3CPFA 4RGOS 4C3IB 4FHKA 1PH9A 1Q10A 5CHWA 2B63H 2KHIA 3VA7A 1IBLQ 5AZHA 3JC66 4BXXH 5G55A 2EOTA 4A3BB 5K36H 4GDKB 1ROEA 1Y8OB 3J7ZC 5IOCA 4ZRZA 2J52A 2N7DA 4A9AA 3HP3A 4F87A 5LMNW 2HT1A 1ZXHA 4US9A 4F8CB 2LI5A 3E9HA 3RR5A 1FNVA 4CBVA 3BS1A 3TP6A 4II3B 2M19A 4K7UA 3F1ZA 3SR6A 2QSDA 5ELDA 4C7ZA 4A3GB 5CV8A 2DYMA 3Q3JA 1EQTA 4IWQA 3TJPA 2VUMH 1XMOQ 1K8MA 1MG8A 5DPRA 5BO4B 5C0XG 1E3PA 4ILWA 5JJIA 3HM3A 1YNJD 3E0JA 2NN6H 1KTKA 2YTXA 4LUOA 1OXSC 1VQKA 1K0RA 2VZKD 1LTRD 4MM3B 1YN5A 1WJNA 2I1JA 3L17A 4ZLTF 3MJWA 1PZJD 2V4DA 1J9OA 1IGCA 5D2MB 5EGTA 4JIOU 2K5VA 1KAAA 4L5TA 3DWMA 1XQQA 4DUZL 1X9NA 4NQLB 4WORA 4L5SA 3IFTA 4A3GH 2PNRC 2BKFA 4D2KA 4P75A 1VQLA 3TBLD 4DGZA 4Q0FA 5E6OA 3W5UB 2MH7A 4ALPA 1I4GA 1EYAA 2KCTA 4C3JB 1DOIA 1O7LA 3VVWB 1Q86C 4ZDVA 4CJ2C 4X62Q 2B3AA 2FINB 1YN3A 3NWTA 1ZUD2 3Q14C 4IKGA 2KEDA 3M3JA 3K6OA 2F0NA 4UP8A 3ALBA 4YHHQ 1CJEA 2UYZB 1HA6A 2ZVOA 1CSQA 3E6ZX 3CC7A 3H09A 2K25A 2LASA 3SEBA 4CJ0B 5IT9c 4NP5A 4EQPA 5JPMC 3ZXRA 2NVYB 2O6VB 3A9KA 4A93B 3PF4A 4H44C 1D1IA 1UE6A 4B3SL 3S14H 3VR3A 4F7ZA 1T5EA 4X3KA 3S1MH 3I55A 2FUG1 5JZEB 4XYQA 3FHWA 4IN3A 1P7FA 1SYGA 1X3PA 3FKYA 4HTHA 3V61A 4EGVA 4MGZE 3K58A 2L32A 1GJZA 3A1QA 1SNPA 3CAMA 1WTRA 4WAFA 3H15A 1V81A 2R7DA 4KGTA 1PH8A 5I2YA 2N7JA 2WDRB 3Q3MC 2W82A 2XSCA 4NXNQ 1K8AC 4EZLA 4HJ5A 3UIPB 3ZJYC 3K7UC 1HJPA 4WJNA 3T1HQ 2HHHQ 3HG9A 4UAIA 1DXMA 4A93H 2A19A 3WAMA 2L52A 1DOLA 2I07B 2B2VC 3PHXB 2KJ6A 4MGYE 2WV6D 1LTID 1E0BA 5EPKA 2NN6I 3AEAB 4HDOA 1NENB 1EIGA 4R9WA 3UI2A 1EWIA 1P98A 3U50C 1WJUA 3CMAA 1GUAB 1I42A 1RTNA 3A9JB 3PUXA 2YTVA 1H9KA 1MD2D 1GJXA 2F0FA 1IUEA 2L8JA 2K5QA 3H0GG 1ASYA 4A3DB 2KHWB 4DHJB 4WJPA 4CDEC 2PMZB 2BE5D 1SN8A 1VQPA 1VMCA 4ZK9B 1VQGA 1PA6A 1H9SA 3KLRA 2WAQE 5KNBA 1K3BC 2P5ZX 1CKNA 3A8IE 2ZM6L 2L05A 3VR4A 2UUBL 4ZQ3A 4BOSC 4TQ0A 2PTLA 4ZAIA 2JA7G 1WTVA 1K51A 2CH4A 2A6HC 1S5ED 3BK2A 4K0KL 4RG1A 4DDID 2FE8A 4XDXA 4J6IA 2JEAI 1CSPA 1GUTA 2CJNA 2KDMA 4KJNA 5M3MG 1BCPC 1T0YA 1SIJA 1V49A 2O5JC 4UDUC 3GTKB 2FUHB 2M56B 4YCUA 2D5DA 4C4VA 1KOTA 4W9FA 2D62A 4BKSD 5F2DA 5IGCA 4DV5Q 3W3AA 1PZID 1HE8A 3GE8C 1F9QA 2X6GA 1JOKA 3NHHA 4DN4M 1A5RA 3T3OA 2VB3X 4CKEA 4DAYA 4FLHA 3I4OA 3MA2B 4I6PA 3GOEA 2ES2A 2PI2E 2JN4A 2KYWA 2CU1A 1FXIA 3MP9A 1YMHE 3MXNA 3VDZA 4BBSB 2ZNVB 2CW0D 1UELA 4DV2Q 2CHBD 4L63B 1MHWC 1BT0A 1WVLA 3RNFC 3C46A 1LQBA 2UXCQ 5TSSA 3M9BA 3GTJB 1XNRQ 4JI1L 2IY0B 5EBCA 5IO9A 2E75C 3Q8AA 1CQFA 4A3FG 1WTPA 3MFGA 4X64L 2RSUA 3DEPA 3AU4A 1H4RA 3OPOA 2DLBA 2CFMA 3P4PB 2UUCL 5FJ8G 2NVUI 1KNEA 5IGFA 1V8QA 3NBHA 5KNCA 1MKHA 4ICVA 1WCMH 3AE4B 3D4DA 1HEZE 2BS4B 1SDFA 1OTCA 2J0KA 2DJGC 3QCAA 4RM8A 4KV2A 1SE8A 2KTFA 4ULLA 4NY0A 4BBSH 4NQKE 4BBNC 5DAUA 1XF5L 3CCQA 3OSOA 1TZ1A 1O78A 1JOOA 1TBEA 2K5NA 2AX5A 2BKRB 2WU2B 5DCNA 2H1EA 4B08A 4ITKA 3HOWG 3DBHI 3HM6X 2XRQD 2FXQA 3NG0A 3U9SA 4A3IG 3RD4A 3FKIB 1C4QA 1YNND 1PH5A 1V97A 2BPSA 2K28A 2BCOA 2BS2B 3CSTA 2K1FA 3ERQA 1U9RA 3ZLZA 3ULPA 4C2MB 1RODA 1X54A 4N9PA 3Q23A 1UE5A 3GTLH 1TT5B 1KFYB 2RCNA 1GKHA 2G5DA 3AH7A 4NZLB 1DZ1A 3H8HA 4FHJA 1L1OC 1I94Q 3ITPA 3RMKC 2K9XA 2EYMA 2WXRA 3PS6A 4YCWA 1IW7C 1I3QH 3H91A 2LFIA 3DVNV 3C1EA 1OEYA 1NBWA 1HNZL 4DNIA 2WINB 2ENBA 4YTPB 1I6HB 1AE3A 1VZ6A 1XT9B 2PZWA 1CI3M 2M2LA 5CORA 3GTOH 1D7QA 2QCZA 3HVDA 1VQDA 1L2FA 2F0PA 4C2MH 2Q2UA 4B3RQ 3VAWA 1WM3A 4OELB 2JT4B 3ND8A 5T8IA 3SDZA 3NQTA 1RTOA 4IO9A 1ZE3D 5EKKA 1FYCA 2Z4HA 4JI2Q 4AH6A 1XPUA 3HOUB 1GO3E 2WB1B 4BA1I 2MO0A 2AUJD 2E2HB 2PVOD 5JVH3 3R3MA 1IPGA 2KJRA 2R2OA 1B4OA 2R3ZA 1Q82C 3DBLB 4AJYB 3DM3A 2JYOA 3AE2B 3NHEB 3AE9B 3Q8EA 2JQRB 2MFIA 3RN5A 3OW7A 4JI0Q 1CHPD 3T13A 1P9DU 3GE3C 1GC7A 5COYA 1FJGQ 3P75A 1YEZA 2F1MA 1E7ZA 5BR8Q 2WXPA 1KABA 2VQEL 5M5XB 4KI0A 3SHQA 4LAAA 3URYA 1FD6A 2LXAA 2W3SA 1TWGB 3HOUH 4GU2A 3V60A 3VUXA 2ICEC 3CQZH 2NPTB 1ILPA 4DR3Q 4ODGA 4W9EA 5C2TB 4EUTA 1XLOA 2BH8A 4A3EH 1PV4A 1MFWA 2C7MB 2LGYA 2MP2B 1TT2A 3P4QB 2AHOB 2KC1A 4JK1C 4IFDH 1ZGUB 1MJCA 3VH3B 3G4SA 4YWKA 3AI5A 3ZQ4A 1EOVA 2EYLA 1B44D 4POFA 3I4MB 2AL6A 4B9XA 1GUOA 1PUTA 4JI7L 1AH9A 4R4IA 5L37A 4GGQA 2XTIA 2QA4A 1HZ6A 4RA8A 4DR6L 3PGEA 5CV5A 1JWAD 2B8FA 4DV1Q 1WMHA 3N32A 4ANXA 1I35A 1FVIA 4FDBA 1Q90A 4NJCA 1B70B 4ZOHC 4ACFA 1B3AA 4YSYB 1E24A 2NVQB 1K53A 5L95C 1VQ9A 3GO5A 1A70A 2D3AA 3U7DA 4C80A 3IT4B 1UEBA 2LFNA 1VQ4A 4POGA 1PXUA 2E2DC 3PSIA 2G45B 4H0LC 2L0CA 4YY3Q 2AUKA 4DDGD 4L2YA 1Z7TA 3O65B 4KY6A 1IBXA 1XCTL 3MZ5A 1ASZA 2JXMB 3I4MH 2FCSA 2ZPNA 1W6JA 3D6WA 4R8NA 2GRIA 3C0RB 1TWCB 1GM5A 1WWTA 1R4PB 1X3EA 4IUPA 5C0XH 3CC2A 4NJ7A 2Z59B 1TKYA 3N1YC 4BS9A 3I91A 3N1ZC 4LF5Q 3JYUA 4JV5L 4HJ8A 1QT9A 1T3QA 1TQOA 2KAJA 2PLPA 1WM2A 5BYQA 3EROA 1ET9A 1A62A 4IWPA 4MTKA 4LWCA 3T1YL 3KBXA 2CVRA 5FOBB 3HOVG 3CPWA 2NZOA 1GAQB 3CRLC 3N52A 2XBBC 3DXJC 4DR4L 1C4PA 5BYSA 1IBMQ 4HEA1 2MEKA 2B2YC 1SIFA 4FULA 1QNKA 2WXIA 1OFFA 2C7HA 3KBGA 3K0YA 2KJXA 3IT6B 3VTVA 3IAYA 1I4XA 2PW7A 2UXBQ 2ZTEA 1K52A 2AQ3B 2IO3B 4RGTA 4GOPB 2OJWA 4K1RB 1NJIC 4DFAA 3RULA 3GV3A 4KV6A 5G3LD 1IBKL 2E2JH 2K6QA 2NBVB 3OMGA 1NMFA 4N58A 4E6IA 1B1ZA 1Q12A 3RLNA 1T0QC 2NVXH 2LUEA 5I9OA 2JK8A 3RLOA 3W2DA 1F2RC 2RR9A 3DBLI 4ZHOA 4IFDI 3J7A5 2MHVA 3NS8A 2BT6A 4C3IG 2EELA 3VFKA 3K5OA 4CGYB 4X65L 1IKMA 3CCSA 4A3BG 4HXDA 4AP4C 1V43A 3SK6A 3CXCA 3QB3A 2D2QA 3QO2A 1YITA 3ETRA 4UP7A 3Q6BA 4IUVA 3EA6A 2K8BA 2IY5B 2MA9B 4W9IA 2Q8RE 2A5UA 2ZJRA 2EJFC 2JZ3B 2FNJB 4A3GG 2NVTB 3KUPA 3NELA 2KHSA 2BW2A 2L76A 1VQBA 2LJIA 2ON8A 3NY5A 5I9PA 1DOXA 1OGWA 1NY4A 1TS3A 2F0KA 1YNXA 1K8GA 5ELNA 3D3RA 3R2TA 1H9JA 3AE5B 1VQIA 1NMGA 3NBIA 1NVID 1U5KA 2A73B 4N9TA 1E8ZA 5AJ3L 3SDLC 4B95A 3APCA 2NBFA 5EKLA 1A3UA 1LO5D 5C0XI 2O6VD 2F4VQ 3AE1B 1ZYRD 3ZNZB 4AS1A 5CV9A 1S40A 1QVFA 1Y69U 5IT9E 1GB4A 3J7AV 2NZ1D 1WYWB 4GKJL 4EKUA 2EZVA 4EZKA 4MT5A 2NVTH 3KOJA 2I0QA 1A8VA 2EPBA 1BCPF 2F0TA 3IRBA 4FXGC 1LM8B 3H0GH 2G4SA 4AWJA 5M3MB 3A7LA 2PKOA 2PYKA 1WXVA 2RDGA 3HOZB 1WX9A 3D8GA 2J7QB 4G57A 3KF8A 4C3JG 2K33A 4NPSA 2OHFA 3AECB 4M1UB 1HNXQ 3N20C 2JQOA 4HKZE 1IKLA 1VQCA 3OW2A 3JVZX 1RL2A 4FXKC 3KH0A 4RF1A 3LXFA 1DGJA 2J7ZA 3IKJA 2JA7H 2SNMA 2QJLA 2RBMA 4JPSA 4NAWA 2AYOB 2AKWB 2WIIB 1QVGA 3CSFA 3PO2G 4LNQA 1DCZA 3Q8FA 4FBJB 3FRPB 5M3MH 1OO9B 1EQVA 4V0BA 2R92B 2WXJA 1EIFA 4RNAA 5AUKA 5AZFA 4DHJD 4FF3A 4F7XA 1G51A 5CR3A 3I72A 4IJLA 4AOFA 1NNXA 2K03A 4CJ1B 4N8FA 3M4YA 2QDLA 2HD5B 4OWTB 1Z5SB 3VYUA 3AFPA 1QILA 1WYGA 4DV4Q 1F2LA 3H6MA 4YWMA 3PZ7A 1PH7A 1B50A 3BIID 4JYAQ 4BBNF 5LMUQ 3DMUA 4GN5A 3M7NA 1T6BX 1WX8A 2NMQA 1NTGA 1S4ZA 1N36L 3ZNGC 1BNZA 1PTOF 2AMCB 4XT1B 5EAYA 1JALA 4C1NI 3U30A 1E5WA 4WJOA 1JJ2A 1U4LA 2AEHA 1RFKA 3U52E 5IN7A 1V8CA 4M00A 1V9PA 2L1AA 2NWGA 1EY4A 1HH2P 1JW9D 2WFWA 3K5LA 3FC4A 5CX3A 1WRIA 4J3OD 3GZNB 2DNEA 1ZDVA 2DBYA 2LVQA 4KN7C 5FJ8H 2EKIA 2Z0DB 2FIDA 1F2ZA 1CKOA 2ASBA 1C9OA 3VH4B 1FPYA 4A3DG 3CHBD 5HHDG 1Z6HA 1QF6A 4QF4A 1N8RC 2FIFA 2J0TD 2H5XA 3OG5A 1XWEA 1MBYA 2PI2A 5FR3A 1N34Q 4KKIA 1Q8KA 4DV7L 1E0ZA 4DNTB 1WTQA 4ID6A 4A3IH 2KDIA 4TQUS 3K9PB 1SMYC 1I7HA 1BCPB 3ML8A 4CO7A 3NTKA 4ZUIA 4YTMB 1IYUA 2O2VA 3A55A 4FXDA 3TEXA 2PJHA 3K59A 2JA6G 4R8IA 4DR7Q 2KFKA 3V05A 2F0DA 2A6EC 3TIXA 1U4MA 3MTNB 1I4QA 1P7EA 3ZO5B 4J8QA 4DR1L 2MJ8A 2GA4B 3L3OC 1JQYD 2EY5A 5IT9L 4NXML 4KY5A 2R7ZB 2JWZA 5C3EB 2WXOA 3UE0A 4K2KA 2RHQB 4NW2A 1OQYA 5IYCG 2YYZA 1SGHA 2KLCA 1WTHA 1CTMA 1HTQA 1S5BD 4JI5L 2EYOA 2JUOA 3V6CB 1SR3A 1XTCD 2ID0A 1I94L 2ZVNA 3AEBB 2WKDA 4MDKE 1HZAA 5T1IA 1YZ6A 2MUYA 4EFOA 4R4OA 4LF7Q 3LJ3A 4GLVB 2EMTA 4JLCA 1MI0A 1V9JA 5DPSA 1D5ZC 3A8KE 4DV0Q 1XMQL 5M3FB 1X6OA 2C5LC 3A4RA 2I5HA 3B2FA 1U0LA 5GROA 1X3FA 4IALA 1WX7A 2GBMA 1L0WA 2R7ZH 1V1PB 5EJWA 4DV6Q 2N49A 3RUZA 2RMMA 3U7ZA 1DM0B 1WE7A 4X66Q 2F03A 3GTMB 4QAYA 4S17A 1EEFD 3RZOH 2KQSA 5HY6A 1WXSA 2JRIB 1OQQA 3RNEC 3MEFA 3T51B 4OIJA 3A7AB 2B76B 4UHVA 3C1FA 2I38A 4BY1B 5D7GA 5LHY1 2DZKA 2QEJC 2DX5B 2XN9C 1MSHA 3MVVA 1AP0A 1HUMA 1TWFB 3U58A 4OW0A 3FMCA 2JPHA 4HPPA 4MHEA 2WDQB 3VRAB 4HIKA 5BMHA 4GOCA 1VRAB 2MP1A 4XWWA 3FKIG 5JPNC 2RF4A 3GV6A 1S5DD 5A35A 2BA1A 3Q69A 1RLFA 5J2RA 3CWIA 4MGKE 5T1GA 1FM0D 5FO9B 2Y0SE 5BR8L 1CKMA 3EQLC 2E74C 3O13A 4HSPA 1V6EA 3ULLA 2PQAA 2Z4IA 4I6LB 1L1OB 1NR4A 3BDCA 1TWHB 2LJ5A 4CKBA 4YTNB 1C48A 1L4ZB 1FGUA 3VR5A 1MSGA 1PRTF 3OWFA 2EY2A 4RAUC 2AQ1B 1TWFH 1E22A 3A74A 4O1NA 2GBNA 1QCBD 4HPMB 2INPE 4KIKB 1N60A 4LF9Q 2VQFL 3QIJA 4KKTA 1VQEA 4GLSC 2UWQA 1VQ8A 2OEDA 2VRRB 3K7AB 2E5LQ 1K8RB 1JWSD 2WACA 5IOIA 1VF5C 2UXDQ 1WGYA 5I6WA 1DJRD 3PPAA 4HRSA 3QOJA 1MHHE 1QB5D 1TWHH 4G7HC 2IO1B 1SE4A 1VR9A 4DXFA 5C4XB 3TEYA 1TY2A 1TKEA 5BMIA 1YN4A 4IC7B 5MPOA 2Z9HA 1CFMA 3HOUG 2Z0EB 2WB1G 4H02A 2K05A 3SD5A 1EFID 2G9DA 2LXJA 3PUVA 4AYBE 4YY3L 3W1BA 2DYOA 4AIMA 2C60A 2KJHB 3PZ8A 1QE6A 4XC2A 3ER0A 1B2TA 1L4DB 1IYJB 3ONSA 2JA8G 3M4OB 3HHMA 1HZ5A 1AFPA 1TXYA 1ISNA 4PS8A 3TN2A 4TMAB 4N9F4 3HOVH 3I56A 3PVLA 4LF5L 1FIQA 2HQLA 1OQRA 1Y8RC 2YV5A 3VUWA 2RA4A 3J7YW 2WXMA 4HR7B 1U4PA 3K57A 1VD2A 1DD2A 4JWUC 2DNCA 1QLBB 3T53B 3AU5A 4AQ7A 5CTRC 2KCMA 4J15A 2IT1A 1YD8U 4RMAA 4LLGM 2E2IH 1JRPA 4HJ9A 2K0PA 4RGMA 3GTQH 1BMLC 4PS3A 1I50H 5IP7G 4RF0A 1QOAA 5IE8A 4LJZC 1V1QA 1QZEA 5E3FA 2LRWA 3OTOQ 4JL9A 3CCVA 2ZT9C 4MIUA 3E9IA 4GNXA 3I4MG 4JW0A 3S2AA 2ALYB 4K8JA 3RZDH 2KDBA 4XX5A 4AUQC 3IFWB 2MNAA 3N1XC 1I4HA 4C3IH 4G7ZC 3Q2AC 1O80A 2TSSA 4JI8L 3GP7A 3M85A 2AL3A 2FBWB 2KO3A 5I4DA 3EJIA 2ONQA 3W1SC 1PH2A 3Q8BA 4A3BH 2YVCA 2IJ0A 2QF7A 4QUFA 3I73A 4P73A 4JCVE 5KGUA 3H3VI 1ICWA 5BN5A 2A4ZA 1CT1D 3D6CA 2BYEA 2IBIB 4KSLC 4GB9A 3PMFA 3UF8A 1YI2A 2INCC 1VQ5A 4USAA 2OXPA 4OL7A 1WF9A 3NUCA 3HVZA 4O0AA 2JYEA 2KMCA 1JE5A 2DUDA 2K8CA 2X69A 3BG3A 4HCSA 3GTPB 4PQXA 1LT4D 4WRDA 4HCPB 1RKNA 2PW5A 1F0ZA 3H7SA 1YQBA 2BWFA 1YJJA 3V96A 1B7YB 1DONA 1EQQA 4JOIA 3KWVA 3DQVA 1BBUA 1D5MC 2IWHA 5LXIB 4W9HA 2RHSB 4JI4Q 4XDDA 4IOAA 3U4VA 3X0WA 1NYQA 1YJ1A 2FCMA 1VF7A 4DU9A 3DLLA 1W3SA 2HTHA 2LVPA 2XK5A 3NK9A 2KT7A 2V9HA 2KENA 2L9HA 1LGRA 1IXRA 4M0WB 2A5HA 2N7EA 1SSOA 3NPPA 4ZKBB
chains in the Genus database with same CATH topology
1GUGA 3PO2B 3T16A 5EPLA 3R93A 2TMPA 1PYWD 4RKLA 1FFUA 2BTEA 1TU2B 3MC0B 5EKIA 4HEDA 5ISRA 1HCZA 2SOBA 4BBRB 3RLFA 3A56A 3S17B 1J7AA 3QWNA 1VZ7A 2A68C 3LWEA 3RFZB 1WD1A 1CZPA 2NYZD 3SFEB 3W9CB 4MACA 5C5LA 1ML0D 3CU7A 1SNCA 4PV1C 1H9MA 2B39A 2JSOA 5D3IB 4A3MB 5KRUA 3VQIA 1SYBA 1IL8A 4H13C 1Y56A 2J4XA 1ZPSA 1B9NA 1HA5A 5C44B 2DY8A 4QCLA 3VYSA 5NUCA 2L83A 3L7ZC 4IQZA 5DM73 3WDNA 3SK8A 2JA6B 4RCOA 2QMTA 1EM7A 3ZGZA 1UUPA 1KLUD 2MJEA 1B9RA 2F0SA 1EY8A 2MPMA 1BOSA 2JA5B 3P42A 4HCEA 2CJOA 1CA6A 4Y7NB 2Q8IB 4YSZB 3HGBA 2BOSA 4OZCA 2QKIC 3HEJA 4DK0A 1WD0A 1ACCA 3ZJVA 5ELFA 1XX8A 4FXCA 3R8BA 3KLSA 1K83B 1VLBA 2A6HD 3NWSA 2KACA 2IX3A 2A69C 3P7JA 1EL0A 1PTOC 2ZXPA 1A3TA 1BCPD 3NE5B 2LMCA 2EVBA 5FO7B 1QQRA 2PIAA 1LTTD 3I4LA 1LT5D 3Q8CA 3DWGC 4DAPA 1L0YB 1V1OA 3AN1A 1AZQA 2NTTA 1C4CA 2EDGA 1F77A 2XRSD 3I70A 4K6LA 3S16B 3FILB 3BYTB 4DK1A 2FJ2A 4KHZA 4DF7A 1F9PA 3NXWA 2K04A 4XDCA 2L4NA 2N9LA 2JX5A 1SNDA 1PFBA 1ENFA 2WAQB 4B0MA 4KKSA 1AEXA 3NQIA 4K8IA 3M3YB 3P4RB 5KYLA 4Z9CB 5C6AA 1TS5A 2JSVX 1FGBD 2F0OA 1UNSA 3S2DB 3T3NA 1XLNA 3I3CA 1K50A 1Y1WB 3AU7A 2WP8J 4RGNA 3SK5A 1S5FD 1EOTA 2O2LD 3SK4A 4ZYSA 5J39A 4FO2A 1PFMA 1A6XA 1XCQL 1LTAD 2QIEB 4GZYC 1SE2A 2E76C 2F0GA 1N63A 2JA8B 2M00A 5I2XA 2G9HD 3LNNA 1BDOA 2LEKA 1ESFA 4US8A 2JU6X 3NP8A 2PVGC 1TWAB 2ZW1A 1GHJA 1NI3A 4JBWA 4IUQA 2WLBA 1E2VA 1IW7D 2B2TA 1KRHA 5CC4A 4RWSC 1D4BA 1JWUD 4P6VF 5AFWA 1SYCA 2CQAA 1SAPA 1EIHA 2DN8A 3N6RA 4JE3B 3X3NA 2I2YA 2K6AA 4TSSA 4PMCA 1J7BA 5EPJA 2L11A 3TP5A 1D5XC 3SHLA 3NVYA 2H89B 1LTBD 5D3DA 5D65A 5EE1A 3P63A 1SB3C 1E2ZA 5IGBA 4GDLB 1EU4A 1N62A 3AMZA 1SF0A 2KOLA 1QG7A 3VR6A 1OXVA 3IL8A 2L5TA 1ONLA 2EXZA 3MXUA 4I7ZC 3VA5A 1PRTC 3AB5A 4QUCA 1STEA 1JICA 2HQEA 3HOYB 1EY7A 2HUGA 2B2TC 4XE0A 1TS4A 1MI2A 4NMZA 5EQ0A 5CGKA 1PFNA 4KGRA 2KEEA 4FF4A 2RKSA 1EZ8A 4C3HB 4MN3A 4B0EA 1D1KA 5D14A 5IGDA 3BZDB 3SE0A 4LK0M 1KDBA 1RF2D 1E7PB 1TR5A 2PMVA 3J7AF 2NUCA 2K22A 5EE9A 5C3WA 3P4SB 4KX6B 2K5DA 3AE6B 3EUB2 1FD7D 3U2SC 1SXTA 1JQ4A 5KNDA 4V190 5A2QL 1KH0A 3L4PA 1C77A 1PDQA 2EY6A 3AB9A 3EFXD 3SVMA 2INNE 1L6VA 3TZUA 3KK7A 3GQBA 1I4RA 1TY0A 3C8YA 3GTGB 4X3SA 1I6VC 3BK1A 2F0IA 4A3JB 2K3UA 5C3JB 2MGSA 5IGEA 4OO1H 4K5VA 1PFDA 1RD9D 2EE1A 5GXGB 4HJGE 4I65A 2BB6A 2Z1CA 1N5WA 1HQRD 4HSVA 3OOCA 3VR9B 3J81E 4BY7B 4IUNA 1Z47A 1SFOB 3HOXB 1G2TA 4OHJA 1L6UA 5C4ZA 3HS0C 1UAPA 2H4OA 2WXNA 1A3VA 1PLFA 5M5WB 4IOIE 1FRRA 3GB1A 3PO0A 1C79A 3HRDD 3VR8B 4L8JA 4DAVA 2ZW0A 3WOEA 1WTXA 4KGSA 5C5MA 3DUZA 1M4VA 3OWEB 3DEOA 1IHZA 1X32A 2PW9A 2Q5WD 3TZDA 4EQOA 2V4IB 1K8OA 2WXHA 3S1NB 5CV6A 4H2AA 2LUMA 4RHRA 2F0UA 3SR1A 1STBA 3TMEA 2AQ2B 1I4PA 2PZTA 5JAVA 2FHTA 5DEHA 5FK9C 3KWLA 1EY9A 1EWHA 2X6LA 3LWUA 1G8ZD 4OVZA 1SNMA 2KN4A 1XLQA 1ENCA 1XLPA 1RWSA 3S2HB 3ND9A 3WOFA 1UGJA 2OT2A 2IGHA 4A8XC 3NUHB 2WDVB 3MJ5A 4ZRQA 2GB1A 1D6EC 4BA2I 3I9V1 3N9YC 2B2UA 1HUNA 5HG2A 3E5SA 2ACZB 2WXQA 1CHQD 2SEBD 1EY5A 1HFGA 3NSWA 2VNUD 2L55A 1TVXA 3FPUB 2F0VA 4QB4A 4K2LA 2F0WA 1L0XB 4J6HA 3EGRA 2JE6I 2SNSA 1UWMA 2D5GA 1LT3D 1NSNS 2K01A 1H9SB 2F0HA 4DNRB 1QKZA 5JEAJ 1FFVA 2K5PA 1CZWA 3J80E 3E56A 3A54A 2PCFB 3FVQA 3R3OA 5FO8B 2JP1A 1E2WA 4OGQC 1SMYD 1PTOB 2IW3A 5CV4A 3OIPA 1R9TB 4RHSA 2A6ED 1KF6B 4PMWA 2KECA 1RCVD 3DWPA 5A2QE 4KMUC 1OXUA 3PUWA 2F4IA 1SEBD 2K1BA 1EU3A 1JWMD 4XT3B 4IUUA 2R61A 3GS2A 5LNK1 1DYQA 1TIID 3S1QB 1UEAB 1GPXA 3S15B 1LV9A 2WXFA 5ELCA 3F2UA 3B9JA 2IX0A 3G6JB 2YU9B 5E6JA 1SNOA 3OMCA 3G7LA 3NTIA 2XVSA 1G2SA 2N55A 2E6XA 3QIAA 5C3XA 1X3QA 1WTWA 2KUMA 1STHA 2M0AA 5G3LF 3PV0A 2LS01 1S5CD 5J1ZA 1MVKA 1TKGA 3FDTA 4YXDB 3Q0AA 1D2BA 2F0LA 1N61A 3TP8A 1SNQA 2F0MA 2QDBA 1BO0A 2KQ4X 4YWGG 1GUNA 1HFNA 3IAM1 1BQQT 1VDZA 3LX0A 1KLGD 1N5XA 3MEHA 2ZXOA 2EYJA 5BYRA 1PGXA 3IAS1 2OEOA 1QOFA 2BB5A 2C9OA 2B63B 2EJGC 1SSNA 1TS2A 1LABA 2NTSA 3AE8B 1YNJC 3UI3A 4TRDA 3A8JE 4DQOC 3D31A 4WJWA 5ELBA 3B2GA 4J1MA 2LKVA 2RQXA 2JZPA 2VXWA 2JWUA 2VUMB 4S3SA 4KKJA 4QMGA 1TJEA 3ZJTA 4RKBA 1CA5A 1YQ4B 1DOKA 3PO3B 1PRTB 1GOZA 2Y0SB 3VYRA 3RPFC 2RVLA 2N9KA 1PDXA 3L9AX 4PNYA 4XTCS 4KKUA 1L0VB 1HXYD 3VRBB 1ZXIA 2AWOA 3PIP3 2RDFA 4KK7A 3BWUD 1C8CA 2BA0A 1HRJA 4A90A 4WURA 1IYVA 3HUIA 3BDLA 1AWDA 3MTSA 1YJIA 3ZYYX 1JCKB 1G291 4IZ8A 4C3HG 3BVGA 4IUTA 4K14A 3NRZA 4Q2JA 1Y8NB 1G6ZA 4C56C 3S14B 1R4QB 2BS3B 1PGBA 2EJMA 3S1MB 1LTSD 2B2VA 4H7BA 5I6YA 4AYBB 1RJTA 2O5IC 1LT6D 5JEAG 1BF4A 1IBXB 1F2MA 3PIO3 4G7OC 3TSSA 3LB8C 4OO1G 2DWQA 3FPPA 4HMIA 2BE5C 1RDPD 1Y1VB 2PPBC 5M9OA 2BDNA 3T56B 1NCVA 5JVG3 2WNMA 2BBCA 4X3UA 1SJED 4JX1C 2W55A 5G5GA 1KDCA 3D4RA 2EY1A 2OF1A 3GD7A 5M5YB 4EVOA 5CBAE 2X38A 1XYIA 3OHXC 3R2IA 4RFBA 5C4JB 5G5HA 2SAKA 3E9SA 5E4WC 1XEEA 3FEWX 3AM9A 3VYTA 3OIQA 3K5MA 4TQ1A 2CW0C 4O42A 4LTUA 1TYGB 2A68D 1VDVA 2IGDA 2IX1A 1WGKA 2IDYA 2E3TA 1EYCA 4M8AA 3TBIB 3MWYW 1E6EB 2WXGA 3CKIB 3MAQA 2C5CA 1JC7A 3M7GA 5KYIA 3NVWA 1Y8PB 1HPCA 1MHXA 1V1PA 3CIRB 1VJKA 2KA7A 1UWXA 2HCIA 2KVMA 3AEGB 1J7CA 2F0QA 1GB1A 3BYYB 4A3KB 1DOMA 4K5WA 1WCMB 3TEZA 1YNNC 3QOLA 3V2TA 1F2RI 3DWQA 1WSPA 4MH8A 3NVVA 2HDMA 4C7YA 1JMLA 5FLXL 1ET6A 4B9WA 2HTME 5EE0A 1PGAA 4FP5D 3NTHA 3D4WA 4XIGS 1CK1A 4HMJA 2WXLA 5CYUA 3EVQA 3PUYA 3Q22A 1RYJA 4NAWB 3AE7B 2J53A 1EZ6A 1CM9A 4EQNA 2R93B 1SYEA 5CBEE 3J81L 1KNAA 3GTLB 1FO4A 4WWMA 5H92C 4FVMA 4ZUJA 3QJYA 1AN8A 4DA2A 2YEPF 1A15A 1KDAA 1C9FA 1I3QB 2L12A 1WXQA 1QOBA 1ESRA 5HGTA 3JAML 3P1MA 2PO4A 3GTOB 1STGA 2A69D 3H3VC 1PTOD 1C4AA 5LL6S 1EYDA 4FF1A 3K5NA 2I46A 1FR3A 3C3LA 4RH6A 3I4NB 5CV7A 1HHVA 2JEBI 4RCNA 5LL6X 1LTGD 2K5WA 2NB0A 4A6QA 5CMDA 1H9RA 4XQJA 2XNAC 1NAPA 1EWCA 5K5PA 5FKAC 1PMRA 3MXPA 3CQZB 1JROA 4ZRPA 1JB3A 1YQ3B 4A3EB 2WXKA 4JWSC 1LACA 2BDOA 4OIKA 1STAA 2W54A 2FMCA 4ARIA 5JOBA 1QJOA 1J8IA 4XQQA 1GUWA 1ZEQX 1EEID 3TUOA 1F9SA 3SFDB 2YEPB 4QIWB 4ARCA 4KN4C 4HN7A 2B2YA 5EE3A 1FXAA 4KY7A 4NKLA 1JE4A 1HQMC 3PUZA 1C78A 4M0WA 4K6DA 2ICIA 2CU3A 1OXTA 1HTPA 4A55A 2FFKB 4XXEA 3DM1A 3BVZA 1DOYA 3ONAB 2WS3B 1FEHA 3KQ4A 4F8MA 1ZKOA 3FAHA 1O7ZA 5KIXA 5E1FA 3J80L 4L1BA 1FMAD 1EY6A 1II3A 4OZAA 4CQNA 2ZXRA 4BWGB 4XYOA 2E2JB 4HAEA 2NVXB 1BUVT 1PRTD 2VZKB 3J9CA 3VR2A 5IIFA 5K36G 2J42A 2KWDA 5J22A 5DM63 2Z8LA 2N88A 2V3NA 1F2YA 1ZDXA 4HKQA 3W5VB 1B53A 3TDQA 1ZYRC 1BUIC 1XXGA 1SJHD 4EE2A 1TKWB 1W6KA 4C1NK 5JEAH 5FLXE 3P1HA 1ZP0B 1JOQA 5IODA 2NN6G 2F3VA 5EBDA 1EWYC 3HZXA 3AMUA 4CKCA 2Q8TA 3HRZC 1XO3A 3H94A 1BXTA 5C4HA 4DXGA 1Q3LA 3ZJUA 2EYFA 4HROA 4KHVA 2LHEA 2V3PA 2JYTA 2LHDA 3H0GB 1VZ8A 1NR2A 2IPKD 5JXVA 3I90A 3S1RB 4K5XA 2XWJB 3ABVB 3IFDA 1FCLA 1CQVA 1FNUA 3JAME 4WFN3 2WU5B 1L5PA 2JA7B 2EYHA 3T4AC 4R3DA 4P16A 1OXXK 5BN4A 2QCPX 1JORA 1RM6C 2L1BA 2PZUA 4YSXB 1QWYA 4CHTB 2A74C 5E4XA 4FNFA 2XWBB 1C76A 4U68A 1E9MA 4U673 1Q1EA 3DHQA 1GXDC 2D9UA 1ENAA 4YIJA 3RMHA 1A2TA 4ABNA 5H8YE 4IDIA 2DY7A 2EYPA 4IFDJ 2G1EA 4XQNA 4WIPA 3BVMA 3U4EG 4A3FB 4PMBA 4OO1I 1Q8IA 1VCIA 3FILA 1FNWA 2QILA 3QG1A 1R7SA 4YT0B 3BDOA 4NDXA 3P20A 2F0EA 3U9OA 1ZXTA 3Q24A 2Y3AA 2M9VA 3HOWB 1Q1BA 1U4RA 2F0JA 4F88A 4A3IB 1O7YA 4ZKCB 1JWBD 1SYDA 2HDLA 5C0XJ 3AEDB 2IL8A 2FMMA 4TKOB 2WP9B 3HKZB 1FCCC 3DWAA 1NYRA 1E10A 3MHBA 1G91A 1QOHA 1CZGA 1ILQA 2KMMA 3TEWA 2LY7A 3TP7A 4WH4A 2AWNA 5HURA 3IXSA 3SXHA 1QOGA 1STYA 3X3MA 2N0SB 1T5XD 1MGSA 3V3XA 2D2CC 2F3WA 3AE3B 1F9RA 1NUCA 5DNFA 5ELEA 2RSNA 2XIWA 3RZOB 3AEEB 1LLRD 4IURA 2Y5PA 2B2UC 1STNA 2B2WA 3NS1A 2K32A 4L6TB 2MJDA 2PQEA 2W3RA 4PT5A 1WTOA 1SBBB 1M8AA 2Y5CA 3NZ3A 2HCCA 2IGGA 1PZKD 5BMGA 5HFYA 1TZOA 2WQYB 4KD3A 2KCNA 1SYFA 1B9MA 5BN3A 1AZPA 1IGDA 1PTOH 3S9WA 1BR9A 2BYTA 3I8ZA 2RSOA 1SE3A 3NVZA 3I57A 5IGGA 4NAMA 3Q6SA 4FF2A 2WKCA 2JXTA 1BBXC 2R6GA 2V0GA 4LK1C 4ME5A 3C2PA 3AEFB 2GI9A 2LMCB 3AV8A 2B2WC 4G4KA 5KEEA 3CRKC 3MFYA 1NEKB 4KJOA 2RDHA 3KLSX 1FRDA 2HDEA 5HI1A 2KQ3A 1RHPA 1HTLD 1JR0D 4L23A 4N59A 4KTAA 5JJZA 3MXGA 1AW7A 1AYFA 4LMQD 3WCQA 4ZHPA 1QNUA 2RPVA 4OZBA 2VB2X 1YNTE 3HOVB 1GHKA 1GUSA 1MPEA 3MHZA 4P2CB 4Q5VA 4N6EB 2KCCA 4KD4A 2B8GA 2MJ3A 3W1SA 1ZOYB 5AUIA 1VMPA 1A2UA 3LYYA 2E2IB 3GTQB 4IFDG 1I50B 2O4XA 2K7VA 4FYDA 2H88B 2SDFA 3RZDB 4X3TA 1EY0A 4REZA 4RGOS 4C3IB 1Q10A 3VA7A 2EOTA 4A3BB 5K36H 4GDKB 1ROEA 1Y8OB 5IOCA 4ZRZA 2J52A 4A9AA 3HP3A 4F87A 1ZXHA 4US9A 4CBVA 1FNVA 3BS1A 3SR6A 3TP6A 4C7ZA 2M19A 2QSDA 5ELDA 4A3GB 5CV8A 2DYMA 1EQTA 1K8MA 5C0XG 4ILWA 1YNJD 3E0JA 2NN6H 1KTKA 1OXSC 4MM3B 2VZKD 1LTRD 1YN5A 4ZLTF 1PZJD 2V4DA 1J9OA 1IGCA 5EGTA 1KAAA 3DWMA 4WORA 3IFTA 4D2KA 2PNRC 4DGZA 4Q0FA 3W5UB 2MH7A 1I4GA 1EYAA 4C3JB 1DOIA 1O7LA 4CJ2C 2FINB 1YN3A 3NWTA 1ZUD2 4IKGA 2KEDA 3K6OA 2F0NA 1CJEA 1HA6A 3E6ZX 3H09A 3SEBA 4CJ0B 4NP5A 4EQPA 5JPMC 2NVYB 4A93B 4H44C 1D1IA 3VR3A 1T5EA 4X3KA 2FUG1 4XYQA 4IN3A 1P7FA 1SYGA 1X3PA 4HTHA 4EGVA 3K58A 2L32A 1SNPA 1WTRA 4WAFA 4KGTA 5I2YA 2N7JA 2WDRB 2W82A 2XSCA 3HG9A 4UAIA 1DXMA 2L52A 1DOLA 2I07B 2B2VC 2WV6D 1LTID 1E0BA 5EPKA 2NN6I 3AEAB 1NENB 1EIGA 4R9WA 3UI2A 1RTNA 3PUXA 1H9KA 1MD2D 1GJXA 2F0FA 1IUEA 2K5QA 4A3DB 2PMZB 2BE5D 1VMCA 4ZK9B 1H9SA 3KLRA 5KNBA 3A8IE 3VR4A 4TQ0A 4ZQ3A 2PTLA 4ZAIA 1WTVA 1K51A 2A6HC 1S5ED 3BK2A 2FE8A 4XDXA 2JEAI 1GUTA 2CJNA 2KDMA 4KJNA 1BCPC 2M56B 1SIJA 2O5JC 4UDUC 3GTKB 2D5DA 2D62A 5F2DA 5IGCA 3W3AA 1PZID 1F9QA 4DN4M 2X6GA 1JOKA 3NHHA 3T3OA 2VB3X 4CKEA 4DAYA 3MA2B 3MP9A 1FXIA 1YMHE 3MXNA 4BBSB 2CW0D 2CHBD 4L63B 1WVLA 3C46A 5TSSA 3GTJB 5EBCA 2E75C 3Q8AA 1CQFA 1WTPA 3MFGA 3DEPA 3OPOA 2DLBA 3P4PB 1KNEA 5IGFA 1V8QA 3NBHA 5KNCA 3AE4B 3D4DA 1HEZE 2BS4B 1SDFA 4ULLA 5DAUA 1XF5L 3OSOA 1O78A 1JOOA 2AX5A 2WU2B 2H1EA 4B08A 4ITKA 2XRQD 3U9SA 3RD4A 3FKIB 1C4QA 1YNND 1V97A 2K28A 2BCOA 2BS2B 3ERQA 1U9RA 4C2MB 1RODA 3Q23A 4N9PA 1KFYB 3AH7A 4NZLB 1DZ1A 3H8HA 3ITPA 2K9XA 2EYMA 2WXRA 1IW7C 3H91A 2LFIA 3C1EA 2WINB 2ENBA 4YTPB 1I6HB 1VZ6A 2PZWA 1CI3M 2M2LA 5CORA 3HVDA 2F0PA 5T8IA 3ND8A 3SDZA 3NQTA 1RTOA 1ZE3D 5EKKA 1FYCA 2Z4HA 3HOUB 2WB1B 4BA1I 2PVOD 2AUJD 2E2HB 5JVH3 1B4OA 2R3ZA 2JYOA 3AE2B 3AE9B 3Q8EA 2JQRB 3OW7A 1CHPD 3T13A 5COYA 3P75A 2F1MA 2WXPA 1KABA 5M5XB 4KI0A 4LAAA 3URYA 1FD6A 2W3SA 1TWGB 2ICEC 1ILPA 4ODGA 5C2TB 1XLOA 3P4QB 1TT2A 4JK1C 4IFDH 3ZQ4A 2EYLA 1B44D 3I4MB 4B9XA 1GUOA 1PUTA 1HZ6A 4RA8A 5CV5A 1JWAD 2B8FA 4ZOHC 4NJCA 1Q90A 1B3AA 4YSYB 2NVQB 1K53A 1A70A 3GO5A 4C80A 3IT4B 2LFNA 1PXUA 2E2DC 4H0LC 2L0CA 2AUKA 4L2YA 1Z7TA 4KY6A 1IBXA 1XCTL 3MZ5A 4WQMA 2JXMB 1W6JA 3D6WA 4R8NA 2GRIA 1TWCB 1WWTA 1R4PB 4IUPA 5C0XH 1TKYA 4BS9A 3I91A 2KAJA 1QT9A 1T3QA 1TQOA 2PLPA 5BYQA 3EROA 1ET9A 3KBXA 2CVRA 5FOBB 1GAQB 3CRLC 3N52A 3DXJC 1C4PA 5BYSA 4HEA1 2MEKA 2B2YC 1QNKA 2WXIA 1OFFA 3KBGA 3K0YA 2KJXA 3IT6B 3IAYA 1I4XA 2PW7A 1K52A 2AQ3B 4RGTA 4DFAA 3GV3A 4KV6A 5G3LD 3OMGA 4N58A 4E6IA 1B1ZA 1Q12A 5I9OA 3W2DA 1F2RC 4ZHOA 4IFDI 2MHVA 2BT6A 4C3IG 2EELA 3K5OA 4CGYB 1IKMA 1V43A 3SK6A 3QB3A 3QO2A 3ETRA 4IUVA 3EA6A 2Q8RE 2EJFC 2NVTB 3KUPA 2BW2A 2KHSA 2LJIA 2ON8A 5I9PA 1DOXA 1TS3A 2F0KA 3D3RA 3R2TA 1H9JA 3AE5B 4XWTA 3NBIA 1NVID 2A73B 4N9TA 2NBFA 5EKLA 1A3UA 1LO5D 5C0XI 3AE1B 1ZYRD 4AS1A 5CV9A 1Y69U 5IT9E 1GB4A 3J7AV 2NZ1D 2EZVA 4MT5A 2EPBA 1BCPF 2F0TA 4FXGC 5M3MB 3A7LA 2PKOA 2PYKA 2RDGA 3HOZB 3D8GA 4G57A 3KF8A 4C3JG 2K33A 2OHFA 3AECB 4M1UB 4HKZE 1IKLA 4FXKC 4RF1A 3LXFA 1DGJA 2J7ZA 3IKJA 2SNMA 2QJLA 2RBMA 4JPSA 2WIIB 1DCZA 3Q8FA 3FRPB 2WXJA 1OO9B 1EQVA 4V0BA 2R92B 4RNAA 5AUKA 4FF3A 4F7XA 5CR3A 3I72A 2K03A 4CJ1B 3M4YA 3VYUA 1QILA 1WYGA 1F2LA 3H6MA 3PZ7A 1B50A 3BIID 3DMUA 2NMQA 3M7NA 1T6BX 1S4ZA 1BNZA 1PTOF 4XT1B 1JALA 4C1NI 1U4LA 3U52E 1RFKA 1V8CA 2L1AA 2NWGA 1EY4A 1JW9D 3FC4A 3K5LA 1WRIA 4J3OD 2DNEA 1ZDVA 2DBYA 4KN7C 2EKIA 1F2ZA 3CHBD 5HHDG 1Z6HA 1QF6A 4QF4A 2J0TD 1XWEA 1MBYA 5FR3A 4KKIA 1E0ZA 4DNTB 1WTQA 4ID6A 4TQUS 1SMYC 1I7HA 1BCPB 3NTKA 4ZUIA 4YTMB 1IYUA 3A55A 4FXDA 3TEXA 3K59A 4R8IA 3V05A 2F0DA 2A6EC 1U4MA 1I4QA 1P7EA 4J8QA 2MJ8A 2GA4B 3L3OC 1JQYD 2EY5A 5IT9L 2R7ZB 4KY5A 2WXOA 5C3EB 4K2KA 4NW2A 2YYZA 1CTMA 1S5BD 2EYOA 2ID0A 1XTCD 3AEBB 2WKDA 5T1IA 2MUYA 1MI0A 1D5ZC 3A8KE 5M3FB 3B2FA 4IALA 1V1PB 5EJWA 3RUZA 3U7ZA 2RMMA 1DM0B 2F03A 3GTMB 1EEFD 1OQQA 3T51B 4OIJA 3A7AB 2B76B 2I38A 3C1FA 5D7GA 4BY1B 5LHY1 2QEJC 2XN9C 1MSHA 3MVVA 1AP0A 1HUMA 1TWFB 4OW0A 3FMCA 3VRAB 4MHEA 2WDQB 5BMHA 1VRAB 2MP1A 4XWWA 5JPNC 3GV6A 1S5DD 5A35A 2BA1A 3Q69A 3CWIA 5T1GA 1FM0D 5FO9B 3EQLC 2E74C 3O13A 4HSPA 2Z4IA 1NR4A 3BDCA 1TWHB 4CKBA 4YTNB 1C48A 1L4ZB 3VR5A 1MSGA 1PRTF 3OWFA 4RAUC 2EY2A 2AQ1B 4O1NA 1QCBD 2INPE 1N60A 4KKTA 4GLSC 2OEDA 3K7AB 1JWSD 2WACA 1VF5C 5I6WA 1DJRD 4HRSA 3QOJA 1MHHE 1QB5D 4G7HC 1SE4A 1VR9A 4DXFA 5C4XB 3TEYA 1TY2A 1TKEA 5BMIA 1YN4A 5MPOA 1CFMA 2K05A 1EFID 2G9DA 2LGIA 3PUVA 2DYOA 3PZ8A 1QE6A 1B2TA 1L4DB 3M4OB 1HZ5A 1AFPA 3TN2A 4TMAB 1FIQA 1OQRA 2RA4A 3J7YW 2WXMA 4HR7B 1U4PA 3K57A 1DD2A 4JWUC 2DNCA 1QLBB 3T53B