1SE4A

Staphylococcal enterotoxin b complexed with lactose
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
239
structure length
239
Chain Sequence
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Residues defining V beta specificity in staphylococcal enterotoxins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN B
total genus 66
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 1997-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1se4A01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1se4A02
1M4VA 4C56C 1BCPD 2SEBD 3W2DA 1RCVD 4Z9CB 1PZID 1PRTD 2Z8LA 1KLUD 1ET9A 2AQ3B 1ET6A 3DWQA 3BVGA 4RHRA 1HA5A 1CK1A 4RCOA 1FD7D 1PZJD 2XRSD 1LTAD 1SJHD 3GP7A 1HTLD 1LLRD 1B44D 1TS5A 1AN8A 1HQRD 1CHPD 2R61A 4RH6A 4RGTA 1TS2A 2QILA 2XRQD 3BZDB 1PZKD 3R2IA 4OHJA 3MC0B 1RF2D 5TSSA 1PRTF 1S5ED 1S5BD 1XTCD 2RDHA 3MFGA 4RGNA 1YN3A 1F77A 5FKAC 1I4QA 1PTOB 1PYWD 1TY0A 4NZLB 1V1PB 1DYQA 3DWAA 5ELEA 1HXYD 5I4DA 1AW7A 5FK9C 3EFXD 1EFID 5D3IB 1YN4A 1LO5D 1LTGD 1KLGD 2O2LD 5ELDA 1MD2D 1RDPD 1JR0D 1SE4A 1EWCA 1GOZA 1TY2A 1JWSD 5D3DA 1PTOF 1LTID 2NTTA 4L63B 2AQ2B 1CT1D 1D5ZC 1JWMD 1ENFA 3CHBD 1SXTA 2IPKD 1PTOH 1BXTA 1STEA 1FNWA 1BCPC 1G8ZD 1SEBD 1JCKB 1PRTB 3O13A 1B1ZA 1EU3A 2IJ0A 1D5MC 1I4GA 1LTRD 2J4XA 4RGOS 1BCPB 4RGMA 1V1PA 4RHSA 2WV6D 1I4XA 2NTSA 1FNVA 1L0XB 3BYTB 1D6EC 4BWGB 1LT3D 1I4HA 4K6LA 1D5XC 4UDUC 3BVMA 1XXGA 4TSSA 1ESFA 2TSSA 1SJED 2XN9C 1LTTD 1V1OA 1TS3A 4ZYSA 1LT6D 1LTSD 2QEJC 1QILA 1I4PA 1DJRD 1FGBD 3R2TA 2AQ1B 1TS4A 1LT4D 1CHQD 4RFBA 2ICIA 1EEID 1UUPA 1T5XD 1LT5D 3DWPA 3URYA 3TSSA 1UNSA 3OWEB 2RDGA 1JQYD 1L0YB 1EEFD 3BVZA 1RD9D 5ELFA 1I4RA 1SBBB 1KTKA 1PRTC 1PTOD 5ELCA 3R8BA 4DXFA 1BCPF 3KLSX 1S5DD 1YN5A 1EU4A 2G9HD 3EA6A 1S5CD 1CQVA 4L6TB 5ELBA 1FNUA 2CHBD 1LTBD 1JWUD 1S5FD 1SE2A 3SEBA 3V05A 1SE3A 1PTOC 2XNAC 3BYYB 4O1NA 4DXGA
chains in the Genus database with same CATH superfamily
2M00A 3H8HA 1XTDA 2ACZB 1R4MB 2NVUI 1SYCA 1UGJA 1PV4A 4W9KA 1TWHH 3W2DA 4KN4C 1C3TA 2O2VB 3CCVA 4JI6L 2TMPA 3L4PA 5HURA 3M3JA 2UUAL 4Q2JA 2LS01 4TV3A 3Q23A 2YTVA 4REZA 4A20A 5HY6A 1NMGA 3KFUA 3U9OA 2WX0A 4C80A 2EOTA 4K7WA 1FRDA 4Q0FA 1NJIC 2G45B 2KK8A 1CHPD 4FXDA 2FUHB 1UEBA 2X6GA 4RGTA 2NPTA 3MTNB 3S1RH 2IY1B 1RLFA 3TP7A 5BYQA 3CCSA 1HTQA 2FFKB 3A9KB 1J5EQ 3IHPC 1L2NA 4IUUA 1SFOB 1NSNS 4GGQA 2UWQA 5CX3A 2RDHA 1B9MA 2HQLA 2K75A 4CHTB 1XNQL 4ARCA 4BKGA 5FO9B 2F4VQ 2Z59B 4IM3A 5FKAC 2PQAB 2EE1A 3HVDA 1MHXA 3PPAA 4P16A 3MEHA 3S1NH 1RFKA 2PKOA 4CJ2C 3PF5A 2PZWA 1GHKA 4UAIA 4S0RA 4EZKA 2F0NA 1QVCA 5CC4A 2G5DA 5FO7B 4AS1A 1E5WA 1BVSA 2PVGC 5EGTA 4BS9A 1KFYB 3H1UA 1PTOF 2OF1A 3I3CA 4JK1C 1OEYJ 1H9JA 1N62A 3F2DA 4C3HB 4BBRH 4HN7A 1ZDVA 3PV0A 2KHWB 3A8IE 1PFDA 2WQYB 4LNNA 2NZOA 1IBXB 4HKZE 1LABA 3WOFA 3GZNB 2ZJPA 4GLAC 2MH7A 3BDLA 2KUMA 3VA7A 1EY6A 1OXVA 1K73C 5LMNQ 4A9AA 3G48A 3B0AA 1Q1BA 1HNXL 1LTRD 1C78A 2I5HA 2V0GA 4HEA1 4ME3A 4DV3Q 1WR1A 1YBYA 2K8CA 2KQ3A 2K32A 1MKHA 3IKJA 4ILWA 2N49A 4KIKA 2MO1A 1E1TA 1I4HA 3MVVA 5GAHC 2LY7A 4LF7Q 1NR2A 3APFA 2NBFA 2B8GA 2TSSA 3NS1A 2O4XA 1EUVB 4X3UA 4KGRA 4BOSC 4IJHA 3VFKA 1LTSD 1XPOA 3VTUA 3WAOA 1KABA 2EKIA 3VYSA 1E90A 1E2WA 3RNBC 5IYCH 3DBHB 4QIWB 3GB1A 1A0IA 4A93G 4RMFA 2KA7A 2I0QA 2RDGA 2Z6BA 2WKCA 4RWSC 4YIJA 3CCUA 1JE4A 2GB1A 2NVYB 4IQZA 1DOLA 3I7FA 3TEXA 3STBC 2YU9H 3E0EA 5IP7H 1KNEA 1BQQT 4RMAA 2H5XA 1ICFB 3T1YQ 2PEAA 1XLOA 4L5RC 1WGHA 2BVCA 4UPAA 1WZ3A 4PG3A 3AQQA 3H3VI 2KOXA 4W9DA 4O42A 1SROA 1S5FD 1SE2A 1D2BA 2AL6A 2NPTB 4GLXA 3PUZA 4O1NA 3GTJB 3K80C 2WXFA 1SNPA 2HDLA 2BBCA 4DV1L 4G7HC 2UXBQ 1CMXB 2OJWA 3KYDD 2A8VA 1VQ5A 3IFDA 2KNBA 2SEBD 2OJRA 1TKYA 1IL2A 4LF7L 1BF4A 2GBJA 1ET9A 1TWAB 1PMRA 1JQ4A 1S72A 1Q12A 4JI5L 4WJPA 1CK1A 2FCNA 2LGXA 2N1WA 3NEMA 3S1QH 3SD5A 2L12A 1ICWA 4A3PA 2IBIB 3NQTA 3HOVH 1AN8A 1QG7A 3ONAB 4OGQC 2N9LA 2NMQA 4IDIA 5D6JB 2QDLA 2BDNA 4DV5L 1PH1A 1WTHA 4B3MQ 3AU7A 4B3RQ 4PZ7A 3KDFB 1PGBA 1IL8A 4CGYB 3ZDTA 2ENBA 2QKIC 2MNAA 3S14B 2RBMA 5DPSA 3ZRFA 3AFQA 3UF8A 1IBXA 4GKJL 3RN2A 3DVGY 3KWVA 5CTRC 2QDBA 4JPSA 4EQPA 1MPEA 2F52A 4D2KA 1YJJA 1EWIA 1UWMA 4KGTA 1AW7A 5FK9C 2B2WC 4A3JH 1EFID 1UBIA 1N33L 5KEEA 4OO1H 5IIFA 4LFAL 3S15H 3QR8A 3SXHA 2VXWA 4C3HG 1MD2D 3GTOH 3SR1A 4ODGA 3NZUA 3X0WA 3K57A 2BGFA 4A3DH 1GJZA 4HEDA 3SDZA 1WGDA 3S2DH 4A3GB 1LFDA 3ONSA 3H3VC 4MACA 5E6JA 3BDCA 3W1GA 2LGSA 1MSHA 3DHQA 1WD0A 5EPKA 2PLPA 1PH2A 3R7RA 2ZCCA 5KIXA 2NCNA 1RJTA 1EU3A 4JI8L 4YWMA 1VZ8A 3PRMB 3VR3A 1L4DB 3DBRB 2M9VA 1FFVA 4GOCA 1AEXA 1VF5C 1XMOQ 3TEZA 3H9DA 4PMBA 1Q1EA 2N55A 2EDGA 3GTQB 4K3CA 1WTXA 3VXWA 3KF6B 3Q14C 3BK2A 1YIJA 4CQNA 2SOBA 2CJNA 2K1FA 3Q69A 3OOCA 1XD3B 4BY7B 4UY8C 1KRHA 4UDUC 2IY0B 3DXJC 1I3QH 2PI2E 1SSNA 4A3IH 4QIWE 1AARA 1V1OA 1YNJD 2WLBA 1TS3A 2CR5A 1SDFA 4DV6L 3S16B 5JJIA 1GVPA 1WXAA 2PPHA 4C7ZA 4IFDH 3NJTA 2WDQB 3DWPA 1STAA 3I9V1 4OVVA 3UI2A 2W55A 2CW0C 1SNCA 2WINB 3SHLA 4BY1H 1ASYA 1KDCA 3VYRA 3CPFA 4BBRB 5ELOA 4IO9A 1GAQB 1S1QB 1I4RA 1QWYA 2CHZA 4M8NA 4XX5A 2R3ZA 2EPBA 1V81A 1VZ7A 3RNEC 1EYCA 1D4BA 5IGFA 1MI0A 3BWUD 1H9MA 2DWQA 4GDLA 2M2LA 3A55A 4NJCA 2DGYA 4WJQA 2D0PA 3IBEA 1O7IA 1O7YA 1TYGB 4GS3A 4OZCA 4HLEA 2LVQA 2I2YA 1JMLA 2CHBD 2OTJA 4JBMA 1TWCB 1W6KA 1JWUD 4R1JA 2PTLA 4GKKQ 1IGDA 4S17A 3V6EB 2UU7A 1CSPA 3BYYB 4KTAA 3MEFA 4C1NK 3I57A 2XK5A 4KDLB 4YTNB 1B9RA 2KWDA 3Q8AA 2ALYB 2EJFC 1Q10A 2B63G 1HR0Q 2JYOA 1QVFA 2EYPA 2BB5A 3QHTA 4WWPA 1QKZA 1BCPD 1EFWA 2NR2A 1PZID 5FLMG 2ONQA 2Z8LA 3AV8A 1HZAA 4MSQB 2K39A 1KLUD 2JXXA 3QAQA 4JI6Q 5C3JB 4KHPL 2KN5A 4CDDC 1E8WA 3MHBA 2UU9Q 4BOZB 4APVA 2YEPF 1SJHD 2FJ2A 4HIKA 1T9HA 2ZM6Q 2N0SB 2F0VA 4FO2A 1PVOA 2X8XX 4HPMB 1TWAH 4P7IA 1XNRL 3CRKC 2MCNB 5C1ZA 1I6HH 4GLSC 5C44B 3RLFA 3N6RA 3VR5A 2N8NA 4JI4L 4QUCA 3IXSA 3P42A 1YX5B 2KDIA 2F0EA 4RCNA 2PNRC 3HIZA 1J5EL 3KK7A 4G50A 3UGBB 2ASBA 1OXUA 5T8IA 3FC4A 2MQHA 1TY0A 1PTOB 1D8LA 4BKSD 1F9JA 4BBNC 2BA0A 3U50C 1VQ8A 4P71A 3PQIA 4JGHB 1Y8OB 4DK0A 2AEHA 2AMCB 3DUZA 5L37A 2LEKA 2WX1A 4MTNA 5CV6A 3GTJH 5BN5A 1CKMA 1WXMA 4KY5A 2KXJA 2ZTCA 1EWCA 4XDCA 3KOJA 3AE5B 4G11A 3VRAB 1QUQB 2EY6A 5LHY1 3RD4A 1N8RC 2Q5WD 1U4RA 4RKBA 1TT5B 3EIVA 2F03A 1GC6A 4HPLB 1BR9A 5M3FB 3BU2A 3A4RA 1JJ2A 5J2RA 1KDBA 4PT5A 3I56A 2KC2A 1WYDA 2F0GA 2LFNA 3OHXC 2INDC 3GTMH 4ABNA 4AQ7A 2RHSB 3K5LA 4PMCA 4RF1A 5KHQA 3C2PA 3DDCB 2F0OA 4F8MA 2K04A 4JI7L 5LXIB 1QZHA 5AZHA 1XEEA 2ZXOA 3TP5A 1K8RB 2LD9A 2O6VA 4XC2A 4USAA 5H92C 1AZPA 1R4NI 1A3VA 2GRIA 4UP8A 1AYFA 1WIAA 3CCEA 1UE7A 3ZJVA 2WXHA 4XDDA 2HDEA 1FJGL 1QZEA 1HQMC 3M62B 4IFDJ 1QJOA 3UIOB 3RLNA 4ZCKA 2KDMA 4QB4A 3NE5B 1R9TB 5CV7A 1C4QA 1T5XD 3A33B 1YEZA 1LT5D 3HEJA 1E1OA 5A35A 4OIJA 4X62Q 3PSEB 2L83A 3L17A 3S16H 2WXRA 4B6WA 3A8JE 4FF4A 4JI2Q 3A8KE 4A3GH 2ZCBA 1AH9A 2KQ4X 2JA5G 2MFIA 2VZKD 1TU2B 3I70A 1RKNA 3L0OA 4LLGM 1X6OA 5DEHA 4A4IA 4URKA 2K25A 1T0YA 2M0AA 4DHJD 1BO0A 4XWWA 1FCCC 1YN5A 2E2JH 1WXVA 1EU4A 3MHZA 4GB9A 4KV2A 1E2ZA 1QZGA 1Q3LA 5M5WB 1XLQA 4ZHOA 1ONLA 2EYFA 1C4AA 4MH8A 5ELBA 4DKAC 1R4PB 3D4WA 3U4ZA 2BPSA 3P4QB 3U7DA 2X38A 5I2YA 1TBEA 4A3OA 4AQYL 4KMUC 2UYZB 5FLMH 3A74A 1WTPA 5GROA 1FM0D 4DV1Q 2K7VA 3QARA 5M3MB 1VQ9A 3MXUA 1IW7D 2QF7A 1SNOA 1TWFH 2D9UA 1ET6A 5IGDA 4GN1A 1HA5A 3G6EA 3N1YC 4JI1L 4EEWA 2YLMA 5KGUA 4YWLA 3ZYYX 3PO2H 1K83H 1STHA 3C1FA 3J80E 4BKSA 5IYDH 1EYDA 2GBKA 3GE3C 3E9IA 2PW9A 3HOWG 1Q7YC 4QJFA 1F9QA 1G2SA 4CKCA 4DV5Q 3ICEA 4BKTA 4BZAA 1CQFA 4G57A 4B3RL 1RIPA 4KIKB 2K03A 1UE1A 4FHJA 3TP6A 1X3FA 3PZ7A 1B4OA 4IFDI 3AEGB 4YSYB 2JVCA 3K0XA 4PMWA 3T13A 1T6BX 2NBWB 2R92H 4CJ1B 1J8IA 3AB5A 1B2TA 1HR0W 2W82A 3PS6A 4CDEC 2JT4B 4PYUA 5IP9H 4DV2Q 1UF0A 3FP9A 1SMYD 3OTOQ 2F0DA 5ELDA 1JOOA 5AFWA 1N33Q 4BBSG 4DR7L 3NXWA 1VDZA 4KKUA 2Z4HA 1WMHB 2D07B 3GZNI 3QOJA 4ITKA 4KSKC 4L23A 3W1YA 3VUYA 5LXHA 2IYDB 4L8JA 4IWPA 5C4HA 4DU9A 4A3MB 5GXGB 1SXTA 4WAAA 3U7ZA 3F1ZA 3K59A 1N36Q 1BBXC 2QJLA 4KX6B 2J0MA 3VYUA 3LGJA 1YNNC 1STEA 1II3A 4CKBA 4LK0M 5FR3A 5JAVA 4QQBX 2P5ZX 3KBXA 5AZGA 4II2B 1MFWA 2R93G 2HUGA 4NB3A 2WHIA 2BWES 4HTHA 1QNUA 5E4WC 1T0SC 3AN1A 3NP8A 1SRUA 1NTGA 2WV6D 2NTSA 3I8ZA 4UHVA 5FJ8G 1A6XA 1GC7A 1YNTE 2K0PA 2OXPA 2KKCA 1HZCA 2KENA 2LHEA 3APCA 1XXGA 4FF1A 1RAXA 1KOTA 5G5HA 3RN9C 1Y1VG 2SDFA 4TRDA 2E5LL 2N3SA 1LT6D 3TCAA 4L5SA 4DAPA 2MJEA 2VQEQ 4NXNQ 4YTMB 5E6PA 1I94Q 2W54A 1TS4A 1CKNB 1Q8IA 1ZKOA 5M9OA 1ZEQX 3VYTA 2DY8A 1LM8B 3KUPA 1WGYA 2AYOB 2JA6B 4LNFA 4DAYA 3BVZA 4LF5L 1L1OC 1EF1A 5J22A 4K6DA 3MFYA 2BCOA 4X3SA 2UUCL 1F9PA 4IPGA 3HOWH 2A19A 3KVFB 4WFN3 2C7MB 3RCZA 3CMMB 2JEBI 4JC0A 2KT7A 5EE3A 3KF6A 2JA5B 2BS4B 3ZUNA 2DYOA 2D5GA 3AYHB 3JAME 1VQKA 4EOYA 4EFOA 2L76A 4JG2A 4ZUJA 2K5DA 1IBMQ 4IUTA 3GTLB 3HK0A 3RZWC 1WJ6A 5C5LA 5C3XA 3V05A 1X3QA 4TKOB 3GTPB 3ULLA 4MTKA 1KQSA 2KOLA 3DVNV 1F9RA 2CU3A 4HCNB 4K7UA 5DLQE 2M1MA 2V3PA 1TTNA 3VH3B 1UBQA 2FIDA 2NBVB 2EYOA 2EYJA 2KC1A 3LX0A 4XT1B 3FKIH 3CCJA 2WWZA 4IW0A 3VQIA 2B2UA 3QQ8B 2E5LQ 2VY3A 5JEAG 4KHPQ 2M8SA 3CF6E 1WGGA 5AEKB 4DV4L 4P74A 2KDFB 5NUCA 1I50B 4A3KB 1VD2A 3CWIA 3I4MG 3HHMA 1TWFB 2XWBB 3D31A 4IUNA 4P73A 2F0FA 5IGBA 1WSPA 4NAWA 3S2HH 4KLKA 1K83B 3Q6SA 2KJRA 4R9WA 2YEPB 3MC0B 1P3QU 4IG7B 3H94A 3PGEA 4LUVA 1ML0D 2D11A 1Q1OA 2NVXH 2KCMA 2JRHA 5C3EG 1QOBA 3VRBB 3DM1A 3RZOH 2BS2B 4GNXA 4X65Q 4IUMB 3OYYA 1HXYD 2QSDA 3LDZE 2ZPNA 1OXTA 1YJ1A 2F0LA 2O2LD 1RODA 3P7JA 1RTNA 5AJ3L 2NN6I 3LB8C 2CQAA 3H0GH 1CZPA 1JALA 3QIJA 1DXMA 2N78A 2V3SA 3GS2A 1MJEA 2PQAA 4KN7C 1NR4A 2NN6G 4FP5D 3BK1A 1XLNA 4LF4Q 3C3LA 4NJ6A 1KHIA 2WXJA 1ENCA 2CH4W 2WXKA 3NVWA 1BXTA 5GMVA 1VZ6A 3NTKA 1PGXA 4M02A 1M8AA 1WTVA 4NKLA 2R93B 4MJSA 4ZRPA 1WI0A 1VQ6A 2MJDA 4C7YA 1WJJA 2DHZA 2HTME 2WP9B 3IVFA 1YNND 4LFAQ 3RUIB 4US8A 1IP9A 4KKJA 5EKKA 4RGOS 4LF9Q 2JQOA 2DAFA 2Y5PA 3B2GA 2KHJA 3DVGX 3NY5A 2EY2A 2LXJA 4XT3B 1U4PA 4H0LC 4WJOA 4LF6Q 3EFCA 3ZQ4A 1HJPA 2FNJB 5F2DA 1UEAB 3VR4A 3T3NA 2NVQB 1EIFA 2HCCA 2R92B 2KFJA 1I5FA 1A5RA 1LTLA 1DGJA 3O65B 1DJRD 1C8CA 2EELA 3E5SA 4BY1G 1F2RI 3DHHC 1NENB 1S40A 1CUKA 1PGAA 1QOAA 1EEFD 5JPNC 1JOQA 2RHQB 3U30A 4Y52H 4HJ5A 4MN3A 2E3TA 3FHWA 3A54A 2CHXA 2MBEA 1GHJA 2HIVA 1JRUA 3S15B 2B2WA 2HT1A 2O5IC 4L6TB 2N88A 3A1QB 3L08A 1PFBA 1SYEA 5EPJA 4KVGB 4ANUA 1GB1A 2JEAI 3TL5A 2K4KA 4U673 1J8CA 3SEBA 4JVZA 3TQYA 4LJOB 2K05A 4EZJA 2B2VC 2KLGA 1XQQA 2LZ6A 2BKRB 4A55A 4DUYL 4JX1C 1RFAA 3RZFA 4C56C 3W5UB 1DOIA 4YY3Q 3TBLD 2XIWA 2GBNA 1NDDA 1SNDA 1PH9A 4DK1A 1L1OB 3BVGA 4CHKA 3KDFA 3EC8A 1PFMA 4DR1L 3RNCC 1FD7D 4ARIA 1TR5A 1XMOL 2E2IB 1G6ZA 3GP7A 2NVTH 3ALBA 2DJFC 3H7PB 4ZRQA 3D6WA 2F3WA 4A3EB 2EY1A 2Z1CA 4A3JB 1V1QA 1MJDA 3ZJTA 3T3OA 2IHEA 2BH2A 4GKKL 1EZ6A 3PLUA 3T56B 2PYKA 2RA4A 3P4SB 1WTWA 2FCMA 3BZDB 1PZKD 1P1AA 1GD7A 2C7HA 2DYMA 4IWOA 3GTGH 1ZUD2 1MGSA 5TSSA 2KTRA 3U8ZA 2JA5H 2LI5A 3Q3OC 3S1RB 2R7ZG 4NZLB 1V1PB 2FHTA 3NTHA 5I4DA 4JI0Q 5IYBG 5M3FG 4GDKA 2K22A 3PIO3 2ZM6L 4P1BC 1PA6A 1SSOA 1NAPA 5JJKA 1PDQA 2KQ7A 1BUVT 2VZAA 2AUJD 4NMZA 4DHJB 2M56B 3ERQA 4FXKC 3N30A 1OFFA 1GXDC 2F3VA 2B2VA 2A68C 2MGSA 3OW2A 4ZRJA 2RR9A 4A93B 2KEEA 2OQ0A 3GO5A 5IT9E 4LFBQ 4GSWA 3NRZA 4NPNA 3TS2A 2JK8A 4E71A 1K8OA 5C0XI 1FNWA 2JP1A 2IO2B 2DNFA 2IGHA 3NWTA 1B1ZA 3UIPB 4J3OD 1IYFA 2EQSA 4KI0A 1D1KA 2Q2IA 4HR7B 3UDIA 1I4GA 3E3XA 2G9DA 2GLSA 2RQXA 2SNSA 5FOBB 2CWPA 4H13C 3Q3JA 3IG3A 3PZ8A 4KSLC 3I91A 4BY1B 1KRSA 1NNXA 3I72A 1QVGA 2Z6KA 1XMQL 4N9F4 2QGQA 3N3KB 4TSSA 4C3IG 5D65A 1WFQA 1X3PA 4AYBG 3PV1A 4MH0E 4X3TA 3FPPA 3CQZB 2VW9A 1WJNA 3G7LA 1VQ4A 1OXXK 5I9PA 1V8CA 1FGBD 1YI2A 4Y7NB 1XX8A 2E2HH 1DZ1A 3ML9A 2R92G 2ZVNA 1VQDA 2GVAA 2L1AA 3AE3B 2FXQA 3M9BA 2KYWA 4B3SQ 2X69A 2CVRA 3L16A 3ZNHB 3TSSA 3NTIA 4JBKA 1FD6A 5C3EB 3WWVA 2RMMA 2ZJRA 1OTCA 1FRRA 1VQMA 1HTPA 1P0RA 4A3BH 2LUEA 2BA1A 2ICEC 2J7ZA 3FKYA 3HKZG 3ND8A 5DM73 3TJPA 4AUQC 4X57B 3WALA 3T53B 4IOCA 3ULJA 1S3OA 1SYGA 1WXSA 5EKIA 1VS0A 5DNFA 2EIFA 1TWGH 5M5XB 4HPPA 4CYEA 2PVOD 3SK8A 3SK4A 4DUZL 3L9AX 1NYQA 4XE0A 4HJAA 5C4XG 4LFCL 3DBLI 5G3LF 2NZHA 3IL8A 4J8QA 3JAML 4DV7L 1YJWA 4EVOA 1ZP0B 2XWJB 5JPMC 3AU5A 1WX7A 2VQFQ 4H2AA 5CHFA 3T1HL 1A63A 3KF8A 3PTFC 3J7YW 2KX0A 2C9OA 2L4NA 2YTYA 1V8QA 1C4PA 1C77A 5M5YB 2YV5A 2JUOA 3A9JA 2Q2UA 4RHRA 1FVIA 4RCOA 1S3SG 3A0JA 5BMIA 2LKVA 1VJKA 4W9GA 1R7SA 3WIMA 4E74A 4XIGS 4AWJA 1C9FA 1TT2A 1VMCA 2ZTDA 5C4JB 2ZJQA 4G7ZC 2FAZA 2V4IB 2EXZA 5LMNL 1HEZE 2LUMA 3VH4B 2N7EA 3VR8B 4XZ4A 4RM8A 3D8GA 3VA5A 3MWYW 4A3EH 4LNQA 3L3OC 4TQ1A 3VDYA 2JYEA 4RGNA 5COYA 3M7GA 5IA7A 1YHQA 5M3FH 1QCBD 2W3SA 1F77A 3WA0A 1QF6A 3NVZA 4LF8L 1VQAA 5ELEA 1DYQA 1K52A 5J1ZA 4K0KQ 3U58A 3Q22A 1YN4A 1LO5D 1LTGD 4A75A 4OEMB 4HDQA 2ZT9C 1RDPD 1Y1WB 3ENEA 1Q8KA 4IOIE 3ZJUA 2Y0SG 4LFCQ 3OIQA 4LK1C 2AQ2B 4R3DA 4ZYNA 1WE6A 1D5ZC 2MP1A 3CHBD 2Z0DB 4KD4A 3KW5B 5KHOA 3RYTA 1ZE3D 3ABVB 3NZ3A 3HOVG 3H3VH 1KDAA 2HDMA 1VQCA 1F1HA 3W5VB 4JBWA 1Q0WB 5FR6A 1VQJA 1JCKB 1PRTB 3BIID 1EOTA 2IJ0A 2JE6I 2LJIA 1YNXA 1JJCB 2KCTA 1GB4A 1GUWA 4POGA 1GPXA 3AU4A 2A69D 1E7ZA 3M4YA 1E3PA 4HSVA 5C6AA 3HOXB 2D5DA 1ZPSA 2DBYA 2LJ5A 4XDXA 3CC2A 2DN8A 3BYTB 2BTEA 2VH1A 1L0VB 2WDVB 1U4AA 1D5XC 1BOSA 1ESFA 5HHDG 4LF6L 1I35A 3JSVB 5C0XJ 4OO1G 3DVNU 4C2MB 3M4QA 3GTQH 2V9HA 4PS7A 4IWQA 2CWAA 2IDYA 3D4RA 3PF4A 4C3HH 4HAEA 4LW1A 2K5QA 3EJIA 3TUOA 1KIXA 4A3LH 3LJ3A 2RDFA 4A3GG 4HCPB 3URYA 5T1IA 3OWEB 2LXCA 1OQQA 2WU5B 3K7UC 1L0YB 4KY7A 3I2ZA 1LQBA 1V5OA 2NVYH 1SE8A 1RD9D 5ELFA 4JV5Q 4A93H 2JQRB 3V60A 4X6AH 1SIFA 4W9IA 1NMFA 2XSCA 3VTWA 1OXSC 4FDBA 2WAQB 1TZOA 2MO0A 3HOZG 2WYQA 2C5LC 2WB1G 3DLLA 1EY9A 3MXNA 1S5CD 2KFKA 2I5LX 5EBDA 3J9CA 1VQ7A 4F7XA 4NQLB 1FL0A 2RPQA 3C46A 4QUFA 3A5UA 2AUKA 3AEDB 2MWSB 5EKLA 2A69C 2KEDA 4XQNA 4DXAB 4K2KA 2ON8A 2PE9A 2KJHB 4DNIA 4F87A 3J80L 2A6ED 2F0IA 3KUZA 5LL6S 5K36G 2KANA 4YCUA 2KQSA 4OZBA 1HNZL 3I4MH 2KHSA 4TVAB 2WXNA 5JZEB 3ZNGC 4K1RB 3L2PA 2OEDA 3Q8CA 2EXDA 4I6LB 3HS0C 1Z6HA 2Y3AA 1E22A 2A6HC 2QHOA 3AEBB 1EM7A 3MFGA 3KH0A 1YNJC 3TN2A 1K8GA 2RD0A 5KRUA 1FEHA 1XYIA 3QWZB 1I94L 2WXGA 3LWUA 1PYSB 4A3FB 4POFA 5TR5A 2KTFA 2DX5B 3F2UA 1VRAB 2F1MA 3Q2AC 3WAPA 3S1MH 1KLGD 2K5VA 4AOFA 4OWXB 2JA7H 3HOUB 3RNFC 1SE4A 1L1OA 1W3SA 5EJWA 3KJPA 2A68D 1JWSD 2OCEA 3RMHA 2PPBC 2NTTA 3GTKB 1I7HA 2ZVOA 3M95A 3DWGC 4ICUA 2PQEA 4HK2A 3RZDB 2PZTA 1IKMA 4YCVA 1C1YB 5CYUA 3UDXA 3A56A 1RTOA 3M7NA 2FCQA 2L0TA 2G1EA 2M0XA 1RM6C 2Z0EB 5FO8B 1HE8A 3HM6X 3CP0A 1JMCA 5DPTA 1LUZA 5AUKA 1G8ZD 5HGTA 3M4PA 3CKIB 3HGBA 4XYQA 2IO3B 5C0XG 1XF5L 1X55A 4KV6A 2E76C 4YWKA 1XLPA 4EQ5A 2MA9B 2AKWB 3U2SC 1IZ6A 4AIMA 4OONA 4R8IA 1P98A 1RWSA 1UELA 4HROA 3I90A 2JA6H 2B63H 3NELA 1HUNA 4YCWA 1L0XB 1LT3D 1E0BA 2RCFA 2DZJA 2BQQA 4AJYB 5FLXE 2INPE 2XEWA 3J7AF 3HOWB 3NZSA 2B2UC 2NUCA 1IHZA 4A3DB 2JWZA 3PT2B 3S2DB 3AMUA 1ILPA 1SR3A 3HOYB 3S2AA 5CHVC 4LMQD 3PVLA 1H9KA 2WNMA 3PIPA 2AHOB 3ECIA 3AFPA 2VH2A 1Z5SB 1H4RA 1L6UA 3NPPA 3NOBA 2D3AA 2L05A 3IT6B 1FFUA 4HMIA 1XNRQ 4QMGA 1WJ4A 3C1EA 1BMLC 5ELCA 3R8BA 2K28A 3N1ZC 4B9KA 3FILB 4ZKCB 3EGRA 1LM0A 1EQVA 1WD1A 4WJ3M 3CAMA 1STGA 1CQVA 3QG1A 1LXDA 1N61A 1T5EA 2KCNA 3HOZB 1C9OA 1PH6A 1TWCH 4C3JG 3STBD 1U4MA 1JOKA 1IGCA 1LTBD 5D14A 2IT1A 4DR5Q 4HKQA 3HKSA 5IGCA 1I50H 4IUPA 1HZ5A 2HHHQ 1G6JA 2DNEA 2CQOA 2XNAC 3NBHB 1JROA 3HUIA 1M4VA 2LVOA 4I6PA 3X3NA 3IAS1 2JSVX 4C2MH 4BBSB 1SE9A 2HCIA 3E0JA 1YMHE 1E7VA 3C19A 4WWNA 2B2YC 1VCBA 1N63A 4JCVE 2VNUD 1X1MA 4L5TA 4A3MG 2LSSA 4DAVA 2WDRB 4DR3L 2HD5B 3DQVA 2D0OA 1YIWA 2D3BA 3LYYA 5JEAH 4RH6A 5C44H 2QC8A 2ES2A 4PK1A 4B9XA 1TS2A 4QAYA 4TQ0A 1TJEA 2UXBL 4XWTA 4DUYQ 2KMAA 1A62A 4OW0A 4C00A 3AE9B 1PRTF 1JRPA 1S5BD 5IOIA 1AFPA 2JA6G 4N8FA 2OWOA 4FA6A 2KHIA 2Q8TA 4DR2L 2KVRA 2L15A 1F52A 2MEKA 2QDFA 1K53A 4FJZA 4NAWB 2F0KA 1RRBA 4LUOA 3A5ZB 1V9JA 4LNKA 2PJHA 1FYCA 2NN6H 1F2RC 4HCEA 1UWXA 4ZAIA 4KHZA 3A9JB 4DV0L 4N9TA 2J7QB 4XYCA 1JR0D 3K0YA 1A2UA 5C4XH 3CU7A 1K8AC 2OQKA 4A6QA 1LTID 3Q8BA 3NG0A 3PO3H 3S1MB 4TQUS 5EE1A 1JWBD 4GOPA 4CJ0B 4GKJQ 1J0GA 3QWNA 4ANVA 3PO2G 3EVQA 5KNCA 4A3BG 5BYSA 4AYBB 1ZOYB 1D5MC 3PIP3 1P9DU 3RFZB 4HMJA 1Z47A 2CKZB 5CV4A 1B50A 1CA5A 2JSOA 3PIOA 3Q3NC 3FRPB 4C3JH 3KYCD 4JI7Q 1D6EC 2RF4A 4AQYQ 3EECA 3BVMA 5IY0A 5L83A 3Q6BA 4A3JG 4R4TA 4LWCA 5IGGA 1P8LA 2NBUA 2JXMB 4B9WA 4ZYSA 1J7AA 1S4ZA 4W9LA 3OMCA 4DR2Q 1N5XA 4K5WA 3BINA 2K1BA 5E7NA 2INNE 3NHEB 4GU2A 4ZRKA 1F9SA 5G2NA 2JZ3B 4TMAB 1H9RA 3HOUH 2JA8G 2BYVE 4YTPB 3K5OA 2KN4A 4IUVA 3KLWA 1MVKA 1Y8RC 2JWUA 1UE6A 3AE7B 4MIUA 4HJ8A 2KJXA 3HOYH 3ZO5B 5JJZA 3PSIA 5K5PA 2RCNA 1CJEA 2YTXA 4YL8A 1KTKA 3DM3A 2KMCA 4DHZB 2O2VA 4DXFA 1EYGA 5GQOA 4BBRG 4ALPA 3JVZX 1STYA 1E8XA 4JI0L 1HZ6A 3J7A5 1CKOA 2MP2B 5GAGC 3N9YC 1BNZA 5J3BA 1L2FA 1E7UA 1ZGUB 2Q8IB 2VUMH 3ZIMA 5I2XA 1FNUA 3OMGA 2BYEA 3ZVVA 2E2DC 5FJ8H 3B2FA 4IUQA 3UE1A 3ZJYC 1FCLA 3DEPA 4IURA 4XYOA 1Y8PB 4MGIE 4OWTB 4IPDA 1SE3A 3H15A 1NYRA 4DV2L 3VVWB 1GUNA 1Y1VB 4X64L 5K36H 2QW7A 2CKHB 4PZ6A 5JOBA 4DR7Q 3NHHA 4XGAB 4OL7A 2V1CC 3BS1A 1Y1WG 1CZGA 1PRTD 1KL9A 4YHHL 3G71A 2A5UA 3DWQA 4P75A 2MBQA 5KYIA 1AP0A 1G2TA 3AE2B 1PZJD 3EUB2 1R4MI 3D32A 2LGDA 1HNZQ 1N32Q 5C44G 1TS5A 5E1FA 5BMHA 4JI2L 4MELA 5C5MA 3TP8A 4BBNF 1WYWB 1HRJA 2FMCA 1P7EA 1DOMA 3HKZB 3QCAA 1V9PA 1KM7A 2IO1B 2XRQD 2VB2X 2A6HD 3FEWX 1XT9B 2KFKB 3K9OB 4N58A 3CQZH 1I3QB 3A4SC 1EQRA 3W3AA 4XTCS 2JY6A 4A3IB 1HR0L 3NUHB 1CI3M 2MW5A 3M4OB 4GOPB 5C3WA 3IAM1 4JL9A 4W9CA 4ZDVA 2K6AA 1PXUA 4B08A 4NXML 1TZ1A 2AX5A 2EVBA 4A90A 1WXQA 5CORA 5BN4A 1WCMG 2JRIB 1PDXA 2MSED 4WQMA 3DWAA 4R4QA 4IFDG 4X66Q 2WXLA 2R7FA 1X65A 4B0EA 3RNAC 3W1SC 1CSQA 3GD7A 2L8JA 4DPGA 2GBMA 3P4RB 4MM3A 1VQPA 3MZ5A 4P6VF 4W9FA 2B29A 2NVXB 3PO3G 2WXMA 1TY2A 1STNA 4DV3L 1TKGA 2BS3B 4J6HA 2KMMA 3V61A 5IAAC 5IODA 4HJ7A 3H0GG 1ASZA 2QCZA 3WCQA 1X3GA 4DK3C 4BBSH 4GDKB 2I1KA 4DDID 5LMUQ 5CV5A 4FLHA 4LF5Q 1TWGB 1KAAA 5M5XH 1Z2MA 1W2BA 5C4XB 4M8MA 1EY5A 3CSTA 3PRPB 2KACA 4LF8Q 2PMZB 4PS3A 2DZMA 5JXVA 2GBRA 4DUZQ 1PFSA 4AJWA 3RR5A 1JICA 4QCLA 5IT9c 1NEKB 2WB1B 1ZKHA 3MC9A 2BWFA 1GJXA 1E8YA 2L5TA 2V3NA 2A6EC 1SNMA 2UUBQ 4HWIB 4PNYA 5IWAL 5C3EH 3RMKC 2VB3X 4MSMB 3MA2B 4KHVA 2H88B 4LTUA 1DONA 3S14H 5LLIA 3QB3A 2M17A 4H7BA 3OTOL 2UUAQ 3NK9A 2WAQG 2ICIA 1EEID 5E6NA 5EE9A 4EQOA 2ATWA 1O7ZA 3MTSA 4E6IA 3CRLC 3K5MA 3CC4A 3OG5A 5E3FA 1VQIA 3MP9A 2F0PA 3HFZB 5EE0A 1TQOA 3CCRA 1BUIC 4F1SA 1N36L 2K3UA 1SBBB 3TBIB 1FR3A 2K5WA 5IGEA 3J80c 3RI7C 5DM63 1N5WA 1OGWA 4UP9A 2ZNVC 3ZXRA 3KLSX 1IBLQ 3X23A 2DENB 4L2YA 4PZ8A 3I4NH 4YWGG 5HKHA 1O80A 4NNJB 5M5YH 4N6EB 1MBYA 3K81C 1MI2A 3PUVA 2ZW1A 2BOSA 2D2CC 5CHWA 1V6EA 1GUAB 1XCQL 3T9LA 3RD2A 5BMGA 1TIID 3T4AC 4GNXB 2CH4A 2HHHL 2INCC 1M94A 4K3BA 4WH4A 4HIMA 4M0WB 1HH2P 3D0FA 4BVUC 3G4SA 3EROA 4Z9CB 3S1NB 2MJ8A 1KAWA 1YQBA 2BF8B 3SFDB 3IAYA 3GV6A 4AH6A 4B3TQ 3M85A 3B08A 4DHZE 3PO0A 4HRSA 1GUTA 2DNCA 4HSPA 4V0BA 2XVSA 1SF0A 2RGFA 1GUSA 2XBBC 3KQ4A 1A15A 1AE3A 2LXAA 4W9HA 3NWSA 4P72A 3BG3A 3KF8B 3RULA 3DHGC 2PW7A 3J81c 2KVZA 1SGHA 4YSXB 4DFAA 1N60A 1EWHA 1SLJA 3R2IA 4NW2A 3VHTC 2NVTB 4J15A 4DAMA 4BA1I 5BR8L 4JPBW 1SFOH 1FPYA 4LNIA 2EZVA 1WYGA 2B8FA 4CDFC 3GTPH 2HD3A 1MHHE 1JORA 3H91A 1EWYC 3U4VA 4J1MA 4BAXA 3K5NA 1N6ZA 3RPFC 4CO7A 1QOFA 4R4IA 4DGZA 5JHBA 4DR6L 1EO6A 4W9JA 2IO0B 4GN3B 4G7OC 3SE0A 3MJ5A 3H6MA 2PO4A 4OXPA 4JWSC 3H0GB 3W1BA 1YHAA 2YVCA 1ISNA 1FXIA 1I6VC 4IN3A 3TMEA 3PMFA 2JX5A 2IX0A 1H9SA 5T1GA 4HIDA 5H8YE 1X9NA 2HTHA 2DLBA 2ZEQA 2HE7A 4S3SA 2HJ1A 2N1VA 3VR9B 1EF5A 3DHIC 3FILA 1BBWA 1ACCA 3DOWA 2J0TD 4IALA 4DV4Q 4FULA 5IO9A 1F2YA 3IRBA 1SEBD 4ZKBB 1EYAA 3O13A 4B3TL 4HIOA 1Z7TA 2KD0A 3L10B 2WB1E 3NVYA 3JSVA 4I7ZC 2I38A 3KUDB 2ZXPA 3RZOB 3JC66 2WGSA 3IFTA 4ZRZA 1WY8A 2CJOA 3W5OA 4K5VA 5IOCA 3A1QA 1G91A 2R7ZB 1K9MC 2F4VL 3MXGA 3ZTCA 3I4MB 1CM9A 1GNUA 4JWUC 5HI1A 4ZQ3A 4I7AA 1KD1C 3N52A 4FF2A 3E6ZX 2B2TA 4N8X1 1EUJA 2QEJC 4BY7G 1QILA 2KECA 2YYZA 4JYAQ 1SYDA 3SU8X 4HVBA 1WGKA 4B0MA 5IYDG 1Y14B 1A8VA 3U52E 2DZKA 2LGYA 1PLFA 1CTMA 4JOIC 3N20C 1JQYD 4GIVA 5CMDA 3MXNB 2NZ1D 1J7CA 2G3QB 2C5CA 1ILQA 2VL6A 1HHVA 4A3FH 3Q0AA 4MGYE 3ERSX 3K8AA 4UP7A 1PHJA 2Z0SA 2D10A 5AZFA 3JAMc 1UGMA 2LRWA 4NXNL 2VQEL 3RT3B 3GE8C 1I42A 1Y56A 2LMCB 3I73A 2QIEB 5IP4D 2BH8A 3U9SA 2MRPA 2CU1A 3ITPA 3ZRCA 3TREA 4DAYB 3OIPA 4DXGA 2DUDA 3D3RA 3L0WB 4KZCA 5G55A 4JI4Q 4BA2I 1L5PA 3FDTA 2NB0A 5GAEC 4WJNA 2L0CA 1FMAD 1ZXHA 4DBGA 4PS8A 3V6CB 3PUWA 1VQBA 1X56A 2DY7A 4L1BA 3CMEA 4K14A 4I6NB 1HNWL 3HOXG 2GVBA 4U68A 4K8JA 1PFNA 4MZ9A 1JC7A 3T16A 2CS4A 4M1UB 4LFBL 2I1JA 1VF7A 4NP5A 1MHWC 1V97A 1IBML 4F7ZA 1FGUA 1E9MA 3TEYA 5ELNA 1DOXA 1HQRD 5E4XA 1C4CA 1R9TH 3H6NA 4DR4L 3UQAA 3AEFB 3J81E 4WWMA 4OVUA 4LDTB 4JOIA 2QILA 2D62A 3AULA 3EN2A 4ZHPA 4DF7A 3SK5A 1IW7C 2F0JA 1QLBB 4KD3A 3HM3A 1KLVA 1YHBA 3HOYG 4OHJA 4R4CA 3GTKH 2BW2A 4EX5A 2MX2A 1RF2D 1WCMH 3PLVA 1XTCD 1L0WA 2Y5BB 3FVQA 2K8BA 4G3XB 1TVXA 4EUTA 1PYWD 2B2YA 2BE5C 3K7AB 1B3AA 2UXDL 2LXKA 3KLRA 2GOWA 3GOEA 5DPWA 1WTQA 1UZXB 1SYFA 3GDEA 4BY7H 1A70A 4G0NB 4DV6Q 1NUCA 1HFNA 1XCTL 3OLMD 2NYZD 1GOZA 5L95C 2PE6B 3PZDA 2WXPA 1IUEA 1Y8NB 4JIOU 1G51A 1ENFA 2A5HA 2EYMA 4L5QA 4MHEA 5BN3A 4DR1Q 4MGZE 2KWVB 1EY0A 3CD6A 3QK0A 1WTOA 2ID0A 1BT0A 1NY4A 2WIIB 1Y1WH 2WU2B 3N32A 4ANWA 3OW7A 1WRIA 4K7SA 1YJ9A 1NBWA 2Y0SB 1XPUA 1J6QA 2KX3A 1J9OA 1KJTA 3KLSA 5FLXc 5A2QE 3NS8A 4IM0A 2MJ3A 2VUMG 1JB7A 4RAUC 4DR4Q 1AE2A 4FHKA 3AE1B 5IN7A 1HZBA 3S17H 1J7BA 3ZNID 5IKCM 2RKSA 4ANXA 1SJED 2H1EA 1LTTD 1UH6A 1DGSA 2Q2TA 1O7LA 4K2LA 3TZDA 1I4PA 3UINB 4C3IH 1YVCA 2MUYA 2W9NA 4V190 4G4KA 2A1AA 1EY4A 2F0TA 2MQJA 1R4NB 4DA2A 1HA6A 3HRDD 5AUIA 2I07B 1G6PA 4PYZA 2UU9L 2BYFA 1YJIA 4JLCA 3NENA 3S2HB 4HXDA 1WX9A 1B8AA 4A3FG 3Q8EA 1PH8A 4RF0A 4A3BB 1WM2A 2L3ZA 1MIUA 3FMCA 3E9HA 1WR6E 1VDVA 4NAMA 2FINB 4P2CB 2J53A 4DK6C 1EZ8A 4KKSA 1S5DD 2L00B 3DBSA 4H44C 3PUXA 1E7PB 1G291 3EA6A 3NBIA 4RA8A 4ASWC 4B95A 3AB9A 4K8IA 3UDFA 2R7DA 2OEOA 4WJWA 2H4OA 1ZXIA 1OTRB 2L52A 2K33A 2MPMA 1LGRA 4EZLA 2PIAA 1XMQQ 5IP9G 5JH5C 2QA4A 3ER0A 1JB3A 4IJLA 3F2BA 1N34Q 4FYDA 4DDGD 2BYTA 2ZNVB 1MSGA 1KH0A 2N9XA 1WVLA 1SB3C 4MEMA 3NBHA 2ZXRA 4ZK9B 1T3QA 3CCQA 2JXTA 3QA8A 2PMVA 5EBCA 3KWLA 1B70B 1V2YA 2VS1A 1STBA 1GO3E 5HGQA 1NBFC 1NI2A 1WMHA 1QE6A 1YQ4B 1B53A 3L7ZC 4X64Q 1EQQA 2V1YA 4JI3L 2WDTB 1IBKQ 1S5ED 2FUG1 4HJKA 3QO2A 3GTOB 3CSFA 1PH4A 2L0FA 1E10A 3AM9A 3CW2C 1SMYC 3I4LA 3ND9A 4A3EG 2K6QA 1GM5A 2KZRA 2LGIA 2XK5B 4DWFA 1SNQA 3EQLC 2EMSA 4A3LG 3H7PA 1EY8A 1N32L 3EFXD 3I3TB 5D3IB 2REXA 2LWPA 1CZWA 4MGKE 4N9PA 1HZ9A 1RHPA 5J39A 4OWWB 2N7DA 4YT0B 2O5JC 1E24A 2L32A 4HCSA 4A3DG 1WJUA 3NUCA 3QJYA 3LNNA 1H8CA 3T1HQ 3BZCA 1DM0B 1BDOA 3T8MA 2K5HA 3B9JA 2SAKA 5CV8A 5C4JH 2VUMB 2IPKD 2KTRB 2N9PC 1KRTA 5A2QL 2QMTA 3Q3MC 3DMUA 2FE8A 4RNAA 1QOGA 1ZYRD 3DEOA 1YX6B 2ZTEA 1MG8A 2D3CA 2OTLA 1T0QC 3K9PB 4IM2A 1K51A 2RSOA 4A3CG 2IGDA 2C9WB 4FXCA 1DOYA 2C7NB 4A3KH 2KLCA 4R4OA 1A2TA 3E9SA 1Q46A 1C76A 5IE8A 1WCMB 4A76A 2IGGA 2RVLA 3Q3FA 2KVMA 1KXLA 1E8ZA 2W3RA 3R3MA 3HP3A 2MBOA 2PMZE 4WAFA 4K0KL 3TEWA 5BYRA 1J19A 1D7QA 2K50A 2JA7G 1K3BC 4KZ0A 3PUYA 2AQ1B 3SHQA 1LT4D 1CHQD 1VQFA 4QGUA 1TKEA 3JYUA 3FKIG 2R2OA 2JPHA 4C4VB 2E74C 2Z4IA 1NCVA 4KGSA 1VMPA 2Q8RE 4C3IB 3GTGB 4FJYA 4E3CA 1IYUA 2XTIA 1BKBA 5ISRA 3ZDMC 2Z6KC 3RUZA 1PTOD 2IX3A 2WXIA 1KNAA 2WXOA 1BCPF 1DOKA 4FXGC 4TKNA 3TIXA 3P1MA 1C7YA 2CCZA 5HG2A 1V5TA 1V86A 3DBLB 1JWAD 4X66L 1U5KA 4JQWC 1WRDB 5C2TB 3ZKJC 4FVMA 3W1SA 2AWOA 1B3QA 2O6VB 3QX1A 5H1SE 1VQOA 5CBEE 4O2DA 2H89B 1TGZB 5LNK1 1BBUA 1TXYA 2WFWA 4LNOA 3AEEB 2HIXA 4OZAA 1SN8A 4LUZA 1V80A 1PH7A 3S17B 5JVG3 1Q86C 2QCPX 2MP2A 2LASA 3UQBA 3SDLC 1H9SB 3VUXA 3AXCA 3PCOB 3AE6B 1IYJB 1K0RA 2I5MX 4AYBE 4KKIA 1MJCA 3WOEA 5M3MH 1HPCA 2DZIA 3A7AB 3OWFA 1Y69U 1I6HB 1WM3A 4GNXC 4X65L 3BJUA 1LTAD 1FXAA 1X3EA 4X62L 1HTLD 3BY4B 1B44D 3TMPB 2Z9HA 4GLVB 1JW9D 5AJ3Q 3DWMA 4HJGE 4JV5L 3OAWA 3V3XA 5G3LD 1PH5A 3MXPA 2R61A 3RLOA 3R66C 2EJGC 2F0MA 4DNRB 2F0WA 1YJNA 2C60A 2K6DB 2K5PA 2VQFL 4KK7A 1NI3A 2RDBC 5MPOA 2BE5D 1YN3A 2GI9A 4FJVB 2FBWB 4Y7NH 4FADA 3K58A 3OSOA 4LAAA 1I4QA 5CGKA 1B7YB 3CMAA 4HDOA 2J0KA 1AWDA 2EKEC 1K8MA 3T1YL 2FCSA 3MJWA 2FMMA 2L11A 5J18A 1HNXQ 3IFWB 3OJ3A 2EY5A 3P1HA 4FNFA 4QF4A 3UE0A 1K0SA 4LF9L 1WFYA 2M19A 1XJVA 1NE3A 3RN5A 3HG9A 5D3DA 1NVID 2KAJA 1CT1D 1GUGA 2WXQA 4M00A 1YZ6A 2F4IA 3NQIA 1JWMD 1K50A 3RZDH 2GMIC 2J52A 2KWUB 1JE5A 2ZPYA 1GUOA 4JI1Q 4A3MH 4HJ9A 4W9EA 5D94A 4IPHA 1EQTA 4MM3B 5EDSA 2BDOA 2UUCQ 3QOLA 1X32A 5CR3A 3DPDA 3U4EG 4JI5Q 3GV3A 1SMXA 2F0UA 2K5NA 5CV9A 3WDNA 1M1KC 2LMCA 2JZPA 3L54A 3A7LA 3VR2A 4OVZA 4RM9A 1R4QB 3TDQA 2J4XA 1YQ3B 4CKEA 5DAUA 3CC7A 1XWEA 2CFMA 4DR5L 3HOVB 3HRZC 4OELB 1C48A 4BWGB 1I4XA 5DPRA 2LRUA 3WAMA 4YSZB 4FBJB 1Z9FA 1ENAA 2JA7B 1M90C 1UE5A 3F2CA 4MDKE 2RSNA 4BXXH 1A3UA 1WGRA 4FN2A 2A4ZA 3DCGA 4J6IA 4X3KA 3J7ZC 1QB5D 3B6YA 4JE3B 4LJPB 2IWHA 2SNMA 4WORA 4A3IG 3ULPA 1DCZA 2K52A 4RFBA 3D6CA 5M3MG 1UUPA 2KCCA 4M8AA 3V96A 2G4SA 4YXDB 1CFMA 4QL5A 1UWVA 1UNSA 1UAPA 1WH3A 3EHVA 4RKLA 1WOCA 4A8XC 2B3GA 1EIGA 3FKIB 2PW5A 2KBNA 1ROEA 2FIFA 4IC7B 2L55A 2BKFA 2KDBA 3V2TA 5KYLA 1ZDXA 3J7AV 3DBHI 4IZ8A 4AP4C 4DQOC 1LV9A 1HUMA 4R8NA 1TIFA 4JYAL 2B2TC 3CPWA 2Y5CA 3MC8A 4II3B 4P1CC 3ZW3A 3CF5A 4DR6Q 4M0WA 4EE2A 4XQJA 3AE8B 3F8TA 3A9KA 3K6OA 1V49A 3NVVA 2K8HA 2QEXA 1VQGA 4OX9L 1E6EB 3GTLH 2K01A 4JI8Q 2B3AA 4OIKA 1FO4A 3P2BA 1Q82C 4B3ML 2JA9A 2JN4A 1U9RA 2HJ8A 1W6JA 4BFRA 1O78A 1KF6B 4DV0Q 1YOVB 1ESRA 4NJ7A 3J81j 1N34L 1E0ZA 1RCVD 1XPRA 4DK5A 3C0RB 3HKZE 4BXXG 2AWTA 4C1NI 1SYBA 3Q8FA 2LHDA 1WE7A 1Y1VH 2XRSD 2V4LA 5E6OA 3AH7A 2WKDA 5I9OA 1LLRD 2R6GA 3P20A 4EQNA 2NS5A 2IHFA 3SK6A 2E2HB 1QT9A 2J42A 3OJ4B 2Q2HA 3EFUA 2B39A 4XQQA 2NWGA 1H95A 1D3ZA 2OT2A 3HOZH 2X6LA 3P63A 2GA4B 2I46A 1MG4A 3C8YA 2R93H 2GN5A 5BO4B 2IY5B 4F8CB 4NY0A 2VRRB 1Q5WB 1A3TA 3SGIA 5LMNW 4OO1I 2RSUA 1E2VA 3I63C 2KJ6A 1OQRA 2E8GA 2VZKB 1VCIA 3TS0A 1QUQA 2JZZA 1F2MA 3PHWB 3SVMA 2XGTA 3HOUG 1QQRA 2JA8H 2E6XA 5J17A 3FPUB 5C4ZA 4WJ4A 1P7FA 1CKNA 1VQEA 2R2QA 3ZNZB 1F0ZA 4KJNA 2E75C 2JU6X 2N9EB 3H7SA 1VQNA 2F0QA 4KKTA 5JJLA 2DYBA 1VQLA 2MBHA 1EY7A 4LF4L 4KY6A 3I5JC 5GADC 1HFGA 4IPCA 5JEAJ 3VR6A 1PTOH 2LVPA 3FAHA 3SFEB 4QY7A 2D3GA 3CCMA 1RL2A 2ZZPB 3JW0X 3HZXA 3I4OA 1EL0A 5KNBA 2UXDQ 1EIYB 4MT5A 4PQXA 3UI3A 1Q90A 3W9CB 3P75A 3OPOA 2PI2A 2OOBB 4GN4B 3R7QA 2IX1A 5FLXL 2RPVA 3R3OA 2WS3B 5IT9L 5CBAE 2UXCL 3ML8A 5LL6X 1BCPB 4RGMA 4JW0A 3J80i 1WTRA 1N9WA 4RG1A 1FNVA 1GG3A 4EKUA 5D7GA 5C23A 3M3YB 4K6LA 2K14A 1X54A 3DBRI 3H09A 1YD8U 1HNWQ 3Q24A 1WI5A 1LACA 2ZW0A 4LCDE 4NQKE 4IKGA 3PO3B 5EAYA 3AI5A 3R2TA 1EIHA 1WX8A 3GTMB 4K5XA 3VUWA 1U4LA 4ZLTF 2HQEA 3N1XC 2EJMA 5EQ0A 4GMVA 1PYBA 1IYVA 2MHJA 3L13A 1JJGA 4CDCC 4DN4M 3QC8B 1OEYA 2K9XA 1SIJA 5KNDA 2C35B 3M63B 4DV7Q 4MJSB 4DNTB 3S24A 1UD7A 3IT4B 4O0AA 1PRTC 3I55A 3K7AH 2A74C 3TEHB 2BB6A 4XXEA 1SAPA 1Q81C 2PZUA 4C3JB 2G9HD 5HFYA 1V43A 2L1BA 2A73B 1RYJA 2AWNA 1VR9A 3SR6A 1KC8C 1FXTB 3I4NG 5IP7G 1ZW7A 5D2MB 1IKLA 3UDGA 3J81i 1FIQA 2WACA 2DJGC 2IW3A 1TWHB 5I6YA 3CXCA 4WIPA 1OQYA 1PTOC 2UXCQ 2F0SA 2LFIA 5JVH3 3QIAA 3BZKA 4A3KG 2L7RA 2MLBA 4YY3L 3CCLA 3HOXH 2IL8A 4K81A 3V62A 5JHAA 1F2ZA 4LJZC 4C4VA 3J81L 2AQ3B 4ULLA 5M5WH 2AL3A 2IZVB 1C79A 5LMUL 1QNKA 4TUUA 1FJGQ 3AEAB 3PRZA 2PNHA 4ZRIA 2E2IH 3LWEA 2JYTA 2OHFA 4H02A 2B63B 1C0AA 2JJQA 4WWOA 1YITA 1QOHA 1DD2A 3ZGZA 3AE4B 3ZTDA 4ICVA 3Q8DA 1TKWB 4EGVA 4ZOHC 1L7YA 3HVZA 5IWAQ 4GDLB 5I6WA 4GZYC 4NXMQ 1PQSA 2ZJDA 4DR3Q 1AZQA 1L6VA 1U0LA 3S9WA 2D2QA 5DCNA 2E2JB 3JAMi 2Y0SE 3TZUA 4NDXA 4CBVA 3ETRA 1VQHA 4US9A 4GN5A 4L63B 4YHHQ 1IPGA 3AECB 3PREA 1K3RA 4JI3Q 2M4NA 2B76B 2WP8J 4IOAA 3MHSD 2DAJA 3B1LX 2N4FA 4MNOA 2O6VD 3RNGC 1D1IA 1WZ0A 3VAWA 3WANA 1BCPC 2N7JA 1GKHA 3M4OH 4A3CH 4WURA 3ZLZA 2F3IA 3EBEA 3RNUA 1P16A 4GXBA 4KDIC 2NVQH 3AEVA 4WQOB 1EOVA 1XO3A 3ZXVA 4ID6A 2MBBB 3PO2B 2G4DB 1V1PA 4RHSA 3D4DA 4ME5A 3KYHC 2UUBL 1CA6A 2JF5A 3QJZA 3MAQA 4GOPC 2KO3A 2XN9C 5EPLA 4KJOA 2BT6A 2V4DA 1JT8A 1VLBA 2JA8B 2MHVA 2WAQE 3CIRB 2L9HA 4B3SL 3GQBA 2R7ZH 4LDTD 3VTVA 3T51B 3S1QB 1HTOA 3LXFA 4F88A 1B9NA 3P4PB 4I65A 2CHWA 2PCFB 3R93A 4Q5VA 2YU9B 4NPSA 3TRZA 2KDEB 5IYCG 2CW0D 4N59A 1IBKL 3VDZA 1IXRA 1F2LA 1WWTA 3PHXB 3NSWA 1LYLA 3KBGA 4PV1C 4WRDA 4FF3A 1PUTA 1XNQQ 1HCZA 3E56A 5G5GA 3APDA 1L4ZB 2EMTA 1OO9B 3X3MA 3I4NB 1PH3A 3G6JB 1IBLL 3KUCB 2J0JA 5BR8Q 2ASQA 2EYHA 4ACFA 3PGZA 2KWCA 1ZXTA 1K28A 3KJOA 4M01A 4JBJA 2N9KA 1ZYRC 3AMZA 1T0RC 5C0XH 2F0HA 4OX9Q 2EYLA 4ZUIA 5IYBH 1WF9A 3BDOA 3M3YH
chains in the Genus database with same CATH topology
2M00A 3H8HA 2ACZB 1SYCA 1UGJA 3W2DA 4KN4C 3L4PA 2TMPA 5HURA 4Q2JA 2LS01 3Q23A 4REZA 3U9OA 4C80A 2EOTA 1FRDA 4Q0FA 1CHPD 4FXDA 2X6GA 4RGTA 3TP7A 5BYQA 2FFKB 4IUUA 1SFOB 1NSNS 2RDHA 1B9MA 4CHTB 4ARCA 5FO9B 5FKAC 2EE1A 3HVDA 1MHXA 4P16A 3MEHA 1RFKA 2PKOA 4CJ2C 2PZWA 1GHKA 4UAIA 4AS1A 2F0NA 5CC4A 5FO7B 2PVGC 5EGTA 4BS9A 1KFYB 1PTOF 2OF1A 3I3CA 4JK1C 1H9JA 1N62A 4C3HB 4HN7A 1ZDVA 3PV0A 3A8IE 1PFDA 2WQYB 1IBXB 4HKZE 1LABA 3WOFA 2MH7A 3BDLA 2KUMA 3VA7A 1EY6A 1OXVA 4A9AA 1Q1BA 1LTRD 1C78A 2V0GA 4HEA1 2KQ3A 2K32A 3IKJA 4ILWA 3MVVA 1I4HA 2LY7A 1NR2A 2NBFA 2B8GA 2TSSA 3NS1A 2O4XA 4KGRA 4X3UA 1LTSD 1KABA 2EKIA 3VYSA 1E2WA 4QIWB 3GB1A 2KA7A 2RDGA 4RWSC 2WKCA 4YIJA 1JE4A 2GB1A 2NVYB 4IQZA 1DOLA 3TEXA 1KNEA 1BQQT 1XLOA 4O42A 1S5FD 1SE2A 1D2BA 3PUZA 4O1NA 3GTJB 2WXFA 1SNPA 2HDLA 2BBCA 4G7HC 3IFDA 2SEBD 1TKYA 1BF4A 1ET9A 1TWAB 1PMRA 1JQ4A 1Q12A 1CK1A 2L12A 1ICWA 3NQTA 1AN8A 1QG7A 3ONAB 4OGQC 2N9LA 2NMQA 4IDIA 2BDNA 3AU7A 1PGBA 1IL8A 4CGYB 2ENBA 2QKIC 3S14B 2RBMA 1IBXA 3KWVA 2QDBA 4JPSA 4EQPA 1MPEA 4D2KA 1YJJA 1UWMA 4KGTA 1AW7A 5FK9C 2B2WC 1EFID 5KEEA 4OO1H 5IIFA 3SXHA 2VXWA 4C3HG 1MD2D 3SR1A 4ODGA 3K57A 4HEDA 3SDZA 4A3GB 3H3VC 4MACA 5E6JA 3BDCA 1MSHA 3DHQA 1WD0A 5EPKA 2PLPA 5KIXA 1RJTA 1EU3A 1VZ8A 3VR3A 1L4DB 2M9VA 1FFVA 3TEZA 1AEXA 1VF5C 4PMBA 1Q1EA 2N55A 2EDGA 3GTQB 1WTXA 3BK2A 4CQNA 2SOBA 2CJNA 3Q69A 3OOCA 4BY7B 1KRHA 4UDUC 3DXJC 1SSNA 1V1OA 1YNJD 2WLBA 1TS3A 1SDFA 3S16B 4C7ZA 4IFDH 2WDQB 3DWPA 1STAA 3I9V1 3UI2A 2W55A 2CW0C 1SNCA 2WINB 3SHLA 1KDCA 3VYRA 4BBRB 1GAQB 1I4RA 1QWYA 2R3ZA 2EPBA 1VZ7A 1EYCA 1D4BA 5IGFA 1MI0A 3BWUD 1H9MA 2DWQA 2M2LA 3A55A 4NJCA 1O7YA 1TYGB 4OZCA 2I2YA 1JMLA 2CHBD 1TWCB 1W6KA 1JWUD 2PTLA 1IGDA 3BYYB 4KTAA 4C1NK 3I57A 1B9RA 2KWDA 3Q8AA 2EJFC 1Q10A 2JYOA 2EYPA 2BB5A 1QKZA 1BCPD 1PZID 2ONQA 3AV8A 2Z8LA 1KLUD 5C3JB 3MHBA 2YEPF 1SJHD 2FJ2A 2N0SB 2F0VA 4FO2A 3CRKC 4GLSC 5C44B 3RLFA 3N6RA 3VR5A 4QUCA 3IXSA 3P42A 2F0EA 4RCNA 2PNRC 3KK7A 1OXUA 5T8IA 3FC4A 1TY0A 1PTOB 2BA0A 1Y8OB 4DK0A 3DUZA 2LEKA 5CV6A 5BN5A 4KY5A 4XDCA 1EWCA 3AE5B 3VRAB 2EY6A 5LHY1 3RD4A 2Q5WD 1U4RA 4RKBA 2F03A 1BR9A 5M3FB 1KDBA 4PT5A 2F0GA 2LFNA 3OHXC 4AQ7A 4ABNA 3K5LA 4PMCA 4RF1A 3C2PA 2F0OA 4F8MA 2K04A 1XEEA 2ZXOA 3TP5A 4USAA 5H92C 1AZPA 1A3VA 2GRIA 1AYFA 3ZJVA 2WXHA 4XDDA 2HDEA 1HQMC 4IFDJ 1QJOA 2KDMA 4QB4A 3NE5B 1R9TB 5CV7A 1C4QA 1T5XD 1LT5D 3HEJA 5A35A 4OIJA 2L83A 2WXRA 3A8JE 4FF4A 3A8KE 2KQ4X 2VZKD 1TU2B 3I70A 1RKNA 4LLGM 5DEHA 2M0AA 1BO0A 4XWWA 1FCCC 1YN5A 1EU4A 3MHZA 1E2ZA 1Q3LA 5M5WB 1XLQA 4ZHOA 1ONLA 2EYFA 1C4AA 4MH8A 5ELBA 1R4PB 3D4WA 3P4QB 2X38A 5I2YA 4KMUC 1WTPA 1FM0D 2K7VA 5M3MB 3MXUA 1IW7D 2QF7A 5IGDA 1SNOA 2D9UA 1ET6A 1HA5A 5KGUA 3ZYYX 1STHA 3C1FA 3J80E 1EYDA 2PW9A 1F9QA 1G2SA 4CKCA 1CQFA 4G57A 2K03A 3TP6A 3PZ7A 1B4OA 4IFDI 3AEGB 4YSYB 4PMWA 3T13A 1T6BX 1J8IA 4CJ1B 3AB5A 1B2TA 2W82A 1SMYD 2F0DA 5ELDA 1JOOA 5AFWA 4XE0A 3NXWA 1VDZA 4KKUA 2Z4HA 4ITKA 4L23A 3QOJA 4L8JA 5C4HA 4DU9A 4A3MB 5GXGB 1SXTA 3U7ZA 4KX6B 3K59A 2QJLA 1BBXC 3VYUA 1YNNC 1STEA 1II3A 4CKBA 4LK0M 5FR3A 5JAVA 3KBXA 2HUGA 4HTHA 1QNUA 5E4WC 3AN1A 3NP8A 2PMVA 3I8ZA 2WV6D 2NTSA 4HRSA 2K0PA 1A6XA 1YNTE 2LHEA 2OXPA 1XXGA 4FF1A 5G5HA 2SDFA 4TRDA 1LT6D 2MJEA 4DAPA 4YTMB 2W54A 1TS4A 1Q8IA 5M9OA 1ZKOA 1ZEQX 3VYTA 2DY8A 3KUPA 2JA6B 4DAYA 3BVZA 5J22A 4K6DA 3MFYA 2BCOA 4X3SA 1F9PA 4WFN3 2JEBI 5EE3A 2JA5B 2BS4B 2DYOA 2D5GA 3JAME 3GTLB 4ZUJA 2K5DA 4IUTA 5C5LA 5C3XA 3V05A 1X3QA 4TKOB 3GTPB 2KOLA 1F9RA 2CU3A 2V3PA 2EYOA 2EYJA 3LX0A 4XT1B 3VQIA 2B2UA 5JEAG 5NUCA 1I50B 4A3KB 3CWIA 1TWFB 2XWBB 3D31A 4IUNA 2F0FA 5IGBA 1WSPA 1K83B 3Q6SA 2YEPB 4R9WA 3MC0B 3H94A 1ML0D 1QOBA 3VRBB 3DM1A 2BS2B 2QSDA 1HXYD 1OXTA 2F0LA 2O2LD 1RODA 3P7JA 1RTNA 2NN6I 3LB8C 2CQAA 1CZPA 1JALA 1DXMA 3GS2A 4KN7C 1NR4A 2NN6G 4FP5D 3BK1A 1XLNA 3C3LA 2WXJA 1ENCA 2WXKA 3NVWA 1BXTA 1VZ6A 3NTKA 1PGXA 1M8AA 1WTVA 4NKLA 2R93B 4ZRPA 2MJDA 4C7YA 2HTME 2WP9B 1YNND 4US8A 4KKJA 5EKKA 4RGOS 2Y5PA 3B2GA 2EY2A 4XT3B 1U4PA 4H0LC 3ZQ4A 5F2DA 1UEAB 3VR4A 3T3NA 2NVQB 2HCCA 2R92B 1DGJA 1DJRD 1C8CA 2EELA 3E5SA 1F2RI 1NENB 1PGAA 1QOAA 1EEFD 5JPNC 1JOQA 4MN3A 2E3TA 3A54A 1GHJA 3S15B 2B2WA 2O5IC 4L6TB 2N88A 1PFBA 1SYEA 5EPJA 1GB1A 2JEAI 4U673 3SEBA 2K05A 2B2VC 4A55A 4JX1C 4C56C 3W5UB 1DOIA 2XIWA 1SNDA 4DK1A 3BVGA 4ARIA 1PFMA 1FD7D 1TR5A 2E2IB 1G6ZA 3GP7A 4ZRQA 3D6WA 2F3WA 4A3EB 2EY1A 2Z1CA 4A3JB 3ZJTA 3T3OA 1EZ6A 3T56B 2PYKA 2RA4A 3P4SB 1WTWA 3BZDB 1PZKD 2DYMA 1ZUD2 1MGSA 5TSSA 3S1RB 4NZLB 1V1PB 2FHTA 3NTHA 5I4DA 2K22A 3PIO3 1SSOA 1NAPA 1PDQA 1BUVT 2AUJD 4NMZA 2M56B 3ERQA 4FXKC 1OFFA 1GXDC 2F3VA 2B2VA 2A68C 2MGSA 4A93B 2KEEA 3GO5A 5IT9E 3NRZA 1K8OA 5C0XI 1FNWA 2JP1A 2IGHA 3NWTA 1B1ZA 4J3OD 4KI0A 1D1KA 4HR7B 1I4GA 2G9DA 2RQXA 2SNSA 5FOBB 4H13C 3PZ8A 3I91A 4BY1B 3I72A 4TSSA 4C3IG 5D65A 1X3PA 4X3TA 3FPPA 3CQZB 3G7LA 1OXXK 5I9PA 1V8CA 1FGBD 4Y7NB 1XX8A 1DZ1A 2L1AA 3AE3B 2X69A 2CVRA 3TSSA 3NTIA 1FD6A 5C3EB 2RMMA 1FRRA 1HTPA 2BA1A 2ICEC 2J7ZA 3ND8A 5DM73 3T53B 1SYGA 5EKIA 5DNFA 5M5XB 2PVOD 3SK8A 3SK4A 3L9AX 1NYQA 5G3LF 3IL8A 4J8QA 3JAML 4EVOA 1ZP0B 2XWJB 5JPMC 4H2AA 3KF8A 3J7YW 2C9OA 2L4NA 1V8QA 1C4PA 1C77A 5M5YB 4RHRA 4RCOA 5BMIA 2LKVA 1VJKA 1R7SA 4XIGS 1C9FA 1TT2A 1VMCA 5C4JB 2V4IB 4G7ZC 2EXZA 1HEZE 2LUMA 3VR8B 3D8GA 3VA5A 3MWYW 4TQ1A 3L3OC 2JYEA 4RGNA 5COYA 3M7GA 2W3SA 1QCBD 1QF6A 1F77A 3NVZA 5ELEA 1DYQA 1K52A 5J1ZA 3Q22A 1YN4A 1LO5D 1LTGD 2ZT9C 1RDPD 1Y1WB 4IOIE 3ZJUA 3OIQA 4LK1C 2AQ2B 4R3DA 1D5ZC 2MP1A 3CHBD 4KD4A 1ZE3D 3ABVB 3NZ3A 1KDAA 2HDMA 3W5VB 4JBWA 1JCKB 1PRTB 3BIID 1EOTA 2IJ0A 2JE6I 2LJIA 1GB4A 1GPXA 1GUWA 2A69D 3M4YA 1ZPSA 4HSVA 5C6AA 3HOXB 2D5DA 2DBYA 4XDXA 2DN8A 3BYTB 2BTEA 1L0VB 2WDVB 1D5XC 1BOSA 1ESFA 5HHDG 5C0XJ 4OO1G 4C2MB 2IDYA 3D4RA 4HAEA 2K5QA 3EJIA 3TUOA 2RDFA 3URYA 5T1IA 3OWEB 1OQQA 2WU5B 1L0YB 4KY7A 1RD9D 5ELFA 2JQRB 2XSCA 1OXSC 2WAQB 1TZOA 1EY9A 1S5CD 3MXNA 5EBDA 3J9CA 4F7XA 3C46A 4QUFA 2AUKA 3AEDB 5EKLA 2A69C 2KEDA 4XQNA 4K2KA 2ON8A 4F87A 3J80L 2A6ED 2F0IA 5LL6S 5K36G 4OZBA 2KHSA 2WXNA 2OEDA 3Q8CA 3HS0C 1Z6HA 2Y3AA 2A6HC 3AEBB 1EM7A 3MFGA 1YNJC 3TN2A 5KRUA 1FEHA 1XYIA 2WXGA 3LWUA 4A3FB 3F2UA 1VRAB 2F1MA 1KLGD 3HOUB 5EJWA 1SE4A 2A68D 1JWSD 3RMHA 2PPBC 2NTTA 3GTKB 1I7HA 3DWGC 2PQEA 3RZDB 2PZTA 1IKMA 5CYUA 3A56A 1RTOA 3M7NA 2G1EA 1RM6C 5FO8B 5AUKA 1G8ZD 5HGTA 3CKIB 3HGBA 4XYQA 5C0XG 1XF5L 4KV6A 2E76C 1XLPA 3U2SC 4R8IA 1RWSA 4HROA 3I90A 1HUNA 1L0XB 1LT3D 1E0BA 5FLXE 2INPE 3J7AF 3HOWB 2B2UC 2NUCA 1IHZA 4A3DB 3S2DB 3AMUA 1ILPA 3HOYB 4LMQD 1H9KA 2WNMA 1L6UA 3NPPA 3IT6B 1FFUA 4HMIA 4QMGA 3C1EA 1BMLC 5ELCA 3R8BA 2K28A 3FILB 4ZKCB 3EGRA 1EQVA 1WD1A 1STGA 1CQVA 3QG1A 1N61A 1T5EA 2KCNA 3HOZB 4C3JG 1IGCA 1U4MA 1JOKA 1LTBD 5D14A 2IT1A 4HKQA 5IGCA 1HZ5A 4IUPA 2DNEA 2XNAC 1JROA 3HUIA 1M4VA 3X3NA 3IAS1 2JSVX 4BBSB 2HCIA 3E0JA 1YMHE 2B2YC 1N63A 2VNUD 4DAVA 2WDRB 3LYYA 5JEAH 4RH6A 4B9XA 1TS2A 4TQ0A 1TJEA 4XWTA 4OW0A 3AE9B 1PRTF 1JRPA 1S5BD 1AFPA 2Q8TA 2MEKA 1K53A 4NAWB 2F0KA 1FYCA 2NN6H 1F2RC 4HCEA 1UWXA 4ZAIA 4KHZA 4N9TA 1JR0D 3K0YA 1A2UA 3CU7A 4A6QA 1LTID 3Q8BA 3S1MB 4TQUS 5EE1A 1JWBD 4CJ0B 3QWNA 3EVQA 5KNCA 5BYSA 4AYBB 1ZOYB 1D5MC 3PIP3 3RFZB 4HMJA 1Z47A 1B50A 5CV4A 1CA5A 2JSOA 3FRPB 1D6EC 3BVMA 5IGGA 2JXMB 4B9WA 4ZYSA 1J7AA 1S4ZA 3OMCA 1N5XA 4K5WA 2K1BA 2INNE 1F9SA 4TMAB 1H9RA 4YTPB 3K5OA 2KN4A 4IUVA 1MVKA 2JWUA 3AE7B 4MIUA 2KJXA 5JJZA 5K5PA 1CJEA 1KTKA 4DXFA 1STYA 3N9YC 1HZ6A 1BNZA 2Q8IB 5I2XA 1FNUA 3OMGA 2E2DC 3B2FA 4IUQA 1FCLA 3DEPA 4IURA 4XYOA 1Y8PB 1SE3A 1NYRA 1GUNA 1Y1VB 5K36H 5JOBA 3NHHA 4OL7A 3BS1A 1CZGA 1PRTD 3DWQA 5KYIA 1AP0A 1G2TA 3AE2B 1PZJD 3EUB2 1TS5A 5E1FA 5BMHA 5C5MA 3TP8A 1HRJA 2FMCA 1P7EA 1DOMA 3HKZB 2XRQD 2VB2X 2A6HD 3FEWX 4N58A 1I3QB 3W3AA 4XTCS 4A3IB 3NUHB 1CI3M 3M4OB 5C3WA 3IAM1 2K6AA 1PXUA 4B08A 2AX5A 4A90A 2EVBA 1WXQA 5CORA 5BN4A 1PDXA 4WQMA 3DWAA 4IFDG 2WXLA 4B0EA 3GD7A 3P4RB 3MZ5A 4P6VF 2NVXB 2WXMA 1TY2A 1STNA 1TKGA 2BS3B 2KMMA 4J6HA 5IODA 3WCQA 4GDKB 5CV5A 1TWGB 1KAAA 5C4XB 1EY5A 2KACA 2PMZB 5JXVA 1JICA 4QCLA 1NEKB 2WB1B 1GJXA 2L5TA 2V3NA 2A6EC 1SNMA 4PNYA 2VB3X 3MA2B 4KHVA 2H88B 4LTUA 1DONA 3QB3A 4H7BA 3NK9A 2ICIA 1EEID 5EE9A 4EQOA 1O7ZA 3MTSA 4E6IA 3K5MA 3CRLC 5E3FA 3MP9A 2F0PA 5EE0A 1TQOA 1BUIC 2K3UA 1SBBB 3TBIB 1FR3A 2K5WA 5IGEA 5DM63 1N5WA 3KLSX 4L2YA 4YWGG 1O80A 4N6EB 1MBYA 1MI2A 3PUVA 2ZW1A 2BOSA 2D2CC 1XCQL 5BMGA 1TIID 3T4AC 4WH4A 3EROA 4Z9CB 3S1NB 2MJ8A 3SFDB 3IAYA 3GV6A 3M85A 3PO0A 1GUTA 2DNCA 4HSPA 4V0BA 2XVSA 1SF0A 3KQ4A 1GUSA 1A15A 3NWSA 3BG3A 2PW7A 4YSXB 4DFAA 1N60A 1EWHA 3R2IA 4NW2A 2NVTB 4BA1I 2EZVA 1WYGA 2B8FA 1MHHE 1JORA 3H91A 1EWYC 4J1MA 3K5NA 3RPFC 1QOFA 4DGZA 4G7OC 3SE0A 3MJ5A 3H6MA 2PO4A 4JWSC 3H0GB 1FXIA 1I6VC 4IN3A 3TMEA 3PMFA 2JX5A 2IX0A 1H9SA 5T1GA 5H8YE 2DLBA 3VR9B 4S3SA 3FILA 1ACCA 2J0TD 4IALA 1F2YA 1SEBD 4ZKBB 1EYAA 3O13A 1Z7TA 3NVYA 4I7ZC 2I38A 2ZXPA 3RZOB 3IFTA 4ZRZA 2CJOA 4K5VA 5IOCA 1G91A 2R7ZB 3MXGA 3I4MB 1CM9A 4JWUC 5HI1A 4ZQ3A 3N52A 4FF2A 3E6ZX 2B2TA 2QEJC 1QILA 2KECA 2YYZA 1SYDA 1WGKA 4B0MA 3U52E 1PLFA 1CTMA 1JQYD 5CMDA 2NZ1D 1J7CA 2C5CA 1ILQA 1HHVA 3Q0AA 1Y56A 2LMCB 3I73A 2QIEB 3U9SA 3ITPA 3OIPA 4DXGA 3D3RA 4BA2I 1L5PA 3FDTA 2NB0A 2L0CA 1FMAD 1ZXHA 3PUWA 2DY7A 4L1BA 4K14A 4U68A 4K8JA 1PFNA 3T16A 1JC7A 4M1UB 1VF7A 4NP5A 1V97A 1E9MA 3TEYA 1DOXA 1HQRD 5E4XA 1C4CA 3AEFB 3J81E 4WWMA 2QILA 2D62A 4ZHPA 4DF7A 3SK5A 1IW7C 2F0JA 1QLBB 4KD3A 4OHJA 2BW2A 1RF2D 1XTCD 3FVQA 1TVXA 1PYWD 2B2YA 2BE5C 3K7AB 1B3AA 3KLRA 1WTQA 1SYFA 1A70A 1XCTL 1NUCA 1HFNA 2NYZD 1GOZA 2WXPA 1IUEA 1Y8NB 1ENFA 2A5HA 2EYMA 5BN3A 4MHEA 1EY0A 1WTOA 2ID0A 2WIIB 2WU2B 3OW7A 1WRIA 2Y0SB 1J9OA 3KLSA 5A2QE 2MJ3A 4RAUC 3AE1B 1J7BA 2RKSA 1SJED 2H1EA 1LTTD 1O7LA 4K2LA 3TZDA 1I4PA 2MUYA 4V190 4G4KA 1EY4A 2F0TA 4DA2A 1HA6A 3HRDD 5AUIA 2I07B 1YJIA 3S2HB 3Q8EA 4RF0A 4A3BB 3FMCA 1VDVA 4NAMA 2FINB 4P2CB 2J53A 1EZ8A 1S5DD 4KKSA 4H44C 3PUXA 1E7PB 1G291 3EA6A 3NBIA 4RA8A 3AB9A 4K8IA 2OEOA 4WJWA 2H4OA 1ZXIA 2L52A 2K33A 2MPMA 2PIAA 1JB3A 4FYDA 2BYTA 1MSGA 1KH0A 1WVLA 1SB3C 3NBHA 2ZXRA 4ZK9B 1T3QA 2JXTA 5EBCA 3KWLA 1STBA 1YQ4B 1QE6A 1B53A 3L7ZC 1S5ED 2FUG1 3QO2A 3GTOB 1E10A 3AM9A 3I4LA 1SMYC 3ND9A 2LGIA 1SNQA 3EQLC 1EY8A 3EFXD 5D3IB 1CZWA 4N9PA 1RHPA 5J39A 4YT0B 2O5JC 2L32A 4HCSA 3NUCA 3QJYA 3LNNA 1DM0B 1BDOA 3B9JA 2SAKA 5CV8A 2VUMB 2IPKD 5A2QL 2QMTA 3DMUA 2FE8A 4RNAA 1QOGA 1ZYRD 3DEOA 1K51A 2RSOA 2IGDA 4FXCA 1DOYA 1A2TA 3E9SA 1C76A 1WCMB 2IGGA 2RVLA 2KVMA 2W3RA 3HP3A 4WAFA 3TEWA 5BYRA 3PUYA 2AQ1B 1LT4D 1CHQD 1TKEA 2E74C 2Z4IA 1NCVA 4KGSA 1VMPA 2Q8RE 4C3IB 3GTGB 1IYUA 5ISRA 3RUZA 1PTOD 2IX3A 2WXIA 1KNAA 2WXOA 1BCPF 1DOKA 4FXGC 3P1MA 5HG2A 1JWAD 5C2TB 4FVMA 3W1SA 2AWOA 5CBEE 2H89B 5LNK1 4OZAA 3AEEB 3S17B 5JVG3 2QCPX 1H9SB 3AE6B 4KKIA 3WOEA 1HPCA 3A7AB 3OWFA 1Y69U 1I6HB 1LTAD 1FXAA 1HTLD 1B44D 1JW9D 3DWMA 4HJGE 3V3XA 5G3LD 3MXPA 2R61A 2EJGC 2F0MA 4DNRB 2F0WA 2K5PA 4KK7A 1NI3A 5MPOA 2BE5D 1YN3A 2GI9A 2FBWB 3K58A 3OSOA 4LAAA 1I4QA 5CGKA 1AWDA 1K8MA 2FMMA 2L11A 2EY5A 3P1HA 4FNFA 4QF4A 2M19A 3HG9A 5D3DA 1NVID 2KAJA 1CT1D 1GUGA 2WXQA 2J52A 2F4IA 3NQIA 1JWMD 1K50A 1GUOA 1EQTA 4MM3B 2BDOA 3QOLA 1X32A 5CR3A 3U4EG 3GV3A 3WDNA 2F0UA 5CV9A 2LMCA 2JZPA 3A7LA 3VR2A 4OVZA 1R4QB 3TDQA 2J4XA 1YQ3B 4CKEA 5DAUA 1XWEA 3HOVB 3HRZC 1C48A 4BWGB 1I4XA 4YSZB 1ENAA 2JA7B 2RSNA 1A3UA 4X3KA 1QB5D 4JE3B 2IWHA 2SNMA 4WORA 1DCZA 4RFBA 3D6CA 1UUPA 2KCCA 4M8AA 3V96A 4YXDB 1CFMA 1UNSA 1UAPA 4RKLA 4A8XC 1EIGA 3FKIB 2PW5A 1ROEA 2L55A 3V2TA 5KYLA 1ZDXA 3J7AV 4IZ8A 4DQOC 1LV9A 1HUMA 4R8NA 2B2TC 2Y5CA 4M0WA 4EE2A 4XQJA 3AE8B 3K6OA 3NVVA 1E6EB 2K01A 4OIKA 1FO4A 1U9RA 1W6JA 1O78A 1KF6B 1ESRA 1E0ZA 1RCVD 4C1NI 1SYBA 3Q8FA 2LHDA 2XRSD 3AH7A 2WKDA 5I9OA 1LLRD 2R6GA 3P20A 4EQNA 3SK6A 2E2HB 1QT9A 2J42A 2B39A 4XQQA 2NWGA 2OT2A 2X6LA 3P63A 2GA4B 2I46A 3C8YA 1A3TA 4OO1I 1E2VA 2VZKB 1OQRA 1VCIA 1F2MA 3SVMA 1QQRA 2E6XA 3FPUB 5C4ZA 1P7FA 1F0ZA 4KJNA 2E75C 2JU6X 2F0QA 4KKTA 1EY7A 4KY6A 1HFGA 5JEAJ 3VR6A 1PTOH 3FAHA 3SFEB 3HZXA 1EL0A 5KNBA 4MT5A 4PQXA 3UI3A 1Q90A 3W9CB 3P75A 3OPOA 2IX1A 5FLXL 2RPVA 3R3OA 2WS3B 5IT9L 5CBAE 5LL6X 1BCPB 4RGMA 1WTRA 1FNVA 5D7GA 3M3YB 4K6LA 3H09A 3Q24A 1LACA 2ZW0A 4IKGA 3PO3B 3R2TA 1EIHA 3GTMB 4K5XA 4ZLTF 1U4LA 2HQEA 2EJMA 5EQ0A 1IYVA 4DN4M 2K9XA 1SIJA 5KNDA 4DNTB 3IT4B 1PRTC 2A74C 2BB6A 4XXEA 1SAPA 2PZUA 4C3JB 2G9HD 5HFYA 1V43A 2L1BA 2A73B 1RYJA 2AWNA 1VR9A 3SR6A 1IKLA 1FIQA 2WACA 2IW3A 1TWHB 5I6YA 4WIPA 1PTOC 2F0SA 2LFIA 5JVH3 3QIAA 4YTNB 2IL8A 1F2ZA 4LJZC 3J81L 2AQ3B 4ULLA 1C79A 1QNKA 3AEAB 3LWEA 2JYTA 2OHFA 2B63B 1QOHA 1DD2A 3ZGZA 3AE4B 1TKWB 4EGVA 4ZOHC 3HVZA 4GDLB 5I6WA 4GZYC 1AZQA 1L6VA 3S9WA 2E2JB 3TZUA 4CBVA 4NDXA 3ETRA 4US9A