2N7EA

Solution structure of the ubl domain of yeast ddi1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
HIEGRHMDLTISNELTGEIYGPIEVSEDMALTDLIALLQADCGFDKTKHDLYYNMDILDSNRTQSLKELGLKTDDLLLIRGKISNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA damage-inducible protein 1
publication title Structural studies of the yeast DNA damage-inducible protein Ddi1 reveal domain architecture of this eukaryotic protein family.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
total genus 18
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2015-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2n7eA00
2K8CA 2KX3A 1YQBA 5L95C 3H7SA 1XD3B 3PGEA 2JZZA 2MBEA 2IY1B 4HWIB 1R4MI 1V9JA 2IO3B 1UD7A 3K9OB 4K1RB 4XZ4A 3ZTCA 4EUTA 2RPQA 3A9KA 2DZIA 2KOXA 3ZKJC 2DAJA 2JUOA 1J8CA 2KNBA 2MX2A 1F9JA 1UH6A 1WXAA 1U4AA 1YX6B 2N7EA 2C60A 2WX0A 2C5LC 3ML9A 1WJ6A 4HCNB 3QK0A 1J19A 4KV2A 3JVZX 3AU5A 4MJSB 2MQJA 4F7ZA 4B95A 3UIOB 4GGQA 1S1QB 2N9PC 1UBQA 2BYFA 3DQVA 4AJWA 2O6VD 4W9LA 3M63B 3AU4A 2N1WA 1FXTB 1YX5B 3IVFA 5J17A 4I6PA 2WDTB 1YJ1A 4LJOB 4PS8A 1WXVA 3OLMD 3VTWA 2UYZB 4FADA 2IY0B 2PE6B 2FCQA 4W9GA 3PS6A 2LASA 3TJPA 1WZ3A 1RAXA 2FAZA 1UGMA 2C9WB 2LXAA 4WJQA 4DHZB 2KTRA 2D10A 2JT4B 4W9HA 1EF5A 1SIFA 3JW0X 3W1SA 3CSFA 3L0WB 3H6NA 2L8JA 1V81A 2V1YA 2MLBA 2D07B 5LLIA 2CS4A 2M17A 3KUCB 3B1LX 3CSTA 3NHEB 4HPLB 4WJNA 2MA9B 3ZUNA 4FBJB 4KVGB 3VUWA 4GOCA 1WGGA 4W9IA 1QZEA 5FR6A 2W9NA 2XBBC 4WWPA 1E90A 3I3TB 3H7PB 2FCNA 2ZEQA 2LD9A 3KYCD 3ZNID 4RMAA 4HLEA 2L76A 3VVWB 2ZPNA 5DPRA 4KZ0A 4MH0E 3WA0A 4AP4C 1WE6A 3ZIMA 2DZJA 2KC1A 5G2NA 1WZ0A 2BKFA 2DYOA 2DZMA 2ZVOA 2MSED 3HM3A 3B0AA 2D11A 2WX1A 4MSQB 2LGXA 1IPGA 2G45B 2KLGA 4WWOA 3L16A 1M94A 2KLCA 2OOBB 1TBEA 3DBSA 2G4SA 2WWZA 3ZTDA 3KUDB 1I42A 5CTRC 2KD0A 2KXJA 1WIAA 3R3MA 3ENEA 2J0JA 1SE9A 3L54A 1WX8A 4BOZB 1WR6E 3M95A 2V4LA 2XEWA 2KDBA 2REXA 3EECA 2G3QB 4W9DA 2R2OA 4JQWC 2KO3A 1PQSA 4E71A 1J0GA 1TGZB 1WMHB 2JWZA 3QIJA 2G4DB 3A1QB 3UF8A 5IA7A 3QC8B 3ECIA 1VD2A 3HHMA 1WJ4A 4KIKA 1C1YB 2JPHA 2YLMA 4EKUA 2B3AA 2NR2A 4HJKA 3UGBB 2BYEA 3CMMB 3PPAA 3SDLC 1WM2A 1P0RA 1WXSA 3NOBA 3VUYA 5JH5C 1L7YA 2FCMA 2KJHB 2XK5A 4BVUC 1V86A 4NQKE 4IW0A 2IO1B 3V6EB 5HKHA 3EFUA 5D94A 4DHJD 2J0KA 4BKTA 1KJTA 2V3SA 4MDKE 1A5RA 2KN5A 4E3CA 4M8MA 3PRPB 3QCAA 1V5TA 2DYBA 2LGDA 1E8ZA 2N9XA 5DPWA 4FULA 3KUZA 5JHAA 1Q1OA 2VRRB 2JVCA 2CKHB 2GOWA 3RCZA 5GMVA 2BWES 4HPMB 4ZRIA 1LQBA 3PV1A 2KJRA 2DENB 1WGRA 2HE7A 2M8SA 3PRMB 5BO4B 4WQOB 1UELA 3GOEA 1EO6A 4IM2A 5LXIB 1SGHA 2EKEC 4IWPA 1V6EA 2MP2A 2NPTB 2KQ7A 4AJYB 2JRIB 2NCNA 2FIDA 2L0TA 3VTVA 2LUEA 3V61A 1Q0WB 4GDKB 2JF5A 5J18A 3KVFB 5D6JB 2LRWA 3R7RA 3WAPA 1HE8A 2K8BA 2LZ6A 3D32A 5E6NA 4MGKE 3Q3JA 4DBGA 5AZHA 3GZNI 3A9JB 4RM9A 4IG7B 2N7DA 4W9KA 1OEYA 1XQQA 3NS8A 1CMXB 4G0NB 4KDIC 4WWNA 2IBIB 2KFKB 4II2B 3T8MA 4CYEA 4TQ1A 3O65B 4GDLA 4J6IA 5EDSA 3ZLZA 4ZRKA 1E5WA 3AI5A 2KJ6A 2R2QA 3UQBA 2HTHA 2JRHA 4OVUA 1NI2A 2BKRB 2RSUA 4WAAA 3V60A 1YIWA 1WGHA 3PTFC 3PLVA 1EUVB 1Y8RC 3WAMA 5JHBA 4HDQA 1LXDA 3DVGY 2DX5B 1K8RB 1WJUA 2J7QB 3DBHI 4ICVA 3U8ZA 5DPTA 2ZCBA 4FJVB 2K8HA 1RRBA 5E6PA 3APDA 2KWUB 3DOWA 2NBVB 3UQAA 4A3OA 1D3ZA 1Z5SB 2KC2A 1JRUA 2KDEB 1T0YA 2MRPA 3V62A 4AUQC 4NPNA 3H7PA 1WI0A 4EZJA 4TUUA 4GB9A 3A9KB 3KH0A 2LVOA 4DHJB 3ZNZB 4JGHB 3PVLA 4PYUA 2AL6A 2DZKA 4BBNF 1Q5WB 3M62B 3OJ4B 3RULA 2KDFB 5DPSA 1NBFC 1OEYJ 4NJ6A 4DDID 4URKA 5CHWA 3ZRCA 4JIOU 2KANA 3LDZE 3DBLI 3QJZA 3BY4B 5CHFA 3M3JA 2L05A 3VUXA 2O2VA 2RGFA 1XT9B 2KDIA 2LVPA 1P9DU 4ANVA 1WGYA 4F8CB 3SD5A 4YL8A 2KZRA 2K6DB 4NAWA 1OGWA 4K7SA 1LM8B 1S3SG 2KTFA 2ZPYA 4LDTD 4W9CA 3ONSA 3PLUA 3S2AA 3ZO5B 4DHZE 1EF1A 2PJHA 4DXAB 4FJYA 2KMCA 2C7MB 1VCBA 2GBMA 4I6LB 5L83A 2MBOA 3L17A 2C7HA 2KTRB 2K6QA 2QHOA 4MM3A 3UIPB 1WXMA 1RLFA 1RFAA 4DWFA 2PE9A 3ALBA 2ASQA 4X57B 1L2NA 3MHSD 4ASWC 3PHWB 2RR9A 1GC7A 5LXHA 3NY5A 3QWZB 5JZEB 3R7QA 4BKSA 3NZSA 2KWCA 3JSVA 4G3XB 3ZW3A 4FLHA 3W1SC 3JYUA 4BOSC 2BPSA 3IHPC 3DBRI 3QA8A 5D7GA 2KQSA 1ZW7A 4FHKA 4BBNC 2ZCCA 3U30A 2LGYA 1ZKHA 2CHXA 2O6VA 3H1UA 4TQ0A 3TL5A 3DVNU 3K9PB 1E8WA 4AWJA 2N1VA 1WH3A 4W9EA 4MEMA 4ICUA 3ZVVA 3W1YA 5CHVC 1NDDA 2KWVB 1GUAB 4ZDVA 3WANA 5AZGA 4W9FA 3APCA 1V80A 3OAWA 1WR1A 1MG8A 3LJ3A 4MSMB 4W9JA 1GG3A 4NY0A 5CX3A 4GN1A 3VQIA 2K25A 4BFRA 2NBUA 2EMTA 3WALA 2KFJA 2KHWB 3Q3FA 4K7WA 3VTUA 3PZDA 2AWTA 4WJPA 1E8XA 4KIKB 5D2MB 1UBIA 3ZDMC 1H8CA 2MW5A 1WRDB 1P1AA 2IYDB 2JY6A 2BGFA 3N3KB 5IAAC 2UWQA 2BYVE 2KX0A 3CF6E 2ZNVB 2D2QA 2XK5B 4I6NB 2NS5A 4E74A 1V49A 5J2RA 3V6CB 2CHZA 2K39A 2Z0EB 2HJ8A 2CR5A 2DHZA 1WE7A 4DK5A 2ZNVC 3RD2A 2PEAA 2M1MA 4M0WB 4MJSA 3SU8X 4FN2A 4GIVA 1E7VA 1WGDA 3RUIB 1WX9A 4LDTB 4ANWA 3QHTA 2IO2B 3X0WA 3A4RA 3QX1A 2NVUI 3L13A 3VXWA 2N9EB 4LCDE 4IWOA 1KLVA 2I1JA 2L00B 4RM8A 4N9F4 2MP2B 2IO0B 3N30A 1TZ1A 4B9KA 5E6OA 2AEHA 4K7UA 2KK8A 1P3QU 3VDZA 2Z59B 3DVGX 1GJZA 3N32A 4A3PA 1E7UA 3HK0A 2A5UA 3WIMA 3P2BA 5DCNA 4EZKA 2J0MA 2RD0A 2CU1A 1GC6A 4OVVA 2NBWB 3RZFA 3H9DA 4K81A 2HD5B 4A20A 4BKSD 1R4NI 3TMPB 2M4NA 3R66C 1ISNA 1TTNA 3RYTA 2JZ3B 3IFWB 5G55A 2BF8B 2C7NB 3EC8A 2YVCA 1I35A 2GBJA 4GDLB 1WJNA 2K1FA 3UINB 2A4ZA 2GBRA 4MGIE 3EHVA 4KZCA 2I1KA 2LRUA 4MGYE 1Z2MA 2MCNB 4EFOA 1WX7A 4G11A 1IYFA 1UZXB 4GMVA 4IWQA 4ZYNA 1LFDA 2AL3A 2ZVNA 3MTNB 4DDGD 3PSEB 2FUHB 3IBEA 4IUMB 3PREA 3SHQA 4II3B 4HVBA 2L3ZA 1WF9A 3DCGA 4IM0A 3ZDTA 1C3TA 3ML8A 3PT2B 5C1ZA 1WMHA 4GSWA 4GXBA 4MGZE 4CHKA 3BINA 4IC7B 3A1QA 2MBHA 1KM7A 3TBLD 2WYQA 3OJ3A 1IP9A 3PRZA 2EMSA 3VHTC 2PPHA 5TR5A 1OTRB 3L08A 3VFKA 3C0RB 3DPDA 1P98A 3IG3A 4LJPB 1E8YA 1WY8A 1BT0A 2ZZPB 4XC2A 1GNUA 1KOTA 3L10B 2CHWA 4BKGA 4EOYA 2Y5BB 3PHXB 4G50A 1OQYA 3ZNHB 2GBKA 4FHJA 4KSLC 2O2VB 3VH4B 1G6JA 4EEWA 2GBNA 2FCSA 3DDCB 2KMAA 3QQ8B 2ZJDA 4WJOA 3RZWC 2FIFA 1V5OA 4NAWB 4TKNA 2LWPA 4PS3A 2GMIC 3NZUA 4F1SA 4B6WA 2L0FA 3WAOA 3QARA 3T9LA 3VH3B 4NNJB 2D3GA 2NPTA 1WM3A 4KSKC 3AXCA 5AZFA 5KHOA 3ZRFA 4PYZA 3HM6X 2KVRA 2M0XA 2Z0DB 4GDKA 4P7IA 1WYWB 4XX5A 2DYMA 4TV3A 3JSVB 3U7DA 3VAWA 4HCPB 1AARA 4HDOA 4FA6A 3MJWA 4JL9A 3A33B 4NQLB 2LI5A 2LXCA 4MELA 2AYOB 2LVQA 3A9JA 3TIXA 4HXDA 2O6VB 3KW5B 3TCAA 4IM3A 2KFKA 1YD8U 3A4SC 5KHQA 4ZRJA 2IZVB 3QAQA 5C23A 4CO7A 2KKCA 3ZNGC 3APFA 4NJ7A 3AULA 3RT3B 4M8NA 2MBBB 2JXXA 3B08A 1WFYA 1X1MA 4AOFA 2BWFA 3HIZA 4FJZA 1V2YA 2DAFA 2FNJB 3KYDD 2MWSB 4ANUA 4JLCA 4ANXA 1ZGUB 4PS7A 4GU2A 3DVNV 2N4FA 2LJ5A 1H4RA 4HK2A 2L7RA 4EZLA 3X23A 5AEKB 2OJRA 4KDLB 2MBQA
chains in the Genus database with same CATH superfamily
1SSNA 2K8CA 1FMAD 3PGEA 5AUIA 4ARCA 4HWIB 4NAMA 4EUTA 2RPQA 1VZ6A 1SXTA 2G1EA 2DAJA 5D3DA 1RYJA 4XDCA 1YX6B 1QOGA 1E6EB 2C5LC 4HCNB 1J19A 1I4GA 1I7HA 2J52A 3UIOB 1JROA 3MC0B 1M4VA 2WDTB 4PS8A 1WXVA 3OLMD 3VTWA 2UYZB 2LASA 2LXAA 1TS2A 1EF5A 3JW0X 3CSFA 4WURA 2V1YA 2GI9A 1NENB 2IPKD 2RPVA 3B1LX 3CSTA 4WJNA 2MA9B 4KVGB 4JPSA 1WGGA 4W9IA 4ZHPA 1QZEA 5FR6A 1ZPSA 3VVWB 5DPRA 4MH0E 3ZIMA 2DYOA 2ZVOA 3RI7C 2D11A 2WX1A 1AN8A 3MHZA 2G45B 2WWZA 3ZXVA 3BIID 1WIAA 3ENEA 1T3QA 1NYRA 3M95A 1R4NB 1C9FA 2KO3A 3RNEC 4E71A 1F2RC 1WJ4A 1C1YB 2B3AA 2NR2A 2LFIA 3UGBB 1KH0A 4C7YA 2INNE 1L7YA 2BB5A 2KJHB 3NVWA 3N20C 3V6EB 5HKHA 4BKTA 3VRAB 1K51A 4B0EA 4M0WA 1QF6A 2JVCA 3E9SA 3AE7B 2BWES 2L52A 1LQBA 1WGRA 5FR3A 2TSSA 3PRMB 1MI0A 1EO6A 3Q8AA 4UDUC 2MP2A 1PYWD 4N58A 2LUEA 1WRIA 3N9YC 5J18A 3KVFB 1FRDA 1FXAA 2K8BA 1J7BA 1DOXA 4DBGA 5AZHA 4RM9A 4W9KA 1JWAD 3P4RB 4G0NB 4CYEA 3RNCC 4II2B 3T8MA 4J6IA 3ABVB 1ZDVA 2QMTA 1E5WA 3AI5A 1FFVA 2BKRB 4WAAA 4LNOA 3U2SC 4C56C 2JU6X 3PLVA 1E9MA 2M0AA 1Y8RC 1LXDA 2DX5B 4MACA 2KWUB 3UQAA 4JE3B 2BTEA 4QAYA 3H7PA 1WI0A 4TUUA 2E3TA 3KH0A 3ZNZB 4JGHB 3PVLA 1L0XB 1A70A 2DZKA 2FBWB 4BBNF 1Q5WB 3OJ4B 3RULA 3W5UB 1NBFC 3LDZE 1FEHA 1WSPA 2L05A 2O2VA 1XT9B 1ET6A 2LVPA 4ANVA 2JWUA 4YL8A 1MHHE 1RM6C 1F52A 4K7SA 4W9CA 3ZO5B 1XLOA 2D3AA 2KTRB 5T8IA 2K6QA 2V0GA 1OFFA 3PHWB 4N59A 2RR9A 1FD6A 4HKQA 1VRAB 2LEKA 2MH7A 3R7QA 3ZW3A 4FLHA 2RDHA 3JYUA 2BPSA 2XN9C 3HRDD 1NVID 2ZCCA 3H1UA 3TL5A 4C00A 2BW2A 2YEPB 4YSYB 1KTKA 1N6ZA 3W1YA 1JQ4A 1NDDA 1L5PA 1GUAB 2V3PA 3TEZA 5AZGA 1ZXHA 1V80A 4W9JA 1GG3A 4NY0A 5CX3A 2K25A 2EELA 2KHWB 3AE8B 3AE3B 4REZA 5D2MB 3RNFC 3CWIA 3N3KB 5IAAC 2KX0A 2NS5A 2PVGC 3V6CB 1N63A 2AQ2B 2PEAA 3Q8EA 2BT6A 4RCOA 3RUIB 2PVOD 1MG4A 1WX9A 2BYTA 4KKJA 4HKZE 4ANWA 3X0WA 4M00A 2NVUI 4BAXA 2VZKD 1ET9A 3L4PA 2WXJA 1KLVA 2L00B 2IO0B 2CJOA 3N30A 2KK8A 1P3QU 2Z59B 3DVGX 4RGOS 1GJZA 1E7UA 2BBCA 2A5UA 3WIMA 4YT0B 4EZKA 1HQRD 2CU1A 2NBWB 3O13A 2HD5B 1R4NI 3R66C 2JZ3B 4LNFA 1ZOYB 1L4DB 3EC8A 2GBJA 3UINB 4ACFA 2V4IB 4ZYSA 4MGIE 1YOVB 5LNK1 3EUB2 1HZ6A 2I1KA 4MGYE 1Z2MA 4D2KA 1WX7A 1CQVA 2AL3A 4P6VF 3OG5A 4DDGD 3SHQA 4II3B 4HVBA 3ML8A 2PMVA 2WXOA 4MGZE 3MJ5A 1KM7A 3OJ3A 3J9CA 1IP9A 3VHTC 1AWDA 2PPHA 5TR5A 2WNMA 3VFKA 2RMMA 1P98A 3IG3A 1WY8A 4XC2A 1KOTA 1PGBA 2K3UA 1OQYA 2GBKA 4FHJA 3VRBB 2KMAA 4USAA 2FIFA 4NAWB 1SJHD 2ONQA 2OHFA 3WAOA 2WXHA 3SEBA 2NPTA 4PYZA 2KVRA 3DBLB 4GDKA 4ARIA 1YNTE 1GPXA 3EA6A 3JSVB 4EE2A 4HDOA 5GXGB 3MJWA 4NQLB 2LXCA 1QOAA 4NZLB 2KFKA 4BZAA 5C23A 2KDMA 1JW9D 4A9AA 2M56B 4OW0A 3ZNGC 4M8NA 2MBBB 2JXXA 2INCC 2BWFA 4FJZA 4ANUA 3KYDD 2MWSB 3MC9A 1JWMD 4P1CC 5AEKB 2OJRA 3IAM1 2MCNB 5L95C 1HTQA 4K1RB 3K9OB 4XZ4A 2INPE 2KWDA 1V1PA 2QIEB 2G9HD 1E0ZA 2JUOA 1WXAA 1U4AA 2C60A 4J3OD 4RF1A 5G5GA 1YN3A 1YJIA 2Y5PA 4LK0M 3JVZX 2ICIA 4MJSB 4F7ZA 2N9PC 2WXNA 2MJDA 3RNAC 3AU4A 2N1WA 1FXTB 3C8YA 1YX5B 5J17A 3RN9C 4LJOB 3P4PB 1GAQB 2IY0B 2PE6B 3PS6A 3GP7A 3TJPA 2FAZA 1SF0A 2CJNA 1XXGA 1SIFA 3L0WB 2L8JA 1V81A 2DWQA 2MLBA 4JWSC 2D07B 5LLIA 3N1ZC 3NHEB 4FBJB 3VUWA 2XBBC 1E90A 3I3TB 1TY2A 2ZEQA 3KYCD 3ZNID 4HLEA 1XCTL 3R2TA 4A8XC 2KAJA 3WA0A 1WE6A 2DZMA 3PO0A 3B0AA 2V9HA 2W82A 5E6JA 1IPGA 4WWOA 1M94A 2OOBB 1TBEA 2G4SA 3KQ4A 2J0JA 3L54A 4BOZB 2L32A 2XEWA 3N1XC 2REXA 1VR9A 3EECA 2NTSA 3IAS1 1PQSA 3QIJA 4LNIA 2G4DB 1K52A 1SBBB 3C19A 3QC8B 3HHMA 4C4VB 4EKUA 4HJKA 1NEKB 3DWGC 4WIPA 1P0RA 5JH5C 4NQKE 4DHJD 4US9A 1A5RA 2KN5A 4M8MA 3PRPB 1ZUD2 2K9XA 1V5TA 1E8ZA 2DYBA 2LGDA 5DPWA 1Q1OA 3H8HA 1D4BA 2VRRB 2H89B 3V3XA 4HPMB 4YSXB 4RFBA 3Q8BA 3I57A 3HUIA 4KGRA 1SGHA 2HJ1A 1V6EA 4AJYB 3VTVA 2L0TA 5D6JB 2LRWA 3R7RA 1LO5D 3WAPA 2LZ6A 4Q2JA 5E6NA 2AQ3B 4IG7B 1OEYA 1XQQA 3NS8A 3HVDA 4KDIC 4WWNA 4K3CA 3O65B 4WAFA 5EDSA 1IBXA 4ZRKA 2R2QA 1D5ZC 3UQBA 2HTHA 1L4ZB 1PUTA 1WGHA 3PTFC 2DLBA 2WXRA 5IP4D 5JHBA 3URYA 1NYQA 1WXQA 2PLPA 1WJUA 4ICVA 2ZCBA 2FUG1 4FJVB 4N6EB 1RRBA 3DOWA 2KC2A 1JRUA 3V62A 2MRPA 4NPNA 4EZJA 1ZDXA 2J4XA 3SFEB 1WYGA 2LVOA 1T5XD 1T6BX 3RMKC 3Q69A 3M62B 2Y5CA 1OEYJ 1F0ZA 5CHWA 4HJGE 1KFYB 2KANA 3DBLI 3GE8C 3QJZA 3BY4B 1C4AA 2RGFA 2KDIA 1P9DU 4XWTA 1OGWA 1J7CA 1LM8B 2KTFA 4LDTD 3S2AA 1MHXA 4XDDA 4DHZE 1EF1A 4DXAB 1KRHA 2KMCA 2C7MB 2GBMA 5L83A 4MM3A 2C7HA 1RLFA 1WXMA 2PE9A 3ALBA 3KLSX 2B76B 4X57B 1L2NA 1GC7A 3SR6A 3QWZB 1FCCC 3W1SC 1FIQA 1SIJA 2INDC 5D7GA 2KQSA 3V05A 4FHKA 5BMHA 2LGYA 1JWUD 2KQ4X 1E8WA 1QT9A 4HPPA 3FILA 1WH3A 4W9EA 4M01A 1Q10A 5CHVC 1TKGA 4W9FA 3OAWA 1OQQA 1DOIA 1MG8A 1ROEA 1TJEA 1VLBA 4K7WA 3PZDA 1E8XA 2MW5A 2UU7A 1YN4A 3AE1B 2N9LA 2BYVE 1P7FA 3ZJUA 3LXFA 2K39A 2Z0EB 2HJ8A 3AEGB 4M0WB 2M1MA 2K0PA 4FN2A 1YMHE 3MC8A 1WGDA 2M19A 1FNWA 3LYYA 2QSDA 2WXPA 5HI1A 2W54A 3A4RA 3AN1A 3QX1A 3VXWA 3NVYA 2AQ1B 1HEZE 2MP2B 3AE6B 1TZ1A 5E6OA 3VDZA 2N7JA 2LHDA 4A3PA 3HK0A 4KGTA 2BB6A 1GC6A 3H9DA 4K81A 4BKSD 1TS4A 2PKOA 1ISNA 3RYTA 5G55A 2C7NB 2WDVB 2YVCA 1WJNA 2K1FA 4WH4A 4KZCA 1PDXA 2LRUA 3E56A 1IYFA 3WCQA 1LFDA 4XE0A 1VZ8A 2ZVNA 3MTNB 3W9CB 2ACZB 2FUHB 3PSEB 2MEKA 5EE9A 4IM0A 3ZDTA 1C3TA 1L0VB 1WMHA 4GSWA 4GXBA 4CHKA 3BINA 2PTLA 3A1QA 5BYRA 1T0SC 3TBLD 3PRZA 3C0RB 1UWMA 2ZZPB 2LGSA 5H8YE 2CHWA 4EOYA 2WDRB 3ZNHB 3VH4B 2O2VB 3QQ8B 3P63A 3IXSA 1TYGB 3NVZA 4B6WA 2L0FA 1VZ7A 3VH3B 4NNJB 2D3GA 3GB1A 3IT6B 4KSKC 5IO9A 3ZRFA 2M0XA 3KWVA 2Z0DB 4P7IA 1WYWB 1UWXA 1K50A 1MPEA 4HCPB 4JX1C 1QOBA 4JL9A 2LI5A 5G5HA 2LVQA 3TIXA 3A9JA 4K3BA 1T0QC 3Q2AC 4IM3A 3TEWA 1YD8U 1C77A 2IZVB 4CO7A 3RT3B 1WFYA 5IKCM 3ETRA 4TSSA 4ANXA 4JLCA 3DBRB 1XO3A 3AV8A 3KWLA 4GU2A 2K5PA 2N4FA 2LJ5A 1H4RA 3X23A 2KACA 4KDLB 2MBQA 5FKAC 2J53A 2KX3A 1RWSA 1YQBA 1SEBD 3ZYYX 3H7SA 2MBEA 2IY1B 4WQMA 1V9JA 2IO3B 3A9KA 1MVKA 2AX5A 3AEDB 2KNBA 2MX2A 1F9JA 2WX0A 1C78A 1VJKA 4O1NA 4KV2A 4IKGA 1DGJA 3AMZA 1S1QB 1UGJA 4XWWA 3DHIC 4W9LA 5BMGA 1UF0A 3IVFA 3AEFB 1YJ1A 4ITKA 2FCQA 1B9RA 3FAHA 1WZ3A 1RAXA 1UGMA 4WJQA 2HDEA 3H6NA 2WQYB 4HROA 1YN5A 3KUCB 3ZUNA 1I4PA 4TMAB 3RNGC 2L83A 2W9NA 4PT5A 2LD9A 2BS2B 2L76A 1EM7A 2ZPNA 4AP4C 2DZJA 2KC1A 3DHGC 3P4SB 2KLGA 2KLCA 3DBSA 2W55A 3ZTDA 1I42A 3TEYA 1TS3A 1QKZA 5I4DA 4RNAA 3R3MA 3PZ7A 2V4LA 1D5MC 2G3QB 4W9DA 1TGZB 3AE9B 5HHDG 3ECIA 4KIKA 4RGNA 2JPHA 2YLMA 2SAKA 2BYEA 3CMMB 3PPAA 3SDLC 2Z8LA 1WM2A 1WXSA 2QEJC 2XK5A 4BVUC 1V86A 2IO1B 3EFUA 4IOIE 1KJTA 2V3SA 4MDKE 3AE4B 2VH1A 2N9XA 4FULA 2KMMA 3KUZA 1IUEA 2GOWA 3RCZA 3PV1A 2NTTA 2DENB 1SE4A 2HE7A 2M8SA 4WQOB 4IM2A 3NRZA 4RGTA 4YTNB 2NPTB 2KQ7A 4AQ7A 2JRIB 2NCNA 2FIDA 3NG0A 3V61A 4S17A 1Q0WB 4GDKB 1FNUA 2QDFA 1NI3A 3D32A 4MGKE 3TEXA 3Q3JA 4WWMA 2I38A 4L1BA 1SE3A 1CMXB 3BZDB 4KX6B 5BYQA 2KFKB 1C79A 4GDLA 2JZPA 5D3IB 2KJ6A 5TSSA 1NI2A 2RSUA 3V60A 1YIWA 2WS3B 2X38A 2WXGA 4HDQA 3DVGY 2WXFA 1K8RB 3RPFC 1MFWA 2K8HA 2E6XA 5E6PA 4ZRPA 2JX5A 2NBVB 1N5XA 1Z5SB 1BMLC 2KDEB 3FC4A 1JMLA 2IJ0A 1V1PB 3BVGA 3RNBC 1L6UA 2AL6A 4IDIA 2OEDA 1KLUD 2KDFB 5DPSA 4DDID 4LLGM 1XEEA 1EU3A 3AH7A 4DXFA 4F8CB 1N61A 1R4MB 3Q8CA 5C2TB 3I63C 1S3SG 3ONSA 3PLUA 1KLGD 1N62A 2DNFA 4FJYA 1HA5A 2W3RA 4H2AA 2MBOA 3L17A 1FCLA 3T3OA 2BS4B 2ASQA 2JSVX 1SJED 5LXHA 3NY5A 1GB4A 5H92C 4BKSA 3NZSA 4G3XB 3Q3MC 3IHPC 3DBRI 1ZW7A 3U30A 1ZKHA 2O6VA 4HEA1 3DVNU 2WXQA 3K9PB 2LJIA 2L1AA 3U7ZA 4DXGA 2QCZA 2WLBA 4ICUA 2KWVB 4ZDVA 2XNAC 1LGRA 3LJ3A 4MSMB 1D6EC 1SB3C 3BK2A 4BFRA 1RFKA 4WJPA 1WRDB 2IYDB 2JY6A 3AEEB 2BGFA 3LB8C 3ZJTA 2ZNVB 1XLQA 1YQ4B 2W3SA 3AE5B 5J2RA 2GLSA 3B9JA 5HFYA 2DHZA 3BK1A 3SU8X 2N0SB 2WGSA 4JWUC 3B2GA 1OQRA 4RH6A 3Q14C 3QHTA 3BWUD 2IO2B 2WXIA 3L13A 1E7PB 2JYEA 4IWOA 2I1JA 4RM8A 4N9F4 2OJWA 4B9KA 2AEHA 4K7UA 1DOYA 1L6VA 3N32A 3U4EG 3MFGA 3P2BA 1C4CA 1CK1A 1JRPA 2J0MA 2RD0A 4OVVA 3ZXRA 4A20A 5EE1A 3TMPB 3VR9B 3Q8FA 1TTNA 4LTUA 3IFWB 1I35A 3P4QB 4OZCA 1IBXB 3EHVA 2KYWA 1C76A 4M02A 4EFOA 1UZXB 4GMVA 4IWQA 4XGAB 4ZYNA 3GZNB 3PREA 4LNNA 4ZOHC 1BUIC 1WF9A 3PT2B 1Y56A 2WYQA 5MPOA 2WXKA 1V8CA 1TKEA 2EMSA 2VH2A 3L08A 3DPDA 2DBYA 4LJPB 4P1BC 5EE3A 3DBHB 3GE3C 3PHXB 4L2YA 3NJTA 1E10A 4KSLC 1G6JA 2GBNA 3DDCB 4WJOA 2ZJDA 5EE0A 2VZKB 1V5OA 3HVZA 2LWPA 4YSZB 3W2DA 3NZUA 3EFCA 3TUOA 2SEBD 3QARA 3T9LA 4MM3B 1WM3A 3CIRB 5AZFA 2I2YA 3HM6X 2HTME 2WU5B 3U7DA 1AARA 4C7ZA 4FA6A 1I4HA 3A33B 4MELA 2AYOB 1FM0D 4YXDB 3TCAA 5KHQA 5BMIA 3FILB 3QAQA 3UI3A 2KKCA 1IGCA 3APFA 4NJ7A 3B08A 2D3BA 2LMCA 3BYYB 4AOFA 1XLPA 3HIZA 2JQRB 2DAFA 1UUPA 2JXTA 2L7RA 4YTMB 1ZXIA 1XD3B 2JZZA 1R4MI 1UD7A 3ZTCA 2D3CA 2DZIA 3GS2A 2KOXA 3ZKJC 2IDYA 2QILA 1J8CA 1UH6A 2N7EA 3ML9A 3U52E 1WJ6A 4C80A 4US8A 3QK0A 3AU5A 2MQJA 4B95A 4GGQA 4CQNA 1VDVA 1N60A 2BQQA 1MJDA 1R7SA 1UBQA 2BYFA 3DQVA 4FXCA 4AJWA 2O6VD 3M63B 1FFUA 3ZQ4A 3I9V1 4I6PA 1ZP0B 2PW9A 4FADA 4W9GA 1V1OA 2C9WB 4DHZB 2KTRA 1P7EA 2D10A 2JT4B 4W9HA 3W1SA 2K22A 2CS4A 2M17A 4HPLB 3NS1A 4RF0A 4GOCA 5C3JB 4WWPA 3H7PB 2FCNA 2WU2B 4RMAA 1WGKA 4KZ0A 4OVZA 3BVZA 5G2NA 1WZ0A 2BKFA 2MSED 3HM3A 4MSQB 2QJLA 2LGXA 1N5WA 3L16A 3KUDB 5CTRC 2KD0A 2KXJA 1AW7A 4HRSA 1SE9A 1WX8A 4A90A 1WR6E 5HG2A 2KDBA 2R2OA 4JQWC 1SE2A 1J0GA 1WMHB 2JWZA 3P1MA 3A1QB 3UF8A 5IA7A 1VD2A 2BVCA 2NMQA 1YQ3B 3W5VB 4RGMA 3NOBA 3VUYA 4ZRQA 2FCMA 2MHJA 4IW0A 5D94A 2H88B 2J0KA 2WHIA 1PFDA 4E3CA 3T3NA 2WP9B 3QCAA 5JHAA 2CKHB 5GMVA 1JWBD 4ZRIA 2KJRA 1HXYD 5BO4B 1UELA 3GOEA 5BYSA 3R8BA 3NZ3A 2N9KA 5LXIB 1BXTA 2EKEC 3NUHB 1DYQA 1L0YB 1ZE3D 4IWPA 4R3DA 2LUMA 2JF5A 2IGGA 1HE8A 4OZBA 4YTPB 1CJEA 3GZNI 3A9JB 1TZOA 2N7DA 1TIFA 2IBIB 2ZW1A 4TQ1A 2QC8A 3ZLZA 3Q3OC 2JRHA 4OVUA 4OZAA 2BS3B 1EUVB 3WAMA 1XF5L 1EWYC 2J7QB 3DBHI 3U8ZA 5DPTA 2KT7A 4P16A 3APDA 4A3OA 1D3ZA 1FRRA 1T0YA 4AUQC 1GOZA 1HTOA 2J42A 4GB9A 3A9KB 2PIAA 4DHJB 1FXIA 4PYUA 3AEAB 1JALA 2R61A 2ON8A 4GLSC 4NJ6A 4URKA 1B1ZA 3ZRCA 4JIOU 1XLNA 2EKIA 5CHFA 3M3JA 4MT5A 3VUXA 1I4XA 3DHHC 1WGYA 3SD5A 3SFDB 2KZRA 2K6DB 1KF6B 3AB5A 4NAWA 2ZPYA 1J7AA 2PJHA 1VCBA 4I6LB 2QHOA 4B0MA 3UIPB 1RFAA 4DWFA 3MHSD 4ASWC 5JZEB 2KWCA 3JSVA 4BOSC 2RDGA 2LHEA 3BVMA 3PZ8A 3I5JC 3QA8A 1FO4A 4BBNC 2CHXA 4TQ0A 1WWTA 4AWJA 2KVZA 2WDQB 2N1VA 4MEMA 3ZVVA 5FK9C 3DWMA 3WANA 3APCA 2WXMA 1WR1A 3VQIA 4GN1A 2ZW0A 3AE2B 2NBUA 2EMTA 2V3NA 3WALA 2KFJA 3Q3FA 3VTUA 4PK1A 5AUKA 1XCQL 2AWTA 2JYTA 4KIKB 1H8CA 1UBIA 3ZDMC 1P1AA 2IGDA 1AYFA 2RDBC 2KN4A 2UWQA 3CF6E 1UNSA 2D2QA 2XK5B 4I6NB 4AS1A 4E74A 1V49A 2FE8A 2CHZA 2CR5A 1TKYA 1WE7A 4DK5A 1IGDA 2ZNVC 3RD2A 3ZJVA 4MJSA 4GIVA 1E7VA 1I4QA 2WXLA 4LDTB 3NVVA 1CZPA 3MP9A 3Q3NC 2LGIA 4NJCA 2N9EB 4LCDE 1JWSD 1YJJA 2MJ3A 1FPYA 3P42A 4A6QA 1STEA 1QLBB 5IOIA 2Y3AA 5DCNA 1F2RI 4XYCA 1QQRA 4KKIA 3RZFA 2M4NA 2BF8B 1K53A 4KGSA 4GDLB 2A4ZA 2GBRA 4G11A 3Q6BA 4IUMB 3IBEA 2GB1A 2YEPF 2L3ZA 3DCGA 4LNKA 5C1ZA 4IC7B 2MBHA 3AEBB 4DQOC 4C4VA 1FNVA 2Q5WD 1OTRB 1EWCA 1HZ5A 1T0RC 1E8YA 1BT0A 3VR8B 1D5XC 1GNUA 3L10B 4BKGA 2Y5BB 4G50A 1F1HA 3TSSA 1ACCA 3EGRA 4EEWA 2FCSA 1PGAA 1QILA 3AM9A 3RZWC 1GB1A 1C4PA 4TKNA 4PS3A 2GMIC 4F1SA 4OHJA 4L23A 1I4RA 2CU3A 3FKYA 2X8XX 1TY0A 5KHOA 3AXCA 3BYTB 1F77A 1TS5A 2IGHA 3B2FA 3IT4B 1TT5B 4XX5A 4MH8A 2DYMA 3OWEB 4TV3A 3VAWA 1QOFA 1JCKB 2GRIA 4S0RA 3N1YC 2MJEA 4HXDA 2O6VB 3KW5B 1PGXA 2D5GA 4ZHOA 5IN7A 3A4SC 1ESFA 4ZRJA 1V97A 4YWGG 3ZGZA 3AULA 1X1MA 3AECB 1V2YA 2FNJB 1ZGUB 4PS7A 1ENFA 3RFZB 4A55A 5JXVA 3DVNV 4HK2A 1EU4A 4EZLA 3R2IA
chains in the Genus database with same CATH topology
2K8CA 2KX3A 1YQBA 5L95C 3H7SA 1XD3B 3PGEA 2JZZA 2MBEA 2IY1B 4HWIB 1R4MI 1V9JA 2IO3B 1UD7A 3K9OB 4K1RB 4XZ4A 3ZTCA 4EUTA 2RPQA 3A9KA 2DZIA 2KOXA 3ZKJC 2DAJA 2JUOA 1J8CA 2KNBA 2MX2A 1F9JA 1UH6A 1WXAA 1U4AA 1YX6B 2N7EA 2C60A 2WX0A 2C5LC 3ML9A 1WJ6A 4HCNB 3QK0A 1J19A 4KV2A 3JVZX 3AU5A 4MJSB 2MQJA 4F7ZA 4B95A 3UIOB 4GGQA 1S1QB 2N9PC 1UBQA 2BYFA 3DQVA 4AJWA 2O6VD 4W9LA 3M63B 3AU4A 2N1WA 1FXTB 1YX5B 3IVFA 5J17A 4I6PA 2WDTB 1YJ1A 4LJOB 4PS8A 1WXVA 3OLMD 3VTWA 2UYZB 4FADA 2IY0B 2PE6B 2FCQA 4W9GA 3PS6A 2LASA 3TJPA 1WZ3A 1RAXA 2FAZA 1UGMA 2C9WB 2LXAA 4WJQA 4DHZB 2KTRA 2D10A 2JT4B 4W9HA 1EF5A 1SIFA 3JW0X 3W1SA 3CSFA 3L0WB 3H6NA 2L8JA 1V81A 2V1YA 2MLBA 2D07B 5LLIA 2CS4A 2M17A 3KUCB 3B1LX 3CSTA 3NHEB 4HPLB 4WJNA 2MA9B 3ZUNA 4FBJB 4KVGB 3VUWA 4GOCA 1WGGA 4W9IA 1QZEA 5FR6A 2W9NA 2XBBC 4WWPA 1E90A 3I3TB 3H7PB 2FCNA 2ZEQA 2LD9A 3KYCD 3ZNID 4RMAA 4HLEA 2L76A 3VVWB 2ZPNA 5DPRA 4KZ0A 4MH0E 3WA0A 4AP4C 1WE6A 3ZIMA 2DZJA 2KC1A 5G2NA 1WZ0A 2BKFA 2DYOA 2DZMA 2ZVOA 2MSED 3HM3A 3B0AA 2D11A 2WX1A 4MSQB 2LGXA 1IPGA 2G45B 2KLGA 4WWOA 3L16A 1M94A 2KLCA 2OOBB 1TBEA 3DBSA 2G4SA 2WWZA 3ZTDA 3KUDB 1I42A 5CTRC 2KD0A 2KXJA 1WIAA 3R3MA 3ENEA 2J0JA 1SE9A 3L54A 1WX8A 4BOZB 1WR6E 3M95A 2V4LA 2XEWA 2KDBA 2REXA 3EECA 2G3QB 4W9DA 2R2OA 4JQWC 2KO3A 1PQSA 4E71A 1J0GA 1TGZB 1WMHB 2JWZA 3QIJA 2G4DB 3A1QB 3UF8A 5IA7A 3QC8B 3ECIA 1VD2A 3HHMA 1WJ4A 4KIKA 1C1YB 2JPHA 2YLMA 4EKUA 2B3AA 2NR2A 4HJKA 3UGBB 2BYEA 3CMMB 3PPAA 3SDLC 1WM2A 1P0RA 1WXSA 3NOBA 3VUYA 5JH5C 1L7YA 2FCMA 2KJHB 2XK5A 4BVUC 1V86A 4NQKE 4IW0A 2IO1B 3V6EB 5HKHA 3EFUA 5D94A 4DHJD 2J0KA 4BKTA 1KJTA 2V3SA 4MDKE 1A5RA 2KN5A 4E3CA 4M8MA 3PRPB 3QCAA 1V5TA 2DYBA 2LGDA 1E8ZA 2N9XA 5DPWA 4FULA 3KUZA 5JHAA 1Q1OA 2VRRB 2JVCA 2CKHB 2GOWA 3RCZA 5GMVA 2BWES 4HPMB 4ZRIA 1LQBA 3PV1A 2KJRA 2DENB 1WGRA 2HE7A 2M8SA 3PRMB 5BO4B 4WQOB 1UELA 3GOEA 1EO6A 4IM2A 5LXIB 1SGHA 2EKEC 4IWPA 1V6EA 2MP2A 2NPTB 2KQ7A 4AJYB 2JRIB 2NCNA 2FIDA 2L0TA 3VTVA 2LUEA 3V61A 1Q0WB 4GDKB 2JF5A 5J18A 3KVFB 5D6JB 2LRWA 3R7RA 3WAPA 1HE8A 2K8BA 2LZ6A 3D32A 5E6NA 4MGKE 3Q3JA 4DBGA 5AZHA 3GZNI 3A9JB 4RM9A 4IG7B 2N7DA 4W9KA 1OEYA 1XQQA 3NS8A 1CMXB 4G0NB 4KDIC 4WWNA 2IBIB 2KFKB 4II2B 3T8MA 4CYEA 4TQ1A 3O65B 4GDLA 4J6IA 5EDSA 3ZLZA 4ZRKA 1E5WA 3AI5A 2KJ6A 2R2QA 3UQBA 2HTHA 2JRHA 4OVUA 1NI2A 2BKRB 2RSUA 4WAAA 3V60A 1YIWA 1WGHA 3PTFC 3PLVA 1EUVB 1Y8RC 3WAMA 5JHBA 4HDQA 1LXDA 3DVGY 2DX5B 1K8RB 1WJUA 2J7QB 3DBHI 4ICVA 3U8ZA 5DPTA 2ZCBA 4FJVB 2K8HA 1RRBA 5E6PA 3APDA 2KWUB 3DOWA 2NBVB 3UQAA 4A3OA 1D3ZA 1Z5SB 2KC2A 1JRUA 2KDEB 1T0YA 2MRPA 3V62A 4AUQC 4NPNA 3H7PA 1WI0A 4EZJA 4TUUA 4GB9A 3A9KB 3KH0A 2LVOA 4DHJB 3ZNZB 4JGHB 3PVLA 4PYUA 2AL6A 2DZKA 4BBNF 1Q5WB 3M62B 3OJ4B 3RULA 2KDFB 5DPSA 1NBFC 1OEYJ 4NJ6A 4DDID 4URKA 5CHWA 3ZRCA 4JIOU 2KANA 3LDZE 3DBLI 3QJZA 3BY4B 5CHFA 3M3JA 2L05A 3VUXA 2O2VA 2RGFA 1XT9B 2KDIA 2LVPA 1P9DU 4ANVA 1WGYA 4F8CB 3SD5A 4YL8A 2KZRA 2K6DB 4NAWA 1OGWA 4K7SA 1LM8B 1S3SG 2KTFA 2ZPYA 4LDTD 4W9CA 3ONSA 3PLUA 3S2AA 3ZO5B 4DHZE 1EF1A 2PJHA 4DXAB 4FJYA 2KMCA 2C7MB 1VCBA 2GBMA 4I6LB 5L83A 2MBOA 3L17A 2C7HA 2KTRB 2K6QA 2QHOA 4MM3A 3UIPB 1WXMA 1RLFA 1RFAA 4DWFA 2PE9A 3ALBA 2ASQA 4X57B 1L2NA 3MHSD 4ASWC 3PHWB 2RR9A 1GC7A 5LXHA 3NY5A 3QWZB 5JZEB 3R7QA 4BKSA 3NZSA 2KWCA 3JSVA 4G3XB 3ZW3A 4FLHA 3W1SC 3JYUA 4BOSC 2BPSA 3IHPC 3DBRI 3QA8A 5D7GA 2KQSA 1ZW7A 4FHKA 4BBNC 2ZCCA 3U30A 2LGYA 1ZKHA 2CHXA 2O6VA 3H1UA 4TQ0A 3TL5A 3DVNU 3K9PB 1E8WA 4AWJA 2N1VA 1WH3A 4W9EA 4MEMA 4ICUA 3ZVVA 3W1YA 5CHVC 1NDDA 2KWVB 1GUAB 4ZDVA 3WANA 5AZGA 4W9FA 3APCA 1V80A 3OAWA 1WR1A 1MG8A 3LJ3A 4MSMB 4W9JA 1GG3A 4NY0A 5CX3A 4GN1A 3VQIA 2K25A 4BFRA 2NBUA 2EMTA 3WALA 2KFJA 2KHWB 3Q3FA 4K7WA 3VTUA 3PZDA 2AWTA 4WJPA 1E8XA 4KIKB 5D2MB 1UBIA 3ZDMC 1H8CA 2MW5A 1WRDB 1P1AA 2IYDB 2JY6A 2BGFA 3N3KB 5IAAC 2UWQA 2BYVE 2KX0A 3CF6E 2ZNVB 2D2QA 2XK5B 4I6NB 2NS5A 4E74A 1V49A 5J2RA 3V6CB 2CHZA 2K39A 2Z0EB 2HJ8A 2CR5A 2DHZA 1WE7A 4DK5A 2ZNVC 3RD2A 2PEAA 2M1MA 4M0WB 4MJSA 3SU8X 4FN2A 4GIVA 1E7VA 1WGDA 3RUIB 1WX9A 4LDTB 4ANWA 3QHTA 2IO2B 3X0WA 3A4RA 3QX1A 2NVUI 3L13A 3VXWA 2N9EB 4LCDE 4IWOA 1KLVA 2I1JA 2L00B 4RM8A 4N9F4 2MP2B 2IO0B 3N30A 1TZ1A 4B9KA 5E6OA 2AEHA 4K7UA 2KK8A 1P3QU 3VDZA 2Z59B 3DVGX 1GJZA 3N32A 4A3PA 1E7UA 3HK0A 2A5UA 3WIMA 3P2BA 5DCNA 4EZKA 2J0MA 2RD0A 2CU1A 1GC6A 4OVVA 2NBWB 3RZFA 3H9DA 4K81A 2HD5B 4A20A 4BKSD 1R4NI 3TMPB 2M4NA 3R66C 1ISNA 1TTNA 3RYTA 2JZ3B 3IFWB 5G55A 2BF8B 2C7NB 3EC8A 2YVCA 1I35A 2GBJA 4GDLB 1WJNA 2K1FA 3UINB 2A4ZA 2GBRA 4MGIE 3EHVA 4KZCA 2I1KA 2LRUA 4MGYE 1Z2MA 2MCNB 4EFOA 1WX7A 4G11A 1IYFA 1UZXB 4GMVA 4IWQA 4ZYNA 1LFDA 2AL3A 2ZVNA 3MTNB 4DDGD 3PSEB 2FUHB 3IBEA 4IUMB 3PREA 3SHQA 4II3B 4HVBA 2L3ZA 1WF9A 3DCGA 4IM0A 3ZDTA 1C3TA 3ML8A 3PT2B 5C1ZA 1WMHA 4GSWA 4GXBA 4MGZE 4CHKA 3BINA 4IC7B 3A1QA 2MBHA 1KM7A 3TBLD 2WYQA 3OJ3A 1IP9A 3PRZA 2EMSA 3VHTC 2PPHA 5TR5A 1OTRB 3L08A 3VFKA 3C0RB 3DPDA 1P98A 3IG3A 4LJPB 1E8YA 1WY8A 1BT0A 2ZZPB 4XC2A 1GNUA 1KOTA 3L10B 2CHWA 4BKGA 4EOYA 2Y5BB 3PHXB 4G50A 1OQYA 3ZNHB 2GBKA 4FHJA 4KSLC 2O2VB 3VH4B 1G6JA 4EEWA 2GBNA 2FCSA 3DDCB 2KMAA 3QQ8B 2ZJDA 4WJOA 3RZWC 2FIFA 1V5OA 4NAWB 4TKNA 2LWPA 4PS3A 2GMIC 3NZUA 4F1SA 4B6WA 2L0FA 3WAOA 3QARA 3T9LA 3VH3B 4NNJB 2D3GA 2NPTA 1WM3A 4KSKC 3AXCA 5AZFA 5KHOA 3ZRFA 4PYZA 3HM6X 2KVRA 2M0XA 2Z0DB 4GDKA 4P7IA 1WYWB 4XX5A 2DYMA 4TV3A 3JSVB 3U7DA 3VAWA 4HCPB 1AARA 4HDOA 4FA6A 3MJWA 4JL9A 3A33B 4NQLB 2LI5A 2LXCA 4MELA 2AYOB 2LVQA 3A9JA 3TIXA 4HXDA 2O6VB 3KW5B 3TCAA 4IM3A 2KFKA 1YD8U 3A4SC 5KHQA 4ZRJA 2IZVB 3QAQA 5C23A 4CO7A 2KKCA 3ZNGC 3APFA 4NJ7A 3AULA 3RT3B 4M8NA 2MBBB 2JXXA 3B08A 1WFYA 1X1MA 4AOFA 2BWFA 3HIZA 4FJZA 1V2YA 2DAFA 2FNJB 3KYDD 2MWSB 4ANUA 4JLCA 4ANXA 1ZGUB 4PS7A 4GU2A 3DVNV 2N4FA 2LJ5A 1H4RA 4HK2A 2L7RA 4EZLA 3X23A 5AEKB 2OJRA 4KDLB 2MBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K8C A;  2KX3 A;  1YQB A;  5L95 C;  3H7S A;  1XD3 B;  3PGE A;  2JZZ A;  2MBE A;  2IY1 B;  4HWI B;  1R4M I;  1V9J A;  2IO3 B;  1UD7 A;  3K9O B;  4K1R B;  4XZ4 A;  3ZTC A;  4EUT A;  2RPQ A;  3A9K A;  2DZI A;  2KOX A;  3ZKJ C;  2DAJ A;  2JUO A;  1J8C A;  2KNB A;  2MX2 A;  1F9J A;  1UH6 A;  1WXA A;  1U4A A;  1YX6 B;  2N7E A;  2C60 A;  2WX0 A;  2C5L C;  3ML9 A;  1WJ6 A;  4HCN B;  3QK0 A;  1J19 A;  4KV2 A;  3JVZ X;  3AU5 A;  4MJS B;  2MQJ A;  4F7Z A;  4B95 A;  3UIO B;  4GGQ A;  1S1Q B;  2N9P C;  1UBQ A;  2BYF A;  3DQV A;  4AJW A;  2O6V D;  4W9L A;  3M63 B;  3AU4 A;  2N1W A;  1FXT B;  1YX5 B;  3IVF A;  5J17 A;  4I6P A;  2WDT B;  1YJ1 A;  4LJO B;  4PS8 A;  1WXV A;  3OLM D;  3VTW A;  2UYZ B;  4FAD A;  2IY0 B;  2PE6 B;  2FCQ A;  4W9G A;  3PS6 A;  2LAS A;  3TJP A;  1WZ3 A;  1RAX A;  2FAZ A;  1UGM A;  2C9W B;  2LXA A;  4WJQ A;  4DHZ B;  2KTR A;  2D10 A;  2JT4 B;  4W9H A;  1EF5 A;  1SIF A;  3JW0 X;  3W1S A;  3CSF A;  3L0W B;  3H6N A;  2L8J A;  1V81 A;  2V1Y A;  2MLB A;  2D07 B;  5LLI A;  2CS4 A;  2M17 A;  3KUC B;  3B1L X;  3CST A;  3NHE B;  4HPL B;  4WJN A;  2MA9 B;  3ZUN A;  4FBJ B;  4KVG B;  3VUW A;  4GOC A;  1WGG A;  4W9I A;  1QZE A;  5FR6 A;  2W9N A;  2XBB C;  4WWP A;  1E90 A;  3I3T B;  3H7P B;  2FCN A;  2ZEQ A;  2LD9 A;  3KYC D;  3ZNI D;  4RMA A;  4HLE A;  2L76 A;  3VVW B;  2ZPN A;  5DPR A;  4KZ0 A;  4MH0 E;  3WA0 A;  4AP4 C;  1WE6 A;  3ZIM A;  2DZJ A;  2KC1 A;  5G2N A;  1WZ0 A;  2BKF A;  2DYO A;  2DZM A;  2ZVO A;  2MSE D;  3HM3 A;  3B0A A;  2D11 A;  2WX1 A;  4MSQ B;  2LGX A;  1IPG A;  2G45 B;  2KLG A;  4WWO A;  3L16 A;  1M94 A;  2KLC A;  2OOB B;  1TBE A;  3DBS A;  2G4S A;  2WWZ A;  3ZTD A;  3KUD B;  1I42 A;  5CTR C;  2KD0 A;  2KXJ A;  1WIA A;  3R3M A;  3ENE A;  2J0J A;  1SE9 A;  3L54 A;  1WX8 A;  4BOZ B;  1WR6 E;  3M95 A;  2V4L A;  2XEW A;  2KDB A;  2REX A;  3EEC A;  2G3Q B;  4W9D A;  2R2O A;  4JQW C;  2KO3 A;  1PQS A;  4E71 A;  1J0G A;  1TGZ B;  1WMH B;  2JWZ A;  3QIJ A;  2G4D B;  3A1Q B;  3UF8 A;  5IA7 A;  3QC8 B;  3ECI A;  1VD2 A;  3HHM A;  1WJ4 A;  4KIK A;  1C1Y B;  2JPH A;  2YLM A;  4EKU A;  2B3A A;  2NR2 A;  4HJK A;  3UGB B;  2BYE A;  3CMM B;  3PPA A;  3SDL C;  1WM2 A;  1P0R A;  1WXS A;  3NOB A;  3VUY A;  5JH5 C;  1L7Y A;  2FCM A;  2KJH B;  2XK5 A;  4BVU C;  1V86 A;  4NQK E;  4IW0 A;  2IO1 B;  3V6E B;  5HKH A;  3EFU A;  5D94 A;  4DHJ D;  2J0K A;  4BKT A;  1KJT A;  2V3S A;  4MDK E;  1A5R A;  2KN5 A;  4E3C A;  4M8M A;  3PRP B;  3QCA A;  1V5T A;  2DYB A;  2LGD A;  1E8Z A;  2N9X A;  5DPW A;  4FUL A;  3KUZ A;  5JHA A;  1Q1O A;  2VRR B;  2JVC A;  2CKH B;  2GOW A;  3RCZ A;  5GMV A;  2BWE S;  4HPM B;  4ZRI A;  1LQB A;  3PV1 A;  2KJR A;  2DEN B;  1WGR A;  2HE7 A;  2M8S A;  3PRM B;  5BO4 B;  4WQO B;  1UEL A;  3GOE A;  1EO6 A;  4IM2 A;  5LXI B;  1SGH A;  2EKE C;  4IWP A;  1V6E A;  2MP2 A;  2NPT B;  2KQ7 A;  4AJY B;  2JRI B;  2NCN A;  2FID A;  2L0T A;  3VTV A;  2LUE A;  3V61 A;  1Q0W B;  4GDK B;  2JF5 A;  5J18 A;  3KVF B;  5D6J B;  2LRW A;  3R7R A;  3WAP A;  1HE8 A;  2K8B A;  2LZ6 A;  3D32 A;  5E6N A;  4MGK E;  3Q3J A;  4DBG A;  5AZH A;  3GZN I;  3A9J B;  4RM9 A;  4IG7 B;  2N7D A;  4W9K A;  1OEY A;  1XQQ A;  3NS8 A;  1CMX B;  4G0N B;  4KDI C;  4WWN A;  2IBI B;  2KFK B;  4II2 B;  3T8M A;  4CYE A;  4TQ1 A;  3O65 B;  4GDL A;  4J6I A;  5EDS A;  3ZLZ A;  4ZRK A;  1E5W A;  3AI5 A;  2KJ6 A;  2R2Q A;  3UQB A;  2HTH A;  2JRH A;  4OVU A;  1NI2 A;  2BKR B;  2RSU A;  4WAA A;  3V60 A;  1YIW A;  1WGH A;  3PTF C;  3PLV A;  1EUV B;  1Y8R C;  3WAM A;  5JHB A;  4HDQ A;  1LXD A;  3DVG Y;  2DX5 B;  1K8R B;  1WJU A;  2J7Q B;  3DBH I;  4ICV A;  3U8Z A;  5DPT A;  2ZCB A;  4FJV B;  2K8H A;  1RRB A;  5E6P A;  3APD A;  2KWU B;  3DOW A;  2NBV B;  3UQA A;  4A3O A;  1D3Z A;  1Z5S B;  2KC2 A;  1JRU A;  2KDE B;  1T0Y A;  2MRP A;  3V62 A;  4AUQ C;  4NPN A;  3H7P A;  1WI0 A;  4EZJ A;  4TUU A;  4GB9 A;  3A9K B;  3KH0 A;  2LVO A;  4DHJ B;  3ZNZ B;  4JGH B;  3PVL A;  4PYU A;  2AL6 A;  2DZK A;  4BBN F;  1Q5W B;  3M62 B;  3OJ4 B;  3RUL A;  2KDF B;  5DPS A;  1NBF C;  1OEY J;  4NJ6 A;  4DDI D;  4URK A;  5CHW A;  3ZRC A;  4JIO U;  2KAN A;  3LDZ E;  3DBL I;  3QJZ A;  3BY4 B;  5CHF A;  3M3J A;  2L05 A;  3VUX A;  2O2V A;  2RGF A;  1XT9 B;  2KDI A;  2LVP A;  1P9D U;  4ANV A;  1WGY A;  4F8C B;  3SD5 A;  4YL8 A;  2KZR A;  2K6D B;  4NAW A;  1OGW A;  4K7S A;  1LM8 B;  1S3S G;  2KTF A;  2ZPY A;  4LDT D;  4W9C A;  3ONS A;  3PLU A;  3S2A A;  3ZO5 B;  4DHZ E;  1EF1 A;  2PJH A;  4DXA B;  4FJY A;  2KMC A;  2C7M B;  1VCB A;  2GBM A;  4I6L B;  5L83 A;  2MBO A;  3L17 A;  2C7H A;  2KTR B;  2K6Q A;  2QHO A;  4MM3 A;  3UIP B;  1WXM A;  1RLF A;  1RFA A;  4DWF A;  2PE9 A;  3ALB A;  2ASQ A;  4X57 B;  1L2N A;  3MHS D;  4ASW C;  3PHW B;  2RR9 A;  1GC7 A;  5LXH A;  3NY5 A;  3QWZ B;  5JZE B;  3R7Q A;  4BKS A;  3NZS A;  2KWC A;  3JSV A;  4G3X B;  3ZW3 A;  4FLH A;  3W1S C;  3JYU A;  4BOS C;  2BPS A;  3IHP C;  3DBR I;  3QA8 A;  5D7G A;  2KQS A;  1ZW7 A;  4FHK A;  4BBN C;  2ZCC A;  3U30 A;  2LGY A;  1ZKH A;  2CHX A;  2O6V A;  3H1U A;  4TQ0 A;  3TL5 A;  3DVN U;  3K9P B;  1E8W A;  4AWJ A;  2N1V A;  1WH3 A;  4W9E A;  4MEM A;  4ICU A;  3ZVV A;  3W1Y A;  5CHV C;  1NDD A;  2KWV B;  1GUA B;  4ZDV A;  3WAN A;  5AZG A;  4W9F A;  3APC A;  1V80 A;  3OAW A;  1WR1 A;  1MG8 A;  3LJ3 A;  4MSM B;  4W9J A;  1GG3 A;  4NY0 A;  5CX3 A;  4GN1 A;  3VQI A;  2K25 A;  4BFR A;  2NBU A;  2EMT A;  3WAL A;  2KFJ A;  2KHW B;  3Q3F A;  4K7W A;  3VTU A;  3PZD A;  2AWT A;  4WJP A;  1E8X A;  4KIK B;  5D2M B;  1UBI A;  3ZDM C;  1H8C A;  2MW5 A;  1WRD B;  1P1A A;  2IYD B;  2JY6 A;  2BGF A;  3N3K B;  5IAA C;  2UWQ A;  2BYV E;  2KX0 A;  3CF6 E;  2ZNV B;  2D2Q A;  2XK5 B;  4I6N B;  2NS5 A;  4E74 A;  1V49 A;  5J2R A;  3V6C B;  2CHZ A;  2K39 A;  2Z0E B;  2HJ8 A;  2CR5 A;  2DHZ A;  1WE7 A;  4DK5 A;  2ZNV C;  3RD2 A;  2PEA A;  2M1M A;  4M0W B;  4MJS A;  3SU8 X;  4FN2 A;  4GIV A;  1E7V A;  1WGD A;  3RUI B;  1WX9 A;  4LDT B;  4ANW A;  3QHT A;  2IO2 B;  3X0W A;  3A4R A;  3QX1 A;  2NVU I;  3L13 A;  3VXW A;  2N9E B;  4LCD E;  4IWO A;  1KLV A;  2I1J A;  2L00 B;  4RM8 A;  4N9F 4;  2MP2 B;  2IO0 B;  3N30 A;  1TZ1 A;  4B9K A;  5E6O A;  2AEH A;  4K7U A;  2KK8 A;  1P3Q U;  3VDZ A;  2Z59 B;  3DVG X;  1GJZ A;  3N32 A;  4A3P A;  1E7U A;  3HK0 A;  2A5U A;  3WIM A;  3P2B A;  5DCN A;  4EZK A;  2J0M A;  2RD0 A;  2CU1 A;  1GC6 A;  4OVV A;  2NBW B;  3RZF A;  3H9D A;  4K81 A;  2HD5 B;  4A20 A;  4BKS D;  1R4N I;  3TMP B;  2M4N A;  3R66 C;  1ISN A;  1TTN A;  3RYT A;  2JZ3 B;  3IFW B;  5G55 A;  2BF8 B;  2C7N B;  3EC8 A;  2YVC A;  1I35 A;  2GBJ A;  4GDL B;  1WJN A;  2K1F A;  3UIN B;  2A4Z A;  2GBR A;  4MGI E;  3EHV A;  4KZC A;  2I1K A;  2LRU A;  4MGY E;  1Z2M A;  2MCN B;  4EFO A;  1WX7 A;  4G11 A;  1IYF A;  1UZX B;  4GMV A;  4IWQ A;  4ZYN A;  1LFD A;  2AL3 A;  2ZVN A;  3MTN B;  4DDG D;  3PSE B;  2FUH B;  3IBE A;  4IUM B;  3PRE A;  3SHQ A;  4II3 B;  4HVB A;  2L3Z A;  1WF9 A;  3DCG A;  4IM0 A;  3ZDT A;  1C3T A;  3ML8 A;  3PT2 B;  5C1Z A;  1WMH A;  4GSW A;  4GXB A;  4MGZ E;  4CHK A;  3BIN A;  4IC7 B;  3A1Q A;  2MBH A;  1KM7 A;  3TBL D;  2WYQ A;  3OJ3 A;  1IP9 A;  3PRZ A;  2EMS A;  3VHT C;  2PPH A;  5TR5 A;  1OTR B;  3L08 A;  3VFK A;  3C0R B;  3DPD A;  1P98 A;  3IG3 A;  4LJP B;  1E8Y A;  1WY8 A;  1BT0 A;  2ZZP B;  4XC2 A;  1GNU A;  1KOT A;  3L10 B;  2CHW A;  4BKG A;  4EOY A;  2Y5B B;  3PHX B;  4G50 A;  1OQY A;  3ZNH B;  2GBK A;  4FHJ A;  4KSL C;  2O2V B;  3VH4 B;  1G6J A;  4EEW A;  2GBN A;  2FCS A;  3DDC B;  2KMA A;  3QQ8 B;  2ZJD A;  4WJO A;  3RZW C;  2FIF A;  1V5O A;  4NAW B;  4TKN A;  2LWP A;  4PS3 A;  2GMI C;  3NZU A;  4F1S A;  4B6W A;  2L0F A;  3WAO A;  3QAR A;  3T9L A;  3VH3 B;  4NNJ B;  2D3G A;  2NPT A;  1WM3 A;  4KSK C;  3AXC A;  5AZF A;  5KHO A;  3ZRF A;  4PYZ A;  3HM6 X;  2KVR A;  2M0X A;  2Z0D B;  4GDK A;  4P7I A;  1WYW B;  4XX5 A;  2DYM A;  4TV3 A;  3JSV B;  3U7D A;  3VAW A;  4HCP B;  1AAR A;  4HDO A;  4FA6 A;  3MJW A;  4JL9 A;  3A33 B;  4NQL B;  2LI5 A;  2LXC A;  4MEL A;  2AYO B;  2LVQ A;  3A9J A;  3TIX A;  4HXD A;  2O6V B;  3KW5 B;  3TCA A;  4IM3 A;  2KFK A;  1YD8 U;  3A4S C;  5KHQ A;  4ZRJ A;  2IZV B;  3QAQ A;  5C23 A;  4CO7 A;  2KKC A;  3ZNG C;  3APF A;  4NJ7 A;  3AUL A;  3RT3 B;  4M8N A;  2MBB B;  2JXX A;  3B08 A;  1WFY A;  1X1M A;  4AOF A;  2BWF A;  3HIZ A;  4FJZ A;  1V2Y A;  2DAF A;  2FNJ B;  3KYD D;  2MWS B;  4ANU A;  4JLC A;  4ANX A;  1ZGU B;  4PS7 A;  4GU2 A;  3DVN V;  2N4F A;  2LJ5 A;  1H4R A;  4HK2 A;  2L7R A;  4EZL A;  3X23 A;  5AEK B;  2OJR A;  4KDL B;  2MBQ A; 
#chains in the Genus database with same CATH topology
 1SSN A;  2K8C A;  1FMA D;  3PGE A;  5AUI A;  4ARC A;  4HWI B;  4NAM A;  4EUT A;  2RPQ A;  1VZ6 A;  1SXT A;  2G1E A;  2DAJ A;  5D3D A;  1RYJ A;  4XDC A;  1YX6 B;  1QOG A;  1E6E B;  2C5L C;  4HCN B;  1J19 A;  1I4G A;  1I7H A;  2J52 A;  3UIO B;  1JRO A;  3MC0 B;  1M4V A;  2WDT B;  4PS8 A;  1WXV A;  3OLM D;  3VTW A;  2UYZ B;  2LAS A;  2LXA A;  1TS2 A;  1EF5 A;  3JW0 X;  3CSF A;  4WUR A;  2V1Y A;  2GI9 A;  1NEN B;  2IPK D;  2RPV A;  3B1L X;  3CST A;  4WJN A;  2MA9 B;  4KVG B;  4JPS A;  1WGG A;  4W9I A;  4ZHP A;  1QZE A;  5FR6 A;  1ZPS A;  3VVW B;  5DPR A;  4MH0 E;  3ZIM A;  2DYO A;  2ZVO A;  3RI7 C;  2D11 A;  2WX1 A;  1AN8 A;  3MHZ A;  2G45 B;  2WWZ A;  3ZXV A;  3BII D;  1WIA A;  3ENE A;  1T3Q A;  1NYR A;  3M95 A;  1R4N B;  1C9F A;  2KO3 A;  3RNE C;  4E71 A;  1F2R C;  1WJ4 A;  1C1Y B;  2B3A A;  2NR2 A;  2LFI A;  3UGB B;  1KH0 A;  4C7Y A;  2INN E;  1L7Y A;  2BB5 A;  2KJH B;  3NVW A;  3N20 C;  3V6E B;  5HKH A;  4BKT A;  3VRA B;  1K51 A;  4B0E A;  4M0W A;  1QF6 A;  2JVC A;  3E9S A;  3AE7 B;  2BWE S;  2L52 A;  1LQB A;  1WGR A;  5FR3 A;  2TSS A;  3PRM B;  1MI0 A;  1EO6 A;  3Q8A A;  4UDU C;  2MP2 A;  1PYW D;  4N58 A;  2LUE A;  1WRI A;  3N9Y C;  5J18 A;  3KVF B;  1FRD A;  1FXA A;  2K8B A;  1J7B A;  1DOX A;  4DBG A;  5AZH A;  4RM9 A;  4W9K A;  1JWA D;  3P4R B;  4G0N B;  4CYE A;  3RNC C;  4II2 B;  3T8M A;  4J6I A;  3ABV B;  1ZDV A;  2QMT A;  1E5W A;  3AI5 A;  1FFV A;  2BKR B;  4WAA A;  4LNO A;  3U2S C;  4C56 C;  2JU6 X;  3PLV A;  1E9M A;  2M0A A;  1Y8R C;  1LXD A;  2DX5 B;  4MAC A;  2KWU B;  3UQA A;  4JE3 B;  2BTE A;  4QAY A;  3H7P A;  1WI0 A;  4TUU A;  2E3T A;  3KH0 A;  3ZNZ B;  4JGH B;  3PVL A;  1L0X B;  1A70 A;  2DZK A;  2FBW B;  4BBN F;  1Q5W B;  3OJ4 B;  3RUL A;  3W5U B;  1NBF C;  3LDZ E;  1FEH A;  1WSP A;  2L05 A;  2O2V A;  1XT9 B;  1ET6 A;  2LVP A;  4ANV A;  2JWU A;  4YL8 A;  1MHH E;  1RM6 C;  1F52 A;  4K7S A;  4W9C A;  3ZO5 B;  1XLO A;  2D3A A;  2KTR B;  5T8I A;  2K6Q A;  2V0G A;  1OFF A;  3PHW B;  4N59 A;  2RR9 A;  1FD6 A;  4HKQ A;  1VRA B;  2LEK A;  2MH7 A;  3R7Q A;  3ZW3 A;  4FLH A;  2RDH A;  3JYU A;  2BPS A;  2XN9 C;  3HRD D;  1NVI D;  2ZCC A;  3H1U A;  3TL5 A;  4C00 A;  2BW2 A;  2YEP B;  4YSY B;  1KTK A;  1N6Z A;  3W1Y A;  1JQ4 A;  1NDD A;  1L5P A;  1GUA B;  2V3P A;  3TEZ A;  5AZG A;  1ZXH A;  1V80 A;  4W9J A;  1GG3 A;  4NY0 A;  5CX3 A;  2K25 A;  2EEL A;  2KHW B;  3AE8 B;  3AE3 B;  4REZ A;  5D2M B;  3RNF C;  3CWI A;  3N3K B;  5IAA C;  2KX0 A;  2NS5 A;  2PVG C;  3V6C B;  1N63 A;  2AQ2 B;  2PEA A;  3Q8E A;  2BT6 A;  4RCO A;  3RUI B;  2PVO D;  1MG4 A;  1WX9 A;  2BYT A;  4KKJ A;  4HKZ E;  4ANW A;  3X0W A;  4M00 A;  2NVU I;  4BAX A;  2VZK D;  1ET9 A;  3L4P A;  2WXJ A;  1KLV A;  2L00 B;  2IO0 B;  2CJO A;  3N30 A;  2KK8 A;  1P3Q U;  2Z59 B;  3DVG X;  4RGO S;  1GJZ A;  1E7U A;  2BBC A;  2A5U A;  3WIM A;  4YT0 B;  4EZK A;  1HQR D;  2CU1 A;  2NBW B;  3O13 A;  2HD5 B;  1R4N I;  3R66 C;  2JZ3 B;  4LNF A;  1ZOY B;  1L4D B;  3EC8 A;  2GBJ A;  3UIN B;  4ACF A;  2V4I B;  4ZYS A;  4MGI E;  1YOV B;  5LNK 1;  3EUB 2;  1HZ6 A;  2I1K A;  4MGY E;  1Z2M A;  4D2K A;  1WX7 A;  1CQV A;  2AL3 A;  4P6V F;  3OG5 A;  4DDG D;  3SHQ A;  4II3 B;  4HVB A;  3ML8 A;  2PMV A;  2WXO A;  4MGZ E;  3MJ5 A;  1KM7 A;  3OJ3 A;  3J9C A;  1IP9 A;  3VHT C;  1AWD A;  2PPH A;  5TR5 A;  2WNM A;  3VFK A;  2RMM A;  1P98 A;  3IG3 A;  1WY8 A;  4XC2 A;  1KOT A;  1PGB A;  2K3U A;  1OQY A;  2GBK A;  4FHJ A;  3VRB B;  2KMA A;  4USA A;  2FIF A;  4NAW B;  1SJH D;  2ONQ A;  2OHF A;  3WAO A;  2WXH A;  3SEB A;  2NPT A;  4PYZ A;  2KVR A;  3DBL B;  4GDK A;  4ARI A;  1YNT E;  1GPX A;  3EA6 A;  3JSV B;  4EE2 A;  4HDO A;  5GXG B;  3MJW A;  4NQL B;  2LXC A;  1QOA A;  4NZL B;  2KFK A;  4BZA A;  5C23 A;  2KDM A;  1JW9 D;  4A9A A;  2M56 B;  4OW0 A;  3ZNG C;  4M8N A;  2MBB B;  2JXX A;  2INC C;  2BWF A;  4FJZ A;  4ANU A;  3KYD D;  2MWS B;  3MC9 A;  1JWM D;  4P1C C;  5AEK B;  2OJR A;  3IAM 1;  2MCN B;  5L95 C;  1HTQ A;  4K1R B;  3K9O B;  4XZ4 A;  2INP E;  2KWD A;  1V1P A;  2QIE B;  2G9H D;  1E0Z A;  2JUO A;  1WXA A;  1U4A A;  2C60 A;  4J3O D;  4RF1 A;  5G5G A;  1YN3 A;  1YJI A;  2Y5P A;  4LK0 M;  3JVZ X;  2ICI A;  4MJS B;  4F7Z A;  2N9P C;  2WXN A;  2MJD A;  3RNA C;  3AU4 A;  2N1W A;  1FXT B;  3C8Y A;  1YX5 B;  5J17 A;  3RN9 C;  4LJO B;  3P4P B;  1GAQ B;  2IY0 B;  2PE6 B;  3PS6 A;  3GP7 A;  3TJP A;  2FAZ A;  1SF0 A;  2CJN A;  1XXG A;  1SIF A;  3L0W B;  2L8J A;  1V81 A;  2DWQ A;  2MLB A;  4JWS C;  2D07 B;  5LLI A;  3N1Z C;  3NHE B;  4FBJ B;  3VUW A;  2XBB C;  1E90 A;  3I3T B;  1TY2 A;  2ZEQ A;  3KYC D;  3ZNI D;  4HLE A;  1XCT L;  3R2T A;  4A8X C;  2KAJ A;  3WA0 A;  1WE6 A;  2DZM A;  3PO0 A;  3B0A A;  2V9H A;  2W82 A;  5E6J A;  1IPG A;  4WWO A;  1M94 A;  2OOB B;  1TBE A;  2G4S A;  3KQ4 A;  2J0J A;  3L54 A;  4BOZ B;  2L32 A;  2XEW A;  3N1X C;  2REX A;  1VR9 A;  3EEC A;  2NTS A;  3IAS 1;  1PQS A;  3QIJ A;  4LNI A;  2G4D B;  1K52 A;  1SBB B;  3C19 A;  3QC8 B;  3HHM A;  4C4V B;  4EKU A;  4HJK A;  1NEK B;  3DWG C;  4WIP A;  1P0R A;  5JH5 C;  4NQK E;  4DHJ D;  4US9 A;  1A5R A;  2KN5 A;  4M8M A;  3PRP B;  1ZUD 2;  2K9X A;  1V5T A;  1E8Z A;  2DYB A;  2LGD A;  5DPW A;  1Q1O A;  3H8H A;  1D4B A;  2VRR B;  2H89 B;  3V3X A;  4HPM B;  4YSX B;  4RFB A;  3Q8B A;  3I57 A;  3HUI A;  4KGR A;  1SGH A;  2HJ1 A;  1V6E A;  4AJY B;  3VTV A;  2L0T A;  5D6J B;  2LRW A;  3R7R A;  1LO5 D;  3WAP A;  2LZ6 A;  4Q2J A;  5E6N A;  2AQ3 B;  4IG7 B;  1OEY A;  1XQQ A;  3NS8 A;  3HVD A;  4KDI C;  4WWN A;  4K3C A;  3O65 B;  4WAF A;  5EDS A;  1IBX A;  4ZRK A;  2R2Q A;  1D5Z C;  3UQB A;  2HTH A;  1L4Z B;  1PUT A;  1WGH A;  3PTF C;  2DLB A;  2WXR A;  5IP4 D;  5JHB A;  3URY A;  1NYQ A;  1WXQ A;  2PLP A;  1WJU A;  4ICV A;  2ZCB A;  2FUG 1;  4FJV B;  4N6E B;  1RRB A;  3DOW A;  2KC2 A;  1JRU A;  3V62 A;  2MRP A;  4NPN A;  4EZJ A;  1ZDX A;  2J4X A;  3SFE B;  1WYG A;  2LVO A;  1T5X D;  1T6B X;  3RMK C;  3Q69 A;  3M62 B;  2Y5C A;  1OEY J;  1F0Z A;  5CHW A;  4HJG E;  1KFY B;  2KAN A;  3DBL I;  3GE8 C;  3QJZ A;  3BY4 B;  1C4A A;  2RGF A;  2KDI A;  1P9D U;  4XWT A;  1OGW A;  1J7C A;  1LM8 B;  2KTF A;  4LDT D;  3S2A A;  1MHX A;  4XDD A;  4DHZ E;  1EF1 A;  4DXA B;  1KRH A;  2KMC A;  2C7M B;  2GBM A;  5L83 A;  4MM3 A;  2C7H A;  1RLF A;  1WXM A;  2PE9 A;  3ALB A;  3KLS X;  2B76 B;  4X57 B;  1L2N A;  1GC7 A;  3SR6 A;  3QWZ B;  1FCC C;  3W1S C;  1FIQ A;  1SIJ A;  2IND C;  5D7G A;  2KQS A;  3V05 A;  4FHK A;  5BMH A;  2LGY A;  1JWU D;  2KQ4 X;  1E8W A;  1QT9 A;  4HPP A;  3FIL A;  1WH3 A;  4W9E A;  4M01 A;  1Q10 A;  5CHV C;  1TKG A;  4W9F A;  3OAW A;  1OQQ A;  1DOI A;  1MG8 A;  1ROE A;  1TJE A;  1VLB A;  4K7W A;  3PZD A;  1E8X A;  2MW5 A;  2UU7 A;  1YN4 A;  3AE1 B;  2N9L A;  2BYV E;  1P7F A;  3ZJU A;  3LXF A;  2K39 A;  2Z0E B;  2HJ8 A;  3AEG B;  4M0W B;  2M1M A;  2K0P A;  4FN2 A;  1YMH E;  3MC8 A;  1WGD A;  2M19 A;  1FNW A;  3LYY A;  2QSD A;  2WXP A;  5HI1 A;  2W54 A;  3A4R A;  3AN1 A;  3QX1 A;  3VXW A;  3NVY A;  2AQ1 B;  1HEZ E;  2MP2 B;  3AE6 B;  1TZ1 A;  5E6O A;  3VDZ A;  2N7J A;  2LHD A;  4A3P A;  3HK0 A;  4KGT A;  2BB6 A;  1GC6 A;  3H9D A;  4K81 A;  4BKS D;  1TS4 A;  2PKO A;  1ISN A;  3RYT A;  5G55 A;  2C7N B;  2WDV B;  2YVC A;  1WJN A;  2K1F A;  4WH4 A;  4KZC A;  1PDX A;  2LRU A;  3E56 A;  1IYF A;  3WCQ A;  1LFD A;  4XE0 A;  1VZ8 A;  2ZVN A;  3MTN B;  3W9C B;  2ACZ B;  2FUH B;  3PSE B;  2MEK A;  5EE9 A;  4IM0 A;  3ZDT A;  1C3T A;  1L0V B;  1WMH A;  4GSW A;  4GXB A;  4CHK A;  3BIN A;  2PTL A;  3A1Q A;  5BYR A;  1T0S C;  3TBL D;  3PRZ A;  3C0R B;  1UWM A;  2ZZP B;  2LGS A;  5H8Y E;  2CHW A;  4EOY A;  2WDR B;  3ZNH B;  3VH4 B;  2O2V B;  3QQ8 B;  3P63 A;  3IXS A;  1TYG B;  3NVZ A;  4B6W A;  2L0F A;  1VZ7 A;  3VH3 B;  4NNJ B;  2D3G A;  3GB1 A;  3IT6 B;  4KSK C;  5IO9 A;  3ZRF A;  2M0X A;  3KWV A;  2Z0D B;  4P7I A;  1WYW B;  1UWX A;  1K50 A;  1MPE A;  4HCP B;  4JX1 C;  1QOB A;  4JL9 A;  2LI5 A;  5G5H A;  2LVQ A;  3TIX A;  3A9J A;  4K3B A;  1T0Q C;  3Q2A C;  4IM3 A;  3TEW A;  1YD8 U;  1C77 A;  2IZV B;  4CO7 A;  3RT3 B;  1WFY A;  5IKC M;  3ETR A;  4TSS A;  4ANX A;  4JLC A;  3DBR B;  1XO3 A;  3AV8 A;  3KWL A;  4GU2 A;  2K5P A;  2N4F A;  2LJ5 A;  1H4R A;  3X23 A;  2KAC A;  4KDL B;  2MBQ A;  5FKA C;  2J53 A;  2KX3 A;  1RWS A;  1YQB A;  1SEB D;  3ZYY X;  3H7S A;  2MBE A;  2IY1 B;  4WQM A;  1V9J A;  2IO3 B;  3A9K A;  1MVK A;  2AX5 A;  3AED B;  2KNB A;  2MX2 A;  1F9J A;  2WX0 A;  1C78 A;  1VJK A;  4O1N A;  4KV2 A;  4IKG A;  1DGJ A;  3AMZ A;  1S1Q B;  1UGJ A;  4XWW A;  3DHI C;  4W9L A;  5BMG A;  1UF0 A;  3IVF A;  3AEF B;  1YJ1 A;  4ITK A;  2FCQ A;  1B9R A;  3FAH A;  1WZ3 A;  1RAX A;  1UGM A;  4WJQ A;  2HDE A;  3H6N A;  2WQY B;  4HRO A;  1YN5 A;  3KUC B;  3ZUN A;  1I4P A;  4TMA B;  3RNG C;  2L83 A;  2W9N A;  4PT5 A;  2LD9 A;  2BS2 B;  2L76 A;  1EM7 A;  2ZPN A;  4AP4 C;  2DZJ A;  2KC1 A;  3DHG C;  3P4S B;  2KLG A;  2KLC A;  3DBS A;  2W55 A;  3ZTD A;  1I42 A;  3TEY A;  1TS3 A;  1QKZ A;  5I4D A;  4RNA A;  3R3M A;  3PZ7 A;  2V4L A;  1D5M C;  2G3Q B;  4W9D A;  1TGZ B;  3AE9 B;  5HHD G;  3ECI A;  4KIK A;  4RGN A;  2JPH A;  2YLM A;  2SAK A;  2BYE A;  3CMM B;  3PPA A;  3SDL C;  2Z8L A;  1WM2 A;  1WXS A;  2QEJ C;  2XK5 A;  4BVU C;  1V86 A;  2IO1 B;  3EFU A;  4IOI E;  1KJT A;  2V3S A;  4MDK E;  3AE4 B;  2VH1 A;  2N9X A;  4FUL A;  2KMM A;  3KUZ A;  1IUE A;  2GOW A;  3RCZ A;  3PV1 A;  2NTT A;  2DEN B;  1SE4 A;  2HE7 A;  2M8S A;  4WQO B;  4IM2 A;  3NRZ A;  4RGT A;  4YTN B;  2NPT B;  2KQ7 A;  4AQ7 A;  2JRI B;  2NCN A;  2FID A;  3NG0 A;  3V61 A;  4S17 A;  1Q0W B;  4GDK B;  1FNU A;  2QDF A;  1NI3 A;  3D32 A;  4MGK E;  3TEX A;  3Q3J A;  4WWM A;  2I38 A;  4L1B A;  1SE3 A;  1CMX B;  3BZD B;  4KX6 B;  5BYQ A;  2KFK B;  1C79 A;  4GDL A;  2JZP A;  5D3I B;  2KJ6 A;  5TSS A;  1NI2 A;  2RSU A;  3V60 A;  1YIW A;  2WS3 B;  2X38 A;  2WXG A;  4HDQ A;  3DVG Y;  2WXF A;  1K8R B;  3RPF C;  1MFW A;  2K8H A;  2E6X A;  5E6P A;  4ZRP A;  2JX5 A;  2NBV B;  1N5X A;  1Z5S B;  1BML C;  2KDE B;  3FC4 A;  1JML A;  2IJ0 A;  1V1P B;  3BVG A;  3RNB C;  1L6U A;  2AL6 A;  4IDI A;  2OED A;  1KLU D;  2KDF B;  5DPS A;  4DDI D;  4LLG M;  1XEE A;  1EU3 A;  3AH7 A;  4DXF A;  4F8C B;  1N61 A;  1R4M B;  3Q8C A;  5C2T B;  3I63 C;  1S3S G;  3ONS A;  3PLU A;  1KLG D;  1N62 A;  2DNF A;  4FJY A;  1HA5 A;  2W3R A;  4H2A A;  2MBO A;  3L17 A;  1FCL A;  3T3O A;  2BS4 B;  2ASQ A;  2JSV X;  1SJE D;  5LXH A;  3NY5 A;  1GB4 A;  5H92 C;  4BKS A;  3NZS A;  4G3X B;  3Q3M C;  3IHP C;  3DBR I;  1ZW7 A;  3U30 A;  1ZKH A;  2O6V A;  4HEA 1;  3DVN U;  2WXQ A;  3K9P B;  2LJI A;  2L1A A;  3U7Z A;  4DXG A;  2QCZ A;  2WLB A;  4ICU A;  2KWV B;  4ZDV A;  2XNA C;  1LGR A;  3LJ3 A;  4MSM B;  1D6E C;  1SB3 C;  3BK2 A;  4BFR A;  1RFK A;  4WJP A;  1WRD B;  2IYD B;  2JY6 A;  3AEE B;  2BGF A;  3LB8 C;  3ZJT A;  2ZNV B;  1XLQ A;  1YQ4 B;  2W3S A;  3AE5 B;  5J2R A;  2GLS A;  3B9J A;  5HFY A;  2DHZ A;  3BK1 A;  3SU8 X;  2N0S B;  2WGS A;  4JWU C;  3B2G A;  1OQR A;  4RH6 A;  3Q14 C;  3QHT A;  3BWU D;  2IO2 B;  2WXI A;  3L13 A;  1E7P B;  2JYE A;  4IWO A;  2I1J A;  4RM8 A;  4N9F 4;  2OJW A;  4B9K A;  2AEH A;  4K7U A;  1DOY A;  1L6V A;  3N32 A;  3U4E G;  3MFG A;  3P2B A;  1C4C A;  1CK1 A;  1JRP A;  2J0M A;  2RD0 A;  4OVV A;  3ZXR A;  4A20 A;  5EE1 A;  3TMP B;  3VR9 B;  3Q8F A;  1TTN A;  4LTU A;  3IFW B;  1I35 A;  3P4Q B;  4OZC A;  1IBX B;  3EHV A;  2KYW A;  1C76 A;  4M02 A;  4EFO A;  1UZX B;  4GMV A;  4IWQ A;  4XGA B;  4ZYN A;  3GZN B;  3PRE A;  4LNN A;  4ZOH C;  1BUI C;  1WF9 A;  3PT2 B;  1Y56 A;  2WYQ A;  5MPO A;  2WXK A;  1V8C A;  1TKE A;  2EMS A;  2VH2 A;  3L08 A;  3DPD A;  2DBY A;  4LJP B;  4P1B C;  5EE3 A;  3DBH B;  3GE3 C;  3PHX B;  4L2Y A;  3NJT A;  1E10 A;  4KSL C;  1G6J A;  2GBN A;  3DDC B;  4WJO A;  2ZJD A;  5EE0 A;  2VZK B;  1V5O A;  3HVZ A;  2LWP A;  4YSZ B;  3W2D A;  3NZU A;  3EFC A;  3TUO A;  2SEB D;  3QAR A;  3T9L A;  4MM3 B;  1WM3 A;  3CIR B;  5AZF A;  2I2Y A;  3HM6 X;  2HTM E;  2WU5 B;  3U7D A;  1AAR A;  4C7Z A;  4FA6 A;  1I4H A;  3A33 B;  4MEL A;  2AYO B;  1FM0 D;  4YXD B;  3TCA A;  5KHQ A;  5BMI A;  3FIL B;  3QAQ A;  3UI3 A;  2KKC A;  1IGC A;  3APF A;  4NJ7 A;  3B08 A;  2D3B A;  2LMC A;  3BYY B;  4AOF A;  1XLP A;  3HIZ A;  2JQR B;  2DAF A;  1UUP A;  2JXT A;  2L7R A;  4YTM B;  1ZXI A;  1XD3 B;  2JZZ A;  1R4M I;  1UD7 A;  3ZTC A;  2D3C A;  2DZI A;  3GS2 A;  2KOX A;  3ZKJ C;  2IDY A;  2QIL A;  1J8C A;  1UH6 A;  2N7E A;  3ML9 A;  3U52 E;  1WJ6 A;  4C80 A;  4US8 A;  3QK0 A;  3AU5 A;  2MQJ A;  4B95 A;  4GGQ A;  4CQN A;  1VDV A;  1N60 A;  2BQQ A;  1MJD A;  1R7S A;  1UBQ A;  2BYF A;  3DQV A;  4FXC A;  4AJW A;  2O6V D;  3M63 B;  1FFU A;  3ZQ4 A;  3I9V 1;  4I6P A;  1ZP0 B;  2PW9 A;  4FAD A;  4W9G A;  1V1O A;  2C9W B;  4DHZ B;  2KTR A;  1P7E A;  2D10 A;  2JT4 B;  4W9H A;  3W1S A;  2K22 A;  2CS4 A;  2M17 A;  4HPL B;  3NS1 A;  4RF0 A;  4GOC A;  5C3J B;  4WWP A;  3H7P B;  2FCN A;  2WU2 B;  4RMA A;  1WGK A;  4KZ0 A;  4OVZ A;  3BVZ A;  5G2N A;  1WZ0 A;  2BKF A;  2MSE D;  3HM3 A;  4MSQ B;  2QJL A;  2LGX A;  1N5W A;  3L16 A;  3KUD B;  5CTR C;  2KD0 A;  2KXJ A;  1AW7 A;  4HRS A;  1SE9 A;  1WX8 A;  4A90 A;  1WR6 E;  5HG2 A;  2KDB A;  2R2O A;  4JQW C;  1SE2 A;  1J0G A;  1WMH B;  2JWZ A;  3P1M A;  3A1Q B;  3UF8 A;  5IA7 A;  1VD2 A;  2BVC A;  2NMQ A;  1YQ3 B;  3W5V B;  4RGM A;  3NOB A;  3VUY A;  4ZRQ A;  2FCM A;  2MHJ A;  4IW0 A;  5D94 A;  2H88 B;  2J0K A;  2WHI A;  1PFD A;  4E3C A;  3T3N A;  2WP9 B;  3QCA A;  5JHA A;  2CKH B;  5GMV A;  1JWB D;  4ZRI A;  2KJR A;  1HXY D;  5BO4 B;  1UEL A;  3GOE A;  5BYS A;  3R8B A;  3NZ3 A;  2N9K A;  5LXI B;  1BXT A;  2EKE C;  3NUH B;  1DYQ A;  1L0Y B;  1ZE3 D;  4IWP A;  4R3D A;  2LUM A;  2JF5 A;  2IGG A;  1HE8 A;  4OZB A;  4YTP B;  1CJE A;  3GZN I;  3A9J B;  1TZO A;  2N7D A;  1TIF A;  2IBI B;  2ZW1 A;  4TQ1 A;  2QC8 A;  3ZLZ A;  3Q3O C;  2JRH A;  4OVU A;  4OZA A;  2BS3 B;  1EUV B;  3WAM A;  1XF5 L;  1EWY C;  2J7Q B;  3DBH I;  3U8Z A;  5DPT A;  2KT7 A;  4P16 A;  3APD A;  4A3O A;  1D3Z A;  1FRR A;  1T0Y A;  4AUQ C;  1GOZ A;  1HTO A;  2J42 A;  4GB9 A;  3A9K B;  2PIA A;  4DHJ B;  1FXI A;  4PYU A;  3AEA B;  1JAL A;  2R61 A;  2ON8 A;  4GLS C;  4NJ6 A;  4URK A;  1B1Z A;  3ZRC A;  4JIO U;  1XLN A;  2EKI A;  5CHF A;  3M3J A;  4MT5 A;  3VUX A;  1I4X A;  3DHH C;  1WGY A;  3SD5 A;  3SFD B;  2KZR A;  2K6D B;  1KF6 B;  3AB5 A;  4NAW A;  2ZPY A;  1J7A A;  2PJH A;  1VCB A;  4I6L B;  2QHO A;  4B0M A;  3UIP B;  1RFA A;  4DWF A;  3MHS D;  4ASW C;  5JZE B;  2KWC A;  3JSV A;  4BOS C;  2RDG A;  2LHE A;  3BVM A;  3PZ8 A;  3I5J C;  3QA8 A;  1FO4 A;  4BBN C;  2CHX A;  4TQ0 A;  1WWT A;  4AWJ A;  2KVZ A;  2WDQ B;  2N1V A;  4MEM A;  3ZVV A;  5FK9 C;  3DWM A;  3WAN A;  3APC A;  2WXM A;  1WR1 A;  3VQI A;  4GN1 A;  2ZW0 A;  3AE2 B;  2NBU A;  2EMT A;  2V3N A;  3WAL A;  2KFJ A;  3Q3F A;  3VTU A;  4PK1 A;  5AUK A;  1XCQ L;  2AWT A;  2JYT A;  4KIK B;  1H8C A;  1UBI A;  3ZDM C;  1P1A A;  2IGD A;  1AYF A;  2RDB C;  2KN4 A;  2UWQ A;  3CF6 E;  1UNS A;  2D2Q A;  2XK5 B;  4I6N B;  4AS1 A;  4E74 A;  1V49 A;  2FE8 A;  2CHZ A;  2CR5 A;  1TKY A;  1WE7 A;  4DK5 A;  1IGD A;  2ZNV C;  3RD2 A;  3ZJV A;  4MJS A;  4GIV A;  1E7V A;  1I4Q A;  2WXL A;  4LDT B;  3NVV A;  1CZP A;  3MP9 A;  3Q3N C;  2LGI A;  4NJC A;  2N9E B;  4LCD E;  1JWS D;  1YJJ A;  2MJ3 A;  1FPY A;  3P42 A;  4A6Q A;  1STE A;  1QLB B;  5IOI A;  2Y3A A;  5DCN A;  1F2R I;  4XYC A;  1QQR A;  4KKI A;  3RZF A;  2M4N A;  2BF8 B;  1K53 A;  4KGS A;  4GDL B;  2A4Z A;  2GBR A;  4G11 A;  3Q6B A;  4IUM B;  3IBE A;  2GB1 A;  2YEP F;  2L3Z A;  3DCG A;  4LNK A;  5C1Z A;  4IC7 B;  2MBH A;  3AEB B;  4DQO C;  4C4V A;  1FNV A;  2Q5W D;  1OTR B;  1EWC A;  1HZ5 A;  1T0R C;  1E8Y A;  1BT0 A;  3VR8 B;  1D5X C;  1GNU A;  3L10 B;  4BKG A;  2Y5B B;  4G50 A;  1F1H A;  3TSS A;  1ACC A;  3EGR A;  4EEW A;  2FCS A;  1PGA A;  1QIL A;  3AM9 A;  3RZW C;  1GB1 A;  1C4P A;  4TKN A;  4PS3 A;  2GMI C;  4F1S A;  4OHJ A;  4L23 A;  1I4R A;  2CU3 A;  3FKY A;  2X8X X;  1TY0 A;  5KHO A;  3AXC A;  3BYT B;  1F77 A;  1TS5 A;  2IGH A;  3B2F A;  3IT4 B;  1TT5 B;  4XX5 A;  4MH8 A;  2DYM A;  3OWE B;  4TV3 A;  3VAW A;  1QOF A;  1JCK B;  2GRI A;  4S0R A;  3N1Y C;  2MJE A;  4HXD A;  2O6V B;  3KW5 B;  1PGX A;  2D5G A;  4ZHO A;  5IN7 A;  3A4S C;  1ESF A;  4ZRJ A;  1V97 A;  4YWG G;  3ZGZ A;  3AUL A;  1X1M A;  3AEC B;  1V2Y A;  2FNJ B;  1ZGU B;  4PS7 A;  1ENF A;  3RFZ B;  4A55 A;  5JXV A;  3DVN V;  4HK2 A;  1EU4 A;  4EZL A;  3R2I A; 
#chains in the Genus database with same CATH homology
 2K8C A;  2KX3 A;  1YQB A;  5L95 C;  3H7S A;  1XD3 B;  3PGE A;  2JZZ A;  2MBE A;  2IY1 B;  4HWI B;  1R4M I;  1V9J A;  2IO3 B;  1UD7 A;  3K9O B;  4K1R B;  4XZ4 A;  3ZTC A;  4EUT A;  2RPQ A;  3A9K A;  2DZI A;  2KOX A;  3ZKJ C;  2DAJ A;  2JUO A;  1J8C A;  2KNB A;  2MX2 A;  1F9J A;  1UH6 A;  1WXA A;  1U4A A;  1YX6 B;  2N7E A;  2C60 A;  2WX0 A;  2C5L C;  3ML9 A;  1WJ6 A;  4HCN B;  3QK0 A;  1J19 A;  4KV2 A;  3JVZ X;  3AU5 A;  4MJS B;  2MQJ A;  4F7Z A;  4B95 A;  3UIO B;  4GGQ A;  1S1Q B;  2N9P C;  1UBQ A;  2BYF A;  3DQV A;  4AJW A;  2O6V D;  4W9L A;  3M63 B;  3AU4 A;  2N1W A;  1FXT B;  1YX5 B;  3IVF A;  5J17 A;  4I6P A;  2WDT B;  1YJ1 A;  4LJO B;  4PS8 A;  1WXV A;  3OLM D;  3VTW A;  2UYZ B;  4FAD A;  2IY0 B;  2PE6 B;  2FCQ A;  4W9G A;  3PS6 A;  2LAS A;  3TJP A;  1WZ3 A;  1RAX A;  2FAZ A;  1UGM A;  2C9W B;  2LXA A;  4WJQ A;  4DHZ B;  2KTR A;  2D10 A;  2JT4 B;  4W9H A;  1EF5 A;  1SIF A;  3JW0 X;  3W1S A;  3CSF A;  3L0W B;  3H6N A;  2L8J A;  1V81 A;  2V1Y A;  2MLB A;  2D07 B;  5LLI A;  2CS4 A;  2M17 A;  3KUC B;  3B1L X;  3CST A;  3NHE B;  4HPL B;  4WJN A;  2MA9 B;  3ZUN A;  4FBJ B;  4KVG B;  3VUW A;  4GOC A;  1WGG A;  4W9I A;  1QZE A;  5FR6 A;  2W9N A;  2XBB C;  4WWP A;  1E90 A;  3I3T B;  3H7P B;  2FCN A;  2ZEQ A;  2LD9 A;  3KYC D;  3ZNI D;  4RMA A;  4HLE A;  2L76 A;  3VVW B;  2ZPN A;  5DPR A;  4KZ0 A;  4MH0 E;  3WA0 A;  4AP4 C;  1WE6 A;  3ZIM A;  2DZJ A;  2KC1 A;  5G2N A;  1WZ0 A;  2BKF A;  2DYO A;  2DZM A;  2ZVO A;  2MSE D;  3HM3 A;  3B0A A;  2D11 A;  2WX1 A;  4MSQ B;  2LGX A;  1IPG A;  2G45 B;  2KLG A;  4WWO A;  3L16 A;  1M94 A;  2KLC A;  2OOB B;  1TBE A;  3DBS A;  2G4S A;  2WWZ A;  3ZTD A;  3KUD B;  1I42 A;  5CTR C;  2KD0 A;  2KXJ A;  1WIA A;  3R3M A;  3ENE A;  2J0J A;  1SE9 A;  3L54 A;  1WX8 A;  4BOZ B;  1WR6 E;  3M95 A;  2V4L A;  2XEW A;  2KDB A;  2REX A;  3EEC A;  2G3Q B;  4W9D A;  2R2O A;  4JQW C;  2KO3 A;  1PQS A;  4E71 A;  1J0G A;  1TGZ B;  1WMH B;  2JWZ A;  3QIJ A;  2G4D B;  3A1Q B;  3UF8 A;  5IA7 A;  3QC8 B;  3ECI A;  1VD2 A;  3HHM A;  1WJ4 A;  4KIK A;  1C1Y B;  2JPH A;  2YLM A;  4EKU A;  2B3A A;  2NR2 A;  4HJK A;  3UGB B;  2BYE A;  3CMM B;  3PPA A;  3SDL C;  1WM2 A;  1P0R A;  1WXS A;  3NOB A;  3VUY A;  5JH5 C;  1L7Y A;  2FCM A;  2KJH B;  2XK5 A;  4BVU C;  1V86 A;  4NQK E;  4IW0 A;  2IO1 B;  3V6E B;  5HKH A;  3EFU A;  5D94 A;  4DHJ D;  2J0K A;  4BKT A;  1KJT A;  2V3S A;  4MDK E;  1A5R A;  2KN5 A;  4E3C A;  4M8M A;  3PRP B;  3QCA A;  1V5T A;  2DYB A;  2LGD A;  1E8Z A;  2N9X A;  5DPW A;  4FUL A;  3KUZ A;  5JHA A;  1Q1O A;  2VRR B;  2JVC A;  2CKH B;  2GOW A;  3RCZ A;  5GMV A;  2BWE S;  4HPM B;  4ZRI A;  1LQB A;  3PV1 A;  2KJR A;  2DEN B;  1WGR A;  2HE7 A;  2M8S A;  3PRM B;  5BO4 B;  4WQO B;  1UEL A;  3GOE A;  1EO6 A;  4IM2 A;  5LXI B;  1SGH A;  2EKE C;  4IWP A;  1V6E A;  2MP2 A;  2NPT B;  2KQ7 A;  4AJY B;  2JRI B;  2NCN A;  2FID A;  2L0T A;  3VTV A;  2LUE A;  3V61 A;  1Q0W B;  4GDK B;  2JF5 A;  5J18 A;  3KVF B;  5D6J B;  2LRW A;  3R7R A;  3WAP A;  1HE8 A;  2K8B A;  2LZ6 A;  3D32 A;  5E6N A;  4MGK E;  3Q3J A;  4DBG A;  5AZH A;  3GZN I;  3A9J B;  4RM9 A;  4IG7 B;  2N7D A;  4W9K A;  1OEY A;  1XQQ A;  3NS8 A;  1CMX B;  4G0N B;  4KDI C;  4WWN A;  2IBI B;  2KFK B;  4II2 B;  3T8M A;  4CYE A;  4TQ1 A;  3O65 B;  4GDL A;  4J6I A;  5EDS A;  3ZLZ A;  4ZRK A;  1E5W A;  3AI5 A;  2KJ6 A;  2R2Q A;  3UQB A;  2HTH A;  2JRH A;  4OVU A;  1NI2 A;  2BKR B;  2RSU A;  4WAA A;  3V60 A;  1YIW A;  1WGH A;  3PTF C;  3PLV A;  1EUV B;  1Y8R C;  3WAM A;  5JHB A;  4HDQ A;  1LXD A;  3DVG Y;  2DX5 B;  1K8R B;  1WJU A;  2J7Q B;  3DBH I;  4ICV A;  3U8Z A;  5DPT A;  2ZCB A;  4FJV B;  2K8H A;  1RRB A;  5E6P A;  3APD A;  2KWU B;  3DOW A;  2NBV B;  3UQA A;  4A3O A;  1D3Z A;  1Z5S B;  2KC2 A;  1JRU A;  2KDE B;  1T0Y A;  2MRP A;  3V62 A;  4AUQ C;  4NPN A;  3H7P A;  1WI0 A;  4EZJ A;  4TUU A;  4GB9 A;  3A9K B;  3KH0 A;  2LVO A;  4DHJ B;  3ZNZ B;  4JGH B;  3PVL A;  4PYU A;  2AL6 A;  2DZK A;  4BBN F;  1Q5W B;  3M62 B;  3OJ4 B;  3RUL A;  2KDF B;  5DPS A;  1NBF C;  1OEY J;  4NJ6 A;  4DDI D;  4URK A;  5CHW A;  3ZRC A;  4JIO U;  2KAN A;  3LDZ E;  3DBL I;  3QJZ A;  3BY4 B;  5CHF A;  3M3J A;  2L05 A;  3VUX A;  2O2V A;  2RGF A;  1XT9 B;  2KDI A;  2LVP A;  1P9D U;  4ANV A;  1WGY A;  4F8C B;  3SD5 A;  4YL8 A;  2KZR A;  2K6D B;  4NAW A;  1OGW A;  4K7S A;  1LM8 B;  1S3S G;  2KTF A;  2ZPY A;  4LDT D;  4W9C A;  3ONS A;  3PLU A;  3S2A A;  3ZO5 B;  4DHZ E;  1EF1 A;  2PJH A;  4DXA B;  4FJY A;  2KMC A;  2C7M B;  1VCB A;  2GBM A;  4I6L B;  5L83 A;  2MBO A;  3L17 A;  2C7H A;  2KTR B;  2K6Q A;  2QHO A;  4MM3 A;  3UIP B;  1WXM A;  1RLF A;  1RFA A;  4DWF A;  2PE9 A;  3ALB A;  2ASQ A;  4X57 B;  1L2N A;  3MHS D;  4ASW C;  3PHW B;  2RR9 A;  1GC7 A;  5LXH A;  3NY5 A;  3QWZ B;  5JZE B;  3R7Q A;  4BKS A;  3NZS A;  2KWC A;  3JSV A;  4G3X B;  3ZW3 A;  4FLH A;  3W1S C;  3JYU A;  4BOS C;  2BPS A;  3IHP C;  3DBR I;  3QA8 A;  5D7G A;  2KQS A;  1ZW7 A;  4FHK A;  4BBN C;  2ZCC A;  3U30 A;  2LGY A;  1ZKH A;  2CHX A;  2O6V A;  3H1U A;  4TQ0 A;  3TL5 A;  3DVN U;  3K9P B;  1E8W A;  4AWJ A;  2N1V A;  1WH3 A;  4W9E A;  4MEM A;  4ICU A;  3ZVV A;  3W1Y A;  5CHV C;  1NDD A;  2KWV B;  1GUA B;  4ZDV A;  3WAN A;  5AZG A;  4W9F A;  3APC A;  1V80 A;  3OAW A;  1WR1 A;  1MG8 A;  3LJ3 A;  4MSM B;  4W9J A;  1GG3 A;  4NY0 A;  5CX3 A;  4GN1 A;  3VQI A;  2K25 A;  4BFR A;  2NBU A;  2EMT A;  3WAL A;  2KFJ A;  2KHW B;  3Q3F A;  4K7W A;  3VTU A;  3PZD A;  2AWT A;  4WJP A;  1E8X A;  4KIK B;  5D2M B;  1UBI A;  3ZDM C;  1H8C A;  2MW5 A;  1WRD B;  1P1A A;  2IYD B;  2JY6 A;  2BGF A;  3N3K B;  5IAA C;  2UWQ A;  2BYV E;  2KX0 A;  3CF6 E;  2ZNV B;  2D2Q A;  2XK5 B;  4I6N B;  2NS5 A;  4E74 A;  1V49 A;  5J2R A;  3V6C B;  2CHZ A;  2K39 A;  2Z0E B;  2HJ8 A;  2CR5 A;  2DHZ A;  1WE7 A;  4DK5 A;  2ZNV C;  3RD2 A;  2PEA A;  2M1M A;  4M0W B;  4MJS A;  3SU8 X;  4FN2 A;  4GIV A;  1E7V A;  1WGD A;  3RUI B;  1WX9 A;  4LDT B;  4ANW A;  3QHT A;  2IO2 B;  3X0W A;  3A4R A;  3QX1 A;  2NVU I;  3L13 A;  3VXW A;  2N9E B;  4LCD E;  4IWO A;  1KLV A;  2I1J A;  2L00 B;  4RM8 A;  4N9F 4;  2MP2 B;  2IO0 B;  3N30 A;  1TZ1 A;  4B9K A;  5E6O A;  2AEH A;  4K7U A;  2KK8 A;  1P3Q U;  3VDZ A;  2Z59 B;  3DVG X;  1GJZ A;  3N32 A;  4A3P A;  1E7U A;  3HK0 A;  2A5U A;  3WIM A;  3P2B A;  5DCN A;  4EZK A;  2J0M A;  2RD0 A;  2CU1 A;  1GC6 A;  4OVV A;  2NBW B;  3RZF A;  3H9D A;  4K81 A;  2HD5 B;  4A20 A;  4BKS D;  1R4N I;  3TMP B;  2M4N A;  3R66 C;  1ISN A;  1TTN A;  3RYT A;  2JZ3 B;  3IFW B;  5G55 A;  2BF8 B;  2C7N B;  3EC8 A;  2YVC A;  1I35 A;  2GBJ A;  4GDL B;  1WJN A;  2K1F A;  3UIN B;  2A4Z A;  2GBR A;  4MGI E;  3EHV A;  4KZC A;  2I1K A;  2LRU A;  4MGY E;  1Z2M A;  2MCN B;  4EFO A;  1WX7 A;  4G11 A;  1IYF A;  1UZX B;  4GMV A;  4IWQ A;  4ZYN A;  1LFD A;  2AL3 A;  2ZVN A;  3MTN B;  4DDG D;  3PSE B;  2FUH B;  3IBE A;  4IUM B;  3PRE A;  3SHQ A;  4II3 B;  4HVB A;  2L3Z A;  1WF9 A;  3DCG A;  4IM0 A;  3ZDT A;  1C3T A;  3ML8 A;  3PT2 B;  5C1Z A;  1WMH A;  4GSW A;  4GXB A;  4MGZ E;  4CHK A;  3BIN A;  4IC7 B;  3A1Q A;  2MBH A;  1KM7 A;  3TBL D;  2WYQ A;  3OJ3 A;  1IP9 A;  3PRZ A;  2EMS A;  3VHT C;  2PPH A;  5TR5 A;  1OTR B;  3L08 A;  3VFK A;  3C0R B;  3DPD A;  1P98 A;  3IG3 A;  4LJP B;  1E8Y A;  1WY8 A;  1BT0 A;  2ZZP B;  4XC2 A;  1GNU A;  1KOT A;  3L10 B;  2CHW A;  4BKG A;  4EOY A;  2Y5B B;  3PHX B;  4G50 A;  1OQY A;  3ZNH B;  2GBK A;  4FHJ A;  4KSL C;  2O2V B;  3VH4 B;  1G6J A;  4EEW A;  2GBN A;  2FCS A;  3DDC B;  2KMA A;  3QQ8 B;  2ZJD A;  4WJO A;  3RZW C;  2FIF A;  1V5O A;  4NAW B;  4TKN A;  2LWP A;  4PS3 A;  2GMI C;  3NZU A;  4F1S A;  4B6W A;  2L0F A;  3WAO A;  3QAR A;  3T9L A;  3VH3 B;  4NNJ B;  2D3G A;  2NPT A;  1WM3 A;  4KSK C;  3AXC A;  5AZF A;  5KHO A;  3ZRF A;  4PYZ A;  3HM6 X;  2KVR A;  2M0X A;  2Z0D B;  4GDK A;  4P7I A;  1WYW B;  4XX5 A;  2DYM A;  4TV3 A;  3JSV B;  3U7D A;  3VAW A;  4HCP B;  1AAR A;  4HDO A;  4FA6 A;  3MJW A;  4JL9 A;  3A33 B;  4NQL B;  2LI5 A;  2LXC A;  4MEL A;  2AYO B;  2LVQ A;  3A9J A;  3TIX A;  4HXD A;  2O6V B;  3KW5 B;  3TCA A;  4IM3 A;  2KFK A;  1YD8 U;  3A4S C;  5KHQ A;  4ZRJ A;  2IZV B;  3QAQ A;  5C23 A;  4CO7 A;  2KKC A;  3ZNG C;  3APF A;  4NJ7 A;  3AUL A;  3RT3 B;  4M8N A;  2MBB B;  2JXX A;  3B08 A;  1WFY A;  1X1M A;  4AOF A;  2BWF A;  3HIZ A;  4FJZ A;  1V2Y A;  2DAF A;  2FNJ B;  3KYD D;  2MWS B;  4ANU A;  4JLC A;  4ANX A;  1ZGU B;  4PS7 A;  4GU2 A;  3DVN V;  2N4F A;  2LJ5 A;  1H4R A;  4HK2 A;  2L7R A;  4EZL A;  3X23 A;  5AEK B;  2OJR A;  4KDL B;  2MBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...