2N7EA

Solution structure of the ubl domain of yeast ddi1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
HIEGRHMDLTISNELTGEIYGPIEVSEDMALTDLIALLQADCGFDKTKHDLYYNMDILDSNRTQSLKELGLKTDDLLLIRGKISNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA damage-inducible protein 1
publication title Structural studies of the yeast DNA damage-inducible protein Ddi1 reveal domain architecture of this eukaryotic protein family.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
total genus 18
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2015-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2n7eA00
2HE7A 2MLBA 3BY4B 2KDFB 1JRUA 2KXJA 2MBOA 3NHEB 2YVCA 3MTNB 4DHJD 5CHVC 2ZCBA 2WX1A 3DOWA 3V6CB 1CMXB 1BT0A 2MWSB 4ASWC 5AEKB 3TIXA 1ISNA 5LLIA 5D2MB 4PYZA 3ZLZA 2LASA 1LXDA 3SDLC 1S1QB 2K8HA 1XT9B 2G3QB 3TMPB 4HDQA 2ZPYA 1TGZB 2NPTB 2QHOA 3PREA 2D3GA 4IC7B 3H7PB 4DDGD 5IA7A 3PRMB 1C1YB 2L0FA 3QAQA 2N9EB 2KFKB 3D32A 3UQBA 5JHAA 1AARA 2BWES 1WIAA 2JZZA 5DPWA 4NY0A 1TZ1A 2J7QB 4ZRJA 3JW0X 1WR1A 5IAAC 1E7UA 1WXMA 1IP9A 3L0WB 4TUUA 2BKFA 3L54A 2MCNB 3RT3B 3ZDTA 2O6VB 2O2VB 3Q3JA 1WH3A 5C1ZA 5J17A 4IM3A 2BWFA 4FA6A 2BYVE 2LXCA 3AXCA 2FIDA 4GB9A 5CTRC 1I42A 4WWOA 5AZGA 1YX5B 2M4NA 3APDA 3K9OB 4KIKA 4MGIE 3U30A 1X1MA 3VQIA 2KC1A 2WDTB 2KLGA 3TJPA 3WA0A 3DVNU 2Z0DB 1WY8A 1XQQA 3KUDB 4AWJA 1F9JA 2KQSA 3PHWB 2KDBA 2G4SA 4HJKA 2K1FA 2WWZA 2GBNA 2KZRA 2LGXA 1ZGUB 2ZZPB 4EUTA 2FCMA 4BFRA 2L05A 2N7EA 2DZJA 1WJ6A 3ECIA 1U4AA 1K8RB 1P98A 2L0TA 3L13A 2L8JA 2MBHA 3PV1A 3NS8A 2NPTA 2ZVOA 3IHPC 1YX6B 1NI2A 1P1AA 2BKRB 4WWPA 2DZMA 3DBRI 3H7PA 5LXIB 2LUEA 3AU5A 3RULA 4I6LB 1OTRB 2LVOA 4K81A 2XEWA 2NBVB 3VFKA 3ZVVA 2AWTA 2PEAA 3HK0A 4GDLB 1WGGA 3ZNZB 2L00B 4A20A 2K25A 1E8WA 3ZTCA 2MRPA 3DVGY 2JVCA 3UGBB 2M17A 2G4DB 3DQVA 3QC8B 3EC8A 3R66C 4MEMA 4HCPB 3VHTC 2HD5B 4CO7A 4TQ1A 2O6VA 2O2VA 1GC7A 1EO6A 3QARA 4LDTD 5E6OA 4B9KA 2GBJA 3VUYA 3LJ3A 1R4MI 1KM7A 1E5WA 2CHXA 4DDID 2DAJA 1WI0A 1VD2A 2JXXA 2C7MB 2RSUA 3VH3B 4DK5A 3VUWA 3PRZA 2FAZA 2BF8B 3B0AA 2KHWB 3ZTDA 1WJNA 1WMHA 5TR5A 4DXAB 4ZDVA 2LWPA 2DYOA 3PSEB 2KWVB 4LDTB 2IY1B 2KN5A 3M62B 4ANUA 3WAMA 5EDSA 3SU8X 2R2QA 3V6EB 1EF1A 1TBEA 4XX5A 1D3ZA 1Y8RC 3VH4B 3PS6A 2C60A 2KDIA 3I3TB 2YLMA 2ZNVB 2M8SA 4GDKA 3ZKJC 4KSLC 4XC2A 3AI5A 4RMAA 4BOSC 2K6QA 3APFA 4IWPA 1C3TA 4GDLA 4K1RB 2CHZA 2OJRA 1EF5A 1V9JA 1UBIA 5KHQA 1WX9A 2C5LC 5G2NA 2CKHB 4F1SA 2V4LA 2IZVB 3PLVA 2JF5A 2FCQA 4HK2A 2LGYA 5DCNA 2G45B 2D10A 2IYDB 2KTRA 4W9KA 2DZKA 4JIOU 4PS3A 1I35A 1E7VA 4P7IA 5C23A 2D07B 3ZRFA 2KO3A 3GOEA 2J0JA 3H9DA 3VTWA 2EMSA 2NS5A 4HPMB 3MJWA 3WALA 1WJUA 1GG3A 1WGRA 4F7ZA 3JSVA 1NDDA 1OQYA 3NY5A 4NJ6A 3ALBA 4MSMB 4DHZB 4X57B 1EUVB 1LFDA 3A1QA 2KMCA 2JWZA 1PQSA 2JY6A 4GIVA 5KHOA 4AJYB 2C7HA 4LJPB 2O6VD 3ZNID 4W9LA 3PPAA 4EFOA 1OEYA 4IW0A 2LVPA 3RD2A 2ZCCA 3KH0A 3DBLI 3ZRCA 4JLCA 3MHSD 1WM2A 5D94A 3M95A 4EEWA 4HVBA 3KYDD 1WX7A 4ZYNA 3ZUNA 2NBUA 4NQLB 5AZFA 2D2QA 3ONSA 4W9FA 4AOFA 3TBLD 2AL3A 3V60A 4E71A 1V5TA 3DBHI 1V80A 3DCGA 5CHWA 3KYCD 3WIMA 4ANXA 3BINA 3EECA 3IFWB 4E74A 2XK5A 2DYBA 3Q3FA 4DBGA 1Z5SB 4HLEA 2FCNA 1YQBA 2PE6B 4ICUA 4W9JA 4GN1A 2MBEA 3PLUA 3ML9A 3VXWA 4JL9A 4W9DA 3QA8A 4HCNB 2HTHA 2M0XA 1UGMA 4M8NA 1V49A 1WGDA 1WMHB 3A9JA 1GC6A 4GMVA 1E8ZA 3KUZA 2JUOA 4M8MA 3HM6X 1OEYJ 1RLFA 3HHMA 4I6PA 2MA9B 4G0NB 3SD5A 4N9F4 3UF8A 2BGFA 2V3SA 4GSWA 2KJHB 4ICVA 4GDKB 3N3KB 1E8YA 3LDZE 5L95C 3EFUA 3TCAA 2UWQA 2ZPNA 4IM0A 4G50A 1WJ4A 1P0RA 2KTFA 2N1WA 3L16A 1YD8U 4II3B 5JHBA 4FADA 1J8CA 4K7SA 1E8XA 3EHVA 4AUQC 4W9HA 1SE9A 2A5UA 4EKUA 4MGZE 3HM3A 2WX0A 1G6JA 2KTRB 4BKSA 2NR2A 4HDOA 3DVGX 4KSKC 2DAFA 3L17A 3RYTA 2L76A 1Z2MA 1KJTA 1T0YA 5E6NA 4MH0E 4BOZB 4MJSA 3PVLA 1OGWA 2I1JA 2K39A 4MM3A 3X0WA 3JYUA 3QQ8B 3A4SC 3JSVB 3NOBA 1WRDB 2OOBB 3R7QA 3ENEA 3ZDMC 2FCSA 2LRWA 1RFAA 2BYFA 3IG3A 3DBSA 3WAPA 2KOXA 1Q5WB 4MELA 5DPRA 3A1QB 1SIFA 4KZCA 3OJ3A 4J6IA 2I1KA 5BO4B 2HJ8A 2LZ6A 1A5RA 3N30A 4B95A 4GU2A 3CMMB 2FNJB 2KKCA 4TV3A 4IWQA 2IO1B 2KVRA 3H6NA 2GMIC 4KV2A 2IO0B 2C9WB 2KJ6A 3H1UA 4M0WB 1J0GA 2JRHA 4NNJB 4JQWC 1V81A 2KFJA 1WYWB 4W9GA 3U8ZA 1KOTA 4OVUA 2B3AA 2RGFA 3GZNI 4PS8A 3X23A 1WZ3A 3RUIB 5LXHA 4ZRKA 2KWCA 2W9NA 2CR5A 3CF6E 4WAAA 3ZW3A 2GBRA 1LQBA 1Q0WB 3ZNHB 1J19A 4FULA 2XK5B 2VRRB 4IM2A 2KANA 4OVVA 2R2OA 4ANWA 1YJ1A 1E90A 4KDLB 3N32A 2J0KA 2DX5B 2AL6A 2RR9A 2A4ZA 2ASQA 3HIZA 2K8CA 5G55A 2N9XA 2LI5A 1S3SG 4NAWA 2UYZB 3QHTA 1WE6A 3UQAA 1WM3A 3B08A 3R7RA 1P3QU 3PTFC 3A9JB 1P9DU 3B1LX 4ANVA 4MSQB 2CS4A 3CSTA 1UZXB 4WQOB 3O65B 1IYFA 4BKSD 4FHJA 4NJ7A 4WJOA 1WE7A 4DHZE 3NZUA 2V1YA 2REXA 3M3JA 1L2NA 4A3OA 2LD9A 3PGEA 5JZEB 5J18A 3OAWA 4LJOB 3L10B 2IO3B 4JGHB 2CHWA 2JT4B 1H8CA 4E3CA 1H4RA 2DYMA 3QIJA 1WFYA 2L3ZA 2IY0B 2PE9A 3T8MA 5HKHA 2JPHA 4HPLB 4BBNF 2MP2A 4HWIB 4KZ0A 2GBMA 2LRUA 3A9KA 2EMTA 4RM9A 1M94A 3L08A 1WZ0A 4K7WA 1WX8A 2NBWB 4G3XB 5DPSA 4ZRIA 4EZKA 4MJSB 4I6NB 4FLHA 5D6JB 3OLMD 4TKNA 4CYEA 4DHJB 2ZEQA 3AULA 3UIPB 2KX3A 3R3MA 1LM8B 1RAXA 2Z59B 3QJZA 5E6PA 3VDZA 4EZLA 4MDKE 2KWUB 3RCZA 3VUXA 4G11A 2KX0A 2M1MA 1R4NI 2N9PC 2JZ3B 2NCNA 4II2B 4LCDE 3V61A 5D7GA 3JVZX 4KDIC 1WXSA 2AEHA 2WYQA 3RZFA 1HE8A 2L7RA 2MW5A 2DENB 2DHZA 4HXDA 2FUHB 2K6DB 4FJVB 2BPSA 1V86A 1IPGA 4MGYE 4WWNA 3AU4A 4GXBA 3VVWB 1UH6A 3A33B 3DPDA 4K7UA 3PZDA 5DPTA 2BYEA 1V6EA 2PPHA 3W1YA 3U7DA 3RZWC 3P2BA 2KDEB 3K9PB 4FHKA 2GBKA 4AJWA 2MX2A 3IBEA 4PS7A 1RRBA 2JRIB 2KK8A 3C0RB 4NQKE 5AZHA 4XZ4A 2N1VA 1KLVA 3VAWA 2FIFA 3TL5A 1MG8A 1NBFC 3QWZB 5GMVA 4W9IA 3WANA 4TQ0A 3VTVA 1WGHA 3M63B 2KFKA 3NZSA 4F8CB 1YIWA 4FN2A 3PT2B 4NAWB 3PRPB 4FJZA 2KJRA 2LGDA 3PHXB 2KMAA 1GJZA 4BVUC 2C7NB 1GUAB 2GOWA 3W1SC 4CHKA 4EZJA 2RPQA 3ZIMA 1TTNA 4PYUA 2MBBB 4B6WA 2RD0A 2Z0EB 4KVGB 3UIOB 4IG7B 2Y5BB 4NPNA 1GNUA 4GOCA 4W9CA 4IWOA 4RM8A 1ZKHA 5JH5C 2LXAA 2ZJDA 4WJPA 4W9EA 2XBBC 4GGQA 4URKA 3APCA 3H7SA 4BKGA 3SHQA 3V62A 4YL8A 3A4RA 2AYOB 2J0MA 3QX1A 3VTUA 2LVQA 2KC2A 2MQJA 5CX3A 4IUMB 4A3PA 1WR6E 3ZNGC 1V5OA 2MP2B 1FXTB 4FJYA 1V2YA 3A9KB 4DWFA 2CU1A 4WJQA 4EOYA 2DZIA 3QCAA 4FBJB 4BKTA 1VCBA 2MSED 2KLCA 2LJ5A 5CHFA 4MGKE 3T9LA 3WAOA 4BBNC 1WXVA 5L83A 2KQ7A 2D11A 3OJ4B 3W1SA 1QZEA 3S2AA 2KD0A 2MBQA 3ML8A 1WXAA 2IBIB 3KVFB 2N7DA 4AP4C 3KUCB 2K8BA 1XD3B 1WGYA 3CSFA 3DVNV 1SGHA 1UBQA 1UD7A 4WJNA 2KNBA 2NVUI 5J2RA 3IVFA 3UINB 1Q1OA 2PJHA 3QK0A 2EKEC 3DDCB 1L7YA 5FR6A 2ZNVC 3ZO5B 2N4FA 3KW5B 2IO2B 1UELA 1ZW7A 4KIKB 1WF9A 2ZVNA
chains in the Genus database with same CATH superfamily
4M02A 3NHEB 2YVCA 1XLPA 3V6CB 2MWSB 1BT0A 4ASWC 4NZLB 4PYZA 3SDLC 1S1QB 2K8HA 4ZYSA 1DOYA 2G3QB 3TMPB 2K9XA 1C78A 2NPTB 1SEBD 1OFFA 3QAQA 1UWXA 2N9EB 2KFKB 3D32A 1DOIA 5JHAA 1EWYC 2BWES 3UQBA 3LYYA 2DLBA 1BXTA 3LXFA 4REZA 4LNKA 3P4QB 3HRDD 1E7UA 3L0WB 4AQ7A 3L54A 1WH3A 5J17A 3RMKC 2FIDA 5CTRC 3U30A 3VQIA 2KC1A 1NYQA 2Z0DB 3DVNU 2HJ1A 3O13A 3PO0A 1JROA 5BMGA 4AWJA 3B9JA 2INPE 2GBNA 4XDDA 2ZZPB 3EA6A 4C4VA 3ECIA 1K8RB 2MBHA 3N1XC 2M56B 3PV1A 1NI2A 1P1AA 2WXIA 1ZOYB 4I6LB 1OTRB 4K81A 1V1OA 2AWTA 2PEAA 1WGGA 3ZJTA 3RN9C 2L00B 2K25A 1IGCA 3DVGY 2JVCA 2IJ0A 3QC8B 3VHTC 4CO7A 1GC7A 1EO6A 5E6OA 1C9FA 5BMIA 2GBJA 1HEZE 3LJ3A 2WGSA 1WI0A 1VD2A 2JXXA 2RSUA 2WXPA 3VH3B 2G1EA 4RGTA 3PRZA 1KFYB 2FE8A 1WMHA 3E56A 4KKIA 2LWPA 3PSEB 2KWVB 3M62B 4XDCA 3SU8X 2R2QA 2JX5A 2E6XA 3VH4B 3PS6A 3I3TB 4GDKA 2M8SA 3ZKJC 3TUOA 1WXQA 2WP9B 2L1AA 1T3QA 3W5VB 2WXJA 2K6QA 3APFA 5FR3A 4HRSA 1C3TA 4GDLA 1FRRA 1FNWA 1WX9A 2CKHB 5EE3A 2JF5A 2BTEA 4WIPA 2D10A 2DZKA 4PS3A 1I35A 1ACCA 2D07B 1EWCA 3GOEA 2NS5A 4HPMB 1WGRA 4F7ZA 3BVZA 1V1PA 3NY5A 3NJTA 4MSMB 1LFDA 3FKYA 1ZXIA 2KMCA 2DWQA 2JWZA 2Z8LA 4LJPB 1OQQA 5G5HA 3PPAA 3P1MA 4IW0A 3DBLI 3KYDD 1CJEA 5AZFA 1MVKA 4W9FA 1QOFA 1TJEA 4A9AA 3V60A 1V5TA 3GP7A 2D5GA 4E74A 4WAFA 3ZGZA 3Q3FA 1FEHA 4JL9A 1NI3A 1TZOA 3J9CA 4M8NA 3SEBA 4GMVA 1HXYD 3HM6X 1RLFA 4I6PA 2MEKA 4N9F4 2DNFA 2BGFA 1UWMA 3N3KB 3EFUA 4IM0A 3NVVA 1WJ4A 1P0RA 2KTFA 3L16A 4II3B 1SXTA 1E8XA 4ZRPA 2AX5A 1GB1A 1G6JA 3MC9A 2KTRB 4DXFA 2DAFA 4A90A 2J4XA 1YJIA 1Z2MA 1T0YA 3ZXRA 3PVLA 3JYUA 3QQ8B 3A4SC 3R7QA 3GS2A 4MELA 5DPRA 1SIFA 4LNFA 4B95A 2K3UA 2KKCA 1D5XC 3Q6BA 2IO0B 1J0GA 4NNJB 4TMAB 2H89B 3DHIC 3NVWA 1QOGA 4A55A 1N5XA 4YTNB 2PMVA 4PS8A 2KWCA 4KGRA 1LQBA 1ET6A 2R2OA 1E90A 3N32A 1MPEA 1IBXA 2ASQA 1ZE3D 3HIZA 2K8CA 2WXLA 5G55A 2N9XA 1EU4A 1S3SG 3TEXA 3IT6B 3QHTA 1WE6A 4ITKA 4L1BA 5BYSA 4JWSC 3B08A 3R7RA 4OZAA 3ZQ4A 3UQAA 1AN8A 4ANVA 4FHJA 4DHZE 1WE7A 2WXKA 2CU3A 2BB5A 1L2NA 1JALA 5JZEB 1TKYA 3OAWA 2IO3B 3FAHA 1WFYA 2PE9A 2JPHA 4TSSA 4HWIB 4P1BC 1M94A 3P4RB 2IPKD 1T0SC 4I6NB 4FLHA 4DHJB 4TKNA 1K52A 3AULA 4S0RA 2KX3A 5E6PA 1RAXA 2Z59B 3VDZA 2RMMA 3ABVB 4EZLA 5IN7A 2W3SA 1J7CA 1YOVB 3EGRA 2KX0A 1VR9A 4YSXB 4US9A 2JZ3B 4II2B 1I4QA 1WXSA 2PLPA 2DENB 4FJVB 2BPSA 4NAMA 3AU4A 4LLGM 2QIEB 2PPHA 3RZWC 3P2BA 2QCZA 3K9PB 5AZHA 2JRIB 2NTSA 1SE3A 2PIAA 1NBFC 3U2SC 2BT6A 3WANA 4TQ0A 2LGIA 2KFKA 2NTTA 4F8CB 4FN2A 4OZCA 3PRPB 1LO5D 3AE3B 1PYWD 4FJZA 3Q3OC 2LGDA 3Q8AA 1FM0D 4B6WA 2Z0EB 3UIOB 4IG7B 1ZPSA 3B2FA 3VR9B 5JH5C 2XBBC 2Y5PA 2D3CA 3V62A 4YL8A 3VTUA 2KC2A 5CX3A 1WR6E 1V5OA 1FXTB 4ACFA 1SE4A 2WLBA 2CU1A 4XWTA 1KRHA 2KLCA 5CHFA 3WAOA 1P7FA 1RWSA 4BBNC 1WXVA 3OJ4B 4UDUC 2EELA 2MBQA 3PZ7A 1MI0A 3KVFB 2IBIB 3BYYB 3W2DA 1JCKB 2K8BA 1HZ5A 1MFWA 4S17A 1UD7A 4WJNA 3UINB 1N63A 2EKEC 3DDCB 3DBLB 1CQVA 4M00A 1MHXA 2WS3B 2ZVNA 1J7AA 2PVGC 2JU6X 1N6ZA 3RNCC 3MTNB 4DHJD 2WX1A 1ISNA 2QILA 3N9YC 2LASA 1SB3C 4HDQA 1F2RC 2YEPF 4IC7B 3H7PB 4DDGD 5IA7A 5BYQA 2L0FA 3P4PB 1AARA 4NY0A 1TZ1A 1FCCC 5IAAC 1IP9A 4TUUA 2MCNB 2BKFA 2O6VB 3Q3JA 5C1ZA 1JQ4A 2BWFA 4FA6A 4GB9A 5AZGA 1YX5B 2M4NA 4QAYA 3RNGC 3GE8C 3TJPA 4B0EA 1WY8A 3KUDB 3BVMA 2JWUA 1F9JA 2KQSA 5GXGB 3PHWB 2KDBA 3Q14C 2G4SA 2GLSA 4HJKA 1JWBD 2WWZA 2KZRA 2FCMA 4BFRA 1F1HA 2N7EA 2DZJA 1NVID 1P98A 1XEEA 1FNUA 3IHPC 2BKRB 1PGAA 3AU5A 2LVOA 4HPPA 2XEWA 2NBVB 3ZNZB 4A20A 1FFVA 1YNTE 2M17A 3R66C 4MEMA 2L52A 2O2VA 3AEAB 4HKQA 1CZPA 2QMTA 1R4MI 2I2YA 2ONQA 2Y5CA 1KM7A 2CHXA 2DAJA 3BIID 4HJGE 4DK5A 1E0ZA 3VUWA 4Q2JA 1KLGD 2BF8B 1YN4A 1WSPA 3ZTDA 1WJNA 2LJIA 2DYOA 2IDYA 2IY1B 3WAMA 3P42A 3V6EB 3ZJVA 1Y8RC 1PGBA 1KLUD 2ON8A 2YLMA 4A6QA 5IKCM 4FXCA 2AQ2B 2CHZA 3BK2A 1UBIA 2JYEA 2PW9A 2K22A 2IZVB 4HK2A 5DCNA 2LGYA 3AMZA 3RFZB 2G45B 1QILA 2IYDB 2KTRA 3U7ZA 4JIOU 1E7VA 4BZAA 3ZRFA 2ZW1A 3WALA 3Q8CA 1WJUA 3DHHC 2BS4B 4X57B 5FK9C 4AS1A 4AJYB 2C7HA 2O6VD 3ZNID 4W9LA 4J3OD 3AE6B 1T0RC 2INDC 2ZCCA 3KH0A 2JXTA 2QEJC 4JLCA 3AE8B 3MHSD 5D94A 4WURA 3ZUNA 2NBUA 2D2QA 3ONSA 3TBLD 4E71A 5CHWA 3KYCD 3BINA 2LMCA 2IGDA 1Z5SB 4DBGA 3DWGC 2FCNA 1YQBA 4W9JA 2N9LA 3UI3A 3PLUA 2WXOA 3ML9A 4W9DA 4HCNB 2M0XA 4C00A 3TEYA 1V49A 1WGDA 1GC6A 3KUZA 3R2TA 3SD5A 2KMMA 1M4VA 2QDFA 3GB1A 4P6VF 3SR6A 1E8YA 5L95C 2VH1A 1NEKB 2UWQA 3KLSX 4KGSA 3MC8A 2B76B 3FILB 3RI7C 4W9HA 1SE9A 2A5UA 4EKUA 4N58A 4MGZE 3HM3A 3AE4B 3DVGX 3RYTA 1T6BX 1XCQL 4MH0E 4MH8A 1IUEA 3JSVB 3ZDMC 3ENEA 1RFAA 3DBSA 1TS3A 5LNK1 1RFKA 3A1QB 2SEBD 2I1KA 4YWGG 3N30A 3C19A 2IO1B 3AE1B 4RFBA 3AN1A 2I38A 4YSZB 4M0WB 1N60A 2WXGA 4JQWC 3I5JC 3AEFB 2KFJA 4W9GA 3U8ZA 1KOTA 3W5UB 3X23A 5LXHA 2W9NA 4HKZE 1FRDA 2GBRA 3ZW3A 3NG0A 3ZNHB 2XK5B 4XGAB 2KANA 1YJ1A 4KDLB 3SFDB 2RR9A 3OG5A 2UYZB 1TS5A 1P3QU 3IXSA 2VZKD 2CS4A 3CSTA 1UZXB 2KVZA 4WQOB 4JX1C 3MP9A 4BKSD 3KWLA 4OZBA 1I7HA 4A3OA 1VRAB 3PGEA 3ETRA 3TEWA 5J18A 4LJOB 4RCOA 1FXAA 4E3CA 1H4RA 2IY0B 3T8MA 4HPLB 2ACZB 4KZ0A 1FCLA 3DHGC 1FNVA 3L08A 3Q8FA 1SF0A 4G3XB 4EZKA 4CQNA 4MJSB 4MM3B 2ZEQA 3UIPB 1WYGA 3R3MA 3Q2AC 1HTOA 4MDKE 3NVYA 1A70A 4OVZA 4G11A 1ET9A 1R4NI 4EE2A 1L0YB 2WQYB 2XN9C 4KDIC 3RZFA 1I4PA 1HE8A 2MW5A 2K6DB 1ESFA 1C77A 4MGYE 4WWNA 3AH7A 3VVWB 3DPDA 2X8XX 5DPTA 2QJLA 3W1YA 1QKZA 2KDEB 1R4MB 4B0MA 1L0XB 2FBWB 3EFCA 2V3PA 1RRBA 2KK8A 1D4BA 2E3TA 4NQKE 4XZ4A 1P7EA 3VAWA 5H8YE 2JSVX 3VTVA 1WGHA 3M63B 3NZSA 1Q10A 1YIWA 2N9KA 3PHXB 4BVUC 2GOWA 2RPQA 3ZIMA 1SJED 4PYUA 2MBBB 2KDMA 4NPNA 4GOCA 1OQRA 2LXAA 3APCA 3H7SA 1I4GA 4YTPB 4WQMA 4BKGA 3SHQA 4GLSC 3QX1A 2MQJA 4IUMB 3ZNGC 2MP2B 4L23A 4EOYA 2DZIA 4FBJB 1F52A 1VCBA 2D11A 4LK0M 1QZEA 4RH6A 2N7DA 1MG4A 3KUCB 1XD3B 5HHDG 3U52E 1WGKA 4PK1A 4HEA1 2WXHA 4IOIE 4KKJA 1L5PA 2N4FA 2DBYA 3BY4B 2KXJA 2MBOA 1SIJA 2LHEA 3DOWA 1VZ8A 2WNMA 1CMXB 2D3AA 1XLQA 5AEKB 5LLIA 5D2MB 5C2TB 1I4XA 3ZLZA 4O1NA 2ZPYA 2UU7A 1KH0A 1E6EB 3PREA 1V8CA 3MHZA 1JWUD 3P4SB 1E10A 5DPWA 1WIAA 1TS4A 2JZZA 2OEDA 1C4AA 4ZRJA 1VJKA 1WXMA 1C79A 2WXFA 4OHJA 4IM3A 4C80A 2BYVE 2LXCA 4PT5A 1I42A 4KIKA 3APDA 3K9OB 4MGIE 2WDVB 2OJWA 2KLGA 3WA0A 1XQQA 5D3DA 1STEA 1SSNA 1ZGUB 1K50A 2L05A 4HROA 3V3XA 1WJ6A 1U4AA 2BW2A 2L8JA 1XCTL 2NPTA 2ZVOA 4WWPA 1YX6B 2DZMA 3DBRI 3KWVA 1PDXA 3RULA 1N5WA 2W3RA 3VFKA 3T3OA 3ZVVA 4GDLB 2GRIA 1E8WA 3UGBB 2G4DB 3DQVA 4HCPB 2PKOA 1N61A 2BB6A 4LDTD 3VUYA 1T5XD 1E5WA 2FAZA 3B0AA 4N59A 2BYTA 2V3NA 4ZDVA 4ZRQA 4ANUA 3RNBC 1TBEA 4XX5A 1D3ZA 4US8A 2C60A 4RGOS 4IKGA 4KSLC 4XC2A 3AI5A 5IP4D 4BOSC 4IWPA 2OJRA 1V9JA 4ZOHC 5KHQA 2C5LC 1WRIA 3FILA 5G2NA 4F1SA 2V4LA 3PLVA 2FCQA 1E7PB 1UNSA 5C23A 2LHDA 5IOIA 1EM7A 2KO3A 4RF0A 3H9DA 1JWAD 3VTWA 4YXDB 2EMSA 3MJWA 1GG3A 3JSVA 1TYGB 4NJ6A 3ALBA 3VR8B 4L2YA 3A1QA 2JY6A 2RPVA 3LB8C 1OEYA 1DGJA 1R4NB 3N1YC 2LVPA 3RD2A 3ZRCA 4ZHOA 1E9MA 2N7JA 1WM2A 4HVBA 4EEWA 4ZHPA 4ZYNA 2J53A 4AOFA 2AL3A 3DBHI 1V80A 3DCGA 3WIMA 4JWUC 3IFWB 2XK5A 3H8HA 2DYBA 1L6VA 4GN1A 5I4DA 3VXWA 2G9HD 4K3CA 3R2IA 2HTHA 1UGMA 2KQ4X 1BUIC 2JUOA 4M8MA 1OEYJ 3HHMA 2MA9B 3UF8A 4GSWA 2V3SA 3NRZA 2KJHB 4DXGA 4YT0B 3AE9B 2BBCA 3TCAA 4R3DA 1FXIA 3ZJUA 2N1WA 1YD8U 4XYCA 4K7SA 3BVGA 5BMHA 3N1ZC 4HDOA 2BS2B 1I4HA 4KSKC 2FUG1 2L76A 1KJTA 1D5ZC 4BOZB 4MJSA 2K39A 4MM3A 1GAQB 4RGMA 3X0WA 3AE7B 1T0QC 1WRDB 2LRWA 5D3IB 1YQ3B 3IG3A 1Q5WB 1KF6B 4J6IA 5BO4B 2MHJA 2HJ8A 1A5RA 4JPSA 2YEPB 4GU2A 2FNJB 4TV3A 2KVRA 1ZP0B 2GMIC 2X38A 2C9WB 2KJ6A 2JRHA 5AUIA 1FIQA 1V81A 1WYWB 2RGFA 3GZNI 1R7SA 3RUIB 2L32A 2LEKA 3IT4B 1Q0WB 1L6UA 1J19A 4FULA 1JWMD 1UUPA 2JZPA 2JYTA 2J0KA 2DX5B 2RDHA 5FKAC 2R61A 2KN4A 1UGJA 3A9JB 1P9DU 3B1LX 5BYRA 5AUKA 1SBBB 1YN3A 1HA5A 4WJOA 3AEGB 1B1ZA 1C4CA 2REXA 3M3JA 1WWTA 4KGTA 1HQRD 3RNEC 4JGHB 2VZKB 3QIJA 5EE0A 5HKHA 4BBNF 2MP2A 4RM9A 1WZ0A 1WX8A 2Q5WD 5DPSA 2J52A 5D6JB 3OLMD 2LUMA 3QJZA 1Y56A 3NS1A 3VUXA 1GB4A 2N9PC 3DBRB 3I9V1 4OW0A 2NCNA 5D7GA 2CJNA 3JVZX 1MJDA 2AEHA 3V05A 2L7RA 2DHZA 2FUHB 1IPGA 2OHFA 4GXBA 1UH6A 3A33B 4K7UA 1YQ4B 1V6EA 4C56C 1IGDA 2MX2A 3IBEA 2RDGA 3C0RB 2N1VA 3BWUD 2FIFA 3TL5A 1MG8A 2EKIA 1L4DB 3QWZB 4JE3B 3PT2B 4NAWB 4XWWA 2W54A 2VH2A 2KJRA 1GJZA 2KMAA 3W1SC 4EZJA 2CJOA 3CWIA 3OWEB 1QOAA 2RD0A 3R8BA 2Y5BB 1GNUA 1FPYA 2JQRB 4IWOA 4RM8A 1TS2A 1TY2A 2J0MA 1HTQA 4A3PA 4FJYA 3A9KB 4DWFA 4WJQA 3QCAA 4BKTA 5G5GA 2MSED 3RPFC 2LJ5A 5L83A 2KQ7A 3W1SA 1L0VB 3S2AA 1NYRA 5T8IA 1UBQA 3URYA 5J2RA 2KNBA 2AQ3B 1LGRA 3ZO5B 2MJDA 2IO2B 1SE2A 1WF9A 1ROEA 2HE7A 2MLBA 3DBHB 4WH4A 3W9CB 2KDFB 1JRUA 5CHVC 2ZCBA 1AWDA 4P1CC 3TIXA 1K53A 1V97A 1QF6A 1LXDA 1JWSD 1XT9B 3FC4A 1TGZB 2IGGA 2QHOA 2D3GA 3PRMB 1C1YB 3HUIA 2J42A 2ICIA 3AEDB 1GPXA 2J7QB 3GE3C 3HVDA 5HG2A 2HTME 3JW0X 1WR1A 1KTKA 4YTMB 1C76A 3Q8BA 3RT3B 3NUHB 3ZDTA 5C3JB 2O2VB 4D2KA 3AXCA 1TKGA 1K51A 2L83A 4RF1A 4WWOA 1FMAD 1X1MA 2WDTB 2RDBC 2NMQA 2WU2B 3HVZA 4DQOC 3L4PA 1VZ7A 2K1FA 2LGXA 2K5PA 4EUTA 4MT5A 2WDRB 2L0TA 3L13A 4YSYB 2V0GA 3NS8A 3Q3MC 1B9RA 3TEZA 3H7PA 5LXIB 1NENB 2LUEA 1SJHD 3HK0A 2D3BA 3ZTCA 2MRPA 2GB1A 3AV8A 3EC8A 1ZDXA 2HD5B 2ZW0A 1VDVA 5IO9A 4TQ1A 4A8XC 2O6VA 1DOXA 2INCC 3QARA 4M01A 4B9KA 3GZNB 1PGXA 2XNAC 3ZYYX 1PFDA 1I4RA 1D5MC 4DDID 2BVCA 2C7MB 2KHWB 1XLNA 4DXAB 5TR5A 3AEEB 4LDTB 2KN5A 3EUB2 3MC0B 5EDSA 1EF1A 2KDIA 2ZNVB 3I57A 3BK1A 4RMAA 4K1RB 1EF5A 2SAKA 2HDEA 4P16A 1YMHE 4W9KA 3Q3NC 4P7IA 2WHIA 2QSDA 4XE0A 2J0JA 1F77A 1NDDA 1OQYA 3BYTB 4DHZB 1AW7A 1EUVB 1XXGA 4C4VB 1PQSA 4GIVA 5KHOA 4EFOA 1EU3A 3KQ4A 2IGHA 3M95A 1WX7A 3NVZA 5TSSA 4NQLB 2MJEA 3NZ3A 1YN5A 2N0SB 2MJ3A 4ANXA 1FFUA 1VLBA 3EECA 1ZDVA 3E9SA 3P63A 2BS3B 3U4EG 4HLEA 2M0AA 2LFIA 2PE6B 4ICUA 1TKEA 2MBEA 3QA8A 1TIFA 3AE2B 4KX6B 1WMHB 3A9JA 1E8ZA 2WU5B 2V9HA 4G0NB 1RYJA 5MPOA 3ZXVA 4ICVA 2MH7A 4GDKB 3LDZE 4WWMA 2ZPNA 3AB5A 4G50A 1FD6A 3IAM1 5JHBA 4FADA 1J8CA 4AUQC 3EHVA 2GI9A 1JMLA 2KWDA 1F0ZA 2WX0A 4BKSA 2NR2A 4RNAA 3L17A 1D6EC 2WDQB 2KYWA 2KACA 5E6NA 1ZXHA 1OGWA 2I1JA 3NOBA 2OOBB 1V1PB 2FCSA 4BAXA 2BYFA 5H92C 3WAPA 2KOXA 1TT5B 4ARIA 3AEBB 4KZCA 3OJ3A 2LZ6A 3Q69A 3AM9A 4N6EB 3CMMB 4IWQA 3H6NA 4KV2A 3H1UA 2PTLA 2PVOD 3BZDB 2B3AA 4OVUA 2Y3AA 1WZ3A 4ZRKA 2CR5A 3CF6E 4WAAA 3AE5B 1QT9A 2VRRB 3IAS1 4IM2A 4OVVA 4ANWA 1DYQA 2W82A 1XLOA 1L4ZB 2AL6A 4USAA 2A4ZA 2LI5A 4NAWA 1WM3A 3SFEB 3PTFC 4MSQB 3O65B 1IYFA 4NJ7A 3NZUA 1J7BA 2KAJA 2V1YA 1PUTA 3Q8EA 4MACA 2W55A 2KT7A 2LD9A 4M0WA 2BQQA 3N20C 3L10B 2CHWA 2JT4B 1H8CA 2DYMA 4LNOA 2L3ZA 1QQRA 2GBMA 2LRUA 4NJCA 5HI1A 3A9KA 4LTUA 2EMTA 1F2RI 4K7WA 2NBWB 4ZRIA 4CYEA 4LNIA 1QLBB 1LM8B 3RCZA 2KWUB 2TSSA 3RNAC 2M1MA 2AQ1B 1GOZA 1JW9D 3I63C 1BMLC 2H88B 4LCDE 3V61A 3TSSA 4ARCA 1C4PA 2WYQA 1FO4A 1QOBA 2V4IB 3B2GA 4HXDA 5E6JA 1CK1A 2WXQA 1V86A 3RNFC 3PZDA 2BYEA 3U7DA 4C7ZA 5HFYA 4FHKA 1AYFA 1YJJA 1ZUD2 2GBKA 4AJWA 4C7YA 1VZ6A 1TY0A 4PS7A 3AECB 1KLVA 1JRPA 3VRBB 4IDIA 5GMVA 1IBXB 4W9IA 1ENFA 1XF5L 2K0PA 3C8YA 2M19A 2WXRA 2C7NB 1GUAB 2QC8A 4CHKA 3DWMA 3PZ8A 1TTNA 5EE1A 4KVGB 4W9CA 1MHHE 1ZKHA 2WXMA 4K3BA 2ZJDA 4WJPA 4W9EA 5JXVA 3MJ5A 4GGQA 3CIRB 4URKA 4H2AA 3VRAB 3A4RA 2AYOB 2INNE 5EE9A 2LVQA 1RM6C 1V2YA 3T3NA 2LGSA 1N62A 4MGKE 2WXNA 3T9LA 2KD0A 3ML8A 1WXAA 4AP4C 1UF0A 1WGYA 3CSFA 3DVNV 1SGHA 3MFGA 2NVUI 3IVFA 1Q1OA 2PJHA 3QK0A 4LNNA 4RGNA 1L7YA 5FR6A 1XO3A 1HZ6A 2ZNVC 3WCQA 3KW5B 1UELA 1ZW7A 4KIKB
chains in the Genus database with same CATH topology
2HE7A 2MLBA 3BY4B 2KDFB 1JRUA 2KXJA 2MBOA 3NHEB 2YVCA 3MTNB 4DHJD 5CHVC 2ZCBA 2WX1A 3DOWA 3V6CB 1CMXB 1BT0A 2MWSB 4ASWC 5AEKB 3TIXA 1ISNA 5LLIA 5D2MB 4PYZA 3ZLZA 2LASA 1LXDA 3SDLC 1S1QB 2K8HA 1XT9B 2G3QB 3TMPB 4HDQA 2ZPYA 1TGZB 2NPTB 2QHOA 3PREA 2D3GA 4IC7B 3H7PB 4DDGD 5IA7A 3PRMB 1C1YB 2L0FA 3QAQA 2N9EB 2KFKB 3D32A 3UQBA 5JHAA 1AARA 2BWES 1WIAA 2JZZA 5DPWA 4NY0A 1TZ1A 2J7QB 4ZRJA 3JW0X 1WR1A 5IAAC 1E7UA 1WXMA 1IP9A 3L0WB 4TUUA 2BKFA 3L54A 2MCNB 3RT3B 3ZDTA 2O6VB 2O2VB 3Q3JA 1WH3A 5C1ZA 5J17A 4IM3A 2BWFA 4FA6A 2BYVE 2LXCA 3AXCA 2FIDA 4GB9A 5CTRC 1I42A 4WWOA 5AZGA 1YX5B 2M4NA 3APDA 3K9OB 4KIKA 4MGIE 3U30A 1X1MA 3VQIA 2KC1A 2WDTB 2KLGA 3TJPA 3WA0A 3DVNU 2Z0DB 1WY8A 1XQQA 3KUDB 4AWJA 1F9JA 2KQSA 3PHWB 2KDBA 2G4SA 4HJKA 2K1FA 2WWZA 2GBNA 2KZRA 2LGXA 1ZGUB 2ZZPB 4EUTA 2FCMA 4BFRA 2L05A 2N7EA 2DZJA 1WJ6A 3ECIA 1U4AA 1K8RB 1P98A 2L0TA 3L13A 2L8JA 2MBHA 3PV1A 3NS8A 2NPTA 2ZVOA 3IHPC 1YX6B 1NI2A 1P1AA 2BKRB 4WWPA 2DZMA 3DBRI 3H7PA 5LXIB 2LUEA 3AU5A 3RULA 4I6LB 1OTRB 2LVOA 4K81A 2XEWA 2NBVB 3VFKA 3ZVVA 2AWTA 2PEAA 3HK0A 4GDLB 1WGGA 3ZNZB 2L00B 4A20A 2K25A 1E8WA 3ZTCA 2MRPA 3DVGY 2JVCA 3UGBB 2M17A 2G4DB 3DQVA 3QC8B 3EC8A 3R66C 4MEMA 4HCPB 3VHTC 2HD5B 4CO7A 4TQ1A 2O6VA 2O2VA 1GC7A 1EO6A 3QARA 4LDTD 5E6OA 4B9KA 2GBJA 3VUYA 3LJ3A 1R4MI 1KM7A 1E5WA 2CHXA 4DDID 2DAJA 1WI0A 1VD2A 2JXXA 2C7MB 2RSUA 3VH3B 4DK5A 3VUWA 3PRZA 2FAZA 2BF8B 3B0AA 2KHWB 3ZTDA 1WJNA 1WMHA 5TR5A 4DXAB 4ZDVA 2LWPA 2DYOA 3PSEB 2KWVB 4LDTB 2IY1B 2KN5A 3M62B 4ANUA 3WAMA 5EDSA 3SU8X 2R2QA 3V6EB 1EF1A 1TBEA 4XX5A 1D3ZA 1Y8RC 3VH4B 3PS6A 2C60A 2KDIA 3I3TB 2YLMA 2ZNVB 2M8SA 4GDKA 3ZKJC 4KSLC 4XC2A 3AI5A 4RMAA 4BOSC 2K6QA 3APFA 4IWPA 1C3TA 4GDLA 4K1RB 2CHZA 2OJRA 1EF5A 1V9JA 1UBIA 5KHQA 1WX9A 2C5LC 5G2NA 2CKHB 4F1SA 2V4LA 2IZVB 3PLVA 2JF5A 2FCQA 4HK2A 2LGYA 5DCNA 2G45B 2D10A 2IYDB 2KTRA 4W9KA 2DZKA 4JIOU 4PS3A 1I35A 1E7VA 4P7IA 5C23A 2D07B 3ZRFA 2KO3A 3GOEA 2J0JA 3H9DA 3VTWA 2EMSA 2NS5A 4HPMB 3MJWA 3WALA 1WJUA 1GG3A 1WGRA 4F7ZA 3JSVA 1NDDA 1OQYA 3NY5A 4NJ6A 3ALBA 4MSMB 4DHZB 4X57B 1EUVB 1LFDA 3A1QA 2KMCA 2JWZA 1PQSA 2JY6A 4GIVA 5KHOA 4AJYB 2C7HA 4LJPB 2O6VD 3ZNID 4W9LA 3PPAA 4EFOA 1OEYA 4IW0A 2LVPA 3RD2A 2ZCCA 3KH0A 3DBLI 3ZRCA 4JLCA 3MHSD 1WM2A 5D94A 3M95A 4EEWA 4HVBA 3KYDD 1WX7A 4ZYNA 3ZUNA 2NBUA 4NQLB 5AZFA 2D2QA 3ONSA 4W9FA 4AOFA 3TBLD 2AL3A 3V60A 4E71A 1V5TA 3DBHI 1V80A 3DCGA 5CHWA 3KYCD 3WIMA 4ANXA 3BINA 3EECA 3IFWB 4E74A 2XK5A 2DYBA 3Q3FA 4DBGA 1Z5SB 4HLEA 2FCNA 1YQBA 2PE6B 4ICUA 4W9JA 4GN1A 2MBEA 3PLUA 3ML9A 3VXWA 4JL9A 4W9DA 3QA8A 4HCNB 2HTHA 2M0XA 1UGMA 4M8NA 1V49A 1WGDA 1WMHB 3A9JA 1GC6A 4GMVA 1E8ZA 3KUZA 2JUOA 4M8MA 3HM6X 1OEYJ 1RLFA 3HHMA 4I6PA 2MA9B 4G0NB 3SD5A 4N9F4 3UF8A 2BGFA 2V3SA 4GSWA 2KJHB 4ICVA 4GDKB 3N3KB 1E8YA 3LDZE 5L95C 3EFUA 3TCAA 2UWQA 2ZPNA 4IM0A 4G50A 1WJ4A 1P0RA 2KTFA 2N1WA 3L16A 1YD8U 4II3B 5JHBA 4FADA 1J8CA 4K7SA 1E8XA 3EHVA 4AUQC 4W9HA 1SE9A 2A5UA 4EKUA 4MGZE 3HM3A 2WX0A 1G6JA 2KTRB 4BKSA 2NR2A 4HDOA 3DVGX 4KSKC 2DAFA 3L17A 3RYTA 2L76A 1Z2MA 1KJTA 1T0YA 5E6NA 4MH0E 4BOZB 4MJSA 3PVLA 1OGWA 2I1JA 2K39A 4MM3A 3X0WA 3JYUA 3QQ8B 3A4SC 3JSVB 3NOBA 1WRDB 2OOBB 3R7QA 3ENEA 3ZDMC 2FCSA 2LRWA 1RFAA 2BYFA 3IG3A 3DBSA 3WAPA 2KOXA 1Q5WB 4MELA 5DPRA 3A1QB 1SIFA 4KZCA 3OJ3A 4J6IA 2I1KA 5BO4B 2HJ8A 2LZ6A 1A5RA 3N30A 4B95A 4GU2A 3CMMB 2FNJB 2KKCA 4TV3A 4IWQA 2IO1B 2KVRA 3H6NA 2GMIC 4KV2A 2IO0B 2C9WB 2KJ6A 3H1UA 4M0WB 1J0GA 2JRHA 4NNJB 4JQWC 1V81A 2KFJA 1WYWB 4W9GA 3U8ZA 1KOTA 4OVUA 2B3AA 2RGFA 3GZNI 4PS8A 3X23A 1WZ3A 3RUIB 5LXHA 4ZRKA 2KWCA 2W9NA 2CR5A 3CF6E 4WAAA 3ZW3A 2GBRA 1LQBA 1Q0WB 3ZNHB 1J19A 4FULA 2XK5B 2VRRB 4IM2A 2KANA 4OVVA 2R2OA 4ANWA 1YJ1A 1E90A 4KDLB 3N32A 2J0KA 2DX5B 2AL6A 2RR9A 2A4ZA 2ASQA 3HIZA 2K8CA 5G55A 2N9XA 2LI5A 1S3SG 4NAWA 2UYZB 3QHTA 1WE6A 3UQAA 1WM3A 3B08A 3R7RA 1P3QU 3PTFC 3A9JB 1P9DU 3B1LX 4ANVA 4MSQB 2CS4A 3CSTA 1UZXB 4WQOB 3O65B 1IYFA 4BKSD 4FHJA 4NJ7A 4WJOA 1WE7A 4DHZE 3NZUA 2V1YA 2REXA 3M3JA 1L2NA 4A3OA 2LD9A 3PGEA 5JZEB 5J18A 3OAWA 4LJOB 3L10B 2IO3B 4JGHB 2CHWA 2JT4B 1H8CA 4E3CA 1H4RA 2DYMA 3QIJA 1WFYA 2L3ZA 2IY0B 2PE9A 3T8MA 5HKHA 2JPHA 4HPLB 4BBNF 2MP2A 4HWIB 4KZ0A 2GBMA 2LRUA 3A9KA 2EMTA 4RM9A 1M94A 3L08A 1WZ0A 4K7WA 1WX8A 2NBWB 4G3XB 5DPSA 4ZRIA 4EZKA 4MJSB 4I6NB 4FLHA 5D6JB 3OLMD 4TKNA 4CYEA 4DHJB 2ZEQA 3AULA 3UIPB 2KX3A 3R3MA 1LM8B 1RAXA 2Z59B 3QJZA 5E6PA 3VDZA 4EZLA 4MDKE 2KWUB 3RCZA 3VUXA 4G11A 2KX0A 2M1MA 1R4NI 2N9PC 2JZ3B 2NCNA 4II2B 4LCDE 3V61A 5D7GA 3JVZX 4KDIC 1WXSA 2AEHA 2WYQA 3RZFA 1HE8A 2L7RA 2MW5A 2DENB 2DHZA 4HXDA 2FUHB 2K6DB 4FJVB 2BPSA 1V86A 1IPGA 4MGYE 4WWNA 3AU4A 4GXBA 3VVWB 1UH6A 3A33B 3DPDA 4K7UA 3PZDA 5DPTA 2BYEA 1V6EA 2PPHA 3W1YA 3U7DA 3RZWC 3P2BA 2KDEB 3K9PB 4FHKA 2GBKA 4AJWA 2MX2A 3IBEA 4PS7A 1RRBA 2JRIB 2KK8A 3C0RB 4NQKE 5AZHA 4XZ4A 2N1VA 1KLVA 3VAWA 2FIFA 3TL5A 1MG8A 1NBFC 3QWZB 5GMVA 4W9IA 3WANA 4TQ0A 3VTVA 1WGHA 3M63B 2KFKA 3NZSA 4F8CB 1YIWA 4FN2A 3PT2B 4NAWB 3PRPB 4FJZA 2KJRA 2LGDA 3PHXB 2KMAA 1GJZA 4BVUC 2C7NB 1GUAB 2GOWA 3W1SC 4CHKA 4EZJA 2RPQA 3ZIMA 1TTNA 4PYUA 2MBBB 4B6WA 2RD0A 2Z0EB 4KVGB 3UIOB 4IG7B 2Y5BB 4NPNA 1GNUA 4GOCA 4W9CA 4IWOA 4RM8A 1ZKHA 5JH5C 2LXAA 2ZJDA 4WJPA 4W9EA 2XBBC 4GGQA 4URKA 3APCA 3H7SA 4BKGA 3SHQA 3V62A 4YL8A 3A4RA 2AYOB 2J0MA 3QX1A 3VTUA 2LVQA 2KC2A 2MQJA 5CX3A 4IUMB 4A3PA 1WR6E 3ZNGC 1V5OA 2MP2B 1FXTB 4FJYA 1V2YA 3A9KB 4DWFA 2CU1A 4WJQA 4EOYA 2DZIA 3QCAA 4FBJB 4BKTA 1VCBA 2MSED 2KLCA 2LJ5A 5CHFA 4MGKE 3T9LA 3WAOA 4BBNC 1WXVA 5L83A 2KQ7A 2D11A 3OJ4B 3W1SA 1QZEA 3S2AA 2KD0A 2MBQA 3ML8A 1WXAA 2IBIB 3KVFB 2N7DA 4AP4C 3KUCB 2K8BA 1XD3B 1WGYA 3CSFA 3DVNV 1SGHA 1UBQA 1UD7A 4WJNA 2KNBA 2NVUI 5J2RA 3IVFA 3UINB 1Q1OA 2PJHA 3QK0A 2EKEC 3DDCB 1L7YA 5FR6A 2ZNVC 3ZO5B 2N4FA 3KW5B 2IO2B 1UELA 1ZW7A 4KIKB 1WF9A 2ZVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HE7 A;  2MLB A;  3BY4 B;  2KDF B;  1JRU A;  2KXJ A;  2MBO A;  3NHE B;  2YVC A;  3MTN B;  4DHJ D;  5CHV C;  2ZCB A;  2WX1 A;  3DOW A;  3V6C B;  1CMX B;  1BT0 A;  2MWS B;  4ASW C;  5AEK B;  3TIX A;  1ISN A;  5LLI A;  5D2M B;  4PYZ A;  3ZLZ A;  2LAS A;  1LXD A;  3SDL C;  1S1Q B;  2K8H A;  1XT9 B;  2G3Q B;  3TMP B;  4HDQ A;  2ZPY A;  1TGZ B;  2NPT B;  2QHO A;  3PRE A;  2D3G A;  4IC7 B;  3H7P B;  4DDG D;  5IA7 A;  3PRM B;  1C1Y B;  2L0F A;  3QAQ A;  2N9E B;  2KFK B;  3D32 A;  3UQB A;  5JHA A;  1AAR A;  2BWE S;  1WIA A;  2JZZ A;  5DPW A;  4NY0 A;  1TZ1 A;  2J7Q B;  4ZRJ A;  3JW0 X;  1WR1 A;  5IAA C;  1E7U A;  1WXM A;  1IP9 A;  3L0W B;  4TUU A;  2BKF A;  3L54 A;  2MCN B;  3RT3 B;  3ZDT A;  2O6V B;  2O2V B;  3Q3J A;  1WH3 A;  5C1Z A;  5J17 A;  4IM3 A;  2BWF A;  4FA6 A;  2BYV E;  2LXC A;  3AXC A;  2FID A;  4GB9 A;  5CTR C;  1I42 A;  4WWO A;  5AZG A;  1YX5 B;  2M4N A;  3APD A;  3K9O B;  4KIK A;  4MGI E;  3U30 A;  1X1M A;  3VQI A;  2KC1 A;  2WDT B;  2KLG A;  3TJP A;  3WA0 A;  3DVN U;  2Z0D B;  1WY8 A;  1XQQ A;  3KUD B;  4AWJ A;  1F9J A;  2KQS A;  3PHW B;  2KDB A;  2G4S A;  4HJK A;  2K1F A;  2WWZ A;  2GBN A;  2KZR A;  2LGX A;  1ZGU B;  2ZZP B;  4EUT A;  2FCM A;  4BFR A;  2L05 A;  2N7E A;  2DZJ A;  1WJ6 A;  3ECI A;  1U4A A;  1K8R B;  1P98 A;  2L0T A;  3L13 A;  2L8J A;  2MBH A;  3PV1 A;  3NS8 A;  2NPT A;  2ZVO A;  3IHP C;  1YX6 B;  1NI2 A;  1P1A A;  2BKR B;  4WWP A;  2DZM A;  3DBR I;  3H7P A;  5LXI B;  2LUE A;  3AU5 A;  3RUL A;  4I6L B;  1OTR B;  2LVO A;  4K81 A;  2XEW A;  2NBV B;  3VFK A;  3ZVV A;  2AWT A;  2PEA A;  3HK0 A;  4GDL B;  1WGG A;  3ZNZ B;  2L00 B;  4A20 A;  2K25 A;  1E8W A;  3ZTC A;  2MRP A;  3DVG Y;  2JVC A;  3UGB B;  2M17 A;  2G4D B;  3DQV A;  3QC8 B;  3EC8 A;  3R66 C;  4MEM A;  4HCP B;  3VHT C;  2HD5 B;  4CO7 A;  4TQ1 A;  2O6V A;  2O2V A;  1GC7 A;  1EO6 A;  3QAR A;  4LDT D;  5E6O A;  4B9K A;  2GBJ A;  3VUY A;  3LJ3 A;  1R4M I;  1KM7 A;  1E5W A;  2CHX A;  4DDI D;  2DAJ A;  1WI0 A;  1VD2 A;  2JXX A;  2C7M B;  2RSU A;  3VH3 B;  4DK5 A;  3VUW A;  3PRZ A;  2FAZ A;  2BF8 B;  3B0A A;  2KHW B;  3ZTD A;  1WJN A;  1WMH A;  5TR5 A;  4DXA B;  4ZDV A;  2LWP A;  2DYO A;  3PSE B;  2KWV B;  4LDT B;  2IY1 B;  2KN5 A;  3M62 B;  4ANU A;  3WAM A;  5EDS A;  3SU8 X;  2R2Q A;  3V6E B;  1EF1 A;  1TBE A;  4XX5 A;  1D3Z A;  1Y8R C;  3VH4 B;  3PS6 A;  2C60 A;  2KDI A;  3I3T B;  2YLM A;  2ZNV B;  2M8S A;  4GDK A;  3ZKJ C;  4KSL C;  4XC2 A;  3AI5 A;  4RMA A;  4BOS C;  2K6Q A;  3APF A;  4IWP A;  1C3T A;  4GDL A;  4K1R B;  2CHZ A;  2OJR A;  1EF5 A;  1V9J A;  1UBI A;  5KHQ A;  1WX9 A;  2C5L C;  5G2N A;  2CKH B;  4F1S A;  2V4L A;  2IZV B;  3PLV A;  2JF5 A;  2FCQ A;  4HK2 A;  2LGY A;  5DCN A;  2G45 B;  2D10 A;  2IYD B;  2KTR A;  4W9K A;  2DZK A;  4JIO U;  4PS3 A;  1I35 A;  1E7V A;  4P7I A;  5C23 A;  2D07 B;  3ZRF A;  2KO3 A;  3GOE A;  2J0J A;  3H9D A;  3VTW A;  2EMS A;  2NS5 A;  4HPM B;  3MJW A;  3WAL A;  1WJU A;  1GG3 A;  1WGR A;  4F7Z A;  3JSV A;  1NDD A;  1OQY A;  3NY5 A;  4NJ6 A;  3ALB A;  4MSM B;  4DHZ B;  4X57 B;  1EUV B;  1LFD A;  3A1Q A;  2KMC A;  2JWZ A;  1PQS A;  2JY6 A;  4GIV A;  5KHO A;  4AJY B;  2C7H A;  4LJP B;  2O6V D;  3ZNI D;  4W9L A;  3PPA A;  4EFO A;  1OEY A;  4IW0 A;  2LVP A;  3RD2 A;  2ZCC A;  3KH0 A;  3DBL I;  3ZRC A;  4JLC A;  3MHS D;  1WM2 A;  5D94 A;  3M95 A;  4EEW A;  4HVB A;  3KYD D;  1WX7 A;  4ZYN A;  3ZUN A;  2NBU A;  4NQL B;  5AZF A;  2D2Q A;  3ONS A;  4W9F A;  4AOF A;  3TBL D;  2AL3 A;  3V60 A;  4E71 A;  1V5T A;  3DBH I;  1V80 A;  3DCG A;  5CHW A;  3KYC D;  3WIM A;  4ANX A;  3BIN A;  3EEC A;  3IFW B;  4E74 A;  2XK5 A;  2DYB A;  3Q3F A;  4DBG A;  1Z5S B;  4HLE A;  2FCN A;  1YQB A;  2PE6 B;  4ICU A;  4W9J A;  4GN1 A;  2MBE A;  3PLU A;  3ML9 A;  3VXW A;  4JL9 A;  4W9D A;  3QA8 A;  4HCN B;  2HTH A;  2M0X A;  1UGM A;  4M8N A;  1V49 A;  1WGD A;  1WMH B;  3A9J A;  1GC6 A;  4GMV A;  1E8Z A;  3KUZ A;  2JUO A;  4M8M A;  3HM6 X;  1OEY J;  1RLF A;  3HHM A;  4I6P A;  2MA9 B;  4G0N B;  3SD5 A;  4N9F 4;  3UF8 A;  2BGF A;  2V3S A;  4GSW A;  2KJH B;  4ICV A;  4GDK B;  3N3K B;  1E8Y A;  3LDZ E;  5L95 C;  3EFU A;  3TCA A;  2UWQ A;  2ZPN A;  4IM0 A;  4G50 A;  1WJ4 A;  1P0R A;  2KTF A;  2N1W A;  3L16 A;  1YD8 U;  4II3 B;  5JHB A;  4FAD A;  1J8C A;  4K7S A;  1E8X A;  3EHV A;  4AUQ C;  4W9H A;  1SE9 A;  2A5U A;  4EKU A;  4MGZ E;  3HM3 A;  2WX0 A;  1G6J A;  2KTR B;  4BKS A;  2NR2 A;  4HDO A;  3DVG X;  4KSK C;  2DAF A;  3L17 A;  3RYT A;  2L76 A;  1Z2M A;  1KJT A;  1T0Y A;  5E6N A;  4MH0 E;  4BOZ B;  4MJS A;  3PVL A;  1OGW A;  2I1J A;  2K39 A;  4MM3 A;  3X0W A;  3JYU A;  3QQ8 B;  3A4S C;  3JSV B;  3NOB A;  1WRD B;  2OOB B;  3R7Q A;  3ENE A;  3ZDM C;  2FCS A;  2LRW A;  1RFA A;  2BYF A;  3IG3 A;  3DBS A;  3WAP A;  2KOX A;  1Q5W B;  4MEL A;  5DPR A;  3A1Q B;  1SIF A;  4KZC A;  3OJ3 A;  4J6I A;  2I1K A;  5BO4 B;  2HJ8 A;  2LZ6 A;  1A5R A;  3N30 A;  4B95 A;  4GU2 A;  3CMM B;  2FNJ B;  2KKC A;  4TV3 A;  4IWQ A;  2IO1 B;  2KVR A;  3H6N A;  2GMI C;  4KV2 A;  2IO0 B;  2C9W B;  2KJ6 A;  3H1U A;  4M0W B;  1J0G A;  2JRH A;  4NNJ B;  4JQW C;  1V81 A;  2KFJ A;  1WYW B;  4W9G A;  3U8Z A;  1KOT A;  4OVU A;  2B3A A;  2RGF A;  3GZN I;  4PS8 A;  3X23 A;  1WZ3 A;  3RUI B;  5LXH A;  4ZRK A;  2KWC A;  2W9N A;  2CR5 A;  3CF6 E;  4WAA A;  3ZW3 A;  2GBR A;  1LQB A;  1Q0W B;  3ZNH B;  1J19 A;  4FUL A;  2XK5 B;  2VRR B;  4IM2 A;  2KAN A;  4OVV A;  2R2O A;  4ANW A;  1YJ1 A;  1E90 A;  4KDL B;  3N32 A;  2J0K A;  2DX5 B;  2AL6 A;  2RR9 A;  2A4Z A;  2ASQ A;  3HIZ A;  2K8C A;  5G55 A;  2N9X A;  2LI5 A;  1S3S G;  4NAW A;  2UYZ B;  3QHT A;  1WE6 A;  3UQA A;  1WM3 A;  3B08 A;  3R7R A;  1P3Q U;  3PTF C;  3A9J B;  1P9D U;  3B1L X;  4ANV A;  4MSQ B;  2CS4 A;  3CST A;  1UZX B;  4WQO B;  3O65 B;  1IYF A;  4BKS D;  4FHJ A;  4NJ7 A;  4WJO A;  1WE7 A;  4DHZ E;  3NZU A;  2V1Y A;  2REX A;  3M3J A;  1L2N A;  4A3O A;  2LD9 A;  3PGE A;  5JZE B;  5J18 A;  3OAW A;  4LJO B;  3L10 B;  2IO3 B;  4JGH B;  2CHW A;  2JT4 B;  1H8C A;  4E3C A;  1H4R A;  2DYM A;  3QIJ A;  1WFY A;  2L3Z A;  2IY0 B;  2PE9 A;  3T8M A;  5HKH A;  2JPH A;  4HPL B;  4BBN F;  2MP2 A;  4HWI B;  4KZ0 A;  2GBM A;  2LRU A;  3A9K A;  2EMT A;  4RM9 A;  1M94 A;  3L08 A;  1WZ0 A;  4K7W A;  1WX8 A;  2NBW B;  4G3X B;  5DPS A;  4ZRI A;  4EZK A;  4MJS B;  4I6N B;  4FLH A;  5D6J B;  3OLM D;  4TKN A;  4CYE A;  4DHJ B;  2ZEQ A;  3AUL A;  3UIP B;  2KX3 A;  3R3M A;  1LM8 B;  1RAX A;  2Z59 B;  3QJZ A;  5E6P A;  3VDZ A;  4EZL A;  4MDK E;  2KWU B;  3RCZ A;  3VUX A;  4G11 A;  2KX0 A;  2M1M A;  1R4N I;  2N9P C;  2JZ3 B;  2NCN A;  4II2 B;  4LCD E;  3V61 A;  5D7G A;  3JVZ X;  4KDI C;  1WXS A;  2AEH A;  2WYQ A;  3RZF A;  1HE8 A;  2L7R A;  2MW5 A;  2DEN B;  2DHZ A;  4HXD A;  2FUH B;  2K6D B;  4FJV B;  2BPS A;  1V86 A;  1IPG A;  4MGY E;  4WWN A;  3AU4 A;  4GXB A;  3VVW B;  1UH6 A;  3A33 B;  3DPD A;  4K7U A;  3PZD A;  5DPT A;  2BYE A;  1V6E A;  2PPH A;  3W1Y A;  3U7D A;  3RZW C;  3P2B A;  2KDE B;  3K9P B;  4FHK A;  2GBK A;  4AJW A;  2MX2 A;  3IBE A;  4PS7 A;  1RRB A;  2JRI B;  2KK8 A;  3C0R B;  4NQK E;  5AZH A;  4XZ4 A;  2N1V A;  1KLV A;  3VAW A;  2FIF A;  3TL5 A;  1MG8 A;  1NBF C;  3QWZ B;  5GMV A;  4W9I A;  3WAN A;  4TQ0 A;  3VTV A;  1WGH A;  3M63 B;  2KFK A;  3NZS A;  4F8C B;  1YIW A;  4FN2 A;  3PT2 B;  4NAW B;  3PRP B;  4FJZ A;  2KJR A;  2LGD A;  3PHX B;  2KMA A;  1GJZ A;  4BVU C;  2C7N B;  1GUA B;  2GOW A;  3W1S C;  4CHK A;  4EZJ A;  2RPQ A;  3ZIM A;  1TTN A;  4PYU A;  2MBB B;  4B6W A;  2RD0 A;  2Z0E B;  4KVG B;  3UIO B;  4IG7 B;  2Y5B B;  4NPN A;  1GNU A;  4GOC A;  4W9C A;  4IWO A;  4RM8 A;  1ZKH A;  5JH5 C;  2LXA A;  2ZJD A;  4WJP A;  4W9E A;  2XBB C;  4GGQ A;  4URK A;  3APC A;  3H7S A;  4BKG A;  3SHQ A;  3V62 A;  4YL8 A;  3A4R A;  2AYO B;  2J0M A;  3QX1 A;  3VTU A;  2LVQ A;  2KC2 A;  2MQJ A;  5CX3 A;  4IUM B;  4A3P A;  1WR6 E;  3ZNG C;  1V5O A;  2MP2 B;  1FXT B;  4FJY A;  1V2Y A;  3A9K B;  4DWF A;  2CU1 A;  4WJQ A;  4EOY A;  2DZI A;  3QCA A;  4FBJ B;  4BKT A;  1VCB A;  2MSE D;  2KLC A;  2LJ5 A;  5CHF A;  4MGK E;  3T9L A;  3WAO A;  4BBN C;  1WXV A;  5L83 A;  2KQ7 A;  2D11 A;  3OJ4 B;  3W1S A;  1QZE A;  3S2A A;  2KD0 A;  2MBQ A;  3ML8 A;  1WXA A;  2IBI B;  3KVF B;  2N7D A;  4AP4 C;  3KUC B;  2K8B A;  1XD3 B;  1WGY A;  3CSF A;  3DVN V;  1SGH A;  1UBQ A;  1UD7 A;  4WJN A;  2KNB A;  2NVU I;  5J2R A;  3IVF A;  3UIN B;  1Q1O A;  2PJH A;  3QK0 A;  2EKE C;  3DDC B;  1L7Y A;  5FR6 A;  2ZNV C;  3ZO5 B;  2N4F A;  3KW5 B;  2IO2 B;  1UEL A;  1ZW7 A;  4KIK B;  1WF9 A;  2ZVN A; 
#chains in the Genus database with same CATH topology
 4M02 A;  3NHE B;  2YVC A;  1XLP A;  3V6C B;  2MWS B;  1BT0 A;  4ASW C;  4NZL B;  4PYZ A;  3SDL C;  1S1Q B;  2K8H A;  4ZYS A;  1DOY A;  2G3Q B;  3TMP B;  2K9X A;  1C78 A;  2NPT B;  1SEB D;  1OFF A;  3QAQ A;  1UWX A;  2N9E B;  2KFK B;  3D32 A;  1DOI A;  5JHA A;  1EWY C;  2BWE S;  3UQB A;  3LYY A;  2DLB A;  1BXT A;  3LXF A;  4REZ A;  4LNK A;  3P4Q B;  3HRD D;  1E7U A;  3L0W B;  4AQ7 A;  3L54 A;  1WH3 A;  5J17 A;  3RMK C;  2FID A;  5CTR C;  3U30 A;  3VQI A;  2KC1 A;  1NYQ A;  2Z0D B;  3DVN U;  2HJ1 A;  3O13 A;  3PO0 A;  1JRO A;  5BMG A;  4AWJ A;  3B9J A;  2INP E;  2GBN A;  4XDD A;  2ZZP B;  3EA6 A;  4C4V A;  3ECI A;  1K8R B;  2MBH A;  3N1X C;  2M56 B;  3PV1 A;  1NI2 A;  1P1A A;  2WXI A;  1ZOY B;  4I6L B;  1OTR B;  4K81 A;  1V1O A;  2AWT A;  2PEA A;  1WGG A;  3ZJT A;  3RN9 C;  2L00 B;  2K25 A;  1IGC A;  3DVG Y;  2JVC A;  2IJ0 A;  3QC8 B;  3VHT C;  4CO7 A;  1GC7 A;  1EO6 A;  5E6O A;  1C9F A;  5BMI A;  2GBJ A;  1HEZ E;  3LJ3 A;  2WGS A;  1WI0 A;  1VD2 A;  2JXX A;  2RSU A;  2WXP A;  3VH3 B;  2G1E A;  4RGT A;  3PRZ A;  1KFY B;  2FE8 A;  1WMH A;  3E56 A;  4KKI A;  2LWP A;  3PSE B;  2KWV B;  3M62 B;  4XDC A;  3SU8 X;  2R2Q A;  2JX5 A;  2E6X A;  3VH4 B;  3PS6 A;  3I3T B;  4GDK A;  2M8S A;  3ZKJ C;  3TUO A;  1WXQ A;  2WP9 B;  2L1A A;  1T3Q A;  3W5V B;  2WXJ A;  2K6Q A;  3APF A;  5FR3 A;  4HRS A;  1C3T A;  4GDL A;  1FRR A;  1FNW A;  1WX9 A;  2CKH B;  5EE3 A;  2JF5 A;  2BTE A;  4WIP A;  2D10 A;  2DZK A;  4PS3 A;  1I35 A;  1ACC A;  2D07 B;  1EWC A;  3GOE A;  2NS5 A;  4HPM B;  1WGR A;  4F7Z A;  3BVZ A;  1V1P A;  3NY5 A;  3NJT A;  4MSM B;  1LFD A;  3FKY A;  1ZXI A;  2KMC A;  2DWQ A;  2JWZ A;  2Z8L A;  4LJP B;  1OQQ A;  5G5H A;  3PPA A;  3P1M A;  4IW0 A;  3DBL I;  3KYD D;  1CJE A;  5AZF A;  1MVK A;  4W9F A;  1QOF A;  1TJE A;  4A9A A;  3V60 A;  1V5T A;  3GP7 A;  2D5G A;  4E74 A;  4WAF A;  3ZGZ A;  3Q3F A;  1FEH A;  4JL9 A;  1NI3 A;  1TZO A;  3J9C A;  4M8N A;  3SEB A;  4GMV A;  1HXY D;  3HM6 X;  1RLF A;  4I6P A;  2MEK A;  4N9F 4;  2DNF A;  2BGF A;  1UWM A;  3N3K B;  3EFU A;  4IM0 A;  3NVV A;  1WJ4 A;  1P0R A;  2KTF A;  3L16 A;  4II3 B;  1SXT A;  1E8X A;  4ZRP A;  2AX5 A;  1GB1 A;  1G6J A;  3MC9 A;  2KTR B;  4DXF A;  2DAF A;  4A90 A;  2J4X A;  1YJI A;  1Z2M A;  1T0Y A;  3ZXR A;  3PVL A;  3JYU A;  3QQ8 B;  3A4S C;  3R7Q A;  3GS2 A;  4MEL A;  5DPR A;  1SIF A;  4LNF A;  4B95 A;  2K3U A;  2KKC A;  1D5X C;  3Q6B A;  2IO0 B;  1J0G A;  4NNJ B;  4TMA B;  2H89 B;  3DHI C;  3NVW A;  1QOG A;  4A55 A;  1N5X A;  4YTN B;  2PMV A;  4PS8 A;  2KWC A;  4KGR A;  1LQB A;  1ET6 A;  2R2O A;  1E90 A;  3N32 A;  1MPE A;  1IBX A;  2ASQ A;  1ZE3 D;  3HIZ A;  2K8C A;  2WXL A;  5G55 A;  2N9X A;  1EU4 A;  1S3S G;  3TEX A;  3IT6 B;  3QHT A;  1WE6 A;  4ITK A;  4L1B A;  5BYS A;  4JWS C;  3B08 A;  3R7R A;  4OZA A;  3ZQ4 A;  3UQA A;  1AN8 A;  4ANV A;  4FHJ A;  4DHZ E;  1WE7 A;  2WXK A;  2CU3 A;  2BB5 A;  1L2N A;  1JAL A;  5JZE B;  1TKY A;  3OAW A;  2IO3 B;  3FAH A;  1WFY A;  2PE9 A;  2JPH A;  4TSS A;  4HWI B;  4P1B C;  1M94 A;  3P4R B;  2IPK D;  1T0S C;  4I6N B;  4FLH A;  4DHJ B;  4TKN A;  1K52 A;  3AUL A;  4S0R A;  2KX3 A;  5E6P A;  1RAX A;  2Z59 B;  3VDZ A;  2RMM A;  3ABV B;  4EZL A;  5IN7 A;  2W3S A;  1J7C A;  1YOV B;  3EGR A;  2KX0 A;  1VR9 A;  4YSX B;  4US9 A;  2JZ3 B;  4II2 B;  1I4Q A;  1WXS A;  2PLP A;  2DEN B;  4FJV B;  2BPS A;  4NAM A;  3AU4 A;  4LLG M;  2QIE B;  2PPH A;  3RZW C;  3P2B A;  2QCZ A;  3K9P B;  5AZH A;  2JRI B;  2NTS A;  1SE3 A;  2PIA A;  1NBF C;  3U2S C;  2BT6 A;  3WAN A;  4TQ0 A;  2LGI A;  2KFK A;  2NTT A;  4F8C B;  4FN2 A;  4OZC A;  3PRP B;  1LO5 D;  3AE3 B;  1PYW D;  4FJZ A;  3Q3O C;  2LGD A;  3Q8A A;  1FM0 D;  4B6W A;  2Z0E B;  3UIO B;  4IG7 B;  1ZPS A;  3B2F A;  3VR9 B;  5JH5 C;  2XBB C;  2Y5P A;  2D3C A;  3V62 A;  4YL8 A;  3VTU A;  2KC2 A;  5CX3 A;  1WR6 E;  1V5O A;  1FXT B;  4ACF A;  1SE4 A;  2WLB A;  2CU1 A;  4XWT A;  1KRH A;  2KLC A;  5CHF A;  3WAO A;  1P7F A;  1RWS A;  4BBN C;  1WXV A;  3OJ4 B;  4UDU C;  2EEL A;  2MBQ A;  3PZ7 A;  1MI0 A;  3KVF B;  2IBI B;  3BYY B;  3W2D A;  1JCK B;  2K8B A;  1HZ5 A;  1MFW A;  4S17 A;  1UD7 A;  4WJN A;  3UIN B;  1N63 A;  2EKE C;  3DDC B;  3DBL B;  1CQV A;  4M00 A;  1MHX A;  2WS3 B;  2ZVN A;  1J7A A;  2PVG C;  2JU6 X;  1N6Z A;  3RNC C;  3MTN B;  4DHJ D;  2WX1 A;  1ISN A;  2QIL A;  3N9Y C;  2LAS A;  1SB3 C;  4HDQ A;  1F2R C;  2YEP F;  4IC7 B;  3H7P B;  4DDG D;  5IA7 A;  5BYQ A;  2L0F A;  3P4P B;  1AAR A;  4NY0 A;  1TZ1 A;  1FCC C;  5IAA C;  1IP9 A;  4TUU A;  2MCN B;  2BKF A;  2O6V B;  3Q3J A;  5C1Z A;  1JQ4 A;  2BWF A;  4FA6 A;  4GB9 A;  5AZG A;  1YX5 B;  2M4N A;  4QAY A;  3RNG C;  3GE8 C;  3TJP A;  4B0E A;  1WY8 A;  3KUD B;  3BVM A;  2JWU A;  1F9J A;  2KQS A;  5GXG B;  3PHW B;  2KDB A;  3Q14 C;  2G4S A;  2GLS A;  4HJK A;  1JWB D;  2WWZ A;  2KZR A;  2FCM A;  4BFR A;  1F1H A;  2N7E A;  2DZJ A;  1NVI D;  1P98 A;  1XEE A;  1FNU A;  3IHP C;  2BKR B;  1PGA A;  3AU5 A;  2LVO A;  4HPP A;  2XEW A;  2NBV B;  3ZNZ B;  4A20 A;  1FFV A;  1YNT E;  2M17 A;  3R66 C;  4MEM A;  2L52 A;  2O2V A;  3AEA B;  4HKQ A;  1CZP A;  2QMT A;  1R4M I;  2I2Y A;  2ONQ A;  2Y5C A;  1KM7 A;  2CHX A;  2DAJ A;  3BII D;  4HJG E;  4DK5 A;  1E0Z A;  3VUW A;  4Q2J A;  1KLG D;  2BF8 B;  1YN4 A;  1WSP A;  3ZTD A;  1WJN A;  2LJI A;  2DYO A;  2IDY A;  2IY1 B;  3WAM A;  3P42 A;  3V6E B;  3ZJV A;  1Y8R C;  1PGB A;  1KLU D;  2ON8 A;  2YLM A;  4A6Q A;  5IKC M;  4FXC A;  2AQ2 B;  2CHZ A;  3BK2 A;  1UBI A;  2JYE A;  2PW9 A;  2K22 A;  2IZV B;  4HK2 A;  5DCN A;  2LGY A;  3AMZ A;  3RFZ B;  2G45 B;  1QIL A;  2IYD B;  2KTR A;  3U7Z A;  4JIO U;  1E7V A;  4BZA A;  3ZRF A;  2ZW1 A;  3WAL A;  3Q8C A;  1WJU A;  3DHH C;  2BS4 B;  4X57 B;  5FK9 C;  4AS1 A;  4AJY B;  2C7H A;  2O6V D;  3ZNI D;  4W9L A;  4J3O D;  3AE6 B;  1T0R C;  2IND C;  2ZCC A;  3KH0 A;  2JXT A;  2QEJ C;  4JLC A;  3AE8 B;  3MHS D;  5D94 A;  4WUR A;  3ZUN A;  2NBU A;  2D2Q A;  3ONS A;  3TBL D;  4E71 A;  5CHW A;  3KYC D;  3BIN A;  2LMC A;  2IGD A;  1Z5S B;  4DBG A;  3DWG C;  2FCN A;  1YQB A;  4W9J A;  2N9L A;  3UI3 A;  3PLU A;  2WXO A;  3ML9 A;  4W9D A;  4HCN B;  2M0X A;  4C00 A;  3TEY A;  1V49 A;  1WGD A;  1GC6 A;  3KUZ A;  3R2T A;  3SD5 A;  2KMM A;  1M4V A;  2QDF A;  3GB1 A;  4P6V F;  3SR6 A;  1E8Y A;  5L95 C;  2VH1 A;  1NEK B;  2UWQ A;  3KLS X;  4KGS A;  3MC8 A;  2B76 B;  3FIL B;  3RI7 C;  4W9H A;  1SE9 A;  2A5U A;  4EKU A;  4N58 A;  4MGZ E;  3HM3 A;  3AE4 B;  3DVG X;  3RYT A;  1T6B X;  1XCQ L;  4MH0 E;  4MH8 A;  1IUE A;  3JSV B;  3ZDM C;  3ENE A;  1RFA A;  3DBS A;  1TS3 A;  5LNK 1;  1RFK A;  3A1Q B;  2SEB D;  2I1K A;  4YWG G;  3N30 A;  3C19 A;  2IO1 B;  3AE1 B;  4RFB A;  3AN1 A;  2I38 A;  4YSZ B;  4M0W B;  1N60 A;  2WXG A;  4JQW C;  3I5J C;  3AEF B;  2KFJ A;  4W9G A;  3U8Z A;  1KOT A;  3W5U B;  3X23 A;  5LXH A;  2W9N A;  4HKZ E;  1FRD A;  2GBR A;  3ZW3 A;  3NG0 A;  3ZNH B;  2XK5 B;  4XGA B;  2KAN A;  1YJ1 A;  4KDL B;  3SFD B;  2RR9 A;  3OG5 A;  2UYZ B;  1TS5 A;  1P3Q U;  3IXS A;  2VZK D;  2CS4 A;  3CST A;  1UZX B;  2KVZ A;  4WQO B;  4JX1 C;  3MP9 A;  4BKS D;  3KWL A;  4OZB A;  1I7H A;  4A3O A;  1VRA B;  3PGE A;  3ETR A;  3TEW A;  5J18 A;  4LJO B;  4RCO A;  1FXA A;  4E3C A;  1H4R A;  2IY0 B;  3T8M A;  4HPL B;  2ACZ B;  4KZ0 A;  1FCL A;  3DHG C;  1FNV A;  3L08 A;  3Q8F A;  1SF0 A;  4G3X B;  4EZK A;  4CQN A;  4MJS B;  4MM3 B;  2ZEQ A;  3UIP B;  1WYG A;  3R3M A;  3Q2A C;  1HTO A;  4MDK E;  3NVY A;  1A70 A;  4OVZ A;  4G11 A;  1ET9 A;  1R4N I;  4EE2 A;  1L0Y B;  2WQY B;  2XN9 C;  4KDI C;  3RZF A;  1I4P A;  1HE8 A;  2MW5 A;  2K6D B;  1ESF A;  1C77 A;  4MGY E;  4WWN A;  3AH7 A;  3VVW B;  3DPD A;  2X8X X;  5DPT A;  2QJL A;  3W1Y A;  1QKZ A;  2KDE B;  1R4M B;  4B0M A;  1L0X B;  2FBW B;  3EFC A;  2V3P A;  1RRB A;  2KK8 A;  1D4B A;  2E3T A;  4NQK E;  4XZ4 A;  1P7E A;  3VAW A;  5H8Y E;  2JSV X;  3VTV A;  1WGH A;  3M63 B;  3NZS A;  1Q10 A;  1YIW A;  2N9K A;  3PHX B;  4BVU C;  2GOW A;  2RPQ A;  3ZIM A;  1SJE D;  4PYU A;  2MBB B;  2KDM A;  4NPN A;  4GOC A;  1OQR A;  2LXA A;  3APC A;  3H7S A;  1I4G A;  4YTP B;  4WQM A;  4BKG A;  3SHQ A;  4GLS C;  3QX1 A;  2MQJ A;  4IUM B;  3ZNG C;  2MP2 B;  4L23 A;  4EOY A;  2DZI A;  4FBJ B;  1F52 A;  1VCB A;  2D11 A;  4LK0 M;  1QZE A;  4RH6 A;  2N7D A;  1MG4 A;  3KUC B;  1XD3 B;  5HHD G;  3U52 E;  1WGK A;  4PK1 A;  4HEA 1;  2WXH A;  4IOI E;  4KKJ A;  1L5P A;  2N4F A;  2DBY A;  3BY4 B;  2KXJ A;  2MBO A;  1SIJ A;  2LHE A;  3DOW A;  1VZ8 A;  2WNM A;  1CMX B;  2D3A A;  1XLQ A;  5AEK B;  5LLI A;  5D2M B;  5C2T B;  1I4X A;  3ZLZ A;  4O1N A;  2ZPY A;  2UU7 A;  1KH0 A;  1E6E B;  3PRE A;  1V8C A;  3MHZ A;  1JWU D;  3P4S B;  1E10 A;  5DPW A;  1WIA A;  1TS4 A;  2JZZ A;  2OED A;  1C4A A;  4ZRJ A;  1VJK A;  1WXM A;  1C79 A;  2WXF A;  4OHJ A;  4IM3 A;  4C80 A;  2BYV E;  2LXC A;  4PT5 A;  1I42 A;  4KIK A;  3APD A;  3K9O B;  4MGI E;  2WDV B;  2OJW A;  2KLG A;  3WA0 A;  1XQQ A;  5D3D A;  1STE A;  1SSN A;  1ZGU B;  1K50 A;  2L05 A;  4HRO A;  3V3X A;  1WJ6 A;  1U4A A;  2BW2 A;  2L8J A;  1XCT L;  2NPT A;  2ZVO A;  4WWP A;  1YX6 B;  2DZM A;  3DBR I;  3KWV A;  1PDX A;  3RUL A;  1N5W A;  2W3R A;  3VFK A;  3T3O A;  3ZVV A;  4GDL B;  2GRI A;  1E8W A;  3UGB B;  2G4D B;  3DQV A;  4HCP B;  2PKO A;  1N61 A;  2BB6 A;  4LDT D;  3VUY A;  1T5X D;  1E5W A;  2FAZ A;  3B0A A;  4N59 A;  2BYT A;  2V3N A;  4ZDV A;  4ZRQ A;  4ANU A;  3RNB C;  1TBE A;  4XX5 A;  1D3Z A;  4US8 A;  2C60 A;  4RGO S;  4IKG A;  4KSL C;  4XC2 A;  3AI5 A;  5IP4 D;  4BOS C;  4IWP A;  2OJR A;  1V9J A;  4ZOH C;  5KHQ A;  2C5L C;  1WRI A;  3FIL A;  5G2N A;  4F1S A;  2V4L A;  3PLV A;  2FCQ A;  1E7P B;  1UNS A;  5C23 A;  2LHD A;  5IOI A;  1EM7 A;  2KO3 A;  4RF0 A;  3H9D A;  1JWA D;  3VTW A;  4YXD B;  2EMS A;  3MJW A;  1GG3 A;  3JSV A;  1TYG B;  4NJ6 A;  3ALB A;  3VR8 B;  4L2Y A;  3A1Q A;  2JY6 A;  2RPV A;  3LB8 C;  1OEY A;  1DGJ A;  1R4N B;  3N1Y C;  2LVP A;  3RD2 A;  3ZRC A;  4ZHO A;  1E9M A;  2N7J A;  1WM2 A;  4HVB A;  4EEW A;  4ZHP A;  4ZYN A;  2J53 A;  4AOF A;  2AL3 A;  3DBH I;  1V80 A;  3DCG A;  3WIM A;  4JWU C;  3IFW B;  2XK5 A;  3H8H A;  2DYB A;  1L6V A;  4GN1 A;  5I4D A;  3VXW A;  2G9H D;  4K3C A;  3R2I A;  2HTH A;  1UGM A;  2KQ4 X;  1BUI C;  2JUO A;  4M8M A;  1OEY J;  3HHM A;  2MA9 B;  3UF8 A;  4GSW A;  2V3S A;  3NRZ A;  2KJH B;  4DXG A;  4YT0 B;  3AE9 B;  2BBC A;  3TCA A;  4R3D A;  1FXI A;  3ZJU A;  2N1W A;  1YD8 U;  4XYC A;  4K7S A;  3BVG A;  5BMH A;  3N1Z C;  4HDO A;  2BS2 B;  1I4H A;  4KSK C;  2FUG 1;  2L76 A;  1KJT A;  1D5Z C;  4BOZ B;  4MJS A;  2K39 A;  4MM3 A;  1GAQ B;  4RGM A;  3X0W A;  3AE7 B;  1T0Q C;  1WRD B;  2LRW A;  5D3I B;  1YQ3 B;  3IG3 A;  1Q5W B;  1KF6 B;  4J6I A;  5BO4 B;  2MHJ A;  2HJ8 A;  1A5R A;  4JPS A;  2YEP B;  4GU2 A;  2FNJ B;  4TV3 A;  2KVR A;  1ZP0 B;  2GMI C;  2X38 A;  2C9W B;  2KJ6 A;  2JRH A;  5AUI A;  1FIQ A;  1V81 A;  1WYW B;  2RGF A;  3GZN I;  1R7S A;  3RUI B;  2L32 A;  2LEK A;  3IT4 B;  1Q0W B;  1L6U A;  1J19 A;  4FUL A;  1JWM D;  1UUP A;  2JZP A;  2JYT A;  2J0K A;  2DX5 B;  2RDH A;  5FKA C;  2R61 A;  2KN4 A;  1UGJ A;  3A9J B;  1P9D U;  3B1L X;  5BYR A;  5AUK A;  1SBB B;  1YN3 A;  1HA5 A;  4WJO A;  3AEG B;  1B1Z A;  1C4C A;  2REX A;  3M3J A;  1WWT A;  4KGT A;  1HQR D;  3RNE C;  4JGH B;  2VZK B;  3QIJ A;  5EE0 A;  5HKH A;  4BBN F;  2MP2 A;  4RM9 A;  1WZ0 A;  1WX8 A;  2Q5W D;  5DPS A;  2J52 A;  5D6J B;  3OLM D;  2LUM A;  3QJZ A;  1Y56 A;  3NS1 A;  3VUX A;  1GB4 A;  2N9P C;  3DBR B;  3I9V 1;  4OW0 A;  2NCN A;  5D7G A;  2CJN A;  3JVZ X;  1MJD A;  2AEH A;  3V05 A;  2L7R A;  2DHZ A;  2FUH B;  1IPG A;  2OHF A;  4GXB A;  1UH6 A;  3A33 B;  4K7U A;  1YQ4 B;  1V6E A;  4C56 C;  1IGD A;  2MX2 A;  3IBE A;  2RDG A;  3C0R B;  2N1V A;  3BWU D;  2FIF A;  3TL5 A;  1MG8 A;  2EKI A;  1L4D B;  3QWZ B;  4JE3 B;  3PT2 B;  4NAW B;  4XWW A;  2W54 A;  2VH2 A;  2KJR A;  1GJZ A;  2KMA A;  3W1S C;  4EZJ A;  2CJO A;  3CWI A;  3OWE B;  1QOA A;  2RD0 A;  3R8B A;  2Y5B B;  1GNU A;  1FPY A;  2JQR B;  4IWO A;  4RM8 A;  1TS2 A;  1TY2 A;  2J0M A;  1HTQ A;  4A3P A;  4FJY A;  3A9K B;  4DWF A;  4WJQ A;  3QCA A;  4BKT A;  5G5G A;  2MSE D;  3RPF C;  2LJ5 A;  5L83 A;  2KQ7 A;  3W1S A;  1L0V B;  3S2A A;  1NYR A;  5T8I A;  1UBQ A;  3URY A;  5J2R A;  2KNB A;  2AQ3 B;  1LGR A;  3ZO5 B;  2MJD A;  2IO2 B;  1SE2 A;  1WF9 A;  1ROE A;  2HE7 A;  2MLB A;  3DBH B;  4WH4 A;  3W9C B;  2KDF B;  1JRU A;  5CHV C;  2ZCB A;  1AWD A;  4P1C C;  3TIX A;  1K53 A;  1V97 A;  1QF6 A;  1LXD A;  1JWS D;  1XT9 B;  3FC4 A;  1TGZ B;  2IGG A;  2QHO A;  2D3G A;  3PRM B;  1C1Y B;  3HUI A;  2J42 A;  2ICI A;  3AED B;  1GPX A;  2J7Q B;  3GE3 C;  3HVD A;  5HG2 A;  2HTM E;  3JW0 X;  1WR1 A;  1KTK A;  4YTM B;  1C76 A;  3Q8B A;  3RT3 B;  3NUH B;  3ZDT A;  5C3J B;  2O2V B;  4D2K A;  3AXC A;  1TKG A;  1K51 A;  2L83 A;  4RF1 A;  4WWO A;  1FMA D;  1X1M A;  2WDT B;  2RDB C;  2NMQ A;  2WU2 B;  3HVZ A;  4DQO C;  3L4P A;  1VZ7 A;  2K1F A;  2LGX A;  2K5P A;  4EUT A;  4MT5 A;  2WDR B;  2L0T A;  3L13 A;  4YSY B;  2V0G A;  3NS8 A;  3Q3M C;  1B9R A;  3TEZ A;  3H7P A;  5LXI B;  1NEN B;  2LUE A;  1SJH D;  3HK0 A;  2D3B A;  3ZTC A;  2MRP A;  2GB1 A;  3AV8 A;  3EC8 A;  1ZDX A;  2HD5 B;  2ZW0 A;  1VDV A;  5IO9 A;  4TQ1 A;  4A8X C;  2O6V A;  1DOX A;  2INC C;  3QAR A;  4M01 A;  4B9K A;  3GZN B;  1PGX A;  2XNA C;  3ZYY X;  1PFD A;  1I4R A;  1D5M C;  4DDI D;  2BVC A;  2C7M B;  2KHW B;  1XLN A;  4DXA B;  5TR5 A;  3AEE B;  4LDT B;  2KN5 A;  3EUB 2;  3MC0 B;  5EDS A;  1EF1 A;  2KDI A;  2ZNV B;  3I57 A;  3BK1 A;  4RMA A;  4K1R B;  1EF5 A;  2SAK A;  2HDE A;  4P16 A;  1YMH E;  4W9K A;  3Q3N C;  4P7I A;  2WHI A;  2QSD A;  4XE0 A;  2J0J A;  1F77 A;  1NDD A;  1OQY A;  3BYT B;  4DHZ B;  1AW7 A;  1EUV B;  1XXG A;  4C4V B;  1PQS A;  4GIV A;  5KHO A;  4EFO A;  1EU3 A;  3KQ4 A;  2IGH A;  3M95 A;  1WX7 A;  3NVZ A;  5TSS A;  4NQL B;  2MJE A;  3NZ3 A;  1YN5 A;  2N0S B;  2MJ3 A;  4ANX A;  1FFU A;  1VLB A;  3EEC A;  1ZDV A;  3E9S A;  3P63 A;  2BS3 B;  3U4E G;  4HLE A;  2M0A A;  2LFI A;  2PE6 B;  4ICU A;  1TKE A;  2MBE A;  3QA8 A;  1TIF A;  3AE2 B;  4KX6 B;  1WMH B;  3A9J A;  1E8Z A;  2WU5 B;  2V9H A;  4G0N B;  1RYJ A;  5MPO A;  3ZXV A;  4ICV A;  2MH7 A;  4GDK B;  3LDZ E;  4WWM A;  2ZPN A;  3AB5 A;  4G50 A;  1FD6 A;  3IAM 1;  5JHB A;  4FAD A;  1J8C A;  4AUQ C;  3EHV A;  2GI9 A;  1JML A;  2KWD A;  1F0Z A;  2WX0 A;  4BKS A;  2NR2 A;  4RNA A;  3L17 A;  1D6E C;  2WDQ B;  2KYW A;  2KAC A;  5E6N A;  1ZXH A;  1OGW A;  2I1J A;  3NOB A;  2OOB B;  1V1P B;  2FCS A;  4BAX A;  2BYF A;  5H92 C;  3WAP A;  2KOX A;  1TT5 B;  4ARI A;  3AEB B;  4KZC A;  3OJ3 A;  2LZ6 A;  3Q69 A;  3AM9 A;  4N6E B;  3CMM B;  4IWQ A;  3H6N A;  4KV2 A;  3H1U A;  2PTL A;  2PVO D;  3BZD B;  2B3A A;  4OVU A;  2Y3A A;  1WZ3 A;  4ZRK A;  2CR5 A;  3CF6 E;  4WAA A;  3AE5 B;  1QT9 A;  2VRR B;  3IAS 1;  4IM2 A;  4OVV A;  4ANW A;  1DYQ A;  2W82 A;  1XLO A;  1L4Z B;  2AL6 A;  4USA A;  2A4Z A;  2LI5 A;  4NAW A;  1WM3 A;  3SFE B;  3PTF C;  4MSQ B;  3O65 B;  1IYF A;  4NJ7 A;  3NZU A;  1J7B A;  2KAJ A;  2V1Y A;  1PUT A;  3Q8E A;  4MAC A;  2W55 A;  2KT7 A;  2LD9 A;  4M0W A;  2BQQ A;  3N20 C;  3L10 B;  2CHW A;  2JT4 B;  1H8C A;  2DYM A;  4LNO A;  2L3Z A;  1QQR A;  2GBM A;  2LRU A;  4NJC A;  5HI1 A;  3A9K A;  4LTU A;  2EMT A;  1F2R I;  4K7W A;  2NBW B;  4ZRI A;  4CYE A;  4LNI A;  1QLB B;  1LM8 B;  3RCZ A;  2KWU B;  2TSS A;  3RNA C;  2M1M A;  2AQ1 B;  1GOZ A;  1JW9 D;  3I63 C;  1BML C;  2H88 B;  4LCD E;  3V61 A;  3TSS A;  4ARC A;  1C4P A;  2WYQ A;  1FO4 A;  1QOB A;  2V4I B;  3B2G A;  4HXD A;  5E6J A;  1CK1 A;  2WXQ A;  1V86 A;  3RNF C;  3PZD A;  2BYE A;  3U7D A;  4C7Z A;  5HFY A;  4FHK A;  1AYF A;  1YJJ A;  1ZUD 2;  2GBK A;  4AJW A;  4C7Y A;  1VZ6 A;  1TY0 A;  4PS7 A;  3AEC B;  1KLV A;  1JRP A;  3VRB B;  4IDI A;  5GMV A;  1IBX B;  4W9I A;  1ENF A;  1XF5 L;  2K0P A;  3C8Y A;  2M19 A;  2WXR A;  2C7N B;  1GUA B;  2QC8 A;  4CHK A;  3DWM A;  3PZ8 A;  1TTN A;  5EE1 A;  4KVG B;  4W9C A;  1MHH E;  1ZKH A;  2WXM A;  4K3B A;  2ZJD A;  4WJP A;  4W9E A;  5JXV A;  3MJ5 A;  4GGQ A;  3CIR B;  4URK A;  4H2A A;  3VRA B;  3A4R A;  2AYO B;  2INN E;  5EE9 A;  2LVQ A;  1RM6 C;  1V2Y A;  3T3N A;  2LGS A;  1N62 A;  4MGK E;  2WXN A;  3T9L A;  2KD0 A;  3ML8 A;  1WXA A;  4AP4 C;  1UF0 A;  1WGY A;  3CSF A;  3DVN V;  1SGH A;  3MFG A;  2NVU I;  3IVF A;  1Q1O A;  2PJH A;  3QK0 A;  4LNN A;  4RGN A;  1L7Y A;  5FR6 A;  1XO3 A;  1HZ6 A;  2ZNV C;  3WCQ A;  3KW5 B;  1UEL A;  1ZW7 A;  4KIK B; 
#chains in the Genus database with same CATH homology
 2HE7 A;  2MLB A;  3BY4 B;  2KDF B;  1JRU A;  2KXJ A;  2MBO A;  3NHE B;  2YVC A;  3MTN B;  4DHJ D;  5CHV C;  2ZCB A;  2WX1 A;  3DOW A;  3V6C B;  1CMX B;  1BT0 A;  2MWS B;  4ASW C;  5AEK B;  3TIX A;  1ISN A;  5LLI A;  5D2M B;  4PYZ A;  3ZLZ A;  2LAS A;  1LXD A;  3SDL C;  1S1Q B;  2K8H A;  1XT9 B;  2G3Q B;  3TMP B;  4HDQ A;  2ZPY A;  1TGZ B;  2NPT B;  2QHO A;  3PRE A;  2D3G A;  4IC7 B;  3H7P B;  4DDG D;  5IA7 A;  3PRM B;  1C1Y B;  2L0F A;  3QAQ A;  2N9E B;  2KFK B;  3D32 A;  3UQB A;  5JHA A;  1AAR A;  2BWE S;  1WIA A;  2JZZ A;  5DPW A;  4NY0 A;  1TZ1 A;  2J7Q B;  4ZRJ A;  3JW0 X;  1WR1 A;  5IAA C;  1E7U A;  1WXM A;  1IP9 A;  3L0W B;  4TUU A;  2BKF A;  3L54 A;  2MCN B;  3RT3 B;  3ZDT A;  2O6V B;  2O2V B;  3Q3J A;  1WH3 A;  5C1Z A;  5J17 A;  4IM3 A;  2BWF A;  4FA6 A;  2BYV E;  2LXC A;  3AXC A;  2FID A;  4GB9 A;  5CTR C;  1I42 A;  4WWO A;  5AZG A;  1YX5 B;  2M4N A;  3APD A;  3K9O B;  4KIK A;  4MGI E;  3U30 A;  1X1M A;  3VQI A;  2KC1 A;  2WDT B;  2KLG A;  3TJP A;  3WA0 A;  3DVN U;  2Z0D B;  1WY8 A;  1XQQ A;  3KUD B;  4AWJ A;  1F9J A;  2KQS A;  3PHW B;  2KDB A;  2G4S A;  4HJK A;  2K1F A;  2WWZ A;  2GBN A;  2KZR A;  2LGX A;  1ZGU B;  2ZZP B;  4EUT A;  2FCM A;  4BFR A;  2L05 A;  2N7E A;  2DZJ A;  1WJ6 A;  3ECI A;  1U4A A;  1K8R B;  1P98 A;  2L0T A;  3L13 A;  2L8J A;  2MBH A;  3PV1 A;  3NS8 A;  2NPT A;  2ZVO A;  3IHP C;  1YX6 B;  1NI2 A;  1P1A A;  2BKR B;  4WWP A;  2DZM A;  3DBR I;  3H7P A;  5LXI B;  2LUE A;  3AU5 A;  3RUL A;  4I6L B;  1OTR B;  2LVO A;  4K81 A;  2XEW A;  2NBV B;  3VFK A;  3ZVV A;  2AWT A;  2PEA A;  3HK0 A;  4GDL B;  1WGG A;  3ZNZ B;  2L00 B;  4A20 A;  2K25 A;  1E8W A;  3ZTC A;  2MRP A;  3DVG Y;  2JVC A;  3UGB B;  2M17 A;  2G4D B;  3DQV A;  3QC8 B;  3EC8 A;  3R66 C;  4MEM A;  4HCP B;  3VHT C;  2HD5 B;  4CO7 A;  4TQ1 A;  2O6V A;  2O2V A;  1GC7 A;  1EO6 A;  3QAR A;  4LDT D;  5E6O A;  4B9K A;  2GBJ A;  3VUY A;  3LJ3 A;  1R4M I;  1KM7 A;  1E5W A;  2CHX A;  4DDI D;  2DAJ A;  1WI0 A;  1VD2 A;  2JXX A;  2C7M B;  2RSU A;  3VH3 B;  4DK5 A;  3VUW A;  3PRZ A;  2FAZ A;  2BF8 B;  3B0A A;  2KHW B;  3ZTD A;  1WJN A;  1WMH A;  5TR5 A;  4DXA B;  4ZDV A;  2LWP A;  2DYO A;  3PSE B;  2KWV B;  4LDT B;  2IY1 B;  2KN5 A;  3M62 B;  4ANU A;  3WAM A;  5EDS A;  3SU8 X;  2R2Q A;  3V6E B;  1EF1 A;  1TBE A;  4XX5 A;  1D3Z A;  1Y8R C;  3VH4 B;  3PS6 A;  2C60 A;  2KDI A;  3I3T B;  2YLM A;  2ZNV B;  2M8S A;  4GDK A;  3ZKJ C;  4KSL C;  4XC2 A;  3AI5 A;  4RMA A;  4BOS C;  2K6Q A;  3APF A;  4IWP A;  1C3T A;  4GDL A;  4K1R B;  2CHZ A;  2OJR A;  1EF5 A;  1V9J A;  1UBI A;  5KHQ A;  1WX9 A;  2C5L C;  5G2N A;  2CKH B;  4F1S A;  2V4L A;  2IZV B;  3PLV A;  2JF5 A;  2FCQ A;  4HK2 A;  2LGY A;  5DCN A;  2G45 B;  2D10 A;  2IYD B;  2KTR A;  4W9K A;  2DZK A;  4JIO U;  4PS3 A;  1I35 A;  1E7V A;  4P7I A;  5C23 A;  2D07 B;  3ZRF A;  2KO3 A;  3GOE A;  2J0J A;  3H9D A;  3VTW A;  2EMS A;  2NS5 A;  4HPM B;  3MJW A;  3WAL A;  1WJU A;  1GG3 A;  1WGR A;  4F7Z A;  3JSV A;  1NDD A;  1OQY A;  3NY5 A;  4NJ6 A;  3ALB A;  4MSM B;  4DHZ B;  4X57 B;  1EUV B;  1LFD A;  3A1Q A;  2KMC A;  2JWZ A;  1PQS A;  2JY6 A;  4GIV A;  5KHO A;  4AJY B;  2C7H A;  4LJP B;  2O6V D;  3ZNI D;  4W9L A;  3PPA A;  4EFO A;  1OEY A;  4IW0 A;  2LVP A;  3RD2 A;  2ZCC A;  3KH0 A;  3DBL I;  3ZRC A;  4JLC A;  3MHS D;  1WM2 A;  5D94 A;  3M95 A;  4EEW A;  4HVB A;  3KYD D;  1WX7 A;  4ZYN A;  3ZUN A;  2NBU A;  4NQL B;  5AZF A;  2D2Q A;  3ONS A;  4W9F A;  4AOF A;  3TBL D;  2AL3 A;  3V60 A;  4E71 A;  1V5T A;  3DBH I;  1V80 A;  3DCG A;  5CHW A;  3KYC D;  3WIM A;  4ANX A;  3BIN A;  3EEC A;  3IFW B;  4E74 A;  2XK5 A;  2DYB A;  3Q3F A;  4DBG A;  1Z5S B;  4HLE A;  2FCN A;  1YQB A;  2PE6 B;  4ICU A;  4W9J A;  4GN1 A;  2MBE A;  3PLU A;  3ML9 A;  3VXW A;  4JL9 A;  4W9D A;  3QA8 A;  4HCN B;  2HTH A;  2M0X A;  1UGM A;  4M8N A;  1V49 A;  1WGD A;  1WMH B;  3A9J A;  1GC6 A;  4GMV A;  1E8Z A;  3KUZ A;  2JUO A;  4M8M A;  3HM6 X;  1OEY J;  1RLF A;  3HHM A;  4I6P A;  2MA9 B;  4G0N B;  3SD5 A;  4N9F 4;  3UF8 A;  2BGF A;  2V3S A;  4GSW A;  2KJH B;  4ICV A;  4GDK B;  3N3K B;  1E8Y A;  3LDZ E;  5L95 C;  3EFU A;  3TCA A;  2UWQ A;  2ZPN A;  4IM0 A;  4G50 A;  1WJ4 A;  1P0R A;  2KTF A;  2N1W A;  3L16 A;  1YD8 U;  4II3 B;  5JHB A;  4FAD A;  1J8C A;  4K7S A;  1E8X A;  3EHV A;  4AUQ C;  4W9H A;  1SE9 A;  2A5U A;  4EKU A;  4MGZ E;  3HM3 A;  2WX0 A;  1G6J A;  2KTR B;  4BKS A;  2NR2 A;  4HDO A;  3DVG X;  4KSK C;  2DAF A;  3L17 A;  3RYT A;  2L76 A;  1Z2M A;  1KJT A;  1T0Y A;  5E6N A;  4MH0 E;  4BOZ B;  4MJS A;  3PVL A;  1OGW A;  2I1J A;  2K39 A;  4MM3 A;  3X0W A;  3JYU A;  3QQ8 B;  3A4S C;  3JSV B;  3NOB A;  1WRD B;  2OOB B;  3R7Q A;  3ENE A;  3ZDM C;  2FCS A;  2LRW A;  1RFA A;  2BYF A;  3IG3 A;  3DBS A;  3WAP A;  2KOX A;  1Q5W B;  4MEL A;  5DPR A;  3A1Q B;  1SIF A;  4KZC A;  3OJ3 A;  4J6I A;  2I1K A;  5BO4 B;  2HJ8 A;  2LZ6 A;  1A5R A;  3N30 A;  4B95 A;  4GU2 A;  3CMM B;  2FNJ B;  2KKC A;  4TV3 A;  4IWQ A;  2IO1 B;  2KVR A;  3H6N A;  2GMI C;  4KV2 A;  2IO0 B;  2C9W B;  2KJ6 A;  3H1U A;  4M0W B;  1J0G A;  2JRH A;  4NNJ B;  4JQW C;  1V81 A;  2KFJ A;  1WYW B;  4W9G A;  3U8Z A;  1KOT A;  4OVU A;  2B3A A;  2RGF A;  3GZN I;  4PS8 A;  3X23 A;  1WZ3 A;  3RUI B;  5LXH A;  4ZRK A;  2KWC A;  2W9N A;  2CR5 A;  3CF6 E;  4WAA A;  3ZW3 A;  2GBR A;  1LQB A;  1Q0W B;  3ZNH B;  1J19 A;  4FUL A;  2XK5 B;  2VRR B;  4IM2 A;  2KAN A;  4OVV A;  2R2O A;  4ANW A;  1YJ1 A;  1E90 A;  4KDL B;  3N32 A;  2J0K A;  2DX5 B;  2AL6 A;  2RR9 A;  2A4Z A;  2ASQ A;  3HIZ A;  2K8C A;  5G55 A;  2N9X A;  2LI5 A;  1S3S G;  4NAW A;  2UYZ B;  3QHT A;  1WE6 A;  3UQA A;  1WM3 A;  3B08 A;  3R7R A;  1P3Q U;  3PTF C;  3A9J B;  1P9D U;  3B1L X;  4ANV A;  4MSQ B;  2CS4 A;  3CST A;  1UZX B;  4WQO B;  3O65 B;  1IYF A;  4BKS D;  4FHJ A;  4NJ7 A;  4WJO A;  1WE7 A;  4DHZ E;  3NZU A;  2V1Y A;  2REX A;  3M3J A;  1L2N A;  4A3O A;  2LD9 A;  3PGE A;  5JZE B;  5J18 A;  3OAW A;  4LJO B;  3L10 B;  2IO3 B;  4JGH B;  2CHW A;  2JT4 B;  1H8C A;  4E3C A;  1H4R A;  2DYM A;  3QIJ A;  1WFY A;  2L3Z A;  2IY0 B;  2PE9 A;  3T8M A;  5HKH A;  2JPH A;  4HPL B;  4BBN F;  2MP2 A;  4HWI B;  4KZ0 A;  2GBM A;  2LRU A;  3A9K A;  2EMT A;  4RM9 A;  1M94 A;  3L08 A;  1WZ0 A;  4K7W A;  1WX8 A;  2NBW B;  4G3X B;  5DPS A;  4ZRI A;  4EZK A;  4MJS B;  4I6N B;  4FLH A;  5D6J B;  3OLM D;  4TKN A;  4CYE A;  4DHJ B;  2ZEQ A;  3AUL A;  3UIP B;  2KX3 A;  3R3M A;  1LM8 B;  1RAX A;  2Z59 B;  3QJZ A;  5E6P A;  3VDZ A;  4EZL A;  4MDK E;  2KWU B;  3RCZ A;  3VUX A;  4G11 A;  2KX0 A;  2M1M A;  1R4N I;  2N9P C;  2JZ3 B;  2NCN A;  4II2 B;  4LCD E;  3V61 A;  5D7G A;  3JVZ X;  4KDI C;  1WXS A;  2AEH A;  2WYQ A;  3RZF A;  1HE8 A;  2L7R A;  2MW5 A;  2DEN B;  2DHZ A;  4HXD A;  2FUH B;  2K6D B;  4FJV B;  2BPS A;  1V86 A;  1IPG A;  4MGY E;  4WWN A;  3AU4 A;  4GXB A;  3VVW B;  1UH6 A;  3A33 B;  3DPD A;  4K7U A;  3PZD A;  5DPT A;  2BYE A;  1V6E A;  2PPH A;  3W1Y A;  3U7D A;  3RZW C;  3P2B A;  2KDE B;  3K9P B;  4FHK A;  2GBK A;  4AJW A;  2MX2 A;  3IBE A;  4PS7 A;  1RRB A;  2JRI B;  2KK8 A;  3C0R B;  4NQK E;  5AZH A;  4XZ4 A;  2N1V A;  1KLV A;  3VAW A;  2FIF A;  3TL5 A;  1MG8 A;  1NBF C;  3QWZ B;  5GMV A;  4W9I A;  3WAN A;  4TQ0 A;  3VTV A;  1WGH A;  3M63 B;  2KFK A;  3NZS A;  4F8C B;  1YIW A;  4FN2 A;  3PT2 B;  4NAW B;  3PRP B;  4FJZ A;  2KJR A;  2LGD A;  3PHX B;  2KMA A;  1GJZ A;  4BVU C;  2C7N B;  1GUA B;  2GOW A;  3W1S C;  4CHK A;  4EZJ A;  2RPQ A;  3ZIM A;  1TTN A;  4PYU A;  2MBB B;  4B6W A;  2RD0 A;  2Z0E B;  4KVG B;  3UIO B;  4IG7 B;  2Y5B B;  4NPN A;  1GNU A;  4GOC A;  4W9C A;  4IWO A;  4RM8 A;  1ZKH A;  5JH5 C;  2LXA A;  2ZJD A;  4WJP A;  4W9E A;  2XBB C;  4GGQ A;  4URK A;  3APC A;  3H7S A;  4BKG A;  3SHQ A;  3V62 A;  4YL8 A;  3A4R A;  2AYO B;  2J0M A;  3QX1 A;  3VTU A;  2LVQ A;  2KC2 A;  2MQJ A;  5CX3 A;  4IUM B;  4A3P A;  1WR6 E;  3ZNG C;  1V5O A;  2MP2 B;  1FXT B;  4FJY A;  1V2Y A;  3A9K B;  4DWF A;  2CU1 A;  4WJQ A;  4EOY A;  2DZI A;  3QCA A;  4FBJ B;  4BKT A;  1VCB A;  2MSE D;  2KLC A;  2LJ5 A;  5CHF A;  4MGK E;  3T9L A;  3WAO A;  4BBN C;  1WXV A;  5L83 A;  2KQ7 A;  2D11 A;  3OJ4 B;  3W1S A;  1QZE A;  3S2A A;  2KD0 A;  2MBQ A;  3ML8 A;  1WXA A;  2IBI B;  3KVF B;  2N7D A;  4AP4 C;  3KUC B;  2K8B A;  1XD3 B;  1WGY A;  3CSF A;  3DVN V;  1SGH A;  1UBQ A;  1UD7 A;  4WJN A;  2KNB A;  2NVU I;  5J2R A;  3IVF A;  3UIN B;  1Q1O A;  2PJH A;  3QK0 A;  2EKE C;  3DDC B;  1L7Y A;  5FR6 A;  2ZNV C;  3ZO5 B;  2N4F A;  3KW5 B;  2IO2 B;  1UEL A;  1ZW7 A;  4KIK B;  1WF9 A;  2ZVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...