2N7EA

Solution structure of the ubl domain of yeast ddi1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
HIEGRHMDLTISNELTGEIYGPIEVSEDMALTDLIALLQADCGFDKTKHDLYYNMDILDSNRTQSLKELGLKTDDLLLIRGKISNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords DNA damage-inducible protein 1
publication title Structural studies of the yeast DNA damage-inducible protein Ddi1 reveal domain architecture of this eukaryotic protein family.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 18
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2015-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2n7eA00
2KC1A 2N9EB 5AZHA 3LDZE 4W9EA 4KZCA 2MX2A 1UGMA 4IM3A 3VH4B 3ECIA 5CHFA 3ZNHB 3L17A 1EF1A 4KVGB 3RD2A 3OJ4B 2FCMA 5C23A 3BY4B 3QA8A 2KQ7A 3PV1A 1P0RA 4FBJB 1WGYA 2GOWA 4AP4C 4ZRKA 4MSQB 1GC7A 4HPMB 2HE7A 4RMAA 1UBQA 3L54A 4M0WB 4EFOA 3VUWA 2AL3A 2KTRA 3DVNU 3UGBB 1I42A 1UBIA 3A33B 3GOEA 3CMMB 2KWUB 3EFUA 4DK5A 1WMHA 2MRPA 2WX0A 2CKHB 4NJ6A 4A3PA 3ZRCA 3RULA 4W9LA 1ZW7A 3PS6A 5KHOA 4F8CB 2AEHA 4ZDVA 2LGXA 4A20A 2D11A 2C60A 1V86A 4HCPB 3QJZA 3ZNID 4ANVA 4AOFA 1C1YB 2IBIB 2KX3A 2JZZA 3HM3A 3KVFB 4MGIE 4URKA 1RRBA 5L95C 2ZPNA 2LGDA 1F9JA 4GDKB 4TV3A 1J0GA 3CF6E 1WXSA 2LRWA 1WI0A 3L13A 3JYUA 1TBEA 3IVFA 2XK5B 1WZ0A 2D2QA 4GSWA 2MSED 2DENB 4BBNC 4GMVA 3B0AA 5JZEB 2CHWA 1WGDA 2L00B 2D07B 3RZFA 5AZGA 4F1SA 3KUCB 4KIKA 2BYFA 1S3SG 3VVWB 2W9NA 4NNJB 1TTNA 4BOSC 3PLVA 2B3AA 4HJKA 3R3MA 3ZIMA 1UELA 4M8MA 2RR9A 1IPGA 5CTRC 1E8ZA 1V80A 3UF8A 1GNUA 2MWSB 3A4RA 3QARA 4W9HA 4MGYE 4EOYA 1RLFA 2JY6A 3APDA 3VAWA 2KFKB 4MH0E 3VUYA 3NZSA 1V49A 2KDBA 3HK0A 2IYDB 2LWPA 5IA7A 3PSEB 3HIZA 3N3KB 3UINB 2EMSA 3HM6X 4KSLC 1RFAA 3DBLI 2O6VD 3AI5A 3P2BA 3R66C 4BKTA 4EUTA 1LFDA 3B1LX 2DZMA 4X57B 4RM8A 4B6WA 2RSUA 3H9DA 4P7IA 3X23A 4AWJA 1WJUA 3O65B 4IUMB 2KMCA 2IY1B 2KJRA 2KZRA 1EF5A 4B9KA 4EKUA 2FIDA 1WX7A 2KTRB 1WJNA 2NPTA 2ZEQA 3PRMB 4FN2A 2JPHA 3VXWA 3HHMA 3NOBA 1GUAB 3PTFC 3APCA 2CU1A 2KJHB 1WJ6A 2V1YA 3Q3JA 3U8ZA 5JHAA 5CHWA 3WAOA 3H6NA 3H7SA 4FLHA 2ZZPB 4BBNF 1Y8RC 3IBEA 4WJPA 5D2MB 4ZRIA 3VUXA 4DHJB 4ANUA 1WX9A 4MGZE 3TIXA 3TBLD 2RPQA 4I6LB 4HXDA 4K1RB 1OGWA 4CHKA 3AXCA 2JRIB 4JL9A 4HVBA 2N7DA 3Q3FA 4XC2A 2MBOA 4IWOA 3ZW3A 2LJ5A 3WALA 2G4SA 4IC7B 3B08A 4ICUA 3PHWB 1M94A 5G55A 3KUDB 4PS3A 5TR5A 1NBFC 3KYDD 3VTUA 1G6JA 4LJPB 1A5RA 3NHEB 1XQQA 3KUZA 2XEWA 5FR6A 4DDID 4EZKA 1QZEA 5DPTA 2PE9A 3WANA 1LM8B 2J0JA 1Q5WB 2HTHA 2MBBB 3UIPB 4KIKB 1UH6A 2J0MA 2J0KA 4FULA 2PJHA 1R4MI 4N9F4 4FADA 1TGZB 3ZDTA 1SIFA 4FJVB 4GDLA 2KHWB 2DX5B 4DHZE 3ML8A 3RYTA 5KHQA 1ZKHA 1V81A 3L0WB 3OAWA 4G50A 3ZKJC 5LXHA 2WX1A 4PYUA 1V5OA 3H7PA 4HDQA 3V61A 3ZDMC 4PS8A 3W1SC 2BWFA 2GMIC 5DPSA 3R7QA 1KLVA 4ZYNA 4TQ0A 4NQLB 3TL5A 1WM3A 4IM2A 4WWNA 5E6OA 5CHVC 2KFJA 2IZVB 1SGHA 2EMTA 2M0XA 2MBEA 3ENEA 2M1MA 3TJPA 1MG8A 2KKCA 3L16A 3ZTDA 3NS8A 3DCGA 2L7RA 1GJZA 1AARA 3DBSA 3OJ3A 1H4RA 4KV2A 3VH3B 1X1MA 2HD5B 3A9JA 2LXCA 4IWQA 1WXVA 5D6JB 4LJOB 2JWZA 4HDOA 1ISNA 3H1UA 1E8XA 1EO6A 2DAFA 1LXDA 2KK8A 4HCNB 2BPSA 3V6CB 3DVNV 4NAWA 3RZWC 5AZFA 4BOZB 3DVGX 3CSFA 1U4AA 4HLEA 2L0TA 4MGKE 3PVLA 5C1ZA 2DHZA 4JIOU 1Q0WB 1V6EA 4WAAA 4E3CA 2MBHA 1JRUA 2PEAA 2LD9A 2ZPYA 2N1WA 2ZNVC 2FCNA 4F7ZA 1OQYA 3MTNB 1VD2A 2MA9B 5DPWA 2I1JA 5HKHA 2NPTB 5G2NA 4WQOB 2KLGA 4K7SA 3VFKA 3A9KB 2KTFA 1EUVB 3R7RA 2BGFA 3VQIA 2CHZA 2IO0B 4WWPA 4II3B 4A3OA 4GXBA 1WX8A 3DQVA 4PYZA 2LZ6A 2FCSA 4I6NB 3LJ3A 4ZRJA 4DDGD 1WIAA 2LGYA 4IM0A 4BKGA 1YD8U 2NCNA 4AJWA 1P98A 2BWES 1WGGA 4EEWA 2KN5A 1CMXB 3QHTA 2N1VA 2GBRA 2O6VB 1E8WA 4FJYA 4FHJA 3ALBA 3W1SA 4GIVA 1FXTB 3VDZA 2ZCCA 3NY5A 4XX5A 5J17A 5JH5C 1WRDB 2LUEA 3PT2B 3QC8B 2ZCBA 5JHBA 1J19A 2LRUA 2R2QA 2CR5A 2M17A 4W9FA 4I6PA 3D32A 5IAAC 3WIMA 3DBRI 2EKEC 2KWVB 3PHXB 2K6DB 4W9JA 3ZVVA 4HK2A 2D10A 2FNJB 2KC2A 4GDLB 4LCDE 3UQAA 4W9IA 2LVPA 3IG3A 2K8CA 4LDTD 3ZTCA 2KLCA 4FHKA 2JUOA 1E5WA 2L05A 3H7PB 3TMPB 3BINA 4JLCA 1TZ1A 1WR6E 3EECA 3A9KA 4NPNA 5J18A 5J2RA 4GN1A 2NBUA 2DZIA 3SD5A 1KOTA 2KANA 3VHTC 2KWCA 1SE9A 1NI2A 1V5TA 2JVCA 2R2OA 3ML9A 2K6QA 3DBHI 3V62A 3VTVA 4DWFA 2RD0A 3ZLZA 5LLIA 3QCAA 4W9CA 2L0FA 4W9KA 3N32A 5CX3A 1WF9A 1WR1A 2LVQA 3EHVA 3X0WA 3ZRFA 2M8SA 2I1KA 2LI5A 3A9JB 1KJTA 5L83A 2KVRA 2O6VA 4XZ4A 1E7UA 2KNBA 3SU8X 1BT0A 4FJZA 3WA0A 1OEYJ 3QIJA 5AEKB 2FIFA 4WWOA 4B95A 2GBKA 2MW5A 3DOWA 5D7GA 4OVVA 1UZXB 1WE7A 3KYCD 1C3TA 1WE6A 2V3SA 5E6NA 4NAWB 3U7DA 4ICVA 2L3ZA 3DPDA 3PPAA 3T9LA 4BVUC 4E74A 2PPHA 1LQBA 2XBBC 3PGEA 4TUUA 3V6EB 3AU5A 4MEMA 3UIOB 4WJOA 2UYZB 2A4ZA 4MSMB 1YJ1A 2LXAA 2MP2A 3VTWA 4KDIC 3ZUNA 2OJRA 2N9XA 4KZ0A 4ANWA 1WXMA 4G3XB 2KDEB 1E7VA 2AYOB 4DXAB 1R4NI 3IHPC 2KX0A 2NVUI 2O2VA 4WJNA 2KXJA 2DZJA 2G45B 5GMVA 2K1FA 4NJ7A 1Q1OA 1WGRA 2FAZA 3ZNZB 4GOCA 3DVGY 3CSTA 2KMAA 3SHQA 3A1QA 4IWPA 2IY0B 2KDIA 1PQSA 2RGFA 4RM9A 4W9DA 1WFYA 5E6PA 1E90A 2N7EA 2C9WB 1P3QU 2Z59B 2CS4A 2GBNA 2MLBA 3KW5B 3IFWB 2IO1B 2A5UA 3MHSD 2JXXA 4MELA 4WJQA 5DPRA 2MBQA 4JQWC 2IO3B 4FA6A 2KO3A 4K7UA 5BO4B 1E8YA 3QQ8B 4GB9A 2BKFA 2C7NB 5D94A 2WYQA 3N30A 2Z0EB 3PRZA 1GG3A 2N4FA 3M95A 3PLUA 1YX5B 2Y5BB 4OVUA 2CHXA 3ONSA 4K81A 1V9JA 1IP9A 1YX6B 2FUHB 2M4NA 2KDFB 3SDLC 4MM3A 1KM7A 1WGHA 2L76A 3JSVA 4IG7B 4MJSA 1WXAA 4HWIB 2MCNB 1I35A 2KQSA 2J7QB 1IYFA 4TQ1A 3M3JA 4BFRA 2V4LA 4G0NB 2KOXA 2Z0DB 4BKSD 2ZVNA 1K8RB 1WYWB 2KJ6A 2K25A 4GGQA 2BF8B 2VRRB 2PE6B 2JRHA 1S1QB 3A4SC 4AJYB 1UD7A 2ZNVB 1Z2MA 4YL8A 3M62B 4DHZB 1WH3A 2NR2A 3OLMD 3C0RB 4EZJA 2IO2B 1WM2A 2ASQA 4PS7A 2YLMA 4JGHB 1WY8A 1VCBA 2C7MB 3QK0A 4KSKC 2YVCA 4M8NA 3K9OB 4TKNA 2DAJA 4MDKE 2OOBB 2DYBA 2GBMA 3JVZX 3W1YA 2DYMA 3M63B 5LXIB 3QAQA 3T8MA 4LDTB 2NBWB 3AULA 1L7YA 1XT9B 2FCQA 3PZDA 1L2NA 1J8CA 3ZNGC 2C5LC 4HPLB 2G3QB 2C7HA 2REXA 4GDKA 3QWZB 3WAMA 4BKSA 1ZGUB 5DCNA 2DYOA 2AL6A 1V2YA 2MP2B 4IW0A 2QHOA 1WJ4A 2G4DB 2ZVOA 1XD3B 4W9GA 2XK5A 1H8CA 3APFA 2WWZA 4K7WA 5EDSA 2AWTA 4KDLB 4NQKE 3MJWA 1P9DU 1YQBA 2D3GA 2O2VB 1RAXA 3I3TB 1OEYA 1WZ3A 1OTRB 4CYEA 3QX1A 2JT4B 3RCZA 2L8JA 2BKRB 3U30A 1GC6A 2K39A 3A1QB 2GBJA 2WDTB 1D3ZA 4NY0A 3EC8A 1NDDA 3ZO5B 3JW0X 2LVOA 1P1AA 2KD0A 3PREA 3KH0A 3PRPB 1WMHB 2BYEA 2UWQA 4AUQC 3S2AA 2MQJA 2ZJDA 2NBVB 2NS5A 2K8BA 2N9PC 2HJ8A 3AU4A 4CO7A 1YIWA 4G11A 4J6IA 3K9PB 4EZLA 4E71A 3UQBA 3TCAA 2DZKA 4ASWC 1T0YA 4ANXA 2LASA 3RUIB 3L10B 4II2B 2JZ3B 2K8HA 3L08A 1Z5SB 2KFKA 3GZNI 2BYVE 3NZUA 2JF5A 3V60A 3WAPA 4DBGA 3DDCB 4DHJD 3RT3B 1HE8A 4GU2A 3JSVB 4MJSB
chains in the Genus database with same CATH superfamily
2KC1A 2N9EB 2QIEB 4W9EA 3VH4B 3L17A 4ZRQA 1EF1A 3OJ4B 2LGSA 3Q3MC 2KQ7A 1P0RA 1XCQL 5EE1A 2UU7A 4AP4C 1JQ4A 4HPMB 1UBQA 3VUWA 2AL3A 3DVNU 3I57A 3CMMB 2KWUB 3EFUA 4A8XC 1D4BA 2MRPA 2L1AA 1UNSA 2QCZA 3AEDB 4W9LA 5KHOA 1F77A 4F8CB 2H88B 2LGXA 3DHIC 2C60A 1V86A 4HCPB 4ANVA 2KX3A 2V0GA 4C4VB 4URKA 3Q8FA 2L52A 3GP7A 5L95C 2ZPNA 4TV3A 1WXSA 2LRWA 1WI0A 1FIQA 3JYUA 3B0AA 1WGDA 2L00B 2D07B 3RZFA 4F1SA 1ZP0B 2BYFA 3PLVA 4HJKA 1MHHE 3ZIMA 2RR9A 2G9HD 2BW2A 1IPGA 1SEBD 1I7HA 4IOIE 2N9KA 2BTEA 4CQNA 3QARA 4W9HA 5FKAC 1RLFA 3VAWA 2KFKB 5HHDG 3NZSA 3VUYA 1V49A 2I2YA 3HK0A 3W2DA 2PVOD 2IGGA 3PSEB 5IN7A 1YN5A 1WYGA 3R66C 1WGKA 2WXLA 1VDVA 2Y5PA 1SJHD 4H2AA 1FM0D 4P7IA 2KZRA 4B9KA 4EKUA 2FIDA 3HVZA 3AEAB 1ZE3D 4ZHPA 3VXWA 2INDC 3ZGZA 1GUAB 3APCA 2CU1A 2V1YA 5JHAA 3N1XC 4BAXA 4BBNF 1Y8RC 5BYSA 4ZRIA 3VUXA 2NMQA 4ANUA 1WX9A 4R3DA 5C2TB 3TBLD 4WAFA 1ROEA 4I6LB 4HXDA 3AXCA 2MBOA 4EE2A 3GS2A 4RNAA 2L83A 3PHWB 4A9AA 1A70A 1NBFC 3KYDD 3VTUA 3NHEB 3KUZA 2XEWA 4PK1A 1QZEA 2PE9A 3TUOA 3BZDB 4P6VF 3UIPB 3KWVA 2J0KA 4N9F4 1TGZB 4DHZE 2DX5B 1XF5L 4M02A 1V81A 3OAWA 2WX1A 3ZYYX 4HDQA 4RGNA 4TSSA 3V61A 2IPKD 2BWFA 2GMIC 4P1BC 3P1MA 4WWNA 5CHVC 2M0XA 2IZVB 2EMTA 3TJPA 2KKCA 2L7RA 1AARA 1QQRA 3I5JC 3DBHB 2GI9A 4YTPB 3T3OA 1TZOA 5D6JB 2B76B 3H1UA 1E8XA 1C77A 2BPSA 2AQ1B 1U4AA 3PVLA 1Q0WB 2MBHA 1FFUA 2LD9A 1TT5B 3MTNB 1SB3C 1FNUA 3I63C 1JWMD 4WQOB 3AEGB 4ARIA 3VQIA 2CHZA 1NYRA 4WWPA 4A3OA 4GXBA 3GB1A 1WIAA 1P98A 4NZLB 4RF0A 3TEXA 1FD6A 2ZW0A 2H89B 2ZCCA 1JMLA 5J17A 2ZCBA 4W9FA 4I6PA 4WH4A 3D32A 1SE4A 3DBRI 1QF6A 2KWVB 3PO0A 2D10A 3UQAA 2ICIA 4W9IA 4HKQA 3IG3A 3ZTCA 3BVZA 3U4EG 2L05A 2WDRB 1YQ4B 1WR6E 1VR9A 3A9KA 5IO9A 3W5VB 1KFYB 2NBUA 2D3AA 2DZIA 4GN1A 1KOTA 1SE9A 1BMLC 2K6QA 2RD0A 2WXIA 3ZLZA 2L0FA 1WF9A 4HKZE 2V9HA 2QDFA 1TY0A 2M8SA 1CZPA 5H8YE 2LI5A 2O6VA 4XZ4A 1AYFA 4FJZA 4LNFA 2WQYB 4OVVA 5BMGA 1K52A 4BVUC 3T9LA 1XEEA 4OZCA 3V6EB 4RGOS 1T0QC 3IT4B 4OW0A 4KZ0A 4ANWA 2D3BA 2V3NA 1E7VA 2W3SA 3AE4B 2KX0A 2O2VA 1JALA 2K1FA 4NJ7A 1WGRA 2FAZA 3DVGY 1QLBB 3U52E 2KDIA 4W9DA 4D2KA 1MI0A 2N7EA 2JXXA 1IGDA 1MPEA 3MP9A 2WU5B 1E8YA 3QQ8B 4GB9A 2BKFA 3N30A 3PRZA 3M95A 2Y5BB 3ONSA 1V9JA 1IP9A 2KDFB 4MM3A 1KM7A 1WGHA 2L76A 4IG7B 3Q3OC 3GZNB 4HWIB 3U7ZA 3IT6B 2J7QB 3AEFB 4TQ1A 1QOAA 2INPE 2V4LA 3RNGC 1K8RB 1TIFA 2KJ6A 3BK1A 1PGXA 3NG0A 3WCQA 4S17A 2PE6B 2JRHA 3ABVB 2BYTA 1S1QB 1HZ5A 1PUTA 1FNWA 2ZNVB 4LTUA 1WH3A 4EZJA 2OJWA 1WM2A 1KRHA 3P63A 1WY8A 3ZQ4A 1RYJA 4KSKC 4M8NA 4TKNA 2OOBB 2DYBA 3JVZX 1C4AA 1L6UA 3QAQA 3T8MA 2NBWB 1L7YA 4ACFA 3PZDA 2BT6A 2C7HA 2REXA 2DYOA 1N6ZA 2ZVOA 2XK5A 2WDVB 2WWZA 1I4RA 4L1BA 2O2VB 1C4CA 2NTSA 1OEYA 2R61A 4CYEA 3RPFC 2BKRB 2JXTA 1GC6A 2GBJA 1JWSD 2N0SB 3FKYA 2IDYA 3JW0X 2ONQA 3P4QB 2BYEA 2UWQA 1T3QA 3S2AA 3AU4A 2LHEA 2N9PC 5D3IB 2XNAC 3IAM1 1PGAA 4EZLA 3UQBA 4II2B 1LGRA 1Z5SB 3V60A 2JF5A 3GE8C 5LNK1 3TEZA 2TSSA 3U2SC 4IM3A 3ECIA 5CHFA 2WP9B 4KVGB 3QA8A 3PV1A 3RFZB 3DBLB 2FE8A 4C56C 5E6JA 2GOWA 3RI7C 2Y3AA 4EFOA 2KTRA 4YXDB 1WMHA 2FUG1 1ET9A 2QMTA 2W55A 1C1YB 2IBIB 2YEPB 4HEA1 2JZZA 1CQVA 4MGIE 1XLNA 1WXQA 2KWDA 2AX5A 1J0GA 3N1ZC 2BS2B 3IVFA 4KKJA 2XK5B 4C80A 2D2QA 4GSWA 2MSED 4XDCA 4GMVA 5JZEB 3J9CA 4KIKA 1TKYA 2W9NA 1TTNA 2XN9C 1KH0A 1YJIA 3DHGC 4LNOA 3R3MA 1UELA 4ZOHC 1V80A 3UF8A 1TS3A 2LHDA 3A4RA 4QAYA 4DXGA 2JYTA 2KDMA 4EOYA 1N62A 3P42A 2JY6A 3TSSA 3APDA 3Q8CA 2KDBA 5IA7A 3ZXVA 4Q2JA 3N3KB 3VR9B 2LUMA 4KSLC 3R2TA 4RGMA 1E7PB 1FCLA 3B1LX 4X57B 3MC9A 3X23A 1NI3A 4AWJA 1L0VB 2KMCA 2KJRA 1EF5A 2JZPA 2KTRB 2NPTA 2ZEQA 2JPHA 1TS2A 3HHMA 1HZ6A 4FLHA 2BS4B 4WJPA 4K1RB 4CHKA 2JRIB 3Q3FA 4XC2A 3SR6A 1M94A 1TYGB 4LJPB 1A5RA 3RN9C 4DDID 5DPTA 4MH8A 1K53A 1Q5WB 2WXGA 4KIKB 4FULA 4FADA 4GDLA 2LGIA 1ZKHA 2BB6A 3ZKJC 4AS1A 3VRAB 3NZ3A 3W1SC 1VRAB 5FR3A 1KLVA 3ENEA 2MBEA 1PYWD 5AUKA 1MG8A 3L16A 3NS8A 2KACA 3DBSA 3NS1A 2RDHA 2IGHA 1H4RA 2WXMA 3VH3B 1HXYD 1X1MA 2HD5B 4IWQA 3C19A 1WXVA 1UWXA 2WXNA 1FFVA 2JWZA 1ISNA 1MFWA 1LXDA 4RH6A 4YT0B 2L0TA 2X38A 1ZUD2 4JIOU 4E3CA 2QC8A 2ZPYA 4F7ZA 4YTNB 1VD2A 2I1JA 1OQQA 1V1PA 5HKHA 2NPTB 2KLGA 3VFKA 2BGFA 4PYZA 4P1CC 2LZ6A 3TEYA 3LJ3A 4DDGD 1OFFA 1YD8U 1R4NB 2E6XA 1ZXIA 4EEWA 2D3CA 3QHTA 2N1VA 3MC8A 1E8WA 1L5PA 1QOGA 3ALBA 4GIVA 3BWUD 4XX5A 5JH5C 3PT2B 1SBBB 5JHBA 1IUEA 1J19A 2LRUA 2R2QA 2M17A 3ZXRA 3Q6BA 2HDEA 4US9A 3WIMA 2L32A 4W9JA 4LCDE 2FNJB 2KC2A 4GDLB 2LVPA 4LDTD 1QOBA 2JUOA 2KQ4X 3BINA 5D3DA 3EECA 2KANA 1FMAD 3DBHI 3VR8B 3VTVA 5IKCM 3UI3A 3EUB2 4W9KA 3N32A 5CX3A 2KN4A 3X0WA 2KVRA 1E7UA 2KNBA 3P4RB 3QIJA 4B95A 4WWOA 4YWGG 2GBKA 2V3PA 3AEBB 4RCOA 1C3TA 2V3SA 2PIAA 1DOXA 3DPDA 3EGRA 3Q14C 3AU5A 1AWDA 3FILA 2LXAA 2MP2A 3ZUNA 4KDIC 1V1PB 4DXFA 2N9XA 4G3XB 4XDDA 2G45B 1NVID 3N20C 5EE9A 3ZNZB 1SE3A 3URYA 3V05A 1JW9D 2C9WB 4OVZA 4YSXB 2MLBA 2DLBA 3IFWB 1VZ7A 4MELA 1ACCA 2MBQA 2BS3B 3AE1B 4JQWC 3RNCC 4A90A 1EU4A 4K7UA 1B1ZA 1SXTA 5D94A 2WYQA 2CJNA 4OVUA 1KTKA 2CHXA 4IKGA 1YX6B 1ESFA 4PT5A 4JWUC 1P7FA 2MCNB 2KQSA 3AE7B 1I35A 2DWQA 4BFRA 1F2RI 1F52A 2JSVX 1EM7A 1XLQA 3AE9B 2WXKA 3PZ7A 2WXOA 2X8XX 2VRRB 3A4SC 1K50A 1YN3A 2G1EA 3IXSA 2NR2A 3AM9A 3C0RB 3HRDD 4LLGM 2YLMA 5C3JB 1VCBA 3H8HA 3QK0A 3BVMA 2DAJA 4MDKE 5MPOA 2GBMA 4OZBA 4LDTB 3VRBB 4MACA 4JPSA 1EWYC 1L2NA 2C5LC 3TEWA 2G3QB 4GDKA 3FILB 2Z8LA 5DCNA 2AL6A 2MP2B 4IW0A 2GRIA 4W9GA 1H8CA 2N9LA 2AWTA 2INCC 1ZOYB 1WZ3A 3E9SA 2HTME 2JT4B 3AE8B 3U30A 4RGTA 2K39A 2WDQB 1D3ZA 1DOYA 4NY0A 1WWTA 1NDDA 4N6EB 4YSYB 3AH7A 1IGCA 4HROA 3RMKC 1T0RC 1YIWA 2BB5A 1JWBD 4ANXA 1N5WA 2JZ3B 2K8HA 3HUIA 3GZNI 1J7CA 3DDCB 4DHJD 3RT3B 4GU2A 3Q8EA 5BYQA 1WSPA 3ZJVA 1UGMA 3OG5A 3RD2A 2FCMA 4FBJB 1WGYA 3AE3B 5EE3A 1M4VA 2HE7A 3DBRB 1FXAA 3A33B 3GOEA 2WXQA 4DK5A 2LMCA 2WX0A 4A3PA 4HPPA 1XO3A 2AEHA 4A20A 2OEDA 1L4ZB 3ZNID 4AOFA 5EE0A 2MH7A 2MEKA 3HM3A 3KVFB 3PZ8A 1RRBA 3BYTB 5G5HA 2MJEA 3RNBC 2J4XA 2LGDA 4GDKB 2WXRA 4C7ZA 4JE3B 3LYYA 2N7JA 5BYRA 1WZ0A 2DENB 2CHWA 5AZGA 1HTQA 1FO4A 2KYWA 3E56A 1RWSA 1J7BA 4BOSC 2B3AA 1I4GA 1D6EC 1YNTE 4M8MA 1R4MB 1E0ZA 3BIID 2J53A 3MJ5A 4MGYE 4P16A 1ENFA 1MVKA 2SEBD 2IYDB 2CJOA 2LWPA 2PW9A 3HM6X 1RFAA 3DBLI 1Q10A 1LFDA 4C7YA 1F2RC 2DZMA 2PTLA 4RM8A 2MJ3A 3O65B 4IUMB 1NEKB 1D5ZC 1V1OA 1WX7A 1WJNA 3PRMB 1D5XC 4FN2A 3NOBA 3SFEB 2KJHB 3Q3JA 3U8ZA 3NRZA 1TS5A 3H7SA 4DHJB 4MGZE 3R2IA 5H92C 1OGWA 2N7DA 2G4SA 3BVGA 4ICUA 2JYEA 3KUDB 4PS3A 5TR5A 1G6JA 5T8IA 4US8A 1XQQA 3FAHA 2J0JA 2HTHA 2MBBB 1UH6A 2J0MA 5BMHA 3ZDTA 3P4SB 4FJVB 4HJGE 3RYTA 3L0WB 4G50A 5LXHA 1R7SA 1OQRA 1FCCC 3ZDMC 5DPSA 3AE2B 1DOIA 4TQ0A 1WM3A 4IM2A 5E6OA 1SGHA 2M1MA 3OJ3A 4ZRPA 1KF6B 4KV2A 2RDGA 2LXCA 3NJTA 4LJOB 4HDOA 1TS4A 1EO6A 2DAFA 3RZWC 3CSFA 4B0EA 4HLEA 1TKEA 4WAAA 2WS3B 2N1WA 2ZNVC 1I4HA 3MHZA 1I4XA 4S0RA 1OQYA 3AMZA 2Y5CA 4K7SA 1Y56A 1JWAD 1SJED 1EUVB 3R7RA 2IO0B 1BUIC 1WX8A 2VZKD 3DQVA 4ZRJA 1L4DB 4BKGA 4LNKA 4AJWA 2WNMA 4OHJA 2KN5A 1CMXB 1ZPSA 4FJYA 3VDZA 1SSNA 3NY5A 2JWUA 1MG4A 2CR5A 2RMMA 1C4PA 5IAAC 1TKGA 2EKEC 3DWMA 2K6DB 3ZVVA 1AN8A 4ZYSA 4HK2A 2W82A 5I4DA 2KLCA 4FHKA 1E5WA 3TMPB 4JLCA 5J18A 1I4QA 1EWCA 3NVYA 2KWCA 2I38A 2K9XA 2JVCA 4DWFA 1T5XD 5LLIA 3QCAA 4W9CA 2LVQA 3EHVA 3OWEB 1VJKA 3ZRFA 1V8CA 1KJTA 1UWMA 3KQ4A 3WA0A 2BBCA 2ON8A 1GB4A 1UZXB 1E6EB 2L3ZA 4ICVA 4N59A 2PPHA 1LQBA 2XBBC 2V4IB 3UIOB 4WJOA 1C76A 2A4ZA 1VZ8A 2IJ0A 3VTWA 2J52A 2OJRA 3L4PA 2AYOB 1STEA 1R4NI 3IHPC 2NVUI 3GE3C 5TSSA 2KXJA 2DZJA 5GMVA 2DBYA 2DNFA 1Q1OA 4GOCA 4XWTA 3SHQA 1E10A 4IWPA 2RGFA 1PQSA 4RM9A 1GOZA 1WFYA 5E6PA 1E90A 1P3QU 1XCTL 2CS4A 2GBNA 2WXPA 3CIRB 3MHSD 3KW5B 2A5UA 1C78A 1YN4A 2IO3B 2M19A 4FA6A 2KO3A 5BO4B 2MJDA 3W9CB 2C7NB 2PLPA 2QJLA 2Z0EB 1GG3A 2N4FA 1YX5B 4O1NA 4K81A 3SDLC 1FEHA 4MJSA 1WXAA 2VZKB 2HJ1A 1HQRD 4G0NB 2KOXA 1SF0A 4LK0M 2PKOA 4GGQA 4WWMA 3SEBA 1UD7A 4M0WA 2D5GA 1Z2MA 3M62B 4B0MA 1ZXHA 4JGHB 2WXFA 1YMHE 2C7MB 2MHJA 3K9OB 2DYMA 4A6QA 5LXIB 3AULA 4J3OD 1XT9B 1FPYA 3ZNGC 4HPLB 3Q2AC 1YJJA 1ZGUB 1V2YA 3AE5B 1RFKA 2QHOA 1XD3B 3APFA 5EDSA 1T6BX 1P9DU 1YQBA 1OTRB 4KKIA 1L0XB 4DQOC 1C9FA 1QKZA 4XE0A 3NVZA 2WDTB 3RNEC 3EC8A 2LVOA 1P1AA 3PRPB 2KMMA 2ZJDA 2NS5A 4CO7A 2HJ8A 4J6IA 4NJCA 1XLOA 1T0YA 3ETRA 2LASA 3L10B 3NZUA 3WAPA 4DBGA 3P4PB 1HE8A 4MJSB 2WHIA 5AZHA 3LDZE 4KZCA 2MX2A 3RNFC 3ZNHB 2CU3A 4KGSA 5C23A 3BY4B 1FRDA 1AW7A 1HA5A 2PVGC 4GLSC 4ZRKA 4MSQB 1JCKB 1GC7A 2AQ3B 4RMAA 3L54A 4M0WB 1J7AA 3UGBB 1I42A 4ITKA 1UBIA 1F1HA 2WLBA 1TJEA 4NJ6A 2CKHB 3ZRCA 3RULA 4M00A 1ZW7A 3PS6A 1KLGD 4ZDVA 1UF0A 3MC0B 2D11A 2SAKA 2WGSA 3QJZA 4RFBA 3B2GA 4WURA 3LXFA 1F0ZA 2KVZA 1JWUD 1F9JA 3CF6E 2W54A 3L13A 1GB1A 1TBEA 1YQ3B 4BBNC 1DYQA 3KUCB 1S3SG 3VVWB 2JX5A 4NNJB 4L23A 1I4PA 1CK1A 5CTRC 1E8ZA 1GNUA 2MWSB 1WRIA 2QILA 1C79A 5IOIA 1BXTA 4MH0E 3HIZA 1P7EA 3N1YC 3UINB 2EMSA 2O6VD 2WXHA 3AI5A 3P2BA 4BKTA 4EUTA 4B6WA 2KAJA 2RSUA 3H9DA 1WJUA 1HEZE 2IY1B 3B2FA 2PMVA 3CWIA 4XWWA 5GXGB 2RDBC 4A55A 1D5MC 3PTFC 1WJ6A 2AQ2B 5CHWA 1ZDVA 3WAOA 5G5GA 1IBXA 3H6NA 2ZZPB 2BQQA 3IBEA 3KWLA 5D2MB 1LO5D 3TIXA 1QOFA 3KLSX 2RPQA 2JQRB 2ZW1A 4JL9A 4HVBA 3W5UB 4IWOA 3ZW3A 2LJ5A 3WALA 4IC7B 3B08A 5G55A 1N61A 5FR6A 1UGJA 4EZKA 1VZ6A 3WANA 1LM8B 4LNIA 2GB1A 2PJHA 1R4MI 1MHXA 4K3BA 4JWSC 1SIFA 3N9YC 5JXVA 2KHWB 5KHQA 3ML8A 1PGBA 4PYUA 5FK9C 3Q3NC 1V5OA 3H7PA 4PS8A 2RPVA 5IP4D 3R7QA 4ZYNA 4REZA 4NQLB 3TL5A 2KFJA 3ZJTA 3ZTDA 3DCGA 1CJEA 1GJZA 3RNAC 1T0SC 1YOVB 2QEJC 3A9JA 2LFIA 3AE6B 1L0YB 1QT9A 2KK8A 4HCNB 3FC4A 3V6CB 3DVNV 4NAWA 5AZFA 4BOZB 3DVGX 4MGKE 1MJDA 3AEEB 5C1ZA 2DHZA 1V6EA 4YTMB 1JRUA 2PEAA 2M56B 4AQ7A 2FCNA 2MA9B 5DPWA 2W3RA 5G2NA 3A9KB 2KTFA 4JX1C 2VH1A 1IBXB 4II3B 4OZAA 1V97A 3T3NA 3V3XA 2FCSA 4I6NB 3NVWA 1JROA 4XGAB 2LGYA 4IM0A 3HVDA 2NCNA 1PDXA 3MFGA 2BWES 3Q8BA 1WGGA 4WQMA 2K3UA 2GBRA 2INNE 4L2YA 2O6VB 2EKIA 3SFDB 2K5PA 2Q5WD 4FHJA 1VLBA 3W1SA 3NVVA 1FXTB 1WRDB 2LUEA 3QC8B 4NAMA 3AB5A 2WXJA 3PHXB 2LEKA 5BMIA 4KGTA 1FXIA 2NTTA 5HFYA 2K8CA 3H7PB 2J42A 3EA6A 1TZ1A 5J2RA 4NPNA 4XYCA 3SD5A 3VHTC 2E3TA 1NI2A 1V5TA 1GPXA 5AUIA 2R2OA 2K22A 3ML9A 3V62A 1NYQA 1WR1A 2I1KA 5L83A 2JU6X 3A9JB 1N60A 4UDUC 3SU8X 1BT0A 4M01A 1JRPA 1OEYJ 5AEKB 2FIFA 2MW5A 3LB8C 3DOWA 5D7GA 1WE7A 3KYCD 1WE6A 5E6NA 1GAQB 4NAWB 3U7DA 1XLPA 3PPAA 4HRSA 4E74A 1FRRA 3PGEA 4TUUA 3DHHC 4MEMA 4N58A 2UYZB 4MSMB 4MM3B 1YJ1A 3EFCA 4LNNA 1TY2A 1WXMA 4KGRA 3R8BA 2KDEB 1HTOA 4KX6B 5HI1A 4DXAB 1FNVA 1K51A 4WJNA 4IDIA 2QSDA 1N63A 1PFDA 1NENB 3I9V1 2K0PA 3CSTA 2KMAA 3A1QA 2IY0B 1SIJA 2Z59B 5DPRA 2IO1B 4WJQA 1EU3A 2BVCA 3O13A 1UUPA 2KT7A 3PLUA 2FUHB 2M4NA 1DGJA 3JSVA 3DWGC 3C8YA 4WIPA 3BYYB 1IYFA 3M3JA 2Z0DB 4BKSD 2ZVNA 1WYWB 2K25A 2BF8B 2M0AA 4AJYB 3AN1A 4DHZB 4YL8A 3OLMD 4K3CA 2LJIA 2WU2B 2IO2B 2ASQA 4PS7A 1XXGA 4C00A 3BK2A 3AV8A 2YVCA 3AECB 3W1YA 3M63B 1SE2A 4MT5A 2GLSA 1N5XA 4C4VA 2YEPF 2FCQA 3ZJUA 1J8CA 2OHFA 3QWZB 3WAMA 4BKSA 1E9MA 1WJ4A 2G4DB 4TMAB 4K7WA 3B9JA 4KDLB 4NQKE 3MJWA 2D3GA 1RAXA 3I3TB 4YSZB 3QX1A 3RCZA 2FBWB 2L8JA 3IAS1 2IGDA 2EELA 3A1QB 4ARCA 1KLUD 1L6VA 3ZO5B 4USAA 2KD0A 3PREA 3KH0A 4ZHOA 1WMHB 1B9RA 4AUQC 2MQJA 4BZAA 4RF1A 2NBVB 2K8BA 3NUHB 1QILA 5HG2A 4FXCA 4G11A 1ET6A 3K9PB 1RM6C 4E71A 2ACZB 3TCAA 2DZKA 3Q8AA 4ASWC 3RUIB 1ZDXA 3L08A 2KFKA 2BYVE 2VH2A 3JSVB 3Q69A
chains in the Genus database with same CATH topology
2KC1A 2N9EB 5AZHA 3LDZE 4W9EA 4KZCA 2MX2A 1UGMA 4IM3A 3VH4B 3ECIA 5CHFA 3ZNHB 3L17A 1EF1A 4KVGB 3RD2A 3OJ4B 2FCMA 5C23A 3BY4B 3QA8A 2KQ7A 3PV1A 1P0RA 4FBJB 1WGYA 2GOWA 4AP4C 4ZRKA 4MSQB 1GC7A 4HPMB 2HE7A 4RMAA 1UBQA 3L54A 4M0WB 4EFOA 3VUWA 2AL3A 2KTRA 3DVNU 3UGBB 1I42A 1UBIA 3A33B 3GOEA 3CMMB 2KWUB 3EFUA 4DK5A 1WMHA 2MRPA 2WX0A 2CKHB 4NJ6A 4A3PA 3ZRCA 3RULA 4W9LA 1ZW7A 3PS6A 5KHOA 4F8CB 2AEHA 4ZDVA 2LGXA 4A20A 2D11A 2C60A 1V86A 4HCPB 3QJZA 3ZNID 4ANVA 4AOFA 1C1YB 2IBIB 2KX3A 2JZZA 3HM3A 3KVFB 4MGIE 4URKA 1RRBA 5L95C 2ZPNA 2LGDA 1F9JA 4GDKB 4TV3A 1J0GA 3CF6E 1WXSA 2LRWA 1WI0A 3L13A 3JYUA 1TBEA 3IVFA 2XK5B 1WZ0A 2D2QA 4GSWA 2MSED 2DENB 4BBNC 4GMVA 3B0AA 5JZEB 2CHWA 1WGDA 2L00B 2D07B 3RZFA 5AZGA 4F1SA 3KUCB 4KIKA 2BYFA 1S3SG 3VVWB 2W9NA 4NNJB 1TTNA 4BOSC 3PLVA 2B3AA 4HJKA 3R3MA 3ZIMA 1UELA 4M8MA 2RR9A 1IPGA 5CTRC 1E8ZA 1V80A 3UF8A 1GNUA 2MWSB 3A4RA 3QARA 4W9HA 4MGYE 4EOYA 1RLFA 2JY6A 3APDA 3VAWA 2KFKB 4MH0E 3VUYA 3NZSA 1V49A 2KDBA 3HK0A 2IYDB 2LWPA 5IA7A 3PSEB 3HIZA 3N3KB 3UINB 2EMSA 3HM6X 4KSLC 1RFAA 3DBLI 2O6VD 3AI5A 3P2BA 3R66C 4BKTA 4EUTA 1LFDA 3B1LX 2DZMA 4X57B 4RM8A 4B6WA 2RSUA 3H9DA 4P7IA 3X23A 4AWJA 1WJUA 3O65B 4IUMB 2KMCA 2IY1B 2KJRA 2KZRA 1EF5A 4B9KA 4EKUA 2FIDA 1WX7A 2KTRB 1WJNA 2NPTA 2ZEQA 3PRMB 4FN2A 2JPHA 3VXWA 3HHMA 3NOBA 1GUAB 3PTFC 3APCA 2CU1A 2KJHB 1WJ6A 2V1YA 3Q3JA 3U8ZA 5JHAA 5CHWA 3WAOA 3H6NA 3H7SA 4FLHA 2ZZPB 4BBNF 1Y8RC 3IBEA 4WJPA 5D2MB 4ZRIA 3VUXA 4DHJB 4ANUA 1WX9A 4MGZE 3TIXA 3TBLD 2RPQA 4I6LB 4HXDA 4K1RB 1OGWA 4CHKA 3AXCA 2JRIB 4JL9A 4HVBA 2N7DA 3Q3FA 4XC2A 2MBOA 4IWOA 3ZW3A 2LJ5A 3WALA 2G4SA 4IC7B 3B08A 4ICUA 3PHWB 1M94A 5G55A 3KUDB 4PS3A 5TR5A 1NBFC 3KYDD 3VTUA 1G6JA 4LJPB 1A5RA 3NHEB 1XQQA 3KUZA 2XEWA 5FR6A 4DDID 4EZKA 1QZEA 5DPTA 2PE9A 3WANA 1LM8B 2J0JA 1Q5WB 2HTHA 2MBBB 3UIPB 4KIKB 1UH6A 2J0MA 2J0KA 4FULA 2PJHA 1R4MI 4N9F4 4FADA 1TGZB 3ZDTA 1SIFA 4FJVB 4GDLA 2KHWB 2DX5B 4DHZE 3ML8A 3RYTA 5KHQA 1ZKHA 1V81A 3L0WB 3OAWA 4G50A 3ZKJC 5LXHA 2WX1A 4PYUA 1V5OA 3H7PA 4HDQA 3V61A 3ZDMC 4PS8A 3W1SC 2BWFA 2GMIC 5DPSA 3R7QA 1KLVA 4ZYNA 4TQ0A 4NQLB 3TL5A 1WM3A 4IM2A 4WWNA 5E6OA 5CHVC 2KFJA 2IZVB 1SGHA 2EMTA 2M0XA 2MBEA 3ENEA 2M1MA 3TJPA 1MG8A 2KKCA 3L16A 3ZTDA 3NS8A 3DCGA 2L7RA 1GJZA 1AARA 3DBSA 3OJ3A 1H4RA 4KV2A 3VH3B 1X1MA 2HD5B 3A9JA 2LXCA 4IWQA 1WXVA 5D6JB 4LJOB 2JWZA 4HDOA 1ISNA 3H1UA 1E8XA 1EO6A 2DAFA 1LXDA 2KK8A 4HCNB 2BPSA 3V6CB 3DVNV 4NAWA 3RZWC 5AZFA 4BOZB 3DVGX 3CSFA 1U4AA 4HLEA 2L0TA 4MGKE 3PVLA 5C1ZA 2DHZA 4JIOU 1Q0WB 1V6EA 4WAAA 4E3CA 2MBHA 1JRUA 2PEAA 2LD9A 2ZPYA 2N1WA 2ZNVC 2FCNA 4F7ZA 1OQYA 3MTNB 1VD2A 2MA9B 5DPWA 2I1JA 5HKHA 2NPTB 5G2NA 4WQOB 2KLGA 4K7SA 3VFKA 3A9KB 2KTFA 1EUVB 3R7RA 2BGFA 3VQIA 2CHZA 2IO0B 4WWPA 4II3B 4A3OA 4GXBA 1WX8A 3DQVA 4PYZA 2LZ6A 2FCSA 4I6NB 3LJ3A 4ZRJA 4DDGD 1WIAA 2LGYA 4IM0A 4BKGA 1YD8U 2NCNA 4AJWA 1P98A 2BWES 1WGGA 4EEWA 2KN5A 1CMXB 3QHTA 2N1VA 2GBRA 2O6VB 1E8WA 4FJYA 4FHJA 3ALBA 3W1SA 4GIVA 1FXTB 3VDZA 2ZCCA 3NY5A 4XX5A 5J17A 5JH5C 1WRDB 2LUEA 3PT2B 3QC8B 2ZCBA 5JHBA 1J19A 2LRUA 2R2QA 2CR5A 2M17A 4W9FA 4I6PA 3D32A 5IAAC 3WIMA 3DBRI 2EKEC 2KWVB 3PHXB 2K6DB 4W9JA 3ZVVA 4HK2A 2D10A 2FNJB 2KC2A 4GDLB 4LCDE 3UQAA 4W9IA 2LVPA 3IG3A 2K8CA 4LDTD 3ZTCA 2KLCA 4FHKA 2JUOA 1E5WA 2L05A 3H7PB 3TMPB 3BINA 4JLCA 1TZ1A 1WR6E 3EECA 3A9KA 4NPNA 5J18A 5J2RA 4GN1A 2NBUA 2DZIA 3SD5A 1KOTA 2KANA 3VHTC 2KWCA 1SE9A 1NI2A 1V5TA 2JVCA 2R2OA 3ML9A 2K6QA 3DBHI 3V62A 3VTVA 4DWFA 2RD0A 3ZLZA 5LLIA 3QCAA 4W9CA 2L0FA 4W9KA 3N32A 5CX3A 1WF9A 1WR1A 2LVQA 3EHVA 3X0WA 3ZRFA 2M8SA 2I1KA 2LI5A 3A9JB 1KJTA 5L83A 2KVRA 2O6VA 4XZ4A 1E7UA 2KNBA 3SU8X 1BT0A 4FJZA 3WA0A 1OEYJ 3QIJA 5AEKB 2FIFA 4WWOA 4B95A 2GBKA 2MW5A 3DOWA 5D7GA 4OVVA 1UZXB 1WE7A 3KYCD 1C3TA 1WE6A 2V3SA 5E6NA 4NAWB 3U7DA 4ICVA 2L3ZA 3DPDA 3PPAA 3T9LA 4BVUC 4E74A 2PPHA 1LQBA 2XBBC 3PGEA 4TUUA 3V6EB 3AU5A 4MEMA 3UIOB 4WJOA 2UYZB 2A4ZA 4MSMB 1YJ1A 2LXAA 2MP2A 3VTWA 4KDIC 3ZUNA 2OJRA 2N9XA 4KZ0A 4ANWA 1WXMA 4G3XB 2KDEB 1E7VA 2AYOB 4DXAB 1R4NI 3IHPC 2KX0A 2NVUI 2O2VA 4WJNA 2KXJA 2DZJA 2G45B 5GMVA 2K1FA 4NJ7A 1Q1OA 1WGRA 2FAZA 3ZNZB 4GOCA 3DVGY 3CSTA 2KMAA 3SHQA 3A1QA 4IWPA 2IY0B 2KDIA 1PQSA 2RGFA 4RM9A 4W9DA 1WFYA 5E6PA 1E90A 2N7EA 2C9WB 1P3QU 2Z59B 2CS4A 2GBNA 2MLBA 3KW5B 3IFWB 2IO1B 2A5UA 3MHSD 2JXXA 4MELA 4WJQA 5DPRA 2MBQA 4JQWC 2IO3B 4FA6A 2KO3A 4K7UA 5BO4B 1E8YA 3QQ8B 4GB9A 2BKFA 2C7NB 5D94A 2WYQA 3N30A 2Z0EB 3PRZA 1GG3A 2N4FA 3M95A 3PLUA 1YX5B 2Y5BB 4OVUA 2CHXA 3ONSA 4K81A 1V9JA 1IP9A 1YX6B 2FUHB 2M4NA 2KDFB 3SDLC 4MM3A 1KM7A 1WGHA 2L76A 3JSVA 4IG7B 4MJSA 1WXAA 4HWIB 2MCNB 1I35A 2KQSA 2J7QB 1IYFA 4TQ1A 3M3JA 4BFRA 2V4LA 4G0NB 2KOXA 2Z0DB 4BKSD 2ZVNA 1K8RB 1WYWB 2KJ6A 2K25A 4GGQA 2BF8B 2VRRB 2PE6B 2JRHA 1S1QB 3A4SC 4AJYB 1UD7A 2ZNVB 1Z2MA 4YL8A 3M62B 4DHZB 1WH3A 2NR2A 3OLMD 3C0RB 4EZJA 2IO2B 1WM2A 2ASQA 4PS7A 2YLMA 4JGHB 1WY8A 1VCBA 2C7MB 3QK0A 4KSKC 2YVCA 4M8NA 3K9OB 4TKNA 2DAJA 4MDKE 2OOBB 2DYBA 2GBMA 3JVZX 3W1YA 2DYMA 3M63B 5LXIB 3QAQA 3T8MA 4LDTB 2NBWB 3AULA 1L7YA 1XT9B 2FCQA 3PZDA 1L2NA 1J8CA 3ZNGC 2C5LC 4HPLB 2G3QB 2C7HA 2REXA 4GDKA 3QWZB 3WAMA 4BKSA 1ZGUB 5DCNA 2DYOA 2AL6A 1V2YA 2MP2B 4IW0A 2QHOA 1WJ4A 2G4DB 2ZVOA 1XD3B 4W9GA 2XK5A 1H8CA 3APFA 2WWZA 4K7WA 5EDSA 2AWTA 4KDLB 4NQKE 3MJWA 1P9DU 1YQBA 2D3GA 2O2VB 1RAXA 3I3TB 1OEYA 1WZ3A 1OTRB 4CYEA 3QX1A 2JT4B 3RCZA 2L8JA 2BKRB 3U30A 1GC6A 2K39A 3A1QB 2GBJA 2WDTB 1D3ZA 4NY0A 3EC8A 1NDDA 3ZO5B 3JW0X 2LVOA 1P1AA 2KD0A 3PREA 3KH0A 3PRPB 1WMHB 2BYEA 2UWQA 4AUQC 3S2AA 2MQJA 2ZJDA 2NBVB 2NS5A 2K8BA 2N9PC 2HJ8A 3AU4A 4CO7A 1YIWA 4G11A 4J6IA 3K9PB 4EZLA 4E71A 3UQBA 3TCAA 2DZKA 4ASWC 1T0YA 4ANXA 2LASA 3RUIB 3L10B 4II2B 2JZ3B 2K8HA 3L08A 1Z5SB 2KFKA 3GZNI 2BYVE 3NZUA 2JF5A 3V60A 3WAPA 4DBGA 3DDCB 4DHJD 3RT3B 1HE8A 4GU2A 3JSVB 4MJSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KC1 A;  2N9E B;  5AZH A;  3LDZ E;  4W9E A;  4KZC A;  2MX2 A;  1UGM A;  4IM3 A;  3VH4 B;  3ECI A;  5CHF A;  3ZNH B;  3L17 A;  1EF1 A;  4KVG B;  3RD2 A;  3OJ4 B;  2FCM A;  5C23 A;  3BY4 B;  3QA8 A;  2KQ7 A;  3PV1 A;  1P0R A;  4FBJ B;  1WGY A;  2GOW A;  4AP4 C;  4ZRK A;  4MSQ B;  1GC7 A;  4HPM B;  2HE7 A;  4RMA A;  1UBQ A;  3L54 A;  4M0W B;  4EFO A;  3VUW A;  2AL3 A;  2KTR A;  3DVN U;  3UGB B;  1I42 A;  1UBI A;  3A33 B;  3GOE A;  3CMM B;  2KWU B;  3EFU A;  4DK5 A;  1WMH A;  2MRP A;  2WX0 A;  2CKH B;  4NJ6 A;  4A3P A;  3ZRC A;  3RUL A;  4W9L A;  1ZW7 A;  3PS6 A;  5KHO A;  4F8C B;  2AEH A;  4ZDV A;  2LGX A;  4A20 A;  2D11 A;  2C60 A;  1V86 A;  4HCP B;  3QJZ A;  3ZNI D;  4ANV A;  4AOF A;  1C1Y B;  2IBI B;  2KX3 A;  2JZZ A;  3HM3 A;  3KVF B;  4MGI E;  4URK A;  1RRB A;  5L95 C;  2ZPN A;  2LGD A;  1F9J A;  4GDK B;  4TV3 A;  1J0G A;  3CF6 E;  1WXS A;  2LRW A;  1WI0 A;  3L13 A;  3JYU A;  1TBE A;  3IVF A;  2XK5 B;  1WZ0 A;  2D2Q A;  4GSW A;  2MSE D;  2DEN B;  4BBN C;  4GMV A;  3B0A A;  5JZE B;  2CHW A;  1WGD A;  2L00 B;  2D07 B;  3RZF A;  5AZG A;  4F1S A;  3KUC B;  4KIK A;  2BYF A;  1S3S G;  3VVW B;  2W9N A;  4NNJ B;  1TTN A;  4BOS C;  3PLV A;  2B3A A;  4HJK A;  3R3M A;  3ZIM A;  1UEL A;  4M8M A;  2RR9 A;  1IPG A;  5CTR C;  1E8Z A;  1V80 A;  3UF8 A;  1GNU A;  2MWS B;  3A4R A;  3QAR A;  4W9H A;  4MGY E;  4EOY A;  1RLF A;  2JY6 A;  3APD A;  3VAW A;  2KFK B;  4MH0 E;  3VUY A;  3NZS A;  1V49 A;  2KDB A;  3HK0 A;  2IYD B;  2LWP A;  5IA7 A;  3PSE B;  3HIZ A;  3N3K B;  3UIN B;  2EMS A;  3HM6 X;  4KSL C;  1RFA A;  3DBL I;  2O6V D;  3AI5 A;  3P2B A;  3R66 C;  4BKT A;  4EUT A;  1LFD A;  3B1L X;  2DZM A;  4X57 B;  4RM8 A;  4B6W A;  2RSU A;  3H9D A;  4P7I A;  3X23 A;  4AWJ A;  1WJU A;  3O65 B;  4IUM B;  2KMC A;  2IY1 B;  2KJR A;  2KZR A;  1EF5 A;  4B9K A;  4EKU A;  2FID A;  1WX7 A;  2KTR B;  1WJN A;  2NPT A;  2ZEQ A;  3PRM B;  4FN2 A;  2JPH A;  3VXW A;  3HHM A;  3NOB A;  1GUA B;  3PTF C;  3APC A;  2CU1 A;  2KJH B;  1WJ6 A;  2V1Y A;  3Q3J A;  3U8Z A;  5JHA A;  5CHW A;  3WAO A;  3H6N A;  3H7S A;  4FLH A;  2ZZP B;  4BBN F;  1Y8R C;  3IBE A;  4WJP A;  5D2M B;  4ZRI A;  3VUX A;  4DHJ B;  4ANU A;  1WX9 A;  4MGZ E;  3TIX A;  3TBL D;  2RPQ A;  4I6L B;  4HXD A;  4K1R B;  1OGW A;  4CHK A;  3AXC A;  2JRI B;  4JL9 A;  4HVB A;  2N7D A;  3Q3F A;  4XC2 A;  2MBO A;  4IWO A;  3ZW3 A;  2LJ5 A;  3WAL A;  2G4S A;  4IC7 B;  3B08 A;  4ICU A;  3PHW B;  1M94 A;  5G55 A;  3KUD B;  4PS3 A;  5TR5 A;  1NBF C;  3KYD D;  3VTU A;  1G6J A;  4LJP B;  1A5R A;  3NHE B;  1XQQ A;  3KUZ A;  2XEW A;  5FR6 A;  4DDI D;  4EZK A;  1QZE A;  5DPT A;  2PE9 A;  3WAN A;  1LM8 B;  2J0J A;  1Q5W B;  2HTH A;  2MBB B;  3UIP B;  4KIK B;  1UH6 A;  2J0M A;  2J0K A;  4FUL A;  2PJH A;  1R4M I;  4N9F 4;  4FAD A;  1TGZ B;  3ZDT A;  1SIF A;  4FJV B;  4GDL A;  2KHW B;  2DX5 B;  4DHZ E;  3ML8 A;  3RYT A;  5KHQ A;  1ZKH A;  1V81 A;  3L0W B;  3OAW A;  4G50 A;  3ZKJ C;  5LXH A;  2WX1 A;  4PYU A;  1V5O A;  3H7P A;  4HDQ A;  3V61 A;  3ZDM C;  4PS8 A;  3W1S C;  2BWF A;  2GMI C;  5DPS A;  3R7Q A;  1KLV A;  4ZYN A;  4TQ0 A;  4NQL B;  3TL5 A;  1WM3 A;  4IM2 A;  4WWN A;  5E6O A;  5CHV C;  2KFJ A;  2IZV B;  1SGH A;  2EMT A;  2M0X A;  2MBE A;  3ENE A;  2M1M A;  3TJP A;  1MG8 A;  2KKC A;  3L16 A;  3ZTD A;  3NS8 A;  3DCG A;  2L7R A;  1GJZ A;  1AAR A;  3DBS A;  3OJ3 A;  1H4R A;  4KV2 A;  3VH3 B;  1X1M A;  2HD5 B;  3A9J A;  2LXC A;  4IWQ A;  1WXV A;  5D6J B;  4LJO B;  2JWZ A;  4HDO A;  1ISN A;  3H1U A;  1E8X A;  1EO6 A;  2DAF A;  1LXD A;  2KK8 A;  4HCN B;  2BPS A;  3V6C B;  3DVN V;  4NAW A;  3RZW C;  5AZF A;  4BOZ B;  3DVG X;  3CSF A;  1U4A A;  4HLE A;  2L0T A;  4MGK E;  3PVL A;  5C1Z A;  2DHZ A;  4JIO U;  1Q0W B;  1V6E A;  4WAA A;  4E3C A;  2MBH A;  1JRU A;  2PEA A;  2LD9 A;  2ZPY A;  2N1W A;  2ZNV C;  2FCN A;  4F7Z A;  1OQY A;  3MTN B;  1VD2 A;  2MA9 B;  5DPW A;  2I1J A;  5HKH A;  2NPT B;  5G2N A;  4WQO B;  2KLG A;  4K7S A;  3VFK A;  3A9K B;  2KTF A;  1EUV B;  3R7R A;  2BGF A;  3VQI A;  2CHZ A;  2IO0 B;  4WWP A;  4II3 B;  4A3O A;  4GXB A;  1WX8 A;  3DQV A;  4PYZ A;  2LZ6 A;  2FCS A;  4I6N B;  3LJ3 A;  4ZRJ A;  4DDG D;  1WIA A;  2LGY A;  4IM0 A;  4BKG A;  1YD8 U;  2NCN A;  4AJW A;  1P98 A;  2BWE S;  1WGG A;  4EEW A;  2KN5 A;  1CMX B;  3QHT A;  2N1V A;  2GBR A;  2O6V B;  1E8W A;  4FJY A;  4FHJ A;  3ALB A;  3W1S A;  4GIV A;  1FXT B;  3VDZ A;  2ZCC A;  3NY5 A;  4XX5 A;  5J17 A;  5JH5 C;  1WRD B;  2LUE A;  3PT2 B;  3QC8 B;  2ZCB A;  5JHB A;  1J19 A;  2LRU A;  2R2Q A;  2CR5 A;  2M17 A;  4W9F A;  4I6P A;  3D32 A;  5IAA C;  3WIM A;  3DBR I;  2EKE C;  2KWV B;  3PHX B;  2K6D B;  4W9J A;  3ZVV A;  4HK2 A;  2D10 A;  2FNJ B;  2KC2 A;  4GDL B;  4LCD E;  3UQA A;  4W9I A;  2LVP A;  3IG3 A;  2K8C A;  4LDT D;  3ZTC A;  2KLC A;  4FHK A;  2JUO A;  1E5W A;  2L05 A;  3H7P B;  3TMP B;  3BIN A;  4JLC A;  1TZ1 A;  1WR6 E;  3EEC A;  3A9K A;  4NPN A;  5J18 A;  5J2R A;  4GN1 A;  2NBU A;  2DZI A;  3SD5 A;  1KOT A;  2KAN A;  3VHT C;  2KWC A;  1SE9 A;  1NI2 A;  1V5T A;  2JVC A;  2R2O A;  3ML9 A;  2K6Q A;  3DBH I;  3V62 A;  3VTV A;  4DWF A;  2RD0 A;  3ZLZ A;  5LLI A;  3QCA A;  4W9C A;  2L0F A;  4W9K A;  3N32 A;  5CX3 A;  1WF9 A;  1WR1 A;  2LVQ A;  3EHV A;  3X0W A;  3ZRF A;  2M8S A;  2I1K A;  2LI5 A;  3A9J B;  1KJT A;  5L83 A;  2KVR A;  2O6V A;  4XZ4 A;  1E7U A;  2KNB A;  3SU8 X;  1BT0 A;  4FJZ A;  3WA0 A;  1OEY J;  3QIJ A;  5AEK B;  2FIF A;  4WWO A;  4B95 A;  2GBK A;  2MW5 A;  3DOW A;  5D7G A;  4OVV A;  1UZX B;  1WE7 A;  3KYC D;  1C3T A;  1WE6 A;  2V3S A;  5E6N A;  4NAW B;  3U7D A;  4ICV A;  2L3Z A;  3DPD A;  3PPA A;  3T9L A;  4BVU C;  4E74 A;  2PPH A;  1LQB A;  2XBB C;  3PGE A;  4TUU A;  3V6E B;  3AU5 A;  4MEM A;  3UIO B;  4WJO A;  2UYZ B;  2A4Z A;  4MSM B;  1YJ1 A;  2LXA A;  2MP2 A;  3VTW A;  4KDI C;  3ZUN A;  2OJR A;  2N9X A;  4KZ0 A;  4ANW A;  1WXM A;  4G3X B;  2KDE B;  1E7V A;  2AYO B;  4DXA B;  1R4N I;  3IHP C;  2KX0 A;  2NVU I;  2O2V A;  4WJN A;  2KXJ A;  2DZJ A;  2G45 B;  5GMV A;  2K1F A;  4NJ7 A;  1Q1O A;  1WGR A;  2FAZ A;  3ZNZ B;  4GOC A;  3DVG Y;  3CST A;  2KMA A;  3SHQ A;  3A1Q A;  4IWP A;  2IY0 B;  2KDI A;  1PQS A;  2RGF A;  4RM9 A;  4W9D A;  1WFY A;  5E6P A;  1E90 A;  2N7E A;  2C9W B;  1P3Q U;  2Z59 B;  2CS4 A;  2GBN A;  2MLB A;  3KW5 B;  3IFW B;  2IO1 B;  2A5U A;  3MHS D;  2JXX A;  4MEL A;  4WJQ A;  5DPR A;  2MBQ A;  4JQW C;  2IO3 B;  4FA6 A;  2KO3 A;  4K7U A;  5BO4 B;  1E8Y A;  3QQ8 B;  4GB9 A;  2BKF A;  2C7N B;  5D94 A;  2WYQ A;  3N30 A;  2Z0E B;  3PRZ A;  1GG3 A;  2N4F A;  3M95 A;  3PLU A;  1YX5 B;  2Y5B B;  4OVU A;  2CHX A;  3ONS A;  4K81 A;  1V9J A;  1IP9 A;  1YX6 B;  2FUH B;  2M4N A;  2KDF B;  3SDL C;  4MM3 A;  1KM7 A;  1WGH A;  2L76 A;  3JSV A;  4IG7 B;  4MJS A;  1WXA A;  4HWI B;  2MCN B;  1I35 A;  2KQS A;  2J7Q B;  1IYF A;  4TQ1 A;  3M3J A;  4BFR A;  2V4L A;  4G0N B;  2KOX A;  2Z0D B;  4BKS D;  2ZVN A;  1K8R B;  1WYW B;  2KJ6 A;  2K25 A;  4GGQ A;  2BF8 B;  2VRR B;  2PE6 B;  2JRH A;  1S1Q B;  3A4S C;  4AJY B;  1UD7 A;  2ZNV B;  1Z2M A;  4YL8 A;  3M62 B;  4DHZ B;  1WH3 A;  2NR2 A;  3OLM D;  3C0R B;  4EZJ A;  2IO2 B;  1WM2 A;  2ASQ A;  4PS7 A;  2YLM A;  4JGH B;  1WY8 A;  1VCB A;  2C7M B;  3QK0 A;  4KSK C;  2YVC A;  4M8N A;  3K9O B;  4TKN A;  2DAJ A;  4MDK E;  2OOB B;  2DYB A;  2GBM A;  3JVZ X;  3W1Y A;  2DYM A;  3M63 B;  5LXI B;  3QAQ A;  3T8M A;  4LDT B;  2NBW B;  3AUL A;  1L7Y A;  1XT9 B;  2FCQ A;  3PZD A;  1L2N A;  1J8C A;  3ZNG C;  2C5L C;  4HPL B;  2G3Q B;  2C7H A;  2REX A;  4GDK A;  3QWZ B;  3WAM A;  4BKS A;  1ZGU B;  5DCN A;  2DYO A;  2AL6 A;  1V2Y A;  2MP2 B;  4IW0 A;  2QHO A;  1WJ4 A;  2G4D B;  2ZVO A;  1XD3 B;  4W9G A;  2XK5 A;  1H8C A;  3APF A;  2WWZ A;  4K7W A;  5EDS A;  2AWT A;  4KDL B;  4NQK E;  3MJW A;  1P9D U;  1YQB A;  2D3G A;  2O2V B;  1RAX A;  3I3T B;  1OEY A;  1WZ3 A;  1OTR B;  4CYE A;  3QX1 A;  2JT4 B;  3RCZ A;  2L8J A;  2BKR B;  3U30 A;  1GC6 A;  2K39 A;  3A1Q B;  2GBJ A;  2WDT B;  1D3Z A;  4NY0 A;  3EC8 A;  1NDD A;  3ZO5 B;  3JW0 X;  2LVO A;  1P1A A;  2KD0 A;  3PRE A;  3KH0 A;  3PRP B;  1WMH B;  2BYE A;  2UWQ A;  4AUQ C;  3S2A A;  2MQJ A;  2ZJD A;  2NBV B;  2NS5 A;  2K8B A;  2N9P C;  2HJ8 A;  3AU4 A;  4CO7 A;  1YIW A;  4G11 A;  4J6I A;  3K9P B;  4EZL A;  4E71 A;  3UQB A;  3TCA A;  2DZK A;  4ASW C;  1T0Y A;  4ANX A;  2LAS A;  3RUI B;  3L10 B;  4II2 B;  2JZ3 B;  2K8H A;  3L08 A;  1Z5S B;  2KFK A;  3GZN I;  2BYV E;  3NZU A;  2JF5 A;  3V60 A;  3WAP A;  4DBG A;  3DDC B;  4DHJ D;  3RT3 B;  1HE8 A;  4GU2 A;  3JSV B;  4MJS B; 
#chains in the Genus database with same CATH topology
 2KC1 A;  2N9E B;  2QIE B;  4W9E A;  3VH4 B;  3L17 A;  4ZRQ A;  1EF1 A;  3OJ4 B;  2LGS A;  3Q3M C;  2KQ7 A;  1P0R A;  1XCQ L;  5EE1 A;  2UU7 A;  4AP4 C;  1JQ4 A;  4HPM B;  1UBQ A;  3VUW A;  2AL3 A;  3DVN U;  3I57 A;  3CMM B;  2KWU B;  3EFU A;  4A8X C;  1D4B A;  2MRP A;  2L1A A;  1UNS A;  2QCZ A;  3AED B;  4W9L A;  5KHO A;  1F77 A;  4F8C B;  2H88 B;  2LGX A;  3DHI C;  2C60 A;  1V86 A;  4HCP B;  4ANV A;  2KX3 A;  2V0G A;  4C4V B;  4URK A;  3Q8F A;  2L52 A;  3GP7 A;  5L95 C;  2ZPN A;  4TV3 A;  1WXS A;  2LRW A;  1WI0 A;  1FIQ A;  3JYU A;  3B0A A;  1WGD A;  2L00 B;  2D07 B;  3RZF A;  4F1S A;  1ZP0 B;  2BYF A;  3PLV A;  4HJK A;  1MHH E;  3ZIM A;  2RR9 A;  2G9H D;  2BW2 A;  1IPG A;  1SEB D;  1I7H A;  4IOI E;  2N9K A;  2BTE A;  4CQN A;  3QAR A;  4W9H A;  5FKA C;  1RLF A;  3VAW A;  2KFK B;  5HHD G;  3NZS A;  3VUY A;  1V49 A;  2I2Y A;  3HK0 A;  3W2D A;  2PVO D;  2IGG A;  3PSE B;  5IN7 A;  1YN5 A;  1WYG A;  3R66 C;  1WGK A;  2WXL A;  1VDV A;  2Y5P A;  1SJH D;  4H2A A;  1FM0 D;  4P7I A;  2KZR A;  4B9K A;  4EKU A;  2FID A;  3HVZ A;  3AEA B;  1ZE3 D;  4ZHP A;  3VXW A;  2IND C;  3ZGZ A;  1GUA B;  3APC A;  2CU1 A;  2V1Y A;  5JHA A;  3N1X C;  4BAX A;  4BBN F;  1Y8R C;  5BYS A;  4ZRI A;  3VUX A;  2NMQ A;  4ANU A;  1WX9 A;  4R3D A;  5C2T B;  3TBL D;  4WAF A;  1ROE A;  4I6L B;  4HXD A;  3AXC A;  2MBO A;  4EE2 A;  3GS2 A;  4RNA A;  2L83 A;  3PHW B;  4A9A A;  1A70 A;  1NBF C;  3KYD D;  3VTU A;  3NHE B;  3KUZ A;  2XEW A;  4PK1 A;  1QZE A;  2PE9 A;  3TUO A;  3BZD B;  4P6V F;  3UIP B;  3KWV A;  2J0K A;  4N9F 4;  1TGZ B;  4DHZ E;  2DX5 B;  1XF5 L;  4M02 A;  1V81 A;  3OAW A;  2WX1 A;  3ZYY X;  4HDQ A;  4RGN A;  4TSS A;  3V61 A;  2IPK D;  2BWF A;  2GMI C;  4P1B C;  3P1M A;  4WWN A;  5CHV C;  2M0X A;  2IZV B;  2EMT A;  3TJP A;  2KKC A;  2L7R A;  1AAR A;  1QQR A;  3I5J C;  3DBH B;  2GI9 A;  4YTP B;  3T3O A;  1TZO A;  5D6J B;  2B76 B;  3H1U A;  1E8X A;  1C77 A;  2BPS A;  2AQ1 B;  1U4A A;  3PVL A;  1Q0W B;  2MBH A;  1FFU A;  2LD9 A;  1TT5 B;  3MTN B;  1SB3 C;  1FNU A;  3I63 C;  1JWM D;  4WQO B;  3AEG B;  4ARI A;  3VQI A;  2CHZ A;  1NYR A;  4WWP A;  4A3O A;  4GXB A;  3GB1 A;  1WIA A;  1P98 A;  4NZL B;  4RF0 A;  3TEX A;  1FD6 A;  2ZW0 A;  2H89 B;  2ZCC A;  1JML A;  5J17 A;  2ZCB A;  4W9F A;  4I6P A;  4WH4 A;  3D32 A;  1SE4 A;  3DBR I;  1QF6 A;  2KWV B;  3PO0 A;  2D10 A;  3UQA A;  2ICI A;  4W9I A;  4HKQ A;  3IG3 A;  3ZTC A;  3BVZ A;  3U4E G;  2L05 A;  2WDR B;  1YQ4 B;  1WR6 E;  1VR9 A;  3A9K A;  5IO9 A;  3W5V B;  1KFY B;  2NBU A;  2D3A A;  2DZI A;  4GN1 A;  1KOT A;  1SE9 A;  1BML C;  2K6Q A;  2RD0 A;  2WXI A;  3ZLZ A;  2L0F A;  1WF9 A;  4HKZ E;  2V9H A;  2QDF A;  1TY0 A;  2M8S A;  1CZP A;  5H8Y E;  2LI5 A;  2O6V A;  4XZ4 A;  1AYF A;  4FJZ A;  4LNF A;  2WQY B;  4OVV A;  5BMG A;  1K52 A;  4BVU C;  3T9L A;  1XEE A;  4OZC A;  3V6E B;  4RGO S;  1T0Q C;  3IT4 B;  4OW0 A;  4KZ0 A;  4ANW A;  2D3B A;  2V3N A;  1E7V A;  2W3S A;  3AE4 B;  2KX0 A;  2O2V A;  1JAL A;  2K1F A;  4NJ7 A;  1WGR A;  2FAZ A;  3DVG Y;  1QLB B;  3U52 E;  2KDI A;  4W9D A;  4D2K A;  1MI0 A;  2N7E A;  2JXX A;  1IGD A;  1MPE A;  3MP9 A;  2WU5 B;  1E8Y A;  3QQ8 B;  4GB9 A;  2BKF A;  3N30 A;  3PRZ A;  3M95 A;  2Y5B B;  3ONS A;  1V9J A;  1IP9 A;  2KDF B;  4MM3 A;  1KM7 A;  1WGH A;  2L76 A;  4IG7 B;  3Q3O C;  3GZN B;  4HWI B;  3U7Z A;  3IT6 B;  2J7Q B;  3AEF B;  4TQ1 A;  1QOA A;  2INP E;  2V4L A;  3RNG C;  1K8R B;  1TIF A;  2KJ6 A;  3BK1 A;  1PGX A;  3NG0 A;  3WCQ A;  4S17 A;  2PE6 B;  2JRH A;  3ABV B;  2BYT A;  1S1Q B;  1HZ5 A;  1PUT A;  1FNW A;  2ZNV B;  4LTU A;  1WH3 A;  4EZJ A;  2OJW A;  1WM2 A;  1KRH A;  3P63 A;  1WY8 A;  3ZQ4 A;  1RYJ A;  4KSK C;  4M8N A;  4TKN A;  2OOB B;  2DYB A;  3JVZ X;  1C4A A;  1L6U A;  3QAQ A;  3T8M A;  2NBW B;  1L7Y A;  4ACF A;  3PZD A;  2BT6 A;  2C7H A;  2REX A;  2DYO A;  1N6Z A;  2ZVO A;  2XK5 A;  2WDV B;  2WWZ A;  1I4R A;  4L1B A;  2O2V B;  1C4C A;  2NTS A;  1OEY A;  2R61 A;  4CYE A;  3RPF C;  2BKR B;  2JXT A;  1GC6 A;  2GBJ A;  1JWS D;  2N0S B;  3FKY A;  2IDY A;  3JW0 X;  2ONQ A;  3P4Q B;  2BYE A;  2UWQ A;  1T3Q A;  3S2A A;  3AU4 A;  2LHE A;  2N9P C;  5D3I B;  2XNA C;  3IAM 1;  1PGA A;  4EZL A;  3UQB A;  4II2 B;  1LGR A;  1Z5S B;  3V60 A;  2JF5 A;  3GE8 C;  5LNK 1;  3TEZ A;  2TSS A;  3U2S C;  4IM3 A;  3ECI A;  5CHF A;  2WP9 B;  4KVG B;  3QA8 A;  3PV1 A;  3RFZ B;  3DBL B;  2FE8 A;  4C56 C;  5E6J A;  2GOW A;  3RI7 C;  2Y3A A;  4EFO A;  2KTR A;  4YXD B;  1WMH A;  2FUG 1;  1ET9 A;  2QMT A;  2W55 A;  1C1Y B;  2IBI B;  2YEP B;  4HEA 1;  2JZZ A;  1CQV A;  4MGI E;  1XLN A;  1WXQ A;  2KWD A;  2AX5 A;  1J0G A;  3N1Z C;  2BS2 B;  3IVF A;  4KKJ A;  2XK5 B;  4C80 A;  2D2Q A;  4GSW A;  2MSE D;  4XDC A;  4GMV A;  5JZE B;  3J9C A;  4KIK A;  1TKY A;  2W9N A;  1TTN A;  2XN9 C;  1KH0 A;  1YJI A;  3DHG C;  4LNO A;  3R3M A;  1UEL A;  4ZOH C;  1V80 A;  3UF8 A;  1TS3 A;  2LHD A;  3A4R A;  4QAY A;  4DXG A;  2JYT A;  2KDM A;  4EOY A;  1N62 A;  3P42 A;  2JY6 A;  3TSS A;  3APD A;  3Q8C A;  2KDB A;  5IA7 A;  3ZXV A;  4Q2J A;  3N3K B;  3VR9 B;  2LUM A;  4KSL C;  3R2T A;  4RGM A;  1E7P B;  1FCL A;  3B1L X;  4X57 B;  3MC9 A;  3X23 A;  1NI3 A;  4AWJ A;  1L0V B;  2KMC A;  2KJR A;  1EF5 A;  2JZP A;  2KTR B;  2NPT A;  2ZEQ A;  2JPH A;  1TS2 A;  3HHM A;  1HZ6 A;  4FLH A;  2BS4 B;  4WJP A;  4K1R B;  4CHK A;  2JRI B;  3Q3F A;  4XC2 A;  3SR6 A;  1M94 A;  1TYG B;  4LJP B;  1A5R A;  3RN9 C;  4DDI D;  5DPT A;  4MH8 A;  1K53 A;  1Q5W B;  2WXG A;  4KIK B;  4FUL A;  4FAD A;  4GDL A;  2LGI A;  1ZKH A;  2BB6 A;  3ZKJ C;  4AS1 A;  3VRA B;  3NZ3 A;  3W1S C;  1VRA B;  5FR3 A;  1KLV A;  3ENE A;  2MBE A;  1PYW D;  5AUK A;  1MG8 A;  3L16 A;  3NS8 A;  2KAC A;  3DBS A;  3NS1 A;  2RDH A;  2IGH A;  1H4R A;  2WXM A;  3VH3 B;  1HXY D;  1X1M A;  2HD5 B;  4IWQ A;  3C19 A;  1WXV A;  1UWX A;  2WXN A;  1FFV A;  2JWZ A;  1ISN A;  1MFW A;  1LXD A;  4RH6 A;  4YT0 B;  2L0T A;  2X38 A;  1ZUD 2;  4JIO U;  4E3C A;  2QC8 A;  2ZPY A;  4F7Z A;  4YTN B;  1VD2 A;  2I1J A;  1OQQ A;  1V1P A;  5HKH A;  2NPT B;  2KLG A;  3VFK A;  2BGF A;  4PYZ A;  4P1C C;  2LZ6 A;  3TEY A;  3LJ3 A;  4DDG D;  1OFF A;  1YD8 U;  1R4N B;  2E6X A;  1ZXI A;  4EEW A;  2D3C A;  3QHT A;  2N1V A;  3MC8 A;  1E8W A;  1L5P A;  1QOG A;  3ALB A;  4GIV A;  3BWU D;  4XX5 A;  5JH5 C;  3PT2 B;  1SBB B;  5JHB A;  1IUE A;  1J19 A;  2LRU A;  2R2Q A;  2M17 A;  3ZXR A;  3Q6B A;  2HDE A;  4US9 A;  3WIM A;  2L32 A;  4W9J A;  4LCD E;  2FNJ B;  2KC2 A;  4GDL B;  2LVP A;  4LDT D;  1QOB A;  2JUO A;  2KQ4 X;  3BIN A;  5D3D A;  3EEC A;  2KAN A;  1FMA D;  3DBH I;  3VR8 B;  3VTV A;  5IKC M;  3UI3 A;  3EUB 2;  4W9K A;  3N32 A;  5CX3 A;  2KN4 A;  3X0W A;  2KVR A;  1E7U A;  2KNB A;  3P4R B;  3QIJ A;  4B95 A;  4WWO A;  4YWG G;  2GBK A;  2V3P A;  3AEB B;  4RCO A;  1C3T A;  2V3S A;  2PIA A;  1DOX A;  3DPD A;  3EGR A;  3Q14 C;  3AU5 A;  1AWD A;  3FIL A;  2LXA A;  2MP2 A;  3ZUN A;  4KDI C;  1V1P B;  4DXF A;  2N9X A;  4G3X B;  4XDD A;  2G45 B;  1NVI D;  3N20 C;  5EE9 A;  3ZNZ B;  1SE3 A;  3URY A;  3V05 A;  1JW9 D;  2C9W B;  4OVZ A;  4YSX B;  2MLB A;  2DLB A;  3IFW B;  1VZ7 A;  4MEL A;  1ACC A;  2MBQ A;  2BS3 B;  3AE1 B;  4JQW C;  3RNC C;  4A90 A;  1EU4 A;  4K7U A;  1B1Z A;  1SXT A;  5D94 A;  2WYQ A;  2CJN A;  4OVU A;  1KTK A;  2CHX A;  4IKG A;  1YX6 B;  1ESF A;  4PT5 A;  4JWU C;  1P7F A;  2MCN B;  2KQS A;  3AE7 B;  1I35 A;  2DWQ A;  4BFR A;  1F2R I;  1F52 A;  2JSV X;  1EM7 A;  1XLQ A;  3AE9 B;  2WXK A;  3PZ7 A;  2WXO A;  2X8X X;  2VRR B;  3A4S C;  1K50 A;  1YN3 A;  2G1E A;  3IXS A;  2NR2 A;  3AM9 A;  3C0R B;  3HRD D;  4LLG M;  2YLM A;  5C3J B;  1VCB A;  3H8H A;  3QK0 A;  3BVM A;  2DAJ A;  4MDK E;  5MPO A;  2GBM A;  4OZB A;  4LDT B;  3VRB B;  4MAC A;  4JPS A;  1EWY C;  1L2N A;  2C5L C;  3TEW A;  2G3Q B;  4GDK A;  3FIL B;  2Z8L A;  5DCN A;  2AL6 A;  2MP2 B;  4IW0 A;  2GRI A;  4W9G A;  1H8C A;  2N9L A;  2AWT A;  2INC C;  1ZOY B;  1WZ3 A;  3E9S A;  2HTM E;  2JT4 B;  3AE8 B;  3U30 A;  4RGT A;  2K39 A;  2WDQ B;  1D3Z A;  1DOY A;  4NY0 A;  1WWT A;  1NDD A;  4N6E B;  4YSY B;  3AH7 A;  1IGC A;  4HRO A;  3RMK C;  1T0R C;  1YIW A;  2BB5 A;  1JWB D;  4ANX A;  1N5W A;  2JZ3 B;  2K8H A;  3HUI A;  3GZN I;  1J7C A;  3DDC B;  4DHJ D;  3RT3 B;  4GU2 A;  3Q8E A;  5BYQ A;  1WSP A;  3ZJV A;  1UGM A;  3OG5 A;  3RD2 A;  2FCM A;  4FBJ B;  1WGY A;  3AE3 B;  5EE3 A;  1M4V A;  2HE7 A;  3DBR B;  1FXA A;  3A33 B;  3GOE A;  2WXQ A;  4DK5 A;  2LMC A;  2WX0 A;  4A3P A;  4HPP A;  1XO3 A;  2AEH A;  4A20 A;  2OED A;  1L4Z B;  3ZNI D;  4AOF A;  5EE0 A;  2MH7 A;  2MEK A;  3HM3 A;  3KVF B;  3PZ8 A;  1RRB A;  3BYT B;  5G5H A;  2MJE A;  3RNB C;  2J4X A;  2LGD A;  4GDK B;  2WXR A;  4C7Z A;  4JE3 B;  3LYY A;  2N7J A;  5BYR A;  1WZ0 A;  2DEN B;  2CHW A;  5AZG A;  1HTQ A;  1FO4 A;  2KYW A;  3E56 A;  1RWS A;  1J7B A;  4BOS C;  2B3A A;  1I4G A;  1D6E C;  1YNT E;  4M8M A;  1R4M B;  1E0Z A;  3BII D;  2J53 A;  3MJ5 A;  4MGY E;  4P16 A;  1ENF A;  1MVK A;  2SEB D;  2IYD B;  2CJO A;  2LWP A;  2PW9 A;  3HM6 X;  1RFA A;  3DBL I;  1Q10 A;  1LFD A;  4C7Y A;  1F2R C;  2DZM A;  2PTL A;  4RM8 A;  2MJ3 A;  3O65 B;  4IUM B;  1NEK B;  1D5Z C;  1V1O A;  1WX7 A;  1WJN A;  3PRM B;  1D5X C;  4FN2 A;  3NOB A;  3SFE B;  2KJH B;  3Q3J A;  3U8Z A;  3NRZ A;  1TS5 A;  3H7S A;  4DHJ B;  4MGZ E;  3R2I A;  5H92 C;  1OGW A;  2N7D A;  2G4S A;  3BVG A;  4ICU A;  2JYE A;  3KUD B;  4PS3 A;  5TR5 A;  1G6J A;  5T8I A;  4US8 A;  1XQQ A;  3FAH A;  2J0J A;  2HTH A;  2MBB B;  1UH6 A;  2J0M A;  5BMH A;  3ZDT A;  3P4S B;  4FJV B;  4HJG E;  3RYT A;  3L0W B;  4G50 A;  5LXH A;  1R7S A;  1OQR A;  1FCC C;  3ZDM C;  5DPS A;  3AE2 B;  1DOI A;  4TQ0 A;  1WM3 A;  4IM2 A;  5E6O A;  1SGH A;  2M1M A;  3OJ3 A;  4ZRP A;  1KF6 B;  4KV2 A;  2RDG A;  2LXC A;  3NJT A;  4LJO B;  4HDO A;  1TS4 A;  1EO6 A;  2DAF A;  3RZW C;  3CSF A;  4B0E A;  4HLE A;  1TKE A;  4WAA A;  2WS3 B;  2N1W A;  2ZNV C;  1I4H A;  3MHZ A;  1I4X A;  4S0R A;  1OQY A;  3AMZ A;  2Y5C A;  4K7S A;  1Y56 A;  1JWA D;  1SJE D;  1EUV B;  3R7R A;  2IO0 B;  1BUI C;  1WX8 A;  2VZK D;  3DQV A;  4ZRJ A;  1L4D B;  4BKG A;  4LNK A;  4AJW A;  2WNM A;  4OHJ A;  2KN5 A;  1CMX B;  1ZPS A;  4FJY A;  3VDZ A;  1SSN A;  3NY5 A;  2JWU A;  1MG4 A;  2CR5 A;  2RMM A;  1C4P A;  5IAA C;  1TKG A;  2EKE C;  3DWM A;  2K6D B;  3ZVV A;  1AN8 A;  4ZYS A;  4HK2 A;  2W82 A;  5I4D A;  2KLC A;  4FHK A;  1E5W A;  3TMP B;  4JLC A;  5J18 A;  1I4Q A;  1EWC A;  3NVY A;  2KWC A;  2I38 A;  2K9X A;  2JVC A;  4DWF A;  1T5X D;  5LLI A;  3QCA A;  4W9C A;  2LVQ A;  3EHV A;  3OWE B;  1VJK A;  3ZRF A;  1V8C A;  1KJT A;  1UWM A;  3KQ4 A;  3WA0 A;  2BBC A;  2ON8 A;  1GB4 A;  1UZX B;  1E6E B;  2L3Z A;  4ICV A;  4N59 A;  2PPH A;  1LQB A;  2XBB C;  2V4I B;  3UIO B;  4WJO A;  1C76 A;  2A4Z A;  1VZ8 A;  2IJ0 A;  3VTW A;  2J52 A;  2OJR A;  3L4P A;  2AYO B;  1STE A;  1R4N I;  3IHP C;  2NVU I;  3GE3 C;  5TSS A;  2KXJ A;  2DZJ A;  5GMV A;  2DBY A;  2DNF A;  1Q1O A;  4GOC A;  4XWT A;  3SHQ A;  1E10 A;  4IWP A;  2RGF A;  1PQS A;  4RM9 A;  1GOZ A;  1WFY A;  5E6P A;  1E90 A;  1P3Q U;  1XCT L;  2CS4 A;  2GBN A;  2WXP A;  3CIR B;  3MHS D;  3KW5 B;  2A5U A;  1C78 A;  1YN4 A;  2IO3 B;  2M19 A;  4FA6 A;  2KO3 A;  5BO4 B;  2MJD A;  3W9C B;  2C7N B;  2PLP A;  2QJL A;  2Z0E B;  1GG3 A;  2N4F A;  1YX5 B;  4O1N A;  4K81 A;  3SDL C;  1FEH A;  4MJS A;  1WXA A;  2VZK B;  2HJ1 A;  1HQR D;  4G0N B;  2KOX A;  1SF0 A;  4LK0 M;  2PKO A;  4GGQ A;  4WWM A;  3SEB A;  1UD7 A;  4M0W A;  2D5G A;  1Z2M A;  3M62 B;  4B0M A;  1ZXH A;  4JGH B;  2WXF A;  1YMH E;  2C7M B;  2MHJ A;  3K9O B;  2DYM A;  4A6Q A;  5LXI B;  3AUL A;  4J3O D;  1XT9 B;  1FPY A;  3ZNG C;  4HPL B;  3Q2A C;  1YJJ A;  1ZGU B;  1V2Y A;  3AE5 B;  1RFK A;  2QHO A;  1XD3 B;  3APF A;  5EDS A;  1T6B X;  1P9D U;  1YQB A;  1OTR B;  4KKI A;  1L0X B;  4DQO C;  1C9F A;  1QKZ A;  4XE0 A;  3NVZ A;  2WDT B;  3RNE C;  3EC8 A;  2LVO A;  1P1A A;  3PRP B;  2KMM A;  2ZJD A;  2NS5 A;  4CO7 A;  2HJ8 A;  4J6I A;  4NJC A;  1XLO A;  1T0Y A;  3ETR A;  2LAS A;  3L10 B;  3NZU A;  3WAP A;  4DBG A;  3P4P B;  1HE8 A;  4MJS B;  2WHI A;  5AZH A;  3LDZ E;  4KZC A;  2MX2 A;  3RNF C;  3ZNH B;  2CU3 A;  4KGS A;  5C23 A;  3BY4 B;  1FRD A;  1AW7 A;  1HA5 A;  2PVG C;  4GLS C;  4ZRK A;  4MSQ B;  1JCK B;  1GC7 A;  2AQ3 B;  4RMA A;  3L54 A;  4M0W B;  1J7A A;  3UGB B;  1I42 A;  4ITK A;  1UBI A;  1F1H A;  2WLB A;  1TJE A;  4NJ6 A;  2CKH B;  3ZRC A;  3RUL A;  4M00 A;  1ZW7 A;  3PS6 A;  1KLG D;  4ZDV A;  1UF0 A;  3MC0 B;  2D11 A;  2SAK A;  2WGS A;  3QJZ A;  4RFB A;  3B2G A;  4WUR A;  3LXF A;  1F0Z A;  2KVZ A;  1JWU D;  1F9J A;  3CF6 E;  2W54 A;  3L13 A;  1GB1 A;  1TBE A;  1YQ3 B;  4BBN C;  1DYQ A;  3KUC B;  1S3S G;  3VVW B;  2JX5 A;  4NNJ B;  4L23 A;  1I4P A;  1CK1 A;  5CTR C;  1E8Z A;  1GNU A;  2MWS B;  1WRI A;  2QIL A;  1C79 A;  5IOI A;  1BXT A;  4MH0 E;  3HIZ A;  1P7E A;  3N1Y C;  3UIN B;  2EMS A;  2O6V D;  2WXH A;  3AI5 A;  3P2B A;  4BKT A;  4EUT A;  4B6W A;  2KAJ A;  2RSU A;  3H9D A;  1WJU A;  1HEZ E;  2IY1 B;  3B2F A;  2PMV A;  3CWI A;  4XWW A;  5GXG B;  2RDB C;  4A55 A;  1D5M C;  3PTF C;  1WJ6 A;  2AQ2 B;  5CHW A;  1ZDV A;  3WAO A;  5G5G A;  1IBX A;  3H6N A;  2ZZP B;  2BQQ A;  3IBE A;  3KWL A;  5D2M B;  1LO5 D;  3TIX A;  1QOF A;  3KLS X;  2RPQ A;  2JQR B;  2ZW1 A;  4JL9 A;  4HVB A;  3W5U B;  4IWO A;  3ZW3 A;  2LJ5 A;  3WAL A;  4IC7 B;  3B08 A;  5G55 A;  1N61 A;  5FR6 A;  1UGJ A;  4EZK A;  1VZ6 A;  3WAN A;  1LM8 B;  4LNI A;  2GB1 A;  2PJH A;  1R4M I;  1MHX A;  4K3B A;  4JWS C;  1SIF A;  3N9Y C;  5JXV A;  2KHW B;  5KHQ A;  3ML8 A;  1PGB A;  4PYU A;  5FK9 C;  3Q3N C;  1V5O A;  3H7P A;  4PS8 A;  2RPV A;  5IP4 D;  3R7Q A;  4ZYN A;  4REZ A;  4NQL B;  3TL5 A;  2KFJ A;  3ZJT A;  3ZTD A;  3DCG A;  1CJE A;  1GJZ A;  3RNA C;  1T0S C;  1YOV B;  2QEJ C;  3A9J A;  2LFI A;  3AE6 B;  1L0Y B;  1QT9 A;  2KK8 A;  4HCN B;  3FC4 A;  3V6C B;  3DVN V;  4NAW A;  5AZF A;  4BOZ B;  3DVG X;  4MGK E;  1MJD A;  3AEE B;  5C1Z A;  2DHZ A;  1V6E A;  4YTM B;  1JRU A;  2PEA A;  2M56 B;  4AQ7 A;  2FCN A;  2MA9 B;  5DPW A;  2W3R A;  5G2N A;  3A9K B;  2KTF A;  4JX1 C;  2VH1 A;  1IBX B;  4II3 B;  4OZA A;  1V97 A;  3T3N A;  3V3X A;  2FCS A;  4I6N B;  3NVW A;  1JRO A;  4XGA B;  2LGY A;  4IM0 A;  3HVD A;  2NCN A;  1PDX A;  3MFG A;  2BWE S;  3Q8B A;  1WGG A;  4WQM A;  2K3U A;  2GBR A;  2INN E;  4L2Y A;  2O6V B;  2EKI A;  3SFD B;  2K5P A;  2Q5W D;  4FHJ A;  1VLB A;  3W1S A;  3NVV A;  1FXT B;  1WRD B;  2LUE A;  3QC8 B;  4NAM A;  3AB5 A;  2WXJ A;  3PHX B;  2LEK A;  5BMI A;  4KGT A;  1FXI A;  2NTT A;  5HFY A;  2K8C A;  3H7P B;  2J42 A;  3EA6 A;  1TZ1 A;  5J2R A;  4NPN A;  4XYC A;  3SD5 A;  3VHT C;  2E3T A;  1NI2 A;  1V5T A;  1GPX A;  5AUI A;  2R2O A;  2K22 A;  3ML9 A;  3V62 A;  1NYQ A;  1WR1 A;  2I1K A;  5L83 A;  2JU6 X;  3A9J B;  1N60 A;  4UDU C;  3SU8 X;  1BT0 A;  4M01 A;  1JRP A;  1OEY J;  5AEK B;  2FIF A;  2MW5 A;  3LB8 C;  3DOW A;  5D7G A;  1WE7 A;  3KYC D;  1WE6 A;  5E6N A;  1GAQ B;  4NAW B;  3U7D A;  1XLP A;  3PPA A;  4HRS A;  4E74 A;  1FRR A;  3PGE A;  4TUU A;  3DHH C;  4MEM A;  4N58 A;  2UYZ B;  4MSM B;  4MM3 B;  1YJ1 A;  3EFC A;  4LNN A;  1TY2 A;  1WXM A;  4KGR A;  3R8B A;  2KDE B;  1HTO A;  4KX6 B;  5HI1 A;  4DXA B;  1FNV A;  1K51 A;  4WJN A;  4IDI A;  2QSD A;  1N63 A;  1PFD A;  1NEN B;  3I9V 1;  2K0P A;  3CST A;  2KMA A;  3A1Q A;  2IY0 B;  1SIJ A;  2Z59 B;  5DPR A;  2IO1 B;  4WJQ A;  1EU3 A;  2BVC A;  3O13 A;  1UUP A;  2KT7 A;  3PLU A;  2FUH B;  2M4N A;  1DGJ A;  3JSV A;  3DWG C;  3C8Y A;  4WIP A;  3BYY B;  1IYF A;  3M3J A;  2Z0D B;  4BKS D;  2ZVN A;  1WYW B;  2K25 A;  2BF8 B;  2M0A A;  4AJY B;  3AN1 A;  4DHZ B;  4YL8 A;  3OLM D;  4K3C A;  2LJI A;  2WU2 B;  2IO2 B;  2ASQ A;  4PS7 A;  1XXG A;  4C00 A;  3BK2 A;  3AV8 A;  2YVC A;  3AEC B;  3W1Y A;  3M63 B;  1SE2 A;  4MT5 A;  2GLS A;  1N5X A;  4C4V A;  2YEP F;  2FCQ A;  3ZJU A;  1J8C A;  2OHF A;  3QWZ B;  3WAM A;  4BKS A;  1E9M A;  1WJ4 A;  2G4D B;  4TMA B;  4K7W A;  3B9J A;  4KDL B;  4NQK E;  3MJW A;  2D3G A;  1RAX A;  3I3T B;  4YSZ B;  3QX1 A;  3RCZ A;  2FBW B;  2L8J A;  3IAS 1;  2IGD A;  2EEL A;  3A1Q B;  4ARC A;  1KLU D;  1L6V A;  3ZO5 B;  4USA A;  2KD0 A;  3PRE A;  3KH0 A;  4ZHO A;  1WMH B;  1B9R A;  4AUQ C;  2MQJ A;  4BZA A;  4RF1 A;  2NBV B;  2K8B A;  3NUH B;  1QIL A;  5HG2 A;  4FXC A;  4G11 A;  1ET6 A;  3K9P B;  1RM6 C;  4E71 A;  2ACZ B;  3TCA A;  2DZK A;  3Q8A A;  4ASW C;  3RUI B;  1ZDX A;  3L08 A;  2KFK A;  2BYV E;  2VH2 A;  3JSV B;  3Q69 A; 
#chains in the Genus database with same CATH homology
 2KC1 A;  2N9E B;  5AZH A;  3LDZ E;  4W9E A;  4KZC A;  2MX2 A;  1UGM A;  4IM3 A;  3VH4 B;  3ECI A;  5CHF A;  3ZNH B;  3L17 A;  1EF1 A;  4KVG B;  3RD2 A;  3OJ4 B;  2FCM A;  5C23 A;  3BY4 B;  3QA8 A;  2KQ7 A;  3PV1 A;  1P0R A;  4FBJ B;  1WGY A;  2GOW A;  4AP4 C;  4ZRK A;  4MSQ B;  1GC7 A;  4HPM B;  2HE7 A;  4RMA A;  1UBQ A;  3L54 A;  4M0W B;  4EFO A;  3VUW A;  2AL3 A;  2KTR A;  3DVN U;  3UGB B;  1I42 A;  1UBI A;  3A33 B;  3GOE A;  3CMM B;  2KWU B;  3EFU A;  4DK5 A;  1WMH A;  2MRP A;  2WX0 A;  2CKH B;  4NJ6 A;  4A3P A;  3ZRC A;  3RUL A;  4W9L A;  1ZW7 A;  3PS6 A;  5KHO A;  4F8C B;  2AEH A;  4ZDV A;  2LGX A;  4A20 A;  2D11 A;  2C60 A;  1V86 A;  4HCP B;  3QJZ A;  3ZNI D;  4ANV A;  4AOF A;  1C1Y B;  2IBI B;  2KX3 A;  2JZZ A;  3HM3 A;  3KVF B;  4MGI E;  4URK A;  1RRB A;  5L95 C;  2ZPN A;  2LGD A;  1F9J A;  4GDK B;  4TV3 A;  1J0G A;  3CF6 E;  1WXS A;  2LRW A;  1WI0 A;  3L13 A;  3JYU A;  1TBE A;  3IVF A;  2XK5 B;  1WZ0 A;  2D2Q A;  4GSW A;  2MSE D;  2DEN B;  4BBN C;  4GMV A;  3B0A A;  5JZE B;  2CHW A;  1WGD A;  2L00 B;  2D07 B;  3RZF A;  5AZG A;  4F1S A;  3KUC B;  4KIK A;  2BYF A;  1S3S G;  3VVW B;  2W9N A;  4NNJ B;  1TTN A;  4BOS C;  3PLV A;  2B3A A;  4HJK A;  3R3M A;  3ZIM A;  1UEL A;  4M8M A;  2RR9 A;  1IPG A;  5CTR C;  1E8Z A;  1V80 A;  3UF8 A;  1GNU A;  2MWS B;  3A4R A;  3QAR A;  4W9H A;  4MGY E;  4EOY A;  1RLF A;  2JY6 A;  3APD A;  3VAW A;  2KFK B;  4MH0 E;  3VUY A;  3NZS A;  1V49 A;  2KDB A;  3HK0 A;  2IYD B;  2LWP A;  5IA7 A;  3PSE B;  3HIZ A;  3N3K B;  3UIN B;  2EMS A;  3HM6 X;  4KSL C;  1RFA A;  3DBL I;  2O6V D;  3AI5 A;  3P2B A;  3R66 C;  4BKT A;  4EUT A;  1LFD A;  3B1L X;  2DZM A;  4X57 B;  4RM8 A;  4B6W A;  2RSU A;  3H9D A;  4P7I A;  3X23 A;  4AWJ A;  1WJU A;  3O65 B;  4IUM B;  2KMC A;  2IY1 B;  2KJR A;  2KZR A;  1EF5 A;  4B9K A;  4EKU A;  2FID A;  1WX7 A;  2KTR B;  1WJN A;  2NPT A;  2ZEQ A;  3PRM B;  4FN2 A;  2JPH A;  3VXW A;  3HHM A;  3NOB A;  1GUA B;  3PTF C;  3APC A;  2CU1 A;  2KJH B;  1WJ6 A;  2V1Y A;  3Q3J A;  3U8Z A;  5JHA A;  5CHW A;  3WAO A;  3H6N A;  3H7S A;  4FLH A;  2ZZP B;  4BBN F;  1Y8R C;  3IBE A;  4WJP A;  5D2M B;  4ZRI A;  3VUX A;  4DHJ B;  4ANU A;  1WX9 A;  4MGZ E;  3TIX A;  3TBL D;  2RPQ A;  4I6L B;  4HXD A;  4K1R B;  1OGW A;  4CHK A;  3AXC A;  2JRI B;  4JL9 A;  4HVB A;  2N7D A;  3Q3F A;  4XC2 A;  2MBO A;  4IWO A;  3ZW3 A;  2LJ5 A;  3WAL A;  2G4S A;  4IC7 B;  3B08 A;  4ICU A;  3PHW B;  1M94 A;  5G55 A;  3KUD B;  4PS3 A;  5TR5 A;  1NBF C;  3KYD D;  3VTU A;  1G6J A;  4LJP B;  1A5R A;  3NHE B;  1XQQ A;  3KUZ A;  2XEW A;  5FR6 A;  4DDI D;  4EZK A;  1QZE A;  5DPT A;  2PE9 A;  3WAN A;  1LM8 B;  2J0J A;  1Q5W B;  2HTH A;  2MBB B;  3UIP B;  4KIK B;  1UH6 A;  2J0M A;  2J0K A;  4FUL A;  2PJH A;  1R4M I;  4N9F 4;  4FAD A;  1TGZ B;  3ZDT A;  1SIF A;  4FJV B;  4GDL A;  2KHW B;  2DX5 B;  4DHZ E;  3ML8 A;  3RYT A;  5KHQ A;  1ZKH A;  1V81 A;  3L0W B;  3OAW A;  4G50 A;  3ZKJ C;  5LXH A;  2WX1 A;  4PYU A;  1V5O A;  3H7P A;  4HDQ A;  3V61 A;  3ZDM C;  4PS8 A;  3W1S C;  2BWF A;  2GMI C;  5DPS A;  3R7Q A;  1KLV A;  4ZYN A;  4TQ0 A;  4NQL B;  3TL5 A;  1WM3 A;  4IM2 A;  4WWN A;  5E6O A;  5CHV C;  2KFJ A;  2IZV B;  1SGH A;  2EMT A;  2M0X A;  2MBE A;  3ENE A;  2M1M A;  3TJP A;  1MG8 A;  2KKC A;  3L16 A;  3ZTD A;  3NS8 A;  3DCG A;  2L7R A;  1GJZ A;  1AAR A;  3DBS A;  3OJ3 A;  1H4R A;  4KV2 A;  3VH3 B;  1X1M A;  2HD5 B;  3A9J A;  2LXC A;  4IWQ A;  1WXV A;  5D6J B;  4LJO B;  2JWZ A;  4HDO A;  1ISN A;  3H1U A;  1E8X A;  1EO6 A;  2DAF A;  1LXD A;  2KK8 A;  4HCN B;  2BPS A;  3V6C B;  3DVN V;  4NAW A;  3RZW C;  5AZF A;  4BOZ B;  3DVG X;  3CSF A;  1U4A A;  4HLE A;  2L0T A;  4MGK E;  3PVL A;  5C1Z A;  2DHZ A;  4JIO U;  1Q0W B;  1V6E A;  4WAA A;  4E3C A;  2MBH A;  1JRU A;  2PEA A;  2LD9 A;  2ZPY A;  2N1W A;  2ZNV C;  2FCN A;  4F7Z A;  1OQY A;  3MTN B;  1VD2 A;  2MA9 B;  5DPW A;  2I1J A;  5HKH A;  2NPT B;  5G2N A;  4WQO B;  2KLG A;  4K7S A;  3VFK A;  3A9K B;  2KTF A;  1EUV B;  3R7R A;  2BGF A;  3VQI A;  2CHZ A;  2IO0 B;  4WWP A;  4II3 B;  4A3O A;  4GXB A;  1WX8 A;  3DQV A;  4PYZ A;  2LZ6 A;  2FCS A;  4I6N B;  3LJ3 A;  4ZRJ A;  4DDG D;  1WIA A;  2LGY A;  4IM0 A;  4BKG A;  1YD8 U;  2NCN A;  4AJW A;  1P98 A;  2BWE S;  1WGG A;  4EEW A;  2KN5 A;  1CMX B;  3QHT A;  2N1V A;  2GBR A;  2O6V B;  1E8W A;  4FJY A;  4FHJ A;  3ALB A;  3W1S A;  4GIV A;  1FXT B;  3VDZ A;  2ZCC A;  3NY5 A;  4XX5 A;  5J17 A;  5JH5 C;  1WRD B;  2LUE A;  3PT2 B;  3QC8 B;  2ZCB A;  5JHB A;  1J19 A;  2LRU A;  2R2Q A;  2CR5 A;  2M17 A;  4W9F A;  4I6P A;  3D32 A;  5IAA C;  3WIM A;  3DBR I;  2EKE C;  2KWV B;  3PHX B;  2K6D B;  4W9J A;  3ZVV A;  4HK2 A;  2D10 A;  2FNJ B;  2KC2 A;  4GDL B;  4LCD E;  3UQA A;  4W9I A;  2LVP A;  3IG3 A;  2K8C A;  4LDT D;  3ZTC A;  2KLC A;  4FHK A;  2JUO A;  1E5W A;  2L05 A;  3H7P B;  3TMP B;  3BIN A;  4JLC A;  1TZ1 A;  1WR6 E;  3EEC A;  3A9K A;  4NPN A;  5J18 A;  5J2R A;  4GN1 A;  2NBU A;  2DZI A;  3SD5 A;  1KOT A;  2KAN A;  3VHT C;  2KWC A;  1SE9 A;  1NI2 A;  1V5T A;  2JVC A;  2R2O A;  3ML9 A;  2K6Q A;  3DBH I;  3V62 A;  3VTV A;  4DWF A;  2RD0 A;  3ZLZ A;  5LLI A;  3QCA A;  4W9C A;  2L0F A;  4W9K A;  3N32 A;  5CX3 A;  1WF9 A;  1WR1 A;  2LVQ A;  3EHV A;  3X0W A;  3ZRF A;  2M8S A;  2I1K A;  2LI5 A;  3A9J B;  1KJT A;  5L83 A;  2KVR A;  2O6V A;  4XZ4 A;  1E7U A;  2KNB A;  3SU8 X;  1BT0 A;  4FJZ A;  3WA0 A;  1OEY J;  3QIJ A;  5AEK B;  2FIF A;  4WWO A;  4B95 A;  2GBK A;  2MW5 A;  3DOW A;  5D7G A;  4OVV A;  1UZX B;  1WE7 A;  3KYC D;  1C3T A;  1WE6 A;  2V3S A;  5E6N A;  4NAW B;  3U7D A;  4ICV A;  2L3Z A;  3DPD A;  3PPA A;  3T9L A;  4BVU C;  4E74 A;  2PPH A;  1LQB A;  2XBB C;  3PGE A;  4TUU A;  3V6E B;  3AU5 A;  4MEM A;  3UIO B;  4WJO A;  2UYZ B;  2A4Z A;  4MSM B;  1YJ1 A;  2LXA A;  2MP2 A;  3VTW A;  4KDI C;  3ZUN A;  2OJR A;  2N9X A;  4KZ0 A;  4ANW A;  1WXM A;  4G3X B;  2KDE B;  1E7V A;  2AYO B;  4DXA B;  1R4N I;  3IHP C;  2KX0 A;  2NVU I;  2O2V A;  4WJN A;  2KXJ A;  2DZJ A;  2G45 B;  5GMV A;  2K1F A;  4NJ7 A;  1Q1O A;  1WGR A;  2FAZ A;  3ZNZ B;  4GOC A;  3DVG Y;  3CST A;  2KMA A;  3SHQ A;  3A1Q A;  4IWP A;  2IY0 B;  2KDI A;  1PQS A;  2RGF A;  4RM9 A;  4W9D A;  1WFY A;  5E6P A;  1E90 A;  2N7E A;  2C9W B;  1P3Q U;  2Z59 B;  2CS4 A;  2GBN A;  2MLB A;  3KW5 B;  3IFW B;  2IO1 B;  2A5U A;  3MHS D;  2JXX A;  4MEL A;  4WJQ A;  5DPR A;  2MBQ A;  4JQW C;  2IO3 B;  4FA6 A;  2KO3 A;  4K7U A;  5BO4 B;  1E8Y A;  3QQ8 B;  4GB9 A;  2BKF A;  2C7N B;  5D94 A;  2WYQ A;  3N30 A;  2Z0E B;  3PRZ A;  1GG3 A;  2N4F A;  3M95 A;  3PLU A;  1YX5 B;  2Y5B B;  4OVU A;  2CHX A;  3ONS A;  4K81 A;  1V9J A;  1IP9 A;  1YX6 B;  2FUH B;  2M4N A;  2KDF B;  3SDL C;  4MM3 A;  1KM7 A;  1WGH A;  2L76 A;  3JSV A;  4IG7 B;  4MJS A;  1WXA A;  4HWI B;  2MCN B;  1I35 A;  2KQS A;  2J7Q B;  1IYF A;  4TQ1 A;  3M3J A;  4BFR A;  2V4L A;  4G0N B;  2KOX A;  2Z0D B;  4BKS D;  2ZVN A;  1K8R B;  1WYW B;  2KJ6 A;  2K25 A;  4GGQ A;  2BF8 B;  2VRR B;  2PE6 B;  2JRH A;  1S1Q B;  3A4S C;  4AJY B;  1UD7 A;  2ZNV B;  1Z2M A;  4YL8 A;  3M62 B;  4DHZ B;  1WH3 A;  2NR2 A;  3OLM D;  3C0R B;  4EZJ A;  2IO2 B;  1WM2 A;  2ASQ A;  4PS7 A;  2YLM A;  4JGH B;  1WY8 A;  1VCB A;  2C7M B;  3QK0 A;  4KSK C;  2YVC A;  4M8N A;  3K9O B;  4TKN A;  2DAJ A;  4MDK E;  2OOB B;  2DYB A;  2GBM A;  3JVZ X;  3W1Y A;  2DYM A;  3M63 B;  5LXI B;  3QAQ A;  3T8M A;  4LDT B;  2NBW B;  3AUL A;  1L7Y A;  1XT9 B;  2FCQ A;  3PZD A;  1L2N A;  1J8C A;  3ZNG C;  2C5L C;  4HPL B;  2G3Q B;  2C7H A;  2REX A;  4GDK A;  3QWZ B;  3WAM A;  4BKS A;  1ZGU B;  5DCN A;  2DYO A;  2AL6 A;  1V2Y A;  2MP2 B;  4IW0 A;  2QHO A;  1WJ4 A;  2G4D B;  2ZVO A;  1XD3 B;  4W9G A;  2XK5 A;  1H8C A;  3APF A;  2WWZ A;  4K7W A;  5EDS A;  2AWT A;  4KDL B;  4NQK E;  3MJW A;  1P9D U;  1YQB A;  2D3G A;  2O2V B;  1RAX A;  3I3T B;  1OEY A;  1WZ3 A;  1OTR B;  4CYE A;  3QX1 A;  2JT4 B;  3RCZ A;  2L8J A;  2BKR B;  3U30 A;  1GC6 A;  2K39 A;  3A1Q B;  2GBJ A;  2WDT B;  1D3Z A;  4NY0 A;  3EC8 A;  1NDD A;  3ZO5 B;  3JW0 X;  2LVO A;  1P1A A;  2KD0 A;  3PRE A;  3KH0 A;  3PRP B;  1WMH B;  2BYE A;  2UWQ A;  4AUQ C;  3S2A A;  2MQJ A;  2ZJD A;  2NBV B;  2NS5 A;  2K8B A;  2N9P C;  2HJ8 A;  3AU4 A;  4CO7 A;  1YIW A;  4G11 A;  4J6I A;  3K9P B;  4EZL A;  4E71 A;  3UQB A;  3TCA A;  2DZK A;  4ASW C;  1T0Y A;  4ANX A;  2LAS A;  3RUI B;  3L10 B;  4II2 B;  2JZ3 B;  2K8H A;  3L08 A;  1Z5S B;  2KFK A;  3GZN I;  2BYV E;  3NZU A;  2JF5 A;  3V60 A;  3WAP A;  4DBG A;  3DDC B;  4DHJ D;  3RT3 B;  1HE8 A;  4GU2 A;  3JSV B;  4MJS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...