4RH6A

2.9 angstrom crystal structure of putative exotoxin 3 from staphylococcus aureus.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
189
structure length
187
Chain Sequence
SESELKHYYNKPILERKNVTGFKYTDEGKHYLEVTVGQQHSRITLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSNSVQYIDYINTPILEIKKDDVLKDFYYISKEDISLKELDYRLRERAIKQHGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exotoxin 3, putative
publication title 2.9 Angstrom Crystal Structure of Putative Exotoxin 3 from Staphylococcus aureus.
rcsb
source organism Staphylococcus aureus subsp. aureus col
molecule tags Toxin
total genus 57
structure length 187
sequence length 189
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rh6A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rh6A01
1KLUD 1S5CD 1V1OA 1D5MC 1PYWD 1PTOC 3MFGA 4BWGB 1T5XD 3URYA 1LTGD 1BCPC 1F77A 5ELFA 1FGBD 1SJED 2XRQD 1I4XA 3EFXD 1PTOB 3R8BA 4O1NA 1S5ED 4DXGA 1TS3A 1I4GA 4OHJA 1EEID 1DJRD 1PZKD 5TSSA 1YN3A 1BCPB 3CHBD 1CQVA 2AQ3B 3EA6A 1LTID 1D5ZC 2IPKD 3TSSA 1TS4A 3R2IA 4RGMA 2WV6D 1LTRD 2RDGA 1S5BD 4NZLB 1SBBB 3OWEB 4Z9CB 1PTOD 2ICIA 1TY2A 4RH6A 3BVZA 1PRTF 2QILA 1KLGD 3BVMA 1AN8A 1EEFD 1BCPD 1JWMD 1LTSD 2SEBD 1I4PA 2NTSA 4L6TB 1CT1D 1JR0D 1ENFA 3BYYB 1XTCD 2AQ1B 1HTLD 1HA5A 1JWSD 1JWUD 1SE3A 3DWPA 1QILA 5ELCA 1HXYD 1SJHD 2G9HD 1UUPA 4RGNA 1PZID 1PRTC 1MD2D 1HQRD 5ELBA 3W2DA 1YN5A 2TSSA 4RHRA 1KTKA 1GOZA 4RGOS 1TS2A 1PTOH 4L63B 1JQYD 1LT3D 4DXFA 3R2TA 3DWAA 4RFBA 1LT6D 5D3DA 2O2LD 3BYTB 4UDUC 1PRTB 3MC0B 1YN4A 3V05A 2CHBD 4RHSA 5ELDA 2RDHA 4K6LA 1AW7A 3DWQA 1V1PB 3BZDB 3GP7A 1FNUA 1ET6A 1FNWA 5ELEA 1DYQA 4RCOA 2J4XA 1PZJD 1SE4A 2QEJC 1SXTA 2XNAC 1LLRD 1TY0A 1LTAD 2AQ2B 2XRSD 1JCKB 1EU3A 1M4VA 1B44D 2Z8LA 5FK9C 1TS5A 1I4QA 1EU4A 1EFID 1LO5D 1PRTD 1BXTA 1ET9A 1FNVA 1I4RA 1STEA 1G8ZD 1LT4D 3O13A 1RDPD 5I4DA 2R61A 1FD7D 1SE2A 1LT5D 1SEBD 4RGTA 1LTTD 5FKAC 1I4HA 1S5DD 1V1PA 2IJ0A 1RCVD 1PTOF 3KLSX 1D6EC 2XN9C 5D3IB 1EWCA 2NTTA 1BCPF 3SEBA 4C56C 1RD9D 1XXGA 4ZYSA 1ESFA 1CHQD 1L0YB 4TSSA 1D5XC 1CK1A 1RF2D 1S5FD 3BVGA 1LTBD 1L0XB 1B1ZA 1CHPD 1UNSA
chains in the Genus database with same CATH superfamily
4LF8Q 1GB4A 1SAPA 1V1OA 1N9WA 3JAME 2K28A 1E2VA 5JOBA 3K57A 5LMNQ 4IDIA 2SAKA 4LTUA 4OVZA 3MVVA 3TEWA 4AQ7A 2NVTH 4LNFA 2VH2A 3DDCB 1SJED 2UUAL 2JZZA 2WP9B 1PH9A 1GO3E 2EJMA 3I72A 1XLNA 2EMSA 2LXCA 3NBHB 4H13C 2E2IB 2CWAA 3G48A 2A19A 3NPPA 1WJ6A 3PHWB 4R9WA 1YVCA 4NXNL 1Q81C 4K7UA 4N8FA 2HCCA 4ANVA 4A3KH 5JH5C 3EC8A 1F9SA 2NVXH 3PS6A 2L52A 3T9LA 3AM9A 3I8ZA 3VXWA 1UBQA 1SYEA 3FKIH 1FFVA 1ASYA 3I3CA 2PQAB 2A6EC 3A9KB 2H4OA 3A54A 2ICIA 3MJWA 2QC8A 2FINB 3ULJA 4QL5A 1JWMD 5AZHA 2RSNA 5CV7A 1RTOA 4KHPQ 1OGWA 1CT1D 2K25A 2PQEA 2LMCA 4XTCS 1WFQA 4LF4L 1L2FA 1BKBA 1SR3A 2KHWB 4DBGA 1E90A 2PCFB 1HA5A 2HT1A 2JA5B 3P42A 3I4MH 1SDFA 2A6HC 1PH6A 3CC4A 5ELCA 3RNBC 3VYSA 1EZ6A 4OWWB 3EGRA 4AYBE 3HOUH 2MNAA 4JI8L 1M8AA 3I91A 2Y5BB 4JCVE 3NS8A 1V8CA 2FFKB 3GDEA 3G6EA 4TQ0A 1G51A 1UE1A 4JOIC 5JVG3 4HJ7A 3SD5A 1AE3A 3PVLA 3RZOH 4ZRZA 4R8IA 1B53A 3E0JA 2HDMA 1SYGA 2CHBD 1FIQA 1WFYA 3ERSX 2LGIA 3I4NH 3FP9A 4R4IA 1AW7A 5M3FG 5EKKA 3M3YB 2GOWA 3PV0A 2WYQA 1BVSA 4K2KA 4B0MA 2N4FA 4K3CA 1JC7A 3S1MH 2L1AA 3QAQA 2WAQB 3UDIA 4U673 1YITA 1SE4A 3DBHI 5IGCA 5A2QE 1LXDA 3L16A 3LXFA 4P1CC 3APCA 3RYTA 4OX9Q 2M4NA 2H5XA 2DAJA 4LUZA 2JK8A 1E1TA 1IGCA 1OEYJ 4Y7NB 1ZYRD 3IRBA 1X55A 2K7VA 1DCZA 3PMFA 1E8WA 3O13A 2CQOA 5I4DA 3S1NB 2KYWA 1SMYD 3K7AH 5IGGA 4ALPA 1E7VA 1Y69U 1ZOYB 2MJ3A 1YHBA 4FXCA 4WURA 4TVAB 1S5DD 1PA6A 1XT9B 1PXUA 2BOSA 4HAEA 3T16A 3HM3A 3A33B 5LMNW 3T4AC 4DN4M 4AIMA 4A3DB 1MJDA 2LUMA 2O6VD 5D14A 1K52A 2IL8A 1TT5B 2MHVA 3UE0A 3HOWG 5I9OA 1Q5WB 2A5UA 4TSSA 2ZXRA 3DCGA 1CKNB 3CQZB 1CMXB 1N63A 1VQHA 4A3FB 1NJIC 1VLBA 4IWPA 5J3BA 1S5CD 3G6JB 3G71A 2A74C 1D5MC 1R9TH 2R92G 3F2CA 4U68A 1M94A 3L0OA 3AB5A 4G0NB 1VQ7A 2K04A 3Q24A 3EROA 4KV6A 4KY7A 5C0XJ 4C3HB 2OJRA 3ZTCA 3CCQA 1K0RA 1E1OA 3STBD 2RVLA 1G6PA 2V0GA 4R4CA 3A0JA 1O7LA 4F7ZA 2LGSA 5IA7A 1J9OA 1IW7C 2MJDA 3KLRA 4E6IA 1CZWA 3IG3A 2CQAA 1HFGA 3K9OB 4FJVB 3U4VA 1I4GA 5IO9A 1EEID 1VR9A 2R7ZB 2EELA 4A8XC 4AJYB 1PQSA 2FE8A 4POFA 2Z59B 3PO3G 1EQQA 1MJCA 4QB4A 1NY4A 1L0VB 1WM2A 2HIXA 2UXDQ 2W55A 1CQVA 4N8X1 4XQNA 1VQOA 4DV4Q 1YJ9A 1AFPA 5BR8Q 3R2IA 4QMGA 3UF8A 4KIKA 4DR5L 4PS8A 1Z2MA 1STBA 2E6XA 4K5VA 3ULLA 4DDID 2WXIA 3RN9C 5HGTA 4JI3L 3ITPA 3BDOA 2AYOB 2K8HA 5DPRA 3OG5A 4UAIA 2J52A 2QILA 1JRPA 4FA6A 4MTKA 4DV1Q 1Q8IA 2DY7A 1NYQA 1LTSD 1QE6A 2LXJA 2SEBD 2WU5B 2ZCCA 3Q8DA 1HTPA 2XSCA 2CU3A 3NTKA 3HOZB 1C78A 4HDOA 1C4QA 1J5EQ 4ZRKA 1RLFA 5IKCM 2J0MA 4LNOA 2VL6A 2GVBA 2YTVA 4LF5Q 3CSFA 2LXAA 4B3TQ 4A93G 1WXSA 4ITKA 4LK0M 4ZRPA 5TR5A 4DDGD 3A5UA 3U4ZA 3QK0A 4ARCA 2K1BA 2R2QA 4HCSA 1Z5SB 3NHHA 4EKUA 1SE8A 1HUNA 4A9AA 3CD6A 5IP9H 4XDXA 5K36G 1X3QA 3R2TA 5DLQE 4IUPA 3LDZE 1UH6A 1DOMA 3MC0B 3JAMi 2EKEC 1N5XA 1TXYA 3V6EB 3TP5A 4R4OA 4YCUA 3SU8X 4PZ6A 1JWAD 4KI0A 2FCQA 1K73C 1QJOA 5D65A 1NNXA 4XDDA 2JQOA 2PMZE 3RN5A 2JXTA 3AMUA 3HZXA 1LQBA 2F0WA 3S17B 1F52A 1I7HA 4UHVA 1QKZA 1WMHB 1XWEA 4S3SA 1XPUA 4LF9Q 3FILB 1K3BC 4BOZB 2BH8A 2XBBC 2G4SA 2PIAA 4LUVA 2MBHA 1BBWA 2BBCA 3FPUB 3NEMA 1ET9A 1FNVA 1I4RA 3C46A 1XF5L 1STEA 1C9FA 1LT4D 1UF0A 4UP9A 5HG2A 1NSNS 3U4EG 1VQKA 4JI7Q 2X38A 3PRPB 3TBLD 4A76A 3S2DH 3UQAA 4C7YA 4CYEA 2X69A 3EUB2 1FD6A 3VYRA 2ZEQA 1UGJA 1JMLA 5IP7G 2DAFA 3K9PB 1BCPF 3NP8A 1P16A 3Q6SA 5GROA 4C3IH 1U4AA 2LHDA 3Q3NC 3R3MA 3SFEB 2KTRA 1FL0A 1YEZA 3C1FA 3HOXH 3BVGA 4DWFA 1LTBD 3TP6A 4KN7C 4EGVA 3NWTA 1YJWA 3DUZA 4GDLB 3N52A 5C44G 1WJNA 3TIXA 4K7WA 1K9MC 4A3BG 3X3NA 1BR9A 5FJ8H 5IAAC 2L0FA 4W9GA 1GUSA 4DV0L 2FUG1 1CTMA 2KNBA 3LWUA 4US8A 5ELFA 4OVUA 4XC2A 4BOSC 1VQ6A 5FOBB 1U0LA 4FF4A 1WGGA 2BS4B 3LYYA 1XJVA 3PREA 5GAEC 3OTOL 2UUAQ 1DOXA 2ZW1A 2RGFA 4EQNA 2IX1A 2RHSB 1U5KA 1V5OA 2C5LC 4JI5L 5EJWA 2UUBL 2LFNA 1VJKA 4M0WB 4DHJB 2PW9A 3J80L 1XEEA 1LTID 2L11A 3HEJA 5JEAJ 1U4PA 3KK7A 3TN2A 4W9FA 4RCNA 3J81E 3GTQH 1VQNA 3PCOB 4K81A 1U4MA 1CZPA 2UXBL 2K6QA 5H92C 3A55A 4IQZA 2A69C 4K5XA 5HFYA 4GU2A 2NBWB 2F3IA 3SHQA 1IBXB 1WTQA 3PSIA 4FVMA 2GBKA 4HVBA 1VF5C 1PRTF 3MXNB 4LMQD 1PH8A 2E2HB 4JI1Q 2GMIC 1UE7A 5EE9A 2INCC 1WOCA 1S4ZA 4DV3L 3BYYB 1V1QA 1HTLD 4WIPA 4FULA 2NVYH 2EMTA 1OTRB 4ME5A 3E3XA 4BS9A 5A35A 1HXYD 1Y8RC 3OW2A 1XPRA 4TV3A 3T53B 1YQ4B 3HIZA 3BINA 3K5LA 3RNEC 2G5DA 3AEEB 1RM6C 2PMVA 1ZYRC 1KRTA 3I63C 4WFN3 4EQPA 5JPNC 4DR3Q 5DPWA 2Q2TA 1SMYC 1XLQA 2NBVB 1BOSA 4BA1I 2DY8A 2WU2B 1YIWA 3B08A 4ZHPA 4JOIA 1CA6A 1UWMA 1H9JA 3A1QA 1W6JA 4H2AA 2R93G 3PIP3 3DWQA 1IL2A 5IT9L 2QGQA 4J15A 2KWVB 2L32A 1WCMG 3NZ3A 1PVOA 2YVCA 2DNFA 1LYLA 4OZCA 2Y5CA 4LFBQ 2RR9A 4IFDI 1BUIC 3CXCA 3K59A 2JUOA 1P1AA 3CCMA 3BDCA 1WZ3A 2KKCA 5D94A 1TWGB 1VMCA 4XT3B 2MEKA 5CTRC 4MHEA 1GUAB 4ZRJA 4D2KA 3STBC 4JV5L 1LABA 1VQBA 4PK1A 1SEBD 2F0FA 4G4KA 3VA5A 4C00A 2MP2A 1V43A 1PFDA 2IJ0A 1V9PA 1X3EA 5KNBA 1EF5A 3VAWA 2J7QB 1EIHA 4WJ4A 2K5NA 5C3EH 3SK8A 1KHIA 1HJPA 4LJOB 3GTPH 4KKTA 4CKBA 3U9OA 1D1KA 3DHGC 3VVWB 4EZLA 4IC7B 3H15A 3FC4A 4S17A 1JALA 5FO7B 4KLKA 4A3EG 2M9VA 3E56A 2IGDA 3M7NA 4A3IB 4FBJB 2JA8B 4MGIE 2Z1CA 3U2SC 1I6HH 3URYA 2KEDA 3APDA 3S1QB 2OXPA 3D31A 4OIKA 3V96A 1Y1WG 5CC4A 4IFDG 3NE5B 3NBHA 2DZIA 3NZSA 1X1MA 4KJOA 1CFMA 3PPAA 3HKZE 1I4XA 2L0CA 1MHXA 2VUMG 3HKSA 2JA9A 2X6GA 2PEAA 2WXHA 4PZ7A 2BS3B 4TQUS 4KGRA 3CCVA 1KRSA 2QKIC 3V2TA 1MI0A 4OW0A 2Q2IA 2SDFA 4M01A 2BE5D 2F52A 4YSYB 1UEBA 2NVQH 1NBFC 3DHHC 2PE6B 1EQRA 1E22A 5E3FA 5COYA 3T13A 3RUIB 4WWPA 2PQAA 2UUCL 3ZJUA 3KDFB 3PSEB 4GLSC 2ZNVB 3KJOA 4X62L 2PNHA 2WB1G 3DBSA 3K5MA 2EOTA 3KYCD 4DAYB 1B50A 2KVMA 2RQXA 4X3TA 4DR5Q 4GNXB 1UWXA 3ECIA 2QDBA 4B3SL 5GAHC 5AFWA 3GTMH 1QF6A 2VQFL 3CCRA 1J19A 1S3SG 1JROA 1T6BX 3GOEA 3R7RA 4UP8A 1K8MA 3ML8A 4A3JB 1EY0A 4A3GH 3RNAC 2H1EA 3HRZC 1G291 1XTCD 1IUEA 1FMAD 1YX6B 3P4SB 4WAFA 5JVH3 2F0OA 5CV5A 4QJFA 2BKRB 2MQJA 5IOCA 3IAS1 4JI2L 4IPDA 2VZKD 4FP5D 4MGZE 1YNXA 4NKLA 5E6OA 1JJCB 3PO2H 1DOIA 1PZID 2PI2E 2ES2A 1GPXA 1MD2D 1HQRD 1PV4A 2W82A 1CA5A 4C3JH 2VB2X 3BY4B 3NVWA 4K8IA 5FLXc 1HNXQ 2MUYA 5KNDA 1OXVA 3G4SA 1V9JA 2A4ZA 3P75A 2MX2A 3U52E 5L37A 3DLLA 2V3SA 4F8CB 3GB1A 3AMZA 4KZCA 4W9CA 4R4QA 1TYGB 4FXDA 1NYRA 4B3RL 4K2LA 1BBXC 2K4KA 3L2PA 5JJLA 3SR6A 2BA1A 2NR2A 4M02A 1YX5B 3EJIA 4EVOA 2W3RA 3KQ4A 3CF6E 4NAWB 3AFQA 4XWTA 2NZ1D 1ENCA 3H0GG 3NSWA 4LAAA 1AE2A 5EDSA 5AUKA 1L6VA 2V1CC 2LS01 1LLRD 4P75A 1DZ1A 1PDXA 4JGHB 3VHTC 4HK2A 3VTWA 1U4RA 2RKSA 1EU3A 3ZW3A 2JA7H 3PLUA 1WD0A 4L5QA 5JAVA 2L4NA 4PV1C 5FR6A 2CU1A 2MCNB 1J7AA 3KF6A 3J81i 1ONLA 2WINB 1LT5D 3GV3A 2BVCA 2C7MB 4IOCA 5AZFA 5IY0A 2K33A 3QOLA 4OIJA 4YWMA 5H1SE 4QGUA 1RCVD 2AUKA 2K5WA 3I5JC 1PTOF 3OHXC 4JE3B 2Z4IA 1STNA 1QVFA 3PGEA 3VRAB 5BN3A 4BXXG 3C1EA 3E9IA 1N6ZA 4H02A 5E1FA 3Q0AA 3J7ZC 4IW0A 1S72A 3DBRI 1D5XC 2RCNA 4MELA 4DNTB 4P7IA 4OONA 4DV6L 3H3VC 1ENAA 1KABA 3GTLB 3WAMA 3K7UC 2YLMA 1P98A 1E8YA 4FHJA 4WJPA 3N3KB 4GSWA 4M8MA 3ZNID 1A5RA 1VQJA 2LJ5A 1I35A 2KHIA 4C4VB 4YL8A 1T5XD 3L17A 1ACCA 2CS4A 1NEKB 2BKFA 4HJKA 1RHPA 1TZOA 3S2HB 4L5TA 3TS0A 2XVSA 4OWTB 4HIDA 3RCZA 1T0QC 4AWJA 5M5WB 3FAHA 1NI2A 3HOYH 1D1IA 1EIGA 3CRKC 4GOPB 1XD3B 2INDC 4FXKC 2M17A 4O1NA 2VNUD 2ZNVC 2B63B 3I90A 1QT9A 3ZQ4A 2C5CA 5BYRA 3TZDA 1CUKA 3DVGX 2HJ8A 4LW1A 3T1HL 2UU9L 4GNXC 2IPKD 3J7YW 2UUBQ 3TSSA 1FRRA 2DZMA 2N9KA 3JAMc 1K8OA 5IGFA 1QZHA 1I6VC 2MP1A 4HWIB 4PS7A 1VQ9A 3CAMA 2VB3X 5BN4A 2LZ6A 4BY1G 3M62B 3VDZA 2GB1A 4ZYNA 1BUVT 1VQPA 5IODA 4NZLB 4OZBA 1K53A 3ZXVA 3Q8EA 1LUZA 5CV6A 2RSOA 4GN5A 4DUYL 3C2PA 1HTOA 2XWBB 1Q1BA 3KLWA 4M8NA 4HLEA 1YNND 1BCPD 5CX3A 1XLOA 2L76A 3KUPA 4AQYQ 1GUWA 3S15B 3MXUA 3T3OA 4LDTB 1C79A 3L9AX 3L7ZC 1YJJA 3TEXA 2KVRA 1X3PA 1SE3A 2V4DA 3RZWC 2G9HD 3VH4B 1FO4A 1J8CA 1AARA 2KLGA 1QZGA 5T1GA 1YQ3B 1STYA 4FDBA 1KIXA 4OEMB 4WJNA 3A56A 2V4IB 1GHKA 5M5YB 2Q2HA 4YTMB 1WTHA 1Y1VG 2QJLA 1MI2A 2B2TC 3A7LA 1JORA 4PMCA 1S3OA 4B08A 1N60A 4DV5L 1A2UA 4V0BA 2RF4A 3BYTB 4OL7A 5FLXE 4IPCA 4GB9A 4BZAA 3NHEB 2B3AA 2OQKA 2M8SA 1EYCA 1ZKOA 4PQXA 3BZDB 4KJNA 5IWAL 2O6VA 2ZJPA 3AE2B 3F2BA 3Q6BA 1ZW7A 2B39A 4N9TA 1R4NI 2EKIA 3N1XC 1PZJD 3NVVA 1O7IA 1SXTA 4A3KG 1C77A 4AYBB 4C2MB 3MP9A 3WCQA 1GB1A 5C4XH 2XRSD 1SIJA 1ZGUB 5NUCA 1N32Q 4MM3A 3P1HA 3TMPB 1P9DU 3FKIG 1RFKA 1PRTD 2K8CA 1C3TA 2QDLA 1G8ZD 3CRLC 4JBKA 1FVIA 4XIGS 3S2AA 5HY6A 1FD7D 4RGTA 5C6AA 3FKYA 2BW2A 1MKHA 4DR2Q 4FF1A 4JV5Q 4BKGA 4TMAB 1CKOA 4RKBA 1NDDA 1QVGA 3N20C 3D6WA 1GUOA 3AE4B 2X8XX 5D3IB 4GKKL 1L7YA 4LNNA 3Q69A 2KO3A 1WIAA 3I4MG 3TUOA 4DPGA 4B3MQ 4DV7L 1RD9D 4MN3A 2XTIA 2YU9B 4DR1L 1PH5A 3HOUG 2WQYB 4NJCA 1TWHH 1VQDA 1SGHA 4JI4Q 2MBBB 3P2BA 3NENA 2I1JA 5BMHA 1LACA 1T0SC 1WYGA 2LFIA 3K80C 2E5LQ 4GOPC 3L10B 5M5XB 1QLBB 3AEDB 1Q7YC 1L5PA 1ZP0B 3ENEA 4F88A 4LK1C 3DOWA 2JA6B 3PZ7A 5IP4D 2KBNA 1SSOA 3RZDB 3I4NG 2IT1A 1P3QU 4M0WA 1SFOH 2KHJA 4L8JA 4EFOA 2WB1E 1FYCA 2K75A 4JI0L 1ZDXA 2CW0D 3AN1A 1PYBA 4EEWA 1BCPB 1E3PA 5IYCH 2KJ6A 3WALA 2VXWA 1GVPA 3FPPA 1ROEA 3N1YC 1VDVA 4DV2L 4LJPB 1VF7A 4FYDA 5LLIA 3KVFB 3S1RB 3AE8B 3DWGC 4LF7L 1TWAH 2F0HA 1GJZA 3D4RA 1JJ2A 2UUCQ 2DJGC 2ASBA 5HURA 3W3AA 3ZJYC 4X62Q 1T0RC 5CV4A 4DR4L 3HRDD 3OW7A 5E4WC 1GD7A 2ZCBA 3BZKA 4RH6A 4RF1A 4CDEC 1SNQA 2HJ1A 3JSVB 5IE8A 1AN8A 4PT5A 2VQEL 3S16H 1PYSB 1Y1VB 3A8KE 2OTJA 1EM7A 3J7AV 3AXCA 4LJZC 4KV2A 1Y8NB 1EUVB 4NMZA 1EZ8A 1JWSD 1JWUD 4GN3B 4ID6A 4ODGA 1XMQL 2V3PA 1QILA 2BB6A 4IURA 2WDRB 3ZKJC 5DM63 1J0GA 2VH1A 1B9MA 4L5SA 1TKYA 1D7QA 4HTHA 5IIFA 4JI2Q 1TQOA 5G55A 2JN4A 1SNDA 3OAWA 4GKJQ 2F0UA 1KDAA 3AI5A 2NBUA 1IHZA 4KHVA 2OCEA 4LWCA 4HJ9A 1Q46A 1YJ1A 3DHIC 2OJWA 2EYFA 1E7PB 2E2IH 4K0KL 1VZ7A 3BZCA 4ACFA 4YHHL 3V61A 2AEHA 1LT6D 4B6WA 1PRTB 1QQRA 2PYKA 1SRUA 2MQHA 2SOBA 1PMRA 2IO3B 3A9JB 3IAYA 3NK9A 4B3RQ 5DEHA 3EECA 2MFIA 3GTKB 1J7CA 3K0XA 1KH0A 1N34Q 3B0AA 1WGRA 4IPGA 3T1YL 1VZ8A 5BYSA 1V5TA 4E3CA 1YD8U 2A8VA 4W9EA 3AB9A 1RKNA 5JXVA 2ZM6L 1Z7TA 1VRAB 2YTXA 4ZCKA 1BXTA 2JWZA 3TRZA 3JVZX 2WX0A 1WVLA 4P74A 3GE8C 3Q2AC 4QQBX 2KJHB 2F0NA 1HZ9A 1AEXA 1HQMC 2A69D 3SK4A 4Q5VA 2JA5H 5KHQA 3IT6B 2E2JB 3PZDA 3D8GA 4JPSA 1G91A 4JQWC 1D3ZA 4EOYA 3VA7A 4XT1B 4BKSD 5I2XA 1V8QA 4IKGA 2PMZB 4EQ5A 2DGYA 5M3MB 1PFMA 1EYAA 2RCFA 1XXGA 4N9PA 2N9EB 1CHQD 2Q8TA 2KECA 1K50A 2ATWA 3MHZA 1EYDA 1YHAA 1I94L 4WWMA 1L0XB 2AKWB 5IP9G 2ENBA 3IBEA 4DV6Q 1HFNA 4HPMB 4YTPB 5D2MB 1SE9A 4BBSB 3NS1A 1IBML 2PPHA 1T5EA 1YNNC 1BCPC 2B2YA 5JZEB 3I3TB 2R2OA 1AH9A 3DVNU 3HOVH 5EAYA 2F0DA 2KQSA 3R8BA 1ISNA 3QB3A 2H88B 1S5ED 3D4WA 1Q8KA 1MHWC 1TS3A 4YSZB 4CKCA 4A3CH 3PHXB 4LNKA 3QARA 3CCLA 1QNKA 1W6KA 3KDFA 4Y7NH 3I56A 1Q86C 2F0TA 3CHBD 2N1VA 1I3QB 2CH4A 2NVUI 2WXPA 4BKTA 2IGHA 3S1NH 1F2ZA 3ABVB 1VQEA 1YOVB 2WFWA 3MC8A 2JU6X 1TS4A 4DAYA 4RGMA 3T1HQ 1F2YA 1A3TA 2BDNA 1ZDVA 2ID0A 3A4SC 3FEWX 4J6HA 2B2VA 2RDGA 4LUOA 2LGXA 3KYHC 4HIKA 3VR5A 1IZ6A 2MH7A 2PTLA 1R4MI 4A3DH 1PTOD 4IJLA 1EY7A 1RL2A 4ANXA 2VW9A 4ICUA 1HZAA 3J7AF 3BDLA 3I70A 4DR6Q 1JR0D 2F0EA 3CQZH 3GV6A 2KCMA 4A3FH 1OQYA 4A90A 1VQGA 4C3IG 4X3UA 1WXAA 1T9HA 3W9CB 4NB3A 3J7A5 2J42A 2UXCL 1PFSA 3J81c 4M00A 4R1JA 3HOXG 2BS2B 3D32A 4I7AA 4ZLTF 3GE3C 5BMIA 2MO1A 4C3HH 1B8AA 2EZVA 3WA0A 1ZXTA 1EY8A 1E9MA 1PRTC 3LJ3A 3HKZG 3QIJA 1E7ZA 2I5HA 2XK5B 2RDFA 5FJ8G 4F87A 2N9XA 1WTOA 4WWNA 3I4LA 3AE3B 3I9V1 3QWNA 4GN4B 3NWSA 1VQMA 1H9KA 2R7ZH 4QAYA 2R7FA 2EY5A 3P7JA 3QO2A 3KW5B 2M0AA 3ZO5B 3CMAA 5LNK1 4KD4A 2DHZA 1J6QA 3NTHA 1G6ZA 1STHA 2QW7A 3OSOA 3TCAA 1F2RC 1PH7A 2V4LA 2Y0SG 4PYZA 4DHJD 1IBLQ 5BYQA 3DEPA 3QX1A 2J0KA 3U58A 1R7SA 2OHFA 3GP7A 1KXLA 1ET6A 1XNRQ 4MACA 3GTJB 4NJ6A 1UBIA 2OEOA 4YXDB 2QEJC 3RPFC 3MTSA 2CHZA 2ZPNA 3E6ZX 1TWFB 5LMUL 1C4CA 5FK9C 1NR4A 3Q14C 3UGBB 2IX3A 5M3FB 4R3DA 1WJJA 3HOZH 4MEMA 2CKHB 2PW5A 2JYTA 5JJIA 1FGUA 4HCNB 4KGTA 2B8GA 1EQVA 4L2YA 2SNSA 1KC8C 1WM3A 2NPTA 2LUEA 3I57A 4JI6Q 5FKAC 3Q3JA 3ONAB 2MHJA 4HJGE 3KLSX 4A3LH 2CW0C 2K22A 5E6JA 2K5QA 3B2FA 4XXEA 5FLMH 2GA4B 4IFDJ 4WQMA 1WTRA 3S14B 4GKKQ 2C60A 1K83B 2YTYA 2N7JA 1L0YB 4GMVA 2WIIB 5EKIA 2WXLA 1RF2D 1FRDA 4C4VA 1W3SA 3ICEA 4DR1Q 2F4IA 1A3UA 3HUIA 2KANA 3P4QB 5KEEA 1VS0A 4HIOA 1PH3A 1L0WA 4DAVA 5GQOA 4OVVA 2WKDA 2GBNA 4GN1A 4OWXB 3PQIA 1CKMA 4GOPA 3HOWB 3L4PA 2QCPX 4C1NK 1NVID 3S17H 2QCZA 3W5OA 1KFYB 3C19A 1ZEQX 1E0BA 4OELB 3NJTA 1PTOB 2R92B 3VUWA 3TDQA 4HDQA 2NS5A 4QIWE 2DYOA 3DBHB 3P4PB 1IBKQ 2KOXA 2LSSA 1OXXK 4ZKCB 2HTME 3LNNA 2KQ3A 3S24A 1X3FA 2F0LA 2K6AA 3EA6A 1XMOL 1FJGL 2AWOA 2K5DA 2BF8B 2CHWA 4GS3A 2K0PA 1KDBA 1Y56A 1D4BA 2L3ZA 4FXGC 1HR0L 3GZNI 2WV6D 4DV2Q 4X3KA 4G11A 3AFPA 3PGZA 3R7QA 4XQJA 4MZ9A 2LJIA 2KJXA 3OJ4B 3PO3B 2Y5PA 4LF7Q 1YQBA 1GC6A 1A0IA 3BVZA 3MFYA 4O42A 1ZPSA 3HKZB 3WANA 5C3EG 1BNZA 4CQNA 2NTSA 5K5PA 4TUUA 4O2DA 3F2DA 4NY0A 1Q0WB 1JMCA 5EE3A 4KZ0A 4GIVA 1H95A 4L1BA 4NDXA 1XMQQ 1MIUA 1KQSA 5IYDH 4LNIA 5EE0A 3DMUA 3UQBA 2D62A 2O4XA 4UY8C 1KAWA 4A6QA 4NXNQ 2ZJDA 5J2RA 5KNCA 1YN5A 2JZ3B 4II2B 3EN2A 4ARIA 4A93B 3AEFB 1TKWB 3A4RA 4N6EB 4E71A 1JQ4A 4A4IA 3F8TA 5D7GA 3MZ5A 1VQLA 1EYGA 3GTGB 3CC2A 4MH0E 1UE5A 3W1SC 2K39A 2HDLA 2FNJB 1N33L 2GVAA 2JP1A 2PVGC 1TIFA 1V1PB 2JE6I 3W1BA 1FNUA 1VCBA 3AU4A 1KJTA 2HCIA 1C7YA 4LF4Q 1A63A 3ML9A 3PT2B 3DEOA 3EIVA 1W2BA 4I6LB 3U30A 4HEDA 4BBRH 1H4RA 1PH1A 5IGBA 2BPSA 1VQFA 3VR4A 2I2YA 2K14A 2Z8LA 2ZTCA 3RUZA 2E2HH 1WTPA 3C3LA 2N7DA 4MJSA 1FFUA 1EFID 1RTNA 2BWFA 4JI8Q 2ZM6Q 2GBMA 2KFJA 4QUCA 4KMUC 4WAAA 1QOGA 1RDPD 2PVOD 2A68D 4OO1H 3ZRCA 2PLPA 2KLCA 2DYBA 2HD3A 3Q8FA 4DUZL 3AULA 4RMAA 4A3GG 3IKJA 3IAM1 1TGZB 2KDEB 3HM6X 3VR9B 1RYJA 1MSGA 1NUCA 4PZ8A 3SEBA 1WZ0A 2ZPYA 3I7FA 3PO2G 4CBVA 1JOQA 1A2TA 3SGIA 1S5FD 4GOCA 2KWCA 2N88A 3T56B 4XDCA 3RD2A 4HMIA 4O0AA 1SNPA 4C3JG 4DF7A 5EPLA 2JPHA 4JWUC 2WP8J 4MIUA 1YZ6A 1YJNA 4DNRB 4II3B 1PTOC 3MFGA 4AOFA 3O65B 3FMCA 3DWMA 3SDZA 1C9OA 1HNZL 3LGJA 4DFAA 4G7HC 1SIFA 2IWHA 2C7HA 3PF4A 5HGQA 2WKCA 2CKZB 3DVGY 5EE1A 3RD4A 2BB5A 5L95C 2IO0B 3J80E 4B9WA 1PH4A 1IBMQ 5KGUA 1CI3M 1U4LA 3TP8A 5IN7A 5C44B 1OO9B 1EQTA 4AS1A 4A3BB 3WAPA 5C4HA 3H09A 2BTEA 1DJRD 2JSOA 1OTCA 1TWGH 2K52A 5CV9A 4YY3L 2ZJRA 1N62A 1C1YB 3JW0X 4WWOA 5DCNA 4JBMA 1D5ZC 4IPHA 3AEBB 4B95A 3P4RB 2JA7G 2D5DA 3LX0A 4Q2JA 3K5NA 1J7BA 1TWCB 2M00A 2JRIB 3QWZB 4CJ0B 3PUVA 1NMFA 2EXZA 1KDCA 2F0SA 1OXTA 1IYFA 2EYHA 2IY5B 4C7ZA 2VY3A 3V6CB 3VR3A 4CHKA 5JHBA 1KF6B 2MW5A 3A8IE 1JOKA 1IKMA 1RRBA 1E24A 3AYHB 1N8RC 2N9PC 3PIO3 4A3IH 1K3RA 2LGDA 2JA8H 4KTAA 1I42A 4A20A 1A6XA 1UEAB 4USAA 3TL5A 1LGRA 1FCCC 4MSMB 3I73A 5T1IA 1SNCA 3S1QH 2C9WB 3BG3A 3H3VH 3A9KA 2Y0SE 4P6VF 2B2UC 1GOZA 1OQRA 3ZVVA 2KZRA 4L63B 3N1ZC 4Y52H 1VDZA 4DXFA 4ZUIA 3WOEA 5IT9E 4RFBA 5EKLA 2AMCB 1X65A 3TEYA 1F0ZA 1AP0A 4FLHA 4FN2A 3HOYG 4JI3Q 3KBXA 2A1AA 2MBQA 3IT4B 4K6LA 1PLFA 2EIFA 1TKGA 2KQ4X 3I2ZA 1ILQA 1GKHA 4A55A 1FR3A 3UDFA 3GTMB 2M56B 4JK1C 4CKEA 1GG3A 4ZDVA 3IHPC 1EIFA 3D3RA 1ESRA 1Q10A 2MO0A 5LMNL 2NWGA 5C0XH 2R93B 1I4QA 4PG3A 2BYTA 5LMUQ 4A3JH 1EOTA 1HUMA 1WCMB 1XTDA 4IN3A 4EX5A 3BU2A 2MBEA 3ULPA 2MA9B 4MDKE 4LFAL 4LDTD 1VQIA 3VYTA 5E6PA 3EFCA 2CWPA 5CHFA 1ILPA 3IL8A 1D6EC 2NN6H 2IYDB 4L23A 5BO4B 5IGEA 3H8HA 4HJAA 4C56C 4MSQB 4N59A 1B9RA 1WXQA 2JRHA 2KVZA 2D0OA 2K01A 3R3OA 2HQLA 3WOFA 1SYFA 1BMLC 3BWUD 1LM0A 4J6IA 4WJOA 3NUCA 3A8JE 1JB7A 2LY7A 4BAXA 1IXRA 3T51B 2O5JC 1EF1A 3IFWB 2R7DA 4H0LC 2WHIA 3Q3MC 1MHHE 3DBLI 4I6NB 2D3GA 3R93A 4KIKB 4KHPL 2OT2A 3AE9B 4GLAC 4A3EB 2FIDA 1AWDA 4XZ4A 2DYMA 2E8GA 2YEPB 2KWUB 2NB0A 1K8GA 4IUTA 2FBWB 2Z6BA 3TQYA 3CC7A 2CFMA 2I1KA 1WRDB 2KT7A 1L1OB 5KYIA 2LD9A 2F0QA 4DXGA 1M90C 3HK0A 4JPBW 1YN3A 1I50B 4KY6A 1HNWL 4IM2A 1DGSA 4CJ1B 1CKNA 1Y1WB 2AQ3B 5CR3A 5C4XG 2IHFA 2AL6A 2LVQA 5DNFA 1BF4A 5DM73 2E3TA 3BIID 3L3OC 2VUMB 1XMOQ 1H9SB 3PLVA 5DPTA 2GI9A 4APVA 3NQTA 3RLFA 1Q3LA 3RULA 1QOAA 4W9HA 1DM0B 4KHZA 2GBJA 3OIPA 2K9XA 2WACA 2DWQA 1Z47A 4BBNC 4MTNA 2F4VL 3KOJA 1I4PA 4C80A 4DV0Q 2F0KA 1KLVA 2WB1B 4GLXA 3GTLH 3ONSA 1GM5A 4DK0A 2NMQA 3AE1B 4L5RC 5FLXL 3AEAB 3OTOQ 1A70A 4JIOU 1XCTL 5IYBH 1E2ZA 2BCOA 4JI5Q 3S2HH 1E6EB 2D07B 3PIPA 3Q3FA 5M5WH 4RAUC 5FR3A 2KC1A 2LGYA 2LWPA 5KRUA 2A68C 2ZJQA 2DN8A 2B63H 2QHOA 5BN5A 2UXBQ 4RMFA 1TT2A 5F2DA 4NQKE 2O2LD 1R4QB 2K8BA 5C4JB 3M4OB 3HVZA 3G7LA 2ZTDA 1M1KC 1L6UA 4RHSA 5I6WA 4KKUA 4BY7H 4G57A 1HHVA 3V62A 2F0MA 3W1SA 2QIEB 4BKSA 2M0XA 3J80i 5IYCG 1V97A 1PFBA 2PW7A 3M9BA 4UPAA 3M63B 2Z6KC 4DV3Q 2KX3A 4HROA 1QB5D 2ONQA 3QJYA 4IOIE 1O80A 2DNEA 3ND9A 1JCKB 3AU5A 4I65A 3NVZA 2JY6A 4W9IA 2DZJA 1M4VA 1LM8B 1SF0A 1KNEA 1FCLA 3ALBA 2KQ7A 3H0GB 1HZBA 3S15H 1DGJA 2CJOA 3WDNA 5G3LF 4QCLA 1V81A 1E8XA 2R61A 1VD2A 2F1MA 2L8JA 3KF8B 2JYEA 2Y3AA 3QR8A 1YHQA 3FHWA 1K51A 1MSHA 1MGSA 1SYBA 3SXHA 4EUTA 1LFDA 1X9NA 5JEAH 4DUZQ 1WMHA 5M5YH 2G1EA 2MLBA 1AZQA 3FILA 4RNAA 1VMPA 2YV5A 2KMAA 3AEVA 3VFKA 2LI5A 4ZYSA 1B70B 1KRHA 4IG7B 2G4DB 5CGKA 4IM0A 2JEBI 3OPOA 3GTOB 2OTLA 1CK1A 3DXJC 3CF5A 3APFA 4CDFC 5EQ0A 2K50A 4JBWA 4KN4C 2K05A 1ICWA 1L1OC 4NQLB 5IOIA 5C23A 1I5FA 3V3XA 4LNQA 1LTGD 3NY5A 4NW2A 1J5EL 1JJGA 1WI0A 2N8NA 2N7EA 3MXPA 1PUTA 1HNZQ 4IUVA 4EE2A 4C2MH 3E0EA 4B3TL 5C2TB 4KX6B 3JAML 3P1MA 3AE5B 1H9MA 3ZDMC 2HHHL 2EY2A 2R3ZA 4KY5A 4XX5A 3CW2C 1S1QB 2KDBA 1E0ZA 4GDLA 4DAPA 4YY3Q 4PYUA 2GBRA 3H7PB 1WTWA 3TZUA 5C3JB 4NXML 2MRPA 3TMEA 3RMKC 2HIVA 5CORA 2FJ2A 1C4PA 5I9PA 3CKIB 2Q2UA 5CYUA 2E2DC 1Z6HA 2JA5G 2VS1A 3AE6B 1FPYA 1STGA 3BVMA 2ZZPB 2FCMA 2UYZB 1EEFD 3AEGB 4HKQA 2KXJA 2PPBC 1DOLA 3SHLA 1SNOA 4BY1B 3KUZA 4DHZE 2HQEA 1GJXA 2D3CA 3A1QB 4LF9L 1XNQL 2LVOA 3L54A 5DPSA 3DBRB 1WGYA 2DBYA 5M5XH 3J9CA 3NUHB 1VQ8A 4BBNF 4RA8A 2N3SA 4P16A 1HZCA 2L12A 2LHEA 2INPE 2ZVNA 4ANWA 2K5PA 4HEA1 1O7YA 2Z9HA 2I5MX 2QA4A 2JA6H 2KX0A 4B0EA 2IZVB 3RZDH 3W2DA 4XYOA 1IBXA 2LASA 1O78A 4RGOS 1TS2A 3M7GA 3MXNA 3VYUA 1JQYD 1YIJA 3BK1A 4ZQ3A 2B2UA 2FUHB 4LLGM 2WAQG 1VQAA 2PE9A 1YNTE 3HOVG 3DQVA 1Z9FA 3OMCA 4LF6L 2QSDA 1F9RA 4J8QA 1ZE3D 4B3SQ 3KWLA 5E4XA 3H6NA 1Q82C 4POGA 4A3CG 3S1RH 2VQFQ 2WXJA 2TMPA 3CU7A 4A3MH 3EQLC 1QCBD 3CWIA 2Q8RE 1SMXA 5ELEA 5L83A 3ZJVA 1F9QA 2NVTB 2HD5B 4QY7A 1NENB 5I2YA 3I4OA 3IFDA 2HTHA 3A7AB 1RFAA 4IALA 2XWJB 2LEKA 4NJ7A 4JWSC 1IPGA 4FHKA 1SN8A 5J39A 1JICA 2QDFA 1Y1VH 3Q8CA 2BYEA 2KCNA 3HVDA 5T8IA 1GUNA 4A3DG 1F1HA 3RLOA 1V6EA 4X57B 4JVZA 5A2QL 2F3VA 4QUFA 4A3KB 4EZKA 1VQ5A 3W5UB 3MHBA 2NVXB 1MFWA 1WY8A 3KUDB 3DPDA 4G7ZC 1I4HA 3VTUA 3EBEA 3X23A 2A73B 3RNUA 4X3SA 3TP7A 3FKIB 3PUXA 3SVMA 4LFAQ 4A3FG 2KWDA 4NNJB 3NXWA 2XN9C 3MAQA 4AJWA 1PGXA 5DAUA 2NTTA 4HMJA 4HCPB 2V1YA 1XQQA 3OJ3A 3QHTA 4C3HG 3N30A 1SLJA 1BQQT 4LFCL 5FO9B 1KNAA 2NBFA 2ZTEA 2DNCA 1B1ZA 1FEHA 1ICFB 2KN5A 4ILWA 5LXHA 5E6NA 2B8FA 3PZ8A 1STAA 1UGMA 2XIWA 2WDQB 1KAAA 3I4MB 1RODA 3DM1A 4JI1L 2RBMA 3HS0C 5C3WA 2R7ZG 3GTKH 2AWTA 2HDEA 2PJHA 4WH4A 5JJZA 3H1UA 3HOUB 3H9DA 5AEKB 3Q22A 2Z0EB 1QUQB 2UWQA 2YEPF 2WLBA 2XRQD 2RMMA 3SDLC 5D6JB 2L55A 3EFXD 3GQBA 2RDBC 4ZRIA 4ANUA 1UAPA 1SYCA 3ER0A 1R4NB 1WWTA 2L9HA 4BVUC 1WYDA 1E7UA 3VUYA 4YCVA 4R8NA 4E74A 3RZOB 1XCQL 2MSED 5KIXA 2M19A 3ZNZB 2W9NA 2WXMA 1C4AA 4IWQA 2K1FA 3CCSA 1HNWQ 1CJEA 1GHJA 2L7RA 4DR3L 2NZOA 3I4NB 3W5VB 2BWES 3RLNA 2E2JH 2PKOA 2D2CC 4FF3A 3HOZG 1OEYA 3S1MB 3AE7B 2CCZA 1XPOA 1SBBB 4Z9CB 1Q1OA 3M3YH 4DKAC 1VQ4A 5M3MH 3UE1A 1KLGD 2PZWA 1IYJB 3E9SA 2XGTA 2ZW0A 4IUMB 4J1MA 3RN2A 5GAGC 4A3LG 1FXAA 1N5WA 2WXRA 3M4YA 3M3JA 3PO0A 3PV1A 4XGAB 1ENFA 2F4VQ 4NPSA 5FLMG 4QIWB 3RZFA 4P73A 1B9NA 3K7AB 1VCIA 4LFBL 2G3QB 4OZAA 3DWPA 4CHTB 5CMDA 2J0TD 3HOVB 2BT6A 4BBSH 4A3OA 1SJHD 3PF5A 3L0WB 2KUMA 4DQOC 1WE6A 1TBEA 4KK7A 3TEHB 1WX8A 3B6YA 2N9LA 4PS3A 2F0VA 4RHRA 1HE8A 3RNFC 2UU9Q 4GNXA 1JE4A 2CHXA 1LT3D 3ZUNA 4K8JA 4GDKB 3WAOA 5LHY1 4HJ8A 4IZ8A 3D4DA 3SK6A 1I3QH 3KF6B 4IM3A 1XX8A 2ZT9C 2D9UA 2MGSA 1R9TB 4KVGB 1YBYA 4DUYQ 3AQQA 4H44C 1NBWA 2DENB 1B3QA 3ZLZA 1KOTA 3CMMB 1FNWA 3N9YC 1DYQA 2AUJD 4PNYA 2K5VA 2JXXA 3BJUA 2ON8A 1E2WA 3ZNHB 1YNJD 2F0IA 1EY9A 1Y8OB 2O2VB 2Z0SA 2AWNA 1JT8A 3H6MA 2Z6KA 1WTVA 4CO7A 5J22A 2N1WA 3PRZA 1B3AA 1QWYA 1EU4A 3JYUA 1LO5D 2FMMA 3QCAA 3Q8BA 2EVBA 1WE7A 3ZXRA 1TTNA 4DK6C 2KFKB 3A74A 1SE2A 3OWFA 2B2TA 1WYWB 2V9HA 4NAWA 4WJWA 2OF1A 1AZPA 2NZHA 2M1MA 3P20A 4A75A 3U50C 4DV5Q 4FADA 2Q5WD 3MEHA 4R4TA 4IJHA 3UDGA 1EWCA 2DLBA 2L5TA 3H7SA 5IYDG 3PUWA 1ESFA 5IWAQ 4OO1I 2KJRA 4MH8A 2J53A 1WJ4A 2OQ0A 1PH2A 4JYAL 4KDLB 1HZ6A 3MHSD 1GC7A 2CH4W 2REXA 4XWWA 4PMBA 2MJ8A 2B2WC 5HHDG 2D3BA 3RFZB 4BWGB 1EFWA 3K5OA 3U7DA 4YWGG 3VRBB 1L1OA 4CDCC 3GTJH 1CM9A 1QOFA 3FRPB 4YIJA 1DXMA 2F3WA 2WXQA 2B29A 3AECB 5JHAA 4IO9A 2PNRC 1X6OA 1TWFH 2CVRA 4OHJA 2KC2A 5M3FH 1EL0A 4AP4C 2IGGA 3SR1A 1H9SA 4BA2I 3QQ8B 2HHHQ 2WXOA 1P8LA 4UP7A 4BBRG 4REZA 4K6DA 3OMGA 5G3LD 1X3GA 1HNXL 4DV7Q 5ISRA 5GXGB 4F1SA 4X64L 3ZIMA 2L0TA 1IL8A 1IYVA 1LTRD 4JW0A 4US9A 1S5BD 2BDOA 1L4DB 2F0JA 2I46A 4DNIA 4NXMQ 2I38A 1UD7A 3J80c 3U7ZA 1TU2B 4OO1G 3PUZA 1Q12A 2C7NB 1X56A 3VR6A 2IO2B 2KMMA 4K3BA 3S14H 3ZDTA 3T3NA 1K83H 5EBCA 3HP3A 3J81L 1RWSA 3NG0A 2PZTA 4K14A 1F9JA 2BQQA 1N36L 1QOBA 1MG8A 2FAZA 5M9OA 2HUGA 2KDFB 3RNCC 4ZUJA 3EVQA 5LL6X 1FXIA 3NBIA 1SNMA 3KWVA 2YYZA 2WAQE 5LL6S 1XNQQ 3WIMA 5HI1A 4JI0Q 3S2DB 2O6VB 3HOWH 2IDYA 1DD2A 1UUPA 2IO1B 3GS2A 4G3XB 1WXVA 1F2LA 3DVNV 4KSKC 5FO8B 3K81C 3CCJA 1PHJA 3VTVA 4P2CB 4C3IB 4DU9A 1KTKA 4P71A 3TREA 3J81j 1PTOH 1XO3A 2R92H 1PFNA 1TVXA 3ETRA 4MM3B 1II3A 1L2NA 3HOXB 3ZTDA 4ZHOA 1V86A 1BDOA 3PTFC 4HN7A 1WF9A 1B7YB 1RJTA 2RHQB 4PMWA 4DR4Q 1WSPA 4N58A 3H3VI 2RDHA 1CSPA 1PDQA 2RD0A 3NELA 4LF6Q 2VQEQ 4JL9A 3JC66 2EYPA 1Y14B 3KJPA 1WJUA 4XYQA 4WORA 4B9KA 2V3NA 3PO3H 1MG4A 2CR5A 1WGDA 1B44D 1EWYC 5ELOA 2Y0SB 5IT9c 1R4MB 3KF8A 3Q23A 1SROA 5CV8A 3WWVA 1PGBA 2KMCA 3RT3B 2AL3A 3EHVA 1X32A 3H91A 2N0SB 1KD1C 2OOBB 1JWBD 2EYMA 3GTQB 1LTTD 1EO6A 4DR7L 4K0KQ 4YHHQ 2VRRB 5C3XA 4YTNB 5C0XI 3X0WA 4A3IG 3CIRB 1T3QA 2JA8G 1PGAA 1E5WA 1UELA 4YCWA 1NMGA 5J17A 4C1NI 4TKNA 4DK5A 2LRUA 4A93H 1JRUA 3F1ZA 3H94A 2PZUA 4YSXB 3GTGH 4X6AH 5C4ZA 3T1YQ 2WGSA 2F0GA 2DUDA 2D2QA 1WXMA 5J1ZA 2NVYB 1C48A 1D8LA 4LFCQ 1K0SA 3IVFA 4YWKA 3QIAA 1PYWD 3Q3OC 2NN6I 4LCDE 5K36H 1WH3A 1NAPA 3EFUA 3RNGC 1AYFA 4BBRB 2I0QA 4AQYL 1EWIA 4HRSA 4IUUA 2IX0A 4KKSA 1WX9A 1G2SA 3VH3B 3FVQA 5CHVC 3K0YA 5G5HA 3Q8AA 1UWVA 3MA2B 1C76A 4G50A 4IUNA 3OLMD 5TSSA 2EY6A 2KDMA 3H7PA 1K28A 2G9DA 2SNMA 4KKIA 1OQQA 1DOYA 1GNUA 1GAQB 4P72A 5C0XG 3VQIA 1IGDA 4ZRQA 4M8AA 3HHMA 3TBIB 3CCEA 3QOJA 4A3JG 1U9RA 2N55A 5C1ZA 2MPMA 3B2GA 1I94Q 3CMEA 3UIPB 1TY2A 3ZNGC 2D5GA 4DK3C 1WGHA 4X66L 4TKOB 2NCNA 4KGSA 4L6TB 3OYYA 1O7ZA 2NN6G 2JWUA 1UZXB 2AQ1B 3ERQA 2RSUA 4KD3A 1YNJC 5IP7H 3MTNB 1N32L 1QG7A 2D11A 5CBEE 2LMCB 4CJ2C 3NRZA 2K03A 2KEEA 4KSLC 5C3EB 4RGNA 2LVPA 3I55A 3TJPA 1IYUA 3NTIA 1LV9A 5CBAE 1LTLA 2G45B 2INNE 4DK1A 3GTPB 2KAJA 3IFTA 5C44H 5GMVA 1JOOA 4DR2L 4A3BH 3JSVA 4ZOHC 4N9F4 3VR8B 4FO2A 4XYCA 5IGDA 2JJQA 4M1UB 1SSNA 2IHEA 1ZXHA 3ZRFA 3FDTA 3D0FA 4F8MA 2C35B 4RF0A 2UU7A 4B3ML 3RR5A 1I6HB 2DX5B 4IWOA 2RA4A 1TKEA 4P1BC 1TWCH 4HKZE 4URKA 5EGTA 2F03A 1P7FA 4JI4L 4H7BA 1WGKA 3UI2A 3GZNB 4TRDA 2LXKA 1TY0A 2W54A 4NPNA 1NR2A 2E5LL 5AJ3L 2VZAA 4S0RA 2EYJA 4J3OD 1T0YA 2UXCQ 3UIOB 2KCCA 2Z0DB 1FM0D 4IUQA 5HKHA 5C5MA 5GADC 1P7EA 2K32A 2R6GA 2NVQB 2WXKA 4X65L 1TR5A 3A9JA 3VDYA 3K6OA 4AH6A 4FJZA 1HCZA 2JYOA 4EQOA 2EDGA 2NYZD 2RPQA 2X6LA 4W9KA 5EBDA 1K8AC 1EUJA 1A8VA 3CCUA 1RAXA 4K5WA 1QOHA 4HJ5A 1OXSC 1V49A 5IYBG 2D0PA 4JLCA 4CDDC 3NVYA 3DM3A 4LF8L 3M85A 4A3GB 1F9PA 2QF7A 1B2TA 2WDVB 4JBJA 1IKLA 4DA2A 1QZEA 1GUTA 4JYAQ 1QUQA 2B63G 3AV8A 4GXBA 2AHOB 4JX1C 2K5HA 2P5ZX 3TEZA 2B2WA 3PO2B 3E5SA 4G7OC 2FCSA 1F77A 1QVCA 1FGBD 2I07B 1OFFA 3PRMB 2EE1A 2L83A 4C3JB 1YI2A 4BY7G 2IBIB 5EPJA 3LWEA 4FJYA 3R66C 1MBYA 2OWOA 1C0AA 2R93H 1HA6A 4HXDA 5KHOA 4CGYB 1EY6A 3C0RB 1E8ZA 2N78A 1WCMH 2GN5A 4ME3A 3BS1A 4GKJL 1RIPA 2B76B 3B9JA 4YWLA 2EYOA 4DAMA 2H89B 4NAMA 4RM9A 4FNFA 1ML0D 3RMHA 4WRDA 2EJGC 1HTQA 4RM8A 2J7ZA 2E74C 4F7XA 2EYLA 2CJNA 4W9JA 1WI5A 3U9SA 1WR6E 2ACZB 2L05A 4X64Q 1BO0A 2NUCA 4ZAIA 1K8RB 4GZYC 3QG1A 2JA7B 1TZ1A 3M4QA 3X3MA 1N34L 1A15A 5JEAG 2GRIA 2KA7A 2Q8IB 1S40A 5LXIB 2DZKA 1N36Q 4QF4A 5EPKA 2QEXA 2MJEA 4YT0B 1ASZA 2JT4B 1EWHA 4A3EH 1XLPA 3E9HA 4GDKA 1VQCA 2ZXOA 5ELBA 1UE6A 2TSSA 1FJGQ 2OEDA 4I7ZC 4B9XA 3SFDB 2IW3A 3ZYYX 1SYDA 1WD1A 3N6RA 5ELNA 1HR0Q 2EPBA 3DWAA 4RKLA 1I50H 1A3VA 2A6ED 1ZXIA 4AUQC 1TJEA 1H8CA 4UDUC 1Y1WH 4AYBG 4IFDH 3A5ZB 1IP9A 1JE5A 5H8YE 4K7SA 3B1LX 1NI3A 1G6JA 1BBUA 3K8AA 2NPTB 1BT0A 4DHZB 2VUMH 2K6DB 3BK2A 3PUYA 1G2TA 2AX5A 2O2VA 3CSTA 5J18A 4HPLB 3IXSA 3K58A 3GD7A 2FXQA 2J4XA 4I6PA 2XNAC 2XK5A 4EZJA 2K3UA 2A6HD 2AQ2B 4OX9L 3HOYB 2KCTA 1Y8PB 5C5LA 1GXDC 2QMTA 1TS5A 1P0RA 2KFKA 3TS2A 1SB3C 2WX1A 2JX5A 1E10A 2JSVX 2B2YC 1NTGA 1DOKA 1X54A 5JPMC 1EY4A 1C8CA 2EQSA 2E76C 4HCEA 1QNUA 2PO4A 1TIID 1EY5A 2BGFA 5G2NA 4BFRA 4HR7B 2L1BA 5CHWA 2DJFC 1VZ6A 1EIYB 3KLSA 2KD0A 4XQQA 4ULLA 2B3GA 4DR7Q 1KL9A 1CSQA 1HH2P 4FF2A 3M4PA 1N33Q 4HPPA 1J8IA 3KH0A 4ICVA 1DONA 2HE7A 1WX7A 3U8ZA 3T8MA 1V80A 4BY7B 4MT5A 2JA6G 2B2VC 1GUGA 4WJ3M 3L13A 5C4JH 3M4OH 1WTXA 1YMHE 1MPEA 2VZKB 3W1GA 1UNSA 2KTRB 1KLUD 4HSPA 3SK5A 2JEAI 2FMCA 3AU7A 4KKJA 4GLVB 5I6YA 4JG2A 2KDIA 4TQ1A 4DR6L 3KBGA 3S9WA 2D3AA 2L00B 3QC8B 2W3SA 3V60A 2KHSA 2EJFC 5AUIA 2F0PA 4OGQC 3QJZA 4A3MG 3L08A 1ZUD2 1NCVA 1B4OA 4DGZA 1EOVA 2UXDL 2JQRB 1PZKD 3AH7A 4WJQA 4DV4L 3H0GH 2BA0A 3N32A 2WWZA 5BR8L 4HIMA 2J0JA 3UI3A 2KOLA 1N61A 3NZUA 3HG9A 3MC9A 3CPFA 1CZGA 4HSVA 1NE3A 2Z4HA 3PIOA 5AZGA 3RI7C 1F2RI 3QA8A 2GLSA 2E75C 4MGYE 1L4ZB 2WXGA 4OXPA 1OXUA 4Q0FA 4DV1L 3OWEB 3M95A 5C4XB 1WRIA 3P63A 2D10A 1IBLL 3DHQA 3OOCA 1XNRL 3GTOH 3UINB 4WQOB 3ND8A 4LF5L 3MJ5A 1F2MA 4ASWC 4X66Q 1IW7D 2C9OA 2LKVA 1HR0W 1HZ5A 2WXNA 2WDTB 1H9RA 3MXGA 3OIQA 1V2YA 2FCNA 5G5GA 4BXXH 4ABNA 1D2BA 1R4PB 1JB3A 2IY1B 4MGKE 5MPOA 2FIFA 3C8YA 3VUXA 4KDIC 1HRJA 2FHTA 2WS3B 2N49A 2KN4A 3DBLB 5JJKA 2ALYB 1A62A 4MJSB 4JI6L 3KFUA 1KM7A 5BMGA 3NQIA 1FXTB 1TWHB 1MVKA 2WXFA 2I5LX 5D3DA 1YN4A 3NOBA 4DXAB 3V05A 4W9DA 2A5HA 2YU9H 2BYVE 5ELDA 1Q1EA 2ICEC 3CP0A 3HFZB 2BE5C 2IY0B 2KENA 4RCOA 5KYLA 2KK8A 2L15A 2ZVOA 2MWSB 4MNOA 3KYDD 2EXDA 2JVCA 4A3PA 1LTAD 1XYIA 4K1RB 3ZJTA 1SFOB 2JF5A 4ZK9B 4ZKBB 2BH2A 5E7NA 3HGBA 1WR1A 2ZXPA 3SE0A 1MJEA 2M2LA 5AJ3Q 4NP5A 3W1YA 1YJIA 4BY1H 4JI7L 2JZPA 3CPWA 5M3MG 3UDXA 4IOAA 2MBOA 3D6CA 1HEZE 4RG1A 3GO5A 2ASQA 3MEFA 4X65Q 1V1PA 1CQFA 1IBKL 1TWAB 3MWYW 1Q90A 3KUCB 3ZGZA 1HPCA 2XEWA 4XE0A 2EY1A 3VR2A 1ZKHA 2LRWA 2MP2B 4JC0A 2PI2A 4BBSG 3F2UA 4RWSC 2RPVA 1JW9D 2WNMA 4GGQA 3S16B 2JXMB 2BYFA 3LB8C 2KACA 4W9LA 2O5IC 4A3MB 2KTFA 1CHPD 4V190
chains in the Genus database with same CATH topology
1GB4A 1SAPA 1V1OA 3JAME 2K28A 1E2VA 5JOBA 3K57A 4IDIA 4LTUA 2SAKA 4OVZA 3TEWA 3MVVA 4AQ7A 1SJED 2WP9B 2EJMA 3I72A 1XLNA 4H13C 2E2IB 3NPPA 4R9WA 2HCCA 1F9SA 2L52A 3AM9A 3I8ZA 1SYEA 1FFVA 3I3CA 2A6EC 2H4OA 3A54A 2ICIA 2FINB 1JWMD 2RSNA 5CV7A 1RTOA 1CT1D 2PQEA 2LMCA 4XTCS 2PCFB 1HA5A 2JA5B 3P42A 1SDFA 2A6HC 5ELCA 3VYSA 1EZ6A 3EGRA 1M8AA 3I91A 1V8CA 2FFKB 4TQ0A 5JVG3 4ZRZA 4R8IA 1B53A 3E0JA 2HDMA 1SYGA 2CHBD 1FIQA 2LGIA 1AW7A 5EKKA 3M3YB 3PV0A 4K2KA 4B0MA 1JC7A 2L1AA 2WAQB 4U673 1SE4A 5IGCA 5A2QE 3LXFA 1IGCA 4Y7NB 1ZYRD 2K7VA 1DCZA 3PMFA 3O13A 5I4DA 3S1NB 1SMYD 5IGGA 2MJ3A 1ZOYB 1Y69U 4FXCA 4WURA 1S5DD 1PXUA 2BOSA 4HAEA 3T16A 3T4AC 4DN4M 4A3DB 2LUMA 5D14A 1K52A 2IL8A 2MHVA 5I9OA 4TSSA 2ZXRA 3CQZB 1N63A 4A3FB 1VLBA 1S5CD 3G6JB 1ZXHA 2A74C 1D5MC 3AB5A 4U68A 2K04A 3Q24A 3EROA 4KV6A 4KY7A 5C0XJ 4C3HB 2RVLA 2V0GA 1O7LA 1J9OA 1IW7C 2MJDA 3KLRA 4E6IA 1CZWA 2CQAA 1HFGA 1I4GA 1EEID 1VR9A 2R7ZB 2EELA 4A8XC 2FE8A 3PO0A 4QB4A 1L0VB 2W55A 1CQVA 4XQNA 1AFPA 3R2IA 4QMGA 1STBA 2E6XA 4K5VA 2WXIA 5HGTA 3ITPA 3BDOA 4UAIA 2J52A 2QILA 1JRPA 1Q8IA 2DY7A 1NYQA 1LTSD 1QE6A 2SEBD 2WU5B 4R3DA 2XSCA 1HTPA 2CU3A 3NTKA 3HOZB 1C78A 1C4QA 4ITKA 4LK0M 4ZRPA 4ARCA 2K1BA 4HCSA 3NHHA 1HUNA 4A9AA 4XDXA 5K36G 1X3QA 3R2TA 4IUPA 1DOMA 3MC0B 1N5XA 3TP5A 1JWAD 4KI0A 1QJOA 5D65A 4XDDA 2JXTA 3AMUA 3HZXA 2F0WA 3S17B 1I7HA 1QKZA 1XWEA 4S3SA 3FILB 2PIAA 2BBCA 3FPUB 1XF5L 1ET9A 1FNVA 1I4RA 3C46A 1C9FA 1STEA 1LT4D 5HG2A 1NSNS 3U4EG 2X38A 4C7YA 1FD6A 2X69A 3EUB2 3VYRA 1UGJA 1JMLA 1BCPF 3NP8A 3Q6SA 2LHDA 3SFEB 3C1FA 3BVGA 1LTBD 3TP6A 4KN7C 4EGVA 3NWTA 4GDLB 3DUZA 3N52A 3X3NA 1BR9A 1GUSA 2FUG1 1CTMA 3LWUA 4US8A 5ELFA 5FOBB 4FF4A 2BS4B 3LYYA 1DOXA 2ZW1A 4EQNA 2IX1A 5EJWA 2LFNA 1VJKA 2PW9A 3J80L 1XEEA 1LTID 2L11A 3HEJA 5JEAJ 1U4PA 3KK7A 3TN2A 4RCNA 3J81E 1U4MA 1CZPA 5H92C 3A55A 4IQZA 2A69C 4K5XA 5HFYA 1IBXB 1WTQA 4FVMA 1VF5C 1PRTF 4LMQD 2E2HB 5EE9A 1S4ZA 3BYYB 1HTLD 4WIPA 4ME5A 4BS9A 5A35A 1HXYD 3T53B 1YQ4B 3K5LA 3AEEB 1RM6C 2PMVA 1ZYRC 4WFN3 4EQPA 5JPNC 1XLQA 1SMYC 1BOSA 4BA1I 2DY8A 2WU2B 4ZHPA 1CA6A 1UWMA 1H9JA 4H2AA 1W6JA 3PIP3 3DWQA 5IT9L 2L32A 3NZ3A 4OZCA 2Y5CA 4IFDI 1BUIC 3K59A 3BDCA 1TWGB 1VMCA 4XT3B 2MEKA 4MHEA 4D2KA 1LABA 1SEBD 2F0FA 4G4KA 3VA5A 1V43A 1PFDA 2IJ0A 5KNBA 1EIHA 3SK8A 4KKTA 4CKBA 3U9OA 1D1KA 3FC4A 1JALA 5FO7B 2M9VA 3E56A 2IGDA 3M7NA 4A3IB 2JA8B 2Z1CA 3U2SC 3URYA 2KEDA 3S1QB 2OXPA 3D31A 4OIKA 3V96A 4IFDG 5CC4A 3NE5B 3NBHA 4KJOA 1CFMA 1I4XA 2L0CA 1MHXA 2WXHA 2X6GA 2BS3B 4TQUS 4KGRA 2QKIC 3V2TA 1MI0A 4OW0A 2SDFA 2BE5D 4YSYB 5E3FA 5COYA 3T13A 3ZJUA 4GLSC 3K5MA 2EOTA 1B50A 2KVMA 2RQXA 4X3TA 1UWXA 2QDBA 5AFWA 1QF6A 1T6BX 1JROA 1K8MA 4A3JB 1EY0A 2H1EA 3HRZC 1G291 1XTCD 1IUEA 1FMAD 3P4SB 4WAFA 5JVH3 2F0OA 5CV5A 5IOCA 3IAS1 2VZKD 4FP5D 4NKLA 1DOIA 1PZID 1GPXA 1MD2D 1HQRD 2W82A 1CA5A 2VB2X 3NVWA 4K8IA 2MUYA 5KNDA 1OXVA 3U52E 3P75A 3GB1A 3AMZA 1TYGB 4FXDA 1NYRA 4K2LA 1BBXC 3SR6A 2BA1A 4NAWB 2W3RA 3EJIA 4EVOA 3KQ4A 4XWTA 2NZ1D 1ENCA 3NSWA 4LAAA 5AUKA 1L6VA 2LS01 1LLRD 1DZ1A 1PDXA 1U4RA 2RKSA 1EU3A 1WD0A 5JAVA 2L4NA 4PV1C 1J7AA 1ONLA 2WINB 1LT5D 3GV3A 2K33A 4OIJA 3QOLA 1RCVD 2AUKA 2K5WA 1PTOF 3OHXC 4JE3B 2Z4IA 1STNA 3VRAB 5BN3A 3C1EA 5E1FA 3Q0AA 1D5XC 4DNTB 3H3VC 1ENAA 1KABA 3GTLB 1T5XD 1ACCA 1NEKB 1RHPA 1TZOA 3S2HB 2XVSA 5M5WB 3FAHA 3UI3A 1D1IA 1EIGA 3CRKC 4FXKC 4O1NA 2VNUD 2B63B 3I90A 1QT9A 3ZQ4A 2C5CA 5BYRA 3TZDA 2IPKD 3J7YW 2N9KA 3TSSA 1FRRA 1K8OA 5IGFA 1I6VC 2MP1A 2VB3X 5BN4A 2GB1A 1BUVT 5IODA 4NZLB 4OZBA 1K53A 3Q8EA 5CV6A 2RSOA 3C2PA 2XWBB 1Q1BA 1YNND 1BCPD 1XLOA 3KUPA 1GUWA 3S15B 3MXUA 3T3OA 1C79A 3L9AX 3L7ZC 1YJJA 3TEXA 1X3PA 1SE3A 2V4DA 2G9HD 1FO4A 5T1GA 1YQ3B 1STYA 3A56A 2V4IB 1GHKA 5M5YB 4YTMB 2QJLA 1MI2A 2B2TC 3A7LA 1JORA 4PMCA 4B08A 1N60A 1A2UA 4V0BA 3BYTB 4OL7A 5FLXE 1EYCA 1ZKOA 4PQXA 3BZDB 4KJNA 3AE2B 2EKIA 2B39A 4N9TA 3NVVA 1PZJD 1SXTA 1C77A 3WCQA 4AYBB 4C2MB 3MP9A 1GB1A 2XRSD 1SIJA 5NUCA 3P1HA 1RFKA 1PRTD 1G8ZD 3CRLC 4XIGS 1FD7D 4RGTA 5C6AA 2BW2A 4FF1A 4TMAB 4RKBA 3D6WA 1GUOA 3AE4B 5D3IB 3Q69A 3TUOA 1RD9D 4MN3A 2YU9B 2WQYB 4NJCA 5BMHA 1LACA 1WYGA 2LFIA 5M5XB 1QLBB 3AEDB 1L5PA 1ZP0B 4F88A 4LK1C 2JA6B 3PZ7A 1SSOA 3RZDB 2IT1A 4M0WA 4L8JA 1FYCA 1ZDXA 2CW0D 3AN1A 1BCPB 2VXWA 3FPPA 1ROEA 1VDVA 1VF7A 4FYDA 3S1RB 3AE8B 3DWGC 2F0HA 3D4RA 5HURA 3W3AA 3HRDD 5CV4A 3OW7A 5E4WC 4RF1A 4RH6A 1SNQA 1AN8A 4PT5A 1Y1VB 3A8KE 1EM7A 3J7AV 4LJZC 1Y8NB 4NMZA 1EZ8A 1JWSD 1JWUD 4ID6A 4ODGA 2V3PA 2WDRB 1QILA 2BB6A 4IURA 5DM63 1B9MA 1TKYA 4HTHA 5IIFA 1TQOA 1SNDA 2F0UA 1KDAA 1IHZA 4KHVA 2EYFA 1E7PB 1VZ7A 1LT6D 1PRTB 1QQRA 2PYKA 2SOBA 1PMRA 3IAYA 3NK9A 5DEHA 3GTKB 1J7CA 1KH0A 1VZ8A 5BYSA 3AB9A 1RKNA 5JXVA 1Z7TA 1VRAB 1BXTA 1WVLA 2F0NA 1AEXA 1HQMC 2A69D 3SK4A 4Q5VA 3IT6B 2E2JB 3D8GA 4JPSA 1G91A 3VA7A 4XT1B 5I2XA 1V8QA 4IKGA 2PMZB 5M3MB 1PFMA 1EYAA 1XXGA 4N9PA 1CHQD 2Q8TA 2KECA 1K50A 3MHZA 4WWMA 1EYDA 1L0XB 2ENBA 1HFNA 4YTPB 4BBSB 3NS1A 1T5EA 1YNNC 1BCPC 2B2YA 2F0DA 3R8BA 2H88B 3QB3A 1S5ED 3D4WA 1TS3A 4YSZB 4CKCA 1QNKA 1W6KA 2F0TA 3CHBD 1I3QB 2WXPA 2IGHA 1F2ZA 3ABVB 2JU6X 1TS4A 4DAYA 4RGMA 1F2YA 1A3TA 2BDNA 1ZDVA 2ID0A 3FEWX 4J6HA 2B2VA 2RDGA 2MH7A 3VR5A 2PTLA 1PTOD 1EY7A 3J7AF 3BDLA 3I70A 1JR0D 2F0EA 3GV6A 4A90A 4C3IG 4X3UA 3W9CB 2J42A 2BS2B 4ZLTF 5BMIA 2EZVA 1ZXTA 1EY8A 1E9MA 1PRTC 2RDFA 4F87A 1WTOA 3I4LA 3AE3B 3I9V1 3QWNA 3NWSA 1H9KA 5LNK1 2EY5A 3P7JA 3QO2A 2M0AA 4KD4A 3NTHA 1G6ZA 1STHA 3OSOA 1F2RC 5BYQA 3DEPA 2OHFA 1R7SA 3GP7A 1ET6A 4MACA 3GTJB 4YXDB 2OEOA 2QEJC 3RPFC 3MTSA 3E6ZX 1TWFB 1C4CA 5FK9C 1NR4A 2IX3A 5M3FB 2PW5A 2JYTA 4KGTA 2B8GA 1EQVA 4L2YA 2SNSA 3I57A 5FKAC 3ONAB 4HJGE 3KLSX 2CW0C 2K22A 5E6JA 2K5QA 3B2FA 4XXEA 2GA4B 4IFDJ 4WQMA 1WTRA 3S14B 1K83B 2N7JA 1L0YB 2WIIB 5EKIA 2WXLA 1RF2D 1FRDA 2F4IA 1A3UA 3HUIA 3P4QB 5KEEA 4DAVA 2WKDA 3HOWB 3L4PA 2QCPX 4C1NK 1NVID 1KFYB 1ZEQX 1E0BA 1PTOB 2R92B 3TDQA 2DYOA 3P4PB 1OXXK 4ZKCB 2HTME 3LNNA 2KQ3A 3EA6A 2F0LA 2K6AA 2AWOA 2K5DA 2K0PA 1KDBA 1Y56A 1D4BA 4FXGC 2WV6D 4X3KA 4XQJA 2LJIA 2KJXA 3PO3B 2Y5PA 3BVZA 3MFYA 4O42A 1ZPSA 3HKZB 1BNZA 4CQNA 2NTSA 5K5PA 5EE3A 4L1BA 4NDXA 5EE0A 3DMUA 2D62A 2O4XA 4A6QA 5KNCA 1YN5A 4ARIA 4A93B 3AEFB 1TKWB 4N6EB 1JQ4A 5D7GA 3MZ5A 3GTGB 2HDLA 2JP1A 2PVGC 1V1PB 2JE6I 1FNUA 2HCIA 3DEOA 4HEDA 2I2YA 5IGBA 3VR4A 2Z8LA 3RUZA 3C3LA 1WTPA 1FFUA 1EFID 1RTNA 4QUCA 4KMUC 1QOGA 1RDPD 2PVOD 2A68D 4OO1H 2PLPA 3Q8FA 3IKJA 3IAM1 3VR9B 1RYJA 1MSGA 1NUCA 3SEBA 4CBVA 1JOQA 1A2TA 1S5FD 2N88A 3T56B 4XDCA 4HMIA 4C3JG 1SNPA 4DF7A 5EPLA 4JWUC 2WP8J 4MIUA 4DNRB 1PTOC 3MFGA 3FMCA 3DWMA 3SDZA 4DFAA 4G7HC 2IWHA 5EE1A 2WKCA 3RD4A 2BB5A 3J80E 4B9WA 5KGUA 1CI3M 1U4LA 3TP8A 5C44B 1OO9B 1EQTA 4AS1A 4A3BB 5C4HA 3H09A 2BTEA 1DJRD 2JSOA 5CV9A 1N62A 1D5ZC 3AEBB 3P4RB 2D5DA 3LX0A 4Q2JA 3K5NA 1J7BA 1TWCB 2M00A 4CJ0B 3PUVA 2EXZA 1KDCA 2F0SA 1OXTA 2EYHA 4C7ZA 3VR3A 1KF6B 3A8IE 1JOKA 1IKMA 3PIO3 4KTAA 1A6XA 1UEAB 4USAA 1FCCC 3I73A 5T1IA 1SNCA 3BG3A 4P6VF 2B2UC 1GOZA 1OQRA 4L63B 1VDZA 4DXFA 4ZUIA 3WOEA 5IT9E 4RFBA 5EKLA 3TEYA 1F0ZA 1AP0A 3KBXA 3IT4B 4K6LA 1PLFA 1TKGA 2KQ4X 1ILQA 4A55A 1FR3A 3GTMB 2M56B 4JK1C 4CKEA 3D3RA 1ESRA 1Q10A 2NWGA 5C0XH 2R93B 1I4QA 2BYTA 1EOTA 1HUMA 1WCMB 4IN3A 3VYTA 1ILPA 3IL8A 1D6EC 2NN6H 4L23A 5IGEA 3H8HA 4C56C 4N59A 1B9RA 1WXQA 2K01A 3R3OA 3WOFA 1BMLC 1SYFA 3BWUD 3NUCA 3A8JE 2LY7A 3T51B 2O5JC 4H0LC 1MHHE 3R93A 2OT2A 3AE9B 4A3EB 1AWDA 2DYMA 2YEPB 2NB0A 4IUTA 2FBWB 5KYIA 2F0QA 4DXGA 1YN3A 1I50B 4KY6A 4CJ1B 1Y1WB 2AQ3B 5CR3A 5DNFA 1BF4A 5DM73 2E3TA 3BIID 3L3OC 2VUMB 1H9SB 2GI9A 3NQTA 3RLFA 1Q3LA 1QOAA 1DM0B 4KHZA 3OIPA 2K9XA 2WACA 2DWQA 1Z47A 1I4PA 4C80A 2F0KA 2WB1B 4DK0A 2NMQA 3AE1B 5FLXL 3AEAB 1A70A 1XCTL 1E2ZA 2BCOA 1E6EB 4RAUC 5FR3A 5KRUA 2A68C 2DN8A 5BN5A 5F2DA 1TT2A 2O2LD 1R4QB 5C4JB 3M4OB 3HVZA 3G7LA 1L6UA 4RHSA 5I6WA 4KKUA 1HHVA 4G57A 3W1SA 2F0MA 2QIEB 1V97A 1PFBA 2PW7A 4HROA 4IOIE 1QB5D 2ONQA 3QJYA 1O80A 2DNEA 3ND9A 1JCKB 4I65A 3NVZA 1M4VA 1SF0A 1KNEA 1FCLA 3H0GB 1DGJA 2CJOA 3WDNA 5G3LF 4QCLA 2R61A 2F1MA 2JYEA 2Y3AA 1K51A 1MSHA 1MGSA 1SYBA 3SXHA 5JEAH 2G1EA 1AZQA 3FILA 4RNAA 1VMPA 4ZYSA 1KRHA 5CGKA 2JEBI 3OPOA 3GTOB 1CK1A 3DXJC 5EQ0A 4JBWA 4KN4C 2K05A 1ICWA 3V3XA 1LTGD 4NW2A 3MXPA 1PUTA 4IUVA 4EE2A 5C2TB 4KX6B 3JAML 3P1MA 3AE5B 1H9MA 2EY2A 2R3ZA 4KY5A 1E0ZA 4DAPA 1WTWA 3TZUA 5C3JB 3TMEA 5CORA 1C4PA 2FJ2A 5I9PA 3CKIB 5CYUA 2E2DC 1Z6HA 3AE6B 1STGA 3BVMA 1EEFD 3AEGB 4HKQA 2PPBC 1DOLA 3SHLA 1SNOA 4BY1B 2HQEA 1GJXA 2DBYA 3NUHB 3J9CA 4RA8A 4P16A 2L12A 2LHEA 2INPE 2K5PA 4HEA1 1O7YA 4B0EA 3W2DA 4XYOA 1IBXA 1O78A 4RGOS 1TS2A 3M7GA 3MXNA 3VYUA 1JQYD 3BK1A 4ZQ3A 2B2UA 4LLGM 1YNTE 3OMCA 2QSDA 1F9RA 4J8QA 1ZE3D 3KWLA 5E4XA 2WXJA 3CWIA 2TMPA 3CU7A 3EQLC 1QCBD 2Q8RE 5ELEA 3ZJVA 1F9QA 2NVTB 1NENB 5I2YA 3IFDA 3A7AB 4IALA 2XWJB 2LEKA 4JWSC 5J39A 1JICA 3Q8CA 2KCNA 3HVDA 5T8IA 1GUNA 5A2QL 2F3VA 4QUFA 4A3KB 3W5UB 3MHBA 2NVXB 4G7ZC 1I4HA 2A73B 4X3SA 3TP7A 3FKIB 3PUXA 3SVMA 2KWDA 3NXWA 2XN9C 3MAQA 1PGXA 5DAUA 2NTTA 4HMJA 4C3HG 1BQQT 5FO9B 1KNAA 2NBFA 1FEHA 2DNCA 1B1ZA 4ILWA 2B8FA 3PZ8A 1STAA 2XIWA 2WDQB 1KAAA 3I4MB 1RODA 3DM1A 5C3WA 2RBMA 3HS0C 2HDEA 4WH4A 5JJZA 3HOUB 3Q22A 2YEPF 2WLBA 2XRQD 2RMMA 2L55A 3EFXD 3GQBA 1UAPA 1SYCA 1WWTA 2L9HA 4R8NA 3RZOB 1XCQL 5KIXA 2M19A 2WXMA 1C4AA 1CJEA 1GHJA 3I4NB 3W5VB 2PKOA 2D2CC 4FF3A 3S1MB 3AE7B 1SBBB 4Z9CB 1KLGD 2PZWA 3E9SA 2ZW0A 4J1MA 1FXAA 1N5WA 2WXRA 3M4YA 1ENFA 4QIWB 1B9NA 3K7AB 1VCIA 4OZAA 3DWPA 4CHTB 5CMDA 2J0TD 3HOVB 2BT6A 1SJHD 2KUMA 4DQOC 4KK7A 2N9LA 2F0VA 4RHRA 1JE4A 1LT3D 4K8JA 4GDKB 5LHY1 4IZ8A 3D4DA 3SK6A 1XX8A 2ZT9C 2D9UA 2MGSA 1R9TB 4H44C 1FNWA 3N9YC 1DYQA 2AUJD 4PNYA 2ON8A 1E2WA 1YNJD 2F0IA 1EY9A 1Y8OB 2AWNA 3H6MA 1WTVA 5J22A 1B3AA 1QWYA 1EU4A 1LO5D 2FMMA 3Q8BA 2EVBA 1SE2A 3OWFA 2B2TA 4WJWA 2OF1A 1AZPA 3P20A 2Q5WD 3MEHA 1EWCA 2DLBA 2L5TA 3PUWA 1ESFA 4OO1I 4MH8A 2J53A 1HZ6A 4XWWA 4PMBA 2MJ8A 2B2WC 5HHDG 3RFZB 4BWGB 3K5OA 4YWGG 3VRBB 1CM9A 1QOFA 3FRPB 4YIJA 1DXMA 2F3WA 2WXQA 3AECB 2PNRC 2CVRA 4OHJA 1EL0A 2IGGA 3SR1A 1H9SA 4BA2I 2WXOA 4REZA 4K6DA 3OMGA 5G3LD 5ISRA 5GXGB 1IL8A 1IYVA 1LTRD 4US9A 1S5BD 2BDOA 1L4DB 2F0JA 2I46A 2I38A 3U7ZA 1TU2B 4OO1G 3PUZA 1Q12A 3VR6A 2KMMA 3T3NA 3J81L 5EBCA 3HP3A 1RWSA 2PZTA 4K14A 1QOBA 5M9OA 2HUGA 4ZUJA 3EVQA 5LL6X 1FXIA 3NBIA 1SNMA 3KWVA 2YYZA 5LL6S 5HI1A 3S2DB 2IDYA 1DD2A 1UUPA 3GS2A 1F2LA 5FO8B 4P2CB 4C3IB 4DU9A 1KTKA 1PTOH 1XO3A 4MM3B 1PFNA 1TVXA 3ETRA 1II3A 3HOXB 4ZHOA 1BDOA 4HN7A 1RJTA 4PMWA 1WSPA 4N58A 2RDHA 1PDQA 2EYPA 4XYQA 4WORA 2V3NA 1B44D 1EWYC 2Y0SB 3KF8A 3Q23A 5CV8A 1PGBA 1X32A 3H91A 2N0SB 1JWBD 2EYMA 3GTQB 1LTTD 5C3XA 4YTNB 5C0XI 3CIRB 1T3QA 1PGAA 4C1NI 3H94A 2PZUA 4YSXB 5C4ZA 2F0GA 5J1ZA 2NVYB 1C48A 3QIAA 1PYWD 2NN6I 5K36H 1NAPA 1AYFA 4BBRB 4HRSA 4IUUA 2IX0A 4KKSA 1G2SA 3FVQA 3K0YA 5G5HA 3Q8AA 3MA2B 1C76A 4IUNA 5TSSA 2EY6A 2KDMA 2G9DA 2SNMA 4KKIA 1OQQA 1DOYA 1GAQB 5C0XG 3VQIA 1IGDA 4ZRQA 4M8AA 3TBIB 3QOJA 1U9RA 2N55A 2MPMA 3B2GA 1TY2A 2D5GA 4TKOB 4KGSA 4L6TB 1O7ZA 2NN6G 2JWUA 2AQ1B 3ERQA 4KD3A 1YNJC 1QG7A 5CBEE 2LMCB 4CJ2C 3NRZA 2K03A 2KEEA 5C3EB 4RGNA 1IYUA 3NTIA 1LV9A 5CBAE 2INNE 4DK1A 3GTPB 2KAJA 3IFTA 1JOOA 4ZOHC 3VR8B 4FO2A 5IGDA 4M1UB 1SSNA 3FDTA 4F8MA 4RF0A 1I6HB 2RA4A 1TKEA 4HKZE 5EGTA 2F03A 1P7FA 4H7BA 1WGKA 3UI2A 4TRDA 2W54A 1TY0A 1NR2A 2EYJA 4J3OD 2KCCA 1FM0D 4IUQA 5C5MA 1P7EA 2K32A 2R6GA 2NVQB 2WXKA 1TR5A 3K6OA 1HCZA 2JYOA 4EQOA 2EDGA 2NYZD 2X6LA 5EBDA 4K5WA 1QOHA 1OXSC 3NVYA 3M85A 4A3GB 1F9PA 2QF7A 1B2TA 2WDVB 1IKLA 4DA2A 1GUTA 3AV8A 4JX1C 3TEZA 2B2WA 3PO2B 3E5SA 4G7OC 1F77A 1FGBD 2I07B 1OFFA 2EE1A 2L83A 4C3JB 5EPJA 3LWEA 1MBYA 1HA6A 4CGYB 1EY6A 3BS1A 2B76B 3B9JA 2EYOA 4NAMA 2H89B 4FNFA 1ML0D 3RMHA 4WRDA 2EJGC 2J7ZA 2E74C 4F7XA 2EYLA 2CJNA 3U9SA 2ACZB 1BO0A 2NUCA 4ZAIA 4GZYC 3QG1A 2JA7B 3X3MA 1A15A 5JEAG 2GRIA 2KA7A 2Q8IB 4QF4A 5EPKA 2MJEA 4YT0B 1EWHA 1XLPA 2ZXOA 5ELBA 2OEDA 2TSSA 3SFDB 4I7ZC 4B9XA 2IW3A 3ZYYX 1SYDA 1WD1A 3N6RA 2EPBA 3DWAA 4RKLA 1ZXIA 1A3VA 2A6ED 1TJEA 4UDUC 4IFDH 5H8YE 1NI3A 3BK2A 3PUYA 1G2TA 2AX5A 3IXSA 3K58A 3GD7A 2J4XA 2XNAC 2K3UA 2A6HD 2AQ2B 3HOYB 1Y8PB 5C5LA 1GXDC 2QMTA 1TS5A 1SB3C 2JX5A 1E10A 2JSVX 2B2YC 1DOKA 5JPMC 1EY4A 1C8CA 2E76C 4HCEA 1QNUA 2PO4A 1TIID 1EY5A 4HR7B 2L1BA 1VZ6A 3KLSA 4XQQA 4ULLA 4FF2A 1J8IA 1DONA 4BY7B 4MT5A 2B2VC 1GUGA 1WTXA 1YMHE 1MPEA 2VZKB 1UNSA 1KLUD 4HSPA 3SK5A 2JEAI 2FMCA 3AU7A 4KKJA 5I6YA 4TQ1A 3KBGA 3S9WA 2W3SA 2KHSA 2EJFC 5AUIA 2F0PA 4OGQC 1ZUD2 1NCVA 1B4OA 4DGZA 3AH7A 2JQRB 1PZKD 2BA0A 2KOLA 1N61A 3HG9A 1CZGA 4HSVA 2Z4HA 1F2RI 2E75C 1L4ZB 2WXGA 1OXUA 4Q0FA 3OWEB 5C4XB 1WRIA 3P63A 3DHQA 3OOCA 3ND8A 3MJ5A 1F2MA 1IW7D 2C9OA 2LKVA 1HZ5A 2WXNA