4RH6A

2.9 angstrom crystal structure of putative exotoxin 3 from staphylococcus aureus.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
189
structure length
187
Chain Sequence
SESELKHYYNKPILERKNVTGFKYTDEGKHYLEVTVGQQHSRITLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSNSVQYIDYINTPILEIKKDDVLKDFYYISKEDISLKELDYRLRERAIKQHGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Exotoxin 3, putative
publication title 2.9 Angstrom Crystal Structure of Putative Exotoxin 3 from Staphylococcus aureus.
rcsb
source organism Staphylococcus aureus subsp. aureus col
total genus 57
structure length 187
sequence length 189
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rh6A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rh6A01
2CHBD 3R8BA 1M4VA 4RGNA 2Z8LA 1PYWD 1CHPD 1L0YB 3MC0B 1SJHD 3DWQA 1PRTC 3KLSX 1SBBB 1D6EC 1S5FD 2WV6D 1I4HA 1TS4A 4OHJA 1ET9A 3TSSA 1B1ZA 3BZDB 4RGMA 5TSSA 1LT5D 4Z9CB 1JQYD 1FGBD 1ET6A 1I4XA 1I4RA 4RGOS 1CT1D 1LO5D 1EEID 1LT6D 2XN9C 1FNWA 3BVMA 1S5CD 1EFID 1UNSA 1B44D 2AQ3B 4RHSA 5ELCA 1YN4A 1BCPB 4TSSA 1LT3D 4ZYSA 1V1OA 1SJED 1YN5A 4DXGA 5I4DA 2IJ0A 1TS2A 4RH6A 1S5BD 1S5DD 3BVZA 1FNVA 1HQRD 1TS3A 1L0XB 1RF2D 4RFBA 1T5XD 1PRTB 5ELFA 1DJRD 1EEFD 2O2LD 3BYTB 1CHQD 1KLGD 5FK9C 4DXFA 2TSSA 1V1PB 1CK1A 4O1NA 2J4XA 2AQ2B 1HXYD 4C56C 1PZKD 1LTBD 1BCPD 1JWMD 1KLUD 1PTOB 2QEJC 1ESFA 1ENFA 5ELBA 3SEBA 3BVGA 3O13A 2RDHA 2R61A 3CHBD 5FKAC 3GP7A 4L63B 3URYA 1SXTA 1LT4D 1I4QA 4RHRA 1EU3A 1XTCD 1JR0D 1RDPD 2XRSD 1JCKB 1EWCA 1LTID 1PRTD 1PZJD 1D5XC 1UUPA 4K6LA 1KTKA 4UDUC 1G8ZD 1HTLD 2G9HD 2AQ1B 1LTSD 1PTOH 3BYYB 1V1PA 1JWSD 1SE3A 1TY0A 1AW7A 1MD2D 1DYQA 1PTOD 1F77A 3DWPA 3OWEB 1TS5A 1SE4A 1RD9D 3EA6A 1I4GA 5D3IB 1PZID 1CQVA 1FD7D 1YN3A 1TY2A 3R2IA 1QILA 4NZLB 1SE2A 1BCPC 1STEA 2ICIA 1EU4A 5D3DA 1BCPF 1BXTA 2RDGA 3W2DA 2XNAC 1AN8A 1S5ED 5ELEA 1FNUA 2QILA 1GOZA 1LTAD 3MFGA 5ELDA 4RCOA 4RGTA 1PRTF 1HA5A 2NTSA 4L6TB 1I4PA 1D5ZC 1RCVD 1SEBD 1PTOC 3V05A 3R2TA 2NTTA 1D5MC 2IPKD 1PTOF 4BWGB 1LLRD 3EFXD 1LTRD 1JWUD 2SEBD 1LTTD 1LTGD 2XRQD 3DWAA 1XXGA
chains in the Genus database with same CATH superfamily
1L5PA 1WTOA 1GUWA 2RR9A 3RZDB 1Q1OA 2ZXOA 4R4CA 3ITPA 4YSXB 3HOYG 3ONAB 2I0QA 1V8QA 1P0RA 3B08A 4RGNA 2JRIB 5C2TB 1JOKA 1Z6HA 1O7ZA 1XNQL 3M4OB 4EE2A 1QNKA 1P8LA 4A3MB 4YWMA 3J81j 4L5QA 4FF1A 5C1ZA 2BH8A 1BNZA 4OHJA 1N63A 2C9OA 1DXMA 4LJOB 1R4PB 3G4SA 1KAWA 2PQEA 4WAAA 4A3DG 1U4LA 2KTRB 1W6JA 2ZZPB 2OJRA 2WXGA 4A3CH 3PRPB 3ZJTA 4H44C 4NXMQ 3W5UB 3CC4A 4H02A 4CDFC 4EUTA 3HOZH 3CCUA 4R8IA 1J7AA 3GTLB 2VZKD 2GN5A 4DV2Q 1L0VB 1F2RC 4HJ5A 1K3RA 3PUYA 2KHSA 4N9PA 4DAYB 3APCA 3HK0A 3RZFA 4YXDB 5JXVA 1H9SB 4AQYL 1PVOA 1S5DD 4EQ5A 1O7LA 2N7DA 3HIZA 1GJXA 1V5TA 2F0HA 4BY1G 4BVUC 1FO4A 1PRTB 4LK1C 2UUCQ 1AZPA 1ZDVA 2C7NB 5C4JB 1L2FA 2KX0A 3RNGC 4UAIA 1EWIA 1WTWA 3A8JE 2VQEL 2ZTCA 1NSNS 3RLOA 2WFWA 5J3BA 3ND9A 2MBOA 2HJ8A 1ENFA 4LNQA 2DNFA 2MO0A 1PQSA 3GP7A 4QY7A 2M8SA 4YTPB 1PUTA 3IL8A 3TP7A 4JI7Q 1U4PA 2BKRB 3NY5A 4K3CA 3PQIA 2PLPA 1JR0D 4ITKA 3I4MB 1WTHA 4DR7L 2NVYB 1RTOA 2EJMA 2BGFA 3DBLB 3TCAA 4XWTA 2SNSA 1N33L 2WYQA 2N8NA 3RD4A 3W1GA 3PIO3 3AECB 3QARA 2G5DA 3WALA 3FVQA 4L8JA 5A35A 1AZQA 1P7EA 2KN5A 2BCOA 3ZIMA 1ZKHA 1NVID 2A74C 3TS0A 3PRZA 3KLRA 1F77A 3DWPA 2HHHL 3OWEB 2YEPB 5G55A 1VMPA 5D6JB 1C8CA 4RM9A 2N9XA 1Q86C 4P75A 3P1MA 2OWOA 2JA5H 3CC7A 4A93B 1EO6A 4US9A 1F2RI 2AWNA 3PIP3 3C19A 3JVZX 4MSMB 3EVQA 4PYUA 4GU2A 3MA2B 2D0OA 1C4CA 1BR9A 1GOZA 4YTNB 1JMCA 3U52E 2VNUD 2IY5B 4EZJA 3L3OC 4A3BB 2IGGA 3L4PA 2LJ5A 4RGTA 1LM8B 1E8WA 1Y69U 1YJNA 3W1SA 2UYZB 4ZRIA 4P6VF 1TU2B 4ICVA 1ROEA 4A3JG 1JWBD 4LF4L 1PH2A 1PTOC 2KO3A 2LY7A 2IO1B 1A15A 2TMPA 5I9OA 1VQFA 4QF4A 3TEZA 4KGRA 3VR2A 2MSED 4ACFA 5ELBA 4CKBA 1PLFA 1WXSA 2LXJA 5EPLA 3DPDA 3ETRA 1WX8A 3HOVH 3IG3A 4JVZA 4P7IA 4B3SQ 3S1QB 1ILPA 5G3LF 3M62B 3BDOA 3UE1A 2DZIA 5CV7A 1IBML 2KCNA 3GTPH 2B2UA 2Z8LA 2FCMA 2KMCA 1NNXA 2VZKB 4HCPB 3A5ZB 1WGYA 2QGQA 5GXGB 2KAJA 1Q7YC 2AL6A 3ZUNA 4KSKC 4IC7B 2E2IH 4GN5A 4ZQ3A 3H0GH 2WV6D 3MXNB 4CJ0B 2F3WA 3BZDB 2FIFA 2LMCA 2NCNA 1NCVA 4RGMA 3G48A 3KF6B 1TQOA 2UUBL 2AHOB 2HDLA 4FULA 2MBEA 4O2DA 1NI3A 5KEEA 3NSWA 3HOXG 2ZJRA 3WAMA 5EKKA 3ULLA 3IFWB 2M2LA 1UE6A 1LT3D 1SB3C 3M4QA 5CTRC 5GROA 1K9MC 1XJVA 2Z6KA 4IUVA 3VYRA 1EF5A 5KYLA 4A3EH 2IJ0A 3B1LX 3A55A 2JA8B 3I90A 1PFBA 4M00A 4W9EA 1VZ8A 5CBEE 4YHHL 3R66C 1CA6A 2GVAA 3GTMH 4KMUC 1IBLQ 2NN6I 3EN2A 2IYDB 4GIVA 1WZ3A 2L0TA 2X38A 1TZOA 2KTRA 4HIDA 4A75A 4OIJA 1EL0A 4FNFA 3SFEB 2EIFA 3D8GA 1RLFA 3VA5A 3TEYA 1R7SA 3P2BA 1B70B 1RIPA 3SEBA 1XPOA 2MUYA 1IL2A 2Q2IA 3R3MA 4XZ4A 4FADA 5ELOA 5JEAJ 1WVLA 1H9SA 4PV1C 4KD4A 4RG1A 4KHPQ 1M90C 2EYJA 4DR3Q 4LJZC 2DWQA 1HTLD 2G9HD 2B2UC 3AE4B 5T1IA 2I5LX 3PPAA 4A55A 4CKEA 1A63A 3IT6B 3SK4A 5M5WB 3VAWA 2I38A 4LNOA 4JK1C 2L11A 3KYHC 2BF8B 1STAA 1K50A 1UBIA 3R3OA 2MO1A 4XIGS 1M94A 2XBBC 1F52A 3AEVA 4OO1I 3P42A 3CW2C 4GDKB 3WANA 3TDQA 5BO4B 2F0OA 2WXKA 5CYUA 2C35B 3R2IA 3IT4B 1BCPC 2GOWA 3N1XC 4BBSG 1WXVA 3MXPA 2K8CA 1OEYJ 2INPE 5CR3A 3G7LA 5HFYA 1Z7TA 2JU6X 2N1VA 2XNAC 4JI0L 3HG9A 5M3FH 4E74A 1NDDA 2WQYB 2A6HD 4IFDJ 1QZEA 4XDCA 1YITA 2WWZA 2CW0C 2A68C 3EBEA 5IGEA 4X3UA 3LWUA 1Q5WB 1Y1WB 2MA9B 4MGYE 3I5JC 1SDFA 5M3MG 3NEMA 4CBVA 1VQ4A 2PNHA 4JV5L 2NTTA 4C1NK 3A4SC 1N9WA 3ZXRA 4IUPA 2KVZA 4AS1A 1YHAA 1HEZE 2KJHB 3P4QB 4MH0E 2SEBD 2XRQD 1XXGA 1JOQA 4K8IA 4B3MQ 3KVFB 5C4XG 4S0RA 3QAQA 4F7ZA 1EIYB 4JI2L 3TS2A 5J17A 2XK5B 4NPNA 1GJZA 3VR3A 3K58A 1I5FA 5FJ8H 4GKJL 5LL6S 1QVGA 2WXMA 3DBHI 2OF1A 4BAXA 4A8XC 3BDLA 2KC1A 1PRTC 4JI4Q 3T56B 2VL6A 1CMXB 2LGSA 2AUKA 1L6UA 4A3OA 3QOJA 3NWSA 1HR0Q 3S1MB 2C5CA 3I3TB 3IXSA 4FXGC 5M5XH 3ICEA 1N6ZA 5IGCA 2O6VB 4J3OD 4KVGB 3W5VB 2RMMA 4KJOA 2DLBA 1PH6A 3MC8A 2KMAA 4ANUA 2F3IA 2ALYB 1PDQA 4IUTA 3NP8A 3PCOB 1TWCH 2I2YA 3K0XA 3G71A 1HTPA 3L17A 3M63B 3VDZA 3RUIB 4DV3L 1ICFB 3AFQA 1SIJA 4NAWB 4KKTA 3E0JA 2RSOA 4QJFA 1BUIC 1GNUA 1ZOYB 3GV3A 2UXBL 3E9SA 4DV4L 4ME5A 2D2CC 5EQ0A 1N34L 1ZPSA 2JQRB 2JX5A 2UUAL 1F1HA 1E5WA 1S5BD 4LFAL 1CKMA 3VQIA 4CHKA 1J8CA 3ZJYC 3PO3B 4A3CG 4XQQA 3M7NA 4WJNA 3OMCA 1E2ZA 4LFCL 2VH2A 5ELFA 4LUOA 3HOZG 5JH5C 3KF6A 3RMKC 5M5YB 5C3EB 3E56A 3KUZA 3A8IE 4IDIA 2PE6B 4FA6A 1H4RA 1DOLA 2BTEA 5AEKB 2R61A 4DV6Q 3NG0A 1SNPA 2HTME 2FMMA 2EYPA 1W6KA 5EDSA 4A3KB 2NWGA 4LDTD 2LXKA 5FOBB 3AB9A 5AUIA 2K5PA 2EMSA 1T0SC 2JF5A 2XGTA 2ZEQA 4NAMA 3EQLC 2GRIA 3X0WA 3U7ZA 3A1QB 1X3GA 1SIFA 1XLNA 3KBGA 3A4RA 3KH0A 5JPNC 3ZLZA 2F0SA 1NI2A 2JWUA 2AWOA 2CHWA 3NTIA 1ZXTA 5BMHA 2ZM6L 3GTJB 2WXFA 3I4OA 3SHLA 4AJYB 2WU5B 3U4VA 1EFWA 3S2DH 1C3TA 4IJLA 4C4VA 1HJPA 2WXLA 1SN8A 3Q3NC 1RTNA 1C4PA 2WXIA 3U58A 1ZW7A 2GA4B 2V1YA 3H91A 3VH3B 2B39A 3VR6A 4GOPA 2FFKB 3I4NB 1SSOA 1V1QA 5G5GA 2IDYA 1VQEA 3SU8X 4EVOA 1FJGL 3WAOA 5CV6A 5J2RA 4P74A 3NBHB 3AH7A 5E6PA 4GNXB 3IBEA 4C7ZA 1XCTL 2Z0DB 1CJEA 3H7PB 3MC9A 2EXDA 3AM9A 1E22A 5T8IA 2Q2TA 3D3RA 4FF3A 2PKOA 3RZOB 2H4OA 2Z1CA 1RYJA 3K5OA 4ZKBB 3HOUH 1EQTA 3HVZA 4HSPA 4IURA 4W9HA 2IPKD 4JI8Q 1KDBA 5HI1A 1QOBA 2BYFA 1WE7A 2K1FA 1E1TA 4HDQA 2YU9H 3D6WA 4RA8A 1K0SA 2D3AA 1JRPA 3MTSA 3X3NA 2KKCA 5DLQE 1D1KA 1ISNA 1RL2A 3QB3A 2UXCQ 2H89B 2N7EA 4EQNA 1CHPD 1E8ZA 5HY6A 1HCZA 4B08A 2KNBA 3AE8B 2M0XA 2HIVA 1E90A 1CSPA 4TQUS 2FHTA 2J53A 1X3FA 2HT1A 1TS4A 2LKVA 3L0OA 2KCMA 3HKZG 3HOVG 1NTGA 4C1NI 3L0WB 4LF9Q 1G6ZA 3NK9A 1L0WA 1I7HA 2IGHA 2OEDA 4IKGA 2JA9A 1JJCB 5DEHA 4DN4M 3HGBA 4I7ZC 2ASBA 3BVMA 4MJSA 5HHDG 5CV5A 4NKLA 4LNFA 1TWHH 4FXCA 2B8GA 1HZBA 1SNMA 4FXKC 2K28A 4GOPC 1E8YA 1GO3E 5I4DA 5LMNL 4A3DH 3NVZA 5E4XA 5JEAH 3A9JA 3OLMD 2EJFC 3MWYW 4AYBB 3T3NA 2B2TA 3AMUA 3PO2G 1SF0A 1KOTA 3FILB 3Q8DA 4G57A 5HGTA 2WGSA 3A7AB 3ECIA 1FYCA 2DNEA 3MXGA 4MT5A 3QJYA 4OWWB 1TWFH 2RGFA 4A3EG 4G7HC 3J7AF 4AYBE 1NYQA 2QCZA 1XNRL 5H92C 4NAWA 4X3SA 4USAA 1E7ZA 4XGAB 1A3TA 3TREA 3F2UA 1MI0A 2D3BA 3CAMA 1YIWA 2R6GA 5K36H 4JX1C 4A3PA 1GXDC 2JWZA 4N8X1 1BKBA 2IHEA 4JBKA 2X8XX 4UDUC 3L13A 1Q1EA 2QJLA 2JE6I 4LWCA 4XTCS 1TYGB 5IOCA 2F4VQ 1VQCA 1K51A 1XT9B 1B9NA 4RMFA 1MD2D 5E6NA 1B4OA 1PTOD 5GADC 1PFDA 1DOIA 2KQ7A 4ODGA 2NBWB 3HVDA 3PO0A 2F0FA 5BN4A 4GN3B 4UPAA 4PZ6A 1K52A 2K9XA 2MP2A 4X66Q 1CFMA 2GBMA 3UQBA 5LHY1 3WIMA 3S1RH 4H13C 5FO8B 1SROA 4X64Q 3TP5A 5E4WC 2VUMB 4HVBA 3OSOA 3NJTA 4G0NB 1FPYA 1Y1VB 3PIOA 1II3A 5C0XI 3NVVA 3A1QA 2DUDA 5AZHA 3KUPA 2DAFA 1J7BA 5IWAL 2KK8A 2M56B 2ZVOA 3ERSX 4ZUIA 1N32Q 3FKIB 2M9VA 3PHXB 1WTVA 4TQ1A 2JA7B 2NMQA 2MHVA 5KNDA 2B2YA 3QO2A 2N9PC 3K5MA 3VHTC 1OXSC 3E3XA 4DR1Q 2WP8J 4UHVA 1T6BX 2H88B 5AUKA 3SFDB 1H9KA 3OMGA 3VH4B 4QAYA 3NENA 2MLBA 1TWGB 2SDFA 1DOKA 1EY6A 4HXDA 3BINA 4BOSC 2D0PA 3C1FA 1IGCA 1YQ3B 5NUCA 1UWVA 4A3JH 2KXJA 1K53A 1Q8KA 2ZNVC 1F0ZA 3CMEA 4GNXA 4GSWA 3D0FA 2F0TA 5A2QL 5FLXc 4BKGA 3KLWA 1GUAB 2QMTA 3H7PA 1HA6A 1WFYA 4OVVA 4NQKE 4YCUA 3C0RB 3T4AC 1A70A 3VR8B 2NVTH 1XPUA 4LNNA 4DK6C 2R93G 2NVXB 2IO3B 3KDFB 3SVMA 4G3XB 3TMPB 1ET6A 5FJ8G 1WTPA 1EY8A 4J6HA 4RGOS 3U4ZA 1LO5D 1DM0B 4R4IA 1YD8U 2E6XA 1AYFA 1LT6D 2RD0A 2VRRB 3LB8C 4N6EB 3ZVVA 4A3LH 2MJ8A 4K14A 4EX5A 3ZQ4A 5BN5A 4X65Q 4EFOA 3OTOQ 2CHXA 2LRUA 1HUMA 2K8HA 2L0FA 1GD7A 1I6HB 1TTNA 3LJ3A 4S17A 5FLXL 4RH6A 4Y7NH 1CKNB 3LDZE 1HQRD 4DUZL 2DENB 2K5QA 1RF2D 3HOXH 1BOSA 2M0AA 1EQRA 1JC7A 1J5EQ 3S2HH 2JSVX 2MJ3A 1CK1A 4HTHA 2BOSA 4O1NA 3K59A 4L5RC 3I55A 3V3XA 2B2YC 1YHBA 4LF8L 1BCPD 1E7VA 1ZXIA 1PTOB 3DMUA 3NWTA 2MEKA 3I57A 1DGSA 3K6OA 2J7QB 4PMBA 2EPBA 1RFAA 5KHQA 3V62A 4KI0A 3K9PB 4OXPA 2HDMA 3ZDTA 2EY2A 1B7YB 1SGHA 2RF4A 2HDEA 5JHAA 3J81L 3WOFA 1Q90A 1P7FA 1WCMB 3CQZH 3I4LA 3MFYA 4RCNA 2EMTA 4REZA 5LNK1 1XLQA 2CW0D 4MHEA 2N4FA 1WFQA 2N88A 1NE3A 4GNXC 4NXNL 4KJNA 4E6IA 1CA5A 4DR6L 1F9PA 1YJIA 2DYOA 1IPGA 2J0MA 2PE9A 4EZLA 2I5HA 2LJIA 3PF5A 1C4QA 2ES2A 1GUTA 1A2TA 5IGDA 5JVH3 4DGZA 4X62Q 1TZ1A 1U4AA 2Y5PA 3CCLA 4HJ8A 1CQVA 1OTCA 4DR2Q 2PEAA 3AE6B 4WURA 1HNXQ 3TBIB 3VTWA 5C23A 3CRKC 4RMAA 2CH4A 1G2TA 2Y0SB 2BPSA 2R2QA 3Q3JA 3CIRB 3NZUA 2D5GA 2QW7A 4TKNA 5COYA 5KRUA 4DQOC 1RFKA 1XMOL 2LFNA 4GLAC 2ACZB 2GBKA 1OXTA 2JY6A 4MGKE 3HOZB 4ASWC 4QL5A 4JI3Q 3AEDB 4EZKA 4BBSH 1IBKL 3JW0X 2NBFA 2Y0SE 1X9NA 1P16A 1W3SA 3DEOA 3GD7A 4NMZA 4JI5L 3AE1B 1TKYA 4HMJA 5CORA 2IO0B 2INDC 2QSDA 1Q0WB 1D5MC 3M9BA 4GLSC 1TVXA 4WIPA 4A90A 1PDXA 1HNZQ 2BT6A 2PTLA 4NQLB 2ID0A 3OPOA 2CHBD 1K0RA 4BBRG 2R92G 5EKIA 1VQAA 5IGFA 3H3VH 2EKIA 4L5SA 4C80A 3PGZA 5DAUA 4FF4A 3QX1A 3MHZA 4D2KA 5M3MH 4BY7B 4WH4A 1PYWD 4FHJA 3T1YQ 5BYSA 1EY4A 3MC0B 3EECA 3DWQA 4MGZE 2JK8A 1SYDA 1XEEA 1UBQA 2YV5A 1A62A 2XIWA 4GN1A 4OZCA 5C4XH 2HE7A 3LNNA 4DK3C 2D5DA 3DBHB 1VDZA 4ZHPA 4LF5Q 1B2TA 3I91A 3RT3B 3EC8A 5EJWA 4HSVA 2ZCBA 2OEOA 3H7SA 1QUQB 2N49A 1SYGA 4HR7B 5CGKA 1HE8A 3C1EA 5JOBA 5I2YA 4JBMA 1BCPB 4TSSA 4KY7A 2KBNA 4B3RL 3GDEA 2BS3B 2BA1A 3K81C 2JA5B 4FHKA 2W3RA 2G4DB 1OQYA 2Q8RE 2EDGA 2KWDA 2JQOA 3WAPA 3Q8AA 4BKTA 3ND8A 4H0LC 3K5NA 2KDIA 4NJCA 1D2BA 3KDFA 1VD2A 4K5XA 3Q14C 1FVIA 4ZKCB 2WXQA 1MPEA 3P4RB 2MNAA 1V5OA 1C9OA 1ILQA 3AU5A 1KL9A 2Y5BB 4OIKA 1WXQA 2VS1A 1PZKD 3X3MA 4AQYQ 3BZKA 5JEAG 2K50A 3UDFA 1QKZA 1HPCA 2KHIA 1V9PA 2LVOA 1IKLA 2MBHA 3PLVA 5DPSA 2WDVB 2YTYA 3CU7A 1R9TH 5IP7H 3AI5A 1CKNA 2IGDA 4EEWA 2PNRC 3Q6SA 4PK1A 1AE3A 3K7UC 1UUPA 2VQEQ 1X56A 4C3HB 3CMAA 3Q22A 3AU4A 1YNXA 3DHHC 3GQBA 1X54A 4GGQA 4PS8A 1EQQA 4UP7A 2IX1A 5C4ZA 1V8CA 2K05A 3DXJC 4DAVA 4HCSA 2XTIA 1DYQA 2L5TA 5K36G 5L37A 1V86A 2V3NA 3GTPB 1VZ6A 1QB5D 1RD9D 2KWUB 3PHWB 3Q8FA 1YNJD 1VR9A 3DQVA 2E2IB 3H0GB 4M8MA 5F2DA 3S15B 4NZLB 2BA0A 5IYBH 2CH4W 4GMVA 3A9KA 1RHPA 2WXPA 1SE9A 4BXXH 4IFDG 1BXTA 3ERQA 2HHHQ 5H8YE 2RSNA 3BS1A 1PA6A 3Q23A 1DONA 4HJKA 2NZ1D 2R7ZG 2JSOA 1OXUA 4A3IH 3HS0C 4ZCKA 3VR5A 1EM7A 4ZRPA 1S3OA 2E5LQ 2WLBA 4NXML 2L1AA 4PYZA 3F2DA 4G7ZC 4TRDA 1Q8IA 1HFNA 2Q8TA 1PRTF 3TP8A 3DVNV 4DV2L 2I1JA 1I3QH 3L9AX 4AUQC 2B2VA 4B95A 4MIUA 1SNOA 2JT4B 4LTUA 2VB2X 1S4ZA 1VZ7A 3VRAB 1U4MA 2QA4A 4IUNA 3AE7B 4II3B 4KHZA 3I56A 4KSLC 2IWHA 5KHOA 1JALA 3GTMB 3TIXA 1CQFA 4A3FG 5K5PA 3NELA 3GTQH 2W9NA 2F52A 4DV7Q 1MKHA 5C0XJ 1EIFA 4C2MH 1GC7A 2K22A 4N58A 3DHQA 2Y3AA 1XMQQ 2DN8A 3R8BA 4BFRA 3PS6A 3QIAA 4HJAA 1O80A 3A8KE 3S1NH 3RCZA 3H3VC 2ZTDA 1E10A 1ZKOA 1AWDA 3T13A 4DXAB 1IXRA 2L4NA 1S5FD 1KJTA 4JI7L 1VRAB 2LS01 2E8GA 1FCLA 1E8XA 1ET9A 3TSSA 3VYTA 4WAFA 1ASZA 2YEPF 1JROA 5TSSA 3DOWA 4G7OC 3QHTA 4IM3A 1GPXA 1WYGA 1TXYA 4IQZA 4R4OA 3L10B 1QVFA 1L7YA 1QT9A 3ZTDA 3R7QA 3WA0A 3UI3A 2WB1G 1E9MA 3KJPA 2AQ3B 1YBYA 3A7LA 2LGXA 2LD9A 3OG5A 4KN4C 4GN4B 2I46A 1LM0A 1UE5A 2Z9HA 2K4KA 3C8YA 3ML9A 4N8FA 3GZNI 3HOWG 4YL8A 3BVZA 1F2YA 4AIMA 3K57A 2KA7A 1OQRA 4A3LG 1EEFD 3D4WA 1D4BA 4I65A 5M3FB 2B2VC 2A4ZA 4F8MA 1R4MI 2X69A 2AQ2B 1QUQA 4C56C 2IO2B 3BK2A 1SNDA 4AJWA 5JZEB 1L2NA 5FR3A 3GTGH 3IVFA 3O13A 4X6AH 3KUCB 2KJRA 5DPRA 4OL7A 4JYAQ 3PO2H 3V6CB 1YIJA 1PHJA 3ZNID 3H3VI 1HRJA 4ID6A 3VVWB 1JCKB 1LTID 3J80c 1U4RA 4JE3B 2CWPA 4DDGD 1WTRA 1TR5A 5CV9A 1FRRA 2FCNA 2JYOA 1P9DU 3UIOB 2M1MA 3E5SA 4XWWA 4BBNC 3GE8C 4LNKA 3H94A 1XF5L 1CZWA 4B3SL 1EYDA 2UXDQ 1Y56A 2LEKA 1V9JA 3HM6X 1JB3A 2F3VA 2WAQB 5A2QE 3I4MH 1I4GA 1PH1A 2DBYA 1YHQA 1PZID 2M00A 2R7DA 4TV3A 4F88A 1TY2A 1NAPA 4UP9A 1QILA 2ONQA 3W9CB 3FHWA 1T0QC 4DUYQ 5M5XB 4A3GG 2KD0A 3MTNB 3Q8EA 2BDNA 3RNFC 2LHDA 4IOAA 3I73A 1TT5B 4K5WA 1U5KA 2WAQE 4C4VB 3TP6A 4JPBW 3J80L 4URKA 1O78A 2KANA 2RPVA 1B9RA 1Q1BA 1TWCB 2ZT9C 3BWUD 4GOPB 3QC8B 5DPTA 3I3CA 2ZCCA 3DDCB 3J7A5 3AEFB 2KECA 5BYQA 2FJ2A 3OYYA 1YEZA 2E74C 5LMUQ 5FLXE 5GQOA 1RCVD 2GB1A 2MWSB 2V4IB 2MQJA 3S17H 2A19A 2L52A 1S1QB 3DEPA 4HJ7A 3S14H 2F0DA 2VB3X 1JWUD 4K0KL 5BMGA 1VMCA 1IBLL 4HJ9A 4A3BH 1LTGD 1MG8A 4KIKA 4V0BA 2VW9A 3SR1A 4DV5Q 2KDBA 5IN7A 1YJJA 3KUDB 1VQHA 2UWQA 4JI1Q 2IX3A 2VQFQ 1WXMA 4I6NB 4N9F4 4P1BC 4F87A 1L0YB 2JZPA 3H6MA 1SJHD 4EQOA 3N9YC 1LYLA 3KLSX 1PV4A 2ZXPA 1Z2MA 1D6EC 3MHBA 1FFVA 4ALPA 3M95A 2H5XA 4GXBA 3VR9B 1QLBB 3TZDA 3J81E 2ZPYA 1Q12A 4EQPA 1EY5A 1RM6C 1ICWA 3CKIB 4A76A 1ZXHA 3J81i 3C46A 4GKJQ 3OW2A 4KHPL 1UAPA 4DNIA 4DR3L 4WJ3M 3JSVA 4WWOA 3VTUA 4P1CC 3CCMA 2KJXA 4CKCA 1V97A 1A0IA 1KABA 1ML0D 1VF5C 2CKHB 2MCNB 4W9LA 3QJZA 5ELCA 3AXCA 1BVSA 3Q0AA 1ACCA 1H95A 2KDEB 2Z0SA 2R93H 2WIIB 3ONSA 4MJSB 4NPSA 3FDTA 2C60A 4J8QA 2MH7A 3GE3C 3OWFA 4C3IG 4UY8C 1TS2A 2KN4A 5JVG3 1GB4A 4LMQD 2WINB 1JE5A 4P72A 1OXVA 3AQQA 1M1KC 2EY5A 2AEHA 3A9JB 1N5WA 2EKEC 2CVRA 2XWBB 3FP9A 4DV1L 2R3ZA 1WJ4A 2N0SB 4NJ7A 2ZW1A 3RPFC 2HCCA 2J42A 1WM3A 4W9FA 3GO5A 4IALA 2PZWA 4KLKA 1AARA 1S40A 5EGTA 2N55A 1N8RC 1KD1C 4JIOU 2AX5A 4HPMB 2NN6G 1BMLC 3URYA 3PTFC 3RFZB 1I4QA 2FXQA 4KKSA 1XTCD 3DUZA 3HOUB 4H2AA 3N3KB 3TRZA 1UF0A 4DK5A 1PZJD 1G2SA 1KTKA 5GAGC 5EPJA 5CHWA 1FXIA 4KZ0A 1LTSD 2ZNVB 3E6ZX 2YU9B 2FINB 4KX6B 4B3ML 5D7GA 1AW7A 1QNUA 1GHJA 4WJQA 3A54A 1LFDA 4DHZB 3S24A 5IP7G 3AE2B 5GMVA 4HN7A 1SFOH 4YCVA 3S2AA 2JEBI 2RCFA 1BBXC 3EUB2 5EPKA 2E3TA 1N60A 4CJ1B 4BA2I 4JI4L 1FIQA 2BWES 2G9DA 1A2UA 4Q5VA 3VFKA 1STHA 2MP2B 1WWTA 1UELA 3SGIA 1HR0L 4C7YA 3HOYB 4DHZE 1SE8A 1AFPA 2B63G 4HEDA 1EYGA 1S5ED 2OQKA 3JAMc 1CM9A 2EOTA 2I5MX 3D32A 1NMFA 3PF4A 4JI6Q 2NYZD 4XYQA 4WJWA 5C3XA 3OIQA 2JYEA 5IYBG 3RI7C 4BZAA 3K8AA 2V3PA 4BXXG 4OW0A 2K04A 1EY0A 3QG1A 4C3JG 1VQOA 4A3DB 1KXLA 3ZKJC 3V05A 1SEBD 4L1BA 2KHJA 4XQNA 3CF6E 3H8HA 2KCCA 3AEAB 4JC0A 4A3IG 3MJWA 4GDLB 3TEWA 2C7HA 4BWGB 1ZE3D 5TR5A 3GOEA 3MEFA 1OXXK 1K8GA 3OAWA 4TQ0A 1WMHB 3T9LA 5LMNW 3L54A 1BT0A 1SYEA 4ME3A 1HZ9A 2EYOA 1X3PA 1TWFB 3JAML 3NS8A 3NHEB 4OZBA 3K9OB 2F0MA 1FGUA 5C5MA 2L0CA 3NZ3A 4JOIA 2GLSA 4CDCC 4BY1B 4W9GA 3FKYA 1VQMA 4YCWA 3K7AH 1UZXB 3FILA 5BYRA 3IKJA 4KKIA 2A8VA 1L4ZB 3CP0A 2ZPNA 4JCVE 4FLHA 5KNCA 1RAXA 4BBRH 4Y52H 2R92H 1B9MA 2CU1A 2REXA 2XEWA 1KIXA 1VDVA 3IAM1 4CO7A 1FGBD 3K5LA 2KQ4X 3ZRCA 4KHVA 4RNAA 3KYDD 1P98A 1YNJC 4FXDA 2KC2A 2Y5CA 3NZSA 3VUYA 3M3YH 4Q0FA 1X6OA 2NR2A 1FD6A 1STYA 1A6XA 1V1OA 3QR8A 4KV6A 2GBJA 3E9HA 1HUNA 3FC4A 3TEXA 3S1RB 2EYLA 3PSEB 1NR2A 2EVBA 5JAVA 4YY3Q 1VQJA 4YTMB 1T5XD 3KW5B 2JRHA 2NUCA 4A3MG 4LF6L 4EKUA 1ESRA 1VQNA 3IHPC 4OELB 3EROA 2BBCA 2RVLA 2FUG1 1JW9D 1F9JA 3ZDMC 4FJZA 2Z0EB 4HKQA 2K5HA 2X6GA 3PMFA 2O2VB 1V6EA 3SK6A 3PO3H 3JYUA 1HHVA 1CSQA 2KOXA 4IPHA 4IJHA 3FAHA 3H9DA 3N52A 4IUQA 4XX5A 4RWSC 1A8VA 1AEXA 4HROA 2JXXA 4JI8L 4JOIC 4CDDC 1EUVB 1TWAH 3S16H 5BR8Q 2Q2HA 2RHQB 3BYYB 5ISRA 3IAYA 1MHHE 2L15A 3VDYA 4A3JB 1SE3A 3P20A 4WFN3 3DWMA 4LDTB 3CRLC 5CX3A 1OO9B 3CF5A 3ZGZA 1E7PB 2A73B 2DHZA 3VTVA 2KFJA 1F9QA 1C48A 2WB1B 2UXCL 5LL6X 2LSSA 2B76B 4ZHOA 1CI3M 2MJEA 1I94L 4YIJA 1WYWB 4MEMA 5D2MB 2HQLA 1STEA 4CQNA 2NB0A 1H9JA 1E2VA 1X65A 1B8AA 1JJGA 2WP9B 3NUHB 4RF0A 4PZ7A 2K6QA 4HWIB 1A3VA 4IN3A 4LF7Q 1AN8A 1F9RA 1L1OC 3GTJH 4BA1I 1KFYB 3JC66 3I4MG 3MXUA 1FM0D 2LHEA 1EIHA 5J1ZA 5ELDA 1WOCA 5BN3A 5EAYA 5FO7B 4IOCA 1V49A 2Q2UA 4QIWB 3M3JA 1G6JA 3LYYA 4IFDH 1SLJA 4DA2A 1WGGA 2NTSA 4Y7NB 4J1MA 1I4PA 4IWQA 2R7ZH 3OOCA 2MBBB 3GB1A 1WSPA 4WJPA 3HOXB 1EUJA 3KYCD 2PQAB 4DAMA 3EFXD 2JZ3B 2M19A 1K28A 4QIWE 2PW9A 3QK0A 4X57B 3DHGC 3V2TA 3GTOH 4A93G 5EE1A 4H7BA 2ZJPA 4DK1A 3UI2A 1X3EA 3F2BA 3APDA 4DWFA 2BS4B 3SR6A 1O7IA 1YJ1A 4RF1A 4POFA 4HKZE 1ZYRD 4P2CB 3NUCA 2CJNA 5G5HA 4A3FH 3PUVA 2PPBC 3STBC 1P3QU 2V0GA 1JRUA 4A3BG 3LGJA 2NVUI 4M02A 1CTMA 2LGDA 1QCBD 2WXOA 4QUFA 3WCQA 3CQZB 1VCIA 4NW2A 4GDLA 3ZJVA 1EZ8A 2NVQH 1JQYD 3T1HQ 1IP9A 1G6PA 1I4RA 1WMHA 5FO9B 5DCNA 1PFNA 1MJEA 1DGJA 2F4VL 3HKSA 3AE5B 1GM5A 5G2NA 1HNWQ 2BB6A 1WZ0A 3QCAA 3B9JA 1KAAA 3T3OA 3FRPB 2SNMA 3TL5A 5CV4A 5J18A 1IL8A 2ZW0A 1XX8A 4DXGA 1EOTA 4X66L 3PREA 3OW7A 4PZ8A 4K7UA 4L23A 5IOIA 3T8MA 2OCEA 1OEYA 4TUUA 3ZNGC 1VQGA 3ZO5B 3KWLA 4X64L 4WWMA 1JORA 5KNBA 3J80E 3NOBA 3A56A 1CHQD 3BG3A 3J7YW 5AJ3Q 4DV0L 3CD6A 1ENCA 2N9KA 3GZNB 2WS3B 1QJOA 3J80i 1D1IA 2RDFA 3NQIA 2EY6A 1NBFC 2DZMA 4FYDA 2RKSA 1C77A 3HOWH 2ASQA 2PPHA 1C79A 2AWTA 3N20C 4KK7A 4BBSB 2OJWA 3HM3A 1X55A 3V61A 2H1EA 1N32L 2A69D 1R4MB 1WF9A 4R9WA 1WH3A 4FBJB 2OTLA 3V96A 2W82A 4CHTB 2KTFA 1SMYD 2L05A 2AUJD 3HP3A 3Q2AC 4DR1L 4K6LA 3RN2A 4PQXA 5ELNA 1MJCA 2FAZA 2KVRA 2JA8G 2C5LC 2EYHA 3FEWX 1XPRA 3R93A 5M3MB 2PO4A 4L5TA 4JL9A 3EA6A 1IW7C 2N78A 3K80C 3TEHB 2O2VA 1IKMA 4B3TL 2KYWA 1EY7A 1SE2A 1U9RA 4GKKQ 5C4XB 2ZJQA 1FXTB 4G11A 5EE0A 4AP4C 2QEXA 4K6DA 4K7WA 4MH8A 3CMMB 2J52A 3Q3FA 3RZWC 4B0EA 2KHWB 3A9KB 4HIOA 5I6WA 4DR4Q 4RKLA 3VRBB 4ZRQA 1E0BA 2PZUA 2Z59B 2QCPX 2BDOA 2K03A 1ZP0B 4M0WB 3K0YA 1E2WA 4RCOA 3N30A 1IYUA 5IIFA 2NZOA 1T0RC 1KC8C 2J7ZA 4X65L 4OVZA 4A3GH 4OX9Q 2RPQA 1HH2P 4O42A 3P4PB 1MGSA 1EYCA 3BY4B 1IHZA 5C0XG 4BKSD 1Y1VH 2KLCA 1PTOF 2QDBA 1DCZA 4IZ8A 2BYTA 1WGHA 1J5EL 2PVGC 2LGYA 2B3GA 3N32A 2LXCA 4X3KA 3RD2A 1MG4A 1KRHA 2Q8IB 2JXMB 2JA7H 1V43A 2L7RA 4HMIA 2F0GA 2Z6BA 1FRDA 1STGA 2FNJB 1R9TB 5AZGA 2K5NA 4XYOA 3PUXA 2BE5D 2XWJB 5C3JB 4HIMA 2EELA 2LI5A 3N6RA 2JA6H 4IUMB 1J6QA 2K6AA 1NENB 1JICA 3FMCA 1Y1WG 1SR3A 2PQAA 1PH9A 4NJ6A 5AFWA 1E24A 1Q81C 1K8OA 4LFBQ 1I6VC 2PVOD 2LRWA 1EEID 2E2HH 2BW2A 4WWNA 1J7CA 5EKLA 3CCJA 5CHVC 3DM1A 1EFID 1L4DB 1CKOA 2CKZB 3U7DA 1C4AA 4ZYNA 3CCRA 1STBA 3U4EG 2G45B 4DR5Q 1VQBA 2NVXH 2LZ6A 3DVNU 2HCIA 2UU9Q 4X62L 4KDIC 2K5WA 1E7UA 1HNXL 2SAKA 4GLVB 1EYAA 5JHBA 1N36L 2KJ6A 1T9HA 1DJRD 1WGKA 4BBNF 3SK8A 4IFDI 5L83A 1D3ZA 1V81A 3UIPB 1TKWB 3CWIA 4JPSA 1WX9A 1XO3A 3PRMB 4JQWC 2KOLA 1EWYC 4C3IH 1LTBD 3RYTA 1I6HH 4JI3L 1VS0A 1ESFA 3SHQA 1I3QB 1XNQQ 1QVCA 1QOFA 2L83A 4CJ2C 2ZVNA 5IAAC 1M8AA 1MJDA 1RODA 4RHRA 1TBEA 4JWSC 4F1SA 4OEMB 1EWCA 2PI2E 3RULA 3GTQB 2OQ0A 5IE8A 3EFUA 2NZHA 1G8ZD 1HNZL 2F0WA 4IPDA 2AQ1B 5C44H 4HPPA 4W9CA 1PTOH 2KACA 4C2MB 1TT2A 2NN6H 3JAME 3PO3G 4KKJA 1TY0A 3I63C 1PMRA 4KN7C 1VQ7A 2CU3A 1TS5A 1E1OA 3JAMi 1XWEA 2G3QB 1OGWA 4K3BA 4LLGM 3S1NB 3AULA 2K01A 3TZUA 4HJGE 3T1YL 4ANVA 5C3EG 1GUOA 1WCMH 2LVPA 5G3LD 2O5IC 1KDCA 1QF6A 2INCC 2PZTA 1Z9FA 3AEGB 3GTKH 1XLOA 1BCPF 3AB5A 2RDGA 3BDCA 3J7ZC 2E2DC 1HQMC 4LF5L 2NPTB 2V3SA 2QILA 2YYZA 4A3KG 3KLSA 3QQ8B 3LX0A 3CCSA 1VLBA 3TBLD 3BU2A 3KJOA 1B53A 3M85A 3HOVB 3HKZB 1HZ5A 1SRUA 5IA7A 1I42A 3I9V1 1MBYA 2B63H 3QOLA 4OO1H 5I6YA 2CFMA 4DR7Q 4NNJB 1IBXB 2INNE 1Q82C 3TMEA 4MGIE 1ZEQX 1FR3A 1LLRD 3HKZE 3A0JA 1N33Q 4CDEC 1MIUA 1N62A 2GVBA 4M01A 1LTTD 2CR5A 2EY1A 2EZVA 1QWYA 3VYUA 2G1EA 1BBWA 2Q5WD 3VYSA 3X23A 5IO9A 4C3JH 4KIKB 2IL8A 2B3AA 5C6AA 1M4VA 1J9OA 3G6EA 3I4NG 3GTGB 1N61A 4M0WA 1WM2A 3TUOA 4MTNA 4FO2A 3PO2B 4WJ4A 1WGRA 2N9LA 4IWOA 4QGUA 2I07B 2DAJA 1FEHA 1Y14B 3ZYYX 1WRIA 2FCQA 4ZLTF 2GBRA 2WXHA 2WXNA 3OJ4B 1FXAA 4JWUC 1LABA 2WACA 1LT5D 1Q3LA 3PUWA 4A3EB 1C1YB 3DBRB 1R4NB 2C7MB 4MNOA 4HEA1 2BS2B 2R2OA 1NBWA 1WX7A 2WXJA 3Q69A 4BY7H 5IODA 2XN9C 2WDTB 4OGQC 3U2SC 3JSVB 1K83H 2JXTA 2UUCL 5LLIA 2F0UA 2ENBA 1NJIC 2E2JH 1LXDA 1V80A 1QOHA 2KWCA 1ONLA 3A74A 1I50H 4RAUC 5E6OA 4CGYB 2DY8A 4LF4Q 1KDAA 1Q46A 2CQAA 1GUNA 3VUWA 3QIJA 1P1AA 4P73A 3LXFA 1XLPA 2W55A 2IT1A 1JMLA 3W1BA 3HUIA 3PZ7A 5FK9C 3B2FA 2KFKA 4DHJD 3UQAA 3RZDH 1DZ1A 1D7QA 1IBMQ 1MI2A 2E5LL 3N1ZC 3PVLA 4KV2A 1OTRB 3BIID 5T1GA 2BKFA 2LUEA 3CHBD 2D3CA 4HPLB 4DU9A 3CSFA 4L63B 3M4OH 3VXWA 1FCCC 1KM7A 3J7AV 1UEBA 4A3MH 3G6JB 3U9OA 3S17B 1EU3A 2KENA 2FBWB 2I1KA 2LGIA 4AQ7A 3S14B 2BVCA 2UUBQ 1YQ4B 3I7FA 1HZAA 2DZKA 4W9IA 3RLFA 5LXHA 1PH4A 2VY3A 4DV7L 1ZYRC 1GUSA 1BDOA 3UDXA 2WKDA 5I9PA 1FL0A 3J9CA 4AYBG 4PT5A 4WJOA 1ENAA 1XMQL 3RNAC 2PI2A 1QG7A 5C5LA 3O65B 3GTLH 4K1RB 5KYIA 1WD0A 4A9AA 1DOYA 2D11A 1UEAB 2EQSA 4WORA 5D3IB 1GHKA 1WYDA 3UINB 1JQ4A 3TQYA 1FD7D 4C3HH 1EZ6A 1PH5A 1YMHE 4YHHQ 4HRSA 1C78A 2J0TD 2RQXA 2V4DA 1T3QA 2JUOA 2K33A 3W2DA 2HJ1A 2KQSA 4J15A 5C4JH 3D4DA 1Q10A 1JB7A 1L6VA 3STBD 1TKGA 2D9UA 4TKOB 3H15A 5E3FA 3UDIA 2IZVB 3PZDA 4KGSA 4FDBA 2UU7A 1SSNA 3RR5A 2R93B 3S15H 1NUCA 4R1JA 5LXIB 1HA5A 5HGQA 4WWPA 2CS4A 3UGBB 4M1UB 3PT2B 3R2TA 3AEBB 5IT9c 4BKSA 1G291 2IX0A 1MFWA 1J0GA 5HKHA 2NVYH 4YWKA 2RA4A 1JWAD 1NMGA 3L16A 1IYJB 4ZUJA 2BH2A 2NPTA 2HIXA 3KWVA 1C9FA 4I6LB 1VQLA 2QKIC 5I2XA 4GOCA 4LJPB 2VUMG 2A69C 5DM63 2WHIA 4E71A 5BMIA 3ZRFA 3PSIA 1KF6B 3LWEA 1Y1VG 1VQ6A 2O6VD 4L2YA 3RUZA 2KWVB 1SMYC 4K0KQ 2KDMA 3C2PA 4JYAL 3Q3OC 1RJTA 4HIKA 3W1SC 1VQKA 4A93H 4FF2A 1K8RB 1I4HA 2JVCA 1IBXA 2DYMA 3Q8CA 2K8BA 3FKIG 1H9RA 5IT9L 1DOMA 1B3QA 3T16A 4JI0Q 2JA7G 3R7RA 5MPOA 1MHXA 5HURA 2FIDA 4AWJA 2OT2A 5IP9G 2IY0B 2KX3A 3ZJUA 2EYMA 2MP1A 1N5XA 4DHJB 2WKCA 4DAYA 2UXDL 2PIAA 4XDDA 2K32A 1YN4A 3UDGA 1UD7A 2ATWA 1SFOB 4DFAA 4HLEA 3SDLC 2JA6G 2IBIB 1IYFA 1KLVA 1JT8A 2GBNA 5CHFA 2QF7A 1YQBA 2RDBC 4P16A 3WWVA 1WGDA 4OZAA 3NHHA 4JV5Q 1T0YA 1L1OB 1OFFA 1VQDA 2BYVE 1TS3A 1L0XB 4DUYL 4XT1B 3QWNA 4DK0A 2YTXA 1ZUD2 4LNIA 2A5UA 2M4NA 3MZ5A 4XDXA 3QWZB 4JI2Q 2IY1B 1IW7D 1WJNA 3U30A 3W5OA 3AFPA 3KF8B 2HD3A 2PJHA 2J4XA 3DM3A 1WRDB 2A6ED 1HR0W 1ASYA 3S1QH 1HTOA 4IWPA 4MDKE 3BVGA 1NEKB 4U68A 4B9WA 1SYFA 2E76C 2L1BA 1VQ8A 2L32A 1SXTA 5CV8A 3CC2A 3NVWA 3DHIC 5LMUL 4DV1Q 1EF1A 4IO9A 3EGRA 2MX2A 2XRSD 4OONA 1MHWC 2Z6KC 4K8JA 1PGXA 3S2DB 3SD5A 4B6WA 4ARCA 3RNCC 4BS9A 2L12A 2DNCA 1J19A 2FUHB 1RRBA 1DOXA 5IYDG 4DV3Q 3AYHB 4DV5L 4A4IA 1ZGUB 2KT7A 4HCNB 5E6JA 3MHSD 5IYCH 4JI1L 3K7AB 2VQFL 2BE5C 2UXBQ 1VQIA 4DV4Q 1MSGA 2FMCA 1N34Q 1S72A 2PMVA 1WI5A 1UWXA 2ICEC 2UUAQ 1RKNA 1CZGA 4LFAQ 2Z4IA 5D65A 5C44G 4BBRB 1W2BA 2R92B 2MFIA 4JBJA 2JA8H 2ICIA 1WJ6A 1PH8A 1YOVB 4LFCQ 5EE9A 1GB1A 4KD3A 3GV6A 4U673 1HTQA 2K1BA 1T5EA 2HTHA 2IW3A 4US8A 1LTAD 2F1MA 4MM3B 2B8FA 3HZXA 3HEJA 4R8NA 1WCMG 3M3YB 1RWSA 4K7SA 2R7FA 3MFGA 4ULLA 1KRTA 1Z47A 3B0AA 4LCDE 2O5JC 4ILWA 2N9EB 4B0MA 1IYVA 3CSTA 2DGYA 4KTAA 4DF7A 2YVCA 4L6TB 4DDID 1F2MA 2L8JA 3EHVA 3SDZA 4PS7A 4PMCA 4I7AA 3DLLA 2MHJA 2RHSB 4FJYA 4R4TA 1YNND 5E1FA 3KBXA 3I70A 2JEAI 1XQQA 2KEEA 1SNQA 2GMIC 3EFCA 4K81A 1XD3B 2F0NA 3NE5B 1J8IA 4QB4A 5JPMC 5M5WH 4IPGA 1B3AA 4TVAB 2Y0SG 3HRDD 4DNTB 2ZM6Q 1KNEA 4LW1A 4QMGA 5C0XH 3CPWA 4OO1G 2QDFA 4B9KA 1A3UA 1BO0A 1U0LA 3MXNA 4XXEA 1WI0A 1KH0A 3CCEA 1TWHB 4PS3A 2WX1A 2J0JA 3F8TA 2G4SA 2KMMA 2K75A 4OVUA 2MPMA 1IUEA 1UGMA 3PV1A 2P5ZX 2BYEA 1TWAB 5M9OA 3S16B 2RSUA 3E0EA 2A5HA 1CT1D 2K52A 2F03A 2L76A 2LWPA 4W9JA 2YTVA 3T51B 1FJGQ 2JZZA 1XYIA 2FCSA 1S5CD 2AKWB 1BUVT 4X3TA 4GZYC 2RCNA 1VQPA 2MRPA 2K3UA 4W9DA 3NTKA 5JJIA 5D14A 3VA7A 4AH6A 2KLGA 4QUCA 1EQVA 2PYKA 3RN9C 4JW0A 1STNA 1Y1WH 3IAS1 4DNRB 5IP4D 1E3PA 2N7JA 1BBUA 3QA8A 4M8NA 5EE3A 2F0KA 3D4RA 4GB9A 3CPFA 4R3DA 4BY7G 3AU7A 1UGJA 3DBRI 5IY0A 4DV6L 1R4NI 4MTKA 4LUVA 4MZ9A 4YSYB 2N1WA 1F2ZA 2ZXRA 4S3SA 4DXFA 2TSSA 1C7YA 3GS2A 4WQMA 2ZTEA 2F0PA 4JI6L 3HRZC 4NY0A 1KRSA 2O4XA 4ANXA 2QEJC 2HUGA 3RMHA 4RKBA 2HD5B 3DBLI 1K8MA 2RDHA 2LUMA 4POGA 3U9SA 3KFUA 4QQBX 3E9IA 2R7ZB 3S9WA 4LF6Q 3KOJA 4KZCA 1PFSA 1RDPD 4ZK9B 3S1MH 1L1OA 3DCGA 1D5XC 2JA5G 1PFMA 3NQTA 3GTOB 2EE1A 2KCTA 4OWTB 2QIEB 2QHOA 5IKCM 4G4KA 1WR1A 1JWSD 3KF8A 3MP9A 4GDKA 4XT3B 4GS3A 2JN4A 1SE4A 1CUKA 1TKEA 4IM0A 2A1AA 1JE4A 4A3FB 3B2GA 4FJVB 3L08A 1WIAA 5LMNQ 2F0LA 1G91A 4R4QA 1UH6A 3B6YA 4ZRZA 4BOZB 3P75A 3L7ZC 2AL3A 4IPCA 2WNMA 5FLMH 1NY4A 4IM2A 2KQ3A 2RBMA 1GVPA 5D3DA 2NVQB 1UE1A 1TGZB 2CJOA 2JYTA 4AOFA 2K5DA 1TIID 4A6QA 5ELEA 1GC6A 5M5YH 3ALBA 3L2PA 1X3QA 2D10A 1VQ5A 5C3EH 1PGAA 1I94Q 1PH3A 1XNRQ 4C3HG 2LXAA 3D31A 3CCVA 2X6LA 1VJKA 1XCQL 4K5VA 2AMCB 4ZOHC 1SYCA 2OHFA 5IGBA 3PUZA 3HOYH 3PGEA 3MVVA 3SXHA 3Q24A 1R4QB 2K5VA 3U8ZA 2L55A 3ER0A 3CXCA 5IGGA 3VR4A 1EY9A 4A3KH 2WU2B 3W1YA 1E6EB 4HK2A 4ICUA 2E75C 4YY3L 5FR6A 2OOBB 2VZAA 2XK5A 1NR4A 2YLMA 3PZ8A 3FPPA 2NVTB 3NPPA 3H0GG 1PXUA 5CBAE 5J22A 3NTHA 4XYCA 3NXWA 5H1SE 4P71A 4PNYA 1V2YA 1ZDXA 1Z5SB 3HOWB 4MM3A 4WRDA 1HZCA 1E0ZA 4LF9L 2QC8A 2WB1E 3IFTA 3UE0A 3UF8A 1QQRA 4YWGG 5JJZA 1Y8PB 3IFDA 1WTXA 4WQOB 3TJPA 2O6VA 2B29A 2F0QA 4TMAB 4JG2A 4NDXA 1I35A 4DPGA 2K6DB 2CWAA 2ZJDA 1YNTE 3KK7A 3H1UA 3A5UA 3M4YA 1K8AC 1I4XA 3I4NH 3P4SB 3RNEC 5BR8L 4BY1H 1QOAA 2CHZA 2BB5A 4YT0B 2V4LA 2F0VA 3V6EB 1WTQA 1SYBA 5EBDA 5IWAQ 3S2HB 4RHSA 5JJLA 1PYSB 1PH7A 1NYRA 1TIFA 1YJWA 2WX0A 3CCQA 3I8ZA 4KKUA 1SJED 2K0PA 1WD1A 1YN5A 1KQSA 1DD2A 3RZOH 1EWHA 1UWMA 1Y8RC 2MW5A 3ABVB 4RM8A 4IW0A 5J39A 3IRBA 2L00B 4APVA 2NBUA 2EJGC 1YJ9A 2O2LD 3BYTB 4F8CB 1AH9A 2JP1A 4UP8A 4LF7L 4IUUA 1CZPA 1IGDA 1V1PB 2W54A 3HHMA 3ZNZB 4ABNA 2LASA 3AEEB 4M8AA 2DZJA 2B2WA 1HXYD 1YZ6A 2VH1A 1JWMD 1KLUD 1WY8A 4EOYA 4A3GB 2KEDA 3VUXA 5FKAC 3DWGC 1WXAA 3Q8BA 3RN5A 1LTLA 2FE8A 5GAEC 3A33B 1LV9A 3NS1A 3WDNA 4DV0Q 4GLXA 5AZFA 2NS5A 1QE6A 5L95C 2EXZA 2KVMA 2K14A 2K7VA 4K2LA 3OJ3A 4KGTA 3KQ4A 2WXRA 4KY6A 1KHIA 4KDLB 3I2ZA 5DM73 4HCEA 3TN2A 3M7GA 2B2TC 1JJ2A 1HFGA 4Q2JA 2AYOB 5GAHC 3W3AA 1QZHA 2ON8A 3BK1A 3D6CA 2LFIA 4W9KA 3AMZA 2DX5B 3PIPA 5C4HA 5M3FG 3NRZA 3Q6BA 2F0IA 4I6PA 1H9MA 3RNUA 4F7XA 3I72A 4IOIE 4YSZB 2SOBA 4DUZQ 2JA6B 4JGHB 3F2CA 1EU4A 4LK0M 5IT9E 2OXPA 3T1HL 3NBHA 1WR6E 1FNUA 5IYCG 2E2HB 3MAQA 5KGUA 5EBCA 4B3TQ 2F0JA 4LF8Q 3PLUA 4CYEA 3RLNA 1HNWL 4PG3A 3P7JA 1GKHA 2BWFA 1F2LA 1X32A 4C00A 3ML8A 1G51A 2D2QA 1H8CA 3MEHA 4NP5A 4EGVA 5HG2A 1SMXA 2WAQG 2B2WC 3SE0A 4DAPA 1O7YA 2A6EC 2XVSA 3FPUB 4NXNQ 4DR6Q 2NBVB 1KLGD 1LACA 3F1ZA 3AE9B 4FVMA 3MJ5A 3ZW3A 3C3LA 2Z4HA 5AJ3L 1YX5B 1KNAA 4E3CA 1QZGA 1XTDA 3NBIA 1PGBA 2F4IA 1VCBA 4C3IB 1EOVA 4KY5A 3DVGY 1WJUA 3J81c 4FP5D 1HZ6A 4II2B 2F0EA 1LQBA 2DYBA 2J0KA 1SBBB 2A6HC 2DJFC 2BQQA 2M17A 3ZNHB 4YWLA 2PMZB 4ZRKA 2W3SA 1C0AA 2GI9A 3AN1A 4ANWA 1B1ZA 2MQHA 2PW5A 3OTOL 1AP0A 1WE6A 3Q3MC 4Z9CB 2VUMH 5C44B 2HQEA 2EYFA 3PV0A 4ZRJA 1XMOQ 1QOGA 2V9HA 4NB3A 1FNWA 4MELA 1MSHA 1BQQT 2PMZE 1C76A 1UNSA 1B44D 1IBKQ 4A20A 1K73C 4ZYSA 1VQ9A 2CQOA 4JI5Q 3SK5A 3DBSA 5C3WA 3FKIH 3BZCA 1TJEA 3P63A 2A68D 4PMWA 2N3SA 1BF4A 2MGSA 1FNVA 1GG3A 2D07B 4GKKL 4N59A 3V60A 5IP9H 4J6IA 3GTKB 5DPWA 1VF7A 4B9XA 1Y8OB 4RFBA 5CC4A 4FN2A 4ZDVA 1JOOA 1GAQB 2WDRB 4G50A 1TWGH 4DR4L 2D3GA 1YX6B 4IG7B 1LUZA 2DY7A 3ULJA 3OHXC 2PCFB 1SNCA 5JJKA 1YVCA 2IHFA 1WJJA 2KFKB 3ULPA 1N36Q 3NVYA 4XE0A 4OX9L 3U50C 5E7NA 2B63B 3ZTCA 1YNNC 3RNBC 1LT4D 2L9HA 4OWXB 4K2KA 3OIPA 1FMAD 1MVKA 1YI2A 2KDFB 1PRTD 4XQJA 1LGRA 2QDLA 5DNFA 5CMDA 1S3SG 1SAPA 4DKAC 4DR2L 3EJIA 4MSQB 1V1PA 4QCLA 2V1CC 4C3JB 2D62A 2DJGC 4N9TA 3M4PA 1Y8NB 1GUGA 4A3IB 4JLCA 4XC2A 4B3RQ 2PW7A 3DVGX 3ZXVA 3AE3B 2MJDA 3APFA 1F9SA 1EIGA 1YN3A 2L3ZA 2C9WB 1PYBA 3EIVA 4LAAA 2JJQA 5KIXA 5IYDH 2OTJA 3AV8A 1AE2A 4ARIA 1IZ6A 1A5RA 4MACA 3HOUG 4LFBL 5D94A 1B50A 2VXWA 4HDOA 1K83B 2JPHA 4MN3A 4HAEA 4JBWA 3T53B 2E2JB 2MBQA 2KZRA 1X1MA 2KUMA 1I50B 5FLMG 1OQQA 4O0AA 3N1YC 4ZAIA 4DR5L 3P1HA 4V190 2UU9L 1UE7A 1D5ZC 4LUZA 1K3BC 2LVQA 3HFZB 2CCZA 2LMCB 2WDQB 4DBGA 3ENEA 2K39A 3BJUA 1LTRD 3H09A 3H6NA 2XSCA 2K25A 1D8LA 3DWAA 1FFUA 3WOEA
chains in the Genus database with same CATH topology
1L5PA 1WTOA 1GUWA 3RZDB 2ZXOA 4YSXB 3ITPA 3ONAB 1V8QA 4RGNA 5C2TB 1JOKA 1Z6HA 1O7ZA 3M4OB 4EE2A 1QNKA 4A3MB 4FF1A 1BNZA 4OHJA 1N63A 2C9OA 1DXMA 1R4PB 2PQEA 1U4LA 1W6JA 2WXGA 3ZJTA 4H44C 3W5UB 4R8IA 1J7AA 3GTLB 2VZKD 1L0VB 1F2RC 3PUYA 2KHSA 4N9PA 4YXDB 5JXVA 1H9SB 1S5DD 1O7LA 1GJXA 2F0HA 1FO4A 1PRTB 4LK1C 1AZPA 1ZDVA 5C4JB 4UAIA 1WTWA 3A8JE 1NSNS 3ND9A 1ENFA 3GP7A 4YTPB 1PUTA 3IL8A 3TP7A 1U4PA 2PLPA 1JR0D 4ITKA 3I4MB 2NVYB 1RTOA 2EJMA 4XWTA 2SNSA 3RD4A 3PIO3 3AECB 3FVQA 4L8JA 5A35A 1AZQA 1P7EA 2BCOA 1NVID 2A74C 3KLRA 1F77A 3DWPA 3OWEB 2YEPB 1VMPA 1C8CA 3P1MA 4A93B 4US9A 1F2RI 2AWNA 3PIP3 3EVQA 3MA2B 1C4CA 1BR9A 1GOZA 4YTNB 3U52E 2VNUD 3L3OC 4A3BB 2IGGA 3L4PA 4RGTA 1Y69U 3W1SA 4P6VF 1TU2B 1ROEA 1JWBD 1PTOC 2LY7A 1A15A 2TMPA 5I9OA 4QF4A 3TEZA 4KGRA 3VR2A 5ELBA 4CKBA 1PLFA 5EPLA 3ETRA 3S1QB 1ILPA 5G3LF 3BDOA 5CV7A 2KCNA 2B2UA 2Z8LA 2VZKB 5GXGB 2KAJA 4ZQ3A 2WV6D 4CJ0B 2F3WA 3BZDB 2LMCA 1NCVA 4RGMA 1TQOA 2HDLA 1NI3A 5KEEA 3NSWA 5EKKA 2M2LA 1LT3D 1SB3C 4IUVA 3VYRA 5KYLA 2IJ0A 3A55A 2JA8B 3I90A 1PFBA 1VZ8A 5CBEE 1CA6A 4KMUC 2NN6I 2X38A 1TZOA 4OIJA 1EL0A 4FNFA 3SFEB 3D8GA 3TEYA 3VA5A 1R7SA 3SEBA 2MUYA 5JEAJ 1WVLA 1H9SA 4PV1C 4KD4A 2EYJA 4LJZC 2DWQA 1HTLD 2G9HD 2B2UC 3AE4B 5T1IA 4CKEA 3IT6B 3SK4A 5M5WB 2I38A 4JK1C 2L11A 1STAA 1K50A 3R3OA 4XIGS 4OO1I 3P42A 4GDKB 3TDQA 2F0OA 2WXKA 5CYUA 3R2IA 3IT4B 1BCPC 3MXPA 2INPE 5CR3A 3G7LA 5HFYA 1Z7TA 2JU6X 2XNAC 3HG9A 2WQYB 2A6HD 4IFDJ 4XDCA 2CW0C 2A68C 5IGEA 4X3UA 3LWUA 1Y1WB 1SDFA 4CBVA 2NTTA 4C1NK 4IUPA 4AS1A 1HEZE 3P4QB 2SEBD 2XRQD 1XXGA 1JOQA 4K8IA 3VR3A 3K58A 5LL6S 2WXMA 2OF1A 4A8XC 3BDLA 1PRTC 3T56B 2AUKA 1L6UA 3QOJA 3NWSA 3S1MB 3IXSA 2C5CA 4FXGC 3W5VB 4J3OD 5IGCA 2RMMA 4KJOA 2DLBA 1PDQA 4IUTA 3NP8A 2I2YA 1HTPA 1SIJA 4NAWB 4KKTA 3E0JA 2RSOA 1BUIC 1ZOYB 3GV3A 3E9SA 1ZPSA 4ME5A 2D2CC 5EQ0A 2JQRB 2JX5A 1S5BD 3VQIA 3PO3B 4XQQA 3M7NA 3OMCA 1E2ZA 5ELFA 5M5YB 5C3EB 3E56A 3A8IE 4IDIA 1DOLA 2BTEA 2R61A 1SNPA 2HTME 2FMMA 2EYPA 1W6KA 4A3KB 2NWGA 5FOBB 3AB9A 5AUIA 2K5PA 4NAMA 3EQLC 2GRIA 3U7ZA 1XLNA 3KBGA 5JPNC 2F0SA 2JWUA 2AWOA 3NTIA 1ZXTA 5BMHA 3GTJB 2WXFA 3SHLA 2WU5B 2WXLA 1RTNA 1C4PA 2WXIA 2GA4B 3H91A 2B39A 3VR6A 2FFKB 3I4NB 1SSOA 5G5GA 2IDYA 4EVOA 5CV6A 3AH7A 4C7ZA 1XCTL 1CJEA 5T8IA 3AM9A 3D3RA 4FF3A 2PKOA 3RZOB 2H4OA 2Z1CA 1RYJA 3K5OA 4ZKBB 1EQTA 3HVZA 4HSPA 4IURA 2IPKD 1KDBA 5HI1A 1QOBA 3D6WA 4RA8A 1JRPA 3MTSA 3X3NA 1D1KA 3QB3A 2H89B 4EQNA 1CHPD 4B08A 1HCZA 3AE8B 4TQUS 2J53A 2FHTA 1TS4A 2LKVA 4C1NI 1G6ZA 3NK9A 2OEDA 1I7HA 2IGHA 4IKGA 5DEHA 4DN4M 3HGBA 4I7ZC 3BVMA 5HHDG 5CV5A 4NKLA 4FXCA 2B8GA 1SNMA 4FXKC 2K28A 5I4DA 3NVZA 5E4XA 5JEAH 2EJFC 3MWYW 4AYBB 3T3NA 2B2TA 3AMUA 1SF0A 3FILB 4G57A 5HGTA 3A7AB 1FYCA 2DNEA 3MXGA 4MT5A 3QJYA 4G7HC 3J7AF 1NYQA 5H92C 4X3SA 4USAA 1A3TA 3F2UA 1MI0A 2R6GA 5K36H 4JX1C 1GXDC 4UDUC 1Q1EA 2QJLA 2JE6I 4XTCS 1TYGB 5IOCA 1K51A 1B9NA 1MD2D 1B4OA 1PTOD 1PFDA 3PO0A 1DOIA 3HVDA 4ODGA 2F0FA 5BN4A 1K52A 2K9XA 1CFMA 5LHY1 4H13C 5FO8B 3TP5A 5E4WC 2VUMB 3OSOA 1Y1VB 1II3A 5C0XI 3NVVA 3KUPA 1J7BA 2M56B 4ZUIA 3FKIB 2M9VA 4TQ1A 1WTVA 2JA7B 2NMQA 2MHVA 5KNDA 2B2YA 3QO2A 3K5MA 1OXSC 1T6BX 5AUKA 2WP8J 2H88B 1H9KA 3OMGA 1TWGB 2SDFA 1DOKA 1EY6A 3C1FA 1IGCA 1YQ3B 5NUCA 1K53A 1F0ZA 2F0TA 5A2QL 2QMTA 1HA6A 3T4AC 1A70A 3VR8B 2NVXB 3SVMA 1ET6A 1WTPA 1EY8A 4J6HA 4RGOS 1LO5D 1DM0B 2E6XA 3LB8C 1AYFA 1LT6D 4N6EB 2MJ8A 4K14A 3ZQ4A 5BN5A 1HUMA 1I6HB 5FLXL 4RH6A 1HQRD 2K5QA 1RF2D 1BOSA 2M0AA 1JC7A 2JSVX 2MJ3A 1CK1A 4HTHA 2BOSA 4O1NA 3K59A 3V3XA 2B2YC 1BCPD 1ZXIA 2MEKA 1PTOB 3DMUA 3NWTA 3I57A 3K6OA 4PMBA 2EPBA 4KI0A 2HDMA 2EY2A 2HDEA 3J81L 3WOFA 1Q90A 1P7FA 1WCMB 4REZA 3I4LA 3MFYA 4RCNA 5LNK1 1XLQA 2CW0D 4MHEA 2N88A 3FILA 4E6IA 4KJNA 1CA5A 1F9PA 1YJIA 2DYOA 2LJIA 1C4QA 1GUTA 1A2TA 5IGDA 5JVH3 4DGZA 2Y5PA 1CQVA 3AE6B 4WURA 3TBIB 3CRKC 1G2TA 2Y0SB 3CIRB 2D5GA 5COYA 5KRUA 4DQOC 1RFKA 2ACZB 2LFNA 1OXTA 3HOZB 3AEDB 2NBFA 3DEOA 3GD7A 4NMZA 3AE1B 1TKYA 4HMJA 5CORA 2QSDA 1D5MC 4GLSC 4WIPA 1TVXA 4A90A 1PDXA 2PTLA 2BT6A 2ID0A 3OPOA 2CHBD 5EKIA 5IGFA 2EKIA 4C80A 5DAUA 4FF4A 3MHZA 4D2KA 4BY7B 4WH4A 1PYWD 5BYSA 1EY4A 3MC0B 3DWQA 1SYDA 1XEEA 2XIWA 4OZCA 3LNNA 2D5DA 1VDZA 4ZHPA 1B2TA 3I91A 5EJWA 4HSVA 2OEOA 1SYGA 4HR7B 5CGKA 3C1EA 5JOBA 5I2YA 1BCPB 4TSSA 4KY7A 2BS3B 2BA1A 2JA5B 2W3RA 2Q8RE 2EDGA 2KWDA 3Q8AA 3ND8A 4H0LC 3K5NA 4NJCA 1D2BA 4K5XA 4ZKCB 2WXQA 1MPEA 3P4RB 1ILQA 4OIKA 1WXQA 3X3MA 1PZKD 5JEAG 1QKZA 1HPCA 1IKLA 2WDVB 3CU7A 2IGDA 2PNRC 3Q6SA 3SFDB 1UUPA 4C3HB 3Q22A 3GQBA 2IX1A 5C4ZA 1V8CA 2K05A 3DXJC 4DAVA 4HCSA 1DYQA 2L5TA 5K36G 2V3NA 3GTPB 1VZ6A 1QB5D 1RD9D 3Q8FA 1YNJD 1VR9A 2E2IB 3H0GB 5F2DA 3S15B 4NZLB 2BA0A 1RHPA 2WXPA 4IFDG 1BXTA 3ERQA 5H8YE 2RSNA 3BS1A 1DONA 3Q23A 2NZ1D 2JSOA 1OXUA 3HS0C 3VR5A 1EM7A 4ZRPA 2WLBA 2L1AA 4G7ZC 4TRDA 1Q8IA 1HFNA 2Q8TA 1PRTF 3TP8A 3L9AX 2B2VA 4MIUA 1SNOA 4LTUA 2VB2X 1S4ZA 1VZ7A 3VRAB 1U4MA 3AE7B 4IUNA 4KHZA 2IWHA 1JALA 3GTMB 1CQFA 5K5PA 5C0XJ 2K22A 4N58A 3DHQA 2Y3AA 2DN8A 3R8BA 3QIAA 1O80A 3A8KE 3H3VC 1E10A 1ZKOA 1AWDA 3T13A 2L4NA 1S5FD 1VRAB 2LS01 1FCLA 1ET9A 3TSSA 3VYTA 4WAFA 2YEPF 1JROA 5TSSA 1GPXA 4G7OC 1WYGA 4IQZA 1QT9A 3UI3A 1E9MA 2AQ3B 3A7LA 4KN4C 2I46A 3C8YA 3BVZA 1F2YA 3K57A 2KA7A 1OQRA 1EEFD 3D4WA 1D4BA 4I65A 5M3FB 2B2VC 4F8MA 2X69A 2AQ2B 4C56C 3BK2A 1SNDA 5FR3A 3O13A 4OL7A 1HRJA 4ID6A 1JCKB 1LTID 1U4RA 4JE3B 1WTRA 1TR5A 5CV9A 1FRRA 2JYOA 3E5SA 4XWWA 3H94A 1XF5L 1CZWA 1Y56A 1EYDA 2LEKA 1JB3A 2F3VA 2WAQB 5A2QE 1I4GA 2DBYA 1PZID 2M00A 4F88A 1TY2A 1NAPA 2ONQA 1QILA 3W9CB 5M5XB 3Q8EA 2BDNA 2LHDA 3I73A 4K5WA 3TP6A 3J80L 1O78A 2RPVA 1B9RA 1Q1BA 1TWCB 2ZT9C 3BWUD 3I3CA 3AEFB 2KECA 5BYQA 2FJ2A 2E74C 5FLXE 1RCVD 2GB1A 2V4IB 2L52A 3DEPA 2F0DA 2VB3X 1JWUD 5BMGA 1VMCA 1LTGD 4V0BA 3SR1A 1YJJA 2IX3A 4F87A 1L0YB 2JZPA 3H6MA 1SJHD 4EQOA 3N9YC 3KLSX 2ZXPA 1D6EC 3MHBA 1FFVA 3VR9B 1QLBB 3TZDA 3J81E 1Q12A 4EQPA 1EY5A 1RM6C 1ICWA 3CKIB 1ZXHA 3C46A 1UAPA 2KJXA 4CKCA 1V97A 1KABA 1ML0D 1VF5C 5ELCA 3Q0AA 1ACCA 2WIIB 3FDTA 2MH7A 4J8QA 3OWFA 4C3IG 2KN4A 1TS2A 5JVG3 1GB4A 4LMQD 2WINB 1OXVA 2EY5A 1N5WA 2CVRA 2XWBB 2R3ZA 2N0SB 2ZW1A 3RPFC 2HCCA 2J42A 3GO5A 4IALA 2PZWA 5EGTA 2N55A 2AX5A 2NN6G 1BMLC 3URYA 3RFZB 1I4QA 4KKSA 1XTCD 3DUZA 3HOUB 4H2AA 1PZJD 1G2SA 1KTKA 5EPJA 1FXIA 1LTSD 3E6ZX 2YU9B 2FINB 4KX6B 5D7GA 1AW7A 1QNUA 1GHJA 3A54A 3AE2B 4HN7A 2JEBI 3EUB2 1BBXC 5EPKA 2E3TA 1N60A 4CJ1B 4BA2I 1FIQA 2G9DA 1A2UA 4Q5VA 1STHA 1WWTA 4C7YA 3HOYB 1AFPA 4HEDA 1S5ED 1CM9A 2EOTA 2NYZD 4XYQA 4WJWA 5C3XA 3OIQA 2JYEA 2V3PA 4OW0A 2K04A 1EY0A 3QG1A 4C3JG 4A3DB 3V05A 1SEBD 4L1BA 4XQNA 3H8HA 2KCCA 3AEAB 3TEWA 4GDLB 4BWGB 1ZE3D 4TQ0A 1OXXK 1SYEA 2EYOA 1X3PA 1TWFB 3JAML 4OZBA 2F0MA 5C5MA 2L0CA 3NZ3A 4BY1B 5BYRA 3IKJA 4KKIA 1L4ZB 5KNCA 1B9MA 1VDVA 3IAM1 1FGBD 3K5LA 2KQ4X 4KHVA 4RNAA 1YNJC 4FXDA 2Y5CA 4Q0FA 1FD6A 1STYA 1A6XA 1V1OA 4KV6A 1HUNA 3FC4A 3TEXA 3S1RB 2EYLA 1NR2A 2EVBA 5JAVA 4YTMB 1T5XD 2NUCA 1ESRA 3EROA 2BBCA 2RVLA 2FUG1 1JW9D 4HKQA 2X6GA 3PMFA 3SK6A 1HHVA 3FAHA 3N52A 4IUQA 4RWSC 1AEXA 4HROA 3BYYB 5ISRA 3IAYA 1MHHE 4A3JB 1SE3A 3P20A 4WFN3 3DWMA 3CRLC 1OO9B 3ZGZA 1E7PB 2A73B 1F9QA 1C48A 2WB1B 5LL6X 4ZHOA 2B76B 1CI3M 2MJEA 4YIJA 1STEA 4CQNA 2NB0A 1H9JA 1E2VA 2WP9B 3NUHB 4RF0A 1A3VA 4IN3A 1AN8A 1F9RA 4BA1I 1KFYB 3MXUA 1FM0D 2LHEA 1EIHA 5J1ZA 5ELDA 5BN3A 5FO7B 4QIWB 3LYYA 4IFDH 4DA2A 2NTSA 4Y7NB 4J1MA 1I4PA 3OOCA 3GB1A 1WSPA 3HOXB 3EFXD 2M19A 2PW9A 3V2TA 5EE1A 4H7BA 4DK1A 3UI2A 2BS4B 3SR6A 4RF1A 4HKZE 1ZYRD 4P2CB 3NUCA 2CJNA 5G5HA 3PUVA 2PPBC 2V0GA 1CTMA 1QCBD 2WXOA 4QUFA 3WCQA 3CQZB 1VCIA 4NW2A 3ZJVA 1EZ8A 1JQYD 1I4RA 5FO9B 1PFNA 1DGJA 3AE5B 2BB6A 3B9JA 1KAAA 3T3OA 3FRPB 2SNMA 5CV4A 1IL8A 2ZW0A 1XX8A 4DXGA 1EOTA 4L23A 3OW7A 3KWLA 4WWMA 1JORA 5KNBA 3J80E 3A56A 1CHQD 3BG3A 3J7YW 2N9KA 1ENCA 2WS3B 1QJOA 1D1IA 2RDFA 3NQIA 2EY6A 4FYDA 2RKSA 1C77A 1C79A 4KK7A 4BBSB 2H1EA 2A69D 4R9WA 3V96A 2W82A 4CHTB 1SMYD 2AUJD 3HP3A 4K6LA 4PQXA 2EYHA 3FEWX 3R93A 5M3MB 2PO4A 3EA6A 1IW7C 1IKMA 1EY7A 1SE2A 1U9RA 5C4XB 5EE0A 4K6DA 4MH8A 2J52A 4B0EA 5I6WA 4RKLA 3VRBB 4ZRQA 1E0BA 2PZUA 2QCPX 2BDOA 2K03A 1ZP0B 3K0YA 1E2WA 4RCOA 5IIFA 1IYUA 2J7ZA 4OVZA 4O42A 3P4PB 1MGSA 1EYCA 1IHZA 5C0XG 1PTOF 2QDBA 1DCZA 4IZ8A 2BYTA 2PVGC 4X3KA 1KRHA 2Q8IB 2JXMB 1V43A 4HMIA 2F0GA 1FRDA 1STGA 1R9TB 4XYOA 3PUXA 2BE5D 2XWJB 5C3JB 2EELA 3N6RA 2K6AA 1NENB 1JICA 3FMCA 5AFWA 1K8OA 2PVOD 1I6VC 1EEID 2BW2A 1J7CA 5EKLA 3DM1A 1EFID 1L4DB 1C4AA 1STBA 3U4EG 2HCIA 2K5WA 2SAKA 1EYAA 1DJRD 1WGKA 3SK8A 4IFDI 1TKWB 3CWIA 4JPSA 1XO3A 2KOLA 1EWYC 1LTBD 1ESFA 1I3QB 1QOFA 2L83A 4CJ2C 1M8AA 1RODA 4RHRA 4JWSC 1EWCA 3GTQB 1G8ZD 2F0WA 2AQ1B 1PTOH 2KACA 4C2MB 1TT2A 2NN6H 3JAME 4KKJA 1TY0A 1PMRA 4KN7C 2CU3A 1TS5A 1XWEA 4LLGM 3S1NB 2K01A 3TZUA 4HJGE 1GUOA 5G3LD 2O5IC 1KDCA 1QF6A 2PZTA 3AEGB 1XLOA 1BCPF 3AB5A 2RDGA 3BDCA 2E2DC 1HQMC 2QILA 2YYZA 3KLSA 3LX0A 1VLBA 1B53A 3M85A 3HOVB 3HKZB 1HZ5A 3I9V1 1MBYA 3QOLA 4OO1H 5I6YA 1IBXB 2INNE 3TMEA 1ZEQX 1FR3A 1LLRD 1N62A 1LTTD 2EY1A 2EZVA 1QWYA 3VYUA 2G1EA 2Q5WD 3VYSA 2IL8A 5C6AA 1M4VA 1J9OA 3GTGB 4M0WA 3TUOA 1N61A 4FO2A 3PO2B 2N9LA 2I07B 1FEHA 3ZYYX 1WRIA 4ZLTF 2WXHA 2WXNA 1FXAA 4JWUC 1LABA 2WACA 1LT5D 1Q3LA 3PUWA 4A3EB 4HEA1 2BS2B 2WXJA 3Q69A 5IODA 2XN9C 4OGQC 3U2SC 2JXTA 2F0UA 2ENBA 1QOHA 1ONLA 4RAUC 4CGYB 2DY8A 1KDAA 2CQAA 1GUNA 3LXFA 1XLPA 2W55A 2IT1A 1JMLA 3HUIA 3PZ7A 5FK9C 3B2FA 1DZ1A 1MI2A 3BIID 5T1GA 3CHBD 4DU9A 4L63B 1FCCC 3J7AV 3U9OA 3G6JB 3S17B 1EU3A 2FBWB 2LGIA 4AQ7A 3S14B 1YQ4B 3RLFA 1ZYRC 1GUSA 1BDOA 4PT5A 2WKDA 5I9PA 3J9CA 1ENAA 1QG7A 5C5LA 5KYIA 1WD0A 4A9AA 1DOYA 1UEAB 4WORA 5D3IB 1GHKA 1JQ4A 1FD7D 1EZ6A 1YMHE 4HRSA 1C78A 2J0TD 2RQXA 2V4DA 1T3QA 2K33A 3W2DA 3D4DA 1Q10A 1TKGA 1L6VA 2D9UA 4TKOB 5E3FA 4KGSA 1SSNA 2R93B 1NUCA 1HA5A 4M1UB 3R2TA 3AEBB 1G291 2IX0A 2RA4A 1JWAD 4ZUJA 3KWVA 1C9FA 2QKIC 5I2XA 2A69C 5DM63 5BMIA 1KF6B 3LWEA 4L2YA 3RUZA 1SMYC 2KDMA 3C2PA 1RJTA 4FF2A 1I4HA 1IBXA 2DYMA 3Q8CA 1H9RA 5IT9L 1DOMA 3T16A 5MPOA 1MHXA 5HURA 2OT2A 3ZJUA 2EYMA 2MP1A 1N5XA 2WKCA 4DAYA 2PIAA 4XDDA 2K32A 1YN4A 1SFOB 4DFAA 2QF7A 4P16A 4OZAA 3NHHA 1OFFA 1TS3A 1L0XB 4XT1B 3QWNA 4DK0A 1ZUD2 3MZ5A 4XDXA 1IW7D 2J4XA 2A6ED 3BVGA 1NEKB 4U68A 4B9WA 1SYFA 2E76C 2L1BA 2L32A 1SXTA 5CV8A 3NVWA 3EGRA 2XRSD 4K8JA 1PGXA 3S2DB 4ARCA 4BS9A 2L12A 2DNCA 5E6JA 3K7AB 2BE5C 1MSGA 2FMCA 2PMVA 1UWXA 2ICEC 1RKNA 1CZGA 2Z4IA 5D65A 4BBRB 2R92B 1GB1A 2ICIA 5EE9A 4KD3A 3GV6A 4U673 2K1BA 1T5EA 2IW3A 4US8A 1LTAD 2F1MA 4MM3B 2B8FA 3HZXA 3HEJA 4R8NA 3M3YB 1RWSA 3MFGA 4ULLA 1Z47A 2O5JC 4ILWA 4B0MA 1IYVA 4KTAA 4DF7A 4L6TB 1F2MA 3SDZA 4PMCA 1YNND 5E1FA 3KBXA 3I70A 2JEAI 2KEEA 1SNQA 2F0NA 3NE5B 1J8IA 4QB4A 5JPMC 3HRDD 1B3AA 4A55A 4DNTB 1KNEA 4QMGA 5C0XH 4OO1G 1A3UA 1BO0A 3MXNA 4XXEA 1KH0A 1TWHB 2KMMA 2MPMA 1IUEA 1TWAB 5M9OA 3S16B 2A5HA 1CT1D 2F03A 3T51B 1XYIA 1S5CD 4X3TA 1BUVT 4GZYC 2K3UA 3NTKA 5D14A 3VA7A 4QUCA 1EQVA 2PYKA 1STNA 3IAS1 4DNRB 2N7JA 5EE3A 2F0KA 3D4RA 4R3DA 3AU7A 1UGJA 4YSYB 1F2ZA 2ZXRA 4S3SA 4DXFA 2TSSA 3GS2A 4WQMA 2F0PA 3HRZC 2O4XA 2QEJC 2HUGA 3RMHA 4RKBA 1K8MA 2RDHA 2LUMA 3U9SA 2R7ZB 3S9WA 1RDPD 4ZK9B 1D5XC 1PFMA 3NQTA 3GTOB 2EE1A 2QIEB 4G4KA 1JWSD 3KF8A 3MP9A 4XT3B 1SE4A 1TKEA 1JE4A 4A3FB 3B2GA 2F0LA 1G91A 4ZRZA 3P75A 3L7ZC 2WNMA 2KQ3A 2RBMA 5D3DA 2NVQB 2CJOA 2JYTA 2K5DA 1TIID 4A6QA 5ELEA 1X3QA 1PGAA 4C3HG 3D31A 2X6LA 1VJKA 1XCQL 4K5VA 4ZOHC 1SYCA 2OHFA 5IGBA 3PUZA 3MVVA 3SXHA 3Q24A 1R4QB 2L55A 5IGGA 3VR4A 1EY9A 2WU2B 1E6EB 2E75C 3PZ8A 1NR4A 3FPPA 2NVTB 3NPPA 5CBAE 1PXUA 5J22A 3NTHA 3NXWA 4PNYA 1ZDXA 3HOWB 4WRDA 1E0ZA 3IFTA 1QQRA 4YWGG 5JJZA 1Y8PB 3IFDA 1WTXA 4TMAB 2F0QA 4NDXA 1YNTE 3KK7A 3M4YA 1I4XA 3P4SB 1QOAA 2BB5A 4YT0B 2F0VA 1WTQA 1SYBA 5EBDA 3S2HB 1NYRA 4RHSA 3I8ZA 4KKUA 1SJED 2K0PA 1WD1A 1YN5A 1DD2A 3ABVB 1EWHA 1UWMA 5J39A 2EJGC 2O2LD 3BYTB 2JP1A 4IUUA 1CZPA 1IGDA 1V1PB 2W54A 4ABNA 3AEEB 4M8AA 2B2WA 1HXYD 1JWMD 1KLUD 4A3GB 2KEDA 5FKAC 3DWGC 3Q8BA 2FE8A 1LV9A 3NS1A 3WDNA 1QE6A 2EXZA 2KVMA 2K7VA 4K2LA 4KGTA 3KQ4A 2WXRA 4KY6A 5DM73 4HCEA 3TN2A 3M7GA 2B2TC 1HFGA 4Q2JA 3W3AA 2ON8A 3BK1A 3D6CA 2LFIA 3AMZA 5C4HA 3NRZA 2F0IA 1H9MA 4F7XA 3I72A 4IOIE 4YSZB 2SOBA 2JA6B 1EU4A 4LK0M 5IT9E 2OXPA 3NBHA 1FNUA 2E2HB 3MAQA 5KGUA 5EBCA 2F0JA 3P7JA 1F2LA 1X32A 3MEHA 4NP5A 4EGVA 5HG2A 3SE0A 2B2WC 4DAPA 1O7YA 2A6EC 2XVSA 3FPUB 3AE9B 1KLGD 1LACA 3MJ5A 4FVMA 3C3LA 2Z4HA 1KNAA 3NBIA 1PGBA 2F4IA 4C3IB 4KY5A 1HZ6A 4FP5D 2F0EA 1SBBB 2A6HC 2PMZB 2W3SA 2GI9A 3AN1A 1B1ZA 2PW5A 1AP0A 4Z9CB 5C44B 2HQEA 2EYFA 3PV0A 1QOGA 1FNWA 1MSHA 1BQQT 1C76A 1UNSA 1B44D 4ZYSA 3SK5A 5C3WA 1TJEA 3P63A 2A68D 4PMWA 1BF4A 2MGSA 1FNVA 4N59A 1DOXA 3GTKB 1VF7A 4B9XA