4RH6A

2.9 angstrom crystal structure of putative exotoxin 3 from staphylococcus aureus.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
189
structure length
187
Chain Sequence
b'SESELKHYYNKPILERKNVTGFKYTDEGKHYLEVTVGQQHSRITLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSNSVQYIDYINTPILEIKKDDVLKDFYYISKEDISLKELDYRLRERAIKQHGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exotoxin 3, putative
publication title 2.9 Angstrom Crystal Structure of Putative Exotoxin 3 from Staphylococcus aureus.
rcsb
source organism Staphylococcus aureus subsp. aureus col
molecule tags Toxin
total genus 57
structure length 187
sequence length 189
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rh6A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rh6A01
4L6TB 2IJ0A 1TS2A 4O1NA 1TY0A 1ET6A 1L0YB 1I4RA 2TSSA 1BCPC 1LTID 4C56C 1JCKB 1YN5A 1CT1D 4NZLB 1FGBD 1S5CD 3KLSX 1FD7D 3MFGA 2G9HD 1PRTB 1D5MC 1TS4A 1AN8A 1SBBB 3R2IA 1ESFA 1XXGA 4TSSA 2QILA 2NTTA 1S5BD 1SJED 3SEBA 1LTBD 1XTCD 1BCPF 2J4XA 1PTOD 2XRSD 1TS5A 4ZYSA 1PTOH 1HTLD 1RDPD 1HA5A 1V1PB 1STEA 3DWAA 1LT3D 1I4GA 4BWGB 2ICIA 5D3DA 1D5XC 1B1ZA 4K6LA 1PTOF 1RD9D 5ELEA 1G8ZD 1LLRD 4RGTA 1DJRD 1ENFA 3W2DA 1PZJD 2RDHA 3O13A 1HXYD 1LT4D 3BYYB 2IPKD 1BXTA 5D3IB 4Z9CB 1KTKA 1S5FD 1I4XA 1SXTA 1EFID 1PTOC 3V05A 2CHBD 1YN3A 1MD2D 3R2TA 2WV6D 3GP7A 5FKAC 1V1OA 1I4QA 5ELCA 1BCPB 1YN4A 1M4VA 1RCVD 1KLUD 1DYQA 1LO5D 1FNUA 1CHPD 3OWEB 4OHJA 2R61A 1EEFD 3DWQA 1F77A 1EEID 4RCOA 1ET9A 1T5XD 2AQ2B 1EU3A 2Z8LA 1D6EC 1JWUD 5TSSA 4RGMA 1L0XB 1SE3A 1PZKD 1LTAD 3CHBD 5FK9C 3DWPA 4RGNA 1SJHD 3R8BA 1PYWD 1EWCA 1SE2A 1B44D 1FNWA 2O2LD 1JR0D 3EA6A 1PRTD 1GOZA 1V1PA 4RFBA 2SEBD 5ELBA 3TSSA 1JWSD 1LTSD 1SE4A 1S5DD 3EFXD 1HQRD 1CK1A 1I4PA 1I4HA 2QEJC 4RHSA 3BVGA 1AW7A 2XRQD 1LTRD 1JWMD 1PRTF 1S5ED 1BCPD 3BYTB 1KLGD 2NTSA 1SEBD 1D5ZC 1PTOB 1TY2A 2XNAC 3BZDB 4RH6A 1QILA 2XN9C 3MC0B 1PZID 5ELFA 1TS3A 2AQ3B 1LTTD 4DXFA 1JQYD 3BVZA 4RHRA 5I4DA 4UDUC 1RF2D 1PRTC 4RGOS 1LTGD 1FNVA 2AQ1B 2RDGA 1CHQD 3BVMA 3URYA 1CQVA 4DXGA 1UNSA 1EU4A 4L63B 1LT5D 5ELDA 1LT6D 1UUPA
chains in the Genus database with same CATH superfamily
3NELA 5M3MB 4HJ8A 2UXCL 1DGJA 2WB1B 3APCA 3VTVA 1YJ9A 3UI3A 2KLCA 4WWMA 3ZRFA 4R4IA 5DPTA 3U7ZA 2B2WA 3STBD 1C9OA 4M8AA 5CBAE 2VZKB 3APDA 3H7PB 4BBRH 2KENA 1O7IA 3KLWA 3WDNA 1VJKA 2MWSB 3VR5A 2E2IB 2O5IC 2KOXA 5J1ZA 4XYOA 4A3JG 2GMIC 2GOWA 3RZDB 1RHPA 4X65Q 5E6PA 4KX6B 4B6WA 1YITA 3W5VB 3WALA 1X3EA 4UP7A 2D10A 2L4NA 2KC1A 4NPSA 2PW7A 4JBWA 4LFBL 1I4GA 3SK8A 4NNJB 4A3LH 3AU4A 1QCBD 3OTOQ 3BK1A 1RLFA 3IBEA 3S2DH 4OVZA 2Q2IA 2DNEA 4W9JA 3H0GG 3BG3A 4B3RL 1T0SC 5GQOA 1T0YA 3L16A 2ZZPB 5JHBA 1KRSA 2PI2A 2WX1A 5L95C 1PZJD 2PE9A 3HVZA 2RDHA 1HPCA 3I7FA 3P42A 2F03A 2OEOA 3RLFA 2C7HA 1TXYA 5IYBG 3ER0A 4J3OD 4Z9CB 2E75C 4F87A 3RI7C 3TZUA 3MTNB 1B50A 4PMCA 4AYBG 2RD0A 4HTHA 4CKEA 4A3JH 3G48A 2RGFA 2KHIA 3HM6X 2Y5BB 3QHTA 4A3PA 4ZHPA 1BDOA 3PIO3 1WTVA 4IUVA 3T56B 3TDQA 1M1KC 5C3EH 1X55A 1M90C 2O6VB 2XGTA 5C6AA 4LWCA 4YXDB 1SMYD 2ZNVC 1Q0WB 1KLUD 4TUUA 1ZXHA 1D4BA 3H94A 4HCEA 5AFWA 4LFCQ 2UXDL 1C4AA 1CHPD 4KD4A 3PMFA 3TCAA 4BAXA 2AKWB 3DWQA 3CCVA 1C76A 3J9CA 5FR6A 2CKZB 2ZXOA 4NJ7A 3TEZA 3ZJTA 4K7UA 4H2AA 2QDBA 1A3UA 1PH6A 2CCZA 5IGFA 2V3PA 5C44H 2KCTA 2NYZD 2EMSA 3C19A 3KUDB 3SFEB 1VQIA 4E6IA 4A3FB 1I6VC 3A9KA 2MBEA 4P7IA 1KDBA 4BBNF 4EOYA 2WAQE 2HDLA 2DY7A 2OTLA 1PQSA 5ELNA 2PNHA 1WXSA 2L0FA 3EHVA 1VCBA 5ELBA 1Z2MA 1P8LA 1JWSD 3EROA 4QUCA 3Q24A 4HLEA 2ZXRA 4WWNA 4UHVA 1I3QB 3MXNA 4DK0A 2LVQA 5EE0A 1GHKA 2W3RA 2EY6A 2V4IB 2KTRB 3HG9A 1PRTF 1XLPA 4C3IH 2LD9A 2D3AA 1KLGD 4EZLA 1NSNS 1STYA 2FAZA 3PLVA 1DONA 1D5ZC 3H8HA 3VTUA 1Y8NB 2AHOB 2C9WB 1MGSA 4NMZA 5C3WA 1L7YA 3CMEA 2B2VA 5IP7G 1FCCC 3VDYA 1AFPA 1WTQA 1PH5A 1QLBB 2AEHA 3ZUNA 2KMCA 2MQJA 2JK8A 4F8CB 3R7RA 1TZOA 1SYBA 1CHQD 1S4ZA 3E9HA 1K52A 1FR3A 4C3HH 3GS2A 3GTOB 2MLBA 1RODA 4ZK9B 1LT6D 3QAQA 1NR4A 2ID0A 2VUMH 5HFYA 4F7ZA 1LV9A 2EYOA 1IZ6A 1I4RA 2N7JA 1F2RI 2N8NA 4YCVA 1WGHA 5AEKB 2DN8A 5AZGA 1ASZA 4CDEC 2EJMA 3ZJUA 4XE0A 3L10B 2JJQA 1NMGA 3NS8A 1T3QA 2DYBA 4CKBA 4DU9A 3ULPA 1G91A 1DD2A 4POFA 2UYZB 1R4QB 5I9PA 1TKGA 3HOXG 2W54A 5EKIA 2YTYA 4OO1G 3PS6A 3AH7A 4CHKA 2NVXB 1F1HA 1W6KA 1WR1A 2OCEA 5CR3A 1PTOH 4EQOA 4A3DG 5C4XB 2CS4A 3PLUA 2CQOA 4R4OA 3I4NB 1YI2A 3DVNU 3VRAB 3S1RH 1YVCA 5JZEB 2LMCA 4DHJB 3IFDA 2BA1A 2KCNA 3A0JA 1KXLA 4RGTA 5C0XI 5A35A 4M8NA 4A3EG 2IGHA 2I5LX 1HXYD 5IWAQ 2ICEC 3I4MB 4GDKB 4B08A 1C7YA 1X3GA 2K25A 1UAPA 2JXMB 2XWBB 3D3RA 4GDLA 1KJTA 3AE7B 3J7ZC 1S5FD 3IAS1 2RHSB 4OVVA 1ZYRD 5M3FG 4B3RQ 5BYRA 4LDTD 1MD2D 3GTMB 3CQZH 1GUNA 3R2TA 1PV4A 2E2JH 2K5DA 1O7LA 1OQRA 4ASWC 4HPPA 4H02A 1Q8IA 2F0EA 1HNWL 3Q14C 4WWOA 2JA5H 3AB5A 2F52A 3U4ZA 3NSWA 4P71A 2K8BA 5EDSA 1A2UA 4A8XC 4X64Q 1VMCA 3HRDD 2IGGA 2F0GA 2DYOA 1T5XD 1EU3A 3ZJYC 2N9XA 4KKIA 1JOQA 3ENEA 4NJ6A 4IPDA 3GTJB 1XLQA 1L0XB 4BY1G 4DUZL 3NEMA 2R92G 1PZKD 4R9WA 1EOVA 1XNRQ 3KF8A 5I2XA 1N34L 2DJFC 1U4AA 1I94L 2LASA 3RT3B 2JA7H 3R8BA 4W9EA 4HJ7A 4EGVA 1JJGA 2JPHA 5E6NA 5HHDG 1LM0A 3L13A 2KANA 4IDIA 3OHXC 1U9RA 3M7GA 1XMQL 3K0YA 3CC2A 2PVOD 2RSUA 3L08A 3G6JB 2AL6A 4P6VF 1PFDA 1SFOH 1VR9A 4US8A 1XTDA 4A20A 4GOCA 2J0KA 1L2NA 5BN4A 1HZCA 1MHWC 4X3TA 4BA1I 1RL2A 1NI2A 4DV3L 3S16H 2HE7A 1L1OC 2BOSA 4IM2A 1K28A 3NY5A 3IXSA 1UEBA 5EBCA 4DK6C 4M00A 4KJNA 2ON8A 1ZDXA 1EWHA 5JEAH 2FE8A 4A90A 3DOWA 3N20C 1HNZL 3LYYA 2KJHB 4WAFA 1I42A 1YNTE 3X0WA 3M4YA 5IP9H 1F0ZA 3GD7A 4LF6L 4RGOS 5CC4A 4IM3A 3TP6A 4L2YA 1SNOA 3IKJA 4PMBA 4NXNQ 2PLPA 1VF5C 2WXFA 4DXGA 1C9FA 2J53A 2O6VA 1S1QB 3N3KB 4PS3A 4EZKA 3C3LA 4L5SA 1TS2A 2KCMA 1SYCA 1G6JA 3OG5A 2W9NA 2OXPA 4TKNA 3HKZE 4YY3L 5BYSA 1YN5A 4R4QA 3S1NB 2RDBC 5H92C 1G2TA 2J7QB 1HH2P 4FJYA 1KHIA 2B2WC 2JA6H 3PO3H 2KAJA 1H9RA 3OW7A 1S5BD 4JQWC 4AQ7A 2PI2E 3BU2A 3T9LA 4TQ1A 2SNSA 2ZW1A 2KOLA 1TVXA 1U0LA 4KGRA 3BJUA 1STEA 3CRLC 3R93A 2FCQA 2O4XA 1WD1A 4OL7A 1TWHH 2RHQB 1Q5WB 1D5XC 4ID6A 4NB3A 4DK5A 3N32A 4A3IH 1LLRD 4IALA 1WGDA 1CKNB 3J7AV 3NHHA 1ENFA 3GTLB 2BYVE 2VNUD 4KIKB 2KTRA 2ZJRA 2VL6A 3UGBB 2N4FA 5E6OA 2QIEB 2BS2B 4NAWB 1WXAA 1E6EB 5M3MH 3HOVG 2C60A 2ACZB 3EJIA 2I2YA 4JI3L 2XEWA 4DNIA 3VXWA 1EFID 1PTOC 2V0GA 4LF8L 1VQ6A 1ZXTA 2FNJB 5JXVA 4X6AH 3U50C 4DFAA 1VQ4A 3AXCA 3BINA 5LNK1 5CX3A 1BUVT 4R3DA 1OQYA 1SR3A 3M4OB 5M5XB 1WX7A 2NUCA 1HR0L 2XVSA 3NP8A 1WE6A 4LW1A 3PTFC 5L37A 3HS0C 2EMTA 2E2IH 1WGKA 1J6QA 1EEID 1TKEA 2LI5A 2QDLA 4B3MQ 1UF0A 1WH3A 2WQYB 4II3B 4PS7A 2MO1A 1C0AA 3PUVA 1I6HH 2VB3X 1V86A 1X56A 3M3JA 1WMHB 4AJWA 1BKBA 3T13A 2UXBL 3WOFA 4C2MB 3X23A 3EQLC 1FM0D 4J1MA 2L12A 3AM9A 2B2TA 4DUZQ 1DOIA 1XF5L 1MI2A 4IWOA 1N8RC 4RMAA 1XJVA 1J7CA 4FVMA 4KLKA 2PZUA 1N34Q 1I94Q 3MFYA 3M7NA 1ZW7A 4N9TA 3B9JA 1VQNA 4YTPB 2KECA 1C78A 3UI2A 4XQJA 2IO2B 3Q3FA 5DM73 4MGZE 4QAYA 3L54A 1XMQQ 3MXPA 4GKKL 3PHXB 1MPEA 1FXAA 4DR4L 2IBIB 1TY2A 3NTHA 2A6HC 4GDKA 4QB4A 3KLRA 2L00B 2DNFA 5JJLA 4KZ0A 1FRDA 3LGJA 3A9JB 5KRUA 2B2VC 4DV3Q 1YBYA 3AFPA 1F9JA 3NHEB 3NUHB 2OJWA 4MGKE 4PS8A 2EY5A 4TMAB 4TRDA 2YTXA 2KLGA 2MSED 1GKHA 2A68C 2O5JC 5ELDA 1HNZQ 2N1WA 2PW9A 1Q81C 1CKMA 4J8QA 5J3BA 3ZIMA 1FFUA 2D62A 1EYDA 4WJ4A 4LCDE 1WGYA 2FINB 4LNFA 1IBML 3EC8A 4FJZA 2RPQA 1S5CD 1N60A 1FD7D 3E3XA 4TKOB 3C46A 2N9EB 3QWZB 2UUBQ 3ZYYX 4OX9L 1I3QH 2QILA 2O2VB 3PQIA 1A6XA 3ZVVA 1RWSA 4K3CA 5C4HA 1IYUA 2F0UA 2GBNA 1NMFA 2WDRB 3ZTCA 1X3FA 2AWNA 4K2KA 1YNJC 2RQXA 2JX5A 4KSLC 3WOEA 3DHQA 5JEAJ 3U7DA 3SD5A 1VD2A 4QIWB 4AIMA 3DEPA 1E7UA 1TR5A 2KCCA 5FLXE 2BE5D 3ZQ4A 2M56B 3KQ4A 2ICIA 2RPVA 2FIFA 1KH0A 4USAA 1K83B 2H88B 2K22A 4DNTB 1J8IA 3HOWG 2Y0SE 5KNDA 4ZHOA 3KLSA 4HRSA 2E5LQ 2DHZA 1G291 2J0JA 3DPDA 2NN6H 2DJGC 1G2SA 1E8WA 2WB1E 3TEHB 3EECA 3K6OA 2IX1A 4W9FA 2MBHA 1CQFA 5AZHA 4WJOA 1I4QA 3AEEB 4I7AA 3L0OA 1FXTB 3IT6B 3PSIA 3ECIA 1RCVD 4ZLTF 3H3VI 5CHVC 1FNUA 1K3RA 1KRHA 3PREA 1C1YB 1X54A 4K7SA 4DAVA 3HOUH 4DR2L 1KDCA 3KW5B 1H9JA 1ENCA 5HGQA 2NVXH 3C1EA 1ET9A 1EWYC 4DGZA 2KMAA 4LNIA 3PO2G 1HFNA 4ABNA 4DV2L 2K52A 2NWGA 5C4XH 2BBCA 2MH7A 5K5PA 3I4NH 2NVTH 5C1ZA 2IW3A 3Q8DA 1B2TA 1CTMA 1X3PA 2HD3A 3H0GB 5FK9C 2JA8H 4WJQA 1WYGA 3PRZA 4TQUS 2ASQA 1HE8A 1N33L 3LX0A 1VQBA 1RJTA 1FGUA 3E0JA 1E2WA 2LVOA 1JE5A 2ZCBA 3CMMB 4JI4L 3GZNB 3IT4B 2K04A 2MGSA 1JR0D 4JV5L 3I2ZA 3I4MH 3QG1A 3QCAA 2VY3A 2ZTEA 4IG7B 1RTOA 3HOZG 3NOBA 3ZXVA 2ZVOA 2Q2HA 3HFZB 1KQSA 2EYJA 5IYCH 2JU6X 1T0RC 5GXGB 3UDFA 3GTMH 2DAJA 4PNYA 2DYMA 3QA8A 4HJGE 1EZ8A 1FO4A 1HJPA 3VR2A 5BN3A 4N9F4 2CWAA 1ESRA 4F1SA 1CKNA 1HR0W 1VMPA 2N1VA 3S14H 2KC2A 2R2QA 3CD6A 5HGTA 5JPMC 3IFTA 5ELFA 1UWXA 4W9DA 3WAPA 5JH5C 3IG3A 3T53B 1QUQB 2BYEA 1JROA 5AJ3Q 3GTJH 1PH9A 3TS2A 1V5OA 2JEBI 3NWSA 1B9RA 4F88A 4WRDA 3K5OA 1LACA 4PT5A 4M1UB 3PZ8A 5GROA 4KDIC 3N6RA 5IN7A 2CFMA 5FO7B 4X3KA 1WI5A 4X66Q 4LF7Q 2ZCCA 3AMZA 3NVZA 4R1JA 3QO2A 1U5KA 2OF1A 2F0WA 1J5EL 2INNE 2SDFA 3J81L 3DQVA 3GTGH 3AE8B 4IW0A 3WAOA 1BR9A 1Z47A 4A3CG 3PZ7A 5CV8A 2DX5B 3DHIC 2OT2A 1J7AA 2PNRC 1IW7C 3DUZA 1S3SG 3NJTA 3X3NA 3T1YQ 1B3AA 4I7ZC 1WMHA 3RN2A 3EN2A 1JB7A 2YEPB 3SK6A 5DPWA 2C7NB 1BF4A 2NZ1D 1YHAA 1N36L 1GM5A 2IGDA 3NZUA 1NY4A 2N3SA 4JE3B 4LJOB 1XT9B 1Y1VG 1VQKA 2LXJA 2F4VQ 2A73B 2F0VA 5IP4D 4GLXA 3HHMA 2EJGC 2D07B 1RD9D 5BR8L 1SYEA 4OZCA 3OMCA 3SR1A 3SDLC 3BWUD 2YU9H 1STAA 1X32A 1DOMA 2K33A 4F8MA 3ZNID 1QOHA 4JI6Q 3PIOA 2JRIB 1EQTA 1EY9A 1AZPA 2NS5A 5G5GA 3ZKJC 4FULA 4XQNA 2MX2A 1HFGA 4ZRPA 4M0WB 4LF5Q 1JOOA 3ULJA 1KTKA 3F8TA 2R2OA 4FADA 2I38A 4RMFA 2C35B 4P16A 3GE3C 4O42A 3L4PA 2EQSA 4ANXA 3A9JA 3A5UA 3S1NH 1T5EA 2L15A 5M5YH 4IFDJ 4MTKA 1HZ5A 3MA2B 2R7DA 2HD5B 2QJLA 2W3SA 4DA2A 4BBSG 3MJWA 4R8NA 3DLLA 3HOXB 3PGEA 2M4NA 4HCSA 1HUNA 4QUFA 3S17B 1PH2A 2K39A 3DVNV 3QOJA 1A3TA 1XX8A 3OW2A 4A3DB 4RCOA 3KFUA 1XEEA 3NZSA 4AS1A 2GA4B 3F2UA 1WGGA 3DM3A 2GBKA 3NS1A 1D6EC 2B63B 3J80i 1TWAB 3S1MB 3AEBB 2CW0D 4ACFA 2X38A 3V61A 2K28A 4NP5A 1WFYA 3PUYA 4DR2Q 3V2TA 5IOCA 5L83A 3CWIA 2F0LA 3X3MA 1HNXL 3Q22A 3GTLH 2I07B 4MH0E 1ICWA 3M62B 1E9MA 1KAAA 3W3AA 3GTQB 3DDCB 1WTHA 3PRMB 3MEHA 4US9A 4B9WA 1TWCH 2B2TC 3I73A 2NPTB 2WAQG 4WURA 1HQMC 4B3TL 1VLBA 2LEKA 1I4HA 2NVQB 3I9V1 4KK7A 4HCPB 4JI4Q 4ZQ3A 4LK0M 3FKYA 1BCPD 4A3KB 3I90A 4JOIA 5LMUL 2PQEA 3QB3A 4DV5L 3KK7A 3M4OH 3A56A 2VRRB 2R7ZB 1VZ8A 3TIXA 4K7WA 4PMWA 4JI5Q 3CPWA 1PGAA 1JQYD 4CDDC 2I46A 4HMJA 4DQOC 2R92B 1HEZE 2KVRA 4OVUA 1LTGD 1FYCA 4O0AA 1P3QU 1WGRA 2E76C 2KDMA 4HSPA 4LK1C 3URYA 2C7MB 3KVFB 1VQHA 1K9MC 4R8IA 5H8YE 5EPKA 4EEWA 1J8CA 1LT5D 2BF8B 2X69A 2MW5A 4LJZC 1R4PB 4XTCS 1QE6A 1ZKHA 3K7AH 4LNOA 2WU2B 4MJSB 4LLGM 5AUKA 3TEXA 3A74A 2Z1CA 2F0KA 3S2HH 1L1OA 4YCWA 4ODGA 3V3XA 2H4OA 3TMEA 2ZW0A 4Q5VA 3HZXA 2CQAA 2FCMA 4PK1A 4JPSA 4J6HA 1EYAA 1AN8A 3HGBA 4FO2A 1XPRA 3TRZA 1XCQL 3AE2B 3RNCC 1IXRA 3J7YW 3KJOA 4RAUC 2J42A 1SSNA 2YVCA 1H8CA 2RCNA 3M9BA 4NDXA 4P74A 4IUPA 4BBRG 5IIFA 4N8FA 4QCLA 2J0TD 1V80A 2LVPA 1GO3E 2R6GA 1QNKA 5IE8A 1MHHE 1L0VB 4DK3C 4PG3A 1MI0A 2NB0A 1AH9A 2ZTDA 3N1ZC 2RR9A 1LT3D 1Q12A 4C1NI 4I65A 2CHWA 4GOPB 1AP0A 2VH2A 4KD3A 5G3LD 1N36Q 4DR6L 2K5WA 4A3LG 2HUGA 3H09A 4GNXB 1P7EA 4E74A 4A3GB 5M5WH 3FILB 1IBXB 4A3BH 4LF9L 2Q5WD 2WXGA 3B6YA 5JHAA 4A76A 1F2LA 1NE3A 2PZTA 5LL6X 2ZJQA 2X6LA 3PSEB 1TWGB 2K6QA 2K14A 4KKUA 1WR6E 2MA9B 1BBWA 1YNND 3HKSA 1PHJA 2KWVB 1QUQA 3HOYB 4HJKA 2GBRA 3K59A 1PH3A 3RUZA 4X3UA 4ARCA 1EY5A 3SE0A 2WHIA 1ML0D 5KNCA 1P7FA 5IY0A 4FA6A 2ZXPA 4DAPA 2K9XA 5C3EG 3PV1A 1VQGA 1EEFD 3W5UB 1E22A 1KOTA 2BS3B 3FAHA 4WJNA 4QF4A 1DOLA 1F2RC 2C5CA 3SVMA 5H1SE 4BKGA 3RUIB 1E5WA 4MT5A 1YMHE 5BYQA 2KVZA 1VQ9A 2L76A 4MM3B 5BMIA 2WDQB 3VAWA 1Q46A 3E6ZX 5I2YA 2M17A 3VR3A 1QG7A 3AMUA 3D31A 5C44G 1BT0A 2IYDB 2JWUA 1MHXA 2DZJA 1DM0B 2RA4A 3KUPA 3HOVB 1B4OA 3J7AF 4ZYNA 3U2SC 2FBWB 4RFBA 3N1YC 1GUWA 2EYLA 1EO6A 3WIMA 2GBMA 3GTKB 4DR7L 2WU5B 4KI0A 1TYGB 3CP0A 4FP5D 4IPCA 2P5ZX 2Y5CA 2BB5A 4XDCA 3NVYA 2NTSA 1GUTA 1P16A 3VHTC 2A69C 2UUAL 4FXCA 4C3IG 2DZKA 1TS3A 4DV0L 2SNMA 1H4RA 3A7AB 2LUMA 4XXEA 2JYEA 1EYGA 4M0WA 1PFSA 4RG1A 4U673 4DR1L 2UUCL 2V4DA 4JBJA 1S40A 3SHQA 1K0RA 2PMZB 5LMUQ 4BY7B 2RDGA 2L9HA 1U4MA 3D4RA 4XDXA 1CSPA 2QMTA 3UIOB 4QL5A 1EQQA 1BNZA 3CHBD 3JSVB 1SB3C 2EY1A 2KEEA 1F2ZA 2KMMA 4FXKC 4C3HG 1OO9B 2JN4A 1VQPA 3S15B 5K36G 1LTID 2N0SB 4A3MG 1F9QA 1YQ4B 1ILQA 1IGDA 2WXNA 2VUMG 1FGBD 3KLSX 4JI1Q 2DENB 3HUIA 1N6ZA 4NZLB 2H5XA 3HKZG 3ZNHB 1P98A 2JQOA 5IKCM 4FYDA 3AEAB 4V190 4QGUA 1PDQA 2V1CC 1Z7TA 3NK9A 4QJFA 4XIGS 5LMNQ 1QB5D 1WM3A 3QC8B 2F0NA 2FCSA 4YTMB 2A6EC 1L0WA 3NXWA 1TWFB 3U9OA 1B7YB 2VQFQ 5GMVA 4YWKA 1CM9A 3C8YA 1Q1EA 2B8FA 2PPHA 2MP2B 3AEFB 5K36H 4ANWA 1JORA 1KL9A 2OWOA 4A3MH 3NG0A 3K58A 2NPTA 4ITKA 2L55A 1CMXB 1G8ZD 2WXMA 1QZHA 1GUGA 4K14A 2JUOA 3J80E 4HIOA 2KWUB 3TS0A 4MELA 4DUYL 5LMNW 3RZOB 1HTOA 2MHJA 3DBHI 2KN4A 2KN5A 3QJZA 4M02A 1DOYA 1SNMA 1ZYRC 1Q3LA 3NQTA 2UXCQ 3I8ZA 5ISRA 5CHFA 1UWVA 1E8ZA 3M4PA 3QARA 2QW7A 3QX1A 4WJ3M 1ZP0B 3RCZA 2ONQA 3VUXA 3FKIB 1XD3B 4N6EB 4LF4L 2F0HA 3NBHB 4H13C 1YN4A 1M4VA 3JAML 1Y1WB 1U4LA 1TZ1A 2G3QB 5M9OA 1CKOA 4K5VA 3GV6A 2VH1A 4R4TA 4KHPL 1F77A 1TTNA 5JVG3 2JA5G 1NNXA 4MJSA 3VUWA 1I50H 4G7OC 1W3SA 2WACA 4BKSD 1JWUD 1ACCA 1CFMA 3ML9A 3GV3A 2KQ4X 3HM3A 2QA4A 2IT1A 4ZOHC 4QIWE 1S72A 1G6PA 1GD7A 1EY4A 2RSNA 1LTAD 3BDCA 3BS1A 4LFBQ 4RGNA 5KHOA 3ML8A 5CV4A 2OQ0A 2ZM6L 3BDLA 3HOWB 1A3VA 1VCIA 4JI8L 4KVGB 1CA5A 2PJHA 1SNQA 3J80c 3L2PA 4H44C 3OMGA 4WQMA 2JA7G 1CA6A 3V60A 2BYTA 5HURA 3M85A 1KABA 3E56A 4XT1B 5CHWA 3T3OA 5EGTA 2DLBA 5FJ8H 4G57A 2FXQA 1VRAB 1JJCB 3FPPA 5J22A 3NRZA 2WXLA 2QEJC 3J7A5 5EE9A 2MJ3A 4RM8A 3A1QB 1QJOA 1LTRD 4GOPA 2JZZA 1V1QA 1NI3A 4LAAA 3W1BA 3H3VH 3P4PB 2PEAA 1P1AA 2R93B 4BBNC 4C80A 3VA5A 1SEBD 4M01A 4JOIC 3SDZA 3PHWB 4FF3A 3S17H 1VQ8A 1PFBA 4GNXA 3PO2B 1XNQL 2YEPF 3VR6A 2UXDQ 3H7PA 3SFDB 1F52A 1QKZA 4C3JH 4ZKBB 5E1FA 2F3WA 1PRTC 2B63H 5JEAG 3S1MH 5KEEA 4DV6L 1K8MA 3BVMA 4A93B 2UUAQ 1IGCA 3L9AX 5IP9G 3KUCB 5E6JA 4YIJA 2K5HA 2BWES 2WS3B 2EYHA 3TZDA 1X1MA 2IJ0A 4BXXH 5CV5A 2Z6BA 3AFQA 3HOZB 5EQ0A 3MHZA 5LLIA 4HEDA 1CT1D 3GTQH 5TR5A 2EELA 4EQ5A 1WTWA 4WH4A 1YNXA 3A4SC 5KIXA 1D5MC 3S9WA 4MIUA 3N30A 2NVQH 1NDDA 2WNMA 1WJJA 3NTKA 1KD1C 2E6XA 4MM3A 2E2HB 1SJED 2GVBA 2KYWA 2XK5B 4A3KH 2JA6G 2J4XA 3PO3G 5IGBA 1WXVA 4P1CC 2EJFC 1E1OA 2JA9A 1OXTA 2I0QA 2F3VA 2WYQA 2R7ZH 4K0KL 3FMCA 1FVIA 2WXKA 2FFKB 3GO5A 2AL3A 3AEDB 3DHGC 3L7ZC 3PUZA 3OJ4B 1C3TA 1GUOA 2E2DC 4K6LA 2LGXA 4PYUA 4IUUA 4S3SA 4IKGA 4LTUA 1CSQA 5E4WC 2K5NA 3G4SA 2PMVA 4ZAIA 5GAEC 1WZ3A 2D0OA 4A3IG 3BYYB 3TBIB 1WOCA 3I72A 4P75A 1CZPA 2Y0SG 2CHZA 1O7ZA 2VB2X 3DMUA 1GAQB 2RBMA 4B95A 5F2DA 2DZIA 4MGYE 5DPSA 1YN3A 1JT8A 2BGFA 2SAKA 3KF6B 3SXHA 5M3MG 1KNEA 2WB1G 5E7NA 5IGDA 4DKAC 2K8HA 1GNUA 2KDFB 4II2B 4IWPA 4HEA1 5DCNA 2FMMA 3ZNGC 4PZ7A 3MXGA 4YT0B 1DYQA 2KX3A 1Q7YC 1WF9A 2CU1A 4IC7B 1KDAA 1IL8A 1PGBA 1Y1VB 3AQQA 3A4RA 3QIAA 3DCGA 4ALPA 5LHY1 2YLMA 3ZRCA 2KDIA 2MJEA 4IOAA 5IGCA 5AZFA 2IWHA 5FO9B 2WKCA 5IT9E 4KHPQ 1UE6A 1H9KA 2ZNVB 1E2ZA 2BT6A 3Q6SA 4PZ8A 2G4SA 3DVGY 1K51A 4HXDA 4JIOU 1Z5SB 1EIGA 1Q1BA 3TP5A 1O80A 2C5LC 3P1MA 5FOBB 4NQLB 5J2RA 2HHHL 1WCMB 1TWGH 2LRWA 3M95A 2MP2A 4NXML 4S0RA 4RHSA 4DV4L 2UU9L 2BH8A 2MQHA 5DAUA 4BBSB 4CBVA 5EPJA 3AE6B 1DXMA 2KJ6A 1B3QA 3HOYH 1B70B 3PVLA 1BOSA 2KVMA 1J9OA 4J15A 2NVYB 3T1HL 4IQZA 3BZDB 2CWPA 4RWSC 3W1GA 3PIP3 1HNWQ 3PRPB 1ENAA 5NUCA 3RZWC 5FLMH 1LTTD 2CVRA 2F0TA 2LXKA 1MG8A 4QY7A 2K5QA 1YQBA 3PPAA 2A1AA 4OONA 3RN5A 3JYUA 2LWPA 4JL9A 4G50A 4J6IA 2AQ1B 4DDGD 4W9CA 3K57A 4LUZA 4JYAL 1A70A 1UNSA 1OTCA 3JAMi 3EIVA 4CGYB 1BBUA 5IT9c 2KJRA 1MVKA 1GG3A 3K5LA 3H3VC 3F2BA 1QVCA 2JRHA 4YHHL 5AUIA 2RF4A 4OXPA 4DV6Q 2F0DA 4X3SA 4KN7C 2WAQB 3V6CB 2Z4IA 4M8MA 4LDTB 2MBOA 4MNOA 5CGKA 3ZW3A 3GTPB 1AE2A 3UF8A 1Q1OA 2CJNA 3ZTDA 1V9PA 2K05A 2V9HA 3D0FA 1YHBA 4Y7NB 1VQ5A 4GB9A 1PTOD 4FHJA 4HN7A 4OEMB 3MC8A 4XWWA 2M19A 3RD2A 2KUMA 2LZ6A 2BE5C 3GE8C 1A15A 3LWUA 2OTJA 2I5HA 4HPMB 3KDFB 3TL5A 4A3OA 2LGYA 5JJIA 4IJLA 2K6AA 4A3FH 4LF6Q 4GU2A 2YV5A 4W9GA 3W2DA 2Z4HA 3P4SB 3I55A 3RULA 4LJPB 3O13A 4K0KQ 1X65A 5C23A 4LFAL 3GOEA 5ELOA 1VQCA 2KO3A 4DR5L 3UQBA 4KKTA 1UBQA 2BW2A 2D11A 4IFDH 4AQYL 1MIUA 2WLBA 3TP7A 2AMCB 4JBMA 4DV7L 4YY3Q 4L1BA 5FKAC 1PH8A 2NN6G 1R9TB 1F9RA 2MP1A 1VF7A 2H1EA 2KBNA 3QR8A 5E4XA 2BCOA 4X62L 1YHQA 3DVGX 5IO9A 3RNUA 3WAMA 1PDXA 4HIKA 2PZWA 2V3SA 4KKJA 2EKEC 4FNFA 4CDCC 5HY6A 3RYTA 2AQ2B 4PQXA 1TWFH 2INDC 3WA0A 4JCVE 2L1BA 3HOUG 2IX0A 4IOIE 4JGHB 2ZJPA 1NYQA 3EFUA 3GTOH 3NWTA 3GDEA 4ICVA 3V96A 4IOCA 5C4XG 3E5SA 2A6HD 1GB4A 1OTRB 1SE9A 3I4NG 1EWCA 4POGA 3VUYA 3C0RB 2JA8G 4ZRKA 3TUOA 4DAYB 1J0GA 1Q90A 2BKRB 4GIVA 3RZOH 2OQKA 3E9IA 1RFKA 2FMCA 3CPFA 1D3ZA 2A68D 5E3FA 3I4MG 4A6QA 1YJJA 4JI3Q 3Q2AC 1HZBA 3DBRI 4A3JB 4OO1I 4LF8Q 3FRPB 5IYDH 1JWMD 3KUZA 3FKIH 5HI1A 2QCPX 5IYCG 2BTEA 4GOPC 1Q10A 3KYDD 1NYRA 1TIID 1EWIA 1SMXA 5FLXc 4ZCKA 4HWIB 1HR0Q 4DV4Q 2AQ3B 2UU9Q 4IPGA 1HCZA 4GNXC 1DOXA 5I4DA 4IUTA 2BPSA 4ANVA 1EY6A 1V49A 3OOCA 4WORA 1HRJA 4G4KA 3T1HQ 1YNJD 2YYZA 3KF6A 1WYWB 2BS4B 2EPBA 1UE5A 3FDTA 1SYGA 3P4RB 4AYBB 1EU4A 1PFMA 2F0QA 2SOBA 4ZRZA 1KLVA 3A55A 4FHKA 2VXWA 1JMCA 1UZXB 1E0ZA 2LY7A 1IYFA 3CC4A 4O1NA 3KYHC 1ET6A 3CXCA 2UXBQ 4MACA 2UU7A 3AULA 1GXDC 2WDVB 3UQAA 1STNA 1A63A 4N9PA 3AN1A 4CYEA 1XPUA 3RNFC 4JI7L 5BMHA 2VW9A 5I9OA 3MXUA 1N63A 2A19A 2QCZA 2M0XA 3FHWA 4KIKA 4FJVB 4GN1A 2Q8IB 4ZUIA 4C1NK 1RM6C 1DOKA 2L5TA 3B2FA 2QEXA 1NUCA 4YHHQ 4NAWA 2M00A 4HJ5A 2CH4W 3TMPB 4C3IB 5LXHA 1M94A 2A5HA 1V1PB 4GKKQ 3AI5A 1Y69U 4DR4Q 1WTPA 2NBUA 3AV8A 1FMAD 4IJHA 1Y8RC 2CH4A 2Y3AA 2L05A 2QF7A 2KJXA 5C3XA 3I4OA 1WJNA 5IAAC 3IAYA 3RPFC 3EVQA 4G0NB 2EY2A 1R7SA 1SIJA 2JSVX 4FBJB 4URKA 1BUIC 2N7DA 3Q3NC 3TQYA 4KV6A 1SE8A 5D3IB 4W9IA 2LHEA 2VUMB 1QVGA 2B8GA 3AE9B 4L8JA 4HK2A 1GHJA 1X3QA 2HTME 4WQOB 5I6WA 1IBMQ 1VDVA 1OEYA 1YQ3B 2GRIA 2KQ3A 1EIYB 4DR5Q 4MSMB 4IWQA 1GVPA 1NTGA 1LO5D 4P2CB 4OX9Q 1WJUA 2UWQA 4GMVA 1UE1A 2E2HH 2XSCA 4OIJA 4K6DA 3BDOA 2R61A 1N32L 2A8VA 3I91A 1D1IA 4ZRIA 5GAHC 1JRPA 4DXAB 4EVOA 1FXIA 2KDBA 3S1RB 1V8CA 3U9SA 3ETRA 1TU2B 4G7ZC 1LTLA 3K9OB 3U52E 4Q2JA 1XYIA 3KWLA 3VQIA 4PZ6A 4CJ1B 3AE3B 4B0MA 3FEWX 4TV3A 4IUNA 3ZXRA 1XWEA 3JAME 1AWDA 3B2GA 3AEVA 4ULLA 2JYTA 3DBRB 2D3GA 2KT7A 4ME3A 1HZ9A 3FP9A 1Y14B 4W9HA 3CQZB 1QT9A 2IL8A 1K3BC 2L7RA 2X8XX 3B0AA 1TJEA 4X65L 1O7YA 3SHLA 3WANA 4RF1A 1I35A 2B2YA 4K8IA 2JA5B 2KD0A 1PZID 2YTVA 2D3CA 5C0XH 1A8VA 4A3EB 3W9CB 3OTOL 1IW7D 2WXIA 1GUSA 4ILWA 1SGHA 4X57B 3CW2C 4AH6A 2PVGC 4QQBX 2O2VA 4DV2Q 1SLJA 1YJNA 1VQFA 2EKIA 2DGYA 5M3FB 1WTOA 1PMRA 1W2BA 1OQQA 4S17A 5D2MB 1Y56A 1J19A 1BQQT 1CI3M 2JA7B 3Q8EA 1KAWA 1TT2A 2ASBA 4H7BA 1N33Q 2WFWA 3PV0A 4JVZA 1WSPA 2DZMA 3PF5A 4JV5Q 3Q6BA 1QVFA 3GB1A 2G9HD 5C4JB 1WCMH 5M5XH 3RLNA 1SBBB 1SFOB 4B9KA 1E7ZA 2K5PA 1XXGA 4LFCL 3IRBA 3G71A 2PTLA 5DNFA 4KY7A 4XYCA 4EUTA 3P75A 1PH4A 4BY1B 3K5MA 4ZYSA 2JWZA 3IL8A 1TBEA 4ZRQA 3S16B 5C4ZA 5LL6S 4DAYA 2GB1A 4NW2A 1BVSA 2PE6B 1SROA 2M9VA 2Z0SA 3KBXA 1YEZA 5D3DA 1Z9FA 1X9NA 4CJ2C 4C2MH 2IZVB 3D6CA 4N8X1 3J81j 4I6NB 2GVAA 3ONSA 4HDOA 4GN4B 3STBC 2Q2TA 1R4MI 1D2BA 2KWDA 4JW0A 1ZUD2 1OXSC 2MEKA 5KYLA 2K50A 1DGSA 1E8XA 3S24A 2GN5A 2LUEA 3RN9C 4DWFA 4GZYC 1V2YA 2KFJA 4HKZE 4DR3L 3V05A 3UDXA 4DF7A 4A3BG 3CSFA 1RKNA 1CUKA 4DV1L 3T8MA 1J5EQ 3H91A 2K1BA 3VDZA 2EYFA 2NR2A 3AEGB 3I5JC 2E8GA 3PGZA 4RKBA 4OELB 2BYFA 3PO3B 3OSOA 3T3NA 3C2PA 4CJ0B 2MUYA 4XZ4A 4JI0L 1B9MA 2KK8A 2L32A 2Z0DB 2RDFA 5DLQE 4NKLA 4GN3B 1SN8A 3Q8BA 5CYUA 1PVOA 3L3OC 1NAPA 2MCNB 3MP9A 2ZPYA 4A55A 4DHJD 2NBFA 2QDFA 2WX0A 2WXJA 1AYFA 4MH8A 1WI0A 2K32A 1UH6A 1TWHB 3FPUB 2OOBB 2K6DB 1BMLC 5EE3A 4ANUA 2Z6KA 2DAFA 3UE0A 5BR8Q 3GQBA 1VDZA 1K8GA 4GLAC 1XCTL 2ZT9C 2LFIA 2LRUA 3S1QB 3ZDTA 3AU7A 3I4LA 1SMYC 3SGIA 1JQ4A 1V1PA 4KHVA 2D2CC 5BMGA 2JZ3B 2FCNA 1I4PA 1CK1A 2B76B 2OEDA 1GPXA 4JWUC 1IP9A 2WDTB 1TGZB 2L1AA 2FUG1 2L8JA 3JC66 1R9TH 2NN6I 2K8CA 1WZ0A 2MFIA 5IGEA 1CJEA 3KF8B 1MFWA 4HAEA 2JXXA 4AJYB 3J81i 4G7HC 2NVUI 3Q3MC 2A74C 2J7ZA 1II3A 2XN9C 3D32A 2GBJA 3VRBB 4JC0A 5EPLA 1VZ7A 3BVZA 5MPOA 1K83H 2N9KA 2J0MA 2V3NA 3I3TB 1ZKOA 3ONAB 4XC2A 3EGRA 1FNVA 1QWYA 1BBXC 1L6VA 4LUVA 4XQQA 3W5OA 5IWAL 2CU3A 4KJOA 4RNAA 1I6HB 1GC7A 4JK1C 1E3PA 1WTRA 1I7HA 5GAGC 1VQOA 1PH1A 2MJDA 4FF2A 3HVDA 2JVCA 4RCNA 4P72A 4XX5A 4PV1C 1TY0A 2BB6A 4YCUA 3HP3A 1HNXQ 4MN3A 2RKSA 3OIQA 2BA0A 3A8KE 4U68A 3VYRA 3BZKA 2KEDA 2EDGA 1FL0A 2AWTA 3K9PB 3RNEC 3K7UC 2Z0EB 1F2MA 4K8JA 2KQ7A 3ALBA 4DHZB 4X64L 4V0BA 3DXJC 3NTIA 4B3TQ 1SSOA 2LJ5A 3V6EB 4K1RB 2HQEA 2KA7A 1EOTA 1JE4A 2XRSD 2MBBB 1RTNA 1HA6A 2CHXA 2WIIB 2AWOA 1RDPD 4UP8A 5C0XJ 1MSHA 1AARA 3H15A 2F4IA 4DV5Q 3CCMA 1YIJA 1IBKL 1QQRA 1XNRL 2N9LA 1E2VA 3H0GH 3LXFA 1B53A 2NZOA 1LM8B 1EF1A 1Q8KA 4HIMA 1R4MB 4HJAA 1WTXA 3QWNA 2NMQA 1TT5B 5IYBH 5CV9A 2LS01 5FO8B 1UE7A 3U30A 4OGQC 3O65B 1K8RB 2LXAA 2G4DB 1L2FA 3P2BA 4G11A 4UP9A 1Y8PB 4K81A 4L5QA 1NENB 2WKDA 2WINB 5EKLA 3VR4A 3LWEA 4KV2A 4A75A 2INCC 4XT3B 5KNBA 1UGJA 3CCQA 1H9MA 3NQIA 2KFKB 1LUZA 5ELCA 1BCPB 1ZXIA 4I6LB 1AE3A 3W1YA 3CKIB 1LGRA 1LXDA 1E7PB 5A2QL 4DR3Q 2V4LA 3U4EG 5G2NA 2NZHA 3P7JA 4KKSA 2FUHB 4DV1Q 2HIXA 1C4PA 3PO0A 3QK0A 1B8AA 2L0CA 1P0RA 1SDFA 1UD7A 1WY8A 2B3AA 2Z59B 1WJ6A 4BOSC 4NXNL 4HKQA 4P73A 2KXJA 3RNAC 2N7EA 3EFCA 1OEYJ 3VH3B 2LKVA 2NCNA 2A69D 3FC4A 3I57A 3ULLA 2Q8TA 2PYKA 2G1EA 4JI0Q 1U4PA 1IHZA 3Q8AA 1VQ7A 2EYPA 3UE1A 2O2LD 4I6PA 4OWXB 4DR6Q 1LFDA 4CDFC 3KJPA 2L0TA 1GOZA 1FJGL 3ZDMC 4XDDA 1JW9D 2IX3A 3TSSA 2Z9HA 1IPGA 4LF9Q 1KFYB 3P63A 3PIPA 4K5WA 2WXOA 2BKFA 4L23A 3BVGA 4MDKE 4HR7B 5EJWA 5GADC 3H9DA 5FJ8G 4UAIA 4C7ZA 3UDIA 1G51A 1WJ4A 4GGQA 5IP7H 4N59A 3MEFA 2KX0A 3QQ8B 1D1KA 1YJWA 2XNAC 1RFAA 3DBLI 4MTNA 2F0SA 1E8YA 4MHEA 3M63B 3OJ3A 2B2YC 1NBWA 3HOUB 2WP8J 3EBEA 1JMLA 2XBBC 3MZ5A 1AZQA 1RF2D 1S3OA 2EXZA 2LFNA 2ZTCA 3DM1A 3OYYA 2ATWA 2A6ED 2ZPNA 4O2DA 4C3JG 1I5FA 2ZJDA 2NVTB 1CQVA 3PF4A 1UELA 2FJ2A 2B63G 2JA8B 4WJPA 2QC8A 2K03A 3ERSX 3HEJA 2GLSA 2TSSA 2DNCA 3ZNZB 3TJPA 4RKLA 1WXQA 4BXXG 3DBSA 1XLOA 2D5GA 3H7SA 1EFWA 2J52A 5T8IA 3HOXH 4OO1H 1FEHA 1TS4A 1KM7A 1MG4A 1ZDVA 2Y5PA 1OFFA 1YJ1A 1A5RA 1YD8U 1IBXA 4A3DH 4GLVB 1ONLA 4DAMA 3FILA 1LTBD 4DR7Q 3Q8CA 1HHVA 2PPBC 4B3ML 2LJIA 1C48A 4OIKA 2E3TA 4ZDVA 1TWAH 1HTLD 1DCZA 1NVID 2B39A 3S14B 2AX5A 4A3KG 2BH2A 4YSXB 1HZAA 4A3EH 1YX6B 3A8JE 1SF0A 2R7FA 2L11A 1N9WA 4DV0Q 5C2TB 4FN2A 1PYBA 3P20A 2R7ZG 1PTOF 4IURA 1IKMA 3BY4B 3QIJA 4LUOA 4DR1Q 2UUCQ 2D5DA 1OXXK 3DWMA 4JPBW 1KNAA 1V97A 1IBKQ 4K5XA 5M3FH 2CKHB 1QF6A 2IPKD 1BXTA 4AYBE 5IODA 1WD0A 2M1MA 3W1SA 4ICUA 3TREA 3ITPA 5EKKA 3R66C 1A0IA 4EZJA 4PYZA 4KY6A 3NENA 1K73C 3D6WA 1YIWA 3NBIA 5C4JH 3GTGB 1V1OA 3N9YC 4YTNB 4IUMB 4FXGC 2F0FA 3Q23A 1LYLA 4REZA 1EQVA 3ND9A 1K0SA 4KZCA 3ZO5B 1RRBA 2RSOA 1JJ2A 1V9JA 1QOAA 4E3CA 1EL0A 5KYIA 4BY1H 2R92H 2JEAI 3KBGA 3T51B 1HTPA 2W55A 3DBHB 2EE1A 1TKYA 4KSKC 3J81E 4A9AA 4K2LA 4HCNB 2HDMA 4MZ9A 3SR6A 3CC7A 4MEMA 3Q8FA 3TEWA 4GLSC 3S2AA 4FF1A 3NVWA 2Z6KC 3RMHA 1PRTD 2YU9B 1WE7A 3C1FA 1SRUA 4IZ8A 3Q3JA 1SAPA 1MSGA 4NAMA 2HIVA 4BOZB 4DUYQ 3P1HA 4TVAB 4IN3A 2UUBL 3ND8A 2NBWB 3NZ3A 2SEBD 1H95A 3RLOA 1LTSD 1SE4A 4A3GG 1K50A 1WWTA 1GJZA 4EQPA 2K3UA 5CMDA 4LNNA 3JSVA 4MGIE 3DBLB 4XYQA 3DHHC 4DPGA 5CV7A 4LNQA 2ZEQA 2WXRA 5M5YB 1FJGQ 4XGAB 4LF4Q 3D4WA 2E74C 3OPOA 1V6EA 4OW0A 5T1GA 2KWCA 3HOYG 3AECB 1FD6A 4RHRA 4D2KA 4HDQA 2LGDA 4EFOA 1D7QA 2QGQA 4YWGG 4L5TA 2JQRB 5FLMG 1IKLA 2D9UA 3J81c 5HKHA 1E0BA 3HRZC 4A3GH 5DEHA 1Q82C 1C79A 3CCUA 2KFKA 3E0EA 2E5LL 4BS9A 1YZ6A 3VR9B 5I6YA 1E10A 3LB8C 2F3IA 1VQEA 1W6JA 2A4ZA 2ZM6Q 1L0YB 4CO7A 1XPOA 4JI8Q 3S1QH 3PCOB 5DM63 3FVQA 3IAM1 1ZPSA 5J17A 4XWTA 4K3BA 5JJKA 1V81A 2PQAB 3R2IA 4WFN3 4JI2L 1TWCB 2DY8A 2XIWA 4TSSA 2CJOA 1GC6A 4F7XA 1SIFA 3UINB 1WYDA 2WGSA 1T9HA 4FDBA 1XO3A 2LXCA 4JBKA 1HA5A 2HDEA 3AU5A 2FIDA 1EF5A 4CKCA 1L5PA 3ZLZA 4R4CA 1XNQQ 1JWBD 3NBHA 2LGSA 1QOFA 1B1ZA 5ELEA 1G6ZA 1R4NI 1BO0A 1DJRD 4OWTB 3CAMA 2K5VA 1T6BX 4W9LA 1JALA 2G9DA 3HOVH 1M8AA 3M3YB 3TBLD 2MJ8A 4FF4A 5JAVA 5J39A 4W9KA 1UEAB 1SNCA 2F0OA 4B0EA 2OHFA 4A3FG 4C7YA 1IYJB 4BY7G 3PUXA 2XTIA 2K4KA 2K7VA 2C9OA 3GTKH 2KKCA 1OXUA 3CF6E 4JWSC 3K7AB 5JOBA 3ZJVA 1NCVA 3S2HB 1L4ZB 4IFDG 3GZNI 1WRDB 4AUQC 2WXPA 1TQOA 1PLFA 2I5MX 4ME5A 1KF6B 1QNUA 4H0LC 1WXMA 4WAAA 4NPNA 4BFRA 2X6GA 2KZRA 2MO0A 4LNKA 4Q0FA 1EZ6A 1IBLL 5AJ3L 3KWVA 3Q0AA 4KN4C 4BY7H 4KY5A 2I1JA 3CRKC 5TSSA 2K1FA 2LGIA 3N52A 2D3BA 3A1QA 4EKUA 2Q2UA 1SE3A 2HJ1A 3VH4B 3LJ3A 2TMPA 2IO0B 4KTAA 1OXVA 5CORA 3B1LX 4LF7L 4FXDA 2R3ZA 4X66L 2F0PA 1SE2A 5JJZA 3S15H 2DWQA 3N1XC 4EQNA 1QZGA 1JICA 3I63C 2WXHA 4B9XA 3CCLA 1WX8A 3KOJA 4IPHA 2ES2A 3LNNA 4HSVA 3H1UA 2IY0B 5M5WB 3K0XA 2DUDA 1HZ6A 4A3BB 4KDLB 4KGSA 4BBRB 3F1ZA 1GJXA 2RMMA 5IA7A 3EFXD 3QOLA 1HQRD 3Q69A 3T1YL 1AW7A 2B2UA 2PW5A 2L52A 3L0WB 4BZAA 3ZGZA 5JPNC 1J7BA 3J80L 5LXIB 5D65A 5COYA 4AOFA 4C4VB 4EX5A 3VYSA 3G6EA 5IYDG 2MRPA 4RH6A 2IY1B 2F4VL 3FKIG 4GKJL 1Y1WG 5KGUA 4UDUC 4CHTB 1VQLA 1F9SA 2PO4A 4IUQA 3S2DB 2KDEB 5C5LA 1SNPA 2JE6I 2PIAA 2XK5A 2D2QA 1ZOYB 4JI6L 3IHPC 1STBA 3VFKA 4OZBA 2JZPA 1WM2A 3CMAA 4LF5L 3HIZA 1V43A 2FHTA 2CR5A 1E1TA 1CZGA 3AE4B 3NPPA 4C56C 3CF5A 1JCKB 1YJIA 1ISNA 5BN5A 3CCRA 3OIPA 2PCFB 3MFGA 4BKTA 1PRTB 5C3EB 3MHSD 4WWPA 3TEYA 1Y1WH 2HHHQ 1ESFA 1PA6A 4UPAA 3KH0A 1DZ1A 1TKWB 4JLCA 1C77A 4NXMQ 2NTTA 2F0MA 1NR2A 3BZCA 2KNBA 5D6JB 3SEBA 5CBEE 1PGXA 4DK1A 1SNDA 3BK2A 1BCPF 3VYUA 3R7QA 3OWFA 1TS5A 3MC9A 2LSSA 1IUEA 1VQAA 1STGA 3OLMD 2MHVA 5C5MA 4HJ9A 3DWAA 4JG2A 2EXDA 4JI2Q 3WWVA 1VQMA 2R93G 1R4NB 5C44B 5KHQA 2M2LA 4BWGB 1L1OB 1K8AC 1N61A 1RAXA 1YOVB 2KQSA 2LHDA 1V8QA 3HOWH 1YX5B 2EIFA 2BVCA 2MBQA 1H9SB 1HTQA 1UBIA 1P9DU 3H6NA 2B29A 1A2TA 1IL2A 1LT4D 4ZUJA 1OGWA 4JYAQ 4DBGA 1WX9A 4A93G 1FRRA 3LDZE 5DPRA 1T0QC 3VA7A 1XMOL 1FPYA 1NBFC 1NEKB 1SXTA 3W1SC 2PKOA 1ILPA 1X6OA 2L3ZA 2A5UA 1Z6HA 2K01A 5IGGA 2WV6D 3D8GA 3GP7A 3MAQA 2R93H 2WP9B 2JT4B 2KHJA 1TIFA 4NQKE 1EY7A 3PO2H 4JI5L 2V1YA 3SK5A 5G55A 4DHZE 1PFNA 1RYJA 3AE5B 4NJCA 1LABA 3CCJA 3U8ZA 1E24A 2BDNA 4RM9A 2QHOA 2Z8LA 2JYOA 1WFQA 2F0JA 4Y52H 2PMZE 3R3OA 4RGMA 3TN2A 5JVH3 4A93H 1UWMA 3B08A 4CQNA 4C3HB 5D94A 2KACA 3DWPA 3K80C 4A3MB 2PQAA 2HT1A 1PYWD 4AP4C 4DN4M 1L6UA 2JF5A 3HOZH 1FNWA 1XLNA 1IBLQ 5G3LF 3HKZB 1ZE3D 5D14A 4B3SL 3NVVA 2VZKD 1CZWA 3EA6A 4YWMA 1VQDA 4UY8C 2GI9A 2HCCA 3PUWA 3L17A 4LFAQ 2IDYA 3E9SA 1ROEA 5IOIA 2JY6A 2VQEL 4DDID 2VZAA 1PXUA 5A2QE 1PH7A 4AQYQ 4BKSA 2XRQD 1N5XA 3SK4A 3QJYA 2WXQA 2IO1B 3KYCD 1S5ED 2RCFA 3UDGA 3BYTB 3TP8A 2QKIC 1MKHA 2CW0C 4LMQD 4DV7Q 1EUVB 4FLHA 2ZVNA 5C3JB 3R3MA 1RIPA 1PTOB 3D4DA 3DWGC 1EM7A 4X62Q 1QILA 3MC0B 4QMGA 3AYHB 1STHA 2Q8RE 3T4AC 1AEXA 3AB9A 2MNAA 1ZEQX 5J18A 5C0XG 2XWJB 1K8OA 2BWFA 1LQBA 3VVWB 1I50B 3NE5B 5T1IA 2N78A 3RNGC 3RFZB 1VZ6A 1EY8A 2G5DA 4L63B 4DXFA 4IO9A 1XQQA 1UUPA 4GKJQ 4L6TB 2N55A 5EBDA 4AWJA 2N49A 3KDFA 1BCPC 2F1MA 4A3CH 1E7VA 3JW0X 2O6VD 2VS1A 4E71A 5BO4B 3NUCA 2OJRA 1JC7A 1L4DB 1WIAA 1A62A 2E2JB 3CCEA 3CCSA 3UIPB 1MJDA 4N58A 5FR3A 3DEOA 3RMKC 4A4IA 5IT9L 2WWZA 2JSOA 2MPMA 3I3CA 1WVLA 2AYOB 2JXTA 4IM0A 4KHZA 1WCMG 3I56A 3A9KB 1XTCD 4NY0A 2L83A 1VQJA 1Y1VH 1Q86C 4RF0A 3RZFA 2IY5B 3K81C 3JVZX 2G45B 1GUAB 3MXNB 2HQLA 4YSZB 1EIFA 4BA2I 3AE1B 4OZAA 2K0PA 3H6MA 4C3JB 2AUJD 2M0AA 4WJWA 4ZKCB 3A8IE 4GS3A 3K5NA 1MJEA 1FIQA 2IO3B 5D7GA 3CSTA 2EZVA 2N9PC 4YSYB 1PYSB 1U4RA 3JAMc 4C4VA 4HPLB 2AUKA 2D0PA 1B9NA 5CV6A 1KRTA 3MVVA 3U4VA 2IHFA 1I4XA 1QOBA 1F9PA 2CHBD 4BBSH 2HCIA 2EYMA 2INPE 3HK0A 2KHSA 1ZGUB 2NVYH 4WIPA 1ASYA 3RNBC 4JI7Q 4ZRJA 1C4QA 3A7LA 4JX1C 1JOKA 2HJ8A 4MSQB 1FFVA 4EE2A 1SYFA 2JP1A 3ERQA 1XMOQ 1NJIC 3CU7A 4OHJA 3OWEB 2BQQA 2NBVB 3ICEA 5CTRC 2I1KA 3V62A 3WCQA 2REXA 2N88A 3M4QA 1SYDA 3P4QB 2ENBA 3Q3OC 1EYCA 2KHWB 1WRIA 1GB1A 3A33B 1Y8OB 1EUJA 2H89B 3IVFA 3SU8X 4HIDA 3MTSA 5HG2A 1IYVA 1SJHD 3U58A 4HMIA 2M8SA 1B44D 3EUB2 4KMUC 1YNNC 4L5RC 3CIRB 4GN5A 4TQ0A 3M3YH 4YL8A 2B3GA 3F2DA 1UGMA 1KC8C 4JI1L 1C8CA 3VR8B 3RD4A 2KTFA 4HVBA 3T16A 2IHEA 3ABVB 4DNRB 1EY0A 2BDOA 4C00A 3APFA 2LMCB 3GTPH 4ARIA 5LMNL 1JRUA 4APVA 1S5DD 1MBYA 4RA8A 4YWLA 2JA6B 1PUTA 5G5HA 3VTWA 1VS0A 3MWYW 1MJCA 4Y7NH 1K53A 1O78A 2EOTA 4B3SQ 3A5ZB 4IFDI 2B2UC 3OAWA 3A54A 2F0IA 2VQFL 1KIXA 1JWAD 2EVBA 4G3XB 4GDLB 1H9SA 5EE1A 1JB3A 2W82A 4HROA 2VQEQ 3RZDH 4BVUC 3BIID 3MHBA 1V5TA 3RR5A 4GSWA 2QSDA 3IFWB 1N5WA 3PZDA 3MJ5A 1QOGA 1D8LA 1F2YA 2ALYB 3I70A 1N32Q 1C4CA 1FCLA 4A3IB 3G7LA 1E90A 4GXBA 4KGTA 1N62A 4P1BC 3VYTA 4OWWB 1ICFB 2Y0SB 5EAYA 1EIHA 1QZEA 1EQRA 2HTHA 3F2CA 3PT2B 2DBYA 2K75A 3K8AA 5FLXL 2RVLA 1HUMA
chains in the Genus database with same CATH topology
5M3MB 1DGJA 2WB1B 3UI3A 4WWMA 3U7ZA 2B2WA 4M8AA 5CBAE 2VZKB 3WDNA 1VJKA 3VR5A 2E2IB 2O5IC 5J1ZA 4XYOA 3RZDB 1RHPA 4KX6B 3W5VB 2L4NA 2PW7A 4JBWA 1I4GA 3SK8A 1QCBD 3BK1A 4OVZA 2DNEA 3BG3A 1PZJD 3HVZA 2RDHA 1HPCA 3P42A 2F03A 2OEOA 3RLFA 4J3OD 4Z9CB 2E75C 4F87A 3TZUA 1B50A 4PMCA 4HTHA 4CKEA 4ZHPA 1BDOA 3PIO3 1WTVA 4IUVA 3T56B 3TDQA 5C6AA 4YXDB 1SMYD 1KLUD 1ZXHA 1D4BA 3H94A 4HCEA 5AFWA 1C4AA 1CHPD 4KD4A 3PMFA 3DWQA 1C76A 3J9CA 2ZXOA 3TEZA 3ZJTA 4H2AA 2QDBA 1A3UA 5IGFA 2V3PA 2NYZD 3SFEB 4A3FB 4E6IA 1I6VC 1KDBA 2HDLA 2DY7A 5ELBA 4QUCA 1JWSD 3EROA 3Q24A 2ZXRA 1I3QB 3MXNA 4DK0A 5EE0A 1GHKA 2W3RA 2EY6A 2V4IB 3HG9A 1PRTF 1XLPA 1KLGD 1NSNS 1STYA 1DONA 1D5ZC 3H8HA 1Y8NB 1MGSA 4NMZA 5C3WA 2B2VA 1FCCC 1AFPA 1WTQA 1QLBB 1TZOA 1SYBA 1CHQD 1S4ZA 1K52A 1FR3A 3GS2A 3GTOB 1RODA 4ZK9B 1LT6D 1NR4A 2ID0A 5HFYA 1LV9A 2EYOA 1I4RA 2N7JA 1F2RI 2DN8A 2EJMA 3ZJUA 4XE0A 1T3QA 4CKBA 4DU9A 1G91A 1DD2A 1R4QB 5I9PA 1TKGA 2W54A 5EKIA 4OO1G 3AH7A 2NVXB 1W6KA 5CR3A 1PTOH 4EQOA 5C4XB 3I4NB 3VRAB 2LMCA 3IFDA 2BA1A 2KCNA 4RGTA 5C0XI 5A35A 2IGHA 1HXYD 3I4MB 2ICEC 4GDKB 4B08A 1UAPA 2JXMB 2XWBB 3D3RA 3AE7B 1S5FD 3IAS1 1ZYRD 5BYRA 1MD2D 3GTMB 1GUNA 3R2TA 2K5DA 1O7LA 1OQRA 1Q8IA 2F0EA 3AB5A 3NSWA 1A2UA 4A8XC 1VMCA 3HRDD 2IGGA 2F0GA 2DYOA 1T5XD 1EU3A 4KKIA 1JOQA 3GTJB 1XLQA 1L0XB 1PZKD 4R9WA 3KF8A 5I2XA 3R8BA 4EGVA 5HHDG 4IDIA 3OHXC 1U9RA 3M7GA 2PVOD 3K0YA 3G6JB 4P6VF 1PFDA 1VR9A 4US8A 5BN4A 4X3TA 4BA1I 2BOSA 3IXSA 5EBCA 4KJNA 2ON8A 1ZDXA 1EWHA 5JEAH 2FE8A 4A90A 3LYYA 4WAFA 1YNTE 1F0ZA 3M4YA 3GD7A 4RGOS 5CC4A 3TP6A 4L2YA 1SNOA 3IKJA 4PMBA 2PLPA 1VF5C 2WXFA 4DXGA 1C9FA 2J53A 3C3LA 1TS2A 1SYCA 2OXPA 5BYSA 1YN5A 3S1NB 5H92C 1G2TA 2B2WC 2KAJA 1H9RA 3OW7A 1S5BD 4AQ7A 4TQ1A 2SNSA 2ZW1A 2KOLA 1TVXA 4KGRA 1STEA 3CRLC 3R93A 2O4XA 1WD1A 4OL7A 1D5XC 4ID6A 1LLRD 4IALA 3J7AV 3NHHA 1ENFA 3GTLB 2VNUD 2QIEB 2BS2B 4NAWB 1E6EB 2ACZB 3EJIA 2I2YA 1EFID 1PTOC 2V0GA 1ZXTA 5JXVA 4DFAA 5LNK1 1BUVT 4R3DA 3M4OB 5M5XB 2NUCA 2XVSA 3NP8A 3HS0C 1WGKA 1TKEA 1EEID 2WQYB 3PUVA 2VB3X 3T13A 3WOFA 4C2MB 3EQLC 1FM0D 4J1MA 2L12A 3AM9A 2B2TA 1DOIA 1XF5L 1MI2A 1J7CA 4FVMA 2PZUA 3MFYA 3M7NA 4N9TA 3B9JA 4YTPB 2KECA 1C78A 3UI2A 4XQJA 5DM73 3MXPA 1MPEA 1FXAA 1TY2A 3NTHA 2A6HC 4QB4A 3KLRA 1FRDA 5KRUA 2B2VC 3NUHB 2EY5A 4TMAB 4TRDA 2A68C 2O5JC 5ELDA 2PW9A 4J8QA 1FFUA 2D62A 1EYDA 2FINB 1S5CD 1N60A 1FD7D 4TKOB 3C46A 3ZYYX 2QILA 1A6XA 1RWSA 5C4HA 1IYUA 2F0UA 2WDRB 2AWNA 4K2KA 1YNJC 2RQXA 2JX5A 3WOEA 3DHQA 5JEAJ 4QIWB 3DEPA 1TR5A 2KCCA 5FLXE 2BE5D 3ZQ4A 2M56B 3KQ4A 2ICIA 2RPVA 1KH0A 4USAA 1K83B 2H88B 2K22A 4DNTB 1J8IA 4ZHOA 5KNDA 3KLSA 4HRSA 1G291 2NN6H 1G2SA 3K6OA 2IX1A 1CQFA 1I4QA 3AEEB 3IT6B 1RCVD 4ZLTF 1FNUA 1KRHA 4DAVA 1KDCA 1H9JA 1ENCA 3C1EA 1ET9A 1EWYC 4DGZA 1HFNA 4ABNA 2BBCA 2NWGA 2MH7A 5K5PA 2IW3A 1B2TA 1CTMA 1X3PA 3H0GB 5FK9C 1WYGA 4TQUS 3LX0A 3E0JA 1RJTA 4HKZE 1E2WA 3IT4B 2K04A 2MGSA 1JR0D 3QG1A 1RTOA 2EYJA 2JU6X 5GXGB 2DYMA 4PNYA 4HJGE 1EZ8A 1FO4A 3VR2A 5BN3A 1ESRA 1VMPA 5HGTA 5JPMC 3IFTA 5ELFA 1UWXA 3T53B 1JROA 2JEBI 3NWSA 1B9RA 4F88A 4WRDA 3K5OA 1LACA 4PT5A 4M1UB 3PZ8A 3N6RA 5FO7B 4X3KA 3NVZA 3AMZA 3QO2A 2OF1A 2F0WA 2INNE 2SDFA 3J81L 3AE8B 1BR9A 1Z47A 3PZ7A 5CV8A 2OT2A 1J7AA 2PNRC 1IW7C 3DUZA 3X3NA 1B3AA 4I7ZC 2YEPB 3SK6A 1BF4A 2NZ1D 2IGDA 4JE3B 2A73B 2F0VA 2EJGC 1RD9D 1SYEA 4OZCA 3OMCA 3SR1A 3BWUD 1STAA 1X32A 1DOMA 2K33A 4F8MA 1QOHA 1EQTA 1EY9A 1AZPA 5G5GA 4XQNA 1HFGA 4ZRPA 1JOOA 1KTKA 2I38A 4P16A 4O42A 3L4PA 4IFDJ 1T5EA 1HZ5A 3MA2B 2QJLA 2W3SA 4DA2A 4R8NA 3HOXB 4HCSA 1HUNA 4QUFA 3S17B 3QOJA 1A3TA 1XX8A 4A3DB 4RCOA 1XEEA 4AS1A 2GA4B 3F2UA 3NS1A 1D6EC 2B63B 1TWAB 3S1MB 3AEBB 2CW0D 2X38A 2K28A 4NP5A 3PUYA 3V2TA 5IOCA 3CWIA 2F0LA 3X3MA 3Q22A 2I07B 1ICWA 1E9MA 1KAAA 3W3AA 3GTQB 3MEHA 4US9A 4B9WA 3I73A 2B2TC 4WURA 1HQMC 1VLBA 2LEKA 3I9V1 1I4HA 2NVQB 4KK7A 4ZQ3A 4LK0M 1BCPD 4A3KB 3I90A 2PQEA 3QB3A 3KK7A 3A56A 2R7ZB 1VZ8A 4PMWA 1PGAA 1JQYD 2I46A 4HMJA 4DQOC 2R92B 1HEZE 1LTGD 1FYCA 2KDMA 2E76C 4LK1C 4HSPA 3URYA 5H8YE 4R8IA 5EPKA 1LT5D 2X69A 4XTCS 4LJZC 1R4PB 1QE6A 2WU2B 4LLGM 5AUKA 3TEXA 2Z1CA 2F0KA 4ODGA 3V3XA 2H4OA 3TMEA 2ZW0A 4Q5VA 3HZXA 2CQAA 4JPSA 4J6HA 1EYAA 1AN8A 3HGBA 4FO2A 1XCQL 3AE2B 3J7YW 4RAUC 2J42A 1SSNA 5IIFA 4NDXA 4IUPA 4QCLA 2J0TD 2R6GA 1MHHE 1QNKA 1L0VB 1MI0A 2NB0A 1LT3D 1Q12A 4C1NI 4I65A 1AP0A 4KD3A 5G3LD 2K5WA 2HUGA 3H09A 1P7EA 4A3GB 1IBXB 3FILB 2Q5WD 2WXGA 1F2LA 2PZTA 5LL6X 2X6LA 1TWGB 4KKUA 1YNND 3HOYB 3K59A 4ARCA 3RUZA 4X3UA 1EY5A 3SE0A 1ML0D 5KNCA 1P7FA 2ZXPA 4DAPA 2K9XA 1EEFD 3W5UB 2BS3B 3FAHA 4QF4A 1DOLA 1F2RC 2C5CA 3SVMA 4MT5A 1YMHE 5BYQA 4MM3B 5BMIA 2WDQB 3E6ZX 5I2YA 3VR3A 1QG7A 3AMUA 3D31A 2JWUA 1MHXA 1DM0B 2RA4A 3KUPA 3HOVB 1B4OA 3J7AF 3U2SC 2FBWB 4RFBA 1GUWA 2EYLA 3GTKB 2WU5B 4KI0A 1TYGB 4FP5D 2Y5CA 2BB5A 4XDCA 3NVYA 2NTSA 1GUTA 2A69C 4FXCA 4C3IG 1TS3A 2SNMA 3A7AB 2LUMA 4XXEA 2JYEA 4M0WA 4U673 2V4DA 2PMZB 4BY7B 2RDGA 2L9HA 1U4MA 3D4RA 4XDXA 2QMTA 1BNZA 3CHBD 1SB3C 2EY1A 1F2ZA 2KEEA 2KMMA 4C3HG 4FXKC 1OO9B 3S15B 5K36G 1LTID 2N0SB 1F9QA 1YQ4B 1ILQA 1IGDA 2WXNA 3HUIA 1FGBD 3KLSX 4NZLB 4FYDA 3AEAB 4V190 1PDQA 4XIGS 1Z7TA 3NK9A 1QB5D 2F0NA 4YTMB 2A6EC 3NXWA 1TWFB 3U9OA 3C8YA 1CM9A 1Q1EA 2B8FA 3AEFB 5K36H 1JORA 3K58A 4ITKA 2L55A 1G8ZD 2WXMA 1GUGA 4K14A 3J80E 3RZOB 1DOYA 2KN4A 1SNMA 1ZYRC 1Q3LA 3NQTA 3I8ZA 5ISRA 1ZP0B 2ONQA 3FKIB 4N6EB 2F0HA 4H13C 1YN4A 1M4VA 3JAML 1Y1WB 1U4LA 5M9OA 4K5VA 3GV6A 1F77A 5JVG3 4G7OC 2WACA 1JWUD 1ACCA 1CFMA 3GV3A 2KQ4X 2IT1A 4ZOHC 2RSNA 1EY4A 1LTAD 3BDCA 3BS1A 4RGNA 5CV4A 3BDLA 3HOWB 1A3VA 1VCIA 1CA5A 1SNQA 4H44C 3OMGA 4WQMA 1CA6A 2BYTA 5HURA 3M85A 1KABA 3E56A 4XT1B 3T3OA 5EGTA 2DLBA 4G57A 1VRAB 3FPPA 5J22A 3NRZA 2WXLA 2QEJC 5EE9A 2MJ3A 1QJOA 1LTRD 1NI3A 4LAAA 3P4PB 2R93B 4C80A 3VA5A 1SEBD 3SDZA 4FF3A 1PFBA 3PO2B 2YEPF 3VR6A 3SFDB 1QKZA 4ZKBB 5E1FA 2F3WA 1PRTC 5JEAG 5KEEA 1K8MA 3BVMA 4A93B 1IGCA 3L9AX 5E6JA 4YIJA 2WS3B 2EYHA 3TZDA 2IJ0A 5CV5A 3HOZB 3MHZA 5EQ0A 4HEDA 1CT1D 2EELA 1WTWA 4WH4A 5KIXA 1D5MC 3S9WA 4MIUA 2WNMA 3NTKA 2E6XA 2E2HB 1SJED 2J4XA 5IGBA 2EJFC 1OXTA 2F3VA 3FMCA 2WXKA 2FFKB 3GO5A 3AEDB 3L7ZC 3PUZA 1GUOA 2E2DC 4K6LA 4IUUA 4S3SA 4IKGA 4LTUA 5E4WC 2PMVA 4ZAIA 3BYYB 3TBIB 3I72A 1CZPA 1O7ZA 2VB2X 3DMUA 1GAQB 2RBMA 5F2DA 1YN3A 2SAKA 3SXHA 1KNEA 5IGDA 4HEA1 2FMMA 3MXGA 4YT0B 1DYQA 1KDAA 1IL8A 1PGBA 1Y1VB 3QIAA 5LHY1 2MJEA 5IGCA 2IWHA 5FO9B 2WKCA 5IT9E 1H9KA 1E2ZA 2BT6A 3Q6SA 1K51A 1EIGA 1Q1BA 3TP5A 1O80A 3P1MA 5FOBB 1WCMB 4RHSA 5DAUA 4BBSB 4CBVA 5EPJA 3AE6B 1DXMA 1BOSA 2KVMA 1J9OA 2NVYB 4IQZA 3BZDB 4RWSC 3PIP3 1ENAA 5NUCA 1LTTD 2CVRA 2F0TA 2K5QA 2AQ1B 3K57A 1A70A 1UNSA 4CGYB 1MVKA 3K5LA 3H3VC 5AUIA 2F0DA 4X3SA 4KN7C 2WAQB 2Z4IA 5CGKA 3GTPB 2CJNA 2K05A 4Y7NB 1PTOD 4HN7A 4XWWA 2M19A 2KUMA 2BE5C 1A15A 3LWUA 2K6AA 3W2DA 2Z4HA 3P4SB 3O13A 4KKTA 2BW2A 4IFDH 2WLBA 3TP7A 4L1BA 5FKAC 1R9TB 2NN6G 1F9RA 2MP1A 1VF7A 2H1EA 5E4XA 2BCOA 1PDXA 2PZWA 4KKJA 4FNFA 2AQ2B 4PQXA 2L1BA 2IX0A 4IOIE 1NYQA 3NWTA 3V96A 3E5SA 2A6HD 1GB4A 1EWCA 3TUOA 1Q90A 1RFKA 2FMCA 2A68D 5E3FA 4A6QA 1YJJA 4A3JB 4OO1I 3FRPB 1JWMD 5HI1A 2QCPX 2BTEA 1Q10A 1NYRA 1TIID 2AQ3B 1HCZA 1DOXA 5I4DA 4IUTA 1EY6A 3OOCA 4WORA 1HRJA 4G4KA 1YNJD 2YYZA 2BS4B 2EPBA 3FDTA 1SYGA 3P4RB 4AYBB 1EU4A 1PFMA 2F0QA 2SOBA 4ZRZA 3A55A 2VXWA 1E0ZA 2LY7A 4O1NA 1ET6A 4MACA 1GXDC 2WDVB 1STNA 4N9PA 3AN1A 5BMHA 5I9OA 3MXUA 1N63A 2Q8IB 4ZUIA 4C1NK 1RM6C 1DOKA 2L5TA 3B2FA 1NUCA 2M00A 4C3IB 2A5HA 1V1PB 1Y69U 1WTPA 3AV8A 1FMAD 2Y3AA 2QF7A 2KJXA 5C3XA 3RPFC 3IAYA 3EVQA 2EY2A 1R7SA 1SIJA 2JSVX 1BUIC 4KV6A 5D3IB 2LHEA 2VUMB 2B8GA 3AE9B 4L8JA 1GHJA 1X3QA 2HTME 5I6WA 1VDVA 1YQ3B 2GRIA 2KQ3A 4P2CB 5BMGA 1LO5D 2XSCA 4OIJA 4K6DA 3BDOA 2R61A 3I91A 1D1IA 1JRPA 4EVOA 1FXIA 3S1RB 1V8CA 3U9SA 3ETRA 1TU2B 4G7ZC 3U52E 4Q2JA 1XYIA 3KWLA 3VQIA 4B0MA 4CJ1B 3AE3B 3FEWX 4IUNA 1XWEA 3JAME 1AWDA 3B2GA 4ULLA 2JYTA 3CQZB 1QT9A 2IL8A 1TJEA 1O7YA 3SHLA 4RF1A 2B2YA 4K8IA 2JA5B 1PZID 5C0XH 4A3EB 3W9CB 1IW7D 2WXIA 1GUSA 4ILWA 2PVGC 2EKIA 5M3FB 1WTOA 1PMRA 1OQQA 1Y56A 1BQQT 1CI3M 2JA7B 3Q8EA 1TT2A 4H7BA 1WSPA 3PV0A 3GB1A 2G9HD 5C4JB 1SBBB 1SFOB 2K5PA 1XXGA 2PTLA 5DNFA 4KY7A 3P75A 4BY1B 3K5MA 4ZYSA 3IL8A 4ZRQA 3S16B 5C4ZA 5LL6S 4DAYA 2GB1A 4NW2A 2M9VA 3KBXA 5D3DA 4CJ2C 3D6CA 1D2BA 2KWDA 1ZUD2 1OXSC 2MEKA 5KYLA 4GZYC 3V05A 4DF7A 1RKNA 3H91A 2K1BA 2EYFA 3AEGB 4RKBA 3PO3B 3OSOA 3T3NA 3C2PA 4CJ0B 2MUYA 1B9MA 2L32A 2RDFA 4NKLA 3Q8BA 5CYUA 3L3OC 1NAPA 3MP9A 4A55A 2NBFA 2WXJA 1AYFA 4MH8A 2K32A 1TWHB 3FPUB 1BMLC 5EE3A 3GQBA 1VDZA 1XCTL 2LFIA 2ZT9C 3S1QB 3AU7A 3I4LA 1SMYC 1JQ4A 1V1PA 4KHVA 2D2CC 1I4PA 1CK1A 2B76B 2OEDA 1GPXA 4JWUC 2L1AA 2FUG1 2NN6I 5IGEA 1CJEA 4HAEA 4G7HC 2A74C 2J7ZA 1II3A 2XN9C 3VRBB 5EPLA 1VZ7A 3BVZA 5MPOA 2N9KA 2V3NA 1ZKOA 3ONAB 3EGRA 1FNVA 1QWYA 1BBXC 1L6VA 4XQQA 2CU3A 4KJOA 4RNAA 1I6HB 1I7HA 4JK1C 1WTRA 2MJDA 3HVDA 4FF2A 4RCNA 4PV1C 1TY0A 2BB6A 3HP3A 4MN3A 2RKSA 3OIQA 2BA0A 3A8KE 4U68A 3VYRA 2KEDA 2EDGA 1F2MA 4K8JA 4V0BA 3DXJC 3NTIA 1SSOA 2HQEA 1EOTA 2KA7A 1JE4A 2XRSD 1RTNA 1HA6A 2WIIB 2AWOA 1RDPD 5C0XJ 1MSHA 2N9LA 2F4IA 1QQRA 1E2VA 3LXFA 1B53A 1WTXA 3QWNA 2NMQA 5CV9A 2LS01 5FO8B 4OGQC 1Y8PB 1NENB 2WKDA 2WINB 5EKLA 3VR4A 3LWEA 4XT3B 5KNBA 1UGJA 1H9MA 3NQIA 5ELCA 1BCPB 1ZXIA 3CKIB 1E7PB 5A2QL 3U4EG 4KKSA 3P7JA 1C4PA 3PO0A 2L0CA 1SDFA 4HKQA 2LKVA 2A69D 3FC4A 3I57A 2Q8TA 2PYKA 2G1EA 1U4PA 1IHZA 3Q8AA 2EYPA 2O2LD 1GOZA 4XDDA 1JW9D 2IX3A 3TSSA 1KFYB 3P63A 4K5WA 2WXOA 4L23A 3BVGA 4HR7B 5EJWA 4UAIA 4C7ZA 4N59A 1D1KA 2XNAC 2F0SA 4MHEA 2B2YC 3HOUB 2WP8J 1JMLA 3MZ5A 1AZQA 1RF2D 2LFNA 2EXZA 3DM1A 2A6ED 4C3JG 2NVTB 1CQVA 2FJ2A 2JA8B 2K03A 3HEJA 2TSSA 2DNCA 4RKLA 1WXQA 1XLOA 2D5GA 2J52A 5T8IA 4OO1H 1FEHA 1TS4A 2Y5PA 1ZDVA 1OFFA 1IBXA 3FILA 1ONLA 1LTBD 3Q8CA 1HHVA 2PPBC 2LJIA 1C48A 4OIKA 2E3TA 1HTLD 1DCZA 1NVID 2B39A 3S14B 2AX5A 4YSXB 3A8JE 1SF0A 2L11A 5C2TB 3P20A 1IKMA 1PTOF 4IURA 2D5DA 1OXXK 3DWMA 1KNAA 1V97A 4K5XA 1QF6A 2IPKD 1BXTA 5IODA 1WD0A 3W1SA 3ITPA 5EKKA 4KY6A 3D6WA 3NBIA 3GTGB 1V1OA 3N9YC 4YTNB 4FXGC 2F0FA 3Q23A 4REZA 1EQVA 3ND9A 2RSOA 1QOAA 1EL0A 5KYIA 2JEAI 3KBGA 3T51B 1HTPA 2W55A 4A9AA 2EE1A 1TKYA 3J81E 4K2LA 2HDMA 3SR6A 3Q8FA 3TEWA 4GLSC 4FF1A 3NVWA 3RMHA 1PRTD 2YU9B 3C1FA 4IZ8A 4NAMA 1SAPA 1MSGA 3P1HA 4IN3A 3NZ3A 3ND8A 2SEBD 1LTSD 1SE4A 1K50A 1WWTA 4EQPA 2K3UA 5CMDA 4XYQA 5CV7A 2WXRA 5M5YB 3D4WA 2E74C 3OPOA 4OW0A 5T1GA 3AECB 1FD6A 4RHRA 4D2KA 4YWGG 2JQRB 1IKLA 2D9UA 1E0BA 3HRZC 5DEHA 1C79A 4BS9A 3VR9B 5I6YA 1E10A 3LB8C 1W6JA 1L0YB 5DM63 3FVQA 3IAM1 1ZPSA 4XWTA 3R2IA 4WFN3 1TWCB 2DY8A 2XIWA 4TSSA 2CJOA 4F7XA 1XO3A 1HA5A 2HDEA 4CKCA 1L5PA 1JWBD 3NBHA 1QOFA 1B1ZA 5ELEA 1G6ZA 1BO0A 1DJRD 1T6BX 1JALA 2G9DA 1M8AA 3M3YB 2MJ8A 4FF4A 5JAVA 5J39A 1UEAB 1SNCA 2F0OA 4B0EA 2OHFA 4C7YA 3PUXA 2K7VA 2C9OA 1OXUA 4JWSC 3K7AB 5JOBA 3ZJVA 1NCVA 3S2HB 1L4ZB 4IFDG 2WXPA 1TQOA 1PLFA 4ME5A 1KF6B 1QNUA 4H0LC 2X6GA 4Q0FA 1EZ6A 3KWVA 3Q0AA 4KN4C 4KY5A 3CRKC 5TSSA 2LGIA 3N52A 1SE3A 2TMPA 4KTAA 1OXVA 5CORA 4FXDA 2DWQA 2R3ZA 2F0PA 1SE2A 5JJZA 4EQNA 1JICA 2WXHA 4B9XA 3LNNA 4HSVA 5M5WB 1HZ6A 4KGSA 4A3BB 4BBRB 1GJXA 2RMMA 3EFXD 3QOLA 1HQRD 3Q69A 1AW7A 2B2UA 2PW5A 2L52A 3ZGZA 5JPNC 1J7BA 3J80L 5D65A 5COYA 3VYSA 4RH6A 5KGUA 4UDUC 4CHTB 3S2DB 1F9SA 2PO4A 4IUQA 5C5LA 1SNPA 2JE6I 2PIAA 1ZOYB 1STBA 4OZBA 2JZPA 1V43A 2FHTA 1CZGA 3AE4B 3NPPA 4C56C 1JCKB 1YJIA 5BN5A 3OIPA 2PCFB 3MFGA 1PRTB 5C3EB 3TEYA 1ESFA 1DZ1A 1TKWB 1C77A 2NTTA 2F0MA 1NR2A 3SEBA 5CBEE 1PGXA 4DK1A 1SNDA 3BK2A 1BCPF 3VYUA 3OWFA 1TS5A 1IUEA 1STGA 2MHVA 5C5MA 3DWAA 5C44B 2M2LA 4BWGB 2LHDA 1N61A 1V8QA 1H9SB 1A2TA 1LT4D 4ZUJA 1FRRA 3VA7A 1NEKB 1SXTA 2PKOA 1ILPA 1Z6HA 2K01A 5IGGA 2WV6D 3D8GA 3GP7A 3MAQA 2WP9B 1EY7A 3SK5A 1PFNA 1RYJA 3AE5B 4NJCA 1LABA 2BDNA 2Z8LA 2JYOA 2F0JA 4CQNA 5JVH3 3R3OA 4RGMA 3TN2A 1UWMA 4C3HB 2KACA 3DWPA 4A3MB 1PYWD 4DN4M 1L6UA 1FNWA 1XLNA 5G3LF 3HKZB 1ZE3D 5D14A 3NVVA 2VZKD 1CZWA 3EA6A 2GI9A 2HCCA 3PUWA 2IDYA 3E9SA 1ROEA 1PXUA 5A2QE 2XRQD 1N5XA 3SK4A 3QJYA 2WXQA 1S5ED 3BYTB 3TP8A 2QKIC 4LMQD 2CW0C 5C3JB 3D4DA 1PTOB 3DWGC 1EM7A 1QILA 3MC0B 4QMGA 1STHA 2Q8RE 3T4AC 1AEXA 3AB9A 1ZEQX 5C0XG 2XWJB 1K8OA 1I50B 3NE5B 5T1IA 3RFZB 1VZ6A 1EY8A 4L63B 4DXFA 1UUPA 4L6TB 2N55A 5EBDA 1BCPC 2F1MA 3NUCA 1JC7A 1L4DB 2E2JB 4N58A 5FR3A 3DEOA 5IT9L 2JSOA 2MPMA 3I3CA 1WVLA 2JXTA 4KHZA 1XTCD 2L83A 4RF0A 4YSZB 4BA2I 3AE1B 4OZAA 2K0PA 3H6MA 4C3JB 2AUJD 2M0AA 4WJWA 4ZKCB 3A8IE 3K5NA 1FIQA 5D7GA 2EZVA 4YSYB 1U4RA 2AUKA 1B9NA 5CV6A 3MVVA 1I4XA 1QOBA 1F9PA 2CHBD 2HCIA 2EYMA 2INPE 2KHSA 4WIPA 1C4QA 3A7LA 4JX1C 1JOKA 1FFVA 4EE2A 1SYFA 2JP1A 3ERQA 3CU7A 4OHJA 3OWEB 3WCQA 2N88A 1SYDA 3P4QB 2ENBA 1EYCA