4RH6A

2.9 angstrom crystal structure of putative exotoxin 3 from staphylococcus aureus.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
189
structure length
187
Chain Sequence
SESELKHYYNKPILERKNVTGFKYTDEGKHYLEVTVGQQHSRITLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSNSVQYIDYINTPILEIKKDDVLKDFYYISKEDISLKELDYRLRERAIKQHGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.9 Angstrom Crystal Structure of Putative Exotoxin 3 from Staphylococcus aureus.
rcsb
source organism Staphylococcus aureus subsp. aureus col
molecule tags Toxin
molecule keywords Exotoxin 3, putative
total genus 57
structure length 187
sequence length 189
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rh6A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rh6A01
3MC0B 1I4GA 2XNAC 2G9HD 2AQ1B 1RD9D 3URYA 4RFBA 1YN4A 1LT4D 1EEID 1D6EC 1PRTC 1I4PA 1T5XD 2CHBD 1JCKB 1UUPA 1F77A 2XN9C 1LT6D 1PTOC 1AN8A 2XRSD 4RGMA 3MFGA 1SJHD 1S5ED 5FKAC 1LTTD 4RH6A 4L6TB 1TY0A 1L0YB 4UDUC 1XTCD 2ICIA 2NTTA 1TS2A 4ZYSA 1AW7A 1UNSA 1LO5D 3BVGA 1S5CD 1PYWD 1PRTB 3W2DA 3BZDB 1I4RA 3DWQA 2QILA 4Z9CB 5FK9C 1PTOB 1SJED 2RDHA 1CHQD 1I4XA 1BCPF 1LTAD 1S5BD 3DWAA 1KTKA 1PTOH 1TS3A 1DYQA 4L63B 1LTRD 5D3IB 1LLRD 1ESFA 1HQRD 1S5FD 1BCPD 1XXGA 1JWUD 2IPKD 1GOZA 1JQYD 2RDGA 3EFXD 4RHRA 3CHBD 5ELBA 1HTLD 1PZJD 1D5MC 3OWEB 2QEJC 1ET6A 1FNUA 1FNWA 3BVMA 1PRTD 3R2TA 4RGNA 2IJ0A 2WV6D 4K6LA 4RGOS 4TSSA 1MD2D 1SE4A 1PTOD 4OHJA 5TSSA 3SEBA 1RDPD 1SE2A 1CHPD 1YN5A 1LTSD 4DXFA 1BCPB 1SE3A 1SBBB 3BYYB 1CT1D 1LTGD 1FD7D 4RGTA 4RHSA 4BWGB 1KLUD 1EFID 1SEBD 1PZKD 1TS5A 5D3DA 5ELEA 5ELFA 2XRQD 1EWCA 1M4VA 2AQ3B 3TSSA 2AQ2B 1TS4A 3BYTB 3R8BA 1LT5D 4RCOA 1BXTA 1JR0D 1SXTA 1ET9A 1G8ZD 1TY2A 3O13A 3R2IA 1CQVA 1KLGD 2SEBD 2TSSA 1YN3A 1RCVD 1LTBD 1FGBD 1LT3D 1EU4A 1JWMD 4DXGA 1V1PA 4C56C 3V05A 4O1NA 1I4HA 1RF2D 1V1PB 3GP7A 1HXYD 2O2LD 3KLSX 3EA6A 5ELCA 1L0XB 1STEA 1V1OA 1CK1A 1I4QA 1PZID 1PRTF 5ELDA 4NZLB 1B1ZA 1QILA 1S5DD 2Z8LA 1BCPC 1EU3A 1PTOF 1ENFA 2NTSA 1JWSD 1D5XC 1LTID 2R61A 5I4DA 3DWPA 3BVZA 1EEFD 2J4XA 1B44D 1D5ZC 1FNVA 1HA5A 1DJRD
chains in the Genus database with same CATH superfamily
2K22A 3UDIA 2M56B 4H02A 1Y8NB 3D31A 2V1CC 2CWAA 1LQBA 2F0SA 2JPHA 5LL6X 1WJ6A 2LJ5A 3ZJTA 3NWTA 4JV5L 5F2DA 1WCMB 2MO1A 3PF5A 4DR3L 1VQCA 2PMZB 1KQSA 3I4OA 1ASZA 1K8AC 2Z0DB 3DVNV 3MAQA 1QOAA 1T5EA 2XTIA 3NQIA 1ZDVA 3L0OA 2F03A 4BBNF 2E6XA 5COYA 2EMSA 3Q0AA 3BINA 2RQXA 2N88A 3IL8A 1F2YA 1MHXA 4ULLA 1J8CA 1YIWA 2A6HC 4H44C 4DR1L 4XDXA 2OT2A 4ICUA 4LF8Q 4NMZA 3CD6A 1K83B 1WGDA 3EVQA 3I73A 4M8AA 2DENB 2ZCBA 3SHQA 2B2VC 4WQMA 5DPTA 3DWMA 3GQBA 4WORA 3X3MA 3C19A 4IOAA 1VQPA 3RNEC 4RHRA 3SK8A 1JW9D 3TIXA 2FBWB 2K6AA 3PO3G 1STNA 1JOQA 1IKMA 2IZVB 2EDGA 2OOBB 3AEEB 1N34Q 4ANXA 3A9KA 3DBLI 2MX2A 5GXGB 5HURA 2HJ1A 3TMPB 1PH3A 2PZUA 4A3KH 5D94A 3WANA 2Q8TA 1ZXHA 3I8ZA 1YBYA 3HKZB 3DXJC 3K9OB 3V2TA 1MFWA 1V9PA 4CJ1B 4A3EG 1WXMA 1Z6HA 2CHWA 2LGDA 4KTAA 1BCPB 2R93G 4RG1A 4BWGB 3L3OC 1SB3C 2KYWA 3SU8X 3TJPA 1JT8A 3HKZG 1EFID 1SEBD 3NVWA 2R92H 1DONA 5GROA 2QCPX 4BY7H 2MJDA 2XRQD 1EM7A 2VRRB 3MHSD 1V5OA 5DPSA 3VFKA 1A3UA 5KYIA 2B2WC 4KKJA 2K75A 2FCSA 4RCOA 3L16A 5IA7A 2K14A 3OTOQ 2LGSA 1WXQA 1WTPA 1RFKA 2TSSA 1TKYA 2FCQA 3KH0A 3NZ3A 4FJZA 3DBHB 4DNTB 4W9FA 1DOYA 1GNUA 2E2HH 3QWZB 4NAWA 4W9DA 2E5LL 3ZVVA 3NELA 1PH7A 3ZNID 1YI2A 2UXBQ 2WDVB 2NBWB 2EYFA 2J7ZA 3A5UA 3AB5A 5C3XA 2DGYA 3PUXA 1EQTA 2Y0SB 2F4VL 2N7JA 3I2ZA 3PIPA 2O4XA 1CI3M 4OWWB 1G2TA 2WXIA 3U9SA 5FLMG 5D65A 1WYDA 5EE1A 4WURA 3HS0C 1Q86C 3I7FA 5KGUA 2K1FA 3MP9A 3NUHB 3VUXA 2CS4A 2AWTA 2F3IA 2RPVA 1L1OB 1HNWL 1N6ZA 3KWVA 2PI2E 3DEPA 2PLPA 4CDFC 1I94Q 1B44D 1FNVA 1SFOB 1TWAB 3MHBA 1P1AA 4JI5Q 5E6NA 1C0AA 4H7BA 1CA5A 4P1CC 2F3VA 5CX3A 1SNCA 4A3OA 5IYDG 3HOZG 4OO1H 2W3SA 1RD9D 4DNRB 3A9KB 4POFA 4BY7G 3M3YH 1EOVA 3HHMA 3Q6BA 2MW5A 1FRRA 1U4AA 2JA9A 1UH6A 3AEDB 1PRTC 2PYKA 3SXHA 2KWCA 1P8LA 3PO2B 2UUBL 3HOVH 1B4OA 1Q0WB 2O2VA 4OZAA 1PTOC 4YHHQ 1HH2P 3DPDA 4US8A 1ML0D 1K53A 3QWNA 4LF9L 1UELA 4IC7B 3CXCA 4E6IA 1NY4A 2EY5A 2BVCA 1X65A 1GUNA 1Q81C 2N4FA 3MXUA 5LL6S 5CHVC 2B2UA 4HJAA 4II3B 2FMMA 5E4XA 3HOUH 1G6ZA 1BR9A 3W9CB 2ZT9C 2HD5B 4GOCA 4EZLA 3I9V1 1M1KC 1DOXA 1YOVB 4XYQA 3S17H 2KJ6A 4IFDJ 1SMYC 5IP9H 2B63G 3L2PA 2Y5PA 4C3JG 3MJ5A 1BCPF 4LF8L 1V80A 3N9YC 2VY3A 4MELA 4L23A 3E0EA 2Q2TA 3VHTC 3B0AA 1PUTA 4A9AA 1GXDC 1XXGA 3CCRA 3VH4B 4W9KA 4DGZA 2RSNA 3STBC 5FLMH 4IFDI 3RMKC 3AB9A 1HTLD 2FIDA 4MSMB 2Y5BB 1RIPA 3RLNA 3H9DA 1OEYJ 2QEJC 3ZTDA 3QHTA 4GKKQ 1I6HB 4GDKA 2Y0SG 4C3IH 2PZTA 4DAYB 1MD2D 2FHTA 2DNCA 3PRZA 2KD0A 3VVWB 1C4QA 4R4QA 2WDRB 3RNAC 3QOJA 1CHPD 3KF6A 3I4NH 4M0WA 1KRSA 2DJFC 5IP4D 3AEVA 4LK0M 2KOLA 3B08A 3GOEA 3HOVG 4FHKA 1C48A 1OXXK 3H91A 2EY6A 1YJ9A 1VF7A 4WJOA 1C3TA 4IM0A 4DK6C 5JH5C 2E76C 1X3GA 2XSCA 1WGHA 2K5HA 3RN9C 3KF8A 1ISNA 4XDDA 1D8LA 4DDID 3I70A 1NI2A 2D3BA 3NXWA 3NHHA 4HJ7A 1KRHA 4YCVA 2WIIB 3HOUG 5IODA 3ZXRA 3QIJA 2O6VA 1CKNB 4UHVA 3HG9A 1NR2A 2QSDA 4LJOB 2V4DA 3LGJA 3MC9A 2JWZA 5E6PA 1A6XA 1E0BA 5GAEC 1N32L 1OXVA 2B39A 1M90C 1C7YA 1CJEA 3JVZX 3VDYA 2F0EA 2R7ZH 1L2NA 1C79A 4ZOHC 1GD7A 1ZE3D 2XGTA 2OXPA 4CHKA 2BQQA 2Z6KC 3FILA 2EYLA 2D5GA 2QCZA 2PMZE 4Y7NH 2GOWA 3RNGC 2PPHA 2HQEA 1U4MA 4ANVA 3AE5B 1EFWA 2NTSA 1JWSD 1IL8A 2K4KA 2R61A 2H88B 2KWVB 4ICVA 4MGKE 4L5QA 5K36G 4LDTD 4FXDA 3QA8A 4P74A 1ZYRC 1KNAA 4JI1Q 4R1JA 2ZW1A 1VQ9A 2EXZA 1IW7D 1I4GA 2CQOA 5HI1A 2XNAC 1MJCA 1SYEA 1VQ5A 1F2RI 4OIJA 4RFBA 2KAJA 3DOWA 2VUMB 1E7ZA 2KTFA 4X3UA 3DDCB 2BCOA 4X66L 3AE7B 3PV0A 4FXGC 3P1MA 3ZNZB 2XBBC 3J7YW 1KJTA 1JC7A 3QR8A 4L6TB 2JQRB 2L4NA 2WQYB 4NXNQ 4LF9Q 1WZ3A 1A62A 5G2NA 3W3AA 1MGSA 2O5JC 2N0SB 1TKEA 4F8CB 4ODGA 4HWIB 4Z9CB 5LMUL 3UE0A 4IPDA 1SJED 1W6KA 2SDFA 2BF8B 1DGSA 1HJPA 1MI2A 4KJOA 5CBAE 3KOJA 4PMWA 1L0VB 3L54A 4K3BA 3ICEA 2B2TA 2IL8A 1KL9A 2KT7A 1ENCA 2EIFA 3FPPA 5C4XG 5C4HA 4C2MB 4A3JH 2CHXA 2REXA 2VQFQ 3UQAA 4ZKCB 4IURA 2KDBA 4G7ZC 3K81C 1E9MA 4YTPB 1C78A 3JAML 2A4ZA 1N9WA 3GDEA 5I9PA 2VUMG 2HTHA 3RUIB 4TSSA 4YHHL 5HGQA 1IYVA 4K2LA 3TEXA 3Q8FA 3OJ4B 1DCZA 4HSPA 1ICFB 4H13C 4LAAA 2O2VB 1RDPD 4IJHA 3M85A 1WM2A 5BMHA 1CT1D 4KKSA 1FD7D 2K52A 1UF0A 2JUOA 1WTHA 4GOPB 1G2SA 3M9BA 5D3DA 3I90A 2VNUD 4ME5A 3NQTA 3F2DA 2HHHQ 2BYFA 4OZCA 2XWBB 3HVDA 3J81c 2ZZPB 4RM8A 1KDCA 1HR0W 2YVCA 3BZCA 5EBCA 4XQJA 5JOBA 1JOKA 4YWMA 2HCIA 1E1TA 4DR5Q 2OF1A 2V3SA 2NBUA 3O13A 1SDFA 3R2IA 2RCNA 2BB5A 1KLGD 2SEBD 5I2YA 1NI3A 1VR9A 2PW7A 1DD2A 3VR3A 1YNJD 4B9XA 1L4ZB 3AU5A 1ZKOA 3EQLC 4L5RC 1OQRA 2FCNA 2KANA 2WXGA 1C9FA 1ONLA 1J9OA 1F9PA 3T16A 1N32Q 1H9SA 2B2TC 2OTLA 1FYCA 1Y69U 2A5HA 3P42A 2O2LD 1S3OA 1UAPA 4D2KA 3VYTA 4FXCA 3H94A 4B3RQ 2I46A 2SNMA 4Q2JA 1WFQA 3UE1A 3FP9A 1CFMA 2MJ3A 4NPSA 4G50A 4GSWA 2KCMA 2D9UA 2VZKB 4DPGA 1EUJA 4UPAA 2FMCA 2Z1CA 4LF7Q 2JXXA 4PV1C 2RDFA 4BY1B 2C9WB 1VCIA 1Q1OA 1SNMA 2UU7A 2A69C 4JLCA 4JI4Q 3M4OH 4FN2A 1V6EA 2EYPA 4Q0FA 1WJ4A 3FEWX 2KC2A 2KDFB 2LRUA 3RNUA 2UUAL 1MG8A 4IUTA 1NDDA 1YN4A 3ERSX 5KIXA 2Z0SA 4KN4C 1P16A 3VR9B 1PH6A 5CV5A 1I35A 3S1NB 2OJRA 2PKOA 3JYUA 4F88A 3OJ3A 4LF5Q 1AN8A 2JQOA 4ITKA 2GN5A 3WOEA 4KD4A 3S2DB 4NPNA 4B08A 1PH4A 1MVKA 2A69D 2DYOA 1MHWC 4FXKC 1D2BA 1EF1A 4KGRA 2I07B 4A3DH 1YHQA 4JI2L 2DJGC 2F0PA 4R4TA 1UNSA 1A3TA 1B8AA 3TMEA 1OTRB 2W54A 3ALBA 3U52E 2IX0A 3B2FA 2AWOA 2FXQA 1WTWA 3A33B 3LNNA 3GTOB 3KLWA 2WKDA 4TKNA 3S1MH 4CJ2C 4GB9A 5CHFA 3JAMi 2OHFA 2WXHA 2L12A 2RHSB 2CW0C 3J7AV 1GUTA 1G51A 1OTCA 4OGQC 4A3MH 1L1OC 1H9RA 3PO3H 2FUHB 2WXFA 1JE4A 2M1MA 1YVCA 2WP9B 3MTNB 4A3FB 1NNXA 1BUVT 3N52A 1IBMQ 3HOYB 2DZMA 2R2OA 4HCPB 5DPWA 1ROEA 3GTQH 2L76A 1CZWA 4LJZC 1U0LA 2YTVA 1YEZA 3GTGH 3A1QA 3DHQA 1KNEA 1WTRA 5AZGA 5IO9A 1E10A 3PZ8A 4AQ7A 2F0FA 4GOPC 2WXQA 3J7ZC 2F0LA 3M62B 5JVG3 4A3EH 4IPHA 5C4JB 3R3MA 2HDMA 1NYQA 3KF8B 1C8CA 1IW7C 1QZHA 1LGRA 4DUZL 4WJNA 3RZOH 3U4ZA 1WFYA 2A6EC 1V8CA 2IWHA 1SBBB 3NBHB 1ZKHA 2JRHA 2KVMA 4RHSA 1CUKA 1PDQA 5EPLA 5M5XB 2KMAA 3SK6A 2WLBA 3GE8C 4WAAA 2MO0A 3T51B 2GBJA 4II2B 4MM3B 2JJQA 2C60A 4OVUA 4P7IA 3E9SA 3OOCA 4WJQA 4OIKA 5J22A 2ASBA 1VDVA 1SXTA 4EZKA 4KKIA 1X32A 3FDTA 4LF6Q 2WXNA 2M9VA 3DHGC 3VDZA 4ZYNA 2D0PA 2IW3A 2EPBA 2F4IA 4AIMA 3ZDMC 2MCNB 2A6ED 4BKGA 1KM7A 1YN3A 4L1BA 5FO8B 3RYTA 4LF6L 1XLOA 3GB1A 4KHZA 2RSOA 4A8XC 4ARIA 4BA2I 1VQNA 4YTMB 3ULLA 5KNDA 4DU9A 1O78A 3UI2A 4QAYA 1KF6B 2CCZA 4C3JB 5C0XI 2JA5H 4M1UB 5M3MB 4LNQA 4DNIA 4PYUA 1FCCC 4FA6A 3H7PA 3PMFA 3OLMD 1STEA 1T3QA 1PZID 1PRTF 3AFPA 4ZQ3A 3PVLA 2J0JA 1B9RA 4G3XB 1XCQL 3IT6B 3RR5A 1PTOF 2XEWA 3CMEA 1WSPA 3PREA 3S15H 5GMVA 4DV0Q 2F52A 4FF4A 4KHVA 4J3OD 3DWPA 1FPYA 2I2YA 2YU9H 1TZ1A 4G4KA 2SOBA 1WI0A 1NJIC 3LX0A 2L0TA 4DR4Q 4GDLA 4NP5A 1YNJC 3TBLD 2BPSA 4JI3L 4X64Q 2A73B 4YXDB 4DR6L 4B3TL 3P20A 5H92C 2GI9A 3BG3A 1EWYC 1NUCA 2IO2B 4DAMA 1EUVB 3IT4B 3IXSA 4JPSA 2L0FA 1JMLA 2UU9L 3ZRFA 1R4MB 3PCOB 3RUZA 4NAWB 2KMCA 2L15A 4J1MA 3RNBC 1LTTD 2DZKA 2K8BA 4EQPA 1TY0A 1XLPA 2O5IC 3EN2A 2ALYB 2G5DA 4B3RL 4LFCL 3JW0X 3A4SC 4EX5A 1UWVA 3RZDH 1UWXA 2EYMA 3CMAA 2BDNA 2E2IH 1S1QB 1E8YA 1IGDA 3N32A 4XT3B 4RA8A 2BWFA 1Q12A 1C77A 4M00A 1E7UA 1QUQB 1E2WA 1GUAB 3N1ZC 1LTRD 1SYGA 4A3GH 1I5FA 4X65L 5ELNA 4PS8A 2WX1A 1VMCA 1FEHA 4A3JG 1MI0A 2E3TA 2ON8A 1JWUD 2IPKD 1A70A 4RMFA 1SF0A 4KI0A 2K28A 4JVZA 4UP9A 1FXIA 4A3IG 3A0JA 2F0JA 3MXGA 1HQMC 3TP6A 1SSNA 2L0CA 4NDXA 4DV2Q 2IX3A 1PRTD 3PZ7A 4LNNA 1CQFA 5AUIA 1TWFB 2RVLA 3NOBA 3EBEA 1BBUA 4GMVA 4LNFA 1TWCB 4RM9A 3PIOA 4DHZB 1JRPA 4IDIA 4I7AA 5TSSA 3FRPB 2IGGA 4ANWA 2V4IB 1NENB 2LI5A 1B9MA 3U58A 4DUYL 1GUOA 1BNZA 3DHIC 4JW0A 2WAQB 4C3HH 5IP7H 2JE6I 3AE6B 3VYUA 3QO2A 4RGTA 5C2TB 2QDLA 1DGJA 2MP2A 2HE7A 4BBSG 5ELEA 4U673 4YL8A 2ZNVC 4J6IA 3H3VC 1RTOA 3DBLB 1R7SA 4DV6Q 2AQ2B 4BA1I 2RDBC 3DUZA 1VQHA 1O7LA 2D07B 4K81A 1ET9A 3UDXA 4B3ML 4EQOA 2UUBQ 4EE2A 1A2TA 4QY7A 3BK1A 3QARA 4XE0A 1YX5B 2IX1A 2QDFA 3JSVB 1QVFA 1IBML 3KYCD 1TWHB 4ACFA 1LTBD 1YHAA 1TBEA 2EZVA 1B3QA 5E6JA 2LGIA 5GAHC 3Q6SA 5DCNA 4DR3Q 1EU4A 3GV3A 4WJ3M 1YHBA 1NCVA 4DXGA 4YT0B 1WWTA 5CV4A 1TGZB 3CCVA 2JYTA 3PS6A 4PYZA 5JHBA 2F0UA 3JC66 4WQOB 3CCSA 5A2QE 3PLUA 3KLSX 1HPCA 1KH0A 2JU6X 4QCLA 3AECB 2M00A 3GTLH 3KF6B 4M0WB 4A90A 3S1RB 1RFAA 3T1YL 2NVYB 4BS9A 5CC4A 1JB3A 1QILA 1OEYA 4CJ0B 1WVLA 1BCPC 2EYHA 5E7NA 3TDQA 3HOWB 4KIKB 1F2RC 4A3FG 3HP3A 2DUDA 3F2UA 4NW2A 3KJPA 5T1IA 3BVZA 2INPE 2WGSA 2I1KA 1SRUA 4PQXA 1XPUA 2BYEA 2EY1A 1L7YA 1ZPSA 2UWQA 1BVSA 4MZ9A 2B8FA 4HIMA 4ZK9B 2TMPA 2B2YC 1HTOA 2KWUB 2LHEA 5FLXE 2NCNA 1VDZA 2J0TD 1LT4D 3B2GA 1SYDA 5BN3A 3VTUA 5NUCA 5CMDA 1T5XD 1X3EA 3K7UC 4G7OC 3BY4B 4HKQA 3GE3C 3QOLA 4HPLB 4KGSA 2IY5B 4KIKA 3KW5B 2IY1B 2NVXH 1IP9A 4S17A 2ZVNA 1SJHD 4YSYB 2WB1E 4GN3B 3NE5B 5IT9E 1STBA 1LABA 2R3ZA 2LUEA 3N1YC 3ERQA 4ZYSA 1FIQA 3NPPA 1NVID 5G5HA 2BGFA 4F7ZA 3CQZB 2GRIA 2MP1A 5C44B 3UIPB 3S2HH 3UDFA 3DWQA 3V3XA 5JAVA 4GKJL 2KX0A 5JJKA 3FHWA 1NBFC 4IWQA 5IOIA 1QLBB 3AQQA 4R8IA 3M3JA 1E8ZA 2BKFA 3U8ZA 5EE3A 1SMXA 1CKMA 2K3UA 5K5PA 4NXMQ 2AHOB 1ESFA 2OEDA 4JI3Q 4P16A 1MKHA 2NZHA 1K0RA 5JVH3 4RCNA 4OEMB 4KV2A 1QJOA 2EQSA 4HAEA 4K5XA 1QVGA 4OX9Q 5J18A 1PH2A 2DYMA 4JI6Q 3DMUA 1ET6A 3BVMA 4HMIA 1IBKQ 2JXMB 3U7ZA 4MIUA 1WGYA 1RL2A 1QOHA 1R4QB 1YX6B 3VUYA 1HRJA 2MGSA 1VQLA 3IFWB 2JA8H 2F4VQ 1C4PA 4O42A 5C3EB 3PO0A 4LTUA 3UIOB 2BS3B 4LFCQ 3MFYA 5M3FB 3ZGZA 1S3SG 3PV1A 5ELFA 4JI1L 1PGAA 2GBMA 1D7QA 4IWOA 3J80L 2Z59B 2ZM6L 4ZUJA 3U30A 4KDIC 4P75A 1FR3A 3S1QB 1V81A 4IOIE 4X65Q 4YCWA 1FGUA 3NS1A 5BYRA 1S72A 2KFKA 4HPPA 1NYRA 2GA4B 4X66Q 4ZUIA 3GTPH 3J7AF 1WRDB 2UUCQ 3WA0A 1HFNA 1GKHA 4K5VA 2HD3A 4LF4L 3D3RA 5M5YB 3GZNI 3S2AA 4WJPA 3DEOA 1JJGA 1V1PA 2UUCL 3GTJH 2BWES 4C56C 4OVVA 1P9DU 2VZKD 5C44G 2N3SA 3K0YA 4DBGA 3TRZA 3A7AB 3MVVA 5FOBB 4MTKA 2NN6G 5EKIA 4A3LH 4A55A 2KFJA 1R4NI 4L5TA 5C1ZA 5KNCA 1X3FA 1UE7A 1B3AA 4NZLB 1QZGA 2Z8LA 4IFDH 2JSOA 2NPTB 2NWGA 4HR7B 3HKZE 4O2DA 1N8RC 1QWYA 2HTME 3IAM1 1WI5A 1TXYA 2VQFL 3BDOA 1FFUA 4EFOA 4I6LB 4R8NA 4B3SL 1IL2A 3TP5A 2KQ7A 2E75C 4PS7A 1HA5A 2R92B 3TP8A 2RPQA 1A2UA 1U4PA 2ID0A 4BY7B 3H7SA 4HPMB 1VQBA 4B3SQ 3LDZE 4HROA 4BOZB 2Q2UA 1A63A 3T56B 2IDYA 1XF5L 2G9DA 3P2BA 4GN4B 2QKIC 1A0IA 4HSVA 1EQQA 1LTLA 5IIFA 2AYOB 3FKYA 3A4RA 4OO1G 2HDEA 1FL0A 1NBWA 3JAME 1QVCA 1Z9FA 2NMQA 4XWWA 2V0GA 3DWGC 3TCAA 1RM6C 2LVQA 3I63C 2KLCA 4ABNA 4UDUC 3WAPA 3P75A 1ZDXA 2CJOA 4W9CA 3LJ3A 1F2LA 2VL6A 3BVGA 3AMUA 2WAQE 2Z4IA 3SD5A 4GLVB 4AP4C 2B63B 1YNTE 3G71A 4PG3A 1N62A 4OWTB 5I2XA 2WB1G 3SVMA 1LFDA 2LFIA 3D4WA 4FJYA 3NTKA 3IBEA 2M0XA 4EOYA 5DPRA 1LTAD 2ZJDA 1XLQA 3ZJVA 1R9TB 1V1QA 4AQYL 4B95A 1HQRD 2N8NA 2HDLA 3C46A 3KQ4A 4HRSA 3NHEB 5D6JB 1X3PA 2CJNA 4APVA 1WIAA 3L13A 2LMCB 1VQ4A 5T8IA 1V8QA 2PMVA 2JXTA 2ENBA 3HOZH 3BWUD 5HG2A 3RPFC 3WAMA 1SFOH 1NSNS 1N63A 3NY5A 2WV6D 3Q22A 3OIQA 4YY3L 1UEAB 3H0GG 4W9IA 3LWEA 4AUQC 4CYEA 4HEA1 2KMMA 4A6QA 5IWAL 3A9JA 4KX6B 2LVPA 3T8MA 1Q90A 3TN2A 3DBRB 3PO2H 3D4DA 3HOVB 4DXFA 1TR5A 4CKCA 2W3RA 1CSQA 4GZYC 5IAAC 4KJNA 1ZW7A 2PE9A 2LGXA 4F87A 1WTXA 2AEHA 4GKJQ 3ZUNA 2PNRC 4AYBB 2GVBA 2KQ3A 2J42A 5FJ8H 4KY7A 4FF2A 3KJOA 1JR0D 3HOUB 3PUWA 4IUVA 4ZHPA 1OO9B 5C0XH 4MH0E 4XXEA 3EC8A 2PQAB 2JA7B 2HQLA 5CTRC 3RNCC 1WYWB 4QF4A 4A3BH 4OX9L 2A1AA 1Q8IA 4YWKA 5JJZA 1E5WA 4LJPB 3TP7A 3D0FA 3V05A 2WXOA 3D6WA 3W1SC 1SYCA 2WB1B 1J0GA 4CKBA 1CKOA 3CCEA 1N34L 2C7NB 4ZRJA 4HJ8A 1DOKA 4BBRG 2NVQB 4NAMA 1ICWA 2A6HD 1IHZA 1B2TA 1EIHA 3EJIA 1L4DB 3H15A 2R7ZG 1P98A 1ZUD2 1K73C 1RRBA 1X56A 4XIGS 1TQOA 1F9RA 3H0GH 4JI0L 1X1MA 4KZ0A 1C1YB 2KJXA 1XPRA 1C76A 1EIGA 2ZM6Q 2CW0D 1IKLA 5BR8Q 3BZKA 1EIFA 1NR4A 2J4XA 3U7DA 1Y1VG 2R93B 2WACA 3VYSA 2VH1A 3G48A 2I5MX 4HCEA 4CHTB 2W55A 2L1BA 1EWHA 1HZAA 4A3IH 3GV6A 1DOIA 3J81j 1DM0B 2D11A 2I5HA 1PLFA 2G9HD 4DAYA 1PHJA 4BXXG 2KTRA 3NVZA 4RAUC 4A76A 4A3PA 5K36H 1V2YA 4N58A 4EQ5A 4TVAB 4ZKBB 3M4QA 3AH7A 3EUB2 2KHWB 1I4PA 3OTOL 3CC4A 1DZ1A 1G91A 2R7FA 1SYBA 3SK4A 2L55A 1L5PA 3MJWA 3GTKH 1VF5C 1PA6A 4JYAL 4RKLA 3Q8AA 4LNIA 4JC0A 2GLSA 3OWFA 2PNHA 4C3HG 3OG5A 4LFAL 3DBSA 3KLRA 4JYAQ 2L7RA 4MJSB 4JK1C 3FKIB 2K9XA 4KGTA 1ENAA 1I50B 3G4SA 2LXJA 4IUPA 4I6PA 4ILWA 4WFN3 2MH7A 1JICA 3BZDB 3OIPA 4V0BA 2K6QA 5I6WA 2INNE 3WCQA 1FFVA 2QMTA 2CR5A 2Z0EB 2QEXA 1I4XA 1ILPA 2IO1B 3CF5A 1KTKA 1PTOH 3CC2A 1DYQA 3CAMA 4Y7NB 1CTMA 1WGGA 2D3AA 1A8VA 3VR5A 2K39A 1EY7A 1PYSB 3ZIMA 5C23A 1TYGB 1JQYD 2RDGA 4IALA 2CKHB 4FULA 5IT9L 4K0KQ 1ZGUB 3DVNU 1K0SA 3FVQA 3C2PA 2B8GA 4C4VA 2Z4HA 2E2JH 2D62A 2MNAA 1VCBA 3VYRA 3SK5A 4GS3A 2IJ0A 4GOPA 4R4OA 1O80A 4XQNA 2J7QB 3CMMB 5C3JB 3KLSA 4F8MA 1KRTA 4BBRB 2NYZD 4QUCA 1BMLC 5C5MA 1V86A 2C7HA 2MRPA 2L52A 2N9EB 2B3GA 3PGZA 4BBSH 1SE2A 2WDQB 3PGEA 4LLGM 4RF0A 4EEWA 2LKVA 4A20A 2VUMH 1YN5A 2L1AA 4X62Q 4A75A 3ABVB 4IM2A 4K3CA 3ZQ4A 5AJ3Q 1LTGD 2Z6KA 1QF6A 2WAQG 1EY6A 5AFWA 2KVZA 1WZ0A 3APCA 4DHJD 1ZXIA 2JT4B 3I3CA 4OO1I 3CRLC 2LRWA 3Q3FA 3AV8A 2MQHA 2X38A 4N6EB 5DNFA 3R8BA 1NMGA 1QT9A 3L0WB 1U5KA 4P2CB 1C9OA 4JPBW 1FRDA 2QF7A 2ACZB 1RWSA 1FJGQ 2C5CA 3K7AH 2UU9Q 3FAHA 1EYAA 4K2KA 2G3QB 3STBD 3HOXG 3ZRCA 4WWMA 1LT3D 4QIWE 5GQOA 5C4XH 4IUNA 4DV4L 4C7ZA 4LUZA 2F0KA 2MPMA 2NN6I 2ZVOA 3C0RB 1CM9A 4KK7A 4JBJA 3IRBA 5H1SE 4W9LA 2N49A 1WMHB 1LM0A 1WM3A 1QG7A 2JWUA 4OL7A 5IWAQ 3I72A 1TT2A 1UZXB 2KKCA 4QB4A 4XX5A 3KDFB 1CSPA 3Q23A 4GKKL 2NS5A 5CV7A 2BKRB 2J52A 3EFUA 3HUIA 4DWFA 2BA1A 2K01A 1HZ5A 3WWVA 4TMAB 2C7MB 4IFDG 5EE0A 4LF7L 2KDEB 1L6UA 5I4DA 3KUZA 1TWAH 3GTMB 1PMRA 4PNYA 1HNZQ 2BS2B 3D32A 1EEFD 2DBYA 1EYCA 1NAPA 2IGDA 4LCDE 4NKLA 3M3YB 1Q1BA 5FLXc 2UUAQ 2B3AA 3WDNA 1XNRL 2Q2IA 5AEKB 4FF1A 4REZA 3CCQA 1Q1EA 2MSED 1SGHA 2A74C 3CPFA 2LASA 1VS0A 3TEYA 2RHQB 3V6CB 1F77A 3HZXA 4RGMA 4NXNL 5L95C 1HZCA 4JOIC 2JA8G 4TUUA 4JI2Q 5CR3A 3RZWC 3RMHA 4ALPA 1B50A 4ZRPA 3WALA 5BMIA 2D5DA 2NTTA 1TS2A 2XVSA 2G4DB 5C4ZA 5LNK1 2DWQA 2K05A 1PRTB 2JYOA 5EPKA 3W2DA 4NQLB 1JJ2A 3KBGA 3U50C 1I4RA 2EVBA 2I5LX 5M9OA 4LFBQ 3OMGA 1WX7A 2XK5A 3UINB 4B0EA 1CA6A 1Q46A 1CHQD 1KXLA 2YYZA 2EKIA 2PQAA 4HN7A 4IJLA 1AH9A 1CKNA 4X3KA 1PGBA 2F0QA 3HOXB 2L32A 4MTNA 3S14H 3ZO5B 1A15A 1SLJA 3K80C 2JA6B 3N20C 3PHXB 3T9LA 3B9JA 4AS1A 2QJLA 1ZYRD 1Q3LA 3HOWG 2ICEC 1AWDA 3QAQA 4C3IB 5IYBH 1WXAA 3ML9A 5BO4B 4WRDA 3OWEB 4K0KL 3K5MA 1YJJA 1XD3B 1FO4A 4Y52H 4NJ6A 1QE6A 3I4NB 4KHPL 1Y1WH 2MJ8A 3NP8A 4N8FA 4RGOS 3ULJA 4H2AA 5JPNC 4YSZB 5D2MB 4IG7B 2AUKA 1AEXA 5J2RA 2VB2X 4YWLA 1EQRA 2BBCA 4MHEA 2KJRA 2SAKA 2NVTB 2ONQA 2K03A 2V3PA 2ZW0A 4HMJA 2EMTA 4TQ0A 1N33Q 2DZIA 5GADC 3S2DH 1EY5A 4CBVA 1YJ1A 2MWSB 5ISRA 1QOFA 4DR5L 4MGIE 4LW1A 1C4CA 5KYLA 1ESRA 1X54A 2VS1A 3SFDB 1LT5D 4IPCA 2GBRA 4AH6A 4HJGE 2K6DB 3ZJYC 3N6RA 3IKJA 3GS2A 1WMHA 4EVOA 2N7DA 1CQVA 4DAVA 4HIOA 5ELOA 1F9QA 4RMAA 2XIWA 2EY2A 2EELA 4K1RB 3K5NA 3Q24A 3PSEB 1CZGA 1N61A 2WP8J 3D4RA 2AX5A 2D3GA 4AJYB 1GHKA 1ASYA 3RD4A 4A93H 4DR7L 1P7FA 4A3LG 3BJUA 5G55A 4K7UA 3CP0A 1WR6E 2FJ2A 2V9HA 2F0IA 4MJSA 3H6NA 1J19A 4L5SA 4XT1B 5IP9G 4YTNB 1B70B 1I4HA 1X55A 3RN2A 3PRPB 1HXYD 3H09A 1BUIC 1WX8A 4BVUC 1VQKA 4WIPA 1P0RA 4GGQA 2KHSA 3MEHA 2PEAA 3ZDTA 5C4JH 2JA5G 4DV0L 1S5DD 2WKCA 5T1GA 1SN8A 4HJ5A 1PFDA 2IGHA 2PO4A 2BTEA 1OXTA 3NEMA 1K3RA 2RBMA 3G7LA 1LTID 1YIJA 2ZNVB 1HZ9A 2H1EA 1H95A 4IKGA 3KYDD 4NNJB 4M02A 4KD3A 3VTVA 2KCNA 1JWAD 1V9JA 3OW7A 5CORA 2HHHL 1J6QA 3H7PB 3TL5A 4HIDA 2PW9A 4MH8A 3R7RA 1XNRQ 1VZ6A 4QJFA 1Y1VB 3MC8A 3RD2A 2NPTA 4DV4Q 1YITA 2WYQA 4DV2L 4BZAA 2W9NA 3W1GA 1WE6A 3CCMA 2XN9C 2WU5B 3MXNA 2F1MA 3PIO3 2CU1A 3AEAB 1WCMH 3EGRA 1K8MA 2V3NA 3S16B 3AN1A 5D7GA 4AOFA 1IXRA 1V97A 2G4SA 4JGHB 4ID6A 3FC4A 4XWTA 1JOOA 4KMUC 2KEEA 4FF3A 4QIWB 1Y8OB 3RLFA 2BE5C 4GNXB 2FE8A 1P3QU 2N1WA 2ZXOA 1SROA 4P73A 3C1FA 3CWIA 3J7A5 2QILA 2CQAA 2E8GA 3R93A 1JALA 4ASWC 3QIAA 4DV6L 3PPAA 3ER0A 5C0XG 2M19A 5HY6A 4ZRIA 3GO5A 4CO7A 1M94A 3K5LA 3DBHI 2JP1A 4DA2A 3HRZC 1I7HA 4IM3A 1S5FD 1BCPD 2V4LA 3X0WA 3CHBD 2ZTEA 1PZJD 2H4OA 1HUMA 4A3GG 3ZTCA 3ZW3A 5J1ZA 2YEPB 1XNQQ 4OZBA 2L05A 5EDSA 4A4IA 5KHQA 2K5QA 2KTRB 3HRDD 1JJCB 1EY4A 3A1QB 5LMNL 2C9OA 3K58A 2KWDA 1EZ6A 4BFRA 2PVGC 4LDTB 2PW5A 2CU3A 3FILB 3A74A 5FJ8G 5JEAG 4A3KB 1JQ4A 3U9OA 4P72A 5M3FG 3N1XC 1HEZE 2EYJA 3IG3A 4AYBE 3QJZA 3EIVA 3EHVA 4DV1Q 2GBKA 4R4IA 1PH8A 2J0KA 1QZEA 2DYBA 2AQ3B 1QQRA 4FDBA 2WXJA 3DQVA 4N8X1 4A3BG 1TKGA 2J0MA 1AE2A 2IYDB 1BBWA 3RZDB 1FM0D 3AU7A 1KFYB 2ZPYA 2E2IB 2H5XA 5JZEB 3H6MA 3NENA 4RF1A 1KDBA 3K9PB 5DLQE 5CBEE 1WR1A 4MDKE 1IYUA 5JEAJ 5IYCH 5M5WB 2UXCQ 2DY7A 1TIFA 3T1HL 4X6AH 2NVUI 1I3QH 4DKAC 5E4WC 4N9TA 2Q8RE 4DR1Q 5LHY1 1GB4A 4ME3A 3GP7A 3GZNB 1F2MA 1VQDA 1VQJA 4JI7L 3IVFA 1HZBA 4A3CG 1I4QA 2I38A 5L83A 1E22A 4W9EA 3FMCA 2KN4A 5IKCM 4DV3L 4PK1A 5J17A 1EU3A 3Q14C 4C3IG 1Y14B 4R4CA 2JEAI 3W1YA 2Z6BA 1T9HA 2OQ0A 1F1HA 1D5XC 1VQEA 1KAWA 5C5LA 3M4OB 3ND8A 4DV3Q 3I4MB 1SE8A 2L83A 4BXXH 4DR6Q 2LVOA 4HLEA 1XCTL 1SYFA 1D5ZC 1STHA 4I7ZC 4NXML 1GO3E 3K59A 1U4RA 1J5EL 5KNBA 2HT1A 1WTOA 1QOGA 2NR2A 3I57A 3MC0B 3WAOA 3H3VH 2KHJA 2F0OA 5CV9A 3PF4A 2RCFA 1UE6A 1CZPA 2EOTA 2AQ1B 2JF5A 4HXDA 5HHDG 2IBIB 3Q3OC 4M8NA 2K50A 4GN1A 4H0LC 1EOTA 4JI6L 2F0HA 5IGEA 5L37A 3OYYA 1UUPA 1CMXB 1UBIA 4P6VF 1E24A 3M7GA 1Y56A 1Z5SB 2NZ1D 4XYOA 1D1KA 1WYGA 5BYSA 2JA7G 2O6VD 4J8QA 3GTOH 2KDIA 5IY0A 1A3VA 1F9SA 1LO5D 3S1MB 2WINB 1PYWD 4LK1C 1YMHE 2WS3B 1PQSA 5BN4A 1ZOYB 2D10A 2MBOA 2P5ZX 2MHJA 4PZ6A 2W82A 4A3MB 3L9AX 2RD0A 4C00A 2KVRA 2JEBI 1EL0A 2N9PC 1KLVA 2WX0A 5M3MG 4JBMA 3JSVA 3ND9A 4A3FH 3OPOA 1F0ZA 3E5SA 1XYIA 3I4MG 4GLSC 4ZRKA 2NVYH 5J3BA 3PUZA 1KHIA 1MPEA 4I65A 5A2QL 4GNXC 2MHVA 4KY5A 3HOWH 1T0RC 3CSTA 1YQ3B 4DQOC 2GBNA 3HGBA 3C3LA 4GNXA 1NEKB 2AL6A 2WNMA 4IUMB 4HTHA 3MWYW 1HTQA 1ZXTA 1KC8C 3RZOB 2VW9A 4FYDA 3TS2A 2RA4A 3K57A 3L17A 1PTOD 4EKUA 1E8WA 1YNXA 1WXVA 3BS1A 1I6HH 3DVGY 5C3EG 2D0OA 4LUVA 4AWJA 4DK1A 3NJTA 1TWGB 3TS0A 1HNWQ 4OVZA 3J9CA 2Y0SE 2KZRA 1HCZA 2X6LA 2N9LA 1SNOA 3AFQA 4JI5L 2IHFA 1RYJA 1E7VA 4HKZE 1WTVA 4DN4M 1N5WA 3A8JE 1M4VA 2CFMA 1Z7TA 1H8CA 1BXTA 4MGYE 3SDLC 1E7PB 1J8IA 2XWJB 2WXRA 5J39A 1HZ6A 5EPJA 2ZCCA 2KUMA 4PMBA 1WJUA 2L8JA 1BT0A 4JQWC 3A5ZB 3ETRA 4GXBA 3RT3B 1BOSA 4HEDA 1JRUA 5M3MH 2BE5D 1BDOA 2DAJA 1E1OA 1XMQL 3VRAB 1VQAA 1NTGA 3IFDA 1O7ZA 4JI8Q 1AP0A 3QB3A 3E56A 3OW2A 3T1HQ 2N78A 2DZJA 2DAFA 1K8GA 1K83H 2WHIA 4FLHA 3W1SA 3UQBA 2WXLA 4A3MG 1L0XB 1VQGA 2WXPA 2KENA 1PH1A 1V49A 2BB6A 2RGFA 3L10B 5ELDA 1JB7A 3CW2C 5CHWA 3AE8B 4AYBG 5IOCA 5DAUA 2K5WA 5CGKA 2K5NA 4DV1L 4UY8C 2WXKA 2JA8B 4BAXA 3A7LA 5C3EH 5C3WA 1PV4A 2WDTB 4LNKA 3K6OA 4AQYQ 1N36L 1QKZA 1IZ6A 1AFPA 2OEOA 3CIRB 4TQUS 1K52A 1J5EQ 3V60A 4DK5A 2KJHB 4LMQD 1FXAA 1LXDA 2UXCL 1D6EC 2Q8IB 4B3MQ 3S1QH 3KFUA 4X62L 2D2CC 4CGYB 4MNOA 4ZCKA 1L6VA 2YTYA 4HJ9A 2KCTA 1VZ7A 5FKAC 4GLXA 3GTPB 1I6VC 1HR0Q 4W9JA 1WH3A 1L0YB 5M5YH 3AYHB 3SFEB 1Q82C 3IAYA 1HR0L 3M95A 4KVGB 1KIXA 1VZ8A 5DM63 2EE1A 4YIJA 1VQIA 3ENEA 2RDHA 2PIAA 2OWOA 4K8JA 1WD0A 2LGYA 2PCFB 2E2HB 3OAWA 1AE3A 2FINB 1TZOA 3LB8C 1VQ8A 4WWPA 3T3NA 5JXVA 1Y8RC 4L63B 4MSQB 2JZ3B 2RF4A 1PH9A 4JE3B 2N55A 2OCEA 3NTHA 1VQFA 3P7JA 3TREA 3QK0A 1EY8A 4WAFA 1Y1WG 1TWFH 2YTXA 2M8SA 2MP2B 1OXSC 2MBHA 3Q8EA 4M01A 2G1EA 2QIEB 3NZUA 3QQ8B 4B9KA 1IBLQ 5LMNW 2R92G 1YJIA 4KSLC 2KC1A 3DBRI 1II3A 1BQQT 2AKWB 1JWBD 5FR6A 5IE8A 1TKWB 3OMCA 5KHOA 2JX5A 1GM5A 2ES2A 3L08A 5FLXL 5A35A 2HCCA 1WY8A 2FFKB 3PTFC 5BR8L 3Q8CA 4RKBA 1TWHH 1WJNA 2I0QA 3WIMA 2LSSA 4TKOB 2J53A 2K0PA 3I5JC 1QB5D 5IYDH 2FUG1 3M4YA 1TY2A 3BK2A 1PFBA 3ITPA 1RAXA 3CCLA 1G6JA 1TU2B 2DN8A 2EJGC 3CRKC 3D8GA 3LWUA 3ZLZA 1I42A 3ZJUA 2QA4A 5MPOA 1QNUA 3BU2A 3MA2B 5DEHA 1SNDA 3CPWA 4AJWA 2L9HA 1XMOL 4DAPA 4E71A 4KV6A 3P1HA 2K33A 1UBQA 2JVCA 3CF6E 5EKLA 2E5LQ 1TTNA 1R4PB 1TT5B 3GTLB 2HIVA 1XMQQ 3QC8B 4O1NA 4LFBL 2RMMA 3T53B 3S17B 5EGTA 1RF2D 2LD9A 3RN5A 2A5UA 3QJYA 5ELCA 1YJNA 1EWIA 5CV8A 4IZ8A 1V1OA 4DV7L 1IBKL 4DR2Q 3S24A 2NBFA 1ILQA 1GAQB 5AZHA 2A8VA 5I9OA 2R6GA 3AULA 1FVIA 4KN7C 4BKSA 3VR6A 1XPOA 2N7EA 5E6OA 3HIZA 2LY7A 3LYYA 2WWZA 2K1BA 3NBIA 3NSWA 1N5XA 4JX1C 2HUGA 3E9HA 4OXPA 2Q2HA 2QGQA 2ATWA 1U4LA 3TEHB 1DJRD 2INDC 3Q3NC 3R66C 1IBXB 4IQZA 4MACA 1VMPA 5JJLA 4PT5A 2UYZB 2H89B 1GJXA 3DM3A 1RODA 4KZCA 3KDFA 3I55A 3BDCA 1EEID 4OW0A 3H3VI 1UE1A 2L11A 2FAZA 3HVZA 2KFKB 1JCKB 2PTLA 1SE9A 4FNFA 3A8KE 1E2VA 2K5DA 4MT5A 2XRSD 1UE5A 1LYLA 3J80E 3AEFB 1YNND 2JA7H 1VD2A 4RH6A 4QL5A 3VAWA 3S2HB 1J7CA 1R4NB 1IGCA 2DHZA 1LACA 4G7HC 2F0NA 2DLBA 3BIID 3D6CA 4A3DB 5BN5A 4S0RA 5TR5A 2MQJA 2AUJD 2UXDL 1WF9A 4K7WA 3PLVA 4EQNA 3RZFA 1B53A 5IGBA 4DHJB 2LUMA 1DOLA 3PUVA 5D3IB 1BKBA 1N36Q 4DR7Q 1LM8B 4GU2A 5IN7A 2FNJB 2QHOA 3MEFA 3AE2B 4OONA 1GOZA 1PFMA 1XWEA 2F0DA 2R7ZB 4WJ4A 4L2YA 3VR8B 4MM3A 2R7DA 4KKUA 4ANUA 2LWPA 1EO6A 2DY8A 4RGNA 3HOYH 1LUZA 4W9GA 1PVOA 1STGA 2B2UC 4K6LA 3GTQB 4A3IB 2WFWA 1SE4A 3RNFC 2ZJRA 1B9NA 4JV5Q 1E8XA 3ML8A 3VTWA 4G57A 3R3OA 5HGTA 4A3EB 1WE7A 3QCAA 3NVYA 3P63A 2DNEA 3VA5A 1K8OA 4JL9A 5KRUA 1STYA 3J80c 1XO3A 2VB3X 1KLUD 3ZYYX 2Y5CA 4K7SA 5AUKA 2K04A 3OSOA 1EWCA 3AI5A 3CKIB 3TSSA 3Q69A 1HNZL 2WU2B 2B2WA 4HDQA 5M5XH 1I50H 2MFIA 1K50A 1OGWA 3KBXA 1RLFA 4U68A 2NZOA 1MIUA 2IHEA 2ZXRA 3HKSA 2MJEA 2KXJA 2L5TA 3V96A 1Z2MA 1J7BA 4FVMA 1RCVD 2RSUA 1MSGA 3VR2A 4EGVA 2NUCA 1IUEA 4GIVA 1O7YA 2C35B 5EAYA 3SE0A 3T13A 3P4SB 2LS01 3RFZB 3PIP3 3TEWA 3AEBB 1XMOQ 3Q3JA 1VRAB 3F8TA 4X3TA 4L8JA 1RJTA 4DK0A 1X6OA 3U4VA 4WWNA 2XK5B 2GMIC 3KYHC 5IGCA 4YWGG 4YY3Q 1J7AA 3Q2AC 3NG0A 3HOYG 3J81E 1YD8U 4DR2L 2D3CA 3TQYA 3A55A 1DOMA 4NB3A 4UP8A 3MXPA 1SNPA 2B29A 4C2MH 4A3JB 5EBDA 4BBSB 3NBHA 4W9HA 3TUOA 2JN4A 2M4NA 5EE9A 4B9WA 5HFYA 4B6WA 2VH2A 2ZEQA 4US9A 3S15B 2ZPNA 2L00B 5IP7G 1Q5WB 1Q10A 4JBWA 2JRIB 2KK8A 4PMCA 2JZPA 5CYUA 3W5UB 5EQ0A 1WXSA 5FR3A 3URYA 4JI4L 4KDLB 4HCSA 3AE4B 3AU4A 4BY1G 3ONSA 3PT2B 1D1IA 3PSIA 4TV3A 2NB0A 2JY6A 2K25A 1YZ6A 3AXCA 3A9JB 1F2ZA 4KHPQ 4LFAQ 2KQSA 3ZNHB 1HTPA 3HEJA 2LFNA 1S5ED 1BBXC 3M7NA 2BYVE 2KN5A 1JORA 4R3DA 4BKSD 3VUWA 4WWOA 2ICIA 3ONAB 4DV7Q 1S4ZA 2VXWA 2G45B 1T0QC 1S5CD 4S3SA 2LMCA 4MEMA 3SR1A 1W3SA 2IO0B 2PZWA 5FK9C 2JZZA 1PGXA 1ZP0B 3ZNGC 3MXNB 1R9TH 2Q5WD 1GPXA 1XJVA 3GD7A 3F2CA 1MSHA 2KDMA 3I91A 5LMUQ 4R9WA 2B2YA 2UXDQ 4HJKA 4I6NB 1S5BD 3DWAA 3W1BA 2IY0B 3AE3B 1TS3A 5HKHA 2BDOA 4URKA 4WJWA 3CCJA 4HIKA 4BOSC 1GUWA 2Y3AA 4JI0Q 4LUOA 3WOFA 4FP5D 3X23A 1FD6A 5LLIA 2KOXA 3MTSA 1U9RA 4ZHOA 1I94L 2F3WA 1PXUA 2DX5B 4KLKA 2SNSA 4JI7Q 1UGMA 1Y8PB 3RCZA 1FNWA 4HK2A 2MUYA 3MZ5A 1GUGA 4NJCA 2QDBA 4QMGA 1Q8KA 1AARA 2LXCA 2LZ6A 1QUQA 4OHJA 5IGGA 3NUCA 1FMAD 4GN5A 3FPUB 3G6JB 1PDXA 2IO3B 2RR9A 5AJ3L 1WOCA 3AEGB 3MHZA 3ZKJC 1QOBA 1LTSD 2ZJQA 3DHHC 1W2BA 4BY1H 1GG3A 1WX9A 4BKTA 1SE3A 3BYYB 4DUZQ 3DM1A 4A3KG 1JE5A 1YJWA 2MLBA 3SR6A 4PS3A 4DR4L 3I56A 4JG2A 1EYGA 1PZKD 2X69A 4XQQA 4HCNB 4M8MA 4B3TQ 3TBIB 2JK8A 2Z9HA 4N9F4 1TJEA 2N9KA 1TS4A 2PVOD 3SHLA 1H9JA 1XEEA 4A3BB 2DNFA 1TIID 3S1NH 3FKIG 1G8ZD 3I4LA 1O7IA 2KA7A 2KEDA 4C1NK 1GHJA 3UI3A 3EECA 4K5WA 2V1YA 5H8YE 1RHPA 2EKEC 2GB1A 1EY9A 4USAA 3A54A 4FO2A 1HA6A 1ACCA 5IYBG 3V61A 1JWMD 5EKKA 1MBYA 3S14B 2PQEA 2HJ8A 4FJVB 4LNOA 2JA6H 3PRMB 4OWXB 1MJDA 2A68C 1HE8A 3E6ZX 3KVFB 4HVBA 4A3DG 2K5PA 2B2VA 3QX1A 4P1BC 3SDZA 3EROA 1SAPA 1V1PB 2ZXPA 4JOIA 4A93G 1OFFA 2PI2A 2E74C 3A56A 3EA6A 1KD1C 4XTCS 3VR4A 1AZQA 2KBNA 3H0GB 3HK0A 2K7VA 2RKSA 1FXTB 4HDOA 5G3LF 3P4QB 3PO3B 1Y1WB 3K0XA 1G6PA 1UWMA 4PZ8A 1V43A 2BH2A 2R93H 2KQ4X 5FO9B 1SMYD 3A8IE 4JWSC 5G3LD 4UP7A 2PPBC 3UDGA 2YLMA 2JYEA 4FHJA 1H4RA 3DVGX 5IT9c 1AZPA 3GTGB 1IPGA 4IO9A 3P4RB 3RULA 3N3KB 3Q8BA 3VXWA 4DXAB 1SNQA 4K8IA 3E9IA 3CSFA 3M63B 1C4AA 3I3TB 1QNKA 4ZAIA 3DLLA 2VZAA 5IGFA 4OELB 1STAA 3CCUA 4NY0A 2EXDA 2C5LC 1KAAA 3GTKB 5FO7B 4FBJB 4ZDVA 2L3ZA 1E90A 3N30A 4KKTA 4YCUA 2EJMA 3W5VB 3X3NA 4Q5VA 2CH4A 1FJGL 4MGZE 3B6YA 3FKIH 1OQYA 3MFGA 2BW2A 4G0NB 4NJ7A 2NVXB 1E2ZA 3KUDB 1AW7A 1FCLA 3NZSA 3F2BA 1WCMG 3F1ZA 2F0MA 3APFA 2OTJA 1A5RA 1SSOA 5EJWA 4J15A 2BA0A 4C1NI 4QGUA 1PTOB 2EYOA 3P4PB 2CVRA 4NQKE 3KUCB 2BT6A 2K32A 1MG4A 2K8HA 3CQZH 3K5OA 2N9XA 4C80A 3ZXVA 4JIOU 3VH3B 2IT1A 4UAIA 1S40A 5G5GA 1TVXA 1XTDA 2EJFC 3CC7A 2E2JB 3AMZA 1QCBD 2OJWA 3T3OA 4C3JH 4DV5L 1HNXQ 2OQKA 4LWCA 4JBKA 1XNQL 2JA5B 3L4PA 1ZEQX 4K14A 2KECA 4BBRH 1D5MC 2GVAA 2ZTCA 4POGA 2PJHA 5BYQA 1XX8A 4LF5L 3JAMc 1KDAA 2LJIA 2R2QA 5JHAA 1BO0A 3M4PA 4GLAC 1OXUA 2X8XX 1UD7A 1N33L 2BYTA 1Y1VH 3VRBB 2YU9B 4IW0A 1KOTA 3IHPC 2M0AA 5LXHA 4V190 2AL3A 2O6VB 4O0AA 1UEBA 4TQ1A 1TS5A 3S16H 2F0VA 2FIFA 4FADA 3I4NG 2K8CA 1MJEA 3BDLA 5KEEA 1K8RB 4KSKC 4ZRZA 5M3FH 4XYCA 3BYTB 1K3BC 3K7AB 3UGBB 1EZ8A 4DF7A 2HIXA 3J81L 1HUNA 4E3CA 4EZJA 1LV9A 4N59A 3NTIA 1R4MI 3AE1B 4MN3A 3NS8A 3HFZB 1H9SB 1EIYB 5C4XB 1OQQA 3HM6X 3H1UA 1PYBA 1SIFA 3CU7A 4CDEC 2CWPA 4QUFA 3R7QA 3L7ZC 1XT9B 1N60A 1FGBD 2M17A 4X57B 2CHZA 3ULPA 4IPGA 4DHZE 1EYDA 3PHWB 3PZDA 3IFTA 3PUYA 4PZ7A 3IAS1 1T6BX 4IN3A 1WD1A 2LXAA 4XDCA 2YV5A 4WH4A 2F0WA 4IOCA 1EF5A 1GC6A 4GDKB 3GTJB 1CK1A 3C1EA 3APDA 1K51A 1VQ6A 3GTMH 5DM73 4A3GB 4JWUC 1E0ZA 2PE6B 3DCGA 2K5VA 1W6JA 2KCCA 3B1LX 1ENFA 1G291 3EFCA 4X3SA 2ZJPA 1EY0A 5BMGA 5E1FA 3OHXC 3S9WA 1GB1A 1JMCA 3KWLA 1T0SC 1YNNC 3RLOA 4C4VB 3LXFA 4KY6A 1HFGA 3PO2G 3UF8A 1K28A 2VQEQ 3C8YA 1GVPA 2QW7A 1TWCH 2I1JA 3V62A 1E3PA 3SGIA 1IBLL 1JROA 4E74A 4X64L 3J81i 1NE3A 2VQEL 1X9NA 3E0JA 2KLGA 2N1VA 4F7XA 4RNAA 5I6YA 2CHBD 4IUQA 4CDDC 4C3HB 5C6AA 4XGAB 5IYCG 2X6GA 1LT6D 1L0WA 2KNBA 2F0TA 1VQMA 1SIJA 2A19A 2MEKA 2CKZB 2JSVX 3K8AA 2LHDA 5M5WH 1XTCD 4CDCC 2ASQA 2AMCB 1I3QB 3O65B 1K9MC 2KACA 4A3CH 2QC8A 4N9PA 2BOSA 3HOXH 1WTQA 2BS4B 1NMFA 1M8AA 2D2QA 1RTNA 1RKNA 1IYJB 2B63H 1IYFA 4LF4Q 1L1OA 1E6EB 1SR3A 1XLNA 4IUUA 2MBBB 3NVVA 1LLRD 1WGRA 2A68D 4DDGD 4CKEA 2MBQA 5GAGC 1MHHE 3VQIA 1IBXA 3EFXD 4DK3C 3E3XA 5ELBA 3I4MH 1B7YB 4G11A 1BF4A 4DV5Q 1HNXL 1FNUA 3R2TA 3S1RH 4DFAA 1L2FA 1F52A 2B76B 4CQNA 1GUSA 4EUTA 5LXIB 5E3FA 2NVTH 1X3QA 1WGKA 3HOZB 2MBEA 3AM9A 2M2LA 3SEBA 5JPMC 3Q3MC 3KUPA 1F9JA 3KK7A 4IWPA 5JJIA 4K6DA 4F1SA 5JEAH 1WJJA 4DUYQ 1VLBA 2KO3A 4TRDA 3W5OA 3VA7A 1YQ4B 3NRZA 3U4EG 2ZTDA 4ZLTF 3TZDA 5IGDA 4GDLB 4RWSC 3H8HA 1D4BA 2AWNA 2INCC 2YEPF 4B0MA 3U2SC 1EQVA 3ECIA 1WRIA 4A93B 1GJZA 1H9MA 2E2DC 4XC2A 3AE9B 3NWSA 4QQBX 4XZ4A 4JI8L 2CH4W 3HM3A 4P71A 2MA9B 1VQ7A 2JA6G 2UXBL 2KX3A 1Z47A 4BBNC 2LXKA 5CV6A 2KHIA 5C44H 4JCVE 1V5TA 3J80i 3TZUA 2NN6H 2FCMA 3QG1A 1GC7A 5AZFA 1D3ZA 1PFNA 3V6EB 2WXMA 5D14A 3T4AC 3Q8DA 3G6EA 1PFSA 2NBVB 1DXMA 1VQOA 4ZRQA 3PQIA 3TEZA 1B1ZA 1KABA 5LMNQ 1P7EA 1YQBA 5C0XJ 1VJKA 2F0GA 4C7YA 3T1YQ 4J6HA 1T0YA 4YSXB 2NVQH 1XQQA 3RI7C 1TWGH 3NK9A 1PH5A 1UGJA 1H9KA 1HHVA 1AYFA 2BH8A 2LEKA 1Q7YC 4ARCA
chains in the Genus database with same CATH topology
2K22A 2M56B 1Y8NB 3D31A 2F0SA 5LL6X 3ZJTA 3NWTA 5F2DA 1WCMB 2PMZB 3MAQA 1QOAA 1T5EA 3NQIA 1ZDVA 2F03A 2E6XA 5COYA 3Q0AA 2RQXA 2N88A 3IL8A 1F2YA 1MHXA 4ULLA 2A6HC 4H44C 4XDXA 2OT2A 4NMZA 1K83B 3EVQA 3I73A 4M8AA 2B2VC 4WQMA 3DWMA 3GQBA 4WORA 3X3MA 4RHRA 3SK8A 1JW9D 2FBWB 2K6AA 1JOQA 1STNA 3AEEB 1IKMA 2EDGA 5GXGB 5HURA 2PZUA 2Q8TA 1ZXHA 3I8ZA 3HKZB 3DXJC 3V2TA 4CJ1B 1Z6HA 4KTAA 1BCPB 4BWGB 3L3OC 1SB3C 1EFID 1SEBD 3NVWA 1DONA 2QCPX 2MJDA 2XRQD 1EM7A 1A3UA 5KYIA 2B2WC 4KKJA 4RCOA 1WXQA 1WTPA 1RFKA 2TSSA 1TKYA 3NZ3A 4DNTB 1DOYA 2WDVB 2EYFA 2J7ZA 3AB5A 5C3XA 3PUXA 1EQTA 2Y0SB 2N7JA 2O4XA 1CI3M 1G2TA 2WXIA 3U9SA 5D65A 5EE1A 4WURA 3HS0C 3MP9A 5KGUA 3NUHB 2RPVA 3KWVA 3DEPA 2PLPA 1B44D 1FNVA 1SFOB 1TWAB 3MHBA 4H7BA 1CA5A 2F3VA 1SNCA 4OO1H 2W3SA 1RD9D 4DNRB 1FRRA 3AEDB 1PRTC 2PYKA 3SXHA 3PO2B 1B4OA 4OZAA 1PTOC 4US8A 1ML0D 1K53A 3QWNA 4E6IA 2EY5A 1GUNA 3MXUA 5LL6S 2B2UA 2FMMA 5E4XA 1G6ZA 1BR9A 3W9CB 2ZT9C 3I9V1 1DOXA 4XYQA 4IFDJ 1SMYC 2Y5PA 3MJ5A 4C3JG 3N9YC 1BCPF 4L23A 4A9AA 1PUTA 1GXDC 1XXGA 4DGZA 2RSNA 4IFDI 3AB9A 1HTLD 2QEJC 1I6HB 2PZTA 1MD2D 2FHTA 2DNCA 1C4QA 2WDRB 3QOJA 1CHPD 4M0WA 4LK0M 2KOLA 1C48A 1OXXK 3H91A 2EY6A 1VF7A 2E76C 2XSCA 3KF8A 4XDDA 3I70A 3NXWA 3NHHA 1KRHA 2WIIB 5IODA 2QSDA 3HG9A 1NR2A 2V4DA 1A6XA 1E0BA 1OXVA 2B39A 1CJEA 2F0EA 1C79A 4ZOHC 1ZE3D 2OXPA 3FILA 2EYLA 2D5GA 2HQEA 1U4MA 3AE5B 2NTSA 1JWSD 1IL8A 2R61A 2H88B 5K36G 4FXDA 1ZYRC 1KNAA 2ZW1A 1IW7D 1I4GA 2EXZA 5HI1A 2XNAC 1SYEA 1F2RI 4OIJA 4RFBA 2KAJA 2VUMB 4X3UA 2BCOA 3AE7B 3PV0A 4FXGC 3P1MA 3J7YW 1JC7A 4L6TB 2JQRB 2L4NA 2WQYB 3W3AA 1MGSA 2O5JC 2N0SB 1TKEA 4ODGA 4Z9CB 1SJED 1W6KA 2SDFA 1MI2A 4KJOA 5CBAE 4PMWA 1L0VB 2B2TA 2IL8A 1ENCA 3FPPA 5C4HA 4C2MB 4ZKCB 4IURA 4G7ZC 1E9MA 4YTPB 1C78A 3JAML 5I9PA 4TSSA 1IYVA 4K2LA 3TEXA 3Q8FA 1DCZA 4HSPA 4H13C 4LAAA 1RDPD 3M85A 5BMHA 1CT1D 4KKSA 1FD7D 2VNUD 1G2SA 5D3DA 3I90A 4ME5A 3NQTA 4OZCA 2XWBB 3HVDA 1KDCA 5EBCA 4XQJA 5JOBA 1JOKA 2HCIA 2OF1A 3O13A 1SDFA 3R2IA 2BB5A 1KLGD 2SEBD 5I2YA 1NI3A 1VR9A 2PW7A 1DD2A 3VR3A 1YNJD 4B9XA 1L4ZB 1ZKOA 3EQLC 1OQRA 2WXGA 1C9FA 1ONLA 1J9OA 1F9PA 3T16A 1H9SA 2B2TC 1FYCA 1Y69U 2A5HA 3P42A 2O2LD 4D2KA 1UAPA 3VYTA 4FXCA 3H94A 2I46A 2SNMA 4Q2JA 2MJ3A 1CFMA 2D9UA 2VZKB 2FMCA 2Z1CA 4PV1C 2RDFA 4BY1B 1VCIA 1SNMA 2A69C 2EYPA 4Q0FA 3FEWX 4IUTA 1YN4A 5KIXA 4KN4C 3VR9B 5CV5A 3S1NB 2PKOA 4F88A 1AN8A 4ITKA 3WOEA 4KD4A 3S2DB 4B08A 1MVKA 2A69D 2DYOA 4FXKC 4KGRA 1D2BA 2I07B 2F0PA 2W54A 1UNSA 1A3TA 3TMEA 3U52E 3ZQ4A 2IX0A 3B2FA 2AWOA 1WTWA 3LNNA 3GTOB 2WKDA 4CJ2C 2OHFA 2WXHA 2L12A 2CW0C 3J7AV 1GUTA 4OGQC 2WXFA 1H9RA 1JE4A 2WP9B 4A3FB 3N52A 1BUVT 3HOYB 1ROEA 1CZWA 4LJZC 3DHQA 1KNEA 1WTRA 1E10A 3PZ8A 4AQ7A 2F0FA 2WXQA 2F0LA 5JVG3 5C4JB 2HDMA 1NYQA 1C8CA 1IW7C 2A6EC 1V8CA 2IWHA 1SBBB 2KVMA 4RHSA 5M5XB 1PDQA 5EPLA 2WLBA 3SK6A 3T51B 4MM3B 3E9SA 3OOCA 4OIKA 5J22A 1VDVA 1SXTA 4KKIA 1X32A 3FDTA 2WXNA 2M9VA 1FO4A 2IW3A 2EPBA 2F4IA 2A6ED 1YN3A 4L1BA 5FO8B 1XLOA 3GB1A 4KHZA 2RSOA 4A8XC 4ARIA 4BA2I 4YTMB 5KNDA 4DU9A 1O78A 3UI2A 1KF6B 4C3JB 5C0XI 4M1UB 5M3MB 1FCCC 3PMFA 1STEA 1T3QA 1PZID 1PRTF 4ZQ3A 1B9RA 1XCQL 3IT6B 1PTOF 1WSPA 4FF4A 4KHVA 4J3OD 3DWPA 2I2YA 2SOBA 4G4KA 3LX0A 4NP5A 1YNJC 2A73B 4YXDB 3P20A 5H92C 2GI9A 3BG3A 1EWYC 1NUCA 3IT4B 3IXSA 4JPSA 1JMLA 3RUZA 4NAWB 4J1MA 1LTTD 4EQPA 1TY0A 1XLPA 2O5IC 1UWXA 2EYMA 2BDNA 1IGDA 4XT3B 4RA8A 1Q12A 1C77A 1E2WA 1LTRD 1SYGA 1VMCA 1FEHA 1MI0A 2E3TA 2ON8A 1JWUD 2IPKD 1A70A 1SF0A 4KI0A 2K28A 1FXIA 2F0JA 3MXGA 1HQMC 3TP6A 1SSNA 2L0CA 4NDXA 3PZ7A 2IX3A 1PRTD 1CQFA 5AUIA 1TWFB 2RVLA 1TWCB 1JRPA 4IDIA 5TSSA 3FRPB 2IGGA 2V4IB 1NENB 1B9MA 1GUOA 1BNZA 2WAQB 2JE6I 3AE6B 3VYUA 3QO2A 4RGTA 5C2TB 1DGJA 5ELEA 4U673 3H3VC 1RTOA 1R7SA 2AQ2B 4BA1I 3DUZA 1O7LA 1ET9A 4EQOA 4EE2A 1A2TA 3BK1A 4XE0A 2IX1A 1TWHB 1LTBD 5E6JA 2EZVA 2LGIA 3Q6SA 1EU4A 3GV3A 1NCVA 4DXGA 4YT0B 1WWTA 5CV4A 2JYTA 2F0UA 5A2QE 3KLSX 1HPCA 1KH0A 2JU6X 4QCLA 3AECB 2M00A 4A90A 3S1RB 2NVYB 4BS9A 5CC4A 1JB3A 1QILA 4CJ0B 1WVLA 1BCPC 2EYHA 3TDQA 3HOWB 1F2RC 3HP3A 3F2UA 4NW2A 5T1IA 3BVZA 2INPE 4PQXA 2EY1A 1ZPSA 2B8FA 4ZK9B 2TMPA 2B2YC 2LHEA 5FLXE 1VDZA 2J0TD 1LT4D 3B2GA 1SYDA 5BN3A 5NUCA 5CMDA 1T5XD 4G7OC 4HKQA 4KGSA 3QOLA 1SJHD 4YSYB 3NE5B 5IT9E 1STBA 1LABA 2R3ZA 3ERQA 4ZYSA 1FIQA 3NPPA 1NVID 5G5HA 3CQZB 2GRIA 2MP1A 5C44B 3DWQA 3V3XA 5JAVA 1QLBB 4R8IA 5EE3A 2K3UA 5K5PA 1ESFA 2OEDA 4P16A 5JVH3 4RCNA 1QJOA 4HAEA 4K5XA 2DYMA 3DMUA 1ET6A 3BVMA 4HMIA 2JXMB 3U7ZA 4MIUA 1QOHA 1R4QB 1HRJA 2MGSA 1C4PA 4O42A 5C3EB 3PO0A 4LTUA 2BS3B 3MFYA 5M3FB 3ZGZA 5ELFA 1PGAA 3J80L 4ZUJA 1FR3A 3S1QB 4IOIE 3NS1A 5BYRA 1NYRA 2GA4B 4ZUIA 3J7AF 1HFNA 4K5VA 3D3RA 5M5YB 3DEOA 1V1PA 4C56C 2VZKD 3K0YA 3A7AB 3MVVA 5FOBB 5EKIA 2NN6G 4A55A 5KNCA 1B3AA 4NZLB 2Z8LA 4IFDH 2JSOA 2NWGA 4HR7B 1QWYA 2HTME 3IAM1 3BDOA 1FFUA 4R8NA 3TP5A 2E75C 1HA5A 2R92B 3TP8A 3VRAB 1A2UA 1U4PA 2ID0A 4BY7B 4HROA 3T56B 2IDYA 1XF5L 2G9DA 4HSVA 2QKIC 5IIFA 4OO1G 2HDEA 2NMQA 3JAME 4XWWA 2V0GA 3DWGC 1RM6C 4ABNA 4UDUC 3P75A 1ZDXA 2CJOA 1F2LA 3BVGA 3AMUA 2Z4IA 2B63B 1YNTE 1N62A 5I2XA 3SVMA 2LFIA 3D4WA 3NTKA 1LTAD 3ZJVA 1XLQA 1R9TB 1HQRD 2HDLA 3C46A 3KQ4A 4HRSA 1X3PA 2CJNA 2LMCB 5T8IA 1V8QA 2PMVA 2JXTA 2ENBA 3BWUD 5HG2A 3RPFC 1NSNS 1N63A 2WV6D 3Q22A 3OIQA 1UEAB 3LWEA 4HEA1 2KMMA 4A6QA 4KX6B 1Q90A 3TN2A 3D4DA 3HOVB 4DXFA 1TR5A 4CKCA 2W3RA 4GZYC 4KJNA 4F87A 1WTXA 2PNRC 4AYBB 2KQ3A 2J42A 4KY7A 4FF2A 1JR0D 3HOUB 3PUWA 4IUVA 4ZHPA 1OO9B 5C0XH 4XXEA 2JA7B 4QF4A 1Q8IA 5JJZA 3TP7A 3V05A 2WXOA 3D6WA 1SYCA 2WB1B 4CKBA 1DOKA 4NAMA 2NVQB 1ICWA 2A6HD 1IHZA 1B2TA 1EIHA 3EJIA 1L4DB 1ZUD2 4XIGS 1TQOA 1F9RA 2KJXA 1C76A 1EIGA 2CW0D 1IKLA 1NR4A 2J4XA 2R93B 2WACA 3VYSA 4HCEA 4CHTB 2W55A 2L1BA 1EWHA 1DOIA 3GV6A 1DM0B 1PLFA 2G9HD 4DAYA 3NVZA 4RAUC 5K36H 4N58A 4ZKBB 3AH7A 3EUB2 1I4PA 1DZ1A 1G91A 1SYBA 3SK4A 2L55A 1L5PA 3Q8AA 1VF5C 4RKLA 3OWFA 4C3HG 3KLRA 3FKIB 4JK1C 2K9XA 4KGTA 1ENAA 1I50B 4IUPA 4ILWA 4WFN3 2MH7A 1JICA 3BZDB 3OIPA 4V0BA 5I6WA 2INNE 3WCQA 1FFVA 2QMTA 1I4XA 1ILPA 1KTKA 1PTOH 1DYQA 4Y7NB 1CTMA 3VR5A 1EY7A 1TYGB 1JQYD 2RDGA 4IALA 5IT9L 3FVQA 3C2PA 2B8GA 2Z4HA 2D62A 3VYRA 3SK5A 2IJ0A 1O80A 4XQNA 5C3JB 3KLSA 4F8MA 4BBRB 2NYZD 4QUCA 1BMLC 5C5MA 2L52A 2WDQB 4LLGM 1SE2A 4RF0A 2LKVA 1YN5A 2L1AA 3ABVB 1LTGD 1QF6A 1EY6A 5AFWA 1ZXIA 3I3CA 4OO1I 3CRLC 3AV8A 2X38A 4N6EB 5DNFA 3R8BA 1QT9A 4P2CB 1FRDA 2QF7A 2ACZB 1RWSA 2C5CA 3FAHA 1EYAA 4K2KA 4WWMA 1LT3D 4IUNA 4C7ZA 2F0KA 2MPMA 2NN6I 1CM9A 4KK7A 1QG7A 2JWUA 4OL7A 3I72A 1TT2A 4QB4A 3Q23A 5CV7A 2J52A 3HUIA 2BA1A 2K01A 1HZ5A 4TMAB 5EE0A 4IFDG 1L6UA 5I4DA 3GTMB 1PMRA 4PNYA 2BS2B 1EEFD 2DBYA 1EYCA 1NAPA 2IGDA 4NKLA 3M3YB 1Q1BA 3WDNA 4FF1A 4REZA 1Q1EA 2A74C 3TEYA 1F77A 3HZXA 4RGMA 5CR3A 3RMHA 1B50A 4ZRPA 5BMIA 2D5DA 2NTTA 1TS2A 2XVSA 5C4ZA 5LNK1 2DWQA 2K05A 1PRTB 2JYOA 5EPKA 3W2DA 3KBGA 1I4RA 2EVBA 5M9OA 3OMGA 4B0EA 1CA6A 1CHQD 2YYZA 2EKIA 4HN7A 4X3KA 1PGBA 2F0QA 3HOXB 2L32A 1A15A 2JA6B 3B9JA 4AS1A 2QJLA 1ZYRD 1Q3LA 2ICEC 1AWDA 4C3IB 4WRDA 3OWEB 1YJJA 3K5MA 1QE6A 3I4NB 2MJ8A 3NP8A 4RGOS 4H2AA 5JPNC 4YSZB 2AUKA 1AEXA 2VB2X 2BBCA 4MHEA 2SAKA 2NVTB 2ONQA 2K03A 2V3PA 2ZW0A 4HMJA 4TQ0A 1EY5A 4CBVA 5ISRA 1QOFA 1C4CA 5KYLA 1ESRA 3SFDB 1LT5D 4HJGE 3N6RA 3IKJA 3GS2A 4EVOA 1CQVA 4DAVA 1F9QA 2XIWA 2EY2A 2EELA 3K5NA 3Q24A 1CZGA 1N61A 2WP8J 3D4RA 2AX5A 1GHKA 3RD4A 1P7FA 2FJ2A 2F0IA 4XT1B 4YTNB 1I4HA 1HXYD 3H09A 1BUIC 4WIPA 2KHSA 3MEHA 1S5DD 2WKCA 5T1GA 1PFDA 2IGHA 2PO4A 2BTEA 1OXTA 2RBMA 3G7LA 1LTID 2H1EA 4IKGA 4KD3A 2KCNA 1JWAD 3OW7A 5CORA 2PW9A 4MH8A 1VZ6A 1Y1VB 2XN9C 2WU5B 3MXNA 2F1MA 3PIO3 3AEAB 3EGRA 1K8MA 2V3NA 3S16B 3AN1A 5D7GA 1V97A 4ID6A 3FC4A 4XWTA 1JOOA 4KMUC 4FF3A 2KEEA 4QIWB 1Y8OB 3RLFA 2BE5C 2FE8A 2ZXOA 3CWIA 3C1FA 2QILA 2CQAA 3R93A 1JALA 3QIAA 5C0XG 2M19A 3GO5A 3K5LA 2JP1A 4DA2A 3HRZC 1I7HA 1S5FD 1BCPD 3CHBD 1PZJD 2H4OA 1HUMA 5J1ZA 2YEPB 4OZBA 2K5QA 3HRDD 1EY4A 2C9OA 3K58A 2KWDA 1EZ6A 2PVGC 2PW5A 2CU3A 3FILB 4A3KB 5JEAG 1JQ4A 3U9OA 1HEZE 2EYJA 2AQ3B 1QQRA 2WXJA 1TKGA 3RZDB 1FM0D 3AU7A 1KFYB 2E2IB 3H6MA 4RF1A 1KDBA 5CBEE 1IYUA 5JEAJ 5M5WB 2DY7A 5E4WC 4N9TA 2Q8RE 5LHY1 1GB4A 3GP7A 1F2MA 1I4QA 2I38A 3FMCA 2KN4A 1EU3A 4C3IG 2JEAI 1D5XC 5C5LA 3M4OB 3ND8A 3I4MB 2L83A 1XCTL 1SYFA 1D5ZC 1STHA 4I7ZC 3K59A 1QOGA 1U4RA 5KNBA 3I57A 1WTOA 3MC0B 5CV9A 2F0OA 1CZPA 2EOTA 2AQ1B 5HHDG 4H0LC 1EOTA 2F0HA 5IGEA 1UUPA 4P6VF 3M7GA 1Y56A 2NZ1D 4XYOA 1D1KA 1WYGA 5BYSA 4J8QA 1A3VA 1F9SA 1LO5D 3S1MB 2WINB 1PYWD 4LK1C 1YMHE 2WS3B 5BN4A 1ZOYB 2W82A 4A3MB 3L9AX 2JEBI 1EL0A 3ND9A 3OPOA 1F0ZA 3E5SA 1XYIA 4GLSC 3PUZA 1MPEA 4I65A 5A2QL 2MHVA 4KY5A 4DQOC 1YQ3B 3HGBA 3C3LA 1NEKB 2WNMA 4HTHA 3MWYW 1ZXTA 3RZOB 4FYDA 2RA4A 3K57A 1PTOD 3BS1A 4DK1A 1TWGB 4OVZA 3J9CA 1HCZA 2X6LA 2N9LA 1SNOA 4HKZE 1RYJA 1WTVA 4DN4M 1N5WA 3A8JE 1M4VA 1Z7TA 1BXTA 1E7PB 1J8IA 2XWJB 2WXRA 5J39A 1HZ6A 5EPJA 2KUMA 4PMBA 3ETRA 1BOSA 4HEDA 2BE5D 1BDOA 3IFDA 1O7ZA 1AP0A 3E56A 3QB3A 3W1SA 2WXLA 1L0XB 2WXPA 2BB6A 5ELDA 3AE8B 5IOCA 5DAUA 2K5WA 5CGKA 2WXKA 2JA8B 3A7LA 5C3WA 3K6OA 1QKZA 1AFPA 2OEOA 3CIRB 4TQUS 1K52A 4LMQD 1FXAA 1D6EC 2Q8IB 2D2CC 4CGYB 1L6VA 1VZ7A 5FKAC 3GTPB 1I6VC 1L0YB 3SFEB 3IAYA 1VZ8A 5DM63 2EE1A 4YIJA 2RDHA 2PIAA 4K8JA 1WD0A 2PCFB 2E2HB 3T3NA 2FINB 1TZOA 3LB8C 5JXVA 4L63B 4JE3B 2N55A 3NTHA 3P7JA 4WAFA 1EY8A 1OXSC 3Q8EA 2G1EA 2QIEB 1YJIA 1II3A 1BQQT 1JWBD 1TKWB 3OMCA 2JX5A 5FLXL 5A35A 2HCCA 2FFKB 3Q8CA 4RKBA 4TKOB 2J53A 2K0PA 1QB5D 2FUG1 3BK2A 3M4YA 1TY2A 1PFBA 3ITPA 1TU2B 2DN8A 2EJGC 3CRKC 3D8GA 3LWUA 3ZJUA 5MPOA 1QNUA 5DEHA 3MA2B 1SNDA 2L9HA 4DAPA 4KV6A 3P1HA 2K33A 5EKLA 1R4PB 3GTLB 4O1NA 2RMMA 3T53B 3S17B 5EGTA 1RF2D 4OW0A 3QJYA 5ELCA 5CV8A 4IZ8A 1V1OA 2NBFA 1ILQA 1GAQB 5I9OA 2R6GA 4KN7C 3VR6A 2LY7A 3LYYA 2K1BA 3NBIA 3NSWA 1N5XA 4JX1C 2HUGA 1U4LA 1DJRD 1IBXB 4IQZA 4MACA 1VMPA 4PT5A 2H89B 1GJXA 1RODA 3BDCA 1EEID 2L11A 3HVZA 1JCKB 2PTLA 4FNFA 3A8KE 1E2VA 2K5DA 4MT5A 2XRSD 3J80E 3AEFB 1YNND 4RH6A 3S2HB 1J7CA 1IGCA 1LACA 4G7HC 2F0NA 2DLBA 3BIID 3D6CA 4A3DB 5BN5A 2AUJD 4EQNA 1B53A 5IGBA 2LUMA 1DOLA 3PUVA 5D3IB 3AE2B 1GOZA 1PFMA 1XWEA 2F0DA 2R7ZB 4L2YA 4KKUA 2DY8A 4RGNA 1STGA 2B2UC 4K6LA 3GTQB 4A3IB 1SE4A 1B9NA 4G57A 3R3OA 5HGTA 4A3EB 3NVYA 3P63A 2DNEA 3VA5A 1K8OA 5KRUA 1STYA 1XO3A 2VB3X 1KLUD 3ZYYX 2Y5CA 5AUKA 2K04A 3OSOA 1EWCA 3CKIB 3TSSA 3Q69A 2WU2B 2B2WA 1K50A 3KBXA 4U68A 2ZXRA 2MJEA 2L5TA 3V96A 1J7BA 4FVMA 1RCVD 1MSGA 3VR2A 4EGVA 2NUCA 1IUEA 1O7YA 3T13A 3SE0A 3P4SB 2LS01 3RFZB 3PIP3 3TEWA 3AEBB 1VRAB 4X3TA 4L8JA 1RJTA 4DK0A 5IGCA 4YWGG 1J7AA 3J81E 3A55A 1DOMA 3MXPA 1SNPA 4A3JB 5EBDA 4BBSB 3NBHA 3TUOA 5EE9A 4B9WA 5HFYA 4US9A 3S15B 1Q10A 4JBWA 4PMCA 2JZPA 5CYUA 3W5UB 5EQ0A 5FR3A 3URYA 4HCSA 3AE4B 1D1IA 2NB0A 1F2ZA 1HTPA 3HEJA 2LFNA 1S5ED 1BBXC 3M7NA 4R3DA 1JORA 2ICIA 3ONAB 1S4ZA 2VXWA 1S5CD 4S3SA 2LMCA 3SR1A 2PZWA 5FK9C 1PGXA 1ZP0B 2Q5WD 1GPXA 3GD7A 1MSHA 2KDMA 3I91A 4R9WA 2B2YA 3VR8B 1S5BD 3DWAA 3AE3B 1TS3A 2BDOA 4WJWA 1GUWA 2Y3AA 3WOFA 4FP5D 1FD6A 3MTSA 1U9RA 4ZHOA 2F3WA 1PXUA 2SNSA 1Y8PB 1FNWA 2MUYA 3MZ5A 1GUGA 4NJCA 2QDBA 4QMGA 4OHJA 5IGGA 3NUCA 1FMAD 1PDXA 3FPUB 3G6JB 3AEGB 3MHZA 1QOBA 1LTSD 1SE3A 3BYYB 3DM1A 3SR6A 1PZKD 2X69A 4XQQA 3TBIB 1TJEA 2N9KA 1TS4A 2PVOD 3SHLA 1H9JA 1XEEA 4A3BB 1TIID 1G8ZD 3I4LA 2KA7A 2KEDA 4C1NK 1GHJA 3UI3A 4K5WA 5H8YE 1RHPA 2GB1A 1EY9A 4USAA 3A54A 4FO2A 1HA6A 1ACCA 1JWMD 5EKKA 1MBYA 3S14B 2PQEA 2A68C 3E6ZX 2K5PA 2B2VA 3SDZA 3EROA 1SAPA 1V1PB 2ZXPA 1OFFA 2E74C 3A56A 3EA6A 4XTCS 3VR4A 1AZQA 3H0GB 2K7VA 2RKSA 5G3LF 3P4QB 3PO3B 1Y1WB 1UWMA 1V43A 2KQ4X 5FO9B 1SMYD 3A8IE 4JWSC 5G3LD 2PPBC 2JYEA 1AZPA 3GTGB 3P4RB 3Q8BA 1SNQA 4K8IA 1C4AA 1QNKA 4ZAIA 5IGFA 1STAA 1KAAA 3GTKB 5FO7B 4KKTA 2EJMA 3W5VB 3X3NA 4Q5VA 3MFGA 2BW2A 2NVXB 1E2ZA 1AW7A 1FCLA 2F0MA 1SSOA 5EJWA 2BA0A 4C1NI 1PTOB 2EYOA 3P4PB 2CVRA 2BT6A 2K32A 3K5OA 4C80A 2IT1A 4UAIA 5G5GA 1TVXA 2EJFC 3AMZA 2E2JB 1QCBD 3T3OA 3L4PA 2JA5B 1ZEQX 4K14A 2KECA 1D5MC 5BYQA 1XX8A 1KDAA 2LJIA 1BO0A 1OXUA 2BYTA 3VRBB 2YU9B 2M0AA 4V190 4TQ1A 1TS5A 2F0VA 3BDLA 5KEEA 4ZRZA 3BYTB 3K7AB 3J81L 1EZ8A 4DF7A 1HUNA 1LV9A 4N59A 3NTIA 3AE1B 4MN3A 1H9SB 5C4XB 1OQQA 3CU7A 4QUFA 3L7ZC 1N60A 1FGBD 1EYDA 3IFTA 3PUYA 3IAS1 1T6BX 4IN3A 1WD1A 4XDCA 4WH4A 2F0WA 4GDKB 3GTJB 1CK1A 3C1EA 1K51A 5DM73 4A3GB 4JWUC 1E0ZA 2KCCA 1W6JA 1ENFA 1G291 4X3SA 1EY0A 5BMGA 5E1FA 3OHXC 3S9WA 1GB1A 3KWLA 1YNNC 3LXFA 4KY6A 1HFGA 3C8YA 1JROA 3E0JA 4F7XA 4RNAA 5I6YA 2CHBD 4IUQA 4C3HB 5C6AA 2X6GA 1LT6D 2F0TA 1SIJA 2MEKA 2JSVX 2LHDA 1XTCD 1I3QB 2KACA 4N9PA 2BOSA 1WTQA 2BS4B 1M8AA 1RTNA 1RKNA 1E6EB 1XLNA 4IUUA 3NVVA 1LLRD 2A68D 4CKEA 1IBXA 1MHHE 3VQIA 3EFXD 5ELBA 1BF4A 1FNUA 3R2TA 2B76