4RH6A

2.9 angstrom crystal structure of putative exotoxin 3 from staphylococcus aureus.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
189
structure length
187
Chain Sequence
b'SESELKHYYNKPILERKNVTGFKYTDEGKHYLEVTVGQQHSRITLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSNSVQYIDYINTPILEIKKDDVLKDFYYISKEDISLKELDYRLRERAIKQHGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exotoxin 3, putative
molecule tags Toxin
source organism Staphylococcus aureus subsp. aureus col
publication title 2.9 Angstrom Crystal Structure of Putative Exotoxin 3 from Staphylococcus aureus.
rcsb
total genus 57
structure length 187
sequence length 189
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rh6A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rh6A01
5ELBA 3BYTB 2TSSA 1YN4A 1DJRD 1PZID 4NZLB 4RCOA 2AQ2B 1LT3D 1PZKD 2XRSD 3BVZA 3TSSA 1QILA 2R61A 3DWQA 3SEBA 1RDPD 1YN3A 1JR0D 1LT4D 1PTOH 5FKAC 3BVMA 3BZDB 3R2TA 1EFID 2XRQD 1T5XD 1TY0A 1B44D 1PRTB 4RGNA 1MD2D 3O13A 4O1NA 1F77A 1KLUD 1ENFA 3V05A 3MFGA 4RHSA 4RGTA 3DWPA 2O2LD 1RD9D 4RFBA 3BVGA 1PRTD 1CT1D 4TSSA 1TS5A 2IJ0A 1GOZA 1EEFD 1SEBD 1L0YB 1LT5D 3MC0B 1AN8A 5D3IB 3W2DA 1SE3A 2ICIA 1I4QA 2RDHA 1AW7A 5D3DA 4L63B 2QILA 3GP7A 1FNUA 4L6TB 1JWMD 1DYQA 1I4XA 1PTOC 1LTBD 1BCPF 4RHRA 3EA6A 1B1ZA 1FD7D 1STEA 1D6EC 1BCPD 1LTTD 1PTOB 5I4DA 5FK9C 1SBBB 1M4VA 1EWCA 2WV6D 1ET6A 1SJED 3EFXD 1XTCD 1SE2A 4RGOS 1LO5D 1I4PA 1PZJD 1PYWD 4ZYSA 4DXFA 1BCPB 5ELFA 2AQ1B 1ET9A 2XN9C 1RF2D 1ESFA 1FGBD 1JWUD 1SXTA 2QEJC 3URYA 4DXGA 2NTTA 4C56C 1PTOF 1SJHD 1EU4A 1S5DD 1XXGA 1D5ZC 1V1OA 1TS4A 1PRTF 1TY2A 1V1PA 2J4XA 4BWGB 1S5CD 4OHJA 4UDUC 1CHQD 1EU3A 2CHBD 5ELCA 1SE4A 1L0XB 1RCVD 1S5ED 1UUPA 1JQYD 3KLSX 1JWSD 3CHBD 1KLGD 1HTLD 1S5FD 1I4HA 1LT6D 1I4GA 1LTSD 3BYYB 5ELDA 2SEBD 4Z9CB 1HA5A 3R8BA 1D5XC 1V1PB 1LTID 1LTRD 1G8ZD 1KTKA 1CQVA 1BCPC 5TSSA 1UNSA 1PRTC 1LTAD 2RDGA 1BXTA 4RGMA 1FNVA 1LTGD 1FNWA 1JCKB 2AQ3B 1S5BD 1TS3A 1D5MC 1CK1A 3OWEB 1PTOD 1I4RA 1CHPD 1HXYD 2IPKD 5ELEA 1EEID 1TS2A 1HQRD 2XNAC 1LLRD 3DWAA 3R2IA 2Z8LA 4K6LA 2NTSA 4RH6A 2G9HD 1YN5A
chains in the Genus database with same CATH superfamily
2IX1A 1Q81C 2MP2B 1SNQA 3A8JE 1A2TA 3QR8A 4B9XA 2W9NA 3UDGA 1QOGA 1LM0A 3APDA 1C7YA 1Q8KA 4OL7A 3ULLA 2NVQB 3D0FA 3CCVA 5IP9G 5C3EH 3Q6SA 4FN2A 4PYUA 3PV1A 1OXTA 1QLBB 1U4AA 3LB8C 4J6IA 1EWIA 4NMZA 3S1RH 3ZIMA 2R92B 4BOSC 4P7IA 1AE3A 2XRQD 3L13A 2MBHA 1B44D 4C3JG 2L32A 5C1ZA 4NJCA 4XTCS 1N5WA 1H9MA 2DUDA 5J3BA 3C46A 4MJSA 3O13A 4ZQ3A 4XQNA 1QWYA 4LFBL 2LRUA 1SMYC 3TS2A 1ENFA 2EY1A 2L3ZA 2EYLA 4B3RL 4ILWA 3P42A 3Q8EA 2MPMA 3BZCA 4S3SA 4DV6Q 3JSVB 2K5HA 4JQWC 1H9RA 4DA2A 1NI2A 5EJWA 2D0PA 1UE7A 1AN8A 1TIID 1KC8C 1DCZA 3DEOA 4XE0A 4KIKA 2OEDA 5HKHA 1XLPA 2K25A 5ELNA 2WQYB 2QILA 3IXSA 3HOVG 1H9KA 3DMUA 4E6IA 4A3KB 1HR0L 3AE8B 3H3VI 4DAYB 1CTMA 4WORA 4GN3B 2IO0B 4C3IB 4FBJB 3K5OA 3SE0A 5FO8B 1Q7YC 1PVOA 4BY7H 3UQBA 1EYGA 4L8JA 2KMMA 4WJWA 3CIRB 1TWGH 4JIOU 4IUQA 1WYDA 1KD1C 2LFIA 3U4ZA 3H7PA 4ZRZA 4MM3B 2LXAA 2L1BA 2LS01 2YTXA 3I7FA 1SLJA 4JOIC 3Q3NC 4N58A 4DR5L 1R4NI 1ZYRD 4US8A 3WALA 3AE3B 2A74C 4XDXA 1ZKOA 3FRPB 4KGSA 3S2HH 3AEFB 1YNJC 1KF6B 5E6PA 1KNAA 3A8KE 1ZKHA 1RHPA 2HD3A 4MGYE 2WXHA 4IJLA 4G7OC 1OXSC 1ZE3D 1ILQA 1CKNA 1S40A 4XT3B 4S17A 5CHFA 4CDCC 2L05A 3LWUA 5IYDG 1OTCA 2BCOA 2V9HA 4C3HB 1EU3A 4B3RQ 3S15H 1EIGA 3IVFA 4QMGA 3FPPA 2IDYA 2K39A 3I73A 2KCCA 4ICUA 4W9CA 1ZW7A 1PUTA 1V81A 3P1HA 5M3FG 4YIJA 4YWMA 5J17A 1VDZA 4R4CA 3RNBC 1B2TA 4JCVE 2JYOA 1BUVT 2KVZA 3IAS1 2UXDQ 2R92G 2K5WA 1BCPC 1KFYB 2LRWA 4IOAA 2RDBC 1JOKA 2SNSA 2BDOA 3T13A 3JAMi 4LF8L 3QX1A 3K57A 2Q8TA 4GN4B 4IO9A 1GD7A 1TS3A 3A7AB 4GN5A 4QUCA 1YHAA 2WXMA 4AWJA 2M00A 1D1KA 4QL5A 1G291 1S72A 1HXYD 4YWLA 4LNKA 5BYSA 4U673 3ZNZB 2WXOA 5JVG3 4DR5Q 1EIYB 1WR6E 4I6PA 3N1YC 1PQSA 4K5XA 4X3SA 3Q8BA 1E9MA 2K8CA 4BBRG 4NY0A 1XX8A 1DJRD 1PZID 2AYOB 1E5WA 1P3QU 4OVVA 2M8SA 2IL8A 4GDLB 2UUCL 4EX5A 1NSNS 5JJZA 5FLXE 3I4MH 2JEBI 2DENB 3JSVA 3ZUNA 1XMOQ 1IW7C 2D2QA 2KC2A 4NJ6A 5LMNW 3NS8A 1OXVA 4GB9A 2D3CA 4DR6Q 3A7LA 2H89B 1TKWB 2EYMA 1XT9B 2NVTB 4RGNA 5IP9H 1VQ8A 1CJEA 1MHXA 2E75C 4EVOA 3GTGB 4O1NA 3V3XA 2NBWB 4KX6B 2BE5D 3ZNHB 3DXJC 2Q2HA 4LFBQ 2L0TA 1STYA 3Q8AA 2R6GA 3G48A 3MJ5A 4XIGS 5HGQA 3I63C 4QGUA 4A3LG 4DHZE 4NXNL 2UU9Q 4NXMQ 3W2DA 2CHZA 3TP6A 2JSVX 4B9KA 3SXHA 3IL8A 3HZXA 2X69A 3J7A5 3RN2A 2QDBA 4MM3A 3OJ4B 4LNOA 1U4MA 3HRZC 1N34L 1YNND 4A3OA 3CRKC 2N0SB 5K36H 1M8AA 4BOZB 4HKQA 1TU2B 1IL8A 1PTOC 2UUBQ 2KT7A 5EBCA 1MG8A 3UDXA 3S1MH 4NJ7A 3JC66 1VQ4A 2Z6KA 1GVPA 4A76A 1IP9A 1EWCA 1OXXK 5IYDH 1V86A 1VZ6A 4DV1Q 1MPEA 3G6EA 2YVCA 3TP5A 2DZKA 3PF5A 4IZ8A 4R1JA 2UWQA 1GJZA 4DXFA 4EZJA 1IZ6A 5ELFA 2G45B 1PA6A 2KQ4X 1JB7A 2QJLA 4NQLB 3K9PB 5JPNC 3HG9A 3RMKC 4IQZA 1V8QA 4PZ7A 1WH3A 1JRPA 4A3PA 1IYFA 3RZWC 2RSUA 1RFAA 1NBFC 3U7DA 1GKHA 5MPOA 2GI9A 4PMCA 1W3SA 2YTVA 1FGUA 4A3FB 3QCAA 1V80A 2B2YA 1Y1VH 3MJWA 1MIUA 5HGTA 5GADC 3M63B 3Q8FA 1F9SA 1MI0A 1DOMA 4IPCA 2F4VQ 3ML8A 2R7ZG 3ML9A 1CKMA 2L8JA 2KDFB 1FJGQ 1D8LA 3MZ5A 2HD5B 3I4LA 5C0XI 4CDFC 3GTLH 1YQBA 3A1QA 3AE5B 4Z9CB 3HVDA 4W9GA 1C1YB 3Q3FA 2DLBA 1BO0A 1SROA 1EFWA 1LTID 4JGHB 1WX8A 1E1TA 2OQKA 4BBRH 3VR8B 1X3GA 2IW3A 4N8X1 4ALPA 2K6DB 1J7AA 4C2MH 1FNVA 4UY8C 3ENEA 3NE5B 1EOTA 4GLVB 4HROA 3J80L 4KY5A 1W6JA 4UP7A 1IUEA 1CK1A 3MVVA 3Q3MC 2Q2IA 3RR5A 2FHTA 2JUOA 4XWTA 2JA7H 3D4WA 4IURA 1TS2A 5C3EG 2JA8H 1SGHA 2WNMA 1FFUA 1LV9A 2BS3B 1LLRD 5KYIA 3FDTA 3K80C 1LUZA 5L37A 1LACA 1VQHA 1PH3A 3HUIA 4RH6A 4POFA 2ZM6Q 1T6BX 1NR4A 3PO2B 1F9QA 2C7MB 2Z0EB 2MJDA 4NZLB 3GTPB 3D4DA 2F0KA 1XPUA 1ZUD2 2K1FA 5D2MB 3SEBA 2LEKA 1LT4D 1ZOYB 3ZKJC 1B53A 2RCNA 4DV3Q 2L83A 3NZ3A 4A3IH 4DHJB 1XYIA 1ZXHA 4DV5Q 2IHFA 1N36L 1EWYC 2WDRB 1TY0A 5BR8Q 3A56A 3KDFB 3T1YL 3A54A 2GB1A 2FFKB 1ZP0B 1KABA 1X32A 4K2LA 1Z6HA 4Q0FA 5ELOA 1E2WA 1SDFA 2EY6A 4PG3A 1WTXA 4DR6L 1WE7A 2Y3AA 3PHWB 4QCLA 5EKIA 1WCMB 2QDLA 5IT9c 1VQMA 3RN9C 3VFKA 2IJ0A 1P7EA 4G11A 3EROA 3QOLA 1B9RA 3TRZA 1XD3B 3U2SC 3ER0A 1SE3A 2X8XX 1TVXA 4OX9L 2KOXA 2L5TA 4C3JH 1QB5D 1JJCB 2ASBA 4JI7L 1MG4A 4AQ7A 5JOBA 2WS3B 1K8AC 2K8BA 3DM3A 4UAIA 1SYCA 2WXGA 2Q2TA 1B1ZA 3PO2G 3PT2B 4JOIA 3AE6B 3U30A 1K3BC 1YJIA 4IG7B 1SBBB 2M1MA 2WB1E 5C5MA 3AE1B 3FKIB 2CHXA 2INCC 4JI2L 3I90A 1IGCA 3JYUA 2IO1B 4I7ZC 2AQ1B 5AZHA 4GKKQ 2DYMA 1B4OA 2K01A 1BT0A 2CU3A 3TEXA 5JH5C 2SDFA 1V97A 2BWFA 5IKCM 4K14A 1IPGA 4DR2L 1C0AA 3VYUA 5IYCG 3HP3A 2PMZE 1I35A 3OTOL 1FXIA 2ZTEA 1JROA 2B2UA 1UF0A 2BA1A 5IT9E 4IM2A 2A5HA 1CHQD 3ZXRA 4M8AA 1HEZE 2PLPA 3AE4B 3TQYA 3DVGY 2ON8A 1PYBA 4PK1A 4KHZA 2RHQB 1RM6C 5IYBH 4YY3L 1O7LA 4ME3A 1CSQA 4BFRA 2KFJA 3C2PA 3A5UA 2SEBD 3MFYA 1UEBA 2DN8A 2N3SA 1N33L 5C44H 3EECA 2IBIB 2A6HC 4PV1C 5M5YB 2K14A 4JI7Q 2F0QA 4WJ4A 2PEAA 2KCNA 3CCSA 1UWMA 2N9PC 3I72A 1TKEA 1L0WA 4A20A 4W9FA 1NJIC 1HH2P 3RN5A 3NBIA 3A0JA 3QOJA 3NVVA 2BKFA 2FCMA 1YD8U 1V8CA 3A9KB 2B29A 4KV6A 1S4ZA 3HOUH 3HOYG 1U9RA 3M7GA 2Z4HA 4K81A 2VW9A 2F52A 3V2TA 5FLMG 5KHOA 2L76A 3HOXB 3HIZA 5KNCA 1YJWA 2EOTA 1KJTA 2RD0A 4C3IG 3ZJVA 2K5VA 1TWFB 4Y52H 3U50C 3OTOQ 3K7AB 2DWQA 1AE2A 4AP4C 2F0VA 1VF5C 2EVBA 4ZHPA 5DPTA 1F0ZA 4A3JH 1NVID 5KGUA 2UXCL 5C23A 1EF1A 1OQQA 2KDEB 3V6EB 4WWMA 1TQOA 3H94A 2GVBA 4DV5L 4DV4Q 3OLMD 5IGGA 3EIVA 1KQSA 2GN5A 1MSHA 3ND9A 1MKHA 1EEFD 1WYWB 4CDDC 5D3IB 1I50H 2B2TC 2ICIA 2B8FA 3AQQA 1B50A 1G6PA 3KVFB 4KZ0A 1JQ4A 2WX1A 2EYOA 1Z5SB 5LMUQ 4OVZA 4IOIE 2ZTDA 4HTHA 3J7ZC 4HJ7A 3H91A 1C4QA 3A1QB 4DR4L 1NEKB 3TS0A 2NBFA 1OEYA 2KJHB 3HM3A 4TQUS 4DPGA 1QT9A 4YTNB 4ANXA 3KLRA 2AWTA 1IW7D 4L5QA 4CKBA 1MJEA 2LGYA 1BCPD 4ZOHC 3DQVA 4MTNA 4HJGE 1GB1A 2WV6D 2DY8A 3W5OA 4EGVA 5C0XG 2NZOA 4A3MB 2N8NA 1J8IA 5IP7G 3IG3A 3L0OA 2L9HA 5FOBB 3L9AX 1PZJD 1UE1A 2ZVNA 3LDZE 3ZXVA 2N7DA 3Q69A 2WKDA 3DVGX 3N1XC 2JE6I 5BMIA 4XDDA 2JA9A 3GTKH 4PZ8A 1YITA 1WM3A 1PH2A 4QJFA 1P1AA 4PT5A 4D2KA 4IFDI 2C9WB 4P1CC 5C44G 5DAUA 4ZRKA 1YVCA 4Y7NB 1HR0W 3IKJA 1GUAB 3U4EG 1V1PA 1HPCA 4UDUC 1SSOA 4A3DB 1Q12A 1Z47A 3T9LA 3QHTA 5T8IA 5LHY1 2PYKA 2R93G 5M3FB 3T4AC 2GBRA 3K0XA 2RCFA 3CW2C 2A69C 1YI2A 1CKOA 2LWPA 2HT1A 2KZRA 2O6VB 4YSXB 4MZ9A 3MWYW 4QUFA 5ELDA 4DUZL 3EJIA 1AYFA 1WWTA 3B2GA 3P63A 4IWQA 2WDVB 5LMUL 3VR5A 1T0RC 5IOIA 1C3TA 2AUJD 2NWGA 3FHWA 1LTRD 2OTLA 1Y1WB 4JV5Q 1L2FA 1FXAA 3PIP3 4XZ4A 3PZ7A 4YCUA 4DK3C 1KAWA 1VQ9A 4KHPQ 4URKA 4LF6Q 4LF7Q 4F88A 3NENA 5ISRA 2A68C 2K32A 2M4NA 5C4ZA 3W1YA 3RNUA 1MHWC 1Y8RC 1VQ7A 4A3EG 2WDQB 4X64Q 1TBEA 1H9SA 3ZYYX 3BU2A 4GOCA 1MHHE 3GQBA 2VQFQ 4YL8A 3CQZH 2FMCA 1VMCA 1U0LA 2F0NA 1PH9A 1VQFA 2K52A 1FPYA 3SDLC 1SIFA 3UQAA 1WGHA 3UE1A 1XMOL 3T3OA 1WX7A 2JXTA 4PS3A 4W9IA 1EQVA 1BBWA 3SK8A 3K6OA 3G71A 1CUKA 3Q2AC 4TV3A 1LFDA 2PZTA 2NB0A 1EIFA 1PYSB 1GUNA 1WTQA 2J7ZA 1X65A 1II3A 3KLSA 4JI3L 5M3FH 2UYZB 1F77A 1CQFA 4E3CA 4N9PA 2OEOA 3V05A 4DXAB 1P0RA 5I9OA 4JI0L 4JI5L 5BN4A 2VUMH 4A3DH 2Y0SE 5D14A 4ACFA 3A55A 2WXPA 4QY7A 4ASWC 1Q86C 2HDEA 3U52E 4KSKC 1L0YB 4A3IG 1X6OA 3CCUA 1N34Q 3VVWB 3QIAA 1TTNA 2CQAA 4LF5Q 2GBKA 4WAFA 2UUBL 3RLNA 4IUTA 1IKMA 1K51A 1FL0A 4LNFA 4J8QA 1SFOH 1JWMD 2E74C 3NWTA 3A9JA 3UGBB 3T56B 2IX0A 3L08A 4HN7A 2QA4A 2JWUA 1IBLQ 4A9AA 1B8AA 3NTIA 3EA6A 4R4TA 1ENAA 3CXCA 3VTVA 1E22A 5T1IA 4ZRPA 4B0MA 2KUMA 1I94L 2L1AA 3GTJH 1ET6A 1UZXB 2INPE 4HIKA 4A3BH 1VCIA 3ABVB 4WAAA 3T8MA 4FF4A 1B9MA 2JA5B 3DHIC 4CKEA 4EQPA 1O7YA 3M95A 3LX0A 4HXDA 2H5XA 5JZEB 3CQZB 3U9OA 3APCA 2D11A 4TQ0A 2MNAA 5IP7H 2DNEA 4C4VB 4HCPB 1S5DD 2CCZA 3P75A 1FXTB 2LGDA 4I6NB 2KMAA 3SHLA 2LD9A 1WTVA 4LNNA 2IO2B 3ITPA 2B2YC 5AUKA 1EZ8A 5ELCA 1NE3A 1IXRA 4JI0Q 1VQCA 2IT1A 1L0XB 1WR1A 3ZTDA 2F0FA 2VUMG 1F2ZA 1I3QH 2XEWA 4ARIA 4X6AH 4MACA 3RNFC 4USAA 1IBMQ 2QEXA 4GKJQ 3T3NA 3T1HQ 2JN4A 3NSWA 4C1NK 2IO3B 2LMCB 1WXMA 4L5RC 3J81j 2DNCA 2FE8A 2R93H 4WIPA 3TMEA 5C4HA 3V61A 2JQRB 3FILA 2MP1A 3QAQA 1WGRA 4YHHQ 1BNZA 4ZRIA 3W9CB 1ILPA 2ZJDA 2WWZA 3CMMB 1S5BD 1WGKA 2NUCA 1V9JA 3H1UA 4A8XC 5M5WH 2WXQA 2Q8RE 2LASA 1EY7A 4DK0A 2ZM6L 1WTPA 4A6QA 4LMQD 2JZPA 2JA8G 1C4AA 3N1ZC 5CBEE 3AE2B 2JP1A 1L1OB 3QG1A 2Z1CA 1QZEA 4X64L 5JHAA 1OXUA 2KJXA 2WAQB 4A3GH 2RA4A 1YN4A 2B2TA 3DBRB 1K50A 4JI6L 4O42A 2O4XA 3P1MA 3UI3A 5I2XA 2RPVA 3AU5A 1O7ZA 1PZKD 4MGZE 3ZQ4A 4P75A 2E2DC 2CKZB 4R4IA 1YIJA 2CJOA 2BVCA 2JXXA 3HS0C 2JU6X 1R9TH 2MSED 3KF6A 3BVMA 2HE7A 2I2YA 5M5YH 2G4DB 2MJ3A 5IOCA 2BOSA 1L4ZB 4BXXH 1YX6B 2B63H 5BYRA 4ANWA 1X56A 2V0GA 1KDAA 1QOBA 2O5IC 3RD2A 1PRTB 1OGWA 2PKOA 1MD2D 4JBWA 5CTRC 2LXKA 4EQ5A 2PI2A 3H3VC 4W9JA 4WJNA 3FC4A 2HQEA 3BVGA 3J81L 4DV0L 1N32Q 4P71A 1VQOA 2BYVE 2W55A 2ZEQA 1GOZA 2XK5B 2Q5WD 5FR3A 3NWSA 2PZUA 4MGKE 2CH4A 3GO5A 1UBIA 4FDBA 2N7EA 4XXEA 1NI3A 2BB6A 4L6TB 2KYWA 3SGIA 2WXRA 5EE1A 2K5PA 1BCPF 3KYHC 4GNXB 1RRBA 3KW5B 3FKYA 3WA0A 3PQIA 2A5UA 3GTOH 1K8GA 4LFCQ 2JYTA 5G55A 1D6EC 5M9OA 4MHEA 2NN6I 2FBWB 1SJED 3NOBA 1J8CA 1PH6A 2WP8J 1XLOA 3HOXH 3S1NH 3RNEC 1JICA 2C5CA 2N55A 4KD4A 3TEWA 2L55A 1WMHB 4TKNA 1WYGA 4XX5A 2J0MA 1WTHA 3NTKA 4C56C 5D94A 2K5QA 1FEHA 1EU4A 4LAAA 1D5ZC 1TWHB 2V4DA 1T3QA 2B2UC 2BA0A 4OO1I 1YNTE 2IGDA 2PVGC 2WGSA 4DHZB 1WCMH 2FINB 5CBAE 5CR3A 3P4RB 5KHQA 2O5JC 1JQYD 3PO3B 1YQ4B 3VR3A 4GN1A 2MCNB 2BS2B 3GTMH 1YNJD 4KKUA 1F2LA 2EELA 3DBLB 3DOWA 3NG0A 4GLSC 5D7GA 4AUQC 4QF4A 2NVYB 4BY1G 3S1QB 4WWOA 2UUAL 4DN4M 2F4IA 4AYBE 4GKJL 2DZJA 2YV5A 2HQLA 3KH0A 5TSSA 2K05A 3PO3H 3T1HL 4GNXC 4HPLB 4EKUA 2KX3A 3OOCA 4IDIA 1GAQB 1RIPA 1SR3A 2F0UA 2NZ1D 4G7HC 3P4PB 1K83H 1X3PA 4IWOA 5A2QL 4WQMA 4KTAA 3LNNA 2PNRC 3I4NG 2LZ6A 2PVOD 3R7RA 3PZ8A 4IC7B 1QJOA 5ELEA 3CCQA 1EEID 1QVFA 1GJXA 2M0XA 1PV4A 2N1VA 2Y5PA 3A4SC 3I3TB 3E3XA 2JA7B 2C60A 2F0JA 3HOUG 3TJPA 1EYDA 5J1ZA 1UD7A 4H0LC 1F2RI 1OFFA 1SB3C 5CV6A 1HNWQ 1Q5WB 2L52A 1E90A 2A69D 3BVZA 4L2YA 4GGQA 4CBVA 4DAYA 5KNDA 3J7AV 2NPTB 1XLQA 4IN3A 2BE5C 3CC2A 3R3MA 1QQRA 5AZGA 3JAME 3M7NA 2BWES 4YCVA 3RMHA 3WDNA 4I6LB 2JVCA 2MO1A 4DR2Q 2W3SA 2JJQA 2K8HA 1ZXIA 4A3JG 1GM5A 2NZHA 3AU7A 1MGSA 3J81i 2GRIA 1XNRL 3DCGA 1OQYA 2E2JB 3FAHA 4WQOB 3RZDH 4DDGD 1QUQB 1E1OA 3G7LA 1TWAH 3NPPA 2JA5G 3X0WA 4AJWA 4UPAA 1QE6A 3HFZB 2D5DA 4BY1H 2CQOA 2BTEA 3S17B 4A3FH 4GNXA 3TIXA 4OZAA 3MXUA 3M4PA 3EFCA 2AUKA 4M8MA 1TWCH 2R7FA 1LT5D 2PZWA 3AFQA 3MC0B 3H0GH 4YY3Q 3TREA 3DUZA 4DV7Q 1ISNA 2AEHA 3IFWB 2DZIA 4JWUC 4HSVA 1YIWA 1VS0A 3E9SA 1D4BA 3P20A 1QVGA 3UI2A 5FJ8H 1SSNA 4WWNA 4IFDG 4DR3Q 3X3MA 5HG2A 3HVZA 1O78A 1I4XA 2FMMA 1VQLA 2VZKD 1DOKA 1WMHA 1LTBD 1BOSA 2QF7A 4ZK9B 2GBNA 3E0JA 4TMAB 3SK6A 4RM9A 4A3IB 1EL0A 3CP0A 5T1GA 4JI1L 2ZJQA 1LTTD 2KN4A 3BWUD 5I4DA 4MSQB 3Q22A 2REXA 3H9DA 4NAWA 1JW9D 4QIWB 3STBD 1YBYA 1HZBA 2W3RA 2R3ZA 1HA6A 5IYBG 3K58A 3DHGC 3PV0A 1K53A 1DXMA 4IW0A 1E7ZA 3ZVVA 4IUNA 3M4QA 3ZO5B 2K33A 1EQTA 2JSOA 1QCBD 4ZCKA 1VQKA 1FCCC 1VJKA 1WRIA 1VLBA 2KDIA 4FJZA 2MH7A 4J15A 4RG1A 5I9PA 1SNMA 2X38A 3OG5A 3H15A 4J3OD 1TKGA 1YJ1A 3IBEA 1R4PB 4JC0A 3HOXG 3BDLA 5TR5A 3RNGC 4LF4L 2A73B 3RZDB 1RFKA 1YOVB 4IOCA 4IJHA 2PIAA 3VHTC 5IP4D 4HIDA 2KKCA 5C3JB 3K5MA 4E71A 3PUYA 3CKIB 2HTME 4DUZQ 3C0RB 3VA5A 2WXJA 4LTUA 3K81C 1E2VA 3MC9A 2JXMB 2KMCA 1S5FD 1C78A 1STBA 2NVTH 4AQYL 3VTWA 1YMHE 2E5LL 1F1HA 2R2OA 2M56B 1HNZL 2LXJA 5A35A 3MTNB 1R4MI 3BZKA 3J81c 2F0IA 5JXVA 2VL6A 4LF7L 2KO3A 1G8ZD 3VUYA 4KKSA 3NVWA 4R3DA 4BBNC 4QIWE 3E56A 2DYOA 3LJ3A 1UE6A 4O2DA 1N63A 4RGMA 1JWAD 4FF1A 4FP5D 4AOFA 1FNWA 1D7QA 2P5ZX 3HRDD 4IUPA 1NNXA 1X9NA 4KKTA 1N62A 3OWEB 1VZ8A 1I4RA 3W1SC 2JRHA 5C4JB 2KQSA 1K83B 1HQRD 4APVA 1Y8NB 1T9HA 2B2WA 4A90A 3VRAB 4A3DG 1MFWA 4HWIB 3M62B 4B3ML 4FULA 4A4IA 1GNUA 5EE0A 2V1YA 3J81E 5BMGA 4ODGA 2PMZB 4JWSC 3F2DA 3WANA 1BDOA 3S1QH 5IAAC 1EY6A 2KQ3A 3D6CA 1YHQA 4OONA 1OQRA 1RDPD 4GU2A 3GTJB 2EJMA 4MNOA 4R4QA 1JORA 3GTMB 5FKAC 1HNWL 1ML0D 1ZGUB 2DAFA 3CCRA 2MLBA 4FVMA 1IBKQ 2OJWA 3S1MB 2O2VB 3U7ZA 1AEXA 2PQAB 3OYYA 1E2ZA 2LMCA 3ERSX 2MA9B 3K0YA 4IM3A 1RTNA 4TRDA 2BT6A 3OJ3A 4O0AA 2RHSB 1ICFB 4DV6L 1YNXA 1RTOA 2KNBA 4IPGA 5EGTA 2PPBC 5AUIA 3GZNI 1VQJA 2JA6G 1RD9D 5AZFA 4LDTD 3VTUA 4TSSA 4FADA 2E2JH 2PW5A 2JA7G 3EGRA 4J1MA 2B63G 1HUMA 1I4QA 2F0OA 2JK8A 4NAWB 4ZKCB 3NS1A 1YZ6A 1AZQA 4CQNA 1A0IA 3FKIH 4L63B 2X6LA 3HM6X 3T53B 4MEMA 3QJZA 2GLSA 4CHKA 2LVPA 2A19A 3HKSA 3GTOB 1H8CA 4KHPL 1V6EA 5J22A 4TQ1A 3CRLC 2XWJB 3H0GG 4BS9A 4DR3L 4A93B 4P1BC 5DPSA 4I7AA 1Z7TA 4P72A 3VR4A 4JW0A 2KOLA 2N78A 3F8TA 2CH4W 2KHWB 3JVZX 3U58A 3EFXD 3DWGC 3I2ZA 4KJOA 2EXDA 1Y69U 3PMFA 3QJYA 1KM7A 2JF5A 3PHXB 5E6JA 2DBYA 3WAPA 4EEWA 1ENCA 3V62A 2UXCQ 4OWTB 5M5XH 1K3RA 2EYPA 2MUYA 1SJHD 1F2RC 3PRZA 1QVCA 2PTLA 1QOHA 1KNEA 1KIXA 1T0YA 2XK5A 4U68A 1SNOA 3IFDA 1PXUA 4H44C 1XNQL 1TT5B 4ZYNA 1VRAB 3I55A 2RGFA 2E2HB 2PE6B 4HRSA 5HHDG 2J52A 2NBVB 3PLUA 4G50A 2J0TD 1FD6A 5AFWA 1PMRA 1ICWA 1R9TB 1LXDA 4J6HA 2EJFC 3L2PA 2XTIA 1IYUA 3D4RA 4DAPA 4OO1G 1YJJA 2KQ7A 4LK1C 4AIMA 1CKNB 1IL2A 1RLFA 3RLOA 2MWSB 3AH7A 1VQGA 3WAOA 2KHIA 3S1RB 2RBMA 3STBC 2M2LA 3BJUA 4PZ6A 2EMTA 3RUIB 1IGDA 2JWZA 1K28A 5EPJA 1BXTA 2XIWA 3JAML 1WTRA 2RQXA 3S15B 1ROEA 2D9UA 4KDLB 4C3HH 3I4OA 1LTGD 2C7NB 1X1MA 5C3XA 3SDZA 4K1RB 3H3VH 2N7JA 4Y7NH 3VDZA 2PNHA 3HGBA 3S1NB 5CHWA 3CD6A 5IWAL 4HIOA 1D3ZA 2XNAC 3R2IA 1IBLL 1U4PA 2O2VA 5IYCH 1HCZA 2K75A 2NTSA 4TUUA 5CV4A 4XDCA 1BBXC 3GTKB 3VYSA 5ELBA 2QMTA 2R93B 4HMIA 1FRRA 1ZYRC 3OIQA 2VQEQ 3L0WB 2DY7A 2DAJA 2LXCA 3HHMA 1UBQA 4DHJD 1QZHA 4RCOA 3K9OB 4B3MQ 2ACZB 4R4OA 1ASZA 1YN3A 2A4ZA 3CF6E 4HCEA 1QNUA 1C4PA 3M9BA 1NYQA 2D3BA 2KEDA 4FYDA 3R2TA 3HKZE 3RUZA 1XQQA 3CSFA 1J7BA 1V43A 2OOBB 4JI4L 5DM73 2ALYB 1ZEQX 3RPFC 4PQXA 4UP9A 5CHVC 3VR2A 4C1NI 3ZDMC 3RFZB 1HQMC 4X62Q 3M85A 3TZDA 1E6EB 1X3FA 3C8YA 2LGXA 2MEKA 4KMUC 3H7SA 4WJOA 2RKSA 2EKEC 1M94A 3TL5A 4A3BB 5D3DA 5LMNL 1XCQL 2YEPF 1PFNA 4EQOA 4IWPA 2FUHB 4Q2JA 4B08A 4BA2I 5E7NA 3E5SA 1DOIA 1FD7D 1VZ7A 4DR4Q 4A3GB 1FMAD 4EUTA 2N9EB 5F2DA 1NDDA 3K7AH 3SFEB 1L6UA 2D2CC 2E76C 4XYQA 1SE2A 2CWAA 2QW7A 4KLKA 2NMQA 5I6YA 4GDKB 2Z6BA 5DM63 3FPUB 4ZYSA 1V1QA 4BY7G 2C5LC 3S14H 1E7PB 3AM9A 3KDFA 1ESFA 4FXKC 3D32A 2VUMB 2QEJC 2D10A 3NRZA 2BYTA 5KNBA 2G1EA 4BXXG 4G7ZC 3ETRA 3H7PB 4BKGA 1W2BA 3AMZA 1DGJA 1WVLA 4BWGB 1FYCA 3VDYA 2SOBA 4OHJA 5JEAJ 4YCWA 2F0PA 4JG2A 4K8JA 4DAVA 2CW0D 3RNAC 3AXCA 4JE3B 1G51A 1SE4A 2XSCA 3AFPA 2BH2A 3O65B 2F0MA 3JAMc 1FJGL 5IN7A 3DBHI 4CHTB 5FLXc 1VQIA 1KLGD 1I3QB 5JJLA 1B9NA 2A6HD 2D3GA 3SHQA 1BMLC 4P74A 4R9WA 4LF5L 2L00B 3DWMA 4X65L 3W1GA 2E2HH 1YX5B 2JX5A 1WJ6A 1XO3A 2F0WA 4OELB 1WY8A 3KYDD 5IO9A 2BPSA 1F9JA 4M00A 5CV7A 5IGDA 5CGKA 2F0HA 1AARA 4M01A 5M5XB 2UU9L 1DOLA 4EQNA 4NXML 1JMLA 2MW5A 3AEGB 4YTPB 2K5NA 3TP8A 4BVUC 3VR9B 2B2WC 4DFAA 1F9RA 3J80c 3PIOA 1Y8PB 1NCVA 3CMAA 2N9LA 1PTOD 4C7YA 1CHPD 3I4NH 1RAXA 1IKLA 3AB9A 2B3GA 4BBSG 3BS1A 3BY4B 3NBHB 4LFAQ 4A3FG 4WH4A 4KKIA 4C3HG 1DOXA 2F3IA 4Q5VA 4HDOA 5IWAQ 1Y1WH 1PH1A 1MJCA 1T0QC 1WXSA 2VXWA 1CFMA 1K8RB 1JWBD 4ANUA 1H4RA 3I4MG 2L7RA 5E6OA 3NP8A 2FCSA 4DV3L 3N20C 2ZVOA 1HTPA 1VQBA 1X3QA 1JR0D 4RKLA 1I6VC 1N8RC 3NHHA 3L54A 2LGIA 3T1YQ 1EF5A 2XBBC 4GSWA 1EFID 3APFA 3PCOB 3U4VA 2CJNA 3R66C 2QCPX 1K52A 2IWHA 1U4RA 1IBML 5D65A 4KHVA 2PW7A 1WRDB 3TEYA 1KLUD 4JI4Q 1WF9A 4P16A 3DHQA 1VR9A 2UXDL 1A63A 3VH3B 4JVZA 4RFBA 2WYQA 4RF0A 5DPRA 4IKGA 1GB4A 4PNYA 4A3KG 2A6EC 1KAAA 1VQ5A 1TIFA 1LYLA 3NK9A 2WU2B 4ZDVA 4MELA 5IY0A 1W6KA 3K5NA 4AYBG 2LY7A 3AECB 2D0OA 3N6RA 1EUJA 5FLXL 4L1BA 2PI2E 1TWGB 3GP7A 5BMHA 4REZA 2HIXA 3CMEA 2QDFA 5E6NA 1VF7A 4HAEA 5FJ8G 4BY7B 2BYEA 3OPOA 4BA1I 2A8VA 3K8AA 4LLGM 3PGEA 1HHVA 2EYHA 2WAQE 4XWWA 4JI2Q 2AL6A 4AH6A 1JALA 5IE8A 2CFMA 3SK4A 1Y1WG 3SR6A 3DM1A 4X57B 5IGFA 1B3QA 1K0SA 4RGOS 2F1MA 1PFBA 4XYOA 4HKZE 1HUNA 2I1KA 2RVLA 3PVLA 4NPSA 3J80i 5C4JH 5E3FA 5NUCA 1U4LA 2E8GA 2IHEA 2K03A 1FGBD 3C19A 1KOTA 3B2FA 4LF4Q 1EY4A 2YEPB 1XWEA 3PIO3 1H9SB 1PTOF 3P2BA 1N61A 4MT5A 2WU5B 1TS4A 1N60A 4YT0B 5CV5A 2HTHA 3HOWG 2O6VD 5E4XA 4NP5A 2K22A 3AEVA 2V3PA 4A3JB 4M0WA 3OWFA 4BBRB 5BR8L 1KRHA 1GUOA 3NTHA 3KLSX 1L6VA 1ONLA 1WGYA 3H6MA 3D8GA 3Q23A 2MBEA 3DBSA 3ICEA 2I5HA 1NMFA 1LTSD 2HDLA 1NY4A 5C3EB 4JI8L 4X3TA 2KK8A 3PUZA 4GXBA 3Q0AA 5C3WA 3A8IE 1D5XC 4G4KA 4CJ1B 2WXNA 5KYLA 4LK0M 4N59A 4DDID 3AEDB 1KTKA 1SF0A 2IY1B 1CQVA 3ERQA 4RMFA 3RYTA 1RJTA 1KDBA 1PFDA 4OW0A 2RDGA 1WD1A 2HJ8A 3HOUB 2KANA 2NBUA 2QSDA 3AEBB 1IBXB 2VS1A 2Q2UA 1UE5A 1JT8A 1GUSA 4K6DA 4LW1A 4HK2A 1MSGA 5G2NA 5KIXA 4YHHL 2ZW0A 4PYZA 1RYJA 2OF1A 1C48A 3EQLC 1Q82C 2VRRB 4CO7A 1JB3A 3DWAA 2G4SA 4RF1A 2Z0DB 3C3LA 1WJUA 3DLLA 3M3JA 4ITKA 2M9VA 4KN7C 4JPSA 1P9DU 1EY8A 4HMJA 1HFGA 1WGGA 4ANVA 5GAEC 3N52A 5L83A 3WWVA 3EVQA 4KY7A 5IGBA 3TSSA 2MO0A 3TP7A 1EQQA 4IFDJ 2R61A 3V60A 4A55A 1E8ZA 3AI5A 1UWVA 3HK0A 4OWWB 4GKKL 5HFYA 2CR5A 3OMGA 1F9PA 4G3XB 3GDEA 5JEAH 3ZGZA 2QGQA 1J0GA 1STGA 2MBBB 2VZAA 3TEZA 1T5XD 4AYBB 2OTJA 3PSEB 4OXPA 4RA8A 2YTYA 4DUYQ 1DONA 2DYBA 3S17H 2PE9A 5C4XB 1FM0D 3MXPA 4JI8Q 4FLHA 1E8YA 3DWPA 2N9XA 1J9OA 1TWAB 4HR7B 3AULA 3VYRA 3VH4B 3ZRCA 2YYZA 5C0XH 2WHIA 1PGAA 1PFSA 4L5TA 2LHEA 1JJGA 3AN1A 3IT4B 4WURA 4RAUC 5EPLA 3NQIA 1SN8A 4GOPA 2D5GA 1N32L 3VXWA 5FO9B 3H8HA 2WAQG 1HFNA 1VMPA 3RCZA 1NUCA 4DK1A 1NYRA 1D1IA 1N33Q 3MXNA 3G4SA 1XLNA 2KX0A 2MP2A 1FNUA 2OQ0A 3M3YH 4LJOB 3ULJA 1QG7A 3CCEA 4OIJA 3OHXC 3DBRI 4GOPB 4GZYC 2YLMA 3GE8C 1G91A 3KJOA 1STEA 1UGMA 3I4MB 1WJNA 4YTMB 5M3MH 3PUXA 4HEDA 3MXNB 1E10A 1WX9A 1B3AA 4C3JB 1NENB 1VQEA 2KTRA 3FILB 4ARCA 2AKWB 2KXJA 2ZJPA 5CC4A 4DF7A 1DM0B 2VB3X 1XMQQ 3G6JB 2XN9C 5EAYA 4ME5A 1ASYA 1RF2D 1L7YA 4FHJA 4JBKA 1B7YB 2BH8A 2I5MX 3NBHA 4HEA1 4ZLTF 2Y5CA 2OXPA 2K1BA 1WFQA 2DGYA 3SD5A 3I70A 3IHPC 2KENA 5C44B 2QC8A 1TR5A 1TZ1A 3CC7A 4NB3A 4GDLA 5LNK1 3SFDB 2RDFA 1RCVD 2X6GA 2Q8IB 4IALA 4DAMA 4GOPC 3H6NA 4BZAA 3B1LX 3W5UB 3DEPA 1K0RA 2E2IH 2F0EA 1WIAA 3L17A 5EE9A 5KEEA 1A3VA 1WOCA 3GTPH 4YWGG 2AX5A 3UE0A 1VCBA 2J53A 1V1PB 2OCEA 1E24A 2MHVA 3PO2H 3HOWB 2LGSA 3ECIA 1HZAA 2HCCA 1GC6A 3I91A 2J42A 4CGYB 1HZ6A 4KDIC 4GLAC 4FXCA 2C9OA 2WX0A 4LJZC 2BGFA 4MTKA 4MSMB 4FA6A 1PGXA 2F0GA 2E6XA 5BO4B 2CVRA 1GG3A 2Z4IA 3QK0A 3TZUA 4X66L 4YWKA 2YU9B 3WIMA 4B3SQ 4IM0A 5J2RA 2VQFL 5HY6A 4HSPA 1XJVA 2W82A 3FMCA 4BKTA 2ZPYA 1TT2A 1HNXL 4C2MB 2ES2A 2K6AA 3ALBA 4KVGB 1EUVB 3GS2A 2Z8LA 3PPAA 1SNCA 3Q8DA 2ZJRA 4LF9L 2FIFA 3RZFA 2IX3A 2ZXPA 2K04A 3Q3JA 2DZMA 4HJ9A 1Z9FA 4JPBW 3NHEB 5CV9A 4HVBA 3KBGA 3TUOA 3A9KA 3TBLD 1SNPA 1SMYD 4CYEA 4H2AA 3T51B 1Q1BA 4FJYA 3RULA 2WINB 2ZNVB 1S1QB 2IZVB 1IYVA 4P6VF 2L12A 4L5SA 2EYJA 4KJNA 4P2CB 1KHIA 4ZAIA 2J7QB 4LJPB 1UWXA 4A3KH 4OIKA 4ZRQA 5JJIA 4LWCA 4OZCA 2PW9A 1Q90A 4N8FA 2Z9HA 1I42A 4IPDA 1EYCA 2HDMA 1XNQQ 1L5PA 3AE9B 1F2MA 5EDSA 2RPQA 3MFGA 3KFUA 4F7ZA 3W1BA 4E74A 2O2LD 1Y56A 1EWHA 2B76B 1IYJB 4HDQA 3VUXA 4W9HA 4XQQA 3L7ZC 2EQSA 3D6WA 1RL2A 2MX2A 4AS1A 1DOYA 4M0WB 3DBLI 3AEAB 2INNE 3DBHB 1EZ6A 2VY3A 2FAZA 2K9XA 2OT2A 1HR0Q 3R7QA 3PREA 2GMIC 2PJHA 1GUTA 1SYFA 3EBEA 2D07B 4DV7L 3VUWA 2L4NA 1VQ6A 2LJIA 1L1OA 1HNXQ 4HJ5A 2L0FA 3NUCA 4BBNF 4I65A 4RHRA 3TMPB 3F2BA 1E7UA 2KDMA 3KF8B 3UIOB 1WZ0A 1IBXA 1M4VA 1STHA 5JAVA 2LHDA 1P7FA 3JW0X 2JQOA 4JI1Q 1PDQA 1I4PA 2KFKA 5AEKB 4QB4A 2PQEA 2NVUI 2QKIC 5M5WB 2A1AA 1IBKL 2A6ED 4HCNB 2EXZA 2RR9A 2KWVB 3URYA 3CAMA 2WP9B 4NPNA 1PH7A 1BUIC 3PGZA 3DDCB 1NR2A 2MFIA 1V1OA 1CA6A 1WXQA 2KAJA 3GTGH 4N9TA 2UU7A 3LXFA 1TY2A 2WXLA 2BYFA 1NBWA 3FEWX 1I5FA 1ZDVA 2RMMA 2CU1A 5E4WC 4LCDE 2DHZA 3ZNID 2WDTB 3CHBD 4DGZA 5LL6X 5D6JB 3AV8A 3MHSD 1I4GA 3K7UC 1TKYA 1K73C 4FJVB 2LUMA 5EQ0A 2N4FA 3RT3B 4LF8Q 4AQYQ 2DJFC 1WI0A 4BKSD 1WTWA 2FCNA 2R7DA 4G57A 5KRUA 1VQPA 2WACA 3HEJA 2BDNA 3ONAB 2N1WA 2VZKB 3SK5A 4EZLA 2EPBA 2FXQA 2KD0A 2IGGA 2GBMA 2LVOA 2UXBL 1R4NB 1XEEA 3N3KB 3LWEA 4GLXA 5CMDA 2Y5BB 4PS8A 2JA5H 4A3LH 1G6JA 2IPKD 2W54A 3GE3C 2L11A 1Y1VG 2LFNA 4B3SL 4CDEC 5DNFA 1EIHA 5BN3A 2G9HD 3U8ZA 1SYGA 1VDVA 2KCMA 3QIJA 1L4DB 3A74A 3NVYA 3HOZG 3NZSA 2UUCQ 3Q6BA 2K7VA 2PCFB 5G5HA 4RWSC 3U9SA 1V5TA 2MJ8A 5JVH3 5HI1A 2AQ2B 1V49A 2KWCA 1QILA 2NN6G 1SFOB 5IODA 2JZ3B 1WTOA 3AB5A 4IFDH 4B95A 3H09A 3ZJUA 2KDBA 1LQBA 2AWOA 2AWNA 1JE4A 1SRUA 2LVQA 3AU4A 3TCAA 3VA7A 3J7AF 1XPOA 5L95C 2B2VC 4WWPA 1XCTL 4C80A 1KL9A 2FUG1 2LI5A 2MQJA 4DV0Q 2J0JA 1G2SA 2H88B 3S2AA 3F1ZA 4RHSA 4RGTA 3R3OA 3S2HB 5FO7B 1HTQA 4A3CG 2ZXOA 3EUB2 3F2UA 2K3UA 1GHKA 3AEEB 3MP9A 5C2TB 4FF2A 3A9JB 2XVSA 3I3CA 1SEBD 5JEAG 4KI0A 4JLCA 4US9A 1TGZB 1WXAA 3DVNU 4FXDA 1GHJA 2N88A 5M3MG 2K28A 1PH5A 2UXBQ 2MRPA 4MH0E 1LABA 5H8YE 2R7ZH 1QOFA 1X3EA 3Q24A 1N6ZA 3P4QB 4ID6A 2EE1A 3S14B 2JY6A 4W9LA 4XT1B 3W3AA 5H92C 4DNRB 3AMUA 1WJ4A 1UELA 1TYGB 3OSOA 3PRPB 1SAPA 1J5EL 2DJGC 3MAQA 2KWUB 4II2B 1N9WA 1XTCD 2KHJA 4HPMB 4PMBA 2KTFA 4F8CB 4LUOA 3I57A 1PYWD 1STNA 3EFUA 4XC2A 3HKZB 1A8VA 5IA7A 1CA5A 3CC4A 3BIID 4GMVA 2B3AA 4QAYA 2K0PA 4FHKA 2RSNA 5G5GA 4N6EB 4KGRA 4MDKE 3PTFC 2KBNA 5DLQE 3GOEA 2A68D 5C5LA 2F4VL 2HUGA 2LJ5A 4RM8A 5JJKA 4C7ZA 2WKCA 1BQQT 4M1UB 4PMWA 4HJAA 3CPFA 3A33B 3NUHB 4DNIA 2KEEA 2L0CA 2DX5B 1I6HB 2PMVA 5GROA 4IUUA 4QQBX 1Y14B 1T0SC 3I8ZA 1LT6D 4NDXA 4BBSH 1Q8IA 3BYYB 4KSLC 3TDQA 4K7WA 2BF8B 1Q10A 2PQAA 3PZDA 4K7UA 5LMNQ 2ZT9C 3GV6A 1CZGA 3GZNB 1CSPA 2KVRA 3D31A 3UIPB 3PUWA 3RLFA 3HOZH 2JRIB 2KTRB 3GD7A 2HIVA 2LSSA 4ABNA 4B9WA 2ZW1A 3DHHC 2I07B 3X23A 5DCNA 1J5EQ 1ESRA 2AQ3B 5C4XG 2CKHB 2XGTA 3A4RA 1VD2A 3HOVH 3HOVB 1GO3E 4RKBA 1CI3M 5C0XJ 2QHOA 1EOVA 2EJGC 1PFMA 1VQAA 2N49A 2Z6KC 4DU9A 1JMCA 2FIDA 2XWBB 4A3MH 4K6LA 2QCZA 2V4LA 4RMAA 2F0SA 2F03A 3E9HA 1K8OA 1LM8B 2WLBA 3CWIA 1Q46A 3UDIA 2YU9H 4MGIE 3C1FA 3D3RA 5LLIA 4A93G 1GXDC 4C3IH 2K4KA 5A2QE 1JC7A 4DV1L 3C1EA 4N9F4 2NCNA 4BBSB 3ZJYC 2DNFA 4CKCA 2I38A 4A3GG 4NW2A 5AJ3Q 2WXKA 3KUDB 3IT6B 1MVKA 2B8GA 2KFKB 5CYUA 2D62A 4V0BA 2K50A 5GQOA 3T16A 3WOFA 1WD0A 4MIUA 4POGA 3HOWH 1I50B 2ZCCA 4OO1H 1FVIA 3B9JA 2IY5B 2C7HA 1P8LA 1N5XA 4EFOA 4NKLA 2E2IB 4R8IA 4LDTB 1F2YA 1FCLA 3MXGA 4OEMB 1XTDA 2IYDB 4XYCA 1K8MA 2INDC 4ZUIA 4ZKBB 1GUWA 4DBGA 1TXYA 1AP0A 4X65Q 3QWNA 4WJ3M 1R4MB 3L16A 3V96A 3DVNV 1PRTD 3EHVA 4LNQA 1H9JA 4OX9Q 4EOYA 4OWXB 5LXIB 2ZTCA 2FNJB 2CS4A 2MGSA 4NNJB 1WJJA 5GMVA 4FNFA 2JYEA 2R92H 1QUQA 3LGJA 4ULLA 3S16H 1UEAB 2KCTA 1DZ1A 1AW7A 1BKBA 3M4OB 2BBCA 3N32A 1WSPA 4TKOB 4A3CH 1TWFH 2BW2A 3PO0A 2NVQH 4ZHOA 4DWFA 3CCMA 2ICEC 4LFAL 1H95A 3P7JA 4B3TL 4A3MG 3MHBA 3VR6A 1PTOB 1C4CA 1C76A 3B0AA 1XMQL 4IUVA 4A93H 1X54A 1CMXB 4F8MA 4BKSA 1M1KC 4ZRJA 1EY0A 4DNTB 3OAWA 5EKLA 1I94Q 1NTGA 5JPMC 5J39A 2VNUD 1BCPB 5AJ3L 4G0NB 2QIEB 3NJTA 5CV8A 3BINA 1UAPA 2ID0A 3KK7A 3J7YW 1JWUD 4XQJA 1SXTA 4OVUA 3LYYA 2LKVA 1C9FA 3CPWA 1WCMG 3CCLA 1XXGA 3B6YA 3HOYH 3NY5A 1E0ZA 3CCJA 2TMPA 5I2YA 1PRTF 3BK1A 4HPPA 2J4XA 1Y8OB 4JYAL 4K2KA 1ZDXA 1CM9A 3J80E 4L23A 3UINB 1YNNC 3MEFA 1N36Q 4NQKE 3NXWA 5I6WA 1SE8A 2E5LQ 3K5LA 4DR1Q 1HNZQ 1HZ5A 3E6ZX 4GIVA 4W9KA 3VQIA 1XNRQ 3TEHB 3F2CA 4DKAC 4RNAA 1SYEA 4IPHA 2WIIB 3L4PA 5DEHA 3R8BA 2CHWA 2VH2A 3TN2A 3KF8A 4OZBA 4KN4C 2MJEA 1PLFA 2ATWA 3PF4A 2WXFA 5DPWA 1KRTA 3RZOH 3QC8B 2KLGA 1B70B 1UNSA 1VQDA 1LTAD 4X66Q 4A75A 2PPHA 3Q8CA 3X3NA 1HE8A 3GB1A 5E1FA 1AZPA 4CJ0B 2N9KA 4B3TQ 4NAMA 1YQ3B 2KWDA 2EZVA 5IGCA 4M8NA 1SYBA 2F3WA 2OHFA 2NR2A 4WJQA 1PHJA 3WAMA 5LL6S 4YXDB 1SMXA 3HOYB 3KWVA 4X3KA 2NN6H 2KC1A 2F0LA 3KF6B 3ZRFA 1EO6A 1QOAA 3ZW3A 4A3EB 2VH1A 4FXGC 1HJPA 2EY5A 2G9DA 1YN5A 3GTQB 1BBUA 2CWPA 1AH9A 1QKZA 2TSSA 2LUEA 2HCIA 3S2DB 2NVXB 2ENBA 1ZPSA 2AL3A 1SE9A 2V3SA 1PGBA 3RI7C 1KXLA 1A3TA 1X55A 1LT3D 4H7BA 2XRSD 3NQTA 2HHHQ 1G6ZA 2KN5A 4XGAB 4JBJA 5BN5A 1MBYA 2H1EA 3KJPA 3W5VB 2B2VA 1PTOH 2I1JA 4JYAQ 1Q1OA 2O6VA 3ZDTA 1S3OA 2SNMA 2WB1B 3E9IA 3HKZG 1D2BA 5GXGB 1WE6A 3L3OC 4DR1L 1TJEA 2KLCA 3OW2A 3I9V1 1AWDA 2JT4B 1E8XA 3KLWA 1K9MC 2V3NA 2Z59B 2GA4B 4KD3A 3UDFA 3BK2A 3J9CA 3FP9A 1WI5A 2BB5A 1E3PA 1EY5A 2UUAQ 1Z2MA 1XPRA 3NZUA 2GVAA 1YHBA 2VB2X 1RWSA 1TS5A 3BG3A 4OGQC 1KH0A 1JOQA 1A70A 2JA6B 1O80A 4K0KL 4KV2A 1STAA 3VRBB 3B08A 4WFN3 2D3AA 2M17A 1C8CA 3KUCB 2F3VA 4UP8A 2M0AA 2RDHA 1QZGA 5K36G 4NXNQ 3EN2A 1KDCA 3TBIB 1GUGA 1JOOA 4HJKA 3MTSA 4C00A 1YJNA 1ACCA 3UF8A 1QNKA 4TVAB 4B6WA 1GC7A 3QWZB 3QARA 4P73A 4LFCL 2JEAI 2JZZA 3E0EA 3Q14C 4RCNA 2JA8B 4K7SA 4M02A 3KOJA 1LTLA 2Z0SA 1BVSA 5K5PA 1Q3LA 3FVQA 5H1SE 1SIJA 1ET9A 2AHOB 2EMSA 3P4SB 5CX3A 4UHVA 4LF9Q 2M19A 1NMGA 2G3QB 4V190 1S3SG 1JRUA 2V4IB 1P98A 1E8WA 2EDGA 4DR7Q 2BQQA 3H0GB 4EZKA 1OEYJ 1FO4A 1TWCB 2B39A 3KUPA 4X3UA 4DUYL 4BAXA 1QF6A 1V5OA 3MEHA 1G2TA 3PIPA 2GOWA 1WM2A 2HJ1A 2E3TA 3IAM1 4DV2Q 3GTLB 1FIQA 3PSIA 3BDCA 4BY1B 4KGTA 2NYZD 1S5ED 3HOZB 2KACA 1UGJA 1UUPA 3RNCC 1JWSD 4AJYB 4K0KQ 1HTLD 4CJ2C 4DV4L 2RF4A 1A15A 4KIKB 4A3BG 2I5LX 2MBQA 1Y1VB 3PRMB 4DK5A 1HA5A 2AMCB 2F0DA 1PH8A 1FRDA 1KRSA 1J6QA 5IGEA 2R2QA 4WJPA 2NS5A 1P16A 3GTQH 2MBOA 1I6HH 3M4YA 1RKNA 4F1SA 3RD4A 4A3EH 3QQ8B 1HZ9A 3MHZA 1YEZA 1C77A 5BYQA 3ZTCA 1OTRB 1R4QB 1D5MC 1M90C 3SVMA 2KJRA 2CW0C 2BKRB 1SNDA 1GPXA 1MI2A 1EYAA 3IAYA 1MJDA 1A3UA 3KYCD 1PDXA 2KJ6A 4C4VA 4F87A 2VQEL 4FO2A 2I46A 4II3B 4H02A 5COYA 3RZOB 3WCQA 1HRJA 1L2NA 3BYTB 2RSOA 3W1SA 2K5DA 1C9OA 4LUZA 1O7IA 2KHSA 3OW7A 4DR7L 1EM7A 1ZXTA 2H4OA 2ZNVC 1HTOA 1UH6A 3DWQA 1Q0WB 4ZUJA 1E0BA 1EY9A 2KECA 1C79A 2BS4B 3BZDB 3MA2B 1I7HA 2HHHL 4F7XA 4DV2L 3BDOA 1E7VA 4HLEA 1FFVA 2NVYH 1A5RA 1BF4A 4JI3Q 1JJ2A 1TZOA 2WB1G 4MN3A 2JA6H 2EY2A 2R7ZB 2EKIA 4JI5Q 4H13C 3KBXA 1WZ3A 4X62L 3KWLA 1OO9B 4K5WA 1WFYA 1WXVA 3VAWA 2F0TA 1CZPA 2GBJA 1CT1D 2OWOA 4B0EA 2KA7A 3PUVA 1T5EA 2WFWA 4KKJA 3GV3A 4JX1C 1LGRA 2ONQA 2K6QA 2C35B 2MQHA 2WXIA 1TWHH 4JL9A 4W9EA 4DQOC 1CZWA 2ZCBA 2ZXRA 4ICVA 4MJSB 5GAHC 1XF5L 4HCSA 3N30A 5CORA 3ZJTA 3ZLZA 5M3MB 2EIFA 4JV5L 1DYQA 4PS7A 1U5KA 3I56A 1DD2A 3AYHB 1PH4A 3DPDA 4W9DA 1A6XA 4R8NA 4LF6L 2PO4A 3FKIG 2NVXH 3S2DH 3ULPA 1WGDA 3M3YB 2ZPNA 5FK9C 2MHJA 3M4OH 5EPKA 5IIFA 1J19A 1RODA 3MC8A 3CU7A 5G3LF 2Y0SG 3S16B 3QO2A 4DK6C 5EE3A 1V2YA 1LO5D 1J7CA 5EBDA 1Q1EA 3OIPA 3K59A 1KLVA 3L10B 2FJ2A 3N9YC 5FLMH 4WRDA 4DXGA 2NTTA 1A62A 3Q3OC 2V1CC 4IUMB 4EE2A 3I4NB 2JPHA 3KUZA 1VQNA 5C4XH 3AE7B 4S0RA 3IFTA 3CSTA 1BR9A 4K8IA 3S9WA 3PS6A 4GDKA 1S5CD 3OMCA 2NPTA 3QA8A 3QB3A 4FF3A 1DGSA 2I0QA 2IGHA 2CHBD 2FCQA 5JHBA 1NAPA 4HIMA 1IHZA 3CF5A 1L0VB 4KK7A 1EQRA 3IRBA 4JK1C 1JE5A 1F52A 3R93A 4K3BA 5LXHA 2EYFA 1FR3A 1I4HA 2ZZPB 3V6CB 1HZCA 5EKKA 2B63B 1SYDA 3I5JC 4K3CA 2ASQA 4LNIA 4MH8A 5IT9L 3PO3G 3ZNGC 5C6AA 3PLVA 5J18A 3NEMA 1A2UA 3SU8X 4HJ8A 4KZCA 4JBMA 1PRTC 2IY0B 2Y0SB 2G5DA 1YJ9A 5G3LD 1L1OC 2J0KA 3A5ZB 1JCKB 3EC8A 4KY6A 4YSYB 2KVMA 3S24A 1V9PA 5HURA 2OJRA 3NELA 4K5VA 2SAKA 5GAGC 3KQ4A 4GS3A 3SR1A 2L15A 3NVZA 3VYTA 3WOEA 1R7SA 3ONSA 4LUVA 4JI6Q 4YSZB 3ND8A 1AFPA 5FR6A
chains in the Genus database with same CATH topology
2IX1A 1SNQA 3A8JE 1A2TA 4B9XA 1QOGA 4OL7A 2NVQB 3Q6SA 1OXTA 1QLBB 3LB8C 4NMZA 2R92B 2XRQD 1B44D 4C3JG 2L32A 4NJCA 4XTCS 1N5WA 1H9MA 3C46A 3O13A 4ZQ3A 4XQNA 1QWYA 1SMYC 1ENFA 2EY1A 2EYLA 4ILWA 3P42A 3Q8EA 2MPMA 4S3SA 1H9RA 4DA2A 5EJWA 1AN8A 1TIID 1DCZA 3DEOA 4XE0A 2OEDA 1XLPA 3IXSA 2WQYB 2QILA 1H9KA 3DMUA 4E6IA 4A3KB 3AE8B 1CTMA 4WORA 4C3IB 3K5OA 3SE0A 5FO8B 4L8JA 2KMMA 4WJWA 3CIRB 4IUQA 2LFIA 4MM3B 4ZRZA 2L1BA 2LS01 4N58A 1ZYRD 4US8A 3AE3B 2A74C 4XDXA 1ZKOA 3FRPB 4KGSA 3AEFB 1YNJC 1KF6B 1KNAA 3A8KE 1RHPA 2WXHA 4G7OC 1OXSC 1ZE3D 1ILQA 4XT3B 3LWUA 2BCOA 4C3HB 1EU3A 1EIGA 4QMGA 3FPPA 2IDYA 3I73A 2KCCA 1PUTA 3P1HA 4YIJA 1VDZA 1B2TA 2JYOA 1BUVT 3IAS1 2K5WA 1BCPC 1KFYB 1JOKA 2SNSA 2BDOA 3T13A 3K57A 2Q8TA 1TS3A 3A7AB 4QUCA 2WXMA 2M00A 1D1KA 1G291 5BYSA 1HXYD 4U673 2WXOA 5JVG3 4K5XA 4X3SA 3Q8BA 1E9MA 1XX8A 1DJRD 1PZID 2IL8A 4GDLB 1NSNS 5JJZA 5FLXE 2JEBI 1IW7C 1OXVA 3A7LA 2H89B 1TKWB 2EYMA 2NVTB 4RGNA 1CJEA 1MHXA 2E75C 4EVOA 3GTGB 4O1NA 3V3XA 4KX6B 2BE5D 3DXJC 1STYA 3Q8AA 2R6GA 3MJ5A 4XIGS 3W2DA 2JSVX 3TP6A 3SXHA 3IL8A 2X69A 3HZXA 2QDBA 1U4MA 3HRZC 1YNND 3CRKC 2N0SB 5K36H 1M8AA 4HKQA 1TU2B 1IL8A 1PTOC 5EBCA 1EWCA 1OXXK 1VZ6A 1MPEA 3TP5A 4IZ8A 4DXFA 5ELFA 2KQ4X 2QJLA 5JPNC 3HG9A 4IQZA 1V8QA 1JRPA 5MPOA 2GI9A 4PMCA 4A3FB 2B2YA 5HGTA 3Q8FA 1F9SA 1MI0A 1DOMA 3MZ5A 3I4LA 5C0XI 3AE5B 3HVDA 4Z9CB 2DLBA 1BO0A 1LTID 3VR8B 2IW3A 1J7AA 1FNVA 3NE5B 1EOTA 4HROA 3J80L 4KY5A 1W6JA 1IUEA 1CK1A 3MVVA 4XWTA 2FHTA 3D4WA 4IURA 1TS2A 2WNMA 1FFUA 1LV9A 2BS3B 1LLRD 5KYIA 3FDTA 4R3DA 1LACA 3HUIA 4RH6A 1T6BX 1NR4A 3PO2B 1F9QA 2MJDA 4NZLB 3GTPB 3D4DA 2F0KA 1ZUD2 3SEBA 2LEKA 1LT4D 1ZOYB 1B53A 2L83A 3NZ3A 1XYIA 1ZXHA 1EWYC 2WDRB 1TY0A 3A56A 3A54A 2GB1A 2FFKB 1ZP0B 1KABA 1X32A 4K2LA 1Z6HA 4Q0FA 1E2WA 1SDFA 2EY6A 1WTXA 2Y3AA 4QCLA 5EKIA 1WCMB 2IJ0A 1P7EA 3EROA 3QOLA 1B9RA 3U2SC 1SE3A 1TVXA 2L5TA 1QB5D 4AQ7A 5JOBA 2WS3B 4UAIA 1SYCA 2WXGA 1B1ZA 3AE6B 1YJIA 1SBBB 3AE1B 5C5MA 3FKIB 3I90A 1IGCA 4I7ZC 2AQ1B 2DYMA 1B4OA 2K01A 2CU3A 3TEXA 2SDFA 1V97A 4K14A 3VYUA 3HP3A 1FXIA 1JROA 2B2UA 2BA1A 5IT9E 2A5HA 1CHQD 4M8AA 1HEZE 2PLPA 3AE4B 2ON8A 4KHZA 1RM6C 1O7LA 3C2PA 2SEBD 3MFYA 2DN8A 2A6HC 4PV1C 5M5YB 2F0QA 2KCNA 1UWMA 3I72A 1TKEA 3NBIA 3QOJA 3NVVA 1V8CA 4KV6A 1S4ZA 1U9RA 3M7GA 2Z4HA 3V2TA 3HOXB 5KNCA 2EOTA 3ZJVA 4C3IG 1TWFB 3K7AB 2DWQA 2F0VA 1VF5C 2EVBA 4ZHPA 1F0ZA 1NVID 5KGUA 1OQQA 4WWMA 1TQOA 3H94A 5IGGA 1MSHA 3ND9A 1EEFD 5D3IB 2B2TC 2ICIA 2B8FA 1B50A 1JQ4A 2EYOA 4OVZA 4IOIE 4HTHA 3H91A 1C4QA 1NEKB 2NBFA 4YTNB 4TQUS 1QT9A 3KLRA 1IW7D 4CKBA 1BCPD 4ZOHC 1GB1A 4HJGE 2WV6D 2DY8A 4EGVA 5C0XG 4A3MB 1J8IA 2L9HA 5FOBB 3L9AX 1PZJD 3Q69A 2WKDA 2JE6I 5BMIA 4XDDA 4PT5A 4D2KA 4IFDI 5DAUA 4Y7NB 3IKJA 3U4EG 1V1PA 1HPCA 4UDUC 1SSOA 4A3DB 1Q12A 1Z47A 5LHY1 2PYKA 5M3FB 3T4AC 2A69C 4YSXB 3MWYW 4QUFA 5ELDA 1AYFA 3EJIA 1WWTA 3B2GA 3P63A 2WDVB 3VR5A 2AUJD 2NWGA 1LTRD 1Y1WB 1FXAA 3PIP3 3PZ7A 4F88A 5ISRA 2A68C 2K32A 5C4ZA 2WDQB 1H9SA 3ZYYX 1MHHE 3GQBA 2FMCA 1VMCA 2F0NA 3T3OA 2JXTA 1EQVA 3SK8A 3K6OA 2PZTA 2NB0A 1GUNA 1WTQA 2J7ZA 1II3A 3KLSA 1F77A 1CQFA 4N9PA 2OEOA 3V05A 5I9OA 5BN4A 5D14A 3A55A 2WXPA 2HDEA 3U52E 1L0YB 3QIAA 2CQAA 4WAFA 4IUTA 1IKMA 1K51A 4J8QA 1JWMD 2E74C 3NWTA 3T56B 2IX0A 4HN7A 2JWUA 4A9AA 3NTIA 3EA6A 1ENAA 5T1IA 4ZRPA 4B0MA 2KUMA 2L1AA 1ET6A 2INPE 1VCIA 3ABVB 4FF4A 1B9MA 2JA5B 4CKEA 4EQPA 1O7YA 3LX0A 3CQZB 3U9OA 4TQ0A 2DNEA 1S5DD 3P75A 3SHLA 1WTVA 3ITPA 2B2YC 5AUKA 1EZ8A 5ELCA 2IT1A 1L0XB 2F0FA 1F2ZA 4ARIA 4MACA 4USAA 3T3NA 3NSWA 4C1NK 2LMCB 2DNCA 2FE8A 4WIPA 3TMEA 5C4HA 2JQRB 3FILA 2MP1A 1BNZA 3W9CB 1ILPA 1S5BD 1WGKA 2NUCA 4A8XC 2WXQA 2Q8RE 1EY7A 4DK0A 1WTPA 4A6QA 4LMQD 2JZPA 1C4AA 5CBEE 3AE2B 2JP1A 3QG1A 2Z1CA 1OXUA 2KJXA 2WAQB 2RA4A 1YN4A 2B2TA 1K50A 4O42A 2O4XA 3P1MA 3UI3A 5I2XA 2RPVA 3ZQ4A 1O7ZA 1PZKD 2E2DC 2CJOA 3HS0C 2JU6X 3BVMA 2I2YA 2MJ3A 5IOCA 2BOSA 1L4ZB 5BYRA 2V0GA 1KDAA 1QOBA 2O5IC 1PRTB 2PKOA 1MD2D 4JBWA 3H3VC 3FC4A 2HQEA 3BVGA 3J81L 2W55A 1GOZA 2Q5WD 5FR3A 3NWSA 2PZUA 3GO5A 4XXEA 1NI3A 2BB6A 4L6TB 2WXRA 5EE1A 2K5PA 1BCPF 2JYTA 1D6EC 5M9OA 4MHEA 2NN6I 2FBWB 1SJED 2WP8J 1XLOA 1JICA 2C5CA 2N55A 4KD4A 3TEWA 2L55A 1WYGA 3NTKA 4C56C 2K5QA 1FEHA 1EU4A 4LAAA 1D5ZC 1TWHB 2V4DA 1T3QA 2B2UC 2BA0A 4OO1I 1YNTE 2IGDA 2PVGC 5CBAE 2FINB 5CR3A 3P4RB 2O5JC 1JQYD 3PO3B 1YQ4B 3VR3A 2BS2B 1YNJD 4KKUA 1F2LA 2EELA 4GLSC 5D7GA 4QF4A 2NVYB 3S1QB 4DN4M 2F4IA 5TSSA 2K05A 3OOCA 4IDIA 1GAQB 4G7HC 2F0UA 2NZ1D 3P4PB 1X3PA 5A2QL 4WQMA 4KTAA 3LNNA 2PNRC 2PVOD 3PZ8A 1QJOA 5ELEA 1EEID 1GJXA 2Y5PA 2JA7B 2F0JA 1EYDA 5J1ZA 4H0LC 1F2RI 1OFFA 1SB3C 5CV6A 2L52A 4L2YA 2A69D 3BVZA 4DAYA 4CBVA 3J7AV 5KNDA 1XLQA 4IN3A 2BE5C 1QQRA 3JAME 3M7NA 3RMHA 3WDNA 2W3SA 1ZXIA 3AU7A 1MGSA 2GRIA 2E2JB 3FAHA 3G7LA 3NPPA 1QE6A 2D5DA 2BTEA 3S17B 4OZAA 3MXUA 2AUKA 1LT5D 2PZWA 3MC0B 4JWUC 3DUZA 4HSVA 3E9SA 1D4BA 3P20A 3UI2A 1SSNA 4IFDG 3X3MA 5HG2A 3HVZA 1O78A 1I4XA 2FMMA 2VZKD 1DOKA 1LTBD 1BOSA 2QF7A 4ZK9B 3E0JA 4TMAB 3SK6A 4A3IB 1EL0A 5T1GA 1LTTD 2KN4A 3BWUD 5I4DA 3Q22A 1JW9D 4QIWB 2W3RA 2R3ZA 1HA6A 3K58A 3PV0A 1K53A 1DXMA 4IUNA 2K33A 1EQTA 2JSOA 1QCBD 1VJKA 1FCCC 1VLBA 1WRIA 2MH7A 5I9PA 1SNMA 2X38A 4J3OD 1TKGA 1R4PB 3BDLA 2A73B 3RZDB 1RFKA 2PIAA 5C3JB 3K5MA 3PUYA 3CKIB 2HTME 3VA5A 2WXJA 4LTUA 1E2VA 2JXMB 1S5FD 1C78A 1STBA 1YMHE 2M56B 5A35A 5JXVA 2F0IA 1G8ZD 4KKSA 3NVWA 3E56A 2DYOA 1N63A 4RGMA 1JWAD 4FF1A 4FP5D 1FNWA 3HRDD 4IUPA 4KKTA 1N62A 3OWEB 1VZ8A 1I4RA 5C4JB 1K83B 1HQRD 1Y8NB 2B2WA 4A90A 3VRAB 5EE0A 3J81E 5BMGA 4ODGA 2PMZB 4JWSC 1BDOA 1EY6A 2KQ3A 3D6CA 1OQRA 1RDPD 3GTJB 2EJMA 1JORA 3GTMB 5FKAC 5T8IA 1ML0D 4FVMA 3S1MB 3U7ZA 1AEXA 1E2ZA 2LMCA 3K0YA 1RTNA 4TRDA 2BT6A 1RTOA 5EGTA 2PPBC 5AUIA 1RD9D 4TSSA 2PW5A 3EGRA 4J1MA 1HUMA 1I4QA 2F0OA 4NAWB 4ZKCB 3NS1A 1AZQA 4CQNA 4L63B 2X6LA 3T53B 3GTOB 5J22A 4TQ1A 3CRLC 2XWJB 4BS9A 4A93B 1Z7TA 3VR4A 2KOLA 3EFXD 3DWGC 4KJOA 1Y69U 3PMFA 3QJYA 5E6JA 2DBYA 1ENCA 2EYPA 2MUYA 1SJHD 1F2RC 2PTLA 1QOHA 1KNEA 4U68A 1SNOA 3IFDA 1PXUA 4H44C 1VRAB 2E2HB 5HHDG 4HRSA 2J52A 2J0TD 1FD6A 5AFWA 1PMRA 1ICWA 1R9TB 4J6HA 2EJFC 3D4RA 1IYUA 4DAPA 4OO1G 1YJJA 4LK1C 3AH7A 3S1RB 2RBMA 2M2LA 1IGDA 1WTRA 1BXTA 2XIWA 5EPJA 3JAML 2RQXA 3S15B 1ROEA 2D9UA 1LTGD 5C3XA 3SDZA 2N7JA 3HGBA 3S1NB 2XNAC 3R2IA 1U4PA 1HCZA 2NTSA 4XDCA 5CV4A 1BBXC 3GTKB 3VYSA 5ELBA 2QMTA 2R93B 4HMIA 1FRRA 1ZYRC 3OIQA 2DY7A 4RCOA 2ACZB 1YN3A 4HCEA 1QNUA 1C4PA 1NYQA 2KEDA 4FYDA 3R2TA 3RUZA 1J7BA 1V43A 5DM73 1ZEQX 3RPFC 4PQXA 3VR2A 4C1NI 3RFZB 1HQMC 3M85A 3TZDA 1E6EB 3C8YA 2MEKA 4KMUC 2RKSA 4A3BB 5D3DA 1XCQL 2YEPF 4EQOA 1PFNA 4Q2JA 4B08A 4BA2I 3E5SA 1DOIA 1FD7D 1VZ7A 4A3GB 1FMAD 5F2DA 3SFEB 1L6UA 2D2CC 2E76C 4XYQA 1SE2A 2NMQA 4GDKB 5I6YA 5DM63 3FPUB 4ZYSA 1E7PB 3AM9A 1ESFA 4FXKC 2VUMB 2QEJC 3NRZA 2BYTA 5KNBA 2G1EA 4G7ZC 3ETRA 3AMZA 1DGJA 1WVLA 4BWGB 1FYCA 2SOBA 4OHJA 5JEAJ 2F0PA 4K8JA 4DAVA 2CW0D 4JE3B 2XSCA 1SE4A 2F0MA 4CHTB 1KLGD 1I3QB 1B9NA 2A6HD 1BMLC 4R9WA 3DWMA 2JX5A 1XO3A 2F0WA 5CV7A 5IGDA 5CGKA 2F0HA 5M5XB 1DOLA 4EQNA 1JMLA 4YTPB 3AEGB 3TP8A 3VR9B 2B2WC 4DFAA 1F9RA 1Y8PB 1NCVA 2N9LA 1PTOD 4C7YA 1CHPD 1IKLA 3AB9A 3BS1A 4WH4A 1DOXA 4KKIA 4C3HG 4Q5VA 2VXWA 1CFMA 1JWBD 3NP8A 1HTPA 1X3QA 1JR0D 4RKLA 1I6VC 3NHHA 2LGIA 1EFID 2CJNA 2QCPX 1K52A 2IWHA 1U4RA 5D65A 4KHVA 2PW7A 3TEYA 1KLUD 4P16A 3DHQA 1VR9A 4RFBA 1GB4A 4RF0A 4IKGA 4PNYA 2A6EC 1KAAA 3NK9A 2WU2B 1W6KA 3K5NA 2LY7A 3AECB 3N6RA 5FLXL 4L1BA 1TWGB 3GP7A 5BMHA 4REZA 1VF7A 4HAEA 4BY7B 3OPOA 4BA1I 4LLGM 1HHVA 2EYHA 4XWWA 1JALA 3SK4A 3SR6A 3DM1A 5IGFA 4RGOS 2F1MA 1PFBA 4XYOA 4HKZE 1HUNA 2RVLA 5E3FA 5NUCA 1U4LA 2K03A 1FGBD 3B2FA 2YEPB 1EY4A 1XWEA 3PIO3 1H9SB 1PTOF 1N61A 4MT5A 2WU5B 1TS4A 1N60A 4YT0B 5CV5A 5E4XA 4NP5A 2K22A 2V3PA 4A3JB 4M0WA 3OWFA 4BBRB 1KRHA 1GUOA 3NTHA 3KLSX 1L6VA 1ONLA 3H6MA 3D8GA 3Q23A 2HDLA 1LTSD 5C3EB 4X3TA 3PUZA 3Q0AA 5C3WA 3A8IE 1D5XC 4G4KA 4CJ1B 2WXNA 5KYLA 4LK0M 4N59A 3AEDB 1KTKA 1SF0A 1CQVA 3ERQA 1RJTA 1KDBA 1PFDA 4OW0A 2RDGA 1WD1A 3AEBB 3HOUB 2QSDA 1IBXB 1GUSA 4K6DA 1MSGA 5KIXA 2ZW0A 1RYJA 2OF1A 1C48A 3EQLC 1JB3A 3DWAA 4RF1A 3C3LA 4JPSA 4ITKA 2M9VA 4KN7C 1EY8A 4HMJA 1HFGA 3N52A 3EVQA 5IGBA 4KY7A 3TSSA 3TP7A 4IFDJ 4A55A 2R61A 5HFYA 3OMGA 1F9PA 5JEAH 3ZGZA 1STGA 3TEZA 1T5XD 4AYBB 4RA8A 1DONA 5C4XB 1FM0D 3MXPA 3DWPA 1J9OA 1TWAB 4HR7B 3VYRA 2YYZA 5C0XH 1PGAA 2LHEA 3AN1A 3IT4B 4WURA 4RAUC 5EPLA 3NQIA 2D5GA 5FO9B 3H8HA 1HFNA 1VMPA 1NUCA 4DK1A 1NYRA 1D1IA 3MXNA 1XLNA 1FNUA 1QG7A 4OIJA 3OHXC 4GZYC 1G91A 1STEA 3I4MB 4YTMB 3PUXA 4HEDA 1E10A 1B3AA 4C3JB 1NENB 3FILB 4ARCA 5CC4A 4DF7A 1DM0B 2VB3X 3G6JB 2XN9C 4ME5A 1RF2D 3NBHA 4HEA1 4ZLTF 2Y5CA 2OXPA 2K1BA 3I70A 5C44B 1TR5A 5LNK1 3SFDB 2RDFA 1RCVD 2X6GA 2Q8IB 4IALA 3W5UB 3DEPA 2F0EA 5EE9A 5KEEA 1A3VA 4YWGG 2AX5A 2J53A 1V1PB 3HOWB 2MHVA 2HCCA 2J42A 3I91A 4CGYB 1HZ6A 4FXCA 2C9OA 4LJZC 1PGXA 2F0GA 2E6XA 2CVRA 2Z4IA 3TZUA 2YU9B 4HSPA 2W82A 3FMCA 1TT2A 4C2MB 2K6AA 3GS2A 2Z8LA 1SNCA 2IX3A 2ZXPA 2K04A 5CV9A 3KBGA 3TUOA 1SNPA 1SMYD 4H2AA 3T51B 1Q1BA 2WINB 1IYVA 4P6VF 2L12A 2EYJA 4KJNA 4P2CB 4ZAIA 1UWXA 4OIKA 4ZRQA 4OZCA 2PW9A 1Q90A 1EYCA 2HDMA 1L5PA 3AE9B 1F2MA 3MFGA 2O2LD 1Y56A 1EWHA 2B76B 4XQQA 3L7ZC 3D6WA 1DOYA 4AS1A 3AEAB 2INNE 1EZ6A 2K9XA 2OT2A 1GUTA 1SYFA 2L4NA 2LJIA 3NUCA 4I65A 4RHRA 2KDMA 1IBXA 1M4VA 1STHA 5JAVA 2LHDA 1P7FA 1PDQA 1I4PA 4QB4A 2PQEA 2QKIC 5M5WB 2A6ED 2EXZA 3URYA 2WP9B 1BUIC 1NR2A 1V1OA 1CA6A 1WXQA 2KAJA 3LXFA 4N9TA 1TY2A 2WXLA 3FEWX 1ZDVA 2RMMA 5E4WC 3CHBD 4DGZA 5LL6X 3AV8A 1I4GA 1TKYA 2LUMA 5EQ0A 1WTWA 5KRUA 4G57A 2WACA 3HEJA 2BDNA 3ONAB 2VZKB 3SK5A 2EPBA 2IGGA 1XEEA 3LWEA 5CMDA 2IPKD 2W54A 2L11A 2LFNA 5DNFA 1EIHA 5BN3A 2G9HD 1SYGA 1VDVA 1L4DB 3NVYA 2K7VA 2PCFB 5G5HA 4RWSC 3U9SA 2MJ8A 5JVH3 5HI1A 2AQ2B 1QILA 2NN6G 1SFOB 5IODA 1WTOA 3AB5A 4IFDH 3H09A 3ZJUA 2AWOA 2AWNA 1JE4A 3VA7A 3J7AF 2B2VC 1XCTL 4C80A 2FUG1 1G2SA 2H88B 4RHSA 4RGTA 3R3OA 3S2HB 5FO7B 3EUB2 2ZXOA 3F2UA 2K3UA 1GHKA 3AEEB 3MP9A 5C2TB 4FF2A 2XVSA 3I3CA 1SEBD 5JEAG 4KI0A 4US9A 4FXDA 1GHJA 2N88A 2K28A 1LABA 5H8YE 1QOFA 3Q24A 3P4QB 4ID6A 2EE1A 3S14B 5H92C 4XT1B 3W3AA 4DNRB 3AMUA 1TYGB 3OSOA 1SAPA 3MAQA 1XTCD 4PMBA 3I57A 1PYWD 1STNA 3HKZB 1CA5A 3BIID 2K0PA 2RSNA 5G5GA 4N6EB 4KGRA 2A68D 5C5LA 4C7ZA 2HUGA 2WKCA 1BQQT 4M1UB 4PMWA 3NUHB 2KEEA 2L0CA 2PMVA 1I6HB 4IUUA 3I8ZA 1LT6D 4NDXA 1Q8IA 3BYYB 3TDQA 1Q10A 2ZT9C 3GV6A 1CZGA 3D31A 3PUWA 3RLFA 3GD7A 4ABNA 4B9WA 2ZW1A 2I07B 1ESRA 2AQ3B 3HOVB 4RKBA 1CI3M 5C0XJ 2EJGC 1PFMA 4DU9A 2XWBB 4K6LA 2F0SA 2F03A 3CWIA 1K8OA 2WLBA 3C1FA 3D3RA 1GXDC 5A2QE 1JC7A 3C1EA 4BBSB 4CKCA 2I38A 4NW2A 2WXKA 3IT6B 1MVKA 2B8GA 5CYUA 2D62A 4V0BA 3T16A 3WOFA 1WD0A 4MIUA 3B9JA 1I50B 4OO1H 1N5XA 4NKLA 2E2IB 4R8IA 1FCLA 1F2YA 3MXGA 1K8MA 4ZUIA 4ZKBB 1GUWA 1AP0A 3QWNA 3V96A 1PRTD 1H9JA 2MGSA 4FNFA 2JYEA 3LYYA 4ULLA 1UEAB 2BBCA 1DZ1A 1AW7A 3M4OB 1WSPA 4TKOB 2BW2A 3PO0A 4ZHOA 2ICEC 3P7JA 3MHBA 3VR6A 1PTOB 1C4CA 1C76A 4IUVA 4F8MA 1EY0A 4DNTB 5EKLA 2VNUD 5JPMC 5J39A 1BCPB 2QIEB 5CV8A 1UAPA 2ID0A 3KK7A 3J7YW 1JWUD 4XQJA 1SXTA 1C9FA 2LKVA 1XXGA 1E0ZA 2TMPA 5I2YA 1PRTF 3BK1A 2J4XA 1Y8OB 4K2KA 1ZDXA 1CM9A 3J80E 4L23A 1YNNC 3NXWA 5I6WA 3K5LA 1HZ5A 3E6ZX 3VQIA 4RNAA 1SYEA 2WIIB 3L4PA 5DEHA 3R8BA 4OZBA 3TN2A 3KF8A 4KN4C 2MJEA 1PLFA 2WXFA 1UNSA 1LTAD 3Q8CA 3X3NA 3GB1A 5E1FA 1AZPA 4CJ0B 2N9KA 4NAMA 1YQ3B 2KWDA 2EZVA 5IGCA 1SYBA 2F3WA 2OHFA 5LL6S 4YXDB 3HOYB 3KWVA 4X3KA 2NN6H 2F0LA 1QOAA 4A3EB 4FXGC 2EY5A 2G9DA 1YN5A 3GTQB 1QKZA 2TSSA 2HCIA 3S2DB 2NVXB 2ENBA 1ZPSA 1PGBA 1A3TA 1LT3D 4H7BA 2XRSD 3NQTA 1G6ZA 5BN5A 1MBYA 2H1EA 3W5VB 2B2VA 1PTOH 2SNMA 2WB1B 5GXGB 1D2BA 3L3OC 1TJEA 3I9V1 1AWDA 2V3NA 2GA4B 4KD3A 3BK2A 3J9CA 2BB5A 1EY5A 2VB2X 1RWSA 1TS5A 3BG3A 4OGQC 1KH0A 1JOQA 1A70A 2JA6B 1O80A 1STAA 3VRBB 4WFN3 1C8CA 2F3VA 2M0AA 2RDHA 5K36G 1KDCA 3TBIB 1GUGA 1JOOA 3MTSA 1ACCA 1QNKA 2JEAI 4RCNA 2JA8B 5K5PA 1Q3LA 3FVQA 1SIJA 3P4SB 1ET9A 2M19A 4V190 2V4IB 2EDGA 1FO4A 3H0GB 1TWCB 2B39A 3KUPA 4X3UA 1QF6A 3MEHA 1G2TA 2E3TA 3IAM1 3GTLB 1FIQA 4BY1B 3BDCA 4KGTA 2NYZD 1S5ED 3HOZB 2KACA 1UGJA 1UUPA 1JWSD 1HTLD 4CJ2C 1A15A 1Y1VB 1HA5A 2F0DA 1FRDA 5IGEA 3M4YA 1RKNA 3RD4A 3MHZA 1C77A 5BYQA 1R4QB 1D5MC 3SVMA 2CW0C 1SNDA 1GPXA 1MI2A 1EYAA 3IAYA 1A3UA 1PDXA 4F87A 4FO2A 2I46A 5COYA 3RZOB 3WCQA 1HRJA 3BYTB 2RSOA 3W1SA 2K5DA 2KHSA 1EM7A 3OW7A 1ZXTA 2H4OA 3DWQA 4ZUJA 1E0BA 1EY9A 2KECA 1C79A 2BS4B 3BZDB 3MA2B 1I7HA 4F7XA 3BDOA 1FFVA 1BF4A 1TZOA 4MN3A 2EY2A 2R7ZB 2EKIA 4H13C 3KBXA 3KWLA 1OO9B 4K5WA 2F0TA 1CZPA 4B0EA 1CT1D 2KA7A 3PUVA 1T5EA 4KKJA 3GV3A 4JX1C 2ONQA 2WXIA 4DQOC 1CZWA 2ZXRA 1XF5L 4HCSA 3ZJTA 5CORA 5M3MB 1DYQA 1DD2A 1A6XA 4R8NA 2PO4A 3M3YB