4RH6A

2.9 angstrom crystal structure of putative exotoxin 3 from staphylococcus aureus.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
189
structure length
187
Chain Sequence
SESELKHYYNKPILERKNVTGFKYTDEGKHYLEVTVGQQHSRITLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSNSVQYIDYINTPILEIKKDDVLKDFYYISKEDISLKELDYRLRERAIKQHGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.9 Angstrom Crystal Structure of Putative Exotoxin 3 from Staphylococcus aureus.
rcsb
source organism Staphylococcus aureus subsp. aureus col
molecule tags Toxin
molecule keywords Exotoxin 3, putative
total genus 57
structure length 187
sequence length 189
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rh6A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rh6A01
2AQ2B 1SE4A 1D5MC 1EU4A 1UNSA 1CHQD 1SE3A 1LT5D 1PTOH 1HXYD 3DWQA 1JWMD 1BCPB 1UUPA 3O13A 1PZKD 1PZID 2XNAC 5ELCA 2ICIA 4O1NA 4DXGA 3BYYB 1EFID 1FGBD 2WV6D 5ELEA 3MC0B 2R61A 3V05A 1CHPD 2RDHA 1DYQA 4RFBA 1MD2D 1AN8A 1LTSD 1I4PA 1RF2D 2O2LD 3TSSA 1T5XD 1CK1A 1PTOF 1PRTD 5ELBA 1PRTC 1LT4D 1I4HA 1LTAD 1XTCD 1BCPF 4DXFA 1I4QA 4K6LA 2CHBD 1TS4A 2SEBD 4NZLB 2G9HD 1PTOB 5ELDA 1JR0D 3MFGA 1SEBD 1V1OA 1HQRD 3W2DA 2AQ3B 3GP7A 1L0XB 4Z9CB 3BVZA 1HA5A 1D6EC 1SJHD 4RHSA 1F77A 3EA6A 4L6TB 1PTOD 2NTSA 1SE2A 1LO5D 5FK9C 1PTOC 1LTTD 5D3DA 1AW7A 3CHBD 3EFXD 3SEBA 4OHJA 4BWGB 3BYTB 2IJ0A 4RGNA 1DJRD 1FNUA 4UDUC 5I4DA 1KLUD 1YN5A 1B44D 2Z8LA 4RGTA 1ET6A 1YN3A 1STEA 1V1PB 3BVGA 1TY2A 1B1ZA 1LTID 2TSSA 3BZDB 1LT3D 3DWAA 1S5BD 2IPKD 1FNVA 2QEJC 1CQVA 1JCKB 1GOZA 1SXTA 1ET9A 1RD9D 4RCOA 2NTTA 1I4RA 4RH6A 4C56C 1L0YB 1PYWD 1KTKA 3OWEB 1YN4A 3R2IA 4TSSA 1BXTA 1LLRD 3KLSX 1S5DD 1CT1D 2J4XA 1EU3A 1TS5A 1I4GA 1LTBD 1SBBB 5D3IB 3R2TA 1BCPD 1I4XA 5TSSA 1QILA 1BCPC 3R8BA 1JWUD 1G8ZD 1S5CD 1PRTB 2RDGA 3DWPA 1FD7D 1EWCA 4L63B 1PZJD 1M4VA 3BVMA 1D5XC 2XRQD 2QILA 5ELFA 1FNWA 4RGOS 1LTRD 1RCVD 1TS3A 3URYA 1SJED 2XN9C 5FKAC 1S5FD 1HTLD 1TS2A 1JQYD 1KLGD 4RHRA 1D5ZC 1ENFA 4ZYSA 2XRSD 1EEFD 1XXGA 4RGMA 1TY0A 1RDPD 2AQ1B 1JWSD 1S5ED 1LT6D 1V1PA 1EEID 1ESFA 1LTGD 1PRTF
chains in the Genus database with same CATH superfamily
1STGA 3KUDB 1D5MC 2B2WC 4K6DA 5I9PA 4FA6A 2IO1B 1EZ6A 1Z2MA 4OZAA 2Z6BA 2D9UA 1WE6A 4OZBA 2M00A 1OXSC 3I4OA 4O42A 1F9SA 3M63B 1CM9A 2BQQA 3FKIB 4J15A 3K5LA 4DV5Q 3Q69A 2KHSA 4WJ4A 1TT2A 2DYBA 2JA6H 3TMPB 1IBMQ 4LF6L 5ELEA 2LKVA 3C2PA 3NRZA 3IAYA 3ZXVA 3ZNZB 1VQHA 2RDHA 4ARIA 5CV6A 2RR9A 5C4ZA 1FCCC 1JC7A 2B29A 3FKIH 3EROA 5BMHA 1ZEQX 3HKZG 3MAQA 3VXWA 4B9KA 5EE3A 3ZTCA 1G2TA 1XLOA 1LM0A 4QGUA 3BK2A 2PZUA 1XMOQ 1P9DU 2I1JA 2AUKA 3HRDD 4E3CA 4FADA 2FFKB 2CS4A 4LLGM 2WU5B 5J3BA 1HA5A 1HFGA 1XNRQ 1IPGA 1HEZE 2UUCL 1K3BC 3X3NA 1PFBA 3IRBA 5EKKA 1WY8A 2OEDA 1WRDB 5IA7A 2EJFC 1N34Q 3P20A 4E6IA 5EBCA 2A6ED 1IBML 2JA8B 5EE0A 1E2ZA 5CBAE 4N8FA 2UU9L 2MBEA 4JI8Q 1D1KA 2QJLA 2J0TD 3A33B 5CHVC 4ZRJA 4B9WA 4OEMB 4DA2A 5KEEA 1WSPA 1VDVA 4DR1L 1KLUD 1NTGA 1CUKA 1VZ7A 1YZ6A 5GAEC 3PIPA 2IO0B 4XZ4A 2HQLA 5C4HA 3PO3H 2MBHA 2HIVA 4DR6L 3AH7A 2K5QA 2M9VA 3CD6A 3TP5A 1YNTE 1HUMA 2N9LA 3ZDMC 4XWTA 2AHOB 3TEHB 4PMWA 2MJEA 3ABVB 3DBHI 3GS2A 2BH2A 2B2UC 2K5WA 5LMNQ 1R4NI 1VQLA 5G2NA 1R4PB 3PGZA 2X6GA 4PK1A 1YBYA 3LXFA 2WDRB 2JYOA 3AE4B 3OWFA 2K39A 2MUYA 1F2ZA 3KLSA 1I94Q 3E9IA 4LF7L 3C46A 1Q46A 1G51A 1AYFA 4NJ6A 2WXRA 5GADC 4DR1Q 2V9HA 5G55A 3FRPB 2ZJDA 2F4VL 3A9KB 1TWCB 3CCEA 4KMUC 1PGAA 1FD7D 2Z0SA 2JA7B 4X65Q 3LWUA 1XF5L 2M4NA 2OJRA 1O7YA 2LJ5A 4W9KA 2MA9B 5JEAH 3CIRB 1FNWA 4IPCA 4M02A 1CSQA 4IWPA 3SR6A 3TEXA 4ACFA 1TS3A 2L0CA 2J7QB 1C9OA 1NR4A 2X6LA 1V9PA 2Y0SB 3IL8A 2VQEL 1IBLL 2E6XA 3S1NB 4PYUA 1PV4A 3EFCA 4RNAA 3CXCA 2V3SA 4A55A 4DQOC 2EDGA 2I5MX 2MLBA 2IYDB 2WXQA 5IP9G 1RTOA 1RWSA 3NZSA 5BYSA 1VQEA 1TGZB 1WFQA 3SDZA 4DV6Q 3TRZA 1H8CA 4YWLA 1TWAB 1N33Q 3G48A 2Q5WD 4KVGB 1LT6D 2RF4A 2NWGA 3I4NG 1V8CA 3MHSD 4NJCA 2RD0A 4KI0A 2LXAA 2CFMA 1CHQD 1L0VB 1ZDVA 2ZVOA 4DHJB 5EDSA 1K83B 5IT9c 4L23A 1VQ5A 2ONQA 1W6JA 2W9NA 3E9SA 4FJZA 1FPYA 4XT1B 2DAJA 3N32A 3G71A 2EVBA 2ICIA 3VTVA 1E8YA 1TZ1A 2DHZA 5BYQA 2V3NA 3BYYB 4YHHQ 4OONA 3ULLA 5KNCA 4JI7L 1EIHA 1YJNA 1SFOB 4JBWA 1WXMA 4NXNQ 1K52A 5GXGB 1N36L 4FYDA 4KKJA 1GJXA 3AU4A 1F0ZA 1FGUA 3UE1A 2WU2B 5FJ8H 1AN8A 2UUAQ 4N58A 3ZLZA 4EZJA 3VA5A 4DV6L 5L83A 2INCC 5BN5A 1S3OA 5ELBA 5C5MA 2HQEA 3P63A 3QA8A 4MJSA 4J6IA 3OSOA 1AARA 1MHWC 2LGSA 1PH1A 4A93H 2FIFA 4P16A 4B0MA 2IHEA 1ASZA 1Y1WH 2WACA 2A69C 4HJ7A 3H6MA 3PZDA 4AOFA 1HQMC 2KDBA 2OXPA 4YHHL 2B3AA 2PCFB 4DV4Q 2EOTA 5M5WB 2YU9H 5JJIA 4HWIB 4A3BG 4YCWA 1TJEA 3SEBA 2KLGA 2OTLA 1Q10A 3VDYA 1KXLA 3CSFA 3NVWA 3PRPB 3VA7A 4GMVA 4LUZA 4JL9A 2LI5A 2KHWB 2F3WA 3PZ8A 4US8A 3A1QB 2YU9B 2NVYB 3D4RA 1I6HH 1ET6A 2LSSA 1IYJB 1NYQA 1R7SA 2HD3A 4JI6Q 5CMDA 1XD3B 2KJ6A 3N1ZC 3GTMH 3RD4A 1BBXC 2TSSA 1JRUA 4JX1C 2IPKD 3RLNA 1CQVA 2H88B 1JCKB 2F3IA 4BBNF 2NVQB 1C0AA 1E3PA 4EQOA 2O5JC 2HJ8A 3CF5A 4C56C 3B2GA 4LK0M 1KTKA 4LNQA 4HCSA 2ASQA 3OMCA 2DJGC 4UP7A 3AEEB 1RTNA 1GUNA 1Y8PB 3ZXRA 5E4WC 4BBNC 2DGYA 3HS0C 4MIUA 3T56B 2JZZA 4Q5VA 4WWOA 4XYOA 1K8OA 3ZJTA 4N59A 4G7OC 3VUWA 3MFYA 3TP8A 2JA6G 4LFBL 3I9V1 1QB5D 2LASA 4YTMB 4ANWA 5COYA 4B3SL 1CKMA 1EF5A 3AQQA 1N5WA 1T6BX 3W1BA 3H7PA 1PRTB 1DOIA 2JN4A 5L37A 4DR2Q 5C3JB 2L32A 5E6NA 4K8IA 3AEDB 1XX8A 4DUYQ 1WR6E 5LLIA 4K0KQ 5G5HA 2D62A 2KQ3A 1CQFA 1FEHA 2EKIA 1KRSA 3OTOQ 2R92G 1EY9A 1MPEA 1H9RA 1NI3A 3KDFB 4JI3Q 2XVSA 4G0NB 1EQTA 2D5DA 4LF4L 4PT5A 2X38A 2PI2E 2PZWA 1D5ZC 1XPUA 3NPPA 4BA1I 3L9AX 3W1YA 1GB1A 1SYDA 4RGMA 2F3VA 3UGBB 4FO2A 3QK0A 1LM8B 1IYVA 1JT8A 3KYCD 4DHZB 1HCZA 1ONLA 2TMPA 3W1GA 4XXEA 4K5VA 5IWAL 4BY7H 3T9LA 1K0RA 3G7LA 1CZGA 2R93G 1KAWA 3DEPA 1B53A 3HFZB 3HOUB 3HG9A 2Z4HA 1TVXA 1PH2A 2JWZA 3B08A 4AS1A 5HHDG 4TV3A 5E4XA 3S1RB 5C4XH 1C48A 3L17A 4GSWA 4DBGA 1OTCA 3OAWA 4UHVA 3PT2B 4P6VF 1HZ6A 2RSOA 3M7GA 2G5DA 3U4VA 1SFOH 3J7AF 3CPWA 4W9IA 3RNBC 2Y5CA 2D3CA 1YNNC 1MD2D 3AV8A 1LTSD 1YJIA 3V6CB 3N3KB 1FRDA 4I6NB 1I35A 4X3KA 3BK1A 1N6ZA 1WTPA 1MIUA 2MO1A 1IZ6A 5M5WH 1I5FA 4HRSA 3H91A 3S16H 2WX1A 3NG0A 3RNFC 3S14H 1PTOB 2JQOA 4PV1C 5ELDA 4JOIC 5BR8Q 1V86A 1UWMA 1V49A 4G3XB 4JLCA 1HQRD 4LAAA 3W2DA 4KHZA 5A35A 1ISNA 2G4DB 4KV2A 1L0XB 4IOIE 4EQNA 1D6EC 5M5YB 1E2VA 4X3SA 2EZVA 1WF9A 2NTSA 2JYTA 3MHBA 3TS0A 5FK9C 1PTOC 2OT2A 4RG1A 3T51B 1LTTD 2VW9A 3S16B 3O65B 1HR0Q 4RF0A 1STYA 4RF1A 3PZ7A 1WX7A 3SDLC 4CKEA 4POFA 5EAYA 2L5TA 4UDUC 3DMUA 3VFKA 1VQ9A 4PS7A 4A3KG 2JSVX 4A90A 1WI5A 1YN3A 2JA5B 3J80L 3VYUA 2QF7A 4LF5L 5KHOA 3L3OC 1H9SA 1E90A 3ERSX 5CORA 1K0SA 2K6QA 2CH4A 2YTVA 3KYDD 1F9RA 1WTVA 5EKLA 5BR8L 1A8VA 2R7ZB 3I57A 1VMPA 1JE5A 3KUPA 3N20C 3KF8B 4HCEA 3IG3A 1YN4A 2CJNA 2KACA 3K81C 2RA4A 3NHHA 3PQIA 3K0YA 1NYRA 5HI1A 1MKHA 3HOXG 1NE3A 3KLSX 3GV3A 4JI2Q 3PGEA 4IWOA 1YX6B 3A55A 1P98A 2ZVNA 3FKIG 4QJFA 1I4XA 3IXSA 1NENB 2GVAA 3SHLA 3ICEA 1VR9A 2LXCA 4ILWA 4X6AH 4OWTB 3L10B 5M5XH 3LNNA 1AP0A 1EWYC 2EYMA 2RDGA 2PQAA 2CKHB 2Z0EB 4MACA 4OVZA 2J7ZA 3AE9B 3I63C 3SU8X 5D14A 2DY8A 3L0OA 2NN6G 2JSOA 1KDAA 5JOBA 3MEHA 4FN2A 1WFYA 1SE9A 4MGIE 3M95A 4LUOA 3R93A 3GTQB 2ZEQA 1F2RI 4HMJA 2RMMA 2Y0SG 1VQ7A 3J7ZC 1DM0B 1DD2A 4GOPB 1FJGL 1ZXHA 3EHVA 1MI2A 3A9JA 4B0EA 4Y7NB 3PO3G 2Q2IA 2Z59B 1IP9A 4NY0A 2K6DB 2QGQA 5FO8B 1YQ3B 4X3UA 1EEID 2IWHA 3WAOA 4BOSC 4C3JB 3HOZB 1M8AA 2AQ2B 1I42A 3E5SA 4PZ8A 1OEYJ 1UGMA 3T1YQ 4IUUA 4HEDA 2JY6A 2I2YA 2REXA 1B9NA 4JBKA 1H9SB 2CVRA 2R93B 1EOTA 5BN4A 3LX0A 4FJYA 1TWGH 3U4EG 2JZPA 3HOUG 4WURA 3Q3MC 2K5HA 4G4KA 2BH8A 3F2CA 1CZPA 2JUOA 4KKTA 3J80c 4KKIA 5HFYA 3A54A 2KYWA 2KFKA 4H7BA 4ANUA 1CTMA 4NKLA 2G45B 4IWQA 2F0QA 2WP8J 3A56A 1XPOA 3PHWB 1WZ0A 1BDOA 4IDIA 3RUIB 5FO9B 1ZYRC 2YVCA 5D2MB 1WCMB 3PO2H 3TBLD 4QB4A 2GBMA 3R3MA 3VH4B 3TZDA 3A4SC 1RODA 3NQTA 2Z0DB 2W82A 1UD7A 2CHBD 2UUBQ 1VCBA 4LF9L 2NCNA 1U0LA 2KTFA 2SOBA 4FF4A 1HA6A 3R7RA 2QDFA 4Z9CB 4ZLTF 4BY1G 4XQQA 2KLCA 2WXNA 2E2JB 2M1MA 4L6TB 1WYDA 3L0WB 2K5NA 1XMQL 1C78A 2BOSA 2K25A 3PIP3 2BS4B 2ZW0A 5DPWA 2BCOA 2JA7G 1OQRA 2RDBC 3IT6B 4OVVA 1T9HA 3U8ZA 4NJ7A 3Q24A 2KCMA 3EUB2 3CMAA 4DV5L 2KC1A 5EGTA 3RZDB 4M00A 4YSYB 2KA7A 4RA8A 1B3AA 1AE3A 5FLXc 4LF6Q 1A63A 3RI7C 3UDFA 3L4PA 4R8NA 1LACA 3V2TA 2J0MA 1Y8NB 1V81A 3PHXB 2DZMA 1V2YA 4IM3A 1FNVA 3CP0A 4IZ8A 4GOCA 3S17H 3ZRFA 2WB1G 4IN3A 4GOPA 4CJ0B 2KWCA 4XIGS 3EFUA 4BFRA 3J7AV 3Q2AC 1HZAA 1RRBA 1WGKA 3D3RA 2GN5A 2BDOA 2EJGC 2E5LQ 2L05A 2QC8A 3ZQ4A 2KDEB 2J4XA 3UE0A 3PUVA 1IKMA 3L13A 4A75A 3MP9A 1OXTA 1X9NA 3CMEA 1HR0W 2WYQA 1Y8OB 4JPBW 2CR5A 5AZFA 2ID0A 5TSSA 3HOVH 2B2VC 4OIKA 1GNUA 1L7YA 4NAWA 4WJPA 5AZHA 3VR9B 1N34L 3KBXA 5EPKA 1B7YB 1JRPA 3OIPA 3DWPA 4KY7A 2H4OA 3G4SA 2UU9Q 3I72A 3T16A 4DPGA 3GTPH 2K33A 1QZGA 3HKZB 1VS0A 3CU7A 2L0TA 2RPQA 3B2FA 5I6WA 1FFUA 4ZCKA 4HPPA 5I2YA 1X6OA 4O0AA 3HEJA 1NJIC 1WTQA 1XT9B 3F8TA 1JQYD 2LMCB 4DK0A 3OHXC 2PVOD 2A6EC 1SLJA 1SYCA 4ZYSA 3P4PB 2OOBB 5L95C 2XRSD 2MJ3A 5EPJA 4WORA 2BKRB 1N9WA 3W1SA 3MXPA 1ZW7A 4FULA 3VQIA 3C0RB 2V1YA 2EYPA 1MG4A 1TWHB 2JYEA 1Y14B 3K8AA 1TKWB 2JA8G 1WIAA 4BBSG 3HKSA 3RN5A 1WWTA 2LVOA 3AEBB 3DPDA 1YIJA 3EGRA 2F0OA 1HH2P 1SNMA 4L5SA 3DWQA 4S0RA 1BO0A 2EXDA 2YTYA 5C3EH 4LF7Q 5M3FH 1YJJA 1TWGB 1V43A 5C0XI 1ZOYB 3VRBB 2E2JH 4PMCA 3AU5A 5BN3A 1WI0A 1BF4A 1QJOA 4CDEC 1NUCA 2EYLA 2F4VQ 4NXML 3RFZB 1UGJA 3CWIA 1GO3E 4R9WA 5JH5C 1CSPA 3DBLI 4PYZA 4RFBA 1UE7A 2C60A 1MHXA 1UE5A 3RZDH 1OXXK 3S2AA 1T3QA 3CMMB 1QOAA 3TP7A 4DV0Q 1O78A 2GLSA 1SIJA 3MXUA 3HOXH 1IBLQ 4GOPC 3C19A 2YEPF 1JW9D 4U68A 1JMLA 3K58A 4DR7L 5E6JA 4HPLB 4HVBA 2EMSA 4OWWB 4JPSA 1OTRB 4M8AA 3P42A 4WH4A 4KIKB 5D7GA 4K8JA 1L0WA 5FLMH 1HJPA 3J80E 3MA2B 1Y1VB 2Y3AA 4HKZE 4KZCA 1Q90A 2CWAA 2GVBA 4P73A 1GVPA 2DJFC 1F2MA 5EBDA 1TQOA 3E0EA 3RUZA 4NXMQ 2XBBC 2D11A 4K14A 1EYAA 3L16A 1YI2A 5DPTA 1ZKHA 2PEAA 2ZCBA 1QNKA 4N8X1 4CKBA 1KDCA 3AB9A 1YJ9A 3B9JA 4FXCA 5IN7A 1FYCA 4QF4A 4ZYNA 4IFDG 1EQRA 3W5UB 1ZKOA 4FXGC 4BBRG 3F2DA 1VQMA 3H1UA 1B1ZA 1LTID 4HSVA 1LT3D 2AYOB 4KN4C 3WAMA 1C4QA 3CCSA 1A0IA 2IO3B 3JSVA 4HPMB 4C80A 1OEYA 3QOJA 3I4NB 2M56B 1Q8KA 2MRPA 1VQOA 1HNZQ 1XO3A 2CU1A 1J6QA 5K36H 1UZXB 1I6VC 3H6NA 5CV4A 4M0WA 2MO0A 1ICFB 3CW2C 4G11A 4XGAB 2O2VB 3U30A 1SNQA 1II3A 1TWAH 1GC7A 4HJGE 4AP4C 3VTUA 3PIO3 1EQQA 4QUFA 1QILA 3IBEA 3OJ4B 3R66C 2WXOA 3H0GB 3A4RA 3MZ5A 1C77A 3DM1A 3TL5A 1G2SA 1JOKA 2EQSA 3H8HA 4KDIC 1Q1EA 2K52A 4R4TA 1PFSA 4A6QA 3BDCA 4RCNA 5IP4D 3RR5A 3DM3A 3PF5A 1BBUA 5C3EG 2G1EA 3KH0A 2XRQD 2QILA 1UH6A 3PO2G 3TEYA 5C0XH 3TCAA 4JBJA 3VUYA 3E3XA 5C4JH 3Q3FA 2A69D 4HIOA 3FILA 1FR3A 1P16A 3LWEA 1RM6C 3ECIA 3AB5A 2I46A 3K7UC 4HK2A 5FOBB 3I4MG 1XLPA 4XDDA 1EEFD 4QIWE 4W9CA 2RPVA 1RDPD 2HE7A 2YEPB 1SYGA 1VZ6A 1C4CA 1PRTF 1IBKQ 4KY5A 3HOWH 1L6UA 2GBKA 1FRRA 1EFWA 3V61A 2KWDA 4CKCA 2BYVE 5AJ3L 3C3LA 1E7PB 3FMCA 3V60A 2V4LA 2Z4IA 1SR3A 3MXGA 4DAPA 2XNAC 2O5IC 4CJ1B 4GKKL 4A3GB 3CPFA 1CMXB 1WJNA 4B3SQ 2HJ1A 3SHQA 1JE4A 4DN4M 3HOWB 1T0YA 3WAPA 1LTLA 2WS3B 4X62L 4BKSA 3GDEA 4BXXH 2D3BA 2CW0C 2IDYA 3VH3B 2XWJB 3H94A 3WANA 2MEKA 5IGCA 5CV8A 3S2DB 4TKOB 4A3OA 1X3FA 4J6HA 1SNCA 2O2LD 1SE8A 2NZHA 3VR3A 3U4ZA 1PRTD 1E2WA 2UXBQ 1PLFA 2HTHA 3GTMB 3VYRA 3H7SA 4MM3B 4NZLB 3WOEA 4AQYL 1TU2B 1O7LA 4H0LC 1YJ1A 3BIID 3OW7A 3HOVG 5C3XA 4PS3A 2I0QA 4CGYB 4V190 4A3DB 3QG1A 1GC6A 1RFKA 2L83A 1SJHD 1IL2A 1WXAA 1SE2A 3WALA 5C5LA 2VS1A 2K5PA 1PDXA 4EX5A 2ZTDA 3PUXA 4RWSC 5IIFA 3K7AH 1SMXA 4OHJA 3BYTB 2Q2UA 3FP9A 4DV3Q 2N7DA 4GN3B 3P4QB 2BDNA 3KJPA 3QB3A 2M19A 1STAA 4IW0A 3IFTA 5FLMG 1WMHA 4YY3L 3ZGZA 2VQEQ 1STEA 1I50H 2VRRB 3BVGA 4MM3A 1TXYA 4YT0B 2XEWA 3M85A 2WDTB 1D3ZA 2KWUB 3HIZA 3ONAB 3KOJA 3PSIA 2SAKA 1EIYB 4MH0E 1L0YB 3TP6A 1QOGA 5CHWA 1TWFH 3FILB 1BOSA 3R2IA 2FCSA 5I6YA 3GTGH 4JQWC 1MI0A 3H3VC 3QAQA 2XWBB 1S5DD 1CT1D 5LNK1 5TR5A 1TS5A 4OGQC 4AQ7A 5J1ZA 3M9BA 3HK0A 4B6WA 4IPHA 3DQVA 1EY6A 1YNND 1U4AA 4EFOA 4FDBA 1Q3LA 2OQKA 2B2TC 2B39A 3IAS1 1YHQA 1RKNA 5C4JB 3CC2A 5HKHA 4YY3Q 2NVXB 2EY5A 4RMAA 4IUPA 3SE0A 2QEXA 2L8JA 3PIOA 3AEAB 3A5ZB 3NS8A 1N36Q 4AYBG 1M4VA 2KTRB 5J17A 2PIAA 4IUNA 1PDQA 1PH5A 1SMYC 5ELFA 1KHIA 4M0WB 1K28A 3K6OA 4UAIA 3S1RH 2WXIA 2C7NB 3PV1A 5IAAC 4OO1I 2GBRA 2RCNA 3H15A 1QOBA 1HTLD 1VDZA 1TS2A 1YHAA 4A3JB 1WRIA 5JJLA 4GIVA 5T8IA 2ZM6Q 3GQBA 4IUMB 2K14A 1L1OC 4LMQD 2AUJD 1E8ZA 4EEWA 1JQ4A 1A3VA 4KD4A 2LY7A 3JAMc 3GTQH 3HOUH 1HZ5A 2F0VA 1P3QU 1PYSB 2BYFA 1KAAA 1ET9A 5DNFA 1SE4A 2EELA 4OWXB 1CA5A 4WAAA 3FPPA 5JXVA 3HP3A 1VRAB 4N9TA 3MVVA 3VR5A 2CKZB 2X8XX 1YMHE 4GDLA 1NY4A 2FINB 4II3B 4E74A 4IUVA 3PPAA 1SIFA 4R4OA 1QCBD 5G3LD 1FFVA 1C76A 1J8CA 2D2QA 1FM0D 1ASYA 2F0LA 2JRHA 4J3OD 4BS9A 2E3TA 2KJHB 2Z6KC 2IO2B 1YQ4B 4FBJB 4C4VA 2PI2A 4L8JA 1HTOA 4XYQA 4YWKA 4WJNA 1WMHB 3NVZA 2V4DA 4M1UB 2LHDA 4YIJA 1GXDC 4GNXB 2Q2TA 2OTJA 4EGVA 1QQRA 4EOYA 2VQFQ 5LMUQ 4GLXA 4KV6A 1AZQA 2HDEA 5JHBA 3NQIA 2AQ3B 4HTHA 2AX5A 4QQBX 1DOLA 4A3DG 4RHSA 1G6ZA 1WGHA 2WDQB 3ZNHB 3I56A 1TKGA 1WJUA 3ETRA 3ITPA 4LJZC 3EFXD 2R93H 4NDXA 2AL6A 1H9KA 3PSEB 5IT9L 2RCFA 4A3IH 2B2UA 5AFWA 5IP7H 4DUYL 4HJ5A 4HAEA 2EYFA 3SK6A 1YHBA 1FNUA 4H44C 4R1JA 2Y0SE 1X3GA 2F0FA 3BJUA 4FP5D 2OHFA 3EQLC 2KOLA 4A3MB 3GE3C 4K2KA 1UAPA 2KZRA 2NVYH 1V1PB 3DWAA 1EYCA 2LJIA 2CU3A 2VQFL 4OX9L 3RZWC 2SDFA 5BO4B 2NVUI 2LRUA 3AMZA 2LMCA 4EKUA 5JAVA 2X69A 2PZTA 2MSED 1J9OA 3Q8DA 1LLRD 2E74C 3NXWA 4XE0A 4B3TQ 4A20A 4EZKA 1I4GA 5M3MB 1K8MA 1QVCA 3VYSA 4M8MA 3CF6E 3C1FA 3AEVA 2D10A 3DBHB 3EVQA 3S24A 1E0ZA 2LXJA 1BCPC 3FKYA 3RN9C 2PW7A 3J81L 3KJOA 1PXUA 1NDDA 1S5CD 3PTFC 4L5TA 4NAWB 2NZ1D 5C2TB 4L63B 4I65A 3APCA 4F7XA 4R4IA 4A76A 1KH0A 2UU7A 1D5XC 4EQ5A 5K5PA 2BB6A 3DHGC 2ZPNA 2WFWA 3P75A 4IO9A 2B63G 3RULA 3UIPB 4FJVB 2KC2A 4TUUA 2KHIA 1FL0A 2FXQA 3TDQA 3RNAC 5FKAC 4AJWA 2IX1A 1XTDA 3EBEA 1HFNA 2WWZA 1LV9A 4OW0A 4XTCS 4A3JG 3Q3OC 1RJTA 2BS3B 2HD5B 2IY0B 1XNQL 4B3TL 3RZFA 4BBRH 4PZ7A 3P1HA 3Q14C 2ACZB 2BWFA 4XYCA 1I3QH 4LFCL 4ZOHC 3KF8A 2LUEA 2MPMA 3HOYB 1Y1VG 4WQMA 2R7DA 3VR2A 1MSHA 2MP2B 2E5LL 5IYCG 2DENB 1JMCA 3AE3B 2CJOA 5DAUA 1J7CA 2BE5D 4BY7B 1K8RB 1VQFA 2LRWA 1F2YA 3CSTA 3DDCB 4M8NA 5F2DA 3L54A 1X55A 4LNFA 2EYOA 1PZKD 2O4XA 4A3GG 4DV1L 2VZKD 3FC4A 4UP8A 4ZKCB 1WXSA 5FO7B 2KVMA 1BVSA 1IGCA 5M9OA 3CQZH 3MC0B 5HURA 2KVZA 4FF2A 3NY5A 4NP5A 5CC4A 4PMBA 1YVCA 1U4MA 2XK5A 2L12A 3Q8EA 1ZGUB 4JI5Q 3WCQA 1SB3C 2KEEA 1T5XD 1PTOF 1LUZA 1VQBA 2A68C 3LJ3A 1VJKA 2P5ZX 4HSPA 5G3LF 1O7ZA 5IY0A 1PRTC 1ESRA 4M01A 3ONSA 3ND8A 1ILQA 1F52A 1EY7A 1T5EA 2BGFA 2L7RA 4DR4L 1HNXL 2KOXA 4KGTA 4OIJA 2SEBD 4G50A 4JI2L 2INNE 3T3OA 2KVRA 2B8GA 1X54A 2KMCA 4LCDE 3BVZA 2VH1A 3ENEA 1QNUA 3WDNA 3MHZA 2A5HA 2GI9A 1YNJD 1X56A 2L11A 3J81j 3F1ZA 2G3QB 3C1EA 2L55A 4A4IA 3GE8C 1P7EA 1L5PA 3W9CB 4A9AA 4C4VB 4F8CB 4JW0A 1AW7A 2IHFA 1L6VA 3I55A 4WIPA 3AE5B 4JWUC 1OQQA 1PGBA 2K1FA 3BWUD 4KK7A 1B9MA 2DNCA 2VB2X 4IUTA 1K8AC 5E7NA 2LVPA 1WM2A 4BKTA 3DVNV 3FHWA 3KYHC 3TZUA 2L1BA 5I4DA 1ROEA 1CJEA 2KECA 3KFUA 4HEA1 3GTOB 4WAFA 2R92H 4R3DA 2IGDA 5EE1A 4ODGA 4JYAQ 2IY1B 1WX8A 2WXFA 5G5GA 2WAQG 3QARA 4PNYA 2UWQA 4PQXA 4IJHA 3ZJYC 5JEAG 3RNEC 1X32A 3NUCA 4BA2I 4XWWA 1IKLA 1V8QA 5C0XJ 4P75A 1Z7TA 4GN4B 3AXCA 2MHVA 5C44G 4TSSA 4DR7Q 4YTNB 3VDZA 5IP9H 1CI3M 1V6EA 4KX6B 3U2SC 2JF5A 3PS6A 4A3PA 4P1BC 1XJVA 5M3MG 1OO9B 2F0SA 4V0BA 3A0JA 1VCIA 4KKUA 1Y1WG 1T0RC 2OEOA 1YIWA 2N7EA 2R2OA 3GTPB 1STBA 4RKLA 3OPOA 4K7UA 2K32A 1Y1VH 4KY6A 1RFAA 3KF6A 1KJTA 2PLPA 4DFAA 3UINB 4DAYA 2C7HA 3K80C 1EWCA 4GXBA 1QUQB 1DOKA 1UWVA 1L4DB 4NNJB 4FVMA 4WJ3M 1V9JA 3I4LA 3RT3B 3HRZC 2NS5A 3OYYA 2E76C 4DK1A 4GN1A 1EWIA 2J52A 1SMYD 1DGSA 1RCVD 3ZNID 2KJXA 2K8CA 2L3ZA 4ICVA 3TQYA 2XSCA 1KLGD 2VL6A 2K5DA 5DLQE 4FF3A 2WXKA 5AUKA 3NENA 2WHIA 1HNWL 4BOZB 2B2YA 1XXGA 4Y7NH 3UF8A 1WCMH 2LFNA 2PNHA 4B3RQ 2JRIB 1HNZL 3MJ5A 4A3BB 2WINB 2C5LC 1LT5D 2Y5BB 4LTUA 4BY7G 2PVGC 4P71A 1A3TA 4JCVE 5IYDH 2GA4B 1C9FA 3BDOA 1PZID 3M4PA 5AZGA 3NBHA 4XQNA 2F0UA 5BMGA 2L0FA 2KFJA 3K9OB 3QHTA 2IL8A 2JA5G 2FCNA 2ZNVB 3MC9A 3P7JA 4KGSA 4KLKA 2IX3A 4REZA 1JJGA 2W54A 2PQEA 5J22A 3DBSA 4H2AA 4A3GH 4X64Q 3TSSA 2D0PA 1RL2A 1QLBB 1R4NB 2EY2A 3AFPA 4DDGD 1NAPA 3Q8BA 1I4HA 3T3NA 3HOXB 4HIMA 2BA1A 1XTCD 4IALA 3V6EB 4K6LA 3E6ZX 3I3CA 5IT9E 1TS4A 4JBMA 2PYKA 4DK5A 4A3CG 4F7ZA 1PH9A 1T0QC 1EM7A 3MFGA 1VMCA 4F1SA 3EECA 1WR1A 1S1QB 3RN2A 1EO6A 2KCNA 1IBKL 2WXHA 3RPFC 1W3SA 2EY6A 4K7SA 1IW7C 3QC8B 1X3QA 1K51A 3L08A 3EA6A 4YTPB 1PTOD 2KBNA 1LABA 2Z6KA 2D5GA 2KX0A 2KWVB 4W9FA 4KTAA 1STHA 2K28A 2QDLA 1TR5A 2XGTA 1LXDA 2BW2A 1FMAD 2AWNA 1I94L 1EY8A 2FBWB 2A6HD 5E1FA 3A7AB 1AE2A 1DJRD 2RQXA 2JPHA 2ZNVC 1AEXA 4WWNA 2V1CC 1YN5A 2A1AA 5C4XB 3NE5B 4IFDI 2BTEA 1GHKA 3HVDA 4PG3A 2F0TA 5A2QE 4D2KA 2FIDA 2R3ZA 4ABNA 2K4KA 2B8FA 3B6YA 1Z6HA 2E2HH 1WGDA 1WTXA 4I7AA 2WXGA 2Q8TA 1XMOL 2A8VA 2UXBL 3Q8FA 3PLVA 3GV6A 1NCVA 4I6LB 4JWSC 4ZRZA 4YWGG 2K8BA 2R6GA 1XNRL 2GMIC 3UDIA 3S1NH 4C3IB 1PGXA 2K04A 1M90C 4AWJA 4NAMA 4GDKA 1Q86C 2QA4A 5JJKA 3MEFA 1EYGA 1F1HA 1YNXA 4XX5A 2L15A 1CKOA 3E0JA 5D3IB 1CKNB 1A6XA 4FXKC 1HZBA 1DOMA 2K50A 2YTXA 2ZJRA 2HHHL 2JEBI 4WWPA 5FLXE 2BYTA 4QAYA 1GUOA 2M0AA 1QKZA 1K8GA 3BG3A 4WQOB 1W6KA 1GD7A 1V5TA 2PW5A 1M94A 3TUOA 3A9JB 2PO4A 1SNOA 3F2UA 5GQOA 3WA0A 5D6JB 3KLWA 2Z9HA 4RGOS 5LL6S 1JWBD 1TBEA 4F87A 4IFDH 2MFIA 3QWNA 4TMAB 1HRJA 4PZ6A 3N1YC 4TQ0A 1PFMA 4CHKA 4JV5Q 2IGHA 1CZWA 1KF6B 1O80A 4J1MA 5IGEA 3DBLB 4MEMA 1X1MA 3P4RB 4BKSD 1U4LA 3AI5A 5LXIB 1ESFA 4HMIA 3OJ3A 5CR3A 1WTWA 4MN3A 5CGKA 3J7A5 2I1KA 3NTHA 4RMFA 3M62B 3AFQA 1EUJA 2KTRA 2ZW1A 3NTIA 1YX5B 1EU4A 1SSOA 1UNSA 1SE3A 4H13C 2WXMA 1YEZA 1FXTB 4A3CH 3ZRCA 1B9RA 5KNDA 4X65L 4GB9A 1K83H 1BCPB 2BE5C 2DN8A 1UUPA 1C8CA 3GTLH 1TZOA 5IOIA 1GHJA 2JZ3B 1PYBA 3G6JB 4LW1A 4ZRIA 5LMNW 2KK8A 1E24A 2NPTB 3PLUA 2MBOA 2F1MA 3MTSA 2NBFA 1ZYRD 3NEMA 3GTJB 4HCPB 5EQ0A 2K05A 1K3RA 4DNTB 4QMGA 1MSGA 3NHEB 3J7YW 1AZPA 2WAQE 2XTIA 1VZ8A 3BDLA 4KIKA 1EL0A 4MJSB 3ZJUA 4JI6L 3S2HH 2EYHA 1L1OA 1J0GA 4L1BA 4F8MA 5HGTA 4DXFA 1EWHA 2C9OA 1QOHA 4A93B 3Q8CA 2G9HD 2LEKA 3ZDTA 2C35B 1Q8IA 2FUG1 1WE7A 2JXXA 3PREA 2WKDA 4URKA 5ELNA 1HUNA 1P0RA 4IOAA 4I7ZC 1ZP0B 1G91A 3HGBA 4JI7Q 1BR9A 4X57B 2K9XA 1NMFA 3UIOB 1H4RA 2Q8RE 4C1NI 2B2TA 5CYUA 1I7HA 1EUVB 2FAZA 2UUAL 2I38A 3GO5A 4C1NK 1XLNA 3Q22A 2KANA 1OXUA 4NQKE 1B44D 1IYUA 3BINA 3GTGB 1HE8A 2C7MB 2F0DA 4GNXC 3CC4A 1D1IA 3X3MA 1I50B 1FXAA 2HCIA 1N62A 1TKYA 2F0IA 4DGZA 4K0KL 4HXDA 1GJZA 3PRMB 4ITKA 2KN5A 3J9CA 4NQLB 3SFDB 4AUQC 4ZUJA 2F0PA 3HM3A 3HVZA 2N9XA 2NBUA 3X23A 1PYWD 2LGIA 5C44B 3RCZA 1VQ8A 3NVVA 4CDDC 4JOIA 3I2ZA 4WRDA 3PF4A 5IYDG 2FE8A 3AECB 5KGUA 2F0HA 3ZJVA 1X3EA 2F4IA 5CV7A 3TIXA 1E7ZA 2N49A 1AH9A 3PV0A 4GKKQ 3VHTC 4A3KB 2V4IB 3GB1A 3I7FA 2E2IH 4UY8C 2WP9B 3S9WA 1U9RA 1B50A 5IWAQ 4JG2A 1A2TA 2NBVB 2CQOA 1I6HB 2AMCB 1CKNA 5JJZA 4X62Q 2RSUA 1QUQA 3BZCA 2V3PA 2B2WA 5J39A 2B3GA 3BVMA 4JK1C 2R7ZG 4N9PA 3SK4A 4YCUA 1KLVA 2BYEA 4POGA 2MH7A 4GDKB 1KOTA 3DVNU 4FF1A 1DGJA 3URYA 5JZEB 1WM3A 4YSXB 3LDZE 4ARCA 3GZNB 1C7YA 1H95A 2IW3A 1VQGA 3S1QB 1UEAB 2NZOA 3UQAA 3H7PB 2AQ1B 3VRAB 2NVTH 2BPSA 2DLBA 4DNRB 2JA8H 1WXQA 4DU9A 1PTOH 1QWYA 2WDVB 4I6PA 4KN7C 1J5EQ 4OZCA 1XEEA 1RAXA 5H8YE 3D0FA 4LFAQ 4DV3L 3KWLA 5DPRA 3STBC 1E10A 4A3EH 4CJ2C 2L00B 2AKWB 2IY5B 3NJTA 2B76B 2DZJA 1HR0L 2N9PC 1HTQA 3DXJC 1DXMA 4A3IB 3PO3B 1MHHE 2MQHA 1WD0A 4IM0A 4II2B 2A19A 2FUHB 4GGQA 3M3YH 4DR5Q 2FCQA 2NN6I 1NEKB 4EE2A 2HDMA 1MJCA 2YLMA 4LNOA 3A1QA 1HZ9A 4LDTD 4CO7A 3LGJA 3FEWX 3S15B 1I4QA 3K5MA 1A3UA 3I3TB 3M3YB 1MFWA 1VQNA 2VZKB 2E75C 1OXVA 5IGFA 5M5YH 2WXLA 2QKIC 4KHPQ 2LHEA 1TWFB 2FMCA 3U9OA 4C3JH 3B1LX 2HUGA 3H0GG 1FXIA 1R4QB 4BZAA 1JALA 2FHTA 3RZOB 1Q82C 5IO9A 5M3MH 2KXJA 1BMLC 4PS8A 4W9LA 3ZO5B 1GKHA 4IURA 4HJAA 1OGWA 1EZ8A 4QIWB 4P74A 1ZUD2 2BB5A 2KN4A 5C3EB 2IJ0A 1E6EB 1B8AA 1J19A 4LJPB 1L2FA 3KUZA 3D4WA 1L1OB 2B63B 1QZEA 2LXKA 3EIVA 4C7YA 3D31A 2JA6B 4ZAIA 5EE9A 3CKIB 2GB1A 3MJWA 4MSQB 5C23A 4A8XC 4US9A 2K8HA 1B3QA 3TS2A 2PKOA 1Y8RC 3K59A 4XT3B 1SRUA 4NPSA 2ZM6L 4ALPA 4IG7B 5AUIA 1WYWB 4S17A 1BUVT 1PH3A 2C9WB 1O7IA 5DEHA 3QX1A 3IKJA 4KSKC 5FLXL 3PO2B 4RH6A 2R92B 3ML8A 4C3IG 1EF1A 1X65A 1WX9A 1WGGA 1BNZA 2D0OA 2JWUA 2HT1A 3AU7A 4QCLA 1Q5WB 3KBGA 2JE6I 4QUCA 3RNCC 3M7NA 1XYIA 3NVYA 2DZKA 1UBIA 2N9EB 4HKQA 1FCLA 1FVIA 4DAYB 1V1QA 1SSNA 5ISRA 2DNFA 4ZRKA 2D07B 4DUZQ 2VUMB 1F9QA 3R8BA 3T1YL 2WGSA 4HCNB 2E2IB 4IPGA 2ZTEA 1E7VA 1WZ3A 3AN1A 4OVUA 5CV9A 4LF5Q 3OIQA 1TYGB 3FVQA 3IHPC 2L4NA 2ES2A 4TQUS 3S2DH 1RLFA 1N8RC 3AM9A 2FMMA 3M4OB 1SJED 1TKEA 1AWDA 3SGIA 2RHQB 2RVLA 1B4OA 1KNEA 3D32A 3N9YC 1JWAD 4H02A 4JI4L 3KWVA 4EQPA 4WFN3 1WVLA 1QVFA 5IYBH 2I5HA 3S17B 2L76A 3ULJA 1TY0A 2DYMA 5E6OA 5CBEE 1LYLA 3I4NH 2A5UA 3M4OH 3TN2A 3CCLA 4Q2JA 2F52A 2J53A 3S15H 2E8GA 2PJHA 1PH4A 3UI3A 3CRKC 3L7ZC 4GKJQ 1KRTA 4C2MB 3VR4A 2KQSA 4B9XA 2QDBA 1BQQT 3KF6B 1VQ6A 4HIKA 1TIFA 2NB0A 1X3PA 4DV7Q 3HOVB 4K81A 2KEDA 1EIFA 4C00A 4O1NA 1WGYA 3H0GH 4HDOA 1H9MA 3HKZE 1XMQQ 1N63A 2ON8A 2F0EA 4QL5A 1B2TA 3PUWA 1TWCH 3V62A 1P8LA 2OQ0A 4IUQA 5IGGA 3ND9A 2MBQA 3ZVVA 5C0XG 3M4YA 4OX9Q 3CAMA 1BKBA 1H9JA 4DNIA 1KL9A 3JAME 2ZZPB 4APVA 1SN8A 2DWQA 3ML9A 1L2NA 5JVG3 4HJ8A 3Q23A 1XQQA 1K9MC 4JI1L 2DYOA 4K7WA 1LQBA 3JVZX 3VTWA 2B2YC 3KK7A 4X3TA 4X66Q 3J81i 5JPMC 1HNWQ 1SYFA 3SD5A 4LJOB 2KCTA 4GKJL 2BWES 1JR0D 1U4PA 1V1OA 1E5WA 3N30A 2N1VA 4B3RL 2FNJB 3Q8AA 2J42A 2KT7A 4YXDB 2M2LA 3Q3NC 4RM9A 3BZKA 1F77A 2NUCA 4GLSC 3ZTDA 5IYCH 2R2QA 3ZYYX 4ANXA 3BS1A 4IQZA 3RD2A 4BWGB 2EIFA 3PCOB 3JW0X 2B2VA 3I90A 2CQAA 4ME3A 1RIPA 2KMMA 3DHQA 2J0KA 4HJ9A 4ULLA 1EY5A 3NP8A 1OQYA 1YITA 2PW9A 3BY4B 4WWMA 1G6JA 1VQDA 1ZE3D 3RLFA 2MP2A 3DHHC 3U7DA 2QW7A 2H1EA 4JI1Q 3GTOH 3PUYA 4A3MH 2NBWB 3UDGA 1TY2A 5FJ8G 3BZDB 4C7ZA 3UQBA 1NVID 1VQCA 4X64L 3A8JE 4AYBB 1XNQQ 3TBIB 4P7IA 5FR6A 1R4MB 1SXTA 5KIXA 1WD1A 1GUGA 1SROA 2KDMA 1N60A 4DF7A 3TEWA 3GD7A 3D8GA 3NZ3A 2A74C 3I5JC 5DPSA 1EU3A 2MJ8A 2YV5A 2K3UA 1LTBD 5IKCM 2N3SA 3RNGC 5CX3A 1DCZA 3E56A 3U7ZA 2JJQA 4TRDA 2QCPX 3A8IE 1NI2A 2UUCQ 3T13A 4BY1H 4XDCA 2I07B 1Q1OA 2VUMG 2W3SA 4W9GA 3WWVA 1J7BA 2WNMA 5CHFA 4CYEA 3K7AB 3APFA 5LXHA 4JI8L 1PZJD 2GOWA 3SXHA 2DNEA 2JEAI 2E2DC 4DHZE 4DK6C 3QIAA 5LHY1 3P4SB 1YNJC 1VQJA 3PVLA 1VF7A 4K3BA 4MH8A 3N6RA 4CDFC 2KAJA 1IXRA 3QWZB 5GAHC 3V3XA 2N78A 4E71A 1Q7YC 1S4ZA 4DR6Q 4RHRA 3G6EA 4S3SA 2KENA 2VH2A 1FIQA 2K22A 2WXPA 3P2BA 1K50A 4DV0L 4O2DA 1S5ED 2AWOA 1V1PA 3K5NA 2PMVA 1TWHH 5LMNL 3PMFA 3GP7A 1KDBA 1WGRA 2CHZA 3NOBA 3T1HL 3ERQA 3PUZA 2LD9A 4RKBA 4YL8A 3U50C 2LGDA 2JA9A 2CHXA 1Y69U 4RM8A 4HN7A 3HUIA 1HXYD 4IOCA 3CCMA 2NN6H 2VNUD 2Y5PA 1GG3A 3RNUA 2F0KA 3EJIA 1QT9A 1V5OA 4MNOA 4A3EG 4MELA 1HPCA 3U58A 3JC66 1AFPA 4ICUA 2J0JA 1QF6A 3CCJA 1WYGA 1FD6A 4ANVA 3WIMA 1I4PA 2R7ZH 4NMZA 2BBCA 3M4QA 2W3RA 4CDCC 2OJWA 4DXAB 4OL7A 3W1SC 3APDA 4KDLB 5CTRC 4BVUC 1PFNA 2MNAA 2RSNA 5KYIA 2WQYB 3GTJH 4L2YA 2MWSB 5HGQA 5EPLA 3W5VB 1SEBD 2OWOA 1N33L 3OLMD 4IJLA 4K2LA 2LGXA 4LUVA 5D94A 3T53B 2BVCA 4C3JG 4BBSH 2Q8IB 2HIXA 2BKFA 1OFFA 2HTME 2JXTA 3CHBD 4HLEA 4J8QA 3DUZA 3OMGA 1LGRA 1WH3A 4GDLB 2ENBA 5E3FA 2KNBA 2NPTA 2PTLA 5C1ZA 1WOCA 1GUAB 3D6WA 3B0AA 3I73A 3C8YA 2LFIA 1TIID 2DBYA 2LUMA 2SNSA 2VY3A 5HY6A 4CBVA 3DEOA 2XK5B 1UEBA 4BAXA 1JB3A 1JB7A 4R4QA 2ZCCA 3VUXA 3PO0A 1WTHA 2F0MA 2KFKB 3DWGC 3V96A 1J8IA 4P2CB 2ASBA 2E2HB 4YSZB 1RD9D 3I91A 2NTTA 4RCOA 1WJ6A 2IBIB 3HOYG 5GAGC 1J7AA 4DAVA 3QIJA 1SYBA 3DWMA 3TREA 3ZKJC 3SK8A 1BXTA 2L52A 1NR2A 4HROA 4EVOA 3NWSA 4C3IH 5LL6X 4MT5A 3U52E 3CCQA 2SNMA 3DVGY 4DAMA 4C3HG 1JJCB 3IFDA 3R2TA 1VD2A 1ZXIA 2GRIA 1BCPD 3T8MA 5KHQA 5M3FB 4HDQA 3MXNA 3H3VI 4DHJD 1A2UA 4UPAA 2QSDA 4ASWC 4KSLC 4LDTB 2RHSB 3A7LA 2BT6A 3CQZB 1ML0D 2YYZA 5AJ3Q 3K9PB 4A3IG 4MGKE 5AEKB 4IPDA 2WX0A 4JE3B 4RAUC 2DY7A 3RMHA 1W2BA 1PMRA 4GN5A 1Q1BA 1SGHA 1UF0A 1IW7D 2FJ2A 3A74A 5MPOA 4XDXA 1KC8C 4LNKA 4OO1H 2JK8A 4KD3A 4K3CA 3DVGX 1HZCA 1XWEA 4JI0Q 2KHJA 1RYJA 1ENFA 2PPBC 3EN2A 2A6HC 3BU2A 1GUWA 1P7FA 1E8XA 2LVQA 2EY1A 3IT4B 4Y52H 4ZRQA 2JVCA 1LTGD 5I2XA 3S2HB 1EY4A 3FDTA 1QZHA 2A4ZA 3S1MB 2JU6X 1GAQB 3AE1B 2AWTA 1Z9FA 3JSVB 1EYDA 2L1AA 1KD1C 1U5KA 1MVKA 4AQYQ 5EKIA 5T1IA 2JA7H 3JAML 3R7QA 5GMVA 2DAFA 3MC8A 3GTLB 1DZ1A 1CFMA 5I9OA 2QCZA 4GLVB 4G7ZC 4TKNA 1IGDA 5DM73 1FGBD 1WJJA 3ZUNA 2WAQB 3GTKH 4W9JA 2R61A 5IGDA 1PFDA 1UE6A 4JI0L 1DYQA 3KUCB 2KQ7A 2D3AA 1SAPA 3NELA 2ZJPA 1NNXA 1MGSA 2A68D 4KZ0A 3I8ZA 3HOZG 4JI3L 4GZYC 4JGHB 5NUCA 5IE8A 3LB8C 5IGBA 2JT4B 3Q6BA 4A3FB 2VXWA 2BA0A 1LT4D 5DM63 4LF4Q 3LYYA 3RMKC 1IBXA 1E1OA 2RGFA 5BYRA 4MGZE 2K0PA 4ZRPA 5BMIA 2MJDA 2LZ6A 4IKGA 3VYTA 1ICWA 1WXVA 5T1GA 3DBRI 1JORA 3A8KE 2G9DA 2RBMA 3T4AC 2EPBA 3QJYA 1PA6A 3JYUA 1PH7A 3HOYH 1L4ZB 1MJDA 1F2LA 4A3FH 1E9MA 1NBWA 2EE1A 2HHHQ 2N1WA 1LO5D 3GZNI 4BBSB 5D3DA 3QJZA 2INDC 4TVAB 1PHJA 2D3GA 4LNNA 4KJNA 1GM5A 2K6AA 5IYBG 4ID6A 1Y1WB 1FO4A 2G4SA 2PE9A 2Z8LA 4RGTA 1E22A 3KVFB 2EKEC 1WJ4A 1E1TA 2F0NA 2O6VA 4FXDA 2KO3A 2I5LX 1U4RA 1NMGA 3HM6X 4JV5L 1WTRA 2N7JA 2NVQH 1PH8A 2V0GA 2B63H 1C4PA 1GOZA 1E7UA 2N4FA 2WB1E 2AL3A 5J2RA 4MZ9A 1WCMG 1ZPSA 3AULA 5H1SE 4A3JH 1STNA 5ELOA 3N1XC 1C3TA 4B3MQ 1EOVA 5JVH3 1ZDXA 1MBYA 3I4MB 3AEGB 1SYEA 1N61A 5FR3A 4L5RC 1EQVA 5GROA 3A9KA 3KQ4A 3FPUB 3W5OA 2DX5B 2O6VD 1K53A 2NR2A 3IVFA 2IT1A 4IC7B 4A3KH 3AE6B 3RYTA 1VQPA 1JWUD 5KRUA 1IUEA 2N0SB 1VQKA 2UXDL 4NXNL 2JA5H 2PPHA 4MTNA 4OXPA 2O2VA 4R4CA 1D4BA 3J81c 3D4DA 4DWFA 4AIMA 1KRHA 2NVTB 3GTKB 3MTNB 4R8IA 2KMAA 3S1MH 2K75A 1K73C 4LNIA 1R9TH 3QO2A 3NTKA 4DK3C 1MJEA 3NUHB 4B3ML 3SFEB 3TJPA 1SF0A 1YOVB 5JHAA 3A5UA 1EIGA 2MBBB 4A3LH 2M0XA 4A3DH 4HR7B 3H3VH 2DZIA 3CCUA 4N9F4 5KYLA 4TQ1A 1XCTL 1R9TB 3W3AA 3U9SA 4DV4L 2NVXH 4W9HA 3PRZA 4MDKE 5M5XB 3H9DA 4EZLA 1E0BA 5LMUL 2ZXPA 2UXDQ 1C4AA 4FHKA 3CRLC 4UP9A 4XC2A 2W55A 5IP7G 2BF8B 3AE7B 1XCQL 2IX0A 1YQBA 4KJOA 1Z5SB 2C5CA 2K5VA 2Q2HA 4DUZL 4DXGA 1EFID 1PQSA 1B70B 5K36G 4HIDA 1CHPD 2K7VA 4C2MH 4ZK9B 2IZVB 2LWPA 2O6VB 3VAWA 4KGRA 1ENAA 2IGGA 4NB3A 4KHVA 1QOFA 2N8NA 3NSWA 3I70A 1CK1A 3DCGA 1F9JA 4KKSA 2JP1A 4NW2A 2MCNB 1LTAD 1FJGQ 1BCPF 1S3SG 1VQ4A 2ZXRA 4JI4Q 3L2PA 1A15A 4LWCA 4FNFA 1A5RA 3AEFB 1QE6A 2KUMA 4LFBQ 2K03A 3DOWA 1UE1A 2N55A 2ATWA 3FAHA 3K0XA 4GS3A 2UXCQ 2OCEA 3NBHB 2A73B 3TMEA 2WLBA 3I4MH 3CC7A 4BXXG 3X0WA 4ZHOA 4DR2L 4G7HC 2K01A 4DV7L 1G291 3QCAA 1IBXB 1QG7A 3Q0AA 4NPNA 4OO1G 1NBFC 1T0SC 2Z1CA 5D65A 3OTOL 1GPXA 1KABA 2ZT9C 2KDFB 1KFYB 3R3OA 1JOOA 3HZXA 1GUTA 2K1BA 3NK9A 4ZQ3A 4AH6A 1BBWA 1YJWA 2MX2A 1ENCA 1S5BD 3MWYW 2NYZD 3SK5A 3STBD 4B08A 2N88A 3ULPA 1MG8A 3S14B 4ZDVA 5H92C 2WKCA 1I4RA 4W9EA 1IYFA 2LS01 2VUMH 1C1YB 2KX3A 4Q0FA 4MSMB 2LGYA 2UXCL 2ALYB 4K1RB 2F03A 1SBBB 3F2BA 2H89B 1J5EL 3AE8B 2M17A 3DBRB 1C79A 3CCVA 4LFCQ 1PVOA 3AE2B 3HHMA 4LFAL 4K5XA 1Q81C 3GOEA 3J80i 1VF5C 2CH4W 4CHTB 1G8ZD 2PE6B 1GUSA 4JVZA 1V80A 4MHEA 1DOXA 1JICA 1VQIA 2F0GA 2MHJA 4ZUIA 1Y56A 4DV1Q 3H09A 1VQAA 3CCRA 4DR5L 1M1KC 3NS1A 1LTRD 1VLBA 4N6EB 3UI2A 5J18A 2HDLA 1KM7A 2XN9C 4L5QA 2N9KA 4ZKBB 3K57A 4ZHPA 3AMUA 2HCCA 5HG2A 2R7FA 4P1CC 4EUTA 2MP1A 4BBRB 4A93G 1NSNS 5IOCA 1SNPA 5C3WA 2MW5A 4JC0A 1I3QB 3S1QH 4WJOA 1JWSD 1N32Q 5DCNA 3JAMi 1S5FD 2GBJA 3MXNB 2H5XA 4KHPL 1PUTA 2GBNA 3IFWB 4USAA 4ME5A 1HNXQ 1GB4A 4WJQA 2WXJA 2MQJA 5EJWA 2KJRA 1JWMD 3RLOA 2XIWA 1R4MI 3O13A 3KW5B 3K5OA 5ELCA 4DDID 1BUIC 4A3LG 1V97A 1D8LA 3DLLA 2WV6D 1D2BA 3AYHB 2OF1A 3V05A 3N52A 3ZNGC 1Q12A 2CCZA 4G57A 2AEHA 3VVWB 4IM2A 2CW0D 1G6PA 4FHJA 1EY0A 4C3HH 1N5XA 2L9HA 1RF2D 1ZXTA 1IHZA 4QY7A 1P1AA 1N32L 2KQ4X 1PH6A 5C44H 2QIEB 5A2QL 1TTNA 4AJYB 3QR8A 4WJWA 4FLHA 3Q3JA 4C3HB 4P72A 1S72A 1TT5B 1UELA 4XQJA 2VZAA 4GNXA 1JOQA 5M3FG 3HOWG 4MGYE 2ZJQA 3P1MA 5IODA 3T1HQ 2PMZB 2EJMA 4A3BH 4AYBE 1DONA 1E8WA 4F88A 4YCVA 1IL8A 4DR3Q 3RZOH 2INPE 3QOLA 2KDIA 3QQ8B 4HJKA 3ALBA 4DV2L 3D6CA 4RGNA 1ILPA 2KKCA 2BS2B 2F0WA 4JI5L 3NWTA 2KD0A 1SNDA 1YD8U 3TEZA 3VR8B 1JJ2A 2UYZB 2D2CC 2RKSA 2JQRB 2CWPA 1F2RC 2PNRC 4OELB 2ZXOA 4DR4Q 3M3JA 2JXMB 2QHOA 1CA6A 4GU2A 3OW2A 1D7QA 2QEJC 2QMTA 2PMZE 5JEAJ 2WIIB 1Z47A 2EYJA 4CQNA 3OWEB 3HOZH 3DHIC 3SVMA 4IFDJ 3ER0A 4YWMA 1ACCA 4DR3L 2FCMA 1S40A 3OG5A 2EXZA 1A62A 2DUDA 5C6AA 4LF8L 2ICEC 1SDFA 3SR1A 4LK1C 5JPNC 2VB3X 4DV2Q 2PQAB 1KQSA 2KCCA 5C4XG 3KDFA 1JROA 2NMQA 1XLQA 2ZPYA 1KNAA 4A3EB 4W9DA 4U673 3ZW3A 4BY1B 2EMTA 3IAM1 2CHWA 4B95A 4JIOU 4JYAL 2MGSA 2RDFA 3VR6A 4DKAC 5KNBA 5CV5A 3NBIA 1HTPA 4K5WA 4GLAC 1QVGA 1DOYA 1F9PA 3Q6SA 3J81E 3EC8A 3ZIMA 4MTKA 1BT0A 2JX5A 4A3FG 1LFDA 1XPRA 2ZTCA 1WTOA 2M8SA 4A3MG 4BKGA 3NZUA 1HHVA 1Q0WB 2F0JA 4X66L 2UUBL 3OOCA 4LF9Q 4LF8Q 5E6PA 1KIXA 3WOFA 1UWXA 2WB1B 3UDXA 3E9HA 1A70A 1RHPA 3KLRA 1UBQA
chains in the Genus database with same CATH topology
1STGA 1D5MC 2B2WC 4K6DA 5I9PA 1EZ6A 4OZAA 2D9UA 4OZBA 2M00A 1OXSC 4O42A 1F9SA 1CM9A 3FKIB 3K5LA 3Q69A 2KHSA 1TT2A 5ELEA 2LKVA 3C2PA 3NRZA 3IAYA 2RDHA 4ARIA 5CV6A 5C4ZA 1FCCC 1JC7A 5BMHA 3EROA 1ZEQX 3MAQA 5EE3A 1G2TA 1XLOA 3BK2A 2PZUA 3HRDD 2AUKA 2FFKB 4LLGM 2WU5B 1HA5A 1HFGA 1HEZE 2OEDA 3X3NA 1PFBA 5EKKA 2EJFC 5EE0A 3P20A 4E6IA 5EBCA 2A6ED 2JA8B 1E2ZA 5CBAE 1D1KA 2QJLA 2J0TD 4B9WA 4DA2A 5KEEA 1WSPA 1VDVA 1KLUD 1VZ7A 5C4HA 3AH7A 2K5QA 2M9VA 3TP5A 1YNTE 1HUMA 2N9LA 4XWTA 4PMWA 2MJEA 3ABVB 3GS2A 2B2UC 2K5WA 1R4PB 2X6GA 3LXFA 2WDRB 2JYOA 3AE4B 3OWFA 2MUYA 1F2ZA 3KLSA 3C46A 1AYFA 2WXRA 3FRPB 1TWCB 4KMUC 1PGAA 1FD7D 2JA7B 3LWUA 1XF5L 1O7YA 5JEAH 3CIRB 1FNWA 3SR6A 3TEXA 1TS3A 2L0CA 1NR4A 2X6LA 2Y0SB 2E6XA 3IL8A 3S1NB 4RNAA 4A55A 4DQOC 2EDGA 2WXQA 1RWSA 1RTOA 5BYSA 3SDZA 1TWAB 2Q5WD 1LT6D 2NWGA 1V8CA 4NJCA 4KI0A 1CHQD 1L0VB 1ZDVA 1K83B 4L23A 2ONQA 1W6JA 3E9SA 4XT1B 2EVBA 2ICIA 5BYQA 2V3NA 3BYYB 5KNCA 1EIHA 1SFOB 4JBWA 1K52A 5GXGB 4FYDA 4KKJA 1GJXA 1F0ZA 2WU2B 4N58A 1AN8A 3VA5A 5BN5A 5ELBA 5C5MA 2HQEA 3P63A 3OSOA 4P16A 4B0MA 2WACA 2A69C 3H6MA 1HQMC 2OXPA 2PCFB 5M5WB 2EOTA 1TJEA 3SEBA 1Q10A 3NVWA 3VA7A 3PZ8A 4US8A 2F3WA 2YU9B 2NVYB 3D4RA 1NYQA 1ET6A 1R7SA 5CMDA 3RD4A 1BBXC 2TSSA 4JX1C 2IPKD 1CQVA 2H88B 1JCKB 2NVQB 2O5JC 4EQOA 4C56C 3B2GA 4LK0M 1KTKA 4HCSA 3OMCA 3AEEB 1RTNA 1GUNA 1Y8PB 5E4WC 3HS0C 4MIUA 3T56B 4Q5VA 4XYOA 1K8OA 3ZJTA 4N59A 4G7OC 3MFYA 3TP8A 3I9V1 4YTMB 1QB5D 5COYA 1N5WA 1T6BX 1PRTB 1DOIA 5C3JB 2L32A 4K8IA 3AEDB 1XX8A 5G5HA 2D62A 2KQ3A 1CQFA 1FEHA 2EKIA 1EY9A 1MPEA 1H9RA 1NI3A 2XVSA 1EQTA 2D5DA 4PT5A 2X38A 2PZWA 1D5ZC 3NPPA 4BA1I 3L9AX 1GB1A 1SYDA 4RGMA 2F3VA 4FO2A 1IYVA 1HCZA 1ONLA 2TMPA 4XXEA 4K5VA 3G7LA 1CZGA 3DEPA 1B53A 3HOUB 3HG9A 2Z4HA 1TVXA 4AS1A 5HHDG 5E4XA 3S1RB 1C48A 4P6VF 1HZ6A 2RSOA 3M7GA 3J7AF 2Y5CA 1YNNC 1MD2D 3AV8A 1LTSD 1YJIA 1FRDA 4X3KA 3BK1A 1WTPA 4HRSA 3H91A 1PTOB 4PV1C 5ELDA 1UWMA 1HQRD 4LAAA 3W2DA 5A35A 4KHZA 1L0XB 4IOIE 4EQNA 1D6EC 5M5YB 1E2VA 4X3SA 2EZVA 2NTSA 2JYTA 3MHBA 5FK9C 1PTOC 2OT2A 3T51B 1LTTD 3S16B 4RF0A 1STYA 4RF1A 3PZ7A 4CKEA 2L5TA 4UDUC 3DMUA 2JSVX 4A90A 1YN3A 2JA5B 3J80L 3VYUA 2QF7A 3L3OC 1H9SA 5CORA 1F9RA 1WTVA 5EKLA 2R7ZB 3I57A 1VMPA 3KUPA 4HCEA 1YN4A 2CJNA 2KACA 2RA4A 3NHHA 3K0YA 1NYRA 5HI1A 3KLSX 3GV3A 3A55A 1I4XA 3IXSA 1NENB 3SHLA 1VR9A 4ILWA 3LNNA 1AP0A 1EWYC 2EYMA 2RDGA 4MACA 4OVZA 2J7ZA 3AE9B 5D14A 2DY8A 2NN6G 2JSOA 1KDAA 5JOBA 3MEHA 3R93A 3GTQB 1F2RI 4HMJA 2RMMA 1DM0B 1DD2A 1ZXHA 1MI2A 4B0EA 4Y7NB 5FO8B 1YQ3B 4X3UA 1EEID 2IWHA 4C3JB 3HOZB 1M8AA 2AQ2B 3E5SA 4IUUA 4HEDA 2I2YA 1B9NA 1H9SB 2CVRA 2R93B 1EOTA 5BN4A 3LX0A 3U4EG 2JZPA 4WURA 4G4KA 1CZPA 4KKTA 4KKIA 5HFYA 3A54A 4H7BA 1CTMA 4NKLA 2F0QA 2WP8J 3A56A 1BDOA 4IDIA 5FO9B 1ZYRC 1WCMB 4QB4A 3TZDA 1RODA 3NQTA 2W82A 2CHBD 2SOBA 4FF4A 1HA6A 4Z9CB 4ZLTF 4XQQA 2WXNA 2E2JB 4L6TB 1C78A 2BOSA 3PIP3 2BS4B 2ZW0A 2WB1B 2BCOA 1OQRA 3IT6B 3Q24A 3EUB2 5EGTA 3RZDB 4YSYB 2KA7A 4RA8A 1B3AA 3L4PA 4R8NA 1LACA 3V2TA 1Y8NB 1FNVA 4IZ8A 4IN3A 4CJ0B 4XIGS 3J7AV 1WGKA 3D3RA 2BDOA 2EJGC 3ZQ4A 2J4XA 3PUVA 1IKMA 3MP9A 1OXTA 1Y8OB 2ID0A 5TSSA 2B2VC 4OIKA 3VR9B 3KBXA 5EPKA 1JRPA 3OIPA 3DWPA 4KY7A 2H4OA 3I72A 3T16A 2K33A 3HKZB 3CU7A 3B2FA 5I6WA 1FFUA 5I2YA 3HEJA 1WTQA 1JQYD 2LMCB 4DK0A 3OHXC 2PVOD 2A6EC 1SYCA 4ZYSA 3P4PB 2XRSD 2MJ3A 5EPJA 4WORA 3W1SA 3MXPA 3VQIA 2EYPA 2JYEA 1TWHB 4KGSA 1TKWB 1WWTA 3AEBB 3EGRA 2F0OA 1SNMA 3DWQA 1BO0A 1YJJA 1TWGB 1V43A 5C0XI 1ZOYB 3VRBB 4PMCA 5BN3A 1BF4A 1QJOA 1NUCA 2EYLA 3RFZB 1UGJA 3CWIA 4R9WA 4RFBA 1MHXA 1OXXK 1T3QA 1QOAA 3TP7A 1O78A 1SIJA 3MXUA 2YEPF 1JW9D 4U68A 1JMLA 3K58A 5E6JA 4JPSA 4M8AA 3P42A 4WH4A 5D7GA 4K8JA 3J80E 3MA2B 1Y1VB 2Y3AA 4HKZE 1Q90A 3RUZA 1F2MA 5EBDA 1TQOA 4K14A 1EYAA 1QNKA 4CKBA 1KDCA 3AB9A 4FXCA 3B9JA 1FYCA 4QF4A 4IFDG 3W5UB 1ZKOA 4FXGC 1B1ZA 1LTID 4HSVA 1LT3D 4KN4C 1C4QA 4C80A 3QOJA 3I4NB 2M56B 1XO3A 5K36H 1I6VC 4M0WA 5CV4A 1SNQA 1II3A 4HJGE 3PIO3 4QUFA 1QILA 2WXOA 3H0GB 3MZ5A 1C77A 3DM1A 1G2SA 1JOKA 3H8HA 1Q1EA 4A6QA 3BDCA 4RCNA 2G1EA 2XRQD 2QILA 3TEYA 5C0XH 2A69D 3FILA 1FR3A 3LWEA 1RM6C 3AB5A 2I46A 1XLPA 4XDDA 1EEFD 2RPVA 1RDPD 2YEPB 1SYGA 1VZ6A 1C4CA 1PRTF 4KY5A 1L6UA 1FRRA 2KWDA 4CKCA 3C3LA 1E7PB 3FMCA 2Z4IA 3MXGA 4DAPA 2O5IC 2XNAC 4A3GB 4CJ1B 1JE4A 4DN4M 3HOWB 2WS3B 2CW0C 2IDYA 2XWJB 3H94A 2MEKA 5IGCA 5CV8A 3S2DB 4TKOB 4J6HA 1SNCA 2O2LD 3VR3A 1PRTD 1E2WA 1PLFA 3GTMB 3VYRA 4MM3B 4NZLB 3WOEA 1TU2B 1O7LA 4H0LC 3BIID 3OW7A 5C3XA 4CGYB 4V190 4A3DB 3QG1A 1RFKA 2L83A 1SJHD 1SE2A 5C5LA 2K5PA 1PDXA 3PUXA 4RWSC 5IIFA 4OHJA 3BYTB 3P4QB 2BDNA 3QB3A 2M19A 1STAA 3IFTA 3ZGZA 1STEA 3BVGA 4YT0B 3M85A 3ONAB 2SAKA 1L0YB 3TP6A 1QOGA 3FILB 1BOSA 3R2IA 5I6YA 1MI0A 3H3VC 2XWBB 1S5DD 1CT1D 5LNK1 1TS5A 4OGQC 4AQ7A 5J1ZA 1EY6A 1YNND 1Q3LA 2B2TC 2B39A 3IAS1 1RKNA 5C4JB 2NVXB 2EY5A 4IUPA 3SE0A 3AEAB 1M4VA 2PIAA 4IUNA 1PDQA 1SMYC 5ELFA 4UAIA 3K6OA 2WXIA 4OO1I 1QOBA 1HTLD 1VDZA 1TS2A 4A3JB 1WRIA 5T8IA 3GQBA 4LMQD 2AUJD 1JQ4A 1A3VA 4KD4A 2LY7A 1HZ5A 2F0VA 1KAAA 1ET9A 5DNFA 1SE4A 2EELA 1CA5A 3FPPA 5JXVA 3HP3A 1VRAB 4N9TA 3MVVA 3VR5A 1YMHE 2FINB 4IUVA 1QCBD 5G3LD 1FFVA 1C76A 1FM0D 2F0LA 4J3OD 4BS9A 2E3TA 1YQ4B 4L8JA 4XYQA 3NVZA 2V4DA 4M1UB 2LHDA 4YIJA 1GXDC 4EGVA 1QQRA 4KV6A 1AZQA 2HDEA 3NQIA 2AQ3B 4HTHA 2AX5A 1DOLA 4RHSA 1G6ZA 2WDQB 1TKGA 3ETRA 3ITPA 4LJZC 3EFXD 4NDXA 1H9KA 5IT9L 2B2UA 5AFWA 4HAEA 2EYFA 3SK6A 4H44C 1FNUA 2F0FA 4FP5D 2OHFA 3EQLC 2KOLA 4A3MB 4K2KA 1UAPA 1V1PB 3DWAA 1EYCA 2LJIA 2CU3A 2SDFA 3AMZA 2LMCA 5JAVA 2X69A 2PZTA 1J9OA 1LLRD 2E74C 3NXWA 4XE0A 1I4GA 5M3MB 1K8MA 3VYSA 3C1FA 3EVQA 1E0ZA 1BCPC 2PW7A 3J81L 1PXUA 1S5CD 4NAWB 2NZ1D 5C2TB 4L63B 4I65A 4F7XA 1KH0A 1D5XC 5K5PA 2BB6A 3P75A 3TDQA 5FKAC 2IX1A 1HFNA 4OW0A 1LV9A 1RJTA 2BS3B 3P1HA 2ACZB 4ZOHC 3KF8A 2MPMA 3HOYB 4WQMA 3VR2A 1MSHA 3AE3B 2CJOA 5DAUA 1J7CA 2BE5D 4BY7B 1F2YA 5F2DA 2EYOA 1PZKD 2O4XA 2VZKD 3FC4A 4ZKCB 5FO7B 2KVMA 1IGCA 5M9OA 3MC0B 5HURA 4FF2A 4NP5A 5CC4A 4PMBA 1U4MA 3Q8EA 2L12A 3WCQA 1SB3C 2KEEA 1T5XD 1PTOF 2A68C 1VJKA 5G3LF 4HSPA 1O7ZA 1PRTC 1ESRA 3ND8A 1ILQA 1EY7A 1T5EA 4KGTA 4OIJA 2SEBD 2INNE 3T3OA 2B8GA 3BVZA 1QNUA 3WDNA 3MHZA 2A5HA 2GI9A 1YNJD 2L11A 3C1EA 2L55A 1P7EA 1L5PA 3W9CB 4A9AA 1AW7A 1L6VA 4WIPA 3AE5B 4JWUC 1OQQA 1PGBA 3BWUD 4KK7A 1B9MA 2DNCA 2VB2X 4IUTA 3TZUA 2L1BA 5I4DA 1ROEA 1CJEA 2KECA 4HEA1 4WAFA 3GTOB 4R3DA 2IGDA 5EE1A 4ODGA 5G5GA 2WXFA 4PNYA 4PQXA 5JEAG 1X32A 3NUCA 4BA2I 4XWWA 1IKLA 1V8QA 5C0XJ 1Z7TA 2MHVA 4TSSA 4YTNB 4KX6B 1CI3M 3U2SC 4MT5A 1OO9B 2F0SA 4V0BA 1VCIA 4KKUA 2OEOA 3GTPB 1STBA 4RKLA 3OPOA 2K32A 4KY6A 2PLPA 4DFAA 4DAYA 1EWCA 1DOKA 1L4DB 4FVMA 3I4LA 3HRZC 2E76C 4DK1A 2J52A 1SMYD 1RCVD 2KJXA 2XSCA 1KLGD 2K5DA 4FF3A 2WXKA 5AUKA 2B2YA 1XXGA 2LFNA 3MJ5A 4A3BB 2WINB 1LT5D 4LTUA 2PVGC 1A3TA 2GA4B 1C9FA 3BDOA 1PZID 3NBHA 4XQNA 2F0UA 5BMGA 2IL8A 3P7JA 2IX3A 4REZA 2W54A 2PQEA 5J22A 4H2AA 3TSSA 1QLBB 2EY2A 1NAPA 3Q8BA 1I4HA 3T3NA 3HOXB 2BA1A 1XTCD 4IALA 4K6LA 3E6ZX 3I3CA 5IT9E 1TS4A 2PYKA 1EM7A 3MFGA 1VMCA 2KCNA 2WXHA 3RPFC 2EY6A 4YTPB 1IW7C 1X3QA 1K51A 3EA6A 1PTOD 2D5GA 1LABA 4KTAA 1STHA 2K28A 1TR5A 2BW2A 1FMAD 2AWNA 1EY8A 2FBWB 2A6HD 5E1FA 3A7AB 1DJRD 2RQXA 1AEXA 1YN5A 5C4XB 3NE5B 4IFDI 2BTEA 1GHKA 3HVDA 4D2KA 2F0TA 5A2QE 2R3ZA 4ABNA 2B8FA 1Z6HA 1WTXA 2WXGA 2Q8TA 3Q8FA 3GV6A 1NCVA 4YWGG 4JWSC 4ZRZA 2R6GA 1PGXA 4C3IB 2K04A 4NAMA 3E0JA 5D3IB 1A6XA 4FXKC 1DOMA 2JEBI 5FLXE 2BYTA 1GUOA 2M0AA 1QKZA 3BG3A 1W6KA 2PW5A 3TUOA 2PO4A 1SNOA 3F2UA 4RGOS 5LL6S 1JWBD 4F87A 4IFDH 3QWNA 4TMAB 1HRJA 4TQ0A 1PFMA 2IGHA 1CZWA 1KF6B 1O80A 4J1MA 5IGEA 3P4RB 1U4LA 1ESFA 4HMIA 5CR3A 1WTWA 4MN3A 5CGKA 3NTHA 2ZW1A 3NTIA 1EU4A 1SSOA 1UNSA 1SE3A 4H13C 2WXMA 1B9RA 5KNDA 2DN8A 1BCPB 2BE5C 1UUPA 1C8CA 1TZOA 1GHJA 3G6JB 2F1MA 3MTSA 2NBFA 1ZYRD 3GTJB 5EQ0A 2K05A 4DNTB 4QMGA 1MSGA 3J7YW 1AZPA 1VZ8A 3BDLA 1EL0A 3ZJUA 2EYHA 4L1BA 4F8MA 5HGTA 4DXFA 1EWHA 2C9OA 1QOHA 4A93B 3Q8CA 2G9HD 2LEKA 1Q8IA 2FUG1 2WKDA 1HUNA 1ZP0B 4I7ZC 1G91A 3HGBA 1BR9A 2K9XA 2Q8RE 4C1NI 2B2TA 5CYUA 1I7HA 2I38A 3GO5A 4C1NK 1XLNA 3Q22A 1OXUA 1B44D 1IYUA 3GTGB 2F0DA 1D1IA 3X3MA 1I50B 1FXAA 2HCIA 1N62A 1TKYA 2F0IA 4DGZA 4ITKA 3J9CA 3SFDB 4ZUJA 2F0PA 3HVZA 1PYWD 2LGIA 5C44B 3NVVA 4WRDA 2FE8A 3AECB 5KGUA 2F0HA 3ZJVA 2F4IA 5CV7A 3PV0A 4A3KB 2V4IB 3GB1A 2WP9B 3S9WA 1U9RA 1B50A 1A2TA 1I6HB 5JJZA 2V3PA 2B2WA 5J39A 3BVMA 4JK1C 4N9PA 3SK4A 4GDKB 2MH7A 4FF1A 1DGJA 3URYA 4YSXB 4ARCA 2IW3A 3S1QB 1UEAB 2AQ1B 3VRAB 2DLBA 4DNRB 1WXQA 4DU9A 1PTOH 1QWYA 2WDVB 4KN7C 4OZCA 1XEEA 5H8YE 3KWLA 1E10A 4CJ2C 2B76B 3DXJC 1DXMA 4A3IB 3PO3B 1MHHE 1WD0A 2NN6I 1NEKB 4EE2A 2HDMA 3FEWX 3S15B 1I4QA 3K5MA 1A3UA 3M3YB 2VZKB 2E75C 5IGFA 1OXVA 2WXLA 2QKIC 2LHEA 1TWFB 3U9OA 2FMCA 2HUGA 1FXIA 1R4QB 1JALA 2FHTA 3RZOB 1BMLC 4IURA 1EZ8A 4QIWB 1ZUD2 5EE9A 2BB5A 2KN4A 5C3EB 2IJ0A 1E6EB 3D4WA 2B63B 4C7YA 3D31A 2JA6B 4ZAIA 3CKIB 2GB1A 4A8XC 4US9A 2PKOA 3K59A 4XT3B 5AUIA 1BUVT 5DEHA 3IKJA 5FLXL 3PO2B 4RH6A 2R92B 4C3IG 2JWUA 1BNZA 3AU7A 4QCLA 3KBGA 2JE6I 4QUCA 3M7NA 1XYIA 3NVYA 4HKQA 1FCLA 1SSNA 5ISRA 2VUMB 1F9QA 3R8BA 2E2IB 3AN1A 5CV9A 3OIQA 1TYGB 3FVQA 2L4NA 4TQUS 3AM9A 2FMMA 3M4OB 1SJED 1TKEA 1AWDA 2RVLA 1B4OA 1KNEA 3N9YC 1JWAD 3KWVA 4EQPA 4WFN3 1WVLA 3S17B 1TY0A 2DYMA 5CBEE 3TN2A 4Q2JA 2J53A 3UI3A 3CRKC 3L7ZC 4C2MB 3VR4A 4B9XA 2QDBA 1BQQT 2NB0A 1X3PA 3HOVB 2KEDA 4O1NA 1H9MA 2ON8A 1N63A 2F0EA 1B2TA 3PUWA 5IGGA 4IUQA 3ND9A 5C0XG 3M4YA 1H9JA 3JAME 2DWQA 5JVG3 3Q23A 2DYOA 2B2YC 3KK7A 4X3TA 5JPMC 1SYFA 1JR0D 1U4PA 1V1OA 3Q8AA 4YXDB 2J42A 2M2LA 1F77A 2NUCA 4GLSC 3ZYYX 3BS1A 4IQZA 4BWGB 2B2VA 3I90A 2CQAA 2KMMA 3DHQA 4ULLA 1EY5A 3NP8A 2PW9A 4WWMA 1ZE3D 3RLFA 2H1EA 3PUYA 1TY2A 3BZDB 4C7ZA 1NVID 3A8JE 4AYBB 3TBIB 1SXTA 5KIXA 1WD1A 1GUGA 2KDMA 1N60A 4DF7A 3TEWA 3GD7A 3D8GA 3NZ3A 2A74C 1EU3A 2MJ8A 2K3UA 1LTBD 1DCZA 3E56A 3U7ZA 4TRDA 2QCPX 3A8IE 4XDCA 3T13A 2I07B 2W3SA 1J7BA 2WNMA 3K7AB 1PZJD 3SXHA 2DNEA 2JEAI 2E2DC 3QIAA 5LHY1 3P4SB 1YNJC 1VF7A 4MH8A 3N6RA 2KAJA 3V3XA 1S4ZA 4RHRA 4S3SA 2WXPA 1FIQA 2K22A 1K50A 3K5NA 1S5ED 2AWOA 1V1PA 2PMVA 3PMFA 3GP7A 1KDBA 3ERQA 3PUZA 4RKBA 1Y69U 4HN7A 3HUIA 1HXYD 2NN6H 2VNUD 2Y5PA 2F0KA 3EJIA 1QT9A 1HPCA 1AFPA 1QF6A 1WYGA 1FD6A 1I4PA 4NMZA 2BBCA 2W3RA 4OL7A 1PFNA 2RSNA 5KYIA 2WQYB 4L2YA 5EPLA 3W5VB 1SEBD 4K2LA 3T53B 4C3JG 2Q8IB 2JXTA 1OFFA 2HTME 3CHBD 4J8QA 3DUZA 3OMGA 4GDLB 2ENBA 5E3FA 2PTLA 3D6WA 3I73A 3C8YA 2LFIA 1TIID 2DBYA 2LUMA 2SNSA 4CBVA 3DEOA 1JB3A 3PO0A 2F0MA 3DWGC 3V96A 1J8IA 4P2CB 2E2HB 4YSZB 1RD9D 3I91A 2NTTA 4RCOA 1J7AA 4DAVA 1SYBA 3DWMA 3SK8A 1BXTA 2L52A 1NR2A 4HROA 4EVOA 3NWSA 5LL6X 3U52E 2SNMA 4C3HG 3IFDA 2GRIA 3R2TA 1ZXIA 1BCPD 5M3FB 3MXNA 1A2UA 2QSDA 3A7LA 2BT6A 3CQZB 1ML0D 2YYZA 4JE3B 4RAUC 2DY7A 3RMHA 1PMRA 1Q1BA 1IW7D 2FJ2A 5MPOA 4XDXA 4OO1H 4KD3A 1XWEA 1RYJA 1ENFA 2PPBC 2A6HC 1GUWA 3IT4B 1P7FA 4ZRQA 2EY1A 1LTGD 5I2XA 3S2HB 1EY4A 3FDTA 3S1MB 2JU6X 1GAQB 3AE1B 1EYDA 2L1AA 1MVKA 5EKIA 5T1IA 3JAML 3GTLB 1DZ1A 1CFMA 5I9OA 4G7ZC 1IGDA 5DM73 1FGBD 2WAQB 2R61A 5IGDA 1PFDA 1DYQA 1SAPA 2A68D 1MGSA 3I8ZA 4GZYC 5NUCA 3LB8C 5IGBA 4A3FB 2VXWA 2BA0A 1LT4D 5DM63 3LYYA 1IBXA 5BYRA 4ZRPA 2K0PA 5BMIA 2MJDA 4IKGA 3VYTA 1ICWA 5T1GA 1JORA 3A8KE 2G9DA 2RBMA 3T4AC 2EPBA 3QJYA 1L4ZB 1F2LA 1E9MA 2EE1A 1LO5D 4BBSB 5D3DA 4KJNA 2K6AA 4ID6A 1Y1WB 1FO4A 2Z8LA 4RGTA 2F0NA 4FXDA 1U4RA 1WTRA 2N7JA 2V0GA 1C4PA 1GOZA 1ZPSA 1STNA 5JVH3 1ZDXA 1MBYA 3I4MB 3AEGB 1SYEA 1N61A 5FR3A 1EQVA 3KQ4A 3FPUB 1K53A 2IT1A 3AE6B 1JWUD 5KRUA 1IUEA 2N0SB 1D4BA 3D4DA 1KRHA 2NVTB 3GTKB 4R8IA 3NUHB 3QO2A 3NTKA 3SFEB 1SF0A 1EIGA 4HR7B 4TQ1A 5KYLA 1XCTL 1R9TB 3W3AA 3U9SA 5M5XB 1E0BA 2ZXPA 1C4AA 3CRLC 2W55A 3AE7B 1XCQL 2IX0A 4KJOA 2C5CA 4DXGA 1EFID 5K36G 1CHPD 2K7VA 4ZK9B 4KGRA 1ENAA 2IGGA 4KHVA 1QOFA 3NSWA 3I70A 1CK1A 4KKSA 2JP1A 4NW2A 1LTAD 1BCPF 2ZXRA 1A15A 4FNFA 3AEFB 1QE6A 2KUMA 2K03A 2N55A 3FAHA 2A73B 3TMEA 2WLBA 4ZHOA 4G7HC 2K01A 1G291 1IBXB 1QG7A 3Q0AA 4OO1G 2Z1CA 5D65A 1GPXA 1KABA 2ZT9C 1KFYB 3R3OA 1JOOA 3HZXA 1GUTA 2K1BA 3NK9A 4ZQ3A 1ENCA 1S5BD 3MWYW 2NYZD 3SK5A 4B08A 2N88A 3S14B 5H92C 2WKCA 1I4RA 2LS01 4Q0FA 2F03A 1SBBB 3AE8B 2H89B 1C79A 3AE2B 4K5XA 1VF5C 4CHTB 1G8ZD 1GUSA 4MHEA 1DOXA 1JICA 2F0GA 4ZUIA 1Y56A 3H09A 3NS1A 1LTRD 1VLBA 4N6EB 3UI2A 2HDLA 2N9KA 2XN9C 4ZHPA 4ZKBB 3K57A 3AMUA 2HCCA 5HG2A 2MP1A 4BBRB 1NSNS 5IOCA 1SNPA 5C3WA 1I3QB 1JWSD 1S5FD 1PUTA 4USAA 4ME5A 1GB4A 2WXJA 5EJWA 1JWMD 2XIWA 3O13A 3K5OA 5ELCA 1BUIC 1V97A 2WV6D 1D2BA 2OF1A 3V05A 3N52A 1Q12A 4G57A 2CW0D 1EY0A 1N5XA 1RF2D 1ZXTA 2L9HA 1IHZA 2KQ4X 2QIEB 5A2QL 4WJWA 4C3HB 4XQJA 1JOQA 3P1MA 5IODA 2PMZB 2EJMA 1DONA 4F88A 1IL8A 2INPE 3QOLA 3D6CA 4RGN