3BVGA

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
237
structure length
228
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type C-3
publication title Assessing energetic contributions to binding from a disordered region in a protein-protein interaction
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 65
structure length 228
sequence length 237
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bvgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bvgA01
1JR0D 1LTTD 4UDUC 1ET9A 1LO5D 1SE2A 1PTOF 1S5CD 1S5BD 1JQYD 1CHQD 1EEID 3GP7A 1FNUA 3OWEB 1ET6A 2R61A 1UUPA 1CK1A 1HA5A 1QILA 2TSSA 4TSSA 1LT3D 1FNWA 1EEFD 4RGOS 1PZKD 1YN5A 1MD2D 1JCKB 3DWQA 1SBBB 2G9HD 3R2IA 5ELEA 1V1PA 1LTID 4RH6A 1PRTD 1EU3A 1EFID 1EWCA 2IJ0A 1F77A 3BYTB 4RHRA 3BYYB 1RDPD 1CQVA 1PZID 1LTAD 1KLGD 1JWUD 1PRTC 1SJED 4RHSA 4NZLB 1HTLD 1PTOB 1BCPC 1ENFA 5ELDA 1SJHD 1D5ZC 1L0YB 2XN9C 1TS2A 5ELBA 1AN8A 4L63B 3W2DA 1YN3A 1KLUD 1AW7A 1RCVD 3EFXD 1HQRD 2QILA 1XXGA 2NTSA 1D5MC 1TS4A 3R8BA 3SEBA 2O2LD 2XRQD 5FKAC 2NTTA 1LLRD 1GOZA 4RFBA 1I4HA 1BCPD 1TY0A 2J4XA 1SXTA 4K6LA 1I4GA 2AQ2B 2ICIA 2IPKD 2Z8LA 3V05A 1XTCD 1RD9D 3BVMA 3EA6A 3DWPA 1M4VA 1PTOD 5D3DA 4RGMA 1JWSD 3BZDB 1V1OA 1FD7D 1KTKA 2RDGA 5TSSA 2XNAC 1PTOH 1PTOC 5ELFA 1EU4A 1G8ZD 1LTGD 1RF2D 3KLSX 1LTBD 1UNSA 1LTRD 5D3IB 1I4QA 4BWGB 1S5DD 1PRTF 4OHJA 3BVGA 1BCPF 1LT4D 2CHBD 3DWAA 1SE3A 3CHBD 1DYQA 1B1ZA 1LT5D 1D6EC 1ESFA 1TY2A 2SEBD 1I4RA 3MC0B 1L0XB 1TS5A 1HXYD 3TSSA 2XRSD 1S5ED 2WV6D 1PYWD 1DJRD 2RDHA 4O1NA 1CT1D 1PZJD 4C56C 3MFGA 4ZYSA 1BXTA 3O13A 4Z9CB 4DXGA 1FGBD 1D5XC 1S5FD 1I4PA 1V1PB 1B44D 4RGNA 1I4XA 1PRTB 5FK9C 5ELCA 1STEA 1LTSD 3BVZA 1SEBD 1BCPB 1CHPD 4DXFA 5I4DA 1SE4A 2AQ3B 1JWMD 3R2TA 4L6TB 2QEJC 1T5XD 1LT6D 1YN4A 4RGTA 1FNVA 2AQ1B 4RCOA 3URYA 1TS3A
chains in the Genus database with same CATH superfamily
3DPDA 3K0XA 2INPE 2D0PA 2MEKA 4I7AA 4A3EB 3ZXRA 1EY7A 3G7LA 3I4NG 4IWOA 1KAAA 3C46A 4G4KA 2ENBA 1U4PA 5C6AA 5DPSA 3ZUNA 2KJRA 5H8YE 1VDZA 5L95C 3L9AX 3Q24A 2E3TA 5JJLA 2GBNA 4RKBA 1FO4A 5I2YA 1HE8A 3TEZA 3MXGA 1TIFA 3C1EA 2VS1A 1EOVA 1LTID 1JRUA 1PRTD 4XQNA 1EU3A 3RT3B 1EYGA 4N9PA 4GGQA 1PFNA 4GXBA 4K2KA 3P20A 5EPKA 3LXFA 4K7WA 3U7DA 4BBSH 2AEHA 1JB3A 4B9WA 3M4YA 4NW2A 1PH3A 2JA9A 2PPBC 1CSPA 1KLVA 3RUZA 4OGQC 3ZW3A 3PO3G 3W5VB 3I2ZA 4QCLA 3V6CB 3ZJVA 1N62A 5M5YB 2A68C 4MN3A 3K5LA 2OJWA 1WFYA 1KRHA 2ZCCA 3K59A 1A2UA 1RYJA 4X64Q 3S15H 4JI6Q 1Y8RC 1KJTA 4LDTD 1BT0A 3SFDB 4IG7B 4ZAIA 3S17H 4HPLB 4FP5D 4KVGB 2JEAI 5IYDH 2B2TA 2ZJRA 2JZZA 3V05A 2AQ2B 4MHEA 1VMCA 1WM2A 2PE9A 4YTPB 3CC2A 1QWYA 2F52A 1BNZA 2BA1A 2HDMA 3NVWA 1Y14B 2WP8J 2WXGA 1RIPA 4JBJA 2B2WC 2L4NA 3SGIA 2EELA 4A3FB 2ZW0A 1PTOH 4POFA 2O6VD 3U4ZA 3RN2A 5FLMG 1IBKL 4RAUC 2B63B 2FCSA 2EMSA 3LYYA 5D3IB 1T0YA 1C79A 4WJPA 3DVNU 4GMVA 4XE0A 1TWFH 1MSHA 3BVGA 1KC8C 1AZQA 1XQQA 2A6HD 3HOWB 2WXLA 4ZHOA 1F2ZA 4JBKA 1KM7A 3N1YC 4BA1I 4X6AH 3HRDD 3N3KB 3S16B 2KHSA 4C1NI 1YQBA 4R9WA 5AUKA 5C4JH 4DR6L 3AEVA 1HXYD 4HCEA 2LVPA 4J3OD 4FVMA 1AEXA 3WIMA 4NXML 4PNYA 3H1UA 2OTJA 4C56C 1UBQA 4A3MB 3GTOB 4LFAQ 2KNBA 2A73B 5BYSA 2ZVOA 2K6AA 1FGBD 1R9TB 2DJGC 2J42A 2HQEA 1R4PB 2Q5WD 4DXFA 4K8IA 3L7ZC 1U5KA 1RL2A 3P7JA 4HPPA 2AQ3B 3N6RA 3CCRA 3HOZG 1A63A 4ANVA 1EY8A 1WMHA 1PQSA 1HNWL 4OZAA 2EYMA 4JGHB 1SRUA 3RMHA 4YXDB 4RWSC 3VRAB 4CO7A 3NE5B 2CHWA 1Z6HA 2CKHB 3H0GB 2ZVNA 3BDCA 5E3FA 4A3LH 2IHFA 1Q10A 5BO4B 4ZUJA 1PH7A 5DPRA 5K5PA 3T8MA 1IBXA 2O6VB 4BY7G 3MXUA 3DOWA 2K52A 2A19A 1TGZB 3AB9A 2NPTA 3V6EB 1HNZQ 3VFKA 2CCZA 4NQLB 3PIP3 3S14H 3I90A 3Q6SA 4OELB 4FJYA 1E8YA 1YEZA 4PMWA 1K52A 1JC7A 1SDFA 4F8MA 5JOBA 4YSXB 3S1QB 2WB1G 3UINB 2KMAA 2NS5A 1L2NA 3BYTB 1Y1VH 4QQBX 4DU9A 2AUKA 4F7XA 1HJPA 4FXDA 1N36Q 5EJWA 2LD9A 4NY0A 4ARIA 3AE3B 3GTMH 4FF4A 3ML8A 2SNSA 2L05A 2LZ6A 1W2BA 1RODA 1H9SA 5ELOA 2N49A 4JV5L 1BDOA 3K8AA 4L63B 1FVIA 4PV1C 3SFEB 2XEWA 4UAIA 1KLUD 1A5RA 1YNND 4IDIA 1PH8A 2BA0A 3A9KA 2E5LQ 2BGFA 2KWUB 5M5YH 4BBSG 1VDVA 2MBOA 3NK9A 2X6GA 5KGUA 4EQNA 2GBJA 4GNXA 1BCPD 3ZJTA 4TRDA 2JXMB 4DV7Q 2B8GA 4K6LA 2LXJA 1WVLA 2RPQA 3N1ZC 4TQ0A 1PUTA 2WDQB 2YV5A 2L32A 5EGTA 1C3TA 4RMFA 5CV4A 3GV6A 3DHHC 5G3LD 4DR2L 4B3TL 1WFQA 3RLNA 4EZKA 3L2PA 4UP9A 4DUYQ 4R3DA 3SDZA 5C23A 3GB1A 2R6GA 3D6CA 1FD7D 3OWFA 3ZO5B 2DLBA 4MGIE 5IIFA 1EYDA 1GUTA 2PQAB 1AZPA 3KLSX 2F0SA 2CU3A 1K8RB 1NEKB 2MPMA 1L4DB 5IYDG 4KDIC 3TDQA 3P4SB 2L12A 1JB7A 1JRPA 4ZKBB 2LRWA 3CSTA 1YNJD 2V4IB 2CKZB 4RF1A 4IM3A 3ER0A 1V49A 2M56B 1J7AA 4LF9Q 1OQQA 2ASQA 2WKCA 4MGZE 3U4EG 3T1HL 3EECA 3U52E 1PYSB 3TEXA 1C78A 1GJZA 3WA0A 1PH9A 1QE6A 3NZUA 5C0XI 1XO3A 3MC0B 1L0XB 2UXCQ 3ZLZA 3N9YC 5IGEA 1N60A 1I3QH 3NUHB 4GN4B 2BDNA 4LFBL 2BB5A 5LL6S 2JA7H 2XBBC 2CU1A 2R7FA 5IY0A 1J19A 4YCWA 2EXZA 1Q3LA 1VQAA 2L1AA 1V1PB 1S5FD 1UAPA 1I4PA 1TIID 2R3ZA 5HY6A 2VH1A 4A55A 4K6DA 3GTGB 3D4WA 1A70A 1G91A 3RD2A 1BCPB 1CHPD 4JC0A 2D3CA 4QL5A 4F87A 1VQKA 1YQ4B 4HEDA 4L6TB 2K3UA 1YIJA 3B1LX 1C9OA 3ERSX 4KZCA 1B70B 2YEPF 3QIJA 3AECB 3NHEB 2G3QB 4HVBA 3MJ5A 2ZT9C 2WXPA 1N61A 3QB3A 2PNHA 1IXRA 1XCQL 5BN4A 1S5CD 2KDBA 2GB1A 4N59A 1JQYD 1K51A 4IUMB 4WJWA 2N88A 1VQOA 4LFAL 1KFYB 2C9WB 1VQDA 2CW0D 4BFRA 1FM0D 4HDQA 1AWDA 1RAXA 1VQNA 2NWGA 3K81C 1TKEA 3W5OA 1WF9A 1ZGUB 4J15A 4KIKA 2WDTB 1XEEA 4IJLA 4CJ0B 3PVLA 1WH3A 3CCMA 2OF1A 1E6EB 1CSQA 1CQFA 2QCZA 2L0CA 3R2IA 3MJWA 3A9JA 1Y8NB 1KL9A 2Q2TA 3K0YA 1WTVA 1OXUA 2I46A 1TU2B 2JA8G 3ALBA 3S1QH 1QOFA 4FO2A 3H9DA 1EIGA 4BBRB 2DYOA 3EGRA 5ELDA 2BS2B 1MGSA 5AZGA 2F0EA 2O5JC 2LGXA 1JE5A 2EY1A 1WJ4A 4LNIA 3LX0A 3P2BA 1NR4A 4W9JA 5KIXA 4JYAL 4US8A 4ZUIA 4GU2A 1DONA 1Y1VG 1XNRL 3CSFA 2RD0A 2C7NB 3V62A 1SB3C 3KFUA 3DM1A 1I5FA 2MSED 1QKZA 1GOZA 2J4XA 4YWLA 1EL0A 3CMEA 4EKUA 4GN5A 2K33A 1CMXB 1FFVA 1HTQA 2Q8IB 2M9VA 1NTGA 4ZQ3A 5T1GA 4K8JA 2MHVA 3VYUA 2EYLA 3HZXA 4OWTB 4PMBA 4XDXA 1I42A 4D2KA 4RGMA 3DWMA 5KNDA 2N7DA 3SE0A 1SMYD 2V0GA 3ETRA 2C5LC 1WGDA 1RJTA 2RPVA 2K01A 2N3SA 4P1BC 1ENCA 2J0MA 4EVOA 1HZAA 1C7YA 4EFOA 1A3VA 1G8ZD 1RF2D 4LAAA 1HZ5A 2K25A 2N0SB 1H8CA 2KCTA 3MVVA 2M1MA 4DV7L 1BCPF 3CIRB 1ASYA 4S0RA 3NJTA 1SROA 5C0XH 1VQJA 3RZOH 4ACFA 4HKQA 1ZDXA 5IP9H 1P3QU 3AI5A 3VH3B 3KUCB 4H02A 4K2LA 3ECIA 1X3GA 3CHBD 4MIUA 5E1FA 5G3LF 5JPNC 2BVCA 1IL8A 1EF5A 1ZYRD 2INDC 2MBQA 3HG9A 4BY1H 3AU5A 3HK0A 1DOKA 2WXKA 1B3QA 1WR1A 3NELA 2UYZB 4AYBG 1OXXK 3P75A 2JA6B 3BK2A 3MFGA 1STGA 3OTOQ 3GTKB 3AE2B 4IC7B 2FAZA 2RBMA 4TMAB 2UXDQ 3P42A 5CX3A 1FR3A 4GLVB 5HHDG 1SE9A 4MSQB 4JI8L 4WFN3 3J7AF 2KHIA 2VQFL 4IPGA 2VH2A 1FNVA 1XYIA 3Q3FA 3ZTCA 4A93B 1E8ZA 2BYTA 2NZ1D 3RLFA 2RR9A 2CWAA 3PO2B 1L6UA 4JLCA 3RNCC 3UI3A 1GAQB 4PZ8A 2JA7G 2KQ7A 4B95A 1WYDA 2I2YA 2PIAA 1CK1A 1WGGA 1QILA 4IPCA 4U68A 4XTCS 5JJKA 3RUIB 4JW0A 1GB1A 2FFKB 3HFZB 4NXNQ 5FLXL 4DUZL 3BK1A 4XX5A 2KANA 1WE6A 3E9HA 3F1ZA 3APDA 1PZKD 3P63A 2FMCA 3W9CB 3VUXA 4JE3B 5M9OA 1H95A 1XMOQ 2AYOB 3L0WB 2KAJA 3Q6BA 1GPXA 4ZLTF 5L37A 1SYDA 4AJYB 2L3ZA 5DNFA 3VR5A 3E3XA 4EX5A 1RM6C 1XMQL 2B2VA 1WGHA 5G5GA 1SN8A 1BBXC 4K7SA 3VVWB 1BCPC 1HH2P 3NOBA 3Q0AA 4G7OC 1D5ZC 5LMNW 1XLOA 1TS2A 3CQZB 3KWLA 4ZRJA 3I3TB 4DK5A 2UU9Q 2A5HA 5ELNA 2KENA 3I4MB 2HJ8A 3I63C 4I6NB 5J2RA 2QIEB 1XXGA 2OTLA 3Q23A 2ZM6Q 4DV3Q 3VYRA 2LXCA 2UWQA 4OVZA 3LGJA 1H9JA 4HR7B 3PTFC 4LNFA 1JQ4A 3SK4A 1IYJB 1U0LA 1PH1A 4LF6L 1CTMA 3CD6A 1FRRA 3ABVB 2F1MA 4ICVA 5D2MB 1IZ6A 4CJ1B 1ASZA 1ZXTA 4MJSA 4DR7Q 2AUJD 1ICWA 4LWCA 1EZ6A 1Y1WB 3IAYA 5EE9A 1SIFA 1XTCD 3EA6A 3DWPA 2FCMA 2L8JA 3GTLB 2F0TA 4RG1A 3NRZA 4B0MA 1EQRA 3R3OA 1K28A 1PFSA 5IT9c 1EFWA 3EFCA 4JG2A 3M3YB 3FRPB 1CKOA 1WX8A 5IAAC 3CC7A 1WGKA 3UIOB 1KF6B 3CCJA 2L52A 3A56A 4PMCA 1ZP0B 2QCPX 2D9UA 5J22A 2ASBA 2NMQA 3NVVA 3OIPA 2K32A 1VRAB 4J6IA 2MFIA 1VD2A 1WMHB 5BN3A 3HVDA 1T6BX 3N32A 1MI2A 3JW0X 3FILA 1SE3A 1K83B 4HTHA 1MI0A 3AULA 4Q0FA 1SGHA 1N34L 3L16A 3FPUB 1D6EC 4GLAC 5IGCA 1IBXB 4OVUA 2N9KA 3CF5A 3DWGC 2ACZB 2GVAA 2JVCA 4N6EB 2GMIC 4MACA 3C19A 3UI2A 5C4HA 1WRDB 2YTVA 2IX1A 1FEHA 2NPTB 1PYWD 2RDHA 4CGYB 5A2QL 5C3EH 4KIKB 1II3A 3DMUA 4Z9CB 3AE7B 2B2YC 1MIUA 1JICA 1IYUA 2LEKA 5C0XG 4MTKA 3CF6E 2K7VA 4C4VA 3NQIA 2PMZE 5LMUL 3NBIA 3D4RA 3K5NA 5LMNL 2DAJA 4FJZA 4WJQA 1OO9B 4WAAA 5KNCA 2NVYB 4OO1I 1YN4A 5C0XJ 2K14A 3J81i 4BY1G 5E7NA 3J81L 3HOUB 1F2LA 2L7RA 1K73C 1M8AA 1H9SB 2AMCB 1V8CA 3B2GA 1ET9A 1SE2A 4JI3Q 2GBMA 1J6QA 2JA5B 4II3B 1KNEA 4MEMA 2KLGA 1P98A 1VQMA 4A93H 5BMHA 4GB9A 3APCA 1EZ8A 1X54A 3KQ4A 4JQWC 4B08A 2NVQB 5EE0A 5IP4D 4KY5A 2HD3A 1V6EA 2F3IA 3I4NH 3G6EA 3G48A 1Z2MA 2IBIB 2K6DB 3IAM1 1XX8A 3K9PB 1WTWA 4GKJQ 2D2QA 4I65A 4RH6A 3RCZA 4GNXB 1Z5SB 1CJEA 3CU7A 2LRUA 3E0EA 3NG0A 1LTAD 2KN5A 1SJED 3QIAA 1WI5A 4KKTA 4HIMA 3F2CA 3TEYA 3FVQA 3ZJUA 1Q8KA 4UPAA 3IFTA 4EUTA 2K03A 4LF5L 1LXDA 3AMZA 1WWTA 1Q46A 2WAQB 4LF7L 4ID6A 3M85A 1EUVB 2K75A 4KD3A 2L55A 3H15A 2JX5A 2JZPA 1SNDA 4EZLA 3AFPA 3X3MA 4A3JB 3HOXB 3TMPB 3CQZH 5DPWA 1QB5D 2B8FA 4CDCC 3S1MB 5KHQA 1LACA 5IYCG 2Q8RE 5CORA 5M5WB 3KUZA 4JVZA 2ZXPA 4C3HB 4KZ0A 3PV1A 3GTJB 2I5MX 2EOTA 2BE5C 3SK6A 2Y0SB 4R4IA 2KA7A 3DQVA 1KHIA 1O7YA 3SHQA 4DHJB 3FPPA 4OX9Q 1D7QA 3KJPA 1EQTA 2DY7A 4L8JA 4JI2L 2JYOA 4DV1L 1DM0B 2DAFA 3CMMB 3GQBA 5D14A 3ONAB 2KUMA 1HZCA 3GTPH 4PS7A 2B2TC 3HKSA 5IT9E 4HAEA 1PTOD 5IWAQ 2QA4A 2NVUI 2N78A 2BF8B 2OEDA 5CHVC 2E8GA 3BZDB 2PW9A 1STNA 3QHTA 1WTRA 1XLNA 1ZYRC 2E2IB 1DOIA 3I5JC 1FGUA 4HMIA 2BYEA 1SIJA 1ROEA 4HCSA 4DGZA 3GTLH 2DBYA 4A4IA 1Z9FA 3M3YH 2EE1A 1LTRD 3PSIA 1YVCA 2WINB 4LJZC 3UE0A 1MJDA 1NE3A 1JMCA 1P9DU 5JXVA 1OQYA 3IL8A 2BDOA 3K5OA 1VQ8A 3GZNB 2K1BA 3DWAA 1F52A 2KFKB 2KJ6A 3D0FA 2E2JB 1UH6A 3AXCA 4DXAB 3T3OA 3MHSD 4KJNA 1E7ZA 1NR2A 1B1ZA 3S2HH 2GVBA 3TP6A 3OLMD 1GUAB 5GADC 1QNUA 4IM0A 1JW9D 1V9PA 1XCTL 2QKIC 2K5DA 5KEEA 3E0JA 3N1XC 5J18A 4XXEA 4GKKL 4O1NA 3GZNI 3KLSA 3PIPA 2K28A 2ALYB 2UUAL 2D5GA 2GBKA 4KHZA 1KNAA 3M4QA 2L1BA 4DR4Q 1GHKA 2KHJA 3A9JB 3L13A 4P72A 1Q8IA 4HJAA 3BVZA 1BMLC 1ZE3D 1V2YA 1ZDVA 3RZDB 2KFJA 1VQ4A 1XNQL 4AQ7A 4P2CB 3OJ3A 4QIWE 1MKHA 1SE8A 4FXKC 3W1GA 2BH2A 3AM9A 2F0KA 1KOTA 2QW7A 4R1JA 1Y56A 2I0QA 2INNE 4H2AA 1PYBA 2R2QA 1JALA 1HZ9A 2EVBA 3A7LA 1NYQA 3RMKC 4QUCA 2NR2A 1H9MA 1WJNA 1N5WA 5BMIA 4DV5Q 3FMCA 3X3NA 5ISRA 3P4RB 3V2TA 4HJGE 2ES2A 1T9HA 4DV2Q 4A3CH 3RN5A 2JA6G 4NMZA 1PFDA 2KVZA 2JA5H 4KI0A 1EEFD 1KH0A 4GIVA 3U2SC 1VLBA 3NS8A 2K39A 3Q8BA 4AS1A 3DBHB 4QAYA 4EOYA 3R3MA 1D1IA 2G9HD 4FADA 2IHEA 3M9BA 2NVQH 1ZPSA 5H92C 5IP7H 5GROA 1J5EL 4HMJA 1JE4A 1QOGA 5M3MH 1VJKA 3Q22A 2HUGA 2NVTB 4YHHL 2QDFA 4F7ZA 2HHHL 1IBLL 2GOWA 2LS01 4RHSA 4R8NA 2LHEA 4QJFA 4A93G 1X56A 2X69A 3KF6A 2JRIB 2MRPA 2Y3AA 1YHQA 4ZDVA 3DBHI 4G57A 4IUQA 2XN9C 3GE3C 4DA2A 4CKCA 1HEZE 1X65A 4A3BB 4B3MQ 2IO0B 2RHSB 1L6VA 3S1RB 2IX0A 2BBCA 5LXHA 1HQMC 4DNIA 2C5CA 3DDCB 1D5MC 3ERQA 1QT9A 5J39A 1TS4A 3MAQA 3R8BA 3PO0A 2H5XA 4JI0Q 2DJFC 3HOXH 5FKAC 1PFBA 3A54A 2CHXA 2FBWB 2MA9B 2Z6KA 4XWWA 3S1MH 4RFBA 1TY0A 5M5WH 2JXXA 4C3HH 4HJ7A 3DBLB 1I4GA 3R7QA 4KGRA 1G6JA 3V3XA 2LGSA 4GNXC 5EBCA 1U4RA 1C77A 3HP3A 4H13C 5IGDA 1V1QA 3Q2AC 2KWDA 3OG5A 3N30A 3I4MG 1K8GA 1G6ZA 2MHJA 3DBLI 3G6JB 5IODA 4K0KQ 4HXDA 4WRDA 5J17A 1PA6A 1EIYB 1E0ZA 3KOJA 2R7ZB 3U9OA 4EQ5A 1QZGA 4CBVA 1NI3A 1R7SA 2HTME 4ICUA 3HOYB 2BYFA 1NENB 2MJDA 4JL9A 2I1JA 2F0QA 2GBRA 1EUJA 4M8AA 2VZKB 1B8AA 4OONA 2AWNA 2Z9HA 3MWYW 2KCMA 1SYEA 2R93B 1F2RC 4A3KB 1EIHA 2L0TA 4WH4A 2LXKA 1JOQA 3EQLC 4HRSA 2EYFA 1VF5C 1UELA 2N9PC 4P7IA 4A75A 3TIXA 1WJUA 2C60A 5LL6X 4YSYB 4C7ZA 1UEAB 1YHAA 4M8NA 5EDSA 1I4XA 1PRTB 3QG1A 1B50A 1STEA 4GSWA 2NZOA 1SR3A 1IL2A 1ILPA 3NTHA 3AU7A 4JI4Q 3Q8FA 3BJUA 1FJGQ 2BTEA 1SLJA 3JAML 3D31A 2JQRB 5CHFA 2QGQA 1R4NB 1TS3A 2PLPA 2M4NA 3M62B 1E2ZA 3WAMA 1QLBB 4OIKA 4NJ6A 3ZKJC 4F8CB 1I94Q 3IAS1 1GXDC 3W1BA 2VQEQ 4OO1G 1VQGA 1J8IA 3PGZA 1FNWA 1HPCA 1H9KA 4BZAA 2F4IA 2M00A 2UUBQ 1R4NI 4DNTB 4LDTB 4AIMA 3DBSA 2WDVB 1HNXL 1EWCA 4HLEA 5I6YA 4LF4L 3BZCA 4RHRA 3UDIA 1N33Q 4MJSB 3NWSA 2Z4IA 3M63B 4NDXA 1HR0Q 3HOUG 1TQOA 3HKZG 2QF7A 4CHTB 1UE5A 4RMAA 4A3CG 3CPWA 1MG4A 3VAWA 2JA8H 3S24A 2JA5G 2Q8TA 2JWUA 5IGBA 2WQYB 2VZAA 1JJGA 3AE6B 5HFYA 4A3DB 3SXHA 1G6PA 3P1MA 3Q14C 4X66Q 2YU9B 2N9EB 3KK7A 4A3EH 2A4ZA 5IP7G 4AOFA 5M3MG 1SNPA 5BYQA 1BR9A 4A3BH 4JK1C 1VQLA 1XPOA 2M0AA 2MGSA 3FILB 4P1CC 3L10B 1B4OA 1Q5WB 1WCMB 3ONSA 2EYPA 3CRLC 1FIQA 3HGBA 1EOTA 1RKNA 2KLCA 2KX3A 3MTSA 3T4AC 2YEPB 2GN5A 1IUEA 1NSNS 1A2TA 3A1QB 5LLIA 2PZWA 3W1SA 3D3RA 2C7HA 3R93A 3H09A 2ZJPA 1S72A 2VUMB 1YJ1A 4LK1C 3MC9A 3LWEA 2LSSA 4FF2A 4YWGG 1X1MA 2WXIA 4KV2A 1FXIA 2MO1A 2WAQG 2ZJQA 2JEBI 4IUUA 3HOXG 1NAPA 3AE8B 4W9LA 1T0QC 3RN9C 1MSGA 4C4VB 2CQAA 2SAKA 4AYBE 2LUEA 2PEAA 2EKIA 1Q82C 1AE3A 4C3HG 1Y8OB 4X65Q 1PRTF 4ODGA 4B3SQ 4TQ1A 1NBWA 3AE4B 4PQXA 2FHTA 4DKAC 3PIOA 1ZUD2 2DZJA 4YCVA 2R7ZH 2QSDA 4GLXA 1FRDA 4IWPA 4DPGA 1LT5D 5AZFA 5LHY1 4FLHA 3PPAA 3WAOA 5IA7A 2PNRC 5HKHA 1CKNA 2XGTA 4KKSA 2KO3A 4BOSC 4A3IB 1IYVA 5TR5A 1CT1D 2WKDA 2WXHA 4FXGC 2K6QA 2LWPA 3ZVVA 5CV9A 1S3OA 3CMAA 1JT8A 4USAA 4X64L 4JI6L 1VQEA 1SNCA 3NBHB 2IDYA 2JSVX 2N55A 1WXVA 4A3FH 4OWWB 3OHXC 2I5LX 3ICEA 2EPBA 4KY7A 2JXTA 2PI2A 1ZKHA 4MM3A 2B63H 2VW9A 1EO6A 4NAWB 5EAYA 1KDCA 2KQ4X 3MXNA 4RCOA 3DM3A 4K3BA 1I6HB 4IUNA 5EKIA 1LTTD 1OTRB 2WP9B 3BDLA 4A90A 3P4PB 4URKA 1HZBA 4LF8Q 3HOWH 2B39A 2JYTA 1WXAA 4REZA 5IOIA 1TKGA 2L76A 2D2CC 2NBWB 3S16H 2KKCA 4W9DA 4ANWA 5CC4A 2E2HB 2MP1A 5GAEC 4PZ7A 3IVFA 4FYDA 1OXVA 4ANUA 3QQ8B 2L83A 4X3TA 3NVZA 3QA8A 1N9WA 4O2DA 4IO9A 1QZEA 3Q8DA 4J1MA 3T16A 3LB8C 2EYJA 3MTNB 4DV0Q 2IGGA 1FPYA 1GUSA 1PH5A 4A3MH 3GTOH 4N9F4 1WX7A 2VB3X 3UIPB 2F4VQ 3VUWA 5JZEB 4Q2JA 1E3PA 2MJ8A 1P0RA 1R9TH 3S9WA 2K5PA 2EY6A 2DWQA 1KQSA 2B2WA 3GV3A 4A3GB 3M4OB 1PRTC 4WJOA 5AUIA 3ENEA 1DOLA 2L00B 2B2VC 4DR1Q 3I9V1 2Z0SA 3I70A 4QY7A 4PG3A 3DVGX 3T1YQ 4RM8A 3PS6A 1LABA 2ZCBA 2HQLA 3PHWB 4X62Q 1SNQA 4DAVA 4DV6Q 1ZXHA 2HD5B 2O2VB 5F2DA 2LASA 3DLLA 4B6WA 3H0GH 4DK1A 4WWNA 3TEHB 3UQBA 4ZRIA 3A0JA 1NDDA 3EROA 3OMGA 3T3NA 1K0SA 2HTHA 1O80A 2RDFA 2D3GA 3EC8A 3KH0A 2AL3A 4X3KA 1TWCB 2NTTA 4H44C 1QOBA 3KLRA 4J6HA 3A4SC 1TWAB 2IPKD 1J7BA 4X3SA 5HG2A 3SDLC 1JJCB 1E2WA 2INCC 1JOOA 1QVGA 1CZPA 1L5PA 4UP8A 2KK8A 2F0LA 3VYSA 2BB6A 4JPSA 3W5UB 2LHDA 3JSVB 4A3EG 1H9RA 1JWSD 2EZVA 4IUVA 1HNZL 1ZXIA 2N1VA 5HGTA 2IO3B 4A3BG 1TJEA 2HDEA 3FP9A 2VUMH 5EPLA 2EMTA 5DCNA 2XIWA 3HOVB 3IHPC 4AWJA 1K3RA 2RCNA 3TS2A 1YJWA 2K50A 3GTQB 1LYLA 4PZ6A 1KIXA 1MVKA 2DYMA 1O7IA 1K3BC 5H1SE 2R92B 1N36L 4ME5A 2XTIA 1TR5A 2IT1A 1GUGA 4M00A 1EY0A 2OEOA 3TRZA 4EE2A 4ARCA 3NQTA 4HJ9A 3O65B 2WXMA 5CHWA 3QARA 2PVOD 1V8QA 2A6HC 2ZPYA 5D6JB 4CKBA 4DV4Q 1TZ1A 1NMGA 5FLXc 1PH2A 3QO2A 4YL8A 4DR5Q 1T3QA 1WJ6A 2KDMA 3DUZA 2J52A 1CM9A 1YQ3B 4WAFA 2XSCA 2FCNA 3F2DA 2Y5PA 2E5LL 5C5LA 3ULJA 2FUHB 4OZBA 4GDLA 1QQRA 2I5HA 2IYDB 4A3IH 3NTKA 3DVNV 5CV7A 1SEBD 2R7ZG 4K3CA 3KYCD 1VCBA 2NBUA 3SVMA 1LUZA 2NCNA 3HOYG 4C3JB 2IL8A 2A8VA 1C76A 1TT5B 3KF6B 3J9CA 4DFAA 1L4ZB 4LJOB 2KEDA 4B3RQ 3ZIMA 4DUYL 1K50A 4UDUC 2R93G 2F3VA 1PH6A 5I9OA 5AFWA 4M1UB 3RZFA 4A3OA 1CHQD 2DNFA 3ZDMC 1PLFA 2QMTA 2JUOA 1EIFA 5IE8A 2QJLA 5HI1A 1HA5A 1XTDA 3T51B 2F0OA 1MPEA 1W6KA 3G71A 4C1NK 3BZKA 4A3FG 2LY7A 1Q1OA 3MEHA 2D3BA 3NEMA 2Q2HA 3B08A 4NJ7A 2B2UC 2E2HH 2SNMA 2B63G 3OAWA 4HJKA 3K80C 3AEBB 4LF9L 4BBNF 3OW2A 4WWMA 1E8WA 5JHAA 1N32Q 2IJ0A 2KECA 3STBD 3CCEA 1GG3A 3H7PA 3VDZA 3HOWG 1MJCA 4HSVA 3GTGH 1TYGB 2UXCL 2WU2B 4US9A 1CFMA 2KCNA 4KD4A 4Y52H 1PV4A 2JSOA 3WAPA 4V0BA 3NHHA 3VRBB 1NVID 2DENB 3RFZB 1KXLA 1SAPA 4C2MB 1IW7D 5JHBA 4XQJA 1QUQA 3KYDD 2L11A 4K81A 4I6PA 1V97A 4P74A 2K9XA 2FXQA 3PLUA 4DV0L 3U4VA 4A3MG 3C1FA 3GOEA 4IW0A 4RCNA 5M3FB 2KMCA 5JVG3 4K5XA 4KHPQ 1UD7A 4N9TA 3HVZA 2HDLA 4HN7A 1LLRD 2QC8A 1A0IA 1YNNC 5M5XB 4CQNA 4KTAA 1VQPA 1RWSA 1C8CA 5IYCH 4IPHA 4GN3B 2FINB 3I56A 1W6JA 2NB0A 2OWOA 5E6OA 1BOSA 1WTHA 3FEWX 3T1YL 4F88A 1TWGB 3B2FA 1M4VA 1GB4A 5FJ8G 4UY8C 1E7PB 1TWAH 3H0GG 2WACA 1NYRA 3UDXA 2BKRB 2RDGA 3AU4A 3Q3JA 3RNEC 4YIJA 2PMZB 3PQIA 3CCVA 4BBRH 3QJZA 4A6QA 5JEAG 2KOLA 2C9OA 2E75C 1FCCC 1HUMA 4DNRB 2IY0B 1LTBD 2K8CA 3E9SA 3GD7A 2KXJA 4BWGB 1AE2A 4DR3Q 4NJCA 2DGYA 2K05A 3KDFA 3J81c 1NJIC 2IO1B 3TQYA 3T53B 4JI5Q 3PV0A 1SNMA 3E9IA 1BO0A 3PCOB 3H3VI 3PRMB 5D94A 1U4MA 4KKJA 5GAGC 1YJNA 2FUG1 4KJOA 5DM63 3B6YA 2D0OA 1OQRA 2JQOA 5JAVA 4Y7NB 2CJOA 1DGJA 4JPBW 5CYUA 3V61A 4BBNC 3DEPA 1YNJC 1WXMA 1D3ZA 1G2SA 2YYZA 4HIOA 2VUMG 3PO3B 2F0VA 2XRSD 3E5SA 4WJ4A 4FJVB 3U8ZA 2HCCA 2A6ED 4TQUS 4BA2I 3IFDA 2G1EA 3UDFA 3CCSA 2JZ3B 1TKYA 1O7ZA 3A8KE 2M19A 2F0PA 3PREA 2RVLA 3PF4A 2AWTA 4KV6A 1PDXA 1OXSC 1WTQA 3DVGY 5E6JA 3L08A 2EJGC 4GLSC 1YMHE 1JWMD 2A69D 2DZMA 5AJ3Q 2NN6I 2WXFA 4JI7Q 4DR5L 4ANXA 4LUOA 3U50C 3KBXA 5G2NA 2Y5CA 1B2TA 4IPDA 4C3JH 4Q5VA 1NI2A 1E8XA 4KSLC 2J0TD 2DZKA 3CPFA 1IKLA 3DCGA 1E9MA 4P75A 3CRKC 4TUUA 3CAMA 1U4AA 5L83A 5IN7A 4A3IG 5I9PA 5IYBH 1RLFA 4KGTA 1DD2A 4R4TA 1E2VA 1HCZA 4B0EA 3L0OA 2J53A 3RNUA 4YWKA 2CW0C 2PW7A 4IALA 3PHXB 4A20A 3IRBA 3I72A 4I6LB 2JA6H 2MX2A 3QOJA 1C9FA 2P5ZX 3GTKH 3HUIA 1CQVA 2ZZPB 2KOXA 1EQQA 4B9KA 4IUPA 2EJFC 1C48A 5FO7B 4JBMA 2A68D 3BINA 3S2DB 1I50B 3OPOA 1GM5A 1X3FA 1Q1EA 3SK8A 1TTNA 3Q69A 1EY6A 3ND8A 3OTOL 2GLSA 3PZ8A 3R7RA 3RLOA 4KSKC 4E74A 3U30A 5BR8Q 3PO2H 2UXDL 3FKIB 4CYEA 3QX1A 2K0PA 1SYBA 2VB2X 3A9KB 1B3AA 4C2MH 2RF4A 3F2BA 1VQHA 5C4XB 2N9XA 3CXCA 1E1TA 2M0XA 1EM7A 4W9GA 1WRIA 3HOZB 2Z59B 4L23A 1XWEA 5M3FH 3A5UA 3AFQA 4P6VF 3ZRFA 4BVUC 3QOLA 2YLMA 2WGSA 3C8YA 4FXCA 5A2QE 1CKNB 2Z6KC 4K5WA 3VHTC 1IBMQ 4QUFA 2ZNVB 1STYA 1HUNA 2HJ1A 3NS1A 1AYFA 1TWHB 2AX5A 4CDFC 4BY7B 1XT9B 4NXNL 2DNEA 1Q1BA 3P1HA 4WQMA 4XYCA 2MH7A 2R2OA 5HGQA 1EF1A 2W3RA 4XZ4A 2WLBA 4F1SA 5C1ZA 4QIWB 4AJWA 1AARA 3NY5A 5DM73 3AV8A 1SMYC 1YNTE 3J81E 1XMOL 1SFOB 3I7FA 2NVXB 2KQSA 2N9LA 4XDCA 4YT0B 3I4MH 4MM3B 2JPHA 4IKGA 3W3AA 4FBJB 1M90C 2CHBD 3PZ7A 2KC2A 2LI5A 1NUCA 3EVQA 3MXNB 2E76C 1J9OA 5D65A 1YD8U 4EQOA 2RDBC 4AP4C 2B3AA 3CWIA 4G7HC 2UU9L 1X3QA 1G2TA 3WOEA 1I7HA 2IX3A 2KJHB 2YTXA 4BBRG 2BOSA 5CR3A 2WV6D 2KACA 1N63A 1X55A 4Y7NH 1DJRD 1PXUA 1VQ5A 1F2RI 1ZW7A 1Y1WH 1PZJD 3TN2A 3ZGZA 4DV3L 2ZM6L 2A74C 3L17A 5BYRA 3IG3A 3HOVG 3SR6A 1U9RA 4JI5L 3RZWC 2NN6H 4I7ZC 2LMCA 1B44D 4RGNA 3H3VC 5FK9C 1OEYJ 5JPMC 1KRSA 4DK0A 4OL7A 1SE4A 2HIVA 3D4DA 4BXXH 2R92G 4DR7L 1FD6A 3H8HA 4BKTA 3TP7A 4TKOB 2X6LA 4IOAA 2EDGA 3P4QB 2N7JA 3R66C 3H7SA 1FXTB 2HCIA 1AFPA 4N8FA 2MQJA 4S3SA 4XWTA 2KTRA 1LGRA 2JF5A 1FNUA 1V43A 2R61A 3NWTA 1VF7A 1K83H 4IURA 3CC4A 1MHHE 3QC8B 2JJQA 3UDGA 3HKZE 2OQ0A 3UGBB 4L5TA 3ZJYC 3S15B 2MP2A 3ZNGC 4LJPB 1IW7C 2CH4A 2JE6I 3S17B 1RFKA 3HHMA 1WE7A 3VTVA 2F0DA 4OO1H 2IY1B 2N1WA 4DWFA 1VS0A 1IBKQ 2M17A 1D2BA 2JK8A 1XLPA 3X0WA 1SYGA 3ITPA 5EBDA 1XPRA 1F9PA 3NXWA 1RDPD 2RMMA 2EXDA 4C3JG 4M0WA 4II2B 1B9RA 1V80A 4NP5A 2WB1E 1PTOB 1L0WA 3I8ZA 5IYBG 2PI2E 5T8IA 2GA4B 2NVYH 3EJIA 3K6OA 3OSOA 3J80i 3J81j 2PZTA 2WX0A 3J80L 4CDDC 3HOUH 4DR6Q 4PT5A 2LFNA 2H1EA 2ZTDA 3S2DH 1TWFB 1I50H 1PH4A 1AW7A 2KX0A 4R4QA 2BCOA 1VZ7A 4NXMQ 1HQRD 3QAQA 1BUVT 4MGYE 2LKVA 1BBWA 1YX5B 3X23A 1NMFA 3NZ3A 2K22A 4BKSD 2AKWB 1TVXA 3DBRB 3AEDB 2V4DA 4W9FA 3GDEA 1WXSA 3BU2A 1D8LA 3TCAA 3NENA 1Q7YC 5C4XH 3K5MA 1I4HA 5FO8B 3J7YW 1YJJA 3U7ZA 1SXTA 3OJ4B 2IWHA 3TMEA 1WD1A 4JI3L 3PRZA 2F0HA 3RNAC 2YTYA 1HNWQ 2K4KA 1KRTA 3J7AV 3BVMA 2K8HA 4DHZE 1G291 1VQFA 3PO2G 5BR8L 4YTMB 4L5SA 2BT6A 4A3PA 4W9CA 3EFUA 1V1OA 2FIFA 3DBRI 4WIPA 2OQKA 1VQ7A 2ZW1A 3W1SC 4GDLB 1HFNA 4KHVA 2QDBA 5A35A 3LNNA 1E5WA 1MFWA 1CZGA 2F0UA 5ELFA 4GKJL 1ESRA 4IQZA 4LLGM 5M3FG 4UP7A 2WU5B 4FNFA 3JAMc 2PO4A 1V81A 4A3JH 4ZRQA 2H88B 3E56A 1SFOH 1XPUA 4ZYNA 1K0RA 4G0NB 2LJ5A 2LXAA 1XF5L 1DYQA 3GTJH 3ULLA 2A69C 1PVOA 1E1OA 3PUWA 2MBHA 3EHVA 1YX6B 3A74A 1DOXA 1VZ8A 2Z1CA 1L1OA 3S14B 4MH8A 1CA5A 2DHZA 4XIGS 4JIOU 5GMVA 4MDKE 3HM6X 1PGAA 4JV5Q 4KLKA 2EJMA 3O13A 1LM8B 3HS0C 2ZNVC 1BF4A 1Y1VB 4KDLB 3HEJA 1O7LA 3I91A 2NBFA 2E2IH 3SK5A 3B0AA 3H7PB 1EWHA 4OX9L 5DPTA 3VTWA 2KD0A 4N8X1 1S40A 5I4DA 1DOYA 3GTMB 1C4AA 2RGFA 5GAHC 2EY5A 4HK2A 1FYCA 4RKLA 1F9JA 5E6NA 3BDOA 1VR9A 1UEBA 2PVGC 2GRIA 4GDKA 5FO9B 3S2AA 4WORA 1F2MA 5IWAL 2KZRA 3RD4A 1WIAA 1Y1WG 1LV9A 2W54A 1PTOF 1QZHA 2Z6BA 1QUQB 1UE7A 4MTNA 2E2JH 4LTUA 3IBEA 4W9KA 4DR2Q 3SHLA 2NN6G 4B3TQ 2BS3B 1ZKOA 3K7UC 3EIVA 3D8GA 4LNNA 2V1CC 1YBYA 1HA6A 4BXXG 2UXBQ 2I07B 4RM9A 1YI2A 4KK7A 5MPOA 2LGDA 2WXNA 4DF7A 1XLQA 2F0MA 4KN4C 4FN2A 1V9JA 4IOCA 3BYYB 2JU6X 4ZRPA 1STHA 3JAMi 3A33B 2RA4A 1F9QA 2DX5B 4HIKA 1MHWC 4G11A 2ATWA 2BH8A 4K7UA 3K57A 3RZDH 2F0GA 1C0AA 4NZLB 2O5IC 4IFDI 3T1HQ 2EY2A 5J1ZA 3U9SA 3ZTDA 1D4BA 2IW3A 4AYBB 4XT3B 1RHPA 3TEWA 2EYOA 1UWVA 2Q2IA 4KMUC 1UGMA 4G50A 3FKYA 1YN3A 4DR4L 1B7YB 4RNAA 2C35B 4JCVE 4KKUA 3J7ZC 1SMXA 4LFBQ 2MNAA 2PKOA 2IO2B 3APFA 3KDFB 4WWOA 2O2LD 4A8XC 1MG8A 2AWOA 2XRQD 4APVA 2LJIA 1OFFA 1Z7TA 3MHBA 3QWNA 5HURA 3RNGC 4WJNA 4JOIA 3DHGC 2KYWA 3GO5A 2B29A 1QF6A 1I3QB 4M8MA 1K9MC 3C0RB 4XGAB 1RFAA 2JA7B 1MHXA 2EKEC 2OJRA 4DV5L 3TZDA 2NVTH 1QCBD 2J0JA 3MEFA 3VR9B 4DV2L 4NNJB 1FXAA 5CV5A 3Q3NC 3BWUD 2XNAC 1CKMA 4NQKE 3FHWA 2D11A 4HPMB 3FKIG 1PTOC 2FIDA 2V3NA 1LTGD 2JWZA 3JAME 1Q90A 1YHBA 5E4XA 5C4XG 3AB5A 3JVZX 3WOFA 3ZXVA 2WDRB 1P1AA 3KUPA 4OHJA 4HKZE 3S1RH 3D32A 2PW5A 1LT4D 2O4XA 4OXPA 2CJNA 1Y8PB 1IKMA 3I4LA 2N7EA 3HM3A 2REXA 4K5VA 1F1HA 3H94A 4GOPA 4M01A 3QCAA 3PF5A 3VTUA 2HIXA 4B3ML 2BQQA 3JC66 4P73A 2AHOB 1L0VB 3A55A 2WXQA 4K1RB 3AEGB 4R4OA 3IKJA 5FOBB 1ONLA 4ZYSA 1CZWA 1X3EA 3MZ5A 1BXTA 2HE7A 4YCUA 1N6ZA 4YTNB 3I55A 4A3JG 4JI0L 2H89B 4JYAQ 5FR3A 1LTSD 3A8IE 1CI3M 4FA6A 3KVFB 1XNRQ 4FF3A 1LFDA 5JH5C 3Q3MC 4C3IB 2Y0SG 1LT6D 5KNBA 2K1FA 2V4LA 3PT2B 1TBEA 2FNJB 3SU8X 3TUOA 3V96A 4ASWC 2F0NA 2AQ1B 5CMDA 4IN3A 2TMPA 2HT1A 1JWAD 2Y5BB 4NAMA 4JWUC 1A8VA 2KBNA 4MZ9A 3HOYH 3GP7A 2BS4B 3RULA 1HR0W 5LNK1 5DLQE 2KDFB 3ZRCA 2R93H 5J3BA 4K0KL 2PYKA 5EKLA 1LT3D 1I6VC 1JJ2A 3TREA 4A3KH 4RGOS 4UHVA 2MQHA 3NPPA 3VUYA 4H0LC 1TKWB 1VQIA 1VQ9A 3AMUA 1WY8A 2MCNB 5E6PA 1GUWA 4DN4M 4QMGA 1KAWA 5ELEA 2OOBB 2G4SA 3RYTA 2CVRA 4ZRKA 4IFDH 1EFID 1ICFB 3AH7A 5JVH3 2K5VA 4HDOA 2N4FA 3ZNHB 4ZCKA 1BQQT 2FMMA 4E6IA 1WR6E 2B3GA 4PS3A 1GKHA 4POGA 3M3JA 4DBGA 2E74C 2EIFA 4NB3A 3A5ZB 3KYHC 1L0YB 1TZOA 2KJXA 2WFWA 4IOIE 2JP1A 4IUTA 2UXBL 3E6ZX 1F2YA 3NUCA 4C7YA 5CBAE 3W2DA 3AN1A 2CQOA 5AEKB 1RCVD 3OW7A 2QILA 3BS1A 1EYCA 3RZOB 3K9OB 1G51A 3W1YA 1YJIA 3VXWA 4JI4L 4ZRZA 4MGKE 4ZKCB 1FJGL 1YITA 1GNUA 1IGCA 4LNOA 5I2XA 2LGIA 2L5TA 4BY1B 4DAYA 3AEEB 4JI8Q 4HEA1 2OXPA 1ENAA 1WXQA 3VQIA 3D6WA 1VMPA 3VA7A 2VQFQ 1I94L 1Q0WB 2VQEL 2WYQA 1A62A 1E24A 5D3DA 4HJ5A 1OXTA 4FDBA 4IJHA 5GQOA 1WI0A 5KRUA 3PZDA 1KTKA 1ACCA 4A9AA 3KBGA 2UUBL 3ZNZB 2LMCB 1PDQA 2CH4W 1OTCA 5FJ8H 1WX9A 1KDAA 4ILWA 3UE1A 1GUOA 1B53A 4DUZQ 2J0KA 2OT2A 4GN1A 4E71A 1STAA 2VXWA 1EY9A 1NY4A 1N33L 2NZHA 3MA2B 4A3DH 1PGXA 5JJIA 5JEAH 3Q8CA 1VCIA 3CCUA 3TP8A 1UE1A 4R8IA 2YU9H 1A3TA 4LFCQ 2BW2A 5BMGA 4CJ2C 5C3JB 1HR0L 2W3SA 1R4MB 1L2FA 3ZYYX 2PZUA 2KFKA 5AZHA 3AYHB 3L54A 2R7DA 3KF8A 2F0WA 2MO0A 2SEBD 2KTRB 4C00A 1WCMH 1XMQQ 2KQ3A 5KHOA 3TSSA 3IFWB 4M02A 3NTIA 2LVOA 4ZOHC 4X66L 3C2PA 4IM2A 2MP2B 2XK5A 3L4PA 4DAMA 5C3WA 4KY6A 2BYVE 5G5HA 2ZXRA 1FMAD 1R4MI 4DXGA 2B76B 3WWVA 4ULLA 2MJEA 1WYWB 1ISNA 3NSWA 4QB4A 1X32A 3TBLD 2J7ZA 2G45B 2KC1A 5IOCA 1E90A 5C44B 1HTOA 1NNXA 3QR8A 2KCCA 1EWYC 4QF4A 2EYHA 4FHKA 4M0WB 3KUDB 1T5XD 4A3LG 2I1KA 4LF6Q 2KEEA 4RGTA 2PMVA 2KDEB 2WX1A 1VQCA 4C3IH 1RTOA 3N20C 3GE8C 3AE1B 1B9NA 1EEID 1J8CA 1QOHA 2DYBA 2L9HA 1ET6A 3NVYA 3AQQA 4TVAB 3RR5A 1C4PA 2ICEC 3PUXA 2UU7A 2KHWB 3IT6B 2D3AA 1X3PA 1PMRA 4X65L 4B3SL 2JN4A 1YN5A 1MD2D 3ZQ4A 1E10A 3WANA 3WALA 2UUCQ 4CDEC 1P7EA 4PS8A 4YWMA 1KABA 2V1YA 3I57A 1EQVA 1FCLA 3A7AB 1F77A 2Z4HA 1V5OA 4NPNA 4XDDA 2Q2UA 2KT7A 1PZID 3PRPB 1EY4A 3DHQA 1QVFA 1VQ6A 3A4RA 4ALPA 5EKKA 1WJJA 3VR3A 5C2TB 1HTLD 2IZVB 1FL0A 4PK1A 4KGSA 1ENFA 1N34Q 1BKBA 4FF1A 1IGDA 3EUB2 3ZNID 5ELBA 4A3KG 1P7FA 1JWBD 1DXMA 5K36H 2XWBB 1I6HH 5C4ZA 1LQBA 2Z0EB 1E0BA 4RF0A 3EFXD 2BE5D 2G9DA 4H7BA 4ABNA 4EGVA 4IFDG 3S1NB 4JWSC 5IGGA 1UGJA 4OZCA 3CCLA 4YY3Q 4BKSA 2WIIB 4IZ8A 3K58A 1T0SC 3N52A 5C3XA 3H6NA 5IKCM 4IFDJ 4WJ3M 4HCPB 2H4OA 1STBA 5LMUQ 5LMNQ 4CHKA 1B9MA 3T13A 2ICIA 4LF8L 5CGKA 2W9NA 1WYGA 3AEAB 4AUQC 5C3EB 1L1OB 2ZXOA 1RD9D 4OWXB 1YZ6A 1L7YA 1ILQA 1GC6A 3KWVA 2JY6A 3DEOA 5EPJA 4A3GH 3UQAA 3M4OH 1SYCA 2QDLA 3K7AB 1XJVA 3MFYA 4OIJA 4DQOC 1UWXA 4NKLA 1YNXA 1UWMA 3HIZA 4NPSA 3I4OA 1UE6A 2MBEA 2F4VL 1A6XA 2NYZD 3EN2A 2WHIA 1WZ0A 2ONQA 2D5DA 4X3UA 4GDKB 1RTNA 1V5TA 4J8QA 4GOCA 2Z0DB 4O42A 4W9HA 3PIO3 1TY2A 3CP0A 2EQSA 2MUYA 4DR1L 1TWCH 1WZ3A 1TS5A 1DOMA 4X62L 2ZJDA 4V190 3I4NB 1S5ED 2K5HA 4DV6L 5CTRC 3NZSA 1UZXB 1C1YB 4LF5Q 1ML0D 2QHOA 3TL5A 4QGUA 1M1KC 4A3DG 2VNUD 4LF7Q 3AEFB 1K8OA 1E7VA 2D07B 4LFCL 2MJ3A 2L0FA 2VL6A 5ELCA 3MXPA 2C7MB 3HOVH 2XWJB 5JEAJ 1CUKA 1WCMG 2QEJC 2KMMA 3DHIC 3RNFC 3VR6A 4BOZB 2E2DC 1M94A 4W9EA 1AP0A 3GTQH 1YIWA 4KKIA 2BWES 4G3XB 5C44H 1MJEA 2DY8A 1GD7A 4JI2Q 5FLXE 1N5XA 3MHZA 4DV1Q 2R92H 3BIID 2BPSA 2E6XA 2PTLA 4FHJA 2IY5B 2WWZA 5KYIA 4HIDA 4E3CA 3PUVA 1SSNA 1TT2A 4TSSA 2RSUA 1QNKA 3KJOA 3VYTA 2JRHA 4MH0E 1WSPA 1QJOA 1F9SA 5G55A 3CW2C 5IGFA 4LUZA 4EEWA 1SNOA 2RCFA 1NBFC 1WM3A 3MP9A 3GTPB 2M2LA 3ZDTA 3LJ3A 4ME3A 4B9XA 4C3IG 1Q81C 2K8BA 1S3SG 1JOKA 2CFMA 2IGHA 3KW5B 3QJYA 4IWQA 4DV4L 5JJZA 1QOAA 2F0FA 1JWUD 3PMFA 4LUVA 5KYLA 1PHJA 5FR6A 4MSMB 2QEXA 3OOCA 1SJHD 2M8SA 4AQYQ 2W82A 1QG7A 2ZPNA 1GHJA 1WGYA 1AN8A 3VH4B 5IO9A 2SDFA 2RQXA 1IPGA 3C3LA 1Q12A 2O6VA 4LNKA 4C80A 4GKKQ 2KVRA 2WXOA 2UUCL 4LMQD 1UBIA 1T5EA 3I73A 2UUAQ 2F03A 3PGEA 4P71A 5CBEE 2WS3B 2OHFA 3S2HB 5CV6A 3S1NH 3UF8A 3CCQA 4B3RL 3AE9B 4L5RC 4DDGD 2DNCA 1C4CA 4L5QA 4GOPB 1TXYA 4OEMB 1K53A 2K5NA 2SOBA 3QK0A 3H6MA 3TZUA 3TBIB 3IXSA 1DCZA 2G4DB 5K36G 1WGRA 3A1QA 1PFMA 2MW5A 3U58A 3DXJC 2F0JA 2JT4B 2A1AA 2GI9A 1C4QA 5TSSA 4JI1Q 3T56B 1BVSA 2KDIA 2ZEQA 4GZYC 4CKEA 4WQOB 3VA5A 4YY3L 1IYFA 1EU4A 3BG3A 3CKIB 4EQPA 2X38A 3J7A5 2G5DA 2AL6A 3BY4B 5IP9G 3PUZA 1UNSA 1N32L 4XYOA 4JX1C 2ON8A 1S5DD 2K5WA 2V3SA 3K7AH 4HSPA 3TS0A 1DGSA 5T1IA 2X8XX 1WTXA 3T9LA 2A5UA 3RPFC 1WTPA 1T0RC 4KN7C 4XC2A 1E22A 1F9RA 4DAPA 2VRRB 2J7QB 3Q3OC 3M7GA 4ZHPA 4DHJD 1J5EQ 2RKSA 2CHZA 1FFUA 3MC8A 3HKZB 3B9JA 1I35A 1EWIA 4XYQA 1GJXA 4YHHQ 4A3GG 2KWVB 2NBVB 3WDNA 5M5XH 2HHHQ 4BAXA 1NCVA 3KLWA 3L3OC 1IBLQ 4WWPA 2DUDA 1S4ZA 3ND9A 4G7ZC 4LNQA 1XNQQ 1F0ZA 1HFGA 1SSOA 2B2UA 3G4SA 1HTPA 1ZOYB 2D10A 2LFIA 1TWGH 2ID0A 1L1OC 1P8LA 2F0IA 5M3MB 4KHPL 3H3VH 1HHVA 5IT9L 4ZK9B 3FC4A 2PQAA 4MELA 5C5MA 1UF0A 3SR1A 2WB1B 3NBHA 3TJPA 2DZIA 4WURA 3RI7C 1KDBA 3WCQA 1SF0A 3R2TA 1BUIC 1W3SA 2RSNA 4L2YA 3PLVA 5D7GA 2RSOA 4XT1B 4PYZA 1H4RA 1IHZA 3J80c 4RA8A 3M7NA 2PCFB 3URYA 4NAWA 1U4LA 1JR0D 1Y69U 1LO5D 4S17A 3VR4A 4PYUA 2YVCA 1S5BD 4HCNB 2KTFA 3GS2A 3OWEB 1K8AC 4FULA 1UUPA 2KVMA 2RHQB 2TSSA 2NUCA 1JORA 1E7UA 3JYUA 3F2UA 2LUMA 4BS9A 3PO3H 1V86A 4DR3L 4YSZB 2WXJA 1WD0A 3M95A 3IT4B 1JCKB 1EYAA 1SBBB 3DWQA 3F8TA 1CA6A 4BBSB 1V1PA 5GXGB 4DDID 1XD3B 4DAYB 3I3CA 1N8RC 5C44G 2BWFA 3Q8AA 4DHZB 2N8NA 1VZ6A 5I6WA 2CR5A 3HRZC 1BBUA 1KLGD 2BKFA 2I38A 3PUYA 1A3UA 2WNMA 3STBC 2W55A 4W9IA 4HWIB 5BN5A 2XVSA 1MBYA 2PJHA 2MLBA 5DEHA 1GVPA 4AH6A 1OGWA 5EE3A 3RNBC 4U673 3M4PA 2L15A 2PQEA 2PE6B 3OMCA 2O2VA 1RRBA 2NTSA 4EZJA 4DK3C 3SEBA 2IGDA 5LXIB 1X6OA 1ZEQX 2FE8A 5AJ3L 3VR8B 3LDZE 5FLMH 1J7CA 4JI7L 2KWCA 1WTOA 1Q86C 1GC7A 1A15A 2F3WA 3FDTA 4JBWA 3KF8B 3ULPA 4AQYL 1PGBA 2Z8LA 4X57B 2FCQA 4OW0A 4JOIC 3NP8A 1GO3E 5EE1A 3LWUA 2XK5B 5E4WC 4A76A 3FAHA 3PSEB 1WOCA 5EQ0A 2D62A 5CV8A 3JSVA 1R4QB 2LVQA 1S1QB 4L1BA 1OEYA 4KX6B 3SD5A 4XQQA 3ML9A 4DK6C 3VDYA 1HRJA 2V9HA 2LGYA 4HROA 4P16A 2PPHA 1D1KA 1I4QA 2WAQE 3Q8EA 2K04A 4OVVA 4BKGA 1IP9A 3FKIH 4LW1A 3QWZB 5C4JB 3A8JE 4LK0M 1HNXQ 1HZ6A 4K14A 1QVCA 2K5QA 4LF4Q 3AE5B 1ESFA 3HOZH 1YJ9A 5C3EG 2JYEA 4MNOA 1I4RA 2Y0SE 5COYA 1P16A 4JI1L 4ITKA 1K8MA 4HJ8A 1LM0A 2B2YA 3OYYA 4R4CA 3OIQA 2MBBB 1Z47A 4GOPC 4MT5A 3TP5A 1JMLA 2CS4A 1GUNA 1O78A 1JROA 1KD1C 1EY5A 2VY3A 3VR2A 1TWHH 1X9NA 4BY7H 1D5XC 4O0AA 1YOVB 2V3PA 2A6EC 2ZTEA 4GS3A 1LTLA 1J0GA 2KN4A 2MWSB 4TV3A 1AH9A 4N58A 1SYFA 4TKNA 2CWPA 2ZTCA 2DN8A 2OCEA 3J80E 2FJ2A 1IBML 2JA8B 2NVXH 3H91A 1VQBA 5NUCA 1DZ1A 4LCDE 5DAUA 3V60A 3EBEA 2VZKD 2WXRA
chains in the Genus database with same CATH topology
2INPE 2MEKA 4A3EB 1EY7A 3G7LA 1KAAA 3C46A 4G4KA 2ENBA 1U4PA 5C6AA 5H8YE 1VDZA 3L9AX 3Q24A 2E3TA 4RKBA 1FO4A 5I2YA 3TEZA 3MXGA 3C1EA 1LTID 1PRTD 4XQNA 1EU3A 4N9PA 1PFNA 4K2KA 3P20A 5EPKA 3LXFA 1JB3A 4B9WA 3M4YA 4NW2A 2PPBC 3RUZA 4OGQC 3W5VB 4QCLA 3ZJVA 1N62A 5M5YB 2A68C 4MN3A 3K5LA 1KRHA 3K59A 1A2UA 1RYJA 3SFDB 4ZAIA 4FP5D 2JEAI 2B2TA 3V05A 2AQ2B 4MHEA 1VMCA 4YTPB 1QWYA 1BNZA 2BA1A 2HDMA 3NVWA 2WP8J 2WXGA 2B2WC 2L4NA 2EELA 4A3FB 2ZW0A 1PTOH 4RAUC 2B63B 3LYYA 5D3IB 1C79A 4XE0A 1MSHA 3BVGA 1AZQA 2A6HD 3HOWB 2WXLA 4ZHOA 1F2ZA 4BA1I 3HRDD 3S16B 2KHSA 4C1NI 4R9WA 5AUKA 1HXYD 4HCEA 4FVMA 1AEXA 4PNYA 4C56C 4A3MB 3GTOB 2A73B 5BYSA 2K6AA 1FGBD 1R9TB 2J42A 2HQEA 1R4PB 2Q5WD 4DXFA 4K8IA 3L7ZC 3P7JA 2AQ3B 3N6RA 1EY8A 4OZAA 2EYMA 3RMHA 4YXDB 4RWSC 3VRAB 3NE5B 1Z6HA 3H0GB 3BDCA 5E3FA 1Q10A 1IBXA 4ZUJA 5K5PA 3MXUA 3AB9A 3PIP3 3I90A 3Q6SA 4PMWA 1K52A 1JC7A 1SDFA 4F8MA 5JOBA 4YSXB 3S1QB 3BYTB 4DU9A 2AUKA 4F7XA 4FXDA 5EJWA 4ARIA 3AE3B 4FF4A 2SNSA 1RODA 1H9SA 1BDOA 4L63B 4PV1C 3SFEB 4UAIA 1KLUD 1YNND 4IDIA 2BA0A 1VDVA 3NK9A 2X6GA 5KGUA 4EQNA 1BCPD 3ZJTA 4TRDA 2JXMB 2B8GA 4K6LA 1WVLA 4TQ0A 1PUTA 2WDQB 2L32A 5EGTA 5CV4A 3GV6A 5G3LD 4R3DA 3SDZA 3GB1A 2R6GA 3D6CA 1FD7D 3OWFA 2DLBA 5IIFA 1EYDA 1GUTA 1AZPA 3KLSX 2F0SA 2CU3A 1NEKB 2MPMA 1L4DB 3TDQA 3P4SB 2L12A 1JRPA 4ZKBB 1YNJD 2V4IB 4RF1A 2M56B 1J7AA 1OQQA 3U4EG 3U52E 2WKCA 3TEXA 1C78A 1QE6A 5C0XI 1XO3A 3MC0B 1L0XB 3N9YC 5IGEA 1N60A 3NUHB 2BDNA 2BB5A 5LL6S 2EXZA 1Q3LA 4TMAB 2L1AA 1V1PB 1S5FD 1UAPA 1I4PA 1TIID 2R3ZA 4A55A 4K6DA 3GTGB 3D4WA 1A70A 1G91A 1BCPB 1CHPD 4F87A 1YQ4B 4HEDA 4L6TB 2K3UA 2YEPF 3AECB 3MJ5A 2ZT9C 2WXPA 1N61A 3QB3A 1XCQL 4N59A 5BN4A 1S5CD 2GB1A 1JQYD 1K51A 4WJWA 2N88A 1KFYB 2CW0D 1FM0D 1AWDA 2NWGA 1TKEA 1XEEA 4CJ0B 2OF1A 1E6EB 1CQFA 2L0CA 3R2IA 1Y8NB 3K0YA 1WTVA 1OXUA 2I46A 1TU2B 1QOFA 4FO2A 1EIGA 4BBRB 2DYOA 3EGRA 5ELDA 2BS2B 1MGSA 2F0EA 2O5JC 2EY1A 3LX0A 1NR4A 4US8A 5KIXA 4ZUIA 1DONA 1SB3C 3DM1A 1QKZA 1GOZA 2J4XA 1EL0A 2K33A 1FFVA 2Q8IB 2M9VA 4ZQ3A 5T1GA 4K8JA 2MHVA 3VYUA 2EYLA 3HZXA 4PMBA 4XDXA 4D2KA 4RGMA 3DWMA 5KNDA 2V0GA 3SE0A 1SMYD 3ETRA 1RJTA 2RPVA 2K01A 1ENCA 4EVOA 1A3VA 1G8ZD 1RF2D 4LAAA 1HZ5A 2N0SB 3MVVA 1BCPF 3CIRB 5C0XH 4HKQA 1ZDXA 4K2LA 3CHBD 4MIUA 5E1FA 5G3LF 5JPNC 1IL8A 1ZYRD 3HG9A 1DOKA 2WXKA 1OXXK 3P75A 2JA6B 3BK2A 3MFGA 1STGA 3AE2B 3GTKB 2RBMA 3P42A 1FR3A 5HHDG 4WFN3 3J7AF 1FNVA 1XYIA 4A93B 2BYTA 2NZ1D 3RLFA 3UI3A 3PO2B 1L6UA 1GAQB 2I2YA 2PIAA 1CK1A 1QILA 4U68A 4XTCS 1GB1A 2FFKB 5FLXL 3BK1A 1PZKD 3P63A 2FMCA 3W9CB 4JE3B 5M9OA 2KAJA 1GPXA 4ZLTF 1SYDA 5DNFA 3VR5A 1RM6C 2B2VA 5G5GA 1BBXC 1BCPC 3Q0AA 4G7OC 1D5ZC 1XLOA 3KWLA 1TS2A 3CQZB 2A5HA 3I4MB 2QIEB 1XXGA 4OVZA 3Q23A 3VYRA 1H9JA 4HR7B 1JQ4A 3SK4A 1FRRA 3ABVB 1CTMA 2F1MA 4CJ1B 1ZXTA 2AUJD 1ICWA 1EZ6A 1Y1WB 3IAYA 5EE9A 1XTCD 3EA6A 3DWPA 3GTLB 2F0TA 3NRZA 4B0MA 3R3OA 3M3YB 3FRPB 1WGKA 1KF6B 2L52A 3A56A 4PMCA 1ZP0B 2QCPX 2D9UA 5J22A 2NMQA 3NVVA 3OIPA 2K32A 1VRAB 5BN3A 3HVDA 1T6BX 1MI2A 3FILA 1SE3A 1K83B 4HTHA 1MI0A 4ARCA 4Q0FA 3FPUB 1D6EC 5IGCA 1IBXB 2N9KA 3DWGC 2ACZB 4N6EB 4MACA 3UI2A 5C4HA 2IX1A 1FEHA 1PYWD 2RDHA 4CGYB 5A2QL 1II3A 3DMUA 4Z9CB 3AE7B 2B2YC 1JICA 1IYUA 2LEKA 5C0XG 2K7VA 3NQIA 3NBIA 3D4RA 3K5NA 1OO9B 5KNCA 2NVYB 4OO1I 1YN4A 5C0XJ 3J81L 3HOUB 1F2LA 1M8AA 1H9SB 3B2GA 1V8CA 1ET9A 1SE2A 2JA5B 1KNEA 5BMHA 1EZ8A 3KQ4A 4B08A 2NVQB 5EE0A 4KY5A 3IAM1 1XX8A 1WTWA 4I65A 4RH6A 1CJEA 3CU7A 1LTAD 1SJED 3QIAA 4KKTA 3TEYA 3ZJUA 3FVQA 3IFTA 2K03A 3AMZA 1WWTA 2WAQB 4ID6A 3M85A 2JZPA 4KD3A 2L55A 2JX5A 1SNDA 3X3MA 4A3JB 3HOXB 1QB5D 2B8FA 3S1MB 1LACA 2Q8RE 5CORA 5M5WB 2ZXPA 4C3HB 3GTJB 2EOTA 2BE5C 3SK6A 2Y0SB 2KA7A 1O7YA 3FPPA 1EQTA 2DY7A 4L8JA 2JYOA 1DM0B 3GQBA 5D14A 3ONAB 2KUMA 2B2TC 5IT9E 2OEDA 4HAEA 1PTOD 3BZDB 2PW9A 1STNA 1WTRA 1XLNA 1ZYRC 2E2IB 1DOIA 4HMIA 1SIJA 1ROEA 4HCSA 4DGZA 2DBYA 2EE1A 1LTRD 2WINB 4LJZC 5JXVA 3IL8A 2BDOA 3K5OA 2K1BA 3DWAA 3T3OA 2E2JB 4KJNA 1NR2A 1B1ZA 3TP6A 1QNUA 1JW9D 1XCTL 2QKIC 2K5DA 5KEEA 3E0JA 4XXEA 4O1NA 3KLSA 2K28A 2D5GA 4KHZA 1KNAA 2L1BA 1GHKA 1Q8IA 3BVZA 1BMLC 1ZE3D 1ZDVA 3RZDB 4AQ7A 4P2CB 4FXKC 3AM9A 2F0KA 1Y56A 2INNE 4H2AA 1JALA 2EVBA 3A7LA 1NYQA 4QUCA 1H9MA 5BMIA 1N5WA 3FMCA 3X3NA 5ISRA 3P4RB 3V2TA 4HJGE 1PFDA 4NMZA 3U2SC 4KI0A 1EEFD 1KH0A 1VLBA 3Q8BA 4AS1A 1D1IA 2G9HD 1ZPSA 5H92C 1VJKA 4HMJA 1JE4A 1QOGA 3Q22A 2HUGA 2NVTB 2LS01 4RHSA 4R8NA 2LHEA 2Y3AA 2X69A 4G57A 4IUQA 2XN9C 4DA2A 4CKCA 1HEZE 4A3BB 1L6VA 3S1RB 2IX0A 2BBCA 1HQMC 2C5CA 1D5MC 3ERQA 1QT9A 5J39A 1TS4A 3MAQA 3R8BA 3PO0A 5FKAC 1PFBA 3A54A 2FBWB 4XWWA 4RFBA 1TY0A 1I4GA 4KGRA 3V3XA 5EBCA 1U4RA 1C77A 3HP3A 4H13C 5IGDA 2KWDA 1G6ZA 3G6JB 5IODA 4WRDA 1E0ZA 2R7ZB 3U9OA 4CBVA 1NI3A 1R7SA 2HTME 3HOYB 2MJDA 1NENB 2F0QA 4M8AA 2VZKB 2AWNA 3MWYW 2R93B 1SYEA 1F2RC 4A3KB 1EIHA 4WH4A 1JOQA 3EQLC 4HRSA 2EYFA 1VF5C 5LL6X 4YSYB 4C7ZA 1UEAB 1I4XA 1PRTB 3QG1A 1B50A 1STEA 1ILPA 3NTHA 3AU7A 3Q8FA 2BTEA 3JAML 3D31A 2JQRB 1TS3A 2PLPA 1E2ZA 1QLBB 4OIKA 3IAS1 1GXDC 4OO1G 1J8IA 1FNWA 1HPCA 1H9KA 2F4IA 2M00A 4DNTB 2WDVB 1EWCA 5I6YA 4RHRA 3NWSA 2Z4IA 4NDXA 1TQOA 2QF7A 4CHTB 2JWUA 2Q8TA 5IGBA 2WQYB 3AE6B 5HFYA 4A3DB 3SXHA 3P1MA 2YU9B 3KK7A 1SNPA 5BYQA 1BR9A 4JK1C 2M0AA 2MGSA 3FILB 1B4OA 1WCMB 2EYPA 3CRLC 1FIQA 3HGBA 1EOTA 1RKNA 3MTSA 3T4AC 2YEPB 1IUEA 1NSNS 1A2TA 2PZWA 3W1SA 3D3RA 3R93A 3H09A 2VUMB 4J3OD 4YWGG 4LK1C 3LWEA 4FF2A 2WXIA 1FXIA 2JEBI 4IUUA 1NAPA 3AE8B 1MSGA 2CQAA 2SAKA 2EKIA 4C3HG 1Y8OB 1PRTF 4ODGA 4TQ1A 3AE4B 4PQXA 2FHTA 1ZUD2 2QSDA 1FRDA 1LT5D 5LHY1 2PNRC 4KKSA 4A3IB 1IYVA 1CT1D 2WKDA 2WXHA 4FXGC 5CV9A 4USAA 1SNCA 2IDYA 2JSVX 2N55A 3OHXC 2EPBA 4KY7A 2JXTA 4NAWB 2KQ4X 1KDCA 3MXNA 4RCOA 1I6HB 4IUNA 5EKIA 1LTTD 2WP9B 3BDLA 4A90A 3P4PB 2JYTA 2B39A 4REZA 1TKGA 2D2CC 5CC4A 2E2HB 2MP1A 4FYDA 1OXVA 2L83A 4X3TA 3NVZA 4J1MA 3T16A 3LB8C 2EYJA 2IGGA 1GUSA 2VB3X 4Q2JA 2MJ8A 3S9WA 2K5PA 2EY6A 2DWQA 2B2WA 3GV3A 4A3GB 3M4OB 1PRTC 5AUIA 1DOLA 2B2VC 3I9V1 3I70A 1LABA 1SNQA 4DAVA 1ZXHA 5F2DA 4DK1A 3EROA 3OMGA 3T3NA 1O80A 2RDFA 4X3KA 1TWCB 2NTTA 4H44C 1QOBA 3KLRA 4J6HA 1TWAB 2IPKD 1J7BA 4X3SA 5HG2A 1E2WA 1JOOA 1CZPA 1L5PA 2F0LA 3VYSA 2BB6A 4JPSA 3W5UB 2LHDA 1H9RA 1JWSD 2EZVA 4IUVA 1ZXIA 5HGTA 2HDEA 1TJEA 5EPLA 2XIWA 3HOVB 3GTQB 2DYMA 1MVKA 2R92B 4ME5A 1TR5A 2IT1A 1GUGA 1EY0A 2OEOA 4EE2A 3NQTA 2WXMA 2PVOD 1V8QA 2A6HC 4CKBA 3QO2A 1T3QA 2KDMA 3DUZA 2J52A 1CM9A 1YQ3B 4WAFA 2XSCA 2Y5PA 4OZBA 5C5LA 1QQRA 3NTKA 5CV7A 1SEBD 3SVMA 4C3JB 2IL8A 1C76A 3J9CA 4DFAA 1L4ZB 2KEDA 1K50A 4UDUC 2F3VA 5I9OA 5AFWA 4M1UB 1CHQD 1PLFA 2QMTA 2QJLA 5HI1A 1HA5A 3T51B 2F0OA 1MPEA 1W6KA 4C1NK 2LY7A 3MEHA 2B2UC 2SNMA 3AEBB 4WWMA 2IJ0A 2KECA 4HSVA 2WU2B 1TYGB 4US9A 1CFMA 2KCNA 4KD4A 2JSOA 4V0BA 3NHHA 3VRBB 1NVID 3RFZB 1SAPA 4C2MB 1IW7D 4XQJA 2L11A 1V97A 2K9XA 3C1FA 4RCNA 5M3FB 5JVG3 4K5XA 4N9TA 3HVZA 2HDLA 4HN7A 1LLRD 4CQNA 1YNNC 5M5XB 4KTAA 1RWSA 1C8CA 2FINB 1W6JA 2NB0A 1BOSA 3FEWX 4F88A 1TWGB 3B2FA 1M4VA 1GB4A 1E7PB 2WACA 1NYRA 2RDGA 4YIJA 2PMZB 4A6QA 5JEAG 2KOLA 2C9OA 2E75C 1FCCC 1HUMA 4DNRB 3E9SA 1LTBD 3GD7A 4BWGB 4NJCA 2K05A 3T53B 3PV0A 1SNMA 1BO0A 1U4MA 4KKJA 2FUG1 4KJOA 5DM63 1OQRA 2CJOA 5JAVA 4Y7NB 1DGJA 5CYUA 3DEPA 1YNJC 1G2SA 2YYZA 3PO3B 2F0VA 2XRSD 3E5SA 2HCCA 2A6ED 4TQUS 4BA2I 3IFDA 2G1EA 1TKYA 1O7ZA 3A8KE 2M19A 2F0PA 2RVLA 4KV6A 1PDXA 1OXSC 1WTQA 5E6JA 2EJGC 4GLSC 1YMHE 1JWMD 2A69D 2WXFA 2NN6I 3KBXA 2Y5CA 1B2TA 4Q5VA 2J0TD 1IKLA 1E9MA 3CRKC 5I9PA 4KGTA 1DD2A 1E2VA 1HCZA 4B0EA 2J53A 2CW0C 2PW7A 4IALA 3I72A 3QOJA 1C9FA 3HUIA 1CQVA 4IUPA 2EJFC 1C48A 5FO7B 2A68D 3S2DB 1I50B 3OPOA 1Q1EA 3SK8A 3Q69A 1EY6A 3ND8A 3PZ8A 3FKIB 2K0PA 1SYBA 2VB2X 1B3AA 5C4XB 1EM7A 1WRIA 3HOZB 4L23A 1XWEA 4P6VF 3QOLA 3C8YA 4FXCA 5A2QE 4K5WA 4QUFA 1STYA 1HUNA 3NS1A 1AYFA 1TWHB 2AX5A 4BY7B 2DNEA 1Q1BA 3P1HA 4WQMA 2MH7A 2W3RA 2WLBA 4QIWB 5DM73 3AV8A 1SMYC 1YNTE 3J81E 1SFOB 4YT0B 2NVXB 2N9LA 4XDCA 4MM3B 4IKGA 3W3AA 3PZ7A 2CHBD 1NUCA 3EVQA 2E76C 1J9OA 5D65A 4EQOA 3CWIA 4G7HC 1X3QA 1G2TA 3WOEA 1I7HA 2IX3A 2BOSA 5CR3A 2WV6D 2KACA 1N63A 1DJRD 1PXUA 1F2RI 1PZJD 3TN2A 3ZGZA 2A74C 5BYRA 3SR6A 1U9RA 2NN6H 4I7ZC 2LMCA 4RGNA 1B44D 3H3VC 5FK9C 5JPMC 4DK0A 4OL7A 1SE4A 3D4DA 1FD6A 3H8HA 3TP7A 4TKOB 2X6LA 3P4QB 2EDGA 2N7JA 2HCIA 1AFPA 4S3SA 4XWTA 1FNUA 1V43A 2R61A 3NWTA 1VF7A 4IURA 1MHHE 3S15B 1IW7C 2JE6I 3S17B 1RFKA 2F0DA 4OO1H 1D2BA 1XLPA 1SYGA 3ITPA 5EBDA 1F9PA 3NXWA 1RDPD 2RMMA 4C3JG 4M0WA 1B9RA 4NP5A 1PTOB 5T8IA 3I8ZA 2GA4B 3EJIA 3K6OA 3OSOA 2PZTA 3J80L 4PT5A 2LFNA 2H1EA 1TWFB 1AW7A 1VZ7A 2BCOA 1HQRD 1BUVT 2LKVA 3NZ3A 2K22A 1TVXA 3AEDB 2V4DA 3U7ZA 1YJJA 3K5MA 1I4HA 5FO8B 3J7YW 1SXTA 2IWHA 3TMEA 1WD1A 2F0HA 3J7AV 3BVMA 1G291 4YTMB 2BT6A 1V1OA 4WIPA 2ZW1A 4GDLB 1HFNA 4KHVA 2QDBA 5A35A 3LNNA 1CZGA 2F0UA 5ELFA 1ESRA 4IQZA 4LLGM 2WU5B 4FNFA 2PO4A 4ZRQA 2H88B 3E56A 1XF5L 1DYQA 2A69C 3PUWA 1DOXA 1VZ8A 2Z1CA 3S14B 4MH8A 1CA5A 4XIGS 1PGAA 2EJMA 3O13A 3HS0C 1BF4A 1Y1VB 3HEJA 1O7LA 3I91A 2NBFA 3SK5A 1EWHA 1DOYA 5I4DA 3GTMB 1C4AA 2EY5A 1FYCA 4RKLA 3BDOA 1VR9A 2PVGC 2GRIA 5FO9B 4WORA 1F2MA 3RD4A 1LV9A 2W54A 1PTOF 4LTUA 3SHLA 2NN6G 2BS3B 1ZKOA 3D8GA 1HA6A 2I07B 4KK7A 5MPOA 2WXNA 4DF7A 1XLQA 2F0MA 4KN4C 3BYYB 2JU6X 4ZRPA 1STHA 2RA4A 1F9QA 3K57A 2F0GA 4NZLB 2O5IC 4IFDI 2EY2A 5J1ZA 3U9SA 1D4BA 2IW3A 4AYBB 4XT3B 1RHPA 3TEWA 2EYOA 4KMUC 1YN3A 4RNAA 4KKUA 2PKOA 2O2LD 4A8XC 2AWOA 2XRQD 2LJIA 1OFFA 1Z7TA 3MHBA 3QWNA 5HURA 3GO5A 1QF6A 1I3QB 2JA7B 1MHXA 3TZDA 1QCBD 3VR9B 1FXAA 5CV5A 3BWUD 2XNAC 1PTOC 2V3NA 1LTGD 3JAME 1Q90A 5E4XA 3AB5A 3WOFA 2WDRB 3KUPA 4OHJA 4HKZE 2PW5A 1LT4D 2O4XA 2CJNA 1Y8PB 1IKMA 3I4LA 4K5VA 3H94A 2WXQA 1L0VB 3A55A 3AEGB 3IKJA 5FOBB 1ONLA 4ZYSA 1CZWA 4YTNB 3MZ5A 1BXTA 2H89B 5FR3A 1LTSD 3A8IE 1CI3M 4FF3A 4C3IB 5KNBA 1LT6D 3TUOA 3V96A 2F0NA 2AQ1B 5CMDA 4IN3A 2TMPA 1JWAD 4NAMA 4JWUC 3GP7A 2BS4B 5LNK1 2PYKA 5EKLA 1LT3D 1I6VC 4RGOS 3NPPA 4H0LC 1TKWB 3AMUA 1GUWA 4DN4M 4QMGA 5ELEA 2CVRA 4IFDH 1EFID 3AH7A 5JVH3 4E6IA 1BQQT 2FMMA 2E74C 1L0YB 1TZOA 2KJXA 4IOIE 2JP1A 4IUTA 3E6ZX 1F2YA 3NUCA 4C7YA 5CBAE 3W2DA 3AN1A 1RCVD 3OW7A 2QILA 3BS1A 1EYCA 3RZOB 1YJIA 4ZRZA 4ZKCB 1IGCA 5I2XA 2LGIA 2L5TA 4BY1B 4DAYA 3AEEB 4HEA1 2OXPA 1ENAA 1WXQA 3VQIA 3D6WA 1VMPA 3VA7A 5D3DA 1OXTA 5KRUA 1KTKA 1ACCA 4A9AA 3KBGA 2LMCB 1PDQA 1KDAA 4ILWA 1GUOA 1B53A 2OT2A 1STAA 2VXWA 1EY9A 3MA2B 1PGXA 3Q8CA 5JEAH 1VCIA 3TP8A 4R8IA 5BMGA 1A3TA 2BW2A 4CJ2C 5C3JB 2W3SA 3ZYYX 2PZUA 3KF8A 2F0WA 2SEBD 2KQ3A 3TSSA 3NTIA 4ZOHC 3C2PA 3L4PA 5C3WA 4KY6A 5G5HA 2ZXRA 1FMAD 4DXGA 2B76B 4ULLA 2MJEA 3NSWA 4QB4A 1X32A 2J7ZA 5IOCA 5C44B 1EWYC 2KCCA 4QF4A 2EYHA 1T5XD 2KEEA 4RGTA 2PMVA 1RTOA 3AE1B 1B9NA 1EEID 1QOHA 2L9HA 1ET6A 3NVYA 1C4PA 2ICEC 3PUXA 3IT6B 1X3PA 1PMRA 1YN5A 1MD2D 3ZQ4A 1E10A 1P7EA 1KABA 3I57A 1EQVA 1FCLA 3A7AB 1F77A 2Z4HA 4XDDA 1PZID 1EY4A 3DHQA 5EKKA 3VR3A 5C2TB 1HTLD 4KGSA 1ENFA 4FF1A 1IGDA 3EUB2 5ELBA 1P7FA 1JWBD 1DXMA 5K36H 2XWBB 5C4ZA 1E0BA 4RF0A 3EFXD 2BE5D 2G9DA 4H7BA 4ABNA 4EGVA 4IFDG 3S1NB 4JWSC 5IGGA 1UGJA 4OZCA 2WIIB 4IZ8A 3K58A 3N52A 5C3XA 4IFDJ 2H4OA 1STBA 1B9MA 3T13A 2ICIA 3AEAB 5CGKA 1WYGA 5C3EB 2ZXOA 1RD9D 1ILQA 3KWVA 3DEOA 5EPJA 1SYCA 3K7AB 3MFYA 4OIJA 4DQOC 1UWXA 4NKLA 1UWMA 1A6XA 2NYZD 2ONQA 2D5DA 4X3UA 4GDKB 1RTNA 4J8QA 4O42A 3PIO3 1TY2A 2MUYA 1TS5A 1DOMA 4V190 3I4NB 1S5ED 1ML0D 2VNUD 3AEFB 1K8OA 2MJ3A 5ELCA 3MXPA 2XWJB 5JEAJ 2KMMA 2QEJC 3VR6A 2E2DC 1AP0A 4KKIA 2DY8A 5FLXE 1N5XA 3MHZA 3BIID 2E6XA 2PTLA 5KYIA 3PUVA 1SSNA 1TT2A 4TSSA 1QNKA 3VYTA 1WSPA 1QJOA 1F9SA 5IGFA 1SNOA 3MP9A 3GTPB 2M2LA 4B9XA 4C3IG 1JOKA 2IGHA 3QJYA 5JJZA 1QOAA 2F0FA 1JWUD 3PMFA 5KYLA 3OOCA 1SJHD 2W82A 1QG7A 1GHJA 1AN8A 2SDFA 2RQXA 3C3LA 1Q12A 4C80A 2WXOA 4LMQD 1T5EA 3I73A 2F03A 5CBEE 2WS3B 2OHFA 3S2HB 5CV6A 3AE9B 2DNCA 1C4CA 1K53A 2SOBA 3H6MA 3TZUA 3TBIB 3IXSA 1DCZA 5K36G 1PFMA 3DXJC 2F0JA 2GI9A 1C4QA 5TSSA 3T56B 4GZYC 4CKEA 3VA5A 1EU4A 3BG3A 3CKIB 4EQPA 2X38A 3PUZA 1UNSA 4JX1C 4XYOA 2ON8A 1S5DD 2K5WA 4HSPA 5T1IA 1WTXA 3RPFC 1WTPA 4KN7C 1F9RA 4DAPA 4ZHPA 3M7GA 2RKSA 1FFUA 3HKZB 3B9JA 4XYQA 1GJXA 3WDNA 1NCVA 3L3OC 1S4ZA 3ND9A 4G7ZC 1F0ZA 1HFGA 1SSOA 2B2UA 1HTPA 1ZOYB 2LFIA 2ID0A 2F0IA 5M3MB 1HHVA 5IT9L 4ZK9B 3FC4A 5C5MA 3SR1A 2WB1B 3NBHA 4WURA 3WCQA 1KDBA 1SF0A 3R2TA 1BUIC 2RSNA 4L2YA 5D7GA 2RSOA 4XT1B 1IHZA 3M7NA 4RA8A 2PCFB 3URYA 1U4LA 1JR0D 1Y69U 1LO5D 3VR4A 1S5BD 3GS2A 3OWEB 1UUPA 2KVMA 2TSSA 2NUCA 1JORA 3F2UA 2LUMA 4BS9A 4YSZB 2WXJA 1WD0A 3IT4B 1JCKB 1EYAA 1SBBB 3DWQA 1CA6A 4BBSB 1V1PA 5GXGB 3Q8AA 3I3CA 1VZ6A 5I6WA 3HRZC 1KLGD 2I38A 3PUYA 1A3UA 2WNMA 2W55A 5BN5A 2XVSA 1MBYA 5DEHA 5EE3A 4U673 2PQEA 3OMCA 2NTSA 2IGDA 3SEBA 3VR8B 1ZEQX 2FE8A