3BVGA

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
237
structure length
228
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Enterotoxin type C-3
publication title Assessing energetic contributions to binding from a disordered region in a protein-protein interaction
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 65
structure length 228
sequence length 237
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bvgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bvgA01
2TSSA 1ET6A 4TSSA 4L63B 1CK1A 2XN9C 1S5CD 1TS2A 1SE3A 5FKAC 1PZKD 1SE4A 1FNWA 1DYQA 1I4RA 3BYYB 3KLSX 1FNUA 3SEBA 1V1PA 3GP7A 4RGNA 4K6LA 1BCPD 1EWCA 1S5DD 1S5ED 3BZDB 4RHSA 4RCOA 1PTOH 1LTTD 1ET9A 1SXTA 3R2IA 1T5XD 1JWUD 2CHBD 1HXYD 3EFXD 1KTKA 1UNSA 3OWEB 4RH6A 1FD7D 1PRTB 1YN3A 1PTOF 1LLRD 1LT3D 1LTGD 3BYTB 1LTAD 2QILA 1I4PA 1TY2A 1I4GA 1M4VA 1HA5A 1UUPA 1TS5A 1LT4D 5ELBA 1CHQD 5ELEA 1CT1D 4C56C 1FGBD 4OHJA 1D5XC 1I4QA 2RDGA 4Z9CB 1BCPC 3BVMA 2Z8LA 1L0YB 5D3IB 1D5MC 1JWMD 5D3DA 1YN5A 1PTOD 1JCKB 1XXGA 3DWQA 4RFBA 4RHRA 2IJ0A 1I4XA 4O1NA 2NTTA 1L0XB 1HQRD 1STEA 1B44D 3TSSA 1LTRD 2NTSA 2QEJC 3DWAA 1CHPD 3R2TA 1PRTF 1EFID 5TSSA 1SBBB 3BVZA 1KLGD 3R8BA 3URYA 1SJHD 5FK9C 1TY0A 1BCPB 3CHBD 4UDUC 1D6EC 1S5BD 3MC0B 2ICIA 1LO5D 1LT5D 1LT6D 1TS3A 1G8ZD 1XTCD 3EA6A 3MFGA 4BWGB 1I4HA 1ESFA 1JWSD 2O2LD 1QILA 1PTOC 2XRSD 1YN4A 1JR0D 2G9HD 1RDPD 2IPKD 2XRQD 1PRTD 1LTID 2WV6D 1MD2D 1RCVD 4L6TB 4RGOS 3BVGA 1PZJD 3DWPA 2R61A 1B1ZA 1DJRD 1SJED 1EU3A 1AN8A 1LTBD 1V1OA 1EEFD 3O13A 5ELDA 1D5ZC 3W2DA 5I4DA 1V1PB 1PZID 2AQ3B 2J4XA 1KLUD 3V05A 1F77A 1SEBD 1TS4A 5ELCA 4NZLB 1BXTA 1RF2D 2SEBD 4RGTA 1CQVA 2RDHA 1PYWD 1HTLD 1JQYD 5ELFA 1BCPF 1ENFA 1LTSD 1EEID 1PTOB 4RGMA 1AW7A 4DXGA 1EU4A 1RD9D 2AQ1B 2AQ2B 4DXFA 1S5FD 1PRTC 1GOZA 1FNVA 1SE2A 2XNAC 4ZYSA
chains in the Genus database with same CATH superfamily
1QE6A 2UUBQ 3CXCA 2ZCBA 2PMVA 2B8FA 3OSOA 1XX8A 3TMEA 1XPOA 2C7NB 4XC2A 3A1QA 5EBCA 4QAYA 4UPAA 2F0FA 4LF9Q 2PYKA 5GXGB 3JSVB 1VLBA 1UF0A 5C5LA 1V1PA 4A3GG 4ZRJA 2M1MA 3HS0C 4KY5A 2MUYA 2A69C 2J0MA 2N1VA 2K6DB 1W6JA 4XE0A 4AUQC 2Z9HA 2WXKA 1C79A 4L5SA 2LEKA 3NY5A 5IOIA 2I1JA 4B6WA 4BVUC 4TUUA 3ZNID 3APDA 1TBEA 4C4VA 1XLQA 1Q5WB 1GXDC 3KUPA 3GS2A 2BKFA 2EQSA 4LF7L 2ZZPB 1HTQA 2EVBA 4CYEA 1YQBA 4KKTA 3NRZA 1YN3A 3ZTCA 2I2YA 2PNHA 5IGEA 2VB3X 4A93B 4GN3B 1X3FA 3I90A 3Q6BA 3QK0A 5IA7A 4A3JH 4FHKA 5I6WA 2K3UA 4POFA 5C2TB 4LW1A 1AFPA 3M62B 3K5OA 2FCNA 3J7ZC 3VYUA 2B8GA 4R4QA 3R93A 3S2DH 3ZQ4A 2K28A 4A3FH 3OTOL 1FCLA 2JRIB 2KEDA 2EYJA 1OGWA 3HOUB 1FPYA 2F0GA 1HCZA 1MG8A 5CTRC 4XQQA 1MSGA 1SFOH 1GUSA 1JE5A 2F0JA 3RFZB 4B3ML 1I6VC 2GA4B 5M3FG 1FGUA 4XZ4A 1GUGA 3NS1A 1LTRD 3EIVA 3SR1A 4U673 4A8XC 3T56B 1DOIA 3MHSD 3MJ5A 4LNOA 4ZKBB 1Y1WG 2GBRA 3HK0A 3APCA 3CRKC 3ND9A 1RAXA 2MEKA 1TTNA 1EY5A 2RA4A 1IBXA 2CH4W 1OQRA 2IY1B 4NQLB 4A6QA 4OVZA 1X54A 3I7FA 1I6HH 1STBA 2K1FA 4EUTA 3KBXA 4XQNA 4BBNC 4JBWA 4WIPA 3TUOA 3AU7A 2R93H 2KEEA 4LF7Q 4QUCA 4DAYA 1UWXA 2QKIC 2AL6A 3HZXA 2MBOA 4IKGA 3AE1B 4YSZB 5IIFA 3RD2A 4IPDA 2K33A 2QDBA 2NN6I 3V61A 3M3JA 1SDFA 1EIGA 4C00A 2IY0B 5M3MH 4MH8A 3I9V1 4K2KA 1KC8C 1SIFA 2LUMA 1L0VB 3A9JB 4OELB 2KN5A 4LTUA 3VFKA 3A1QB 2M17A 1KDBA 1HZCA 2M0AA 2ALYB 4DUYL 1V1PB 3VRAB 3OTOQ 2L1AA 4WRDA 2PE9A 3V05A 2IO0B 3CCRA 5C5MA 1C4CA 4DK5A 3L08A 1P8LA 1PYSB 5HKHA 2NN6H 1XTDA 5CV6A 5E1FA 1QNKA 4R4TA 2HTHA 4LNFA 1CSPA 5C23A 4B3MQ 3CW2C 4ZQ3A 4XWWA 3KOJA 2K1BA 3H6MA 3M3YH 4Y7NH 4KKUA 3QHTA 1RIPA 5HG2A 2VW9A 2C60A 4LJOB 5C3EG 2MQJA 3NUHB 1FJGL 4ANVA 4HKZE 4WAFA 5AJ3L 3IT4B 4KLKA 5CC4A 1RTNA 4HIOA 3CMMB 2BW2A 4JX1C 4MEMA 2KDIA 2MQHA 3RNUA 3S2HB 4M0WA 3GP7A 4R9WA 5M5YH 4DK0A 2ACZB 1V97A 4G7HC 3BY4B 4X64L 4KV2A 5EAYA 4NDXA 3C0RB 1EY4A 4P74A 2VUMB 2K6QA 1JOKA 4QMGA 2V4IB 1V2YA 1IYFA 1SNPA 3I5JC 3UDXA 1HXYD 5CBAE 4BA2I 4JOIC 5JHBA 2EYOA 1VQ7A 4JW0A 4FF1A 3H7SA 1VQCA 4R4OA 1EO6A 2L15A 2A8VA 4I7AA 3HKSA 4NMZA 1LTAD 3A7AB 2JA7B 2EYFA 2LKVA 1L4ZB 3VAWA 2ES2A 1WXQA 1B7YB 3GV3A 3F2CA 2QJLA 4YT0B 1V9JA 2N55A 4A9AA 2MP2A 2EY1A 1BR9A 4DUYQ 2KFJA 3MA2B 2EYHA 3PHXB 2KA7A 1KRTA 4NQKE 2Y5BB 3RZDB 3P4SB 4ME5A 4DV4Q 4S0RA 4P71A 4XIGS 3FILA 3VQIA 2WB1E 1MJCA 1A15A 1V6EA 3TDQA 4LLGM 1S3OA 4K7WA 1RHPA 3HG9A 4E6IA 2K0PA 1B8AA 1HZAA 4JBMA 4GOCA 2KVMA 1H9SA 2I0QA 4HKQA 3S9WA 5M9OA 1GAQB 2LRUA 2WDTB 3KLWA 3UE1A 2X69A 4IJHA 2ZNVB 2HT1A 3P4PB 1STEA 1FJGQ 1QNUA 2KACA 2W3SA 3S1RH 5AJ3Q 5CYUA 4A3MG 1NEKB 1TZOA 2A68D 5M5XH 1L2NA 1SMXA 4JI4L 1WM2A 3DVGY 3IHPC 2D5DA 3UDIA 2B3AA 3W1BA 2E74C 2VL6A 4P1BC 4X64Q 4CO7A 3MC0B 3H15A 1DOYA 4MTNA 1TS3A 4JPBW 4JV5L 4BBSB 3GTOB 4J6HA 3ZDTA 1ESFA 2OF1A 3G48A 3Q6SA 4J15A 3RZOB 4LNIA 2CKZB 3FDTA 3OMCA 5JJIA 3OOCA 2JPHA 3LB8C 2PO4A 1JRPA 4BKTA 3HKZE 4DU9A 3RCZA 2KNBA 2NVYB 5IYDG 5C4JB 1B9MA 3CP0A 3PIPA 3G71A 2WLBA 4UP9A 1YHAA 1GM5A 1BF4A 1NYRA 1EU3A 4L23A 1F2YA 1EEFD 1QVGA 1GJXA 1C1YB 2LVPA 4G3XB 2SDFA 3J81i 1HUMA 1IKLA 1U0LA 5ELOA 3AE7B 4HCSA 1AH9A 4BY1B 1M1KC 2BE5C 2DJFC 1DCZA 1HNZL 4J6IA 3PLVA 4ZHPA 1G6JA 1JC7A 3SK5A 3T3OA 3FEWX 4C1NI 2CU1A 3N32A 5G55A 2D0PA 1LXDA 2OJWA 2AX5A 2MCNB 1EU4A 1MJEA 3HRZC 3EN2A 4B95A 4ZUIA 2RDBC 1WI0A 1TWHH 5C44B 4LUOA 1WCMB 4WJWA 1K50A 2AL3A 2CFMA 2ZW1A 4HRSA 2JT4B 2IBIB 2HD5B 2KCMA 3MWYW 1JMCA 4JBKA 3B9JA 1SE4A 4ZKCB 2A19A 2FFKB 4JI4Q 3KLSX 1WGHA 3PREA 2MP2B 1EIYB 4P72A 1TT2A 5D14A 1N62A 3PO3G 5HFYA 2M0XA 1A6XA 1CKMA 4JV5Q 3R7QA 1GC7A 2BYTA 2L11A 1IGDA 3NUCA 1Z2MA 3FILB 4KVGB 4C3IB 3RN2A 3DBRB 1OEYJ 4K7UA 1YX6B 3H8HA 3IFWB 1H9SB 1X55A 5H92C 3A4SC 5EDSA 3E0EA 3FAHA 2INCC 4HLEA 1GO3E 1PHJA 2MSED 1AARA 1SR3A 4EQOA 2UYZB 1G2SA 2E2IB 3P1MA 5D65A 2N1WA 2RBMA 5CHWA 2K52A 1WI5A 3LX0A 4QGUA 3B2FA 1I4QA 2AUJD 1KRHA 3PV1A 3V6EB 4QIWE 3BVMA 4NPSA 5COYA 1HNZQ 4GZYC 1DZ1A 2MO1A 1K0SA 1EF1A 1KRSA 2TMPA 5E7NA 1TWAB 1JROA 2FAZA 1LM0A 3NVYA 1UAPA 3U52E 4IUUA 4PYUA 1DOMA 4CDFC 1AP0A 4A3IB 3MXUA 1ZPSA 4GN4B 4AYBE 4IM3A 3HOZB 1C9OA 3Q8EA 1R4NB 1CI3M 1NR2A 1STHA 3ERQA 3TP5A 3VR6A 1F9JA 4GLVB 3DWAA 5TSSA 2B2VC 4K8IA 1EFID 4ALPA 3AMUA 2FCSA 2DNCA 4JGHB 2CQOA 4K2LA 5JJZA 1E5WA 2A74C 2FINB 4KJNA 1ROEA 5IGFA 3HOUH 1GC6A 2M56B 2IO2B 3VTWA 4YHHL 1LT5D 5L37A 4BA1I 5C6AA 2KQ7A 1Q10A 1Y8PB 3DBLB 1GUTA 2WACA 1PFDA 4JBJA 2RMMA 1YJJA 1JR0D 1MGSA 3LWEA 1XCQL 4DV2L 4UHVA 4FYDA 2KC1A 4MGIE 4A3KG 2XRQD 1BNZA 1Y1VG 3F2DA 4KK7A 1VQIA 1MD2D 3UE0A 3S17B 1TWCB 1PZJD 3DWPA 2R61A 4FJYA 1RKNA 1WWTA 4BY7H 1FRRA 2C7HA 3P4RB 4PZ7A 1SRUA 1J8CA 3S15H 1VZ7A 2Q2IA 4KI0A 2DENB 3O13A 2KTRB 3IVFA 4FLHA 1PDQA 4YSYB 3I4NB 3AU4A 2N3SA 4URKA 3PIO3 1A3UA 1TXYA 1YX5B 4O42A 5E6NA 3AU5A 4ZRZA 2KDEB 1JQYD 4DUZL 5C4XB 2KZRA 2MJ8A 3VR4A 3UI3A 1JMLA 5EPLA 2KHJA 4DXFA 3T9LA 2NVTB 3FC4A 3N52A 1WTRA 1GOZA 1JW9D 2F0MA 1O80A 4H44C 3F1ZA 4EQPA 4DDID 4ANUA 5JVH3 4BBRG 2HQLA 4OX9L 1P7EA 3K6OA 3LYYA 4KMUC 4YHHQ 1V80A 1S5DD 1JICA 2K5HA 2VQFQ 1OQYA 1S5ED 4DAVA 1V5TA 1WXVA 2MW5A 4WJ3M 5JEAH 4A4IA 3KWLA 2QA4A 4P75A 3D4DA 4PV1C 4DV2Q 1XO3A 2WU2B 3KLSA 4RMFA 2X6GA 3DEPA 3QAQA 3ZJVA 2WDRB 1PH8A 2R92B 4S17A 4IWOA 4QY7A 2ATWA 5C0XH 2KN4A 3RI7C 4A76A 4EKUA 3QO2A 4CDDC 2ZCCA 3PQIA 2MBHA 1TZ1A 3S2HH 2LVOA 4X57B 1FGBD 5A35A 4ZDVA 1SB3C 2JF5A 1X3EA 2HD3A 1G2TA 1NSNS 1L1OB 3VR3A 3MXPA 2Z8LA 4A3FB 2H89B 2OOBB 4RKBA 4DUZQ 2KQSA 3QWNA 3M95A 4DN4M 2F4VL 3OPOA 2ICEC 4FXKC 2BT6A 3DMUA 3ZJYC 4OO1G 5KGUA 2K22A 2MJEA 1JCKB 1G6ZA 4JVZA 1WM3A 4NP5A 1VQPA 1SFOB 4DR1L 3RNEC 2KQ4X 2ZEQA 4O1NA 4APVA 2HCIA 2EXDA 2HDLA 4MGYE 4V0BA 3PO2H 3S2AA 5CV7A 2JA7H 3GTJB 3MP9A 3TL5A 1OXXK 2ZNVC 1WX7A 4BKGA 4IWPA 3U30A 4W9DA 4OX9Q 2CS4A 3I8ZA 3A9KA 5IP9G 1KLGD 1JALA 4GXBA 3DDCB 1X3GA 1WGRA 3UDFA 3NHEB 2J0TD 2BTEA 3RZDH 1E2WA 3BIID 2WXMA 3RR5A 3ZLZA 4JI3L 3M4OH 3U9SA 2B63B 1E1OA 1XTCD 3D6CA 4BFRA 5KNCA 1EY6A 1WTWA 5C3WA 3K57A 2BYVE 2D10A 1IBLL 1XMOL 1ILQA 1YHQA 4XQJA 2MA9B 3J9CA 4JOIA 4ANWA 2D07B 3HOWG 2GB1A 4WORA 2FUHB 2A5UA 3HKZB 5IYBG 4IW0A 3P7JA 1WX9A 5IYCH 3IAM1 3TCAA 1EY7A 2FIFA 1WJNA 1VQ5A 2BB5A 4W9GA 1FXIA 4GOPC 3K0YA 1WX8A 2NCNA 2OEDA 4HPMB 3L0OA 1OXVA 1DGJA 4N9PA 1S4ZA 5E3FA 5FJ8G 5ELDA 5IODA 1SLJA 2Q2TA 2NBVB 1PH4A 3DBSA 2J53A 3U7DA 2KLCA 3H9DA 3BZCA 2KMCA 2LWPA 1LUZA 3U4VA 2F3IA 2Y0SG 2K8BA 4OWWB 3GTOH 3RNGC 1GVPA 4OW0A 2F4VQ 1NI2A 1CQVA 1HJPA 3ZKJC 4DK3C 3FVQA 4XTCS 4RGMA 4DXGA 1B4OA 4IG7B 4DR1Q 1MHWC 3LXFA 2WDVB 4GMVA 2GVAA 1KNAA 1A2TA 4F87A 5C4JH 4IFDI 3ZTDA 4A3CG 4ZUJA 1TIFA 1N60A 3IXSA 2BCOA 1L7YA 4JPSA 4IN3A 3G7LA 5MPOA 4Y7NB 3ZDMC 3EFCA 4ARIA 3D0FA 1FNUA 3H0GH 4JI3Q 3I3CA 2O5IC 5HHDG 2NZ1D 4II2B 1E8YA 5BO4B 3ICEA 5M5YB 3A33B 4PMCA 3P75A 3AB9A 4ZRPA 4IFDH 4AQYL 3MXNB 1IBLQ 1XMOQ 4WWMA 3A4RA 3DOWA 4RH6A 1E22A 3ULPA 4GLAC 4C3JH 5KYIA 5C44H 3DBRI 3EECA 1WCMH 5CV8A 2DN8A 2WWZA 1FM0D 3MVVA 5AZFA 2F03A 2JJQA 3TZUA 2Z59B 4KZ0A 4IOAA 2JE6I 3ULJA 2B39A 3B6YA 3K9PB 1QUQA 1NBFC 3UIPB 4DV5L 1UUPA 2SNMA 1WE6A 2LXCA 1TS5A 1VF5C 1ZEQX 1FRDA 1CHQD 1Q81C 4PK1A 3D31A 3RYTA 3WA0A 1R4MI 1C4PA 1IBML 2R7ZG 1UEAB 1VQBA 4LJZC 1BCPC 3HM3A 4QIWB 1L6VA 1WGYA 3G6EA 3SXHA 4LNQA 5AUIA 1F0ZA 4MIUA 1FXTB 4C3IH 3OJ3A 4TV3A 4KIKA 3HOXG 3V62A 3IFDA 2NS5A 4PMWA 4DR5L 4AYBB 5EE1A 1PA6A 1XWEA 3AE3B 2EYMA 4RHRA 4MACA 1I35A 1YVCA 2INNE 1B70B 3OIQA 4DFAA 2JEBI 1R4NI 2JA9A 1L6UA 3PT2B 3AE8B 4I7ZC 3BVZA 3PZ8A 3R8BA 3Q24A 3QOLA 2BOSA 5EE9A 5FLXL 3JSVA 1EOVA 2DZJA 1EWYC 2LJIA 1NVID 4KJOA 4K8JA 2AYOB 1TWAH 4U68A 1ZXIA 2XEWA 4A3IH 4AQYQ 2BPSA 1VQDA 2K5WA 5CBEE 2MP1A 4HTHA 3ZNZB 1QILA 1PTOC 4A3EB 3Q14C 3CCQA 3DBLI 4IC7B 3V3XA 1BO0A 3PUZA 2W82A 1TR5A 1XCTL 1SMYC 1I42A 3AEVA 3RMHA 3N30A 4NJ7A 3U9OA 1FXAA 1HTOA 1NMGA 2F0KA 1J6QA 1XNRL 2YEPB 2JA6B 1RWSA 4BOZB 4DV5Q 2ZM6L 4WWPA 2KWCA 4L2YA 3LJ3A 2RVLA 3NE5B 1TWGH 1OXUA 3ERSX 2FHTA 5I6YA 1IBMQ 1VQFA 1XLOA 4A3JG 1F77A 4NKLA 4B08A 2Z0DB 1C78A 4XXEA 4DR5Q 3JVZX 3FMCA 5KHQA 1AW7A 3T16A 2AQ1B 4DV7L 1TIID 3ZGZA 4WAAA 3S17H 1TWCH 5JXVA 4CJ0B 2YU9H 2WB1G 4I6PA 1A62A 4IUTA 2F0EA 5IGCA 2B2VA 1TWHB 4G4KA 3DVNV 1IYUA 3Q2AC 1YJ9A 5FKAC 4XDXA 3I4NH 3ONAB 1VJKA 2QIEB 4DHJB 4WQMA 3L13A 1EYDA 3K7AB 1A63A 2W54A 4PQXA 3PO0A 2CQAA 1HEZE 2XWJB 3MHZA 2FBWB 4DK1A 4NJ6A 2OJRA 4HEDA 4A3BB 3BZDB 3NZUA 4XWTA 3Q8CA 5C4XH 5GAEC 3KDFA 1ET9A 1MI0A 1FMAD 1II3A 3JYUA 2AWTA 4JI8L 3EFXD 4R8NA 1YIWA 5JOBA 1AEXA 2Q5WD 1WR6E 1V8QA 5GMVA 5C4HA 1HR0L 1T6BX 1XNRQ 1HH2P 2INDC 2DLBA 3W1SC 4X66Q 2QDFA 3RPFC 2ZM6Q 1J0GA 4RKLA 2R93G 1K51A 2JXMB 1F9RA 2QGQA 5DEHA 3VDYA 1P9DU 4FO2A 2L05A 5IGDA 3A9JA 4GN1A 3QB3A 2E8GA 4QUFA 4HIDA 1R9TB 1U4MA 4X3UA 4W9JA 3D4WA 3RN9C 3KBGA 5I2YA 5M3MG 3CCMA 1VQEA 3KUZA 5HI1A 1L1OC 5LL6X 1HFNA 3EUB2 2YTXA 1ONLA 2P5ZX 2Y5PA 2ZW0A 4ID6A 2BBCA 3HOYB 3VA7A 4DV7Q 2R92H 3ER0A 3JAMi 4A90A 2PZUA 1HA6A 4M8MA 4KKSA 5A2QL 1ZW7A 4A3DG 4DQOC 1L0XB 4MTKA 1KAAA 1IYJB 4MM3B 2PJHA 2B2YC 3I55A 4QCLA 3K59A 1SBBB 3GTGB 3EFUA 3U4EG 1GG3A 1HE8A 1UWMA 3K58A 4KDIC 4P73A 2ZXOA 4B3SL 3R7RA 5IT9L 2N8NA 1QZHA 4G7OC 1VZ8A 4DHJD 5C1ZA 1JWBD 3ZO5B 3V96A 1O7IA 2BE5D 2EJFC 4JI5L 1PH9A 3TEHB 4EZLA 4HROA 1K8OA 3HOVH 1QT9A 1NR4A 2K5VA 3S1QB 4JI8Q 2HHHL 2A6ED 2Z6KC 5FLXc 3J80i 3SK8A 3VYTA 2E2JH 2JA5H 3N1ZC 4L5QA 4ZAIA 4B0MA 1JWAD 2PW9A 1IHZA 3CKIB 3GTJH 3X23A 1HR0Q 4GN5A 2D9UA 4KHZA 2K25A 2PIAA 1IP9A 1AZPA 2WKCA 3KFUA 2HUGA 3CCUA 4B3TL 4DR4L 1V8CA 5G2NA 1LTBD 3PLUA 1N33L 4HIKA 3CRLC 4KD3A 4BY7B 4RWSC 3AB5A 3S15B 1R7SA 2N9XA 4LFCL 4HWIB 1B3AA 5EKKA 4G11A 1WGGA 2B63H 1YMHE 2D5GA 3GTKH 5ELCA 4L8JA 2SEBD 2QCZA 3KDFB 3WDNA 3TEXA 1ENFA 2ID0A 4L5TA 4RMAA 1STAA 2IHEA 1VQ8A 5FLMH 4W9LA 4JI1L 1FNVA 1YHBA 1BQQT 4W9CA 2E2DC 4JWUC 4L63B 4ZK9B 4W9EA 2DY8A 3SR6A 3SHLA 2ZJPA 1F9QA 2B2UC 4DWFA 4R1JA 4B3SQ 1PH5A 2LUEA 1P3QU 3TEYA 1E2VA 3Q0AA 3L54A 2YEPF 4AOFA 4KKIA 2JZPA 3FPUB 1XEEA 4JI5Q 3J81E 2I1KA 1VQHA 3QR8A 1AZQA 4DV4L 3C3LA 3RUIB 2GVBA 1WJ4A 2L12A 5H1SE 2HHHQ 2LI5A 2PMZB 4CJ1B 1WZ3A 2MPMA 1CJEA 1E90A 2JQRB 2L5TA 3TEWA 2BB6A 5JVG3 3ZUNA 3QA8A 2K03A 2XVSA 5CHFA 3STBD 2F3WA 1ESRA 1BDOA 3CQZH 4B3TQ 4DR4Q 3J7AF 4GOPA 1VQ4A 4L5RC 1M4VA 3L3OC 1N33Q 5ELNA 4YWMA 4ZHOA 5L95C 5DPTA 1VQKA 1NI3A 2FCQA 5ELBA 2L7RA 2C5LC 3J81L 4LFCQ 1N9WA 2BWES 3CMAA 3TRZA 4N9F4 1TKGA 4KY6A 4C80A 2GOWA 1C48A 4B3RL 1L0YB 4LF8L 1FL0A 1E7VA 1XPUA 1N6ZA 2KANA 2AUKA 2VXWA 1UWVA 3DCGA 4A3OA 4GU2A 4IDIA 2CR5A 4KTAA 3FRPB 2L00B 2G4DB 3AM9A 4JI1Q 5JH5C 3ETRA 1U4RA 1VS0A 1SAPA 3C1FA 1ZGUB 1NENB 4P1CC 3E6ZX 3NVZA 2L1BA 1JJGA 3TSSA 1EZ8A 2NTSA 4DR6L 3PO2B 4LCDE 1V1QA 3PCOB 3U2SC 1E0BA 4O2DA 1QJOA 3DHIC 3FKIG 1HRJA 2L55A 3OLMD 3RULA 1X1MA 5FK9C 1TT5B 1EWIA 2DY7A 1C0AA 4A3KB 5CV9A 3N1YC 1TQOA 1DM0B 1PMRA 1ZP0B 5BMHA 4MSQB 1LT6D 1SNCA 1ENCA 3CC7A 3M4OB 1QOBA 5EPKA 1KXLA 1Y1WH 2DBYA 5IT9c 1SYFA 2A6HC 3TBIB 5IGBA 4N6EB 2KJXA 4LWCA 1G91A 1E8ZA 3ENEA 3I63C 2O4XA 1ISNA 4TVAB 4IOCA 2JA8B 1E7UA 3E9SA 3CCLA 5EPJA 1K0RA 3IG3A 4UP8A 2OCEA 2XSCA 4AS1A 2CVRA 1HZ5A 3RT3B 2PZTA 4IUQA 2B76B 4HR7B 3EBEA 3MAQA 2IGHA 2CJOA 2BGFA 2A4ZA 2J4XA 4G0NB 5D6JB 1ML0D 5BN3A 3SE0A 2Z4HA 5J39A 2K9XA 1VQ9A 4B3RQ 4LF8Q 1M90C 3Q8FA 2V3PA 4A3EH 1PYWD 1EYCA 2EY2A 1N61A 3E3XA 5GADC 4ODGA 4GNXC 3OAWA 4K3CA 1KL9A 1YNND 4DAPA 4RF1A 3UINB 1LM8B 3QJYA 4Q0FA 3VHTC 3RN5A 4NW2A 1WVLA 2JA6H 4XT1B 2INPE 4DR6Q 5K36G 4GOPB 3VR8B 1CK1A 1IPGA 4I6LB 5JPMC 1E0ZA 1PZKD 2UUCL 1I4RA 5GAHC 4P2CB 4A20A 4XYOA 4A93G 4BKSD 4IZ8A 1RLFA 2MBBB 3Q8BA 4I6NB 3BJUA 4FULA 4C7ZA 3OHXC 3H0GB 1RTOA 3PIOA 1ZUD2 5C3EH 5EE3A 4EE2A 4KD4A 3AEAB 2R2OA 1VQJA 3B08A 1SXTA 1CKNB 3KF6B 1K53A 2NPTB 5JHAA 3T53B 2N9PC 2K7VA 1B9NA 2A6EC 1WE7A 2EE1A 3UF8A 3HOUG 4X65L 1HZ9A 1LLRD 4DXAB 4C3JB 1JB7A 3P63A 1WRDB 2YV5A 4GS3A 3EJIA 1BOSA 4RM9A 2KWDA 2WXJA 4K1RB 1HA5A 3M4PA 4X3TA 3NTKA 3K7AH 1VQ6A 1S3SG 1Y69U 2KTRA 4HEA1 1MI2A 2GBNA 2EDGA 1OXTA 3I4OA 1PGAA 4A3BH 1FCCC 3OG5A 2RKSA 5IWAL 1WMHA 3OW2A 3MC8A 4TQ1A 3U58A 1F1HA 3MXGA 3GTQH 2DYBA 4GKJL 3X0WA 4KV6A 1EY9A 5EKLA 4YTMB 3W9CB 3J81c 2JXXA 4HSPA 1OXSC 1SNOA 2JUOA 1T0RC 3N20C 5BMIA 1IL2A 1RRBA 3PTFC 3BG3A 1XF5L 4OONA 2EOTA 2ASBA 2BKRB 2RF4A 3R2TA 2X6LA 1KD1C 2UUCQ 5BMGA 3ND8A 5BN4A 1HUNA 1R4MB 3ZYYX 1R9TH 3S16B 3OMGA 2QSDA 3SD5A 3ML9A 1Y8NB 3NELA 1B3QA 3NG0A 3UI2A 3X3MA 2KC2A 5J17A 3PRZA 3VUXA 5LHY1 1QZGA 1BCPB 2KWUB 2KHWB 3GTLH 1FFVA 2VQEL 3JW0X 5D2MB 1XYIA 4LDTB 4HN7A 1C4AA 4JI6L 1WGDA 4A3MH 3HOYH 1VR9A 4Q2JA 1CKOA 3JC66 5FO8B 4K0KL 2IY5B 3I4MG 1BMLC 3W1YA 3SHQA 3OIPA 4X65Q 1STNA 2LVQA 1LTID 2MFIA 3SK4A 4HCEA 4L6TB 3STBC 4MN3A 4P6VF 3PUVA 3W1SA 3GTGH 3GTPB 2J52A 2XK5B 5JEAG 1SJED 1Z7TA 3GOEA 4WJQA 3L16A 2V0GA 2G9DA 2GI9A 2ONQA 4RM8A 4NNJB 2MHVA 2IYDB 4KHVA 3CC4A 1RYJA 1Z5SB 5IWAQ 1WGKA 1PFMA 2BH8A 1TWGB 3G6JB 4YCWA 5C0XG 1U4LA 3L2PA 5IYDH 2MH7A 3D32A 3OJ4B 1L1OA 4GKJQ 3AE5B 2JSVX 2VQFL 1TWFH 2E3TA 1NMFA 3S1QH 2L8JA 1GUOA 1I94L 1PTOB 2LMCB 3RMKC 2WP8J 4OEMB 4TQUS 1SE9A 1KDAA 2SOBA 2NVQB 3TEZA 2VUMG 1YJWA 3IL8A 4JC0A 3CF5A 4R4CA 2K5DA 1P0RA 1I7HA 1ET6A 1F9SA 4TSSA 5CX3A 2B2YA 1GKHA 1X6OA 2YU9B 4DNRB 2WXRA 3PS6A 4LF4L 2G5DA 1S72A 2W9NA 3H3VC 4N59A 3SEBA 1T9HA 3H3VI 4BAXA 1OO9B 1UELA 1WYGA 2YVCA 2VQEQ 2ZPNA 1BCPD 1EWCA 3DM1A 3MEFA 2JA7G 1D7QA 1WMHB 1DOLA 4JI6Q 1UE6A 5D94A 3K8AA 1M8AA 4RHSA 4LDTD 2HJ1A 1W3SA 3RNBC 4K0KQ 4MNOA 4US9A 2Z6KA 2OTJA 2Z6BA 3A0JA 1MBYA 3OWEB 4AIMA 2Y5CA 1QOHA 2K04A 1U5KA 5DCNA 2VY3A 3IFTA 2R7ZB 3AEEB 5BN5A 2UWQA 3H3VH 3NXWA 3CWIA 3WAPA 3D4RA 4JK1C 4K6DA 3HIZA 1FVIA 3BWUD 4LMQD 2N7JA 4FHJA 1JJCB 5ELEA 3AEGB 2L4NA 1IW7C 3BU2A 4YWGG 3P1HA 3RLNA 3UQAA 5J3BA 5IYCG 2EYPA 2UXDL 2D3AA 3S1NB 1C7YA 2DZIA 2JRHA 3Q3NC 3T51B 5LXIB 4FF4A 3KUDB 1K3BC 1I94Q 1QCBD 3PUXA 2FXQA 1PTOD 1CA5A 1LFDA 1DOKA 1OFFA 2B2TC 1EY8A 2WAQB 1MKHA 1YNNC 3VTUA 4BBSG 1Q8IA 1SMYD 1Y14B 2EJMA 2M9VA 5KEEA 4US8A 1WTXA 4CGYB 2BDOA 4JE3B 1I3QH 1BVSA 2JU6X 2KJHB 2KAJA 1BUVT 4A75A 4LF4Q 1JOQA 3Q23A 2B2WC 1A0IA 5J1ZA 2B2UA 2RCFA 1QLBB 4OGQC 1UD7A 4C7YA 3TP8A 3IRBA 2KX3A 4E71A 4DKAC 3EC8A 3OW7A 3KH0A 4UDUC 1D6EC 2K5QA 2LASA 3MFYA 3HVDA 1C4QA 1T5EA 3TP7A 1Q1OA 3K7UC 3BK2A 3T13A 2IX3A 1QVFA 3AI5A 1TYGB 4BWGB 3MC9A 4KKJA 1I4HA 2V3NA 2O2LD 1E7ZA 3E9HA 5CV5A 2DYOA 3MXNA 4GIVA 5AFWA 3E5SA 3HOVB 4YXDB 4BY1G 5FO9B 1A3VA 1E8XA 4IM2A 2KHIA 2A1AA 4C1NK 3GTMH 2JA5B 4GDLB 4B9KA 2E2JB 2DYMA 3BVGA 2L0FA 2LY7A 3ML8A 2BA1A 2K14A 2F0OA 4HMJA 3ZIMA 1BBUA 4IFDG 1I5FA 3V6CB 4A3LG 2PNRC 4HIMA 1B2TA 1ZXHA 5T1GA 1X3PA 2WS3B 1FIQA 2L9HA 4IUMB 5I4DA 4HCPB 4J1MA 1H9RA 1WCMG 4A3KH 5C4ZA 1K8AC 2KFKA 3M63B 2UXDQ 4JCVE 2UXCL 2D3BA 1YQ3B 2F0SA 4RGTA 3GTKB 3EHVA 2RDHA 1WTHA 1BCPF 1LTSD 2Q8RE 3CPWA 1JE4A 2L83A 1U4AA 1E7PB 1QQRA 3ZRCA 2JA8H 1X32A 2LFNA 4LUVA 4LNNA 1Q82C 2R6GA 2PVOD 3S1MH 3A7LA 2I07B 4C3IG 3IBEA 2O2VA 4F88A 2WXPA 4HSVA 2OT2A 4HXDA 3GQBA 1T0QC 4W9HA 3VR2A 2J0JA 3D3RA 2NBUA 4RG1A 3HHMA 4FDBA 3KVFB 3L7ZC 4E74A 5FR3A 4IPCA 5BR8L 2N9KA 1OTRB 3GE3C 2R7FA 2QW7A 4FF2A 4RAUC 1MFWA 2KDBA 5CMDA 1V43A 5J22A 5LMNL 4B9XA 1PGXA 2NUCA 2K4KA 3NWTA 4BXXH 4HJ7A 3NBHB 3R2IA 4PYZA 2WXGA 2KO3A 1RFAA 2J42A 2NR2A 4OIKA 1YQ4B 3GB1A 1EUJA 1UNSA 5CV4A 1E8WA 1JRUA 1J19A 1B50A 2WFWA 1PTOF 4A3GB 3DWMA 3KWVA 4A3IG 5G3LD 2VRRB 1CSQA 2LXAA 2WXQA 2L32A 3CQZB 2N0SB 4HK2A 5JAVA 3HOZG 1CT1D 3M7NA 3L9AX 1NBWA 2V4LA 1Q7YC 4DR7L 2G4SA 2I5LX 2F0WA 2XIWA 5HGQA 2UXCQ 3B1LX 1WTOA 4OO1I 1J8IA 2PCFB 4MZ9A 4MJSB 5IGGA 3TQYA 2AMCB 5GAGC 4A3DB 3RLOA 4Q5VA 4M01A 4PG3A 2CW0C 3BDCA 1O7YA 3SK6A 1WJUA 2K01A 2KYWA 4H02A 2YTYA 2PMZE 4C3HG 3GD7A 2EELA 4JL9A 2XTIA 5F2DA 2QHOA 4IWQA 4OXPA 3CU7A 2H88B 2FE8A 2KVRA 1QKZA 2BA0A 4AH6A 3E56A 4QQBX 5KNDA 1MHHE 3WCQA 3CF6E 4FJVB 5BR8Q 4HJ9A 1YJNA 2KFKB 3I70A 2I46A 1Q1EA 2KUMA 1YIJA 2BS4B 4DAMA 1TY0A 2NWGA 4M02A 1V9PA 5M3FB 5LMNQ 5FLXE 2GBMA 1G8ZD 1FEHA 2N88A 2FCMA 3AH7A 2GLSA 1Q8KA 2K75A 2UUAL 3I4NG 1NNXA 2KK8A 5IE8A 2AWNA 5DM73 2IPKD 4OVVA 4OZBA 1Y1WB 4OWTB 2IDYA 3NZSA 1K73C 2D62A 4YY3Q 2PPBC 2WQYB 3NTHA 4MGKE 3ALBA 2O2VB 5C4XG 5E6JA 3NEMA 2KENA 2N49A 2VS1A 1MVKA 2Q2HA 1WFQA 1HQMC 2D0OA 3S16H 2KTFA 1LV9A 2GRIA 3R3MA 4USAA 3RNAC 1HPCA 3L4PA 2PLPA 1CM9A 2OXPA 4H2AA 3HOWH 4DR7Q 1K52A 3NPPA 2NVXH 2MHJA 4L1BA 3BK1A 2EJGC 5IYBH 4M8NA 1KLUD 2QDLA 1CMXB 3N6RA 1YNTE 2D2QA 1SYGA 2QF7A 5ELFA 2IO3B 1UGMA 4WJ4A 4OWXB 2HIVA 5FJ8H 3S14B 1K8RB 3K0XA 3JAML 3K81C 2WP9B 2DJGC 1F2ZA 1Y8OB 3QC8B 4II3B 4FNFA 3J80E 3GTPH 4GLSC 3J7AV 1SSNA 4WJPA 2WXHA 4CBVA 4W9KA 1YI2A 1GB1A 4MM3A 2XN9C 1TS2A 4RCNA 4X66L 2DNEA 5H8YE 2D3GA 2R92G 5G3LF 2C35B 4IM0A 4ABNA 4DHZE 2JYOA 1ASZA 2RSUA 4JWSC 1D4BA 1G6PA 4A3CH 1SSOA 4OZAA 4H7BA 3AE9B 3AE2B 1SYEA 4RCOA 1PTOH 1GUAB 3T3NA 1KDCA 2UUAQ 1SNQA 3M85A 5LL6S 5C3EB 2KJRA 2NVQH 4GNXB 3J80L 5HGTA 2LGYA 1AE2A 3W3AA 3SGIA 1SYBA 3VA5A 1VQNA 1XT9B 5DM63 4A3FG 1QF6A 3G4SA 2AHOB 2L76A 4PS3A 3A8KE 2ZJDA 4B0EA 4AWJA 4KN7C 2NVUI 2KCCA 3B2GA 1H8CA 1XMQL 1YEZA 1Z6HA 1YJ1A 5KRUA 3SDLC 3H09A 4C56C 4EGVA 2G45B 5IY0A 4BS9A 4WH4A 2RDGA 1UBQA 2XGTA 3CCSA 1WFYA 1MJDA 2KWVB 1KM7A 1JQ4A 3CSFA 1GPXA 2AEHA 2BS3B 4DK6C 4CDCC 3E0JA 1H9KA 2E2HH 3GTQB 1U4PA 2NZOA 3WOFA 1PGBA 2CHZA 3ECIA 2B3GA 2MO0A 4EFOA 1TU2B 1Q46A 2A6HD 3BS1A 3KLRA 4RFBA 1XNQL 2R7ZH 2LHEA 4DA2A 2B63G 1CZGA 4A55A 3U50C 2C7MB 4DPGA 2RSNA 1B44D 1STYA 1QZEA 1XLPA 3L17A 2VH1A 2ZVOA 4XX5A 5A2QE 4AQ7A 5C3JB 1T0SC 5FR6A 4CHTB 2EY5A 3N1XC 2RHQB 2QCPX 3HKZG 4GSWA 5KYLA 3RNCC 3T4AC 1P98A 3S1NH 2CU3A 4NPNA 4ILWA 5EJWA 3CAMA 1NE3A 1LO5D 3DHQA 4LAAA 3KW5B 5IT9E 3K80C 1BT0A 2C9OA 1Z9FA 4UP7A 3MFGA 1D8LA 3GTLB 3TMPB 3WAMA 2LGIA 4A3MB 2KD0A 3UIOB 3I91A 4HJ8A 4ME3A 1A5RA 1AWDA 2D11A 3CD6A 1T0YA 4PZ8A 1B1ZA 1DJRD 4K7SA 3A5UA 4NAMA 1NYQA 1C3TA 1XMQQ 4EOYA 2IL8A 5IP7H 3UDGA 2NN6G 2OQ0A 1KH0A 2DX5B 1PH1A 2XBBC 1D5ZC 2G3QB 2F0PA 5C3XA 4YTPB 2ENBA 2HDEA 2JX5A 2DZKA 2M4NA 4KSKC 3DLLA 1ILPA 4DBGA 4LFAL 1N34L 3PF5A 3I72A 3DVGX 1YNJC 1IZ6A 2XWBB 4ZRKA 3RLFA 2FMMA 4TQ0A 3AE4B 4B9WA 1EQTA 2PE6B 3QIJA 3ZJUA 1TWFB 1YOVB 3I4LA 4IURA 2HIXA 1ZE3D 3VRBB 2B2TA 2CWAA 1XNQQ 4YCUA 1MSHA 2CH4A 1PRTC 5EGTA 1VCIA 4Y52H 3SVMA 3ZJTA 3NWSA 4HJ5A 1L2FA 2R2QA 4XYCA 4IUPA 2Y0SE 4H13C 1F2MA 3VR5A 2B2WA 4DNTB 4IALA 1L5PA 3AEDB 1EFWA 4EQ5A 3HUIA 3JAMc 5LMUL 1DD2A 3BYYB 4ITKA 4WFN3 3DEOA 3K5MA 1N5XA 1EYAA 2K8HA 3AXCA 3DHHC 4BKSA 4CHKA 1WTVA 1TVXA 3QARA 1HFGA 4J3OD 4LUZA 2FIDA 1LGRA 2Z1CA 4K5VA 4IJLA 5JJLA 3M4QA 1IYVA 3PSIA 2CHBD 4C2MB 1YZ6A 4K14A 4HJGE 5DPSA 4A3PA 1PH3A 1KTKA 2IX0A 5JJKA 2VH2A 3U7ZA 3AFPA 3GZNB 1KNEA 4K5XA 3FP9A 1VDVA 1R4PB 3PO3B 1I4PA 4AYBG 1Q0WB 3MJWA 2B29A 3NVVA 3J80c 4DGZA 4MDKE 3KUCB 1LT4D 1PFSA 3A74A 3NOBA 1WD1A 4UY8C 2MLBA 5IO9A 3IAS1 1WXSA 3ZXRA 5CR3A 4QJFA 5LNK1 4LFAQ 1N34Q 3VTVA 1IBKL 1SN8A 4R8IA 5L83A 1B9RA 2ZXRA 5DLQE 1VD2A 5TR5A 5D3IB 3VDZA 1D5MC 2WKDA 2EKEC 3O65B 5D3DA 3DVNU 2WGSA 2CCZA 3QJZA 3RZWC 1CZPA 1N32L 2BDNA 3VYSA 1HHVA 2V1YA 3DWQA 2RDFA 2UU7A 1VQLA 3ITPA 1OTCA 4YIJA 4A3GH 4WWNA 4MGZE 2N7EA 4ANXA 4LF6L 1EZ6A 1F2LA 1PYBA 2ON8A 4A3EG 1I50H 1RM6C 1VMPA 2WX0A 1I3QB 5LMUQ 1ZOYB 2IX1A 1K3RA 2JYEA 2MBQA 1UBIA 4CKBA 3Q3OC 2CHXA 1SJHD 2Q8TA 5I9OA 3I4MB 2Q8IB 1KHIA 1EQVA 1PVOA 2K32A 4A3DH 1XD3B 2DGYA 3P20A 2FJ2A 2JA6G 3HRDD 2PQEA 4RNAA 5I9PA 4C4VB 3BDLA 1VDZA 3EA6A 4DNIA 2JWUA 2K39A 1CKNA 2XRSD 3CPFA 3KF6A 5JEAJ 4JYAL 1C76A 3NENA 2KCNA 1JORA 2CHWA 2NPTA 3UGBB 2G9HD 1VZ6A 4POGA 2WAQE 1X9NA 1HNXL 2V3SA 2DWQA 3AV8A 2KKCA 3GTMB 5C0XJ 4N8FA 4BZAA 3K5NA 2OWOA 4G50A 2NB0A 1J9OA 3ZXVA 1UZXB 4QF4A 1EQRA 1H4RA 3W2DA 5J2RA 2WINB 1R4QB 2WU5B 3VUYA 3F8TA 5M3FH 2ZTCA 3Q22A 2ZT9C 1IBKQ 3SFEB 1Y1VB 2R3ZA 2F0UA 1G51A 1GUNA 1XQQA 4BOSC 3HEJA 3EGRA 2HCCA 1HR0W 1YN5A 2K8CA 4D2KA 1N32Q 2NYZD 1N36L 4DR2L 1A2UA 1QG7A 1OEYA 2O5JC 1WJJA 1EL0A 2KQ3A 4ZLTF 3A8IE 4A3BG 4M1UB 3KF8A 4EX5A 4ACFA 1NJIC 4E3CA 4LF6Q 3U4ZA 2TSSA 4ZYSA 1SYCA 1SYDA 1U9RA 2J7QB 4LK0M 4G7ZC 2NBWB 1Q90A 3S1MB 5IP4D 4P16A 1FO4A 1F9PA 3DQVA 1WTQA 2WXOA 1AYFA 2N78A 2GBJA 3BINA 1IBXB 3KYCD 4QB4A 1VMCA 1VCBA 4CKEA 2Y3AA 4DHZB 2F52A 3AECB 1PFBA 1IW7D 4XT3B 2RD0A 2HTME 1QOAA 2L0TA 3PGEA 1MHXA 1X65A 2SNSA 1YD8U 1LTTD 4DAYB 4JI0L 3S14H 3KJOA 4JYAQ 4CKCA 3NZ3A 3DPDA 2LSSA 1EYGA 4BBRB 2BF8B 4NB3A 4DR3L 3CCVA 1FFUA 2J0KA 1FD7D 2F3VA 1HNXQ 5GROA 3W5OA 2KXJA 2M19A 3NVWA 3M4YA 3Q8AA 1KAWA 5EKIA 5KHOA 3IAYA 1KFYB 4KGTA 2RHSB 4J8QA 3HOYG 1V49A 1J5EL 5ISRA 2XK5A 1Y8RC 4QL5A 4ZCKA 2N9EB 2K6AA 3AQQA 1XJVA 1WR1A 2FUG1 1LQBA 1VF7A 4V190 2HJ8A 1RJTA 1KOTA 1D5XC 4DV3L 2LFIA 3NK9A 2KOLA 2JWZA 3BZKA 4FXGC 4HVBA 1MPEA 1L4DB 1PXUA 2JP1A 1N63A 1P1AA 2DAJA 4KHPL 1IGCA 5AZGA 1LACA 2H1EA 1N36Q 2LMCA 4DR2Q 1SGHA 1X3QA 2NBFA 2UU9L 4FN2A 5D7GA 1KJTA 2KMAA 3AEBB 3Q8DA 1XPRA 1T3QA 4FA6A 3W1GA 3TREA 1GHKA 2QEJC 2GMIC 1CHPD 1CQFA 3IKJA 3TBLD 3MHBA 3QCAA 4JG2A 5KIXA 1JT8A 3KQ4A 4KGRA 2EKIA 1GNUA 4M0WB 1KQSA 1S40A 2PPHA 2ICIA 5G5GA 2JQOA 3D6WA 3CC2A 1C8CA 4G57A 5FOBB 1VQMA 3LDZE 1ZXTA 4LF5L 4BY7G 4JI0Q 4KX6B 1EWHA 3ZNHB 1JWSD 1NCVA 4YCVA 5M5WH 4IFDJ 2IGGA 2L52A 3FKIH 4DR3Q 1ZDVA 1H9MA 5K5PA 3KF8B 1K28A 2Z4IA 2GN5A 3U8ZA 2DZMA 3AULA 2WYQA 1O7LA 1J5EQ 2F1MA 5BYQA 2FMCA 1VQAA 3J7YW 4JLCA 2I5MX 4PS8A 5G5HA 1PUTA 3W5UB 3DUZA 2M8SA 3NQIA 2REXA 3P4QB 3Q3JA 2K5NA 2LJ5A 2D2CC 2YTVA 4DV3Q 4AJWA 2PW7A 3A5ZB 3LGJA 1UGJA 4X62L 3HOWB 2NVXB 1M94A 1TS4A 1NTGA 3D8GA 2LZ6A 3ONSA 2F4IA 4KHPQ 5EE0A 1TJEA 5LLIA 4ARCA 4OL7A 4GKKL 2IO1B 2QEXA 1HTLD 3Q69A 5T8IA 4FBJB 3BDOA 5BYRA 4K3BA 4NXML 2UU9Q 1IUEA 3ZNGC 1ZDXA 4LJPB 2K5PA 3VYRA 3FHWA 1RD9D 3A56A 2MJDA 4N9TA 5CHVC 3ZVVA 1DGSA 2R7DA 4FP5D 2EZVA 3L10B 4YL8A 3C2PA 2XNAC 1K8GA 1UE5A 2Q2UA 3ABVB 2YYZA 3C46A 1WSPA 2EYLA 3B0AA 3HVZA 1SE8A 3KYDD 2Y0SB 3WIMA 3KJPA 3AEFB 1A70A 1SE3A 2LGSA 3WANA 3A8JE 1WJ6A 3IT6B 2I5HA 2K05A 1QOGA 4HPPA 4RGNA 2BVCA 4K6LA 4LNKA 4IOIE 1JB3A 2BYFA 3OWFA 3K9OB 1X56A 4LF5Q 2JZ3B 5K36H 2KBNA 1WXMA 2WXNA 3TJPA 1LABA 1WYDA 2CW0D 2C9WB 2RR9A 3N3KB 3TZDA 1JWUD 4MHEA 4A93H 3Q3FA 1PLFA 2KVZA 2OQKA 3C19A 3T1HL 4NJCA 4ICVA 3X3NA 1S1QB 4GLXA 3H7PA 4GDLA 4KY7A 5E6PA 1DOXA 2WXLA 1LTGD 1K83B 4LFBL 3GZNI 4RF0A 5DPRA 3J81j 1E24A 4CJ2C 3NP8A 4TRDA 1MG4A 4MH0E 2WHIA 1E6EB 3HFZB 4EVOA 2W55A 1TKEA 2KOXA 3TN2A 4OHJA 3NBIA 4C3HB 3MTSA 4X62Q 4Z9CB 2F0TA 1A3TA 2RPVA 2V4DA 1H9JA 3PO2G 1IKMA 1WIAA 3R66C 3PZDA 4GKKQ 1V86A 1CTMA 4C2MH 3QWZB 3DBHB 4NXMQ 2GBKA 2MRPA 1WOCA 4YWKA 4RA8A 4N8X1 1D1KA 4XDDA 2E2HB 2IJ0A 2LXKA 2HDMA 2JK8A 2NZHA 2RSOA 4FF3A 1J7BA 1P16A 3PIP3 3PO3H 1VRAB 4ZOHC 1NUCA 2LD9A 2MX2A 4HPLB 4IPGA 2KMMA 5GQOA 1HZ6A 1Q3LA 4S3SA 1F2RC 2C5CA 3C1EA 4JI7L 2PQAA 3HOXB 1F2RI 2PI2E 3PGZA 1ACCA 2JA8G 1FR3A 3PRPB 4GB9A 2BQQA 1EM7A 2G1EA 3QQ8B 4JQWC 3CHBD 4LK1C 2F0NA 4I65A 1VQGA 2HQEA 2IGDA 2DNFA 2F0VA 2ASQA 1CZWA 1CA6A 3I2ZA 5E4WC 1P7FA 1ZYRD 2KCTA 3NTIA 3EQLC 3QOJA 4CQNA 5J18A 3NBHA 3T1HQ 4R4IA 1WTPA 1UH6A 2KX0A 5KNBA 3RZFA 2EMSA 2WV6D 3EROA 3F2BA 3GE8C 1STGA 1RCVD 2PZWA 3SFDB 4YTNB 4LFBQ 1PH6A 1V5OA 1A8VA 4BXXG 2A68C 3NSWA 2VZKB 1RFKA 4WWOA 1D2BA 5C0XI 2H5XA 1OQQA 1V1OA 3I4MH 4KZCA 2KJ6A 3PPAA 4X3KA 1JOOA 1PZID 1E1TA 3NS8A 1E10A 1PH7A 2ZVNA 2IZVB 3CSTA 5FO7B 1DXMA 3TP6A 1V81A 4MJSA 4W9IA 4DDGD 1NY4A 1BUIC 3H1UA 1WZ0A 1QWYA 4XDCA 5JZEB 1Q1BA 3CCJA 3H0GG 2AQ2B 3RD4A 2F0LA 1L0WA 2I38A 2JVCA 1ZKOA 1EIHA 1ENAA 2VB2X 2N4FA 3H7PB 1NAPA 4X3SA 2O6VA 4JIOU 2RCNA 2E5LL 3VH4B 4OVUA 3A55A 4A3JB 5DAUA 5HY6A 2MWSB 1S5CD 1SNMA 4JI7Q 3APFA 4MELA 4O0AA 3RUZA 3PHWB 2RGFA 3S2DB 1W2BA 2LHDA 5HURA 4C3JG 5C44G 2KHSA 2VUMH 2W3RA 3DWGC 1Y1VH 1N8RC 4IQZA 1CFMA 3PMFA 2N7DA 4ZRQA 2V1CC 3DM3A 2E6XA 2KLGA 2WB1B 3I3TB 2E76C 2JN4A 5E4XA 2L0CA 3M7GA 4GDKA 1EQQA 3VVWB 2K50A 1KIXA 1N5WA 1PRTB 3VXWA 1D3ZA 1J7CA 3J7A5 2JYTA 1EY0A 2OTLA 4PZ6A 5CORA 5IKCM 1GUWA 1LT3D 3BYTB 2ZXPA 1KABA 3TIXA 3OYYA 2VZKD 4TMAB 4K81A 1ICWA 2JEAI 4AP4C 1YITA 3QG1A 2PQAB 1LYLA 1E2ZA 4DV1L 3PRMB 3CMEA 4ASWC 3QIAA 5T1IA 3T1YL 2N9LA 3NJTA 1C77A 3L0WB 5EBDA 1W6KA 5IAAC 1TKWB 3TS2A 4KDLB 4MT5A 1I6HB 3EVQA 2E75C 4HMIA 1WY8A 4BBRH 1JWMD 5JPNC 2R93B 4FJZA 1XXGA 1XLNA 5DNFA 1QOFA 1F52A 4F8CB 1SROA 3GO5A 1BBWA 3PV0A 4FADA 4WJNA 1HQRD 2E5LQ 4ICUA 4YY3L 2YLMA 2AWOA 3UQBA 5M3MB 1E9MA 2EXZA 4ZYNA 2X38A 2ZPYA 1PQSA 3H6NA 4XGAB 1I50B 1CUKA 3VH3B 2BH2A 2PW5A 5AEKB 2DUDA 3AFQA 4BBSH 2LGXA 2A69D 4ULLA 3WAOA 1K9MC 1BKBA 2L3ZA 2WIIB 3SU8X 2IW3A 3K5LA 3RZOH 1D1IA 1J7AA 2ZJRA 1YNJD 4HCNB 2A5HA 1EUVB 3AE6B 1WH3A 1YN4A 3MEHA 1HZBA 1RDPD 2NVYH 4HJAA 4GNXA 3C8YA 3NHHA 4OZCA 4YWLA 1PRTD 3V2TA 3PUYA 4RGOS 2O6VB 4DF7A 3M3YB 1Y56A 2EPBA 3CCEA 4AJYB 3I56A 3Q3MC 5E6OA 5AZHA 4CDEC 1IL8A 2ZTEA 4DV1Q 1HTPA 4OO1H 1K8MA 2NMQA 2WXIA 2ZJQA 2PI2A 4BY1H 2MJ3A 3FKYA 2WXFA 4W9FA 2AQ3B 3P42A 1G291 4IO9A 3T1YQ 5LXHA 4DV0L 3KK7A 1HNWL 1YJIA 2QMTA 4YSXB 1SEBD 4NZLB 1BXTA 1RF2D 4KGSA 3V60A 4A3LH 2PVGC 1KLVA 1EEID 3F2UA 2CJNA 5IP9H 2FNJB 4M00A 2H4OA 3WOEA 3AYHB 4GDKB 4GGQA 4NAWA 1MIUA 2X8XX 1Q12A 5I2XA 1S5FD 2QC8A 3P2BA 2KECA 3AMZA 3JAME 2J7ZA 3MZ5A 3PUWA 4TKOB 3A9KB 2LGDA 2JXTA 2PEAA 3WWVA 2CWPA 4F7XA 4X6AH 1FNWA 1DYQA 1SNDA 5NUCA 2JZZA 4PS7A 1WYWB 4UAIA 2HE7A 4FVMA 3KYHC 2BYEA 2DHZA 2ZTDA 2M2LA 3M9BA 4M8AA 1ICFB 4DV6L 2MBEA 3N9YC 3QX1A 1EOTA 3NQTA 3A54A 1UE7A 2Z0SA 3S24A 2BS2B 4NY0A 2VZAA 2UXBL 4N58A 4IUNA 1ZYRC 3PVLA 1GB4A 1Z47A 1WD0A 1T5XD 3W5VB 4HAEA 2VNUD 1NDDA 3ZW3A 3LWUA 3RNFC 2BWFA 1PFNA 2AKWB 4PNYA 4PMBA 1O7ZA 1AE3A 2WDQB 2O6VD 2IWHA 2E2IH 2WNMA 2QILA 1TY2A 4NXNL 1GHJA 2M00A 1FD6A 1I4GA 2A73B 4KSLC 2WAQG 3S1RB 3HM6X 2KT7A 2F0IA 1FYCA 3HP3A 5M5XB 3TS0A 4DV0Q 1HNWQ 1YNXA 3R3OA 1DONA 3VR9B 2LS01 1EIFA 2JY6A 1SIJA 4EZJA 2IHFA 5IP7G 2PTLA 1H95A 4OIJA 2OHFA 2V9HA 2D3CA 5CGKA 3HOZH 4FXCA 4HDQA 4EZKA 3DBHI 3PSEB 3HGBA 1RODA 1E3PA 1I4XA 1GD7A 2NTTA 1K83H 1UEBA 3I73A 4MSMB 4JI2L 2RQXA 3H91A 3PF4A 4KN4C 5IN7A 3ULLA 2UUBL 1PRTF 3HOVG 1KF6B 2MNAA 4EQNA 4F8MA 2EY6A 3URYA 4IUVA 4H0LC 4C3HH 2JA5G 4IPHA 4DV6Q 4LF9L 2EIFA 1EF5A 3DXJC 4XYQA 5EQ0A 3AN1A 3I57A 3CIRB 3T8MA 4EEWA 4PT5A 1S5BD 2PKOA 4WQOB 1YBYA 2F0QA 4F7ZA 2JSOA 3WALA 1LTLA 2Z0EB 4HJKA 2UXBQ 5BYSA 1UE1A 1WRIA 1TGZB 1TKYA 1QB5D 3E9IA 1PH2A 4P7IA 4NAWB 5DPWA 4REZA 3GV6A 4K5WA 5M5WB 1C9FA 3FKIB 2IT1A 3FPPA 1PV4A 3MTNB 1BBXC 4HDOA 5AUKA 4NXNQ 4ZRIA 1IXRA 1QUQB 3DHGC 1AN8A 2EMTA 3HOXH 3VUWA 2F0DA 1Q86C 3SDZA 5LMNW 1ZKHA 5FLMG 2SAKA 4R3DA 2MGSA 1GJZA 4F1SA 2RPQA 2LXJA 2F0HA 1SF0A 1QVCA 4KIKB 1ASYA 3LNNA 3ZRFA 4TKNA 1VQOA 1JJ2A 3PZ7A 3GDEA 2OEOA 2KDMA 2NVTH 2CKHB 2DAFA 1B53A 4BBNF 1RL2A 4FXDA 1WF9A 2KDFB 3H94A 2WX1A 4WJOA 1O78A 4WURA 1WXAA 4JI2Q 5IOCA 1SE2A 2LRWA 1PDXA
chains in the Genus database with same CATH topology
1QE6A 2PMVA 2B8FA 3OSOA 1XX8A 3TMEA 5EBCA 2F0FA 2PYKA 5GXGB 1VLBA 5C5LA 1V1PA 3HS0C 4KY5A 2MUYA 2A69C 1W6JA 4XE0A 2WXKA 1C79A 2LEKA 1XLQA 3GS2A 1GXDC 3KUPA 2EVBA 4KKTA 3NRZA 1YN3A 2I2YA 5IGEA 2VB3X 4A93B 3I90A 5I6WA 2K3UA 5C2TB 1AFPA 3K5OA 3VYUA 2B8GA 3R93A 3ZQ4A 2K28A 1FCLA 2KEDA 2EYJA 3HOUB 2F0GA 1HCZA 4XQQA 1MSGA 1GUSA 2F0JA 3RFZB 1I6VC 2GA4B 1GUGA 3NS1A 1LTRD 3SR1A 4U673 4A8XC 3T56B 1DOIA 3MJ5A 4ZKBB 3CRKC 3ND9A 2MEKA 1EY5A 2RA4A 1IBXA 1OQRA 4A6QA 4OVZA 1STBA 3KBXA 4XQNA 4JBWA 4WIPA 3TUOA 3AU7A 2KEEA 4QUCA 4DAYA 1UWXA 2QKIC 3HZXA 4IKGA 3AE1B 4YSZB 5IIFA 2K33A 2QDBA 2NN6I 1SDFA 1EIGA 4MH8A 3I9V1 4K2KA 2LUMA 4LTUA 1L0VB 1KDBA 2M0AA 1V1PB 3VRAB 2L1AA 4WRDA 3V05A 5C5MA 1C4CA 2NN6H 5CV6A 5E1FA 1QNKA 4ZQ3A 4XWWA 2K1BA 3H6MA 4KKUA 5HG2A 3NUHB 4HKZE 4WAFA 3IT4B 5CC4A 1RTNA 2BW2A 4JX1C 4M0WA 3S2HB 3GP7A 4R9WA 4DK0A 2ACZB 1V97A 4G7HC 4NDXA 1EY4A 2VUMB 1JOKA 4QMGA 2V4IB 1SNPA 1HXYD 5CBAE 4BA2I 2EYOA 4FF1A 4NMZA 1LTAD 3A7AB 2JA7B 2EYFA 2LKVA 1L4ZB 1WXQA 3GV3A 2QJLA 4YT0B 2N55A 4A9AA 2EY1A 1BR9A 3MA2B 2EYHA 2KA7A 3RZDB 3P4SB 4ME5A 4XIGS 3FILA 3VQIA 1A15A 3TDQA 4LLGM 1RHPA 3HG9A 4E6IA 2K0PA 2KVMA 1H9SA 4HKQA 3S9WA 5M9OA 1GAQB 3P4PB 2X69A 1STEA 1QNUA 2KACA 2W3SA 5CYUA 1NEKB 1TZOA 2A68D 2D5DA 2E74C 3MC0B 1DOYA 1TS3A 4BBSB 3GTOB 4J6HA 1ESFA 2OF1A 3Q6SA 3RZOB 3FDTA 3OMCA 3LB8C 3OOCA 2PO4A 1JRPA 4DU9A 2NVYB 5C4JB 1B9MA 2WLBA 1BF4A 1NYRA 1EU3A 4L23A 1F2YA 1EEFD 1GJXA 2SDFA 1HUMA 1IKLA 3AE7B 4HCSA 4BY1B 2BE5C 1DCZA 4ZHPA 1JC7A 3SK5A 3T3OA 3FEWX 4C1NI 2AX5A 1EU4A 3HRZC 4ZUIA 5C44B 1WCMB 4WJWA 1K50A 2ZW1A 4HRSA 3MWYW 3B9JA 1SE4A 4ZKCB 2FFKB 3KLSX 1TT2A 5D14A 1N62A 5HFYA 1A6XA 2BYTA 2L11A 1IGDA 3NUCA 3FILB 4C3IB 3H8HA 1H9SB 5H92C 3FAHA 4EQOA 1G2SA 2E2IB 3P1MA 5D65A 2RBMA 3LX0A 3B2FA 1I4QA 2AUJD 1KRHA 4GZYC 3BVMA 5COYA 1DZ1A 2TMPA 1JROA 1TWAB 3NVYA 1UAPA 3U52E 4IUUA 1DOMA 1AP0A 4A3IB 3MXUA 1ZPSA 3HOZB 3Q8EA 1CI3M 1NR2A 1STHA 3ERQA 3TP5A 3VR6A 3DWAA 5TSSA 2B2VC 4K8IA 1EFID 3AMUA 2DNCA 4K2LA 5JJZA 2A74C 2FINB 4KJNA 1ROEA 5IGFA 2M56B 1LT5D 4BA1I 5C6AA 1Q10A 1Y8PB 1GUTA 2WACA 1PFDA 2RMMA 1YJJA 1JR0D 1MGSA 3LWEA 1XCQL 4FYDA 2XRQD 1BNZA 4KK7A 1MD2D 3S17B 1TWCB 1PZJD 3DWPA 2R61A 1RKNA 1WWTA 1FRRA 3P4RB 1VZ7A 4KI0A 3O13A 1PDQA 4YSYB 3I4NB 3PIO3 1A3UA 4O42A 4ZRZA 1JQYD 5C4XB 2MJ8A 3VR4A 3UI3A 1JMLA 5EPLA 4DXFA 2NVTB 3FC4A 3N52A 1WTRA 1GOZA 1JW9D 2F0MA 1O80A 4H44C 4EQPA 5JVH3 1P7EA 3K6OA 3LYYA 4KMUC 1S5DD 1JICA 1S5ED 4DAVA 5JEAH 3KWLA 4PV1C 3D4DA 1XO3A 2WU2B 3KLSA 3ZJVA 2X6GA 3DEPA 2WDRB 2R92B 5C0XH 2KN4A 3QO2A 1FGBD 5A35A 1SB3C 1G2TA 1NSNS 3VR3A 3MXPA 2Z8LA 4A3FB 2H89B 4RKBA 3QWNA 4DN4M 3OPOA 2ICEC 4FXKC 2BT6A 3DMUA 4OO1G 5KGUA 2K22A 2MJEA 1JCKB 1G6ZA 4NP5A 1SFOB 2KQ4X 4O1NA 2HCIA 2HDLA 4V0BA 5CV7A 3GTJB 3MP9A 1OXXK 3I8ZA 1KLGD 1JALA 2J0TD 2BTEA 3BIID 1E2WA 2WXMA 3U9SA 2B63B 1XTCD 3D6CA 5KNCA 1EY6A 1WTWA 5C3WA 3K57A 1ILQA 3J9CA 4XQJA 2GB1A 4WORA 3HKZB 3P7JA 3IAM1 1EY7A 2BB5A 1FXIA 3K0YA 2OEDA 1OXVA 1DGJA 4N9PA 1S4ZA 5E3FA 3GB1A 5ELDA 5IODA 2J53A 4OW0A 1CQVA 3FVQA 4XTCS 4RGMA 4DXGA 1B4OA 3LXFA 2WDVB 1KNAA 4F87A 4IFDI 4ZUJA 1N60A 3IXSA 2BCOA 4JPSA 4IN3A 3G7LA 5MPOA 4Y7NB 4ARIA 1FNUA 3I3CA 2O5IC 5HHDG 2NZ1D 5M5YB 4PMCA 3P75A 3AB9A 4ZRPA 4IFDH 4WWMA 4RH6A 5KYIA 5CV8A 2DN8A 1FM0D 3MVVA 2F03A 3TZUA 2JE6I 2B39A 1UUPA 2SNMA 1TS5A 1VF5C 1ZEQX 1FRDA 1CHQD 3D31A 1C4PA 1UEAB 4LJZC 1BCPC 4QIWB 1L6VA 5AUIA 3SXHA 1F0ZA 4MIUA 3IFDA 4PMWA 4AYBB 5EE1A 1XWEA 3AE3B 2EYMA 4RHRA 4MACA 2INNE 3OIQA 4DFAA 2JEBI 1L6UA 3AE8B 4I7ZC 3BVZA 3PZ8A 3R8BA 3Q24A 3QOLA 2BOSA 5EE9A 5FLXL 2LJIA 1EWYC 1NVID 4KJOA 4K8JA 4U68A 1ZXIA 2K5WA 5CBEE 2MP1A 4HTHA 1QILA 1PTOC 4A3EB 3V3XA 1BO0A 3PUZA 2W82A 1TR5A 1XCTL 1SMYC 3RMHA 3U9OA 1FXAA 2F0KA 2YEPB 2JA6B 1RWSA 4L2YA 2RVLA 3NE5B 5I6YA 1OXUA 2FHTA 1XLOA 1F77A 4NKLA 4B08A 1C78A 4XXEA 3FMCA 1AW7A 3T16A 2AQ1B 3ZGZA 1TIID 5JXVA 4CJ0B 4IUTA 2F0EA 5IGCA 2B2VA 1TWHB 4G4KA 1IYUA 5FKAC 4XDXA 3ONAB 1VJKA 2QIEB 4WQMA 1EYDA 3K7AB 2W54A 4PQXA 3PO0A 2CQAA 1HEZE 2XWJB 3MHZA 2FBWB 4DK1A 4HEDA 4A3BB 3BZDB 4XWTA 3Q8CA 1ET9A 1MI0A 1FMAD 1II3A 3EFXD 4R8NA 5JOBA 1AEXA 2Q5WD 1V8QA 5C4HA 1T6BX 2DLBA 3RPFC 4RKLA 1K51A 2JXMB 1F9RA 5DEHA 4FO2A 5IGDA 3QB3A 4QUFA 1R9TB 1U4MA 4X3UA 3D4WA 3KBGA 5I2YA 5HI1A 1HFNA 5LL6X 3EUB2 1ONLA 2Y5PA 2ZW0A 4ID6A 2BBCA 3HOYB 3VA7A 4A90A 2PZUA 1HA6A 4KKSA 5A2QL 4DQOC 1L0XB 1KAAA 4MM3B 2B2YC 4QCLA 3K59A 1SBBB 3GTGB 3U4EG 1UWMA 3K58A 2ZXOA 5IT9L 4G7OC 1VZ8A 1JWBD 3V96A 2BE5D 2EJFC 4HROA 1K8OA 1QT9A 1NR4A 3S1QB 2A6ED 3SK8A 3VYTA 4B0MA 4ZAIA 1JWAD 2PW9A 1IHZA 3CKIB 2D9UA 4KHZA 2PIAA 1AZPA 2WKCA 2HUGA 1V8CA 1LTBD 4BY7B 3CRLC 4KD3A 4RWSC 3AB5A 3S15B 1R7SA 1B3AA 5EKKA 2D5GA 1YMHE 5ELCA 4L8JA 2SEBD 3WDNA 3TEXA 1ENFA 2ID0A 1STAA 1FNVA 1BQQT 2E2DC 4JWUC 4L63B 4ZK9B 2DY8A 3SR6A 3SHLA 1F9QA 2B2UC 3TEYA 1E2VA 3Q0AA 2YEPF 4KKIA 2JZPA 3FPUB 1XEEA 3J81E 1AZQA 3C3LA 2L12A 2PMZB 4CJ1B 2MPMA 1CJEA 2JQRB 2L5TA 3TEWA 2BB6A 5JVG3 2K03A 2XVSA 2F3WA 1ESRA 1BDOA 3J7AF 1M4VA 3L3OC 4ZHOA 1NI3A 5ELBA 3J81L 1TKGA 4KY6A 4C80A 1C48A 1L0YB 2AUKA 2VXWA 4IDIA 4KTAA 3FRPB 3AM9A 3ETRA 1U4RA 3C1FA 1SAPA 1NENB 3E6ZX 3NVZA 2L1BA 3TSSA 1EZ8A 2NTSA 3PO2B 3U2SC 1E0BA 1QJOA 1HRJA 2L55A 5FK9C 2DY7A 4A3KB 5CV9A 1TQOA 1DM0B 1PMRA 1ZP0B 5BMHA 1LT6D 1SNCA 1ENCA 3M4OB 1QOBA 5EPKA 2DBYA 1SYFA 2A6HC 3TBIB 5IGBA 4N6EB 2KJXA 1G91A 2O4XA 2JA8B 3E9SA 5EPJA 4AS1A 2XSCA 2CVRA 1HZ5A 2PZTA 4IUQA 2B76B 4HR7B 3MAQA 2IGHA 2CJOA 2J4XA 1ML0D 5BN3A 3SE0A 2Z4HA 5J39A 2K9XA 3Q8FA 2V3PA 1PYWD 1EYCA 2EY2A 1N61A 4ODGA 1YNND 4DAPA 4RF1A 3QJYA 4Q0FA 4NW2A 1WVLA 4XT1B 2INPE 5K36G 3VR8B 1CK1A 5JPMC 1E0ZA 1PZKD 1I4RA 4P2CB 4XYOA 4IZ8A 3Q8BA 4C7ZA 3OHXC 3H0GB 1RTOA 1ZUD2 5EE3A 4EE2A 4KD4A 3AEAB 1SXTA 1K53A 3T53B 2K7VA 1B9NA 2A6EC 2EE1A 1LLRD 4C3JB 3P63A 3EJIA 1BOSA 2KWDA 2WXJA 1HA5A 4X3TA 3NTKA 1Y69U 4HEA1 1MI2A 2EDGA 1OXTA 1PGAA 1FCCC 2RKSA 4TQ1A 3MXGA 4KV6A 1EY9A 5EKLA 4YTMB 3W9CB 4HSPA 1OXSC 1SNOA 5BMIA 3BG3A 1XF5L 2EOTA 3R2TA 2X6LA 5BMGA 3ND8A 5BN4A 1HUNA 3ZYYX 3S16B 3OMGA 2QSDA 1Y8NB 3UI2A 3X3MA 5LHY1 1BCPB 1FFVA 1XYIA 4HN7A 1C4AA 1VR9A 4Q2JA 5FO8B 1BMLC 3OIPA 1STNA 1LTID 3SK4A 4HCEA 4L6TB 4MN3A 4P6VF 3PUVA 3W1SA 3GTPB 2J52A 5JEAG 1SJED 1Z7TA 2V0GA 2G9DA 2GI9A 2ONQA 2MHVA 4KHVA 1RYJA 1WGKA 1PFMA 1TWGB 3G6JB 5C0XG 2MH7A 1U4LA 3AE5B 2JSVX 2E3TA 1GUOA 1PTOB 2LMCB 2WP8J 4TQUS 1KDAA 2SOBA 2NVQB 3TEZA 3IL8A 2K5DA 1I7HA 1ET6A 1F9SA 4TSSA 2B2YA 2YU9B 2WXRA 4DNRB 3H3VC 4N59A 3SEBA 1OO9B 1WYGA 1BCPD 1EWCA 3DM1A 4H2AA 1DOLA 1M8AA 4RHSA 4US9A 1MBYA 3OWEB 2Y5CA 1QOHA 2K04A 3IFTA 2R7ZB 3AEEB 5BN5A 3NXWA 3CWIA 3D4RA 4JK1C 4K6DA 3BWUD 4LMQD 2N7JA 5ELEA 3AEGB 2L4NA 1IW7C 4YWGG 3P1HA 2EYPA 3S1NB 3T51B 4FF4A 1QCBD 3PUXA 1PTOD 1CA5A 1DOKA 1OFFA 2B2TC 1EY8A 2WAQB 1YNNC 1Q8IA 1SMYD 2EJMA 2M9VA 5KEEA 4US8A 1WTXA 4CGYB 2BDOA 4JE3B 2JU6X 2KAJA 1BUVT 1JOQA 3Q23A 2B2WC 5J1ZA 2B2UA 1QLBB 4OGQC 4C7YA 3TP8A 3OW7A 4UDUC 1D6EC 2K5QA 3MFYA 3HVDA 1C4QA 1T5EA 3TP7A 3BK2A 3T13A 2IX3A 1TYGB 4BWGB 4KKJA 1I4HA 2V3NA 2O2LD 5CV5A 2DYOA 3MXNA 5AFWA 3E5SA 3HOVB 4YXDB 5FO9B 1A3VA 4C1NK 2JA5B 4GDLB 2E2JB 2DYMA 3BVGA 2LY7A 2BA1A 4HMJA 2F0OA 4IFDG 2PNRC 1B2TA 1ZXHA 5T1GA 1X3PA 2WS3B 1FIQA 2L9HA 5I4DA 4J1MA 1H9RA 5C4ZA 1YQ3B 2F0SA 4RGTA 3GTKB 2RDHA 1BCPF 1LTSD 2Q8RE 1JE4A 2L83A 1E7PB 1QQRA 1X32A 2LFNA 2R6GA 2PVOD 3A7LA 2I07B 4C3IG 4F88A 2WXPA 4HSVA 2OT2A 3GQBA 3VR2A 5FR3A 3D3RA 3L7ZC 2N9KA 4FF2A 4RAUC 5CMDA 1V43A 5J22A 4B9XA 1PGXA 2NUCA 3NWTA 3R2IA 2WXGA 2J42A 4OIKA 1YQ4B 1UNSA 5CV4A 1B50A 1PTOF 4A3GB 3DWMA 3KWVA 5G3LD 2WXQA 2L32A 3CQZB 2N0SB 5JAVA 1CT1D 3M7NA 3L9AX 2F0WA 2XIWA 1WTOA 4OO1I 1J8IA 2PCFB 5IGGA 4A3DB 4Q5VA 2CW0C 3BDCA 1O7YA 3SK6A 2K01A 4C3HG 2EELA 3GD7A 5F2DA 3CU7A 2H88B 2FE8A 1QKZA 2BA0A 3E56A 5KNDA 1MHHE 3WCQA 3I70A 2I46A 1Q1EA 2KUMA 2BS4B 1TY0A 2NWGA 5M3FB 5FLXE 1G8ZD 1FEHA 2N88A 3AH7A 2AWNA 5DM73 2IPKD 4OZBA 1Y1WB 2IDYA 2D62A 2PPBC 3NTHA 5E6JA 1MVKA 1HQMC 4USAA 1LV9A 2GRIA 1HPCA 3L4PA 2PLPA 1CM9A 2OXPA 1K52A 3NPPA 4L1BA 3BK1A 2EJGC 1KLUD 3N6RA 1YNTE 1SYGA 2QF7A 5ELFA 3S14B 3JAML 2WP9B 1F2ZA 1Y8OB 4FNFA 3J80E 4GLSC 3J7AV 1SSNA 2WXHA 4CBVA 1GB1A 2XN9C 1TS2A 4RCNA 5H8YE 2DNEA 5G3LF 4ABNA 2JYOA 1D4BA 4JWSC 1SSOA 4OZAA 4H7BA 3AE9B 3AE2B 1SYEA 4RCOA 1PTOH 3T3NA 1KDCA 1SNQA 3M85A 5LL6S 5C3EB 3J80L 5HGTA 3VA5A 3W3AA 1SYBA 5DM63 1QF6A 3A8KE 4B0EA 4KN7C 2KCCA 3B2GA 1Z6HA 5KRUA 3H09A 4C56C 4EGVA 4BS9A 4WH4A 2RDGA 1JQ4A 1GPXA 2BS3B 3E0JA 1H9KA 3GTQB 1U4PA 3WOFA 1PGBA 1TU2B 2A6HD 3BS1A 3KLRA 4RFBA 2LHEA 4DA2A 1CZGA 4A55A 2RSNA 1B44D 1STYA 1XLPA 4AQ7A 5A2QE 5C3JB 4CHTB 2EY5A 2QCPX 5KYLA 3T4AC 2CU3A 4ILWA 5EJWA 3DHQA 1LO5D 4LAAA 5IT9E 2C9OA 3MFGA 3GTLB 2LGIA 4A3MB 3I91A 1AWDA 1B1ZA 1DJRD 4NAMA 1NYQA 2IL8A 2NN6G 1KH0A 1D5ZC 2F0PA 5C3XA 4YTPB 2ENBA 2HDEA 2JX5A 1ILPA 3I72A 1YNJC 2XWBB 3RLFA 2FMMA 4TQ0A 3AE4B 4B9WA 1EQTA 3ZJUA 1TWFB 1ZE3D 3I4LA 4IURA 3VRBB 2B2TA 1MSHA 1PRTC 5EGTA 1VCIA 3SVMA 3ZJTA 3NWSA 4IUPA 4H13C 1F2MA 3VR5A 2B2WA 4DNTB 4IALA 1L5PA 3AEDB 3HUIA 1DD2A 3BYYB 4ITKA 4WFN3 3DEOA 3K5MA 1N5XA 1EYAA 1WTVA 1TVXA 1HFGA 4J3OD 2Z1CA 4K5VA 1IYVA 2CHBD 4C2MB 4K14A 4HJGE 1KTKA 2IX0A 3U7ZA 1KNEA 4K5XA 1VDVA 1R4PB 3PO3B 1I4PA 3NVVA 4DGZA 1LT4D 1WD1A 3IAS1 5CR3A 5LNK1 4R8IA 1B9RA 2ZXRA 5D3IB 1D5MC 2WKDA 5D3DA 1CZPA 2BDNA 3VYSA 1HHVA 3DWQA 2RDFA 3ITPA 4YIJA 1EZ6A 1F2LA 2ON8A 1RM6C 1VMPA 1I3QB 1ZOYB 2JYEA 2IX1A 4CKBA 1SJHD 2Q8TA 5I9OA 3I4MB 2Q8IB 1EQVA 2K32A 3HRDD 3P20A 2FJ2A 2PQEA 4RNAA 5I9PA 3BDLA 1VDZA 3EA6A 2JWUA 5JEAJ 2XRSD 1C76A 2KCNA 1JORA 2G9HD 1VZ6A 2DWQA 3AV8A 3GTMB 5C0XJ 3K5NA 2NB0A 1J9OA 4QF4A 3W2DA 2WINB 1R4QB 2WU5B 3Q22A 2ZT9C 3SFEB 1Y1VB 2R3ZA 2F0UA 1GUNA 3HEJA 3EGRA 2HCCA 1YN5A 4D2KA 2NYZD 1A2UA 1QG7A 2O5JC 1EL0A 2KQ3A 4ZLTF 3A8IE 4M1UB 3KF8A 4ZYSA 2TSSA 1SYCA 1SYDA 1U9RA 4LK0M 4G7ZC 1Q90A 3S1MB 1FO4A 4P16A 1F9PA 1WTQA 2WXOA 1AYFA 1IBXB 4QB4A 1VMCA 4CKEA 2Y3AA 3AECB 1PFBA 1IW7D 4XT3B 2HTME 1QOAA 1MHXA 2SNSA 1LTTD 4CKCA 3NZ3A 4BBRB 1FFUA 1FD7D 2F3VA 3NVWA 2M19A 3M4YA 3Q8AA 5EKIA 3IAYA 1KFYB 4KGTA 4J8QA 5ISRA 2K6AA 2FUG1 1VF7A 4V190 1RJTA 1D5XC 2LFIA 3NK9A 2KOLA 4FXGC 1MPEA 1L4DB 1PXUA 2JP1A 1N63A 1IGCA 1LACA 2H1EA 2LMCA 1X3QA 2NBFA 5D7GA 3AEBB 1T3QA 1GHKA 2QEJC 1CHPD 1CQFA 3IKJA 3MHBA 5KIXA 3KQ4A 4KGRA 2EKIA 2ICIA 5G5GA 3D6WA 1C8CA 4G57A 5FOBB 1ZXTA 4KX6B 1EWHA 1JWSD 1NCVA 4IFDJ 2L52A 2IGGA 1ZDVA 1H9MA 5K5PA 2Z4IA 1O7LA 5BYQA 2F1MA 2FMCA 3J7YW 5G5HA 1PUTA 3W5UB 3DUZA 3NQIA 3P4QB 2D2CC 2PW7A 1UGJA 3HOWB 2NVXB 1TS4A 3D8GA 2F4IA 5EE0A 1TJEA 4ARCA 4OL7A 1HTLD 3Q69A 5T8IA 3BDOA 5BYRA 1IUEA 1ZDXA 2K5PA 3VYRA 1RD9D 3A56A 2MJDA 4N9TA 4FP5D 2EZVA 3C2PA 2XNAC 3ABVB 2YYZA 3C46A 1WSPA 2EYLA 3HVZA 2Y0SB 3AEFB 1A70A 1SE3A 3A8JE 3IT6B 2K05A 1QOGA 4RGNA 4K6LA 4IOIE 1JB3A 3OWFA 5K36H 2WXNA 1LABA 2CW0D 3TZDA 1JWUD 4MHEA 1PLFA 4NJCA 3X3NA 1DOXA 4KY7A 2WXLA 1LTGD 1K83B 4RF0A 4CJ2C 3NP8A 4TRDA 1E6EB 4EVOA 2W55A 1TKEA 3TN2A 4OHJA 3NBIA 4C3HB 3MTSA 4Z9CB 2F0TA 1A3TA 2RPVA 2V4DA 1H9JA 1IKMA 1CTMA 4RA8A 4XDDA 1D1KA 2E2HB 2IJ0A 2RSOA 2HDMA 2WQYB 4FF3A 1J7BA 1VRAB 4ZOHC 3PIP3 1NUCA 2KMMA 1HZ6A 1Q3LA 4S3SA 1F2RC 2C5CA 3C1EA 3HOXB 1F2RI 1ACCA 1FR3A 2G1EA 1EM7A 3CHBD 4LK1C 2F0NA 4I65A 2HQEA 2IGDA 2F0VA 1CZWA 1CA6A 5E4WC 1P7FA 1ZYRD 3QOJA 3NTIA 3EQLC 4CQNA 3NBHA 1WTPA 5KNBA 2WV6D 3EROA 3SFDB 1STGA 1RCVD 2PZWA 4YTNB 2A68C 3NSWA 2VZKB 1RFKA 1D2BA 5C0XI 1OQQA 1V1OA 4X3KA 1JOOA 1PZID 1E10A 5FO7B 1DXMA 3TP6A 1BUIC 4XDCA 1QWYA 1Q1BA 3RD4A 2AQ2B 2F0LA 2I38A 1ZKOA 1EIHA 1ENAA 2VB2X 1NAPA 4X3SA 3A55A 4A3JB 5DAUA 1S5CD 1SNMA 3RUZA 3S2DB 2LHDA 5HURA 4C3JG 2KHSA 3DWGC 2W3RA 4IQZA 1CFMA 3PMFA 4ZRQA 2E6XA 2WB1B 2E76C 5E4XA 2L0CA 3M7GA 1N5WA 1PRTB 1J7CA 2JYTA 1EY0A 5CORA 1GUWA 1LT3D 3BYTB 2ZXPA 1KABA 2VZKD 4TMAB 1ICWA 2JEAI 3QG1A 1E2ZA 3QIAA 5T1IA 2N9LA 1C77A 5EBDA 1W6KA 1TKWB 4MT5A 1I6HB 3EVQA 2E75C 4HMIA 1JWMD 5JPNC 2R93B 1XXGA 1XLNA 5DNFA 1QOFA 3GO5A 3PV0A 1HQRD 2AWOA 5M3MB 1E9MA 2EXZA 2X38A 1I50B 2PW5A 2A69D 4ULLA 2WIIB 2IW3A 3K5LA 1D1IA 1J7AA 1YNJD 2A5HA 3AE6B 1YN4A 3MEHA 1RDPD 3C8YA 3NHHA 4OZCA 1PRTD 3V2TA 3PUYA 4RGOS 4DF7A 3M3YB 1Y56A 2EPBA 1IL8A 4OO1H 1HTPA 1K8MA 2NMQA 2WXIA 2MJ3A 2WXFA 2AQ3B 3P42A 1G291 3KK7A 1YJIA 4YSXB 2QMTA 1SEBD 4NZLB 1BXTA 1RF2D 4KGSA 2PVGC 1EEID 3F2UA 2CJNA 2H4OA 3WOEA 4GDKB 1Q12A 5I2XA 1S5FD 2KECA 3AMZA 3JAME 2J7ZA 3MZ5A 3PUWA 4TKOB 2JXTA 4F7XA 1FNWA 1DYQA 1SNDA 5NUCA 4UAIA 4FVMA 3N9YC 2M2LA 4M8AA 1EOTA 3NQTA 3A54A 2BS2B 4N58A 4IUNA 1ZYRC 1GB4A 1Z47A 1WD0A 1T5XD 3W5VB 4HAEA 2VNUD 3LWUA 1PFNA 4PNYA 4PMBA 1O7ZA 2WDQB 2IWHA 2WNMA 2QILA 1TY2A 1GHJA 2M00A 1FD6A 1I4GA 2A73B 3S1RB 2F0IA 1FYCA 3HP3A 5M5XB 3R3OA 1DONA 3VR9B 2LS01 1SIJA <