3BVGA

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
237
structure length
228
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Assessing energetic contributions to binding from a disordered region in a protein-protein interaction
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords Enterotoxin type C-3
total genus 65
structure length 228
sequence length 237
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bvgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bvgA01
1STEA 1T5XD 1D5ZC 1TY2A 3MC0B 1CHQD 1EU4A 1PZID 1PTOB 1EEFD 1PZKD 1CT1D 2RDGA 1G8ZD 1XTCD 1YN5A 5ELCA 1LTSD 1CK1A 1SEBD 1S5DD 1I4XA 1LTRD 1QILA 1V1PB 1PRTD 2XN9C 1SBBB 2Z8LA 1PRTB 3BVGA 1D5XC 1ENFA 4RH6A 1YN4A 2TSSA 4L6TB 1KLGD 3EFXD 1S5BD 1JQYD 1M4VA 1JWMD 3MFGA 2CHBD 1DYQA 4RGTA 1SJED 1FNUA 2XRSD 1LT6D 1FNVA 1L0YB 1PRTC 1PZJD 3BYTB 3R2TA 4RFBA 5ELFA 1SXTA 1BCPF 1RCVD 1BCPB 2AQ2B 3TSSA 2IPKD 1I4HA 1DJRD 1JR0D 1PTOH 2AQ3B 4UDUC 1FGBD 4RHRA 1I4QA 1L0XB 1KLUD 3DWPA 1EWCA 1D5MC 1XXGA 1I4RA 2NTSA 1LT4D 1UNSA 3URYA 1RF2D 1V1PA 1CQVA 2G9HD 3V05A 1LT5D 4BWGB 1HQRD 1D6EC 3EA6A 4RGNA 1TS3A 3R2IA 1EEID 1GOZA 1AW7A 5FKAC 1JWUD 3O13A 1YN3A 3W2DA 1LTTD 1B44D 4RGOS 1RDPD 1EU3A 1EFID 1PTOF 1PTOC 3SEBA 4Z9CB 1B1ZA 3OWEB 2QILA 1BCPD 1ET6A 4K6LA 2NTTA 2RDHA 2XRQD 1I4GA 1ESFA 1PRTF 1FNWA 3BVZA 3DWQA 1I4PA 1S5CD 3BZDB 1LO5D 1RD9D 2ICIA 3GP7A 3BYYB 1V1OA 1SE3A 2WV6D 4O1NA 1CHPD 2AQ1B 1TS2A 2R61A 1S5ED 4RGMA 1TY0A 4RCOA 1LLRD 2QEJC 1HA5A 1HXYD 4L63B 4ZYSA 1F77A 1KTKA 1BCPC 1LTBD 1FD7D 2O2LD 4RHSA 1TS5A 1SJHD 5ELBA 1PTOD 1HTLD 3BVMA 1PYWD 1SE4A 5ELDA 2J4XA 1LTID 4OHJA 1LTAD 4DXFA 4TSSA 2SEBD 1AN8A 1TS4A 1SE2A 3CHBD 5FK9C 4C56C 3DWAA 1UUPA 1LT3D 5D3DA 5I4DA 1S5FD 2XNAC 4NZLB 1JWSD 1BXTA 1LTGD 5D3IB 4DXGA 1ET9A 3KLSX 5TSSA 5ELEA 1JCKB 2IJ0A 3R8BA 1MD2D
chains in the Genus database with same CATH superfamily
1E2WA 2YVCA 2ZM6L 4LCDE 4QUFA 4BZAA 4DR1L 4KY5A 3AEFB 5IYBG 4KX6B 3EUB2 4IKGA 2EYPA 2DYMA 4LFAL 2EPBA 1SMXA 2RDGA 3FPPA 3KFUA 2EKIA 1KDAA 3HOWB 1VQGA 4B3RQ 3U4VA 2Q5WD 2C60A 4Q2JA 3TEZA 1A5RA 4KKIA 2B2UC 3Q0AA 1LTRD 3BZCA 2D3BA 1FIQA 1Q90A 1W6JA 2MJDA 3NTHA 1E22A 1B3QA 3AB9A 4GLVB 1ENFA 2D10A 4GXBA 3ETRA 3ZTDA 2PJHA 3NOBA 4GNXA 4FVMA 4A90A 5KRUA 2LWPA 4KKJA 1BOSA 1ZDVA 3K58A 1UEAB 5I6YA 1JJGA 4HK2A 2KJ6A 4IUUA 4RFBA 2NBVB 2WACA 1SXTA 4OX9L 3N6RA 1TWFH 5DM73 1UBQA 5EE1A 2J42A 2VUMH 1DONA 2YV5A 1W2BA 3KW5B 3NS8A 2MA9B 4IJHA 4NW2A 2D11A 3BU2A 1VQ9A 1NMFA 4DV5Q 2A69C 4JX1C 2VXWA 3TEHB 2UXCL 2MP1A 4DR5Q 1IXRA 4LLGM 1EIYB 4LNQA 4GSWA 4DNRB 2I2YA 3MA2B 2XWJB 3Q3MC 2PZUA 3KF8A 1TXYA 4BWGB 1XLQA 1HQRD 2JEBI 3Q22A 1FXIA 5C4JB 3KJOA 1K52A 1ZUD2 3ZLZA 3DVNU 2RF4A 4OO1G 3M4OB 4H13C 2YTXA 3HOVG 4RGOS 4IWOA 1OTCA 4P71A 4P1CC 2WNMA 1CTMA 1SRUA 2KOLA 4OELB 2LD9A 3OYYA 2C7NB 2NPTB 5C3EH 5CV6A 2IBIB 2QHOA 4NXMQ 3ENEA 3FEWX 2A74C 1ET6A 4YL8A 2E3TA 4FHJA 4DUYQ 1F2ZA 3VRBB 1JW9D 3I8ZA 4K2LA 1FCCC 2XSCA 2KVZA 3ZW3A 4A3BH 1JALA 2IHFA 5FLXE 2I1JA 3LJ3A 3CCQA 3PSEB 5IGGA 2FCQA 3I91A 3J80i 4HLEA 3CW2C 3DBLI 4F87A 2FJ2A 3OW7A 2O6VA 3K7AH 4G3XB 1Q5WB 2K14A 3A8JE 4BY1H 5AZHA 2ZJQA 5CBEE 3RLOA 4BA1I 1SNOA 2BDOA 1PGBA 4REZA 1HZBA 4G7OC 4LAAA 2A6HD 4IUTA 4DKAC 5BR8L 1F77A 4EX5A 1RYJA 2UXBL 3ERSX 4H7BA 3EGRA 2F0FA 2Y5PA 1U5KA 3AECB 2LFNA 4JBMA 2E76C 4HJ7A 1NY4A 1VR9A 2J53A 4RMAA 4WWNA 1IBLQ 5C5LA 3MFYA 1B9NA 2KDFB 2B2UA 1T0QC 2ZPNA 1Y8RC 2DZKA 1EZ8A 1JWSD 2PW7A 4XIGS 5IYDH 4DXGA 1ASYA 3PPAA 3PV1A 5ELEA 1P16A 3P4SB 3SD5A 2A69D 4JYAQ 2DZJA 5H92C 5M3FG 4CYEA 1STEA 3ONSA 4RM8A 4NXNQ 3KF6B 2KCCA 2DZMA 2MHVA 2VUMB 3MHSD 2B8GA 5J18A 2PE6B 2G4SA 3OMGA 1EO6A 4AWJA 3HOYH 3MTNB 1HZAA 1UELA 4A3MB 1GUAB 4PZ8A 2IL8A 2VB2X 3A5UA 3BVGA 1YN4A 1WJ4A 4A3MH 5M3MB 2DUDA 4C3HH 3M4PA 2PEAA 1K28A 1N36Q 2GVAA 3TEYA 3W3AA 2BWFA 2B2WC 1N32L 4LW1A 2UUBQ 2INDC 2XRSD 2RHQB 4KSLC 1HUMA 3AULA 4K8JA 2AL6A 2OQ0A 1AEXA 3W1YA 2MFIA 1N32Q 4MEMA 3X0WA 3SK6A 1KC8C 1JROA 3ZUNA 4M0WA 2Z6KA 1X65A 3QK0A 4RHRA 5H8YE 3S1QH 1O78A 2WKDA 2BH2A 1Q10A 1PH5A 4HAEA 3NVWA 3SR6A 3WDNA 4WIPA 2EYMA 1KAAA 3HHMA 1VF5C 1WD0A 1QLBB 3A33B 2MRPA 2E2DC 2PO4A 3P4RB 3V05A 2KEDA 4KSKC 3KYDD 4BY7H 1XPOA 3GO5A 4WWPA 1CKNB 3RNGC 4AQYL 2VL6A 1YITA 4K0KQ 3I55A 1VF7A 4MH0E 5BYQA 3MEHA 1PDXA 4GKKQ 1NNXA 1XPUA 1CKNA 3I90A 3N9YC 4Z9CB 3OWEB 5IGDA 4LF6L 3KYHC 1SF0A 3FAHA 2L7RA 4UPAA 3X3MA 4DV7Q 1S1QB 4RKBA 4GKKL 3T1YL 3UE0A 2GRIA 1FNWA 3ML8A 5CV5A 3PLVA 1CUKA 1I4PA 3A55A 4AYBB 1YD8U 4ANWA 5AUIA 2WYQA 1XNQQ 2WX1A 4K3BA 2WXNA 2JZPA 3S1NB 1II3A 1EF5A 1C79A 3GZNI 1B2TA 3KK7A 1HE8A 2GBKA 2ON8A 2C9WB 1VQCA 4DAYA 4W9LA 4YIJA 2H4OA 2WXMA 1WXQA 1R4NI 1MSHA 1S5ED 2NN6G 3PHWB 2A8VA 4FYDA 3AU4A 4P75A 1WWTA 1GHKA 1HXYD 1ZEQX 5E3FA 3IT6B 2KANA 1BCPC 4DAYB 3GTOB 1Y8OB 2CWPA 2D3CA 4JV5L 4ZK9B 5EQ0A 2UU7A 1E7VA 1K73C 5JH5C 1ICWA 2BW2A 2PVOD 2V0GA 1B70B 4HPLB 3EBEA 4L8JA 4JVZA 3HP3A 3MEFA 5ELDA 3L3OC 3LWUA 4JI5L 4EQ5A 4K8IA 4LFCQ 2BWES 4TSSA 3D3RA 2SEBD 1OXVA 2HCIA 4AQYQ 4IC7B 1TT2A 2BA1A 4BKTA 1TR5A 1YNJC 1GAQB 3DWMA 2K22A 1J9OA 5EAYA 3ERQA 2JWUA 1WTPA 1KL9A 5JAVA 1J6QA 2KCMA 5I9PA 3RMKC 5JHBA 2EIFA 1XF5L 4DV3Q 1SIFA 3CXCA 4RF1A 3UE1A 2LKVA 1JCKB 4S17A 4F7ZA 1XWEA 3GQBA 4JCVE 4AYBG 3J81c 4JI3L 4KGRA 2F1MA 3CC2A 3ZJUA 5IYDG 2Z6BA 3CMMB 1UEBA 1PZID 2JK8A 2K0PA 1UGJA 4KD3A 5C6AA 4ICUA 4DFAA 3RD2A 4LF5Q 3PUZA 4YWGG 4ACFA 4WJNA 3H6NA 4FN2A 2OCEA 3GV3A 1Y1WG 2GBRA 1FMAD 1YJ1A 4A3DH 1MVKA 3TP8A 3V96A 1KF6B 3DWGC 4OWTB 1MSGA 3K59A 2RMMA 3V6EB 4AP4C 3K57A 2ZEQA 1PYSB 1S72A 3FVQA 1JWMD 1FM0D 3GE3C 3LB8C 2CHBD 2OWOA 1JB3A 4XDXA 3CWIA 4RGTA 4HJAA 1H95A 3BDCA 3HZXA 1WGYA 3L10B 5IP4D 2WP9B 3NXWA 1X3EA 3TP6A 3WWVA 3A4RA 1PRTC 1L0YB 5FR3A 3ECIA 2B2WA 1QOFA 3M3YB 3RMHA 3J81j 2JZ3B 1I94Q 2KACA 4A20A 1V97A 1HNWQ 2ENBA 3VDYA 2V9HA 2VS1A 3KQ4A 4O42A 1NI3A 3R3MA 4XX5A 4DV4Q 4A3EB 1V49A 4DUZL 1OXXK 1OO9B 3CCRA 5IYBH 4O2DA 2K5NA 1Q81C 4MM3B 4DK0A 3A9KB 2ZT9C 4X65Q 3PV0A 1FEHA 4DAMA 1WZ0A 1V1PA 2KC2A 3TZDA 2KXJA 4E6IA 3WA0A 1T5EA 2X6LA 2NUCA 1A3TA 2BS3B 2KLGA 2AEHA 3VQIA 3DHHC 1KOTA 5LHY1 3HOUG 5FKAC 2BVCA 4LJPB 2WXQA 5DPWA 2JQOA 1A3UA 2A5HA 4UP7A 4DA2A 4F1SA 1E0BA 1E1TA 1Z2MA 4II3B 1VQMA 5J3BA 5C23A 4ZRKA 1GUNA 1QE6A 1TKEA 4K6LA 3IFDA 1N33Q 2ZW0A 4RF0A 3MXPA 5FLXc 2QSDA 1F2MA 1EQVA 1STBA 2RD0A 1IP9A 1CA6A 3HM6X 2VQFL 4ANUA 1DCZA 1F9QA 1HUNA 3W5OA 3A56A 3U4ZA 3BZDB 4IM0A 3NUCA 3L9AX 3I7FA 1RD9D 3PUXA 2XVSA 4KHPQ 1OFFA 1A63A 2BGFA 4A3LG 3ZGZA 1A15A 4A93G 1QOHA 3U50C 4N8FA 1BO0A 4JL9A 4O1NA 1CHPD 2FE8A 4NJCA 2BOSA 1LABA 2LXKA 3HS0C 4YHHQ 1E2ZA 1TY0A 3FKIH 5IT9L 4K7UA 4OWWB 1NCVA 5FJ8H 4L63B 4E3CA 5FLXL 1Q8IA 1TGZB 1C1YB 2L1AA 1SIJA 2CJNA 3M95A 3UI3A 2PCFB 1NMGA 5C0XJ 1FRDA 4IUVA 1TYGB 2JVCA 1H9KA 5C0XH 4NJ7A 3H0GG 3DHQA 4B3ML 4A3DB 2FCNA 2WAQB 2PMZE 4C4VB 1HZ5A 1G6PA 1TS4A 1L0WA 2PE9A 2K8CA 4IWPA 3RT3B 5EGTA 3JYUA 3PIPA 1VQBA 1PFMA 2R93H 3NVVA 4R4OA 1KDCA 2LVQA 1WCMH 1BXTA 2JA8G 1B9MA 1CI3M 1KRHA 3SDLC 4A3KH 3BDLA 2KDIA 1V1QA 3TREA 2MBOA 2DY8A 2HDEA 4JQWC 1E24A 1D5ZC 5G55A 2KA7A 2BKRB 1FJGQ 2F0PA 3KDFA 3CCVA 1PFDA 2DYOA 4M01A 3VHTC 4BAXA 3PMFA 3AQQA 1AYFA 1JWBD 2F0MA 4I6NB 3H7SA 5C3EG 2XWBB 4ZCKA 1SEBD 4DK3C 4FF4A 2MH7A 3IXSA 4N6EB 1FJGL 1SBBB 1R9TH 1YJ9A 4MGZE 4R3DA 2FCSA 4XT1B 3T53B 1WXSA 1PV4A 4I6LB 3E5SA 1S5BD 1M4VA 3AB5A 2GOWA 2RR9A 2A6HC 3K9OB 2D5GA 2FBWB 2Z59B 1E0ZA 2QDBA 1BBXC 3FP9A 3NELA 1QZEA 1JOKA 2CW0C 5HI1A 3PIO3 4GOPA 2KWVB 2GI9A 4HIOA 5M5XH 3I4MB 1G2TA 3K80C 1N5XA 4LNKA 5CX3A 3PUWA 4B95A 1RCVD 4B9XA 2IW3A 4POFA 2M56B 2V3SA 3EECA 3WCQA 1YIJA 4MGKE 4XT3B 4JI7L 1V8CA 2VZKD 1IYVA 2DHZA 4TMAB 2JUOA 2MGSA 4KJOA 4HJ8A 1ICFB 1R4QB 2K5WA 3EROA 4EQNA 1M1KC 1GXDC 4FF2A 1V2YA 4KGSA 4A3GG 1DM0B 2G4DB 2R2OA 1MKHA 1SROA 3GTQB 1LT5D 1WJ6A 4JI7Q 3BS1A 1KNAA 3SXHA 1VQKA 2OJWA 3NY5A 2WB1G 3CCJA 1P7EA 1S4ZA 4ME3A 4IUNA 4LFAQ 1UZXB 5HGTA 4IDIA 1HZ9A 4DHJB 1KD1C 1WFYA 4A93H 2QCZA 1RDPD 3STBC 4DR1Q 2JA8B 1A3VA 1G2SA 4DV4L 4DR2L 2MQJA 4A3JG 3VXWA 5KNCA 1ESRA 1XQQA 3BG3A 1D2BA 4US9A 1STYA 2EY5A 3RPFC 3M7GA 1VDZA 4HCSA 2E5LL 1L5PA 2NTTA 1SLJA 1FGUA 2I46A 2FXQA 2FHTA 2RDHA 1H9SA 4XTCS 3WAOA 4QCLA 1V80A 3PCOB 5EKKA 2Y5BB 2NS5A 4R4CA 1IGCA 3IAM1 4J6IA 1Y1VB 4EFOA 5AZFA 5M5YH 3MVVA 1UH6A 2D9UA 3HOVH 3A5ZB 2F0VA 1ZKHA 4RA8A 2Q8RE 3S1NH 3AE8B 4W9IA 2NVXB 3QOJA 1YNTE 3T9LA 3V60A 3GTLH 3T13A 4EZLA 3S15B 1F9SA 1PH4A 1UD7A 3IAYA 1FD7D 2KFKB 4RHSA 2KQ4X 2KX0A 3H7PB 1TS5A 1C4QA 3AE6B 3GTOH 3OJ4B 3M63B 5CBAE 4HRSA 1WYWB 2AKWB 1YX6B 1CZGA 1OXSC 3KLRA 4YCVA 1VQ5A 1PGXA 2K1FA 2QA4A 5LMUL 1ZPSA 4PT5A 2A1AA 3U9SA 3KUPA 1ILPA 2CKZB 4JI8L 2O5IC 3PO3H 2ZTCA 2N1VA 2KCNA 5KHOA 3RUIB 2KMCA 3TUOA 1V9JA 4LTUA 3EN2A 2KK8A 4BBSG 4TKNA 4HEDA 3A7LA 2HJ1A 3IFTA 4F8CB 3NE5B 3A1QB 3NS1A 1UAPA 4KVGB 2F0HA 1PTOB 1EEFD 3F8TA 3M3JA 4CDCC 3GTPH 2PLPA 1XMQQ 2KHWB 4KJNA 4GZYC 3ZDTA 4DAPA 1N63A 1CK1A 2LI5A 3D0FA 3A1QA 3RN9C 3DEPA 4IFDG 4NPSA 5I2YA 1QILA 3TQYA 4MSMB 2BE5D 3FMCA 3T3NA 3KUZA 1K50A 4N9PA 2EJMA 2DX5B 4PYZA 2WXIA 4JOIC 4DAVA 4A3OA 1Q82C 4X64Q 4DGZA 2NPTA 2SOBA 3TBIB 3CF6E 2JSOA 4B3TL 1TWFB 2JSVX 2PKOA 2L76A 3M4OH 3N1XC 5LMUQ 4TQ0A 1L2NA 1Y69U 3B2FA 4W9DA 4DPGA 1DJRD 2LJ5A 3I3TB 3H0GH 1RHPA 2ZNVC 4K7WA 1B3AA 4LNOA 1WX7A 4HPMB 3OSOA 1DD2A 3TMPB 1WI5A 2IX0A 1JJCB 2K28A 1ISNA 2BPSA 5EBDA 4ALPA 1OQYA 5DEHA 5AUKA 2WXGA 2FAZA 4YY3L 1CFMA 2KAJA 1RF2D 1GUTA 2G9HD 5C0XI 1WTHA 3I4NB 1WD1A 3I63C 3R2IA 3KUDB 1HFGA 2EOTA 1YJNA 1PA6A 2EMTA 3TBLD 3H7PA 2N9LA 3CPFA 4APVA 5CMDA 3CSTA 3MXGA 4PQXA 2VQFQ 2L12A 3NZUA 1MG8A 1TT5B 3JAMc 2JA5G 2PQEA 3GB1A 5F2DA 2GMIC 1XNRL 4TV3A 4C1NK 3QJYA 5ELNA 4YWMA 2XRQD 1I4GA 2NZOA 4QB4A 1WM3A 4WQOB 3AU5A 1CSQA 1KHIA 4HIMA 2V1CC 3JAML 3CCMA 4BXXH 4JG2A 4IPHA 4ULLA 1QWYA 2B3GA 5J22A 1SN8A 3S1MH 1HEZE 1LGRA 2KJHB 3BYYB 3CF5A 3MJWA 1ENAA 4J6HA 5M5XB 1MPEA 1TS2A 3AE1B 4J3OD 2W3RA 3MWYW 2QEJC 3VUXA 2XEWA 3VR8B 3NWTA 3OG5A 1F2RC 1Q8KA 2WXKA 3Q8AA 4LNIA 1E2VA 2HTHA 2LXJA 2UU9L 4YWKA 2LGIA 5IAAC 1GB4A 1GUSA 5CV4A 4KV2A 3CRKC 5AJ3L 4XDDA 2N55A 1EWHA 3DWAA 3Q8CA 3I3CA 4GDLB 3AEAB 4ITKA 3HM3A 3Q23A 2KN5A 1S5FD 2BYTA 1RTOA 1Z47A 4IPGA 1KDBA 1N34Q 2UYZB 3RFZB 4PNYA 1C4AA 2M00A 1WTOA 2M9VA 1E10A 4HJGE 1VQHA 4WAFA 4BFRA 2ZTDA 4ZAIA 4C3HG 1RRBA 4HEA1 3KYCD 1KLVA 4N58A 4NAWB 2OXPA 3CQZB 4H02A 4JWSC 4ANXA 2L11A 1O7LA 1ZXTA 2KHIA 3R93A 4F88A 2A4ZA 1WE7A 4ZRPA 2MWSB 2UXCQ 2BA0A 4OX9Q 4KKTA 3HOZB 1IBML 3AXCA 2XBBC 4AYBE 5D2MB 3SGIA 5FO7B 1PHJA 1RFKA 4DNIA 1DGJA 3L54A 4C7ZA 3R7RA 4JW0A 4O0AA 1D7QA 2BBCA 2A6EC 2H5XA 1K53A 4K5VA 1YHAA 4B6WA 2NVXH 3EJIA 1NEKB 1EY5A 2WIIB 3OOCA 1E7UA 2DAJA 3I5JC 2D62A 1RTNA 2ZVOA 4MHEA 1FO4A 3JC66 4BY7B 3L0WB 5DPRA 1RIPA 1BBUA 2BE5C 3R2TA 3D8GA 1KQSA 5JVH3 2ACZB 2Z0EB 4JI4Q 3M7NA 1D1KA 2G45B 3RUZA 1N62A 1SR3A 2QKIC 4DHZB 2KTFA 4IM3A 2NZHA 2KDBA 3E9HA 1TZ1A 3D6CA 1GO3E 3IBEA 2NVQB 3RN2A 2B63H 2AX5A 1LM8B 2F0EA 1AFPA 4MN3A 2NTSA 1ASZA 1WTXA 1LT4D 3OPOA 4OWXB 5G2NA 3S1MB 2JPHA 3ZJTA 4DK1A 4H44C 1F9PA 4DR4L 1U0LA 1K8AC 2YYZA 2NBFA 1SFOH 3I57A 1Q1OA 4JPSA 4RGNA 4A3JH 5LXHA 1YN3A 2JXTA 2KT7A 2L9HA 2C7MB 1IBMQ 2N7DA 3TP5A 1FXTB 1J19A 2CU1A 1WYDA 1VCIA 2H88B 2V3NA 3HOWH 1AE2A 2ONQA 1O7ZA 1SYDA 4BBNC 4RAUC 3ZO5B 2REXA 4CGYB 1D3ZA 2L55A 4NKLA 2E2JB 1ESFA 2JE6I 2D0PA 1TWHH 4JI1Q 3T4AC 3PRMB 2JYEA 4GLSC 4A3FH 3C1FA 5ELOA 2RPQA 2LRWA 4NNJB 1Y8NB 1QUQB 1WXVA 2J52A 2Z4IA 2J7ZA 2W82A 4NAWA 3ZXVA 4A3FB 1P1AA 1U4MA 4LJZC 4J8QA 1Z5SB 5M3MH 2K6AA 2L5TA 3IL8A 3TZUA 3M85A 3KOJA 3ALBA 4DU9A 4G11A 1ZP0B 1R4PB 3DXJC 3HK0A 5BR8Q 2WP8J 2D3AA 3SU8X 4FO2A 1Q46A 3HG9A 4A75A 4AJWA 4OZCA 4L5QA 3E3XA 4FXKC 3J7A5 3NZSA 1YHBA 2NVTB 3WALA 1EOTA 5AFWA 4JLCA 3V62A 2L00B 4EZKA 4X3UA 4C56C 1IL2A 2CH4W 1HR0W 2K8HA 2LGXA 4XXEA 1ILQA 2JU6X 2GBJA 2UUBL 4JI6L 2F0NA 2JA6B 2DNCA 2PYKA 4XQQA 1QZGA 2PPBC 1PUTA 1XPRA 2CR5A 4HWIB 3JAMi 2ZW1A 4RG1A 1YVCA 4W9CA 4OEMB 2KHSA 1LXDA 3L4PA 3P42A 4ZHOA 3CC4A 5T1IA 3NJTA 4X3TA 1BMLC 3K81C 4XC2A 4C3JB 3J80L 1EUJA 4NJ6A 1HTPA 1S5DD 4YSYB 3VVWB 1A0IA 4LF4Q 1AWDA 5D65A 4C3JH 2ES2A 4R4QA 5KYIA 4ID6A 2Q2HA 2K5DA 1HR0Q 3J7AV 1JQYD 3FPUB 3K8AA 4P72A 4LF9Q 1B50A 1XNRQ 4N8X1 1TKYA 4HTHA 1DYQA 4FLHA 1XX8A 2SDFA 4M1UB 3BJUA 3E56A 4OONA 5JVG3 4OZAA 3RZFA 5IA7A 2EJFC 3LYYA 4KZ0A 1BF4A 1BCPF 1DZ1A 3RZDH 3JSVB 1N5WA 1WMHA 3VR4A 2EYJA 2O4XA 5JJIA 1SNPA 4UDUC 3SK4A 3CP0A 3DBRI 3R3OA 2EYHA 5K36H 4GLAC 1E8YA 2JX5A 3JSVA 1A62A 3U4EG 3KUCB 5EJWA 1ZW7A 4ABNA 1XXGA 1JE4A 3F1ZA 1MJEA 1EIFA 1T6BX 2BQQA 1YJJA 2RSUA 4BY1G 1F1HA 4TRDA 3PO3G 1WJJA 5HY6A 3P1HA 3ND8A 3S1RH 4X62Q 1EEID 1GOZA 3Q24A 4JI4L 1AW7A 2ZXRA 2A5UA 3A54A 5L83A 1E90A 4A3LH 2D2QA 2C35B 5BN5A 3PZ7A 3JAME 2RBMA 1P8LA 1YNXA 3SEBA 3M62B 3G6EA 2D0OA 2A68D 1J7BA 4PS3A 2WB1E 4LF6Q 1B1ZA 3BY4B 3QWNA 2I5HA 1C3TA 1WSPA 1OXTA 4JI3Q 2KOXA 2KQSA 1WE6A 1QB5D 1IBKL 4XDCA 4B9KA 3KLWA 2JF5A 5IP7H 2BTEA 2HD5B 1ZDXA 1W6KA 5C2TB 4DDGD 3NVYA 2L05A 5CHWA 1R4NB 3L17A 2E2HB 3V3XA 2LGSA 1I50B 1C9FA 5C4HA 3L13A 1DOXA 5KYLA 1T0YA 2DLBA 1M8AA 2B2TA 3DVGX 1UE6A 4QJFA 1EWIA 1C77A 3AE9B 4ZYSA 5H1SE 3NQIA 5CORA 4IOAA 1UBIA 4OIJA 2FIFA 1QCBD 4PS7A 3HOYG 5CHVC 2A6ED 1BT0A 2B63B 5A2QL 4K7SA 3RLFA 5IY0A 3NUHB 2KMAA 2GB1A 1IL8A 3RN5A 4RCNA 1PH3A 3ITPA 3X3NA 3VR9B 3RLNA 1WXAA 1VQ4A 5FR6A 3RNUA 1TTNA 1D8LA 1KH0A 2D07B 4I6PA 4LNNA 3HKZB 4E71A 3I4OA 1YZ6A 1SYEA 4K5WA 1ET9A 2JZZA 3F2DA 3VA5A 4PMCA 2HTME 3S9WA 5CR3A 4ZLTF 3I4MH 1E8XA 3RD4A 1EY6A 2I07B 2LHDA 1I6HH 2Q2TA 1BQQT 2UUCQ 4GN4B 3AFPA 5KEEA 1EQRA 3AU7A 1UWMA 1I4XA 1WRIA 3APFA 4W9GA 5BYRA 2DN8A 4P7IA 5BN3A 3OMCA 2JQRB 1L2FA 1PRTD 3AI5A 2Y3AA 1H9JA 4IWQA 3AE4B 2DNEA 5CV9A 1PRTB 1SAPA 1VQFA 4UP8A 3VYUA 3NVZA 3C8YA 1E6EB 3U7ZA 2Z4HA 4ZKCB 2R92H 4PV1C 2NVUI 1SNMA 3G71A 3J81L 4DR5L 2Q2IA 1YIWA 2FUHB 3B0AA 4A76A 4CKCA 3P2BA 5IKCM 4MH8A 4WURA 1EYAA 3SE0A 2E2HH 4MNOA 1J7CA 4S0RA 5CTRC 4OXPA 3BINA 3H3VI 3FHWA 4P1BC 3HRZC 5FOBB 1W3SA 4W9HA 2KQ7A 2VW9A 4QY7A 1Y1WB 5EKLA 3DHIC 4IW0A 2MBQA 3TSSA 3SFEB 5FLMH 4ZDVA 1HNWL 3ZVVA 4G7ZC 1VZ7A 1V43A 4DR4Q 3VUWA 3AFQA 5LNK1 1OEYA 4K5XA 3DWPA 1C48A 1K3RA 1C8CA 2OT2A 2K05A 2NYZD 5JEAJ 1E8WA 2AWTA 2IO0B 1KABA 1FL0A 4JWUC 3J81i 2L4NA 1SNQA 3APCA 3X23A 2KUMA 2BB5A 2V4LA 4Y7NB 3QIJA 1K0SA 2MBBB 2XGTA 1NI2A 2AL3A 2HQLA 1FFVA 4DN4M 2X69A 4V190 5HGQA 4ICVA 2LFIA 5EE3A 2K25A 2ZCBA 5KHQA 1EL0A 3U7DA 2MQHA 1V86A 3SFDB 3JVZX 5M9OA 3KBXA 4LF9L 3ZQ4A 3Q2AC 1T3QA 1CKOA 1RL2A 1MGSA 1Y1VH 2UXDQ 4YSZB 3P7JA 4PZ6A 4R4IA 2Q8TA 4W9EA 5I9OA 1Q12A 2AUJD 4C2MB 4B3TQ 4OO1I 1LO5D 1NE3A 1JWAD 4L5RC 2RQXA 3B1LX 3LXFA 3OLMD 4PYUA 1BKBA 1DOYA 4QUCA 4DR3L 2WV6D 3IT4B 1PH8A 1G6ZA 4GU2A 2GBMA 2PZWA 3M3YH 4DV2L 3D31A 1PVOA 1LQBA 5I6WA 1ZE3D 2J0MA 4KIKA 3OHXC 1HFNA 2VZKB 3T16A 5I2XA 1TWGH 4ILWA 2HJ8A 2WDVB 2RCNA 2IO2B 4MSQB 2J0TD 3S2DB 2NBUA 1FVIA 2OF1A 3H94A 4JI6Q 5HURA 3TRZA 4ZRIA 3S2AA 4BOSC 4Y52H 3CC7A 2IY0B 3K9PB 1XCTL 5AJ3Q 2JYTA 1X56A 2PI2A 2E8GA 3HOUH 1UUPA 3DBRB 5IGCA 4WJWA 3S1RB 4B3SQ 1R4MB 2WKCA 4KLKA 4C3HB 1WTRA 3AM9A 1WGKA 1NSNS 4NZLB 3HOUB 1HZCA 3C0RB 1XMOQ 1YQ4B 5IIFA 4WJ3M 3DPDA 3UGBB 4KKUA 4PG3A 2EXDA 2MJ3A 1XLOA 3ZNHB 2I5LX 1VMCA 4WWOA 1TY2A 2GBNA 2XK5B 2K5VA 4BBRH 4QIWB 2RHSB 1T0SC 1RODA 4JK1C 3Q3OC 4C3JG 4JI0L 3K5NA 1SGHA 1L7YA 1N61A 4RNAA 1ZXHA 5ELCA 2Z0DB 3RNCC 2F0KA 3O65B 4FBJB 1A2UA 4UHVA 2KCTA 1BR9A 3PF5A 1WH3A 2F0UA 4G57A 1LYLA 2N9PC 4YCUA 4DV6Q 1R7SA 1D5XC 2WX0A 2TSSA 4L6TB 5C3WA 4BY7G 1VQPA 4JI0Q 4KDIC 1KRSA 4C80A 2K4KA 1GPXA 1GKHA 4CHKA 5G5HA 3SK8A 2BB6A 4LJOB 2KWUB 3A8IE 5E6JA 2CVRA 4A3GH 1DGSA 1F2RI 2D5DA 2SNMA 1VQLA 1FD6A 2LMCB 4TQ1A 2B39A 1U4RA 4HPPA 2KTRB 2ZPYA 2MPMA 3BDOA 1J5EL 4FJZA 1ZYRD 1PLFA 3VYRA 2AQ2B 2FCMA 2UUAL 1Y1VG 1TWGB 2IPKD 1K8RB 2ZTEA 4DQOC 1EY4A 4QF4A 4EQOA 4IPCA 3EHVA 5EPLA 3ULLA 1NYRA 2VB3X 3Q6SA 4X62L 3FDTA 1D5MC 1Z6HA 1NR4A 4A3CG 1HHVA 1MG4A 2IGDA 1FFUA 2VH1A 3HOXH 1EY0A 2K75A 1VQNA 3HKZE 4BBSH 3R7QA 4IG7B 3M4YA 1CA5A 2IO3B 3H91A 3OIPA 1EY9A 5E1FA 1UGMA 3STBD 1VQDA 4JI8Q 2X8XX 2O2VB 1HJPA 4QIWE 4W9FA 4F7XA 2LGDA 5DM63 1X9NA 1TWCH 1A6XA 5M5WB 2W54A 4IOCA 3AN1A 2O2VA 3LDZE 4A3EG 3H09A 1D1IA 1B8AA 4BBRB 5GADC 3VYSA 2JWZA 1FCLA 5D14A 2NR2A 2N4FA 5FLMG 3TN2A 2AHOB 4CO7A 5LMNL 2O6VB 3DWQA 3MXUA 2WDRB 1GHJA 3N1ZC 1WOCA 4R8NA 4HJKA 4WJQA 4M0WB 1JOOA 4NMZA 1SSNA 4EQPA 4D2KA 5G3LF 1XO3A 1MBYA 2LUMA 1HCZA 2KLCA 1E9MA 2XK5A 1YJIA 2WXFA 2EQSA 1E8ZA 1L6VA 2QW7A 4AJYB 4IN3A 3H8HA 2IX1A 3VUYA 5C0XG 4HKQA 2B2TC 2WXJA 2G9DA 2PIAA 4X65L 2B63G 4OGQC 5D7GA 2EYLA 2D3GA 5KNBA 5HG2A 1NAPA 3U9OA 4ASWC 2IY5B 4WJOA 4EVOA 2VQEQ 4R8IA 2KWDA 2W55A 4HDQA 4L5SA 2K33A 5M3FH 4K6DA 2Z0SA 2V1YA 5D3DA 4TUUA 2K5QA 2N3SA 5EBCA 2QEXA 4BBSB 3N30A 2VQEL 1MHHE 1RKNA 3KF6A 1NYQA 2RDBC 1J8CA 2JEAI 2K8BA 1NVID 2M0AA 1IBXB 1TU2B 2Y0SB 3PF4A 1P0RA 2HE7A 3PRPB 3Q8EA 2NN6I 3Q6BA 3ZJVA 2RGFA 3LNNA 4LK1C 3E0JA 5L37A 4A3EH 5BN4A 3Q8DA 5JJKA 4DK6C 2IY1B 3WAMA 2K3UA 3ULJA 2R6GA 3C19A 1CSPA 3PO2B 3CSFA 2MO0A 4EEWA 3CAMA 3A4SC 4GN1A 4XE0A 1EYDA 4KHZA 3PSIA 3SHQA 4NXNL 2Z8LA 4BBRG 4PMWA 1I3QH 2V3PA 2VH2A 1KNEA 4RH6A 3CPWA 3RZOH 1P3QU 3MHZA 3QB3A 2EE1A 1SYGA 1STAA 2G5DA 4P2CB 4DV0Q 3K6OA 4X3SA 2ALYB 2WU2B 4CJ0B 1TQOA 3H6MA 2R92B 3AMUA 3S15H 3W9CB 2FUG1 4GDLA 2KMMA 1WCMG 3DUZA 1T9HA 3HUIA 2W3SA 2K01A 3IVFA 1SDFA 1C9OA 2NCNA 2OTLA 3I2ZA 4ZRQA 2LVOA 5IP7G 4FHKA 4ZKBB 3HIZA 4BKSA 1F2LA 4RKLA 4IUMB 2MW5A 1Y1WH 3GS2A 5ISRA 3UQAA 4LFBQ 2C5CA 2HD3A 4P74A 1HA6A 1P98A 2F0TA 5EE0A 3T1HQ 2E2JH 2WDTB 4A6QA 1WM2A 2L83A 5IT9c 3HRDD 4JV5Q 3B6YA 1EFWA 4LF4L 4ZUIA 4RWSC 4UAIA 2AUKA 4LWCA 5LL6X 1VS0A 3N32A 4V0BA 1QZHA 2N9KA 1QQRA 2L0TA 3AE3B 3MAQA 1V5TA 3OAWA 1KRTA 1HTQA 1QOAA 4L5TA 2ASBA 4IFDJ 1Q1BA 3I56A 2H1EA 2JY6A 3DBHB 3BK1A 1OTRB 5C4XB 1XNQL 3NTIA 1IUEA 1QG7A 3B2GA 3CCSA 2KWCA 3H0GB 4A8XC 3PREA 3RYTA 2EY2A 4X6AH 1EZ6A 4DV2Q 1E1OA 3BVZA 3HOWG 2JA5H 4BKSD 1EYGA 1RAXA 5JJLA 2H89B 1STGA 3BWUD 3NG0A 1TIID 3EIVA 4Y7NH 2JP1A 4MTKA 1WGRA 2L0FA 4WAAA 4N9F4 1V1OA 4XQJA 1GUWA 5D94A 2WB1B 4LF8Q 3N1YC 2F3VA 1JOQA 3UDXA 1I35A 3AEEB 4K81A 4M8MA 1LLRD 3FILA 5J2RA 4KN7C 4I65A 3T1HL 2M4NA 3IG3A 4J1MA 2O5JC 4H2AA 3GDEA 4TVAB 3QCAA 5LMNQ 2K6DB 3WANA 4MGIE 2IO1B 2ZVNA 1NJIC 3NQTA 3J80E 1VD2A 2N7JA 1LTID 2DZIA 1LTAD 3K5OA 2K9XA 1AN8A 1NDDA 1SE2A 2YEPB 4II2B 4A3BB 4P6VF 2ICEC 3W1BA 1DOKA 1WF9A 3I4NH 2KD0A 3KWLA 4POGA 4KN4C 3SHLA 4HDOA 2L15A 3PLUA 2LSSA 2QGQA 5IGBA 3KLSX 3GTLB 1OGWA 1WMHB 2CH4A 4DV7L 1TWCB 3P1MA 3R8BA 5BYSA 1B9RA 1QUQA 3CMAA 4G7HC 1CZPA 4C3IB 1Q86C 2VRRB 1QNKA 1T5XD 1WFQA 1GB1A 1ROEA 1JB7A 3GV6A 2EMSA 4USAA 1X1MA 1PZKD 4GOCA 4GOPC 3TS0A 1G91A 3MTSA 1UE7A 4EKUA 3IAS1 3W1SC 1E7PB 1YN5A 1VDVA 4ZYNA 5C4XG 1U4PA 1G51A 3PO2G 1Q7YC 3NENA 2MP2A 1EWYC 5C3XA 3DEOA 2FNJB 2INPE 3NTKA 2CQOA 3D32A 1KLGD 5EE9A 2LHEA 5E6OA 1SFOB 4EUTA 1LM0A 1WY8A 1TWHB 1VRAB 4FA6A 1L1OA 3MZ5A 4BS9A 4FP5D 4B08A 1N6ZA 1TIFA 2E74C 4OVZA 3ZDMC 1WXMA 3DHGC 4A93B 4ZOHC 1CKMA 4I7ZC 2B2YA 1M94A 3AE2B 3UDIA 3ICEA 4HCPB 4M02A 4G0NB 5C4XH 3QG1A 1PXUA 2F0IA 1ZGUB 1BCPB 4CQNA 3G4SA 1ZXIA 3KBGA 1I4HA 1SMYC 3ZNZB 3S14H 3HEJA 4YXDB 1SSOA 4FXDA 1UWXA 3P4PB 3A9KA 3G7LA 2KJRA 2M2LA 1GJZA 3KDFB 1E7ZA 4ZRZA 1EWCA 1GM5A 3QARA 4WH4A 2K04A 3ZXRA 1HRJA 4C1NI 5FO9B 1DOIA 1I4RA 3VH4B 3AEGB 2OQKA 3URYA 1NUCA 4DUZQ 3KJPA 4CHTB 2RSOA 3H9DA 5CC4A 1TS3A 1PQSA 2O6VD 4E74A 3PIOA 2DGYA 3W2DA 4YY3Q 4NQLB 4LNFA 4RMFA 3VA7A 2R93G 1IW7C 3FKIB 1FPYA 4JGHB 1IYUA 3I72A 1YX5B 3RZWC 4XGAB 2EY1A 2JYOA 3NSWA 4K14A 5HHDG 1Y14B 4A3MG 3WOEA 3FKYA 1PFSA 3UDGA 5AEKB 1U4AA 2BS2B 4YTNB 2F4IA 5NUCA 1JRPA 1VQAA 5E6NA 1MHXA 4B3SL 4X64L 1PH2A 3G48A 3OTOL 1V5OA 1Q1EA 2NVQH 2YEPF 4EGVA 4HCEA 3A9JA 2PW5A 1XLPA 1IYJB 3K7AB 2WDQB 5DCNA 2ICIA 1XD3B 3GE8C 3KVFB 3NPPA 1T0RC 4HKZE 1N36L 2LUEA 2KEEA 1XEEA 1X3PA 4MJSA 4UP9A 4R4TA 1PYBA 2KVRA 3PQIA 4RGMA 3E0EA 1QNUA 4C3IH 2DBYA 2R92G 4RCOA 2PTLA 4NY0A 3Q8BA 1Z9FA 2F0DA 4R9WA 3GTGB 2AYOB 2WWZA 3IFWB 1YJWA 1EYCA 5EPJA 1XYIA 4CDEC 5K36G 2F0SA 1CQFA 3QOLA 3GTGH 4ARIA 2ZNVB 1JORA 3QX1A 2WAQG 3BVMA 2J4XA 3ONAB 1RM6C 2KENA 1L1OB 1K8GA 4JYAL 1CMXB 4A3IB 2UU9Q 3E6ZX 1HZ6A 2LJIA 5G5GA 4WRDA 3RULA 2PVGC 5GQOA 4B0MA 3Q3JA 1NTGA 4Q0FA 4X57B 5TSSA 1WX9A 2IGHA 5DPSA 1MD2D 3ER0A 5BMGA 1LUZA 1C7YA 2WXHA 4MELA 3OJ3A 3MC0B 5IO9A 1ZKOA 3U8ZA 2EYFA 2B2VA 4IUPA 2IT1A 3WIMA 2GLSA 3CQZH 2F3WA 1G8ZD 1PFNA 1XTCD 5KNDA 3AEVA 3ML9A 3ZKJC 3I4LA 2N49A 2EDGA 1K8MA 4IJLA 2KFKA 3C3LA 4IFDI 1V1PB 4KK7A 2QF7A 4KV6A 4C00A 3UQBA 3NP8A 3EFCA 3DDCB 3HVZA 4AS1A 4HMJA 1HR0L 1PFBA 2BYVE 2DYBA 1MI2A 2DNFA 1PH7A 3NWSA 4B9WA 3MJ5A 2OEDA 2RCFA 4EZJA 2OJRA 3C46A 4BY1B 1SB3C 5HKHA 1K9MC 3RNFC 5FO8B 2NVTH 1JR0D 1VZ6A 1QT9A 1LTLA 3GTKB 3HOXG 5J17A 3A9JB 3CCLA 3J9CA 1I4QA 4UY8C 3HOZG 4A3CH 3DOWA 5LXIB 2E2IH 1S3SG 1C78A 4DXAB 2EKEC 4JBKA 3RZOB 3MHBA 3W5VB 3ZTCA 1UNSA 1C76A 3AMZA 4K2KA 4MJSB 4WORA 4XQNA 1HH2P 1CQVA 1QF6A 3QC8B 4EOYA 2F03A 3APDA 1D6EC 4A3IH 5DAUA 2IX3A 3DBLB 2B76B 3HKSA 2MCNB 1VQEA 1FYCA 3AYHB 3J7ZC 3K5MA 4KKSA 1BNZA 1TBEA 1B44D 3HKZG 2B3AA 2CKHB 4AIMA 3Q3NC 3TIXA 3PTFC 4KDLB 2RKSA 3JW0X 1EFID 4KI0A 5KGUA 1PTOC 5JPNC 1VQIA 5IGFA 1QOBA 2Y0SE 2INCC 4H0LC 3B9JA 1UE5A 1AE3A 1H9MA 1BBWA 1JJ2A 3S2DH 4MIUA 4NXML 2J0JA 3RNEC 4NB3A 4HJ5A 2LXCA 4YTMB 1PMRA 2N7EA 2HCCA 2WXPA 2LEKA 4C2MH 1L0VB 1AZQA 3DMUA 3F2CA 3HOYB 1S5CD 3HVDA 5T8IA 4ARCA 2DENB 1PDQA 3KWVA 1EIGA 4XYQA 4A3JB 1JMCA 2AWOA 2QC8A 3F2BA 2FIDA 2KDMA 4F8MA 2HUGA 3N20C 4KGTA 2LXAA 2R7ZH 5AZGA 2R3ZA 2M17A 4FJVB 5CV8A 1GD7A 3A8KE 3ND9A 4CKEA 1HTOA 3ZNGC 4DBGA 4DHZE 2YTVA 2O2LD 1AH9A 2MX2A 4NQKE 1EY7A 4EE2A 3HOZH 2I38A 1SNDA 5BMHA 1X3QA 1E3PA 1SE4A 5JOBA 4KZCA 4DV5L 4GNXB 1KXLA 1K8OA 3W1SA 2VUMG 3GTKH 1EQTA 4S3SA 2BYFA 3C1EA 1G291 2FINB 5K5PA 1OQRA 3DQVA 1RLFA 2IYDB 2N0SB 4LDTD 1F0ZA 4C7YA 2ATWA 1NR2A 2XNAC 4GOPB 1VZ8A 3NBIA 4YWLA 4IPDA 5LL6S 4AH6A 2TMPA 1H4RA 4A3FG 2WQYB 1FRRA 1O80A 2ZJDA 3CKIB 4US8A 3HGBA 4J15A 2Z1CA 3QHTA 4DUYL 5M3MG 2C7HA 2G1EA 3U2SC 3EFUA 1QVCA 1EUVB 1EIHA 2OHFA 2ZZPB 2EY6A 1TZOA 2QCPX 3TP7A 3H3VH 1WI0A 3U52E 5MPOA 2CQAA 2D2CC 1KJTA 2DWQA 2CW0D 2Q8IB 1TWAB 4OIKA 4XYCA 5IODA 1V8QA 5GMVA 4BVUC 2M1MA 3GD7A 4TQUS 4KHPL 1XMQL 2NB0A 4MGYE 2EELA 2L52A 2KJXA 3MFGA 2ZJPA 2JA6G 4JI2Q 1TJEA 4JC0A 3A0JA 2N8NA 1FNUA 1C0AA 2LRUA 1WTWA 1FNVA 1BDOA 1HPCA 1K3BC 3EVQA 3F2UA 2FMCA 5CYUA 4CJ1B 4JE3B 4W9JA 1XJVA 2HHHL 3U30A 4AUQC 1GUGA 1QOGA 2UWQA 2F0GA 4DV1L 4GKJL 1YHQA 4FADA 4Q5VA 3H15A 2BDNA 1I6HB 4ZRJA 2MO1A 5GAHC 1FGBD 4LF7Q 1Z7TA 5IP9H 4B3MQ 1CJEA 3AV8A 1KLUD 3HFZB 3HOXB 4N59A 4DDID 5C3JB 1EM7A 4DF7A 3W5UB 3PGEA 4ODGA 4ZUJA 4LF7L 4LF8L 1X54A 2Q2UA 2WS3B 1WJUA 3N3KB 1XTDA 2WGSA 1I6VC 2WXLA 4GMVA 2QDFA 1X55A 1V81A 4JBWA 5C44H 1LTTD 3UIPB 1STHA 4DK5A 2MUYA 2OEOA 1QKZA 4U68A 3DVNV 2ZXPA 1PTOF 1GC6A 3OTOQ 5CGKA 1WR1A 3T51B 4ANVA 4BA2I 2LMCA 3J7YW 1XLNA 5G3LD 2CCZA 1YEZA 4OVUA 1VMPA 1JT8A 4CDFC 2ZM6Q 3LX0A 2KQ3A 3VR5A 1N9WA 1SYBA 4AOFA 3K5LA 4LFBL 2JN4A 1Y56A 1XT9B 1MJCA 2PI2E 2QDLA 1MHWC 1SYCA 5GAEC 4B3RL 3W1GA 5C44G 2B29A 2JA7B 1TWAH 1IBXA 4DV1Q 4GKJQ 3B08A 1OEYJ 3FILB 5JPMC 3I4MG 4OW0A 1NENB 2QIEB 5C4ZA 4YSXB 3S24A 3VR2A 3PIP3 1EQQA 3Q8FA 2BCOA 2KC1A 2RPVA 5JJZA 4LF5L 4QAYA 1AARA 2HIVA 1X32A 3MC8A 1H8CA 1WGDA 1O7YA 2E75C 3AEBB 3PHXB 4B0EA 1GJXA 4CBVA 3RNBC 2N9EB 4DWFA 2K6QA 3S17H 2FMMA 4DV6L 4K1RB 3SR1A 1F2YA 5DLQE 3PGZA 2L1BA 2JA9A 1U9RA 1R4MI 3QIAA 2BYEA 1UE1A 2YU9B 3CHBD 1A70A 1ACCA 1KM7A 1OQQA 2MNAA 3CCEA 1VJKA 4R1JA 1WZ3A 2F0OA 2NBWB 2Z6KC 3I70A 3BIID 2ID0A 2N88A 1VCBA 2G3QB 5M5YB 3UDFA 4GIVA 2K7VA 1PGAA 2F0QA 3CU7A 5JEAG 2KX3A 2K50A 3S16H 4GGQA 2IJ0A 2JJQA 2F3IA 1SE8A 4KY6A 3MXNA 4YCWA 2K1BA 1WVLA 1ONLA 2C5LC 1BUIC 4GDKA 1EU4A 2KYWA 5C44B 1B7YB 4OL7A 2PQAA 1YOVB 1CT1D 3PO2H 4NAMA 5TR5A 4A55A 4WWMA 1GVPA 4HR7B 4IO9A 1SYFA 2SAKA 2L0CA 1WTQA 1J7AA 2K39A 3AE5B 1I42A 1IZ6A 2XN9C 1TVXA 1IYFA 1P9DU 1FXAA 2CHXA 3Q3FA 4PMBA 2F4VL 3NHEB 2JXMB 2MHJA 3FKIG 4KHVA 4IURA 5KIXA 4FF3A 3PZDA 1TKGA 4ZHPA 1MIUA 1TKWB 2F52A 3PO3B 3QR8A 2V4IB 1K83H 4CKBA 3DM3A 5C5MA 1SJED 2ASQA 1Q3LA 1JQ4A 1WYGA 1LV9A 1L4ZB 3CRLC 1LT6D 5GAGC 2QMTA 2HDLA 1PZJD 2DY7A 1CZWA 2L8JA 2M19A 3VYTA 3UINB 1QVGA 3NHHA 1J0GA 1CM9A 5E7NA 5EKIA 3LGJA 3L2PA 1PTOH 3GTPB 1LFDA 2FFKB 4PS8A 1JC7A 4LFCL 4HSPA 5A2QE 4JI5Q 4FDBA 2CU3A 2WXRA 5A35A 2BH8A 1FR3A 3PVLA 4DNTB 3GTQH 2INNE 1Q0WB 4JI2L 2K03A 1PH9A 1HNZQ 2JA7H 1ZOYB 5C1ZA 5J39A 2OOBB 2R7ZG 1I5FA 1RWSA 1BVSA 4DV3L 5CV7A 1B4OA 1K51A 3K0XA 4JIOU 3EA6A 5M3FB 2KNBA 2A73B 1IBLL 5LLIA 1YNJD 2WINB 2F0JA 2HT1A 3A7AB 3D4RA 5CHFA 4XWWA 1N8RC 3DCGA 1C4CA 1WJNA 5GXGB 4IFDH 1D4BA 3L7ZC 3RR5A 4GN3B 1S40A 1U4LA 1DOMA 1IKLA 1J5EQ 2BS4B 1YMHE 4BBNF 5IGEA 3NBHA 2K5PA 3G6JB 3Q14C 3VR3A 2CJOA 3S2HH 2Y5CA 3E9IA 2EZVA 4M8NA 2IDYA 4IZ8A 3NBHB 4FJYA 4WJPA 2N9XA 1AP0A 1R9TB 3L08A 2MBHA 3VFKA 3MXNB 3QJZA 1SE3A 5E4WC 4DR6L 4FXGC 1HQMC 4GDKB 2AQ1B 2UXDL 2R61A 4JI1L 4MZ9A 4L2YA 2MBEA 3PS6A 1IHZA 5IOIA 1HA5A 1Y8PB 2DJFC 4JOIA 3GTMB 2J7QB 1N33L 2NZ1D 2R7ZB 1WX8A 2LZ6A 2PPHA 4KY7A 1PH1A 3UF8A 2B2YC 3ZJYC 4OVVA 2M8SA 3GTMH 2IZVB 4LK0M 4BOZB 4KMUC 2WLBA 3T3OA 1PTOD 2RSNA 1PYWD 3PZ8A 4L23A 3TJPA 2I5MX 2LVPA 1YNNC 2MSED 1F9RA 4XYOA 2L3ZA 5FK9C 3P63A 2Z9HA 3ULPA 3PUYA 1VLBA 2PNHA 4NPNA 4CDDC 4W9KA 2WAQE 1HNXQ 4X3KA 1VQJA 1YI2A 1GC7A 4FXCA 3DBHI 5IWAQ 2YLMA 5IYCG 3NZ3A 3VTUA 2R7DA 4IQZA 4GLXA 3I4NG 2OTJA 3UIOB 4K0KL 4M00A 3BK2A 3ZYYX 4A3PA 1H9RA 1CHQD 2NVYH 5IP9G 5COYA 1PH6A 3EQLC 3I73A 3RZDB 1GG3A 3SVMA 2AWNA 1C4PA 4MM3A 2F0WA 5BMIA 1AZPA 3AE7B 3T8MA 2I0QA 4ZQ3A 4LMQD 1YNND 3T1YQ 3OWFA 3R66C 1M90C 1YQBA 1IGDA 4A4IA 2ZXOA 3EFXD 2WXOA 2JA6H 4A3KG 5IYCH 1LACA 2X38A 4HSVA 2JA7G 5BO4B 1EY8A 3J81E 3DLLA 3Q69A 3IRBA 3QQ8B 1JMLA 2EXZA 4A3GB 3BYTB 4A3KB 3KLSA 1E5WA 4CJ2C 3NRZA 1VQ6A 4TKOB 2HDMA 4A3IG 2IHEA 4ME5A 3TMEA 2AQ3B 4P73A 2LGYA 2AMCB 4LDTB 1L0XB 2RVLA 4QMGA 4QL5A 3PT2B 3WOFA 4HIDA 2WHIA 3M9BA 3P75A 5EPKA 5IWAL 3P4QB 4DR7Q 3U58A 1WCMB 1SE9A 3GOEA 3MP9A 4IOIE 2KO3A 1RFAA 4GS3A 1N34L 5HFYA 5EDSA 4PZ7A 4WFN3 1O7IA 1NBFC 2MP2B 2WFWA 1KIXA 3CCUA 3O13A 5JXVA 1K0RA 1NBWA 4URKA 3VAWA 3NK9A 1EF1A 1MJDA 3T56B 2MJEA 2ZCCA 1VQ7A 2SNSA 1IBKQ 2KKCA 4A9AA 3ZIMA 1WTVA 1H9SB 4A3BG 1UF0A 4HN7A 1XMOL 1N60A 3NEMA 3L16A 4C4VA 1JE5A 5JHAA 3C2PA 2QILA 3P20A 4OZBA 2V4DA 1YBYA 2LS01 2I1KA 4HJ9A 2DJGC 3GZNB 3TL5A 4JBJA 1KFYB 2Y0SG 1J8IA 4MDKE 2PZTA 5IE8A 3GP7A 1X6OA 4IALA 1XCQL 4OO1H 5L95C 2KDEB 2KECA 2UUAQ 2KHJA 1IKMA 3DM1A 3CD6A 2E6XA 2F4VQ 2MJ8A 5JEAH 4IM2A 2E5LQ 2JA8H 4FULA 1KTKA 4GN5A 1VQOA 2KN4A 5E4XA 2MLBA 1OXUA 2CS4A 1SJHD 2XTIA 1HNZL 3QA8A 4RM9A 1IW7D 3DBSA 3ZRFA 3BZKA 4OHJA 4DXFA 3S17B 4FF1A 1L6UA 3AH7A 5IOCA 4NP5A 4DR6Q 2DAFA 2L32A 2VY3A 2RDFA 3D4WA 3UI2A 2JRHA 1I50H 5I4DA 3CIRB 3E9SA 4DR2Q 3SDZA 4KD4A 3V2TA 4BXXG 5FJ8G 3VTVA 3TCAA 2BKFA 1X3FA 4X66Q 3GTJB 2R7FA 3IHPC 4K3CA 2EJGC 3D4DA 3FRPB 2CHWA 2QJLA 3M4QA 2KZRA 1QVFA 3QAQA 2JXXA 3VRAB 3S16B 2RA4A 3TS2A 1EOVA 2CHZA 4LUOA 3VTWA 4WQMA 1SMYD 3K7UC 1GNUA 2N1WA 3EC8A 4MT5A 1I94L 4YTPB 1LTSD 2BT6A 2JA5B 1ZYRC 3AEDB 1X3GA 2YU9H 1G6JA 2BF8B 2X6GA 2JT4B 3DVGY 1DXMA 3HOVB 1IPGA 1L1OC 3IKJA 2R93B 4WJ4A 2YTYA 4C3IG 3QO2A 3OIQA 1WGHA 2K52A 4QQBX 1BUVT 3MC9A 3LWEA 4HMIA 4YHHL 4HVBA 4XZ4A 1V6EA 5E6PA 1WIAA 2K32A 5ELFA 1WR6E 5M5WH 1A8VA 3V6CB 2C9OA 4DR3Q 3OW2A 5GROA 1MI0A 2R2QA 2W9NA 2EYOA 3K0YA 4QGUA 1I7HA 4L1BA 4GNXC 3PO0A 4X66L 3VH3B 3ABVB 2PMVA 4PK1A 3I9V1 2NMQA 3N52A 2VNUD 4BKGA 3CMEA 1K83B 2NN6H 5IT9E 3H3VC 4HXDA 2A68C 4U673 2LY7A 1GUOA 5DNFA 4NDXA 5LMNW 2UUCL 1JICA 2GVBA 2B2VC 1QJOA 4JPBW 2HHHQ 3TDQA 1JWUD 2IGGA 2NVYB 3A74A 1KAWA 2A19A 1F52A 2PW9A 1EU3A 1ENCA 1L4DB 3SK5A 1JRUA 1MFWA 2CFMA 3J7AF 2KTRA 4DV0L 1RJTA 3S14B 1BCPD 3PUVA 2UXBQ 4MTNA 4A3DG 2WU5B 3H1UA 1PRTF 3RI7C 1STNA 1DOLA 1WGGA 3FC4A 3S2HB 4AQ7A 2ZJRA 1S3OA 2M0XA 5D6JB 3QWZB 2KVMA 2PMZB 3ZNID 3VR6A 3L0OA 3GTJH 1F9JA 4P16A 2PNRC 5JZEB 2EVBA 3KF8B 5J1ZA 3RCZA 3ZRCA 5DPTA 2N78A 3V61A 2JRIB 2KBNA 4G4KA 1YQ3B 1LTBD 2GN5A 4FNFA 3PRZA 2MEKA 4IUQA 4KIKB 3TEXA 2VZAA 3D6WA 4HIKA 4DR7L 5C3EB 4GB9A 3TEWA 4M8AA 5T1GA 5ELBA 1VQ8A 4HCNB 4N9TA 1HTLD 1HNXL 2IWHA 2HIXA 4MACA 4I7AA 1I3QB 1B53A 1ML0D 3KH0A 4HROA 2HQEA 2B8FA 2GA4B 2CWAA 3J80c 3S1QB 1UWVA 4LUZA 4LUVA 4XWTA 2E2IB 2K5HA 2LASA 1SNCA 1LT3D 5C4JH 2J0KA 1WRDB 2KFJA 2P5ZX 4G50A 5IN7A 2NWGA 4YT0B 1LTGD 5D3IB 1A2TA 1V9PA 3RNAC 3WAPA 3VDZA 2PQAB 2XIWA 2F0LA 4KTAA 4DHJD 1P7FA
chains in the Genus database with same CATH topology
1E2WA 4QUFA 4KY5A 3AEFB 4KX6B 3EUB2 4IKGA 2EYPA 2DYMA 2EPBA 2RDGA 3FPPA 2EKIA 1KDAA 3HOWB 4Q2JA 2Q5WD 3TEZA 4KKIA 2B2UC 3Q0AA 1LTRD 2MJDA 1FIQA 1Q90A 1W6JA 3NTHA 3AB9A 1ENFA 3ETRA 4FVMA 4A90A 5KRUA 4KKJA 1BOSA 1ZDVA 3K58A 1UEAB 5I6YA 4IUUA 4RFBA 2WACA 1SXTA 3N6RA 5DM73 5EE1A 2J42A 1DONA 4NW2A 4JX1C 2A69C 2VXWA 2MP1A 4LLGM 2I2YA 4DNRB 3MA2B 2XWJB 2PZUA 3KF8A 4BWGB 1XLQA 1HQRD 2JEBI 3Q22A 1FXIA 5C4JB 1K52A 1ZUD2 4OO1G 3M4OB 4H13C 4RGOS 2WNMA 1CTMA 2KOLA 5CV6A 3FEWX 2A74C 1ET6A 2E3TA 1F2ZA 3VRBB 1JW9D 3I8ZA 4K2LA 1FCCC 2XSCA 1JALA 5FLXE 5IGGA 3I91A 4F87A 2FJ2A 3OW7A 3A8JE 4REZA 5CBEE 4BA1I 1SNOA 2BDOA 1PGBA 4G7OC 4LAAA 2A6HD 4IUTA 1F77A 1RYJA 4H7BA 3EGRA 2F0FA 2Y5PA 3AECB 2LFNA 2E76C 1VR9A 2J53A 5C5LA 3MFYA 1B9NA 2B2UA 1EZ8A 1JWSD 2PW7A 4XIGS 4DXGA 5ELEA 3P4SB 2A69D 5H92C 1STEA 2KCCA 2MHVA 2VUMB 2B8GA 3OMGA 4A3MB 2IL8A 2VB2X 3BVGA 1YN4A 5M3MB 3TEYA 3W3AA 2B2WC 2XRSD 1HUMA 4K8JA 1AEXA 3SK6A 1JROA 4M0WA 5H8YE 4RHRA 1O78A 2WKDA 3NVWA 1Q10A 4HAEA 3SR6A 3WDNA 4WIPA 2EYMA 1KAAA 1VF5C 1WD0A 1QLBB 2E2DC 2PO4A 3P4RB 3V05A 2KEDA 3GO5A 1VF7A 5BYQA 3MEHA 1PDXA 3I90A 3N9YC 4Z9CB 3OWEB 5IGDA 1SF0A 3FAHA 3X3MA 4RKBA 2GRIA 1FNWA 5CV5A 4AYBB 1I4PA 3A55A 5AUIA 2WXNA 2JZPA 3S1NB 1II3A 1C79A 1B2TA 3KK7A 2ON8A 4DAYA 4YIJA 2H4OA 2WXMA 1WXQA 1MSHA 1S5ED 2NN6G 4FYDA 1WWTA 1GHKA 1HXYD 1ZEQX 5E3FA 3IT6B 1BCPC 3GTOB 1Y8OB 4ZK9B 5EQ0A 1ICWA 2BW2A 2PVOD 2V0GA 4L8JA 3HP3A 5ELDA 3L3OC 3LWUA 4K8IA 4TSSA 3D3RA 2SEBD 1OXVA 2HCIA 1TT2A 2BA1A 1TR5A 1YNJC 1GAQB 3DWMA 2K22A 1J9OA 3ERQA 2JWUA 1WTPA 5JAVA 5I9PA 1XF5L 4RF1A 2LKVA 1JCKB 1XWEA 3GQBA 3ZJUA 4KGRA 2F1MA 1PZID 2K0PA 1UGJA 4KD3A 5C6AA 4DFAA 3PUZA 4YWGG 3GV3A 1FMAD 1MVKA 3TP8A 3V96A 1KF6B 3DWGC 1MSGA 3K59A 2RMMA 3K57A 1FM0D 3FVQA 1JWMD 3LB8C 2CHBD 1JB3A 4XDXA 3CWIA 4RGTA 3BDCA 3HZXA 2WP9B 3NXWA 3TP6A 1PRTC 1L0YB 5FR3A 2B2WA 1QOFA 3M3YB 3RMHA 1V97A 2ENBA 3KQ4A 4O42A 1NI3A 4A3EB 1OXXK 1OO9B 4MM3B 4DK0A 2ZT9C 3PV0A 1FEHA 1V1PA 3TZDA 4E6IA 1T5EA 2X6LA 2NUCA 1A3TA 2BS3B 3VQIA 5LHY1 5FKAC 2WXQA 1A3UA 2A5HA 4DA2A 1E0BA 1GUNA 1QE6A 1TKEA 4K6LA 3IFDA 2ZW0A 4RF0A 3MXPA 2QSDA 1F2MA 1EQVA 1STBA 1CA6A 1DCZA 1F9QA 1HUNA 3A56A 3BZDB 3NUCA 3L9AX 1OFFA 1RD9D 3PUXA 2XVSA 3ZGZA 1A15A 1QOHA 1BO0A 4O1NA 1CHPD 2FE8A 4NJCA 2BOSA 1LABA 3HS0C 1E2ZA 1TY0A 5IT9L 1NCVA 4L63B 5FLXL 1Q8IA 2L1AA 1SIJA 2CJNA 3UI3A 2PCFB 5C0XJ 1FRDA 4IUVA 1TYGB 1H9KA 5C0XH 3DHQA 4A3DB 2WAQB 1HZ5A 1TS4A 5EGTA 1PFMA 3NVVA 1KDCA 1BXTA 1B9MA 1CI3M 1KRHA 3BDLA 2DY8A 2HDEA 1D5ZC 2KA7A 2F0PA 1PFDA 2DYOA 3PMFA 1JWBD 1AYFA 2F0MA 2XWBB 1SEBD 4FF4A 2MH7A 3IXSA 4N6EB 1SBBB 4R3DA 4XT1B 3T53B 3E5SA 1S5BD 1M4VA 3AB5A 1E0ZA 2A6HC 2D5GA 2FBWB 2QDBA 1BBXC 5HI1A 1JOKA 2CW0C 3PIO3 2GI9A 3I4MB 1G2TA 1N5XA 3PUWA 1RCVD 4B9XA 2IW3A 2M56B 3WCQA 4XT3B 1V8CA 2VZKD 1IYVA 4TMAB 2MGSA 4KJOA 1R4QB 2K5WA 3EROA 4EQNA 1GXDC 4FF2A 4KGSA 1DM0B 3GTQB 1LT5D 3BS1A 1KNAA 3SXHA 1P7EA 1S4ZA 4IUNA 5HGTA 4IDIA 1RDPD 2JA8B 1A3VA 1G2SA 5KNCA 1ESRA 3BG3A 1D2BA 4US9A 1STYA 2EY5A 3RPFC 3M7GA 1VDZA 4HCSA 1L5PA 2NTTA 2I46A 2FHTA 2RDHA 1H9SA 4XTCS 4QCLA 5EKKA 1IGCA 3IAM1 1Y1VB 3MVVA 2D9UA 2F0VA 4RA8A 2Q8RE 3AE8B 2NVXB 3QOJA 1YNTE 3T13A 3S15B 1F9SA 3IAYA 1FD7D 4RHSA 2KQ4X 1TS5A 1C4QA 3AE6B 4HRSA 5CBAE 1CZGA 1OXSC 3KLRA 1PGXA 1ZPSA 4PT5A 3U9SA 3KUPA 1ILPA 2O5IC 2KCNA 3TUOA 4LTUA 4HEDA 3A7LA 3IFTA 3NE5B 3NS1A 1UAPA 2F0HA 1PTOB 1EEFD 2PLPA 4KJNA 4GZYC 4DAPA 1N63A 1CK1A 3DEPA 4IFDG 5I2YA 1QILA 2BE5D 3FMCA 3T3NA 1K50A 4N9PA 2EJMA 2WXIA 4DAVA 4DGZA 2SOBA 3TBIB 2JSOA 1TWFB 2JSVX 2PKOA 4TQ0A 1Y69U 3B2FA 1DJRD 1RHPA 1B3AA 3OSOA 1DD2A 2IX0A 2K28A 5EBDA 5AUKA 5DEHA 2WXGA 1CFMA 2KAJA 1RF2D 1GUTA 2G9HD 5C0XI 3I4NB 1WD1A 3R2IA 1HFGA 2EOTA 2N9LA 5CMDA 3MXGA 4PQXA 2L12A 3GB1A 2PQEA 5F2DA 4C1NK 3QJYA 2XRQD 1I4GA 4QB4A 3JAML 1HEZE 4ULLA 1QWYA 5J22A 3BYYB 1ENAA 4J6HA 5M5XB 1MPEA 1TS2A 3AE1B 4J3OD 2W3RA 3MWYW 2QEJC 3VR8B 3NWTA 1F2RC 2WXKA 3Q8AA 1E2VA 1GB4A 2LGIA 1GUSA 5CV4A 3CRKC 4XDDA 2N55A 1EWHA 3DWAA 3Q8CA 3I3CA 4GDLB 3AEAB 4ITKA 3Q23A 1S5FD 2BYTA 1RTOA 1Z47A 1KDBA 3RFZB 4PNYA 1C4AA 2M00A 1WTOA 2M9VA 1E10A 4HJGE 4WAFA 4ZAIA 4C3HG 4HEA1 4N58A 4NAWB 2OXPA 3CQZB 4JWSC 2L11A 1O7LA 1ZXTA 3R93A 4F88A 4ZRPA 2BA0A 4KKTA 3HOZB 5FO7B 1RFKA 1DGJA 4C7ZA 2BBCA 2A6EC 1K53A 4K5VA 3EJIA 1NEKB 1EY5A 2WIIB 3OOCA 2D62A 1RTNA 4MHEA 1FO4A 4BY7B 2BE5C 3R2TA 3D8GA 5JVH3 2ACZB 3M7NA 1D1KA 3RUZA 1N62A 2QKIC 3D6CA 2NVQB 2AX5A 2F0EA 1AFPA 4MN3A 2NTSA 1WTXA 1LT4D 3OPOA 3ZJTA 3S1MB 4DK1A 4H44C 1F9PA 2YYZA 2NBFA 3I57A 4JPSA 4RGNA 1YN3A 2JXTA 2L9HA 3TP5A 1VCIA 2H88B 2V3NA 2ONQA 1O7ZA 1SYDA 4RAUC 4CGYB 2L55A 4NKLA 2E2JB 1ESFA 2JE6I 3T4AC 2JYEA 4GLSC 3C1FA 1Y8NB 2J52A 2Z4IA 2J7ZA 2W82A 4A3FB 1U4MA 4LJZC 4J8QA 3TZUA 3M85A 2K6AA 2L5TA 3IL8A 4DU9A 1ZP0B 1R4PB 3DXJC 2WP8J 4FO2A 3HG9A 4OZCA 4FXKC 2NVTB 5AFWA 1EOTA 4C56C 4X3UA 4XXEA 1ILQA 2JU6X 2F0NA 2JA6B 2DNCA 2PYKA 4XQQA 2PPBC 1PUTA 2ZW1A 4ZHOA 2KHSA 3L4PA 3P42A 5T1IA 4X3TA 1BMLC 4C3JB 3J80L 1HTPA 1S5DD 4YSYB 1AWDA 5D65A 5KYIA 4ID6A 2K5DA 3J7AV 1JQYD 3FPUB 1B50A 1TKYA 4HTHA 1DYQA 1XX8A 2SDFA 4M1UB 3E56A 5JVG3 4OZAA 2EJFC 3LYYA 1BF4A 1BCPF 1DZ1A 1N5WA 3VR4A 2EYJA 2O4XA 1SNPA 4UDUC 3SK4A 3R3OA 2EYHA 5K36H 2JX5A 3U4EG 5EJWA 4ABNA 1XXGA 1JE4A 1T6BX 1YJJA 4TRDA 3P1HA 3ND8A 1EEID 1GOZA 3Q24A 1AW7A 2ZXRA 3A54A 5BN5A 3PZ7A 3JAME 2RBMA 3SEBA 2A68D 1J7BA 1B1ZA 3QWNA 1WSPA 1OXTA 1QB5D 4XDCA 2BTEA 1ZDXA 1W6KA 5C2TB 3NVYA 2E2HB 3V3XA 1I50B 1C9FA 5C4HA 1DOXA 5KYLA 2DLBA 1M8AA 2B2TA 1C77A 3AE9B 4ZYSA 3NQIA 5CORA 4OIJA 1QCBD 2A6ED 2B63B 5A2QL 3RLFA 3NUHB 2GB1A 1IL8A 4RCNA 3ITPA 3X3NA 3VR9B 1KH0A 3HKZB 4K5WA 1SYEA 1ET9A 3VA5A 4PMCA 2HTME 3S9WA 5CR3A 4ZLTF 3RD4A 1EY6A 2I07B 2LHDA 1BQQT 5KEEA 1UWMA 3AU7A 1I4XA 1WRIA 5BYRA 2DN8A 5BN3A 3OMCA 2JQRB 1PRTD 2Y3AA 1H9JA 3AE4B 2DNEA 5CV9A 1PRTB 1SAPA 3VYUA 3NVZA 3C8YA 1E6EB 3U7ZA 2Z4HA 4ZKCB 4PV1C 1SNMA 3J81L 4CKCA 4MH8A 4WURA 1EYAA 3SE0A 1J7CA 3HRZC 5FOBB 1Y1WB 5EKLA 3SFEB 3TSSA 4G7ZC 1VZ7A 1V43A 5LNK1 4K5XA 3DWPA 1C48A 1C8CA 2OT2A 2K05A 2NYZD 5JEAJ 1KABA 4JWUC 2L4NA 1SNQA 2KUMA 2BB5A 4Y7NB 1FFVA 4DN4M 2X69A 4V190 2LFIA 5EE3A 1EL0A 3SFDB 5M9OA 3KBXA 3ZQ4A 1T3QA 1MGSA 4YSZB 3P7JA 2Q8TA 5I9OA 1Q12A 2AUJD 4C2MB 1JWAD 4OO1I 1LO5D 3LXFA 2RQXA 1DOYA 4QUCA 2WV6D 3IT4B 1G6ZA 2PZWA 3D31A 1ZE3D 5I6WA 3OHXC 1HFNA 2VZKB 3T16A 5I2XA 4ILWA 2WDVB 2J0TD 3S2DB 2OF1A 3H94A 5HURA 1XCTL 2JYTA 1UUPA 5IGCA 4WJWA 3S1RB 2WKCA 4C3HB 1WTRA 3AM9A 1WGKA 1NSNS 4NZLB 3HOUB 1YQ4B 5IIFA 4KKUA 2MJ3A 1XLOA 1VMCA 1TY2A 4QIWB 1RODA 4JK1C 4C3JG 4RNAA 3K5NA 1N61A 1ZXHA 5ELCA 2F0KA 1A2UA 1BR9A 2F0UA 4G57A 1R7SA 1D5XC 2TSSA 4L6TB 5C3WA 4C80A 1GPXA 5G5HA 3SK8A 2BB6A 3A8IE 5E6JA 2CVRA 1F2RI 2D5DA 2SNMA 1FD6A 2LMCB 4TQ1A 2B39A 1U4RA 2MPMA 3BDOA 1ZYRD 1PLFA 3VYRA 2AQ2B 2IPKD 1TWGB 4DQOC 1EY4A 4QF4A 4EQOA 5EPLA 1NYRA 2VB3X 3Q6SA 3FDTA 1D5MC 1Z6HA 1NR4A 1HHVA 2IGDA 1FFUA 1EY0A 3M4YA 1CA5A 3H91A 3OIPA 1EY9A 5E1FA 4F7XA 5DM63 1A6XA 5M5WB 2W54A 3AN1A 3H09A 1D1IA 4BBRB 3VYSA 1FCLA 5D14A 3TN2A 3DWQA 3MXUA 2WDRB 1GHJA 4R8NA 1JOOA 4NMZA 1SSNA 4EQPA 4D2KA 5G3LF 1XO3A 1MBYA 2LUMA 1HCZA 1E9MA 1YJIA 2WXFA 1L6VA 4IN3A 3H8HA 2IX1A 5C0XG 4HKQA 2B2TC 2WXJA 2G9DA 2PIAA 4OGQC 5D7GA 2EYLA 5KNBA 5HG2A 1NAPA 3U9OA 4EVOA 4R8IA 2KWDA 2W55A 2K33A 4K6DA 5D3DA 2K5QA 5EBCA 4BBSB 1MHHE 1RKNA 1NYQA 2JEAI 1NVID 2M0AA 1IBXB 1TU2B 2Y0SB 3Q8EA 3ZJVA 2NN6I 3LNNA 4LK1C 3E0JA 5BN4A 2K3UA 2R6GA 3PO2B 4XE0A 1EYDA 4KHZA 2Z8LA 4PMWA 2V3PA 1KNEA 4RH6A 3MHZA 3QB3A 2EE1A 1SYGA 1STAA 4P2CB 3K6OA 4X3SA 2WU2B 4CJ0B 1TQOA 3H6MA 2R92B 3AMUA 3W9CB 2FUG1 2KMMA 3DUZA 3HUIA 2W3SA 2K01A 1SDFA 4ZRQA 4ZKBB 1F2LA 4RKLA 3GS2A 5ISRA 2C5CA 1HA6A 2F0TA 5EE0A 4A6QA 2L83A 3HRDD 4ZUIA 4RWSC 4UAIA 2AUKA 5LL6X 4V0BA 2N9KA 1QQRA 3AE3B 3MAQA 1QOAA 4IFDJ 1Q1BA 2H1EA 3BK1A 5C4XB 3NTIA 1IUEA 1QG7A 3B2GA 3H0GB 4A8XC 2EY2A 1EZ6A 3BVZA 2H89B 1STGA 3BWUD 1TIID 2JP1A 1V1OA 4XQJA 1GUWA 2WB1B 2F3VA 1JOQA 3AEEB 1LLRD 3FILA 4KN7C 4I65A 4J1MA 2O5JC 4H2AA 3NQTA 3J80E 2N7JA 1LTID 1LTAD 3K5OA 2K9XA 1AN8A 2YEPB 1SE2A 4A3BB 4P6VF 2ICEC 1DOKA 3KWLA 4KN4C 3SHLA 5IGBA 3KLSX 3GTLB 3P1MA 1TWCB 5BYSA 3R8BA 1B9RA 4G7HC 1CZPA 4C3IB 1GB1A 1QNKA 1T5XD 1ROEA 4USAA 3GV6A 1PZKD 1G91A 3MTSA 3IAS1 1E7PB 1YN5A 1VDVA 1U4PA 1EWYC 5C3XA 3DEOA 2INPE 3NTKA 1KLGD 5EE9A 2LHEA 1SFOB 1TWHB 1VRAB 4BS9A 3MZ5A 4FP5D 4B08A 4OVZA 2E74C 4A93B 4ZOHC 4I7ZC 2B2YA 3AE2B 3QG1A 1PXUA 2F0IA 1BCPB 4CQNA 1ZXIA 3KBGA 1I4HA 1SMYC 3HEJA 4YXDB 1SSOA 4FXDA 1UWXA 3P4PB 3G7LA 2M2LA 4WH4A 4ZRZA 1EWCA 2K04A 1HRJA 4C1NI 5FO9B 1DOIA 1I4RA 3AEGB 3URYA 1NUCA 4CHTB 2RSOA 5CC4A 1TS3A 3W2DA 3VA7A 1IW7C 3FKIB 1IYUA 3I72A 2EY1A 2JYOA 3NSWA 4K14A 5HHDG 3WOEA 2BS2B 4YTNB 2F4IA 5NUCA 1JRPA 1MHXA 2YEPF 1Q1EA 4EGVA 4HCEA 2PW5A 1XLPA 3K7AB 2WDQB 2ICIA 3NPPA 4HKZE 2KEEA 1XEEA 1X3PA 4RGMA 1QNUA 2DBYA 4RCOA 2PTLA 3Q8BA 2F0DA 4R9WA 3GTGB 1EYCA 5EPJA 1XYIA 5K36G 2F0SA 1CQFA 3QOLA 4ARIA 1JORA 3BVMA 2J4XA 3ONAB 1RM6C 4A3IB 3E6ZX 1HZ6A 2LJIA 5G5GA 4WRDA 2PVGC 4B0MA 4Q0FA 5TSSA 2IGHA 1MD2D 5BMGA 2WXHA 3MC0B 1ZKOA 2EYFA 2B2VA 4IUPA 2IT1A 2F3WA 1G8ZD 1PFNA 1XTCD 5KNDA 3I4LA 2EDGA 1K8MA 3C3LA 4IFDI 1V1PB 4KK7A 2QF7A 4KV6A 3NP8A 3HVZA 4AS1A 4HMJA 1PFBA 1MI2A 3NWSA 4B9WA 3MJ5A 2OEDA 3C46A 4BY1B 1SB3C 5FO8B 1JR0D 1VZ6A 1QT9A 3GTKB 3J9CA 1I4QA 1C78A 3RZOB 3MHBA 3W5VB 1UNSA 1C76A 3AMZA 4K2KA 4WORA 4XQNA 1CQVA 1QF6A 2F03A 1D6EC 5DAUA 2IX3A 2B76B 1FYCA 1BNZA 3K5MA 4KKSA 1B44D 2RKSA 1EFID 4KI0A 5KGUA 1PTOC 5JPNC 1QOBA 5IGFA 3B9JA 4H0LC 1H9MA 4MIUA 4YTMB 1PMRA 2HCCA 2WXPA 2LEKA 1L0VB 1AZQA 3DMUA 3HOYB 1S5CD 3HVDA 5T8IA 4ARCA 1PDQA 3KWVA 1EIGA 4XYQA 4A3JB 2AWOA 2KDMA 4F8MA 2HUGA 4KGTA 2R3ZA 5CV8A 3A8KE 3ND9A 4CKEA 2O2LD 1EY7A 4EE2A 2I38A 1SNDA 5BMHA 1X3QA 1SE4A 5JOBA 3W1SA 1K8OA 1EQTA 4S3SA 3C1EA 1G291 2FINB 5K5PA 1OQRA 1F0ZA 2N0SB 4C7YA 1NR2A 2XNAC 1VZ8A 3NBIA 5LL6S 2TMPA 2WQYB 1FRRA 1O80A 3CKIB 4US8A 3HGBA 2Z1CA 2G1EA 3U2SC 1EIHA 2OHFA 2EY6A 1TZOA 2QCPX 3TP7A 3U52E 5MPOA 2CQAA 2D2CC 2DWQA 2CW0D 2Q8IB 1TWAB 4OIKA 5IODA 1V8QA 3GD7A 4TQUS 2NB0A 2EELA 2L52A 2KJXA 3MFGA 1TJEA 1FNUA 1WTWA 1FNVA 1BDOA 1HPCA 3EVQA 3F2UA 5CYUA 2FMCA 4CJ1B 4JE3B 1GUGA 1QOGA 2F0GA 4Q5VA 2BDNA 1I6HB 1FGBD 1Z7TA 1CJEA 3AV8A 1KLUD 3HOXB 4N59A 5C3JB 1EM7A 4DF7A 3W5UB 4ODGA 4ZUJA 2WS3B 2WXLA 1I6VC 4JBWA 1LTTD 1STHA 2MUYA 2OEOA 1QKZA 4U68A 2ZXPA 1PTOF 5CGKA 3T51B 4BA2I 2LMCA 3J7YW 1XLNA 5G3LD 1VMPA 3LX0A 2KQ3A 3VR5A 1SYBA 3K5LA 1Y56A 1SYCA 2JA7B 1IBXA 3FILB 5JPMC 4OW0A 1NENB 2QIEB 5C4ZA 4YSXB 3VR2A 3PIP3 3Q8FA 2BCOA 2RPVA 5JJZA 1X32A 1O7YA 2E75C 3AEBB 4B0EA 1GJXA 4CBVA 2FMMA 3SR1A 1F2YA 2L1BA 1U9RA 3QIAA 1A70A 2YU9B 3CHBD 1ACCA 1OQQA 1VJKA 2F0OA 3I70A 3BIID 2ID0A 2N88A 5M5YB 2K7VA 1PGAA 2F0QA 3CU7A 5JEAG 2IJ0A 4KY6A 3MXNA 2K1BA 1WVLA 1ONLA 1BUIC 1EU4A 5C44B 4OL7A 1CT1D 4NAMA 4A55A 4WWMA 4HR7B 2SAKA 1SYFA 3AE5B 2L0CA 1WTQA 1J7AA 2XN9C 1TVXA 1FXAA 4PMBA 2JXMB 4KHVA 5KIXA 4IURA 4FF3A 4ZHPA 1TKGA 1TKWB 3PO3B 2V4IB 4CKBA 5C5MA 1SJED 1Q3LA 1JQ4A 1WYGA 1LV9A 1L4ZB 3CRLC 1LT6D 2QMTA 2HDLA 1PZJD 2DY7A 1CZWA 2M19A 3VYTA 3NHHA 1CM9A 5EKIA 1PTOH 3GTPB 2FFKB 1JC7A 2CU3A 4HSPA 5A2QE 2WXRA 5A35A 1FR3A 4DNTB 2INNE 2K03A 1ZOYB 5J39A 1RWSA 5CV7A 1B4OA 1K51A 3EA6A 5M3FB 2A73B 1YNJD 2WINB 2F0JA 3A7AB 3D4RA 1D4BA 4XWWA 5GXGB 1C4CA 4IFDH 3L7ZC 1U4LA 1DOMA 1IKLA 2BS4B 1YMHE 5IGEA 3NBHA 2K5PA 3G6JB 3VR3A 2CJOA 2Y5CA 2EZVA 2IDYA 4IZ8A 1AP0A 1R9TB 1SE3A 5E4WC 4FXGC 1HQMC 4GDKB 2AQ1B 4L2YA 2R61A 1IHZA 1HA5A 1Y8PB 3GTMB 2NZ1D 2R7ZB 4KY7A 2B2YC 3T3OA 4LK0M 4KMUC 2WLBA 1PTOD 2RSNA 1PYWD 3PZ8A 4L23A 1YNNC 1F9RA 4XYOA 5FK9C 3P63A 3PUYA 1VLBA 4X3KA 4FXCA 3NZ3A 4IQZA 3BK2A 3ZYYX 1H9RA 1CHQD 5COYA 3EQLC 3I73A 3RZDB 3SVMA 2AWNA 1C4PA 5BMIA 2F0WA 1AZPA 3AE7B 4ZQ3A 4LMQD 1YNND 3OWFA 1IGDA 2ZXOA 3EFXD 2WXOA 1LACA 2X38A 4HSVA 1EY8A 3J81E 3Q69A 1JMLA 2EXZA 4A3GB 3BYTB 4A3KB 3KLSA 3NRZA 4CJ2C 4TKOB 2HDMA 4ME5A 3TMEA 2AQ3B 1L0XB 2RVLA 4QMGA 3WOFA 3P75A 5EPKA 3P4QB 1WCMB 3MP9A 4IOIE 5HFYA 4WFN3 3O13A 5JXVA 3NK9A 3T56B 2MJEA 2SNSA 4A9AA 1WTVA 1H9SB 4HN7A 1N60A 3C2PA 2QILA 3P20A 4OZBA 2V4DA 2LS01 1KFYB 1J8IA 2PZTA 3GP7A 4IALA 1XCQL 4OO1H 2KECA 1IKMA 3DM1A 2E6XA 2MJ8A 5JEAH 1KTKA 2KN4A 5E4XA 1OXUA 1SJHD 1IW7D 4OHJA 4DXFA 3S17B 4FF1A 1L6UA 3AH7A 5IOCA 4NP5A 2L32A 3D4WA 2RDFA 3UI2A 5I4DA 3CIRB 3E9SA 3SDZA 4KD4A 3V2TA 3GTJB 2EJGC 3D4DA 3FRPB 2QJLA 3VRAB 3S16B 2RA4A 4WQMA 1SMYD 4MT5A 4YTPB 1LTSD 2BT6A 2JA5B 1ZYRC 3AEDB 2X6GA 1DXMA 3HOVB 3IKJA 2R93B 4C3IG 3QO2A 3OIQA 1BUVT 3LWEA 4HMIA 2K32A 5ELFA 2C9OA 1MI0A 2EYOA 3K0YA 1I7HA 4L1BA 3PO0A 3ABVB 2PMVA 3I9V1 2NMQA 3N52A 2VNUD 3H3VC 1K83B 2NN6H 5IT9E 2A68C 4U673 2LY7A 1GUOA 5DNFA 4NDXA 2KACA 1JICA