3BVGA

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
237
structure length
228
Chain Sequence
b'ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type C-3
publication title Assessing energetic contributions to binding from a disordered region in a protein-protein interaction
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 65
structure length 228
sequence length 237
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bvgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bvgA01
1L0YB 2XRSD 3BYTB 3EA6A 2IJ0A 5FKAC 5D3DA 1S5BD 2CHBD 1KLUD 1RDPD 4L6TB 1BCPD 1LTBD 3BVMA 3TSSA 1FNVA 3GP7A 5ELDA 1TS4A 2SEBD 1D5ZC 1T5XD 1YN4A 1ET9A 1PYWD 1EU3A 2AQ1B 1XXGA 1G8ZD 2QILA 1LT6D 1AN8A 2XN9C 1I4RA 4RFBA 1JR0D 4TSSA 3MC0B 1MD2D 1FNUA 1I4PA 1S5ED 1LO5D 1ET6A 1JWSD 1I4QA 1S5FD 2RDGA 4K6LA 1SE3A 1PRTB 1ESFA 1PTOC 4Z9CB 1FGBD 1M4VA 3R2TA 1KLGD 1LTAD 4C56C 3R8BA 1LT3D 1LLRD 4NZLB 4RGNA 1LT5D 1YN3A 1B1ZA 2WV6D 4RHSA 1D5MC 2O2LD 4RGTA 5ELEA 4RGOS 1RCVD 1D6EC 1LTGD 1PZKD 3MFGA 1PTOF 1DJRD 1SE2A 1BCPB 3DWPA 1GOZA 2AQ2B 2XNAC 5D3IB 1CHQD 5ELBA 1EFID 4ZYSA 1UNSA 3DWQA 1PTOD 2NTTA 1HQRD 1LTTD 2QEJC 4UDUC 1SBBB 1V1OA 2AQ3B 5ELCA 1BXTA 1CHPD 1HXYD 4BWGB 4RGMA 1ENFA 5ELFA 1PZJD 1I4HA 1SJED 3BVZA 1DYQA 1L0XB 1RD9D 1JQYD 1TS3A 1S5CD 1PRTC 5FK9C 1KTKA 1V1PB 5I4DA 2TSSA 1I4XA 2G9HD 1LTID 1XTCD 1UUPA 1LTSD 1PTOH 4L63B 1HA5A 1STEA 1SEBD 1TY2A 1AW7A 1JCKB 1V1PA 1SJHD 1EU4A 3R2IA 1S5DD 1CT1D 1I4GA 1PTOB 2XRQD 1EEFD 1CK1A 3BZDB 1EWCA 1JWMD 1PRTF 1RF2D 3CHBD 3OWEB 1BCPC 1FD7D 2IPKD 4OHJA 1TS2A 1EEID 3EFXD 1SXTA 3W2DA 1PZID 3URYA 1TS5A 3BYYB 3BVGA 4DXGA 5TSSA 1PRTD 1B44D 2R61A 2NTSA 2Z8LA 1FNWA 4RHRA 1LT4D 4RH6A 1JWUD 3DWAA 4O1NA 1QILA 4RCOA 3SEBA 3V05A 1HTLD 3O13A 1LTRD 2RDHA 1TY0A 4DXFA 1SE4A 1YN5A 1F77A 2ICIA 3KLSX 2J4XA 1D5XC 1BCPF 1CQVA
chains in the Genus database with same CATH superfamily
1PH1A 5EPKA 3N30A 1BT0A 1WR6E 1ZOYB 3GOEA 2PPHA 3HRZC 1BUIC 2L32A 1HH2P 3ZXRA 3ZNID 2UXCL 2DZIA 3NWSA 2ON8A 1E5WA 2YV5A 2KVRA 3I73A 1G8ZD 2HQLA 2RKSA 1I35A 3BU2A 3A33B 3H6NA 4WJ4A 4M01A 3I55A 3H7PB 1H9SA 3B9JA 3HOVB 2KA7A 3J81i 1WXVA 2N9EB 2IO1B 4TKNA 1A3TA 3QHTA 1E90A 2IW3A 2NZHA 4DR1L 1BBXC 1FFUA 3BK2A 3NOBA 1CKNA 2F0TA 1M4VA 1PH4A 2V1YA 2B3GA 1MGSA 1LV9A 3OMCA 4YWMA 2K3UA 3I7FA 2R93B 4LNFA 3ZDMC 4MTNA 1LT3D 1Q10A 2A8VA 1CMXB 4F7XA 3F8TA 4I65A 4BY1B 4MGIE 2EYLA 1D5MC 5DM63 4DV6Q 2W82A 1F9PA 3BINA 2FBWB 1B9NA 2GVAA 3EVQA 2WACA 1YX5B 3SK5A 1L5PA 1PUTA 4A3IB 2MFIA 4BKSA 1GOZA 3FKIH 1HFNA 4DV0L 4NAMA 1XNRL 1NE3A 3W3AA 3M85A 1STBA 3CRKC 3E6ZX 4FDBA 5CYUA 5IGFA 1FXIA 2NYZD 2DNFA 2MW5A 2V3SA 3PRZA 4HPMB 4C7YA 4DAMA 4DNTB 1PHJA 5EE3A 4GLXA 3W1BA 4BY7H 1T0YA 3ZIMA 4JBJA 1OQQA 5JAVA 2WX0A 2IL8A 5JZEB 5BN4A 5FLXL 1PZJD 2IO2B 5J1ZA 4AS1A 1WRIA 4GIVA 4GDKA 4C3JB 1DYQA 3DWGC 1TS3A 3RD4A 3D8GA 3P75A 5C44B 1CFMA 4C3IG 4MGZE 1RL2A 2V9HA 1GJZA 2F3VA 1ML0D 4ICUA 2F4IA 4DV3Q 1WX8A 4QCLA 5DM73 2M4NA 2WB1B 1EOVA 4FF2A 2V4IB 4IPCA 2BWFA 2HCCA 4MJSB 4OL7A 4Y52H 2EJGC 1EIGA 1PGAA 1JCKB 1EOTA 1AP0A 1UE5A 4Y7NH 1F0ZA 4QUFA 1STHA 2KTRB 4Q2JA 1RM6C 3DDCB 3CIRB 2R92H 1N9WA 3VDZA 2N9XA 3KLSA 5IKCM 1HZCA 1P9DU 2X6GA 3OSOA 1QG7A 3VA5A 2EXZA 2R61A 4OWXB 4R8NA 4PV1C 3EQLC 3TMEA 3PTFC 5E7NA 1EY4A 4BXXH 1QZEA 3AE8B 3M63B 1FEHA 1QB5D 3DWAA 4A3BG 1JROA 2B2TA 3IT6B 3TREA 4A3KG 1Q1EA 4KDIC 1BBUA 4GLSC 1CA5A 3DBHI 4B3MQ 2VUMH 1FIQA 1OFFA 5LLIA 2B2TC 1QVGA 2J4XA 1D5XC 1VQPA 2KFJA 4DA2A 3OTOL 3ICEA 4KD3A 4IUTA 2K14A 2QF7A 1SNQA 3NQIA 4OEMB 2HJ1A 3N1ZC 1GXDC 4L5SA 2FCNA 5CX3A 5JXVA 2MQJA 2KLCA 3RI7C 1AE3A 2NN6G 4DHJB 2XTIA 2LGDA 1JMCA 1Y14B 3F2CA 1LM8B 2QC8A 4K1RB 4DUZL 2DYBA 2AQ1B 3FAHA 1MI2A 1XXGA 2UWQA 2K1FA 3UDFA 1EY9A 2M0XA 3AECB 1IGCA 2KTRA 3GTLB 3M3JA 1JT8A 4LF9Q 1IBLQ 1HEZE 2EDGA 4AQYL 1LO5D 2JZ3B 4FN2A 3NUHB 1PRTB 3TP8A 5FO7B 5IGDA 5C0XJ 1P7FA 2ZCBA 4A6QA 3RZOH 4PMBA 2NS5A 2Y0SG 2BYFA 2HUGA 3OLMD 4KY6A 4DV7L 4WQMA 1C48A 3SE0A 1GB4A 3DEPA 3L16A 1I50H 2RCFA 3H1UA 3QJZA 1JW9D 2KDIA 4NZLB 2MO1A 2VB3X 1ZPSA 2FIDA 3DBHB 4C3IH 2E5LL 2O2LD 4HDOA 3PREA 1H95A 2PVGC 2FE8A 3ZKJC 4BVUC 1LTGD 1WFYA 3PUXA 1XMQQ 3HM3A 1DJRD 3JAML 4XT3B 2FJ2A 2A5UA 2M9VA 1HNXL 3TUOA 1D3ZA 2ZJRA 2IO3B 2JSVX 5DNFA 1OTRB 1UNSA 3V6EB 4W9GA 2NVYH 1TKYA 1DXMA 2PW9A 2O6VD 2MBEA 2M1MA 2K32A 2G3QB 2Y5CA 1HZ9A 4KMUC 4U68A 3AB9A 2DAFA 1PH8A 1CHPD 2A19A 4GU2A 2KJHB 3QOLA 4FNFA 4XYOA 1FGUA 5BN5A 3AE6B 1ZYRC 1SNPA 4N9TA 2V1CC 2LEKA 2QHOA 1SJED 4B9KA 4FADA 3Q69A 4XYCA 4Y7NB 2KECA 1NNXA 4LF8Q 2N88A 2ZM6L 4A3BH 1PRTC 2R92B 4A3KH 2ZJPA 2E2JH 3IVFA 4H02A 5ELOA 4LFAQ 5LXHA 1RIPA 1RRBA 1V8CA 2EMTA 1S1QB 2EY2A 5CGKA 3PF5A 2MCNB 1DOIA 1OQRA 2LY7A 1NBFC 1WH3A 2FAZA 2QGQA 1DONA 4K5VA 4TVAB 1ACCA 2DJFC 1TY2A 2IT1A 5EPLA 4JI0Q 2IWHA 1EM7A 3K9OB 5JH5C 3H7SA 2XGTA 5JHBA 2KCNA 2CW0D 2WXGA 4G3XB 2LGYA 2VUMB 2SOBA 3E0JA 3CCLA 1T6BX 3QCAA 2NN6H 3ZRCA 1IZ6A 2DHZA 3T1HQ 1KRSA 3W1YA 4GLAC 2KUMA 2R2OA 1ILQA 2I5MX 3EFXD 4LUZA 1SXTA 3BG3A 5M3MG 1GJXA 3J81j 4CGYB 4DKAC 1W6JA 1XLQA 2NTSA 4XWTA 2KACA 1IGDA 3HOXH 1VQEA 2W3RA 3FHWA 1A15A 1D1IA 3R93A 3ZYYX 2KVZA 2LS01 4K7WA 4HPLB 1Q90A 1WJUA 5HG2A 2A73B 1AZQA 5FLXE 3H3VI 4HPPA 4ANXA 4TKOB 2B2YA 1YN5A 3I90A 4M02A 1EIFA 1Z5SB 2LFIA 2MJ3A 1N5XA 2B2YC 2L0FA 1RKNA 3S1QB 2KK8A 1GUNA 1YZ6A 4YIJA 2OXPA 3HKSA 4DV3L 1LFDA 1LQBA 4XXEA 4IM3A 4M1UB 2EYMA 4WJQA 4LAAA 2KWVB 3Q3MC 1V97A 1R9TB 1N32L 3E5SA 4JCVE 4RFBA 3L0OA 3MFYA 3I4NB 1P16A 2ZTDA 1PH5A 4A20A 1QNKA 1UE6A 3VH3B 4KD4A 5J22A 1IBMQ 4ZAIA 4O2DA 5JHAA 3PCOB 3K8AA 1FPYA 2Q8IB 2NN6I 2LRWA 2IZVB 4EZJA 2NVQB 3S14H 2ZT9C 3F2UA 4LF4L 3NG0A 1KL9A 2EYFA 1EYGA 4YWKA 2JA8G 1E7ZA 3MVVA 2KQSA 4B3ML 3Q8BA 3C8YA 4JPSA 1JRUA 1GHJA 4JC0A 2PE6B 1SNCA 3I4OA 3DVNU 4OXPA 1X3EA 4EQPA 3LNNA 2F0MA 5I2YA 1GHKA 3KBGA 2HHHQ 2D5GA 3SU8X 4ME5A 4KIKA 5KNDA 3DWQA 3WIMA 1A3VA 2KOXA 3FVQA 4A3KB 1K83H 5AUIA 2RF4A 4NW2A 1F9JA 2J53A 3NVVA 5C3JB 2WAQG 2V4DA 1P7EA 2CHWA 1SBBB 2EY5A 4IPHA 2WXFA 1SRUA 1Y8OB 4A3FG 1Q81C 4AQ7A 4LTUA 2ZEQA 1WZ0A 3D4WA 1YJIA 4ZRQA 4GKJL 1WR1A 3DXJC 3PLVA 3B08A 1KDAA 2AKWB 4LF9L 1IBLL 1P3QU 4B3TL 2JUOA 2FUHB 3CMMB 5DPSA 4TMAB 3AYHB 2UUBL 1SYCA 1ILPA 3SK4A 2KWCA 3RMHA 1T0SC 4JVZA 5HFYA 3IL8A 2I1JA 3HG9A 4X65Q 3EHVA 2ES2A 1EZ8A 5EGTA 3CCJA 2M8SA 4DAVA 2R7ZG 1N62A 3HOXB 2N8NA 1HA5A 4YHHQ 4Q0FA 3PV0A 1WTPA 2EZVA 2XK5B 3CW2C 2M19A 2JSOA 3M4QA 2A1AA 4AYBG 4DPGA 3H3VC 3UQBA 2JQOA 2MBQA 1H9KA 4GNXB 5CV4A 4CQNA 2BT6A 3GE8C 3ZRFA 3S1MB 3SK6A 4LF7Q 4B3SQ 5KEEA 3GTKB 2C7MB 1TS5A 1UWVA 3HZXA 4BBNF 3P4RB 4CJ2C 2WYQA 1JWUD 4J6IA 2ZXOA 3HFZB 3GTMH 3PV1A 3K5OA 2F52A 2TMPA 4RMAA 1BQQT 5C4JB 1RYJA 4FXDA 2WU5B 1LTRD 3P1HA 1D7QA 2L55A 3LWEA 1WTRA 4IUNA 1SE4A 4W9FA 2AWOA 5IA7A 2RHSB 2K39A 4KLKA 2JEBI 3Q6SA 1H9MA 1KD1C 4LF8L 1CQVA 2CJNA 4EOYA 1L0YB 1MSGA 4OO1H 2IGHA 1OXSC 1NAPA 2UXBL 4RF1A 5D3DA 5TR5A 1Y69U 1CA6A 4LFAL 2JA8H 3J7AV 3J7A5 2KN4A 4GGQA 1J19A 4KGSA 2LGSA 4WRDA 4JI3Q 3S17H 2VS1A 3S14B 2XK5A 1TS4A 3A55A 1IUEA 1ET9A 4R4CA 1U0LA 2GOWA 1TT2A 3FMCA 3STBD 2PQAB 3S16B 3DEOA 3F2BA 5FLMG 2D5DA 3G4SA 2DJGC 4DNIA 3S15H 2K8CA 2N7DA 4K2LA 3DBLB 4AP4C 4DQOC 2EJMA 4GNXC 1WXQA 4A3FH 3CKIB 3PRPB 5CC4A 4JI5L 2IX1A 1IBXB 4DK3C 2EKIA 1J8IA 4PS3A 1K83B 4QJFA 5D2MB 1WGHA 3C1EA 3AEEB 5IGEA 3K0YA 1N33Q 1JRPA 2DYMA 2VRRB 4DWFA 2RDBC 4G11A 1GUSA 2UU9Q 1EYAA 1PDQA 5ELEA 3PO2G 4HKZE 1ZKHA 1UH6A 2WHIA 3ND9A 1QJOA 1E0BA 1KC8C 1SE2A 4MTKA 1QOFA 2IDYA 1KNAA 2R7ZH 1YJ1A 4XE0A 3J80c 3DUZA 1QF6A 1EFID 4ZYSA 4FF4A 1QOGA 2OQKA 2KCCA 2GBNA 1H9JA 3F1ZA 4NPNA 1J6QA 4OO1I 2CS4A 1S4ZA 3PSIA 4YSYB 3I4MG 2ATWA 2OEOA 1Q3LA 1NSNS 3AFQA 1HTOA 4FBJB 1UAPA 4A3MB 1VR9A 2J7QB 4USAA 4EKUA 3K58A 2NVXB 1VQFA 1YX6B 1JORA 2CHZA 1UE1A 1SNMA 1GVPA 1WY8A 4OZBA 2MBOA 1L0XB 5D6JB 1ENCA 5E6OA 1V49A 4KTAA 4JK1C 4GDLB 5I9PA 1EQTA 2KMAA 3VTWA 1IBXA 1E2ZA 2BGFA 2DZKA 1YHBA 2D3GA 3AEFB 1Y1VB 3M9BA 2E2IH 1E6EB 1AYFA 1L0WA 3P63A 1FXTB 4BKSD 4C2MH 2ICEC 1SEBD 2R3ZA 4XDXA 3B0AA 4GXBA 4DDID 3U4EG 3S2DB 1XD3B 1V1PA 2OTLA 3D32A 2KX0A 3NK9A 4X64L 4JI7L 4BBSB 3ITPA 3ML8A 4DHZB 1CI3M 1A2TA 1EWCA 1TQOA 1RF2D 3PIP3 3OWEB 2INCC 3W5UB 2UUCQ 1NY4A 1C9OA 1SNOA 4NB3A 3MC8A 5EE1A 3A7AB 3HOWB 3J81c 4HJ5A 4AWJA 1BDOA 1ONLA 5C1ZA 3EECA 2FHTA 2M2LA 3V96A 1EIHA 3ZXVA 3FPUB 5FLMH 3CD6A 4HEA1 3BZCA 3I4LA 3H0GG 3L10B 4R3DA 1KF6B 2F4VQ 1EYCA 3FKYA 3U4ZA 1HFGA 2Y5PA 5NUCA 2UXCQ 4ARIA 1RLFA 2K7VA 2JYTA 2LJ5A 3U58A 4UY8C 4JV5Q 3D4RA 3GO5A 3K81C 1C4PA 3QG1A 3S15B 3SHLA 3K80C 2GBKA 1K9MC 3NSWA 2SNSA 5FKAC 2MSED 2QCPX 4YY3L 1PH9A 4K14A 4JWSC 3PO2H 2QMTA 4X65L 4OX9Q 4QQBX 3RUIB 2IY0B 4KN4C 4DXAB 1FNVA 2ZTCA 2QCZA 5EQ0A 4DR1Q 4KV2A 4APVA 4NP5A 3GDEA 5LNK1 2L8JA 1PYWD 4IPGA 3D3RA 1F9RA 4JI8Q 2W54A 1HUMA 3AU5A 4G50A 4XX5A 1I4RA 4XQJA 1ZGUB 4TSSA 1YJJA 3E9HA 3OIPA 1WJ4A 4UPAA 1YD8U 5BO4B 1D2BA 4JI6Q 5DEHA 3PIPA 2Q2HA 3CQZB 3HOUB 2Y3AA 4IFDI 3LXFA 3PRMB 1U4LA 4YTPB 3I5JC 2WAQE 4LF7L 4JPBW 3VRBB 3W5OA 4RKLA 1V6EA 5IODA 1JALA 4MELA 3FILA 1PA6A 1JJ2A 5CTRC 2KTFA 4N9F4 5GADC 1LUZA 1A63A 1CM9A 4B9WA 2JA5G 2LJIA 3NHHA 4TV3A 1K8AC 1XLOA 3K7AH 2FMMA 3NELA 3CSFA 1AE2A 1PZKD 5JJZA 2K8BA 3DM1A 4MM3A 4JOIA 1WYWB 1K3BC 3DWPA 1J0GA 3KQ4A 4RM8A 1C3TA 2NUCA 2DZJA 1YNXA 3MJ5A 4QB4A 2BH8A 4JOIC 2MGSA 5CR3A 4NNJB 3RNUA 3ND8A 3NTKA 4JI3L 5BN3A 1S72A 3I8ZA 1IP9A 2F0FA 4BKTA 3HOYG 2L0CA 4M8NA 5CV6A 4P1BC 1NVID 1TGZB 1Q1BA 4PZ8A 4RGMA 4DV4L 3VR8B 2EOTA 4HCEA 1KM7A 4ZKCB 2YYZA 3DHIC 4DR4L 2VY3A 2ZNVB 4N59A 3E3XA 3QR8A 3AE2B 4QAYA 4W9EA 1IHZA 1GUGA 3H0GH 1Z7TA 2EXDA 1XPUA 1AARA 4OVUA 4KKTA 2CKHB 4B6WA 1ESRA 3T53B 4L63B 4ILWA 1N33L 3IFDA 5HY6A 4LF5Q 3HUIA 3WA0A 3X23A 4ZHOA 2WDQB 4PG3A 5D7GA 2UU9L 1CJEA 3IFWB 1TT5B 1E1OA 3O65B 1EF1A 3JW0X 3R2IA 4DHJD 2KD0A 1E8ZA 2C35B 5KGUA 2LWPA 4K3CA 2XRQD 1EEFD 2OQ0A 4LCDE 4X6AH 4RAUC 3UINB 1ZYRD 2MBHA 5HI1A 3T3OA 4KHZA 1SYEA 2O5JC 1L0VB 2BA1A 1KAWA 3ULJA 3OTOQ 3A5UA 3PO2B 4FHJA 1PRTD 4BS9A 3A56A 4OVZA 4MHEA 4W9KA 4XDCA 5T8IA 3Q8EA 4IM2A 1NMFA 3Q2AC 1OXTA 4LJZC 2KCMA 5KRUA 2L9HA 4N8X1 3HOZB 5BMHA 3L0WB 5J39A 2B2UA 3U9SA 1RHPA 1N5WA 4DN4M 1TWFH 3NTIA 3PF4A 2IY5B 3B2FA 4QUCA 3KLSX 1LACA 3WAPA 1K3RA 3RLNA 2EY1A 1BCPF 1X65A 4K7UA 1WZ3A 3K57A 2ZNVC 4TQUS 1SIFA 3MHSD 5KNBA 3LGJA 2JA5H 1EYDA 1KLUD 1MI0A 4KHPQ 3AE7B 1JICA 2EYPA 2NCNA 5C4ZA 2ZJDA 4URKA 2NWGA 3SR1A 3ZTDA 1L4DB 2Y5BB 1GUAB 3G7LA 2OHFA 2INDC 1SFOH 1LM0A 4IOCA 1FXAA 4QIWE 2VW9A 2IYDB 3PHXB 3S1NH 3G6EA 3UE0A 3K7AB 3STBC 1JB3A 1MD2D 1SB3C 2V3PA 3LDZE 2LZ6A 4KDLB 1YHQA 2E5LQ 4PT5A 3M4OH 2ZXRA 1VZ6A 4DV1L 5L83A 4JQWC 1KDBA 1PLFA 2F0SA 1H4RA 4Z9CB 2UUCL 1WGRA 3HOYH 3NRZA 3RMKC 2JEAI 4HSVA 1L6UA 1UBIA 2EMSA 3RLFA 1PVOA 4R1JA 2B8GA 1XTDA 1T5EA 2CJOA 5EPJA 4FXGC 4IOIE 3Q0AA 1KNEA 2MNAA 2L83A 3BIID 3ZTCA 3QIAA 3RFZB 4IO9A 2F4VL 5EE9A 3P7JA 2F0DA 1IPGA 4BZAA 2JWUA 4PZ6A 4CDFC 2RVLA 4C3HB 1VQ5A 2YU9B 1HZ6A 2WXOA 1GB1A 4A3GH 2WXHA 4JV5L 4PMWA 1YIJA 1CHQD 4LDTB 4KI0A 2XWBB 4BBRB 2JRHA 1WYGA 1BMLC 2YTVA 3HP3A 3H0GB 2CVRA 4L5RC 2A68D 4GDKB 4OX9L 1HUNA 2CU1A 2FCQA 3N3KB 3NZUA 5GAEC 1JQ4A 4W9LA 4MACA 2ZM6Q 4JBKA 4YCWA 4DK1A 1V8QA 3MXNA 4A3CG 4S0RA 4F88A 2MP2B 2BS4B 4JI8L 4P74A 3G48A 4BWGB 3QQ8B 1LABA 5IY0A 2KYWA 1U4PA 2M0AA 4CKEA 1PDXA 3BVZA 1X9NA 2LGIA 1VLBA 1K28A 4JI6L 2OF1A 3T1YQ 3OPOA 2XEWA 5M5WB 2LI5A 5IOCA 1AEXA 1QNUA 4M8MA 2CH4W 3H09A 4MSMB 1KAAA 4JYAQ 4C1NI 3QO2A 4HR7B 3A9KB 4ULLA 2KHIA 2WP8J 2C60A 2WDVB 4PYZA 4K8JA 4X66L 2WP9B 4DDGD 3H9DA 2VH2A 2IO0B 1JE5A 1PTOH 4G4KA 4HJ8A 3P20A 4NJCA 3ERQA 1ZE3D 2B63G 3OW7A 3PQIA 3PGEA 2AL6A 5IT9E 1CSQA 1M1KC 2K6AA 3NQTA 2QA4A 2E2HH 2QIEB 2KHSA 2F0LA 3FP9A 5FOBB 3U52E 1TWFB 4IUPA 5JPNC 2L7RA 1SAPA 4GN1A 3CHBD 3U4VA 3TDQA 4ICVA 2ZPNA 3CAMA 3I56A 2KDBA 1JMLA 3WDNA 2F0PA 2BYVE 3BYYB 1ZKOA 3D0FA 3NXWA 4TRDA 1YNNC 5D14A 2MP2A 3M95A 2WXLA 4REZA 3NZ3A 1JB7A 1YJWA 3HHMA 1HTLD 3HKZB 5IYDH 4M00A 3T8MA 1EF5A 5AEKB 4XZ4A 3NZSA 2Z9HA 2K4KA 4LWCA 3B2GA 1N32Q 2EYHA 1OTCA 1C8CA 3C3LA 2EPBA 3J7ZC 4U673 3A9KA 1SYFA 4GOCA 3M4OB 2V0GA 5BMIA 5C0XG 1GC6A 1RDPD 2H88B 4K3BA 1WX9A 4RG1A 3R3OA 1X56A 1A5RA 2FFKB 5ELDA 5JEAJ 2KQ7A 2PE9A 4LF5L 3QARA 4HMJA 5A2QL 2D11A 1UEBA 1W2BA 3ALBA 1WTHA 2RQXA 1X1MA 2KC1A 1YJ9A 4LF4Q 3N9YC 4KKUA 3MC0B 1KOTA 1S3SG 2WDRB 2L11A 2PZWA 3T13A 1IBKQ 2F0UA 1ZDXA 4A3GB 3DVNV 2JN4A 2BOSA 4A3CH 1VMCA 3HVZA 1U5KA 1EY8A 4ALPA 4P2CB 1YJNA 1G291 1OXVA 3GTJH 1J8CA 3RZDH 2IGDA 3U7DA 2AYOB 2BW2A 3S9WA 4CDCC 3JSVB 3CMEA 1NENB 2W3SA 1RODA 1B1ZA 4FVMA 5K5PA 3L4PA 2VZKB 4AUQC 4RGTA 5IN7A 5MPOA 5KIXA 3RNFC 1L1OA 2E76C 2WB1E 1WE6A 2GLSA 3N1YC 4I6PA 4IKGA 5ELBA 4GKJQ 2J42A 3S1RH 2R6GA 1H9RA 2B63H 2PMZB 4GZYC 1YITA 4B3TQ 3QAQA 4DV5L 3GZNI 3TCAA 4KHPL 2D2CC 2UUBQ 1KRHA 4MNOA 3UDGA 1HQRD 1VQMA 4G0NB 4ZRJA 5G55A 5IP4D 4HJKA 2I5LX 3FKIB 1C0AA 1QT9A 3AEAB 2HTME 1HQMC 2M00A 1WD0A 3K5MA 4ANWA 2HE7A 2KCTA 2Q8RE 3ZNGC 4HIMA 1KABA 3NY5A 2KJ6A 4OGQC 4YTNB 1TWAH 1VQKA 1TU2B 4CHKA 1EY6A 2E2HB 4BY7B 1HE8A 1JQYD 4WWPA 1WJNA 1VQ6A 3QC8B 1EFWA 3VR9B 3APFA 4LNKA 1I4XA 1XTCD 2N0SB 3JSVA 4JGHB 3CCVA 3ZGZA 1U4RA 2BA0A 1LTLA 3AV8A 5KYIA 4L23A 3A5ZB 1QQRA 1UE7A 5CHVC 5EKKA 4CKBA 2PLPA 3EIVA 4MT5A 2KAJA 3V2TA 1BBWA 3KDFB 5C0XH 2DZMA 2J0MA 4ARCA 2LGXA 2E8GA 2G9DA 4HEDA 2A5HA 3BZDB 4EUTA 1NR2A 1X32A 4X3UA 1PFDA 3IFTA 3B1LX 3PHWB 2B2WA 1LYLA 1ZW7A 1WI5A 4PQXA 3TQYA 4MH8A 3ENEA 2KEEA 1F9QA 4S17A 3TZDA 2B2WC 2MEKA 2UXBQ 2DY8A 5JPMC 2XIWA 4DV2Q 2JA6G 1VQOA 4XQQA 4MH0E 3SEBA 3NP8A 2EJFC 3MHBA 2R7DA 4H13C 1GG3A 1XCQL 3BDOA 1TY0A 4BOSC 4DR3L 2K5HA 1UGMA 1VF7A 3KWVA 2F0GA 1BKBA 1HTPA 4KJOA 4WJ3M 1WM2A 3KF6B 2L5TA 3T1YL 2FINB 2D0PA 4L1BA 3EJIA 1X3QA 2F0EA 4N6EB 4P7IA 4CYEA 4NJ7A 4JYAL 3H15A 4JWUC 3ETRA 4LNQA 4A3DG 3FDTA 3NBIA 3A7LA 3EFUA 3SGIA 1GUWA 1E9MA 5AZGA 2WXJA 4JI5Q 1Z6HA 2KHJA 2BB5A 2RGFA 1WTVA 4KGTA 3KDFA 1TWGH 3I2ZA 1B50A 4ITKA 3WAMA 1B2TA 3GB1A 2LXAA 3AEVA 3DHGC 2JK8A 4IALA 1FNUA 2JYEA 2H5XA 4NAWA 1JC7A 1S5FD 4K6LA 1K52A 3RYTA 2BYEA 5IP9G 2G4SA 4N58A 2BYTA 2KZRA 4LLGM 3CCMA 4NMZA 1XYIA 5C4XG 3IXSA 3FC4A 1Z9FA 3J80L 3QWZB 4RGNA 1SGHA 2Q2IA 1VQBA 3OMGA 3RZOB 3OJ4B 3ZO5B 2FNJB 1KFYB 2KX3A 1YVCA 4LK1C 1IL2A 1TWCH 1OEYA 3Q8FA 3PUWA 4KIKB 4FULA 2WWZA 1I50B 4H2AA 4A55A 5LMNW 3KF6A 1DZ1A 3S2HH 2DY7A 1GC7A 3Q24A 1BCPB 5EKIA 3TP6A 3Q8CA 4C3IB 3AH7A 2KT7A 3NPPA 1M94A 4WWMA 1BO0A 5AJ3Q 2B39A 1E7VA 3LYYA 1VCBA 1EO6A 3KBXA 1IL8A 2A68C 5LMNQ 3W1SA 4K7SA 1R4QB 1IYVA 2L52A 3AI5A 2AHOB 3A54A 4A4IA 3SDZA 2AQ3B 5ELCA 4NKLA 2NVYB 4P73A 5EAYA 5A2QE 4D2KA 4EEWA 3JVZX 1FO4A 3T4AC 2UU7A 2P5ZX 1FD6A 1SROA 1I4HA 3E9IA 4WIPA 2L1BA 3TRZA 2A6HC 5EDSA 5KHQA 2CKZB 1IBKL 2F0OA 1WGYA 1Q46A 2KN5A 2BDNA 1S5CD 4X64Q 4JI7Q 3ONAB 2JA6H 1GO3E 4ABNA 1JWAD 4DR7Q 1QZHA 3OYYA 1G6ZA 2D3AA 1QCBD 3VTVA 5COYA 1CUKA 5FR6A 3RZWC 3VHTC 2EVBA 5D65A 2B76B 2K28A 4RMFA 2D0OA 1JJCB 4A3BB 3J81L 2HD3A 2E2JB 4EVOA 4CBVA 4A93G 2HD5B 3FEWX 3MEFA 2JZZA 1SJHD 1A70A 2QJLA 3HM6X 2KWUB 4A3DH 3SR6A 3V61A 4A9AA 4LJPB 2NPTB 5M3MH 5FO9B 1BCPC 4KY7A 4OHJA 4I6NB 4J3OD 2JA7G 1EUJA 4KHVA 4GN5A 2K50A 1VQNA 2WKCA 3UE1A 1FNWA 4HRSA 4S3SA 2BH2A 4YY3Q 3KLWA 2GMIC 4WJNA 3X0WA 3MXGA 4IWPA 4KGRA 1TWGB 3I72A 5C4XH 3RULA 1L6VA 4ZDVA 1DM0B 1NYRA 4FLHA 1IKLA 2Y0SB 3RNEC 4IOAA 4MIUA 1S5BD 5LXIB 3JAME 3VA7A 3OHXC 2K01A 4L2YA 1STGA 1UGJA 1CKOA 2JF5A 4PZ7A 1N6ZA 3ZJTA 5DPTA 4WJWA 4AJYB 4W9DA 2IX0A 1TYGB 2GBRA 2VXWA 1NTGA 3NEMA 1RJTA 4P1CC 1JOKA 1VQ4A 4WFN3 1NYQA 2LHEA 5C4HA 2NPTA 1I94Q 3T3NA 4KZ0A 4IURA 3S2HB 1CZPA 2ZVOA 4XC2A 5G5HA 4WORA 2BE5C 4ZCKA 1J9OA 3J7AF 4FJYA 1YI2A 2H1EA 2XSCA 1HNZL 1A8VA 1HR0W 1VZ7A 4LFCQ 2GBJA 4FYDA 2PTLA 4B3RL 3R2TA 1XPRA 2I46A 2JE6I 3QA8A 3K7UC 4KZCA 1UF0A 2YEPF 2QW7A 1Q5WB 4GN4B 1CSPA 4DV2L 4I7ZC 2HJ8A 2JX5A 2NVTH 1JOQA 3GV3A 1SF0A 3AN1A 1STAA 1HR0Q 4HCSA 2Z6BA 2F0KA 4DGZA 2K5NA 2O5IC 3PT2B 2AQ2B 3L54A 5GROA 1YNTE 4DV4Q 3HK0A 1VQHA 1KH0A 4AH6A 1D4BA 5E6PA 2PIAA 4DR4Q 4A93H 2MA9B 4YT0B 4A3PA 2YTYA 1XNQL 3SK8A 2WXPA 3CCQA 4KSKC 1XQQA 2JJQA 1Y8PB 1SSNA 3M62B 1BXTA 1K73C 2BQQA 3N1XC 2JA7H 1GAQB 2MJEA 4K6DA 1MSHA 4RWSC 2AL3A 2JPHA 1R7SA 4R4IA 1ZUD2 1KTKA 1V1PB 3D6WA 5M3MB 5LMUL 5K36G 3A4RA 3GE3C 4QF4A 1JJGA 1WRDB 4W9HA 5AUKA 1HTQA 5M3FG 1WCMG 4K8IA 2REXA 5F2DA 2UXDQ 3J80E 3MWYW 3LB8C 3R66C 5DCNA 1DGSA 1E2VA 2PW5A 1QOAA 3QX1A 4DUYQ 5G3LF 1YQ3B 4X57B 1V5OA 1C4QA 5IYCG 1S5DD 3E0EA 3K5LA 1N34L 1ASYA 1LGRA 4QY7A 5C4XB 3EUB2 5DLQE 1A3UA 5EBCA 4RF0A 3VR4A 1GUOA 3IBEA 1N63A 1VZ8A 3G71A 1FD7D 1F9SA 1RAXA 4MDKE 2LKVA 5AJ3L 3W2DA 4GSWA 1ISNA 2VQEL 2KBNA 4E74A 5M5YH 5LMNL 1MJDA 4NJ6A 4A3JG 1TTNA 2LVPA 3W1GA 5H1SE 3EFCA 4IW0A 2V4LA 1QILA 3V05A 3ZNZB 4YCUA 5E6JA 1TIID 4IFDJ 3RT3B 4DXFA 3PMFA 3ZQ4A 3CC4A 3NUCA 3MC9A 3GTMB 5IGBA 2L76A 3GQBA 1XMOQ 3VAWA 1J5EQ 3VUXA 3A0JA 1PMRA 1FMAD 3MP9A 3N6RA 5J17A 1GD7A 4DR7L 3T56B 2WXIA 4C00A 1Q12A 1LTBD 3BVMA 4DV1Q 1TKWB 2FMCA 4LDTD 3PSEB 2PYKA 1PFBA 3SVMA 1WMHA 3SHQA 4LUOA 1UWXA 1YNND 4DR6Q 2JA8B 3ER0A 4K2KA 2NVTB 2ENBA 2KJXA 3VR2A 4XT1B 2WXQA 3S17B 4OWWB 3FILB 3MTNB 5C3WA 3NENA 2CQAA 1I4QA 5IO9A 1B9RA 2QDBA 3TZUA 1XJVA 5FR3A 1EQQA 1E2WA 3M4PA 4HN7A 1UELA 5JVG3 2I07B 1FRDA 2QEXA 1MPEA 3FRPB 2RBMA 5T1GA 2W55A 4A93B 1VJKA 2ZW1A 1E0ZA 4MM3B 2WAQB 3ZUNA 1S40A 2K03A 1Y8NB 2GB1A 3C1FA 4R8IA 4A3FB 2AX5A 4ZYNA 1R4NI 4JI1Q 4DNRB 1QOHA 3AMZA 4ANUA 3GTQH 3EROA 5IE8A 3CCUA 4RGOS 3KK7A 1VQLA 1PTOF 1WD1A 1B3QA 1WTOA 1A6XA 1WCMH 3HOVG 4HXDA 3DMUA 2DNCA 2XNAC 3PUYA 3DBRI 4YL8A 1BNZA 3CPWA 4K81A 4B9XA 2F0QA 1VQJA 2H89B 2OOBB 1SMXA 1Q1OA 1I3QH 1O7IA 3I91A 2PZUA 5C3XA 3X3NA 4DHZE 3I4MH 2K5VA 5IYCH 2MHJA 3BJUA 1KRTA 2R7ZB 2DBYA 3AE3B 2JXMB 5FO8B 2B3AA 4AOFA 2G45B 2RHQB 4BY1G 4DR2L 4X66Q 1UWMA 2KO3A 1WOCA 4AYBB 2L4NA 2JA9A 4ZK9B 3OOCA 3I57A 5D94A 3TEXA 5C3EG 1HZBA 2EKEC 2E6XA 2F0NA 3HGBA 3UDXA 1I94L 2WS3B 4A3JH 1Z2MA 2LVOA 3VR3A 1E7UA 4YWGG 3SFEB 3CXCA 2K6QA 3A9JB 2BF8B 3RN9C 1WVLA 4LFCL 3TN2A 1DGJA 2DLBA 3QWNA 5G5GA 3UIOB 1A0IA 1LTSD 3BK1A 4GN3B 1R4NB 1PXUA 5M5YB 1WSPA 4ANVA 1QKZA 2CHXA 4ZRKA 1E1TA 2ID0A 2HCIA 4F8MA 4KVGB 3V3XA 1X3GA 3AEDB 3K59A 4NXMQ 2E2IB 1HR0L 1KIXA 4W9CA 2MBBB 1EWHA 4C2MB 1B53A 5FJ8G 3DBRB 2B2VA 4C3JG 3ULPA 2ASBA 3UQAA 2SAKA 3D6CA 5C44G 5J18A 1WX7A 2LMCA 1EY0A 3WWVA 4ZRIA 3PUVA 1G6PA 4UP7A 2NMQA 2B2VC 5CBAE 5CV8A 5GAGC 3JAMi 1AWDA 2V3NA 3VQIA 3NBHB 3ZJYC 2N4FA 1EUVB 5GXGB 3E9SA 1X3PA 2KFKB 3HRDD 2WB1G 1O7YA 2B29A 1PH6A 3FPPA 2H4OA 4DR5Q 3O13A 4J1MA 4OZCA 4PMCA 5IIFA 2A6ED 1G6JA 2HT1A 4YCVA 3PPAA 2ICIA 1PFSA 2VZKD 1H8CA 4J6HA 2LD9A 3APDA 2Z59B 1WJ6A 3A9JA 3OJ3A 3NE5B 1Q8IA 3MEHA 3AEBB 1E8YA 2OWOA 2CHBD 4AJWA 3CRLC 3CMAA 4L5QA 1TWHH 2SNMA 2UXDL 1GM5A 3HOVH 3EGRA 4FJVB 2UUAQ 3B6YA 4H44C 1AFPA 1J7BA 4KY5A 1WIAA 2L1AA 4HJGE 4DUYL 2NZ1D 3DWMA 1E8WA 4R4OA 3C46A 1AN8A 4XIGS 2BKFA 3RNGC 1G91A 1BUVT 1K51A 2OJWA 1IYFA 4DFAA 1O80A 3DHQA 1E3PA 1WCMB 2VL6A 4QIWB 1EIYB 4II3B 4IQZA 5EBDA 2IBIB 3NBHA 4BY1H 4ZQ3A 3N52A 1XLPA 4BAXA 1ICWA 2K22A 4W9JA 2N78A 5BR8L 1I3QB 2KFKA 3S2AA 2B2UC 1YEZA 4K5WA 5C3EH 3I4MB 3R8BA 3KUDB 4DF7A 2MP1A 4US9A 3KWLA 1LT5D 4DV5Q 1YN3A 3EC8A 3Q6BA 3RR5A 1Q86C 1WGGA 3NVYA 1HRJA 2JZPA 2ASQA 3X3MA 3A8KE 3KVFB 1XLNA 3MXNB 2DX5B 2GRIA 5D3IB 2DGYA 1XMOL 1PV4A 3PLUA 2JQRB 4ZOHC 1J5EL 5IWAL 4A3JB 2NBVB 1ASZA 2X69A 1JWBD 3K6OA 1A62A 3U2SC 4QMGA 1VQCA 1PYSB 3NS1A 3CWIA 4IUMB 3UI3A 2NTTA 3ULLA 1K8MA 1N36Q 1SE9A 4OW0A 4CO7A 1Q7YC 5JJLA 5FJ8H 3P4SB 1V1OA 3RLOA 4C3JH 3TBIB 4R4TA 4ZRZA 5C44H 4DR6L 2N9KA 1HXYD 2ALYB 4FF1A 4F8CB 1MIUA 4O0AA 1YNJC 3J9CA 5EJWA 1E24A 4XDDA 1SN8A 3VYRA 1XO3A 3RNBC 1Q0WB 1VS0A 1TZ1A 1EQVA 3MJWA 4KKJA 4C1NK 1UZXB 1DOLA 1Q82C 2WKDA 2HTHA 3ZJUA 5KHOA 1QWYA 5JOBA 1IW7C 1PGXA 3I3TB 3KUZA 2K5WA 1OXUA 4JI2L 5GMVA 2RMMA 2PO4A 4JBMA 1QE6A 2YEPB 3KW5B 5BYQA 1E7PB 5IP7G 2XBBC 4FJZA 2PI2E 3K0XA 4JI1L 4NXNQ 3V60A 1AW7A 1QLBB 1SIJA 3CCEA 1BR9A 2BDOA 2GI9A 4BOZB 2PCFB 4ZUJA 2JXTA 3L2PA 4OVVA 4F87A 1WE7A 1MVKA 1HPCA 3IAM1 5AZFA 1BF4A 3TMPB 2PZTA 3ZVVA 1EQRA 4DR3Q 4LK0M 2A6HD 2R92G 1B70B 3NS8A 3AE5B 5H8YE 3RD2A 3OG5A 2K52A 1NMGA 2A4ZA 4ZLTF 1TWHB 2PI2A 2FCMA 4FP5D 3UDIA 1YOVB 2ZTEA 1C79A 1OXXK 2NBFA 1STYA 1HZ5A 1KLVA 3Q8AA 4BXXG 3MHZA 2ZW0A 1M90C 5JEAG 3KYDD 2JU6X 5IGGA 4ME3A 4F7ZA 4OIKA 1F77A 4KV6A 2VUMG 2L00B 1ICFB 2Z0SA 2RR9A 4KJNA 2YLMA 2WQYB 3MA2B 1NR4A 1NUCA 4YXDB 1PGBA 1QVFA 3IHPC 4QGUA 2E75C 1L7YA 5J3BA 2ZCCA 3PIO3 5G2NA 1EWYC 2N7JA 1BCPD 2MUYA 5CV9A 4BBNC 3GTLH 3WAOA 1M8AA 3VXWA 1VDZA 2PNRC 5ELNA 5C3EB 1D5ZC 2JA5B 4ZUIA 4E6IA 1EU3A 2RDFA 2BWES 3NJTA 3WCQA 1STNA 2QILA 1LT6D 1XPOA 4NXML 3VH4B 1V1QA 3JC66 4GOPB 4CKCA 2RDGA 1F52A 1PH2A 4NPSA 5E4WC 3SXHA 1WGKA 5BYRA 1SFOB 5EKLA 5IT9c 3Q8DA 1HNWQ 1FGBD 3DHHC 1IXRA 4OONA 1L1OB 3S1NB 4WJOA 5HGTA 1DOMA 4V0BA 1ZDVA 4I7AA 1WXAA 2D3BA 3H7PA 2L0TA 1F2LA 1P0RA 3HOYB 3QJYA 2Q8TA 3TL5A 1OEYJ 4HWIB 4RHSA 4DR5L 4F1SA 4KKSA 1FVIA 2K04A 3ERSX 5CHFA 4IN3A 3I4NG 4X62L 2R7FA 1VQGA 3M7NA 4YWLA 1XWEA 1TKEA 1R4MI 1KQSA 3VDYA 2I5HA 3VYUA 1K0SA 5IP7H 2CCZA 1K53A 3CU7A 3KYHC 1WXSA 3PIOA 3AU4A 2BE5D 2RSOA 1QZGA 1C7YA 2NR2A 3KYCD 2X38A 4UDUC 1F2MA 2UUAL 2Z0DB 2VQFL 1PH7A 2KOLA 2D9UA 1V81A 3P2BA 4KN7C 3KLRA 5ELFA 4PNYA 4GOPA 2EYOA 1NDDA 2EYJA 2B8FA 1XEEA 2X6LA 1FRRA 5I6YA 4MN3A 2J52A 1T0RC 4HIKA 2KHWB 3AE4B 1F2ZA 4GOPC 3HKZE 1YQ4B 3DCGA 2IX3A 3L17A 3VRAB 5CV5A 5L37A 3UIPB 4C4VB 2G9HD 5JEAH 3PGZA 2GA4B 1NBWA 5KNCA 3KJOA 1UUPA 4E71A 1L1OC 1G2SA 3MXPA 4A75A 5DAUA 5HURA 1N8RC 4A8XC 2KDFB 3NTHA 3ML9A 1HHVA 2RCNA 4XYQA 2WU2B 4FHKA 3RPFC 4IDIA 3K5NA 1GUTA 1R4MB 2MLBA 1NCVA 1PTOB 1QOBA 4BA2I 1JWMD 2JXXA 4J8QA 1SMYC 3PZ7A 1V2YA 3KUCB 4MJSA 2LFNA 4QL5A 1D1KA 4LW1A 4R4QA 2E2DC 3URYA 1RTNA 1N36L 2E74C 1V9PA 4B0EA 2KQ3A 3OAWA 1V5TA 4X3SA 4JW0A 4EZLA 1EY7A 3HOXG 3RCZA 4OWTB 2KDMA 4PYUA 4GKKL 5C5MA 2MH7A 2K33A 2HIXA 2MJ8A 3S1QH 3T9LA 3BS1A 5EE0A 3VTUA 4K0KL 2A6EC 3KUPA 4X3TA 4MGKE 3RNCC 5AZHA 2Q5WD 4C4VA 2N9PC 1VQAA 3GTPH 2XRSD 3BYTB 2D07B 1R9TH 1CKMA 2AWNA 4WWOA 3KJPA 1SR3A 4NAWB 2D3CA 2A74C 1NEKB 1WFQA 3I4NH 2FIFA 3GZNB 4DAPA 1HNZQ 2PMZE 1SDFA 4EQOA 1YN4A 3Q3JA 4N8FA 1JE4A 4NXNL 5E1FA 4B3RQ 4G7ZC 3TBLD 3TEWA 3DLLA 1TKGA 3KFUA 5GQOA 4HJAA 1LXDA 2K9XA 1PFNA 2CFMA 1SYDA 1N60A 2KC2A 1Y1WG 3V6CB 5J2RA 2NVQH 4JG2A 1JWSD 4P71A 2HIVA 1C77A 1ESFA 1B4OA 1PTOC 2LHDA 5CV7A 5LL6X 4K5XA 1G2TA 2M17A 4A3EG 3H3VH 2N9LA 2KQ4X 3I70A 3E56A 1L2FA 3DQVA 3KOJA 3UF8A 1K50A 4IG7B 2AMCB 2EE1A 1OQYA 4FXCA 2XWJB 1YIWA 1U4MA 1B3AA 2L12A 1B9MA 3VR6A 1I42A 5CHWA 1XNQQ 3GTJB 1Y56A 1ZEQX 1B7YB 3RZDB 4RNAA 3QOJA 1SNDA 2WLBA 3QB3A 2YVCA 3CCSA 5E3FA 2D10A 3R7RA 2F0VA 2Z1CA 4UP8A 3EN2A 3L7ZC 2MPMA 1E10A 1FM0D 2WFWA 4DAYB 1K8OA 2OCEA 1X3FA 4YSXB 4JIOU 4OZAA 3Q23A 5C0XI 2Z0EB 4DV6L 2QEJC 1PH3A 2JRIB 3NVZA 5HKHA 3S1RB 3AB5A 4R9WA 5LMUQ 4LFBQ 2KLGA 3PZ8A 2B63B 3TS0A 4DU9A 3GTOH 1KXLA 3BWUD 2N7EA 4PK1A 2A69C 1ENFA 1P1AA 5M5XH 4ODGA 1SE8A 2WXRA 4WQOB 2Z4HA 3U9OA 2NB0A 4PS7A 2FUG1 5E6NA 2F03A 1N34Q 2ZPYA 4X3KA 3TP7A 1K8GA 1HNWL 5DPRA 5I6WA 1YQBA 4ZHPA 1TWAB 1LTID 2C7NB 2EELA 2Q2TA 4UP9A 3L9AX 3ECIA 4ZRPA 2OTJA 4EZKA 1VQ8A 4NY0A 5FLXc 2K5DA 2AUJD 2WX1A 5BMGA 3T51B 2FXQA 4B0MA 2VQEQ 3S1MH 1I7HA 3P4QB 3UI2A 4HROA 4A3MG 1C9FA 4MGYE 1NI2A 3GTKH 3Q3NC 2L15A 3L13A 3UGBB 2K8HA 1HCZA 4NDXA 2NZOA 4WAFA 4J15A 1CK1A 1RTOA 5ISRA 3JYUA 3W1SC 4DAYA 2I0QA 4TQ1A 2IHFA 2K6DB 1CQFA 1L4ZB 2AWTA 3U7ZA 3GTPB 3APCA 3DVGX 2KENA 2WINB 1V86A 5C4JH 2K5PA 4US8A 2WIIB 2ZJQA 2IGGA 1Y1VG 1MHXA 4DXGA 5TSSA 4P72A 2Z8LA 1QVCA 4WJPA 1GPXA 1DOXA 4ACFA 1Y1WH 3AE1B 4WURA 1ZXTA 1VQ9A 1V43A 4O1NA 1VD2A 2KANA 1TVXA 1MFWA 2RDHA 4A3EH 2O4XA 3CCRA 4BBSG 2BVCA 2CR5A 4II2B 2PEAA 4LNOA 5GAHC 1WF9A 4WWNA 2C7HA 2KMCA 1DOKA 3RUZA 1HZAA 3CP0A 4OELB 3HOWG 4L6TB 4OO1G 3TJPA 3S16H 3ONSA 5HHDG 2J0TD 2MX2A 2ACZB 3OIQA 3HEJA 3M4YA 3I9V1 4JI4Q 1MJEA 1K8RB 4A76A 1C4AA 2J0KA 1I4PA 4BFRA 5IP9H 3TEZA 3S24A 3F2DA 2RSNA 3M7GA 3H8HA 4HKQA 2INPE 1V9JA 3Q22A 3G6JB 3A74A 1VQDA 1VDVA 3AEGB 2EQSA 1DD2A 2G4DB 1KHIA 4C56C 4E3CA 4IUUA 3TS2A 1B8AA 3BZKA 1R4PB 2D62A 1MHWC 1VRAB 1MG8A 2ONQA 1FR3A 2MJDA 1II3A 3A1QB 1PFMA 1X55A 5IGCA 3GTOB 3P1MA 3PVLA 3IRBA 1D6EC 3IKJA 4GS3A 2QKIC 2DYOA 5M5XB 3MFGA 1WTWA 5I2XA 1WTQA 3SDLC 3ZW3A 3SFDB 1FCCC 2VH1A 4DR2Q 2F0JA 1CTMA 1EL0A 2Z4IA 3HOUG 3L08A 5LHY1 3W9CB 1TWCB 1Y8RC 2N1VA 1E22A 1TIFA 2LSSA 4HJ7A 5DPWA 4A3MH 5M9OA 1D8LA 2KDEB 2NVXH 2F3IA 1RFAA 3QK0A 2CWAA 3MZ5A 3C19A 2LASA 1VQ7A 1FJGQ 5JVH3 3M3YH 1XCTL 3WANA 5CORA 4POGA 1XMQL 3JAMc 2M56B 4POFA 3PO0A 1NI3A 4GMVA 3RN2A 1P8LA 4IUQA 1C78A 3DBLI 1NJIC 4I6LB 3VFKA 1Y1VH 1C1YB 2NBUA 2VB2X 3D4DA 1O7ZA 1RD9D 4HLEA 2IHEA 1OO9B 3AU7A 1TBEA 4JBWA 5IYBG 5I4DA 4G7HC 4IJHA 1RFKA 2W9NA 3WOEA 3S2DH 2GN5A 2WXNA 4G57A 2EY6A 4HCNB 3VUWA 1T3QA 3W5VB 1V80A 4BBSH 4HAEA 1FL0A 4CDEC 2Y0SE 3A1QA 1Y1WB 1STEA 2Q2UA 1K0RA 2JA6B 4M0WB 2MQHA 2WXKA 3Q14C 2PNHA 1I6HH 1WGDA 3TIXA 1TJEA 2SDFA 3HOWH 2XVSA 4A3EB 3CF6E 5BYSA 4KX6B 3A4SC 4L8JA 3TP5A 4IFDG 2O6VB 1ZXIA 1YNJD 3IG3A 3A8IE 3RZFA 1MBYA 4HTHA 3IAS1 3H91A 3ZLZA 2IPKD 2I38A 1L2NA 1EEID 3A8JE 4H7BA 4A3DB 4P6VF 3DM3A 2F1MA 4JI0L 1B44D 3RNAC 3CSTA 5CMDA 1IW7D 2NBWB 1UBQA 3BY4B 1LT4D 4GNXA 1KDCA 4LFBL 1EZ6A 2KVMA 4V190 3PS6A 4C80A 3NVWA 3T1HL 1UEAB 4FXKC 3OW2A 3U50C 1HA6A 1BVSA 1AH9A 1RWSA 2C5CA 4IUVA 2CH4A 4DK0A 4LF6Q 1WMHB 5IAAC 3R3MA 2K1BA 1MKHA 1MHHE 1GNUA 3PO3G 4IWOA 2IJ0A 3H6MA 1WI0A 4LNNA 2G5DA 3CC7A 2AEHA 3GP7A 2BS3B 4M0WA 1U4AA 5I9OA 4N9PA 3HOUH 3CQZH 4UHVA 5BR8Q 1MG4A 4L5TA 2LRUA 4BKGA 5C5LA 2ZXPA 3OWFA 3HOZG 2AUKA 3GS2A 4YTMB 2O6VA 3DOWA 4NQLB 2PKOA 1ET6A 3I3CA 4IPDA 4EQ5A 1EWIA 1G51A 3AMUA 4A3LG 3IAYA 3AM9A 2N55A 2DAJA 2KXJA 1W3SA 1YBYA 2KJRA 4IZ8A 4W9IA 2K0PA 4P75A 3WOFA 4FF3A 3P42A 2BPSA 2GBMA 2PQAA 2N3SA 5IWAQ 3HVDA 3GV6A 2PW7A 3Q3OC 2HDLA 2C9OA 4BA1I 1LLRD 4EQNA 3VYSA 3M3YB 1YMHE 2BBCA 2RPQA 4OIJA 1TR5A 1X54A 5IYBH 1IBML 1F2RI 3L3OC 1FYCA 3MTSA 1FFVA 1PQSA 2BKRB 4KKIA 4WAAA 3J81E 1UD7A 1ZXHA 4C7ZA 3AULA 4CJ0B 1VQIA 4PS8A 2QDFA 4UAIA 3VVWB 4MZ9A 3NWTA 4XQNA 3RN5A 1XT9B 2J0JA 3MXUA 4HMIA 3U30A 4FA6A 2JP1A 4IFDH 2I1KA 1F2YA 1MJCA 4JI2Q 2CW0C 1I5FA 1SSOA 4JI4L 2JY6A 2HHHL 4HDQA 1ENAA 1I6HB 2PPBC 1T0QC 2LUMA 2DENB 4C3HG 3QIJA 3Q3FA 2MRPA 1BOSA 3CPFA 4EX5A 5K36H 3LX0A 2MWSB 2ZZPB 3ZNHB 5FK9C 4BBRG 4ID6A 3D31A 5AFWA 2TSSA 2JA7B 5M3FH 2K5QA 3I63C 2RA4A 4M8AA 3GTGH 1F1HA 1O7LA 3U8ZA 1AZPA 1SYGA 5HGQA 2VNUD 2QSDA 1IYUA 2LMCB 4HIDA 1P98A 2D2QA 4EFOA 2BS2B 2WNMA 3PUZA 5LL6S 3TEHB 3MAQA 3PO3H 1J7AA 2KNBA 4HSPA 4GDLA 5C2TB 1EU4A 2R93G 2BB6A 3GD7A 4EE2A 1CT1D 2NVUI 1I4GA 2JT4B 2MO0A 1WWTA 1PRTF 2F3WA 2DWQA 2RSUA 1SLJA 1WTXA 1A2UA 2PQEA 5G3LD 3VR5A 4LUVA 1C4CA 2GVBA 2K75A 3HIZA 1JOOA 1TS2A 5A35A 4Q5VA 4KK7A 4YHHL 1GKHA 2HQEA 4A3IG 4JLCA 3HOZH 3BVGA 3R7QA 3IT4B 2DNEA 4JL9A 2N49A 1O78A 3C0RB 1FJGL 3AQQA 4A90A 4RH6A 3V62A 4TUUA 2YTXA 2INNE 1QUQB 4A3LH 1SYBA 1ZP0B 4XWWA 4LNIA 4YSZB 3N20C 2LXJA 3VYTA 2C9WB 1T9HA 4B3SL 1Q8KA 5JJKA 3LWUA 4A3OA 2F0WA 4G7OC 3VUYA 4RKBA 3H94A 4IWQA 2OJRA 2PVOD 4HJ9A 4B95A 4DV0Q 3LJ3A 1PYBA 1XNRQ 4DK6C 3EA6A 2WDTB 3DBSA 1S3OA 1SMYD 2KEDA 2JVCA 3TSSA 4HIOA 4CJ1B 5T1IA 1N61A 4HCPB 2EIFA 5IT9L 1Z47A 3AFPA 1DOYA 1TXYA 2SEBD 2L3ZA 3CF5A 1E8XA 1T5XD 2O2VB 3N32A 4GB9A 4XGAB 1WJJA 2F0IA 4HVBA 2BTEA 3HKZG 2BCOA 5JJIA 3KF8B 2XN9C 1F2RC 2RD0A 5H92C 3WALA 2KKCA 4DBGA 1JR0D 3BDLA 1S5ED 4MSQB 2G1EA 1XF5L 1WM3A 1SE3A 4B08A 2LUEA 3NHEB 4MEMA 4RCNA 5E4XA 4AYBE 4EGVA 3CC2A 2LXCA 4X62Q 1VMPA 4ASWC 2LXKA 1X6OA 1XX8A 4O42A 1CZGA 3J7YW 1KLGD 1LTAD 3HS0C 2HDEA 4KSLC 1QUQA 4C3HH 2YU9H 1VF5C 1HJPA 4RA8A 3DPDA 2CQOA 2WV6D 5L95C 2Z6KA 4H0LC 4BBRH 1RCVD 1YHAA 5C23A 1WYDA 2QDLA 3T16A 1I6VC 2VQFQ 4LF6L 2Z6KC 4WH4A 3DVGY 2J7ZA 4XTCS 4A3GG 3GTQB 3KH0A 1PTOD 4FO2A 2C5LC 2LVQA 5M3FB 4IJLA 2R93H 1LTTD 1C76A 3GTGB 2X8XX 2FCSA 2O2VA 3SD5A 2DN8A 2ZVNA 3KF8A 5M5WH 1W6KA 2KWDA 3ZJVA 1EY5A 3BDCA 3PO3B 2N1WA 4AIMA 4GLVB 4A3IH 4IC7B 3ZDTA 4CDDC 2OT2A 2JYOA 2L05A 4RM9A 4TQ0A 3P4PB 2CU3A 1CZWA 1DCZA 3EBEA 3PZDA 3C2PA 3FKIG 4IM0A 4LJOB 3TEYA 4DUZQ 2DUDA 1J7CA 4LMQD 2CWPA 2JWZA 2MHVA 3J80i 1IYJB 2RPVA 3AE9B 1ROEA 2A69D 4AQYQ 2WXMA 1TZOA 4BY7G 5C6AA 1IKMA 2OEDA 2WGSA 1H9SB 3AXCA 4P16A 4GKKQ 4DK5A 1WXMA 4CHTB 1OGWA 2KMMA 4K0KQ 1KJTA 4JE3B 4DV7Q 1PZID 5CBEE 1CKNB 2HDMA 4HK2A 4RHRA 1VCIA 2VZAA 2K25A 2F0HA 2PMVA 2I2YA 2K05A 2E3TA 4RCOA 3K9PB 5IOIA 2R2QA 5KYLA 1U9RA 4ZKBB 2IY1B 5IYDG 2UYZB 3ABVB 1FCLA 4NQKE 1HNXQ 2PJHA 4JX1C
chains in the Genus database with same CATH topology
5EPKA 1ZOYB 3HRZC 1BUIC 2L32A 2ON8A 3NWSA 3I73A 1G8ZD 2RKSA 1H9SA 3B9JA 3HOVB 2KA7A 1A3TA 2IW3A 1BBXC 1FFUA 3BK2A 2F0TA 1M4VA 1MGSA 1LV9A 3OMCA 2K3UA 2R93B 1Q10A 1LT3D 4F7XA 4I65A 4BY1B 2EYLA 1D5MC 5DM63 2W82A 1F9PA 2FBWB 1B9NA 3EVQA 2WACA 3SK5A 1L5PA 1PUTA 4A3IB 1GOZA 1HFNA 4NAMA 3W3AA 3M85A 1STBA 3CRKC 3E6ZX 5CYUA 5IGFA 1FXIA 2NYZD 4C7YA 4DNTB 5EE3A 1OQQA 5JAVA 2IL8A 5BN4A 5FLXL 1PZJD 4AS1A 5J1ZA 1WRIA 4C3JB 1DYQA 3DWGC 1TS3A 3RD4A 3D8GA 3P75A 5C44B 1CFMA 4C3IG 2F3VA 1ML0D 2F4IA 4QCLA 5DM73 2WB1B 4FF2A 2V4IB 2HCCA 4OL7A 2EJGC 1EIGA 1PGAA 1JCKB 1EOTA 1AP0A 1F0ZA 4QUFA 1STHA 4Q2JA 1RM6C 3CIRB 3KLSA 2X6GA 3OSOA 1QG7A 3VA5A 2EXZA 2R61A 3TMEA 4R8NA 4PV1C 3EQLC 1EY4A 3AE8B 1FEHA 1QB5D 3DWAA 1JROA 2B2TA 3IT6B 1Q1EA 4GLSC 1CA5A 1OFFA 1FIQA 2B2TC 2J4XA 1D5XC 4DA2A 4KD3A 4IUTA 2QF7A 1SNQA 3NQIA 1GXDC 5JXVA 2NN6G 2AQ1B 3FAHA 1MI2A 1XXGA 1EY9A 3AECB 1IGCA 3GTLB 1HEZE 2EDGA 1LO5D 3NUHB 1PRTB 3TP8A 5FO7B 5IGDA 5C0XJ 1P7FA 4A6QA 4PMBA 2HUGA 4KY6A 4WQMA 1C48A 3SE0A 1GB4A 3DEPA 1JW9D 4NZLB 2VB3X 1ZPSA 2O2LD 2PVGC 2FE8A 1LTGD 3PUXA 1DJRD 3JAML 4XT3B 2FJ2A 2M9VA 3TUOA 2JSVX 5DNFA 1UNSA 1TKYA 1DXMA 2PW9A 2K32A 2Y5CA 4KMUC 4U68A 3AB9A 1CHPD 3QOLA 4FNFA 4XYOA 5BN5A 3AE6B 1ZYRC 1SNPA 4N9TA 2LEKA 1SJED 3Q69A 4Y7NB 2KECA 2N88A 1PRTC 2R92B 1V8CA 2EY2A 5CGKA 1DOIA 1OQRA 2LY7A 1DONA 4K5VA 1ACCA 1TY2A 2IT1A 5EPLA 1EM7A 2IWHA 2KCNA 2CW0D 2WXGA 2VUMB 2SOBA 3E0JA 1T6BX 2NN6H 2KUMA 1ILQA 3EFXD 1SXTA 3BG3A 1GJXA 4CGYB 1W6JA 1XLQA 2NTSA 4XWTA 2KACA 1IGDA 2W3RA 1A15A 1D1IA 3R93A 3ZYYX 2LS01 1Q90A 5HG2A 2A73B 1AZQA 5FLXE 4TKOB 2B2YA 1YN5A 3I90A 2LFIA 2MJ3A 1N5XA 2B2YC 1RKNA 3S1QB 1GUNA 4YIJA 2OXPA 4XXEA 4M1UB 2EYMA 4LAAA 1V97A 1R9TB 3E5SA 4RFBA 3MFYA 3I4NB 1QNKA 4KD4A 5J22A 4ZAIA 2Q8IB 2NN6I 2NVQB 2ZT9C 3F2UA 2EYFA 3MVVA 3Q8BA 3C8YA 4JPSA 1GHJA 1SNCA 4EQPA 3LNNA 2F0MA 5I2YA 1GHKA 3KBGA 2D5GA 4ME5A 5KNDA 3DWQA 1A3VA 3FVQA 4A3KB 5AUIA 4NW2A 2J53A 5C3JB 3NVVA 2V4DA 1P7EA 1SBBB 2EY5A 2WXFA 1Y8OB 4AQ7A 4LTUA 3D4WA 1YJIA 4ZRQA 3DXJC 1KDAA 4TMAB 1SYCA 1ILPA 3SK4A 3RMHA 5HFYA 3IL8A 3HG9A 1EZ8A 5EGTA 4DAVA 1N62A 3HOXB 1HA5A 4Q0FA 3PV0A 1WTPA 2EZVA 2M19A 2JSOA 3H3VC 1H9KA 5CV4A 4CQNA 2BT6A 3S1MB 3SK6A 5KEEA 3GTKB 1TS5A 3HZXA 3P4RB 4CJ2C 1JWUD 2ZXOA 3K5OA 2TMPA 1BQQT 5C4JB 1RYJA 4FXDA 2WU5B 1LTRD 3P1HA 2L55A 3LWEA 1WTRA 4IUNA 1SE4A 2AWOA 2JEBI 3Q6SA 1H9MA 1CQVA 2CJNA 1L0YB 1MSGA 4OO1H 2IGHA 1OXSC 1NAPA 4RF1A 5D3DA 1Y69U 1CA6A 4KGSA 3J7AV 2KN4A 4WRDA 3S14B 1TS4A 3A55A 1IUEA 1ET9A 1TT2A 3FMCA 3S16B 3DEOA 2D5DA 4DQOC 4K2LA 2EJMA 1WXQA 3CKIB 5CC4A 2IX1A 1IBXB 2EKIA 1J8IA 1K83B 3C1EA 3AEEB 5IGEA 3K0YA 1JRPA 2DYMA 1GUSA 1EYAA 1PDQA 5ELEA 4HKZE 3ND9A 1QJOA 1E0BA 1SE2A 1QOFA 2IDYA 1KNAA 4XE0A 3DUZA 1QF6A 1EFID 4ZYSA 4FF4A 1QOGA 2KCCA 1H9JA 4OO1I 1S4ZA 4YSYB 2OEOA 1Q3LA 1NSNS 1UAPA 4A3MB 1VR9A 4USAA 3K58A 2NVXB 1JORA 1SNMA 4OZBA 1L0XB 1ENCA 4KTAA 4JK1C 4GDLB 5I9PA 1EQTA 1IBXA 1E2ZA 3AEFB 1Y1VB 1E6EB 1AYFA 3P63A 2ICEC 1SEBD 2R3ZA 4XDXA 3U4EG 3S2DB 1V1PA 3NK9A 4BBSB 3ITPA 1CI3M 1A2TA 1EWCA 1TQOA 1RF2D 3PIP3 3OWEB 3W5UB 1SNOA 5EE1A 3A7AB 3HOWB 1BDOA 1ONLA 2FHTA 2M2LA 3V96A 1EIHA 3FPUB 4HEA1 3I4LA 4R3DA 1KF6B 1EYCA 1HFGA 2Y5PA 5NUCA 4ARIA 2K7VA 2JYTA 3D4RA 3GO5A 1C4PA 3QG1A 3S15B 3SHLA 3NSWA 2SNSA 5FKAC 2QCPX 4K14A 4JWSC 2QMTA 4KN4C 1FNVA 5EQ0A 4NP5A 1PYWD 2W54A 3D3RA 1F9RA 1HUMA 1I4RA 4XQJA 4TSSA 1YJJA 3OIPA 1D2BA 5DEHA 3HOUB 3CQZB 3LXFA 4D2KA 2Y3AA 4IFDI 4YTPB 1U4LA 3VRBB 4RKLA 5IODA 1JALA 3FILA 1CM9A 4B9WA 2LJIA 3NHHA 1XLOA 2FMMA 1PZKD 5JJZA 3DM1A 3DWPA 3KQ4A 2NUCA 3MJ5A 4QB4A 2MGSA 5CR3A 3ND8A 3NTKA 5BN3A 3I8ZA 2F0FA 2L0CA 5CV6A 1NVID 1Q1BA 4RGMA 3VR8B 2EOTA 4HCEA 4ZKCB 2YYZA 4N59A 3AE2B 1IHZA 1GUGA 1Z7TA 4KKTA 1ESRA 3T53B 4L63B 4ILWA 3IFDA 4ZHOA 3HUIA 2WDQB 5D7GA 1CJEA 3R2IA 5KGUA 2XRQD 1EEFD 4RAUC 1ZYRD 3T3OA 5HI1A 4KHZA 1SYEA 2O5JC 1L0VB 2BA1A 3PO2B 1PRTD 4BS9A 3A56A 4OVZA 4MHEA 5T8IA 4XDCA 3Q8EA 1OXTA 4LJZC 5KRUA 2L9HA 3HOZB 5BMHA 5J39A 2B2UA 3U9SA 1RHPA 1N5WA 4DN4M 3NTIA 3B2FA 4QUCA 3KLSX 1LACA 2EY1A 1BCPF 3K57A 4TQUS 5KNBA 1EYDA 1KLUD 1MI0A 3AE7B 1JICA 2EYPA 5C4ZA 2NWGA 3SR1A 1L4DB 3G7LA 2OHFA 1FXAA 3K7AB 1SB3C 1JB3A 1MD2D 2V3PA 4PT5A 1VZ6A 2ZXRA 1KDBA 1PLFA 2F0SA 4Z9CB 3NRZA 2JEAI 4HSVA 1L6UA 3RLFA 2B8GA 1T5EA 2CJOA 5EPJA 4FXGC 4IOIE 3Q0AA 1KNEA 2L83A 3BIID 3QIAA 3RFZB 5EE9A 3P7JA 2F0DA 2JWUA 2WXOA 2RVLA 4C3HB 2YU9B 1HZ6A 1GB1A 2WXHA 4PMWA 1CHQD 4KI0A 2XWBB 4BBRB 1WYGA 1BMLC 3H0GB 3HP3A 2CVRA 2A68D 4GDKB 1HUNA 1JQ4A 4MACA 4DK1A 1V8QA 3MXNA 4F88A 2BS4B 4BWGB 1LABA 1U4PA 2M0AA 4CKEA 1PDXA 3BVZA 2LGIA 1VLBA 2OF1A 3OPOA 5M5WB 5IOCA 1AEXA 1QNUA 3H09A 1KAAA 4C1NI 3QO2A 4HR7B 4ULLA 2WDVB 2WP8J 4K8JA 2WP9B 4G4KA 1PTOH 3P20A 4NJCA 3ERQA 1ZE3D 3OW7A 5IT9E 2QIEB 2K6AA 3NQTA 3U52E 5FOBB 2F0LA 2KHSA 1TWFB 4IUPA 5JPNC 1SAPA 3CHBD 3TDQA 1JMLA 3WDNA 2F0PA 3BYYB 1ZKOA 3NXWA 4TRDA 1YNNC 5D14A 2WXLA 4REZA 3NZ3A 1HTLD 3HKZB 3B2GA 2EYHA 1C8CA 3C3LA 2EPBA 4U673 1SYFA 2V0GA 3M4OB 5BMIA 5C0XG 2H88B 1RDPD 3R3OA 2FFKB 5ELDA 5JEAJ 4HMJA 5A2QL 2RQXA 3N9YC 4KKUA 3MC0B 2WDRB 2L11A 2PZWA 3T13A 1ZDXA 2F0UA 4A3GB 2BOSA 1VMCA 3HVZA 1EY8A 4P2CB 1G291 1OXVA 2IGDA 2BW2A 3S9WA 2W3SA 1NENB 3L4PA 1RODA 1B1ZA 4FVMA 5K5PA 2VZKB 4RGTA 5MPOA 5KIXA 2E76C 4IKGA 5ELBA 2J42A 2R6GA 1H9RA 4GZYC 2PMZB 2D2CC 1KRHA 1HQRD 3FKIB 1QT9A 3AEAB 2HTME 1HQMC 2M00A 1WD0A 3K5MA 2Q8RE 1KABA 4YTNB 4OGQC 1TU2B 1EY6A 2E2HB 4BY7B 1JQYD 3VR9B 1I4XA 1XTCD 2N0SB 3ZGZA 1U4RA 2BA0A 3AV8A 5KYIA 4L23A 1QQRA 5EKKA 4CKBA 2PLPA 4MT5A 2KAJA 3V2TA 5C0XH 4ARCA 2G9DA 4HEDA 2A5HA 3BZDB 1NR2A 1X32A 4X3UA 1PFDA 3IFTA 2B2WA 4PQXA 2KEEA 1F9QA 3TZDA 2B2WC 2MEKA 2DY8A 5JPMC 2XIWA 4XQQA 3SEBA 3NP8A 2EJFC 3MHBA 4H13C 1XCQL 3BDOA 1TY0A 3KWVA 1VF7A 2F0GA 1HTPA 4KJOA 2L5TA 2FINB 4L1BA 3EJIA 1X3QA 2F0EA 4N6EB 4JWUC 3ETRA 3FDTA 3NBIA 3A7LA 1GUWA 1E9MA 2WXJA 1Z6HA 2BB5A 4KGTA 1WTVA 1B50A 4ITKA 1B2TA 3GB1A 4IALA 1FNUA 2JYEA 1JC7A 1S5FD 4K6LA 1K52A 4N58A 2BYTA 4LLGM 4NMZA 1XYIA 3IXSA 3FC4A 3J80L 4RGNA 3OMGA 3RZOB 1KFYB 4LK1C 3Q8FA 3PUWA 4A55A 1I50B 4H2AA 1DZ1A 2DY7A 3Q24A 1BCPB 5EKIA 3TP6A 3Q8CA 4C3IB 3AH7A 3NPPA 4WWMA 1BO0A 2B39A 3LYYA 3KBXA 1IL8A 2A68C 3W1SA 1R4QB 1IYVA 2L52A 3A54A 3SDZA 2AQ3B 5ELCA 4NKLA 2NVYB 5A2QE 1FO4A 3T4AC 1FD6A 1I4HA 4WIPA 2L1BA 2A6HC 2F0OA 2BDNA 1S5CD 3ONAB 4ABNA 1JWAD 1G6ZA 1QCBD 5COYA 2EVBA 5D65A 2B76B 2K28A 4A3BB 3J81L 2E2JB 4EVOA 4CBVA 3FEWX 1SJHD 1A70A 2QJLA 3SR6A 4A9AA 5FO9B 1BCPC 4KY7A 4OHJA 4J3OD 4KHVA 2WKCA 1FNWA 4HRSA 4S3SA 3MXGA 4KGRA 1TWGB 3I72A 1L6VA 1DM0B 1NYRA 1IKLA 2Y0SB 4MIUA 1S5BD 3JAME 3VA7A 3OHXC 2K01A 4L2YA 1STGA 1UGJA 3ZJTA 4WJWA 2IX0A 1TYGB 2VXWA 1RJTA 1JOKA 4WFN3 1NYQA 2LHEA 5C4HA 3T3NA 5G5HA 4IURA 3S2HB 1CZPA 4WORA 2BE5C 1J9OA 3J7AF 2H1EA 2XSCA 2PTLA 1VZ7A 4FYDA 3R2TA 2I46A 2JE6I 2YEPF 2JX5A 4I7ZC 1JOQA 1SF0A 3GV3A 3AN1A 1STAA 4HCSA 2F0KA 4DGZA 2O5IC 2AQ2B 1YNTE 1D4BA 1KH0A 2PIAA 4YT0B 3SK8A 2WXPA 1Y8PB 1SSNA 1BXTA 1GAQB 2MJEA 4K6DA 1MSHA 4RWSC 1R7SA 1ZUD2 1KTKA 1V1PB 3D6WA 5M3MB 5K36G 5AUKA 4QF4A 4K8IA 5F2DA 3LB8C 3J80E 3MWYW 1E2VA 2PW5A 1QOAA 5G3LF 1YQ3B 1C4QA 1S5DD 3K5LA 5C4XB 3EUB2 1A3UA 5EBCA 4RF0A 3VR4A 1GUOA 1N63A 1VZ8A 1FD7D 1F9SA 2LKVA 3W2DA 1QILA 3V05A 5E6JA 1TIID 4IFDJ 4DXFA 3PMFA 3ZQ4A 3NUCA 3GTMB 5IGBA 3GQBA 1PMRA 1FMAD 3MP9A 3N6RA 3T56B 2WXIA 1Q12A 1LTBD 3BVMA 1TKWB 2FMCA 2PYKA 1PFBA 3SVMA 1UWXA 1YNND 2JA8B 4K2KA 2NVTB 2ENBA 2KJXA 3VR2A 4XT1B 2WXQA 3S17B 3FILB 5C3WA 2CQAA 1I4QA 1B9RA 2QDBA 3TZUA 5FR3A 1E2WA 4HN7A 5JVG3 2I07B 1FRDA 1MPEA 3FRPB 2RBMA 5T1GA 2W55A 4A93B 1VJKA 2ZW1A 1E0ZA 4MM3B 2WAQB 2K03A 1Y8NB 2GB1A 3C1FA 4R8IA 4A3FB 2AX5A 4DNRB 1QOHA 3AMZA 3EROA 4RGOS 3KK7A 1PTOF 1WD1A 1WTOA 1A6XA 3DMUA 2DNCA 2XNAC 3PUYA 1BNZA 4B9XA 2F0QA 2H89B 3I91A 2PZUA 5C3XA 3X3NA 2R7ZB 2DBYA 3AE3B 2JXMB 5FO8B 1UWMA 4AYBB 2L4NA 4ZK9B 3I57A 3OOCA 3TEXA 2E6XA 2F0NA 3HGBA 2WS3B 3VR3A 4YWGG 3SFEB 1WVLA 3TN2A 1DGJA 2DLBA 3QWNA 5G5GA 1LTSD 3BK1A 1PXUA 5M5YB 1WSPA 1QKZA 2ID0A 2HCIA 4F8MA 3V3XA 3AEDB 3K59A 2E2IB 1EWHA 4C2MB 1B53A 2B2VA 4C3JG 2SAKA 3D6CA 2LMCA 1EY0A 3PUVA 2NMQA 2B2VC 5CBAE 5CV8A 1AWDA 2V3NA 3VQIA 5GXGB 3E9SA 1X3PA 3HRDD 1O7YA 3FPPA 2H4OA 3O13A 4J1MA 4OZCA 4PMCA 5IIFA 2A6ED 2ICIA 2VZKD 4J6HA 3NE5B 1Q8IA 3MEHA 3AEBB 2CHBD 3CRLC 2SNMA 3EGRA 1AFPA 4H44C 1J7BA 2L1AA 4KY5A 4HJGE 4MH8A 2NZ1D 3DWMA 3C46A 1AN8A 4XIGS 1G91A 1BUVT 1K51A 4DFAA 1O80A 3DHQA 1WCMB 4QIWB 4IQZA 5EBDA 3NBHA 4ZQ3A 3N52A 1XLPA 1ICWA 2K22A 1I3QB 2B2UC 4K5WA 4US9A 3I4MB 3R8BA 4DF7A 2MP1A 3KWLA 1LT5D 1YN3A 3NVYA 1HRJA 2JZPA 3X3MA 3A8KE 1XLNA 2GRIA 5D3IB 4ZOHC 2JQRB 4A3JB 1JWBD 2X69A 3K6OA 3U2SC 4QMGA 3NS1A 3CWIA 3UI3A 2NTTA 1K8MA 4OW0A 3P4SB 1V1OA 3TBIB 4ZRZA 2N9KA 1HXYD 4FF1A 3J9CA 1YNJC 5EJWA 4XDDA 3VYRA 1XO3A 1EQVA 4KKJA 4C1NK 1DOLA 2WKDA 3ZJUA 1QWYA 5JOBA 1IW7C 1PGXA 2K5WA 1OXUA 2RMMA 2PO4A 1QE6A 2YEPB 5BYQA 1E7PB 1AW7A 1QLBB 1SIJA 1BR9A 2BDOA 2GI9A 2PCFB 4ZUJA 2JXTA 4F87A 3IAM1 1MVKA 1HPCA 1BF4A 2PZTA 4LK0M 2A6HD 5H8YE 3AE5B 4ZLTF 1TWHB 4FP5D 1C79A 1OXXK 2NBFA 1STYA 1HZ5A 3Q8AA 3MHZA 2ZW0A 5JEAG 2JU6X 5IGGA 4OIKA 1F77A 4KV6A 4KJNA 2WQYB 3MA2B 1NR4A 1NUCA 4YXDB 1PGBA 2E75C 3PIO3 1EWYC 2N7JA 1BCPD 2MUYA 5CV9A 1M8AA 1VDZA 2PNRC 5C3EB 1D5ZC 2JA5B 4ZUIA 4E6IA 1EU3A 2RDFA 3WCQA 1STNA 2QILA 1LT6D 4CKCA 2RDGA 5E4WC 5BYRA 3SXHA 1WGKA 1SFOB 5EKLA 1FGBD 3S1NB 5HGTA 1DOMA 4V0BA 1ZDVA 1F2LA 3HOYB 3QJYA 2Q8TA 4RHSA 4KKSA 2K04A 4IN3A 3M7NA 1XWEA 1TKEA 3VYUA 1K53A 3CU7A 2BE5D 2RSOA 2X38A 4UDUC 1F2MA 2KOLA 2D9UA 4KN7C 3KLRA 5ELFA 4PNYA 2EYOA 2EYJA 2B8FA 1XEEA 2X6LA 1FRRA 5I6YA 4MN3A 2J52A 3AE4B 1F2ZA 3VRAB 1YQ4B 2IX3A 5CV5A 2G9HD 5JEAH 2GA4B 5KNCA 1UUPA 1G2SA 3MXPA 5DAUA 5HURA 4A8XC 3NTHA 1HHVA 4XYQA 2WU2B 3RPFC 4IDIA 3K5NA 1GUTA 1NCVA 1PTOB 1QOBA 4BA2I 1JWMD 4J8QA 1SMYC 3PZ7A 2LFNA 1D1KA 2E2DC 3URYA 1RTNA 2E74C 4B0EA 2KQ3A 4X3SA 1EY7A 2KDMA 5C5MA 2MH7A 2K33A 2MJ8A 3BS1A 5EE0A 2A6EC 3KUPA 4X3TA 2Q5WD 2XRSD 3BYTB 2AWNA 4NAWB 2A74C 1NEKB 4DAPA 4EQOA 1SDFA 1YN4A 1JE4A 5E1FA 3TEWA 4G7ZC 1TKGA 2K9XA 1PFNA 1SYDA 1N60A 1JWSD 1C77A 1ESFA 1B4OA 1PTOC 2LHDA 5CV7A 5LL6X 4K5XA 1G2TA 2N9LA 2KQ4X 3I70A 3E56A 1K50A 2EE1A 4FXCA 2XWJB 1U4MA 1B3AA 2L12A 1B9MA 3VR6A 3GTJB 1Y56A 1ZEQX 3RZDB 4RNAA 3QOJA 1SNDA 2WLBA 3QB3A 5E3FA 2F0VA 2Z1CA 3L7ZC 2MPMA 1E10A 1FM0D 1K8OA 4YSXB 4OZAA 3Q23A 5C0XI 2QEJC 3NVZA 3S1RB 3AB5A 4R9WA 3PZ8A 2B63B 4DU9A 3BWUD 2A69C 1ENFA 4ODGA 2WXRA 2Z4HA 3U9OA 2NB0A 2FUG1 2F03A 4X3KA 3TP7A 4ZHPA 5I6WA 1TWAB 1LTID 2EELA 5LNK1 3L9AX 4ZRPA 2K5DA 2AUJD 5BMGA 3T51B 4B0MA 1I7HA 3P4QB 3UI2A 4HROA 1C9FA 1HCZA 4NDXA 4WAFA 1RTOA 1CK1A 5ISRA 4DAYA 4TQ1A 1CQFA 1L4ZB 3U7ZA 3GTPB 2WINB 4US8A 2K5PA 2WIIB 2IGGA 1MHXA 4DXGA 5TSSA 2Z8LA 1GPXA 1DOXA 3AE1B 4WURA 1ZXTA 1V43A 4O1NA 1TVXA 2RDHA 2O4XA 1DOKA 3RUZA 4OO1G 4L6TB 5HHDG 2J0TD 2ACZB 3OIQA 3HEJA 3M4YA 3I9V1 1C4AA 1I4PA 3TEZA 2RSNA 3M7GA 3H8HA 4HKQA 2INPE 3Q22A 3G6JB 1VDVA 3AEGB 1DD2A 4C56C 4IUUA 1R4PB 2D62A 1VRAB 2ONQA 1FR3A 2MJDA 1II3A 3P1MA 1PFMA 5IGCA 3GTOB 1D6EC 3IKJA 2QKIC 2DYOA 5M5XB 3MFGA 1WTWA 5I2XA 1WTQA 3SFDB 1FCCC 2F0JA 1CTMA 1EL0A 2Z4IA 5LHY1 3W9CB 1TWCB 5M9OA 3MZ5A 1XCTL 5JVH3 5CORA 2M56B 3PO0A 1NI3A 4IUQA 1C78A 2VB2X 3D4DA 1O7ZA 1RD9D 1OO9B 3AU7A 4JBWA 5I4DA 4G7HC 1RFKA 3WOEA 2WXNA 4G57A 2EY6A 1T3QA 3W5VB 4HAEA 1Y1WB 1STEA 2JA6B 2WXKA 1TJEA 2SDFA 2XVSA 4A3EB 5BYSA 4KX6B 4L8JA 3TP5A 4IFDG 1ZXIA 1YNJD 3A8IE 1MBYA 4HTHA 3IAS1 3H91A 2IPKD 2I38A 1EEID 3A8JE 4H7BA 4A3DB 4P6VF 2F1MA 1B44D 5CMDA 1IW7D 1LT4D 1KDCA 1EZ6A 2KVMA 4V190 4C80A 3NVWA 1UEAB 4FXKC 1HA6A 1RWSA 2C5CA 4IUVA 4DK0A 2K1BA 1MHHE 2IJ0A 3H6MA 3GP7A 2BS3B 4M0WA 5I9OA 4N9PA 5C5LA 2ZXPA 3OWFA 3GS2A 2AUKA 4YTMB 2PKOA 1ET6A 3I3CA 3AMUA 3IAYA 3AM9A 2N55A 4IZ8A 2K0PA 3WOFA 3P42A 4FF3A 3HVDA 3GV6A 2PW7A 2HDLA 2C9OA 4BA1I 1LLRD 4EQNA 3VYSA 3M3YB 1YMHE 2BBCA 4OIJA 1TR5A 1F2RI 3L3OC 1FYCA 3MTSA 1FFVA 4KKIA 3J81E 1ZXHA 4C7ZA 4CJ0B 4UAIA 4XQNA 3NWTA 3MXUA 4HMIA 2JP1A 4IFDH 1F2YA 2CW0C 1SSOA 1ENAA 1I6HB 2PPBC 2LUMA 4C3HG 1BOSA 5K36H 3LX0A 5FK9C 4ID6A 3D31A 5AFWA 2TSSA 2JA7B 2K5QA 2RA4A 4M8AA 1O7LA 1AZPA 1SYGA 2VNUD 2QSDA 1IYUA 2LMCB 2BS2B 2WNMA 3PUZA 5LL6S 3MAQA 1J7AA 4HSPA 5C2TB 1EU4A 2BB6A 3GD7A 4EE2A 1CT1D 1I4GA 1WWTA 1PRTF 2F3WA 2DWQA 1WTXA 1A2UA 2PQEA 5G3LD 3VR5A 1C4CA 1JOOA 1TS2A 5A35A 4Q5VA 4KK7A 2HQEA 3BVGA 3IT4B 2DNEA 1O78A 4A90A 4RH6A 2INNE 1SYBA 1ZP0B 4XWWA 4YSZB 3VYTA 3LWUA 2F0WA 4G7OC 4RKBA 3H94A 2PVOD 3EA6A 1SMYD 2KEDA 3TSSA 1N61A 4CJ1B 5T1IA 5IT9L 1Z47A 1DOYA 2SEBD 1T5XD 2F0IA 2BTEA 2BCOA 1F2RC 2XN9C 5H92C 1JR0D 3BDLA 1S5ED 2G1EA 1XF5L 1SE3A 4B08A 4RCNA 5E4XA 4EGVA 1VMPA 1XX8A 4O42A 1CZGA 3J7YW 1KLGD 1LTAD 3HS0C 2HDEA