3BVGA

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
237
structure length
228
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type C-3
publication title Assessing energetic contributions to binding from a disordered region in a protein-protein interaction
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 65
structure length 228
sequence length 237
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bvgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bvgA01
4O1NA 1UNSA 1CK1A 2NTSA 1CQVA 3URYA 4DXFA 1LO5D 1PRTB 1SE3A 4RHRA 5D3DA 1S5ED 1T5XD 1JWSD 3R2TA 1KTKA 2QILA 1JR0D 4RGOS 4NZLB 5ELFA 2XN9C 1PTOD 1AN8A 2R61A 1HQRD 1ET6A 1BCPF 4TSSA 4K6LA 1LT3D 3BVGA 5ELCA 3TSSA 1FNWA 1LT5D 2ICIA 1SE4A 1PRTC 1SBBB 3DWAA 4Z9CB 1XTCD 1JWMD 1D5MC 2RDGA 1LLRD 1M4VA 1EU4A 1PRTD 1XXGA 1V1PA 1KLGD 3CHBD 1CHQD 3R2IA 1GOZA 1JQYD 3MC0B 4L63B 1LTSD 1PTOC 1AW7A 1LT4D 1TS4A 1KLUD 1TY0A 4RGNA 5FKAC 1S5CD 5I4DA 1G8ZD 1CHPD 1EWCA 1D5ZC 1LTID 2CHBD 2Z8LA 3BYTB 1TS3A 2G9HD 1D6EC 4UDUC 2J4XA 1F77A 3EFXD 3SEBA 3W2DA 1EEFD 1I4QA 1DJRD 2IPKD 2TSSA 1I4HA 2SEBD 1ET9A 1RDPD 2XNAC 1L0XB 1EU3A 1SJED 3DWQA 3KLSX 3MFGA 1JCKB 1BCPB 1B44D 1YN4A 2XRQD 1I4XA 1LT6D 1B1ZA 1PZJD 1SXTA 2RDHA 4DXGA 1RD9D 1LTTD 3EA6A 1HA5A 1HTLD 1I4GA 1EFID 1LTGD 1PRTF 1RF2D 3R8BA 1I4RA 1V1OA 1I4PA 1TS5A 3GP7A 4RHSA 1LTRD 1CT1D 1RCVD 5D3IB 1TY2A 3O13A 1PZKD 4RCOA 1STEA 1LTBD 1MD2D 1FNUA 1BCPD 3BVMA 4RGMA 3OWEB 4RH6A 5ELDA 1ENFA 1D5XC 1BXTA 4OHJA 1SJHD 1QILA 5TSSA 2XRSD 4C56C 1PYWD 1PTOH 1PTOF 2WV6D 1LTAD 1S5BD 2AQ1B 1YN3A 1SEBD 1ESFA 5ELBA 1TS2A 1S5DD 1HXYD 1UUPA 4BWGB 1PZID 2O2LD 1V1PB 5FK9C 3BVZA 3V05A 4ZYSA 2AQ2B 2AQ3B 4L6TB 2QEJC 3BZDB 1FNVA 1PTOB 4RFBA 4RGTA 1FGBD 1EEID 1FD7D 2IJ0A 3BYYB 1BCPC 2NTTA 3DWPA 5ELEA 1L0YB 1S5FD 1DYQA 1SE2A 1JWUD 1YN5A
chains in the Genus database with same CATH superfamily
2AL6A 3M3JA 4IUNA 1CUKA 3JAML 2B2UA 1WIAA 1VQAA 2B76B 3EIVA 5M5XB 3I4MG 1CQVA 1TWHH 1KNEA 2BWES 3D4WA 5CV6A 2CH4W 4IOAA 4B9KA 4QL5A 2Q2IA 2L9HA 4RM8A 1STAA 4K3BA 5DM63 5CV4A 3CCEA 2BTEA 4BVUC 1PFBA 4ULLA 2QCZA 3QQ8B 2K0PA 3OJ4B 2B2TA 2A5HA 3OG5A 4IUMB 1TWCH 2CJNA 4N8FA 4TSSA 1PH7A 1L2NA 3TCAA 4C3JH 3VTUA 4K8IA 4QMGA 1ZXTA 1UF0A 2KVMA 1JE5A 2LGDA 4DK5A 1PFSA 1GG3A 3K9OB 3A4SC 3SHQA 2B63G 3AULA 3DBRB 5C3XA 1QOHA 2NB0A 2J53A 4LK0M 4HAEA 1FPYA 2IX3A 1Q81C 3S15B 1A2TA 3CHBD 4BY1G 3IFTA 5DM73 4C3IG 1BNZA 1KF6B 1C9OA 3PIPA 2ASQA 4K2LA 4L5QA 2J7ZA 2XGTA 1G2SA 2NUCA 2QW7A 2Z8LA 5C0XI 1FXIA 4AIMA 1X9NA 2DBYA 4Q2JA 3IAYA 1K8GA 3S2DH 2Z0DB 5IA7A 3J81j 2JVCA 2D5DA 2N55A 4CYEA 3PZ8A 2FIFA 4JBJA 2I07B 3CCVA 3M7GA 3QCAA 3VDZA 2IO3B 3HOYH 1XLQA 4NPSA 4K5WA 1ZW7A 2BPSA 3ZJUA 3AE1B 3X23A 3AU4A 5E6PA 5C5LA 1GAQB 2CU1A 2JXTA 2XK5A 1DOYA 4OX9Q 3GO5A 1B44D 3W1BA 4C2MH 1VQ4A 2VUMG 1ZEQX 2RF4A 1JJCB 2AUKA 1V9JA 1U4PA 2O5IC 4GIVA 4ICUA 1R4NB 3CWIA 2KC2A 5C5MA 1Z47A 2KHJA 2L52A 2QDFA 2C7HA 1BR9A 4L8JA 3GTPB 3Q8BA 3V3XA 3I7FA 2WHIA 1WJJA 2RQXA 4X6AH 2L7RA 3HOXH 1D4BA 2WU2B 5M3FG 4A3KB 3Q3JA 3V6EB 1WR6E 1NBWA 3O13A 2AUJD 2F3VA 2XVSA 3I72A 2R93B 3VR3A 2PE6B 1X55A 1VQGA 2K50A 3UDXA 4CHTB 5FOBB 1C4CA 4HPLB 5BMIA 5CV9A 2LFIA 3RN5A 2KLCA 1CKOA 4MGYE 4NQLB 2LKVA 4C80A 1VCIA 2Q2HA 4H0LC 1D7QA 1PTOH 2L55A 4IUTA 4N58A 1VQKA 5AZGA 5EKIA 3VR5A 4FYDA 1FGUA 1P3QU 3H1UA 5FJ8G 1F52A 1HXYD 1K8MA 5F2DA 4JI3L 4HR7B 4JI3Q 1X54A 1PHJA 4A3PA 4AOFA 2ZT9C 2Z4IA 3TBIB 2O2VB 3UF8A 1WD0A 4I7ZC 1J8IA 2OEDA 2XBBC 2BS3B 3AEBB 3LB8C 3Q14C 3UI3A 5JHAA 2CWPA 2D0PA 3NZUA 2MBQA 1N60A 4ABNA 1IYJB 3DMUA 1LTLA 3AQQA 4IPDA 1SLJA 1O7IA 2FJ2A 2AMCB 3BDCA 2UXCL 4GGQA 2UU7A 2UXCQ 3D4RA 2MBOA 1X6OA 5M3MG 3K81C 1FFUA 2B2UC 2BCOA 5CGKA 3URYA 2JZZA 3H91A 1PRTB 4JYAL 2DYMA 4K5VA 4IOIE 1SYFA 4JYAQ 2MGSA 2NBWB 4DQOC 2GB1A 3D3RA 2Q5WD 3AE6B 1PFNA 1SMYC 3RNFC 3VR6A 4DR3L 4DR3Q 4GOPA 2E2JB 2PW9A 4R4IA 3DPDA 2G9DA 2IGHA 1VRAB 3AEEB 4LK1C 1SROA 2HCCA 2OT2A 4APVA 1SF0A 3FKIH 1R4MB 4JW0A 1QUQA 1O7YA 1SBBB 3DWAA 3HP3A 2KHSA 3I70A 5A35A 1B8AA 5I9PA 3AU5A 3HIZA 4FA6A 3RN9C 4EOYA 1QCBD 4L1BA 4A93H 5J39A 2MP2A 2WXLA 4HJKA 4C4VB 1B70B 1FVIA 3AFPA 3J80i 5IGBA 2INNE 1PH6A 3QIJA 5BMHA 3T51B 2NVQH 2SNMA 1PV4A 3IL8A 4DR1L 1WTQA 1XNQL 3Q3MC 5IOIA 3X3NA 4DR1Q 1GUSA 1XNQQ 2BYFA 4IUUA 3K6OA 4KY7A 3J81L 3SHLA 1DGSA 3ZTCA 1D6EC 4DV7L 3E0EA 2MX2A 1XNRL 4DV7Q 3DOWA 1YNJC 1KNAA 1XNRQ 2FUHB 3ZLZA 1TIFA 5IT9c 1Y1VH 2K8CA 3VVWB 3H15A 2A68D 2ID0A 3Q0AA 2I5MX 1ZOYB 3M7NA 4FN2A 3T8MA 3WAOA 2PMVA 3N20C 4OZAA 3Q2AC 2JA8G 2Q2TA 5G55A 1ET9A 4DR4L 4A3JH 1NYQA 1K51A 4TRDA 2BKFA 3DWQA 1STHA 2CW0C 4DR4Q 3P1HA 5JJIA 2BA0A 5C44H 3DUZA 1HZ6A 2FCNA 2KYWA 3NS8A 2N0SB 1HNZL 1WF9A 3P2BA 1HNZQ 2WXHA 3V61A 1AFPA 3ITPA 3UDFA 1XMOL 3W1GA 3HOVH 2ZZPB 3SK5A 1SXTA 1XMOQ 3A74A 4FDBA 4FF2A 2AWTA 2KXJA 3L13A 4MH0E 5CHVC 2R92G 4YTPB 3SU8X 4IUPA 4OXPA 5A2QE 4N9F4 2K05A 3GTOB 3FEWX 1H9JA 3MAQA 3A9JA 5IODA 3ULJA 5M5YB 1PRTF 1B4OA 3BS1A 2M19A 4B0EA 2EPBA 1PGAA 2V1CC 3LWEA 1FJGQ 1EIHA 5CX3A 2KJXA 1Z5SB 1EWHA 2N7JA 4OONA 2W82A 2RD0A 4GDKB 1KIXA 1I42A 5IWAL 4A3FB 2KANA 4HDQA 5L83A 1P7FA 4FJZA 2SNSA 1WGGA 4V0BA 4S17A 3HOZB 1AE3A 1B9RA 2EOTA 5HFYA 1WY8A 4DHZB 3Q8AA 1BQQT 1EZ6A 1QZHA 4GLSC 1S5DD 4I6PA 3H0GB 3BG3A 3NWSA 2LZ6A 2OTJA 1I50B 4DHJD 4OVUA 3PO2H 4WWPA 3UIOB 3LWUA 1ZUD2 1E2ZA 2QEJC 2LJIA 3KWLA 1HZCA 3BZDB 1WMHB 3AE3B 2K5PA 2ZCBA 4FJYA 3UDGA 1WTWA 4NB3A 1Q1OA 2DX5B 4CJ2C 1E0BA 3VH3B 1UD7A 3A7LA 5C4ZA 2JP1A 2Z6KA 1PVOA 2WDVB 4FO2A 4LF8Q 5IYDH 1C4PA 3KUCB 1WGHA 3SR6A 5FLMG 4JI5L 4CDDC 3GB1A 1N33L 4JI5Q 4EQNA 4UP9A 1N33Q 1JORA 3L16A 3QOLA 2JA5B 3Q3OC 3N30A 2K5HA 2WXQA 1A0IA 3UDIA 3PGZA 2KHWB 1S4ZA 3I4NG 2PI2E 2IY1B 3GTLH 4NZLB 2M56B 3TEHB 4B95A 2XN9C 2DAFA 5DNFA 1IBKQ 2K5QA 2J52A 2QCPX 2KCTA 4FULA 2OCEA 2A6HD 2WKCA 3CC7A 1ICWA 4FADA 4KZCA 3J80c 2R7ZH 4KDIC 1FNWA 2J42A 5IN7A 3KBXA 5C6AA 3J80E 1VQHA 3DM3A 4JOIA 4YWMA 2CKHB 4KJOA 5CMDA 2MQJA 2R3ZA 2FFKB 4IO9A 2WQYB 4QIWB 1TJEA 2WACA 2K75A 1M8AA 3J7YW 1KD1C 3PCOB 4MZ9A 3ML9A 1VQLA 3NUHB 3P4QB 1CHQD 1L5PA 1SNMA 4OO1H 1X3PA 3C2PA 3CPWA 1JQYD 5GAEC 2WXNA 1LTSD 5JVH3 1ZKOA 4K2KA 3L0OA 2UU9L 2REXA 1E3PA 1LTID 3K7AH 2UU9Q 4NJ6A 3GS2A 5IO9A 2V3PA 2H4OA 2FHTA 5H8YE 3KYCD 3A9KA 4JG2A 4UDUC 1F77A 4WURA 1I5FA 2AYOB 4DV0L 3PT2B 4NAWA 5C4XH 1YJ9A 1A3TA 3U7ZA 4DV0Q 4FF1A 3A4RA 4WRDA 2EMTA 5KHQA 2RDFA 4HEDA 2O6VB 1EOTA 3ZO5B 1UE6A 1E8YA 2HIVA 2B3AA 2PZUA 4BXXH 5E6OA 1J5EL 4A8XC 2WIIB 1H9RA 5CR3A 3U50C 1J5EQ 3PRMB 4F1SA 1XMQQ 3CC4A 2KD0A 2WXFA 4C3IB 4A3GH 4M8MA 3B6YA 1KH0A 4CDCC 1PZJD 2RDHA 4QY7A 4XTCS 1YQ4B 3U7DA 4YHHL 3EA6A 1Q46A 2BDNA 3QIAA 1ICFB 4YHHQ 3GTGH 1HA5A 3NHHA 4CKBA 2EJGC 2F0FA 3CCUA 3Q6BA 3ONAB 3TN2A 3H94A 3GP7A 4PT5A 5C2TB 4RF1A 2E74C 1WJUA 1TY2A 3PTFC 3WIMA 1PZKD 1Y8PB 3VYUA 1STEA 4YXDB 1ZXHA 3CMMB 5G3LD 4XDDA 2LVQA 2LXJA 4YIJA 4ZLTF 1OTCA 3CCMA 1Y8RC 2BE5D 2MSED 1XLPA 1BOSA 1SJHD 2E75C 3RZDB 3GQBA 3AE4B 4K0KL 5EE3A 2NVYH 2IX1A 4L2YA 4K0KQ 2VUMB 4WAFA 3AFQA 3L7ZC 4BOSC 1P9DU 1UUPA 5CYUA 3L3OC 4X3KA 5C3EG 1KHIA 3S17H 3T56B 3K8AA 2CQAA 2C60A 1LQBA 1VJKA 3TUOA 1M1KC 1KL9A 1VQ6A 4MN3A 4IWPA 3FDTA 1Y69U 5C1ZA 4E74A 1S3OA 3RLFA 2JQRB 3QWNA 3DWPA 5ELEA 3I57A 3DBLI 1BKBA 2EE1A 3V62A 4A3EB 4YY3L 2LVPA 3MJWA 5C3JB 3DEPA 3F2CA 1V1QA 4XYOA 4YY3Q 1JOQA 2KKCA 3L0WB 3PHWB 2DJFC 1WGDA 2NTSA 2N7DA 4A3BH 4IW0A 3NQIA 4RHRA 3CKIB 1HNWL 4QB4A 4W9CA 1QZGA 1HNWQ 2M1MA 3NVVA 4MJSB 3OIPA 3M95A 1KTKA 4DAPA 2DGYA 4FF3A 2E3TA 3OLMD 1V86A 2DENB 5ELFA 3RT3B 3QJYA 2NN6H 2KQ7A 4WJ3M 1K8OA 4IFDJ 2M9VA 3QG1A 1TWHB 3TP6A 1V2YA 2R7FA 5EPJA 4KVGB 4HIKA 4K6LA 1KOTA 4TV3A 2F0OA 3L2PA 4NJ7A 1NNXA 3PUWA 1LFDA 1L0VB 4FF4A 4ZKBB 3LXFA 2OQKA 3VUXA 1IHZA 3AH7A 1E1TA 1LLRD 4DK0A 1TWCB 2L11A 3GV3A 2Q8IB 4P75A 1KLGD 1U4AA 5IIFA 4IG7B 3OPOA 3DCGA 2OTLA 4A55A 3PS6A 5J2RA 4NXNQ 3QK0A 2Y0SE 4R4CA 2N9PC 4XIGS 4G0NB 3W9CB 1Q10A 3MXNB 1CI3M 1G8ZD 3RCZA 3PLVA 3KUZA 4BFRA 4BXXG 4LF4L 2MW5A 2PIAA 5T1GA 4IWQA 4F7ZA 4LF4Q 1X3GA 3PV0A 4TQUS 1T0SC 2HCIA 4DR2Q 4JI7L 4JI7Q 2TSSA 2LHDA 4A3MH 4IURA 4ASWC 1OXXK 2F1MA 2SEBD 2GOWA 4C3HH 1B9NA 4Y7NH 3FPPA 1YZ6A 4BY7H 2ZW0A 1JB7A 1F0ZA 2MO1A 2R2QA 2OJRA 2J0MA 1NEKB 4C00A 1IBLL 4NAMA 1B50A 3MXGA 4FXKC 5GAHC 5IP9G 4G57A 4LW1A 1B1ZA 4WORA 2FMCA 4DAVA 4WJNA 4FXCA 5H1SE 2RCNA 2Z4HA 1VQ9A 3TIXA 1R4QB 2I2YA 1A5RA 3IKJA 1CKNA 2NBFA 1T0YA 2F0IA 2KBNA 2DUDA 1HH2P 1ILPA 4A3KG 3KH0A 4RHSA 1SYGA 4WH4A 4KIKB 3AM9A 1EY8A 3CRKC 2L05A 4MGKE 3PZ7A 2R93G 4HJ5A 3I56A 2K6DB 3EBEA 2EKEC 4RGMA 1I3QB 4Q0FA 1E2WA 2RCFA 1FO4A 1ASZA 4GKKL 3TDQA 1YNNC 4RNAA 3VR8B 3SK8A 4GKKQ 1C1YB 3W1SA 1I6HH 3N52A 5C3WA 1S5BD 1YN3A 3N1ZC 4X3UA 2IT1A 2B29A 2N4FA 2PTLA 3KLSA 1V81A 2DNFA 3P4SB 2XWJB 3M3YH 3V05A 1K83B 2WXOA 3BVZA 2R92B 2DYBA 3OHXC 4HJ7A 2L32A 4YWKA 3H6MA 1PTOB 2KJHB 2QHOA 5HG2A 4B9WA 2DWQA 1JALA 2L0FA 1MKHA 1DGJA 2QGQA 4QJFA 5AJ3L 4IOCA 4YT0B 2V3NA 3NBHB 4BBRG 2F0KA 2WB1B 3UE1A 4KKIA 4DHZE 1ESRA 3NSWA 1JWBD 3ND8A 4W9EA 4AYBB 1HR0W 4EE2A 2MCNB 2QILA 2M0AA 3AE7B 2GN5A 4H02A 3AE9B 2GVAA 1CA6A 1P8LA 2Y0SG 2JEBI 5FR6A 3DBLB 3QAQA 1NMFA 1JJ2A 1MPEA 2KVRA 3S1NB 4HCNB 3WA0A 4EUTA 1BVSA 1PRTC 2EDGA 3VYRA 1EYDA 4OO1I 4L23A 2LGYA 2RMMA 4EFOA 1EU4A 4DNTB 4DNRB 1DD2A 4KLKA 2SAKA 3HHMA 3Q8EA 1HRJA 4ILWA 2R6GA 3A33B 3ER0A 3RR5A 1E8ZA 4ANVA 1F9PA 3DHIC 1TS4A 2LSSA 3L08A 1WI0A 5FKAC 4II2B 4A93B 4G7HC 3I90A 2K6AA 1VQPA 2GBKA 3KWVA 1XWEA 2G9HD 3PO3H 4XT3B 1P16A 2NVQB 4M8AA 2ZTCA 1I4QA 1J8CA 3M63B 3KDFA 1IP9A 1BBWA 4XE0A 1BBXC 2JU6X 1L1OB 2WXPA 4DV5L 3VDYA 1W2BA 4ZRZA 1IKMA 1L0XB 2D10A 4BA1I 4F88A 2MBHA 1FIQA 2KWCA 3PLUA 5EE9A 4HTHA 3BK2A 4HCEA 1A3VA 4X3SA 1X32A 5C0XG 2K9XA 3KFUA 3VAWA 4HJAA 3T1YQ 1K3BC 2CWAA 4A3CH 1CZWA 2KVZA 4FBJB 5EDSA 5KYIA 4JCVE 3HRDD 2A73B 4WAAA 3CMEA 5C44B 4GSWA 3R3OA 4ZQ3A 2JF5A 1DOLA 2V3SA 1HTLD 5LXIB 1B7YB 1LTGD 2JPHA 1RF2D 3RLNA 2DYOA 2INDC 1V1OA 3A55A 3AU7A 4KKSA 4R4QA 5E7NA 3HOVB 3DVGX 2K1FA 3M62B 5IT9L 3GE3C 1CT1D 2FCSA 2XTIA 3MHBA 2YU9H 3BVMA 3B0AA 5E3FA 4ZHOA 5ELDA 3I3TB 2KDMA 4LF7L 1WZ3A 4LF7Q 3ZUNA 4LDTB 3TBLD 3OMGA 1ZDVA 4JPSA 3MEHA 1A62A 1T5EA 3F2UA 3TZDA 3HOZG 2BT6A 2I38A 2MJDA 3AEGB 3NQTA 1QE6A 4POFA 4DK3C 1OFFA 3H0GG 4W9HA 5A2QL 2LEKA 5JEAJ 1ISNA 2AQ3B 3K80C 1PFDA 4X3TA 1Q90A 3TP7A 4HEA1 1STGA 3ZDMC 3KJOA 2EZVA 3S2HH 3T1HL 1LM8B 3IVFA 2BB6A 2N3SA 1C8CA 3T1HQ 4DA2A 5CORA 2GLSA 3NY5A 3DBSA 1WD1A 1Y14B 5M5WB 4US9A 1VQIA 5COYA 4DPGA 2LUEA 3AE2B 1TBEA 5HI1A 2K7VA 3OOCA 3TZUA 3J7A5 2PZTA 3QHTA 1H9SB 3U2SC 2NN6I 3ZNHB 4C1NK 2A69D 1FEHA 3Q8FA 5FR3A 2B2YC 1HTPA 3APFA 5IYCH 3V6CB 2AHOB 5CC4A 4RMFA 3JYUA 4J6IA 3KW5B 1YHAA 1ZP0B 2IY5B 5C3EB 3OW2A 2A74C 1AN8A 2G4DB 1C79A 2AWOA 3FKYA 4XZ4A 4K5XA 3CSFA 5GMVA 2ICIA 2X69A 5DEHA 2UUBL 3VFKA 3GTLB 1AP0A 4YSYB 2UUBQ 1XTCD 4V190 3VXWA 4CDFC 1C7YA 2EIFA 1NAPA 1NR2A 2DLBA 2JUOA 2KUMA 1XXGA 3A54A 2GBRA 1AH9A 4DAYA 2KX3A 3OTOL 2R7ZB 2AX5A 3OTOQ 4OW0A 4A76A 1FCCC 2BWFA 3ZNGC 2Q8RE 1V80A 4Y52H 5T1IA 4DDID 3EJIA 2K8HA 4WIPA 4GLXA 1UWVA 1SNOA 1EF5A 3O65B 3G71A 4N6EB 2ZXRA 5GXGB 5KGUA 5E6NA 2ASBA 5L37A 1N63A 3FHWA 1YMHE 2K04A 2UYZB 3UINB 3J80L 1JOOA 3PO0A 2WNMA 4LFCL 3ABVB 1RJTA 4OVVA 4OIKA 4LFCQ 3K7AB 1YNJD 4FHKA 3QB3A 1PDXA 2GBNA 2F0SA 2OF1A 3RZOH 1QG7A 3S1MH 2D5GA 4HK2A 1QNKA 1BCPB 4KN7C 5C4XB 2DZJA 2RSNA 2CW0D 1AEXA 3U52E 1LT6D 4H44C 1QJOA 3SK4A 2FCMA 2JT4B 2KN5A 2W54A 1C9FA 2VH1A 4LUZA 1AYFA 2YLMA 1HFNA 3OWFA 1NBFC 3LGJA 1QOGA 1HHVA 2BB5A 1WYDA 2DNEA 2F0WA 1MJEA 1ZKHA 2KC1A 3ZXVA 2LJ5A 3F1ZA 3E5SA 3RZWC 4KSKC 4CO7A 3N1YC 4HJ9A 2RSUA 2K5DA 5G5GA 4A75A 1O7ZA 2WLBA 2MQHA 3GTGB 1D3ZA 3BU2A 3SVMA 3K7UC 4C56C 3ZYYX 1E7UA 4HXDA 4LJOB 4O2DA 4AP4C 3GTJB 1H9KA 3SFDB 3Q3FA 4P73A 5LNK1 1TU2B 2OHFA 3TJPA 4H7BA 2Z9HA 3KF8A 3VRAB 2MUYA 5D7GA 3CMAA 1RODA 5KHOA 3RFZB 1P1AA 2NVYB 4PQXA 1IYFA 4POGA 3BDLA 3S1QH 4XQQA 2RA4A 3HFZB 4C1NI 3PZDA 1HJPA 1NMGA 2CHXA 3S17B 4A3EG 3OJ3A 2L5TA 1WX9A 1A15A 3C1FA 1YNTE 1DM0B 4ZHPA 3HRZC 1YHBA 1T6BX 1J19A 1YQBA 2MJ3A 2LXKA 1AZPA 1CSQA 1Z7TA 2NWGA 2GBMA 1ASYA 4FJVB 1S5ED 4MTKA 5JJZA 1M90C 2VL6A 2A8VA 1BUIC 3EGRA 2IGDA 5D94A 3GTQB 3LDZE 2PQAA 3BWUD 3MEFA 1G6JA 2VZKD 1HEZE 4RG1A 3HOUH 1BCPF 5NUCA 1PH5A 3QOJA 3ERQA 5DLQE 4L5SA 2BH8A 4UHVA 1VQEA 3L54A 4LJZC 3KLWA 4JI1L 1HNXL 3PUVA 2WB1E 1HNXQ 3U4EG 2AWNA 3G6EA 1Y1WH 4OIJA 1WJNA 1FYCA 2N1WA 4HROA 3ZRCA 1Y8OB 5JJLA 2HDMA 2A69C 4BBRB 3H3VH 5K36H 3F8TA 1E7PB 1E9MA 4AYBE 4CKCA 2JWZA 4HLEA 2EQSA 1YJ1A 3V2TA 4C3JG 4M0WB 1ZE3D 1NUCA 1GOZA 3S1RB 4PZ8A 5LL6X 2RPQA 1TZOA 3DHGC 1RKNA 2L0CA 4P2CB 2IW3A 4XQNA 1UH6A 4IUQA 1LT4D 3B2FA 2ZJPA 4XC2A 4ZDVA 4CQNA 2DNCA 2VW9A 2WP9B 4EGVA 3Q6SA 1VZ7A 2K25A 2Y0SB 3SEBA 3EFXD 4DUYL 5HGQA 4TUUA 5JHBA 4DUYQ 3K59A 4US8A 2G4SA 3CQZB 5EQ0A 1JMCA 2ONQA 2IHFA 1O78A 4FP5D 4KY5A 1NCVA 1Q8IA 1OEYJ 5CV5A 2JA7H 4DK1A 3KBGA 1I7HA 1WCMH 3FILA 1QKZA 1G6PA 2Y5BB 4B08A 5KNCA 4MIUA 3QA8A 3MZ5A 1F9QA 3EHVA 2WP8J 4A3MB 1WVLA 2KTRA 3GV6A 4NPNA 5JOBA 1VQ8A 3HOYG 4OL7A 4C3HB 4Y7NB 1UEAB 4RA8A 4DV3L 3ERSX 4RKLA 3J7ZC 4BY7B 4AJYB 4DV3Q 5LMNW 1HQMC 2WAQE 4HIMA 2K32A 1ZYRC 4GKJL 2D2CC 2EY6A 3T53B 4IJHA 2KK8A 3NVYA 4GKJQ 3ZIMA 4J1MA 1TS5A 2IO1B 4I65A 1WR1A 3K9PB 5JZEB 1A6XA 4HSVA 3S16H 2G5DA 2DAJA 3SFEB 2F0TA 2CFMA 4KKTA 1XTDA 3HOXG 3NVZA 2XRSD 4EKUA 2HQLA 1H9MA 1P0RA 5ELNA 1WM3A 3JC66 1WYWB 4RF0A 2GMIC 3NE5B 3ZW3A 2NVTH 2AKWB 4UP8A 3JSVB 1LXDA 1TS2A 1PH1A 5CHWA 3A7AB 5CHFA 1PZID 2O2LD 1KRTA 3RUIB 3T4AC 4JI8L 3IAS1 4JI8Q 4CJ0B 3AV8A 4WJQA 1WYGA 1I6HB 1DCZA 2JYEA 2KO3A 3ETRA 1QF6A 5EGTA 4WWNA 1FGBD 2DN8A 3KJPA 1R9TB 3JW0X 2L0TA 5G2NA 1RFAA 3SXHA 1OXTA 1TWGB 3M3YB 2BDOA 4HJ8A 4J15A 3NOBA 2WB1G 5GAGC 2Y5CA 1CK1A 2G3QB 1YJIA 4G7OC 2K22A 4EQPA 5IWAQ 1C76A 3VUYA 1MIUA 1N61A 4ARCA 3HK0A 5E4WC 3K5OA 4MM3B 1WFQA 4AYBG 1PH4A 2UUAL 1P98A 4C7ZA 2I46A 4G4KA 1Q8KA 1SYCA 4CGYB 3KF6A 1GM5A 2UUAQ 2LY7A 2IWHA 1EY5A 3MWYW 2NVXB 2I1KA 2ZM6L 2R61A 1UZXB 3HOWH 1U0LA 3RNUA 1YX5B 3TSSA 1LT5D 4TKNA 2JA6H 3CAMA 1VQNA 2KFKA 5K5PA 2KNBA 4HJGE 1FXAA 4DFAA 3ICEA 2CU3A 3E0JA 3VQIA 1PYSB 1RFKA 3A1QB 3PIP3 3F2DA 3PSIA 2A5UA 2D62A 3MTSA 5J17A 4LNNA 1NJIC 1IPGA 1EIGA 3FKIG 2NBVB 4OWXB 1Q82C 2F0HA 2VQEL 5HGTA 2VQEQ 4DU9A 1XLNA 1S72A 4A93G 1ML0D 4MHEA 2QDBA 4D2KA 1X1MA 4GNXB 1TKGA 3X3MA 3HM3A 4ICVA 1P7EA 2YEPB 2LASA 5FLXE 2FMMA 2LXAA 1YEZA 4HDOA 1VQOA 2WAQG 2JYTA 1PH8A 2QC8A 2MHVA 2KWVB 1ENCA 1C0AA 2UXDL 2MO0A 1RDPD 2UXDQ 1TT2A 4IDIA 2XNAC 4ZKCB 3PO3B 3RNCC 3ZQ4A 5KNDA 1H8CA 1YI2A 1OTRB 1Y1VG 1MSGA 1TTNA 2PCFB 3NXWA 3CCQA 1WZ0A 4OELB 3EUB2 1K50A 2ZTDA 1FL0A 1RLFA 1XF5L 3AMUA 4BKTA 1QVCA 2NBUA 3I3CA 1BF4A 4A3JG 2HD3A 2QA4A 1KJTA 2W3SA 4RCNA 4BAXA 2PNHA 4M00A 5C44G 3KLRA 4RM9A 1L1OC 4A3LH 2D3GA 4HRSA 1OEYA 2LGXA 1FRDA 4KHVA 4YCUA 3CCJA 5IAAC 1I4PA 3HOVG 2N9KA 5C4JH 2PVOD 1RTOA 2YTVA 3N1XC 3LJ3A 3G7LA 1Z9FA 3HKZB 4YWGG 3UQBA 4NY0A 4NDXA 2KECA 3A8KE 4X64L 3Q22A 4LUOA 1PH9A 1IYVA 1JT8A 2ZEQA 3PUXA 1ENFA 4X64Q 4B3ML 4B3TL 4R3DA 3UGBB 1UGMA 4B3TQ 4B3MQ 1L7YA 5TSSA 2F0UA 5C0XJ 1PYWD 1WI5A 4QUCA 2DHZA 2NPTB 2ZPYA 3MHSD 1DXMA 2K39A 3SGIA 3SR1A 5IP7H 3TS0A 1YNND 4PS7A 4IQZA 4CKEA 2YU9B 2CVRA 2F3WA 4BWGB 2GRIA 2KMMA 1V1PB 1HFGA 4YWLA 2IBIB 4KMUC 5BO4B 3NK9A 3S15H 2BOSA 2KQSA 1IBML 3EFUA 3QARA 1SE8A 2QEXA 2L12A 3U8ZA 1E22A 1GUOA 3S24A 4ALPA 1V43A 1F2RC 2X38A 4IKGA 3A0JA 3RPFC 3PO2G 1VF7A 1RRBA 4O42A 2RHSB 3TP5A 2YEPF 2G1EA 2LMCB 3S2HB 1WGKA 2IHEA 3NUCA 2KWUB 1T5XD 3NZ3A 4DF7A 4ITKA 4RGOS 1GJXA 1O80A 5IYDG 2Y3AA 3U30A 1C4QA 1N6ZA 5KEEA 2PVGC 4YCVA 4JI6L 1HQRD 4JI6Q 5IP4D 3U4ZA 1QWYA 1JMLA 3H3VI 3M4QA 5ELCA 4ODGA 1OO9B 2I5LX 1F9SA 1N9WA 1Q1BA 1TWFH 4A90A 1SSNA 4II3B 4AUQC 1Y8NB 2W3RA 1CM9A 1VQ5A 1PRTD 3VUWA 2XSCA 1SFOB 4PNYA 2BS4B 2IYDB 2JZPA 1U9RA 1GNUA 4MGZE 3PGEA 2KOLA 4OEMB 3FMCA 2R7ZG 3NZSA 1CTMA 1JICA 2E76C 3R2IA 1W6KA 4LMQD 2O2VA 3I5JC 3H7PB 2HT1A 3U9OA 4ZRKA 3OSOA 1T0RC 2C7NB 3Q3NC 1PGBA 2WU5B 3RLOA 5JJKA 1EY6A 1GHKA 2ZVNA 2KENA 1XLOA 4XYQA 1X3FA 4MELA 1G2TA 3PUZA 5L95C 1GO3E 3BY4B 4P72A 2B2WC 1E6EB 2M0XA 2XEWA 4OO1G 4JBMA 2INPE 4AQ7A 3RMKC 1DJRD 1SYBA 5E4XA 2F0NA 5IYBH 1DOMA 3W5OA 3D6CA 2DZKA 3RMHA 3EC8A 2PW5A 5DPTA 5LLIA 5D65A 1EY0A 3UIPB 4JV5L 4LAAA 3DQVA 4B3RL 1N5XA 1HZAA 4B3RQ 5C4XG 3OAWA 4C3JB 1WGRA 4UP7A 2L15A 3S9WA 1PA6A 2XRQD 1YOVB 3DDCB 1SRUA 3W3AA 1V6EA 1WXQA 5BN3A 2JA9A 1B2TA 4A3IH 4JX1C 2OQ0A 1DOKA 1WRDB 1HA6A 5D6JB 3RZOB 1X3QA 4IPGA 2D11A 4LCDE 3S1MB 1VMCA 3PUYA 2KDFB 1OXVA 3N6RA 4G3XB 4C4VA 1JE4A 1I4RA 2K33A 3MHZA 2L4NA 4A3GG 2JXXA 4A3DH 4REZA 4H2AA 4JWSC 4IZ8A 4XXEA 3SDZA 3B1LX 2VXWA 3VR9B 4RCOA 3DHQA 1SNDA 1E0ZA 1XD3B 2YVCA 1F2YA 4AH6A 5I2XA 2D2QA 1OXSC 4X66L 4P7IA 3BINA 4TMAB 2VB3X 4X66Q 3S2DB 1E7ZA 1F2ZA 5AUKA 2WV6D 3TRZA 1NENB 4QUFA 1E8WA 2MH7A 4WWOA 2A6EC 4OWWB 1IBLQ 3NJTA 4A4IA 1ESFA 1GUTA 3HOYB 1SIJA 2IO0B 4M8NA 1Q0WB 1L6VA 1WM2A 3TEWA 1BT0A 3S14H 1KRHA 1VLBA 2ATWA 3AEAB 4YSXB 1Z6HA 1YX6B 2QKIC 3NP8A 4QQBX 3ZJTA 3I73A 3R93A 4C2MB 2FINB 3TS2A 2CS4A 4A6QA 4RGTA 3ZVVA 1WTVA 2WS3B 1KQSA 4HCSA 1IXRA 1LABA 1VZ6A 3E9HA 1GUAB 1F9RA 1X56A 1BO0A 5IGGA 3J7AF 1G6ZA 3VA5A 1MHXA 2VS1A 3QO2A 1PH3A 2ZXOA 4ZCKA 2M2LA 3VR2A 3HOXB 3NWTA 3TQYA 4K3CA 5D3DA 2KZRA 2GVBA 1WSPA 2XK5B 4IM3A 4FLHA 1XJVA 4A3BG 4EQ5A 4QAYA 4GDKA 1MG4A 3NENA 4GB9A 4XWWA 1CZGA 4Q5VA 2WXKA 2DJGC 4GDLA 3ULPA 2N1VA 4LJPB 1WJ6A 4Z9CB 2WXRA 1QZEA 5AJ3Q 1TR5A 2Z0SA 1D2BA 2NN6G 3APDA 3H6NA 1HTOA 5BR8L 1SYDA 5BR8Q 3GTOH 1AWDA 2O5JC 1VS0A 5IGEA 3AI5A 3ECIA 3C0RB 1HUNA 3P4RB 1YD8U 3KYHC 1UAPA 2ZXPA 2B2YA 1WMHA 2IDYA 4GU2A 1AW7A 3I63C 3TEZA 1EYCA 4BBSH 1X3EA 2F52A 3EECA 2MJEA 2KJRA 2L1BA 4A3FH 4MH8A 3B2GA 3OMCA 3H8HA 3RUZA 4LNFA 3W2DA 1ZPSA 3W1YA 2A1AA 2ACZB 5D14A 2WX1A 4P6VF 1EUJA 3EROA 1VMPA 2WWZA 2C5LC 3D32A 2EYMA 3IRBA 5IGFA 1Q3LA 3NTIA 1KRSA 1I50H 3IFDA 1EQQA 3PPAA 5DPSA 4RAUC 2N9XA 4K1RB 1N5WA 2D9UA 1AZQA 1HCZA 2WYQA 2EYLA 4NW2A 1XEEA 1EOVA 3D31A 3FKIB 4A3MG 4HWIB 2B8GA 1H4RA 2RVLA 1GUWA 1CQFA 4YL8A 4C3HG 2GBJA 1RD9D 4E6IA 4BY7G 3DVNU 3P20A 1D1IA 2Z6BA 1T3QA 2QF7A 2KQ4X 2WGSA 3QWZB 2PYKA 2JA5H 1DOIA 4LNKA 4TKOB 3SD5A 2O6VD 4GOPB 2WAQB 3RNGC 1JOKA 3C19A 1MD2D 1FNUA 1GPXA 1VQMA 2Y5PA 1SNCA 2K52A 1PLFA 2IL8A 1D5XC 4DV5Q 2J0KA 2OJWA 3RNEC 3VH4B 4AWJA 1WWTA 1QUQB 1YBYA 1PTOF 4IFDH 4JI4L 1K52A 1Y1VB 2AQ1B 1L6UA 1J9OA 3HS0C 2R2OA 5LMUL 1SEBD 3DEOA 2EYFA 2F0PA 5HURA 1PUTA 2F4IA 5LMUQ 4J6HA 2MP2B 2RDBC 4JWUC 4A3JB 1E8XA 4N59A 2BS2B 2O6VA 2NMQA 5J3BA 3I4MH 3F2BA 3HKZE 4GOCA 3HZXA 4GN1A 3RN2A 2NVTB 2IJ0A 3BYYB 4IUVA 4DR5L 4RWSC 5KNBA 4DR5Q 3H9DA 3V96A 1OGWA 2RBMA 4OZBA 4YTMB 3AEVA 3DBHI 3AYHB 4HPPA 2MP1A 2V4LA 1FR3A 3ZNID 2C9WB 4F87A 2KCMA 1L4DB 4NNJB 1LO5D 1YVCA 1ZDXA 5AUIA 4A3OA 5AZHA 1STYA 1GXDC 3E9SA 4WQMA 1LV9A 5KYLA 1GVPA 1A2UA 4R1JA 1U4MA 2IX0A 5BN4A 2LD9A 2B63H 2F0VA 2PEAA 4NKLA 4MSMB 5DPWA 4IPHA 1WX8A 1WFYA 1VDVA 3HM6X 3MVVA 1CA5A 3WAMA 3T3NA 3BVGA 3Q69A 4E3CA 4BY1H 1QOFA 1EZ8A 4C3IH 2KFJA 2K28A 2OOBB 5EAYA 1JWMD 3P1MA 4BBSG 5MPOA 1D5MC 1IW7D 2QIEB 3A9JB 1WGYA 1SAPA 3HOWB 3PO2B 1TWAH 2V0GA 1WXVA 1VQ7A 2L3ZA 4BKSD 3P63A 2LVOA 2JA6B 2WFWA 3AEFB 5IGCA 1PQSA 2F0MA 3RNAC 3PMFA 1RTNA 1KXLA 3BIID 3QJZA 1MG8A 1C78A 2HHHL 2CHBD 1UBIA 3ZDTA 2D3CA 2HHHQ 1CJEA 3R66C 1TS3A 4MEMA 1Y56A 1FM0D 1IKLA 3MXPA 1HZBA 3PQIA 2ZVOA 3KUDB 2NS5A 2VUMH 1A8VA 3FAHA 1UE1A 4YSZB 1XQQA 3KYDD 4BBNF 1FFVA 4BKSA 1II3A 2WXMA 2B2VC 4MJSA 1IZ6A 2PNRC 3I8ZA 3KLSX 2J7QB 5IGDA 4KK7A 3PO3G 3GOEA 3QC8B 4G50A 4KKJA 1ZXIA 4ZRJA 1E10A 3P7JA 4KTAA 4LF6L 4GNXC 4FNFA 4IPCA 3QX1A 4LF6Q 1Q5WB 5M3FH 1YN4A 2F0QA 4KGSA 5CBEE 4DXGA 2NVUI 2V9HA 1IGDA 3PIOA 1TYGB 2LHEA 1CMXB 5BMGA 2N9LA 3C3LA 4PZ6A 3CXCA 2W55A 2OWOA 4PS8A 1EFID 2VY3A 4DHJB 2AL3A 5FLXL 4URKA 2ZNVB 4B9XA 3LYYA 2MEKA 1HR0L 1YIJA 4A3CG 1EUVB 3L4PA 4P1BC 4DV1L 1ZYRD 1HR0Q 2EVBA 5J22A 1FCLA 4DV1Q 5FJ8H 3GZNI 3HKZG 1FRRA 1R4MI 1GUNA 1KLVA 3JVZX 3WDNA 3MXNA 2F0GA 2K5WA 1QILA 1Q1EA 3GDEA 4FXDA 5C4JB 1F1HA 1JW9D 3M4OH 1C4AA 1RL2A 1YJJA 3CD6A 2N7EA 4KJNA 4JK1C 3N3KB 1GC6A 2NCNA 2LI5A 2OEOA 3VYTA 2F03A 1ZGUB 3K5NA 3WAPA 1V97A 4RMAA 5FK9C 2BYTA 4KSLC 4ANXA 3E3XA 4OWTB 2D0OA 5M3MH 2LXCA 1EQTA 2PMZB 4FHJA 3ZXRA 1HZ5A 3RYTA 3WANA 5FO7B 4ME3A 1NVID 4A3GB 3L17A 4ZK9B 2NTTA 4MNOA 3PVLA 1PFMA 3PSEB 2PKOA 5JH5C 3A9KB 3RD2A 4WJOA 1R7SA 4E71A 4WJWA 3FRPB 4NAWB 1M94A 2EXZA 1SE3A 3BZCA 4LNQA 2CHZA 5EBDA 3K0XA 2ZJRA 4ARIA 2JN4A 3KOJA 2E8GA 2HJ8A 4BA2I 3D6WA 4KIKA 3L9AX 1PTOD 1J7BA 1VDZA 3A8JE 4JPBW 3DVNV 4I6NB 1EM7A 2BA1A 3E56A 3DBHB 2XIWA 1N32L 3H09A 5IYCG 2VNUD 1N32Q 1X65A 2L00B 2EY1A 2PO4A 3UQAA 1G91A 1HUMA 1M4VA 1MFWA 4OX9L 1ILQA 1QQRA 1CKMA 1Z2MA 2AEHA 4J3OD 4BKGA 4CHKA 1GJZA 3GE8C 2VZAA 3P75A 4BZAA 3IAM1 2DZMA 3U58A 2BVCA 1UE5A 1VQCA 1B9MA 1TWFB 3FC4A 1XPUA 1TY0A 3IFWB 5CV8A 2I5HA 4R9WA 5IY0A 1WTRA 1PXUA 1S5CD 5I4DA 1EWCA 2JA8H 2H5XA 2SDFA 5I9OA 4HCPB 1MBYA 1I3QH 2Z1CA 1XPRA 1OQRA 1VR9A 1ONLA 3NBHA 4PMCA 4A3BB 3M9BA 4L5RC 1WXSA 2BH2A 3HUIA 1B3QA 1IW7C 1IYUA 1SMXA 2L8JA 2ES2A 2KDBA 1MJDA 4ZOHC 4NMZA 4DV4L 4JI1Q 4MSQB 2D3BA 1YJNA 4DV4Q 2JEAI 3CU7A 1K3RA 2KMAA 3IG3A 1SYEA 4WFN3 1K83H 4I7AA 1SJED 1SNQA 4LFAL 2R92H 1DZ1A 1QLBB 2GI9A 3ZJVA 4LFAQ 1JCKB 4U68A 4UPAA 1IBXA 5JEAH 2UWQA 4JIOU 5G5HA 1FD6A 2HDLA 1RYJA 1KDAA 1FMAD 4AS1A 1I4XA 1C48A 3VA7A 2V4DA 1WXMA 2KEEA 2P5ZX 4HSPA 2PW7A 1XO3A 1K9MC 3GTMH 4IWOA 3E6ZX 3NBIA 2INCC 3HKSA 3NELA 1JRPA 2BF8B 2FBWB 1GUGA 1BBUA 1BMLC 2YV5A 1TT5B 2F0LA 4KD4A 4WJPA 2LGIA 1J6QA 1LTRD 3EVQA 5D3IB 5T8IA 5I6YA 4A3IB 4PMBA 4IFDI 2X6LA 1LTBD 2BKRB 5EKLA 1WTOA 2J0TD 1BXTA 3RNBC 3K0YA 3MC8A 4A3DB 3S1NH 1LTAD 4LWCA 5DPRA 1EQVA 4ZRQA 2KCNA 2H89B 4R8NA 3JAMi 4EZKA 2F0DA 2WINB 1WTPA 4PV1C 3WALA 2EXDA 3IHPC 3NTHA 2FAZA 2AQ2B 2B2TC 5HY6A 5FLMH 4L6TB 3R3MA 4PMWA 4O0AA 1L1OA 4HIOA 1V5TA 3AE5B 4EZJA 2BGFA 2HTME 3WWVA 4DK6C 2MA9B 3STBC 2QMTA 1K0SA 3GZNB 3OIQA 3K57A 1NTGA 2N88A 4N9PA 1XPOA 3I4NH 4H13C 5ELOA 1EQRA 1S5FD 1DYQA 1GD7A 3S14B 2JSVX 2F3IA 3B9JA 3J9CA 4WQOB 3GD7A 1DONA 4EZLA 4LDTD 4RKBA 1XCTL 4DXFA 4IALA 3ALBA 1EYAA 1U4LA 1C77A 2RR9A 3TEXA 3VRBB 1GC7A 3H7SA 3RULA 2Q8TA 2ZTEA 1JR0D 1R4PB 4JE3B 1YNXA 2JX5A 3TL5A 2FIDA 2QSDA 2KEDA 2LUMA 3U9SA 4G7ZC 3NG0A 5G3LF 4PZ7A 3WOFA 4ZRIA 4GN3B 4EVOA 5BYRA 1LT3D 1MSHA 1UBQA 3P4PB 1E2VA 4GZYC 1K73C 5IT9E 3AB5A 2RKSA 3BJUA 5EPLA 4K7UA 3A56A 4W9IA 1SR3A 4JI0L 2HUGA 4PG3A 2C5CA 1CKNB 3BK1A 4JI0Q 2HDEA 5CTRC 1TKWB 1SN8A 2KHIA 3HOUG 2N9EB 2K01A 3PIO3 3C46A 2LRUA 1MHWC 4JC0A 1PDQA 1GHJA 1D1KA 1VQBA 1IUEA 4YCWA 2N8NA 4L63B 5CV7A 1Y1WG 1PTOC 1SIFA 1K8RB 1EYGA 3TEYA 4HMIA 3N9YC 4CBVA 4JLCA 3BYTB 5K36G 2EJFC 3GTKH 1DOXA 5JEAG 4XQJA 2DY7A 2VH2A 4KN4C 4G11A 3TMEA 2ZM6Q 4K7SA 2R7DA 3T16A 5BYSA 1FJGL 2J0JA 4N9TA 2ZCCA 4IM0A 1H9SA 3LX0A 4HIDA 2K3UA 1EL0A 4KHPL 1OQYA 1D8LA 3ML8A 4KHPQ 4BBSB 1QVFA 4GDLB 4W9KA 3I4OA 2WDTB 3H3VC 1KFYB 3U4VA 1SGHA 5GQOA 5JPNC 1V8QA 2PE9A 1C3TA 3TREA 3ONSA 2PI2A 1QT9A 4DWFA 2E2IH 4I6LB 2FE8A 2ICEC 2JA7G 3V60A 2MBEA 1WCMG 4ME5A 3D4DA 5M5WH 1VQDA 4LNIA 3R7QA 4PYZA 4R4OA 2B2WA 5KRUA 5FLXc 4JBWA 2ZW1A 4M02A 1BUVT 2CKZB 3MXUA 1RCVD 4LF8L 2M8SA 2K1BA 3T3OA 1YQ3B 1S3SG 5C3EH 1K8AC 1BCPD 1LACA 1SDFA 3JAMc 2FNJB 3OWEB 3ENEA 3T9LA 2NZ1D 5AFWA 4MGIE 3JAME 1UWMA 2L83A 1JRUA 2VB2X 4TVAB 2EELA 2KCCA 1EIYB 2EYOA 3M4YA 2WKDA 5EPKA 2A19A 4DDGD 4DN4M 4PK1A 2E2HH 1V5OA 2JRIB 3WCQA 1IBKL 3CC2A 1YJWA 4GOPC 2A6ED 1SSOA 5BYQA 4J8QA 2X6GA 5M5XH 4HKZE 4ANUA 3DLLA 4A20A 3LNNA 1QB5D 3G48A 2K5NA 1UWXA 2CJOA 5EE1A 2KA7A 2C35B 1LYLA 4DR7L 2E6XA 3TMPB 3W5UB 4DR7Q 4MTNA 1TXYA 2KWDA 3B08A 3NHEB 3KK7A 1I94L 4F8CB 4HMJA 4B0MA 1I94Q 1YN5A 3QR8A 1CZPA 3KVFB 3I2ZA 3L10B 4BBNC 4MACA 4XYCA 1MJCA 2KLGA 1UNSA 4GN4B 3I4MB 2KDEB 1J7AA 3KDFB 1MVKA 4ZAIA 2M4NA 3NVWA 1S40A 5FO9B 2FXQA 1TIID 3R2TA 3OW7A 3Q8CA 5TR5A 3ND9A 3CP0A 2PMZE 2Z59B 5BN5A 1VZ8A 4DXAB 3Q24A 4P16A 4S0RA 2EY2A 4KGRA 3MC9A 1GB4A 1KABA 4HN7A 1PYBA 1NDDA 4A9AA 5EBCA 4X65L 1W3SA 2JSOA 4LF9L 3P42A 4X65Q 5IKCM 4LF9Q 1IBMQ 3EQLC 1SE4A 1EWYC 3CF6E 1VQFA 4IC7B 3J81i 3HVDA 3A5UA 2JZ3B 2JYOA 1AE2A 1VF5C 2B63B 2ZPNA 3NTKA 2CR5A 5D2MB 5LMNL 2RGFA 1HZ9A 3BDOA 5LMNQ 3HOWG 1YHQA 1WOCA 1XMQL 5AEKB 5CBAE 3G6JB 2K4KA 4DV6L 4BY1B 2JY6A 4DV6Q 1I35A 2JA6G 2DY8A 4LF5L 4GN5A 4U673 1TZ1A 3I9V1 4LF5Q 4GXBA 2QDLA 4NP5A 1T0QC 3CCRA 1TWAB 3HVZA 1Q7YC 2A68C 4ANWA 1QVGA 2EJMA 2B3GA 4QF4A 2K03A 3GTJH 2IPKD 4EX5A 3PF5A 1I4HA 4KHZA 5IP9H 1O7LA 1QOAA 4TQ1A 1L4ZB 3A8IE 5C4HA 4W9FA 2BQQA 4K8JA 1QOBA 3PREA 4KD3A 1WXAA 2UUCL 3MTNB 1AARA 2UUCQ 1H95A 3GTPH 3MP9A 1ENAA 2PPBC 1L2FA 1OQQA 2H1EA 4A3KH 1WRIA 1J0GA 3Q23A 1K28A 2HTHA 3DXJC 2R93H 1E24A 3AECB 2BW2A 3X0WA 1TKEA 4GS3A 4S3SA 5I2YA 2F0EA 4LNOA 4KKUA 2VRRB 3I91A 5M3FB 4HKQA 3ZJYC 2MNAA 3I4LA 2Z6KC 4M0WA 4W9GA 1YITA 4M1UB 4GLAC 4XT1B 5I6WA 3GTQH 1STNA 4B3SL 4A3LG 1NI3A 1NYRA 3DM1A 3PHXB 1N8RC 4GLVB 4B3SQ 1NSNS 3UI2A 4JV5Q 1GB1A 3HGBA 1E90A 3CSTA 4K7WA 3UE0A 1K53A 5JXVA 5ELBA 2ZNVC 3VTWA 2FCQA 4DAYB 3AXCA 1IGCA 4BBRH 3CF5A 4QCLA 3PF4A 3NEMA 4RFBA 5HKHA 2PZWA 3M4OB 5IP7G 1EEID 1F2LA 1FD7D 2CH4A 4X62L 3S1RH 4WJ4A 3Q8DA 4X62Q 1NI2A 3PRZA 1BCPC 4P1CC 3DWGC 4JOIC 4OZCA 1RWSA 1A63A 5ISRA 2WXIA 1EF1A 2L76A 2YTXA 2E2JH 5M3MB 2ZJQA 3ZTDA 4P74A 3ZGZA 1HTQA 3CW2C 2KX0A 1K0RA 1RAXA 2JQOA 4NXNL 1OXUA 2NZHA 2A4ZA 4KI0A 4F7XA 3D8GA 3CQZH 5JPMC 4OVZA 1JWSD 1ACCA 1RHPA 3VR4A 4JI2L 2C7MB 3CCLA 4JL9A 2A6HC 4JI2Q 3EN2A 4TQ0A 3SE0A 3J81c 4DAMA 3J81E 1WE7A 1KAWA 4DR2L 2JRHA 3HEJA 4ZUIA 4M01A 2UXBL 1A70A 2PPHA 1EFWA 2UXBQ 4MT5A 2KOXA 1SB3C 4F8MA 1G51A 1WE6A 2BYVE 1PMRA 1V49A 2WXJA 3JSVA 2JXMB 3A5ZB 3T13A 3VYSA 3CCSA 1RIPA 2H88B 4ZUJA 3PV1A 3S1QB 1S1QB 2C9OA 2XWBB 2MBBB 1WJ4A 2PJHA 2V4IB 4ID6A 3DVGY 3MC0B 2B8FA 4KGTA 2D07B 5EJWA 3PRPB 1KLUD 1B3AA 1CHPD 1D5ZC 1F2RI 4ZYNA 1NE3A 1EWIA 4AQYL 1F2MA 4AQYQ 5JAVA 1TQOA 2LS01 5EKKA 4KV6A 4DV2L 3KF8B 5C0XH 2NR2A 3RI7C 4DV2Q 1LGRA 2IGGA 4NQKE 3EFCA 2JA8B 3R7RA 5KIXA 5J18A 3CRLC 4MM3A 1JQ4A 4R8IA 2CCZA 1EU3A 4IJLA 1XX8A 4ZRPA 3I55A 2MLBA 2M00A 1UE7A 3MFGA 4FVMA 3HOUB 3G4SA 1SNPA 2KAJA 3AB9A 1WX7A 1Q86C 2D3AA 5M5YH 4KV2A 2TMPA 5GROA 4PS3A 5IYBG 1R9TH 4LFBL 1V8CA 1JC7A 4BOZB 4MDKE 4LFBQ 1Y1WB 1EY9A 1TWGH 2F4VL 1LTTD 2KDIA 2F4VQ 2WX0A 1N62A 1WH3A 1XT9B 3APCA 3N32A 1I4GA 4IN3A 3SDLC 3A1QA 4DBGA 3K58A 2HQEA 1CFMA 1CSPA 1EIFA 2YYZA 4W9DA 4XX5A 3HG9A 3HOZH 2BE5C 2PQAB 4A3IG 2K5VA 2NVXH 1HPCA 2EYHA 3H0GH 1W6JA 3GTMB 3AMZA 2B2VA 4HPMB 3FP9A 2DZIA 5H92C 4N8X1 1IL2A 2KN4A 2MJ8A 4GNXA 5FO8B 2KQ3A 4A3DG 2K8BA 4UAIA 3E9IA 4CJ1B 1N34L 5JVG3 1N34Q 3FPUB 2JA7B 1IBXB 1EY4A 3NPPA 1WCMB 3BZKA 4L5TA 2N78A 2I1JA 1XYIA 4K14A 4IM2A 5LHY1 1TKYA 1ROEA 2NYZD 2VZKB 2ZJDA 1BDOA 1EY7A 2ALYB 1WTXA 2PQEA 4XDXA 2JJQA 1L0YB 4BS9A 4NXML 2MWSB 4C7YA 1SE2A 4NXMQ 1VCBA 1JWUD 4YTNB 2F0JA 2V1YA 4KY6A 3OYYA 1UELA 4O1NA 2JE6I 3ULLA 3DBRI 2CHWA 2Z0EB 3CIRB 4UY8C 3SK6A 3I4NB 4JGHB 1U5KA 4JI4Q 4EQOA 3S16B 3FILB 3J7AV 1E5WA 1KAAA 2EYPA 5IOCA 4R4TA 2LWPA 3RZFA 4HVBA 4ACFA 1G291 5IE8A 1ET6A 3KUPA 2KTRB 2LGSA 1JWAD 1KDCA 3IT4B 3VHTC 1E7VA 4DNIA 4QIWE 1V9PA 3MFYA 5DAUA 1F9JA 2KJ6A 2E2DC 1JJGA 1UGJA 1I6VC 2NPTA 3S2AA 3ZNZB 1LM0A 2HD5B 3ZKJC 2RDGA 5LXHA 5C23A 2CQOA 1MI2A 1JROA 1V1PA 2VQFL 3KQ4A 5AZFA 2IO2B 3T1YL 2VQFQ 2E5LL 3NS1A 4PYUA 3W5VB 2E5LQ 2X8XX 2EMSA 1B53A 2IY0B 2MRPA 4OGQC 2LRWA 4RGNA 3WOEA 3RD4A 4X57B 5M9OA 2SOBA 5E1FA 3AEDB 3DWMA 2JWUA 1R4NI 2HIXA 1SE9A 2J4XA 3MJ5A 3NRZA 1QNUA 2WDQB 1EEFD 4QGUA 2B39A 1KM7A 4DGZA 1PGXA 2BYEA 4W9JA 4USAA 5LL6S 2WXGA 4XGAB 5EE0A 5J1ZA 4CDEC 1KDBA 3ZRFA 1N36L 2EKIA 1J7CA 2LMCA 1TGZB 3IXSA 4JQWC 1N36Q 2KTFA 1Q12A 4XDCA 3GTKB 1T9HA 1KC8C 3IT6B 4KDLB 4A3FG 5HHDG 2BBCA 4XWTA 1MGSA 2NZOA 3C8YA 1MI0A 5DCNA 4KZ0A 3W1SC 1GKHA 1TVXA 2M17A 1HE8A 2JK8A 1A3UA 2ON8A 3FVQA 4JVZA 2YTYA 2MHJA 2PLPA 3AE8B 2Q2UA 2L1AA 2HE7A 4EEWA 1JB3A 2K14A 1EO6A 1MHHE 1E1OA 2FUG1 4P71A 2EY5A 5GADC 2GA4B 3R8BA 3RZDH 1PH2A 2MFIA 4KX6B 3IBEA 4K6DA 3KF6B 2IZVB 1YIWA 4WWMA 2E2IB 2KACA 2QJLA 4NJCA 2HJ1A 4DUZL 1RM6C 3MA2B 1IL8A 1LUZA 4DUZQ 4B6WA 3H7PA 1WTHA 3M85A 4RH6A 2I0QA 2OXPA 4FXGC 4OHJA 4DKAC 2K6QA 2JA5G 4LUVA 2KFKB 4W9LA 4GMVA 2LFNA 2EYJA 2MPMA 3C1EA 3K5LA 1NR4A 3K5MA 3AN1A 4LLGM 4AJWA 3M4PA 1FXTB 1NY4A 3TP8A 2ENBA 2RHQB 2G45B 3VTVA 4ZYSA 1UEBA 4A3EH 5E6JA 3DHHC 1SMYD 1SFOH 4K81A 1U4RA 3D0FA 1VD2A 1FNVA 3CPFA 1XCQL 4IFDG 2KMCA 2RSOA 2RPVA 4LTUA 1STBA 2KT7A 2E2HB 4DR6L 1VQJA 4DR6Q 3STBD 1L0WA 2N49A 2W9NA 4JBKA 2WDRB 2O4XA
chains in the Genus database with same CATH topology
4IUNA 3JAML 2B76B 2B2UA 5M5XB 1CQVA 1KNEA 3D4WA 5CV6A 2L9HA 1STAA 5DM63 5CV4A 2BTEA 1PFBA 4ULLA 2K0PA 2B2TA 2A5HA 2CJNA 4TSSA 4K8IA 4QMGA 1ZXTA 2KVMA 5C3XA 1QOHA 2NB0A 2J53A 4LK0M 4HAEA 2IX3A 3S15B 1A2TA 3CHBD 3IFTA 5DM73 4C3IG 1BNZA 1KF6B 4K2LA 2J7ZA 1G2SA 2NUCA 5C0XI 2Z8LA 1FXIA 2DBYA 4Q2JA 3IAYA 2D5DA 2N55A 3PZ8A 2I07B 3M7GA 1XLQA 4K5WA 3ZJUA 3AE1B 5C5LA 1GAQB 2JXTA 1DOYA 3GO5A 1B44D 1ZEQX 2AUKA 1U4PA 2O5IC 3CWIA 5C5MA 1Z47A 2L52A 3Q8BA 1BR9A 4L8JA 3GTPB 3V3XA 2RQXA 1D4BA 2WU2B 4A3KB 3O13A 2AUJD 2F3VA 2XVSA 3I72A 2R93B 3VR3A 4CHTB 1C4CA 5FOBB 5BMIA 5CV9A 2LFIA 2LKVA 4C80A 1VCIA 4H0LC 1PTOH 2L55A 4IUTA 4N58A 5EKIA 3VR5A 4FYDA 1HXYD 1K8MA 5F2DA 4HR7B 2ZT9C 2Z4IA 3TBIB 1WD0A 4I7ZC 1J8IA 2OEDA 3AEBB 2BS3B 3UI3A 3LB8C 1N60A 4ABNA 3DMUA 2FJ2A 3BDCA 3D4RA 1FFUA 2B2UC 2BCOA 5CGKA 3URYA 3H91A 1PRTB 2DYMA 4K5VA 4IOIE 1SYFA 2MGSA 4DQOC 2GB1A 3D3RA 2Q5WD 3AE6B 1PFNA 1SMYC 3VR6A 2E2JB 2PW9A 2G9DA 2IGHA 1VRAB 3AEEB 4LK1C 2HCCA 2OT2A 1SF0A 5A35A 1O7YA 1SBBB 3DWAA 3HP3A 2KHSA 3I70A 5I9PA 1QCBD 4L1BA 5J39A 2WXLA 5IGBA 2INNE 5BMHA 3T51B 2SNMA 3IL8A 1WTQA 3X3NA 1GUSA 4IUUA 3K6OA 4KY7A 3J81L 3SHLA 1D6EC 1YNJC 1KNAA 2A68D 2ID0A 3Q0AA 1ZOYB 3M7NA 2PMVA 4OZAA 1ET9A 1NYQA 1K51A 4TRDA 3DWQA 1STHA 2CW0C 3P1HA 2BA0A 3DUZA 1HZ6A 2N0SB 2WXHA 1AFPA 3ITPA 3SK5A 1SXTA 4FF2A 4YTPB 4IUPA 5A2QE 2K05A 3GTOB 3FEWX 1H9JA 3MAQA 5IODA 5M5YB 1PRTF 1B4OA 3BS1A 2M19A 4B0EA 2EPBA 1PGAA 3LWEA 1EIHA 2KJXA 1EWHA 2N7JA 2W82A 4GDKB 4A3FB 1P7FA 2SNSA 4V0BA 3HOZB 2EOTA 5HFYA 3Q8AA 1BQQT 1EZ6A 4GLSC 1S5DD 3H0GB 3BG3A 3NWSA 1I50B 3LWUA 1ZUD2 1E2ZA 2QEJC 2LJIA 3KWLA 3BZDB 3AE3B 2K5PA 1WTWA 4CJ2C 1E0BA 3A7LA 5C4ZA 2JP1A 2WDVB 4FO2A 1C4PA 3SR6A 3GB1A 4EQNA 1JORA 3QOLA 2JA5B 2WXQA 1S4ZA 4NZLB 2M56B 2XN9C 5DNFA 2K5QA 2J52A 2QCPX 2A6HD 2WKCA 1ICWA 1FNWA 2J42A 3KBXA 5C6AA 3J80E 4KJOA 5CMDA 2R3ZA 2FFKB 2WQYB 4QIWB 1TJEA 2WACA 1M8AA 3J7YW 3NUHB 3P4QB 1CHQD 1L5PA 1SNMA 4OO1H 1X3PA 3C2PA 1JQYD 2WXNA 1LTSD 5JVH3 1ZKOA 4K2KA 1LTID 3GS2A 2V3PA 2H4OA 2FHTA 5H8YE 4UDUC 1F77A 4WURA 1A3TA 3U7ZA 4FF1A 4WRDA 2RDFA 4HEDA 1EOTA 2PZUA 4A8XC 2WIIB 1H9RA 5CR3A 2WXFA 4C3IB 1KH0A 1PZJD 2RDHA 4XTCS 1YQ4B 3EA6A 2BDNA 3QIAA 1HA5A 3NHHA 4CKBA 2EJGC 2F0FA 3ONAB 3TN2A 3H94A 3GP7A 4PT5A 5C2TB 4RF1A 2E74C 1TY2A 1PZKD 1Y8PB 3VYUA 1STEA 4YXDB 1ZXHA 5G3LD 4XDDA 4YIJA 4ZLTF 2BE5D 1XLPA 1BOSA 1SJHD 2E75C 3RZDB 3GQBA 3AE4B 5EE3A 2IX1A 4L2YA 2VUMB 4WAFA 3L7ZC 1UUPA 5CYUA 3L3OC 4X3KA 3T56B 2CQAA 1VJKA 3TUOA 4MN3A 3FDTA 1Y69U 3RLFA 2JQRB 3QWNA 3DWPA 5ELEA 3I57A 2EE1A 4A3EB 5C3JB 3DEPA 4XYOA 1JOQA 2NTSA 3NQIA 4RHRA 3CKIB 4QB4A 3NVVA 3OIPA 1KTKA 4DAPA 4FF3A 2E3TA 5ELFA 3QJYA 2NN6H 1K8OA 4IFDJ 2M9VA 3QG1A 1TWHB 3TP6A 5EPJA 4K6LA 2F0OA 3PUWA 1L0VB 4FF4A 4ZKBB 3LXFA 1IHZA 3AH7A 1LLRD 4DK0A 1TWCB 2L11A 3GV3A 2Q8IB 1KLGD 5IIFA 3OPOA 4A55A 4XIGS 3W9CB 1Q10A 1CI3M 1G8ZD 2PIAA 5T1GA 3PV0A 4TQUS 2HCIA 2TSSA 2LHDA 4IURA 1OXXK 2F1MA 2SEBD 1B9NA 3FPPA 2ZW0A 1F0ZA 1NEKB 4NAMA 1B50A 3MXGA 4FXKC 4G57A 1B1ZA 4WORA 2FMCA 4DAVA 4FXCA 2Z4HA 1R4QB 2I2YA 3IKJA 2NBFA 2F0IA 1ILPA 4RHSA 1SYGA 4WH4A 3AM9A 1EY8A 3CRKC 3PZ7A 4RGMA 1I3QB 4Q0FA 1E2WA 1FO4A 4RNAA 3VR8B 3TDQA 1YNNC 3SK8A 3W1SA 3N52A 5C3WA 1S5BD 1YN3A 4X3UA 2IT1A 2PTLA 3KLSA 3P4SB 2XWJB 3V05A 1K83B 2WXOA 3BVZA 2R92B 3OHXC 2L32A 3H6MA 1PTOB 5HG2A 4B9WA 2DWQA 1JALA 1DGJA 4YT0B 2V3NA 2F0KA 2WB1B 4KKIA 1ESRA 3NSWA 1JWBD 3ND8A 4AYBB 4EE2A 2QILA 2M0AA 3AE7B 3AE9B 1CA6A 2JEBI 1MPEA 3S1NB 1PRTC 2EDGA 3VYRA 1EYDA 4OO1I 4L23A 2RMMA 1EU4A 4DNTB 4DNRB 1DD2A 2SAKA 3Q8EA 1HRJA 4ILWA 2R6GA 1F9PA 1TS4A 5FKAC 4A93B 4G7HC 3I90A 2K6AA 3KWVA 1XWEA 2G9HD 4XT3B 2NVQB 4M8AA 1I4QA 4XE0A 1BBXC 2JU6X 2WXPA 4ZRZA 1IKMA 1L0XB 5EE9A 4BA1I 4F88A 1FIQA 4HTHA 3BK2A 4HCEA 1A3VA 4X3SA 1X32A 5C0XG 2K9XA 1CZWA 5KYIA 3HRDD 2A73B 5C44B 3R3OA 4ZQ3A 1DOLA 1HTLD 1LTGD 1RF2D 2DYOA 1V1OA 3A55A 3AU7A 4KKSA 3HOVB 5IT9L 1CT1D 3MHBA 3BVMA 4ZHOA 5E3FA 5ELDA 2KDMA 3OMGA 1ZDVA 4JPSA 3MEHA 3TZDA 1T5EA 3F2UA 2BT6A 2I38A 3AEGB 2MJDA 3NQTA 1QE6A 1OFFA 5A2QL 2LEKA 5JEAJ 2AQ3B 1PFDA 4X3TA 1Q90A 3TP7A 4HEA1 1STGA 2EZVA 2BB6A 1C8CA 4DA2A 5CORA 1WD1A 5M5WB 4US9A 5COYA 3AE2B 5HI1A 2K7VA 3OOCA 3TZUA 2PZTA 5FR3A 1H9SB 3U2SC 2NN6I 1B9RA 4C1NK 2A69D 1FEHA 3Q8FA 2B2YC 1HTPA 5CC4A 1ZP0B 5C3EB 2A74C 1AN8A 1C79A 2AWOA 4K5XA 2ICIA 2X69A 5DEHA 3GTLB 1AP0A 4YSYB 1XTCD 4V190 1NAPA 1NR2A 2DLBA 2KUMA 1XXGA 3A54A 4DAYA 2R7ZB 2AX5A 4OW0A 1FCCC 2Q8RE 5T1IA 3EJIA 4WIPA 1SNOA 4N6EB 2ZXRA 5GXGB 5KGUA 1N63A 1YMHE 2K04A 3J80L 1JOOA 3PO0A 2WNMA 3ABVB 1RJTA 4OIKA 3K7AB 1YNJD 3QB3A 1PDXA 2F0SA 2OF1A 1QG7A 2D5GA 1QNKA 1BCPB 4KN7C 5C4XB 2RSNA 2CW0D 1AEXA 3U52E 1LT6D 4H44C 1QJOA 3SK4A 2W54A 1C9FA 1AYFA 1HFNA 3OWFA 1QOGA 1HHVA 2BB5A 2F0WA 2DNEA 3E5SA 2K5DA 5G5GA 1O7ZA 2WLBA 3GTGB 3SVMA 4C56C 3ZYYX 3GTJB 1H9KA 3SFDB 5LNK1 1TU2B 2OHFA 4H7BA 3VRAB 3KF8A 2MUYA 5D7GA 1RODA 3RFZB 2NVYB 4PQXA 3BDLA 4XQQA 2RA4A 4C1NI 3S17B 2L5TA 1YNTE 1A15A 3C1FA 1DM0B 4ZHPA 3HRZC 1T6BX 2MJ3A 1AZPA 1Z7TA 2NWGA 1S5ED 5JJZA 1BUIC 3EGRA 2IGDA 3GTQB 3BWUD 2VZKD 1HEZE 1BCPF 5NUCA 3QOJA 3ERQA 4LJZC 3PUVA 3U4EG 2AWNA 4OIJA 1FYCA 4HROA 1Y8OB 2HDMA 2A69C 4BBRB 5K36H 1E7PB 1E9MA 4CKCA 3V2TA 4C3JG 1ZE3D 1NUCA 1GOZA 3S1RB 5LL6X 1TZOA 1RKNA 2L0CA 4P2CB 2IW3A 4XQNA 3B2FA 4IUQA 1LT4D 4CQNA 2DNCA 2WP9B 4EGVA 3Q6SA 1VZ7A 2Y0SB 3SEBA 3EFXD 3K59A 4US8A 3CQZB 5EQ0A 2ONQA 4KY5A 1O78A 4FP5D 1NCVA 1Q8IA 5CV5A 4DK1A 3KBGA 1I7HA 3FILA 1QKZA 4B08A 5KNCA 4MIUA 3MZ5A 1F9QA 2WP8J 4A3MB 1WVLA 3GV6A 5JOBA 4OL7A 4C3HB 4Y7NB 1UEAB 4RA8A 4BY7B 4RKLA 1HQMC 2K32A 1ZYRC 3NVYA 2D2CC 2EY6A 3T53B 4J1MA 1TS5A 4I65A 1A6XA 4HSVA 3SFEB 2F0TA 4KKTA 3NVZA 2XRSD 1H9MA 4RF0A 3NE5B 1TS2A 3A7AB 1PZID 2O2LD 3T4AC 3IAS1 3AV8A 4CJ0B 1WYGA 1I6HB 1DCZA 2JYEA 3ETRA 5EGTA 1FGBD 2DN8A 1R9TB 3SXHA 1OXTA 1TWGB 3M3YB 2BDOA 2Y5CA 1CK1A 1YJIA 4G7OC 2K22A 4EQPA 1C76A 1N61A 4ARCA 5E4WC 3K5OA 4MM3B 4C7ZA 2I46A 4G4KA 1SYCA 4CGYB 2LY7A 2IWHA 1EY5A 3MWYW 2NVXB 2R61A 3TSSA 1LT5D 5K5PA 4HJGE 1FXAA 4DFAA 2CU3A 3VQIA 3E0JA 1RFKA 3PIP3 2D62A 3MTSA 1EIGA 2F0HA 5HGTA 4DU9A 1XLNA 1ML0D 4MHEA 2QDBA 4D2KA 1TKGA 3X3MA 1P7EA 2YEPB 5FLXE 2FMMA 2JYTA 2MHVA 1ENCA 1RDPD 1TT2A 4IDIA 2XNAC 4ZKCB 3PO3B 3ZQ4A 5KNDA 1MSGA 2PCFB 3NXWA 3EUB2 1K50A 1XF5L 3AMUA 2W3SA 3I3CA 1BF4A 4RCNA 3KLRA 4HRSA 1FRDA 4KHVA 1I4PA 2N9KA 2PVOD 1RTOA 3G7LA 3HKZB 4YWGG 4NDXA 2KECA 3A8KE 3Q22A 1IYVA 3ZGZA 3PUXA 1ENFA 4R3DA 5TSSA 2F0UA 5C0XJ 1PYWD 4QUCA 1DXMA 3SR1A 1YNND 4IQZA 4CKEA 2YU9B 2CVRA 4BWGB 2F3WA 2GRIA 2KMMA 1V1PB 1HFGA 4KMUC 3NK9A 2BOSA 2L12A 1GUOA 1V43A 1F2RC 2X38A 4IKGA 3RPFC 1VF7A 4O42A 3TP5A 2YEPF 2G1EA 2LMCB 3S2HB 1WGKA 3NUCA 1T5XD 3NZ3A 4DF7A 4ITKA 4RGOS 1GJXA 1O80A 2Y3AA 1C4QA 5KEEA 2PVGC 1HQRD 1QWYA 1JMLA 5ELCA 4ODGA 1OO9B 1F9SA 1Q1BA 4A90A 1SSNA 1Y8NB 2W3RA 1CM9A 1PRTD 2XSCA 1SFOB 4PNYA 2BS4B 2JZPA 1U9RA 2KOLA 3FMCA 1CTMA 1JICA 2E76C 3R2IA 1W6KA 4LMQD 3U9OA 3OSOA 1PGBA 2WU5B 1GHKA 1EY6A 1XLOA 4XYQA 1G2TA 3PUZA 2B2WC 1E6EB 4OO1G 2INPE 4AQ7A 1DJRD 1SYBA 5E4XA 2F0NA 1DOMA 3D6CA 3RMHA 2PW5A 5D65A 1EY0A 4LAAA 1N5XA 4C3JB 3S9WA 2XRQD 3W3AA 1WXQA 5BN3A 1B2TA 1DOKA 1HA6A 3RZOB 1X3QA 3S1MB 1VMCA 3PUYA 1OXVA 3N6RA 1JE4A 1I4RA 2K33A 3MHZA 2L4NA 4REZA 4H2AA 4JWSC 4IZ8A 4XXEA 3SDZA 2VXWA 3VR9B 4RCOA 3DHQA 1SNDA 1E0ZA 1F2YA 5I2XA 1OXSC 4TMAB 2VB3X 3S2DB 1F2ZA 5AUKA 2WV6D 1NENB 4QUFA 2MH7A 2A6EC 1QF6A 1ESFA 1GUTA 3HOYB 1SIJA 1L6VA 3TEWA 1KRHA 1VLBA 3AEAB 4YSXB 1Z6HA 3ZJTA 2QKIC 3NP8A 3I73A 3R93A 4C2MB 2FINB 4A6QA 4RGTA 1WTVA 2WS3B 4HCSA 1LABA 1VZ6A 1F9RA 1BO0A 5IGGA 3J7AF 1G6ZA 3VA5A 1MHXA 3QO2A 2ZXOA 2M2LA 3VR2A 3HOXB 3NWTA 5D3DA 1WSPA 4XWWA 1CZGA 4Q5VA 2WXKA 4Z9CB 2WXRA 1TR5A 1D2BA 2NN6G 1SYDA 1AWDA 2O5JC 5IGEA 1HUNA 3P4RB 1UAPA 2ZXPA 2B2YA 2IDYA 1AW7A 3TEZA 1EYCA 2MJEA 2L1BA 4MH8A 3B2GA 3OMCA 3H8HA 3RUZA 3W2DA 1ZPSA 2ACZB 5D14A 4P6VF 3EROA 1VMPA 2EYMA 5IGFA 1Q3LA 3NTIA 3IFDA 4RAUC 1N5WA 2D9UA 1AZQA 1HCZA 2EYLA 4NW2A 1XEEA 3D31A 3FKIB 2B8GA 2RVLA 1GUWA 1CQFA 4C3HG 1RD9D 4E6IA 3P20A 1D1IA 1T3QA 2KQ4X 2QF7A 2PYKA 1DOIA 4TKOB 2WAQB 1JOKA 1MD2D 1FNUA 1GPXA 2Y5PA 1SNCA 1PLFA 2IL8A 1D5XC 1WWTA 1PTOF 4IFDH 1K52A 1L6UA 1Y1VB 2AQ1B 1J9OA 3HS0C 1SEBD 3DEOA 2EYFA 2F0PA 5HURA 1PUTA 2F4IA 4JWUC 4J6HA 4A3JB 4N59A 2BS2B 2NMQA 3HZXA 2NVTB 2IJ0A 3BYYB 4IUVA 4RWSC 5KNBA 3V96A 2RBMA 4OZBA 4YTMB 2MP1A 1FR3A 4F87A 1L4DB 1LO5D 1ZDXA 5AUIA 1STYA 1GXDC 3E9SA 4WQMA 1LV9A 5KYLA 1A2UA 5BN4A 1U4MA 2IX0A 2F0VA 4NKLA 1VDVA 3MVVA 1CA5A 3T3NA 3BVGA 3Q69A 1QOFA 1EZ8A 2K28A 3P1MA 1JWMD 5MPOA 1IW7D 1D5MC 2QIEB 1SAPA 3HOWB 3PO2B 2V0GA 3P63A 2JA6B 3AEFB 5IGCA 2F0MA 3PMFA 1RTNA 3BIID 1C78A 2CHBD 1CJEA 1TS3A 1Y56A 1FM0D 1IKLA 3MXPA 3FAHA 4YSZB 1FFVA 1II3A 2WXMA 2B2VC 2PNRC 3I8ZA 3KLSX 5IGDA 4KK7A 4KKJA 1ZXIA 1E10A 3P7JA 4KTAA 4FNFA 1YN4A 2F0QA 5CBEE 4DXGA 1IGDA 2LHEA 1TYGB 5BMGA 2N9LA 3C3LA 2W55A 1EFID 5FLXL 4B9XA 3LYYA 2MEKA 3L4PA 1ZYRD 2EVBA 5J22A 1FCLA 1FRRA 1GUNA 3WDNA 3MXNA 2F0GA 2K5WA 1QILA 1Q1EA 4FXDA 1JW9D 5C4JB 1C4AA 1YJJA 4KJNA 4JK1C 2OEOA 3VYTA 2F03A 3K5NA 1V97A 5FK9C 2BYTA 1EQTA 2PMZB 1HZ5A 5FO7B 1NVID 4A3GB 4ZK9B 2NTTA 1PFMA 2PKOA 1R7SA 4WJWA 3FRPB 4NAWB 2EXZA 1SE3A 5EBDA 4ARIA 4BA2I 3D6WA 3L9AX 1PTOD 1J7BA 1VDZA 3A8JE 1EM7A 2BA1A 3E56A 2XIWA 3H09A 2VNUD 2EY1A 2PO4A 1G91A 1HUMA 1M4VA 4KGSA 1ILQA 1QQRA 4J3OD 3P75A 3IAM1 1B9MA 1TWFB 3FC4A 1TY0A 5CV8A 1WTRA 4R9WA 3AE8B 5I4DA 1S5CD 1PXUA 1EWCA 2SDFA 5I9OA 1MBYA 2Z1CA 1OQRA 1VR9A 1ONLA 3NBHA 4PMCA 4A3BB 3HUIA 1IW7C 1IYUA 4ZOHC 4NMZA 2JEAI 3CU7A 1SYEA 4WFN3 1DZ1A 1QLBB 1SJED 1SNQA 2GI9A 3ZJVA 1JCKB 4U68A 1IBXA 5JEAH 5G5HA 1FD6A 2HDLA 1RYJA 1KDAA 1FMAD 4AS1A 1I4XA 1C48A 3VA7A 2V4DA 2KEEA 4HSPA 2PW7A 1XO3A 3E6ZX 3NBIA 1JRPA 2FBWB 1GUGA 1BMLC 2F0LA 4KD4A 2LGIA 3EVQA 1LTRD 5D3IB 5T8IA 5I6YA 4A3IB 4PMBA 4IFDI 2X6LA 1LTBD 5EKLA 1WTOA 2J0TD 1BXTA 3K0YA 4A3DB 1LTAD 1EQVA 4ZRQA 2KCNA 2H89B 4R8NA 2F0DA 2WINB 1WTPA 4PV1C 3NTHA 2AQ2B 2B2TC 4L6TB 4PMWA 3AE5B 2HTME 2QMTA 3OIQA 3K57A 2N88A 4N9PA 4H13C 1S5FD 1DYQA 2JSVX 3S14B 3B9JA 3J9CA 3GD7A 1DONA 4RKBA 1XCTL 4DXFA 4IALA 1EYAA 1U4LA 1C77A 3TEXA 3VRBB 2Q8TA 1JR0D 1R4PB 4JE3B 2JX5A 2QSDA 2KEDA 2LUMA 3U9SA 4G7ZC 5G3LF 3WOFA 4EVOA 5BYRA 1LT3D 1MSHA 3P4PB 1E2VA 4GZYC 5IT9E 3AB5A 2RKSA 5EPLA 3A56A 2HUGA 2C5CA 3BK1A 2HDEA 1TKWB 2K01A 3PIO3 3C46A 1PDQA 1GHJA 1D1KA 1IUEA 4L63B 5CV7A 1PTOC 3TEYA 4HMIA 3N9YC 4CBVA 3BYTB 5K36G 2EJFC 1DOXA 5JEAG 4XQJA 2DY7A 4KN4C 3TMEA 3T16A 5BYSA 4N9TA 1H9SA 3LX0A 2K3UA 1EL0A 4BBSB 4GDLB 3H3VC 1KFYB 5JPNC 1V8QA 1QT9A 2FE8A 2ICEC 4ME5A 3D4DA 2B2WA 5KRUA 4JBWA 2ZW1A 1BUVT 3MXUA 1RCVD 2K1BA 3T3OA 1YQ3B 1BCPD 1LACA 1SDFA 3OWEB 2NZ1D 5AFWA 3JAME 1UWMA 2L83A 2VB2X 2EELA 2KCCA 2EYOA 3M4YA 2WKDA 5EPKA 4DN4M 3WCQA 2A6ED 1SSOA 5BYQA 4J8QA 2X6GA 4HKZE 3LNNA 1QB5D 1UWXA 5EE1A 2CJOA 2KA7A 2E6XA 3W5UB 2KWDA 3KK7A 4HMJA 4B0MA 1YN5A 1CZPA 4MACA 1UNSA 3I4MB 1J7AA 1MVKA 4ZAIA 3NVWA 5FO9B 1TIID 3R2TA 3OW7A 3Q8CA 3ND9A 5BN5A 1VZ8A 3Q24A 4P16A 2EY2A 4KGRA 1GB4A 1KABA 4HN7A 4A9AA 5EBCA 3P42A 2JSOA 1EWYC 3EQLC 1SE4A 3HVDA 2JYOA 1VF5C 2B63B 3NTKA 3BDOA 5CBAE 3G6JB 4BY1B 2DY8A 3I9V1 4U673 4NP5A 1TWAB 3HVZA 2A68C 2EJMA 4QF4A 2K03A 2IPKD 1I4HA 4KHZA 1QOAA 1O7LA 4TQ1A 1L4ZB 3A8IE 5C4HA 4K8JA 1QOBA 4KD3A 3MP9A 1ENAA 2PPBC 1OQQA 2H1EA 1WRIA 3Q23A 3DXJC 3AECB 2BW2A 1TKEA 4S3SA 5I2YA 2F0EA 4KKUA 3I91A 5M3FB 4HKQA 3I4LA 4M0WA 4M1UB 4XT1B 5I6WA 1STNA 1NI3A 1NYRA 3DM1A 1NSNS 3UI2A 1GB1A 3HGBA 1K53A 5JXVA 5ELBA 1IGCA 4QCLA 4RFBA 2PZWA 3M4OB 1EEID 1F2LA 1FD7D 4JX1C 1BCPC 3DWGC 4OZCA 1RWSA 2WXIA 5ISRA 5M3MB 1OXUA 4KI0A 4F7XA 3D8GA 5JPMC 4OVZA 1JWSD 1ACCA 1RHPA 3VR4A 2A6HC 4TQ0A 3SE0A 3J81E 3HEJA 4ZUIA 1A70A 4MT5A 1SB3C 4F8MA 1PMRA 2WXJA 2JXMB 3T13A 3VYSA 2H88B 4ZUJA 3S1QB 2C9OA 2XWBB 2V4IB 4ID6A 3MC0B 2B8FA 4KGTA 5EJWA 1KLUD 1B3AA 1CHPD 1D5ZC 1F2RI 1F2MA 5JAVA 1TQOA 2LS01 5EKKA 4KV6A 5C0XH 2IGGA 2JA8B 5KIXA 3CRLC 1JQ4A 4R8IA 1EU3A 1XX8A 4ZRPA 2M00A 3MFGA 4FVMA 3HOUB 1SNPA 2KAJA 3AB9A 2TMPA 1V8CA 1JC7A 1Y1WB 1EY9A 1LTTD 1N62A 1I4GA 4IN3A 3K58A 2HQEA 1CFMA 2YYZA 3HG9A 2BE5C 1HPCA 2EYHA 3GTMB 1W6JA 3AMZA 2B2VA 5H92C 2KN4A 2MJ8A 5FO8B 2KQ3A 4UAIA 4CJ1B 5JVG3 3FPUB 2JA7B 1IBXB 1EY4A 3NPPA 1WCMB 1XYIA 4K14A 5LHY1 1TKYA 1ROEA 2NYZD 2VZKB 1BDOA 1EY7A 1WTXA 2PQEA 4XDXA 1L0YB 4BS9A 4C7YA 1SE2A 4YTNB 1JWUD 2F0JA 4KY6A 4O1NA 2JE6I 3CIRB 3SK6A 3I4NB 4EQOA 3S16B 3FILB 3J7AV 5IOCA 1KAAA 2EYPA 1G291 1ET6A 3KUPA 3IT4B 1JWAD 1KDCA 3MFYA 5DAUA 2E2DC 1UGJA 1I6VC 2RDGA 1MI2A 1JROA 1V1PA 3KQ4A 3NS1A 3W5VB 1B53A 4OGQC 4RGNA 3WOEA 3RD4A 5M9OA 2SOBA 5E1FA 3AEDB 3DWMA 2JWUA 3MJ5A 2J4XA 3NRZA 1QNUA 2WDQB 1EEFD 1PGXA 2B39A 4DGZA 4USAA 5LL6S 2WXGA 5EE0A