3BVGA

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
237
structure length
228
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Assessing energetic contributions to binding from a disordered region in a protein-protein interaction
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords Enterotoxin type C-3
total genus 65
structure length 228
sequence length 237
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bvgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bvgA01
1TS2A 1XXGA 1JWUD 3BZDB 1FGBD 1PTOC 1SEBD 1KTKA 5FK9C 1HXYD 1EU3A 1UNSA 1I4HA 1M4VA 3DWQA 1V1PB 3SEBA 1D5MC 1S5DD 4Z9CB 1TS3A 4L6TB 2IJ0A 1KLUD 2XRQD 2AQ3B 1LT4D 1YN4A 1JR0D 3CHBD 3R2IA 1LO5D 1LTSD 1LLRD 1HTLD 1D5ZC 3OWEB 1LT6D 1EEFD 1T5XD 4L63B 4RGTA 1TY2A 2G9HD 2TSSA 1FNWA 1HQRD 2RDGA 1PTOH 2XNAC 4K6LA 1JWMD 1BCPB 1G8ZD 1JWSD 1GOZA 1PTOF 3W2DA 1S5FD 1EFID 2QILA 4RH6A 1LT5D 2NTSA 1RCVD 1LT3D 2RDHA 1V1OA 1D6EC 3R2TA 1S5BD 1EWCA 4NZLB 1CT1D 4RGMA 5ELEA 1BCPC 3URYA 1FNVA 1BCPF 1SE3A 1SJED 2IPKD 1UUPA 2R61A 1PZJD 3GP7A 5TSSA 2AQ1B 3O13A 1EU4A 1LTID 2AQ2B 5I4DA 1PTOD 2Z8LA 3BVZA 5ELCA 4OHJA 3EA6A 1PRTB 1DJRD 3DWPA 1HA5A 1YN3A 1YN5A 2XN9C 1CQVA 1JCKB 2O2LD 1L0XB 1AN8A 2J4XA 1BCPD 1PZKD 1I4PA 4RFBA 1DYQA 2WV6D 1SXTA 1LTRD 1LTBD 1S5ED 3V05A 1QILA 1EEID 1CHQD 2SEBD 1SE2A 1AW7A 4BWGB 1RDPD 1ENFA 1I4GA 3TSSA 1BXTA 1TS4A 1MD2D 1SBBB 1I4QA 1S5CD 4DXFA 1LTTD 1B1ZA 1ET6A 4DXGA 1PZID 1CHPD 1ESFA 5ELFA 3BYTB 1CK1A 2ICIA 5FKAC 3R8BA 1PRTC 1ET9A 2XRSD 2QEJC 1PRTF 3KLSX 1LTGD 3MC0B 1JQYD 4UDUC 2NTTA 1XTCD 1KLGD 1FNUA 1SE4A 1L0YB 3DWAA 5ELBA 3EFXD 4RGOS 4C56C 1F77A 1TY0A 4RGNA 5ELDA 3BVMA 1V1PA 4ZYSA 5D3DA 1FD7D 3BYYB 1PTOB 4O1NA 4RCOA 1TS5A 1STEA 1LTAD 1PRTD 1I4XA 1RF2D 1RD9D 4RHRA 5D3IB 3BVGA 3MFGA 4TSSA 1B44D 1PYWD 1D5XC 1I4RA 1SJHD 2CHBD 4RHSA
chains in the Genus database with same CATH superfamily
2PPHA 3NENA 2KQ4X 1CKMA 2KJRA 2AYOB 4BY7B 5CHVC 1L1OA 3AE5B 4HPPA 2OT2A 4E74A 4HEDA 5IP7G 1WGGA 1TS3A 2ID0A 2J0TD 1O7ZA 3TBIB 1U4RA 1FPYA 3QWNA 4TMAB 1OXUA 5L37A 2XK5B 3M7NA 1LT4D 3AE6B 2KQSA 2B2TA 4OEMB 4QGUA 1YNJC 5C44H 2KCMA 3DBHB 4JLCA 5I2YA 1LLRD 3O65B 1CSQA 1E8XA 2F1MA 4PYZA 4DV3Q 3N32A 1TYGB 2MBOA 3ML9A 2AUJD 4ICVA 5IAAC 4I6NB 2QDFA 4B3SL 2DWQA 4B3RQ 2UXCQ 2V3PA 2E2IH 2DAJA 5C3JB 1VQHA 1BCPB 2PQAB 4LF7Q 4L2YA 1PH2A 3M3YH 2EMTA 3MEFA 2IX1A 1I42A 3UINB 1D3ZA 4A55A 1TJEA 4H7BA 1UWVA 2JX5A 3H0GG 3QC8B 4J6HA 5MPOA 3ZJVA 2MGSA 1C4CA 4ANXA 1SR3A 2A69C 2FUHB 4PMBA 5LMUL 3T3NA 1EYDA 4C3JG 1N34Q 4QAYA 3ZW3A 3KW5B 2KC1A 3EFUA 1F52A 2Z4IA 3K7AB 5IP7H 2K0PA 2K6DB 3RCZA 3T56B 5FR3A 3KH0A 1T0QC 1EWIA 2F3WA 4JI4Q 5GXGB 1AFPA 1GC7A 1ZYRC 4ABNA 3WA0A 1F2MA 1EU4A 4RKBA 4RMFA 4DR4Q 5M5YH 4KHPL 2KC2A 2BVCA 1VZ6A 3PUWA 2R7DA 1PRTB 1VF5C 4A3EG 4A3GH 5C2TB 3DWPA 2D3AA 3HRZC 1EUJA 3OSOA 3OWFA 3ZUNA 3W1SC 1ZW7A 1FXAA 2HJ1A 3EECA 5M3FB 3HOYH 2LHDA 4HPLB 1QZGA 3NBIA 2EMSA 4RFBA 4WRDA 3UIOB 2OWOA 5DPWA 3ULPA 1QVFA 1AARA 3N6RA 1STHA 2KD0A 4ULLA 2WXQA 4AP4C 2A1AA 3T4AC 2WIIB 4FHJA 3A1QB 2KOXA 4DXFA 1IYUA 1I94Q 1GUTA 3L0OA 1B9NA 1S40A 1KRSA 2PW9A 3RD4A 1YIJA 2C60A 4DHZE 1SYBA 3VH3B 3IT6B 1VQBA 2INNE 1VMCA 1ENCA 2MBEA 3MHBA 4RF1A 5HG2A 4C56C 1F77A 1VQAA 5ELDA 3HEJA 4BBRH 1WTPA 1OGWA 2K8HA 3M85A 3DM1A 4KI0A 4B3RL 2UXCL 4OZCA 3ZGZA 1VQLA 2NYZD 5CHFA 1KRTA 1V49A 1WZ3A 2E2JB 2F3VA 3UDXA 1WZ0A 1GHKA 2KMCA 3Q3JA 5BN4A 2KHWB 3DWMA 4GSWA 1ML0D 3PO3G 1B9MA 1R4MB 1PYWD 1RHPA 4DR7L 2JEBI 2AWOA 4NJ7A 1TWAB 2CU3A 4HKZE 4P75A 4JX1C 3V62A 2D5DA 4F87A 4C3JH 1YJ9A 2HHHL 2I0QA 4MGYE 5HFYA 1ZXTA 2CQOA 1CA6A 4JIOU 3B08A 4GOCA 3Q3OC 2D5GA 1SFOB 2BS3B 2PMZE 4DR5Q 3DWQA 2YU9H 4CYEA 4E71A 1EL0A 4ARCA 5I6YA 3S1RB 4WJ3M 1FFUA 1P7FA 1M8AA 2Z6KA 1YNXA 1WSPA 2KAJA 2B2UA 1CKOA 2B2VC 1G51A 2B76B 4KHPQ 2YEPB 2F0GA 3ZDMC 4W9KA 4K5XA 2C7HA 3SGIA 4NB3A 2L52A 1X3PA 2IYDB 2B3GA 5M5WH 2BYTA 4ANUA 1N36L 2N55A 2IY5B 1AWDA 2K5WA 4ZLTF 4O42A 4QQBX 2V4IB 4K5VA 1PFDA 4HSPA 2KWVB 1DOLA 1N63A 4R1JA 2VZKD 5CYUA 5JXVA 3NHHA 2B39A 1Q10A 2VUMB 3G7LA 1HTPA 4NKLA 4RF0A 2V3NA 2K5VA 1HZ5A 2RDHA 5EKIA 3PO3B 3CF6E 1IBXA 1IBLL 4FF3A 1C1YB 3FPUB 3R3MA 4PT5A 1EQTA 5AZHA 3R2TA 1E7PB 1X6OA 4RGMA 4EQOA 1BCPC 3AB9A 3URYA 2GI9A 3R93A 3MJWA 2LEKA 1CKNB 1O80A 2R61A 2N78A 2RGFA 2AQ1B 2C5CA 5DNFA 3GV6A 1B3QA 3Q24A 3S2HB 1YX6B 1QQRA 1XYIA 3GDEA 3KOJA 1PLFA 2K05A 2Y0SB 1QB5D 3JAMi 4JWUC 5ELCA 2IDYA 4LJOB 1YEZA 1XD3B 2KLCA 1IXRA 3TEZA 4K7WA 1Q7YC 4KN7C 3AMZA 4HCSA 3IVFA 1FIQA 3OMGA 1WXMA 3KJPA 1WY8A 4K3BA 1ZXHA 4KKIA 4GDLB 4C3HH 3CPWA 4LJPB 1XPRA 5TR5A 3HM6X 4DV2L 4JV5L 1KDBA 1QT9A 2F0SA 4J15A 5IY0A 1QOHA 4MTKA 4PZ7A 4BS9A 1I6VC 3V05A 3MTSA 4FF1A 1SNQA 3GTGH 2JXTA 5JJIA 2N4FA 4MSMB 4B6WA 1MKHA 2ES2A 1CHQD 1FM0D 3E56A 4H0LC 3E6ZX 3OIPA 4OELB 1I7HA 2L5TA 1JW9D 3L10B 3S9WA 2HHHQ 2GBJA 3U9SA 4RM9A 1ET6A 1F2LA 1OXXK 1U5KA 2RHQB 4DR5L 5ELNA 2E2HH 1VD2A 2E74C 1JRPA 1BOSA 3R8BA 1IKLA 1VCIA 2XRSD 1DOXA 4DAPA 4FXGC 2B2YA 4HTHA 1LTGD 4MNOA 3VYUA 2O2VB 1WTRA 4K0KL 3J81c 2BW2A 3KBGA 3L0WB 3JAML 1KLGD 2NMQA 1GC6A 1L0YB 3VUXA 2G3QB 1N36Q 4MJSA 3KLSA 2F0PA 2K7VA 4OIJA 2D2CC 1XJVA 2WYQA 4MDKE 4HWIB 4YSYB 2MCNB 3FILA 3CMAA 3QG1A 4Y7NB 4LAAA 1OTCA 3J9CA 3CRLC 3CMEA 3AM9A 2KTRA 3GTLB 4K6DA 5LMNL 3VDYA 1I4XA 2I07B 3E9IA 3CCUA 3BVGA 1FD6A 3ND9A 2W9NA 1DZ1A 2JXMB 3R3OA 1YNNC 2A6ED 2HT1A 3CC2A 2LHEA 1X65A 1IBLQ 1XXGA 3D32A 2PO4A 3HUIA 2LZ6A 2W54A 1T0RC 1WM3A 2LXJA 1TWFH 2WDTB 4HCPB 3A9JA 2KCNA 3PREA 2DJGC 2EYMA 1SB3C 3SK4A 1VQPA 5C4XG 3T13A 1WXQA 2EJGC 4ZOHC 2M2LA 3SVMA 1D8LA 3CAMA 3TQYA 3A56A 3F2UA 3HP3A 4AIMA 4CO7A 4OW0A 1WX8A 3WOEA 5JPNC 5IO9A 4E3CA 1LO5D 1SAPA 1HTLD 1EOVA 3MFYA 1WYWB 2EXZA 4WJNA 4U673 3CU7A 3EJIA 3KF8B 1RODA 4DV2Q 4LFBL 5IP4D 3B9JA 4GDLA 2RVLA 1JWSD 4MH0E 2KQ3A 2LGXA 1S5FD 4R8IA 1R4MI 4NQKE 2HCIA 4RH6A 1H9SA 3M4OH 5H8YE 3UDFA 3A9KB 4D2KA 2WAQG 1CSPA 5E3FA 4W9FA 3J7YW 4RMAA 4A3FG 3KYDD 2LXKA 2Q2HA 1CT1D 3AI5A 2JU6X 1O7LA 4A3BB 3DBLI 3U58A 2GVAA 3GS2A 3N52A 1Z9FA 3VYRA 4BKGA 1J7BA 3WAOA 3PHWB 2A74C 1L1OB 3PQIA 2O5IC 2K6QA 4MEMA 2E8GA 2F0QA 2KJ6A 3RMHA 1Q46A 2QCPX 4XGAB 3R7RA 1VDZA 2MQJA 3VA7A 1HA5A 2BKRB 3I70A 2F0LA 3K59A 5AUKA 3ZNHB 1QNKA 3TDQA 5LMNQ 2RPQA 2A73B 2DENB 1TIID 2Z4HA 5EAYA 4BXXH 2QMTA 4CJ2C 1XTDA 1IBKL 4HVBA 1DYQA 1I3QB 4LCDE 3PGEA 2NVTB 3KDFA 3DPDA 4XQQA 5C23A 5KNCA 2NBFA 4B3ML 1V8CA 3HOVH 1WXAA 1H9JA 2KDIA 1OFFA 4I7ZC 2KO3A 2FAZA 2HDLA 2EELA 1RDPD 5KNDA 2G45B 3NZUA 4HJ8A 3NVWA 4IW0A 1ZPSA 3K6OA 1LV9A 4C3HB 3AE8B 4TV3A 4UP8A 3H0GB 5EE1A 4LNQA 3BYTB 3GD7A 4IJHA 1PV4A 4N9PA 3I4MH 4GU2A 5KHQA 1Z7TA 4C3IG 3JAMc 4IFDI 4OVVA 5AZFA 3DEOA 4JE3B 2EVBA 1AEXA 3I90A 2L0FA 3DCGA 4M8AA 2LVPA 4W9IA 2QKIC 3HHMA 2BCOA 3AU4A 2IY0B 3CQZB 1YQ4B 4ODGA 5IYBG 2FCQA 2L76A 1GKHA 3V2TA 4HJAA 3NTHA 2KVRA 4LFBQ 1EQVA 3W5VB 4GLXA 2PCFB 4K1RB 4GDKB 3TP7A 1EF1A 1R7SA 4PMCA 3VR4A 3IAS1 3X23A 3PLVA 2J7QB 3HKZE 1AE3A 2R93H 3MVVA 3RLNA 2DZJA 2IWHA 4DK1A 4JYAL 2MBQA 1I50H 3GTPB 2WAQB 1RAXA 4G7HC 2WKDA 2ZTCA 1PA6A 4IO9A 3CCRA 2JPHA 4O2DA 1K8RB 1X1MA 4Y7NH 1E90A 1EZ8A 4DV1Q 2JT4B 4KIKA 4OZBA 2A5UA 3KUPA 3J7AF 2OXPA 3ZJYC 3NQTA 3A7LA 3P7JA 4REZA 4YTNB 1GAQB 5BYSA 1D5MC 4HIKA 2X8XX 1TU2B 2IJ0A 4XQNA 3QR8A 3A1QA 4HROA 1QCBD 4YL8A 3D6CA 2WDVB 3H1UA 1JMLA 3R2IA 1V80A 1IGDA 5T8IA 3TP5A 4AQYL 3D4WA 4A3EH 3I4LA 4JWSC 5J17A 4WURA 1MSGA 2FMCA 1IYJB 5J22A 3GV3A 3DEPA 2TSSA 2GBNA 4GNXB 3KBXA 2KCCA 3DVGY 1GUAB 4LNFA 2L0CA 5JJZA 2L7RA 4ZKCB 4B3MQ 3PIPA 3P63A 4MTNA 2AKWB 1LT5D 5CV4A 2H89B 2KX0A 4EQNA 4YY3Q 2BE5C 2UYZB 2NTSA 2NVQH 4R3DA 4KN4C 3RI7C 3MA2B 1JWAD 1UF0A 4KV6A 2PJHA 4RCNA 1F9PA 3K58A 3Q0AA 1F1HA 2AMCB 5E6JA 2KDMA 5LHY1 3X3NA 5ELEA 3RLOA 4K2KA 5FLXc 1SJED 2NS5A 4KIKB 3ZQ4A 2NVYH 4FXDA 1EQQA 4JQWC 2YLMA 3ONSA 5GAHC 1HNZQ 3ZJTA 2IW3A 2UXBL 2ZXPA 2O5JC 5FO9B 2JZZA 3KUDB 4DR1L 4WAFA 1A2UA 5IYDH 3PO0A 4A90A 2K1FA 2UXDQ 2O6VD 3T8MA 1WF9A 4JPSA 3VRAB 2XN9C 4DNTB 5KRUA 1QJOA 4Y52H 3VR9B 1Q86C 3G6JB 1PXUA 4LMQD 1SXTA 1Y1WB 2HTHA 1TWGB 2N7JA 3AECB 2J53A 2I46A 2BH8A 3A5UA 1T0YA 5CX3A 4MACA 3HK0A 2ZPYA 1U0LA 3N1YC 1V9PA 3FC4A 1TR5A 3F1ZA 2JA8B 4IPCA 3G6EA 4IUTA 1G2TA 2EY6A 3I55A 5E6NA 1TWCH 1YNJD 1STGA 1FXTB 2ZVOA 3QK0A 3WANA 2F52A 5A2QL 2HUGA 2LGYA 5EPLA 1CK1A 3K80C 1WX9A 3VR2A 4PNYA 5JVH3 2FXQA 3HFZB 3TP6A 3QARA 2MJ8A 4A3FH 1QOAA 4ZRIA 2KA7A 2IHEA 2PZTA 3NQIA 1JB7A 2E2HB 5BO4B 3A8KE 2GMIC 4YHHQ 1GUGA 1R4PB 3FKIG 2GOWA 4A4IA 4GLSC 1SRUA 3AE7B 2WXHA 4W9HA 3L9AX 3Q2AC 4B9WA 1NI2A 1UE7A 4KK7A 4C3JB 3HOUH 1LFDA 1IW7D 1R4NB 1GXDC 5EGTA 3L17A 2RCFA 3H91A 4L5SA 4L5RC 3I9V1 1PRTD 1XLNA 2KK8A 2A68C 2EY2A 4YY3L 4DR2Q 2KQ7A 2GLSA 1SE9A 2HDEA 2NBWB 4Q2JA 2CQAA 3NOBA 3D3RA 2CHBD 1UD7A 2MW5A 4OWXB 4A93H 2IX0A 4BA1I 1LQBA 4JI0L 3OLMD 1IP9A 2A5HA 1V43A 3BZDB 3KYHC 1TT2A 1BT0A 3VA5A 2WU5B 3VH4B 2HDMA 5C4XH 3A74A 1F9SA 1TWCB 1U4LA 1PMRA 1NBWA 3WOFA 4C2MB 3AULA 1FL0A 4HSVA 2KX3A 1Y56A 3AFPA 2DZKA 4M1UB 1HNZL 2K01A 1Q8KA 4PMWA 4UPAA 2R93B 3A4SC 1XCTL 2UXBQ 2KDFB 2BDNA 3Q6SA 2W3SA 4IC7B 3RNGC 1I50B 2OTLA 4KKSA 2HE7A 3GTMB 2TMPA 2UXDL 5IYDG 3CCMA 2CH4W 3V6EB 4GN1A 2DZIA 3N9YC 4GIVA 2BS2B 3JW0X 2C9OA 1L5PA 1HQRD 3IT4B 3ZRCA 3VTUA 2BYEA 1EY5A 5IA7A 3CCLA 2PNHA 1BBUA 4O0AA 1G8ZD 4GKKL 2JVCA 2WNMA 5IWAL 4DF7A 4BY1B 5EBDA 3HOYG 2D10A 2LXCA 2NWGA 5AJ3Q 2RD0A 1KNEA 1VQ7A 2C9WB 3RPFC 4MGIE 1F0ZA 1GB4A 2JA5G 3J81j 3Q3NC 2OJRA 2KTFA 2WAQE 1HNWQ 3NTKA 2IZVB 1A3VA 1K51A 2IGDA 1PFMA 2MWSB 2LUMA 3PRPB 1WI5A 3BDCA 5LXHA 2LGSA 1TQOA 1RJTA 3HKZB 1VQNA 4K7UA 2UUBQ 4G4KA 2L05A 4DV3L 2O6VB 3D6WA 2ZW0A 3PMFA 1JOKA 2ZNVC 3OJ3A 2MUYA 2C35B 3W1BA 1Q1BA 3PO2G 5C0XJ 3K9OB 4G0NB 5BMIA 2JZ3B 1NYQA 2BYVE 3OW2A 3QJYA 4HEA1 4R9WA 3RN5A 4LF7L 4JL9A 2KYWA 3Q8FA 1H95A 2K8CA 1CTMA 2OQ0A 4BKSD 2J42A 2OOBB 2D0PA 4CHTB 1LTLA 2F0VA 2MP2B 1BUIC 3A4RA 1BKBA 2ZXOA 1WTXA 1N32Q 4TQ1A 5LMUQ 5D7GA 1N34L 2ACZB 3CPFA 2WINB 4POFA 1CZPA 2G4DB 1EY4A 1AW7A 2VZKB 1SFOH 4ZUJA 3TSSA 1NNXA 3L2PA 1TS4A 3CC4A 3BK2A 5LNK1 4M00A 1NY4A 3ZNID 4DV7Q 2D62A 1E0BA 3P2BA 1NI3A 5ELFA 1Q1EA 2AL6A 5EDSA 2JA5B 1J0GA 3NSWA 3DHIC 1Y8NB 3GQBA 1CI3M 3IAM1 3RT3B 1GB1A 2KANA 2VQEL 3IRBA 4G7OC 1KNAA 2F0EA 5EBCA 5A2QE 2NZ1D 2HJ8A 1V1PA 4NXNQ 4A3DB 2K5PA 1II3A 3UF8A 5EE3A 4G57A 1PDXA 2M4NA 3BYYB 1CZGA 3I4NG 1CJEA 1BBXC 1TS5A 5IWAQ 1ENAA 1SYFA 1STEA 4A3FB 1E1TA 1B53A 3E3XA 4IZ8A 1XMQL 3GTQH 1J5EQ 5AJ3L 3S2AA 3UE0A 5FR6A 1TVXA 3HOYB 4IUMB 4LK0M 1ZOYB 2AHOB 2R3ZA 3J80E 1PH1A 4FP5D 1VQ5A 2KWDA 1TKWB 1HNWL 3C3LA 1Y14B 1C0AA 3A5ZB 4AUQC 3PRMB 2K52A 4FYDA 5EPJA 1KTKA 3HOVG 2JN4A 3K8AA 3PRZA 2RQXA 3UIPB 2BOSA 1N6ZA 1GUOA 5J39A 1STAA 1SNOA 2E76C 3AEEB 1IBXB 2LD9A 3PUXA 2XRQD 5JAVA 1KF6B 2EY5A 3Q6BA 4GDKA 5GAEC 3S1QB 1HE8A 2I38A 1A15A 2LI5A 1LABA 2IY1B 2MJEA 1ILQA 5E1FA 1IUEA 4RGTA 2UUCL 3TBLD 1R4NI 1JJ2A 4DR7Q 2XNAC 3LWEA 3D8GA 3I2ZA 3RZFA 1C4PA 5CV8A 2Z1CA 4DHJD 1EFID 3IKJA 4GZYC 2GBMA 5CHWA 3S17H 2K22A 4K81A 3PTFC 1ICFB 4DAMA 1UH6A 4DV4Q 3KLRA 3E0EA 1LT3D 2HD3A 4NQLB 2FNJB 2Z0EB 3RZWC 2R7ZB 3VTWA 1MJDA 1OXTA 4IURA 1HPCA 2MLBA 4JI1L 4IM0A 2AEHA 1UUPA 5IGGA 3D4DA 2PW7A 5D6JB 3PSIA 4DV0L 3HOZG 1OXVA 2AQ2B 3BINA 4GXBA 1QZHA 1DOKA 5AUIA 5GROA 3C2PA 5M3FG 1M94A 4TUUA 1F9JA 1XLQA 2PI2A 2D3GA 1A8VA 2ALYB 1WTOA 3W5UB 2QC8A 5CMDA 2V0GA 4J6IA 3OIQA 4N9TA 1KXLA 5BR8Q 1XMQQ 2GVBA 4DR3L 4XYCA 1HZAA 4GLVB 4JI7Q 1OQRA 1LTBD 2X6GA 4RG1A 3ULLA 1PH6A 4BKTA 4ZHPA 4NNJB 2XGTA 2QGQA 3PO2H 2INPE 2KTRB 3AE1B 1ROEA 4N8X1 2CHWA 4XXEA 2EYHA 3T1YQ 2MP2A 2Q2TA 1CHPD 1Y1VG 1C78A 3PHXB 2L12A 3BG3A 3SE0A 2RR9A 5BMHA 3PO3H 1ET9A 3MAQA 5C1ZA 3JVZX 2KWCA 2BB6A 3MC0B 4P16A 3HOWB 2VS1A 3DWAA 1KC8C 3ERSX 4M0WA 4DAYA 2KJXA 4IALA 1WTVA 3RMKC 4X57B 5IOIA 4R4QA 4JV5Q 3V61A 4IDIA 3MZ5A 3VQIA 1ICWA 2PE6B 3OAWA 3Q3MC 3HKZG 4F88A 1A6XA 2ZTEA 2Y0SE 2DNCA 2JP1A 4IUQA 4IOIE 5EPKA 5I6WA 4A3KB 3LB8C 4EZKA 3H8HA 1YVCA 1D1IA 2B3AA 2EJMA 1RD9D 3HRDD 3Q8BA 2MHVA 4OWWB 3FDTA 1HNXL 3FVQA 2ATWA 5JJLA 2I1KA 2RBMA 1SNCA 2LFNA 4RHSA 1C7YA 1HR0W 2ZVNA 1RL2A 3KUCB 4XX5A 1TS2A 4II3B 5BMGA 1NDDA 5G55A 2M8SA 4IWPA 4NXML 3KUZA 1MJEA 1ZKHA 4GS3A 1DXMA 2RKSA 1N33L 3QX1A 3ZJUA 1M4VA 4FVMA 4N8FA 1VRAB 1J9OA 1OXSC 4DAYB 1XMOL 2H4OA 1EYCA 3TREA 3EQLC 4IJLA 4DV0Q 1BNZA 1HZ6A 5HGQA 5HURA 2WB1G 2NCNA 5IGFA 4ARIA 2A6EC 3M3YB 2Q2UA 2R93G 2K4KA 3NUHB 1K28A 1Q81C 2M17A 2Z6KC 4HAEA 5BR8L 3PVLA 1K53A 3ZNGC 1JICA 5EQ0A 3T16A 4BBSH 4K6LA 1XO3A 2NVTH 1KQSA 2MP1A 4JI7L 2WXKA 2O4XA 1HEZE 1GOZA 1YHAA 4WAAA 1TZOA 1GJZA 1A2TA 1N62A 2D11A 2N8NA 3FKIH 2PMZB 3EBEA 3I4OA 2K1BA 1VCBA 1WJ6A 2JXXA 2MO1A 1DCZA 1U4AA 4K14A 2NVUI 3TS0A 1EUVB 3RFZB 1XX8A 2Q5WD 3MXNA 5M3MB 2B63G 2M19A 1VQMA 1I5FA 2FMMA 3NBHA 2WHIA 1MIUA 4NZLB 3PF4A 2BE5D 3BS1A 1S3SG 1TBEA 1V81A 2WGSA 2Y3AA 3A33B 3SDLC 1KH0A 2B29A 4AOFA 3GP7A 1WYGA 1PGAA 3I4MG 3WAPA 4J3OD 3ZXVA 4HK2A 5KYLA 4HR7B 1BMLC 4KGTA 4K3CA 2DGYA 3LJ3A 3W1SA 1T5EA 4X3KA 1C48A 2FIFA 1HRJA 3OG5A 1EY7A 4L5QA 1PDQA 2M0XA 4OIKA 2KBNA 2JYOA 1Y69U 1VQ8A 2J4XA 2QF7A 1WE6A 1EIYB 1FCLA 4QL5A 3M63B 3S2HH 3C1FA 1HNXQ 5C0XH 4LF4Q 2PNRC 1S4ZA 4A3GB 4L8JA 3IXSA 2RHSB 2F0NA 1FMAD 1V5TA 1E9MA 5CBEE 4A93G 4XWWA 3RZOB 3AE9B 4BBSG 2WXFA 3SR1A 1K52A 5GMVA 1X3EA 3SDZA 2F0OA 1O78A 4WWNA 3T3OA 4MH8A 5IT9E 1B1ZA 4UAIA 2D2QA 3ULJA 3VXWA 4JK1C 1XMOQ 2R7ZG 2BA0A 1TKGA 2ICIA 3OHXC 1UEBA 5CBAE 4DV6Q 3KQ4A 1VR9A 3PSEB 4GMVA 3MTNB 3P1MA 2I5MX 2INDC 2JK8A 2CHZA 5BN3A 5JH5C 2YVCA 2JA6B 4ANVA 1EIGA 4DK0A 2RDBC 3UQAA 4FXKC 4JI8L 4HDOA 2MO0A 4S17A 1JE4A 2VXWA 1B3AA 4NP5A 2SDFA 1HA6A 4B95A 4M01A 4CBVA 3E9HA 5FLMG 3I7FA 3U2SC 3A8IE 4YSXB 2LSSA 5BYQA 3K0YA 3AE3B 2D0OA 1H8CA 1FRRA 2DY8A 2R2OA 4A76A 2YU9B 4DWFA 2H1EA 3KK7A 2E3TA 2KHJA 1EWYC 3PV0A 4DUYQ 2KHSA 2NVYB 4X66L 5IE8A 2L32A 2FBWB 5JHBA 1A0IA 5FO8B 2ZCCA 2DN8A 2N9KA 3WAMA 4V190 2EPBA 3CC7A 3AXCA 2FINB 2NVXH 1K3BC 2LS01 4W9LA 1ASZA 3NELA 4WWPA 3P75A 3CCEA 1KLUD 4A3JH 3K5NA 2E5LQ 4KY5A 2ASBA 1YHBA 2FIDA 3DBSA 4H02A 3PIP3 1Y8PB 4PV1C 2WB1B 3P4RB 1G6JA 2IL8A 3LYYA 1E2WA 4CKCA 1I6HB 3L4PA 3ML8A 4M8NA 4ZRQA 2PZWA 2JA6H 1X3QA 4LF5Q 3EROA 1L1OC 1JWMD 4JYAQ 4LF4L 2BGFA 3GB1A 1VF7A 4TRDA 1TKEA 2DUDA 2JA8H 5L83A 5DM63 2NB0A 1EO6A 1WGDA 2LMCA 1B8AA 1WCMH 3QAQA 1F9QA 5C3WA 3CSTA 3H3VC 4MELA 5JOBA 1P98A 3S1MB 2DY7A 4CDCC 1WRIA 3CSFA 1QUQA 3LX0A 3RZDH 3UQBA 1D6EC 4U68A 4DV6L 1DD2A 1K50A 2IHFA 2VW9A 3KWVA 4L23A 1BCPF 4A3DG 1EWHA 1HZCA 3HS0C 3AEDB 3U30A 1PZJD 1RLFA 3S2DB 2I1JA 2CWAA 4AQYQ 1H4RA 3PS6A 1YBYA 2K8BA 2I5HA 2WXOA 4JI2L 3KLWA 3SHLA 1YD8U 3L54A 4EKUA 4JI8Q 1H9KA 3QIAA 5KNBA 2RSOA 5T1GA 2WXPA 3Q14C 3EA6A 1MG8A 4WJQA 1O7IA 4E6IA 2G5DA 3BY4B 3PUZA 1XPOA 4ZDVA 2LMCB 4ZUIA 2JYEA 1E7VA 3V3XA 4FADA 4KHVA 4KKTA 2ZW1A 5C3EH 1JORA 2A19A 2WV6D 1EY8A 1VQCA 1VQ6A 3S15H 4MGZE 4US9A 4C3HG 4AWJA 4EQ5A 3CCVA 4ITKA 1WCMB 5JEAH 2BF8B 2L3ZA 4IPHA 2OEOA 3L7ZC 2KCTA 3OOCA 4DUYL 4C2MH 4X66Q 2REXA 3Q69A 1N60A 1BXTA 3DVGX 3V96A 1RTNA 3H6MA 3MXPA 1ZE3D 3VUWA 3EFCA 3FHWA 3GTGB 3Q8EA 1LGRA 3TN2A 2Y5PA 4APVA 4LDTD 4WH4A 5DPSA 5EE0A 4QMGA 3J7ZC 4PK1A 1CA5A 1WTQA 3E5SA 4MZ9A 3GTMH 1H9MA 4DK3C 3EC8A 2LGIA 2CWPA 3F2BA 3VVWB 3R66C 5C0XG 4C80A 4R4TA 2K5QA 1L2FA 4BY1G 2E2IB 5CTRC 4GGQA 1K73C 1V86A 1LXDA 2N1WA 3H0GH 3GE8C 2MBHA 1PTOB 1QVGA 1WGRA 3P1HA 4AYBE 3M3JA 4ILWA 2KENA 2PQEA 1NJIC 1L6VA 4BOZB 4R4IA 5C5LA 1ILPA 2MHJA 5C3EB 1BQQT 2LUEA 2XK5A 2JRIB 4TSSA 1JOQA 1VQIA 3NG0A 3DBRB 3TRZA 3TMPB 4CDDC 1SIFA 4EZJA 1LM8B 2N9PC 4JPBW 4NJ6A 4PG3A 3MEHA 1KHIA 3UDGA 4QCLA 2K28A 2EJFC 4II2B 1WRDB 3HVZA 3Q8AA 2YTVA 1WFYA 3PV1A 2EYPA 2WDQB 4BA2I 2XSCA 2HQEA 1NEKB 5HGTA 1MHXA 4QB4A 1UBIA 3GZNB 2A6HD 2C5LC 3ERQA 4JI2Q 4YHHL 2KMAA 4OVZA 1EY6A 1EYAA 2VZAA 4QF4A 1LYLA 1F2RI 3TEYA 2F0KA 4FA6A 4JBMA 3SFEB 2FCSA 5M3FH 3D4RA 3KDFB 4ZHOA 1W6KA 5K36G 2NBUA 2Z0SA 3EIVA 4A8XC 3K5LA 3CF5A 1KFYB 4MM3B 3ITPA 2JSOA 3T1HQ 2Y5CA 1PYBA 2BWES 3M4PA 1V6EA 3NZ3A 2D9UA 4G11A 1HH2P 5M5XB 2UU7A 4A3BH 1GUSA 2R6GA 1X3GA 3UGBB 1F9RA 3CCSA 5D94A 4KDLB 2KMMA 1MHHE 1B70B 1S5BD 1JJGA 1K3RA 4IKGA 3F8TA 4A3LH 5IGDA 5AEKB 4JI5Q 2QIEB 2IPKD 1ZUD2 1UEAB 3B2GA 1NVID 3I4NB 2KECA 1WE7A 2QCZA 3CW2C 4ME3A 3HOXB 3AYHB 4DU9A 4BY7G 3AEGB 3N1XC 1PTOD 3S1MH 1B2TA 5G2NA 1HTQA 4BBRB 2WQYB 3RZDB 4OHJA 3VR8B 1KM7A 4XC2A 3I56A 2R92B 2XIWA 1V2YA 3RULA 5JZEB 3MXNB 4A9AA 2F0TA 1L0XB 4IUPA 2L4NA 1BF4A 1BCPD 2N9LA 2BQQA 2JY6A 4X3TA 2HCCA 2WACA 2BB5A 1B9RA 3AEBB 3HOZB 3DOWA 1L2NA 1C79A 1S5ED 2Z6BA 1ZP0B 2ZCBA 1T6BX 1EQRA 4EFOA 1XF5L 3OYYA 4IQZA 1YQBA 5JPMC 1VDVA 1TWAH 4KZCA 3ONAB 2UUBL 2K75A 4JI6Q 3QOLA 1J7CA 1HJPA 4YCWA 5EKLA 3W3AA 2EYLA 4DXGA 1L0WA 2NBVB 3K9PB 1Y1WH 4JG2A 3Q8CA 2IX3A 2FE8A 1X32A 4UP9A 1CMXB 3KLSX 4NAWB 3N20C 4QIWB 3TEHB 5LMNW 3H15A 1E10A 4WJOA 2FHTA 1E5WA 1GVPA 4KJOA 3CD6A 2IGHA 2ZTDA 2MNAA 4A3JG 3I4NH 4RGNA 5G3LF 3S1NH 3DWGC 4ZYNA 1G2SA 1IKMA 3ZVVA 1DGSA 2WP9B 1N32L 4PS7A 1J7AA 3S14H 4TKNA 3APFA 1F2ZA 4DUZQ 3A54A 4IPGA 3QWZB 4KSLC 5IT9c 2B63B 1QZEA 1RF2D 2K5DA 5JVG3 2KFKA 1NYRA 1A63A 1B44D 2LJIA 3PIOA 1I4RA 3CCJA 4DV7L 4ALPA 3DMUA 4JVZA 4A3MB 4YIJA 1VQJA 2K14A 5G3LD 1KD1C 2ZEQA 4A3JB 1PTOC 1E7UA 4CKEA 1G6PA 2DJFC 3G71A 4HMIA 3NWSA 1VLBA 5T1IA 4JI5L 2DZMA 5FK9C 3L08A 2W82A 1FGUA 1HZBA 2VQEQ 1EU3A 1JQ4A 1UNSA 3UE1A 2DBYA 1V1PB 3CP0A 1S5DD 1HZ9A 4K8IA 4L6TB 1SNMA 3STBD 1JMCA 2I5LX 4NXNL 1EOTA 1UGJA 5KGUA 1JT8A 3M95A 4W9EA 4GKJL 1YN4A 1WTWA 2K50A 1JR0D 4YWGG 2JA5H 2HD5B 4DFAA 2CFMA 2F0MA 2OQKA 1PFNA 3OWEB 1B7YB 2PW5A 1JROA 1Z5SB 4GLAC 2IO2B 5FOBB 1VQOA 3U7DA 1J5EL 2JWUA 1VQKA 5JHAA 2ZNVB 2EXDA 3R7QA 1Q3LA 2BBCA 2N9EB 4EEWA 3PCOB 4YTPB 3A8JE 1TXYA 3KF6B 3RR5A 1MFWA 4QY7A 2DYOA 1SDFA 4XDXA 2ON8A 3EN2A 4BFRA 4JI6L 4N6EB 2NR2A 2JWZA 3TZUA 3T53B 3QJZA 4CQNA 1HR0Q 1R9TB 4A3KG 3IL8A 3U9OA 5E4XA 1KIXA 4PS8A 1ONLA 2CKHB 4XE0A 4DV5L 1DGJA 1ZXIA 1I3QH 3FRPB 1OQYA 1PGBA 1LTID 4JGHB 1J6QA 2UUCQ 1GUNA 4HDQA 2Z8LA 4YSZB 2KVZA 1ISNA 3S15B 1RTOA 3BDOA 3S24A 1KAAA 3IBEA 3SK6A 1L7YA 1YN5A 4DUZL 2LKVA 4YWLA 3BDLA 3NZSA 5C44G 4EVOA 2BH2A 5M5WB 3TMEA 3RYTA 2MX2A 3H7PB 2JRHA 5G5HA 4ZAIA 4DV4L 1TGZB 2D3BA 3NEMA 3X3MA 5G5GA 2KACA 1Q8IA 1T9HA 1C3TA 2F4IA 1FJGQ 1VQGA 2R7FA 3STBC 1SYCA 1NBFC 1VZ8A 4JI1Q 1PQSA 3M4QA 2ZZPB 1ENFA 1ACCA 3MWYW 4USAA 2L1AA 2YV5A 4HJ7A 1P7EA 3NUCA 1Q90A 1PH9A 3K81C 1KAWA 3MC8A 1E8YA 3HOZH 3RD2A 4GKJQ 1N61A 2JQRB 2CHXA 3WALA 4UDUC 1BDOA 4LNOA 1AZQA 2V9HA 4BBRG 3QIJA 4MN3A 1UE5A 2VB3X 3EFXD 4RGOS 4RM8A 4C1NK 1IYVA 3DBLB 4GN4B 3HVDA 4W9GA 2JA7G 4BVUC 4WORA 4DR3Q 3DDCB 1FD7D 3ECIA 4IUUA 2PE9A 5IKCM 2UUAL 4KJNA 3LXFA 3KJOA 1I35A 5K5PA 5KYIA 2DNFA 4GB9A 4MT5A 3IG3A 3PLUA 5D14A 4K7SA 3AQQA 3VTVA 2PVOD 3NVZA 5M3MH 2JEAI 3T1YL 4DN4M 1X54A 3HGBA 3AN1A 1WVLA 2MJDA 1J8CA 2MQHA 1NR4A 3WCQA 2Y0SG 4HJ5A 2KXJA 4BKSA 1NCVA 1X3FA 3ZKJC 3ZYYX 3LDZE 3SEBA 4QUCA 4WIPA 1E2VA 3GTQB 2WXIA 2BPSA 4X65L 3WIMA 1OEYA 3AV8A 3PZ8A 2ZT9C 3RNAC 1YX5B 1NUCA 2ASQA 1DOIA 2QDLA 2JZPA 1LT6D 2CS4A 3TJPA 1NMFA 3W1GA 1YI2A 2W3RA 1GUWA 5HY6A 5DPRA 4ZQ3A 2VUMG 3UI3A 2RDGA 4I7AA 4CKBA 1K83B 1NENB 3P4QB 3T51B 4NXMQ 3GTLH 3FAHA 1N33Q 1SSNA 2PQAA 2LY7A 1VS0A 4G7ZC 2N1VA 1V8QA 1ZEQX 1XEEA 2BYFA 2PZUA 2C7MB 2K25A 3CWIA 4LJZC 1WH3A 4WJPA 2D07B 4US8A 4B08A 2X6LA 3RNUA 4IFDG 1EFWA 3J81E 1UAPA 1P0RA 1N5XA 3AE2B 1U4MA 4GN3B 1K8GA 2HTME 4A3OA 4EZLA 1SNPA 3BVZA 4X3SA 1YJNA 3NJTA 2MSED 5JEAJ 3NY5A 3HKSA 3OMCA 4RA8A 1TWHB 2UUAQ 1YMHE 2KUMA 4KHZA 2XEWA 1NAPA 2R92G 1HTOA 4OO1H 1E8WA 2KN4A 4MIUA 1SYDA 4BBSB 4NW2A 1WXVA 4LWCA 2L1BA 3QCAA 1C4QA 2L55A 1QNUA 2LXAA 2LVOA 3GZNI 2CJOA 2L00B 4MM3A 3WDNA 2V4LA 2F4VL 1I4QA 1S5CD 3AB5A 2N49A 4XYOA 2H88B 5IGEA 3U4ZA 4X65Q 1A3UA 1XNRL 2RPVA 1Y1VH 1ZYRD 2EYOA 4RAUC 5CV7A 4DNIA 3A9JB 4WFN3 4FLHA 2KLGA 5FLXE 5I9OA 4PZ8A 2EY1A 1GHJA 1SE4A 1YNND 2K33A 2E2JH 1JALA 2ZM6L 4OX9Q 1EM7A 5CV5A 3J80c 2QHOA 3ZIMA 4K8JA 3E9SA 3ZO5B 3OTOL 2Q8RE 2Z0DB 4PZ6A 1WYDA 2YTXA 4C4VB 4FHKA 3I73A 3ALBA 4BY7H 4B9KA 4RCOA 5KIXA 5ISRA 3AMUA 2NVQB 3H3VH 4LF9Q 4GKKQ 1EY0A 3TL5A 5GQOA 1L4DB 2F0UA 4W9DA 1W6JA 2A8VA 1PH7A 2VB2X 5J3BA 1PH5A 2IGGA 3ABVB 3HOVB 1RFKA 3DBHI 1K0SA 1HQMC 2OTJA 3TEXA 2FJ2A 1WJUA 4NPSA 5IYCG 4BOSC 2JUOA 3PZ7A 4NAWA 2XVSA 1SF0A 4XDCA 1C77A 3DHHC 1A62A 4IFDH 3PGZA 3L16A 1RYJA 3J81i 3S2DH 4Q5VA 4Z9CB 4KTAA 4NMZA 4DHJB 1MBYA 4RKLA 4KGSA 2A68D 2LWPA 1A3TA 4I6LB 1W2BA 4PS3A 3VUYA 1O7YA 4G50A 1MJCA 1RKNA 3ICEA 4NY0A 4DK5A 2CKZB 2MH7A 2XBBC 2CH4A 4LNKA 2WXLA 1TY2A 2YEPF 1HCZA 3BJUA 3CRKC 3SD5A 3B1LX 3CQZH 2M56B 4R8NA 3V6CB 2BWFA 1MPEA 1G291 4X62Q 3DBRI 2N0SB 1PFBA 3PZDA 5CV9A 1SYGA 1JOOA 5J18A 1S3OA 4DR6L 1DONA 4FN2A 4C3IB 2F4VQ 3W1YA 5I9PA 1CQFA 1M1KC 1QKZA 4ASWC 1WWTA 4KY7A 1EF5A 2KDEB 2BTEA 1EWCA 4B3TQ 2K39A 4YXDB 3CKIB 4BBNC 2E5LL 1QOFA 2BKFA 1BUVT 4A3IG 5CC4A 1GNUA 5C4JB 4JI3L 4XZ4A 1K83H 4BAXA 4FDBA 3FKIB 4P2CB 3ZTCA 1A5RA 2KOLA 2YYZA 3NE5B 3M4OB 2ZJDA 4IWOA 3U7ZA 4F1SA 3CMMB 3HOUG 4AH6A 1FRDA 4KKJA 3AFQA 3OTOQ 1IPGA 4LF5L 3DM3A 5GADC 4PYUA 1K8OA 3M4YA 1JCKB 2O2LD 1AN8A 4MSQB 3PO2B 4L1BA 2F0HA 3DLLA 4LF9L 4C4VA 2RSUA 4LUOA 5COYA 3APDA 1L6UA 3U52E 4LUVA 3A9KA 2KJHB 1WMHB 3U50C 1PVOA 2XTIA 3ER0A 4A93B 4ACFA 5IT9L 3JAME 1Q0WB 2CR5A 1YJJA 2CVRA 2L9HA 4LW1A 1YOVB 4LFCQ 5IYCH 1I4GA 2KFJA 4A20A 3K5MA 1ZDVA 1NSNS 5H92C 3JC66 1E3PA 4B9XA 1VQ9A 3Q23A 4A3GG 3DVNV 5DAUA 3K0XA 3Q22A 1PZID 4OVUA 5FKAC 1VZ7A 2NPTB 4M0WB 4WJWA 1R4QB 3CXCA 1WR1A 5E6OA 1PRTF 5CGKA 5IOCA 1WI0A 3FPPA 4DXAB 2ICEC 2CW0C 1JQYD 4UY8C 2WWZA 2JQOA 1UGMA 5C6AA 4A3KH 1CFMA 3H94A 3IFDA 2B8GA 4HN7A 4YWMA 2EE1A 1UZXB 4NPNA 5BYRA 5J2RA 2SNSA 5FLXL 4AYBB 3BVMA 1OO9B 2HQLA 2MRPA 2LRUA 2RCNA 1PGXA 1IYFA 4L5TA 2I2YA 3TZDA 4F7ZA 2RDFA 2ONQA 3B2FA 4AQ7A 2LJ5A 4X62L 1H9SB 1W3SA 4GN5A 1LTAD 1K8MA 4DKAC 2ZJRA 1XLOA 2KVMA 4B3SQ 4KY6A 1TWGH 4DR6Q 4C00A 3E0JA 3F2CA 1NMGA 3ZTDA 2X69A 4S3SA 1FVIA 1UWMA 1OEYJ 1UBQA 2K5NA 1J19A 4B3TL 3NVYA 3MP9A 1S72A 4LFAQ 1WTHA 4ZRPA 3HOXH 2WKCA 2F03A 1AH9A 2OJWA 1GJXA 2WS3B 4OO1I 5IP9H 3VYSA 4MJSB 1T0SC 2RF4A 1YJ1A 5M5YB 3G4SA 2DYBA 1D1KA 3RNCC 4A6QA 4JI4L 3A55A 3MJ5A 2F0FA 1AZPA 1WM2A 4NDXA 4L63B 4JBWA 4OL7A 4DR4L 1CUKA 4DQOC 3U4EG 2BDOA 5JEAG 2KNBA 1XCQL 1RFAA 2K04A 2WP8J 1PTOH 3S16B 3BWUD 4HJKA 1FCCC 4KX6B 1QVCA 1P8LA 2WXJA 2PEAA 2MA9B 2FUG1 1EIFA 1N9WA 2QILA 1FEHA 4WWOA 1OQQA 3C19A 1CZWA 2B2YC 3NP8A 4LFCL 1JWBD 1MSHA 5AZGA 3M62B 1RIPA 2K03A 2CW0D 5IN7A 3K5OA 3BU2A 3GOEA 3NWTA 4DAVA 4LNNA 3HOXG 3HG9A 1WIAA 1EZ6A 3H6NA 5L95C 1L0VB 5HKHA 3V60A 2J52A 5FO7B 5TSSA 1TKYA 3H3VI 1I94L 1Y1WG 2L83A 1E6EB 2M0AA 3X0WA 3KF8A 4TQUS 4KDIC 3AU7A 4TKOB 4G3XB 5FJ8G 2IT1A 5C44B 4N59A 3T1HL 5F2DA 1MHWC 4X3UA 5I2XA 1NR2A 1SMYD 2MPMA 4MHEA 2N9XA 3HM3A 1CQVA 2H5XA 3AU5A 1E0ZA 2OHFA 2Q8IB 1P16A 1PYSB 4IUVA 4OXPA 4FF4A 4M8MA 4QUFA 4CGYB 4HIOA 1LTRD 1PHJA 1WCMG 4BY1H 2LASA 3I4MB 1Q12A 2SEBD 5C5MA 4N9F4 1YJIA 4JW0A 5C4HA 2KT7A 4FULA 3FMCA 2YTYA 4LFAL 1SBBB 1GO3E 2BS4B 1LTTD 3H7PA 1E2ZA 3SHQA 1ESFA 5AFWA 4NJCA 4ZRZA 1C9FA 1YNTE 3RZOH 1WFQA 1IZ6A 2BT6A 5IODA 1GD7A 3GTJB 5ELBA 4A3IH 1IL2A 1TTNA 4CJ0B 4ZYSA 1UWXA 2LVQA 2LRWA 3AH7A 5BN5A 4ANWA 5GAGC 5E4WC 3TEWA 2ZPNA 4DBGA 1GPXA 2O2VA 1SIJA 1BO0A 2Y5BB 3S17B 4EUTA 2KEEA 5C3EG 2AX5A 1DM0B 1XNQL 3J7AV 5C3XA 2WU2B 3EUB2 2B2VA 2B2UC 3MFGA 2DHZA 1TT5B 2C7NB 1D5XC 1R9TH 1JB3A 1HHVA 5FLMH 1SSOA 1X9NA 2E75C 4IN3A 3VR6A 2L0TA 4A3CG 3QQ8B 1HFGA 2FFKB 3IHPC 3HOUB 1SEBD 3VR3A 5IP9G 4FF2A 5LXIB 5IGBA 4QJFA 4YCUA 4ZK9B 1B50A 3ZXRA 1KLVA 3K57A 3VFKA 4KLKA 1QUQB 1SE8A 4IFDJ 3N1ZC 4XWTA 4LLGM 1J8IA 1X56A 3DHQA 4P72A 1YJWA 3C46A 2JA9A 2KEDA 2QJLA 2UWQA 3DQVA 3I5JC 1XPUA 1U9RA 4C1NI 2MBBB 1STYA 3CHBD 1QLBB 4CJ1B 2PIAA 4C7ZA 1CKNA 1D5ZC 3GTOH 1D2BA 2NVXB 1T5XD 1UE1A 3BZKA 3KF6A 5E7NA 1N8RC 5C4XB 1AYFA 2CU1A 2V3SA 2G9HD 3I3TB 1LM0A 4CDFC 1KDCA 2CJNA 3HOWG 4WQOB 3S14B 1PH4A 1AP0A 5M9OA 1XWEA 4DPGA 2JA6G 3VHTC 4Q0FA 1RRBA 1FR3A 2A6HC 2PLPA 2EKEC 1VMPA 1RCVD 2N88A 2M9VA 3QO2A 4A3MH 5NUCA 4ME5A 3ETRA 2MFIA 3L3OC 2RSNA 3S16H 1SLJA 2IO0B 2SNMA 2WXNA 3PT2B 4IUNA 3FEWX 2PTLA 2F3IA 3M7GA 1KL9A 4LUZA 2Q8TA 4C3IH 3FP9A 4CDEC 1P9DU 5C4ZA 2JA7B 3O13A 5M5XH 1NE3A 2ENBA 4WQMA 3APCA 3Q8DA 1JC7A 1F2RC 1F2YA 2L8JA 3J81L 1SNDA 1E8ZA 2Z9HA 1DJRD 1QWYA 3MXGA 3LGJA 4K0KQ 1YN3A 1C76A 3GTOB 3P4SB 4IM3A 2EYFA 4HIMA 2GBKA 4HPMB 1Q1OA 4LF6Q 2IO3B 3N3KB 1XNQQ 2MEKA 4BZAA 1V1QA 1PZKD 4ZRJA 3T9LA 4B0MA 2JA8G 4XT1B 3SU8X 2VRRB 4FJYA 1C4AA 1PFSA 2P5ZX 4R4CA 1HR0L 2G1EA 2Z59B 2E2DC 2VUMH 3FILB 3A7AB 5JJKA 1SE2A 3VAWA 4IWQA 1YZ6A 4A3CH 3I91A 2GRIA 2PVGC 4DV5Q 1YQ3B 1MD2D 4KZ0A 1FO4A 1WD0A 5LL6X 3U8ZA 4FXCA 2F0IA 3SK8A 3PUVA 2B8FA 2QEJC 1DOMA 2NN6H 1WJNA 3OW7A 2J0KA 2R7ZH 1V97A 1WR6E 1V9JA 2GB1A 3M9BA 3VR5A 2JA7H 2WFWA 1V5OA 2VY3A 3SFDB 3PIO3 3J7A5 2V4DA 3GTPH 1NTGA 2EDGA 2L11A 1HUNA 1Z6HA 1STNA 4KSKC 3MXUA 1VJKA 2K32A 1C8CA 2G9DA 2VH1A 2UU9Q 4DDID 3ENEA 2EYJA 5M3MG 5H1SE 2VL6A 2XWBB 1Q82C 1FJGL 2N7EA 3ZNZB 3ZDTA 2B2TC 2JSVX 3KWLA 3P4PB 2F0JA 1K8AC 1WOCA 1QE6A 5D3IB 4LK1C 3CIRB 4B0EA 1LUZA 4OWTB 1E1OA 4A3LG 5KHOA 2JYTA 3W9CB 1XQQA 4JBJA 3N30A 4XYQA 4A3DH 3QOJA 1EIHA 3A0JA 2F0DA 2EOTA 1MI2A 5CV6A 3BK1A 3NS1A 3QHTA 4XDDA 2JJQA 1FGBD 2NUCA 3RLFA 1E22A 2KWUB 4OZAA 3VRBB 4DA2A 1WMHA 5IYBH 3I57A 2AWTA 4WJ4A 2WB1E 3OPOA 3KVFB 3MC9A 3NRZA 4F8CB 5J1ZA 1XT9B 3I3CA 1KOTA 4A75A 2K3UA 2WX0A 3H9DA 2VNUD 4ICUA 2FCNA 1VQDA 2N7DA 3TCAA 4AJWA 1QF6A 4H44C 3VYTA 4LTUA 1SMXA 4W9CA 3NHEB 3RNFC 1TWHH 1MG4A 4BBNF 3D0FA 3NBHB 4V0BA 1LACA 3RNEC 3VDZA 3RN9C 4LF6L 5CR3A 2J0MA 2Q2IA 1FNWA 2EIFA 2PPBC 3S1RH 3TS2A 2RMMA 5EE9A 1KJTA 1CM9A 4P73A 2LGDA 2WLBA 1PTOF 3W2DA 1K9MC 3SK5A 4HLEA 1D7QA 3S1QH 4A3MG 4FJZA 4J8QA 1IBKQ 1P3QU 3SXHA 2J0JA 5LL6S 2QDBA 2L15A 1Y1VB 4HXDA 4DDGD 4FO2A 3TP8A 1BBWA 2DLBA 1Z47A 2DYMA 2R2QA 1T3QA 1FNVA 1SE3A 3AEAB 5A35A 4OONA 1Y8RC 2NN6G 1VQEA 4TVAB 4GOPC 2DAFA 1QG7A 3HIZA 1KDAA 4KGRA 3NS8A 4XQJA 2M00A 5I4DA 2J7ZA 4AYBG 1WGYA 1GG3A 1WJJA 2MJ3A 3MHZA 4EOYA 3J80i 5IGCA 1KABA 5K36H 3K7UC 3H09A 3UI2A 2UU9L 2INCC 2NZHA 2PMVA 3AE4B 3AEVA 4X64Q 4QIWE 2LFIA 2EQSA 2E6XA 2GBRA 1H9RA 2R92H 2AUKA 2B2WC 3U4VA 1IBML 4OO1G 2K9XA 1JE5A 2ZXRA 2HIVA 3IFTA 4HIDA 3PF5A 1WD1A 4KVGB 1QILA 1YIWA 4BWGB 1MGSA 1JJCB 3NXWA 3PUYA 4H13C 2EZVA 4MGKE 2DNEA 1IW7C 4HJ9A 2O6VA 3GTJH 3EHVA 2CCZA 2OCEA 1HFNA 3NVVA 3DVNU 2WXMA 3TUOA 3P20A 1YITA 3G48A 1STBA 2OEDA 2PKOA 5D65A 3S1NB 1U4PA 3JYUA 2QEXA 2VH2A 5HI1A 1FXIA 4DV1L 4W9JA 2NTTA 2QA4A 1XTCD 1I6HH 1FNUA 1YHQA 4N58A 3I72A 4I65A 2SAKA 4P1CC 2OF1A 1TY0A 3H7SA 4P6VF 3NK9A 2FCMA 5D3DA 2AL3A 2KFKB 4BXXG 2G4SA 3AEFB 3L13A 1VQ4A 2KDBA 2GN5A 3PPAA 4K5WA 3C1EA 5DEHA 5C0XI 1D4BA 1MI0A 1EY9A 4FBJB 1ZKOA 4A3IB 3ZLZA 1E24A 4EQPA 3RNBC 4GOPB 3KYCD 4X6AH 1RWSA 2IO1B 3B0AA 4LF8Q 1WGHA 2K6AA 3Q3FA 1SJHD 1UE6A 3OJ4B 4ZCKA 4GNXA 4S0RA 3LNNA 5EKKA 2NZOA 4JC0A 1G6ZA 2ZJQA 1JWUD 3QB3A 4FNFA 4P71A 4JOIA 1MVKA 4P74A 3D31A 1XNRQ 2SOBA 1PH3A 2KKCA 4DK6C 4JOIC 5D2MB 2F0WA 4IOAA 3I63C 2KZRA 4DGZA 3TIXA 3RN2A 1SGHA 1HXYD 1ZGUB 1I4HA 2VQFQ 4GNXC 4HRSA 2N3SA 2ZM6Q 4OX9L 1M90C 3SR6A 1TIFA 2IBIB 4EE2A 2AQ3B 3MHSD 4DNRB 4HCNB 4AS1A 2M1MA 4LNIA 1ASYA 1LTSD 3QA8A 3RUIB 1EEFD 1TWFB 3HZXA 2QW7A 2QSDA 1SN8A 3KFUA 2D3CA 3DHGC 4ID6A 4X64L 3W5OA 1RM6C 4IOCA 4DR1Q 2KN5A 4YT0B 1ESRA 3JSVB 5HHDG 3K7AH 4K2LA 4AJYB 1IBMQ 1IHZA 2AWNA 5E6PA 4PQXA 5KEEA 2JF5A 2NN6I 4CHKA 5IIFA 4KD4A 2PYKA 1SYEA 1XLPA 2WDRB 3GE3C 3LWUA 1P1AA 3GTKB 2NPTA 3FKYA 1G91A 1QOGA 2PI2E 5CORA 4EGVA 4M02A 4DHZB 1V1OA 2A4ZA 4KV2A 3IFWB 4POGA 3EVQA 4IG7B 2HIXA 4HKQA 4P1BC 4LDTB 3I8ZA 2WXRA 4RWSC 4XIGS 4I6PA 1N5WA 5ELOA 3JSVA 1E7ZA 1BVSA 4WWMA 1IL8A 2B2WA 5DCNA 2BA1A 1Y8OB 4F8MA 4FJVB 1SROA 4TQ0A 3UDIA 5DM73 3C0RB 3ZRFA 1WX7A 5EJWA 1X55A 1S1QB 1PUTA 1AE2A 1WGKA 3B6YA 4A3EB 4HJGE 3DUZA 1PH8A 1FFVA 1WJ4A 4KD3A 2V1CC 4IM2A 1I4PA 4ZRKA 1B4OA 1VQFA 4LF8L 2JE6I 1SMYC 4JCVE 4OGQC 4JBKA 2WXGA 1QOBA 1DOYA 4GOPA 2WX1A 4A3PA 1EEID 3NPPA 1TZ1A 4NAMA 2XWJB 4URKA 4ZKBB 4XTCS 2X38A 1HUMA 4DR2L 4J1MA 4JI3Q 5FJ8H 1UELA 1K0RA 4UP7A 1WXSA 4R4OA 2VQFL 3GTKH 5LLIA 4JI0Q 2KHIA 1PRTC 4F7XA 1Q5WB 3BZCA 2DX5B 2EKIA 2W55A 4KKUA 4IPDA 5DLQE 2ZJPA 2B63H 4H2AA 2A69D 1BR9A 4XT3B 3WWVA 3BIID 5C4JH 4YWKA 1Z2MA 3ND8A 3GO5A 3EGRA 1KRHA 4KMUC 2V1YA 3DXJC 3IAYA 1C9OA 2GA4B 1GM5A 4YCVA 4A3BG 1OTRB 3C8YA 1L4ZB 4YTMB 4RNAA 4HCEA 4O1NA 4C7YA 3HOWH 1ZDXA 1EYGA 3NTIA 3J80L 1A70A 4EX5A 3CCQA 1JRUA 4RHRA 2RA4A 4HMJA 1IGCA 2K5HA 3P42A 5DPTA 4UHVA 4P7IA 3RUZA 3F2DA 1FYCA
chains in the Genus database with same CATH topology
2KQ4X 4BY7B 3AE5B 2OT2A 4HEDA 1TS3A 2ID0A 2J0TD 1O7ZA 3TBIB 1U4RA 3QWNA 1OXUA 3M7NA 1LT4D 3AE6B 2B2TA 1YNJC 5I2YA 1LLRD 2F1MA 1TYGB 2AUJD 2V3PA 2DWQA 5C3JB 1BCPB 4L2YA 2IX1A 4A55A 1TJEA 4H7BA 2JX5A 4J6HA 5MPOA 3ZJVA 2MGSA 1C4CA 2A69C 4PMBA 3T3NA 1EYDA 4C3JG 2Z4IA 3K7AB 2K0PA 3T56B 5FR3A 2F3WA 5GXGB 1AFPA 1ZYRC 4ABNA 1F2MA 1EU4A 4RKBA 1VZ6A 3PUWA 1PRTB 1VF5C 5C2TB 3DWPA 3HRZC 3OSOA 3OWFA 1FXAA 5M3FB 2LHDA 3NBIA 4RFBA 4WRDA 3N6RA 1STHA 4ULLA 2WXQA 3T4AC 2WIIB 4DXFA 1IYUA 1GUTA 1B9NA 2PW9A 3RD4A 1SYBA 3IT6B 2INNE 1VMCA 1ENCA 4RF1A 3MHBA 5HG2A 4C56C 1F77A 5ELDA 3HEJA 1WTPA 3M85A 3DM1A 4KI0A 4OZCA 3ZGZA 2NYZD 2E2JB 2F3VA 1GHKA 5BN4A 3DWMA 1ML0D 1B9MA 1PYWD 1RHPA 2JEBI 2AWOA 1TWAB 2CU3A 4HKZE 4JX1C 2D5DA 4F87A 1ZXTA 1CA6A 2D5GA 1SFOB 2BS3B 4ARCA 3DWQA 1EL0A 5I6YA 3S1RB 1FFUA 1P7FA 1M8AA 2KAJA 1WSPA 2B2UA 2B2VC 2B76B 2YEPB 2F0GA 4K5XA 2L52A 1X3PA 2BYTA 2N55A 1AWDA 2K5WA 4ZLTF 4O42A 2V4IB 4K5VA 1PFDA 4HSPA 1DOLA 1N63A 2VZKD 5CYUA 5JXVA 3NHHA 2B39A 1Q10A 2VUMB 3G7LA 1HTPA 4NKLA 4RF0A 2V3NA 1HZ5A 2RDHA 5EKIA 3PO3B 1IBXA 4FF3A 3FPUB 4PT5A 1EQTA 3R2TA 1E7PB 4RGMA 4EQOA 1BCPC 3AB9A 3URYA 2GI9A 3R93A 2LEKA 1O80A 2R61A 2AQ1B 2C5CA 5DNFA 3GV6A 3Q24A 3S2HB 1QQRA 1XYIA 5E6JA 1PLFA 2K05A 2Y0SB 1QB5D 4JWUC 2BTEA 5ELCA 2IDYA 3TEZA 4KN7C 3AMZA 4HCSA 1FIQA 3OMGA 1ZXHA 4KKIA 4GDLB 1KDBA 1QT9A 2F0SA 1QOHA 4BS9A 1I6VC 3V05A 3MTSA 4FF1A 1SNQA 2JXTA 4TMAB 1FM0D 1CHQD 3E56A 4H0LC 3E6ZX 3OIPA 1I7HA 1JW9D 2L5TA 3S9WA 3U9SA 1ET6A 1F2LA 1OXXK 1QF6A 2E74C 1JRPA 1BOSA 3R8BA 1IKLA 1VCIA 2XRSD 1DOXA 4DAPA 4FXGC 2B2YA 4HTHA 1LTGD 3VYUA 1WTRA 2BW2A 3KBGA 3JAML 1KLGD 2NMQA 1L0YB 3KLSA 2F0PA 2K7VA 4OIJA 2D2CC 4YSYB 3FILA 3QG1A 4Y7NB 4LAAA 3J9CA 3CRLC 3AM9A 3GTLB 4K6DA 1I4XA 2I07B 3BVGA 3ND9A 1DZ1A 2JXMB 3R3OA 1YNNC 2A6ED 2LHEA 1XXGA 2PO4A 3HUIA 2KCNA 2EYMA 1SB3C 1WXQA 3SK4A 3T13A 2EJGC 4ZOHC 2M2LA 3SVMA 3A56A 3F2UA 3HP3A 4OW0A 3WOEA 5JPNC 1LO5D 1SAPA 1HTLD 3MFYA 2EXZA 4U673 3CU7A 3EJIA 1RODA 3B9JA 2RVLA 1JWSD 2KQ3A 1S5FD 4R8IA 2HCIA 4RH6A 1H9SA 5H8YE 4D2KA 5E3FA 3J7YW 1CT1D 2JU6X 1O7LA 4A3BB 3GS2A 3N52A 3VYRA 1J7BA 2A74C 2O5IC 2F0QA 3RMHA 2QCPX 1VDZA 3VA7A 1HA5A 3I70A 2F0LA 3K59A 5AUKA 1QNKA 3TDQA 2A73B 1TIID 2Z4HA 2QMTA 4CJ2C 1DYQA 1I3QB 2NVTB 4XQQA 5KNCA 2NBFA 1V8CA 1H9JA 1OFFA 4I7ZC 2HDLA 2EELA 1RDPD 5KNDA 3NVWA 1ZPSA 3K6OA 1LV9A 4C3HB 3AE8B 3H0GB 5EE1A 3BYTB 3GD7A 4N9PA 1Z7TA 4C3IG 4IFDI 3DEOA 4JE3B 2EVBA 1AEXA 3I90A 4M8AA 2QKIC 2BCOA 3CQZB 1YQ4B 4ODGA 3V2TA 3NTHA 1EQVA 3W5VB 2PCFB 4GDKB 3TP7A 1R7SA 4PMCA 3VR4A 3IAS1 3MVVA 2IWHA 4DK1A 3GTPB 2WAQB 4G7HC 2WKDA 1EZ8A 4OZBA 3KUPA 3J7AF 2OXPA 3NQTA 3A7LA 3P7JA 4REZA 4YTNB 1GAQB 5BYSA 1D5MC 1TU2B 2IJ0A 4XQNA 4HROA 1QCBD 3D6CA 2WDVB 1JMLA 3R2IA 1IGDA 5T8IA 3TP5A 3D4WA 3I4LA 4JWSC 4WURA 1MSGA 2FMCA 5J22A 3GV3A 3DEPA 2TSSA 3KBXA 2KCCA 2L0CA 5JJZA 4ZKCB 3P63A 1LT5D 5CV4A 2H89B 4R3DA 4EQNA 2BE5C 2NTSA 4KN4C 3MA2B 1JWAD 4KV6A 4RCNA 1F9PA 3K58A 3Q0AA 2KDMA 5LHY1 3X3NA 5ELEA 4K2KA 1SJED 3ZQ4A 4FXDA 3ZJTA 2IW3A 2O5JC 2ZXPA 5FO9B 4WAFA 1A2UA 3PO0A 4A90A 4JPSA 3VRAB 2XN9C 4DNTB 5KRUA 1QJOA 3VR9B 3G6JB 1PXUA 4LMQD 1SXTA 1Y1WB 1TWGB 2N7JA 3AECB 2J53A 2I46A 4MACA 3FC4A 1TR5A 2JA8B 4IUTA 1G2TA 2EY6A 1YNJD 1STGA 5A2QL 2HUGA 5EPLA 1CK1A 5JVH3 4PNYA 3VR2A 3TP6A 2MJ8A 1QOAA 2KA7A 2PZTA 3NQIA 2E2HB 3A8KE 1GUGA 1R4PB 4GLSC 3AE7B 2WXHA 3L9AX 4B9WA 4KK7A 4C3JB 1IW7D 1GXDC 5EGTA 3H91A 3I9V1 1PRTD 1XLNA 2A68C 2EY2A 2HDEA 4Q2JA 2CQAA 3D3RA 2CHBD 4BA1I 2IX0A 2A5HA 1V43A 3BZDB 1TT2A 2WU5B 3VA5A 2HDMA 1F9SA 1TWCB 1U4LA 1PMRA 3WOFA 4C2MB 4HSVA 1Y56A 4M1UB 2K01A 4PMWA 2R93B 1XCTL 2W3SA 2BDNA 3Q6SA 1I50B 4KKSA 3GTMB 2TMPA 3N9YC 2BS2B 2C9OA 1L5PA 1HQRD 3IT4B 1EY5A 1G8ZD 2WNMA 4DF7A 4BY1B 5EBDA 2NWGA 3RPFC 1KNEA 1F0ZA 1GB4A 3NTKA 1A3VA 1K51A 2IGDA 1PFMA 2LUMA 3BDCA 1TQOA 1RJTA 3HKZB 4G4KA 3D6WA 2ZW0A 3PMFA 1JOKA 2MUYA 1Q1BA 5C0XJ 5BMIA 1NYQA 3QJYA 4HEA1 4R9WA 3Q8FA 1CTMA 2J42A 4CHTB 2F0VA 1BUIC 2ZXOA 1WTXA 4TQ1A 5D7GA 2ACZB 2WINB 1CZPA 1EY4A 1AW7A 2VZKB 4ZUJA 3TSSA 5LNK1 1TS4A 3BK2A 2D62A 1E0BA 1NI3A 5ELFA 1Q1EA 2JA5B 3NSWA 1Y8NB 3GQBA 1CI3M 3IAM1 1GB1A 4G7OC 1KNAA 2F0EA 5EBCA 5A2QE 2NZ1D 1V1PA 4A3DB 2K5PA 1II3A 5EE3A 4G57A 1PDXA 3BYYB 1CZGA 1CJEA 1BBXC 1TS5A 1ENAA 1SYFA 1STEA 4A3FB 1B53A 4IZ8A 1TVXA 3HOYB 4LK0M 1ZOYB 2R3ZA 3J80E 4FP5D 2KWDA 1TKWB 3C3LA 4FYDA 5EPJA 1KTKA 2RQXA 2BOSA 1GUOA 5J39A 1STAA 1SNOA 2E76C 3AEEB 1IBXB 3PUXA 2XRQD 5JAVA 1KF6B 2EY5A 3S1QB 2I38A 1A15A 1LABA 2MJEA 1ILQA 5E1FA 1IUEA 4RGTA 2XNAC 3LWEA 3D8GA 1C4PA 5CV8A 2Z1CA 1EFID 3IKJA 4GZYC 2K22A 3KLRA 1LT3D 2R7ZB 1OXTA 4IURA 1HPCA 1UUPA 5IGGA 3D4DA 2PW7A 1OXVA 2AQ2B 1DOKA 5AUIA 3C2PA 1WTOA 3W5UB 2V0GA 5CMDA 3OIQA 4N9TA 1OQRA 1LTBD 2X6GA 4ZHPA 3AE1B 2INPE 1ROEA 4XXEA 2EYHA 1CHPD 1C78A 2L12A 3BG3A 3SE0A 5BMHA 1ET9A 3MAQA 2BB6A 3MC0B 4P16A 3HOWB 3DWAA 4M0WA 4DAYA 2KJXA 4IALA 1WTVA 3VQIA 4IDIA 3MZ5A 1ICWA 4F88A 1A6XA 2DNCA 2JP1A 4IUQA 4IOIE 5EPKA 5I6WA 4A3KB 3LB8C 3H8HA 1D1IA 2EJMA 1RD9D 3HRDD 3Q8BA 2MHVA 3FDTA 3FVQA 2RBMA 1SNCA 2LFNA 4RHSA 5BMGA 1TS2A 1DXMA 2RKSA 3ZJUA 1M4VA 4FVMA 1VRAB 1J9OA 1OXSC 2H4OA 1EYCA 3EQLC 1BNZA 1HZ6A 5HURA 4ARIA 5IGFA 2A6EC 3M3YB 3NUHB 4HAEA 1K53A 1JICA 5EQ0A 3T16A 2WXKA 4K6LA 1XO3A 2MP1A 2O4XA 1HEZE 1GOZA 1TZOA 1A2TA 1N62A 2PMZB 2K1BA 1DCZA 4K14A 3RFZB 1XX8A 2Q5WD 3MXNA 5M3MB 2M19A 3NBHA 2FMMA 4NZLB 2BE5D 3BS1A 2Y3AA 1KH0A 3GP7A 1WYGA 1PGAA 4J3OD 5KYLA 4HR7B 1BMLC 4KGTA 1T5EA 4X3KA 1C48A 1HRJA 1EY7A 1PDQA 4OIKA 2JYOA 1Y69U 2J4XA 2QF7A 1FCLA 3C1FA 5C0XH 2PNRC 1S4ZA 4A3GB 4L8JA 3IXSA 2F0NA 1FMAD 1E9MA 5CBEE 4XWWA 3RZOB 3AE9B 2WXFA 3SR1A 1K52A 3SDZA 2F0OA 1O78A 3T3OA 4MH8A 5IT9E 1B1ZA 4UAIA 4JK1C 1TKGA 2BA0A 2ICIA 3OHXC 5CBAE 3KQ4A 1VR9A 3P1MA 5BN3A 2JA6B 1EIGA 4DK0A 4FXKC 1JE4A 2VXWA 1B3AA 4NP5A 2SDFA 1HA6A 4CBVA 3U2SC 3A8IE 4YSXB 5BYQA 3K0YA 3AE3B 1FRRA 2DY8A 2YU9B 2H1EA 3KK7A 2E3TA 1EWYC 3PV0A 2KHSA 2NVYB 2L32A 2FBWB 5FO8B 2DN8A 2N9KA 4V190 2EPBA 2FINB 2LS01 3P75A 1KLUD 3K5NA 4KY5A 3PIP3 1Y8PB 4PV1C 2WB1B 3P4RB 2IL8A 3LYYA 1E2WA 4CKCA 1I6HB 3L4PA 4ZRQA 2PZWA 1X3QA 3EROA 1JWMD 3GB1A 1VF7A 4TRDA 1TKEA 5DM63 2NB0A 2LMCA 1F9QA 5C3WA 3H3VC 5JOBA 3S1MB 2DY7A 1WRIA 3LX0A 1D6EC 4U68A 1DD2A 1K50A 3KWVA 4L23A 1BCPF 1EWHA 3HS0C 3AEDB 1PZJD 3S2DB 2WXOA 3SHLA 2WXPA 1H9KA 3QIAA 5KNBA 2RSOA 5T1GA 3EA6A 4E6IA 3PUZA 2LMCB 4ZUIA 2JYEA 3V3XA 4KHVA 4KKTA 2ZW1A 1JORA 2WV6D 1EY8A 4US9A 4C3HG 4ITKA 1WCMB 5JEAH 2OEOA 3L7ZC 3OOCA 3Q69A 1N60A 1BXTA 3V96A 1RTNA 3H6MA 3MXPA 1ZE3D 3GTGB 3Q8EA 4WH4A 3TN2A 2Y5PA 5EE0A 4QMGA 1CA5A 1WTQA 3E5SA 1H9MA 2LGIA 5C0XG 4C80A 2K5QA 2E2IB 1PTOB 3P1HA 4ILWA 2PQEA 1L6VA 5C5LA 1ILPA 5C3EB 1BQQT 4TSSA 1JOQA 3MEHA 4QCLA 2K28A 2EJFC 3HVZA 3Q8AA 2EYPA 2WDQB 4BA2I 2XSCA 2HQEA 1NEKB 5HGTA 1MHXA 4QB4A 2A6HD 3ERQA 4OVZA 1EY6A 1EYAA 4QF4A 1F2RI 3TEYA 2F0KA 3SFEB 3D4RA 4ZHOA 1W6KA 5K36G 4A8XC 3K5LA 1KFYB 4MM3B 3ITPA 2JSOA 2Y5CA 3NZ3A 2D9UA 5M5XB 1GUSA 2R6GA 1F9RA 2KMMA 1MHHE 1S5BD 4IKGA 5IGDA 2QIEB 2IPKD 1ZUD2 1UEAB 3B2GA 1NVID 3I4NB 2KECA 3HOXB 4DU9A 3AEGB 1PTOD 1B2TA 4BBRB 2WQYB 3RZDB 4OHJA 3VR8B 2R92B 2XIWA 4A9AA 2F0TA 1L0XB 4IUPA 2L4NA 1BF4A 1BCPD 2N9LA 4X3TA 2HCCA 2WACA 2BB5A 1B9RA 3AEBB 3HOZB 1C79A 1S5ED 1ZP0B 1T6BX 1XF5L 4IQZA 5JPMC 1VDVA 3ONAB 3QOLA 1J7CA 5EKLA 3W3AA 2EYLA 4DXGA 3Q8CA 2IX3A 2FE8A 1X32A 3KLSX 4NAWB 4QIWB 1E10A 2FHTA 2IGHA 4KJOA 4RGNA 5G3LF 3DWGC 1G2SA 1IKMA 2WP9B 1J7AA 1F2ZA 3A54A 2B63B 1RF2D 2K5DA 5JVG3 1NYRA 1B44D 2LJIA 1I4RA 3DMUA 4A3MB 4YIJA 5G3LD 4A3JB 1PTOC 4CKEA 1VLBA 4HMIA 3NWSA 5T1IA 5FK9C 2W82A 1JQ4A 1EU3A 1UNSA 2DBYA 1V1PB 1S5DD 4K8IA 4L6TB 1SNMA 1EOTA 1UGJA 5KGUA 1YN4A 1WTWA 1JR0D 4YWGG 4DFAA 2F0MA 1PFNA 3OWEB 2PW5A 1JROA 5FOBB 2JWUA 1Q3LA 2BBCA 4YTPB 3A8JE 2DYOA 1SDFA 4XDXA 2ON8A 4N6EB 3TZUA 3T53B 4CQNA 1R9TB 3IL8A 3U9OA 5E4XA 1ONLA 4XE0A 1DGJA 1ZXIA 3FRPB 1PGBA 1LTID 1GUNA 4YSZB 2Z8LA 3S15B 1RTOA 3BDOA 1KAAA 3SK6A 1YN5A 2LKVA 3BDLA 4EVOA 5M5WB 3TMEA 5G5HA 4ZAIA 3X3MA 5G5GA 2KACA 1Q8IA 2F4IA 1VZ8A 1SYCA 1ENFA 1ACCA 3MWYW 4USAA 2L1AA 1P7EA 3NUCA 1Q90A 2JQRB 1N61A 4UDUC 1BDOA 1AZQA 4MN3A 2VB3X 3EFXD 4RGOS 4C1NK 1IYVA 3HVDA 4WORA 1FD7D 4IUUA 4KJNA 3LXFA 5K5PA 5KYIA 4MT5A 5D14A 2PVOD 3NVZA 2JEAI 4DN4M 3AN1A 3HGBA 1WVLA 2MJDA 1NR4A 3WCQA 1NCVA 3ZYYX 3SEBA 4QUCA 4WIPA 1E2VA 3GTQB 2WXIA 3AV8A 3PZ8A 2ZT9C 1NUCA 1DOIA 2JZPA 1LT6D 2W3RA 1GUWA 4ZQ3A 3UI3A 2RDGA 4CKBA 1K83B 1NENB 3P4QB 3T51B 3FAHA 1SSNA 2LY7A 4G7ZC 1V8QA 1ZEQX 1XEEA 3CWIA 2PZUA 4US8A 4LJZC 4B08A 2X6LA 4IFDG 3J81E 1UAPA 1N5XA 3AE2B 1U4MA 2HTME 1SNPA 3BVZA 4X3SA 5JEAJ 3OMCA 4RA8A 1TWHB 1YMHE 2KUMA 4KHZA 1NAPA 4OO1H 2KN4A 4MIUA 1SYDA 4BBSB 4NW2A 2L1BA 1C4QA 2L55A 1QNUA 2CJOA 3WDNA 1I4QA 1S5CD 3AB5A 4XYOA 2H88B 5IGEA 1A3UA 2RPVA 1ZYRD 2EYOA 4RAUC 5CV7A 4WFN3 5FLXE 5I9OA 1JALA 2EY1A 1GHJA 1SE4A 1YNND 2K33A 1EM7A 5CV5A 4K8JA 3E9SA 2Q8RE 3I73A 4RCOA 5KIXA 5ISRA 3AMUA 2NVQB 1EY0A 1L4DB 2F0UA 1W6JA 2VB2X 2IGGA 3ABVB 3HOVB 1RFKA 1HQMC 3TEXA 2FJ2A 3PZ7A 2XVSA 1SF0A 4XDCA 1C77A 4IFDH 1RYJA 4Q5VA 4Z9CB 4KTAA 4NMZA 1MBYA 4RKLA 4KGSA 2A68D 1A3TA 1O7YA 1RKNA 2MH7A 2WXLA 1TY2A 2YEPF 1HCZA 3CRKC 2M56B 4R8NA 1MPEA 1G291 2N0SB 1PFBA 5CV9A 1SYGA 1JOOA 1DONA 4C3IB 5I9PA 1CQFA 1QKZA 1WWTA 4KY7A 1EWCA 4YXDB 3CKIB 1QOFA 1BUVT 5CC4A 5C4JB 4P2CB 3FKIB 2KOLA 2YYZA 3NE5B 3M4OB 3U7ZA 1FRDA 4KKJA 1K8OA 3M4YA 1JCKB 2O2LD 1AN8A 4L1BA 3PO2B 2F0HA 5COYA 1L6UA 3U52E 4A93B 5IT9L 3JAME 1YJJA 2CVRA 2L9HA 1I4GA 3K5MA 1ZDVA 1NSNS 5H92C 4B9XA 3Q23A 5DAUA 3Q22A 1PZID 5FKAC 1VZ7A 4WJWA 1R4QB 1PRTF 5CGKA 5IOCA 3FPPA 2ICEC 2CW0C 1JQYD 5C6AA 1CFMA 3H94A 3IFDA 2B8GA 4HN7A 5BYRA 2EE1A 2SNSA 5FLXL 4AYBB 3BVMA 1OO9B 1PGXA 2I2YA 3TZDA 2RDFA 2ONQA 3B2FA 4AQ7A 1H9SB 1LTAD 1K8MA 1XLOA 2KVMA 4KY6A 3E0JA 2X69A 4S3SA 1UWMA 3NVYA 3MP9A 4ZRPA 2F03A 2WKCA 1GJXA 2WS3B 4OO1I 3VYSA 5M5YB 4A6QA 1D1KA 3A55A 3MJ5A 2F0FA 1AZPA 4NDXA 4L63B 4JBWA 4OL7A 4DQOC 3U4EG 2BDOA 5JEAG 1XCQL 2K04A 2WP8J 1PTOH 3S16B 3BWUD 1FCCC 4KX6B 2WXJA 2FUG1 2QILA 1FEHA 1OQQA 1CZWA 2B2YC 3NP8A 1JWBD 1MSHA 2K03A 2CW0D 3K5OA 3NWTA 4DAVA 3HG9A 1EZ6A 1L0VB 2J52A 5FO7B 5TSSA 1TKYA 2L83A 1E6EB 2M0AA 3KF8A 4TQUS 3AU7A 4TKOB 2IT1A 5C44B 4N59A 5F2DA 4X3UA 5I2XA 1NR2A 1SMYD 2MPMA 4MHEA 1CQVA 1E0ZA 2OHFA 2Q8IB 4IUVA 4FF4A 4QUFA 4CGYB 1LTRD 3I4MB 1Q12A 2SEBD 5C5MA 1YJIA 5C4HA 3FMCA 1SBBB 2BS4B 1LTTD 1E2ZA 1ESFA 5AFWA 4NJCA 4ZRZA 1C9FA 1YNTE 2BT6A 5IODA 3GTJB 5ELBA 4CJ0B 4ZYSA 1UWXA 3AH7A 5BN5A 5E4WC 3TEWA 1GPXA 1SIJA 1BO0A 3S17B 2KEEA 2AX5A 1DM0B 3J7AV 5C3XA 2WU2B 3EUB2 2B2VA 2B2UC 3MFGA 1D5XC 1JB3A 1HHVA 1SSOA 2E75C 4IN3A 3VR6A 1HFGA 2FFKB 3HOUB 1SEBD 3VR3A 4FF2A 5IGBA 1B50A 4ZK9B 3K57A 4IFDJ 4XWTA 4LLGM 1J8IA 3DHQA 2QJLA 3C46A 2KEDA 1U9RA 4C1NI 1STYA 3CHBD 1QLBB 4CJ1B 2PIAA 4C7ZA 1D5ZC 1D2BA 2NVXB 1T5XD 5C4XB 1AYFA 2G9HD 1KDCA 2CJNA 3S14B 1AP0A 5M9OA 1XWEA 4Q0FA 1FR3A 2A6HC 2PLPA 1VMPA 1RCVD 2N88A 2M9VA 3QO2A 5NUCA 4ME5A 3ETRA 3L3OC 2RSNA 2SNMA 2WXNA 4IUNA 3FEWX 2PTLA 3M7GA 2Q8TA 5C4ZA 2JA7B 3O13A 2ENBA 4WQMA 1JC7A 1F2RC 1F2YA 3J81L 1SNDA 1DJRD 1QWYA 3MXGA 3W1SA 1YN3A 3P4SB 1C76A 3GTOB 2EYFA 2MEKA 1PZKD 4XT1B 1C4AA 2G1EA 2E2DC 3FILB 3A7AB 1SE2A 3I91A 2GRIA 2PVGC 1YQ3B 1MD2D 1FO4A 1WD0A 5LL6X 4FXCA 2F0IA 3SK8A 3PUVA 2B8FA 2QEJC 1DOMA 2NN6H 3OW7A 1V97A 2GB1A 3VR5A 3SFDB 3PIO3 2V4DA 2EDGA 2L11A 1HUNA 1Z6HA 1STNA 3MXUA 1VJKA 2K32A 1C8CA 2G9DA 2EYJA 2XWBB 2B2TC 2JSVX 3KWLA 3P4PB 2F0JA 1QE6A 5D3IB 4LK1C 3CIRB 4B0EA 2JYTA 3W9CB 4XYQA 1EIHA 3QOJA 3BK1A 2F0DA 2EOTA 1MI2A 5CV6A 3NS1A 4XDDA 1FGBD 2NUCA 3RLFA 3VRBB 4OZAA 4DA2A 3I57A 3OPOA 3NRZA 5J1ZA 3I3CA 2K3UA 2VNUD 4H44C 3VYTA 4LTUA 4V0BA 1LACA 5CR3A 1FNWA 2RMMA 2PPBC 5EE9A 1CM9A 2WLBA 1PTOF 3W2DA 3SK5A 4J8QA 3SXHA 5LL6S 2QDBA 1Y1VB 4FO2A 3TP8A 2DLBA 1Z47A 2DYMA 1T3QA 1FNVA 1SE3A 3AEAB 5A35A 2NN6G 1QG7A 1KDAA 4KGRA 4XQJA 2M00A 5I4DA 2J7ZA 2MJ3A 3MHZA 5IGCA 1KABA 5K36H 3H09A 3UI2A 2PMVA 3AE4B 2LFIA 2E6XA 1H9RA 2K9XA 2AUKA 2B2WC 4OO1G 2ZXRA 3IFTA 1WD1A 1QILA 4BWGB 1MGSA 3NXWA 3PUYA 4H13C 2EZVA 2DNEA 1IW7C 1HFNA 3NVVA 3TUOA 2WXMA 3P20A 2OEDA 2PKOA 1STBA 5D65A 3S1NB 1U4PA 5HI1A 1FXIA 2NTTA 1XTCD 1FNUA 4N58A 3I72A 4I65A 2SAKA 2OF1A 1TY0A 4P6VF 3NK9A 5D3DA 3AEFB 4K5WA 3C1EA 5DEHA 5C0XI 1D4BA 1MI0A 1EY9A 1ZKOA 4A3IB 4EQPA 1RWSA 2K6AA 1SJHD 3LNNA 5EKKA 1G6ZA 1XLQA 1JWUD 3QB3A 4FNFA 1MVKA 2W54A 4B0MA 5HFYA 3D31A 2SOBA 2F0WA 4DGZA 1HXYD 1I4HA 4HRSA 3SR6A 4EE2A 2AQ3B 4AS1A 4DNRB 1LTSD 1EEFD 1TWFB 3HZXA 2QSDA 4ID6A 1RM6C 4YT0B 1ESRA 5HHDG 4K2LA 1IHZA 2AWNA 4PQXA 5KEEA 2NN6I 5IIFA 2PYKA 4KD4A 1SYEA 1XLPA 2WDRB 3LWUA 3GTKB 1G91A 1QOGA 5CORA 4EGVA 1V1OA 3EVQA 4HKQA 3I8ZA 2WXRA 4RWSC 4XIGS 1N5WA 4WWMA 1IL8A