2WS3B

Crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd tyr83phe mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Succinate Dehydrogenase Activity
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
total genus 65
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2ws3B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ws3B01
1E10A 1JRPA 2H89B 1PUTA 3AEAB 3P4PB 3VR8B 1YJJA 4YXDB 3AEDB 2CJNA 1DOXA 1WRIA 3AE1B 2LEKA 1N60A 2BS2B 2WS3B 2BT6A 1RYJA 3VRAB 3NVZA 1JWBD 4YT0B 4JX1C 3AE5B 4ZHPA 1PDXA 1OFFA 5GXGB 3ZYYX 3DWGC 4LTUA 1UWMA 2M56B 1H7WA 3AECB 1E9MA 1ZOYB 3P4RB 1ZXIA 1WYGA 1FRRA 1AWDA 2PVGC 3AV8A 3W5UB 4C7ZA 3SR6A 1FO4A 3P1MA 3HVZA 4YTPB 1JALA 1GAQB 2KAJA 1CJEA 1N61A 1NVID 3AE8B 1KFYB 4YSYB 1EWYC 3AE2B 1I7HA 1YQ4B 4US9A 1YJIA 3AE9B 2G1EA 1J7AA 2QIEB 3AB5A 2W3SA 1RFKA 3KWLA 1GT8A 1V97A 2M19A 2QJLA 5C2TB 1TJEA 3WCQA 1GTEA 4FXCA 1NEKB 2W55A 3NVWA 1DOIA 4N6EB 4WQMA 2Y5CA 1F0ZA 4N59A 1FFVA 1NENB 2K22A 3EUB2 1KF6B 4YSXB 4KX6B 1T3QA 3AN1A 1E7PB 1L6VA 3HUIA 3NS1A 4WWMA 1IUEA 4C7YA 2EKIA 1FM0D 2JX5A 1VLBA 4HRSA 1A70A 4ITKA 1E6EB 2E3TA 3B9JA 1OQRA 2DWQA 2MJ3A 2W54A 1XLQA 3LB8C 3NRZA 1XLNA 1FFUA 1NI3A 2DBYA 2K5PA 3AEBB 2WP9B 1VDVA 2WDVB 1FRDA 4YTNB 3B2FA 1PFDA 2MJDA 3CWIA 3AH7A 2WU2B 3AE4B 2L83A 1B9RA 2W3RA 1ZP0B 1L6UA 2JQRB 1JQ4A 5H8YE 2CJOA 2OHFA 3W5VB 1RWSA 1GPXA 3P63A 4C80A 1DGJA 4YTMB 2PKOA 1AYFA 1QT9A 1TKEA 1QOGA 2B76B 3AMZA 4N58A 2CU3A 1TKGA 1QOAA 4ZHOA 1VJKA 2K9XA 5MPOA 1J7BA 3AEEB 1YQ3B 1L0VB 3NVYA 1WGKA 5H92C 2ACZB 2FBWB 1ROEA 1N63A 1NYQA 1JW9D 1ZUD2 1H7XA 1E0ZA 3DWMA 3ABVB 1OQQA 5AUIA 3FC4A 3PO0A 1L5PA 4P6VF 3HRDD 5EE1A 3AEFB 5EE0A 3B2GA 1GTHA 1SIJA 1WWTA 2WLBA 5G5HA 1FXIA 3LXFA 2WU5B 4USAA 1QF6A 3RPFC 3VR9B 2WDQB 2BS3B 1NYRA 5C3JB 2AX5A 2HTME 4HROA 3ETRA 4ZOHC 2WQYB 3AEGB 1QLBB 2L52A 1R7SA 3P4QB 4IDIA 1WXQA 4A9AA 1SB3C 2KMMA 1J7CA 5EE3A 1TKYA 3SFEB 1JROA 1SF0A 3SFDB 1DOYA 3W9CB 3AE3B 1V8CA 1RM6C 1N62A 3FAHA 1XLOA 3P4SB 2BS4B 2MJEA 3AE6B 1FXAA 2N0SB 3NVVA 3CF4A 3BIID 3VRBB 5G5GA 3AE7B 1FIQA 2WDRB 2Q5WD 5EE9A 1XLPA 1JWAD 2MH7A 3AM9A 1XO3A 5AUKA 1QOBA 3CIRB 1TYGB 1N5XA 2PVOD 1N5WA 4US8A 1CZPA 4JWUC 4JWSC 4YSZB 1QOFA 3L4PA 2PIAA 1FMAD 2H88B 1KRHA
chains in the Genus database with same CATH superfamily
1HA5A 1SGHA 1YJJA 4LNFA 3RZFA 4WURA 3N32A 1Q1OA 3ZO5B 2AL3A 2UWQA 2REXA 4M8NA 2YEPB 2L3ZA 4AJYB 3TBLD 2QCZA 2BQQA 3P4RB 4DHJB 3M3JA 4WWNA 3APDA 3VFKA 2YLMA 1CJEA 4YSYB 2I1KA 1M94A 3TMPB 2QSDA 4ZDVA 2D10A 3LYYA 5G2NA 1R4MI 2KX3A 2BGFA 4HK2A 1XCQL 1PGBA 4FXCA 2K6DB 2PLPA 4ARIA 1T3QA 4NQLB 3MTNB 4C7YA 3HM3A 1A70A 1V81A 2QILA 3MC9A 4GSWA 4D2KA 2KDMA 4XGAB 4YTNB 4HLEA 3GOEA 3JSVB 1SE2A 2KK8A 3MHSD 5D6JB 2MBEA 2WU2B 3AE4B 2ICIA 3A9JB 1KH0A 1TGZB 2M8SA 2CJOA 2OHFA 4L2YA 1IP9A 2MWSB 3CF6E 2KACA 1AYFA 2I1JA 1VJKA 4HDOA 1YQ3B 3NVYA 2FBWB 4KSLC 1NYQA 3ECIA 3DWMA 5D2MB 3LDZE 2K6QA 3DCGA 3A1QB 4GU2A 1RLFA 3Q3JA 1H4RA 1Y56A 2QC8A 2MHJA 1QLBB 2L52A 3P4QB 3RNFC 1HZ5A 2KDIA 2VZKD 5EE3A 1D4BA 1FXTB 4NNJB 3CF4A 3BIID 1F9JA 3R3MA 1D3ZA 1UNSA 1C76A 2HE7A 2WXPA 5TR5A 2JZ3B 3P4PB 1E7VA 1UH6A 1ZDVA 1K50A 2ZW0A 2KJRA 4ZHPA 3I5JC 5J18A 3TEWA 3QCAA 1T0QC 2BBCA 3AU4A 3MJWA 4UDUC 2KQSA 1ZPSA 4YTPB 4HVBA 3SDLC 4MGIE 1V97A 1IYFA 4DWFA 1IBXA 1E8XA 5HG2A 5D3DA 4MJSA 3SEBA 1BUIC 4KX6B 2JWUA 2O2VB 1XLQA 4B9KA 2BKFA 1WI0A 3HK0A 1UBIA 3PPAA 4A90A 1PFDA 1P9DU 2MJDA 1SJHD 2FCMA 3U7ZA 1IGDA 1C9FA 5JXVA 1EF5A 4FJYA 1B9RA 2K8HA 2M0XA 4XYCA 1SE9A 2OOBB 3N30A 2KN5A 3H7SA 1QILA 2PEAA 2WXNA 1QOAA 1UGMA 5LXHA 1F1HA 4EZKA 2FIDA 3ZTDA 3AEFB 5G55A 2XK5A 5AZHA 1OTRB 1VRAB 3A4SC 5C3JB 2ONQA 2AX5A 3KUZA 2MEKA 3ZUNA 1TBEA 4GDKA 2JZPA 1KTKA 4W9JA 2DNFA 1RM6C 2GBNA 3ZXVA 1NDDA 2D3GA 2Q5WD 2FNJB 2WXJA 1XO3A 4II2B 3SD5A 3Q6BA 1WJ4A 4DK5A 4XZ4A 1Q0WB 2BS2B 4IC7B 1L7YA 4CYEA 1JWBD 2N9EB 4FJVB 3AE5B 3ZVVA 3DWGC 4LNIA 4TKNA 5IA7A 3I3TB 3NUHB 1WZ0A 3RMKC 3TEYA 2V1YA 2D11A 1WGYA 1JCKB 4RGTA 1XT9B 2NPTB 2FCSA 2QIEB 3AB5A 1RFKA 4ZRPA 3PZDA 1LQBA 1CQVA 5T8IA 2V3PA 3T3OA 3NZUA 1S1QB 1KF6B 5AUIA 3W1SC 4F1SA 1E7PB 1I35A 1BT0A 2YVCA 4C4VA 3VXWA 2DWQA 4MSQB 2MQJA 2KFKA 5JHAA 5I4DA 1VCBA 3ZDMC 2BWFA 2KYWA 4TV3A 2ZZPB 3PLVA 4LNOA 5H8YE 2KTRB 3P63A 3RI7C 3W1SA 2EMSA 3Q2AC 3U8ZA 4EZJA 1T0YA 2HTHA 3TUOA 3L17A 3Q8CA 1ZUD2 3O65B 4II3B 2JZZA 5IP4D 1SIJA 2KFKB 1F77A 1P7EA 1FNVA 2KOXA 3VR9B 2L76A 2MA9B 4DXGA 1E90A 2HTME 1WM2A 3X23A 2WHIA 2L7RA 3V05A 4CQNA 4IDIA 5E6JA 1DYQA 3SFDB 1P0RA 3WAMA 3APFA 2VRRB 3VRBB 4M00A 5E6OA 4M8MA 2Y5PA 1FIQA 1L0YB 2MLBA 5AUKA 1WMHA 4WJPA 2O6VD 1WJUA 2LGDA 2GLSA 2R2OA 1C77A 4L1BA 3AEAB 2K8CA 4HCPB 2A4ZA 2HJ1A 4LCDE 4JIOU 2JVCA 2LASA 1E9MA 2XN9C 3JSVA 1V49A 3D32A 3H8HA 2PE9A 2VH1A 2KQ7A 2V3SA 1XF5L 4PS8A 3N1XC 2NR2A 1FNWA 1FD6A 4BZAA 1XCTL 2K22A 3ZDTA 4ZRQA 1SE4A 4FULA 4HRSA 1I4XA 2E3TA 2K1FA 4RCOA 4C00A 1FRDA 1Q5WB 4BOSC 3RULA 4K7UA 3ZQ4A 1YD8U 1WIAA 2LRWA 4G0NB 3C19A 2XEWA 2DAFA 3ZJUA 5AZFA 4KGTA 4HKZE 1CMXB 4GN1A 2QMTA 3VTUA 1WY8A 4MGKE 3BYYB 4CO7A 3B0AA 1YMHE 3NG0A 3T9LA 3NHEB 4CHKA 2JUOA 2LVPA 4MT5A 3AEGB 2HD5B 1SEBD 3DBRB 2NPTA 2G9HD 4WJOA 3Q3FA 3QAQA 3KYCD 5EDSA 2WGSA 1QQRA 3ALBA 3OLMD 2KLGA 4W9LA 3PGEA 1N60A 2NTSA 4MGZE 1WYWB 2ZNVC 2GB1A 3DVNV 4YT0B 2IYDB 2J7QB 2IGGA 2LGYA 3FILB 3QARA 4IWOA 2LUEA 1ZXIA 4MELA 3AULA 4MACA 3MJ5A 2INPE 1KFYB 3A9KA 4XWWA 3CMMB 5C2TB 3RZWC 1IUEA 3EFCA 5LLIA 4E3CA 1QZEA 3FILA 4XWTA 2KQ4X 2DAJA 1EUVB 1MFWA 2DYMA 1RRBA 1WE6A 3ZJTA 2R2QA 2E6XA 3APCA 1PGAA 2K9XA 4PK1A 1T5XD 3IAS1 5H92C 2ACZB 1V1OA 2ZPYA 3BY4B 2N9KA 2WXIA 4FN2A 2LXCA 2BB6A 1QF6A 2JXTA 2WDQB 2KWDA 4G3XB 1JWUD 2KDBA 3DBSA 4OZBA 5D7GA 1P7FA 2MP2A 2CU1A 4K7SA 3NZSA 3AE3B 3FAHA 5DPTA 2WYQA 3BK1A 5EE9A 1XLPA 1QOBA 1TT5B 4JLCA 1FMAD 2IO0B 3IBEA 1T6BX 4YXDB 1GUAB 1RYJA 3OWEB 4IUMB 3NVZA 2KDFB 5BMGA 1PDXA 1MPEA 2FCQA 4LTUA 1UWMA 2BWES 1SBBB 3QX1A 4EKUA 2IGHA 1YX5B 3JVZX 3V6EB 2BPSA 3AE2B 1YQ4B 3UGBB 2MBBB 2MP2B 2N9LA 3CSTA 1TJEA 2BYFA 2KNBA 4N6EB 3GP7A 4LDTB 3A1QA 3AU5A 5HKHA 1L6VA 3HUIA 1FM0D 4RM8A 4REZA 1FFUA 5BMHA 1HE8A 1VDVA 3DVNU 1WXVA 3VUWA 3MP9A 4RFBA 4ZYNA 3PRZA 5HFYA 4WWPA 2LHEA 3TEZA 3GS2A 1OEYJ 3OAWA 4X57B 3L08A 2J0KA 3FC4A 4P6VF 5IN7A 4IW0A 5G5HA 4NAWB 3RCZA 1M4VA 4ARCA 5C1ZA 4FHKA 1E7UA 3NOBA 2K25A 1TTNA 1TKYA 3A33B 4NJCA 4EUTA 1E5WA 3TJPA 1MHXA 2N0SB 4GGQA 1FNUA 2X8XX 2Y5BB 5DPWA 1TY0A 1E8YA 2PIAA 4DXFA 3VDZA 3RT3B 1HQRD 3Q8BA 4M02A 3Q3NC 3ONSA 2PJHA 4BAXA 1SE3A 2OJWA 3P2BA 1YJ1A 4WAFA 4JL9A 3QIJA 1TS4A 3J9CA 4TUUA 3AV8A 3RN9C 3W5UB 3DBHB 2DYBA 2ZJDA 1RAXA 4US9A 1R4NI 1EO6A 4B0MA 3KWLA 2KVRA 4G50A 1GT8A 2D3CA 2MX2A 2WXFA 1WM3A 1NEKB 3ZJVA 3SU8X 2JRHA 2GBKA 2M0AA 4YSXB 2N9PC 3EUB2 2LMCA 2EKIA 5LNK1 2CHZA 2W82A 2INDC 1C4AA 1OGWA 2MJ3A 1KLGD 3NRZA 4TQ1A 1NI3A 5FR6A 1VZ6A 2XNAC 3L10B 4N9F4 3Q69A 3DBRI 2FAZA 3BYTB 1V1PB 3PV1A 5JZEB 2PW9A 1KJTA 4WIPA 1L6UA 2RPQA 1AARA 1GPXA 2W9NA 3N20C 2Z0EB 2BW2A 1WGGA 1TKEA 3TIXA 3PRPB 1D5ZC 4AOFA 1XD3B 3RYTA 3VTWA 3VUXA 4A3PA 5EE0A 4B0EA 1ET9A 4KVGB 3U4EG 2KKCA 4ASWC 3BWUD 3GE8C 2BS3B 1EM7A 2QEJC 4NAMA 2Z0DB 4ZOHC 2IBIB 3N1YC 1SB3C 2WX0A 4AWJA 2KMAA 2N7EA 1V8CA 3P4SB 2PMVA 2BVCA 3VQIA 2M17A 4LLGM 3B1LX 4GXBA 3EC8A 2MH7A 2C7MB 4M0WB 2Z59B 1PUTA 3VR8B 2D5GA 2MBHA 4O1NA 1UZXB 1YN3A 3DDCB 2WXMA 2IGDA 1JRUA 2L1AA 1HTQA 2OEDA 4AJWA 3ZYYX 4KZ0A 3GB1A 2QDFA 4XX5A 2PVGC 4KSKC 1YX6B 1V6EA 1A5RA 2V9HA 2WXKA 4BOZB 3MC0B 2G3QB 4RF1A 3ENEA 1C1YB 2LVOA 1K8RB 4C56C 1GTEA 2UU7A 3IVFA 1ACCA 1MG8A 2CR5A 1DOIA 4W9DA 4E74A 4WQMA 3UQAA 2JF5A 4MM3A 3PHXB 2V4IB 3WAOA 4DHZB 4NZLB 1GOZA 2EMTA 4C4VB 3Q14C 3DVGY 2C7HA 2KD0A 4ZYSA 2D2QA 5E6NA 1YOVB 1UWXA 2IO2B 1EWCA 3PSEB 3P42A 1ZXHA 5JH5C 1Y8RC 3JYUA 3AEEB 1WGKA 1ROEA 1LO5D 3N9YC 5KHOA 2WWZA 4KDLB 3B2GA 3LXFA 4KZCA 4USAA 2IDYA 2KANA 3H1UA 2LFIA 1SIFA 1YQBA 3IHPC 2WQYB 5AZGA 3C8YA 4DBGA 2FE8A 4L23A 3ZRCA 2BF8B 4LJPB 1DOYA 1I4HA 2RSUA 2V4LA 1N62A 2MBOA 3RNCC 4BBNC 2N7JA 2D3AA 2K39A 5CHVC 2JYTA 4P1CC 3V61A 1CZPA 1QKZA 2H88B 4OW0A 2H89B 3JW0X 4ANUA 2WS3B 3M62B 3L0WB 2FCNA 1LFDA 3TCAA 1F2RI 1Z2MA 4RNAA 1YNTE 1BMLC 1WRDB 4C7ZA 1FO4A 4PYZA 2L00B 3AE8B 2J0MA 3FKYA 2M19A 3RUIB 4RF0A 4AP4C 1NENB 4IWPA 2C60A 3I9V1 3U30A 1OQRA 3AEBB 2WP9B 1MVKA 1X1MA 2LWPA 1WZ3A 5DPSA 1GB4A 3BZDB 5D3IB 4AQ7A 1TS3A 4BKSD 3ZRFA 5BYQA 1YN4A 3V3XA 1IBXB 1DGJA 4YTMB 1J19A 2GBRA 4N58A 2KMCA 1V5TA 1WX9A 1UBQA 4KGSA 4YL8A 4PS3A 2WXHA 3N1ZC 4NY0A 4FLHA 2J4XA 1H7XA 2NTTA 2KWCA 2O2VA 1L4DB 1GTHA 5HI1A 2VH2A 3LJ3A 2ZCCA 2GBMA 1C4PA 3KW5B 4MGYE 1J0GA 3IG3A 1R7SA 4K1RB 5CTRC 1GB1A 2KWVB 1F2RC 2RR9A 4ACFA 1JWAD 2L32A 3DBLB 3PT2B 1WJ6A 3M95A 2MSED 3QQ8B 1E10A 2XK5B 5FR3A 2K0PA 1DOXA 3BVGA 1IGCA 3V60A 2IO3B 3HM6X 4MSMB 2O6VB 1WF9A 1OFFA 2V0GA 3UINB 3H6NA 1WR1A 4DHJD 2CHWA 4A55A 2K3UA 2RPVA 1HTOA 4AS1A 3ZNGC 3ZXRA 2J52A 2KAJA 1N61A 2DZMA 2FUHB 3PZ8A 4RGMA 3AE9B 3BK2A 4XDDA 2W55A 3NJTA 4TQ0A 4HDQA 1FFVA 1LGRA 4N59A 1YIWA 3TSSA 2LUMA 3H7PA 3MFGA 3DBLI 4OVUA 1PQSA 3ZNHB 3P1MA 5FKAC 4MH8A 3R7RA 2ZPNA 2LGXA 1TIFA 2JYEA 2GMIC 3PVLA 2G4SA 2L83A 4Q2JA 2WXGA 2NBWB 2BTEA 2PKOA 3ZTCA 1AW7A 1UGJA 2ZNVB 1K53A 1TKGA 3A4RA 3ZKJC 1JWMD 1WR6E 1OEYA 3ZW3A 1WFYA 2LD9A 1E0ZA 3ABVB 1P1AA 1B1ZA 1YN5A 4HKQA 1I4QA 2MCNB 4EOYA 1J8CA 2WU5B 1PYWD 2JWZA 1ZGUB 2C5LC 4HEA1 2MW5A 2HDEA 3WA0A 1EU3A 2WNMA 1SXTA 3T3NA 2KMMA 2IPKD 1XQQA 4ZRIA 4BKTA 3H9DA 3H7PB 3UQBA 1PGXA 2ZVNA 2KZRA 3AM9A 4IG7B 2LZ6A 4RGOS 4IWQA 4JWSC 1JRPA 2CJNA 2RMMA 2DYOA 1WRIA 4HPMB 1E8ZA 2BT6A 2CS4A 3U2SC 5GXGB 3DHGC 2KFJA 1TZOA 1WYGA 2TSSA 1JALA 2WX1A 1V80A 2G1EA 2L05A 2KHWB 1JWSD 2AQ1B 5IOIA 4FADA 3DQVA 2JX5A 4EE2A 4HPLB 4TMAB 2RDGA 1T0SC 2JXXA 1F52A 3OJ4B 1I4RA 1V86A 4P1BC 3KQ4A 1UD7A 3CWIA 3RFZB 2FIFA 4W9HA 5KHQA 3IT4B 3GZNB 1GG3A 1WX7A 3B08A 3W5VB 3A9KB 4C80A 4P7IA 1KLVA 4K3BA 4KIKA 4MDKE 3QJZA 5BYSA 2CU3A 1I42A 3R8BA 2R61A 4XE0A 4WJNA 2KC2A 1N63A 4IM3A 4OZCA 4PS7A 3KYDD 4HPPA 4XDCA 1UF0A 4GB9A 2B3AA 5LXIB 2RDBC 2AQ3B 4A9AA 3AXCA 4A20A 1ZDXA 3R2TA 3NVVA 2AL6A 2MJEA 4XC2A 2GI9A 2WDRB 3ZLZA 2C7NB 3CIRB 2NMQA 2KT7A 1N5XA 2PVOD 3W1YA 1N5WA 1L2NA 2N9XA 4MJSB 3L4PA 1KM7A 3N3KB 4FBJB 2IJ0A 2CHXA 3Q3OC 1WGDA 2AYOB 3ZNZB 3VRAB 4DHZE 5IO9A 1HZ6A 3DOWA 4FHJA 3ZIMA 4ZRJA 1I7HA 2VZKB 3DPDA 1WXMA 2W3SA 2KTRA 4OZAA 2ZCBA 1V1PA 3ZGZA 2GBJA 3I57A 2Y5CA 4BVUC 3HVDA 1UELA 1VLBA 4KGRA 2G4DB 1G6JA 4NJ7A 2W54A 5FK9C 4AUQC 4BKSA 2WDVB 3K9OB 4MH0E 1MG4A 3VTVA 1ET6A 1WXAA 4HCNB 4KKJA 1XXGA 2KN4A 1RWSA 1STEA 3BVMA 2NS5A 1XEEA 1FEHA 2LGIA 1WGRA 2JT4B 1BXTA 4M01A 1WE7A 5IKCM 4ICVA 1S3SG 3V62A 1JW9D 2LI5A 1JMLA 4HJKA 4LNKA 1L5PA 5EE1A 4W9KA 5L95C 1T0RC 2INNE 3VH3B 3ZNID 3DBHI 1P98A 2EELA 4I6LB 1Q10A 4W9IA 1C4CA 3IXSA 4ANVA 1J7CA 4OVVA 3SFEB 5IAAC 4DXAB 3W9CB 3MC8A 2BYEA 2BS4B 1GJZA 4HJGE 4BKGA 1EU4A 4KV2A 4JQWC 2NBUA 1D6EC 1KOTA 1E8WA 2SAKA 2O6VA 2WXOA 4KIKB 4NAWA 4QAYA 5BYRA 2QHOA 3M63B 2LXAA 2A5UA 4G11A 4ZRKA 4ANXA 2ZW1A 1AWDA 2LVQA 1VR9A 1YJIA 2NBVB 2D07B 1N6ZA 2M1MA 4M0WA 4MM3B 3C0RB 3T8MA 4PYUA 4GIVA 3V6CB 3NS1A 2Y3AA 2NCNA 3B9JA 1NBFC 1OQYA 5HHDG 1U4AA 4HWIB 4K81A 4EZLA 1MJDA 4ANWA 4BBNF 4RH6A 3AH7A 2N1WA 4P16A 4NQKE 1JQ4A 4DDGD 3TEXA 1SSNA 3RNBC 2BYVE 1QOGA 3KLSX 2ZVOA 3TL5A 4RMAA 4MEMA 4RGNA 2DHZA 1OQQA 3HRDD 1K52A 1C79A 3R7QA 2EKEC 3IAM1 2WLBA 1FXIA 1NYRA 1AN8A 3MHZA 1LM8B 2BKRB 1ISNA 5L83A 2LJIA 4KDIC 3VUYA 2SEBD 1SF0A 3QC8B 4YWGG 3Q8EA 3AE6B 1FXAA 3AI5A 4GOCA 4HXDA 2N4FA 2WXRA 4JWUC 2K8BA 4YSZB 1UUPA 3CSFA 4F8CB 3WAPA 2PPHA 3Q8AA 5JHBA 3KUDB 1TS5A 4LK0M 2KLCA 5DCNA 3QA8A 3HIZA 3SR6A 3U52E 3HVZA 1GAQB 1NVID 4WH4A 1EWYC 1MI0A 2KXJA 1J7AA 3PTFC 4BFRA 4IOIE 3WCQA 1WX8A 4K3CA 4I6NB 1LXDA 1ZE3D 3K9PB 4WQOB 3AN1A 1HXYD 1I4PA 4J6IA 4W9FA 2KO3A 2OJRA 1FPYA 1WH3A 2IY1B 1ZW7A 3EFUA 3RNGC 5CHWA 2W3RA 4WAAA 1VZ8A 2I2YA 4OVZA 1ESFA 1HEZE 2YEPF 1J7BA 5DPRA 3PS6A 2KJ6A 3ML8A 1TS2A 1KLUD 4EEWA 1R4MB 2LGSA 3RNEC 4K7WA 5GMVA 3EA6A 1WJNA 2IZVB 2N7DA 1FCLA 4S0RA 2DZIA 4WWOA 2KDEB 2RDHA 3ETRA 4URKA 3U7DA 4IM2A 4LDTD 2NVUI 5D94A 3Q3MC 3DVGX 3EHVA 1WMHB 3WANA 2J0JA 2KJHB 5AEKB 3AE7B 1WXSA 2N1VA 2RD0A 4B95A 4GDLA 1CK1A 3RD2A 1EF1A 3L54A 4S17A 1H8CA 2FUG1 3EGRA 4DDID 2KVZA 1L4ZB 3AEDB 1D5XC 1IPGA 3DHIC 4NPNA 5E6PA 3KUCB 3O13A 2PTLA 4JX1C 4H2AA 2KC1A 3AECB 1C3TA 4FJZA 1RFAA 3DHHC 2RGFA 2DZJA 1V9JA 3PRMB 2KTFA 3UI3A 2XBBC 1F0ZA 1ENFA 4WWMA 2GOWA 1L0XB 4ITKA 2PE6B 4JGHB 3VAWA 4W9EA 5J17A 3E56A 2Z8LA 2DBYA 1Z5SB 3W2DA 3I63C 1VD2A 3NS8A 4GMVA 3B2FA 1GC7A 2AQ2B 2INCC 2BYTA 2LJ5A 2LRUA 2AWTA 2JU6X 1GNUA 2DZKA 3OG5A 4W9CA 1ZP0B 2JQRB 2WDTB 4J3OD 2IO1B 2D3BA 1WSPA 3QWZB 2JY6A 3IFWB 2B76B 4E71A 5CHFA 3AMZA 2KWUB 4ZHOA 5MPOA 5BO4B 3KWVA 4WJQA 3S2AA 1P3QU 3L13A 4PT5A 1C78A 2L0TA 3PO0A 2C9WB 3GZNI 4B6WA 1WWTA 3RPFC 3WIMA 4RM9A 3A9JA 4DQOC 2DX5B 4A6QA 3PZ7A 1XLOA 5CX3A 1TYGB 3QHTA 4GDKB 4OHJA 3EECA 3GE3C 4US8A 3WALA 2L0FA 1QOFA 1KRHA 2WXLA 3E9SA 2J42A 3AE1B 1R4NB 2LEKA 3BVZA 3ML9A 3X0WA 4A3OA 2JRIB 2DENB 3BINA 3URYA 2GRIA 1NI2A 2M56B 4R3DA 4GDLB 1H7WA 4KKIA 1ZOYB 3PLUA 3L16A 1FRRA 5BMIA 2DLBA 2UYZB 2LHDA 2AEHA 3UF8A 4A8XC 2HJ8A 5J2RA 3IT6B 1D5MC 3PHWB 2I38A 1V5OA 1TY2A 2QJLA 5C23A 2MRPA 3NVWA 4I6PA 2CKHB 2L8JA 3QK0A 2JSVX 2V3NA 1E6EB 3SHQA 3LB8C 3PREA 4EFOA 2KX0A 1XLNA 2K5PA 2G45B 1FCCC 4F7ZA 2M4NA 3RNAC 4IM0A 3UIOB 2BB5A 2JPHA 3R2IA 3KVFB 4JE3B 4TSSA 3HHMA 1QT9A 3NZ3A 4GLSC 1V2YA 2J53A 1GC6A 1K51A 2ZEQA 3VHTC 1ZKHA 2IY0B 1SJED 1L0VB 4JPSA 1TZ1A 3Q8FA 4W9GA 3KH0A 2ON8A 3VVWB 3UIPB 3OJ3A 2WXQA 4IKGA 1WGHA 4HROA 3NY5A 1MHHE 1VZ7A 1WXQA 1I4GA 4NJ6A 4FA6A 4LJOB 2X38A 1JROA 4LNNA 5G5GA 3VH4B 2MBQA 4ICUA 2ASQA 5TSSA 3R66C
chains in the Genus database with same CATH topology
1HA5A 2WXOA 2H89B 1YJJA 4WURA 1N60A 2NTSA 2WS3B 5BYRA 2YEPB 2GB1A 4YT0B 1F2RI 2IGGA 3FILB 4RNAA 3P4RB 1ZXIA 2ZW1A 1YNTE 1AWDA 1BMLC 4C7ZA 1FO4A 4MACA 1VR9A 3MJ5A 2INPE 1CJEA 3AE8B 1KFYB 4YSYB 4XWWA 2QSDA 1YJIA 3LYYA 2M19A 1XCQL 5C2TB 4M0WA 1PGBA 4FXCA 4MM3B 4RF0A 2PLPA 1NENB 4ARIA 1T3QA 3NS1A 2Y3AA 4C7YA 1IUEA 3I9V1 1A70A 3B9JA 1OQRA 2QILA 5HHDG 4D2KA 3AEBB 2WP9B 1MVKA 2KDMA 1GB4A 4YTNB 3FILA 3BZDB 5D3IB 4XWTA 4AQ7A 4RH6A 2KQ4X 1TS3A 3AH7A 1SE2A 4P16A 2DYMA 2WU2B 3AE4B 2ICIA 5BYQA 1KH0A 1YN4A 1JQ4A 3V3XA 2CJOA 2OHFA 4L2YA 3ZJTA 1IBXB 2KACA 1DGJA 4YTMB 3TEXA 1AYFA 2E6XA 1SSNA 1QOGA 1PGAA 3KLSX 4N58A 4KGSA 1VJKA 2K9XA 1T5XD 3IAS1 1YQ3B 3NVYA 2WXHA 5H92C 2ACZB 2FBWB 1NYQA 2J4XA 1V1OA 1H7XA 4RGNA 2N9KA 3DWMA 1OQQA 2NTTA 2WXIA 3HRDD 1K52A 1C79A 1L4DB 1GTHA 3IAM1 2WLBA 1FXIA 5HI1A 2BB6A 1QF6A 2JXTA 1C4PA 2WDQB 1NYRA 2KWDA 1AN8A 1Y56A 3MHZA 1JWUD 1QLBB 2L52A 1R7SA 4OZBA 3P4QB 1P7FA 2LJIA 5D7GA 1HZ5A 2VZKD 5EE3A 1D4BA 2SEBD 1SF0A 1GB1A 1F2RC 4YWGG 3AE3B 3Q8EA 3FAHA 3BK1A 3AE6B 1FXAA 3CF4A 3BIID 5EE9A 1XLPA 1JWAD 2L32A 1UNSA 1C76A 1QOBA 2WXPA 2WXRA 4JWUC 4YSZB 1UUPA 1FMAD 1E10A 3P4PB 1T6BX 2K0PA 4YXDB 5FR3A 1DOXA 3BVGA 1IGCA 3Q8AA 1ZDVA 1K50A 1RYJA 3OWEB 2ZW0A 3NVZA 4ZHPA 1TS5A 4LK0M 1PDXA 1MPEA 5BMGA 1OFFA 2V0GA 3TEWA 2BBCA 4LTUA 1UWMA 1SBBB 4A55A 4UDUC 2K3UA 2RPVA 2IGHA 3SR6A 4AS1A 3U52E 1ZPSA 3HVZA 4YTPB 1GAQB 2J52A 2KAJA 1N61A 1NVID 4WH4A 1EWYC 3PZ8A 3AE2B 1YQ4B 4RGMA 1MI0A 3AE9B 1J7AA 3BK2A 1V97A 2N9LA 4IOIE 1IBXA 1TJEA 3WCQA 4XDDA 5HG2A 2W55A 5D3DA 3SEBA 4N6EB 3GP7A 4TQ0A 1ZE3D 4N59A 1FFVA 1BUIC 4KX6B 3TSSA 2LUMA 1L6VA 3AN1A 3HUIA 3MFGA 1FM0D 1HXYD 2JWUA 1I4PA 3P1MA 5FKAC 1XLQA 4MH8A 4REZA 1FFUA 5BMHA 1VDVA 4A90A 2JYEA 1PFDA 2MJDA 3MP9A 1SJHD 3U7ZA 1C9FA 1IGDA 5JXVA 4RFBA 2L83A 1B9RA 2W3RA 4Q2JA 2WXGA 1VZ8A 2BTEA 2PKOA 1AW7A 2I2YA 1UGJA 1K53A 4OVZA 5HFYA 1ESFA 1QILA 1HEZE 2YEPF 1TKGA 2WXNA 1QOAA 1J7BA 2LHEA 3TEZA 1JWMD 1TS2A 1KLUD 3GS2A 1E0ZA 3ABVB 3FC4A 1B1ZA 4P6VF 1YN5A 3AEFB 4HKQA 1I4QA 3EA6A 5G5HA 2WU5B 1PYWD 4NAWB 1VRAB 1M4VA 5C3JB 4ARCA 1FCLA 2ONQA 2AX5A 4HEA1 2RDHA 3ETRA 2HDEA 2MEKA 1EU3A 2WNMA 1SXTA 3T3NA 2KMMA 1TKYA 4NJCA 2JZPA 1KTKA 2IPKD 1RM6C 1MHXA 2N0SB 3AE7B 1FNUA 2Q5WD 1PGXA 3AM9A 2WXJA 1CK1A 1XO3A 1TY0A 4RGOS 2FUG1 4JWSC 3EGRA 2PIAA 4DXFA 1L4ZB 1JRPA 2CJNA 2RMMA 1HQRD 3Q8BA 3AEDB 2DYOA 1WRIA 1D5XC 2BS2B 2BT6A 1SE3A 1JWBD 3O13A 4WAFA 2PTLA 4JX1C 3AE5B 4H2AA 3U2SC 5GXGB 3DWGC 1TZOA 1TS4A 3J9CA 3AECB 1WYGA 2TSSA 3AV8A 3W5UB 3NUHB 3TEYA 1JALA 4US9A 1JCKB 4RGTA 2G1EA 4B0MA 2QIEB 3AB5A 1RFKA 3KWLA 1GT8A 4ZRPA 2WXFA 1NEKB 1CQVA 3ZJVA 5T8IA 3UI3A 2V3PA 3T3OA 1F0ZA 1ENFA 1JWSD 2AQ1B 3EUB2 1KF6B 4YSXB 2M0AA 5AUIA 2LMCA 1E7PB 4WWMA 2EKIA 2JX5A 4EE2A 2W82A 5LNK1 1L0XB 1C4AA 4ITKA 4TMAB 2RDGA 2DWQA 2MJ3A 1KLGD 3NRZA 4TQ1A 3E56A 2Z8LA 1NI3A 2DBYA 1VZ6A 2XNAC 3W2DA 5I4DA 1I4RA 3B2FA 3KQ4A 2AQ2B 3Q69A 2BYTA 3CWIA 3RFZB 3BYTB 1V1PB 2JU6X 2PW9A 4WIPA 1ZP0B 1L6UA 3IT4B 2JQRB 5H8YE 3W5VB 1GPXA 3P63A 4J3OD 4C80A 3W1SA 2BW2A 1WSPA 1TKEA 2B76B 3AMZA 5BYSA 2CU3A 1D5ZC 4ZHOA 5MPOA 3R8BA 2R61A 4XE0A 3TUOA 3KWVA 4PT5A 3Q8CA 1N63A 1ZUD2 1C78A 5EE0A 3PO0A 4OZCA 4B0EA 1ET9A 1SIJA 1WWTA 1F77A 1P7EA 4XDCA 1FNVA 3RPFC 3VR9B 3U4EG 4DXGA 3BWUD 2BS3B 1EM7A 2QEJC 4NAMA 2HTME 4DQOC 4ZOHC 2AQ3B 3V05A 4CQNA 4IDIA 4A9AA 1SB3C 5E6JA 4A6QA 1DYQA 3SFDB 1ZDXA 1V8CA 3R2TA 3NVVA 3PZ7A 1XLOA 3P4SB 2MJEA 2PMVA 3VQIA 3VRBB 2GI9A 4LLGM 2Y5PA 1FIQA 2WDRB 1L0YB 2MH7A 5AUKA 1TYGB 3CIRB 2NMQA 4GDKB 1N5XA 2PVOD 4OHJA 1N5WA 4US8A 3L4PA 1QOFA 1C77A 4L1BA 1KRHA 2WXLA 1PUTA 2IJ0A 3AEAB 3VR8B 2D5GA 2J42A 3E9SA 4O1NA 3AE1B 2LEKA 1YN3A 3BVZA 3VRAB 2WXMA 2IGDA 2L1AA 3URYA 2OEDA 2GRIA 3ZYYX 2M56B 4GDLB 4KKIA 1H7WA 4R3DA 3GB1A 1E9MA 1ZOYB 1HZ6A 1FRRA 2PVGC 5BMIA 2DLBA 2XN9C 2LHDA 3H8HA 4A8XC 2WXKA 3MC0B 3IT6B 1I7HA 4RF1A 1D5MC 2VZKB 1XF5L 2I38A 2W3SA 1FNWA 1FD6A 1TY2A 2QJLA 4OZAA 4C56C 1GTEA 1XCTL 1V1PA 1ACCA 3NVWA 1DOIA 3I57A 3ZGZA 4WQMA 2Y5CA 3HVDA 2K22A 4ZRQA 2JSVX 1SE4A 1VLBA 2V3NA 4HRSA 4KGRA 1I4XA 1E6EB 2E3TA 3LB8C 2W54A 5FK9C 2V4IB 4RCOA 1XLNA 2K5PA 1FCCC 1GOZA 4NZLB 2WDVB 1FRDA 1ET6A 3ZQ4A 2BB5A 4KKJA 4ZYSA 1XXGA 3ZJUA 2KN4A 1RWSA 1STEA 3BVMA 3R2IA 4KGTA 4HKZE 1XEEA 4JE3B 4TSSA 1QT9A 1UWXA 1FEHA 1EWCA 2LGIA 3NZ3A 1ZXHA 3P42A 4GLSC 2J53A 1K51A 1BXTA 2QMTA 3AEEB 1SJED 1L0VB 1WGKA 4JPSA 1ROEA 1LO5D 1JW9D 3N9YC 1JMLA 3BYYB 3Q8FA 1L5PA 5EE1A 1YMHE 3B2GA 2ON8A 3LXFA 2INNE 4USAA 2IDYA 2EELA 2WXQA 2LFIA 4IKGA 4HROA 2WQYB 4MT5A 3AEGB 1Q10A 1C4CA 3C8YA 3IXSA 1MHHE 1VZ7A 1WXQA 1I4GA 2FE8A 4L23A 1J7CA 3SFEB 2X38A 1JROA 1SEBD 1DOYA 1I4HA 3W9CB 1N62A 2BS4B 2G9HD 5G5GA 2N7JA 4HJGE 1EU4A 2JYTA 5TSSA 1CZPA 1QKZA 1D6EC 1QQRA 2SAKA 2H88B 4OW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E10 A;  1JRP A;  2H89 B;  1PUT A;  3AEA B;  3P4P B;  3VR8 B;  1YJJ A;  4YXD B;  3AED B;  2CJN A;  1DOX A;  1WRI A;  3AE1 B;  2LEK A;  1N60 A;  2BS2 B;  2WS3 B;  2BT6 A;  1RYJ A;  3VRA B;  3NVZ A;  1JWB D;  4YT0 B;  4JX1 C;  3AE5 B;  4ZHP A;  1PDX A;  1OFF A;  5GXG B;  3ZYY X;  3DWG C;  4LTU A;  1UWM A;  2M56 B;  1H7W A;  3AEC B;  1E9M A;  1ZOY B;  3P4R B;  1ZXI A;  1WYG A;  1FRR A;  1AWD A;  2PVG C;  3AV8 A;  3W5U B;  4C7Z A;  3SR6 A;  1FO4 A;  3P1M A;  3HVZ A;  4YTP B;  1JAL A;  1GAQ B;  2KAJ A;  1CJE A;  1N61 A;  1NVI D;  3AE8 B;  1KFY B;  4YSY B;  1EWY C;  3AE2 B;  1I7H A;  1YQ4 B;  4US9 A;  1YJI A;  3AE9 B;  2G1E A;  1J7A A;  2QIE B;  3AB5 A;  2W3S A;  1RFK A;  3KWL A;  1GT8 A;  1V97 A;  2M19 A;  2QJL A;  5C2T B;  1TJE A;  3WCQ A;  1GTE A;  4FXC A;  1NEK B;  2W55 A;  3NVW A;  1DOI A;  4N6E B;  4WQM A;  2Y5C A;  1F0Z A;  4N59 A;  1FFV A;  1NEN B;  2K22 A;  3EUB 2;  1KF6 B;  4YSX B;  4KX6 B;  1T3Q A;  3AN1 A;  1E7P B;  1L6V A;  3HUI A;  3NS1 A;  4WWM A;  1IUE A;  4C7Y A;  2EKI A;  1FM0 D;  2JX5 A;  1VLB A;  4HRS A;  1A70 A;  4ITK A;  1E6E B;  2E3T A;  3B9J A;  1OQR A;  2DWQ A;  2MJ3 A;  2W54 A;  1XLQ A;  3LB8 C;  3NRZ A;  1XLN A;  1FFU A;  1NI3 A;  2DBY A;  2K5P A;  3AEB B;  2WP9 B;  1VDV A;  2WDV B;  1FRD A;  4YTN B;  3B2F A;  1PFD A;  2MJD A;  3CWI A;  3AH7 A;  2WU2 B;  3AE4 B;  2L83 A;  1B9R A;  2W3R A;  1ZP0 B;  1L6U A;  2JQR B;  1JQ4 A;  5H8Y E;  2CJO A;  2OHF A;  3W5V B;  1RWS A;  1GPX A;  3P63 A;  4C80 A;  1DGJ A;  4YTM B;  2PKO A;  1AYF A;  1QT9 A;  1TKE A;  1QOG A;  2B76 B;  3AMZ A;  4N58 A;  2CU3 A;  1TKG A;  1QOA A;  4ZHO A;  1VJK A;  2K9X A;  5MPO A;  1J7B A;  3AEE B;  1YQ3 B;  1L0V B;  3NVY A;  1WGK A;  5H92 C;  2ACZ B;  2FBW B;  1ROE A;  1N63 A;  1NYQ A;  1JW9 D;  1ZUD 2;  1H7X A;  1E0Z A;  3DWM A;  3ABV B;  1OQQ A;  5AUI A;  3FC4 A;  3PO0 A;  1L5P A;  4P6V F;  3HRD D;  5EE1 A;  3AEF B;  5EE0 A;  3B2G A;  1GTH A;  1SIJ A;  1WWT A;  2WLB A;  5G5H A;  1FXI A;  3LXF A;  2WU5 B;  4USA A;  1QF6 A;  3RPF C;  3VR9 B;  2WDQ B;  2BS3 B;  1NYR A;  5C3J B;  2AX5 A;  2HTM E;  4HRO A;  3ETR A;  4ZOH C;  2WQY B;  3AEG B;  1QLB B;  2L52 A;  1R7S A;  3P4Q B;  4IDI A;  1WXQ A;  4A9A A;  1SB3 C;  2KMM A;  1J7C A;  5EE3 A;  1TKY A;  3SFE B;  1JRO A;  1SF0 A;  3SFD B;  1DOY A;  3W9C B;  3AE3 B;  1V8C A;  1RM6 C;  1N62 A;  3FAH A;  1XLO A;  3P4S B;  2BS4 B;  2MJE A;  3AE6 B;  1FXA A;  2N0S B;  3NVV A;  3CF4 A;  3BII D;  3VRB B;  5G5G A;  3AE7 B;  1FIQ A;  2WDR B;  2Q5W D;  5EE9 A;  1XLP A;  1JWA D;  2MH7 A;  3AM9 A;  1XO3 A;  5AUK A;  1QOB A;  3CIR B;  1TYG B;  1N5X A;  2PVO D;  1N5W A;  4US8 A;  1CZP A;  4JWU C;  4JWS C;  4YSZ B;  1QOF A;  3L4P A;  2PIA A;  1FMA D;  2H88 B;  1KRH A; 
#chains in the Genus database with same CATH topology
 1HA5 A;  1SGH A;  1YJJ A;  4LNF A;  3RZF A;  4WUR A;  3N32 A;  1Q1O A;  3ZO5 B;  2AL3 A;  2UWQ A;  2REX A;  4M8N A;  2YEP B;  2L3Z A;  4AJY B;  3TBL D;  2QCZ A;  2BQQ A;  3P4R B;  4DHJ B;  3M3J A;  4WWN A;  3APD A;  3VFK A;  2YLM A;  1CJE A;  4YSY B;  2I1K A;  1M94 A;  3TMP B;  2QSD A;  4ZDV A;  2D10 A;  3LYY A;  5G2N A;  1R4M I;  2KX3 A;  2BGF A;  4HK2 A;  1XCQ L;  1PGB A;  4FXC A;  2K6D B;  2PLP A;  4ARI A;  1T3Q A;  4NQL B;  3MTN B;  4C7Y A;  3HM3 A;  1A70 A;  1V81 A;  2QIL A;  3MC9 A;  4GSW A;  4D2K A;  2KDM A;  4XGA B;  4YTN B;  4HLE A;  3GOE A;  3JSV B;  1SE2 A;  2KK8 A;  3MHS D;  5D6J B;  2MBE A;  2WU2 B;  3AE4 B;  2ICI A;  3A9J B;  1KH0 A;  1TGZ B;  2M8S A;  2CJO A;  2OHF A;  4L2Y A;  1IP9 A;  2MWS B;  3CF6 E;  2KAC A;  1AYF A;  2I1J A;  1VJK A;  4HDO A;  1YQ3 B;  3NVY A;  2FBW B;  4KSL C;  1NYQ A;  3ECI A;  3DWM A;  5D2M B;  3LDZ E;  2K6Q A;  3DCG A;  3A1Q B;  4GU2 A;  1RLF A;  3Q3J A;  1H4R A;  1Y56 A;  2QC8 A;  2MHJ A;  1QLB B;  2L52 A;  3P4Q B;  3RNF C;  1HZ5 A;  2KDI A;  2VZK D;  5EE3 A;  1D4B A;  1FXT B;  4NNJ B;  3CF4 A;  3BII D;  1F9J A;  3R3M A;  1D3Z A;  1UNS A;  1C76 A;  2HE7 A;  2WXP A;  5TR5 A;  2JZ3 B;  3P4P B;  1E7V A;  1UH6 A;  1ZDV A;  1K50 A;  2ZW0 A;  2KJR A;  4ZHP A;  3I5J C;  5J18 A;  3TEW A;  3QCA A;  1T0Q C;  2BBC A;  3AU4 A;  3MJW A;  4UDU C;  2KQS A;  1ZPS A;  4YTP B;  4HVB A;  3SDL C;  4MGI E;  1V97 A;  1IYF A;  4DWF A;  1IBX A;  1E8X A;  5HG2 A;  5D3D A;  4MJS A;  3SEB A;  1BUI C;  4KX6 B;  2JWU A;  2O2V B;  1XLQ A;  4B9K A;  2BKF A;  1WI0 A;  3HK0 A;  1UBI A;  3PPA A;  4A90 A;  1PFD A;  1P9D U;  2MJD A;  1SJH D;  2FCM A;  3U7Z A;  1IGD A;  1C9F A;  5JXV A;  1EF5 A;  4FJY A;  1B9R A;  2K8H A;  2M0X A;  4XYC A;  1SE9 A;  2OOB B;  3N30 A;  2KN5 A;  3H7S A;  1QIL A;  2PEA A;  2WXN A;  1QOA A;  1UGM A;  5LXH A;  1F1H A;  4EZK A;  2FID A;  3ZTD A;  3AEF B;  5G55 A;  2XK5 A;  5AZH A;  1OTR B;  1VRA B;  3A4S C;  5C3J B;  2ONQ A;  2AX5 A;  3KUZ A;  2MEK A;  3ZUN A;  1TBE A;  4GDK A;  2JZP A;  1KTK A;  4W9J A;  2DNF A;  1RM6 C;  2GBN A;  3ZXV A;  1NDD A;  2D3G A;  2Q5W D;  2FNJ B;  2WXJ A;  1XO3 A;  4II2 B;  3SD5 A;  3Q6B A;  1WJ4 A;  4DK5 A;  4XZ4 A;  1Q0W B;  2BS2 B;  4IC7 B;  1L7Y A;  4CYE A;  1JWB D;  2N9E B;  4FJV B;  3AE5 B;  3ZVV A;  3DWG C;  4LNI A;  4TKN A;  5IA7 A;  3I3T B;  3NUH B;  1WZ0 A;  3RMK C;  3TEY A;  2V1Y A;  2D11 A;  1WGY A;  1JCK B;  4RGT A;  1XT9 B;  2NPT B;  2FCS A;  2QIE B;  3AB5 A;  1RFK A;  4ZRP A;  3PZD A;  1LQB A;  1CQV A;  5T8I A;  2V3P A;  3T3O A;  3NZU A;  1S1Q B;  1KF6 B;  5AUI A;  3W1S C;  4F1S A;  1E7P B;  1I35 A;  1BT0 A;  2YVC A;  4C4V A;  3VXW A;  2DWQ A;  4MSQ B;  2MQJ A;  2KFK A;  5JHA A;  5I4D A;  1VCB A;  3ZDM C;  2BWF A;  2KYW A;  4TV3 A;  2ZZP B;  3PLV A;  4LNO A;  5H8Y E;  2KTR B;  3P63 A;  3RI7 C;  3W1S A;  2EMS A;  3Q2A C;  3U8Z A;  4EZJ A;  1T0Y A;  2HTH A;  3TUO A;  3L17 A;  3Q8C A;  1ZUD 2;  3O65 B;  4II3 B;  2JZZ A;  5IP4 D;  1SIJ A;  2KFK B;  1F77 A;  1P7E A;  1FNV A;  2KOX A;  3VR9 B;  2L76 A;  2MA9 B;  4DXG A;  1E90 A;  2HTM E;  1WM2 A;  3X23 A;  2WHI A;  2L7R A;  3V05 A;  4CQN A;  4IDI A;  5E6J A;  1DYQ A;  3SFD B;  1P0R A;  3WAM A;  3APF A;  2VRR B;  3VRB B;  4M00 A;  5E6O A;  4M8M A;  2Y5P A;  1FIQ A;  1L0Y B;  2MLB A;  5AUK A;  1WMH A;  4WJP A;  2O6V D;  1WJU A;  2LGD A;  2GLS A;  2R2O A;  1C77 A;  4L1B A;  3AEA B;  2K8C A;  4HCP B;  2A4Z A;  2HJ1 A;  4LCD E;  4JIO U;  2JVC A;  2LAS A;  1E9M A;  2XN9 C;  3JSV A;  1V49 A;  3D32 A;  3H8H A;  2PE9 A;  2VH1 A;  2KQ7 A;  2V3S A;  1XF5 L;  4PS8 A;  3N1X C;  2NR2 A;  1FNW A;  1FD6 A;  4BZA A;  1XCT L;  2K22 A;  3ZDT A;  4ZRQ A;  1SE4 A;  4FUL A;  4HRS A;  1I4X A;  2E3T A;  2K1F A;  4RCO A;  4C00 A;  1FRD A;  1Q5W B;  4BOS C;  3RUL A;  4K7U A;  3ZQ4 A;  1YD8 U;  1WIA A;  2LRW A;  4G0N B;  3C19 A;  2XEW A;  2DAF A;  3ZJU A;  5AZF A;  4KGT A;  4HKZ E;  1CMX B;  4GN1 A;  2QMT A;  3VTU A;  1WY8 A;  4MGK E;  3BYY B;  4CO7 A;  3B0A A;  1YMH E;  3NG0 A;  3T9L A;  3NHE B;  4CHK A;  2JUO A;  2LVP A;  4MT5 A;  3AEG B;  2HD5 B;  1SEB D;  3DBR B;  2NPT A;  2G9H D;  4WJO A;  3Q3F A;  3QAQ A;  3KYC D;  5EDS A;  2WGS A;  1QQR A;  3ALB A;  3OLM D;  2KLG A;  4W9L A;  3PGE A;  1N60 A;  2NTS A;  4MGZ E;  1WYW B;  2ZNV C;  2GB1 A;  3DVN V;  4YT0 B;  2IYD B;  2J7Q B;  2IGG A;  2LGY A;  3FIL B;  3QAR A;  4IWO A;  2LUE A;  1ZXI A;  4MEL A;  3AUL A;  4MAC A;  3MJ5 A;  2INP E;  1KFY B;  3A9K A;  4XWW A;  3CMM B;  5C2T B;  3RZW C;  1IUE A;  3EFC A;  5LLI A;  4E3C A;  1QZE A;  3FIL A;  4XWT A;  2KQ4 X;  2DAJ A;  1EUV B;  1MFW A;  2DYM A;  1RRB A;  1WE6 A;  3ZJT A;  2R2Q A;  2E6X A;  3APC A;  1PGA A;  2K9X A;  4PK1 A;  1T5X D;  3IAS 1;  5H92 C;  2ACZ B;  1V1O A;  2ZPY A;  3BY4 B;  2N9K A;  2WXI A;  4FN2 A;  2LXC A;  2BB6 A;  1QF6 A;  2JXT A;  2WDQ B;  2KWD A;  4G3X B;  1JWU D;  2KDB A;  3DBS A;  4OZB A;  5D7G A;  1P7F A;  2MP2 A;  2CU1 A;  4K7S A;  3NZS A;  3AE3 B;  3FAH A;  5DPT A;  2WYQ A;  3BK1 A;  5EE9 A;  1XLP A;  1QOB A;  1TT5 B;  4JLC A;  1FMA D;  2IO0 B;  3IBE A;  1T6B X;  4YXD B;  1GUA B;  1RYJ A;  3OWE B;  4IUM B;  3NVZ A;  2KDF B;  5BMG A;  1PDX A;  1MPE A;  2FCQ A;  4LTU A;  1UWM A;  2BWE S;  1SBB B;  3QX1 A;  4EKU A;  2IGH A;  1YX5 B;  3JVZ X;  3V6E B;  2BPS A;  3AE2 B;  1YQ4 B;  3UGB B;  2MBB B;  2MP2 B;  2N9L A;  3CST A;  1TJE A;  2BYF A;  2KNB A;  4N6E B;  3GP7 A;  4LDT B;  3A1Q A;  3AU5 A;  5HKH A;  1L6V A;  3HUI A;  1FM0 D;  4RM8 A;  4REZ A;  1FFU A;  5BMH A;  1HE8 A;  1VDV A;  3DVN U;  1WXV A;  3VUW A;  3MP9 A;  4RFB A;  4ZYN A;  3PRZ A;  5HFY A;  4WWP A;  2LHE A;  3TEZ A;  3GS2 A;  1OEY J;  3OAW A;  4X57 B;  3L08 A;  2J0K A;  3FC4 A;  4P6V F;  5IN7 A;  4IW0 A;  5G5H A;  4NAW B;  3RCZ A;  1M4V A;  4ARC A;  5C1Z A;  4FHK A;  1E7U A;  3NOB A;  2K25 A;  1TTN A;  1TKY A;  3A33 B;  4NJC A;  4EUT A;  1E5W A;  3TJP A;  1MHX A;  2N0S B;  4GGQ A;  1FNU A;  2X8X X;  2Y5B B;  5DPW A;  1TY0 A;  1E8Y A;  2PIA A;  4DXF A;  3VDZ A;  3RT3 B;  1HQR D;  3Q8B A;  4M02 A;  3Q3N C;  3ONS A;  2PJH A;  4BAX A;  1SE3 A;  2OJW A;  3P2B A;  1YJ1 A;  4WAF A;  4JL9 A;  3QIJ A;  1TS4 A;  3J9C A;  4TUU A;  3AV8 A;  3RN9 C;  3W5U B;  3DBH B;  2DYB A;  2ZJD A;  1RAX A;  4US9 A;  1R4N I;  1EO6 A;  4B0M A;  3KWL A;  2KVR A;  4G50 A;  1GT8 A;  2D3C A;  2MX2 A;  2WXF A;  1WM3 A;  1NEK B;  3ZJV A;  3SU8 X;  2JRH A;  2GBK A;  2M0A A;  4YSX B;  2N9P C;  3EUB 2;  2LMC A;  2EKI A;  5LNK 1;  2CHZ A;  2W82 A;  2IND C;  1C4A A;  1OGW A;  2MJ3 A;  1KLG D;  3NRZ A;  4TQ1 A;  1NI3 A;  5FR6 A;  1VZ6 A;  2XNA C;  3L10 B;  4N9F 4;  3Q69 A;  3DBR I;  2FAZ A;  3BYT B;  1V1P B;  3PV1 A;  5JZE B;  2PW9 A;  1KJT A;  4WIP A;  1L6U A;  2RPQ A;  1AAR A;  1GPX A;  2W9N A;  3N20 C;  2Z0E B;  2BW2 A;  1WGG A;  1TKE A;  3TIX A;  3PRP B;  1D5Z C;  4AOF A;  1XD3 B;  3RYT A;  3VTW A;  3VUX A;  4A3P A;  5EE0 A;  4B0E A;  1ET9 A;  4KVG B;  3U4E G;  2KKC A;  4ASW C;  3BWU D;  3GE8 C;  2BS3 B;  1EM7 A;  2QEJ C;  4NAM A;  2Z0D B;  4ZOH C;  2IBI B;  3N1Y C;  1SB3 C;  2WX0 A;  4AWJ A;  2KMA A;  2N7E A;  1V8C A;  3P4S B;  2PMV A;  2BVC A;  3VQI A;  2M17 A;  4LLG M;  3B1L X;  4GXB A;  3EC8 A;  2MH7 A;  2C7M B;  4M0W B;  2Z59 B;  1PUT A;  3VR8 B;  2D5G A;  2MBH A;  4O1N A;  1UZX B;  1YN3 A;  3DDC B;  2WXM A;  2IGD A;  1JRU A;  2L1A A;  1HTQ A;  2OED A;  4AJW A;  3ZYY X;  4KZ0 A;  3GB1 A;  2QDF A;  4XX5 A;  2PVG C;  4KSK C;  1YX6 B;  1V6E A;  1A5R A;  2V9H A;  2WXK A;  4BOZ B;  3MC0 B;  2G3Q B;  4RF1 A;  3ENE A;  1C1Y B;  2LVO A;  1K8R B;  4C56 C;  1GTE A;  2UU7 A;  3IVF A;  1ACC A;  1MG8 A;  2CR5 A;  1DOI A;  4W9D A;  4E74 A;  4WQM A;  3UQA A;  2JF5 A;  4MM3 A;  3PHX B;  2V4I B;  3WAO A;  4DHZ B;  4NZL B;  1GOZ A;  2EMT A;  4C4V B;  3Q14 C;  3DVG Y;  2C7H A;  2KD0 A;  4ZYS A;  2D2Q A;  5E6N A;  1YOV B;  1UWX A;  2IO2 B;  1EWC A;  3PSE B;  3P42 A;  1ZXH A;  5JH5 C;  1Y8R C;  3JYU A;  3AEE B;  1WGK A;  1ROE A;  1LO5 D;  3N9Y C;  5KHO A;  2WWZ A;  4KDL B;  3B2G A;  3LXF A;  4KZC A;  4USA A;  2IDY A;  2KAN A;  3H1U A;  2LFI A;  1SIF A;  1YQB A;  3IHP C;  2WQY B;  5AZG A;  3C8Y A;  4DBG A;  2FE8 A;  4L23 A;  3ZRC A;  2BF8 B;  4LJP B;  1DOY A;  1I4H A;  2RSU A;  2V4L A;  1N62 A;  2MBO A;  3RNC C;  4BBN C;  2N7J A;  2D3A A;  2K39 A;  5CHV C;  2JYT A;  4P1C C;  3V61 A;  1CZP A;  1QKZ A;  2H88 B;  4OW0 A;  2H89 B;  3JW0 X;  4ANU A;  2WS3 B;  3M62 B;  3L0W B;  2FCN A;  1LFD A;  3TCA A;  1F2R I;  1Z2M A;  4RNA A;  1YNT E;  1BML C;  1WRD B;  4C7Z A;  1FO4 A;  4PYZ A;  2L00 B;  3AE8 B;  2J0M A;  3FKY A;  2M19 A;  3RUI B;  4RF0 A;  4AP4 C;  1NEN B;  4IWP A;  2C60 A;  3I9V 1;  3U30 A;  1OQR A;  3AEB B;  2WP9 B;  1MVK A;  1X1M A;  2LWP A;  1WZ3 A;  5DPS A;  1GB4 A;  3BZD B;  5D3I B;  4AQ7 A;  1TS3 A;  4BKS D;  3ZRF A;  5BYQ A;  1YN4 A;  3V3X A;  1IBX B;  1DGJ A;  4YTM B;  1J19 A;  2GBR A;  4N58 A;  2KMC A;  1V5T A;  1WX9 A;  1UBQ A;  4KGS A;  4YL8 A;  4PS3 A;  2WXH A;  3N1Z C;  4NY0 A;  4FLH A;  2J4X A;  1H7X A;  2NTT A;  2KWC A;  2O2V A;  1L4D B;  1GTH A;  5HI1 A;  2VH2 A;  3LJ3 A;  2ZCC A;  2GBM A;  1C4P A;  3KW5 B;  4MGY E;  1J0G A;  3IG3 A;  1R7S A;  4K1R B;  5CTR C;  1GB1 A;  2KWV B;  1F2R C;  2RR9 A;  4ACF A;  1JWA D;  2L32 A;  3DBL B;  3PT2 B;  1WJ6 A;  3M95 A;  2MSE D;  3QQ8 B;  1E10 A;  2XK5 B;  5FR3 A;  2K0P A;  1DOX A;  3BVG A;  1IGC A;  3V60 A;  2IO3 B;  3HM6 X;  4MSM B;  2O6V B;  1WF9 A;  1OFF A;  2V0G A;  3UIN B;  3H6N A;  1WR1 A;  4DHJ D;  2CHW A;  4A55 A;  2K3U A;  2RPV A;  1HTO A;  4AS1 A;  3ZNG C;  3ZXR A;  2J52 A;  2KAJ A;  1N61 A;  2DZM A;  2FUH B;  3PZ8 A;  4RGM A;  3AE9 B;  3BK2 A;  4XDD A;  2W55 A;  3NJT A;  4TQ0 A;  4HDQ A;  1FFV A;  1LGR A;  4N59 A;  1YIW A;  3TSS A;  2LUM A;  3H7P A;  3MFG A;  3DBL I;  4OVU A;  1PQS A;  3ZNH B;  3P1M A;  5FKA C;  4MH8 A;  3R7R A;  2ZPN A;  2LGX A;  1TIF A;  2JYE A;  2GMI C;  3PVL A;  2G4S A;  2L83 A;  4Q2J A;  2WXG A;  2NBW B;  2BTE A;  2PKO A;  3ZTC A;  1AW7 A;  1UGJ A;  2ZNV B;  1K53 A;  1TKG A;  3A4R A;  3ZKJ C;  1JWM D;  1WR6 E;  1OEY A;  3ZW3 A;  1WFY A;  2LD9 A;  1E0Z A;  3ABV B;  1P1A A;  1B1Z A;  1YN5 A;  4HKQ A;  1I4Q A;  2MCN B;  4EOY A;  1J8C A;  2WU5 B;  1PYW D;  2JWZ A;  1ZGU B;  2C5L C;  4HEA 1;  2MW5 A;  2HDE A;  3WA0 A;  1EU3 A;  2WNM A;  1SXT A;  3T3N A;  2KMM A;  2IPK D;  1XQQ A;  4ZRI A;  4BKT A;  3H9D A;  3H7P B;  3UQB A;  1PGX A;  2ZVN A;  2KZR A;  3AM9 A;  4IG7 B;  2LZ6 A;  4RGO S;  4IWQ A;  4JWS C;  1JRP A;  2CJN A;  2RMM A;  2DYO A;  1WRI A;  4HPM B;  1E8Z A;  2BT6 A;  2CS4 A;  3U2S C;  5GXG B;  3DHG C;  2KFJ A;  1TZO A;  1WYG A;  2TSS A;  1JAL A;  2WX1 A;  1V80 A;  2G1E A;  2L05 A;  2KHW B;  1JWS D;  2AQ1 B;  5IOI A;  4FAD A;  3DQV A;  2JX5 A;  4EE2 A;  4HPL B;  4TMA B;  2RDG A;  1T0S C;  2JXX A;  1F52 A;  3OJ4 B;  1I4R A;  1V86 A;  4P1B C;  3KQ4 A;  1UD7 A;  3CWI A;  3RFZ B;  2FIF A;  4W9H A;  5KHQ A;  3IT4 B;  3GZN B;  1GG3 A;  1WX7 A;  3B08 A;  3W5V B;  3A9K B;  4C80 A;  4P7I A;  1KLV A;  4K3B A;  4KIK A;  4MDK E;  3QJZ A;  5BYS A;  2CU3 A;  1I42 A;  3R8B A;  2R61 A;  4XE0 A;  4WJN A;  2KC2 A;  1N63 A;  4IM3 A;  4OZC A;  4PS7 A;  3KYD D;  4HPP A;  4XDC A;  1UF0 A;  4GB9 A;  2B3A A;  5LXI B;  2RDB C;  2AQ3 B;  4A9A A;  3AXC A;  4A20 A;  1ZDX A;  3R2T A;  3NVV A;  2AL6 A;  2MJE A;  4XC2 A;  2GI9 A;  2WDR B;  3ZLZ A;  2C7N B;  3CIR B;  2NMQ A;  2KT7 A;  1N5X A;  2PVO D;  3W1Y A;  1N5W A;  1L2N A;  2N9X A;  4MJS B;  3L4P A;  1KM7 A;  3N3K B;  4FBJ B;  2IJ0 A;  2CHX A;  3Q3O C;  1WGD A;  2AYO B;  3ZNZ B;  3VRA B;  4DHZ E;  5IO9 A;  1HZ6 A;  3DOW A;  4FHJ A;  3ZIM A;  4ZRJ A;  1I7H A;  2VZK B;  3DPD A;  1WXM A;  2W3S A;  2KTR A;  4OZA A;  2ZCB A;  1V1P A;  3ZGZ A;  2GBJ A;  3I57 A;  2Y5C A;  4BVU C;  3HVD A;  1UEL A;  1VLB A;  4KGR A;  2G4D B;  1G6J A;  4NJ7 A;  2W54 A;  5FK9 C;  4AUQ C;  4BKS A;  2WDV B;  3K9O B;  4MH0 E;  1MG4 A;  3VTV A;  1ET6 A;  1WXA A;  4HCN B;  4KKJ A;  1XXG A;  2KN4 A;  1RWS A;  1STE A;  3BVM A;  2NS5 A;  1XEE A;  1FEH A;  2LGI A;  1WGR A;  2JT4 B;  1BXT A;  4M01 A;  1WE7 A;  5IKC M;  4ICV A;  1S3S G;  3V62 A;  1JW9 D;  2LI5 A;  1JML A;  4HJK A;  4LNK A;  1L5P A;  5EE1 A;  4W9K A;  5L95 C;  1T0R C;  2INN E;  3VH3 B;  3ZNI D;  3DBH I;  1P98 A;  2EEL A;  4I6L B;  1Q10 A;  4W9I A;  1C4C A;  3IXS A;  4ANV A;  1J7C A;  4OVV A;  3SFE B;  5IAA C;  4DXA B;  3W9C B;  3MC8 A;  2BYE A;  2BS4 B;  1GJZ A;  4HJG E;  4BKG A;  1EU4 A;  4KV2 A;  4JQW C;  2NBU A;  1D6E C;  1KOT A;  1E8W A;  2SAK A;  2O6V A;  2WXO A;  4KIK B;  4NAW A;  4QAY A;  5BYR A;  2QHO A;  3M63 B;  2LXA A;  2A5U A;  4G11 A;  4ZRK A;  4ANX A;  2ZW1 A;  1AWD A;  2LVQ A;  1VR9 A;  1YJI A;  2NBV B;  2D07 B;  1N6Z A;  2M1M A;  4M0W A;  4MM3 B;  3C0R B;  3T8M A;  4PYU A;  4GIV A;  3V6C B;  3NS1 A;  2Y3A A;  2NCN A;  3B9J A;  1NBF C;  1OQY A;  5HHD G;  1U4A A;  4HWI B;  4K81 A;  4EZL A;  1MJD A;  4ANW A;  4BBN F;  4RH6 A;  3AH7 A;  2N1W A;  4P16 A;  4NQK E;  1JQ4 A;  4DDG D;  3TEX A;  1SSN A;  3RNB C;  2BYV E;  1QOG A;  3KLS X;  2ZVO A;  3TL5 A;  4RMA A;  4MEM A;  4RGN A;  2DHZ A;  1OQQ A;  3HRD D;  1K52 A;  1C79 A;  3R7Q A;  2EKE C;  3IAM 1;  2WLB A;  1FXI A;  1NYR A;  1AN8 A;  3MHZ A;  1LM8 B;  2BKR B;  1ISN A;  5L83 A;  2LJI A;  4KDI C;  3VUY A;  2SEB D;  1SF0 A;  3QC8 B;  4YWG G;  3Q8E A;  3AE6 B;  1FXA A;  3AI5 A;  4GOC A;  4HXD A;  2N4F A;  2WXR A;  4JWU C;  2K8B A;  4YSZ B;  1UUP A;  3CSF A;  4F8C B;  3WAP A;  2PPH A;  3Q8A A;  5JHB A;  3KUD B;  1TS5 A;  4LK0 M;  2KLC A;  5DCN A;  3QA8 A;  3HIZ A;  3SR6 A;  3U52 E;  3HVZ A;  1GAQ B;  1NVI D;  4WH4 A;  1EWY C;  1MI0 A;  2KXJ A;  1J7A A;  3PTF C;  4BFR A;  4IOI E;  3WCQ A;  1WX8 A;  4K3C A;  4I6N B;  1LXD A;  1ZE3 D;  3K9P B;  4WQO B;  3AN1 A;  1HXY D;  1I4P A;  4J6I A;  4W9F A;  2KO3 A;  2OJR A;  1FPY A;  1WH3 A;  2IY1 B;  1ZW7 A;  3EFU A;  3RNG C;  5CHW A;  2W3R A;  4WAA A;  1VZ8 A;  2I2Y A;  4OVZ A;  1ESF A;  1HEZ E;  2YEP F;  1J7B A;  5DPR A;  3PS6 A;  2KJ6 A;  3ML8 A;  1TS2 A;  1KLU D;  4EEW A;  1R4M B;  2LGS A;  3RNE C;  4K7W A;  5GMV A;  3EA6 A;  1WJN A;  2IZV B;  2N7D A;  1FCL A;  4S0R A;  2DZI A;  4WWO A;  2KDE B;  2RDH A;  3ETR A;  4URK A;  3U7D A;  4IM2 A;  4LDT D;  2NVU I;  5D94 A;  3Q3M C;  3DVG X;  3EHV A;  1WMH B;  3WAN A;  2J0J A;  2KJH B;  5AEK B;  3AE7 B;  1WXS A;  2N1V A;  2RD0 A;  4B95 A;  4GDL A;  1CK1 A;  3RD2 A;  1EF1 A;  3L54 A;  4S17 A;  1H8C A;  2FUG 1;  3EGR A;  4DDI D;  2KVZ A;  1L4Z B;  3AED B;  1D5X C;  1IPG A;  3DHI C;  4NPN A;  5E6P A;  3KUC B;  3O13 A;  2PTL A;  4JX1 C;  4H2A A;  2KC1 A;  3AEC B;  1C3T A;  4FJZ A;  1RFA A;  3DHH C;  2RGF A;  2DZJ A;  1V9J A;  3PRM B;  2KTF A;  3UI3 A;  2XBB C;  1F0Z A;  1ENF A;  4WWM A;  2GOW A;  1L0X B;  4ITK A;  2PE6 B;  4JGH B;  3VAW A;  4W9E A;  5J17 A;  3E56 A;  2Z8L A;  2DBY A;  1Z5S B;  3W2D A;  3I63 C;  1VD2 A;  3NS8 A;  4GMV A;  3B2F A;  1GC7 A;  2AQ2 B;  2INC C;  2BYT A;  2LJ5 A;  2LRU A;  2AWT A;  2JU6 X;  1GNU A;  2DZK A;  3OG5 A;  4W9C A;  1ZP0 B;  2JQR B;  2WDT B;  4J3O D;  2IO1 B;  2D3B A;  1WSP A;  3QWZ B;  2JY6 A;  3IFW B;  2B76 B;  4E71 A;  5CHF A;  3AMZ A;  2KWU B;  4ZHO A;  5MPO A;  5BO4 B;  3KWV A;  4WJQ A;  3S2A A;  1P3Q U;  3L13 A;  4PT5 A;  1C78 A;  2L0T A;  3PO0 A;  2C9W B;  3GZN I;  4B6W A;  1WWT A;  3RPF C;  3WIM A;  4RM9 A;  3A9J A;  4DQO C;  2DX5 B;  4A6Q A;  3PZ7 A;  1XLO A;  5CX3 A;  1TYG B;  3QHT A;  4GDK B;  4OHJ A;  3EEC A;  3GE3 C;  4US8 A;  3WAL A;  2L0F A;  1QOF A;  1KRH A;  2WXL A;  3E9S A;  2J42 A;  3AE1 B;  1R4N B;  2LEK A;  3BVZ A;  3ML9 A;  3X0W A;  4A3O A;  2JRI B;  2DEN B;  3BIN A;  3URY A;  2GRI A;  1NI2 A;  2M56 B;  4R3D A;  4GDL B;  1H7W A;  4KKI A;  1ZOY B;  3PLU A;  3L16 A;  1FRR A;  5BMI A;  2DLB A;  2UYZ B;  2LHD A;  2AEH A;  3UF8 A;  4A8X C;  2HJ8 A;  5J2R A;  3IT6 B;  1D5M C;  3PHW B;  2I38 A;  1V5O A;  1TY2 A;  2QJL A;  5C23 A;  2MRP A;  3NVW A;  4I6P A;  2CKH B;  2L8J A;  3QK0 A;  2JSV X;  2V3N A;  1E6E B;  3SHQ A;  3LB8 C;  3PRE A;  4EFO A;  2KX0 A;  1XLN A;  2K5P A;  2G45 B;  1FCC C;  4F7Z A;  2M4N A;  3RNA C;  4IM0 A;  3UIO B;  2BB5 A;  2JPH A;  3R2I A;  3KVF B;  4JE3 B;  4TSS A;  3HHM A;  1QT9 A;  3NZ3 A;  4GLS C;  1V2Y A;  2J53 A;  1GC6 A;  1K51 A;  2ZEQ A;  3VHT C;  1ZKH A;  2IY0 B;  1SJE D;  1L0V B;  4JPS A;  1TZ1 A;  3Q8F A;  4W9G A;  3KH0 A;  2ON8 A;  3VVW B;  3UIP B;  3OJ3 A;  2WXQ A;  4IKG A;  1WGH A;  4HRO A;  3NY5 A;  1MHH E;  1VZ7 A;  1WXQ A;  1I4G A;  4NJ6 A;  4FA6 A;  4LJO B;  2X38 A;  1JRO A;  4LNN A;  5G5G A;  3VH4 B;  2MBQ A;  4ICU A;  2ASQ A;  5TSS A;  3R66 C; 
#chains in the Genus database with same CATH homology
 1HA5 A;  2WXO A;  2H89 B;  1YJJ A;  4WUR A;  1N60 A;  2NTS A;  2WS3 B;  5BYR A;  2YEP B;  2GB1 A;  4YT0 B;  1F2R I;  2IGG A;  3FIL B;  4RNA A;  3P4R B;  1ZXI A;  2ZW1 A;  1YNT E;  1AWD A;  1BML C;  4C7Z A;  1FO4 A;  4MAC A;  1VR9 A;  3MJ5 A;  2INP E;  1CJE A;  3AE8 B;  1KFY B;  4YSY B;  4XWW A;  2QSD A;  1YJI A;  3LYY A;  2M19 A;  1XCQ L;  5C2T B;  4M0W A;  1PGB A;  4FXC A;  4MM3 B;  4RF0 A;  2PLP A;  1NEN B;  4ARI A;  1T3Q A;  3NS1 A;  2Y3A A;  4C7Y A;  1IUE A;  3I9V 1;  1A70 A;  3B9J A;  1OQR A;  2QIL A;  5HHD G;  4D2K A;  3AEB B;  2WP9 B;  1MVK A;  2KDM A;  1GB4 A;  4YTN B;  3FIL A;  3BZD B;  5D3I B;  4XWT A;  4AQ7 A;  4RH6 A;  2KQ4 X;  1TS3 A;  3AH7 A;  1SE2 A;  4P16 A;  2DYM A;  2WU2 B;  3AE4 B;  2ICI A;  5BYQ A;  1KH0 A;  1YN4 A;  1JQ4 A;  3V3X A;  2CJO A;  2OHF A;  4L2Y A;  3ZJT A;  1IBX B;  2KAC A;  1DGJ A;  4YTM B;  3TEX A;  1AYF A;  2E6X A;  1SSN A;  1QOG A;  1PGA A;  3KLS X;  4N58 A;  4KGS A;  1VJK A;  2K9X A;  1T5X D;  3IAS 1;  1YQ3 B;  3NVY A;  2WXH A;  5H92 C;  2ACZ B;  2FBW B;  1NYQ A;  2J4X A;  1V1O A;  1H7X A;  4RGN A;  2N9K A;  3DWM A;  1OQQ A;  2NTT A;  2WXI A;  3HRD D;  1K52 A;  1C79 A;  1L4D B;  1GTH A;  3IAM 1;  2WLB A;  1FXI A;  5HI1 A;  2BB6 A;  1QF6 A;  2JXT A;  1C4P A;  2WDQ B;  1NYR A;  2KWD A;  1AN8 A;  1Y56 A;  3MHZ A;  1JWU D;  1QLB B;  2L52 A;  1R7S A;  4OZB A;  3P4Q B;  1P7F A;  2LJI A;  5D7G A;  1HZ5 A;  2VZK D;  5EE3 A;  1D4B A;  2SEB D;  1SF0 A;  1GB1 A;  1F2R C;  4YWG G;  3AE3 B;  3Q8E A;  3FAH A;  3BK1 A;  3AE6 B;  1FXA A;  3CF4 A;  3BII D;  5EE9 A;  1XLP A;  1JWA D;  2L32 A;  1UNS A;  1C76 A;  1QOB A;  2WXP A;  2WXR A;  4JWU C;  4YSZ B;  1UUP A;  1FMA D;  1E10 A;  3P4P B;  1T6B X;  2K0P A;  4YXD B;  5FR3 A;  1DOX A;  3BVG A;  1IGC A;  3Q8A A;  1ZDV A;  1K50 A;  1RYJ A;  3OWE B;  2ZW0 A;  3NVZ A;  4ZHP A;  1TS5 A;  4LK0 M;  1PDX A;  1MPE A;  5BMG A;  1OFF A;  2V0G A;  3TEW A;  2BBC A;  4LTU A;  1UWM A;  1SBB B;  4A55 A;  4UDU C;  2K3U A;  2RPV A;  2IGH A;  3SR6 A;  4AS1 A;  3U52 E;  1ZPS A;  3HVZ A;  4YTP B;  1GAQ B;  2J52 A;  2KAJ A;  1N61 A;  1NVI D;  4WH4 A;  1EWY C;  3PZ8 A;  3AE2 B;  1YQ4 B;  4RGM A;  1MI0 A;  3AE9 B;  1J7A A;  3BK2 A;  1V97 A;  2N9L A;  4IOI E;  1IBX A;  1TJE A;  3WCQ A;  4XDD A;  5HG2 A;  2W55 A;  5D3D A;  3SEB A;  4N6E B;  3GP7 A;  4TQ0 A;  1ZE3 D;  4N59 A;  1FFV A;  1BUI C;  4KX6 B;  3TSS A;  2LUM A;  1L6V A;  3AN1 A;  3HUI A;  3MFG A;  1FM0 D;  1HXY D;  2JWU A;  1I4P A;  3P1M A;  5FKA C;  1XLQ A;  4MH8 A;  4REZ A;  1FFU A;  5BMH A;  1VDV A;  4A90 A;  2JYE A;  1PFD A;  2MJD A;  3MP9 A;  1SJH D;  3U7Z A;  1C9F A;  1IGD A;  5JXV A;  4RFB A;  2L83 A;  1B9R A;  2W3R A;  4Q2J A;  2WXG A;  1VZ8 A;  2BTE A;  2PKO A;  1AW7 A;  2I2Y A;  1UGJ A;  1K53 A;  4OVZ A;  5HFY A;  1ESF A;  1QIL A;  1HEZ E;  2YEP F;  1TKG A;  2WXN A;  1QOA A;  1J7B A;  2LHE A;  3TEZ A;  1JWM D;  1TS2 A;  1KLU D;  3GS2 A;  1E0Z A;  3ABV B;  3FC4 A;  1B1Z A;  4P6V F;  1YN5 A;  3AEF B;  4HKQ A;  1I4Q A;  3EA6 A;  5G5H A;  2WU5 B;  1PYW D;  4NAW B;  1VRA B;  1M4V A;  5C3J B;  4ARC A;  1FCL A;  2ONQ A;  2AX5 A;  4HEA 1;  2RDH A;  3ETR A;  2HDE A;  2MEK A;  1EU3 A;  2WNM A;  1SXT A;  3T3N A;  2KMM A;  1TKY A;  4NJC A;  2JZP A;  1KTK A;  2IPK D;  1RM6 C;  1MHX A;  2N0S B;  3AE7 B;  1FNU A;  2Q5W D;  1PGX A;  3AM9 A;  2WXJ A;  1CK1 A;  1XO3 A;  1TY0 A;  4RGO S;  2FUG 1;  4JWS C;  3EGR A;  2PIA A;  4DXF A;  1L4Z B;  1JRP A;  2CJN A;  2RMM A;  1HQR D;  3Q8B A;  3AED B;  2DYO A;  1WRI A;  1D5X C;  2BS2 B;  2BT6 A;  1SE3 A;  1JWB D;  3O13 A;  4WAF A;  2PTL A;  4JX1 C;  3AE5 B;  4H2A A;  3U2S C;  5GXG B;  3DWG C;  1TZO A;  1TS4 A;  3J9C A;  3AEC B;  1WYG A;  2TSS A;  3AV8 A;  3W5U B;  3NUH B;  3TEY A;  1JAL A;  4US9 A;  1JCK B;  4RGT A;  2G1E A;  4B0M A;  2QIE B;  3AB5 A;  1RFK A;  3KWL A;  1GT8 A;  4ZRP A;  2WXF A;  1NEK B;  1CQV A;  3ZJV A;  5T8I A;  3UI3 A;  2V3P A;  3T3O A;  1F0Z A;  1ENF A;  1JWS D;  2AQ1 B;  3EUB 2;  1KF6 B;  4YSX B;  2M0A A;  5AUI A;  2LMC A;  1E7P B;  4WWM A;  2EKI A;  2JX5 A;  4EE2 A;  2W82 A;  5LNK 1;  1L0X B;  1C4A A;  4ITK A;  4TMA B;  2RDG A;  2DWQ A;  2MJ3 A;  1KLG D;  3NRZ A;  4TQ1 A;  3E56 A;  2Z8L A;  1NI3 A;  2DBY A;  1VZ6 A;  2XNA C;  3W2D A;  5I4D A;  1I4R A;  3B2F A;  3KQ4 A;  2AQ2 B;  3Q69 A;  2BYT A;  3CWI A;  3RFZ B;  3BYT B;  1V1P B;  2JU6 X;  2PW9 A;  4WIP A;  1ZP0 B;  1L6U A;  3IT4 B;  2JQR B;  5H8Y E;  3W5V B;  1GPX A;  3P63 A;  4J3O D;  4C80 A;  3W1S A;  2BW2 A;  1WSP A;  1TKE A;  2B76 B;  3AMZ A;  5BYS A;  2CU3 A;  1D5Z C;  4ZHO A;  5MPO A;  3R8B A;  2R61 A;  4XE0 A;  3TUO A;  3KWV A;  4PT5 A;  3Q8C A;  1N63 A;  1ZUD 2;  1C78 A;  5EE0 A;  3PO0 A;  4OZC A;  4B0E A;  1ET9 A;  1SIJ A;  1WWT A;  1F77 A;  1P7E A;  4XDC A;  1FNV A;  3RPF C;  3VR9 B;  3U4E G;  4DXG A;  3BWU D;  2BS3 B;  1EM7 A;  2QEJ C;  4NAM A;  2HTM E;  4DQO C;  4ZOH C;  2AQ3 B;  3V05 A;  4CQN A;  4IDI A;  4A9A A;  1SB3 C;  5E6J A;  4A6Q A;  1DYQ A;  3SFD B;  1ZDX A;  1V8C A;  3R2T A;  3NVV A;  3PZ7 A;  1XLO A;  3P4S B;  2MJE A;  2PMV A;  3VQI A;  3VRB B;  2GI9 A;  4LLG M;  2Y5P A;  1FIQ A;  2WDR B;  1L0Y B;  2MH7 A;  5AUK A;  1TYG B;  3CIR B;  2NMQ A;  4GDK B;  1N5X A;  2PVO D;  4OHJ A;  1N5W A;  4US8 A;  3L4P A;  1QOF A;  1C77 A;  4L1B A;  1KRH A;  2WXL A;  1PUT A;  2IJ0 A;  3AEA B;  3VR8 B;  2D5G A;  2J42 A;  3E9S A;  4O1N A;  3AE1 B;  2LEK A;  1YN3 A;  3BVZ A;  3VRA B;  2WXM A;  2IGD A;  2L1A A;  3URY A;  2OED A;  2GRI A;  3ZYY X;  2M56 B;  4GDL B;  4KKI A;  1H7W A;  4R3D A;  3GB1 A;  1E9M A;  1ZOY B;  1HZ6 A;  1FRR A;  2PVG C;  5BMI A;  2DLB A;  2XN9 C;  2LHD A;  3H8H A;  4A8X C;  2WXK A;  3MC0 B;  3IT6 B;  1I7H A;  4RF1 A;  1D5M C;  2VZK B;  1XF5 L;  2I38 A;  2W3S A;  1FNW A;  1FD6 A;  1TY2 A;  2QJL A;  4OZA A;  4C56 C;  1GTE A;  1XCT L;  1V1P A;  1ACC A;  3NVW A;  1DOI A;  3I57 A;  3ZGZ A;  4WQM A;  2Y5C A;  3HVD A;  2K22 A;  4ZRQ A;  2JSV X;  1SE4 A;  1VLB A;  2V3N A;  4HRS A;  4KGR A;  1I4X A;  1E6E B;  2E3T A;  3LB8 C;  2W54 A;  5FK9 C;  2V4I B;  4RCO A;  1XLN A;  2K5P A;  1FCC C;  1GOZ A;  4NZL B;  2WDV B;  1FRD A;  1ET6 A;  3ZQ4 A;  2BB5 A;  4KKJ A;  4ZYS A;  1XXG A;  3ZJU A;  2KN4 A;  1RWS A;  1STE A;  3BVM A;  3R2I A;  4KGT A;  4HKZ E;  1XEE A;  4JE3 B;  4TSS A;  1QT9 A;  1UWX A;  1FEH A;  1EWC A;  2LGI A;  3NZ3 A;  1ZXH A;  3P42 A;  4GLS C;  2J53 A;  1K51 A;  1BXT A;  2QMT A;  3AEE B;  1SJE D;  1L0V B;  1WGK A;  4JPS A;  1ROE A;  1LO5 D;  1JW9 D;  3N9Y C;  1JML A;  3BYY B;  3Q8F A;  1L5P A;  5EE1 A;  1YMH E;  3B2G A;  2ON8 A;  3LXF A;  2INN E;  4USA A;  2IDY A;  2EEL A;  2WXQ A;  2LFI A;  4IKG A;  4HRO A;  2WQY B;  4MT5 A;  3AEG B;  1Q10 A;  1C4C A;  3C8Y A;  3IXS A;  1MHH E;  1VZ7 A;  1WXQ A;  1I4G A;  2FE8 A;  4L23 A;  1J7C A;  3SFE B;  2X38 A;  1JRO A;  1SEB D;  1DOY A;  1I4H A;  3W9C B;  1N62 A;  2BS4 B;  2G9H D;  5G5G A;  2N7J A;  4HJG E;  1EU4 A;  2JYT A;  5TSS A;  1CZP A;  1QKZ A;  1D6E C;  1QQR A;  2SAK A;  2H88 B;  4OW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...