2WS3B

Crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd tyr83phe mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Succinate Dehydrogenase Activity
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
total genus 65
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2ws3B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ws3B01
1V97A 3AE4B 3NVVA 3AE7B 3EUB2 1TJEA 3VRAB 3ZYYX 2G1EA 2MJEA 1IUEA 3P4PB 1T3QA 1QOFA 1UWMA 2BS4B 1KRHA 1ZXIA 2W3SA 1XLQA 4YTPB 1JALA 1NENB 1DGJA 3RPFC 3HVZA 2CJOA 2E3TA 3B9JA 3AECB 2Y5CA 1JW9D 1OQQA 1GT8A 1KFYB 2FBWB 5AUIA 2WDVB 1V8CA 4US8A 1E7PB 5MPOA 1JWAD 1H7WA 3ETRA 4N6EB 1TKGA 4YT0B 3CIRB 1AYFA 1CJEA 1N61A 4C7ZA 3VR8B 2H88B 4YTMB 2ACZB 1FFUA 1QT9A 2JQRB 2MJDA 1EWYC 1E9MA 1XLPA 2W3RA 2K22A 3KWLA 1A70A 3AE9B 5C3JB 1FIQA 2L83A 2M56B 4YSXB 3NVZA 4IDIA 1YQ3B 3B2FA 3FC4A 2EKIA 3AN1A 1WWTA 3NVYA 5G5GA 4C80A 4FXCA 1ROEA 2KMMA 3P4SB 5EE0A 1DOYA 1TKEA 1YJIA 1VLBA 1CZPA 1H7XA 3AEDB 3VRBB 1FFVA 1J7CA 2LEKA 1QOBA 3WCQA 3NRZA 2WU2B 2MJ3A 1ZOYB 1GAQB 1N62A 2MH7A 2B76B 2PVGC 2WDQB 2M19A 4YTNB 2DBYA 2OHFA 3AM9A 1N60A 3AEBB 4JX1C 4N58A 4WWMA 3SR6A 1E0ZA 3AMZA 4YXDB 1ZP0B 1FRDA 1NI3A 1ZUD2 1QOAA 1GPXA 2N0SB 1NYQA 4HRSA 2CJNA 1PDXA 4US9A 1WRIA 4ZOHC 5GXGB 4YSZB 2K5PA 3AV8A 3LB8C 3P4QB 1L5PA 2BT6A 1GTEA 1QLBB 3SFEB 1AWDA 1DOIA 1N63A 1RWSA 1FO4A 1JQ4A 1NEKB 4N59A 3P4RB 3L4PA 2DWQA 5G5HA 1XO3A 1WGKA 4P6VF 1NYRA 3AEFB 3DWMA 1XLOA 1L6VA 3LXFA 1FXAA 3AE8B 1J7AA 1OQRA 2BS2B 3AE6B 1E6EB 1VDVA 2HTME 2W55A 3CWIA 4HROA 3AE5B 1PUTA 1DOXA 2QJLA 1FMAD 1WYGA 1XLNA 2PVOD 2AX5A 1PFDA 1SF0A 3W5VB 2JX5A 1FXIA 4ZHOA 1E10A 3AE2B 5EE1A 1RFKA 2WP9B 2W54A 5EE3A 2WS3B 4KX6B 3AEAB 3HRDD 1OFFA 2Q5WD 1F0ZA 3W9CB 2QIEB 4C7YA 2WQYB 2PKOA 1JRPA 4ITKA 3AEGB 1KF6B 2K9XA 3AE3B 3AE1B 1TKYA 5C2TB 1N5WA 5EE9A 1RYJA 2PIAA 2BS3B 1SIJA 1YJJA 1FM0D 3AH7A 1YQ4B 3VR9B 1L6UA 1I7HA 1N5XA 2L52A 3HUIA 5H8YE 3BIID 1NVID 1SB3C 4YSYB 1J7BA 1R7SA 1QF6A 3DWGC 4JWSC 3PO0A 1TYGB 1RM6C 2WDRB 3SFDB 3FAHA 1JROA 1B9RA 5H92C 2WU5B 1FRRA 1VJKA 4JWUC 2H89B 4LTUA 4ZHPA 1GTHA 3NS1A 2WLBA 1QOGA 1JWBD 3AB5A 4WQMA 3W5UB 4USAA 2KAJA 3AEEB 3B2GA 3CF4A 1L0VB 2CU3A 3P63A 3P1MA 5AUKA 3NVWA 3ABVB 4A9AA 1WXQA
chains in the Genus database with same CATH superfamily
2FUHB 5E6NA 3AE7B 4G50A 4YTPB 1FNUA 3RPFC 1Z2MA 2BVCA 2R2OA 2WDVB 1H7WA 1SJED 4B95A 2H88B 3IXSA 3IT6B 1HTOA 1CK1A 2M56B 2BPSA 2FNJB 3B2FA 4IC7B 1YIWA 3QQ8B 1P3QU 3R2IA 1WSPA 2KXJA 4NNJB 3ENEA 4KDLB 4GDLA 2KFKB 3NOBA 4K7WA 1TS2A 1ZP0B 1FRDA 1ZUD2 1GPXA 4TQ1A 3N1XC 3AV8A 3LB8C 3EECA 2BT6A 1FPYA 3ZDMC 4K1RB 3APCA 2LRUA 2MSED 1WM2A 1OTRB 2Z8LA 5BMGA 4AJWA 2DNFA 1E8YA 4ANUA 2KC2A 4XC2A 5JHAA 4DHZB 2WXHA 2IGGA 4EFOA 1R4NB 1CQVA 2BYFA 4MGYE 3KUDB 3AE1B 2LGDA 4NAWA 4EEWA 4FJVB 5DPRA 3RNBC 3W1SC 4MM3A 2YEPF 3HUIA 4XZ4A 1J7BA 2VH2A 3IAM1 2JYTA 1WJ4A 2KT7A 1RM6C 3U8ZA 4XWWA 2KQSA 3NG0A 2G4DB 1JWBD 3W5UB 2OJRA 4HLEA 2L32A 3R3MA 3P63A 4A3PA 4YL8A 3NVWA 3ZNID 5CTRC 2KX0A 3VRAB 3A33B 3DCGA 1J8CA 3M63B 5D7GA 3Q14C 1IGDA 2YVCA 3SHQA 4B6WA 4S0RA 3WA0A 2MA9B 2MJDA 2KDBA 4MH0E 4NQKE 2K22A 2K8BA 1TIFA 2KTFA 4AP4C 1V5OA 2KKCA 1H7XA 1HE8A 4PS8A 2HD5B 3Q3NC 2LASA 5JHBA 3DPDA 4IM0A 2WU2B 2MBBB 4URKA 3SR6A 3AEBB 2D3CA 1ZDXA 2PW9A 2ZW1A 1WIAA 2V3SA 3IVFA 5BMIA 4HCPB 3KUCB 2RMMA 3O65B 2N9KA 3Q8CA 1WE6A 3NS8A 4BAXA 4IUMB 1WJ6A 1K51A 2ZNVB 2MBEA 5FR6A 4JGHB 1VZ8A 3TUOA 2M0XA 3CF6E 3CWIA 2WXFA 4GDKA 3M95A 1Q0WB 3AE2B 2BF8B 2K6QA 1WX8A 1ESFA 1VD2A 1MG4A 1R7SA 1HTQA 3RNGC 1V5TA 3PS6A 4C4VB 1UGMA 3UQBA 3WAPA 4JQWC 2ZZPB 3EC8A 4CYEA 4LCDE 3N1ZC 1ZE3D 3ABVB 2K39A 3NZ3A 1L7YA 1E8ZA 2Z0DB 2IO1B 1I4RA 3GE8C 1D4BA 3OLMD 4GOCA 1JWMD 2CR5A 3BYTB 4M8NA 5KHQA 1M94A 4G3XB 3AECB 1GT8A 3OAWA 1E7PB 3IFWB 3W1YA 1LFDA 4W9KA 3KUZA 2ACZB 3ZJVA 2ZVNA 3EA6A 2IO3B 2Z0EB 3V6CB 4RF1A 3NVYA 2I38A 3AN1A 1WRDB 3PZ8A 1F2RC 1WXSA 5CHVC 4J3OD 3HHMA 3PV1A 1N62A 2ICIA 2PVGC 2AQ1B 1UZXB 4N58A 5IOIA 2LHEA 3ML8A 4YSZB 3GB1A 4KVGB 2JXTA 3UIOB 3AXCA 3SFEB 3OWEB 1UUPA 5HFYA 3L4PA 4LNOA 4W9IA 3RZFA 2BS2B 1SXTA 2INCC 3BVZA 4DHJD 4HPMB 2PTLA 4A90A 2DZIA 2MBQA 4ZYSA 4K3BA 3H8HA 3N20C 1TKYA 2L05A 3IT4B 3TL5A 2ZNVC 3BIID 4K81A 1P98A 4MSMB 4KGRA 3SFDB 1VR9A 1WGHA 3VUYA 4FBJB 1GTHA 2LVQA 4GGQA 1ZW7A 3TMPB 1F77A 2V4LA 4GDLB 4R3DA 2C60A 1TY2A 2JZ3B 5LXIB 3PLUA 2RPVA 3KW5B 2RD0A 4AQ7A 3JYUA 3APDA 4L23A 3W2DA 1SE4A 1KFYB 4WJQA 1TKGA 3ZTCA 1WJUA 1TY0A 2OEDA 3H7PA 1C4AA 2PE9A 1YJIA 2BBCA 5C23A 2DYOA 3JSVB 2ONQA 3R7QA 2WDQB 1E0ZA 2KFJA 2N9LA 4Q2JA 4RGOS 5GXGB 2WXKA 2CU1A 3Q3FA 4DDID 3MC9A 1NI2A 4K7UA 1A5RA 2ZEQA 3HVDA 2WXMA 4ZRKA 2N9EB 4OVVA 2RDHA 2KWDA 4WJNA 3HM3A 2QJLA 2QEJC 3DVNU 4EOYA 4FHKA 4FN2A 2WP9B 3VH4B 4ICUA 4XE0A 4NAMA 2WXIA 5C2TB 2C5LC 1FM0D 3DOWA 3U7ZA 2V3NA 1Y8RC 1QF6A 2KTRA 4KGTA 2KDFB 3L10B 3VHTC 1GUAB 1GJZA 5FR3A 3DBRI 3BZDB 3RUIB 2J52A 3J9CA 3PVLA 2R2QA 2GBMA 2FIDA 4P1BC 4JIOU 1AN8A 1XD3B 4RMAA 4OZCA 1DGJA 2NBUA 4LNNA 4WAFA 2MX2A 3W1SA 4KIKA 2FCNA 5AUIA 3ETRA 3WALA 1EWYC 2W3RA 1LM8B 2M0AA 2L83A 3UIPB 5C3JB 3R8BA 1KM7A 4W9EA 1VLBA 4ZRQA 2V9HA 1J7CA 2KMCA 2G4SA 2WX1A 4I6LB 2N1VA 5AUKA 4A3OA 3AM9A 1WGYA 1N60A 3EGRA 2IGHA 4MGKE 1IGCA 1ZPSA 3VH3B 1M4VA 2CJNA 1PDXA 2V3PA 4MT5A 4F1SA 3PRPB 2MEKA 3KH0A 3JSVA 5AZHA 1MHHE 2BYEA 2J53A 2WYQA 3ZXRA 3NHEB 4HDQA 2DWQA 2LVOA 4HK2A 4XDCA 3PPAA 4NJ7A 1TT5B 1OQRA 2BQQA 4UDUC 4HROA 4C56C 3UQAA 1ZXHA 4GN1A 3N30A 1RLFA 3ZKJC 3U52E 2RDBC 2W54A 3DVGY 1QILA 3AEGB 2LGSA 3E9SA 4W9HA 3PRMB 2UYZB 5E6OA 3SDLC 2N1WA 1SB3C 3PO0A 1YOVB 2JXXA 5AEKB 4RCOA 2JY6A 4XX5A 2PMVA 2WLBA 1QOGA 1T5XD 3B2GA 2LRWA 3APFA 3BYYB 3UINB 2O2VB 2JRIB 4XGAB 3Q3MC 4OW0A 1E8WA 4IM2A 2PLPA 3M3JA 3ZO5B 4WWPA 4B0MA 2WXLA 3FKYA 3DHGC 4P7IA 1CMXB 1P1AA 3B9JA 3KYCD 2IBIB 5CHWA 3ZIMA 2L00B 3GOEA 3I63C 2JUOA 2L7RA 3AI5A 3CMMB 1ROEA 2KDEB 1S3SG 2QHOA 4S17A 1C1YB 2LFIA 3VRBB 4JX1C 2L3ZA 4HPLB 1TS3A 2WXRA 3KWVA 1NI3A 1E5WA 3PRZA 4I6NB 1WM3A 1HXYD 4IKGA 3A9KA 4HCNB 4ZOHC 1KJTA 2LJIA 1KOTA 4ARCA 4M0WA 3TJPA 5BYSA 2BKRB 1DOIA 4TQ0A 1JQ4A 5JH5C 1NEKB 3PSEB 1NYRA 1FNVA 1XLOA 3DBRB 3AE8B 1J7AA 2W55A 3AE6B 2ZW0A 1WYGA 4JE3B 2KVZA 4M02A 2LVPA 1PFDA 1C3TA 4ZHOA 1FXIA 3K9OB 4HKZE 4BZAA 1TBEA 1BXTA 1Z5SB 2SEBD 3KVFB 2WWZA 5TR5A 3QIJA 3ZW3A 5D3DA 3ML9A 5KHOA 1C76A 1MVKA 2MW5A 2H89B 2UU7A 2GBJA 3V62A 1PGXA 3PHWB 2LXAA 2D3BA 3O13A 4DXGA 1SEBD 1P7EA 1AARA 1WMHA 4G11A 1EU3A 3ZJUA 1NENB 1FXTB 4W9GA 5HI1A 4NY0A 3N3KB 3MTNB 1LGRA 1OQQA 4WWNA 2M4NA 2D3GA 3VTUA 4WWOA 4W9FA 3PZ7A 3ZGZA 2HDEA 1UD7A 1FFUA 3PHXB 5IKCM 1WF9A 1A70A 3U30A 2W82A 4A6QA 4A55A 4C80A 2EKIA 3ZNZB 3AULA 3A9JA 1QOBA 3H7SA 4IW0A 3WCQA 5LXHA 2E6XA 3PZDA 2CHXA 3Q8EA 4AJYB 2NTSA 2KLGA 4YTNB 2DBYA 3R66C 3AU5A 4RH6A 3QCAA 5DCNA 1WYWB 2KTRB 4DBGA 2WXNA 4E3CA 2DX5B 1AWDA 2WDTB 1I4QA 1QQRA 1WZ0A 2AQ2B 3NUHB 3AEFB 1L6VA 2DZJA 2KWCA 1UH6A 3IBEA 2K8HA 1P7FA 3ZVVA 5IA7A 2JWUA 2L8JA 1K53A 1OFFA 3L13A 4HXDA 4GDKB 2M17A 2WQYB 1YX6B 2PKOA 3Q2AC 1KF6B 3DQVA 2WXOA 4KIKB 2JPHA 3OJ4B 1RYJA 2IY0B 2D2QA 1GB4A 2LGIA 1WZ3A 3B08A 4GXBA 4IWOA 4YSYB 1WX9A 3DWGC 3ALBA 1B9RA 4DHZE 1VJKA 2JRHA 1WR1A 1GC6A 4IOIE 3ZJTA 2MQJA 2KAJA 2DLBA 5IN7A 4LDTD 2JWZA 1MJDA 2TSSA 1V97A 3RNCC 3DBHB 3I5JC 1P0RA 3Q3JA 2YEPB 4RF0A 1T3QA 2LZ6A 2AL6A 3ZDTA 4QAYA 2IY1B 2MHJA 3HVZA 2NS5A 5J2RA 1JW9D 2LI5A 4ASWC 3T8MA 2MP2A 1QZEA 1N6ZA 1C79A 2EKEC 2IZVB 1E9MA 3AE9B 3RYTA 2BWES 3QX1A 3DBLB 2KMMA 4CHKA 1DOYA 1D5XC 2IPKD 1FFVA 1L0YB 4OZAA 4NZLB 2DAJA 2QCZA 2JSVX 3HK0A 1TS5A 3IAS1 1UBIA 1WJNA 4GIVA 1YNTE 1IYFA 5G5HA 3MHZA 1E6EB 1GC7A 4NQLB 3Q8BA 2HTHA 2PEAA 4KZ0A 1V86A 1V2YA 2FCMA 2N4FA 2KDMA 2M1MA 4BFRA 3HRDD 3EFCA 3NY5A 2QDFA 4C7YA 1FD6A 3C8YA 3UF8A 1SIJA 3QK0A 4DXFA 2LHDA 3MC8A 3VR9B 3JVZX 2J4XA 3H6NA 2NPTA 2K25A 2XN9C 1JROA 4JWUC 3BK2A 4ZRJA 1OQYA 1WH3A 4RM8A 1DYQA 1UELA 3AEEB 4WJPA 3RT3B 4NJCA 2WXPA 3ZXVA 5LNK1 4ZRIA 3PGEA 4M01A 1PQSA 3RULA 4DK5A 2NCNA 1J19A 1XT9B 3LJ3A 1V49A 3R2TA 2LXCA 4BKSD 4N6EB 1HA5A 1R4MB 1AYFA 1N61A 3V6EB 2JQRB 2V4IB 4W9LA 2BYTA 5HG2A 2MRPA 3ZRCA 4GMVA 2IO2B 2K8CA 1AW7A 2ZCBA 4WAAA 3VTWA 1ZOYB 1WXVA 1UGJA 2JF5A 1GAQB 4J6IA 2INNE 2DZMA 4EKUA 4FLHA 2VZKD 3H1UA 4DHJB 2MBOA 3N9YC 1GB1A 1C77A 4OZBA 1PGAA 1GTEA 4MDKE 3L54A 2O6VB 2D10A 2GLSA 4YWGG 1G6JA 1HZ5A 2LWPA 3V3XA 1VDVA 2HTME 4GSWA 1U4AA 5D94A 2N7DA 3A4SC 2BTEA 4RFBA 4WIPA 1YN5A 3CSFA 2OOBB 4EZJA 3ZQ4A 3RFZB 3TEZA 2WS3B 3I9V1 3E56A 2WGSA 2RR9A 2JU6X 2K9XA 3TBLD 3BVGA 1SE2A 4FJZA 2BW2A 2DAFA 3GS2A 3CSTA 3WAOA 4LJOB 2KX3A 1I4GA 1TYGB 2CHZA 3SU8X 2D07B 5T8IA 1YMHE 2G3QB 4DQOC 4LTUA 1R4MI 1UNSA 1IPGA 2KC1A 4WQMA 2MWSB 2NBWB 1NDDA 4HEA1 4LK0M 4A9AA 3DVNV 1EF1A 2XNAC 1TJEA 5I4DA 1WE7A 2MJEA 4RM9A 1ZXIA 3N1YC 1JWSD 2N9PC 2O2VA 2AL3A 4ZDVA 5GMVA 3TSSA 4US8A 1JWAD 1V80A 1CJEA 4C7ZA 4YTMB 1V1PA 3IHPC 4TUUA 2J0KA 1FIQA 1FCCC 1MPEA 3NZUA 3P4SB 1L4ZB 3ZLZA 5G55A 4MJSA 2AYOB 3K9PB 2MH7A 4EE2A 2B76B 5AZGA 5J17A 3RNEC 4ANWA 4BKTA 3T3NA 2PPHA 2JT4B 2XEWA 4CO7A 5C1ZA 1EM7A 5BO4B 4JL9A 4KKIA 2KJHB 3QC8B 3MHSD 3RNFC 2J7QB 1T0RC 4M0WB 1T6BX 1XLNA 4LLGM 3Q6BA 3W5VB 4HVBA 2DZKA 1E10A 5EE3A 2W9NA 3RNAC 1SIFA 4K7SA 2KMAA 1JRPA 3UGBB 5L95C 1ACCA 3DHHC 2KJ6A 2R61A 3T3OA 4C4VA 3I57A 3DBLI 5FKAC 1BMLC 3B1LX 1WXMA 4JWSC 2KJRA 2JYEA 2WHIA 4K3CA 1ZKHA 1T0QC 2AQ3B 4KSLC 5DPWA 3U7DA 5FK9C 2RSUA 3BVMA 4BKSA 1WX7A 4PT5A 1XLQA 3VAWA 1V8CA 3HIZA 1EWCA 4KGSA 2MCNB 3KWLA 3NZSA 3L16A 5E6JA 3FC4A 2EELA 4P16A 1YN4A 3VXWA 1IBXA 2IYDB 2WXJA 4LNKA 4ACFA 2M19A 4KKJA 2KLCA 4EUTA 4YXDB 2VH1A 4LJPB 4GB9A 3PTFC 4ZYNA 1FEHA 4XDDA 1T0YA 2J42A 3DDCB 1K52A 1BUIC 5IAAC 1QLBB 4MELA 2FIFA 4E71A 1D6EC 1WY8A 4PS7A 3MP9A 2V1YA 1DOXA 3FILB 3TCAA 1K8RB 2CKHB 1D5MC 2PVOD 1KLUD 2QMTA 3DHIC 5BYQA 4EZLA 5LLIA 4CQNA 1RFKA 4MH8A 4BOSC 3Q69A 3W9CB 4MACA 2C7MB 1ET6A 3QWZB 3C0RB 2KD0A 3RI7C 1XF5L 1YJJA 1L6UA 3V05A 4WQOB 1KTKA 3HM6X 1HQRD 4ZRPA 3UI3A 1X1MA 1L4DB 1YX5B 3CF4A 1L0VB 5EDSA 2A5UA 2LUEA 2IJ0A 3PREA 4HJKA 3PLVA 2G1EA 3SEBA 2AEHA 3P4PB 2XK5B 2ZVOA 2FCQA 2MLBA 1PYWD 1JALA 1EU4A 1KH0A 2JZPA 2EMTA 2E3TA 2Y5CA 3BY4B 2FBWB 2A4ZA 5MPOA 3RMKC 2GBNA 1TS4A 5G2NA 1QT9A 4FULA 1T0SC 4KV2A 2N7EA 3MJWA 3ZNHB 2KFKA 5EE0A 2ON8A 1CZPA 4II2B 5IO9A 2KQ7A 3NRZA 3QARA 1E7VA 3T9LA 2OJWA 2KHWB 2KNBA 1B1ZA 1E8XA 5CX3A 3P4QB 4RNAA 5DPTA 2L76A 4RGTA 4W9CA 1WGKA 3H9DA 1WFYA 2KANA 5D2MB 3R7RA 2GRIA 4X57B 3URYA 2AX5A 1SF0A 2VRRB 1JRUA 2G9HD 2JX5A 2WXGA 3RN9C 4E74A 4KX6B 3ZUNA 1F0ZA 1WR6E 1JWUD 4KSKC 1MI0A 3FILA 1N5WA 1SE3A 1P9DU 1F52A 1MHXA 1YQ4B 1I7HA 1N5XA 2JVCA 4A8XC 4ICVA 4PK1A 2L1AA 3LDZE 4BVUC 2X38A 2WU5B 5CHFA 5JZEB 3ONSA 2GBKA 3A9JB 2DYBA 2LUMA 3TIXA 5J18A 3P1MA 2PJHA 1YJ1A 3AE4B 1ZDVA 1IUEA 4TSSA 2AWTA 2W3SA 2KDIA 2I1JA 2IO0B 3Q8AA 4YT0B 3X23A 1STEA 2ZCCA 1XLPA 2K3UA 4PYUA 3VUXA 4IDIA 2NVUI 2DHZA 2FUG1 5G5GA 2QC8A 2KYWA 3AEDB 4HDOA 1I4PA 3P42A 1BT0A 2OHFA 2QILA 4WWMA 5JXVA 1VZ6A 5HKHA 4HRSA 4W9DA 4JPSA 1C4CA 1Q5WB 3TEXA 2KQ4X 4AS1A 3MJ5A 1OGWA 3RCZA 2INDC 1J0GA 3DWMA 5D3IB 2BGFA 3LXFA 3WANA 5AZFA 2REXA 3VQIA 1WMHB 2X8XX 2D5GA 2KN5A 1RRBA 2O6VA 1WXAA 3M62B 3PT2B 2WNMA 5BMHA 4OVZA 2BYVE 2M8SA 2KZRA 1MFWA 3MFGA 3D32A 3AE3B 2C9WB 3VDZA 1I4HA 2MBHA 4XYCA 5EE9A 2KOXA 3Q3OC 2PIAA 3AH7A 1V9JA 1XCQL 2L52A 5E6PA 3VFKA 1LQBA 4PS3A 2I2YA 2SAKA 4W9JA 2WDRB 3TEYA 2RPQA 4MJSB 2EMSA 2IDYA 4USAA 4WH4A 4OHJA 4MGIE 1L0XB 4MEMA 2J0JA 1WXQA 2LGYA 3GE3C 2GOWA 3I3TB 3BWUD 3ZRFA 4ARIA 1XCTL 4IM3A 2KWVB 2NTTA 2RDGA 2CJOA 2RGFA 3GZNI 2ZPYA 1S1QB 2KO3A 2CS4A 3CIRB 3L08A 1HEZE 5DPSA 2BWFA 3L0WB 2WX0A 4YSXB 3NVZA 1EF5A 4FXCA 4MSQB 4WURA 5TSSA 1V81A 4DWFA 2LEKA 3A1QB 2MJ3A 4LNIA 1WGGA 4JLCA 3N32A 4HWIB 4KDIC 2Y5PA 3AMZA 4GU2A 1EO6A 1VZ7A 2I1KA 1SJHD 4US9A 2HE7A 4A20A 1TGZB 1XQQA 5D6JB 2L0FA 1ZGUB 3AU4A 1N63A 2Z59B 3ECIA 2V0GA 1KLVA 1IP9A 1D3ZA 4IG7B 4P6VF 3EHVA 4XWTA 4RGNA 4B0EA 1OEYA 1KLGD 3AE5B 1PUTA 1H8CA 4FADA 1I35A 1VCBA 2C7HA 1LXDA 2QIEB 2J0MA 3WIMA 4AOFA 1QKZA 2MP2B 3RD2A 2LGXA 1MG8A 4TV3A 4HPPA 3OJ3A 1E7UA 3A4RA 5BYRA 1SGHA 2Y5BB 2L0TA 1FRRA 2FE8A 2N7JA 2GBRA 2JZZA 3NS1A 1E90A 1WGDA 3AB5A 2BB6A 4DDGD 4BBNC 4L2YA 4N9F4 1WGRA 3ZNGC 3ZYYX 2GMIC 3NJTA 2LJ5A 3JW0X 2DYMA 2ZJDA 1C4PA 4II3B 2FCSA 2VZKB 2INPE 4NAWB 4IWPA 4ANVA 4OVUA 3LYYA 2K6DB 3H7PB 4MM3B 3DBHI 2IGDA 3KQ4A 3VR8B 2KWUB 3V60A 2B3AA 1ENFA 1FNWA 2N9XA 1TKEA 1F1HA 3WAMA 4L1BA 3U4EG 3V61A 1XXGA 4FA6A 1SSNA 3QA8A 2NMQA 3VVWB 2K5PA 1C9FA 1L5PA 2G45B 3TEWA 2QSDA 4TKNA 1YD8U 1RWSA 1K50A 3P4RB 1XO3A 4AUQC 2LMCA 2O6VD 3OG5A 1FXAA 3DBSA 1UWXA 3BINA 2HJ8A 4M00A 3VTVA 1FMAD 2CHWA 4HKQA 4BOZB 4O1NA 2DENB 4TMAB 1GOZA 2GB1A 4FHJA 2XBBC 1JCKB 4EZKA 4LDTB 1HZ6A 3U2SC 1F9JA 2BS3B 3BK1A 1H4RA 2KVRA 2ZPNA 1V1PB 3GZNB 1NBFC 1EUVB 1L2NA 3FAHA 2UWQA 5H92C 1WI0A 2KACA 3SD5A 1I42A 1GNUA 4F8CB 1V6EA 1YN3A 1D5ZC 3X0WA 3DVGX 3Q8FA 1Q10A 3EFUA 4WJOA 3NVVA 3EUB2 4FJYA 3VUWA 2D11A 2WXQA 1QOFA 1UWMA 2BS4B 1KRHA 4G0NB 1RAXA 1RFAA 3QJZA 3RZWC 1UF0A 2LD9A 3C19A 5IP4D 1V1OA 4ANXA 2BB5A 2XK5A 4NJ6A 1FCLA 1F2RI 4B9KA 3IG3A 1YQ3B 1WWTA 1PGBA 1VRAB 2BKFA 1C78A 2NR2A 4DXAB 2K0PA 2FAZA 1TZOA 4C00A 3KLSX 4AWJA 5L83A 1YQBA 1R4NI 1IBXB 1QOAA 4MGZE 2N0SB 4IWQA 1NYQA 2C7NB 4KZCA 4RGMA 1SBBB 3B0AA 2KK8A 3ZTDA 1OEYJ 2D3AA 3S2AA 4NPNA 1FO4A 1ISNA 2Y3AA 4N59A 1GG3A 4LNFA 3MC0B 4GLSC 1Q1OA 4M8MA 4BKGA 2K1FA 4H2AA 1SE9A 1UBQA 3KYDD 4D2KA 1TZ1A 2PE6B 4F7ZA 5EE1A 3L17A 3AEAB 2Q5WD 2GI9A 4REZA 4ITKA 2NBVB 4I6PA 5HHDG 3A9KB 2ASQA 5H8YE 4BBNF 3P2BA 1XEEA 2YLMA 1NVID 2HJ1A 4HJGE 1TTNA 2KN4A 4PYZA 1ET9A 3QHTA 4ZHPA 1LO5D 3QAQA 2NPTB 2CU3A 3A1QA 1I4XA 1JMLA 4P1CC 1Y56A 3GP7A 1WRIA
chains in the Genus database with same CATH topology
3AE4B 3AE7B 1ZDVA 1IUEA 4TSSA 1AN8A 2W3SA 4OZCA 4YTPB 1FNUA 1DGJA 3RPFC 4WAFA 3W1SA 5AUIA 3Q8AA 2WDVB 3R2TA 3ETRA 1H7WA 4N6EB 1HA5A 1SJED 4YT0B 1AYFA 1N61A 2H88B 3IXSA 2JQRB 1STEA 2V4IB 1EWYC 1XLPA 2K3UA 2W3RA 3IT6B 2M0AA 2L83A 5C3JB 2BYTA 1CK1A 2M56B 5HG2A 3R8BA 4IDIA 3B2FA 2FUG1 5G5GA 1VLBA 3R2IA 4ZRQA 1WSPA 3AEDB 1AW7A 1J7CA 1I4PA 1ZOYB 1UGJA 1GAQB 3P42A 2INNE 5AUKA 3AM9A 2OHFA 2QILA 4WWMA 1N60A 2VZKD 5JXVA 1VZ6A 1TS2A 1ZP0B 1FRDA 1ZUD2 3EGRA 2IGHA 1GPXA 1IGCA 3N9YC 1ZPSA 4HRSA 1M4VA 4JPSA 2CJNA 1PDXA 2V3PA 4TQ1A 4MT5A 1C4CA 2MEKA 1GB1A 3TEXA 1C77A 3AV8A 4OZBA 2KQ4X 3LB8C 1MHHE 4AS1A 2BT6A 1PGAA 3MJ5A 2J53A 1GTEA 4YWGG 1HZ5A 2DWQA 4XDCA 3V3XA 3DWMA 5D3IB 3LXFA 1VDVA 2Z8LA 2HTME 1OQRA 3VQIA 4UDUC 5BMGA 2D5GA 4HROA 4C56C 1ZXHA 2BTEA 4RFBA 4WIPA 3U52E 1YN5A 2WXPA 2W54A 3ZQ4A 3RFZB 5BMHA 2WS3B 2WNMA 3TEZA 4OVZA 3I9V1 3E56A 1QILA 2JU6X 2IGGA 2WXHA 3AEGB 2K9XA 3MFGA 3E9SA 1CQVA 3BVGA 3AE3B 1I4HA 3AE1B 1SE2A 5EE9A 2BW2A 2PIAA 3AH7A 1XCQL 2L52A 2YEPF 3HUIA 3GS2A 1SB3C 1J7BA 2I2YA 2SAKA 2JYTA 3IAM1 3PO0A 1I4GA 1TYGB 1RM6C 2WDRB 4XWWA 5T8IA 4RCOA 3TEYA 1YMHE 4DQOC 4LTUA 2PMVA 1UNSA 2WLBA 1QOGA 1JWBD 4WQMA 3W5UB 2IDYA 4USAA 4WH4A 4OHJA 1T5XD 3B2GA 1L0XB 2L32A 3BYYB 3P63A 3NVWA 4HEA1 4LK0M 4A9AA 1WXQA 2XNAC 4OW0A 1TJEA 5I4DA 3VRAB 2MJEA 2PLPA 1ZXIA 1JWSD 4B0MA 3BWUD 4ARIA 1XCTL 2NTTA 2RDGA 2CJOA 2WXLA 3B9JA 5D7GA 3TSSA 4US8A 1IGDA 1JWAD 3CIRB 1CJEA 4C7ZA 4YTMB 2MJDA 1HEZE 1V1PA 2K22A 1FIQA 1FCCC 4YSXB 3NVZA 1MPEA 4FXCA 1ROEA 3P4SB 4WURA 5TSSA 1L4ZB 2LFIA 1H7XA 3VRBB 2LEKA 2WU2B 2MJ3A 2MH7A 4EE2A 2B76B 4JX1C 2Y5PA 3SR6A 3AEBB 1ZDXA 1TS3A 2WXRA 3AMZA 1NI3A 3KWVA 2PW9A 2ZW1A 1VZ7A 3T3NA 5BMIA 1HXYD 4IKGA 1SJHD 4US9A 4ZOHC 2RMMA 2LJIA 4ARCA 2N9KA 4M0WA 3Q8CA 1EM7A 5BYSA 4KKIA 1DOIA 1K51A 1N63A 4TQ0A 1JQ4A 2V0GA 1NEKB 4P6VF 1NYRA 1VZ8A 1FNVA 1XLOA 4RGNA 4XWTA 3TUOA 4B0EA 3AE8B 1J7AA 2W55A 3AE6B 2ZW0A 3CWIA 1KLGD 3AE5B 1PUTA 2WXFA 1WYGA 4JE3B 1T6BX 1XLNA 1PFDA 4LLGM 3W5VB 4ZHOA 1FXIA 1E10A 3AE2B 5EE3A 4HKZE 2QIEB 1JRPA 1ACCA 1BXTA 2SEBD 1QKZA 1ESFA 2R61A 3T3OA 3I57A 5D3DA 5FKAC 1BMLC 1R7SA 5BYRA 1C76A 4JWSC 1MVKA 2JYEA 1FRRA 2FE8A 2N7JA 2H89B 3NS1A 1PGXA 3AB5A 2AQ3B 2BB6A 3O13A 4DXGA 1ZE3D 3ABVB 4L2YA 1SEBD 3NZ3A 1P7EA 5FK9C 1I4RA 3ZYYX 1D4BA 1EU3A 3BVMA 1JWMD 2DYMA 4PT5A 1XLQA 3ZJUA 3BYTB 1NENB 5HI1A 1C4PA 3AECB 1OQQA 4NAWB 2VZKB 1GT8A 2INPE 1V8CA 1E7PB 3LYYA 3PZ7A 3ZGZA 1EWCA 2HDEA 4MM3B 2IGDA 3KQ4A 3VR8B 1FFUA 4KGSA 2ACZB 3ZJVA 3KWLA 3EA6A 1A70A 5E6JA 4RF1A 2W82A 4A6QA 1ENFA 4A55A 3FC4A 2I38A 2EKIA 3AN1A 3NVYA 4C80A 2EELA 4P16A 1FNWA 1TKEA 1YN4A 1IBXA 1QOBA 2WXJA 4L1BA 3WCQA 3PZ8A 2E6XA 1F2RC 3U4EG 4J3OD 3Q8EA 1N62A 2ICIA 2NTSA 2AQ1B 2PVGC 2M19A 4YTNB 2DBYA 4KKJA 4N58A 4YXDB 1XXGA 4RH6A 1SSNA 2LHEA 2NMQA 4YSZB 3GB1A 1FEHA 2JXTA 4XDDA 2K5PA 1C9FA 2J42A 1L5PA 1K52A 3TEWA 2QSDA 1BUIC 2WXNA 1QLBB 3SFEB 1AWDA 3OWEB 1UUPA 1RWSA 1I4QA 5HFYA 1K50A 3P4RB 1QQRA 3L4PA 1XO3A 2AQ2B 2LMCA 3NUHB 3AEFB 1D6EC 1L6VA 1FXAA 2BS2B 3MP9A 1SXTA 1UWXA 1DOXA 3FILB 1FMAD 3BVZA 4HKQA 1D5MC 2PVOD 1KLUD 2QMTA 2PTLA 5BYQA 1P7FA 4A90A 4CQNA 4O1NA 1RFKA 4MH8A 2JWUA 1K53A 3Q69A 1OFFA 4GDKB 3W9CB 4TMAB 2WQYB 1GOZA 2GB1A 2PKOA 4MACA 4ZYSA 1KF6B 1ET6A 1JCKB 3H8HA 2WXOA 1TKYA 1HZ6A 1XF5L 1RYJA 3U2SC 2BS3B 3IT4B 1YJJA 1GB4A 3BK1A 1L6UA 2LGIA 3V05A 3BIID 4YSYB 1V1PB 3DWGC 1KTKA 4KGRA 3SFDB 3FAHA 1HQRD 1VR9A 4ZRPA 5H92C 1B9RA 1VJKA 2KACA 4IOIE 3UI3A 1GTHA 3ZJTA 1L4DB 1F77A 2KAJA 3CF4A 1L0VB 1D5ZC 1YN3A 2DLBA 3Q8FA 1Q10A 2IJ0A 4GDLB 4R3DA 2TSSA 1V97A 3NVVA 3EUB2 1TY2A 2G1EA 3SEBA 4RF0A 2YEPB 3P4PB 2RPVA 1T3QA 1QOFA 1UWMA 2WXQA 2BS4B 1KRHA 4AQ7A 1PYWD 1JALA 1EU4A 1KH0A 4L23A 3HVZA 3W2DA 1SE4A 2JZPA 2E3TA 2Y5CA 1JW9D 1KFYB 2FBWB 5MPOA 1V1OA 1TKGA 2BB5A 1TS4A 1C79A 2OEDA 1TY0A 1QT9A 1FCLA 1F2RI 1E9MA 3AE9B 1YQ3B 1C4AA 1WWTA 1PGBA 2KMMA 1VRAB 5EE0A 1DOYA 1D5XC 1YJIA 1C78A 2ON8A 2IPKD 1CZPA 1FFVA 2K0PA 2BBCA 2DYOA 3NRZA 1L0YB 1TZOA 4OZAA 3KLSX 4NZLB 2ONQA 2WDQB 1E0ZA 1IBXB 2JSVX 1QOAA 2N0SB 2N9LA 1NYQA 1TS5A 4Q2JA 4RGOS 1B1ZA 5GXGB 2WXKA 4RGMA 3IAS1 1SBBB 3P4QB 4RNAA 4RGTA 1FO4A 1YNTE 2Y3AA 4N59A 3HVDA 5G5HA 1WGKA 3MHZA 2WXMA 3MC0B 4GLSC 1E6EB 2RDHA 2KWDA 4H2AA 2QJLA 3Q8BA 4D2KA 2GRIA 2QEJC 3URYA 2AX5A 1SF0A 2G9HD 2JX5A 2KDMA 2WXGA 5EE1A 2WP9B 4KX6B 3AEAB 3HRDD 2Q5WD 1F0ZA 4C7YA 2GI9A 4REZA 4ITKA 1FD6A 4XE0A 1JWUD 1MI0A 3FILA 4NAMA 3C8YA 2WXIA 5C2TB 1N5WA 1SE3A 5HHDG 1MHXA 1SIJA 4DXFA 2LHDA 1FM0D 1YQ4B 3VR9B 1I7HA 1N5XA 5H8YE 3U7ZA 2J4XA 2V3NA 1XEEA 1NVID 1QF6A 4A8XC 4HJGE 2L1AA 2KN4A 2X38A 1ET9A 2XN9C 1JROA 4KGTA 2WU5B 4JWUC 4ZHPA 3BK2A 1LO5D 5FR3A 1DYQA 3BZDB 2LUMA 3AEEB 2CU3A 3P1MA 1I4XA 2J52A 1JMLA 3J9CA 1Y56A 4NJCA 3GP7A 1WRIA 5LNK1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V97 A;  3AE4 B;  3NVV A;  3AE7 B;  3EUB 2;  1TJE A;  3VRA B;  3ZYY X;  2G1E A;  2MJE A;  1IUE A;  3P4P B;  1T3Q A;  1QOF A;  1UWM A;  2BS4 B;  1KRH A;  1ZXI A;  2W3S A;  1XLQ A;  4YTP B;  1JAL A;  1NEN B;  1DGJ A;  3RPF C;  3HVZ A;  2CJO A;  2E3T A;  3B9J A;  3AEC B;  2Y5C A;  1JW9 D;  1OQQ A;  1GT8 A;  1KFY B;  2FBW B;  5AUI A;  2WDV B;  1V8C A;  4US8 A;  1E7P B;  5MPO A;  1JWA D;  1H7W A;  3ETR A;  4N6E B;  1TKG A;  4YT0 B;  3CIR B;  1AYF A;  1CJE A;  1N61 A;  4C7Z A;  3VR8 B;  2H88 B;  4YTM B;  2ACZ B;  1FFU A;  1QT9 A;  2JQR B;  2MJD A;  1EWY C;  1E9M A;  1XLP A;  2W3R A;  2K22 A;  3KWL A;  1A70 A;  3AE9 B;  5C3J B;  1FIQ A;  2L83 A;  2M56 B;  4YSX B;  3NVZ A;  4IDI A;  1YQ3 B;  3B2F A;  3FC4 A;  2EKI A;  3AN1 A;  1WWT A;  3NVY A;  5G5G A;  4C80 A;  4FXC A;  1ROE A;  2KMM A;  3P4S B;  5EE0 A;  1DOY A;  1TKE A;  1YJI A;  1VLB A;  1CZP A;  1H7X A;  3AED B;  3VRB B;  1FFV A;  1J7C A;  2LEK A;  1QOB A;  3WCQ A;  3NRZ A;  2WU2 B;  2MJ3 A;  1ZOY B;  1GAQ B;  1N62 A;  2MH7 A;  2B76 B;  2PVG C;  2WDQ B;  2M19 A;  4YTN B;  2DBY A;  2OHF A;  3AM9 A;  1N60 A;  3AEB B;  4JX1 C;  4N58 A;  4WWM A;  3SR6 A;  1E0Z A;  3AMZ A;  4YXD B;  1ZP0 B;  1FRD A;  1NI3 A;  1ZUD 2;  1QOA A;  1GPX A;  2N0S B;  1NYQ A;  4HRS A;  2CJN A;  1PDX A;  4US9 A;  1WRI A;  4ZOH C;  5GXG B;  4YSZ B;  2K5P A;  3AV8 A;  3LB8 C;  3P4Q B;  1L5P A;  2BT6 A;  1GTE A;  1QLB B;  3SFE B;  1AWD A;  1DOI A;  1N63 A;  1RWS A;  1FO4 A;  1JQ4 A;  1NEK B;  4N59 A;  3P4R B;  3L4P A;  2DWQ A;  5G5H A;  1XO3 A;  1WGK A;  4P6V F;  1NYR A;  3AEF B;  3DWM A;  1XLO A;  1L6V A;  3LXF A;  1FXA A;  3AE8 B;  1J7A A;  1OQR A;  2BS2 B;  3AE6 B;  1E6E B;  1VDV A;  2HTM E;  2W55 A;  3CWI A;  4HRO A;  3AE5 B;  1PUT A;  1DOX A;  2QJL A;  1FMA D;  1WYG A;  1XLN A;  2PVO D;  2AX5 A;  1PFD A;  1SF0 A;  3W5V B;  2JX5 A;  1FXI A;  4ZHO A;  1E10 A;  3AE2 B;  5EE1 A;  1RFK A;  2WP9 B;  2W54 A;  5EE3 A;  2WS3 B;  4KX6 B;  3AEA B;  3HRD D;  1OFF A;  2Q5W D;  1F0Z A;  3W9C B;  2QIE B;  4C7Y A;  2WQY B;  2PKO A;  1JRP A;  4ITK A;  3AEG B;  1KF6 B;  2K9X A;  3AE3 B;  3AE1 B;  1TKY A;  5C2T B;  1N5W A;  5EE9 A;  1RYJ A;  2PIA A;  2BS3 B;  1SIJ A;  1YJJ A;  1FM0 D;  3AH7 A;  1YQ4 B;  3VR9 B;  1L6U A;  1I7H A;  1N5X A;  2L52 A;  3HUI A;  5H8Y E;  3BII D;  1NVI D;  1SB3 C;  4YSY B;  1J7B A;  1R7S A;  1QF6 A;  3DWG C;  4JWS C;  3PO0 A;  1TYG B;  1RM6 C;  2WDR B;  3SFD B;  3FAH A;  1JRO A;  1B9R A;  5H92 C;  2WU5 B;  1FRR A;  1VJK A;  4JWU C;  2H89 B;  4LTU A;  4ZHP A;  1GTH A;  3NS1 A;  2WLB A;  1QOG A;  1JWB D;  3AB5 A;  4WQM A;  3W5U B;  4USA A;  2KAJ A;  3AEE B;  3B2G A;  3CF4 A;  1L0V B;  2CU3 A;  3P63 A;  3P1M A;  5AUK A;  3NVW A;  3ABV B;  4A9A A;  1WXQ A; 
#chains in the Genus database with same CATH topology
 2FUH B;  5E6N A;  3AE7 B;  4G50 A;  4YTP B;  1FNU A;  3RPF C;  1Z2M A;  2BVC A;  2R2O A;  2WDV B;  1H7W A;  1SJE D;  4B95 A;  2H88 B;  3IXS A;  3IT6 B;  1HTO A;  1CK1 A;  2M56 B;  2BPS A;  2FNJ B;  3B2F A;  4IC7 B;  1YIW A;  3QQ8 B;  1P3Q U;  3R2I A;  1WSP A;  2KXJ A;  4NNJ B;  3ENE A;  4KDL B;  4GDL A;  2KFK B;  3NOB A;  4K7W A;  1TS2 A;  1ZP0 B;  1FRD A;  1ZUD 2;  1GPX A;  4TQ1 A;  3N1X C;  3AV8 A;  3LB8 C;  3EEC A;  2BT6 A;  1FPY A;  3ZDM C;  4K1R B;  3APC A;  2LRU A;  2MSE D;  1WM2 A;  1OTR B;  2Z8L A;  5BMG A;  4AJW A;  2DNF A;  1E8Y A;  4ANU A;  2KC2 A;  4XC2 A;  5JHA A;  4DHZ B;  2WXH A;  2IGG A;  4EFO A;  1R4N B;  1CQV A;  2BYF A;  4MGY E;  3KUD B;  3AE1 B;  2LGD A;  4NAW A;  4EEW A;  4FJV B;  5DPR A;  3RNB C;  3W1S C;  4MM3 A;  2YEP F;  3HUI A;  4XZ4 A;  1J7B A;  2VH2 A;  3IAM 1;  2JYT A;  1WJ4 A;  2KT7 A;  1RM6 C;  3U8Z A;  4XWW A;  2KQS A;  3NG0 A;  2G4D B;  1JWB D;  3W5U B;  2OJR A;  4HLE A;  2L32 A;  3R3M A;  3P63 A;  4A3P A;  4YL8 A;  3NVW A;  3ZNI D;  5CTR C;  2KX0 A;  3VRA B;  3A33 B;  3DCG A;  1J8C A;  3M63 B;  5D7G A;  3Q14 C;  1IGD A;  2YVC A;  3SHQ A;  4B6W A;  4S0R A;  3WA0 A;  2MA9 B;  2MJD A;  2KDB A;  4MH0 E;  4NQK E;  2K22 A;  2K8B A;  1TIF A;  2KTF A;  4AP4 C;  1V5O A;  2KKC A;  1H7X A;  1HE8 A;  4PS8 A;  2HD5 B;  3Q3N C;  2LAS A;  5JHB A;  3DPD A;  4IM0 A;  2WU2 B;  2MBB B;  4URK A;  3SR6 A;  3AEB B;  2D3C A;  1ZDX A;  2PW9 A;  2ZW1 A;  1WIA A;  2V3S A;  3IVF A;  5BMI A;  4HCP B;  3KUC B;  2RMM A;  3O65 B;  2N9K A;  3Q8C A;  1WE6 A;  3NS8 A;  4BAX A;  4IUM B;  1WJ6 A;  1K51 A;  2ZNV B;  2MBE A;  5FR6 A;  4JGH B;  1VZ8 A;  3TUO A;  2M0X A;  3CF6 E;  3CWI A;  2WXF A;  4GDK A;  3M95 A;  1Q0W B;  3AE2 B;  2BF8 B;  2K6Q A;  1WX8 A;  1ESF A;  1VD2 A;  1MG4 A;  1R7S A;  1HTQ A;  3RNG C;  1V5T A;  3PS6 A;  4C4V B;  1UGM A;  3UQB A;  3WAP A;  4JQW C;  2ZZP B;  3EC8 A;  4CYE A;  4LCD E;  3N1Z C;  1ZE3 D;  3ABV B;  2K39 A;  3NZ3 A;  1L7Y A;  1E8Z A;  2Z0D B;  2IO1 B;  1I4R A;  3GE8 C;  1D4B A;  3OLM D;  4GOC A;  1JWM D;  2CR5 A;  3BYT B;  4M8N A;  5KHQ A;  1M94 A;  4G3X B;  3AEC B;  1GT8 A;  3OAW A;  1E7P B;  3IFW B;  3W1Y A;  1LFD A;  4W9K A;  3KUZ A;  2ACZ B;  3ZJV A;  2ZVN A;  3EA6 A;  2IO3 B;  2Z0E B;  3V6C B;  4RF1 A;  3NVY A;  2I38 A;  3AN1 A;  1WRD B;  3PZ8 A;  1F2R C;  1WXS A;  5CHV C;  4J3O D;  3HHM A;  3PV1 A;  1N62 A;  2ICI A;  2PVG C;  2AQ1 B;  1UZX B;  4N58 A;  5IOI A;  2LHE A;  3ML8 A;  4YSZ B;  3GB1 A;  4KVG B;  2JXT A;  3UIO B;  3AXC A;  3SFE B;  3OWE B;  1UUP A;  5HFY A;  3L4P A;  4LNO A;  4W9I A;  3RZF A;  2BS2 B;  1SXT A;  2INC C;  3BVZ A;  4DHJ D;  4HPM B;  2PTL A;  4A90 A;  2DZI A;  2MBQ A;  4ZYS A;  4K3B A;  3H8H A;  3N20 C;  1TKY A;  2L05 A;  3IT4 B;  3TL5 A;  2ZNV C;  3BII D;  4K81 A;  1P98 A;  4MSM B;  4KGR A;  3SFD B;  1VR9 A;  1WGH A;  3VUY A;  4FBJ B;  1GTH A;  2LVQ A;  4GGQ A;  1ZW7 A;  3TMP B;  1F77 A;  2V4L A;  4GDL B;  4R3D A;  2C60 A;  1TY2 A;  2JZ3 B;  5LXI B;  3PLU A;  2RPV A;  3KW5 B;  2RD0 A;  4AQ7 A;  3JYU A;  3APD A;  4L23 A;  3W2D A;  1SE4 A;  1KFY B;  4WJQ A;  1TKG A;  3ZTC A;  1WJU A;  1TY0 A;  2OED A;  3H7P A;  1C4A A;  2PE9 A;  1YJI A;  2BBC A;  5C23 A;  2DYO A;  3JSV B;  2ONQ A;  3R7Q A;  2WDQ B;  1E0Z A;  2KFJ A;  2N9L A;  4Q2J A;  4RGO S;  5GXG B;  2WXK A;  2CU1 A;  3Q3F A;  4DDI D;  3MC9 A;  1NI2 A;  4K7U A;  1A5R A;  2ZEQ A;  3HVD A;  2WXM A;  4ZRK A;  2N9E B;  4OVV A;  2RDH A;  2KWD A;  4WJN A;  3HM3 A;  2QJL A;  2QEJ C;  3DVN U;  4EOY A;  4FHK A;  4FN2 A;  2WP9 B;  3VH4 B;  4ICU A;  4XE0 A;  4NAM A;  2WXI A;  5C2T B;  2C5L C;  1FM0 D;  3DOW A;  3U7Z A;  2V3N A;  1Y8R C;  1QF6 A;  2KTR A;  4KGT A;  2KDF B;  3L10 B;  3VHT C;  1GUA B;  1GJZ A;  5FR3 A;  3DBR I;  3BZD B;  3RUI B;  2J52 A;  3J9C A;  3PVL A;  2R2Q A;  2GBM A;  2FID A;  4P1B C;  4JIO U;  1AN8 A;  1XD3 B;  4RMA A;  4OZC A;  1DGJ A;  2NBU A;  4LNN A;  4WAF A;  2MX2 A;  3W1S A;  4KIK A;  2FCN A;  5AUI A;  3ETR A;  3WAL A;  1EWY C;  2W3R A;  1LM8 B;  2M0A A;  2L83 A;  3UIP B;  5C3J B;  3R8B A;  1KM7 A;  4W9E A;  1VLB A;  4ZRQ A;  2V9H A;  1J7C A;  2KMC A;  2G4S A;  2WX1 A;  4I6L B;  2N1V A;  5AUK A;  4A3O A;  3AM9 A;  1WGY A;  1N60 A;  3EGR A;  2IGH A;  4MGK E;  1IGC A;  1ZPS A;  3VH3 B;  1M4V A;  2CJN A;  1PDX A;  2V3P A;  4MT5 A;  4F1S A;  3PRP B;  2MEK A;  3KH0 A;  3JSV A;  5AZH A;  1MHH E;  2BYE A;  2J53 A;  2WYQ A;  3ZXR A;  3NHE B;  4HDQ A;  2DWQ A;  2LVO A;  4HK2 A;  4XDC A;  3PPA A;  4NJ7 A;  1TT5 B;  1OQR A;  2BQQ A;  4UDU C;  4HRO A;  4C56 C;  3UQA A;  1ZXH A;  4GN1 A;  3N30 A;  1RLF A;  3ZKJ C;  3U52 E;  2RDB C;  2W54 A;  3DVG Y;  1QIL A;  3AEG B;  2LGS A;  3E9S A;  4W9H A;  3PRM B;  2UYZ B;  5E6O A;  3SDL C;  2N1W A;  1SB3 C;  3PO0 A;  1YOV B;  2JXX A;  5AEK B;  4RCO A;  2JY6 A;  4XX5 A;  2PMV A;  2WLB A;  1QOG A;  1T5X D;  3B2G A;  2LRW A;  3APF A;  3BYY B;  3UIN B;  2O2V B;  2JRI B;  4XGA B;  3Q3M C;  4OW0 A;  1E8W A;  4IM2 A;  2PLP A;  3M3J A;  3ZO5 B;  4WWP A;  4B0M A;  2WXL A;  3FKY A;  3DHG C;  4P7I A;  1CMX B;  1P1A A;  3B9J A;  3KYC D;  2IBI B;  5CHW A;  3ZIM A;  2L00 B;  3GOE A;  3I63 C;  2JUO A;  2L7R A;  3AI5 A;  3CMM B;  1ROE A;  2KDE B;  1S3S G;  2QHO A;  4S17 A;  1C1Y B;  2LFI A;  3VRB B;  4JX1 C;  2L3Z A;  4HPL B;  1TS3 A;  2WXR A;  3KWV A;  1NI3 A;  1E5W A;  3PRZ A;  4I6N B;  1WM3 A;  1HXY D;  4IKG A;  3A9K A;  4HCN B;  4ZOH C;  1KJT A;  2LJI A;  1KOT A;  4ARC A;  4M0W A;  3TJP A;  5BYS A;  2BKR B;  1DOI A;  4TQ0 A;  1JQ4 A;  5JH5 C;  1NEK B;  3PSE B;  1NYR A;  1FNV A;  1XLO A;  3DBR B;  3AE8 B;  1J7A A;  2W55 A;  3AE6 B;  2ZW0 A;  1WYG A;  4JE3 B;  2KVZ A;  4M02 A;  2LVP A;  1PFD A;  1C3T A;  4ZHO A;  1FXI A;  3K9O B;  4HKZ E;  4BZA A;  1TBE A;  1BXT A;  1Z5S B;  2SEB D;  3KVF B;  2WWZ A;  5TR5 A;  3QIJ A;  3ZW3 A;  5D3D A;  3ML9 A;  5KHO A;  1C76 A;  1MVK A;  2MW5 A;  2H89 B;  2UU7 A;  2GBJ A;  3V62 A;  1PGX A;  3PHW B;  2LXA A;  2D3B A;  3O13 A;  4DXG A;  1SEB D;  1P7E A;  1AAR A;  1WMH A;  4G11 A;  1EU3 A;  3ZJU A;  1NEN B;  1FXT B;  4W9G A;  5HI1 A;  4NY0 A;  3N3K B;  3MTN B;  1LGR A;  1OQQ A;  4WWN A;  2M4N A;  2D3G A;  3VTU A;  4WWO A;  4W9F A;  3PZ7 A;  3ZGZ A;  2HDE A;  1UD7 A;  1FFU A;  3PHX B;  5IKC M;  1WF9 A;  1A70 A;  3U30 A;  2W82 A;  4A6Q A;  4A55 A;  4C80 A;  2EKI A;  3ZNZ B;  3AUL A;  3A9J A;  1QOB A;  3H7S A;  4IW0 A;  3WCQ A;  5LXH A;  2E6X A;  3PZD A;  2CHX A;  3Q8E A;  4AJY B;  2NTS A;  2KLG A;  4YTN B;  2DBY A;  3R66 C;  3AU5 A;  4RH6 A;  3QCA A;  5DCN A;  1WYW B;  2KTR B;  4DBG A;  2WXN A;  4E3C A;  2DX5 B;  1AWD A;  2WDT B;  1I4Q A;  1QQR A;  1WZ0 A;  2AQ2 B;  3NUH B;  3AEF B;  1L6V A;  2DZJ A;  2KWC A;  1UH6 A;  3IBE A;  2K8H A;  1P7F A;  3ZVV A;  5IA7 A;  2JWU A;  2L8J A;  1K53 A;  1OFF A;  3L13 A;  4HXD A;  4GDK B;  2M17 A;  2WQY B;  1YX6 B;  2PKO A;  3Q2A C;  1KF6 B;  3DQV A;  2WXO A;  4KIK B;  2JPH A;  3OJ4 B;  1RYJ A;  2IY0 B;  2D2Q A;  1GB4 A;  2LGI A;  1WZ3 A;  3B08 A;  4GXB A;  4IWO A;  4YSY B;  1WX9 A;  3DWG C;  3ALB A;  1B9R A;  4DHZ E;  1VJK A;  2JRH A;  1WR1 A;  1GC6 A;  4IOI E;  3ZJT A;  2MQJ A;  2KAJ A;  2DLB A;  5IN7 A;  4LDT D;  2JWZ A;  1MJD A;  2TSS A;  1V97 A;  3RNC C;  3DBH B;  3I5J C;  1P0R A;  3Q3J A;  2YEP B;  4RF0 A;  1T3Q A;  2LZ6 A;  2AL6 A;  3ZDT A;  4QAY A;  2IY1 B;  2MHJ A;  3HVZ A;  2NS5 A;  5J2R A;  1JW9 D;  2LI5 A;  4ASW C;  3T8M A;  2MP2 A;  1QZE A;  1N6Z A;  1C79 A;  2EKE C;  2IZV B;  1E9M A;  3AE9 B;  3RYT A;  2BWE S;  3QX1 A;  3DBL B;  2KMM A;  4CHK A;  1DOY A;  1D5X C;  2IPK D;  1FFV A;  1L0Y B;  4OZA A;  4NZL B;  2DAJ A;  2QCZ A;  2JSV X;  3HK0 A;  1TS5 A;  3IAS 1;  1UBI A;  1WJN A;  4GIV A;  1YNT E;  1IYF A;  5G5H A;  3MHZ A;  1E6E B;  1GC7 A;  4NQL B;  3Q8B A;  2HTH A;  2PEA A;  4KZ0 A;  1V86 A;  1V2Y A;  2FCM A;  2N4F A;  2KDM A;  2M1M A;  4BFR A;  3HRD D;  3EFC A;  3NY5 A;  2QDF A;  4C7Y A;  1FD6 A;  3C8Y A;  3UF8 A;  1SIJ A;  3QK0 A;  4DXF A;  2LHD A;  3MC8 A;  3VR9 B;  3JVZ X;  2J4X A;  3H6N A;  2NPT A;  2K25 A;  2XN9 C;  1JRO A;  4JWU C;  3BK2 A;  4ZRJ A;  1OQY A;  1WH3 A;  4RM8 A;  1DYQ A;  1UEL A;  3AEE B;  4WJP A;  3RT3 B;  4NJC A;  2WXP A;  3ZXV A;  5LNK 1;  4ZRI A;  3PGE A;  4M01 A;  1PQS A;  3RUL A;  4DK5 A;  2NCN A;  1J19 A;  1XT9 B;  3LJ3 A;  1V49 A;  3R2T A;  2LXC A;  4BKS D;  4N6E B;  1HA5 A;  1R4M B;  1AYF A;  1N61 A;  3V6E B;  2JQR B;  2V4I B;  4W9L A;  2BYT A;  5HG2 A;  2MRP A;  3ZRC A;  4GMV A;  2IO2 B;  2K8C A;  1AW7 A;  2ZCB A;  4WAA A;  3VTW A;  1ZOY B;  1WXV A;  1UGJ A;  2JF5 A;  1GAQ B;  4J6I A;  2INN E;  2DZM A;  4EKU A;  4FLH A;  2VZK D;  3H1U A;  4DHJ B;  2MBO A;  3N9Y C;  1GB1 A;  1C77 A;  4OZB A;  1PGA A;  1GTE A;  4MDK E;  3L54 A;  2O6V B;  2D10 A;  2GLS A;  4YWG G;  1G6J A;  1HZ5 A;  2LWP A;  3V3X A;  1VDV A;  2HTM E;  4GSW A;  1U4A A;  5D94 A;  2N7D A;  3A4S C;  2BTE A;  4RFB A;  4WIP A;  1YN5 A;  3CSF A;  2OOB B;  4EZJ A;  3ZQ4 A;  3RFZ B;  3TEZ A;  2WS3 B;  3I9V 1;  3E56 A;  2WGS A;  2RR9 A;  2JU6 X;  2K9X A;  3TBL D;  3BVG A;  1SE2 A;  4FJZ A;  2BW2 A;  2DAF A;  3GS2 A;  3CST A;  3WAO A;  4LJO B;  2KX3 A;  1I4G A;  1TYG B;  2CHZ A;  3SU8 X;  2D07 B;  5T8I A;  1YMH E;  2G3Q B;  4DQO C;  4LTU A;  1R4M I;  1UNS A;  1IPG A;  2KC1 A;  4WQM A;  2MWS B;  2NBW B;  1NDD A;  4HEA 1;  4LK0 M;  4A9A A;  3DVN V;  1EF1 A;  2XNA C;  1TJE A;  5I4D A;  1WE7 A;  2MJE A;  4RM9 A;  1ZXI A;  3N1Y C;  1JWS D;  2N9P C;  2O2V A;  2AL3 A;  4ZDV A;  5GMV A;  3TSS A;  4US8 A;  1JWA D;  1V80 A;  1CJE A;  4C7Z A;  4YTM B;  1V1P A;  3IHP C;  4TUU A;  2J0K A;  1FIQ A;  1FCC C;  1MPE A;  3NZU A;  3P4S B;  1L4Z B;  3ZLZ A;  5G55 A;  4MJS A;  2AYO B;  3K9P B;  2MH7 A;  4EE2 A;  2B76 B;  5AZG A;  5J17 A;  3RNE C;  4ANW A;  4BKT A;  3T3N A;  2PPH A;  2JT4 B;  2XEW A;  4CO7 A;  5C1Z A;  1EM7 A;  5BO4 B;  4JL9 A;  4KKI A;  2KJH B;  3QC8 B;  3MHS D;  3RNF C;  2J7Q B;  1T0R C;  4M0W B;  1T6B X;  1XLN A;  4LLG M;  3Q6B A;  3W5V B;  4HVB A;  2DZK A;  1E10 A;  5EE3 A;  2W9N A;  3RNA C;  1SIF A;  4K7S A;  2KMA A;  1JRP A;  3UGB B;  5L95 C;  1ACC A;  3DHH C;  2KJ6 A;  2R61 A;  3T3O A;  4C4V A;  3I57 A;  3DBL I;  5FKA C;  1BML C;  3B1L X;  1WXM A;  4JWS C;  2KJR A;  2JYE A;  2WHI A;  4K3C A;  1ZKH A;  1T0Q C;  2AQ3 B;  4KSL C;  5DPW A;  3U7D A;  5FK9 C;  2RSU A;  3BVM A;  4BKS A;  1WX7 A;  4PT5 A;  1XLQ A;  3VAW A;  1V8C A;  3HIZ A;  1EWC A;  4KGS A;  2MCN B;  3KWL A;  3NZS A;  3L16 A;  5E6J A;  3FC4 A;  2EEL A;  4P16 A;  1YN4 A;  3VXW A;  1IBX A;  2IYD B;  2WXJ A;  4LNK A;  4ACF A;  2M19 A;  4KKJ A;  2KLC A;  4EUT A;  4YXD B;  2VH1 A;  4LJP B;  4GB9 A;  3PTF C;  4ZYN A;  1FEH A;  4XDD A;  1T0Y A;  2J42 A;  3DDC B;  1K52 A;  1BUI C;  5IAA C;  1QLB B;  4MEL A;  2FIF A;  4E71 A;  1D6E C;  1WY8 A;  4PS7 A;  3MP9 A;  2V1Y A;  1DOX A;  3FIL B;  3TCA A;  1K8R B;  2CKH B;  1D5M C;  2PVO D;  1KLU D;  2QMT A;  3DHI C;  5BYQ A;  4EZL A;  5LLI A;  4CQN A;  1RFK A;  4MH8 A;  4BOS C;  3Q69 A;  3W9C B;  4MAC A;  2C7M B;  1ET6 A;  3QWZ B;  3C0R B;  2KD0 A;  3RI7 C;  1XF5 L;  1YJJ A;  1L6U A;  3V05 A;  4WQO B;  1KTK A;  3HM6 X;  1HQR D;  4ZRP A;  3UI3 A;  1X1M A;  1L4D B;  1YX5 B;  3CF4 A;  1L0V B;  5EDS A;  2A5U A;  2LUE A;  2IJ0 A;  3PRE A;  4HJK A;  3PLV A;  2G1E A;  3SEB A;  2AEH A;  3P4P B;  2XK5 B;  2ZVO A;  2FCQ A;  2MLB A;  1PYW D;  1JAL A;  1EU4 A;  1KH0 A;  2JZP A;  2EMT A;  2E3T A;  2Y5C A;  3BY4 B;  2FBW B;  2A4Z A;  5MPO A;  3RMK C;  2GBN A;  1TS4 A;  5G2N A;  1QT9 A;  4FUL A;  1T0S C;  4KV2 A;  2N7E A;  3MJW A;  3ZNH B;  2KFK A;  5EE0 A;  2ON8 A;  1CZP A;  4II2 B;  5IO9 A;  2KQ7 A;  3NRZ A;  3QAR A;  1E7V A;  3T9L A;  2OJW A;  2KHW B;  2KNB A;  1B1Z A;  1E8X A;  5CX3 A;  3P4Q B;  4RNA A;  5DPT A;  2L76 A;  4RGT A;  4W9C A;  1WGK A;  3H9D A;  1WFY A;  2KAN A;  5D2M B;  3R7R A;  2GRI A;  4X57 B;  3URY A;  2AX5 A;  1SF0 A;  2VRR B;  1JRU A;  2G9H D;  2JX5 A;  2WXG A;  3RN9 C;  4E74 A;  4KX6 B;  3ZUN A;  1F0Z A;  1WR6 E;  1JWU D;  4KSK C;  1MI0 A;  3FIL A;  1N5W A;  1SE3 A;  1P9D U;  1F52 A;  1MHX A;  1YQ4 B;  1I7H A;  1N5X A;  2JVC A;  4A8X C;  4ICV A;  4PK1 A;  2L1A A;  3LDZ E;  4BVU C;  2X38 A;  2WU5 B;  5CHF A;  5JZE B;  3ONS A;  2GBK A;  3A9J B;  2DYB A;  2LUM A;  3TIX A;  5J18 A;  3P1M A;  2PJH A;  1YJ1 A;  3AE4 B;  1ZDV A;  1IUE A;  4TSS A;  2AWT A;  2W3S A;  2KDI A;  2I1J A;  2IO0 B;  3Q8A A;  4YT0 B;  3X23 A;  1STE A;  2ZCC A;  1XLP A;  2K3U A;  4PYU A;  3VUX A;  4IDI A;  2NVU I;  2DHZ A;  2FUG 1;  5G5G A;  2QC8 A;  2KYW A;  3AED B;  4HDO A;  1I4P A;  3P42 A;  1BT0 A;  2OHF A;  2QIL A;  4WWM A;  5JXV A;  1VZ6 A;  5HKH A;  4HRS A;  4W9D A;  4JPS A;  1C4C A;  1Q5W B;  3TEX A;  2KQ4 X;  4AS1 A;  3MJ5 A;  1OGW A;  3RCZ A;  2IND C;  1J0G A;  3DWM A;  5D3I B;  2BGF A;  3LXF A;  3WAN A;  5AZF A;  2REX A;  3VQI A;  1WMH B;  2X8X X;  2D5G A;  2KN5 A;  1RRB A;  2O6V A;  1WXA A;  3M62 B;  3PT2 B;  2WNM A;  5BMH A;  4OVZ A;  2BYV E;  2M8S A;  2KZR A;  1MFW A;  3MFG A;  3D32 A;  3AE3 B;  2C9W B;  3VDZ A;  1I4H A;  2MBH A;  4XYC A;  5EE9 A;  2KOX A;  3Q3O C;  2PIA A;  3AH7 A;  1V9J A;  1XCQ L;  2L52 A;  5E6P A;  3VFK A;  1LQB A;  4PS3 A;  2I2Y A;  2SAK A;  4W9J A;  2WDR B;  3TEY A;  2RPQ A;  4MJS B;  2EMS A;  2IDY A;  4USA A;  4WH4 A;  4OHJ A;  4MGI E;  1L0X B;  4MEM A;  2J0J A;  1WXQ A;  2LGY A;  3GE3 C;  2GOW A;  3I3T B;  3BWU D;  3ZRF A;  4ARI A;  1XCT L;  4IM3 A;  2KWV B;  2NTT A;  2RDG A;  2CJO A;  2RGF A;  3GZN I;  2ZPY A;  1S1Q B;  2KO3 A;  2CS4 A;  3CIR B;  3L08 A;  1HEZ E;  5DPS A;  2BWF A;  3L0W B;  2WX0 A;  4YSX B;  3NVZ A;  1EF5 A;  4FXC A;  4MSQ B;  4WUR A;  5TSS A;  1V81 A;  4DWF A;  2LEK A;  3A1Q B;  2MJ3 A;  4LNI A;  1WGG A;  4JLC A;  3N32 A;  4HWI B;  4KDI C;  2Y5P A;  3AMZ A;  4GU2 A;  1EO6 A;  1VZ7 A;  2I1K A;  1SJH D;  4US9 A;  2HE7 A;  4A20 A;  1TGZ B;  1XQQ A;  5D6J B;  2L0F A;  1ZGU B;  3AU4 A;  1N63 A;  2Z59 B;  3ECI A;  2V0G A;  1KLV A;  1IP9 A;  1D3Z A;  4IG7 B;  4P6V F;  3EHV A;  4XWT A;  4RGN A;  4B0E A;  1OEY A;  1KLG D;  3AE5 B;  1PUT A;  1H8C A;  4FAD A;  1I35 A;  1VCB A;  2C7H A;  1LXD A;  2QIE B;  2J0M A;  3WIM A;  4AOF A;  1QKZ A;  2MP2 B;  3RD2 A;  2LGX A;  1MG8 A;  4TV3 A;  4HPP A;  3OJ3 A;  1E7U A;  3A4R A;  5BYR A;  1SGH A;  2Y5B B;  2L0T A;  1FRR A;  2FE8 A;  2N7J A;  2GBR A;  2JZZ A;  3NS1 A;  1E90 A;  1WGD A;  3AB5 A;  2BB6 A;  4DDG D;  4BBN C;  4L2Y A;  4N9F 4;  1WGR A;  3ZNG C;  3ZYY X;  2GMI C;  3NJT A;  2LJ5 A;  3JW0 X;  2DYM A;  2ZJD A;  1C4P A;  4II3 B;  2FCS A;  2VZK B;  2INP E;  4NAW B;  4IWP A;  4ANV A;  4OVU A;  3LYY A;  2K6D B;  3H7P B;  4MM3 B;  3DBH I;  2IGD A;  3KQ4 A;  3VR8 B;  2KWU B;  3V60 A;  2B3A A;  1ENF A;  1FNW A;  2N9X A;  1TKE A;  1F1H A;  3WAM A;  4L1B A;  3U4E G;  3V61 A;  1XXG A;  4FA6 A;  1SSN A;  3QA8 A;  2NMQ A;  3VVW B;  2K5P A;  1C9F A;  1L5P A;  2G45 B;  3TEW A;  2QSD A;  4TKN A;  1YD8 U;  1RWS A;  1K50 A;  3P4R B;  1XO3 A;  4AUQ C;  2LMC A;  2O6V D;  3OG5 A;  1FXA A;  3DBS A;  1UWX A;  3BIN A;  2HJ8 A;  4M00 A;  3VTV A;  1FMA D;  2CHW A;  4HKQ A;  4BOZ B;  4O1N A;  2DEN B;  4TMA B;  1GOZ A;  2GB1 A;  4FHJ A;  2XBB C;  1JCK B;  4EZK A;  4LDT B;  1HZ6 A;  3U2S C;  1F9J A;  2BS3 B;  3BK1 A;  1H4R A;  2KVR A;  2ZPN A;  1V1P B;  3GZN B;  1NBF C;  1EUV B;  1L2N A;  3FAH A;  2UWQ A;  5H92 C;  1WI0 A;  2KAC A;  3SD5 A;  1I42 A;  1GNU A;  4F8C B;  1V6E A;  1YN3 A;  1D5Z C;  3X0W A;  3DVG X;  3Q8F A;  1Q10 A;  3EFU A;  4WJO A;  3NVV A;  3EUB 2;  4FJY A;  3VUW A;  2D11 A;  2WXQ A;  1QOF A;  1UWM A;  2BS4 B;  1KRH A;  4G0N B;  1RAX A;  1RFA A;  3QJZ A;  3RZW C;  1UF0 A;  2LD9 A;  3C19 A;  5IP4 D;  1V1O A;  4ANX A;  2BB5 A;  2XK5 A;  4NJ6 A;  1FCL A;  1F2R I;  4B9K A;  3IG3 A;  1YQ3 B;  1WWT A;  1PGB A;  1VRA B;  2BKF A;  1C78 A;  2NR2 A;  4DXA B;  2K0P A;  2FAZ A;  1TZO A;  4C00 A;  3KLS X;  4AWJ A;  5L83 A;  1YQB A;  1R4N I;  1IBX B;  1QOA A;  4MGZ E;  2N0S B;  4IWQ A;  1NYQ A;  2C7N B;  4KZC A;  4RGM A;  1SBB B;  3B0A A;  2KK8 A;  3ZTD A;  1OEY J;  2D3A A;  3S2A A;  4NPN A;  1FO4 A;  1ISN A;  2Y3A A;  4N59 A;  1GG3 A;  4LNF A;  3MC0 B;  4GLS C;  1Q1O A;  4M8M A;  4BKG A;  2K1F A;  4H2A A;  1SE9 A;  1UBQ A;  3KYD D;  4D2K A;  1TZ1 A;  2PE6 B;  4F7Z A;  5EE1 A;  3L17 A;  3AEA B;  2Q5W D;  2GI9 A;  4REZ A;  4ITK A;  2NBV B;  4I6P A;  5HHD G;  3A9K B;  2ASQ A;  5H8Y E;  4BBN F;  3P2B A;  1XEE A;  2YLM A;  1NVI D;  2HJ1 A;  4HJG E;  1TTN A;  2KN4 A;  4PYZ A;  1ET9 A;  3QHT A;  4ZHP A;  1LO5 D;  3QAQ A;  2NPT B;  2CU3 A;  3A1Q A;  1I4X A;  1JML A;  4P1C C;  1Y56 A;  3GP7 A;  1WRI A; 
#chains in the Genus database with same CATH homology
 3AE4 B;  3AE7 B;  1ZDV A;  1IUE A;  4TSS A;  1AN8 A;  2W3S A;  4OZC A;  4YTP B;  1FNU A;  1DGJ A;  3RPF C;  4WAF A;  3W1S A;  5AUI A;  3Q8A A;  2WDV B;  3R2T A;  3ETR A;  1H7W A;  4N6E B;  1HA5 A;  1SJE D;  4YT0 B;  1AYF A;  1N61 A;  2H88 B;  3IXS A;  2JQR B;  1STE A;  2V4I B;  1EWY C;  1XLP A;  2K3U A;  2W3R A;  3IT6 B;  2M0A A;  2L83 A;  5C3J B;  2BYT A;  1CK1 A;  2M56 B;  5HG2 A;  3R8B A;  4IDI A;  3B2F A;  2FUG 1;  5G5G A;  1VLB A;  3R2I A;  4ZRQ A;  1WSP A;  3AED B;  1AW7 A;  1J7C A;  1I4P A;  1ZOY B;  1UGJ A;  1GAQ B;  3P42 A;  2INN E;  5AUK A;  3AM9 A;  2OHF A;  2QIL A;  4WWM A;  1N60 A;  2VZK D;  5JXV A;  1VZ6 A;  1TS2 A;  1ZP0 B;  1FRD A;  1ZUD 2;  3EGR A;  2IGH A;  1GPX A;  1IGC A;  3N9Y C;  1ZPS A;  4HRS A;  1M4V A;  4JPS A;  2CJN A;  1PDX A;  2V3P A;  4TQ1 A;  4MT5 A;  1C4C A;  2MEK A;  1GB1 A;  3TEX A;  1C77 A;  3AV8 A;  4OZB A;  2KQ4 X;  3LB8 C;  1MHH E;  4AS1 A;  2BT6 A;  1PGA A;  3MJ5 A;  2J53 A;  1GTE A;  4YWG G;  1HZ5 A;  2DWQ A;  4XDC A;  3V3X A;  3DWM A;  5D3I B;  3LXF A;  1VDV A;  2Z8L A;  2HTM E;  1OQR A;  3VQI A;  4UDU C;  5BMG A;  2D5G A;  4HRO A;  4C56 C;  1ZXH A;  2BTE A;  4RFB A;  4WIP A;  3U52 E;  1YN5 A;  2WXP A;  2W54 A;  3ZQ4 A;  3RFZ B;  5BMH A;  2WS3 B;  2WNM A;  3TEZ A;  4OVZ A;  3I9V 1;  3E56 A;  1QIL A;  2JU6 X;  2IGG A;  2WXH A;  3AEG B;  2K9X A;  3MFG A;  3E9S A;  1CQV A;  3BVG A;  3AE3 B;  1I4H A;  3AE1 B;  1SE2 A;  5EE9 A;  2BW2 A;  2PIA A;  3AH7 A;  1XCQ L;  2L52 A;  2YEP F;  3HUI A;  3GS2 A;  1SB3 C;  1J7B A;  2I2Y A;  2SAK A;  2JYT A;  3IAM 1;  3PO0 A;  1I4G A;  1TYG B;  1RM6 C;  2WDR B;  4XWW A;  5T8I A;  4RCO A;  3TEY A;  1YMH E;  4DQO C;  4LTU A;  2PMV A;  1UNS A;  2WLB A;  1QOG A;  1JWB D;  4WQM A;  3W5U B;  2IDY A;  4USA A;  4WH4 A;  4OHJ A;  1T5X D;  3B2G A;  1L0X B;  2L32 A;  3BYY B;  3P63 A;  3NVW A;  4HEA 1;  4LK0 M;  4A9A A;  1WXQ A;  2XNA C;  4OW0 A;  1TJE A;  5I4D A;  3VRA B;  2MJE A;  2PLP A;  1ZXI A;  1JWS D;  4B0M A;  3BWU D;  4ARI A;  1XCT L;  2NTT A;  2RDG A;  2CJO A;  2WXL A;  3B9J A;  5D7G A;  3TSS A;  4US8 A;  1IGD A;  1JWA D;  3CIR B;  1CJE A;  4C7Z A;  4YTM B;  2MJD A;  1HEZ E;  1V1P A;  2K22 A;  1FIQ A;  1FCC C;  4YSX B;  3NVZ A;  1MPE A;  4FXC A;  1ROE A;  3P4S B;  4WUR A;  5TSS A;  1L4Z B;  2LFI A;  1H7X A;  3VRB B;  2LEK A;  2WU2 B;  2MJ3 A;  2MH7 A;  4EE2 A;  2B76 B;  4JX1 C;  2Y5P A;  3SR6 A;  3AEB B;  1ZDX A;  1TS3 A;  2WXR A;  3AMZ A;  1NI3 A;  3KWV A;  2PW9 A;  2ZW1 A;  1VZ7 A;  3T3N A;  5BMI A;  1HXY D;  4IKG A;  1SJH D;  4US9 A;  4ZOH C;  2RMM A;  2LJI A;  4ARC A;  2N9K A;  4M0W A;  3Q8C A;  1EM7 A;  5BYS A;  4KKI A;  1DOI A;  1K51 A;  1N63 A;  4TQ0 A;  1JQ4 A;  2V0G A;  1NEK B;  4P6V F;  1NYR A;  1VZ8 A;  1FNV A;  1XLO A;  4RGN A;  4XWT A;  3TUO A;  4B0E A;  3AE8 B;  1J7A A;  2W55 A;  3AE6 B;  2ZW0 A;  3CWI A;  1KLG D;  3AE5 B;  1PUT A;  2WXF A;  1WYG A;  4JE3 B;  1T6B X;  1XLN A;  1PFD A;  4LLG M;  3W5V B;  4ZHO A;  1FXI A;  1E10 A;  3AE2 B;  5EE3 A;  4HKZ E;  2QIE B;  1JRP A;  1ACC A;  1BXT A;  2SEB D;  1QKZ A;  1ESF A;  2R61 A;  3T3O A;  3I57 A;  5D3D A;  5FKA C;  1BML C;  1R7S A;  5BYR A;  1C76 A;  4JWS C;  1MVK A;  2JYE A;  1FRR A;  2FE8 A;  2N7J A;  2H89 B;  3NS1 A;  1PGX A;  3AB5 A;  2AQ3 B;  2BB6 A;  3O13 A;  4DXG A;  1ZE3 D;  3ABV B;  4L2Y A;  1SEB D;  3NZ3 A;  1P7E A;  5FK9 C;  1I4R A;  3ZYY X;  1D4B A;  1EU3 A;  3BVM A;  1JWM D;  2DYM A;  4PT5 A;  1XLQ A;  3ZJU A;  3BYT B;  1NEN B;  5HI1 A;  1C4P A;  3AEC B;  1OQQ A;  4NAW B;  2VZK B;  1GT8 A;  2INP E;  1V8C A;  1E7P B;  3LYY A;  3PZ7 A;  3ZGZ A;  1EWC A;  2HDE A;  4MM3 B;  2IGD A;  3KQ4 A;  3VR8 B;  1FFU A;  4KGS A;  2ACZ B;  3ZJV A;  3KWL A;  3EA6 A;  1A70 A;  5E6J A;  4RF1 A;  2W82 A;  4A6Q A;  1ENF A;  4A55 A;  3FC4 A;  2I38 A;  2EKI A;  3AN1 A;  3NVY A;  4C80 A;  2EEL A;  4P16 A;  1FNW A;  1TKE A;  1YN4 A;  1IBX A;  1QOB A;  2WXJ A;  4L1B A;  3WCQ A;  3PZ8 A;  2E6X A;  1F2R C;  3U4E G;  4J3O D;  3Q8E A;  1N62 A;  2ICI A;  2NTS A;  2AQ1 B;  2PVG C;  2M19 A;  4YTN B;  2DBY A;  4KKJ A;  4N58 A;  4YXD B;  1XXG A;  4RH6 A;  1SSN A;  2LHE A;  2NMQ A;  4YSZ B;  3GB1 A;  1FEH A;  2JXT A;  4XDD A;  2K5P A;  1C9F A;  2J42 A;  1L5P A;  1K52 A;  3TEW A;  2QSD A;  1BUI C;  2WXN A;  1QLB B;  3SFE B;  1AWD A;  3OWE B;  1UUP A;  1RWS A;  1I4Q A;  5HFY A;  1K50 A;  3P4R B;  1QQR A;  3L4P A;  1XO3 A;  2AQ2 B;  2LMC A;  3NUH B;  3AEF B;  1D6E C;  1L6V A;  1FXA A;  2BS2 B;  3MP9 A;  1SXT A;  1UWX A;  1DOX A;  3FIL B;  1FMA D;  3BVZ A;  4HKQ A;  1D5M C;  2PVO D;  1KLU D;  2QMT A;  2PTL A;  5BYQ A;  1P7F A;  4A90 A;  4CQN A;  4O1N A;  1RFK A;  4MH8 A;  2JWU A;  1K53 A;  3Q69 A;  1OFF A;  4GDK B;  3W9C B;  4TMA B;  2WQY B;  1GOZ A;  2GB1 A;  2PKO A;  4MAC A;  4ZYS A;  1KF6 B;  1ET6 A;  1JCK B;  3H8H A;  2WXO A;  1TKY A;  1HZ6 A;  1XF5 L;  1RYJ A;  3U2S C;  2BS3 B;  3IT4 B;  1YJJ A;  1GB4 A;  3BK1 A;  1L6U A;  2LGI A;  3V05 A;  3BII D;  4YSY B;  1V1P B;  3DWG C;  1KTK A;  4KGR A;  3SFD B;  3FAH A;  1HQR D;  1VR9 A;  4ZRP A;  5H92 C;  1B9R A;  1VJK A;  2KAC A;  4IOI E;  3UI3 A;  1GTH A;  3ZJT A;  1L4D B;  1F77 A;  2KAJ A;  3CF4 A;  1L0V B;  1D5Z C;  1YN3 A;  2DLB A;  3Q8F A;  1Q10 A;  2IJ0 A;  4GDL B;  4R3D A;  2TSS A;  1V97 A;  3NVV A;  3EUB 2;  1TY2 A;  2G1E A;  3SEB A;  4RF0 A;  2YEP B;  3P4P B;  2RPV A;  1T3Q A;  1QOF A;  1UWM A;  2WXQ A;  2BS4 B;  1KRH A;  4AQ7 A;  1PYW D;  1JAL A;  1EU4 A;  1KH0 A;  4L23 A;  3HVZ A;  3W2D A;  1SE4 A;  2JZP A;  2E3T A;  2Y5C A;  1JW9 D;  1KFY B;  2FBW B;  5MPO A;  1V1O A;  1TKG A;  2BB5 A;  1TS4 A;  1C79 A;  2OED A;  1TY0 A;  1QT9 A;  1FCL A;  1F2R I;  1E9M A;  3AE9 B;  1YQ3 B;  1C4A A;  1WWT A;  1PGB A;  2KMM A;  1VRA B;  5EE0 A;  1DOY A;  1D5X C;  1YJI A;  1C78 A;  2ON8 A;  2IPK D;  1CZP A;  1FFV A;  2K0P A;  2BBC A;  2DYO A;  3NRZ A;  1L0Y B;  1TZO A;  4OZA A;  3KLS X;  4NZL B;  2ONQ A;  2WDQ B;  1E0Z A;  1IBX B;  2JSV X;  1QOA A;  2N0S B;  2N9L A;  1NYQ A;  1TS5 A;  4Q2J A;  4RGO S;  1B1Z A;  5GXG B;  2WXK A;  4RGM A;  3IAS 1;  1SBB B;  3P4Q B;  4RNA A;  4RGT A;  1FO4 A;  1YNT E;  2Y3A A;  4N59 A;  3HVD A;  5G5H A;  1WGK A;  3MHZ A;  2WXM A;  3MC0 B;  4GLS C;  1E6E B;  2RDH A;  2KWD A;  4H2A A;  2QJL A;  3Q8B A;  4D2K A;  2GRI A;  2QEJ C;  3URY A;  2AX5 A;  1SF0 A;  2G9H D;  2JX5 A;  2KDM A;  2WXG A;  5EE1 A;  2WP9 B;  4KX6 B;  3AEA B;  3HRD D;  2Q5W D;  1F0Z A;  4C7Y A;  2GI9 A;  4REZ A;  4ITK A;  1FD6 A;  4XE0 A;  1JWU D;  1MI0 A;  3FIL A;  4NAM A;  3C8Y A;  2WXI A;  5C2T B;  1N5W A;  1SE3 A;  5HHD G;  1MHX A;  1SIJ A;  4DXF A;  2LHD A;  1FM0 D;  1YQ4 B;  3VR9 B;  1I7H A;  1N5X A;  5H8Y E;  3U7Z A;  2J4X A;  2V3N A;  1XEE A;  1NVI D;  1QF6 A;  4A8X C;  4HJG E;  2L1A A;  2KN4 A;  2X38 A;  1ET9 A;  2XN9 C;  1JRO A;  4KGT A;  2WU5 B;  4JWU C;  4ZHP A;  3BK2 A;  1LO5 D;  5FR3 A;  1DYQ A;  3BZD B;  2LUM A;  3AEE B;  2CU3 A;  3P1M A;  1I4X A;  2J52 A;  1JML A;  3J9C A;  1Y56 A;  4NJC A;  3GP7 A;  1WRI A;  5LNK 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...