2WS3B

Crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd tyr83phe mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
238
structure length
238
Chain Sequence
b'MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
publication title Succinate Dehydrogenase Activity
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 65
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2ws3B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ws3B01
2CU3A 1VLBA 1B9RA 1WWTA 2B76B 1N63A 2MJ3A 1QOFA 1XLOA 1VJKA 3LXFA 1H7WA 3AB5A 3ZYYX 1N60A 2M56B 5G5HA 4LTUA 2PVOD 3AE2B 1DOIA 1A70A 2WDVB 4IDIA 1J7CA 3SR6A 2WQYB 1N61A 1YQ4B 1GTEA 3VRBB 2OHFA 1E6EB 3AEAB 4YSXB 1NYQA 1PDXA 3RPFC 1ZP0B 1FIQA 1TKGA 3NVZA 1JRPA 1ZXIA 1RM6C 3LB8C 3SFDB 2QJLA 4JWSC 1OQQA 3AEBB 3P4SB 3AE3B 2H88B 1TYGB 1XLNA 1SIJA 2DWQA 4N6EB 4ZHPA 3AEFB 2W3RA 4A9AA 2MH7A 5C3JB 3AECB 1E10A 3W5VB 3AE5B 3SFEB 1TKEA 1WYGA 1DOYA 2FBWB 3AEDB 3NVWA 4WQMA 1VDVA 3L4PA 2L52A 4ZOHC 1JQ4A 1H7XA 3NVYA 1JWBD 3AV8A 1UWMA 3P1MA 2WLBA 2CJNA 3HRDD 4YSYB 3P4QB 1PFDA 2MJDA 1NEKB 4HROA 3B2GA 5H8YE 2BS2B 2W54A 3EUB2 2WU5B 1R7SA 2PIAA 3P63A 1L5PA 4C7ZA 3AE4B 2ACZB 4C7YA 2N0SB 2CJOA 1CJEA 4USAA 3AEEB 1IUEA 1E0ZA 5EE0A 4YSZB 3AEGB 3VR9B 1T3QA 2DBYA 3B2FA 2WDQB 1DGJA 1ZOYB 4ITKA 1GAQB 2QIEB 4JX1C 1XLPA 1NYRA 4JWUC 5G5GA 1L6VA 3W9CB 3PO0A 1EWYC 1XLQA 1YJJA 3VRAB 1XO3A 1KFYB 1AYFA 1FM0D 1N62A 1YJIA 1N5XA 1KRHA 3AMZA 1AWDA 1FFUA 5MPOA 2PVGC 5EE3A 2JQRB 2MJEA 3HVZA 1QF6A 3AE1B 3AE9B 1ZUD2 4ZHOA 4YXDB 1CZPA 1RWSA 3NS1A 1NI3A 2WP9B 3NRZA 5H92C 1L6UA 2AX5A 3DWGC 1QOBA 2PKOA 4US9A 3CWIA 2KMMA 3CIRB 3VR8B 1FMAD 4HRSA 1QOAA 1FFVA 1QLBB 2WS3B 2W55A 1J7BA 1N5WA 1DOXA 1GT8A 3CF4A 1PUTA 2K22A 2KAJA 5AUKA 2EKIA 1NENB 1ROEA 1WRIA 4US8A 1YQ3B 3ABVB 1L0VB 4KX6B 2LEKA 2Y5CA 1V97A 3AM9A 1OFFA 2HTME 4N58A 2BT6A 2Q5WD 2BS3B 3B9JA 3AN1A 2E3TA 2G1EA 3AE8B 3BIID 3P4RB 3ETRA 4WWMA 1FRRA 1JROA 4YT0B 4YTPB 1JALA 1E9MA 1TKYA 2L83A 1FXIA 1I7HA 3DWMA 1JW9D 4P6VF 1V8CA 1QOGA 1TJEA 3KWLA 1GPXA 5C2TB 4YTMB 5EE9A 4C80A 2BS4B 5EE1A 3P4PB 1NVID 3FAHA 5AUIA 2JX5A 1FO4A 2H89B 3AE7B 1E7PB 1JWAD 1SB3C 2W3SA 3W5UB 2WU2B 1WGKA 3AH7A 1WXQA 1QT9A 1RYJA 1SF0A 3WCQA 2WDRB 2M19A 1FXAA 3FC4A 4N59A 5GXGB 4FXCA 1GTHA 3AE6B 4YTNB 2K5PA 3NVVA 1FRDA 1OQRA 1RFKA 1F0ZA 1J7AA 3HUIA 1KF6B 2K9XA
chains in the Genus database with same CATH superfamily
2JZZA 4MACA 4K7UA 4D2KA 2JZPA 2G4DB 5BYQA 1WXMA 1X1MA 2XNAC 4WJNA 1WX9A 2KXJA 1DOIA 2IGHA 2WDVB 2QC8A 1D6EC 2GOWA 3C19A 5AZGA 3AEAB 3JW0X 1WE7A 2JVCA 4II3B 4BZAA 1TS3A 4NJCA 1SJED 3BVZA 3SFEB 4GGQA 3BY4B 2LXAA 4URKA 2KYWA 4TUUA 4C7ZA 1MVKA 4M00A 4PK1A 4O1NA 2N0SB 3GE8C 4YSZB 1ZOYB 2R61A 2K39A 3W9CB 3PO0A 3U7ZA 3A33B 1N5XA 1D4BA 1WGDA 2MWSB 5IN7A 2PVGC 5EE3A 1C4PA 5FR3A 4XGAB 3U30A 2R2QA 4B95A 3CIRB 4IWQA 3ZIMA 1QOAA 3V60A 4XX5A 1U4AA 5AUKA 2IYDB 5E6JA 1V2YA 2KQ4X 4JL9A 5DPRA 3ETRA 1IGCA 1I7HA 1HEZE 2GI9A 3UGBB 4DXFA 3MC8A 3Q3MC 1I4XA 3IBEA 2MBOA 4F8CB 2MP2A 2NBUA 1I4QA 3R7RA 3WCQA 4HCNB 2M19A 1P98A 3P2BA 1TS4A 4GDLB 4ZRPA 1ET6A 3TUOA 2WNMA 3KVFB 1J7AA 3K9OB 1E8YA 1D5MC 2MJ3A 3ALBA 3LXFA 3P42A 2WX1A 1A70A 3H7PA 3SEBA 1VZ8A 1Z2MA 2O6VD 3CSFA 1UZXB 1NYQA 2K6DB 3R3MA 4BKTA 1XLNA 4XZ4A 1GB4A 1TKEA 3ZO5B 3LDZE 4RFBA 3TSSA 4AS1A 4BFRA 4E3CA 2CJNA 2L00B 4KDIC 5H8YE 3R2IA 2WU5B 1E8ZA 1WF9A 2DLBA 3NOBA 4I6PA 1C77A 1YNTE 3AEGB 2JPHA 2VZKB 3URYA 2LJIA 4NY0A 1L6VA 2AQ3B 4FJVB 1V1OA 3BZDB 1C79A 2MJEA 2FIFA 2QSDA 4FA6A 1HXYD 2W82A 3DHHC 2KMCA 5KHQA 3UF8A 3L08A 1QLBB 1DOXA 2M17A 1WZ0A 3I3TB 2Y5CA 5FR6A 3W2DA 2JY6A 3AM9A 2A4ZA 2MCNB 1SE4A 2BS3B 4EEWA 1WMHB 2ON8A 3V6CB 1RFAA 2LVPA 1V8CA 3DBSA 2LASA 1TJEA 3M95A 3PHWB 5AUIA 1FEHA 1YN3A 4I6NB 3TMPB 4DBGA 2Z0DB 3SHQA 1MG8A 4DQOC 2YEPF 1K50A 2K8BA 2QILA 1QQRA 4IM3A 4FXCA 1Q1OA 3NVVA 1L0YB 2B76B 1FCCC 1QOFA 2D5GA 1H7WA 3UIPB 1RLFA 3DQVA 2PVOD 1UBIA 4C00A 1EUVB 4JQWC 3V61A 2GMIC 2LVOA 3WAOA 3RYTA 3ZUNA 4B0MA 4WWPA 2J0JA 1L4ZB 2BF8B 3AE5B 2J0MA 5CHVC 3ENEA 4HDQA 4L23A 4ZOHC 3RNAC 1J0GA 1NI2A 4DHZE 1P3QU 2L7RA 2ACZB 2CJOA 2KZRA 3DBHI 2CHXA 1E0ZA 3IG3A 1WM3A 3KQ4A 2KT7A 4XE0A 3ZKJC 2V4IB 4BKSA 5JHAA 2KDMA 4M0WA 1KFYB 3RMKC 3DPDA 4NAWB 4W9CA 1SBBB 3I5JC 5L95C 5BMHA 2O2VB 5IA7A 4YXDB 3QARA 4KV2A 3ZRFA 2PKOA 2KMMA 3MC0B 3A9JB 1SE9A 4OZAA 1N5WA 1GT8A 2KOXA 2KAJA 2UU7A 2HTME 2KN4A 5HKHA 3B9JA 2G1EA 1YQBA 3IT4B 2PE6B 4AOFA 3PZ7A 3Q69A 4P6VF 2G45B 3PVLA 2NCNA 3FAHA 4A90A 2KLCA 2MRPA 3MFGA 2L8JA 5G2NA 1JWAD 3U2SC 4C56C 2LZ6A 2C7NB 2DX5B 3W5UB 2WXLA 4R3DA 5CTRC 2GB1A 4HPMB 2JT4B 4N59A 4RH6A 3VVWB 2V3PA 2K5PA 2VH1A 1WGYA 1KF6B 1TZ1A 1VJKA 1N60A 4WJQA 5G5HA 2WQYB 1H4RA 1GTEA 1AW7A 1A5RA 2YVCA 3E56A 3N1YC 4P1CC 4II2B 2IO3B 5HHDG 1SIJA 3N32A 2WXIA 3AECB 5GMVA 4PYZA 3B1LX 2N7DA 5JH5C 2D3CA 4XC2A 3NZUA 4LNOA 1WGRA 2C7MB 4HDOA 4W9DA 2INCC 4KGSA 1WY8A 3CSTA 2Z8LA 2KNBA 1L7YA 3VTWA 3BWUD 3RN9C 2MBBB 4USAA 3APFA 4C4VA 1DGJA 2QIEB 2WXGA 4K3CA 3AULA 1EWYC 1FD6A 2CHZA 2NPTA 4FHJA 4IW0A 1MG4A 1FNUA 4LNNA 1HA5A 2DZKA 3V05A 2ZPYA 2N9PC 3BVMA 3PTFC 3JSVA 2B3AA 1L6UA 3RNBC 2DHZA 4G3XB 2O6VB 4P16A 4KIKB 2PJHA 3NZ3A 3JYUA 3T9LA 2JYTA 3ECIA 2REXA 3T3OA 2L83A 1UELA 4S0RA 2C5LC 3VH4B 2I1KA 2WXFA 4YTMB 3N20C 5EE9A 5EE1A 2V0GA 2MLBA 5DPTA 3WAPA 3N30A 4M8NA 4EOYA 1K51A 2QEJC 1OTRB 4LDTD 1PGBA 4MGYE 1YMHE 1YOVB 3HUIA 4HXDA 4BVUC 3QK0A 3ZJVA 1B9RA 2N1VA 5G55A 4J3OD 3AB5A 4TQ0A 1UUPA 4EE2A 1OEYJ 2INPE 1LGRA 4ICVA 2CHWA 3Q3JA 3V3XA 5TSSA 3EFCA 4H2AA 2JUOA 1ZE3D 4L1BA 4WIPA 4A9AA 4FULA 1HQRD 2KTRA 1DOYA 5HFYA 3VHTC 1VDVA 1H7XA 1XD3B 4K1RB 4JLCA 2KJHB 4PYUA 3VUYA 2MQJA 3B2GA 3Q8CA 4OVVA 3ZNHB 1LXDA 4P1BC 3DOWA 3PRZA 2IO1B 3AXCA 5AZHA 2WDQB 1UBQA 2LGIA 1FPYA 4K81A 4KSLC 1GG3A 2BKFA 2ZW1A 3DHGC 1YJJA 1ACCA 4F1SA 1N62A 2WXOA 4KZ0A 3IAS1 1VCBA 1KRHA 3ONSA 5MPOA 1KM7A 2JQRB 1KLGD 2AQ2B 2M0XA 2BQQA 4M01A 3NJTA 1BXTA 3DWGC 3CWIA 2KWDA 2WS3B 4ZRQA 4IWPA 2EMSA 1WYWB 2EKIA 3H8HA 4KGRA 4MGZE 1J8CA 4JPSA 1D5ZC 3BIID 1ZW7A 4IG7B 3VTUA 1YX5B 4YTPB 3FKYA 1JW9D 3BYTB 4E71A 4A6QA 1TS2A 5T8IA 3Q6BA 4BKSD 1M94A 1EU4A 5D3IB 1IPGA 1MHXA 2CKHB 2ZVNA 3RFZB 3H7SA 1SE2A 1CQVA 2RGFA 2L0TA 1C1YB 3PREA 1E6EB 4PS8A 2KFKA 4YSXB 2ICIA 2QDFA 3SFDB 2CR5A 2DZMA 4ANUA 2KJ6A 3I9V1 4N6EB 3D32A 3H6NA 1WRDB 4HK2A 4HPPA 3ZDMC 4OW0A 3NVWA 4KSKC 1F2RI 2KC2A 3EHVA 4YSYB 2ZNVB 3EUB2 1OEYA 4EZLA 1V80A 2BW2A 1WH3A 2WXRA 1BMLC 1HZ6A 3PLVA 1XLPA 4K7SA 4BKGA 3QHTA 2BYTA 1YJIA 1AWDA 1JRUA 2IGGA 3UINB 2OJRA 2KX3A 3AU5A 3U4EG 1NI3A 2SAKA 2WX0A 1E7UA 4US9A 4BOSC 3NG0A 1C76A 4W9KA 4IKGA 2ZW0A 2ZNVC 1T0QC 1IBXA 3IXSA 1FRRA 2LUEA 1E9MA 2BYFA 2BYVE 4OVUA 2W3SA 3U7DA 2JZ3B 3R2TA 1M4VA 3GE3C 4N9F4 1RYJA 2YEPB 1C9FA 4TQ1A 1ISNA 3IHPC 5FK9C 3UI3A 3DHIC 2WHIA 1XLOA 3H7PB 2KC1A 4KDLB 2M8SA 2V9HA 4IDIA 4RMAA 3IFWB 1ZDVA 1TKGA 3HVDA 1GB1A 4ZHPA 1JCKB 4WQOB 1V86A 3RT3B 4HVBA 1VZ7A 3L4PA 3VUXA 1ET9A 3DCGA 5E6NA 2DAFA 1WX8A 3A4RA 4AWJA 3O65B 3ZNZB 2M0AA 2ZPNA 3APCA 2N9LA 2JXXA 2KTFA 2LGYA 4ANWA 3GZNB 4X57B 3ZTDA 1IUEA 4A3OA 3PHXB 3RI7C 2MBHA 4NZLB 3AI5A 2XEWA 4LDTB 4A55A 1JWSD 1WI0A 2EMTA 3HVZA 1QF6A 1ZUD2 1RWSA 2MA9B 2C60A 3NRZA 1I4GA 4OHJA 1P7FA 3KUDB 3QWZB 4HRSA 1FFVA 4OZCA 1K8RB 3MHZA 4DHJD 2IDYA 2WGSA 3N1XC 2K1FA 1XQQA 4GDLA 2E3TA 2HE7A 3ZGZA 1WJNA 3NZSA 4MDKE 3GZNI 3N3KB 3PPAA 1HTQA 2HJ8A 1QOGA 2ZZPB 5BYRA 3U8ZA 3KWLA 3P4PB 2PMVA 1AARA 3PS6A 2CU1A 2KWVB 1QZEA 4PS7A 1E5WA 1WJ4A 3NHEB 3HIZA 2XBBC 3A1QB 4BAXA 2INNE 4QAYA 2D10A 1N63A 5DCNA 4LTUA 4UDUC 2RMMA 3VXWA 1ZXHA 3ZLZA 3Q8FA 1YQ4B 1WJUA 2WXHA 5J18A 2IY0B 5I4DA 1I35A 2RDGA 3J9CA 3VDZA 2DWQA 4ZYNA 3DDCB 2N4FA 4WJOA 3W5VB 3PZDA 2FBWB 3ZW3A 2L52A 2KDBA 1UWMA 1I42A 2QCZA 3PRMB 1MFWA 1L5PA 1F77A 3C8YA 2LJ5A 1LFDA 2XK5B 1CK1A 1CJEA 2L32A 3L10B 3OJ4B 4M0WB 3VUWA 1KLVA 4LNKA 3ZDTA 4RNAA 2HD5B 3Q14C 1WMHA 4HEA1 1WFYA 1ZGUB 3DVGY 1I4RA 2KO3A 4J6IA 2AX5A 3VFKA 4IOIE 2G4SA 4DK5A 1C4AA 4TSSA 3CF4A 4FJYA 4US8A 3R7QA 1WJ6A 1V97A 5D3DA 3QJZA 4ZRJA 3AE8B 2FUG1 1JALA 4MM3A 1DYQA 3DWMA 1WX7A 2MX2A 4GOCA 2K0PA 2JXTA 1C78A 3ZJUA 1FO4A 4YL8A 1WM2A 1Y56A 1KTKA 3KYCD 5AZFA 4GIVA 4HJGE 1WGKA 1TS5A 3FC4A 5HI1A 3DBLB 1XEEA 4YTNB 2WDTB 1F9JA 1FRDA 1F0ZA 3KUZA 2G9HD 1H8CA 2Y3AA 1J19A 4ARIA 3RCZA 1SSNA 1XCTL 4WAFA 3VRBB 2KDIA 5E6OA 2JWZA 1ZP0B 2TSSA 4TKNA 5D6JB 3RZWC 1XT9B 5D2MB 5LXIB 3EECA 1PGAA 3UIOB 2VRRB 2RDHA 2IGDA 3PSEB 1FXTB 3DVGX 3NVYA 3AV8A 2D07B 2MJDA 3DBLI 2O2VA 1KOTA 2L0FA 1V5OA 4BBNF 1I4PA 3BVGA 5LLIA 3IVFA 3V6EB 2PPHA 1C3TA 3RZFA 2ZCCA 3MHSD 2GBJA 2MBEA 4TV3A 1FFUA 1GNUA 3BINA 4W9EA 2PE9A 3NS8A 3S2AA 3JSVB 3ZVVA 1EM7A 4ZHOA 1PYWD 3NS1A 5JHBA 2N9KA 2KVZA 3ML8A 3ZNID 5BO4B 2NTTA 3ZXRA 2W55A 4DDGD 2K22A 1UH6A 4E74A 1YN5A 4W9HA 3TIXA 1YQ3B 2Y5BB 3VAWA 2NS5A 2BVCA 4XWWA 4WWMA 5E6PA 1TKYA 4ARCA 5IKCM 2V4LA 3WANA 4KZCA 2KVRA 1QT9A 4PT5A 2X38A 5GXGB 1GTHA 1OQRA 1RFKA 1UGJA 4MJSA 1UWXA 4XWTA 3PV1A 2LGSA 3SDLC 5IOIA 1I4HA 2NTSA 2AL6A 2DZIA 1SEBD 3ZRCA 1ZXIA 1D5XC 2CS4A 2N1WA 3P4SB 2KTRB 4NNJB 2IY1B 1BUIC 3AEFB 4DHJB 4GN1A 4AP4C 3A9KA 1WYGA 2OEDA 3AEDB 1VD2A 3TEXA 3TEWA 4GSWA 2KX0A 3UQAA 4WWOA 1T0YA 3P4QB 1PFDA 4HROA 4MEMA 4B6WA 2W54A 3P63A 1IP9A 2KWCA 2FCMA 2KFJA 3I57A 5EE0A 3VR9B 2DBYA 3HK0A 4EZJA 1GAQB 1R4MB 2K6QA 1FM0D 4PS3A 4HPLB 4B9KA 4RGTA 3AE1B 4AQ7A 3QAQA 4FHKA 5JZEB 1TZOA 1SE3A 3O13A 1QOBA 2LGXA 1K52A 3BYYB 2KACA 2JRHA 1MHHE 1XXGA 2RPVA 1WGHA 2LEKA 2KDEB 4N58A 2KD0A 2BT6A 2K8CA 3AU4A 3ZQ4A 2IBIB 3W1SA 4GDKB 1GOZA 1R4MI 3KH0A 3ZTCA 2LMCA 2J0KA 3FILB 3LJ3A 4WWNA 2BWFA 4RGMA 2C9WB 3OJ3A 4KKIA 3AE6B 1B1ZA 2WYQA 1VLBA 4G0NB 4JGHB 1TY0A 3GP7A 4LLGM 1KH0A 3N1ZC 4HKQA 2MEKA 1EWCA 2BTEA 3TCAA 1ZDXA 2KFKB 1J7CA 2FIDA 1N61A 1G6JA 2Y5PA 5J2RA 2L76A 4A8XC 1JRPA 2FE8A 3K9PB 3SD5A 1Q5WB 1TGZB 2AEHA 5C3JB 4AUQC 2V3SA 4OZBA 4AJWA 4WQMA 1JQ4A 1P1AA 3TL5A 2KQSA 4M8MA 4AJYB 4GLSC 3EGRA 3AEEB 1T3QA 4ITKA 1FCLA 3VRAB 3HM3A 3VQIA 2MSED 2FUHB 3Q8EA 2A5UA 3WA0A 2Z0EB 1V81A 1WZ3A 3KW5B 1E90A 1PQSA 1TIFA 1V1PA 3ABVB 4KX6B 1L2NA 3M63B 4MELA 1TY2A 1WSPA 4NPNA 2BWES 1LM8B 3PLUA 2WXQA 2WXKA 2AQ1B 3W1YA 1TTNA 1ENFA 4EUTA 2BPSA 3TEZA 1OQYA 2KQ7A 4NQKE 2GBMA 4CO7A 3MP9A 5AEKB 4GB9A 1RRBA 3PRPB 2WU2B 4WJPA 1WXQA 4W9IA 4IUMB 2LHEA 2WXJA 4WAAA 2WLBA 1WWTA 4MH8A 1YX6B 1JWMD 2M56B 1VZ6A 2L3ZA 1D3ZA 4MSQB 2MP2B 2J4XA 4ACFA 2RR9A 3MC9A 1Q0WB 3LB8C 2QJLA 2KDFB 2BKRB 2BB5A 1GUAB 2INDC 2LUMA 4NJ7A 1JWBD 5CHFA 3HRDD 2PLPA 1GC6A 2NVUI 2ASQA 3EC8A 4NAMA 5KHOA 1R7SA 4MH0E 3CMMB 3KLSX 1SJHD 1KJTA 2YLMA 3H9DA 4DWFA 5DPWA 2JU6X 4ASWC 1Z5SB 2KJRA 2LFIA 1GJZA 4LJPB 5JXVA 2GLSA 4REZA 1E8XA 1T6BX 3BK1A 2L05A 1UNSA 5J17A 2DNFA 4IM2A 1PUTA 5LXHA 3E9SA 2Q5WD 4GXBA 4IC7B 1JROA 2NMQA 3APDA 3V62A 1EF1A 4MGIE 2R2OA 3L17A 5DPSA 1RAXA 1GPXA 1ESFA 1ZPSA 2SEBD 3U52E 5CHWA 1WXVA 1TBEA 2WXMA 4WURA 2HTHA 4RCOA 1YD8U 2WDRB 2LGDA 1WR1A 2QMTA 1Y8RC 1V6EA 2CU3A 3RNCC 2LD9A 3Q3FA 4XDCA 4FBJB 3NY5A 3SR6A 2OHFA 4Q2JA 1FIQA 1IGDA 3NVZA 3QX1A 4MSMB 3R8BA 2IJ0A 3AE3B 3X0WA 2IO0B 4TMAB 2LWPA 4M02A 5D7GA 1N6ZA 2W3RA 4B0EA 2GBNA 1HTOA 3Q2AC 2DZJA 1S3SG 4LCDE 3P1MA 2I38A 1NDDA 4K3BA 1NEKB 2KHWB 2D3GA 4YWGG 3RNFC 2NBWB 2EELA 3L0WB 1MJDA 4ZRIA 2K25A 5IP4D 4ZRKA 5BMIA 2LHDA 2DYMA 1R4NB 2FCSA 4EFOA 1L0XB 2PW9A 1VRAB 3AMZA 2WXPA 2FNJB 3L54A 2J52A 3WALA 2X8XX 4P7IA 1FMAD 3C0RB 4RM8A 3QCAA 5HG2A 1WGGA 4RM9A 4F7ZA 2IPKD 2I1JA 2M1MA 2DAJA 4MM3B 4L2YA 4HLEA 3DBHB 1KLUD 3A1QA 2MW5A 1BT0A 3UQBA 5BMGA 4KVGB 2BS4B 2JX5A 1R4NI 2J42A 4BBNC 4JE3B 4ZDVA 3AE7B 1E7PB 1SB3C 3RULA 1FXAA 3EFUA 2C7HA 1HZ5A 1YN4A 3Q8AA 5BYSA 4S17A 3X23A 1JWUD 3L16A 2J53A 1K53A 2K9XA 3B0AA 3ZYYX 1EU3A 5EDSA 2WXNA 3IT6B 1F1HA 1P7EA 3QQ8B 2IO2B 1PDXA 1SGHA 3DVNU 4DHZB 1RM6C 4FLHA 4A3PA 1OQQA 2XK5A 2AL3A 4CYEA 1TYGB 2JWUA 3Q8BA 1L4DB 3KWVA 2BGFA 3ZXVA 2LRUA 2RSUA 1P9DU 2HDEA 4GMVA 4FADA 3OG5A 3AE4B 3GB1A 4NQLB 4LNIA 4KKJA 4ZYSA 5G5GA 1NYRA 3MJWA 3QC8B 1XLQA 3DVNV 2D2QA 3CF6E 4RGNA 2HJ1A 3BK2A 3AE9B 1LQBA 3TBLD 2KWUB 4NAWA 3L13A 3N9YC 4MT5A 5H92C 4W9GA 3VR8B 4RF1A 2ZJDA 1CMXB 4C4VB 2JYEA 4RGOS 3LYYA 1WRIA 3A9JA 3ZNGC 1YIWA 2NPTB 3P4RB 1AN8A 3GS2A 2KANA 4IWOA 4RF0A 4DDID 3MTNB 4EZKA 4C80A 1T0SC 4I6LB 5FKAC 1UGMA 3AH7A 4W9LA 2QHOA 3SU8X 2ZVOA 3QIJA 4MJSB 2NBVB 2MBQA 2LXCA 4K7WA 1WR6E 4XDDA 3WIMA 4HJKA 5LNK1 2D3AA 1NBFC 1V9JA 3GOEA 3Q3NC 1C4CA 3AE2B 2JRIB 3I63C 3RUIB 3T8MA 4G11A 1T5XD 3RNGC 2D3BA 3RPFC 1GC7A 1YJ1A 1ZKHA 3AEBB 2H88B 3A9KB 2OJWA 2LI5A 2MH7A 1E7VA 1E10A 2FCQA 4HCPB 2GRIA 1UF0A 1PGXA 3T3NA 2K3UA 2M4NA 3OLMD 4XYCA 2NR2A 2KKCA 4FN2A 3HM6X 2K8HA 2V3NA 4JWUC 4KGTA 1WE6A 1V49A 2LRWA 2PEAA 2N7JA 2UYZB 4WH4A 1XO3A 2Z59B 4EKUA 4CQNA 1CZPA 3Q3OC 1Q10A 2N9XA 3M62B 4LNFA 2LVQA 2BBCA 3R66C 3ZJTA 1V5TA 1NENB 1ROEA 3QA8A 3RNEC 1L0VB 2O6VA 2BYEA 1OFFA 2KK8A 4DXAB 1WIAA 2JSVX 2WWZA 3AN1A 5IO9A 1WXAA 4BOZB 4ANXA 4KIKA 1FNWA 1LO5D 1FXIA 1HE8A 1QILA 2GBRA 1XCQL 1QKZA 2EKEC 2VH2A 3VTVA 4W9FA 3MJ5A 2RPQA 2ZCBA 2VZKD 2RDBC 2XN9C 4OVZA 1F2RC 1EO6A 1UD7A 1WXSA 1P0RA 4ANVA 3VH3B 2AWTA 4CHKA 3TJPA 4HKZE 1VR9A 2UWQA 3H1UA 3W1SC 1S1QB 4DXGA 4NJ6A 5C23A 4JWSC 3NUHB 4IM0A 2L1AA 4JIOU 3PGEA 4HWIB 3PZ8A 3DBRB 3TEYA 3PT2B 1MPEA 1JMLA 2KMAA 2BS2B 1OGWA 3B08A 2PIAA 4LK0M 2PTLA 1T0RC 3RD2A 3A4SC 4C7YA 2MHJA 1F52A 2N9EB 3OWEB 3B2FA 4JX1C 2J7QB 4MGKE 1XF5L 3HHMA 2N7EA 1AYFA 1MI0A 1STEA 1SXTA 2W9NA 3M3JA 4G50A 2I2YA 2GBKA 2FCNA 4GDKA 2ONQA 5IAAC 2KN5A 2WP9B 2DYOA 2KLGA 2BB6A 5C1ZA 1V1PB 2OOBB 1J7BA 3DBRI 1SIFA 3FILA 1TT5B 1E8WA 2D11A 2JF5A 2ZEQA 3KYDD 2E6XA 2G3QB 2V1YA 3KUCB 4ICUA 4YT0B 2IZVB 2RD0A 3IAM1 5D94A 4LJOB 5C2TB 1NVID 4W9JA 3OAWA 1FNVA 4FJZA 3EA6A 2H89B 2AYOB 2DYBA 5L83A 1SF0A 1IYFA 1EF5A 4A20A 5TR5A 2DENB 2FAZA 3ML9A 1IBXB 3WAMA 5CX3A 4GU2A 3JVZX
chains in the Genus database with same CATH topology
2CU3A 4MACA 3ZJVA 1B9RA 4D2KA 2Y3AA 2JZPA 4J3OD 5BYQA 3AB5A 2XNAC 4TQ0A 4XDCA 4ARIA 1DOIA 2IGHA 1SSNA 2WDVB 1UUPA 3HUIA 1XCTL 4WAFA 3SR6A 4EE2A 1D6EC 3VRBB 2OHFA 4Q2JA 2INPE 3AEAB 1ZP0B 1FIQA 1IGDA 3NVZA 3V3XA 5TSSA 2TSSA 4H2AA 3R8BA 2IJ0A 3AE3B 4TMAB 1ZE3D 4L1BA 4WIPA 4B0EA 5D7GA 2W3RA 1TS3A 4A9AA 1HQRD 4NJCA 1SJED 3BVZA 3SFEB 1PGAA 1DOYA 2RDHA 5HFYA 2IGDA 1VDVA 1H7XA 3NVYA 3AV8A 3P1MA 2I38A 2MJDA 1NEKB 3B2GA 3Q8CA 4YWGG 4C7ZA 2EELA 1MVKA 4O1NA 2N0SB 5BMIA 2LHDA 2DYMA 4YSZB 1I4PA 3BVGA 2WDQB 1ZOYB 2LGIA 2R61A 3W9CB 2ZW1A 3PO0A 1L0XB 1ACCA 1YJJA 3U7ZA 1N62A 2WXOA 2PW9A 1N5XA 3IAS1 1D4BA 1KRHA 1VRAB 1FFUA 3AMZA 5MPOA 2PVGC 2WXPA 5EE3A 2JQRB 1EM7A 4ZHOA 1C4PA 1PYWD 1KLGD 3NS1A 5FR3A 2AQ2B 2N9KA 2J52A 1BXTA 3DWGC 3CWIA 3CIRB 2KWDA 1FMAD 1QOAA 2NTTA 2WS3B 2W55A 4ZRQA 2K22A 5HG2A 5AUKA 2EKIA 3H8HA 1YN5A 1YQ3B 2IPKD 4KGRA 5E6JA 2KQ4X 4XWWA 4MM3B 4L2YA 4JPSA 1D5ZC 3BIID 3ETRA 4WWMA 1KLUD 4YTPB 1IGCA 1TKYA 1I7HA 1HEZE 1JW9D 2GI9A 5BMGA 3BYTB 4DXFA 4A6QA 4ARCA 2BS4B 1TS2A 5T8IA 2JX5A 2J42A 1I4XA 4JE3B 3AE7B 1E7PB 1SB3C 1QT9A 1EU4A 1I4QA 4PT5A 3WCQA 2M19A 2X38A 1FXAA 5GXGB 1TS4A 4GDLB 5D3IB 4ZRPA 1HZ5A 1YN4A 1GTHA 1ET6A 3Q8AA 3TUOA 1MHXA 5BYSA 1JWUD 2WNMA 1OQRA 1RFKA 3RFZB 1UGJA 1J7AA 1K53A 2J53A 2K9XA 1UWXA 1D5MC 1SE2A 2MJ3A 3LXFA 3P42A 1EU3A 4XWTA 3ZYYX 1CQVA 2WXNA 3IT6B 1P7EA 1I4HA 1A70A 2NTSA 3SEBA 1VZ8A 1E6EB 1PDXA 4YSXB 1NYQA 2ICIA 1SEBD 1ZXIA 1D5XC 1RM6C 3SFDB 1OQQA 3P4SB 1TYGB 1XLNA 3I9V1 4N6EB 1BUIC 3AEFB 2JWUA 3Q8BA 1L4DB 3KWVA 1GB4A 1TKEA 1WYGA 4OW0A 2OEDA 3AEDB 3NVWA 4RFBA 3TEXA 3TEWA 1F2RI 3TSSA 4AS1A 2CJNA 2HDEA 4YSYB 3P4QB 1PFDA 4HROA 5H8YE 3R2IA 2W54A 3EUB2 2WU5B 3P63A 2DLBA 3AE4B 3GB1A 2BW2A 1C77A 1YNTE 3I57A 2WXRA 5EE0A 3AEGB 3VR9B 2DBYA 4KKJA 1BMLC 4ZYSA 1GAQB 1HZ6A 5G5GA 1XLPA 1NYRA 2VZKB 3URYA 2LJIA 1L6VA 1XLQA 2BYTA 1FM0D 1YJIA 2AQ3B 4RGNA 1AWDA 1V1OA 3BK2A 2IGGA 1C79A 3BZDB 2MJEA 4RGTA 2QSDA 3AE1B 3AE9B 1HXYD 2W82A 4AQ7A 3N9YC 3U4EG 1NI3A 4MT5A 5H92C 1TZOA 2SAKA 1SE3A 3O13A 1QOBA 4US9A 3VR8B 4RF1A 1QLBB 1K52A 1DOXA 3BYYB 2KACA 2JYEA 4RGOS 1C76A 3LYYA 1WRIA 1MHHE 1XXGA 2RPVA 2Y5CA 2LEKA 3W2DA 3AM9A 4IKGA 4N58A 2ZW0A 1SE4A 2BT6A 2BS3B 2ON8A 3P4RB 1AN8A 1IBXA 3IXSA 1FRRA 3GS2A 3ZQ4A 1E9MA 4RF0A 3W1SA 4GDKB 1V8CA 1TJEA 4C80A 5FKAC 1GOZA 5AUIA 1FEHA 1YN3A 2W3SA 2LMCA 3R2TA 2YEPF 4DQOC 1M4VA 3AH7A 1K50A 3FILB 1RYJA 2QILA 2YEPB 1QQRA 4FXCA 4RGMA 1C9FA 4KKIA 4TQ1A 3AE6B 1B1ZA 5FK9C 3NVVA 3UI3A 1L0YB 1VLBA 4LLGM 4XDDA 1TY0A 3GP7A 2B76B 1FCCC 1KH0A 1QOFA 1XLOA 2D5GA 1H7WA 4HKQA 5LNK1 2MEKA 1EWCA 2BTEA 1C4CA 2PVOD 3AE2B 1ZDXA 4IDIA 1J7CA 1N61A 1ZDVA 1T5XD 2Y5PA 3RPFC 1TKGA 4A8XC 3HVDA 1JRPA 1GB1A 2FE8A 4B0MA 3AEBB 2H88B 4ZHPA 1JCKB 2MH7A 5C3JB 1E10A 1L4ZB 3AE5B 4OZBA 1VZ7A 4L23A 4WQMA 3L4PA 1ET9A 4ZOHC 1JQ4A 2GRIA 1PGXA 3T3NA 2K3UA 4GLSC 2M0AA 2N9LA 2ACZB 3EGRA 2CJOA 3AEEB 1IUEA 1E0ZA 1T3QA 2V3NA 4ITKA 3KQ4A 4JWUC 4KGTA 4XE0A 4NZLB 2V4IB 2KDMA 2N7JA 4M0WA 4A55A 1FCLA 4WH4A 3VRAB 1XO3A 1KFYB 3VQIA 1JWSD 4NAWB 4CQNA 1SBBB 3HVZA 5BMHA 1QF6A 1ZUD2 3Q8EA 4YXDB 1CZPA 1RWSA 3NRZA 1I4GA 4OHJA 1Q10A 1P7FA 2PKOA 2KMMA 3MC0B 4HRSA 2BBCA 1FFVA 4OZCA 3ZJTA 4OZAA 1N5WA 1GT8A 2KAJA 3MHZA 1V1PA 2IDYA 1NENB 1ROEA 3ABVB 1L0VB 4KX6B 1TY2A 1WSPA 1OFFA 2HTME 2KN4A 2JSVX 3AN1A 3B9JA 2E3TA 2G1EA 3ZGZA 2WXQA 2WXKA 1FNWA 2AQ1B 3IT4B 1ENFA 3PZ7A 1LO5D 1FXIA 3Q69A 4P6VF 3TEZA 1QOGA 1QILA 5BYRA 3KWLA 1XCQL 1QKZA 3P4PB 2PMVA 3FAHA 4A90A 3MP9A 3MFGA 1JWAD 3U2SC 4C56C 3MJ5A 3W5UB 2WU2B 2WXLA 1WXQA 4R3DA 2VZKD 2GB1A 4RH6A 2XN9C 4N59A 2V3PA 2LHEA 2WXJA 2K5PA 4OVZA 2WLBA 1KF6B 2INNE 1WWTA 4MH8A 1N63A 1VJKA 1N60A 1JWMD 2M56B 5G5HA 4LTUA 1VZ6A 4UDUC 2RMMA 1ZXHA 2WQYB 3Q8FA 1YQ4B 2WXHA 1GTEA 2J4XA 1AW7A 4HKZE 1VR9A 5I4DA 4DXGA 3LB8C 2QJLA 3E56A 2RDGA 3J9CA 4JWSC 3NUHB 2L1AA 5HHDG 1SIJA 2DWQA 2WXIA 3AECB 3W5VB 2FBWB 2BB5A 2L52A 2LUMA 3PZ8A 3TEYA 1JWBD 1MPEA 1JMLA 1UWMA 3HRDD 2PLPA 4KGSA 2BS2B 4NAMA 1R7SA 2PIAA 4LK0M 1L5PA 1F77A 2PTLA 3C8YA 3KLSX 2Z8LA 1SJHD 4C7YA 1CK1A 3BWUD 1CJEA 2L32A 4USAA 3OWEB 3B2FA 2JU6X 1DGJA 4JX1C 2QIEB 2WXGA 4RNAA 1EWYC 1XF5L 1FD6A 1AYFA 1MI0A 2LFIA 4HEA1 1STEA 1SXTA 1FNUA 1HA5A 2I2YA 3V05A 5JXVA 4REZA 1I4RA 2ONQA 3BVMA 1T6BX 2WP9B 2DYOA 3BK1A 2BB6A 1L6UA 2AX5A 1UNSA 4IOIE 1V1PB 1C4AA 1J7BA 4TSSA 1PUTA 3CF4A 4P16A 4US8A 3FILA 1V97A 5D3DA 3E9SA 3NZ3A 2Q5WD 3AE8B 2E6XA 1JROA 2JYTA 2NMQA 2FUG1 4YT0B 1JALA 3T3OA 2L83A 3IAM1 1DYQA 3DWMA 2WXFA 1GPXA 1ESFA 5C2TB 1ZPSA 4YTMB 2K0PA 2SEBD 5EE9A 3U52E 5EE1A 1NVID 1FNVA 2JXTA 2V0GA 1C78A 3ZJUA 3EA6A 1FO4A 2H89B 1Y56A 1KTKA 2WXMA 4HJGE 4WURA 1WGKA 4RCOA 1K51A 2QEJC 1SF0A 1TS5A 2WDRB 3FC4A 1PGBA 5HI1A 1XEEA 4YTNB 2QMTA 1IBXB 1FRDA 1YMHE 1F0ZA 2G9HD 1F2RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CU3 A;  1VLB A;  1B9R A;  1WWT A;  2B76 B;  1N63 A;  2MJ3 A;  1QOF A;  1XLO A;  1VJK A;  3LXF A;  1H7W A;  3AB5 A;  3ZYY X;  1N60 A;  2M56 B;  5G5H A;  4LTU A;  2PVO D;  3AE2 B;  1DOI A;  1A70 A;  2WDV B;  4IDI A;  1J7C A;  3SR6 A;  2WQY B;  1N61 A;  1YQ4 B;  1GTE A;  3VRB B;  2OHF A;  1E6E B;  3AEA B;  4YSX B;  1NYQ A;  1PDX A;  3RPF C;  1ZP0 B;  1FIQ A;  1TKG A;  3NVZ A;  1JRP A;  1ZXI A;  1RM6 C;  3LB8 C;  3SFD B;  2QJL A;  4JWS C;  1OQQ A;  3AEB B;  3P4S B;  3AE3 B;  2H88 B;  1TYG B;  1XLN A;  1SIJ A;  2DWQ A;  4N6E B;  4ZHP A;  3AEF B;  2W3R A;  4A9A A;  2MH7 A;  5C3J B;  3AEC B;  1E10 A;  3W5V B;  3AE5 B;  3SFE B;  1TKE A;  1WYG A;  1DOY A;  2FBW B;  3AED B;  3NVW A;  4WQM A;  1VDV A;  3L4P A;  2L52 A;  4ZOH C;  1JQ4 A;  1H7X A;  3NVY A;  1JWB D;  3AV8 A;  1UWM A;  3P1M A;  2WLB A;  2CJN A;  3HRD D;  4YSY B;  3P4Q B;  1PFD A;  2MJD A;  1NEK B;  4HRO A;  3B2G A;  5H8Y E;  2BS2 B;  2W54 A;  3EUB 2;  2WU5 B;  1R7S A;  2PIA A;  3P63 A;  1L5P A;  4C7Z A;  3AE4 B;  2ACZ B;  4C7Y A;  2N0S B;  2CJO A;  1CJE A;  4USA A;  3AEE B;  1IUE A;  1E0Z A;  5EE0 A;  4YSZ B;  3AEG B;  3VR9 B;  1T3Q A;  2DBY A;  3B2F A;  2WDQ B;  1DGJ A;  1ZOY B;  4ITK A;  1GAQ B;  2QIE B;  4JX1 C;  1XLP A;  1NYR A;  4JWU C;  5G5G A;  1L6V A;  3W9C B;  3PO0 A;  1EWY C;  1XLQ A;  1YJJ A;  3VRA B;  1XO3 A;  1KFY B;  1AYF A;  1FM0 D;  1N62 A;  1YJI A;  1N5X A;  1KRH A;  3AMZ A;  1AWD A;  1FFU A;  5MPO A;  2PVG C;  5EE3 A;  2JQR B;  2MJE A;  3HVZ A;  1QF6 A;  3AE1 B;  3AE9 B;  1ZUD 2;  4ZHO A;  4YXD B;  1CZP A;  1RWS A;  3NS1 A;  1NI3 A;  2WP9 B;  3NRZ A;  5H92 C;  1L6U A;  2AX5 A;  3DWG C;  1QOB A;  2PKO A;  4US9 A;  3CWI A;  2KMM A;  3CIR B;  3VR8 B;  1FMA D;  4HRS A;  1QOA A;  1FFV A;  1QLB B;  2WS3 B;  2W55 A;  1J7B A;  1N5W A;  1DOX A;  1GT8 A;  3CF4 A;  1PUT A;  2K22 A;  2KAJ A;  5AUK A;  2EKI A;  1NEN B;  1ROE A;  1WRI A;  4US8 A;  1YQ3 B;  3ABV B;  1L0V B;  4KX6 B;  2LEK A;  2Y5C A;  1V97 A;  3AM9 A;  1OFF A;  2HTM E;  4N58 A;  2BT6 A;  2Q5W D;  2BS3 B;  3B9J A;  3AN1 A;  2E3T A;  2G1E A;  3AE8 B;  3BII D;  3P4R B;  3ETR A;  4WWM A;  1FRR A;  1JRO A;  4YT0 B;  4YTP B;  1JAL A;  1E9M A;  1TKY A;  2L83 A;  1FXI A;  1I7H A;  3DWM A;  1JW9 D;  4P6V F;  1V8C A;  1QOG A;  1TJE A;  3KWL A;  1GPX A;  5C2T B;  4YTM B;  5EE9 A;  4C80 A;  2BS4 B;  5EE1 A;  3P4P B;  1NVI D;  3FAH A;  5AUI A;  2JX5 A;  1FO4 A;  2H89 B;  3AE7 B;  1E7P B;  1JWA D;  1SB3 C;  2W3S A;  3W5U B;  2WU2 B;  1WGK A;  3AH7 A;  1WXQ A;  1QT9 A;  1RYJ A;  1SF0 A;  3WCQ A;  2WDR B;  2M19 A;  1FXA A;  3FC4 A;  4N59 A;  5GXG B;  4FXC A;  1GTH A;  3AE6 B;  4YTN B;  2K5P A;  3NVV A;  1FRD A;  1OQR A;  1RFK A;  1F0Z A;  1J7A A;  3HUI A;  1KF6 B;  2K9X A; 
#chains in the Genus database with same CATH topology
 2JZZ A;  4MAC A;  4K7U A;  4D2K A;  2JZP A;  2G4D B;  5BYQ A;  1WXM A;  1X1M A;  2XNA C;  4WJN A;  1WX9 A;  2KXJ A;  1DOI A;  2IGH A;  2WDV B;  2QC8 A;  1D6E C;  2GOW A;  3C19 A;  5AZG A;  3AEA B;  3JW0 X;  1WE7 A;  2JVC A;  4II3 B;  4BZA A;  1TS3 A;  4NJC A;  1SJE D;  3BVZ A;  3SFE B;  4GGQ A;  3BY4 B;  2LXA A;  4URK A;  2KYW A;  4TUU A;  4C7Z A;  1MVK A;  4M00 A;  4PK1 A;  4O1N A;  2N0S B;  3GE8 C;  4YSZ B;  1ZOY B;  2R61 A;  2K39 A;  3W9C B;  3PO0 A;  3U7Z A;  3A33 B;  1N5X A;  1D4B A;  1WGD A;  2MWS B;  5IN7 A;  2PVG C;  5EE3 A;  1C4P A;  5FR3 A;  4XGA B;  3U30 A;  2R2Q A;  4B95 A;  3CIR B;  4IWQ A;  3ZIM A;  1QOA A;  3V60 A;  4XX5 A;  1U4A A;  5AUK A;  2IYD B;  5E6J A;  1V2Y A;  2KQ4 X;  4JL9 A;  5DPR A;  3ETR A;  1IGC A;  1I7H A;  1HEZ E;  2GI9 A;  3UGB B;  4DXF A;  3MC8 A;  3Q3M C;  1I4X A;  3IBE A;  2MBO A;  4F8C B;  2MP2 A;  2NBU A;  1I4Q A;  3R7R A;  3WCQ A;  4HCN B;  2M19 A;  1P98 A;  3P2B A;  1TS4 A;  4GDL B;  4ZRP A;  1ET6 A;  3TUO A;  2WNM A;  3KVF B;  1J7A A;  3K9O B;  1E8Y A;  1D5M C;  2MJ3 A;  3ALB A;  3LXF A;  3P42 A;  2WX1 A;  1A70 A;  3H7P A;  3SEB A;  1VZ8 A;  1Z2M A;  2O6V D;  3CSF A;  1UZX B;  1NYQ A;  2K6D B;  3R3M A;  4BKT A;  1XLN A;  4XZ4 A;  1GB4 A;  1TKE A;  3ZO5 B;  3LDZ E;  4RFB A;  3TSS A;  4AS1 A;  4BFR A;  4E3C A;  2CJN A;  2L00 B;  4KDI C;  5H8Y E;  3R2I A;  2WU5 B;  1E8Z A;  1WF9 A;  2DLB A;  3NOB A;  4I6P A;  1C77 A;  1YNT E;  3AEG B;  2JPH A;  2VZK B;  3URY A;  2LJI A;  4NY0 A;  1L6V A;  2AQ3 B;  4FJV B;  1V1O A;  3BZD B;  1C79 A;  2MJE A;  2FIF A;  2QSD A;  4FA6 A;  1HXY D;  2W82 A;  3DHH C;  2KMC A;  5KHQ A;  3UF8 A;  3L08 A;  1QLB B;  1DOX A;  2M17 A;  1WZ0 A;  3I3T B;  2Y5C A;  5FR6 A;  3W2D A;  2JY6 A;  3AM9 A;  2A4Z A;  2MCN B;  1SE4 A;  2BS3 B;  4EEW A;  1WMH B;  2ON8 A;  3V6C B;  1RFA A;  2LVP A;  1V8C A;  3DBS A;  2LAS A;  1TJE A;  3M95 A;  3PHW B;  5AUI A;  1FEH A;  1YN3 A;  4I6N B;  3TMP B;  4DBG A;  2Z0D B;  3SHQ A;  1MG8 A;  4DQO C;  2YEP F;  1K50 A;  2K8B A;  2QIL A;  1QQR A;  4IM3 A;  4FXC A;  1Q1O A;  3NVV A;  1L0Y B;  2B76 B;  1FCC C;  1QOF A;  2D5G A;  1H7W A;  3UIP B;  1RLF A;  3DQV A;  2PVO D;  1UBI A;  4C00 A;  1EUV B;  4JQW C;  3V61 A;  2GMI C;  2LVO A;  3WAO A;  3RYT A;  3ZUN A;  4B0M A;  4WWP A;  2J0J A;  1L4Z B;  2BF8 B;  3AE5 B;  2J0M A;  5CHV C;  3ENE A;  4HDQ A;  4L23 A;  4ZOH C;  3RNA C;  1J0G A;  1NI2 A;  4DHZ E;  1P3Q U;  2L7R A;  2ACZ B;  2CJO A;  2KZR A;  3DBH I;  2CHX A;  1E0Z A;  3IG3 A;  1WM3 A;  3KQ4 A;  2KT7 A;  4XE0 A;  3ZKJ C;  2V4I B;  4BKS A;  5JHA A;  2KDM A;  4M0W A;  1KFY B;  3RMK C;  3DPD A;  4NAW B;  4W9C A;  1SBB B;  3I5J C;  5L95 C;  5BMH A;  2O2V B;  5IA7 A;  4YXD B;  3QAR A;  4KV2 A;  3ZRF A;  2PKO A;  2KMM A;  3MC0 B;  3A9J B;  1SE9 A;  4OZA A;  1N5W A;  1GT8 A;  2KOX A;  2KAJ A;  2UU7 A;  2HTM E;  2KN4 A;  5HKH A;  3B9J A;  2G1E A;  1YQB A;  3IT4 B;  2PE6 B;  4AOF A;  3PZ7 A;  3Q69 A;  4P6V F;  2G45 B;  3PVL A;  2NCN A;  3FAH A;  4A90 A;  2KLC A;  2MRP A;  3MFG A;  2L8J A;  5G2N A;  1JWA D;  3U2S C;  4C56 C;  2LZ6 A;  2C7N B;  2DX5 B;  3W5U B;  2WXL A;  4R3D A;  5CTR C;  2GB1 A;  4HPM B;  2JT4 B;  4N59 A;  4RH6 A;  3VVW B;  2V3P A;  2K5P A;  2VH1 A;  1WGY A;  1KF6 B;  1TZ1 A;  1VJK A;  1N60 A;  4WJQ A;  5G5H A;  2WQY B;  1H4R A;  1GTE A;  1AW7 A;  1A5R A;  2YVC A;  3E56 A;  3N1Y C;  4P1C C;  4II2 B;  2IO3 B;  5HHD G;  1SIJ A;  3N32 A;  2WXI A;  3AEC B;  5GMV A;  4PYZ A;  3B1L X;  2N7D A;  5JH5 C;  2D3C A;  4XC2 A;  3NZU A;  4LNO A;  1WGR A;  2C7M B;  4HDO A;  4W9D A;  2INC C;  4KGS A;  1WY8 A;  3CST A;  2Z8L A;  2KNB A;  1L7Y A;  3VTW A;  3BWU D;  3RN9 C;  2MBB B;  4USA A;  3APF A;  4C4V A;  1DGJ A;  2QIE B;  2WXG A;  4K3C A;  3AUL A;  1EWY C;  1FD6 A;  2CHZ A;  2NPT A;  4FHJ A;  4IW0 A;  1MG4 A;  1FNU A;  4LNN A;  1HA5 A;  2DZK A;  3V05 A;  2ZPY A;  2N9P C;  3BVM A;  3PTF C;  3JSV A;  2B3A A;  1L6U A;  3RNB C;  2DHZ A;  4G3X B;  2O6V B;  4P16 A;  4KIK B;  2PJH A;  3NZ3 A;  3JYU A;  3T9L A;  2JYT A;  3ECI A;  2REX A;  3T3O A;  2L83 A;  1UEL A;  4S0R A;  2C5L C;  3VH4 B;  2I1K A;  2WXF A;  4YTM B;  3N20 C;  5EE9 A;  5EE1 A;  2V0G A;  2MLB A;  5DPT A;  3WAP A;  3N30 A;  4M8N A;  4EOY A;  1K51 A;  2QEJ C;  1OTR B;  4LDT D;  1PGB A;  4MGY E;  1YMH E;  1YOV B;  3HUI A;  4HXD A;  4BVU C;  3QK0 A;  3ZJV A;  1B9R A;  2N1V A;  5G55 A;  4J3O D;  3AB5 A;  4TQ0 A;  1UUP A;  4EE2 A;  1OEY J;  2INP E;  1LGR A;  4ICV A;  2CHW A;  3Q3J A;  3V3X A;  5TSS A;  3EFC A;  4H2A A;  2JUO A;  1ZE3 D;  4L1B A;  4WIP A;  4A9A A;  4FUL A;  1HQR D;  2KTR A;  1DOY A;  5HFY A;  3VHT C;  1VDV A;  1H7X A;  1XD3 B;  4K1R B;  4JLC A;  2KJH B;  4PYU A;  3VUY A;  2MQJ A;  3B2G A;  3Q8C A;  4OVV A;  3ZNH B;  1LXD A;  4P1B C;  3DOW A;  3PRZ A;  2IO1 B;  3AXC A;  5AZH A;  2WDQ B;  1UBQ A;  2LGI A;  1FPY A;  4K81 A;  4KSL C;  1GG3 A;  2BKF A;  2ZW1 A;  3DHG C;  1YJJ A;  1ACC A;  4F1S A;  1N62 A;  2WXO A;  4KZ0 A;  3IAS 1;  1VCB A;  1KRH A;  3ONS A;  5MPO A;  1KM7 A;  2JQR B;  1KLG D;  2AQ2 B;  2M0X A;  2BQQ A;  4M01 A;  3NJT A;  1BXT A;  3DWG C;  3CWI A;  2KWD A;  2WS3 B;  4ZRQ A;  4IWP A;  2EMS A;  1WYW B;  2EKI A;  3H8H A;  4KGR A;  4MGZ E;  1J8C A;  4JPS A;  1D5Z C;  3BII D;  1ZW7 A;  4IG7 B;  3VTU A;  1YX5 B;  4YTP B;  3FKY A;  1JW9 D;  3BYT B;  4E71 A;  4A6Q A;  1TS2 A;  5T8I A;  3Q6B A;  4BKS D;  1M94 A;  1EU4 A;  5D3I B;  1IPG A;  1MHX A;  2CKH B;  2ZVN A;  3RFZ B;  3H7S A;  1SE2 A;  1CQV A;  2RGF A;  2L0T A;  1C1Y B;  3PRE A;  1E6E B;  4PS8 A;  2KFK A;  4YSX B;  2ICI A;  2QDF A;  3SFD B;  2CR5 A;  2DZM A;  4ANU A;  2KJ6 A;  3I9V 1;  4N6E B;  3D32 A;  3H6N A;  1WRD B;  4HK2 A;  4HPP A;  3ZDM C;  4OW0 A;  3NVW A;  4KSK C;  1F2R I;  2KC2 A;  3EHV A;  4YSY B;  2ZNV B;  3EUB 2;  1OEY A;  4EZL A;  1V80 A;  2BW2 A;  1WH3 A;  2WXR A;  1BML C;  1HZ6 A;  3PLV A;  1XLP A;  4K7S A;  4BKG A;  3QHT A;  2BYT A;  1YJI A;  1AWD A;  1JRU A;  2IGG A;  3UIN B;  2OJR A;  2KX3 A;  3AU5 A;  3U4E G;  1NI3 A;  2SAK A;  2WX0 A;  1E7U A;  4US9 A;  4BOS C;  3NG0 A;  1C76 A;  4W9K A;  4IKG A;  2ZW0 A;  2ZNV C;  1T0Q C;  1IBX A;  3IXS A;  1FRR A;  2LUE A;  1E9M A;  2BYF A;  2BYV E;  4OVU A;  2W3S A;  3U7D A;  2JZ3 B;  3R2T A;  1M4V A;  3GE3 C;  4N9F 4;  1RYJ A;  2YEP B;  1C9F A;  4TQ1 A;  1ISN A;  3IHP C;  5FK9 C;  3UI3 A;  3DHI C;  2WHI A;  1XLO A;  3H7P B;  2KC1 A;  4KDL B;  2M8S A;  2V9H A;  4IDI A;  4RMA A;  3IFW B;  1ZDV A;  1TKG A;  3HVD A;  1GB1 A;  4ZHP A;  1JCK B;  4WQO B;  1V86 A;  3RT3 B;  4HVB A;  1VZ7 A;  3L4P A;  3VUX A;  1ET9 A;  3DCG A;  5E6N A;  2DAF A;  1WX8 A;  3A4R A;  4AWJ A;  3O65 B;  3ZNZ B;  2M0A A;  2ZPN A;  3APC A;  2N9L A;  2JXX A;  2KTF A;  2LGY A;  4ANW A;  3GZN B;  4X57 B;  3ZTD A;  1IUE A;  4A3O A;  3PHX B;  3RI7 C;  2MBH A;  4NZL B;  3AI5 A;  2XEW A;  4LDT B;  4A55 A;  1JWS D;  1WI0 A;  2EMT A;  3HVZ A;  1QF6 A;  1ZUD 2;  1RWS A;  2MA9 B;  2C60 A;  3NRZ A;  1I4G A;  4OHJ A;  1P7F A;  3KUD B;  3QWZ B;  4HRS A;  1FFV A;  4OZC A;  1K8R B;  3MHZ A;  4DHJ D;  2IDY A;  2WGS A;  3N1X C;  2K1F A;  1XQQ A;  4GDL A;  2E3T A;  2HE7 A;  3ZGZ A;  1WJN A;  3NZS A;  4MDK E;  3GZN I;  3N3K B;  3PPA A;  1HTQ A;  2HJ8 A;  1QOG A;  2ZZP B;  5BYR A;  3U8Z A;  3KWL A;  3P4P B;  2PMV A;  1AAR A;  3PS6 A;  2CU1 A;  2KWV B;  1QZE A;  4PS7 A;  1E5W A;  1WJ4 A;  3NHE B;  3HIZ A;  2XBB C;  3A1Q B;  4BAX A;  2INN E;  4QAY A;  2D10 A;  1N63 A;  5DCN A;  4LTU A;  4UDU C;  2RMM A;  3VXW A;  1ZXH A;  3ZLZ A;  3Q8F A;  1YQ4 B;  1WJU A;  2WXH A;  5J18 A;  2IY0 B;  5I4D A;  1I35 A;  2RDG A;  3J9C A;  3VDZ A;  2DWQ A;  4ZYN A;  3DDC B;  2N4F A;  4WJO A;  3W5V B;  3PZD A;  2FBW B;  3ZW3 A;  2L52 A;  2KDB A;  1UWM A;  1I42 A;  2QCZ A;  3PRM B;  1MFW A;  1L5P A;  1F77 A;  3C8Y A;  2LJ5 A;  1LFD A;  2XK5 B;  1CK1 A;  1CJE A;  2L32 A;  3L10 B;  3OJ4 B;  4M0W B;  3VUW A;  1KLV A;  4LNK A;  3ZDT A;  4RNA A;  2HD5 B;  3Q14 C;  1WMH A;  4HEA 1;  1WFY A;  1ZGU B;  3DVG Y;  1I4R A;  2KO3 A;  4J6I A;  2AX5 A;  3VFK A;  4IOI E;  2G4S A;  4DK5 A;  1C4A A;  4TSS A;  3CF4 A;  4FJY A;  4US8 A;  3R7Q A;  1WJ6 A;  1V97 A;  5D3D A;  3QJZ A;  4ZRJ A;  3AE8 B;  2FUG 1;  1JAL A;  4MM3 A;  1DYQ A;  3DWM A;  1WX7 A;  2MX2 A;  4GOC A;  2K0P A;  2JXT A;  1C78 A;  3ZJU A;  1FO4 A;  4YL8 A;  1WM2 A;  1Y56 A;  1KTK A;  3KYC D;  5AZF A;  4GIV A;  4HJG E;  1WGK A;  1TS5 A;  3FC4 A;  5HI1 A;  3DBL B;  1XEE A;  4YTN B;  2WDT B;  1F9J A;  1FRD A;  1F0Z A;  3KUZ A;  2G9H D;  1H8C A;  2Y3A A;  1J19 A;  4ARI A;  3RCZ A;  1SSN A;  1XCT L;  4WAF A;  3VRB B;  2KDI A;  5E6O A;  2JWZ A;  1ZP0 B;  2TSS A;  4TKN A;  5D6J B;  3RZW C;  1XT9 B;  5D2M B;  5LXI B;  3EEC A;  1PGA A;  3UIO B;  2VRR B;  2RDH A;  2IGD A;  3PSE B;  1FXT B;  3DVG X;  3NVY A;  3AV8 A;  2D07 B;  2MJD A;  3DBL I;  2O2V A;  1KOT A;  2L0F A;  1V5O A;  4BBN F;  1I4P A;  3BVG A;  5LLI A;  3IVF A;  3V6E B;  2PPH A;  1C3T A;  3RZF A;  2ZCC A;  3MHS D;  2GBJ A;  2MBE A;  4TV3 A;  1FFU A;  1GNU A;  3BIN A;  4W9E A;  2PE9 A;  3NS8 A;  3S2A A;  3JSV B;  3ZVV A;  1EM7 A;  4ZHO A;  1PYW D;  3NS1 A;  5JHB A;  2N9K A;  2KVZ A;  3ML8 A;  3ZNI D;  5BO4 B;  2NTT A;  3ZXR A;  2W55 A;  4DDG D;  2K22 A;  1UH6 A;  4E74 A;  1YN5 A;  4W9H A;  3TIX A;  1YQ3 B;  2Y5B B;  3VAW A;  2NS5 A;  2BVC A;  4XWW A;  4WWM A;  5E6P A;  1TKY A;  4ARC A;  5IKC M;  2V4L A;  3WAN A;  4KZC A;  2KVR A;  1QT9 A;  4PT5 A;  2X38 A;  5GXG B;  1GTH A;  1OQR A;  1RFK A;  1UGJ A;  4MJS A;  1UWX A;  4XWT A;  3PV1 A;  2LGS A;  3SDL C;  5IOI A;  1I4H A;  2NTS A;  2AL6 A;  2DZI A;  1SEB D;  3ZRC A;  1ZXI A;  1D5X C;  2CS4 A;  2N1W A;  3P4S B;  2KTR B;  4NNJ B;  2IY1 B;  1BUI C;  3AEF B;  4DHJ B;  4GN1 A;  4AP4 C;  3A9K A;  1WYG A;  2OED A;  3AED B;  1VD2 A;  3TEX A;  3TEW A;  4GSW A;  2KX0 A;  3UQA A;  4WWO A;  1T0Y A;  3P4Q B;  1PFD A;  4HRO A;  4MEM A;  4B6W A;  2W54 A;  3P63 A;  1IP9 A;  2KWC A;  2FCM A;  2KFJ A;  3I57 A;  5EE0 A;  3VR9 B;  2DBY A;  3HK0 A;  4EZJ A;  1GAQ B;  1R4M B;  2K6Q A;  1FM0 D;  4PS3 A;  4HPL B;  4B9K A;  4RGT A;  3AE1 B;  4AQ7 A;  3QAQ A;  4FHK A;  5JZE B;  1TZO A;  1SE3 A;  3O13 A;  1QOB A;  2LGX A;  1K52 A;  3BYY B;  2KAC A;  2JRH A;  1MHH E;  1XXG A;  2RPV A;  1WGH A;  2LEK A;  2KDE B;  4N58 A;  2KD0 A;  2BT6 A;  2K8C A;  3AU4 A;  3ZQ4 A;  2IBI B;  3W1S A;  4GDK B;  1GOZ A;  1R4M I;  3KH0 A;  3ZTC A;  2LMC A;  2J0K A;  3FIL B;  3LJ3 A;  4WWN A;  2BWF A;  4RGM A;  2C9W B;  3OJ3 A;  4KKI A;  3AE6 B;  1B1Z A;  2WYQ A;  1VLB A;  4G0N B;  4JGH B;  1TY0 A;  3GP7 A;  4LLG M;  1KH0 A;  3N1Z C;  4HKQ A;  2MEK A;  1EWC A;  2BTE A;  3TCA A;  1ZDX A;  2KFK B;  1J7C A;  2FID A;  1N61 A;  1G6J A;  2Y5P A;  5J2R A;  2L76 A;  4A8X C;  1JRP A;  2FE8 A;  3K9P B;  3SD5 A;  1Q5W B;  1TGZ B;  2AEH A;  5C3J B;  4AUQ C;  2V3S A;  4OZB A;  4AJW A;  4WQM A;  1JQ4 A;  1P1A A;  3TL5 A;  2KQS A;  4M8M A;  4AJY B;  4GLS C;  3EGR A;  3AEE B;  1T3Q A;  4ITK A;  1FCL A;  3VRA B;  3HM3 A;  3VQI A;  2MSE D;  2FUH B;  3Q8E A;  2A5U A;  3WA0 A;  2Z0E B;  1V81 A;  1WZ3 A;  3KW5 B;  1E90 A;  1PQS A;  1TIF A;  1V1P A;  3ABV B;  4KX6 B;  1L2N A;  3M63 B;  4MEL A;  1TY2 A;  1WSP A;  4NPN A;  2BWE S;  1LM8 B;  3PLU A;  2WXQ A;  2WXK A;  2AQ1 B;  3W1Y A;  1TTN A;  1ENF A;  4EUT A;  2BPS A;  3TEZ A;  1OQY A;  2KQ7 A;  4NQK E;  2GBM A;  4CO7 A;  3MP9 A;  5AEK B;  4GB9 A;  1RRB A;  3PRP B;  2WU2 B;  4WJP A;  1WXQ A;  4W9I A;  4IUM B;  2LHE A;  2WXJ A;  4WAA A;  2WLB A;  1WWT A;  4MH8 A;  1YX6 B;  1JWM D;  2M56 B;  1VZ6 A;  2L3Z A;  1D3Z A;  4MSQ B;  2MP2 B;  2J4X A;  4ACF A;  2RR9 A;  3MC9 A;  1Q0W B;  3LB8 C;  2QJL A;  2KDF B;  2BKR B;  2BB5 A;  1GUA B;  2IND C;  2LUM A;  4NJ7 A;  1JWB D;  5CHF A;  3HRD D;  2PLP A;  1GC6 A;  2NVU I;  2ASQ A;  3EC8 A;  4NAM A;  5KHO A;  1R7S A;  4MH0 E;  3CMM B;  3KLS X;  1SJH D;  1KJT A;  2YLM A;  3H9D A;  4DWF A;  5DPW A;  2JU6 X;  4ASW C;  1Z5S B;  2KJR A;  2LFI A;  1GJZ A;  4LJP B;  5JXV A;  2GLS A;  4REZ A;  1E8X A;  1T6B X;  3BK1 A;  2L05 A;  1UNS A;  5J17 A;  2DNF A;  4IM2 A;  1PUT A;  5LXH A;  3E9S A;  2Q5W D;  4GXB A;  4IC7 B;  1JRO A;  2NMQ A;  3APD A;  3V62 A;  1EF1 A;  4MGI E;  2R2O A;  3L17 A;  5DPS A;  1RAX A;  1GPX A;  1ESF A;  1ZPS A;  2SEB D;  3U52 E;  5CHW A;  1WXV A;  1TBE A;  2WXM A;  4WUR A;  2HTH A;  4RCO A;  1YD8 U;  2WDR B;  2LGD A;  1WR1 A;  2QMT A;  1Y8R C;  1V6E A;  2CU3 A;  3RNC C;  2LD9 A;  3Q3F A;  4XDC A;  4FBJ B;  3NY5 A;  3SR6 A;  2OHF A;  4Q2J A;  1FIQ A;  1IGD A;  3NVZ A;  3QX1 A;  4MSM B;  3R8B A;  2IJ0 A;  3AE3 B;  3X0W A;  2IO0 B;  4TMA B;  2LWP A;  4M02 A;  5D7G A;  1N6Z A;  2W3R A;  4B0E A;  2GBN A;  1HTO A;  3Q2A C;  2DZJ A;  1S3S G;  4LCD E;  3P1M A;  2I38 A;  1NDD A;  4K3B A;  1NEK B;  2KHW B;  2D3G A;  4YWG G;  3RNF C;  2NBW B;  2EEL A;  3L0W B;  1MJD A;  4ZRI A;  2K25 A;  5IP4 D;  4ZRK A;  5BMI A;  2LHD A;  2DYM A;  1R4N B;  2FCS A;  4EFO A;  1L0X B;  2PW9 A;  1VRA B;  3AMZ A;  2WXP A;  2FNJ B;  3L54 A;  2J52 A;  3WAL A;  2X8X X;  4P7I A;  1FMA D;  3C0R B;  4RM8 A;  3QCA A;  5HG2 A;  1WGG A;  4RM9 A;  4F7Z A;  2IPK D;  2I1J A;  2M1M A;  2DAJ A;  4MM3 B;  4L2Y A;  4HLE A;  3DBH B;  1KLU D;  3A1Q A;  2MW5 A;  1BT0 A;  3UQB A;  5BMG A;  4KVG B;  2BS4 B;  2JX5 A;  1R4N I;  2J42 A;  4BBN C;  4JE3 B;  4ZDV A;  3AE7 B;  1E7P B;  1SB3 C;  3RUL A;  1FXA A;  3EFU A;  2C7H A;  1HZ5 A;  1YN4 A;  3Q8A A;  5BYS A;  4S17 A;  3X23 A;  1JWU D;  3L16 A;  2J53 A;  1K53 A;  2K9X A;  3B0A A;  3ZYY X;  1EU3 A;  5EDS A;  2WXN A;  3IT6 B;  1F1H A;  1P7E A;  3QQ8 B;  2IO2 B;  1PDX A;  1SGH A;  3DVN U;  4DHZ B;  1RM6 C;  4FLH A;  4A3P A;  1OQQ A;  2XK5 A;  2AL3 A;  4CYE A;  1TYG B;  2JWU A;  3Q8B A;  1L4D B;  3KWV A;  2BGF A;  3ZXV A;  2LRU A;  2RSU A;  1P9D U;  2HDE A;  4GMV A;  4FAD A;  3OG5 A;  3AE4 B;  3GB1 A;  4NQL B;  4LNI A;  4KKJ A;  4ZYS A;  5G5G A;  1NYR A;  3MJW A;  3QC8 B;  1XLQ A;  3DVN V;  2D2Q A;  3CF6 E;  4RGN A;  2HJ1 A;  3BK2 A;  3AE9 B;  1LQB A;  3TBL D;  2KWU B;  4NAW A;  3L13 A;  3N9Y C;  4MT5 A;  5H92 C;  4W9G A;  3VR8 B;  4RF1 A;  2ZJD A;  1CMX B;  4C4V B;  2JYE A;  4RGO S;  3LYY A;  1WRI A;  3A9J A;  3ZNG C;  1YIW A;  2NPT B;  3P4R B;  1AN8 A;  3GS2 A;  2KAN A;  4IWO A;  4RF0 A;  4DDI D;  3MTN B;  4EZK A;  4C80 A;  1T0S C;  4I6L B;  5FKA C;  1UGM A;  3AH7 A;  4W9L A;  2QHO A;  3SU8 X;  2ZVO A;  3QIJ A;  4MJS B;  2NBV B;  2MBQ A;  2LXC A;  4K7W A;  1WR6 E;  4XDD A;  3WIM A;  4HJK A;  5LNK 1;  2D3A A;  1NBF C;  1V9J A;  3GOE A;  3Q3N C;  1C4C A;  3AE2 B;  2JRI B;  3I63 C;  3RUI B;  3T8M A;  4G11 A;  1T5X D;  3RNG C;  2D3B A;  3RPF C;  1GC7 A;  1YJ1 A;  1ZKH A;  3AEB B;  2H88 B;  3A9K B;  2OJW A;  2LI5 A;  2MH7 A;  1E7V A;  1E10 A;  2FCQ A;  4HCP B;  2GRI A;  1UF0 A;  1PGX A;  3T3N A;  2K3U A;  2M4N A;  3OLM D;  4XYC A;  2NR2 A;  2KKC A;  4FN2 A;  3HM6 X;  2K8H A;  2V3N A;  4JWU C;  4KGT A;  1WE6 A;  1V49 A;  2LRW A;  2PEA A;  2N7J A;  2UYZ B;  4WH4 A;  1XO3 A;  2Z59 B;  4EKU A;  4CQN A;  1CZP A;  3Q3O C;  1Q10 A;  2N9X A;  3M62 B;  4LNF A;  2LVQ A;  2BBC A;  3R66 C;  3ZJT A;  1V5T A;  1NEN B;  1ROE A;  3QA8 A;  3RNE C;  1L0V B;  2O6V A;  2BYE A;  1OFF A;  2KK8 A;  4DXA B;  1WIA A;  2JSV X;  2WWZ A;  3AN1 A;  5IO9 A;  1WXA A;  4BOZ B;  4ANX A;  4KIK A;  1FNW A;  1LO5 D;  1FXI A;  1HE8 A;  1QIL A;  2GBR A;  1XCQ L;  1QKZ A;  2EKE C;  2VH2 A;  3VTV A;  4W9F A;  3MJ5 A;  2RPQ A;  2ZCB A;  2VZK D;  2RDB C;  2XN9 C;  4OVZ A;  1F2R C;  1EO6 A;  1UD7 A;  1WXS A;  1P0R A;  4ANV A;  3VH3 B;  2AWT A;  4CHK A;  3TJP A;  4HKZ E;  1VR9 A;  2UWQ A;  3H1U A;  3W1S C;  1S1Q B;  4DXG A;  4NJ6 A;  5C23 A;  4JWS C;  3NUH B;  4IM0 A;  2L1A A;  4JIO U;  3PGE A;  4HWI B;  3PZ8 A;  3DBR B;  3TEY A;  3PT2 B;  1MPE A;  1JML A;  2KMA A;  2BS2 B;  1OGW A;  3B08 A;  2PIA A;  4LK0 M;  2PTL A;  1T0R C;  3RD2 A;  3A4S C;  4C7Y A;  2MHJ A;  1F52 A;  2N9E B;  3OWE B;  3B2F A;  4JX1 C;  2J7Q B;  4MGK E;  1XF5 L;  3HHM A;  2N7E A;  1AYF A;  1MI0 A;  1STE A;  1SXT A;  2W9N A;  3M3J A;  4G50 A;  2I2Y A;  2GBK A;  2FCN A;  4GDK A;  2ONQ A;  5IAA C;  2KN5 A;  2WP9 B;  2DYO A;  2KLG A;  2BB6 A;  5C1Z A;  1V1P B;  2OOB B;  1J7B A;  3DBR I;  1SIF A;  3FIL A;  1TT5 B;  1E8W A;  2D11 A;  2JF5 A;  2ZEQ A;  3KYD D;  2E6X A;  2G3Q B;  2V1Y A;  3KUC B;  4ICU A;  4YT0 B;  2IZV B;  2RD0 A;  3IAM 1;  5D94 A;  4LJO B;  5C2T B;  1NVI D;  4W9J A;  3OAW A;  1FNV A;  4FJZ A;  3EA6 A;  2H89 B;  2AYO B;  2DYB A;  5L83 A;  1SF0 A;  1IYF A;  1EF5 A;  4A20 A;  5TR5 A;  2DEN B;  2FAZ A;  3ML9 A;  1IBX B;  3WAM A;  5CX3 A;  4GU2 A;  3JVZ X; 
#chains in the Genus database with same CATH homology
 2CU3 A;  4MAC A;  3ZJV A;  1B9R A;  4D2K A;  2Y3A A;  2JZP A;  4J3O D;  5BYQ A;  3AB5 A;  2XNA C;  4TQ0 A;  4XDC A;  4ARI A;  1DOI A;  2IGH A;  1SSN A;  2WDV B;  1UUP A;  3HUI A;  1XCT L;  4WAF A;  3SR6 A;  4EE2 A;  1D6E C;  3VRB B;  2OHF A;  4Q2J A;  2INP E;  3AEA B;  1ZP0 B;  1FIQ A;  1IGD A;  3NVZ A;  3V3X A;  5TSS A;  2TSS A;  4H2A A;  3R8B A;  2IJ0 A;  3AE3 B;  4TMA B;  1ZE3 D;  4L1B A;  4WIP A;  4B0E A;  5D7G A;  2W3R A;  1TS3 A;  4A9A A;  1HQR D;  4NJC A;  1SJE D;  3BVZ A;  3SFE B;  1PGA A;  1DOY A;  2RDH A;  5HFY A;  2IGD A;  1VDV A;  1H7X A;  3NVY A;  3AV8 A;  3P1M A;  2I38 A;  2MJD A;  1NEK B;  3B2G A;  3Q8C A;  4YWG G;  4C7Z A;  2EEL A;  1MVK A;  4O1N A;  2N0S B;  5BMI A;  2LHD A;  2DYM A;  4YSZ B;  1I4P A;  3BVG A;  2WDQ B;  1ZOY B;  2LGI A;  2R61 A;  3W9C B;  2ZW1 A;  3PO0 A;  1L0X B;  1ACC A;  1YJJ A;  3U7Z A;  1N62 A;  2WXO A;  2PW9 A;  1N5X A;  3IAS 1;  1D4B A;  1KRH A;  1VRA B;  1FFU A;  3AMZ A;  5MPO A;  2PVG C;  2WXP A;  5EE3 A;  2JQR B;  1EM7 A;  4ZHO A;  1C4P A;  1PYW D;  1KLG D;  3NS1 A;  5FR3 A;  2AQ2 B;  2N9K A;  2J52 A;  1BXT A;  3DWG C;  3CWI A;  3CIR B;  2KWD A;  1FMA D;  1QOA A;  2NTT A;  2WS3 B;  2W55 A;  4ZRQ A;  2K22 A;  5HG2 A;  5AUK A;  2EKI A;  3H8H A;  1YN5 A;  1YQ3 B;  2IPK D;  4KGR A;  5E6J A;  2KQ4 X;  4XWW A;  4MM3 B;  4L2Y A;  4JPS A;  1D5Z C;  3BII D;  3ETR A;  4WWM A;  1KLU D;  4YTP B;  1IGC A;  1TKY A;  1I7H A;  1HEZ E;  1JW9 D;  2GI9 A;  5BMG A;  3BYT B;  4DXF A;  4A6Q A;  4ARC A;  2BS4 B;  1TS2 A;  5T8I A;  2JX5 A;  2J42 A;  1I4X A;  4JE3 B;  3AE7 B;  1E7P B;  1SB3 C;  1QT9 A;  1EU4 A;  1I4Q A;  4PT5 A;  3WCQ A;  2M19 A;  2X38 A;  1FXA A;  5GXG B;  1TS4 A;  4GDL B;  5D3I B;  4ZRP A;  1HZ5 A;  1YN4 A;  1GTH A;  1ET6 A;  3Q8A A;  3TUO A;  1MHX A;  5BYS A;  1JWU D;  2WNM A;  1OQR A;  1RFK A;  3RFZ B;  1UGJ A;  1J7A A;  1K53 A;  2J53 A;  2K9X A;  1UWX A;  1D5M C;  1SE2 A;  2MJ3 A;  3LXF A;  3P42 A;  1EU3 A;  4XWT A;  3ZYY X;  1CQV A;  2WXN A;  3IT6 B;  1P7E A;  1I4H A;  1A70 A;  2NTS A;  3SEB A;  1VZ8 A;  1E6E B;  1PDX A;  4YSX B;  1NYQ A;  2ICI A;  1SEB D;  1ZXI A;  1D5X C;  1RM6 C;  3SFD B;  1OQQ A;  3P4S B;  1TYG B;  1XLN A;  3I9V 1;  4N6E B;  1BUI C;  3AEF B;  2JWU A;  3Q8B A;  1L4D B;  3KWV A;  1GB4 A;  1TKE A;  1WYG A;  4OW0 A;  2OED A;  3AED B;  3NVW A;  4RFB A;  3TEX A;  3TEW A;  1F2R I;  3TSS A;  4AS1 A;  2CJN A;  2HDE A;  4YSY B;  3P4Q B;  1PFD A;  4HRO A;  5H8Y E;  3R2I A;  2W54 A;  3EUB 2;  2WU5 B;  3P63 A;  2DLB A;  3AE4 B;  3GB1 A;  2BW2 A;  1C77 A;  1YNT E;  3I57 A;  2WXR A;  5EE0 A;  3AEG B;  3VR9 B;  2DBY A;  4KKJ A;  1BML C;  4ZYS A;  1GAQ B;  1HZ6 A;  5G5G A;  1XLP A;  1NYR A;  2VZK B;  3URY A;  2LJI A;  1L6V A;  1XLQ A;  2BYT A;  1FM0 D;  1YJI A;  2AQ3 B;  4RGN A;  1AWD A;  1V1O A;  3BK2 A;  2IGG A;  1C79 A;  3BZD B;  2MJE A;  4RGT A;  2QSD A;  3AE1 B;  3AE9 B;  1HXY D;  2W82 A;  4AQ7 A;  3N9Y C;  3U4E G;  1NI3 A;  4MT5 A;  5H92 C;  1TZO A;  2SAK A;  1SE3 A;  3O13 A;  1QOB A;  4US9 A;  3VR8 B;  4RF1 A;  1QLB B;  1K52 A;  1DOX A;  3BYY B;  2KAC A;  2JYE A;  4RGO S;  1C76 A;  3LYY A;  1WRI A;  1MHH E;  1XXG A;  2RPV A;  2Y5C A;  2LEK A;  3W2D A;  3AM9 A;  4IKG A;  4N58 A;  2ZW0 A;  1SE4 A;  2BT6 A;  2BS3 B;  2ON8 A;  3P4R B;  1AN8 A;  1IBX A;  3IXS A;  1FRR A;  3GS2 A;  3ZQ4 A;  1E9M A;  4RF0 A;  3W1S A;  4GDK B;  1V8C A;  1TJE A;  4C80 A;  5FKA C;  1GOZ A;  5AUI A;  1FEH A;  1YN3 A;  2W3S A;  2LMC A;  3R2T A;  2YEP F;  4DQO C;  1M4V A;  3AH7 A;  1K50 A;  3FIL B;  1RYJ A;  2QIL A;  2YEP B;  1QQR A;  4FXC A;  4RGM A;  1C9F A;  4KKI A;  4TQ1 A;  3AE6 B;  1B1Z A;  5FK9 C;  3NVV A;  3UI3 A;  1L0Y B;  1VLB A;  4LLG M;  4XDD A;  1TY0 A;  3GP7 A;  2B76 B;  1FCC C;  1KH0 A;  1QOF A;  1XLO A;  2D5G A;  1H7W A;  4HKQ A;  5LNK 1;  2MEK A;  1EWC A;  2BTE A;  1C4C A;  2PVO D;  3AE2 B;  1ZDX A;  4IDI A;  1J7C A;  1N61 A;  1ZDV A;  1T5X D;  2Y5P A;  3RPF C;  1TKG A;  4A8X C;  3HVD A;  1JRP A;  1GB1 A;  2FE8 A;  4B0M A;  3AEB B;  2H88 B;  4ZHP A;  1JCK B;  2MH7 A;  5C3J B;  1E10 A;  1L4Z B;  3AE5 B;  4OZB A;  1VZ7 A;  4L23 A;  4WQM A;  3L4P A;  1ET9 A;  4ZOH C;  1JQ4 A;  2GRI A;  1PGX A;  3T3N A;  2K3U A;  4GLS C;  2M0A A;  2N9L A;  2ACZ B;  3EGR A;  2CJO A;  3AEE B;  1IUE A;  1E0Z A;  1T3Q A;  2V3N A;  4ITK A;  3KQ4 A;  4JWU C;  4KGT A;  4XE0 A;  4NZL B;  2V4I B;  2KDM A;  2N7J A;  4M0W A;  4A55 A;  1FCL A;  4WH4 A;  3VRA B;  1XO3 A;  1KFY B;  3VQI A;  1JWS D;  4NAW B;  4CQN A;  1SBB B;  3HVZ A;  5BMH A;  1QF6 A;  1ZUD 2;  3Q8E A;  4YXD B;  1CZP A;  1RWS A;  3NRZ A;  1I4G A;  4OHJ A;  1Q10 A;  1P7F A;  2PKO A;  2KMM A;  3MC0 B;  4HRS A;  2BBC A;  1FFV A;  4OZC A;  3ZJT A;  4OZA A;  1N5W A;  1GT8 A;  2KAJ A;  3MHZ A;  1V1P A;  2IDY A;  1NEN B;  1ROE A;  3ABV B;  1L0V B;  4KX6 B;  1TY2 A;  1WSP A;  1OFF A;  2HTM E;  2KN4 A;  2JSV X;  3AN1 A;  3B9J A;  2E3T A;  2G1E A;  3ZGZ A;  2WXQ A;  2WXK A;  1FNW A;  2AQ1 B;  3IT4 B;  1ENF A;  3PZ7 A;  1LO5 D;  1FXI A;  3Q69 A;  4P6V F;  3TEZ A;  1QOG A;  1QIL A;  5BYR A;  3KWL A;  1XCQ L;  1QKZ A;  3P4P B;  2PMV A;  3FAH A;  4A90 A;  3MP9 A;  3MFG A;  1JWA D;  3U2S C;  4C56 C;  3MJ5 A;  3W5U B;  2WU2 B;  2WXL A;  1WXQ A;  4R3D A;  2VZK D;  2GB1 A;  4RH6 A;  2XN9 C;  4N59 A;  2V3P A;  2LHE A;  2WXJ A;  2K5P A;  4OVZ A;  2WLB A;  1KF6 B;  2INN E;  1WWT A;  4MH8 A;  1N63 A;  1VJK A;  1N60 A;  1JWM D;  2M56 B;  5G5H A;  4LTU A;  1VZ6 A;  4UDU C;  2RMM A;  1ZXH A;  2WQY B;  3Q8F A;  1YQ4 B;  2WXH A;  1GTE A;  2J4X A;  1AW7 A;  4HKZ E;  1VR9 A;  5I4D A;  4DXG A;  3LB8 C;  2QJL A;  3E56 A;  2RDG A;  3J9C A;  4JWS C;  3NUH B;  2L1A A;  5HHD G;  1SIJ A;  2DWQ A;  2WXI A;  3AEC B;  3W5V B;  2FBW B;  2BB5 A;  2L52 A;  2LUM A;  3PZ8 A;  3TEY A;  1JWB D;  1MPE A;  1JML A;  1UWM A;  3HRD D;  2PLP A;  4KGS A;  2BS2 B;  4NAM A;  1R7S A;  2PIA A;  4LK0 M;  1L5P A;  1F77 A;  2PTL A;  3C8Y A;  3KLS X;  2Z8L A;  1SJH D;  4C7Y A;  1CK1 A;  3BWU D;  1CJE A;  2L32 A;  4USA A;  3OWE B;  3B2F A;  2JU6 X;  1DGJ A;  4JX1 C;  2QIE B;  2WXG A;  4RNA A;  1EWY C;  1XF5 L;  1FD6 A;  1AYF A;  1MI0 A;  2LFI A;  4HEA 1;  1STE A;  1SXT A;  1FNU A;  1HA5 A;  2I2Y A;  3V05 A;  5JXV A;  4REZ A;  1I4R A;  2ONQ A;  3BVM A;  1T6B X;  2WP9 B;  2DYO A;  3BK1 A;  2BB6 A;  1L6U A;  2AX5 A;  1UNS A;  4IOI E;  1V1P B;  1C4A A;  1J7B A;  4TSS A;  1PUT A;  3CF4 A;  4P16 A;  4US8 A;  3FIL A;  1V97 A;  5D3D A;  3E9S A;  3NZ3 A;  2Q5W D;  3AE8 B;  2E6X A;  1JRO A;  2JYT A;  2NMQ A;  2FUG 1;  4YT0 B;  1JAL A;  3T3O A;  2L83 A;  3IAM 1;  1DYQ A;  3DWM A;  2WXF A;  1GPX A;  1ESF A;  5C2T B;  1ZPS A;  4YTM B;  2K0P A;  2SEB D;  5EE9 A;  3U52 E;  5EE1 A;  1NVI D;  1FNV A;  2JXT A;  2V0G A;  1C78 A;  3ZJU A;  3EA6 A;  1FO4 A;  2H89 B;  1Y56 A;  1KTK A;  2WXM A;  4HJG E;  4WUR A;  1WGK A;  4RCO A;  1K51 A;  2QEJ C;  1SF0 A;  1TS5 A;  2WDR B;  3FC4 A;  1PGB A;  5HI1 A;  1XEE A;  4YTN B;  2QMT A;  1IBX B;  1FRD A;  1YMH E;  1F0Z A;  2G9H D;  1F2R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...