2WS3B

Crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd tyr83phe mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
publication title Succinate Dehydrogenase Activity
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 65
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2ws3B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ws3B01
4YT0B 5EE1A 3NVWA 1ZUD2 1R7SA 2K22A 3AEGB 1XLQA 4YTNB 4JX1C 3AE4B 2Q5WD 4YSZB 1KRHA 1AYFA 1UWMA 2WLBA 3AE8B 1JW9D 5EE3A 4A9AA 3SR6A 4N59A 1ROEA 1N61A 1FIQA 1JROA 1OQQA 3BIID 3AE6B 1L6UA 3DWMA 1FO4A 3VR9B 3VRAB 1FM0D 1QF6A 3AEDB 1JALA 4JWUC 3NVVA 1QOAA 3ZYYX 1TKGA 3AEBB 1SF0A 1I7HA 1N5WA 1YJJA 3ABVB 3AH7A 3AE3B 2CJOA 2M56B 2OHFA 1XO3A 3EUB2 1N63A 5H92C 1WRIA 3FC4A 1GTHA 2HTME 3FAHA 1WYGA 4C7ZA 1IUEA 1J7AA 1N60A 1WGKA 3P63A 2K9XA 2W54A 4YXDB 2DWQA 2MJDA 1RYJA 3PO0A 3W5UB 3NRZA 2N0SB 1AWDA 1FRDA 1GT8A 1RFKA 5GXGB 3AECB 2LEKA 3AN1A 1NENB 2PVGC 3AE5B 1KF6B 1PUTA 1QOFA 2WP9B 1VLBA 2ACZB 2FBWB 1JQ4A 2E3TA 1SB3C 1JRPA 4USAA 3P4PB 2WDRB 1GTEA 1E7PB 2B76B 5C3JB 3AEAB 1SIJA 2WDVB 3AE7B 2W3SA 1DOIA 2MJ3A 1F0ZA 4IDIA 2QIEB 1JWAD 1L0VB 1E6EB 2KAJA 2CU3A 4N6EB 2JQRB 3WCQA 1E0ZA 1ZXIA 2W55A 4HRSA 4P6VF 2BS3B 2WQYB 3VR8B 1J7CA 2QJLA 1FFVA 2WU5B 1QLBB 4ZOHC 4KX6B 1TKEA 2EKIA 2PIAA 3LXFA 1YJIA 1PDXA 1DOXA 3W9CB 1WWTA 4YSYB 2KMMA 2G1EA 5H8YE 1FXIA 2M19A 1FXAA 3W5VB 2H89B 5AUIA 1RM6C 1EWYC 5EE0A 2WS3B 1QOBA 1YQ4B 3CF4A 2WDQB 1RWSA 1V8CA 2AX5A 1WXQA 4WWMA 1XLOA 2PVOD 1FMAD 3AEFB 3ETRA 1DOYA 1JWBD 1L6VA 1PFDA 3B2FA 3DWGC 2BS2B 2H88B 4US8A 1VJKA 3AE2B 1VDVA 1NI3A 3AE9B 1TYGB 5C2TB 1A70A 2L52A 1H7WA 2JX5A 1NVID 5AUKA 5G5HA 1ZP0B 3AE1B 3CIRB 3P4QB 1KFYB 4N58A 3AEEB 4YSXB 1V97A 1H7XA 1CJEA 2MH7A 1QOGA 2BS4B 4US9A 2CJNA 4YTPB 2DBYA 2Y5CA 1NEKB 3P1MA 5EE9A 3CWIA 1ZOYB 1QT9A 3HVZA 3L4PA 4WQMA 3KWLA 2K5PA 1B9RA 1OQRA 1N5XA 3HUIA 5MPOA 1CZPA 1NYQA 1E9MA 3P4SB 1GPXA 1FFUA 3B9JA 3AB5A 3P4RB 1FRRA 3LB8C 4HROA 4FXCA 1OFFA 1XLPA 5G5GA 4YTMB 1J7BA 1XLNA 3AM9A 3NVYA 1GAQB 3AMZA 1T3QA 3HRDD 1YQ3B 3NS1A 4ITKA 3AV8A 4LTUA 1TJEA 2PKOA 3VRBB 1NYRA 1N62A 4C80A 3SFDB 4C7YA 2MJEA 1TKYA 2WU2B 2W3RA 4ZHOA 1DGJA 4JWSC 4ZHPA 1E10A 2BT6A 3NVZA 3SFEB 3RPFC 2L83A 3B2GA 1L5PA
chains in the Genus database with same CATH superfamily
3NZ3A 1GC7A 4YTNB 2KJHB 4YSZB 3GE3C 1YJ1A 4HPLB 1K51A 2FCQA 1KJTA 4MELA 4JWUC 3Q3OC 2BYEA 1WE7A 2IJ0A 1V5OA 3HUIA 1JRUA 2IGGA 1IP9A 3T8MA 3T3OA 2NVUI 3GE8C 1MHHE 3QA8A 1TZOA 2JRHA 1UGMA 1PUTA 3NZSA 2D5GA 3L54A 3X0WA 1UZXB 1MPEA 2BF8B 2ZZPB 1S1QB 3K9OB 4GLSC 4HXDA 1E6EB 2BWES 2JQRB 3JW0X 1SE4A 4W9EA 4WWPA 4K7UA 1FFVA 4WAAA 1QLBB 2LJIA 2K3UA 1WYWB 2JYEA 2MBQA 3PVLA 3W9CB 4MGZE 4HDOA 4EOYA 4BKGA 1DYQA 1E7UA 5EE0A 1E8ZA 2LHDA 1M94A 3RNFC 1XLOA 1T0YA 1EWCA 5BYSA 3ZKJC 1GB1A 3R2TA 1QZEA 3AE2B 5FKAC 1A70A 2NS5A 1GOZA 3B08A 1NVID 1VCBA 2KC2A 2KK8A 1H7XA 2DHZA 3HHMA 4JE3B 1V1OA 2NTSA 4KZ0A 1ZOYB 5E6PA 3JYUA 3KWLA 3A9KB 4WURA 5KHOA 2A4ZA 4NJCA 2N9XA 2EELA 3PTFC 2GBNA 2MBOA 3VH4B 3LB8C 4YTMB 1WJNA 3RUIB 3NS1A 4PT5A 1T3QA 4FA6A 4PS8A 5D3IB 3IFWB 4MSMB 3VUYA 2GBKA 3RCZA 1E5WA 1WR6E 3RNGC 1NDDA 5EE3A 4AUQC 2JYTA 4QAYA 2ZJDA 3IVFA 2KT7A 2LXAA 2JT4B 1XO3A 3UF8A 2L3ZA 1V9JA 1C78A 2DWQA 2KFJA 2PW9A 3VAWA 1L4DB 1QKZA 1KF6B 1Y56A 1EU3A 4FBJB 1JQ4A 3DDCB 4USAA 3U52E 3BINA 5AZHA 5J2RA 2QIEB 2N1WA 2MA9B 3ZNID 4OZBA 2LHEA 1TZ1A 3AI5A 4K7WA 3SU8X 1LFDA 2KFKA 4FHJA 1XT9B 3BK2A 4IOIE 2PE9A 3Q8CA 4ANWA 1FNVA 1FEHA 1E8XA 3Q3NC 1EO6A 2IY0B 3ENEA 1PFDA 1SE3A 1ZE3D 2IO0B 4OZCA 2K25A 3TEWA 3O13A 4E3CA 3DOWA 2CJNA 4M00A 4ZYNA 3H8HA 4OVVA 5LNK1 2Z8LA 1ISNA 2O6VB 1E9MA 4DHJD 3HRDD 4LTUA 4KVGB 2K8HA 3MJWA 3UIPB 3DPDA 2W3RA 3ZNHB 1TS3A 5DPWA 3NVZA 2KHWB 2L8JA 1H4RA 3ZVVA 2IO3B 4GU2A 4WJQA 2EMTA 2MP2B 2ZNVB 2I1JA 1XEEA 5HFYA 3VRAB 4KIKA 2J4XA 3N9YC 4C56C 3NOBA 3FAHA 1C4AA 3QARA 1J8CA 1GG3A 2W54A 2MJDA 3UIOB 3JSVA 3UQBA 2VZKB 2MWSB 1L2NA 2XK5A 4F1SA 3T3NA 4G0NB 5C3JB 1SIJA 2KTFA 4DQOC 4NJ7A 2QSDA 3L08A 3MC9A 4AS1A 4RM9A 2CU3A 2DYOA 1E0ZA 1ZXIA 2J0MA 2WQYB 3VR8B 1L0XB 2Y5BB 3TJPA 2INPE 3E9SA 5KHQA 3V05A 2VH1A 2KMMA 4NJ6A 2C7MB 2G1EA 2AQ3B 1WXQA 1YN3A 2K1FA 2KJRA 1L6VA 4XGAB 1TYGB 2D3BA 2KYWA 2ZCBA 2D3CA 3L10B 1V97A 1S3SG 4YTPB 2DBYA 3WAPA 3VTUA 1L4ZB 2Y5PA 4IG7B 3TEZA 4ACFA 2GLSA 3W2DA 1FFUA 1KLVA 4FXCA 4MH8A 3CSFA 3LYYA 2ZW1A 4BAXA 5JHAA 2ZNVC 1UD7A 4MH0E 2ONQA 4MACA 4GDLA 2GBJA 3H7SA 4A9AA 1TTNA 4UDUC 1F1HA 5HI1A 2NMQA 3IBEA 4TKNA 5CHVC 1JW9D 3Q8FA 1MJDA 4LLGM 1UF0A 4TQ0A 3ONSA 3Q6BA 1WRIA 2J7QB 2DAFA 2WXNA 2K9XA 4TSSA 5JZEB 4LNKA 3RT3B 1RFKA 3WA0A 1C76A 3AN1A 1J19A 5IA7A 1QOFA 4MSQB 2M8SA 2KOXA 1R4NI 4ZYSA 4XX5A 2W3SA 1ZDVA 3AE7B 2ZEQA 3PZ8A 3N1ZC 2DZIA 3I57A 4REZA 4HRSA 2R2OA 3W1SA 4ICVA 1V80A 5IN7A 1SE9A 4CO7A 2WX0A 2AL6A 1RM6C 2MHJA 3OG5A 2BTEA 2AX5A 4AJYB 3L0WB 1DOYA 4MGIE 1JWBD 4II3B 2LVPA 4DXFA 1ET9A 3GS2A 1KFYB 2E6XA 2WX1A 1C79A 2VRRB 2NPTB 3VVWB 5J17A 3RULA 4G50A 2L00B 3MJ5A 4RGNA 2LGDA 2A5UA 2L0FA 1T6BX 1V2YA 5GMVA 2WNMA 4M02A 4GOCA 1XCQL 2SAKA 1GB4A 4RNAA 4TUUA 2JWUA 1D5XC 4II2B 4C80A 3DBRI 5BMGA 1IPGA 3BYYB 3Q8AA 2MRPA 2K22A 2IO1B 3PZ7A 3N3KB 1J0GA 2CU1A 1H8CA 1ROEA 2N9EB 4PK1A 3DBSA 3ZTCA 1FIQA 3DHHC 4K81A 1QF6A 3U30A 2G9HD 5CX3A 2HTME 1R4NB 4GDKB 2UU7A 1N6ZA 1V1PA 3W5UB 1T5XD 3TSSA 1I42A 2QCZA 4CYEA 4HJKA 2EMSA 1GJZA 1YOVB 3OJ4B 4JIOU 4FN2A 1UUPA 1TBEA 2KZRA 2W55A 2AQ2B 3Q3MC 3EFCA 1XQQA 4MT5A 2J0KA 3LXFA 3W5VB 1EM7A 3PRMB 4ZRJA 3CF6E 2R2QA 3MHSD 2UYZB 5DPTA 2KDMA 2WXLA 1TT5B 4M8NA 5G55A 2MQJA 3E56A 2D2QA 2K6QA 1MFWA 2I2YA 2JX5A 3VFKA 3Q3JA 3AE1B 1L0YB 2JWZA 4O1NA 1FPYA 3DBRB 3CWIA 3DVNV 1OQRA 3A1QB 1GPXA 3A9JA 2JZ3B 3U7DA 4KSKC 1AN8A 2L1AA 3ECIA 4TQ1A 3AM9A 3WIMA 1P98A 2V3NA 4MM3A 3VRBB 5AZFA 2V3SA 2BBCA 5IAAC 2KQSA 2CHXA 2N7DA 2KJ6A 1C1YB 4A3PA 4RF0A 4M01A 2HD5B 1R7SA 3Q3FA 4BFRA 2Q5WD 2DZKA 3GB1A 1JWSD 4N59A 1FO4A 1AARA 3QHTA 2LVQA 4MGYE 1FXTB 1GTHA 4I6LB 4IWPA 1JWUD 3FILA 5LLIA 1HEZE 1TIFA 1V5TA 2KQ4X 5C23A 1EF5A 4URKA 4K3BA 3GOEA 2FBWB 3MFGA 2LRUA 1E7PB 3ZRFA 1UBIA 1L0VB 2WXJA 1IGCA 4WQOB 1WJUA 1MI0A 4WWOA 2M17A 1MG4A 4KX6B 1F77A 1PDXA 1ZKHA 3X23A 2CHWA 5IO9A 1P1AA 4N9F4 2PEAA 2M19A 3U2SC 1LGRA 1BT0A 3L13A 4P1CC 2YLMA 4W9JA 5JHBA 1UH6A 5CHWA 2D10A 4F7ZA 3EA6A 4ZRKA 2LUMA 2FE8A 2L52A 3KUZA 5AUKA 3GP7A 4BVUC 2ZPYA 3HK0A 3HIZA 2MH7A 3ZXVA 4US9A 4MGKE 1QOGA 2GMIC 1QT9A 2N7EA 4WQMA 2ON8A 3VTVA 2K5PA 3DBLI 1N5XA 1HXYD 2KQ7A 2FIFA 3HM3A 3KLSX 4PS3A 3KWVA 3W1YA 2V1YA 4LCDE 3RNCC 2DX5B 1E10A 2L83A 1L5PA 1D5MC 1KLUD 5D2MB 1OEYA 4ANVA 3P42A 1N61A 1P7EA 3OLMD 3MP9A 3QWZB 4NAWA 1YJJA 1ZXHA 2M56B 4J6IA 1V49A 2QC8A 3BY4B 4HK2A 2XBBC 2WYQA 2NCNA 1RYJA 1STEA 3TMPB 4JGHB 2PVGC 3N30A 2K8CA 2ACZB 5BMIA 2PMVA 1YN5A 4GXBA 4HPPA 2FAZA 4HPMB 2RGFA 3A9KA 3DHIC 4L1BA 2BYVE 2LRWA 1VR9A 2OOBB 2YEPF 3N1YC 1WI0A 2LVOA 3U7ZA 3PT2B 5D94A 4DHZE 2KFKB 1HE8A 3CF4A 1I4HA 2RDHA 4F8CB 3DBLB 1FMAD 4WJOA 1R4MI 3ETRA 3KYCD 2LASA 1VDVA 5BYRA 2AWTA 3PHWB 2WDTB 3ZNZB 2JUOA 2Y5CA 2NR2A 3P1MA 4WJNA 1UNSA 2KANA 2FUHB 4IM2A 1CZPA 3CMMB 2KNBA 4HROA 4RMAA 3M62B 3R7QA 1C4CA 1XLNA 1WMHB 2LGXA 4ARIA 2MCNB 3APDA 3EECA 1N62A 2WXHA 3TUOA 2JXTA 3VXWA 4G3XB 3SDLC 4HWIB 4BKSA 3RMKC 2CHZA 3ML9A 2MLBA 4DHZB 3KYDD 2BKRB 3TCAA 2AQ1B 1B1ZA 1TY2A 3SR6A 4RH6A 2INDC 2OJWA 1JALA 2G3QB 1UBQA 1I7HA 4KDLB 4KIKB 4FJVB 2J53A 2QEJC 4ZDVA 4M0WB 1GT8A 1VRAB 4W9LA 3AE5B 4M8MA 1VLBA 4Q2JA 2XK5B 1I4XA 2MJ3A 1D6EC 3WCQA 5L95C 3PZDA 2BS3B 3C19A 3I5JC 1R4MB 2B3AA 4WWNA 1JWMD 1TKEA 3MC8A 2LZ6A 4BOZB 1ACCA 2FCSA 1K53A 1JMLA 1FXAA 1Q10A 4A55A 4B9KA 1YX5B 1WXAA 4LNOA 1RWSA 2FCNA 3B2FA 1Y8RC 1NI3A 4MDKE 1EF1A 2HTHA 2KLGA 1YX6B 2MP2A 5AEKB 2M0AA 1SEBD 1WIAA 1E90A 1CK1A 4BBNF 2R61A 2REXA 2KWDA 4RGOS 4IC7B 2HJ1A 1WJ4A 2W82A 4LDTD 2L0TA 2HDEA 1YD8U 2N1VA 3H7PA 2N4FA 3AMZA 3VDZA 1HQRD 2OJRA 3N32A 1KTKA 2PKOA 1OTRB 1NYRA 1YQBA 4HKZE 2D3AA 2W9NA 3AULA 4W9KA 3S2AA 2C9WB 3V6EB 3AE4B 2KDFB 4GDLB 3WAMA 1UWMA 2QHOA 3N20C 4GMVA 1OQYA 1SGHA 2DYBA 1YIWA 4C4VA 1TKGA 1N5WA 2KACA 2KDIA 4FJZA 1WH3A 3IHPC 2V3PA 1IUEA 4OZAA 2KVRA 4A8XC 3NRZA 3DBHI 2M1MA 1NENB 3EHVA 3RZFA 4L2YA 1WM3A 3L17A 2YEPB 3ZTDA 2KAJA 4N6EB 3C8YA 2GOWA 1WGYA 3I63C 5E6NA 1C77A 3R66C 1F52A 3U4EG 2V9HA 1WRDB 4J3OD 3RNAC 3OAWA 4KDIC 2KTRA 1WM2A 1T0SC 3VQIA 2RPVA 4DK5A 1V8CA 4NQKE 5G2NA 2FIDA 2KN5A 2RD0A 1VJKA 4DWFA 1ZP0B 2Y3AA 3NG0A 4S17A 1G6JA 1K52A 5MPOA 4JPSA 3I9V1 4A20A 1FRRA 4IWOA 2BWFA 1J7BA 1PGBA 3IG3A 4XE0A 4DBGA 1IBXA 2MJEA 3RFZB 4RGTA 1K50A 1XD3B 4CQNA 3BVGA 1NI2A 2WXIA 1RRBA 2JY6A 2C7HA 4XYCA 2NBVB 4KGTA 3QC8B 3DBHB 1JROA 4W9HA 2BPSA 4BOSC 5TR5A 3IAS1 1FM0D 3PLUA 3P2BA 3H9DA 3AH7A 1WGDA 2TSSA 4KKIA 5EDSA 1D5ZC 1RLFA 4JLCA 2M0XA 2LI5A 2KN4A 4GB9A 4EZLA 1HZ6A 2IGDA 5FR6A 1LQBA 4DHJB 4W9IA 3NZUA 1HZ5A 2IBIB 4ZRPA 1PYWD 1JRPA 3ZDTA 2B76B 2WWZA 5CHFA 3GZNI 1HA5A 4RFBA 3W1SC 2NPTA 4OVUA 1F9JA 5D6JB 1ZGUB 2EKIA 3K9PB 5DCNA 3R3MA 4YWGG 1WWTA 2Z59B 1WZ3A 4MJSB 3IT4B 1TY0A 4TMAB 2QDFA 1YQ4B 3C0RB 1I4RA 4I6NB 1SJHD 2GBMA 4HCPB 1GC6A 3R7RA 2RPQA 2BQQA 2BS2B 5E6JA 3HVDA 4LNNA 3ZUNA 2DAJA 4EZJA 2G4DB 4AQ7A 2DNFA 4E74A 4JL9A 3EFUA 3IAM1 3L4PA 1YNTE 4W9GA 3RN9C 4OW0A 4TV3A 1P9DU 3A33B 3DVGY 3PRZA 3TEYA 2IYDB 2J52A 4BKSD 2ASQA 2ZVOA 3PRPB 1UWXA 3A9JB 3VHTC 1FNWA 2PLPA 3WAOA 1EUVB 4MM3B 4FHKA 2O2VA 2KD0A 3NVWA 4XWWA 2QMTA 3V6CB 2KXJA 2WXRA 3PS6A 1IYFA 2WXQA 1PGAA 2K6DB 1OQQA 1RAXA 1SJED 1WZ0A 1QQRA 4HCNB 1QOAA 3ZYYX 2JXXA 4FADA 1F2RC 2N9LA 2G4SA 3EUB2 1N63A 2WXPA 3FC4A 2LGYA 4GGQA 1V6EA 3GZNB 4X57B 2NBUA 1J7AA 1WGKA 3MC0B 3Q14C 2PPHA 4W9CA 1FRDA 2KC1A 4RM8A 2LEKA 3SD5A 1Z5SB 3IXSA 4NAMA 1TGZB 2INNE 3ZIMA 4PYUA 2DZMA 3PV1A 1C4PA 5D3DA 1ZPSA 4HKQA 2HE7A 4HDQA 1GNUA 1KM7A 2V4IB 1C3TA 2QJLA 3A1QA 4EE2A 2MW5A 2CKHB 1DOXA 2BYTA 4BBNC 3RZWC 1ZW7A 4XZ4A 3PLVA 3LDZE 1QOBA 1TS2A 4OVZA 2DENB 2ZW0A 1GUAB 3OJ3A 3BYTB 3IT6B 2JU6X 5IOIA 1I4PA 3ZO5B 3AE9B 4EEWA 1H7WA 4YSXB 1CJEA 4NZLB 4WH4A 4KZCA 4DXGA 5EE9A 4HVBA 3BVMA 2VZKD 3P4RB 4ASWC 2JZZA 4KGRA 4D2KA 1LXDA 1X1MA 2D11A 2RR9A 1Q0WB 2JRIB 1BXTA 3T9LA 2DZJA 2WHIA 4A6QA 3Q2AC 4ZRQA 4ICUA 4AWJA 3VH3B 1IGDA 3SFEB 3RPFC 4YT0B 4H2AA 3AEGB 2L32A 2PJHA 4WAFA 3FKYA 2WLBA 1TS5A 3QCAA 3ZJTA 3BIID 3B0AA 3B1LX 4EKUA 3PPAA 2CJOA 3QQ8B 2JF5A 4FULA 4NAWB 1WGGA 3KUCB 3QK0A 4A3OA 2KLCA 3NHEB 4YL8A 4DDGD 1SSNA 1LO5D 4K1RB 3RD2A 1DOIA 2IGHA 3KH0A 1NBFC 3KUDB 4P6VF 2G45B 2WU5B 2RSUA 4B0MA 1KOTA 2HJ8A 2I38A 2KDEB 1YN4A 1MVKA 1FXIA 2H89B 5AUIA 5LXHA 4R3DA 1WXMA 2MBHA 3V3XA 3BK1A 4NQLB 2ICIA 1SIFA 4US8A 2IO2B 4IUMB 2LD9A 5G5HA 2L05A 2XN9C 1BMLC 4FJYA 4S0RA 3RNBC 2DYMA 3N1XC 4IM3A 4LK0M 3RNEC 3TBLD 1WGHA 5BMHA 1NYQA 3HM6X 1OFFA 1XLPA 1P0RA 3ZLZA 4P1BC 2K0PA 1TKYA 4K3CA 3ML8A 5BYQA 3B2GA 5BO4B 2KWVB 4JX1C 3EC8A 4HLEA 1ZDXA 1RFAA 3NJTA 3QAQA 3OWEB 4P7IA 3V60A 5IP4D 1E7VA 2LXCA 1WJ6A 3UI3A 2M4NA 4XC2A 3AE6B 3VR9B 1D4BA 2UWQA 2GRIA 4XWTA 1SF0A 3AE3B 2OHFA 2V0GA 2GB1A 2BVCA 1WYGA 4C7ZA 2KDBA 2KX3A 3UINB 1N60A 3ZJVA 4YXDB 1AWDA 1QILA 3AECB 1T0RC 1PQSA 2CS4A 4B95A 3ZW3A 2IZVB 3KW5B 2MX2A 2SEBD 1V81A 1D3ZA 3P4PB 2ZCCA 1GTEA 2AYOB 2WDVB 4A90A 1F0ZA 2J42A 1FCLA 3I3TB 3ALBA 5DPRA 3M63B 4AOFA 2K39A 2D07B 2MBBB 1FD6A 4NPNA 4BKTA 4HEA1 4YSYB 1WMHA 4B6WA 4KV2A 4MEMA 5JH5C 3SHQA 4W9FA 3ZRCA 3JSVB 1WX8A 1ET6A 4NY0A 4DXAB 3APCA 3TIXA 1P7FA 1AW7A 1SXTA 5C2TB 4NNJB 5L83A 2JPHA 2KKCA 3CIRB 2O6VA 1WGRA 3ZQ4A 3DHGC 1C9FA 3ZGZA 3HVZA 5D7GA 2XNAC 3VTWA 4C00A 1ENFA 1U4AA 3AB5A 2GBRA 3URYA 2LFIA 5CTRC 1GAQB 4W9DA 1VZ6A 3H7PB 2AEHA 4M0WA 1OGWA 4ZHOA 4ZHPA 2BT6A 3APFA 1XLQA 4GIVA 1CQVA 4EUTA 3AE8B 1Z2MA 1XXGA 3ZXRA 3DWMA 1L6UA 1V86A 3AEBB 3PSEB 1VZ8A 1M4VA 5AZGA 3AU4A 3J9CA 5H92C 4C4VB 3AXCA 3NUHB 3R8BA 3MTNB 1XCTL 2DLBA 2N0SB 4LNFA 3ZDMC 4BZAA 1WX9A 3BZDB 5FK9C 3L16A 3UQAA 2E3TA 2KO3A 2KWCA 2AL3A 2INCC 4K7SA 1WSPA 3WANA 2N9KA 2PIAA 2FUG1 3RI7C 3QX1A 1WF9A 3KQ4A 1EWYC 4PYZA 2CR5A 4AJWA 2BW2A 4ARCA 2KTRB 3MHZA 3DWGC 5HKHA 2LWPA 2JVCA 2WXMA 5I4DA 2GI9A 3P4QB 1SBBB 3AEEB 4N58A 4LJPB 2BS4B 1F2RI 2K8BA 2WXKA 5HHDG 3B9JA 2KMAA 4CHKA 3Q8BA 3M95A 4WIPA 1FCCC 1HTQA 2OEDA 2KWUB 3SFDB 3PGEA 3A4RA 4IDIA 1I4GA 1ZUD2 1IBXB 2RMMA 1KRHA 4PS7A 1AYFA 3ZNGC 1E8YA 2VH2A 2LMCA 1MHXA 1ESFA 3AEDB 2BB5A 2LUEA 2C7NB 3KVFB 5DPSA 4HJGE 5IKCM 4XDCA 1MG8A 3RYTA 3NY5A 1UGJA 5HG2A 2RDBC 1TS4A 3P63A 3VUWA 2JSVX 4RF1A 5JXVA 1EU4A 3DQVA 1XF5L 5GXGB 4XDDA 4E71A 1PGXA 2N7JA 4GN1A 2WDRB 4KSLC 3H1UA 3TL5A 1KLGD 4GSWA 1JWAD 1JCKB 4IW0A 5T8IA 1WE6A 1J7CA 2KX0A 2IPKD 2QILA 2L7RA 4IKGA 1YJIA 3DCGA 4EZKA 3WALA 4I6PA 2WDQB 1V1PB 1K8RB 2Z0DB 2I1KA 4RGMA 2PVOD 3R2IA 4LNIA 2X8XX 5LXIB 2LJ5A 3DVGX 5C1ZA 3V62A 3QJZA 1CMXB 2EKEC 2C5LC 4P16A 2BGFA 1T0QC 2V4LA 3AU5A 2XEWA 1WX7A 1WR1A 4IM0A 4RCOA 2D3GA 3JVZX 5G5GA 2WXOA 1YQ3B 3D32A 3QIJA 4IWQA 3LJ3A 4OHJA 2WU2B 2MEKA 4JWSC 1E8WA 2WXFA 1VZ7A 2IY1B 2IDYA 5EE1A 2ZPNA 1Q5WB 2WGSA 3O65B 3PREA 2O2VB 1I4QA 2BYFA 1SE2A 1KH0A 3NVVA 4GDKA 1UELA 4ZRIA 3ABVB 2X38A 1LM8B 2Z0EB 4MJSA 2N9PC 1HTOA 1I35A 2PE6B 4LDTB 3PO0A 3BVZA 5J18A 3Q8EA 2LGSA 1L7YA 2WP9B 3UGBB 3ZJUA 1SB3C 1OEYJ 4KKJA 2FNJB 4ANUA 3AEAB 4ANXA 2PTLA 3EGRA 2ZVNA 4G11A 1BUIC 5FR3A 5TSSA 2MBEA 3DVNU 1P3QU 4ZOHC 2C60A 2BB6A 2NTTA 1A5RA 2LGIA 5H8YE 3SEBA 5E6OA 3CSTA 3FILB 1WXSA 4JQWC 2WS3B 4WJPA 3A4SC 4WWMA 2YVCA 3AEFB 2O6VD 1Q1OA 3BWUD 2H88B 1WFYA 3H6NA 4B0EA 4DDID 2BKFA 4FLHA 1WY8A 2RDGA 3VUXA 2FCMA 3Q69A 1NEKB 3V61A 4KGSA 4AP4C 3NS8A 2WXGA 1B9RA 2L76A 1WXVA 1YMHE 2J0JA 2MSED 3P4SB 3M3JA 1FNUA 1VD2A 4LJOB 3NVYA 2NBWB 3TEXA 4ITKA 3PHXB 3AV8A 1TJEA 2JZPA 4C7YA 3U8ZA 4L23A 2KMCA 1DGJA 2KVZA 4EFOA
chains in the Genus database with same CATH topology
3NZ3A 3Q8AA 2K22A 3PZ7A 4YTNB 4JX1C 3AE4B 4GDLB 4YSZB 1UWMA 1ZDXA 1K51A 3OWEB 1ROEA 3UI3A 1FIQA 3AE6B 3VR9B 1QF6A 1D4BA 4JWUC 2G9HD 2GRIA 1TKGA 4XWTA 2IJ0A 1SF0A 1N5WA 3HUIA 2KACA 3AE3B 2OHFA 2HTME 2IGGA 2GB1A 2V0GA 1WYGA 4GDKB 2V3PA 4C7ZA 1IUEA 4OZAA 3ZJVA 1N60A 3T3OA 4YXDB 1V1PA 3W5UB 4A8XC 3NRZA 1T5XD 1AWDA 3TSSA 1QILA 1MHHE 1TZOA 3AECB 1NENB 1PUTA 2SEBD 2D5GA 1MPEA 3P4PB 1GTEA 1UUPA 4L2YA 2WDVB 4A90A 2YEPB 1F0ZA 4GLSC 2J42A 1FCLA 2KAJA 1E6EB 4N6EB 2JQRB 1SE4A 2W55A 3C8YA 2AQ2B 1C77A 1FFVA 1QLBB 2LJIA 2K3UA 4MT5A 3U4EG 2JYEA 3LXFA 1FD6A 3W9CB 4HEA1 4YSYB 4J3OD 3W5VB 1DYQA 5EE0A 1EM7A 3VQIA 2LHDA 2RPVA 1ET6A 1V8CA 1XLOA 2KDMA 1EWCA 5BYSA 1GB1A 2WXLA 3R2TA 1VJKA 3AE2B 1P7FA 5FKAC 3E56A 1AW7A 1SXTA 5C2TB 1A70A 1GOZA 2I2YA 2JX5A 1NVID 1ZP0B 3AE1B 3CIRB 2Y3AA 1H7XA 1L0YB 3ZQ4A 1C9FA 4JE3B 1V1OA 4O1NA 3ZGZA 2NTSA 3CWIA 1ZOYB 3HVZA 3KWLA 4WURA 1OQRA 5D7GA 1K52A 5MPOA 2XNAC 4NJCA 4JPSA 2EELA 1GPXA 1ENFA 3I9V1 3AB5A 1FRRA 3LB8C 3URYA 2LFIA 4YTMB 1AN8A 2L1AA 1J7BA 4TQ1A 3AM9A 1GAQB 3NS1A 1T3QA 4PT5A 2V3NA 5D3IB 1PGBA 1VZ6A 3VRBB 4M0WA 4XE0A 1IBXA 2MJEA 2BBCA 3RFZB 4ZHOA 4RGTA 4ZHPA 1K50A 2BT6A 4RF0A 1R7SA 1XLQA 4CQNA 1CQVA 2Q5WD 2WXIA 3BVGA 3GB1A 3AE8B 5EE3A 1JWSD 4KGTA 4N59A 1XXGA 1JROA 3DWMA 1L6UA 2JYTA 1FO4A 3IAS1 1FM0D 3AEBB 3AH7A 1VZ8A 1M4VA 1XO3A 2TSSA 3J9CA 5H92C 4KKIA 1GTHA 1D5ZC 3NUHB 3R8BA 1JWUD 3FILA 1HEZE 1C78A 2DWQA 2KN4A 1XCTL 1HZ6A 2IGDA 2DLBA 2N0SB 2PW9A 2KQ4X 1L4DB 1QKZA 1KF6B 1Y56A 1HZ5A 1EU3A 3BZDB 4ZRPA 5FK9C 1PYWD 2FBWB 1JQ4A 2E3TA 1JRPA 4USAA 3MFGA 3U52E 2B76B 1E7PB 4RFBA 1HA5A 2QIEB 1L0VB 1WSPA 2WXJA 1IGCA 4OZBA 2LHEA 1MI0A 2N9KA 3BK2A 4KX6B 2EKIA 2PIAA 1F77A 1PDXA 4IOIE 2FUG1 4YWGG 1WWTA 3Q8CA 2M19A 3IT4B 1FNVA 1TY0A 1EWYC 3KQ4A 4TMAB 1FEHA 3U2SC 1YQ4B 1I4RA 1SJHD 2BW2A 4ARCA 1PFDA 1SE3A 1ZE3D 2BS2B 3DWGC 3MHZA 5E6JA 3EA6A 2LUMA 2WXMA 3HVDA 2FE8A 2L52A 4OZCA 3GP7A 5AUKA 5I4DA 2GI9A 3P4QB 3TEWA 1SBBB 3AEEB 2MH7A 3O13A 4N58A 4US9A 4AQ7A 1QOGA 2BS4B 1F2RI 2CJNA 3H8HA 5LNK1 3IAM1 1QT9A 2Z8LA 3L4PA 2ON8A 2WXKA 1YNTE 2K5PA 4WQMA 1N5XA 1HXYD 3KLSX 4OW0A 3KWVA 1E9MA 5HHDG 3B9JA 3TEYA 3Q8BA 4WIPA 2J52A 3HRDD 4LTUA 1UWXA 1FCCC 1FNWA 2OEDA 2PLPA 3SFDB 2W3RA 1TS3A 1E10A 3NVZA 4MM3B 2L83A 4IDIA 1L5PA 1I4GA 1ZUD2 3NVWA 1D5MC 1KLUD 1IBXB 2RMMA 4XWWA 1KRHA 1AYFA 2QMTA 2WXRA 1XEEA 3P42A 5HFYA 2WXQA 1N61A 1P7EA 1PGAA 1OQQA 2LMCA 1SJED 1MHXA 1QQRA 3MP9A 1ESFA 3VRAB 3AEDB 2BB5A 1QOAA 3ZYYX 2J4XA 4HJGE 1YJJA 3N9YC 1F2RC 1ZXHA 2M56B 2N9LA 4XDCA 3EUB2 4C56C 1N63A 2WXPA 3FC4A 3FAHA 1C4AA 1UGJA 5HG2A 1TS4A 1J7AA 1WGKA 2JSVX 3P63A 2W54A 4RF1A 5JXVA 2MJDA 1RYJA 3MC0B 1STEA 1EU4A 2VZKB 1FRDA 1XF5L 5GXGB 4XDDA 2LEKA 2PVGC 2ACZB 1PGXA 2N7JA 3T3NA 3IXSA 4NAMA 2INNE 5BMIA 2WDRB 2PMVA 5C3JB 1SIJA 4DQOC 1C4PA 1YN5A 2QSDA 5D3DA 1ZPSA 1KLGD 1JWAD 4AS1A 1JCKB 5T8IA 2CU3A 2DYOA 1E0ZA 1ZXIA 4HKQA 2V4IB 2WQYB 3VR8B 1J7CA 1L0XB 2QJLA 4L1BA 2IPKD 2QILA 1VR9A 4EE2A 2YEPF 2INPE 3E9SA 4IKGA 1YJIA 3V05A 1DOXA 2BYTA 3U7ZA 2KMMA 2G1EA 1QOBA 1TS2A 2AQ3B 4OVZA 3CF4A 2WDQB 1I4HA 1V1PB 2RDHA 2ZW0A 1WXQA 4RGMA 1YN3A 1FMAD 2PVOD 3R2IA 3ETRA 3BYTB 1L6VA 3IT6B 2JU6X 1I4PA 1VDVA 3AE9B 1TYGB 5BYRA 1H7WA 4P16A 4YSXB 1V97A 1CJEA 4NZLB 4WH4A 4YTPB 2DBYA 2Y5CA 4DXGA 1L4ZB 3P1MA 5EE9A 2Y5PA 3TEZA 1UNSA 1CZPA 3BVMA 2VZKD 3W2DA 1FFUA 3P4RB 4HROA 4RCOA 4FXCA 4MH8A 5G5GA 4KGRA 4D2KA 1C4CA 1XLNA 2WXOA 3LYYA 4ARIA 2ZW1A 1YQ3B 1N62A 2WXHA 2ONQA 3TUOA 1BXTA 2JXTA 4MACA 4OHJA 4A6QA 2WU2B 4ZRQA 2MEKA 4JWSC 2WXFA 1VZ7A 1IGDA 3SFEB 3RPFC 4A9AA 2IDYA 4YT0B 5EE1A 4UDUC 4H2AA 3AEGB 2L32A 5HI1A 2NMQA 4WAFA 2AQ1B 2WLBA 1B1ZA 1JW9D 1TY2A 3SR6A 3Q8FA 1TS5A 4RH6A 3ZJTA 1I4QA 3BIID 4LLGM 1SE2A 1JALA 1KH0A 3NVVA 1I7HA 3ABVB 2X38A 2CJOA 4TQ0A 1WRIA 2WXNA 4NAWB 2K9XA 4TSSA 3PO0A 2J53A 2QEJC 3BVZA 3Q8EA 1VRAB 1GT8A 1RFKA 1C76A 3AN1A 3AE5B 1SSNA 1QOFA 2WP9B 1VLBA 1LO5D 3ZJUA 1SB3C 4KKJA 4ZYSA 2W3SA 3AEAB 1ZDVA 4Q2JA 3AE7B 1I4XA 1DOIA 2MJ3A 2PTLA 3EGRA 1D6EC 3PZ8A 3I57A 1BUIC 3WCQA 4REZA 2IGHA 5FR3A 4HRSA 5TSSA 4P6VF 2BS3B 3W1SA 2WU5B 4ZOHC 4B0MA 1JWMD 1TKEA 2BB6A 2NTTA 2I38A 1ACCA 1YN4A 1K53A 1MVKA 2LGIA 1FXIA 5H8YE 1JMLA 1FXAA 3SEBA 1Q10A 2H89B 5AUIA 1RM6C 4A55A 3FILB 4R3DA 3V3XA 2WS3B 2BTEA 1RWSA 2AX5A 3BK1A 4WWMA 3AEFB 2ICIA 1DOYA 1JWBD 3B2FA 3BWUD 2H88B 4US8A 1NI3A 4DXFA 1ET9A 3GS2A 4B0EA 5G5HA 2RDGA 1KFYB 2E6XA 2M0AA 1SEBD 1C79A 2XN9C 3Q69A 1BMLC 1CK1A 1NEKB 2R61A 2KWDA 4KGSA 2DYMA 4RGOS 2WXGA 2W82A 4LK0M 1B9RA 3MJ5A 4RGNA 1YMHE 2HDEA 5BMHA 1NYQA 3P4SB 1T6BX 1FNUA 1OFFA 1XLPA 2WNMA 1XCQL 2SAKA 1GB4A 3NVYA 3AMZA 4ITKA 3TEXA 1HQRD 4RNAA 3AV8A 1TJEA 1KTKA 2PKOA 2K0PA 2JWUA 1D5XC 1NYRA 2JZPA 4C80A 4HKZE 4C7YA 5BMGA 4L23A 1TKYA 3BYYB 1DGJA 5BYQA 3B2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YT0 B;  5EE1 A;  3NVW A;  1ZUD 2;  1R7S A;  2K22 A;  3AEG B;  1XLQ A;  4YTN B;  4JX1 C;  3AE4 B;  2Q5W D;  4YSZ B;  1KRH A;  1AYF A;  1UWM A;  2WLB A;  3AE8 B;  1JW9 D;  5EE3 A;  4A9A A;  3SR6 A;  4N59 A;  1ROE A;  1N61 A;  1FIQ A;  1JRO A;  1OQQ A;  3BII D;  3AE6 B;  1L6U A;  3DWM A;  1FO4 A;  3VR9 B;  3VRA B;  1FM0 D;  1QF6 A;  3AED B;  1JAL A;  4JWU C;  3NVV A;  1QOA A;  3ZYY X;  1TKG A;  3AEB B;  1SF0 A;  1I7H A;  1N5W A;  1YJJ A;  3ABV B;  3AH7 A;  3AE3 B;  2CJO A;  2M56 B;  2OHF A;  1XO3 A;  3EUB 2;  1N63 A;  5H92 C;  1WRI A;  3FC4 A;  1GTH A;  2HTM E;  3FAH A;  1WYG A;  4C7Z A;  1IUE A;  1J7A A;  1N60 A;  1WGK A;  3P63 A;  2K9X A;  2W54 A;  4YXD B;  2DWQ A;  2MJD A;  1RYJ A;  3PO0 A;  3W5U B;  3NRZ A;  2N0S B;  1AWD A;  1FRD A;  1GT8 A;  1RFK A;  5GXG B;  3AEC B;  2LEK A;  3AN1 A;  1NEN B;  2PVG C;  3AE5 B;  1KF6 B;  1PUT A;  1QOF A;  2WP9 B;  1VLB A;  2ACZ B;  2FBW B;  1JQ4 A;  2E3T A;  1SB3 C;  1JRP A;  4USA A;  3P4P B;  2WDR B;  1GTE A;  1E7P B;  2B76 B;  5C3J B;  3AEA B;  1SIJ A;  2WDV B;  3AE7 B;  2W3S A;  1DOI A;  2MJ3 A;  1F0Z A;  4IDI A;  2QIE B;  1JWA D;  1L0V B;  1E6E B;  2KAJ A;  2CU3 A;  4N6E B;  2JQR B;  3WCQ A;  1E0Z A;  1ZXI A;  2W55 A;  4HRS A;  4P6V F;  2BS3 B;  2WQY B;  3VR8 B;  1J7C A;  2QJL A;  1FFV A;  2WU5 B;  1QLB B;  4ZOH C;  4KX6 B;  1TKE A;  2EKI A;  2PIA A;  3LXF A;  1YJI A;  1PDX A;  1DOX A;  3W9C B;  1WWT A;  4YSY B;  2KMM A;  2G1E A;  5H8Y E;  1FXI A;  2M19 A;  1FXA A;  3W5V B;  2H89 B;  5AUI A;  1RM6 C;  1EWY C;  5EE0 A;  2WS3 B;  1QOB A;  1YQ4 B;  3CF4 A;  2WDQ B;  1RWS A;  1V8C A;  2AX5 A;  1WXQ A;  4WWM A;  1XLO A;  2PVO D;  1FMA D;  3AEF B;  3ETR A;  1DOY A;  1JWB D;  1L6V A;  1PFD A;  3B2F A;  3DWG C;  2BS2 B;  2H88 B;  4US8 A;  1VJK A;  3AE2 B;  1VDV A;  1NI3 A;  3AE9 B;  1TYG B;  5C2T B;  1A70 A;  2L52 A;  1H7W A;  2JX5 A;  1NVI D;  5AUK A;  5G5H A;  1ZP0 B;  3AE1 B;  3CIR B;  3P4Q B;  1KFY B;  4N58 A;  3AEE B;  4YSX B;  1V97 A;  1H7X A;  1CJE A;  2MH7 A;  1QOG A;  2BS4 B;  4US9 A;  2CJN A;  4YTP B;  2DBY A;  2Y5C A;  1NEK B;  3P1M A;  5EE9 A;  3CWI A;  1ZOY B;  1QT9 A;  3HVZ A;  3L4P A;  4WQM A;  3KWL A;  2K5P A;  1B9R A;  1OQR A;  1N5X A;  3HUI A;  5MPO A;  1CZP A;  1NYQ A;  1E9M A;  3P4S B;  1GPX A;  1FFU A;  3B9J A;  3AB5 A;  3P4R B;  1FRR A;  3LB8 C;  4HRO A;  4FXC A;  1OFF A;  1XLP A;  5G5G A;  4YTM B;  1J7B A;  1XLN A;  3AM9 A;  3NVY A;  1GAQ B;  3AMZ A;  1T3Q A;  3HRD D;  1YQ3 B;  3NS1 A;  4ITK A;  3AV8 A;  4LTU A;  1TJE A;  2PKO A;  3VRB B;  1NYR A;  1N62 A;  4C80 A;  3SFD B;  4C7Y A;  2MJE A;  1TKY A;  2WU2 B;  2W3R A;  4ZHO A;  1DGJ A;  4JWS C;  4ZHP A;  1E10 A;  2BT6 A;  3NVZ A;  3SFE B;  3RPF C;  2L83 A;  3B2G A;  1L5P A; 
#chains in the Genus database with same CATH topology
 3NZ3 A;  1GC7 A;  4YTN B;  2KJH B;  4YSZ B;  3GE3 C;  1YJ1 A;  4HPL B;  1K51 A;  2FCQ A;  1KJT A;  4MEL A;  4JWU C;  3Q3O C;  2BYE A;  1WE7 A;  2IJ0 A;  1V5O A;  3HUI A;  1JRU A;  2IGG A;  1IP9 A;  3T8M A;  3T3O A;  2NVU I;  3GE8 C;  1MHH E;  3QA8 A;  1TZO A;  2JRH A;  1UGM A;  1PUT A;  3NZS A;  2D5G A;  3L54 A;  3X0W A;  1UZX B;  1MPE A;  2BF8 B;  2ZZP B;  1S1Q B;  3K9O B;  4GLS C;  4HXD A;  1E6E B;  2BWE S;  2JQR B;  3JW0 X;  1SE4 A;  4W9E A;  4WWP A;  4K7U A;  1FFV A;  4WAA A;  1QLB B;  2LJI A;  2K3U A;  1WYW B;  2JYE A;  2MBQ A;  3PVL A;  3W9C B;  4MGZ E;  4HDO A;  4EOY A;  4BKG A;  1DYQ A;  1E7U A;  5EE0 A;  1E8Z A;  2LHD A;  1M94 A;  3RNF C;  1XLO A;  1T0Y A;  1EWC A;  5BYS A;  3ZKJ C;  1GB1 A;  3R2T A;  1QZE A;  3AE2 B;  5FKA C;  1A70 A;  2NS5 A;  1GOZ A;  3B08 A;  1NVI D;  1VCB A;  2KC2 A;  2KK8 A;  1H7X A;  2DHZ A;  3HHM A;  4JE3 B;  1V1O A;  2NTS A;  4KZ0 A;  1ZOY B;  5E6P A;  3JYU A;  3KWL A;  3A9K B;  4WUR A;  5KHO A;  2A4Z A;  4NJC A;  2N9X A;  2EEL A;  3PTF C;  2GBN A;  2MBO A;  3VH4 B;  3LB8 C;  4YTM B;  1WJN A;  3RUI B;  3NS1 A;  4PT5 A;  1T3Q A;  4FA6 A;  4PS8 A;  5D3I B;  3IFW B;  4MSM B;  3VUY A;  2GBK A;  3RCZ A;  1E5W A;  1WR6 E;  3RNG C;  1NDD A;  5EE3 A;  4AUQ C;  2JYT A;  4QAY A;  2ZJD A;  3IVF A;  2KT7 A;  2LXA A;  2JT4 B;  1XO3 A;  3UF8 A;  2L3Z A;  1V9J A;  1C78 A;  2DWQ A;  2KFJ A;  2PW9 A;  3VAW A;  1L4D B;  1QKZ A;  1KF6 B;  1Y56 A;  1EU3 A;  4FBJ B;  1JQ4 A;  3DDC B;  4USA A;  3U52 E;  3BIN A;  5AZH A;  5J2R A;  2QIE B;  2N1W A;  2MA9 B;  3ZNI D;  4OZB A;  2LHE A;  1TZ1 A;  3AI5 A;  4K7W A;  3SU8 X;  1LFD A;  2KFK A;  4FHJ A;  1XT9 B;  3BK2 A;  4IOI E;  2PE9 A;  3Q8C A;  4ANW A;  1FNV A;  1FEH A;  1E8X A;  3Q3N C;  1EO6 A;  2IY0 B;  3ENE A;  1PFD A;  1SE3 A;  1ZE3 D;  2IO0 B;  4OZC A;  2K25 A;  3TEW A;  3O13 A;  4E3C A;  3DOW A;  2CJN A;  4M00 A;  4ZYN A;  3H8H A;  4OVV A;  5LNK 1;  2Z8L A;  1ISN A;  2O6V B;  1E9M A;  4DHJ D;  3HRD D;  4LTU A;  4KVG B;  2K8H A;  3MJW A;  3UIP B;  3DPD A;  2W3R A;  3ZNH B;  1TS3 A;  5DPW A;  3NVZ A;  2KHW B;  2L8J A;  1H4R A;  3ZVV A;  2IO3 B;  4GU2 A;  4WJQ A;  2EMT A;  2MP2 B;  2ZNV B;  2I1J A;  1XEE A;  5HFY A;  3VRA B;  4KIK A;  2J4X A;  3N9Y C;  4C56 C;  3NOB A;  3FAH A;  1C4A A;  3QAR A;  1J8C A;  1GG3 A;  2W54 A;  2MJD A;  3UIO B;  3JSV A;  3UQB A;  2VZK B;  2MWS B;  1L2N A;  2XK5 A;  4F1S A;  3T3N A;  4G0N B;  5C3J B;  1SIJ A;  2KTF A;  4DQO C;  4NJ7 A;  2QSD A;  3L08 A;  3MC9 A;  4AS1 A;  4RM9 A;  2CU3 A;  2DYO A;  1E0Z A;  1ZXI A;  2J0M A;  2WQY B;  3VR8 B;  1L0X B;  2Y5B B;  3TJP A;  2INP E;  3E9S A;  5KHQ A;  3V05 A;  2VH1 A;  2KMM A;  4NJ6 A;  2C7M B;  2G1E A;  2AQ3 B;  1WXQ A;  1YN3 A;  2K1F A;  2KJR A;  1L6V A;  4XGA B;  1TYG B;  2D3B A;  2KYW A;  2ZCB A;  2D3C A;  3L10 B;  1V97 A;  1S3S G;  4YTP B;  2DBY A;  3WAP A;  3VTU A;  1L4Z B;  2Y5P A;  4IG7 B;  3TEZ A;  4ACF A;  2GLS A;  3W2D A;  1FFU A;  1KLV A;  4FXC A;  4MH8 A;  3CSF A;  3LYY A;  2ZW1 A;  4BAX A;  5JHA A;  2ZNV C;  1UD7 A;  4MH0 E;  2ONQ A;  4MAC A;  4GDL A;  2GBJ A;  3H7S A;  4A9A A;  1TTN A;  4UDU C;  1F1H A;  5HI1 A;  2NMQ A;  3IBE A;  4TKN A;  5CHV C;  1JW9 D;  3Q8F A;  1MJD A;  4LLG M;  1UF0 A;  4TQ0 A;  3ONS A;  3Q6B A;  1WRI A;  2J7Q B;  2DAF A;  2WXN A;  2K9X A;  4TSS A;  5JZE B;  4LNK A;  3RT3 B;  1RFK A;  3WA0 A;  1C76 A;  3AN1 A;  1J19 A;  5IA7 A;  1QOF A;  4MSQ B;  2M8S A;  2KOX A;  1R4N I;  4ZYS A;  4XX5 A;  2W3S A;  1ZDV A;  3AE7 B;  2ZEQ A;  3PZ8 A;  3N1Z C;  2DZI A;  3I57 A;  4REZ A;  4HRS A;  2R2O A;  3W1S A;  4ICV A;  1V80 A;  5IN7 A;  1SE9 A;  4CO7 A;  2WX0 A;  2AL6 A;  1RM6 C;  2MHJ A;  3OG5 A;  2BTE A;  2AX5 A;  4AJY B;  3L0W B;  1DOY A;  4MGI E;  1JWB D;  4II3 B;  2LVP A;  4DXF A;  1ET9 A;  3GS2 A;  1KFY B;  2E6X A;  2WX1 A;  1C79 A;  2VRR B;  2NPT B;  3VVW B;  5J17 A;  3RUL A;  4G50 A;  2L00 B;  3MJ5 A;  4RGN A;  2LGD A;  2A5U A;  2L0F A;  1T6B X;  1V2Y A;  5GMV A;  2WNM A;  4M02 A;  4GOC A;  1XCQ L;  2SAK A;  1GB4 A;  4RNA A;  4TUU A;  2JWU A;  1D5X C;  4II2 B;  4C80 A;  3DBR I;  5BMG A;  1IPG A;  3BYY B;  3Q8A A;  2MRP A;  2K22 A;  2IO1 B;  3PZ7 A;  3N3K B;  1J0G A;  2CU1 A;  1H8C A;  1ROE A;  2N9E B;  4PK1 A;  3DBS A;  3ZTC A;  1FIQ A;  3DHH C;  4K81 A;  1QF6 A;  3U30 A;  2G9H D;  5CX3 A;  2HTM E;  1R4N B;  4GDK B;  2UU7 A;  1N6Z A;  1V1P A;  3W5U B;  1T5X D;  3TSS A;  1I42 A;  2QCZ A;  4CYE A;  4HJK A;  2EMS A;  1GJZ A;  1YOV B;  3OJ4 B;  4JIO U;  4FN2 A;  1UUP A;  1TBE A;  2KZR A;  2W55 A;  2AQ2 B;  3Q3M C;  3EFC A;  1XQQ A;  4MT5 A;  2J0K A;  3LXF A;  3W5V B;  1EM7 A;  3PRM B;  4ZRJ A;  3CF6 E;  2R2Q A;  3MHS D;  2UYZ B;  5DPT A;  2KDM A;  2WXL A;  1TT5 B;  4M8N A;  5G55 A;  2MQJ A;  3E56 A;  2D2Q A;  2K6Q A;  1MFW A;  2I2Y A;  2JX5 A;  3VFK A;  3Q3J A;  3AE1 B;  1L0Y B;  2JWZ A;  4O1N A;  1FPY A;  3DBR B;  3CWI A;  3DVN V;  1OQR A;  3A1Q B;  1GPX A;  3A9J A;  2JZ3 B;  3U7D A;  4KSK C;  1AN8 A;  2L1A A;  3ECI A;  4TQ1 A;  3AM9 A;  3WIM A;  1P98 A;  2V3N A;  4MM3 A;  3VRB B;  5AZF A;  2V3S A;  2BBC A;  5IAA C;  2KQS A;  2CHX A;  2N7D A;  2KJ6 A;  1C1Y B;  4A3P A;  4RF0 A;  4M01 A;  2HD5 B;  1R7S A;  3Q3F A;  4BFR A;  2Q5W D;  2DZK A;  3GB1 A;  1JWS D;  4N59 A;  1FO4 A;  1AAR A;  3QHT A;  2LVQ A;  4MGY E;  1FXT B;  1GTH A;  4I6L B;  4IWP A;  1JWU D;  3FIL A;  5LLI A;  1HEZ E;  1TIF A;  1V5T A;  2KQ4 X;  5C23 A;  1EF5 A;  4URK A;  4K3B A;  3GOE A;  2FBW B;  3MFG A;  2LRU A;  1E7P B;  3ZRF A;  1UBI A;  1L0V B;  2WXJ A;  1IGC A;  4WQO B;  1WJU A;  1MI0 A;  4WWO A;  2M17 A;  1MG4 A;  4KX6 B;  1F77 A;  1PDX A;  1ZKH A;  3X23 A;  2CHW A;  5IO9 A;  1P1A A;  4N9F 4;  2PEA A;  2M19 A;  3U2S C;  1LGR A;  1BT0 A;  3L13 A;  4P1C C;  2YLM A;  4W9J A;  5JHB A;  1UH6 A;  5CHW A;  2D10 A;  4F7Z A;  3EA6 A;  4ZRK A;  2LUM A;  2FE8 A;  2L52 A;  3KUZ A;  5AUK A;  3GP7 A;  4BVU C;  2ZPY A;  3HK0 A;  3HIZ A;  2MH7 A;  3ZXV A;  4US9 A;  4MGK E;  1QOG A;  2GMI C;  1QT9 A;  2N7E A;  4WQM A;  2ON8 A;  3VTV A;  2K5P A;  3DBL I;  1N5X A;  1HXY D;  2KQ7 A;  2FIF A;  3HM3 A;  3KLS X;  4PS3 A;  3KWV A;  3W1Y A;  2V1Y A;  4LCD E;  3RNC C;  2DX5 B;  1E10 A;  2L83 A;  1L5P A;  1D5M C;  1KLU D;  5D2M B;  1OEY A;  4ANV A;  3P42 A;  1N61 A;  1P7E A;  3OLM D;  3MP9 A;  3QWZ B;  4NAW A;  1YJJ A;  1ZXH A;  2M56 B;  4J6I A;  1V49 A;  2QC8 A;  3BY4 B;  4HK2 A;  2XBB C;  2WYQ A;  2NCN A;  1RYJ A;  1STE A;  3TMP B;  4JGH B;  2PVG C;  3N30 A;  2K8C A;  2ACZ B;  5BMI A;  2PMV A;  1YN5 A;  4GXB A;  4HPP A;  2FAZ A;  4HPM B;  2RGF A;  3A9K A;  3DHI C;  4L1B A;  2BYV E;  2LRW A;  1VR9 A;  2OOB B;  2YEP F;  3N1Y C;  1WI0 A;  2LVO A;  3U7Z A;  3PT2 B;  5D94 A;  4DHZ E;  2KFK B;  1HE8 A;  3CF4 A;  1I4H A;  2RDH A;  4F8C B;  3DBL B;  1FMA D;  4WJO A;  1R4M I;  3ETR A;  3KYC D;  2LAS A;  1VDV A;  5BYR A;  2AWT A;  3PHW B;  2WDT B;  3ZNZ B;  2JUO A;  2Y5C A;  2NR2 A;  3P1M A;  4WJN A;  1UNS A;  2KAN A;  2FUH B;  4IM2 A;  1CZP A;  3CMM B;  2KNB A;  4HRO A;  4RMA A;  3M62 B;  3R7Q A;  1C4C A;  1XLN A;  1WMH B;  2LGX A;  4ARI A;  2MCN B;  3APD A;  3EEC A;  1N62 A;  2WXH A;  3TUO A;  2JXT A;  3VXW A;  4G3X B;  3SDL C;  4HWI B;  4BKS A;  3RMK C;  2CHZ A;  3ML9 A;  2MLB A;  4DHZ B;  3KYD D;  2BKR B;  3TCA A;  2AQ1 B;  1B1Z A;  1TY2 A;  3SR6 A;  4RH6 A;  2IND C;  2OJW A;  1JAL A;  2G3Q B;  1UBQ A;  1I7H A;  4KDL B;  4KIK B;  4FJV B;  2J53 A;  2QEJ C;  4ZDV A;  4M0W B;  1GT8 A;  1VRA B;  4W9L A;  3AE5 B;  4M8M A;  1VLB A;  4Q2J A;  2XK5 B;  1I4X A;  2MJ3 A;  1D6E C;  3WCQ A;  5L95 C;  3PZD A;  2BS3 B;  3C19 A;  3I5J C;  1R4M B;  2B3A A;  4WWN A;  1JWM D;  1TKE A;  3MC8 A;  2LZ6 A;  4BOZ B;  1ACC A;  2FCS A;  1K53 A;  1JML A;  1FXA A;  1Q10 A;  4A55 A;  4B9K A;  1YX5 B;  1WXA A;  4LNO A;  1RWS A;  2FCN A;  3B2F A;  1Y8R C;  1NI3 A;  4MDK E;  1EF1 A;  2HTH A;  2KLG A;  1YX6 B;  2MP2 A;  5AEK B;  2M0A A;  1SEB D;  1WIA A;  1E90 A;  1CK1 A;  4BBN F;  2R61 A;  2REX A;  2KWD A;  4RGO S;  4IC7 B;  2HJ1 A;  1WJ4 A;  2W82 A;  4LDT D;  2L0T A;  2HDE A;  1YD8 U;  2N1V A;  3H7P A;  2N4F A;  3AMZ A;  3VDZ A;  1HQR D;  2OJR A;  3N32 A;  1KTK A;  2PKO A;  1OTR B;  1NYR A;  1YQB A;  4HKZ E;  2D3A A;  2W9N A;  3AUL A;  4W9K A;  3S2A A;  2C9W B;  3V6E B;  3AE4 B;  2KDF B;  4GDL B;  3WAM A;  1UWM A;  2QHO A;  3N20 C;  4GMV A;  1OQY A;  1SGH A;  2DYB A;  1YIW A;  4C4V A;  1TKG A;  1N5W A;  2KAC A;  2KDI A;  4FJZ A;  1WH3 A;  3IHP C;  2V3P A;  1IUE A;  4OZA A;  2KVR A;  4A8X C;  3NRZ A;  3DBH I;  2M1M A;  1NEN B;  3EHV A;  3RZF A;  4L2Y A;  1WM3 A;  3L17 A;  2YEP B;  3ZTD A;  2KAJ A;  4N6E B;  3C8Y A;  2GOW A;  1WGY A;  3I63 C;  5E6N A;  1C77 A;  3R66 C;  1F52 A;  3U4E G;  2V9H A;  1WRD B;  4J3O D;  3RNA C;  3OAW A;  4KDI C;  2KTR A;  1WM2 A;  1T0S C;  3VQI A;  2RPV A;  4DK5 A;  1V8C A;  4NQK E;  5G2N A;  2FID A;  2KN5 A;  2RD0 A;  1VJK A;  4DWF A;  1ZP0 B;  2Y3A A;  3NG0 A;  4S17 A;  1G6J A;  1K52 A;  5MPO A;  4JPS A;  3I9V 1;  4A20 A;  1FRR A;  4IWO A;  2BWF A;  1J7B A;  1PGB A;  3IG3 A;  4XE0 A;  4DBG A;  1IBX A;  2MJE A;  3RFZ B;  4RGT A;  1K50 A;  1XD3 B;  4CQN A;  3BVG A;  1NI2 A;  2WXI A;  1RRB A;  2JY6 A;  2C7H A;  4XYC A;  2NBV B;  4KGT A;  3QC8 B;  3DBH B;  1JRO A;  4W9H A;  2BPS A;  4BOS C;  5TR5 A;  3IAS 1;  1FM0 D;  3PLU A;  3P2B A;  3H9D A;  3AH7 A;  1WGD A;  2TSS A;  4KKI A;  5EDS A;  1D5Z C;  1RLF A;  4JLC A;  2M0X A;  2LI5 A;  2KN4 A;  4GB9 A;  4EZL A;  1HZ6 A;  2IGD A;  5FR6 A;  1LQB A;  4DHJ B;  4W9I A;  3NZU A;  1HZ5 A;  2IBI B;  4ZRP A;  1PYW D;  1JRP A;  3ZDT A;  2B76 B;  2WWZ A;  5CHF A;  3GZN I;  1HA5 A;  4RFB A;  3W1S C;  2NPT A;  4OVU A;  1F9J A;  5D6J B;  1ZGU B;  2EKI A;  3K9P B;  5DCN A;  3R3M A;  4YWG G;  1WWT A;  2Z59 B;  1WZ3 A;  4MJS B;  3IT4 B;  1TY0 A;  4TMA B;  2QDF A;  1YQ4 B;  3C0R B;  1I4R A;  4I6N B;  1SJH D;  2GBM A;  4HCP B;  1GC6 A;  3R7R A;  2RPQ A;  2BQQ A;  2BS2 B;  5E6J A;  3HVD A;  4LNN A;  3ZUN A;  2DAJ A;  4EZJ A;  2G4D B;  4AQ7 A;  2DNF A;  4E74 A;  4JL9 A;  3EFU A;  3IAM 1;  3L4P A;  1YNT E;  4W9G A;  3RN9 C;  4OW0 A;  4TV3 A;  1P9D U;  3A33 B;  3DVG Y;  3PRZ A;  3TEY A;  2IYD B;  2J52 A;  4BKS D;  2ASQ A;  2ZVO A;  3PRP B;  1UWX A;  3A9J B;  3VHT C;  1FNW A;  2PLP A;  3WAO A;  1EUV B;  4MM3 B;  4FHK A;  2O2V A;  2KD0 A;  3NVW A;  4XWW A;  2QMT A;  3V6C B;  2KXJ A;  2WXR A;  3PS6 A;  1IYF A;  2WXQ A;  1PGA A;  2K6D B;  1OQQ A;  1RAX A;  1SJE D;  1WZ0 A;  1QQR A;  4HCN B;  1QOA A;  3ZYY X;  2JXX A;  4FAD A;  1F2R C;  2N9L A;  2G4S A;  3EUB 2;  1N63 A;  2WXP A;  3FC4 A;  2LGY A;  4GGQ A;  1V6E A;  3GZN B;  4X57 B;  2NBU A;  1J7A A;  1WGK A;  3MC0 B;  3Q14 C;  2PPH A;  4W9C A;  1FRD A;  2KC1 A;  4RM8 A;  2LEK A;  3SD5 A;  1Z5S B;  3IXS A;  4NAM A;  1TGZ B;  2INN E;  3ZIM A;  4PYU A;  2DZM A;  3PV1 A;  1C4P A;  5D3D A;  1ZPS A;  4HKQ A;  2HE7 A;  4HDQ A;  1GNU A;  1KM7 A;  2V4I B;  1C3T A;  2QJL A;  3A1Q A;  4EE2 A;  2MW5 A;  2CKH B;  1DOX A;  2BYT A;  4BBN C;  3RZW C;  1ZW7 A;  4XZ4 A;  3PLV A;  3LDZ E;  1QOB A;  1TS2 A;  4OVZ A;  2DEN B;  2ZW0 A;  1GUA B;  3OJ3 A;  3BYT B;  3IT6 B;  2JU6 X;  5IOI A;  1I4P A;  3ZO5 B;  3AE9 B;  4EEW A;  1H7W A;  4YSX B;  1CJE A;  4NZL B;  4WH4 A;  4KZC A;  4DXG A;  5EE9 A;  4HVB A;  3BVM A;  2VZK D;  3P4R B;  4ASW C;  2JZZ A;  4KGR A;  4D2K A;  1LXD A;  1X1M A;  2D11 A;  2RR9 A;  1Q0W B;  2JRI B;  1BXT A;  3T9L A;  2DZJ A;  2WHI A;  4A6Q A;  3Q2A C;  4ZRQ A;  4ICU A;  4AWJ A;  3VH3 B;  1IGD A;  3SFE B;  3RPF C;  4YT0 B;  4H2A A;  3AEG B;  2L32 A;  2PJH A;  4WAF A;  3FKY A;  2WLB A;  1TS5 A;  3QCA A;  3ZJT A;  3BII D;  3B0A A;  3B1L X;  4EKU A;  3PPA A;  2CJO A;  3QQ8 B;  2JF5 A;  4FUL A;  4NAW B;  1WGG A;  3KUC B;  3QK0 A;  4A3O A;  2KLC A;  3NHE B;  4YL8 A;  4DDG D;  1SSN A;  1LO5 D;  4K1R B;  3RD2 A;  1DOI A;  2IGH A;  3KH0 A;  1NBF C;  3KUD B;  4P6V F;  2G45 B;  2WU5 B;  2RSU A;  4B0M A;  1KOT A;  2HJ8 A;  2I38 A;  2KDE B;  1YN4 A;  1MVK A;  1FXI A;  2H89 B;  5AUI A;  5LXH A;  4R3D A;  1WXM A;  2MBH A;  3V3X A;  3BK1 A;  4NQL B;  2ICI A;  1SIF A;  4US8 A;  2IO2 B;  4IUM B;  2LD9 A;  5G5H A;  2L05 A;  2XN9 C;  1BML C;  4FJY A;  4S0R A;  3RNB C;  2DYM A;  3N1X C;  4IM3 A;  4LK0 M;  3RNE C;  3TBL D;  1WGH A;  5BMH A;  1NYQ A;  3HM6 X;  1OFF A;  1XLP A;  1P0R A;  3ZLZ A;  4P1B C;  2K0P A;  1TKY A;  4K3C A;  3ML8 A;  5BYQ A;  3B2G A;  5BO4 B;  2KWV B;  4JX1 C;  3EC8 A;  4HLE A;  1ZDX A;  1RFA A;  3NJT A;  3QAQ A;  3OWE B;  4P7I A;  3V60 A;  5IP4 D;  1E7V A;  2LXC A;  1WJ6 A;  3UI3 A;  2M4N A;  4XC2 A;  3AE6 B;  3VR9 B;  1D4B A;  2UWQ A;  2GRI A;  4XWT A;  1SF0 A;  3AE3 B;  2OHF A;  2V0G A;  2GB1 A;  2BVC A;  1WYG A;  4C7Z A;  2KDB A;  2KX3 A;  3UIN B;  1N60 A;  3ZJV A;  4YXD B;  1AWD A;  1QIL A;  3AEC B;  1T0R C;  1PQS A;  2CS4 A;  4B95 A;  3ZW3 A;  2IZV B;  3KW5 B;  2MX2 A;  2SEB D;  1V81 A;  1D3Z A;  3P4P B;  2ZCC A;  1GTE A;  2AYO B;  2WDV B;  4A90 A;  1F0Z A;  2J42 A;  1FCL A;  3I3T B;  3ALB A;  5DPR A;  3M63 B;  4AOF A;  2K39 A;  2D07 B;  2MBB B;  1FD6 A;  4NPN A;  4BKT A;  4HEA 1;  4YSY B;  1WMH A;  4B6W A;  4KV2 A;  4MEM A;  5JH5 C;  3SHQ A;  4W9F A;  3ZRC A;  3JSV B;  1WX8 A;  1ET6 A;  4NY0 A;  4DXA B;  3APC A;  3TIX A;  1P7F A;  1AW7 A;  1SXT A;  5C2T B;  4NNJ B;  5L83 A;  2JPH A;  2KKC A;  3CIR B;  2O6V A;  1WGR A;  3ZQ4 A;  3DHG C;  1C9F A;  3ZGZ A;  3HVZ A;  5D7G A;  2XNA C;  3VTW A;  4C00 A;  1ENF A;  1U4A A;  3AB5 A;  2GBR A;  3URY A;  2LFI A;  5CTR C;  1GAQ B;  4W9D A;  1VZ6 A;  3H7P B;  2AEH A;  4M0W A;  1OGW A;  4ZHO A;  4ZHP A;  2BT6 A;  3APF A;  1XLQ A;  4GIV A;  1CQV A;  4EUT A;  3AE8 B;  1Z2M A;  1XXG A;  3ZXR A;  3DWM A;  1L6U A;  1V86 A;  3AEB B;  3PSE B;  1VZ8 A;  1M4V A;  5AZG A;  3AU4 A;  3J9C A;  5H92 C;  4C4V B;  3AXC A;  3NUH B;  3R8B A;  3MTN B;  1XCT L;  2DLB A;  2N0S B;  4LNF A;  3ZDM C;  4BZA A;  1WX9 A;  3BZD B;  5FK9 C;  3L16 A;  3UQA A;  2E3T A;  2KO3 A;  2KWC A;  2AL3 A;  2INC C;  4K7S A;  1WSP A;  3WAN A;  2N9K A;  2PIA A;  2FUG 1;  3RI7 C;  3QX1 A;  1WF9 A;  3KQ4 A;  1EWY C;  4PYZ A;  2CR5 A;  4AJW A;  2BW2 A;  4ARC A;  2KTR B;  3MHZ A;  3DWG C;  5HKH A;  2LWP A;  2JVC A;  2WXM A;  5I4D A;  2GI9 A;  3P4Q B;  1SBB B;  3AEE B;  4N58 A;  4LJP B;  2BS4 B;  1F2R I;  2K8B A;  2WXK A;  5HHD G;  3B9J A;  2KMA A;  4CHK A;  3Q8B A;  3M95 A;  4WIP A;  1FCC C;  1HTQ A;  2OED A;  2KWU B;  3SFD B;  3PGE A;  3A4R A;  4IDI A;  1I4G A;  1ZUD 2;  1IBX B;  2RMM A;  1KRH A;  4PS7 A;  1AYF A;  3ZNG C;  1E8Y A;  2VH2 A;  2LMC A;  1MHX A;  1ESF A;  3AED B;  2BB5 A;  2LUE A;  2C7N B;  3KVF B;  5DPS A;  4HJG E;  5IKC M;  4XDC A;  1MG8 A;  3RYT A;  3NY5 A;  1UGJ A;  5HG2 A;  2RDB C;  1TS4 A;  3P63 A;  3VUW A;  2JSV X;  4RF1 A;  5JXV A;  1EU4 A;  3DQV A;  1XF5 L;  5GXG B;  4XDD A;  4E71 A;  1PGX A;  2N7J A;  4GN1 A;  2WDR B;  4KSL C;  3H1U A;  3TL5 A;  1KLG D;  4GSW A;  1JWA D;  1JCK B;  4IW0 A;  5T8I A;  1WE6 A;  1J7C A;  2KX0 A;  2IPK D;  2QIL A;  2L7R A;  4IKG A;  1YJI A;  3DCG A;  4EZK A;  3WAL A;  4I6P A;  2WDQ B;  1V1P B;  1K8R B;  2Z0D B;  2I1K A;  4RGM A;  2PVO D;  3R2I A;  4LNI A;  2X8X X;  5LXI B;  2LJ5 A;  3DVG X;  5C1Z A;  3V62 A;  3QJZ A;  1CMX B;  2EKE C;  2C5L C;  4P16 A;  2BGF A;  1T0Q C;  2V4L A;  3AU5 A;  2XEW A;  1WX7 A;  1WR1 A;  4IM0 A;  4RCO A;  2D3G A;  3JVZ X;  5G5G A;  2WXO A;  1YQ3 B;  3D32 A;  3QIJ A;  4IWQ A;  3LJ3 A;  4OHJ A;  2WU2 B;  2MEK A;  4JWS C;  1E8W A;  2WXF A;  1VZ7 A;  2IY1 B;  2IDY A;  5EE1 A;  2ZPN A;  1Q5W B;  2WGS A;  3O65 B;  3PRE A;  2O2V B;  1I4Q A;  2BYF A;  1SE2 A;  1KH0 A;  3NVV A;  4GDK A;  1UEL A;  4ZRI A;  3ABV B;  2X38 A;  1LM8 B;  2Z0E B;  4MJS A;  2N9P C;  1HTO A;  1I35 A;  2PE6 B;  4LDT B;  3PO0 A;  3BVZ A;  5J18 A;  3Q8E A;  2LGS A;  1L7Y A;  2WP9 B;  3UGB B;  3ZJU A;  1SB3 C;  1OEY J;  4KKJ A;  2FNJ B;  4ANU A;  3AEA B;  4ANX A;  2PTL A;  3EGR A;  2ZVN A;  4G11 A;  1BUI C;  5FR3 A;  5TSS A;  2MBE A;  3DVN U;  1P3Q U;  4ZOH C;  2C60 A;  2BB6 A;  2NTT A;  1A5R A;  2LGI A;  5H8Y E;  3SEB A;  5E6O A;  3CST A;  3FIL B;  1WXS A;  4JQW C;  2WS3 B;  4WJP A;  3A4S C;  4WWM A;  2YVC A;  3AEF B;  2O6V D;  1Q1O A;  3BWU D;  2H88 B;  1WFY A;  3H6N A;  4B0E A;  4DDI D;  2BKF A;  4FLH A;  1WY8 A;  2RDG A;  3VUX A;  2FCM A;  3Q69 A;  1NEK B;  3V61 A;  4KGS A;  4AP4 C;  3NS8 A;  2WXG A;  1B9R A;  2L76 A;  1WXV A;  1YMH E;  2J0J A;  2MSE D;  3P4S B;  3M3J A;  1FNU A;  1VD2 A;  4LJO B;  3NVY A;  2NBW B;  3TEX A;  4ITK A;  3PHX B;  3AV8 A;  1TJE A;  2JZP A;  4C7Y A;  3U8Z A;  4L23 A;  2KMC A;  1DGJ A;  2KVZ A;  4EFO A; 
#chains in the Genus database with same CATH homology
 3NZ3 A;  3Q8A A;  2K22 A;  3PZ7 A;  4YTN B;  4JX1 C;  3AE4 B;  4GDL B;  4YSZ B;  1UWM A;  1ZDX A;  1K51 A;  3OWE B;  1ROE A;  3UI3 A;  1FIQ A;  3AE6 B;  3VR9 B;  1QF6 A;  1D4B A;  4JWU C;  2G9H D;  2GRI A;  1TKG A;  4XWT A;  2IJ0 A;  1SF0 A;  1N5W A;  3HUI A;  2KAC A;  3AE3 B;  2OHF A;  2HTM E;  2IGG A;  2GB1 A;  2V0G A;  1WYG A;  4GDK B;  2V3P A;  4C7Z A;  1IUE A;  4OZA A;  3ZJV A;  1N60 A;  3T3O A;  4YXD B;  1V1P A;  3W5U B;  4A8X C;  3NRZ A;  1T5X D;  1AWD A;  3TSS A;  1QIL A;  1MHH E;  1TZO A;  3AEC B;  1NEN B;  1PUT A;  2SEB D;  2D5G A;  1MPE A;  3P4P B;  1GTE A;  1UUP A;  4L2Y A;  2WDV B;  4A90 A;  2YEP B;  1F0Z A;  4GLS C;  2J42 A;  1FCL A;  2KAJ A;  1E6E B;  4N6E B;  2JQR B;  1SE4 A;  2W55 A;  3C8Y A;  2AQ2 B;  1C77 A;  1FFV A;  1QLB B;  2LJI A;  2K3U A;  4MT5 A;  3U4E G;  2JYE A;  3LXF A;  1FD6 A;  3W9C B;  4HEA 1;  4YSY B;  4J3O D;  3W5V B;  1DYQ A;  5EE0 A;  1EM7 A;  3VQI A;  2LHD A;  2RPV A;  1ET6 A;  1V8C A;  1XLO A;  2KDM A;  1EWC A;  5BYS A;  1GB1 A;  2WXL A;  3R2T A;  1VJK A;  3AE2 B;  1P7F A;  5FKA C;  3E56 A;  1AW7 A;  1SXT A;  5C2T B;  1A70 A;  1GOZ A;  2I2Y A;  2JX5 A;  1NVI D;  1ZP0 B;  3AE1 B;  3CIR B;  2Y3A A;  1H7X A;  1L0Y B;  3ZQ4 A;  1C9F A;  4JE3 B;  1V1O A;  4O1N A;  3ZGZ A;  2NTS A;  3CWI A;  1ZOY B;  3HVZ A;  3KWL A;  4WUR A;  1OQR A;  5D7G A;  1K52 A;  5MPO A;  2XNA C;  4NJC A;  4JPS A;  2EEL A;  1GPX A;  1ENF A;  3I9V 1;  3AB5 A;  1FRR A;  3LB8 C;  3URY A;  2LFI A;  4YTM B;  1AN8 A;  2L1A A;  1J7B A;  4TQ1 A;  3AM9 A;  1GAQ B;  3NS1 A;  1T3Q A;  4PT5 A;  2V3N A;  5D3I B;  1PGB A;  1VZ6 A;  3VRB B;  4M0W A;  4XE0 A;  1IBX A;  2MJE A;  2BBC A;  3RFZ B;  4ZHO A;  4RGT A;  4ZHP A;  1K50 A;  2BT6 A;  4RF0 A;  1R7S A;  1XLQ A;  4CQN A;  1CQV A;  2Q5W D;  2WXI A;  3BVG A;  3GB1 A;  3AE8 B;  5EE3 A;  1JWS D;  4KGT A;  4N59 A;  1XXG A;  1JRO A;  3DWM A;  1L6U A;  2JYT A;  1FO4 A;  3IAS 1;  1FM0 D;  3AEB B;  3AH7 A;  1VZ8 A;  1M4V A;  1XO3 A;  2TSS A;  3J9C A;  5H92 C;  4KKI A;  1GTH A;  1D5Z C;  3NUH B;  3R8B A;  1JWU D;  3FIL A;  1HEZ E;  1C78 A;  2DWQ A;  2KN4 A;  1XCT L;  1HZ6 A;  2IGD A;  2DLB A;  2N0S B;  2PW9 A;  2KQ4 X;  1L4D B;  1QKZ A;  1KF6 B;  1Y56 A;  1HZ5 A;  1EU3 A;  3BZD B;  4ZRP A;  5FK9 C;  1PYW D;  2FBW B;  1JQ4 A;  2E3T A;  1JRP A;  4USA A;  3MFG A;  3U52 E;  2B76 B;  1E7P B;  4RFB A;  1HA5 A;  2QIE B;  1L0V B;  1WSP A;  2WXJ A;  1IGC A;  4OZB A;  2LHE A;  1MI0 A;  2N9K A;  3BK2 A;  4KX6 B;  2EKI A;  2PIA A;  1F77 A;  1PDX A;  4IOI E;  2FUG 1;  4YWG G;  1WWT A;  3Q8C A;  2M19 A;  3IT4 B;  1FNV A;  1TY0 A;  1EWY C;  3KQ4 A;  4TMA B;  1FEH A;  3U2S C;  1YQ4 B;  1I4R A;  1SJH D;  2BW2 A;  4ARC A;  1PFD A;  1SE3 A;  1ZE3 D;  2BS2 B;  3DWG C;  3MHZ A;  5E6J A;  3EA6 A;  2LUM A;  2WXM A;  3HVD A;  2FE8 A;  2L52 A;  4OZC A;  3GP7 A;  5AUK A;  5I4D A;  2GI9 A;  3P4Q B;  3TEW A;  1SBB B;  3AEE B;  2MH7 A;  3O13 A;  4N58 A;  4US9 A;  4AQ7 A;  1QOG A;  2BS4 B;  1F2R I;  2CJN A;  3H8H A;  5LNK 1;  3IAM 1;  1QT9 A;  2Z8L A;  3L4P A;  2ON8 A;  2WXK A;  1YNT E;  2K5P A;  4WQM A;  1N5X A;  1HXY D;  3KLS X;  4OW0 A;  3KWV A;  1E9M A;  5HHD G;  3B9J A;  3TEY A;  3Q8B A;  4WIP A;  2J52 A;  3HRD D;  4LTU A;  1UWX A;  1FCC C;  1FNW A;  2OED A;  2PLP A;  3SFD B;  2W3R A;  1TS3 A;  1E10 A;  3NVZ A;  4MM3 B;  2L83 A;  4IDI A;  1L5P A;  1I4G A;  1ZUD 2;  3NVW A;  1D5M C;  1KLU D;  1IBX B;  2RMM A;  4XWW A;  1KRH A;  1AYF A;  2QMT A;  2WXR A;  1XEE A;  3P42 A;  5HFY A;  2WXQ A;  1N61 A;  1P7E A;  1PGA A;  1OQQ A;  2LMC A;  1SJE D;  1MHX A;  1QQR A;  3MP9 A;  1ESF A;  3VRA B;  3AED B;  2BB5 A;  1QOA A;  3ZYY X;  2J4X A;  4HJG E;  1YJJ A;  3N9Y C;  1F2R C;  1ZXH A;  2M56 B;  2N9L A;  4XDC A;  3EUB 2;  4C56 C;  1N63 A;  2WXP A;  3FC4 A;  3FAH A;  1C4A A;  1UGJ A;  5HG2 A;  1TS4 A;  1J7A A;  1WGK A;  2JSV X;  3P63 A;  2W54 A;  4RF1 A;  5JXV A;  2MJD A;  1RYJ A;  3MC0 B;  1STE A;  1EU4 A;  2VZK B;  1FRD A;  1XF5 L;  5GXG B;  4XDD A;  2LEK A;  2PVG C;  2ACZ B;  1PGX A;  2N7J A;  3T3N A;  3IXS A;  4NAM A;  2INN E;  5BMI A;  2WDR B;  2PMV A;  5C3J B;  1SIJ A;  4DQO C;  1C4P A;  1YN5 A;  2QSD A;  5D3D A;  1ZPS A;  1KLG D;  1JWA D;  4AS1 A;  1JCK B;  5T8I A;  2CU3 A;  2DYO A;  1E0Z A;  1ZXI A;  4HKQ A;  2V4I B;  2WQY B;  3VR8 B;  1J7C A;  1L0X B;  2QJL A;  4L1B A;  2IPK D;  2QIL A;  1VR9 A;  4EE2 A;  2YEP F;  2INP E;  3E9S A;  4IKG A;  1YJI A;  3V05 A;  1DOX A;  2BYT A;  3U7Z A;  2KMM A;  2G1E A;  1QOB A;  1TS2 A;  2AQ3 B;  4OVZ A;  3CF4 A;  2WDQ B;  1I4H A;  1V1P B;  2RDH A;  2ZW0 A;  1WXQ A;  4RGM A;  1YN3 A;  1FMA D;  2PVO D;  3R2I A;  3ETR A;  3BYT B;  1L6V A;  3IT6 B;  2JU6 X;  1I4P A;  1VDV A;  3AE9 B;  1TYG B;  5BYR A;  1H7W A;  4P16 A;  4YSX B;  1V97 A;  1CJE A;  4NZL B;  4WH4 A;  4YTP B;  2DBY A;  2Y5C A;  4DXG A;  1L4Z B;  3P1M A;  5EE9 A;  2Y5P A;  3TEZ A;  1UNS A;  1CZP A;  3BVM A;  2VZK D;  3W2D A;  1FFU A;  3P4R B;  4HRO A;  4RCO A;  4FXC A;  4MH8 A;  5G5G A;  4KGR A;  4D2K A;  1C4C A;  1XLN A;  2WXO A;  3LYY A;  4ARI A;  2ZW1 A;  1YQ3 B;  1N62 A;  2WXH A;  2ONQ A;  3TUO A;  1BXT A;  2JXT A;  4MAC A;  4OHJ A;  4A6Q A;  2WU2 B;  4ZRQ A;  2MEK A;  4JWS C;  2WXF A;  1VZ7 A;  1IGD A;  3SFE B;  3RPF C;  4A9A A;  2IDY A;  4YT0 B;  5EE1 A;  4UDU C;  4H2A A;  3AEG B;  2L32 A;  5HI1 A;  2NMQ A;  4WAF A;  2AQ1 B;  2WLB A;  1B1Z A;  1JW9 D;  1TY2 A;  3SR6 A;  3Q8F A;  1TS5 A;  4RH6 A;  3ZJT A;  1I4Q A;  3BII D;  4LLG M;  1SE2 A;  1JAL A;  1KH0 A;  3NVV A;  1I7H A;  3ABV B;  2X38 A;  2CJO A;  4TQ0 A;  1WRI A;  2WXN A;  4NAW B;  2K9X A;  4TSS A;  3PO0 A;  2J53 A;  2QEJ C;  3BVZ A;  3Q8E A;  1VRA B;  1GT8 A;  1RFK A;  1C76 A;  3AN1 A;  3AE5 B;  1SSN A;  1QOF A;  2WP9 B;  1VLB A;  1LO5 D;  3ZJU A;  1SB3 C;  4KKJ A;  4ZYS A;  2W3S A;  3AEA B;  1ZDV A;  4Q2J A;  3AE7 B;  1I4X A;  1DOI A;  2MJ3 A;  2PTL A;  3EGR A;  1D6E C;  3PZ8 A;  3I57 A;  1BUI C;  3WCQ A;  4REZ A;  2IGH A;  5FR3 A;  4HRS A;  5TSS A;  4P6V F;  2BS3 B;  3W1S A;  2WU5 B;  4ZOH C;  4B0M A;  1JWM D;  1TKE A;  2BB6 A;  2NTT A;  2I38 A;  1ACC A;  1YN4 A;  1K53 A;  1MVK A;  2LGI A;  1FXI A;  5H8Y E;  1JML A;  1FXA A;  3SEB A;  1Q10 A;  2H89 B;  5AUI A;  1RM6 C;  4A55 A;  3FIL B;  4R3D A;  3V3X A;  2WS3 B;  2BTE A;  1RWS A;  2AX5 A;  3BK1 A;  4WWM A;  3AEF B;  2ICI A;  1DOY A;  1JWB D;  3B2F A;  3BWU D;  2H88 B;  4US8 A;  1NI3 A;  4DXF A;  1ET9 A;  3GS2 A;  4B0E A;  5G5H A;  2RDG A;  1KFY B;  2E6X A;  2M0A A;  1SEB D;  1C79 A;  2XN9 C;  3Q69 A;  1BML C;  1CK1 A;  1NEK B;  2R61 A;  2KWD A;  4KGS A;  2DYM A;  4RGO S;  2WXG A;  2W82 A;  4LK0 M;  1B9R A;  3MJ5 A;  4RGN A;  1YMH E;  2HDE A;  5BMH A;  1NYQ A;  3P4S B;  1T6B X;  1FNU A;  1OFF A;  1XLP A;  2WNM A;  1XCQ L;  2SAK A;  1GB4 A;  3NVY A;  3AMZ A;  4ITK A;  3TEX A;  1HQR D;  4RNA A;  3AV8 A;  1TJE A;  1KTK A;  2PKO A;  2K0P A;  2JWU A;  1D5X C;  1NYR A;  2JZP A;  4C80 A;  4HKZ E;  4C7Y A;  5BMG A;  4L23 A;  1TKY A;  3BYY B;  1DGJ A;  5BYQ A;  3B2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...