2WS3B

Crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd tyr83phe mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Succinate Dehydrogenase Activity
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
total genus 65
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2ws3B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ws3B01
1YQ3B 3AM9A 1AYFA 1FFVA 3P4QB 1RM6C 2ACZB 1V97A 2PIAA 1N60A 4ZHPA 3VR8B 1YQ4B 2LEKA 2W3SA 3AB5A 3AH7A 3AE2B 4KX6B 3KWLA 1GTEA 1KF6B 1FIQA 1JW9D 1WXQA 2MJ3A 3NVZA 4FXCA 2WS3B 1DOYA 3AN1A 1IUEA 1L0VB 3SFEB 1GAQB 2HTME 1XLPA 2MJDA 3AECB 1NEKB 1FRDA 1RWSA 1TKEA 5C3JB 1VJKA 1PUTA 3FC4A 1VLBA 4N6EB 2K5PA 1QOGA 4C7ZA 4HROA 2KMMA 2BS3B 1QF6A 1KFYB 4HRSA 4A9AA 3VRBB 4YSYB 3W5UB 4ITKA 1NYRA 2WDVB 1PDXA 1NENB 3L4PA 1XLQA 2CJOA 1OQQA 3ZYYX 1R7SA 5AUIA 1FO4A 1YJJA 1J7CA 3NVVA 1E6EB 2WDQB 1WWTA 3NS1A 3P4PB 4WQMA 2CU3A 1YJIA 1FMAD 1E10A 2H88B 4N59A 3WCQA 3HUIA 1E9MA 2KAJA 3LXFA 3NVYA 5GXGB 4LTUA 3AE1B 4YT0B 1QOAA 1E7PB 1TJEA 1GT8A 2W3RA 1RYJA 2Q5WD 4JWUC 3CF4A 3PO0A 1RFKA 4IDIA 1NYQA 4ZOHC 1VDVA 1XO3A 1SF0A 1ZP0B 1JWAD 3AEAB 2E3TA 5C2TB 2M56B 4JX1C 3AE9B 2DWQA 4ZHOA 2W54A 4YXDB 5EE0A 3AE8B 1L6VA 3EUB2 3SR6A 2M19A 1OQRA 5EE9A 2H89B 2EKIA 1GTHA 5AUKA 5H8YE 3RPFC 1FXIA 2K22A 2PVOD 2Y5CA 4WWMA 2CJNA 2DBYA 1N5WA 3NVWA 1H7WA 1JROA 5G5HA 4JWSC 4YTNB 3LB8C 1B9RA 1JQ4A 2WU5B 1TYGB 3DWGC 3AEGB 1FFUA 5EE1A 1OFFA 4YTPB 1E0ZA 1TKYA 1GPXA 2BS4B 1J7AA 1QLBB 2FBWB 1NI3A 4US8A 2AX5A 3DWMA 3VR9B 1WRIA 1H7XA 3ABVB 1N61A 1V8CA 1PFDA 3HRDD 3FAHA 1KRHA 3HVZA 5EE3A 3AEEB 1ZOYB 4YSXB 1DOXA 1SIJA 2MJEA 1JRPA 1ROEA 1N62A 2PKOA 3SFDB 1FXAA 2N0SB 3P4RB 1UWMA 1QT9A 4YSZB 2WQYB 3AE6B 1ZUD2 2JX5A 2QJLA 3B2FA 3P63A 5G5GA 3W9CB 1WGKA 1JALA 1NVID 3AE5B 4C7YA 1L5PA 2JQRB 5H92C 5MPOA 2WDRB 2WP9B 1QOFA 1XLNA 2MH7A 1F0ZA 2WU2B 1AWDA 3ETRA 3P1MA 4P6VF 2BT6A 1N63A 3AEBB 3AE3B 3CIRB 3NRZA 3AEFB 1CZPA 2K9XA 1T3QA 2W55A 2BS2B 3CWIA 4C80A 1DOIA 1FM0D 3W5VB 1JWBD 1J7BA 2L83A 4N58A 2QIEB 1N5XA 1EWYC 1FRRA 2OHFA 3VRAB 2L52A 3B9JA 1A70A 2WLBA 3P4SB 4US9A 1XLOA 1L6UA 3AV8A 2G1EA 4USAA 1TKGA 1CJEA 3AE4B 2PVGC 2B76B 3AEDB 4YTMB 1DGJA 3BIID 1I7HA 1QOBA 3AE7B 1ZXIA 1WYGA 1SB3C 3B2GA 3AMZA
chains in the Genus database with same CATH superfamily
1XCQL 3M95A 4AUQC 2D5GA 2DENB 2WX1A 2VZKB 2GBMA 1YX6B 4II2B 3KUCB 5DPRA 1MI0A 4C7ZA 1VJKA 5T8IA 1ZDXA 1JMLA 3ZUNA 1FEHA 1WE6A 1PDXA 3IVFA 1WM3A 3MFGA 1R7SA 3PLUA 3A1QA 1IBXB 3NS1A 3L54A 3ZTDA 1E10A 2NCNA 1PGBA 1EF5A 1E90A 2GBJA 2GBKA 3R3MA 1KLVA 2D3AA 1NYQA 4TMAB 2O2VA 1ZP0B 2ZW1A 2WXFA 1UF0A 4ZHOA 3SEBA 3MTNB 4IM2A 2Y5CA 2DZMA 1N5WA 2OJWA 1AN8A 3UINB 4LJOB 1WMHA 3ZVVA 1GG3A 2MW5A 3A1QB 2ON8A 2LVQA 4LNOA 4W9CA 5CX3A 3VR9B 3VHTC 5G55A 3OJ4B 3AEEB 1WE7A 2NTSA 3TBLD 1DOXA 2ZVNA 3DQVA 3DBHB 2PE6B 4EZKA 1KJTA 1QQRA 3EGRA 4XZ4A 2WDRB 3C8YA 3ETRA 3P1MA 2V4LA 4HK2A 1HZ6A 2MBHA 1GC7A 3W5VB 2PPHA 1J7BA 1ET6A 2MX2A 1YOVB 4AQ7A 4US9A 4USAA 1XXGA 4NJ7A 2KJRA 2JT4B 1KLGD 4ZRQA 3JSVB 5E6PA 2M1MA 2KDBA 1K8RB 2XEWA 4II3B 1D5MC 3FC4A 3AECB 4WJNA 2BYTA 1AW7A 2WXLA 1R4NB 4HRSA 2WDVB 2CJOA 3DVNV 2LRUA 3NVVA 1WWTA 4W9IA 4ARCA 1S1QB 4EEWA 4L23A 3AE1B 1JRUA 1E7PB 3A9JB 3J9CA 3PO0A 2QHOA 4BKSA 2N9KA 2OEDA 5C2TB 3UIPB 5J18A 2KFJA 3PT2B 4AS1A 4JE3B 1WF9A 3JYUA 3RI7C 1I4QA 3GP7A 4AP4C 2DYMA 3BK2A 4HVBA 3W1YA 3RZFA 3RUIB 4ZYSA 2MJEA 2CS4A 4L1BA 2INNE 2G4DB 2RDHA 3EA6A 3QAQA 1Q1OA 3N30A 2WP9B 3DDCB 2JXXA 5JZEB 2WU2B 4P6VF 3ZXVA 3RNCC 1M94A 3BYYB 4RH6A 2KMAA 1DOIA 2LGIA 2OJRA 3M63B 4NJ6A 4ZRJA 4CYEA 2KDFB 4EOYA 4W9HA 5E6JA 2OHFA 3IT6B 4C80A 2IPKD 2PVGC 3AEDB 1QOBA 5TSSA 1L4ZB 4E74A 4LCDE 2K8BA 3RN9C 3AM9A 2MA9B 3RNAC 1YQ4B 3AULA 1T5XD 2FCSA 2V1YA 2RGFA 2BW2A 4LJPB 3A4SC 2N1VA 4WAFA 2DAFA 4ASWC 2KO3A 1EU4A 4GU2A 5G2NA 4C4VA 2AQ3B 3DCGA 3MC0B 4M02A 2PW9A 4KZCA 1FO4A 2LWPA 1IGCA 1V1PB 2RDBC 4F7ZA 2GOWA 4K3CA 3MJ5A 4JLCA 3R2IA 2LXAA 5GXGB 4N9F4 1D6EC 1QOAA 2WHIA 2W82A 1RYJA 3P2BA 2KYWA 1QKZA 1FNWA 4LLGM 1G6JA 2JXTA 1I42A 1T0RC 2LASA 1L6VA 2KXJA 1P0RA 3Q69A 2K22A 3PLVA 4JWSC 4WAAA 4PT5A 4FJZA 1I4XA 4CHKA 2I2YA 3AEGB 5EE1A 1OFFA 3RFZB 2C7HA 4GDKB 5AZGA 2SAKA 3OWEB 5CHFA 3U2SC 4IM3A 3O65B 2R2QA 3R2TA 2G9HD 3SHQA 1ENFA 4K7UA 4HPLB 1L5PA 1V80A 3L0WB 3RCZA 3CF6E 2N4FA 3TCAA 1VR9A 1CQVA 1RFAA 1F0ZA 1K50A 3K9OB 1TS5A 3NRZA 4A20A 1CZPA 3CWIA 4RM9A 4A90A 4ANXA 4WWOA 1UZXB 1MJDA 4PS8A 3DBRI 3T9LA 2ZJDA 5HHDG 2WXMA 2W9NA 3WAPA 1JWSD 2LGDA 4WIPA 5KHOA 5I4DA 2FCQA 4KZ0A 3UQBA 2KX0A 3KUDB 4LNIA 1NEKB 3HM6X 2WGSA 2FNJB 1EWCA 2UU7A 1XQQA 3X0WA 5EDSA 2N1WA 4S17A 4M8MA 2DAJA 1YJJA 2KWUB 4IUMB 1FMAD 4N59A 1MHXA 3H9DA 3KH0A 4W9GA 3VTUA 5IAAC 3V3XA 1C76A 5AZHA 1T0QC 2RPQA 5IP4D 3H7PA 2FCMA 3FKYA 4MEMA 4XWTA 1F2RI 1JWAD 4PK1A 1F9JA 2FIDA 2W54A 4DWFA 3N1XC 2IO2B 2ZW0A 1TIFA 3Q6BA 3ZRCA 2KKCA 1H7WA 1KM7A 3WANA 1RLFA 3JSVA 2IGGA 4JQWC 4M8NA 4FHJA 4HDQA 2CHZA 2G45B 4AWJA 1HE8A 4UDUC 4EZJA 1WXSA 4HKZE 4DDGD 2WDTB 1WXAA 1ZUD2 4OHJA 3ZNGC 1IBXA 5BMGA 1V9JA 1V86A 2JRIB 1WXMA 2BYEA 3DHIC 1P9DU 3DVGY 3DBSA 3VRAB 3TIXA 2K1FA 3BYTB 5BYSA 4WH4A 4REZA 3B2GA 3PTFC 3R8BA 4BKSD 3MHZA 1KH0A 3A9JA 5IN7A 2K8CA 2BF8B 2TSSA 1WSPA 3PV1A 4NAMA 5G5GA 2IBIB 2KQ7A 1STEA 4NQKE 3W5UB 3QWZB 4RF1A 2KD0A 1IYFA 2HDEA 2JZZA 4BOZB 1UELA 2B3AA 3QIJA 3VQIA 3K9PB 3PHXB 4GB9A 1YN4A 3V60A 2W3RA 2RDGA 3DHGC 1TZOA 2K39A 5CHVC 2O6VB 1XO3A 1QILA 2LVPA 3HM3A 2M56B 2L0FA 2REXA 2C60A 1UUPA 2PTLA 1WR1A 4WWMA 2J7QB 3MHSD 3TJPA 1WFYA 4M0WB 4DHZE 2C7MB 3SU8X 5L83A 1C4PA 1C9FA 2JU6X 4IWPA 2AX5A 1XF5L 4IOIE 5AEKB 2Z0DB 3W9CB 3B2FA 1F1HA 3VVWB 5DPSA 3Q3MC 3KVFB 5H92C 2ZVOA 2O6VA 1B1ZA 4L2YA 3D32A 5BYQA 2BT6A 1OGWA 1R4MB 3BY4B 2W55A 5LXHA 3VTVA 1SE2A 4N58A 1OTRB 3DVGX 1TS3A 1L6UA 2RPVA 3NJTA 1TKGA 2B76B 2BWES 3U30A 1HXYD 3ZLZA 1ZXIA 1KOTA 1WYGA 2ZPNA 1RAXA 1S3SG 2ZPYA 4JPSA 3HIZA 3P4QB 3X23A 3EHVA 2YEPF 1TS2A 3T3NA 3NVZA 2PEAA 1SE4A 2KLGA 2D2QA 2LJ5A 2DNFA 4DXGA 4YL8A 1LM8B 4NAWB 4K81A 3ZJUA 1E8ZA 2CHWA 4ZRPA 3UQAA 3KYCD 1XLQA 3PRPB 5AUIA 1Z2MA 1YJ1A 1GB4A 1UD7A 1SEBD 4GDLA 4IDIA 1D5ZC 4RFBA 5D7GA 2KANA 2M19A 2FIFA 1SBBB 4S0RA 1WJ4A 3JVZX 1FXIA 4PYUA 3DOWA 1JROA 4GXBA 1CMXB 1B9RA 2BKRB 4AJYB 1ZE3D 4B0MA 1WX8A 1WRIA 3ABVB 2KQ4X 3A9KA 3FAHA 3N20C 2PJHA 4KIKB 1JRPA 1N62A 1WR6E 2WQYB 2WX0A 3VUWA 2AL3A 4EZLA 2BB6A 4K7SA 2MEKA 3PHWB 4A55A 1T0SC 1PGXA 4E71A 1Y56A 3W2DA 2MBBB 1WY8A 2IZVB 1Q5WB 2L83A 2I38A 2NS5A 4O1NA 3BVGA 1E8WA 2IY0B 3AV8A 4A3PA 1F52A 1V6EA 3V6CB 4ACFA 1TY2A 1YQ3B 3RNGC 1WJNA 2JSVX 1H8CA 3M3JA 3DPDA 3OJ3A 2KN5A 1KF6B 3NZUA 2X8XX 2WS3B 1E8XA 1WGRA 1K51A 4MM3A 1FRDA 3VUXA 1V49A 2V4IB 4BFRA 3KWVA 2M8SA 4ZRIA 4GN1A 2Z0EB 3WAMA 4FHKA 4RM8A 2KDIA 1ACCA 1SXTA 3U7ZA 1WI0A 4M01A 1V5TA 1UGJA 2KHWB 2IO3B 5LXIB 3O13A 4GSWA 1GJZA 4MELA 1P7EA 1TY0A 4F1SA 3EFUA 3W1SC 1RRBA 2VH1A 2KT7A 3Q8EA 4I6LB 2BWFA 1I4RA 3V61A 1GPXA 5BO4B 1ZPSA 3DWMA 1GNUA 1XEEA 3HRDD 4MJSB 5J17A 3L16A 1FNUA 2JWZA 4B9KA 3P4RB 3ZJVA 3DBLB 4MT5A 2BTEA 2EMTA 5D94A 2L0TA 2XBBC 1WJ6A 4IKGA 4BOSC 4IC7B 1T3QA 1VCBA 2BS2B 1UGMA 4DXAB 3PREA 5D2MB 4DDID 3IAM1 1WZ3A 4KDIC 1YX5B 4P1BC 4AJWA 1DYQA 4GIVA 4XYCA 4ANVA 2XK5B 3ALBA 2KWCA 2KFKB 3UF8A 1NBFC 1FFVA 4DHJB 4ZHPA 3BVMA 3RYTA 3AE2B 4M0WA 3PPAA 3V05A 3C0RB 4XDDA 3SFEB 3TEZA 3JW0X 1MG8A 2MP2A 2WXGA 2CKHB 4MSMB 2J52A 4KKJA 1I4HA 3OG5A 4LNNA 3QARA 4B6WA 1YJIA 2L00B 4G3XB 2A4ZA 1BXTA 2WXKA 3AU4A 4DHJD 1NDDA 4QAYA 4IWQA 2XK5A 2D3GA 4JWUC 1WGHA 1Z5SB 5JXVA 1VDVA 4P7IA 3KUZA 2KWDA 2INCC 4GLSC 2QSDA 2NPTA 4OZAA 3AE8B 3NS8A 4FA6A 1E5WA 2CJNA 5KHQA 3RNBC 2K6QA 1EF1A 1VD2A 4C00A 3N3KB 4J6IA 3IHPC 4W9KA 2KC2A 3ZDTA 3ZKJC 1FCLA 2WXQA 4HPPA 2IGHA 2JY6A 5FKAC 4MSQB 4RGTA 1T6BX 2I1KA 1UNSA 2K0PA 1AWDA 3AEBB 3AE3B 4XE0A 3DBHI 1U4AA 3GZNI 2K9XA 2KJ6A 3N1ZC 3L10B 3QJZA 1CK1A 2LUEA 4DXFA 2FUG1 4MH0E 3AMZA 2KLCA 1AYFA 1RM6C 3C19A 2CHXA 2AEHA 2W3SA 3WIMA 2Y5PA 1IP9A 1DOYA 2HTME 3PZ8A 2RSUA 5C3JB 4AOFA 2D11A 4HROA 4B0EA 2GLSA 2MQJA 1PQSA 1QF6A 4MH8A 3PS6A 2HD5B 1OQYA 3MJWA 4BBNC 2LRWA 1SGHA 5CHWA 1SE3A 2UWQA 4H2AA 3ZNZB 3E56A 1GT8A 2Q5WD 2HTHA 4ZOHC 4TQ0A 1SF0A 3ENEA 2DYBA 1LO5D 2DWQA 2KC1A 3GE3C 3EUB2 2G3QB 3QK0A 1VZ6A 1SJHD 3RPFC 1WGGA 3I5JC 3LDZE 5G5HA 2JF5A 1X1MA 4FJYA 3PRMB 3ZDMC 3N9YC 1E0ZA 2K6DB 2WXJA 4A3OA 5EE3A 3TEYA 2K8HA 4XX5A 1ROEA 2FE8A 3SFDB 2MRPA 4KSKC 2V0GA 4KKIA 1LFDA 2L05A 1WRDB 3QA8A 4OZCA 2IO0B 1K52A 4C7YA 3IT4B 2LZ6A 2ZNVB 4LNFA 2MBEA 2LHEA 2J0JA 3H7PB 3TEXA 3CIRB 4HJGE 5L95C 2JRHA 2EMSA 4R3DA 1FM0D 2L7RA 3DHHC 4WJOA 2LI5A 2Y3AA 4KIKA 2G1EA 4TKNA 1SJED 4YTMB 2LGXA 1JCKB 4MGIE 4BBNF 2PIAA 3AB5A 4LDTB 4X57B 3KWLA 4FXCA 1FIQA 1UBIA 1H4RA 3VH4B 5IO9A 3Q3JA 4KDLB 2LJIA 1YN3A 1XT9B 2MJDA 4LK0M 1V1PA 1RWSA 2N7EA 1PUTA 4N6EB 1ZKHA 3GZNB 4HWIB 1L0XB 2I1JA 3DBLI 3PSEB 4P16A 1BUIC 2KJHB 2D3CA 2IY1B 2KTFA 4ICVA 1WYWB 4WQOB 4DBGA 3APCA 3V62A 1C4CA 4WJPA 3TMPB 4MGYE 2X38A 1RFKA 1D3ZA 4FADA 1TTNA 1WMHB 2LMCA 2YLMA 4WWNA 5AUKA 5H8YE 1GOZA 3URYA 1OEYJ 3V6EB 2LHDA 3U7DA 2QC8A 4M00A 4Q2JA 4NQLB 3NZSA 4FJVB 2RD0A 2MP2B 4KGTA 2L8JA 2UYZB 1KRHA 1HA5A 2NVUI 2WXHA 2OOBB 4YSZB 3Q3NC 3GOEA 5GMVA 1WGKA 3A33B 2M4NA 1WGDA 5C1ZA 5MPOA 1QOFA 3T8MA 4HCNB 1FXTB 4W9FA 4GDLB 3MC9A 2J42A 2KWVB 3Q8CA 2LFIA 3VH3B 2M17A 2LGYA 4EUTA 1ET9A 2VZKD 2DX5B 1ZDVA 4PYZA 1MG4A 1WX7A 3AE7B 4HJKA 1P98A 2BPSA 4WWPA 2ZEQA 1MVKA 4C4VB 5IKCM 1V97A 1N60A 3VR8B 1HEZE 2IDYA 1E7UA 3FILB 4KX6B 2AL6A 2BQQA 1XLPA 2C9WB 1VLBA 2K5PA 3TSSA 4XWWA 3S2AA 3L17A 4DK5A 2WWZA 3RMKC 1OQQA 1E6EB 2DHZA 4IWOA 3VAWA 2H88B 1JWMD 3HUIA 3B0AA 2KAJA 1SE9A 3WA0A 3UGBB 3CF4A 1TT5B 3IFWB 3L08A 5C23A 3AEAB 3KLSX 1MHHE 1F77A 1PYWD 1HZ5A 2BGFA 2M0XA 3BINA 3EECA 2EKIA 1C3TA 2C5LC 2NBWB 3VUYA 2FUHB 3TL5A 2DBYA 4YTNB 3VDZA 1L7YA 2JYTA 4BKGA 2R61A 3HK0A 5FR6A 5D3DA 1IGDA 2WXPA 1WIAA 2NPTB 4GOCA 5CTRC 2QJLA 2BKFA 1NVID 3MP9A 1J0GA 1NI2A 3NZ3A 1TZ1A 4NY0A 4NAWA 1WX9A 4FBJB 4PS7A 4PS3A 2WXNA 4ZDVA 5AZFA 1FD6A 4ARIA 3DVNU 4HPMB 1EO6A 3P42A 3NG0A 1MPEA 2BYVE 2QIEB 1EU3A 1WXVA 4TQ1A 2DZJA 3ZNID 1CJEA 4XGAB 3BIID 2BBCA 2YEPB 1V1OA 3TEWA 1ZGUB 2DLBA 3U52E 2LEKA 2PE9A 2ASQA 4HDOA 1L0VB 5HI1A 1SIFA 2LXCA 2GRIA 2ZZPB 1QOGA 2KMMA 1EUVB 1QZEA 1GUAB 1D4BA 4ITKA 1NYRA 1NENB 2J4XA 2JZPA 4CQNA 1GC6A 3I9V1 2KK8A 4EKUA 2L76A 4FULA 1E9MA 1VZ8A 1AARA 1WM2A 2ZCCA 1M4VA 2N7JA 2KOXA 3CSTA 2BVCA 2ONQA 4JX1C 3AE9B 2L1AA 4BVUC 2KX3A 2XNAC 3NY5A 2KMCA 4NJCA 2AYOB 1WZ0A 2JVCA 4TSSA 1YIWA 4NZLB 4ANWA 4FN2A 5FK9C 2ZNVC 2HJ1A 2WU5B 2BYFA 3Q2AC 2INPE 2BS4B 1VRAB 4RF0A 1NI3A 4KV2A 4OVUA 3KW5B 1PFDA 3WAOA 2Y5BB 2KN4A 2N0SB 2JX5A 4GDKA 2C7NB 1WJUA 3AE5B 4E3CA 2JQRB 3QCAA 3RZWC 2D10A 2QEJC 3RNFC 1YMHE 1E7VA 3AEFB 4KGSA 3I3TB 2J0MA 1P1AA 3Q8AA 3Q3FA 1N5XA 2L52A 3B9JA 4ICUA 3HVZA 2D07B 1SB3C 2MSED 4JIOU 3T3OA 2ACZB 4P1CC 3R66C 3FILA 3VTWA 4NNJB 1D5XC 2KDEB 1I4PA 1WXQA 2Z59B 3AN1A 1J19A 2ICIA 1P7FA 5EE9A 1TKEA 1UBQA 3RNEC 3I57A 3W1SA 3HVDA 2CR5A 3H7SA 2KZRA 4MGKE 2KACA 2RMMA 3VRBB 4YSYB 4GMVA 3ZQ4A 3IXSA 3M62B 1PGAA 4G11A 2N9LA 4HLEA 2QMTA 2KNBA 1ISNA 2V9HA 2LUMA 1LXDA 4K7WA 3IAS1 5FR3A 4J3OD 2INDC 2IYDB 4EFOA 1C1YB 4OW0A 3ZIMA 2PMVA 2A5UA 2DZIA 4OVZA 2E3TA 2JZ3B 2JUOA 3OAWA 4NPNA 2KVZA 2V3PA 4YXDB 1UH6A 1L2NA 3U4EG 5HKHA 5D6JB 2MHJA 1GTHA 3MC8A 2NBUA 1ZXHA 3AXCA 4JGHB 2IJ0A 2K3UA 1FFUA 5J2RA 2IO1B 3BVZA 1J7AA 2FBWB 1J8CA 3ML8A 1N61A 3QX1A 1V8CA 1ZOYB 4FLHA 4D2KA 3Q8BA 1E8YA 1QT9A 1GB1A 3NUHB 1SSNA 4KGRA 4GGQA 5DPWA 2WXIA 2LVOA 1XLNA 2N9XA 3EFCA 4G0NB 1V5OA 4K3BA 4EE2A 4W9JA 1YN5A 3Q14C 3PZDA 4MM3B 4XDCA 3IG3A 2YVCA 1XD3B 3KQ4A 2WNMA 5E6NA 5JH5C 3BZDB 1XLOA 2JYEA 3AE4B 1C77A 2MWSB 1DGJA 1I7HA 5D3IB 1FCCC 4RGNA 2GBRA 4C56C 4BKTA 2JPHA 3BWUD 1IUEA 1WGYA 2MCNB 5JHBA 3R7QA 4BAXA 3GE8C 4KVGB 2EKEC 2KDMA 3VFKA 2CU3A 3HHMA 2KVRA 4KSLC 4YT0B 2AWTA 1TJEA 2VRRB 4RGMA 3N1YC 1L4DB 3R7RA 4BZAA 5BYRA 3IBEA 4URKA 5DPTA 2H89B 4CO7A 3U8ZA 3UI3A 3PRZA 2DZKA 3PGEA 1K53A 2LGSA 1XCTL 3NVWA 1Y8RC 3LB8C 2DYOA 2RR9A 4DHZB 3KYDD 2JWUA 1FPYA 3APFA 4YTPB 1IPGA 1EM7A 1LQBA 4RCOA 2HE7A 4YSXB 4W9LA 4IW0A 1JALA 2Z8LA 1WH3A 3N32A 3EC8A 2N7DA 5HFYA 4W9EA 2AQ1B 2MH7A 4XC2A 2SEBD 3NOBA 1MFWA 2GMIC 3QQ8B 4JL9A 2WXRA 1N6ZA 1A70A 2AQ2B 1T0YA 2O2VB 4I6NB 5JHAA 1FNVA 4A8XC 4A6QA 3AH7A 1YNTE 1GTEA 3DBRB 3CMMB 1JW9D 3RULA 1TS4A 2QDFA 2KFKA 1C78A 5LLIA 3ZGZA 1LGRA 1KFYB 4A9AA 2O6VD 1V2YA 2KTRB 2E6XA 3QC8B 3ZYYX 5BMIA 1L0YB 1J7CA 2WDQB 3P4PB 2NMQA 4HEA1 4LDTD 3WCQA 2LD9A 2G4SA 2V3SA 4LTUA 3SD5A 3Q8FA 3QHTA 2NTTA 1KTKA 5IOIA 1OEYA 5EE0A 4F8CB 4ANUA 1OQRA 1HTOA 3AU5A 3AI5A 4K1RB 4TUUA 3RT3B 2PVOD 2GBNA 1JWUD 1I35A 2GB1A 1JQ4A 2KTRA 1A5RA 1HQRD 4OVVA 4ZYNA 2FCNA 4RMAA 3PZ7A 1TGZB 4US8A 4WURA 2MBQA 4HKQA 2V3NA 4G50A 5DCNA 2FAZA 2PKOA 1FXAA 5E6OA 2EELA 3AE6B 1I4GA 4RNAA 3ZO5B 3P63A 3SDLC 2CU1A 1BT0A 4MDKE 3CSFA 4RGOS 1N63A 5LNK1 3WALA 3ZRFA 2R2OA 2M0AA 1Q0WB 1JWBD 4W9DA 1C4AA 2L32A 2L3ZA 2QILA 1EWYC 3VXWA 2HJ8A 2WXOA 1HTQA 3H8HA 2MLBA 3BK1A 2QCZA 3GB1A 3H1UA 3B08A 3APDA 4ZRKA 2MJ3A 2D3BA 1ZW7A 2BB5A 2NR2A 1GAQB 1P3QU 4YWGG 3A4RA 2BS3B 5BMHA 4IG7B 4I6PA 2GI9A 3RD2A 3ONSA 3L4PA 4LNKA 3UIOB 2K25A 4WQMA 3GS2A 3B1LX 1V81A 3ECIA 3ML9A 3LXFA 3NVYA 2ZCBA 3TUOA 3LYYA 4B95A 3ZTCA 1TBEA 4OZBA 3ZJTA 2N9PC 2J0KA 1BMLC 4HXDA 3A9KB 2MBOA 3I63C 3PVLA 1TYGB 3DWGC 3NHEB 1KLUD 3ZXRA 4MACA 1TKYA 2XN9C 1QLBB 2WYQA 2N9EB 4WJQA 1H7XA 3H6NA 1VZ7A 1SIJA 1UWMA 1YQBA 4HCPB 1C79A 4MJSA 1UWXA 2NBVB 4TV3A 2J53A 4IM0A 3ZW3A 2VH2A 1Q10A 1F2RC 2KQSA 4MGZE 5HG2A 5IA7A 1R4NI 4DQOC 5TR5A 2IGDA 1ESFA 3ZNHB 3OLMD 1FRRA 1YD8U 2WLBA 3P4SB 1R4MI 3E9SA 3Q3OC 3LJ3A 3L13A 3SR6A 2PLPA
chains in the Genus database with same CATH topology
1XCQL 3R8BA 3T3OA 1AYFA 1RM6C 2ACZB 3MHZA 2D5GA 2W3SA 3FILA 1KH0A 1D5XC 2Y5PA 2VZKB 1I4PA 1WXQA 2TSSA 1WSPA 1DOYA 3AN1A 2ICIA 2HTME 1P7FA 1MI0A 3PZ8A 4NAMA 5G5GA 5EE9A 1TKEA 3W1SA 4C7ZA 5C3JB 1VJKA 3I57A 3HVDA 1ZDXA 5T8IA 4HROA 4B0EA 1STEA 1QF6A 1JMLA 2KACA 4MH8A 2RMMA 3VRBB 4YSYB 1FEHA 3W5UB 1PDXA 4RF1A 3ZQ4A 2HDEA 3MFGA 1R7SA 3IXSA 1PGAA 1IBXB 3NS1A 2N9LA 3VQIA 2QMTA 1SE3A 1E10A 2LUMA 3IAS1 5FR3A 1PGBA 4H2AA 4J3OD 3E56A 1YN4A 1GT8A 2W3RA 2Q5WD 2RDGA 4OW0A 2PMVA 1TZOA 4ZOHC 1NYQA 4TMAB 4TQ0A 1XO3A 1SF0A 1ZP0B 1QILA 4OVZA 1LO5D 2E3TA 2ZW1A 2WXFA 2M56B 2DWQA 2V3PA 4ZHOA 4YXDB 3SEBA 3EUB2 3U4EG 1VZ6A 1GTHA 1SJHD 3RPFC 1UUPA 2PTLA 2Y5CA 4WWMA 1N5WA 1ZXHA 5G5HA 1AN8A 2IJ0A 1C4PA 2K3UA 2ON8A 1C9FA 1FFUA 2JU6X 1E0ZA 3N9YC 3BVZA 1J7AA 2FBWB 2AX5A 3VR9B 2WXJA 1N61A 1V8CA 5EE3A 3TEYA 3AEEB 2NTSA 1ZOYB 1XF5L 1DOXA 1ROEA 2FE8A 3SFDB 4IOIE 4D2KA 3Q8BA 2V0GA 1QT9A 4KKIA 3W9CB 1GB1A 3B2FA 3NUHB 1SSNA 4KGRA 4OZCA 1K52A 1QQRA 4C7YA 3IT4B 3EGRA 5H92C 2WDRB 3C8YA 1B1ZA 2WXIA 1XLNA 4L2YA 5BYQA 3ETRA 2LHEA 3P1MA 2BT6A 1HZ6A 3TEXA 3CIRB 4EE2A 4HJGE 1YN5A 2W55A 4MM3B 4XDCA 4R3DA 1FM0D 3W5VB 1SE2A 1J7BA 3KQ4A 4N58A 1ET6A 2WNMA 4AQ7A 2Y3AA 3BZDB 4US9A 1TS3A 1XLOA 1L6UA 2JYEA 2G1EA 2RPVA 4USAA 1TKGA 3AE4B 1SJED 1XXGA 1C77A 2B76B 4YTMB 1DGJA 1HXYD 1I7HA 1ZXIA 1WYGA 1JCKB 5D3IB 1FCCC 4RGNA 1KLGD 4ZRQA 4JPSA 3P4QB 2PIAA 2YEPF 3AB5A 4C56C 1TS2A 3KWLA 4FXCA 1FIQA 3T3NA 3NVZA 3BWUD 1IUEA 1SE4A 2LJIA 1YN3A 1D5MC 2MJDA 3AECB 1V1PA 3FC4A 1RWSA 4LK0M 2BYTA 4DXGA 1PUTA 4N6EB 1AW7A 2WXLA 4NAWB 3ZJUA 4HRSA 4ZRPA 2WDVB 1L0XB 1XLQA 2CJOA 4P16A 5AUIA 1BUIC 2KDMA 3NVVA 1WWTA 4ARCA 2CU3A 1GB4A 4L23A 3AE1B 4YT0B 1TJEA 1E7PB 1SEBD 3J9CA 4RGMA 1C4CA 1L4DB 3PO0A 2X38A 1RFKA 4IDIA 5BYRA 2N9KA 2OEDA 5C2TB 1D5ZC 4RFBA 5D7GA 2LMCA 2M19A 2H89B 1SBBB 5AUKA 3UI3A 5H8YE 4AS1A 1FXIA 1K53A 1GOZA 4JE3B 1XCTL 3NVWA 1JROA 3LB8C 1B9RA 2DYOA 3URYA 1I4QA 2JWUA 2LHDA 3GP7A 4YTPB 1EM7A 2DYMA 3BK2A 1ZE3D 4Q2JA 4B0MA 1WRIA 3ABVB 2KQ4X 4KGTA 4RCOA 3FAHA 1KRHA 1HA5A 4YSXB 4ZYSA 2MJEA 1JRPA 1N62A 2WXHA 4L1BA 2INNE 4YSZB 2WQYB 1WGKA 1JALA 2Z8LA 2RDHA 3EA6A 5MPOA 5HFYA 2BB6A 2WP9B 1QOFA 2AQ1B 2MEKA 2MH7A 2WU2B 4P6VF 4A55A 2SEBD 4RH6A 3BYYB 1PGXA 1DOIA 2LGIA 4GDLB 1Y56A 3W2DA 2J42A 2L83A 2I38A 3Q8CA 2LFIA 4O1NA 5E6JA 2WXRA 2OHFA 3BVGA 1A70A 3IT6B 3AV8A 1ET9A 2VZKD 2AQ2B 4C80A 2IPKD 1ZDVA 2PVGC 3AEDB 1QOBA 5TSSA 3AE7B 1L4ZB 1TY2A 1YQ3B 3AM9A 1MVKA 2JSVX 1V97A 1FNVA 4A8XC 1N60A 4A6QA 3VR8B 1YQ4B 1HEZE 2IDYA 3AH7A 1T5XD 4KX6B 1YNTE 1GTEA 1KF6B 3FILB 1JW9D 1TS4A 2BW2A 2WS3B 1K51A 1XLPA 1FRDA 1C78A 4WAFA 2V4IB 3ZGZA 1VLBA 2K5PA 3TSSA 3KWVA 1EU4A 4XWWA 1KFYB 2AQ3B 4A9AA 3MC0B 2PW9A 2E6XA 1OQQA 3ZYYX 1ACCA 5BMIA 1FO4A 1L0YB 1SXTA 1IGCA 1V1PB 1J7CA 1E6EB 2WDQB 3U7ZA 3P4PB 3MJ5A 2NMQA 4HEA1 2H88B 1JWMD 3WCQA 3HUIA 2KAJA 3R2IA 5GXGB 4LTUA 1D6EC 1QOAA 1UGJA 3Q8FA 2W82A 1RYJA 3CF4A 1QKZA 2NTTA 1FNWA 1KTKA 4LLGM 3AEAB 3O13A 2JXTA 3KLSX 1MHHE 1F77A 1PYWD 1HZ5A 5EE0A 1P7EA 1L6VA 3SR6A 1OQRA 2EKIA 1TY0A 3Q69A 2PVOD 2K22A 2DBYA 4JWSC 4YTNB 1JWUD 4PT5A 2JYTA 2GB1A 3Q8EA 1I4XA 1JQ4A 2R61A 2I2YA 3AEGB 5EE1A 1OFFA 1I4RA 3RFZB 1GPXA 1HQRD 5D3DA 1ZPSA 4GDKB 3PZ7A 4US8A 3DWMA 4WURA 2SAKA 3OWEB 3U2SC 1XEEA 3HRDD 4HKQA 1IGDA 2V3NA 2WXPA 2PKOA 1FNUA 1FXAA 3P4RB 3ZJVA 2QJLA 2EELA 3AE6B 1I4GA 4MT5A 4RNAA 3P63A 3R2TA 2G9HD 2BTEA 1NVID 1ENFA 3MP9A 1L5PA 3NZ3A 4IKGA 1VR9A 1CQVA 1F0ZA 1K50A 1N63A 4RGOS 5LNK1 2WXNA 1TS5A 3NRZA 1CZPA 1T3QA 3CWIA 2BS2B 1FD6A 4A90A 4ARIA 2M0AA 3P42A 1JWBD 1MPEA 1C4AA 2L32A 2QIEB 3IAM1 1EU3A 2QILA 1EWYC 4TQ1A 2WXOA 5HHDG 1CJEA 2WXMA 1DYQA 3BIID 3H8HA 1JWSD 4WIPA 2BBCA 2YEPB 1V1OA 3BK1A 2DLBA 3TEWA 1FFVA 5I4DA 3U52E 3GB1A 4ZHPA 2LEKA 3BVMA 3AE2B 4M0WA 2MJ3A 3V05A 2BB5A 4XDDA 1L0VB 3SFEB 1GAQB 5HI1A 3TEZA 2GRIA 1NEKB 4YWGG 1QOGA 2WXGA 2KMMA 2BS3B 1EWCA 5BMHA 1D4BA 2GI9A 4ITKA 1NYRA 3L4PA 1NENB 2J4XA 2J52A 2JZPA 4CQNA 4KKJA 1I4HA 3I9V1 1YJJA 4WQMA 3GS2A 1YJIA 1FMAD 4N59A 1MHXA 1BXTA 1E9MA 2WXKA 3LXFA 3NVYA 3TUOA 3V3XA 3LYYA 1C76A 1VZ8A 4JWUC 1M4VA 2N7JA 5JXVA 1VDVA 4OZBA 4XWTA 1F2RI 2KWDA 1JWAD 4GLSC 2QSDA 3ZJTA 2ONQA 4JX1C 3AE9B 4OZAA 2L1AA 2W54A 3AE8B 2XNAC 1BMLC 2ZW0A 4NJCA 2CJNA 4TSSA 1H7WA 4NZLB 5FK9C 2WU5B 1TYGB 2IGGA 3DWGC 1KLUD 4MACA 1TKYA 2INPE 2BS4B 1VRAB 2XN9C 4RF0A 1QLBB 1NI3A 1H7XA 1VZ7A 1PFDA 4UDUC 1FCLA 2WXQA 1SIJA 4HKZE 2IGHA 2KN4A 2N0SB 1UWMA 1ZUD2 2JX5A 4OHJA 1IBXA 5BMGA 5FKAC 1C79A 3AE5B 2JQRB 1UWXA 2J53A 4RGTA 1T6BX 2QEJC 1UNSA 1YMHE 2K0PA 1AWDA 1Q10A 3AEBB 1F2RC 3AE3B 4XE0A 5HG2A 3AEFB 2K9XA 4DQOC 4KGSA 3Q8AA 2IGDA 1ESFA 1N5XA 1FRRA 3VRAB 2L52A 3B9JA 2WLBA 3P4SB 1CK1A 3HVZA 4DXFA 3E9SA 2FUG1 5BYSA 3BYTB 4WH4A 4REZA 1SB3C 3B2GA 3AMZA 2PLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQ3 B;  3AM9 A;  1AYF A;  1FFV A;  3P4Q B;  1RM6 C;  2ACZ B;  1V97 A;  2PIA A;  1N60 A;  4ZHP A;  3VR8 B;  1YQ4 B;  2LEK A;  2W3S A;  3AB5 A;  3AH7 A;  3AE2 B;  4KX6 B;  3KWL A;  1GTE A;  1KF6 B;  1FIQ A;  1JW9 D;  1WXQ A;  2MJ3 A;  3NVZ A;  4FXC A;  2WS3 B;  1DOY A;  3AN1 A;  1IUE A;  1L0V B;  3SFE B;  1GAQ B;  2HTM E;  1XLP A;  2MJD A;  3AEC B;  1NEK B;  1FRD A;  1RWS A;  1TKE A;  5C3J B;  1VJK A;  1PUT A;  3FC4 A;  1VLB A;  4N6E B;  2K5P A;  1QOG A;  4C7Z A;  4HRO A;  2KMM A;  2BS3 B;  1QF6 A;  1KFY B;  4HRS A;  4A9A A;  3VRB B;  4YSY B;  3W5U B;  4ITK A;  1NYR A;  2WDV B;  1PDX A;  1NEN B;  3L4P A;  1XLQ A;  2CJO A;  1OQQ A;  3ZYY X;  1R7S A;  5AUI A;  1FO4 A;  1YJJ A;  1J7C A;  3NVV A;  1E6E B;  2WDQ B;  1WWT A;  3NS1 A;  3P4P B;  4WQM A;  2CU3 A;  1YJI A;  1FMA D;  1E10 A;  2H88 B;  4N59 A;  3WCQ A;  3HUI A;  1E9M A;  2KAJ A;  3LXF A;  3NVY A;  5GXG B;  4LTU A;  3AE1 B;  4YT0 B;  1QOA A;  1E7P B;  1TJE A;  1GT8 A;  2W3R A;  1RYJ A;  2Q5W D;  4JWU C;  3CF4 A;  3PO0 A;  1RFK A;  4IDI A;  1NYQ A;  4ZOH C;  1VDV A;  1XO3 A;  1SF0 A;  1ZP0 B;  1JWA D;  3AEA B;  2E3T A;  5C2T B;  2M56 B;  4JX1 C;  3AE9 B;  2DWQ A;  4ZHO A;  2W54 A;  4YXD B;  5EE0 A;  3AE8 B;  1L6V A;  3EUB 2;  3SR6 A;  2M19 A;  1OQR A;  5EE9 A;  2H89 B;  2EKI A;  1GTH A;  5AUK A;  5H8Y E;  3RPF C;  1FXI A;  2K22 A;  2PVO D;  2Y5C A;  4WWM A;  2CJN A;  2DBY A;  1N5W A;  3NVW A;  1H7W A;  1JRO A;  5G5H A;  4JWS C;  4YTN B;  3LB8 C;  1B9R A;  1JQ4 A;  2WU5 B;  1TYG B;  3DWG C;  3AEG B;  1FFU A;  5EE1 A;  1OFF A;  4YTP B;  1E0Z A;  1TKY A;  1GPX A;  2BS4 B;  1J7A A;  1QLB B;  2FBW B;  1NI3 A;  4US8 A;  2AX5 A;  3DWM A;  3VR9 B;  1WRI A;  1H7X A;  3ABV B;  1N61 A;  1V8C A;  1PFD A;  3HRD D;  3FAH A;  1KRH A;  3HVZ A;  5EE3 A;  3AEE B;  1ZOY B;  4YSX B;  1DOX A;  1SIJ A;  2MJE A;  1JRP A;  1ROE A;  1N62 A;  2PKO A;  3SFD B;  1FXA A;  2N0S B;  3P4R B;  1UWM A;  1QT9 A;  4YSZ B;  2WQY B;  3AE6 B;  1ZUD 2;  2JX5 A;  2QJL A;  3B2F A;  3P63 A;  5G5G A;  3W9C B;  1WGK A;  1JAL A;  1NVI D;  3AE5 B;  4C7Y A;  1L5P A;  2JQR B;  5H92 C;  5MPO A;  2WDR B;  2WP9 B;  1QOF A;  1XLN A;  2MH7 A;  1F0Z A;  2WU2 B;  1AWD A;  3ETR A;  3P1M A;  4P6V F;  2BT6 A;  1N63 A;  3AEB B;  3AE3 B;  3CIR B;  3NRZ A;  3AEF B;  1CZP A;  2K9X A;  1T3Q A;  2W55 A;  2BS2 B;  3CWI A;  4C80 A;  1DOI A;  1FM0 D;  3W5V B;  1JWB D;  1J7B A;  2L83 A;  4N58 A;  2QIE B;  1N5X A;  1EWY C;  1FRR A;  2OHF A;  3VRA B;  2L52 A;  3B9J A;  1A70 A;  2WLB A;  3P4S B;  4US9 A;  1XLO A;  1L6U A;  3AV8 A;  2G1E A;  4USA A;  1TKG A;  1CJE A;  3AE4 B;  2PVG C;  2B76 B;  3AED B;  4YTM B;  1DGJ A;  3BII D;  1I7H A;  1QOB A;  3AE7 B;  1ZXI A;  1WYG A;  1SB3 C;  3B2G A;  3AMZ A; 
#chains in the Genus database with same CATH topology
 1XCQ L;  3M95 A;  4AUQ C;  2D5G A;  2DEN B;  2WX1 A;  2VZK B;  2GBM A;  1YX6 B;  4II2 B;  3KUC B;  5DPR A;  1MI0 A;  4C7Z A;  1VJK A;  5T8I A;  1ZDX A;  1JML A;  3ZUN A;  1FEH A;  1WE6 A;  1PDX A;  3IVF A;  1WM3 A;  3MFG A;  1R7S A;  3PLU A;  3A1Q A;  1IBX B;  3NS1 A;  3L54 A;  3ZTD A;  1E10 A;  2NCN A;  1PGB A;  1EF5 A;  1E90 A;  2GBJ A;  2GBK A;  3R3M A;  1KLV A;  2D3A A;  1NYQ A;  4TMA B;  2O2V A;  1ZP0 B;  2ZW1 A;  2WXF A;  1UF0 A;  4ZHO A;  3SEB A;  3MTN B;  4IM2 A;  2Y5C A;  2DZM A;  1N5W A;  2OJW A;  1AN8 A;  3UIN B;  4LJO B;  1WMH A;  3ZVV A;  1GG3 A;  2MW5 A;  3A1Q B;  2ON8 A;  2LVQ A;  4LNO A;  4W9C A;  5CX3 A;  3VR9 B;  3VHT C;  5G55 A;  3OJ4 B;  3AEE B;  1WE7 A;  2NTS A;  3TBL D;  1DOX A;  2ZVN A;  3DQV A;  3DBH B;  2PE6 B;  4EZK A;  1KJT A;  1QQR A;  3EGR A;  4XZ4 A;  2WDR B;  3C8Y A;  3ETR A;  3P1M A;  2V4L A;  4HK2 A;  1HZ6 A;  2MBH A;  1GC7 A;  3W5V B;  2PPH A;  1J7B A;  1ET6 A;  2MX2 A;  1YOV B;  4AQ7 A;  4US9 A;  4USA A;  1XXG A;  4NJ7 A;  2KJR A;  2JT4 B;  1KLG D;  4ZRQ A;  3JSV B;  5E6P A;  2M1M A;  2KDB A;  1K8R B;  2XEW A;  4II3 B;  1D5M C;  3FC4 A;  3AEC B;  4WJN A;  2BYT A;  1AW7 A;  2WXL A;  1R4N B;  4HRS A;  2WDV B;  2CJO A;  3DVN V;  2LRU A;  3NVV A;  1WWT A;  4W9I A;  4ARC A;  1S1Q B;  4EEW A;  4L23 A;  3AE1 B;  1JRU A;  1E7P B;  3A9J B;  3J9C A;  3PO0 A;  2QHO A;  4BKS A;  2N9K A;  2OED A;  5C2T B;  3UIP B;  5J18 A;  2KFJ A;  3PT2 B;  4AS1 A;  4JE3 B;  1WF9 A;  3JYU A;  3RI7 C;  1I4Q A;  3GP7 A;  4AP4 C;  2DYM A;  3BK2 A;  4HVB A;  3W1Y A;  3RZF A;  3RUI B;  4ZYS A;  2MJE A;  2CS4 A;  4L1B A;  2INN E;  2G4D B;  2RDH A;  3EA6 A;  3QAQ A;  1Q1O A;  3N30 A;  2WP9 B;  3DDC B;  2JXX A;  5JZE B;  2WU2 B;  4P6V F;  3ZXV A;  3RNC C;  1M94 A;  3BYY B;  4RH6 A;  2KMA A;  1DOI A;  2LGI A;  2OJR A;  3M63 B;  4NJ6 A;  4ZRJ A;  4CYE A;  2KDF B;  4EOY A;  4W9H A;  5E6J A;  2OHF A;  3IT6 B;  4C80 A;  2IPK D;  2PVG C;  3AED B;  1QOB A;  5TSS A;  1L4Z B;  4E74 A;  4LCD E;  2K8B A;  3RN9 C;  3AM9 A;  2MA9 B;  3RNA C;  1YQ4 B;  3AUL A;  1T5X D;  2FCS A;  2V1Y A;  2RGF A;  2BW2 A;  4LJP B;  3A4S C;  2N1V A;  4WAF A;  2DAF A;  4ASW C;  2KO3 A;  1EU4 A;  4GU2 A;  5G2N A;  4C4V A;  2AQ3 B;  3DCG A;  3MC0 B;  4M02 A;  2PW9 A;  4KZC A;  1FO4 A;  2LWP A;  1IGC A;  1V1P B;  2RDB C;  4F7Z A;  2GOW A;  4K3C A;  3MJ5 A;  4JLC A;  3R2I A;  2LXA A;  5GXG B;  4N9F 4;  1D6E C;  1QOA A;  2WHI A;  2W82 A;  1RYJ A;  3P2B A;  2KYW A;  1QKZ A;  1FNW A;  4LLG M;  1G6J A;  2JXT A;  1I42 A;  1T0R C;  2LAS A;  1L6V A;  2KXJ A;  1P0R A;  3Q69 A;  2K22 A;  3PLV A;  4JWS C;  4WAA A;  4PT5 A;  4FJZ A;  1I4X A;  4CHK A;  2I2Y A;  3AEG B;  5EE1 A;  1OFF A;  3RFZ B;  2C7H A;  4GDK B;  5AZG A;  2SAK A;  3OWE B;  5CHF A;  3U2S C;  4IM3 A;  3O65 B;  2R2Q A;  3R2T A;  2G9H D;  3SHQ A;  1ENF A;  4K7U A;  4HPL B;  1L5P A;  1V80 A;  3L0W B;  3RCZ A;  3CF6 E;  2N4F A;  3TCA A;  1VR9 A;  1CQV A;  1RFA A;  1F0Z A;  1K50 A;  3K9O B;  1TS5 A;  3NRZ A;  4A20 A;  1CZP A;  3CWI A;  4RM9 A;  4A90 A;  4ANX A;  4WWO A;  1UZX B;  1MJD A;  4PS8 A;  3DBR I;  3T9L A;  2ZJD A;  5HHD G;  2WXM A;  2W9N A;  3WAP A;  1JWS D;  2LGD A;  4WIP A;  5KHO A;  5I4D A;  2FCQ A;  4KZ0 A;  3UQB A;  2KX0 A;  3KUD B;  4LNI A;  1NEK B;  3HM6 X;  2WGS A;  2FNJ B;  1EWC A;  2UU7 A;  1XQQ A;  3X0W A;  5EDS A;  2N1W A;  4S17 A;  4M8M A;  2DAJ A;  1YJJ A;  2KWU B;  4IUM B;  1FMA D;  4N59 A;  1MHX A;  3H9D A;  3KH0 A;  4W9G A;  3VTU A;  5IAA C;  3V3X A;  1C76 A;  5AZH A;  1T0Q C;  2RPQ A;  5IP4 D;  3H7P A;  2FCM A;  3FKY A;  4MEM A;  4XWT A;  1F2R I;  1JWA D;  4PK1 A;  1F9J A;  2FID A;  2W54 A;  4DWF A;  3N1X C;  2IO2 B;  2ZW0 A;  1TIF A;  3Q6B A;  3ZRC A;  2KKC A;  1H7W A;  1KM7 A;  3WAN A;  1RLF A;  3JSV A;  2IGG A;  4JQW C;  4M8N A;  4FHJ A;  4HDQ A;  2CHZ A;  2G45 B;  4AWJ A;  1HE8 A;  4UDU C;  4EZJ A;  1WXS A;  4HKZ E;  4DDG D;  2WDT B;  1WXA A;  1ZUD 2;  4OHJ A;  3ZNG C;  1IBX A;  5BMG A;  1V9J A;  1V86 A;  2JRI B;  1WXM A;  2BYE A;  3DHI C;  1P9D U;  3DVG Y;  3DBS A;  3VRA B;  3TIX A;  2K1F A;  3BYT B;  5BYS A;  4WH4 A;  4REZ A;  3B2G A;  3PTF C;  3R8B A;  4BKS D;  3MHZ A;  1KH0 A;  3A9J A;  5IN7 A;  2K8C A;  2BF8 B;  2TSS A;  1WSP A;  3PV1 A;  4NAM A;  5G5G A;  2IBI B;  2KQ7 A;  1STE A;  4NQK E;  3W5U B;  3QWZ B;  4RF1 A;  2KD0 A;  1IYF A;  2HDE A;  2JZZ A;  4BOZ B;  1UEL A;  2B3A A;  3QIJ A;  3VQI A;  3K9P B;  3PHX B;  4GB9 A;  1YN4 A;  3V60 A;  2W3R A;  2RDG A;  3DHG C;  1TZO A;  2K39 A;  5CHV C;  2O6V B;  1XO3 A;  1QIL A;  2LVP A;  3HM3 A;  2M56 B;  2L0F A;  2REX A;  2C60 A;  1UUP A;  2PTL A;  1WR1 A;  4WWM A;  2J7Q B;  3MHS D;  3TJP A;  1WFY A;  4M0W B;  4DHZ E;  2C7M B;  3SU8 X;  5L83 A;  1C4P A;  1C9F A;  2JU6 X;  4IWP A;  2AX5 A;  1XF5 L;  4IOI E;  5AEK B;  2Z0D B;  3W9C B;  3B2F A;  1F1H A;  3VVW B;  5DPS A;  3Q3M C;  3KVF B;  5H92 C;  2ZVO A;  2O6V A;  1B1Z A;  4L2Y A;  3D32 A;  5BYQ A;  2BT6 A;  1OGW A;  1R4M B;  3BY4 B;  2W55 A;  5LXH A;  3VTV A;  1SE2 A;  4N58 A;  1OTR B;  3DVG X;  1TS3 A;  1L6U A;  2RPV A;  3NJT A;  1TKG A;  2B76 B;  2BWE S;  3U30 A;  1HXY D;  3ZLZ A;  1ZXI A;  1KOT A;  1WYG A;  2ZPN A;  1RAX A;  1S3S G;  2ZPY A;  4JPS A;  3HIZ A;  3P4Q B;  3X23 A;  3EHV A;  2YEP F;  1TS2 A;  3T3N A;  3NVZ A;  2PEA A;  1SE4 A;  2KLG A;  2D2Q A;  2LJ5 A;  2DNF A;  4DXG A;  4YL8 A;  1LM8 B;  4NAW B;  4K81 A;  3ZJU A;  1E8Z A;  2CHW A;  4ZRP A;  3UQA A;  3KYC D;  1XLQ A;  3PRP B;  5AUI A;  1Z2M A;  1YJ1 A;  1GB4 A;  1UD7 A;  1SEB D;  4GDL A;  4IDI A;  1D5Z C;  4RFB A;  5D7G A;  2KAN A;  2M19 A;  2FIF A;  1SBB B;  4S0R A;  1WJ4 A;  3JVZ X;  1FXI A;  4PYU A;  3DOW A;  1JRO A;  4GXB A;  1CMX B;  1B9R A;  2BKR B;  4AJY B;  1ZE3 D;  4B0M A;  1WX8 A;  1WRI A;  3ABV B;  2KQ4 X;  3A9K A;  3FAH A;  3N20 C;  2PJH A;  4KIK B;  1JRP A;  1N62 A;  1WR6 E;  2WQY B;  2WX0 A;  3VUW A;  2AL3 A;  4EZL A;  2BB6 A;  4K7S A;  2MEK A;  3PHW B;  4A55 A;  1T0S C;  1PGX A;  4E71 A;  1Y56 A;  3W2D A;  2MBB B;  1WY8 A;  2IZV B;  1Q5W B;  2L83 A;  2I38 A;  2NS5 A;  4O1N A;  3BVG A;  1E8W A;  2IY0 B;  3AV8 A;  4A3P A;  1F52 A;  1V6E A;  3V6C B;  4ACF A;  1TY2 A;  1YQ3 B;  3RNG C;  1WJN A;  2JSV X;  1H8C A;  3M3J A;  3DPD A;  3OJ3 A;  2KN5 A;  1KF6 B;  3NZU A;  2X8X X;  2WS3 B;  1E8X A;  1WGR A;  1K51 A;  4MM3 A;  1FRD A;  3VUX A;  1V49 A;  2V4I B;  4BFR A;  3KWV A;  2M8S A;  4ZRI A;  4GN1 A;  2Z0E B;  3WAM A;  4FHK A;  4RM8 A;  2KDI A;  1ACC A;  1SXT A;  3U7Z A;  1WI0 A;  4M01 A;  1V5T A;  1UGJ A;  2KHW B;  2IO3 B;  5LXI B;  3O13 A;  4GSW A;  1GJZ A;  4MEL A;  1P7E A;  1TY0 A;  4F1S A;  3EFU A;  3W1S C;  1RRB A;  2VH1 A;  2KT7 A;  3Q8E A;  4I6L B;  2BWF A;  1I4R A;  3V61 A;  1GPX A;  5BO4 B;  1ZPS A;  3DWM A;  1GNU A;  1XEE A;  3HRD D;  4MJS B;  5J17 A;  3L16 A;  1FNU A;  2JWZ A;  4B9K A;  3P4R B;  3ZJV A;  3DBL B;  4MT5 A;  2BTE A;  2EMT A;  5D94 A;  2L0T A;  2XBB C;  1WJ6 A;  4IKG A;  4BOS C;  4IC7 B;  1T3Q A;  1VCB A;  2BS2 B;  1UGM A;  4DXA B;  3PRE A;  5D2M B;  4DDI D;  3IAM 1;  1WZ3 A;  4KDI C;  1YX5 B;  4P1B C;  4AJW A;  1DYQ A;  4GIV A;  4XYC A;  4ANV A;  2XK5 B;  3ALB A;  2KWC A;  2KFK B;  3UF8 A;  1NBF C;  1FFV A;  4DHJ B;  4ZHP A;  3BVM A;  3RYT A;  3AE2 B;  4M0W A;  3PPA A;  3V05 A;  3C0R B;  4XDD A;  3SFE B;  3TEZ A;  3JW0 X;  1MG8 A;  2MP2 A;  2WXG A;  2CKH B;  4MSM B;  2J52 A;  4KKJ A;  1I4H A;  3OG5 A;  4LNN A;  3QAR A;  4B6W A;  1YJI A;  2L00 B;  4G3X B;  2A4Z A;  1BXT A;  2WXK A;  3AU4 A;  4DHJ D;  1NDD A;  4QAY A;  4IWQ A;  2XK5 A;  2D3G A;  4JWU C;  1WGH A;  1Z5S B;  5JXV A;  1VDV A;  4P7I A;  3KUZ A;  2KWD A;  2INC C;  4GLS C;  2QSD A;  2NPT A;  4OZA A;  3AE8 B;  3NS8 A;  4FA6 A;  1E5W A;  2CJN A;  5KHQ A;  3RNB C;  2K6Q A;  1EF1 A;  1VD2 A;  4C00 A;  3N3K B;  4J6I A;  3IHP C;  4W9K A;  2KC2 A;  3ZDT A;  3ZKJ C;  1FCL A;  2WXQ A;  4HPP A;  2IGH A;  2JY6 A;  5FKA C;  4MSQ B;  4RGT A;  1T6B X;  2I1K A;  1UNS A;  2K0P A;  1AWD A;  3AEB B;  3AE3 B;  4XE0 A;  3DBH I;  1U4A A;  3GZN I;  2K9X A;  2KJ6 A;  3N1Z C;  3L10 B;  3QJZ A;  1CK1 A;  2LUE A;  4DXF A;  2FUG 1;  4MH0 E;  3AMZ A;  2KLC A;  1AYF A;  1RM6 C;  3C19 A;  2CHX A;  2AEH A;  2W3S A;  3WIM A;  2Y5P A;  1IP9 A;  1DOY A;  2HTM E;  3PZ8 A;  2RSU A;  5C3J B;  4AOF A;  2D11 A;  4HRO A;  4B0E A;  2GLS A;  2MQJ A;  1PQS A;  1QF6 A;  4MH8 A;  3PS6 A;  2HD5 B;  1OQY A;  3MJW A;  4BBN C;  2LRW A;  1SGH A;  5CHW A;  1SE3 A;  2UWQ A;  4H2A A;  3ZNZ B;  3E56 A;  1GT8 A;  2Q5W D;  2HTH A;  4ZOH C;  4TQ0 A;  1SF0 A;  3ENE A;  2DYB A;  1LO5 D;  2DWQ A;  2KC1 A;  3GE3 C;  3EUB 2;  2G3Q B;  3QK0 A;  1VZ6 A;  1SJH D;  3RPF C;  1WGG A;  3I5J C;  3LDZ E;  5G5H A;  2JF5 A;  1X1M A;  4FJY A;  3PRM B;  3ZDM C;  3N9Y C;  1E0Z A;  2K6D B;  2WXJ A;  4A3O A;  5EE3 A;  3TEY A;  2K8H A;  4XX5 A;  1ROE A;  2FE8 A;  3SFD B;  2MRP A;  4KSK C;  2V0G A;  4KKI A;  1LFD A;  2L05 A;  1WRD B;  3QA8 A;  4OZC A;  2IO0 B;  1K52 A;  4C7Y A;  3IT4 B;  2LZ6 A;  2ZNV B;  4LNF A;  2MBE A;  2LHE A;  2J0J A;  3H7P B;  3TEX A;  3CIR B;  4HJG E;  5L95 C;  2JRH A;  2EMS A;  4R3D A;  1FM0 D;  2L7R A;  3DHH C;  4WJO A;  2LI5 A;  2Y3A A;  4KIK A;  2G1E A;  4TKN A;  1SJE D;  4YTM B;  2LGX A;  1JCK B;  4MGI E;  4BBN F;  2PIA A;  3AB5 A;  4LDT B;  4X57 B;  3KWL A;  4FXC A;  1FIQ A;  1UBI A;  1H4R A;  3VH4 B;  5IO9 A;  3Q3J A;  4KDL B;  2LJI A;  1YN3 A;  1XT9 B;  2MJD A;  4LK0 M;  1V1P A;  1RWS A;  2N7E A;  1PUT A;  4N6E B;  1ZKH A;  3GZN B;  4HWI B;  1L0X B;  2I1J A;  3DBL I;  3PSE B;  4P16 A;  1BUI C;  2KJH B;  2D3C A;  2IY1 B;  2KTF A;  4ICV A;  1WYW B;  4WQO B;  4DBG A;  3APC A;  3V62 A;  1C4C A;  4WJP A;  3TMP B;  4MGY E;  2X38 A;  1RFK A;  1D3Z A;  4FAD A;  1TTN A;  1WMH B;  2LMC A;  2YLM A;  4WWN A;  5AUK A;  5H8Y E;  1GOZ A;  3URY A;  1OEY J;  3V6E B;  2LHD A;  3U7D A;  2QC8 A;  4M00 A;  4Q2J A;  4NQL B;  3NZS A;  4FJV B;  2RD0 A;  2MP2 B;  4KGT A;  2L8J A;  2UYZ B;  1KRH A;  1HA5 A;  2NVU I;  2WXH A;  2OOB B;  4YSZ B;  3Q3N C;  3GOE A;  5GMV A;  1WGK A;  3A33 B;  2M4N A;  1WGD A;  5C1Z A;  5MPO A;  1QOF A;  3T8M A;  4HCN B;  1FXT B;  4W9F A;  4GDL B;  3MC9 A;  2J42 A;  2KWV B;  3Q8C A;  2LFI A;  3VH3 B;  2M17 A;  2LGY A;  4EUT A;  1ET9 A;  2VZK D;  2DX5 B;  1ZDV A;  4PYZ A;  1MG4 A;  1WX7 A;  3AE7 B;  4HJK A;  1P98 A;  2BPS A;  4WWP A;  2ZEQ A;  1MVK A;  4C4V B;  5IKC M;  1V97 A;  1N60 A;  3VR8 B;  1HEZ E;  2IDY A;  1E7U A;  3FIL B;  4KX6 B;  2AL6 A;  2BQQ A;  1XLP A;  2C9W B;  1VLB A;  2K5P A;  3TSS A;  4XWW A;  3S2A A;  3L17 A;  4DK5 A;  2WWZ A;  3RMK C;  1OQQ A;  1E6E B;  2DHZ A;  4IWO A;  3VAW A;  2H88 B;  1JWM D;  3HUI A;  3B0A A;  2KAJ A;  1SE9 A;  3WA0 A;  3UGB B;  3CF4 A;  1TT5 B;  3IFW B;  3L08 A;  5C23 A;  3AEA B;  3KLS X;  1MHH E;  1F77 A;  1PYW D;  1HZ5 A;  2BGF A;  2M0X A;  3BIN A;  3EEC A;  2EKI A;  1C3T A;  2C5L C;  2NBW B;  3VUY A;  2FUH B;  3TL5 A;  2DBY A;  4YTN B;  3VDZ A;  1L7Y A;  2JYT A;  4BKG A;  2R61 A;  3HK0 A;  5FR6 A;  5D3D A;  1IGD A;  2WXP A;  1WIA A;  2NPT B;  4GOC A;  5CTR C;  2QJL A;  2BKF A;  1NVI D;  3MP9 A;  1J0G A;  1NI2 A;  3NZ3 A;  1TZ1 A;  4NY0 A;  4NAW A;  1WX9 A;  4FBJ B;  4PS7 A;  4PS3 A;  2WXN A;  4ZDV A;  5AZF A;  1FD6 A;  4ARI A;  3DVN U;  4HPM B;  1EO6 A;  3P42 A;  3NG0 A;  1MPE A;  2BYV E;  2QIE B;  1EU3 A;  1WXV A;  4TQ1 A;  2DZJ A;  3ZNI D;  1CJE A;  4XGA B;  3BII D;  2BBC A;  2YEP B;  1V1O A;  3TEW A;  1ZGU B;  2DLB A;  3U52 E;  2LEK A;  2PE9 A;  2ASQ A;  4HDO A;  1L0V B;  5HI1 A;  1SIF A;  2LXC A;  2GRI A;  2ZZP B;  1QOG A;  2KMM A;  1EUV B;  1QZE A;  1GUA B;  1D4B A;  4ITK A;  1NYR A;  1NEN B;  2J4X A;  2JZP A;  4CQN A;  1GC6 A;  3I9V 1;  2KK8 A;  4EKU A;  2L76 A;  4FUL A;  1E9M A;  1VZ8 A;  1AAR A;  1WM2 A;  2ZCC A;  1M4V A;  2N7J A;  2KOX A;  3CST A;  2BVC A;  2ONQ A;  4JX1 C;  3AE9 B;  2L1A A;  4BVU C;  2KX3 A;  2XNA C;  3NY5 A;  2KMC A;  4NJC A;  2AYO B;  1WZ0 A;  2JVC A;  4TSS A;  1YIW A;  4NZL B;  4ANW A;  4FN2 A;  5FK9 C;  2ZNV C;  2HJ1 A;  2WU5 B;  2BYF A;  3Q2A C;  2INP E;  2BS4 B;  1VRA B;  4RF0 A;  1NI3 A;  4KV2 A;  4OVU A;  3KW5 B;  1PFD A;  3WAO A;  2Y5B B;  2KN4 A;  2N0S B;  2JX5 A;  4GDK A;  2C7N B;  1WJU A;  3AE5 B;  4E3C A;  2JQR B;  3QCA A;  3RZW C;  2D10 A;  2QEJ C;  3RNF C;  1YMH E;  1E7V A;  3AEF B;  4KGS A;  3I3T B;  2J0M A;  1P1A A;  3Q8A A;  3Q3F A;  1N5X A;  2L52 A;  3B9J A;  4ICU A;  3HVZ A;  2D07 B;  1SB3 C;  2MSE D;  4JIO U;  3T3O A;  2ACZ B;  4P1C C;  3R66 C;  3FIL A;  3VTW A;  4NNJ B;  1D5X C;  2KDE B;  1I4P A;  1WXQ A;  2Z59 B;  3AN1 A;  1J19 A;  2ICI A;  1P7F A;  5EE9 A;  1TKE A;  1UBQ A;  3RNE C;  3I57 A;  3W1S A;  3HVD A;  2CR5 A;  3H7S A;  2KZR A;  4MGK E;  2KAC A;  2RMM A;  3VRB B;  4YSY B;  4GMV A;  3ZQ4 A;  3IXS A;  3M62 B;  1PGA A;  4G11 A;  2N9L A;  4HLE A;  2QMT A;  2KNB A;  1ISN A;  2V9H A;  2LUM A;  1LXD A;  4K7W A;  3IAS 1;  5FR3 A;  4J3O D;  2IND C;  2IYD B;  4EFO A;  1C1Y B;  4OW0 A;  3ZIM A;  2PMV A;  2A5U A;  2DZI A;  4OVZ A;  2E3T A;  2JZ3 B;  2JUO A;  3OAW A;  4NPN A;  2KVZ A;  2V3P A;  4YXD B;  1UH6 A;  1L2N A;  3U4E G;  5HKH A;  5D6J B;  2MHJ A;  1GTH A;  3MC8 A;  2NBU A;  1ZXH A;  3AXC A;  4JGH B;  2IJ0 A;  2K3U A;  1FFU A;  5J2R A;  2IO1 B;  3BVZ A;  1J7A A;  2FBW B;  1J8C A;  3ML8 A;  1N61 A;  3QX1 A;  1V8C A;  1ZOY B;  4FLH A;  4D2K A;  3Q8B A;  1E8Y A;  1QT9 A;  1GB1 A;  3NUH B;  1SSN A;  4KGR A;  4GGQ A;  5DPW A;  2WXI A;  2LVO A;  1XLN A;  2N9X A;  3EFC A;  4G0N B;  1V5O A;  4K3B A;  4EE2 A;  4W9J A;  1YN5 A;  3Q14 C;  3PZD A;  4MM3 B;  4XDC A;  3IG3 A;  2YVC A;  1XD3 B;  3KQ4 A;  2WNM A;  5E6N A;  5JH5 C;  3BZD B;  1XLO A;  2JYE A;  3AE4 B;  1C77 A;  2MWS B;  1DGJ A;  1I7H A;  5D3I B;  1FCC C;  4RGN A;  2GBR A;  4C56 C;  4BKT A;  2JPH A;  3BWU D;  1IUE A;  1WGY A;  2MCN B;  5JHB A;  3R7Q A;  4BAX A;  3GE8 C;  4KVG B;  2EKE C;  2KDM A;  3VFK A;  2CU3 A;  3HHM A;  2KVR A;  4KSL C;  4YT0 B;  2AWT A;  1TJE A;  2VRR B;  4RGM A;  3N1Y C;  1L4D B;  3R7R A;  4BZA A;  5BYR A;  3IBE A;  4URK A;  5DPT A;  2H89 B;  4CO7 A;  3U8Z A;  3UI3 A;  3PRZ A;  2DZK A;  3PGE A;  1K53 A;  2LGS A;  1XCT L;  3NVW A;  1Y8R C;  3LB8 C;  2DYO A;  2RR9 A;  4DHZ B;  3KYD D;  2JWU A;  1FPY A;  3APF A;  4YTP B;  1IPG A;  1EM7 A;  1LQB A;  4RCO A;  2HE7 A;  4YSX B;  4W9L A;  4IW0 A;  1JAL A;  2Z8L A;  1WH3 A;  3N32 A;  3EC8 A;  2N7D A;  5HFY A;  4W9E A;  2AQ1 B;  2MH7 A;  4XC2 A;  2SEB D;  3NOB A;  1MFW A;  2GMI C;  3QQ8 B;  4JL9 A;  2WXR A;  1N6Z A;  1A70 A;  2AQ2 B;  1T0Y A;  2O2V B;  4I6N B;  5JHA A;  1FNV A;  4A8X C;  4A6Q A;  3AH7 A;  1YNT E;  1GTE A;  3DBR B;  3CMM B;  1JW9 D;  3RUL A;  1TS4 A;  2QDF A;  2KFK A;  1C78 A;  5LLI A;  3ZGZ A;  1LGR A;  1KFY B;  4A9A A;  2O6V D;  1V2Y A;  2KTR B;  2E6X A;  3QC8 B;  3ZYY X;  5BMI A;  1L0Y B;  1J7C A;  2WDQ B;  3P4P B;  2NMQ A;  4HEA 1;  4LDT D;  3WCQ A;  2LD9 A;  2G4S A;  2V3S A;  4LTU A;  3SD5 A;  3Q8F A;  3QHT A;  2NTT A;  1KTK A;  5IOI A;  1OEY A;  5EE0 A;  4F8C B;  4ANU A;  1OQR A;  1HTO A;  3AU5 A;  3AI5 A;  4K1R B;  4TUU A;  3RT3 B;  2PVO D;  2GBN A;  1JWU D;  1I35 A;  2GB1 A;  1JQ4 A;  2KTR A;  1A5R A;  1HQR D;  4OVV A;  4ZYN A;  2FCN A;  4RMA A;  3PZ7 A;  1TGZ B;  4US8 A;  4WUR A;  2MBQ A;  4HKQ A;  2V3N A;  4G50 A;  5DCN A;  2FAZ A;  2PKO A;  1FXA A;  5E6O A;  2EEL A;  3AE6 B;  1I4G A;  4RNA A;  3ZO5 B;  3P63 A;  3SDL C;  2CU1 A;  1BT0 A;  4MDK E;  3CSF A;  4RGO S;  1N63 A;  5LNK 1;  3WAL A;  3ZRF A;  2R2O A;  2M0A A;  1Q0W B;  1JWB D;  4W9D A;  1C4A A;  2L32 A;  2L3Z A;  2QIL A;  1EWY C;  3VXW A;  2HJ8 A;  2WXO A;  1HTQ A;  3H8H A;  2MLB A;  3BK1 A;  2QCZ A;  3GB1 A;  3H1U A;  3B08 A;  3APD A;  4ZRK A;  2MJ3 A;  2D3B A;  1ZW7 A;  2BB5 A;  2NR2 A;  1GAQ B;  1P3Q U;  4YWG G;  3A4R A;  2BS3 B;  5BMH A;  4IG7 B;  4I6P A;  2GI9 A;  3RD2 A;  3ONS A;  3L4P A;  4LNK A;  3UIO B;  2K25 A;  4WQM A;  3GS2 A;  3B1L X;  1V81 A;  3ECI A;  3ML9 A;  3LXF A;  3NVY A;  2ZCB A;  3TUO A;  3LYY A;  4B95 A;  3ZTC A;  1TBE A;  4OZB A;  3ZJT A;  2N9P C;  2J0K A;  1BML C;  4HXD A;  3A9K B;  2MBO A;  3I63 C;  3PVL A;  1TYG B;  3DWG C;  3NHE B;  1KLU D;  3ZXR A;  4MAC A;  1TKY A;  2XN9 C;  1QLB B;  2WYQ A;  2N9E B;  4WJQ A;  1H7X A;  3H6N A;  1VZ7 A;  1SIJ A;  1UWM A;  1YQB A;  4HCP B;  1C79 A;  4MJS A;  1UWX A;  2NBV B;  4TV3 A;  2J53 A;  4IM0 A;  3ZW3 A;  2VH2 A;  1Q10 A;  1F2R C;  2KQS A;  4MGZ E;  5HG2 A;  5IA7 A;  1R4N I;  4DQO C;  5TR5 A;  2IGD A;  1ESF A;  3ZNH B;  3OLM D;  1FRR A;  1YD8 U;  2WLB A;  3P4S B;  1R4M I;  3E9S A;  3Q3O C;  3LJ3 A;  3L13 A;  3SR6 A;  2PLP A; 
#chains in the Genus database with same CATH homology
 1XCQ L;  3R8B A;  3T3O A;  1AYF A;  1RM6 C;  2ACZ B;  3MHZ A;  2D5G A;  2W3S A;  3FIL A;  1KH0 A;  1D5X C;  2Y5P A;  2VZK B;  1I4P A;  1WXQ A;  2TSS A;  1WSP A;  1DOY A;  3AN1 A;  2ICI A;  2HTM E;  1P7F A;  1MI0 A;  3PZ8 A;  4NAM A;  5G5G A;  5EE9 A;  1TKE A;  3W1S A;  4C7Z A;  5C3J B;  1VJK A;  3I57 A;  3HVD A;  1ZDX A;  5T8I A;  4HRO A;  4B0E A;  1STE A;  1QF6 A;  1JML A;  2KAC A;  4MH8 A;  2RMM A;  3VRB B;  4YSY B;  1FEH A;  3W5U B;  1PDX A;  4RF1 A;  3ZQ4 A;  2HDE A;  3MFG A;  1R7S A;  3IXS A;  1PGA A;  1IBX B;  3NS1 A;  2N9L A;  3VQI A;  2QMT A;  1SE3 A;  1E10 A;  2LUM A;  3IAS 1;  5FR3 A;  1PGB A;  4H2A A;  4J3O D;  3E56 A;  1YN4 A;  1GT8 A;  2W3R A;  2Q5W D;  2RDG A;  4OW0 A;  2PMV A;  1TZO A;  4ZOH C;  1NYQ A;  4TMA B;  4TQ0 A;  1XO3 A;  1SF0 A;  1ZP0 B;  1QIL A;  4OVZ A;  1LO5 D;  2E3T A;  2ZW1 A;  2WXF A;  2M56 B;  2DWQ A;  2V3P A;  4ZHO A;  4YXD B;  3SEB A;  3EUB 2;  3U4E G;  1VZ6 A;  1GTH A;  1SJH D;  3RPF C;  1UUP A;  2PTL A;  2Y5C A;  4WWM A;  1N5W A;  1ZXH A;  5G5H A;  1AN8 A;  2IJ0 A;  1C4P A;  2K3U A;  2ON8 A;  1C9F A;  1FFU A;  2JU6 X;  1E0Z A;  3N9Y C;  3BVZ A;  1J7A A;  2FBW B;  2AX5 A;  3VR9 B;  2WXJ A;  1N61 A;  1V8C A;  5EE3 A;  3TEY A;  3AEE B;  2NTS A;  1ZOY B;  1XF5 L;  1DOX A;  1ROE A;  2FE8 A;  3SFD B;  4IOI E;  4D2K A;  3Q8B A;  2V0G A;  1QT9 A;  4KKI A;  3W9C B;  1GB1 A;  3B2F A;  3NUH B;  1SSN A;  4KGR A;  4OZC A;  1K52 A;  1QQR A;  4C7Y A;  3IT4 B;  3EGR A;  5H92 C;  2WDR B;  3C8Y A;  1B1Z A;  2WXI A;  1XLN A;  4L2Y A;  5BYQ A;  3ETR A;  2LHE A;  3P1M A;  2BT6 A;  1HZ6 A;  3TEX A;  3CIR B;  4EE2 A;  4HJG E;  1YN5 A;  2W55 A;  4MM3 B;  4XDC A;  4R3D A;  1FM0 D;  3W5V B;  1SE2 A;  1J7B A;  3KQ4 A;  4N58 A;  1ET6 A;  2WNM A;  4AQ7 A;  2Y3A A;  3BZD B;  4US9 A;  1TS3 A;  1XLO A;  1L6U A;  2JYE A;  2G1E A;  2RPV A;  4USA A;  1TKG A;  3AE4 B;  1SJE D;  1XXG A;  1C77 A;  2B76 B;  4YTM B;  1DGJ A;  1HXY D;  1I7H A;  1ZXI A;  1WYG A;  1JCK B;  5D3I B;  1FCC C;  4RGN A;  1KLG D;  4ZRQ A;  4JPS A;  3P4Q B;  2PIA A;  2YEP F;  3AB5 A;  4C56 C;  1TS2 A;  3KWL A;  4FXC A;  1FIQ A;  3T3N A;  3NVZ A;  3BWU D;  1IUE A;  1SE4 A;  2LJI A;  1YN3 A;  1D5M C;  2MJD A;  3AEC B;  1V1P A;  3FC4 A;  1RWS A;  4LK0 M;  2BYT A;  4DXG A;  1PUT A;  4N6E B;  1AW7 A;  2WXL A;  4NAW B;  3ZJU A;  4HRS A;  4ZRP A;  2WDV B;  1L0X B;  1XLQ A;  2CJO A;  4P16 A;  5AUI A;  1BUI C;  2KDM A;  3NVV A;  1WWT A;  4ARC A;  2CU3 A;  1GB4 A;  4L23 A;  3AE1 B;  4YT0 B;  1TJE A;  1E7P B;  1SEB D;  3J9C A;  4RGM A;  1C4C A;  1L4D B;  3PO0 A;  2X38 A;  1RFK A;  4IDI A;  5BYR A;  2N9K A;  2OED A;  5C2T B;  1D5Z C;  4RFB A;  5D7G A;  2LMC A;  2M19 A;  2H89 B;  1SBB B;  5AUK A;  3UI3 A;  5H8Y E;  4AS1 A;  1FXI A;  1K53 A;  1GOZ A;  4JE3 B;  1XCT L;  3NVW A;  1JRO A;  3LB8 C;  1B9R A;  2DYO A;  3URY A;  1I4Q A;  2JWU A;  2LHD A;  3GP7 A;  4YTP B;  1EM7 A;  2DYM A;  3BK2 A;  1ZE3 D;  4Q2J A;  4B0M A;  1WRI A;  3ABV B;  2KQ4 X;  4KGT A;  4RCO A;  3FAH A;  1KRH A;  1HA5 A;  4YSX B;  4ZYS A;  2MJE A;  1JRP A;  1N62 A;  2WXH A;  4L1B A;  2INN E;  4YSZ B;  2WQY B;  1WGK A;  1JAL A;  2Z8L A;  2RDH A;  3EA6 A;  5MPO A;  5HFY A;  2BB6 A;  2WP9 B;  1QOF A;  2AQ1 B;  2MEK A;  2MH7 A;  2WU2 B;  4P6V F;  4A55 A;  2SEB D;  4RH6 A;  3BYY B;  1PGX A;  1DOI A;  2LGI A;  4GDL B;  1Y56 A;  3W2D A;  2J42 A;  2L83 A;  2I38 A;  3Q8C A;  2LFI A;  4O1N A;  5E6J A;  2WXR A;  2OHF A;  3BVG A;  1A70 A;  3IT6 B;  3AV8 A;  1ET9 A;  2VZK D;  2AQ2 B;  4C80 A;  2IPK D;  1ZDV A;  2PVG C;  3AED B;  1QOB A;  5TSS A;  3AE7 B;  1L4Z B;  1TY2 A;  1YQ3 B;  3AM9 A;  1MVK A;  2JSV X;  1V97 A;  1FNV A;  4A8X C;  1N60 A;  4A6Q A;  3VR8 B;  1YQ4 B;  1HEZ E;  2IDY A;  3AH7 A;  1T5X D;  4KX6 B;  1YNT E;  1GTE A;  1KF6 B;  3FIL B;  1JW9 D;  1TS4 A;  2BW2 A;  2WS3 B;  1K51 A;  1XLP A;  1FRD A;  1C78 A;  4WAF A;  2V4I B;  3ZGZ A;  1VLB A;  2K5P A;  3TSS A;  3KWV A;  1EU4 A;  4XWW A;  1KFY B;  2AQ3 B;  4A9A A;  3MC0 B;  2PW9 A;  2E6X A;  1OQQ A;  3ZYY X;  1ACC A;  5BMI A;  1FO4 A;  1L0Y B;  1SXT A;  1IGC A;  1V1P B;  1J7C A;  1E6E B;  2WDQ B;  3U7Z A;  3P4P B;  3MJ5 A;  2NMQ A;  4HEA 1;  2H88 B;  1JWM D;  3WCQ A;  3HUI A;  2KAJ A;  3R2I A;  5GXG B;  4LTU A;  1D6E C;  1QOA A;  1UGJ A;  3Q8F A;  2W82 A;  1RYJ A;  3CF4 A;  1QKZ A;  2NTT A;  1FNW A;  1KTK A;  4LLG M;  3AEA B;  3O13 A;  2JXT A;  3KLS X;  1MHH E;  1F77 A;  1PYW D;  1HZ5 A;  5EE0 A;  1P7E A;  1L6V A;  3SR6 A;  1OQR A;  2EKI A;  1TY0 A;  3Q69 A;  2PVO D;  2K22 A;  2DBY A;  4JWS C;  4YTN B;  1JWU D;  4PT5 A;  2JYT A;  2GB1 A;  3Q8E A;  1I4X A;  1JQ4 A;  2R61 A;  2I2Y A;  3AEG B;  5EE1 A;  1OFF A;  1I4R A;  3RFZ B;  1GPX A;  1HQR D;  5D3D A;  1ZPS A;  4GDK B;  3PZ7 A;  4US8 A;  3DWM A;  4WUR A;  2SAK A;  3OWE B;  3U2S C;  1XEE A;  3HRD D;  4HKQ A;  1IGD A;  2V3N A;  2WXP A;  2PKO A;  1FNU A;  1FXA A;  3P4R B;  3ZJV A;  2QJL A;  2EEL A;  3AE6 B;  1I4G A;  4MT5 A;  4RNA A;  3P63 A;  3R2T A;  2G9H D;  2BTE A;  1NVI D;  1ENF A;  3MP9 A;  1L5P A;  3NZ3 A;  4IKG A;  1VR9 A;  1CQV A;  1F0Z A;  1K50 A;  1N63 A;  4RGO S;  5LNK 1;  2WXN A;  1TS5 A;  3NRZ A;  1CZP A;  1T3Q A;  3CWI A;  2BS2 B;  1FD6 A;  4A90 A;  4ARI A;  2M0A A;  3P42 A;  1JWB D;  1MPE A;  1C4A A;  2L32 A;  2QIE B;  3IAM 1;  1EU3 A;  2QIL A;  1EWY C;  4TQ1 A;  2WXO A;  5HHD G;  1CJE A;  2WXM A;  1DYQ A;  3BII D;  3H8H A;  1JWS D;  4WIP A;  2BBC A;  2YEP B;  1V1O A;  3BK1 A;  2DLB A;  3TEW A;  1FFV A;  5I4D A;  3U52 E;  3GB1 A;  4ZHP A;  2LEK A;  3BVM A;  3AE2 B;  4M0W A;  2MJ3 A;  3V05 A;  2BB5 A;  4XDD A;  1L0V B;  3SFE B;  1GAQ B;  5HI1 A;  3TEZ A;  2GRI A;  1NEK B;  4YWG G;  1QOG A;  2WXG A;  2KMM A;  2BS3 B;  1EWC A;  5BMH A;  1D4B A;  2GI9 A;  4ITK A;  1NYR A;  3L4P A;  1NEN B;  2J4X A;  2J52 A;  2JZP A;  4CQN A;  4KKJ A;  1I4H A;  3I9V 1;  1YJJ A;  4WQM A;  3GS2 A;  1YJI A;  1FMA D;  4N59 A;  1MHX A;  1BXT A;  1E9M A;  2WXK A;  3LXF A;  3NVY A;  3TUO A;  3V3X A;  3LYY A;  1C76 A;  1VZ8 A;  4JWU C;  1M4V A;  2N7J A;  5JXV A;  1VDV A;  4OZB A;  4XWT A;  1F2R I;  2KWD A;  1JWA D;  4GLS C;  2QSD A;  3ZJT A;  2ONQ A;  4JX1 C;  3AE9 B;  4OZA A;  2L1A A;  2W54 A;  3AE8 B;  2XNA C;  1BML C;  2ZW0 A;  4NJC A;  2CJN A;  4TSS A;  1H7W A;  4NZL B;  5FK9 C;  2WU5 B;  1TYG B;  2IGG A;  3DWG C;  1KLU D;  4MAC A;  1TKY A;  2INP E;  2BS4 B;  1VRA B;  2XN9 C;  4RF0 A;  1QLB B;  1NI3 A;  1H7X A;  1VZ7 A;  1PFD A;  4UDU C;  1FCL A;  2WXQ A;  1SIJ A;  4HKZ E;  2IGH A;  2KN4 A;  2N0S B;  1UWM A;  1ZUD 2;  2JX5 A;  4OHJ A;  1IBX A;  5BMG A;  5FKA C;  1C79 A;  3AE5 B;  2JQR B;  1UWX A;  2J53 A;  4RGT A;  1T6B X;  2QEJ C;  1UNS A;  1YMH E;  2K0P A;  1AWD A;  1Q10 A;  3AEB B;  1F2R C;  3AE3 B;  4XE0 A;  5HG2 A;  3AEF B;  2K9X A;  4DQO C;  4KGS A;  3Q8A A;  2IGD A;  1ESF A;  1N5X A;  1FRR A;  3VRA B;  2L52 A;  3B9J A;  2WLB A;  3P4S B;  1CK1 A;  3HVZ A;  4DXF A;  3E9S A;  2FUG 1;  5BYS A;  3BYT B;  4WH4 A;  4REZ A;  1SB3 C;  3B2G A;  3AMZ A;  2PLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...