3W9CB

Crystal structure of the electron transfer complex of cytochrome p450cam with putidaredoxin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Camphor 5-monooxygenase
publication title The Structure of the Cytochrome P450cam-Putidaredoxin Complex Determined by Paramagnetic NMR Spectroscopy and Crystallography.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3w9cB00
3AE8B 2BS3B 3AE4B 4ITKA 3VRBB 1FRRA 1XLPA 1V97A 3AE3B 2LEKA 1ZP0B 1QLBB 1YQ4B 3LB8C 4WQMA 3SFEB 1NYRA 5C3JB 2K5PA 1RFKA 3AEFB 5G5GA 2DWQA 3VRAB 2Y5CA 1QF6A 1KRHA 1TYGB 1XLNA 1PUTA 3AE7B 1PFDA 3CIRB 3W5UB 1CZPA 1QOGA 1YJJA 1N60A 1QOAA 3AN1A 1FXAA 2G1EA 3AMZA 4N59A 3SR6A 2WDRB 1JQ4A 4JWSC 1RWSA 2QIEB 3NVYA 3VR9B 4C7YA 2CU3A 2FBWB 1E9MA 1NI3A 1QT9A 1RYJA 2CJOA 1N5XA 3AE5B 2M19A 2WU5B 3P4QB 3NS1A 3P4RB 3W5VB 3AE1B 2MH7A 1B9RA 3AE9B 4YTNB 1FM0D 1XLQA 5H92C 4ZHOA 1F0ZA 3NVWA 1E6EB 1UWMA 1JWBD 1V8CA 4YXDB 1J7CA 1FFUA 2ACZB 2JQRB 4JWUC 1FXIA 4N6EB 2L83A 2WQYB 1NENB 5EE9A 3AE2B 1DOXA 1TKGA 1VLBA 2W55A 3HUIA 1JRPA 3AH7A 1NEKB 1YJIA 3AM9A 2HTME 5EE1A 2WLBA 2MJDA 4FXCA 2WS3B 3NVVA 5EE0A 1L6VA 2KMMA 1VDVA 1NYQA 1ROEA 2WDQB 5GXGB 1SIJA 1N5WA 2BT6A 4US9A 5AUKA 5H8YE 3ZYYX 2B76B 3AE6B 1SF0A 2PVGC 3KWLA 5C2TB 3FAHA 1FIQA 3AB5A 2WU2B 1JROA 3LXFA 4YSYB 1FO4A 1FRDA 2QJLA 3DWGC 1JW9D 3FC4A 1DOIA 4YT0B 1GAQB 1ZUD2 1A70A 4P6VF 1EWYC 1N61A 1OFFA 3HRDD 2MJ3A 4C7ZA 4IDIA 4YTPB 3AEAB 2AX5A 5G5HA 4C80A 2M56B 1AYFA 3AEEB 1L0VB 1N62A 3AEDB 4ZHPA 1R7SA 2MJEA 1QOFA 4YTMB 1OQQA 2H88B 1JALA 1JWAD 2K9XA 4KX6B 1GPXA 1I7HA 1QOBA 4JX1C 3BIID 2BS2B 1N63A 2PIAA 4LTUA 3P1MA 3VR8B 1WXQA 3ETRA 2KAJA 3HVZA 2H89B 5EE3A 3AV8A 4WWMA 2W3RA 1KFYB 1OQRA 1RM6C 1E7PB 1WYGA 2L52A 3AEBB 1NVID 2CJNA 4YSZB 3P4SB 2PKOA 2JX5A 2W3SA 3B9JA 1WRIA 3B2FA 1PDXA 3P63A 1WWTA 1E0ZA 1TKYA 1FMAD 1L6UA 1WGKA 2BS4B 3ABVB 1YQ3B 3L4PA 3B2GA 1XO3A 2K22A 1SB3C 2WDVB 3AECB 1TJEA 3NRZA 3DWMA 3RPFC 1TKEA 1J7BA 4ZOHC 5AUIA 4YSXB 3AEGB 2OHFA 5MPOA 3NVZA 2Q5WD 4A9AA 1IUEA 1KF6B 2N0SB 2E3TA 2PVOD 1AWDA 3EUB2 4US8A 4HRSA 4N58A 1DGJA 2DBYA 3P4PB 3PO0A 2WP9B 1E10A 3SFDB 1DOYA 1ZXIA 1ZOYB 1J7AA 2EKIA 3W9CB 1CJEA 1T3QA 1L5PA 3WCQA 2W54A 4HROA 3CWIA 4USAA 1VJKA 1XLOA 1FFVA
chains in the Genus database with same CATH superfamily
3OJ4B 4B0EA 3TSSA 1WXAA 2N9LA 4DHZE 4G0NB 1MHHE 3UI3A 2QIEB 3R66C 1WY8A 2K8BA 1KOTA 3JW0X 4IC7B 1I4GA 3A1QB 3QX1A 1WM3A 3EECA 4D2KA 4GSWA 2WQYB 3AE2B 1DOXA 5DPRA 1KM7A 1V86A 2KJ6A 2PJHA 2CHZA 1NEKB 5E6OA 3GZNI 4TSSA 3W1SA 1SE9A 5IP4D 5H8YE 2ASQA 3WANA 4AP4C 1EUVB 4DBGA 1IYFA 1R4MB 4C7ZA 1I4XA 2AX5A 4HCNB 1E8ZA 1NI2A 1Q0WB 2LUMA 5IA7A 2H88B 2V1YA 2E6XA 3J9CA 4HCPB 1MPEA 4WWOA 4ANXA 4DDGD 1LGRA 4LNKA 3IT6B 2N9EB 4ZRJA 4AQ7A 3P2BA 3R2IA 4YSZB 3MJWA 4NAWA 3OWEB 1WXVA 2K6DB 4E74A 4M02A 1PGBA 1ET6A 3R7QA 2WDVB 1E8YA 1FNUA 3IAS1 1J7BA 3V60A 2MQJA 1V80A 2JWUA 2WNMA 4BAXA 2N7EA 2WXQA 3EA6A 2XNAC 1KF6B 2QC8A 3CMMB 2CHWA 1ZE3D 2KVZA 3H7SA 1T3QA 3BVGA 2HE7A 4MT5A 3VHTC 2N7DA 3AE4B 2IO0B 5DPTA 3Q3MC 3X0WA 2N1WA 3AEFB 2DWQA 4IM2A 1V81A 1WX7A 1EU3A 1PUTA 3M63B 2LVPA 2OEDA 4XC2A 3SR6A 2NTSA 3FILB 1UGMA 5AZHA 3RZWC 1MVKA 2MBBB 3GZNB 2C9WB 4XE0A 5I4DA 5D7GA 2R61A 5D3IB 2K39A 2YLMA 2VH2A 2KC1A 4H2AA 3ZO5B 1IP9A 4K7SA 2ACZB 2JQRB 3BINA 4OVVA 3LDZE 4KKIA 3N32A 2YEPB 3DQVA 5J18A 4AJWA 2B76B 1F1HA 4YSYB 1GB4A 4C56C 5L83A 4MGIE 3DHHC 4IUMB 3Q69A 3AEAB 4REZA 1XCQL 3E9SA 1KLUD 1N62A 1R7SA 1QOFA 1WI0A 1OQQA 2N1VA 3IFWB 3EHVA 3APFA 4MSQB 1WXQA 2KTRB 2W3RA 4HDOA 2WXGA 3VUXA 4LLGM 1YX6B 1STEA 2XK5B 2BS4B 3IT4B 1HA5A 2K22A 2SAKA 3NRZA 3DVGX 3DBRI 3ONSA 5MPOA 1S1QB 1F52A 3CF6E 4HPPA 1E10A 2DBYA 3ZW3A 3W9CB 3WCQA 2FNJB 1SEBD 1T5XD 4KIKA 1VJKA 2KHWB 4GDLA 3VRBB 2LEKA 4PS3A 3TEWA 1BUIC 5G5GA 3RD2A 3I57A 1JWSD 3ENEA 3AULA 2BWES 1KH0A 2MP2A 1GC6A 1Q5WB 2INDC 4XDDA 3X23A 1OGWA 2BYFA 3W5VB 2J0KA 4DDID 1UGJA 4HWIB 2ZVOA 3ZNHB 1WZ0A 3VUYA 1WZ3A 2BKRB 1E8XA 1WGYA 4LCDE 2KDEB 1Z2MA 1L4DB 4B0MA 5EE0A 2HTHA 3L16A 3CSTA 5BMIA 2ZPNA 5CHFA 3GS2A 2A5UA 2MSED 3ZUNA 1CQVA 5HKHA 2I1JA 1P0RA 4IM0A 2CS4A 4YL8A 3TL5A 5IN7A 1ZUD2 2CHXA 1SE3A 1GJZA 2KFJA 2JVCA 4W9HA 4N9F4 5LXIB 2IY0B 4EEWA 3A33B 3KYDD 2G4DB 1ZDXA 1VZ7A 3A9JA 2AQ3B 4XGAB 2RDBC 3D32A 1MG8A 3AECB 2Z59B 4AWJA 1L2NA 2CU1A 3TCAA 5GMVA 2BTEA 4B9KA 3IVFA 3BWUD 1ZXIA 1IGCA 2DZKA 3H7PA 3JVZX 1FRRA 3KUDB 5J17A 1WJUA 1PYWD 2WXKA 3PGEA 2K6QA 1XT9B 3Q3OC 2J7QB 2RPQA 2OJWA 1TGZB 1CZPA 3P42A 2NMQA 2ZW1A 4C7YA 1NI3A 2WGSA 2IBIB 2M4NA 2WU5B 1UUPA 3GE8C 4KSLC 3PS6A 4RH6A 2DAJA 1RFAA 2ZNVB 4NZLB 2INCC 1SJHD 4EZLA 2Y3AA 3RNFC 4QAYA 4WURA 1NYQA 3MP9A 4HXDA 1YD8U 2LUEA 2BGFA 3WA0A 1V1PA 4OVZA 3UF8A 4IWPA 2M17A 4NNJB 1DOIA 3JSVA 3NY5A 4LDTD 2KVRA 5LNK1 4P7IA 1HQRD 2IY1B 1WXMA 3S2AA 3U2SC 1L0VB 2XN9C 5FR6A 4DHZB 1NVID 4K7UA 1GNUA 2GBJA 3P63A 2LVQA 1WJNA 1XO3A 1SB3C 2I1KA 4W9KA 2W9NA 4PS8A 1TBEA 1KLGD 5FKAC 1DYQA 3A9KA 3NVZA 3UIPB 1NBFC 2O2VB 2WX0A 2GI9A 5HG2A 1WGRA 4GB9A 4HJGE 2V3NA 1F77A 1L5PA 3VUWA 2AL3A 1UBIA 3DOWA 4UDUC 2K1FA 1NYRA 2AWTA 4JGHB 2L7RA 3BYTB 1PFDA 5AZGA 3NG0A 1E5WA 1T0QC 2D11A 3RNCC 4WWNA 3P4QB 3PRZA 4ANUA 1Y56A 3WALA 3KWVA 4NJ6A 4WJOA 3JYUA 1V5OA 3PHXB 3RT3B 1FFUA 1XD3B 3MC0B 2WWZA 4FXCA 3L54A 4DK5A 1L6VA 2WXRA 1IBXA 2L00B 4DXFA 1N5WA 5AUKA 4BKTA 1SF0A 1WX9A 1ZXHA 4HK2A 5CTRC 4PYUA 2WU2B 4PK1A 4RGNA 2HD5B 4P6VF 5BMGA 4AUQC 1OFFA 3ALBA 1TT5B 5IAAC 2NTTA 4FJYA 4W9GA 1MHXA 1K52A 2K9XA 4MJSB 3QCAA 1D5MC 4M0WA 1F2RI 1HE8A 2LJ5A 1WYGA 4OW0A 2HJ1A 4II2B 4WJQA 5J2RA 3Q3JA 2FIDA 3DPDA 1P1AA 1Z5SB 3O65B 4ANVA 1D3ZA 1WE7A 3B08A 1VZ6A 5IOIA 2N0SB 2BWFA 4N58A 3C0RB 5IO9A 4K1RB 3ZDMC 4MGKE 3ZVVA 2JU6X 1XLOA 2J4XA 2LWPA 4ITKA 1XLPA 4KZ0A 2WX1A 3AXCA 1L7YA 4DHJD 2KKCA 1KRHA 2Y5BB 4EE2A 1QOGA 1QOAA 1V2YA 2X38A 2NCNA 2L8JA 1H8CA 2WXJA 4N59A 2G9HD 2WDRB 2NBWB 1RWSA 3N3KB 3CSFA 4I6LB 3AE5B 1EM7A 3L17A 2M19A 4M8NA 3P4RB 4L1BA 1C4CA 2K8CA 4WJPA 3RUIB 3O13A 1V8CA 4RNAA 1JWBD 3QK0A 4XWWA 2O6VD 1KLVA 3RFZB 2MX2A 1YQBA 2KFKB 5EE9A 1WJ4A 3QJZA 4KGTA 3N9YC 5EE1A 2KQ7A 2JYTA 3BK1A 1AW7A 4RCOA 4A55A 3NOBA 1NDDA 2DZIA 4B95A 1E8WA 2WXHA 1ESFA 1T0YA 2J0MA 3A4RA 4JIOU 1C3TA 2PW9A 4WWPA 4AOFA 1L0YB 2W82A 3AEDB 1WJ6A 1YNTE 2V9HA 3H6NA 1N63A 2VH1A 1XCTL 2LXCA 3I3TB 4FLHA 1I35A 3ETRA 3VVWB 3ZNZB 2D5GA 4EZKA 4FJZA 1YOVB 1UELA 2LZ6A 4NJCA 2UU7A 1FD6A 4W9LA 5BO4B 5AUIA 2KTFA 4LNOA 2YEPF 1M94A 4WIPA 1SIFA 1YMHE 4MGYE 2KT7A 3TBLD 2D3CA 3TEXA 1KJTA 2CR5A 1I4HA 4O1NA 5EDSA 3CWIA 4YTMB 4EZJA 2VRRB 1LQBA 2LVOA 1QLBB 1E90A 5IKCM 2K5PA 4W9IA 4EFOA 4C4VB 5G2NA 4OZCA 1EF1A 3HHMA 2WYQA 2JXXA 3R3MA 1VZ8A 1FCLA 4GU2A 3FKYA 1V49A 2HJ8A 4F7ZA 4ZRQA 5E6NA 5HFYA 2KQSA 3AM9A 4LNIA 1XEEA 1E7VA 4L23A 1Y8RC 3RZFA 2KMMA 4EOYA 2PVGC 1OEYA 3FAHA 4KKJA 3KQ4A 1I4RA 4LNNA 4KV2A 3QIJA 3KW5B 3MHSD 3OG5A 4MSMB 1Q1OA 2N9KA 1TS5A 1JALA 3OAWA 1SBBB 1I7HA 2X8XX 3BIID 3U4EG 3K9OB 4NAMA 1QILA 2DYBA 1MFWA 1OQRA 1TZOA 4ICVA 1D5ZC 3RNEC 1WR1A 3U7DA 1HTQA 1TKYA 4DXGA 4PS7A 1YQ3B 2ONQA 1LFDA 4MH8A 3NZUA 1TJEA 1QQRA 4FHKA 1J0GA 3KVFB 1FCCC 1MJDA 3AEGB 2JY6A 2FE8A 3WAPA 4RM9A 1VCBA 3P4PB 1J8CA 3ZNID 4GN1A 3I5JC 1WM2A 3IHPC 4HROA 3AE8B 3MTNB 1VD2A 4IW0A 5LLIA 3IBEA 1U4AA 4E3CA 1WMHA 1FXAA 1UBQA 1P7EA 2FBWB 3R7RA 1IGDA 2ZCCA 4GMVA 4ZHOA 1H4RA 2WXMA 4MM3A 4CQNA 2NVUI 3I63C 2ZNVC 2EELA 2JT4B 5KHQA 2PE6B 1Q10A 3BVZA 2IPKD 2REXA 2MHJA 2AL6A 1VDVA 4LDTB 1SIJA 2B3AA 5L95C 4IM3A 2O6VA 3V3XA 2KDMA 3LXFA 4KGRA 1L0XB 3FC4A 3DVGY 2JUOA 2MBHA 2WXNA 1A70A 3IG3A 4K3BA 4MDKE 2V3SA 2JF5A 3R8BA 4GIVA 4BKSD 2JZZA 3SHQA 1GPXA 4FN2A 1UF0A 1JWUD 4GGQA 4RGTA 3MFGA 3Q3NC 1VR9A 4ZRKA 1G6JA 3PREA 3Q8BA 3RULA 2DLBA 2UWQA 4NAWB 2IO3B 3B9JA 3PHWB 2ON8A 1GC7A 3NS8A 4LJOB 3GE3C 4W9DA 3RNBC 1F9JA 2OHFA 1WXSA 2PVOD 2QSDA 3K9PB 1P7FA 2L1AA 1HXYD 3DBRB 4RM8A 3UINB 3ZXRA 2BVCA 3APDA 3RNGC 2BS3B 1V97A 3SFEB 2UYZB 1M4VA 2N4FA 2BYTA 3ZQ4A 5LXHA 1D6EC 3Q6BA 1WGDA 1XLNA 4ACFA 2FCSA 3CIRB 2DX5B 2KX3A 2G1EA 1S3SG 2KMCA 1RYJA 1WH3A 3NS1A 5CHWA 1RAXA 2J52A 3ZNGC 3ECIA 1E6EB 4JWUC 3QHTA 2J42A 3BK2A 2J0JA 4JE3B 2WLBA 4K7WA 2MJDA 1A5RA 2C5LC 1LM8B 2KWDA 4ZRPA 3AI5A 1ROEA 1TTNA 3HVDA 3ZYYX 4US9A 3KH0A 1N6ZA 4GOCA 1FO4A 2JYEA 1FRDA 1GAQB 1YN3A 2IGDA 4IDIA 4YTPB 4WAFA 3PZ8A 1TS4A 4A6QA 1YJ1A 3GB1A 2Z8LA 2RMMA 2AEHA 3P1MA 4W9FA 2KN5A 3AEBB 2KWVB 2L52A 2JXTA 5D94A 4URKA 2V4LA 1WRIA 3NJTA 4G3XB 4KZCA 5HHDG 3ABVB 2MLBA 4P16A 1TY0A 1C78A 3OJ3A 3H8HA 4KDLB 1BMLC 4BVUC 1AWDA 5DPWA 2IZVB 3HM3A 5BYQA 3T9LA 3SDLC 5JH5C 1WYWB 1CJEA 4DHJB 2JRIB 4KIKB 1CK1A 3MC9A 1FXTB 4TV3A 4GDLB 2DHZA 2V0GA 1ZP0B 2AYOB 1I4PA 2LHEA 3LB8C 4WQMA 3RMKC 2C7NB 1RFKA 1TS3A 2BYVE 2R2OA 3VTWA 1WF9A 3VDZA 5D6JB 2EMSA 2MP2B 4RF0A 1BT0A 4ZRIA 3PVLA 2MEKA 1E9MA 2O6VB 2I2YA 3AE9B 4YTNB 1FM0D 1WGGA 3BZDB 2KX0A 1SE2A 1LXDA 5C1ZA 4YXDB 3DHGC 2L83A 1NENB 1T6BX 2L76A 2M0AA 3DBLI 3Q8CA 3HUIA 1YJIA 3N1XC 5AZFA 2NBUA 1K8RB 2QILA 1EU4A 1FPYA 2D3BA 1JROA 4TQ1A 4BKGA 1JW9D 4CYEA 1UD7A 2GBNA 3HRDD 1N61A 1F2RC 4TKNA 2A4ZA 3SU8X 4C80A 1C77A 1ZKHA 3Q8FA 4FADA 4ZHPA 5HI1A 4FHJA 4I6NB 4F8CB 4KX6B 3UQBA 3NZSA 1QOBA 4YWGG 2PIAA 3ML8A 2FIFA 3A9JB 3PRPB 2KDIA 3P4SB 2JX5A 2W3SA 3ZDTA 4RGMA 3DHIC 2ZJDA 4BKSA 2OOBB 1TS2A 4A3PA 3L4PA 2GRIA 2IO2B 3DCGA 4OZAA 4EUTA 1SE4A 2FCQA 1XXGA 2E3TA 2M0XA 1WR6E 3GOEA 3H7PB 2W54A 2QCZA 4XYCA 3KUCB 1RLFA 3DVNV 4ZYSA 3Q2AC 3AE7B 1C4PA 1YJJA 3Q3FA 3AN1A 1C1YB 3N1YC 3V05A 4JWSC 4NJ7A 1L4ZB 3FILA 1QT9A 2CJOA 2L0FA 4PYZA 3KYCD 3UGBB 3NVWA 4HEA1 2RGFA 4LNFA 4JLCA 1KTKA 1D5XC 2LFIA 3QA8A 4EKUA 3BYYB 1AARA 1LO5D 2W55A 3BVMA 2KZRA 3AH7A 3T3OA 5TR5A 4TQ0A 2L3ZA 2WDQB 2PE9A 2C7HA 1V1PB 2ICIA 2VZKD 3PRMB 3LYYA 1FIQA 5D2MB 3JSVB 3PV1A 3PZDA 1TIFA 4XZ4A 1MG4A 4HLEA 1FEHA 3B0AA 2EKEC 3TEYA 5D3DA 4JX1C 2NR2A 1X1MA 3QAQA 4A8XC 2AQ1B 2QDFA 2QMTA 3PZ7A 2KLCA 2LGXA 2KTRA 4FULA 2IDYA 2BBCA 2CJNA 2NS5A 4PT5A 2L32A 3M62B 1PDXA 1E0ZA 1WGKA 4MACA 2XK5A 1YN5A 3MJ5A 3RI7C 1TKEA 4ZOHC 3A9KB 2INPE 2KDBA 4JL9A 1GOZA 3RYTA 2WDTB 4HRSA 4W9JA 4OHJA 4F1SA 3NUHB 1ZOYB 3L13A 3WIMA 1UH6A 2L0TA 3TMPB 2BB5A 3KUZA 3AU5A 3QQ8B 4E71A 2D2QA 4S0RA 2KWCA 1ZW7A 3IAM1 1GUAB 2KOXA 1QZEA 1JQ4A 2GBRA 1OQYA 2CKHB 3PTFC 4WAAA 3EFCA 3IXSA 1B9RA 4ZDVA 2KJRA 5E6PA 2KLGA 2Z0EB 1UWMA 2V4IB 3A4SC 1RRBA 3U8ZA 3KLSX 3I9V1 5CX3A 4WJNA 2DENB 1IBXB 3W1SC 4ANWA 3V61A 3RNAC 3AE6B 1ISNA 3ZIMA 2KO3A 3ML9A 1PGAA 1SXTA 3DWGC 2RPVA 4YT0B 2RDGA 1EWYC 4GLSC 5G5HA 2M56B 3W1YA 1JRUA 3LJ3A 2WXIA 2D07B 4WH4A 1JWAD 1C4AA 4RGOS 1SSNA 2KYWA 1V6EA 1YX5B 2WXFA 2FCNA 4M0WB 2KK8A 3L0WB 3U7ZA 3R2TA 5EE3A 2C60A 2KD0A 4A3OA 5JHBA 2KN4A 3PLUA 3ZKJC 4BZAA 4NQKE 1ZGUB 3ZJUA 2LGYA 2M1MA 3DWMA 3PSEB 3PT2B 2NPTA 3AU4A 3OLMD 1IUEA 4ARIA 2OJRA 2K0PA 1JMLA 1T0RC 1DOYA 1C76A 2EKIA 2MWSB 2XBBC 2D3GA 4MELA 3EC8A 3WAMA 2DYMA 5C23A 3ZJTA 1T0SC 4RMAA 3VQIA 2Y5CA 1GG3A 2GBMA 1N60A 2L05A 3H1UA 1WRDB 2CU3A 2RSUA 1N5XA 2JPHA 4W9CA 5CHVC 3U52E 2MH7A 4ICUA 1YIWA 4I6PA 4AS1A 4IOIE 4N6EB 2N9PC 1EF5A 1R4NI 1ZPSA 5G55A 4KVGB 1JRPA 4P1CC 3APCA 3ZRCA 2LRUA 1PQSA 3N1ZC 2NBVB 1HZ5A 2GOWA 3VAWA 3SEBA 2LJIA 4KGSA 3AEEB 4IKGA 4NY0A 2KC2A 2LGIA 2K25A 2D3AA 3UQAA 2BPSA 3VR8B 2JZPA 2KDFB 1OTRB 3N20C 1HTOA 1C79A 4GDKA 1FMAD 1L6UA 3B2GA 2V3PA 2PLPA 2G4SA 1WFYA 4KSKC 2DNFA 4FA6A 3EFUA 3M3JA 3Q14C 3TIXA 2JZ3B 2O2VA 1DGJA 2I38A 2Y5PA 2WP9B 3U30A 2MCNB 1J7AA 2N9XA 3SD5A 2C7MB 2MW5A 1FFVA 5FR3A 1YQ4B 4XWTA 2LMCA 2QEJC 4CO7A 4G50A 1AN8A 2J53A 1K50A 1HEZE 2BQQA 1R4NB 3ZGZA 3N30A 4BFRA 5JZEB 4MGZE 1FNVA 3TEZA 2XEWA 2DAFA 2INNE 4LJPB 3HM6X 4FBJB 4DQOC 1TKGA 1VLBA 4IWQA 3QC8B 1ACCA 2PMVA 3MC8A 3RN9C 4IWOA 2WXLA 3NVVA 2RD0A 5JXVA 4DXAB 2GBKA 3PLVA 2QJLA 2N7JA 5DPSA 1JCKB 2BYEA 2KJHB 2ZEQA 3V6CB 3VFKA 1WX8A 5DCNA 2NPTB 2RDHA 2MJEA 4RFBA 2GB1A 2EMTA 4LTUA 4MJSA 3ZTCA 4WWMA 1KFYB 1RM6C 1E7PB 4BOSC 1EWCA 1SGHA 4BOZB 3W2DA 4NPNA 3B2FA 2MRPA 1E7UA 2SEBD 5JHAA 5E6JA 1TY2A 2KXJA 1K53A 4HPLB 4YSXB 5FK9C 3L08A 1QKZA 1WGHA 4US8A 1FNWA 2PPHA 3SFDB 2DYOA 3GP7A 4USAA 4W9EA 4ZYNA 3HIZA 5C3JB 2MBOA 2FCMA 3QWZB 4GXBA 2MBEA 1QF6A 2AQ2B 4B6WA 2WXOA 2GMIC 1WMHB 4OVUA 3W5UB 4S17A 2ZVNA 3NVYA 4A90A 3VR9B 4NQLB 1P98A 1OEYJ 3L10B 2M8SA 1TZ1A 2LI5A 2LGSA 4ASWC 5H92C 1XLQA 1I4QA 2GLSA 4MM3B 1YN4A 2HDEA 2KANA 1P9DU 2MBQA 4A20A 4AJYB 1FXIA 4KDIC 1JWMD 3T3NA 4FJVB 2VZKB 2KFKA 3WAOA 3DVNU 2G45B 2K8HA 2HTME 2KWUB 4HKQA 3NHEB 1UWXA 5GXGB 5BYSA 1UZXB 1B1ZA 4R3DA 3KWLA 2LRWA 2WHIA 1EO6A 4M8MA 4II3B 2G3QB 5TSSA 5BYRA 3T8MA 4GDKB 4J3OD 1V1OA 2IYDB 3H9DA 4HKZE 2PTLA 1C9FA 4L2YA 2MJ3A 1I42A 3A1QA 2BKFA 4HDQA 1MI0A 3QARA 2TSSA 2BB6A 4TUUA 3DBSA 4MH0E 2D10A 1HZ6A 4M00A 3B1LX 2KNBA 2BS2B 3C19A 5T8IA 2LXAA 3HVZA 2KAJA 4XDCA 2H89B 4JQWC 1IPGA 2LD9A 2PKOA 2IGHA 2LGDA 3VXWA 1WWTA 3Q8AA 1WSPA 2Q5WD 2QHOA 4A9AA 2IGGA 4JPSA 3EUB2 4M01A 3DBHI 2KACA 2PEAA 2DZJA 1WE6A 3AE3B 3EGRA 2FUHB 2LASA 3VRAB 1TYGB 2R2QA 2WXPA 4C4VA 1ENFA 3AMZA 1V5TA 1ZDVA 5BMHA 3VH3B 2IO1B 4TMAB 3VTVA 3V6EB 3AE1B 1CMXB 1ET9A 1F0ZA 3NZ3A 1J7CA 1PGXA 4XX5A 1VRAB 4IG7B 3ZRFA 4MEMA 1K51A 2FAZA 3VH4B 2BW2A 3ZTDA 4BBNC 2ZZPB 2ZW0A 4G11A 2ZCBA 4P1BC 2BF8B 1WIAA 2WS3B 3UIOB 3TJPA 2BT6A 3ZXVA 1GB1A 3DBLB 1V9JA 5C2TB 4J6IA 2MA9B 3AB5A 1XQQA 1P3QU 4HJKA 2LHDA 1BXTA 4X57B 3VTUA 4DWFA 2KMAA 1AYFA 4HVBA 2IJ0A 4WQOB 4K81A 3ZJVA 5KHOA 2ZPYA 3M95A 4CHKA 3MHZA 2FUG1 3Q8EA 4OZBA 3TUOA 1R4MI 3AV8A 1UNSA 2RR9A 2DZMA 4ARCA 3RCZA 2KQ4X 3C8YA 3HK0A 3URYA 1XF5L 2JWZA 3DBHB 4LK0M 3ZLZA 1SJED 3E56A 4BBNF 1J19A 3RPFC 5AEKB 4HPMB 2K3UA 2Z0DB 3DDCB 2JRHA 3BY4B 4RF1A 3PO0A 2JSVX 3V62A 4K3CA 2YVCA 4Q2JA 1D4BA 3PPAA 4C00A
chains in the Genus database with same CATH topology
2BS3B 1V97A 3SFEB 1M4VA 1NYRA 2DYMA 4B0EA 3ZJTA 3TSSA 3VQIA 2BYTA 3ZQ4A 2N9LA 1D6EC 2Y5CA 1XLNA 3BYTB 1PFDA 3CIRB 1N60A 2G1EA 1MHHE 3UI3A 2QIEB 2CU3A 1RYJA 1N5XA 3P4QB 3NS1A 3U52E 1Y56A 2MH7A 3KWVA 2J52A 1I4GA 1E6EB 4AS1A 1FFUA 4D2KA 4JWUC 4IOIE 2J42A 4N6EB 2WQYB 3AE2B 1DOXA 1ZPSA 3BK2A 1JRPA 1NEKB 3MC0B 4JE3B 2WLBA 2MJDA 4FXCA 4TSSA 1L6VA 2KWDA 2WXRA 4ZRPA 3W1SA 1IBXA 1ROEA 4DXFA 3HVDA 1N5WA 4US9A 5AUKA 3ZYYX 5H8YE 1SF0A 1ZXHA 2WU2B 1FO4A 1HZ5A 2JYEA 1FRDA 4RGNA 3SEBA 1GAQB 1YN3A 4P6VF 5BMGA 1OFFA 4C7ZA 2IGDA 4IDIA 4YTPB 1I4XA 2NTTA 2AX5A 4WAFA 3PZ8A 2LJIA 4KGSA 3AEEB 1TS4A 4A6QA 3GB1A 4IKGA 2Z8LA 2LGIA 2LUMA 2RMMA 1MHXA 2H88B 1K52A 2K9XA 2E6XA 3J9CA 1MPEA 3P1MA 1D5MC 2JZPA 1F2RI 4M0WA 3VR8B 3IT6B 4AQ7A 1WYGA 3AEBB 2L52A 2JXTA 3R2IA 4YSZB 4OW0A 1C79A 1WRIA 3OWEB 1FMAD 1L6UA 1PGBA 5HHDG 3ABVB 3B2GA 1ET6A 2WDVB 2V3PA 4P16A 1FNUA 1TY0A 1C78A 3IAS1 1J7BA 2PLPA 2JWUA 2WNMA 2WXQA 3H8HA 1VZ6A 3EA6A 2XNAC 1BMLC 1KF6B 2N0SB 1AWDA 4N58A 1DGJA 2I38A 2Y5PA 5BYQA 2WP9B 1ZE3D 1J7AA 1CJEA 1T3QA 3BVGA 4MT5A 1CK1A 4GDLB 2JU6X 1XLOA 2J4XA 1FFVA 3AE4B 4ITKA 1XLPA 2V0GA 5FR3A 1ZP0B 1YQ4B 1I4PA 2LHEA 3LB8C 4WQMA 4XWTA 2LMCA 1RFKA 3AEFB 2DWQA 2QEJC 1KRHA 1TS3A 1EU3A 1PUTA 4EE2A 1AN8A 1QOGA 2J53A 1QOAA 2X38A 1K50A 2OEDA 3SR6A 2WXJA 4N59A 2G9HD 2WDRB 4RF0A 2NTSA 1RWSA 3FILB 1HEZE 2MEKA 1E9MA 3AE5B 1EM7A 1MVKA 3ZGZA 2M19A 2I2YA 3P4RB 1FNVA 3TEZA 4L1BA 3AE9B 4YTNB 1FM0D 1C4CA 4XE0A 5D7GA 2R61A 5D3IB 3O13A 5I4DA 3BZDB 1SE2A 1V8CA 1JWBD 4RNAA 4YXDB 4H2AA 4XWWA 2ACZB 2JQRB 3RFZB 2INNE 2L83A 1NENB 5EE9A 1T6BX 4DQOC 1TKGA 1VLBA 2M0AA 4KKIA 3Q8CA 3HUIA 1ACCA 2PMVA 1YJIA 4KGTA 3N9YC 5EE1A 2YEPB 2WXLA 2JYTA 3BK1A 1AW7A 3NVVA 4RCOA 4A55A 5JXVA 2QILA 2B76B 1EU4A 2WXHA 1ESFA 1JROA 4TQ1A 4YSYB 1GB4A 4C56C 2PW9A 2N7JA 1JW9D 2QJLA 1JCKB 3HRDD 1N61A 1F2RC 3Q69A 3AEAB 4C80A 4REZA 1C77A 3Q8FA 1XCQL 1L0YB 2W82A 3E9SA 1KLUD 1N62A 3AEDB 4ZHPA 1R7SA 2RDHA 5HI1A 2MJEA 1QOFA 4RFBA 1OQQA 4KX6B 1YNTE 1QOBA 4YWGG 2GB1A 4LTUA 1N63A 2PIAA 1XCTL 1WXQA 3ETRA 4WWMA 2W3RA 1KFYB 1RM6C 1E7PB 2D5GA 1EWCA 2WXGA 3P4SB 4LLGM 2JX5A 1STEA 2W3SA 4RGMA 3W2DA 3B2FA 4NJCA 1TS2A 2BS4B 3L4PA 3IT4B 1FD6A 1HA5A 2K22A 2GRIA 2SAKA 2SEBD 5E6JA 1TY2A 3NRZA 1K53A 4OZAA 5AUIA 1SE4A 2YEPF 4YSXB 1XXGA 4WIPA 5MPOA 5FK9C 2E3TA 1YMHE 1QKZA 4US8A 1FNWA 1E10A 2DBYA 3SFDB 2DYOA 3TEXA 3W9CB 3GP7A 1I4HA 4O1NA 3WCQA 2W54A 1SEBD 1T5XD 3CWIA 4USAA 1VJKA 4YTMB 3VRBB 5C3JB 2LEKA 1QLBB 3TEWA 2K5PA 1BUIC 5G5GA 1QF6A 2AQ2B 3I57A 2WXOA 4ZYSA 1JWSD 3AE7B 1C4PA 3W5UB 1YJJA 4OZCA 3AN1A 1KH0A 3V05A 4JWSC 3NVYA 1L4ZB 4A90A 3VR9B 3FILA 1QT9A 2CJOA 4XDDA 1VZ8A 1FCLA 3W5VB 1UGJA 5H92C 1XLQA 1I4QA 4MM3B 3NVWA 1YN4A 2HDEA 4HEA1 1KTKA 1D5XC 2LFIA 1FXIA 1JWMD 3BYYB 4ZRQA 3T3NA 5HFYA 1LO5D 2VZKB 2W55A 3BVMA 3AH7A 3AM9A 2HTME 1XEEA 4HKQA 3T3OA 4L23A 4B0MA 1L4DB 5EE0A 2KMMA 4TQ0A 1UWXA 2WDQB 5GXGB 5BMIA 5BYSA 3GS2A 1V1PB 2ICIA 1B1ZA 2VZKD 2PVGC 4R3DA 1CQVA 3KWLA 3FAHA 3LYYA 1FIQA 4KKJA 3KQ4A 5TSSA 5BYRA 4GDKB 4J3OD 1V1OA 1I4RA 4HKZE 2PTLA 1ZUD2 1C9FA 1SE3A 4L2YA 1FEHA 2MJ3A 1MI0A 2TSSA 2BB6A 2N9KA 1TS5A 3TEYA 1JALA 5D3DA 1SBBB 1HZ6A 1I7HA 4JX1C 3BIID 4A8XC 3U4EG 2BS2B 2AQ1B 5T8IA 3HVZA 2KAJA 2QMTA 1ZDXA 2H89B 3PZ7A 1QILA 1VZ7A 4NAMA 4XDCA 1OQRA 1TZOA 2IDYA 2AQ3B 2BBCA 1D5ZC 2CJNA 2PKOA 2IGHA 4PT5A 2L32A 1PDXA 1WWTA 1E0ZA 1TKYA 4DXGA 1WGKA 4MACA 1YQ3B 2ONQA 3Q8AA 4MH8A 1YN5A 3MJ5A 3AECB 1TJEA 1WSPA 1TKEA 4ZOHC 1QQRA 2INPE 1FCCC 3AEGB 2Q5WD 4A9AA 2BTEA 2IGGA 2FE8A 4JPSA 1GOZA 3EUB2 4HRSA 3P4PB 4OHJA 3BWUD 1ZXIA 1ZOYB 3NUHB 2KACA 1IGCA 4HROA 2BB5A 3AE8B 1FRRA 3AE3B 3EGRA 1PYWD 2WXKA 3VRAB 3IAM1 1TYGB 2WXPA 1CZPA 3P42A 1FXAA 1ENFA 3AMZA 1JQ4A 2NMQA 1ZDVA 5BMHA 2ZW1A 4C7YA 1P7EA 2FBWB 4TMAB 1NI3A 1IGDA 2WU5B 1UUPA 3AE1B 3IXSA 1B9RA 1ET9A 1F0ZA 4ZHOA 4RH6A 2WXMA 3NZ3A 4CQNA 1UWMA 2V4IB 4NZLB 1SJHD 1J7CA 2EELA 1PGXA 1VRAB 2Y3AA 1Q10A 1K51A 3KLSX 3I9V1 3BVZA 2IPKD 2BW2A 2ZW0A 1IBXB 2WS3B 4WURA 1VDVA 1NYQA 3MP9A 1SIJA 2BT6A 3AE6B 1GB1A 1V1PA 4OVZA 5C2TB 3V3XA 3AB5A 2KDMA 3LXFA 1PGAA 1L0XB 1SXTA 3DWGC 2RPVA 3FC4A 4KGRA 1DOIA 4YT0B 2LHDA 2WXNA 1A70A 5LNK1 2RDGA 1EWYC 1BXTA 1HQRD 4GLSC 5G5HA 2M56B 1AYFA 3U2SC 2IJ0A 1L0VB 2WXIA 3R8BA 3ZJVA 4WH4A 2XN9C 1GPXA 1JWAD 1C4AA 4RGOS 1SSNA 3MHZA 1JWUD 2FUG1 2WXFA 3Q8EA 4RGTA 3MFGA 4OZBA 1VR9A 3TUOA 3U7ZA 3R2TA 5EE3A 3Q8BA 3AV8A 1UNSA 2DLBA 1NVID 4NAWB 4ARCA 3B9JA 2KQ4X 3C8YA 3URYA 1XF5L 3P63A 2ON8A 2KN4A 4LK0M 1XO3A 1SB3C 3ZJUA 1SJED 3E56A 3DWMA 3RPFC 1KLGD 2K3UA 5FKAC 1DYQA 2OHFA 3NVZA 1IUEA 2PVOD 2QSDA 2GI9A 4ARIA 1P7FA 5HG2A 2K0PA 2L1AA 3PO0A 4RF1A 1JMLA 1HXYD 2JSVX 1DOYA 1C76A 4HJGE 2EKIA 2V3NA 1F77A 4Q2JA 1D4BA 1L5PA 4UDUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE8 B;  2BS3 B;  3AE4 B;  4ITK A;  3VRB B;  1FRR A;  1XLP A;  1V97 A;  3AE3 B;  2LEK A;  1ZP0 B;  1QLB B;  1YQ4 B;  3LB8 C;  4WQM A;  3SFE B;  1NYR A;  5C3J B;  2K5P A;  1RFK A;  3AEF B;  5G5G A;  2DWQ A;  3VRA B;  2Y5C A;  1QF6 A;  1KRH A;  1TYG B;  1XLN A;  1PUT A;  3AE7 B;  1PFD A;  3CIR B;  3W5U B;  1CZP A;  1QOG A;  1YJJ A;  1N60 A;  1QOA A;  3AN1 A;  1FXA A;  2G1E A;  3AMZ A;  4N59 A;  3SR6 A;  2WDR B;  1JQ4 A;  4JWS C;  1RWS A;  2QIE B;  3NVY A;  3VR9 B;  4C7Y A;  2CU3 A;  2FBW B;  1E9M A;  1NI3 A;  1QT9 A;  1RYJ A;  2CJO A;  1N5X A;  3AE5 B;  2M19 A;  2WU5 B;  3P4Q B;  3NS1 A;  3P4R B;  3W5V B;  3AE1 B;  2MH7 A;  1B9R A;  3AE9 B;  4YTN B;  1FM0 D;  1XLQ A;  5H92 C;  4ZHO A;  1F0Z A;  3NVW A;  1E6E B;  1UWM A;  1JWB D;  1V8C A;  4YXD B;  1J7C A;  1FFU A;  2ACZ B;  2JQR B;  4JWU C;  1FXI A;  4N6E B;  2L83 A;  2WQY B;  1NEN B;  5EE9 A;  3AE2 B;  1DOX A;  1TKG A;  1VLB A;  2W55 A;  3HUI A;  1JRP A;  3AH7 A;  1NEK B;  1YJI A;  3AM9 A;  2HTM E;  5EE1 A;  2WLB A;  2MJD A;  4FXC A;  2WS3 B;  3NVV A;  5EE0 A;  1L6V A;  2KMM A;  1VDV A;  1NYQ A;  1ROE A;  2WDQ B;  5GXG B;  1SIJ A;  1N5W A;  2BT6 A;  4US9 A;  5AUK A;  5H8Y E;  3ZYY X;  2B76 B;  3AE6 B;  1SF0 A;  2PVG C;  3KWL A;  5C2T B;  3FAH A;  1FIQ A;  3AB5 A;  2WU2 B;  1JRO A;  3LXF A;  4YSY B;  1FO4 A;  1FRD A;  2QJL A;  3DWG C;  1JW9 D;  3FC4 A;  1DOI A;  4YT0 B;  1GAQ B;  1ZUD 2;  1A70 A;  4P6V F;  1EWY C;  1N61 A;  1OFF A;  3HRD D;  2MJ3 A;  4C7Z A;  4IDI A;  4YTP B;  3AEA B;  2AX5 A;  5G5H A;  4C80 A;  2M56 B;  1AYF A;  3AEE B;  1L0V B;  1N62 A;  3AED B;  4ZHP A;  1R7S A;  2MJE A;  1QOF A;  4YTM B;  1OQQ A;  2H88 B;  1JAL A;  1JWA D;  2K9X A;  4KX6 B;  1GPX A;  1I7H A;  1QOB A;  4JX1 C;  3BII D;  2BS2 B;  1N63 A;  2PIA A;  4LTU A;  3P1M A;  3VR8 B;  1WXQ A;  3ETR A;  2KAJ A;  3HVZ A;  2H89 B;  5EE3 A;  3AV8 A;  4WWM A;  2W3R A;  1KFY B;  1OQR A;  1RM6 C;  1E7P B;  1WYG A;  2L52 A;  3AEB B;  1NVI D;  2CJN A;  4YSZ B;  3P4S B;  2PKO A;  2JX5 A;  2W3S A;  3B9J A;  1WRI A;  3B2F A;  1PDX A;  3P63 A;  1WWT A;  1E0Z A;  1TKY A;  1FMA D;  1L6U A;  1WGK A;  2BS4 B;  3ABV B;  1YQ3 B;  3L4P A;  3B2G A;  1XO3 A;  2K22 A;  1SB3 C;  2WDV B;  3AEC B;  1TJE A;  3NRZ A;  3DWM A;  3RPF C;  1TKE A;  1J7B A;  4ZOH C;  5AUI A;  4YSX B;  3AEG B;  2OHF A;  5MPO A;  3NVZ A;  2Q5W D;  4A9A A;  1IUE A;  1KF6 B;  2N0S B;  2E3T A;  2PVO D;  1AWD A;  3EUB 2;  4US8 A;  4HRS A;  4N58 A;  1DGJ A;  2DBY A;  3P4P B;  3PO0 A;  2WP9 B;  1E10 A;  3SFD B;  1DOY A;  1ZXI A;  1ZOY B;  1J7A A;  2EKI A;  3W9C B;  1CJE A;  1T3Q A;  1L5P A;  3WCQ A;  2W54 A;  4HRO A;  3CWI A;  4USA A;  1VJK A;  1XLO A;  1FFV A; 
#chains in the Genus database with same CATH topology
 3OJ4 B;  4B0E A;  3TSS A;  1WXA A;  2N9L A;  4DHZ E;  4G0N B;  1MHH E;  3UI3 A;  2QIE B;  3R66 C;  1WY8 A;  2K8B A;  1KOT A;  3JW0 X;  4IC7 B;  1I4G A;  3A1Q B;  3QX1 A;  1WM3 A;  3EEC A;  4D2K A;  4GSW A;  2WQY B;  3AE2 B;  1DOX A;  5DPR A;  1KM7 A;  1V86 A;  2KJ6 A;  2PJH A;  2CHZ A;  1NEK B;  5E6O A;  3GZN I;  4TSS A;  3W1S A;  1SE9 A;  5IP4 D;  5H8Y E;  2ASQ A;  3WAN A;  4AP4 C;  1EUV B;  4DBG A;  1IYF A;  1R4M B;  4C7Z A;  1I4X A;  2AX5 A;  4HCN B;  1E8Z A;  1NI2 A;  1Q0W B;  2LUM A;  5IA7 A;  2H88 B;  2V1Y A;  2E6X A;  3J9C A;  4HCP B;  1MPE A;  4WWO A;  4ANX A;  4DDG D;  1LGR A;  4LNK A;  3IT6 B;  2N9E B;  4ZRJ A;  4AQ7 A;  3P2B A;  3R2I A;  4YSZ B;  3MJW A;  4NAW A;  3OWE B;  1WXV A;  2K6D B;  4E74 A;  4M02 A;  1PGB A;  1ET6 A;  3R7Q A;  2WDV B;  1E8Y A;  1FNU A;  3IAS 1;  1J7B A;  3V60 A;  2MQJ A;  1V80 A;  2JWU A;  2WNM A;  4BAX A;  2N7E A;  2WXQ A;  3EA6 A;  2XNA C;  1KF6 B;  2QC8 A;  3CMM B;  2CHW A;  1ZE3 D;  2KVZ A;  3H7S A;  1T3Q A;  3BVG A;  2HE7 A;  4MT5 A;  3VHT C;  2N7D A;  3AE4 B;  2IO0 B;  5DPT A;  3Q3M C;  3X0W A;  2N1W A;  3AEF B;  2DWQ A;  4IM2 A;  1V81 A;  1WX7 A;  1EU3 A;  1PUT A;  3M63 B;  2LVP A;  2OED A;  4XC2 A;  3SR6 A;  2NTS A;  3FIL B;  1UGM A;  5AZH A;  3RZW C;  1MVK A;  2MBB B;  3GZN B;  2C9W B;  4XE0 A;  5I4D A;  5D7G A;  2R61 A;  5D3I B;  2K39 A;  2YLM A;  2VH2 A;  2KC1 A;  4H2A A;  3ZO5 B;  1IP9 A;  4K7S A;  2ACZ B;  2JQR B;  3BIN A;  4OVV A;  3LDZ E;  4KKI A;  3N32 A;  2YEP B;  3DQV A;  5J18 A;  4AJW A;  2B76 B;  1F1H A;  4YSY B;  1GB4 A;  4C56 C;  5L83 A;  4MGI E;  3DHH C;  4IUM B;  3Q69 A;  3AEA B;  4REZ A;  1XCQ L;  3E9S A;  1KLU D;  1N62 A;  1R7S A;  1QOF A;  1WI0 A;  1OQQ A;  2N1V A;  3IFW B;  3EHV A;  3APF A;  4MSQ B;  1WXQ A;  2KTR B;  2W3R A;  4HDO A;  2WXG A;  3VUX A;  4LLG M;  1YX6 B;  1STE A;  2XK5 B;  2BS4 B;  3IT4 B;  1HA5 A;  2K22 A;  2SAK A;  3NRZ A;  3DVG X;  3DBR I;  3ONS A;  5MPO A;  1S1Q B;  1F52 A;  3CF6 E;  4HPP A;  1E10 A;  2DBY A;  3ZW3 A;  3W9C B;  3WCQ A;  2FNJ B;  1SEB D;  1T5X D;  4KIK A;  1VJK A;  2KHW B;  4GDL A;  3VRB B;  2LEK A;  4PS3 A;  3TEW A;  1BUI C;  5G5G A;  3RD2 A;  3I57 A;  1JWS D;  3ENE A;  3AUL A;  2BWE S;  1KH0 A;  2MP2 A;  1GC6 A;  1Q5W B;  2IND C;  4XDD A;  3X23 A;  1OGW A;  2BYF A;  3W5V B;  2J0K A;  4DDI D;  1UGJ A;  4HWI B;  2ZVO A;  3ZNH B;  1WZ0 A;  3VUY A;  1WZ3 A;  2BKR B;  1E8X A;  1WGY A;  4LCD E;  2KDE B;  1Z2M A;  1L4D B;  4B0M A;  5EE0 A;  2HTH A;  3L16 A;  3CST A;  5BMI A;  2ZPN A;  5CHF A;  3GS2 A;  2A5U A;  2MSE D;  3ZUN A;  1CQV A;  5HKH A;  2I1J A;  1P0R A;  4IM0 A;  2CS4 A;  4YL8 A;  3TL5 A;  5IN7 A;  1ZUD 2;  2CHX A;  1SE3 A;  1GJZ A;  2KFJ A;  2JVC A;  4W9H A;  4N9F 4;  5LXI B;  2IY0 B;  4EEW A;  3A33 B;  3KYD D;  2G4D B;  1ZDX A;  1VZ7 A;  3A9J A;  2AQ3 B;  4XGA B;  2RDB C;  3D32 A;  1MG8 A;  3AEC B;  2Z59 B;  4AWJ A;  1L2N A;  2CU1 A;  3TCA A;  5GMV A;  2BTE A;  4B9K A;  3IVF A;  3BWU D;  1ZXI A;  1IGC A;  2DZK A;  3H7P A;  3JVZ X;  1FRR A;  3KUD B;  5J17 A;  1WJU A;  1PYW D;  2WXK A;  3PGE A;  2K6Q A;  1XT9 B;  3Q3O C;  2J7Q B;  2RPQ A;  2OJW A;  1TGZ B;  1CZP A;  3P42 A;  2NMQ A;  2ZW1 A;  4C7Y A;  1NI3 A;  2WGS A;  2IBI B;  2M4N A;  2WU5 B;  1UUP A;  3GE8 C;  4KSL C;  3PS6 A;  4RH6 A;  2DAJ A;  1RFA A;  2ZNV B;  4NZL B;  2INC C;  1SJH D;  4EZL A;  2Y3A A;  3RNF C;  4QAY A;  4WUR A;  1NYQ A;  3MP9 A;  4HXD A;  1YD8 U;  2LUE A;  2BGF A;  3WA0 A;  1V1P A;  4OVZ A;  3UF8 A;  4IWP A;  2M17 A;  4NNJ B;  1DOI A;  3JSV A;  3NY5 A;  4LDT D;  2KVR A;  5LNK 1;  4P7I A;  1HQR D;  2IY1 B;  1WXM A;  3S2A A;  3U2S C;  1L0V B;  2XN9 C;  5FR6 A;  4DHZ B;  1NVI D;  4K7U A;  1GNU A;  2GBJ A;  3P63 A;  2LVQ A;  1WJN A;  1XO3 A;  1SB3 C;  2I1K A;  4W9K A;  2W9N A;  4PS8 A;  1TBE A;  1KLG D;  5FKA C;  1DYQ A;  3A9K A;  3NVZ A;  3UIP B;  1NBF C;  2O2V B;  2WX0 A;  2GI9 A;  5HG2 A;  1WGR A;  4GB9 A;  4HJG E;  2V3N A;  1F77 A;  1L5P A;  3VUW A;  2AL3 A;  1UBI A;  3DOW A;  4UDU C;  2K1F A;  1NYR A;  2AWT A;  4JGH B;  2L7R A;  3BYT B;  1PFD A;  5AZG A;  3NG0 A;  1E5W A;  1T0Q C;  2D11 A;  3RNC C;  4WWN A;  3P4Q B;  3PRZ A;  4ANU A;  1Y56 A;  3WAL A;  3KWV A;  4NJ6 A;  4WJO A;  3JYU A;  1V5O A;  3PHX B;  3RT3 B;  1FFU A;  1XD3 B;  3MC0 B;  2WWZ A;  4FXC A;  3L54 A;  4DK5 A;  1L6V A;  2WXR A;  1IBX A;  2L00 B;  4DXF A;  1N5W A;  5AUK A;  4BKT A;  1SF0 A;  1WX9 A;  1ZXH A;  4HK2 A;  5CTR C;  4PYU A;  2WU2 B;  4PK1 A;  4RGN A;  2HD5 B;  4P6V F;  5BMG A;  4AUQ C;  1OFF A;  3ALB A;  1TT5 B;  5IAA C;  2NTT A;  4FJY A;  4W9G A;  1MHX A;  1K52 A;  2K9X A;  4MJS B;  3QCA A;  1D5M C;  4M0W A;  1F2R I;  1HE8 A;  2LJ5 A;  1WYG A;  4OW0 A;  2HJ1 A;  4II2 B;  4WJQ A;  5J2R A;  3Q3J A;  2FID A;  3DPD A;  1P1A A;  1Z5S B;  3O65 B;  4ANV A;  1D3Z A;  1WE7 A;  3B08 A;  1VZ6 A;  5IOI A;  2N0S B;  2BWF A;  4N58 A;  3C0R B;  5IO9 A;  4K1R B;  3ZDM C;  4MGK E;  3ZVV A;  2JU6 X;  1XLO A;  2J4X A;  2LWP A;  4ITK A;  1XLP A;  4KZ0 A;  2WX1 A;  3AXC A;  1L7Y A;  4DHJ D;  2KKC A;  1KRH A;  2Y5B B;  4EE2 A;  1QOG A;  1QOA A;  1V2Y A;  2X38 A;  2NCN A;  2L8J A;  1H8C A;  2WXJ A;  4N59 A;  2G9H D;  2WDR B;  2NBW B;  1RWS A;  3N3K B;  3CSF A;  4I6L B;  3AE5 B;  1EM7 A;  3L17 A;  2M19 A;  4M8N A;  3P4R B;  4L1B A;  1C4C A;  2K8C A;  4WJP A;  3RUI B;  3O13 A;  1V8C A;  4RNA A;  1JWB D;  3QK0 A;  4XWW A;  2O6V D;  1KLV A;  3RFZ B;  2MX2 A;  1YQB A;  2KFK B;  5EE9 A;  1WJ4 A;  3QJZ A;  4KGT A;  3N9Y C;  5EE1 A;  2KQ7 A;  2JYT A;  3BK1 A;  1AW7 A;  4RCO A;  4A55 A;  3NOB A;  1NDD A;  2DZI A;  4B95 A;  1E8W A;  2WXH A;  1ESF A;  1T0Y A;  2J0M A;  3A4R A;  4JIO U;  1C3T A;  2PW9 A;  4WWP A;  4AOF A;  1L0Y B;  2W82 A;  3AED B;  1WJ6 A;  1YNT E;  2V9H A;  3H6N A;  1N63 A;  2VH1 A;  1XCT L;  2LXC A;  3I3T B;  4FLH A;  1I35 A;  3ETR A;  3VVW B;  3ZNZ B;  2D5G A;  4EZK A;  4FJZ A;  1YOV B;  1UEL A;  2LZ6 A;  4NJC A;  2UU7 A;  1FD6 A;  4W9L A;  5BO4 B;  5AUI A;  2KTF A;  4LNO A;  2YEP F;  1M94 A;  4WIP A;  1SIF A;  1YMH E;  4MGY E;  2KT7 A;  3TBL D;  2D3C A;  3TEX A;  1KJT A;  2CR5 A;  1I4H A;  4O1N A;  5EDS A;  3CWI A;  4YTM B;  4EZJ A;  2VRR B;  1LQB A;  2LVO A;  1QLB B;  1E90 A;  5IKC M;  2K5P A;  4W9I A;  4EFO A;  4C4V B;  5G2N A;  4OZC A;  1EF1 A;  3HHM A;  2WYQ A;  2JXX A;  3R3M A;  1VZ8 A;  1FCL A;  4GU2 A;  3FKY A;  1V49 A;  2HJ8 A;  4F7Z A;  4ZRQ A;  5E6N A;  5HFY A;  2KQS A;  3AM9 A;  4LNI A;  1XEE A;  1E7V A;  4L23 A;  1Y8R C;  3RZF A;  2KMM A;  4EOY A;  2PVG C;  1OEY A;  3FAH A;  4KKJ A;  3KQ4 A;  1I4R A;  4LNN A;  4KV2 A;  3QIJ A;  3KW5 B;  3MHS D;  3OG5 A;  4MSM B;  1Q1O A;  2N9K A;  1TS5 A;  1JAL A;  3OAW A;  1SBB B;  1I7H A;  2X8X X;  3BII D;  3U4E G;  3K9O B;  4NAM A;  1QIL A;  2DYB A;  1MFW A;  1OQR A;  1TZO A;  4ICV A;  1D5Z C;  3RNE C;  1WR1 A;  3U7D A;  1HTQ A;  1TKY A;  4DXG A;  4PS7 A;  1YQ3 B;  2ONQ A;  1LFD A;  4MH8 A;  3NZU A;  1TJE A;  1QQR A;  4FHK A;  1J0G A;  3KVF B;  1FCC C;  1MJD A;  3AEG B;  2JY6 A;  2FE8 A;  3WAP A;  4RM9 A;  1VCB A;  3P4P B;  1J8C A;  3ZNI D;  4GN1 A;  3I5J C;  1WM2 A;  3IHP C;  4HRO A;  3AE8 B;  3MTN B;  1VD2 A;  4IW0 A;  5LLI A;  3IBE A;  1U4A A;  4E3C A;  1WMH A;  1FXA A;  1UBQ A;  1P7E A;  2FBW B;  3R7R A;  1IGD A;  2ZCC A;  4GMV A;  4ZHO A;  1H4R A;  2WXM A;  4MM3 A;  4CQN A;  2NVU I;  3I63 C;  2ZNV C;  2EEL A;  2JT4 B;  5KHQ A;  2PE6 B;  1Q10 A;  3BVZ A;  2IPK D;  2REX A;  2MHJ A;  2AL6 A;  1VDV A;  4LDT B;  1SIJ A;  2B3A A;  5L95 C;  4IM3 A;  2O6V A;  3V3X A;  2KDM A;  3LXF A;  4KGR A;  1L0X B;  3FC4 A;  3DVG Y;  2JUO A;  2MBH A;  2WXN A;  1A70 A;  3IG3 A;  4K3B A;  4MDK E;  2V3S A;  2JF5 A;  3R8B A;  4GIV A;  4BKS D;  2JZZ A;  3SHQ A;  1GPX A;  4FN2 A;  1UF0 A;  1JWU D;  4GGQ A;  4RGT A;  3MFG A;  3Q3N C;  1VR9 A;  4ZRK A;  1G6J A;  3PRE A;  3Q8B A;  3RUL A;  2DLB A;  2UWQ A;  4NAW B;  2IO3 B;  3B9J A;  3PHW B;  2ON8 A;  1GC7 A;  3NS8 A;  4LJO B;  3GE3 C;  4W9D A;  3RNB C;  1F9J A;  2OHF A;  1WXS A;  2PVO D;  2QSD A;  3K9P B;  1P7F A;  2L1A A;  1HXY D;  3DBR B;  4RM8 A;  3UIN B;  3ZXR A;  2BVC A;  3APD A;  3RNG C;  2BS3 B;  1V97 A;  3SFE B;  2UYZ B;  1M4V A;  2N4F A;  2BYT A;  3ZQ4 A;  5LXH A;  1D6E C;  3Q6B A;  1WGD A;  1XLN A;  4ACF A;  2FCS A;  3CIR B;  2DX5 B;  2KX3 A;  2G1E A;  1S3S G;  2KMC A;  1RYJ A;  1WH3 A;  3NS1 A;  5CHW A;  1RAX A;  2J52 A;  3ZNG C;  3ECI A;  1E6E B;  4JWU C;  3QHT A;  2J42 A;  3BK2 A;  2J0J A;  4JE3 B;  2WLB A;  4K7W A;  2MJD A;  1A5R A;  2C5L C;  1LM8 B;  2KWD A;  4ZRP A;  3AI5 A;  1ROE A;  1TTN A;  3HVD A;  3ZYY X;  4US9 A;  3KH0 A;  1N6Z A;  4GOC A;  1FO4 A;  2JYE A;  1FRD A;  1GAQ B;  1YN3 A;  2IGD A;  4IDI A;  4YTP B;  4WAF A;  3PZ8 A;  1TS4 A;  4A6Q A;  1YJ1 A;  3GB1 A;  2Z8L A;  2RMM A;  2AEH A;  3P1M A;  4W9F A;  2KN5 A;  3AEB B;  2KWV B;  2L52 A;  2JXT A;  5D94 A;  4URK A;  2V4L A;  1WRI A;  3NJT A;  4G3X B;  4KZC A;  5HHD G;  3ABV B;  2MLB A;  4P16 A;  1TY0 A;  1C78 A;  3OJ3 A;  3H8H A;  4KDL B;  1BML C;  4BVU C;  1AWD A;  5DPW A;  2IZV B;  3HM3 A;  5BYQ A;  3T9L A;  3SDL C;  5JH5 C;  1WYW B;  1CJE A;  4DHJ B;  2JRI B;  4KIK B;  1CK1 A;  3MC9 A;  1FXT B;  4TV3 A;  4GDL B;  2DHZ A;  2V0G A;  1ZP0 B;  2AYO B;  1I4P A;  2LHE A;  3LB8 C;  4WQM A;  3RMK C;  2C7N B;  1RFK A;  1TS3 A;  2BYV E;  2R2O A;  3VTW A;  1WF9 A;  3VDZ A;  5D6J B;  2EMS A;  2MP2 B;  4RF0 A;  1BT0 A;  4ZRI A;  3PVL A;  2MEK A;  1E9M A;  2O6V B;  2I2Y A;  3AE9 B;  4YTN B;  1FM0 D;  1WGG A;  3BZD B;  2KX0 A;  1SE2 A;  1LXD A;  5C1Z A;  4YXD B;  3DHG C;  2L83 A;  1NEN B;  1T6B X;  2L76 A;  2M0A A;  3DBL I;  3Q8C A;  3HUI A;  1YJI A;  3N1X C;  5AZF A;  2NBU A;  1K8R B;  2QIL A;  1EU4 A;  1FPY A;  2D3B A;  1JRO A;  4TQ1 A;  4BKG A;  1JW9 D;  4CYE A;  1UD7 A;  2GBN A;  3HRD D;  1N61 A;  1F2R C;  4TKN A;  2A4Z A;  3SU8 X;  4C80 A;  1C77 A;  1ZKH A;  3Q8F A;  4FAD A;  4ZHP A;  5HI1 A;  4FHJ A;  4I6N B;  4F8C B;  4KX6 B;  3UQB A;  3NZS A;  1QOB A;  4YWG G;  2PIA A;  3ML8 A;  2FIF A;  3A9J B;  3PRP B;  2KDI A;  3P4S B;  2JX5 A;  2W3S A;  3ZDT A;  4RGM A;  3DHI C;  2ZJD A;  4BKS A;  2OOB B;  1TS2 A;  4A3P A;  3L4P A;  2GRI A;  2IO2 B;  3DCG A;  4OZA A;  4EUT A;  1SE4 A;  2FCQ A;  1XXG A;  2E3T A;  2M0X A;  1WR6 E;  3GOE A;  3H7P B;  2W54 A;  2QCZ A;  4XYC A;  3KUC B;  1RLF A;  3DVN V;  4ZYS A;  3Q2A C;  3AE7 B;  1C4P A;  1YJJ A;  3Q3F A;  3AN1 A;  1C1Y B;  3N1Y C;  3V05 A;  4JWS C;  4NJ7 A;  1L4Z B;  3FIL A;  1QT9 A;  2CJO A;  2L0F A;  4PYZ A;  3KYC D;  3UGB B;  3NVW A;  4HEA 1;  2RGF A;  4LNF A;  4JLC A;  1KTK A;  1D5X C;  2LFI A;  3QA8 A;  4EKU A;  3BYY B;  1AAR A;  1LO5 D;  2W55 A;  3BVM A;  2KZR A;  3AH7 A;  3T3O A;  5TR5 A;  4TQ0 A;  2L3Z A;  2WDQ B;  2PE9 A;  2C7H A;  1V1P B;  2ICI A;  2VZK D;  3PRM B;  3LYY A;  1FIQ A;  5D2M B;  3JSV B;  3PV1 A;  3PZD A;  1TIF A;  4XZ4 A;  1MG4 A;  4HLE A;  1FEH A;  3B0A A;  2EKE C;  3TEY A;  5D3D A;  4JX1 C;  2NR2 A;  1X1M A;  3QAQ A;  4A8X C;  2AQ1 B;  2QDF A;  2QMT A;  3PZ7 A;  2KLC A;  2LGX A;  2KTR A;  4FUL A;  2IDY A;  2BBC A;  2CJN A;  2NS5 A;  4PT5 A;  2L32 A;  3M62 B;  1PDX A;  1E0Z A;  1WGK A;  4MAC A;  2XK5 A;  1YN5 A;  3MJ5 A;  3RI7 C;  1TKE A;  4ZOH C;  3A9K B;  2INP E;  2KDB A;  4JL9 A;  1GOZ A;  3RYT A;  2WDT B;  4HRS A;  4W9J A;  4OHJ A;  4F1S A;  3NUH B;  1ZOY B;  3L13 A;  3WIM A;  1UH6 A;  2L0T A;  3TMP B;  2BB5 A;  3KUZ A;  3AU5 A;  3QQ8 B;  4E71 A;  2D2Q A;  4S0R A;  2KWC A;  1ZW7 A;  3IAM 1;  1GUA B;  2KOX A;  1QZE A;  1JQ4 A;  2GBR A;  1OQY A;  2CKH B;  3PTF C;  4WAA A;  3EFC A;  3IXS A;  1B9R A;  4ZDV A;  2KJR A;  5E6P A;  2KLG A;  2Z0E B;  1UWM A;  2V4I B;  3A4S C;  1RRB A;  3U8Z A;  3KLS X;  3I9V 1;  5CX3 A;  4WJN A;  2DEN B;  1IBX B;  3W1S C;  4ANW A;  3V61 A;  3RNA C;  3AE6 B;  1ISN A;  3ZIM A;  2KO3 A;  3ML9 A;  1PGA A;  1SXT A;  3DWG C;  2RPV A;  4YT0 B;  2RDG A;  1EWY C;  4GLS C;  5G5H A;  2M56 B;  3W1Y A;  1JRU A;  3LJ3 A;  2WXI A;  2D07 B;  4WH4 A;  1JWA D;  1C4A A;  4RGO S;  1SSN A;  2KYW A;  1V6E A;  1YX5 B;  2WXF A;  2FCN A;  4M0W B;  2KK8 A;  3L0W B;  3U7Z A;  3R2T A;  5EE3 A;  2C60 A;  2KD0 A;  4A3O A;  5JHB A;  2KN4 A;  3PLU A;  3ZKJ C;  4BZA A;  4NQK E;  1ZGU B;  3ZJU A;  2LGY A;  2M1M A;  3DWM A;  3PSE B;  3PT2 B;  2NPT A;  3AU4 A;  3OLM D;  1IUE A;  4ARI A;  2OJR A;  2K0P A;  1JML A;  1T0R C;  1DOY A;  1C76 A;  2EKI A;  2MWS B;  2XBB C;  2D3G A;  4MEL A;  3EC8 A;  3WAM A;  2DYM A;  5C23 A;  3ZJT A;  1T0S C;  4RMA A;  3VQI A;  2Y5C A;  1GG3 A;  2GBM A;  1N60 A;  2L05 A;  3H1U A;  1WRD B;  2CU3 A;  2RSU A;  1N5X A;  2JPH A;  4W9C A;  5CHV C;  3U52 E;  2MH7 A;  4ICU A;  1YIW A;  4I6P A;  4AS1 A;  4IOI E;  4N6E B;  2N9P C;  1EF5 A;  1R4N I;  1ZPS A;  5G55 A;  4KVG B;  1JRP A;  4P1C C;  3APC A;  3ZRC A;  2LRU A;  1PQS A;  3N1Z C;  2NBV B;  1HZ5 A;  2GOW A;  3VAW A;  3SEB A;  2LJI A;  4KGS A;  3AEE B;  4IKG A;  4NY0 A;  2KC2 A;  2LGI A;  2K25 A;  2D3A A;  3UQA A;  2BPS A;  3VR8 B;  2JZP A;  2KDF B;  1OTR B;  3N20 C;  1HTO A;  1C79 A;  4GDK A;  1FMA D;  1L6U A;  3B2G A;  2V3P A;  2PLP A;  2G4S A;  1WFY A;  4KSK C;  2DNF A;  4FA6 A;  3EFU A;  3M3J A;  3Q14 C;  3TIX A;  2JZ3 B;  2O2V A;  1DGJ A;  2I38 A;  2Y5P A;  2WP9 B;  3U30 A;  2MCN B;  1J7A A;  2N9X A;  3SD5 A;  2C7M B;  2MW5 A;  1FFV A;  5FR3 A;  1YQ4 B;  4XWT A;  2LMC A;  2QEJ C;  4CO7 A;  4G50 A;  1AN8 A;  2J53 A;  1K50 A;  1HEZ E;  2BQQ A;  1R4N B;  3ZGZ A;  3N30 A;  4BFR A;  5JZE B;  4MGZ E;  1FNV A;  3TEZ A;  2XEW A;  2DAF A;  2INN E;  4LJP B;  3HM6 X;  4FBJ B;  4DQO C;  1TKG A;  1VLB A;  4IWQ A;  3QC8 B;  1ACC A;  2PMV A;  3MC8 A;  3RN9 C;  4IWO A;  2WXL A;  3NVV A;  2RD0 A;  5JXV A;  4DXA B;  2GBK A;  3PLV A;  2QJL A;  2N7J A;  5DPS A;  1JCK B;  2BYE A;  2KJH B;  2ZEQ A;  3V6C B;  3VFK A;  1WX8 A;  5DCN A;  2NPT B;  2RDH A;  2MJE A;  4RFB A;  2GB1 A;  2EMT A;  4LTU A;  4MJS A;  3ZTC A;  4WWM A;  1KFY B;  1RM6 C;  1E7P B;  4BOS C;  1EWC A;  1SGH A;  4BOZ B;  3W2D A;  4NPN A;  3B2F A;  2MRP A;  1E7U A;  2SEB D;  5JHA A;  5E6J A;  1TY2 A;  2KXJ A;  1K53 A;  4HPL B;  4YSX B;  5FK9 C;  3L08 A;  1QKZ A;  1WGH A;  4US8 A;  1FNW A;  2PPH A;  3SFD B;  2DYO A;  3GP7 A;  4USA A;  4W9E A;  4ZYN A;  3HIZ A;  5C3J B;  2MBO A;  2FCM A;  3QWZ B;  4GXB A;  2MBE A;  1QF6 A;  2AQ2 B;  4B6W A;  2WXO A;  2GMI C;  1WMH B;  4OVU A;  3W5U B;  4S17 A;  2ZVN A;  3NVY A;  4A90 A;  3VR9 B;  4NQL B;  1P98 A;  1OEY J;  3L10 B;  2M8S A;  1TZ1 A;  2LI5 A;  2LGS A;  4ASW C;  5H92 C;  1XLQ A;  1I4Q A;  2GLS A;  4MM3 B;  1YN4 A;  2HDE A;  2KAN A;  1P9D U;  2MBQ A;  4A20 A;  4AJY B;  1FXI A;  4KDI C;  1JWM D;  3T3N A;  4FJV B;  2VZK B;  2KFK A;  3WAO A;  3DVN U;  2G45 B;  2K8H A;  2HTM E;  2KWU B;  4HKQ A;  3NHE B;  1UWX A;  5GXG B;  5BYS A;  1UZX B;  1B1Z A;  4R3D A;  3KWL A;  2LRW A;  2WHI A;  1EO6 A;  4M8M A;  4II3 B;  2G3Q B;  5TSS A;  5BYR A;  3T8M A;  4GDK B;  4J3O D;  1V1O A;  2IYD B;  3H9D A;  4HKZ E;  2PTL A;  1C9F A;  4L2Y A;  2MJ3 A;  1I42 A;  3A1Q A;  2BKF A;  4HDQ A;  1MI0 A;  3QAR A;  2TSS A;  2BB6 A;  4TUU A;  3DBS A;  4MH0 E;  2D10 A;  1HZ6 A;  4M00 A;  3B1L X;  2KNB A;  2BS2 B;  3C19 A;  5T8I A;  2LXA A;  3HVZ A;  2KAJ A;  4XDC A;  2H89 B;  4JQW C;  1IPG A;  2LD9 A;  2PKO A;  2IGH A;  2LGD A;  3VXW A;  1WWT A;  3Q8A A;  1WSP A;  2Q5W D;  2QHO A;  4A9A A;  2IGG A;  4JPS A;  3EUB 2;  4M01 A;  3DBH I;  2KAC A;  2PEA A;  2DZJ A;  1WE6 A;  3AE3 B;  3EGR A;  2FUH B;  2LAS A;  3VRA B;  1TYG B;  2R2Q A;  2WXP A;  4C4V A;  1ENF A;  3AMZ A;  1V5T A;  1ZDV A;  5BMH A;  3VH3 B;  2IO1 B;  4TMA B;  3VTV A;  3V6E B;  3AE1 B;  1CMX B;  1ET9 A;  1F0Z A;  3NZ3 A;  1J7C A;  1PGX A;  4XX5 A;  1VRA B;  4IG7 B;  3ZRF A;  4MEM A;  1K51 A;  2FAZ A;  3VH4 B;  2BW2 A;  3ZTD A;  4BBN C;  2ZZP B;  2ZW0 A;  4G11 A;  2ZCB A;  4P1B C;  2BF8 B;  1WIA A;  2WS3 B;  3UIO B;  3TJP A;  2BT6 A;  3ZXV A;  1GB1 A;  3DBL B;  1V9J A;  5C2T B;  4J6I A;  2MA9 B;  3AB5 A;  1XQQ A;  1P3Q U;  4HJK A;  2LHD A;  1BXT A;  4X57 B;  3VTU A;  4DWF A;  2KMA A;  1AYF A;  4HVB A;  2IJ0 A;  4WQO B;  4K81 A;  3ZJV A;  5KHO A;  2ZPY A;  3M95 A;  4CHK A;  3MHZ A;  2FUG 1;  3Q8E A;  4OZB A;  3TUO A;  1R4M I;  3AV8 A;  1UNS A;  2RR9 A;  2DZM A;  4ARC A;  3RCZ A;  2KQ4 X;  3C8Y A;  3HK0 A;  3URY A;  1XF5 L;  2JWZ A;  3DBH B;  4LK0 M;  3ZLZ A;  1SJE D;  3E56 A;  4BBN F;  1J19 A;  3RPF C;  5AEK B;  4HPM B;  2K3U A;  2Z0D B;  3DDC B;  2JRH A;  3BY4 B;  4RF1 A;  3PO0 A;  2JSV X;  3V62 A;  4K3C A;  2YVC A;  4Q2J A;  1D4B A;  3PPA A;  4C00 A; 
#chains in the Genus database with same CATH homology
 2BS3 B;  1V97 A;  3SFE B;  1M4V A;  1NYR A;  2DYM A;  4B0E A;  3ZJT A;  3TSS A;  3VQI A;  2BYT A;  3ZQ4 A;  2N9L A;  1D6E C;  2Y5C A;  1XLN A;  3BYT B;  1PFD A;  3CIR B;  1N60 A;  2G1E A;  1MHH E;  3UI3 A;  2QIE B;  2CU3 A;  1RYJ A;  1N5X A;  3P4Q B;  3NS1 A;  3U52 E;  1Y56 A;  2MH7 A;  3KWV A;  2J52 A;  1I4G A;  1E6E B;  4AS1 A;  1FFU A;  4D2K A;  4JWU C;  4IOI E;  2J42 A;  4N6E B;  2WQY B;  3AE2 B;  1DOX A;  1ZPS A;  3BK2 A;  1JRP A;  1NEK B;  3MC0 B;  4JE3 B;  2WLB A;  2MJD A;  4FXC A;  4TSS A;  1L6V A;  2KWD A;  2WXR A;  4ZRP A;  3W1S A;  1IBX A;  1ROE A;  4DXF A;  3HVD A;  1N5W A;  4US9 A;  5AUK A;  3ZYY X;  5H8Y E;  1SF0 A;  1ZXH A;  2WU2 B;  1FO4 A;  1HZ5 A;  2JYE A;  1FRD A;  4RGN A;  3SEB A;  1GAQ B;  1YN3 A;  4P6V F;  5BMG A;  1OFF A;  4C7Z A;  2IGD A;  4IDI A;  4YTP B;  1I4X A;  2NTT A;  2AX5 A;  4WAF A;  3PZ8 A;  2LJI A;  4KGS A;  3AEE B;  1TS4 A;  4A6Q A;  3GB1 A;  4IKG A;  2Z8L A;  2LGI A;  2LUM A;  2RMM A;  1MHX A;  2H88 B;  1K52 A;  2K9X A;  2E6X A;  3J9C A;  1MPE A;  3P1M A;  1D5M C;  2JZP A;  1F2R I;  4M0W A;  3VR8 B;  3IT6 B;  4AQ7 A;  1WYG A;  3AEB B;  2L52 A;  2JXT A;  3R2I A;  4YSZ B;  4OW0 A;  1C79 A;  1WRI A;  3OWE B;  1FMA D;  1L6U A;  1PGB A;  5HHD G;  3ABV B;  3B2G A;  1ET6 A;  2WDV B;  2V3P A;  4P16 A;  1FNU A;  1TY0 A;  1C78 A;  3IAS 1;  1J7B A;  2PLP A;  2JWU A;  2WNM A;  2WXQ A;  3H8H A;  1VZ6 A;  3EA6 A;  2XNA C;  1BML C;  1KF6 B;  2N0S B;  1AWD A;  4N58 A;  1DGJ A;  2I38 A;  2Y5P A;  5BYQ A;  2WP9 B;  1ZE3 D;  1J7A A;  1CJE A;  1T3Q A;  3BVG A;  4MT5 A;  1CK1 A;  4GDL B;  2JU6 X;  1XLO A;  2J4X A;  1FFV A;  3AE4 B;  4ITK A;  1XLP A;  2V0G A;  5FR3 A;  1ZP0 B;  1YQ4 B;  1I4P A;  2LHE A;  3LB8 C;  4WQM A;  4XWT A;  2LMC A;  1RFK A;  3AEF B;  2DWQ A;  2QEJ C;  1KRH A;  1TS3 A;  1EU3 A;  1PUT A;  4EE2 A;  1AN8 A;  1QOG A;  2J53 A;  1QOA A;  2X38 A;  1K50 A;  2OED A;  3SR6 A;  2WXJ A;  4N59 A;  2G9H D;  2WDR B;  4RF0 A;  2NTS A;  1RWS A;  3FIL B;  1HEZ E;  2MEK A;  1E9M A;  3AE5 B;  1EM7 A;  1MVK A;  3ZGZ A;  2M19 A;  2I2Y A;  3P4R B;  1FNV A;  3TEZ A;  4L1B A;  3AE9 B;  4YTN B;  1FM0 D;  1C4C A;  4XE0 A;  5D7G A;  2R61 A;  5D3I B;  3O13 A;  5I4D A;  3BZD B;  1SE2 A;  1V8C A;  1JWB D;  4RNA A;  4YXD B;  4H2A A;  4XWW A;  2ACZ B;  2JQR B;  3RFZ B;  2INN E;  2L83 A;  1NEN B;  5EE9 A;  1T6B X;  4DQO C;  1TKG A;  1VLB A;  2M0A A;  4KKI A;  3Q8C A;  3HUI A;  1ACC A;  2PMV A;  1YJI A;  4KGT A;  3N9Y C;  5EE1 A;  2YEP B;  2WXL A;  2JYT A;  3BK1 A;  1AW7 A;  3NVV A;  4RCO A;  4A55 A;  5JXV A;  2QIL A;  2B76 B;  1EU4 A;  2WXH A;  1ESF A;  1JRO A;  4TQ1 A;  4YSY B;  1GB4 A;  4C56 C;  2PW9 A;  2N7J A;  1JW9 D;  2QJL A;  1JCK B;  3HRD D;  1N61 A;  1F2R C;  3Q69 A;  3AEA B;  4C80 A;  4REZ A;  1C77 A;  3Q8F A;  1XCQ L;  1L0Y B;  2W82 A;  3E9S A;  1KLU D;  1N62 A;  3AED B;  4ZHP A;  1R7S A;  2RDH A;  5HI1 A;  2MJE A;  1QOF A;  4RFB A;  1OQQ A;  4KX6 B;  1YNT E;  1QOB A;  4YWG G;  2GB1 A;  4LTU A;  1N63 A;  2PIA A;  1XCT L;  1WXQ A;  3ETR A;  4WWM A;  2W3R A;  1KFY B;  1RM6 C;  1E7P B;  2D5G A;  1EWC A;  2WXG A;  3P4S B;  4LLG M;  2JX5 A;  1STE A;  2W3S A;  4RGM A;  3W2D A;  3B2F A;  4NJC A;  1TS2 A;  2BS4 B;  3L4P A;  3IT4 B;  1FD6 A;  1HA5 A;  2K22 A;  2GRI A;  2SAK A;  2SEB D;  5E6J A;  1TY2 A;  3NRZ A;  1K53 A;  4OZA A;  5AUI A;  1SE4 A;  2YEP F;  4YSX B;  1XXG A;  4WIP A;  5MPO A;  5FK9 C;  2E3T A;  1YMH E;  1QKZ A;  4US8 A;  1FNW A;  1E10 A;  2DBY A;  3SFD B;  2DYO A;  3TEX A;  3W9C B;  3GP7 A;  1I4H A;  4O1N A;  3WCQ A;  2W54 A;  1SEB D;  1T5X D;  3CWI A;  4USA A;  1VJK A;  4YTM B;  3VRB B;  5C3J B;  2LEK A;  1QLB B;  3TEW A;  2K5P A;  1BUI C;  5G5G A;  1QF6 A;  2AQ2 B;  3I57 A;  2WXO A;  4ZYS A;  1JWS D;  3AE7 B;  1C4P A;  3W5U B;  1YJJ A;  4OZC A;  3AN1 A;  1KH0 A;  3V05 A;  4JWS C;  3NVY A;  1L4Z B;  4A90 A;  3VR9 B;  3FIL A;  1QT9 A;  2CJO A;  4XDD A;  1VZ8 A;  1FCL A;  3W5V B;  1UGJ A;  5H92 C;  1XLQ A;  1I4Q A;  4MM3 B;  3NVW A;  1YN4 A;  2HDE A;  4HEA 1;  1KTK A;  1D5X C;  2LFI A;  1FXI A;  1JWM D;  3BYY B;  4ZRQ A;  3T3N A;  5HFY A;  1LO5 D;  2VZK B;  2W55 A;  3BVM A;  3AH7 A;  3AM9 A;  2HTM E;  1XEE A;  4HKQ A;  3T3O A;  4L23 A;  4B0M A;  1L4D B;  5EE0 A;  2KMM A;  4TQ0 A;  1UWX A;  2WDQ B;  5GXG B;  5BMI A;  5BYS A;  3GS2 A;  1V1P B;  2ICI A;  1B1Z A;  2VZK D;  2PVG C;  4R3D A;  1CQV A;  3KWL A;  3FAH A;  3LYY A;  1FIQ A;  4KKJ A;  3KQ4 A;  5TSS A;  5BYR A;  4GDK B;  4J3O D;  1V1O A;  1I4R A;  4HKZ E;  2PTL A;  1ZUD 2;  1C9F A;  1SE3 A;  4L2Y A;  1FEH A;  2MJ3 A;  1MI0 A;  2TSS A;  2BB6 A;  2N9K A;  1TS5 A;  3TEY A;  1JAL A;  5D3D A;  1SBB B;  1HZ6 A;  1I7H A;  4JX1 C;  3BII D;  4A8X C;  3U4E G;  2BS2 B;  2AQ1 B;  5T8I A;  3HVZ A;  2KAJ A;  2QMT A;  1ZDX A;  2H89 B;  3PZ7 A;  1QIL A;  1VZ7 A;  4NAM A;  4XDC A;  1OQR A;  1TZO A;  2IDY A;  2AQ3 B;  2BBC A;  1D5Z C;  2CJN A;  2PKO A;  2IGH A;  4PT5 A;  2L32 A;  1PDX A;  1WWT A;  1E0Z A;  1TKY A;  4DXG A;  1WGK A;  4MAC A;  1YQ3 B;  2ONQ A;  3Q8A A;  4MH8 A;  1YN5 A;  3MJ5 A;  3AEC B;  1TJE A;  1WSP A;  1TKE A;  4ZOH C;  1QQR A;  2INP E;  1FCC C;  3AEG B;  2Q5W D;  4A9A A;  2BTE A;  2IGG A;  2FE8 A;  4JPS A;  1GOZ A;  3EUB 2;  4HRS A;  3P4P B;  4OHJ A;  3BWU D;  1ZXI A;  1ZOY B;  3NUH B;  2KAC A;  1IGC A;  4HRO A;  2BB5 A;  3AE8 B;  1FRR A;  3AE3 B;  3EGR A;  1PYW D;  2WXK A;  3VRA B;  3IAM 1;  1TYG B;  2WXP A;  1CZP A;  3P42 A;  1FXA A;  1ENF A;  3AMZ A;  1JQ4 A;  2NMQ A;  1ZDV A;  5BMH A;  2ZW1 A;  4C7Y A;  1P7E A;  2FBW B;  4TMA B;  1NI3 A;  1IGD A;  2WU5 B;  1UUP A;  3AE1 B;  3IXS A;  1B9R A;  1ET9 A;  1F0Z A;  4ZHO A;  4RH6 A;  2WXM A;  3NZ3 A;  4CQN A;  1UWM A;  2V4I B;  4NZL B;  1SJH D;  1J7C A;  2EEL A;  1PGX A;  1VRA B;  2Y3A A;  1Q10 A;  1K51 A;  3KLS X;  3I9V 1;  3BVZ A;  2IPK D;  2BW2 A;  2ZW0 A;  1IBX B;  2WS3 B;  4WUR A;  1VDV A;  1NYQ A;  3MP9 A;  1SIJ A;  2BT6 A;  3AE6 B;  1GB1 A;  1V1P A;  4OVZ A;  5C2T B;  3V3X A;  3AB5 A;  2KDM A;  3LXF A;  1PGA A;  1L0X B;  1SXT A;  3DWG C;  2RPV A;  3FC4 A;  4KGR A;  1DOI A;  4YT0 B;  2LHD A;  2WXN A;  1A70 A;  5LNK 1;  2RDG A;  1EWY C;  1BXT A;  1HQR D;  4GLS C;  5G5H A;  2M56 B;  1AYF A;  3U2S C;  2IJ0 A;  1L0V B;  2WXI A;  3R8B A;  3ZJV A;  4WH4 A;  2XN9 C;  1GPX A;  1JWA D;  1C4A A;  4RGO S;  1SSN A;  3MHZ A;  1JWU D;  2FUG 1;  2WXF A;  3Q8E A;  4RGT A;  3MFG A;  4OZB A;  1VR9 A;  3TUO A;  3U7Z A;  3R2T A;  5EE3 A;  3Q8B A;  3AV8 A;  1UNS A;  2DLB A;  1NVI D;  4NAW B;  4ARC A;  3B9J A;  2KQ4 X;  3C8Y A;  3URY A;  1XF5 L;  3P63 A;  2ON8 A;  2KN4 A;  4LK0 M;  1XO3 A;  1SB3 C;  3ZJU A;  1SJE D;  3E56 A;  3DWM A;  3RPF C;  1KLG D;  2K3U A;  5FKA C;  1DYQ A;  2OHF A;  3NVZ A;  1IUE A;  2PVO D;  2QSD A;  2GI9 A;  4ARI A;  1P7F A;  5HG2 A;  2K0P A;  2L1A A;  3PO0 A;  4RF1 A;  1JML A;  1HXY D;  2JSV X;  1DOY A;  1C76 A;  4HJG E;  2EKI A;  2V3N A;  1F77 A;  4Q2J A;  1D4B A;  1L5P A;  4UDU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...