1JWAD

Structure of the atp-bound moeb-moad protein complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
total genus 16
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2001-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwaD00
1UWMA 1DOXA 4HROA 3B9JA 1B9RA 1RWSA 1T3QA 1CZPA 1TYGB 1WXQA 1QOGA 1A70A 1L0VB 2LEKA 3NVWA 4YT0B 1E7PB 1EWYC 1PFDA 2AX5A 1AYFA 3AEAB 1OQQA 2OHFA 3AE1B 3EUB2 4JX1C 1QLBB 1QOBA 3LB8C 2QJLA 1KRHA 2CJOA 1R7SA 4YSYB 2ACZB 2CU3A 1N63A 4C7YA 2MJ3A 1RM6C 3AV8A 1N61A 1ZOYB 1V97A 3B2GA 3AE7B 1DOYA 3P1MA 1V8CA 2DBYA 3AE8B 5GXGB 5C2TB 1I7HA 2PVGC 2WDQB 4C80A 1NENB 2B76B 1ZUD2 4LTUA 2MJDA 5EE9A 5G5GA 2JQRB 4YSZB 1FXAA 1OFFA 2W54A 3NS1A 2BS3B 4HRSA 3HVZA 1QOFA 2MJEA 4YTMB 3P4RB 3AEBB 1QF6A 2BS2B 3AM9A 1FRDA 4N59A 1TKYA 3DWGC 1J7BA 5G5HA 2W3RA 2K9XA 3AE5B 1VDVA 1CJEA 1FFVA 3VRBB 1JQ4A 1L5PA 3LXFA 1ZXIA 5AUKA 1NYQA 1YQ4B 5EE0A 3NVZA 1VJKA 1WWTA 2QIEB 2WP9B 3P4QB 4US9A 5AUIA 3AB5A 3W5UB 1YJJA 1L6UA 2KAJA 3ZYYX 1SF0A 1N5XA 1NI3A 4WWMA 1JWBD 2WQYB 1QT9A 1FFUA 3AE4B 3HUIA 3SFEB 2Y5CA 3VRAB 3PO0A 1E0ZA 2CJNA 3ETRA 2WDRB 4N6EB 3VR8B 1TKGA 3W5VB 2KMMA 3AEFB 1KF6B 1IUEA 1RYJA 1JROA 1NVID 2M19A 4P6VF 4USAA 3AEDB 1JWAD 1KFYB 3AE3B 1NEKB 1N60A 1E10A 2W55A 1JRPA 4IDIA 4YTNB 4ZOHC 3P4SB 2PKOA 1ROEA 1AWDA 1YQ3B 2G1EA 2K22A 1XO3A 3CIRB 4YSXB 2DWQA 1WYGA 3RPFC 4ZHOA 5C3JB 1XLOA 2E3TA 1XLPA 3KWLA 1JALA 5EE3A 5H8YE 1JW9D 2WU5B 3BIID 1E9MA 3AH7A 1WRIA 3HRDD 2FBWB 4FXCA 2WS3B 1XLNA 5H92C 1PUTA 3L4PA 3NVYA 2PIAA 2Q5WD 1FM0D 3B2FA 1WGKA 2M56B 4JWSC 1PDXA 1XLQA 4C7ZA 3CWIA 1NYRA 3NVVA 2MH7A 1FMAD 1TKEA 4JWUC 3DWMA 3FC4A 2BT6A 2K5PA 3AEGB 4WQMA 3WCQA 3AECB 1E6EB 1YJIA 3SFDB 3AMZA 5MPOA 1TJEA 3AE9B 1FIQA 1N5WA 3AN1A 2WDVB 4ITKA 4KX6B 2H88B 4N58A 4US8A 1J7AA 3AE2B 1F0ZA 1GPXA 3FAHA 1RFKA 1FO4A 1J7CA 3ABVB 3AE6B 1SB3C 2EKIA 2JX5A 3P63A 4YTPB 5EE1A 3W9CB 2L83A 1OQRA 2WLBA 1SIJA 1DOIA 2PVOD 3NRZA 1DGJA 1QOAA 3SR6A 1FRRA 2W3SA 2BS4B 2HTME 4YXDB 4ZHPA 1ZP0B 2N0SB 1GAQB 2L52A 1N62A 3VR9B 1L6VA 3AEEB 1FXIA 4A9AA 2H89B 3P4PB 1VLBA 2WU2B
chains in the Genus database with same CATH superfamily
3C19A 4IM0A 3OJ3A 5DCNA 2XEWA 4YSYB 1K50A 3LJ3A 2N9PC 3ML8A 1E8WA 2IO0B 3WA0A 2BKRB 4H2AA 3VHTC 1ZUD2 1OTRB 3GE3C 4ANUA 1I4QA 3OG5A 4HJGE 2AQ3B 3EECA 1R4NI 4TMAB 1FCLA 4OHJA 3PRPB 4DK5A 1SJHD 2D10A 1F77A 3QC8B 1K52A 5J2RA 4NJCA 1VRAB 3ZIMA 3MHZA 2MBHA 2WQYB 3VRAB 1ZDVA 2ZPYA 3ETRA 1WJ4A 4N6EB 5E6OA 4IM2A 1RYJA 3A4RA 2JXTA 2WXJA 5BO4B 4E74A 1JRPA 1V5OA 3A1QB 3A33B 4YSXB 3PSEB 1YIWA 1E8ZA 5IN7A 2WU5B 2HJ1A 3IXSA 3PTFC 4CO7A 4G11A 3JVZX 1WMHA 3CWIA 3NVVA 1OEYA 1TY2A 3V6EB 2JSVX 2BYEA 1WM3A 1EF1A 1RAXA 1OQRA 3MFGA 4A3OA 4YXDB 3EFUA 1HZ6A 2DYOA 1TZOA 5IP4D 1UZXB 4W9FA 1T3QA 2DX5B 2J7QB 1I4HA 4EE2A 3AU4A 5JZEB 2K25A 1P0RA 3N1XC 3NJTA 2CJOA 2IBIB 4XX5A 4GDLB 4W9HA 2FAZA 3B0AA 4C80A 4KGTA 2ZVOA 1J8CA 1YD8U 3BZDB 1QOFA 5LXHA 3AEBB 2BPSA 2WXHA 2C7MB 1XD3B 1XEEA 3UINB 2KHWB 2KWVB 2R61A 2WXGA 1UELA 3PREA 2REXA 3UIPB 2J0KA 4DDID 1NI3A 1F52A 2AYOB 2WX1A 3DVGY 4B6WA 2ZJDA 4AP4C 3VR8B 5AZFA 4C4VB 4JPSA 2KOXA 1MVKA 1XCQL 5H8YE 4C4VA 4FXCA 4MELA 2B3AA 1QQRA 1LQBA 2INPE 2PIAA 1FM0D 4WJPA 2QMTA 4GLSC 4IOIE 1UBQA 1FNWA 2J52A 4NJ6A 4HKQA 2QC8A 3L08A 4NY0A 1D5MC 3ZGZA 4M00A 1GPXA 3FAHA 3UF8A 1SB3C 4FADA 3U30A 3Q8CA 2KANA 2HTME 5D6JB 3C8YA 1EU4A 3A1QA 1ZPSA 3ZNGC 1CMXB 4HROA 1B9RA 3O13A 4YT0B 5I4DA 3EUB2 1GB4A 1T5XD 3Q14C 2GB1A 3N20C 3GP7A 1BT0A 5CX3A 3B2GA 3BINA 3AE8B 1NENB 5AEKB 4YSZB 3AXCA 4K3CA 3NS1A 2KLCA 2WX0A 4M01A 1Q0WB 2DNFA 1TS5A 1ZGUB 4FJYA 1UWXA 3UIOB 5GMVA 3R2TA 2KT7A 1GB1A 1WYWB 1V80A 1QZEA 3AE5B 5J18A 1V86A 2OJRA 1V2YA 2DHZA 4BKTA 1U4AA 2TSSA 4E71A 1UGMA 3NUHB 4PK1A 1WX8A 1CQVA 2ZEQA 1KLGD 4I6PA 2D2QA 3VDZA 1C76A 4DXGA 1YMHE 3T3NA 1ISNA 3VVWB 1HA5A 1QILA 3D32A 1LM8B 4GDLA 3TMPB 2BTEA 1NDDA 2LI5A 2KN5A 3AEDB 4GDKB 2FUG1 5TSSA 4M0WB 3I9V1 4WJQA 4PYZA 1XLPA 2ONQA 1XLNA 4HEA1 3ZNZB 4FA6A 3N3KB 1BUIC 4FHJA 2K8CA 4BKSD 2M56B 2FIFA 4LCDE 1EM7A 2HJ8A 2V4LA 1CK1A 2BT6A 4BOSC 2LGDA 4JLCA 3AE9B 2L76A 3I3TB 4KIKB 1D5ZC 1RFKA 3RULA 2I2YA 1C4AA 2LVPA 2XK5A 3NRZA 3K9PB 2KYWA 1E90A 1N62A 3VR9B 3AEEB 4DWFA 3IT6B 4FN2A 1C9FA 1ESFA 2MX2A 2AQ2B 1C79A 2CU1A 3KUCB 3MHSD 1HQRD 1SGHA 1DOYA 3P1MA 1I7HA 1WGGA 1F2RC 3N32A 1HEZE 2RSUA 1UF0A 4HRSA 3KUZA 4KZCA 3P4RB 2PE6B 1JMLA 2W3RA 2INCC 1XXGA 4AWJA 4B95A 2KX0A 1WWTA 2L3ZA 4B9KA 2IYDB 2PW9A 3M63B 1GC6A 4OZBA 2WNMA 2CJNA 4NAWA 3ZXRA 1XF5L 2WHIA 4KV2A 4DHJD 2J0JA 4IDIA 1IBXB 1KLUD 2VH1A 1JALA 1L0XB 2FBWB 5H92C 3QHTA 4LNFA 4C7ZA 3ZJVA 3Q6BA 2IZVB 2W82A 5D3IB 1IGDA 2KJ6A 4KDIC 2Y5PA 2BYTA 1T6BX 3URYA 2K0PA 3TEWA 3QK0A 1P98A 1SIFA 3RNCC 3RFZB 5EE1A 3ZNID 5E6NA 3PZDA 2RD0A 3EA6A 2G4SA 3KW5B 1FXIA 4OVUA 2AWTA 1KOTA 2J0MA 2SAKA 1EWYC 2BBCA 3N30A 2ZPNA 3UI3A 2IY1B 2K8BA 4ACFA 4HKZE 1WGYA 3U8ZA 3R66C 4RM8A 1ZDXA 3Q3OC 5C2TB 2B76B 4HDOA 3VUYA 4F8CB 4P1BC 1GC7A 4A90A 4MSQB 2J53A 4MGZE 2IO1B 3VRBB 4RF0A 2WYQA 2WXQA 3R3MA 2VRRB 4WWMA 1QT9A 4MGYE 2Y5CA 3BVMA 2DZMA 4EZKA 3PRMB 1JWAD 3AE3B 3VXWA 4HJKA 1E10A 1ENFA 1Z2MA 1YQ3B 4HPMB 3MP9A 4AUQC 2I1JA 4MDKE 2BWFA 5CHWA 2IPKD 2O2VA 4IWOA 2N1WA 4XE0A 1PUTA 2LUEA 2RGFA 3WANA 4LDTB 2FNJB 2OJWA 4I6LB 1RFAA 2JWZA 4EOYA 2JWUA 4G0NB 1TKEA 4JWUC 1FCCC 2NPTA 2MCNB 2KTRA 3SFDB 3DBRI 4BOZB 1N5WA 3KLSX 5CHVC 4EEWA 2JY6A 1WIAA 3W9CB 2L83A 3SR6A 5BYSA 3VUXA 2KTRB 2PTLA 3X0WA 2RDBC 3ZVVA 1V1OA 3B9JA 4ZYNA 3VTUA 4BZAA 1WSPA 4L2YA 2LMCA 4MT5A 1GNUA 3RZFA 3UGBB 1R7SA 1N63A 3P42A 4ANWA 4K3BA 2NS5A 4GXBA 3Q8FA 2BKFA 4KVGB 3V6CB 5FR3A 1D5XC 2W54A 3RUIB 1Q1OA 2BB6A 3W2DA 3Q2AC 3HK0A 1PYWD 4DHZE 2K9XA 1KH0A 1UD7A 5D3DA 2YEPF 3VTVA 1YQ4B 4XC2A 2KDIA 4AOFA 2HDEA 3RNBC 1WX7A 4WQOB 3H9DA 1ZW7A 3EC8A 3DBRB 1TS2A 1YQBA 3U7DA 3ZJTA 4GSWA 2JRIB 2UYZB 3NZUA 3HVDA 4IC7B 1BMLC 3RZWC 1TKGA 3IFWB 2KMMA 2PPHA 1NVID 1WF9A 1SE9A 2LHEA 2GOWA 1P3QU 4TQ0A 3Q3JA 2MBBB 2V3PA 1ROEA 2K22A 2MHJA 2NTTA 3NG0A 1RLFA 4LJPB 1KLVA 1WRIA 2GBNA 3NZ3A 1Q5WB 4RH6A 1FMAD 1T0QC 2NBVB 2N9LA 3WCQA 2LD9A 1NBFC 2KNBA 1GOZA 1V81A 1F0ZA 3ZO5B 2NVUI 1FO4A 2JXXA 1K53A 3U52E 2NBWB 2Z59B 1YJ1A 2D3GA 1TIFA 3N1YC 3R7QA 3RT3B 3CSTA 1WE7A 2M8SA 2KACA 3H8HA 2GBMA 4W9EA 1T0YA 1V49A 4MEMA 4A3PA 1PFDA 3NOBA 2MJ3A 4MSMB 1EO6A 2NPTB 2PLPA 1VR9A 5G2NA 2FCQA 3T9LA 1VD2A 2WXRA 3CMMB 2JRHA 2NMQA 4M8NA 2KDEB 4O1NA 4WWOA 5J17A 4EKUA 4BVUC 4JQWC 1FFVA 4M02A 3VUWA 4EZJA 1I35A 4R3DA 3PPAA 4XWTA 4ASWC 2KC1A 3C0RB 4FLHA 4GMVA 4BAXA 1JROA 3R2IA 1WFYA 2N9KA 3VFKA 5JXVA 4LJOB 2LRUA 4ZOHC 3WIMA 1WMHB 1OGWA 1XO3A 1C1YB 5EDSA 3VTWA 2L00B 4OVVA 4GN1A 1P7EA 3BIID 1YX5B 4CQNA 2KD0A 2Q5WD 3Q69A 2M17A 1I42A 2YEPB 3DBHB 2NR2A 1E7VA 2BQQA 3H7PB 4N58A 5KHQA 3BY4B 4DBGA 4CYEA 2N1VA 1QKZA 1R4MB 4KSKC 3ZUNA 2PVOD 3DVGX 4PS8A 1FRRA 4ZYSA 1GAQB 2L52A 3H7PA 1V6EA 1C77A 2ZW1A 3ZTCA 4IM3A 4PT5A 3JYUA 3DVNV 1DOXA 2CHZA 5JHAA 3TEYA 1FD6A 1WE6A 2MBOA 3WAMA 3DCGA 1QOBA 1YN3A 1C3TA 2UU7A 3HIZA 2JUOA 1V97A 2JU6X 3AE7B 4ICVA 1PGAA 2KTFA 3GOEA 2C5LC 3V62A 1YNTE 1SSNA 2DAJA 4J3OD 3HVZA 5IAAC 1BXTA 2L32A 3SU8X 2ZW0A 4N59A 3X23A 5G5HA 3RYTA 1VDVA 2YLMA 3FILA 4Q2JA 4K7UA 3LXFA 3W1YA 2V9HA 2DENB 3AULA 2G3QB 3M62B 2IO2B 4ARCA 3ZW3A 2LUMA 1H8CA 1N5XA 1EWCA 3DBHI 2QCZA 1E7UA 3KH0A 3PVLA 2X8XX 2IO3B 2JZ3B 4K1RB 2EMTA 1R4MI 1WX9A 1KF6B 2CKHB 1WXAA 4G50A 1WZ3A 1EU3A 1WR1A 1PGBA 3H1UA 1JWMD 1F1HA 2BW2A 2G1EA 3CIRB 4F7ZA 2C7HA 1XLOA 2E3TA 2BWES 3AH7A 5DPTA 2KQSA 2LGSA 1TY0A 2W9NA 2DAFA 2BGFA 4WAFA 3ZRFA 2QILA 4K81A 2FUHB 1J19A 1FNUA 3ZQ4A 1MI0A 3PRZA 1TJEA 3ZTDA 1FIQA 1STEA 4WIPA 2WDVB 3V3XA 1J7AA 3AE2B 2KVZA 1C4PA 1B1ZA 3P63A 4A6QA 4B0MA 4ZHPA 4LNNA 1L6VA 2FCNA 4RM9A 1UWMA 3L0WB 2VH2A 5BMHA 1WXQA 2LEKA 2KVRA 3AEAB 2KDMA 4A8XC 4RMAA 2JVCA 2HE7A 2CU3A 4A55A 2LGYA 3PGEA 4K7SA 1VZ6A 4DQOC 2MA9B 2O6VD 2WXMA 4JL9A 4OZAA 2MJDA 1TS4A 3KWVA 3GB1A 2L1AA 3SD5A 3Q8EA 4LNIA 1FRDA 4NQKE 1VZ8A 3DDCB 4S17A 1ZKHA 3L16A 3APCA 1WXVA 2AQ1B 2BYFA 2KWCA 2LGXA 2WP9B 2V3NA 2K1FA 3AB5A 1L6UA 3WALA 4GDKA 2KKCA 4KDLB 2PE9A 2MBEA 3AE4B 2MEKA 3KQ4A 4IWQA 4P1CC 4KSLC 2ZNVB 4REZA 1IUEA 1LO5D 3UQAA 3NY5A 4YTNB 4IWPA 2FIDA 1Z5SB 2KLGA 3NVYA 3TUOA 2DZJA 3B2FA 1HXYD 1P1AA 2KMAA 1YX6B 3P2BA 3U2SC 2K5PA 4IUMB 4URKA 1YJIA 3APDA 4ICUA 4ITKA 4KX6B 4ZRPA 3QAQA 5DPRA 3ZLZA 2WLBA 5IOIA 1DGJA 2JYTA 1ZP0B 3APFA 2WWZA 3MJ5A 1FEHA 2GI9A 2L8JA 1CZPA 1EF5A 1OEYJ 1AYFA 3AE1B 1H4RA 1UNSA 3QWZB 2ACZB 2O6VA 4HLEA 3AV8A 3K9OB 2DLBA 3PHXB 3MJWA 5GXGB 2PVGC 3RNFC 5CTRC 5IA7A 5EE9A 1FXAA 2E6XA 4HVBA 4YTMB 2MQJA 2WXNA 4GB9A 1ZE3D 2BS2B 3AM9A 5T8IA 1UH6A 4WH4A 4NAWB 4E3CA 2R2QA 5AUIA 2RMMA 1C78A 1SF0A 1KJTA 1N6ZA 2GBRA 1MHHE 3A9KB 2NCNA 3PO0A 4S0RA 1AN8A 4GOCA 4W9CA 4P6VF 1VZ7A 5IKCM 2PMVA 3SDLC 4MJSA 1V5TA 2NBUA 2ZCCA 2DWQA 4D2KA 4IG7B 3L4PA 1T0SC 3PLVA 4MJSB 3V60A 3T3OA 2MH7A 2LZ6A 3DWMA 3FC4A 1MG8A 5LXIB 2KO3A 3AECB 1E6EB 3M95A 2GBKA 4AJWA 2L7RA 3NS8A 4DHJB 1SIJA 4KKJA 1JWSD 2N0SB 2N7JA 4M0WA 1VLBA 4XWWA 1SXTA 2LWPA 1UGJA 1ET6A 3L54A 2ZVNA 3BK1A 4OW0A 1QLBB 1X1MA 4HPLB 3BWUD 3WAPA 3ONSA 1XT9B 1UUPA 2J4XA 4WAAA 2DBYA 2DYMA 2JQRB 4RFBA 1MHXA 2J42A 4XYCA 1HZ5A 2Z8LA 3E9SA 2OEDA 4EUTA 3ENEA 2A4ZA 4ZDVA 1WY8A 2MJEA 1IYFA 1HE8A 4ARIA 2EKEC 2WXLA 1CJEA 3RNGC 1JQ4A 2KFJA 4ZRIA 2XN9C 3NVZA 4HWIB 3VH3B 1YJJA 4LNKA 4ZRJA 3IHPC 3KYCD 4YWGG 2O6VB 4WURA 4NZLB 2R2OA 4W9DA 4F1SA 2O2VB 2XNAC 3BYTB 3OAWA 3W5VB 4DHZB 4USAA 1WXMA 3VAWA 4K7WA 3DVNU 2L0TA 2PKOA 1GJZA 1AWDA 1LXDA 4MGIE 4HDQA 3RPFC 4QAYA 3KWLA 1VCBA 2AL6A 3EGRA 3JW0X 1JW9D 1E9MA 1A5RA 2Z0EB 3R7RA 4EFOA 3IG3A 3QIJA 3R8BA 3TCAA 4JWSC 3PV1A 2KK8A 3JSVA 3N1ZC 3TJPA 4ANVA 3AMZA 3ZNHB 4M8MA 1E0ZA 3TSSA 2RDHA 4ANXA 4YTPB 5AZHA 3U7ZA 3PS6A 3DBSA 3V61A 2M0XA 4RCOA 2H89B 4TUUA 1IBXA 3B1LX 2LXAA 3SHQA 4N9F4 1SE4A 1TT5B 1WRDB 4KZ0A 1L2NA 1E7PB 1TTNA 2KFKB 4X57B 4RGNA 2EMSA 2RR9A 4HK2A 2KC2A 3PHWB 2SEBD 2V0GA 2WDQB 3DOWA 3HM6X 3Q8BA 2FCSA 2KFKA 4ZRKA 1M94A 1IP9A 5HG2A 1Q10A 1TKYA 5LLIA 3QX1A 4W9JA 1ZXIA 2LXCA 3M3JA 5EE0A 2WGSA 2N9EB 3TEXA 3W5UB 3AI5A 2G9HD 1FFUA 4RGTA 3SFEB 2JF5A 1KTKA 2CR5A 2ZZPB 5E6JA 2GMIC 4HCPB 3DBLI 1IGCA 1S1QB 1NEKB 5TR5A 2KJHB 5KHOA 1JWUD 2C60A 5L95C 5HI1A 3U4EG 1L0YB 4ZHOA 4XDCA 2VZKB 4J6IA 5C3JB 3FKYA 2OOBB 3MC0B 2CHXA 2WS3B 4AJYB 2QEJC 3L10B 1WGKA 4HCNB 2QHOA 3QARA 1JRUA 2BB5A 2V1YA 3PT2B 4DDGD 3DQVA 3ZDMC 2LGIA 4WQMA 4PS7A 1L7YA 5MPOA 2JT4B 4US8A 2KDBA 5JH5C 5E6PA 3Q3MC 1J7CA 3AE6B 2Y5BB 4NQLB 1EUVB 1I4XA 1PQSA 2MSED 4XGAB 1I4RA 1ZXHA 1R4NB 1V9JA 1TYGB 3W1SC 1YOVB 2GLSA 1ACCA 2QJLA 5BMIA 1AARA 4RF1A 5AZGA 1RM6C 2A5UA 4HPPA 1N61A 4AS1A 1FXTB 4L1BA 3JSVB 1WGHA 3S2AA 4MGKE 1V8CA 2HTHA 1SE2A 2GRIA 3DBLB 4KGSA 4FJVB 1Y56A 1NI2A 2C7NB 4WJOA 2LRWA 2AEHA 2D3AA 2INDC 2YVCA 3IBEA 2INNE 1WM2A 2ZNVC 1V1PA 4AQ7A 4BBNC 3P4QB 3I5JC 2KAJA 4L23A 3ZYYX 3DHIC 3VQIA 5HKHA 3NHEB 4IW0A 3ZJUA 4II3B 2D11A 3DHGC 1V1PB 3A4SC 3GE8C 5BYRA 4UDUC 2D3BA 2FE8A 5C1ZA 1F9JA 2N7EA 2KQ4X 3KYDD 3MTNB 2WDTB 3ML9A 3ALBA 3RNEC 1WJ6A 2KN4A 4NJ7A 2KWDA 3HRDD 2FCMA 2KWUB 4RGOS 4LNOA 1E8XA 1L4DB 1YN4A 3MC8A 2MW5A 3OWEB 2LHDA 2MLBA 2D07B 2K6QA 1AW7A 3ABVB 4MM3B 1MFWA 3SEBA 1FNVA 2QDFA 2I1KA 3L17A 2WXIA 4KIKA 1DYQA 3ZRCA 4TKNA 2WU2B 3ECIA 3TL5A 3IAS1 1QOGA 1A70A 2XK5B 3DPDA 3NVWA 3QJZA 4JX1C 1XQQA 2L05A 1KRHA 4C7YA 4BFRA 1ZOYB 1E8YA 3QCAA 1J0GA 1E5WA 2IGDA 5G5GA 4LTUA 4NAMA 1OFFA 1TBEA 1LGRA 4W9IA 3GZNB 3EFCA 2MP2B 2KQ7A 4JIOU 2WXOA 2G4DB 2K8HA 3BK2A 2KDFB 1L5PA 5AUKA 2ZCBA 5CHFA 2MP2A 2X38A 3E56A 4US9A 4EZLA 1WGDA 2IJ0A 3I57A 3PZ7A 4FHKA 3ZDTA 4NPNA 3QQ8B 1JWBD 2WXPA 2RPVA 1LFDA 3EHVA 4GIVA 2M19A 1WGRA 1KFYB 1TGZB 3PZ8A 3N9YC 2AL3A 2LFIA 2ASQA 2CS4A 5G55A 3TBLD 1S3SG 1D6EC 4LLGM 4W9LA 5FR6A 3KUDB 4W9KA 1TZ1A 4HXDA 2K3UA 2KZRA 3J9CA 1PDXA 3NZSA 1NYRA 5HHDG 1XCTL 4BKSA 5D94A 3BVGA 1P7FA 2WXKA 4TQ1A 5HFYA 4GU2A 3HM3A 3TEZA 3KVFB 4IKGA 4WWPA 2K39A 2JPHA 2EKIA 2JX5A 2V3SA 3GZNI 5BYQA 1I4PA 2LJ5A 2NTSA 5BMGA 2Y3AA 4TV3A 3B08A 2HD5B 5C23A 2JZZA 2C9WB 1I4GA 4C00A 2M4NA 2Z0DB 3O65B 4OZCA 1WZ0A 1SE3A 1G6JA 1YN5A 3RI7C 2IDYA 4C56C 2LASA 1P9DU 2MRPA 1PGXA 2VZKD 1WJNA 1SEBD 2PJHA 2BF8B 4KKIA 4MACA 2L0FA 4A20A 3IT4B 5D2MB 3PLUA 1K51A 3VH4B 1QF6A 2LJIA 4MM3A 1D4BA 4P7IA 3OLMD 2KXJA 1SBBB 3V05A 1NYQA 1VJKA 1F2RI 2RDGA 1MG4A 2WXFA 3ZXVA 2DZKA 1SJED 4PS3A 5DPSA 2PEAA 4FULA 2KMCA 3LYYA 3HHMA 4B0EA 3AEFB 4CHKA 2UWQA 4JGHB 4MH8A 2XBBC 2W55A 3P4SB 4DXFA 1WYGA 2IGHA 5EE3A 2GBJA 1MPEA 3Q3FA 4XDDA 1RRBA 2ICIA 4JE3B 1D3ZA 2LVOA 3AU5A 2MWSB 1K8RB 3CSFA 4WWNA 3FILB 2IY0B 4RNAA 2G45B 3H6NA 3AEGB 2N4FA 2V4IB 3AN1A 1WXSA 2H88B 5L83A 3RCZA 3LDZE 1TS3A 3OJ4B 1FPYA 4KGRA 3H7SA 2M0AA 1ET9A 2DYBA 3Q8AA 2LVQA 2CHWA 4I6NB 4LK0M 4A9AA 5FK9C 4XZ4A 3T8MA 1RWSA 1Y8RC 3Q3NC 1UBIA 1L0VB 3ZKJC 4RGMA 2AX5A 1OQQA 2OHFA 1GG3A 3LB8C 3W1SA 1WR6E 1MJDA 3L13A 4DXAB 2N7DA 2RPQA 4II2B 4PYUA 2M1MA 5D7GA 4BKGA 2BS3B 4WJNA 3RD2A 1HTOA 1WH3A 3WAOA 5DPWA 3DWGC 1J7BA 2I38A 4GGQA 1M4VA 3CF6E 4G3XB 1OQYA 3A9KA 5IO9A 2DZIA 4BBNF 4ZRQA 3UQBA 2K6DB 2QIEB 2D3CA 4W9GA 2BYVE 4YL8A 3IAM1 1C4CA 5JHBA 3HUIA 1WI0A 3RMKC 1KM7A 3RNAC 4FBJB 2WDRB 2N9XA 3GS2A 4FJZA 3DHHC 1N60A 2IGGA 4MH0E 3A9JA 1L4ZB 3TIXA 3RN9C 1T0RC 2JYEA 2KJRA 1HTQA 2BVCA 3A9JB 3QA8A 2JZPA 4TSSA 1XLQA 4LDTD 1GUAB 2QSDA 5FKAC 4NNJB 2EELA 1IPGA 3BVZA 4P16A 2KX3A 2ON8A 3MC9A 2MBQA 5LNK1 3BYYB 1DOIA 1WJUA 1QOAA 2W3SA 1JCKB 2BS4B 2D5GA 3IVFA 3I63C 3P4PB 4OVZA
chains in the Genus database with same CATH topology
1UWMA 1ZXHA 1TYGB 1WXQA 5BMHA 2LEKA 2SAKA 1EWYC 2BBCA 2KDMA 3AEAB 4A8XC 3UI3A 1ACCA 2QJLA 5BMIA 4YSYB 2CU3A 4RF1A 1K50A 4A55A 1RM6C 4HKZE 1N61A 1VZ6A 4AS1A 4DQOC 4L1BA 1ZDXA 1V8CA 5C2TB 4H2AA 2WXMA 1SE2A 2B76B 1ZUD2 2GRIA 2MJDA 4OZAA 4KGSA 1TS4A 1Y56A 3KWVA 4A90A 3GB1A 2L1AA 1I4QA 4HJGE 2AQ3B 3Q8EA 1FRDA 1VZ8A 4TMAB 1FCLA 2J53A 4OHJA 2INNE 3VRBB 4RF0A 1SJHD 2AQ1B 1F77A 2WXQA 1K52A 1V1PA 4AQ7A 2WP9B 3P4QB 2V3NA 3AB5A 1L6UA 2KAJA 4L23A 3ZYYX 4NJCA 1VRAB 4WWMA 3MHZA 2WQYB 1QT9A 3VQIA 3AE4B 2MEKA 2Y5CA 1ZDVA 3VRAB 3KQ4A 3ZJUA 3ETRA 4N6EB 1V1PB 5BYRA 3BVMA 4UDUC 4REZA 1IUEA 1RYJA 1LO5D 2JXTA 2WXJA 1JWAD 3AE3B 2FE8A 1E10A 1ENFA 4YTNB 1JRPA 2KQ4X 1YQ3B 3MP9A 4YSXB 2IPKD 2WU5B 2KN4A 2KWDA 3HRDD 3IXSA 4XE0A 4RGOS 1PUTA 3NVYA 3TUOA 3B2FA 1HXYD 2JWUA 3CWIA 3NVVA 3U2SC 1TKEA 4JWUC 1L4DB 1FCCC 1YN4A 1TY2A 2K5PA 2JSVX 1YJIA 3SFDB 3OWEB 4ITKA 4KX6B 2LHDA 1N5WA 4ZRPA 3KLSX 1AW7A 3ABVB 3W9CB 2L83A 1OQRA 2WLBA 4MM3B 3SEBA 3SR6A 5BYSA 1DGJA 3MFGA 2JYTA 4YXDB 1FNVA 1ZP0B 2PTLA 1HZ6A 2DYOA 2WXIA 1TZOA 1DYQA 3MJ5A 1FEHA 2WU2B 1V1OA 2GI9A 3B9JA 1T3QA 1CZPA 3IAS1 1QOGA 1A70A 3NVWA 1WSPA 4L2YA 1AYFA 1I4HA 3AE1B 4JX1C 4EE2A 2LMCA 4MT5A 1KRHA 2CJOA 1R7SA 1UNSA 2ACZB 4C7YA 1N63A 3AV8A 3P42A 1ZOYB 2DLBA 4GDLB 5GXGB 4C80A 3Q8FA 2IGDA 2PVGC 5G5GA 4LTUA 5EE9A 4KGTA 5FR3A 4NAMA 1FXAA 1OFFA 1D5XC 2W54A 3BZDB 2BB6A 2E6XA 3W2DA 1QOFA 4YTMB 2WXNA 3AEBB 1ZE3D 2BS2B 1PYWD 3AM9A 2WXOA 2WXHA 3BK2A 2K9XA 5T8IA 1KH0A 1L5PA 5D3DA 5AUKA 2YEPF 1XEEA 4WH4A 1YQ4B 2R61A 2WXGA 4NAWB 2X38A 3E56A 5AUIA 2HDEA 4US9A 2RMMA 1C78A 2IJ0A 3I57A 3PZ7A 1SF0A 1NI3A 1JWBD 1TS2A 3ZJTA 2WXPA 2RPVA 1MHHE 3PO0A 3HVDA 1BMLC 1AN8A 3VR8B 1TKGA 4JPSA 2KMMA 1NVID 1VZ7A 2M19A 4P6VF 2LHEA 2PMVA 1KFYB 3PZ8A 1MVKA 4TQ0A 2V3PA 3N9YC 2LFIA 1ROEA 2K22A 1XCQL 2DWQA 2NTTA 5H8YE 1D6EC 4D2KA 4LLGM 1WRIA 4FXCA 1QQRA 2K3UA 3L4PA 2INPE 2PIAA 1FM0D 3NZ3A 3J9CA 1PDXA 2QMTA 4GLSC 4RH6A 4IOIE 1NYRA 3T3OA 2MH7A 1FMAD 5HHDG 3DWMA 3FC4A 1XCTL 2N9LA 1FNWA 3WCQA 3AECB 1E6EB 2J52A 3BVGA 1P7FA 4HKQA 1GOZA 2WXKA 1D5MC 4TQ1A 5HFYA 1F0ZA 3ZGZA 1GPXA 3FAHA 3TEZA 1FO4A 4IKGA 1K53A 1SB3C 2EKIA 2JX5A 3U52E 5BYQA 1SIJA 3Q8CA 1I4PA 2NTSA 2HTME 4KKJA 1JWSD 5BMGA 2Y3AA 2N0SB 3C8YA 2KACA 3H8HA 1EU4A 1ZPSA 2N7JA 4M0WA 1VLBA 4XWWA 1SXTA 4HROA 1I4GA 1B9RA 1UGJA 4OZCA 1ET6A 3O13A 4YT0B 5I4DA 1PFDA 3EUB2 3BK1A 4OW0A 1QLBB 1SE3A 1GB4A 3BWUD 1T5XD 1YN5A 2GB1A 2IDYA 4C56C 3GP7A 2MJ3A 1UUPA 1PGXA 2VZKD 2J4XA 3B2GA 1SEBD 2DBYA 3AE8B 2PLPA 1NENB 1VR9A 2DYMA 4KKIA 4MACA 4YSZB 2JQRB 4RFBA 1MHXA 2J42A 1HZ5A 3IT4B 3NS1A 2WXRA 2Z8LA 3E9SA 1TS5A 2OEDA 2NMQA 1UWXA 2MJEA 3R2TA 1K51A 1GB1A 1QF6A 2LJIA 4O1NA 1D4BA 4ARIA 3AE5B 2WXLA 1CJEA 1FFVA 1JQ4A 1SBBB 3V05A 1NYQA 2XN9C 3NVZA 2TSSA 1VJKA 3NUHB 1F2RI 1CQVA 4R3DA 2RDGA 1KLGD 1YJJA 3T3NA 4DXGA 1C76A 1YMHE 2WXFA 1SJED 4YWGG 4XWTA 3LYYA 4NZLB 4OVZA 4WURA 1HA5A 1QILA 2BTEA 2XNAC 3BYTB 3W5VB 4B0EA 3AEFB 1JROA 3R2IA 2N9KA 4USAA 3AEDB 4GDKB 4MH8A 5JXVA 2W55A 2FUG1 4ZOHC 3P4SB 5TSSA 4DXFA 2PKOA 3I9V1 1AWDA 1XO3A 1WYGA 3RPFC 2IGHA 1XLPA 3KWLA 1MPEA 2ONQA 3EGRA 5EE3A 1JW9D 1P7EA 3BIID 1E9MA 4XDDA 2ICIA 4JE3B 1XLNA 4HEA1 4CQNA 1BUIC 2Q5WD 3FILB 3R8BA 2M56B 4JWSC 3Q69A 4RNAA 1EM7A 1CK1A 2BT6A 3AEGB 2V4IB 2YEPB 3AMZA 3AE9B 3AN1A 1E0ZA 4N58A 2H88B 3TSSA 1TS3A 1D5ZC 2RDHA 1RFKA 2I2YA 1C4AA 4YTPB 3U7ZA 1QKZA 3NRZA 4KGRA 2PVOD 1FRRA 2M0AA 1ET9A 4ZYSA 4RCOA 3Q8AA 1GAQB 2L52A 1N62A 3VR9B 3AEEB 4LK0M 4A9AA 2H89B 1C77A 2ZW1A 4PT5A 1IBXA 5FK9C 1DOXA 3IT6B 1RWSA 3TEYA 1SE4A 1C9FA 1FD6A 1L0VB 4RGMA 1E7PB 2AX5A 1OQQA 1ESFA 2OHFA 1QOBA 1YN3A 3LB8C 3W1SA 2AQ2B 1C79A 1HQRD 1V97A 2JU6X 3AE7B 4RGNA 1PGAA 3P1MA 1DOYA 2SEBD 2V0GA 1I7HA 2WDQB 3Q8BA 5D7GA 1F2RC 1YNTE 1HEZE 1SSNA 2BS3B 5HG2A 4J3OD 4HRSA 3HVZA 1BXTA 1Q10A 2L32A 2ZW0A 3P4RB 4N59A 1TKYA 3DWGC 1J7BA 2I38A 5G5HA 1JMLA 2W3RA 1VDVA 3FILA 4Q2JA 1XXGA 3LXFA 1ZXIA 1M4VA 5EE0A 4ZRQA 1WWTA 2QIEB 4ARCA 3TEXA 3W5UB 2LUMA 1N5XA 2PW9A 2G9HD 1EWCA 3IAM1 1FFUA 1C4CA 3HUIA 4RGTA 3SFEB 4OZBA 2WNMA 2CJNA 1KTKA 2WDRB 5E6JA 1XF5L 1KF6B 3GS2A 1IGCA 1EU3A 1N60A 1NEKB 2IGGA 4IDIA 1PGBA 1L4ZB 1JWUD 5HI1A 3U4EG 1IBXB 1JWMD 1KLUD 1L0YB 2BW2A 2G1EA 3CIRB 4ZHOA 4XDCA 2VZKB 5C3JB 1XLOA 2E3TA 1JALA 1L0XB 2JYEA 3MC0B 3AH7A 1TY0A 2FBWB 2WS3B 4WAFA 5H92C 2QEJC 2QILA 1WGKA 2JZPA 2BB5A 4TSSA 1XLQA 4C7ZA 3ZJVA 1FNUA 2W82A 2LGIA 2QSDA 3ZQ4A 1MI0A 5FKAC 5D3IB 1IGDA 4WQMA 2EELA 2Y5PA 2BYTA 5MPOA 1TJEA 1FIQA 1STEA 4WIPA 1T6BX 2WDVB 3V3XA 3URYA 4US8A 3BVZA 1J7AA 2K0PA 3AE2B 4P16A 1C4PA 3TEWA 1J7CA 3AE6B 2ON8A 3RFZB 1B1ZA 3P63A 5EE1A 4A6QA 1I4XA 5LNK1 3BYYB 1DOIA 4B0MA 1QOAA 2W3SA 1JCKB 2BS4B 4ZHPA 2D5GA 3EA6A 1L6VA 1FXIA 3P4PB 1I4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWM A;  1DOX A;  4HRO A;  3B9J A;  1B9R A;  1RWS A;  1T3Q A;  1CZP A;  1TYG B;  1WXQ A;  1QOG A;  1A70 A;  1L0V B;  2LEK A;  3NVW A;  4YT0 B;  1E7P B;  1EWY C;  1PFD A;  2AX5 A;  1AYF A;  3AEA B;  1OQQ A;  2OHF A;  3AE1 B;  3EUB 2;  4JX1 C;  1QLB B;  1QOB A;  3LB8 C;  2QJL A;  1KRH A;  2CJO A;  1R7S A;  4YSY B;  2ACZ B;  2CU3 A;  1N63 A;  4C7Y A;  2MJ3 A;  1RM6 C;  3AV8 A;  1N61 A;  1ZOY B;  1V97 A;  3B2G A;  3AE7 B;  1DOY A;  3P1M A;  1V8C A;  2DBY A;  3AE8 B;  5GXG B;  5C2T B;  1I7H A;  2PVG C;  2WDQ B;  4C80 A;  1NEN B;  2B76 B;  1ZUD 2;  4LTU A;  2MJD A;  5EE9 A;  5G5G A;  2JQR B;  4YSZ B;  1FXA A;  1OFF A;  2W54 A;  3NS1 A;  2BS3 B;  4HRS A;  3HVZ A;  1QOF A;  2MJE A;  4YTM B;  3P4R B;  3AEB B;  1QF6 A;  2BS2 B;  3AM9 A;  1FRD A;  4N59 A;  1TKY A;  3DWG C;  1J7B A;  5G5H A;  2W3R A;  2K9X A;  3AE5 B;  1VDV A;  1CJE A;  1FFV A;  3VRB B;  1JQ4 A;  1L5P A;  3LXF A;  1ZXI A;  5AUK A;  1NYQ A;  1YQ4 B;  5EE0 A;  3NVZ A;  1VJK A;  1WWT A;  2QIE B;  2WP9 B;  3P4Q B;  4US9 A;  5AUI A;  3AB5 A;  3W5U B;  1YJJ A;  1L6U A;  2KAJ A;  3ZYY X;  1SF0 A;  1N5X A;  1NI3 A;  4WWM A;  1JWB D;  2WQY B;  1QT9 A;  1FFU A;  3AE4 B;  3HUI A;  3SFE B;  2Y5C A;  3VRA B;  3PO0 A;  1E0Z A;  2CJN A;  3ETR A;  2WDR B;  4N6E B;  3VR8 B;  1TKG A;  3W5V B;  2KMM A;  3AEF B;  1KF6 B;  1IUE A;  1RYJ A;  1JRO A;  1NVI D;  2M19 A;  4P6V F;  4USA A;  3AED B;  1JWA D;  1KFY B;  3AE3 B;  1NEK B;  1N60 A;  1E10 A;  2W55 A;  1JRP A;  4IDI A;  4YTN B;  4ZOH C;  3P4S B;  2PKO A;  1ROE A;  1AWD A;  1YQ3 B;  2G1E A;  2K22 A;  1XO3 A;  3CIR B;  4YSX B;  2DWQ A;  1WYG A;  3RPF C;  4ZHO A;  5C3J B;  1XLO A;  2E3T A;  1XLP A;  3KWL A;  1JAL A;  5EE3 A;  5H8Y E;  1JW9 D;  2WU5 B;  3BII D;  1E9M A;  3AH7 A;  1WRI A;  3HRD D;  2FBW B;  4FXC A;  2WS3 B;  1XLN A;  5H92 C;  1PUT A;  3L4P A;  3NVY A;  2PIA A;  2Q5W D;  1FM0 D;  3B2F A;  1WGK A;  2M56 B;  4JWS C;  1PDX A;  1XLQ A;  4C7Z A;  3CWI A;  1NYR A;  3NVV A;  2MH7 A;  1FMA D;  1TKE A;  4JWU C;  3DWM A;  3FC4 A;  2BT6 A;  2K5P A;  3AEG B;  4WQM A;  3WCQ A;  3AEC B;  1E6E B;  1YJI A;  3SFD B;  3AMZ A;  5MPO A;  1TJE A;  3AE9 B;  1FIQ A;  1N5W A;  3AN1 A;  2WDV B;  4ITK A;  4KX6 B;  2H88 B;  4N58 A;  4US8 A;  1J7A A;  3AE2 B;  1F0Z A;  1GPX A;  3FAH A;  1RFK A;  1FO4 A;  1J7C A;  3ABV B;  3AE6 B;  1SB3 C;  2EKI A;  2JX5 A;  3P63 A;  4YTP B;  5EE1 A;  3W9C B;  2L83 A;  1OQR A;  2WLB A;  1SIJ A;  1DOI A;  2PVO D;  3NRZ A;  1DGJ A;  1QOA A;  3SR6 A;  1FRR A;  2W3S A;  2BS4 B;  2HTM E;  4YXD B;  4ZHP A;  1ZP0 B;  2N0S B;  1GAQ B;  2L52 A;  1N62 A;  3VR9 B;  1L6V A;  3AEE B;  1FXI A;  4A9A A;  2H89 B;  3P4P B;  1VLB A;  2WU2 B; 
#chains in the Genus database with same CATH topology
 3C19 A;  4IM0 A;  3OJ3 A;  5DCN A;  2XEW A;  4YSY B;  1K50 A;  3LJ3 A;  2N9P C;  3ML8 A;  1E8W A;  2IO0 B;  3WA0 A;  2BKR B;  4H2A A;  3VHT C;  1ZUD 2;  1OTR B;  3GE3 C;  4ANU A;  1I4Q A;  3OG5 A;  4HJG E;  2AQ3 B;  3EEC A;  1R4N I;  4TMA B;  1FCL A;  4OHJ A;  3PRP B;  4DK5 A;  1SJH D;  2D10 A;  1F77 A;  3QC8 B;  1K52 A;  5J2R A;  4NJC A;  1VRA B;  3ZIM A;  3MHZ A;  2MBH A;  2WQY B;  3VRA B;  1ZDV A;  2ZPY A;  3ETR A;  1WJ4 A;  4N6E B;  5E6O A;  4IM2 A;  1RYJ A;  3A4R A;  2JXT A;  2WXJ A;  5BO4 B;  4E74 A;  1JRP A;  1V5O A;  3A1Q B;  3A33 B;  4YSX B;  3PSE B;  1YIW A;  1E8Z A;  5IN7 A;  2WU5 B;  2HJ1 A;  3IXS A;  3PTF C;  4CO7 A;  4G11 A;  3JVZ X;  1WMH A;  3CWI A;  3NVV A;  1OEY A;  1TY2 A;  3V6E B;  2JSV X;  2BYE A;  1WM3 A;  1EF1 A;  1RAX A;  1OQR A;  3MFG A;  4A3O A;  4YXD B;  3EFU A;  1HZ6 A;  2DYO A;  1TZO A;  5IP4 D;  1UZX B;  4W9F A;  1T3Q A;  2DX5 B;  2J7Q B;  1I4H A;  4EE2 A;  3AU4 A;  5JZE B;  2K25 A;  1P0R A;  3N1X C;  3NJT A;  2CJO A;  2IBI B;  4XX5 A;  4GDL B;  4W9H A;  2FAZ A;  3B0A A;  4C80 A;  4KGT A;  2ZVO A;  1J8C A;  1YD8 U;  3BZD B;  1QOF A;  5LXH A;  3AEB B;  2BPS A;  2WXH A;  2C7M B;  1XD3 B;  1XEE A;  3UIN B;  2KHW B;  2KWV B;  2R61 A;  2WXG A;  1UEL A;  3PRE A;  2REX A;  3UIP B;  2J0K A;  4DDI D;  1NI3 A;  1F52 A;  2AYO B;  2WX1 A;  3DVG Y;  4B6W A;  2ZJD A;  4AP4 C;  3VR8 B;  5AZF A;  4C4V B;  4JPS A;  2KOX A;  1MVK A;  1XCQ L;  5H8Y E;  4C4V A;  4FXC A;  4MEL A;  2B3A A;  1QQR A;  1LQB A;  2INP E;  2PIA A;  1FM0 D;  4WJP A;  2QMT A;  4GLS C;  4IOI E;  1UBQ A;  1FNW A;  2J52 A;  4NJ6 A;  4HKQ A;  2QC8 A;  3L08 A;  4NY0 A;  1D5M C;  3ZGZ A;  4M00 A;  1GPX A;  3FAH A;  3UF8 A;  1SB3 C;  4FAD A;  3U30 A;  3Q8C A;  2KAN A;  2HTM E;  5D6J B;  3C8Y A;  1EU4 A;  3A1Q A;  1ZPS A;  3ZNG C;  1CMX B;  4HRO A;  1B9R A;  3O13 A;  4YT0 B;  5I4D A;  3EUB 2;  1GB4 A;  1T5X D;  3Q14 C;  2GB1 A;  3N20 C;  3GP7 A;  1BT0 A;  5CX3 A;  3B2G A;  3BIN A;  3AE8 B;  1NEN B;  5AEK B;  4YSZ B;  3AXC A;  4K3C A;  3NS1 A;  2KLC A;  2WX0 A;  4M01 A;  1Q0W B;  2DNF A;  1TS5 A;  1ZGU B;  4FJY A;  1UWX A;  3UIO B;  5GMV A;  3R2T A;  2KT7 A;  1GB1 A;  1WYW B;  1V80 A;  1QZE A;  3AE5 B;  5J18 A;  1V86 A;  2OJR A;  1V2Y A;  2DHZ A;  4BKT A;  1U4A A;  2TSS A;  4E71 A;  1UGM A;  3NUH B;  4PK1 A;  1WX8 A;  1CQV A;  2ZEQ A;  1KLG D;  4I6P A;  2D2Q A;  3VDZ A;  1C76 A;  4DXG A;  1YMH E;  3T3N A;  1ISN A;  3VVW B;  1HA5 A;  1QIL A;  3D32 A;  1LM8 B;  4GDL A;  3TMP B;  2BTE A;  1NDD A;  2LI5 A;  2KN5 A;  3AED B;  4GDK B;  2FUG 1;  5TSS A;  4M0W B;  3I9V 1;  4WJQ A;  4PYZ A;  1XLP A;  2ONQ A;  1XLN A;  4HEA 1;  3ZNZ B;  4FA6 A;  3N3K B;  1BUI C;  4FHJ A;  2K8C A;  4BKS D;  2M56 B;  2FIF A;  4LCD E;  1EM7 A;  2HJ8 A;  2V4L A;  1CK1 A;  2BT6 A;  4BOS C;  2LGD A;  4JLC A;  3AE9 B;  2L76 A;  3I3T B;  4KIK B;  1D5Z C;  1RFK A;  3RUL A;  2I2Y A;  1C4A A;  2LVP A;  2XK5 A;  3NRZ A;  3K9P B;  2KYW A;  1E90 A;  1N62 A;  3VR9 B;  3AEE B;  4DWF A;  3IT6 B;  4FN2 A;  1C9F A;  1ESF A;  2MX2 A;  2AQ2 B;  1C79 A;  2CU1 A;  3KUC B;  3MHS D;  1HQR D;  1SGH A;  1DOY A;  3P1M A;  1I7H A;  1WGG A;  1F2R C;  3N32 A;  1HEZ E;  2RSU A;  1UF0 A;  4HRS A;  3KUZ A;  4KZC A;  3P4R B;  2PE6 B;  1JML A;  2W3R A;  2INC C;  1XXG A;  4AWJ A;  4B95 A;  2KX0 A;  1WWT A;  2L3Z A;  4B9K A;  2IYD B;  2PW9 A;  3M63 B;  1GC6 A;  4OZB A;  2WNM A;  2CJN A;  4NAW A;  3ZXR A;  1XF5 L;  2WHI A;  4KV2 A;  4DHJ D;  2J0J A;  4IDI A;  1IBX B;  1KLU D;  2VH1 A;  1JAL A;  1L0X B;  2FBW B;  5H92 C;  3QHT A;  4LNF A;  4C7Z A;  3ZJV A;  3Q6B A;  2IZV B;  2W82 A;  5D3I B;  1IGD A;  2KJ6 A;  4KDI C;  2Y5P A;  2BYT A;  1T6B X;  3URY A;  2K0P A;  3TEW A;  3QK0 A;  1P98 A;  1SIF A;  3RNC C;  3RFZ B;  5EE1 A;  3ZNI D;  5E6N A;  3PZD A;  2RD0 A;  3EA6 A;  2G4S A;  3KW5 B;  1FXI A;  4OVU A;  2AWT A;  1KOT A;  2J0M A;  2SAK A;  1EWY C;  2BBC A;  3N30 A;  2ZPN A;  3UI3 A;  2IY1 B;  2K8B A;  4ACF A;  4HKZ E;  1WGY A;  3U8Z A;  3R66 C;  4RM8 A;  1ZDX A;  3Q3O C;  5C2T B;  2B76 B;  4HDO A;  3VUY A;  4F8C B;  4P1B C;  1GC7 A;  4A90 A;  4MSQ B;  2J53 A;  4MGZ E;  2IO1 B;  3VRB B;  4RF0 A;  2WYQ A;  2WXQ A;  3R3M A;  2VRR B;  4WWM A;  1QT9 A;  4MGY E;  2Y5C A;  3BVM A;  2DZM A;  4EZK A;  3PRM B;  1JWA D;  3AE3 B;  3VXW A;  4HJK A;  1E10 A;  1ENF A;  1Z2M A;  1YQ3 B;  4HPM B;  3MP9 A;  4AUQ C;  2I1J A;  4MDK E;  2BWF A;  5CHW A;  2IPK D;  2O2V A;  4IWO A;  2N1W A;  4XE0 A;  1PUT A;  2LUE A;  2RGF A;  3WAN A;  4LDT B;  2FNJ B;  2OJW A;  4I6L B;  1RFA A;  2JWZ A;  4EOY A;  2JWU A;  4G0N B;  1TKE A;  4JWU C;  1FCC C;  2NPT A;  2MCN B;  2KTR A;  3SFD B;  3DBR I;  4BOZ B;  1N5W A;  3KLS X;  5CHV C;  4EEW A;  2JY6 A;  1WIA A;  3W9C B;  2L83 A;  3SR6 A;  5BYS A;  3VUX A;  2KTR B;  2PTL A;  3X0W A;  2RDB C;  3ZVV A;  1V1O A;  3B9J A;  4ZYN A;  3VTU A;  4BZA A;  1WSP A;  4L2Y A;  2LMC A;  4MT5 A;  1GNU A;  3RZF A;  3UGB B;  1R7S A;  1N63 A;  3P42 A;  4ANW A;  4K3B A;  2NS5 A;  4GXB A;  3Q8F A;  2BKF A;  4KVG B;  3V6C B;  5FR3 A;  1D5X C;  2W54 A;  3RUI B;  1Q1O A;  2BB6 A;  3W2D A;  3Q2A C;  3HK0 A;  1PYW D;  4DHZ E;  2K9X A;  1KH0 A;  1UD7 A;  5D3D A;  2YEP F;  3VTV A;  1YQ4 B;  4XC2 A;  2KDI A;  4AOF A;  2HDE A;  3RNB C;  1WX7 A;  4WQO B;  3H9D A;  1ZW7 A;  3EC8 A;  3DBR B;  1TS2 A;  1YQB A;  3U7D A;  3ZJT A;  4GSW A;  2JRI B;  2UYZ B;  3NZU A;  3HVD A;  4IC7 B;  1BML C;  3RZW C;  1TKG A;  3IFW B;  2KMM A;  2PPH A;  1NVI D;  1WF9 A;  1SE9 A;  2LHE A;  2GOW A;  1P3Q U;  4TQ0 A;  3Q3J A;  2MBB B;  2V3P A;  1ROE A;  2K22 A;  2MHJ A;  2NTT A;  3NG0 A;  1RLF A;  4LJP B;  1KLV A;  1WRI A;  2GBN A;  3NZ3 A;  1Q5W B;  4RH6 A;  1FMA D;  1T0Q C;  2NBV B;  2N9L A;  3WCQ A;  2LD9 A;  1NBF C;  2KNB A;  1GOZ A;  1V81 A;  1F0Z A;  3ZO5 B;  2NVU I;  1FO4 A;  2JXX A;  1K53 A;  3U52 E;  2NBW B;  2Z59 B;  1YJ1 A;  2D3G A;  1TIF A;  3N1Y C;  3R7Q A;  3RT3 B;  3CST A;  1WE7 A;  2M8S A;  2KAC A;  3H8H A;  2GBM A;  4W9E A;  1T0Y A;  1V49 A;  4MEM A;  4A3P A;  1PFD A;  3NOB A;  2MJ3 A;  4MSM B;  1EO6 A;  2NPT B;  2PLP A;  1VR9 A;  5G2N A;  2FCQ A;  3T9L A;  1VD2 A;  2WXR A;  3CMM B;  2JRH A;  2NMQ A;  4M8N A;  2KDE B;  4O1N A;  4WWO A;  5J17 A;  4EKU A;  4BVU C;  4JQW C;  1FFV A;  4M02 A;  3VUW A;  4EZJ A;  1I35 A;  4R3D A;  3PPA A;  4XWT A;  4ASW C;  2KC1 A;  3C0R B;  4FLH A;  4GMV A;  4BAX A;  1JRO A;  3R2I A;  1WFY A;  2N9K A;  3VFK A;  5JXV A;  4LJO B;  2LRU A;  4ZOH C;  3WIM A;  1WMH B;  1OGW A;  1XO3 A;  1C1Y B;  5EDS A;  3VTW A;  2L00 B;  4OVV A;  4GN1 A;  1P7E A;  3BII D;  1YX5 B;  4CQN A;  2KD0 A;  2Q5W D;  3Q69 A;  2M17 A;  1I42 A;  2YEP B;  3DBH B;  2NR2 A;  1E7V A;  2BQQ A;  3H7P B;  4N58 A;  5KHQ A;  3BY4 B;  4DBG A;  4CYE A;  2N1V A;  1QKZ A;  1R4M B;  4KSK C;  3ZUN A;  2PVO D;  3DVG X;  4PS8 A;  1FRR A;  4ZYS A;  1GAQ B;  2L52 A;  3H7P A;  1V6E A;  1C77 A;  2ZW1 A;  3ZTC A;  4IM3 A;  4PT5 A;  3JYU A;  3DVN V;  1DOX A;  2CHZ A;  5JHA A;  3TEY A;  1FD6 A;  1WE6 A;  2MBO A;  3WAM A;  3DCG A;  1QOB A;  1YN3 A;  1C3T A;  2UU7 A;  3HIZ A;  2JUO A;  1V97 A;  2JU6 X;  3AE7 B;  4ICV A;  1PGA A;  2KTF A;  3GOE A;  2C5L C;  3V62 A;  1YNT E;  1SSN A;  2DAJ A;  4J3O D;  3HVZ A;  5IAA C;  1BXT A;  2L32 A;  3SU8 X;  2ZW0 A;  4N59 A;  3X23 A;  5G5H A;  3RYT A;  1VDV A;  2YLM A;  3FIL A;  4Q2J A;  4K7U A;  3LXF A;  3W1Y A;  2V9H A;  2DEN B;  3AUL A;  2G3Q B;  3M62 B;  2IO2 B;  4ARC A;  3ZW3 A;  2LUM A;  1H8C A;  1N5X A;  1EWC A;  3DBH I;  2QCZ A;  1E7U A;  3KH0 A;  3PVL A;  2X8X X;  2IO3 B;  2JZ3 B;  4K1R B;  2EMT A;  1R4M I;  1WX9 A;  1KF6 B;  2CKH B;  1WXA A;  4G50 A;  1WZ3 A;  1EU3 A;  1WR1 A;  1PGB A;  3H1U A;  1JWM D;  1F1H A;  2BW2 A;  2G1E A;  3CIR B;  4F7Z A;  2C7H A;  1XLO A;  2E3T A;  2BWE S;  3AH7 A;  5DPT A;  2KQS A;  2LGS A;  1TY0 A;  2W9N A;  2DAF A;  2BGF A;  4WAF A;  3ZRF A;  2QIL A;  4K81 A;  2FUH B;  1J19 A;  1FNU A;  3ZQ4 A;  1MI0 A;  3PRZ A;  1TJE A;  3ZTD A;  1FIQ A;  1STE A;  4WIP A;  2WDV B;  3V3X A;  1J7A A;  3AE2 B;  2KVZ A;  1C4P A;  1B1Z A;  3P63 A;  4A6Q A;  4B0M A;  4ZHP A;  4LNN A;  1L6V A;  2FCN A;  4RM9 A;  1UWM A;  3L0W B;  2VH2 A;  5BMH A;  1WXQ A;  2LEK A;  2KVR A;  3AEA B;  2KDM A;  4A8X C;  4RMA A;  2JVC A;  2HE7 A;  2CU3 A;  4A55 A;  2LGY A;  3PGE A;  4K7S A;  1VZ6 A;  4DQO C;  2MA9 B;  2O6V D;  2WXM A;  4JL9 A;  4OZA A;  2MJD A;  1TS4 A;  3KWV A;  3GB1 A;  2L1A A;  3SD5 A;  3Q8E A;  4LNI A;  1FRD A;  4NQK E;  1VZ8 A;  3DDC B;  4S17 A;  1ZKH A;  3L16 A;  3APC A;  1WXV A;  2AQ1 B;  2BYF A;  2KWC A;  2LGX A;  2WP9 B;  2V3N A;  2K1F A;  3AB5 A;  1L6U A;  3WAL A;  4GDK A;  2KKC A;  4KDL B;  2PE9 A;  2MBE A;  3AE4 B;  2MEK A;  3KQ4 A;  4IWQ A;  4P1C C;  4KSL C;  2ZNV B;  4REZ A;  1IUE A;  1LO5 D;  3UQA A;  3NY5 A;  4YTN B;  4IWP A;  2FID A;  1Z5S B;  2KLG A;  3NVY A;  3TUO A;  2DZJ A;  3B2F A;  1HXY D;  1P1A A;  2KMA A;  1YX6 B;  3P2B A;  3U2S C;  2K5P A;  4IUM B;  4URK A;  1YJI A;  3APD A;  4ICU A;  4ITK A;  4KX6 B;  4ZRP A;  3QAQ A;  5DPR A;  3ZLZ A;  2WLB A;  5IOI A;  1DGJ A;  2JYT A;  1ZP0 B;  3APF A;  2WWZ A;  3MJ5 A;  1FEH A;  2GI9 A;  2L8J A;  1CZP A;  1EF5 A;  1OEY J;  1AYF A;  3AE1 B;  1H4R A;  1UNS A;  3QWZ B;  2ACZ B;  2O6V A;  4HLE A;  3AV8 A;  3K9O B;  2DLB A;  3PHX B;  3MJW A;  5GXG B;  2PVG C;  3RNF C;  5CTR C;  5IA7 A;  5EE9 A;  1FXA A;  2E6X A;  4HVB A;  4YTM B;  2MQJ A;  2WXN A;  4GB9 A;  1ZE3 D;  2BS2 B;  3AM9 A;  5T8I A;  1UH6 A;  4WH4 A;  4NAW B;  4E3C A;  2R2Q A;  5AUI A;  2RMM A;  1C78 A;  1SF0 A;  1KJT A;  1N6Z A;  2GBR A;  1MHH E;  3A9K B;  2NCN A;  3PO0 A;  4S0R A;  1AN8 A;  4GOC A;  4W9C A;  4P6V F;  1VZ7 A;  5IKC M;  2PMV A;  3SDL C;  4MJS A;  1V5T A;  2NBU A;  2ZCC A;  2DWQ A;  4D2K A;  4IG7 B;  3L4P A;  1T0S C;  3PLV A;  4MJS B;  3V60 A;  3T3O A;  2MH7 A;  2LZ6 A;  3DWM A;  3FC4 A;  1MG8 A;  5LXI B;  2KO3 A;  3AEC B;  1E6E B;  3M95 A;  2GBK A;  4AJW A;  2L7R A;  3NS8 A;  4DHJ B;  1SIJ A;  4KKJ A;  1JWS D;  2N0S B;  2N7J A;  4M0W A;  1VLB A;  4XWW A;  1SXT A;  2LWP A;  1UGJ A;  1ET6 A;  3L54 A;  2ZVN A;  3BK1 A;  4OW0 A;  1QLB B;  1X1M A;  4HPL B;  3BWU D;  3WAP A;  3ONS A;  1XT9 B;  1UUP A;  2J4X A;  4WAA A;  2DBY A;  2DYM A;  2JQR B;  4RFB A;  1MHX A;  2J42 A;  4XYC A;  1HZ5 A;  2Z8L A;  3E9S A;  2OED A;  4EUT A;  3ENE A;  2A4Z A;  4ZDV A;  1WY8 A;  2MJE A;  1IYF A;  1HE8 A;  4ARI A;  2EKE C;  2WXL A;  1CJE A;  3RNG C;  1JQ4 A;  2KFJ A;  4ZRI A;  2XN9 C;  3NVZ A;  4HWI B;  3VH3 B;  1YJJ A;  4LNK A;  4ZRJ A;  3IHP C;  3KYC D;  4YWG G;  2O6V B;  4WUR A;  4NZL B;  2R2O A;  4W9D A;  4F1S A;  2O2V B;  2XNA C;  3BYT B;  3OAW A;  3W5V B;  4DHZ B;  4USA A;  1WXM A;  3VAW A;  4K7W A;  3DVN U;  2L0T A;  2PKO A;  1GJZ A;  1AWD A;  1LXD A;  4MGI E;  4HDQ A;  3RPF C;  4QAY A;  3KWL A;  1VCB A;  2AL6 A;  3EGR A;  3JW0 X;  1JW9 D;  1E9M A;  1A5R A;  2Z0E B;  3R7R A;  4EFO A;  3IG3 A;  3QIJ A;  3R8B A;  3TCA A;  4JWS C;  3PV1 A;  2KK8 A;  3JSV A;  3N1Z C;  3TJP A;  4ANV A;  3AMZ A;  3ZNH B;  4M8M A;  1E0Z A;  3TSS A;  2RDH A;  4ANX A;  4YTP B;  5AZH A;  3U7Z A;  3PS6 A;  3DBS A;  3V61 A;  2M0X A;  4RCO A;  2H89 B;  4TUU A;  1IBX A;  3B1L X;  2LXA A;  3SHQ A;  4N9F 4;  1SE4 A;  1TT5 B;  1WRD B;  4KZ0 A;  1L2N A;  1E7P B;  1TTN A;  2KFK B;  4X57 B;  4RGN A;  2EMS A;  2RR9 A;  4HK2 A;  2KC2 A;  3PHW B;  2SEB D;  2V0G A;  2WDQ B;  3DOW A;  3HM6 X;  3Q8B A;  2FCS A;  2KFK A;  4ZRK A;  1M94 A;  1IP9 A;  5HG2 A;  1Q10 A;  1TKY A;  5LLI A;  3QX1 A;  4W9J A;  1ZXI A;  2LXC A;  3M3J A;  5EE0 A;  2WGS A;  2N9E B;  3TEX A;  3W5U B;  3AI5 A;  2G9H D;  1FFU A;  4RGT A;  3SFE B;  2JF5 A;  1KTK A;  2CR5 A;  2ZZP B;  5E6J A;  2GMI C;  4HCP B;  3DBL I;  1IGC A;  1S1Q B;  1NEK B;  5TR5 A;  2KJH B;  5KHO A;  1JWU D;  2C60 A;  5L95 C;  5HI1 A;  3U4E G;  1L0Y B;  4ZHO A;  4XDC A;  2VZK B;  4J6I A;  5C3J B;  3FKY A;  2OOB B;  3MC0 B;  2CHX A;  2WS3 B;  4AJY B;  2QEJ C;  3L10 B;  1WGK A;  4HCN B;  2QHO A;  3QAR A;  1JRU A;  2BB5 A;  2V1Y A;  3PT2 B;  4DDG D;  3DQV A;  3ZDM C;  2LGI A;  4WQM A;  4PS7 A;  1L7Y A;  5MPO A;  2JT4 B;  4US8 A;  2KDB A;  5JH5 C;  5E6P A;  3Q3M C;  1J7C A;  3AE6 B;  2Y5B B;  4NQL B;  1EUV B;  1I4X A;  1PQS A;  2MSE D;  4XGA B;  1I4R A;  1ZXH A;  1R4N B;  1V9J A;  1TYG B;  3W1S C;  1YOV B;  2GLS A;  1ACC A;  2QJL A;  5BMI A;  1AAR A;  4RF1 A;  5AZG A;  1RM6 C;  2A5U A;  4HPP A;  1N61 A;  4AS1 A;  1FXT B;  4L1B A;  3JSV B;  1WGH A;  3S2A A;  4MGK E;  1V8C A;  2HTH A;  1SE2 A;  2GRI A;  3DBL B;  4KGS A;  4FJV B;  1Y56 A;  1NI2 A;  2C7N B;  4WJO A;  2LRW A;  2AEH A;  2D3A A;  2IND C;  2YVC A;  3IBE A;  2INN E;  1WM2 A;  2ZNV C;  1V1P A;  4AQ7 A;  4BBN C;  3P4Q B;  3I5J C;  2KAJ A;  4L23 A;  3ZYY X;  3DHI C;  3VQI A;  5HKH A;  3NHE B;  4IW0 A;  3ZJU A;  4II3 B;  2D11 A;  3DHG C;  1V1P B;  3A4S C;  3GE8 C;  5BYR A;  4UDU C;  2D3B A;  2FE8 A;  5C1Z A;  1F9J A;  2N7E A;  2KQ4 X;  3KYD D;  3MTN B;  2WDT B;  3ML9 A;  3ALB A;  3RNE C;  1WJ6 A;  2KN4 A;  4NJ7 A;  2KWD A;  3HRD D;  2FCM A;  2KWU B;  4RGO S;  4LNO A;  1E8X A;  1L4D B;  1YN4 A;  3MC8 A;  2MW5 A;  3OWE B;  2LHD A;  2MLB A;  2D07 B;  2K6Q A;  1AW7 A;  3ABV B;  4MM3 B;  1MFW A;  3SEB A;  1FNV A;  2QDF A;  2I1K A;  3L17 A;  2WXI A;  4KIK A;  1DYQ A;  3ZRC A;  4TKN A;  2WU2 B;  3ECI A;  3TL5 A;  3IAS 1;  1QOG A;  1A70 A;  2XK5 B;  3DPD A;  3NVW A;  3QJZ A;  4JX1 C;  1XQQ A;  2L05 A;  1KRH A;  4C7Y A;  4BFR A;  1ZOY B;  1E8Y A;  3QCA A;  1J0G A;  1E5W A;  2IGD A;  5G5G A;  4LTU A;  4NAM A;  1OFF A;  1TBE A;  1LGR A;  4W9I A;  3GZN B;  3EFC A;  2MP2 B;  2KQ7 A;  4JIO U;  2WXO A;  2G4D B;  2K8H A;  3BK2 A;  2KDF B;  1L5P A;  5AUK A;  2ZCB A;  5CHF A;  2MP2 A;  2X38 A;  3E56 A;  4US9 A;  4EZL A;  1WGD A;  2IJ0 A;  3I57 A;  3PZ7 A;  4FHK A;  3ZDT A;  4NPN A;  3QQ8 B;  1JWB D;  2WXP A;  2RPV A;  1LFD A;  3EHV A;  4GIV A;  2M19 A;  1WGR A;  1KFY B;  1TGZ B;  3PZ8 A;  3N9Y C;  2AL3 A;  2LFI A;  2ASQ A;  2CS4 A;  5G55 A;  3TBL D;  1S3S G;  1D6E C;  4LLG M;  4W9L A;  5FR6 A;  3KUD B;  4W9K A;  1TZ1 A;  4HXD A;  2K3U A;  2KZR A;  3J9C A;  1PDX A;  3NZS A;  1NYR A;  5HHD G;  1XCT L;  4BKS A;  5D94 A;  3BVG A;  1P7F A;  2WXK A;  4TQ1 A;  5HFY A;  4GU2 A;  3HM3 A;  3TEZ A;  3KVF B;  4IKG A;  4WWP A;  2K39 A;  2JPH A;  2EKI A;  2JX5 A;  2V3S A;  3GZN I;  5BYQ A;  1I4P A;  2LJ5 A;  2NTS A;  5BMG A;  2Y3A A;  4TV3 A;  3B08 A;  2HD5 B;  5C23 A;  2JZZ A;  2C9W B;  1I4G A;  4C00 A;  2M4N A;  2Z0D B;  3O65 B;  4OZC A;  1WZ0 A;  1SE3 A;  1G6J A;  1YN5 A;  3RI7 C;  2IDY A;  4C56 C;  2LAS A;  1P9D U;  2MRP A;  1PGX A;  2VZK D;  1WJN A;  1SEB D;  2PJH A;  2BF8 B;  4KKI A;  4MAC A;  2L0F A;  4A20 A;  3IT4 B;  5D2M B;  3PLU A;  1K51 A;  3VH4 B;  1QF6 A;  2LJI A;  4MM3 A;  1D4B A;  4P7I A;  3OLM D;  2KXJ A;  1SBB B;  3V05 A;  1NYQ A;  1VJK A;  1F2R I;  2RDG A;  1MG4 A;  2WXF A;  3ZXV A;  2DZK A;  1SJE D;  4PS3 A;  5DPS A;  2PEA A;  4FUL A;  2KMC A;  3LYY A;  3HHM A;  4B0E A;  3AEF B;  4CHK A;  2UWQ A;  4JGH B;  4MH8 A;  2XBB C;  2W55 A;  3P4S B;  4DXF A;  1WYG A;  2IGH A;  5EE3 A;  2GBJ A;  1MPE A;  3Q3F A;  4XDD A;  1RRB A;  2ICI A;  4JE3 B;  1D3Z A;  2LVO A;  3AU5 A;  2MWS B;  1K8R B;  3CSF A;  4WWN A;  3FIL B;  2IY0 B;  4RNA A;  2G45 B;  3H6N A;  3AEG B;  2N4F A;  2V4I B;  3AN1 A;  1WXS A;  2H88 B;  5L83 A;  3RCZ A;  3LDZ E;  1TS3 A;  3OJ4 B;  1FPY A;  4KGR A;  3H7S A;  2M0A A;  1ET9 A;  2DYB A;  3Q8A A;  2LVQ A;  2CHW A;  4I6N B;  4LK0 M;  4A9A A;  5FK9 C;  4XZ4 A;  3T8M A;  1RWS A;  1Y8R C;  3Q3N C;  1UBI A;  1L0V B;  3ZKJ C;  4RGM A;  2AX5 A;  1OQQ A;  2OHF A;  1GG3 A;  3LB8 C;  3W1S A;  1WR6 E;  1MJD A;  3L13 A;  4DXA B;  2N7D A;  2RPQ A;  4II2 B;  4PYU A;  2M1M A;  5D7G A;  4BKG A;  2BS3 B;  4WJN A;  3RD2 A;  1HTO A;  1WH3 A;  3WAO A;  5DPW A;  3DWG C;  1J7B A;  2I38 A;  4GGQ A;  1M4V A;  3CF6 E;  4G3X B;  1OQY A;  3A9K A;  5IO9 A;  2DZI A;  4BBN F;  4ZRQ A;  3UQB A;  2K6D B;  2QIE B;  2D3C A;  4W9G A;  2BYV E;  4YL8 A;  3IAM 1;  1C4C A;  5JHB A;  3HUI A;  1WI0 A;  3RMK C;  1KM7 A;  3RNA C;  4FBJ B;  2WDR B;  2N9X A;  3GS2 A;  4FJZ A;  3DHH C;  1N60 A;  2IGG A;  4MH0 E;  3A9J A;  1L4Z B;  3TIX A;  3RN9 C;  1T0R C;  2JYE A;  2KJR A;  1HTQ A;  2BVC A;  3A9J B;  3QA8 A;  2JZP A;  4TSS A;  1XLQ A;  4LDT D;  1GUA B;  2QSD A;  5FKA C;  4NNJ B;  2EEL A;  1IPG A;  3BVZ A;  4P16 A;  2KX3 A;  2ON8 A;  3MC9 A;  2MBQ A;  5LNK 1;  3BYY B;  1DOI A;  1WJU A;  1QOA A;  2W3S A;  1JCK B;  2BS4 B;  2D5G A;  3IVF A;  3I63 C;  3P4P B;  4OVZ A; 
#chains in the Genus database with same CATH homology
 1UWM A;  1ZXH A;  1TYG B;  1WXQ A;  5BMH A;  2LEK A;  2SAK A;  1EWY C;  2BBC A;  2KDM A;  3AEA B;  4A8X C;  3UI3 A;  1ACC A;  2QJL A;  5BMI A;  4YSY B;  2CU3 A;  4RF1 A;  1K50 A;  4A55 A;  1RM6 C;  4HKZ E;  1N61 A;  1VZ6 A;  4AS1 A;  4DQO C;  4L1B A;  1ZDX A;  1V8C A;  5C2T B;  4H2A A;  2WXM A;  1SE2 A;  2B76 B;  1ZUD 2;  2GRI A;  2MJD A;  4OZA A;  4KGS A;  1TS4 A;  1Y56 A;  3KWV A;  4A90 A;  3GB1 A;  2L1A A;  1I4Q A;  4HJG E;  2AQ3 B;  3Q8E A;  1FRD A;  1VZ8 A;  4TMA B;  1FCL A;  2J53 A;  4OHJ A;  2INN E;  3VRB B;  4RF0 A;  1SJH D;  2AQ1 B;  1F77 A;  2WXQ A;  1K52 A;  1V1P A;  4AQ7 A;  2WP9 B;  3P4Q B;  2V3N A;  3AB5 A;  1L6U A;  2KAJ A;  4L23 A;  3ZYY X;  4NJC A;  1VRA B;  4WWM A;  3MHZ A;  2WQY B;  1QT9 A;  3VQI A;  3AE4 B;  2MEK A;  2Y5C A;  1ZDV A;  3VRA B;  3KQ4 A;  3ZJU A;  3ETR A;  4N6E B;  1V1P B;  5BYR A;  3BVM A;  4UDU C;  4REZ A;  1IUE A;  1RYJ A;  1LO5 D;  2JXT A;  2WXJ A;  1JWA D;  3AE3 B;  2FE8 A;  1E10 A;  1ENF A;  4YTN B;  1JRP A;  2KQ4 X;  1YQ3 B;  3MP9 A;  4YSX B;  2IPK D;  2WU5 B;  2KN4 A;  2KWD A;  3HRD D;  3IXS A;  4XE0 A;  4RGO S;  1PUT A;  3NVY A;  3TUO A;  3B2F A;  1HXY D;  2JWU A;  3CWI A;  3NVV A;  3U2S C;  1TKE A;  4JWU C;  1L4D B;  1FCC C;  1YN4 A;  1TY2 A;  2K5P A;  2JSV X;  1YJI A;  3SFD B;  3OWE B;  4ITK A;  4KX6 B;  2LHD A;  1N5W A;  4ZRP A;  3KLS X;  1AW7 A;  3ABV B;  3W9C B;  2L83 A;  1OQR A;  2WLB A;  4MM3 B;  3SEB A;  3SR6 A;  5BYS A;  1DGJ A;  3MFG A;  2JYT A;  4YXD B;  1FNV A;  1ZP0 B;  2PTL A;  1HZ6 A;  2DYO A;  2WXI A;  1TZO A;  1DYQ A;  3MJ5 A;  1FEH A;  2WU2 B;  1V1O A;  2GI9 A;  3B9J A;  1T3Q A;  1CZP A;  3IAS 1;  1QOG A;  1A70 A;  3NVW A;  1WSP A;  4L2Y A;  1AYF A;  1I4H A;  3AE1 B;  4JX1 C;  4EE2 A;  2LMC A;  4MT5 A;  1KRH A;  2CJO A;  1R7S A;  1UNS A;  2ACZ B;  4C7Y A;  1N63 A;  3AV8 A;  3P42 A;  1ZOY B;  2DLB A;  4GDL B;  5GXG B;  4C80 A;  3Q8F A;  2IGD A;  2PVG C;  5G5G A;  4LTU A;  5EE9 A;  4KGT A;  5FR3 A;  4NAM A;  1FXA A;  1OFF A;  1D5X C;  2W54 A;  3BZD B;  2BB6 A;  2E6X A;  3W2D A;  1QOF A;  4YTM B;  2WXN A;  3AEB B;  1ZE3 D;  2BS2 B;  1PYW D;  3AM9 A;  2WXO A;  2WXH A;  3BK2 A;  2K9X A;  5T8I A;  1KH0 A;  1L5P A;  5D3D A;  5AUK A;  2YEP F;  1XEE A;  4WH4 A;  1YQ4 B;  2R61 A;  2WXG A;  4NAW B;  2X38 A;  3E56 A;  5AUI A;  2HDE A;  4US9 A;  2RMM A;  1C78 A;  2IJ0 A;  3I57 A;  3PZ7 A;  1SF0 A;  1NI3 A;  1JWB D;  1TS2 A;  3ZJT A;  2WXP A;  2RPV A;  1MHH E;  3PO0 A;  3HVD A;  1BML C;  1AN8 A;  3VR8 B;  1TKG A;  4JPS A;  2KMM A;  1NVI D;  1VZ7 A;  2M19 A;  4P6V F;  2LHE A;  2PMV A;  1KFY B;  3PZ8 A;  1MVK A;  4TQ0 A;  2V3P A;  3N9Y C;  2LFI A;  1ROE A;  2K22 A;  1XCQ L;  2DWQ A;  2NTT A;  5H8Y E;  1D6E C;  4D2K A;  4LLG M;  1WRI A;  4FXC A;  1QQR A;  2K3U A;  3L4P A;  2INP E;  2PIA A;  1FM0 D;  3NZ3 A;  3J9C A;  1PDX A;  2QMT A;  4GLS C;  4RH6 A;  4IOI E;  1NYR A;  3T3O A;  2MH7 A;  1FMA D;  5HHD G;  3DWM A;  3FC4 A;  1XCT L;  2N9L A;  1FNW A;  3WCQ A;  3AEC B;  1E6E B;  2J52 A;  3BVG A;  1P7F A;  4HKQ A;  1GOZ A;  2WXK A;  1D5M C;  4TQ1 A;  5HFY A;  1F0Z A;  3ZGZ A;  1GPX A;  3FAH A;  3TEZ A;  1FO4 A;  4IKG A;  1K53 A;  1SB3 C;  2EKI A;  2JX5 A;  3U52 E;  5BYQ A;  1SIJ A;  3Q8C A;  1I4P A;  2NTS A;  2HTM E;  4KKJ A;  1JWS D;  5BMG A;  2Y3A A;  2N0S B;  3C8Y A;  2KAC A;  3H8H A;  1EU4 A;  1ZPS A;  2N7J A;  4M0W A;  1VLB A;  4XWW A;  1SXT A;  4HRO A;  1I4G A;  1B9R A;  1UGJ A;  4OZC A;  1ET6 A;  3O13 A;  4YT0 B;  5I4D A;  1PFD A;  3EUB 2;  3BK1 A;  4OW0 A;  1QLB B;  1SE3 A;  1GB4 A;  3BWU D;  1T5X D;  1YN5 A;  2GB1 A;  2IDY A;  4C56 C;  3GP7 A;  2MJ3 A;  1UUP A;  1PGX A;  2VZK D;  2J4X A;  3B2G A;  1SEB D;  2DBY A;  3AE8 B;  2PLP A;  1NEN B;  1VR9 A;  2DYM A;  4KKI A;  4MAC A;  4YSZ B;  2JQR B;  4RFB A;  1MHX A;  2J42 A;  1HZ5 A;  3IT4 B;  3NS1 A;  2WXR A;  2Z8L A;  3E9S A;  1TS5 A;  2OED A;  2NMQ A;  1UWX A;  2MJE A;  3R2T A;  1K51 A;  1GB1 A;  1QF6 A;  2LJI A;  4O1N A;  1D4B A;  4ARI A;  3AE5 B;  2WXL A;  1CJE A;  1FFV A;  1JQ4 A;  1SBB B;  3V05 A;  1NYQ A;  2XN9 C;  3NVZ A;  2TSS A;  1VJK A;  3NUH B;  1F2R I;  1CQV A;  4R3D A;  2RDG A;  1KLG D;  1YJJ A;  3T3N A;  4DXG A;  1C76 A;  1YMH E;  2WXF A;  1SJE D;  4YWG G;  4XWT A;  3LYY A;  4NZL B;  4OVZ A;  4WUR A;  1HA5 A;  1QIL A;  2BTE A;  2XNA C;  3BYT B;  3W5V B;  4B0E A;  3AEF B;  1JRO A;  3R2I A;  2N9K A;  4USA A;  3AED B;  4GDK B;  4MH8 A;  5JXV A;  2W55 A;  2FUG 1;  4ZOH C;  3P4S B;  5TSS A;  4DXF A;  2PKO A;  3I9V 1;  1AWD A;  1XO3 A;  1WYG A;  3RPF C;  2IGH A;  1XLP A;  3KWL A;  1MPE A;  2ONQ A;  3EGR A;  5EE3 A;  1JW9 D;  1P7E A;  3BII D;  1E9M A;  4XDD A;  2ICI A;  4JE3 B;  1XLN A;  4HEA 1;  4CQN A;  1BUI C;  2Q5W D;  3FIL B;  3R8B A;  2M56 B;  4JWS C;  3Q69 A;  4RNA A;  1EM7 A;  1CK1 A;  2BT6 A;  3AEG B;  2V4I B;  2YEP B;  3AMZ A;  3AE9 B;  3AN1 A;  1E0Z A;  4N58 A;  2H88 B;  3TSS A;  1TS3 A;  1D5Z C;  2RDH A;  1RFK A;  2I2Y A;  1C4A A;  4YTP B;  3U7Z A;  1QKZ A;  3NRZ A;  4KGR A;  2PVO D;  1FRR A;  2M0A A;  1ET9 A;  4ZYS A;  4RCO A;  3Q8A A;  1GAQ B;  2L52 A;  1N62 A;  3VR9 B;  3AEE B;  4LK0 M;  4A9A A;  2H89 B;  1C77 A;  2ZW1 A;  4PT5 A;  1IBX A;  5FK9 C;  1DOX A;  3IT6 B;  1RWS A;  3TEY A;  1SE4 A;  1C9F A;  1FD6 A;  1L0V B;  4RGM A;  1E7P B;  2AX5 A;  1OQQ A;  1ESF A;  2OHF A;  1QOB A;  1YN3 A;  3LB8 C;  3W1S A;  2AQ2 B;  1C79 A;  1HQR D;  1V97 A;  2JU6 X;  3AE7 B;  4RGN A;  1PGA A;  3P1M A;  1DOY A;  2SEB D;  2V0G A;  1I7H A;  2WDQ B;  3Q8B A;  5D7G A;  1F2R C;  1YNT E;  1HEZ E;  1SSN A;  2BS3 B;  5HG2 A;  4J3O D;  4HRS A;  3HVZ A;  1BXT A;  1Q10 A;  2L32 A;  2ZW0 A;  3P4R B;  4N59 A;  1TKY A;  3DWG C;  1J7B A;  2I38 A;  5G5H A;  1JML A;  2W3R A;  1VDV A;  3FIL A;  4Q2J A;  1XXG A;  3LXF A;  1ZXI A;  1M4V A;  5EE0 A;  4ZRQ A;  1WWT A;  2QIE B;  4ARC A;  3TEX A;  3W5U B;  2LUM A;  1N5X A;  2PW9 A;  2G9H D;  1EWC A;  3IAM 1;  1FFU A;  1C4C A;  3HUI A;  4RGT A;  3SFE B;  4OZB A;  2WNM A;  2CJN A;  1KTK A;  2WDR B;  5E6J A;  1XF5 L;  1KF6 B;  3GS2 A;  1IGC A;  1EU3 A;  1N60 A;  1NEK B;  2IGG A;  4IDI A;  1PGB A;  1L4Z B;  1JWU D;  5HI1 A;  3U4E G;  1IBX B;  1JWM D;  1KLU D;  1L0Y B;  2BW2 A;  2G1E A;  3CIR B;  4ZHO A;  4XDC A;  2VZK B;  5C3J B;  1XLO A;  2E3T A;  1JAL A;  1L0X B;  2JYE A;  3MC0 B;  3AH7 A;  1TY0 A;  2FBW B;  2WS3 B;  4WAF A;  5H92 C;  2QEJ C;  2QIL A;  1WGK A;  2JZP A;  2BB5 A;  4TSS A;  1XLQ A;  4C7Z A;  3ZJV A;  1FNU A;  2W82 A;  2LGI A;  2QSD A;  3ZQ4 A;  1MI0 A;  5FKA C;  5D3I B;  1IGD A;  4WQM A;  2EEL A;  2Y5P A;  2BYT A;  5MPO A;  1TJE A;  1FIQ A;  1STE A;  4WIP A;  1T6B X;  2WDV B;  3V3X A;  3URY A;  4US8 A;  3BVZ A;  1J7A A;  2K0P A;  3AE2 B;  4P16 A;  1C4P A;  3TEW A;  1J7C A;  3AE6 B;  2ON8 A;  3RFZ B;  1B1Z A;  3P63 A;  5EE1 A;  4A6Q A;  1I4X A;  5LNK 1;  3BYY B;  1DOI A;  4B0M A;  1QOA A;  2W3S A;  1JCK B;  2BS4 B;  4ZHP A;  2D5G A;  3EA6 A;  1L6V A;  1FXI A;  3P4P B;  1I4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...