1JWAD

Structure of the atp-bound moeb-moad protein complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
publication title Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 16
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2001-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwaD00
1OFFA 1NYQA 1DGJA 1JW9D 1JWAD 1YQ4B 2E3TA 4N58A 2KAJA 1E7PB 2WP9B 2JX5A 1XLPA 2QIEB 3BIID 1PDXA 2ACZB 5GXGB 3LB8C 1ZOYB 2K5PA 3AN1A 1JQ4A 3CIRB 3HVZA 3NS1A 1NEKB 1QLBB 1QOGA 4YTNB 5EE1A 5G5GA 1XLQA 3AMZA 2WS3B 3AEAB 1SF0A 4YTPB 3AE9B 1WYGA 3P4PB 1N61A 2N0SB 4YTMB 2KMMA 3ETRA 3W9CB 1V8CA 1NYRA 1QOBA 1NENB 2K9XA 2M19A 1FXIA 3LXFA 1A70A 1QF6A 3NRZA 3B9JA 3L4PA 4YSYB 1GAQB 3AEEB 2W55A 2WLBA 3VR8B 3SFDB 1ROEA 4YSZB 1N5WA 3HRDD 4US9A 4N6EB 2B76B 3NVVA 1RWSA 2JQRB 3AE1B 3SFEB 5MPOA 3VRAB 1FMAD 2CJNA 2K22A 2M56B 4FXCA 1EWYC 4YXDB 2PVOD 1N5XA 4JWSC 4LTUA 4HRSA 4HROA 2W3RA 1E0ZA 3P1MA 5G5HA 2Y5CA 1KRHA 3SR6A 4USAA 3W5UB 1ZP0B 1DOYA 4C7YA 1J7CA 3AE8B 1WXQA 2MJEA 1L6UA 3AE6B 2WU2B 1FO4A 2G1EA 1TKEA 4ITKA 3AB5A 3ZYYX 1DOIA 1AWDA 2AX5A 2EKIA 1WRIA 3AE4B 4JX1C 1DOXA 4WQMA 3P4QB 1JALA 1PFDA 3AEGB 2W54A 1PUTA 1QOFA 2QJLA 1N62A 1YJJA 3VR9B 3AEBB 1TKGA 3KWLA 2FBWB 1OQQA 3P63A 1L0VB 3AH7A 2LEKA 1WWTA 3AEDB 1OQRA 4ZOHC 5C2TB 3WCQA 3EUB2 3FC4A 1AYFA 1QOAA 3AECB 5AUKA 1E6EB 3CWIA 1V97A 1CJEA 2WDQB 1I7HA 3NVYA 2PKOA 4KX6B 4P6VF 1QT9A 1FFUA 1NI3A 2MJ3A 1XLNA 2Q5WD 1RM6C 1J7AA 4A9AA 3B2GA 1JROA 1RFKA 1E9MA 1FRDA 1YQ3B 3AE5B 3NVWA 4ZHPA 3B2FA 1KF6B 2WDRB 3AEFB 3FAHA 4IDIA 3AE2B 2WU5B 2PVGC 1ZXIA 3DWMA 2BS2B 1KFYB 5EE9A 1CZPA 2WQYB 3AV8A 1FRRA 2OHFA 3NVZA 1SB3C 2BS4B 2DWQA 5EE3A 1E10A 1N60A 1UWMA 1IUEA 3P4SB 1T3QA 1YJIA 4YSXB 1L5PA 3DWGC 2L83A 3PO0A 3VRBB 5EE0A 1TYGB 1N63A 4N59A 2MJDA 2WDVB 1WGKA 1VDVA 2HTME 3RPFC 4WWMA 1SIJA 1J7BA 1TKYA 3W5VB 5C3JB 1R7SA 3P4RB 1L6VA 4YT0B 1VJKA 1TJEA 2MH7A 5H92C 1F0ZA 4US8A 2H88B 1FIQA 2L52A 3AM9A 2DBYA 1VLBA 1GPXA 2CU3A 3HUIA 1ZUD2 1XLOA 2H89B 2CJOA 1NVID 4JWUC 1FM0D 5AUIA 1RYJA 2W3SA 5H8YE 4C7ZA 1JWBD 2BS3B 1FFVA 1FXAA 3ABVB 4C80A 4ZHOA 1B9RA 2PIAA 1XO3A 2BT6A 3AE3B 1JRPA 3AE7B
chains in the Genus database with same CATH superfamily
4K3CA 4HDQA 1JWAD 1PGXA 2JX5A 4IW0A 4L2YA 3Q8FA 2O6VA 3EC8A 4IM2A 4H2AA 3EFUA 4IUMB 1GJZA 3L08A 2N0SB 4WH4A 5E6PA 3TSSA 3FILB 1QILA 3B9JA 2LXAA 4XWTA 1ROEA 2KWCA 2WNMA 3QCAA 4US9A 3VRAB 2XN9C 4ANUA 2GB1A 3ZTCA 1WM2A 1YMHE 4USAA 1LGRA 3EFCA 4HCPB 4FA6A 4C7YA 2VH1A 1C78A 1L4DB 1EM7A 4NPNA 2PEAA 3NUHB 4KGRA 3PS6A 1P1AA 4PS8A 4N9F4 1AYFA 1KLGD 3BYYB 5DCNA 5LNK1 2WXIA 1QT9A 3KQ4A 2CU1A 3N32A 4ANVA 1WSPA 4ZHPA 2AL3A 5KHQA 1WRDB 2WDRB 2NPTA 4IDIA 1BUIC 2PTLA 1FRRA 3A1QB 3FKYA 4LNFA 3IXSA 2VH2A 3DHHC 1NBFC 2N9LA 2KFKB 5CX3A 1RAXA 4D2KA 4WAFA 1H4RA 4HXDA 2CJOA 4II3B 1MPEA 4FJYA 2PJHA 2M4NA 1V9JA 4AUQC 3NOBA 3JSVB 2LVQA 4AP4C 2GBMA 1YIWA 1QOGA 1XQQA 1ZE3D 3H6NA 4K7SA 3AMZA 1N61A 3MP9A 2O6VB 5G2NA 3ZUNA 4YTMB 2K39A 3ETRA 4MGKE 1QOBA 4RMAA 2ZNVC 1UNSA 3ALBA 4P1BC 2BBCA 3RZWC 2Z0EB 2GLSA 5HG2A 4AJWA 2ZPYA 4OVUA 1FCCC 4GDLA 3SEBA 4W9JA 4GXBA 4HRSA 1XD3B 2WDTB 4II2B 4TMAB 1KRHA 2WXJA 3W5UB 4HKZE 4F7ZA 1F52A 2V9HA 1I4XA 1J7CA 2BW2A 4NAMA 2YEPF 1V80A 1ZGUB 3CF6E 4ITKA 1WH3A 4HVBA 3PRZA 1P7FA 4W9IA 3AEBB 3KWLA 3P63A 4K81A 1YN3A 4HCNB 3RT3B 3ZRFA 2WXPA 5BYSA 1ZPSA 4FN2A 4DXAB 1PQSA 4JIOU 2BPSA 3NVYA 4MSQB 2KWDA 2K1FA 1XLNA 2LRWA 1TIFA 3B2GA 2IGHA 4LDTB 1RFAA 1KJTA 1FNWA 3R3MA 2MEKA 4YL8A 2OHFA 2PE6B 2C60A 2DLBA 4BOSC 2IY1B 2KTFA 2HE7A 4BBNC 1VZ8A 1JCKB 4I6NB 2X8XX 2RSUA 4GGQA 2DAJA 3DDCB 4XDCA 1ZUD2 3N1ZC 3RI7C 1CQVA 4XDDA 5BYQA 3UQAA 1FXAA 1XO3A 3W2DA 2LGSA 2BB5A 1D6EC 1GB4A 4EOYA 1FNUA 4XZ4A 2K5PA 3Q8BA 3GZNI 1D5XC 2W82A 5EE1A 1MFWA 1P0RA 2JPHA 4LLGM 3AEAB 3ECIA 3IHPC 2R2QA 3PSEB 5AZGA 2PW9A 4WWOA 3ZXRA 4CQNA 1ET9A 3LXFA 3TMPB 1LFDA 4NJ6A 3VR8B 2KX0A 1MJDA 4ANWA 2GRIA 1F9JA 4FXCA 2RGFA 4NNJB 1BMLC 1N5XA 2XK5A 5EDSA 3DVGX 2R61A 4RGMA 3OJ4B 3QIJA 1FO4A 2WU2B 4W9FA 2KOXA 3AB5A 2EKIA 2BKRB 3AEGB 2LXCA 3L17A 1R4MI 1OQQA 2QMTA 4MH0E 2MA9B 1EO6A 2M1MA 3AH7A 4PK1A 4K3BA 5IAAC 3RCZA 2WX1A 1TZ1A 4P7IA 2VRRB 2FNJB 3I9V1 3R66C 3KYDD 2Y5BB 3NG0A 1Q10A 2KXJA 4K1RB 1E9MA 3E56A 3W1YA 3AEFB 4JL9A 4GMVA 4CHKA 1AN8A 1E8XA 2WQYB 2W9NA 3GS2A 1SB3C 2DWQA 3DBRI 1T3QA 3U7DA 5L83A 4RFBA 1CK1A 4A6QA 1I42A 4NQKE 2QEJC 3BVGA 5CHFA 3KUDB 2KJRA 2IDYA 2L52A 2VZKB 3HUIA 4XX5A 1SGHA 4HPLB 4RM8A 2HJ1A 2BS3B 3DQVA 4ZOHC 3JW0X 3C8YA 2LFIA 3EA6A 4GDKB 1YQ4B 2REXA 2IPKD 4A55A 3AU5A 5E6OA 1ZOYB 3CSFA 3AN1A 3Q6BA 2ZVOA 1XLQA 1RRBA 1V49A 1SF0A 2N7EA 3P4PB 5JHAA 4GU2A 2N9KA 1UF0A 3DBSA 3P42A 2M19A 1A70A 1I4GA 2BYFA 5D3DA 5BO4B 3TEXA 3X0WA 1N5WA 3A9JB 2KLGA 2MSED 3OJ3A 5LLIA 2PVOD 2IJ0A 4K7WA 5LXHA 5BYRA 2KMAA 4IC7B 4JGHB 1DOYA 4W9DA 2CR5A 2G1EA 2AX5A 3ZO5B 3GB1A 3WA0A 3HHMA 4WAAA 1L0VB 1Q5WB 2HTHA 5T8IA 4KSLC 1XCQL 2GBNA 3UQBA 1EF5A 3ONSA 2IBIB 1ZKHA 3ZQ4A 2JXXA 1J7AA 4A9AA 1ZDXA 4LNIA 2OEDA 5BMIA 1TY2A 1ET6A 2QC8A 1EWCA 3M3JA 5BMHA 4LCDE 3FAHA 1Z2MA 2B3AA 2ASQA 1MG4A 1WMHA 2FCNA 3AV8A 1TS3A 2PMVA 1WXVA 1ENFA 2BB6A 1IUEA 3ZNZB 3RNBC 3VUWA 3DWGC 1F2RI 4L23A 1N63A 1PYWD 1VDVA 4A3OA 1J7BA 2D10A 1SE9A 2WGSA 2KTRB 2I1JA 4LNKA 4KGTA 4G3XB 3MC0B 3OAWA 2LUMA 3QK0A 1E7UA 1OGWA 5H8YE 1WXMA 4C80A 1HXYD 1HA5A 3D32A 3KUZA 2KZRA 1NYQA 4FHJA 2KVZA 3LB8C 3OG5A 3VDZA 3NS1A 4NY0A 3PREA 1SBBB 3LJ3A 4M01A 2IGDA 1WXAA 4MJSB 2IYDB 1C3TA 1JMLA 1WF9A 5J2RA 2XNAC 4C00A 3V6CB 2QILA 1V86A 2X38A 4GSWA 2BTEA 2KC1A 1I4HA 1OEYA 3FILA 4ZRPA 1I4QA 4ZRQA 4G0NB 2L32A 1JQ4A 1K50A 4M8MA 4WJPA 3R8BA 2D2QA 3U52E 1QOFA 3VR9B 2FBWB 2KWVB 3ZJUA 1SSNA 4DBGA 3FC4A 5CTRC 5AZFA 1FCLA 1D5ZC 4XWWA 1E6EB 1V97A 3RNGC 2MW5A 3PHWB 3SDLC 4BFRA 3MC8A 3Q2AC 4EZJA 2K0PA 2KMCA 5FR6A 2QHOA 1B1ZA 1FNVA 4HKQA 1LO5D 1VZ7A 2YLMA 1E8WA 1HZ5A 4W9LA 1UELA 3TEYA 1L5PA 4RGNA 2L83A 4GN1A 5HI1A 1TYGB 4N59A 3RULA 2KQ7A 3RNCC 3W5VB 4FBJB 3P4RB 3WAOA 3MHSD 3GZNB 1F0ZA 1KTKA 2LI5A 1GPXA 2RPVA 2D11A 4B6WA 1FM0D 5C23A 1LQBA 1TS4A 1B9RA 1WZ3A 2JU6X 3HK0A 3JYUA 4OVVA 2C5LC 4JLCA 3AE7B 1E7PB 2WP9B 3J9CA 3RUIB 4MEMA 2I1KA 2MBHA 1C4CA 1JWUD 2AEHA 1V5OA 3ML9A 4KSKC 2KDFB 4W9GA 2KMMA 1C4PA 1LXDA 4RF0A 2LZ6A 4XC2A 1MVKA 3QWZB 4BVUC 4CO7A 2LJ5A 3VUXA 1OTRB 3O13A 1E90A 1SE4A 5D94A 3SR6A 3R2TA 3URYA 5D7GA 5DPWA 3L10B 1PGBA 2NBUA 2QCZA 4I6PA 5IN7A 3P4QB 1IP9A 3DBHI 4XE0A 2RR9A 3N1YC 3Q8EA 3VTVA 1PUTA 5CHVC 3TUOA 4EFOA 1N6ZA 3T3OA 1WWTA 3HIZA 2KK8A 3DBRB 2WXFA 4FHKA 4AOFA 4AWJA 1NI3A 4IWQA 1D5MC 1J0GA 1KLVA 1GOZA 3DWMA 4W9EA 2AQ3B 2BS2B 4KZ0A 1SJHD 1YJIA 4YSXB 1OEYJ 1T0YA 1SE3A 1T0QC 3L54A 3WIMA 1HTQA 1SIJA 4GB9A 4ACFA 4DDID 2GOWA 1VJKA 5H92C 3RYTA 2WXOA 1G6JA 1RYJA 3T8MA 3ABVB 2DZMA 2PIAA 3AE3B 3NZ3A 3LDZE 2CKHB 5GXGB 3DCGA 2DHZA 3HVZA 2ZJDA 3PHXB 2FCQA 4GIVA 3H7PA 3DHIC 1WYGA 1UGMA 3GP7A 3RFZB 2EELA 2FE8A 1QF6A 1GAQB 2G3QB 4YSZB 3PT2B 5IO9A 1TY0A 3BK2A 3NVVA 1RWSA 3VAWA 3MFGA 5I4DA 2M56B 3EECA 3IT6B 4OZCA 3QC8B 2EMTA 4XYCA 2D3GA 4HWIB 2KO3A 4OHJA 3AE8B 2MJEA 2WXLA 2L0FA 3T3NA 1AWDA 1WRIA 3A4SC 2FIFA 2NCNA 3TBLD 3W1SC 5E6JA 2DAFA 1IGDA 2AQ1B 4TUUA 4M02A 3N3KB 3WCQA 2BYTA 2L1AA 3ZXVA 4ZRIA 1E8ZA 3AE5B 1BT0A 4X57B 1TGZB 2PVGC 1V5TA 2HDEA 4PYUA 5EE9A 2IO1B 3NVZA 3PVLA 1UWMA 1KH0A 1GNUA 3PZDA 2KLCA 2M0AA 2WXGA 2KN5A 2KD0A 4MSMB 3QHTA 3VTWA 4S0RA 3KWVA 1GB1A 3Q3JA 4DHJB 4RGOS 1WJ6A 4IWOA 4IM0A 2KJ6A 2BGFA 2GMIC 4DDGD 5JHBA 3QA8A 4ICVA 2V3SA 3L0WB 3ZKJC 1DGJA 3WALA 1UUPA 2ACZB 1RLFA 4EUTA 1AARA 2K25A 3PZ7A 3X23A 2WS3B 4RM9A 3ZTDA 4YTPB 3AE9B 5IA7A 3KLSX 4RNAA 4YWGG 1HZ6A 4WJOA 5IP4D 1NENB 2JXTA 3H7PB 1FXIA 4GDKA 4JPSA 1SIFA 3OLMD 3V62A 2MBBB 1FD6A 3SFEB 3RNAC 1FXTB 5D3IB 2XBBC 2GBJA 1I35A 1DYQA 3PPAA 2RDBC 4JX1C 4EE2A 3RZFA 1UGJA 2DZIA 3AXCA 3DPDA 3A9JA 2N7JA 3VFKA 3GE3C 3I63C 1EF1A 2JWZA 3AECB 2LGIA 4AQ7A 2WWZA 4FLHA 2MP2B 4OVZA 4KV2A 4A3PA 1VR9A 4MM3B 1KF6B 2KNBA 2ONQA 3WAMA 1MI0A 3PRMB 3IFWB 1ESFA 3O65B 2M8SA 2C7MB 2K8CA 4WWMA 3Q3OC 3GE8C 2JSVX 2MBEA 2MH7A 2WHIA 3I5JC 1C76A 4F1SA 1YNTE 1NI2A 1UBQA 2N4FA 2RMMA 4ARIA 2LHEA 1C9FA 4M00A 4NJ7A 2QDFA 1C4AA 1YD8U 2KTRA 2INDC 3CIRB 1IPGA 3PGEA 1XXGA 3KW5B 2BYVE 3DOWA 1MHHE 3V05A 1NYRA 2K9XA 4Q2JA 4DXGA 3DBHB 3L4PA 2MRPA 2FCSA 4KDLB 2K8BA 2YVCA 2J0MA 2GBRA 2JQRB 1K52A 4JWSC 2Y5CA 2AWTA 3L16A 2HJ8A 4MJSA 3K9OB 3ZYYX 2NR2A 3AE4B 4IKGA 1N62A 3VH3B 1YJJA 1E8YA 1HE8A 4M8NA 2KDMA 3P2BA 1NDDA 4MGYE 3H8HA 1XT9B 1L7YA 2LVPA 2PPHA 3RNEC 2M17A 4TQ1A 2L76A 3BINA 1I4RA 2ZPNA 1H8CA 2V0GA 3EHVA 3VRBB 5EE0A 2L0TA 2WDVB 2HTME 2JVCA 5CHWA 3VUYA 2E6XA 3KVFB 3U2SC 3ZGZA 4JWUC 3JVZX 2UYZB 5KHOA 2C9WB 1UD7A 1GC7A 2JUOA 2K6DB 3BY4B 1YX5B 1WGYA 3H1UA 5TSSA 2QIEB 2MLBA 2WXKA 4PS7A 2J0JA 1QLBB 1EUVB 2PE9A 5IOIA 1C77A 2FUG1 1WJNA 1V8CA 5TR5A 4PT5A 2MBQA 2AQ2B 1TBEA 1WGHA 4F8CB 3NS8A 4A8XC 3IAS1 1V81A 2KFJA 3WAPA 2XEWA 4E74A 5AEKB 1YN5A 4DWFA 1E0ZA 2RD0A 1XEEA 3UINB 5JXVA 2L05A 3WANA 2LGDA 4TSSA 4DQOC 4BKSD 1K8RB 2LEKA 4KVGB 5E6NA 5C2TB 2UU7A 3EUB2 3C0RB 4KX6B 2SAKA 3NJTA 1MG8A 4C56C 3B08A 4R3DA 3B0AA 1UBIA 3AE2B 3ZJVA 1KFYB 2I38A 3NZUA 2TSSA 1PGAA 5EE3A 5IKCM 2JT4B 1YOVB 3KH0A 1BXTA 3U8ZA 4AS1A 4KZCA 2MJDA 2BWFA 3RPFC 2CHZA 2JYTA 1TTNA 4GOCA 4JE3B 2KACA 1KOTA 2NVUI 2DENB 3TEWA 1WJUA 4MT5A 4FULA 2FCMA 2W3SA 2KN4A 4C7ZA 2BT6A 4MACA 3A9KA 1JRPA 1OFFA 1VD2A 4TKNA 4W9HA 4WWPA 2E3TA 3QAQA 4N58A 2I2YA 5FK9C 3V61A 1JWSD 5D6JB 2O6VD 2LUEA 1L4ZB 4NZLB 2BF8B 4BBNF 4RF1A 5L95C 1FEHA 2ZW0A 4MGIE 3HRDD 2RDHA 2B76B 2WYQA 4TV3A 5MPOA 2K22A 2BKFA 4RCOA 4MDKE 1L2NA 2IO3B 4HROA 1F1HA 3MJ5A 1STEA 2WXHA 3IVFA 3B1LX 1FPYA 4MH8A 4PS3A 1L6UA 1M4VA 3ZIMA 2V3NA 4HJGE 1E5WA 1JALA 1PFDA 3UI3A 2W54A 4LK0M 1R4MB 2NMQA 3VTUA 1CJEA 3RMKC 1S3SG 3N9YC 4KIKB 3C19A 1IGCA 3VQIA 4P6VF 2LHDA 1FFUA 1WGRA 1OQYA 3Q14C 1P7EA 4LDTD 4IM3A 1YX6B 1WR6E 2KVRA 1D4BA 3DHGC 1Y8RC 3HM3A 1Q0WB 2V4LA 2NTTA 4ZRJA 4ZDVA 2A5UA 3PO0A 2EKEC 4HPMB 5DPTA 3RN9C 1TJEA 4ZYSA 2FIDA 1FIQA 2MX2A 2ZNVB 4JQWC 3Q8AA 2MBOA 1TZOA 2J53A 2KWUB 2Z8LA 3M95A 4O1NA 2JY6A 4KDIC 1AW7A 2MCNB 3L13A 1WI0A 1X1MA 2NBVB 1WE6A 1XLPA 3BIID 3EGRA 1TS2A 1PDXA 3A9KB 3PTFC 2G4DB 2DZJA 1WY8A 5G5GA 1WIAA 3APDA 2MQJA 2WXMA 1YQBA 3W9CB 4YSYB 3AEEB 3SFDB 3N30A 4G11A 3M62B 4A20A 1EU3A 3AE1B 3ZLZA 4ARCA 2ICIA 3ZJTA 2W3RA 2LASA 2KQSA 2OJRA 3AE6B 1WX8A 2WXNA 2IO2B 3KYCD 1V6EA 3DVNV 1LM8B 2JWUA 3R7QA 1TKGA 4RH6A 4ASWC 1TT5B 2K8HA 3AEDB 2C7NB 1SXTA 1EU4A 1QOAA 1YJ1A 3DBLI 5AUKA 1GC6A 2KDIA 1QZEA 4M0WB 2PKOA 2MJ3A 1MHXA 2MWSB 1K53A 4A90A 3PRPB 3APCA 4LJPB 3NVWA 3AI5A 2D07B 2J7QB 1Z5SB 3UGBB 2L8JA 2WU5B 4OZBA 4KKJA 2O2VB 1SEBD 3BZDB 2G9HD 2QSDA 3P4SB 2MP2A 4NQLB 1WGKA 4MM3A 2VZKD 4NJCA 1VLBA 1P3QU 2L7RA 1XLOA 4DK5A 3QX1A 2ZZPB 3A4RA 1JWBD 4EZKA 1T0SC 4CYEA 4UDUC 3Q3FA 2KHWB 2PLPA 3VHTC 2JYEA 3R2IA 2BYEA 4ZYNA 2ZVNA 4HK2A 3TIXA 2JZPA 1HQRD 3AU4A 3NRZA 2W55A 4NAWA 4S17A 5FR3A 1YN4A 3ZDMC 1VCBA 2LWPA 4N6EB 3Q8CA 1A5RA 1V2YA 4YXDB 1WR1A 4LTUA 5C1ZA 1HTOA 3Q69A 2DYOA 3P1MA 4KKIA 4B0EA 2HD5B 2DZKA 1ZP0B 3ZNID 2N1VA 4PYZA 3SD5A 1WXQA 2ZCBA 1SE2A 2BVCA 3MTNB 3I57A 3MJWA 4BAXA 4LNNA 1R4NI 3TEZA 4WQOB 2AL6A 2NPTB 1QQRA 4G50A 3R7RA 2NTSA 2KDEB 2LJIA 1T6BX 2WDQB 5G55A 3MC9A 2ZEQA 4HDOA 1RM6C 4P1CC 2CS4A 2A4ZA 4IOIE 4J6IA 2WX0A 2DYBA 1HEZE 1C79A 3PLUA 4FJVB 1WE7A 2RPQA 3ZNGC 4RGTA 2D5GA 4FJZA 1F2RC 4B95A 4YT0B 2L00B 2EMSA 2N9PC 3HVDA 2DBYA 4K7UA 4BKTA 4MGZE 3QJZA 2Y5PA 2V3PA 5AUIA 1T0RC 4AJYB 3N1XC 5BMGA 2K3UA 5DPSA 1D3ZA 1WXSA 2IO0B 1V1PA 1JW9D 2ON8A 4QAYA 2C7HA 1ISNA 4GDLB 4IG7B 2KX3A 4YTNB 5HFYA 4EKUA 4IWPA 3PV1A 3BYTB 2INPE 4XGAB 1KM7A 3BK1A 5LXIB 2WLBA 2L3ZA 4LJOB 3ZW3A 2KC2A 1UZXB 3N20C 1FMAD 2CJNA 4NAWB 3OWEB 3M63B 4LNOA 2KDBA 2WXRA 3IT4B 3T9LA 3UIOB 4C4VA 4BZAA 4HJKA 5AZHA 3NHEB 3MHZA 2YEPB 2KT7A 1JWMD 3U7ZA 2DX5B 3V60A 2JRHA 3VXWA 3H7SA 1U4AA 3BVMA 4ZRKA 1TS5A 3CWIA 2KYWA 4I6LB 1I7HA 1P9DU 3Q3MC 3DVNU 2DNFA 3UF8A 3NY5A 3AULA 4P16A 1FRDA 1WFYA 1YQ3B 1GG3A 3B2FA 1E7VA 2LGXA 3UIPB 2DYMA 2CHXA 1T5XD 2IGGA 2N1WA 5J18A 1UWXA 2IZVB 3A33B 1I4PA 3CSTA 5HKHA 4FADA 1L0XB 4KGSA 3TCAA 2Z0DB 4DXFA 2OJWA 3RD2A 1FFVA 2N7DA 2G45B 3E9SA 1Q1OA 2KAJA 2RDGA 4BOZB 3VVWB 1GUAB 3LYYA 1V1PB 3IBEA 2BWES 1NEKB 5JZEB 2XK5B 1P98A 4HPPA 3IG3A 5FKAC 2WXQA 4WWNA 4WIPA 2LRUA 1EWYC 1WYWB 3DBLB 4J3OD 3DVGY 3V3XA 1UH6A 4HEA1 4DHZE 2GI9A 2GBKA 4HLEA 1TKEA 2JZZA 1WM3A 2KKCA 4EEWA 1DOXA 3V6EB 4WQMA 4C4VB 1IBXA 4GLSC 2QJLA 3TL5A 1VRAB 4W9KA 4MELA 1V1OA 2ZW1A 1OQRA 2J0KA 3TJPA 2Z59B 4DHZB 2AYOB 1WZ0A 1JROA 1RFKA 2D3BA 3IAM1 1ZXIA 1ACCA 4W9CA 1CZPA 3BWUD 2LD9A 1N60A 4KIKA 2INNE 2LMCA 1IYFA 1TKYA 3ZNHB 1WGDA 1SJED 4TQ0A 1L6VA 2N9EB 1KLUD 2FUHB 4E71A 3AM9A 2CU3A 3SHQA 2H89B 3H9DA 1NVID 3K9PB 2ZCCA 3U4EG 1WGGA 4URKA 2NBWB 2OOBB 2Y3AA 1L0YB 1WX9A 3ZDTA 3BVZA 3HM6X 3W1SA 2KANA 2D3AA 2IY0B 5D2MB 2J52A 3I3TB 1WJ4A 1CMXB 4L1BA 1R4NB 1C1YB 2JRIB 3ZRCA 2NS5A 2N9XA 2LGYA 1Y56A 4EZLA 3RNFC 4ANXA 5G5HA 3GOEA 1K51A 3NZSA 1F77A 3VH4B 2KJHB 1WX7A 5HHDG 3PLVA 2JF5A 4BKSA 2R2OA 1DOIA 3QQ8B 3SU8X 2J42A 2V1YA 2G4SA 4OZAA 4BKGA 5J17A 1IBXB 1XCTL 3APFA 2SEBD 4WJNA 4ICUA 1WMHB 2JZ3B 4B9KA 1VZ6A 5DPRA 1QKZA 3QARA 2K6QA 2Q5WD 1M94A 4E3CA 2J4XA 3PZ8A 3A1QA 2INCC 2BQQA 3ML8A 4WJQA 3Q3NC 4WURA 3KUCB 3U30A 2V4IB 1XF5L 2FAZA 2BS4B 3S2AA 1ZXHA 2KFKA 1E10A 3ZVVA 1J8CA 1JRUA 1J19A 1ZDVA 4M0WA 2M0XA 2CHWA 2UWQA 4OW0A 5JH5C 3CMMB 5C3JB 2LVOA 1R7SA 2D3CA 4DHJD 2KQ4X 5GMVA 4US8A 2H88B 1ZW7A 4REZA 2O2VA 3JSVA 3ENEA 4B0MA 2MHJA 4ZHOA 1S1QB
chains in the Genus database with same CATH topology
1NYQA 1JWAD 1C9FA 1PGXA 2JX5A 1C4AA 2PLPA 3LB8C 4L2YA 3Q8FA 3CIRB 3NS1A 2JYEA 1SBBB 1XXGA 3R2IA 4H2AA 2N0SB 2IGDA 4WH4A 3TSSA 1MHHE 3FILB 3V05A 2K9XA 1NYRA 1QILA 2JZPA 1HQRD 1JMLA 3NRZA 4Q2JA 3B9JA 3L4PA 4DXGA 2XNAC 2W55A 4XWTA 1ROEA 2WNMA 5FR3A 1YN4A 4US9A 4N6EB 2JQRB 3Q8CA 3VRAB 2QILA 2XN9C 2X38A 1K52A 4YXDB 2GB1A 4JWSC 4LTUA 3Q69A 2DYOA 1YMHE 3P1MA 4KKIA 4B0EA 2Y5CA 2BTEA 1I4HA 4USAA 1ZP0B 3FILA 4C7YA 1WXQA 1I4QA 1C78A 4ZRPA 4ZRQA 1L4DB 1EM7A 1SE2A 2L32A 3NUHB 3ZYYX 1JQ4A 3AE4B 3I57A 4KGRA 1K50A 3R8BA 4IKGA 3U52E 3TEZA 1QOFA 1N62A 1YJJA 3VR9B 2FBWB 3ZJUA 2KDMA 1SSNA 1QQRA 2NTSA 3FC4A 1AYFA 1KLGD 3BYYB 1FCLA 5LNK1 1D5ZC 2LJIA 1E6EB 4XWWA 1V97A 1T6BX 2WDQB 2WXIA 3H8HA 1QT9A 3KQ4A 1RM6C 1WSPA 2K0PA 4ZHPA 1B1ZA 4IOIE 2WDRB 4IDIA 1FNVA 4TQ1A 4HKQA 1HEZE 1LO5D 1BUIC 1VZ7A 2PTLA 1C79A 1I4RA 1FRRA 1HZ5A 3IXSA 3TEYA 2V0GA 1L5PA 4RGNA 2L83A 5HI1A 3VRBB 5EE0A 1TYGB 4N59A 2WDVB 4RGTA 2D5GA 2HTME 2N9LA 3W5VB 4D2KA 1F2RC 3P4RB 4WAFA 4YT0B 1F0ZA 1KTKA 2E6XA 3HVDA 2DBYA 3U2SC 1GPXA 3ZGZA 2RPVA 2CJOA 1MPEA 2Y5PA 4JWUC 2V3PA 1FM0D 5AUIA 5BMGA 2K3UA 1TS4A 1B9RA 2JU6X 3AE7B 1V1PA 1JW9D 2ON8A 1E7PB 2WP9B 5TSSA 2QIEB 3J9CA 4GDLB 2WXKA 1C4CA 1JWUD 1QLBB 1QOGA 4YTNB 1ZE3D 5HFYA 3AMZA 1C77A 2FUG1 1N61A 3MP9A 4YTMB 2KMMA 3ETRA 1C4PA 3BYTB 1V8CA 2INPE 1QOBA 3BK1A 1UNSA 4PT5A 2BBCA 2WLBA 4RF0A 2AQ2B 5HG2A 1FCCC 1MVKA 3SEBA 4A8XC 3IAS1 1FMAD 2CJNA 4NAWB 3O13A 3OWEB 1YN5A 1E0ZA 1SE4A 4HRSA 4TMAB 2WXRA 3IT4B 1KRHA 2WXJA 3R2TA 3SR6A 3W5UB 4HKZE 3URYA 5D7GA 1XEEA 1I4XA 1J7CA 2BW2A 4NAMA 5JXVA 2YEPF 4ITKA 4TSSA 1PGBA 4DQOC 3P4QB 3MHZA 1P7FA 3Q8EA 4XE0A 2YEPB 1PUTA 1JWMD 3TUOA 3U7ZA 3AEBB 3KWLA 3P63A 3T3OA 2LEKA 1WWTA 2WXFA 1YN3A 3EUB2 3BVMA 5C2TB 2WXPA 1TS5A 1ZPSA 5BYSA 3CWIA 1I7HA 3NVYA 2KWDA 4KX6B 1NI3A 1XLNA 2SAKA 1D5MC 3B2GA 4P16A 4C56C 1FRDA 1YQ3B 2IGHA 4R3DA 3B2FA 1FNWA 1GOZA 3AE2B 3DWMA 2DYMA 2AQ3B 2BS2B 3ZJVA 2I38A 1KFYB 2MEKA 2OHFA 1SJHD 1PGAA 2TSSA 1T5XD 2DLBA 5EE3A 1YJIA 2IGGA 4YSXB 1SE3A 1UWXA 1BXTA 4AS1A 2MJDA 3RPFC 1SIJA 1VZ8A 2JYTA 1JCKB 4JE3B 1VJKA 1I4PA 2KACA 5H92C 1L0XB 4XDCA 1ZUD2 3TEWA 4MT5A 1CQVA 4XDDA 2WXOA 5BYQA 4KGSA 4DXFA 1RYJA 2W3SA 2KN4A 4C7ZA 1FFVA 1FXAA 3ABVB 2PIAA 1XO3A 2BT6A 3AE3B 4MACA 1JRPA 3E9SA 1OFFA 3NZ3A 3W2DA 2E3TA 4N58A 2KAJA 2RDGA 2I2YA 2BB5A 1D6EC 5GXGB 5FK9C 1GB4A 3LYYA 1V1PB 1FNUA 2K5PA 3Q8BA 1D5XC 3HVZA 1NEKB 2W82A 5EE1A 1JWSD 4LLGM 3AEAB 1WYGA 5FKAC 3GP7A 1L4ZB 2WXQA 4NZLB 2PW9A 2EELA 3RFZB 2FE8A 4CQNA 1ET9A 3LXFA 1QF6A 4RF1A 1GAQB 3VR8B 4YSZB 1FEHA 1TY0A 2ZW0A 3BK2A 4WIPA 3HRDD 2RDHA 2B76B 3NVVA 1RWSA 2GRIA 5MPOA 3MFGA 5I4DA 2K22A 2M56B 3IT6B 4FXCA 4OZCA 1EWYC 4RCOA 1BMLC 1N5XA 4HROA 4J3OD 3V3XA 4HEA1 3MJ5A 1STEA 2WXHA 2R61A 2GI9A 4MH8A 4OHJA 4RGMA 3AE8B 2MJEA 1L6UA 1M4VA 2WU2B 1FO4A 1TKEA 2V3NA 2WXLA 3AB5A 4HJGE 1AWDA 2EKIA 3T3NA 1WRIA 1DOXA 4WQMA 1IBXA 1JALA 1PFDA 3AEGB 3UI3A 2W54A 4GLSC 5E6JA 2QJLA 1VRAB 4LK0M 1OQQA 2QMTA 1IGDA 1V1OA 2AQ1B 2NMQA 3AH7A 2ZW1A 1OQRA 3WCQA 2BYTA 2L1AA 1CJEA 3N9YC 1IGCA 3VQIA 4P6VF 2LHDA 1FFUA 3I9V1 1JROA 1RFKA 1P7EA 1Q10A 1E9MA 3AE5B 3E56A 3IAM1 3AEFB 2PVGC 1ZXIA 1D4BA 1ACCA 2HDEA 5EE9A 1AN8A 1CZPA 2WQYB 3NVZA 3BWUD 2DWQA 1SB3C 3GS2A 1N60A 1KH0A 1UWMA 2NTTA 1T3QA 2M0AA 2WXGA 4RFBA 3PO0A 1CK1A 4A6QA 2INNE 2LMCA 2QEJC 3BVGA 1TKYA 3KWVA 1GB1A 1SJED 4TQ0A 1L6VA 1KLUD 1TJEA 4RGOS 4ZYSA 2IDYA 1FIQA 2L52A 3AM9A 2VZKB 2CU3A 3HUIA 3Q8AA 2H89B 1TZOA 2J53A 1NVID 2Z8LA 4O1NA 2BS3B 3U4EG 1AW7A 4ZOHC 2Y3AA 3C8YA 2LFIA 1L0YB 3EA6A 1DGJA 4GDKB 1YQ4B 1XLPA 2IPKD 3BIID 3BVZA 1TS2A 3EGRA 1PDXA 1UUPA 2ACZB 4A55A 1ZOYB 3W1SA 3AN1A 5G5GA 1XLQA 3PZ7A 2WS3B 1SF0A 2WXMA 4YTPB 2J52A 3AE9B 3KLSX 3P4PB 4RNAA 2N9KA 3W9CB 4YWGG 1HZ6A 3P42A 1NENB 2JXTA 2M19A 1FXIA 1A70A 1I4GA 4YSYB 4L1BA 3AEEB 5D3DA 4JPSA 3SFDB 3TEXA 1N5WA 1FD6A 1EU3A 3AE1B 3SFEB 4ARCA 1Y56A 2PVOD 2ICIA 3ZJTA 2IJ0A 2W3RA 5D3IB 5BYRA 5G5HA 1K51A 1F77A 1DOYA 5HHDG 3AE6B 2G1EA 1DOIA 1DYQA 2AX5A 2J42A 2WXNA 4JX1C 4EE2A 1UGJA 3GB1A 2JWUA 1TKGA 4OZAA 4RH6A 2N7JA 1IBXB 1L0VB 5T8IA 1XCTL 2SEBD 3AEDB 1XCQL 1SXTA 1EU4A 1QOAA 3AECB 5AUKA 2LGIA 4AQ7A 1VZ6A 1QKZA 4OVZA 2PKOA 3ZQ4A 2Q5WD 2MJ3A 1MHXA 1K53A 1J7AA 4A90A 4A9AA 1ZDXA 2OEDA 5BMIA 1TY2A 2J4XA 3PZ8A 3NVWA 1ET6A 1VR9A 1EWCA 4MM3B 5BMHA 1KF6B 2ONQA 3FAHA 1MI0A 2WU5B 1ESFA 4OZBA 4WURA 2V4IB 1TS3A 1XF5L 3AV8A 4KKJA 2PMVA 1ENFA 1SEBD 2BS4B 1ZXHA 3BZDB 1E10A 2BB6A 1IUEA 2G9HD 2QSDA 3P4SB 3DWGC 1F2RI 1ZDVA 4M0WA 4L23A 1N63A 1PYWD 1WGKA 1VDVA 4OW0A 4WWMA 1J7BA 5C3JB 1R7SA 2JSVX 2KQ4X 2MH7A 4KGTA 4US8A 2H88B 2VZKD 3MC0B 4NJCA 1VLBA 2LUMA 4REZA 1C76A 1XLOA 1YNTE 5H8YE 1JWBD 2RMMA 4B0MA 4C80A 1HXYD 1HA5A 4ZHOA 4ARIA 4UDUC 2LHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OFF A;  1NYQ A;  1DGJ A;  1JW9 D;  1JWA D;  1YQ4 B;  2E3T A;  4N58 A;  2KAJ A;  1E7P B;  2WP9 B;  2JX5 A;  1XLP A;  2QIE B;  3BII D;  1PDX A;  2ACZ B;  5GXG B;  3LB8 C;  1ZOY B;  2K5P A;  3AN1 A;  1JQ4 A;  3CIR B;  3HVZ A;  3NS1 A;  1NEK B;  1QLB B;  1QOG A;  4YTN B;  5EE1 A;  5G5G A;  1XLQ A;  3AMZ A;  2WS3 B;  3AEA B;  1SF0 A;  4YTP B;  3AE9 B;  1WYG A;  3P4P B;  1N61 A;  2N0S B;  4YTM B;  2KMM A;  3ETR A;  3W9C B;  1V8C A;  1NYR A;  1QOB A;  1NEN B;  2K9X A;  2M19 A;  1FXI A;  3LXF A;  1A70 A;  1QF6 A;  3NRZ A;  3B9J A;  3L4P A;  4YSY B;  1GAQ B;  3AEE B;  2W55 A;  2WLB A;  3VR8 B;  3SFD B;  1ROE A;  4YSZ B;  1N5W A;  3HRD D;  4US9 A;  4N6E B;  2B76 B;  3NVV A;  1RWS A;  2JQR B;  3AE1 B;  3SFE B;  5MPO A;  3VRA B;  1FMA D;  2CJN A;  2K22 A;  2M56 B;  4FXC A;  1EWY C;  4YXD B;  2PVO D;  1N5X A;  4JWS C;  4LTU A;  4HRS A;  4HRO A;  2W3R A;  1E0Z A;  3P1M A;  5G5H A;  2Y5C A;  1KRH A;  3SR6 A;  4USA A;  3W5U B;  1ZP0 B;  1DOY A;  4C7Y A;  1J7C A;  3AE8 B;  1WXQ A;  2MJE A;  1L6U A;  3AE6 B;  2WU2 B;  1FO4 A;  2G1E A;  1TKE A;  4ITK A;  3AB5 A;  3ZYY X;  1DOI A;  1AWD A;  2AX5 A;  2EKI A;  1WRI A;  3AE4 B;  4JX1 C;  1DOX A;  4WQM A;  3P4Q B;  1JAL A;  1PFD A;  3AEG B;  2W54 A;  1PUT A;  1QOF A;  2QJL A;  1N62 A;  1YJJ A;  3VR9 B;  3AEB B;  1TKG A;  3KWL A;  2FBW B;  1OQQ A;  3P63 A;  1L0V B;  3AH7 A;  2LEK A;  1WWT A;  3AED B;  1OQR A;  4ZOH C;  5C2T B;  3WCQ A;  3EUB 2;  3FC4 A;  1AYF A;  1QOA A;  3AEC B;  5AUK A;  1E6E B;  3CWI A;  1V97 A;  1CJE A;  2WDQ B;  1I7H A;  3NVY A;  2PKO A;  4KX6 B;  4P6V F;  1QT9 A;  1FFU A;  1NI3 A;  2MJ3 A;  1XLN A;  2Q5W D;  1RM6 C;  1J7A A;  4A9A A;  3B2G A;  1JRO A;  1RFK A;  1E9M A;  1FRD A;  1YQ3 B;  3AE5 B;  3NVW A;  4ZHP A;  3B2F A;  1KF6 B;  2WDR B;  3AEF B;  3FAH A;  4IDI A;  3AE2 B;  2WU5 B;  2PVG C;  1ZXI A;  3DWM A;  2BS2 B;  1KFY B;  5EE9 A;  1CZP A;  2WQY B;  3AV8 A;  1FRR A;  2OHF A;  3NVZ A;  1SB3 C;  2BS4 B;  2DWQ A;  5EE3 A;  1E10 A;  1N60 A;  1UWM A;  1IUE A;  3P4S B;  1T3Q A;  1YJI A;  4YSX B;  1L5P A;  3DWG C;  2L83 A;  3PO0 A;  3VRB B;  5EE0 A;  1TYG B;  1N63 A;  4N59 A;  2MJD A;  2WDV B;  1WGK A;  1VDV A;  2HTM E;  3RPF C;  4WWM A;  1SIJ A;  1J7B A;  1TKY A;  3W5V B;  5C3J B;  1R7S A;  3P4R B;  1L6V A;  4YT0 B;  1VJK A;  1TJE A;  2MH7 A;  5H92 C;  1F0Z A;  4US8 A;  2H88 B;  1FIQ A;  2L52 A;  3AM9 A;  2DBY A;  1VLB A;  1GPX A;  2CU3 A;  3HUI A;  1ZUD 2;  1XLO A;  2H89 B;  2CJO A;  1NVI D;  4JWU C;  1FM0 D;  5AUI A;  1RYJ A;  2W3S A;  5H8Y E;  4C7Z A;  1JWB D;  2BS3 B;  1FFV A;  1FXA A;  3ABV B;  4C80 A;  4ZHO A;  1B9R A;  2PIA A;  1XO3 A;  2BT6 A;  3AE3 B;  1JRP A;  3AE7 B; 
#chains in the Genus database with same CATH topology
 4K3C A;  4HDQ A;  1JWA D;  1PGX A;  2JX5 A;  4IW0 A;  4L2Y A;  3Q8F A;  2O6V A;  3EC8 A;  4IM2 A;  4H2A A;  3EFU A;  4IUM B;  1GJZ A;  3L08 A;  2N0S B;  4WH4 A;  5E6P A;  3TSS A;  3FIL B;  1QIL A;  3B9J A;  2LXA A;  4XWT A;  1ROE A;  2KWC A;  2WNM A;  3QCA A;  4US9 A;  3VRA B;  2XN9 C;  4ANU A;  2GB1 A;  3ZTC A;  1WM2 A;  1YMH E;  4USA A;  1LGR A;  3EFC A;  4HCP B;  4FA6 A;  4C7Y A;  2VH1 A;  1C78 A;  1L4D B;  1EM7 A;  4NPN A;  2PEA A;  3NUH B;  4KGR A;  3PS6 A;  1P1A A;  4PS8 A;  4N9F 4;  1AYF A;  1KLG D;  3BYY B;  5DCN A;  5LNK 1;  2WXI A;  1QT9 A;  3KQ4 A;  2CU1 A;  3N32 A;  4ANV A;  1WSP A;  4ZHP A;  2AL3 A;  5KHQ A;  1WRD B;  2WDR B;  2NPT A;  4IDI A;  1BUI C;  2PTL A;  1FRR A;  3A1Q B;  3FKY A;  4LNF A;  3IXS A;  2VH2 A;  3DHH C;  1NBF C;  2N9L A;  2KFK B;  5CX3 A;  1RAX A;  4D2K A;  4WAF A;  1H4R A;  4HXD A;  2CJO A;  4II3 B;  1MPE A;  4FJY A;  2PJH A;  2M4N A;  1V9J A;  4AUQ C;  3NOB A;  3JSV B;  2LVQ A;  4AP4 C;  2GBM A;  1YIW A;  1QOG A;  1XQQ A;  1ZE3 D;  3H6N A;  4K7S A;  3AMZ A;  1N61 A;  3MP9 A;  2O6V B;  5G2N A;  3ZUN A;  4YTM B;  2K39 A;  3ETR A;  4MGK E;  1QOB A;  4RMA A;  2ZNV C;  1UNS A;  3ALB A;  4P1B C;  2BBC A;  3RZW C;  2Z0E B;  2GLS A;  5HG2 A;  4AJW A;  2ZPY A;  4OVU A;  1FCC C;  4GDL A;  3SEB A;  4W9J A;  4GXB A;  4HRS A;  1XD3 B;  2WDT B;  4II2 B;  4TMA B;  1KRH A;  2WXJ A;  3W5U B;  4HKZ E;  4F7Z A;  1F52 A;  2V9H A;  1I4X A;  1J7C A;  2BW2 A;  4NAM A;  2YEP F;  1V80 A;  1ZGU B;  3CF6 E;  4ITK A;  1WH3 A;  4HVB A;  3PRZ A;  1P7F A;  4W9I A;  3AEB B;  3KWL A;  3P63 A;  4K81 A;  1YN3 A;  4HCN B;  3RT3 B;  3ZRF A;  2WXP A;  5BYS A;  1ZPS A;  4FN2 A;  4DXA B;  1PQS A;  4JIO U;  2BPS A;  3NVY A;  4MSQ B;  2KWD A;  2K1F A;  1XLN A;  2LRW A;  1TIF A;  3B2G A;  2IGH A;  4LDT B;  1RFA A;  1KJT A;  1FNW A;  3R3M A;  2MEK A;  4YL8 A;  2OHF A;  2PE6 B;  2C60 A;  2DLB A;  4BOS C;  2IY1 B;  2KTF A;  2HE7 A;  4BBN C;  1VZ8 A;  1JCK B;  4I6N B;  2X8X X;  2RSU A;  4GGQ A;  2DAJ A;  3DDC B;  4XDC A;  1ZUD 2;  3N1Z C;  3RI7 C;  1CQV A;  4XDD A;  5BYQ A;  3UQA A;  1FXA A;  1XO3 A;  3W2D A;  2LGS A;  2BB5 A;  1D6E C;  1GB4 A;  4EOY A;  1FNU A;  4XZ4 A;  2K5P A;  3Q8B A;  3GZN I;  1D5X C;  2W82 A;  5EE1 A;  1MFW A;  1P0R A;  2JPH A;  4LLG M;  3AEA B;  3ECI A;  3IHP C;  2R2Q A;  3PSE B;  5AZG A;  2PW9 A;  4WWO A;  3ZXR A;  4CQN A;  1ET9 A;  3LXF A;  3TMP B;  1LFD A;  4NJ6 A;  3VR8 B;  2KX0 A;  1MJD A;  4ANW A;  2GRI A;  1F9J A;  4FXC A;  2RGF A;  4NNJ B;  1BML C;  1N5X A;  2XK5 A;  5EDS A;  3DVG X;  2R61 A;  4RGM A;  3OJ4 B;  3QIJ A;  1FO4 A;  2WU2 B;  4W9F A;  2KOX A;  3AB5 A;  2EKI A;  2BKR B;  3AEG B;  2LXC A;  3L17 A;  1R4M I;  1OQQ A;  2QMT A;  4MH0 E;  2MA9 B;  1EO6 A;  2M1M A;  3AH7 A;  4PK1 A;  4K3B A;  5IAA C;  3RCZ A;  2WX1 A;  1TZ1 A;  4P7I A;  2VRR B;  2FNJ B;  3I9V 1;  3R66 C;  3KYD D;  2Y5B B;  3NG0 A;  1Q10 A;  2KXJ A;  4K1R B;  1E9M A;  3E56 A;  3W1Y A;  3AEF B;  4JL9 A;  4GMV A;  4CHK A;  1AN8 A;  1E8X A;  2WQY B;  2W9N A;  3GS2 A;  1SB3 C;  2DWQ A;  3DBR I;  1T3Q A;  3U7D A;  5L83 A;  4RFB A;  1CK1 A;  4A6Q A;  1I42 A;  4NQK E;  2QEJ C;  3BVG A;  5CHF A;  3KUD B;  2KJR A;  2IDY A;  2L52 A;  2VZK B;  3HUI A;  4XX5 A;  1SGH A;  4HPL B;  4RM8 A;  2HJ1 A;  2BS3 B;  3DQV A;  4ZOH C;  3JW0 X;  3C8Y A;  2LFI A;  3EA6 A;  4GDK B;  1YQ4 B;  2REX A;  2IPK D;  4A55 A;  3AU5 A;  5E6O A;  1ZOY B;  3CSF A;  3AN1 A;  3Q6B A;  2ZVO A;  1XLQ A;  1RRB A;  1V49 A;  1SF0 A;  2N7E A;  3P4P B;  5JHA A;  4GU2 A;  2N9K A;  1UF0 A;  3DBS A;  3P42 A;  2M19 A;  1A70 A;  1I4G A;  2BYF A;  5D3D A;  5BO4 B;  3TEX A;  3X0W A;  1N5W A;  3A9J B;  2KLG A;  2MSE D;  3OJ3 A;  5LLI A;  2PVO D;  2IJ0 A;  4K7W A;  5LXH A;  5BYR A;  2KMA A;  4IC7 B;  4JGH B;  1DOY A;  4W9D A;  2CR5 A;  2G1E A;  2AX5 A;  3ZO5 B;  3GB1 A;  3WA0 A;  3HHM A;  4WAA A;  1L0V B;  1Q5W B;  2HTH A;  5T8I A;  4KSL C;  1XCQ L;  2GBN A;  3UQB A;  1EF5 A;  3ONS A;  2IBI B;  1ZKH A;  3ZQ4 A;  2JXX A;  1J7A A;  4A9A A;  1ZDX A;  4LNI A;  2OED A;  5BMI A;  1TY2 A;  1ET6 A;  2QC8 A;  1EWC A;  3M3J A;  5BMH A;  4LCD E;  3FAH A;  1Z2M A;  2B3A A;  2ASQ A;  1MG4 A;  1WMH A;  2FCN A;  3AV8 A;  1TS3 A;  2PMV A;  1WXV A;  1ENF A;  2BB6 A;  1IUE A;  3ZNZ B;  3RNB C;  3VUW A;  3DWG C;  1F2R I;  4L23 A;  1N63 A;  1PYW D;  1VDV A;  4A3O A;  1J7B A;  2D10 A;  1SE9 A;  2WGS A;  2KTR B;  2I1J A;  4LNK A;  4KGT A;  4G3X B;  3MC0 B;  3OAW A;  2LUM A;  3QK0 A;  1E7U A;  1OGW A;  5H8Y E;  1WXM A;  4C80 A;  1HXY D;  1HA5 A;  3D32 A;  3KUZ A;  2KZR A;  1NYQ A;  4FHJ A;  2KVZ A;  3LB8 C;  3OG5 A;  3VDZ A;  3NS1 A;  4NY0 A;  3PRE A;  1SBB B;  3LJ3 A;  4M01 A;  2IGD A;  1WXA A;  4MJS B;  2IYD B;  1C3T A;  1JML A;  1WF9 A;  5J2R A;  2XNA C;  4C00 A;  3V6C B;  2QIL A;  1V86 A;  2X38 A;  4GSW A;  2BTE A;  2KC1 A;  1I4H A;  1OEY A;  3FIL A;  4ZRP A;  1I4Q A;  4ZRQ A;  4G0N B;  2L32 A;  1JQ4 A;  1K50 A;  4M8M A;  4WJP A;  3R8B A;  2D2Q A;  3U52 E;  1QOF A;  3VR9 B;  2FBW B;  2KWV B;  3ZJU A;  1SSN A;  4DBG A;  3FC4 A;  5CTR C;  5AZF A;  1FCL A;  1D5Z C;  4XWW A;  1E6E B;  1V97 A;  3RNG C;  2MW5 A;  3PHW B;  3SDL C;  4BFR A;  3MC8 A;  3Q2A C;  4EZJ A;  2K0P A;  2KMC A;  5FR6 A;  2QHO A;  1B1Z A;  1FNV A;  4HKQ A;  1LO5 D;  1VZ7 A;  2YLM A;  1E8W A;  1HZ5 A;  4W9L A;  1UEL A;  3TEY A;  1L5P A;  4RGN A;  2L83 A;  4GN1 A;  5HI1 A;  1TYG B;  4N59 A;  3RUL A;  2KQ7 A;  3RNC C;  3W5V B;  4FBJ B;  3P4R B;  3WAO A;  3MHS D;  3GZN B;  1F0Z A;  1KTK A;  2LI5 A;  1GPX A;  2RPV A;  2D11 A;  4B6W A;  1FM0 D;  5C23 A;  1LQB A;  1TS4 A;  1B9R A;  1WZ3 A;  2JU6 X;  3HK0 A;  3JYU A;  4OVV A;  2C5L C;  4JLC A;  3AE7 B;  1E7P B;  2WP9 B;  3J9C A;  3RUI B;  4MEM A;  2I1K A;  2MBH A;  1C4C A;  1JWU D;  2AEH A;  1V5O A;  3ML9 A;  4KSK C;  2KDF B;  4W9G A;  2KMM A;  1C4P A;  1LXD A;  4RF0 A;  2LZ6 A;  4XC2 A;  1MVK A;  3QWZ B;  4BVU C;  4CO7 A;  2LJ5 A;  3VUX A;  1OTR B;  3O13 A;  1E90 A;  1SE4 A;  5D94 A;  3SR6 A;  3R2T A;  3URY A;  5D7G A;  5DPW A;  3L10 B;  1PGB A;  2NBU A;  2QCZ A;  4I6P A;  5IN7 A;  3P4Q B;  1IP9 A;  3DBH I;  4XE0 A;  2RR9 A;  3N1Y C;  3Q8E A;  3VTV A;  1PUT A;  5CHV C;  3TUO A;  4EFO A;  1N6Z A;  3T3O A;  1WWT A;  3HIZ A;  2KK8 A;  3DBR B;  2WXF A;  4FHK A;  4AOF A;  4AWJ A;  1NI3 A;  4IWQ A;  1D5M C;  1J0G A;  1KLV A;  1GOZ A;  3DWM A;  4W9E A;  2AQ3 B;  2BS2 B;  4KZ0 A;  1SJH D;  1YJI A;  4YSX B;  1OEY J;  1T0Y A;  1SE3 A;  1T0Q C;  3L54 A;  3WIM A;  1HTQ A;  1SIJ A;  4GB9 A;  4ACF A;  4DDI D;  2GOW A;  1VJK A;  5H92 C;  3RYT A;  2WXO A;  1G6J A;  1RYJ A;  3T8M A;  3ABV B;  2DZM A;  2PIA A;  3AE3 B;  3NZ3 A;  3LDZ E;  2CKH B;  5GXG B;  3DCG A;  2DHZ A;  3HVZ A;  2ZJD A;  3PHX B;  2FCQ A;  4GIV A;  3H7P A;  3DHI C;  1WYG A;  1UGM A;  3GP7 A;  3RFZ B;  2EEL A;  2FE8 A;  1QF6 A;  1GAQ B;  2G3Q B;  4YSZ B;  3PT2 B;  5IO9 A;  1TY0 A;  3BK2 A;  3NVV A;  1RWS A;  3VAW A;  3MFG A;  5I4D A;  2M56 B;  3EEC A;  3IT6 B;  4OZC A;  3QC8 B;  2EMT A;  4XYC A;  2D3G A;  4HWI B;  2KO3 A;  4OHJ A;  3AE8 B;  2MJE A;  2WXL A;  2L0F A;  3T3N A;  1AWD A;  1WRI A;  3A4S C;  2FIF A;  2NCN A;  3TBL D;  3W1S C;  5E6J A;  2DAF A;  1IGD A;  2AQ1 B;  4TUU A;  4M02 A;  3N3K B;  3WCQ A;  2BYT A;  2L1A A;  3ZXV A;  4ZRI A;  1E8Z A;  3AE5 B;  1BT0 A;  4X57 B;  1TGZ B;  2PVG C;  1V5T A;  2HDE A;  4PYU A;  5EE9 A;  2IO1 B;  3NVZ A;  3PVL A;  1UWM A;  1KH0 A;  1GNU A;  3PZD A;  2KLC A;  2M0A A;  2WXG A;  2KN5 A;  2KD0 A;  4MSM B;  3QHT A;  3VTW A;  4S0R A;  3KWV A;  1GB1 A;  3Q3J A;  4DHJ B;  4RGO S;  1WJ6 A;  4IWO A;  4IM0 A;  2KJ6 A;  2BGF A;  2GMI C;  4DDG D;  5JHB A;  3QA8 A;  4ICV A;  2V3S A;  3L0W B;  3ZKJ C;  1DGJ A;  3WAL A;  1UUP A;  2ACZ B;  1RLF A;  4EUT A;  1AAR A;  2K25 A;  3PZ7 A;  3X23 A;  2WS3 B;  4RM9 A;  3ZTD A;  4YTP B;  3AE9 B;  5IA7 A;  3KLS X;  4RNA A;  4YWG G;  1HZ6 A;  4WJO A;  5IP4 D;  1NEN B;  2JXT A;  3H7P B;  1FXI A;  4GDK A;  4JPS A;  1SIF A;  3OLM D;  3V62 A;  2MBB B;  1FD6 A;  3SFE B;  3RNA C;  1FXT B;  5D3I B;  2XBB C;  2GBJ A;  1I35 A;  1DYQ A;  3PPA A;  2RDB C;  4JX1 C;  4EE2 A;  3RZF A;  1UGJ A;  2DZI A;  3AXC A;  3DPD A;  3A9J A;  2N7J A;  3VFK A;  3GE3 C;  3I63 C;  1EF1 A;  2JWZ A;  3AEC B;  2LGI A;  4AQ7 A;  2WWZ A;  4FLH A;  2MP2 B;  4OVZ A;  4KV2 A;  4A3P A;  1VR9 A;  4MM3 B;  1KF6 B;  2KNB A;  2ONQ A;  3WAM A;  1MI0 A;  3PRM B;  3IFW B;  1ESF A;  3O65 B;  2M8S A;  2C7M B;  2K8C A;  4WWM A;  3Q3O C;  3GE8 C;  2JSV X;  2MBE A;  2MH7 A;  2WHI A;  3I5J C;  1C76 A;  4F1S A;  1YNT E;  1NI2 A;  1UBQ A;  2N4F A;  2RMM A;  4ARI A;  2LHE A;  1C9F A;  4M00 A;  4NJ7 A;  2QDF A;  1C4A A;  1YD8 U;  2KTR A;  2IND C;  3CIR B;  1IPG A;  3PGE A;  1XXG A;  3KW5 B;  2BYV E;  3DOW A;  1MHH E;  3V05 A;  1NYR A;  2K9X A;  4Q2J A;  4DXG A;  3DBH B;  3L4P A;  2MRP A;  2FCS A;  4KDL B;  2K8B A;  2YVC A;  2J0M A;  2GBR A;  2JQR B;  1K52 A;  4JWS C;  2Y5C A;  2AWT A;  3L16 A;  2HJ8 A;  4MJS A;  3K9O B;  3ZYY X;  2NR2 A;  3AE4 B;  4IKG A;  1N62 A;  3VH3 B;  1YJJ A;  1E8Y A;  1HE8 A;  4M8N A;  2KDM A;  3P2B A;  1NDD A;  4MGY E;  3H8H A;  1XT9 B;  1L7Y A;  2LVP A;  2PPH A;  3RNE C;  2M17 A;  4TQ1 A;  2L76 A;  3BIN A;  1I4R A;  2ZPN A;  1H8C A;  2V0G A;  3EHV A;  3VRB B;  5EE0 A;  2L0T A;  2WDV B;  2HTM E;  2JVC A;  5CHW A;  3VUY A;  2E6X A;  3KVF B;  3U2S C;  3ZGZ A;  4JWU C;  3JVZ X;  2UYZ B;  5KHO A;  2C9W B;  1UD7 A;  1GC7 A;  2JUO A;  2K6D B;  3BY4 B;  1YX5 B;  1WGY A;  3H1U A;  5TSS A;  2QIE B;  2MLB A;  2WXK A;  4PS7 A;  2J0J A;  1QLB B;  1EUV B;  2PE9 A;  5IOI A;  1C77 A;  2FUG 1;  1WJN A;  1V8C A;  5TR5 A;  4PT5 A;  2MBQ A;  2AQ2 B;  1TBE A;  1WGH A;  4F8C B;  3NS8 A;  4A8X C;  3IAS 1;  1V81 A;  2KFJ A;  3WAP A;  2XEW A;  4E74 A;  5AEK B;  1YN5 A;  4DWF A;  1E0Z A;  2RD0 A;  1XEE A;  3UIN B;  5JXV A;  2L05 A;  3WAN A;  2LGD A;  4TSS A;  4DQO C;  4BKS D;  1K8R B;  2LEK A;  4KVG B;  5E6N A;  5C2T B;  2UU7 A;  3EUB 2;  3C0R B;  4KX6 B;  2SAK A;  3NJT A;  1MG8 A;  4C56 C;  3B08 A;  4R3D A;  3B0A A;  1UBI A;  3AE2 B;  3ZJV A;  1KFY B;  2I38 A;  3NZU A;  2TSS A;  1PGA A;  5EE3 A;  5IKC M;  2JT4 B;  1YOV B;  3KH0 A;  1BXT A;  3U8Z A;  4AS1 A;  4KZC A;  2MJD A;  2BWF A;  3RPF C;  2CHZ A;  2JYT A;  1TTN A;  4GOC A;  4JE3 B;  2KAC A;  1KOT A;  2NVU I;  2DEN B;  3TEW A;  1WJU A;  4MT5 A;  4FUL A;  2FCM A;  2W3S A;  2KN4 A;  4C7Z A;  2BT6 A;  4MAC A;  3A9K A;  1JRP A;  1OFF A;  1VD2 A;  4TKN A;  4W9H A;  4WWP A;  2E3T A;  3QAQ A;  4N58 A;  2I2Y A;  5FK9 C;  3V61 A;  1JWS D;  5D6J B;  2O6V D;  2LUE A;  1L4Z B;  4NZL B;  2BF8 B;  4BBN F;  4RF1 A;  5L95 C;  1FEH A;  2ZW0 A;  4MGI E;  3HRD D;  2RDH A;  2B76 B;  2WYQ A;  4TV3 A;  5MPO A;  2K22 A;  2BKF A;  4RCO A;  4MDK E;  1L2N A;  2IO3 B;  4HRO A;  1F1H A;  3MJ5 A;  1STE A;  2WXH A;  3IVF A;  3B1L X;  1FPY A;  4MH8 A;  4PS3 A;  1L6U A;  1M4V A;  3ZIM A;  2V3N A;  4HJG E;  1E5W A;  1JAL A;  1PFD A;  3UI3 A;  2W54 A;  4LK0 M;  1R4M B;  2NMQ A;  3VTU A;  1CJE A;  3RMK C;  1S3S G;  3N9Y C;  4KIK B;  3C19 A;  1IGC A;  3VQI A;  4P6V F;  2LHD A;  1FFU A;  1WGR A;  1OQY A;  3Q14 C;  1P7E A;  4LDT D;  4IM3 A;  1YX6 B;  1WR6 E;  2KVR A;  1D4B A;  3DHG C;  1Y8R C;  3HM3 A;  1Q0W B;  2V4L A;  2NTT A;  4ZRJ A;  4ZDV A;  2A5U A;  3PO0 A;  2EKE C;  4HPM B;  5DPT A;  3RN9 C;  1TJE A;  4ZYS A;  2FID A;  1FIQ A;  2MX2 A;  2ZNV B;  4JQW C;  3Q8A A;  2MBO A;  1TZO A;  2J53 A;  2KWU B;  2Z8L A;  3M95 A;  4O1N A;  2JY6 A;  4KDI C;  1AW7 A;  2MCN B;  3L13 A;  1WI0 A;  1X1M A;  2NBV B;  1WE6 A;  1XLP A;  3BII D;  3EGR A;  1TS2 A;  1PDX A;  3A9K B;  3PTF C;  2G4D B;  2DZJ A;  1WY8 A;  5G5G A;  1WIA A;  3APD A;  2MQJ A;  2WXM A;  1YQB A;  3W9C B;  4YSY B;  3AEE B;  3SFD B;  3N30 A;  4G11 A;  3M62 B;  4A20 A;  1EU3 A;  3AE1 B;  3ZLZ A;  4ARC A;  2ICI A;  3ZJT A;  2W3R A;  2LAS A;  2KQS A;  2OJR A;  3AE6 B;  1WX8 A;  2WXN A;  2IO2 B;  3KYC D;  1V6E A;  3DVN V;  1LM8 B;  2JWU A;  3R7Q A;  1TKG A;  4RH6 A;  4ASW C;  1TT5 B;  2K8H A;  3AED B;  2C7N B;  1SXT A;  1EU4 A;  1QOA A;  1YJ1 A;  3DBL I;  5AUK A;  1GC6 A;  2KDI A;  1QZE A;  4M0W B;  2PKO A;  2MJ3 A;  1MHX A;  2MWS B;  1K53 A;  4A90 A;  3PRP B;  3APC A;  4LJP B;  3NVW A;  3AI5 A;  2D07 B;  2J7Q B;  1Z5S B;  3UGB B;  2L8J A;  2WU5 B;  4OZB A;  4KKJ A;  2O2V B;  1SEB D;  3BZD B;  2G9H D;  2QSD A;  3P4S B;  2MP2 A;  4NQL B;  1WGK A;  4MM3 A;  2VZK D;  4NJC A;  1VLB A;  1P3Q U;  2L7R A;  1XLO A;  4DK5 A;  3QX1 A;  2ZZP B;  3A4R A;  1JWB D;  4EZK A;  1T0S C;  4CYE A;  4UDU C;  3Q3F A;  2KHW B;  2PLP A;  3VHT C;  2JYE A;  3R2I A;  2BYE A;  4ZYN A;  2ZVN A;  4HK2 A;  3TIX A;  2JZP A;  1HQR D;  3AU4 A;  3NRZ A;  2W55 A;  4NAW A;  4S17 A;  5FR3 A;  1YN4 A;  3ZDM C;  1VCB A;  2LWP A;  4N6E B;  3Q8C A;  1A5R A;  1V2Y A;  4YXD B;  1WR1 A;  4LTU A;  5C1Z A;  1HTO A;  3Q69 A;  2DYO A;  3P1M A;  4KKI A;  4B0E A;  2HD5 B;  2DZK A;  1ZP0 B;  3ZNI D;  2N1V A;  4PYZ A;  3SD5 A;  1WXQ A;  2ZCB A;  1SE2 A;  2BVC A;  3MTN B;  3I57 A;  3MJW A;  4BAX A;  4LNN A;  1R4N I;  3TEZ A;  4WQO B;  2AL6 A;  2NPT B;  1QQR A;  4G50 A;  3R7R A;  2NTS A;  2KDE B;  2LJI A;  1T6B X;  2WDQ B;  5G55 A;  3MC9 A;  2ZEQ A;  4HDO A;  1RM6 C;  4P1C C;  2CS4 A;  2A4Z A;  4IOI E;  4J6I A;  2WX0 A;  2DYB A;  1HEZ E;  1C79 A;  3PLU A;  4FJV B;  1WE7 A;  2RPQ A;  3ZNG C;  4RGT A;  2D5G A;  4FJZ A;  1F2R C;  4B95 A;  4YT0 B;  2L00 B;  2EMS A;  2N9P C;  3HVD A;  2DBY A;  4K7U A;  4BKT A;  4MGZ E;  3QJZ A;  2Y5P A;  2V3P A;  5AUI A;  1T0R C;  4AJY B;  3N1X C;  5BMG A;  2K3U A;  5DPS A;  1D3Z A;  1WXS A;  2IO0 B;  1V1P A;  1JW9 D;  2ON8 A;  4QAY A;  2C7H A;  1ISN A;  4GDL B;  4IG7 B;  2KX3 A;  4YTN B;  5HFY A;  4EKU A;  4IWP A;  3PV1 A;  3BYT B;  2INP E;  4XGA B;  1KM7 A;  3BK1 A;  5LXI B;  2WLB A;  2L3Z A;  4LJO B;  3ZW3 A;  2KC2 A;  1UZX B;  3N20 C;  1FMA D;  2CJN A;  4NAW B;  3OWE B;  3M63 B;  4LNO A;  2KDB A;  2WXR A;  3IT4 B;  3T9L A;  3UIO B;  4C4V A;  4BZA A;  4HJK A;  5AZH A;  3NHE B;  3MHZ A;  2YEP B;  2KT7 A;  1JWM D;  3U7Z A;  2DX5 B;  3V60 A;  2JRH A;  3VXW A;  3H7S A;  1U4A A;  3BVM A;  4ZRK A;  1TS5 A;  3CWI A;  2KYW A;  4I6L B;  1I7H A;  1P9D U;  3Q3M C;  3DVN U;  2DNF A;  3UF8 A;  3NY5 A;  3AUL A;  4P16 A;  1FRD A;  1WFY A;  1YQ3 B;  1GG3 A;  3B2F A;  1E7V A;  2LGX A;  3UIP B;  2DYM A;  2CHX A;  1T5X D;  2IGG A;  2N1W A;  5J18 A;  1UWX A;  2IZV B;  3A33 B;  1I4P A;  3CST A;  5HKH A;  4FAD A;  1L0X B;  4KGS A;  3TCA A;  2Z0D B;  4DXF A;  2OJW A;  3RD2 A;  1FFV A;  2N7D A;  2G45 B;  3E9S A;  1Q1O A;  2KAJ A;  2RDG A;  4BOZ B;  3VVW B;  1GUA B;  3LYY A;  1V1P B;  3IBE A;  2BWE S;  1NEK B;  5JZE B;  2XK5 B;  1P98 A;  4HPP A;  3IG3 A;  5FKA C;  2WXQ A;  4WWN A;  4WIP A;  2LRU A;  1EWY C;  1WYW B;  3DBL B;  4J3O D;  3DVG Y;  3V3X A;  1UH6 A;  4HEA 1;  4DHZ E;  2GI9 A;  2GBK A;  4HLE A;  1TKE A;  2JZZ A;  1WM3 A;  2KKC A;  4EEW A;  1DOX A;  3V6E B;  4WQM A;  4C4V B;  1IBX A;  4GLS C;  2QJL A;  3TL5 A;  1VRA B;  4W9K A;  4MEL A;  1V1O A;  2ZW1 A;  1OQR A;  2J0K A;  3TJP A;  2Z59 B;  4DHZ B;  2AYO B;  1WZ0 A;  1JRO A;  1RFK A;  2D3B A;  3IAM 1;  1ZXI A;  1ACC A;  4W9C A;  1CZP A;  3BWU D;  2LD9 A;  1N60 A;  4KIK A;  2INN E;  2LMC A;  1IYF A;  1TKY A;  3ZNH B;  1WGD A;  1SJE D;  4TQ0 A;  1L6V A;  2N9E B;  1KLU D;  2FUH B;  4E71 A;  3AM9 A;  2CU3 A;  3SHQ A;  2H89 B;  3H9D A;  1NVI D;  3K9P B;  2ZCC A;  3U4E G;  1WGG A;  4URK A;  2NBW B;  2OOB B;  2Y3A A;  1L0Y B;  1WX9 A;  3ZDT A;  3BVZ A;  3HM6 X;  3W1S A;  2KAN A;  2D3A A;  2IY0 B;  5D2M B;  2J52 A;  3I3T B;  1WJ4 A;  1CMX B;  4L1B A;  1R4N B;  1C1Y B;  2JRI B;  3ZRC A;  2NS5 A;  2N9X A;  2LGY A;  1Y56 A;  4EZL A;  3RNF C;  4ANX A;  5G5H A;  3GOE A;  1K51 A;  3NZS A;  1F77 A;  3VH4 B;  2KJH B;  1WX7 A;  5HHD G;  3PLV A;  2JF5 A;  4BKS A;  2R2O A;  1DOI A;  3QQ8 B;  3SU8 X;  2J42 A;  2V1Y A;  2G4S A;  4OZA A;  4BKG A;  5J17 A;  1IBX B;  1XCT L;  3APF A;  2SEB D;  4WJN A;  4ICU A;  1WMH B;  2JZ3 B;  4B9K A;  1VZ6 A;  5DPR A;  1QKZ A;  3QAR A;  2K6Q A;  2Q5W D;  1M94 A;  4E3C A;  2J4X A;  3PZ8 A;  3A1Q A;  2INC C;  2BQQ A;  3ML8 A;  4WJQ A;  3Q3N C;  4WUR A;  3KUC B;  3U30 A;  2V4I B;  1XF5 L;  2FAZ A;  2BS4 B;  3S2A A;  1ZXH A;  2KFK A;  1E10 A;  3ZVV A;  1J8C A;  1JRU A;  1J19 A;  1ZDV A;  4M0W A;  2M0X A;  2CHW A;  2UWQ A;  4OW0 A;  5JH5 C;  3CMM B;  5C3J B;  2LVO A;  1R7S A;  2D3C A;  4DHJ D;  2KQ4 X;  5GMV A;  4US8 A;  2H88 B;  1ZW7 A;  4REZ A;  2O2V A;  3JSV A;  3ENE A;  4B0M A;  2MHJ A;  4ZHO A;  1S1Q B; 
#chains in the Genus database with same CATH homology
 1NYQ A;  1JWA D;  1C9F A;  1PGX A;  2JX5 A;  1C4A A;  2PLP A;  3LB8 C;  4L2Y A;  3Q8F A;  3CIR B;  3NS1 A;  2JYE A;  1SBB B;  1XXG A;  3R2I A;  4H2A A;  2N0S B;  2IGD A;  4WH4 A;  3TSS A;  1MHH E;  3FIL B;  3V05 A;  2K9X A;  1NYR A;  1QIL A;  2JZP A;  1HQR D;  1JML A;  3NRZ A;  4Q2J A;  3B9J A;  3L4P A;  4DXG A;  2XNA C;  2W55 A;  4XWT A;  1ROE A;  2WNM A;  5FR3 A;  1YN4 A;  4US9 A;  4N6E B;  2JQR B;  3Q8C A;  3VRA B;  2QIL A;  2XN9 C;  2X38 A;  1K52 A;  4YXD B;  2GB1 A;  4JWS C;  4LTU A;  3Q69 A;  2DYO A;  1YMH E;  3P1M A;  4KKI A;  4B0E A;  2Y5C A;  2BTE A;  1I4H A;  4USA A;  1ZP0 B;  3FIL A;  4C7Y A;  1WXQ A;  1I4Q A;  1C78 A;  4ZRP A;  4ZRQ A;  1L4D B;  1EM7 A;  1SE2 A;  2L32 A;  3NUH B;  3ZYY X;  1JQ4 A;  3AE4 B;  3I57 A;  4KGR A;  1K50 A;  3R8B A;  4IKG A;  3U52 E;  3TEZ A;  1QOF A;  1N62 A;  1YJJ A;  3VR9 B;  2FBW B;  3ZJU A;  2KDM A;  1SSN A;  1QQR A;  2NTS A;  3FC4 A;  1AYF A;  1KLG D;  3BYY B;  1FCL A;  5LNK 1;  1D5Z C;  2LJI A;  1E6E B;  4XWW A;  1V97 A;  1T6B X;  2WDQ B;  2WXI A;  3H8H A;  1QT9 A;  3KQ4 A;  1RM6 C;  1WSP A;  2K0P A;  4ZHP A;  1B1Z A;  4IOI E;  2WDR B;  4IDI A;  1FNV A;  4TQ1 A;  4HKQ A;  1HEZ E;  1LO5 D;  1BUI C;  1VZ7 A;  2PTL A;  1C79 A;  1I4R A;  1FRR A;  1HZ5 A;  3IXS A;  3TEY A;  2V0G A;  1L5P A;  4RGN A;  2L83 A;  5HI1 A;  3VRB B;  5EE0 A;  1TYG B;  4N59 A;  2WDV B;  4RGT A;  2D5G A;  2HTM E;  2N9L A;  3W5V B;  4D2K A;  1F2R C;  3P4R B;  4WAF A;  4YT0 B;  1F0Z A;  1KTK A;  2E6X A;  3HVD A;  2DBY A;  3U2S C;  1GPX A;  3ZGZ A;  2RPV A;  2CJO A;  1MPE A;  2Y5P A;  4JWU C;  2V3P A;  1FM0 D;  5AUI A;  5BMG A;  2K3U A;  1TS4 A;  1B9R A;  2JU6 X;  3AE7 B;  1V1P A;  1JW9 D;  2ON8 A;  1E7P B;  2WP9 B;  5TSS A;  2QIE B;  3J9C A;  4GDL B;  2WXK A;  1C4C A;  1JWU D;  1QLB B;  1QOG A;  4YTN B;  1ZE3 D;  5HFY A;  3AMZ A;  1C77 A;  2FUG 1;  1N61 A;  3MP9 A;  4YTM B;  2KMM A;  3ETR A;  1C4P A;  3BYT B;  1V8C A;  2INP E;  1QOB A;  3BK1 A;  1UNS A;  4PT5 A;  2BBC A;  2WLB A;  4RF0 A;  2AQ2 B;  5HG2 A;  1FCC C;  1MVK A;  3SEB A;  4A8X C;  3IAS 1;  1FMA D;  2CJN A;  4NAW B;  3O13 A;  3OWE B;  1YN5 A;  1E0Z A;  1SE4 A;  4HRS A;  4TMA B;  2WXR A;  3IT4 B;  1KRH A;  2WXJ A;  3R2T A;  3SR6 A;  3W5U B;  4HKZ E;  3URY A;  5D7G A;  1XEE A;  1I4X A;  1J7C A;  2BW2 A;  4NAM A;  5JXV A;  2YEP F;  4ITK A;  4TSS A;  1PGB A;  4DQO C;  3P4Q B;  3MHZ A;  1P7F A;  3Q8E A;  4XE0 A;  2YEP B;  1PUT A;  1JWM D;  3TUO A;  3U7Z A;  3AEB B;  3KWL A;  3P63 A;  3T3O A;  2LEK A;  1WWT A;  2WXF A;  1YN3 A;  3EUB 2;  3BVM A;  5C2T B;  2WXP A;  1TS5 A;  1ZPS A;  5BYS A;  3CWI A;  1I7H A;  3NVY A;  2KWD A;  4KX6 B;  1NI3 A;  1XLN A;  2SAK A;  1D5M C;  3B2G A;  4P16 A;  4C56 C;  1FRD A;  1YQ3 B;  2IGH A;  4R3D A;  3B2F A;  1FNW A;  1GOZ A;  3AE2 B;  3DWM A;  2DYM A;  2AQ3 B;  2BS2 B;  3ZJV A;  2I38 A;  1KFY B;  2MEK A;  2OHF A;  1SJH D;  1PGA A;  2TSS A;  1T5X D;  2DLB A;  5EE3 A;  1YJI A;  2IGG A;  4YSX B;  1SE3 A;  1UWX A;  1BXT A;  4AS1 A;  2MJD A;  3RPF C;  1SIJ A;  1VZ8 A;  2JYT A;  1JCK B;  4JE3 B;  1VJK A;  1I4P A;  2KAC A;  5H92 C;  1L0X B;  4XDC A;  1ZUD 2;  3TEW A;  4MT5 A;  1CQV A;  4XDD A;  2WXO A;  5BYQ A;  4KGS A;  4DXF A;  1RYJ A;  2W3S A;  2KN4 A;  4C7Z A;  1FFV A;  1FXA A;  3ABV B;  2PIA A;  1XO3 A;  2BT6 A;  3AE3 B;  4MAC A;  1JRP A;  3E9S A;  1OFF A;  3NZ3 A;  3W2D A;  2E3T A;  4N58 A;  2KAJ A;  2RDG A;  2I2Y A;  2BB5 A;  1D6E C;  5GXG B;  5FK9 C;  1GB4 A;  3LYY A;  1V1P B;  1FNU A;  2K5P A;  3Q8B A;  1D5X C;  3HVZ A;  1NEK B;  2W82 A;  5EE1 A;  1JWS D;  4LLG M;  3AEA B;  1WYG A;  5FKA C;  3GP7 A;  1L4Z B;  2WXQ A;  4NZL B;  2PW9 A;  2EEL A;  3RFZ B;  2FE8 A;  4CQN A;  1ET9 A;  3LXF A;  1QF6 A;  4RF1 A;  1GAQ B;  3VR8 B;  4YSZ B;  1FEH A;  1TY0 A;  2ZW0 A;  3BK2 A;  4WIP A;  3HRD D;  2RDH A;  2B76 B;  3NVV A;  1RWS A;  2GRI A;  5MPO A;  3MFG A;  5I4D A;  2K22 A;  2M56 B;  3IT6 B;  4FXC A;  4OZC A;  1EWY C;  4RCO A;  1BML C;  1N5X A;  4HRO A;  4J3O D;  3V3X A;  4HEA 1;  3MJ5 A;  1STE A;  2WXH A;  2R61 A;  2GI9 A;  4MH8 A;  4OHJ A;  4RGM A;  3AE8 B;  2MJE A;  1L6U A;  1M4V A;  2WU2 B;  1FO4 A;  1TKE A;  2V3N A;  2WXL A;  3AB5 A;  4HJG E;  1AWD A;  2EKI A;  3T3N A;  1WRI A;  1DOX A;  4WQM A;  1IBX A;  1JAL A;  1PFD A;  3AEG B;  3UI3 A;  2W54 A;  4GLS C;  5E6J A;  2QJL A;  1VRA B;  4LK0 M;  1OQQ A;  2QMT A;  1IGD A;  1V1O A;  2AQ1 B;  2NMQ A;  3AH7 A;  2ZW1 A;  1OQR A;  3WCQ A;  2BYT A;  2L1A A;  1CJE A;  3N9Y C;  1IGC A;  3VQI A;  4P6V F;  2LHD A;  1FFU A;  3I9V 1;  1JRO A;  1RFK A;  1P7E A;  1Q10 A;  1E9M A;  3AE5 B;  3E56 A;  3IAM 1;  3AEF B;  2PVG C;  1ZXI A;  1D4B A;  1ACC A;  2HDE A;  5EE9 A;  1AN8 A;  1CZP A;  2WQY B;  3NVZ A;  3BWU D;  2DWQ A;  1SB3 C;  3GS2 A;  1N60 A;  1KH0 A;  1UWM A;  2NTT A;  1T3Q A;  2M0A A;  2WXG A;  4RFB A;  3PO0 A;  1CK1 A;  4A6Q A;  2INN E;  2LMC A;  2QEJ C;  3BVG A;  1TKY A;  3KWV A;  1GB1 A;  1SJE D;  4TQ0 A;  1L6V A;  1KLU D;  1TJE A;  4RGO S;  4ZYS A;  2IDY A;  1FIQ A;  2L52 A;  3AM9 A;  2VZK B;  2CU3 A;  3HUI A;  3Q8A A;  2H89 B;  1TZO A;  2J53 A;  1NVI D;  2Z8L A;  4O1N A;  2BS3 B;  3U4E G;  1AW7 A;  4ZOH C;  2Y3A A;  3C8Y A;  2LFI A;  1L0Y B;  3EA6 A;  1DGJ A;  4GDK B;  1YQ4 B;  1XLP A;  2IPK D;  3BII D;  3BVZ A;  1TS2 A;  3EGR A;  1PDX A;  1UUP A;  2ACZ B;  4A55 A;  1ZOY B;  3W1S A;  3AN1 A;  5G5G A;  1XLQ A;  3PZ7 A;  2WS3 B;  1SF0 A;  2WXM A;  4YTP B;  2J52 A;  3AE9 B;  3KLS X;  3P4P B;  4RNA A;  2N9K A;  3W9C B;  4YWG G;  1HZ6 A;  3P42 A;  1NEN B;  2JXT A;  2M19 A;  1FXI A;  1A70 A;  1I4G A;  4YSY B;  4L1B A;  3AEE B;  5D3D A;  4JPS A;  3SFD B;  3TEX A;  1N5W A;  1FD6 A;  1EU3 A;  3AE1 B;  3SFE B;  4ARC A;  1Y56 A;  2PVO D;  2ICI A;  3ZJT A;  2IJ0 A;  2W3R A;  5D3I B;  5BYR A;  5G5H A;  1K51 A;  1F77 A;  1DOY A;  5HHD G;  3AE6 B;  2G1E A;  1DOI A;  1DYQ A;  2AX5 A;  2J42 A;  2WXN A;  4JX1 C;  4EE2 A;  1UGJ A;  3GB1 A;  2JWU A;  1TKG A;  4OZA A;  4RH6 A;  2N7J A;  1IBX B;  1L0V B;  5T8I A;  1XCT L;  2SEB D;  3AED B;  1XCQ L;  1SXT A;  1EU4 A;  1QOA A;  3AEC B;  5AUK A;  2LGI A;  4AQ7 A;  1VZ6 A;  1QKZ A;  4OVZ A;  2PKO A;  3ZQ4 A;  2Q5W D;  2MJ3 A;  1MHX A;  1K53 A;  1J7A A;  4A90 A;  4A9A A;  1ZDX A;  2OED A;  5BMI A;  1TY2 A;  2J4X A;  3PZ8 A;  3NVW A;  1ET6 A;  1VR9 A;  1EWC A;  4MM3 B;  5BMH A;  1KF6 B;  2ONQ A;  3FAH A;  1MI0 A;  2WU5 B;  1ESF A;  4OZB A;  4WUR A;  2V4I B;  1TS3 A;  1XF5 L;  3AV8 A;  4KKJ A;  2PMV A;  1ENF A;  1SEB D;  2BS4 B;  1ZXH A;  3BZD B;  1E10 A;  2BB6 A;  1IUE A;  2G9H D;  2QSD A;  3P4S B;  3DWG C;  1F2R I;  1ZDV A;  4M0W A;  4L23 A;  1N63 A;  1PYW D;  1WGK A;  1VDV A;  4OW0 A;  4WWM A;  1J7B A;  5C3J B;  1R7S A;  2JSV X;  2KQ4 X;  2MH7 A;  4KGT A;  4US8 A;  2H88 B;  2VZK D;  3MC0 B;  4NJC A;  1VLB A;  2LUM A;  4REZ A;  1C76 A;  1XLO A;  1YNT E;  5H8Y E;  1JWB D;  2RMM A;  4B0M A;  4C80 A;  1HXY D;  1HA5 A;  4ZHO A;  4ARI A;  4UDU C;  2LHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...