1JWAD

Structure of the atp-bound moeb-moad protein complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
b'MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
publication title Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 16
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2001-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwaD00
1WWTA 2PKOA 1NI3A 1WYGA 4YTMB 3HRDD 2WDVB 3NVWA 4A9AA 3P63A 1WGKA 2BS3B 3DWGC 1YJJA 1L0VB 3CWIA 3L4PA 2CJOA 2N0SB 1DOIA 3BIID 3SFDB 2QIEB 1E0ZA 3AECB 5C2TB 1IUEA 4JWUC 1V97A 1JWAD 3HVZA 1T3QA 1QOBA 1ROEA 4YT0B 1RYJA 4C80A 1N60A 1YQ4B 5G5HA 4IDIA 4ZHOA 1JWBD 1RWSA 1FXAA 3ABVB 1KFYB 3AE7B 4YSYB 3VR8B 1ZP0B 4FXCA 2PVOD 1J7BA 4YSZB 1GAQB 1L5PA 3AE2B 1NEKB 3PO0A 2MJEA 2KAJA 1PDXA 2M56B 3FC4A 2G1EA 3SR6A 1QF6A 3VRAB 1FFVA 1CJEA 3P1MA 2WP9B 3NVZA 2WDRB 2WLBA 3W5UB 1OQQA 3P4SB 2W3SA 2OHFA 1J7CA 1VJKA 4YTPB 1N61A 3AE6B 1QLBB 1WRIA 2H89B 3ETRA 2QJLA 2DBYA 4C7YA 2Q5WD 3CIRB 2WS3B 3AEEB 3KWLA 3AM9A 4LTUA 3SFEB 3B9JA 1XLQA 3NVYA 4JX1C 3W9CB 3WCQA 1XO3A 1XLOA 1NYRA 1SIJA 2E3TA 1DGJA 3LB8C 1A70A 1VDVA 1CZPA 1QT9A 2W54A 1JALA 3AE9B 1GPXA 5AUIA 1FO4A 1E6EB 1TYGB 3AE5B 5GXGB 1EWYC 4USAA 1XLNA 1KRHA 4WQMA 3NS1A 4ZOHC 5AUKA 1JW9D 3ZYYX 1TJEA 1QOFA 2PVGC 2BS2B 4P6VF 4YXDB 1E9MA 2K22A 2WU5B 3AH7A 1NYQA 2FBWB 1AWDA 2BT6A 1N5WA 1TKEA 2W55A 3AEBB 3AMZA 1SB3C 5G5GA 2ACZB 3AE8B 4YSXB 2LEKA 1FRDA 1OQRA 2WDQB 3B2GA 4US9A 2JQRB 2KMMA 5MPOA 1E10A 1TKGA 1FRRA 1AYFA 1B9RA 1ZXIA 3AN1A 1YQ3B 1L6VA 2WU2B 1NENB 3LXFA 3P4PB 1F0ZA 3AE3B 3AEGB 3DWMA 2EKIA 1NVID 3AEAB 3VR9B 1N5XA 3RPFC 1J7AA 1FM0D 1L6UA 1R7SA 3AE4B 1KF6B 2CJNA 3EUB2 4N58A 2B76B 1TKYA 1RFKA 5H8YE 2Y5CA 2MJ3A 3NRZA 1V8CA 2W3RA 5EE0A 1PFDA 5EE9A 3VRBB 3P4RB 3NVVA 2PIAA 1DOYA 1QOAA 1JRPA 2H88B 1FIQA 4HRSA 1OFFA 4HROA 4WWMA 5C3JB 2HTME 2CU3A 1JROA 1I7HA 3AB5A 1VLBA 1QOGA 3B2FA 2K9XA 4N6EB 3P4QB 3AEDB 4N59A 2L83A 1PUTA 1SF0A 1RM6C 1FXIA 4YTNB 1N63A 1JQ4A 3AE1B 2BS4B 4ZHPA 1N62A 5EE1A 4US8A 1XLPA 1YJIA 5EE3A 1UWMA 3W5VB 1DOXA 2M19A 1FMAD 4C7ZA 1ZUD2 2JX5A 4ITKA 2MJDA 1ZOYB 2AX5A 5H92C 3FAHA 1E7PB 4JWSC 4KX6B 2WQYB 3AEFB 1FFUA 1WXQA 3HUIA 2L52A 3AV8A 2K5PA 2DWQA 2MH7A
chains in the Genus database with same CATH superfamily
2KDFB 2KTRB 4YTMB 2RMMA 1C78A 3V6CB 1YJJA 2DENB 4DHZE 2QIEB 3GZNI 1D5ZC 4MSMB 1L0YB 1ZGUB 3H6NA 4K7SA 4F7ZA 2CKHB 3U8ZA 2L05A 2MJEA 2I38A 3NG0A 1QF6A 2RDGA 1HXYD 1CJEA 4FADA 2WP9B 4BKSA 4ANXA 4C4VA 3RI7C 2L7RA 4TQ0A 3N9YC 3ZJTA 1P1AA 3Q8FA 4FLHA 1C9FA 2UWQA 3TUOA 4XYCA 3NS8A 2IYDB 3MFGA 4IWPA 1DYQA 2Z0DB 3SFDB 3M62B 1WR1A 4RMAA 2WXRA 4CHKA 2CHZA 5MPOA 2R2QA 4NPNA 4K7WA 3R8BA 1V49A 3WALA 3VR9B 3ZQ4A 1RFAA 2JUOA 3VDZA 3DCGA 2KD0A 3IVFA 4MACA 3ZTCA 4OZBA 3NZ3A 1DOYA 1QQRA 1XXGA 2J42A 3A4RA 1E90A 4MGIE 2V3NA 3BY4B 1JQ4A 3APDA 4GDKB 1XLPA 2ZVNA 1TZOA 2JRHA 2I1KA 1V5OA 4KSKC 1IP9A 2N1VA 2ZPNA 3ZXVA 2K5PA 2GBNA 2LWPA 4K3CA 4JQWC 4MH0E 3M95A 3DWGC 3K9OB 2RPVA 2ZJDA 4RCOA 3VQIA 4AUQC 1M4VA 2I2YA 1WGGA 3N32A 3M63B 3ZDTA 1V6EA 2WXGA 2QILA 3UF8A 1RAXA 2WX0A 4BBNC 2JZ3B 4LNIA 4MM3B 4TQ1A 5AZFA 3H7PA 4ZRIA 2NPTA 4ANWA 5L83A 1K8RB 5C1ZA 1XLQA 2KHWB 2G4DB 5BMIA 2KKCA 5E6NA 1Q0WB 2DZJA 4KVGB 1OEYA 2MQJA 5G2NA 4ASWC 1V80A 4EZKA 2ON8A 4LDTB 3PPAA 2W55A 2KMMA 2D10A 2LUEA 2KFKA 1YQ3B 3NOBA 1UUPA 1P3QU 2FUHB 4IM3A 1PFDA 3Q2AC 2YVCA 3NY5A 3N3KB 3QWZB 4WURA 2FCMA 3Q8CA 2OJRA 2K9XA 2Z0EB 3DPDA 5IN7A 1BUIC 1SF0A 5CHVC 3NUHB 1XCQL 2BQQA 3AE1B 3W5VB 2K6QA 4YWGG 3WAMA 3PHWB 2EKEC 3VTVA 1V5TA 1R4MB 4YL8A 4GDLA 4WWOA 2C7HA 1VRAB 2LVOA 2Z8LA 1EUVB 2KX3A 4G0NB 1LGRA 3DVGY 3H7PB 2NPTB 1N6ZA 1MG4A 2WXLA 4F1SA 1ROEA 2GI9A 2KX0A 4RGMA 4AP4C 3KUDB 3HM6X 1E7UA 2ONQA 4YSZB 2A4ZA 4PS3A 4EKUA 3RZFA 2WXPA 2J0KA 2WDRB 2WLBA 3WA0A 2W3SA 3ZIMA 3DVNV 3ZNZB 2N9PC 4HDOA 1KLVA 2MBHA 4XDDA 4IUMB 1BXTA 2ICIA 2MP2A 3T9LA 3SHQA 3KH0A 1FO4A 4MEMA 2GMIC 2K0PA 4URKA 1EWYC 2XN9C 3ZDMC 3SD5A 2IPKD 2K22A 3I63C 1XCTL 3LYYA 4NJCA 3Q3JA 2N4FA 2L1AA 2JQRB 5HFYA 1FXTB 5D94A 4XWTA 3U4EG 1H8CA 2Y3AA 1X1MA 1EM7A 3NRZA 1K53A 2L8JA 3SEBA 3C8YA 3DVNU 3WIMA 1TS5A 3NZSA 5E6JA 5EDSA 5C3JB 2I1JA 2BWFA 3OWEB 1JROA 3A4SC 3AB5A 3HM3A 1JCKB 3DDCB 4RM9A 2X8XX 3DBHB 1YN4A 2KXJA 2KQSA 4ZYSA 2JYTA 2KK8A 2JXXA 2BB5A 2LGIA 3P2BA 3U7ZA 3AV8A 1E8ZA 2PKOA 3I9V1 2BGFA 4OZAA 4FA6A 1F2RI 2X38A 3R66C 3R7RA 2CU1A 4B6WA 2VZKB 2PLPA 4NY0A 4WJPA 4LDTD 4MGZE 2MP2B 4ZHOA 2BYTA 1RWSA 1FXAA 2D5GA 1IGCA 2G9HD 4FXCA 4KDLB 1A5RA 1SJHD 5CTRC 1WIAA 1I4HA 1I4GA 1T0SC 4GLSC 4ARCA 1GG3A 2HTHA 3NVZA 5LNK1 1OQQA 2ZCBA 2KO3A 1N61A 4JPSA 1WRIA 5BO4B 2YEPB 1YMHE 4GMVA 2BBCA 1C1YB 2MWSB 5FR3A 2MA9B 4JGHB 1ZKHA 5IO9A 2LXCA 3DBRB 4LNNA 3H7SA 2D3BA 3KYDD 1C77A 4M0WB 1TJEA 4ICUA 1E9MA 3ZXRA 5JH5C 2NBVB 3AMZA 2XK5A 2FCQA 3VVWB 3EGRA 2INPE 4ANUA 2V9HA 3P4PB 5E6OA 3BZDB 3EUB2 4BZAA 4N58A 3K9PB 2W3RA 3TEYA 1E7VA 4HJKA 4HROA 1OFFA 3DBLI 3MC8A 1QOGA 1LO5D 1PUTA 1WYWB 2O6VD 3ZNHB 1N63A 4AJYB 4LNOA 1YN5A 2IY0B 1TGZB 1YJIA 2BVCA 4HDQA 4DWFA 2J53A 3FILB 4P7IA 2N9EB 2B3AA 2KVRA 3IT4B 1WF9A 3NVWA 3EC8A 3ZNGC 2JPHA 2GB1A 3Q8AA 2MSED 4M01A 3A1QB 2WYQA 1FD6A 2PJHA 3L13A 2N9LA 4E71A 1WJ4A 1HQRD 1Q5WB 1N60A 3RULA 4W9JA 4TMAB 3OJ3A 2KWUB 2NBUA 4K81A 2JWUA 4IG7B 2KAJA 2FUG1 4B9KA 3FC4A 2K25A 1WI0A 4W9GA 2WXJA 1QLBB 1D5XC 1WRDB 2V3SA 1FCCC 3I5JC 4FN2A 1MVKA 1ACCA 1NYRA 3JSVA 4WJQA 1DGJA 3PTFC 1A70A 1VDVA 2FNJB 3O13A 5L95C 5GXGB 3TMPB 3ZJUA 2BB6A 3B1LX 3GE3C 2NR2A 1I4PA 4OVUA 3TL5A 2KTFA 2DAFA 5DPTA 4J6IA 1OQRA 1SBBB 1TKGA 3ZUNA 3RNAC 1NENB 3MC9A 3AE3B 2CR5A 3RPFC 2M8SA 1R7SA 1LXDA 3Q3FA 1ET9A 5H8YE 4L2YA 2IO3B 2K8HA 4GU2A 1GUAB 1QOAA 2H88B 4A20A 4ARIA 2MW5A 3T3OA 2VZKD 4N6EB 3APCA 2LASA 5BYSA 4ZHPA 5EE3A 1UGJA 1XF5L 1IBXA 4EUTA 3Q6BA 3QCAA 2ZCCA 4DHJD 3FKYA 2DYBA 4UDUC 4GXBA 1DOIA 1F77A 2V4LA 4M00A 1MHHE 4J3OD 5HI1A 2L00B 2SAKA 1PDXA 5G55A 1EF1A 3PSEB 3IBEA 2HE7A 3W5UB 2BKFA 3TEXA 3WAOA 1CQVA 1JWSD 3WAPA 2K8CA 2AWTA 2KACA 3CIRB 4GDKA 2TSSA 3B9JA 3PRZA 5DPRA 4XGAB 3HK0A 4LK0M 2AL3A 1L4ZB 2WDTB 1QT9A 2AYOB 2DZMA 4KZ0A 1QILA 4WQMA 3RCZA 1JW9D 2W82A 1WM3A 4XDCA 2KWDA 2IGGA 4AQ7A 1MFWA 3B2GA 3VTUA 1NBFC 1AYFA 3ZVVA 3PLUA 4ZDVA 1PGAA 4EEWA 1WMHA 4OW0A 2JYEA 4FJYA 3Q8EA 5EE0A 4MT5A 1IBXB 2MBQA 2WX1A 2INNE 4MM3A 3TSSA 1XEEA 3PZ7A 1JRPA 1SXTA 2JWZA 1PQSA 3P4QB 2L83A 3BYYB 3A9JA 1UGMA 3GS2A 1DOXA 2JX5A 3NZUA 2IBIB 3N1YC 1C3TA 1ZOYB 3VUXA 3AEFB 1T0RC 3M3JA 5C23A 2GOWA 4KDIC 2JT4B 4AOFA 3HRDD 4WWNA 2FIDA 3H8HA 2WXFA 3CMMB 2FCNA 3GP7A 5I4DA 4WQOB 4RGTA 4A3OA 4YT0B 1GNUA 2OOBB 3R3MA 2KC2A 1ZP0B 1J7BA 3OLMD 1GAQB 3RT3B 2CS4A 4NQKE 1ZXHA 1MG8A 4LCDE 3P1MA 3NJTA 3P4SB 4JE3B 4NJ7A 3BINA 4WH4A 1G6JA 3PT2B 2C60A 2HDEA 3Q3MC 1Q10A 4JX1C 3W9CB 1M94A 2KANA 1WMHB 1JALA 4II3B 4TSSA 2ASQA 3NS1A 2JSVX 1UWXA 4NNJB 1ESFA 5HKHA 4PYUA 5G5GA 3X23A 1YQBA 4TUUA 3V6EB 1B9RA 2WU2B 1STEA 3AEAB 3BK2A 1J7AA 3A9JB 2FIFA 2ZZPB 3VH3B 5AZHA 3PS6A 3TBLD 2IGDA 3VRBB 1D4BA 2M1MA 2AQ1B 2JY6A 2FAZA 3VH4B 2CU3A 4ZYNA 2NS5A 2J0JA 1IPGA 5FKAC 3Q3NC 1N62A 2NVUI 3BWUD 4AS1A 2FE8A 2KLGA 3FAHA 1ZDVA 5CHFA 3BK1A 1TY2A 2KVZA 1FNUA 4S17A 1K51A 3R2TA 1C79A 2PVOD 3PHXB 2Z59B 3A9KA 3N1ZC 4KGTA 4DXGA 4KIKA 3L4PA 1L4DB 2WXQA 2PE9A 3AECB 4DBGA 1I35A 1IUEA 3EECA 3IT6B 2R61A 1IYFA 2ZVOA 4HLEA 4Q2JA 3SR6A 1C76A 5IP4D 1SE3A 3B08A 1L7YA 3VUYA 1JWUD 3DQVA 5D6JB 3CSTA 1AN8A 3AM9A 1XO3A 1XLOA 4O1NA 2KLCA 3O65B 1OEYJ 1KOTA 2ZW1A 2WXMA 4K7UA 3QX1A 1E6EB 5AUIA 1GC6A 2GBRA 4KGRA 2RDBC 2O6VB 4USAA 4MDKE 4P6VF 3N30A 1U4AA 1D5MC 4YSXB 3RZWC 1WZ0A 4US9A 4KKIA 2C9WB 4GSWA 2Y5CA 1WX9A 2D2QA 2VRRB 4ACFA 4WWPA 2V0GA 2SEBD 1PGBA 1MHXA 4HJGE 2O2VB 4HWIB 2FCSA 2WWZA 3A9KB 3RN9C 3DHGC 1RM6C 3CSFA 4KIKB 3ZLZA 4LJOB 2K1FA 2EELA 5H92C 2KDEB 4KX6B 4M0WA 4BKGA 3I57A 4HCNB 4A9AA 1V81A 3BIID 1YJ1A 4JWUC 3KLSX 1WJNA 2A5UA 4HPPA 3L0WB 1TIFA 2V1YA 1WGHA 3IAM1 2R2OA 2HJ1A 4JL9A 5DPSA 4BKSD 3PO0A 2NTSA 2M56B 3AULA 3KUCB 2OJWA 5D7GA 1FFVA 3RD2A 4DQOC 3D32A 1UF0A 3NHEB 1SEBD 1LQBA 1E8WA 4LTUA 2NCNA 5CHWA 1WGDA 1IGDA 2JU6X 2KOXA 2C5LC 1WFYA 2W54A 3FILA 4ZOHC 2YEPF 2KWVB 2LXAA 1F52A 1XT9B 1I4RA 2BT6A 2LGXA 1SB3C 2ACZB 4OZCA 3A1QA 1GJZA 1R4MI 2KDBA 1FRRA 3KW5B 3U52E 4BVUC 4EE2A 3R2IA 4TKNA 3W1SC 2LHEA 2CJNA 3VXWA 4DHJB 1R4NB 2MJ3A 1P7EA 1NDDA 3NVVA 1RRBA 4WAFA 1HTOA 4RGOS 1FIQA 1QKZA 2JRIB 3KUZA 1F2RC 1MPEA 2AQ2B 3Q14C 2BKRB 2EMSA 5EE1A 2KN4A 1VZ6A 3ALBA 3W1YA 1WXMA 1JMLA 2G4SA 4FJVB 2RGFA 1NI2A 1ZDXA 3DHIC 3PGEA 3ZRFA 2INDC 1WWTA 1WM2A 3MP9A 3P63A 4IM0A 3U2SC 2ZW0A 3BVMA 5FK9C 2MHJA 3T8MA 1UH6A 4IOIE 4HPLB 1WE7A 3HIZA 5G5HA 3PVLA 3TIXA 1JWBD 2D11A 3KVFB 4JLCA 3VR8B 1FNWA 1NEKB 4ZRKA 4II2B 1VZ8A 2LHDA 2KDMA 1UELA 1Q1OA 3AE6B 5IA7A 5IOIA 4HKQA 3URYA 3WANA 4QAYA 3QA8A 4DDID 3W2DA 3UQBA 3KQ4A 3AE9B 3ZO5B 1H4RA 1B1ZA 2KJHB 2IZVB 1WXVA 3ZYYX 1D3ZA 3DBHI 2QCZA 3GZNB 3QAQA 1SE2A 1ZXIA 1L6VA 2JVCA 4REZA 3GE8C 3DWMA 1YX5B 2JZPA 5DCNA 1N5XA 2DNFA 4LJPB 5LLIA 1OTRB 2QEJC 2LI5A 3UQAA 2KMAA 1KTKA 1JRUA 4HRSA 1TT5B 2L32A 2DX5B 4PS7A 1I7HA 1SE9A 3RNGC 1P7FA 1KH0A 5BYQA 2D3CA 4US8A 5JHBA 4I6LB 4MGKE 5T8IA 4IWQA 5AEKB 4P1CC 1UD7A 2RSUA 4YTPB 2KJRA 4OHJA 1WYGA 3DBRI 3DHHC 2N7EA 4IWOA 1K50A 4BBNF 3TEZA 2E6XA 1E0ZA 2JF5A 3RYTA 3S2AA 4WJOA 1WXAA 3HVZA 2KZRA 3RFZB 5JXVA 1RYJA 1MJDA 1I4XA 3AE2B 2J7QB 3BVGA 2QMTA 2G1EA 2IGHA 1I42A 2LGDA 3ONSA 3QIJA 1XD3B 3LJ3A 2KWCA 2MBOA 3ECIA 4K1RB 5HG2A 2K6DB 3WCQA 3NVYA 1V2YA 3EA6A 4RNAA 1CZPA 4ZRQA 2PE6B 4MGYE 3OG5A 2WXHA 2D07B 2V4IB 3AE5B 2L0TA 3UIPB 3RNBC 1Y56A 2WXIA 5DPWA 5BMGA 3AEBB 2N7DA 2M0XA 2RDHA 2LEKA 1UBIA 2WDQB 4MELA 1P98A 3HVDA 2G3QB 4BFRA 1E10A 1AW7A 1SGHA 1ENFA 1EO6A 4NZLB 2WNMA 3L10B 3GB1A 3MHSD 2KYWA 1TKYA 4IKGA 3BYTB 1E8XA 2K3UA 4MJSB 3RMKC 5LXIB 4OVVA 2MBEA 3PLVA 1V1OA 3MTNB 4IC7B 1CK1A 1FXIA 3MJWA 1WGRA 2M19A 2MJDA 4JWSC 1FFUA 3ML9A 3HUIA 5GMVA 3VHTC 2MH7A 1V86A 2K39A 2HD5B 2Y5BB 1V97A 3QK0A 4X57B 3V60A 2LJ5A 4DXFA 1VR9A 5LXHA 2MEKA 1C4PA 1GOZA 3ABVB 4DK5A 3AE7B 1E5WA 2VH2A 2LGYA 4W9IA 3EFCA 1I4QA 2BYEA 5TSSA 3HHMA 4E74A 1VJKA 4WJNA 3L08A 2LFIA 3KWLA 1P9DU 1LFDA 5BMHA 3SDLC 3QC8B 4S0RA 4FJZA 1GB4A 4RF1A 1ET6A 2L76A 4KV2A 3TCAA 5HHDG 1GPXA 1WXSA 3W1SA 2LJIA 4HVBA 2PEAA 1EU4A 1L6UA 1Y8RC 2GRIA 4HEA1 1AARA 3CF6E 2MBBB 2MRPA 1HA5A 3P4RB 4PK1A 2AEHA 2HTME 1YD8U 3B2FA 2DYMA 4C4VB 4YTNB 4FHJA 4KZCA 2M4NA 2XEWA 2BS4B 1JWMD 1ISNA 2RR9A 4K3BA 1UWMA 3ZNID 4C7ZA 4N9F4 3JW0X 4I6NB 2O6VA 4EZLA 1EU3A 1YOVB 1J8CA 2WQYB 2LVQA 4BOZB 2AQ3B 2L52A 4A90A 1SSNA 2KT7A 2BS3B 2N9KA 3J9CA 2CJOA 3U7DA 2YLMA 4B0EA 2PMVA 1VCBA 4M8NA 3AU4A 2GBKA 1XQQA 3PRMB 3BVZA 3ZGZA 3V62A 2XNAC 2ZEQA 2EMTA 4A6QA 1L5PA 4ICVA 1C4AA 4R3DA 2L3ZA 1UNSA 4W9EA 3MC0B 2O2VA 1YNTE 4TV3A 1WGYA 4C56C 4HXDA 4M8MA 3L16A 1KJTA 4E3CA 4HCPB 2QJLA 3UI3A 4C7YA 4CQNA 2WS3B 1TTNA 2CHWA 3N1XC 2M0AA 1SJED 2NMQA 1T0YA 4XZ4A 3QARA 1SIJA 3ZTDA 3LB8C 2KJ6A 4W9KA 2BYFA 1XLNA 1RLFA 1J0GA 2BW2A 1S3SG 2BYVE 4RGNA 1TKEA 4L1BA 1YN3A 2WXKA 3PZ8A 2KNBA 2LZ6A 3AN1A 4A8XC 1T5XD 1WX8A 1F0ZA 3Q8BA 4GOCA 5D3DA 1NVID 4W9LA 3ZW3A 2PW9A 4NJ6A 2B76B 1RFKA 3IHPC 2KQ4X 1V8CA 2LRUA 2BPSA 4ZRPA 2UYZB 1UBQA 4G3XB 1QZEA 4WWMA 2LMCA 4C00A 3ZJVA 2DLBA 4B0MA 3PRPB 2L0FA 3AEDB 2V3PA 2LD9A 3IG3A 1KLGD 4PYZA 1YX6B 1YIWA 3Q3OC 1D6EC 4PS8A 5KHOA 1V9JA 2MLBA 1FNVA 1UZXB 2ZPYA 1WSPA 1VD2A 4A3PA 2IO2B 3CWIA 3V05A 4ZRJA 5C2TB 3ENEA 1EF5A 2KFKB 2Y5PA 2D3GA 2KN5A 4XWWA 5J18A 1T3QA 5BYRA 5JZEB 3N20C 1HZ5A 3DBLB 3PZDA 4IDIA 2NBWB 1WR6E 4YSYB 1ZW7A 5KHQA 4LNKA 3ZRCA 2CHXA 3TEWA 3VRAB 2JZZA 4RFBA 4EFOA 2KC1A 2XBBC 4KGSA 3AI5A 2C7MB 3ETRA 2DBYA 1TS3A 3AEEB 3SFEB 4EZJA 1TBEA 2LRWA 5D2MB 2QC8A 4NAWA 1L0XB 5D3IB 3ZKJC 1LM8B 4MH8A 2GBMA 2WU5B 2AL6A 5E6PA 4W9CA 1N5WA 1OGWA 4GDLB 3AE8B 4G50A 4GN1A 1WJ6A 2HJ8A 5FR6A 1FRDA 2J0MA 3U30A 4KKJA 2PTLA 3LXFA 1ZPSA 1Z2MA 1WH3A 3AEGB 3AXCA 1E8YA 1FM0D 3KWVA 4NAMA 3JVZX 4IM2A 3E56A 3Q69A 3UIOB 3ML8A 1HTQA 1VZ7A 2KDIA 2PIAA 4FHKA 3MJ5A 1SIFA 5J17A 3RNCC 4OVZA 3DOWA 3IAS1 3VFKA 1TS2A 2ZNVB 1Z5SB 1HE8A 1WJUA 4HPMB 3KYCD 3UGBB 3DBSA 2KMCA 4AWJA 2BF8B 2INCC 1C4CA 1WX7A 4ITKA 5JHAA 1OQYA 1TS4A 2OEDA 4HK2A 4XC2A 3APFA 2RPQA 2NTTA 2WDVB 2QSDA 1WGKA 1L0VB 2LVPA 4G11A 1ZE3D 2N0SB 1TZ1A 2LUMA 1JWAD 3C19A 1P0RA 2MX2A 2M17A 2G45B 3SU8X 4NAWB 3H1UA 5J2RA 4FULA 3R7QA 2KQ7A 3RNFC 4W9FA 4JIOU 1WY8A 4RM8A 3C0RB 3I3TB 3UINB 3PREA 2PVGC 4BOSC 3AH7A 3P42A 4WIPA 1NYQA 2FBWB 1S1QB 4RF0A 1BT0A 2W9NA 1PGXA 3V3XA 2VH1A 1MI0A 2EKIA 3VAWA 1WE6A 2REXA 2N9XA 4RH6A 4XX5A 2KFJA 4GIVA 2QDFA 1KLUD 2RD0A 2LGSA 1V1PA 4P1BC 4W9DA 5IKCM 2N7JA 1T0QC 3X0WA 1SE4A 3AU5A 3L54A 2IY1B 2WHIA 4D2KA 2AX5A 3V61A 2JXTA 4BKTA 3EFUA 3RUIB 2K8BA 1WXQA 2IDYA 2DWQA 2WXOA 3GOEA 4CYEA 1FPYA 1NI3A 3IXSA 1HEZE 1CMXB 1KM7A 2XK5B 4L23A 2DZKA 1FCLA 1F9JA 3A33B 2WXNA 4KSLC 1QOBA 4GGQA 4C80A 1GB1A 1YQ4B 2DYOA 3LDZE 1KFYB 4I6PA 4F8CB 4MJSA 2KTRA 4LLGM 4P16A 1F1HA 4NQLB 2BTEA 1R4NI 1WZ3A 3OAWA 2DAJA 2MCNB 2OHFA 1J7CA 4DXAB 2H89B 1TY0A 2QHOA 2D3AA 2Q5WD 2ZNVC 2J4XA 1J19A 5IAAC 2E3TA 3T3NA 3B0AA 3E9SA 2UU7A 3JYUA 4IW0A 1TYGB 5AUKA 1EWCA 1KRHA 3EHVA 1T6BX 1HZ6A 4GB9A 1L2NA 1QOFA 2BS2B 5AZGA 4DDGD 3OJ4B 3PV1A 4FBJB 4BAXA 1AWDA 1K52A 4H2AA 3DVGX 4WAAA 2BWES 1V1PB 4CO7A 4DHZB 4B95A 4PT5A 2PPHA 4MSQB 2IO1B 3TJPA 3AE4B 1KF6B 4EOYA 4LNFA 3VTWA 2IJ0A 5TR5A 4XE0A 4W9HA 3IFWB 3RNEC 5EE9A 4ANVA 3L17A 3MHZA 3QJZA 1GC7A 2GBJA 2WGSA 3QHTA 5CX3A 1VLBA 3H9DA 2DZIA 4AJWA 3VUWA 4N59A 2DHZA 2N1WA 1BMLC 1FEHA 4M02A 2J52A 4A55A 1FMAD 1ZUD2 3JSVB 1E7PB 2GLSA 2C7NB 3QQ8B 1PYWD 4HKZE 2IO0B 4YXDB
chains in the Genus database with same CATH topology
4YTMB 2RMMA 3IT4B 3NVWA 4A9AA 1C78A 2BS3B 2GB1A 3Q8AA 1YJJA 2N9KA 3J9CA 2CJOA 3BIID 2QIEB 1FD6A 4B0EA 4JWUC 2PMVA 1D5ZC 2N9LA 1L0YB 1HQRD 3BVZA 3KLSX 3ZGZA 1N60A 4TMAB 2XNAC 3IAM1 4A6QA 1L5PA 1C4AA 3PO0A 2JWUA 2MJEA 2I38A 2KAJA 1UNSA 2FUG1 2M56B 2NTSA 3FC4A 1QF6A 3MC0B 1YNTE 1FFVA 1CJEA 1HXYD 2RDGA 5D7GA 2WP9B 4C56C 4DQOC 2WXJA 1QLBB 1D5XC 1SEBD 1FCCC 2QJLA 3UI3A 4C7YA 4CQNA 2WS3B 4LTUA 4TQ0A 2M0AA 1MVKA 1ACCA 1SJED 2NMQA 3N9YC 3ZJTA 3Q8FA 1NYRA 1SIJA 1DGJA 1IGDA 3LB8C 1A70A 2JU6X 1VDVA 2W54A 3FILA 3O13A 1C9FA 5GXGB 1XLNA 4ZOHC 2YEPF 3TUOA 3ZJUA 2BB6A 3MFGA 2BW2A 4YXDB 1DYQA 4RGNA 1I4PA 1I4RA 2BT6A 3SFDB 1TKEA 1SB3C 4L1BA 2ACZB 1YN3A 2WXRA 2WXKA 4OZCA 1OQRA 1SBBB 5MPOA 1TKGA 1FRRA 3PZ8A 3U52E 3AN1A 4A8XC 1T5XD 4EE2A 1NENB 1F0ZA 3Q8BA 3R2IA 3R8BA 5D3DA 3AE3B 1NVID 3VR9B 3RPFC 2LHEA 1R7SA 2PW9A 3ZQ4A 2CJNA 2B76B 1ET9A 1RFKA 5H8YE 2MJ3A 2KQ4X 1V8CA 4MACA 1P7EA 4L2YA 4OZBA 3NVVA 4WAFA 4ZRPA 3NZ3A 1DOYA 1QOAA 2H88B 1QQRA 1XXGA 1FIQA 1QKZA 2J42A 4RGOS 4WWMA 2LMCA 3ZJVA 4ARIA 2DLBA 3T3OA 1F2RC 2VZKD 4B0MA 1MPEA 4N6EB 2AQ2B 3AEDB 2V3PA 2V3NA 1JQ4A 1KLGD 5BYSA 4ZHPA 5EE1A 1D6EC 1XLPA 2KN4A 1UGJA 4GDKB 1VZ6A 5EE3A 1TZOA 1XF5L 1IBXA 1JMLA 1FNVA 1WSPA 1ZDXA 2K5PA 1WWTA 3MP9A 3P63A 3DWGC 2RPVA 3CWIA 3U2SC 4UDUC 4RCOA 1DOIA 3V05A 2ZW0A 3BVMA 5FK9C 5C2TB 3VQIA 1F77A 2Y5PA 1M4VA 4XWWA 2I2YA 1MHHE 1T3QA 4IOIE 5BYRA 1HZ5A 5G5HA 4IDIA 4J3OD 1JWBD 2WXGA 2QILA 4YSYB 3VR8B 5HI1A 1FNWA 2SAKA 1NEKB 1PDXA 4MM3B 3TEWA 3VRAB 4TQ1A 1VZ8A 2LHDA 4RFBA 2KDMA 3W5UB 4KGSA 3TEXA 3AE6B 1CQVA 3ETRA 1JWSD 2DBYA 3CIRB 2KACA 1TS3A 3AEEB 3SFEB 3URYA 2TSSA 3B9JA 1XLQA 4HKQA 5BMIA 4LK0M 1L4ZB 3W2DA 3KQ4A 1QT9A 3AE9B 1L0XB 5D3IB 1B1ZA 1QILA 4WQMA 1JW9D 2W82A 3ZYYX 4MH8A 4XDCA 2KWDA 2WU5B 2ON8A 2W55A 1N5WA 4GDLB 3AE8B 2IGGA 1FRDA 4AQ7A 1SE2A 3B2GA 2KMMA 1AYFA 4KKJA 1ZXIA 2PTLA 1YQ3B 1L6VA 1ZPSA 3LXFA 4REZA 1PGAA 3AEGB 3DWMA 2JZPA 1N5XA 1FM0D 4OW0A 3KWVA 4NAMA 2JYEA 1UUPA 3E56A 3Q69A 2QEJC 3Q8EA 5EE0A 1PFDA 4MT5A 1IBXB 1VZ7A 2INNE 2PIAA 3TSSA 1KTKA 4WURA 1XEEA 3PZ7A 3MJ5A 1JRPA 1SXTA 3Q8CA 4HRSA 4OVZA 2L32A 3IAS1 1I7HA 1TS2A 2K9XA 3P4QB 1BUIC 2L83A 1SF0A 3NUHB 1P7FA 1XCQL 3BYYB 1KH0A 3AE1B 5BYQA 4US8A 3GS2A 3W5VB 1DOXA 1C4CA 4YWGG 2JX5A 5T8IA 4ITKA 1ZOYB 1TS4A 3AEFB 2OEDA 1VRAB 4YTPB 2Z8LA 4OHJA 1WYGA 2NTTA 3HRDD 2WDVB 2QSDA 1WGKA 3H8HA 1L0VB 1K50A 1ZE3D 3TEZA 2N0SB 2E6XA 2WXFA 3GP7A 1E0ZA 5I4DA 2WXLA 2LUMA 4RGTA 1JWAD 3HVZA 4YT0B 1ROEA 3RFZB 5JXVA 1RYJA 2GI9A 4RGMA 1ZP0B 2ONQA 1I4XA 1J7BA 4YSZB 1GAQB 3AE2B 3BVGA 4NAWB 2QMTA 1ZXHA 2G1EA 2IGHA 2WXPA 3P1MA 2WDRB 2WLBA 3P4SB 2W3SA 4JE3B 5HG2A 4WH4A 4XDDA 3WCQA 2HDEA 1BXTA 1Q10A 3NVYA 4JX1C 2ICIA 3W9CB 3EA6A 4RNAA 1CZPA 4ZRQA 1JALA 2WXHA 1FO4A 2V4IB 3AE5B 2K0PA 4TSSA 1EWYC 2XN9C 3NS1A 2JSVX 2PVGC 1UWXA 1Y56A 2WXIA 2IPKD 2K22A 3AH7A 1XCTL 3LYYA 3P42A 1NYQA 1ESFA 2FBWB 3AEBB 4NJCA 4WIPA 5BMGA 2RDHA 5G5GA 4RF0A 2L1AA 2LEKA 2WDQB 3HVDA 2JQRB 5HFYA 1E10A 1AW7A 1B9RA 3V3XA 1PGXA 2WU2B 1STEA 1ENFA 1MI0A 2EKIA 3AEAB 4NZLB 3BK2A 1J7AA 4XWTA 2WNMA 3GB1A 3U4EG 1TKYA 2Y3AA 1EM7A 3NRZA 1K53A 4RH6A 4IKGA 3SEBA 3BYTB 2IGDA 3VRBB 1D4BA 2K3UA 3C8YA 2AQ1B 1TS5A 5E6JA 1KLUD 5C3JB 1V1PA 2CU3A 1V1OA 1JROA 3AB5A 3OWEB 2N7JA 1JCKB 1CK1A 1FXIA 5FKAC 1N62A 1SE4A 3BWUD 4AS1A 2M19A 1YN4A 4ZYSA 2FE8A 2MJDA 4D2KA 2JYTA 2AX5A 2BB5A 2LGIA 1ZDVA 3FAHA 2JXTA 4JWSC 3BK1A 1TY2A 1FFUA 1FNUA 1WXQA 2IDYA 3U7ZA 3HUIA 3AV8A 1K51A 3R2TA 2DWQA 2WXOA 1C79A 2MH7A 2PKOA 2PVOD 3IXSA 1NI3A 3I9V1 1HEZE 4OZAA 4KGTA 4DXGA 3L4PA 4L23A 1L4DB 1F2RI 2WXQA 2X38A 1FCLA 3AECB 1IUEA 1V97A 2VZKB 3IT6B 2WXNA 2PLPA 4DXFA 1QOBA 1VR9A 2R61A 4C80A 1GB1A 1YQ4B 2MEKA 4ZHOA 2BYTA 1RWSA 1C4PA 1FXAA 1GOZA 1KFYB 2D5GA 2DYOA 3ABVB 3AE7B 1IGCA 2G9HD 4FXCA 1SJHD 4LLGM 4P16A 1I4HA 1I4GA 4Q2JA 3SR6A 4GLSC 1C76A 4ARCA 1SE3A 1I4QA 2BTEA 3NVZA 5TSSA 5LNK1 1OQQA 1JWUD 2OHFA 1J7CA 1VJKA 1N61A 4JPSA 1WRIA 2H89B 1TY0A 2YEPB 1AN8A 1YMHE 2Q5WD 2LFIA 3KWLA 2BBCA 3AM9A 5FR3A 1XO3A 2J4XA 1XLOA 5BMHA 4O1NA 2E3TA 3T3NA 1GB4A 3E9SA 2ZW1A 2WXMA 5AUIA 1E6EB 1TYGB 4RF1A 4KGRA 1ET6A 4USAA 1EWCA 1C77A 1KRHA 5AUKA 1T6BX 1HZ6A 1TJEA 1QOFA 4P6VF 2BS2B 4R3DA 1E9MA 5HHDG 1D5MC 1AWDA 1GPXA 3W1SA 3AMZA 4YSXB 1K52A 4H2AA 2LJIA 4US9A 1V1PB 3EGRA 2INPE 4PT5A 3P4PB 4KKIA 3BZDB 1EU4A 1L6UA 3EUB2 3AE4B 1KF6B 2GRIA 4HEA1 4N58A 2IJ0A 2Y5CA 4XE0A 2W3RA 1HA5A 5EE9A 3P4RB 3TEYA 2V0GA 4HROA 1OFFA 2SEBD 1PGBA 3MHZA 1MHXA 2HTME 4HJGE 1VLBA 1QOGA 3B2FA 1LO5D 4N59A 1PUTA 1RM6C 1BMLC 2DYMA 1FEHA 4YTNB 1N63A 2BS4B 1YN5A 1JWMD 2J52A 1YJIA 4A55A 1UWMA 4C7ZA 1FMAD 1ZUD2 2J53A 2EELA 5H92C 1E7PB 1EU3A 4KX6B 4M0WA 3FILB 2WQYB 1PYWD 3I57A 4HKZE 2AQ3B 2L52A 4A90A 1SSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWT A;  2PKO A;  1NI3 A;  1WYG A;  4YTM B;  3HRD D;  2WDV B;  3NVW A;  4A9A A;  3P63 A;  1WGK A;  2BS3 B;  3DWG C;  1YJJ A;  1L0V B;  3CWI A;  3L4P A;  2CJO A;  2N0S B;  1DOI A;  3BII D;  3SFD B;  2QIE B;  1E0Z A;  3AEC B;  5C2T B;  1IUE A;  4JWU C;  1V97 A;  1JWA D;  3HVZ A;  1T3Q A;  1QOB A;  1ROE A;  4YT0 B;  1RYJ A;  4C80 A;  1N60 A;  1YQ4 B;  5G5H A;  4IDI A;  4ZHO A;  1JWB D;  1RWS A;  1FXA A;  3ABV B;  1KFY B;  3AE7 B;  4YSY B;  3VR8 B;  1ZP0 B;  4FXC A;  2PVO D;  1J7B A;  4YSZ B;  1GAQ B;  1L5P A;  3AE2 B;  1NEK B;  3PO0 A;  2MJE A;  2KAJ A;  1PDX A;  2M56 B;  3FC4 A;  2G1E A;  3SR6 A;  1QF6 A;  3VRA B;  1FFV A;  1CJE A;  3P1M A;  2WP9 B;  3NVZ A;  2WDR B;  2WLB A;  3W5U B;  1OQQ A;  3P4S B;  2W3S A;  2OHF A;  1J7C A;  1VJK A;  4YTP B;  1N61 A;  3AE6 B;  1QLB B;  1WRI A;  2H89 B;  3ETR A;  2QJL A;  2DBY A;  4C7Y A;  2Q5W D;  3CIR B;  2WS3 B;  3AEE B;  3KWL A;  3AM9 A;  4LTU A;  3SFE B;  3B9J A;  1XLQ A;  3NVY A;  4JX1 C;  3W9C B;  3WCQ A;  1XO3 A;  1XLO A;  1NYR A;  1SIJ A;  2E3T A;  1DGJ A;  3LB8 C;  1A70 A;  1VDV A;  1CZP A;  1QT9 A;  2W54 A;  1JAL A;  3AE9 B;  1GPX A;  5AUI A;  1FO4 A;  1E6E B;  1TYG B;  3AE5 B;  5GXG B;  1EWY C;  4USA A;  1XLN A;  1KRH A;  4WQM A;  3NS1 A;  4ZOH C;  5AUK A;  1JW9 D;  3ZYY X;  1TJE A;  1QOF A;  2PVG C;  2BS2 B;  4P6V F;  4YXD B;  1E9M A;  2K22 A;  2WU5 B;  3AH7 A;  1NYQ A;  2FBW B;  1AWD A;  2BT6 A;  1N5W A;  1TKE A;  2W55 A;  3AEB B;  3AMZ A;  1SB3 C;  5G5G A;  2ACZ B;  3AE8 B;  4YSX B;  2LEK A;  1FRD A;  1OQR A;  2WDQ B;  3B2G A;  4US9 A;  2JQR B;  2KMM A;  5MPO A;  1E10 A;  1TKG A;  1FRR A;  1AYF A;  1B9R A;  1ZXI A;  3AN1 A;  1YQ3 B;  1L6V A;  2WU2 B;  1NEN B;  3LXF A;  3P4P B;  1F0Z A;  3AE3 B;  3AEG B;  3DWM A;  2EKI A;  1NVI D;  3AEA B;  3VR9 B;  1N5X A;  3RPF C;  1J7A A;  1FM0 D;  1L6U A;  1R7S A;  3AE4 B;  1KF6 B;  2CJN A;  3EUB 2;  4N58 A;  2B76 B;  1TKY A;  1RFK A;  5H8Y E;  2Y5C A;  2MJ3 A;  3NRZ A;  1V8C A;  2W3R A;  5EE0 A;  1PFD A;  5EE9 A;  3VRB B;  3P4R B;  3NVV A;  2PIA A;  1DOY A;  1QOA A;  1JRP A;  2H88 B;  1FIQ A;  4HRS A;  1OFF A;  4HRO A;  4WWM A;  5C3J B;  2HTM E;  2CU3 A;  1JRO A;  1I7H A;  3AB5 A;  1VLB A;  1QOG A;  3B2F A;  2K9X A;  4N6E B;  3P4Q B;  3AED B;  4N59 A;  2L83 A;  1PUT A;  1SF0 A;  1RM6 C;  1FXI A;  4YTN B;  1N63 A;  1JQ4 A;  3AE1 B;  2BS4 B;  4ZHP A;  1N62 A;  5EE1 A;  4US8 A;  1XLP A;  1YJI A;  5EE3 A;  1UWM A;  3W5V B;  1DOX A;  2M19 A;  1FMA D;  4C7Z A;  1ZUD 2;  2JX5 A;  4ITK A;  2MJD A;  1ZOY B;  2AX5 A;  5H92 C;  3FAH A;  1E7P B;  4JWS C;  4KX6 B;  2WQY B;  3AEF B;  1FFU A;  1WXQ A;  3HUI A;  2L52 A;  3AV8 A;  2K5P A;  2DWQ A;  2MH7 A; 
#chains in the Genus database with same CATH topology
 2KDF B;  2KTR B;  4YTM B;  2RMM A;  1C78 A;  3V6C B;  1YJJ A;  2DEN B;  4DHZ E;  2QIE B;  3GZN I;  1D5Z C;  4MSM B;  1L0Y B;  1ZGU B;  3H6N A;  4K7S A;  4F7Z A;  2CKH B;  3U8Z A;  2L05 A;  2MJE A;  2I38 A;  3NG0 A;  1QF6 A;  2RDG A;  1HXY D;  1CJE A;  4FAD A;  2WP9 B;  4BKS A;  4ANX A;  4C4V A;  3RI7 C;  2L7R A;  4TQ0 A;  3N9Y C;  3ZJT A;  1P1A A;  3Q8F A;  4FLH A;  1C9F A;  2UWQ A;  3TUO A;  4XYC A;  3NS8 A;  2IYD B;  3MFG A;  4IWP A;  1DYQ A;  2Z0D B;  3SFD B;  3M62 B;  1WR1 A;  4RMA A;  2WXR A;  4CHK A;  2CHZ A;  5MPO A;  2R2Q A;  4NPN A;  4K7W A;  3R8B A;  1V49 A;  3WAL A;  3VR9 B;  3ZQ4 A;  1RFA A;  2JUO A;  3VDZ A;  3DCG A;  2KD0 A;  3IVF A;  4MAC A;  3ZTC A;  4OZB A;  3NZ3 A;  1DOY A;  1QQR A;  1XXG A;  2J42 A;  3A4R A;  1E90 A;  4MGI E;  2V3N A;  3BY4 B;  1JQ4 A;  3APD A;  4GDK B;  1XLP A;  2ZVN A;  1TZO A;  2JRH A;  2I1K A;  1V5O A;  4KSK C;  1IP9 A;  2N1V A;  2ZPN A;  3ZXV A;  2K5P A;  2GBN A;  2LWP A;  4K3C A;  4JQW C;  4MH0 E;  3M95 A;  3DWG C;  3K9O B;  2RPV A;  2ZJD A;  4RCO A;  3VQI A;  4AUQ C;  1M4V A;  2I2Y A;  1WGG A;  3N32 A;  3M63 B;  3ZDT A;  1V6E A;  2WXG A;  2QIL A;  3UF8 A;  1RAX A;  2WX0 A;  4BBN C;  2JZ3 B;  4LNI A;  4MM3 B;  4TQ1 A;  5AZF A;  3H7P A;  4ZRI A;  2NPT A;  4ANW A;  5L83 A;  1K8R B;  5C1Z A;  1XLQ A;  2KHW B;  2G4D B;  5BMI A;  2KKC A;  5E6N A;  1Q0W B;  2DZJ A;  4KVG B;  1OEY A;  2MQJ A;  5G2N A;  4ASW C;  1V80 A;  4EZK A;  2ON8 A;  4LDT B;  3PPA A;  2W55 A;  2KMM A;  2D10 A;  2LUE A;  2KFK A;  1YQ3 B;  3NOB A;  1UUP A;  1P3Q U;  2FUH B;  4IM3 A;  1PFD A;  3Q2A C;  2YVC A;  3NY5 A;  3N3K B;  3QWZ B;  4WUR A;  2FCM A;  3Q8C A;  2OJR A;  2K9X A;  2Z0E B;  3DPD A;  5IN7 A;  1BUI C;  1SF0 A;  5CHV C;  3NUH B;  1XCQ L;  2BQQ A;  3AE1 B;  3W5V B;  2K6Q A;  4YWG G;  3WAM A;  3PHW B;  2EKE C;  3VTV A;  1V5T A;  1R4M B;  4YL8 A;  4GDL A;  4WWO A;  2C7H A;  1VRA B;  2LVO A;  2Z8L A;  1EUV B;  2KX3 A;  4G0N B;  1LGR A;  3DVG Y;  3H7P B;  2NPT B;  1N6Z A;  1MG4 A;  2WXL A;  4F1S A;  1ROE A;  2GI9 A;  2KX0 A;  4RGM A;  4AP4 C;  3KUD B;  3HM6 X;  1E7U A;  2ONQ A;  4YSZ B;  2A4Z A;  4PS3 A;  4EKU A;  3RZF A;  2WXP A;  2J0K A;  2WDR B;  2WLB A;  3WA0 A;  2W3S A;  3ZIM A;  3DVN V;  3ZNZ B;  2N9P C;  4HDO A;  1KLV A;  2MBH A;  4XDD A;  4IUM B;  1BXT A;  2ICI A;  2MP2 A;  3T9L A;  3SHQ A;  3KH0 A;  1FO4 A;  4MEM A;  2GMI C;  2K0P A;  4URK A;  1EWY C;  2XN9 C;  3ZDM C;  3SD5 A;  2IPK D;  2K22 A;  3I63 C;  1XCT L;  3LYY A;  4NJC A;  3Q3J A;  2N4F A;  2L1A A;  2JQR B;  5HFY A;  1FXT B;  5D94 A;  4XWT A;  3U4E G;  1H8C A;  2Y3A A;  1X1M A;  1EM7 A;  3NRZ A;  1K53 A;  2L8J A;  3SEB A;  3C8Y A;  3DVN U;  3WIM A;  1TS5 A;  3NZS A;  5E6J A;  5EDS A;  5C3J B;  2I1J A;  2BWF A;  3OWE B;  1JRO A;  3A4S C;  3AB5 A;  3HM3 A;  1JCK B;  3DDC B;  4RM9 A;  2X8X X;  3DBH B;  1YN4 A;  2KXJ A;  2KQS A;  4ZYS A;  2JYT A;  2KK8 A;  2JXX A;  2BB5 A;  2LGI A;  3P2B A;  3U7Z A;  3AV8 A;  1E8Z A;  2PKO A;  3I9V 1;  2BGF A;  4OZA A;  4FA6 A;  1F2R I;  2X38 A;  3R66 C;  3R7R A;  2CU1 A;  4B6W A;  2VZK B;  2PLP A;  4NY0 A;  4WJP A;  4LDT D;  4MGZ E;  2MP2 B;  4ZHO A;  2BYT A;  1RWS A;  1FXA A;  2D5G A;  1IGC A;  2G9H D;  4FXC A;  4KDL B;  1A5R A;  1SJH D;  5CTR C;  1WIA A;  1I4H A;  1I4G A;  1T0S C;  4GLS C;  4ARC A;  1GG3 A;  2HTH A;  3NVZ A;  5LNK 1;  1OQQ A;  2ZCB A;  2KO3 A;  1N61 A;  4JPS A;  1WRI A;  5BO4 B;  2YEP B;  1YMH E;  4GMV A;  2BBC A;  1C1Y B;  2MWS B;  5FR3 A;  2MA9 B;  4JGH B;  1ZKH A;  5IO9 A;  2LXC A;  3DBR B;  4LNN A;  3H7S A;  2D3B A;  3KYD D;  1C77 A;  4M0W B;  1TJE A;  4ICU A;  1E9M A;  3ZXR A;  5JH5 C;  2NBV B;  3AMZ A;  2XK5 A;  2FCQ A;  3VVW B;  3EGR A;  2INP E;  4ANU A;  2V9H A;  3P4P B;  5E6O A;  3BZD B;  3EUB 2;  4BZA A;  4N58 A;  3K9P B;  2W3R A;  3TEY A;  1E7V A;  4HJK A;  4HRO A;  1OFF A;  3DBL I;  3MC8 A;  1QOG A;  1LO5 D;  1PUT A;  1WYW B;  2O6V D;  3ZNH B;  1N63 A;  4AJY B;  4LNO A;  1YN5 A;  2IY0 B;  1TGZ B;  1YJI A;  2BVC A;  4HDQ A;  4DWF A;  2J53 A;  3FIL B;  4P7I A;  2N9E B;  2B3A A;  2KVR A;  3IT4 B;  1WF9 A;  3NVW A;  3EC8 A;  3ZNG C;  2JPH A;  2GB1 A;  3Q8A A;  2MSE D;  4M01 A;  3A1Q B;  2WYQ A;  1FD6 A;  2PJH A;  3L13 A;  2N9L A;  4E71 A;  1WJ4 A;  1HQR D;  1Q5W B;  1N60 A;  3RUL A;  4W9J A;  4TMA B;  3OJ3 A;  2KWU B;  2NBU A;  4K81 A;  2JWU A;  4IG7 B;  2KAJ A;  2FUG 1;  4B9K A;  3FC4 A;  2K25 A;  1WI0 A;  4W9G A;  2WXJ A;  1QLB B;  1D5X C;  1WRD B;  2V3S A;  1FCC C;  3I5J C;  4FN2 A;  1MVK A;  1ACC A;  1NYR A;  3JSV A;  4WJQ A;  1DGJ A;  3PTF C;  1A70 A;  1VDV A;  2FNJ B;  3O13 A;  5L95 C;  5GXG B;  3TMP B;  3ZJU A;  2BB6 A;  3B1L X;  3GE3 C;  2NR2 A;  1I4P A;  4OVU A;  3TL5 A;  2KTF A;  2DAF A;  5DPT A;  4J6I A;  1OQR A;  1SBB B;  1TKG A;  3ZUN A;  3RNA C;  1NEN B;  3MC9 A;  3AE3 B;  2CR5 A;  3RPF C;  2M8S A;  1R7S A;  1LXD A;  3Q3F A;  1ET9 A;  5H8Y E;  4L2Y A;  2IO3 B;  2K8H A;  4GU2 A;  1GUA B;  1QOA A;  2H88 B;  4A20 A;  4ARI A;  2MW5 A;  3T3O A;  2VZK D;  4N6E B;  3APC A;  2LAS A;  5BYS A;  4ZHP A;  5EE3 A;  1UGJ A;  1XF5 L;  1IBX A;  4EUT A;  3Q6B A;  3QCA A;  2ZCC A;  4DHJ D;  3FKY A;  2DYB A;  4UDU C;  4GXB A;  1DOI A;  1F77 A;  2V4L A;  4M00 A;  1MHH E;  4J3O D;  5HI1 A;  2L00 B;  2SAK A;  1PDX A;  5G55 A;  1EF1 A;  3PSE B;  3IBE A;  2HE7 A;  3W5U B;  2BKF A;  3TEX A;  3WAO A;  1CQV A;  1JWS D;  3WAP A;  2K8C A;  2AWT A;  2KAC A;  3CIR B;  4GDK A;  2TSS A;  3B9J A;  3PRZ A;  5DPR A;  4XGA B;  3HK0 A;  4LK0 M;  2AL3 A;  1L4Z B;  2WDT B;  1QT9 A;  2AYO B;  2DZM A;  4KZ0 A;  1QIL A;  4WQM A;  3RCZ A;  1JW9 D;  2W82 A;  1WM3 A;  4XDC A;  2KWD A;  2IGG A;  4AQ7 A;  1MFW A;  3B2G A;  3VTU A;  1NBF C;  1AYF A;  3ZVV A;  3PLU A;  4ZDV A;  1PGA A;  4EEW A;  1WMH A;  4OW0 A;  2JYE A;  4FJY A;  3Q8E A;  5EE0 A;  4MT5 A;  1IBX B;  2MBQ A;  2WX1 A;  2INN E;  4MM3 A;  3TSS A;  1XEE A;  3PZ7 A;  1JRP A;  1SXT A;  2JWZ A;  1PQS A;  3P4Q B;  2L83 A;  3BYY B;  3A9J A;  1UGM A;  3GS2 A;  1DOX A;  2JX5 A;  3NZU A;  2IBI B;  3N1Y C;  1C3T A;  1ZOY B;  3VUX A;  3AEF B;  1T0R C;  3M3J A;  5C23 A;  2GOW A;  4KDI C;  2JT4 B;  4AOF A;  3HRD D;  4WWN A;  2FID A;  3H8H A;  2WXF A;  3CMM B;  2FCN A;  3GP7 A;  5I4D A;  4WQO B;  4RGT A;  4A3O A;  4YT0 B;  1GNU A;  2OOB B;  3R3M A;  2KC2 A;  1ZP0 B;  1J7B A;  3OLM D;  1GAQ B;  3RT3 B;  2CS4 A;  4NQK E;  1ZXH A;  1MG8 A;  4LCD E;  3P1M A;  3NJT A;  3P4S B;  4JE3 B;  4NJ7 A;  3BIN A;  4WH4 A;  1G6J A;  3PT2 B;  2C60 A;  2HDE A;  3Q3M C;  1Q10 A;  4JX1 C;  3W9C B;  1M94 A;  2KAN A;  1WMH B;  1JAL A;  4II3 B;  4TSS A;  2ASQ A;  3NS1 A;  2JSV X;  1UWX A;  4NNJ B;  1ESF A;  5HKH A;  4PYU A;  5G5G A;  3X23 A;  1YQB A;  4TUU A;  3V6E B;  1B9R A;  2WU2 B;  1STE A;  3AEA B;  3BK2 A;  1J7A A;  3A9J B;  2FIF A;  2ZZP B;  3VH3 B;  5AZH A;  3PS6 A;  3TBL D;  2IGD A;  3VRB B;  1D4B A;  2M1M A;  2AQ1 B;  2JY6 A;  2FAZ A;  3VH4 B;  2CU3 A;  4ZYN A;  2NS5 A;  2J0J A;  1IPG A;  5FKA C;  3Q3N C;  1N62 A;  2NVU I;  3BWU D;  4AS1 A;  2FE8 A;  2KLG A;  3FAH A;  1ZDV A;  5CHF A;  3BK1 A;  1TY2 A;  2KVZ A;  1FNU A;  4S17 A;  1K51 A;  3R2T A;  1C79 A;  2PVO D;  3PHX B;  2Z59 B;  3A9K A;  3N1Z C;  4KGT A;  4DXG A;  4KIK A;  3L4P A;  1L4D B;  2WXQ A;  2PE9 A;  3AEC B;  4DBG A;  1I35 A;  1IUE A;  3EEC A;  3IT6 B;  2R61 A;  1IYF A;  2ZVO A;  4HLE A;  4Q2J A;  3SR6 A;  1C76 A;  5IP4 D;  1SE3 A;  3B08 A;  1L7Y A;  3VUY A;  1JWU D;  3DQV A;  5D6J B;  3CST A;  1AN8 A;  3AM9 A;  1XO3 A;  1XLO A;  4O1N A;  2KLC A;  3O65 B;  1OEY J;  1KOT A;  2ZW1 A;  2WXM A;  4K7U A;  3QX1 A;  1E6E B;  5AUI A;  1GC6 A;  2GBR A;  4KGR A;  2RDB C;  2O6V B;  4USA A;  4MDK E;  4P6V F;  3N30 A;  1U4A A;  1D5M C;  4YSX B;  3RZW C;  1WZ0 A;  4US9 A;  4KKI A;  2C9W B;  4GSW A;  2Y5C A;  1WX9 A;  2D2Q A;  2VRR B;  4ACF A;  4WWP A;  2V0G A;  2SEB D;  1PGB A;  1MHX A;  4HJG E;  2O2V B;  4HWI B;  2FCS A;  2WWZ A;  3A9K B;  3RN9 C;  3DHG C;  1RM6 C;  3CSF A;  4KIK B;  3ZLZ A;  4LJO B;  2K1F A;  2EEL A;  5H92 C;  2KDE B;  4KX6 B;  4M0W A;  4BKG A;  3I57 A;  4HCN B;  4A9A A;  1V81 A;  3BII D;  1YJ1 A;  4JWU C;  3KLS X;  1WJN A;  2A5U A;  4HPP A;  3L0W B;  1TIF A;  2V1Y A;  1WGH A;  3IAM 1;  2R2O A;  2HJ1 A;  4JL9 A;  5DPS A;  4BKS D;  3PO0 A;  2NTS A;  2M56 B;  3AUL A;  3KUC B;  2OJW A;  5D7G A;  1FFV A;  3RD2 A;  4DQO C;  3D32 A;  1UF0 A;  3NHE B;  1SEB D;  1LQB A;  1E8W A;  4LTU A;  2NCN A;  5CHW A;  1WGD A;  1IGD A;  2JU6 X;  2KOX A;  2C5L C;  1WFY A;  2W54 A;  3FIL A;  4ZOH C;  2YEP F;  2KWV B;  2LXA A;  1F52 A;  1XT9 B;  1I4R A;  2BT6 A;  2LGX A;  1SB3 C;  2ACZ B;  4OZC A;  3A1Q A;  1GJZ A;  1R4M I;  2KDB A;  1FRR A;  3KW5 B;  3U52 E;  4BVU C;  4EE2 A;  3R2I A;  4TKN A;  3W1S C;  2LHE A;  2CJN A;  3VXW A;  4DHJ B;  1R4N B;  2MJ3 A;  1P7E A;  1NDD A;  3NVV A;  1RRB A;  4WAF A;  1HTO A;  4RGO S;  1FIQ A;  1QKZ A;  2JRI B;  3KUZ A;  1F2R C;  1MPE A;  2AQ2 B;  3Q14 C;  2BKR B;  2EMS A;  5EE1 A;  2KN4 A;  1VZ6 A;  3ALB A;  3W1Y A;  1WXM A;  1JML A;  2G4S A;  4FJV B;  2RGF A;  1NI2 A;  1ZDX A;  3DHI C;  3PGE A;  3ZRF A;  2IND C;  1WWT A;  1WM2 A;  3MP9 A;  3P63 A;  4IM0 A;  3U2S C;  2ZW0 A;  3BVM A;  5FK9 C;  2MHJ A;  3T8M A;  1UH6 A;  4IOI E;  4HPL B;  1WE7 A;  3HIZ A;  5G5H A;  3PVL A;  3TIX A;  1JWB D;  2D11 A;  3KVF B;  4JLC A;  3VR8 B;  1FNW A;  1NEK B;  4ZRK A;  4II2 B;  1VZ8 A;  2LHD A;  2KDM A;  1UEL A;  1Q1O A;  3AE6 B;  5IA7 A;  5IOI A;  4HKQ A;  3URY A;  3WAN A;  4QAY A;  3QA8 A;  4DDI D;  3W2D A;  3UQB A;  3KQ4 A;  3AE9 B;  3ZO5 B;  1H4R A;  1B1Z A;  2KJH B;  2IZV B;  1WXV A;  3ZYY X;  1D3Z A;  3DBH I;  2QCZ A;  3GZN B;  3QAQ A;  1SE2 A;  1ZXI A;  1L6V A;  2JVC A;  4REZ A;  3GE8 C;  3DWM A;  1YX5 B;  2JZP A;  5DCN A;  1N5X A;  2DNF A;  4LJP B;  5LLI A;  1OTR B;  2QEJ C;  2LI5 A;  3UQA A;  2KMA A;  1KTK A;  1JRU A;  4HRS A;  1TT5 B;  2L32 A;  2DX5 B;  4PS7 A;  1I7H A;  1SE9 A;  3RNG C;  1P7F A;  1KH0 A;  5BYQ A;  2D3C A;  4US8 A;  5JHB A;  4I6L B;  4MGK E;  5T8I A;  4IWQ A;  5AEK B;  4P1C C;  1UD7 A;  2RSU A;  4YTP B;  2KJR A;  4OHJ A;  1WYG A;  3DBR I;  3DHH C;  2N7E A;  4IWO A;  1K50 A;  4BBN F;  3TEZ A;  2E6X A;  1E0Z A;  2JF5 A;  3RYT A;  3S2A A;  4WJO A;  1WXA A;  3HVZ A;  2KZR A;  3RFZ B;  5JXV A;  1RYJ A;  1MJD A;  1I4X A;  3AE2 B;  2J7Q B;  3BVG A;  2QMT A;  2G1E A;  2IGH A;  1I42 A;  2LGD A;  3ONS A;  3QIJ A;  1XD3 B;  3LJ3 A;  2KWC A;  2MBO A;  3ECI A;  4K1R B;  5HG2 A;  2K6D B;  3WCQ A;  3NVY A;  1V2Y A;  3EA6 A;  4RNA A;  1CZP A;  4ZRQ A;  2PE6 B;  4MGY E;  3OG5 A;  2WXH A;  2D07 B;  2V4I B;  3AE5 B;  2L0T A;  3UIP B;  3RNB C;  1Y56 A;  2WXI A;  5DPW A;  5BMG A;  3AEB B;  2N7D A;  2M0X A;  2RDH A;  2LEK A;  1UBI A;  2WDQ B;  4MEL A;  1P98 A;  3HVD A;  2G3Q B;  4BFR A;  1E10 A;  1AW7 A;  1SGH A;  1ENF A;  1EO6 A;  4NZL B;  2WNM A;  3L10 B;  3GB1 A;  3MHS D;  2KYW A;  1TKY A;  4IKG A;  3BYT B;  1E8X A;  2K3U A;  4MJS B;  3RMK C;  5LXI B;  4OVV A;  2MBE A;  3PLV A;  1V1O A;  3MTN B;  4IC7 B;  1CK1 A;  1FXI A;  3MJW A;  1WGR A;  2M19 A;  2MJD A;  4JWS C;  1FFU A;  3ML9 A;  3HUI A;  5GMV A;  3VHT C;  2MH7 A;  1V86 A;  2K39 A;  2HD5 B;  2Y5B B;  1V97 A;  3QK0 A;  4X57 B;  3V60 A;  2LJ5 A;  4DXF A;  1VR9 A;  5LXH A;  2MEK A;  1C4P A;  1GOZ A;  3ABV B;  4DK5 A;  3AE7 B;  1E5W A;  2VH2 A;  2LGY A;  4W9I A;  3EFC A;  1I4Q A;  2BYE A;  5TSS A;  3HHM A;  4E74 A;  1VJK A;  4WJN A;  3L08 A;  2LFI A;  3KWL A;  1P9D U;  1LFD A;  5BMH A;  3SDL C;  3QC8 B;  4S0R A;  4FJZ A;  1GB4 A;  4RF1 A;  1ET6 A;  2L76 A;  4KV2 A;  3TCA A;  5HHD G;  1GPX A;  1WXS A;  3W1S A;  2LJI A;  4HVB A;  2PEA A;  1EU4 A;  1L6U A;  1Y8R C;  2GRI A;  4HEA 1;  1AAR A;  3CF6 E;  2MBB B;  2MRP A;  1HA5 A;  3P4R B;  4PK1 A;  2AEH A;  2HTM E;  1YD8 U;  3B2F A;  2DYM A;  4C4V B;  4YTN B;  4FHJ A;  4KZC A;  2M4N A;  2XEW A;  2BS4 B;  1JWM D;  1ISN A;  2RR9 A;  4K3B A;  1UWM A;  3ZNI D;  4C7Z A;  4N9F 4;  3JW0 X;  4I6N B;  2O6V A;  4EZL A;  1EU3 A;  1YOV B;  1J8C A;  2WQY B;  2LVQ A;  4BOZ B;  2AQ3 B;  2L52 A;  4A90 A;  1SSN A;  2KT7 A;  2BS3 B;  2N9K A;  3J9C A;  2CJO A;  3U7D A;  2YLM A;  4B0E A;  2PMV A;  1VCB A;  4M8N A;  3AU4 A;  2GBK A;  1XQQ A;  3PRM B;  3BVZ A;  3ZGZ A;  3V62 A;  2XNA C;  2ZEQ A;  2EMT A;  4A6Q A;  1L5P A;  4ICV A;  1C4A A;  4R3D A;  2L3Z A;  1UNS A;  4W9E A;  3MC0 B;  2O2V A;  1YNT E;  4TV3 A;  1WGY A;  4C56 C;  4HXD A;  4M8M A;  3L16 A;  1KJT A;  4E3C A;  4HCP B;  2QJL A;  3UI3 A;  4C7Y A;  4CQN A;  2WS3 B;  1TTN A;  2CHW A;  3N1X C;  2M0A A;  1SJE D;  2NMQ A;  1T0Y A;  4XZ4 A;  3QAR A;  1SIJ A;  3ZTD A;  3LB8 C;  2KJ6 A;  4W9K A;  2BYF A;  1XLN A;  1RLF A;  1J0G A;  2BW2 A;  1S3S G;  2BYV E;  4RGN A;  1TKE A;  4L1B A;  1YN3 A;  2WXK A;  3PZ8 A;  2KNB A;  2LZ6 A;  3AN1 A;  4A8X C;  1T5X D;  1WX8 A;  1F0Z A;  3Q8B A;  4GOC A;  5D3D A;  1NVI D;  4W9L A;  3ZW3 A;  2PW9 A;  4NJ6 A;  2B76 B;  1RFK A;  3IHP C;  2KQ4 X;  1V8C A;  2LRU A;  2BPS A;  4ZRP A;  2UYZ B;  1UBQ A;  4G3X B;  1QZE A;  4WWM A;  2LMC A;  4C00 A;  3ZJV A;  2DLB A;  4B0M A;  3PRP B;  2L0F A;  3AED B;  2V3P A;  2LD9 A;  3IG3 A;  1KLG D;  4PYZ A;  1YX6 B;  1YIW A;  3Q3O C;  1D6E C;  4PS8 A;  5KHO A;  1V9J A;  2MLB A;  1FNV A;  1UZX B;  2ZPY A;  1WSP A;  1VD2 A;  4A3P A;  2IO2 B;  3CWI A;  3V05 A;  4ZRJ A;  5C2T B;  3ENE A;  1EF5 A;  2KFK B;  2Y5P A;  2D3G A;  2KN5 A;  4XWW A;  5J18 A;  1T3Q A;  5BYR A;  5JZE B;  3N20 C;  1HZ5 A;  3DBL B;  3PZD A;  4IDI A;  2NBW B;  1WR6 E;  4YSY B;  1ZW7 A;  5KHQ A;  4LNK A;  3ZRC A;  2CHX A;  3TEW A;  3VRA B;  2JZZ A;  4RFB A;  4EFO A;  2KC1 A;  2XBB C;  4KGS A;  3AI5 A;  2C7M B;  3ETR A;  2DBY A;  1TS3 A;  3AEE B;  3SFE B;  4EZJ A;  1TBE A;  2LRW A;  5D2M B;  2QC8 A;  4NAW A;  1L0X B;  5D3I B;  3ZKJ C;  1LM8 B;  4MH8 A;  2GBM A;  2WU5 B;  2AL6 A;  5E6P A;  4W9C A;  1N5W A;  1OGW A;  4GDL B;  3AE8 B;  4G50 A;  4GN1 A;  1WJ6 A;  2HJ8 A;  5FR6 A;  1FRD A;  2J0M A;  3U30 A;  4KKJ A;  2PTL A;  3LXF A;  1ZPS A;  1Z2M A;  1WH3 A;  3AEG B;  3AXC A;  1E8Y A;  1FM0 D;  3KWV A;  4NAM A;  3JVZ X;  4IM2 A;  3E56 A;  3Q69 A;  3UIO B;  3ML8 A;  1HTQ A;  1VZ7 A;  2KDI A;  2PIA A;  4FHK A;  3MJ5 A;  1SIF A;  5J17 A;  3RNC C;  4OVZ A;  3DOW A;  3IAS 1;  3VFK A;  1TS2 A;  2ZNV B;  1Z5S B;  1HE8 A;  1WJU A;  4HPM B;  3KYC D;  3UGB B;  3DBS A;  2KMC A;  4AWJ A;  2BF8 B;  2INC C;  1C4C A;  1WX7 A;  4ITK A;  5JHA A;  1OQY A;  1TS4 A;  2OED A;  4HK2 A;  4XC2 A;  3APF A;  2RPQ A;  2NTT A;  2WDV B;  2QSD A;  1WGK A;  1L0V B;  2LVP A;  4G11 A;  1ZE3 D;  2N0S B;  1TZ1 A;  2LUM A;  1JWA D;  3C19 A;  1P0R A;  2MX2 A;  2M17 A;  2G45 B;  3SU8 X;  4NAW B;  3H1U A;  5J2R A;  4FUL A;  3R7Q A;  2KQ7 A;  3RNF C;  4W9F A;  4JIO U;  1WY8 A;  4RM8 A;  3C0R B;  3I3T B;  3UIN B;  3PRE A;  2PVG C;  4BOS C;  3AH7 A;  3P42 A;  4WIP A;  1NYQ A;  2FBW B;  1S1Q B;  4RF0 A;  1BT0 A;  2W9N A;  1PGX A;  3V3X A;  2VH1 A;  1MI0 A;  2EKI A;  3VAW A;  1WE6 A;  2REX A;  2N9X A;  4RH6 A;  4XX5 A;  2KFJ A;  4GIV A;  2QDF A;  1KLU D;  2RD0 A;  2LGS A;  1V1P A;  4P1B C;  4W9D A;  5IKC M;  2N7J A;  1T0Q C;  3X0W A;  1SE4 A;  3AU5 A;  3L54 A;  2IY1 B;  2WHI A;  4D2K A;  2AX5 A;  3V61 A;  2JXT A;  4BKT A;  3EFU A;  3RUI B;  2K8B A;  1WXQ A;  2IDY A;  2DWQ A;  2WXO A;  3GOE A;  4CYE A;  1FPY A;  1NI3 A;  3IXS A;  1HEZ E;  1CMX B;  1KM7 A;  2XK5 B;  4L23 A;  2DZK A;  1FCL A;  1F9J A;  3A33 B;  2WXN A;  4KSL C;  1QOB A;  4GGQ A;  4C80 A;  1GB1 A;  1YQ4 B;  2DYO A;  3LDZ E;  1KFY B;  4I6P A;  4F8C B;  4MJS A;  2KTR A;  4LLG M;  4P16 A;  1F1H A;  4NQL B;  2BTE A;  1R4N I;  1WZ3 A;  3OAW A;  2DAJ A;  2MCN B;  2OHF A;  1J7C A;  4DXA B;  2H89 B;  1TY0 A;  2QHO A;  2D3A A;  2Q5W D;  2ZNV C;  2J4X A;  1J19 A;  5IAA C;  2E3T A;  3T3N A;  3B0A A;  3E9S A;  2UU7 A;  3JYU A;  4IW0 A;  1TYG B;  5AUK A;  1EWC A;  1KRH A;  3EHV A;  1T6B X;  1HZ6 A;  4GB9 A;  1L2N A;  1QOF A;  2BS2 B;  5AZG A;  4DDG D;  3OJ4 B;  3PV1 A;  4FBJ B;  4BAX A;  1AWD A;  1K52 A;  4H2A A;  3DVG X;  4WAA A;  2BWE S;  1V1P B;  4CO7 A;  4DHZ B;  4B95 A;  4PT5 A;  2PPH A;  4MSQ B;  2IO1 B;  3TJP A;  3AE4 B;  1KF6 B;  4EOY A;  4LNF A;  3VTW A;  2IJ0 A;  5TR5 A;  4XE0 A;  4W9H A;  3IFW B;  3RNE C;  5EE9 A;  4ANV A;  3L17 A;  3MHZ A;  3QJZ A;  1GC7 A;  2GBJ A;  2WGS A;  3QHT A;  5CX3 A;  1VLB A;  3H9D A;  2DZI A;  4AJW A;  3VUW A;  4N59 A;  2DHZ A;  2N1W A;  1BML C;  1FEH A;  4M02 A;  2J52 A;  4A55 A;  1FMA D;  1ZUD 2;  3JSV B;  1E7P B;  2GLS A;  2C7N B;  3QQ8 B;  1PYW D;  4HKZ E;  2IO0 B;  4YXD B; 
#chains in the Genus database with same CATH homology
 4YTM B;  2RMM A;  3IT4 B;  3NVW A;  4A9A A;  1C78 A;  2BS3 B;  2GB1 A;  3Q8A A;  1YJJ A;  2N9K A;  3J9C A;  2CJO A;  3BII D;  2QIE B;  1FD6 A;  4B0E A;  4JWU C;  2PMV A;  1D5Z C;  2N9L A;  1L0Y B;  1HQR D;  3BVZ A;  3KLS X;  3ZGZ A;  1N60 A;  4TMA B;  2XNA C;  3IAM 1;  4A6Q A;  1L5P A;  1C4A A;  3PO0 A;  2JWU A;  2MJE A;  2I38 A;  2KAJ A;  1UNS A;  2FUG 1;  2M56 B;  2NTS A;  3FC4 A;  1QF6 A;  3MC0 B;  1YNT E;  1FFV A;  1CJE A;  1HXY D;  2RDG A;  5D7G A;  2WP9 B;  4C56 C;  4DQO C;  2WXJ A;  1QLB B;  1D5X C;  1SEB D;  1FCC C;  2QJL A;  3UI3 A;  4C7Y A;  4CQN A;  2WS3 B;  4LTU A;  4TQ0 A;  2M0A A;  1MVK A;  1ACC A;  1SJE D;  2NMQ A;  3N9Y C;  3ZJT A;  3Q8F A;  1NYR A;  1SIJ A;  1DGJ A;  1IGD A;  3LB8 C;  1A70 A;  2JU6 X;  1VDV A;  2W54 A;  3FIL A;  3O13 A;  1C9F A;  5GXG B;  1XLN A;  4ZOH C;  2YEP F;  3TUO A;  3ZJU A;  2BB6 A;  3MFG A;  2BW2 A;  4YXD B;  1DYQ A;  4RGN A;  1I4P A;  1I4R A;  2BT6 A;  3SFD B;  1TKE A;  1SB3 C;  4L1B A;  2ACZ B;  1YN3 A;  2WXR A;  2WXK A;  4OZC A;  1OQR A;  1SBB B;  5MPO A;  1TKG A;  1FRR A;  3PZ8 A;  3U52 E;  3AN1 A;  4A8X C;  1T5X D;  4EE2 A;  1NEN B;  1F0Z A;  3Q8B A;  3R2I A;  3R8B A;  5D3D A;  3AE3 B;  1NVI D;  3VR9 B;  3RPF C;  2LHE A;  1R7S A;  2PW9 A;  3ZQ4 A;  2CJN A;  2B76 B;  1ET9 A;  1RFK A;  5H8Y E;  2MJ3 A;  2KQ4 X;  1V8C A;  4MAC A;  1P7E A;  4L2Y A;  4OZB A;  3NVV A;  4WAF A;  4ZRP A;  3NZ3 A;  1DOY A;  1QOA A;  2H88 B;  1QQR A;  1XXG A;  1FIQ A;  1QKZ A;  2J42 A;  4RGO S;  4WWM A;  2LMC A;  3ZJV A;  4ARI A;  2DLB A;  3T3O A;  1F2R C;  2VZK D;  4B0M A;  1MPE A;  4N6E B;  2AQ2 B;  3AED B;  2V3P A;  2V3N A;  1JQ4 A;  1KLG D;  5BYS A;  4ZHP A;  5EE1 A;  1D6E C;  1XLP A;  2KN4 A;  1UGJ A;  4GDK B;  1VZ6 A;  5EE3 A;  1TZO A;  1XF5 L;  1IBX A;  1JML A;  1FNV A;  1WSP A;  1ZDX A;  2K5P A;  1WWT A;  3MP9 A;  3P63 A;  3DWG C;  2RPV A;  3CWI A;  3U2S C;  4UDU C;  4RCO A;  1DOI A;  3V05 A;  2ZW0 A;  3BVM A;  5FK9 C;  5C2T B;  3VQI A;  1F77 A;  2Y5P A;  1M4V A;  4XWW A;  2I2Y A;  1MHH E;  1T3Q A;  4IOI E;  5BYR A;  1HZ5 A;  5G5H A;  4IDI A;  4J3O D;  1JWB D;  2WXG A;  2QIL A;  4YSY B;  3VR8 B;  5HI1 A;  1FNW A;  2SAK A;  1NEK B;  1PDX A;  4MM3 B;  3TEW A;  3VRA B;  4TQ1 A;  1VZ8 A;  2LHD A;  4RFB A;  2KDM A;  3W5U B;  4KGS A;  3TEX A;  3AE6 B;  1CQV A;  3ETR A;  1JWS D;  2DBY A;  3CIR B;  2KAC A;  1TS3 A;  3AEE B;  3SFE B;  3URY A;  2TSS A;  3B9J A;  1XLQ A;  4HKQ A;  5BMI A;  4LK0 M;  1L4Z B;  3W2D A;  3KQ4 A;  1QT9 A;  3AE9 B;  1L0X B;  5D3I B;  1B1Z A;  1QIL A;  4WQM A;  1JW9 D;  2W82 A;  3ZYY X;  4MH8 A;  4XDC A;  2KWD A;  2WU5 B;  2ON8 A;  2W55 A;  1N5W A;  4GDL B;  3AE8 B;  2IGG A;  1FRD A;  4AQ7 A;  1SE2 A;  3B2G A;  2KMM A;  1AYF A;  4KKJ A;  1ZXI A;  2PTL A;  1YQ3 B;  1L6V A;  1ZPS A;  3LXF A;  4REZ A;  1PGA A;  3AEG B;  3DWM A;  2JZP A;  1N5X A;  1FM0 D;  4OW0 A;  3KWV A;  4NAM A;  2JYE A;  1UUP A;  3E56 A;  3Q69 A;  2QEJ C;  3Q8E A;  5EE0 A;  1PFD A;  4MT5 A;  1IBX B;  1VZ7 A;  2INN E;  2PIA A;  3TSS A;  1KTK A;  4WUR A;  1XEE A;  3PZ7 A;  3MJ5 A;  1JRP A;  1SXT A;  3Q8C A;  4HRS A;  4OVZ A;  2L32 A;  3IAS 1;  1I7H A;  1TS2 A;  2K9X A;  3P4Q B;  1BUI C;  2L83 A;  1SF0 A;  3NUH B;  1P7F A;  1XCQ L;  3BYY B;  1KH0 A;  3AE1 B;  5BYQ A;  4US8 A;  3GS2 A;  3W5V B;  1DOX A;  1C4C A;  4YWG G;  2JX5 A;  5T8I A;  4ITK A;  1ZOY B;  1TS4 A;  3AEF B;  2OED A;  1VRA B;  4YTP B;  2Z8L A;  4OHJ A;  1WYG A;  2NTT A;  3HRD D;  2WDV B;  2QSD A;  1WGK A;  3H8H A;  1L0V B;  1K50 A;  1ZE3 D;  3TEZ A;  2N0S B;  2E6X A;  2WXF A;  3GP7 A;  1E0Z A;  5I4D A;  2WXL A;  2LUM A;  4RGT A;  1JWA D;  3HVZ A;  4YT0 B;  1ROE A;  3RFZ B;  5JXV A;  1RYJ A;  2GI9 A;  4RGM A;  1ZP0 B;  2ONQ A;  1I4X A;  1J7B A;  4YSZ B;  1GAQ B;  3AE2 B;  3BVG A;  4NAW B;  2QMT A;  1ZXH A;  2G1E A;  2IGH A;  2WXP A;  3P1M A;  2WDR B;  2WLB A;  3P4S B;  2W3S A;  4JE3 B;  5HG2 A;  4WH4 A;  4XDD A;  3WCQ A;  2HDE A;  1BXT A;  1Q10 A;  3NVY A;  4JX1 C;  2ICI A;  3W9C B;  3EA6 A;  4RNA A;  1CZP A;  4ZRQ A;  1JAL A;  2WXH A;  1FO4 A;  2V4I B;  3AE5 B;  2K0P A;  4TSS A;  1EWY C;  2XN9 C;  3NS1 A;  2JSV X;  2PVG C;  1UWX A;  1Y56 A;  2WXI A;  2IPK D;  2K22 A;  3AH7 A;  1XCT L;  3LYY A;  3P42 A;  1NYQ A;  1ESF A;  2FBW B;  3AEB B;  4NJC A;  4WIP A;  5BMG A;  2RDH A;  5G5G A;  4RF0 A;  2L1A A;  2LEK A;  2WDQ B;  3HVD A;  2JQR B;  5HFY A;  1E10 A;  1AW7 A;  1B9R A;  3V3X A;  1PGX A;  2WU2 B;  1STE A;  1ENF A;  1MI0 A;  2EKI A;  3AEA B;  4NZL B;  3BK2 A;  1J7A A;  4XWT A;  2WNM A;  3GB1 A;  3U4E G;  1TKY A;  2Y3A A;  1EM7 A;  3NRZ A;  1K53 A;  4RH6 A;  4IKG A;  3SEB A;  3BYT B;  2IGD A;  3VRB B;  1D4B A;  2K3U A;  3C8Y A;  2AQ1 B;  1TS5 A;  5E6J A;  1KLU D;  5C3J B;  1V1P A;  2CU3 A;  1V1O A;  1JRO A;  3AB5 A;  3OWE B;  2N7J A;  1JCK B;  1CK1 A;  1FXI A;  5FKA C;  1N62 A;  1SE4 A;  3BWU D;  4AS1 A;  2M19 A;  1YN4 A;  4ZYS A;  2FE8 A;  2MJD A;  4D2K A;  2JYT A;  2AX5 A;  2BB5 A;  2LGI A;  1ZDV A;  3FAH A;  2JXT A;  4JWS C;  3BK1 A;  1TY2 A;  1FFU A;  1FNU A;  1WXQ A;  2IDY A;  3U7Z A;  3HUI A;  3AV8 A;  1K51 A;  3R2T A;  2DWQ A;  2WXO A;  1C79 A;  2MH7 A;  2PKO A;  2PVO D;  3IXS A;  1NI3 A;  3I9V 1;  1HEZ E;  4OZA A;  4KGT A;  4DXG A;  3L4P A;  4L23 A;  1L4D B;  1F2R I;  2WXQ A;  2X38 A;  1FCL A;  3AEC B;  1IUE A;  1V97 A;  2VZK B;  3IT6 B;  2WXN A;  2PLP A;  4DXF A;  1QOB A;  1VR9 A;  2R61 A;  4C80 A;  1GB1 A;  1YQ4 B;  2MEK A;  4ZHO A;  2BYT A;  1RWS A;  1C4P A;  1FXA A;  1GOZ A;  1KFY B;  2D5G A;  2DYO A;  3ABV B;  3AE7 B;  1IGC A;  2G9H D;  4FXC A;  1SJH D;  4LLG M;  4P16 A;  1I4H A;  1I4G A;  4Q2J A;  3SR6 A;  4GLS C;  1C76 A;  4ARC A;  1SE3 A;  1I4Q A;  2BTE A;  3NVZ A;  5TSS A;  5LNK 1;  1OQQ A;  1JWU D;  2OHF A;  1J7C A;  1VJK A;  1N61 A;  4JPS A;  1WRI A;  2H89 B;  1TY0 A;  2YEP B;  1AN8 A;  1YMH E;  2Q5W D;  2LFI A;  3KWL A;  2BBC A;  3AM9 A;  5FR3 A;  1XO3 A;  2J4X A;  1XLO A;  5BMH A;  4O1N A;  2E3T A;  3T3N A;  1GB4 A;  3E9S A;  2ZW1 A;  2WXM A;  5AUI A;  1E6E B;  1TYG B;  4RF1 A;  4KGR A;  1ET6 A;  4USA A;  1EWC A;  1C77 A;  1KRH A;  5AUK A;  1T6B X;  1HZ6 A;  1TJE A;  1QOF A;  4P6V F;  2BS2 B;  4R3D A;  1E9M A;  5HHD G;  1D5M C;  1AWD A;  1GPX A;  3W1S A;  3AMZ A;  4YSX B;  1K52 A;  4H2A A;  2LJI A;  4US9 A;  1V1P B;  3EGR A;  2INP E;  4PT5 A;  3P4P B;  4KKI A;  3BZD B;  1EU4 A;  1L6U A;  3EUB 2;  3AE4 B;  1KF6 B;  2GRI A;  4HEA 1;  4N58 A;  2IJ0 A;  2Y5C A;  4XE0 A;  2W3R A;  1HA5 A;  5EE9 A;  3P4R B;  3TEY A;  2V0G A;  4HRO A;  1OFF A;  2SEB D;  1PGB A;  3MHZ A;  1MHX A;  2HTM E;  4HJG E;  1VLB A;  1QOG A;  3B2F A;  1LO5 D;  4N59 A;  1PUT A;  1RM6 C;  1BML C;  2DYM A;  1FEH A;  4YTN B;  1N63 A;  2BS4 B;  1YN5 A;  1JWM D;  2J52 A;  1YJI A;  4A55 A;  1UWM A;  4C7Z A;  1FMA D;  1ZUD 2;  2J53 A;  2EEL A;  5H92 C;  1E7P B;  1EU3 A;  4KX6 B;  4M0W A;  3FIL B;  2WQY B;  1PYW D;  3I57 A;  4HKZ E;  2AQ3 B;  2L52 A;  4A90 A;  1SSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...