1JWAD

Structure of the atp-bound moeb-moad protein complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
publication title Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 16
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2001-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwaD00
2CJOA 3AEDB 1E6EB 4C7YA 1JRPA 5EE0A 4HROA 2AX5A 1FXIA 1VDVA 1QF6A 3P4RB 1J7CA 2DBYA 2L52A 1EWYC 1QLBB 1XLOA 3B2FA 3SR6A 3AE3B 3HRDD 4C7ZA 3P1MA 2Y5CA 3W5VB 2W3SA 4N6EB 3AE4B 1NENB 4ZOHC 1NYRA 1SIJA 3VR9B 2B76B 3NS1A 3W9CB 1DOYA 1F0ZA 3VRBB 2MH7A 2ACZB 1XO3A 3AECB 4ITKA 4JWUC 3ZYYX 1YQ3B 3AB5A 2N0SB 3AM9A 1JALA 3CWIA 2BS2B 3AN1A 1PUTA 2W54A 3VRAB 3B2GA 3HUIA 1QOFA 2BS3B 1UWMA 3L4PA 3ABVB 4YSZB 1N61A 3RPFC 1KRHA 2G1EA 1XLQA 4JX1C 1JROA 1OQRA 3P4QB 1A70A 1NI3A 3AE5B 2MJEA 1FO4A 2M56B 2E3TA 4WWMA 4LTUA 1L0VB 1SF0A 2DWQA 2FBWB 3LB8C 4US8A 2K5PA 3AE1B 4USAA 3EUB2 1RWSA 2KMMA 1J7BA 3NVYA 1TYGB 2H88B 4YSYB 1AWDA 1XLNA 5G5GA 1PFDA 2BT6A 1J7AA 2BS4B 2PVOD 5C2TB 4A9AA 2LEKA 3P4PB 3VR8B 4YTMB 1TKGA 1V97A 3AMZA 4JWSC 1RYJA 1RFKA 4WQMA 3NRZA 1QOAA 1TJEA 3FAHA 4P6VF 2W55A 3FC4A 4YXDB 1YJJA 3BIID 3AE6B 3AEFB 4N58A 1WXQA 1E0ZA 1WRIA 1E7PB 1NVID 1N5WA 1FXAA 1T3QA 1VJKA 2Q5WD 2WLBA 2WP9B 4FXCA 2WU2B 5AUIA 1E10A 3LXFA 1JQ4A 3KWLA 1XLPA 2PKOA 3AV8A 1E9MA 1N63A 3P63A 1JWAD 1JW9D 2L83A 5EE9A 4YT0B 1IUEA 3AEEB 1RM6C 2M19A 1N60A 1CJEA 1WYGA 1GPXA 1ZOYB 1KF6B 1TKYA 2CU3A 2MJDA 3CIRB 1NEKB 1ZP0B 5AUKA 2KAJA 3AE9B 3PO0A 1WGKA 5GXGB 2WDQB 1VLBA 3NVVA 1OQQA 2MJ3A 1AYFA 3AE7B 1L6UA 5EE1A 3WCQA 4C80A 1CZPA 1TKEA 3SFDB 1N5XA 4YTNB 1OFFA 5H8YE 3B9JA 1YJIA 3W5UB 2WS3B 2W3RA 1JWBD 3AEGB 1QOGA 3NVWA 3DWMA 1ZUD2 1DGJA 4YSXB 4IDIA 5MPOA 3NVZA 1PDXA 1FM0D 2WQYB 3AE2B 2PIAA 2WDRB 3P4SB 1QOBA 2JQRB 3AE8B 1WWTA 4YTPB 1R7SA 3AEAB 4KX6B 5H92C 2OHFA 1DOXA 1I7HA 1QT9A 1V8CA 1FMAD 1FRDA 1FIQA 1SB3C 4US9A 2K22A 2PVGC 3HVZA 3ETRA 2K9XA 3AEBB 4ZHPA 2EKIA 1NYQA 2H89B 1GAQB 2CJNA 4ZHOA 1N62A 1FFVA 5C3JB 1B9RA 2WU5B 5EE3A 1DOIA 2HTME 4HRSA 1L6VA 2QJLA 5G5HA 1FRRA 3SFEB 1YQ4B 3AH7A 1L5PA 2WDVB 4N59A 1FFUA 1ROEA 1KFYB 3DWGC 2QIEB 1ZXIA 2JX5A
chains in the Genus database with same CATH superfamily
3R2TA 4C56C 1E8ZA 4ANUA 3KYCD 1VDVA 1J7CA 4FJVB 1YMHE 1OEYJ 4N6EB 4DHJB 4NJ6A 2NPTB 4Q2JA 2O6VD 2L0TA 1RAXA 3AECB 2X8XX 2JRIB 2LASA 4WJNA 3URYA 3HUIA 1TGZB 2GBMA 2PMVA 1JROA 2RDBC 3OWEB 4P1CC 1HE8A 2KANA 2MJEA 4WURA 3RN9C 4DBGA 1C3TA 3EUB2 1S3SG 1WFYA 4BBNF 4ZYSA 1WRDB 2WXNA 1TS3A 4P6VF 2XN9C 1EWCA 2LJ5A 2DZMA 2KQSA 3KH0A 5GMVA 2L00B 3RNFC 2QMTA 5E6OA 2G4SA 1FNVA 2D11A 3V3XA 1I4QA 1KF6B 3BK1A 3OAWA 1KJTA 1T0YA 4JQWC 1ET6A 3NVVA 4LLGM 3A9KB 1AYFA 2JU6X 1MJDA 2I38A 1VR9A 4RMAA 3ZNID 2WDTB 4YTPB 3P2BA 1QZEA 4I6NB 2HDEA 4US9A 4PS7A 1JWUD 3AEBB 4G50A 2H89B 2MBOA 2WU5B 4HRSA 2QCZA 2V9HA 3H7PB 2ZPYA 5LXHA 3DQVA 3Q14C 1LM8B 2GBRA 2XNAC 1XLOA 1WXSA 4DXGA 4W9LA 2A4ZA 1NENB 2CS4A 1XEEA 2INDC 3ZYYX 3CWIA 4GN1A 2BS3B 3ECIA 3EGRA 2WHIA 2JF5A 4E71A 3R2IA 3W2DA 1V1PA 4GDLA 5KHOA 1EU4A 1GC6A 1EF1A 1YJ1A 3ZRCA 1YN5A 2KMMA 5D2MB 4FA6A 1UGMA 3UGBB 4GDKB 2KQ7A 2MBEA 3U4EG 3FC4A 1WGYA 2LVPA 1VJKA 3GP7A 4HLEA 4LNOA 2FUG1 1IUEA 4XWTA 1Q5WB 2BKRB 3ONSA 1T0RC 4BKGA 3I63C 5AUKA 3VQIA 2AQ2B 3L54A 1SBBB 3SEBA 2IDYA 5HFYA 2MJ3A 4PS3A 1P7EA 4NY0A 4NJ7A 1WMHB 3B9JA 1AARA 2W3RA 4DHZB 4IM3A 3P42A 3ZNGC 1IYFA 4EFOA 3K9OB 1T6BX 3AEAB 2IO0B 2K1FA 1WZ0A 2CJNA 3H9DA 2BQQA 2A5UA 1D5ZC 2PEAA 4HK2A 1V6EA 2KACA 5AZFA 3VUYA 1WGRA 4XC2A 3V62A 5IP4D 2D3GA 2CKHB 3BWUD 1WR1A 2KK8A 1YN3A 3P1MA 2LRUA 3TSSA 4YWGG 4MM3B 2N1WA 5J18A 1PYWD 3AM9A 2Z8LA 4RM8A 1F2RC 4IKGA 3B0AA 4EZLA 1GB4A 4WIPA 2J0MA 2XK5B 1Q10A 2ZVNA 5BYRA 2NTTA 4USAA 2ASQA 2RR9A 1XLNA 1E8YA 2AQ3B 1WI0A 1WM3A 1RYJA 1P3QU 1WGGA 4LNNA 3NRZA 1XXGA 1QOAA 4M0WA 3V60A 1K8RB 4ANXA 3ZO5B 3AEFB 3C0RB 4LK0M 3PHWB 4WH4A 1KOTA 2DAFA 2B3AA 4EZKA 3DVNU 1FNWA 2HE7A 1JWAD 1Y8RC 4YT0B 1ENFA 3APCA 3DDCB 3Q3OC 3CIRB 3V6CB 2K3UA 5EE1A 3ZNZB 1NDDA 4MJSA 3W1SC 4MH8A 2D3CA 1E7UA 3DBLB 3W5UB 5IN7A 3RD2A 1WGHA 2YVCA 2C60A 4X57B 2BB5A 2NPTA 3JYUA 3GB1A 3DCGA 3PS6A 2BPSA 5J17A 2WXHA 4WJQA 4MACA 4RFBA 2W9NA 4S17A 1FRRA 3IAS1 1TS5A 2LD9A 4K1RB 4N59A 3UF8A 4EUTA 2QIEB 2JX5A 4FJYA 1WJNA 2L52A 4G11A 3RMKC 4WWOA 1TS4A 5LXIB 4A20A 2ONQA 1SIFA 4KKJA 3QAQA 1K52A 4CHKA 2BS2B 3AU4A 2ZW0A 2CU1A 3N1XC 3ENEA 2N1VA 4XGAB 2KMAA 1D5XC 2IJ0A 4TQ1A 2MHJA 1TZ1A 3RNCC 1SJED 3AE1B 3A9KA 2JVCA 3AULA 2MCNB 2KVZA 1XD3B 1GOZA 4WQMA 1TJEA 1ZXHA 2LGYA 1LO5D 3AE6B 4A55A 2WXKA 1XQQA 4XYCA 3A4SC 3KWLA 1C76A 3RFZB 5DPRA 2DAJA 2KDBA 3QHTA 5EE9A 1NI2A 5G55A 2MJDA 1LFDA 2N7DA 3N1ZC 3I5JC 2KOXA 3H7PA 3KUZA 4OVZA 3KQ4A 1C78A 1SXTA 4C80A 1TKEA 3TEWA 3RNBC 1I4RA 5MPOA 1C77A 2PIAA 1NBFC 1YIWA 2KYWA 4G0NB 1ZDVA 4KX6B 5H92C 4NNJB 4OZAA 3OJ3A 4ZHPA 4II2B 3E9SA 2RPVA 4N9F4 4F1SA 4LNIA 1L5PA 3VH4B 3NOBA 1WX9A 2N9EB 3QK0A 1ZXIA 4PYUA 4XWWA 1E6EB 1KTKA 2JWUA 2AX5A 1RFAA 4A3PA 3B2FA 4TV3A 3HRDD 1QILA 4GDKA 3RNGC 3W1SA 3VAWA 2JYEA 3VR9B 1DOYA 1GC7A 1Q0WB 3EHVA 1LXDA 2ACZB 3L17A 3RNAC 4HKQA 1FCCC 3VH3B 3V05A 3GS2A 4LJOB 3B2GA 2BWES 5EDSA 3MJ5A 5E6PA 1A70A 1J19A 2MBHA 3BYYB 4OHJA 2NVUI 4GB9A 1V49A 1PGAA 2KZRA 4US8A 1C1YB 1PFDA 1J7AA 4KIKB 1WMHA 4FULA 1T5XD 2J4XA 4B0EA 1B1ZA 3SD5A 5JHBA 3RUIB 1E10A 4JL9A 2WGSA 4K7SA 3AV8A 1P7FA 2HJ1A 4RH6A 1RM6C 1YX6B 4HWIB 3KUDB 1RLFA 2FNJB 4W9DA 4L1BA 3VUWA 1KLVA 3AE7B 4II3B 3QC8B 4BKTA 2M17A 2G45B 5JHAA 3IFWB 4FBJB 4HEA1 3Q3JA 3NVWA 2LUMA 5L95C 2UYZB 1WYWB 4CYEA 4DXAB 4MM3A 3RT3B 3AE8B 2MA9B 2RD0A 2ZVOA 2Z59B 3HVZA 3TMPB 1C9FA 4KKIA 5IKCM 2IYDB 4ANVA 2N7JA 1U4AA 4ZHOA 3SFEB 2QJLA 4MSMB 2C7MB 3T3NA 1HTOA 3N32A 2C7HA 2XK5A 2QC8A 2KFJA 3B1LX 4NZLB 4TQ0A 2CJOA 2GI9A 3HIZA 3T9LA 4GSWA 2ZZPB 4ICUA 3B08A 3AE3B 4MGZE 2BKFA 2DZKA 3VRBB 1PGBA 2G9HD 4LNKA 3VRAB 2HJ8A 2MBQA 3O65B 2MSED 4NAMA 3SDLC 3TIXA 3ZLZA 4NAWB 4RGTA 4AJYB 4OVVA 1E8XA 5G5GA 4MGKE 5HHDG 3PRMB 4HKZE 3V6EB 1MVKA 2LXCA 1GJZA 1TY2A 3JVZX 2NS5A 1E0ZA 1CK1A 2KMCA 4MT5A 1A5RA 2C5LC 3FKYA 1UF0A 4BKSD 5HI1A 1OGWA 4WAAA 2W82A 4KGRA 1R4MI 1WE7A 1F77A 2FAZA 4JIOU 2BGFA 4ASWC 3QA8A 5GXGB 2Z0DB 3ZRFA 3DHGC 1OQQA 5IA7A 4TMAB 2PW9A 4WJOA 3M63B 1D6EC 2MQJA 2ZEQA 2V0GA 3NY5A 1D3ZA 2R2QA 2WX1A 1JWBD 3AEGB 4B9KA 2N9KA 3RZWC 4M8MA 2D3AA 2WDRB 4ZDVA 1J8CA 3L0WB 5L83A 4DDGD 4H2AA 1D5MC 1L6VA 2DYMA 5KHQA 2V3NA 1SE9A 4S0RA 1WX7A 4ANWA 5D6JB 3WAMA 4QAYA 4KSLC 2GLSA 4DXFA 2C7NB 2W3SA 2BWFA 2CHWA 3W9CB 2VH2A 4FHJA 5D3DA 3ZJUA 2N7EA 1WIAA 5TR5A 3TEXA 3ZIMA 3IXSA 3SU8X 2ZPNA 3GZNI 5IOIA 1WE6A 1N61A 4FJZA 4MELA 1KRHA 5DPSA 3RPFC 1BUIC 3NUHB 3AE5B 3PHXB 5CHFA 1Z5SB 2IGDA 2E3TA 2KLCA 4XX5A 2FBWB 4LJPB 1L4DB 2KO3A 1J7BA 2JWZA 1ZGUB 1FCLA 5FKAC 3KYDD 1LGRA 3X23A 2JUOA 3VTUA 2KLGA 1C79A 1FXAA 3FILB 1XLPA 1ZW7A 1YNTE 3EFUA 1C4PA 3WALA 1IBXB 3E56A 1VRAB 1ZKHA 1EUVB 2DYOA 2MWSB 1TKYA 3BYTB 3IVFA 1WZ3A 3AE9B 2X38A 4NQKE 4J6IA 4CQNA 4NJCA 1N5XA 1TY0A 1OFFA 4TSSA 4NQLB 4LDTD 3KVFB 3ZJTA 3DWMA 4KSKC 1TIFA 2PJHA 3AE2B 3CSTA 4W9CA 2KN5A 4IG7B 1R7SA 1DOXA 1FMAD 1FRDA 3R3MA 2EKIA 4RGOS 2JSVX 3Q6BA 3UQBA 3U7ZA 4JGHB 1ESFA 4MH0E 4OVUA 3EA6A 2QHOA 2WX0A 2MBBB 2G3QB 2KNBA 2KWVB 1EWYC 4KIKA 3W5VB 4GLSC 3AE4B 1JWSD 1JMLA 2O6VB 4O1NA 4IUMB 3NHEB 1L0YB 1V2YA 2K8BA 2KDIA 3ZTCA 3VFKA 4KV2A 4OZBA 4B95A 2V3SA 2NMQA 4P16A 4XZ4A 2KD0A 2VRRB 4W9JA 3A33B 4C4VB 1IPGA 1L0VB 1EO6A 5I4DA 4EE2A 4YSYB 3HHMA 2LXAA 2BT6A 4OZCA 4W9GA 2AWTA 2L8JA 3FAHA 1QQRA 2DX5B 2VH1A 1E7VA 1WRIA 1NVID 3A9JB 2Q5WD 1H8CA 4FXCA 1L0XB 4ARCA 3PT2B 2LGDA 1WJUA 1N63A 2I1JA 4HJKA 3KW5B 1GG3A 3L08A 3N9YC 3BK2A 3Q3NC 1YN4A 1GPXA 4R3DA 1TT5B 3PRPB 3WIMA 2MLBA 1UGJA 3DVGX 2Y5PA 3WCQA 3IT6B 2IO3B 3L10B 2LRWA 3MFGA 4PYZA 2HD5B 4CO7A 2PE9A 2WS3B 4ACFA 3NZUA 1V5TA 3QX1A 4HXDA 4K7UA 1UELA 1FM0D 1BT0A 2WXLA 2KJHB 2BYFA 3PV1A 2JQRB 3Q69A 1N6ZA 4ZRPA 5AEKB 4JLCA 1MG8A 1HZ5A 3PPAA 1SJHD 5EE3A 4GMVA 3VDZA 5JZEB 2GBJA 1IP9A 5FK9C 1UD7A 4EEWA 3MC0B 4B0MA 4K81A 2KJRA 4HCNB 4NAWA 3PLUA 5D3IB 1QF6A 3NJTA 2L7RA 2IBIB 3BVZA 3J9CA 2MEKA 4ZOHC 4HCPB 3MP9A 5D7GA 3DBRB 2FUHB 3ZXRA 4K7WA 4I6LB 1C4AA 3AN1A 4KZCA 3HVDA 4YSZB 1R4NB 2G1EA 1Y56A 2JPHA 1F52A 1IGCA 1H4RA 4W9EA 1UH6A 1HTQA 2DWQA 2J52A 3NG0A 1DYQA 2LZ6A 2L3ZA 1TKGA 4AP4C 1JWMD 3HM6X 3PGEA 2PLPA 3A1QB 2L0FA 3QIJA 4BFRA 1VD2A 2QILA 4AOFA 2KJ6A 2JZ3B 3N30A 1I4XA 1KM7A 1ZP0B 3PO0A 1WGKA 2QDFA 4WAFA 3UQAA 4W9FA 3UIOB 3M95A 2SAKA 1OQYA 4HVBA 3AI5A 3TUOA 3JSVB 2K8HA 5J2RA 2RSUA 1CQVA 3ETRA 4E74A 3VHTC 2QEJC 4A90A 3ZDMC 2RGFA 1N62A 2M8SA 3DBHB 2ZCBA 3ZGZA 3BZDB 1FFUA 3KWVA 3RCZA 2KVRA 4JX1C 5D94A 1S1QB 1HZ6A 3HM3A 2JXTA 1QLBB 1K53A 2LHDA 4DHJD 2D10A 2GB1A 2BTEA 2MH7A 4KDIC 3DBSA 3FILA 3MJWA 4ARIA 5CX3A 4IM2A 2NTSA 3LYYA 3DBLI 1IBXA 3I57A 2JY6A 4WWMA 4MGIE 1TZOA 4DQOC 2IGGA 1RWSA 1STEA 2DENB 3DHHC 3NVYA 3H7SA 1VZ8A 1D4BA 1SEBD 1UUPA 2D07B 3S2AA 2D3BA 2J42A 3APFA 4HDOA 3RULA 3BIID 2BB6A 1ET9A 4N58A 1E9MA 3P63A 4XDDA 2L83A 4E3CA 1PGXA 1VZ6A 3N20C 1ZDXA 3Q3FA 1V81A 2FIDA 1HXYD 1EU3A 1AN8A 1L6UA 5CTRC 4YTNB 2GMIC 5H8YE 2IPKD 2V4LA 4PT5A 1DGJA 3IBEA 3QQ8B 3ZDTA 4KGSA 1FXTB 2WQYB 2O6VA 2INPE 2EMSA 2WXOA 2MRPA 4J3OD 3DPDA 3PLVA 1FFVA 1F1HA 2EKEC 4BKSA 4C4VA 1V1OA 3AH7A 2WDVB 1ROEA 2KXJA 3AXCA 1UBQA 4KZ0A 1WF9A 1SSNA 1BMLC 3P4RB 4L23A 2UU7A 4MEMA 1V86A 4EKUA 2B76B 3AU5A 4GOCA 1FNUA 4ITKA 3A9JA 4RGNA 4RM9A 1FPYA 1WR6E 1WJ6A 1EF5A 2IO2B 1OQRA 1G6JA 4ZRQA 1WXVA 2JRHA 4GXBA 4GU2A 3IHPC 3LB8C 4IWOA 3R7RA 1AWDA 2JT4B 3TCAA 3GE3C 4ZRJA 1WGDA 2J0JA 1YJJA 2CHZA 1V9JA 1WXQA 3VTVA 5C1ZA 1MHHE 3LXFA 1BXTA 2PKOA 3KUCB 1YD8U 1YOVB 2O2VB 4M00A 4FHKA 3H1UA 2CU3A 3ZW3A 1XT9B 2G4DB 2MP2B 1TBEA 2WDQB 3WAOA 3U8ZA 3I3TB 2FIFA 3VXWA 2YEPB 2WXRA 4GIVA 3MC8A 2N9PC 3BY4B 2ZCCA 1V80A 2JXXA 4REZA 4IDIA 4EOYA 5LLIA 3DVNV 3NZSA 2NBWB 2WXGA 2OHFA 3LJ3A 1I42A 1I7HA 5TSSA 5BMGA 2K22A 4G3XB 2ZNVB 3CMMB 2GOWA 1DOIA 1ACCA 3O13A 2VZKD 5AZGA 1SGHA 1YQ4B 3Q8FA 3R7QA 2RMMA 3DWGC 2NBVB 3NZ3A 4A8XC 1WY8A 4ICVA 1FXIA 1Z2MA 2DNFA 2IY1B 4C7ZA 2KWUB 1PQSA 2ICIA 5CHVC 3A1QA 1WH3A 3R8BA 4HDQA 1XO3A 1SE4A 2SEBD 1JALA 1PUTA 1UWXA 1OEYA 2INNE 2NBUA 4RF1A 3Q8CA 2IZVB 3ZVVA 2N4FA 4M02A 3PREA 2N9XA 3OJ4B 5T8IA 1SF0A 3UINB 4L2YA 2FCNA 5E6NA 1L4ZB 2CHXA 2I2YA 1GNUA 3L13A 4YTMB 2K0PA 3AMZA 1JCKB 4JWSC 3Q8EA 2LVQA 5HG2A 3PTFC 2EELA 3JSVA 1JQ4A 2WU2B 2JZZA 4FADA 4W9KA 4DDID 3AEEB 2NR2A 1M4VA 1N60A 4DK5A 3K9PB 4M01A 4WQOB 1XCQL 2K39A 1E90A 2GRIA 3H6NA 4MGYE 1CZPA 1YQBA 3HK0A 1YJIA 3ALBA 1SE3A 2GBKA 2AYOB 4W9IA 3ZKJC 3M3JA 3ZNHB 3EC8A 4K3CA 4MSQB 1QOBA 2TSSA 3WANA 2LGSA 4RF0A 2AQ1B 1RRBA 2ON8A 2PVGC 2YLMA 2K9XA 2REXA 5JH5C 1P98A 3I9V1 1GAQB 5BMHA 2BVCA 3PZDA 4DWFA 5C3JB 1B9RA 2HTHA 5G5HA 3QWZB 2DHZA 1ZE3D 2KFKB 1FD6A 1K51A 4JPSA 3RI7C 4BZAA 1P0RA 4IOIE 2PPHA 2BBCA 1WX8A 2UWQA 5AZHA 1P9DU 2DLBA 2R2OA 1WSPA 3OG5A 2FCQA 2K6DB 2MW5A 1XF5L 2LUEA 1F0ZA 1QKZA 1P1AA 4EZJA 2ZNVC 1ZPSA 4P1BC 2WXQA 2E6XA 3Q8AA 4BOSC 1LQBA 2OEDA 3LDZE 2J7QB 3ML8A 2WXPA 3IAM1 3RZFA 2KKCA 3V61A 3ZQ4A 3VR8B 1K50A 4RCOA 3DVGY 1T3QA 1TS2A 3QARA 5AUIA 1T0SC 2KHWB 2OJRA 2L76A 4HPLB 4XDCA 1NEKB 1E8WA 2LMCA 1VLBA 2N9LA 2KTRB 3APDA 2JYTA 2VZKB 3VTWA 1F2RI 2BYEA 2DZJA 2FCMA 2OJWA 3NVZA 5BYQA 1WXAA 2FE8A 5DPWA 4KDLB 1WWTA 3QJZA 1V8CA 1SB3C 1FIQA 4IW0A 3WAPA 3IG3A 1NYQA 1I4PA 1ISNA 2HTME 3JW0X 2V1YA 2IGHA 2LHEA 3EFCA 1M94A 3U7DA 2Z0EB 4HROA 3RNEC 3VUXA 4UDUC 3SHQA 2DBYA 5C23A 2Y5CA 4IC7B 4AQ7A 4FLHA 3R66C 1NYRA 3NS1A 1KLGD 4TKNA 4ZRIA 4JWUC 3AB5A 2LJIA 2C9WB 3U2SC 1QOFA 2O2VA 3ABVB 2NCNA 3N1YC 1NI3A 3W1YA 3BVGA 1FO4A 4OW0A 1UNSA 1EM7A 2MP2A 2K5PA 3NS8A 1MHXA 1TYGB 2H88B 2IY0B 2PVOD 2V4IB 2Y3AA 2K8CA 2LEKA 3P4PB 3ZJVA 4KVGB 3PZ7A 4C00A 2W55A 2WP9B 1I35A 3DHIC 3TBLD 3D32A 3PZ8A 3WA0A 1JW9D 4F7ZA 2JZPA 2M19A 2WYQA 1L2NA 2KAJA 1HA5A 2M0AA 4LCDE 3MC9A 2K6QA 3Q3MC 4NPNA 3MTNB 2KWDA 4URKA 2INCC 5CHWA 4LDTB 2KX0A 2ZJDA 3DOWA 4HPPA 2FCSA 2M0XA 2DZIA 4YSXB 4AWJA 5LNK1 3TL5A 1MI0A 3M62B 5FR6A 1Q1OA 2KQ4X 1X1MA 5BO4B 4BVUC 2LFIA 2L05A 4K3BA 1J0GA 2LGXA 1VCBA 2WXIA 2WWZA 1KFYB 3N3KB 4A6QA 3AEDB 3BINA 1JRPA 3QCAA 1MG4A 1KH0A 3KLSX 5HKHA 3GOEA 3SR6A 4IM0A 1KLUD 2DYBA 2KDEB 4W9HA 2XBBC 1FEHA 1SIJA 3BVMA 4BBNC 1VZ7A 1YQ3B 2N0SB 4RNAA 4WWPA 2W54A 3ZTDA 2KWCA 3ML9A 4ZRKA 1UWMA 2YEPF 3L4PA 3L16A 2QSDA 1XLQA 3P4QB 3X0WA 4YL8A 1I4HA 3CSFA 2M56B 4HJGE 4M8NA 2RDHA 2WXFA 1JRUA 2KC1A 4ZYNA 1L7YA 2D2QA 3U30A 1V97A 1C4CA 1RFKA 3T8MA 3UI3A 2RDGA 2V3PA 3PRZA 1E7PB 1N5WA 3T3OA 1CMXB 4WWNA 4A3OA 2D5GA 2AEHA 5DPTA 1V1PB 4GDLB 4AS1A 1WYGA 2LVOA 5E6JA 2IO1B 2KFKA 3DBRI 4PK1A 4D2KA 3GE8C 1GB1A 4HPMB 1R4NI 4BOZB 2L1AA 1IGDA 3PVLA 1V5OA 3C8YA 5IO9A 1T0QC 2RPQA 1I4GA 4GGQA 1HQRD 5IAAC 2BF8B 5G2NA 4AJWA 2BYTA 2M4NA 5BMIA 3TEZA 2KX3A 3A4RA 2PTLA 4C7YA 5EE0A 1R4MB 2WXJA 3ZXVA 2WNMA 3H8HA 2BW2A 2KT7A 4JE3B 3IT4B 2KDFB 5FR3A 3MHSD 3UIPB 4B6WA 1E5WA 2ZW1A 3MHZA 2M1MA 4BAXA 1WM2A 3OLMD 2LI5A 4MDKE 1MFWA 1GUAB 4F8CB 4IWQA 4LTUA 2EMTA 4PS8A 2MX2A 3VVWB 2AL3A 3U52E 2KTRA 4XE0A 4A9AA 1OTRB 2BS4B 5C2TB 2WXMA 4FN2A 3DBHI 2LGIA 2GBNA 4YXDB 1YX5B 2WLBA 2R61A 2AL6A 3Q2AC 5JXVA 3PSEB 2OOBB 2PE6B 1MPEA 2I1KA 3TJPA 2XEWA 2LWPA 1UBIA 3Q8BA 1AW7A 2J53A 1CJEA 1ZOYB 2CR5A 4WJPA 5DCNA 4DHZE 4TUUA 5BYSA 4RGMA 1XCTL 3EECA 2KDMA 3GZNB 3SFDB 4I6PA 3C19A 3ZUNA 4M0WB 1QOGA 1TTNA 3CF6E 1ZUD2 4LNFA 1PDXA 4IWPA 3TEYA 3P4SB 4AUQC 2L32A 2KTFA 4P7IA 3RYTA 1QT9A 1WXMA 2J0KA 2Y5BB 2KC2A 4KGTA 2KN4A 2BYVE 1HEZE 1UZXB 1F9JA 1SE2A 4MJSB 2K25A 1WJ4A
chains in the Genus database with same CATH topology
4XWWA 1E6EB 1KTKA 2JWUA 3R2TA 4C56C 2AX5A 1VDVA 4IOIE 2BBCA 5D3IB 1QF6A 1J7CA 3B2FA 1YMHE 3HRDD 1QILA 3W1SA 3BVZA 3J9CA 4N6EB 2DLBA 2MEKA 2JYEA 4ZOHC 1WSPA 4Q2JA 3VR9B 1DOYA 1XF5L 3MP9A 5D7GA 1F0ZA 1QKZA 2ACZB 3AECB 4HKQA 1FCCC 1C4AA 3V05A 3GS2A 3AN1A 1ZPSA 3URYA 3HVDA 3B2GA 3HUIA 2WXQA 2PMVA 3MJ5A 2E6XA 4YSZB 2G1EA 1Y56A 3Q8AA 1JROA 1A70A 1IGCA 3OWEB 2OEDA 2MJEA 4WURA 3BYYB 4OHJA 2DWQA 2WXPA 3IAM1 2J52A 1PGAA 1DYQA 3EUB2 4US8A 1PFDA 3ZQ4A 1J7AA 4ZYSA 3VR8B 1TKGA 2WXNA 1JWMD 1T5XD 2J4XA 4B0EA 1B1ZA 1K50A 1TS3A 2PLPA 4RCOA 4P6VF 2XN9C 1T3QA 1TS2A 5AUIA 1E10A 1EWCA 3AV8A 2QILA 1P7FA 2QMTA 4RH6A 1RM6C 4XDCA 1FNVA 3V3XA 1I4QA 1KF6B 1I4XA 3BK1A 1NEKB 1ZP0B 2LMCA 3PO0A 1WGKA 1VLBA 1ET6A 2N9LA 4L1BA 3NVVA 4LLGM 3AE7B 1AYFA 2JU6X 4WAFA 2JYTA 2VZKB 2I38A 2SAKA 4HEA1 1F2RI 3NVWA 2LUMA 1VR9A 3NVZA 5BYQA 3TUOA 2FE8A 3AE8B 4YTPB 1WWTA 1V8CA 1SB3C 1FIQA 1CQVA 2HDEA 4US9A 3HVZA 1JWUD 3ETRA 1C9FA 4KKIA 3AEBB 2QEJC 1NYQA 2H89B 2N7JA 4A90A 4ZHOA 1I4PA 1N62A 2WU5B 3SFEB 2HTME 4HRSA 3ZGZA 2QJLA 2IGHA 2LHEA 3T3NA 3BZDB 1FFUA 3KWVA 4TQ0A 4JX1C 4NZLB 2CJOA 2GI9A 4HROA 1HZ6A 4UDUC 2DBYA 2XNAC 2JXTA 1QLBB 1XLOA 3AE3B 4DXGA 2Y5CA 1K53A 2LHDA 4AQ7A 1NENB 1NYRA 3NS1A 1KLGD 2GB1A 2BTEA 1XEEA 3VRBB 2MH7A 4JWUC 1PGBA 3FILA 2G9HD 3AB5A 3ZYYX 2LJIA 4ARIA 3CWIA 3U2SC 2NTSA 3VRAB 1QOFA 2BS3B 3LYYA 3ABVB 1IBXA 3EGRA 3I57A 3R2IA 1NI3A 3W2DA 3BVGA 1V1PA 1FO4A 4WWMA 4OW0A 1EU4A 1UNSA 1TZOA 1EM7A 4NAMA 2K5PA 4DQOC 2IGGA 4NAWB 2KMMA 1RWSA 1STEA 1YN5A 1MHXA 1TYGB 2H88B 1VZ8A 3NVYA 4RGTA 2PVOD 5G5GA 1D4BA 2V4IB 2Y3AA 2LEKA 3P4PB 5HHDG 3ZJVA 1SEBD 4GDKB 1UUPA 2J42A 4HKZE 3PZ7A 1MVKA 3U4EG 2W55A 3FC4A 3BIID 2BB6A 1ET9A 1TY2A 4N58A 1E0ZA 1VJKA 1CK1A 2WP9B 3GP7A 4MT5A 1E9MA 3P63A 3PZ8A 2FUG1 1JW9D 4XDDA 2L83A 5HI1A 1IUEA 4XWTA 1PGXA 2W82A 1VZ6A 2JZPA 2M19A 4KGRA 1F77A 1ZDXA 5AUKA 3VQIA 2KAJA 5GXGB 1HXYD 2AQ2B 1HA5A 2M0AA 1SBBB 3SEBA 2IDYA 1EU3A 1AN8A 1OQQA 2MJ3A 5HFYA 1L6UA 4TMAB 1P7EA 2PW9A 2KWDA 4YTNB 1D6EC 5H8YE 2IPKD 3B9JA 2V0GA 2W3RA 1JWBD 3AEGB 2N9KA 4PT5A 1DGJA 4YSXB 4KGSA 2WQYB 3P42A 2WDRB 1T6BX 2INPE 3AEAB 5LNK1 2WXOA 1MI0A 4J3OD 2KQ4X 2CJNA 2LFIA 1FFVA 4H2AA 1D5MC 1L6VA 2DYMA 1V1OA 3AH7A 2WXIA 2V3NA 1D5ZC 2WDVB 1ROEA 1KFYB 2KACA 4A6QA 3AEDB 1JRPA 1SSNA 1BMLC 3P4RB 1KH0A 3KLSX 4DXFA 3SR6A 3BWUD 4L23A 1YN3A 3P1MA 3TSSA 1KLUD 2W3SA 1FEHA 1SIJA 3W9CB 4YWGG 2B76B 3BVMA 4MM3B 5D3DA 3ZJUA 1FNUA 1PYWD 4ITKA 1VZ7A 1YQ3B 2N0SB 3AM9A 4RNAA 3TEXA 4RGNA 3IXSA 2W54A 2Z8LA 1UWMA 2YEPF 3L4PA 1N61A 3RPFC 1KRHA 2QSDA 1XLQA 1BUIC 1OQRA 3NUHB 3P4QB 4ZRQA 3AE5B 1F2RC 4IKGA 1I4HA 1GB4A 2IGDA 2M56B 2E3TA 4WIPA 2FBWB 4HJGE 2RDHA 2WXFA 1Q10A 3LB8C 5BYRA 2NTTA 1L4DB 4USAA 1J7BA 1AWDA 1XLNA 1FCLA 2AQ3B 5FKAC 1V97A 1RYJA 1C4CA 1RFKA 3NRZA 1XXGA 1QOAA 4M0WA 3UI3A 2RDGA 1YJJA 2V3PA 3AEFB 1WXQA 4WH4A 1C79A 1E7PB 4LK0M 1N5WA 1FXAA 3FILB 3T3OA 1MHHE 3LXFA 1BXTA 1FNWA 1XLPA 2PKOA 1YNTE 1C4PA 1JWAD 1IBXB 4YT0B 1ENFA 3E56A 1VRAB 2D5GA 1V1PB 2DYOA 4GDLB 1WYGA 4AS1A 5E6JA 1TKYA 2CU3A 3CIRB 3BYTB 3AE9B 2WDQB 2X38A 2K3UA 5EE1A 4CQNA 4NJCA 4MH8A 1N5XA 2WXRA 1TY0A 2YEPB 4D2KA 1GB1A 1OFFA 4TSSA 3W5UB 3ZJTA 2L1AA 3DWMA 4REZA 1IGDA 2BB5A 4IDIA 3AE2B 3GB1A 1R7SA 3C8YA 2WXGA 2OHFA 1DOXA 1I7HA 1FMAD 1FRDA 5TSSA 5BMGA 1I4GA 2K22A 1HQRD 2WXHA 2EKIA 4MACA 4RGOS 2JSVX 4RFBA 1DOIA 2BYTA 3U7ZA 1ESFA 1FRRA 1ACCA 3IAS1 2VZKD 1TS5A 3O13A 5BMIA 1YQ4B 3TEZA 3EA6A 3Q8FA 2RMMA 4N59A 3DWGC 2QIEB 2PTLA 3NZ3A 2JX5A 4A8XC 4C7YA 5EE0A 1FXIA 2L52A 1EWYC 1TS4A 4C7ZA 3W5VB 2ONQA 4GLSC 2WXJA 2WNMA 3AE4B 1JWSD 2ICIA 3H8HA 1JMLA 4KKJA 2BW2A 4O1NA 3R8BA 1L0YB 3IT4B 4JE3B 1K52A 5FR3A 1XO3A 1SE4A 2SEBD 1JALA 2ZW1A 2BS2B 4OZBA 3MHZA 1PUTA 2ZW0A 1UWXA 2INNE 4RF1A 3Q8CA 2NMQA 4P16A 1D5XC 2IJ0A 4TQ1A 4LTUA 5T8IA 1L0VB 1SF0A 4L2YA 5I4DA 1SJED 3AE1B 4EE2A 3U52E 4YSYB 1L4ZB 4XE0A 4A9AA 2BT6A 2BS4B 5C2TB 4OZCA 2I2YA 4YTMB 2WXMA 2K0PA 3AMZA 1JCKB 4JWSC 1GOZA 4WQMA 3Q8EA 1TJEA 3FAHA 1QQRA 2LGIA 5HG2A 1ZXHA 4YXDB 1LO5D 3AE6B 4A55A 1WRIA 1NVID 2WXKA 2WLBA 2Q5WD 2EELA 2R61A 4FXCA 5JXVA 2WU2B 1JQ4A 3KWLA 1C76A 1L0XB 3RFZB 4ARCA 1MPEA 1N63A 5EE9A 3AEEB 3Q8BA 3N9YC 1AW7A 1M4VA 2J53A 1N60A 3BK2A 1CJEA 1YN4A 1GPXA 1ZOYB 4R3DA 2MJDA 1XCQL 1UGJA 2GRIA 5BYSA 4RGMA 1XCTL 2Y5PA 4OVZA 3WCQA 3IT6B 3KQ4A 1C78A 1SXTA 1CZPA 1TKEA 4C80A 2KDMA 3SFDB 3TEWA 3MFGA 1I4RA 1YJIA 2WS3B 1SE3A 1QOGA 1ZUD2 5MPOA 1PDXA 1C77A 1FM0D 2PIAA 3TEYA 2WXLA 3P4SB 1QOBA 2JQRB 2TSSA 1ZDVA 4KX6B 3Q69A 2L32A 4RF0A 5H92C 1QT9A 4OZAA 4ZRPA 2AQ1B 2ON8A 2PVGC 2K9XA 1HZ5A 4ZHPA 3E9SA 3I9V1 1GAQB 2RPVA 2KN4A 4KGTA 5BMHA 5C3JB 1B9RA 1SJHD 5EE3A 5G5HA 1HEZE 5FK9C 1ZE3D 1L5PA 3MC0B 1SE2A 4B0MA 1FD6A 1K51A 4JPSA 1ZXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJO A;  3AED B;  1E6E B;  4C7Y A;  1JRP A;  5EE0 A;  4HRO A;  2AX5 A;  1FXI A;  1VDV A;  1QF6 A;  3P4R B;  1J7C A;  2DBY A;  2L52 A;  1EWY C;  1QLB B;  1XLO A;  3B2F A;  3SR6 A;  3AE3 B;  3HRD D;  4C7Z A;  3P1M A;  2Y5C A;  3W5V B;  2W3S A;  4N6E B;  3AE4 B;  1NEN B;  4ZOH C;  1NYR A;  1SIJ A;  3VR9 B;  2B76 B;  3NS1 A;  3W9C B;  1DOY A;  1F0Z A;  3VRB B;  2MH7 A;  2ACZ B;  1XO3 A;  3AEC B;  4ITK A;  4JWU C;  3ZYY X;  1YQ3 B;  3AB5 A;  2N0S B;  3AM9 A;  1JAL A;  3CWI A;  2BS2 B;  3AN1 A;  1PUT A;  2W54 A;  3VRA B;  3B2G A;  3HUI A;  1QOF A;  2BS3 B;  1UWM A;  3L4P A;  3ABV B;  4YSZ B;  1N61 A;  3RPF C;  1KRH A;  2G1E A;  1XLQ A;  4JX1 C;  1JRO A;  1OQR A;  3P4Q B;  1A70 A;  1NI3 A;  3AE5 B;  2MJE A;  1FO4 A;  2M56 B;  2E3T A;  4WWM A;  4LTU A;  1L0V B;  1SF0 A;  2DWQ A;  2FBW B;  3LB8 C;  4US8 A;  2K5P A;  3AE1 B;  4USA A;  3EUB 2;  1RWS A;  2KMM A;  1J7B A;  3NVY A;  1TYG B;  2H88 B;  4YSY B;  1AWD A;  1XLN A;  5G5G A;  1PFD A;  2BT6 A;  1J7A A;  2BS4 B;  2PVO D;  5C2T B;  4A9A A;  2LEK A;  3P4P B;  3VR8 B;  4YTM B;  1TKG A;  1V97 A;  3AMZ A;  4JWS C;  1RYJ A;  1RFK A;  4WQM A;  3NRZ A;  1QOA A;  1TJE A;  3FAH A;  4P6V F;  2W55 A;  3FC4 A;  4YXD B;  1YJJ A;  3BII D;  3AE6 B;  3AEF B;  4N58 A;  1WXQ A;  1E0Z A;  1WRI A;  1E7P B;  1NVI D;  1N5W A;  1FXA A;  1T3Q A;  1VJK A;  2Q5W D;  2WLB A;  2WP9 B;  4FXC A;  2WU2 B;  5AUI A;  1E10 A;  3LXF A;  1JQ4 A;  3KWL A;  1XLP A;  2PKO A;  3AV8 A;  1E9M A;  1N63 A;  3P63 A;  1JWA D;  1JW9 D;  2L83 A;  5EE9 A;  4YT0 B;  1IUE A;  3AEE B;  1RM6 C;  2M19 A;  1N60 A;  1CJE A;  1WYG A;  1GPX A;  1ZOY B;  1KF6 B;  1TKY A;  2CU3 A;  2MJD A;  3CIR B;  1NEK B;  1ZP0 B;  5AUK A;  2KAJ A;  3AE9 B;  3PO0 A;  1WGK A;  5GXG B;  2WDQ B;  1VLB A;  3NVV A;  1OQQ A;  2MJ3 A;  1AYF A;  3AE7 B;  1L6U A;  5EE1 A;  3WCQ A;  4C80 A;  1CZP A;  1TKE A;  3SFD B;  1N5X A;  4YTN B;  1OFF A;  5H8Y E;  3B9J A;  1YJI A;  3W5U B;  2WS3 B;  2W3R A;  1JWB D;  3AEG B;  1QOG A;  3NVW A;  3DWM A;  1ZUD 2;  1DGJ A;  4YSX B;  4IDI A;  5MPO A;  3NVZ A;  1PDX A;  1FM0 D;  2WQY B;  3AE2 B;  2PIA A;  2WDR B;  3P4S B;  1QOB A;  2JQR B;  3AE8 B;  1WWT A;  4YTP B;  1R7S A;  3AEA B;  4KX6 B;  5H92 C;  2OHF A;  1DOX A;  1I7H A;  1QT9 A;  1V8C A;  1FMA D;  1FRD A;  1FIQ A;  1SB3 C;  4US9 A;  2K22 A;  2PVG C;  3HVZ A;  3ETR A;  2K9X A;  3AEB B;  4ZHP A;  2EKI A;  1NYQ A;  2H89 B;  1GAQ B;  2CJN A;  4ZHO A;  1N62 A;  1FFV A;  5C3J B;  1B9R A;  2WU5 B;  5EE3 A;  1DOI A;  2HTM E;  4HRS A;  1L6V A;  2QJL A;  5G5H A;  1FRR A;  3SFE B;  1YQ4 B;  3AH7 A;  1L5P A;  2WDV B;  4N59 A;  1FFU A;  1ROE A;  1KFY B;  3DWG C;  2QIE B;  1ZXI A;  2JX5 A; 
#chains in the Genus database with same CATH topology
 3R2T A;  4C56 C;  1E8Z A;  4ANU A;  3KYC D;  1VDV A;  1J7C A;  4FJV B;  1YMH E;  1OEY J;  4N6E B;  4DHJ B;  4NJ6 A;  2NPT B;  4Q2J A;  2O6V D;  2L0T A;  1RAX A;  3AEC B;  2X8X X;  2JRI B;  2LAS A;  4WJN A;  3URY A;  3HUI A;  1TGZ B;  2GBM A;  2PMV A;  1JRO A;  2RDB C;  3OWE B;  4P1C C;  1HE8 A;  2KAN A;  2MJE A;  4WUR A;  3RN9 C;  4DBG A;  1C3T A;  3EUB 2;  1S3S G;  1WFY A;  4BBN F;  4ZYS A;  1WRD B;  2WXN A;  1TS3 A;  4P6V F;  2XN9 C;  1EWC A;  2LJ5 A;  2DZM A;  2KQS A;  3KH0 A;  5GMV A;  2L00 B;  3RNF C;  2QMT A;  5E6O A;  2G4S A;  1FNV A;  2D11 A;  3V3X A;  1I4Q A;  1KF6 B;  3BK1 A;  3OAW A;  1KJT A;  1T0Y A;  4JQW C;  1ET6 A;  3NVV A;  4LLG M;  3A9K B;  1AYF A;  2JU6 X;  1MJD A;  2I38 A;  1VR9 A;  4RMA A;  3ZNI D;  2WDT B;  4YTP B;  3P2B A;  1QZE A;  4I6N B;  2HDE A;  4US9 A;  4PS7 A;  1JWU D;  3AEB B;  4G50 A;  2H89 B;  2MBO A;  2WU5 B;  4HRS A;  2QCZ A;  2V9H A;  3H7P B;  2ZPY A;  5LXH A;  3DQV A;  3Q14 C;  1LM8 B;  2GBR A;  2XNA C;  1XLO A;  1WXS A;  4DXG A;  4W9L A;  2A4Z A;  1NEN B;  2CS4 A;  1XEE A;  2IND C;  3ZYY X;  3CWI A;  4GN1 A;  2BS3 B;  3ECI A;  3EGR A;  2WHI A;  2JF5 A;  4E71 A;  3R2I A;  3W2D A;  1V1P A;  4GDL A;  5KHO A;  1EU4 A;  1GC6 A;  1EF1 A;  1YJ1 A;  3ZRC A;  1YN5 A;  2KMM A;  5D2M B;  4FA6 A;  1UGM A;  3UGB B;  4GDK B;  2KQ7 A;  2MBE A;  3U4E G;  3FC4 A;  1WGY A;  2LVP A;  1VJK A;  3GP7 A;  4HLE A;  4LNO A;  2FUG 1;  1IUE A;  4XWT A;  1Q5W B;  2BKR B;  3ONS A;  1T0R C;  4BKG A;  3I63 C;  5AUK A;  3VQI A;  2AQ2 B;  3L54 A;  1SBB B;  3SEB A;  2IDY A;  5HFY A;  2MJ3 A;  4PS3 A;  1P7E A;  4NY0 A;  4NJ7 A;  1WMH B;  3B9J A;  1AAR A;  2W3R A;  4DHZ B;  4IM3 A;  3P42 A;  3ZNG C;  1IYF A;  4EFO A;  3K9O B;  1T6B X;  3AEA B;  2IO0 B;  2K1F A;  1WZ0 A;  2CJN A;  3H9D A;  2BQQ A;  2A5U A;  1D5Z C;  2PEA A;  4HK2 A;  1V6E A;  2KAC A;  5AZF A;  3VUY A;  1WGR A;  4XC2 A;  3V62 A;  5IP4 D;  2D3G A;  2CKH B;  3BWU D;  1WR1 A;  2KK8 A;  1YN3 A;  3P1M A;  2LRU A;  3TSS A;  4YWG G;  4MM3 B;  2N1W A;  5J18 A;  1PYW D;  3AM9 A;  2Z8L A;  4RM8 A;  1F2R C;  4IKG A;  3B0A A;  4EZL A;  1GB4 A;  4WIP A;  2J0M A;  2XK5 B;  1Q10 A;  2ZVN A;  5BYR A;  2NTT A;  4USA A;  2ASQ A;  2RR9 A;  1XLN A;  1E8Y A;  2AQ3 B;  1WI0 A;  1WM3 A;  1RYJ A;  1P3Q U;  1WGG A;  4LNN A;  3NRZ A;  1XXG A;  1QOA A;  4M0W A;  3V60 A;  1K8R B;  4ANX A;  3ZO5 B;  3AEF B;  3C0R B;  4LK0 M;  3PHW B;  4WH4 A;  1KOT A;  2DAF A;  2B3A A;  4EZK A;  3DVN U;  1FNW A;  2HE7 A;  1JWA D;  1Y8R C;  4YT0 B;  1ENF A;  3APC A;  3DDC B;  3Q3O C;  3CIR B;  3V6C B;  2K3U A;  5EE1 A;  3ZNZ B;  1NDD A;  4MJS A;  3W1S C;  4MH8 A;  2D3C A;  1E7U A;  3DBL B;  3W5U B;  5IN7 A;  3RD2 A;  1WGH A;  2YVC A;  2C60 A;  4X57 B;  2BB5 A;  2NPT A;  3JYU A;  3GB1 A;  3DCG A;  3PS6 A;  2BPS A;  5J17 A;  2WXH A;  4WJQ A;  4MAC A;  4RFB A;  2W9N A;  4S17 A;  1FRR A;  3IAS 1;  1TS5 A;  2LD9 A;  4K1R B;  4N59 A;  3UF8 A;  4EUT A;  2QIE B;  2JX5 A;  4FJY A;  1WJN A;  2L52 A;  4G11 A;  3RMK C;  4WWO A;  1TS4 A;  5LXI B;  4A20 A;  2ONQ A;  1SIF A;  4KKJ A;  3QAQ A;  1K52 A;  4CHK A;  2BS2 B;  3AU4 A;  2ZW0 A;  2CU1 A;  3N1X C;  3ENE A;  2N1V A;  4XGA B;  2KMA A;  1D5X C;  2IJ0 A;  4TQ1 A;  2MHJ A;  1TZ1 A;  3RNC C;  1SJE D;  3AE1 B;  3A9K A;  2JVC A;  3AUL A;  2MCN B;  2KVZ A;  1XD3 B;  1GOZ A;  4WQM A;  1TJE A;  1ZXH A;  2LGY A;  1LO5 D;  3AE6 B;  4A55 A;  2WXK A;  1XQQ A;  4XYC A;  3A4S C;  3KWL A;  1C76 A;  3RFZ B;  5DPR A;  2DAJ A;  2KDB A;  3QHT A;  5EE9 A;  1NI2 A;  5G55 A;  2MJD A;  1LFD A;  2N7D A;  3N1Z C;  3I5J C;  2KOX A;  3H7P A;  3KUZ A;  4OVZ A;  3KQ4 A;  1C78 A;  1SXT A;  4C80 A;  1TKE A;  3TEW A;  3RNB C;  1I4R A;  5MPO A;  1C77 A;  2PIA A;  1NBF C;  1YIW A;  2KYW A;  4G0N B;  1ZDV A;  4KX6 B;  5H92 C;  4NNJ B;  4OZA A;  3OJ3 A;  4ZHP A;  4II2 B;  3E9S A;  2RPV A;  4N9F 4;  4F1S A;  4LNI A;  1L5P A;  3VH4 B;  3NOB A;  1WX9 A;  2N9E B;  3QK0 A;  1ZXI A;  4PYU A;  4XWW A;  1E6E B;  1KTK A;  2JWU A;  2AX5 A;  1RFA A;  4A3P A;  3B2F A;  4TV3 A;  3HRD D;  1QIL A;  4GDK A;  3RNG C;  3W1S A;  3VAW A;  2JYE A;  3VR9 B;  1DOY A;  1GC7 A;  1Q0W B;  3EHV A;  1LXD A;  2ACZ B;  3L17 A;  3RNA C;  4HKQ A;  1FCC C;  3VH3 B;  3V05 A;  3GS2 A;  4LJO B;  3B2G A;  2BWE S;  5EDS A;  3MJ5 A;  5E6P A;  1A70 A;  1J19 A;  2MBH A;  3BYY B;  4OHJ A;  2NVU I;  4GB9 A;  1V49 A;  1PGA A;  2KZR A;  4US8 A;  1C1Y B;  1PFD A;  1J7A A;  4KIK B;  1WMH A;  4FUL A;  1T5X D;  2J4X A;  4B0E A;  1B1Z A;  3SD5 A;  5JHB A;  3RUI B;  1E10 A;  4JL9 A;  2WGS A;  4K7S A;  3AV8 A;  1P7F A;  2HJ1 A;  4RH6 A;  1RM6 C;  1YX6 B;  4HWI B;  3KUD B;  1RLF A;  2FNJ B;  4W9D A;  4L1B A;  3VUW A;  1KLV A;  3AE7 B;  4II3 B;  3QC8 B;  4BKT A;  2M17 A;  2G45 B;  5JHA A;  3IFW B;  4FBJ B;  4HEA 1;  3Q3J A;  3NVW A;  2LUM A;  5L95 C;  2UYZ B;  1WYW B;  4CYE A;  4DXA B;  4MM3 A;  3RT3 B;  3AE8 B;  2MA9 B;  2RD0 A;  2ZVO A;  2Z59 B;  3HVZ A;  3TMP B;  1C9F A;  4KKI A;  5IKC M;  2IYD B;  4ANV A;  2N7J A;  1U4A A;  4ZHO A;  3SFE B;  2QJL A;  4MSM B;  2C7M B;  3T3N A;  1HTO A;  3N32 A;  2C7H A;  2XK5 A;  2QC8 A;  2KFJ A;  3B1L X;  4NZL B;  4TQ0 A;  2CJO A;  2GI9 A;  3HIZ A;  3T9L A;  4GSW A;  2ZZP B;  4ICU A;  3B08 A;  3AE3 B;  4MGZ E;  2BKF A;  2DZK A;  3VRB B;  1PGB A;  2G9H D;  4LNK A;  3VRA B;  2HJ8 A;  2MBQ A;  3O65 B;  2MSE D;  4NAM A;  3SDL C;  3TIX A;  3ZLZ A;  4NAW B;  4RGT A;  4AJY B;  4OVV A;  1E8X A;  5G5G A;  4MGK E;  5HHD G;  3PRM B;  4HKZ E;  3V6E B;  1MVK A;  2LXC A;  1GJZ A;  1TY2 A;  3JVZ X;  2NS5 A;  1E0Z A;  1CK1 A;  2KMC A;  4MT5 A;  1A5R A;  2C5L C;  3FKY A;  1UF0 A;  4BKS D;  5HI1 A;  1OGW A;  4WAA A;  2W82 A;  4KGR A;  1R4M I;  1WE7 A;  1F77 A;  2FAZ A;  4JIO U;  2BGF A;  4ASW C;  3QA8 A;  5GXG B;  2Z0D B;  3ZRF A;  3DHG C;  1OQQ A;  5IA7 A;  4TMA B;  2PW9 A;  4WJO A;  3M63 B;  1D6E C;  2MQJ A;  2ZEQ A;  2V0G A;  3NY5 A;  1D3Z A;  2R2Q A;  2WX1 A;  1JWB D;  3AEG B;  4B9K A;  2N9K A;  3RZW C;  4M8M A;  2D3A A;  2WDR B;  4ZDV A;  1J8C A;  3L0W B;  5L83 A;  4DDG D;  4H2A A;  1D5M C;  1L6V A;  2DYM A;  5KHQ A;  2V3N A;  1SE9 A;  4S0R A;  1WX7 A;  4ANW A;  5D6J B;  3WAM A;  4QAY A;  4KSL C;  2GLS A;  4DXF A;  2C7N B;  2W3S A;  2BWF A;  2CHW A;  3W9C B;  2VH2 A;  4FHJ A;  5D3D A;  3ZJU A;  2N7E A;  1WIA A;  5TR5 A;  3TEX A;  3ZIM A;  3IXS A;  3SU8 X;  2ZPN A;  3GZN I;  5IOI A;  1WE6 A;  1N61 A;  4FJZ A;  4MEL A;  1KRH A;  5DPS A;  3RPF C;  1BUI C;  3NUH B;  3AE5 B;  3PHX B;  5CHF A;  1Z5S B;  2IGD A;  2E3T A;  2KLC A;  4XX5 A;  2FBW B;  4LJP B;  1L4D B;  2KO3 A;  1J7B A;  2JWZ A;  1ZGU B;  1FCL A;  5FKA C;  3KYD D;  1LGR A;  3X23 A;  2JUO A;  3VTU A;  2KLG A;  1C79 A;  1FXA A;  3FIL B;  1XLP A;  1ZW7 A;  1YNT E;  3EFU A;  1C4P A;  3WAL A;  1IBX B;  3E56 A;  1VRA B;  1ZKH A;  1EUV B;  2DYO A;  2MWS B;  1TKY A;  3BYT B;  3IVF A;  1WZ3 A;  3AE9 B;  2X38 A;  4NQK E;  4J6I A;  4CQN A;  4NJC A;  1N5X A;  1TY0 A;  1OFF A;  4TSS A;  4NQL B;  4LDT D;  3KVF B;  3ZJT A;  3DWM A;  4KSK C;  1TIF A;  2PJH A;  3AE2 B;  3CST A;  4W9C A;  2KN5 A;  4IG7 B;  1R7S A;  1DOX A;  1FMA D;  1FRD A;  3R3M A;  2EKI A;  4RGO S;  2JSV X;  3Q6B A;  3UQB A;  3U7Z A;  4JGH B;  1ESF A;  4MH0 E;  4OVU A;  3EA6 A;  2QHO A;  2WX0 A;  2MBB B;  2G3Q B;  2KNB A;  2KWV B;  1EWY C;  4KIK A;  3W5V B;  4GLS C;  3AE4 B;  1JWS D;  1JML A;  2O6V B;  4O1N A;  4IUM B;  3NHE B;  1L0Y B;  1V2Y A;  2K8B A;  2KDI A;  3ZTC A;  3VFK A;  4KV2 A;  4OZB A;  4B95 A;  2V3S A;  2NMQ A;  4P16 A;  4XZ4 A;  2KD0 A;  2VRR B;  4W9J A;  3A33 B;  4C4V B;  1IPG A;  1L0V B;  1EO6 A;  5I4D A;  4EE2 A;  4YSY B;  3HHM A;  2LXA A;  2BT6 A;  4OZC A;  4W9G A;  2AWT A;  2L8J A;  3FAH A;  1QQR A;  2DX5 B;  2VH1 A;  1E7V A;  1WRI A;  1NVI D;  3A9J B;  2Q5W D;  1H8C A;  4FXC A;  1L0X B;  4ARC A;  3PT2 B;  2LGD A;  1WJU A;  1N63 A;  2I1J A;  4HJK A;  3KW5 B;  1GG3 A;  3L08 A;  3N9Y C;  3BK2 A;  3Q3N C;  1YN4 A;  1GPX A;  4R3D A;  1TT5 B;  3PRP B;  3WIM A;  2MLB A;  1UGJ A;  3DVG X;  2Y5P A;  3WCQ A;  3IT6 B;  2IO3 B;  3L10 B;  2LRW A;  3MFG A;  4PYZ A;  2HD5 B;  4CO7 A;  2PE9 A;  2WS3 B;  4ACF A;  3NZU A;  1V5T A;  3QX1 A;  4HXD A;  4K7U A;  1UEL A;  1FM0 D;  1BT0 A;  2WXL A;  2KJH B;  2BYF A;  3PV1 A;  2JQR B;  3Q69 A;  1N6Z A;  4ZRP A;  5AEK B;  4JLC A;  1MG8 A;  1HZ5 A;  3PPA A;  1SJH D;  5EE3 A;  4GMV A;  3VDZ A;  5JZE B;  2GBJ A;  1IP9 A;  5FK9 C;  1UD7 A;  4EEW A;  3MC0 B;  4B0M A;  4K81 A;  2KJR A;  4HCN B;  4NAW A;  3PLU A;  5D3I B;  1QF6 A;  3NJT A;  2L7R A;  2IBI B;  3BVZ A;  3J9C A;  2MEK A;  4ZOH C;  4HCP B;  3MP9 A;  5D7G A;  3DBR B;  2FUH B;  3ZXR A;  4K7W A;  4I6L B;  1C4A A;  3AN1 A;  4KZC A;  3HVD A;  4YSZ B;  1R4N B;  2G1E A;  1Y56 A;  2JPH A;  1F52 A;  1IGC A;  1H4R A;  4W9E A;  1UH6 A;  1HTQ A;  2DWQ A;  2J52 A;  3NG0 A;  1DYQ A;  2LZ6 A;  2L3Z A;  1TKG A;  4AP4 C;  1JWM D;  3HM6 X;  3PGE A;  2PLP A;  3A1Q B;  2L0F A;  3QIJ A;  4BFR A;  1VD2 A;  2QIL A;  4AOF A;  2KJ6 A;  2JZ3 B;  3N30 A;  1I4X A;  1KM7 A;  1ZP0 B;  3PO0 A;  1WGK A;  2QDF A;  4WAF A;  3UQA A;  4W9F A;  3UIO B;  3M95 A;  2SAK A;  1OQY A;  4HVB A;  3AI5 A;  3TUO A;  3JSV B;  2K8H A;  5J2R A;  2RSU A;  1CQV A;  3ETR A;  4E74 A;  3VHT C;  2QEJ C;  4A90 A;  3ZDM C;  2RGF A;  1N62 A;  2M8S A;  3DBH B;  2ZCB A;  3ZGZ A;  3BZD B;  1FFU A;  3KWV A;  3RCZ A;  2KVR A;  4JX1 C;  5D94 A;  1S1Q B;  1HZ6 A;  3HM3 A;  2JXT A;  1QLB B;  1K53 A;  2LHD A;  4DHJ D;  2D10 A;  2GB1 A;  2BTE A;  2MH7 A;  4KDI C;  3DBS A;  3FIL A;  3MJW A;  4ARI A;  5CX3 A;  4IM2 A;  2NTS A;  3LYY A;  3DBL I;  1IBX A;  3I57 A;  2JY6 A;  4WWM A;  4MGI E;  1TZO A;  4DQO C;  2IGG A;  1RWS A;  1STE A;  2DEN B;  3DHH C;  3NVY A;  3H7S A;  1VZ8 A;  1D4B A;  1SEB D;  1UUP A;  2D07 B;  3S2A A;  2D3B A;  2J42 A;  3APF A;  4HDO A;  3RUL A;  3BII D;  2BB6 A;  1ET9 A;  4N58 A;  1E9M A;  3P63 A;  4XDD A;  2L83 A;  4E3C A;  1PGX A;  1VZ6 A;  3N20 C;  1ZDX A;  3Q3F A;  1V81 A;  2FID A;  1HXY D;  1EU3 A;  1AN8 A;  1L6U A;  5CTR C;  4YTN B;  2GMI C;  5H8Y E;  2IPK D;  2V4L A;  4PT5 A;  1DGJ A;  3IBE A;  3QQ8 B;  3ZDT A;  4KGS A;  1FXT B;  2WQY B;  2O6V A;  2INP E;  2EMS A;  2WXO A;  2MRP A;  4J3O D;  3DPD A;  3PLV A;  1FFV A;  1F1H A;  2EKE C;  4BKS A;  4C4V A;  1V1O A;  3AH7 A;  2WDV B;  1ROE A;  2KXJ A;  3AXC A;  1UBQ A;  4KZ0 A;  1WF9 A;  1SSN A;  1BML C;  3P4R B;  4L23 A;  2UU7 A;  4MEM A;  1V86 A;  4EKU A;  2B76 B;  3AU5 A;  4GOC A;  1FNU A;  4ITK A;  3A9J A;  4RGN A;  4RM9 A;  1FPY A;  1WR6 E;  1WJ6 A;  1EF5 A;  2IO2 B;  1OQR A;  1G6J A;  4ZRQ A;  1WXV A;  2JRH A;  4GXB A;  4GU2 A;  3IHP C;  3LB8 C;  4IWO A;  3R7R A;  1AWD A;  2JT4 B;  3TCA A;  3GE3 C;  4ZRJ A;  1WGD A;  2J0J A;  1YJJ A;  2CHZ A;  1V9J A;  1WXQ A;  3VTV A;  5C1Z A;  1MHH E;  3LXF A;  1BXT A;  2PKO A;  3KUC B;  1YD8 U;  1YOV B;  2O2V B;  4M00 A;  4FHK A;  3H1U A;  2CU3 A;  3ZW3 A;  1XT9 B;  2G4D B;  2MP2 B;  1TBE A;  2WDQ B;  3WAO A;  3U8Z A;  3I3T B;  2FIF A;  3VXW A;  2YEP B;  2WXR A;  4GIV A;  3MC8 A;  2N9P C;  3BY4 B;  2ZCC A;  1V80 A;  2JXX A;  4REZ A;  4IDI A;  4EOY A;  5LLI A;  3DVN V;  3NZS A;  2NBW B;  2WXG A;  2OHF A;  3LJ3 A;  1I42 A;  1I7H A;  5TSS A;  5BMG A;  2K22 A;  4G3X B;  2ZNV B;  3CMM B;  2GOW A;  1DOI A;  1ACC A;  3O13 A;  2VZK D;  5AZG A;  1SGH A;  1YQ4 B;  3Q8F A;  3R7Q A;  2RMM A;  3DWG C;  2NBV B;  3NZ3 A;  4A8X C;  1WY8 A;  4ICV A;  1FXI A;  1Z2M A;  2DNF A;  2IY1 B;  4C7Z A;  2KWU B;  1PQS A;  2ICI A;  5CHV C;  3A1Q A;  1WH3 A;  3R8B A;  4HDQ A;  1XO3 A;  1SE4 A;  2SEB D;  1JAL A;  1PUT A;  1UWX A;  1OEY A;  2INN E;  2NBU A;  4RF1 A;  3Q8C A;  2IZV B;  3ZVV A;  2N4F A;  4M02 A;  3PRE A;  2N9X A;  3OJ4 B;  5T8I A;  1SF0 A;  3UIN B;  4L2Y A;  2FCN A;  5E6N A;  1L4Z B;  2CHX A;  2I2Y A;  1GNU A;  3L13 A;  4YTM B;  2K0P A;  3AMZ A;  1JCK B;  4JWS C;  3Q8E A;  2LVQ A;  5HG2 A;  3PTF C;  2EEL A;  3JSV A;  1JQ4 A;  2WU2 B;  2JZZ A;  4FAD A;  4W9K A;  4DDI D;  3AEE B;  2NR2 A;  1M4V A;  1N60 A;  4DK5 A;  3K9P B;  4M01 A;  4WQO B;  1XCQ L;  2K39 A;  1E90 A;  2GRI A;  3H6N A;  4MGY E;  1CZP A;  1YQB A;  3HK0 A;  1YJI A;  3ALB A;  1SE3 A;  2GBK A;  2AYO B;  4W9I A;  3ZKJ C;  3M3J A;  3ZNH B;  3EC8 A;  4K3C A;  4MSQ B;  1QOB A;  2TSS A;  3WAN A;  2LGS A;  4RF0 A;  2AQ1 B;  1RRB A;  2ON8 A;  2PVG C;  2YLM A;  2K9X A;  2REX A;  5JH5 C;  1P98 A;  3I9V 1;  1GAQ B;  5BMH A;  2BVC A;  3PZD A;  4DWF A;  5C3J B;  1B9R A;  2HTH A;  5G5H A;  3QWZ B;  2DHZ A;  1ZE3 D;  2KFK B;  1FD6 A;  1K51 A;  4JPS A;  3RI7 C;  4BZA A;  1P0R A;  4IOI E;  2PPH A;  2BBC A;  1WX8 A;  2UWQ A;  5AZH A;  1P9D U;  2DLB A;  2R2O A;  1WSP A;  3OG5 A;  2FCQ A;  2K6D B;  2MW5 A;  1XF5 L;  2LUE A;  1F0Z A;  1QKZ A;  1P1A A;  4EZJ A;  2ZNV C;  1ZPS A;  4P1B C;  2WXQ A;  2E6X A;  3Q8A A;  4BOS C;  1LQB A;  2OED A;  3LDZ E;  2J7Q B;  3ML8 A;  2WXP A;  3IAM 1;  3RZF A;  2KKC A;  3V61 A;  3ZQ4 A;  3VR8 B;  1K50 A;  4RCO A;  3DVG Y;  1T3Q A;  1TS2 A;  3QAR A;  5AUI A;  1T0S C;  2KHW B;  2OJR A;  2L76 A;  4HPL B;  4XDC A;  1NEK B;  1E8W A;  2LMC A;  1VLB A;  2N9L A;  2KTR B;  3APD A;  2JYT A;  2VZK B;  3VTW A;  1F2R I;  2BYE A;  2DZJ A;  2FCM A;  2OJW A;  3NVZ A;  5BYQ A;  1WXA A;  2FE8 A;  5DPW A;  4KDL B;  1WWT A;  3QJZ A;  1V8C A;  1SB3 C;  1FIQ A;  4IW0 A;  3WAP A;  3IG3 A;  1NYQ A;  1I4P A;  1ISN A;  2HTM E;  3JW0 X;  2V1Y A;  2IGH A;  2LHE A;  3EFC A;  1M94 A;  3U7D A;  2Z0E B;  4HRO A;  3RNE C;  3VUX A;  4UDU C;  3SHQ A;  2DBY A;  5C23 A;  2Y5C A;  4IC7 B;  4AQ7 A;  4FLH A;  3R66 C;  1NYR A;  3NS1 A;  1KLG D;  4TKN A;  4ZRI A;  4JWU C;  3AB5 A;  2LJI A;  2C9W B;  3U2S C;  1QOF A;  2O2V A;  3ABV B;  2NCN A;  3N1Y C;  1NI3 A;  3W1Y A;  3BVG A;  1FO4 A;  4OW0 A;  1UNS A;  1EM7 A;  2MP2 A;  2K5P A;  3NS8 A;  1MHX A;  1TYG B;  2H88 B;  2IY0 B;  2PVO D;  2V4I B;  2Y3A A;  2K8C A;  2LEK A;  3P4P B;  3ZJV A;  4KVG B;  3PZ7 A;  4C00 A;  2W55 A;  2WP9 B;  1I35 A;  3DHI C;  3TBL D;  3D32 A;  3PZ8 A;  3WA0 A;  1JW9 D;  4F7Z A;  2JZP A;  2M19 A;  2WYQ A;  1L2N A;  2KAJ A;  1HA5 A;  2M0A A;  4LCD E;  3MC9 A;  2K6Q A;  3Q3M C;  4NPN A;  3MTN B;  2KWD A;  4URK A;  2INC C;  5CHW A;  4LDT B;  2KX0 A;  2ZJD A;  3DOW A;  4HPP A;  2FCS A;  2M0X A;  2DZI A;  4YSX B;  4AWJ A;  5LNK 1;  3TL5 A;  1MI0 A;  3M62 B;  5FR6 A;  1Q1O A;  2KQ4 X;  1X1M A;  5BO4 B;  4BVU C;  2LFI A;  2L05 A;  4K3B A;  1J0G A;  2LGX A;  1VCB A;  2WXI A;  2WWZ A;  1KFY B;  3N3K B;  4A6Q A;  3AED B;  3BIN A;  1JRP A;  3QCA A;  1MG4 A;  1KH0 A;  3KLS X;  5HKH A;  3GOE A;  3SR6 A;  4IM0 A;  1KLU D;  2DYB A;  2KDE B;  4W9H A;  2XBB C;  1FEH A;  1SIJ A;  3BVM A;  4BBN C;  1VZ7 A;  1YQ3 B;  2N0S B;  4RNA A;  4WWP A;  2W54 A;  3ZTD A;  2KWC A;  3ML9 A;  4ZRK A;  1UWM A;  2YEP F;  3L4P A;  3L16 A;  2QSD A;  1XLQ A;  3P4Q B;  3X0W A;  4YL8 A;  1I4H A;  3CSF A;  2M56 B;  4HJG E;  4M8N A;  2RDH A;  2WXF A;  1JRU A;  2KC1 A;  4ZYN A;  1L7Y A;  2D2Q A;  3U30 A;  1V97 A;  1C4C A;  1RFK A;  3T8M A;  3UI3 A;  2RDG A;  2V3P A;  3PRZ A;  1E7P B;  1N5W A;  3T3O A;  1CMX B;  4WWN A;  4A3O A;  2D5G A;  2AEH A;  5DPT A;  1V1P B;  4GDL B;  4AS1 A;  1WYG A;  2LVO A;  5E6J A;  2IO1 B;  2KFK A;  3DBR I;  4PK1 A;  4D2K A;  3GE8 C;  1GB1 A;  4HPM B;  1R4N I;  4BOZ B;  2L1A A;  1IGD A;  3PVL A;  1V5O A;  3C8Y A;  5IO9 A;  1T0Q C;  2RPQ A;  1I4G A;  4GGQ A;  1HQR D;  5IAA C;  2BF8 B;  5G2N A;  4AJW A;  2BYT A;  2M4N A;  5BMI A;  3TEZ A;  2KX3 A;  3A4R A;  2PTL A;  4C7Y A;  5EE0 A;  1R4M B;  2WXJ A;  3ZXV A;  2WNM A;  3H8H A;  2BW2 A;  2KT7 A;  4JE3 B;  3IT4 B;  2KDF B;  5FR3 A;  3MHS D;  3UIP B;  4B6W A;  1E5W A;  2ZW1 A;  3MHZ A;  2M1M A;  4BAX A;  1WM2 A;  3OLM D;  2LI5 A;  4MDK E;  1MFW A;  1GUA B;  4F8C B;  4IWQ A;  4LTU A;  2EMT A;  4PS8 A;  2MX2 A;  3VVW B;  2AL3 A;  3U52 E;  2KTR A;  4XE0 A;  4A9A A;  1OTR B;  2BS4 B;  5C2T B;  2WXM A;  4FN2 A;  3DBH I;  2LGI A;  2GBN A;  4YXD B;  1YX5 B;  2WLB A;  2R61 A;  2AL6 A;  3Q2A C;  5JXV A;  3PSE B;  2OOB B;  2PE6 B;  1MPE A;  2I1K A;  3TJP A;  2XEW A;  2LWP A;  1UBI A;  3Q8B A;  1AW7 A;  2J53 A;  1CJE A;  1ZOY B;  2CR5 A;  4WJP A;  5DCN A;  4DHZ E;  4TUU A;  5BYS A;  4RGM A;  1XCT L;  3EEC A;  2KDM A;  3GZN B;  3SFD B;  4I6P A;  3C19 A;  3ZUN A;  4M0W B;  1QOG A;  1TTN A;  3CF6 E;  1ZUD 2;  4LNF A;  1PDX A;  4IWP A;  3TEY A;  3P4S B;  4AUQ C;  2L32 A;  2KTF A;  4P7I A;  3RYT A;  1QT9 A;  1WXM A;  2J0K A;  2Y5B B;  2KC2 A;  4KGT A;  2KN4 A;  2BYV E;  1HEZ E;  1UZX B;  1F9J A;  1SE2 A;  4MJS B;  2K25 A;  1WJ4 A; 
#chains in the Genus database with same CATH homology
 4XWW A;  1E6E B;  1KTK A;  2JWU A;  3R2T A;  4C56 C;  2AX5 A;  1VDV A;  4IOI E;  2BBC A;  5D3I B;  1QF6 A;  1J7C A;  3B2F A;  1YMH E;  3HRD D;  1QIL A;  3W1S A;  3BVZ A;  3J9C A;  4N6E B;  2DLB A;  2MEK A;  2JYE A;  4ZOH C;  1WSP A;  4Q2J A;  3VR9 B;  1DOY A;  1XF5 L;  3MP9 A;  5D7G A;  1F0Z A;  1QKZ A;  2ACZ B;  3AEC B;  4HKQ A;  1FCC C;  1C4A A;  3V05 A;  3GS2 A;  3AN1 A;  1ZPS A;  3URY A;  3HVD A;  3B2G A;  3HUI A;  2WXQ A;  2PMV A;  3MJ5 A;  2E6X A;  4YSZ B;  2G1E A;  1Y56 A;  3Q8A A;  1JRO A;  1A70 A;  1IGC A;  3OWE B;  2OED A;  2MJE A;  4WUR A;  3BYY B;  4OHJ A;  2DWQ A;  2WXP A;  3IAM 1;  2J52 A;  1PGA A;  1DYQ A;  3EUB 2;  4US8 A;  1PFD A;  3ZQ4 A;  1J7A A;  4ZYS A;  3VR8 B;  1TKG A;  2WXN A;  1JWM D;  1T5X D;  2J4X A;  4B0E A;  1B1Z A;  1K50 A;  1TS3 A;  2PLP A;  4RCO A;  4P6V F;  2XN9 C;  1T3Q A;  1TS2 A;  5AUI A;  1E10 A;  1EWC A;  3AV8 A;  2QIL A;  1P7F A;  2QMT A;  4RH6 A;  1RM6 C;  4XDC A;  1FNV A;  3V3X A;  1I4Q A;  1KF6 B;  1I4X A;  3BK1 A;  1NEK B;  1ZP0 B;  2LMC A;  3PO0 A;  1WGK A;  1VLB A;  1ET6 A;  2N9L A;  4L1B A;  3NVV A;  4LLG M;  3AE7 B;  1AYF A;  2JU6 X;  4WAF A;  2JYT A;  2VZK B;  2I38 A;  2SAK A;  4HEA 1;  1F2R I;  3NVW A;  2LUM A;  1VR9 A;  3NVZ A;  5BYQ A;  3TUO A;  2FE8 A;  3AE8 B;  4YTP B;  1WWT A;  1V8C A;  1SB3 C;  1FIQ A;  1CQV A;  2HDE A;  4US9 A;  3HVZ A;  1JWU D;  3ETR A;  1C9F A;  4KKI A;  3AEB B;  2QEJ C;  1NYQ A;  2H89 B;  2N7J A;  4A90 A;  4ZHO A;  1I4P A;  1N62 A;  2WU5 B;  3SFE B;  2HTM E;  4HRS A;  3ZGZ A;  2QJL A;  2IGH A;  2LHE A;  3T3N A;  3BZD B;  1FFU A;  3KWV A;  4TQ0 A;  4JX1 C;  4NZL B;  2CJO A;  2GI9 A;  4HRO A;  1HZ6 A;  4UDU C;  2DBY A;  2XNA C;  2JXT A;  1QLB B;  1XLO A;  3AE3 B;  4DXG A;  2Y5C A;  1K53 A;  2LHD A;  4AQ7 A;  1NEN B;  1NYR A;  3NS1 A;  1KLG D;  2GB1 A;  2BTE A;  1XEE A;  3VRB B;  2MH7 A;  4JWU C;  1PGB A;  3FIL A;  2G9H D;  3AB5 A;  3ZYY X;  2LJI A;  4ARI A;  3CWI A;  3U2S C;  2NTS A;  3VRA B;  1QOF A;  2BS3 B;  3LYY A;  3ABV B;  1IBX A;  3EGR A;  3I57 A;  3R2I A;  1NI3 A;  3W2D A;  3BVG A;  1V1P A;  1FO4 A;  4WWM A;  4OW0 A;  1EU4 A;  1UNS A;  1TZO A;  1EM7 A;  4NAM A;  2K5P A;  4DQO C;  2IGG A;  4NAW B;  2KMM A;  1RWS A;  1STE A;  1YN5 A;  1MHX A;  1TYG B;  2H88 B;  1VZ8 A;  3NVY A;  4RGT A;  2PVO D;  5G5G A;  1D4B A;  2V4I B;  2Y3A A;  2LEK A;  3P4P B;  5HHD G;  3ZJV A;  1SEB D;  4GDK B;  1UUP A;  2J42 A;  4HKZ E;  3PZ7 A;  1MVK A;  3U4E G;  2W55 A;  3FC4 A;  3BII D;  2BB6 A;  1ET9 A;  1TY2 A;  4N58 A;  1E0Z A;  1VJK A;  1CK1 A;  2WP9 B;  3GP7 A;  4MT5 A;  1E9M A;  3P63 A;  3PZ8 A;  2FUG 1;  1JW9 D;  4XDD A;  2L83 A;  5HI1 A;  1IUE A;  4XWT A;  1PGX A;  2W82 A;  1VZ6 A;  2JZP A;  2M19 A;  4KGR A;  1F77 A;  1ZDX A;  5AUK A;  3VQI A;  2KAJ A;  5GXG B;  1HXY D;  2AQ2 B;  1HA5 A;  2M0A A;  1SBB B;  3SEB A;  2IDY A;  1EU3 A;  1AN8 A;  1OQQ A;  2MJ3 A;  5HFY A;  1L6U A;  4TMA B;  1P7E A;  2PW9 A;  2KWD A;  4YTN B;  1D6E C;  5H8Y E;  2IPK D;  3B9J A;  2V0G A;  2W3R A;  1JWB D;  3AEG B;  2N9K A;  4PT5 A;  1DGJ A;  4YSX B;  4KGS A;  2WQY B;  3P42 A;  2WDR B;  1T6B X;  2INP E;  3AEA B;  5LNK 1;  2WXO A;  1MI0 A;  4J3O D;  2KQ4 X;  2CJN A;  2LFI A;  1FFV A;  4H2A A;  1D5M C;  1L6V A;  2DYM A;  1V1O A;  3AH7 A;  2WXI A;  2V3N A;  1D5Z C;  2WDV B;  1ROE A;  1KFY B;  2KAC A;  4A6Q A;  3AED B;  1JRP A;  1SSN A;  1BML C;  3P4R B;  1KH0 A;  3KLS X;  4DXF A;  3SR6 A;  3BWU D;  4L23 A;  1YN3 A;  3P1M A;  3TSS A;  1KLU D;  2W3S A;  1FEH A;  1SIJ A;  3W9C B;  4YWG G;  2B76 B;  3BVM A;  4MM3 B;  5D3D A;  3ZJU A;  1FNU A;  1PYW D;  4ITK A;  1VZ7 A;  1YQ3 B;  2N0S B;  3AM9 A;  4RNA A;  3TEX A;  4RGN A;  3IXS A;  2W54 A;  2Z8L A;  1UWM A;  2YEP F;  3L4P A;  1N61 A;  3RPF C;  1KRH A;  2QSD A;  1XLQ A;  1BUI C;  1OQR A;  3NUH B;  3P4Q B;  4ZRQ A;  3AE5 B;  1F2R C;  4IKG A;  1I4H A;  1GB4 A;  2IGD A;  2M56 B;  2E3T A;  4WIP A;  2FBW B;  4HJG E;  2RDH A;  2WXF A;  1Q10 A;  3LB8 C;  5BYR A;  2NTT A;  1L4D B;  4USA A;  1J7B A;  1AWD A;  1XLN A;  1FCL A;  2AQ3 B;  5FKA C;  1V97 A;  1RYJ A;  1C4C A;  1RFK A;  3NRZ A;  1XXG A;  1QOA A;  4M0W A;  3UI3 A;  2RDG A;  1YJJ A;  2V3P A;  3AEF B;  1WXQ A;  4WH4 A;  1C79 A;  1E7P B;  4LK0 M;  1N5W A;  1FXA A;  3FIL B;  3T3O A;  1MHH E;  3LXF A;  1BXT A;  1FNW A;  1XLP A;  2PKO A;  1YNT E;  1C4P A;  1JWA D;  1IBX B;  4YT0 B;  1ENF A;  3E56 A;  1VRA B;  2D5G A;  1V1P B;  2DYO A;  4GDL B;  1WYG A;  4AS1 A;  5E6J A;  1TKY A;  2CU3 A;  3CIR B;  3BYT B;  3AE9 B;  2WDQ B;  2X38 A;  2K3U A;  5EE1 A;  4CQN A;  4NJC A;  4MH8 A;  1N5X A;  2WXR A;  1TY0 A;  2YEP B;  4D2K A;  1GB1 A;  1OFF A;  4TSS A;  3W5U B;  3ZJT A;  2L1A A;  3DWM A;  4REZ A;  1IGD A;  2BB5 A;  4IDI A;  3AE2 B;  3GB1 A;  1R7S A;  3C8Y A;  2WXG A;  2OHF A;  1DOX A;  1I7H A;  1FMA D;  1FRD A;  5TSS A;  5BMG A;  1I4G A;  2K22 A;  1HQR D;  2WXH A;  2EKI A;  4MAC A;  4RGO S;  2JSV X;  4RFB A;  1DOI A;  2BYT A;  3U7Z A;  1ESF A;  1FRR A;  1ACC A;  3IAS 1;  2VZK D;  1TS5 A;  3O13 A;  5BMI A;  1YQ4 B;  3TEZ A;  3EA6 A;  3Q8F A;  2RMM A;  4N59 A;  3DWG C;  2QIE B;  2PTL A;  3NZ3 A;  2JX5 A;  4A8X C;  4C7Y A;  5EE0 A;  1FXI A;  2L52 A;  1EWY C;  1TS4 A;  4C7Z A;  3W5V B;  2ONQ A;  4GLS C;  2WXJ A;  2WNM A;  3AE4 B;  1JWS D;  2ICI A;  3H8H A;  1JML A;  4KKJ A;  2BW2 A;  4O1N A;  3R8B A;  1L0Y B;  3IT4 B;  4JE3 B;  1K52 A;  5FR3 A;  1XO3 A;  1SE4 A;  2SEB D;  1JAL A;  2ZW1 A;  2BS2 B;  4OZB A;  3MHZ A;  1PUT A;  2ZW0 A;  1UWX A;  2INN E;  4RF1 A;  3Q8C A;  2NMQ A;  4P16 A;  1D5X C;  2IJ0 A;  4TQ1 A;  4LTU A;  5T8I A;  1L0V B;  1SF0 A;  4L2Y A;  5I4D A;  1SJE D;  3AE1 B;  4EE2 A;  3U52 E;  4YSY B;  1L4Z B;  4XE0 A;  4A9A A;  2BT6 A;  2BS4 B;  5C2T B;  4OZC A;  2I2Y A;  4YTM B;  2WXM A;  2K0P A;  3AMZ A;  1JCK B;  4JWS C;  1GOZ A;  4WQM A;  3Q8E A;  1TJE A;  3FAH A;  1QQR A;  2LGI A;  5HG2 A;  1ZXH A;  4YXD B;  1LO5 D;  3AE6 B;  4A55 A;  1WRI A;  1NVI D;  2WXK A;  2WLB A;  2Q5W D;  2EEL A;  2R61 A;  4FXC A;  5JXV A;  2WU2 B;  1JQ4 A;  3KWL A;  1C76 A;  1L0X B;  3RFZ B;  4ARC A;  1MPE A;  1N63 A;  5EE9 A;  3AEE B;  3Q8B A;  3N9Y C;  1AW7 A;  1M4V A;  2J53 A;  1N60 A;  3BK2 A;  1CJE A;  1YN4 A;  1GPX A;  1ZOY B;  4R3D A;  2MJD A;  1XCQ L;  1UGJ A;  2GRI A;  5BYS A;  4RGM A;  1XCT L;  2Y5P A;  4OVZ A;  3WCQ A;  3IT6 B;  3KQ4 A;  1C78 A;  1SXT A;  1CZP A;  1TKE A;  4C80 A;  2KDM A;  3SFD B;  3TEW A;  3MFG A;  1I4R A;  1YJI A;  2WS3 B;  1SE3 A;  1QOG A;  1ZUD 2;  5MPO A;  1PDX A;  1C77 A;  1FM0 D;  2PIA A;  3TEY A;  2WXL A;  3P4S B;  1QOB A;  2JQR B;  2TSS A;  1ZDV A;  4KX6 B;  3Q69 A;  2L32 A;  4RF0 A;  5H92 C;  1QT9 A;  4OZA A;  4ZRP A;  2AQ1 B;  2ON8 A;  2PVG C;  2K9X A;  1HZ5 A;  4ZHP A;  3E9S A;  3I9V 1;  1GAQ B;  2RPV A;  2KN4 A;  4KGT A;  5BMH A;  5C3J B;  1B9R A;  1SJH D;  5EE3 A;  5G5H A;  1HEZ E;  5FK9 C;  1ZE3 D;  1L5P A;  3MC0 B;  1SE2 A;  4B0M A;  1FD6 A;  1K51 A;  4JPS A;  1ZXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...