1JWAD

Structure of the atp-bound moeb-moad protein complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
publication title Mechanism of ubiquitin activation revealed by the structure of a bacterial MoeB-MoaD complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 16
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2001-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwaD00
4WQMA 2M56B 4C80A 1FXAA 2BS2B 2PIAA 4ZHPA 4N6EB 1OQQA 2WDQB 2WP9B 1VDVA 2L52A 3NVVA 1FO4A 3KWLA 3PO0A 3B2GA 1TJEA 2L83A 2WDVB 1FFVA 5EE9A 1RYJA 1JROA 5H92C 2WQYB 3HVZA 1A70A 1FMAD 1GAQB 3B9JA 1JW9D 4ITKA 3AB5A 1N61A 3DWGC 1AYFA 1JWAD 1DOIA 3VRAB 1JQ4A 1NI3A 2OHFA 1T3QA 2PKOA 3AH7A 3AEFB 2K5PA 1OFFA 1XLQA 1WXQA 1CZPA 2CJOA 1GPXA 3ZYYX 2WU2B 1SF0A 1RFKA 3NVWA 2Y5CA 5AUIA 5MPOA 3SFEB 4USAA 5H8YE 3AE6B 2W3SA 1J7CA 2K9XA 3RPFC 1FIQA 2ACZB 1EWYC 3SFDB 4A9AA 2G1EA 1TKEA 2W55A 1NYQA 5EE1A 1KRHA 1N62A 1YJJA 5GXGB 1QT9A 3NVZA 3SR6A 3W5UB 1E6EB 2MJEA 2PVOD 2MJ3A 1PFDA 1QOGA 5C3JB 1N5WA 2JX5A 3HUIA 1R7SA 1I7HA 3AMZA 1B9RA 4N58A 2W3RA 3FAHA 4US8A 3AEAB 1N63A 2FBWB 1QOBA 2MJDA 1XLPA 4N59A 3VR8B 3CIRB 3P63A 2B76B 1QLBB 1VLBA 1J7BA 2CU3A 2W54A 4ZOHC 5G5HA 1QOAA 1SB3C 1DGJA 2BS4B 4C7ZA 1WGKA 2MH7A 1YQ4B 4LTUA 1E7PB 3P4QB 4WWMA 4YTNB 1L6UA 1PDXA 1ROEA 2QIEB 3AECB 3AV8A 1XLNA 4YXDB 5C2TB 3DWMA 2E3TA 1FM0D 1WRIA 2EKIA 4YSXB 4C7YA 1XO3A 2PVGC 2LEKA 3L4PA 1TKGA 3AE2B 1TKYA 3W9CB 1WWTA 1E0ZA 1IUEA 2DWQA 3AE3B 3EUB2 3P4PB 1ZUD2 4HRSA 4YSYB 1NVID 1TYGB 1SIJA 1FFUA 1KF6B 4US9A 1ZXIA 1JRPA 1FXIA 2KAJA 2N0SB 4IDIA 4HROA 4P6VF 3WCQA 1QF6A 1V8CA 1L6VA 2BS3B 2WU5B 1ZOYB 3P1MA 4YTMB 3AE1B 3BIID 1XLOA 1KFYB 1VJKA 3AN1A 3W5VB 1RM6C 4JWSC 3B2FA 3NS1A 4KX6B 1QOFA 1YQ3B 3VRBB 3AE8B 1NEKB 3ETRA 1DOYA 1N5XA 2M19A 2QJLA 2H88B 2JQRB 1DOXA 4JWUC 3VR9B 1V97A 1J7AA 5EE3A 1JALA 3FC4A 1F0ZA 1PUTA 1ZP0B 3AE4B 1AWDA 1E9MA 3AE5B 3AEGB 3LXFA 4YT0B 5EE0A 2WS3B 4ZHOA 1FRRA 3HRDD 4YTPB 2CJNA 1CJEA 3P4RB 2WLBA 1RWSA 2DBYA 3AE9B 3NRZA 3AM9A 3CWIA 5AUKA 1NYRA 1UWMA 4FXCA 5G5GA 2HTME 1N60A 3P4SB 1YJIA 4YSZB 1FRDA 1WYGA 2K22A 2H89B 3AEBB 2AX5A 3ABVB 3AEDB 2Q5WD 1E10A 1L0VB 1L5PA 1JWBD 2KMMA 3AEEB 3LB8C 1NENB 2BT6A 2WDRB 4JX1C 3AE7B 1OQRA 3NVYA
chains in the Genus database with same CATH superfamily
4DXGA 4KZ0A 4ZRPA 1TIFA 1XD3B 4WJPA 3NZUA 3V3XA 4C00A 1A70A 4ITKA 1BXTA 1N61A 1SXTA 1WI0A 5D6JB 3K9PB 2NCNA 3ZTDA 2AEHA 3V60A 4M02A 3N1XC 2WU2B 3LDZE 5MPOA 2W3SA 4KGSA 1GB1A 4YWGG 4KKIA 4BBNC 2ZW1A 1L4ZB 4RH6A 2PE9A 2FIFA 5C23A 3Q8BA 2KZRA 4DHZB 1V1PA 1DGJA 4WWMA 2XK5A 1WXSA 3FILB 5J17A 2AQ1B 2KANA 2J4XA 3KH0A 5C1ZA 2KJ6A 4TQ1A 2LEKA 3RZFA 1Q5WB 1IUEA 2HE7A 4B0MA 5D7GA 1IYFA 1S3SG 2LVQA 2V3SA 1ZXIA 2XNAC 3KUDB 1BT0A 4C4VA 4DWFA 3NS8A 1KFYB 5GMVA 1RM6C 2MSED 3PLVA 4LDTB 1WJUA 1WGGA 3ETRA 4J6IA 4WIPA 2QJLA 1DOXA 3FC4A 3KVFB 2G45B 3W2DA 2DLBA 3KW5B 1YD8U 2KWDA 3C19A 5AUKA 2DNFA 1HXYD 1S1QB 4B0EA 3WANA 1JCKB 2R2QA 2LD9A 2RPQA 2N9EB 1M4VA 2DX5B 1K8RB 3EC8A 3RCZA 4FJZA 2C7MB 1GC7A 3VUYA 2JWZA 3DBSA 1TJEA 2KVRA 1WGRA 2V9HA 3V6EB 1IBXA 1FCCC 3N9YC 3VRAB 2ZVOA 3RULA 1IGCA 2AWTA 1C76A 1XLQA 4ANUA 1GPXA 2JSVX 3BY4B 3SFEB 1HZ6A 3ZJVA 2K9XA 2ACZB 2HDEA 1YJ1A 2BQQA 3DVNV 2BB6A 1OQYA 1MI0A 1SE4A 2LGSA 3Q3JA 2AL3A 1V1OA 4PS8A 4OVUA 1WYWB 5JHBA 2KWVB 2K3UA 2K8BA 4IM0A 4QAYA 1BMLC 3A4RA 4A90A 4YXDB 2KJHB 1WGYA 2V3NA 2X38A 3HHMA 2JY6A 3IG3A 2NBUA 1UH6A 1Q0WB 4G0NB 1I4GA 4EOYA 4XDDA 3QA8A 1FXIA 5LLIA 2B3AA 1OGWA 1E90A 3KUCB 1D5ZC 3ZRCA 3ONSA 4FHKA 2DHZA 2YEPB 1E7VA 2PTLA 2MP2A 5EE0A 3R2IA 2PJHA 1CJEA 3ZJUA 2LGDA 3PZ8A 3ZKJC 5HKHA 3HIZA 1WJ4A 2R61A 3NZSA 3BVGA 3ALBA 4HWIB 1TTNA 2BS2B 1J19A 1V1PB 3ML8A 3Q6BA 3IXSA 2KDIA 4MGKE 5HI1A 4B95A 4E74A 2PMVA 1QZEA 1RYJA 1WIAA 3Q3FA 3HVZA 2DYBA 2XN9C 2GBMA 3KYCD 2OJRA 4FULA 3AH7A 2LGIA 3WALA 4LNFA 4ICVA 2Y5CA 4C4VB 4USAA 2VH1A 1QQRA 4RM9A 1ZE3D 4K3CA 3MC8A 1JWUD 3GP7A 3MHSD 4BVUC 3RI7C 2FCMA 4GOCA 3CIRB 3U2SC 1QLBB 2CU3A 4M00A 3H1UA 2DYMA 2PEAA 1R4NI 2CS4A 5G2NA 1K51A 3RZWC 1JRUA 2EKIA 3IT6B 1MVKA 2LASA 4C56C 5IKCM 1Y56A 2RPVA 2QDFA 3Q69A 4A55A 1P0RA 2N0SB 4JIOU 2ICIA 4K7UA 2INPE 1LM8B 4YTMB 2INNE 1IBXB 4OZAA 1V49A 1WF9A 2KX0A 2L1AA 3RFZB 1DOYA 1N5XA 4BFRA 4NY0A 5FKAC 2O6VA 2PLPA 3U52E 3VXWA 2O6VD 3JYUA 3ZUNA 3FKYA 5E6NA 4MGZE 1NYRA 4ARIA 2W82A 2YEPF 5CHWA 3RD2A 5BMHA 3ZDMC 1IPGA 3ABVB 3I5JC 4XC2A 1L5PA 1RFAA 2Z0EB 2BVCA 3EFUA 3AE7B 1FO4A 3PHWB 3S2AA 3PO0A 2WDVB 4DXAB 3WAPA 2LJ5A 2NTTA 3PSEB 3RMKC 2LGXA 4AUQC 1ET9A 4K1RB 2FAZA 2K5PA 2JZZA 3IHPC 1HA5A 4PS7A 4GB9A 1R4NB 2KX3A 1QILA 3DBHI 3RPFC 2M17A 3P42A 5CHFA 2N9LA 2BB5A 4CHKA 3V61A 1KLGD 1SBBB 2WDTB 3FAHA 1WXMA 1QOBA 3VR8B 3EGRA 2MP2B 3BK1A 5IN7A 4C7ZA 2BS4B 1C79A 1E7PB 3NHEB 4A3PA 1P9DU 3DHHC 1NDDA 1EO6A 3AE2B 2MRPA 2NR2A 5IOIA 1LO5D 2EMTA 1PQSA 1C3TA 1T0SC 3RNFC 2ZCCA 3RN9C 4GN1A 4P6VF 4PK1A 3IFWB 2Y3AA 4D2KA 3WIMA 3QQ8B 1XLOA 4JWSC 3BYYB 1JMLA 4MSQB 4A3OA 1ZGUB 3NJTA 1JALA 4KIKA 1MFWA 2CHXA 4YT0B 1YN4A 3I9V1 1D3ZA 4LK0M 2D3AA 1LGRA 3P4RB 3AE9B 4HKQA 3CWIA 4X57B 2JPHA 3DVGX 2BYTA 2I38A 1MG8A 2K22A 2PPHA 1ZKHA 2J0KA 1L0VB 2A4ZA 2QCZA 1OQRA 2JWUA 2INCC 2M56B 4YL8A 1VZ7A 2L52A 2KQ7A 2KACA 3N3KB 1E8WA 1YOVB 4HJKA 2CKHB 1DYQA 1F52A 1M94A 3ZW3A 4OW0A 3AU5A 4BKSA 1GOZA 3GB1A 5FR3A 3K9OB 4XDCA 1I35A 1F9JA 4BKSD 3NVWA 2YVCA 4S17A 1WE7A 2K6QA 3IT4B 2WHIA 3TEZA 1UUPA 4MACA 2AL6A 3VAWA 2NPTA 1SJED 2MBOA 1YMHE 3DBRI 5DPTA 2LVPA 2O6VB 1N63A 2MBBB 4GDKA 1R4MI 2FNJB 1XLPA 4HEA1 1WJ6A 3N1YC 1WGKA 3A9JA 2MCNB 1ROEA 2MHJA 1XLNA 1VR9A 3DWMA 1ZXHA 1TKGA 2BGFA 3L10B 4B6WA 1ISNA 4ANWA 3P4PB 4YSYB 2LHEA 1EF1A 4EZLA 4KVGB 3I3TB 2QC8A 2Y5BB 4IDIA 4HROA 1V8CA 1GG3A 2DAFA 2NBVB 2LRWA 1D4BA 3VUXA 2I1KA 1VJKA 2TSSA 4K7WA 2WX1A 3VRBB 2KNBA 3OJ4B 4HKZE 2O2VA 1ENFA 2V1YA 3T9LA 1AW7A 3TL5A 4XGAB 4EZKA 2ZEQA 1FNUA 2QILA 5G5GA 4TSSA 1I4QA 5LNK1 1L0YB 4H2AA 4LCDE 2LXAA 2XBBC 2KDEB 1VDVA 3U8ZA 1WSPA 4K3BA 4NJCA 2RDGA 1UBIA 1FMAD 1WJNA 2IBIB 4L2YA 1AYFA 4ZRJA 1PGBA 2LXCA 3ML9A 1Q10A 4RM8A 3MTNB 2JVCA 2QSDA 4KSLC 3AE6B 4GIVA 3QJZA 3PRZA 2M0XA 3SR6A 2MBQA 3VVWB 4DDGD 1YIWA 3W5UB 3V05A 1V6EA 3LYYA 2WXOA 4N58A 1GC6A 2IPKD 4KIKB 1J7BA 3E9SA 3NG0A 4GDLA 1TY2A 4FJYA 3URYA 1E5WA 3WAOA 2M1MA 2BTEA 4HRSA 1TYGB 1FEHA 2IO2B 2CR5A 3P1MA 1FD6A 4E71A 2N4FA 3RNCC 2GBRA 3N30A 4HK2A 1OEYA 3L54A 5AZGA 4G50A 1KTKA 2INDC 1P7FA 1XT9B 1ZDXA 5D3DA 5LXHA 4BBNF 1ZP0B 1V86A 4ZHOA 1WR1A 1OEYJ 4YTPB 4NQKE 3EHVA 2RDHA 2DBYA 2MX2A 4XWTA 3VTVA 1UWMA 5D3IB 2IGHA 2NPTB 4IUMB 4IC7B 1YJIA 3H7PA 3ECIA 4AP4C 3AEBB 3HVDA 3PRPB 1WXAA 1JWBD 4GDKB 2DAJA 2BPSA 4ZYNA 2L3ZA 2NTSA 3R66C 3A9JB 3R3MA 4TKNA 2GOWA 3QIJA 2MQJA 4N9F4 5AZHA 3AB5A 3DBLB 2RD0A 4DHZE 4XYCA 1TS4A 2ASQA 2CJOA 4P16A 4WQOB 4JGHB 5D2MB 3ZGZA 4AWJA 3SFDB 4A9AA 1Z5SB 2G1EA 3KUZA 2W55A 2BYFA 3BINA 2LHDA 3O65B 3OG5A 1E8ZA 2JX5A 4F8CB 3AMZA 1B9RA 2B76B 4NJ6A 5D94A 1XEEA 2O2VB 1EU4A 2GI9A 4ICUA 1A5RA 1XO3A 2KMCA 3ZNHB 4PS3A 3U4EG 1TT5B 2KQSA 2K6DB 2D10A 4J3OD 3ZLZA 1JRPA 2KXJA 1P3QU 1ZOYB 2KFKA 1WE6A 4HPMB 4Q2JA 4HXDA 2LJIA 3VTWA 5EDSA 4HJGE 4JWUC 4W9IA 2L7RA 1PUTA 4A8XC 2JXXA 1I4PA 1T5XD 2CHWA 4HCNB 2FUG1 2WXHA 4PYUA 2JZ3B 1ACCA 4DK5A 3UF8A 3SHQA 4RGMA 1WX8A 4W9DA 1E8XA 3D32A 1OQQA 2WP9B 4GDLB 3T3OA 3SDLC 2L00B 1KH0A 1VCBA 2WXRA 4WURA 4DBGA 1JROA 2JYTA 2D3GA 3EECA 5DCNA 4LNKA 2DENB 3L17A 2ZZPB 1UWXA 1XCQL 1TS5A 4LLGM 1RFKA 2KLCA 1RLFA 1KM7A 1SGHA 3BWUD 1NBFC 4RGTA 4O1NA 2OJWA 1I7HA 2I2YA 2KLGA 1XF5L 2FBWB 2MJDA 1VRAB 2BW2A 2W54A 4JLCA 1Z2MA 1FCLA 4W9EA 2KJRA 2FCSA 5KHQA 4XX5A 3AV8A 4K7SA 1FM0D 1XQQA 3H7PB 4S0RA 1TZ1A 1V81A 2DWQA 1WY8A 3PTFC 4L1BA 2QEJC 1KF6B 5BYSA 1SSNA 2D11A 5LXIB 3ZXVA 2VRRB 1K53A 2C60A 3BIID 2IGDA 3W5VB 2ZPNA 3V62A 4OZBA 2N9XA 3AE8B 5DPSA 2DZKA 2DZMA 2VZKD 3CSFA 2ZW0A 2HTHA 4RCOA 3X0WA 1EF5A 1Q1OA 4ZDVA 3GZNB 2WXGA 3AM9A 2LFIA 3B08A 1P98A 1FRDA 2YLMA 1E10A 2Q5WD 3PZ7A 3MC0B 4OVZA 3NZ3A 4IOIE 4XE0A 2FUHB 1Y8RC 4L23A 4IWOA 3EA6A 4ARCA 1P1AA 1FXTB 3KWLA 3A1QA 1C78A 2CHZA 4IW0A 2WQYB 3B9JA 2DZJA 1TGZB 3DVNU 2LZ6A 2JRHA 3W1SA 3AEFB 2LRUA 4IM3A 4EKUA 3VH3B 4MSMB 1H8CA 2BF8B 2G3QB 5AUIA 3PVLA 2KFKB 2IJ0A 2R2OA 3RNGC 5G55A 3HM6X 5BO4B 4G11A 5IO9A 1E6EB 2MJ3A 2WXKA 2MWSB 3VDZA 4RMAA 2W3RA 2EKEC 2BYVE 2N7JA 2IO3B 2LI5A 2WWZA 2MH7A 2J0JA 1WH3A 4MM3A 2L8JA 1SE3A 2FE8A 1AN8A 3DCGA 2ZNVC 3OAWA 1J8CA 1C77A 3EUB2 3ZXRA 2BWFA 4WH4A 1F2RI 2MBEA 4US9A 1UNSA 2KAJA 3CMMB 3T3NA 1JWMD 1QF6A 3Q3NC 3AE1B 2PE6B 2M4NA 4BAXA 4CYEA 4FADA 5IP4D 1NEKB 4BOZB 3R8BA 5L95C 4JPSA 3DDCB 3ZIMA 3QWZB 5J18A 3AE5B 4AJYB 2KMAA 1FRRA 1D5XC 2BKRB 5KHOA 4KDIC 3VHTC 1I42A 3C0RB 1WM3A 4ZRQA 2WXNA 2IY1B 2KDMA 1PYWD 3NVYA 2BWES 1TBEA 2Z59B 2WDQB 4IG7B 3ZTCA 2GMIC 1FFVA 2JYEA 2KVZA 2KN4A 1MJDA 4AJWA 4II3B 4NAMA 3PREA 1DOIA 2WXIA 4UDUC 1L0XB 3IAM1 2UU7A 2KK8A 2L32A 2RR9A 5HG2A 2HJ8A 3TEWA 5H8YE 1I4XA 1UGMA 1EWYC 3ZNGC 1UBQA 5HFYA 1N62A 2VZKB 1T0YA 4NAWA 5C3JB 1N5WA 3AI5A 4LNNA 4KV2A 4G3XB 3NOBA 4M0WA 2FCQA 5E6JA 4LNOA 1QOAA 3DOWA 4EE2A 1YQ4B 1IGDA 1L4DB 5J2RA 3PV1A 2KDFB 4TMAB 5AEKB 4I6NB 2N7DA 3PHXB 2D5GA 2KTRA 1KLUD 2KTFA 1VZ8A 4AS1A 2N7EA 3TBLD 2UYZB 3WCQA 1YQBA 3L08A 1L6VA 3A1QB 3RNBC 2JRIB 3SD5A 2QHOA 2KHWB 4W9JA 3B2FA 3U30A 3R2TA 2KKCA 1WMHA 2M19A 1MPEA 2JQRB 1XXGA 1J7AA 1KLVA 2KN5A 2PW9A 1HTOA 3NRZA 1VZ6A 3A4SC 3B1LX 4PYZA 2JZPA 4IWPA 1V5TA 2WXPA 1KJTA 3RNEC 4GMVA 2FCNA 2IO1B 3AEEB 3UQAA 4JX1C 2WDRB 1FNWA 3OLMD 2PIAA 1CMXB 4N6EB 1ESFA 1RRBA 2EMSA 1CQVA 3TMPB 2L83A 1K50A 4MM3B 3H8HA 5TSSA 1SIFA 1T3QA 4ZRIA 1C4CA 4NPNA 4W9KA 2MEKA 4MH8A 2C7HA 3DVGY 2M8SA 2A5UA 1EUVB 3JW0X 4WJQA 3PZDA 2JXTA 2KC2A 4KGTA 4GSWA 2MA9B 3L16A 3PS6A 4KGRA 3MJ5A 4IM2A 2WXLA 3BVMA 4LTUA 3P4QB 4YTNB 4RNAA 1L6UA 3BK2A 4NJ7A 1V9JA 4GXBA 3E56A 1ZDVA 4ANXA 1YN5A 2PVGC 2WXQA 1STEA 3W9CB 4EFOA 1HEZE 3VUWA 1WRDB 3KYDD 3Q8FA 3PGEA 4MDKE 3TEYA 3DBLI 3Q2AC 2N1WA 3W1SC 2C9WB 2K8HA 2KO3A 1TS2A 3U7DA 2WGSA 4KX6B 1QOFA 3GS2A 5IA7A 1UD7A 3ZNID 3UIPB 2HJ1A 2L0FA 2H88B 1WZ3A 4FLHA 3AE4B 1AWDA 1C9FA 3HRDD 5FK9C 1E8YA 2KWUB 4DDID 2ZVNA 4LJOB 1B1ZA 2IYDB 4KZCA 4NAWB 1L7YA 3KWVA 4KKJA 4YSZB 2BYEA 3UINB 3MJWA 2GLSA 5CTRC 2J0MA 4M0WB 4ZHPA 5JH5C 2DZIA 4EZJA 1WX9A 2LUMA 2C7NB 5H92C 3Q14C 2W9NA 1GAQB 2V0GA 2JUOA 1EWCA 3DWGC 2KTRB 4WAFA 4HVBA 2PKOA 3BZDB 1EM7A 1V2YA 1CZPA 3ZYYX 2G4SA 2C5LC 4FJVB 5T8IA 4BKGA 4KDLB 5EE1A 1V5OA 4WWOA 1MHXA 1QT9A 2AQ2B 3NVZA 4F7ZA 2IDYA 2WXFA 4BZAA 2UWQA 2KD0A 1WMHB 1R7SA 3UQBA 2X8XX 4W9FA 3N1ZC 4MJSA 2GBNA 4N59A 4OVVA 1VLBA 1BUIC 3A9KA 1PGXA 2IY0B 3ZNZB 4ZRKA 1TKYA 1TS3A 1FNVA 1WWTA 2KC1A 4TUUA 2MW5A 5CHVC 3W1YA 2D3CA 2KQ4X 5FR6A 4OZCA 5I4DA 1YQ3B 1GUAB 2M0AA 1T6BX 2XEWA 4W9GA 4RFBA 1V97A 5JXVA 5EE3A 3V6CB 2L76A 4HDQA 5L83A 4GLSC 2HTME 4GU2A 3Q3OC 2J53A 2K0PA 3OJ3A 4I6LB 4JE3B 1WM2A 2KMMA 3P2BA 2NS5A 1FXAA 1SE9A 3B2GA 3EFCA 1UELA 3VQIA 3Q8EA 1CK1A 2JF5A 3UIOB 3KLSX 3KQ4A 1I4HA 4OHJA 3PRMB 1MHHE 4RF1A 2HD5B 3PT2B 3M63B 1WXQA 1JWSD 3RYTA 3WA0A 1FIQA 4GGQA 3M95A 2J52A 4P1CC 3QX1A 4DHJD 4I6PA 2WXMA 1T0RC 2Z8LA 3QC8B 4NZLB 4DXFA 4P1BC 3GZNI 3M62B 3AEAB 3TSSA 4RGOS 3M3JA 3P63A 2J7QB 4ZOHC 2KDBA 1L2NA 4MGIE 3TIXA 1LXDA 3AECB 1F1HA 5C2TB 5JZEB 2WXJA 4YSXB 2IZVB 2LMCA 3AULA 3AXCA 2E6XA 2KT7A 3RUIB 3ZO5B 1U4AA 1ZUD2 2WYQA 1FFUA 1WR6E 4IKGA 4RGNA 4EUTA 2BS3B 2WU5B 3APDA 1C1YB 3AN1A 3BYTB 2JT4B 2V3PA 4JL9A 2RMMA 2XK5B 4LNIA 3GOEA 1WGHA 4W9HA 3LXFA 4M8NA 2OEDA 5AZFA 2AQ3B 2ZNVB 3LJ3A 4BKTA 2K1FA 2KWCA 3P4SB 4ASWC 3QARA 1T0QC 2AX5A 3OWEB 1ZW7A 3B0AA 4FA6A 4MJSB 2NBWB 2NVUI 3A9KB 4WWPA 4XZ4A 1TY0A 3RNAC 1EU3A 1GB4A 1C4PA 1KOTA 3A33B 5BMIA 1JWAD 3AU4A 2L0TA 4W9CA 1OFFA 4HPLB 4PT5A 1SE2A 4KSKC 1WGDA 3TJPA 1KRHA 2MLBA 2DYOA 4NNJB 5GXGB 3N20C 4F1SA 3HUIA 3H9DA 1ZPSA 1SB3C 2RDBC 4FN2A 1X1MA 1PDXA 2WX0A 3IVFA 1E7UA 4JQWC 2SEBD 3QK0A 1QKZA 2D2QA 4TV3A 4MEMA 3AE3B 2LUEA 3ZQ4A 2G9HD 2ZPYA 1WXVA 3UGBB 1D5MC 3JSVA 3MFGA 4A6QA 5CX3A 1XCTL 2V4LA 4M8MA 3CSTA 2BBCA 2KYWA 2I1JA 3VR9B 3APCA 4MELA 2G4DB 1E9MA 3AEGB 3MP9A 4WWNA 2WNMA 3RT3B 2CJNA 4DHJB 1RWSA 3MC9A 3NUHB 3DQVA 3R7RA 1H4RA 3DHIC 4CQNA 1FPYA 1MG4A 4XWWA 3Q3MC 2LGYA 3AEDB 1HZ5A 3LB8C 1NENB 5HHDG 1N6ZA 4EEWA 2Z0DB 2GB1A 2KOXA 4WQMA 2FIDA 4NQLB 2SAKA 2LVOA 3NVVA 1F77A 2N1VA 5IAAC 4ACFA 1HE8A 4FHJA 1V80A 3CF6E 3IBEA 4WAAA 1JW9D 5BMGA 4MGYE 4LJPB 1NI3A 1HTQA 3SU8X 4FBJB 2IO0B 2BKFA 3BVZA 3ZJTA 1J0GA 1C4AA 2JU6X 2N9PC 1TKEA 1K52A 4AQ7A 4W9LA 3H7SA 3PPAA 4E3CA 1QOGA 3VFKA 2IGGA 1WZ0A 1TZOA 3TEXA 4CO7A 2D07B 3O13A 3APFA 3QCAA 1UF0A 2LWPA 2QIEB 3X23A 3VTUA 2E3TA 1UZXB 1P7EA 2OOBB 4MH0E 5E6OA 1NVID 4RF0A 4MT5A 1SJHD 2CU1A 1VD2A 3J9CA 1GNUA 3NS1A 2K8CA 3GE8C 4A20A 3DBHB 1OTRB 1I4RA 1SEBD 1G6JA 1HQRD 3PLUA 2WS3B 1IP9A 1WFYA 5JHAA 2REXA 3R7QA 3Q8AA 2AYOB 2WLBA 5BYRA 2GRIA 3SEBA 3FILA 3HK0A 3L13A 3GE3C 2L05A 3I57A 4IWQA 3QHTA 1N60A 3UI3A 1WYGA 2H89B 3ENEA 1YN3A 4HPPA 3H6NA 3QAQA 4C80A 3I63C 3C8YA 2QMTA 1LQBA 5BYQA 3MHZA 1YX6B 5EE9A 4REZA 2J42A 3ZRFA 3N32A 2NMQA 1YX5B 2ON8A 3ZVVA 2OHFA 1JQ4A 2Y5PA 4URKA 4LDTD 4R3DA 4TQ0A 3ZDTA 5TR5A 1SF0A 1AARA 4M01A 1J7CA 3JSVB 3DHGC 1NYQA 1YJJA 2MJEA 2PVOD 3T8MA 4BOSC 1PFDA 2EELA 5DPRA 2ONQA 1WX7A 3TCAA 4US8A 2VH2A 2N9KA 3VH4B 5G5HA 3WAMA 3NY5A 4HLEA 1UGJA 2V4IB 3L0WB 1WRIA 4HCPB 4C7YA 1GJZA 2K25A 3L4PA 4K81A 3DPDA 1E0ZA 5E6PA 1SIJA 2KFJA 4WJOA 4DQOC 1RAXA 4P7IA 2GBJA 2K39A 2D3BA 4HDOA 1D6EC 1F2RC 4ZYSA 1LFDA 1ET6A 2RSUA 2ZJDA 4ANVA 4WJNA 4B9KA 1NI2A 1F0ZA 2MBHA 5DPWA 3DBRB 1PGAA 3Q8CA 3HM3A 1YNTE 2ZCBA 1R4MB 4FXCA 3IAS1 3JVZX 3TUOA 4II2B 4AOFA 2BT6A 2RGFA 3U7ZA 2GBKA
chains in the Genus database with same CATH topology
2M56B 1FXAA 4L23A 3EA6A 1VZ7A 4ARCA 2L52A 4DXGA 3KWLA 3B2GA 1C78A 2KACA 4ZRPA 3V3XA 3VQIA 3Q8EA 1CK1A 1DYQA 2WQYB 1A70A 3B9JA 3KLSX 1BXTA 1N61A 1SXTA 3KQ4A 1I4HA 4ITKA 4OHJA 4OW0A 3W1SA 1GOZA 1MHHE 3AEFB 3GB1A 4RF1A 5FR3A 4XDCA 1WXQA 1JWSD 2WU2B 3NVWA 5AUIA 5MPOA 2W3SA 1FIQA 2IJ0A 3IT4B 4KGSA 3TEZA 1GB1A 1UUPA 4YWGG 4KKIA 2J52A 2ZW1A 4MACA 1L4ZB 1E6EB 1SJED 2MJ3A 2WXMA 1YMHE 2Z8LA 4NZLB 4RH6A 4DXFA 2WXKA 2W3RA 3AEAB 3TSSA 1N63A 2N7JA 3Q8BA 4RGOS 1XLPA 4HEA1 3P63A 4ZOHC 1V1PA 1DGJA 1WGKA 2MH7A 4WWMA 1ROEA 3AECB 3FILB 1XLNA 1VR9A 2AQ1B 3DWMA 5C2TB 2WXJA 4YSXB 1SE3A 1ZXHA 2J4XA 2FE8A 2LMCA 2E6XA 1AN8A 2LEKA 4TQ1A 1TKGA 1C77A 1IUEA 3EUB2 3P4PB 4YSYB 1ZUD2 2LHEA 4B0MA 5D7GA 1FFUA 4WH4A 1F2RI 4US9A 1UNSA 1ZXIA 2XNAC 2KAJA 4IDIA 4HROA 3T3NA 1JWMD 4IKGA 1QF6A 1V8CA 4RGNA 2BS3B 2WU5B 1D4BA 3AE1B 1KFYB 1VJKA 3BYTB 3AN1A 1RM6C 2TSSA 3VRBB 2V3PA 1NEKB 3ETRA 4WIPA 3R8BA 2QJLA 1DOXA 4JPSA 2RMMA 3FC4A 3LXFA 3AE5B 3W2DA 4HKZE 1FRRA 1D5XC 2DLBA 1ENFA 2OEDA 2AQ3B 2KWDA 1AW7A 5AUKA 1FNUA 2QILA 5G5GA 1HXYD 4ZRQA 3P4SB 4B0EA 2WXNA 4TSSA 1I4QA 1JCKB 2AX5A 3OWEB 5LNK1 1L0YB 2KDMA 4H2AA 1PYWD 3NVYA 1M4VA 2WDQB 1VDVA 1WSPA 1TY0A 1TJEA 1EU3A 1FFVA 2JYEA 1C4PA 2RDGA 4NJCA 2KN4A 1GB4A 1IBXA 1FMAD 4L2YA 1FCCC 3N9YC 4NAMA 1AYFA 5BMIA 1PGBA 1JWAD 1DOIA 2WXIA 4UDUC 3VRAB 1L0XB 3IAM1 1IGCA 1Q10A 1OFFA 1C76A 1XLQA 4PT5A 1GPXA 2QSDA 2JSVX 2L32A 5HG2A 3TEWA 3SFEB 5H8YE 1HZ6A 1I4XA 3AE6B 2K9XA 3ZJVA 2ACZB 1EWYC 1SE2A 2HDEA 5HFYA 1KRHA 1N62A 2DYOA 2VZKB 2BB6A 5GXGB 3SR6A 3W5UB 3V05A 3LYYA 5C3JB 1N5WA 2WXOA 3HUIA 1MI0A 1SE4A 4N58A 2IPKD 1ZPSA 1V1OA 4M0WA 1J7BA 5E6JA 3E9SA 1QOAA 1SB3C 4EE2A 2K3UA 1YQ4B 1PDXA 1IGDA 3U7ZA 1BMLC 1L4DB 1TY2A 4A90A 4YXDB 4TMAB 3URYA 2V3NA 2X38A 2SEBD 2D5GA 1QKZA 2BTEA 3AE3B 4HRSA 1KLUD 1TYGB 1VZ8A 4AS1A 3ZQ4A 1I4GA 2G9HD 1FEHA 4XDDA 1FXIA 3WCQA 1D5MC 1L6VA 3P1MA 1FD6A 3MFGA 1D5ZC 4A6QA 3B2FA 3R2TA 1XCTL 1KTKA 2BBCA 2YEPB 1P7FA 1MPEA 2M19A 2JQRB 1XXGA 1ZDXA 3VR9B 1J7AA 5D3DA 1ZP0B 1E9MA 2PTLA 3AEGB 3MP9A 5EE0A 4ZHOA 2WNMA 4YTPB 3R2IA 2PW9A 2CJNA 1CJEA 2RDHA 1RWSA 2DBYA 3NRZA 3NUHB 4XWTA 3ZJUA 1UWMA 1VZ6A 5D3IB 4CQNA 2IGHA 2JZPA 3PZ8A 4XWWA 1YJIA 2WXPA 3AEBB 3HVDA 3AEDB 1HZ5A 2R61A 3AEEB 1JWBD 3BVGA 3LB8C 4JX1C 1NENB 4GDKB 2WDRB 5HHDG 1FNWA 2GB1A 4WQMA 2BS2B 2SAKA 2PIAA 4N6EB 1V1PB 1ESFA 2NTSA 3IXSA 3NVVA 1F77A 5HI1A 1CQVA 2L83A 2PMVA 1K50A 1RYJA 4MM3B 3HVZA 3H8HA 1JW9D 5BMGA 2XN9C 3AB5A 5TSSA 1NI3A 1T3QA 1TS4A 3AH7A 2LGIA 1C4CA 2CJOA 4P16A 2MEKA 2Y5CA 3BVZA 4MH8A 4USAA 3ZJTA 3ZGZA 3SFDB 4A9AA 1C4AA 2JU6X 1QQRA 2G1EA 1TKEA 2W55A 1K52A 1ZE3D 4AQ7A 2JXTA 2LHDA 4KGTA 1JWUD 1QOGA 3GP7A 2IGGA 2JX5A 3AMZA 1B9RA 1TZOA 3MJ5A 4KGRA 2WXLA 3TEXA 3CIRB 3O13A 2B76B 1QLBB 2CU3A 3U2SC 3BVMA 1XEEA 2DYMA 4LTUA 3P4QB 4YTNB 4RNAA 1L6UA 2QIEB 1EU4A 1K51A 3BK2A 2GI9A 2E3TA 2EKIA 1P7EA 3E56A 3IT6B 1MVKA 1XO3A 1ZDVA 1YN5A 2PVGC 4C56C 1Y56A 2RPVA 1STEA 2WXQA 3W9CB 3U4EG 1HEZE 3Q69A 1NVID 4RF0A 4A55A 3Q8FA 4J3OD 1JRPA 4MT5A 2N0SB 3TEYA 1SJHD 2ICIA 2INPE 1ZOYB 3J9CA 4YTMB 1TS2A 2INNE 1IBXB 4Q2JA 3NS1A 4KX6B 4OZAA 2LJIA 1QOFA 3GS2A 2L1AA 3RFZB 1DOYA 1N5XA 2H88B 4HJGE 4JWUC 1I4RA 5FKAC 2PLPA 1SEBD 3U52E 1PUTA 3AE4B 4A8XC 1AWDA 1HQRD 1I4PA 2WS3B 1C9FA 1T5XD 3HRDD 5FK9C 2FUG1 3Q8AA 5BYRA 2WLBA 2GRIA 3SEBA 2WXHA 3FILA 1NYRA 4ARIA 1ACCA 1B1ZA 3I57A 2W82A 2YEPF 5BMHA 1N60A 4NAWB 3KWVA 4KKJA 3UI3A 4YSZB 4RGMA 1WYGA 2H89B 3ABVB 1YN3A 1L5PA 3AE7B 1FO4A 4C80A 4ZHPA 3C8YA 1OQQA 2QMTA 2WP9B 3PO0A 4GDLB 3T3OA 5BYQA 2LUMA 2WDVB 3MHZA 1KH0A 2WXRA 4WURA 5EE9A 1JROA 2JYTA 4REZA 2J42A 2NTTA 5H92C 1GAQB 2V0GA 2NMQA 1EWCA 3DWGC 1UWXA 4WAFA 2ON8A 1JQ4A 2OHFA 1ET9A 2PKOA 2Y5PA 2K5PA 3BZDB 1XCQL 1TS5A 4R3DA 1EM7A 1CZPA 4LLGM 3ZYYX 4TQ0A 1HA5A 1SF0A 1RFKA 1QILA 1J7CA 3RPFC 3P42A 5T8IA 2N9LA 2BB5A 1NYQA 3BWUD 5EE1A 1YJJA 1MHXA 1QT9A 2AQ2B 3NVZA 2IDYA 2WXFA 2MJEA 2PVOD 4RGTA 1PFDA 2EELA 4O1NA 2ONQA 1KLGD 1R7SA 1I7HA 1SBBB 2I2YA 3FAHA 4US8A 1XF5L 2FBWB 1QOBA 2MJDA 4N59A 3VR8B 1VRAB 2N9KA 1VLBA 2BW2A 2W54A 3EGRA 3BK1A 1BUIC 5G5HA 4C7ZA 1FCLA 1PGXA 2BS4B 1C79A 1E7PB 1UGJA 3AV8A 1FM0D 2V4IB 1WRIA 4C7YA 3L4PA 3AE2B 1TKYA 1TS3A 1FNVA 1WWTA 1LO5D 1E0ZA 2DWQA 4L1BA 1SIJA 2QEJC 1KF6B 5BYSA 1SSNA 4DQOC 4P6VF 2Y3AA 1K53A 3BIID 4D2KA 2IGDA 1XLOA 2KQ4X 3W5VB 4JWSC 3BYYB 4OZCA 1JMLA 4OZBA 1D6EC 1F2RC 4ZYSA 5I4DA 1YQ3B 3AE8B 2M0AA 2VZKD 1T6BX 1ET6A 2ZW0A 4RFBA 1V97A 5JXVA 5EE3A 1JALA 4RCOA 1F0ZA 4YT0B 1YN4A 3I9V1 4LK0M 1PGAA 3Q8CA 3P4RB 3AE9B 4HKQA 2WXGA 1YNTE 3AM9A 3CWIA 2LFIA 4GLSC 4FXCA 3IAS1 2BYTA 2HTME 2I38A 3TUOA 2J53A 2K0PA 1FRDA 2K22A 4JE3B 1E10A 2Q5WD 3PZ7A 1L0VB 2KMMA 3MC0B 4OVZA 3NZ3A 2BT6A 4IOIE 4XE0A 1OQRA 2JWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WQM A;  2M56 B;  4C80 A;  1FXA A;  2BS2 B;  2PIA A;  4ZHP A;  4N6E B;  1OQQ A;  2WDQ B;  2WP9 B;  1VDV A;  2L52 A;  3NVV A;  1FO4 A;  3KWL A;  3PO0 A;  3B2G A;  1TJE A;  2L83 A;  2WDV B;  1FFV A;  5EE9 A;  1RYJ A;  1JRO A;  5H92 C;  2WQY B;  3HVZ A;  1A70 A;  1FMA D;  1GAQ B;  3B9J A;  1JW9 D;  4ITK A;  3AB5 A;  1N61 A;  3DWG C;  1AYF A;  1JWA D;  1DOI A;  3VRA B;  1JQ4 A;  1NI3 A;  2OHF A;  1T3Q A;  2PKO A;  3AH7 A;  3AEF B;  2K5P A;  1OFF A;  1XLQ A;  1WXQ A;  1CZP A;  2CJO A;  1GPX A;  3ZYY X;  2WU2 B;  1SF0 A;  1RFK A;  3NVW A;  2Y5C A;  5AUI A;  5MPO A;  3SFE B;  4USA A;  5H8Y E;  3AE6 B;  2W3S A;  1J7C A;  2K9X A;  3RPF C;  1FIQ A;  2ACZ B;  1EWY C;  3SFD B;  4A9A A;  2G1E A;  1TKE A;  2W55 A;  1NYQ A;  5EE1 A;  1KRH A;  1N62 A;  1YJJ A;  5GXG B;  1QT9 A;  3NVZ A;  3SR6 A;  3W5U B;  1E6E B;  2MJE A;  2PVO D;  2MJ3 A;  1PFD A;  1QOG A;  5C3J B;  1N5W A;  2JX5 A;  3HUI A;  1R7S A;  1I7H A;  3AMZ A;  1B9R A;  4N58 A;  2W3R A;  3FAH A;  4US8 A;  3AEA B;  1N63 A;  2FBW B;  1QOB A;  2MJD A;  1XLP A;  4N59 A;  3VR8 B;  3CIR B;  3P63 A;  2B76 B;  1QLB B;  1VLB A;  1J7B A;  2CU3 A;  2W54 A;  4ZOH C;  5G5H A;  1QOA A;  1SB3 C;  1DGJ A;  2BS4 B;  4C7Z A;  1WGK A;  2MH7 A;  1YQ4 B;  4LTU A;  1E7P B;  3P4Q B;  4WWM A;  4YTN B;  1L6U A;  1PDX A;  1ROE A;  2QIE B;  3AEC B;  3AV8 A;  1XLN A;  4YXD B;  5C2T B;  3DWM A;  2E3T A;  1FM0 D;  1WRI A;  2EKI A;  4YSX B;  4C7Y A;  1XO3 A;  2PVG C;  2LEK A;  3L4P A;  1TKG A;  3AE2 B;  1TKY A;  3W9C B;  1WWT A;  1E0Z A;  1IUE A;  2DWQ A;  3AE3 B;  3EUB 2;  3P4P B;  1ZUD 2;  4HRS A;  4YSY B;  1NVI D;  1TYG B;  1SIJ A;  1FFU A;  1KF6 B;  4US9 A;  1ZXI A;  1JRP A;  1FXI A;  2KAJ A;  2N0S B;  4IDI A;  4HRO A;  4P6V F;  3WCQ A;  1QF6 A;  1V8C A;  1L6V A;  2BS3 B;  2WU5 B;  1ZOY B;  3P1M A;  4YTM B;  3AE1 B;  3BII D;  1XLO A;  1KFY B;  1VJK A;  3AN1 A;  3W5V B;  1RM6 C;  4JWS C;  3B2F A;  3NS1 A;  4KX6 B;  1QOF A;  1YQ3 B;  3VRB B;  3AE8 B;  1NEK B;  3ETR A;  1DOY A;  1N5X A;  2M19 A;  2QJL A;  2H88 B;  2JQR B;  1DOX A;  4JWU C;  3VR9 B;  1V97 A;  1J7A A;  5EE3 A;  1JAL A;  3FC4 A;  1F0Z A;  1PUT A;  1ZP0 B;  3AE4 B;  1AWD A;  1E9M A;  3AE5 B;  3AEG B;  3LXF A;  4YT0 B;  5EE0 A;  2WS3 B;  4ZHO A;  1FRR A;  3HRD D;  4YTP B;  2CJN A;  1CJE A;  3P4R B;  2WLB A;  1RWS A;  2DBY A;  3AE9 B;  3NRZ A;  3AM9 A;  3CWI A;  5AUK A;  1NYR A;  1UWM A;  4FXC A;  5G5G A;  2HTM E;  1N60 A;  3P4S B;  1YJI A;  4YSZ B;  1FRD A;  1WYG A;  2K22 A;  2H89 B;  3AEB B;  2AX5 A;  3ABV B;  3AED B;  2Q5W D;  1E10 A;  1L0V B;  1L5P A;  1JWB D;  2KMM A;  3AEE B;  3LB8 C;  1NEN B;  2BT6 A;  2WDR B;  4JX1 C;  3AE7 B;  1OQR A;  3NVY A; 
#chains in the Genus database with same CATH topology
 4DXG A;  4KZ0 A;  4ZRP A;  1TIF A;  1XD3 B;  4WJP A;  3NZU A;  3V3X A;  4C00 A;  1A70 A;  4ITK A;  1BXT A;  1N61 A;  1SXT A;  1WI0 A;  5D6J B;  3K9P B;  2NCN A;  3ZTD A;  2AEH A;  3V60 A;  4M02 A;  3N1X C;  2WU2 B;  3LDZ E;  5MPO A;  2W3S A;  4KGS A;  1GB1 A;  4YWG G;  4KKI A;  4BBN C;  2ZW1 A;  1L4Z B;  4RH6 A;  2PE9 A;  2FIF A;  5C23 A;  3Q8B A;  2KZR A;  4DHZ B;  1V1P A;  1DGJ A;  4WWM A;  2XK5 A;  1WXS A;  3FIL B;  5J17 A;  2AQ1 B;  2KAN A;  2J4X A;  3KH0 A;  5C1Z A;  2KJ6 A;  4TQ1 A;  2LEK A;  3RZF A;  1Q5W B;  1IUE A;  2HE7 A;  4B0M A;  5D7G A;  1IYF A;  1S3S G;  2LVQ A;  2V3S A;  1ZXI A;  2XNA C;  3KUD B;  1BT0 A;  4C4V A;  4DWF A;  3NS8 A;  1KFY B;  5GMV A;  1RM6 C;  2MSE D;  3PLV A;  4LDT B;  1WJU A;  1WGG A;  3ETR A;  4J6I A;  4WIP A;  2QJL A;  1DOX A;  3FC4 A;  3KVF B;  2G45 B;  3W2D A;  2DLB A;  3KW5 B;  1YD8 U;  2KWD A;  3C19 A;  5AUK A;  2DNF A;  1HXY D;  1S1Q B;  4B0E A;  3WAN A;  1JCK B;  2R2Q A;  2LD9 A;  2RPQ A;  2N9E B;  1M4V A;  2DX5 B;  1K8R B;  3EC8 A;  3RCZ A;  4FJZ A;  2C7M B;  1GC7 A;  3VUY A;  2JWZ A;  3DBS A;  1TJE A;  2KVR A;  1WGR A;  2V9H A;  3V6E B;  1IBX A;  1FCC C;  3N9Y C;  3VRA B;  2ZVO A;  3RUL A;  1IGC A;  2AWT A;  1C76 A;  1XLQ A;  4ANU A;  1GPX A;  2JSV X;  3BY4 B;  3SFE B;  1HZ6 A;  3ZJV A;  2K9X A;  2ACZ B;  2HDE A;  1YJ1 A;  2BQQ A;  3DVN V;  2BB6 A;  1OQY A;  1MI0 A;  1SE4 A;  2LGS A;  3Q3J A;  2AL3 A;  1V1O A;  4PS8 A;  4OVU A;  1WYW B;  5JHB A;  2KWV B;  2K3U A;  2K8B A;  4IM0 A;  4QAY A;  1BML C;  3A4R A;  4A90 A;  4YXD B;  2KJH B;  1WGY A;  2V3N A;  2X38 A;  3HHM A;  2JY6 A;  3IG3 A;  2NBU A;  1UH6 A;  1Q0W B;  4G0N B;  1I4G A;  4EOY A;  4XDD A;  3QA8 A;  1FXI A;  5LLI A;  2B3A A;  1OGW A;  1E90 A;  3KUC B;  1D5Z C;  3ZRC A;  3ONS A;  4FHK A;  2DHZ A;  2YEP B;  1E7V A;  2PTL A;  2MP2 A;  5EE0 A;  3R2I A;  2PJH A;  1CJE A;  3ZJU A;  2LGD A;  3PZ8 A;  3ZKJ C;  5HKH A;  3HIZ A;  1WJ4 A;  2R61 A;  3NZS A;  3BVG A;  3ALB A;  4HWI B;  1TTN A;  2BS2 B;  1J19 A;  1V1P B;  3ML8 A;  3Q6B A;  3IXS A;  2KDI A;  4MGK E;  5HI1 A;  4B95 A;  4E74 A;  2PMV A;  1QZE A;  1RYJ A;  1WIA A;  3Q3F A;  3HVZ A;  2DYB A;  2XN9 C;  2GBM A;  3KYC D;  2OJR A;  4FUL A;  3AH7 A;  2LGI A;  3WAL A;  4LNF A;  4ICV A;  2Y5C A;  4C4V B;  4USA A;  2VH1 A;  1QQR A;  4RM9 A;  1ZE3 D;  4K3C A;  3MC8 A;  1JWU D;  3GP7 A;  3MHS D;  4BVU C;  3RI7 C;  2FCM A;  4GOC A;  3CIR B;  3U2S C;  1QLB B;  2CU3 A;  4M00 A;  3H1U A;  2DYM A;  2PEA A;  1R4N I;  2CS4 A;  5G2N A;  1K51 A;  3RZW C;  1JRU A;  2EKI A;  3IT6 B;  1MVK A;  2LAS A;  4C56 C;  5IKC M;  1Y56 A;  2RPV A;  2QDF A;  3Q69 A;  4A55 A;  1P0R A;  2N0S B;  4JIO U;  2ICI A;  4K7U A;  2INP E;  1LM8 B;  4YTM B;  2INN E;  1IBX B;  4OZA A;  1V49 A;  1WF9 A;  2KX0 A;  2L1A A;  3RFZ B;  1DOY A;  1N5X A;  4BFR A;  4NY0 A;  5FKA C;  2O6V A;  2PLP A;  3U52 E;  3VXW A;  2O6V D;  3JYU A;  3ZUN A;  3FKY A;  5E6N A;  4MGZ E;  1NYR A;  4ARI A;  2W82 A;  2YEP F;  5CHW A;  3RD2 A;  5BMH A;  3ZDM C;  1IPG A;  3ABV B;  3I5J C;  4XC2 A;  1L5P A;  1RFA A;  2Z0E B;  2BVC A;  3EFU A;  3AE7 B;  1FO4 A;  3PHW B;  3S2A A;  3PO0 A;  2WDV B;  4DXA B;  3WAP A;  2LJ5 A;  2NTT A;  3PSE B;  3RMK C;  2LGX A;  4AUQ C;  1ET9 A;  4K1R B;  2FAZ A;  2K5P A;  2JZZ A;  3IHP C;  1HA5 A;  4PS7 A;  4GB9 A;  1R4N B;  2KX3 A;  1QIL A;  3DBH I;  3RPF C;  2M17 A;  3P42 A;  5CHF A;  2N9L A;  2BB5 A;  4CHK A;  3V61 A;  1KLG D;  1SBB B;  2WDT B;  3FAH A;  1WXM A;  1QOB A;  3VR8 B;  3EGR A;  2MP2 B;  3BK1 A;  5IN7 A;  4C7Z A;  2BS4 B;  1C79 A;  1E7P B;  3NHE B;  4A3P A;  1P9D U;  3DHH C;  1NDD A;  1EO6 A;  3AE2 B;  2MRP A;  2NR2 A;  5IOI A;  1LO5 D;  2EMT A;  1PQS A;  1C3T A;  1T0S C;  3RNF C;  2ZCC A;  3RN9 C;  4GN1 A;  4P6V F;  4PK1 A;  3IFW B;  2Y3A A;  4D2K A;  3WIM A;  3QQ8 B;  1XLO A;  4JWS C;  3BYY B;  1JML A;  4MSQ B;  4A3O A;  1ZGU B;  3NJT A;  1JAL A;  4KIK A;  1MFW A;  2CHX A;  4YT0 B;  1YN4 A;  3I9V 1;  1D3Z A;  4LK0 M;  2D3A A;  1LGR A;  3P4R B;  3AE9 B;  4HKQ A;  3CWI A;  4X57 B;  2JPH A;  3DVG X;  2BYT A;  2I38 A;  1MG8 A;  2K22 A;  2PPH A;  1ZKH A;  2J0K A;  1L0V B;  2A4Z A;  2QCZ A;  1OQR A;  2JWU A;  2INC C;  2M56 B;  4YL8 A;  1VZ7 A;  2L52 A;  2KQ7 A;  2KAC A;  3N3K B;  1E8W A;  1YOV B;  4HJK A;  2CKH B;  1DYQ A;  1F52 A;  1M94 A;  3ZW3 A;  4OW0 A;  3AU5 A;  4BKS A;  1GOZ A;  3GB1 A;  5FR3 A;  3K9O B;  4XDC A;  1I35 A;  1F9J A;  4BKS D;  3NVW A;  2YVC A;  4S17 A;  1WE7 A;  2K6Q A;  3IT4 B;  2WHI A;  3TEZ A;  1UUP A;  4MAC A;  2AL6 A;  3VAW A;  2NPT A;  1SJE D;  2MBO A;  1YMH E;  3DBR I;  5DPT A;  2LVP A;  2O6V B;  1N63 A;  2MBB B;  4GDK A;  1R4M I;  2FNJ B;  1XLP A;  4HEA 1;  1WJ6 A;  3N1Y C;  1WGK A;  3A9J A;  2MCN B;  1ROE A;  2MHJ A;  1XLN A;  1VR9 A;  3DWM A;  1ZXH A;  1TKG A;  2BGF A;  3L10 B;  4B6W A;  1ISN A;  4ANW A;  3P4P B;  4YSY B;  2LHE A;  1EF1 A;  4EZL A;  4KVG B;  3I3T B;  2QC8 A;  2Y5B B;  4IDI A;  4HRO A;  1V8C A;  1GG3 A;  2DAF A;  2NBV B;  2LRW A;  1D4B A;  3VUX A;  2I1K A;  1VJK A;  2TSS A;  4K7W A;  2WX1 A;  3VRB B;  2KNB A;  3OJ4 B;  4HKZ E;  2O2V A;  1ENF A;  2V1Y A;  3T9L A;  1AW7 A;  3TL5 A;  4XGA B;  4EZK A;  2ZEQ A;  1FNU A;  2QIL A;  5G5G A;  4TSS A;  1I4Q A;  5LNK 1;  1L0Y B;  4H2A A;  4LCD E;  2LXA A;  2XBB C;  2KDE B;  1VDV A;  3U8Z A;  1WSP A;  4K3B A;  4NJC A;  2RDG A;  1UBI A;  1FMA D;  1WJN A;  2IBI B;  4L2Y A;  1AYF A;  4ZRJ A;  1PGB A;  2LXC A;  3ML9 A;  1Q10 A;  4RM8 A;  3MTN B;  2JVC A;  2QSD A;  4KSL C;  3AE6 B;  4GIV A;  3QJZ A;  3PRZ A;  2M0X A;  3SR6 A;  2MBQ A;  3VVW B;  4DDG D;  1YIW A;  3W5U B;  3V05 A;  1V6E A;  3LYY A;  2WXO A;  4N58 A;  1GC6 A;  2IPK D;  4KIK B;  1J7B A;  3E9S A;  3NG0 A;  4GDL A;  1TY2 A;  4FJY A;  3URY A;  1E5W A;  3WAO A;  2M1M A;  2BTE A;  4HRS A;  1TYG B;  1FEH A;  2IO2 B;  2CR5 A;  3P1M A;  1FD6 A;  4E71 A;  2N4F A;  3RNC C;  2GBR A;  3N30 A;  4HK2 A;  1OEY A;  3L54 A;  5AZG A;  4G50 A;  1KTK A;  2IND C;  1P7F A;  1XT9 B;  1ZDX A;  5D3D A;  5LXH A;  4BBN F;  1ZP0 B;  1V86 A;  4ZHO A;  1WR1 A;  1OEY J;  4YTP B;  4NQK E;  3EHV A;  2RDH A;  2DBY A;  2MX2 A;  4XWT A;  3VTV A;  1UWM A;  5D3I B;  2IGH A;  2NPT B;  4IUM B;  4IC7 B;  1YJI A;  3H7P A;  3ECI A;  4AP4 C;  3AEB B;  3HVD A;  3PRP B;  1WXA A;  1JWB D;  4GDK B;  2DAJ A;  2BPS A;  4ZYN A;  2L3Z A;  2NTS A;  3R66 C;  3A9J B;  3R3M A;  4TKN A;  2GOW A;  3QIJ A;  2MQJ A;  4N9F 4;  5AZH A;  3AB5 A;  3DBL B;  2RD0 A;  4DHZ E;  4XYC A;  1TS4 A;  2ASQ A;  2CJO A;  4P16 A;  4WQO B;  4JGH B;  5D2M B;  3ZGZ A;  4AWJ A;  3SFD B;  4A9A A;  1Z5S B;  2G1E A;  3KUZ A;  2W55 A;  2BYF A;  3BIN A;  2LHD A;  3O65 B;  3OG5 A;  1E8Z A;  2JX5 A;  4F8C B;  3AMZ A;  1B9R A;  2B76 B;  4NJ6 A;  5D94 A;  1XEE A;  2O2V B;  1EU4 A;  2GI9 A;  4ICU A;  1A5R A;  1XO3 A;  2KMC A;  3ZNH B;  4PS3 A;  3U4E G;  1TT5 B;  2KQS A;  2K6D B;  2D10 A;  4J3O D;  3ZLZ A;  1JRP A;  2KXJ A;  1P3Q U;  1ZOY B;  2KFK A;  1WE6 A;  4HPM B;  4Q2J A;  4HXD A;  2LJI A;  3VTW A;  5EDS A;  4HJG E;  4JWU C;  4W9I A;  2L7R A;  1PUT A;  4A8X C;  2JXX A;  1I4P A;  1T5X D;  2CHW A;  4HCN B;  2FUG 1;  2WXH A;  4PYU A;  2JZ3 B;  1ACC A;  4DK5 A;  3UF8 A;  3SHQ A;  4RGM A;  1WX8 A;  4W9D A;  1E8X A;  3D32 A;  1OQQ A;  2WP9 B;  4GDL B;  3T3O A;  3SDL C;  2L00 B;  1KH0 A;  1VCB A;  2WXR A;  4WUR A;  4DBG A;  1JRO A;  2JYT A;  2D3G A;  3EEC A;  5DCN A;  4LNK A;  2DEN B;  3L17 A;  2ZZP B;  1UWX A;  1XCQ L;  1TS5 A;  4LLG M;  1RFK A;  2KLC A;  1RLF A;  1KM7 A;  1SGH A;  3BWU D;  1NBF C;  4RGT A;  4O1N A;  2OJW A;  1I7H A;  2I2Y A;  2KLG A;  1XF5 L;  2FBW B;  2MJD A;  1VRA B;  2BW2 A;  2W54 A;  4JLC A;  1Z2M A;  1FCL A;  4W9E A;  2KJR A;  2FCS A;  5KHQ A;  4XX5 A;  3AV8 A;  4K7S A;  1FM0 D;  1XQQ A;  3H7P B;  4S0R A;  1TZ1 A;  1V81 A;  2DWQ A;  1WY8 A;  3PTF C;  4L1B A;  2QEJ C;  1KF6 B;  5BYS A;  1SSN A;  2D11 A;  5LXI B;  3ZXV A;  2VRR B;  1K53 A;  2C60 A;  3BII D;  2IGD A;  3W5V B;  2ZPN A;  3V62 A;  4OZB A;  2N9X A;  3AE8 B;  5DPS A;  2DZK A;  2DZM A;  2VZK D;  3CSF A;  2ZW0 A;  2HTH A;  4RCO A;  3X0W A;  1EF5 A;  1Q1O A;  4ZDV A;  3GZN B;  2WXG A;  3AM9 A;  2LFI A;  3B08 A;  1P98 A;  1FRD A;  2YLM A;  1E10 A;  2Q5W D;  3PZ7 A;  3MC0 B;  4OVZ A;  3NZ3 A;  4IOI E;  4XE0 A;  2FUH B;  1Y8R C;  4L23 A;  4IWO A;  3EA6 A;  4ARC A;  1P1A A;  1FXT B;  3KWL A;  3A1Q A;  1C78 A;  2CHZ A;  4IW0 A;  2WQY B;  3B9J A;  2DZJ A;  1TGZ B;  3DVN U;  2LZ6 A;  2JRH A;  3W1S A;  3AEF B;  2LRU A;  4IM3 A;  4EKU A;  3VH3 B;  4MSM B;  1H8C A;  2BF8 B;  2G3Q B;  5AUI A;  3PVL A;  2KFK B;  2IJ0 A;  2R2O A;  3RNG C;  5G55 A;  3HM6 X;  5BO4 B;  4G11 A;  5IO9 A;  1E6E B;  2MJ3 A;  2WXK A;  2MWS B;  3VDZ A;  4RMA A;  2W3R A;  2EKE C;  2BYV E;  2N7J A;  2IO3 B;  2LI5 A;  2WWZ A;  2MH7 A;  2J0J A;  1WH3 A;  4MM3 A;  2L8J A;  1SE3 A;  2FE8 A;  1AN8 A;  3DCG A;  2ZNV C;  3OAW A;  1J8C A;  1C77 A;  3EUB 2;  3ZXR A;  2BWF A;  4WH4 A;  1F2R I;  2MBE A;  4US9 A;  1UNS A;  2KAJ A;  3CMM B;  3T3N A;  1JWM D;  1QF6 A;  3Q3N C;  3AE1 B;  2PE6 B;  2M4N A;  4BAX A;  4CYE A;  4FAD A;  5IP4 D;  1NEK B;  4BOZ B;  3R8B A;  5L95 C;  4JPS A;  3DDC B;  3ZIM A;  3QWZ B;  5J18 A;  3AE5 B;  4AJY B;  2KMA A;  1FRR A;  1D5X C;  2BKR B;  5KHO A;  4KDI C;  3VHT C;  1I42 A;  3C0R B;  1WM3 A;  4ZRQ A;  2WXN A;  2IY1 B;  2KDM A;  1PYW D;  3NVY A;  2BWE S;  1TBE A;  2Z59 B;  2WDQ B;  4IG7 B;  3ZTC A;  2GMI C;  1FFV A;  2JYE A;  2KVZ A;  2KN4 A;  1MJD A;  4AJW A;  4II3 B;  4NAM A;  3PRE A;  1DOI A;  2WXI A;  4UDU C;  1L0X B;  3IAM 1;  2UU7 A;  2KK8 A;  2L32 A;  2RR9 A;  5HG2 A;  2HJ8 A;  3TEW A;  5H8Y E;  1I4X A;  1UGM A;  1EWY C;  3ZNG C;  1UBQ A;  5HFY A;  1N62 A;  2VZK B;  1T0Y A;  4NAW A;  5C3J B;  1N5W A;  3AI5 A;  4LNN A;  4KV2 A;  4G3X B;  3NOB A;  4M0W A;  2FCQ A;  5E6J A;  4LNO A;  1QOA A;  3DOW A;  4EE2 A;  1YQ4 B;  1IGD A;  1L4D B;  5J2R A;  3PV1 A;  2KDF B;  4TMA B;  5AEK B;  4I6N B;  2N7D A;  3PHX B;  2D5G A;  2KTR A;  1KLU D;  2KTF A;  1VZ8 A;  4AS1 A;  2N7E A;  3TBL D;  2UYZ B;  3WCQ A;  1YQB A;  3L08 A;  1L6V A;  3A1Q B;  3RNB C;  2JRI B;  3SD5 A;  2QHO A;  2KHW B;  4W9J A;  3B2F A;  3U30 A;  3R2T A;  2KKC A;  1WMH A;  2M19 A;  1MPE A;  2JQR B;  1XXG A;  1J7A A;  1KLV A;  2KN5 A;  2PW9 A;  1HTO A;  3NRZ A;  1VZ6 A;  3A4S C;  3B1L X;  4PYZ A;  2JZP A;  4IWP A;  1V5T A;  2WXP A;  1KJT A;  3RNE C;  4GMV A;  2FCN A;  2IO1 B;  3AEE B;  3UQA A;  4JX1 C;  2WDR B;  1FNW A;  3OLM D;  2PIA A;  1CMX B;  4N6E B;  1ESF A;  1RRB A;  2EMS A;  1CQV A;  3TMP B;  2L83 A;  1K50 A;  4MM3 B;  3H8H A;  5TSS A;  1SIF A;  1T3Q A;  4ZRI A;  1C4C A;  4NPN A;  4W9K A;  2MEK A;  4MH8 A;  2C7H A;  3DVG Y;  2M8S A;  2A5U A;  1EUV B;  3JW0 X;  4WJQ A;  3PZD A;  2JXT A;  2KC2 A;  4KGT A;  4GSW A;  2MA9 B;  3L16 A;  3PS6 A;  4KGR A;  3MJ5 A;  4IM2 A;  2WXL A;  3BVM A;  4LTU A;  3P4Q B;  4YTN B;  4RNA A;  1L6U A;  3BK2 A;  4NJ7 A;  1V9J A;  4GXB A;  3E56 A;  1ZDV A;  4ANX A;  1YN5 A;  2PVG C;  2WXQ A;  1STE A;  3W9C B;  4EFO A;  1HEZ E;  3VUW A;  1WRD B;  3KYD D;  3Q8F A;  3PGE A;  4MDK E;  3TEY A;  3DBL I;  3Q2A C;  2N1W A;  3W1S C;  2C9W B;  2K8H A;  2KO3 A;  1TS2 A;  3U7D A;  2WGS A;  4KX6 B;  1QOF A;  3GS2 A;  5IA7 A;  1UD7 A;  3ZNI D;  3UIP B;  2HJ1 A;  2L0F A;  2H88 B;  1WZ3 A;  4FLH A;  3AE4 B;  1AWD A;  1C9F A;  3HRD D;  5FK9 C;  1E8Y A;  2KWU B;  4DDI D;  2ZVN A;  4LJO B;  1B1Z A;  2IYD B;  4KZC A;  4NAW B;  1L7Y A;  3KWV A;  4KKJ A;  4YSZ B;  2BYE A;  3UIN B;  3MJW A;  2GLS A;  5CTR C;  2J0M A;  4M0W B;  4ZHP A;  5JH5 C;  2DZI A;  4EZJ A;  1WX9 A;  2LUM A;  2C7N B;  5H92 C;  3Q14 C;  2W9N A;  1GAQ B;  2V0G A;  2JUO A;  1EWC A;  3DWG C;  2KTR B;  4WAF A;  4HVB A;  2PKO A;  3BZD B;  1EM7 A;  1V2Y A;  1CZP A;  3ZYY X;  2G4S A;  2C5L C;  4FJV B;  5T8I A;  4BKG A;  4KDL B;  5EE1 A;  1V5O A;  4WWO A;  1MHX A;  1QT9 A;  2AQ2 B;  3NVZ A;  4F7Z A;  2IDY A;  2WXF A;  4BZA A;  2UWQ A;  2KD0 A;  1WMH B;  1R7S A;  3UQB A;  2X8X X;  4W9F A;  3N1Z C;  4MJS A;  2GBN A;  4N59 A;  4OVV A;  1VLB A;  1BUI C;  3A9K A;  1PGX A;  2IY0 B;  3ZNZ B;  4ZRK A;  1TKY A;  1TS3 A;  1FNV A;  1WWT A;  2KC1 A;  4TUU A;  2MW5 A;  5CHV C;  3W1Y A;  2D3C A;  2KQ4 X;  5FR6 A;  4OZC A;  5I4D A;  1YQ3 B;  1GUA B;  2M0A A;  1T6B X;  2XEW A;  4W9G A;  4RFB A;  1V97 A;  5JXV A;  5EE3 A;  3V6C B;  2L76 A;  4HDQ A;  5L83 A;  4GLS C;  2HTM E;  4GU2 A;  3Q3O C;  2J53 A;  2K0P A;  3OJ3 A;  4I6L B;  4JE3 B;  1WM2 A;  2KMM A;  3P2B A;  2NS5 A;  1FXA A;  1SE9 A;  3B2G A;  3EFC A;  1UEL A;  3VQI A;  3Q8E A;  1CK1 A;  2JF5 A;  3UIO B;  3KLS X;  3KQ4 A;  1I4H A;  4OHJ A;  3PRM B;  1MHH E;  4RF1 A;  2HD5 B;  3PT2 B;  3M63 B;  1WXQ A;  1JWS D;  3RYT A;  3WA0 A;  1FIQ A;  4GGQ A;  3M95 A;  2J52 A;  4P1C C;  3QX1 A;  4DHJ D;  4I6P A;  2WXM A;  1T0R C;  2Z8L A;  3QC8 B;  4NZL B;  4DXF A;  4P1B C;  3GZN I;  3M62 B;  3AEA B;  3TSS A;  4RGO S;  3M3J A;  3P63 A;  2J7Q B;  4ZOH C;  2KDB A;  1L2N A;  4MGI E;  3TIX A;  1LXD A;  3AEC B;  1F1H A;  5C2T B;  5JZE B;  2WXJ A;  4YSX B;  2IZV B;  2LMC A;  3AUL A;  3AXC A;  2E6X A;  2KT7 A;  3RUI B;  3ZO5 B;  1U4A A;  1ZUD 2;  2WYQ A;  1FFU A;  1WR6 E;  4IKG A;  4RGN A;  4EUT A;  2BS3 B;  2WU5 B;  3APD A;  1C1Y B;  3AN1 A;  3BYT B;  2JT4 B;  2V3P A;  4JL9 A;  2RMM A;  2XK5 B;  4LNI A;  3GOE A;  1WGH A;  4W9H A;  3LXF A;  4M8N A;  2OED A;  5AZF A;  2AQ3 B;  2ZNV B;  3LJ3 A;  4BKT A;  2K1F A;  2KWC A;  3P4S B;  4ASW C;  3QAR A;  1T0Q C;  2AX5 A;  3OWE B;  1ZW7 A;  3B0A A;  4FA6 A;  4MJS B;  2NBW B;  2NVU I;  3A9K B;  4WWP A;  4XZ4 A;  1TY0 A;  3RNA C;  1EU3 A;  1GB4 A;  1C4P A;  1KOT A;  3A33 B;  5BMI A;  1JWA D;  3AU4 A;  2L0T A;  4W9C A;  1OFF A;  4HPL B;  4PT5 A;  1SE2 A;  4KSK C;  1WGD A;  3TJP A;  1KRH A;  2MLB A;  2DYO A;  4NNJ B;  5GXG B;  3N20 C;  4F1S A;  3HUI A;  3H9D A;  1ZPS A;  1SB3 C;  2RDB C;  4FN2 A;  1X1M A;  1PDX A;  2WX0 A;  3IVF A;  1E7U A;  4JQW C;  2SEB D;  3QK0 A;  1QKZ A;  2D2Q A;  4TV3 A;  4MEM A;  3AE3 B;  2LUE A;  3ZQ4 A;  2G9H D;  2ZPY A;  1WXV A;  3UGB B;  1D5M C;  3JSV A;  3MFG A;  4A6Q A;  5CX3 A;  1XCT L;  2V4L A;  4M8M A;  3CST A;  2BBC A;  2KYW A;  2I1J A;  3VR9 B;  3APC A;  4MEL A;  2G4D B;  1E9M A;  3AEG B;  3MP9 A;  4WWN A;  2WNM A;  3RT3 B;  2CJN A;  4DHJ B;  1RWS A;  3MC9 A;  3NUH B;  3DQV A;  3R7R A;  1H4R A;  3DHI C;  4CQN A;  1FPY A;  1MG4 A;  4XWW A;  3Q3M C;  2LGY A;  3AED B;  1HZ5 A;  3LB8 C;  1NEN B;  5HHD G;  1N6Z A;  4EEW A;  2Z0D B;  2GB1 A;  2KOX A;  4WQM A;  2FID A;  4NQL B;  2SAK A;  2LVO A;  3NVV A;  1F77 A;  2N1V A;  5IAA C;  4ACF A;  1HE8 A;  4FHJ A;  1V80 A;  3CF6 E;  3IBE A;  4WAA A;  1JW9 D;  5BMG A;  4MGY E;  4LJP B;  1NI3 A;  1HTQ A;  3SU8 X;  4FBJ B;  2IO0 B;  2BKF A;  3BVZ A;  3ZJT A;  1J0G A;  1C4A A;  2JU6 X;  2N9P C;  1TKE A;  1K52 A;  4AQ7 A;  4W9L A;  3H7S A;  3PPA A;  4E3C A;  1QOG A;  3VFK A;  2IGG A;  1WZ0 A;  1TZO A;  3TEX A;  4CO7 A;  2D07 B;  3O13 A;  3APF A;  3QCA A;  1UF0 A;  2LWP A;  2QIE B;  3X23 A;  3VTU A;  2E3T A;  1UZX B;  1P7E A;  2OOB B;  4MH0 E;  5E6O A;  1NVI D;  4RF0 A;  4MT5 A;  1SJH D;  2CU1 A;  1VD2 A;  3J9C A;  1GNU A;  3NS1 A;  2K8C A;  3GE8 C;  4A20 A;  3DBH B;  1OTR B;  1I4R A;  1SEB D;  1G6J A;  1HQR D;  3PLU A;  2WS3 B;  1IP9 A;  1WFY A;  5JHA A;  2REX A;  3R7Q A;  3Q8A A;  2AYO B;  2WLB A;  5BYR A;  2GRI A;  3SEB A;  3FIL A;  3HK0 A;  3L13 A;  3GE3 C;  2L05 A;  3I57 A;  4IWQ A;  3QHT A;  1N60 A;  3UI3 A;  1WYG A;  2H89 B;  3ENE A;  1YN3 A;  4HPP A;  3H6N A;  3QAQ A;  4C80 A;  3I63 C;  3C8Y A;  2QMT A;  1LQB A;  5BYQ A;  3MHZ A;  1YX6 B;  5EE9 A;  4REZ A;  2J42 A;  3ZRF A;  3N32 A;  2NMQ A;  1YX5 B;  2ON8 A;  3ZVV A;  2OHF A;  1JQ4 A;  2Y5P A;  4URK A;  4LDT D;  4R3D A;  4TQ0 A;  3ZDT A;  5TR5 A;  1SF0 A;  1AAR A;  4M01 A;  1J7C A;  3JSV B;  3DHG C;  1NYQ A;  1YJJ A;  2MJE A;  2PVO D;  3T8M A;  4BOS C;  1PFD A;  2EEL A;  5DPR A;  2ONQ A;  1WX7 A;  3TCA A;  4US8 A;  2VH2 A;  2N9K A;  3VH4 B;  5G5H A;  3WAM A;  3NY5 A;  4HLE A;  1UGJ A;  2V4I B;  3L0W B;  1WRI A;  4HCP B;  4C7Y A;  1GJZ A;  2K25 A;  3L4P A;  4K81 A;  3DPD A;  1E0Z A;  5E6P A;  1SIJ A;  2KFJ A;  4WJO A;  4DQO C;  1RAX A;  4P7I A;  2GBJ A;  2K39 A;  2D3B A;  4HDO A;  1D6E C;  1F2R C;  4ZYS A;  1LFD A;  1ET6 A;  2RSU A;  2ZJD A;  4ANV A;  4WJN A;  4B9K A;  1NI2 A;  1F0Z A;  2MBH A;  5DPW A;  3DBR B;  1PGA A;  3Q8C A;  3HM3 A;  1YNT E;  2ZCB A;  1R4M B;  4FXC A;  3IAS 1;  3JVZ X;  3TUO A;  4II2 B;  4AOF A;  2BT6 A;  2RGF A;  3U7Z A;  2GBK A; 
#chains in the Genus database with same CATH homology
 2M56 B;  1FXA A;  4L23 A;  3EA6 A;  1VZ7 A;  4ARC A;  2L52 A;  4DXG A;  3KWL A;  3B2G A;  1C78 A;  2KAC A;  4ZRP A;  3V3X A;  3VQI A;  3Q8E A;  1CK1 A;  1DYQ A;  2WQY B;  1A70 A;  3B9J A;  3KLS X;  1BXT A;  1N61 A;  1SXT A;  3KQ4 A;  1I4H A;  4ITK A;  4OHJ A;  4OW0 A;  3W1S A;  1GOZ A;  1MHH E;  3AEF B;  3GB1 A;  4RF1 A;  5FR3 A;  4XDC A;  1WXQ A;  1JWS D;  2WU2 B;  3NVW A;  5AUI A;  5MPO A;  2W3S A;  1FIQ A;  2IJ0 A;  3IT4 B;  4KGS A;  3TEZ A;  1GB1 A;  1UUP A;  4YWG G;  4KKI A;  2J52 A;  2ZW1 A;  4MAC A;  1L4Z B;  1E6E B;  1SJE D;  2MJ3 A;  2WXM A;  1YMH E;  2Z8L A;  4NZL B;  4RH6 A;  4DXF A;  2WXK A;  2W3R A;  3AEA B;  3TSS A;  1N63 A;  2N7J A;  3Q8B A;  4RGO S;  1XLP A;  4HEA 1;  3P63 A;  4ZOH C;  1V1P A;  1DGJ A;  1WGK A;  2MH7 A;  4WWM A;  1ROE A;  3AEC B;  3FIL B;  1XLN A;  1VR9 A;  2AQ1 B;  3DWM A;  5C2T B;  2WXJ A;  4YSX B;  1SE3 A;  1ZXH A;  2J4X A;  2FE8 A;  2LMC A;  2E6X A;  1AN8 A;  2LEK A;  4TQ1 A;  1TKG A;  1C77 A;  1IUE A;  3EUB 2;  3P4P B;  4YSY B;  1ZUD 2;  2LHE A;  4B0M A;  5D7G A;  1FFU A;  4WH4 A;  1F2R I;  4US9 A;  1UNS A;  1ZXI A;  2XNA C;  2KAJ A;  4IDI A;  4HRO A;  3T3N A;  1JWM D;  4IKG A;  1QF6 A;  1V8C A;  4RGN A;  2BS3 B;  2WU5 B;  1D4B A;  3AE1 B;  1KFY B;  1VJK A;  3BYT B;  3AN1 A;  1RM6 C;  2TSS A;  3VRB B;  2V3P A;  1NEK B;  3ETR A;  4WIP A;  3R8B A;  2QJL A;  1DOX A;  4JPS A;  2RMM A;  3FC4 A;  3LXF A;  3AE5 B;  3W2D A;  4HKZ E;  1FRR A;  1D5X C;  2DLB A;  1ENF A;  2OED A;  2AQ3 B;  2KWD A;  1AW7 A;  5AUK A;  1FNU A;  2QIL A;  5G5G A;  1HXY D;  4ZRQ A;  3P4S B;  4B0E A;  2WXN A;  4TSS A;  1I4Q A;  1JCK B;  2AX5 A;  3OWE B;  5LNK 1;  1L0Y B;  2KDM A;  4H2A A;  1PYW D;  3NVY A;  1M4V A;  2WDQ B;  1VDV A;  1WSP A;  1TY0 A;  1TJE A;  1EU3 A;  1FFV A;  2JYE A;  1C4P A;  2RDG A;  4NJC A;  2KN4 A;  1GB4 A;  1IBX A;  1FMA D;  4L2Y A;  1FCC C;  3N9Y C;  4NAM A;  1AYF A;  5BMI A;  1PGB A;  1JWA D;  1DOI A;  2WXI A;  4UDU C;  3VRA B;  1L0X B;  3IAM 1;  1IGC A;  1Q10 A;  1OFF A;  1C76 A;  1XLQ A;  4PT5 A;  1GPX A;  2QSD A;  2JSV X;  2L32 A;  5HG2 A;  3TEW A;  3SFE B;  5H8Y E;  1HZ6 A;  1I4X A;  3AE6 B;  2K9X A;  3ZJV A;  2ACZ B;  1EWY C;  1SE2 A;  2HDE A;  5HFY A;  1KRH A;  1N62 A;  2DYO A;  2VZK B;  2BB6 A;  5GXG B;  3SR6 A;  3W5U B;  3V05 A;  3LYY A;  5C3J B;  1N5W A;  2WXO A;  3HUI A;  1MI0 A;  1SE4 A;  4N58 A;  2IPK D;  1ZPS A;  1V1O A;  4M0W A;  1J7B A;  5E6J A;  3E9S A;  1QOA A;  1SB3 C;  4EE2 A;  2K3U A;  1YQ4 B;  1PDX A;  1IGD A;  3U7Z A;  1BML C;  1L4D B;  1TY2 A;  4A90 A;  4YXD B;  4TMA B;  3URY A;  2V3N A;  2X38 A;  2SEB D;  2D5G A;  1QKZ A;  2BTE A;  3AE3 B;  4HRS A;  1KLU D;  1TYG B;  1VZ8 A;  4AS1 A;  3ZQ4 A;  1I4G A;  2G9H D;  1FEH A;  4XDD A;  1FXI A;  3WCQ A;  1D5M C;  1L6V A;  3P1M A;  1FD6 A;  3MFG A;  1D5Z C;  4A6Q A;  3B2F A;  3R2T A;  1XCT L;  1KTK A;  2BBC A;  2YEP B;  1P7F A;  1MPE A;  2M19 A;  2JQR B;  1XXG A;  1ZDX A;  3VR9 B;  1J7A A;  5D3D A;  1ZP0 B;  1E9M A;  2PTL A;  3AEG B;  3MP9 A;  5EE0 A;  4ZHO A;  2WNM A;  4YTP B;  3R2I A;  2PW9 A;  2CJN A;  1CJE A;  2RDH A;  1RWS A;  2DBY A;  3NRZ A;  3NUH B;  4XWT A;  3ZJU A;  1UWM A;  1VZ6 A;  5D3I B;  4CQN A;  2IGH A;  2JZP A;  3PZ8 A;  4XWW A;  1YJI A;  2WXP A;  3AEB B;  3HVD A;  3AED B;  1HZ5 A;  2R61 A;  3AEE B;  1JWB D;  3BVG A;  3LB8 C;  4JX1 C;  1NEN B;  4GDK B;  2WDR B;  5HHD G;  1FNW A;  2GB1 A;  4WQM A;  2BS2 B;  2SAK A;  2PIA A;  4N6E B;  1V1P B;  1ESF A;  2NTS A;  3IXS A;  3NVV A;  1F77 A;  5HI1 A;  1CQV A;  2L83 A;  2PMV A;  1K50 A;  1RYJ A;  4MM3 B;  3HVZ A;  3H8H A;  1JW9 D;  5BMG A;  2XN9 C;  3AB5 A;  5TSS A;  1NI3 A;  1T3Q A;  1TS4 A;  3AH7 A;  2LGI A;  1C4C A;  2CJO A;  4P16 A;  2MEK A;  2Y5C A;  3BVZ A;  4MH8 A;  4USA A;  3ZJT A;  3ZGZ A;  3SFD B;  4A9A A;  1C4A A;  2JU6 X;  1QQR A;  2G1E A;  1TKE A;  2W55 A;  1K52 A;  1ZE3 D;  4AQ7 A;  2JXT A;  2LHD A;  4KGT A;  1JWU D;  1QOG A;  3GP7 A;  2IGG A;  2JX5 A;  3AMZ A;  1B9R A;  1TZO A;  3MJ5 A;  4KGR A;  2WXL A;  3TEX A;  3CIR B;  3O13 A;  2B76 B;  1QLB B;  2CU3 A;  3U2S C;  3BVM A;  1XEE A;  2DYM A;  4LTU A;  3P4Q B;  4YTN B;  4RNA A;  1L6U A;  2QIE B;  1EU4 A;  1K51 A;  3BK2 A;  2GI9 A;  2E3T A;  2EKI A;  1P7E A;  3E56 A;  3IT6 B;  1MVK A;  1XO3 A;  1ZDV A;  1YN5 A;  2PVG C;  4C56 C;  1Y56 A;  2RPV A;  1STE A;  2WXQ A;  3W9C B;  3U4E G;  1HEZ E;  3Q69 A;  1NVI D;  4RF0 A;  4A55 A;  3Q8F A;  4J3O D;  1JRP A;  4MT5 A;  2N0S B;  3TEY A;  1SJH D;  2ICI A;  2INP E;  1ZOY B;  3J9C A;  4YTM B;  1TS2 A;  2INN E;  1IBX B;  4Q2J A;  3NS1 A;  4KX6 B;  4OZA A;  2LJI A;  1QOF A;  3GS2 A;  2L1A A;  3RFZ B;  1DOY A;  1N5X A;  2H88 B;  4HJG E;  4JWU C;  1I4R A;  5FKA C;  2PLP A;  1SEB D;  3U52 E;  1PUT A;  3AE4 B;  4A8X C;  1AWD A;  1HQR D;  1I4P A;  2WS3 B;  1C9F A;  1T5X D;  3HRD D;  5FK9 C;  2FUG 1;  3Q8A A;  5BYR A;  2WLB A;  2GRI A;  3SEB A;  2WXH A;  3FIL A;  1NYR A;  4ARI A;  1ACC A;  1B1Z A;  3I57 A;  2W82 A;  2YEP F;  5BMH A;  1N60 A;  4NAW B;  3KWV A;  4KKJ A;  3UI3 A;  4YSZ B;  4RGM A;  1WYG A;  2H89 B;  3ABV B;  1YN3 A;  1L5P A;  3AE7 B;  1FO4 A;  4C80 A;  4ZHP A;  3C8Y A;  1OQQ A;  2QMT A;  2WP9 B;  3PO0 A;  4GDL B;  3T3O A;  5BYQ A;  2LUM A;  2WDV B;  3MHZ A;  1KH0 A;  2WXR A;  4WUR A;  5EE9 A;  1JRO A;  2JYT A;  4REZ A;  2J42 A;  2NTT A;  5H92 C;  1GAQ B;  2V0G A;  2NMQ A;  1EWC A;  3DWG C;  1UWX A;  4WAF A;  2ON8 A;  1JQ4 A;  2OHF A;  1ET9 A;  2PKO A;  2Y5P A;  2K5P A;  3BZD B;  1XCQ L;  1TS5 A;  4R3D A;  1EM7 A;  1CZP A;  4LLG M;  3ZYY X;  4TQ0 A;  1HA5 A;  1SF0 A;  1RFK A;  1QIL A;  1J7C A;  3RPF C;  3P42 A;  5T8I A;  2N9L A;  2BB5 A;  1NYQ A;  3BWU D;  5EE1 A;  1YJJ A;  1MHX A;  1QT9 A;  2AQ2 B;  3NVZ A;  2IDY A;  2WXF A;  2MJE A;  2PVO D;  4RGT A;  1PFD A;  2EEL A;  4O1N A;  2ONQ A;  1KLG D;  1R7S A;  1I7H A;  1SBB B;  2I2Y A;  3FAH A;  4US8 A;  1XF5 L;  2FBW B;  1QOB A;  2MJD A;  4N59 A;  3VR8 B;  1VRA B;  2N9K A;  1VLB A;  2BW2 A;  2W54 A;  3EGR A;  3BK1 A;  1BUI C;  5G5H A;  4C7Z A;  1FCL A;  1PGX A;  2BS4 B;  1C79 A;  1E7P B;  1UGJ A;  3AV8 A;  1FM0 D;  2V4I B;  1WRI A;  4C7Y A;  3L4P A;  3AE2 B;  1TKY A;  1TS3 A;  1FNV A;  1WWT A;  1LO5 D;  1E0Z A;  2DWQ A;  4L1B A;  1SIJ A;  2QEJ C;  1KF6 B;  5BYS A;  1SSN A;  4DQO C;  4P6V F;  2Y3A A;  1K53 A;  3BII D;  4D2K A;  2IGD A;  1XLO A;  2KQ4 X;  3W5V B;  4JWS C;  3BYY B;  4OZC A;  1JML A;  4OZB A;  1D6E C;  1F2R C;  4ZYS A;  5I4D A;  1YQ3 B;  3AE8 B;  2M0A A;  2VZK D;  1T6B X;  1ET6 A;  2ZW0 A;  4RFB A;  1V97 A;  5JXV A;  5EE3 A;  1JAL A;  4RCO A;  1F0Z A;  4YT0 B;  1YN4 A;  3I9V 1;  4LK0 M;  1PGA A;  3Q8C A;  3P4R B;  3AE9 B;  4HKQ A;  2WXG A;  1YNT E;  3AM9 A;  3CWI A;  2LFI A;  4GLS C;  4FXC A;  3IAS 1;  2BYT A;  2HTM E;  2I38 A;  3TUO A;  2J53 A;  2K0P A;  1FRD A;  2K22 A;  4JE3 B;  1E10 A;  2Q5W D;  3PZ7 A;  1L0V B;  2KMM A;  3MC0 B;  4OVZ A;  3NZ3 A;  2BT6 A;  4IOI E;  4XE0 A;  1OQR A;  2JWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...