1UD7A

Solution structure of the designed hydrophobic core mutant of ubiquitin, 1d7
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
MQVFLKTLTGKTVTIEVEPSDTVENFKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTIHLVLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (UBIQUITIN CORE MUTANT 1D7)
publication title Solution structure and dynamics of a designed hydrophobic core variant of ubiquitin.
pubmed doi rcsb
molecule tags Ubiquitin
total genus 17
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1999-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ud7A00
2Z59B 2I1KA 2MWSB 1YX6B 4JLCA 3LJ3A 2WYQA 1E8WA 2IY1B 3TL5A 3KUZA 5DCNA 1ZKHA 2IBIB 3DVNU 3ZTDA 3H9DA 2G4SA 4JL9A 3UQBA 4GB9A 4NQKE 3KH0A 4FJVB 2D10A 1WRDB 2AL3A 3QA8A 4NY0A 1V2YA 1GUAB 5D7GA 4B9KA 4GDKB 2NR2A 3U30A 2DHZA 1V81A 3APDA 5JHAA 2R2OA 4P7IA 5JHBA 4GXBA 1AARA 1ZW7A 4GN1A 1SIFA 3AXCA 2NVUI 4BBNC 3NZUA 1WIAA 2BYEA 1R4MI 2LXCA 4DK5A 2QHOA 3AU5A 5C1ZA 2KHWB 1S1QB 1Z2MA 4A3PA 1OGWA 2LUEA 4BFRA 2JY6A 2M0XA 2C5LC 3QAQA 2IO1B 2D11A 4FADA 3EHVA 1P9DU 4GSWA 2PE9A 4A20A 1WGYA 4DHZB 4W9CA 3ML8A 3OJ3A 4ZYNA 1EF1A 3K9OB 2KWUB 2KFKB 4W9KA 2V3SA 1WXAA 4W9EA 2XK5A 4HLEA 2GBKA 2MBEA 4KZ0A 2LWPA 2KLCA 3PRPB 1VD2A 2R2QA 2ZVOA 4E74A 4GGQA 2N1WA 2L7RA 2RSUA 4GIVA 2CHXA 2PE6B 4A3OA 4NAWB 4BOSC 2L00B 4ANWA 1WMHB 3VUXA 1Q1OA 3H7PB 2KWVB 3ML9A 4WWOA 2WX1A 4TQ1A 1WGHA 1V49A 2ZPYA 2DAJA 4FHJA 1ZGUB 2MLBA 3ZLZA 3VVWB 1RLFA 4E71A 1WR1A 3KUDB 4RMAA 4WWPA 3A9JB 1C1YB 3DBHI 2CHWA 4RM8A 5AZGA 1SE9A 2C9WB 3JSVA 1A5RA 1WXVA 3RT3B 2FIDA 3PTFC 2K6QA 4G11A 3VFKA 2FAZA 3VAWA 5LXHA 3QHTA 2J0JA 4KIKA 3M62B 1P3QU 1WY8A 2BWFA 1WX7A 3ENEA 3R7QA 5LXIB 3N30A 1C3TA 4IM3A 1V86A 1P0RA 1VCBA 5JZEB 2KTRB 1TGZB 3AI5A 3C0RB 1U4AA 4F8CB 4EZJA 5EDSA 2KKCA 1WGRA 4BKGA 4MJSB 3ZW3A 3T9LA 4EEWA 1YD8U 2KOXA 3ALBA 3PV1A 3L10B 3PS6A 4ASWC 2LVOA 4FN2A 2BGFA 1WX8A 3PRMB 3DOWA 3VUWA 3ZNID 1NBFC 4DHJB 3SD5A 1P1AA 4W9DA 2GBRA 2JT4B 2N1VA 3ZRCA 2AYOB 4XZ4A 3AULA 3BY4B 1E8YA 4MH0E 5J2RA 3MTNB 3DBLI 3HHMA 1BT0A 3QIJA 3B08A 4TQ0A 1XT9B 3A33B 2KLGA 1WFYA 3WA0A 1WYWB 2KD0A 2XK5B 2I1JA 2KDFB 4WJQA 4ICUA 1WZ0A 3U7DA 4HDOA 4LCDE 2LRWA 4DDGD 3L17A 2Z0DB 4URKA 2O6VD 2KDBA 1UH6A 4IWPA 4HCPB 4KDLB 4IWOA 4F7ZA 2RR9A 4YL8A 5G2NA 3DVNV 1KM7A 3DCGA 4BBNF 3JVZX 4AUQC 2L05A 2NBUA 2OJRA 5BO4B 4B6WA 2MX2A 3KVFB 2Y5BB 5CHVC 2XEWA 3V61A 3JW0X 2KJ6A 4MGYE 5CX3A 1SGHA 2CR5A 1RRBA 2MBHA 2RPQA 3APCA 3HM3A 3M63B 2K39A 2DZJA 4ANVA 2W9NA 3PLVA 3M95A 1TBEA 2G4DB 3QK0A 3VQIA 1V80A 4E3CA 2J0MA 3DBRI 1EO6A 2N7DA 5DPWA 4K81A 3WAPA 1KOTA 4KV2A 3O65B 4I6NB 4W9FA 3RZFA 4BVUC 5JH5C 2BKFA 4OVUA 2DX5B 2AL6A 3JSVB 4ZDVA 2DYOA 2KXJA 1CMXB 2JZ3B 4PS8A 2LGDA 4EKUA 4W9JA 4K1RB 3VDZA 3VUYA 4ANUA 2WX0A 3UGBB 4K7WA 2L0TA 3Q3FA 1E8XA 2JF5A 4BKTA 3CSFA 2K8HA 1WM3A 2L8JA 2K6DB 2K1FA 2EMSA 2N9PC 2NBWB 2Z0EB 2NPTB 2G3QB 4BOZB 3ZRFA 1WJUA 3IBEA 3SDLC 4JIOU 4KSLC 3ZO5B 2O6VA 2C7MB 2IY0B 1K8RB 1WGGA 2KX3A 4CYEA 1NI2A 2BF8B 2ZNVB 1L2NA 2N9XA 4WJPA 4LDTD 1H8CA 3IG3A 3WANA 1IYFA 2MP2A 1S3SG 1V9JA 1Z5SB 2V1YA 2VRRB 2ZCCA 2FCNA 2KK8A 5TR5A 3A1QA 2NS5A 2JRIB 2JXXA 2CU1A 4DBGA 1GC6A 1YQBA 1V5TA 2KZRA 3PREA 3V6CB 4HK2A 2KTFA 2HTHA 3L54A 4IM0A 4LJPB 2N7EA 4W9GA 1V5OA 2CHZA 3L13A 3QWZB 2LD9A 2LI5A 2MCNB 2ZJDA 1IPGA 3EFUA 2ZNVC 4EZLA 5E6OA 5G55A 4MDKE 5HKHA 1EUVB 4J6IA 3X23A 3I3TB 2DZKA 4M8NA 1GC7A 3L0WB 1WJ4A 4II2B 5FR6A 2GBMA 2HE7A 2MSED 1Y8RC 4MEMA 1I35A 2FNJB 3AU4A 3MJWA 4G0NB 1Q0WB 2L76A 4HJKA 1J0GA 3ECIA 4HPLB 5AZFA 4WAAA 3CSTA 3V60A 4AOFA 1J8CA 4NJ7A 3OJ4B 4F1SA 1LM8B 3RZWC 2V4LA 3R3MA 2UYZB 3HM6X 3UIOB 3NOBA 2FCQA 2FUHB 1G6JA 2HD5B 2ZZPB 2LASA 4GDKA 1LQBA 4MSMB 2D2QA 4EZKA 5IA7A 3M3JA 4IC7B 4MSQB 5L83A 4B95A 2K25A 4WQOB 3L16A 4HXDA 3DVGY 3DDCB 3IHPC 3RD2A 1OTRB 1WE7A 2EKEC 2LVQA 3CMMB 2O2VA 3LDZE 1HE8A 3DVGX 4IM2A 4WJNA 2MBOA 3B1LX 1E90A 3PRZA 1NDDA 2J0KA 1WJ6A 2MRPA 1QZEA 4NPNA 4TKNA 1WF9A 3H6NA 2PPHA 3PLUA 4CO7A 3H7SA 3UQAA 2CKHB 2DYBA 2NCNA 2O6VB 1KLVA 1MG8A 3RYTA 4DWFA 4PS3A 2N4FA 1WR6E 2PEAA 4HDQA 1UD7A 4MGKE 4I6LB 2KWCA 4GDLA 4EOYA 2MP2B 1UBQA 4CHKA 1YX5B 3X0WA 4AWJA 3U8ZA 3RCZA 2MA9B 2OOBB 2WDTB 3QJZA 4KSKC 3VH3B 4HPMB 2KDEB 5C23A 3ZVVA 3PHWB 3JYUA 3EC8A 3A9KA 4ZRJA 3V6EB 4DHZE 2C7NB 1EF5A 5CHFA 3W1SA 4HCNB 1WZ3A 4ZRIA 4JQWC 4EUTA 3NY5A 4JGHB 4DHJD 4NAWA 3SHQA 2JVCA 5D94A 2IZVB 3GOEA 3DPDA 5GMVA 3PGEA 2LRUA 3UF8A 1XQQA 2MQJA 1WXSA 1R4NI 5E6PA 2RD0A 2JZZA 3PPAA 2KFJA 3QX1A 2J7QB 2IO0B 2DAFA 4FBJB 5D2MB 4DDID 3A9JA 1UBIA 4PYZA 1OEYA 4KVGB 2GOWA 2KNBA 4TV3A 4KIKB 2JWZA 3PZDA 2D3GA 4PYUA 4PS7A 4IW0A 3R66C 4G3XB 4GOCA 1WI0A 3KYCD 2ASQA 4M0WB 3VTWA 3S2AA 2DZMA 5CHWA 4GU2A 3HIZA 2XBBC 4LDTB 1IP9A 2NBVB 2REXA 4K7SA 2KTRA 1PQSA 2KANA 2WWZA 2KQSA 3MHSD 1J19A 4G50A 1FXTB 3K9PB 2ZPNA 2KVRA 1WX9A 3QCAA 3OAWA 3PT2B 2JPHA 4MJSA 2ZCBA 4KZCA 2O2VB 1UELA 1T0YA 3ZNZB 4HVBA 1WXMA 4RM9A 3TJPA 2ZVNA 2GBNA 2KJHB 4ICVA 3HK0A 3QARA 2KMCA 2BPSA 3VH4B 2LGYA 3OLMD 1RAXA 3ZDTA 3QC8B 3ZIMA 4FLHA 4LJOB 2ZEQA 4BKSD 2RGFA 4NNJB 4XX5A 5D6JB 1WE6A 3Q3JA 3UIPB 2JRHA 4GDLB 1GG3A 2KN5A 2M1MA 3L08A 4AJWA 5AEKB 3NS8A 2JUOA 2N9EB 4II3B 4OVVA 5DPRA 3WALA 1UZXB 2BYFA 5J18A 1LXDA 3N3KB 4IG7B 2GMIC 2EMTA 3UINB 1L7YA 2LZ6A 3A4RA 3A9KB 2DENB 2PJHA 2IO2B 4MGIE 4NQLB 1E8ZA 3VTUA 2AEHA 2DYMA 5LLIA 2C60A 2KO3A 1OEYJ 1LFDA 4FJZA 4FA6A 3DQVA 3ZKJC 2M4NA 2LVPA 3IVFA 4IWQA 3KYDD 3ZTCA 2GBJA 4FJYA 4WJOA 4W9IA 2MBQA 2C7HA 2L3ZA 2M17A 3QQ8B 3TIXA 3NZSA 1ISNA 3WAMA 3ZDMC 3ZNHB 2B3AA 2KMAA 2G45B 3TCAA 3PHXB 3SU8X 1X1MA 2MW5A 1WH3A 2A5UA 3RUIB 2AWTA 3B0AA 2K8CA 3W1SC 1WGDA 2HJ8A 2YLMA 5AZHA 4ZRKA 3ZNGC 2KQ7A 3TBLD 1TTNA 2LGXA 4KDIC 3CF6E 5E6NA 4ANXA 5L95C 3VTVA 2LXAA 1E7UA 1P98A 3H1UA 3ONSA 2K8BA 4BKSA 1JRUA 1H4RA 4AJYB 2DZIA 4TUUA 4EFOA 2YVCA 1D3ZA 2NPTA 3GZNI 4MM3A 2FCMA 4M8MA 3APFA 5KHOA 4AP4C 1I42A 2BWES 1UGMA 2KC2A 3KW5B 1WM2A 2IYDB 1Q5WB 1F9JA 4I6PA 1E5WA 2L0FA 4IUMB 3WIMA 1YJ1A 3ZUNA 2KDIA 2KFKA 3A1QB 1TZ1A 2KJRA 4FHKA 3KUCB 1YIWA 1OQYA 2D07B 4FULA 2MBBB 4GMVA 3R7RA 3WAOA 4DXAB 1E7VA 4W9LA 1M94A 3RULA 1XD3B 5DPSA 2UWQA 2CS4A 4W9HA 5IAAC 5CTRC 5J17A 4X57B 2BKRB 2KX0A 5KHQA 1GJZA 3W1YA 3NHEB 3VHTC 1WMHA 3BINA 3N32A 3EECA 4XC2A 4WWNA 2LJ5A 3TMPB 3T8MA 3V62A 1V6EA 2FIFA 3D32A 3H7PA 3P2BA 4K7UA 2IO3B 2M8SA 2BYVE 3VXWA 1WJNA 4MGZE 3PSEB 3IFWB 2A4ZA 4HWIB 2KC1A 1KJTA 4NJ6A 5DPTA 1GNUA 4MELA 3PVLA 1RFAA 3A4SC 3DBSA 4N9F4 2FCSA
chains in the Genus database with same CATH superfamily
2I1KA 2QJLA 1WSPA 3KUZA 2G4SA 4GB9A 1VR9A 4NY0A 4GDKB 2NR2A 3ZXRA 3U30A 2J52A 3AM9A 2WP9B 1V81A 3APDA 2R2OA 5JHBA 3P63A 4GN1A 4JX1C 3TEXA 3MP9A 2B76B 2NMQA 2LXCA 4DK5A 2QHOA 1IUEA 2LUEA 3LXFA 1SF0A 4XWTA 1P9DU 4A20A 4P16A 5BYRA 4ZYNA 3BWUD 1WXAA 2YEPF 1YJJA 2ZVOA 1CJEA 3RNCC 4BOSC 2L00B 1WMHB 3VUXA 3ML9A 4TQ1A 2INDC 2ZPYA 4FHJA 2KMMA 1ZGUB 2MLBA 3URYA 3N1ZC 1RLFA 1LGRA 1JCKB 3FILB 4RM8A 1HXYD 5AZGA 1ZOYB 1A5RA 4DXGA 1TS4A 1JROA 2CU3A 2DLBA 3QHTA 1D5MC 1P3QU 3R7QA 3DWMA 4YSXB 5EE1A 1P0RA 3BVZA 2KTRB 1TGZB 4C7YA 2AQ3B 3ZJTA 4LNFA 1WGRA 3AECB 4MJSB 3T9LA 4EEWA 2KOXA 3L10B 5EE3A 1JWBD 3Q8BA 2LVOA 3MC8A 1WX8A 3VUWA 3RNFC 3VR8B 2GBRA 2JT4B 2MEKA 2D5GA 4KGSA 1CK1A 4MH0E 4L23A 2WXLA 1BT0A 3QIJA 3A33B 3WA0A 2KD0A 2XK5B 1N60A 4WJQA 4HDOA 4URKA 4LNIA 2KDBA 4OZBA 5IKCM 4YL8A 1KM7A 3JVZX 2OJRA 5BO4B 3Q14C 2MX2A 1K53A 3KVFB 2KJ6A 3RN9C 4MGYE 4REZA 2PIAA 4ANVA 4JPSA 4RFBA 1MPEA 4M02A 1B9RA 5JH5C 3DBHB 4RGOS 2DYOA 3KWLA 1FMAD 4K1RB 2WX0A 2D3AA 4K7WA 3Q3FA 4BKTA 1FIQA 3CSFA 1I4XA 2N9PC 1L0XB 1TY2A 2G3QB 4RF1A 4RGTA 3SDLC 1T0QC 3ZO5B 3RNAC 1UNSA 2ZNVB 2N9XA 2WXPA 3IG3A 5HI1A 1V9JA 1Z5SB 2V1YA 5TR5A 3A1QA 1FCCC 2JRIB 2CU1A 1V5TA 4PK1A 2KTFA 2WU2B 4LJPB 1V5OA 3NS1A 2HJ1A 3AN1A 3HRDD 2PKOA 2ZNVC 3N9YC 5E6OA 5HKHA 1SEBD 3GE3C 5FKAC 5FR6A 4HJKA 3HVDA 4KKIA 3DHIC 1J8CA 4NJ7A 2QEJC 1LM8B 3RZWC 1V97A 3NZ3A 5IP4D 3MC9A 4J3OD 3R3MA 2FCQA 2LFIA 2WU5B 2NTTA 1LQBA 4MSMB 4ZRPA 3P4RB 1C76A 4IC7B 4B95A 1ROEA 4HXDA 3RD2A 1OTRB 2CJNA 2EKEC 2GLSA 2LEKA 2J53A 2LVQA 3DVGX 4LLGM 3PRZA 1E90A 2MRPA 1WF9A 1F2RI 2NCNA 2MHJA 3HUIA 1GB1A 1UBQA 4CHKA 3X0WA 3VH3B 4KSKC 4UDUC 1XLQA 1MHXA 1YOVB 3ZVVA 3JYUA 5CHFA 4ARCA 3W1SA 4HCNB 1WZ3A 2BS3B 4S0RA 3FAHA 4NAWA 2JVCA 1I4PA 1LO5D 4AS1A 2IZVB 3DPDA 5GMVA 1I4GA 3RNGC 2N9KA 2IO0B 1P7FA 3A9JA 4YXDB 3BVMA 2D3GA 4G3XB 1PUTA 1WI0A 3KYCD 4M0WB 3S2AA 3HIZA 4LDTB 3AEDB 2NBVB 2REXA 5H8YE 2KANA 1D5ZC 2ACZB 3MHSD 4XGAB 3SFEB 5HFYA 2O2VB 1UELA 3TJPA 2LUMA 1YQ3B 2GBNA 4ICVA 3HK0A 3QARA 3OLMD 3ZDTA 3QC8B 1QQRA 2RGFA 4NNJB 5D6JB 2H88B 4LTUA 1GG3A 2M1MA 2BT6A 4AJWA 3NJTA 4XWWA 4II3B 2WDQB 4RGNA 2BYFA 1L6VA 1XF5L 2DBYA 2DYMA 3ZXVA 5LLIA 3DQVA 3ZKJC 1UWXA 3KYDD 4S17A 4HEA1 3NZSA 4HPPA 1R7SA 2B3AA 1X1MA 1SE3A 3RUIB 4YWGG 4HRSA 2HJ8A 2YLMA 4US8A 2KQ7A 1WYGA 4KDIC 3RPFC 3VTVA 4D2KA 4BKSA 1JRUA 2DZIA 2DWQA 1CQVA 2BS2B 3GZNI 4MM3A 4M8MA 2MJEA 3AEEB 4P6VF 2KC2A 2ZW0A 1WM2A 1E5WA 1TJEA 3ZUNA 2KDIA 5LNK1 3A1QB 2LGIA 3KUCB 1OQYA 2MBBB 3R7RA 1ZDXA 2BVCA 2BB5A 3RULA 2UWQA 2WXIA 4W9HA 1WGKA 5CTRC 4X57B 1WXQA 3DHHC 3W1YA 3VHTC 1WMHA 3N32A 1D5XC 3SEBA 4K7UA 3P2BA 2IO3B 3VXWA 3LYYA 1E7PB 1HZ5A 1PFDA 3GB1A 4NJ6A 2ON8A 1GNUA 3PVLA 4AQ7A 3A4SC 2FCSA 1YX6B 2IY1B 5DCNA 1ZKHA 3L4PA 4JL9A 2AL3A 1V2YA 1N5WA 3GS2A 2WXFA 4P7IA 4ZHPA 4A9AA 1ZW7A 1PYWD 4MT5A 3B2FA 1SSNA 2NTSA 4BBNC 3NZUA 4N6EB 1R4MI 3P4QB 2LHEA 3B2GA 2SAKA 1S1QB 4QAYA 1Z2MA 4BFRA 2JY6A 2C5LC 2IO1B 2QSDA 2XNAC 3EHVA 4TMAB 2PE9A 1L6UA 5FK9C 3AEGB 2WXNA 3AE5B 3ML8A 1IBXB 2KWUB 2V3SA 4WIPA 1JW9D 2XK5A 2GBKA 3NVZA 1JWAD 1VD2A 2WXOA 5EE0A 4E74A 4GGQA 4P1CC 2RSUA 4KGTA 4A3OA 4NAWB 2GB1A 2KWVB 4WWOA 2WX1A 1V49A 1QOAA 4ZRQA 3I5JC 3VVWB 4JE3B 2JU6X 3I57A 3A9JB 1C1YB 2VH1A 2E6XA 2FIDA 2K6QA 4KIKA 2GI9A 3RFZB 1ET6A 5JZEB 1L0YB 3EGRA 3C0RB 1E9MA 3IT4B 2PMVA 5EDSA 2I38A 4LNNA 4BKGA 3NVWA 1C4CA 4RF0A 1L4ZB 3BYYB 3ALBA 3PV1A 1YMHE 1XXGA 3DWGC 4ASWC 4FN2A 2BGFA 3ZNID 1NBFC 1UUPA 5IOIA 3SD5A 4W9DA 2KWDA 3DHGC 2N1VA 2AYOB 4A90A 5J2RA 3VRBB 3DBLI 1PDXA 2K9XA 2KLGA 1WFYA 1WYWB 1WZ0A 4LCDE 3R2IA 4DDGD 2O6VD 1UH6A 2RR9A 3TUOA 3DCGA 2Q5WD 2WNMA 1MJDA 2NBUA 3CWIA 4B6WA 1KF6B 2N7JA 3AE3B 3V61A 5CX3A 3APCA 3HM3A 3M63B 3J9CA 3AEBB 3WAPA 1KOTA 4KV2A 3O65B 3RZFA 2BKFA 4OVUA 2DX5B 3ZJVA 4ZDVA 2WDVB 1CMXB 4PS8A 4EKUA 4W9JA 3VDZA 2W3RA 1E8XA 1FEHA 1FCLA 2K6DB 2NBWB 4MM3B 1KRHA 1ZDVA 3B9JA 1WGGA 1NI2A 2BF8B 1EM7A 4WJPA 2KDMA 1IYFA 2VRRB 2VZKB 5GXGB 2NS5A 1YQ4B 1GC6A 3PREA 3V6CB 1KFYB 4RGMA 2N7EA 4W9GA 1HEZE 4JWSC 2HTME 2LD9A 1FNVA 5H92C 2LI5A 1UGJA 2K5PA 4EZLA 4MDKE 1V1PB 1J7CA 3I3TB 3L0WB 3VR9B 1F52A 3MJWA 1Q0WB 2L76A 3ECIA 4HPLB 5AZFA 4WAAA 3V60A 4AOFA 1OFFA 3EFCA 4F1SA 4O1NA 2DNFA 3AE4B 3KWVA 4US9A 3HM6X 4M0WA 3AB5A 3AE2B 2FUHB 1G6JA 2ZZPB 3Q69A 5IA7A 3M3JA 3AEFB 3MJ5A 2K25A 4WQOB 1QLBB 1DOIA 4BAXA 3CMMB 2O2VA 1HE8A 2G9HD 2MBOA 1NDDA 1WJ6A 3PLUA 1MG8A 3RYTA 4PS3A 2M0AA 2QILA 3IAM1 1KH0A 4I6LB 4EOYA 2EKIA 1E6EB 4AWJA 3U8ZA 2HDEA 2OOBB 2WDTB 1F1HA 5C23A 3V6EB 4DHZE 2Y5PA 1ESFA 2IPKD 1YJIA 4ZRIA 4JGHB 4KGRA 1XLOA 3GOEA 3TEZA 2LRUA 2QC8A 2ZW1A 1OQQA 5E6PA 4M00A 2OEDA 3PPAA 4WAFA 5D2MB 3W9CB 4KVGB 3SFDB 4KIKB 3R66C 1JWMD 1FRRA 3VTWA 2ASQA 2J4XA 2N9LA 1FXIA 4GU2A 2XBBC 1IP9A 1QF6A 2WWZA 2M56B 4G50A 2D3CA 1SE4A 1FXTB 3K9PB 1SJHD 3OAWA 3BVGA 3PT2B 1JALA 4KZCA 1PGBA 1T0YA 2ZVNA 4DQOC 1TIFA 1TT5B 2BPSA 2KQ4X 3ZIMA 4LJOB 3LB8C 1FXAA 4GDLB 4TSSA 4YSZB 2QCZA 4OVVA 5DPRA 5J18A 1LXDA 2GMIC 2EMTA 2FUG1 3V05A 3A9KB 2L83A 2W3SA 2AEHA 2KO3A 1LFDA 1F2RC 2M4NA 3IVFA 4IWQA 4FJYA 3BIID 4W9IA 2L3ZA 2M17A 1MHHE 3ZNHB 2KMAA 2G45B 3TCAA 3SU8X 2MW5A 3WCQA 3AE9B 2BS4B 1FNWA 2AWTA 2K8CA 4A6QA 4ZRKA 1TTNA 2LGXA 5E6NA 1NYQA 3CF6E 5AUIA 3EUB2 2LHDA 4ANXA 4LNKA 2LXAA 1P98A 1JQ4A 2WXKA 5BMGA 3T3OA 2RPVA 2YVCA 1JMLA 5MPOA 3APFA 2V4IB 1I42A 1KLGD 1Q5WB 4I6PA 1TKGA 1IBXA 1YJ1A 4GMVA 1ACCA 4DXAB 4OZAA 1Y56A 2CS4A 1SBBB 1V8CA 3BINA 4WWNA 3EECA 2FIFA 3D32A 2WXRA 2M8SA 2BYVE 1WJNA 4JWUC 4NJCA 2A4ZA 3NVYA 3I63C 1BMLC 1RFAA 3FC4A 4N9F4 2Z59B 1SIJA 4FXCA 2MWSB 3LJ3A 2WYQA 1K52A 3NRZA 5JXVA 3DVNU 3ZTDA 2WXHA 2ICIA 3UQBA 1T3QA 2D10A 3QA8A 4B9KA 2WHIA 5D7GA 3AH7A 2RDGA 5HHDG 2DHZA 3W5VB 1AARA 1QOFA 1XCQL 2NVUI 1WIAA 2BYEA 5C1ZA 1SB3C 2KHWB 4A3PA 1OGWA 4C4VB 3RMKC 2D11A 3GZNB 3E56A 1TKEA 1WGYA 4DHZB 3OJ3A 1VDVA 2PLPA 2W54A 3E9SA 3T3NA 4W9KA 4W9EA 4HLEA 4KZ0A 2LWPA 3PRPB 5D3IB 4IOIE 1FRDA 4C00A 1NI3A 1N63A 2L7RA 5EE9A 4GIVA 1FM0D 3UI3A 4DXFA 4MH8A 5IO9A 4ANWA 1FFUA 3H7PB 4YTPB 1WGHA 3MC0B 3ZLZA 1D6EC 4E71A 4WQMA 3U52E 1WR1A 4RMAA 3FKYA 2V0GA 2R61A 1K51A 1SE9A 1VZ8A 1WXVA 3RT3B 3RNBC 1T0RC 4G11A 3VAWA 2J0JA 3N30A 2W55A 4IM3A 3C19A 3V3XA 3AI5A 4F8CB 1Q10A 2ONQA 2QIEB 2PVOD 3ZGZA 4L2YA 3ZW3A 1TS5A 1R4MB 3CIRB 3DOWA 4DHJB 1P1AA 4PT5A 3ZRCA 3Q8CA 3BY4B 1NYRA 1N5XA 4TQ0A 1XT9B 4RCOA 2D3BA 3SR6A 2MJDA 2I1JA 4ICUA 2LRWA 4HCPB 1V1PA 2FBWB 3AEAB 4H2AA 5G2NA 3P4PB 3NUHB 2L05A 3PZ7A 5CHVC 3JW0X 1WWTA 5T8IA 4XE0A 1SGHA 2RPQA 4OHJA 2K39A 2DZJA 2W9NA 3PLVA 3M95A 2BBCA 3QK0A 1XEEA 1V80A 3VQIA 1K50A 2J0MA 3DBRI 2N7DA 1CZPA 4K81A 4BVUC 4I6NB 4R3DA 3N1YC 3JSVB 2JZ3B 2LGDA 2GRIA 3HVZA 2INCC 4ANUA 2JF5A 1VZ6A 2K8HA 1WM3A 2L8JA 1EU4A 2KYWA 4BOZB 3RNEC 3IT6B 3ZRFA 4JIOU 4P1BC 2LMCA 4EE2A 2C7MB 1L2NA 3WANA 2X38A 1S3SG 2FCNA 2KVZA 1P7EA 3PZ8A 3RI7C 1YQBA 1RFKA 1D4BA 1JWSD 2HTHA 4N58A 3DBLB 1STEA 4IM0A 4ZOHC 1ET9A 3QWZB 2WDRB 2LJIA 2ZJDA 1IPGA 4BZAA 3AE6B 5G55A 3N20C 2WXJA 1EUVB 1XLPA 3VRAB 3X23A 1JRPA 4II2B 2GBMA 1I35A 1KLUD 2FNJB 3AU4A 3O13A 4G0NB 1J0GA 3CSTA 3Q8EA 1XCTL 2V4LA 2BB6A 2WXGA 5G5HA 4NAMA 3UIOB 2UU7A 2WQYB 2HD5B 2LASA 4EZKA 2PVGC 2BW2A 5L83A 1HTOA 3L16A 3DVGY 2Y3AA 1WE7A 4A8XC 4WJNA 1AYFA 2J0KA 4CQNA 5BMHA 4NPNA 3H6NA 2Y5CA 4CO7A 2O6VB 1KLVA 2PEAA 4HDQA 1UD7A 2KWCA 4GDLA 2MP2B 1M4VA 1MVKA 1YX5B 4K3BA 1TKYA 3RCZA 2KAJA 2MA9B 1RYJA 3QJZA 5D3DA 2KDEB 1C4AA 3A9KA 4ZRJA 2C7NB 1EF5A 4HROA 2IJ0A 1FFVA 3MFGA 4JQWC 4YT0B 4USAA 2KN4A 3P42A 3PGEA 1L0VB 3UF8A 2E3TA 1R4NI 5AUKA 1C79A 1N62A 2KFJA 4XDCA 3IAS1 1MI0A 1T6BX 4FBJB 1SE2A 3Q3MC 1UBIA 4GLSC 4B0MA 4PYZA 1OEYA 1N61A 1ZXHA 4PYUA 4GOCA 1J7AA 2DZMA 5CHWA 2JX5A 2BTEA 4K7SA 1PQSA 4OW0A 2KQSA 1J19A 3U2SC 2ZPNA 2KVRA 1WX9A 4IKGA 2JPHA 2INNE 2ZCBA 3TSSA 4HVBA 1FD6A 3OWEB 2BYTA 1RM6C 3AE7B 3VH4B 2INPE 1HA5A 4BKSD 3Q3JA 3UIPB 2JRHA 5IN7A 2KN5A 4C7ZA 3L08A 3NS8A 1C78A 2JUOA 1ZE3D 3WALA 2KACA 5C3JB 4N59A 1L7YA 2SEBD 1FNUA 2PJHA 2IO2B 4NQLB 2XN9C 2C60A 2VZKD 1OEYJ 1DYQA 1TZOA 4FJZA 4FA6A 4IDIA 2LVPA 4LK0M 3ZTCA 2GBJA 4WJOA 3TIXA 4YTMB 1ISNA 3WAMA 3ZDMC 3OG5A 2RDHA 2EELA 3PHXB 1WH3A 2A5UA 1MG4A 5AZHA 3TBLD 1E7UA 3H1UA 1RWSA 3ONSA 3Q3OC 5E6JA 2X8XX 4TUUA 4OZCA 4C4VA 1YNTE 3U7ZA 2NPTA 3R2TA 1F9JA 4IUMB 2L0FA 1PGXA 1L5PA 2RMMA 3WIMA 1JWUD 3BZDB 2KJRA 4FHKA 1YIWA 4FULA 2D07B 2H89B 3WAOA 2RDBC 3W2DA 1F77A 1XD3B 2WLBA 4HJGE 2BKRB 1T0SC 2JSVX 3NHEB 3TMPB 4XC2A 1I7HA 1V6EA 3H7PA 2WXQA 2L1AA 4WURA 2QMTA 3GP7A 2AX5A 1HZ6A 3IFWB 3PO0A 2PTLA 1C77A 5DPTA 3BK1A 4MELA 1QT9A 2V3PA 4JLCA 1E8WA 3TL5A 2IBIB 3H9DA 4NQKE 3KH0A 4FJVB 1WRDB 1GUAB 5JHAA 2CJOA 4GXBA 3Q6BA 1SIFA 3W5UB 3AXCA 1F0ZA 3AU5A 3AV8A 2M0XA 2JQRB 3QAQA 4FADA 4GSWA 4W9CA 1EF1A 3K9OB 2KFKB 2MBEA 2WS3B 2KLCA 1I4RA 2R2QA 2YEPB 1DOXA 2QDFA 1YN4A 2K3UA 2N1WA 4KX6B 1T5XD 3P1MA 2CHXA 2PE6B 1V1OA 1YN3A 1Q1OA 1N6ZA 1NENB 2DAJA 4XDDA 4HKZE 3KUDB 1GPXA 4WWPA 2MH7A 5BYQA 3DBHI 2CHWA 2C9WB 3JSVA 5I4DA 4L1BA 3PTFC 4LNOA 3VFKA 2FAZA 5LXHA 3M62B 2BWFA 1WY8A 3EA6A 1WX7A 3ENEA 5LXIB 1C3TA 1V86A 1VCBA 2OHFA 1U4AA 4EZJA 2KKCA 1XO3A 1YD8U 3PS6A 3PRMB 3AMZA 2VH2A 2IDYA 3ZJUA 4XZ4A 3AULA 1E8YA 3MTNB 1FO4A 4ZYSA 3HHMA 3B08A 1NEKB 3ABVB 2K22A 2KDFB 2WXMA 3U7DA 1EWYC 3L17A 2Z0DB 1ZUD2 4KDLB 4IWPA 1ENFA 1IGCA 4IWOA 1KTKA 4F7ZA 1VJKA 1ZP0B 3AE8B 5BYSA 3DVNV 2JZPA 4BBNF 4MACA 4AUQC 2G1EA 1QILA 2IGGA 2Y5BB 2XEWA 4ACFA 2CR5A 1RRBA 2MBHA 3NG0A 1TBEA 2G4DB 4E3CA 1FPYA 1EO6A 3AE1B 5DPWA 4W9FA 1QOBA 4RH6A 2V3NA 2AL6A 2KXJA 1EU3A 3Q3NC 1BXTA 3VUYA 4ARIA 3UGBB 2L0TA 4KKJA 2K1FA 2EMSA 2Z0EB 2NPTB 1WJUA 1E10A 3IBEA 4KSLC 2KT7A 2O6VA 1GB4A 2IY0B 2KX3A 1B1ZA 1K8RB 4CYEA 2M19A 4LDTD 1H8CA 2MP2A 2ZCCA 2KK8A 1DOYA 2JXXA 4DBGA 2KZRA 3KQ4A 4HK2A 3L54A 2CHZA 3L13A 2MCNB 4YTNB 1GAQB 3EFUA 1OQRA 4J6IA 1A70A 2DZKA 1GC7A 4M8NA 1WJ4A 2IGDA 2HE7A 1AW7A 2MSED 4B0EA 1Y8RC 4MEMA 4HKQA 5HG2A 4M01A 2BQQA 2IGHA 2AQ1B 1I4QA 2JYEA 3OJ4B 4ZHOA 1QKZA 2UYZB 3KLSX 3DBRB 1XLNA 3NOBA 4OVZA 5FR3A 1TS3A 2AQ2B 4GDKA 2D2QA 4Q2JA 2JYTA 4MSQB 3DDCB 3IHPC 2W82A 3LDZE 4IM2A 3B1LX 1QZEA 4TKNA 1TYGB 2PPHA 3H7SA 3UQAA 2CKHB 2DYBA 4DWFA 1J7BA 1WR6E 2N4FA 2J42A 4MGKE 3Q8FA 1AWDA 1I4HA 2MJ3A 1YN5A 4HPMB 3PHWB 1HQRD 3EC8A 4YSYB 1ZPSA 3NVVA 1E0ZA 2JWUA 4EUTA 3NY5A 4DHJD 2PW9A 3SHQA 5D94A 1XQQA 2MQJA 1GOZA 1WXSA 3U4EG 3R8BA 2OJWA 2JXTA 2RD0A 2JZZA 3QX1A 2J7QB 2DAFA 3FILA 4DDID 2GOWA 2KNBA 1BUIC 4TV3A 2JWZA 3PZDA 4PS7A 4IW0A 1DGJA 2WGSA 4WWMA 1IGDA 2KTRA 1WRIA 3QCAA 4MJSA 3ZNZB 1WXMA 2L52A 4RM9A 2KJHB 3MHZA 2KMCA 1EWCA 2LGYA 1HTQA 1RAXA 3ZYYX 4FLHA 2ZEQA 1ZXIA 3BYTB 4XX5A 1WE6A 5AEKB 2N9EB 1AN8A 1C4PA 1UZXB 3N3KB 4IG7B 3UINB 2LZ6A 3A4RA 2DENB 1TY0A 3ZQ4A 4MGIE 1E8ZA 3VTUA 2I2YA 1PGAA 1R4NB 2MBQA 4RNAA 2C7HA 1C9FA 1MFWA 1SXTA 3QQ8B 1UWMA 1VRAB 3I9V1 3H8HA 3P4SB 1QOGA 4WH4A 3TEWA 4C80A 3B0AA 4ITKA 1WGDA 5G5GA 3W1SC 3ZNGC 1NVID 3BK2A 5L95C 2N0SB 2FE8A 2TSSA 2K8BA 1H4RA 3TEYA 4AJYB 5BMIA 2L32A 1VLBA 4EFOA 1D3ZA 2FCMA 5KHOA 4AP4C 2BWES 1UGMA 3KW5B 2IYDB 5C2TB 2K0PA 2KFKA 1TS2A 1TZ1A 2Z8LA 3Q2AC 2LGSA 1E7VA 4W9LA 1M94A 4C56C 5DPSA 3C8YA 3N1XC 3GE8C 4K3CA 1VZ7A 5IAAC 5J17A 2KX0A 5KHQA 4XYCA 3IXSA 1GJZA 5TSSA 3V62A 4A55A 1UF0A 2LJ5A 4NZLB 3T8MA 4MGZE 3PSEB 2V9HA 3Q8AA 4HWIB 2KC1A 1KJTA 1SJED 3ETRA 3DBSA 1L4DB
chains in the Genus database with same CATH topology
2Z59B 2I1KA 2MWSB 1YX6B 4JLCA 3LJ3A 2WYQA 1E8WA 2IY1B 3TL5A 3KUZA 5DCNA 1ZKHA 2IBIB 3DVNU 3ZTDA 3H9DA 2G4SA 4JL9A 3UQBA 4GB9A 4NQKE 3KH0A 4FJVB 2D10A 1WRDB 2AL3A 3QA8A 4NY0A 1V2YA 1GUAB 5D7GA 4B9KA 4GDKB 2NR2A 3U30A 2DHZA 1V81A 3APDA 5JHAA 2R2OA 4P7IA 5JHBA 4GXBA 1AARA 1ZW7A 4GN1A 1SIFA 3AXCA 2NVUI 4BBNC 3NZUA 1WIAA 2BYEA 1R4MI 2LXCA 4DK5A 2QHOA 3AU5A 5C1ZA 2KHWB 1S1QB 1Z2MA 4A3PA 1OGWA 2LUEA 4BFRA 2JY6A 2M0XA 2C5LC 3QAQA 2IO1B 2D11A 4FADA 3EHVA 1P9DU 4GSWA 2PE9A 4A20A 1WGYA 4DHZB 4W9CA 3ML8A 3OJ3A 4ZYNA 1EF1A 3K9OB 2KWUB 2KFKB 4W9KA 2V3SA 1WXAA 4W9EA 2XK5A 4HLEA 2GBKA 2MBEA 4KZ0A 2LWPA 2KLCA 3PRPB 1VD2A 2R2QA 2ZVOA 4E74A 4GGQA 2N1WA 2L7RA 2RSUA 4GIVA 2CHXA 2PE6B 4A3OA 4NAWB 4BOSC 2L00B 4ANWA 1WMHB 3VUXA 1Q1OA 3H7PB 2KWVB 3ML9A 4WWOA 2WX1A 4TQ1A 1WGHA 1V49A 2ZPYA 2DAJA 4FHJA 1ZGUB 2MLBA 3ZLZA 3VVWB 1RLFA 4E71A 1WR1A 3KUDB 4RMAA 4WWPA 3A9JB 1C1YB 3DBHI 2CHWA 4RM8A 5AZGA 1SE9A 2C9WB 3JSVA 1A5RA 1WXVA 3RT3B 2FIDA 3PTFC 2K6QA 4G11A 3VFKA 2FAZA 3VAWA 5LXHA 3QHTA 2J0JA 4KIKA 3M62B 1P3QU 1WY8A 2BWFA 1WX7A 3ENEA 3R7QA 5LXIB 3N30A 1C3TA 4IM3A 1V86A 1P0RA 1VCBA 5JZEB 2KTRB 1TGZB 3AI5A 3C0RB 1U4AA 4F8CB 4EZJA 5EDSA 2KKCA 1WGRA 4BKGA 4MJSB 3ZW3A 3T9LA 4EEWA 1YD8U 2KOXA 3ALBA 3PV1A 3L10B 3PS6A 4ASWC 2LVOA 4FN2A 2BGFA 1WX8A 3PRMB 3DOWA 3VUWA 3ZNID 1NBFC 4DHJB 3SD5A 1P1AA 4W9DA 2GBRA 2JT4B 2N1VA 3ZRCA 2AYOB 4XZ4A 3AULA 3BY4B 1E8YA 4MH0E 5J2RA 3MTNB 3DBLI 3HHMA 1BT0A 3QIJA 3B08A 4TQ0A 1XT9B 3A33B 2KLGA 1WFYA 3WA0A 1WYWB 2KD0A 2XK5B 2I1JA 2KDFB 4WJQA 4ICUA 1WZ0A 3U7DA 4HDOA 4LCDE 2LRWA 4DDGD 3L17A 2Z0DB 4URKA 2O6VD 2KDBA 1UH6A 4IWPA 4HCPB 4KDLB 4IWOA 4F7ZA 2RR9A 4YL8A 5G2NA 3DVNV 1KM7A 3DCGA 4BBNF 3JVZX 4AUQC 2L05A 2NBUA 2OJRA 5BO4B 4B6WA 2MX2A 3KVFB 2Y5BB 5CHVC 2XEWA 3V61A 3JW0X 2KJ6A 4MGYE 5CX3A 1SGHA 2CR5A 1RRBA 2MBHA 2RPQA 3APCA 3HM3A 3M63B 2K39A 2DZJA 4ANVA 2W9NA 3PLVA 3M95A 1TBEA 2G4DB 3QK0A 3VQIA 1V80A 4E3CA 2J0MA 3DBRI 1EO6A 2N7DA 5DPWA 4K81A 3WAPA 1KOTA 4KV2A 3O65B 4I6NB 4W9FA 3RZFA 4BVUC 5JH5C 2BKFA 4OVUA 2DX5B 2AL6A 3JSVB 4ZDVA 2DYOA 2KXJA 1CMXB 2JZ3B 4PS8A 2LGDA 4EKUA 4W9JA 4K1RB 3VDZA 3VUYA 4ANUA 2WX0A 3UGBB 4K7WA 2L0TA 3Q3FA 1E8XA 2JF5A 4BKTA 3CSFA 2K8HA 1WM3A 2L8JA 2K6DB 2K1FA 2EMSA 2N9PC 2NBWB 2Z0EB 2NPTB 2G3QB 4BOZB 3ZRFA 1WJUA 3IBEA 3SDLC 4JIOU 4KSLC 3ZO5B 2O6VA 2C7MB 2IY0B 1K8RB 1WGGA 2KX3A 4CYEA 1NI2A 2BF8B 2ZNVB 1L2NA 2N9XA 4WJPA 4LDTD 1H8CA 3IG3A 3WANA 1IYFA 2MP2A 1S3SG 1V9JA 1Z5SB 2V1YA 2VRRB 2ZCCA 2FCNA 2KK8A 5TR5A 3A1QA 2NS5A 2JRIB 2JXXA 2CU1A 4DBGA 1GC6A 1YQBA 1V5TA 2KZRA 3PREA 3V6CB 4HK2A 2KTFA 2HTHA 3L54A 4IM0A 4LJPB 2N7EA 4W9GA 1V5OA 2CHZA 3L13A 3QWZB 2LD9A 2LI5A 2MCNB 2ZJDA 1IPGA 3EFUA 2ZNVC 4EZLA 5E6OA 5G55A 4MDKE 5HKHA 1EUVB 4J6IA 3X23A 3I3TB 2DZKA 4M8NA 1GC7A 3L0WB 1WJ4A 4II2B 5FR6A 2GBMA 2HE7A 2MSED 1Y8RC 4MEMA 1I35A 2FNJB 3AU4A 3MJWA 4G0NB 1Q0WB 2L76A 4HJKA 1J0GA 3ECIA 4HPLB 5AZFA 4WAAA 3CSTA 3V60A 4AOFA 1J8CA 4NJ7A 3OJ4B 4F1SA 1LM8B 3RZWC 2V4LA 3R3MA 2UYZB 3HM6X 3UIOB 3NOBA 2FCQA 2FUHB 1G6JA 2HD5B 2ZZPB 2LASA 4GDKA 1LQBA 4MSMB 2D2QA 4EZKA 5IA7A 3M3JA 4IC7B 4MSQB 5L83A 4B95A 2K25A 4WQOB 3L16A 4HXDA 3DVGY 3DDCB 3IHPC 3RD2A 1OTRB 1WE7A 2EKEC 2LVQA 3CMMB 2O2VA 3LDZE 1HE8A 3DVGX 4IM2A 4WJNA 2MBOA 3B1LX 1E90A 3PRZA 1NDDA 2J0KA 1WJ6A 2MRPA 1QZEA 4NPNA 4TKNA 1WF9A 3H6NA 2PPHA 3PLUA 4CO7A 3H7SA 3UQAA 2CKHB 2DYBA 2NCNA 2O6VB 1KLVA 1MG8A 3RYTA 4DWFA 4PS3A 2N4FA 1WR6E 2PEAA 4HDQA 1UD7A 4MGKE 4I6LB 2KWCA 4GDLA 4EOYA 2MP2B 1UBQA 4CHKA 1YX5B 3X0WA 4AWJA 3U8ZA 3RCZA 2MA9B 2OOBB 2WDTB 3QJZA 4KSKC 3VH3B 4HPMB 2KDEB 5C23A 3ZVVA 3PHWB 3JYUA 3EC8A 3A9KA 4ZRJA 3V6EB 4DHZE 2C7NB 1EF5A 5CHFA 3W1SA 4HCNB 1WZ3A 4ZRIA 4JQWC 4EUTA 3NY5A 4JGHB 4DHJD 4NAWA 3SHQA 2JVCA 5D94A 2IZVB 3GOEA 3DPDA 5GMVA 3PGEA 2LRUA 3UF8A 1XQQA 2MQJA 1WXSA 1R4NI 5E6PA 2RD0A 2JZZA 3PPAA 2KFJA 3QX1A 2J7QB 2IO0B 2DAFA 4FBJB 5D2MB 4DDID 3A9JA 1UBIA 4PYZA 1OEYA 4KVGB 2GOWA 2KNBA 4TV3A 4KIKB 2JWZA 3PZDA 2D3GA 4PYUA 4PS7A 4IW0A 3R66C 4G3XB 4GOCA 1WI0A 3KYCD 2ASQA 4M0WB 3VTWA 3S2AA 2DZMA 5CHWA 4GU2A 3HIZA 2XBBC 4LDTB 1IP9A 2NBVB 2REXA 4K7SA 2KTRA 1PQSA 2KANA 2WWZA 2KQSA 3MHSD 1J19A 4G50A 1FXTB 3K9PB 2ZPNA 2KVRA 1WX9A 3QCAA 3OAWA 3PT2B 2JPHA 4MJSA 2ZCBA 4KZCA 2O2VB 1UELA 1T0YA 3ZNZB 4HVBA 1WXMA 4RM9A 3TJPA 2ZVNA 2GBNA 2KJHB 4ICVA 3HK0A 3QARA 2KMCA 2BPSA 3VH4B 2LGYA 3OLMD 1RAXA 3ZDTA 3QC8B 3ZIMA 4FLHA 4LJOB 2ZEQA 4BKSD 2RGFA 4NNJB 4XX5A 5D6JB 1WE6A 3Q3JA 3UIPB 2JRHA 4GDLB 1GG3A 2KN5A 2M1MA 3L08A 4AJWA 5AEKB 3NS8A 2JUOA 2N9EB 4II3B 4OVVA 5DPRA 3WALA 1UZXB 2BYFA 5J18A 1LXDA 3N3KB 4IG7B 2GMIC 2EMTA 3UINB 1L7YA 2LZ6A 3A4RA 3A9KB 2DENB 2PJHA 2IO2B 4MGIE 4NQLB 1E8ZA 3VTUA 2AEHA 2DYMA 5LLIA 2C60A 2KO3A 1OEYJ 1LFDA 4FJZA 4FA6A 3DQVA 3ZKJC 2M4NA 2LVPA 3IVFA 4IWQA 3KYDD 3ZTCA 2GBJA 4FJYA 4WJOA 4W9IA 2MBQA 2C7HA 2L3ZA 2M17A 3QQ8B 3TIXA 3NZSA 1ISNA 3WAMA 3ZDMC 3ZNHB 2B3AA 2KMAA 2G45B 3TCAA 3PHXB 3SU8X 1X1MA 2MW5A 1WH3A 2A5UA 3RUIB 2AWTA 3B0AA 2K8CA 3W1SC 1WGDA 2HJ8A 2YLMA 5AZHA 4ZRKA 3ZNGC 2KQ7A 3TBLD 1TTNA 2LGXA 4KDIC 3CF6E 5E6NA 4ANXA 5L95C 3VTVA 2LXAA 1E7UA 1P98A 3H1UA 3ONSA 2K8BA 4BKSA 1JRUA 1H4RA 4AJYB 2DZIA 4TUUA 4EFOA 2YVCA 1D3ZA 2NPTA 3GZNI 4MM3A 2FCMA 4M8MA 3APFA 5KHOA 4AP4C 1I42A 2BWES 1UGMA 2KC2A 3KW5B 1WM2A 2IYDB 1Q5WB 1F9JA 4I6PA 1E5WA 2L0FA 4IUMB 3WIMA 1YJ1A 3ZUNA 2KDIA 2KFKA 3A1QB 1TZ1A 2KJRA 4FHKA 3KUCB 1YIWA 1OQYA 2D07B 4FULA 2MBBB 4GMVA 3R7RA 3WAOA 4DXAB 1E7VA 4W9LA 1M94A 3RULA 1XD3B 5DPSA 2UWQA 2CS4A 4W9HA 5IAAC 5CTRC 5J17A 4X57B 2BKRB 2KX0A 5KHQA 1GJZA 3W1YA 3NHEB 3VHTC 1WMHA 3BINA 3N32A 3EECA 4XC2A 4WWNA 2LJ5A 3TMPB 3T8MA 3V62A 1V6EA 2FIFA 3D32A 3H7PA 3P2BA 4K7UA 2IO3B 2M8SA 2BYVE 3VXWA 1WJNA 4MGZE 3PSEB 3IFWB 2A4ZA 4HWIB 2KC1A 1KJTA 4NJ6A 5DPTA 1GNUA 4MELA 3PVLA 1RFAA 3A4SC 3DBSA 4N9F4 2FCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z59 B;  2I1K A;  2MWS B;  1YX6 B;  4JLC A;  3LJ3 A;  2WYQ A;  1E8W A;  2IY1 B;  3TL5 A;  3KUZ A;  5DCN A;  1ZKH A;  2IBI B;  3DVN U;  3ZTD A;  3H9D A;  2G4S A;  4JL9 A;  3UQB A;  4GB9 A;  4NQK E;  3KH0 A;  4FJV B;  2D10 A;  1WRD B;  2AL3 A;  3QA8 A;  4NY0 A;  1V2Y A;  1GUA B;  5D7G A;  4B9K A;  4GDK B;  2NR2 A;  3U30 A;  2DHZ A;  1V81 A;  3APD A;  5JHA A;  2R2O A;  4P7I A;  5JHB A;  4GXB A;  1AAR A;  1ZW7 A;  4GN1 A;  1SIF A;  3AXC A;  2NVU I;  4BBN C;  3NZU A;  1WIA A;  2BYE A;  1R4M I;  2LXC A;  4DK5 A;  2QHO A;  3AU5 A;  5C1Z A;  2KHW B;  1S1Q B;  1Z2M A;  4A3P A;  1OGW A;  2LUE A;  4BFR A;  2JY6 A;  2M0X A;  2C5L C;  3QAQ A;  2IO1 B;  2D11 A;  4FAD A;  3EHV A;  1P9D U;  4GSW A;  2PE9 A;  4A20 A;  1WGY A;  4DHZ B;  4W9C A;  3ML8 A;  3OJ3 A;  4ZYN A;  1EF1 A;  3K9O B;  2KWU B;  2KFK B;  4W9K A;  2V3S A;  1WXA A;  4W9E A;  2XK5 A;  4HLE A;  2GBK A;  2MBE A;  4KZ0 A;  2LWP A;  2KLC A;  3PRP B;  1VD2 A;  2R2Q A;  2ZVO A;  4E74 A;  4GGQ A;  2N1W A;  2L7R A;  2RSU A;  4GIV A;  2CHX A;  2PE6 B;  4A3O A;  4NAW B;  4BOS C;  2L00 B;  4ANW A;  1WMH B;  3VUX A;  1Q1O A;  3H7P B;  2KWV B;  3ML9 A;  4WWO A;  2WX1 A;  4TQ1 A;  1WGH A;  1V49 A;  2ZPY A;  2DAJ A;  4FHJ A;  1ZGU B;  2MLB A;  3ZLZ A;  3VVW B;  1RLF A;  4E71 A;  1WR1 A;  3KUD B;  4RMA A;  4WWP A;  3A9J B;  1C1Y B;  3DBH I;  2CHW A;  4RM8 A;  5AZG A;  1SE9 A;  2C9W B;  3JSV A;  1A5R A;  1WXV A;  3RT3 B;  2FID A;  3PTF C;  2K6Q A;  4G11 A;  3VFK A;  2FAZ A;  3VAW A;  5LXH A;  3QHT A;  2J0J A;  4KIK A;  3M62 B;  1P3Q U;  1WY8 A;  2BWF A;  1WX7 A;  3ENE A;  3R7Q A;  5LXI B;  3N30 A;  1C3T A;  4IM3 A;  1V86 A;  1P0R A;  1VCB A;  5JZE B;  2KTR B;  1TGZ B;  3AI5 A;  3C0R B;  1U4A A;  4F8C B;  4EZJ A;  5EDS A;  2KKC A;  1WGR A;  4BKG A;  4MJS B;  3ZW3 A;  3T9L A;  4EEW A;  1YD8 U;  2KOX A;  3ALB A;  3PV1 A;  3L10 B;  3PS6 A;  4ASW C;  2LVO A;  4FN2 A;  2BGF A;  1WX8 A;  3PRM B;  3DOW A;  3VUW A;  3ZNI D;  1NBF C;  4DHJ B;  3SD5 A;  1P1A A;  4W9D A;  2GBR A;  2JT4 B;  2N1V A;  3ZRC A;  2AYO B;  4XZ4 A;  3AUL A;  3BY4 B;  1E8Y A;  4MH0 E;  5J2R A;  3MTN B;  3DBL I;  3HHM A;  1BT0 A;  3QIJ A;  3B08 A;  4TQ0 A;  1XT9 B;  3A33 B;  2KLG A;  1WFY A;  3WA0 A;  1WYW B;  2KD0 A;  2XK5 B;  2I1J A;  2KDF B;  4WJQ A;  4ICU A;  1WZ0 A;  3U7D A;  4HDO A;  4LCD E;  2LRW A;  4DDG D;  3L17 A;  2Z0D B;  4URK A;  2O6V D;  2KDB A;  1UH6 A;  4IWP A;  4HCP B;  4KDL B;  4IWO A;  4F7Z A;  2RR9 A;  4YL8 A;  5G2N A;  3DVN V;  1KM7 A;  3DCG A;  4BBN F;  3JVZ X;  4AUQ C;  2L05 A;  2NBU A;  2OJR A;  5BO4 B;  4B6W A;  2MX2 A;  3KVF B;  2Y5B B;  5CHV C;  2XEW A;  3V61 A;  3JW0 X;  2KJ6 A;  4MGY E;  5CX3 A;  1SGH A;  2CR5 A;  1RRB A;  2MBH A;  2RPQ A;  3APC A;  3HM3 A;  3M63 B;  2K39 A;  2DZJ A;  4ANV A;  2W9N A;  3PLV A;  3M95 A;  1TBE A;  2G4D B;  3QK0 A;  3VQI A;  1V80 A;  4E3C A;  2J0M A;  3DBR I;  1EO6 A;  2N7D A;  5DPW A;  4K81 A;  3WAP A;  1KOT A;  4KV2 A;  3O65 B;  4I6N B;  4W9F A;  3RZF A;  4BVU C;  5JH5 C;  2BKF A;  4OVU A;  2DX5 B;  2AL6 A;  3JSV B;  4ZDV A;  2DYO A;  2KXJ A;  1CMX B;  2JZ3 B;  4PS8 A;  2LGD A;  4EKU A;  4W9J A;  4K1R B;  3VDZ A;  3VUY A;  4ANU A;  2WX0 A;  3UGB B;  4K7W A;  2L0T A;  3Q3F A;  1E8X A;  2JF5 A;  4BKT A;  3CSF A;  2K8H A;  1WM3 A;  2L8J A;  2K6D B;  2K1F A;  2EMS A;  2N9P C;  2NBW B;  2Z0E B;  2NPT B;  2G3Q B;  4BOZ B;  3ZRF A;  1WJU A;  3IBE A;  3SDL C;  4JIO U;  4KSL C;  3ZO5 B;  2O6V A;  2C7M B;  2IY0 B;  1K8R B;  1WGG A;  2KX3 A;  4CYE A;  1NI2 A;  2BF8 B;  2ZNV B;  1L2N A;  2N9X A;  4WJP A;  4LDT D;  1H8C A;  3IG3 A;  3WAN A;  1IYF A;  2MP2 A;  1S3S G;  1V9J A;  1Z5S B;  2V1Y A;  2VRR B;  2ZCC A;  2FCN A;  2KK8 A;  5TR5 A;  3A1Q A;  2NS5 A;  2JRI B;  2JXX A;  2CU1 A;  4DBG A;  1GC6 A;  1YQB A;  1V5T A;  2KZR A;  3PRE A;  3V6C B;  4HK2 A;  2KTF A;  2HTH A;  3L54 A;  4IM0 A;  4LJP B;  2N7E A;  4W9G A;  1V5O A;  2CHZ A;  3L13 A;  3QWZ B;  2LD9 A;  2LI5 A;  2MCN B;  2ZJD A;  1IPG A;  3EFU A;  2ZNV C;  4EZL A;  5E6O A;  5G55 A;  4MDK E;  5HKH A;  1EUV B;  4J6I A;  3X23 A;  3I3T B;  2DZK A;  4M8N A;  1GC7 A;  3L0W B;  1WJ4 A;  4II2 B;  5FR6 A;  2GBM A;  2HE7 A;  2MSE D;  1Y8R C;  4MEM A;  1I35 A;  2FNJ B;  3AU4 A;  3MJW A;  4G0N B;  1Q0W B;  2L76 A;  4HJK A;  1J0G A;  3ECI A;  4HPL B;  5AZF A;  4WAA A;  3CST A;  3V60 A;  4AOF A;  1J8C A;  4NJ7 A;  3OJ4 B;  4F1S A;  1LM8 B;  3RZW C;  2V4L A;  3R3M A;  2UYZ B;  3HM6 X;  3UIO B;  3NOB A;  2FCQ A;  2FUH B;  1G6J A;  2HD5 B;  2ZZP B;  2LAS A;  4GDK A;  1LQB A;  4MSM B;  2D2Q A;  4EZK A;  5IA7 A;  3M3J A;  4IC7 B;  4MSQ B;  5L83 A;  4B95 A;  2K25 A;  4WQO B;  3L16 A;  4HXD A;  3DVG Y;  3DDC B;  3IHP C;  3RD2 A;  1OTR B;  1WE7 A;  2EKE C;  2LVQ A;  3CMM B;  2O2V A;  3LDZ E;  1HE8 A;  3DVG X;  4IM2 A;  4WJN A;  2MBO A;  3B1L X;  1E90 A;  3PRZ A;  1NDD A;  2J0K A;  1WJ6 A;  2MRP A;  1QZE A;  4NPN A;  4TKN A;  1WF9 A;  3H6N A;  2PPH A;  3PLU A;  4CO7 A;  3H7S A;  3UQA A;  2CKH B;  2DYB A;  2NCN A;  2O6V B;  1KLV A;  1MG8 A;  3RYT A;  4DWF A;  4PS3 A;  2N4F A;  1WR6 E;  2PEA A;  4HDQ A;  1UD7 A;  4MGK E;  4I6L B;  2KWC A;  4GDL A;  4EOY A;  2MP2 B;  1UBQ A;  4CHK A;  1YX5 B;  3X0W A;  4AWJ A;  3U8Z A;  3RCZ A;  2MA9 B;  2OOB B;  2WDT B;  3QJZ A;  4KSK C;  3VH3 B;  4HPM B;  2KDE B;  5C23 A;  3ZVV A;  3PHW B;  3JYU A;  3EC8 A;  3A9K A;  4ZRJ A;  3V6E B;  4DHZ E;  2C7N B;  1EF5 A;  5CHF A;  3W1S A;  4HCN B;  1WZ3 A;  4ZRI A;  4JQW C;  4EUT A;  3NY5 A;  4JGH B;  4DHJ D;  4NAW A;  3SHQ A;  2JVC A;  5D94 A;  2IZV B;  3GOE A;  3DPD A;  5GMV A;  3PGE A;  2LRU A;  3UF8 A;  1XQQ A;  2MQJ A;  1WXS A;  1R4N I;  5E6P A;  2RD0 A;  2JZZ A;  3PPA A;  2KFJ A;  3QX1 A;  2J7Q B;  2IO0 B;  2DAF A;  4FBJ B;  5D2M B;  4DDI D;  3A9J A;  1UBI A;  4PYZ A;  1OEY A;  4KVG B;  2GOW A;  2KNB A;  4TV3 A;  4KIK B;  2JWZ A;  3PZD A;  2D3G A;  4PYU A;  4PS7 A;  4IW0 A;  3R66 C;  4G3X B;  4GOC A;  1WI0 A;  3KYC D;  2ASQ A;  4M0W B;  3VTW A;  3S2A A;  2DZM A;  5CHW A;  4GU2 A;  3HIZ A;  2XBB C;  4LDT B;  1IP9 A;  2NBV B;  2REX A;  4K7S A;  2KTR A;  1PQS A;  2KAN A;  2WWZ A;  2KQS A;  3MHS D;  1J19 A;  4G50 A;  1FXT B;  3K9P B;  2ZPN A;  2KVR A;  1WX9 A;  3QCA A;  3OAW A;  3PT2 B;  2JPH A;  4MJS A;  2ZCB A;  4KZC A;  2O2V B;  1UEL A;  1T0Y A;  3ZNZ B;  4HVB A;  1WXM A;  4RM9 A;  3TJP A;  2ZVN A;  2GBN A;  2KJH B;  4ICV A;  3HK0 A;  3QAR A;  2KMC A;  2BPS A;  3VH4 B;  2LGY A;  3OLM D;  1RAX A;  3ZDT A;  3QC8 B;  3ZIM A;  4FLH A;  4LJO B;  2ZEQ A;  4BKS D;  2RGF A;  4NNJ B;  4XX5 A;  5D6J B;  1WE6 A;  3Q3J A;  3UIP B;  2JRH A;  4GDL B;  1GG3 A;  2KN5 A;  2M1M A;  3L08 A;  4AJW A;  5AEK B;  3NS8 A;  2JUO A;  2N9E B;  4II3 B;  4OVV A;  5DPR A;  3WAL A;  1UZX B;  2BYF A;  5J18 A;  1LXD A;  3N3K B;  4IG7 B;  2GMI C;  2EMT A;  3UIN B;  1L7Y A;  2LZ6 A;  3A4R A;  3A9K B;  2DEN B;  2PJH A;  2IO2 B;  4MGI E;  4NQL B;  1E8Z A;  3VTU A;  2AEH A;  2DYM A;  5LLI A;  2C60 A;  2KO3 A;  1OEY J;  1LFD A;  4FJZ A;  4FA6 A;  3DQV A;  3ZKJ C;  2M4N A;  2LVP A;  3IVF A;  4IWQ A;  3KYD D;  3ZTC A;  2GBJ A;  4FJY A;  4WJO A;  4W9I A;  2MBQ A;  2C7H A;  2L3Z A;  2M17 A;  3QQ8 B;  3TIX A;  3NZS A;  1ISN A;  3WAM A;  3ZDM C;  3ZNH B;  2B3A A;  2KMA A;  2G45 B;  3TCA A;  3PHX B;  3SU8 X;  1X1M A;  2MW5 A;  1WH3 A;  2A5U A;  3RUI B;  2AWT A;  3B0A A;  2K8C A;  3W1S C;  1WGD A;  2HJ8 A;  2YLM A;  5AZH A;  4ZRK A;  3ZNG C;  2KQ7 A;  3TBL D;  1TTN A;  2LGX A;  4KDI C;  3CF6 E;  5E6N A;  4ANX A;  5L95 C;  3VTV A;  2LXA A;  1E7U A;  1P98 A;  3H1U A;  3ONS A;  2K8B A;  4BKS A;  1JRU A;  1H4R A;  4AJY B;  2DZI A;  4TUU A;  4EFO A;  2YVC A;  1D3Z A;  2NPT A;  3GZN I;  4MM3 A;  2FCM A;  4M8M A;  3APF A;  5KHO A;  4AP4 C;  1I42 A;  2BWE S;  1UGM A;  2KC2 A;  3KW5 B;  1WM2 A;  2IYD B;  1Q5W B;  1F9J A;  4I6P A;  1E5W A;  2L0F A;  4IUM B;  3WIM A;  1YJ1 A;  3ZUN A;  2KDI A;  2KFK A;  3A1Q B;  1TZ1 A;  2KJR A;  4FHK A;  3KUC B;  1YIW A;  1OQY A;  2D07 B;  4FUL A;  2MBB B;  4GMV A;  3R7R A;  3WAO A;  4DXA B;  1E7V A;  4W9L A;  1M94 A;  3RUL A;  1XD3 B;  5DPS A;  2UWQ A;  2CS4 A;  4W9H A;  5IAA C;  5CTR C;  5J17 A;  4X57 B;  2BKR B;  2KX0 A;  5KHQ A;  1GJZ A;  3W1Y A;  3NHE B;  3VHT C;  1WMH A;  3BIN A;  3N32 A;  3EEC A;  4XC2 A;  4WWN A;  2LJ5 A;  3TMP B;  3T8M A;  3V62 A;  1V6E A;  2FIF A;  3D32 A;  3H7P A;  3P2B A;  4K7U A;  2IO3 B;  2M8S A;  2BYV E;  3VXW A;  1WJN A;  4MGZ E;  3PSE B;  3IFW B;  2A4Z A;  4HWI B;  2KC1 A;  1KJT A;  4NJ6 A;  5DPT A;  1GNU A;  4MEL A;  3PVL A;  1RFA A;  3A4S C;  3DBS A;  4N9F 4;  2FCS A; 
#chains in the Genus database with same CATH topology
 2I1K A;  2QJL A;  1WSP A;  3KUZ A;  2G4S A;  4GB9 A;  1VR9 A;  4NY0 A;  4GDK B;  2NR2 A;  3ZXR A;  3U30 A;  2J52 A;  3AM9 A;  2WP9 B;  1V81 A;  3APD A;  2R2O A;  5JHB A;  3P63 A;  4GN1 A;  4JX1 C;  3TEX A;  3MP9 A;  2B76 B;  2NMQ A;  2LXC A;  4DK5 A;  2QHO A;  1IUE A;  2LUE A;  3LXF A;  1SF0 A;  4XWT A;  1P9D U;  4A20 A;  4P16 A;  5BYR A;  4ZYN A;  3BWU D;  1WXA A;  2YEP F;  1YJJ A;  2ZVO A;  1CJE A;  3RNC C;  4BOS C;  2L00 B;  1WMH B;  3VUX A;  3ML9 A;  4TQ1 A;  2IND C;  2ZPY A;  4FHJ A;  2KMM A;  1ZGU B;  2MLB A;  3URY A;  3N1Z C;  1RLF A;  1LGR A;  1JCK B;  3FIL B;  4RM8 A;  1HXY D;  5AZG A;  1ZOY B;  1A5R A;  4DXG A;  1TS4 A;  1JRO A;  2CU3 A;  2DLB A;  3QHT A;  1D5M C;  1P3Q U;  3R7Q A;  3DWM A;  4YSX B;  5EE1 A;  1P0R A;  3BVZ A;  2KTR B;  1TGZ B;  4C7Y A;  2AQ3 B;  3ZJT A;  4LNF A;  1WGR A;  3AEC B;  4MJS B;  3T9L A;  4EEW A;  2KOX A;  3L10 B;  5EE3 A;  1JWB D;  3Q8B A;  2LVO A;  3MC8 A;  1WX8 A;  3VUW A;  3RNF C;  3VR8 B;  2GBR A;  2JT4 B;  2MEK A;  2D5G A;  4KGS A;  1CK1 A;  4MH0 E;  4L23 A;  2WXL A;  1BT0 A;  3QIJ A;  3A33 B;  3WA0 A;  2KD0 A;  2XK5 B;  1N60 A;  4WJQ A;  4HDO A;  4URK A;  4LNI A;  2KDB A;  4OZB A;  5IKC M;  4YL8 A;  1KM7 A;  3JVZ X;  2OJR A;  5BO4 B;  3Q14 C;  2MX2 A;  1K53 A;  3KVF B;  2KJ6 A;  3RN9 C;  4MGY E;  4REZ A;  2PIA A;  4ANV A;  4JPS A;  4RFB A;  1MPE A;  4M02 A;  1B9R A;  5JH5 C;  3DBH B;  4RGO S;  2DYO A;  3KWL A;  1FMA D;  4K1R B;  2WX0 A;  2D3A A;  4K7W A;  3Q3F A;  4BKT A;  1FIQ A;  3CSF A;  1I4X A;  2N9P C;  1L0X B;  1TY2 A;  2G3Q B;  4RF1 A;  4RGT A;  3SDL C;  1T0Q C;  3ZO5 B;  3RNA C;  1UNS A;  2ZNV B;  2N9X A;  2WXP A;  3IG3 A;  5HI1 A;  1V9J A;  1Z5S B;  2V1Y A;  5TR5 A;  3A1Q A;  1FCC C;  2JRI B;  2CU1 A;  1V5T A;  4PK1 A;  2KTF A;  2WU2 B;  4LJP B;  1V5O A;  3NS1 A;  2HJ1 A;  3AN1 A;  3HRD D;  2PKO A;  2ZNV C;  3N9Y C;  5E6O A;  5HKH A;  1SEB D;  3GE3 C;  5FKA C;  5FR6 A;  4HJK A;  3HVD A;  4KKI A;  3DHI C;  1J8C A;  4NJ7 A;  2QEJ C;  1LM8 B;  3RZW C;  1V97 A;  3NZ3 A;  5IP4 D;  3MC9 A;  4J3O D;  3R3M A;  2FCQ A;  2LFI A;  2WU5 B;  2NTT A;  1LQB A;  4MSM B;  4ZRP A;  3P4R B;  1C76 A;  4IC7 B;  4B95 A;  1ROE A;  4HXD A;  3RD2 A;  1OTR B;  2CJN A;  2EKE C;  2GLS A;  2LEK A;  2J53 A;  2LVQ A;  3DVG X;  4LLG M;  3PRZ A;  1E90 A;  2MRP A;  1WF9 A;  1F2R I;  2NCN A;  2MHJ A;  3HUI A;  1GB1 A;  1UBQ A;  4CHK A;  3X0W A;  3VH3 B;  4KSK C;  4UDU C;  1XLQ A;  1MHX A;  1YOV B;  3ZVV A;  3JYU A;  5CHF A;  4ARC A;  3W1S A;  4HCN B;  1WZ3 A;  2BS3 B;  4S0R A;  3FAH A;  4NAW A;  2JVC A;  1I4P A;  1LO5 D;  4AS1 A;  2IZV B;  3DPD A;  5GMV A;  1I4G A;  3RNG C;  2N9K A;  2IO0 B;  1P7F A;  3A9J A;  4YXD B;  3BVM A;  2D3G A;  4G3X B;  1PUT A;  1WI0 A;  3KYC D;  4M0W B;  3S2A A;  3HIZ A;  4LDT B;  3AED B;  2NBV B;  2REX A;  5H8Y E;  2KAN A;  1D5Z C;  2ACZ B;  3MHS D;  4XGA B;  3SFE B;  5HFY A;  2O2V B;  1UEL A;  3TJP A;  2LUM A;  1YQ3 B;  2GBN A;  4ICV A;  3HK0 A;  3QAR A;  3OLM D;  3ZDT A;  3QC8 B;  1QQR A;  2RGF A;  4NNJ B;  5D6J B;  2H88 B;  4LTU A;  1GG3 A;  2M1M A;  2BT6 A;  4AJW A;  3NJT A;  4XWW A;  4II3 B;  2WDQ B;  4RGN A;  2BYF A;  1L6V A;  1XF5 L;  2DBY A;  2DYM A;  3ZXV A;  5LLI A;  3DQV A;  3ZKJ C;  1UWX A;  3KYD D;  4S17 A;  4HEA 1;  3NZS A;  4HPP A;  1R7S A;  2B3A A;  1X1M A;  1SE3 A;  3RUI B;  4YWG G;  4HRS A;  2HJ8 A;  2YLM A;  4US8 A;  2KQ7 A;  1WYG A;  4KDI C;  3RPF C;  3VTV A;  4D2K A;  4BKS A;  1JRU A;  2DZI A;  2DWQ A;  1CQV A;  2BS2 B;  3GZN I;  4MM3 A;  4M8M A;  2MJE A;  3AEE B;  4P6V F;  2KC2 A;  2ZW0 A;  1WM2 A;  1E5W A;  1TJE A;  3ZUN A;  2KDI A;  5LNK 1;  3A1Q B;  2LGI A;  3KUC B;  1OQY A;  2MBB B;  3R7R A;  1ZDX A;  2BVC A;  2BB5 A;  3RUL A;  2UWQ A;  2WXI A;  4W9H A;  1WGK A;  5CTR C;  4X57 B;  1WXQ A;  3DHH C;  3W1Y A;  3VHT C;  1WMH A;  3N32 A;  1D5X C;  3SEB A;  4K7U A;  3P2B A;  2IO3 B;  3VXW A;  3LYY A;  1E7P B;  1HZ5 A;  1PFD A;  3GB1 A;  4NJ6 A;  2ON8 A;  1GNU A;  3PVL A;  4AQ7 A;  3A4S C;  2FCS A;  1YX6 B;  2IY1 B;  5DCN A;  1ZKH A;  3L4P A;  4JL9 A;  2AL3 A;  1V2Y A;  1N5W A;  3GS2 A;  2WXF A;  4P7I A;  4ZHP A;  4A9A A;  1ZW7 A;  1PYW D;  4MT5 A;  3B2F A;  1SSN A;  2NTS A;  4BBN C;  3NZU A;  4N6E B;  1R4M I;  3P4Q B;  2LHE A;  3B2G A;  2SAK A;  1S1Q B;  4QAY A;  1Z2M A;  4BFR A;  2JY6 A;  2C5L C;  2IO1 B;  2QSD A;  2XNA C;  3EHV A;  4TMA B;  2PE9 A;  1L6U A;  5FK9 C;  3AEG B;  2WXN A;  3AE5 B;  3ML8 A;  1IBX B;  2KWU B;  2V3S A;  4WIP A;  1JW9 D;  2XK5 A;  2GBK A;  3NVZ A;  1JWA D;  1VD2 A;  2WXO A;  5EE0 A;  4E74 A;  4GGQ A;  4P1C C;  2RSU A;  4KGT A;  4A3O A;  4NAW B;  2GB1 A;  2KWV B;  4WWO A;  2WX1 A;  1V49 A;  1QOA A;  4ZRQ A;  3I5J C;  3VVW B;  4JE3 B;  2JU6 X;  3I57 A;  3A9J B;  1C1Y B;  2VH1 A;  2E6X A;  2FID A;  2K6Q A;  4KIK A;  2GI9 A;  3RFZ B;  1ET6 A;  5JZE B;  1L0Y B;  3EGR A;  3C0R B;  1E9M A;  3IT4 B;  2PMV A;  5EDS A;  2I38 A;  4LNN A;  4BKG A;  3NVW A;  1C4C A;  4RF0 A;  1L4Z B;  3BYY B;  3ALB A;  3PV1 A;  1YMH E;  1XXG A;  3DWG C;  4ASW C;  4FN2 A;  2BGF A;  3ZNI D;  1NBF C;  1UUP A;  5IOI A;  3SD5 A;  4W9D A;  2KWD A;  3DHG C;  2N1V A;  2AYO B;  4A90 A;  5J2R A;  3VRB B;  3DBL I;  1PDX A;  2K9X A;  2KLG A;  1WFY A;  1WYW B;  1WZ0 A;  4LCD E;  3R2I A;  4DDG D;  2O6V D;  1UH6 A;  2RR9 A;  3TUO A;  3DCG A;  2Q5W D;  2WNM A;  1MJD A;  2NBU A;  3CWI A;  4B6W A;  1KF6 B;  2N7J A;  3AE3 B;  3V61 A;  5CX3 A;  3APC A;  3HM3 A;  3M63 B;  3J9C A;  3AEB B;  3WAP A;  1KOT A;  4KV2 A;  3O65 B;  3RZF A;  2BKF A;  4OVU A;  2DX5 B;  3ZJV A;  4ZDV A;  2WDV B;  1CMX B;  4PS8 A;  4EKU A;  4W9J A;  3VDZ A;  2W3R A;  1E8X A;  1FEH A;  1FCL A;  2K6D B;  2NBW B;  4MM3 B;  1KRH A;  1ZDV A;  3B9J A;  1WGG A;  1NI2 A;  2BF8 B;  1EM7 A;  4WJP A;  2KDM A;  1IYF A;  2VRR B;  2VZK B;  5GXG B;  2NS5 A;  1YQ4 B;  1GC6 A;  3PRE A;  3V6C B;  1KFY B;  4RGM A;  2N7E A;  4W9G A;  1HEZ E;  4JWS C;  2HTM E;  2LD9 A;  1FNV A;  5H92 C;  2LI5 A;  1UGJ A;  2K5P A;  4EZL A;  4MDK E;  1V1P B;  1J7C A;  3I3T B;  3L0W B;  3VR9 B;  1F52 A;  3MJW A;  1Q0W B;  2L76 A;  3ECI A;  4HPL B;  5AZF A;  4WAA A;  3V60 A;  4AOF A;  1OFF A;  3EFC A;  4F1S A;  4O1N A;  2DNF A;  3AE4 B;  3KWV A;  4US9 A;  3HM6 X;  4M0W A;  3AB5 A;  3AE2 B;  2FUH B;  1G6J A;  2ZZP B;  3Q69 A;  5IA7 A;  3M3J A;  3AEF B;  3MJ5 A;  2K25 A;  4WQO B;  1QLB B;  1DOI A;  4BAX A;  3CMM B;  2O2V A;  1HE8 A;  2G9H D;  2MBO A;  1NDD A;  1WJ6 A;  3PLU A;  1MG8 A;  3RYT A;  4PS3 A;  2M0A A;  2QIL A;  3IAM 1;  1KH0 A;  4I6L B;  4EOY A;  2EKI A;  1E6E B;  4AWJ A;  3U8Z A;  2HDE A;  2OOB B;  2WDT B;  1F1H A;  5C23 A;  3V6E B;  4DHZ E;  2Y5P A;  1ESF A;  2IPK D;  1YJI A;  4ZRI A;  4JGH B;  4KGR A;  1XLO A;  3GOE A;  3TEZ A;  2LRU A;  2QC8 A;  2ZW1 A;  1OQQ A;  5E6P A;  4M00 A;  2OED A;  3PPA A;  4WAF A;  5D2M B;  3W9C B;  4KVG B;  3SFD B;  4KIK B;  3R66 C;  1JWM D;  1FRR A;  3VTW A;  2ASQ A;  2J4X A;  2N9L A;  1FXI A;  4GU2 A;  2XBB C;  1IP9 A;  1QF6 A;  2WWZ A;  2M56 B;  4G50 A;  2D3C A;  1SE4 A;  1FXT B;  3K9P B;  1SJH D;  3OAW A;  3BVG A;  3PT2 B;  1JAL A;  4KZC A;  1PGB A;  1T0Y A;  2ZVN A;  4DQO C;  1TIF A;  1TT5 B;  2BPS A;  2KQ4 X;  3ZIM A;  4LJO B;  3LB8 C;  1FXA A;  4GDL B;  4TSS A;  4YSZ B;  2QCZ A;  4OVV A;  5DPR A;  5J18 A;  1LXD A;  2GMI C;  2EMT A;  2FUG 1;  3V05 A;  3A9K B;  2L83 A;  2W3S A;  2AEH A;  2KO3 A;  1LFD A;  1F2R C;  2M4N A;  3IVF A;  4IWQ A;  4FJY A;  3BII D;  4W9I A;  2L3Z A;  2M17 A;  1MHH E;  3ZNH B;  2KMA A;  2G45 B;  3TCA A;  3SU8 X;  2MW5 A;  3WCQ A;  3AE9 B;  2BS4 B;  1FNW A;  2AWT A;  2K8C A;  4A6Q A;  4ZRK A;  1TTN A;  2LGX A;  5E6N A;  1NYQ A;  3CF6 E;  5AUI A;  3EUB 2;  2LHD A;  4ANX A;  4LNK A;  2LXA A;  1P98 A;  1JQ4 A;  2WXK A;  5BMG A;  3T3O A;  2RPV A;  2YVC A;  1JML A;  5MPO A;  3APF A;  2V4I B;  1I42 A;  1KLG D;  1Q5W B;  4I6P A;  1TKG A;  1IBX A;  1YJ1 A;  4GMV A;  1ACC A;  4DXA B;  4OZA A;  1Y56 A;  2CS4 A;  1SBB B;  1V8C A;  3BIN A;  4WWN A;  3EEC A;  2FIF A;  3D32 A;  2WXR A;  2M8S A;  2BYV E;  1WJN A;  4JWU C;  4NJC A;  2A4Z A;  3NVY A;  3I63 C;  1BML C;  1RFA A;  3FC4 A;  4N9F 4;  2Z59 B;  1SIJ A;  4FXC A;  2MWS B;  3LJ3 A;  2WYQ A;  1K52 A;  3NRZ A;  5JXV A;  3DVN U;  3ZTD A;  2WXH A;  2ICI A;  3UQB A;  1T3Q A;  2D10 A;  3QA8 A;  4B9K A;  2WHI A;  5D7G A;  3AH7 A;  2RDG A;  5HHD G;  2DHZ A;  3W5V B;  1AAR A;  1QOF A;  1XCQ L;  2NVU I;  1WIA A;  2BYE A;  5C1Z A;  1SB3 C;  2KHW B;  4A3P A;  1OGW A;  4C4V B;  3RMK C;  2D11 A;  3GZN B;  3E56 A;  1TKE A;  1WGY A;  4DHZ B;  3OJ3 A;  1VDV A;  2PLP A;  2W54 A;  3E9S A;  3T3N A;  4W9K A;  4W9E A;  4HLE A;  4KZ0 A;  2LWP A;  3PRP B;  5D3I B;  4IOI E;  1FRD A;  4C00 A;  1NI3 A;  1N63 A;  2L7R A;  5EE9 A;  4GIV A;  1FM0 D;  3UI3 A;  4DXF A;  4MH8 A;  5IO9 A;  4ANW A;  1FFU A;  3H7P B;  4YTP B;  1WGH A;  3MC0 B;  3ZLZ A;  1D6E C;  4E71 A;  4WQM A;  3U52 E;  1WR1 A;  4RMA A;  3FKY A;  2V0G A;  2R61 A;  1K51 A;  1SE9 A;  1VZ8 A;  1WXV A;  3RT3 B;  3RNB C;  1T0R C;  4G11 A;  3VAW A;  2J0J A;  3N30 A;  2W55 A;  4IM3 A;  3C19 A;  3V3X A;  3AI5 A;  4F8C B;  1Q10 A;  2ONQ A;  2QIE B;  2PVO D;  3ZGZ A;  4L2Y A;  3ZW3 A;  1TS5 A;  1R4M B;  3CIR B;  3DOW A;  4DHJ B;  1P1A A;  4PT5 A;  3ZRC A;  3Q8C A;  3BY4 B;  1NYR A;  1N5X A;  4TQ0 A;  1XT9 B;  4RCO A;  2D3B A;  3SR6 A;  2MJD A;  2I1J A;  4ICU A;  2LRW A;  4HCP B;  1V1P A;  2FBW B;  3AEA B;  4H2A A;  5G2N A;  3P4P B;  3NUH B;  2L05 A;  3PZ7 A;  5CHV C;  3JW0 X;  1WWT A;  5T8I A;  4XE0 A;  1SGH A;  2RPQ A;  4OHJ A;  2K39 A;  2DZJ A;  2W9N A;  3PLV A;  3M95 A;  2BBC A;  3QK0 A;  1XEE A;  1V80 A;  3VQI A;  1K50 A;  2J0M A;  3DBR I;  2N7D A;  1CZP A;  4K81 A;  4BVU C;  4I6N B;  4R3D A;  3N1Y C;  3JSV B;  2JZ3 B;  2LGD A;  2GRI A;  3HVZ A;  2INC C;  4ANU A;  2JF5 A;  1VZ6 A;  2K8H A;  1WM3 A;  2L8J A;  1EU4 A;  2KYW A;  4BOZ B;  3RNE C;  3IT6 B;  3ZRF A;  4JIO U;  4P1B C;  2LMC A;  4EE2 A;  2C7M B;  1L2N A;  3WAN A;  2X38 A;  1S3S G;  2FCN A;  2KVZ A;  1P7E A;  3PZ8 A;  3RI7 C;  1YQB A;  1RFK A;  1D4B A;  1JWS D;  2HTH A;  4N58 A;  3DBL B;  1STE A;  4IM0 A;  4ZOH C;  1ET9 A;  3QWZ B;  2WDR B;  2LJI A;  2ZJD A;  1IPG A;  4BZA A;  3AE6 B;  5G55 A;  3N20 C;  2WXJ A;  1EUV B;  1XLP A;  3VRA B;  3X23 A;  1JRP A;  4II2 B;  2GBM A;  1I35 A;  1KLU D;  2FNJ B;  3AU4 A;  3O13 A;  4G0N B;  1J0G A;  3CST A;  3Q8E A;  1XCT L;  2V4L A;  2BB6 A;  2WXG A;  5G5H A;  4NAM A;  3UIO B;  2UU7 A;  2WQY B;  2HD5 B;  2LAS A;  4EZK A;  2PVG C;  2BW2 A;  5L83 A;  1HTO A;  3L16 A;  3DVG Y;  2Y3A A;  1WE7 A;  4A8X C;  4WJN A;  1AYF A;  2J0K A;  4CQN A;  5BMH A;  4NPN A;  3H6N A;  2Y5C A;  4CO7 A;  2O6V B;  1KLV A;  2PEA A;  4HDQ A;  1UD7 A;  2KWC A;  4GDL A;  2MP2 B;  1M4V A;  1MVK A;  1YX5 B;  4K3B A;  1TKY A;  3RCZ A;  2KAJ A;  2MA9 B;  1RYJ A;  3QJZ A;  5D3D A;  2KDE B;  1C4A A;  3A9K A;  4ZRJ A;  2C7N B;  1EF5 A;  4HRO A;  2IJ0 A;  1FFV A;  3MFG A;  4JQW C;  4YT0 B;  4USA A;  2KN4 A;  3P42 A;  3PGE A;  1L0V B;  3UF8 A;  2E3T A;  1R4N I;  5AUK A;  1C79 A;  1N62 A;  2KFJ A;  4XDC A;  3IAS 1;  1MI0 A;  1T6B X;  4FBJ B;  1SE2 A;  3Q3M C;  1UBI A;  4GLS C;  4B0M A;  4PYZ A;  1OEY A;  1N61 A;  1ZXH A;  4PYU A;  4GOC A;  1J7A A;  2DZM A;  5CHW A;  2JX5 A;  2BTE A;  4K7S A;  1PQS A;  4OW0 A;  2KQS A;  1J19 A;  3U2S C;  2ZPN A;  2KVR A;  1WX9 A;  4IKG A;  2JPH A;  2INN E;  2ZCB A;  3TSS A;  4HVB A;  1FD6 A;  3OWE B;  2BYT A;  1RM6 C;  3AE7 B;  3VH4 B;  2INP E;  1HA5 A;  4BKS D;  3Q3J A;  3UIP B;  2JRH A;  5IN7 A;  2KN5 A;  4C7Z A;  3L08 A;  3NS8 A;  1C78 A;  2JUO A;  1ZE3 D;  3WAL A;  2KAC A;  5C3J B;  4N59 A;  1L7Y A;  2SEB D;  1FNU A;  2PJH A;  2IO2 B;  4NQL B;  2XN9 C;  2C60 A;  2VZK D;  1OEY J;  1DYQ A;  1TZO A;  4FJZ A;  4FA6 A;  4IDI A;  2LVP A;  4LK0 M;  3ZTC A;  2GBJ A;  4WJO A;  3TIX A;  4YTM B;  1ISN A;  3WAM A;  3ZDM C;  3OG5 A;  2RDH A;  2EEL A;  3PHX B;  1WH3 A;  2A5U A;  1MG4 A;  5AZH A;  3TBL D;  1E7U A;  3H1U A;  1RWS A;  3ONS A;  3Q3O C;  5E6J A;  2X8X X;  4TUU A;  4OZC A;  4C4V A;  1YNT E;  3U7Z A;  2NPT A;  3R2T A;  1F9J A;  4IUM B;  2L0F A;  1PGX A;  1L5P A;  2RMM A;  3WIM A;  1JWU D;  3BZD B;  2KJR A;  4FHK A;  1YIW A;  4FUL A;  2D07 B;  2H89 B;  3WAO A;  2RDB C;  3W2D A;  1F77 A;  1XD3 B;  2WLB A;  4HJG E;  2BKR B;  1T0S C;  2JSV X;  3NHE B;  3TMP B;  4XC2 A;  1I7H A;  1V6E A;  3H7P A;  2WXQ A;  2L1A A;  4WUR A;  2QMT A;  3GP7 A;  2AX5 A;  1HZ6 A;  3IFW B;  3PO0 A;  2PTL A;  1C77 A;  5DPT A;  3BK1 A;  4MEL A;  1QT9 A;  2V3P A;  4JLC A;  1E8W A;  3TL5 A;  2IBI B;  3H9D A;  4NQK E;  3KH0 A;  4FJV B;  1WRD B;  1GUA B;  5JHA A;  2CJO A;  4GXB A;  3Q6B A;  1SIF A;  3W5U B;  3AXC A;  1F0Z A;  3AU5 A;  3AV8 A;  2M0X A;  2JQR B;  3QAQ A;  4FAD A;  4GSW A;  4W9C A;  1EF1 A;  3K9O B;  2KFK B;  2MBE A;  2WS3 B;  2KLC A;  1I4R A;  2R2Q A;  2YEP B;  1DOX A;  2QDF A;  1YN4 A;  2K3U A;  2N1W A;  4KX6 B;  1T5X D;  3P1M A;  2CHX A;  2PE6 B;  1V1O A;  1YN3 A;  1Q1O A;  1N6Z A;  1NEN B;  2DAJ A;  4XDD A;  4HKZ E;  3KUD B;  1GPX A;  4WWP A;  2MH7 A;  5BYQ A;  3DBH I;  2CHW A;  2C9W B;  3JSV A;  5I4D A;  4L1B A;  3PTF C;  4LNO A;  3VFK A;  2FAZ A;  5LXH A;  3M62 B;  2BWF A;  1WY8 A;  3EA6 A;  1WX7 A;  3ENE A;  5LXI B;  1C3T A;  1V86 A;  1VCB A;  2OHF A;  1U4A A;  4EZJ A;  2KKC A;  1XO3 A;  1YD8 U;  3PS6 A;  3PRM B;  3AMZ A;  2VH2 A;  2IDY A;  3ZJU A;  4XZ4 A;  3AUL A;  1E8Y A;  3MTN B;  1FO4 A;  4ZYS A;  3HHM A;  3B08 A;  1NEK B;  3ABV B;  2K22 A;  2KDF B;  2WXM A;  3U7D A;  1EWY C;  3L17 A;  2Z0D B;  1ZUD 2;  4KDL B;  4IWP A;  1ENF A;  1IGC A;  4IWO A;  1KTK A;  4F7Z A;  1VJK A;  1ZP0 B;  3AE8 B;  5BYS A;  3DVN V;  2JZP A;  4BBN F;  4MAC A;  4AUQ C;  2G1E A;  1QIL A;  2IGG A;  2Y5B B;  2XEW A;  4ACF A;  2CR5 A;  1RRB A;  2MBH A;  3NG0 A;  1TBE A;  2G4D B;  4E3C A;  1FPY A;  1EO6 A;  3AE1 B;  5DPW A;  4W9F A;  1QOB A;  4RH6 A;  2V3N A;  2AL6 A;  2KXJ A;  1EU3 A;  3Q3N C;  1BXT A;  3VUY A;  4ARI A;  3UGB B;  2L0T A;  4KKJ A;  2K1F A;  2EMS A;  2Z0E B;  2NPT B;  1WJU A;  1E10 A;  3IBE A;  4KSL C;  2KT7 A;  2O6V A;  1GB4 A;  2IY0 B;  2KX3 A;  1B1Z A;  1K8R B;  4CYE A;  2M19 A;  4LDT D;  1H8C A;  2MP2 A;  2ZCC A;  2KK8 A;  1DOY A;  2JXX A;  4DBG A;  2KZR A;  3KQ4 A;  4HK2 A;  3L54 A;  2CHZ A;  3L13 A;  2MCN B;  4YTN B;  1GAQ B;  3EFU A;  1OQR A;  4J6I A;  1A70 A;  2DZK A;  1GC7 A;  4M8N A;  1WJ4 A;  2IGD A;  2HE7 A;  1AW7 A;  2MSE D;  4B0E A;  1Y8R C;  4MEM A;  4HKQ A;  5HG2 A;  4M01 A;  2BQQ A;  2IGH A;  2AQ1 B;  1I4Q A;  2JYE A;  3OJ4 B;  4ZHO A;  1QKZ A;  2UYZ B;  3KLS X;  3DBR B;  1XLN A;  3NOB A;  4OVZ A;  5FR3 A;  1TS3 A;  2AQ2 B;  4GDK A;  2D2Q A;  4Q2J A;  2JYT A;  4MSQ B;  3DDC B;  3IHP C;  2W82 A;  3LDZ E;  4IM2 A;  3B1L X;  1QZE A;  4TKN A;  1TYG B;  2PPH A;  3H7S A;  3UQA A;  2CKH B;  2DYB A;  4DWF A;  1J7B A;  1WR6 E;  2N4F A;  2J42 A;  4MGK E;  3Q8F A;  1AWD A;  1I4H A;  2MJ3 A;  1YN5 A;  4HPM B;  3PHW B;  1HQR D;  3EC8 A;  4YSY B;  1ZPS A;  3NVV A;  1E0Z A;  2JWU A;  4EUT A;  3NY5 A;  4DHJ D;  2PW9 A;  3SHQ A;  5D94 A;  1XQQ A;  2MQJ A;  1GOZ A;  1WXS A;  3U4E G;  3R8B A;  2OJW A;  2JXT A;  2RD0 A;  2JZZ A;  3QX1 A;  2J7Q B;  2DAF A;  3FIL A;  4DDI D;  2GOW A;  2KNB A;  1BUI C;  4TV3 A;  2JWZ A;  3PZD A;  4PS7 A;  4IW0 A;  1DGJ A;  2WGS A;  4WWM A;  1IGD A;  2KTR A;  1WRI A;  3QCA A;  4MJS A;  3ZNZ B;  1WXM A;  2L52 A;  4RM9 A;  2KJH B;  3MHZ A;  2KMC A;  1EWC A;  2LGY A;  1HTQ A;  1RAX A;  3ZYY X;  4FLH A;  2ZEQ A;  1ZXI A;  3BYT B;  4XX5 A;  1WE6 A;  5AEK B;  2N9E B;  1AN8 A;  1C4P A;  1UZX B;  3N3K B;  4IG7 B;  3UIN B;  2LZ6 A;  3A4R A;  2DEN B;  1TY0 A;  3ZQ4 A;  4MGI E;  1E8Z A;  3VTU A;  2I2Y A;  1PGA A;  1R4N B;  2MBQ A;  4RNA A;  2C7H A;  1C9F A;  1MFW A;  1SXT A;  3QQ8 B;  1UWM A;  1VRA B;  3I9V 1;  3H8H A;  3P4S B;  1QOG A;  4WH4 A;  3TEW A;  4C80 A;  3B0A A;  4ITK A;  1WGD A;  5G5G A;  3W1S C;  3ZNG C;  1NVI D;  3BK2 A;  5L95 C;  2N0S B;  2FE8 A;  2TSS A;  2K8B A;  1H4R A;  3TEY A;  4AJY B;  5BMI A;  2L32 A;  1VLB A;  4EFO A;  1D3Z A;  2FCM A;  5KHO A;  4AP4 C;  2BWE S;  1UGM A;  3KW5 B;  2IYD B;  5C2T B;  2K0P A;  2KFK A;  1TS2 A;  1TZ1 A;  2Z8L A;  3Q2A C;  2LGS A;  1E7V A;  4W9L A;  1M94 A;  4C56 C;  5DPS A;  3C8Y A;  3N1X C;  3GE8 C;  4K3C A;  1VZ7 A;  5IAA C;  5J17 A;  2KX0 A;  5KHQ A;  4XYC A;  3IXS A;  1GJZ A;  5TSS A;  3V62 A;  4A55 A;  1UF0 A;  2LJ5 A;  4NZL B;  3T8M A;  4MGZ E;  3PSE B;  2V9H A;  3Q8A A;  4HWI B;  2KC1 A;  1KJT A;  1SJE D;  3ETR A;  3DBS A;  1L4D B; 
#chains in the Genus database with same CATH homology
 2Z59 B;  2I1K A;  2MWS B;  1YX6 B;  4JLC A;  3LJ3 A;  2WYQ A;  1E8W A;  2IY1 B;  3TL5 A;  3KUZ A;  5DCN A;  1ZKH A;  2IBI B;  3DVN U;  3ZTD A;  3H9D A;  2G4S A;  4JL9 A;  3UQB A;  4GB9 A;  4NQK E;  3KH0 A;  4FJV B;  2D10 A;  1WRD B;  2AL3 A;  3QA8 A;  4NY0 A;  1V2Y A;  1GUA B;  5D7G A;  4B9K A;  4GDK B;  2NR2 A;  3U30 A;  2DHZ A;  1V81 A;  3APD A;  5JHA A;  2R2O A;  4P7I A;  5JHB A;  4GXB A;  1AAR A;  1ZW7 A;  4GN1 A;  1SIF A;  3AXC A;  2NVU I;  4BBN C;  3NZU A;  1WIA A;  2BYE A;  1R4M I;  2LXC A;  4DK5 A;  2QHO A;  3AU5 A;  5C1Z A;  2KHW B;  1S1Q B;  1Z2M A;  4A3P A;  1OGW A;  2LUE A;  4BFR A;  2JY6 A;  2M0X A;  2C5L C;  3QAQ A;  2IO1 B;  2D11 A;  4FAD A;  3EHV A;  1P9D U;  4GSW A;  2PE9 A;  4A20 A;  1WGY A;  4DHZ B;  4W9C A;  3ML8 A;  3OJ3 A;  4ZYN A;  1EF1 A;  3K9O B;  2KWU B;  2KFK B;  4W9K A;  2V3S A;  1WXA A;  4W9E A;  2XK5 A;  4HLE A;  2GBK A;  2MBE A;  4KZ0 A;  2LWP A;  2KLC A;  3PRP B;  1VD2 A;  2R2Q A;  2ZVO A;  4E74 A;  4GGQ A;  2N1W A;  2L7R A;  2RSU A;  4GIV A;  2CHX A;  2PE6 B;  4A3O A;  4NAW B;  4BOS C;  2L00 B;  4ANW A;  1WMH B;  3VUX A;  1Q1O A;  3H7P B;  2KWV B;  3ML9 A;  4WWO A;  2WX1 A;  4TQ1 A;  1WGH A;  1V49 A;  2ZPY A;  2DAJ A;  4FHJ A;  1ZGU B;  2MLB A;  3ZLZ A;  3VVW B;  1RLF A;  4E71 A;  1WR1 A;  3KUD B;  4RMA A;  4WWP A;  3A9J B;  1C1Y B;  3DBH I;  2CHW A;  4RM8 A;  5AZG A;  1SE9 A;  2C9W B;  3JSV A;  1A5R A;  1WXV A;  3RT3 B;  2FID A;  3PTF C;  2K6Q A;  4G11 A;  3VFK A;  2FAZ A;  3VAW A;  5LXH A;  3QHT A;  2J0J A;  4KIK A;  3M62 B;  1P3Q U;  1WY8 A;  2BWF A;  1WX7 A;  3ENE A;  3R7Q A;  5LXI B;  3N30 A;  1C3T A;  4IM3 A;  1V86 A;  1P0R A;  1VCB A;  5JZE B;  2KTR B;  1TGZ B;  3AI5 A;  3C0R B;  1U4A A;  4F8C B;  4EZJ A;  5EDS A;  2KKC A;  1WGR A;  4BKG A;  4MJS B;  3ZW3 A;  3T9L A;  4EEW A;  1YD8 U;  2KOX A;  3ALB A;  3PV1 A;  3L10 B;  3PS6 A;  4ASW C;  2LVO A;  4FN2 A;  2BGF A;  1WX8 A;  3PRM B;  3DOW A;  3VUW A;  3ZNI D;  1NBF C;  4DHJ B;  3SD5 A;  1P1A A;  4W9D A;  2GBR A;  2JT4 B;  2N1V A;  3ZRC A;  2AYO B;  4XZ4 A;  3AUL A;  3BY4 B;  1E8Y A;  4MH0 E;  5J2R A;  3MTN B;  3DBL I;  3HHM A;  1BT0 A;  3QIJ A;  3B08 A;  4TQ0 A;  1XT9 B;  3A33 B;  2KLG A;  1WFY A;  3WA0 A;  1WYW B;  2KD0 A;  2XK5 B;  2I1J A;  2KDF B;  4WJQ A;  4ICU A;  1WZ0 A;  3U7D A;  4HDO A;  4LCD E;  2LRW A;  4DDG D;  3L17 A;  2Z0D B;  4URK A;  2O6V D;  2KDB A;  1UH6 A;  4IWP A;  4HCP B;  4KDL B;  4IWO A;  4F7Z A;  2RR9 A;  4YL8 A;  5G2N A;  3DVN V;  1KM7 A;  3DCG A;  4BBN F;  3JVZ X;  4AUQ C;  2L05 A;  2NBU A;  2OJR A;  5BO4 B;  4B6W A;  2MX2 A;  3KVF B;  2Y5B B;  5CHV C;  2XEW A;  3V61 A;  3JW0 X;  2KJ6 A;  4MGY E;  5CX3 A;  1SGH A;  2CR5 A;  1RRB A;  2MBH A;  2RPQ A;  3APC A;  3HM3 A;  3M63 B;  2K39 A;  2DZJ A;  4ANV A;  2W9N A;  3PLV A;  3M95 A;  1TBE A;  2G4D B;  3QK0 A;  3VQI A;  1V80 A;  4E3C A;  2J0M A;  3DBR I;  1EO6 A;  2N7D A;  5DPW A;  4K81 A;  3WAP A;  1KOT A;  4KV2 A;  3O65 B;  4I6N B;  4W9F A;  3RZF A;  4BVU C;  5JH5 C;  2BKF A;  4OVU A;  2DX5 B;  2AL6 A;  3JSV B;  4ZDV A;  2DYO A;  2KXJ A;  1CMX B;  2JZ3 B;  4PS8 A;  2LGD A;  4EKU A;  4W9J A;  4K1R B;  3VDZ A;  3VUY A;  4ANU A;  2WX0 A;  3UGB B;  4K7W A;  2L0T A;  3Q3F A;  1E8X A;  2JF5 A;  4BKT A;  3CSF A;  2K8H A;  1WM3 A;  2L8J A;  2K6D B;  2K1F A;  2EMS A;  2N9P C;  2NBW B;  2Z0E B;  2NPT B;  2G3Q B;  4BOZ B;  3ZRF A;  1WJU A;  3IBE A;  3SDL C;  4JIO U;  4KSL C;  3ZO5 B;  2O6V A;  2C7M B;  2IY0 B;  1K8R B;  1WGG A;  2KX3 A;  4CYE A;  1NI2 A;  2BF8 B;  2ZNV B;  1L2N A;  2N9X A;  4WJP A;  4LDT D;  1H8C A;  3IG3 A;  3WAN A;  1IYF A;  2MP2 A;  1S3S G;  1V9J A;  1Z5S B;  2V1Y A;  2VRR B;  2ZCC A;  2FCN A;  2KK8 A;  5TR5 A;  3A1Q A;  2NS5 A;  2JRI B;  2JXX A;  2CU1 A;  4DBG A;  1GC6 A;  1YQB A;  1V5T A;  2KZR A;  3PRE A;  3V6C B;  4HK2 A;  2KTF A;  2HTH A;  3L54 A;  4IM0 A;  4LJP B;  2N7E A;  4W9G A;  1V5O A;  2CHZ A;  3L13 A;  3QWZ B;  2LD9 A;  2LI5 A;  2MCN B;  2ZJD A;  1IPG A;  3EFU A;  2ZNV C;  4EZL A;  5E6O A;  5G55 A;  4MDK E;  5HKH A;  1EUV B;  4J6I A;  3X23 A;  3I3T B;  2DZK A;  4M8N A;  1GC7 A;  3L0W B;  1WJ4 A;  4II2 B;  5FR6 A;  2GBM A;  2HE7 A;  2MSE D;  1Y8R C;  4MEM A;  1I35 A;  2FNJ B;  3AU4 A;  3MJW A;  4G0N B;  1Q0W B;  2L76 A;  4HJK A;  1J0G A;  3ECI A;  4HPL B;  5AZF A;  4WAA A;  3CST A;  3V60 A;  4AOF A;  1J8C A;  4NJ7 A;  3OJ4 B;  4F1S A;  1LM8 B;  3RZW C;  2V4L A;  3R3M A;  2UYZ B;  3HM6 X;  3UIO B;  3NOB A;  2FCQ A;  2FUH B;  1G6J A;  2HD5 B;  2ZZP B;  2LAS A;  4GDK A;  1LQB A;  4MSM B;  2D2Q A;  4EZK A;  5IA7 A;  3M3J A;  4IC7 B;  4MSQ B;  5L83 A;  4B95 A;  2K25 A;  4WQO B;  3L16 A;  4HXD A;  3DVG Y;  3DDC B;  3IHP C;  3RD2 A;  1OTR B;  1WE7 A;  2EKE C;  2LVQ A;  3CMM B;  2O2V A;  3LDZ E;  1HE8 A;  3DVG X;  4IM2 A;  4WJN A;  2MBO A;  3B1L X;  1E90 A;  3PRZ A;  1NDD A;  2J0K A;  1WJ6 A;  2MRP A;  1QZE A;  4NPN A;  4TKN A;  1WF9 A;  3H6N A;  2PPH A;  3PLU A;  4CO7 A;  3H7S A;  3UQA A;  2CKH B;  2DYB A;  2NCN A;  2O6V B;  1KLV A;  1MG8 A;  3RYT A;  4DWF A;  4PS3 A;  2N4F A;  1WR6 E;  2PEA A;  4HDQ A;  1UD7 A;  4MGK E;  4I6L B;  2KWC A;  4GDL A;  4EOY A;  2MP2 B;  1UBQ A;  4CHK A;  1YX5 B;  3X0W A;  4AWJ A;  3U8Z A;  3RCZ A;  2MA9 B;  2OOB B;  2WDT B;  3QJZ A;  4KSK C;  3VH3 B;  4HPM B;  2KDE B;  5C23 A;  3ZVV A;  3PHW B;  3JYU A;  3EC8 A;  3A9K A;  4ZRJ A;  3V6E B;  4DHZ E;  2C7N B;  1EF5 A;  5CHF A;  3W1S A;  4HCN B;  1WZ3 A;  4ZRI A;  4JQW C;  4EUT A;  3NY5 A;  4JGH B;  4DHJ D;  4NAW A;  3SHQ A;  2JVC A;  5D94 A;  2IZV B;  3GOE A;  3DPD A;  5GMV A;  3PGE A;  2LRU A;  3UF8 A;  1XQQ A;  2MQJ A;  1WXS A;  1R4N I;  5E6P A;  2RD0 A;  2JZZ A;  3PPA A;  2KFJ A;  3QX1 A;  2J7Q B;  2IO0 B;  2DAF A;  4FBJ B;  5D2M B;  4DDI D;  3A9J A;  1UBI A;  4PYZ A;  1OEY A;  4KVG B;  2GOW A;  2KNB A;  4TV3 A;  4KIK B;  2JWZ A;  3PZD A;  2D3G A;  4PYU A;  4PS7 A;  4IW0 A;  3R66 C;  4G3X B;  4GOC A;  1WI0 A;  3KYC D;  2ASQ A;  4M0W B;  3VTW A;  3S2A A;  2DZM A;  5CHW A;  4GU2 A;  3HIZ A;  2XBB C;  4LDT B;  1IP9 A;  2NBV B;  2REX A;  4K7S A;  2KTR A;  1PQS A;  2KAN A;  2WWZ A;  2KQS A;  3MHS D;  1J19 A;  4G50 A;  1FXT B;  3K9P B;  2ZPN A;  2KVR A;  1WX9 A;  3QCA A;  3OAW A;  3PT2 B;  2JPH A;  4MJS A;  2ZCB A;  4KZC A;  2O2V B;  1UEL A;  1T0Y A;  3ZNZ B;  4HVB A;  1WXM A;  4RM9 A;  3TJP A;  2ZVN A;  2GBN A;  2KJH B;  4ICV A;  3HK0 A;  3QAR A;  2KMC A;  2BPS A;  3VH4 B;  2LGY A;  3OLM D;  1RAX A;  3ZDT A;  3QC8 B;  3ZIM A;  4FLH A;  4LJO B;  2ZEQ A;  4BKS D;  2RGF A;  4NNJ B;  4XX5 A;  5D6J B;  1WE6 A;  3Q3J A;  3UIP B;  2JRH A;  4GDL B;  1GG3 A;  2KN5 A;  2M1M A;  3L08 A;  4AJW A;  5AEK B;  3NS8 A;  2JUO A;  2N9E B;  4II3 B;  4OVV A;  5DPR A;  3WAL A;  1UZX B;  2BYF A;  5J18 A;  1LXD A;  3N3K B;  4IG7 B;  2GMI C;  2EMT A;  3UIN B;  1L7Y A;  2LZ6 A;  3A4R A;  3A9K B;  2DEN B;  2PJH A;  2IO2 B;  4MGI E;  4NQL B;  1E8Z A;  3VTU A;  2AEH A;  2DYM A;  5LLI A;  2C60 A;  2KO3 A;  1OEY J;  1LFD A;  4FJZ A;  4FA6 A;  3DQV A;  3ZKJ C;  2M4N A;  2LVP A;  3IVF A;  4IWQ A;  3KYD D;  3ZTC A;  2GBJ A;  4FJY A;  4WJO A;  4W9I A;  2MBQ A;  2C7H A;  2L3Z A;  2M17 A;  3QQ8 B;  3TIX A;  3NZS A;  1ISN A;  3WAM A;  3ZDM C;  3ZNH B;  2B3A A;  2KMA A;  2G45 B;  3TCA A;  3PHX B;  3SU8 X;  1X1M A;  2MW5 A;  1WH3 A;  2A5U A;  3RUI B;  2AWT A;  3B0A A;  2K8C A;  3W1S C;  1WGD A;  2HJ8 A;  2YLM A;  5AZH A;  4ZRK A;  3ZNG C;  2KQ7 A;  3TBL D;  1TTN A;  2LGX A;  4KDI C;  3CF6 E;  5E6N A;  4ANX A;  5L95 C;  3VTV A;  2LXA A;  1E7U A;  1P98 A;  3H1U A;  3ONS A;  2K8B A;  4BKS A;  1JRU A;  1H4R A;  4AJY B;  2DZI A;  4TUU A;  4EFO A;  2YVC A;  1D3Z A;  2NPT A;  3GZN I;  4MM3 A;  2FCM A;  4M8M A;  3APF A;  5KHO A;  4AP4 C;  1I42 A;  2BWE S;  1UGM A;  2KC2 A;  3KW5 B;  1WM2 A;  2IYD B;  1Q5W B;  1F9J A;  4I6P A;  1E5W A;  2L0F A;  4IUM B;  3WIM A;  1YJ1 A;  3ZUN A;  2KDI A;  2KFK A;  3A1Q B;  1TZ1 A;  2KJR A;  4FHK A;  3KUC B;  1YIW A;  1OQY A;  2D07 B;  4FUL A;  2MBB B;  4GMV A;  3R7R A;  3WAO A;  4DXA B;  1E7V A;  4W9L A;  1M94 A;  3RUL A;  1XD3 B;  5DPS A;  2UWQ A;  2CS4 A;  4W9H A;  5IAA C;  5CTR C;  5J17 A;  4X57 B;  2BKR B;  2KX0 A;  5KHQ A;  1GJZ A;  3W1Y A;  3NHE B;  3VHT C;  1WMH A;  3BIN A;  3N32 A;  3EEC A;  4XC2 A;  4WWN A;  2LJ5 A;  3TMP B;  3T8M A;  3V62 A;  1V6E A;  2FIF A;  3D32 A;  3H7P A;  3P2B A;  4K7U A;  2IO3 B;  2M8S A;  2BYV E;  3VXW A;  1WJN A;  4MGZ E;  3PSE B;  3IFW B;  2A4Z A;  4HWI B;  2KC1 A;  1KJT A;  4NJ6 A;  5DPT A;  1GNU A;  4MEL A;  3PVL A;  1RFA A;  3A4S C;  3DBS A;  4N9F 4;  2FCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...