1UD7A

Solution structure of the designed hydrophobic core mutant of ubiquitin, 1d7
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
b'MQVFLKTLTGKTVTIEVEPSDTVENFKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTIHLVLRLRGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (UBIQUITIN CORE MUTANT 1D7)
publication title Solution structure and dynamics of a designed hydrophobic core variant of ubiquitin.
pubmed doi rcsb
molecule tags Ubiquitin
total genus 17
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1999-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ud7A00
2N7EA 2O6VD 4BKSA 2MBOA 4KZ0A 2Y5BB 2KWUB 3DOWA 5DPSA 1GNUA 1E7UA 1WZ3A 2GBKA 2B3AA 2K1FA 2L8JA 1RAXA 3ZUNA 5FR6A 3S2AA 5JH5C 1KLVA 3KVFB 3A1QB 1ZKHA 1UD7A 5L95C 4X57B 1K8RB 2KWVB 2KK8A 2KDEB 4KIKB 1WXMA 1AARA 2KC1A 3PHWB 4DK5A 1WJNA 1OQYA 4WWOA 4WJPA 1WXSA 2IO0B 3JSVB 3T8MA 2YVCA 2JZ3B 2HD5B 4NJ7A 1KM7A 2LVPA 1RLFA 2I1JA 2LD9A 2N7DA 4TV3A 3M95A 1WGGA 2L00B 1E8ZA 4I6LB 4LDTD 4HWIB 5LXHA 5AEKB 5JZEB 3SD5A 4DWFA 3EC8A 4K7SA 3TL5A 2CHWA 3LDZE 4FJZA 4GIVA 5TR5A 2C7NB 2IBIB 2KDBA 2OJRA 1I42A 3UQAA 3CSTA 3GZNI 1E5WA 5J18A 2CS4A 1UGMA 3ZNGC 1WGHA 2WDTB 5C1ZA 3PLVA 4URKA 4OVUA 4GU2A 4GOCA 4BBNF 4GGQA 3UGBB 2L7RA 1A5RA 3L10B 2M1MA 2RPQA 2MBBB 2J7QB 4ANWA 3VUXA 2UWQA 3VTVA 3DDCB 3A1QA 3WIMA 1WR1A 4E3CA 1KOTA 2FIFA 4IW0A 3VH3B 4K7UA 5DPRA 4KIKA 1Q0WB 2KZRA 3DQVA 2KFKA 4G11A 4IUMB 2FCMA 2NBUA 1C1YB 2KLCA 4IWOA 1TZ1A 3VVWB 2JT4B 3JSVA 1XD3B 1RRBA 4KZCA 2A5UA 4NPNA 2DZJA 3D32A 2N9PC 3PLUA 3PRZA 1RFAA 5DCNA 4HJKA 4MELA 2HJ8A 2DZKA 2ZJDA 3NZUA 3QX1A 2K8HA 2D07B 2RR9A 1ZW7A 2MA9B 3QJZA 3N3KB 4HXDA 3IBEA 1WGYA 3DPDA 1SGHA 2ZVOA 3DVGX 3ECIA 2DYBA 1Z2MA 2N1WA 5C23A 4P7IA 2J0MA 3APFA 3UIPB 1VD2A 2M8SA 4MJSB 1S3SG 4RM8A 5DPWA 2AL3A 1ISNA 4ANUA 2JRHA 1WM2A 2NVUI 3H7PB 3IHPC 3KH0A 3B0AA 1SE9A 4FADA 4FLHA 4K81A 4AJWA 4M8NA 3V6EB 4NAWB 2ZVNA 4JQWC 4PS3A 4W9EA 2KTRB 2PJHA 2KMAA 3ZLZA 5E6OA 2DYMA 4ICUA 4J6IA 3APCA 3A4SC 3NY5A 4FN2A 4W9HA 2ASQA 5E6NA 4ZRIA 2MP2A 3ZO5B 1M94A 5CTRC 1R4MI 3B08A 1WYWB 1ZGUB 3U7DA 4DXAB 1H8CA 4NQKE 3AXCA 1UH6A 2MQJA 4KSKC 4WAAA 4ZRJA 1E8XA 1GC6A 1WZ0A 3R3MA 4K1RB 4B6WA 1JRUA 1YJ1A 2IO3B 3GOEA 1EO6A 1WJ6A 1WRDB 3N30A 3RT3B 4CYEA 1J0GA 2IZVB 2WX1A 1WJUA 3PHXB 2XEWA 3ZNZB 4G0NB 1R4NI 1TTNA 1Z5SB 2KJRA 3ZTDA 4BKTA 4MJSA 4NJ6A 3AULA 2PPHA 4KDLB 3O65B 4W9GA 4LJPB 1IP9A 5LLIA 2KC2A 4LCDE 3H7PA 2MWSB 1UBIA 3WA0A 2KLGA 2BGFA 2M0XA 3V61A 2FUHB 2K6DB 5G55A 3V6CB 2LVOA 4NAWA 3ZRCA 1F9JA 2NBWB 1IPGA 3IG3A 3RYTA 2KTRA 3DCGA 3RZWC 3TCAA 3WALA 2JPHA 2I1KA 4GN1A 1P1AA 2BWES 4W9LA 2D3GA 2YLMA 2KJHB 2KO3A 4OVVA 4WJOA 4HPLB 4BVUC 1E7VA 4GMVA 4IG7B 3RULA 5JHBA 3KW5B 2ZZPB 4MGKE 2KFKB 4WQOB 1YX6B 2C9WB 2KQSA 2L05A 4BKSD 4RM9A 3UQBA 1GC7A 2K8BA 2LASA 2LVQA 3DVNV 3QAQA 4EZKA 3NOBA 2LXCA 4DHZE 4G50A 3ZDMC 2HTHA 3ZDTA 4ICVA 1NBFC 2BKFA 2KWCA 5AZGA 3MTNB 2MLBA 3AI5A 3R7QA 1L7YA 2AL6A 3QWZB 2G4SA 4NQLB 1WI0A 4BBNC 4FA6A 3BINA 1WX7A 4CHKA 1TGZB 3PT2B 1E8YA 1GUAB 2XBBC 2BYVE 4E71A 2CHZA 1V81A 2DENB 2JWZA 3WAOA 2WX0A 2ZEQA 1TBEA 4AJYB 3ML9A 3DBRI 3PSEB 3JVZX 4GXBA 2IO1B 4EUTA 4ZRKA 3R66C 3Q3JA 2JF5A 3AU5A 3QC8B 3PTFC 3VTWA 2N9XA 2N9EB 4AOFA 5BO4B 3I3TB 4DHZB 4II2B 3WAPA 4BKGA 4EKUA 1U4AA 3LJ3A 1WGDA 1EUVB 3ZVVA 4TKNA 3KYDD 1WR6E 1YIWA 2LUEA 2L0FA 4HDOA 3WAMA 2MP2B 3QA8A 3U8ZA 4EZLA 4IM2A 3PREA 2BKRB 3QIJA 2IY1B 3DBLI 4TQ1A 1WXAA 3M3JA 1I35A 3TMPB 4HCPB 4G3XB 1UBQA 3JW0X 2FCQA 3DBSA 4GB9A 3R7RA 2MBEA 4MDKE 2ZPYA 2JY6A 4KSLC 2RD0A 1MG8A 2K25A 1WX8A 2J0JA 3H1UA 1C3TA 2NBVB 4PYZA 1V86A 1LFDA 3EECA 2MBQA 2R2QA 3UIOB 2ZCBA 2KDIA 2V1YA 2V4LA 3W1YA 5IAAC 4PS7A 1WGRA 2KX0A 3SU8X 2V3SA 4W9IA 4YL8A 4DDID 5EDSA 1WJ4A 4ASWC 4DHJB 2C60A 1P98A 1V6EA 1WM3A 2W9NA 3A9KA 2JRIB 1P0RA 1Y8RC 2KTFA 3BY4B 4AUQC 2Z0DB 1XQQA 3RUIB 3APDA 2KHWB 1OTRB 2NR2A 4II3B 2L0TA 5GMVA 5D2MB 4WWNA 2AYOB 4XZ4A 2O6VB 4IWQA 2ZCCA 3KUZA 2GOWA 4KDIC 2IY0B 2J0KA 2MW5A 3PRPB 4W9FA 1WX9A 2NS5A 4IWPA 2BF8B 2LJ5A 4KVGB 5CX3A 4E74A 2KANA 2JZZA 1YX5B 2G3QB 3KUDB 2CU1A 2RSUA 2GBMA 5KHOA 2PEAA 3IFWB 2L3ZA 3B1LX 3V62A 1UZXB 4LDTB 2RGFA 3DVGY 2A4ZA 3ZTCA 2CHXA 3T9LA 4M8MA 4HPMB 2CKHB 2FCSA 3RCZA 4F1SA 4XX5A 2QHOA 4JGHB 4B9KA 4MSMB 4TQ0A 3ONSA 2DZMA 4JL9A 2MCNB 3MHSD 2LZ6A 4W9DA 1V5TA 4EFOA 2EMTA 1OGWA 4EZJA 2MRPA 3L17A 4GSWA 3K9OB 4AP4C 1VCBA 4FJVB 3KUCB 5KHQA 4N9F4 4JIOU 2O6VA 5J2RA 4WJNA 4KV2A 4NNJB 1WH3A 2G45B 2REXA 2DAJA 3N32A 3PZDA 2PE6B 3M63B 2Z0EB 2WWZA 2LI5A 3A4RA 2GBNA 4AWJA 3NHEB 3PV1A 2BWFA 5IA7A 2KN5A 1D3ZA 1P3QU 3HHMA 2CR5A 2D2QA 3V60A 4EOYA 5JHAA 2Z59B 3PVLA 3SHQA 4A3OA 2N4FA 1WY8A 3ZIMA 4WWPA 4WJQA 1V9JA 3OLMD 3CSFA 4EEWA 1BT0A 1WFYA 2GBRA 2VRRB 3K9PB 4GDLB 2KOXA 3VH4B 2BYFA 2GBJA 1NDDA 3MJWA 2JVCA 1QZEA 4MM3A 1L2NA 2BPSA 3L0WB 3PGEA 1V2YA 2NCNA 3VUYA 2IO2B 2LRWA 3W1SC 5HKHA 1LQBA 2KFJA 3H9DA 2NPTB 3JYUA 4F8CB 4BOZB 5DPTA 3RZFA 2KVRA 1S1QB 1LM8B 2EKEC 3HIZA 4FHJA 4ANVA 3RD2A 1Q5WB 4FULA 3A9KB 1XT9B 4MH0E 2KQ7A 3U30A 1CMXB 1V5OA 4MSQB 4MGYE 3ALBA 1WE7A 3VUWA 3DVNU 2LXAA 3TIXA 1V49A 4F7ZA 2C5LC 4FHKA 5AZFA 3QQ8B 1E8WA 3M62B 4ANXA 2O2VB 4HK2A 4FBJB 1G6JA 1WXVA 3QK0A 2AWTA 2ZNVC 3KYCD 4FJYA 3VAWA 2K8CA 3HM6X 2KXJA 3PS6A 1GJZA 4W9KA 3L16A 3ZW3A 1EF1A 3HK0A 4MGIE 1WIAA 2D10A 4GDLA 1WE6A 4MEMA 3VFKA 2M4NA 4BOSC 3HM3A 3VTUA 3OAWA 3WANA 4K7WA 5J17A 5LXIB 1WF9A 2XK5B 4GDKB 3C0RB 3A33B 4IC7B 2LGXA 1YD8U 2C7MB 1E90A 2KJ6A 2NPTA 1J8CA 1V80A 2K6QA 1J19A 1PQSA 1UELA 1HE8A 4LJOB 4NY0A 4B95A 3H7SA 3A9JB 3QHTA 3NZSA 3AU4A 1FXTB 2DX5B 2KDFB 2KX3A 4MGZE 3TJPA 2LGYA 3PRMB 1Q1OA 3ML8A 4I6NB 2C7HA 3PPAA 3L13A 4RMAA 5E6PA 4ZDVA 3L08A 4IM3A 2LWPA 1GG3A 1X1MA 2M17A 5D94A 2JXXA 4TUUA 3X0WA 4HVBA 2D11A 4HDQA 2FNJB 1WMHB 2AEHA 3OJ3A 1LXDA 2N1VA 2FAZA 2IYDB 3CF6E 4XC2A 3EFUA 4PS8A 2O2VA 3ENEA 3Q3FA 2KD0A 3IVFA 3P2BA 1SIFA 1YQBA 5AZHA 1NI2A 3OJ4B 4JLCA 2LRUA 4PYUA 3QARA 2FIDA 2R2OA 5CHFA 2KNBA 3ZNID 3EHVA 4HCNB 2PE9A 3UINB 2K39A 2DHZA 2HE7A 1OEYJ 2XK5A 4GDKA 2MSED 3ZNHB 4I6PA 2DYOA 2EMSA 3ZKJC 3VXWA 2BYEA 3X23A 1EF5A 2ZNVB 2DAFA 2JUOA 3A9JA 3H6NA 4IM0A 4A3PA 2MBHA 3VHTC 4HLEA 4ZYNA 4A20A 4DDGD 5CHVC 2OOBB 2WYQA 1P9DU 1OEYA 4W9JA 2KKCA 3CMMB 1KJTA 3L54A 3VQIA 5G2NA 5D7GA 2MX2A 5D6JB 4W9CA 2UYZB 3QCAA 2LGDA 2DZIA 3NS8A 3TBLD 1T0YA 3VDZA 3W1SA 4CO7A 2FCNA 5L83A 4BFRA 1WMHA 3ZRFA 4DBGA 4DHJD 3SDLC 2G4DB 2GMIC 3UF8A 1H4RA 2KMCA 5CHWA 2ZPNA 1IYFA 2L76A 4M0WB 3DBHI
chains in the Genus database with same CATH superfamily
5G5GA 2MBOA 2B3AA 1HTQA 1EU4A 1KLVA 1L0VB 1ZKHA 3A1QB 4X57B 4YTNB 2KK8A 5MPOA 1AARA 2KC1A 4DK5A 4L23A 2JZ3B 4TV3A 2LD9A 2N7DA 4KKIA 1K51A 3M95A 1WGGA 4LDTD 1GAQB 5LXHA 3BVZA 3SD5A 4K7SA 2JXTA 1F52A 2IBIB 2KDBA 2OJRA 4XGAB 2AQ1B 3NVZA 1E7PB 1C77A 5C1ZA 1QOFA 4XWTA 4OZBA 2YEPF 4GGQA 1A5RA 4ANWA 1J7BA 2UWQA 3DDCB 3AEBB 1KOTA 4K7UA 2ONQA 3DQVA 2R61A 4IUMB 3RI7C 3ZXRA 1N60A 1XD3B 4NPNA 2DZJA 4HJKA 2N0SB 1C79A 3TEYA 4R3DA 2BTEA 2RR9A 1YJJA 1KRHA 3AH7A 2DYBA 1QILA 3DHHC 2J0MA 1F2RC 2HJ1A 3FC4A 3RFZB 2AL3A 1ISNA 2JRHA 1B9RA 1WXQA 3H7PB 1BUIC 3KH0A 1TS3A 2Y5CA 4RF0A 2K9XA 4K81A 4M8NA 4NAWB 2ZVNA 1I4HA 2D3BA 1MPEA 2KMAA 2DYMA 3Q8AA 4JX1C 1I4GA 3NY5A 4ZRIA 2MP2A 1TIFA 3ZO5B 3ETRA 1R4MI 2GLSA 2JZPA 1FEHA 4ZRPA 1UH6A 3KWLA 2MQJA 4WAAA 3HUIA 1E8XA 1GC6A 1WZ0A 3Q3MC 2K3UA 3R3MA 4YSZB 2KAJA 4WIPA 1WJ6A 3RT3B 2IZVB 2WX1A 2KJRA 4KGTA 3AN1A 4BKTA 4MJSA 4RGNA 2PPHA 4KDLB 5E6JA 1IP9A 2M0AA 4LJPB 5LLIA 2KC2A 4RH6A 2BGFA 3R8BA 3V61A 5G55A 3W5VB 1FXIA 2EKIA 3ZRCA 2VH1A 1F9JA 2H88B 1SEBD 3EFCA 1DGJA 3DCGA 2PVGC 3ABVB 1QQRA 3U2SC 2D3GA 2ACZB 2KJHB 4OVVA 1SIJA 4RGMA 3RULA 3P42A 3KW5B 4MGKE 2C9WB 4BKSD 1RM6C 2LVQA 4LLGM 5H8YE 3AE3B 4M0WB 2HTHA 2FE8A 5FKAC 2WXMA 4HPPA 2V3PA 1L7YA 4NQLB 1WI0A 1ZXHA 4FA6A 1TGZB 3RNEC 4JPSA 1I4RA 2CHZA 1FD6A 1IBXA 1TBEA 2D3AA 3DBRI 3N1ZC 3BIID 3AU5A 5HG2A 3QC8B 3VTWA 3C19A 5BO4B 4II2B 1VZ6A 3WAPA 4BKGA 2CJOA 2TSSA 1IGDA 4TKNA 5BYQA 2LUEA 1Y56A 2MP2B 3Q14C 3AEEB 2WXKA 1RFKA 2PTLA 4HCPB 4G3XB 2FCQA 4GB9A 4AQ7A 1ENFA 2JY6A 4PYZA 2R2QA 1EWCA 2V1YA 3W1YA 5IAAC 3RNBC 5EE9A 3ZGZA 1R7SA 4MACA 4ASWC 2YEPB 1QKZA 2V4IB 4AUQC 5TSSA 1WYGA 1GOZA 1OTRB 2NR2A 1DYQA 2L0TA 4WWNA 4PK1A 4OHJA 2ZCCA 2GOWA 1XEEA 1NVID 2WU5B 2JYEA 3AE5B 1WX9A 1XLNA 1V8CA 1I4XA 2KANA 2JZZA 1YX5B 4ARIA 3IFWB 2WS3B 2L3ZA 3V62A 4LDTB 2EELA 4M8MA 1EM7A 1JRPA 2QHOA 3BK1A 2EMTA 2MRPA 3C8YA 1VCBA 4FJVB 3KUCB 3RNAC 5KHQA 4DQOC 4ITKA 1WH3A 1QLBB 3N32A 4HEA1 1JQ4A 2LFIA 2I38A 3LXFA 4GLSC 1KF6B 2VZKD 1P3QU 3V60A 2CR5A 5JHAA 2CU3A 4LNIA 4DXFA 2Z59B 2WXNA 1IUEA 1TY2A 3AEGB 1SE3A 1WY8A 1NYQA 3OLMD 4EE2A 4EEWA 1BT0A 3DBHB 2VRRB 2BYFA 1F0ZA 4MM3A 2BPSA 1CQVA 3PGEA 2NCNA 3VUYA 2LRWA 1A70A 3JYUA 4BOZB 5DPTA 1S1QB 3HIZA 1N6ZA 2EKEC 3RD2A 1HA5A 1VJKA 1XT9B 1CMXB 4MSQB 4MGYE 3ALBA 1PGBA 4AS1A 3N1XC 4RF1A 4F7ZA 2C5LC 3MP9A 2O2VB 3KQ4A 1L6VA 1WXVA 3QK0A 2K8CA 3HM6X 3PS6A 1J7CA 1SSNA 1AW7A 4GDLA 1WE6A 3OAWA 5J17A 1WF9A 4GDKB 2LGXA 4NY0A 3H7SA 2WXOA 3NG0A 2SAKA 4MGZE 3KWVA 3PRMB 5BMHA 4LNFA 4H2AA 3W5UB 1TKGA 3L08A 4ZDVA 4IM3A 1XF5L 3X0WA 4OW0A 4HDQA 2FNJB 3N20C 4PS8A 3IVFA 3E9SA 1YQBA 1NEKB 1NI2A 3OJ4B 3MJ5A 3AE8B 1VZ8A 3QARA 2R2OA 3EHVA 4HCNB 1XLPA 2PE9A 3UINB 2FUG1 2K39A 2XK5A 4RFBA 1MFWA 1AYFA 2ON8A 3TSSA 2BS2B 1FIQA 4BZAA 2MBHA 4HLEA 4DDGD 2OOBB 1OEYA 1KJTA 3EUB2 5D7GA 5D6JB 3TBLD 2LGDA 4DBGA 4DHJD 1MI0A 1E10A 2JSVX 1JWUD 1IYFA 4YSYB 4CQNA 2MH7A 2KWUB 1N5WA 1WZ3A 3NVYA 2L8JA 1RAXA 3ZUNA 2BS3B 3S2AA 5JH5C 3KVFB 2KWVB 3H8HA 1WXMA 2BVCA 3UI3A 1FMAD 1LGRA 2IO0B 3JSVB 4NJ7A 1KM7A 2LVPA 1RLFA 1YJIA 3P63A 2JWUA 3SEBA 4JWSC 3TL5A 1RYJA 1EWYC 4GIVA 2E6XA 3T3NA 5HI1A 1I42A 3GZNI 1UGMA 2W55A 2GI9A 2ICIA 5FK9C 1ZUD2 3PLVA 4REZA 4M0WA 4URKA 4GU2A 4XE0A 2L7RA 3L10B 2M1MA 3VRBB 2J52A 2BBCA 3A1QA 3N1YC 1WR1A 3VH3B 4G11A 2NBUA 2KLCA 3EA6A 4IWOA 2QC8A 1TZ1A 2A5UA 2KVZA 2M56B 2N9PC 3PLUA 5DCNA 1RFAA 2QMTA 3HRDD 4MELA 2K22A 1T5XD 4US8A 2KACA 3N3KB 3IBEA 1WGYA 3DPDA 4RGOS 1PDXA 1E9MA 2QIEB 1VD2A 4L1BA 2NVUI 4NZLB 3B0AA 1SE9A 2V0GA 1ZOYB 4PS3A 2AQ3B 3AE9B 5E6OA 4J6IA 3A4SC 4W9HA 4FN2A 1QOGA 3B08A 4DXAB 4ZHPA 1E0ZA 4NQKE 1HEZE 3AXCA 4KSKC 1JRUA 2IO3B 1BMLC 1LO5D 1D5MC 4G0NB 1Z5SB 2WXFA 3ZTDA 2QSDA 1PYWD 4W9GA 1I4QA 4LCDE 3H7PA 1GB1A 1UBIA 1YN4A 3NRZA 2FUHB 2K6DB 4NAWA 2OJWA 3IAS1 3WALA 3RZWC 5L95C 1YQ3B 3TCAA 2I1KA 1N61A 4WJOA 1DOXA 5JHBA 1E7VA 4IG7B 1FRRA 3AE1B 2BT6A 1E6EB 2GRIA 3UQBA 2K8BA 3DVNV 1K50A 4P6VF 1YNTE 2BKFA 5AZGA 2INCC 2AL6A 2G4SA 4BBNC 1V1PB 3CWIA 1WX7A 3PT2B 1GUAB 1XCTL 1ZPSA 4ARCA 2BYVE 3TUOA 2WXQA 3BWUD 2K0PA 3ML9A 3PSEB 3JVZX 2IO1B 1P7EA 4Q2JA 4EUTA 4ZRKA 4HKQA 3R66C 2HDEA 2JF5A 2WQYB 2DWQA 4L2YA 4AOFA 3I3TB 4DHZB 4EKUA 4N6EB 4ZRQA 1EUVB 2QJLA 4KGSA 4A90A 1YIWA 4HDOA 2L0FA 3WAMA 3U8ZA 1FNUA 2D3CA 4EZLA 2BKRB 2IY1B 3M3JA 1UBQA 3JW0X 3R7RA 2MBEA 1JWBD 4KSLC 3H1UA 1V86A 1F1HA 3EECA 4PS7A 3B9JA 1WGRA 2WXLA 2KX0A 1T0QC 4YL8A 4YTMB 2INPE 5EDSA 3W2DA 1FO4A 4DHJB 1P98A 1WM3A 3U4EG 2JRIB 1P0RA 1N62A 2KTFA 2Z0DB 2KHWB 4DXGA 3MFGA 4KDIC 4YT0B 2RMMA 2WXIA 4W9FA 1WWTA 2BF8B 2LJ5A 2DBYA 4TSSA 2KYWA 2CU1A 2RSUA 5KHOA 2DNFA 3HVZA 1AWDA 1YQ4B 3ZTCA 1C9FA 2WDVB 3IT4B 2CKHB 1RWSA 4TMAB 2V3NA 4JGHB 2LEKA 5LNK1 3RN9C 2MCNB 3MHSD 1VLBA 1V5TA 4GSWA 1I4PA 4N9F4 4WAFA 5BMGA 3NJTA 1QOAA 4KV2A 1ESFA 2G45B 5EE0A 2DAJA 2NMQA 3PZDA 2WWZA 2GBNA 3Q8EA 2BWFA 5IA7A 3P4RB 3N9YC 2D2QA 4A3OA 2RDGA 1ACCA 1V9JA 1KLUD 2BB5A 3I5JC 4P16A 1UUPA 1MJDA 3VH4B 4OVZA 3P4QB 2JVCA 1FRDA 3VR9B 2WXJA 4JWUC 3Q2AC 2KFJA 2NPTB 4ZYSA 4ANVA 1FNVA 1SE4A 1V5OA 2KMMA 2LXAA 2QCZA 3NVVA 5AZFA 3AEAB 1VRAB 3M62B 4ANXA 4RCOA 4ZHOA 1EU3A 2AWTA 2ZNVC 4FJYA 4USAA 1UWMA 3ZW3A 1EF1A 3HK0A 4MGIE 3E56A 4MEMA 2M4NA 2IDYA 3DBRB 1FXAA 3AECB 1T0RC 1D4BA 3C0RB 3A33B 4IC7B 1C78A 1L4ZB 2C7MB 5JXVA 2KJ6A 1J8CA 2K6QA 1PQSA 2J42A 4LJOB 3A9JB 3QHTA 2BB6A 3NZSA 2KDFB 2KX3A 2N9KA 3TJPA 2LGIA 4I6NB 4RMAA 1C4AA 3GE8C 3ZJTA 2LWPA 2RPVA 4TUUA 3RYTA 3OJ3A 2AEHA 2FAZA 2IYDB 2O2VA 1OQQA 3T3OA 5AZHA 2W3SA 2FIDA 4FXCA 3AE4B 1D6EC 4GDKA 3ZNHB 4S17A 4I6PA 2EMSA 3X23A 1EF5A 4XWWA 2JUOA 4A3PA 3AE7B 2WHIA 3VQIA 5C2TB 2MX2A 2UYZB 3NS8A 5L83A 3W1SA 4LTUA 3FKYA 4P1CC 2I2YA 1WGKA 3DBHI 1FPYA 3P1MA 2N7EA 2O6VD 4BKSA 3DOWA 5DPSA 1E7UA 2GBKA 3DWGC 2QDFA 5FR6A 1NYRA 1K8RB 1FNWA 2KDEB 4KIKB 1WJNA 4WJPA 1WXSA 4WH4A 3KLSX 2HD5B 2I1JA 1ET6A 1E8ZA 4HWIB 5IO9A 5JZEB 4DWFA 2SEBD 1B1ZA 3LDZE 4FJZA 1VDVA 2C7NB 2E3TA 4HROA 3CSTA 3RNGC 1E5WA 1CK1A 2CS4A 3ZNGC 2WDTB 1TS5A 1PUTA 4OVUA 4BBNF 1JROA 2RPQA 2MBBB 3FILB 3VUXA 3WIMA 4E3CA 3ZJVA 4A6QA 4YSXB 2FIFA 4IW0A 5DPRA 3RPFC 2FCMA 5AUKA 1JALA 2G9HD 2LUMA 3JSVA 3L4PA 3D32A 3PRZA 2HJ8A 2X38A 2ZJDA 3NZUA 3ZYYX 4C00A 1ZW7A 1C4CA 1UGJA 3FAHA 1SGHA 2ZVOA 1TS4A 1JWSD 1Z2MA 2N1WA 2WXGA 3Q69A 1ET9A 3APFA 3UIPB 1L0YB 3DBLB 1S3SG 4ANUA 4B0MA 2PKOA 3IHPC 2ZW0A 3TEXA 4FADA 2RDBC 3J9CA 2L1AA 1C76A 3V6EB 3AEDB 4J3OD 2KTRB 4M01A 3MC8A 3ZLZA 3VRAB 2ASQA 1M94A 5CTRC 2OHFA 1H8CA 1WYWB 4IKGA 4C56C 4K1RB 1YJ1A 5T8IA 1IGCA 3GOEA 1EO6A 1WRDB 4CYEA 4S0RA 3ZNZB 2XEWA 4KX6B 1R4NI 4A9AA 4NJ6A 3AULA 2MWSB 3WA0A 2MEKA 1JW9D 4GN1A 1P1AA 2BWES 2INNE 2CJNA 2KO3A 4BVUC 4HPLB 4GMVA 1PGXA 1MHXA 1ROEA 1YX6B 4WQOB 2KQSA 2L05A 1GC7A 2LASA 4LK0M 3NOBA 2LXCA 4DHZE 4G50A 2KN4A 3ZDMC 3ZDTA 4ICVA 3GP7A 1NBFC 2KWCA 3MTNB 2MLBA 3AI5A 4K3BA 3QWZB 1KH0A 4ACFA 3B2GA 3BINA 4CHKA 1E8YA 4E71A 2JX5A 1V81A 2DENB 2WXRA 2WX0A 1ZXIA 2ZEQA 4AJYB 4GXBA 5HFYA 3Q3JA 1UWXA 2LMCA 3NS1A 2N9XA 4XYCA 3GB1A 3LJ3A 1WGDA 4IDIA 3ZVVA 2V9HA 3KYDD 4LNNA 1V97A 4UDUC 4P1BC 1T3QA 3QA8A 4IM2A 3QIJA 3TMPB 1V1PA 2ZPYA 5IKCM 2RD0A 1MG8A 2K25A 2J0JA 2L83A 2NBVB 1LFDA 1CZPA 2MBQA 4ZOHC 3UIOB 2KDIA 2V4LA 4B0EA 3SU8X 4DDID 4W9IA 2ZW1A 3BYTB 1V6EA 3IXSA 2W9NA 3BY4B 2IGGA 5GMVA 5D2MB 1NI3A 2AYOB 4XZ4A 2O6VB 1KFYB 2WNMA 4IWQA 3KUZA 2PLPA 2IY0B 2J0KA 2MW5A 3PRPB 1JWMD 3BYYB 1PFDA 4A55A 1HZ6A 2NS5A 1N5XA 4MT5A 2G3QB 3Q8BA 2Y3AA 3HVDA 3SFDB 2PEAA 4C7ZA 1UZXB 1F2RI 2RGFA 1SB3C 2CHXA 3P4SB 2FCSA 4XX5A 4B9KA 4PT5A 2JQRB 4TQ0A 3ONSA 2DZMA 4W9DA 1OGWA 3L17A 3K9OB 4JIOU 1SBBB 5J2RA 4WJNA 3R2TA 2LHEA 4HKZE 2QILA 1K53A 2GB1A 2PE6B 2LI5A 3RMKC 3A4RA 4AWJA 1NENB 3PV1A 5D3DA 4C4VB 1FFUA 2KN5A 4IOIE 2LHDA 4EOYA 3PVLA 3SHQA 1XLOA 2N4FA 2M19A 3ZIMA 1KTKA 3CSFA 1WFYA 3K9PB 4WURA 2MJDA 2KOXA 1VZ7A 2W3RA 1NDDA 4K3CA 1L2NA 2IJ0A 3L0WB 1ZE3D 2IO2B 3P4PB 5HKHA 5IN7A 3H9DA 5EE3A 1M4VA 1LM8B 1HZ5A 3V05A 1MVKA 1T6BX 4MH0E 2KQ7A 3U30A 1WE7A 3VR8B 3VUWA 3AEFB 1L4DB 3MHZA 3TIXA 1V49A 3NZ3A 3IT6B 3QQ8B 1E8WA 3TEWA 3AMZA 2K5PA 2PIAA 2W54A 3RNCC 3KYCD 2KXJA 1GJZA 4A8XC 3L16A 2N9LA 3VTUA 4K7WA 2BS4B 1E90A 2NPTA 1V80A 1UELA 5EE1A 3MC0B 4B95A 1V1OA 4WWMA 3AU4A 1FXTB 3ML8A 3L13A 2M17A 5D94A 2JXXA 4HVBA 3MC9A 2D11A 1WMHB 2N1VA 3NUHB 2KD0A 2N7JA 1SIFA 2G1EA 4LNOA 3ZXVA 2LRUA 4PYUA 2KQ4X 5CHFA 2KNBA 2WLBA 2H89B 1OEYJ 1MHHE 2MSED 2IGHA 2W82A 2DYOA 2RDHA 3ZKJC 2BYEA 3OWEB 2ZNVB 1T0SC 3H6NA 3A9JA 4IM0A 3VHTC 3BK2A 1YN5A 2WYQA 4US9A 4W9JA 2KKCA 3CMMB 1HQRD 1R4MB 3QCAA 1T0YA 1XO3A 4HJGE 2FCNA 3SDLC 2G4DB 4BAXA 3UF8A 2KMCA 5CHWA 2XN9C 3V3XA 1J7AA 4KZ0A 2Y5BB 1GNUA 2K1FA 2WDRB 1UD7A 4NJCA 3PHWB 1OQYA 4WWOA 4C80A 5I4DA 3T8MA 2YVCA 1JMLA 2L00B 4I6LB 1L0XB 1PGAA 2J4XA 5AEKB 2NTSA 1ZDXA 3TEZA 3EC8A 2CHWA 5AUIA 5TR5A 2J53A 2IGDA 3UQAA 1SJED 5J18A 1WGHA 1L6UA 4GOCA 2OEDA 3UGBB 2J7QB 3Q3NC 1DOYA 3VTVA 1Q10A 4KIKA 1Q0WB 2KZRA 2KFKA 3O13A 1C1YB 3VVWB 2JT4B 1RRBA 4KZCA 2PW9A 2WXPA 2DZKA 3PO0A 3QX1A 2K8HA 2D07B 2MA9B 3QJZA 4HXDA 2JYTA 3Q3OC 3DVGX 3ECIA 5C23A 1D5XC 4P7IA 1TKYA 3U7ZA 3BVMA 3GS2A 3PZ7A 2M8SA 4MJSB 4RM8A 5DPWA 2QEJC 1WM2A 3FILA 5D3IB 3LYYA 4FLHA 4AJWA 1SXTA 4JQWC 4W9EA 2PJHA 1YOVB 4ICUA 4QAYA 3APCA 5E6NA 1N63A 3U7DA 1ZGUB 4ZRJA 5C3JB 4B6WA 1AN8A 2WP9B 3N30A 1BXTA 1J0GA 3Q8CA 1SE2A 1WJUA 3PHXB 2XNAC 1TTNA 4OZCA 3I9V1 2BW2A 3U52E 3I63C 4N59A 3O65B 1WRIA 2KLGA 5HHDG 2L32A 2M0XA 3B2FA 3V6CB 1P7FA 2LVOA 5GXGB 1IBXB 2NBWB 1IPGA 3IG3A 2KTRA 2JPHA 1TYGB 4W9LA 2YLMA 3NVWA 2UU7A 1UF0A 2ZZPB 5BMIA 4WQMA 2KFKB 2WGSA 3Q6BA 4RM9A 1TKEA 5BYSA 1D5ZC 3QAQA 3SR6A 4EZKA 2MJEA 1YN3A 1FCLA 1F77A 4O1NA 3R2IA 3R7QA 1ZP0B 1QF6A 1OFFA 2XBBC 3PZ8A 2JWZA 3WAOA 3URYA 4LNKA 2B76B 3DHIC 5IP4D 1TJEA 1OQRA 4RNAA 3Q8FA 3PTFC 2INDC 2N9EB 1QT9A 3RNFC 1U4AA 1XLQA 1WR6E 5IOIA 2KDMA 1GPXA 3PREA 3IAM1 3DBLI 4TQ1A 2WU2B 1STEA 1WXAA 1I35A 3DBSA 4MDKE 1WX8A 2Q5WD 1C3TA 1JCKB 1HXYD 3DWMA 3EGRA 2ZCBA 2HTME 2V3SA 3W9CB 3GE3C 1WJ4A 3LB8C 2C60A 2PMVA 3A9KA 1Y8RC 1C4PA 1XQQA 3RUIB 3APDA 4II3B 3AE2B 3AM9A 3ZQ4A 4YTPB 1FCCC 2FBWB 4IWPA 4KVGB 5CX3A 4E74A 3I57A 3KUDB 2KWDA 2GBMA 3BVGA 3B1LX 4M02A 3DVGY 2A4ZA 3T9LA 2KT7A 2MHJA 1JWAD 4HPMB 3RCZA 4F1SA 2NTTA 3AB5A 1CJEA 5H92C 4MSMB 4MM3B 4JL9A 2LZ6A 4EFOA 4EZJA 2JU6X 2AX5A 4OZAA 4AP4C 1XCQL 1SF0A 4M00A 2O6VA 2PVOD 2DLBA 4NNJB 2VH2A 2REXA 3CIRB 3M63B 4YWGG 2Z0EB 4XDCA 1DOIA 1R4NB 3NHEB 1D3ZA 3HHMA 4NAMA 4WWPA 4WJQA 4KKJA 2GBRA 2D5GA 2X8XX 4GDLB 3DHGC 2GBJA 3MJWA 3AE6B 1QZEA 1WSPA 1GB4A 4N58A 1V2YA 3W1SC 1LQBA 1ZDVA 4F8CB 4RGTA 4HRSA 3RZFA 3BZDB 2KVRA 4FHJA 1Q5WB 4FULA 3A9KB 5G5HA 2MJ3A 3DVNU 5FR3A 1VR9A 4FHKA 4C4VA 1L5PA 1TY0A 4C7YA 4HK2A 3GZNB 4FBJB 1KLGD 1G6JA 3VAWA 4W9KA 1YMHE 2L52A 2AQ2B 1MG4A 1FM0D 1WIAA 2D10A 3VFKA 4BOSC 3HM3A 2LGSA 1TZOA 3WANA 5LXIB 1HTOA 1XXGA 1I7HA 1UNSA 2XK5B 1YD8U 1J19A 1HE8A 3AV8A 1QOBA 4D2KA 2WDQB 2DX5B 2LGYA 1SJHD 1Q1OA 2C7HA 3PPAA 1TT5B 5E6PA 4JE3B 1GG3A 1X1MA 4XC2A 2IPKD 1LXDA 2BYTA 3CF6E 3EFUA 3Q3FA 3ENEA 3OG5A 3P2BA 4XDDA 4JLCA 3ZNID 1K52A 2DHZA 2HE7A 2VZKB 1FFVA 2BQQA 3ZJUA 3VXWA 2DAFA 3WCQA 3SFEB 4MH8A 2Y5PA 5BYRA 4ZYNA 4A20A 5CHVC 1P9DU 3L54A 5G2NA 1TS2A 4W9CA 4KGRA 2DZIA 3VDZA 4CO7A 2LJIA 1WMHA 3ZRFA 4BFRA 2GMIC 1H4RA 2ZPNA 4YXDB 2L76A 2Z8LA 2WXHA
chains in the Genus database with same CATH topology
2N7EA 2O6VD 4BKSA 2MBOA 4KZ0A 2Y5BB 2KWUB 3DOWA 5DPSA 1GNUA 1E7UA 1WZ3A 2GBKA 2B3AA 2K1FA 2L8JA 1RAXA 3ZUNA 5FR6A 3S2AA 5JH5C 1KLVA 3KVFB 3A1QB 1ZKHA 1UD7A 5L95C 4X57B 1K8RB 2KWVB 2KK8A 2KDEB 4KIKB 1WXMA 1AARA 2KC1A 3PHWB 4DK5A 1WJNA 1OQYA 4WWOA 4WJPA 1WXSA 2IO0B 3JSVB 3T8MA 2YVCA 2JZ3B 2HD5B 4NJ7A 1KM7A 2LVPA 1RLFA 2I1JA 2LD9A 2N7DA 4TV3A 3M95A 1WGGA 2L00B 1E8ZA 4I6LB 4LDTD 4HWIB 5LXHA 5AEKB 5JZEB 3SD5A 4DWFA 3EC8A 4K7SA 3TL5A 2CHWA 3LDZE 4FJZA 4GIVA 5TR5A 2C7NB 2IBIB 2KDBA 2OJRA 1I42A 3UQAA 3CSTA 3GZNI 1E5WA 5J18A 2CS4A 1UGMA 3ZNGC 1WGHA 2WDTB 5C1ZA 3PLVA 4URKA 4OVUA 4GU2A 4GOCA 4BBNF 4GGQA 3UGBB 2L7RA 1A5RA 3L10B 2M1MA 2RPQA 2MBBB 2J7QB 4ANWA 3VUXA 2UWQA 3VTVA 3DDCB 3A1QA 3WIMA 1WR1A 4E3CA 1KOTA 2FIFA 4IW0A 3VH3B 4K7UA 5DPRA 4KIKA 1Q0WB 2KZRA 3DQVA 2KFKA 4G11A 4IUMB 2FCMA 2NBUA 1C1YB 2KLCA 4IWOA 1TZ1A 3VVWB 2JT4B 3JSVA 1XD3B 1RRBA 4KZCA 2A5UA 4NPNA 2DZJA 3D32A 2N9PC 3PLUA 3PRZA 1RFAA 5DCNA 4HJKA 4MELA 2HJ8A 2DZKA 2ZJDA 3NZUA 3QX1A 2K8HA 2D07B 2RR9A 1ZW7A 2MA9B 3QJZA 3N3KB 4HXDA 3IBEA 1WGYA 3DPDA 1SGHA 2ZVOA 3DVGX 3ECIA 2DYBA 1Z2MA 2N1WA 5C23A 4P7IA 2J0MA 3APFA 3UIPB 1VD2A 2M8SA 4MJSB 1S3SG 4RM8A 5DPWA 2AL3A 1ISNA 4ANUA 2JRHA 1WM2A 2NVUI 3H7PB 3IHPC 3KH0A 3B0AA 1SE9A 4FADA 4FLHA 4K81A 4AJWA 4M8NA 3V6EB 4NAWB 2ZVNA 4JQWC 4PS3A 4W9EA 2KTRB 2PJHA 2KMAA 3ZLZA 5E6OA 2DYMA 4ICUA 4J6IA 3APCA 3A4SC 3NY5A 4FN2A 4W9HA 2ASQA 5E6NA 4ZRIA 2MP2A 3ZO5B 1M94A 5CTRC 1R4MI 3B08A 1WYWB 1ZGUB 3U7DA 4DXAB 1H8CA 4NQKE 3AXCA 1UH6A 2MQJA 4KSKC 4WAAA 4ZRJA 1E8XA 1GC6A 1WZ0A 3R3MA 4K1RB 4B6WA 1JRUA 1YJ1A 2IO3B 3GOEA 1EO6A 1WJ6A 1WRDB 3N30A 3RT3B 4CYEA 1J0GA 2IZVB 2WX1A 1WJUA 3PHXB 2XEWA 3ZNZB 4G0NB 1R4NI 1TTNA 1Z5SB 2KJRA 3ZTDA 4BKTA 4MJSA 4NJ6A 3AULA 2PPHA 4KDLB 3O65B 4W9GA 4LJPB 1IP9A 5LLIA 2KC2A 4LCDE 3H7PA 2MWSB 1UBIA 3WA0A 2KLGA 2BGFA 2M0XA 3V61A 2FUHB 2K6DB 5G55A 3V6CB 2LVOA 4NAWA 3ZRCA 1F9JA 2NBWB 1IPGA 3IG3A 3RYTA 2KTRA 3DCGA 3RZWC 3TCAA 3WALA 2JPHA 2I1KA 4GN1A 1P1AA 2BWES 4W9LA 2D3GA 2YLMA 2KJHB 2KO3A 4OVVA 4WJOA 4HPLB 4BVUC 1E7VA 4GMVA 4IG7B 3RULA 5JHBA 3KW5B 2ZZPB 4MGKE 2KFKB 4WQOB 1YX6B 2C9WB 2KQSA 2L05A 4BKSD 4RM9A 3UQBA 1GC7A 2K8BA 2LASA 2LVQA 3DVNV 3QAQA 4EZKA 3NOBA 2LXCA 4DHZE 4G50A 3ZDMC 2HTHA 3ZDTA 4ICVA 1NBFC 2BKFA 2KWCA 5AZGA 3MTNB 2MLBA 3AI5A 3R7QA 1L7YA 2AL6A 3QWZB 2G4SA 4NQLB 1WI0A 4BBNC 4FA6A 3BINA 1WX7A 4CHKA 1TGZB 3PT2B 1E8YA 1GUAB 2XBBC 2BYVE 4E71A 2CHZA 1V81A 2DENB 2JWZA 3WAOA 2WX0A 2ZEQA 1TBEA 4AJYB 3ML9A 3DBRI 3PSEB 3JVZX 4GXBA 2IO1B 4EUTA 4ZRKA 3R66C 3Q3JA 2JF5A 3AU5A 3QC8B 3PTFC 3VTWA 2N9XA 2N9EB 4AOFA 5BO4B 3I3TB 4DHZB 4II2B 3WAPA 4BKGA 4EKUA 1U4AA 3LJ3A 1WGDA 1EUVB 3ZVVA 4TKNA 3KYDD 1WR6E 1YIWA 2LUEA 2L0FA 4HDOA 3WAMA 2MP2B 3QA8A 3U8ZA 4EZLA 4IM2A 3PREA 2BKRB 3QIJA 2IY1B 3DBLI 4TQ1A 1WXAA 3M3JA 1I35A 3TMPB 4HCPB 4G3XB 1UBQA 3JW0X 2FCQA 3DBSA 4GB9A 3R7RA 2MBEA 4MDKE 2ZPYA 2JY6A 4KSLC 2RD0A 1MG8A 2K25A 1WX8A 2J0JA 3H1UA 1C3TA 2NBVB 4PYZA 1V86A 1LFDA 3EECA 2MBQA 2R2QA 3UIOB 2ZCBA 2KDIA 2V1YA 2V4LA 3W1YA 5IAAC 4PS7A 1WGRA 2KX0A 3SU8X 2V3SA 4W9IA 4YL8A 4DDID 5EDSA 1WJ4A 4ASWC 4DHJB 2C60A 1P98A 1V6EA 1WM3A 2W9NA 3A9KA 2JRIB 1P0RA 1Y8RC 2KTFA 3BY4B 4AUQC 2Z0DB 1XQQA 3RUIB 3APDA 2KHWB 1OTRB 2NR2A 4II3B 2L0TA 5GMVA 5D2MB 4WWNA 2AYOB 4XZ4A 2O6VB 4IWQA 2ZCCA 3KUZA 2GOWA 4KDIC 2IY0B 2J0KA 2MW5A 3PRPB 4W9FA 1WX9A 2NS5A 4IWPA 2BF8B 2LJ5A 4KVGB 5CX3A 4E74A 2KANA 2JZZA 1YX5B 2G3QB 3KUDB 2CU1A 2RSUA 2GBMA 5KHOA 2PEAA 3IFWB 2L3ZA 3B1LX 3V62A 1UZXB 4LDTB 2RGFA 3DVGY 2A4ZA 3ZTCA 2CHXA 3T9LA 4M8MA 4HPMB 2CKHB 2FCSA 3RCZA 4F1SA 4XX5A 2QHOA 4JGHB 4B9KA 4MSMB 4TQ0A 3ONSA 2DZMA 4JL9A 2MCNB 3MHSD 2LZ6A 4W9DA 1V5TA 4EFOA 2EMTA 1OGWA 4EZJA 2MRPA 3L17A 4GSWA 3K9OB 4AP4C 1VCBA 4FJVB 3KUCB 5KHQA 4N9F4 4JIOU 2O6VA 5J2RA 4WJNA 4KV2A 4NNJB 1WH3A 2G45B 2REXA 2DAJA 3N32A 3PZDA 2PE6B 3M63B 2Z0EB 2WWZA 2LI5A 3A4RA 2GBNA 4AWJA 3NHEB 3PV1A 2BWFA 5IA7A 2KN5A 1D3ZA 1P3QU 3HHMA 2CR5A 2D2QA 3V60A 4EOYA 5JHAA 2Z59B 3PVLA 3SHQA 4A3OA 2N4FA 1WY8A 3ZIMA 4WWPA 4WJQA 1V9JA 3OLMD 3CSFA 4EEWA 1BT0A 1WFYA 2GBRA 2VRRB 3K9PB 4GDLB 2KOXA 3VH4B 2BYFA 2GBJA 1NDDA 3MJWA 2JVCA 1QZEA 4MM3A 1L2NA 2BPSA 3L0WB 3PGEA 1V2YA 2NCNA 3VUYA 2IO2B 2LRWA 3W1SC 5HKHA 1LQBA 2KFJA 3H9DA 2NPTB 3JYUA 4F8CB 4BOZB 5DPTA 3RZFA 2KVRA 1S1QB 1LM8B 2EKEC 3HIZA 4FHJA 4ANVA 3RD2A 1Q5WB 4FULA 3A9KB 1XT9B 4MH0E 2KQ7A 3U30A 1CMXB 1V5OA 4MSQB 4MGYE 3ALBA 1WE7A 3VUWA 3DVNU 2LXAA 3TIXA 1V49A 4F7ZA 2C5LC 4FHKA 5AZFA 3QQ8B 1E8WA 3M62B 4ANXA 2O2VB 4HK2A 4FBJB 1G6JA 1WXVA 3QK0A 2AWTA 2ZNVC 3KYCD 4FJYA 3VAWA 2K8CA 3HM6X 2KXJA 3PS6A 1GJZA 4W9KA 3L16A 3ZW3A 1EF1A 3HK0A 4MGIE 1WIAA 2D10A 4GDLA 1WE6A 4MEMA 3VFKA 2M4NA 4BOSC 3HM3A 3VTUA 3OAWA 3WANA 4K7WA 5J17A 5LXIB 1WF9A 2XK5B 4GDKB 3C0RB 3A33B 4IC7B 2LGXA 1YD8U 2C7MB 1E90A 2KJ6A 2NPTA 1J8CA 1V80A 2K6QA 1J19A 1PQSA 1UELA 1HE8A 4LJOB 4NY0A 4B95A 3H7SA 3A9JB 3QHTA 3NZSA 3AU4A 1FXTB 2DX5B 2KDFB 2KX3A 4MGZE 3TJPA 2LGYA 3PRMB 1Q1OA 3ML8A 4I6NB 2C7HA 3PPAA 3L13A 4RMAA 5E6PA 4ZDVA 3L08A 4IM3A 2LWPA 1GG3A 1X1MA 2M17A 5D94A 2JXXA 4TUUA 3X0WA 4HVBA 2D11A 4HDQA 2FNJB 1WMHB 2AEHA 3OJ3A 1LXDA 2N1VA 2FAZA 2IYDB 3CF6E 4XC2A 3EFUA 4PS8A 2O2VA 3ENEA 3Q3FA 2KD0A 3IVFA 3P2BA 1SIFA 1YQBA 5AZHA 1NI2A 3OJ4B 4JLCA 2LRUA 4PYUA 3QARA 2FIDA 2R2OA 5CHFA 2KNBA 3ZNID 3EHVA 4HCNB 2PE9A 3UINB 2K39A 2DHZA 2HE7A 1OEYJ 2XK5A 4GDKA 2MSED 3ZNHB 4I6PA 2DYOA 2EMSA 3ZKJC 3VXWA 2BYEA 3X23A 1EF5A 2ZNVB 2DAFA 2JUOA 3A9JA 3H6NA 4IM0A 4A3PA 2MBHA 3VHTC 4HLEA 4ZYNA 4A20A 4DDGD 5CHVC 2OOBB 2WYQA 1P9DU 1OEYA 4W9JA 2KKCA 3CMMB 1KJTA 3L54A 3VQIA 5G2NA 5D7GA 2MX2A 5D6JB 4W9CA 2UYZB 3QCAA 2LGDA 2DZIA 3NS8A 3TBLD 1T0YA 3VDZA 3W1SA 4CO7A 2FCNA 5L83A 4BFRA 1WMHA 3ZRFA 4DBGA 4DHJD 3SDLC 2G4DB 2GMIC 3UF8A 1H4RA 2KMCA 5CHWA 2ZPNA 1IYFA 2L76A 4M0WB 3DBHI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N7E A;  2O6V D;  4BKS A;  2MBO A;  4KZ0 A;  2Y5B B;  2KWU B;  3DOW A;  5DPS A;  1GNU A;  1E7U A;  1WZ3 A;  2GBK A;  2B3A A;  2K1F A;  2L8J A;  1RAX A;  3ZUN A;  5FR6 A;  3S2A A;  5JH5 C;  1KLV A;  3KVF B;  3A1Q B;  1ZKH A;  1UD7 A;  5L95 C;  4X57 B;  1K8R B;  2KWV B;  2KK8 A;  2KDE B;  4KIK B;  1WXM A;  1AAR A;  2KC1 A;  3PHW B;  4DK5 A;  1WJN A;  1OQY A;  4WWO A;  4WJP A;  1WXS A;  2IO0 B;  3JSV B;  3T8M A;  2YVC A;  2JZ3 B;  2HD5 B;  4NJ7 A;  1KM7 A;  2LVP A;  1RLF A;  2I1J A;  2LD9 A;  2N7D A;  4TV3 A;  3M95 A;  1WGG A;  2L00 B;  1E8Z A;  4I6L B;  4LDT D;  4HWI B;  5LXH A;  5AEK B;  5JZE B;  3SD5 A;  4DWF A;  3EC8 A;  4K7S A;  3TL5 A;  2CHW A;  3LDZ E;  4FJZ A;  4GIV A;  5TR5 A;  2C7N B;  2IBI B;  2KDB A;  2OJR A;  1I42 A;  3UQA A;  3CST A;  3GZN I;  1E5W A;  5J18 A;  2CS4 A;  1UGM A;  3ZNG C;  1WGH A;  2WDT B;  5C1Z A;  3PLV A;  4URK A;  4OVU A;  4GU2 A;  4GOC A;  4BBN F;  4GGQ A;  3UGB B;  2L7R A;  1A5R A;  3L10 B;  2M1M A;  2RPQ A;  2MBB B;  2J7Q B;  4ANW A;  3VUX A;  2UWQ A;  3VTV A;  3DDC B;  3A1Q A;  3WIM A;  1WR1 A;  4E3C A;  1KOT A;  2FIF A;  4IW0 A;  3VH3 B;  4K7U A;  5DPR A;  4KIK A;  1Q0W B;  2KZR A;  3DQV A;  2KFK A;  4G11 A;  4IUM B;  2FCM A;  2NBU A;  1C1Y B;  2KLC A;  4IWO A;  1TZ1 A;  3VVW B;  2JT4 B;  3JSV A;  1XD3 B;  1RRB A;  4KZC A;  2A5U A;  4NPN A;  2DZJ A;  3D32 A;  2N9P C;  3PLU A;  3PRZ A;  1RFA A;  5DCN A;  4HJK A;  4MEL A;  2HJ8 A;  2DZK A;  2ZJD A;  3NZU A;  3QX1 A;  2K8H A;  2D07 B;  2RR9 A;  1ZW7 A;  2MA9 B;  3QJZ A;  3N3K B;  4HXD A;  3IBE A;  1WGY A;  3DPD A;  1SGH A;  2ZVO A;  3DVG X;  3ECI A;  2DYB A;  1Z2M A;  2N1W A;  5C23 A;  4P7I A;  2J0M A;  3APF A;  3UIP B;  1VD2 A;  2M8S A;  4MJS B;  1S3S G;  4RM8 A;  5DPW A;  2AL3 A;  1ISN A;  4ANU A;  2JRH A;  1WM2 A;  2NVU I;  3H7P B;  3IHP C;  3KH0 A;  3B0A A;  1SE9 A;  4FAD A;  4FLH A;  4K81 A;  4AJW A;  4M8N A;  3V6E B;  4NAW B;  2ZVN A;  4JQW C;  4PS3 A;  4W9E A;  2KTR B;  2PJH A;  2KMA A;  3ZLZ A;  5E6O A;  2DYM A;  4ICU A;  4J6I A;  3APC A;  3A4S C;  3NY5 A;  4FN2 A;  4W9H A;  2ASQ A;  5E6N A;  4ZRI A;  2MP2 A;  3ZO5 B;  1M94 A;  5CTR C;  1R4M I;  3B08 A;  1WYW B;  1ZGU B;  3U7D A;  4DXA B;  1H8C A;  4NQK E;  3AXC A;  1UH6 A;  2MQJ A;  4KSK C;  4WAA A;  4ZRJ A;  1E8X A;  1GC6 A;  1WZ0 A;  3R3M A;  4K1R B;  4B6W A;  1JRU A;  1YJ1 A;  2IO3 B;  3GOE A;  1EO6 A;  1WJ6 A;  1WRD B;  3N30 A;  3RT3 B;  4CYE A;  1J0G A;  2IZV B;  2WX1 A;  1WJU A;  3PHX B;  2XEW A;  3ZNZ B;  4G0N B;  1R4N I;  1TTN A;  1Z5S B;  2KJR A;  3ZTD A;  4BKT A;  4MJS A;  4NJ6 A;  3AUL A;  2PPH A;  4KDL B;  3O65 B;  4W9G A;  4LJP B;  1IP9 A;  5LLI A;  2KC2 A;  4LCD E;  3H7P A;  2MWS B;  1UBI A;  3WA0 A;  2KLG A;  2BGF A;  2M0X A;  3V61 A;  2FUH B;  2K6D B;  5G55 A;  3V6C B;  2LVO A;  4NAW A;  3ZRC A;  1F9J A;  2NBW B;  1IPG A;  3IG3 A;  3RYT A;  2KTR A;  3DCG A;  3RZW C;  3TCA A;  3WAL A;  2JPH A;  2I1K A;  4GN1 A;  1P1A A;  2BWE S;  4W9L A;  2D3G A;  2YLM A;  2KJH B;  2KO3 A;  4OVV A;  4WJO A;  4HPL B;  4BVU C;  1E7V A;  4GMV A;  4IG7 B;  3RUL A;  5JHB A;  3KW5 B;  2ZZP B;  4MGK E;  2KFK B;  4WQO B;  1YX6 B;  2C9W B;  2KQS A;  2L05 A;  4BKS D;  4RM9 A;  3UQB A;  1GC7 A;  2K8B A;  2LAS A;  2LVQ A;  3DVN V;  3QAQ A;  4EZK A;  3NOB A;  2LXC A;  4DHZ E;  4G50 A;  3ZDM C;  2HTH A;  3ZDT A;  4ICV A;  1NBF C;  2BKF A;  2KWC A;  5AZG A;  3MTN B;  2MLB A;  3AI5 A;  3R7Q A;  1L7Y A;  2AL6 A;  3QWZ B;  2G4S A;  4NQL B;  1WI0 A;  4BBN C;  4FA6 A;  3BIN A;  1WX7 A;  4CHK A;  1TGZ B;  3PT2 B;  1E8Y A;  1GUA B;  2XBB C;  2BYV E;  4E71 A;  2CHZ A;  1V81 A;  2DEN B;  2JWZ A;  3WAO A;  2WX0 A;  2ZEQ A;  1TBE A;  4AJY B;  3ML9 A;  3DBR I;  3PSE B;  3JVZ X;  4GXB A;  2IO1 B;  4EUT A;  4ZRK A;  3R66 C;  3Q3J A;  2JF5 A;  3AU5 A;  3QC8 B;  3PTF C;  3VTW A;  2N9X A;  2N9E B;  4AOF A;  5BO4 B;  3I3T B;  4DHZ B;  4II2 B;  3WAP A;  4BKG A;  4EKU A;  1U4A A;  3LJ3 A;  1WGD A;  1EUV B;  3ZVV A;  4TKN A;  3KYD D;  1WR6 E;  1YIW A;  2LUE A;  2L0F A;  4HDO A;  3WAM A;  2MP2 B;  3QA8 A;  3U8Z A;  4EZL A;  4IM2 A;  3PRE A;  2BKR B;  3QIJ A;  2IY1 B;  3DBL I;  4TQ1 A;  1WXA A;  3M3J A;  1I35 A;  3TMP B;  4HCP B;  4G3X B;  1UBQ A;  3JW0 X;  2FCQ A;  3DBS A;  4GB9 A;  3R7R A;  2MBE A;  4MDK E;  2ZPY A;  2JY6 A;  4KSL C;  2RD0 A;  1MG8 A;  2K25 A;  1WX8 A;  2J0J A;  3H1U A;  1C3T A;  2NBV B;  4PYZ A;  1V86 A;  1LFD A;  3EEC A;  2MBQ A;  2R2Q A;  3UIO B;  2ZCB A;  2KDI A;  2V1Y A;  2V4L A;  3W1Y A;  5IAA C;  4PS7 A;  1WGR A;  2KX0 A;  3SU8 X;  2V3S A;  4W9I A;  4YL8 A;  4DDI D;  5EDS A;  1WJ4 A;  4ASW C;  4DHJ B;  2C60 A;  1P98 A;  1V6E A;  1WM3 A;  2W9N A;  3A9K A;  2JRI B;  1P0R A;  1Y8R C;  2KTF A;  3BY4 B;  4AUQ C;  2Z0D B;  1XQQ A;  3RUI B;  3APD A;  2KHW B;  1OTR B;  2NR2 A;  4II3 B;  2L0T A;  5GMV A;  5D2M B;  4WWN A;  2AYO B;  4XZ4 A;  2O6V B;  4IWQ A;  2ZCC A;  3KUZ A;  2GOW A;  4KDI C;  2IY0 B;  2J0K A;  2MW5 A;  3PRP B;  4W9F A;  1WX9 A;  2NS5 A;  4IWP A;  2BF8 B;  2LJ5 A;  4KVG B;  5CX3 A;  4E74 A;  2KAN A;  2JZZ A;  1YX5 B;  2G3Q B;  3KUD B;  2CU1 A;  2RSU A;  2GBM A;  5KHO A;  2PEA A;  3IFW B;  2L3Z A;  3B1L X;  3V62 A;  1UZX B;  4LDT B;  2RGF A;  3DVG Y;  2A4Z A;  3ZTC A;  2CHX A;  3T9L A;  4M8M A;  4HPM B;  2CKH B;  2FCS A;  3RCZ A;  4F1S A;  4XX5 A;  2QHO A;  4JGH B;  4B9K A;  4MSM B;  4TQ0 A;  3ONS A;  2DZM A;  4JL9 A;  2MCN B;  3MHS D;  2LZ6 A;  4W9D A;  1V5T A;  4EFO A;  2EMT A;  1OGW A;  4EZJ A;  2MRP A;  3L17 A;  4GSW A;  3K9O B;  4AP4 C;  1VCB A;  4FJV B;  3KUC B;  5KHQ A;  4N9F 4;  4JIO U;  2O6V A;  5J2R A;  4WJN A;  4KV2 A;  4NNJ B;  1WH3 A;  2G45 B;  2REX A;  2DAJ A;  3N32 A;  3PZD A;  2PE6 B;  3M63 B;  2Z0E B;  2WWZ A;  2LI5 A;  3A4R A;  2GBN A;  4AWJ A;  3NHE B;  3PV1 A;  2BWF A;  5IA7 A;  2KN5 A;  1D3Z A;  1P3Q U;  3HHM A;  2CR5 A;  2D2Q A;  3V60 A;  4EOY A;  5JHA A;  2Z59 B;  3PVL A;  3SHQ A;  4A3O A;  2N4F A;  1WY8 A;  3ZIM A;  4WWP A;  4WJQ A;  1V9J A;  3OLM D;  3CSF A;  4EEW A;  1BT0 A;  1WFY A;  2GBR A;  2VRR B;  3K9P B;  4GDL B;  2KOX A;  3VH4 B;  2BYF A;  2GBJ A;  1NDD A;  3MJW A;  2JVC A;  1QZE A;  4MM3 A;  1L2N A;  2BPS A;  3L0W B;  3PGE A;  1V2Y A;  2NCN A;  3VUY A;  2IO2 B;  2LRW A;  3W1S C;  5HKH A;  1LQB A;  2KFJ A;  3H9D A;  2NPT B;  3JYU A;  4F8C B;  4BOZ B;  5DPT A;  3RZF A;  2KVR A;  1S1Q B;  1LM8 B;  2EKE C;  3HIZ A;  4FHJ A;  4ANV A;  3RD2 A;  1Q5W B;  4FUL A;  3A9K B;  1XT9 B;  4MH0 E;  2KQ7 A;  3U30 A;  1CMX B;  1V5O A;  4MSQ B;  4MGY E;  3ALB A;  1WE7 A;  3VUW A;  3DVN U;  2LXA A;  3TIX A;  1V49 A;  4F7Z A;  2C5L C;  4FHK A;  5AZF A;  3QQ8 B;  1E8W A;  3M62 B;  4ANX A;  2O2V B;  4HK2 A;  4FBJ B;  1G6J A;  1WXV A;  3QK0 A;  2AWT A;  2ZNV C;  3KYC D;  4FJY A;  3VAW A;  2K8C A;  3HM6 X;  2KXJ A;  3PS6 A;  1GJZ A;  4W9K A;  3L16 A;  3ZW3 A;  1EF1 A;  3HK0 A;  4MGI E;  1WIA A;  2D10 A;  4GDL A;  1WE6 A;  4MEM A;  3VFK A;  2M4N A;  4BOS C;  3HM3 A;  3VTU A;  3OAW A;  3WAN A;  4K7W A;  5J17 A;  5LXI B;  1WF9 A;  2XK5 B;  4GDK B;  3C0R B;  3A33 B;  4IC7 B;  2LGX A;  1YD8 U;  2C7M B;  1E90 A;  2KJ6 A;  2NPT A;  1J8C A;  1V80 A;  2K6Q A;  1J19 A;  1PQS A;  1UEL A;  1HE8 A;  4LJO B;  4NY0 A;  4B95 A;  3H7S A;  3A9J B;  3QHT A;  3NZS A;  3AU4 A;  1FXT B;  2DX5 B;  2KDF B;  2KX3 A;  4MGZ E;  3TJP A;  2LGY A;  3PRM B;  1Q1O A;  3ML8 A;  4I6N B;  2C7H A;  3PPA A;  3L13 A;  4RMA A;  5E6P A;  4ZDV A;  3L08 A;  4IM3 A;  2LWP A;  1GG3 A;  1X1M A;  2M17 A;  5D94 A;  2JXX A;  4TUU A;  3X0W A;  4HVB A;  2D11 A;  4HDQ A;  2FNJ B;  1WMH B;  2AEH A;  3OJ3 A;  1LXD A;  2N1V A;  2FAZ A;  2IYD B;  3CF6 E;  4XC2 A;  3EFU A;  4PS8 A;  2O2V A;  3ENE A;  3Q3F A;  2KD0 A;  3IVF A;  3P2B A;  1SIF A;  1YQB A;  5AZH A;  1NI2 A;  3OJ4 B;  4JLC A;  2LRU A;  4PYU A;  3QAR A;  2FID A;  2R2O A;  5CHF A;  2KNB A;  3ZNI D;  3EHV A;  4HCN B;  2PE9 A;  3UIN B;  2K39 A;  2DHZ A;  2HE7 A;  1OEY J;  2XK5 A;  4GDK A;  2MSE D;  3ZNH B;  4I6P A;  2DYO A;  2EMS A;  3ZKJ C;  3VXW A;  2BYE A;  3X23 A;  1EF5 A;  2ZNV B;  2DAF A;  2JUO A;  3A9J A;  3H6N A;  4IM0 A;  4A3P A;  2MBH A;  3VHT C;  4HLE A;  4ZYN A;  4A20 A;  4DDG D;  5CHV C;  2OOB B;  2WYQ A;  1P9D U;  1OEY A;  4W9J A;  2KKC A;  3CMM B;  1KJT A;  3L54 A;  3VQI A;  5G2N A;  5D7G A;  2MX2 A;  5D6J B;  4W9C A;  2UYZ B;  3QCA A;  2LGD A;  2DZI A;  3NS8 A;  3TBL D;  1T0Y A;  3VDZ A;  3W1S A;  4CO7 A;  2FCN A;  5L83 A;  4BFR A;  1WMH A;  3ZRF A;  4DBG A;  4DHJ D;  3SDL C;  2G4D B;  2GMI C;  3UF8 A;  1H4R A;  2KMC A;  5CHW A;  2ZPN A;  1IYF A;  2L76 A;  4M0W B;  3DBH I; 
#chains in the Genus database with same CATH topology
 5G5G A;  2MBO A;  2B3A A;  1HTQ A;  1EU4 A;  1KLV A;  1L0V B;  1ZKH A;  3A1Q B;  4X57 B;  4YTN B;  2KK8 A;  5MPO A;  1AAR A;  2KC1 A;  4DK5 A;  4L23 A;  2JZ3 B;  4TV3 A;  2LD9 A;  2N7D A;  4KKI A;  1K51 A;  3M95 A;  1WGG A;  4LDT D;  1GAQ B;  5LXH A;  3BVZ A;  3SD5 A;  4K7S A;  2JXT A;  1F52 A;  2IBI B;  2KDB A;  2OJR A;  4XGA B;  2AQ1 B;  3NVZ A;  1E7P B;  1C77 A;  5C1Z A;  1QOF A;  4XWT A;  4OZB A;  2YEP F;  4GGQ A;  1A5R A;  4ANW A;  1J7B A;  2UWQ A;  3DDC B;  3AEB B;  1KOT A;  4K7U A;  2ONQ A;  3DQV A;  2R61 A;  4IUM B;  3RI7 C;  3ZXR A;  1N60 A;  1XD3 B;  4NPN A;  2DZJ A;  4HJK A;  2N0S B;  1C79 A;  3TEY A;  4R3D A;  2BTE A;  2RR9 A;  1YJJ A;  1KRH A;  3AH7 A;  2DYB A;  1QIL A;  3DHH C;  2J0M A;  1F2R C;  2HJ1 A;  3FC4 A;  3RFZ B;  2AL3 A;  1ISN A;  2JRH A;  1B9R A;  1WXQ A;  3H7P B;  1BUI C;  3KH0 A;  1TS3 A;  2Y5C A;  4RF0 A;  2K9X A;  4K81 A;  4M8N A;  4NAW B;  2ZVN A;  1I4H A;  2D3B A;  1MPE A;  2KMA A;  2DYM A;  3Q8A A;  4JX1 C;  1I4G A;  3NY5 A;  4ZRI A;  2MP2 A;  1TIF A;  3ZO5 B;  3ETR A;  1R4M I;  2GLS A;  2JZP A;  1FEH A;  4ZRP A;  1UH6 A;  3KWL A;  2MQJ A;  4WAA A;  3HUI A;  1E8X A;  1GC6 A;  1WZ0 A;  3Q3M C;  2K3U A;  3R3M A;  4YSZ B;  2KAJ A;  4WIP A;  1WJ6 A;  3RT3 B;  2IZV B;  2WX1 A;  2KJR A;  4KGT A;  3AN1 A;  4BKT A;  4MJS A;  4RGN A;  2PPH A;  4KDL B;  5E6J A;  1IP9 A;  2M0A A;  4LJP B;  5LLI A;  2KC2 A;  4RH6 A;  2BGF A;  3R8B A;  3V61 A;  5G55 A;  3W5V B;  1FXI A;  2EKI A;  3ZRC A;  2VH1 A;  1F9J A;  2H88 B;  1SEB D;  3EFC A;  1DGJ A;  3DCG A;  2PVG C;  3ABV B;  1QQR A;  3U2S C;  2D3G A;  2ACZ B;  2KJH B;  4OVV A;  1SIJ A;  4RGM A;  3RUL A;  3P42 A;  3KW5 B;  4MGK E;  2C9W B;  4BKS D;  1RM6 C;  2LVQ A;  4LLG M;  5H8Y E;  3AE3 B;  4M0W B;  2HTH A;  2FE8 A;  5FKA C;  2WXM A;  4HPP A;  2V3P A;  1L7Y A;  4NQL B;  1WI0 A;  1ZXH A;  4FA6 A;  1TGZ B;  3RNE C;  4JPS A;  1I4R A;  2CHZ A;  1FD6 A;  1IBX A;  1TBE A;  2D3A A;  3DBR I;  3N1Z C;  3BII D;  3AU5 A;  5HG2 A;  3QC8 B;  3VTW A;  3C19 A;  5BO4 B;  4II2 B;  1VZ6 A;  3WAP A;  4BKG A;  2CJO A;  2TSS A;  1IGD A;  4TKN A;  5BYQ A;  2LUE A;  1Y56 A;  2MP2 B;  3Q14 C;  3AEE B;  2WXK A;  1RFK A;  2PTL A;  4HCP B;  4G3X B;  2FCQ A;  4GB9 A;  4AQ7 A;  1ENF A;  2JY6 A;  4PYZ A;  2R2Q A;  1EWC A;  2V1Y A;  3W1Y A;  5IAA C;  3RNB C;  5EE9 A;  3ZGZ A;  1R7S A;  4MAC A;  4ASW C;  2YEP B;  1QKZ A;  2V4I B;  4AUQ C;  5TSS A;  1WYG A;  1GOZ A;  1OTR B;  2NR2 A;  1DYQ A;  2L0T A;  4WWN A;  4PK1 A;  4OHJ A;  2ZCC A;  2GOW A;  1XEE A;  1NVI D;  2WU5 B;  2JYE A;  3AE5 B;  1WX9 A;  1XLN A;  1V8C A;  1I4X A;  2KAN A;  2JZZ A;  1YX5 B;  4ARI A;  3IFW B;  2WS3 B;  2L3Z A;  3V62 A;  4LDT B;  2EEL A;  4M8M A;  1EM7 A;  1JRP A;  2QHO A;  3BK1 A;  2EMT A;  2MRP A;  3C8Y A;  1VCB A;  4FJV B;  3KUC B;  3RNA C;  5KHQ A;  4DQO C;  4ITK A;  1WH3 A;  1QLB B;  3N32 A;  4HEA 1;  1JQ4 A;  2LFI A;  2I38 A;  3LXF A;  4GLS C;  1KF6 B;  2VZK D;  1P3Q U;  3V60 A;  2CR5 A;  5JHA A;  2CU3 A;  4LNI A;  4DXF A;  2Z59 B;  2WXN A;  1IUE A;  1TY2 A;  3AEG B;  1SE3 A;  1WY8 A;  1NYQ A;  3OLM D;  4EE2 A;  4EEW A;  1BT0 A;  3DBH B;  2VRR B;  2BYF A;  1F0Z A;  4MM3 A;  2BPS A;  1CQV A;  3PGE A;  2NCN A;  3VUY A;  2LRW A;  1A70 A;  3JYU A;  4BOZ B;  5DPT A;  1S1Q B;  3HIZ A;  1N6Z A;  2EKE C;  3RD2 A;  1HA5 A;  1VJK A;  1XT9 B;  1CMX B;  4MSQ B;  4MGY E;  3ALB A;  1PGB A;  4AS1 A;  3N1X C;  4RF1 A;  4F7Z A;  2C5L C;  3MP9 A;  2O2V B;  3KQ4 A;  1L6V A;  1WXV A;  3QK0 A;  2K8C A;  3HM6 X;  3PS6 A;  1J7C A;  1SSN A;  1AW7 A;  4GDL A;  1WE6 A;  3OAW A;  5J17 A;  1WF9 A;  4GDK B;  2LGX A;  4NY0 A;  3H7S A;  2WXO A;  3NG0 A;  2SAK A;  4MGZ E;  3KWV A;  3PRM B;  5BMH A;  4LNF A;  4H2A A;  3W5U B;  1TKG A;  3L08 A;  4ZDV A;  4IM3 A;  1XF5 L;  3X0W A;  4OW0 A;  4HDQ A;  2FNJ B;  3N20 C;  4PS8 A;  3IVF A;  3E9S A;  1YQB A;  1NEK B;  1NI2 A;  3OJ4 B;  3MJ5 A;  3AE8 B;  1VZ8 A;  3QAR A;  2R2O A;  3EHV A;  4HCN B;  1XLP A;  2PE9 A;  3UIN B;  2FUG 1;  2K39 A;  2XK5 A;  4RFB A;  1MFW A;  1AYF A;  2ON8 A;  3TSS A;  2BS2 B;  1FIQ A;  4BZA A;  2MBH A;  4HLE A;  4DDG D;  2OOB B;  1OEY A;  1KJT A;  3EUB 2;  5D7G A;  5D6J B;  3TBL D;  2LGD A;  4DBG A;  4DHJ D;  1MI0 A;  1E10 A;  2JSV X;  1JWU D;  1IYF A;  4YSY B;  4CQN A;  2MH7 A;  2KWU B;  1N5W A;  1WZ3 A;  3NVY A;  2L8J A;  1RAX A;  3ZUN A;  2BS3 B;  3S2A A;  5JH5 C;  3KVF B;  2KWV B;  3H8H A;  1WXM A;  2BVC A;  3UI3 A;  1FMA D;  1LGR A;  2IO0 B;  3JSV B;  4NJ7 A;  1KM7 A;  2LVP A;  1RLF A;  1YJI A;  3P63 A;  2JWU A;  3SEB A;  4JWS C;  3TL5 A;  1RYJ A;  1EWY C;  4GIV A;  2E6X A;  3T3N A;  5HI1 A;  1I42 A;  3GZN I;  1UGM A;  2W55 A;  2GI9 A;  2ICI A;  5FK9 C;  1ZUD 2;  3PLV A;  4REZ A;  4M0W A;  4URK A;  4GU2 A;  4XE0 A;  2L7R A;  3L10 B;  2M1M A;  3VRB B;  2J52 A;  2BBC A;  3A1Q A;  3N1Y C;  1WR1 A;  3VH3 B;  4G11 A;  2NBU A;  2KLC A;  3EA6 A;  4IWO A;  2QC8 A;  1TZ1 A;  2A5U A;  2KVZ A;  2M56 B;  2N9P C;  3PLU A;  5DCN A;  1RFA A;  2QMT A;  3HRD D;  4MEL A;  2K22 A;  1T5X D;  4US8 A;  2KAC A;  3N3K B;  3IBE A;  1WGY A;  3DPD A;  4RGO S;  1PDX A;  1E9M A;  2QIE B;  1VD2 A;  4L1B A;  2NVU I;  4NZL B;  3B0A A;  1SE9 A;  2V0G A;  1ZOY B;  4PS3 A;  2AQ3 B;  3AE9 B;  5E6O A;  4J6I A;  3A4S C;  4W9H A;  4FN2 A;  1QOG A;  3B08 A;  4DXA B;  4ZHP A;  1E0Z A;  4NQK E;  1HEZ E;  3AXC A;  4KSK C;  1JRU A;  2IO3 B;  1BML C;  1LO5 D;  1D5M C;  4G0N B;  1Z5S B;  2WXF A;  3ZTD A;  2QSD A;  1PYW D;  4W9G A;  1I4Q A;  4LCD E;  3H7P A;  1GB1 A;  1UBI A;  1YN4 A;  3NRZ A;  2FUH B;  2K6D B;  4NAW A;  2OJW A;  3IAS 1;  3WAL A;  3RZW C;  5L95 C;  1YQ3 B;  3TCA A;  2I1K A;  1N61 A;  4WJO A;  1DOX A;  5JHB A;  1E7V A;  4IG7 B;  1FRR A;  3AE1 B;  2BT6 A;  1E6E B;  2GRI A;  3UQB A;  2K8B A;  3DVN V;  1K50 A;  4P6V F;  1YNT E;  2BKF A;  5AZG A;  2INC C;  2AL6 A;  2G4S A;  4BBN C;  1V1P B;  3CWI A;  1WX7 A;  3PT2 B;  1GUA B;  1XCT L;  1ZPS A;  4ARC A;  2BYV E;  3TUO A;  2WXQ A;  3BWU D;  2K0P A;  3ML9 A;  3PSE B;  3JVZ X;  2IO1 B;  1P7E A;  4Q2J A;  4EUT A;  4ZRK A;  4HKQ A;  3R66 C;  2HDE A;  2JF5 A;  2WQY B;  2DWQ A;  4L2Y A;  4AOF A;  3I3T B;  4DHZ B;  4EKU A;  4N6E B;  4ZRQ A;  1EUV B;  2QJL A;  4KGS A;  4A90 A;  1YIW A;  4HDO A;  2L0F A;  3WAM A;  3U8Z A;  1FNU A;  2D3C A;  4EZL A;  2BKR B;  2IY1 B;  3M3J A;  1UBQ A;  3JW0 X;  3R7R A;  2MBE A;  1JWB D;  4KSL C;  3H1U A;  1V86 A;  1F1H A;  3EEC A;  4PS7 A;  3B9J A;  1WGR A;  2WXL A;  2KX0 A;  1T0Q C;  4YL8 A;  4YTM B;  2INP E;  5EDS A;  3W2D A;  1FO4 A;  4DHJ B;  1P98 A;  1WM3 A;  3U4E G;  2JRI B;  1P0R A;  1N62 A;  2KTF A;  2Z0D B;  2KHW B;  4DXG A;  3MFG A;  4KDI C;  4YT0 B;  2RMM A;  2WXI A;  4W9F A;  1WWT A;  2BF8 B;  2LJ5 A;  2DBY A;  4TSS A;  2KYW A;  2CU1 A;  2RSU A;  5KHO A;  2DNF A;  3HVZ A;  1AWD A;  1YQ4 B;  3ZTC A;  1C9F A;  2WDV B;  3IT4 B;  2CKH B;  1RWS A;  4TMA B;  2V3N A;  4JGH B;  2LEK A;  5LNK 1;  3RN9 C;  2MCN B;  3MHS D;  1VLB A;  1V5T A;  4GSW A;  1I4P A;  4N9F 4;  4WAF A;  5BMG A;  3NJT A;  1QOA A;  4KV2 A;  1ESF A;  2G45 B;  5EE0 A;  2DAJ A;  2NMQ A;  3PZD A;  2WWZ A;  2GBN A;  3Q8E A;  2BWF A;  5IA7 A;  3P4R B;  3N9Y C;  2D2Q A;  4A3O A;  2RDG A;  1ACC A;  1V9J A;  1KLU D;  2BB5 A;  3I5J C;  4P16 A;  1UUP A;  1MJD A;  3VH4 B;  4OVZ A;  3P4Q B;  2JVC A;  1FRD A;  3VR9 B;  2WXJ A;  4JWU C;  3Q2A C;  2KFJ A;  2NPT B;  4ZYS A;  4ANV A;  1FNV A;  1SE4 A;  1V5O A;  2KMM A;  2LXA A;  2QCZ A;  3NVV A;  5AZF A;  3AEA B;  1VRA B;  3M62 B;  4ANX A;  4RCO A;  4ZHO A;  1EU3 A;  2AWT A;  2ZNV C;  4FJY A;  4USA A;  1UWM A;  3ZW3 A;  1EF1 A;  3HK0 A;  4MGI E;  3E56 A;  4MEM A;  2M4N A;  2IDY A;  3DBR B;  1FXA A;  3AEC B;  1T0R C;  1D4B A;  3C0R B;  3A33 B;  4IC7 B;  1C78 A;  1L4Z B;  2C7M B;  5JXV A;  2KJ6 A;  1J8C A;  2K6Q A;  1PQS A;  2J42 A;  4LJO B;  3A9J B;  3QHT A;  2BB6 A;  3NZS A;  2KDF B;  2KX3 A;  2N9K A;  3TJP A;  2LGI A;  4I6N B;  4RMA A;  1C4A A;  3GE8 C;  3ZJT A;  2LWP A;  2RPV A;  4TUU A;  3RYT A;  3OJ3 A;  2AEH A;  2FAZ A;  2IYD B;  2O2V A;  1OQQ A;  3T3O A;  5AZH A;  2W3S A;  2FID A;  4FXC A;  3AE4 B;  1D6E C;  4GDK A;  3ZNH B;  4S17 A;  4I6P A;  2EMS A;  3X23 A;  1EF5 A;  4XWW A;  2JUO A;  4A3P A;  3AE7 B;  2WHI A;  3VQI A;  5C2T B;  2MX2 A;  2UYZ B;  3NS8 A;  5L83 A;  3W1S A;  4LTU A;  3FKY A;  4P1C C;  2I2Y A;  1WGK A;  3DBH I;  1FPY A;  3P1M A;  2N7E A;  2O6V D;  4BKS A;  3DOW A;  5DPS A;  1E7U A;  2GBK A;  3DWG C;  2QDF A;  5FR6 A;  1NYR A;  1K8R B;  1FNW A;  2KDE B;  4KIK B;  1WJN A;  4WJP A;  1WXS A;  4WH4 A;  3KLS X;  2HD5 B;  2I1J A;  1ET6 A;  1E8Z A;  4HWI B;  5IO9 A;  5JZE B;  4DWF A;  2SEB D;  1B1Z A;  3LDZ E;  4FJZ A;  1VDV A;  2C7N B;  2E3T A;  4HRO A;  3CST A;  3RNG C;  1E5W A;  1CK1 A;  2CS4 A;  3ZNG C;  2WDT B;  1TS5 A;  1PUT A;  4OVU A;  4BBN F;  1JRO A;  2RPQ A;  2MBB B;  3FIL B;  3VUX A;  3WIM A;  4E3C A;  3ZJV A;  4A6Q A;  4YSX B;  2FIF A;  4IW0 A;  5DPR A;  3RPF C;  2FCM A;  5AUK A;  1JAL A;  2G9H D;  2LUM A;  3JSV A;  3L4P A;  3D32 A;  3PRZ A;  2HJ8 A;  2X38 A;  2ZJD A;  3NZU A;  3ZYY X;  4C00 A;  1ZW7 A;  1C4C A;  1UGJ A;  3FAH A;  1SGH A;  2ZVO A;  1TS4 A;  1JWS D;  1Z2M A;  2N1W A;  2WXG A;  3Q69 A;  1ET9 A;  3APF A;  3UIP B;  1L0Y B;  3DBL B;  1S3S G;  4ANU A;  4B0M A;  2PKO A;  3IHP C;  2ZW0 A;  3TEX A;  4FAD A;  2RDB C;  3J9C A;  2L1A A;  1C76 A;  3V6E B;  3AED B;  4J3O D;  2KTR B;  4M01 A;  3MC8 A;  3ZLZ A;  3VRA B;  2ASQ A;  1M94 A;  5CTR C;  2OHF A;  1H8C A;  1WYW B;  4IKG A;  4C56 C;  4K1R B;  1YJ1 A;  5T8I A;  1IGC A;  3GOE A;  1EO6 A;  1WRD B;  4CYE A;  4S0R A;  3ZNZ B;  2XEW A;  4KX6 B;  1R4N I;  4A9A A;  4NJ6 A;  3AUL A;  2MWS B;  3WA0 A;  2MEK A;  1JW9 D;  4GN1 A;  1P1A A;  2BWE S;  2INN E;  2CJN A;  2KO3 A;  4BVU C;  4HPL B;  4GMV A;  1PGX A;  1MHX A;  1ROE A;  1YX6 B;  4WQO B;  2KQS A;  2L05 A;  1GC7 A;  2LAS A;  4LK0 M;  3NOB A;  2LXC A;  4DHZ E;  4G50 A;  2KN4 A;  3ZDM C;  3ZDT A;  4ICV A;  3GP7 A;  1NBF C;  2KWC A;  3MTN B;  2MLB A;  3AI5 A;  4K3B A;  3QWZ B;  1KH0 A;  4ACF A;  3B2G A;  3BIN A;  4CHK A;  1E8Y A;  4E71 A;  2JX5 A;  1V81 A;  2DEN B;  2WXR A;  2WX0 A;  1ZXI A;  2ZEQ A;  4AJY B;  4GXB A;  5HFY A;  3Q3J A;  1UWX A;  2LMC A;  3NS1 A;  2N9X A;  4XYC A;  3GB1 A;  3LJ3 A;  1WGD A;  4IDI A;  3ZVV A;  2V9H A;  3KYD D;  4LNN A;  1V97 A;  4UDU C;  4P1B C;  1T3Q A;  3QA8 A;  4IM2 A;  3QIJ A;  3TMP B;  1V1P A;  2ZPY A;  5IKC M;  2RD0 A;  1MG8 A;  2K25 A;  2J0J A;  2L83 A;  2NBV B;  1LFD A;  1CZP A;  2MBQ A;  4ZOH C;  3UIO B;  2KDI A;  2V4L A;  4B0E A;  3SU8 X;  4DDI D;  4W9I A;  2ZW1 A;  3BYT B;  1V6E A;  3IXS A;  2W9N A;  3BY4 B;  2IGG A;  5GMV A;  5D2M B;  1NI3 A;  2AYO B;  4XZ4 A;  2O6V B;  1KFY B;  2WNM A;  4IWQ A;  3KUZ A;  2PLP A;  2IY0 B;  2J0K A;  2MW5 A;  3PRP B;  1JWM D;  3BYY B;  1PFD A;  4A55 A;  1HZ6 A;  2NS5 A;  1N5X A;  4MT5 A;  2G3Q B;  3Q8B A;  2Y3A A;  3HVD A;  3SFD B;  2PEA A;  4C7Z A;  1UZX B;  1F2R I;  2RGF A;  1SB3 C;  2CHX A;  3P4S B;  2FCS A;  4XX5 A;  4B9K A;  4PT5 A;  2JQR B;  4TQ0 A;  3ONS A;  2DZM A;  4W9D A;  1OGW A;  3L17 A;  3K9O B;  4JIO U;  1SBB B;  5J2R A;  4WJN A;  3R2T A;  2LHE A;  4HKZ E;  2QIL A;  1K53 A;  2GB1 A;  2PE6 B;  2LI5 A;  3RMK C;  3A4R A;  4AWJ A;  1NEN B;  3PV1 A;  5D3D A;  4C4V B;  1FFU A;  2KN5 A;  4IOI E;  2LHD A;  4EOY A;  3PVL A;  3SHQ A;  1XLO A;  2N4F A;  2M19 A;  3ZIM A;  1KTK A;  3CSF A;  1WFY A;  3K9P B;  4WUR A;  2MJD A;  2KOX A;  1VZ7 A;  2W3R A;  1NDD A;  4K3C A;  1L2N A;  2IJ0 A;  3L0W B;  1ZE3 D;  2IO2 B;  3P4P B;  5HKH A;  5IN7 A;  3H9D A;  5EE3 A;  1M4V A;  1LM8 B;  1HZ5 A;  3V05 A;  1MVK A;  1T6B X;  4MH0 E;  2KQ7 A;  3U30 A;  1WE7 A;  3VR8 B;  3VUW A;  3AEF B;  1L4D B;  3MHZ A;  3TIX A;  1V49 A;  3NZ3 A;  3IT6 B;  3QQ8 B;  1E8W A;  3TEW A;  3AMZ A;  2K5P A;  2PIA A;  2W54 A;  3RNC C;  3KYC D;  2KXJ A;  1GJZ A;  4A8X C;  3L16 A;  2N9L A;  3VTU A;  4K7W A;  2BS4 B;  1E90 A;  2NPT A;  1V80 A;  1UEL A;  5EE1 A;  3MC0 B;  4B95 A;  1V1O A;  4WWM A;  3AU4 A;  1FXT B;  3ML8 A;  3L13 A;  2M17 A;  5D94 A;  2JXX A;  4HVB A;  3MC9 A;  2D11 A;  1WMH B;  2N1V A;  3NUH B;  2KD0 A;  2N7J A;  1SIF A;  2G1E A;  4LNO A;  3ZXV A;  2LRU A;  4PYU A;  2KQ4 X;  5CHF A;  2KNB A;  2WLB A;  2H89 B;  1OEY J;  1MHH E;  2MSE D;  2IGH A;  2W82 A;  2DYO A;  2RDH A;  3ZKJ C;  2BYE A;  3OWE B;  2ZNV B;  1T0S C;  3H6N A;  3A9J A;  4IM0 A;  3VHT C;  3BK2 A;  1YN5 A;  2WYQ A;  4US9 A;  4W9J A;  2KKC A;  3CMM B;  1HQR D;  1R4M B;  3QCA A;  1T0Y A;  1XO3 A;  4HJG E;  2FCN A;  3SDL C;  2G4D B;  4BAX A;  3UF8 A;  2KMC A;  5CHW A;  2XN9 C;  3V3X A;  1J7A A;  4KZ0 A;  2Y5B B;  1GNU A;  2K1F A;  2WDR B;  1UD7 A;  4NJC A;  3PHW B;  1OQY A;  4WWO A;  4C80 A;  5I4D A;  3T8M A;  2YVC A;  1JML A;  2L00 B;  4I6L B;  1L0X B;  1PGA A;  2J4X A;  5AEK B;  2NTS A;  1ZDX A;  3TEZ A;  3EC8 A;  2CHW A;  5AUI A;  5TR5 A;  2J53 A;  2IGD A;  3UQA A;  1SJE D;  5J18 A;  1WGH A;  1L6U A;  4GOC A;  2OED A;  3UGB B;  2J7Q B;  3Q3N C;  1DOY A;  3VTV A;  1Q10 A;  4KIK A;  1Q0W B;  2KZR A;  2KFK A;  3O13 A;  1C1Y B;  3VVW B;  2JT4 B;  1RRB A;  4KZC A;  2PW9 A;  2WXP A;  2DZK A;  3PO0 A;  3QX1 A;  2K8H A;  2D07 B;  2MA9 B;  3QJZ A;  4HXD A;  2JYT A;  3Q3O C;  3DVG X;  3ECI A;  5C23 A;  1D5X C;  4P7I A;  1TKY A;  3U7Z A;  3BVM A;  3GS2 A;  3PZ7 A;  2M8S A;  4MJS B;  4RM8 A;  5DPW A;  2QEJ C;  1WM2 A;  3FIL A;  5D3I B;  3LYY A;  4FLH A;  4AJW A;  1SXT A;  4JQW C;  4W9E A;  2PJH A;  1YOV B;  4ICU A;  4QAY A;  3APC A;  5E6N A;  1N63 A;  3U7D A;  1ZGU B;  4ZRJ A;  5C3J B;  4B6W A;  1AN8 A;  2WP9 B;  3N30 A;  1BXT A;  1J0G A;  3Q8C A;  1SE2 A;  1WJU A;  3PHX B;  2XNA C;  1TTN A;  4OZC A;  3I9V 1;  2BW2 A;  3U52 E;  3I63 C;  4N59 A;  3O65 B;  1WRI A;  2KLG A;  5HHD G;  2L32 A;  2M0X A;  3B2F A;  3V6C B;  1P7F A;  2LVO A;  5GXG B;  1IBX B;  2NBW B;  1IPG A;  3IG3 A;  2KTR A;  2JPH A;  1TYG B;  4W9L A;  2YLM A;  3NVW A;  2UU7 A;  1UF0 A;  2ZZP B;  5BMI A;  4WQM A;  2KFK B;  2WGS A;  3Q6B A;  4RM9 A;  1TKE A;  5BYS A;  1D5Z C;  3QAQ A;  3SR6 A;  4EZK A;  2MJE A;  1YN3 A;  1FCL A;  1F77 A;  4O1N A;  3R2I A;  3R7Q A;  1ZP0 B;  1QF6 A;  1OFF A;  2XBB C;  3PZ8 A;  2JWZ A;  3WAO A;  3URY A;  4LNK A;  2B76 B;  3DHI C;  5IP4 D;  1TJE A;  1OQR A;  4RNA A;  3Q8F A;  3PTF C;  2IND C;  2N9E B;  1QT9 A;  3RNF C;  1U4A A;  1XLQ A;  1WR6 E;  5IOI A;  2KDM A;  1GPX A;  3PRE A;  3IAM 1;  3DBL I;  4TQ1 A;  2WU2 B;  1STE A;  1WXA A;  1I35 A;  3DBS A;  4MDK E;  1WX8 A;  2Q5W D;  1C3T A;  1JCK B;  1HXY D;  3DWM A;  3EGR A;  2ZCB A;  2HTM E;  2V3S A;  3W9C B;  3GE3 C;  1WJ4 A;  3LB8 C;  2C60 A;  2PMV A;  3A9K A;  1Y8R C;  1C4P A;  1XQQ A;  3RUI B;  3APD A;  4II3 B;  3AE2 B;  3AM9 A;  3ZQ4 A;  4YTP B;  1FCC C;  2FBW B;  4IWP A;  4KVG B;  5CX3 A;  4E74 A;  3I57 A;  3KUD B;  2KWD A;  2GBM A;  3BVG A;  3B1L X;  4M02 A;  3DVG Y;  2A4Z A;  3T9L A;  2KT7 A;  2MHJ A;  1JWA D;  4HPM B;  3RCZ A;  4F1S A;  2NTT A;  3AB5 A;  1CJE A;  5H92 C;  4MSM B;  4MM3 B;  4JL9 A;  2LZ6 A;  4EFO A;  4EZJ A;  2JU6 X;  2AX5 A;  4OZA A;  4AP4 C;  1XCQ L;  1SF0 A;  4M00 A;  2O6V A;  2PVO D;  2DLB A;  4NNJ B;  2VH2 A;  2REX A;  3CIR B;  3M63 B;  4YWG G;  2Z0E B;  4XDC A;  1DOI A;  1R4N B;  3NHE B;  1D3Z A;  3HHM A;  4NAM A;  4WWP A;  4WJQ A;  4KKJ A;  2GBR A;  2D5G A;  2X8X X;  4GDL B;  3DHG C;  2GBJ A;  3MJW A;  3AE6 B;  1QZE A;  1WSP A;  1GB4 A;  4N58 A;  1V2Y A;  3W1S C;  1LQB A;  1ZDV A;  4F8C B;  4RGT A;  4HRS A;  3RZF A;  3BZD B;  2KVR A;  4FHJ A;  1Q5W B;  4FUL A;  3A9K B;  5G5H A;  2MJ3 A;  3DVN U;  5FR3 A;  1VR9 A;  4FHK A;  4C4V A;  1L5P A;  1TY0 A;  4C7Y A;  4HK2 A;  3GZN B;  4FBJ B;  1KLG D;  1G6J A;  3VAW A;  4W9K A;  1YMH E;  2L52 A;  2AQ2 B;  1MG4 A;  1FM0 D;  1WIA A;  2D10 A;  3VFK A;  4BOS C;  3HM3 A;  2LGS A;  1TZO A;  3WAN A;  5LXI B;  1HTO A;  1XXG A;  1I7H A;  1UNS A;  2XK5 B;  1YD8 U;  1J19 A;  1HE8 A;  3AV8 A;  1QOB A;  4D2K A;  2WDQ B;  2DX5 B;  2LGY A;  1SJH D;  1Q1O A;  2C7H A;  3PPA A;  1TT5 B;  5E6P A;  4JE3 B;  1GG3 A;  1X1M A;  4XC2 A;  2IPK D;  1LXD A;  2BYT A;  3CF6 E;  3EFU A;  3Q3F A;  3ENE A;  3OG5 A;  3P2B A;  4XDD A;  4JLC A;  3ZNI D;  1K52 A;  2DHZ A;  2HE7 A;  2VZK B;  1FFV A;  2BQQ A;  3ZJU A;  3VXW A;  2DAF A;  3WCQ A;  3SFE B;  4MH8 A;  2Y5P A;  5BYR A;  4ZYN A;  4A20 A;  5CHV C;  1P9D U;  3L54 A;  5G2N A;  1TS2 A;  4W9C A;  4KGR A;  2DZI A;  3VDZ A;  4CO7 A;  2LJI A;  1WMH A;  3ZRF A;  4BFR A;  2GMI C;  1H4R A;  2ZPN A;  4YXD B;  2L76 A;  2Z8L A;  2WXH A; 
#chains in the Genus database with same CATH homology
 2N7E A;  2O6V D;  4BKS A;  2MBO A;  4KZ0 A;  2Y5B B;  2KWU B;  3DOW A;  5DPS A;  1GNU A;  1E7U A;  1WZ3 A;  2GBK A;  2B3A A;  2K1F A;  2L8J A;  1RAX A;  3ZUN A;  5FR6 A;  3S2A A;  5JH5 C;  1KLV A;  3KVF B;  3A1Q B;  1ZKH A;  1UD7 A;  5L95 C;  4X57 B;  1K8R B;  2KWV B;  2KK8 A;  2KDE B;  4KIK B;  1WXM A;  1AAR A;  2KC1 A;  3PHW B;  4DK5 A;  1WJN A;  1OQY A;  4WWO A;  4WJP A;  1WXS A;  2IO0 B;  3JSV B;  3T8M A;  2YVC A;  2JZ3 B;  2HD5 B;  4NJ7 A;  1KM7 A;  2LVP A;  1RLF A;  2I1J A;  2LD9 A;  2N7D A;  4TV3 A;  3M95 A;  1WGG A;  2L00 B;  1E8Z A;  4I6L B;  4LDT D;  4HWI B;  5LXH A;  5AEK B;  5JZE B;  3SD5 A;  4DWF A;  3EC8 A;  4K7S A;  3TL5 A;  2CHW A;  3LDZ E;  4FJZ A;  4GIV A;  5TR5 A;  2C7N B;  2IBI B;  2KDB A;  2OJR A;  1I42 A;  3UQA A;  3CST A;  3GZN I;  1E5W A;  5J18 A;  2CS4 A;  1UGM A;  3ZNG C;  1WGH A;  2WDT B;  5C1Z A;  3PLV A;  4URK A;  4OVU A;  4GU2 A;  4GOC A;  4BBN F;  4GGQ A;  3UGB B;  2L7R A;  1A5R A;  3L10 B;  2M1M A;  2RPQ A;  2MBB B;  2J7Q B;  4ANW A;  3VUX A;  2UWQ A;  3VTV A;  3DDC B;  3A1Q A;  3WIM A;  1WR1 A;  4E3C A;  1KOT A;  2FIF A;  4IW0 A;  3VH3 B;  4K7U A;  5DPR A;  4KIK A;  1Q0W B;  2KZR A;  3DQV A;  2KFK A;  4G11 A;  4IUM B;  2FCM A;  2NBU A;  1C1Y B;  2KLC A;  4IWO A;  1TZ1 A;  3VVW B;  2JT4 B;  3JSV A;  1XD3 B;  1RRB A;  4KZC A;  2A5U A;  4NPN A;  2DZJ A;  3D32 A;  2N9P C;  3PLU A;  3PRZ A;  1RFA A;  5DCN A;  4HJK A;  4MEL A;  2HJ8 A;  2DZK A;  2ZJD A;  3NZU A;  3QX1 A;  2K8H A;  2D07 B;  2RR9 A;  1ZW7 A;  2MA9 B;  3QJZ A;  3N3K B;  4HXD A;  3IBE A;  1WGY A;  3DPD A;  1SGH A;  2ZVO A;  3DVG X;  3ECI A;  2DYB A;  1Z2M A;  2N1W A;  5C23 A;  4P7I A;  2J0M A;  3APF A;  3UIP B;  1VD2 A;  2M8S A;  4MJS B;  1S3S G;  4RM8 A;  5DPW A;  2AL3 A;  1ISN A;  4ANU A;  2JRH A;  1WM2 A;  2NVU I;  3H7P B;  3IHP C;  3KH0 A;  3B0A A;  1SE9 A;  4FAD A;  4FLH A;  4K81 A;  4AJW A;  4M8N A;  3V6E B;  4NAW B;  2ZVN A;  4JQW C;  4PS3 A;  4W9E A;  2KTR B;  2PJH A;  2KMA A;  3ZLZ A;  5E6O A;  2DYM A;  4ICU A;  4J6I A;  3APC A;  3A4S C;  3NY5 A;  4FN2 A;  4W9H A;  2ASQ A;  5E6N A;  4ZRI A;  2MP2 A;  3ZO5 B;  1M94 A;  5CTR C;  1R4M I;  3B08 A;  1WYW B;  1ZGU B;  3U7D A;  4DXA B;  1H8C A;  4NQK E;  3AXC A;  1UH6 A;  2MQJ A;  4KSK C;  4WAA A;  4ZRJ A;  1E8X A;  1GC6 A;  1WZ0 A;  3R3M A;  4K1R B;  4B6W A;  1JRU A;  1YJ1 A;  2IO3 B;  3GOE A;  1EO6 A;  1WJ6 A;  1WRD B;  3N30 A;  3RT3 B;  4CYE A;  1J0G A;  2IZV B;  2WX1 A;  1WJU A;  3PHX B;  2XEW A;  3ZNZ B;  4G0N B;  1R4N I;  1TTN A;  1Z5S B;  2KJR A;  3ZTD A;  4BKT A;  4MJS A;  4NJ6 A;  3AUL A;  2PPH A;  4KDL B;  3O65 B;  4W9G A;  4LJP B;  1IP9 A;  5LLI A;  2KC2 A;  4LCD E;  3H7P A;  2MWS B;  1UBI A;  3WA0 A;  2KLG A;  2BGF A;  2M0X A;  3V61 A;  2FUH B;  2K6D B;  5G55 A;  3V6C B;  2LVO A;  4NAW A;  3ZRC A;  1F9J A;  2NBW B;  1IPG A;  3IG3 A;  3RYT A;  2KTR A;  3DCG A;  3RZW C;  3TCA A;  3WAL A;  2JPH A;  2I1K A;  4GN1 A;  1P1A A;  2BWE S;  4W9L A;  2D3G A;  2YLM A;  2KJH B;  2KO3 A;  4OVV A;  4WJO A;  4HPL B;  4BVU C;  1E7V A;  4GMV A;  4IG7 B;  3RUL A;  5JHB A;  3KW5 B;  2ZZP B;  4MGK E;  2KFK B;  4WQO B;  1YX6 B;  2C9W B;  2KQS A;  2L05 A;  4BKS D;  4RM9 A;  3UQB A;  1GC7 A;  2K8B A;  2LAS A;  2LVQ A;  3DVN V;  3QAQ A;  4EZK A;  3NOB A;  2LXC A;  4DHZ E;  4G50 A;  3ZDM C;  2HTH A;  3ZDT A;  4ICV A;  1NBF C;  2BKF A;  2KWC A;  5AZG A;  3MTN B;  2MLB A;  3AI5 A;  3R7Q A;  1L7Y A;  2AL6 A;  3QWZ B;  2G4S A;  4NQL B;  1WI0 A;  4BBN C;  4FA6 A;  3BIN A;  1WX7 A;  4CHK A;  1TGZ B;  3PT2 B;  1E8Y A;  1GUA B;  2XBB C;  2BYV E;  4E71 A;  2CHZ A;  1V81 A;  2DEN B;  2JWZ A;  3WAO A;  2WX0 A;  2ZEQ A;  1TBE A;  4AJY B;  3ML9 A;  3DBR I;  3PSE B;  3JVZ X;  4GXB A;  2IO1 B;  4EUT A;  4ZRK A;  3R66 C;  3Q3J A;  2JF5 A;  3AU5 A;  3QC8 B;  3PTF C;  3VTW A;  2N9X A;  2N9E B;  4AOF A;  5BO4 B;  3I3T B;  4DHZ B;  4II2 B;  3WAP A;  4BKG A;  4EKU A;  1U4A A;  3LJ3 A;  1WGD A;  1EUV B;  3ZVV A;  4TKN A;  3KYD D;  1WR6 E;  1YIW A;  2LUE A;  2L0F A;  4HDO A;  3WAM A;  2MP2 B;  3QA8 A;  3U8Z A;  4EZL A;  4IM2 A;  3PRE A;  2BKR B;  3QIJ A;  2IY1 B;  3DBL I;  4TQ1 A;  1WXA A;  3M3J A;  1I35 A;  3TMP B;  4HCP B;  4G3X B;  1UBQ A;  3JW0 X;  2FCQ A;  3DBS A;  4GB9 A;  3R7R A;  2MBE A;  4MDK E;  2ZPY A;  2JY6 A;  4KSL C;  2RD0 A;  1MG8 A;  2K25 A;  1WX8 A;  2J0J A;  3H1U A;  1C3T A;  2NBV B;  4PYZ A;  1V86 A;  1LFD A;  3EEC A;  2MBQ A;  2R2Q A;  3UIO B;  2ZCB A;  2KDI A;  2V1Y A;  2V4L A;  3W1Y A;  5IAA C;  4PS7 A;  1WGR A;  2KX0 A;  3SU8 X;  2V3S A;  4W9I A;  4YL8 A;  4DDI D;  5EDS A;  1WJ4 A;  4ASW C;  4DHJ B;  2C60 A;  1P98 A;  1V6E A;  1WM3 A;  2W9N A;  3A9K A;  2JRI B;  1P0R A;  1Y8R C;  2KTF A;  3BY4 B;  4AUQ C;  2Z0D B;  1XQQ A;  3RUI B;  3APD A;  2KHW B;  1OTR B;  2NR2 A;  4II3 B;  2L0T A;  5GMV A;  5D2M B;  4WWN A;  2AYO B;  4XZ4 A;  2O6V B;  4IWQ A;  2ZCC A;  3KUZ A;  2GOW A;  4KDI C;  2IY0 B;  2J0K A;  2MW5 A;  3PRP B;  4W9F A;  1WX9 A;  2NS5 A;  4IWP A;  2BF8 B;  2LJ5 A;  4KVG B;  5CX3 A;  4E74 A;  2KAN A;  2JZZ A;  1YX5 B;  2G3Q B;  3KUD B;  2CU1 A;  2RSU A;  2GBM A;  5KHO A;  2PEA A;  3IFW B;  2L3Z A;  3B1L X;  3V62 A;  1UZX B;  4LDT B;  2RGF A;  3DVG Y;  2A4Z A;  3ZTC A;  2CHX A;  3T9L A;  4M8M A;  4HPM B;  2CKH B;  2FCS A;  3RCZ A;  4F1S A;  4XX5 A;  2QHO A;  4JGH B;  4B9K A;  4MSM B;  4TQ0 A;  3ONS A;  2DZM A;  4JL9 A;  2MCN B;  3MHS D;  2LZ6 A;  4W9D A;  1V5T A;  4EFO A;  2EMT A;  1OGW A;  4EZJ A;  2MRP A;  3L17 A;  4GSW A;  3K9O B;  4AP4 C;  1VCB A;  4FJV B;  3KUC B;  5KHQ A;  4N9F 4;  4JIO U;  2O6V A;  5J2R A;  4WJN A;  4KV2 A;  4NNJ B;  1WH3 A;  2G45 B;  2REX A;  2DAJ A;  3N32 A;  3PZD A;  2PE6 B;  3M63 B;  2Z0E B;  2WWZ A;  2LI5 A;  3A4R A;  2GBN A;  4AWJ A;  3NHE B;  3PV1 A;  2BWF A;  5IA7 A;  2KN5 A;  1D3Z A;  1P3Q U;  3HHM A;  2CR5 A;  2D2Q A;  3V60 A;  4EOY A;  5JHA A;  2Z59 B;  3PVL A;  3SHQ A;  4A3O A;  2N4F A;  1WY8 A;  3ZIM A;  4WWP A;  4WJQ A;  1V9J A;  3OLM D;  3CSF A;  4EEW A;  1BT0 A;  1WFY A;  2GBR A;  2VRR B;  3K9P B;  4GDL B;  2KOX A;  3VH4 B;  2BYF A;  2GBJ A;  1NDD A;  3MJW A;  2JVC A;  1QZE A;  4MM3 A;  1L2N A;  2BPS A;  3L0W B;  3PGE A;  1V2Y A;  2NCN A;  3VUY A;  2IO2 B;  2LRW A;  3W1S C;  5HKH A;  1LQB A;  2KFJ A;  3H9D A;  2NPT B;  3JYU A;  4F8C B;  4BOZ B;  5DPT A;  3RZF A;  2KVR A;  1S1Q B;  1LM8 B;  2EKE C;  3HIZ A;  4FHJ A;  4ANV A;  3RD2 A;  1Q5W B;  4FUL A;  3A9K B;  1XT9 B;  4MH0 E;  2KQ7 A;  3U30 A;  1CMX B;  1V5O A;  4MSQ B;  4MGY E;  3ALB A;  1WE7 A;  3VUW A;  3DVN U;  2LXA A;  3TIX A;  1V49 A;  4F7Z A;  2C5L C;  4FHK A;  5AZF A;  3QQ8 B;  1E8W A;  3M62 B;  4ANX A;  2O2V B;  4HK2 A;  4FBJ B;  1G6J A;  1WXV A;  3QK0 A;  2AWT A;  2ZNV C;  3KYC D;  4FJY A;  3VAW A;  2K8C A;  3HM6 X;  2KXJ A;  3PS6 A;  1GJZ A;  4W9K A;  3L16 A;  3ZW3 A;  1EF1 A;  3HK0 A;  4MGI E;  1WIA A;  2D10 A;  4GDL A;  1WE6 A;  4MEM A;  3VFK A;  2M4N A;  4BOS C;  3HM3 A;  3VTU A;  3OAW A;  3WAN A;  4K7W A;  5J17 A;  5LXI B;  1WF9 A;  2XK5 B;  4GDK B;  3C0R B;  3A33 B;  4IC7 B;  2LGX A;  1YD8 U;  2C7M B;  1E90 A;  2KJ6 A;  2NPT A;  1J8C A;  1V80 A;  2K6Q A;  1J19 A;  1PQS A;  1UEL A;  1HE8 A;  4LJO B;  4NY0 A;  4B95 A;  3H7S A;  3A9J B;  3QHT A;  3NZS A;  3AU4 A;  1FXT B;  2DX5 B;  2KDF B;  2KX3 A;  4MGZ E;  3TJP A;  2LGY A;  3PRM B;  1Q1O A;  3ML8 A;  4I6N B;  2C7H A;  3PPA A;  3L13 A;  4RMA A;  5E6P A;  4ZDV A;  3L08 A;  4IM3 A;  2LWP A;  1GG3 A;  1X1M A;  2M17 A;  5D94 A;  2JXX A;  4TUU A;  3X0W A;  4HVB A;  2D11 A;  4HDQ A;  2FNJ B;  1WMH B;  2AEH A;  3OJ3 A;  1LXD A;  2N1V A;  2FAZ A;  2IYD B;  3CF6 E;  4XC2 A;  3EFU A;  4PS8 A;  2O2V A;  3ENE A;  3Q3F A;  2KD0 A;  3IVF A;  3P2B A;  1SIF A;  1YQB A;  5AZH A;  1NI2 A;  3OJ4 B;  4JLC A;  2LRU A;  4PYU A;  3QAR A;  2FID A;  2R2O A;  5CHF A;  2KNB A;  3ZNI D;  3EHV A;  4HCN B;  2PE9 A;  3UIN B;  2K39 A;  2DHZ A;  2HE7 A;  1OEY J;  2XK5 A;  4GDK A;  2MSE D;  3ZNH B;  4I6P A;  2DYO A;  2EMS A;  3ZKJ C;  3VXW A;  2BYE A;  3X23 A;  1EF5 A;  2ZNV B;  2DAF A;  2JUO A;  3A9J A;  3H6N A;  4IM0 A;  4A3P A;  2MBH A;  3VHT C;  4HLE A;  4ZYN A;  4A20 A;  4DDG D;  5CHV C;  2OOB B;  2WYQ A;  1P9D U;  1OEY A;  4W9J A;  2KKC A;  3CMM B;  1KJT A;  3L54 A;  3VQI A;  5G2N A;  5D7G A;  2MX2 A;  5D6J B;  4W9C A;  2UYZ B;  3QCA A;  2LGD A;  2DZI A;  3NS8 A;  3TBL D;  1T0Y A;  3VDZ A;  3W1S A;  4CO7 A;  2FCN A;  5L83 A;  4BFR A;  1WMH A;  3ZRF A;  4DBG A;  4DHJ D;  3SDL C;  2G4D B;  2GMI C;  3UF8 A;  1H4R A;  2KMC A;  5CHW A;  2ZPN A;  1IYF A;  2L76 A;  4M0W B;  3DBH I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...