1UD7A

Solution structure of the designed hydrophobic core mutant of ubiquitin, 1d7
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
MQVFLKTLTGKTVTIEVEPSDTVENFKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTIHLVLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ubiquitin
molecule keywords PROTEIN (UBIQUITIN CORE MUTANT 1D7)
publication title Solution structure and dynamics of a designed hydrophobic core variant of ubiquitin.
pubmed doi rcsb
total genus 17
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1999-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ud7A00
2MX2A 4LCDE 4XC2A 3ZNGC 3ZNZB 2JPHA 2MRPA 2O6VD 4G0NB 4IG7B 2D07B 2I1KA 5G55A 4AJYB 1P1AA 3OJ3A 2KMAA 3DDCB 1TBEA 2G4SA 3SHQA 2KNBA 1OTRB 2BYFA 3A9KB 3DBRI 3C0RB 3APFA 1G6JA 2VRRB 2BGFA 2MSED 2N1VA 1RAXA 3ZTDA 2JZZA 3DVGX 4JQWC 4MSMB 4N9F4 4BVUC 2JWZA 3RZWC 1GC7A 2LXCA 3D32A 3ML9A 1V81A 2GBKA 4RM9A 3KUDB 2JVCA 4TQ1A 5BO4B 2C9WB 1S3SG 3UGBB 3R7RA 3M62B 5D7GA 3A9JA 2IO1B 2KK8A 2LUEA 2KD0A 3UQAA 3A4SC 1E8WA 1GUAB 2K39A 2V3SA 2LVOA 2B3AA 2LD9A 1V9JA 3APDA 4HJKA 4NQKE 2KLGA 3IHPC 4I6LB 1E7UA 1J19A 3PPAA 3WA0A 1V86A 1KOTA 2AL3A 1Q1OA 2N9XA 2LWPA 2WDTB 5CTRC 4A20A 4F8CB 3VFKA 3QJZA 1EO6A 3KUZA 2L05A 3K9PB 2FAZA 4BOZB 2ZZPB 4TUUA 4W9LA 4X57B 5JZEB 1UELA 2LASA 1LFDA 3ZLZA 3EECA 4ZDVA 2LVQA 3JSVA 3ML8A 1L2NA 5AZFA 1UBQA 2YLMA 3WIMA 2DYMA 1U4AA 3AI5A 3HK0A 1ZW7A 1OEYJ 2Z59B 4FN2A 3K9OB 1Q0WB 2KDFB 3V6EB 2L3ZA 2RR9A 3KYDD 3QCAA 4EKUA 4KZCA 2O6VB 3H1UA 2KC1A 1GC6A 3PLUA 1Y8RC 2MP2A 1WMHA 3O65B 2GBJA 4DK5A 3CMMB 1RFAA 1WGDA 2W9NA 2MBEA 3QARA 2G45B 3OJ4B 1LQBA 2IY1B 1CMXB 1WXVA 1P9DU 3ZDMC 2GBMA 1E5WA 4HCPB 3PSEB 2BF8B 2KTFA 4OVUA 4HLEA 1WR1A 4G3XB 4I6PA 3P2BA 5FR6A 4HVBA 5DPWA 3DPDA 2JF5A 4FHKA 3L54A 1M94A 2EMTA 2XEWA 3M95A 1WRDB 4GIVA 2NBWB 3DBSA 3VVWB 4G50A 2DZIA 1A5RA 4K7SA 5D94A 1WGHA 3R7QA 2XK5A 5E6NA 3DVNV 3KVFB 4DXAB 4E71A 5J17A 3KH0A 5L83A 4NAWA 2IO0B 3UIOB 1L7YA 2J0MA 4TQ0A 2KWCA 2KC2A 4XX5A 3RULA 2C7HA 4GGQA 2JZ3B 4B6WA 2ZVNA 3QC8B 2G3QB 1P98A 3BINA 4AWJA 1BT0A 1XD3B 1V6EA 3N3KB 1EF1A 4KZ0A 3U30A 5DPTA 5LXHA 2DAJA 3OAWA 4IM2A 3B08A 2WWZA 4PS3A 3B1LX 2D11A 1VD2A 3AXCA 2KX3A 4WWPA 2KHWB 3MJWA 3UIPB 4LJOB 2NVUI 4MJSA 3RYTA 4F1SA 4FLHA 3A9JB 4TV3A 3A33B 2KLCA 3ZW3A 2J7QB 3PHWB 3WAMA 5TR5A 4II2B 4WAAA 3GZNI 2KZRA 3AULA 3RCZA 2K8CA 4ICUA 4BBNC 4FJZA 2K6DB 2GBRA 3AU5A 2GMIC 5AEKB 3PHXB 1I42A 2NBVB 4M8NA 1UBIA 3ZRCA 3QA8A 2KJHB 3WAOA 1WF9A 1AARA 2DYOA 1R4NI 2BWES 4W9HA 4GDKA 4FJYA 1ZGUB 3X23A 2M0XA 4EZKA 2K6QA 4WWOA 3R66C 1K8RB 4I6NB 3NZUA 3KUCB 3L13A 3VTWA 2LGYA 4KDIC 5EDSA 1X1MA 3VTUA 2KFKA 2WX1A 4PYUA 1V2YA 4IW0A 2GOWA 3KYCD 2I1JA 1H4RA 2KJ6A 3HM3A 3ZNID 4EOYA 2AEHA 1WM3A 2DZKA 3VH3B 1YD8U 3ONSA 1MG8A 1WI0A 2Z0EB 3VUYA 4K81A 2CHXA 2LRUA 2N4FA 4WWNA 4EZJA 2BPSA 3B0AA 4IUMB 2LI5A 2MP2B 4MDKE 3T9LA 4WJOA 1WMHB 2V1YA 3ALBA 1WFYA 2ZCBA 1WGRA 3ENEA 4PYZA 2KTRA 1WXMA 2LJ5A 2KVRA 4BKSA 2M1MA 3ZNHB 4E3CA 1TTNA 1XT9B 4B9KA 2KQSA 1C1YB 3V6CB 3H6NA 4P7IA 1V5TA 3DVNU 4W9KA 3VTVA 1YQBA 2A4ZA 2G4DB 3SDLC 3IBEA 4WJNA 2YVCA 2ZNVC 3TBLD 2MBBB 2MBQA 2Z0DB 3CSFA 5DCNA 1IP9A 2HE7A 1JRUA 4MGYE 4K7WA 4W9EA 2KANA 3RZFA 2REXA 2DHZA 4PS8A 2FCMA 2PJHA 1ISNA 2XK5B 1Z2MA 4WJPA 2FUHB 3W1SC 2C7NB 4NAWB 5HKHA 1T0YA 3L17A 1E90A 4NPNA 1WR6E 4LDTD 4HDQA 1GNUA 2M8SA 4JIOU 3ZRFA 2AL6A 2J0JA 4GSWA 3Q3FA 5JHBA 2FCQA 3JVZX 3QAQA 4BKSD 1WJ4A 2MLBA 2DX5B 3DBHI 4W9DA 1P0RA 4ZRJA 4ANUA 2MW5A 5CX3A 1HE8A 1SGHA 3IFWB 1V5OA 4KIKA 4NJ7A 5E6OA 5JHAA 2N9PC 1WM2A 4HPLB 1C3TA 1OGWA 4NJ6A 5AZHA 4CO7A 2KX0A 1D3ZA 4MEMA 2BKRB 3DVGY 4MJSB 4BOSC 1WXSA 2BYVE 2V4LA 1NI2A 2C7MB 4EZLA 2C60A 4LJPB 2JUOA 4DHJD 3Q3JA 1UGMA 3H7PA 4HCNB 1WX9A 3QQ8B 2CR5A 1YX6B 2EKEC 3IG3A 4IWQA 3VDZA 4ASWC 4IC7B 2MWSB 3W1SA 3UINB 3QIJA 2BYEA 4GDKB 2KN5A 3S2AA 2ASQA 3WALA 2KDEB 2LXAA 1E8YA 3PRZA 2K8BA 2KKCA 3H7SA 4DBGA 1WXAA 4BKGA 4KSKC 2PE6B 2XBBC 1WX8A 4AP4C 1PQSA 3NHEB 2HTHA 2PPHA 2KFKB 1KLVA 2ZPYA 3L16A 4ZRIA 4URKA 2K25A 5E6PA 3QHTA 2IO2B 4RMAA 2HJ8A 2ZEQA 4AOFA 4WJQA 5L95C 1ZKHA 4TKNA 4HDOA 4FJVB 1SE9A 4HXDA 4IWPA 3EHVA 4EFOA 1TZ1A 2ZVOA 2WYQA 4JL9A 3TCAA 4W9FA 1E8XA 1LXDA 1WJUA 1H8CA 3GOEA 4LDTB 5C23A 4K7UA 4W9IA 2L8JA 3VQIA 2FCNA 2NPTA 2C5LC 3UQBA 1SIFA 2PEAA 3PGEA 3RD2A 3SD5A 4FA6A 5IA7A 1EUVB 2KDIA 3APCA 3L10B 2CHWA 2FIFA 2OJRA 2RPQA 4ANWA 1E8ZA 2KWUB 1J8CA 4XZ4A 2M4NA 2IO3B 2OOBB 2ZCCA 2BKFA 2RGFA 3VXWA 2JT4B 3JW0X 4HK2A 1OQYA 1QZEA 4CYEA 1I35A 1WJNA 3JSVB 5KHOA 3DCGA 1WY8A 3M3JA 2ZJDA 3PVLA 3LDZE 4KSLC 2MCNB 2Y5BB 3W1YA 2L0TA 4DHJB 3M63B 2N1WA 2KXJA 3QWZB 2RSUA 3L08A 3PTFC 3UF8A 2DAFA 3NS8A 2L76A 1Z5SB 4OVVA 5CHFA 2KO3A 3RUIB 4GDLA 4ICVA 2L7RA 4GXBA 3TL5A 1EF5A 1LM8B 2KOXA 2DZMA 4KIKB 3N30A 2D3GA 3U8ZA 3WAPA 4ANXA 5GMVA 3MHSD 3DOWA 2R2OA 4PS7A 5JH5C 3R3MA 5CHWA 3CF6E 1WJ6A 5IAAC 3ZUNA 4A3OA 3EC8A 2MA9B 4CHKA 4DDGD 3HM6X 2JXXA 4B95A 3PZDA 4NNJB 2LRWA 1WE6A 4EUTA 2ZNVB 5KHQA 2JY6A 3QX1A 2KJRA 3SU8X 4ZYNA 2EMSA 2M17A 3VAWA 2L0FA 3A1QA 3JYUA 4W9CA 3T8MA 2O2VA 3QK0A 3H7PB 2WX0A 4ZRKA 3AU4A 4A3PA 2HD5B 4AJWA 3PRMB 4HWIB 4JGHB 3TIXA 4GOCA 1WE7A 3LJ3A 3BY4B 1WZ3A 2KWVB 3PV1A 1KM7A 2CU1A 4GB9A 4MGIE 3PREA 1E7VA 3VHTC 4KDLB 1KJTA 4YL8A 2PE9A 3DQVA 1R4MI 3KW5B 4FADA 2KMCA 3PRPB 3CSTA 3ZTCA 4GMVA 4MELA 5D2MB 5DPSA 2LVPA 3PS6A 1P3QU 1RLFA 3N32A 2AWTA 2KQ7A 3VUWA 3A9KA 5LLIA 4IWOA 4DWFA 4F7ZA 1V49A 2GBNA 4W9JA 1WGYA 4GN1A 1WGGA 2BWFA 1J0GA 2N7DA 2NPTB 3NOBA 1F9JA 4M8MA 2IZVB 2LGDA 4MM3A 1RRBA 2ZPNA 4MH0E 4G11A 4AUQC 1WH3A 3DBLI 2NR2A 2A5UA 2DZJA 2CKHB 2N9EB 3A4RA 5AZGA 2D10A 3OLMD 2K1FA 3MTNB 5J18A 3NY5A 4KVGB 4KV2A 4BFRA 2AYOB 3PT2B 3V60A 2FNJB 1NBFC 3HIZA 2NS5A 1YX5B 2FCSA 1UH6A 4E74A 2KDBA 1FXTB 2JRIB 1UZXB 1WX7A 5D6JB 4MGZE 3VUXA 3TMPB 4IM3A 4GU2A 2FIDA 4JLCA 4DDID 1UD7A 4EEWA 2QHOA 3TJPA 3ZVVA 5LXIB 4J6IA 2IY0B 3EFUA 2UWQA 2DYBA 3L0WB 2N7EA 4IM0A 5G2NA 3ZKJC 5C1ZA 4DHZE 2IYDB 3RT3B 4RM8A 4HPMB 4GDLB 4FHJA 2K8HA 4FULA 4II3B 4K1RB 4MSQB 1V80A 1XQQA 4W9GA 5DPRA 3ZIMA 2NCNA 2DENB 4DHZB 2KTRB 4M0WB 4NQLB 3ZDTA 2O6VA 2LGXA 2MQJA 1VCBA 2KFJA 2R2QA 4NY0A 2UYZB 2LZ6A 3V61A 1IPGA 2MBHA 2NBUA 1TGZB 3IVFA 2D2QA 2CHZA 1YJ1A 2IBIB 1WZ0A 3PLVA 5CHVC 3V62A 3I3TB 2J0KA 3X0WA 3WANA 1IYFA 3A1QB 4WQOB 3ZO5B 1GJZA 2O2VB 3U7DA 3NZSA 3ECIA 3HHMA 2MBOA 4BKTA 2L00B 1WIAA 2CS4A 3H9DA 2JRHA 1OEYA 4MGKE 1GG3A 1S1QB 1WYWB 4ANVA 3VH4B 5J2RA 2RD0A 1Q5WB 1NDDA 1YIWA 4FBJB 4BBNF
chains in the Genus database with same CATH superfamily
4OZCA 2JPHA 4IG7B 2D07B 3I5JC 2KMAA 5IO9A 4YXDB 2KNBA 2BYFA 5HFYA 3ZTDA 2JZZA 3RZWC 2LXCA 1XLPA 4NJCA 3IAM1 3TSSA 1S3SG 3M62B 1ZOYB 1N6ZA 3R2TA 2KK8A 1FCLA 2KD0A 2WLBA 1QF6A 2PKOA 4NAMA 4NQKE 3IHPC 1KOTA 2AL3A 1Q1OA 1NEKB 5CTRC 3VFKA 3KUZA 3ZQ4A 2V9HA 4TUUA 1MVKA 3HVDA 3AE6B 4WQMA 3RI7C 3SEBA 4ZDVA 2LVQA 3JSVA 5AZFA 1YMHE 4IOIE 2L83A 3BVGA 4RH6A 4YSZB 3AI5A 2Z59B 1V1PB 1F2RC 4REZA 3V6EB 5HHDG 1JROA 1GB4A 1TS2A 1FNVA 1TIFA 3H1UA 2B76B 1BUIC 2IGGA 1XLOA 1LQBA 1FNUA 1CMXB 2LGSA 4G3XB 3M95A 3DBSA 4G50A 5D94A 2QEJC 2XK5A 5J17A 3KVFB 4E71A 2BS4B 2WXJA 2J0MA 4TQ0A 3R2IA 3RULA 2C7HA 2BB6A 2HJ1A 1BT0A 1V6EA 3N3KB 3VRAB 5LXHA 2DAJA 4IM2A 2IGDA 1VD2A 1HTOA 2KX3A 2KHWB 3AEDB 2D3AA 2NVUI 2KLCA 2J7QB 1DOYA 2K8CA 2GBRA 5AEKB 3PHXB 1UBIA 1I4XA 4W9HA 1ZE3D 4GDKA 4OW0A 4FJYA 1B1ZA 1FPYA 1Q10A 3R66C 1F77A 5C2TB 4H2AA 3VTUA 3HVZA 5BYSA 3U52E 3Q8FA 1H4RA 3HM3A 3ZNID 4EE2A 2DZKA 3AB5A 2ZW0A 2LUMA 4K81A 2PLPA 2PMVA 2N4FA 2BPSA 1VZ6A 3B0AA 4WJOA 1WMHB 2Y5CA 1WGRA 3ENEA 1VJKA 1WXMA 2KVRA 4BKSA 1XT9B 5JXVA 3DVNU 3VTVA 3AE8B 3ZXRA 2A4ZA 5DCNA 3BIID 4MGYE 3RZFA 2RDGA 1TYGB 4JE3B 2PJHA 3TEXA 1GB1A 3W1SC 4NAWB 1T0YA 4HDQA 1GNUA 4JIOU 3ZRFA 3I9V1 2AL6A 1M4VA 3JVZX 2MLBA 4ZRJA 4ACFA 1P0RA 2K9XA 2MW5A 4YTMB 1HE8A 4NJ7A 1OGWA 4NJ6A 1LO5D 3DHHC 4MEMA 2BKRB 5I4DA 1I7HA 2C60A 3AMZA 2D5GA 3Q6BA 4DHJD 3W2DA 1UGMA 3EFCA 3Q14C 4HCNB 2Z8LA 3IG3A 4S17A 4ASWC 3GP7A 1TS4A 2NTTA 2LXAA 1E8YA 2KKCA 3H7SA 1WXAA 2LMCA 5MPOA 2QJLA 2XBBC 4AP4C 3NHEB 2PPHA 2KFKB 4ARCA 5E6PA 4HDOA 2N7JA 4HXDA 3EHVA 1TZ1A 2BB5A 4KX6B 1JW9D 1E8XA 4D2KA 1WJUA 1H8CA 4IKGA 4W9IA 3P4SB 2L8JA 3VQIA 3RNGC 2PEAA 1PGXA 1E0ZA 3APCA 3BVZA 3I63C 2OJRA 3H8HA 2IO3B 3AH7A 4LNIA 4C4VA 3JSVB 1QILA 2Y5BB 1GPXA 5T8IA 2N1WA 2KVZA 2RSUA 3L08A 1WRIA 1D5MC 1Z5SB 4GDLA 4ICVA 4K3CA 1EF5A 2D3GA 3OG5A 2R2OA 5CHWA 3ZUNA 2JU6X 3PZ8A 2JXXA 4EUTA 2ZNVB 2JY6A 2IGHA 5EE1A 2KJRA 1TKGA 1R7SA 3ETRA 4W9CA 2V3NA 2W82A 3QK0A 3AU4A 4OZBA 3P1MA 1TZOA 2AQ1B 1WZ3A 3VHTC 1KM7A 4KDLB 2QCZA 1KJTA 4YL8A 4AS1A 4L1BA 1FEHA 3CSTA 5D2MB 1MG4A 3VUWA 1K50A 4F7ZA 1TJEA 1E10A 3RPFC 1J0GA 2N7DA 2IZVB 2LGDA 4HKQA 4AUQC 3DBLI 3ZGZA 2NR2A 3A4RA 2N9EB 3OLMD 2AQ2B 4KV2A 2PVOD 1C4PA 2AYOB 3NVWA 3HIZA 4E74A 2KDBA 3B9JA 1XF5L 4JPSA 4EEWA 1OQQA 3MP9A 4LLGM 4RGOS 4DQOC 5C1ZA 4DHZE 1UF0A 4MSQB 1V80A 4W9GA 5DPRA 3ZIMA 3BZDB 3RMKC 4M0WB 2NMQA 1NYRA 2KFJA 1L6UA 4XDDA 4OHJA 1TGZB 3IVFA 2D2QA 2CHZA 1WZ0A 4US9A 3V62A 3X0WA 4KKIA 2KWDA 1SBBB 3A1QB 3ZO5B 1GJZA 1EU3A 2O2VB 3U7DA 4RGNA 4BKTA 1WIAA 2ONQA 2BTEA 4MT5A 3U2SC 4ANVA 3VH4B 1AYFA 5TSSA 2RD0A 1YIWA 3TEWA 4FBJB 2MX2A 4LCDE 2BW2A 3ZNGC 2KMMA 1P1AA 5H8YE 3DDCB 2G4SA 3SHQA 2INPE 1C78A 2QIEB 3A9KB 3DBRI 1C9FA 1TY0A 2MSED 1WWTA 3DVGX 4N9F4 1P7FA 2JWZA 2WU5B 1GC7A 4LTUA 3R7RA 4MM3B 2IO1B 2LUEA 3UQAA 3A4SC 1E8WA 2B3AA 2JWUA 1V9JA 3APDA 3U4EG 1L4DB 3AEAB 2KLGA 3VR8B 1V86A 1XEEA 2RDBC 3LXFA 2N9XA 2WDTB 3QJZA 1WYGA 1NVID 4W9LA 4X57B 5JZEB 3LB8C 3EECA 1L2NA 4KKJA 2INDC 3WIMA 5FR3A 1U4AA 2WXMA 1RM6C 2KDFB 2RR9A 3QCAA 4EKUA 1WMHA 3O65B 2GBJA 4P16A 1C76A 3CMMB 2JYEA 2G45B 1UUPA 2IY1B 3RFZB 3ZDMC 4NZLB 4HCPB 1BXTA 5FR6A 2E6XA 2JF5A 4FHKA 3L54A 1WRDB 1YOVB 2MEKA 4NAWA 1IBXB 3P4PB 5D3IB 4M00A 2INNE 1E7PB 4AWJA 1XD3B 2XN9C 2N9LA 1EF1A 1ZDVA 1QT9A 1EM7A 4PS3A 3B2FA 3MJWA 3UIPB 4US8A 4HKZE 4F1SA 4FLHA 3ABVB 3ZW3A 1N63A 3P4RB 3DBLB 4II2B 3AULA 4ICUA 1WXQA 3NZ3A 3V3XA 2K6DB 1I42A 4GLSC 1YJJA 2NBVB 3QA8A 3WAOA 1JQ4A 2DYOA 1CJEA 5FKAC 3CIRB 4A8XC 1ZP0B 3X23A 4EZKA 1K8RB 3KUCB 1C4AA 3AE4B 2G9HD 2MJ3A 3VTWA 5EDSA 1PDXA 2KFKA 3N9YC 1K53A 2GOWA 2QILA 3KYCD 2D3BA 1KH0A 1ESFA 1WM3A 1WI0A 4ZHPA 2V1YA 3ALBA 3Q3MC 4PYZA 2KTRA 2LJ5A 4E3CA 3ZNHB 2UU7A 4B9KA 1C1YB 3H6NA 1V5TA 3NJTA 4W9KA 1YQBA 1JWBD 1KRHA 2MBQA 3CSFA 3GZNB 4USAA 4DXGA 2QC8A 1IP9A 2HE7A 1JRUA 1LGRA 2KANA 3IT4B 5EE3A 4WJPA 1EU4A 2KN4A 1ZPSA 2K5PA 1VLBA 2WXFA 4NPNA 1F52A 5AUIA 2FCQA 2DX5B 3BYYB 3DBRB 5CX3A 2N9PC 2LEKA 1TS3A 1D3ZA 3GB1A 3DVGY 2KACA 2V4LA 3R8BA 1QOFA 2WXGA 1VR9A 2WDRB 3EUB2 2J4XA 2MWSB 3QIJA 2V4IB 3ZJTA 2KN5A 4BKGA 1PGBA 1QOAA 2PE6B 4KGRA 2BS3B 2J42A 2ZPYA 1AWDA 4ZRIA 4URKA 1OFFA 2JYTA 2HJ8A 1ZKHA 4FJVB 4EFOA 1N5WA 1KTKA 2ON8A 3DBHB 4XE0A 2SEBD 3UQBA 1SIFA 3SD5A 4S0RA 4FA6A 3L10B 5BMHA 2CHWA 1V97A 2FIFA 1V1OA 4ANWA 2KWUB 2ACZB 2M4NA 2ZCCA 1EWYC 3FILB 3VXWA 4HK2A 4CYEA 2R61A 1I35A 2CJNA 1WJNA 1KFYB 3M3JA 2ZJDA 3PVLA 4KSLC 4XDCA 4DHJB 4LNNA 5IKCM 4OVVA 3TL5A 2KO3A 1ET9A 1LM8B 1STEA 2KOXA 1KF6B 3P63A 3N30A 4ANXA 5GMVA 3MHSD 1VRAB 3DOWA 4PS7A 4M0WA 3BK2A 3CF6E 1WJ6A 4C56C 2PW9A 4A3OA 1J7AA 3EC8A 3MC8A 3J9CA 1L5PA 4NNJB 1WE6A 1T0QC 5KHQA 3SU8X 2WU2B 4A6QA 4YWGG 2DLBA 2M17A 2L0FA 3A1QA 1XLQA 2O2VA 4ZRKA 4A3PA 2BVCA 4HWIB 3TIXA 1ZDXA 4PK1A 3P42A 2WHIA 3LJ3A 3DHIC 3BY4B 3BWUD 3PRPB 3ZTCA 2WDVB 1BMLC 2AWTA 3A9KA 1T5XD 4OZAA 2KQ4X 1HZ6A 1WGYA 2BWFA 3NOBA 4RFBA 5BMIA 4MM3A 1C77A 2ZPNA 4MH0E 2QSDA 5J18A 4BFRA 5GXGB 2NS5A 4WAFA 2JRIB 2LHDA 1UZXB 1N62A 4L23A 2QHOA 4IM0A 2HTME 2IYDB 4II3B 4FXCA 1XQQA 2WXKA 2NCNA 1NENB 2KTRB 4NQLB 2MQJA 1VCBA 2R2QA 3AE1B 4NY0A 1ENFA 2MBHA 2NBUA 1YJ1A 1JWAD 1YJIA 1UNSA 3WANA 1K52A 1VZ8A 1MI0A 2FBWB 4IDIA 1C79A 1Y56A 1OEYA 4MGKE 1QOBA 1S1QB 1WYWB 1F1HA 1Q5WB 1NDDA 4BBNF 4XC2A 3ZNZB 1IBXA 2MRPA 2O6VD 4G0NB 2I1KA 3CWIA 5G55A 3OJ3A 2ICIA 1TBEA 3TEYA 2H89B 1QKZA 1RYJA 1G6JA 3APFA 3O13A 2VRRB 1NYQA 4JQWC 3D32A 4P6VF 1V81A 2GBKA 3KUDB 1WGKA 4TQ1A 1YN3A 2C9WB 4RNAA 4HPPA 2IDYA 3AV8A 3BYTB 2OJWA 2MJEA 3HUIA 1GUAB 2V3SA 3E9SA 2LVOA 2LD9A 4A9AA 3AE9B 2INCC 1E7UA 1J19A 3PPAA 2LWPA 3HRDD 1EO6A 2L05A 3K9PB 5HI1A 4BOZB 2ZZPB 4B0EA 1UELA 1LFDA 3ZLZA 3ML8A 4ITKA 2WS3B 2YLMA 2DYMA 3HK0A 1OEYJ 3K9OB 1Q0WB 5G5HA 2L3ZA 4KZCA 3IAS1 2LHEA 1GC6A 4HJGE 3URYA 2VZKD 3PLUA 2RDHA 1ET6A 4DK5A 1RFAA 2AX5A 2WXQA 3NVYA 3Q8BA 1FXIA 2RMMA 1WXVA 4XYCA 1P9DU 2GBMA 1E5WA 1DOXA 2BF8B 3AE7B 2J52A 1YQ3B 4HVBA 3NRZA 4I6PA 5DPWA 1SSNA 3DPDA 1UGJA 2XEWA 2EMTA 4XWTA 2NBWB 1A5RA 1TY2A 4K7SA 4KGTA 5E6NA 1L6VA 2IO0B 2SAKA 1L7YA 2KWCA 2KC2A 3I57A 2JZ3B 2ZVNA 3QC8B 2G3QB 1P98A 2JSVX 4KZ0A 4O1NA 3U30A 5DPTA 4RF1A 3OAWA 3AXCA 4LNOA 1ACCA 4WWPA 3KWVA 3A9JB 3A33B 1PFDA 3WAMA 5TR5A 1IGDA 3GZNI 1SJHD 2W54A 1D4BA 3W5VB 4BBNC 4FJZA 3ZRCA 2KJHB 2TSSA 1WF9A 1AARA 1P7EA 2KYWA 1F2RI 1ZGUB 2M0XA 2PIAA 2WQYB 4ZRQA 3NZUA 3SR6A 2I2YA 4BAXA 3SFEB 2LGYA 3Q69A 1X1MA 4RGTA 1SB3C 1V2YA 1HA5A 2KJ6A 4MH8A 4EOYA 4B0MA 2AEHA 1FCCC 3PO0A 3ONSA 1J7CA 1YD8U 3VH3B 2WXIA 2WGSA 2Z0EB 2CHXA 2LRUA 2N0SB 4EZJA 4IUMB 2LI5A 2MP2B 4MDKE 3T9LA 2ZCBA 1DGJA 3NVVA 4TMAB 3AE2B 3B2GA 3V6CB 2WXNA 4P7IA 4ZHOA 1MJDA 2V0GA 2G4DB 3Q8CA 3IBEA 3SDLC 3FILA 3FAHA 4WIPA 2MBBB 1T0SC 4LNFA 2BT6A 4K7WA 3Q8AA 3DWGC 4UDUC 2REXA 2DHZA 2OHFA 2C7NB 1E90A 1WSPA 4LDTD 2BYTA 4GSWA 1UWMA 5JHBA 3QAQA 4BKSD 1WJ4A 3AEGB 3DBHI 4W9DA 3MC0B 1SGHA 2EELA 5E6OA 5JHAA 2W55A 1QOGA 1QLBB 2CJOA 1C3TA 2DNFA 3RNEC 5AZHA 4MJSB 2MHJA 1FRDA 2L1AA 4P1CC 5BYQA 3W9CB 1SIJA 2JUOA 3QQ8B 3VDZA 2CR5A 2VH2A 4IWQA 1JALA 4IC7B 3W1SA 3UINB 2BYEA 1HQRD 2ASQA 2KDEB 3P4QB 3PRZA 2K8BA 4DBGA 2PVGC 4KSKC 4Q2JA 1WX8A 4XWWA 5C3JB 2HTHA 2L32A 3Q3NC 1KLVA 2E3TA 3T3OA 4RMAA 1AW7A 4WJQA 5L95C 1SXTA 2CU3A 4TKNA 1FMAD 2ZVOA 3TUOA 2WYQA 2LFIA 2K22A 1JWMD 4W9FA 1ROEA 1LXDA 3GOEA 5C23A 2C5LC 1L4ZB 2KDMA 1E8ZA 1SE2A 2WXRA 4XZ4A 1YQ4B 2RGFA 1QZEA 2RPVA 4WWMA 5KHOA 3DCGA 2GB1A 2MCNB 3W1YA 2L0TA 3M63B 1YNTE 2K0PA 1SF0A 3PTFC 3UF8A 4YTNB 3NS8A 1XO3A 2L76A 5CHFA 3RUIB 4GXBA 1CQVA 3L4PA 4XGAB 2DZMA 4KIKB 1F0ZA 3VRBB 1YN5A 5IAAC 4ZYSA 4N58A 4DDGD 3HM6X 4WH4A 2KT7A 2M56B 1T3QA 3JYUA 3H7PB 2WX0A 1GOZA 2HDEA 2L52A 4HEA1 4JGHB 3NS1A 1FFVA 1KLGD 2J53A 1WE7A 3PV1A 4GB9A 2CU1A 3PREA 1E7VA 3C19A 2PE9A 2W3SA 3KW5B 1A70A 4YT0B 4GMVA 5DPSA 4RF0A 2LVPA 1EWCA 3MJ5A 1RLFA 3N32A 5LLIA 4IWOA 2FUG1 3N1YC 4GN1A 1WGGA 1FNWA 1SE3A 2NPTB 1F9JA 2H88B 4G11A 1WH3A 2A5UA 2DZJA 4HRSA 1XLNA 1T6BX 3RNCC 1I4PA 2WDQB 3V60A 2NTSA 2FNJB 1NBFC 4J3OD 5EE9A 2DBYA 3RNAC 3C8YA 4MACA 1WX7A 3VUXA 4DDID 3N20C 1UD7A 3AN1A 3ZVVA 4C7ZA 5LXIB 4J6IA 3L0WB 2UWQA 2N7EA 3ZKJC 3RT3B 4RM8A 1R4MB 2K8HA 2VH1A 3ZDTA 2LZ6A 3ZJUA 2IPKD 2QDFA 3DWMA 3UI3A 2Q5WD 3KWLA 3PLVA 3I3TB 2J0KA 3ZJVA 1IYFA 2D3CA 2BS2B 1RWSA 3NZSA 3BVMA 3ECIA 3FKYA 3HHMA 2MBOA 2L00B 3EGRA 1D6EC 2JRHA 3H9DA 1MFWA 1GG3A 5J2RA 3AEFB 3RNBC 2MH7A 3NVZA 5G5GA 4AJYB 4ZRPA 1FO4A 1ZUD2 2GLSA 4JX1C 5IP4D 1D5ZC 2GI9A 1OTRB 3C0RB 1FM0D 3ZYYX 2BGFA 2N1VA 1RAXA 1I4GA 4MSMB 4BVUC 3ML9A 4WURA 4RM9A 2JVCA 5BO4B 3UGBB 5D7GA 3A9JA 2K39A 4KGSA 3DHGC 4HJKA 2G1EA 1JMLA 4I6LB 3WA0A 4ARIA 4A20A 4F8CB 1MHXA 2FAZA 2JZPA 4N6EB 1CZPA 2LASA 3Q3OC 1FFUA 3FC4A 2X8XX 4L2YA 1UBQA 1ZW7A 4FN2A 2K3UA 3Q8EA 3KYDD 2V3PA 2O6VB 2KC1A 1Y8RC 2MP2A 3MFGA 2XNAC 1WGDA 2W9NA 2MBEA 3QARA 5IN7A 3V05A 3OJ4B 3U7ZA 4CQNA 5H92C 1E6EB 3PSEB 4OVUA 2KTFA 2WP9B 4HLEA 3NG0A 1WR1A 3P2BA 5D3DA 1M94A 4GIVA 3VVWB 2DZIA 1MPEA 1WGHA 3R7QA 3DVNV 4DXAB 3KH0A 5L83A 3AM9A 3UIOB 1FIQA 1JWUD 4XX5A 4GGQA 5BMGA 4B6WA 1TT5B 1N61A 3BINA 4BZAA 1ZXIA 1I4RA 3PZ7A 3B08A 2WWZA 1FD6A 3B1LX 2D11A 1TKYA 4LJOB 3RYTA 4MJSA 3SFDB 4TV3A 3AE5B 1DYQA 3PHWB 4WAAA 2WXPA 2KZRA 3RCZA 5LNK1 3AU5A 2GMIC 4M8NA 2VZKB 2M19A 4C00A 4M02A 1L0VB 1R4NI 2BWES 3IT6B 2K6QA 4WWOA 2IJ0A 3EA6A 2M0AA 4I6NB 1L0XB 1TS5A 1TKEA 3L13A 4KDIC 1K51A 2WX1A 3MHZA 4PYUA 2WNMA 4IW0A 2I1JA 1N60A 1QQRA 3AEEB 1IUEA 4PT5A 1MG8A 3VUYA 4RGMA 1N5XA 4WWNA 1WFYA 3IXSA 3AEBB 2M1MA 3GS2A 1TTNA 2KQSA 2JX5A 2YEPF 4P1BC 2LGIA 4WJNA 2YVCA 2ZNVC 3TBLD 2Z0DB 4W9EA 4C80A 2OEDA 4PS8A 4M01A 2FCMA 1ISNA 2XK5B 1Z2MA 3N1ZC 2FUHB 5HKHA 3L17A 1WR6E 3T3NA 2M8SA 4ZOHC 4TSSA 2J0JA 2WXHA 3Q3FA 2BBCA 4ANUA 2I38A 4C7YA 3IFWB 4KIKA 1V5OA 3N1XC 2MJDA 1WM2A 4HPLB 4CO7A 2KX0A 2BQQA 2X38A 4BOSC 1I4QA 1C4CA 1YN4A 1WXSA 2BYVE 1JRPA 1NI2A 2C7MB 3AE3B 1DOIA 5IOIA 4EZLA 4JWUC 2WXOA 4LJPB 1UWXA 3Q3JA 3WCQA 3H7PA 1WX9A 1HZ5A 1YX6B 2EKEC 4GDKB 3AECB 3S2AA 3WALA 4YSYB 3ZXVA 1L0YB 2W3RA 3E56A 2Y5PA 1PQSA 1PYWD 3L16A 3GE3C 2K25A 3QHTA 2IO2B 2ZEQA 4AOFA 3NUHB 3OWEB 4YTPB 1SE9A 4IWPA 4JL9A 3TCAA 1T0RC 2ZW1A 4LDTB 4K7UA 1V1PA 4HROA 2FCNA 2NPTA 4RCOA 3RD2A 3PGEA 1PGAA 5IA7A 1EUVB 2KDIA 5E6JA 1KLUD 3W5UB 2RPQA 1J8CA 2DWQA 2WXLA 2OOBB 2YEPB 1IGCA 1OQRA 2BKFA 2JT4B 3JW0X 1OQYA 3TJPA 1WY8A 2EKIA 3LDZE 1PUTA 2QMTA 4N59A 1AN8A 1VDVA 2KXJA 3QWZB 2Y3AA 1MHHE 3Q2AC 1E9MA 2DAFA 1B9RA 1I4HA 2L7RA 5HG2A 3MC9A 3WAPA 3U8ZA 2JQRB 5JH5C 3R3MA 2LJIA 2MA9B 4CHKA 4LNKA 4B95A 3PZDA 2LRWA 1CK1A 1D5XC 3QX1A 1SE4A 1JWSD 4ZYNA 2EMSA 3VAWA 3T8MA 2HD5B 4AJWA 3PRMB 1GAQB 1RFKA 4GOCA 4LK0M 1R4NB 4DXFA 4MGIE 2KWVB 4YSXB 1XXGA 3DQVA 1R4MI 4FADA 1JCKB 2KMCA 3BK1A 1NI3A 1V8CA 4MELA 3PS6A 1P3QU 2KQ7A 1SJED 4DWFA 2N9KA 5BYRA 1V49A 2GBNA 4W9JA 4R3DA 4M8MA 1FRRA 2AQ3B 4A55A 1RRBA 2CKHB 5AZGA 2GRIA 2D10A 2K1FA 1XCQL 3MTNB 2PTLA 3NY5A 4KVGB 3PT2B 1SEBD 5AUKA 1J7BA 1YX5B 2FCSA 1UH6A 4A90A 4C4VB 1FXTB 5EE0A 4JWSC 1HTQA 4OVZA 5D6JB 3TEZA 4MGZE 3TMPB 4IM3A 4GU2A 2FIDA 1HEZE 1VZ7A 4JLCA 2JXTA 2IY0B 1HXYD 3EFUA 4AQ7A 2DYBA 5G2NA 1FXAA 4HPMB 4GDLB 4FHJA 4FULA 4K1RB 4K3BA 1XCTL 2DENB 3VR9B 4DHZB 3KLSX 1ZXHA 2KAJA 2LGXA 2O6VA 2UYZB 3RNFC 3V61A 1IPGA 2FE8A 2IBIB 5CHVC 3KQ4A 4WQOB 4QAYA 2CS4A 5FK9C 3RN9C 3LYYA 3GE8C
chains in the Genus database with same CATH topology
2MX2A 4LCDE 4XC2A 3ZNGC 3ZNZB 2JPHA 2MRPA 2O6VD 4G0NB 4IG7B 2D07B 2I1KA 5G55A 4AJYB 1P1AA 3OJ3A 2KMAA 3DDCB 1TBEA 2G4SA 3SHQA 2KNBA 1OTRB 2BYFA 3A9KB 3DBRI 3C0RB 3APFA 1G6JA 2VRRB 2BGFA 2MSED 2N1VA 1RAXA 3ZTDA 2JZZA 3DVGX 4JQWC 4MSMB 4N9F4 4BVUC 2JWZA 3RZWC 1GC7A 2LXCA 3D32A 3ML9A 1V81A 2GBKA 4RM9A 3KUDB 2JVCA 4TQ1A 5BO4B 2C9WB 1S3SG 3UGBB 3R7RA 3M62B 5D7GA 3A9JA 2IO1B 2KK8A 2LUEA 2KD0A 3UQAA 3A4SC 1E8WA 1GUAB 2K39A 2V3SA 2LVOA 2B3AA 2LD9A 1V9JA 3APDA 4HJKA 4NQKE 2KLGA 3IHPC 4I6LB 1E7UA 1J19A 3PPAA 3WA0A 1V86A 1KOTA 2AL3A 1Q1OA 2N9XA 2LWPA 2WDTB 5CTRC 4A20A 4F8CB 3VFKA 3QJZA 1EO6A 3KUZA 2L05A 3K9PB 2FAZA 4BOZB 2ZZPB 4TUUA 4W9LA 4X57B 5JZEB 1UELA 2LASA 1LFDA 3ZLZA 3EECA 4ZDVA 2LVQA 3JSVA 3ML8A 1L2NA 5AZFA 1UBQA 2YLMA 3WIMA 2DYMA 1U4AA 3AI5A 3HK0A 1ZW7A 1OEYJ 2Z59B 4FN2A 3K9OB 1Q0WB 2KDFB 3V6EB 2L3ZA 2RR9A 3KYDD 3QCAA 4EKUA 4KZCA 2O6VB 3H1UA 2KC1A 1GC6A 3PLUA 1Y8RC 2MP2A 1WMHA 3O65B 2GBJA 4DK5A 3CMMB 1RFAA 1WGDA 2W9NA 2MBEA 3QARA 2G45B 3OJ4B 1LQBA 2IY1B 1CMXB 1WXVA 1P9DU 3ZDMC 2GBMA 1E5WA 4HCPB 3PSEB 2BF8B 2KTFA 4OVUA 4HLEA 1WR1A 4G3XB 4I6PA 3P2BA 5FR6A 4HVBA 5DPWA 3DPDA 2JF5A 4FHKA 3L54A 1M94A 2EMTA 2XEWA 3M95A 1WRDB 4GIVA 2NBWB 3DBSA 3VVWB 4G50A 2DZIA 1A5RA 4K7SA 5D94A 1WGHA 3R7QA 2XK5A 5E6NA 3DVNV 3KVFB 4DXAB 4E71A 5J17A 3KH0A 5L83A 4NAWA 2IO0B 3UIOB 1L7YA 2J0MA 4TQ0A 2KWCA 2KC2A 4XX5A 3RULA 2C7HA 4GGQA 2JZ3B 4B6WA 2ZVNA 3QC8B 2G3QB 1P98A 3BINA 4AWJA 1BT0A 1XD3B 1V6EA 3N3KB 1EF1A 4KZ0A 3U30A 5DPTA 5LXHA 2DAJA 3OAWA 4IM2A 3B08A 2WWZA 4PS3A 3B1LX 2D11A 1VD2A 3AXCA 2KX3A 4WWPA 2KHWB 3MJWA 3UIPB 4LJOB 2NVUI 4MJSA 3RYTA 4F1SA 4FLHA 3A9JB 4TV3A 3A33B 2KLCA 3ZW3A 2J7QB 3PHWB 3WAMA 5TR5A 4II2B 4WAAA 3GZNI 2KZRA 3AULA 3RCZA 2K8CA 4ICUA 4BBNC 4FJZA 2K6DB 2GBRA 3AU5A 2GMIC 5AEKB 3PHXB 1I42A 2NBVB 4M8NA 1UBIA 3ZRCA 3QA8A 2KJHB 3WAOA 1WF9A 1AARA 2DYOA 1R4NI 2BWES 4W9HA 4GDKA 4FJYA 1ZGUB 3X23A 2M0XA 4EZKA 2K6QA 4WWOA 3R66C 1K8RB 4I6NB 3NZUA 3KUCB 3L13A 3VTWA 2LGYA 4KDIC 5EDSA 1X1MA 3VTUA 2KFKA 2WX1A 4PYUA 1V2YA 4IW0A 2GOWA 3KYCD 2I1JA 1H4RA 2KJ6A 3HM3A 3ZNID 4EOYA 2AEHA 1WM3A 2DZKA 3VH3B 1YD8U 3ONSA 1MG8A 1WI0A 2Z0EB 3VUYA 4K81A 2CHXA 2LRUA 2N4FA 4WWNA 4EZJA 2BPSA 3B0AA 4IUMB 2LI5A 2MP2B 4MDKE 3T9LA 4WJOA 1WMHB 2V1YA 3ALBA 1WFYA 2ZCBA 1WGRA 3ENEA 4PYZA 2KTRA 1WXMA 2LJ5A 2KVRA 4BKSA 2M1MA 3ZNHB 4E3CA 1TTNA 1XT9B 4B9KA 2KQSA 1C1YB 3V6CB 3H6NA 4P7IA 1V5TA 3DVNU 4W9KA 3VTVA 1YQBA 2A4ZA 2G4DB 3SDLC 3IBEA 4WJNA 2YVCA 2ZNVC 3TBLD 2MBBB 2MBQA 2Z0DB 3CSFA 5DCNA 1IP9A 2HE7A 1JRUA 4MGYE 4K7WA 4W9EA 2KANA 3RZFA 2REXA 2DHZA 4PS8A 2FCMA 2PJHA 1ISNA 2XK5B 1Z2MA 4WJPA 2FUHB 3W1SC 2C7NB 4NAWB 5HKHA 1T0YA 3L17A 1E90A 4NPNA 1WR6E 4LDTD 4HDQA 1GNUA 2M8SA 4JIOU 3ZRFA 2AL6A 2J0JA 4GSWA 3Q3FA 5JHBA 2FCQA 3JVZX 3QAQA 4BKSD 1WJ4A 2MLBA 2DX5B 3DBHI 4W9DA 1P0RA 4ZRJA 4ANUA 2MW5A 5CX3A 1HE8A 1SGHA 3IFWB 1V5OA 4KIKA 4NJ7A 5E6OA 5JHAA 2N9PC 1WM2A 4HPLB 1C3TA 1OGWA 4NJ6A 5AZHA 4CO7A 2KX0A 1D3ZA 4MEMA 2BKRB 3DVGY 4MJSB 4BOSC 1WXSA 2BYVE 2V4LA 1NI2A 2C7MB 4EZLA 2C60A 4LJPB 2JUOA 4DHJD 3Q3JA 1UGMA 3H7PA 4HCNB 1WX9A 3QQ8B 2CR5A 1YX6B 2EKEC 3IG3A 4IWQA 3VDZA 4ASWC 4IC7B 2MWSB 3W1SA 3UINB 3QIJA 2BYEA 4GDKB 2KN5A 3S2AA 2ASQA 3WALA 2KDEB 2LXAA 1E8YA 3PRZA 2K8BA 2KKCA 3H7SA 4DBGA 1WXAA 4BKGA 4KSKC 2PE6B 2XBBC 1WX8A 4AP4C 1PQSA 3NHEB 2HTHA 2PPHA 2KFKB 1KLVA 2ZPYA 3L16A 4ZRIA 4URKA 2K25A 5E6PA 3QHTA 2IO2B 4RMAA 2HJ8A 2ZEQA 4AOFA 4WJQA 5L95C 1ZKHA 4TKNA 4HDOA 4FJVB 1SE9A 4HXDA 4IWPA 3EHVA 4EFOA 1TZ1A 2ZVOA 2WYQA 4JL9A 3TCAA 4W9FA 1E8XA 1LXDA 1WJUA 1H8CA 3GOEA 4LDTB 5C23A 4K7UA 4W9IA 2L8JA 3VQIA 2FCNA 2NPTA 2C5LC 3UQBA 1SIFA 2PEAA 3PGEA 3RD2A 3SD5A 4FA6A 5IA7A 1EUVB 2KDIA 3APCA 3L10B 2CHWA 2FIFA 2OJRA 2RPQA 4ANWA 1E8ZA 2KWUB 1J8CA 4XZ4A 2M4NA 2IO3B 2OOBB 2ZCCA 2BKFA 2RGFA 3VXWA 2JT4B 3JW0X 4HK2A 1OQYA 1QZEA 4CYEA 1I35A 1WJNA 3JSVB 5KHOA 3DCGA 1WY8A 3M3JA 2ZJDA 3PVLA 3LDZE 4KSLC 2MCNB 2Y5BB 3W1YA 2L0TA 4DHJB 3M63B 2N1WA 2KXJA 3QWZB 2RSUA 3L08A 3PTFC 3UF8A 2DAFA 3NS8A 2L76A 1Z5SB 4OVVA 5CHFA 2KO3A 3RUIB 4GDLA 4ICVA 2L7RA 4GXBA 3TL5A 1EF5A 1LM8B 2KOXA 2DZMA 4KIKB 3N30A 2D3GA 3U8ZA 3WAPA 4ANXA 5GMVA 3MHSD 3DOWA 2R2OA 4PS7A 5JH5C 3R3MA 5CHWA 3CF6E 1WJ6A 5IAAC 3ZUNA 4A3OA 3EC8A 2MA9B 4CHKA 4DDGD 3HM6X 2JXXA 4B95A 3PZDA 4NNJB 2LRWA 1WE6A 4EUTA 2ZNVB 5KHQA 2JY6A 3QX1A 2KJRA 3SU8X 4ZYNA 2EMSA 2M17A 3VAWA 2L0FA 3A1QA 3JYUA 4W9CA 3T8MA 2O2VA 3QK0A 3H7PB 2WX0A 4ZRKA 3AU4A 4A3PA 2HD5B 4AJWA 3PRMB 4HWIB 4JGHB 3TIXA 4GOCA 1WE7A 3LJ3A 3BY4B 1WZ3A 2KWVB 3PV1A 1KM7A 2CU1A 4GB9A 4MGIE 3PREA 1E7VA 3VHTC 4KDLB 1KJTA 4YL8A 2PE9A 3DQVA 1R4MI 3KW5B 4FADA 2KMCA 3PRPB 3CSTA 3ZTCA 4GMVA 4MELA 5D2MB 5DPSA 2LVPA 3PS6A 1P3QU 1RLFA 3N32A 2AWTA 2KQ7A 3VUWA 3A9KA 5LLIA 4IWOA 4DWFA 4F7ZA 1V49A 2GBNA 4W9JA 1WGYA 4GN1A 1WGGA 2BWFA 1J0GA 2N7DA 2NPTB 3NOBA 1F9JA 4M8MA 2IZVB 2LGDA 4MM3A 1RRBA 2ZPNA 4MH0E 4G11A 4AUQC 1WH3A 3DBLI 2NR2A 2A5UA 2DZJA 2CKHB 2N9EB 3A4RA 5AZGA 2D10A 3OLMD 2K1FA 3MTNB 5J18A 3NY5A 4KVGB 4KV2A 4BFRA 2AYOB 3PT2B 3V60A 2FNJB 1NBFC 3HIZA 2NS5A 1YX5B 2FCSA 1UH6A 4E74A 2KDBA 1FXTB 2JRIB 1UZXB 1WX7A 5D6JB 4MGZE 3VUXA 3TMPB 4IM3A 4GU2A 2FIDA 4JLCA 4DDID 1UD7A 4EEWA 2QHOA 3TJPA 3ZVVA 5LXIB 4J6IA 2IY0B 3EFUA 2UWQA 2DYBA 3L0WB 2N7EA 4IM0A 5G2NA 3ZKJC 5C1ZA 4DHZE 2IYDB 3RT3B 4RM8A 4HPMB 4GDLB 4FHJA 2K8HA 4FULA 4II3B 4K1RB 4MSQB 1V80A 1XQQA 4W9GA 5DPRA 3ZIMA 2NCNA 2DENB 4DHZB 2KTRB 4M0WB 4NQLB 3ZDTA 2O6VA 2LGXA 2MQJA 1VCBA 2KFJA 2R2QA 4NY0A 2UYZB 2LZ6A 3V61A 1IPGA 2MBHA 2NBUA 1TGZB 3IVFA 2D2QA 2CHZA 1YJ1A 2IBIB 1WZ0A 3PLVA 5CHVC 3V62A 3I3TB 2J0KA 3X0WA 3WANA 1IYFA 3A1QB 4WQOB 3ZO5B 1GJZA 2O2VB 3U7DA 3NZSA 3ECIA 3HHMA 2MBOA 4BKTA 2L00B 1WIAA 2CS4A 3H9DA 2JRHA 1OEYA 4MGKE 1GG3A 1S1QB 1WYWB 4ANVA 3VH4B 5J2RA 2RD0A 1Q5WB 1NDDA 1YIWA 4FBJB 4BBNF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MX2 A;  4LCD E;  4XC2 A;  3ZNG C;  3ZNZ B;  2JPH A;  2MRP A;  2O6V D;  4G0N B;  4IG7 B;  2D07 B;  2I1K A;  5G55 A;  4AJY B;  1P1A A;  3OJ3 A;  2KMA A;  3DDC B;  1TBE A;  2G4S A;  3SHQ A;  2KNB A;  1OTR B;  2BYF A;  3A9K B;  3DBR I;  3C0R B;  3APF A;  1G6J A;  2VRR B;  2BGF A;  2MSE D;  2N1V A;  1RAX A;  3ZTD A;  2JZZ A;  3DVG X;  4JQW C;  4MSM B;  4N9F 4;  4BVU C;  2JWZ A;  3RZW C;  1GC7 A;  2LXC A;  3D32 A;  3ML9 A;  1V81 A;  2GBK A;  4RM9 A;  3KUD B;  2JVC A;  4TQ1 A;  5BO4 B;  2C9W B;  1S3S G;  3UGB B;  3R7R A;  3M62 B;  5D7G A;  3A9J A;  2IO1 B;  2KK8 A;  2LUE A;  2KD0 A;  3UQA A;  3A4S C;  1E8W A;  1GUA B;  2K39 A;  2V3S A;  2LVO A;  2B3A A;  2LD9 A;  1V9J A;  3APD A;  4HJK A;  4NQK E;  2KLG A;  3IHP C;  4I6L B;  1E7U A;  1J19 A;  3PPA A;  3WA0 A;  1V86 A;  1KOT A;  2AL3 A;  1Q1O A;  2N9X A;  2LWP A;  2WDT B;  5CTR C;  4A20 A;  4F8C B;  3VFK A;  3QJZ A;  1EO6 A;  3KUZ A;  2L05 A;  3K9P B;  2FAZ A;  4BOZ B;  2ZZP B;  4TUU A;  4W9L A;  4X57 B;  5JZE B;  1UEL A;  2LAS A;  1LFD A;  3ZLZ A;  3EEC A;  4ZDV A;  2LVQ A;  3JSV A;  3ML8 A;  1L2N A;  5AZF A;  1UBQ A;  2YLM A;  3WIM A;  2DYM A;  1U4A A;  3AI5 A;  3HK0 A;  1ZW7 A;  1OEY J;  2Z59 B;  4FN2 A;  3K9O B;  1Q0W B;  2KDF B;  3V6E B;  2L3Z A;  2RR9 A;  3KYD D;  3QCA A;  4EKU A;  4KZC A;  2O6V B;  3H1U A;  2KC1 A;  1GC6 A;  3PLU A;  1Y8R C;  2MP2 A;  1WMH A;  3O65 B;  2GBJ A;  4DK5 A;  3CMM B;  1RFA A;  1WGD A;  2W9N A;  2MBE A;  3QAR A;  2G45 B;  3OJ4 B;  1LQB A;  2IY1 B;  1CMX B;  1WXV A;  1P9D U;  3ZDM C;  2GBM A;  1E5W A;  4HCP B;  3PSE B;  2BF8 B;  2KTF A;  4OVU A;  4HLE A;  1WR1 A;  4G3X B;  4I6P A;  3P2B A;  5FR6 A;  4HVB A;  5DPW A;  3DPD A;  2JF5 A;  4FHK A;  3L54 A;  1M94 A;  2EMT A;  2XEW A;  3M95 A;  1WRD B;  4GIV A;  2NBW B;  3DBS A;  3VVW B;  4G50 A;  2DZI A;  1A5R A;  4K7S A;  5D94 A;  1WGH A;  3R7Q A;  2XK5 A;  5E6N A;  3DVN V;  3KVF B;  4DXA B;  4E71 A;  5J17 A;  3KH0 A;  5L83 A;  4NAW A;  2IO0 B;  3UIO B;  1L7Y A;  2J0M A;  4TQ0 A;  2KWC A;  2KC2 A;  4XX5 A;  3RUL A;  2C7H A;  4GGQ A;  2JZ3 B;  4B6W A;  2ZVN A;  3QC8 B;  2G3Q B;  1P98 A;  3BIN A;  4AWJ A;  1BT0 A;  1XD3 B;  1V6E A;  3N3K B;  1EF1 A;  4KZ0 A;  3U30 A;  5DPT A;  5LXH A;  2DAJ A;  3OAW A;  4IM2 A;  3B08 A;  2WWZ A;  4PS3 A;  3B1L X;  2D11 A;  1VD2 A;  3AXC A;  2KX3 A;  4WWP A;  2KHW B;  3MJW A;  3UIP B;  4LJO B;  2NVU I;  4MJS A;  3RYT A;  4F1S A;  4FLH A;  3A9J B;  4TV3 A;  3A33 B;  2KLC A;  3ZW3 A;  2J7Q B;  3PHW B;  3WAM A;  5TR5 A;  4II2 B;  4WAA A;  3GZN I;  2KZR A;  3AUL A;  3RCZ A;  2K8C A;  4ICU A;  4BBN C;  4FJZ A;  2K6D B;  2GBR A;  3AU5 A;  2GMI C;  5AEK B;  3PHX B;  1I42 A;  2NBV B;  4M8N A;  1UBI A;  3ZRC A;  3QA8 A;  2KJH B;  3WAO A;  1WF9 A;  1AAR A;  2DYO A;  1R4N I;  2BWE S;  4W9H A;  4GDK A;  4FJY A;  1ZGU B;  3X23 A;  2M0X A;  4EZK A;  2K6Q A;  4WWO A;  3R66 C;  1K8R B;  4I6N B;  3NZU A;  3KUC B;  3L13 A;  3VTW A;  2LGY A;  4KDI C;  5EDS A;  1X1M A;  3VTU A;  2KFK A;  2WX1 A;  4PYU A;  1V2Y A;  4IW0 A;  2GOW A;  3KYC D;  2I1J A;  1H4R A;  2KJ6 A;  3HM3 A;  3ZNI D;  4EOY A;  2AEH A;  1WM3 A;  2DZK A;  3VH3 B;  1YD8 U;  3ONS A;  1MG8 A;  1WI0 A;  2Z0E B;  3VUY A;  4K81 A;  2CHX A;  2LRU A;  2N4F A;  4WWN A;  4EZJ A;  2BPS A;  3B0A A;  4IUM B;  2LI5 A;  2MP2 B;  4MDK E;  3T9L A;  4WJO A;  1WMH B;  2V1Y A;  3ALB A;  1WFY A;  2ZCB A;  1WGR A;  3ENE A;  4PYZ A;  2KTR A;  1WXM A;  2LJ5 A;  2KVR A;  4BKS A;  2M1M A;  3ZNH B;  4E3C A;  1TTN A;  1XT9 B;  4B9K A;  2KQS A;  1C1Y B;  3V6C B;  3H6N A;  4P7I A;  1V5T A;  3DVN U;  4W9K A;  3VTV A;  1YQB A;  2A4Z A;  2G4D B;  3SDL C;  3IBE A;  4WJN A;  2YVC A;  2ZNV C;  3TBL D;  2MBB B;  2MBQ A;  2Z0D B;  3CSF A;  5DCN A;  1IP9 A;  2HE7 A;  1JRU A;  4MGY E;  4K7W A;  4W9E A;  2KAN A;  3RZF A;  2REX A;  2DHZ A;  4PS8 A;  2FCM A;  2PJH A;  1ISN A;  2XK5 B;  1Z2M A;  4WJP A;  2FUH B;  3W1S C;  2C7N B;  4NAW B;  5HKH A;  1T0Y A;  3L17 A;  1E90 A;  4NPN A;  1WR6 E;  4LDT D;  4HDQ A;  1GNU A;  2M8S A;  4JIO U;  3ZRF A;  2AL6 A;  2J0J A;  4GSW A;  3Q3F A;  5JHB A;  2FCQ A;  3JVZ X;  3QAQ A;  4BKS D;  1WJ4 A;  2MLB A;  2DX5 B;  3DBH I;  4W9D A;  1P0R A;  4ZRJ A;  4ANU A;  2MW5 A;  5CX3 A;  1HE8 A;  1SGH A;  3IFW B;  1V5O A;  4KIK A;  4NJ7 A;  5E6O A;  5JHA A;  2N9P C;  1WM2 A;  4HPL B;  1C3T A;  1OGW A;  4NJ6 A;  5AZH A;  4CO7 A;  2KX0 A;  1D3Z A;  4MEM A;  2BKR B;  3DVG Y;  4MJS B;  4BOS C;  1WXS A;  2BYV E;  2V4L A;  1NI2 A;  2C7M B;  4EZL A;  2C60 A;  4LJP B;  2JUO A;  4DHJ D;  3Q3J A;  1UGM A;  3H7P A;  4HCN B;  1WX9 A;  3QQ8 B;  2CR5 A;  1YX6 B;  2EKE C;  3IG3 A;  4IWQ A;  3VDZ A;  4ASW C;  4IC7 B;  2MWS B;  3W1S A;  3UIN B;  3QIJ A;  2BYE A;  4GDK B;  2KN5 A;  3S2A A;  2ASQ A;  3WAL A;  2KDE B;  2LXA A;  1E8Y A;  3PRZ A;  2K8B A;  2KKC A;  3H7S A;  4DBG A;  1WXA A;  4BKG A;  4KSK C;  2PE6 B;  2XBB C;  1WX8 A;  4AP4 C;  1PQS A;  3NHE B;  2HTH A;  2PPH A;  2KFK B;  1KLV A;  2ZPY A;  3L16 A;  4ZRI A;  4URK A;  2K25 A;  5E6P A;  3QHT A;  2IO2 B;  4RMA A;  2HJ8 A;  2ZEQ A;  4AOF A;  4WJQ A;  5L95 C;  1ZKH A;  4TKN A;  4HDO A;  4FJV B;  1SE9 A;  4HXD A;  4IWP A;  3EHV A;  4EFO A;  1TZ1 A;  2ZVO A;  2WYQ A;  4JL9 A;  3TCA A;  4W9F A;  1E8X A;  1LXD A;  1WJU A;  1H8C A;  3GOE A;  4LDT B;  5C23 A;  4K7U A;  4W9I A;  2L8J A;  3VQI A;  2FCN A;  2NPT A;  2C5L C;  3UQB A;  1SIF A;  2PEA A;  3PGE A;  3RD2 A;  3SD5 A;  4FA6 A;  5IA7 A;  1EUV B;  2KDI A;  3APC A;  3L10 B;  2CHW A;  2FIF A;  2OJR A;  2RPQ A;  4ANW A;  1E8Z A;  2KWU B;  1J8C A;  4XZ4 A;  2M4N A;  2IO3 B;  2OOB B;  2ZCC A;  2BKF A;  2RGF A;  3VXW A;  2JT4 B;  3JW0 X;  4HK2 A;  1OQY A;  1QZE A;  4CYE A;  1I35 A;  1WJN A;  3JSV B;  5KHO A;  3DCG A;  1WY8 A;  3M3J A;  2ZJD A;  3PVL A;  3LDZ E;  4KSL C;  2MCN B;  2Y5B B;  3W1Y A;  2L0T A;  4DHJ B;  3M63 B;  2N1W A;  2KXJ A;  3QWZ B;  2RSU A;  3L08 A;  3PTF C;  3UF8 A;  2DAF A;  3NS8 A;  2L76 A;  1Z5S B;  4OVV A;  5CHF A;  2KO3 A;  3RUI B;  4GDL A;  4ICV A;  2L7R A;  4GXB A;  3TL5 A;  1EF5 A;  1LM8 B;  2KOX A;  2DZM A;  4KIK B;  3N30 A;  2D3G A;  3U8Z A;  3WAP A;  4ANX A;  5GMV A;  3MHS D;  3DOW A;  2R2O A;  4PS7 A;  5JH5 C;  3R3M A;  5CHW A;  3CF6 E;  1WJ6 A;  5IAA C;  3ZUN A;  4A3O A;  3EC8 A;  2MA9 B;  4CHK A;  4DDG D;  3HM6 X;  2JXX A;  4B95 A;  3PZD A;  4NNJ B;  2LRW A;  1WE6 A;  4EUT A;  2ZNV B;  5KHQ A;  2JY6 A;  3QX1 A;  2KJR A;  3SU8 X;  4ZYN A;  2EMS A;  2M17 A;  3VAW A;  2L0F A;  3A1Q A;  3JYU A;  4W9C A;  3T8M A;  2O2V A;  3QK0 A;  3H7P B;  2WX0 A;  4ZRK A;  3AU4 A;  4A3P A;  2HD5 B;  4AJW A;  3PRM B;  4HWI B;  4JGH B;  3TIX A;  4GOC A;  1WE7 A;  3LJ3 A;  3BY4 B;  1WZ3 A;  2KWV B;  3PV1 A;  1KM7 A;  2CU1 A;  4GB9 A;  4MGI E;  3PRE A;  1E7V A;  3VHT C;  4KDL B;  1KJT A;  4YL8 A;  2PE9 A;  3DQV A;  1R4M I;  3KW5 B;  4FAD A;  2KMC A;  3PRP B;  3CST A;  3ZTC A;  4GMV A;  4MEL A;  5D2M B;  5DPS A;  2LVP A;  3PS6 A;  1P3Q U;  1RLF A;  3N32 A;  2AWT A;  2KQ7 A;  3VUW A;  3A9K A;  5LLI A;  4IWO A;  4DWF A;  4F7Z A;  1V49 A;  2GBN A;  4W9J A;  1WGY A;  4GN1 A;  1WGG A;  2BWF A;  1J0G A;  2N7D A;  2NPT B;  3NOB A;  1F9J A;  4M8M A;  2IZV B;  2LGD A;  4MM3 A;  1RRB A;  2ZPN A;  4MH0 E;  4G11 A;  4AUQ C;  1WH3 A;  3DBL I;  2NR2 A;  2A5U A;  2DZJ A;  2CKH B;  2N9E B;  3A4R A;  5AZG A;  2D10 A;  3OLM D;  2K1F A;  3MTN B;  5J18 A;  3NY5 A;  4KVG B;  4KV2 A;  4BFR A;  2AYO B;  3PT2 B;  3V60 A;  2FNJ B;  1NBF C;  3HIZ A;  2NS5 A;  1YX5 B;  2FCS A;  1UH6 A;  4E74 A;  2KDB A;  1FXT B;  2JRI B;  1UZX B;  1WX7 A;  5D6J B;  4MGZ E;  3VUX A;  3TMP B;  4IM3 A;  4GU2 A;  2FID A;  4JLC A;  4DDI D;  1UD7 A;  4EEW A;  2QHO A;  3TJP A;  3ZVV A;  5LXI B;  4J6I A;  2IY0 B;  3EFU A;  2UWQ A;  2DYB A;  3L0W B;  2N7E A;  4IM0 A;  5G2N A;  3ZKJ C;  5C1Z A;  4DHZ E;  2IYD B;  3RT3 B;  4RM8 A;  4HPM B;  4GDL B;  4FHJ A;  2K8H A;  4FUL A;  4II3 B;  4K1R B;  4MSQ B;  1V80 A;  1XQQ A;  4W9G A;  5DPR A;  3ZIM A;  2NCN A;  2DEN B;  4DHZ B;  2KTR B;  4M0W B;  4NQL B;  3ZDT A;  2O6V A;  2LGX A;  2MQJ A;  1VCB A;  2KFJ A;  2R2Q A;  4NY0 A;  2UYZ B;  2LZ6 A;  3V61 A;  1IPG A;  2MBH A;  2NBU A;  1TGZ B;  3IVF A;  2D2Q A;  2CHZ A;  1YJ1 A;  2IBI B;  1WZ0 A;  3PLV A;  5CHV C;  3V62 A;  3I3T B;  2J0K A;  3X0W A;  3WAN A;  1IYF A;  3A1Q B;  4WQO B;  3ZO5 B;  1GJZ A;  2O2V B;  3U7D A;  3NZS A;  3ECI A;  3HHM A;  2MBO A;  4BKT A;  2L00 B;  1WIA A;  2CS4 A;  3H9D A;  2JRH A;  1OEY A;  4MGK E;  1GG3 A;  1S1Q B;  1WYW B;  4ANV A;  3VH4 B;  5J2R A;  2RD0 A;  1Q5W B;  1NDD A;  1YIW A;  4FBJ B;  4BBN F; 
#chains in the Genus database with same CATH topology
 4OZC A;  2JPH A;  4IG7 B;  2D07 B;  3I5J C;  2KMA A;  5IO9 A;  4YXD B;  2KNB A;  2BYF A;  5HFY A;  3ZTD A;  2JZZ A;  3RZW C;  2LXC A;  1XLP A;  4NJC A;  3IAM 1;  3TSS A;  1S3S G;  3M62 B;  1ZOY B;  1N6Z A;  3R2T A;  2KK8 A;  1FCL A;  2KD0 A;  2WLB A;  1QF6 A;  2PKO A;  4NAM A;  4NQK E;  3IHP C;  1KOT A;  2AL3 A;  1Q1O A;  1NEK B;  5CTR C;  3VFK A;  3KUZ A;  3ZQ4 A;  2V9H A;  4TUU A;  1MVK A;  3HVD A;  3AE6 B;  4WQM A;  3RI7 C;  3SEB A;  4ZDV A;  2LVQ A;  3JSV A;  5AZF A;  1YMH E;  4IOI E;  2L83 A;  3BVG A;  4RH6 A;  4YSZ B;  3AI5 A;  2Z59 B;  1V1P B;  1F2R C;  4REZ A;  3V6E B;  5HHD G;  1JRO A;  1GB4 A;  1TS2 A;  1FNV A;  1TIF A;  3H1U A;  2B76 B;  1BUI C;  2IGG A;  1XLO A;  1LQB A;  1FNU A;  1CMX B;  2LGS A;  4G3X B;  3M95 A;  3DBS A;  4G50 A;  5D94 A;  2QEJ C;  2XK5 A;  5J17 A;  3KVF B;  4E71 A;  2BS4 B;  2WXJ A;  2J0M A;  4TQ0 A;  3R2I A;  3RUL A;  2C7H A;  2BB6 A;  2HJ1 A;  1BT0 A;  1V6E A;  3N3K B;  3VRA B;  5LXH A;  2DAJ A;  4IM2 A;  2IGD A;  1VD2 A;  1HTO A;  2KX3 A;  2KHW B;  3AED B;  2D3A A;  2NVU I;  2KLC A;  2J7Q B;  1DOY A;  2K8C A;  2GBR A;  5AEK B;  3PHX B;  1UBI A;  1I4X A;  4W9H A;  1ZE3 D;  4GDK A;  4OW0 A;  4FJY A;  1B1Z A;  1FPY A;  1Q10 A;  3R66 C;  1F77 A;  5C2T B;  4H2A A;  3VTU A;  3HVZ A;  5BYS A;  3U52 E;  3Q8F A;  1H4R A;  3HM3 A;  3ZNI D;  4EE2 A;  2DZK A;  3AB5 A;  2ZW0 A;  2LUM A;  4K81 A;  2PLP A;  2PMV A;  2N4F A;  2BPS A;  1VZ6 A;  3B0A A;  4WJO A;  1WMH B;  2Y5C A;  1WGR A;  3ENE A;  1VJK A;  1WXM A;  2KVR A;  4BKS A;  1XT9 B;  5JXV A;  3DVN U;  3VTV A;  3AE8 B;  3ZXR A;  2A4Z A;  5DCN A;  3BII D;  4MGY E;  3RZF A;  2RDG A;  1TYG B;  4JE3 B;  2PJH A;  3TEX A;  1GB1 A;  3W1S C;  4NAW B;  1T0Y A;  4HDQ A;  1GNU A;  4JIO U;  3ZRF A;  3I9V 1;  2AL6 A;  1M4V A;  3JVZ X;  2MLB A;  4ZRJ A;  4ACF A;  1P0R A;  2K9X A;  2MW5 A;  4YTM B;  1HE8 A;  4NJ7 A;  1OGW A;  4NJ6 A;  1LO5 D;  3DHH C;  4MEM A;  2BKR B;  5I4D A;  1I7H A;  2C60 A;  3AMZ A;  2D5G A;  3Q6B A;  4DHJ D;  3W2D A;  1UGM A;  3EFC A;  3Q14 C;  4HCN B;  2Z8L A;  3IG3 A;  4S17 A;  4ASW C;  3GP7 A;  1TS4 A;  2NTT A;  2LXA A;  1E8Y A;  2KKC A;  3H7S A;  1WXA A;  2LMC A;  5MPO A;  2QJL A;  2XBB C;  4AP4 C;  3NHE B;  2PPH A;  2KFK B;  4ARC A;  5E6P A;  4HDO A;  2N7J A;  4HXD A;  3EHV A;  1TZ1 A;  2BB5 A;  4KX6 B;  1JW9 D;  1E8X A;  4D2K A;  1WJU A;  1H8C A;  4IKG A;  4W9I A;  3P4S B;  2L8J A;  3VQI A;  3RNG C;  2PEA A;  1PGX A;  1E0Z A;  3APC A;  3BVZ A;  3I63 C;  2OJR A;  3H8H A;  2IO3 B;  3AH7 A;  4LNI A;  4C4V A;  3JSV B;  1QIL A;  2Y5B B;  1GPX A;  5T8I A;  2N1W A;  2KVZ A;  2RSU A;  3L08 A;  1WRI A;  1D5M C;  1Z5S B;  4GDL A;  4ICV A;  4K3C A;  1EF5 A;  2D3G A;  3OG5 A;  2R2O A;  5CHW A;  3ZUN A;  2JU6 X;  3PZ8 A;  2JXX A;  4EUT A;  2ZNV B;  2JY6 A;  2IGH A;  5EE1 A;  2KJR A;  1TKG A;  1R7S A;  3ETR A;  4W9C A;  2V3N A;  2W82 A;  3QK0 A;  3AU4 A;  4OZB A;  3P1M A;  1TZO A;  2AQ1 B;  1WZ3 A;  3VHT C;  1KM7 A;  4KDL B;  2QCZ A;  1KJT A;  4YL8 A;  4AS1 A;  4L1B A;  1FEH A;  3CST A;  5D2M B;  1MG4 A;  3VUW A;  1K50 A;  4F7Z A;  1TJE A;  1E10 A;  3RPF C;  1J0G A;  2N7D A;  2IZV B;  2LGD A;  4HKQ A;  4AUQ C;  3DBL I;  3ZGZ A;  2NR2 A;  3A4R A;  2N9E B;  3OLM D;  2AQ2 B;  4KV2 A;  2PVO D;  1C4P A;  2AYO B;  3NVW A;  3HIZ A;  4E74 A;  2KDB A;  3B9J A;  1XF5 L;  4JPS A;  4EEW A;  1OQQ A;  3MP9 A;  4LLG M;  4RGO S;  4DQO C;  5C1Z A;  4DHZ E;  1UF0 A;  4MSQ B;  1V80 A;  4W9G A;  5DPR A;  3ZIM A;  3BZD B;  3RMK C;  4M0W B;  2NMQ A;  1NYR A;  2KFJ A;  1L6U A;  4XDD A;  4OHJ A;  1TGZ B;  3IVF A;  2D2Q A;  2CHZ A;  1WZ0 A;  4US9 A;  3V62 A;  3X0W A;  4KKI A;  2KWD A;  1SBB B;  3A1Q B;  3ZO5 B;  1GJZ A;  1EU3 A;  2O2V B;  3U7D A;  4RGN A;  4BKT A;  1WIA A;  2ONQ A;  2BTE A;  4MT5 A;  3U2S C;  4ANV A;  3VH4 B;  1AYF A;  5TSS A;  2RD0 A;  1YIW A;  3TEW A;  4FBJ B;  2MX2 A;  4LCD E;  2BW2 A;  3ZNG C;  2KMM A;  1P1A A;  5H8Y E;  3DDC B;  2G4S A;  3SHQ A;  2INP E;  1C78 A;  2QIE B;  3A9K B;  3DBR I;  1C9F A;  1TY0 A;  2MSE D;  1WWT A;  3DVG X;  4N9F 4;  1P7F A;  2JWZ A;  2WU5 B;  1GC7 A;  4LTU A;  3R7R A;  4MM3 B;  2IO1 B;  2LUE A;  3UQA A;  3A4S C;  1E8W A;  2B3A A;  2JWU A;  1V9J A;  3APD A;  3U4E G;  1L4D B;  3AEA B;  2KLG A;  3VR8 B;  1V86 A;  1XEE A;  2RDB C;  3LXF A;  2N9X A;  2WDT B;  3QJZ A;  1WYG A;  1NVI D;  4W9L A;  4X57 B;  5JZE B;  3LB8 C;  3EEC A;  1L2N A;  4KKJ A;  2IND C;  3WIM A;  5FR3 A;  1U4A A;  2WXM A;  1RM6 C;  2KDF B;  2RR9 A;  3QCA A;  4EKU A;  1WMH A;  3O65 B;  2GBJ A;  4P16 A;  1C76 A;  3CMM B;  2JYE A;  2G45 B;  1UUP A;  2IY1 B;  3RFZ B;  3ZDM C;  4NZL B;  4HCP B;  1BXT A;  5FR6 A;  2E6X A;  2JF5 A;  4FHK A;  3L54 A;  1WRD B;  1YOV B;  2MEK A;  4NAW A;  1IBX B;  3P4P B;  5D3I B;  4M00 A;  2INN E;  1E7P B;  4AWJ A;  1XD3 B;  2XN9 C;  2N9L A;  1EF1 A;  1ZDV A;  1QT9 A;  1EM7 A;  4PS3 A;  3B2F A;  3MJW A;  3UIP B;  4US8 A;  4HKZ E;  4F1S A;  4FLH A;  3ABV B;  3ZW3 A;  1N63 A;  3P4R B;  3DBL B;  4II2 B;  3AUL A;  4ICU A;  1WXQ A;  3NZ3 A;  3V3X A;  2K6D B;  1I42 A;  4GLS C;  1YJJ A;  2NBV B;  3QA8 A;  3WAO A;  1JQ4 A;  2DYO A;  1CJE A;  5FKA C;  3CIR B;  4A8X C;  1ZP0 B;  3X23 A;  4EZK A;  1K8R B;  3KUC B;  1C4A A;  3AE4 B;  2G9H D;  2MJ3 A;  3VTW A;  5EDS A;  1PDX A;  2KFK A;  3N9Y C;  1K53 A;  2GOW A;  2QIL A;  3KYC D;  2D3B A;  1KH0 A;  1ESF A;  1WM3 A;  1WI0 A;  4ZHP A;  2V1Y A;  3ALB A;  3Q3M C;  4PYZ A;  2KTR A;  2LJ5 A;  4E3C A;  3ZNH B;  2UU7 A;  4B9K A;  1C1Y B;  3H6N A;  1V5T A;  3NJT A;  4W9K A;  1YQB A;  1JWB D;  1KRH A;  2MBQ A;  3CSF A;  3GZN B;  4USA A;  4DXG A;  2QC8 A;  1IP9 A;  2HE7 A;  1JRU A;  1LGR A;  2KAN A;  3IT4 B;  5EE3 A;  4WJP A;  1EU4 A;  2KN4 A;  1ZPS A;  2K5P A;  1VLB A;  2WXF A;  4NPN A;  1F52 A;  5AUI A;  2FCQ A;  2DX5 B;  3BYY B;  3DBR B;  5CX3 A;  2N9P C;  2LEK A;  1TS3 A;  1D3Z A;  3GB1 A;  3DVG Y;  2KAC A;  2V4L A;  3R8B A;  1QOF A;  2WXG A;  1VR9 A;  2WDR B;  3EUB 2;  2J4X A;  2MWS B;  3QIJ A;  2V4I B;  3ZJT A;  2KN5 A;  4BKG A;  1PGB A;  1QOA A;  2PE6 B;  4KGR A;  2BS3 B;  2J42 A;  2ZPY A;  1AWD A;  4ZRI A;  4URK A;  1OFF A;  2JYT A;  2HJ8 A;  1ZKH A;  4FJV B;  4EFO A;  1N5W A;  1KTK A;  2ON8 A;  3DBH B;  4XE0 A;  2SEB D;  3UQB A;  1SIF A;  3SD5 A;  4S0R A;  4FA6 A;  3L10 B;  5BMH A;  2CHW A;  1V97 A;  2FIF A;  1V1O A;  4ANW A;  2KWU B;  2ACZ B;  2M4N A;  2ZCC A;  1EWY C;  3FIL B;  3VXW A;  4HK2 A;  4CYE A;  2R61 A;  1I35 A;  2CJN A;  1WJN A;  1KFY B;  3M3J A;  2ZJD A;  3PVL A;  4KSL C;  4XDC A;  4DHJ B;  4LNN A;  5IKC M;  4OVV A;  3TL5 A;  2KO3 A;  1ET9 A;  1LM8 B;  1STE A;  2KOX A;  1KF6 B;  3P63 A;  3N30 A;  4ANX A;  5GMV A;  3MHS D;  1VRA B;  3DOW A;  4PS7 A;  4M0W A;  3BK2 A;  3CF6 E;  1WJ6 A;  4C56 C;  2PW9 A;  4A3O A;  1J7A A;  3EC8 A;  3MC8 A;  3J9C A;  1L5P A;  4NNJ B;  1WE6 A;  1T0Q C;  5KHQ A;  3SU8 X;  2WU2 B;  4A6Q A;  4YWG G;  2DLB A;  2M17 A;  2L0F A;  3A1Q A;  1XLQ A;  2O2V A;  4ZRK A;  4A3P A;  2BVC A;  4HWI B;  3TIX A;  1ZDX A;  4PK1 A;  3P42 A;  2WHI A;  3LJ3 A;  3DHI C;  3BY4 B;  3BWU D;  3PRP B;  3ZTC A;  2WDV B;  1BML C;  2AWT A;  3A9K A;  1T5X D;  4OZA A;  2KQ4 X;  1HZ6 A;  1WGY A;  2BWF A;  3NOB A;  4RFB A;  5BMI A;  4MM3 A;  1C77 A;  2ZPN A;  4MH0 E;  2QSD A;  5J18 A;  4BFR A;  5GXG B;  2NS5 A;  4WAF A;  2JRI B;  2LHD A;  1UZX B;  1N62 A;  4L23 A;  2QHO A;  4IM0 A;  2HTM E;  2IYD B;  4II3 B;  4FXC A;  1XQQ A;  2WXK A;  2NCN A;  1NEN B;  2KTR B;  4NQL B;  2MQJ A;  1VCB A;  2R2Q A;  3AE1 B;  4NY0 A;  1ENF A;  2MBH A;  2NBU A;  1YJ1 A;  1JWA D;  1YJI A;  1UNS A;  3WAN A;  1K52 A;  1VZ8 A;  1MI0 A;  2FBW B;  4IDI A;  1C79 A;  1Y56 A;  1OEY A;  4MGK E;  1QOB A;  1S1Q B;  1WYW B;  1F1H A;  1Q5W B;  1NDD A;  4BBN F;  4XC2 A;  3ZNZ B;  1IBX A;  2MRP A;  2O6V D;  4G0N B;  2I1K A;  3CWI A;  5G55 A;  3OJ3 A;  2ICI A;  1TBE A;  3TEY A;  2H89 B;  1QKZ A;  1RYJ A;  1G6J A;  3APF A;  3O13 A;  2VRR B;  1NYQ A;  4JQW C;  3D32 A;  4P6V F;  1V81 A;  2GBK A;  3KUD B;  1WGK A;  4TQ1 A;  1YN3 A;  2C9W B;  4RNA A;  4HPP A;  2IDY A;  3AV8 A;  3BYT B;  2OJW A;  2MJE A;  3HUI A;  1GUA B;  2V3S A;  3E9S A;  2LVO A;  2LD9 A;  4A9A A;  3AE9 B;  2INC C;  1E7U A;  1J19 A;  3PPA A;  2LWP A;  3HRD D;  1EO6 A;  2L05 A;  3K9P B;  5HI1 A;  4BOZ B;  2ZZP B;  4B0E A;  1UEL A;  1LFD A;  3ZLZ A;  3ML8 A;  4ITK A;  2WS3 B;  2YLM A;  2DYM A;  3HK0 A;  1OEY J;  3K9O B;  1Q0W B;  5G5H A;  2L3Z A;  4KZC A;  3IAS 1;  2LHE A;  1GC6 A;  4HJG E;  3URY A;  2VZK D;  3PLU A;  2RDH A;  1ET6 A;  4DK5 A;  1RFA A;  2AX5 A;  2WXQ A;  3NVY A;  3Q8B A;  1FXI A;  2RMM A;  1WXV A;  4XYC A;  1P9D U;  2GBM A;  1E5W A;  1DOX A;  2BF8 B;  3AE7 B;  2J52 A;  1YQ3 B;  4HVB A;  3NRZ A;  4I6P A;  5DPW A;  1SSN A;  3DPD A;  1UGJ A;  2XEW A;  2EMT A;  4XWT A;  2NBW B;  1A5R A;  1TY2 A;  4K7S A;  4KGT A;  5E6N A;  1L6V A;  2IO0 B;  2SAK A;  1L7Y A;  2KWC A;  2KC2 A;  3I57 A;  2JZ3 B;  2ZVN A;  3QC8 B;  2G3Q B;  1P98 A;  2JSV X;  4KZ0 A;  4O1N A;  3U30 A;  5DPT A;  4RF1 A;  3OAW A;  3AXC A;  4LNO A;  1ACC A;  4WWP A;  3KWV A;  3A9J B;  3A33 B;  1PFD A;  3WAM A;  5TR5 A;  1IGD A;  3GZN I;  1SJH D;  2W54 A;  1D4B A;  3W5V B;  4BBN C;  4FJZ A;  3ZRC A;  2KJH B;  2TSS A;  1WF9 A;  1AAR A;  1P7E A;  2KYW A;  1F2R I;  1ZGU B;  2M0X A;  2PIA A;  2WQY B;  4ZRQ A;  3NZU A;  3SR6 A;  2I2Y A;  4BAX A;  3SFE B;  2LGY A;  3Q69 A;  1X1M A;  4RGT A;  1SB3 C;  1V2Y A;  1HA5 A;  2KJ6 A;  4MH8 A;  4EOY A;  4B0M A;  2AEH A;  1FCC C;  3PO0 A;  3ONS A;  1J7C A;  1YD8 U;  3VH3 B;  2WXI A;  2WGS A;  2Z0E B;  2CHX A;  2LRU A;  2N0S B;  4EZJ A;  4IUM B;  2LI5 A;  2MP2 B;  4MDK E;  3T9L A;  2ZCB A;  1DGJ A;  3NVV A;  4TMA B;  3AE2 B;  3B2G A;  3V6C B;  2WXN A;  4P7I A;  4ZHO A;  1MJD A;  2V0G A;  2G4D B;  3Q8C A;  3IBE A;  3SDL C;  3FIL A;  3FAH A;  4WIP A;  2MBB B;  1T0S C;  4LNF A;  2BT6 A;  4K7W A;  3Q8A A;  3DWG C;  4UDU C;  2REX A;  2DHZ A;  2OHF A;  2C7N B;  1E90 A;  1WSP A;  4LDT D;  2BYT A;  4GSW A;  1UWM A;  5JHB A;  3QAQ A;  4BKS D;  1WJ4 A;  3AEG B;  3DBH I;  4W9D A;  3MC0 B;  1SGH A;  2EEL A;  5E6O A;  5JHA A;  2W55 A;  1QOG A;  1QLB B;  2CJO A;  1C3T A;  2DNF A;  3RNE C;  5AZH A;  4MJS B;  2MHJ A;  1FRD A;  2L1A A;  4P1C C;  5BYQ A;  3W9C B;  1SIJ A;  2JUO A;  3QQ8 B;  3VDZ A;  2CR5 A;  2VH2 A;  4IWQ A;  1JAL A;  4IC7 B;  3W1S A;  3UIN B;  2BYE A;  1HQR D;  2ASQ A;  2KDE B;  3P4Q B;  3PRZ A;  2K8B A;  4DBG A;  2PVG C;  4KSK C;  4Q2J A;  1WX8 A;  4XWW A;  5C3J B;  2HTH A;  2L32 A;  3Q3N C;  1KLV A;  2E3T A;  3T3O A;  4RMA A;  1AW7 A;  4WJQ A;  5L95 C;  1SXT A;  2CU3 A;  4TKN A;  1FMA D;  2ZVO A;  3TUO A;  2WYQ A;  2LFI A;  2K22 A;  1JWM D;  4W9F A;  1ROE A;  1LXD A;  3GOE A;  5C23 A;  2C5L C;  1L4Z B;  2KDM A;  1E8Z A;  1SE2 A;  2WXR A;  4XZ4 A;  1YQ4 B;  2RGF A;  1QZE A;  2RPV A;  4WWM A;  5KHO A;  3DCG A;  2GB1 A;  2MCN B;  3W1Y A;  2L0T A;  3M63 B;  1YNT E;  2K0P A;  1SF0 A;  3PTF C;  3UF8 A;  4YTN B;  3NS8 A;  1XO3 A;  2L76 A;  5CHF A;  3RUI B;  4GXB A;  1CQV A;  3L4P A;  4XGA B;  2DZM A;  4KIK B;  1F0Z A;  3VRB B;  1YN5 A;  5IAA C;  4ZYS A;  4N58 A;  4DDG D;  3HM6 X;  4WH4 A;  2KT7 A;  2M56 B;  1T3Q A;  3JYU A;  3H7P B;  2WX0 A;  1GOZ A;  2HDE A;  2L52 A;  4HEA 1;  4JGH B;  3NS1 A;  1FFV A;  1KLG D;  2J53 A;  1WE7 A;  3PV1 A;  4GB9 A;  2CU1 A;  3PRE A;  1E7V A;  3C19 A;  2PE9 A;  2W3S A;  3KW5 B;  1A70 A;  4YT0 B;  4GMV A;  5DPS A;  4RF0 A;  2LVP A;  1EWC A;  3MJ5 A;  1RLF A;  3N32 A;  5LLI A;  4IWO A;  2FUG 1;  3N1Y C;  4GN1 A;  1WGG A;  1FNW A;  1SE3 A;  2NPT B;  1F9J A;  2H88 B;  4G11 A;  1WH3 A;  2A5U A;  2DZJ A;  4HRS A;  1XLN A;  1T6B X;  3RNC C;  1I4P A;  2WDQ B;  3V60 A;  2NTS A;  2FNJ B;  1NBF C;  4J3O D;  5EE9 A;  2DBY A;  3RNA C;  3C8Y A;  4MAC A;  1WX7 A;  3VUX A;  4DDI D;  3N20 C;  1UD7 A;  3AN1 A;  3ZVV A;  4C7Z A;  5LXI B;  4J6I A;  3L0W B;  2UWQ A;  2N7E A;  3ZKJ C;  3RT3 B;  4RM8 A;  1R4M B;  2K8H A;  2VH1 A;  3ZDT A;  2LZ6 A;  3ZJU A;  2IPK D;  2QDF A;  3DWM A;  3UI3 A;  2Q5W D;  3KWL A;  3PLV A;  3I3T B;  2J0K A;  3ZJV A;  1IYF A;  2D3C A;  2BS2 B;  1RWS A;  3NZS A;  3BVM A;  3ECI A;  3FKY A;  3HHM A;  2MBO A;  2L00 B;  3EGR A;  1D6E C;  2JRH A;  3H9D A;  1MFW A;  1GG3 A;  5J2R A;  3AEF B;  3RNB C;  2MH7 A;  3NVZ A;  5G5G A;  4AJY B;  4ZRP A;  1FO4 A;  1ZUD 2;  2GLS A;  4JX1 C;  5IP4 D;  1D5Z C;  2GI9 A;  1OTR B;  3C0R B;  1FM0 D;  3ZYY X;  2BGF A;  2N1V A;  1RAX A;  1I4G A;  4MSM B;  4BVU C;  3ML9 A;  4WUR A;  4RM9 A;  2JVC A;  5BO4 B;  3UGB B;  5D7G A;  3A9J A;  2K39 A;  4KGS A;  3DHG C;  4HJK A;  2G1E A;  1JML A;  4I6L B;  3WA0 A;  4ARI A;  4A20 A;  4F8C B;  1MHX A;  2FAZ A;  2JZP A;  4N6E B;  1CZP A;  2LAS A;  3Q3O C;  1FFU A;  3FC4 A;  2X8X X;  4L2Y A;  1UBQ A;  1ZW7 A;  4FN2 A;  2K3U A;  3Q8E A;  3KYD D;  2V3P A;  2O6V B;  2KC1 A;  1Y8R C;  2MP2 A;  3MFG A;  2XNA C;  1WGD A;  2W9N A;  2MBE A;  3QAR A;  5IN7 A;  3V05 A;  3OJ4 B;  3U7Z A;  4CQN A;  5H92 C;  1E6E B;  3PSE B;  4OVU A;  2KTF A;  2WP9 B;  4HLE A;  3NG0 A;  1WR1 A;  3P2B A;  5D3D A;  1M94 A;  4GIV A;  3VVW B;  2DZI A;  1MPE A;  1WGH A;  3R7Q A;  3DVN V;  4DXA B;  3KH0 A;  5L83 A;  3AM9 A;  3UIO B;  1FIQ A;  1JWU D;  4XX5 A;  4GGQ A;  5BMG A;  4B6W A;  1TT5 B;  1N61 A;  3BIN A;  4BZA A;  1ZXI A;  1I4R A;  3PZ7 A;  3B08 A;  2WWZ A;  1FD6 A;  3B1L X;  2D11 A;  1TKY A;  4LJO B;  3RYT A;  4MJS A;  3SFD B;  4TV3 A;  3AE5 B;  1DYQ A;  3PHW B;  4WAA A;  2WXP A;  2KZR A;  3RCZ A;  5LNK 1;  3AU5 A;  2GMI C;  4M8N A;  2VZK B;  2M19 A;  4C00 A;  4M02 A;  1L0V B;  1R4N I;  2BWE S;  3IT6 B;  2K6Q A;  4WWO A;  2IJ0 A;  3EA6 A;  2M0A A;  4I6N B;  1L0X B;  1TS5 A;  1TKE A;  3L13 A;  4KDI C;  1K51 A;  2WX1 A;  3MHZ A;  4PYU A;  2WNM A;  4IW0 A;  2I1J A;  1N60 A;  1QQR A;  3AEE B;  1IUE A;  4PT5 A;  1MG8 A;  3VUY A;  4RGM A;  1N5X A;  4WWN A;  1WFY A;  3IXS A;  3AEB B;  2M1M A;  3GS2 A;  1TTN A;  2KQS A;  2JX5 A;  2YEP F;  4P1B C;  2LGI A;  4WJN A;  2YVC A;  2ZNV C;  3TBL D;  2Z0D B;  4W9E A;  4C80 A;  2OED A;  4PS8 A;  4M01 A;  2FCM A;  1ISN A;  2XK5 B;  1Z2M A;  3N1Z C;  2FUH B;  5HKH A;  3L17 A;  1WR6 E;  3T3N A;  2M8S A;  4ZOH C;  4TSS A;  2J0J A;  2WXH A;  3Q3F A;  2BBC A;  4ANU A;  2I38 A;  4C7Y A;  3IFW B;  4KIK A;  1V5O A;  3N1X C;  2MJD A;  1WM2 A;  4HPL B;  4CO7 A;  2KX0 A;  2BQQ A;  2X38 A;  4BOS C;  1I4Q A;  1C4C A;  1YN4 A;  1WXS A;  2BYV E;  1JRP A;  1NI2 A;  2C7M B;  3AE3 B;  1DOI A;  5IOI A;  4EZL A;  4JWU C;  2WXO A;  4LJP B;  1UWX A;  3Q3J A;  3WCQ A;  3H7P A;  1WX9 A;  1HZ5 A;  1YX6 B;  2EKE C;  4GDK B;  3AEC B;  3S2A A;  3WAL A;  4YSY B;  3ZXV A;  1L0Y B;  2W3R A;  3E56 A;  2Y5P A;  1PQS A;  1PYW D;  3L16 A;  3GE3 C;  2K25 A;  3QHT A;  2IO2 B;  2ZEQ A;  4AOF A;  3NUH B;  3OWE B;  4YTP B;  1SE9 A;  4IWP A;  4JL9 A;  3TCA A;  1T0R C;  2ZW1 A;  4LDT B;  4K7U A;  1V1P A;  4HRO A;  2FCN A;  2NPT A;  4RCO A;  3RD2 A;  3PGE A;  1PGA A;  5IA7 A;  1EUV B;  2KDI A;  5E6J A;  1KLU D;  3W5U B;  2RPQ A;  1J8C A;  2DWQ A;  2WXL A;  2OOB B;  2YEP B;  1IGC A;  1OQR A;  2BKF A;  2JT4 B;  3JW0 X;  1OQY A;  3TJP A;  1WY8 A;  2EKI A;  3LDZ E;  1PUT A;  2QMT A;  4N59 A;  1AN8 A;  1VDV A;  2KXJ A;  3QWZ B;  2Y3A A;  1MHH E;  3Q2A C;  1E9M A;  2DAF A;  1B9R A;  1I4H A;  2L7R A;  5HG2 A;  3MC9 A;  3WAP A;  3U8Z A;  2JQR B;  5JH5 C;  3R3M A;  2LJI A;  2MA9 B;  4CHK A;  4LNK A;  4B95 A;  3PZD A;  2LRW A;  1CK1 A;  1D5X C;  3QX1 A;  1SE4 A;  1JWS D;  4ZYN A;  2EMS A;  3VAW A;  3T8M A;  2HD5 B;  4AJW A;  3PRM B;  1GAQ B;  1RFK A;  4GOC A;  4LK0 M;  1R4N B;  4DXF A;  4MGI E;  2KWV B;  4YSX B;  1XXG A;  3DQV A;  1R4M I;  4FAD A;  1JCK B;  2KMC A;  3BK1 A;  1NI3 A;  1V8C A;  4MEL A;  3PS6 A;  1P3Q U;  2KQ7 A;  1SJE D;  4DWF A;  2N9K A;  5BYR A;  1V49 A;  2GBN A;  4W9J A;  4R3D A;  4M8M A;  1FRR A;  2AQ3 B;  4A55 A;  1RRB A;  2CKH B;  5AZG A;  2GRI A;  2D10 A;  2K1F A;  1XCQ L;  3MTN B;  2PTL A;  3NY5 A;  4KVG B;  3PT2 B;  1SEB D;  5AUK A;  1J7B A;  1YX5 B;  2FCS A;  1UH6 A;  4A90 A;  4C4V B;  1FXT B;  5EE0 A;  4JWS C;  1HTQ A;  4OVZ A;  5D6J B;  3TEZ A;  4MGZ E;  3TMP B;  4IM3 A;  4GU2 A;  2FID A;  1HEZ E;  1VZ7 A;  4JLC A;  2JXT A;  2IY0 B;  1HXY D;  3EFU A;  4AQ7 A;  2DYB A;  5G2N A;  1FXA A;  4HPM B;  4GDL B;  4FHJ A;  4FUL A;  4K1R B;  4K3B A;  1XCT L;  2DEN B;  3VR9 B;  4DHZ B;  3KLS X;  1ZXH A;  2KAJ A;  2LGX A;  2O6V A;  2UYZ B;  3RNF C;  3V61 A;  1IPG A;  2FE8 A;  2IBI B;  5CHV C;  3KQ4 A;  4WQO B;  4QAY A;  2CS4 A;  5FK9 C;  3RN9 C;  3LYY A;  3GE8 C; 
#chains in the Genus database with same CATH homology
 2MX2 A;  4LCD E;  4XC2 A;  3ZNG C;  3ZNZ B;  2JPH A;  2MRP A;  2O6V D;  4G0N B;  4IG7 B;  2D07 B;  2I1K A;  5G55 A;  4AJY B;  1P1A A;  3OJ3 A;  2KMA A;  3DDC B;  1TBE A;  2G4S A;  3SHQ A;  2KNB A;  1OTR B;  2BYF A;  3A9K B;  3DBR I;  3C0R B;  3APF A;  1G6J A;  2VRR B;  2BGF A;  2MSE D;  2N1V A;  1RAX A;  3ZTD A;  2JZZ A;  3DVG X;  4JQW C;  4MSM B;  4N9F 4;  4BVU C;  2JWZ A;  3RZW C;  1GC7 A;  2LXC A;  3D32 A;  3ML9 A;  1V81 A;  2GBK A;  4RM9 A;  3KUD B;  2JVC A;  4TQ1 A;  5BO4 B;  2C9W B;  1S3S G;  3UGB B;  3R7R A;  3M62 B;  5D7G A;  3A9J A;  2IO1 B;  2KK8 A;  2LUE A;  2KD0 A;  3UQA A;  3A4S C;  1E8W A;  1GUA B;  2K39 A;  2V3S A;  2LVO A;  2B3A A;  2LD9 A;  1V9J A;  3APD A;  4HJK A;  4NQK E;  2KLG A;  3IHP C;  4I6L B;  1E7U A;  1J19 A;  3PPA A;  3WA0 A;  1V86 A;  1KOT A;  2AL3 A;  1Q1O A;  2N9X A;  2LWP A;  2WDT B;  5CTR C;  4A20 A;  4F8C B;  3VFK A;  3QJZ A;  1EO6 A;  3KUZ A;  2L05 A;  3K9P B;  2FAZ A;  4BOZ B;  2ZZP B;  4TUU A;  4W9L A;  4X57 B;  5JZE B;  1UEL A;  2LAS A;  1LFD A;  3ZLZ A;  3EEC A;  4ZDV A;  2LVQ A;  3JSV A;  3ML8 A;  1L2N A;  5AZF A;  1UBQ A;  2YLM A;  3WIM A;  2DYM A;  1U4A A;  3AI5 A;  3HK0 A;  1ZW7 A;  1OEY J;  2Z59 B;  4FN2 A;  3K9O B;  1Q0W B;  2KDF B;  3V6E B;  2L3Z A;  2RR9 A;  3KYD D;  3QCA A;  4EKU A;  4KZC A;  2O6V B;  3H1U A;  2KC1 A;  1GC6 A;  3PLU A;  1Y8R C;  2MP2 A;  1WMH A;  3O65 B;  2GBJ A;  4DK5 A;  3CMM B;  1RFA A;  1WGD A;  2W9N A;  2MBE A;  3QAR A;  2G45 B;  3OJ4 B;  1LQB A;  2IY1 B;  1CMX B;  1WXV A;  1P9D U;  3ZDM C;  2GBM A;  1E5W A;  4HCP B;  3PSE B;  2BF8 B;  2KTF A;  4OVU A;  4HLE A;  1WR1 A;  4G3X B;  4I6P A;  3P2B A;  5FR6 A;  4HVB A;  5DPW A;  3DPD A;  2JF5 A;  4FHK A;  3L54 A;  1M94 A;  2EMT A;  2XEW A;  3M95 A;  1WRD B;  4GIV A;  2NBW B;  3DBS A;  3VVW B;  4G50 A;  2DZI A;  1A5R A;  4K7S A;  5D94 A;  1WGH A;  3R7Q A;  2XK5 A;  5E6N A;  3DVN V;  3KVF B;  4DXA B;  4E71 A;  5J17 A;  3KH0 A;  5L83 A;  4NAW A;  2IO0 B;  3UIO B;  1L7Y A;  2J0M A;  4TQ0 A;  2KWC A;  2KC2 A;  4XX5 A;  3RUL A;  2C7H A;  4GGQ A;  2JZ3 B;  4B6W A;  2ZVN A;  3QC8 B;  2G3Q B;  1P98 A;  3BIN A;  4AWJ A;  1BT0 A;  1XD3 B;  1V6E A;  3N3K B;  1EF1 A;  4KZ0 A;  3U30 A;  5DPT A;  5LXH A;  2DAJ A;  3OAW A;  4IM2 A;  3B08 A;  2WWZ A;  4PS3 A;  3B1L X;  2D11 A;  1VD2 A;  3AXC A;  2KX3 A;  4WWP A;  2KHW B;  3MJW A;  3UIP B;  4LJO B;  2NVU I;  4MJS A;  3RYT A;  4F1S A;  4FLH A;  3A9J B;  4TV3 A;  3A33 B;  2KLC A;  3ZW3 A;  2J7Q B;  3PHW B;  3WAM A;  5TR5 A;  4II2 B;  4WAA A;  3GZN I;  2KZR A;  3AUL A;  3RCZ A;  2K8C A;  4ICU A;  4BBN C;  4FJZ A;  2K6D B;  2GBR A;  3AU5 A;  2GMI C;  5AEK B;  3PHX B;  1I42 A;  2NBV B;  4M8N A;  1UBI A;  3ZRC A;  3QA8 A;  2KJH B;  3WAO A;  1WF9 A;  1AAR A;  2DYO A;  1R4N I;  2BWE S;  4W9H A;  4GDK A;  4FJY A;  1ZGU B;  3X23 A;  2M0X A;  4EZK A;  2K6Q A;  4WWO A;  3R66 C;  1K8R B;  4I6N B;  3NZU A;  3KUC B;  3L13 A;  3VTW A;  2LGY A;  4KDI C;  5EDS A;  1X1M A;  3VTU A;  2KFK A;  2WX1 A;  4PYU A;  1V2Y A;  4IW0 A;  2GOW A;  3KYC D;  2I1J A;  1H4R A;  2KJ6 A;  3HM3 A;  3ZNI D;  4EOY A;  2AEH A;  1WM3 A;  2DZK A;  3VH3 B;  1YD8 U;  3ONS A;  1MG8 A;  1WI0 A;  2Z0E B;  3VUY A;  4K81 A;  2CHX A;  2LRU A;  2N4F A;  4WWN A;  4EZJ A;  2BPS A;  3B0A A;  4IUM B;  2LI5 A;  2MP2 B;  4MDK E;  3T9L A;  4WJO A;  1WMH B;  2V1Y A;  3ALB A;  1WFY A;  2ZCB A;  1WGR A;  3ENE A;  4PYZ A;  2KTR A;  1WXM A;  2LJ5 A;  2KVR A;  4BKS A;  2M1M A;  3ZNH B;  4E3C A;  1TTN A;  1XT9 B;  4B9K A;  2KQS A;  1C1Y B;  3V6C B;  3H6N A;  4P7I A;  1V5T A;  3DVN U;  4W9K A;  3VTV A;  1YQB A;  2A4Z A;  2G4D B;  3SDL C;  3IBE A;  4WJN A;  2YVC A;  2ZNV C;  3TBL D;  2MBB B;  2MBQ A;  2Z0D B;  3CSF A;  5DCN A;  1IP9 A;  2HE7 A;  1JRU A;  4MGY E;  4K7W A;  4W9E A;  2KAN A;  3RZF A;  2REX A;  2DHZ A;  4PS8 A;  2FCM A;  2PJH A;  1ISN A;  2XK5 B;  1Z2M A;  4WJP A;  2FUH B;  3W1S C;  2C7N B;  4NAW B;  5HKH A;  1T0Y A;  3L17 A;  1E90 A;  4NPN A;  1WR6 E;  4LDT D;  4HDQ A;  1GNU A;  2M8S A;  4JIO U;  3ZRF A;  2AL6 A;  2J0J A;  4GSW A;  3Q3F A;  5JHB A;  2FCQ A;  3JVZ X;  3QAQ A;  4BKS D;  1WJ4 A;  2MLB A;  2DX5 B;  3DBH I;  4W9D A;  1P0R A;  4ZRJ A;  4ANU A;  2MW5 A;  5CX3 A;  1HE8 A;  1SGH A;  3IFW B;  1V5O A;  4KIK A;  4NJ7 A;  5E6O A;  5JHA A;  2N9P C;  1WM2 A;  4HPL B;  1C3T A;  1OGW A;  4NJ6 A;  5AZH A;  4CO7 A;  2KX0 A;  1D3Z A;  4MEM A;  2BKR B;  3DVG Y;  4MJS B;  4BOS C;  1WXS A;  2BYV E;  2V4L A;  1NI2 A;  2C7M B;  4EZL A;  2C60 A;  4LJP B;  2JUO A;  4DHJ D;  3Q3J A;  1UGM A;  3H7P A;  4HCN B;  1WX9 A;  3QQ8 B;  2CR5 A;  1YX6 B;  2EKE C;  3IG3 A;  4IWQ A;  3VDZ A;  4ASW C;  4IC7 B;  2MWS B;  3W1S A;  3UIN B;  3QIJ A;  2BYE A;  4GDK B;  2KN5 A;  3S2A A;  2ASQ A;  3WAL A;  2KDE B;  2LXA A;  1E8Y A;  3PRZ A;  2K8B A;  2KKC A;  3H7S A;  4DBG A;  1WXA A;  4BKG A;  4KSK C;  2PE6 B;  2XBB C;  1WX8 A;  4AP4 C;  1PQS A;  3NHE B;  2HTH A;  2PPH A;  2KFK B;  1KLV A;  2ZPY A;  3L16 A;  4ZRI A;  4URK A;  2K25 A;  5E6P A;  3QHT A;  2IO2 B;  4RMA A;  2HJ8 A;  2ZEQ A;  4AOF A;  4WJQ A;  5L95 C;  1ZKH A;  4TKN A;  4HDO A;  4FJV B;  1SE9 A;  4HXD A;  4IWP A;  3EHV A;  4EFO A;  1TZ1 A;  2ZVO A;  2WYQ A;  4JL9 A;  3TCA A;  4W9F A;  1E8X A;  1LXD A;  1WJU A;  1H8C A;  3GOE A;  4LDT B;  5C23 A;  4K7U A;  4W9I A;  2L8J A;  3VQI A;  2FCN A;  2NPT A;  2C5L C;  3UQB A;  1SIF A;  2PEA A;  3PGE A;  3RD2 A;  3SD5 A;  4FA6 A;  5IA7 A;  1EUV B;  2KDI A;  3APC A;  3L10 B;  2CHW A;  2FIF A;  2OJR A;  2RPQ A;  4ANW A;  1E8Z A;  2KWU B;  1J8C A;  4XZ4 A;  2M4N A;  2IO3 B;  2OOB B;  2ZCC A;  2BKF A;  2RGF A;  3VXW A;  2JT4 B;  3JW0 X;  4HK2 A;  1OQY A;  1QZE A;  4CYE A;  1I35 A;  1WJN A;  3JSV B;  5KHO A;  3DCG A;  1WY8 A;  3M3J A;  2ZJD A;  3PVL A;  3LDZ E;  4KSL C;  2MCN B;  2Y5B B;  3W1Y A;  2L0T A;  4DHJ B;  3M63 B;  2N1W A;  2KXJ A;  3QWZ B;  2RSU A;  3L08 A;  3PTF C;  3UF8 A;  2DAF A;  3NS8 A;  2L76 A;  1Z5S B;  4OVV A;  5CHF A;  2KO3 A;  3RUI B;  4GDL A;  4ICV A;  2L7R A;  4GXB A;  3TL5 A;  1EF5 A;  1LM8 B;  2KOX A;  2DZM A;  4KIK B;  3N30 A;  2D3G A;  3U8Z A;  3WAP A;  4ANX A;  5GMV A;  3MHS D;  3DOW A;  2R2O A;  4PS7 A;  5JH5 C;  3R3M A;  5CHW A;  3CF6 E;  1WJ6 A;  5IAA C;  3ZUN A;  4A3O A;  3EC8 A;  2MA9 B;  4CHK A;  4DDG D;  3HM6 X;  2JXX A;  4B95 A;  3PZD A;  4NNJ B;  2LRW A;  1WE6 A;  4EUT A;  2ZNV B;  5KHQ A;  2JY6 A;  3QX1 A;  2KJR A;  3SU8 X;  4ZYN A;  2EMS A;  2M17 A;  3VAW A;  2L0F A;  3A1Q A;  3JYU A;  4W9C A;  3T8M A;  2O2V A;  3QK0 A;  3H7P B;  2WX0 A;  4ZRK A;  3AU4 A;  4A3P A;  2HD5 B;  4AJW A;  3PRM B;  4HWI B;  4JGH B;  3TIX A;  4GOC A;  1WE7 A;  3LJ3 A;  3BY4 B;  1WZ3 A;  2KWV B;  3PV1 A;  1KM7 A;  2CU1 A;  4GB9 A;  4MGI E;  3PRE A;  1E7V A;  3VHT C;  4KDL B;  1KJT A;  4YL8 A;  2PE9 A;  3DQV A;  1R4M I;  3KW5 B;  4FAD A;  2KMC A;  3PRP B;  3CST A;  3ZTC A;  4GMV A;  4MEL A;  5D2M B;  5DPS A;  2LVP A;  3PS6 A;  1P3Q U;  1RLF A;  3N32 A;  2AWT A;  2KQ7 A;  3VUW A;  3A9K A;  5LLI A;  4IWO A;  4DWF A;  4F7Z A;  1V49 A;  2GBN A;  4W9J A;  1WGY A;  4GN1 A;  1WGG A;  2BWF A;  1J0G A;  2N7D A;  2NPT B;  3NOB A;  1F9J A;  4M8M A;  2IZV B;  2LGD A;  4MM3 A;  1RRB A;  2ZPN A;  4MH0 E;  4G11 A;  4AUQ C;  1WH3 A;  3DBL I;  2NR2 A;  2A5U A;  2DZJ A;  2CKH B;  2N9E B;  3A4R A;  5AZG A;  2D10 A;  3OLM D;  2K1F A;  3MTN B;  5J18 A;  3NY5 A;  4KVG B;  4KV2 A;  4BFR A;  2AYO B;  3PT2 B;  3V60 A;  2FNJ B;  1NBF C;  3HIZ A;  2NS5 A;  1YX5 B;  2FCS A;  1UH6 A;  4E74 A;  2KDB A;  1FXT B;  2JRI B;  1UZX B;  1WX7 A;  5D6J B;  4MGZ E;  3VUX A;  3TMP B;  4IM3 A;  4GU2 A;  2FID A;  4JLC A;  4DDI D;  1UD7 A;  4EEW A;  2QHO A;  3TJP A;  3ZVV A;  5LXI B;  4J6I A;  2IY0 B;  3EFU A;  2UWQ A;  2DYB A;  3L0W B;  2N7E A;  4IM0 A;  5G2N A;  3ZKJ C;  5C1Z A;  4DHZ E;  2IYD B;  3RT3 B;  4RM8 A;  4HPM B;  4GDL B;  4FHJ A;  2K8H A;  4FUL A;  4II3 B;  4K1R B;  4MSQ B;  1V80 A;  1XQQ A;  4W9G A;  5DPR A;  3ZIM A;  2NCN A;  2DEN B;  4DHZ B;  2KTR B;  4M0W B;  4NQL B;  3ZDT A;  2O6V A;  2LGX A;  2MQJ A;  1VCB A;  2KFJ A;  2R2Q A;  4NY0 A;  2UYZ B;  2LZ6 A;  3V61 A;  1IPG A;  2MBH A;  2NBU A;  1TGZ B;  3IVF A;  2D2Q A;  2CHZ A;  1YJ1 A;  2IBI B;  1WZ0 A;  3PLV A;  5CHV C;  3V62 A;  3I3T B;  2J0K A;  3X0W A;  3WAN A;  1IYF A;  3A1Q B;  4WQO B;  3ZO5 B;  1GJZ A;  2O2V B;  3U7D A;  3NZS A;  3ECI A;  3HHM A;  2MBO A;  4BKT A;  2L00 B;  1WIA A;  2CS4 A;  3H9D A;  2JRH A;  1OEY A;  4MGK E;  1GG3 A;  1S1Q B;  1WYW B;  4ANV A;  3VH4 B;  5J2R A;  2RD0 A;  1Q5W B;  1NDD A;  1YIW A;  4FBJ B;  4BBN F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...