1UD7A

Solution structure of the designed hydrophobic core mutant of ubiquitin, 1d7
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
b'MQVFLKTLTGKTVTIEVEPSDTVENFKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTIHLVLRLRGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (UBIQUITIN CORE MUTANT 1D7)
publication title Solution structure and dynamics of a designed hydrophobic core variant of ubiquitin.
pubmed doi rcsb
molecule tags Ubiquitin
total genus 17
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1999-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ud7A00
3PRZA 3DBLI 5HKHA 2MQJA 3RZWC 4KDIC 4HDOA 5AEKB 4TV3A 2LGXA 2GOWA 2PEAA 5LXIB 1FXTB 4DHZE 2KTFA 4W9KA 4MELA 2ZCBA 2NBUA 1P1AA 3IG3A 2FCQA 3H6NA 2C5LC 1WM2A 1WGHA 4MGZE 4FA6A 1KOTA 2K8HA 3CSTA 3JVZX 4EEWA 3KUCB 2ZVNA 4KZCA 2CKHB 2LWPA 4JGHB 4HLEA 1V2YA 3SD5A 2KC1A 1LXDA 2YLMA 4IWQA 3W1SC 2A5UA 3A33B 2K25A 1QZEA 4FLHA 1WXSA 2C9WB 5JHBA 1Q5WB 1WF9A 2HJ8A 4IM3A 3X0WA 5JZEB 3CF6E 3KH0A 4GB9A 2RPQA 2RGFA 3A1QB 3CSFA 4ANWA 3EHVA 4FULA 2KMAA 4W9HA 1UBIA 4ANXA 2A4ZA 3JW0X 1J8CA 4IM2A 1GG3A 3R3MA 5CHWA 2KDEB 1E7VA 2NR2A 2R2QA 2KX3A 3KVFB 3L17A 1WXAA 1IYFA 5D7GA 3A1QA 2MBOA 1TZ1A 2L3ZA 2DX5B 3VHTC 3ZRFA 2Z0DB 1GC7A 2YVCA 4KSLC 2N1WA 1R4MI 4KVGB 2BWFA 2JUOA 1WIAA 2KQ7A 3VH4B 4ASWC 1RLFA 4AWJA 1K8RB 2L00B 3VXWA 2BF8B 2AL6A 2KVRA 4HPLB 1U4AA 4AJWA 1EF1A 4WAAA 5FR6A 1IPGA 3APCA 4G11A 2BYVE 2MSED 4DBGA 4YL8A 5AZGA 2KOXA 1WZ3A 2KTRB 2AL3A 2RSUA 4PYZA 4NY0A 4PS8A 4W9IA 3VFKA 1YD8U 4DHJD 1WI0A 1UELA 2CS4A 3ML8A 2W9NA 1Z5SB 2KNBA 4B95A 2IO0B 2DAJA 1WXVA 2XK5B 4GGQA 4LDTB 2ZVOA 4MM3A 3GOEA 4BVUC 2KTRA 5CHFA 1YQBA 2LGYA 3WAPA 3ZUNA 3AU4A 3H7SA 2KDBA 4HCPB 4II3B 2L0TA 2MP2B 1WR1A 1E5WA 2XK5A 4HCNB 4WWNA 3V6CB 2XEWA 2GBJA 1X1MA 2Z59B 2RR9A 1OGWA 2KDFB 2OJRA 3U8ZA 2EMTA 4MSQB 1WJNA 1WH3A 2NS5A 4K81A 1WYWB 1WX8A 2HE7A 2MP2A 5D2MB 4W9EA 4JQWC 2C7NB 2LD9A 1S1QB 2NPTB 4P7IA 2LASA 4FJZA 4GN1A 1TGZB 2DYOA 3BY4B 3M62B 3WAMA 5DPWA 1AARA 1GNUA 2GBMA 3TL5A 3D32A 1S3SG 2C7HA 3DVGX 3SHQA 1UGMA 1J19A 4A3OA 4BOZB 1F9JA 2DZMA 2NPTA 1TTNA 2V4LA 3DVNU 1OTRB 1WE7A 3ECIA 1P9DU 3APDA 4XX5A 2BYEA 3V61A 2IO3B 1WXMA 1V9JA 2KD0A 3KYCD 1E8ZA 1WJ6A 3I3TB 1J0GA 2KFKB 1YJ1A 3B08A 4GXBA 2NCNA 5G55A 4BKSD 3A4SC 3ALBA 3PLVA 2XBBC 4X57B 3DOWA 4RM9A 2Y5BB 1XT9B 2EKEC 3IBEA 4ZRIA 2ZCCA 2D11A 2JZ3B 3WANA 2HTHA 5IA7A 2KK8A 2CHWA 2L0FA 3W1YA 2C7MB 4CYEA 2ZJDA 4FJVB 4TQ0A 4FADA 5EDSA 2FAZA 3KUZA 4IWOA 1WJ4A 3QAQA 2IO1B 3NS8A 1A5RA 3DQVA 3R66C 3VUYA 2KKCA 3PLUA 3DBSA 4AP4C 1SE9A 3L0WB 4E71A 1V81A 3TBLD 4HVBA 2KWUB 3PSEB 4K7WA 4F7ZA 4W9LA 3TCAA 1V5OA 4KDLB 4F1SA 2MBBB 3DPDA 3QWZB 1WGGA 4BKTA 4DDID 4EKUA 3JYUA 3B1LX 4FBJB 1ZGUB 1JRUA 2KN5A 1EF5A 2I1KA 3M95A 3NOBA 4I6LB 3RZFA 5D94A 2MLBA 4ICUA 3NHEB 2K6DB 4W9FA 4WJNA 2LUEA 3WA0A 4OVVA 4NJ6A 1ZKHA 1GUAB 2WWZA 2JRIB 2PPHA 2JZZA 3A9KB 4NPNA 4GIVA 3PVLA 1WR6E 4K7UA 5E6NA 3EFUA 2J0JA 4A20A 3L08A 4BFRA 2D10A 4PYUA 2G4DB 3HHMA 4NQKE 2MW5A 5CTRC 4CO7A 2IYDB 3UIPB 3V60A 2KO3A 2GMIC 2MBEA 3H9DA 3A9KA 3T9LA 3B0AA 4TUUA 2G3QB 3OJ3A 5G2NA 3V62A 2LRUA 3A4RA 4IM0A 4MGKE 4E74A 2R2OA 1C3TA 3RCZA 2KLCA 2FIDA 2KMCA 3VQIA 1LM8B 4DHZB 4G0NB 2PJHA 4RMAA 1Q0WB 2DAFA 3N32A 3ZIMA 3MTNB 4J6IA 2RD0A 4JLCA 5KHQA 5LLIA 3GZNI 2FCMA 2M1MA 2BGFA 4I6NB 1G6JA 3DBHI 1R4NI 4FN2A 5DCNA 4M8NA 2JT4B 3VUWA 2KLGA 4B9KA 5E6PA 4BKSA 2G45B 2N7DA 3EC8A 3M63B 3UF8A 2I1JA 2JXXA 4BKGA 1LFDA 4W9JA 3QC8B 3VAWA 4ZYNA 3IVFA 1WRDB 4NJ7A 3WAOA 1I35A 3LJ3A 1EO6A 3VTVA 4JL9A 3DVNV 4GDLB 3AU5A 3N3KB 4XC2A 1ZW7A 2MBHA 4GMVA 3VH3B 2BPSA 1WFYA 2J0MA 4GOCA 3AXCA 2ZNVB 2D07B 2IZVB 1Q1OA 3OJ4B 3ZRCA 1LQBA 3VUXA 2PE6B 2K8BA 3L10B 4BOSC 2DZKA 4M8MA 2LI5A 2LJ5A 4K1RB 3W1SA 4W9GA 2M4NA 3R7RA 5L83A 4GDLA 4ZRKA 1I42A 3DVGY 3WIMA 1NI2A 4JIOU 3K9OB 2D2QA 4HK2A 3SDLC 1E8WA 1D3ZA 3M3JA 4HWIB 1CMXB 3KUDB 3AI5A 2FNJB 3U30A 1H8CA 1E8XA 3Q3FA 2WDTB 2LVOA 1YX5B 2GBNA 3ZDMC 4KZ0A 1SIFA 2KX0A 4PS3A 2ZPYA 2G4SA 3H7PB 5JH5C 3H1UA 2ASQA 3V6EB 4IUMB 3QK0A 3NZSA 5CHVC 5IAAC 3X23A 2KZRA 2N9PC 3PS6A 4IW0A 2CHXA 2KJRA 2IY1B 2L8JA 2VRRB 4ANVA 3MJWA 3H7PA 5D6JB 3RD2A 3ZNZB 3RYTA 2JY6A 2MX2A 1NDDA 3ML9A 2KWCA 4DWFA 5L95C 2BWES 3QX1A 1RRBA 3VDZA 4HPMB 5DPSA 2KWVB 2UYZB 2N1VA 4DK5A 3L16A 3HM3A 1L7YA 1H4RA 3ZTDA 2O2VB 1ISNA 3T8MA 2L05A 2KFJA 1UBQA 2CHZA 3PHXB 5C23A 5DPRA 1SGHA 4DHJB 2FUHB 1E8YA 3N30A 3PV1A 2KANA 4W9CA 3ZDTA 3UQAA 1BT0A 2DZIA 1V5TA 4LCDE 3HIZA 1EUVB 2O2VA 2QHOA 4KSKC 5BO4B 1WMHB 3DDCB 1XD3B 2V3SA 3JSVB 5LXHA 3Q3JA 1E90A 2CU1A 4EZKA 4MEMA 3ONSA 1Y8RC 2N9XA 3IFWB 1E7UA 1WZ0A 2O6VD 4WJPA 1IP9A 3ZTCA 2N9EB 3PHWB 1WMHA 2IO2B 1KLVA 1NBFC 1V86A 2K1FA 3C0RB 3JSVA 3U7DA 1T0YA 1V49A 3A9JB 2LXCA 4BBNF 4WJOA 1UH6A 4AUQC 4RM8A 2KHWB 3K9PB 3CMMB 2MWSB 4EFOA 4TQ1A 1WX7A 4FHKA 2DYMA 2JWZA 4PS7A 4TKNA 4NAWB 1TBEA 2WX0A 3L13A 3PGEA 1YX6B 1GJZA 3S2AA 2MBQA 3A9JA 1VD2A 2AWTA 1RAXA 1WX9A 2NBVB 3WALA 3ZNHB 3APFA 3OAWA 1RFAA 3UIOB 2BKRB 1WE6A 2AEHA 4EZJA 4K7SA 2LGDA 3VVWB 3QIJA 2Z0EB 3SU8X 4NAWA 4ZDVA 4WJQA 3QCAA 2JRHA 2OOBB 4G3XB 4W9DA 2KJHB 4FHJA 3ZO5B 4WQOB 4WWOA 5JHAA 2MCNB 2JPHA 2ZNVC 3VTUA 4F8CB 1XQQA 2N7EA 5E6OA 2WX1A 3O65B 2ZEQA 2K8CA 3DCGA 5J18A 2LXAA 4MH0E 3QARA 2WYQA 3ZVVA 2LRWA 3DBRI 1WGRA 4HDQA 4KIKB 2ZPNA 4GDKB 5C1ZA 2IY0B 3HM6X 3VTWA 4BBNC 4E3CA 4IG7B 1KJTA 4HJKA 4G50A 3R7QA 1OQYA 4ANUA 3HK0A 4EZLA 1P3QU 2PE9A 3UQBA 1MG8A 2CR5A 2EMSA 3ZNID 4KIKA 2BYFA 1WGDA 3ENEA 5GMVA 4GDKA 2L76A 4DDGD 4FJYA 5DPTA 3KYDD 2J7QB 3PZDA 3PPAA 1P0RA 2REXA 3QHTA 2O6VB 1P98A 1C1YB 4WWPA 4M0WB 5AZFA 2FIFA 3PT2B 3ZLZA 2MA9B 2C60A 1PQSA 3PREA 2M8SA 2O6VA 3TIXA 1VCBA 2DZJA 4GU2A 4ZRJA 2ZZPB 2NVUI 2KC2A 4CHKA 2HD5B 2KJ6A 4EOYA 2B3AA 2DYBA 1V80A 5J2RA 3ZKJC 2JF5A 2AYOB 4HXDA 4KV2A 3ZW3A 3ZNGC 4II2B 1Z2MA 2UWQA 3QJZA 2BKFA 4IWPA 5KHOA 4GSWA 3UGBB 1HE8A 4N9F4 2K6QA 2D3GA 3QA8A 2DHZA 4OVUA 3AULA 3KW5B 3RULA 1L2NA 3IHPC 2FCSA 2LZ6A 2MRPA 2LVQA 4IC7B 2JVCA 2KDIA 4MGYE 2NBWB 4A3PA 3BINA 3PRPB 3UINB 2M17A 2V1YA 4MGIE 2IBIB 3LDZE 3NZUA 1OEYA 2KQSA 1V6EA 1WY8A 3L54A 4MDKE 5TR5A 2DENB 3TJPA 2GBKA 4NNJB 1GC6A 1M94A 1OEYJ 3PRMB 4DXAB 2L7RA 2KXJA 2GBRA 2LVPA 3EECA 4MJSB 1UD7A 3RUIB 3RT3B 5AZHA 4URKA 1WM3A 4AOFA 5J17A 2K39A 3OLMD 2FCNA 4I6PA 1KM7A 1WGYA 4AJYB 4B6WA 2KFKA 2J0KA 3QQ8B 4LJPB 3P2BA 1UZXB 4MJSA 1WJUA 4NQLB 4XZ4A 4MSMB 3MHSD 2N4FA 2M0XA 3TMPB 4EUTA 4ICVA 1YIWA 4LDTD 3NY5A 3PTFC 4LJOB 5CX3A
chains in the Genus database with same CATH superfamily
2MQJA 3AH7A 4HDOA 4DHZE 2ZCBA 1D4BA 3R2IA 1I4GA 2PMVA 1TKGA 4FA6A 4LK0M 2K8HA 1L0VB 2ZVNA 2LWPA 1NEKB 4IWQA 3W1SC 2K25A 3Q8AA 1N60A 1FMAD 2RGFA 4ANWA 3EHVA 4HRSA 4W9HA 1XLNA 4PT5A 2A4ZA 1L0YB 4IM2A 3R3MA 2WGSA 1WXAA 3A1QA 1QLBB 2MBOA 2Y3AA 1XLQA 3VHTC 3ZRFA 2Z0DB 1GC7A 1R4MI 4KVGB 2JUOA 1SE4A 1PGXA 1JRPA 1IPGA 1ZE3D 4G11A 2BYVE 2MSED 4USAA 3Q6BA 3VFKA 1XF5L 3BYYB 1JWSD 1T0RC 2IO0B 1WXVA 1VLBA 2KACA 3GOEA 4BVUC 3Q8BA 4ZYSA 2WXRA 1QOAA 3WAPA 2K0PA 3ZUNA 2INDC 1XCTL 3H7SA 2Y5CA 2HDEA 2MJEA 2XK5A 2W54A 2RR9A 1OGWA 2NS5A 2MP2A 5D2MB 2C7NB 2LHEA 3IT4B 1STEA 3Q3MC 1S1QB 3B2GA 2LASA 4LNNA 3IAM1 2DYOA 1HXYD 2V3PA 1QT9A 3IXSA 4C00A 2GBMA 3DHIC 2C7HA 2NPTA 5G5HA 1OTRB 2BYEA 1WXMA 2KD0A 4XWTA 1M4VA 4C80A 3I3TB 1TKYA 5G55A 4BKSD 4X57B 1TKEA 4OHJA 1XT9B 2EKEC 2D11A 3W5UB 2L0FA 1DYQA 3W1YA 4CYEA 2WLBA 2FAZA 2WXGA 2IO1B 3V3XA 2L52A 1AN8A 3NS1A 2SAKA 3PLUA 4OZBA 4BZAA 3L0WB 4YSZB 4W9LA 4KDLB 3DPDA 2BB6A 3B1LX 1ZGUB 1FEHA 2KN5A 2M19A 1L4ZB 1EF5A 2HJ1A 3M95A 3NOBA 4I6LB 1WGKA 3Q8EA 3BK2A 5D3DA 4WJNA 3WA0A 2JRIB 3A9KB 2JZZA 3PVLA 1WR6E 2OJWA 2D10A 4YTMB 2ONQA 3UIPB 5FR3A 4RF0A 2MJ3A 2NTSA 2QDFA 1PYWD 2IJ0A 4L23A 3OJ3A 1FFVA 1XO3A 4MGKE 5I4DA 1C3TA 3RCZA 4DHZB 4G0NB 1NVID 3N9YC 3MTNB 5LLIA 3EFCA 2LJIA 3GZNI 4RGMA 2BGFA 1TS2A 3DBHI 5DCNA 1SSNA 3VUWA 2KLGA 3TEXA 4DXGA 3EC8A 2N7DA 2JXXA 2V4IB 4YXDB 3VRAB 1FRDA 3WAOA 3DVNV 4XC2A 3ZJVA 1WFYA 2D07B 3BYTB 3ZRCA 2PE6B 3KWLA 3L10B 1JWMD 4BOSC 2DZKA 4M8MA 2LJ5A 3W1SA 2M4NA 1ZOYB 1F77A 1PFDA 1NI2A 4JIOU 2D2QA 3BIID 3SDLC 1E8WA 2WDVB 1D3ZA 3M3JA 4WIPA 1CMXB 1HTOA 3Q3FA 2LUMA 1J7CA 1PGBA 2GBNA 3ZDMC 1T6BX 1JALA 1JROA 4PS3A 2ZPYA 4LTUA 2KZRA 4IW0A 2CHXA 3H7PA 4A90A 1WXQA 1K53A 3ZNZB 3RYTA 2KWCA 1I4RA 1Q10A 5L95C 3QX1A 1RRBA 3GE3C 3RNCC 3ZXVA 1IGDA 1PUTA 3T8MA 4KKIA 3N1YC 3MC0B 4S0RA 1HQRD 2R61A 2KANA 3UQAA 1BT0A 1L5PA 2DNFA 3HIZA 2QHOA 3DDCB 4MH8A 3JSVB 4EZKA 1A70A 1E7UA 1WZ0A 2O6VD 4WJPA 4KKJA 1IP9A 3ZTCA 3SFDB 3VR8B 1NBFC 1V8CA 1V86A 1EWCA 3W9CB 2DLBA 1V49A 4KGTA 1TT5B 4RM8A 3I9V1 1F1HA 2MWSB 4RF1A 4EFOA 2WDQB 2JWZA 4PS7A 1YX6B 2MBQA 3A9JA 3VR9B 3ZNHB 4TSSA 1RFAA 4EZJA 1B1ZA 2JRHA 3AE9B 3LXFA 4FHJA 2JPHA 2ZNVC 2N7EA 4NAMA 1L6VA 2J42A 2WX1A 2LXAA 3QARA 4WH4A 2RDBC 4N58A 2LRWA 4KIKB 2ZPNA 1R4NB 1GOZA 4IG7B 4HJKA 4G50A 3HK0A 2CR5A 2EMSA 5BMGA 1WGDA 2L76A 4ARIA 3KYDD 2J7QB 5BMIA 3PPAA 3FAHA 1C1YB 2WXIA 4WWPA 1BUIC 1K50A 3ZLZA 3DWGC 3R8BA 2C60A 4US9A 3MJ5A 1VCBA 3TIXA 1C78A 3CIRB 2KN4A 2NVUI 4LLGM 2KJ6A 1V80A 2JQRB 3AEGB 1QILA 2LFIA 3ZKJC 1QQRA 2IGGA 4II2B 2UWQA 4IWPA 3UGBB 1FRRA 4K3CA 3QA8A 4QAYA 2ZW0A 2Q5WD 2LZ6A 3OWEB 2LVQA 1TS3A 2KDIA 4MGYE 5D3IB 3UI3A 3BINA 1ZDXA 2KQ4X 1L6UA 2V1YA 1D6EC 4WWMA 3NZUA 1OEYA 1V6EA 2DENB 3Q8CA 2L7RA 3HVZA 4DQOC 2LVPA 3EECA 1Y56A 1MPEA 1DGJA 2KYWA 3RT3B 4URKA 1WM3A 4AOFA 2K39A 1WGYA 4AJYB 1ZP0B 3Q3OC 1UF0A 3P2BA 1IBXB 2VH2A 2J53A 4EUTA 4ICVA 4PYZA 4XGAB 4LJOB 2L83A 5HKHA 3BVGA 4WURA 5LXIB 1N5XA 4W9KA 4MELA 1P1AA 3IG3A 1KOTA 4EEWA 2JSVX 4KZCA 4HLEA 1N63A 2KC1A 1LXDA 1EWYC 2YLMA 1I4PA 1QZEA 1QOGA 2C9WB 1Q5WB 2Y5PA 2ACZB 3CF6E 4GB9A 2RPQA 4AS1A 3CSFA 3I5JC 1N61A 3JW0X 3ZJTA 1IYFA 1JQ4A 1TZ1A 3N1XC 2L3ZA 1FCCC 3AE2B 2N1WA 1IUEA 4B0EA 1UGJA 3VH4B 4ASWC 1EU4A 1RLFA 4REZA 4JWUC 2AL6A 1U4AA 2SEBD 4WAAA 5FR6A 1CK1A 2KOXA 2RSUA 2BS4B 1YD8U 3AE1B 1Z5SB 2KNBA 3GS2A 3PZ8A 2MHJA 4LDTB 2PTLA 2WXLA 2LGYA 2HTME 4D2KA 3HRDD 1OQQA 2KDBA 3Q14C 4II3B 3NVYA 4O1NA 4WWNA 2XEWA 2N9KA 1X1MA 2Z59B 1KTKA 2EMTA 4MSQB 2E3TA 5EE1A 4K81A 4JQWC 1FFUA 4FJZA 4GN1A 3M62B 5DPWA 1AARA 3TL5A 4ZHPA 3D32A 1UGMA 4BOZB 2DZMA 2V4LA 1P9DU 3V61A 3BWUD 1WJ6A 2K9XA 1OFFA 3ALBA 5BMHA 2VZKD 3DOWA 2Y5BB 3AV8A 2ZCCA 2JZ3B 2W82A 1VZ8A 5IA7A 2GI9A 1HTQA 4BAXA 4FADA 3KUZA 4HEA1 1TS5A 1V97A 3NS8A 3R66C 3VUYA 2KKCA 1JWBD 4US8A 1JWUD 1V81A 3TBLD 2KWUB 1TY2A 1V5OA 1PGAA 4F1SA 3RFZB 3QWZB 4BKTA 4DDID 2J52A 4FXCA 3PO0A 2I1KA 5D94A 1EU3A 3TUOA 3T3OA 2LUEA 4OVVA 4NJ6A 2WWZA 2PPHA 2FE8A 2J0JA 3L08A 4PYUA 2G4DB 4NQKE 2MW5A 3AE7B 3H9DA 3A9KA 1SJED 3NUHB 1CQVA 3DHHC 4TUUA 4E74A 3GE8C 2LRUA 3A4RA 2R2OA 2KMCA 1LM8B 2PJHA 1Q0WB 2V3NA 1TZOA 2RD0A 5FKAC 2Z8LA 1R4MB 3AB5A 2JT4B 3AE8B 4B9KA 3HVDA 3M63B 2RDHA 4W9JA 3ZGZA 4LNIA 4CQNA 3IVFA 4NJ7A 3LJ3A 1EO6A 3LYYA 3IAS1 4JL9A 5C2TB 4GDLB 2KVZA 3N3KB 1FXIA 3VH3B 1KF6B 2BPSA 3DHGC 1KRHA 2ZNVB 2IZVB 1Q1OA 4HJGE 3VUXA 1YOVB 3O13A 4W9GA 3DVGY 1GPXA 2W3RA 1ACCA 3K9OB 1FNVA 1E8XA 2WP9B 4KZ0A 2KX0A 3MP9A 3FKYA 1RM6C 4P6VF 2H89B 2KJRA 3MJWA 3NVZA 2ON8A 2JY6A 1UNSA 1NDDA 4DWFA 3P63A 3VDZA 2WU2B 1JCKB 2N1VA 3NZ3A 1L7YA 2KFJA 1F2RC 1YQ3B 3PHXB 5TSSA 4DHJB 2WXQA 3N30A 3PV1A 4S17A 1V5TA 1EUVB 3TEYA 1WMHB 1SXTA 1XD3B 1C4PA 5LXHA 3Q3JA 1E90A 2CU1A 5H8YE 3ONSA 1Y8RC 1FM0D 2N9XA 3DBLB 5H92C 2N9EB 2N7JA 2WXMA 3JSVA 4BBNF 4P16A 1E9MA 1C77A 4FHKA 2KDMA 2DYMA 3H8HA 4NAWB 1TBEA 3L13A 4R3DA 3S2AA 2W55A 2AQ1B 3APFA 2QSDA 1SEBD 2AEHA 1YNTE 3L4PA 3NRZA 4WJQA 4XYCA 4XDCA 4GLSC 1GAQB 2OOBB 4RGTA 4WWOA 1J7AA 2LMCA 3TEWA 3AM9A 1R7SA 2K8CA 5J18A 1YJIA 3ZVVA 2MJDA 3DBRI 3KLSX 1WGRA 4HDQA 3GZNB 1ET6A 3DBHB 1QOBA 4BBNC 1E7PB 2QIEB 1TYGB 4KIKA 2BYFA 3ENEA 4B0MA 5GXGB 4FJYA 1XCQL 3HUIA 1JWAD 1P0RA 2O6VB 3PZ7A 2CJNA 4J3OD 2W3SA 5AZFA 1MFWA 3PT2B 2IPKD 4NJCA 3B2FA 1BMLC 2ZZPB 4CHKA 2B76B 2GLSA 1KLGD 5J2RA 2AYOB 4HXDA 1OQRA 3QJZA 4GSWA 4TMAB 1HE8A 2K6QA 1NYQA 4M02A 4OVUA 3KW5B 1L2NA 5IP4D 3WCQA 2MRPA 4IC7B 2JVCA 3SEBA 4A3PA 2IGDA 3N20C 2WXFA 4ACFA 2IBIB 3LDZE 1WY8A 4MDKE 2WXKA 1YQ4B 4OVZA 3TJPA 2GBKA 2BS2B 5IO9A 4YTNB 2EELA 4MJSB 1FNUA 5AZHA 3URYA 1P7FA 4K3BA 1KM7A 1YJJA 4OZAA 1KLUD 3QQ8B 4LJPB 1N62A 4NQLB 4MSMB 2JU6X 2N4FA 2M0XA 3PTFC 4UDUC 2VH1A 3PRZA 5CX3A 3RZWC 4KDIC 2L32A 2PEAA 2GOWA 1IBXA 2NBUA 3ETRA 2FCQA 1WM2A 1WGHA 2X8XX 2H88B 3KUCB 5BYSA 2CKHB 1V2YA 3SD5A 3A33B 5G5GA 4FLHA 4C7YA 5JHBA 2HJ8A 1WF9A 3X0WA 1MG4A 3KH0A 2KMAA 1BXTA 1GG3A 5CHWA 4RGNA 2KDEB 1E7VA 2NR2A 2R2QA 3L17A 5HI1A 2GRIA 4OW0A 5D7GA 4WAFA 2YVCA 1WIAA 1K8RB 2WXJA 3NJTA 1SIJA 3VXWA 2BF8B 4AJWA 1EF1A 2K5PA 4DXFA 4MM3B 4YL8A 1WZ3A 2KTRB 4PS8A 4W9IA 4N6EB 4B95A 1QKZA 2DAJA 2WXHA 1WWTA 2ZVOA 5CHFA 1LGRA 1WR1A 2WXPA 1E5WA 4HCNB 3V6CB 2KDFB 3ZXRA 3U8ZA 2WDRB 1FNWA 1KFYB 1WX8A 1YN4A 4C56C 3EUB2 1TGZB 2GB1A 1E6EB 1GNUA 1ESFA 1KH0A 3SHQA 4A3OA 3AE6B 3C8YA 3DVGX 1J19A 1TTNA 1WE7A 4XX5A 3APDA 2K3UA 1WYGA 2PW9A 1V9JA 3KYCD 4JPSA 4H2AA 1I4HA 1CJEA 3B08A 3E56A 4OZCA 1UUPA 4RM9A 4C4VB 3WANA 2CHWA 2C7MB 4HPPA 2ZJDA 3Q2AC 4TQ0A 2DWQA 5EDSA 3IT6B 1WJ4A 2RPVA 3DQVA 4EE2A 2RMMA 2JYEA 4E71A 3AMZA 4K7WA 4F7ZA 3SFEB 1WGGA 3JYUA 4FBJB 1JRUA 5EE0A 2K6DB 3P4QB 1ZKHA 1GUAB 3RPFC 3EFUA 3HHMA 2RDGA 3V60A 3AE3B 2MBEA 1C4AA 1SB3C 4KGSA 3B0AA 1V1PB 5G2NA 2CU3A 3V62A 3VQIA 4RMAA 2DAFA 3ZIMA 2VZKB 4J6IA 2WU5B 2FCMA 1HZ5A 4L2YA 4M8NA 4BKSA 5E6PA 2PVOD 1F0ZA 3UF8A 1C4CA 2I1JA 2LGSA 4BKGA 3QC8B 3VAWA 1I35A 1WRDB 3W2DA 1QF6A 3AU5A 1ZW7A 2MBHA 4GOCA 1JMLA 1QOFA 4K1RB 1HA5A 3R7RA 5L83A 4GDLA 4ZRKA 1I42A 3Q3NC 3WIMA 3KQ4A 4HWIB 3AI5A 3U30A 2M56B 1YX5B 2CJOA 1C79A 3GB1A 1SIFA 3RI7C 5JH5C 3ABVB 3V6EB 3NZSA 5CHVC 5IAAC 1DOIA 4L1BA 3U7ZA 2N9PC 3PS6A 2I38A 1JW9D 2NTTA 4ZHOA 2VRRB 4JE3B 3RD2A 2M0AA 1TIFA 2MX2A 3ML9A 2BWES 3C19A 4HPMB 5DPSA 4DK5A 3ZTDA 1H4RA 2O2VB 2D3AA 2L05A 1UBQA 2CHZA 5AUIA 5DPRA 1AYFA 4W9CA 3ZDTA 2V9HA 4KSKC 3W5VB 1LO5D 2YEPB 4MEMA 2KMMA 2G9HD 4Q2JA 1K52A 2QC8A 3PHWB 1KLVA 1WMHA 2FBWB 1XXGA 1J7BA 3C0RB 2LXCA 4WJOA 3AEAB 2KHWB 3K9PB 3CMMB 4TKNA 2WX0A 3RN9C 1MHXA 1VD2A 1SE2A 1RAXA 1WX9A 2NBVB 3WALA 3OAWA 3UIOB 2BKRB 1WE6A 3VVWB 3SU8X 2Z0EB 3BZDB 3VRBB 2TSSA 4NAWA 4ZDVA 2NMQA 3QCAA 1XEEA 3FILB 4G3XB 4W9DA 5JHAA 4P1CC 1RFKA 2ZEQA 5JXVA 1TS4A 1CZPA 2IDYA 2EKIA 2OHFA 2JXTA 2WYQA 4GDKB 5C1ZA 3RNFC 3HM6X 4E3CA 4YSXB 2ZW1A 3R7QA 3ZQ4A 1OQYA 3UQBA 4ZRQA 1NENB 4DDGD 2LGIA 3PZDA 1P98A 2UU7A 4JWSC 2N9LA 5MPOA 4M0WB 2BQQA 3I57A 3MFGA 2MA9B 3NG0A 1XLPA 1PQSA 1SF0A 4LNFA 1ROEA 2M8SA 2O6VA 4YSYB 2DZJA 4GU2A 4ZRJA 1T3QA 3ZYYX 2KC2A 1HZ6A 1UWXA 4EOYA 1VDVA 2JF5A 2JX5A 2IGHA 3RNAC 2PKOA 4N9F4 2D3GA 2DHZA 2BB5A 3N1ZC 1F52A 1VRAB 2NBWB 3U2SC 4HKZE 3UINB 1VR9A 2BW2A 2M17A 1C76A 1RWSA 2D5GA 5TR5A 4RGOS 4NNJB 1GC6A 1OEYJ 4DXAB 2GBRA 1ET9A 5J17A 4I6PA 2I2YA 1RYJA 2QCZA 2KFKA 2J0KA 4MJSA 2INNE 3TMPB 1T0QC 4HKQA 4IDIA 1ENFA 3DBLI 5IN7A 5AEKB 4TV3A 2LGXA 1FXTB 2KTFA 1I7HA 4RH6A 3H6NA 2C5LC 1VZ7A 4MGZE 3CSTA 3JVZX 4LNOA 4JGHB 2XNAC 1FXAA 2A5UA 1NYRA 1WXSA 3I63C 4IM3A 5JZEB 1C9FA 3KWVA 3A1QB 1VJKA 4FULA 1UBIA 4ANXA 1FPYA 1J8CA 2L1AA 4A6QA 1AW7A 3KVFB 2KX3A 2MEKA 2QEJC 2DX5B 4ITKA 4KSLC 2BWFA 2KQ7A 2YEPF 3DBRB 4AWJA 2L00B 1T0SC 3BVMA 2KVRA 4HPLB 1P7EA 4RCOA 3APCA 4DBGA 4ARCA 5AZGA 4AQ7A 2AL3A 4NY0A 4DHJD 2LHDA 1WI0A 1UELA 2CS4A 2WS3B 2W9NA 2G1EA 3ML8A 2WNMA 2XK5B 4N59A 4GGQA 4YTPB 4MM3A 3AE4B 4A8XC 2KTRA 1YQBA 4WQMA 3AU4A 4HCPB 1AWDA 2L0TA 2MP2B 1GB4A 3AEEB 2GBJA 2AQ2B 2OJRA 1WJNA 3DWMA 1WH3A 1WYWB 2HE7A 4W9EA 2LD9A 5FK9C 2NPTB 4P7IA 3MC9A 1ZPSA 3BY4B 4RFBA 3WAMA 1TY0A 2WXNA 3J9CA 2WHIA 1NI3A 2D3BA 3BVZA 1S3SG 1I4QA 1F9JA 3DVNU 3ECIA 1T5XD 5T8IA 2IO3B 3BK1A 1E8ZA 1J0GA 2BTEA 2KFKB 5EE3A 1YJ1A 4GXBA 2NCNA 4XE0A 2KWDA 3A4SC 3PLVA 2XBBC 1XLOA 3IBEA 4ZRIA 4JX1C 3LB8C 2HTHA 2KK8A 2BT6A 1MI0A 4FJVB 3U4EG 3P4RB 4IWOA 3QAQA 4C4VA 1A5RA 2KAJA 3DBSA 4AP4C 3CWIA 1SE9A 1YN5A 3B9JA 4HVBA 3PSEB 1N6ZA 3TCAA 1VZ6A 5E6JA 2XN9C 2MBBB 4EKUA 2PVGC 2BBCA 3TEZA 3RNEC 3RZFA 5AUKA 4IOIE 2MLBA 4ICUA 3NHEB 4W9FA 2QMTA 3MHZA 4NPNA 4GIVA 5HFYA 4K7UA 5E6NA 4A20A 4BFRA 1E0ZA 3V05A 5CTRC 4CO7A 2IYDB 2KO3A 2GMIC 3EGRA 2AQ3B 2ICIA 3T9LA 2G3QB 2QILA 3RNGC 4IM0A 1D5XC 2KLCA 2FIDA 5BYRA 3OG5A 1YMHE 1GB1A 3P4SB 3N32A 1V1PA 5KHQA 3Q8FA 4JLCA 2M1MA 4I6NB 2AX5A 1G6JA 1R4NI 4FN2A 1DOYA 1E10A 1MVKA 3P1MA 2G45B 2PLPA 1LFDA 4ZYNA 5IOIA 2D3CA 5IKCM 3VTVA 3AEBB 2JYTA 4GMVA 5HHDG 2J0MA 3AXCA 3OJ4B 1LQBA 2K8BA 4M00A 2LI5A 3R2TA 4HK2A 3KUDB 4P1BC 2FNJB 1H8CA 2WDTB 2LVOA 3EA6A 2KT7A 2G4SA 3H7PB 3H1UA 2ASQA 4IUMB 3QK0A 3X23A 1DOXA 2IY1B 3NVWA 2L8JA 4ANVA 5D6JB 4A55A 2WXOA 4KGRA 4RNAA 2KWVB 2UYZB 1WSPA 3L16A 3HM3A 1ISNA 4LNKA 2DBYA 1ZUD2 5C23A 1SGHA 2FUHB 1E8YA 2JWUA 1B9RA 2DZIA 4LCDE 2O2VA 5BO4B 4YT0B 3T3NA 2V3SA 2BYTA 2INPE 3IFWB 4ZOHC 4NZLB 2IO2B 3P4PB 2K1FA 3U7DA 1T0YA 3A9JB 3NVVA 4MACA 1UH6A 4AUQC 1ZXIA 1MHHE 4TQ1A 3SR6A 1WX7A 2V0GA 3ZJUA 1WRIA 2K22A 3PGEA 3RMKC 3P42A 1GJZA 1F2RI 2AWTA 3TSSA 3AN1A 2MH7A 4C7ZA 4K7SA 2LGDA 3QIJA 5HG2A 1TJEA 4YWGG 2JZPA 2KJHB 3ZO5B 4WQOB 2X38A 2MCNB 3VTUA 3FC4A 4F8CB 1XQQA 2BS3B 5E6OA 1ZXHA 3O65B 3RNBC 4A9AA 1FO4A 3DCGA 1SJHD 4MH0E 1V1OA 3FILA 4IKGA 3AEDB 5BYQA 2IY0B 1SBBB 4M01A 3VTWA 1ZDVA 1KJTA 4ANUA 4EZLA 1P3QU 2PE9A 1MG8A 3ZNID 3AEFB 5GMVA 4GDKA 4KX6B 5DPTA 4XWWA 2BVCA 1N5WA 3QHTA 2REXA 4HROA 1EM7A 2INCC 2FIFA 1UWMA 2FUG1 1D5MC 1PDXA 3PREA 1FCLA 3E9SA 4PK1A 2HD5B 4M0WA 2QJLA 2B3AA 2DYBA 3Q69A 1D5ZC 2PIAA 2N0SB 4KV2A 3ZW3A 3ZNGC 1K51A 1Z2MA 2BKFA 4MT5A 5KHOA 2LEKA 1L0XB 3AULA 3RULA 1FD6A 1YN3A 1I4XA 4XDDA 3IHPC 2FCSA 5EE9A 3GP7A 3PRPB 3AE5B 1IGCA 4MGIE 2WQYB 1HEZE 5C3JB 2KQSA 2E6XA 3L54A 1M94A 3PRMB 1SE3A 2KXJA 2J4XA 4ZRPA 1MJDA 1UD7A 3RUIB 3U52E 1FIQA 3OLMD 2FCNA 3AECB 4B6WA 3MC8A 1UZXB 4XZ4A 1WJUA 3MHSD 5LNK1 1YIWA 4LDTD 2OEDA 3NY5A 1L4DB
chains in the Genus database with same CATH topology
3PRZA 3DBLI 5HKHA 2MQJA 3RZWC 4KDIC 4HDOA 5AEKB 4TV3A 2LGXA 2GOWA 2PEAA 5LXIB 1FXTB 4DHZE 2KTFA 4W9KA 4MELA 2ZCBA 2NBUA 1P1AA 3IG3A 2FCQA 3H6NA 2C5LC 1WM2A 1WGHA 4MGZE 4FA6A 1KOTA 2K8HA 3CSTA 3JVZX 4EEWA 3KUCB 2ZVNA 4KZCA 2CKHB 2LWPA 4JGHB 4HLEA 1V2YA 3SD5A 2KC1A 1LXDA 2YLMA 4IWQA 3W1SC 2A5UA 3A33B 2K25A 1QZEA 4FLHA 1WXSA 2C9WB 5JHBA 1Q5WB 1WF9A 2HJ8A 4IM3A 3X0WA 5JZEB 3CF6E 3KH0A 4GB9A 2RPQA 2RGFA 3A1QB 3CSFA 4ANWA 3EHVA 4FULA 2KMAA 4W9HA 1UBIA 4ANXA 2A4ZA 3JW0X 1J8CA 4IM2A 1GG3A 3R3MA 5CHWA 2KDEB 1E7VA 2NR2A 2R2QA 2KX3A 3KVFB 3L17A 1WXAA 1IYFA 5D7GA 3A1QA 2MBOA 1TZ1A 2L3ZA 2DX5B 3VHTC 3ZRFA 2Z0DB 1GC7A 2YVCA 4KSLC 2N1WA 1R4MI 4KVGB 2BWFA 2JUOA 1WIAA 2KQ7A 3VH4B 4ASWC 1RLFA 4AWJA 1K8RB 2L00B 3VXWA 2BF8B 2AL6A 2KVRA 4HPLB 1U4AA 4AJWA 1EF1A 4WAAA 5FR6A 1IPGA 3APCA 4G11A 2BYVE 2MSED 4DBGA 4YL8A 5AZGA 2KOXA 1WZ3A 2KTRB 2AL3A 2RSUA 4PYZA 4NY0A 4PS8A 4W9IA 3VFKA 1YD8U 4DHJD 1WI0A 1UELA 2CS4A 3ML8A 2W9NA 1Z5SB 2KNBA 4B95A 2IO0B 2DAJA 1WXVA 2XK5B 4GGQA 4LDTB 2ZVOA 4MM3A 3GOEA 4BVUC 2KTRA 5CHFA 1YQBA 2LGYA 3WAPA 3ZUNA 3AU4A 3H7SA 2KDBA 4HCPB 4II3B 2L0TA 2MP2B 1WR1A 1E5WA 2XK5A 4HCNB 4WWNA 3V6CB 2XEWA 2GBJA 1X1MA 2Z59B 2RR9A 1OGWA 2KDFB 2OJRA 3U8ZA 2EMTA 4MSQB 1WJNA 1WH3A 2NS5A 4K81A 1WYWB 1WX8A 2HE7A 2MP2A 5D2MB 4W9EA 4JQWC 2C7NB 2LD9A 1S1QB 2NPTB 4P7IA 2LASA 4FJZA 4GN1A 1TGZB 2DYOA 3BY4B 3M62B 3WAMA 5DPWA 1AARA 1GNUA 2GBMA 3TL5A 3D32A 1S3SG 2C7HA 3DVGX 3SHQA 1UGMA 1J19A 4A3OA 4BOZB 1F9JA 2DZMA 2NPTA 1TTNA 2V4LA 3DVNU 1OTRB 1WE7A 3ECIA 1P9DU 3APDA 4XX5A 2BYEA 3V61A 2IO3B 1WXMA 1V9JA 2KD0A 3KYCD 1E8ZA 1WJ6A 3I3TB 1J0GA 2KFKB 1YJ1A 3B08A 4GXBA 2NCNA 5G55A 4BKSD 3A4SC 3ALBA 3PLVA 2XBBC 4X57B 3DOWA 4RM9A 2Y5BB 1XT9B 2EKEC 3IBEA 4ZRIA 2ZCCA 2D11A 2JZ3B 3WANA 2HTHA 5IA7A 2KK8A 2CHWA 2L0FA 3W1YA 2C7MB 4CYEA 2ZJDA 4FJVB 4TQ0A 4FADA 5EDSA 2FAZA 3KUZA 4IWOA 1WJ4A 3QAQA 2IO1B 3NS8A 1A5RA 3DQVA 3R66C 3VUYA 2KKCA 3PLUA 3DBSA 4AP4C 1SE9A 3L0WB 4E71A 1V81A 3TBLD 4HVBA 2KWUB 3PSEB 4K7WA 4F7ZA 4W9LA 3TCAA 1V5OA 4KDLB 4F1SA 2MBBB 3DPDA 3QWZB 1WGGA 4BKTA 4DDID 4EKUA 3JYUA 3B1LX 4FBJB 1ZGUB 1JRUA 2KN5A 1EF5A 2I1KA 3M95A 3NOBA 4I6LB 3RZFA 5D94A 2MLBA 4ICUA 3NHEB 2K6DB 4W9FA 4WJNA 2LUEA 3WA0A 4OVVA 4NJ6A 1ZKHA 1GUAB 2WWZA 2JRIB 2PPHA 2JZZA 3A9KB 4NPNA 4GIVA 3PVLA 1WR6E 4K7UA 5E6NA 3EFUA 2J0JA 4A20A 3L08A 4BFRA 2D10A 4PYUA 2G4DB 3HHMA 4NQKE 2MW5A 5CTRC 4CO7A 2IYDB 3UIPB 3V60A 2KO3A 2GMIC 2MBEA 3H9DA 3A9KA 3T9LA 3B0AA 4TUUA 2G3QB 3OJ3A 5G2NA 3V62A 2LRUA 3A4RA 4IM0A 4MGKE 4E74A 2R2OA 1C3TA 3RCZA 2KLCA 2FIDA 2KMCA 3VQIA 1LM8B 4DHZB 4G0NB 2PJHA 4RMAA 1Q0WB 2DAFA 3N32A 3ZIMA 3MTNB 4J6IA 2RD0A 4JLCA 5KHQA 5LLIA 3GZNI 2FCMA 2M1MA 2BGFA 4I6NB 1G6JA 3DBHI 1R4NI 4FN2A 5DCNA 4M8NA 2JT4B 3VUWA 2KLGA 4B9KA 5E6PA 4BKSA 2G45B 2N7DA 3EC8A 3M63B 3UF8A 2I1JA 2JXXA 4BKGA 1LFDA 4W9JA 3QC8B 3VAWA 4ZYNA 3IVFA 1WRDB 4NJ7A 3WAOA 1I35A 3LJ3A 1EO6A 3VTVA 4JL9A 3DVNV 4GDLB 3AU5A 3N3KB 4XC2A 1ZW7A 2MBHA 4GMVA 3VH3B 2BPSA 1WFYA 2J0MA 4GOCA 3AXCA 2ZNVB 2D07B 2IZVB 1Q1OA 3OJ4B 3ZRCA 1LQBA 3VUXA 2PE6B 2K8BA 3L10B 4BOSC 2DZKA 4M8MA 2LI5A 2LJ5A 4K1RB 3W1SA 4W9GA 2M4NA 3R7RA 5L83A 4GDLA 4ZRKA 1I42A 3DVGY 3WIMA 1NI2A 4JIOU 3K9OB 2D2QA 4HK2A 3SDLC 1E8WA 1D3ZA 3M3JA 4HWIB 1CMXB 3KUDB 3AI5A 2FNJB 3U30A 1H8CA 1E8XA 3Q3FA 2WDTB 2LVOA 1YX5B 2GBNA 3ZDMC 4KZ0A 1SIFA 2KX0A 4PS3A 2ZPYA 2G4SA 3H7PB 5JH5C 3H1UA 2ASQA 3V6EB 4IUMB 3QK0A 3NZSA 5CHVC 5IAAC 3X23A 2KZRA 2N9PC 3PS6A 4IW0A 2CHXA 2KJRA 2IY1B 2L8JA 2VRRB 4ANVA 3MJWA 3H7PA 5D6JB 3RD2A 3ZNZB 3RYTA 2JY6A 2MX2A 1NDDA 3ML9A 2KWCA 4DWFA 5L95C 2BWES 3QX1A 1RRBA 3VDZA 4HPMB 5DPSA 2KWVB 2UYZB 2N1VA 4DK5A 3L16A 3HM3A 1L7YA 1H4RA 3ZTDA 2O2VB 1ISNA 3T8MA 2L05A 2KFJA 1UBQA 2CHZA 3PHXB 5C23A 5DPRA 1SGHA 4DHJB 2FUHB 1E8YA 3N30A 3PV1A 2KANA 4W9CA 3ZDTA 3UQAA 1BT0A 2DZIA 1V5TA 4LCDE 3HIZA 1EUVB 2O2VA 2QHOA 4KSKC 5BO4B 1WMHB 3DDCB 1XD3B 2V3SA 3JSVB 5LXHA 3Q3JA 1E90A 2CU1A 4EZKA 4MEMA 3ONSA 1Y8RC 2N9XA 3IFWB 1E7UA 1WZ0A 2O6VD 4WJPA 1IP9A 3ZTCA 2N9EB 3PHWB 1WMHA 2IO2B 1KLVA 1NBFC 1V86A 2K1FA 3C0RB 3JSVA 3U7DA 1T0YA 1V49A 3A9JB 2LXCA 4BBNF 4WJOA 1UH6A 4AUQC 4RM8A 2KHWB 3K9PB 3CMMB 2MWSB 4EFOA 4TQ1A 1WX7A 4FHKA 2DYMA 2JWZA 4PS7A 4TKNA 4NAWB 1TBEA 2WX0A 3L13A 3PGEA 1YX6B 1GJZA 3S2AA 2MBQA 3A9JA 1VD2A 2AWTA 1RAXA 1WX9A 2NBVB 3WALA 3ZNHB 3APFA 3OAWA 1RFAA 3UIOB 2BKRB 1WE6A 2AEHA 4EZJA 4K7SA 2LGDA 3VVWB 3QIJA 2Z0EB 3SU8X 4NAWA 4ZDVA 4WJQA 3QCAA 2JRHA 2OOBB 4G3XB 4W9DA 2KJHB 4FHJA 3ZO5B 4WQOB 4WWOA 5JHAA 2MCNB 2JPHA 2ZNVC 3VTUA 4F8CB 1XQQA 2N7EA 5E6OA 2WX1A 3O65B 2ZEQA 2K8CA 3DCGA 5J18A 2LXAA 4MH0E 3QARA 2WYQA 3ZVVA 2LRWA 3DBRI 1WGRA 4HDQA 4KIKB 2ZPNA 4GDKB 5C1ZA 2IY0B 3HM6X 3VTWA 4BBNC 4E3CA 4IG7B 1KJTA 4HJKA 4G50A 3R7QA 1OQYA 4ANUA 3HK0A 4EZLA 1P3QU 2PE9A 3UQBA 1MG8A 2CR5A 2EMSA 3ZNID 4KIKA 2BYFA 1WGDA 3ENEA 5GMVA 4GDKA 2L76A 4DDGD 4FJYA 5DPTA 3KYDD 2J7QB 3PZDA 3PPAA 1P0RA 2REXA 3QHTA 2O6VB 1P98A 1C1YB 4WWPA 4M0WB 5AZFA 2FIFA 3PT2B 3ZLZA 2MA9B 2C60A 1PQSA 3PREA 2M8SA 2O6VA 3TIXA 1VCBA 2DZJA 4GU2A 4ZRJA 2ZZPB 2NVUI 2KC2A 4CHKA 2HD5B 2KJ6A 4EOYA 2B3AA 2DYBA 1V80A 5J2RA 3ZKJC 2JF5A 2AYOB 4HXDA 4KV2A 3ZW3A 3ZNGC 4II2B 1Z2MA 2UWQA 3QJZA 2BKFA 4IWPA 5KHOA 4GSWA 3UGBB 1HE8A 4N9F4 2K6QA 2D3GA 3QA8A 2DHZA 4OVUA 3AULA 3KW5B 3RULA 1L2NA 3IHPC 2FCSA 2LZ6A 2MRPA 2LVQA 4IC7B 2JVCA 2KDIA 4MGYE 2NBWB 4A3PA 3BINA 3PRPB 3UINB 2M17A 2V1YA 4MGIE 2IBIB 3LDZE 3NZUA 1OEYA 2KQSA 1V6EA 1WY8A 3L54A 4MDKE 5TR5A 2DENB 3TJPA 2GBKA 4NNJB 1GC6A 1M94A 1OEYJ 3PRMB 4DXAB 2L7RA 2KXJA 2GBRA 2LVPA 3EECA 4MJSB 1UD7A 3RUIB 3RT3B 5AZHA 4URKA 1WM3A 4AOFA 5J17A 2K39A 3OLMD 2FCNA 4I6PA 1KM7A 1WGYA 4AJYB 4B6WA 2KFKA 2J0KA 3QQ8B 4LJPB 3P2BA 1UZXB 4MJSA 1WJUA 4NQLB 4XZ4A 4MSMB 3MHSD 2N4FA 2M0XA 3TMPB 4EUTA 4ICVA 1YIWA 4LDTD 3NY5A 3PTFC 4LJOB 5CX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRZ A;  3DBL I;  5HKH A;  2MQJ A;  3RZW C;  4KDI C;  4HDO A;  5AEK B;  4TV3 A;  2LGX A;  2GOW A;  2PEA A;  5LXI B;  1FXT B;  4DHZ E;  2KTF A;  4W9K A;  4MEL A;  2ZCB A;  2NBU A;  1P1A A;  3IG3 A;  2FCQ A;  3H6N A;  2C5L C;  1WM2 A;  1WGH A;  4MGZ E;  4FA6 A;  1KOT A;  2K8H A;  3CST A;  3JVZ X;  4EEW A;  3KUC B;  2ZVN A;  4KZC A;  2CKH B;  2LWP A;  4JGH B;  4HLE A;  1V2Y A;  3SD5 A;  2KC1 A;  1LXD A;  2YLM A;  4IWQ A;  3W1S C;  2A5U A;  3A33 B;  2K25 A;  1QZE A;  4FLH A;  1WXS A;  2C9W B;  5JHB A;  1Q5W B;  1WF9 A;  2HJ8 A;  4IM3 A;  3X0W A;  5JZE B;  3CF6 E;  3KH0 A;  4GB9 A;  2RPQ A;  2RGF A;  3A1Q B;  3CSF A;  4ANW A;  3EHV A;  4FUL A;  2KMA A;  4W9H A;  1UBI A;  4ANX A;  2A4Z A;  3JW0 X;  1J8C A;  4IM2 A;  1GG3 A;  3R3M A;  5CHW A;  2KDE B;  1E7V A;  2NR2 A;  2R2Q A;  2KX3 A;  3KVF B;  3L17 A;  1WXA A;  1IYF A;  5D7G A;  3A1Q A;  2MBO A;  1TZ1 A;  2L3Z A;  2DX5 B;  3VHT C;  3ZRF A;  2Z0D B;  1GC7 A;  2YVC A;  4KSL C;  2N1W A;  1R4M I;  4KVG B;  2BWF A;  2JUO A;  1WIA A;  2KQ7 A;  3VH4 B;  4ASW C;  1RLF A;  4AWJ A;  1K8R B;  2L00 B;  3VXW A;  2BF8 B;  2AL6 A;  2KVR A;  4HPL B;  1U4A A;  4AJW A;  1EF1 A;  4WAA A;  5FR6 A;  1IPG A;  3APC A;  4G11 A;  2BYV E;  2MSE D;  4DBG A;  4YL8 A;  5AZG A;  2KOX A;  1WZ3 A;  2KTR B;  2AL3 A;  2RSU A;  4PYZ A;  4NY0 A;  4PS8 A;  4W9I A;  3VFK A;  1YD8 U;  4DHJ D;  1WI0 A;  1UEL A;  2CS4 A;  3ML8 A;  2W9N A;  1Z5S B;  2KNB A;  4B95 A;  2IO0 B;  2DAJ A;  1WXV A;  2XK5 B;  4GGQ A;  4LDT B;  2ZVO A;  4MM3 A;  3GOE A;  4BVU C;  2KTR A;  5CHF A;  1YQB A;  2LGY A;  3WAP A;  3ZUN A;  3AU4 A;  3H7S A;  2KDB A;  4HCP B;  4II3 B;  2L0T A;  2MP2 B;  1WR1 A;  1E5W A;  2XK5 A;  4HCN B;  4WWN A;  3V6C B;  2XEW A;  2GBJ A;  1X1M A;  2Z59 B;  2RR9 A;  1OGW A;  2KDF B;  2OJR A;  3U8Z A;  2EMT A;  4MSQ B;  1WJN A;  1WH3 A;  2NS5 A;  4K81 A;  1WYW B;  1WX8 A;  2HE7 A;  2MP2 A;  5D2M B;  4W9E A;  4JQW C;  2C7N B;  2LD9 A;  1S1Q B;  2NPT B;  4P7I A;  2LAS A;  4FJZ A;  4GN1 A;  1TGZ B;  2DYO A;  3BY4 B;  3M62 B;  3WAM A;  5DPW A;  1AAR A;  1GNU A;  2GBM A;  3TL5 A;  3D32 A;  1S3S G;  2C7H A;  3DVG X;  3SHQ A;  1UGM A;  1J19 A;  4A3O A;  4BOZ B;  1F9J A;  2DZM A;  2NPT A;  1TTN A;  2V4L A;  3DVN U;  1OTR B;  1WE7 A;  3ECI A;  1P9D U;  3APD A;  4XX5 A;  2BYE A;  3V61 A;  2IO3 B;  1WXM A;  1V9J A;  2KD0 A;  3KYC D;  1E8Z A;  1WJ6 A;  3I3T B;  1J0G A;  2KFK B;  1YJ1 A;  3B08 A;  4GXB A;  2NCN A;  5G55 A;  4BKS D;  3A4S C;  3ALB A;  3PLV A;  2XBB C;  4X57 B;  3DOW A;  4RM9 A;  2Y5B B;  1XT9 B;  2EKE C;  3IBE A;  4ZRI A;  2ZCC A;  2D11 A;  2JZ3 B;  3WAN A;  2HTH A;  5IA7 A;  2KK8 A;  2CHW A;  2L0F A;  3W1Y A;  2C7M B;  4CYE A;  2ZJD A;  4FJV B;  4TQ0 A;  4FAD A;  5EDS A;  2FAZ A;  3KUZ A;  4IWO A;  1WJ4 A;  3QAQ A;  2IO1 B;  3NS8 A;  1A5R A;  3DQV A;  3R66 C;  3VUY A;  2KKC A;  3PLU A;  3DBS A;  4AP4 C;  1SE9 A;  3L0W B;  4E71 A;  1V81 A;  3TBL D;  4HVB A;  2KWU B;  3PSE B;  4K7W A;  4F7Z A;  4W9L A;  3TCA A;  1V5O A;  4KDL B;  4F1S A;  2MBB B;  3DPD A;  3QWZ B;  1WGG A;  4BKT A;  4DDI D;  4EKU A;  3JYU A;  3B1L X;  4FBJ B;  1ZGU B;  1JRU A;  2KN5 A;  1EF5 A;  2I1K A;  3M95 A;  3NOB A;  4I6L B;  3RZF A;  5D94 A;  2MLB A;  4ICU A;  3NHE B;  2K6D B;  4W9F A;  4WJN A;  2LUE A;  3WA0 A;  4OVV A;  4NJ6 A;  1ZKH A;  1GUA B;  2WWZ A;  2JRI B;  2PPH A;  2JZZ A;  3A9K B;  4NPN A;  4GIV A;  3PVL A;  1WR6 E;  4K7U A;  5E6N A;  3EFU A;  2J0J A;  4A20 A;  3L08 A;  4BFR A;  2D10 A;  4PYU A;  2G4D B;  3HHM A;  4NQK E;  2MW5 A;  5CTR C;  4CO7 A;  2IYD B;  3UIP B;  3V60 A;  2KO3 A;  2GMI C;  2MBE A;  3H9D A;  3A9K A;  3T9L A;  3B0A A;  4TUU A;  2G3Q B;  3OJ3 A;  5G2N A;  3V62 A;  2LRU A;  3A4R A;  4IM0 A;  4MGK E;  4E74 A;  2R2O A;  1C3T A;  3RCZ A;  2KLC A;  2FID A;  2KMC A;  3VQI A;  1LM8 B;  4DHZ B;  4G0N B;  2PJH A;  4RMA A;  1Q0W B;  2DAF A;  3N32 A;  3ZIM A;  3MTN B;  4J6I A;  2RD0 A;  4JLC A;  5KHQ A;  5LLI A;  3GZN I;  2FCM A;  2M1M A;  2BGF A;  4I6N B;  1G6J A;  3DBH I;  1R4N I;  4FN2 A;  5DCN A;  4M8N A;  2JT4 B;  3VUW A;  2KLG A;  4B9K A;  5E6P A;  4BKS A;  2G45 B;  2N7D A;  3EC8 A;  3M63 B;  3UF8 A;  2I1J A;  2JXX A;  4BKG A;  1LFD A;  4W9J A;  3QC8 B;  3VAW A;  4ZYN A;  3IVF A;  1WRD B;  4NJ7 A;  3WAO A;  1I35 A;  3LJ3 A;  1EO6 A;  3VTV A;  4JL9 A;  3DVN V;  4GDL B;  3AU5 A;  3N3K B;  4XC2 A;  1ZW7 A;  2MBH A;  4GMV A;  3VH3 B;  2BPS A;  1WFY A;  2J0M A;  4GOC A;  3AXC A;  2ZNV B;  2D07 B;  2IZV B;  1Q1O A;  3OJ4 B;  3ZRC A;  1LQB A;  3VUX A;  2PE6 B;  2K8B A;  3L10 B;  4BOS C;  2DZK A;  4M8M A;  2LI5 A;  2LJ5 A;  4K1R B;  3W1S A;  4W9G A;  2M4N A;  3R7R A;  5L83 A;  4GDL A;  4ZRK A;  1I42 A;  3DVG Y;  3WIM A;  1NI2 A;  4JIO U;  3K9O B;  2D2Q A;  4HK2 A;  3SDL C;  1E8W A;  1D3Z A;  3M3J A;  4HWI B;  1CMX B;  3KUD B;  3AI5 A;  2FNJ B;  3U30 A;  1H8C A;  1E8X A;  3Q3F A;  2WDT B;  2LVO A;  1YX5 B;  2GBN A;  3ZDM C;  4KZ0 A;  1SIF A;  2KX0 A;  4PS3 A;  2ZPY A;  2G4S A;  3H7P B;  5JH5 C;  3H1U A;  2ASQ A;  3V6E B;  4IUM B;  3QK0 A;  3NZS A;  5CHV C;  5IAA C;  3X23 A;  2KZR A;  2N9P C;  3PS6 A;  4IW0 A;  2CHX A;  2KJR A;  2IY1 B;  2L8J A;  2VRR B;  4ANV A;  3MJW A;  3H7P A;  5D6J B;  3RD2 A;  3ZNZ B;  3RYT A;  2JY6 A;  2MX2 A;  1NDD A;  3ML9 A;  2KWC A;  4DWF A;  5L95 C;  2BWE S;  3QX1 A;  1RRB A;  3VDZ A;  4HPM B;  5DPS A;  2KWV B;  2UYZ B;  2N1V A;  4DK5 A;  3L16 A;  3HM3 A;  1L7Y A;  1H4R A;  3ZTD A;  2O2V B;  1ISN A;  3T8M A;  2L05 A;  2KFJ A;  1UBQ A;  2CHZ A;  3PHX B;  5C23 A;  5DPR A;  1SGH A;  4DHJ B;  2FUH B;  1E8Y A;  3N30 A;  3PV1 A;  2KAN A;  4W9C A;  3ZDT A;  3UQA A;  1BT0 A;  2DZI A;  1V5T A;  4LCD E;  3HIZ A;  1EUV B;  2O2V A;  2QHO A;  4KSK C;  5BO4 B;  1WMH B;  3DDC B;  1XD3 B;  2V3S A;  3JSV B;  5LXH A;  3Q3J A;  1E90 A;  2CU1 A;  4EZK A;  4MEM A;  3ONS A;  1Y8R C;  2N9X A;  3IFW B;  1E7U A;  1WZ0 A;  2O6V D;  4WJP A;  1IP9 A;  3ZTC A;  2N9E B;  3PHW B;  1WMH A;  2IO2 B;  1KLV A;  1NBF C;  1V86 A;  2K1F A;  3C0R B;  3JSV A;  3U7D A;  1T0Y A;  1V49 A;  3A9J B;  2LXC A;  4BBN F;  4WJO A;  1UH6 A;  4AUQ C;  4RM8 A;  2KHW B;  3K9P B;  3CMM B;  2MWS B;  4EFO A;  4TQ1 A;  1WX7 A;  4FHK A;  2DYM A;  2JWZ A;  4PS7 A;  4TKN A;  4NAW B;  1TBE A;  2WX0 A;  3L13 A;  3PGE A;  1YX6 B;  1GJZ A;  3S2A A;  2MBQ A;  3A9J A;  1VD2 A;  2AWT A;  1RAX A;  1WX9 A;  2NBV B;  3WAL A;  3ZNH B;  3APF A;  3OAW A;  1RFA A;  3UIO B;  2BKR B;  1WE6 A;  2AEH A;  4EZJ A;  4K7S A;  2LGD A;  3VVW B;  3QIJ A;  2Z0E B;  3SU8 X;  4NAW A;  4ZDV A;  4WJQ A;  3QCA A;  2JRH A;  2OOB B;  4G3X B;  4W9D A;  2KJH B;  4FHJ A;  3ZO5 B;  4WQO B;  4WWO A;  5JHA A;  2MCN B;  2JPH A;  2ZNV C;  3VTU A;  4F8C B;  1XQQ A;  2N7E A;  5E6O A;  2WX1 A;  3O65 B;  2ZEQ A;  2K8C A;  3DCG A;  5J18 A;  2LXA A;  4MH0 E;  3QAR A;  2WYQ A;  3ZVV A;  2LRW A;  3DBR I;  1WGR A;  4HDQ A;  4KIK B;  2ZPN A;  4GDK B;  5C1Z A;  2IY0 B;  3HM6 X;  3VTW A;  4BBN C;  4E3C A;  4IG7 B;  1KJT A;  4HJK A;  4G50 A;  3R7Q A;  1OQY A;  4ANU A;  3HK0 A;  4EZL A;  1P3Q U;  2PE9 A;  3UQB A;  1MG8 A;  2CR5 A;  2EMS A;  3ZNI D;  4KIK A;  2BYF A;  1WGD A;  3ENE A;  5GMV A;  4GDK A;  2L76 A;  4DDG D;  4FJY A;  5DPT A;  3KYD D;  2J7Q B;  3PZD A;  3PPA A;  1P0R A;  2REX A;  3QHT A;  2O6V B;  1P98 A;  1C1Y B;  4WWP A;  4M0W B;  5AZF A;  2FIF A;  3PT2 B;  3ZLZ A;  2MA9 B;  2C60 A;  1PQS A;  3PRE A;  2M8S A;  2O6V A;  3TIX A;  1VCB A;  2DZJ A;  4GU2 A;  4ZRJ A;  2ZZP B;  2NVU I;  2KC2 A;  4CHK A;  2HD5 B;  2KJ6 A;  4EOY A;  2B3A A;  2DYB A;  1V80 A;  5J2R A;  3ZKJ C;  2JF5 A;  2AYO B;  4HXD A;  4KV2 A;  3ZW3 A;  3ZNG C;  4II2 B;  1Z2M A;  2UWQ A;  3QJZ A;  2BKF A;  4IWP A;  5KHO A;  4GSW A;  3UGB B;  1HE8 A;  4N9F 4;  2K6Q A;  2D3G A;  3QA8 A;  2DHZ A;  4OVU A;  3AUL A;  3KW5 B;  3RUL A;  1L2N A;  3IHP C;  2FCS A;  2LZ6 A;  2MRP A;  2LVQ A;  4IC7 B;  2JVC A;  2KDI A;  4MGY E;  2NBW B;  4A3P A;  3BIN A;  3PRP B;  3UIN B;  2M17 A;  2V1Y A;  4MGI E;  2IBI B;  3LDZ E;  3NZU A;  1OEY A;  2KQS A;  1V6E A;  1WY8 A;  3L54 A;  4MDK E;  5TR5 A;  2DEN B;  3TJP A;  2GBK A;  4NNJ B;  1GC6 A;  1M94 A;  1OEY J;  3PRM B;  4DXA B;  2L7R A;  2KXJ A;  2GBR A;  2LVP A;  3EEC A;  4MJS B;  1UD7 A;  3RUI B;  3RT3 B;  5AZH A;  4URK A;  1WM3 A;  4AOF A;  5J17 A;  2K39 A;  3OLM D;  2FCN A;  4I6P A;  1KM7 A;  1WGY A;  4AJY B;  4B6W A;  2KFK A;  2J0K A;  3QQ8 B;  4LJP B;  3P2B A;  1UZX B;  4MJS A;  1WJU A;  4NQL B;  4XZ4 A;  4MSM B;  3MHS D;  2N4F A;  2M0X A;  3TMP B;  4EUT A;  4ICV A;  1YIW A;  4LDT D;  3NY5 A;  3PTF C;  4LJO B;  5CX3 A; 
#chains in the Genus database with same CATH topology
 2MQJ A;  3AH7 A;  4HDO A;  4DHZ E;  2ZCB A;  1D4B A;  3R2I A;  1I4G A;  2PMV A;  1TKG A;  4FA6 A;  4LK0 M;  2K8H A;  1L0V B;  2ZVN A;  2LWP A;  1NEK B;  4IWQ A;  3W1S C;  2K25 A;  3Q8A A;  1N60 A;  1FMA D;  2RGF A;  4ANW A;  3EHV A;  4HRS A;  4W9H A;  1XLN A;  4PT5 A;  2A4Z A;  1L0Y B;  4IM2 A;  3R3M A;  2WGS A;  1WXA A;  3A1Q A;  1QLB B;  2MBO A;  2Y3A A;  1XLQ A;  3VHT C;  3ZRF A;  2Z0D B;  1GC7 A;  1R4M I;  4KVG B;  2JUO A;  1SE4 A;  1PGX A;  1JRP A;  1IPG A;  1ZE3 D;  4G11 A;  2BYV E;  2MSE D;  4USA A;  3Q6B A;  3VFK A;  1XF5 L;  3BYY B;  1JWS D;  1T0R C;  2IO0 B;  1WXV A;  1VLB A;  2KAC A;  3GOE A;  4BVU C;  3Q8B A;  4ZYS A;  2WXR A;  1QOA A;  3WAP A;  2K0P A;  3ZUN A;  2IND C;  1XCT L;  3H7S A;  2Y5C A;  2HDE A;  2MJE A;  2XK5 A;  2W54 A;  2RR9 A;  1OGW A;  2NS5 A;  2MP2 A;  5D2M B;  2C7N B;  2LHE A;  3IT4 B;  1STE A;  3Q3M C;  1S1Q B;  3B2G A;  2LAS A;  4LNN A;  3IAM 1;  2DYO A;  1HXY D;  2V3P A;  1QT9 A;  3IXS A;  4C00 A;  2GBM A;  3DHI C;  2C7H A;  2NPT A;  5G5H A;  1OTR B;  2BYE A;  1WXM A;  2KD0 A;  4XWT A;  1M4V A;  4C80 A;  3I3T B;  1TKY A;  5G55 A;  4BKS D;  4X57 B;  1TKE A;  4OHJ A;  1XT9 B;  2EKE C;  2D11 A;  3W5U B;  2L0F A;  1DYQ A;  3W1Y A;  4CYE A;  2WLB A;  2FAZ A;  2WXG A;  2IO1 B;  3V3X A;  2L52 A;  1AN8 A;  3NS1 A;  2SAK A;  3PLU A;  4OZB A;  4BZA A;  3L0W B;  4YSZ B;  4W9L A;  4KDL B;  3DPD A;  2BB6 A;  3B1L X;  1ZGU B;  1FEH A;  2KN5 A;  2M19 A;  1L4Z B;  1EF5 A;  2HJ1 A;  3M95 A;  3NOB A;  4I6L B;  1WGK A;  3Q8E A;  3BK2 A;  5D3D A;  4WJN A;  3WA0 A;  2JRI B;  3A9K B;  2JZZ A;  3PVL A;  1WR6 E;  2OJW A;  2D10 A;  4YTM B;  2ONQ A;  3UIP B;  5FR3 A;  4RF0 A;  2MJ3 A;  2NTS A;  2QDF A;  1PYW D;  2IJ0 A;  4L23 A;  3OJ3 A;  1FFV A;  1XO3 A;  4MGK E;  5I4D A;  1C3T A;  3RCZ A;  4DHZ B;  4G0N B;  1NVI D;  3N9Y C;  3MTN B;  5LLI A;  3EFC A;  2LJI A;  3GZN I;  4RGM A;  2BGF A;  1TS2 A;  3DBH I;  5DCN A;  1SSN A;  3VUW A;  2KLG A;  3TEX A;  4DXG A;  3EC8 A;  2N7D A;  2JXX A;  2V4I B;  4YXD B;  3VRA B;  1FRD A;  3WAO A;  3DVN V;  4XC2 A;  3ZJV A;  1WFY A;  2D07 B;  3BYT B;  3ZRC A;  2PE6 B;  3KWL A;  3L10 B;  1JWM D;  4BOS C;  2DZK A;  4M8M A;  2LJ5 A;  3W1S A;  2M4N A;  1ZOY B;  1F77 A;  1PFD A;  1NI2 A;  4JIO U;  2D2Q A;  3BII D;  3SDL C;  1E8W A;  2WDV B;  1D3Z A;  3M3J A;  4WIP A;  1CMX B;  1HTO A;  3Q3F A;  2LUM A;  1J7C A;  1PGB A;  2GBN A;  3ZDM C;  1T6B X;  1JAL A;  1JRO A;  4PS3 A;  2ZPY A;  4LTU A;  2KZR A;  4IW0 A;  2CHX A;  3H7P A;  4A90 A;  1WXQ A;  1K53 A;  3ZNZ B;  3RYT A;  2KWC A;  1I4R A;  1Q10 A;  5L95 C;  3QX1 A;  1RRB A;  3GE3 C;  3RNC C;  3ZXV A;  1IGD A;  1PUT A;  3T8M A;  4KKI A;  3N1Y C;  3MC0 B;  4S0R A;  1HQR D;  2R61 A;  2KAN A;  3UQA A;  1BT0 A;  1L5P A;  2DNF A;  3HIZ A;  2QHO A;  3DDC B;  4MH8 A;  3JSV B;  4EZK A;  1A70 A;  1E7U A;  1WZ0 A;  2O6V D;  4WJP A;  4KKJ A;  1IP9 A;  3ZTC A;  3SFD B;  3VR8 B;  1NBF C;  1V8C A;  1V86 A;  1EWC A;  3W9C B;  2DLB A;  1V49 A;  4KGT A;  1TT5 B;  4RM8 A;  3I9V 1;  1F1H A;  2MWS B;  4RF1 A;  4EFO A;  2WDQ B;  2JWZ A;  4PS7 A;  1YX6 B;  2MBQ A;  3A9J A;  3VR9 B;  3ZNH B;  4TSS A;  1RFA A;  4EZJ A;  1B1Z A;  2JRH A;  3AE9 B;  3LXF A;  4FHJ A;  2JPH A;  2ZNV C;  2N7E A;  4NAM A;  1L6V A;  2J42 A;  2WX1 A;  2LXA A;  3QAR A;  4WH4 A;  2RDB C;  4N58 A;  2LRW A;  4KIK B;  2ZPN A;  1R4N B;  1GOZ A;  4IG7 B;  4HJK A;  4G50 A;  3HK0 A;  2CR5 A;  2EMS A;  5BMG A;  1WGD A;  2L76 A;  4ARI A;  3KYD D;  2J7Q B;  5BMI A;  3PPA A;  3FAH A;  1C1Y B;  2WXI A;  4WWP A;  1BUI C;  1K50 A;  3ZLZ A;  3DWG C;  3R8B A;  2C60 A;  4US9 A;  3MJ5 A;  1VCB A;  3TIX A;  1C78 A;  3CIR B;  2KN4 A;  2NVU I;  4LLG M;  2KJ6 A;  1V80 A;  2JQR B;  3AEG B;  1QIL A;  2LFI A;  3ZKJ C;  1QQR A;  2IGG A;  4II2 B;  2UWQ A;  4IWP A;  3UGB B;  1FRR A;  4K3C A;  3QA8 A;  4QAY A;  2ZW0 A;  2Q5W D;  2LZ6 A;  3OWE B;  2LVQ A;  1TS3 A;  2KDI A;  4MGY E;  5D3I B;  3UI3 A;  3BIN A;  1ZDX A;  2KQ4 X;  1L6U A;  2V1Y A;  1D6E C;  4WWM A;  3NZU A;  1OEY A;  1V6E A;  2DEN B;  3Q8C A;  2L7R A;  3HVZ A;  4DQO C;  2LVP A;  3EEC A;  1Y56 A;  1MPE A;  1DGJ A;  2KYW A;  3RT3 B;  4URK A;  1WM3 A;  4AOF A;  2K39 A;  1WGY A;  4AJY B;  1ZP0 B;  3Q3O C;  1UF0 A;  3P2B A;  1IBX B;  2VH2 A;  2J53 A;  4EUT A;  4ICV A;  4PYZ A;  4XGA B;  4LJO B;  2L83 A;  5HKH A;  3BVG A;  4WUR A;  5LXI B;  1N5X A;  4W9K A;  4MEL A;  1P1A A;  3IG3 A;  1KOT A;  4EEW A;  2JSV X;  4KZC A;  4HLE A;  1N63 A;  2KC1 A;  1LXD A;  1EWY C;  2YLM A;  1I4P A;  1QZE A;  1QOG A;  2C9W B;  1Q5W B;  2Y5P A;  2ACZ B;  3CF6 E;  4GB9 A;  2RPQ A;  4AS1 A;  3CSF A;  3I5J C;  1N61 A;  3JW0 X;  3ZJT A;  1IYF A;  1JQ4 A;  1TZ1 A;  3N1X C;  2L3Z A;  1FCC C;  3AE2 B;  2N1W A;  1IUE A;  4B0E A;  1UGJ A;  3VH4 B;  4ASW C;  1EU4 A;  1RLF A;  4REZ A;  4JWU C;  2AL6 A;  1U4A A;  2SEB D;  4WAA A;  5FR6 A;  1CK1 A;  2KOX A;  2RSU A;  2BS4 B;  1YD8 U;  3AE1 B;  1Z5S B;  2KNB A;  3GS2 A;  3PZ8 A;  2MHJ A;  4LDT B;  2PTL A;  2WXL A;  2LGY A;  2HTM E;  4D2K A;  3HRD D;  1OQQ A;  2KDB A;  3Q14 C;  4II3 B;  3NVY A;  4O1N A;  4WWN A;  2XEW A;  2N9K A;  1X1M A;  2Z59 B;  1KTK A;  2EMT A;  4MSQ B;  2E3T A;  5EE1 A;  4K81 A;  4JQW C;  1FFU A;  4FJZ A;  4GN1 A;  3M62 B;  5DPW A;  1AAR A;  3TL5 A;  4ZHP A;  3D32 A;  1UGM A;  4BOZ B;  2DZM A;  2V4L A;  1P9D U;  3V61 A;  3BWU D;  1WJ6 A;  2K9X A;  1OFF A;  3ALB A;  5BMH A;  2VZK D;  3DOW A;  2Y5B B;  3AV8 A;  2ZCC A;  2JZ3 B;  2W82 A;  1VZ8 A;  5IA7 A;  2GI9 A;  1HTQ A;  4BAX A;  4FAD A;  3KUZ A;  4HEA 1;  1TS5 A;  1V97 A;  3NS8 A;  3R66 C;  3VUY A;  2KKC A;  1JWB D;  4US8 A;  1JWU D;  1V81 A;  3TBL D;  2KWU B;  1TY2 A;  1V5O A;  1PGA A;  4F1S A;  3RFZ B;  3QWZ B;  4BKT A;  4DDI D;  2J52 A;  4FXC A;  3PO0 A;  2I1K A;  5D94 A;  1EU3 A;  3TUO A;  3T3O A;  2LUE A;  4OVV A;  4NJ6 A;  2WWZ A;  2PPH A;  2FE8 A;  2J0J A;  3L08 A;  4PYU A;  2G4D B;  4NQK E;  2MW5 A;  3AE7 B;  3H9D A;  3A9K A;  1SJE D;  3NUH B;  1CQV A;  3DHH C;  4TUU A;  4E74 A;  3GE8 C;  2LRU A;  3A4R A;  2R2O A;  2KMC A;  1LM8 B;  2PJH A;  1Q0W B;  2V3N A;  1TZO A;  2RD0 A;  5FKA C;  2Z8L A;  1R4M B;  3AB5 A;  2JT4 B;  3AE8 B;  4B9K A;  3HVD A;  3M63 B;  2RDH A;  4W9J A;  3ZGZ A;  4LNI A;  4CQN A;  3IVF A;  4NJ7 A;  3LJ3 A;  1EO6 A;  3LYY A;  3IAS 1;  4JL9 A;  5C2T B;  4GDL B;  2KVZ A;  3N3K B;  1FXI A;  3VH3 B;  1KF6 B;  2BPS A;  3DHG C;  1KRH A;  2ZNV B;  2IZV B;  1Q1O A;  4HJG E;  3VUX A;  1YOV B;  3O13 A;  4W9G A;  3DVG Y;  1GPX A;  2W3R A;  1ACC A;  3K9O B;  1FNV A;  1E8X A;  2WP9 B;  4KZ0 A;  2KX0 A;  3MP9 A;  3FKY A;  1RM6 C;  4P6V F;  2H89 B;  2KJR A;  3MJW A;  3NVZ A;  2ON8 A;  2JY6 A;  1UNS A;  1NDD A;  4DWF A;  3P63 A;  3VDZ A;  2WU2 B;  1JCK B;  2N1V A;  3NZ3 A;  1L7Y A;  2KFJ A;  1F2R C;  1YQ3 B;  3PHX B;  5TSS A;  4DHJ B;  2WXQ A;  3N30 A;  3PV1 A;  4S17 A;  1V5T A;  1EUV B;  3TEY A;  1WMH B;  1SXT A;  1XD3 B;  1C4P A;  5LXH A;  3Q3J A;  1E90 A;  2CU1 A;  5H8Y E;  3ONS A;  1Y8R C;  1FM0 D;  2N9X A;  3DBL B;  5H92 C;  2N9E B;  2N7J A;  2WXM A;  3JSV A;  4BBN F;  4P16 A;  1E9M A;  1C77 A;  4FHK A;  2KDM A;  2DYM A;  3H8H A;  4NAW B;  1TBE A;  3L13 A;  4R3D A;  3S2A A;  2W55 A;  2AQ1 B;  3APF A;  2QSD A;  1SEB D;  2AEH A;  1YNT E;  3L4P A;  3NRZ A;  4WJQ A;  4XYC A;  4XDC A;  4GLS C;  1GAQ B;  2OOB B;  4RGT A;  4WWO A;  1J7A A;  2LMC A;  3TEW A;  3AM9 A;  1R7S A;  2K8C A;  5J18 A;  1YJI A;  3ZVV A;  2MJD A;  3DBR I;  3KLS X;  1WGR A;  4HDQ A;  3GZN B;  1ET6 A;  3DBH B;  1QOB A;  4BBN C;  1E7P B;  2QIE B;  1TYG B;  4KIK A;  2BYF A;  3ENE A;  4B0M A;  5GXG B;  4FJY A;  1XCQ L;  3HUI A;  1JWA D;  1P0R A;  2O6V B;  3PZ7 A;  2CJN A;  4J3O D;  2W3S A;  5AZF A;  1MFW A;  3PT2 B;  2IPK D;  4NJC A;  3B2F A;  1BML C;  2ZZP B;  4CHK A;  2B76 B;  2GLS A;  1KLG D;  5J2R A;  2AYO B;  4HXD A;  1OQR A;  3QJZ A;  4GSW A;  4TMA B;  1HE8 A;  2K6Q A;  1NYQ A;  4M02 A;  4OVU A;  3KW5 B;  1L2N A;  5IP4 D;  3WCQ A;  2MRP A;  4IC7 B;  2JVC A;  3SEB A;  4A3P A;  2IGD A;  3N20 C;  2WXF A;  4ACF A;  2IBI B;  3LDZ E;  1WY8 A;  4MDK E;  2WXK A;  1YQ4 B;  4OVZ A;  3TJP A;  2GBK A;  2BS2 B;  5IO9 A;  4YTN B;  2EEL A;  4MJS B;  1FNU A;  5AZH A;  3URY A;  1P7F A;  4K3B A;  1KM7 A;  1YJJ A;  4OZA A;  1KLU D;  3QQ8 B;  4LJP B;  1N62 A;  4NQL B;  4MSM B;  2JU6 X;  2N4F A;  2M0X A;  3PTF C;  4UDU C;  2VH1 A;  3PRZ A;  5CX3 A;  3RZW C;  4KDI C;  2L32 A;  2PEA A;  2GOW A;  1IBX A;  2NBU A;  3ETR A;  2FCQ A;  1WM2 A;  1WGH A;  2X8X X;  2H88 B;  3KUC B;  5BYS A;  2CKH B;  1V2Y A;  3SD5 A;  3A33 B;  5G5G A;  4FLH A;  4C7Y A;  5JHB A;  2HJ8 A;  1WF9 A;  3X0W A;  1MG4 A;  3KH0 A;  2KMA A;  1BXT A;  1GG3 A;  5CHW A;  4RGN A;  2KDE B;  1E7V A;  2NR2 A;  2R2Q A;  3L17 A;  5HI1 A;  2GRI A;  4OW0 A;  5D7G A;  4WAF A;  2YVC A;  1WIA A;  1K8R B;  2WXJ A;  3NJT A;  1SIJ A;  3VXW A;  2BF8 B;  4AJW A;  1EF1 A;  2K5P A;  4DXF A;  4MM3 B;  4YL8 A;  1WZ3 A;  2KTR B;  4PS8 A;  4W9I A;  4N6E B;  4B95 A;  1QKZ A;  2DAJ A;  2WXH A;  1WWT A;  2ZVO A;  5CHF A;  1LGR A;  1WR1 A;  2WXP A;  1E5W A;  4HCN B;  3V6C B;  2KDF B;  3ZXR A;  3U8Z A;  2WDR B;  1FNW A;  1KFY B;  1WX8 A;  1YN4 A;  4C56 C;  3EUB 2;  1TGZ B;  2GB1 A;  1E6E B;  1GNU A;  1ESF A;  1KH0 A;  3SHQ A;  4A3O A;  3AE6 B;  3C8Y A;  3DVG X;  1J19 A;  1TTN A;  1WE7 A;  4XX5 A;  3APD A;  2K3U A;  1WYG A;  2PW9 A;  1V9J A;  3KYC D;  4JPS A;  4H2A A;  1I4H A;  1CJE A;  3B08 A;  3E56 A;  4OZC A;  1UUP A;  4RM9 A;  4C4V B;  3WAN A;  2CHW A;  2C7M B;  4HPP A;  2ZJD A;  3Q2A C;  4TQ0 A;  2DWQ A;  5EDS A;  3IT6 B;  1WJ4 A;  2RPV A;  3DQV A;  4EE2 A;  2RMM A;  2JYE A;  4E71 A;  3AMZ A;  4K7W A;  4F7Z A;  3SFE B;  1WGG A;  3JYU A;  4FBJ B;  1JRU A;  5EE0 A;  2K6D B;  3P4Q B;  1ZKH A;  1GUA B;  3RPF C;  3EFU A;  3HHM A;  2RDG A;  3V60 A;  3AE3 B;  2MBE A;  1C4A A;  1SB3 C;  4KGS A;  3B0A A;  1V1P B;  5G2N A;  2CU3 A;  3V62 A;  3VQI A;  4RMA A;  2DAF A;  3ZIM A;  2VZK B;  4J6I A;  2WU5 B;  2FCM A;  1HZ5 A;  4L2Y A;  4M8N A;  4BKS A;  5E6P A;  2PVO D;  1F0Z A;  3UF8 A;  1C4C A;  2I1J A;  2LGS A;  4BKG A;  3QC8 B;  3VAW A;  1I35 A;  1WRD B;  3W2D A;  1QF6 A;  3AU5 A;  1ZW7 A;  2MBH A;  4GOC A;  1JML A;  1QOF A;  4K1R B;  1HA5 A;  3R7R A;  5L83 A;  4GDL A;  4ZRK A;  1I42 A;  3Q3N C;  3WIM A;  3KQ4 A;  4HWI B;  3AI5 A;  3U30 A;  2M56 B;  1YX5 B;  2CJO A;  1C79 A;  3GB1 A;  1SIF A;  3RI7 C;  5JH5 C;  3ABV B;  3V6E B;  3NZS A;  5CHV C;  5IAA C;  1DOI A;  4L1B A;  3U7Z A;  2N9P C;  3PS6 A;  2I38 A;  1JW9 D;  2NTT A;  4ZHO A;  2VRR B;  4JE3 B;  3RD2 A;  2M0A A;  1TIF A;  2MX2 A;  3ML9 A;  2BWE S;  3C19 A;  4HPM B;  5DPS A;  4DK5 A;  3ZTD A;  1H4R A;  2O2V B;  2D3A A;  2L05 A;  1UBQ A;  2CHZ A;  5AUI A;  5DPR A;  1AYF A;  4W9C A;  3ZDT A;  2V9H A;  4KSK C;  3W5V B;  1LO5 D;  2YEP B;  4MEM A;  2KMM A;  2G9H D;  4Q2J A;  1K52 A;  2QC8 A;  3PHW B;  1KLV A;  1WMH A;  2FBW B;  1XXG A;  1J7B A;  3C0R B;  2LXC A;  4WJO A;  3AEA B;  2KHW B;  3K9P B;  3CMM B;  4TKN A;  2WX0 A;  3RN9 C;  1MHX A;  1VD2 A;  1SE2 A;  1RAX A;  1WX9 A;  2NBV B;  3WAL A;  3OAW A;  3UIO B;  2BKR B;  1WE6 A;  3VVW B;  3SU8 X;  2Z0E B;  3BZD B;  3VRB B;  2TSS A;  4NAW A;  4ZDV A;  2NMQ A;  3QCA A;  1XEE A;  3FIL B;  4G3X B;  4W9D A;  5JHA A;  4P1C C;  1RFK A;  2ZEQ A;  5JXV A;  1TS4 A;  1CZP A;  2IDY A;  2EKI A;  2OHF A;  2JXT A;  2WYQ A;  4GDK B;  5C1Z A;  3RNF C;  3HM6 X;  4E3C A;  4YSX B;  2ZW1 A;  3R7Q A;  3ZQ4 A;  1OQY A;  3UQB A;  4ZRQ A;  1NEN B;  4DDG D;  2LGI A;  3PZD A;  1P98 A;  2UU7 A;  4JWS C;  2N9L A;  5MPO A;  4M0W B;  2BQQ A;  3I57 A;  3MFG A;  2MA9 B;  3NG0 A;  1XLP A;  1PQS A;  1SF0 A;  4LNF A;  1ROE A;  2M8S A;  2O6V A;  4YSY B;  2DZJ A;  4GU2 A;  4ZRJ A;  1T3Q A;  3ZYY X;  2KC2 A;  1HZ6 A;  1UWX A;  4EOY A;  1VDV A;  2JF5 A;  2JX5 A;  2IGH A;  3RNA C;  2PKO A;  4N9F 4;  2D3G A;  2DHZ A;  2BB5 A;  3N1Z C;  1F52 A;  1VRA B;  2NBW B;  3U2S C;  4HKZ E;  3UIN B;  1VR9 A;  2BW2 A;  2M17 A;  1C76 A;  1RWS A;  2D5G A;  5TR5 A;  4RGO S;  4NNJ B;  1GC6 A;  1OEY J;  4DXA B;  2GBR A;  1ET9 A;  5J17 A;  4I6P A;  2I2Y A;  1RYJ A;  2QCZ A;  2KFK A;  2J0K A;  4MJS A;  2INN E;  3TMP B;  1T0Q C;  4HKQ A;  4IDI A;  1ENF A;  3DBL I;  5IN7 A;  5AEK B;  4TV3 A;  2LGX A;  1FXT B;  2KTF A;  1I7H A;  4RH6 A;  3H6N A;  2C5L C;  1VZ7 A;  4MGZ E;  3CST A;  3JVZ X;  4LNO A;  4JGH B;  2XNA C;  1FXA A;  2A5U A;  1NYR A;  1WXS A;  3I63 C;  4IM3 A;  5JZE B;  1C9F A;  3KWV A;  3A1Q B;  1VJK A;  4FUL A;  1UBI A;  4ANX A;  1FPY A;  1J8C A;  2L1A A;  4A6Q A;  1AW7 A;  3KVF B;  2KX3 A;  2MEK A;  2QEJ C;  2DX5 B;  4ITK A;  4KSL C;  2BWF A;  2KQ7 A;  2YEP F;  3DBR B;  4AWJ A;  2L00 B;  1T0S C;  3BVM A;  2KVR A;  4HPL B;  1P7E A;  4RCO A;  3APC A;  4DBG A;  4ARC A;  5AZG A;  4AQ7 A;  2AL3 A;  4NY0 A;  4DHJ D;  2LHD A;  1WI0 A;  1UEL A;  2CS4 A;  2WS3 B;  2W9N A;  2G1E A;  3ML8 A;  2WNM A;  2XK5 B;  4N59 A;  4GGQ A;  4YTP B;  4MM3 A;  3AE4 B;  4A8X C;  2KTR A;  1YQB A;  4WQM A;  3AU4 A;  4HCP B;  1AWD A;  2L0T A;  2MP2 B;  1GB4 A;  3AEE B;  2GBJ A;  2AQ2 B;  2OJR A;  1WJN A;  3DWM A;  1WH3 A;  1WYW B;  2HE7 A;  4W9E A;  2LD9 A;  5FK9 C;  2NPT B;  4P7I A;  3MC9 A;  1ZPS A;  3BY4 B;  4RFB A;  3WAM A;  1TY0 A;  2WXN A;  3J9C A;  2WHI A;  1NI3 A;  2D3B A;  3BVZ A;  1S3S G;  1I4Q A;  1F9J A;  3DVN U;  3ECI A;  1T5X D;  5T8I A;  2IO3 B;  3BK1 A;  1E8Z A;  1J0G A;  2BTE A;  2KFK B;  5EE3 A;  1YJ1 A;  4GXB A;  2NCN A;  4XE0 A;  2KWD A;  3A4S C;  3PLV A;  2XBB C;  1XLO A;  3IBE A;  4ZRI A;  4JX1 C;  3LB8 C;  2HTH A;  2KK8 A;  2BT6 A;  1MI0 A;  4FJV B;  3U4E G;  3P4R B;  4IWO A;  3QAQ A;  4C4V A;  1A5R A;  2KAJ A;  3DBS A;  4AP4 C;  3CWI A;  1SE9 A;  1YN5 A;  3B9J A;  4HVB A;  3PSE B;  1N6Z A;  3TCA A;  1VZ6 A;  5E6J A;  2XN9 C;  2MBB B;  4EKU A;  2PVG C;  2BBC A;  3TEZ A;  3RNE C;  3RZF A;  5AUK A;  4IOI E;  2MLB A;  4ICU A;  3NHE B;  4W9F A;  2QMT A;  3MHZ A;  4NPN A;  4GIV A;  5HFY A;  4K7U A;  5E6N A;  4A20 A;  4BFR A;  1E0Z A;  3V05 A;  5CTR C;  4CO7 A;  2IYD B;  2KO3 A;  2GMI C;  3EGR A;  2AQ3 B;  2ICI A;  3T9L A;  2G3Q B;  2QIL A;  3RNG C;  4IM0 A;  1D5X C;  2KLC A;  2FID A;  5BYR A;  3OG5 A;  1YMH E;  1GB1 A;  3P4S B;  3N32 A;  1V1P A;  5KHQ A;  3Q8F A;  4JLC A;  2M1M A;  4I6N B;  2AX5 A;  1G6J A;  1R4N I;  4FN2 A;  1DOY A;  1E10 A;  1MVK A;  3P1M A;  2G45 B;  2PLP A;  1LFD A;  4ZYN A;  5IOI A;  2D3C A;  5IKC M;  3VTV A;  3AEB B;  2JYT A;  4GMV A;  5HHD G;  2J0M A;  3AXC A;  3OJ4 B;  1LQB A;  2K8B A;  4M00 A;  2LI5 A;  3R2T A;  4HK2 A;  3KUD B;  4P1B C;  2FNJ B;  1H8C A;  2WDT B;  2LVO A;  3EA6 A;  2KT7 A;  2G4S A;  3H7P B;  3H1U A;  2ASQ A;  4IUM B;  3QK0 A;  3X23 A;  1DOX A;  2IY1 B;  3NVW A;  2L8J A;  4ANV A;  5D6J B;  4A55 A;  2WXO A;  4KGR A;  4RNA A;  2KWV B;  2UYZ B;  1WSP A;  3L16 A;  3HM3 A;  1ISN A;  4LNK A;  2DBY A;  1ZUD 2;  5C23 A;  1SGH A;  2FUH B;  1E8Y A;  2JWU A;  1B9R A;  2DZI A;  4LCD E;  2O2V A;  5BO4 B;  4YT0 B;  3T3N A;  2V3S A;  2BYT A;  2INP E;  3IFW B;  4ZOH C;  4NZL B;  2IO2 B;  3P4P B;  2K1F A;  3U7D A;  1T0Y A;  3A9J B;  3NVV A;  4MAC A;  1UH6 A;  4AUQ C;  1ZXI A;  1MHH E;  4TQ1 A;  3SR6 A;  1WX7 A;  2V0G A;  3ZJU A;  1WRI A;  2K22 A;  3PGE A;  3RMK C;  3P42 A;  1GJZ A;  1F2R I;  2AWT A;  3TSS A;  3AN1 A;  2MH7 A;  4C7Z A;  4K7S A;  2LGD A;  3QIJ A;  5HG2 A;  1TJE A;  4YWG G;  2JZP A;  2KJH B;  3ZO5 B;  4WQO B;  2X38 A;  2MCN B;  3VTU A;  3FC4 A;  4F8C B;  1XQQ A;  2BS3 B;  5E6O A;  1ZXH A;  3O65 B;  3RNB C;  4A9A A;  1FO4 A;  3DCG A;  1SJH D;  4MH0 E;  1V1O A;  3FIL A;  4IKG A;  3AED B;  5BYQ A;  2IY0 B;  1SBB B;  4M01 A;  3VTW A;  1ZDV A;  1KJT A;  4ANU A;  4EZL A;  1P3Q U;  2PE9 A;  1MG8 A;  3ZNI D;  3AEF B;  5GMV A;  4GDK A;  4KX6 B;  5DPT A;  4XWW A;  2BVC A;  1N5W A;  3QHT A;  2REX A;  4HRO A;  1EM7 A;  2INC C;  2FIF A;  1UWM A;  2FUG 1;  1D5M C;  1PDX A;  3PRE A;  1FCL A;  3E9S A;  4PK1 A;  2HD5 B;  4M0W A;  2QJL A;  2B3A A;  2DYB A;  3Q69 A;  1D5Z C;  2PIA A;  2N0S B;  4KV2 A;  3ZW3 A;  3ZNG C;  1K51 A;  1Z2M A;  2BKF A;  4MT5 A;  5KHO A;  2LEK A;  1L0X B;  3AUL A;  3RUL A;  1FD6 A;  1YN3 A;  1I4X A;  4XDD A;  3IHP C;  2FCS A;  5EE9 A;  3GP7 A;  3PRP B;  3AE5 B;  1IGC A;  4MGI E;  2WQY B;  1HEZ E;  5C3J B;  2KQS A;  2E6X A;  3L54 A;  1M94 A;  3PRM B;  1SE3 A;  2KXJ A;  2J4X A;  4ZRP A;  1MJD A;  1UD7 A;  3RUI B;  3U52 E;  1FIQ A;  3OLM D;  2FCN A;  3AEC B;  4B6W A;  3MC8 A;  1UZX B;  4XZ4 A;  1WJU A;  3MHS D;  5LNK 1;  1YIW A;  4LDT D;  2OED A;  3NY5 A;  1L4D B; 
#chains in the Genus database with same CATH homology
 3PRZ A;  3DBL I;  5HKH A;  2MQJ A;  3RZW C;  4KDI C;  4HDO A;  5AEK B;  4TV3 A;  2LGX A;  2GOW A;  2PEA A;  5LXI B;  1FXT B;  4DHZ E;  2KTF A;  4W9K A;  4MEL A;  2ZCB A;  2NBU A;  1P1A A;  3IG3 A;  2FCQ A;  3H6N A;  2C5L C;  1WM2 A;  1WGH A;  4MGZ E;  4FA6 A;  1KOT A;  2K8H A;  3CST A;  3JVZ X;  4EEW A;  3KUC B;  2ZVN A;  4KZC A;  2CKH B;  2LWP A;  4JGH B;  4HLE A;  1V2Y A;  3SD5 A;  2KC1 A;  1LXD A;  2YLM A;  4IWQ A;  3W1S C;  2A5U A;  3A33 B;  2K25 A;  1QZE A;  4FLH A;  1WXS A;  2C9W B;  5JHB A;  1Q5W B;  1WF9 A;  2HJ8 A;  4IM3 A;  3X0W A;  5JZE B;  3CF6 E;  3KH0 A;  4GB9 A;  2RPQ A;  2RGF A;  3A1Q B;  3CSF A;  4ANW A;  3EHV A;  4FUL A;  2KMA A;  4W9H A;  1UBI A;  4ANX A;  2A4Z A;  3JW0 X;  1J8C A;  4IM2 A;  1GG3 A;  3R3M A;  5CHW A;  2KDE B;  1E7V A;  2NR2 A;  2R2Q A;  2KX3 A;  3KVF B;  3L17 A;  1WXA A;  1IYF A;  5D7G A;  3A1Q A;  2MBO A;  1TZ1 A;  2L3Z A;  2DX5 B;  3VHT C;  3ZRF A;  2Z0D B;  1GC7 A;  2YVC A;  4KSL C;  2N1W A;  1R4M I;  4KVG B;  2BWF A;  2JUO A;  1WIA A;  2KQ7 A;  3VH4 B;  4ASW C;  1RLF A;  4AWJ A;  1K8R B;  2L00 B;  3VXW A;  2BF8 B;  2AL6 A;  2KVR A;  4HPL B;  1U4A A;  4AJW A;  1EF1 A;  4WAA A;  5FR6 A;  1IPG A;  3APC A;  4G11 A;  2BYV E;  2MSE D;  4DBG A;  4YL8 A;  5AZG A;  2KOX A;  1WZ3 A;  2KTR B;  2AL3 A;  2RSU A;  4PYZ A;  4NY0 A;  4PS8 A;  4W9I A;  3VFK A;  1YD8 U;  4DHJ D;  1WI0 A;  1UEL A;  2CS4 A;  3ML8 A;  2W9N A;  1Z5S B;  2KNB A;  4B95 A;  2IO0 B;  2DAJ A;  1WXV A;  2XK5 B;  4GGQ A;  4LDT B;  2ZVO A;  4MM3 A;  3GOE A;  4BVU C;  2KTR A;  5CHF A;  1YQB A;  2LGY A;  3WAP A;  3ZUN A;  3AU4 A;  3H7S A;  2KDB A;  4HCP B;  4II3 B;  2L0T A;  2MP2 B;  1WR1 A;  1E5W A;  2XK5 A;  4HCN B;  4WWN A;  3V6C B;  2XEW A;  2GBJ A;  1X1M A;  2Z59 B;  2RR9 A;  1OGW A;  2KDF B;  2OJR A;  3U8Z A;  2EMT A;  4MSQ B;  1WJN A;  1WH3 A;  2NS5 A;  4K81 A;  1WYW B;  1WX8 A;  2HE7 A;  2MP2 A;  5D2M B;  4W9E A;  4JQW C;  2C7N B;  2LD9 A;  1S1Q B;  2NPT B;  4P7I A;  2LAS A;  4FJZ A;  4GN1 A;  1TGZ B;  2DYO A;  3BY4 B;  3M62 B;  3WAM A;  5DPW A;  1AAR A;  1GNU A;  2GBM A;  3TL5 A;  3D32 A;  1S3S G;  2C7H A;  3DVG X;  3SHQ A;  1UGM A;  1J19 A;  4A3O A;  4BOZ B;  1F9J A;  2DZM A;  2NPT A;  1TTN A;  2V4L A;  3DVN U;  1OTR B;  1WE7 A;  3ECI A;  1P9D U;  3APD A;  4XX5 A;  2BYE A;  3V61 A;  2IO3 B;  1WXM A;  1V9J A;  2KD0 A;  3KYC D;  1E8Z A;  1WJ6 A;  3I3T B;  1J0G A;  2KFK B;  1YJ1 A;  3B08 A;  4GXB A;  2NCN A;  5G55 A;  4BKS D;  3A4S C;  3ALB A;  3PLV A;  2XBB C;  4X57 B;  3DOW A;  4RM9 A;  2Y5B B;  1XT9 B;  2EKE C;  3IBE A;  4ZRI A;  2ZCC A;  2D11 A;  2JZ3 B;  3WAN A;  2HTH A;  5IA7 A;  2KK8 A;  2CHW A;  2L0F A;  3W1Y A;  2C7M B;  4CYE A;  2ZJD A;  4FJV B;  4TQ0 A;  4FAD A;  5EDS A;  2FAZ A;  3KUZ A;  4IWO A;  1WJ4 A;  3QAQ A;  2IO1 B;  3NS8 A;  1A5R A;  3DQV A;  3R66 C;  3VUY A;  2KKC A;  3PLU A;  3DBS A;  4AP4 C;  1SE9 A;  3L0W B;  4E71 A;  1V81 A;  3TBL D;  4HVB A;  2KWU B;  3PSE B;  4K7W A;  4F7Z A;  4W9L A;  3TCA A;  1V5O A;  4KDL B;  4F1S A;  2MBB B;  3DPD A;  3QWZ B;  1WGG A;  4BKT A;  4DDI D;  4EKU A;  3JYU A;  3B1L X;  4FBJ B;  1ZGU B;  1JRU A;  2KN5 A;  1EF5 A;  2I1K A;  3M95 A;  3NOB A;  4I6L B;  3RZF A;  5D94 A;  2MLB A;  4ICU A;  3NHE B;  2K6D B;  4W9F A;  4WJN A;  2LUE A;  3WA0 A;  4OVV A;  4NJ6 A;  1ZKH A;  1GUA B;  2WWZ A;  2JRI B;  2PPH A;  2JZZ A;  3A9K B;  4NPN A;  4GIV A;  3PVL A;  1WR6 E;  4K7U A;  5E6N A;  3EFU A;  2J0J A;  4A20 A;  3L08 A;  4BFR A;  2D10 A;  4PYU A;  2G4D B;  3HHM A;  4NQK E;  2MW5 A;  5CTR C;  4CO7 A;  2IYD B;  3UIP B;  3V60 A;  2KO3 A;  2GMI C;  2MBE A;  3H9D A;  3A9K A;  3T9L A;  3B0A A;  4TUU A;  2G3Q B;  3OJ3 A;  5G2N A;  3V62 A;  2LRU A;  3A4R A;  4IM0 A;  4MGK E;  4E74 A;  2R2O A;  1C3T A;  3RCZ A;  2KLC A;  2FID A;  2KMC A;  3VQI A;  1LM8 B;  4DHZ B;  4G0N B;  2PJH A;  4RMA A;  1Q0W B;  2DAF A;  3N32 A;  3ZIM A;  3MTN B;  4J6I A;  2RD0 A;  4JLC A;  5KHQ A;  5LLI A;  3GZN I;  2FCM A;  2M1M A;  2BGF A;  4I6N B;  1G6J A;  3DBH I;  1R4N I;  4FN2 A;  5DCN A;  4M8N A;  2JT4 B;  3VUW A;  2KLG A;  4B9K A;  5E6P A;  4BKS A;  2G45 B;  2N7D A;  3EC8 A;  3M63 B;  3UF8 A;  2I1J A;  2JXX A;  4BKG A;  1LFD A;  4W9J A;  3QC8 B;  3VAW A;  4ZYN A;  3IVF A;  1WRD B;  4NJ7 A;  3WAO A;  1I35 A;  3LJ3 A;  1EO6 A;  3VTV A;  4JL9 A;  3DVN V;  4GDL B;  3AU5 A;  3N3K B;  4XC2 A;  1ZW7 A;  2MBH A;  4GMV A;  3VH3 B;  2BPS A;  1WFY A;  2J0M A;  4GOC A;  3AXC A;  2ZNV B;  2D07 B;  2IZV B;  1Q1O A;  3OJ4 B;  3ZRC A;  1LQB A;  3VUX A;  2PE6 B;  2K8B A;  3L10 B;  4BOS C;  2DZK A;  4M8M A;  2LI5 A;  2LJ5 A;  4K1R B;  3W1S A;  4W9G A;  2M4N A;  3R7R A;  5L83 A;  4GDL A;  4ZRK A;  1I42 A;  3DVG Y;  3WIM A;  1NI2 A;  4JIO U;  3K9O B;  2D2Q A;  4HK2 A;  3SDL C;  1E8W A;  1D3Z A;  3M3J A;  4HWI B;  1CMX B;  3KUD B;  3AI5 A;  2FNJ B;  3U30 A;  1H8C A;  1E8X A;  3Q3F A;  2WDT B;  2LVO A;  1YX5 B;  2GBN A;  3ZDM C;  4KZ0 A;  1SIF A;  2KX0 A;  4PS3 A;  2ZPY A;  2G4S A;  3H7P B;  5JH5 C;  3H1U A;  2ASQ A;  3V6E B;  4IUM B;  3QK0 A;  3NZS A;  5CHV C;  5IAA C;  3X23 A;  2KZR A;  2N9P C;  3PS6 A;  4IW0 A;  2CHX A;  2KJR A;  2IY1 B;  2L8J A;  2VRR B;  4ANV A;  3MJW A;  3H7P A;  5D6J B;  3RD2 A;  3ZNZ B;  3RYT A;  2JY6 A;  2MX2 A;  1NDD A;  3ML9 A;  2KWC A;  4DWF A;  5L95 C;  2BWE S;  3QX1 A;  1RRB A;  3VDZ A;  4HPM B;  5DPS A;  2KWV B;  2UYZ B;  2N1V A;  4DK5 A;  3L16 A;  3HM3 A;  1L7Y A;  1H4R A;  3ZTD A;  2O2V B;  1ISN A;  3T8M A;  2L05 A;  2KFJ A;  1UBQ A;  2CHZ A;  3PHX B;  5C23 A;  5DPR A;  1SGH A;  4DHJ B;  2FUH B;  1E8Y A;  3N30 A;  3PV1 A;  2KAN A;  4W9C A;  3ZDT A;  3UQA A;  1BT0 A;  2DZI A;  1V5T A;  4LCD E;  3HIZ A;  1EUV B;  2O2V A;  2QHO A;  4KSK C;  5BO4 B;  1WMH B;  3DDC B;  1XD3 B;  2V3S A;  3JSV B;  5LXH A;  3Q3J A;  1E90 A;  2CU1 A;  4EZK A;  4MEM A;  3ONS A;  1Y8R C;  2N9X A;  3IFW B;  1E7U A;  1WZ0 A;  2O6V D;  4WJP A;  1IP9 A;  3ZTC A;  2N9E B;  3PHW B;  1WMH A;  2IO2 B;  1KLV A;  1NBF C;  1V86 A;  2K1F A;  3C0R B;  3JSV A;  3U7D A;  1T0Y A;  1V49 A;  3A9J B;  2LXC A;  4BBN F;  4WJO A;  1UH6 A;  4AUQ C;  4RM8 A;  2KHW B;  3K9P B;  3CMM B;  2MWS B;  4EFO A;  4TQ1 A;  1WX7 A;  4FHK A;  2DYM A;  2JWZ A;  4PS7 A;  4TKN A;  4NAW B;  1TBE A;  2WX0 A;  3L13 A;  3PGE A;  1YX6 B;  1GJZ A;  3S2A A;  2MBQ A;  3A9J A;  1VD2 A;  2AWT A;  1RAX A;  1WX9 A;  2NBV B;  3WAL A;  3ZNH B;  3APF A;  3OAW A;  1RFA A;  3UIO B;  2BKR B;  1WE6 A;  2AEH A;  4EZJ A;  4K7S A;  2LGD A;  3VVW B;  3QIJ A;  2Z0E B;  3SU8 X;  4NAW A;  4ZDV A;  4WJQ A;  3QCA A;  2JRH A;  2OOB B;  4G3X B;  4W9D A;  2KJH B;  4FHJ A;  3ZO5 B;  4WQO B;  4WWO A;  5JHA A;  2MCN B;  2JPH A;  2ZNV C;  3VTU A;  4F8C B;  1XQQ A;  2N7E A;  5E6O A;  2WX1 A;  3O65 B;  2ZEQ A;  2K8C A;  3DCG A;  5J18 A;  2LXA A;  4MH0 E;  3QAR A;  2WYQ A;  3ZVV A;  2LRW A;  3DBR I;  1WGR A;  4HDQ A;  4KIK B;  2ZPN A;  4GDK B;  5C1Z A;  2IY0 B;  3HM6 X;  3VTW A;  4BBN C;  4E3C A;  4IG7 B;  1KJT A;  4HJK A;  4G50 A;  3R7Q A;  1OQY A;  4ANU A;  3HK0 A;  4EZL A;  1P3Q U;  2PE9 A;  3UQB A;  1MG8 A;  2CR5 A;  2EMS A;  3ZNI D;  4KIK A;  2BYF A;  1WGD A;  3ENE A;  5GMV A;  4GDK A;  2L76 A;  4DDG D;  4FJY A;  5DPT A;  3KYD D;  2J7Q B;  3PZD A;  3PPA A;  1P0R A;  2REX A;  3QHT A;  2O6V B;  1P98 A;  1C1Y B;  4WWP A;  4M0W B;  5AZF A;  2FIF A;  3PT2 B;  3ZLZ A;  2MA9 B;  2C60 A;  1PQS A;  3PRE A;  2M8S A;  2O6V A;  3TIX A;  1VCB A;  2DZJ A;  4GU2 A;  4ZRJ A;  2ZZP B;  2NVU I;  2KC2 A;  4CHK A;  2HD5 B;  2KJ6 A;  4EOY A;  2B3A A;  2DYB A;  1V80 A;  5J2R A;  3ZKJ C;  2JF5 A;  2AYO B;  4HXD A;  4KV2 A;  3ZW3 A;  3ZNG C;  4II2 B;  1Z2M A;  2UWQ A;  3QJZ A;  2BKF A;  4IWP A;  5KHO A;  4GSW A;  3UGB B;  1HE8 A;  4N9F 4;  2K6Q A;  2D3G A;  3QA8 A;  2DHZ A;  4OVU A;  3AUL A;  3KW5 B;  3RUL A;  1L2N A;  3IHP C;  2FCS A;  2LZ6 A;  2MRP A;  2LVQ A;  4IC7 B;  2JVC A;  2KDI A;  4MGY E;  2NBW B;  4A3P A;  3BIN A;  3PRP B;  3UIN B;  2M17 A;  2V1Y A;  4MGI E;  2IBI B;  3LDZ E;  3NZU A;  1OEY A;  2KQS A;  1V6E A;  1WY8 A;  3L54 A;  4MDK E;  5TR5 A;  2DEN B;  3TJP A;  2GBK A;  4NNJ B;  1GC6 A;  1M94 A;  1OEY J;  3PRM B;  4DXA B;  2L7R A;  2KXJ A;  2GBR A;  2LVP A;  3EEC A;  4MJS B;  1UD7 A;  3RUI B;  3RT3 B;  5AZH A;  4URK A;  1WM3 A;  4AOF A;  5J17 A;  2K39 A;  3OLM D;  2FCN A;  4I6P A;  1KM7 A;  1WGY A;  4AJY B;  4B6W A;  2KFK A;  2J0K A;  3QQ8 B;  4LJP B;  3P2B A;  1UZX B;  4MJS A;  1WJU A;  4NQL B;  4XZ4 A;  4MSM B;  3MHS D;  2N4F A;  2M0X A;  3TMP B;  4EUT A;  4ICV A;  1YIW A;  4LDT D;  3NY5 A;  3PTF C;  4LJO B;  5CX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...