3BIID

Crystal structure of activated mpt synthase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
80
structure length
80
Chain Sequence
MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdopterin-converting factor subunit 1
publication title Crystal structure of a molybdopterin synthase-precursor Z complex: insight into its sulfur transfer mechanism and its role in molybdenum cofactor deficiency.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 22
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2007-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3biiD00
1NEKB 1E9MA 3AEFB 2CJNA 4FXCA 3NRZA 1PUTA 3AB5A 3AH7A 4P6VF 4JX1C 1YQ3B 2QJLA 5C2TB 1IUEA 2BS3B 1DOYA 1RM6C 3AEBB 1L5PA 2H89B 3HRDD 4YSZB 3P1MA 4WWMA 1CZPA 3FAHA 2PVGC 1CJEA 3AN1A 1NYRA 1N60A 2CU3A 4ITKA 2KMMA 1YJJA 1AYFA 1JRPA 1TKEA 5EE0A 1E10A 3W5UB 1XLOA 5H92C 2W54A 4WQMA 4C80A 3KWLA 4ZOHC 1A70A 3RPFC 2Y5CA 1OQQA 2BS4B 4C7ZA 2MJDA 2QIEB 2EKIA 3VR9B 1L6VA 2MJEA 3ETRA 4YTMB 2W55A 4YXDB 5C3JB 2HTME 1GPXA 1VJKA 4N59A 3HVZA 1JQ4A 1AWDA 1EWYC 2L52A 3WCQA 3AV8A 1ROEA 2E3TA 2WDQB 2H88B 1TKGA 1N62A 1ZUD2 3NVVA 2MH7A 1PFDA 4HROA 1L6UA 3ZYYX 1E6EB 4USAA 4C7YA 1N61A 1YJIA 1YQ4B 2WU5B 1FRRA 1QT9A 3BIID 3P4RB 3B9JA 4N6EB 2WU2B 1ZOYB 1QLBB 5EE1A 2CJOA 2PKOA 1GAQB 2KAJA 2WQYB 2MJ3A 5G5HA 2OHFA 3AE2B 3L4PA 2PIAA 1V97A 3P4PB 1FFUA 4YTPB 1R7SA 2M56B 1XLPA 3P4QB 4N58A 3P63A 1QOGA 2M19A 3NVYA 2ACZB 1J7AA 3AEAB 2K5PA 1E7PB 2W3RA 1KRHA 4YT0B 1JW9D 1DOIA 4JWUC 2K22A 3VR8B 1OQRA 3AE5B 3AMZA 3NS1A 1SF0A 4JWSC 2JQRB 3AECB 1DOXA 1F0ZA 5MPOA 3ABVB 1KFYB 1ZP0B 2BS2B 2WDVB 3DWGC 3PO0A 3W9CB 4YSXB 2N0SB 3W5VB 3AE8B 3AE9B 2AX5A 1WWTA 2G1EA 1J7CA 3AE1B 3AE7B 5EE9A 4A9AA 3SFDB 3AEGB 3FC4A 3EUB2 1UWMA 1XLQA 1JROA 2B76B 1VLBA 1VDVA 1FXIA 3AE4B 3B2GA 4YSYB 2FBWB 2W3SA 1SB3C 1NENB 1JWBD 3DWMA 4ZHPA 2JX5A 2LEKA 2K9XA 4YTNB 1FIQA 1FRDA 3B2FA 1NYQA 2WP9B 5EE3A 1XLNA 1WRIA 3AEDB 1FXAA 3LXFA 1E0ZA 2Q5WD 3AE3B 1I7HA 1QOFA 1SIJA 4IDIA 3CIRB 2WLBA 4HRSA 1B9RA 1JALA 2PVOD 2DWQA 5GXGB 1FFVA 3CWIA 1N5WA 1FM0D 1FO4A 4KX6B 2L83A 2WDRB 1RWSA 1J7BA 3AE6B 1QOBA 1TYGB 3HUIA 4LTUA 5AUKA 1N63A 1WYGA 2DBYA 1FMAD 1L0VB 1OFFA 1PDXA 1RFKA 1TJEA 1TKYA 4US8A 1NVID 1RYJA 1NI3A 1T3QA 1DGJA 3NVZA 2BT6A 4US9A 1KF6B 1V8CA 3P4SB 5AUIA 1JWAD 1WGKA 5H8YE 3SFEB 3NVWA 3VRAB 1QOAA 1XO3A 2WS3B 3LB8C 3VRBB 1QF6A 3AEEB 3SR6A 5G5GA 1N5XA 4ZHOA 1WXQA 3AM9A 1ZXIA
chains in the Genus database with same CATH superfamily
4GIVA 3ENEA 2KDIA 2I38A 2QJLA 2W9NA 5C2TB 2LGSA 3T3OA 2FCNA 5JHBA 5EE0A 3T9LA 3MC9A 3BK2A 3Q8FA 3MTNB 3KWLA 1YN5A 2GLSA 1KLGD 4REZA 1OQQA 4M8NA 2KMAA 1L6VA 1Q1OA 1Y8RC 4IWQA 3U2SC 3L10B 5E6JA 4XWTA 2QILA 2ZVOA 1OTRB 1ESFA 4DHJB 4JQWC 4DWFA 4URKA 1AN8A 2V9HA 4RGMA 3PLUA 1V80A 3RT3B 1CMXB 3RNAC 3MC8A 3DHGC 1ISNA 2WXNA 3QCAA 3AECB 5MPOA 4L1BA 4XDDA 2N0SB 4LNOA 1VZ6A 4OZAA 3AE4B 3AI5A 1WGHA 4NAWA 2KDEB 1FIQA 1XLNA 3N1ZC 1E8YA 5IO9A 2WNMA 4P1CC 1DYQA 4XDCA 3N9YC 1UNSA 3GP7A 5IKCM 3OG5A 3FKYA 4WJPA 3ZLZA 4NAWB 3VUYA 1FCCC 2PLPA 1ZE3D 4BVUC 1RYJA 4US9A 4KSLC 3VHTC 1RRBA 1C4PA 2DX5B 1IUEA 2DYMA 4LJPB 1FD6A 4ARCA 1WMHA 2RSUA 1F1HA 2D3CA 3BZDB 2KOXA 5HKHA 4J3OD 5FK9C 4AJWA 1SBBB 1WMHB 1HE8A 5C3JB 5JZEB 5D6JB 1EWYC 1M94A 2KXJA 2KC2A 1FNWA 3MJWA 3NZ3A 3RFZB 1D3ZA 1QZEA 3GS2A 3DBHB 4IG7B 2G45B 3P4PB 4MEMA 3TEWA 4LDTD 4MH0E 1QQRA 1SF0A 3JSVA 1RAXA 2L32A 4TSSA 3EHVA 5JH5C 1YN4A 3R2IA 3DBLB 3JSVB 4DXAB 3N1XC 2GBMA 2JXTA 1I4XA 3VDZA 3M63B 3VXWA 4KDIC 3IBEA 1HTOA 1XT9B 4IOIE 2IDYA 3DBHI 2I2YA 3UINB 3TJPA 1RWSA 4BAXA 3SD5A 5E6OA 1VD2A 3H9DA 2MBBB 2BYTA 5C1ZA 4A20A 2ZZPB 3MHSD 3PHXB 3AEEB 5AZGA 1SJHD 3DBLI 2WX0A 1TY2A 3VTWA 4F7ZA 3AN1A 4L2YA 3IVFA 4LLGM 4HWIB 3E9SA 3RUIB 1T6BX 4LNFA 3S2AA 4MT5A 1K50A 2OJWA 2NBUA 2FCMA 1LXDA 2HTME 1GPXA 4N59A 1AWDA 1YD8U 2N1VA 3R8BA 2E3TA 1C77A 1N61A 2D10A 5GMVA 3B9JA 4N6EB 4GLSC 4M8MA 5DCNA 4ZDVA 2Z59B 2L3ZA 1EF5A 5HG2A 2K8BA 5BMGA 3ZJTA 1V97A 1K51A 2D11A 1GB1A 1KRHA 2KFJA 1JWSD 5J2RA 2DYBA 3NZSA 1SIFA 1V2YA 2QEJC 4RGTA 4CQNA 3ZXRA 2AX5A 1WWTA 3J9CA 3B2GA 3E56A 3I63C 1G6JA 2DHZA 1WGRA 2IO0B 4KGTA 3PV1A 3ZIMA 5E6PA 5BMHA 3P42A 2LD9A 2V3PA 4RCOA 3SU8X 3MJ5A 4HRSA 2YLMA 4L23A 2DWQA 3IT4B 1N5WA 2JYEA 3SHQA 1FO4A 3DBRB 4MGKE 3NJTA 3Q14C 4P1BC 4TV3A 1TGZB 2RGFA 3ZRCA 2BKRB 3QARA 3RZFA 3U8ZA 1UD7A 3NVWA 3GOEA 3LB8C 2MLBA 3LDZE 3TIXA 1ZXIA 2FUG1 1TS2A 2GMIC 1YQ3B 2PTLA 2KANA 2BBCA 2ZNVC 2BF8B 2C7NB 3BWUD 1T5XD 4JPSA 1WX9A 3DPDA 2UYZB 4GOCA 2XBBC 1WXMA 3OWEB 1VR9A 4WQMA 4KZCA 3RNBC 1EF1A 3VH3B 1PQSA 3A9JA 3DBRI 3ZTDA 3NOBA 3UIOB 5IAAC 4D2KA 3RCZA 1JWMD 4W9FA 1IYFA 3AV8A 1GC7A 3DVNV 2WDQB 1TKGA 1L6UA 2VH2A 3PRZA 1V86A 3A9JB 4RMAA 3UF8A 2OHFA 2FNJB 2KWUB 1FFUA 4N58A 3P4QB 3AEAB 2N7JA 2BPSA 3BYTB 3B0AA 4MELA 2FE8A 3WANA 3IFWB 3AE9B 3I57A 3ZNHB 2X38A 3QA8A 3AE1B 3HM6X 4C00A 2L0FA 1VDVA 4S17A 3L17A 4TMAB 1MHHE 2X8XX 3V61A 2MRPA 2G4SA 3DDCB 1B9RA 3EFCA 4IWPA 1WX8A 3M62B 3IAS1 3IHPC 5I4DA 3AE6B 1TYGB 2D5GA 1MG8A 1PGAA 2KFKA 2K6DB 1WY8A 2L76A 4E3CA 1YIWA 1ACCA 4PT5A 2C7MB 1WI0A 1YJ1A 1HZ5A 1I4HA 4HPPA 4RGOS 2K25A 4I6PA 5FR3A 1E9MA 1M4VA 1JRUA 4JX1C 1I35A 2KFKB 2JRHA 2KDFB 2QHOA 1L5PA 4YSZB 3R3MA 2NTTA 1WM2A 1WYWB 5LXIB 2RDHA 1KLVA 4XGAB 2BTEA 3DBSA 3RYTA 3W5UB 1H4RA 4IWOA 2K8HA 2NBWB 4BOSC 4UDUC 2HDEA 5BYQA 3VR9B 4AS1A 4NJCA 3GE8C 3W1SA 2HE7A 4XC2A 1JQ4A 1WJNA 4FHKA 4KIKA 2AQ3B 4MJSA 3NVVA 2XEWA 3WAOA 3BVGA 4IM0A 5AZHA 2ON8A 5LLIA 2KACA 5D7GA 2CJOA 2RDBC 1UGJA 5G5HA 3H7SA 3X23A 5L95C 4G0NB 2M19A 3IG3A 1JW9D 1E8XA 1V81A 3W2DA 2JQRB 1KJTA 2MSED 3KYCD 4A8XC 2LXCA 1TZOA 1OQYA 3DCGA 4A9AA 1E0ZA 3EUB2 2B76B 1XEEA 5JHAA 5FKAC 3HIZA 4WJQA 4BOZB 3VFKA 5IN7A 3BINA 2J0KA 2K9XA 1SXTA 3BYYB 3ZUNA 1WRIA 4TQ1A 1C3TA 2LRUA 3ZRFA 5LXHA 3AE3B 4NZLB 2WDTB 1T0SC 1ZKHA 2KK8A 2I1KA 4E74A 2GI9A 1UZXB 3PLVA 3IXSA 3RMKC 3WALA 3ZW3A 3WAPA 3Q8BA 1OFFA 4ZRIA 1GB4A 2AEHA 1NI3A 1SJED 1KF6B 1WGKA 2BWFA 1UF0A 2WS3B 1EU3A 2HJ1A 3ZNGC 3L13A 2LGDA 2ZPNA 2CKHB 3Q3JA 5HI1A 4AOFA 2UWQA 3APCA 1FXTB 4FA6A 1I4GA 4TUUA 3PREA 2IGHA 1CJEA 4RM9A 4ASWC 3UI3A 3CSTA 1Q10A 1SGHA 3RI7C 1E90A 2VRRB 1IBXA 4W9KA 2JXXA 2V3NA 1QKZA 3Q3NC 4MH8A 4NJ7A 1XQQA 3BVMA 1AW7A 4W9LA 3IT6B 2W55A 4K7SA 1WH3A 1VJKA 1WGYA 3Q3OC 1ROEA 2L00B 1C9FA 4LCDE 1ZUD2 2KQSA 1IBXB 2A4ZA 4TKNA 4MM3B 1FRRA 1JCKB 3V62A 4ACFA 2PKOA 1GAQB 2JWZA 2IJ0A 4HXDA 1EUVB 1LO5D 2O2VA 4WWPA 4EEWA 1MVKA 1E7PB 1DOIA 3VAWA 4S0RA 4KSKC 4QAYA 2LGXA 2N9EB 3NS8A 3TL5A 2O2VB 2LVQA 3QWZB 1JWUD 2K1FA 1JROA 5IA7A 4H2AA 2C9WB 4ZHPA 4YTNB 2WP9B 2D3GA 3SEBA 2E6XA 3CF6E 4HJGE 3V05A 4NPNA 2IYDB 3OJ3A 1K53A 3DOWA 2M4NA 1MI0A 3OJ4B 2K0PA 3C0RB 1P7EA 3C19A 4FJVB 1K8RB 3QIJA 4WH4A 1T0RC 2ZEQA 4DHZE 3SFEB 1HEZE 3SR6A 1WIAA 4C4VB 2UU7A 3VUXA 1WXQA 2SAKA 4BBNC 3GB1A 5EDSA 4Q2JA 2PE6B 1WX7A 1WRDB 4I6LB 2Y5PA 1TKEA 2PE9A 4ZRKA 1WF9A 2KDBA 4ZOHC 2L7RA 2J52A 4B9KA 2BS4B 1QILA 3ONSA 2EKEC 3ZGZA 3K9OB 4FN2A 3HVZA 5JXVA 2JF5A 1GJZA 2L1AA 2LJIA 2WXFA 1V1PA 1SE4A 1E6EB 1YQ4B 3P4RB 2LJ5A 1QLBB 2KAJA 4CYEA 4KGRA 1V5TA 4OHJA 2PMVA 1Y56A 4ARIA 1LGRA 1NDDA 4LDTB 1V1PB 1J7AA 2CHXA 1I4RA 3N30A 4BKSD 2DNFA 4GB9A 2CHWA 1C4CA 2AL6A 3W5VB 2R2OA 3ZDTA 1XXGA 1I4QA 5BMIA 1HZ6A 2MBEA 4GDLA 1NENB 3JYUA 5L83A 3B2FA 3LJ3A 4RM8A 2HTHA 2INDC 2KX3A 2CS4A 3KQ4A 4JLCA 5GXGB 4XWWA 4WAAA 3GZNB 4GDLB 1D5MC 4YWGG 1FMAD 2V3SA 3HK0A 1TKYA 3M95A 3R66C 4US8A 1NVID 2J0MA 2PPHA 2LHDA 2YEPF 1IGCA 3RN9C 4DXFA 2IY1B 2WXKA 4A6QA 3FAHA 1AYFA 1S1QB 1ZDXA 2INPE 3ZKJC 1WM3A 3DVNU 2LGIA 4WIPA 1F2RC 3GZNI 2LUEA 3PVLA 2GBNA 2J42A 1T0YA 1ET9A 4WJOA 5HHDG 3B1LX 2N7EA 2FCSA 2MJ3A 3N20C 4EFOA 4CHKA 3KWVA 1QOGA 4ZYNA 3TUOA 2LMCA 2ZPYA 5D2MB 1XCQL 3PZ7A 2MQJA 4JL9A 3DWGC 2AYOB 2N9PC 1J7CA 4GSWA 3GE3C 4BKGA 2DYOA 1P0RA 3TBLD 2W3SA 2JYTA 3PPAA 2Z0DB 4HLEA 2LEKA 2BB6A 3KH0A 1YOVB 3T3NA 2Q5WD 5CHFA 1P9DU 4GDKA 1C79A 4KX6B 4K7UA 1J7BA 5AUKA 3HUIA 1P3QU 3R2TA 2BVCA 5G55A 1KTKA 4DDGD 3Q8AA 2IZVB 4GDKB 1IP9A 1WXSA 4W9GA 4EKUA 1QF6A 3DWMA 4DXGA 2KWVB 3AEFB 4WQOB 1YX6B 4IW0A 2CR5A 4ANWA 2JZZA 2AQ2B 4CO7A 1MPEA 1RLFA 2LZ6A 2W54A 4NJ6A 2HJ8A 3NUHB 2BWES 2FCQA 3R7RA 2JWUA 3TSSA 3H6NA 1SE2A 3RNGC 1D5ZC 1V1OA 5D3IB 2ICIA 4HROA 3ZYYX 1PFDA 2XK5A 2EELA 2JUOA 4E71A 2AQ1B 1PGXA 4A90A 1E7UA 4M00A 1EU4A 3AE2B 4PS3A 2KTRA 2PIAA 4MGYE 3NVYA 3HM3A 4KKIA 2W3RA 2XK5B 2KJHB 1E8WA 3AMZA 3NS1A 1T0QC 4HK2A 4NY0A 1FCLA 2KTRB 3ECIA 2QDFA 3AE7B 1P7FA 2IGDA 1XLQA 4WAFA 3A9KA 4MSQB 3BVZA 5D94A 4LK0M 1JWBD 3W1SC 4LJOB 5EE3A 4HPMB 3HHMA 4ZYSA 3I9V1 3QAQA 3AEDB 4FHJA 2EMTA 3CSFA 4EZJA 1QOFA 1WGDA 3CIRB 4KDLB 5KHOA 1WJ6A 1GC6A 4K81A 3A9KB 1FFVA 4GU2A 3OLMD 4KKJA 4KV2A 4RFBA 2YEPB 2V0GA 4K3CA 1FPYA 2ZJDA 3C8YA 3VRAB 2IO2B 1QOAA 2O6VD 4NQLB 3PZDA 2CJNA 2BW2A 3H7PA 2NPTA 2BS3B 3AEBB 1J0GA 1KM7A 3P1MA 1V6EA 2CU3A 4PYZA 4FBJB 5TSSA 2SEBD 2WXOA 2JZPA 4XX5A 3EC8A 3SDLC 3H7PB 2NPTB 1Z2MA 1EM7A 2RDGA 1V5OA 3PRPB 4EZLA 2EKIA 1U4AA 1L0YB 2MBQA 2BYVE 1IGDA 3TEYA 2KDMA 2H88B 1ZDVA 4C7YA 3N32A 4MGIE 2N9XA 3RD2A 4JIOU 2MCNB 2WQYB 2HD5B 3X0WA 3Q69A 1F9JA 1XCTL 4A3PA 4B6WA 1YNTE 2K22A 3QQ8B 1HXYD 3JW0X 1VZ7A 2ZNVB 1DOXA 1MJDA 2GBKA 1ZP0B 2KN4A 4HCNB 2G1EA 4LNIA 5EE9A 3FC4A 4EZKA 1VLBA 3QX1A 5CX3A 4BZAA 1MFWA 3U7ZA 1E8ZA 1D6EC 4PK1A 3KW5B 5E6NA 1CK1A 1K52A 2M8SA 1FXAA 2G9HD 1SIJA 3P2BA 2WLBA 2K3UA 1JALA 2PVOD 2V1YA 2KZRA 2V4IB 3CWIA 1FM0D 4LTUA 1QOBA 2NCNA 3MHZA 5BYRA 1WYGA 4WJNA 1UBIA 3DQVA 2RD0A 4HKQA 3EA6A 1PGBA 1JWAD 2J0JA 4XE0A 5LNK1 1XO3A 5C23A 2K6QA 3AM9A 1NEKB 3U7DA 1OGWA 4F8CB 3U30A 5T8IA 2KJRA 2MHJA 1RM6C 1LM8B 1V49A 4WWMA 2GBRA 1KOTA 3LYYA 2KJ6A 1YJJA 4K7WA 1E10A 3ZO5B 1YQBA 5KHQA 4C80A 3RPFC 1BT0A 1MG4A 2K8CA 3PT2B 1HA5A 3VVWB 2QIEB 4X57B 5HFYA 2WXMA 1L2NA 4ANUA 2PJHA 3B08A 1C76A 2WXPA 4OZBA 3PGEA 2NTSA 2DAFA 1QT9A 2BB5A 3TEZA 2BYEA 2KTFA 4KVGB 2R2QA 4MM3A 1TY0A 3AE5B 5DPRA 1UH6A 2JVCA 4B0MA 1KFYB 3PO0A 3W9CB 4BBNF 4YSXB 2M0AA 3V6CB 4G3XB 1YMHE 4I6NB 4MGZE 3ML9A 3SFDB 5DPTA 4YSYB 2IPKD 4YL8A 1X1MA 4OW0A 3AULA 4KGSA 2KVRA 1WR1A 3A4SC 2ONQA 3Q3MC 2VZKD 3L08A 1I7HA 2LVOA 1SE3A 2JY6A 2JU6X 3ZJVA 2ZCCA 4II3B 2REXA 4W9HA 1RFKA 1ZXHA 3ML8A 1SE9A 3P4SB 2KNBA 4GMVA 2Z8LA 2D2QA 4ZHOA 2C60A 2QCZA 3NZUA 4EE2A 1C78A 3Q3FA 1DOYA 2L8JA 2H89B 2DZMA 1CZPA 2GBJA 1MHXA 4C4VA 2KMMA 1XD3B 3MP9A 4W9IA 4IC7B 1XLOA 4C56C 2IBIB 4PS8A 1LQBA 2RPQA 4G50A 2XN9C 3R7QA 2Y5CA 2WXQA 2WX1A 3I3TB 4C7ZA 2C7HA 2KYWA 1EWCA 2OOBB 4YXDB 2WXRA 2DZJA 3QC8B 1NBFC 4BKSA 2XNAC 4DBGA 3A1QA 2MH7A 4W9EA 4WURA 1RFAA 2KC1A 2WYQA 2KD0A 1SSNA 3U52E 3VTUA 4DHJD 2LHEA 2KWDA 3L4PA 4YTPB 3W1YA 1R7SA 3PSEB 3A1QB 1EO6A 2ACZB 3QJZA 3ZJUA 1TBEA 5AEKB 1F0ZA 4HJKA 2KKCA 3AE8B 3FILA 3VUWA 3O65B 2N4FA 3NY5A 4LNNA 4IKGA 2PW9A 2IO3B 2M1MA 3AEGB 3NG0A 4RGNA 2FBWB 1SB3C 1WXVA 1J8CA 4HPLB 2LGYA 1Q5WB 3FILB 1OEYA 2WWZA 2N1WA 2J7QB 4K1RB 1BUIC 2NBVB 3VTVA 1N63A 1L0VB 4EOYA 1L4DB 1VZ8A 2D3BA 3WAMA 3UQAA 1P98A 2C5LC 4ICUA 4NQKE 1H8CA 5AUIA 2KHWB 3VRBB 2LWPA 1HQRD 1F77A 1PUTA 3RNCC 3HRDD 2MBHA 5D3DA 4K3BA 2MA9B 1N60A 5AZFA 4PS7A 1JRPA 3EECA 4O1NA 4HDQA 1WGGA 5H92C 2NMQA 2MBOA 1WZ3A 2BYFA 2WHIA 5J17A 2NVUI 2GOWA 1GNUA 2KVZA 2OEDA 4ANVA 3AU5A 2WXHA 3URYA 4AUQC 1B1ZA 3WCQA 1WFYA 2MW5A 3U4EG 1XF5L 1N62A 4HCPB 2DZIA 3DHHC 4HVBA 3RZWC 4II2B 2WXLA 3PTFC 5EE1A 2R61A 2GRIA 2M56B 1XLPA 1P1AA 2VH1A 4J6IA 1VRAB 4YT0B 3PRMB 1STEA 3RNEC 3VR8B 2WXGA 4TQ0A 3K9PB 1L4ZB 1KLUD 2WDVB 2AL3A 3ZXVA 2FUHB 2W82A 4FLHA 2ZCBA 2J4XA 1TTNA 3I5JC 2D07B 2V4LA 2NR2A 1UWMA 1HTQA 3UQBA 4RF0A 3WIMA 2RMMA 1PYWD 5IP4D 2KLGA 4G11A 4WWNA 3N3KB 2KN5A 2KLCA 4M02A 2G3QB 3D32A 4ZRQA 3LXFA 3UGBB 2KT7A 1R4NB 3OAWA 3KUZA 2MX2A 4A3OA 2LXAA 4DHZB 4ZRJA 2WDRB 1AARA 2L05A 1ET6A 2MP2A 1PDXA 2QC8A 1T3QA 3NVZA 1GG3A 2LFIA 1J19A 4GN1A 3KVFB 1N5XA 3WA0A 3NRZA 2MP2B 2L0TA 2DENB 4B95A 3ZTCA 3HVDA 4ZRPA 2CHZA 2ZW0A 2JPHA 1TS4A 1R4NI 2RPVA 3MFGA 1Q0WB 4HDOA 1TS5A 3KUCB 3TMPB 3ZVVA 2MJEA 3ETRA 4ANXA 2Y5BB 3N1YC 1OEYJ 4BFRA 2WXIA 2L52A 5DPWA 2KQ4X 3BY4B 1E7VA 4USAA 4JE3B 4XYCA 3V60A 2N9LA 1WR6E 1ZOYB 1IPGA 4OVVA 4IM3A 2KX0A 3ZQ4A 3H8HA 1OQRA 3L54A 1V9JA 1R4MB 3PZ8A 3IAM1 2OJRA 4A55A 1WJ4A 2QMTA 2JRIB 2BKFA 2N9KA 1FXIA 1WXAA 3Q6BA 4LNKA 1D4BA 2IO1B 3O13A 3TCAA 4M0WA 5DPSA 2JZ3B 2LI5A 1N6ZA 5FR6A 3ZNID 2KQ7A 4IDIA 2QSDA 1UBQA 2O6VA 2RR9A 1E5WA 1UWXA 2BQQA 1SEBD 2JSVX 2DBYA 3DHIC 4M0WB 1TIFA 1TJEA 2DAJA 2KMCA 3PHWB 2EMSA 1TZ1A 3M3JA 3A4RA 2BT6A 1I4PA 1GOZA 1R4MI 2DLBA 4MSMB 1Z5SB 2O6VB 4RH6A 2INCC 2MEKA 4GXBA 1CQVA 3TEXA 1GUAB 2YVCA 1F2RI 4R3DA 2FAZA 1BXTA 3QHTA 1JMLA 3H1UA 1WJUA 3APFA 1ZW7A 5CHVC 4F1SA 5BO4B 4N9F4 2A5UA 1A70A 3EGRA 2FIDA 1KH0A 2MJDA 1C1YB 4FJYA 1L0XB 3AU4A 4W9JA 1F52A 2LVPA 2IY0B 4NNJB 1YJIA 2INNE 2KO3A 2LRWA 2WGSA 3APDA 3PS6A 3JVZX 1FEHA 5BYSA 2GB1A 1WZ0A 3EFUA 1ZPSA 3KUDB 3MC0B 1I42A 1WE6A 4JWUC 1UGMA 1FNVA 3DVGX 3ABVB 2D3AA 4AJYB 3Q8CA 1C4AA 4MDKE 1ENFA 3RNFC 2ZW1A 1S3SG 2JX5A 1WE7A 1FRDA 1LFDA 4P16A 2BGFA 4IM2A 4AWJA 4PYUA 4XZ4A 4KZ0A 2LUMA 3UIPB 4HEA1 4EUTA 3Q8EA 2ASQA 4RNAA 2KWCA 4M01A 1A5RA 3DVGY 1V8CA 5H8YE 2Y3AA 1VCBA 3ZNZB 5G5GA 4AP4C 4FXCA 3AH7A 3AB5A 4P6VF 3RULA 4GGQA 3A33B 2PVGC 1NYRA 1UUPA 3QK0A 4AQ7A 2TSSA 5CHWA 1NI2A 4WWOA 3Q2AC 4OZCA 2ZVNA 3KLSX 4DQOC 2M17A 4KIKB 4MJSB 5CTRC 4NAMA 4YTMB 1FNUA 5TR5A 2N7DA 4W9DA 1YN3A 1YX5B 1D5XC 3V3XA 2LASA 4DK5A 4W9CA 4JGHB 2FIFA 3VH4B 2JT4B 1TS3A 2WU5B 3BIID 4P7IA 3T8MA 4RF1A 2WU2B 3V6EB 1TT5B 3VQIA 1WSPA 2NS5A 4B0EA 3L0WB 2MWSB 3P63A 2G4DB 4MACA 2Z0EB 2K5PA 4FJZA 3KYDD 5IOIA 2PEAA 1L7YA 3ZDMC 4JWSC 4OVUA 3NHEB 2BS2B 3AXCA 2AWTA 2J53A 4ITKA 1BMLC 5G2NA 2VZKB 1NYQA 3CMMB 1UELA 2K39A 4FULA 2DZKA 2WXJA 3L16A 2I1JA 2M0XA 2CU1A 4OVZA 1ZGUB 4HKZE 2B3AA 3BK1A 4ICVA 2L83A 4DDID 5J18A 4FADA 4BKTA 2IGGA 4IUMB 3ALBA 1DGJA
chains in the Genus database with same CATH topology
5FR3A 1E9MA 3AEFB 1M4VA 1PUTA 4JX1C 2I38A 2QJLA 5C2TB 3HRDD 1L5PA 4YSZB 2NTTA 5D3DA 3T3OA 1N60A 2RDHA 2BTEA 1JRPA 5EE0A 3BK2A 3W5UB 2AQ2B 3Q8FA 4O1NA 1MPEA 2W54A 5H92C 2NMQA 3KWLA 1YN5A 1KLGD 4REZA 3NUHB 1OQQA 4UDUC 2HDEA 2OEDA 5BYQA 3VR9B 1L6VA 2WXHA 4AS1A 4NJCA 2JWUA 3URYA 3U2SC 3TSSA 1B1ZA 3W1SA 1JQ4A 1SE2A 3WCQA 1D5ZC 1V1OA 5E6JA 3U4EG 4XWTA 2QILA 2AQ3B 5D3IB 1XF5L 1N62A 2ICIA 3NVVA 4HROA 1PFDA 3ZYYX 1ESFA 3BVGA 2EELA 2ON8A 2AQ1B 2KACA 5D7GA 1PGXA 2WXLA 5EE1A 2CJOA 4A90A 1UGJA 1AN8A 2R61A 1EU4A 5G5HA 3AE2B 2PIAA 2GRIA 4RGMA 2M56B 1XLPA 2M19A 3NVYA 1VRAB 4KKIA 4YT0B 2W3RA 1JW9D 1STEA 3VR8B 3W2DA 3AMZA 3NS1A 2WXNA 2JQRB 2WXGA 3AECB 4TQ0A 5MPOA 1L4ZB 1KLUD 2WDVB 4L1BA 1FCLA 4XDDA 2N0SB 4A8XC 2W82A 1VZ6A 3AE7B 2J4XA 1TZOA 1P7FA 4A9AA 1E0ZA 4OZAA 2IGDA 2B76B 1UWMA 1XLQA 1XEEA 3AE4B 3EUB2 4RF0A 3BVZA 4WAFA 2RMMA 5FKAC 4LK0M 1PYWD 1JWBD 2K9XA 5EE3A 1FIQA 1SXTA 4ZYSA 3BYYB 1XLNA 1WRIA 4TQ1A 2WNMA 3I9V1 4ZRQA 3AEDB 1DYQA 3LXFA 3N9YC 4XDCA 3AE3B 1QOFA 1UNSA 3CIRB 3GP7A 4NZLB 2GI9A 1FFVA 2WDRB 3IXSA 4NAWB 1ET6A 1FCCC 2PLPA 4KKJA 3Q8BA 1OFFA 1PDXA 1ZE3D 1GB4A 1RYJA 2YEPB 4RFBA 1NI3A 2V0GA 1T3QA 3NVZA 1SJED 4US9A 1KF6B 3C8YA 1WGKA 3VRAB 2LFIA 1QOAA 2WS3B 1EU3A 1N5XA 2CJNA 1C4PA 3NRZA 5HI1A 2BW2A 1IUEA 2BS3B 2DYMA 3AEBB 3P1MA 1I4GA 1FD6A 2IGHA 1CJEA 4ARCA 2CU3A 3UI3A 1Q10A 3HVDA 5TSSA 2SEBD 2WXOA 2ZW0A 4ZRPA 1TS4A 2JZPA 3BZDB 2RPVA 3MFGA 1IBXA 1TS5A 2V3NA 4MH8A 1EM7A 1QKZA 4J3OD 2RDGA 3BVMA 5FK9C 1AW7A 2EKIA 3IT6B 1L0YB 2MJEA 3ETRA 1SBBB 2W55A 5C3JB 1IGDA 1VJKA 1EWYC 2WXIA 2L52A 3TEYA 1ROEA 2KDMA 2KQ4X 1FNWA 2H88B 1ZDVA 1C9FA 1ZUD2 3RFZB 3NZ3A 4C7YA 1IBXB 4USAA 4MM3B 4JE3B 1FRRA 1JCKB 2N9LA 1ZOYB 3GS2A 2PKOA 1GAQB 2WQYB 2IJ0A 1LO5D 3Q69A 3P4PB 1XCTL 1MVKA 3TEWA 1E7PB 1DOIA 1YNTE 2K22A 3H8HA 3ZQ4A 1HXYD 1OQRA 1VZ7A 1QQRA 1SF0A 1DOXA 2L32A 4TSSA 3PZ8A 1ZP0B 3IAM1 2KN4A 1YN4A 4A55A 2QMTA 2G1EA 1JWUD 3R2IA 5EE9A 3FC4A 1JROA 2N9KA 1VLBA 1FXIA 4H2AA 3U7ZA 1D6EC 3DWMA 4ZHPA 4YTNB 1D4BA 2WP9B 1CK1A 1K52A 3O13A 2JXTA 1I4XA 4M0WA 1FXAA 2G9HD 1SIJA 4IDIA 3SEBA 2WLBA 2K3UA 2QSDA 1JALA 2PVOD 2V4IB 2E6XA 4IOIE 2IDYA 2I2YA 4HJGE 3CWIA 1FM0D 3V05A 1K53A 1UWXA 4LTUA 1MI0A 1RWSA 1QOBA 1SEBD 2JSVX 2K0PA 1WYGA 2DBYA 3MHZA 5BYRA 1P7EA 1TJEA 2BYTA 4HKQA 4WH4A 3EA6A 2BT6A 1I4PA 1GOZA 1PGBA 2DLBA 3SFEB 1JWAD 1HEZE 4XE0A 5LNK1 4RH6A 1XO3A 3AEEB 3SR6A 1WXQA 3AM9A 1NEKB 2SAKA 1SJHD 2MEKA 3GB1A 5T8IA 1RM6C 1CQVA 3TEXA 4WWMA 4Q2JA 1TY2A 3LYYA 3AN1A 4L2YA 1F2RI 4LLGM 4R3DA 3E9SA 1YJJA 1BXTA 2Y5PA 1TKEA 1JMLA 1E10A 1T6BX 4C80A 4ZOHC 1A70A 3RPFC 2J52A 3EGRA 2BS4B 4MT5A 1K50A 1HA5A 1KH0A 1QILA 2MJDA 2QIEB 5HFYA 2WXMA 3ZGZA 2HTME 1GPXA 1L0XB 3HVZA 4N59A 1AWDA 5JXVA 2L1AA 1C76A 3R8BA 2LJIA 2WXPA 4OZBA 2E3TA 2WXFA 1C77A 1V1PA 1SE4A 1E6EB 2NTSA 1N61A 1YJIA 1YQ4B 2INNE 1QT9A 3P4RB 3B9JA 4N6EB 1QLBB 4GLSC 2BB5A 1FEHA 2KAJA 5BYSA 4KGRA 5HG2A 2GB1A 3TEZA 4OHJA 5BMGA 3ZJTA 2PMVA 1Y56A 4ARIA 1V97A 1K51A 1V1PB 1ZPSA 1J7AA 3MC0B 1GB1A 1I4RA 1KRHA 4JWUC 1JWSD 1TY0A 3AE5B 1C4CA 1FNVA 2QEJC 3ABVB 4B0MA 1KFYB 3PO0A 4RGTA 3W9CB 4CQNA 4YSXB 2M0AA 3W5VB 2AX5A 1WWTA 1YMHE 1XXGA 3J9CA 3Q8CA 1I4QA 3SFDB 5BMIA 1C4AA 3B2GA 1ENFA 1HZ6A 4YSYB 2IPKD 3E56A 4OW0A 1NENB 4KGSA 2ZW1A 2JX5A 1FRDA 3B2FA 4P16A 4KGTA 2ONQA 5BMHA 2VZKD 3P42A 1I7HA 2V3PA 1SE3A 4RCOA 3MJ5A 2LUMA 4HRSA 3KQ4A 2JU6X 4L23A 2DWQA 5GXGB 4HEA1 3IT4B 4XWWA 1N5WA 2JYEA 3Q8EA 1FO4A 3ZJVA 4GDLB 1D5MC 4YWGG 4RNAA 1FMAD 1RFKA 1ZXHA 1TKYA 4US8A 1NVID 1V8CA 2LHDA 3P4SB 5H8YE 2Y3AA 2YEPF 2Z8LA 3NVWA 1IGCA 3LB8C 5G5GA 4ZHOA 4DXFA 2FUG1 1ZXIA 1TS2A 2WXKA 4FXCA 1C78A 4EE2A 3AH7A 3AB5A 4P6VF 1YQ3B 2PTLA 1DOYA 2BBCA 4A6QA 2H89B 1CZPA 3FAHA 3BWUD 2PVGC 1NYRA 1MHXA 1UUPA 2KMMA 1AYFA 1T5XD 3MP9A 4JPSA 4AQ7A 2TSSA 1ZDXA 2INPE 3OWEB 1XLOA 4C56C 4OZCA 1VR9A 4WQMA 3KLSX 4DQOC 2LGIA 2XN9C 2Y5CA 2WXQA 4WIPA 4C7ZA 1F2RC 4NAMA 4D2KA 1EWCA 4YTMB 1FNUA 4YXDB 2WXRA 2J42A 1YN3A 1JWMD 1D5XC 3AV8A 3V3XA 2XNAC 2WDQB 1TKGA 1ET9A 2MH7A 1L6UA 1TS3A 4WURA 2WU5B 3BIID 4RF1A 2WU2B 1SSNA 5HHDG 3U52E 3VQIA 2MJ3A 1WSPA 4B0EA 2OHFA 2LHEA 2KWDA 3L4PA 4YTPB 1FFUA 1R7SA 4N58A 3P4QB 3P63A 3KWVA 1QOGA 3TUOA 2LMCA 2ACZB 4MACA 3AEAB 2K5PA 1XCQL 2N7JA 3ZJUA 3BYTB 3PZ7A 4JWSC 1F0ZA 2FE8A 2BS2B 3DWGC 3AE8B 3FILA 3AE9B 2J53A 3I57A 2X38A 1J7CA 3AE1B 4IKGA 2PW9A 3AEGB 4ITKA 1VDVA 1BMLC 2DYOA 4RGNA 2FBWB 2W3SA 1SB3C 2JYTA 4TMAB 1MHHE 2LEKA 2VZKB 2BB6A 1NYQA 3T3NA 3FILB 2WXJA 2Q5WD 4OVZA 1B9RA 4HKZE 1C79A 4KX6B 3IAS1 1BUIC 3BK1A 2L83A 1J7BA 3AE6B 1TYGB 2D5GA 3HUIA 5AUKA 5I4DA 1N63A 1L0VB 1PGAA 3R2TA 1KTKA 1L4DB 1VZ8A 1ACCA 3Q8AA 4GDKB 4PT5A 5AUIA 2IGGA 1HZ5A 1I4HA 3VRBB 1QF6A 1HQRD 1DGJA 4DXGA 4RGOS 1F77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEK B;  1E9M A;  3AEF B;  2CJN A;  4FXC A;  3NRZ A;  1PUT A;  3AB5 A;  3AH7 A;  4P6V F;  4JX1 C;  1YQ3 B;  2QJL A;  5C2T B;  1IUE A;  2BS3 B;  1DOY A;  1RM6 C;  3AEB B;  1L5P A;  2H89 B;  3HRD D;  4YSZ B;  3P1M A;  4WWM A;  1CZP A;  3FAH A;  2PVG C;  1CJE A;  3AN1 A;  1NYR A;  1N60 A;  2CU3 A;  4ITK A;  2KMM A;  1YJJ A;  1AYF A;  1JRP A;  1TKE A;  5EE0 A;  1E10 A;  3W5U B;  1XLO A;  5H92 C;  2W54 A;  4WQM A;  4C80 A;  3KWL A;  4ZOH C;  1A70 A;  3RPF C;  2Y5C A;  1OQQ A;  2BS4 B;  4C7Z A;  2MJD A;  2QIE B;  2EKI A;  3VR9 B;  1L6V A;  2MJE A;  3ETR A;  4YTM B;  2W55 A;  4YXD B;  5C3J B;  2HTM E;  1GPX A;  1VJK A;  4N59 A;  3HVZ A;  1JQ4 A;  1AWD A;  1EWY C;  2L52 A;  3WCQ A;  3AV8 A;  1ROE A;  2E3T A;  2WDQ B;  2H88 B;  1TKG A;  1N62 A;  1ZUD 2;  3NVV A;  2MH7 A;  1PFD A;  4HRO A;  1L6U A;  3ZYY X;  1E6E B;  4USA A;  4C7Y A;  1N61 A;  1YJI A;  1YQ4 B;  2WU5 B;  1FRR A;  1QT9 A;  3BII D;  3P4R B;  3B9J A;  4N6E B;  2WU2 B;  1ZOY B;  1QLB B;  5EE1 A;  2CJO A;  2PKO A;  1GAQ B;  2KAJ A;  2WQY B;  2MJ3 A;  5G5H A;  2OHF A;  3AE2 B;  3L4P A;  2PIA A;  1V97 A;  3P4P B;  1FFU A;  4YTP B;  1R7S A;  2M56 B;  1XLP A;  3P4Q B;  4N58 A;  3P63 A;  1QOG A;  2M19 A;  3NVY A;  2ACZ B;  1J7A A;  3AEA B;  2K5P A;  1E7P B;  2W3R A;  1KRH A;  4YT0 B;  1JW9 D;  1DOI A;  4JWU C;  2K22 A;  3VR8 B;  1OQR A;  3AE5 B;  3AMZ A;  3NS1 A;  1SF0 A;  4JWS C;  2JQR B;  3AEC B;  1DOX A;  1F0Z A;  5MPO A;  3ABV B;  1KFY B;  1ZP0 B;  2BS2 B;  2WDV B;  3DWG C;  3PO0 A;  3W9C B;  4YSX B;  2N0S B;  3W5V B;  3AE8 B;  3AE9 B;  2AX5 A;  1WWT A;  2G1E A;  1J7C A;  3AE1 B;  3AE7 B;  5EE9 A;  4A9A A;  3SFD B;  3AEG B;  3FC4 A;  3EUB 2;  1UWM A;  1XLQ A;  1JRO A;  2B76 B;  1VLB A;  1VDV A;  1FXI A;  3AE4 B;  3B2G A;  4YSY B;  2FBW B;  2W3S A;  1SB3 C;  1NEN B;  1JWB D;  3DWM A;  4ZHP A;  2JX5 A;  2LEK A;  2K9X A;  4YTN B;  1FIQ A;  1FRD A;  3B2F A;  1NYQ A;  2WP9 B;  5EE3 A;  1XLN A;  1WRI A;  3AED B;  1FXA A;  3LXF A;  1E0Z A;  2Q5W D;  3AE3 B;  1I7H A;  1QOF A;  1SIJ A;  4IDI A;  3CIR B;  2WLB A;  4HRS A;  1B9R A;  1JAL A;  2PVO D;  2DWQ A;  5GXG B;  1FFV A;  3CWI A;  1N5W A;  1FM0 D;  1FO4 A;  4KX6 B;  2L83 A;  2WDR B;  1RWS A;  1J7B A;  3AE6 B;  1QOB A;  1TYG B;  3HUI A;  4LTU A;  5AUK A;  1N63 A;  1WYG A;  2DBY A;  1FMA D;  1L0V B;  1OFF A;  1PDX A;  1RFK A;  1TJE A;  1TKY A;  4US8 A;  1NVI D;  1RYJ A;  1NI3 A;  1T3Q A;  1DGJ A;  3NVZ A;  2BT6 A;  4US9 A;  1KF6 B;  1V8C A;  3P4S B;  5AUI A;  1JWA D;  1WGK A;  5H8Y E;  3SFE B;  3NVW A;  3VRA B;  1QOA A;  1XO3 A;  2WS3 B;  3LB8 C;  3VRB B;  1QF6 A;  3AEE B;  3SR6 A;  5G5G A;  1N5X A;  4ZHO A;  1WXQ A;  3AM9 A;  1ZXI A; 
#chains in the Genus database with same CATH topology
 4GIV A;  3ENE A;  2KDI A;  2I38 A;  2QJL A;  2W9N A;  5C2T B;  2LGS A;  3T3O A;  2FCN A;  5JHB A;  5EE0 A;  3T9L A;  3MC9 A;  3BK2 A;  3Q8F A;  3MTN B;  3KWL A;  1YN5 A;  2GLS A;  1KLG D;  4REZ A;  1OQQ A;  4M8N A;  2KMA A;  1L6V A;  1Q1O A;  1Y8R C;  4IWQ A;  3U2S C;  3L10 B;  5E6J A;  4XWT A;  2QIL A;  2ZVO A;  1OTR B;  1ESF A;  4DHJ B;  4JQW C;  4DWF A;  4URK A;  1AN8 A;  2V9H A;  4RGM A;  3PLU A;  1V80 A;  3RT3 B;  1CMX B;  3RNA C;  3MC8 A;  3DHG C;  1ISN A;  2WXN A;  3QCA A;  3AEC B;  5MPO A;  4L1B A;  4XDD A;  2N0S B;  4LNO A;  1VZ6 A;  4OZA A;  3AE4 B;  3AI5 A;  1WGH A;  4NAW A;  2KDE B;  1FIQ A;  1XLN A;  3N1Z C;  1E8Y A;  5IO9 A;  2WNM A;  4P1C C;  1DYQ A;  4XDC A;  3N9Y C;  1UNS A;  3GP7 A;  5IKC M;  3OG5 A;  3FKY A;  4WJP A;  3ZLZ A;  4NAW B;  3VUY A;  1FCC C;  2PLP A;  1ZE3 D;  4BVU C;  1RYJ A;  4US9 A;  4KSL C;  3VHT C;  1RRB A;  1C4P A;  2DX5 B;  1IUE A;  2DYM A;  4LJP B;  1FD6 A;  4ARC A;  1WMH A;  2RSU A;  1F1H A;  2D3C A;  3BZD B;  2KOX A;  5HKH A;  4J3O D;  5FK9 C;  4AJW A;  1SBB B;  1WMH B;  1HE8 A;  5C3J B;  5JZE B;  5D6J B;  1EWY C;  1M94 A;  2KXJ A;  2KC2 A;  1FNW A;  3MJW A;  3NZ3 A;  3RFZ B;  1D3Z A;  1QZE A;  3GS2 A;  3DBH B;  4IG7 B;  2G45 B;  3P4P B;  4MEM A;  3TEW A;  4LDT D;  4MH0 E;  1QQR A;  1SF0 A;  3JSV A;  1RAX A;  2L32 A;  4TSS A;  3EHV A;  5JH5 C;  1YN4 A;  3R2I A;  3DBL B;  3JSV B;  4DXA B;  3N1X C;  2GBM A;  2JXT A;  1I4X A;  3VDZ A;  3M63 B;  3VXW A;  4KDI C;  3IBE A;  1HTO A;  1XT9 B;  4IOI E;  2IDY A;  3DBH I;  2I2Y A;  3UIN B;  3TJP A;  1RWS A;  4BAX A;  3SD5 A;  5E6O A;  1VD2 A;  3H9D A;  2MBB B;  2BYT A;  5C1Z A;  4A20 A;  2ZZP B;  3MHS D;  3PHX B;  3AEE B;  5AZG A;  1SJH D;  3DBL I;  2WX0 A;  1TY2 A;  3VTW A;  4F7Z A;  3AN1 A;  4L2Y A;  3IVF A;  4LLG M;  4HWI B;  3E9S A;  3RUI B;  1T6B X;  4LNF A;  3S2A A;  4MT5 A;  1K50 A;  2OJW A;  2NBU A;  2FCM A;  1LXD A;  2HTM E;  1GPX A;  4N59 A;  1AWD A;  1YD8 U;  2N1V A;  3R8B A;  2E3T A;  1C77 A;  1N61 A;  2D10 A;  5GMV A;  3B9J A;  4N6E B;  4GLS C;  4M8M A;  5DCN A;  4ZDV A;  2Z59 B;  2L3Z A;  1EF5 A;  5HG2 A;  2K8B A;  5BMG A;  3ZJT A;  1V97 A;  1K51 A;  2D11 A;  1GB1 A;  1KRH A;  2KFJ A;  1JWS D;  5J2R A;  2DYB A;  3NZS A;  1SIF A;  1V2Y A;  2QEJ C;  4RGT A;  4CQN A;  3ZXR A;  2AX5 A;  1WWT A;  3J9C A;  3B2G A;  3E56 A;  3I63 C;  1G6J A;  2DHZ A;  1WGR A;  2IO0 B;  4KGT A;  3PV1 A;  3ZIM A;  5E6P A;  5BMH A;  3P42 A;  2LD9 A;  2V3P A;  4RCO A;  3SU8 X;  3MJ5 A;  4HRS A;  2YLM A;  4L23 A;  2DWQ A;  3IT4 B;  1N5W A;  2JYE A;  3SHQ A;  1FO4 A;  3DBR B;  4MGK E;  3NJT A;  3Q14 C;  4P1B C;  4TV3 A;  1TGZ B;  2RGF A;  3ZRC A;  2BKR B;  3QAR A;  3RZF A;  3U8Z A;  1UD7 A;  3NVW A;  3GOE A;  3LB8 C;  2MLB A;  3LDZ E;  3TIX A;  1ZXI A;  2FUG 1;  1TS2 A;  2GMI C;  1YQ3 B;  2PTL A;  2KAN A;  2BBC A;  2ZNV C;  2BF8 B;  2C7N B;  3BWU D;  1T5X D;  4JPS A;  1WX9 A;  3DPD A;  2UYZ B;  4GOC A;  2XBB C;  1WXM A;  3OWE B;  1VR9 A;  4WQM A;  4KZC A;  3RNB C;  1EF1 A;  3VH3 B;  1PQS A;  3A9J A;  3DBR I;  3ZTD A;  3NOB A;  3UIO B;  5IAA C;  4D2K A;  3RCZ A;  1JWM D;  4W9F A;  1IYF A;  3AV8 A;  1GC7 A;  3DVN V;  2WDQ B;  1TKG A;  1L6U A;  2VH2 A;  3PRZ A;  1V86 A;  3A9J B;  4RMA A;  3UF8 A;  2OHF A;  2FNJ B;  2KWU B;  1FFU A;  4N58 A;  3P4Q B;  3AEA B;  2N7J A;  2BPS A;  3BYT B;  3B0A A;  4MEL A;  2FE8 A;  3WAN A;  3IFW B;  3AE9 B;  3I57 A;  3ZNH B;  2X38 A;  3QA8 A;  3AE1 B;  3HM6 X;  4C00 A;  2L0F A;  1VDV A;  4S17 A;  3L17 A;  4TMA B;  1MHH E;  2X8X X;  3V61 A;  2MRP A;  2G4S A;  3DDC B;  1B9R A;  3EFC A;  4IWP A;  1WX8 A;  3M62 B;  3IAS 1;  3IHP C;  5I4D A;  3AE6 B;  1TYG B;  2D5G A;  1MG8 A;  1PGA A;  2KFK A;  2K6D B;  1WY8 A;  2L76 A;  4E3C A;  1YIW A;  1ACC A;  4PT5 A;  2C7M B;  1WI0 A;  1YJ1 A;  1HZ5 A;  1I4H A;  4HPP A;  4RGO S;  2K25 A;  4I6P A;  5FR3 A;  1E9M A;  1M4V A;  1JRU A;  4JX1 C;  1I35 A;  2KFK B;  2JRH A;  2KDF B;  2QHO A;  1L5P A;  4YSZ B;  3R3M A;  2NTT A;  1WM2 A;  1WYW B;  5LXI B;  2RDH A;  1KLV A;  4XGA B;  2BTE A;  3DBS A;  3RYT A;  3W5U B;  1H4R A;  4IWO A;  2K8H A;  2NBW B;  4BOS C;  4UDU C;  2HDE A;  5BYQ A;  3VR9 B;  4AS1 A;  4NJC A;  3GE8 C;  3W1S A;  2HE7 A;  4XC2 A;  1JQ4 A;  1WJN A;  4FHK A;  4KIK A;  2AQ3 B;  4MJS A;  3NVV A;  2XEW A;  3WAO A;  3BVG A;  4IM0 A;  5AZH A;  2ON8 A;  5LLI A;  2KAC A;  5D7G A;  2CJO A;  2RDB C;  1UGJ A;  5G5H A;  3H7S A;  3X23 A;  5L95 C;  4G0N B;  2M19 A;  3IG3 A;  1JW9 D;  1E8X A;  1V81 A;  3W2D A;  2JQR B;  1KJT A;  2MSE D;  3KYC D;  4A8X C;  2LXC A;  1TZO A;  1OQY A;  3DCG A;  4A9A A;  1E0Z A;  3EUB 2;  2B76 B;  1XEE A;  5JHA A;  5FKA C;  3HIZ A;  4WJQ A;  4BOZ B;  3VFK A;  5IN7 A;  3BIN A;  2J0K A;  2K9X A;  1SXT A;  3BYY B;  3ZUN A;  1WRI A;  4TQ1 A;  1C3T A;  2LRU A;  3ZRF A;  5LXH A;  3AE3 B;  4NZL B;  2WDT B;  1T0S C;  1ZKH A;  2KK8 A;  2I1K A;  4E74 A;  2GI9 A;  1UZX B;  3PLV A;  3IXS A;  3RMK C;  3WAL A;  3ZW3 A;  3WAP A;  3Q8B A;  1OFF A;  4ZRI A;  1GB4 A;  2AEH A;  1NI3 A;  1SJE D;  1KF6 B;  1WGK A;  2BWF A;  1UF0 A;  2WS3 B;  1EU3 A;  2HJ1 A;  3ZNG C;  3L13 A;  2LGD A;  2ZPN A;  2CKH B;  3Q3J A;  5HI1 A;  4AOF A;  2UWQ A;  3APC A;  1FXT B;  4FA6 A;  1I4G A;  4TUU A;  3PRE A;  2IGH A;  1CJE A;  4RM9 A;  4ASW C;  3UI3 A;  3CST A;  1Q10 A;  1SGH A;  3RI7 C;  1E90 A;  2VRR B;  1IBX A;  4W9K A;  2JXX A;  2V3N A;  1QKZ A;  3Q3N C;  4MH8 A;  4NJ7 A;  1XQQ A;  3BVM A;  1AW7 A;  4W9L A;  3IT6 B;  2W55 A;  4K7S A;  1WH3 A;  1VJK A;  1WGY A;  3Q3O C;  1ROE A;  2L00 B;  1C9F A;  4LCD E;  1ZUD 2;  2KQS A;  1IBX B;  2A4Z A;  4TKN A;  4MM3 B;  1FRR A;  1JCK B;  3V62 A;  4ACF A;  2PKO A;  1GAQ B;  2JWZ A;  2IJ0 A;  4HXD A;  1EUV B;  1LO5 D;  2O2V A;  4WWP A;  4EEW A;  1MVK A;  1E7P B;  1DOI A;  3VAW A;  4S0R A;  4KSK C;  4QAY A;  2LGX A;  2N9E B;  3NS8 A;  3TL5 A;  2O2V B;  2LVQ A;  3QWZ B;  1JWU D;  2K1F A;  1JRO A;  5IA7 A;  4H2A A;  2C9W B;  4ZHP A;  4YTN B;  2WP9 B;  2D3G A;  3SEB A;  2E6X A;  3CF6 E;  4HJG E;  3V05 A;  4NPN A;  2IYD B;  3OJ3 A;  1K53 A;  3DOW A;  2M4N A;  1MI0 A;  3OJ4 B;  2K0P A;  3C0R B;  1P7E A;  3C19 A;  4FJV B;  1K8R B;  3QIJ A;  4WH4 A;  1T0R C;  2ZEQ A;  4DHZ E;  3SFE B;  1HEZ E;  3SR6 A;  1WIA A;  4C4V B;  2UU7 A;  3VUX A;  1WXQ A;  2SAK A;  4BBN C;  3GB1 A;  5EDS A;  4Q2J A;  2PE6 B;  1WX7 A;  1WRD B;  4I6L B;  2Y5P A;  1TKE A;  2PE9 A;  4ZRK A;  1WF9 A;  2KDB A;  4ZOH C;  2L7R A;  2J52 A;  4B9K A;  2BS4 B;  1QIL A;  3ONS A;  2EKE C;  3ZGZ A;  3K9O B;  4FN2 A;  3HVZ A;  5JXV A;  2JF5 A;  1GJZ A;  2L1A A;  2LJI A;  2WXF A;  1V1P A;  1SE4 A;  1E6E B;  1YQ4 B;  3P4R B;  2LJ5 A;  1QLB B;  2KAJ A;  4CYE A;  4KGR A;  1V5T A;  4OHJ A;  2PMV A;  1Y56 A;  4ARI A;  1LGR A;  1NDD A;  4LDT B;  1V1P B;  1J7A A;  2CHX A;  1I4R A;  3N30 A;  4BKS D;  2DNF A;  4GB9 A;  2CHW A;  1C4C A;  2AL6 A;  3W5V B;  2R2O A;  3ZDT A;  1XXG A;  1I4Q A;  5BMI A;  1HZ6 A;  2MBE A;  4GDL A;  1NEN B;  3JYU A;  5L83 A;  3B2F A;  3LJ3 A;  4RM8 A;  2HTH A;  2IND C;  2KX3 A;  2CS4 A;  3KQ4 A;  4JLC A;  5GXG B;  4XWW A;  4WAA A;  3GZN B;  4GDL B;  1D5M C;  4YWG G;  1FMA D;  2V3S A;  3HK0 A;  1TKY A;  3M95 A;  3R66 C;  4US8 A;  1NVI D;  2J0M A;  2PPH A;  2LHD A;  2YEP F;  1IGC A;  3RN9 C;  4DXF A;  2IY1 B;  2WXK A;  4A6Q A;  3FAH A;  1AYF A;  1S1Q B;  1ZDX A;  2INP E;  3ZKJ C;  1WM3 A;  3DVN U;  2LGI A;  4WIP A;  1F2R C;  3GZN I;  2LUE A;  3PVL A;  2GBN A;  2J42 A;  1T0Y A;  1ET9 A;  4WJO A;  5HHD G;  3B1L X;  2N7E A;  2FCS A;  2MJ3 A;  3N20 C;  4EFO A;  4CHK A;  3KWV A;  1QOG A;  4ZYN A;  3TUO A;  2LMC A;  2ZPY A;  5D2M B;  1XCQ L;  3PZ7 A;  2MQJ A;  4JL9 A;  3DWG C;  2AYO B;  2N9P C;  1J7C A;  4GSW A;  3GE3 C;  4BKG A;  2DYO A;  1P0R A;  3TBL D;  2W3S A;  2JYT A;  3PPA A;  2Z0D B;  4HLE A;  2LEK A;  2BB6 A;  3KH0 A;  1YOV B;  3T3N A;  2Q5W D;  5CHF A;  1P9D U;  4GDK A;  1C79 A;  4KX6 B;  4K7U A;  1J7B A;  5AUK A;  3HUI A;  1P3Q U;  3R2T A;  2BVC A;  5G55 A;  1KTK A;  4DDG D;  3Q8A A;  2IZV B;  4GDK B;  1IP9 A;  1WXS A;  4W9G A;  4EKU A;  1QF6 A;  3DWM A;  4DXG A;  2KWV B;  3AEF B;  4WQO B;  1YX6 B;  4IW0 A;  2CR5 A;  4ANW A;  2JZZ A;  2AQ2 B;  4CO7 A;  1MPE A;  1RLF A;  2LZ6 A;  2W54 A;  4NJ6 A;  2HJ8 A;  3NUH B;  2BWE S;  2FCQ A;  3R7R A;  2JWU A;  3TSS A;  3H6N A;  1SE2 A;  3RNG C;  1D5Z C;  1V1O A;  5D3I B;  2ICI A;  4HRO A;  3ZYY X;  1PFD A;  2XK5 A;  2EEL A;  2JUO A;  4E71 A;  2AQ1 B;  1PGX A;  4A90 A;  1E7U A;  4M00 A;  1EU4 A;  3AE2 B;  4PS3 A;  2KTR A;  2PIA A;  4MGY E;  3NVY A;  3HM3 A;  4KKI A;  2W3R A;  2XK5 B;  2KJH B;  1E8W A;  3AMZ A;  3NS1 A;  1T0Q C;  4HK2 A;  4NY0 A;  1FCL A;  2KTR B;  3ECI A;  2QDF A;  3AE7 B;  1P7F A;  2IGD A;  1XLQ A;  4WAF A;  3A9K A;  4MSQ B;  3BVZ A;  5D94 A;  4LK0 M;  1JWB D;  3W1S C;  4LJO B;  5EE3 A;  4HPM B;  3HHM A;  4ZYS A;  3I9V 1;  3QAQ A;  3AED B;  4FHJ A;  2EMT A;  3CSF A;  4EZJ A;  1QOF A;  1WGD A;  3CIR B;  4KDL B;  5KHO A;  1WJ6 A;  1GC6 A;  4K81 A;  3A9K B;  1FFV A;  4GU2 A;  3OLM D;  4KKJ A;  4KV2 A;  4RFB A;  2YEP B;  2V0G A;  4K3C A;  1FPY A;  2ZJD A;  3C8Y A;  3VRA B;  2IO2 B;  1QOA A;  2O6V D;  4NQL B;  3PZD A;  2CJN A;  2BW2 A;  3H7P A;  2NPT A;  2BS3 B;  3AEB B;  1J0G A;  1KM7 A;  3P1M A;  1V6E A;  2CU3 A;  4PYZ A;  4FBJ B;  5TSS A;  2SEB D;  2WXO A;  2JZP A;  4XX5 A;  3EC8 A;  3SDL C;  3H7P B;  2NPT B;  1Z2M A;  1EM7 A;  2RDG A;  1V5O A;  3PRP B;  4EZL A;  2EKI A;  1U4A A;  1L0Y B;  2MBQ A;  2BYV E;  1IGD A;  3TEY A;  2KDM A;  2H88 B;  1ZDV A;  4C7Y A;  3N32 A;  4MGI E;  2N9X A;  3RD2 A;  4JIO U;  2MCN B;  2WQY B;  2HD5 B;  3X0W A;  3Q69 A;  1F9J A;  1XCT L;  4A3P A;  4B6W A;  1YNT E;  2K22 A;  3QQ8 B;  1HXY D;  3JW0 X;  1VZ7 A;  2ZNV B;  1DOX A;  1MJD A;  2GBK A;  1ZP0 B;  2KN4 A;  4HCN B;  2G1E A;  4LNI A;  5EE9 A;  3FC4 A;  4EZK A;  1VLB A;  3QX1 A;  5CX3 A;  4BZA A;  1MFW A;  3U7Z A;  1E8Z A;  1D6E C;  4PK1 A;  3KW5 B;  5E6N A;  1CK1 A;  1K52 A;  2M8S A;  1FXA A;  2G9H D;  1SIJ A;  3P2B A;  2WLB A;  2K3U A;  1JAL A;  2PVO D;  2V1Y A;  2KZR A;  2V4I B;  3CWI A;  1FM0 D;  4LTU A;  1QOB A;  2NCN A;  3MHZ A;  5BYR A;  1WYG A;  4WJN A;  1UBI A;  3DQV A;  2RD0 A;  4HKQ A;  3EA6 A;  1PGB A;  1JWA D;  2J0J A;  4XE0 A;  5LNK 1;  1XO3 A;  5C23 A;  2K6Q A;  3AM9 A;  1NEK B;  3U7D A;  1OGW A;  4F8C B;  3U30 A;  5T8I A;  2KJR A;  2MHJ A;  1RM6 C;  1LM8 B;  1V49 A;  4WWM A;  2GBR A;  1KOT A;  3LYY A;  2KJ6 A;  1YJJ A;  4K7W A;  1E10 A;  3ZO5 B;  1YQB A;  5KHQ A;  4C80 A;  3RPF C;  1BT0 A;  1MG4 A;  2K8C A;  3PT2 B;  1HA5 A;  3VVW B;  2QIE B;  4X57 B;  5HFY A;  2WXM A;  1L2N A;  4ANU A;  2PJH A;  3B08 A;  1C76 A;  2WXP A;  4OZB A;  3PGE A;  2NTS A;  2DAF A;  1QT9 A;  2BB5 A;  3TEZ A;  2BYE A;  2KTF A;  4KVG B;  2R2Q A;  4MM3 A;  1TY0 A;  3AE5 B;  5DPR A;  1UH6 A;  2JVC A;  4B0M A;  1KFY B;  3PO0 A;  3W9C B;  4BBN F;  4YSX B;  2M0A A;  3V6C B;  4G3X B;  1YMH E;  4I6N B;  4MGZ E;  3ML9 A;  3SFD B;  5DPT A;  4YSY B;  2IPK D;  4YL8 A;  1X1M A;  4OW0 A;  3AUL A;  4KGS A;  2KVR A;  1WR1 A;  3A4S C;  2ONQ A;  3Q3M C;  2VZK D;  3L08 A;  1I7H A;  2LVO A;  1SE3 A;  2JY6 A;  2JU6 X;  3ZJV A;  2ZCC A;  4II3 B;  2REX A;  4W9H A;  1RFK A;  1ZXH A;  3ML8 A;  1SE9 A;  3P4S B;  2KNB A;  4GMV A;  2Z8L A;  2D2Q A;  4ZHO A;  2C60 A;  2QCZ A;  3NZU A;  4EE2 A;  1C78 A;  3Q3F A;  1DOY A;  2L8J A;  2H89 B;  2DZM A;  1CZP A;  2GBJ A;  1MHX A;  4C4V A;  2KMM A;  1XD3 B;  3MP9 A;  4W9I A;  4IC7 B;  1XLO A;  4C56 C;  2IBI B;  4PS8 A;  1LQB A;  2RPQ A;  4G50 A;  2XN9 C;  3R7Q A;  2Y5C A;  2WXQ A;  2WX1 A;  3I3T B;  4C7Z A;  2C7H A;  2KYW A;  1EWC A;  2OOB B;  4YXD B;  2WXR A;  2DZJ A;  3QC8 B;  1NBF C;  4BKS A;  2XNA C;  4DBG A;  3A1Q A;  2MH7 A;  4W9E A;  4WUR A;  1RFA A;  2KC1 A;  2WYQ A;  2KD0 A;  1SSN A;  3U52 E;  3VTU A;  4DHJ D;  2LHE A;  2KWD A;  3L4P A;  4YTP B;  3W1Y A;  1R7S A;  3PSE B;  3A1Q B;  1EO6 A;  2ACZ B;  3QJZ A;  3ZJU A;  1TBE A;  5AEK B;  1F0Z A;  4HJK A;  2KKC A;  3AE8 B;  3FIL A;  3VUW A;  3O65 B;  2N4F A;  3NY5 A;  4LNN A;  4IKG A;  2PW9 A;  2IO3 B;  2M1M A;  3AEG B;  3NG0 A;  4RGN A;  2FBW B;  1SB3 C;  1WXV A;  1J8C A;  4HPL B;  2LGY A;  1Q5W B;  3FIL B;  1OEY A;  2WWZ A;  2N1W A;  2J7Q B;  4K1R B;  1BUI C;  2NBV B;  3VTV A;  1N63 A;  1L0V B;  4EOY A;  1L4D B;  1VZ8 A;  2D3B A;  3WAM A;  3UQA A;  1P98 A;  2C5L C;  4ICU A;  4NQK E;  1H8C A;  5AUI A;  2KHW B;  3VRB B;  2LWP A;  1HQR D;  1F77 A;  1PUT A;  3RNC C;  3HRD D;  2MBH A;  5D3D A;  4K3B A;  2MA9 B;  1N60 A;  5AZF A;  4PS7 A;  1JRP A;  3EEC A;  4O1N A;  4HDQ A;  1WGG A;  5H92 C;  2NMQ A;  2MBO A;  1WZ3 A;  2BYF A;  2WHI A;  5J17 A;  2NVU I;  2GOW A;  1GNU A;  2KVZ A;  2OED A;  4ANV A;  3AU5 A;  2WXH A;  3URY A;  4AUQ C;  1B1Z A;  3WCQ A;  1WFY A;  2MW5 A;  3U4E G;  1XF5 L;  1N62 A;  4HCP B;  2DZI A;  3DHH C;  4HVB A;  3RZW C;  4II2 B;  2WXL A;  3PTF C;  5EE1 A;  2R61 A;  2GRI A;  2M56 B;  1XLP A;  1P1A A;  2VH1 A;  4J6I A;  1VRA B;  4YT0 B;  3PRM B;  1STE A;  3RNE C;  3VR8 B;  2WXG A;  4TQ0 A;  3K9P B;  1L4Z B;  1KLU D;  2WDV B;  2AL3 A;  3ZXV A;  2FUH B;  2W82 A;  4FLH A;  2ZCB A;  2J4X A;  1TTN A;  3I5J C;  2D07 B;  2V4L A;  2NR2 A;  1UWM A;  1HTQ A;  3UQB A;  4RF0 A;  3WIM A;  2RMM A;  1PYW D;  5IP4 D;  2KLG A;  4G11 A;  4WWN A;  3N3K B;  2KN5 A;  2KLC A;  4M02 A;  2G3Q B;  3D32 A;  4ZRQ A;  3LXF A;  3UGB B;  2KT7 A;  1R4N B;  3OAW A;  3KUZ A;  2MX2 A;  4A3O A;  2LXA A;  4DHZ B;  4ZRJ A;  2WDR B;  1AAR A;  2L05 A;  1ET6 A;  2MP2 A;  1PDX A;  2QC8 A;  1T3Q A;  3NVZ A;  1GG3 A;  2LFI A;  1J19 A;  4GN1 A;  3KVF B;  1N5X A;  3WA0 A;  3NRZ A;  2MP2 B;  2L0T A;  2DEN B;  4B95 A;  3ZTC A;  3HVD A;  4ZRP A;  2CHZ A;  2ZW0 A;  2JPH A;  1TS4 A;  1R4N I;  2RPV A;  3MFG A;  1Q0W B;  4HDO A;  1TS5 A;  3KUC B;  3TMP B;  3ZVV A;  2MJE A;  3ETR A;  4ANX A;  2Y5B B;  3N1Y C;  1OEY J;  4BFR A;  2WXI A;  2L52 A;  5DPW A;  2KQ4 X;  3BY4 B;  1E7V A;  4USA A;  4JE3 B;  4XYC A;  3V60 A;  2N9L A;  1WR6 E;  1ZOY B;  1IPG A;  4OVV A;  4IM3 A;  2KX0 A;  3ZQ4 A;  3H8H A;  1OQR A;  3L54 A;  1V9J A;  1R4M B;  3PZ8 A;  3IAM 1;  2OJR A;  4A55 A;  1WJ4 A;  2QMT A;  2JRI B;  2BKF A;  2N9K A;  1FXI A;  1WXA A;  3Q6B A;  4LNK A;  1D4B A;  2IO1 B;  3O13 A;  3TCA A;  4M0W A;  5DPS A;  2JZ3 B;  2LI5 A;  1N6Z A;  5FR6 A;  3ZNI D;  2KQ7 A;  4IDI A;  2QSD A;  1UBQ A;  2O6V A;  2RR9 A;  1E5W A;  1UWX A;  2BQQ A;  1SEB D;  2JSV X;  2DBY A;  3DHI C;  4M0W B;  1TIF A;  1TJE A;  2DAJ A;  2KMC A;  3PHW B;  2EMS A;  1TZ1 A;  3M3J A;  3A4R A;  2BT6 A;  1I4P A;  1GOZ A;  1R4M I;  2DLB A;  4MSM B;  1Z5S B;  2O6V B;  4RH6 A;  2INC C;  2MEK A;  4GXB A;  1CQV A;  3TEX A;  1GUA B;  2YVC A;  1F2R I;  4R3D A;  2FAZ A;  1BXT A;  3QHT A;  1JML A;  3H1U A;  1WJU A;  3APF A;  1ZW7 A;  5CHV C;  4F1S A;  5BO4 B;  4N9F 4;  2A5U A;  1A70 A;  3EGR A;  2FID A;  1KH0 A;  2MJD A;  1C1Y B;  4FJY A;  1L0X B;  3AU4 A;  4W9J A;  1F52 A;  2LVP A;  2IY0 B;  4NNJ B;  1YJI A;  2INN E;  2KO3 A;  2LRW A;  2WGS A;  3APD A;  3PS6 A;  3JVZ X;  1FEH A;  5BYS A;  2GB1 A;  1WZ0 A;  3EFU A;  1ZPS A;  3KUD B;  3MC0 B;  1I42 A;  1WE6 A;  4JWU C;  1UGM A;  1FNV A;  3DVG X;  3ABV B;  2D3A A;  4AJY B;  3Q8C A;  1C4A A;  4MDK E;  1ENF A;  3RNF C;  2ZW1 A;  1S3S G;  2JX5 A;  1WE7 A;  1FRD A;  1LFD A;  4P16 A;  2BGF A;  4IM2 A;  4AWJ A;  4PYU A;  4XZ4 A;  4KZ0 A;  2LUM A;  3UIP B;  4HEA 1;  4EUT A;  3Q8E A;  2ASQ A;  4RNA A;  2KWC A;  4M01 A;  1A5R A;  3DVG Y;  1V8C A;  5H8Y E;  2Y3A A;  1VCB A;  3ZNZ B;  5G5G A;  4AP4 C;  4FXC A;  3AH7 A;  3AB5 A;  4P6V F;  3RUL A;  4GGQ A;  3A33 B;  2PVG C;  1NYR A;  1UUP A;  3QK0 A;  4AQ7 A;  2TSS A;  5CHW A;  1NI2 A;  4WWO A;  3Q2A C;  4OZC A;  2ZVN A;  3KLS X;  4DQO C;  2M17 A;  4KIK B;  4MJS B;  5CTR C;  4NAM A;  4YTM B;  1FNU A;  5TR5 A;  2N7D A;  4W9D A;  1YN3 A;  1YX5 B;  1D5X C;  3V3X A;  2LAS A;  4DK5 A;  4W9C A;  4JGH B;  2FIF A;  3VH4 B;  2JT4 B;  1TS3 A;  2WU5 B;  3BII D;  4P7I A;  3T8M A;  4RF1 A;  2WU2 B;  3V6E B;  1TT5 B;  3VQI A;  1WSP A;  2NS5 A;  4B0E A;  3L0W B;  2MWS B;  3P63 A;  2G4D B;  4MAC A;  2Z0E B;  2K5P A;  4FJZ A;  3KYD D;  5IOI A;  2PEA A;  1L7Y A;  3ZDM C;  4JWS C;  4OVU A;  3NHE B;  2BS2 B;  3AXC A;  2AWT A;  2J53 A;  4ITK A;  1BML C;  5G2N A;  2VZK B;  1NYQ A;  3CMM B;  1UEL A;  2K39 A;  4FUL A;  2DZK A;  2WXJ A;  3L16 A;  2I1J A;  2M0X A;  2CU1 A;  4OVZ A;  1ZGU B;  4HKZ E;  2B3A A;  3BK1 A;  4ICV A;  2L83 A;  4DDI D;  5J18 A;  4FAD A;  4BKT A;  2IGG A;  4IUM B;  3ALB A;  1DGJ A; 
#chains in the Genus database with same CATH homology
 5FR3 A;  1E9M A;  3AEF B;  1M4V A;  1PUT A;  4JX1 C;  2I38 A;  2QJL A;  5C2T B;  3HRD D;  1L5P A;  4YSZ B;  2NTT A;  5D3D A;  3T3O A;  1N60 A;  2RDH A;  2BTE A;  1JRP A;  5EE0 A;  3BK2 A;  3W5U B;  2AQ2 B;  3Q8F A;  4O1N A;  1MPE A;  2W54 A;  5H92 C;  2NMQ A;  3KWL A;  1YN5 A;  1KLG D;  4REZ A;  3NUH B;  1OQQ A;  4UDU C;  2HDE A;  2OED A;  5BYQ A;  3VR9 B;  1L6V A;  2WXH A;  4AS1 A;  4NJC A;  2JWU A;  3URY A;  3U2S C;  3TSS A;  1B1Z A;  3W1S A;  1JQ4 A;  1SE2 A;  3WCQ A;  1D5Z C;  1V1O A;  5E6J A;  3U4E G;  4XWT A;  2QIL A;  2AQ3 B;  5D3I B;  1XF5 L;  1N62 A;  2ICI A;  3NVV A;  4HRO A;  1PFD A;  3ZYY X;  1ESF A;  3BVG A;  2EEL A;  2ON8 A;  2AQ1 B;  2KAC A;  5D7G A;  1PGX A;  2WXL A;  5EE1 A;  2CJO A;  4A90 A;  1UGJ A;  1AN8 A;  2R61 A;  1EU4 A;  5G5H A;  3AE2 B;  2PIA A;  2GRI A;  4RGM A;  2M56 B;  1XLP A;  2M19 A;  3NVY A;  1VRA B;  4KKI A;  4YT0 B;  2W3R A;  1JW9 D;  1STE A;  3VR8 B;  3W2D A;  3AMZ A;  3NS1 A;  2WXN A;  2JQR B;  2WXG A;  3AEC B;  4TQ0 A;  5MPO A;  1L4Z B;  1KLU D;  2WDV B;  4L1B A;  1FCL A;  4XDD A;  2N0S B;  4A8X C;  2W82 A;  1VZ6 A;  3AE7 B;  2J4X A;  1TZO A;  1P7F A;  4A9A A;  1E0Z A;  4OZA A;  2IGD A;  2B76 B;  1UWM A;  1XLQ A;  1XEE A;  3AE4 B;  3EUB 2;  4RF0 A;  3BVZ A;  4WAF A;  2RMM A;  5FKA C;  4LK0 M;  1PYW D;  1JWB D;  2K9X A;  5EE3 A;  1FIQ A;  1SXT A;  4ZYS A;  3BYY B;  1XLN A;  1WRI A;  4TQ1 A;  2WNM A;  3I9V 1;  4ZRQ A;  3AED B;  1DYQ A;  3LXF A;  3N9Y C;  4XDC A;  3AE3 B;  1QOF A;  1UNS A;  3CIR B;  3GP7 A;  4NZL B;  2GI9 A;  1FFV A;  2WDR B;  3IXS A;  4NAW B;  1ET6 A;  1FCC C;  2PLP A;  4KKJ A;  3Q8B A;  1OFF A;  1PDX A;  1ZE3 D;  1GB4 A;  1RYJ A;  2YEP B;  4RFB A;  1NI3 A;  2V0G A;  1T3Q A;  3NVZ A;  1SJE D;  4US9 A;  1KF6 B;  3C8Y A;  1WGK A;  3VRA B;  2LFI A;  1QOA A;  2WS3 B;  1EU3 A;  1N5X A;  2CJN A;  1C4P A;  3NRZ A;  5HI1 A;  2BW2 A;  1IUE A;  2BS3 B;  2DYM A;  3AEB B;  3P1M A;  1I4G A;  1FD6 A;  2IGH A;  1CJE A;  4ARC A;  2CU3 A;  3UI3 A;  1Q10 A;  3HVD A;  5TSS A;  2SEB D;  2WXO A;  2ZW0 A;  4ZRP A;  1TS4 A;  2JZP A;  3BZD B;  2RPV A;  3MFG A;  1IBX A;  1TS5 A;  2V3N A;  4MH8 A;  1EM7 A;  1QKZ A;  4J3O D;  2RDG A;  3BVM A;  5FK9 C;  1AW7 A;  2EKI A;  3IT6 B;  1L0Y B;  2MJE A;  3ETR A;  1SBB B;  2W55 A;  5C3J B;  1IGD A;  1VJK A;  1EWY C;  2WXI A;  2L52 A;  3TEY A;  1ROE A;  2KDM A;  2KQ4 X;  1FNW A;  2H88 B;  1ZDV A;  1C9F A;  1ZUD 2;  3RFZ B;  3NZ3 A;  4C7Y A;  1IBX B;  4USA A;  4MM3 B;  4JE3 B;  1FRR A;  1JCK B;  2N9L A;  1ZOY B;  3GS2 A;  2PKO A;  1GAQ B;  2WQY B;  2IJ0 A;  1LO5 D;  3Q69 A;  3P4P B;  1XCT L;  1MVK A;  3TEW A;  1E7P B;  1DOI A;  1YNT E;  2K22 A;  3H8H A;  3ZQ4 A;  1HXY D;  1OQR A;  1VZ7 A;  1QQR A;  1SF0 A;  1DOX A;  2L32 A;  4TSS A;  3PZ8 A;  1ZP0 B;  3IAM 1;  2KN4 A;  1YN4 A;  4A55 A;  2QMT A;  2G1E A;  1JWU D;  3R2I A;  5EE9 A;  3FC4 A;  1JRO A;  2N9K A;  1VLB A;  1FXI A;  4H2A A;  3U7Z A;  1D6E C;  3DWM A;  4ZHP A;  4YTN B;  1D4B A;  2WP9 B;  1CK1 A;  1K52 A;  3O13 A;  2JXT A;  1I4X A;  4M0W A;  1FXA A;  2G9H D;  1SIJ A;  4IDI A;  3SEB A;  2WLB A;  2K3U A;  2QSD A;  1JAL A;  2PVO D;  2V4I B;  2E6X A;  4IOI E;  2IDY A;  2I2Y A;  4HJG E;  3CWI A;  1FM0 D;  3V05 A;  1K53 A;  1UWX A;  4LTU A;  1MI0 A;  1RWS A;  1QOB A;  1SEB D;  2JSV X;  2K0P A;  1WYG A;  2DBY A;  3MHZ A;  5BYR A;  1P7E A;  1TJE A;  2BYT A;  4HKQ A;  4WH4 A;  3EA6 A;  2BT6 A;  1I4P A;  1GOZ A;  1PGB A;  2DLB A;  3SFE B;  1JWA D;  1HEZ E;  4XE0 A;  5LNK 1;  4RH6 A;  1XO3 A;  3AEE B;  3SR6 A;  1WXQ A;  3AM9 A;  1NEK B;  2SAK A;  1SJH D;  2MEK A;  3GB1 A;  5T8I A;  1RM6 C;  1CQV A;  3TEX A;  4WWM A;  4Q2J A;  1TY2 A;  3LYY A;  3AN1 A;  4L2Y A;  1F2R I;  4LLG M;  4R3D A;  3E9S A;  1YJJ A;  1BXT A;  2Y5P A;  1TKE A;  1JML A;  1E10 A;  1T6B X;  4C80 A;  4ZOH C;  1A70 A;  3RPF C;  2J52 A;  3EGR A;  2BS4 B;  4MT5 A;  1K50 A;  1HA5 A;  1KH0 A;  1QIL A;  2MJD A;  2QIE B;  5HFY A;  2WXM A;  3ZGZ A;  2HTM E;  1GPX A;  1L0X B;  3HVZ A;  4N59 A;  1AWD A;  5JXV A;  2L1A A;  1C76 A;  3R8B A;  2LJI A;  2WXP A;  4OZB A;  2E3T A;  2WXF A;  1C77 A;  1V1P A;  1SE4 A;  1E6E B;  2NTS A;  1N61 A;  1YJI A;  1YQ4 B;  2INN E;  1QT9 A;  3P4R B;  3B9J A;  4N6E B;  1QLB B;  4GLS C;  2BB5 A;  1FEH A;  2KAJ A;  5BYS A;  4KGR A;  5HG2 A;  2GB1 A;  3TEZ A;  4OHJ A;  5BMG A;  3ZJT A;  2PMV A;  1Y56 A;  4ARI A;  1V97 A;  1K51 A;  1V1P B;  1ZPS A;  1J7A A;  3MC0 B;  1GB1 A;  1I4R A;  1KRH A;  4JWU C;  1JWS D;  1TY0 A;  3AE5 B;  1C4C A;  1FNV A;  2QEJ C;  3ABV B;  4B0M A;  1KFY B;  3PO0 A;  4RGT A;  3W9C B;  4CQN A;  4YSX B;  2M0A A;  3W5V B;  2AX5 A;  1WWT A;  1YMH E;  1XXG A;  3J9C A;  3Q8C A;  1I4Q A;  3SFD B;  5BMI A;  1C4A A;  3B2G A;  1ENF A;  1HZ6 A;  4YSY B;  2IPK D;  3E56 A;  4OW0 A;  1NEN B;  4KGS A;  2ZW1 A;  2JX5 A;  1FRD A;  3B2F A;  4P16 A;  4KGT A;  2ONQ A;  5BMH A;  2VZK D;  3P42 A;  1I7H A;  2V3P A;  1SE3 A;  4RCO A;  3MJ5 A;  2LUM A;  4HRS A;  3KQ4 A;  2JU6 X;  4L23 A;  2DWQ A;  5GXG B;  4HEA 1;  3IT4 B;  4XWW A;  1N5W A;  2JYE A;  3Q8E A;  1FO4 A;  3ZJV A;  4GDL B;  1D5M C;  4YWG G;  4RNA A;  1FMA D;  1RFK A;  1ZXH A;  1TKY A;  4US8 A;  1NVI D;  1V8C A;  2LHD A;  3P4S B;  5H8Y E;  2Y3A A;  2YEP F;  2Z8L A;  3NVW A;  1IGC A;  3LB8 C;  5G5G A;  4ZHO A;  4DXF A;  2FUG 1;  1ZXI A;  1TS2 A;  2WXK A;  4FXC A;  1C78 A;  4EE2 A;  3AH7 A;  3AB5 A;  4P6V F;  1YQ3 B;  2PTL A;  1DOY A;  2BBC A;  4A6Q A;  2H89 B;  1CZP A;  3FAH A;  3BWU D;  2PVG C;  1NYR A;  1MHX A;  1UUP A;  2KMM A;  1AYF A;  1T5X D;  3MP9 A;  4JPS A;  4AQ7 A;  2TSS A;  1ZDX A;  2INP E;  3OWE B;  1XLO A;  4C56 C;  4OZC A;  1VR9 A;  4WQM A;  3KLS X;  4DQO C;  2LGI A;  2XN9 C;  2Y5C A;  2WXQ A;  4WIP A;  4C7Z A;  1F2R C;  4NAM A;  4D2K A;  1EWC A;  4YTM B;  1FNU A;  4YXD B;  2WXR A;  2J42 A;  1YN3 A;  1JWM D;  1D5X C;  3AV8 A;  3V3X A;  2XNA C;  2WDQ B;  1TKG A;  1ET9 A;  2MH7 A;  1L6U A;  1TS3 A;  4WUR A;  2WU5 B;  3BII D;  4RF1 A;  2WU2 B;  1SSN A;  5HHD G;  3U52 E;  3VQI A;  2MJ3 A;  1WSP A;  4B0E A;  2OHF A;  2LHE A;  2KWD A;  3L4P A;  4YTP B;  1FFU A;  1R7S A;  4N58 A;  3P4Q B;  3P63 A;  3KWV A;  1QOG A;  3TUO A;  2LMC A;  2ACZ B;  4MAC A;  3AEA B;  2K5P A;  1XCQ L;  2N7J A;  3ZJU A;  3BYT B;  3PZ7 A;  4JWS C;  1F0Z A;  2FE8 A;  2BS2 B;  3DWG C;  3AE8 B;  3FIL A;  3AE9 B;  2J53 A;  3I57 A;  2X38 A;  1J7C A;  3AE1 B;  4IKG A;  2PW9 A;  3AEG B;  4ITK A;  1VDV A;  1BML C;  2DYO A;  4RGN A;  2FBW B;  2W3S A;  1SB3 C;  2JYT A;  4TMA B;  1MHH E;  2LEK A;  2VZK B;  2BB6 A;  1NYQ A;  3T3N A;  3FIL B;  2WXJ A;  2Q5W D;  4OVZ A;  1B9R A;  4HKZ E;  1C79 A;  4KX6 B;  3IAS 1;  1BUI C;  3BK1 A;  2L83 A;  1J7B A;  3AE6 B;  1TYG B;  2D5G A;  3HUI A;  5AUK A;  5I4D A;  1N63 A;  1L0V B;  1PGA A;  3R2T A;  1KTK A;  1L4D B;  1VZ8 A;  1ACC A;  3Q8A A;  4GDK B;  4PT5 A;  5AUI A;  2IGG A;  1HZ5 A;  1I4H A;  3VRB B;  1QF6 A;  1HQR D;  1DGJ A;  4DXG A;  4RGO S;  1F77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...