3BIID

Crystal structure of activated mpt synthase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
80
structure length
80
Chain Sequence
MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Molybdopterin-converting factor subunit 1
publication title Crystal structure of a molybdopterin synthase-precursor Z complex: insight into its sulfur transfer mechanism and its role in molybdenum cofactor deficiency.
pubmed doi rcsb
source organism Escherichia coli
total genus 22
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2007-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3biiD00
3RPFC 1V8CA 1FO4A 1QF6A 1RYJA 2Y5CA 3AB5A 3HRDD 3AE7B 4YTNB 4YSZB 1JROA 1FXAA 1VJKA 3LXFA 2PKOA 1KFYB 1XO3A 2AX5A 2HTME 3NRZA 1A70A 3W5VB 1ZXIA 3BIID 1V97A 2KAJA 2K9XA 3SFEB 1RFKA 1OQQA 1JQ4A 2PVOD 5C2TB 2QIEB 4C80A 3AEBB 1SIJA 3AEDB 2B76B 1L0VB 4ZOHC 3VR8B 1E7PB 3AEGB 1WWTA 3NVZA 2MJDA 4YXDB 1N63A 2BS2B 1N5XA 3SFDB 1AWDA 4YTMB 1QOGA 2W55A 1FRRA 1FIQA 2LEKA 1E10A 1JWBD 2BS3B 3AECB 1ZUD2 1OFFA 2Q5WD 2PIAA 5EE0A 1FFUA 1WGKA 5H8YE 5H92C 1N60A 3VR9B 4USAA 1TYGB 1GAQB 3AMZA 1PFDA 1ZP0B 2KMMA 3NVWA 2CJNA 2CJOA 2G1EA 2K22A 3AE3B 1J7AA 3B2FA 4YSYB 1E6EB 1NI3A 2DWQA 3B9JA 2WDVB 3HUIA 5AUIA 3ZYYX 1ZOYB 1TKGA 4HRSA 4ZHPA 3KWLA 1L5PA 3NVVA 1JALA 4ITKA 1QLBB 5EE1A 1F0ZA 3DWGC 3P4PB 1FFVA 1QOBA 3AEEB 2QJLA 3AM9A 1L6VA 4YT0B 1PUTA 2H88B 2L83A 1B9RA 3AEAB 3AE2B 3L4PA 4WWMA 1N61A 2M56B 2OHFA 2BT6A 1SB3C 1WRIA 5EE9A 1YQ4B 5MPOA 2W3SA 1CZPA 4FXCA 3AE5B 1OQRA 1E0ZA 1TJEA 4YTPB 4KX6B 3W9CB 3ABVB 1I7HA 2EKIA 1RWSA 2FBWB 1IUEA 1QOFA 1N5WA 5AUKA 4YSXB 1WXQA 3AE8B 1NYQA 2E3TA 3HVZA 1ROEA 3CWIA 1J7BA 5EE3A 3P1MA 1NYRA 1PDXA 1SF0A 4JWUC 3SR6A 1XLPA 4A9AA 1VLBA 1XLOA 2W54A 1T3QA 2W3RA 3NVYA 1KF6B 4JX1C 3PO0A 4US9A 2WLBA 1FM0D 3AH7A 1AYFA 1DGJA 3P4SB 2DBYA 1NVID 3AEFB 3B2GA 3P63A 1JW9D 5C3JB 1JWAD 1XLQA 1DOYA 2WDQB 2WDRB 1DOIA 3AE4B 2K5PA 1YJIA 4C7YA 1KRHA 2JX5A 4HROA 3AE6B 5GXGB 2BS4B 1E9MA 4N6EB 1FRDA 1N62A 3AE1B 1TKEA 2ACZB 5G5GA 3FAHA 1CJEA 4US8A 4WQMA 1FMAD 1L6UA 2H89B 4P6VF 5G5HA 3WCQA 3CIRB 2MH7A 1R7SA 3AV8A 1XLNA 1WYGA 3AE9B 1FXIA 2WU5B 1UWMA 3W5UB 2WP9B 1GPXA 3NS1A 1TKYA 4IDIA 2WU2B 2L52A 3VRAB 4ZHOA 2WQYB 1J7CA 1RM6C 3FC4A 2CU3A 4N59A 1YJJA 1EWYC 3DWMA 1NEKB 4JWSC 3VRBB 1JRPA 2MJEA 1QT9A 3P4QB 2MJ3A 3EUB2 3LB8C 2M19A 3ETRA 3AN1A 4C7ZA 2JQRB 1YQ3B 3P4RB 4LTUA 2WS3B 2N0SB 1NENB 1QOAA 2PVGC 4N58A 1DOXA 1VDVA
chains in the Genus database with same CATH superfamily
4KDLB 3IT6B 1TY2A 1YN3A 3SEBA 3DBRB 3CSTA 2KQ4X 1T0SC 3RULA 2ZPYA 4ZRPA 1TGZB 4URKA 5D7GA 2B76B 2ZPNA 5AZFA 4OHJA 4DXGA 5C1ZA 1VZ8A 4MJSB 3DBHI 5IKCM 1EU4A 2XN9C 2LASA 2GBKA 4AS1A 3VQIA 1TS4A 3C0RB 4GDLB 2HE7A 2ZCCA 2KMMA 3WIMA 4IM3A 3RN9C 3VFKA 3JW0X 4B9KA 1CQVA 1P7FA 1UELA 4MEMA 4G11A 4W9DA 2MX2A 2QJLA 2VZKD 1PUTA 5AZGA 1EF1A 2VRRB 1ZE3D 4IWOA 1YX6B 2IGHA 2KTRB 3ZKJC 4N9F4 4ZYSA 5D3IB 5FK9C 5EDSA 1WH3A 2AQ1B 2KWVB 2LGYA 3P63A 3PZDA 2K1FA 1KLGD 2WXMA 3RNEC 4RCOA 1YX5B 3W1SC 4OW0A 1WXAA 3ALBA 3KLSX 4WWPA 2DAJA 3QIJA 4RGMA 1TKEA 4XX5A 3W2DA 2YLMA 3UF8A 4DHZB 5G5HA 3WCQA 1XLNA 4ANXA 3W5UB 1E8XA 3BVZA 4C56C 3KUCB 4LNNA 1D5MC 2E6XA 3QARA 2Y5BB 3C19A 4N58A 2BF8B 1YOVB 1I35A 3QWZB 1IBXB 4M02A 4TSSA 1S1QB 5HHDG 3T3NA 3QCAA 1ZXIA 1KOTA 1SJHD 1ENFA 4P7IA 3GS2A 3NG0A 3AEDB 4QAYA 4KIKA 3KWVA 2WXPA 2W55A 5JHAA 3PHXB 1OFFA 2TSSA 3MC9A 4GDKB 3ZGZA 4HKZE 1EF5A 4GOCA 3NVWA 5AUIA 4WH4A 5IAAC 3AU4A 2KOXA 2LZ6A 3RNBC 3B08A 3AM9A 1Y8RC 3L54A 4BFRA 3W1YA 3Q14C 3PREA 3GP7A 4JLCA 4B6WA 2EKIA 2BTEA 5AUKA 1JCKB 2A4ZA 5CHVC 3P1MA 3HK0A 2CHXA 1TZOA 1WZ3A 2JRIB 4ZDVA 1FM0D 2M0AA 3ZRCA 2EELA 3AEFB 3ZVVA 2WX1A 4K7WA 2ZNVC 4HK2A 4W9EA 1L2NA 3Q69A 4NJ7A 2KFKA 5GXGB 1WZ0A 1HTQA 2CHZA 3W1SA 4US8A 3UINB 2LHEA 1KLUD 4M0WB 2W82A 4NY0A 2L00B 4IDIA 1WM2A 3VRAB 1V2YA 2NPTB 3DWMA 2WNMA 4JWSC 3EC8A 2LRUA 2AQ2B 1H4RA 4E3CA 3N1ZC 2KJRA 2LVOA 2FNJB 3KW5B 4W9CA 2KQ7A 1IPGA 3WAMA 2OOBB 3TCAA 5CTRC 1JROA 2LFIA 1WXVA 1L4ZB 1RRBA 3HIZA 2K39A 2DLBA 1L0VB 3MFGA 2KN5A 2MLBA 4YXDB 1JWSD 2KN4A 3DBLI 4C4VB 2GBJA 4I6NB 3A1QB 1VCBA 4GMVA 4KZCA 5DPRA 3QHTA 1N60A 1GAQB 1KJTA 3H6NA 2CJNA 2BWFA 4CO7A 3B9JA 4R3DA 4WJPA 1ZOYB 4FA6A 1L5PA 4FJVB 1FFVA 3AEEB 3SD5A 2R61A 3U30A 3AEAB 2KC1A 3QK0A 4CYEA 2K6DB 3TBLD 4FXCA 3C8YA 2KDIA 1T0YA 4HKQA 1J7BA 4NAWB 1LXDA 2MA9B 1F1HA 1D4BA 2KACA 2BVCA 1AYFA 1GUAB 2NR2A 2ONQA 3IXSA 1DOYA 3UI3A 1XF5L 4ACFA 4MSQB 2BB6A 2AL3A 4H2AA 3VTWA 1KRHA 4WAAA 2BS4B 1FRDA 2GI9A 4EE2A 3MJ5A 3RMKC 4XDCA 1WXMA 3NS1A 1XT9B 2QEJC 2WQYB 1J7CA 1K8RB 2JZZA 4N59A 3ZW3A 5J17A 2MJ3A 3R2IA 1EWCA 2IO2B 4WWNA 1QOAA 2BGFA 3N32A 5CHFA 4BVUC 1Z2MA 1TY0A 3HRDD 1MJDA 2HTME 4ARIA 3UQBA 3AEGB 3FKYA 2IO1B 1QOGA 1UUPA 1WMHA 2JWZA 4HCPB 2MHJA 3NZ3A 2GBRA 2MEKA 1BMLC 1NBFC 3HM3A 3AU5A 1T6BX 1WGGA 2BB5A 2N7DA 1ZP0B 3AE3B 3B2FA 2WDVB 1WX9A 1YIWA 3WANA 3ML9A 3IT4B 1QF6A 3PZ8A 4TKNA 2J0JA 4W9GA 2JXTA 3AE2B 4RF0A 1TS5A 2OHFA 4IWQA 1YQ4B 3ZDMC 3DBHB 2J7QB 1I7HA 4MGYE 2I1KA 3L10B 3K9PB 3M63B 2EKEC 4A3OA 2LVPA 3VHTC 1T3QA 1SGHA 2MWSB 4DHJB 2WLBA 2WYQA 3DCGA 3ZO5B 4XZ4A 4IM0A 4BBNF 2ZJDA 1F9JA 3A33B 3IHPC 2V3NA 3O65B 2G4SA 1MFWA 3QJZA 5E6NA 1L6UA 2H89B 4DWFA 5FR3A 1TS3A 3DHIC 3A9JB 1PQSA 1UGMA 1V86A 5D94A 2M19A 1FCLA 3VXWA 2RD0A 1FEHA 1ET9A 2M4NA 1TIFA 2C7HA 3J9CA 1V5OA 4FULA 2KDBA 4NAMA 3NY5A 2EMTA 2KAJA 4K81A 5D3DA 2CS4A 2A5UA 1ZW7A 4C80A 1V81A 1SIJA 4ZOHC 4ASWC 1WWTA 2M8SA 3MTNB 1HQRD 3R2TA 4GSWA 1FXTB 5E6OA 2MW5A 2R2QA 2PIAA 3S2AA 3PRPB 2BWES 2GMIC 1WX7A 4IC7B 1SE4A 4XDDA 3AMZA 4DHJD 1XCTL 2ZCBA 4NZLB 3HUIA 3Q3MC 2KFKB 2QC8A 3NVVA 2M1MA 1G6JA 3P4PB 4O1NA 1L4DB 4WWMA 4KSLC 4A20A 2KT7A 3IVFA 4XYCA 3RUIB 3W9CB 1P98A 3BVMA 3PRMB 4NQKE 4ANUA 5BYQA 1WX8A 1XQQA 1UNSA 4C00A 1WXSA 5BYRA 2W3RA 2Z8LA 2DBYA 2J53A 5CX3A 3R8BA 2LJ5A 1MG4A 3Q8CA 2KD0A 4UDUC 3IAS1 2K5PA 2CR5A 4AOFA 3MJWA 1I4XA 2K0PA 3ENEA 4IM2A 1NI2A 4MACA 4F7ZA 2KHWB 2Y5PA 4C4VA 5D2MB 2L3ZA 2WU2B 1KM7A 2KANA 2KWCA 1RLFA 5JHBA 1YJJA 3UIPB 4ANVA 4BKTA 1PGXA 4PK1A 3VH3B 2VZKB 4PYUA 4GU2A 3TJPA 2N9PC 3VR8B 3Q6BA 1QILA 4AJWA 2MSED 4WIPA 1SEBD 3RNAC 3BIID 2KQSA 2N4FA 2ZVNA 2WXOA 3OJ3A 4MH0E 4P16A 3MHSD 1E7PB 2N9LA 3GZNI 1GOZA 5JXVA 4NAWA 1I42A 4HJGE 3CMMB 4LK0M 5EE0A 4RNAA 3RZFA 2AEHA 1PFDA 2OJRA 1ZPSA 4TUUA 1U4AA 2FAZA 1BXTA 3BYYB 4MGIE 3KUDB 2ZNVB 5E6PA 4ZHPA 2K8CA 1L6VA 3V62A 4OVVA 1N61A 3DBLB 1WRDB 2XNAC 2N9EB 3LYYA 2D07B 2I2YA 3BZDB 4WJOA 1QOFA 5C23A 3AE8B 3R66C 1E90A 2E3TA 1QKZA 4B0MA 3Q8BA 3H8HA 2W54A 3GE3C 1HE8A 1KF6B 3MHZA 2JRHA 5C3JB 4E71A 1JWAD 4RGNA 4FJYA 1VZ6A 4K7SA 1YD8U 1P0RA 1WF9A 2KX0A 1YN4A 2C7NB 3FAHA 3PGEA 2WXLA 1WMHB 1KLVA 1R7SA 4F1SA 4AQ7A 4BOSC 2LXCA 4ZRKA 5DCNA 1FNWA 4ZHOA 3ZJUA 2VH2A 1EWYC 4HPPA 1RAXA 4GXBA 1EU3A 3AN1A 4LTUA 2ZZPB 4KGRA 3RPFC 4NNJB 4DHZE 1TBEA 3LXFA 1C1YB 2PMVA 2NCNA 2IJ0A 1M4VA 2BS2B 1S3SG 1FIQA 2B3AA 4WWOA 1ZXHA 4HEA1 2G1EA 1MHXA 3DDCB 1WJNA 3KQ4A 1TKGA 2RR9A 3O13A 1C4AA 2WX0A 2H88B 2L83A 5J18A 1SB3C 1ET6A 1UBQA 3E56A 3CSFA 4JL9A 1RWSA 1WXQA 1NYQA 2N1WA 1HA5A 2LUMA 4BOZB 5BYSA 3A9JA 5LNK1 2O2VB 4ARCA 4W9FA 2LMCA 1DGJA 1Z5SB 1WE6A 2V3SA 4HCNB 2UU7A 1F77A 3R7RA 3AE6B 3OAWA 3HVDA 4FBJB 1GB1A 2ACZB 4WQMA 5L83A 1P3QU 4WJNA 2X8XX 2DZMA 4DDID 3KUZA 2ICIA 2AWTA 5DPTA 4MGZE 3M62B 3MP9A 1MVKA 2KDEB 2HD5B 2L8JA 3JSVA 2N7JA 1YQ3B 2N0SB 1NENB 3I3TB 4RGTA 4RGOS 1WYWB 1VDVA 1J8CA 1RYJA 3ZNZB 2XEWA 1XO3A 2AX5A 3L0WB 3SU8X 3JYUA 2J52A 3R7QA 2DYMA 3NVZA 3DVNU 3WA0A 1F52A 4ANWA 3EA6A 4W9IA 3VTUA 2N9KA 2DNFA 1ESFA 2V4IB 3NUHB 2MRPA 2J0MA 4RFBA 4IW0A 3TUOA 2OJWA 2NBVB 3IAM1 2HDEA 2DWQA 3NJTA 2DX5B 4MH8A 2REXA 1HEZE 1YNTE 2D3BA 1XD3B 2NBWB 4JGHB 5IN7A 4TV3A 4YTPB 3V3XA 1C3TA 2JU6X 4IOIE 3ECIA 3P2BA 3NHEB 4JX1C 2KMCA 4FJZA 3Q3JA 4G50A 3PSEB 3Q3NC 4M00A 3X0WA 4HJKA 3CF6E 3Q2AC 2JZ3B 1D5ZC 2WXJA 4M01A 2L7RA 1J0GA 3L17A 4YWGG 2IYDB 1JMLA 2WDTB 1UWMA 1B1ZA 3H7PA 4FLHA 1L0YB 4HPMB 2HTHA 3TL5A 2XK5A 2C9WB 1GNUA 2V4LA 4LCDE 2UYZB 2ZEQA 2VH1A 2FIDA 2DZJA 3AB5A 2L0TA 3AE7B 5BMHA 2IZVB 2QSDA 2DAFA 2INPE 2FCMA 3QA8A 3SFEB 2MBQA 1RFAA 1GB4A 3OG5A 3WALA 1N63A 3Q8FA 1J19A 3U2SC 2BYTA 4G0NB 1TYGB 1YQBA 3TEXA 4EZJA 2MBOA 2XBBC 2RDGA 4YSYB 4BBNC 1NI3A 4MELA 3ZYYX 4HRSA 3TEYA 3FILA 1JALA 1P7EA 1C76A 5L95C 4KVGB 3GZNB 5LLIA 4XWWA 1ISNA 5DPWA 3E9SA 3RD2A 3M95A 1ZKHA 2IBIB 3SHQA 4JIOU 1V9JA 4TQ0A 3NVYA 4ZRJA 3AXCA 2KTFA 2JUOA 1VD2A 4KDIC 2MCNB 4LNKA 1ACCA 1WGHA 3ZXVA 2IY1B 2M17A 1M94A 4REZA 1C9FA 1MHHE 3LJ3A 4LDTD 4N6EB 1QZEA 5G5GA 2GBMA 1FMAD 2RGFA 1JRUA 1MG8A 2D10A 3ZQ4A 1UH6A 3V05A 3NS8A 4TMAB 2GOWA 1GPXA 2DENB 3U8ZA 1SE3A 2WXQA 1RM6C 2KXJA 1QQRA 4OZAA 3N1YC 4FADA 2RPQA 4RMAA 2JYEA 3ETRA 1SXTA 3P4RB 1DOXA 4AUQC 2Y5CA 2CU1A 2D11A 3TSSA 3PS6A 1VJKA 3OWEB 2IPKD 1R4MI 3N20C 2K9XA 5HKHA 4IWPA 1VZ7A 2C5LC 1WR1A 1T5XD 1C78A 3L13A 2RPVA 4KKIA 4YTMB 5FKAC 2O2VA 3A9KA 3EECA 1TTNA 4LLGM 2KO3A 3PV1A 1SE9A 4A90A 2Z0EB 5E6JA 1WR6E 3KWLA 2D5GA 1FD6A 1K50A 1C4CA 3RYTA 2WGSA 1WIAA 3DHGC 5EE9A 2Y3AA 3AE5B 1WGDA 2QILA 4II2B 3HVZA 3JVZX 5EE3A 2KZRA 2R2OA 3JSVB 2KVRA 3DOWA 2FCNA 1NVID 3I57A 3Q3OC 1E7VA 2J4XA 1GJZA 1YJIA 1VRAB 2L05A 1CJEA 2CKHB 2BYVE 3KH0A 3BWUD 4FHJA 2QMTA 3GOEA 2WU5B 2ASQA 1V1PA 1SBBB 4XE0A 4AJYB 2GB1A 1TKYA 3V60A 5GMVA 3RFZB 5I4DA 4FN2A 2K25A 2DYOA 2KDMA 2L1AA 2QDFA 2MJEA 3P4QB 4BAXA 3LB8C 1FNUA 3ML8A 3ONSA 4C7ZA 2SEBD 1UD7A 2JQRB 4P6VF 4ZYNA 4GN1A 4YTNB 1FXAA 2PKOA 3PZ7A 4BZAA 1RFKA 1KTKA 1L7YA 2LGIA 2CHWA 2N9XA 1AWDA 4MM3A 3UGBB 4EKUA 4I6PA 3L16A 3QX1A 1R4NI 1FFUA 1CMXB 2ZVOA 1IGDA 4USAA 1WJ4A 1K52A 2N7EA 2K22A 5JZEB 1E6EB 3BK2A 2KKCA 4HPLB 1SJED 1HZ5A 1Q1OA 3L08A 2KX3A 1F0ZA 2V1YA 4EZLA 1GC7A 3DVGY 3L4PA 1WRIA 1Q0WB 4FHKA 1E0ZA 3H7PB 1OQRA 2INCC 2WXGA 4YSXB 1ZDVA 2XK5B 3V6CB 2ZW1A 4ICUA 2V0GA 3PPAA 1SF0A 1PDXA 3DPDA 1Q10A 4EOYA 1EUVB 1UWXA 2GBNA 2RMMA 2RDHA 3TEWA 1DOIA 3DBSA 1PGBA 2FUHB 1N62A 2WXKA 4A3PA 2JF5A 3UQAA 1JWMD 1PYWD 3CIRB 2MH7A 3AV8A 2K8HA 3AE9B 3SDLC 4S17A 4S0RA 4M8MA 2L32A 3RNGC 2CU3A 2K8BA 1Y56A 5G55A 5G2NA 3RNCC 4EFOA 3ZXRA 4DXFA 2WS3B 3FILB 3QAQA 3ZNID 2KNBA 1V8CA 4GLSC 1EM7A 2QHOA 5TR5A 2JSVX 2PJHA 3APCA 3ZJTA 3ZRFA 2PE6B 3M3JA 2PPHA 5CHWA 2FCQA 1JQ4A 2PVOD 1N6ZA 3V61A 2NTTA 3PVLA 3AEBB 2MJDA 4AWJA 3A4SC 2YEPB 4DBGA 2PTLA 2IO3B 2LEKA 5LXHA 1JWBD 5BMIA 3AECB 3N30A 1CK1A 4Q2JA 3T9LA 4GIVA 1C79A 2FCSA 2KJHB 4PS8A 1J7AA 2YVCA 1FNVA 2I1JA 3VAWA 4ITKA 1QLBB 2GRIA 5EE1A 1UZXB 4KV2A 3PHWB 1KH0A 3PTFC 2O6VB 3U7DA 1N5WA 2MP2B 3CWIA 1WJ6A 2BBCA 3VUXA 1LQBA 2G3QB 3KVFB 2G4DB 3URYA 1VLBA 4KGSA 5AEKB 2KWDA 2IDYA 1UBIA 5TSSA 1I4QA 2PLPA 2KK8A 4HXDA 2JVCA 2KLGA 3AE4B 3DHHC 2NMQA 3GB1A 3TIXA 4HROA 1E9MA 4LJPB 4WQOB 2WXHA 4D2KA 4KGTA 2KJ6A 2L0FA 2UWQA 1WYGA 1T0RC 2EMSA 2BW2A 3A9KB 4GGQA 4HLEA 4MSMB 2KLCA 2IGDA 2KWUB 4RH6A 4JE3B 3MC0B 2JT4B 1E7UA 4JPSA 1LO5D 2LJIA 3ZNHB 4B0EA 3NRZA 2KDFB 1V97A 1WGYA 2N1VA 1WY8A 5DPSA 3UIOB 3I5JC 1T0QC 1GG3A 4IG7B 3ZTCA 4W9LA 3X23A 3ZJVA 4IUMB 4K3CA 2O6VD 2LGXA 1I4RA 2JXXA 4WJQA 2GLSA 3ZTDA 1BUIC 5H8YE 5H92C 2WXFA 3BK1A 3VR9B 1D3ZA 1MI0A 2BYFA 1R4MB 2BPSA 3IFWB 4A55A 4ZRIA 4YT0B 1OTRB 1IYFA 2BQQA 5KHQA 4MDKE 4LNOA 1V1PB 3R3MA 4DXAB 4MT5A 1WSPA 4E74A 1IGCA 1ROEA 1XEEA 1NYRA 3TMPB 1UGJA 4US9A 3VDZA 5HI1A 3P4SB 4OZCA 1XLQA 3A4RA 4XWTA 4OZBA 2WDRB 4YL8A 2J0KA 4HDOA 4DQOC 2FIFA 2LUEA 2BYEA 3AE1B 3WAPA 3BVGA 4BKGA 2BKFA 2LXAA 3N3KB 4MM3B 1FPYA 3DBRI 2NS5A 3Q8AA 5IA7A 1D6EC 1K51A 3HM6X 3I63C 3TEZA 2MQJA 3U7ZA 1UF0A 1IP9A 3IG3A 1P1AA 4P1BC 3PT2B 1JRPA 4K3BA 1QT9A 1SSNA 4B95A 1AARA 3U4EG 1V80A 2JWUA 2PVGC 4PS7A 1VR9A 2V9HA 2LRWA 3EFCA 4YSZB 3B0AA 1KFYB 3W5VB 3OJ4B 1XXGA 1Q5WB 2ZW0A 3ZLZA 5AZHA 1N5XA 1P9DU 3Q8EA 3OLMD 4LNIA 4DDGD 2G9HD 4W9HA 3RCZA 2LWPA 4LDTB 2INDC 3VH4B 3AI5A 2CJOA 1F2RC 5JH5C 1PGAA 2D3CA 2DHZA 2M0XA 4HWIB 3Q3FA 1OEYA 5BMGA 1B9RA 2M56B 3GE8C 5MPOA 4A6QA 4EZKA 1R4NB 1SE2A 2WWZA 3VUWA 2AL6A 1XCQL 2YEPF 1XLPA 4MGKE 1K53A 1V5TA 4DK5A 4EEWA 4MJSA 3PLUA 4OVZA 1X1MA 3B2GA 1JW9D 3DQVA 1V49A 3HHMA 1E5WA 4GDLA 1YMHE 3H7SA 3VUYA 3B1LX 4C7YA 4K1RB 1A5RA 4NQLB 2JPHA 1E8ZA 1HTOA 1F2RI 2W9NA 5T8IA 3RI7C 1ZDXA 5FR6A 3AULA 4XGAB 2KMAA 4XC2A 3ZDTA 4BKSD 4HVBA 4A8XC 3BY4B 2Z59B 2WP9B 2G45B 2AQ3B 4AP4C 2KTRA 2L52A 2NVUI 5KHOA 1NDDA 2LVQA 3PRZA 2MBHA 3MC8A 4W9KA 1YJ1A 1SIFA 5LXIB 1WI0A 2WXRA 2PW9A 3PLVA 3ZIMA 1FO4A 2LGDA 4KSKC 3U52E 2KC2A 3LDZE 2HJ1A 1I4PA 1OQYA 1I4GA 3VTVA 2O6VA 2IGGA 4J6IA 1E8WA 2ON8A 2MP2A 3SFDB 3P42A 1JWUD 2BS3B 2Q5WD 2DZKA 2L76A 4HDQA 4L23A 4TQ1A 2K6QA 2KYWA 1EO6A 1HZ6A 2SAKA 5BO4B 4GB9A 4LNFA 2D3GA 3DWGC 1IBXA 4LJOB 3RNFC 1AN8A 3QQ8B 3D32A 2JYTA 2FBWB 4KIKB 1IUEA 3QC8B 4IKGA 2I38A 4WURA 2J42A 3PO0A 4W9JA 5IP4D 3AH7A 1E8YA 4GDKA 4JQWC 4PT5A 3ZUNA 2D2QA 1V1OA 4RM8A 4J3OD 1WGRA 1LM8B 2HJ8A 1C4PA 1I4HA 2IO0B 2V3PA 3H9DA 2JX5A 3H1UA 1WE7A 1LGRA 2RSUA 4EUTA 3RT3B 3EFUA 2K3UA 1L0XB 1TT5B 2NTSA 4WAFA 1WJUA 1V6EA 2KFJA 2MBBB 4P1CC 5D6JB 3IBEA 2INNE 2D3AA 4M8NA 5IO9A 3VRBB 3EUB2 2LI5A 2FE8A 4L2YA 2NBUA 1GC6A 2MBEA 1A70A 3KYDD 4ZRQA 1OQQA 1YN5A 4KKJA 2PE9A 2BKRB 2LHDA 5C2TB 1WFYA 2QIEB 1STEA 3K9OB 2Z0DB 3DVNV 1FRRA 1E10A 2X38A 4M0WA 3DVGX 1ZUD2 1TS2A 2LD9A 3APDA 1WGKA 2NPTA 4I6LB 2C7MB 3NZUA 3VVWB 1DYQA 3APFA 1QOBA 4CHKA 1ZGUB 2PEAA 4ICVA 2BT6A 4II3B 2WXNA 2WXIA 2W3SA 1CZPA 1TJEA 4KX6B 3ABVB 3EGRA 3V6EB 4F8CB 1LFDA 4NPNA 4K7UA 4NJCA 1FCCC 3SR6A 4JWUC 4A9AA 1H8CA 1TZ1A 1XLOA 3EHVA 3WAOA 3T8MA 5HG2A 3NOBA 4PS3A 4G3XB 1C77A 2IY0B 2OEDA 3A1QA 3NZSA 5IOIA 5HFYA 1WM3A 2LGSA 1OEYJ 2WDQB 3ZNGC 4RF1A 3T3OA 1HXYD 1OGWA 2WHIA 4BKSA 5J2RA 2AYOB 1MPEA 3N9YC 4PYZA 2DZIA 2FUG1 2JZPA 4L1BA 4OVUA 3RZWC 1FXIA 1BT0A 2DYBA 2JY6A 2RDBC 3BINA 4KZ0A 4X57B 2KVZA 4RM9A 1AW7A 3FC4A 4NJ6A 3BYTB 1NEKB 3I9V1 2QCZA 3N1XC 1D5XC 4CQNA 2C60A 3KYCD
chains in the Genus database with same CATH topology
1ET9A 1LO5D 3J9CA 2LJIA 3IT6B 3AB5A 3AE7B 5BMHA 1TY2A 1YN3A 2QSDA 3SEBA 4B0EA 2KQ4X 2INPE 3NRZA 4NAMA 4ZRPA 1V97A 2KAJA 3SFEB 5D3DA 1GB4A 5D7GA 4C80A 4ZOHC 1SIJA 2B76B 4OHJA 1WWTA 3ZJVA 1N63A 1HQRD 3Q8FA 4DXGA 3R2TA 1VZ8A 1I4RA 1EU4A 2PIAA 3U2SC 2XN9C 1BUIC 5H8YE 5H92C 2WXFA 3BK1A 1TS4A 3VQIA 4GDLB 2BYTA 3VR9B 4AS1A 1TYGB 1SE4A 4XDDA 3AMZA 1MI0A 3TEXA 2KMMA 1XCTL 2RDGA 4YSYB 4NZLB 3HUIA 1NI3A 3ZYYX 4HRSA 3TEYA 3FILA 3NVVA 1JALA 1CQVA 1P7FA 4A55A 3P4PB 1P7EA 4O1NA 4YT0B 2QJLA 2VZKD 1PUTA 1C76A 1L4DB 4WWMA 1ZE3D 4XWWA 1V1PB 3E9SA 3W9CB 4MT5A 3BVMA 2IGHA 1WSPA 5BYQA 4ZYSA 1IGCA 1UNSA 1ROEA 1XEEA 1NYRA 5BYRA 4TQ0A 5D3IB 3NVYA 2W3RA 5FK9C 1UGJA 4US9A 2Z8LA 5HI1A 2AQ1B 3P4SB 2DBYA 3P63A 4OZCA 2J53A 1ACCA 1XLQA 3R8BA 4XWTA 3Q8CA 2WDRB 4OZBA 1KLGD 4UDUC 3IAS1 2WXMA 2K5PA 4RCOA 4REZA 4OW0A 1C9FA 3KLSX 4DQOC 1MHHE 4N6EB 1I4XA 4RGMA 2K0PA 1TKEA 3AE1B 5G5GA 3BVGA 3W2DA 1FMAD 4MACA 5G5HA 3WCQA 4MM3B 1XLNA 3Q8AA 3ZQ4A 1D6EC 2Y5PA 1K51A 3W5UB 3V05A 4TMAB 1GPXA 3TEZA 3BVZA 3U7ZA 4C56C 2WU2B 1SE3A 2WXQA 1RM6C 1D5MC 1QQRA 4OZAA 1YJJA 2E6XA 1JRPA 1PGXA 1QT9A 1SSNA 2VZKB 2JYEA 3ETRA 1SXTA 3P4RB 4N58A 3U4EG 1DOXA 2JWUA 2PVGC 1VR9A 3VR8B 1IBXB 4TSSA 5HHDG 1QILA 2Y5CA 3T3NA 4YSZB 3TSSA 1VJKA 1KFYB 4WIPA 1SEBD 2IPKD 3OWEB 1ZXIA 3BIID 3W5VB 2K9XA 1SJHD 2WXOA 1ENFA 1VZ7A 3GS2A 1XXGA 4P16A 1T5XD 3AEDB 1C78A 2RPVA 1E7PB 2ZW0A 2N9LA 3KWVA 1N5XA 2WXPA 1GOZA 4KKIA 4YTMB 5JXVA 2W55A 3Q8EA 5FKAC 1OFFA 2TSSA 4HJGE 4GDKB 3ZGZA 4LK0M 5EE0A 2G9HD 4RNAA 4LLGM 4HKZE 1PFDA 3NVWA 1ZPSA 4A90A 2CJOA 1F2RC 5E6JA 1PGAA 5AUIA 4WH4A 1BXTA 3BYYB 4ZHPA 3KWLA 2D5GA 1FD6A 1K50A 1C4CA 5BMGA 3AM9A 1L6VA 1B9RA 1N61A 2M56B 5EE9A 2Y3AA 2XNAC 5MPOA 3GP7A 3LYYA 3AE5B 2I2YA 2QILA 4A6QA 1SE2A 3BZDB 2EKIA 2BTEA 1QOFA 5AUKA 1JCKB 3AE8B 3HVZA 1XCQL 2E3TA 1QKZA 4B0MA 3Q8BA 5EE3A 3P1MA 3H8HA 2YEPF 1XLPA 1K53A 1TZOA 2W54A 1KF6B 3MHZA 1FM0D 2M0AA 4OVZA 5C3JB 2EELA 1NVID 3AEFB 3B2GA 1JW9D 1JWAD 3I57A 4RGNA 1VZ6A 1YMHE 2J4XA 3Q69A 1YJIA 4C7YA 5GXGB 1F2RI 1VRAB 1YN4A 3W1SA 5T8IA 3FAHA 1CJEA 4US8A 1ZDXA 2WXLA 3BWUD 1R7SA 2QMTA 2LHEA 1KLUD 4AQ7A 2WU5B 4A8XC 1V1PA 2W82A 2WP9B 1SBBB 4XE0A 2AQ3B 2GB1A 1TKYA 4IDIA 1FNWA 2L52A 3VRAB 4ZHOA 3ZJUA 3RFZB 5I4DA 2DYOA 2KDMA 1EWYC 2L1AA 2WNMA 3DWMA 4JWSC 2MJEA 3P4QB 2AQ2B 3LB8C 1FNUA 2WXRA 1EU3A 2PW9A 2SEBD 2JQRB 3AN1A 4LTUA 4C7ZA 4KGRA 4P6VF 3RPFC 1FO4A 3U52E 4YTNB 1JROA 1FXAA 2LFIA 3LXFA 2PKOA 2PMVA 1I4PA 3PZ7A 1L4ZB 1I4GA 1RFKA 2DLBA 2IGGA 1KTKA 1M4VA 2IJ0A 1L0VB 3MFGA 2ON8A 2LGIA 4YXDB 2BS2B 1JWSD 3SFDB 1AWDA 2KN4A 3P42A 1FIQA 1JWUD 2BS3B 2Q5WD 1ZXHA 1FFUA 4L23A 1N60A 1IGDA 4HEA1 4TQ1A 4USAA 1K52A 1GAQB 2CJNA 2G1EA 1MHXA 2K22A 1E6EB 3BK2A 1HZ6A 3B9JA 3KQ4A 4R3DA 1SJED 1ZOYB 1TKGA 2SAKA 1HZ5A 1L5PA 1F0ZA 3DWGC 3O13A 1FFVA 1C4AA 3AEEB 1IBXA 2R61A 2H88B 2L83A 3AEAB 3L4PA 1AN8A 1SB3C 2JYTA 1ET6A 1WRIA 3E56A 1E0ZA 4FXCA 1OQRA 3C8YA 2WXGA 2FBWB 1RWSA 4YSXB 1IUEA 1ZDVA 1WXQA 1NYQA 4HKQA 1HA5A 2LUMA 2ZW1A 2V0GA 1J7BA 5BYSA 4NAWB 1SF0A 1PDXA 4IKGA 2I38A 4WURA 5LNK1 2J42A 1D4BA 1Q10A 3PO0A 4ARCA 1UWXA 2KACA 3AH7A 2LMCA 1AYFA 1DGJA 4PT5A 2RMMA 2RDHA 2ONQA 3IXSA 1DOYA 1V1OA 3TEWA 3UI3A 1DOIA 1XF5L 4J3OD 2BB6A 1F77A 1C4PA 1I4HA 4H2AA 2V3PA 1KRHA 1PGBA 2JX5A 3AE6B 2BS4B 3HVDA 1FRDA 2GI9A 1N62A 2WXKA 1GB1A 2ACZB 4EE2A 1JWMD 3MJ5A 4WQMA 1PYWD 2K3UA 1L0XB 3CIRB 2MH7A 2NTSA 3AV8A 4WAFA 3AE9B 2ICIA 4XDCA 3NS1A 2L32A 2QEJC 2WQYB 1J7CA 2CU3A 4N59A 3MP9A 1MVKA 2INNE 1Y56A 3VRBB 2MJ3A 3EUB2 3R2IA 1EWCA 2N7JA 1YQ3B 4DXFA 2FE8A 2N0SB 1NENB 1QOAA 2WS3B 3FILB 4L2YA 4RGTA 4RGOS 1VDVA 1V8CA 4GLSC 1EM7A 2JSVX 1RYJA 1TY0A 3HRDD 3ZJTA 1XO3A 2AX5A 2HTME 1A70A 4ZRQA 4ARIA 1JQ4A 1OQQA 1YN5A 4KKJA 2PVOD 2LHDA 5C2TB 2NTTA 2QIEB 3AEBB 1STEA 2J52A 3AEGB 2DYMA 3NVZA 2MJDA 1QOGA 1UUPA 2YEPB 2PTLA 1FRRA 2LEKA 2X38A 3EA6A 1JWBD 2N9KA 4M0WA 5BMIA 1E10A 3NZ3A 3AECB 1ZUD2 2MEKA 1BMLC 1ESFA 1CK1A 1TS2A 4Q2JA 2V4IB 3NUHB 1T6BX 2BB5A 1WGKA 1C79A 4RFBA 1ZP0B 3TUOA 3IAM1 2HDEA 3AE3B 1J7AA 3B2FA 2DWQA 2WDVB 4MH8A 1FNVA 1HEZE 1YNTE 4ITKA 1QLBB 2GRIA 3IT4B 1DYQA 5EE1A 1QOBA 1QF6A 3PZ8A 2JXTA 3AE2B 4RF0A 1TS5A 2OHFA 2BT6A 2WXNA 1KH0A 1YQ4B 2WXIA 2W3SA 1CZPA 1TJEA 4YTPB 4KX6B 3ABVB 1I7HA 3V3XA 3EGRA 1N5WA 2JU6X 4NJCA 3CWIA 4IOIE 2BBCA 1FCCC 3SR6A 4JWUC 4A9AA 3URYA 1VLBA 1XLOA 4KGSA 1T3QA 4JX1C 2KWDA 5HG2A 2IDYA 2WLBA 5TSSA 1I4QA 1C77A 2OEDA 2PLPA 5HFYA 2WDQB 3AE4B 2NMQA 3GB1A 4RF1A 4HROA 3T3OA 1E9MA 1HXYD 2V3NA 1D5ZC 2WXJA 2WXHA 3N9YC 1MPEA 4D2KA 4KGTA 2FUG1 2JZPA 1L6UA 2H89B 4L1BA 4YWGG 1WYGA 1JMLA 1FXIA 1UWMA 1B1ZA 2BW2A 1L0YB 5FR3A 1TS3A 1AW7A 3FC4A 3BYTB 1NEKB 2IGDA 3I9V1 4RH6A 2M19A 4JE3B 1D5XC 4CQNA 3MC0B 1FCLA 1FEHA 4JPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RPF C;  1V8C A;  1FO4 A;  1QF6 A;  1RYJ A;  2Y5C A;  3AB5 A;  3HRD D;  3AE7 B;  4YTN B;  4YSZ B;  1JRO A;  1FXA A;  1VJK A;  3LXF A;  2PKO A;  1KFY B;  1XO3 A;  2AX5 A;  2HTM E;  3NRZ A;  1A70 A;  3W5V B;  1ZXI A;  3BII D;  1V97 A;  2KAJ A;  2K9X A;  3SFE B;  1RFK A;  1OQQ A;  1JQ4 A;  2PVO D;  5C2T B;  2QIE B;  4C80 A;  3AEB B;  1SIJ A;  3AED B;  2B76 B;  1L0V B;  4ZOH C;  3VR8 B;  1E7P B;  3AEG B;  1WWT A;  3NVZ A;  2MJD A;  4YXD B;  1N63 A;  2BS2 B;  1N5X A;  3SFD B;  1AWD A;  4YTM B;  1QOG A;  2W55 A;  1FRR A;  1FIQ A;  2LEK A;  1E10 A;  1JWB D;  2BS3 B;  3AEC B;  1ZUD 2;  1OFF A;  2Q5W D;  2PIA A;  5EE0 A;  1FFU A;  1WGK A;  5H8Y E;  5H92 C;  1N60 A;  3VR9 B;  4USA A;  1TYG B;  1GAQ B;  3AMZ A;  1PFD A;  1ZP0 B;  2KMM A;  3NVW A;  2CJN A;  2CJO A;  2G1E A;  2K22 A;  3AE3 B;  1J7A A;  3B2F A;  4YSY B;  1E6E B;  1NI3 A;  2DWQ A;  3B9J A;  2WDV B;  3HUI A;  5AUI A;  3ZYY X;  1ZOY B;  1TKG A;  4HRS A;  4ZHP A;  3KWL A;  1L5P A;  3NVV A;  1JAL A;  4ITK A;  1QLB B;  5EE1 A;  1F0Z A;  3DWG C;  3P4P B;  1FFV A;  1QOB A;  3AEE B;  2QJL A;  3AM9 A;  1L6V A;  4YT0 B;  1PUT A;  2H88 B;  2L83 A;  1B9R A;  3AEA B;  3AE2 B;  3L4P A;  4WWM A;  1N61 A;  2M56 B;  2OHF A;  2BT6 A;  1SB3 C;  1WRI A;  5EE9 A;  1YQ4 B;  5MPO A;  2W3S A;  1CZP A;  4FXC A;  3AE5 B;  1OQR A;  1E0Z A;  1TJE A;  4YTP B;  4KX6 B;  3W9C B;  3ABV B;  1I7H A;  2EKI A;  1RWS A;  2FBW B;  1IUE A;  1QOF A;  1N5W A;  5AUK A;  4YSX B;  1WXQ A;  3AE8 B;  1NYQ A;  2E3T A;  3HVZ A;  1ROE A;  3CWI A;  1J7B A;  5EE3 A;  3P1M A;  1NYR A;  1PDX A;  1SF0 A;  4JWU C;  3SR6 A;  1XLP A;  4A9A A;  1VLB A;  1XLO A;  2W54 A;  1T3Q A;  2W3R A;  3NVY A;  1KF6 B;  4JX1 C;  3PO0 A;  4US9 A;  2WLB A;  1FM0 D;  3AH7 A;  1AYF A;  1DGJ A;  3P4S B;  2DBY A;  1NVI D;  3AEF B;  3B2G A;  3P63 A;  1JW9 D;  5C3J B;  1JWA D;  1XLQ A;  1DOY A;  2WDQ B;  2WDR B;  1DOI A;  3AE4 B;  2K5P A;  1YJI A;  4C7Y A;  1KRH A;  2JX5 A;  4HRO A;  3AE6 B;  5GXG B;  2BS4 B;  1E9M A;  4N6E B;  1FRD A;  1N62 A;  3AE1 B;  1TKE A;  2ACZ B;  5G5G A;  3FAH A;  1CJE A;  4US8 A;  4WQM A;  1FMA D;  1L6U A;  2H89 B;  4P6V F;  5G5H A;  3WCQ A;  3CIR B;  2MH7 A;  1R7S A;  3AV8 A;  1XLN A;  1WYG A;  3AE9 B;  1FXI A;  2WU5 B;  1UWM A;  3W5U B;  2WP9 B;  1GPX A;  3NS1 A;  1TKY A;  4IDI A;  2WU2 B;  2L52 A;  3VRA B;  4ZHO A;  2WQY B;  1J7C A;  1RM6 C;  3FC4 A;  2CU3 A;  4N59 A;  1YJJ A;  1EWY C;  3DWM A;  1NEK B;  4JWS C;  3VRB B;  1JRP A;  2MJE A;  1QT9 A;  3P4Q B;  2MJ3 A;  3EUB 2;  3LB8 C;  2M19 A;  3ETR A;  3AN1 A;  4C7Z A;  2JQR B;  1YQ3 B;  3P4R B;  4LTU A;  2WS3 B;  2N0S B;  1NEN B;  1QOA A;  2PVG C;  4N58 A;  1DOX A;  1VDV A; 
#chains in the Genus database with same CATH topology
 4KDL B;  3IT6 B;  1TY2 A;  1YN3 A;  3SEB A;  3DBR B;  3CST A;  2KQ4 X;  1T0S C;  3RUL A;  2ZPY A;  4ZRP A;  1TGZ B;  4URK A;  5D7G A;  2B76 B;  2ZPN A;  5AZF A;  4OHJ A;  4DXG A;  5C1Z A;  1VZ8 A;  4MJS B;  3DBH I;  5IKC M;  1EU4 A;  2XN9 C;  2LAS A;  2GBK A;  4AS1 A;  3VQI A;  1TS4 A;  3C0R B;  4GDL B;  2HE7 A;  2ZCC A;  2KMM A;  3WIM A;  4IM3 A;  3RN9 C;  3VFK A;  3JW0 X;  4B9K A;  1CQV A;  1P7F A;  1UEL A;  4MEM A;  4G11 A;  4W9D A;  2MX2 A;  2QJL A;  2VZK D;  1PUT A;  5AZG A;  1EF1 A;  2VRR B;  1ZE3 D;  4IWO A;  1YX6 B;  2IGH A;  2KTR B;  3ZKJ C;  4N9F 4;  4ZYS A;  5D3I B;  5FK9 C;  5EDS A;  1WH3 A;  2AQ1 B;  2KWV B;  2LGY A;  3P63 A;  3PZD A;  2K1F A;  1KLG D;  2WXM A;  3RNE C;  4RCO A;  1YX5 B;  3W1S C;  4OW0 A;  1WXA A;  3ALB A;  3KLS X;  4WWP A;  2DAJ A;  3QIJ A;  4RGM A;  1TKE A;  4XX5 A;  3W2D A;  2YLM A;  3UF8 A;  4DHZ B;  5G5H A;  3WCQ A;  1XLN A;  4ANX A;  3W5U B;  1E8X A;  3BVZ A;  4C56 C;  3KUC B;  4LNN A;  1D5M C;  2E6X A;  3QAR A;  2Y5B B;  3C19 A;  4N58 A;  2BF8 B;  1YOV B;  1I35 A;  3QWZ B;  1IBX B;  4M02 A;  4TSS A;  1S1Q B;  5HHD G;  3T3N A;  3QCA A;  1ZXI A;  1KOT A;  1SJH D;  1ENF A;  4P7I A;  3GS2 A;  3NG0 A;  3AED B;  4QAY A;  4KIK A;  3KWV A;  2WXP A;  2W55 A;  5JHA A;  3PHX B;  1OFF A;  2TSS A;  3MC9 A;  4GDK B;  3ZGZ A;  4HKZ E;  1EF5 A;  4GOC A;  3NVW A;  5AUI A;  4WH4 A;  5IAA C;  3AU4 A;  2KOX A;  2LZ6 A;  3RNB C;  3B08 A;  3AM9 A;  1Y8R C;  3L54 A;  4BFR A;  3W1Y A;  3Q14 C;  3PRE A;  3GP7 A;  4JLC A;  4B6W A;  2EKI A;  2BTE A;  5AUK A;  1JCK B;  2A4Z A;  5CHV C;  3P1M A;  3HK0 A;  2CHX A;  1TZO A;  1WZ3 A;  2JRI B;  4ZDV A;  1FM0 D;  2M0A A;  3ZRC A;  2EEL A;  3AEF B;  3ZVV A;  2WX1 A;  4K7W A;  2ZNV C;  4HK2 A;  4W9E A;  1L2N A;  3Q69 A;  4NJ7 A;  2KFK A;  5GXG B;  1WZ0 A;  1HTQ A;  2CHZ A;  3W1S A;  4US8 A;  3UIN B;  2LHE A;  1KLU D;  4M0W B;  2W82 A;  4NY0 A;  2L00 B;  4IDI A;  1WM2 A;  3VRA B;  1V2Y A;  2NPT B;  3DWM A;  2WNM A;  4JWS C;  3EC8 A;  2LRU A;  2AQ2 B;  1H4R A;  4E3C A;  3N1Z C;  2KJR A;  2LVO A;  2FNJ B;  3KW5 B;  4W9C A;  2KQ7 A;  1IPG A;  3WAM A;  2OOB B;  3TCA A;  5CTR C;  1JRO A;  2LFI A;  1WXV A;  1L4Z B;  1RRB A;  3HIZ A;  2K39 A;  2DLB A;  1L0V B;  3MFG A;  2KN5 A;  2MLB A;  4YXD B;  1JWS D;  2KN4 A;  3DBL I;  4C4V B;  2GBJ A;  4I6N B;  3A1Q B;  1VCB A;  4GMV A;  4KZC A;  5DPR A;  3QHT A;  1N60 A;  1GAQ B;  1KJT A;  3H6N A;  2CJN A;  2BWF A;  4CO7 A;  3B9J A;  4R3D A;  4WJP A;  1ZOY B;  4FA6 A;  1L5P A;  4FJV B;  1FFV A;  3AEE B;  3SD5 A;  2R61 A;  3U30 A;  3AEA B;  2KC1 A;  3QK0 A;  4CYE A;  2K6D B;  3TBL D;  4FXC A;  3C8Y A;  2KDI A;  1T0Y A;  4HKQ A;  1J7B A;  4NAW B;  1LXD A;  2MA9 B;  1F1H A;  1D4B A;  2KAC A;  2BVC A;  1AYF A;  1GUA B;  2NR2 A;  2ONQ A;  3IXS A;  1DOY A;  3UI3 A;  1XF5 L;  4ACF A;  4MSQ B;  2BB6 A;  2AL3 A;  4H2A A;  3VTW A;  1KRH A;  4WAA A;  2BS4 B;  1FRD A;  2GI9 A;  4EE2 A;  3MJ5 A;  3RMK C;  4XDC A;  1WXM A;  3NS1 A;  1XT9 B;  2QEJ C;  2WQY B;  1J7C A;  1K8R B;  2JZZ A;  4N59 A;  3ZW3 A;  5J17 A;  2MJ3 A;  3R2I A;  1EWC A;  2IO2 B;  4WWN A;  1QOA A;  2BGF A;  3N32 A;  5CHF A;  4BVU C;  1Z2M A;  1TY0 A;  3HRD D;  1MJD A;  2HTM E;  4ARI A;  3UQB A;  3AEG B;  3FKY A;  2IO1 B;  1QOG A;  1UUP A;  1WMH A;  2JWZ A;  4HCP B;  2MHJ A;  3NZ3 A;  2GBR A;  2MEK A;  1BML C;  1NBF C;  3HM3 A;  3AU5 A;  1T6B X;  1WGG A;  2BB5 A;  2N7D A;  1ZP0 B;  3AE3 B;  3B2F A;  2WDV B;  1WX9 A;  1YIW A;  3WAN A;  3ML9 A;  3IT4 B;  1QF6 A;  3PZ8 A;  4TKN A;  2J0J A;  4W9G A;  2JXT A;  3AE2 B;  4RF0 A;  1TS5 A;  2OHF A;  4IWQ A;  1YQ4 B;  3ZDM C;  3DBH B;  2J7Q B;  1I7H A;  4MGY E;  2I1K A;  3L10 B;  3K9P B;  3M63 B;  2EKE C;  4A3O A;  2LVP A;  3VHT C;  1T3Q A;  1SGH A;  2MWS B;  4DHJ B;  2WLB A;  2WYQ A;  3DCG A;  3ZO5 B;  4XZ4 A;  4IM0 A;  4BBN F;  2ZJD A;  1F9J A;  3A33 B;  3IHP C;  2V3N A;  3O65 B;  2G4S A;  1MFW A;  3QJZ A;  5E6N A;  1L6U A;  2H89 B;  4DWF A;  5FR3 A;  1TS3 A;  3DHI C;  3A9J B;  1PQS A;  1UGM A;  1V86 A;  5D94 A;  2M19 A;  1FCL A;  3VXW A;  2RD0 A;  1FEH A;  1ET9 A;  2M4N A;  1TIF A;  2C7H A;  3J9C A;  1V5O A;  4FUL A;  2KDB A;  4NAM A;  3NY5 A;  2EMT A;  2KAJ A;  4K81 A;  5D3D A;  2CS4 A;  2A5U A;  1ZW7 A;  4C80 A;  1V81 A;  1SIJ A;  4ZOH C;  4ASW C;  1WWT A;  2M8S A;  3MTN B;  1HQR D;  3R2T A;  4GSW A;  1FXT B;  5E6O A;  2MW5 A;  2R2Q A;  2PIA A;  3S2A A;  3PRP B;  2BWE S;  2GMI C;  1WX7 A;  4IC7 B;  1SE4 A;  4XDD A;  3AMZ A;  4DHJ D;  1XCT L;  2ZCB A;  4NZL B;  3HUI A;  3Q3M C;  2KFK B;  2QC8 A;  3NVV A;  2M1M A;  1G6J A;  3P4P B;  4O1N A;  1L4D B;  4WWM A;  4KSL C;  4A20 A;  2KT7 A;  3IVF A;  4XYC A;  3RUI B;  3W9C B;  1P98 A;  3BVM A;  3PRM B;  4NQK E;  4ANU A;  5BYQ A;  1WX8 A;  1XQQ A;  1UNS A;  4C00 A;  1WXS A;  5BYR A;  2W3R A;  2Z8L A;  2DBY A;  2J53 A;  5CX3 A;  3R8B A;  2LJ5 A;  1MG4 A;  3Q8C A;  2KD0 A;  4UDU C;  3IAS 1;  2K5P A;  2CR5 A;  4AOF A;  3MJW A;  1I4X A;  2K0P A;  3ENE A;  4IM2 A;  1NI2 A;  4MAC A;  4F7Z A;  2KHW B;  2Y5P A;  4C4V A;  5D2M B;  2L3Z A;  2WU2 B;  1KM7 A;  2KAN A;  2KWC A;  1RLF A;  5JHB A;  1YJJ A;  3UIP B;  4ANV A;  4BKT A;  1PGX A;  4PK1 A;  3VH3 B;  2VZK B;  4PYU A;  4GU2 A;  3TJP A;  2N9P C;  3VR8 B;  3Q6B A;  1QIL A;  4AJW A;  2MSE D;  4WIP A;  1SEB D;  3RNA C;  3BII D;  2KQS A;  2N4F A;  2ZVN A;  2WXO A;  3OJ3 A;  4MH0 E;  4P16 A;  3MHS D;  1E7P B;  2N9L A;  3GZN I;  1GOZ A;  5JXV A;  4NAW A;  1I42 A;  4HJG E;  3CMM B;  4LK0 M;  5EE0 A;  4RNA A;  3RZF A;  2AEH A;  1PFD A;  2OJR A;  1ZPS A;  4TUU A;  1U4A A;  2FAZ A;  1BXT A;  3BYY B;  4MGI E;  3KUD B;  2ZNV B;  5E6P A;  4ZHP A;  2K8C A;  1L6V A;  3V62 A;  4OVV A;  1N61 A;  3DBL B;  1WRD B;  2XNA C;  2N9E B;  3LYY A;  2D07 B;  2I2Y A;  3BZD B;  4WJO A;  1QOF A;  5C23 A;  3AE8 B;  3R66 C;  1E90 A;  2E3T A;  1QKZ A;  4B0M A;  3Q8B A;  3H8H A;  2W54 A;  3GE3 C;  1HE8 A;  1KF6 B;  3MHZ A;  2JRH A;  5C3J B;  4E71 A;  1JWA D;  4RGN A;  4FJY A;  1VZ6 A;  4K7S A;  1YD8 U;  1P0R A;  1WF9 A;  2KX0 A;  1YN4 A;  2C7N B;  3FAH A;  3PGE A;  2WXL A;  1WMH B;  1KLV A;  1R7S A;  4F1S A;  4AQ7 A;  4BOS C;  2LXC A;  4ZRK A;  5DCN A;  1FNW A;  4ZHO A;  3ZJU A;  2VH2 A;  1EWY C;  4HPP A;  1RAX A;  4GXB A;  1EU3 A;  3AN1 A;  4LTU A;  2ZZP B;  4KGR A;  3RPF C;  4NNJ B;  4DHZ E;  1TBE A;  3LXF A;  1C1Y B;  2PMV A;  2NCN A;  2IJ0 A;  1M4V A;  2BS2 B;  1S3S G;  1FIQ A;  2B3A A;  4WWO A;  1ZXH A;  4HEA 1;  2G1E A;  1MHX A;  3DDC B;  1WJN A;  3KQ4 A;  1TKG A;  2RR9 A;  3O13 A;  1C4A A;  2WX0 A;  2H88 B;  2L83 A;  5J18 A;  1SB3 C;  1ET6 A;  1UBQ A;  3E56 A;  3CSF A;  4JL9 A;  1RWS A;  1WXQ A;  1NYQ A;  2N1W A;  1HA5 A;  2LUM A;  4BOZ B;  5BYS A;  3A9J A;  5LNK 1;  2O2V B;  4ARC A;  4W9F A;  2LMC A;  1DGJ A;  1Z5S B;  1WE6 A;  2V3S A;  4HCN B;  2UU7 A;  1F77 A;  3R7R A;  3AE6 B;  3OAW A;  3HVD A;  4FBJ B;  1GB1 A;  2ACZ B;  4WQM A;  5L83 A;  1P3Q U;  4WJN A;  2X8X X;  2DZM A;  4DDI D;  3KUZ A;  2ICI A;  2AWT A;  5DPT A;  4MGZ E;  3M62 B;  3MP9 A;  1MVK A;  2KDE B;  2HD5 B;  2L8J A;  3JSV A;  2N7J A;  1YQ3 B;  2N0S B;  1NEN B;  3I3T B;  4RGT A;  4RGO S;  1WYW B;  1VDV A;  1J8C A;  1RYJ A;  3ZNZ B;  2XEW A;  1XO3 A;  2AX5 A;  3L0W B;  3SU8 X;  3JYU A;  2J52 A;  3R7Q A;  2DYM A;  3NVZ A;  3DVN U;  3WA0 A;  1F52 A;  4ANW A;  3EA6 A;  4W9I A;  3VTU A;  2N9K A;  2DNF A;  1ESF A;  2V4I B;  3NUH B;  2MRP A;  2J0M A;  4RFB A;  4IW0 A;  3TUO A;  2OJW A;  2NBV B;  3IAM 1;  2HDE A;  2DWQ A;  3NJT A;  2DX5 B;  4MH8 A;  2REX A;  1HEZ E;  1YNT E;  2D3B A;  1XD3 B;  2NBW B;  4JGH B;  5IN7 A;  4TV3 A;  4YTP B;  3V3X A;  1C3T A;  2JU6 X;  4IOI E;  3ECI A;  3P2B A;  3NHE B;  4JX1 C;  2KMC A;  4FJZ A;  3Q3J A;  4G50 A;  3PSE B;  3Q3N C;  4M00 A;  3X0W A;  4HJK A;  3CF6 E;  3Q2A C;  2JZ3 B;  1D5Z C;  2WXJ A;  4M01 A;  2L7R A;  1J0G A;  3L17 A;  4YWG G;  2IYD B;  1JML A;  2WDT B;  1UWM A;  1B1Z A;  3H7P A;  4FLH A;  1L0Y B;  4HPM B;  2HTH A;  3TL5 A;  2XK5 A;  2C9W B;  1GNU A;  2V4L A;  4LCD E;  2UYZ B;  2ZEQ A;  2VH1 A;  2FID A;  2DZJ A;  3AB5 A;  2L0T A;  3AE7 B;  5BMH A;  2IZV B;  2QSD A;  2DAF A;  2INP E;  2FCM A;  3QA8 A;  3SFE B;  2MBQ A;  1RFA A;  1GB4 A;  3OG5 A;  3WAL A;  1N63 A;  3Q8F A;  1J19 A;  3U2S C;  2BYT A;  4G0N B;  1TYG B;  1YQB A;  3TEX A;  4EZJ A;  2MBO A;  2XBB C;  2RDG A;  4YSY B;  4BBN C;  1NI3 A;  4MEL A;  3ZYY X;  4HRS A;  3TEY A;  3FIL A;  1JAL A;  1P7E A;  1C76 A;  5L95 C;  4KVG B;  3GZN B;  5LLI A;  4XWW A;  1ISN A;  5DPW A;  3E9S A;  3RD2 A;  3M95 A;  1ZKH A;  2IBI B;  3SHQ A;  4JIO U;  1V9J A;  4TQ0 A;  3NVY A;  4ZRJ A;  3AXC A;  2KTF A;  2JUO A;  1VD2 A;  4KDI C;  2MCN B;  4LNK A;  1ACC A;  1WGH A;  3ZXV A;  2IY1 B;  2M17 A;  1M94 A;  4REZ A;  1C9F A;  1MHH E;  3LJ3 A;  4LDT D;  4N6E B;  1QZE A;  5G5G A;  2GBM A;  1FMA D;  2RGF A;  1JRU A;  1MG8 A;  2D10 A;  3ZQ4 A;  1UH6 A;  3V05 A;  3NS8 A;  4TMA B;  2GOW A;  1GPX A;  2DEN B;  3U8Z A;  1SE3 A;  2WXQ A;  1RM6 C;  2KXJ A;  1QQR A;  4OZA A;  3N1Y C;  4FAD A;  2RPQ A;  4RMA A;  2JYE A;  3ETR A;  1SXT A;  3P4R B;  1DOX A;  4AUQ C;  2Y5C A;  2CU1 A;  2D11 A;  3TSS A;  3PS6 A;  1VJK A;  3OWE B;  2IPK D;  1R4M I;  3N20 C;  2K9X A;  5HKH A;  4IWP A;  1VZ7 A;  2C5L C;  1WR1 A;  1T5X D;  1C78 A;  3L13 A;  2RPV A;  4KKI A;  4YTM B;  5FKA C;  2O2V A;  3A9K A;  3EEC A;  1TTN A;  4LLG M;  2KO3 A;  3PV1 A;  1SE9 A;  4A90 A;  2Z0E B;  5E6J A;  1WR6 E;  3KWL A;  2D5G A;  1FD6 A;  1K50 A;  1C4C A;  3RYT A;  2WGS A;  1WIA A;  3DHG C;  5EE9 A;  2Y3A A;  3AE5 B;  1WGD A;  2QIL A;  4II2 B;  3HVZ A;  3JVZ X;  5EE3 A;  2KZR A;  2R2O A;  3JSV B;  2KVR A;  3DOW A;  2FCN A;  1NVI D;  3I57 A;  3Q3O C;  1E7V A;  2J4X A;  1GJZ A;  1YJI A;  1VRA B;  2L05 A;  1CJE A;  2CKH B;  2BYV E;  3KH0 A;  3BWU D;  4FHJ A;  2QMT A;  3GOE A;  2WU5 B;  2ASQ A;  1V1P A;  1SBB B;  4XE0 A;  4AJY B;  2GB1 A;  1TKY A;  3V60 A;  5GMV A;  3RFZ B;  5I4D A;  4FN2 A;  2K25 A;  2DYO A;  2KDM A;  2L1A A;  2QDF A;  2MJE A;  3P4Q B;  4BAX A;  3LB8 C;  1FNU A;  3ML8 A;  3ONS A;  4C7Z A;  2SEB D;  1UD7 A;  2JQR B;  4P6V F;  4ZYN A;  4GN1 A;  4YTN B;  1FXA A;  2PKO A;  3PZ7 A;  4BZA A;  1RFK A;  1KTK A;  1L7Y A;  2LGI A;  2CHW A;  2N9X A;  1AWD A;  4MM3 A;  3UGB B;  4EKU A;  4I6P A;  3L16 A;  3QX1 A;  1R4N I;  1FFU A;  1CMX B;  2ZVO A;  1IGD A;  4USA A;  1WJ4 A;  1K52 A;  2N7E A;  2K22 A;  5JZE B;  1E6E B;  3BK2 A;  2KKC A;  4HPL B;  1SJE D;  1HZ5 A;  1Q1O A;  3L08 A;  2KX3 A;  1F0Z A;  2V1Y A;  4EZL A;  1GC7 A;  3DVG Y;  3L4P A;  1WRI A;  1Q0W B;  4FHK A;  1E0Z A;  3H7P B;  1OQR A;  2INC C;  2WXG A;  4YSX B;  1ZDV A;  2XK5 B;  3V6C B;  2ZW1 A;  4ICU A;  2V0G A;  3PPA A;  1SF0 A;  1PDX A;  3DPD A;  1Q10 A;  4EOY A;  1EUV B;  1UWX A;  2GBN A;  2RMM A;  2RDH A;  3TEW A;  1DOI A;  3DBS A;  1PGB A;  2FUH B;  1N62 A;  2WXK A;  4A3P A;  2JF5 A;  3UQA A;  1JWM D;  1PYW D;  3CIR B;  2MH7 A;  3AV8 A;  2K8H A;  3AE9 B;  3SDL C;  4S17 A;  4S0R A;  4M8M A;  2L32 A;  3RNG C;  2CU3 A;  2K8B A;  1Y56 A;  5G55 A;  5G2N A;  3RNC C;  4EFO A;  3ZXR A;  4DXF A;  2WS3 B;  3FIL B;  3QAQ A;  3ZNI D;  2KNB A;  1V8C A;  4GLS C;  1EM7 A;  2QHO A;  5TR5 A;  2JSV X;  2PJH A;  3APC A;  3ZJT A;  3ZRF A;  2PE6 B;  3M3J A;  2PPH A;  5CHW A;  2FCQ A;  1JQ4 A;  2PVO D;  1N6Z A;  3V61 A;  2NTT A;  3PVL A;  3AEB B;  2MJD A;  4AWJ A;  3A4S C;  2YEP B;  4DBG A;  2PTL A;  2IO3 B;  2LEK A;  5LXH A;  1JWB D;  5BMI A;  3AEC B;  3N30 A;  1CK1 A;  4Q2J A;  3T9L A;  4GIV A;  1C79 A;  2FCS A;  2KJH B;  4PS8 A;  1J7A A;  2YVC A;  1FNV A;  2I1J A;  3VAW A;  4ITK A;  1QLB B;  2GRI A;  5EE1 A;  1UZX B;  4KV2 A;  3PHW B;  1KH0 A;  3PTF C;  2O6V B;  3U7D A;  1N5W A;  2MP2 B;  3CWI A;  1WJ6 A;  2BBC A;  3VUX A;  1LQB A;  2G3Q B;  3KVF B;  2G4D B;  3URY A;  1VLB A;  4KGS A;  5AEK B;  2KWD A;  2IDY A;  1UBI A;  5TSS A;  1I4Q A;  2PLP A;  2KK8 A;  4HXD A;  2JVC A;  2KLG A;  3AE4 B;  3DHH C;  2NMQ A;  3GB1 A;  3TIX A;  4HRO A;  1E9M A;  4LJP B;  4WQO B;  2WXH A;  4D2K A;  4KGT A;  2KJ6 A;  2L0F A;  2UWQ A;  1WYG A;  1T0R C;  2EMS A;  2BW2 A;  3A9K B;  4GGQ A;  4HLE A;  4MSM B;  2KLC A;  2IGD A;  2KWU B;  4RH6 A;  4JE3 B;  3MC0 B;  2JT4 B;  1E7U A;  4JPS A;  1LO5 D;  2LJI A;  3ZNH B;  4B0E A;  3NRZ A;  2KDF B;  1V97 A;  1WGY A;  2N1V A;  1WY8 A;  5DPS A;  3UIO B;  3I5J C;  1T0Q C;  1GG3 A;  4IG7 B;  3ZTC A;  4W9L A;  3X23 A;  3ZJV A;  4IUM B;  4K3C A;  2O6V D;  2LGX A;  1I4R A;  2JXX A;  4WJQ A;  2GLS A;  3ZTD A;  1BUI C;  5H8Y E;  5H92 C;  2WXF A;  3BK1 A;  3VR9 B;  1D3Z A;  1MI0 A;  2BYF A;  1R4M B;  2BPS A;  3IFW B;  4A55 A;  4ZRI A;  4YT0 B;  1OTR B;  1IYF A;  2BQQ A;  5KHQ A;  4MDK E;  4LNO A;  1V1P B;  3R3M A;  4DXA B;  4MT5 A;  1WSP A;  4E74 A;  1IGC A;  1ROE A;  1XEE A;  1NYR A;  3TMP B;  1UGJ A;  4US9 A;  3VDZ A;  5HI1 A;  3P4S B;  4OZC A;  1XLQ A;  3A4R A;  4XWT A;  4OZB A;  2WDR B;  4YL8 A;  2J0K A;  4HDO A;  4DQO C;  2FIF A;  2LUE A;  2BYE A;  3AE1 B;  3WAP A;  3BVG A;  4BKG A;  2BKF A;  2LXA A;  3N3K B;  4MM3 B;  1FPY A;  3DBR I;  2NS5 A;  3Q8A A;  5IA7 A;  1D6E C;  1K51 A;  3HM6 X;  3I63 C;  3TEZ A;  2MQJ A;  3U7Z A;  1UF0 A;  1IP9 A;  3IG3 A;  1P1A A;  4P1B C;  3PT2 B;  1JRP A;  4K3B A;  1QT9 A;  1SSN A;  4B95 A;  1AAR A;  3U4E G;  1V80 A;  2JWU A;  2PVG C;  4PS7 A;  1VR9 A;  2V9H A;  2LRW A;  3EFC A;  4YSZ B;  3B0A A;  1KFY B;  3W5V B;  3OJ4 B;  1XXG A;  1Q5W B;  2ZW0 A;  3ZLZ A;  5AZH A;  1N5X A;  1P9D U;  3Q8E A;  3OLM D;  4LNI A;  4DDG D;  2G9H D;  4W9H A;  3RCZ A;  2LWP A;  4LDT B;  2IND C;  3VH4 B;  3AI5 A;  2CJO A;  1F2R C;  5JH5 C;  1PGA A;  2D3C A;  2DHZ A;  2M0X A;  4HWI B;  3Q3F A;  1OEY A;  5BMG A;  1B9R A;  2M56 B;  3GE8 C;  5MPO A;  4A6Q A;  4EZK A;  1R4N B;  1SE2 A;  2WWZ A;  3VUW A;  2AL6 A;  1XCQ L;  2YEP F;  1XLP A;  4MGK E;  1K53 A;  1V5T A;  4DK5 A;  4EEW A;  4MJS A;  3PLU A;  4OVZ A;  1X1M A;  3B2G A;  1JW9 D;  3DQV A;  1V49 A;  3HHM A;  1E5W A;  4GDL A;  1YMH E;  3H7S A;  3VUY A;  3B1L X;  4C7Y A;  4K1R B;  1A5R A;  4NQL B;  2JPH A;  1E8Z A;  1HTO A;  1F2R I;  2W9N A;  5T8I A;  3RI7 C;  1ZDX A;  5FR6 A;  3AUL A;  4XGA B;  2KMA A;  4XC2 A;  3ZDT A;  4BKS D;  4HVB A;  4A8X C;  3BY4 B;  2Z59 B;  2WP9 B;  2G45 B;  2AQ3 B;  4AP4 C;  2KTR A;  2L52 A;  2NVU I;  5KHO A;  1NDD A;  2LVQ A;  3PRZ A;  2MBH A;  3MC8 A;  4W9K A;  1YJ1 A;  1SIF A;  5LXI B;  1WI0 A;  2WXR A;  2PW9 A;  3PLV A;  3ZIM A;  1FO4 A;  2LGD A;  4KSK C;  3U52 E;  2KC2 A;  3LDZ E;  2HJ1 A;  1I4P A;  1OQY A;  1I4G A;  3VTV A;  2O6V A;  2IGG A;  4J6I A;  1E8W A;  2ON8 A;  2MP2 A;  3SFD B;  3P42 A;  1JWU D;  2BS3 B;  2Q5W D;  2DZK A;  2L76 A;  4HDQ A;  4L23 A;  4TQ1 A;  2K6Q A;  2KYW A;  1EO6 A;  1HZ6 A;  2SAK A;  5BO4 B;  4GB9 A;  4LNF A;  2D3G A;  3DWG C;  1IBX A;  4LJO B;  3RNF C;  1AN8 A;  3QQ8 B;  3D32 A;  2JYT A;  2FBW B;  4KIK B;  1IUE A;  3QC8 B;  4IKG A;  2I38 A;  4WUR A;  2J42 A;  3PO0 A;  4W9J A;  5IP4 D;  3AH7 A;  1E8Y A;  4GDK A;  4JQW C;  4PT5 A;  3ZUN A;  2D2Q A;  1V1O A;  4RM8 A;  4J3O D;  1WGR A;  1LM8 B;  2HJ8 A;  1C4P A;  1I4H A;  2IO0 B;  2V3P A;  3H9D A;  2JX5 A;  3H1U A;  1WE7 A;  1LGR A;  2RSU A;  4EUT A;  3RT3 B;  3EFU A;  2K3U A;  1L0X B;  1TT5 B;  2NTS A;  4WAF A;  1WJU A;  1V6E A;  2KFJ A;  2MBB B;  4P1C C;  5D6J B;  3IBE A;  2INN E;  2D3A A;  4M8N A;  5IO9 A;  3VRB B;  3EUB 2;  2LI5 A;  2FE8 A;  4L2Y A;  2NBU A;  1GC6 A;  2MBE A;  1A70 A;  3KYD D;  4ZRQ A;  1OQQ A;  1YN5 A;  4KKJ A;  2PE9 A;  2BKR B;  2LHD A;  5C2T B;  1WFY A;  2QIE B;  1STE A;  3K9O B;  2Z0D B;  3DVN V;  1FRR A;  1E10 A;  2X38 A;  4M0W A;  3DVG X;  1ZUD 2;  1TS2 A;  2LD9 A;  3APD A;  1WGK A;  2NPT A;  4I6L B;  2C7M B;  3NZU A;  3VVW B;  1DYQ A;  3APF A;  1QOB A;  4CHK A;  1ZGU B;  2PEA A;  4ICV A;  2BT6 A;  4II3 B;  2WXN A;  2WXI A;  2W3S A;  1CZP A;  1TJE A;  4KX6 B;  3ABV B;  3EGR A;  3V6E B;  4F8C B;  1LFD A;  4NPN A;  4K7U A;  4NJC A;  1FCC C;  3SR6 A;  4JWU C;  4A9A A;  1H8C A;  1TZ1 A;  1XLO A;  3EHV A;  3WAO A;  3T8M A;  5HG2 A;  3NOB A;  4PS3 A;  4G3X B;  1C77 A;  2IY0 B;  2OED A;  3A1Q A;  3NZS A;  5IOI A;  5HFY A;  1WM3 A;  2LGS A;  1OEY J;  2WDQ B;  3ZNG C;  4RF1 A;  3T3O A;  1HXY D;  1OGW A;  2WHI A;  4BKS A;  5J2R A;  2AYO B;  1MPE A;  3N9Y C;  4PYZ A;  2DZI A;  2FUG 1;  2JZP A;  4L1B A;  4OVU A;  3RZW C;  1FXI A;  1BT0 A;  2DYB A;  2JY6 A;  2RDB C;  3BIN A;  4KZ0 A;  4X57 B;  2KVZ A;  4RM9 A;  1AW7 A;  3FC4 A;  4NJ6 A;  3BYT B;  1NEK B;  3I9V 1;  2QCZ A;  3N1X C;  1D5X C;  4CQN A;  2C60 A;  3KYC D; 
#chains in the Genus database with same CATH homology
 1ET9 A;  1LO5 D;  3J9C A;  2LJI A;  3IT6 B;  3AB5 A;  3AE7 B;  5BMH A;  1TY2 A;  1YN3 A;  2QSD A;  3SEB A;  4B0E A;  2KQ4 X;  2INP E;  3NRZ A;  4NAM A;  4ZRP A;  1V97 A;  2KAJ A;  3SFE B;  5D3D A;  1GB4 A;  5D7G A;  4C80 A;  4ZOH C;  1SIJ A;  2B76 B;  4OHJ A;  1WWT A;  3ZJV A;  1N63 A;  1HQR D;  3Q8F A;  4DXG A;  3R2T A;  1VZ8 A;  1I4R A;  1EU4 A;  2PIA A;  3U2S C;  2XN9 C;  1BUI C;  5H8Y E;  5H92 C;  2WXF A;  3BK1 A;  1TS4 A;  3VQI A;  4GDL B;  2BYT A;  3VR9 B;  4AS1 A;  1TYG B;  1SE4 A;  4XDD A;  3AMZ A;  1MI0 A;  3TEX A;  2KMM A;  1XCT L;  2RDG A;  4YSY B;  4NZL B;  3HUI A;  1NI3 A;  3ZYY X;  4HRS A;  3TEY A;  3FIL A;  3NVV A;  1JAL A;  1CQV A;  1P7F A;  4A55 A;  3P4P B;  1P7E A;  4O1N A;  4YT0 B;  2QJL A;  2VZK D;  1PUT A;  1C76 A;  1L4D B;  4WWM A;  1ZE3 D;  4XWW A;  1V1P B;  3E9S A;  3W9C B;  4MT5 A;  3BVM A;  2IGH A;  1WSP A;  5BYQ A;  4ZYS A;  1IGC A;  1UNS A;  1ROE A;  1XEE A;  1NYR A;  5BYR A;  4TQ0 A;  5D3I B;  3NVY A;  2W3R A;  5FK9 C;  1UGJ A;  4US9 A;  2Z8L A;  5HI1 A;  2AQ1 B;  3P4S B;  2DBY A;  3P63 A;  4OZC A;  2J53 A;  1ACC A;  1XLQ A;  3R8B A;  4XWT A;  3Q8C A;  2WDR B;  4OZB A;  1KLG D;  4UDU C;  3IAS 1;  2WXM A;  2K5P A;  4RCO A;  4REZ A;  4OW0 A;  1C9F A;  3KLS X;  4DQO C;  1MHH E;  4N6E B;  1I4X A;  4RGM A;  2K0P A;  1TKE A;  3AE1 B;  5G5G A;  3BVG A;  3W2D A;  1FMA D;  4MAC A;  5G5H A;  3WCQ A;  4MM3 B;  1XLN A;  3Q8A A;  3ZQ4 A;  1D6E C;  2Y5P A;  1K51 A;  3W5U B;  3V05 A;  4TMA B;  1GPX A;  3TEZ A;  3BVZ A;  3U7Z A;  4C56 C;  2WU2 B;  1SE3 A;  2WXQ A;  1RM6 C;  1D5M C;  1QQR A;  4OZA A;  1YJJ A;  2E6X A;  1JRP A;  1PGX A;  1QT9 A;  1SSN A;  2VZK B;  2JYE A;  3ETR A;  1SXT A;  3P4R B;  4N58 A;  3U4E G;  1DOX A;  2JWU A;  2PVG C;  1VR9 A;  3VR8 B;  1IBX B;  4TSS A;  5HHD G;  1QIL A;  2Y5C A;  3T3N A;  4YSZ B;  3TSS A;  1VJK A;  1KFY B;  4WIP A;  1SEB D;  2IPK D;  3OWE B;  1ZXI A;  3BII D;  3W5V B;  2K9X A;  1SJH D;  2WXO A;  1ENF A;  1VZ7 A;  3GS2 A;  1XXG A;  4P16 A;  1T5X D;  3AED B;  1C78 A;  2RPV A;  1E7P B;  2ZW0 A;  2N9L A;  3KWV A;  1N5X A;  2WXP A;  1GOZ A;  4KKI A;  4YTM B;  5JXV A;  2W55 A;  3Q8E A;  5FKA C;  1OFF A;  2TSS A;  4HJG E;  4GDK B;  3ZGZ A;  4LK0 M;  5EE0 A;  2G9H D;  4RNA A;  4LLG M;  4HKZ E;  1PFD A;  3NVW A;  1ZPS A;  4A90 A;  2CJO A;  1F2R C;  5E6J A;  1PGA A;  5AUI A;  4WH4 A;  1BXT A;  3BYY B;  4ZHP A;  3KWL A;  2D5G A;  1FD6 A;  1K50 A;  1C4C A;  5BMG A;  3AM9 A;  1L6V A;  1B9R A;  1N61 A;  2M56 B;  5EE9 A;  2Y3A A;  2XNA C;  5MPO A;  3GP7 A;  3LYY A;  3AE5 B;  2I2Y A;  2QIL A;  4A6Q A;  1SE2 A;  3BZD B;  2EKI A;  2BTE A;  1QOF A;  5AUK A;  1JCK B;  3AE8 B;  3HVZ A;  1XCQ L;  2E3T A;  1QKZ A;  4B0M A;  3Q8B A;  5EE3 A;  3P1M A;  3H8H A;  2YEP F;  1XLP A;  1K53 A;  1TZO A;  2W54 A;  1KF6 B;  3MHZ A;  1FM0 D;  2M0A A;  4OVZ A;  5C3J B;  2EEL A;  1NVI D;  3AEF B;  3B2G A;  1JW9 D;  1JWA D;  3I57 A;  4RGN A;  1VZ6 A;  1YMH E;  2J4X A;  3Q69 A;  1YJI A;  4C7Y A;  5GXG B;  1F2R I;  1VRA B;  1YN4 A;  3W1S A;  5T8I A;  3FAH A;  1CJE A;  4US8 A;  1ZDX A;  2WXL A;  3BWU D;  1R7S A;  2QMT A;  2LHE A;  1KLU D;  4AQ7 A;  2WU5 B;  4A8X C;  1V1P A;  2W82 A;  2WP9 B;  1SBB B;  4XE0 A;  2AQ3 B;  2GB1 A;  1TKY A;  4IDI A;  1FNW A;  2L52 A;  3VRA B;  4ZHO A;  3ZJU A;  3RFZ B;  5I4D A;  2DYO A;  2KDM A;  1EWY C;  2L1A A;  2WNM A;  3DWM A;  4JWS C;  2MJE A;  3P4Q B;  2AQ2 B;  3LB8 C;  1FNU A;  2WXR A;  1EU3 A;  2PW9 A;  2SEB D;  2JQR B;  3AN1 A;  4LTU A;  4C7Z A;  4KGR A;  4P6V F;  3RPF C;  1FO4 A;  3U52 E;  4YTN B;  1JRO A;  1FXA A;  2LFI A;  3LXF A;  2PKO A;  2PMV A;  1I4P A;  3PZ7 A;  1L4Z B;  1I4G A;  1RFK A;  2DLB A;  2IGG A;  1KTK A;  1M4V A;  2IJ0 A;  1L0V B;  3MFG A;  2ON8 A;  2LGI A;  4YXD B;  2BS2 B;  1JWS D;  3SFD B;  1AWD A;  2KN4 A;  3P42 A;  1FIQ A;  1JWU D;  2BS3 B;  2Q5W D;  1ZXH A;  1FFU A;  4L23 A;  1N60 A;  1IGD A;  4HEA 1;  4TQ1 A;  4USA A;  1K52 A;  1GAQ B;  2CJN A;  2G1E A;  1MHX A;  2K22 A;  1E6E B;  3BK2 A;  1HZ6 A;  3B9J A;  3KQ4 A;  4R3D A;  1SJE D;  1ZOY B;  1TKG A;  2SAK A;  1HZ5 A;  1L5P A;  1F0Z A;  3DWG C;  3O13 A;  1FFV A;  1C4A A;  3AEE B;  1IBX A;  2R61 A;  2H88 B;  2L83 A;  3AEA B;  3L4P A;  1AN8 A;  1SB3 C;  2JYT A;  1ET6 A;  1WRI A;  3E56 A;  1E0Z A;  4FXC A;  1OQR A;  3C8Y A;  2WXG A;  2FBW B;  1RWS A;  4YSX B;  1IUE A;  1ZDV A;  1WXQ A;  1NYQ A;  4HKQ A;  1HA5 A;  2LUM A;  2ZW1 A;  2V0G A;  1J7B A;  5BYS A;  4NAW B;  1SF0 A;  1PDX A;  4IKG A;  2I38 A;  4WUR A;  5LNK 1;  2J42 A;  1D4B A;  1Q10 A;  3PO0 A;  4ARC A;  1UWX A;  2KAC A;  3AH7 A;  2LMC A;  1AYF A;  1DGJ A;  4PT5 A;  2RMM A;  2RDH A;  2ONQ A;  3IXS A;  1DOY A;  1V1O A;  3TEW A;  3UI3 A;  1DOI A;  1XF5 L;  4J3O D;  2BB6 A;  1F77 A;  1C4P A;  1I4H A;  4H2A A;  2V3P A;  1KRH A;  1PGB A;  2JX5 A;  3AE6 B;  2BS4 B;  3HVD A;  1FRD A;  2GI9 A;  1N62 A;  2WXK A;  1GB1 A;  2ACZ B;  4EE2 A;  1JWM D;  3MJ5 A;  4WQM A;  1PYW D;  2K3U A;  1L0X B;  3CIR B;  2MH7 A;  2NTS A;  3AV8 A;  4WAF A;  3AE9 B;  2ICI A;  4XDC A;  3NS1 A;  2L32 A;  2QEJ C;  2WQY B;  1J7C A;  2CU3 A;  4N59 A;  3MP9 A;  1MVK A;  2INN E;  1Y56 A;  3VRB B;  2MJ3 A;  3EUB 2;  3R2I A;  1EWC A;  2N7J A;  1YQ3 B;  4DXF A;  2FE8 A;  2N0S B;  1NEN B;  1QOA A;  2WS3 B;  3FIL B;  4L2Y A;  4RGT A;  4RGO S;  1VDV A;  1V8C A;  4GLS C;  1EM7 A;  2JSV X;  1RYJ A;  1TY0 A;  3HRD D;  3ZJT A;  1XO3 A;  2AX5 A;  2HTM E;  1A70 A;  4ZRQ A;  4ARI A;  1JQ4 A;  1OQQ A;  1YN5 A;  4KKJ A;  2PVO D;  2LHD A;  5C2T B;  2NTT A;  2QIE B;  3AEB B;  1STE A;  2J52 A;  3AEG B;  2DYM A;  3NVZ A;  2MJD A;  1QOG A;  1UUP A;  2YEP B;  2PTL A;  1FRR A;  2LEK A;  2X38 A;  3EA6 A;  1JWB D;  2N9K A;  4M0W A;  5BMI A;  1E10 A;  3NZ3 A;  3AEC B;  1ZUD 2;  2MEK A;  1BML C;  1ESF A;  1CK1 A;  1TS2 A;  4Q2J A;  2V4I B;  3NUH B;  1T6B X;  2BB5 A;  1WGK A;  1C79 A;  4RFB A;  1ZP0 B;  3TUO A;  3IAM 1;  2HDE A;  3AE3 B;  1J7A A;  3B2F A;  2DWQ A;  2WDV B;  4MH8 A;  1FNV A;  1HEZ E;  1YNT E;  4ITK A;  1QLB B;  2GRI A;  3IT4 B;  1DYQ A;  5EE1 A;  1QOB A;  1QF6 A;  3PZ8 A;  2JXT A;  3AE2 B;  4RF0 A;  1TS5 A;  2OHF A;  2BT6 A;  2WXN A;  1KH0 A;  1YQ4 B;  2WXI A;  2W3S A;  1CZP A;  1TJE A;  4YTP B;  4KX6 B;  3ABV B;  1I7H A;  3V3X A;  3EGR A;  1N5W A;  2JU6 X;  4NJC A;  3CWI A;  4IOI E;  2BBC A;  1FCC C;  3SR6 A;  4JWU C;  4A9A A;  3URY A;  1VLB A;  1XLO A;  4KGS A;  1T3Q A;  4JX1 C;  2KWD A;  5HG2 A;  2IDY A;  2WLB A;  5TSS A;  1I4Q A;  1C77 A;  2OED A;  2PLP A;  5HFY A;  2WDQ B;  3AE4 B;  2NMQ A;  3GB1 A;  4RF1 A;  4HRO A;  3T3O A;  1E9M A;  1HXY D;  2V3N A;  1D5Z C;  2WXJ A;  2WXH A;  3N9Y C;  1MPE A;  4D2K A;  4KGT A;  2FUG 1;  2JZP A;  1L6U A;  2H89 B;  4L1B A;  4YWG G;  1WYG A;  1JML A;  1FXI A;  1UWM A;  1B1Z A;  2BW2 A;  1L0Y B;  5FR3 A;  1TS3 A;  1AW7 A;  3FC4 A;  3BYT B;  1NEK B;  2IGD A;  3I9V 1;  4RH6 A;  2M19 A;  4JE3 B;  1D5X C;  4CQN A;  3MC0 B;  1FCL A;  1FEH A;  4JPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...