3BIID

Crystal structure of activated mpt synthase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
80
structure length
80
Chain Sequence
MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a molybdopterin synthase-precursor Z complex: insight into its sulfur transfer mechanism and its role in molybdenum cofactor deficiency.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Molybdopterin-converting factor subunit 1
total genus 22
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2007-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3biiD00
2M56B 2MJDA 1L5PA 1AWDA 1J7AA 1ZXIA 3BIID 1ZOYB 1FXIA 1NEKB 2LEKA 2MJEA 2WDVB 2WU2B 2CU3A 3LB8C 4KX6B 2BS2B 4N59A 5MPOA 1RYJA 1DGJA 3NVWA 1FRRA 1SIJA 1FM0D 3P63A 4JWUC 1QF6A 4C7YA 1N5XA 3AB5A 1AYFA 3AEGB 2ACZB 2L52A 1QLBB 1PFDA 2OHFA 4WWMA 1NENB 4YSXB 1WYGA 2FBWB 1XLQA 2WQYB 1NYRA 1TKGA 1QT9A 1JW9D 1YQ4B 5EE0A 5H8YE 2H88B 2BT6A 1QOFA 1FXAA 1L6UA 2N0SB 3FC4A 3AEFB 4YSZB 1FRDA 3W9CB 2PKOA 2EKIA 1PUTA 2PIAA 4N58A 1N5WA 1QOAA 3AE4B 1N63A 1JWBD 3P4SB 5C3JB 2DBYA 2K22A 3AE6B 1CZPA 5H92C 3W5VB 2DWQA 2M19A 1KRHA 5GXGB 4US8A 1F0ZA 3ETRA 4WQMA 2W54A 3CWIA 2PVGC 3HVZA 2W3RA 3ABVB 4YT0B 2WP9B 1E9MA 1UWMA 1WGKA 2QJLA 2KAJA 1FFUA 3AE8B 4YTMB 1E6EB 3P4RB 4HRSA 1DOYA 1OFFA 3CIRB 5AUIA 4YTPB 3SFEB 2CJNA 1QOBA 1B9RA 2Y5CA 1JROA 2G1EA 3P4PB 2BS3B 1NI3A 5G5GA 1V8CA 3AEAB 3NVZA 1A70A 1VJKA 1KFYB 2K5PA 3EUB2 2L83A 1N62A 3AEDB 3HUIA 2MJ3A 2WLBA 1E0ZA 1TKYA 1KF6B 5C2TB 3B9JA 1IUEA 3L4PA 1XLOA 3AE7B 1WXQA 3B2GA 3KWLA 4P6VF 1FO4A 3AEBB 2WDRB 1ZP0B 3AECB 1DOIA 2K9XA 5AUKA 1RFKA 1VLBA 1ZUD2 3B2FA 4JWSC 3VR9B 1E7PB 3ZYYX 3P4QB 3DWMA 2W3SA 2H89B 4ZHOA 2BS4B 3NVVA 3AMZA 4N6EB 3RPFC 1JRPA 3WCQA 2CJOA 4YSYB 2QIEB 3DWGC 1QOGA 1R7SA 1YJIA 1E10A 3P1MA 3SR6A 4ITKA 4C7ZA 4ZHPA 1ROEA 2MH7A 5EE3A 1WRIA 3FAHA 1DOXA 1CJEA 2JX5A 3AE5B 1RM6C 4C80A 1XLPA 4ZOHC 5EE9A 1NVID 1JALA 1JWAD 1L6VA 3NRZA 3VR8B 1N61A 1GAQB 2B76B 3NS1A 1TYGB 1YJJA 1V97A 4YTNB 1FIQA 4US9A 3AEEB 5EE1A 2E3TA 1GPXA 3AE1B 1EWYC 1T3QA 1N60A 1YQ3B 5G5HA 3VRBB 1L0VB 2HTME 2W55A 4USAA 1FMAD 2KMMA 1SF0A 2PVOD 3VRAB 4HROA 3AM9A 4YXDB 3HRDD 1OQRA 3AE2B 3AN1A 4A9AA 2WU5B 3NVYA 2Q5WD 1FFVA 2WS3B 1J7CA 2JQRB 1VDVA 1JQ4A 3AV8A 1J7BA 1WWTA 3AE3B 4FXCA 1OQQA 1SB3C 2WDQB 1PDXA 4JX1C 3W5UB 4IDIA 1NYQA 3AE9B 3AH7A 3LXFA 1RWSA 1TKEA 1I7HA 3SFDB 2AX5A 4LTUA 1TJEA 1XLNA 1XO3A 3PO0A
chains in the Genus database with same CATH superfamily
2WDVB 3TBLD 4EEWA 5IN7A 1IPGA 1RYJA 1ZGUB 1FRRA 3ZNHB 1EU3A 3H7PB 4K3BA 4ZRIA 2JSVX 1WJ4A 2ACZB 4K7WA 1OEYA 3ZXVA 4GDKA 1QT9A 5BMHA 3BVZA 2EELA 3FC4A 3AEFB 4YSZB 3EECA 2K6QA 2MRPA 2EKIA 2PIAA 2OJWA 1ZE3D 4JE3B 4HWIB 4G11A 1P7EA 1XCQL 2MBOA 2J53A 2W54A 1PQSA 3HVZA 1OFFA 1B9RA 1GUAB 2JZ3B 2SEBD 2LVQA 1RLFA 2AQ2B 3AEDB 4NZLB 4OVVA 1P3QU 1KF6B 3L0WB 4F1SA 3EA6A 4CYEA 2WDRB 2W3SA 2H89B 4KSLC 2K0PA 3FILB 1UZXB 1SSNA 2LUMA 2KANA 3NZUA 4EZLA 1E10A 3SR6A 2KFKB 2WGSA 4XC2A 4BBNF 1FD6A 3RFZB 1CMXB 1PGBA 1GNUA 5AZFA 3N20C 2RMMA 2XK5B 2BQQA 2WXPA 4RGNA 4ZRPA 1VD2A 2UWQA 3VRAB 2W9NA 2NCNA 2R2OA 3AE2B 4PK1A 2N1VA 3T9LA 4XWWA 1YQBA 2Y5PA 2WXFA 3AE3B 2HJ8A 4RF1A 2IZVB 1KFYB 3L13A 2KFKA 1ZOYB 3HM6X 2CU3A 1ISNA 3EHVA 2G4DB 3I9V1 5CX3A 4BOZB 2MWSB 4ZDVA 3SHQA 2NTTA 1DYQA 2LJ5A 3BK1A 1PFDA 2OHFA 1VZ7A 2KVRA 3ML8A 4YSXB 4IUMB 3MC9A 3R66C 3RZWC 3GE3C 4LNNA 2XEWA 2JT4B 3C0RB 3HK0A 1TS4A 4G50A 3NS8A 3UI3A 4KGTA 2GBKA 1J0GA 3EC8A 3DHGC 2KVZA 2XN9C 3B1LX 2CU1A 4RF0A 1P7FA 3BY4B 4CQNA 2L0TA 1FPYA 4R3DA 2INCC 1ZDVA 2WP9B 1FFUA 1WRDB 4OZCA 2EMSA 1E8XA 3CIRB 3KQ4A 1WYWB 5DPTA 2IO2B 3UIOB 2BS3B 4MM3A 1C9FA 1EWCA 2K6DB 2MP2A 4HKQA 4KDLB 5C2TB 4IM3A 3TEWA 4XE0A 3B2GA 4W9KA 5HKHA 3SU8X 3BYTB 3DWGC 2Z0DB 4K1RB 3BWUD 4OW0A 5EE3A 3FAHA 1XLPA 1IYFA 4FADA 1V86A 2L05A 3NS1A 1S1QB 1ET6A 2QCZA 3P42A 2KACA 1K50A 3QJZA 1YQ3B 2PJHA 2O6VB 2IO0B 4IC7B 3A9KB 2WU5B 1IGDA 2L32A 5HHDG 1EO6A 1S3SG 2WX0A 4HJGE 4FXCA 3ZNZB 5C1ZA 1OQQA 1FEHA 2QC8A 3PV1A 1I4GA 2LEKA 4BAXA 2DYBA 2L52A 2DYMA 2NMQA 3RYTA 2YVCA 4QAYA 4OZBA 4WJQA 1WY8A 2Z59B 4UDUC 2N9XA 2D3GA 1WH3A 2ZJDA 2L7RA 1YIWA 4HCPB 2HD5B 5GXGB 1L2NA 2QSDA 2JYEA 3CWIA 2W82A 1H4RA 2QMTA 4KIKB 1MFWA 3RUIB 2KOXA 4HXDA 2Y5CA 1JROA 1JMLA 2LASA 3Q14C 4PS7A 3UF8A 3ZQ4A 2PPHA 1E0ZA 1D3ZA 4DHZB 1FCLA 4J6IA 4AJWA 3PREA 5D3DA 1I35A 2L00B 1TS3A 2C7NB 4LJPB 2DLBA 1ZKHA 2MH7A 3TSSA 3V6CB 1XT9B 2JX5A 2JWUA 1F9JA 2DX5B 2K25A 2N7JA 4NJCA 1WGGA 3C8YA 3ZXRA 3NRZA 4AWJA 1MG8A 3KLSX 3C19A 2I38A 4MGYE 4IWPA 5L95C 3A9JA 1YMHE 1OQRA 4IOIE 2INPE 3ZUNA 4RGMA 3NVYA 5CHWA 2KNBA 1PDXA 2Z8LA 2AX5A 1TTNA 3RNGC 2AYOB 1FNWA 1F52A 4DQOC 1DGJA 3N1ZC 4KGSA 2FUHB 3JW0X 1L4ZB 1WGYA 3MJ5A 3PGEA 2WXLA 3DBLB 2D2QA 1KJTA 4C00A 4K7UA 1N5WA 2SAKA 1HTQA 3IAM1 1U4AA 2LVOA 1GC6A 1RFAA 1OGWA 3ABVB 5TR5A 2O6VA 1E6EB 1V6EA 2A4ZA 2KX3A 4RFBA 2FUG1 5G2NA 2KDMA 2WLBA 4E3CA 4LCDE 4K3CA 2KJHB 3L4PA 1RAXA 1XLOA 4W9GA 3KWLA 3W1SC 1WE6A 1VLBA 2N9EB 2MX2A 5BMIA 1XEEA 2MSED 4GU2A 2CJOA 4KZCA 1JWMD 1WJNA 4J3OD 1T0SC 2BYEA 2NS5A 3OWEB 1DOXA 2GB1A 4ZOHC 2D5GA 5EE9A 1NVID 2HE7A 2BYVE 3APDA 2N7DA 1T3QA 3PRPB 1AARA 2CHWA 1SF0A 3R7RA 3WAOA 1WSPA 4X57B 2N4FA 2G3QB 2OOBB 5G55A 4JLCA 2JQRB 1WXVA 2KC2A 4EKUA 1SB3C 4XYCA 2NPTA 3PHXB 3I63C 1ZDXA 1TJEA 1AN8A 3BIID 3N3KB 1SIJA 3P63A 4DHJB 2ZPNA 5D7GA 3RN9C 3CSTA 4FN2A 2JF5A 2KMCA 2WQYB 1D6EC 2FCNA 5EE0A 2H88B 1WE7A 2N0SB 3LDZE 2FCQA 1CQVA 2GBMA 2JY6A 1ACCA 1JWBD 3TL5A 2WXIA 3ZLZA 3Q8AA 2WXHA 3AU5A 2R2QA 3MP9A 4ZRJA 1UWMA 2KAJA 3E9SA 4FJYA 5E6PA 1SIFA 1KLVA 1NI3A 2N9LA 3A1QB 1Y56A 3X0WA 1KOTA 2LD9A 4ICUA 3TUOA 3QK0A 3VH4B 3AEBB 4MH0E 3CSFA 2IGDA 2D10A 3DWMA 2ZNVB 3RPFC 1JRPA 3H1UA 2FIDA 3P1MA 2MP2B 1BXTA 2ON8A 4A6QA 1BUIC 1T5XD 1TYGB 3BVMA 4F7ZA 2W55A 4DHJD 3T8MA 5L83A 4NAWB 2JRIB 1F2RI 3X23A 1QILA 4OZAA 5DPRA 1XD3B 2IDYA 4HPPA 2VZKD 1YJ1A 1IBXA 1NYQA 1GG3A 1OQYA 3ZO5B 2M56B 2RPVA 1J7AA 2KJ6A 4NPNA 1LM8B 4BKGA 2IGGA 4URKA 2FE8A 3IFWB 2QEJC 2AQ1B 2LRWA 1WYGA 3H7SA 3WIMA 5JHBA 5D6JB 3KH0A 2DZJA 4M0WA 2WX1A 3U52E 1P0RA 4AQ7A 3T3OA 5D94A 4M8NA 1QOAA 1T0QC 1STEA 2RDGA 3WAPA 2G45B 3PRZA 2KYWA 4PS3A 2KDEB 4B95A 2W3RA 3DBRB 4LLGM 5AUIA 1IGCA 2M17A 1JRUA 3ONSA 5G5GA 1V8CA 4WH4A 2LXAA 2KWUB 1VJKA 3I3TB 1M4VA 2K5PA 3EUB2 2L83A 4GSWA 2EMTA 4JPSA 4ICVA 2KLCA 2X8XX 1RFKA 4RGTA 2GBJA 3ZDTA 3Q69A 4XZ4A 4ZYSA 1HXYD 3OJ3A 2GLSA 4P16A 1TS5A 3SEBA 3WANA 4EOYA 2WHIA 1WGRA 4TQ0A 4B0MA 1CJEA 4B6WA 3ENEA 3BZDB 2RSUA 4KGRA 3NY5A 1B1ZA 2KKCA 2B3AA 1JWAD 2C7HA 1N6ZA 2BBCA 4YTNB 3R2TA 1LQBA 2K39A 3KUCB 4A20A 3LJ3A 2KMMA 3GZNI 3HM3A 3O65B 3HRDD 4LK0M 2M0XA 4BKTA 2D11A 2WXRA 5FR6A 2LWPA 3FKYA 4E74A 4PYUA 2DHZA 3W5UB 4MH8A 2FBWB 4WAFA 2JRHA 1WM3A 1AWDA 4P1BC 1WX9A 4KV2A 5GMVA 3ZNGC 1SBBB 2MQJA 4WWNA 4GDKB 3AU4A 5HG2A 2BB6A 3R3MA 1XLQA 1TKGA 2BPSA 1JW9D 2BT6A 4HDOA 2LHEA 4B0EA 3GOEA 4XWTA 4MM3B 4M8MA 1C4PA 1PUTA 1EU4A 2BYFA 2DZKA 4N58A 2FNJB 2JVCA 4II2B 1H8CA 2G9HD 1QZEA 2IO1B 1F2RC 4GN1A 3U7ZA 3WALA 2C5LC 4GB9A 3ETRA 3OG5A 1SE9A 3ZJUA 1WXMA 1FNVA 4CO7A 2KTRA 4GDLA 4NJ6A 3MHZA 3DVNU 2LGDA 1V5OA 4NJ7A 2C7MB 4WWOA 4TSSA 1Q5WB 4HKZE 3QWZB 4LNOA 4WIPA 3KVFB 1J19A 4MJSB 2KJRA 4FA6A 4P1CC 3ZYYX 3N9YC 3BINA 2RDBC 4O1NA 2XNAC 3IVFA 5FR3A 2ZEQA 4IM0A 1YN5A 1WRIA 3H9DA 4II3B 3U7DA 1RRBA 4HPLB 2YEPF 3VUWA 1V1PA 2M8SA 5HI1A 4YWGG 2LUEA 4TV3A 1UD7A 2HTHA 1EUVB 1LXDA 3OJ4B 1SGHA 2IPKD 3ZDMC 2KX0A 4JX1C 4EZJA 3SD5A 3JSVB 4MGIE 4LNFA 1WZ3A 1WIAA 2MCNB 3QCAA 5IO9A 2WU2B 3UINB 5MPOA 4IG7B 5LXHA 4JWUC 1FM0D 1Q1OA 1Z5SB 4LDTD 3ZVVA 2BWFA 4A90A 4C4VA 5C23A 3AI5A 4ZYNA 4E71A 2ZNVC 2X38A 1T6BX 1FCCC 4G0NB 1FRDA 1JWUD 3W9CB 3DBHB 2PTLA 2DENB 3GE8C 3Q3JA 4F8CB 2IGHA 2ZZPB 3W5VB 3JVZX 3N1YC 1CK1A 5TSSA 4FULA 3Q3MC 1E9MA 1WGKA 4MT5A 4YTPB 2VH1A 2MHJA 2Y3AA 1A70A 3Q2AC 4BBNC 3IHPC 1ET9A 4FHJA 2BGFA 4ASWC 3AE7B 2ZCBA 1E8YA 3VUYA 1DOIA 1D5XC 3ZNID 4TKNA 1SJED 1YD8U 3RNAC 1UBIA 2PE9A 3CF6E 3NUHB 1C3TA 2UU7A 2D3CA 1KM7A 2BTEA 4AP4C 3MHSD 4D2KA 4MELA 2JZZA 5EE1A 1MJDA 1JWSD 3VRBB 1L0VB 3VTWA 5CTRC 4DDGD 2GMIC 3R8BA 3ZTDA 2K8HA 3NZ3A 1G6JA 1TZOA 3TEXA 4DHZE 3AH7A 2K1FA 4AJYB 5BMGA 2O2VA 2JWZA 2N9PC 4ANXA 1FXIA 1NEKB 3RNFC 1K52A 2BS2B 3NVWA 1UGMA 4C4VB 3PS6A 2V3PA 1V2YA 4M00A 5LLIA 1PGAA 4M01A 3A4RA 1ENFA 1E7UA 2M0AA 2DWQA 3OAWA 3DBRI 4HCNB 1YN3A 4XDDA 2KHWB 4JIOU 3RNCC 3W2DA 4RM8A 4YT0B 2J7QB 1F1HA 1MI0A 3V60A 4REZA 1A5RA 3K9OB 4NNJB 3DBLI 2E6XA 3IT4B 4P6VF 2V4LA 3IXSA 3DOWA 3VH3B 2KZRA 3AECB 2I1JA 4WWPA 1WGHA 3Q3NC 5JXVA 3DQVA 4ZHOA 2LVPA 4N6EB 3UGBB 1LFDA 1YJIA 1R7SA 4TQ1A 2RR9A 4XDCA 3V3XA 1RM6C 5E6OA 2CKHB 1C4CA 4IWOA 1N61A 1C76A 2PW9A 1FIQA 4US9A 2Z0EB 5JZEB 2LGIA 1BT0A 4USAA 2KN5A 2BF8B 2EKEC 3RI7C 2KN4A 3NJTA 5LNK1 3BK2A 3SDLC 3QAQA 1HZ5A 1EF1A 2Q5WD 3MC0B 1VDVA 1JQ4A 1R4NI 2LGYA 2J0KA 1GOZA 4JQWC 2RDHA 1TKEA 3SFDB 1XLNA 1E90A 1L0XB 3QC8B 3HIZA 4FJVB 5AZGA 1QLBB 5BYQA 3U2SC 1YX6B 2PE6B 4LNIA 1GB1A 1I4RA 4ANUA 1WMHA 4DXAB 4DK5A 2K22A 3AE6B 5H92C 2M19A 2D3BA 2I2YA 4YL8A 4WQMA 2CS4A 3ECIA 2HDEA 3M62B 2D07B 2D3AA 4ANWA 1V1PB 4FHKA 3DVNV 1WR1A 3NG0A 2L76A 3J9CA 2DAJA 2V1YA 4TMAB 1P98A 3DVGY 2PLPA 4KKJA 5CHFA 1WZ0A 3URYA 1TY0A 3PSEB 4JWSC 2XBBC 4A3PA 2ZCCA 1R4MB 3M3JA 2WXNA 4I6NB 4DWFA 4ITKA 2NBWB 3B08A 3GS2A 4AS1A 3IT6B 3VHTC 3KUZA 5IOIA 2ONQA 3CMMB 2JXXA 3AE1B 4B9KA 1K51A 2JU6X 2DNFA 4OHJA 3ZGZA 2IY1B 3GZNB 3DHHC 1QKZA 2GRIA 5CHVC 2M4NA 3I5JC 1TS2A 2KWDA 3VTVA 2KWVB 2L1AA 3RNBC 2KXJA 4N59A 3LB8C 3HHMA 3W1SA 3VXWA 4EZKA 3Q8FA 2IBIB 2WDTB 3NOBA 3Q8EA 3DVGX 1L6UA 4HDQA 1NBFC 3IBEA 5FK9C 2PKOA 3ZJVA 3OLMD 3P4SB 2ICIA 4N9F4 2IY0B 2BWES 4ZRQA 1F0ZA 2QILA 2KDBA 2NVUI 3EGRA 3AE8B 3P4RB 2I1KA 2AL6A 3PZ8A 3IG3A 3P4PB 5IKCM 2MBQA 3AEAB 4TUUA 3I57A 4PS8A 2LFIA 1ZP0B 4NQKE 4BVUC 4DXFA 2RGFA 4WAAA 1V81A 2V4IB 2MBHA 1QOGA 4WJPA 3RNEC 3AE5B 4OVZA 2KDFB 2NBVB 1WXSA 1JALA 5J17A 3VQIA 3VR8B 4GMVA 2VZKB 3JYUA 1N60A 3WA0A 2KFJA 4HROA 3KUDB 1EM7A 2KT7A 1KLUD 2MBBB 1WR6E 2DZMA 1L0YB 3AV8A 3A4SC 3QA8A 1TZ1A 3WAMA 2AL3A 2INNE 2LZ6A 4JGHB 4AOFA 3PZDA 1RWSA 4BFRA 1E8ZA 4K7SA 4M0WB 1XO3A 3TCAA 3ALBA 2GI9A 1WX8A 2PMVA 3PLVA 1J8CA 1HE8A 1N5XA 3RCZA 2BB5A 2REXA 3PZ7A 1Q10A 2OEDA 2L3ZA 1YX5B 1WI0A 2MEKA 1SEBD 4BZAA 2NR2A 1I4QA 1HTOA 1KTKA 4OVUA 2C9WB 2YEPB 2KQ7A 2KLGA 4WQOB 2L0FA 4BKSD 1CZPA 4H2AA 2NBUA 2VRRB 2WWZA 4NAWA 2PVGC 1D4BA 4IM2A 4NQLB 1Y8RC 2KTFA 3RD2A 2QJLA 3PTFC 1DOYA 3V05A 1QOBA 1V5TA 1SE4A 5E6NA 3VTUA 3MJWA 1L4DB 2JYTA 4W9HA 2LMCA 4GIVA 1WXQA 3DPDA 5JHAA 3P4QB 2FCSA 1GB4A 1LGRA 1EF5A 1WXAA 2UYZB 2ASQA 2J42A 3VDZA 3H8HA 4C80A 3H6NA 2A5UA 2YLMA 2K8CA 2LGXA 1VR9A 2AQ3B 3DHIC 1I4HA 3N30A 4ANVA 2V0GA 3P2BA 3L54A 2LGSA 4A55A 1FMAD 3RZFA 4P7IA 1FXTB 3VAWA 4C56C 1V80A 3MTNB 1J7CA 1Q0WB 3UIPB 3L10B 1TBEA 1WMHB 4IDIA 3AE9B 2KK8A 4LTUA 2BKRB 1MG4A 4A9AA 2FIFA 1ZXIA 2JZPA 3VFKA 2AEHA 4W9FA 1XXGA 1ESFA 4IW0A 1K53A 1AYFA 3O13A 4G3XB 5LXIB 1R4MI 2WNMA 4KVGB 1X1MA 4W9DA 2K3UA 5H8YE 5J2RA 1FXAA 1KLGD 4DDID 3VVWB 2N7EA 4W9JA 3KYDD 4W9IA 1WFYA 3Q8BA 1WX7A 5D3IB 2Y5BB 3NZSA 4FBJB 4KDIC 2CHZA 3HVDA 4MEMA 2HJ1A 4RH6A 1XCTL 1UH6A 1HZ6A 2CJNA 3A9JB 2G1EA 3KWVA 3PLUA 3K9PB 2GOWA 3DBHI 1M94A 3TEYA 4CHKA 1IUEA 2V3NA 5AUKA 1SJHD 3B2FA 3AMZA 4HEA1 3WCQA 4JL9A 4RM9A 4YSYB 4EE2A 1WGDA 4ZHPA 1ROEA 2K8BA 4GLSC 3ZJTA 5IA7A 3JSVA 1C78A 3DDCB 3AEEB 2E3TA 4BOSC 3AM9A 2IJ0A 3GP7A 3LYYA 1L7YA 3PHWB 1MHHE 3L08A 5BYRA 3M95A 1MVKA 3DBSA 1MHXA 4FJZA 1XQQA 1ZPSA 2XK5A 2WXOA 3DCGA 1MPEA 3LXFA 3U4EG 5BYSA 2MJDA 1L5PA 4KX6B 2C60A 1QF6A 1C4AA 1TIFA 4IKGA 1ZXHA 4ACFA 3FILA 2CHXA 2GBRA 3L17A 3E56A 3TEZA 3VUXA 5KHQA 1T0YA 4PT5A 3U30A 4MSQB 3A1QA 4MJSA 3B0AA 1WJ6A 1UWXA 5T8IA 1N63A 3BVGA 1V49A 3BYYB 3V62A 1UGJA 2RD0A 4L1BA 1C1YB 1VZ8A 2KTRB 2NTSA 1KRHA 5AEKB 3Q8CA 1D5ZC 2QDFA 2V9HA 1I42A 1WJUA 2M1MA 3TMPB 3NVZA 1N62A 4W9CA 4FLHA 2BKFA 4GOCA 1FO4A 3TIXA 3W1YA 1ZUD2 3RT3B 3QARA 1WF9A 2N1WA 4A8XC 1PGXA 3RMKC 2QIEB 3U8ZA 4C7ZA 1V9JA 3PVLA 3PRMB 1WM2A 5FKAC 1IP9A 4RCOA 2NPTB 1LO5D 1GAQB 2B76B 1YJJA 2J0MA 2QHOA 4XGAB 4PYZA 5G5HA 2KC1A 5DPSA 1BMLC 2FCMA 4LDTB 3L16A 4YXDB 2WXJA 4BKSA 2BYTA 5JH5C 4MSMB 5DCNA 1HA5A 3PT2B 1WWTA 1GJZA 2WXMA 4MGZE 4S17A 1OEYJ 1TT5B 2JXTA 1UELA 2MJEA 1UNSA 4S0RA 2GBNA 2LI5A 1YNTE 1T0RC 1XF5L 4HLEA 4WWMA 1NENB 2KQSA 2L8JA 1NYRA 3NHEB 1I4PA 3QIJA 1YQ4B 2INDC 1KH0A 2KQ4X 4MACA 1QOFA 2LRUA 2BVCA 2ZW0A 4ARIA 1SXTA 5AZHA 1TGZB 4HJKA 2WXQA 4DBGA 3AE4B 1QQRA 1I4XA 4L23A 1GC7A 3A9KA 2DBYA 5C3JB 5D2MB 3QX1A 1VZ6A 4EFOA 1UBQA 2MA9B 3AULA 3D32A 3MFGA 2KDIA 3S2AA 2PEAA 4HRSA 4I6LB 4HPMB 2G4SA 3RULA 3A33B 3ZRCA 2MLBA 3APCA 4WJOA 1C79A 2MJ3A 3QQ8B 3GB1A 4LNKA 3KYCD 2RPQA 2DYOA 2KD0A 1UF0A 5IP4D 2K9XA 3UQBA 1E7PB 2KO3A 3ZW3A 4AUQC 2BS4B 2IYDB 3EFCA 1P1AA 4KKIA 2MW5A 1JCKB 2ZVOA 4MGKE 3UQAA 2TSSA 4KSKC 1E7VA 1L6VA 3APFA 2R61A 1R4NB 3ML9A 5J18A 1IBXB 3M63B 4NAMA 3R2IA 5KHOA 2PVOD 2VH2A 2N9KA 2DZIA 4ZRKA 4W9LA 3N1XC 4A3OA 2J4XA 1J7BA 5E6JA 2WYQA 2O6VD 1I7HA 3ZIMA 5DPWA 3PO0A 4ARCA 1GPXA 2JUOA 1NDDA 1F77A 2FAZA 1E8WA 1YN4A 3IAS1 1E5WA 4C7YA 1FNUA 3AB5A 4L2YA 4NY0A 3AEGB 4GXBA 1YOVB 3H7PA 2LJIA 2KWCA 3ZKJC 1UUPA 2AWTA 1D5MC 4RGOS 3ZTCA 4KZ0A 3N32A 4GGQA 2LHDA 3AXCA 1AW7A 2DAFA 3Q3FA 4KIKA 3V61A 4US8A 2IO3B 3TJPA 4YTMB 4RNAA 2V3SA 1HEZE 2OJRA 3SFEB 1NI2A 5EDSA 2ZW1A 4M02A 2BW2A 3HUIA 5BO4B 1TKYA 1VCBA 3QHTA 3B9JA 2KMAA 5HFYA 4I6PA 3R7QA 4HK2A 4HVBA 3VR9B 4DXGA 4Q2JA 3Q3OC 3NVVA 1SE3A 4RMAA 4XX5A 1V1OA 1TY2A 4MDKE 2O2VB 2JPHA 2LXCA 1PYWD 4W9EA 2ZPYA 4LJOB 2MBEA 3V6EB 3EFUA 4EUTA 4GDLB 1V97A 2J0JA 3PPAA 5I4DA 1EWYC 2ZVNA 2HTME 4IWQA 1SE2A 1ZW7A 3MC8A 4K81A 5IAAC 3Q6BA 3AN1A 1VRAB 1K8RB 2WXKA 4WURA 1FFVA 2WS3B 3KW5B 2J52A 1Z2MA 3T3NA 4WJNA 1C77A 1HQRD 1P9DU 2WDQB 3ZRFA 1OTRB 2WXGA 2CR5A
chains in the Genus database with same CATH topology
4A9AA 3BIID 1ZXIA 2JZPA 2WDVB 1FXIA 1NEKB 1K52A 2BS2B 1XXGA 1RYJA 3NVWA 1ESFA 1FRRA 1SIJA 3P63A 1EU3A 1K53A 5D7GA 1AYFA 3O13A 2JSVX 2ACZB 2WNMA 2V3PA 2WQYB 1QT9A 2K3UA 1D6EC 5EE0A 5H8YE 2H88B 5BMHA 3BVZA 2EELA 1FXAA 1PGAA 2N0SB 1KLGD 3FC4A 3AEFB 4YSZB 1CQVA 2EKIA 2PIAA 1ACCA 3Q8BA 1JWBD 1ZE3D 1ENFA 2M0AA 5D3IB 2WXIA 4JE3B 2DWQA 3Q8AA 2WXHA 1P7EA 1XCQL 1YN3A 3HVDA 2J53A 2W54A 4XDDA 3W2DA 3MP9A 3HVZA 4YT0B 4RH6A 1UWMA 1XCTL 2KAJA 3E9SA 1MI0A 1OFFA 4REZA 1HZ6A 2CJNA 1B9RA 2G1EA 3KWVA 1NI3A 2SEBD 2N9LA 2AQ2B 3TEYA 3AEDB 4NZLB 1Y56A 3TUOA 1KF6B 2E6XA 1IUEA 3IT4B 4P6VF 2V3NA 3EA6A 3IXSA 3AEBB 2WDRB 3AECB 5AUKA 1SJHD 3B2FA 2IGDA 5JXVA 3DWMA 2W3SA 2H89B 4ZHOA 3AMZA 4HEA1 4N6EB 3RPFC 1JRPA 2K0PA 3FILB 3WCQA 1SSNA 4YSYB 2LUMA 1YJIA 1R7SA 4EE2A 4TQ1A 1E10A 3P1MA 3SR6A 4ZHPA 1ROEA 4GLSC 4XDCA 3V3XA 1RM6C 3ZJTA 1C4CA 1FD6A 3RFZB 1BXTA 2ON8A 1PGBA 1N61A 1C76A 4A6QA 1BUIC 1C78A 1T5XD 1TYGB 2PW9A 2RMMA 1FIQA 4US9A 3AEEB 2E3TA 2WXPA 3BVMA 4RGNA 4ZRPA 2W55A 2LGIA 4USAA 4NAWB 3VRAB 2KN4A 3AM9A 1F2RI 3AE2B 2IJ0A 3GP7A 5LNK1 1QILA 3LYYA 3BK2A 1MHHE 4OZAA 5BYRA 4XWWA 1HZ5A 1MVKA 2IDYA 2Q5WD 2Y5PA 3MC0B 1VDVA 2VZKD 2WXFA 1MHXA 1JQ4A 3AE3B 1IBXA 4RF1A 1GOZA 1ZPSA 2WXOA 1MPEA 1NYQA 3LXFA 2RDHA 1TKEA 3SFDB 3U4EG 5BYSA 1KFYB 1XLNA 2M56B 2MJDA 1L5PA 2RPVA 1J7AA 1ZOYB 4KX6B 1L0XB 2CU3A 1QF6A 1C4AA 3I9V1 2IGGA 4IKGA 1ZXHA 2FE8A 2QEJC 2NTTA 1DYQA 1QLBB 3BK1A 1PFDA 3FILA 2OHFA 1VZ7A 2AQ1B 3E56A 5BYQA 4YSXB 1WYGA 3U2SC 3TEZA 4PT5A 4M0WA 3U52E 1TS4A 4AQ7A 1GB1A 3T3OA 3UI3A 1I4RA 4KGTA 1UWXA 5T8IA 1QOAA 2XN9C 1N63A 3BVGA 4RF0A 3BYYB 1STEA 2K22A 2RDGA 1UGJA 3AE6B 1P7FA 4L1BA 5H92C 4CQNA 1VZ8A 2M19A 2NTSA 1KRHA 4R3DA 2I2YA 4WQMA 3Q8CA 2HDEA 2W3RA 1ZDVA 1D5ZC 2WP9B 1V1PB 1FFUA 4OZCA 4LLGM 3CIRB 3KQ4A 5AUIA 1IGCA 2BS3B 1C9FA 5G5GA 1V8CA 4WH4A 3J9CA 3NVZA 1VJKA 1M4VA 1EWCA 2K5PA 3EUB2 2L83A 4HKQA 1N62A 4TMAB 2PLPA 4KKJA 3URYA 5C2TB 3TEWA 4JPSA 4XE0A 1FO4A 3B2GA 1TY0A 1RFKA 1ZUD2 4JWSC 4RGTA 3Q69A 2WXNA 4ZYSA 1HXYD 4A8XC 4P16A 1PGXA 1TS5A 3BYTB 3SEBA 2QIEB 3DWGC 3BWUD 4C7ZA 4TQ0A 4ITKA 4OW0A 5EE3A 3FAHA 4B0MA 1CJEA 5FKAC 3GS2A 1XLPA 4AS1A 4RCOA 3BZDB 3IT6B 4KGRA 1B1ZA 1LO5D 1JWAD 2ONQA 1GAQB 2B76B 3NS1A 1YJJA 2BBCA 1ET6A 4YTNB 3P42A 2KACA 1K50A 3R2TA 3AE1B 1YQ3B 5G5HA 1K51A 2KMMA 2JU6X 1BMLC 4YXDB 3HRDD 4OHJA 2WXJA 3ZGZA 4LK0M 2BYTA 1QKZA 2GRIA 2WU5B 1IGDA 2L32A 1HA5A 2WXRA 5HHDG 1TS2A 1WWTA 4HJGE 2WXMA 2KWDA 4FXCA 1OQQA 1FEHA 3W5UB 2L1AA 4MH8A 2FBWB 4WAFA 2JXTA 1AWDA 1I4GA 2MJEA 1UNSA 2LEKA 1SBBB 3LB8C 4N59A 4GDKB 1YNTE 3W1SA 2L52A 1XF5L 3Q8FA 4WWMA 2DYMA 1NENB 5HG2A 2BB6A 1XLQA 1NYRA 1TKGA 2NMQA 1JW9D 1I4PA 1YQ4B 3Q8EA 2BT6A 4OZBA 1KH0A 2KQ4X 2LHEA 4MACA 1QOFA 4B0EA 2ZW0A 1L6UA 4UDUC 4XWTA 4ARIA 4MM3B 1SXTA 5FK9C 2PKOA 1C4PA 1PUTA 1EU4A 2WXQA 3ZJVA 4N58A 3AE4B 1QQRA 1I4XA 4L23A 2G9HD 3P4SB 5C3JB 2DBYA 2ICIA 1F2RC 3U7ZA 1VZ6A 4ZRQA 5GXGB 2QILA 3MFGA 3ETRA 1F0ZA 2QSDA 2JYEA 3CWIA 2W82A 3EGRA 2QMTA 3ZJUA 1FNVA 3AE8B 3P4RB 4HRSA 3PZ8A 3MHZA 2Y5CA 1JROA 3P4PB 3AEAB 1JMLA 1C79A 4TSSA 3I57A 4HKZE 3ZQ4A 2MJ3A 4WIPA 3GB1A 1E0ZA 1FCLA 2DYOA 2LFIA 1ZP0B 2K9XA 3ZYYX 3N9YC 5D3DA 4DXFA 1E7PB 1TS3A 2BS4B 2V4IB 4O1NA 2XNAC 5FR3A 1QOGA 4KKIA 2DLBA 2MH7A 1YN5A 3TSSA 1WRIA 1JCKB 2JX5A 2JWUA 3AE5B 4OVZA 2N7JA 4NJCA 2TSSA 3C8YA 1JALA 1L6VA 3NRZA 3VQIA 3VR8B 3KLSX 2I38A 2R61A 2YEPF 1IBXB 2VZKB 1V1PA 4NAMA 5HI1A 1N60A 4YWGG 3R2IA 1YMHE 2PVOD 4HROA 1OQRA 1EM7A 2N9KA 4IOIE 2INPE 4RGMA 1KLUD 3NVYA 2J4XA 1L0YB 3AV8A 1J7BA 5E6JA 2IPKD 2INNE 1PDXA 4JX1C 2Z8LA 1RWSA 1I7HA 2AX5A 1XO3A 3PO0A 2GI9A 4ARCA 2PMVA 1GPXA 1FNWA 2WU2B 1F77A 5MPOA 1YN4A 3IAS1 4DQOC 1DGJA 4JWUC 1FM0D 4C7YA 1FNUA 1N5XA 3AB5A 4L2YA 3AEGB 2BB5A 3PZ7A 4KGSA 4A90A 1Q10A 2OEDA 1L4ZB 2LJIA 3MJ5A 2MEKA 2X38A 1T6BX 1SEBD 2WXLA 1UUPA 1FCCC 1D5MC 1I4QA 1KTKA 1FRDA 1JWUD 4RGOS 3W9CB 2YEPB 2PTLA 1N5WA 2SAKA 2LHDA 1AW7A 3IAM1 2IGHA 1CZPA 3W5VB 4H2AA 5TSSA 1CK1A 4US8A 2PVGC 1D4BA 3ABVB 1E9MA 2QJLA 1WGKA 4YTMB 4RNAA 1E6EB 1DOYA 4MT5A 1HEZE 4YTPB 3SFEB 3V05A 1QOBA 1SE4A 2Y3AA 1A70A 2ZW1A 4RFBA 2FUG1 1ET9A 2BW2A 3HUIA 1L4DB 2JYTA 2KDMA 2WLBA 1TKYA 3B9JA 2LMCA 3L4PA 1XLOA 3AE7B 1WXQA 3KWLA 5HFYA 1DOIA 1D5XC 1VLBA 3VR9B 1SJED 3P4QB 5BMIA 4DXGA 4Q2JA 1XEEA 3NVVA 1GB4A 2CJOA 1SE3A 1JWMD 3NUHB 1V1OA 1TY2A 4J3OD 3OWEB 1DOXA 2J42A 4C80A 2GB1A 3H8HA 1PYWD 4ZOHC 2D5GA 2BTEA 5EE9A 1NVID 1VR9A 2AQ3B 1I4HA 4D2KA 4GDLB 1V97A 5EE1A 2V0GA 1JWSD 5I4DA 3VRBB 1EWYC 1T3QA 1L0VB 2HTME 4A55A 1FMAD 1SE2A 1SF0A 4C56C 1WSPA 3AN1A 1VRAB 2WXKA 4WURA 3R8BA 1FFVA 2WS3B 3T3NA 2J52A 1J7CA 2JQRB 3NZ3A 1C77A 1HQRD 1SB3C 1TZOA 2WDQB 3TEXA 4IDIA 3AE9B 3AH7A 1ZDXA 5BMGA 4LTUA 1TJEA 2WXGA 1AN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M56 B;  2MJD A;  1L5P A;  1AWD A;  1J7A A;  1ZXI A;  3BII D;  1ZOY B;  1FXI A;  1NEK B;  2LEK A;  2MJE A;  2WDV B;  2WU2 B;  2CU3 A;  3LB8 C;  4KX6 B;  2BS2 B;  4N59 A;  5MPO A;  1RYJ A;  1DGJ A;  3NVW A;  1FRR A;  1SIJ A;  1FM0 D;  3P63 A;  4JWU C;  1QF6 A;  4C7Y A;  1N5X A;  3AB5 A;  1AYF A;  3AEG B;  2ACZ B;  2L52 A;  1QLB B;  1PFD A;  2OHF A;  4WWM A;  1NEN B;  4YSX B;  1WYG A;  2FBW B;  1XLQ A;  2WQY B;  1NYR A;  1TKG A;  1QT9 A;  1JW9 D;  1YQ4 B;  5EE0 A;  5H8Y E;  2H88 B;  2BT6 A;  1QOF A;  1FXA A;  1L6U A;  2N0S B;  3FC4 A;  3AEF B;  4YSZ B;  1FRD A;  3W9C B;  2PKO A;  2EKI A;  1PUT A;  2PIA A;  4N58 A;  1N5W A;  1QOA A;  3AE4 B;  1N63 A;  1JWB D;  3P4S B;  5C3J B;  2DBY A;  2K22 A;  3AE6 B;  1CZP A;  5H92 C;  3W5V B;  2DWQ A;  2M19 A;  1KRH A;  5GXG B;  4US8 A;  1F0Z A;  3ETR A;  4WQM A;  2W54 A;  3CWI A;  2PVG C;  3HVZ A;  2W3R A;  3ABV B;  4YT0 B;  2WP9 B;  1E9M A;  1UWM A;  1WGK A;  2QJL A;  2KAJ A;  1FFU A;  3AE8 B;  4YTM B;  1E6E B;  3P4R B;  4HRS A;  1DOY A;  1OFF A;  3CIR B;  5AUI A;  4YTP B;  3SFE B;  2CJN A;  1QOB A;  1B9R A;  2Y5C A;  1JRO A;  2G1E A;  3P4P B;  2BS3 B;  1NI3 A;  5G5G A;  1V8C A;  3AEA B;  3NVZ A;  1A70 A;  1VJK A;  1KFY B;  2K5P A;  3EUB 2;  2L83 A;  1N62 A;  3AED B;  3HUI A;  2MJ3 A;  2WLB A;  1E0Z A;  1TKY A;  1KF6 B;  5C2T B;  3B9J A;  1IUE A;  3L4P A;  1XLO A;  3AE7 B;  1WXQ A;  3B2G A;  3KWL A;  4P6V F;  1FO4 A;  3AEB B;  2WDR B;  1ZP0 B;  3AEC B;  1DOI A;  2K9X A;  5AUK A;  1RFK A;  1VLB A;  1ZUD 2;  3B2F A;  4JWS C;  3VR9 B;  1E7P B;  3ZYY X;  3P4Q B;  3DWM A;  2W3S A;  2H89 B;  4ZHO A;  2BS4 B;  3NVV A;  3AMZ A;  4N6E B;  3RPF C;  1JRP A;  3WCQ A;  2CJO A;  4YSY B;  2QIE B;  3DWG C;  1QOG A;  1R7S A;  1YJI A;  1E10 A;  3P1M A;  3SR6 A;  4ITK A;  4C7Z A;  4ZHP A;  1ROE A;  2MH7 A;  5EE3 A;  1WRI A;  3FAH A;  1DOX A;  1CJE A;  2JX5 A;  3AE5 B;  1RM6 C;  4C80 A;  1XLP A;  4ZOH C;  5EE9 A;  1NVI D;  1JAL A;  1JWA D;  1L6V A;  3NRZ A;  3VR8 B;  1N61 A;  1GAQ B;  2B76 B;  3NS1 A;  1TYG B;  1YJJ A;  1V97 A;  4YTN B;  1FIQ A;  4US9 A;  3AEE B;  5EE1 A;  2E3T A;  1GPX A;  3AE1 B;  1EWY C;  1T3Q A;  1N60 A;  1YQ3 B;  5G5H A;  3VRB B;  1L0V B;  2HTM E;  2W55 A;  4USA A;  1FMA D;  2KMM A;  1SF0 A;  2PVO D;  3VRA B;  4HRO A;  3AM9 A;  4YXD B;  3HRD D;  1OQR A;  3AE2 B;  3AN1 A;  4A9A A;  2WU5 B;  3NVY A;  2Q5W D;  1FFV A;  2WS3 B;  1J7C A;  2JQR B;  1VDV A;  1JQ4 A;  3AV8 A;  1J7B A;  1WWT A;  3AE3 B;  4FXC A;  1OQQ A;  1SB3 C;  2WDQ B;  1PDX A;  4JX1 C;  3W5U B;  4IDI A;  1NYQ A;  3AE9 B;  3AH7 A;  3LXF A;  1RWS A;  1TKE A;  1I7H A;  3SFD B;  2AX5 A;  4LTU A;  1TJE A;  1XLN A;  1XO3 A;  3PO0 A; 
#chains in the Genus database with same CATH topology
 2WDV B;  3TBL D;  4EEW A;  5IN7 A;  1IPG A;  1RYJ A;  1ZGU B;  1FRR A;  3ZNH B;  1EU3 A;  3H7P B;  4K3B A;  4ZRI A;  2JSV X;  1WJ4 A;  2ACZ B;  4K7W A;  1OEY A;  3ZXV A;  4GDK A;  1QT9 A;  5BMH A;  3BVZ A;  2EEL A;  3FC4 A;  3AEF B;  4YSZ B;  3EEC A;  2K6Q A;  2MRP A;  2EKI A;  2PIA A;  2OJW A;  1ZE3 D;  4JE3 B;  4HWI B;  4G11 A;  1P7E A;  1XCQ L;  2MBO A;  2J53 A;  2W54 A;  1PQS A;  3HVZ A;  1OFF A;  1B9R A;  1GUA B;  2JZ3 B;  2SEB D;  2LVQ A;  1RLF A;  2AQ2 B;  3AED B;  4NZL B;  4OVV A;  1P3Q U;  1KF6 B;  3L0W B;  4F1S A;  3EA6 A;  4CYE A;  2WDR B;  2W3S A;  2H89 B;  4KSL C;  2K0P A;  3FIL B;  1UZX B;  1SSN A;  2LUM A;  2KAN A;  3NZU A;  4EZL A;  1E10 A;  3SR6 A;  2KFK B;  2WGS A;  4XC2 A;  4BBN F;  1FD6 A;  3RFZ B;  1CMX B;  1PGB A;  1GNU A;  5AZF A;  3N20 C;  2RMM A;  2XK5 B;  2BQQ A;  2WXP A;  4RGN A;  4ZRP A;  1VD2 A;  2UWQ A;  3VRA B;  2W9N A;  2NCN A;  2R2O A;  3AE2 B;  4PK1 A;  2N1V A;  3T9L A;  4XWW A;  1YQB A;  2Y5P A;  2WXF A;  3AE3 B;  2HJ8 A;  4RF1 A;  2IZV B;  1KFY B;  3L13 A;  2KFK A;  1ZOY B;  3HM6 X;  2CU3 A;  1ISN A;  3EHV A;  2G4D B;  3I9V 1;  5CX3 A;  4BOZ B;  2MWS B;  4ZDV A;  3SHQ A;  2NTT A;  1DYQ A;  2LJ5 A;  3BK1 A;  1PFD A;  2OHF A;  1VZ7 A;  2KVR A;  3ML8 A;  4YSX B;  4IUM B;  3MC9 A;  3R66 C;  3RZW C;  3GE3 C;  4LNN A;  2XEW A;  2JT4 B;  3C0R B;  3HK0 A;  1TS4 A;  4G50 A;  3NS8 A;  3UI3 A;  4KGT A;  2GBK A;  1J0G A;  3EC8 A;  3DHG C;  2KVZ A;  2XN9 C;  3B1L X;  2CU1 A;  4RF0 A;  1P7F A;  3BY4 B;  4CQN A;  2L0T A;  1FPY A;  4R3D A;  2INC C;  1ZDV A;  2WP9 B;  1FFU A;  1WRD B;  4OZC A;  2EMS A;  1E8X A;  3CIR B;  3KQ4 A;  1WYW B;  5DPT A;  2IO2 B;  3UIO B;  2BS3 B;  4MM3 A;  1C9F A;  1EWC A;  2K6D B;  2MP2 A;  4HKQ A;  4KDL B;  5C2T B;  4IM3 A;  3TEW A;  4XE0 A;  3B2G A;  4W9K A;  5HKH A;  3SU8 X;  3BYT B;  3DWG C;  2Z0D B;  4K1R B;  3BWU D;  4OW0 A;  5EE3 A;  3FAH A;  1XLP A;  1IYF A;  4FAD A;  1V86 A;  2L05 A;  3NS1 A;  1S1Q B;  1ET6 A;  2QCZ A;  3P42 A;  2KAC A;  1K50 A;  3QJZ A;  1YQ3 B;  2PJH A;  2O6V B;  2IO0 B;  4IC7 B;  3A9K B;  2WU5 B;  1IGD A;  2L32 A;  5HHD G;  1EO6 A;  1S3S G;  2WX0 A;  4HJG E;  4FXC A;  3ZNZ B;  5C1Z A;  1OQQ A;  1FEH A;  2QC8 A;  3PV1 A;  1I4G A;  2LEK A;  4BAX A;  2DYB A;  2L52 A;  2DYM A;  2NMQ A;  3RYT A;  2YVC A;  4QAY A;  4OZB A;  4WJQ A;  1WY8 A;  2Z59 B;  4UDU C;  2N9X A;  2D3G A;  1WH3 A;  2ZJD A;  2L7R A;  1YIW A;  4HCP B;  2HD5 B;  5GXG B;  1L2N A;  2QSD A;  2JYE A;  3CWI A;  2W82 A;  1H4R A;  2QMT A;  4KIK B;  1MFW A;  3RUI B;  2KOX A;  4HXD A;  2Y5C A;  1JRO A;  1JML A;  2LAS A;  3Q14 C;  4PS7 A;  3UF8 A;  3ZQ4 A;  2PPH A;  1E0Z A;  1D3Z A;  4DHZ B;  1FCL A;  4J6I A;  4AJW A;  3PRE A;  5D3D A;  1I35 A;  2L00 B;  1TS3 A;  2C7N B;  4LJP B;  2DLB A;  1ZKH A;  2MH7 A;  3TSS A;  3V6C B;  1XT9 B;  2JX5 A;  2JWU A;  1F9J A;  2DX5 B;  2K25 A;  2N7J A;  4NJC A;  1WGG A;  3C8Y A;  3ZXR A;  3NRZ A;  4AWJ A;  1MG8 A;  3KLS X;  3C19 A;  2I38 A;  4MGY E;  4IWP A;  5L95 C;  3A9J A;  1YMH E;  1OQR A;  4IOI E;  2INP E;  3ZUN A;  4RGM A;  3NVY A;  5CHW A;  2KNB A;  1PDX A;  2Z8L A;  2AX5 A;  1TTN A;  3RNG C;  2AYO B;  1FNW A;  1F52 A;  4DQO C;  1DGJ A;  3N1Z C;  4KGS A;  2FUH B;  3JW0 X;  1L4Z B;  1WGY A;  3MJ5 A;  3PGE A;  2WXL A;  3DBL B;  2D2Q A;  1KJT A;  4C00 A;  4K7U A;  1N5W A;  2SAK A;  1HTQ A;  3IAM 1;  1U4A A;  2LVO A;  1GC6 A;  1RFA A;  1OGW A;  3ABV B;  5TR5 A;  2O6V A;  1E6E B;  1V6E A;  2A4Z A;  2KX3 A;  4RFB A;  2FUG 1;  5G2N A;  2KDM A;  2WLB A;  4E3C A;  4LCD E;  4K3C A;  2KJH B;  3L4P A;  1RAX A;  1XLO A;  4W9G A;  3KWL A;  3W1S C;  1WE6 A;  1VLB A;  2N9E B;  2MX2 A;  5BMI A;  1XEE A;  2MSE D;  4GU2 A;  2CJO A;  4KZC A;  1JWM D;  1WJN A;  4J3O D;  1T0S C;  2BYE A;  2NS5 A;  3OWE B;  1DOX A;  2GB1 A;  4ZOH C;  2D5G A;  5EE9 A;  1NVI D;  2HE7 A;  2BYV E;  3APD A;  2N7D A;  1T3Q A;  3PRP B;  1AAR A;  2CHW A;  1SF0 A;  3R7R A;  3WAO A;  1WSP A;  4X57 B;  2N4F A;  2G3Q B;  2OOB B;  5G55 A;  4JLC A;  2JQR B;  1WXV A;  2KC2 A;  4EKU A;  1SB3 C;  4XYC A;  2NPT A;  3PHX B;  3I63 C;  1ZDX A;  1TJE A;  1AN8 A;  3BII D;  3N3K B;  1SIJ A;  3P63 A;  4DHJ B;  2ZPN A;  5D7G A;  3RN9 C;  3CST A;  4FN2 A;  2JF5 A;  2KMC A;  2WQY B;  1D6E C;  2FCN A;  5EE0 A;  2H88 B;  1WE7 A;  2N0S B;  3LDZ E;  2FCQ A;  1CQV A;  2GBM A;  2JY6 A;  1ACC A;  1JWB D;  3TL5 A;  2WXI A;  3ZLZ A;  3Q8A A;  2WXH A;  3AU5 A;  2R2Q A;  3MP9 A;  4ZRJ A;  1UWM A;  2KAJ A;  3E9S A;  4FJY A;  5E6P A;  1SIF A;  1KLV A;  1NI3 A;  2N9L A;  3A1Q B;  1Y56 A;  3X0W A;  1KOT A;  2LD9 A;  4ICU A;  3TUO A;  3QK0 A;  3VH4 B;  3AEB B;  4MH0 E;  3CSF A;  2IGD A;  2D10 A;  3DWM A;  2ZNV B;  3RPF C;  1JRP A;  3H1U A;  2FID A;  3P1M A;  2MP2 B;  1BXT A;  2ON8 A;  4A6Q A;  1BUI C;  1T5X D;  1TYG B;  3BVM A;  4F7Z A;  2W55 A;  4DHJ D;  3T8M A;  5L83 A;  4NAW B;  2JRI B;  1F2R I;  3X23 A;  1QIL A;  4OZA A;  5DPR A;  1XD3 B;  2IDY A;  4HPP A;  2VZK D;  1YJ1 A;  1IBX A;  1NYQ A;  1GG3 A;  1OQY A;  3ZO5 B;  2M56 B;  2RPV A;  1J7A A;  2KJ6 A;  4NPN A;  1LM8 B;  4BKG A;  2IGG A;  4URK A;  2FE8 A;  3IFW B;  2QEJ C;  2AQ1 B;  2LRW A;  1WYG A;  3H7S A;  3WIM A;  5JHB A;  5D6J B;  3KH0 A;  2DZJ A;  4M0W A;  2WX1 A;  3U52 E;  1P0R A;  4AQ7 A;  3T3O A;  5D94 A;  4M8N A;  1QOA A;  1T0Q C;  1STE A;  2RDG A;  3WAP A;  2G45 B;  3PRZ A;  2KYW A;  4PS3 A;  2KDE B;  4B95 A;  2W3R A;  3DBR B;  4LLG M;  5AUI A;  1IGC A;  2M17 A;  1JRU A;  3ONS A;  5G5G A;  1V8C A;  4WH4 A;  2LXA A;  2KWU B;  1VJK A;  3I3T B;  1M4V A;  2K5P A;  3EUB 2;  2L83 A;  4GSW A;  2EMT A;  4JPS A;  4ICV A;  2KLC A;  2X8X X;  1RFK A;  4RGT A;  2GBJ A;  3ZDT A;  3Q69 A;  4XZ4 A;  4ZYS A;  1HXY D;  3OJ3 A;  2GLS A;  4P16 A;  1TS5 A;  3SEB A;  3WAN A;  4EOY A;  2WHI A;  1WGR A;  4TQ0 A;  4B0M A;  1CJE A;  4B6W A;  3ENE A;  3BZD B;  2RSU A;  4KGR A;  3NY5 A;  1B1Z A;  2KKC A;  2B3A A;  1JWA D;  2C7H A;  1N6Z A;  2BBC A;  4YTN B;  3R2T A;  1LQB A;  2K39 A;  3KUC B;  4A20 A;  3LJ3 A;  2KMM A;  3GZN I;  3HM3 A;  3O65 B;  3HRD D;  4LK0 M;  2M0X A;  4BKT A;  2D11 A;  2WXR A;  5FR6 A;  2LWP A;  3FKY A;  4E74 A;  4PYU A;  2DHZ A;  3W5U B;  4MH8 A;  2FBW B;  4WAF A;  2JRH A;  1WM3 A;  1AWD A;  4P1B C;  1WX9 A;  4KV2 A;  5GMV A;  3ZNG C;  1SBB B;  2MQJ A;  4WWN A;  4GDK B;  3AU4 A;  5HG2 A;  2BB6 A;  3R3M A;  1XLQ A;  1TKG A;  2BPS A;  1JW9 D;  2BT6 A;  4HDO A;  2LHE A;  4B0E A;  3GOE A;  4XWT A;  4MM3 B;  4M8M A;  1C4P A;  1PUT A;  1EU4 A;  2BYF A;  2DZK A;  4N58 A;  2FNJ B;  2JVC A;  4II2 B;  1H8C A;  2G9H D;  1QZE A;  2IO1 B;  1F2R C;  4GN1 A;  3U7Z A;  3WAL A;  2C5L C;  4GB9 A;  3ETR A;  3OG5 A;  1SE9 A;  3ZJU A;  1WXM A;  1FNV A;  4CO7 A;  2KTR A;  4GDL A;  4NJ6 A;  3MHZ A;  3DVN U;  2LGD A;  1V5O A;  4NJ7 A;  2C7M B;  4WWO A;  4TSS A;  1Q5W B;  4HKZ E;  3QWZ B;  4LNO A;  4WIP A;  3KVF B;  1J19 A;  4MJS B;  2KJR A;  4FA6 A;  4P1C C;  3ZYY X;  3N9Y C;  3BIN A;  2RDB C;  4O1N A;  2XNA C;  3IVF A;  5FR3 A;  2ZEQ A;  4IM0 A;  1YN5 A;  1WRI A;  3H9D A;  4II3 B;  3U7D A;  1RRB A;  4HPL B;  2YEP F;  3VUW A;  1V1P A;  2M8S A;  5HI1 A;  4YWG G;  2LUE A;  4TV3 A;  1UD7 A;  2HTH A;  1EUV B;  1LXD A;  3OJ4 B;  1SGH A;  2IPK D;  3ZDM C;  2KX0 A;  4JX1 C;  4EZJ A;  3SD5 A;  3JSV B;  4MGI E;  4LNF A;  1WZ3 A;  1WIA A;  2MCN B;  3QCA A;  5IO9 A;  2WU2 B;  3UIN B;  5MPO A;  4IG7 B;  5LXH A;  4JWU C;  1FM0 D;  1Q1O A;  1Z5S B;  4LDT D;  3ZVV A;  2BWF A;  4A90 A;  4C4V A;  5C23 A;  3AI5 A;  4ZYN A;  4E71 A;  2ZNV C;  2X38 A;  1T6B X;  1FCC C;  4G0N B;  1FRD A;  1JWU D;  3W9C B;  3DBH B;  2PTL A;  2DEN B;  3GE8 C;  3Q3J A;  4F8C B;  2IGH A;  2ZZP B;  3W5V B;  3JVZ X;  3N1Y C;  1CK1 A;  5TSS A;  4FUL A;  3Q3M C;  1E9M A;  1WGK A;  4MT5 A;  4YTP B;  2VH1 A;  2MHJ A;  2Y3A A;  1A70 A;  3Q2A C;  4BBN C;  3IHP C;  1ET9 A;  4FHJ A;  2BGF A;  4ASW C;  3AE7 B;  2ZCB A;  1E8Y A;  3VUY A;  1DOI A;  1D5X C;  3ZNI D;  4TKN A;  1SJE D;  1YD8 U;  3RNA C;  1UBI A;  2PE9 A;  3CF6 E;  3NUH B;  1C3T A;  2UU7 A;  2D3C A;  1KM7 A;  2BTE A;  4AP4 C;  3MHS D;  4D2K A;  4MEL A;  2JZZ A;  5EE1 A;  1MJD A;  1JWS D;  3VRB B;  1L0V B;  3VTW A;  5CTR C;  4DDG D;  2GMI C;  3R8B A;  3ZTD A;  2K8H A;  3NZ3 A;  1G6J A;  1TZO A;  3TEX A;  4DHZ E;  3AH7 A;  2K1F A;  4AJY B;  5BMG A;  2O2V A;  2JWZ A;  2N9P C;  4ANX A;  1FXI A;  1NEK B;  3RNF C;  1K52 A;  2BS2 B;  3NVW A;  1UGM A;  4C4V B;  3PS6 A;  2V3P A;  1V2Y A;  4M00 A;  5LLI A;  1PGA A;  4M01 A;  3A4R A;  1ENF A;  1E7U A;  2M0A A;  2DWQ A;  3OAW A;  3DBR I;  4HCN B;  1YN3 A;  4XDD A;  2KHW B;  4JIO U;  3RNC C;  3W2D A;  4RM8 A;  4YT0 B;  2J7Q B;  1F1H A;  1MI0 A;  3V60 A;  4REZ A;  1A5R A;  3K9O B;  4NNJ B;  3DBL I;  2E6X A;  3IT4 B;  4P6V F;  2V4L A;  3IXS A;  3DOW A;  3VH3 B;  2KZR A;  3AEC B;  2I1J A;  4WWP A;  1WGH A;  3Q3N C;  5JXV A;  3DQV A;  4ZHO A;  2LVP A;  4N6E B;  3UGB B;  1LFD A;  1YJI A;  1R7S A;  4TQ1 A;  2RR9 A;  4XDC A;  3V3X A;  1RM6 C;  5E6O A;  2CKH B;  1C4C A;  4IWO A;  1N61 A;  1C76 A;  2PW9 A;  1FIQ A;  4US9 A;  2Z0E B;  5JZE B;  2LGI A;  1BT0 A;  4USA A;  2KN5 A;  2BF8 B;  2EKE C;  3RI7 C;  2KN4 A;  3NJT A;  5LNK 1;  3BK2 A;  3SDL C;  3QAQ A;  1HZ5 A;  1EF1 A;  2Q5W D;  3MC0 B;  1VDV A;  1JQ4 A;  1R4N I;  2LGY A;  2J0K A;  1GOZ A;  4JQW C;  2RDH A;  1TKE A;  3SFD B;  1XLN A;  1E90 A;  1L0X B;  3QC8 B;  3HIZ A;  4FJV B;  5AZG A;  1QLB B;  5BYQ A;  3U2S C;  1YX6 B;  2PE6 B;  4LNI A;  1GB1 A;  1I4R A;  4ANU A;  1WMH A;  4DXA B;  4DK5 A;  2K22 A;  3AE6 B;  5H92 C;  2M19 A;  2D3B A;  2I2Y A;  4YL8 A;  4WQM A;  2CS4 A;  3ECI A;  2HDE A;  3M62 B;  2D07 B;  2D3A A;  4ANW A;  1V1P B;  4FHK A;  3DVN V;  1WR1 A;  3NG0 A;  2L76 A;  3J9C A;  2DAJ A;  2V1Y A;  4TMA B;  1P98 A;  3DVG Y;  2PLP A;  4KKJ A;  5CHF A;  1WZ0 A;  3URY A;  1TY0 A;  3PSE B;  4JWS C;  2XBB C;  4A3P A;  2ZCC A;  1R4M B;  3M3J A;  2WXN A;  4I6N B;  4DWF A;  4ITK A;  2NBW B;  3B08 A;  3GS2 A;  4AS1 A;  3IT6 B;  3VHT C;  3KUZ A;  5IOI A;  2ONQ A;  3CMM B;  2JXX A;  3AE1 B;  4B9K A;  1K51 A;  2JU6 X;  2DNF A;  4OHJ A;  3ZGZ A;  2IY1 B;  3GZN B;  3DHH C;  1QKZ A;  2GRI A;  5CHV C;  2M4N A;  3I5J C;  1TS2 A;  2KWD A;  3VTV A;  2KWV B;  2L1A A;  3RNB C;  2KXJ A;  4N59 A;  3LB8 C;  3HHM A;  3W1S A;  3VXW A;  4EZK A;  3Q8F A;  2IBI B;  2WDT B;  3NOB A;  3Q8E A;  3DVG X;  1L6U A;  4HDQ A;  1NBF C;  3IBE A;  5FK9 C;  2PKO A;  3ZJV A;  3OLM D;  3P4S B;  2ICI A;  4N9F 4;  2IY0 B;  2BWE S;  4ZRQ A;  1F0Z A;  2QIL A;  2KDB A;  2NVU I;  3EGR A;  3AE8 B;  3P4R B;  2I1K A;  2AL6 A;  3PZ8 A;  3IG3 A;  3P4P B;  5IKC M;  2MBQ A;  3AEA B;  4TUU A;  3I57 A;  4PS8 A;  2LFI A;  1ZP0 B;  4NQK E;  4BVU C;  4DXF A;  2RGF A;  4WAA A;  1V81 A;  2V4I B;  2MBH A;  1QOG A;  4WJP A;  3RNE C;  3AE5 B;  4OVZ A;  2KDF B;  2NBV B;  1WXS A;  1JAL A;  5J17 A;  3VQI A;  3VR8 B;  4GMV A;  2VZK B;  3JYU A;  1N60 A;  3WA0 A;  2KFJ A;  4HRO A;  3KUD B;  1EM7 A;  2KT7 A;  1KLU D;  2MBB B;  1WR6 E;  2DZM A;  1L0Y B;  3AV8 A;  3A4S C;  3QA8 A;  1TZ1 A;  3WAM A;  2AL3 A;  2INN E;  2LZ6 A;  4JGH B;  4AOF A;  3PZD A;  1RWS A;  4BFR A;  1E8Z A;  4K7S A;  4M0W B;  1XO3 A;  3TCA A;  3ALB A;  2GI9 A;  1WX8 A;  2PMV A;  3PLV A;  1J8C A;  1HE8 A;  1N5X A;  3RCZ A;  2BB5 A;  2REX A;  3PZ7 A;  1Q10 A;  2OED A;  2L3Z A;  1YX5 B;  1WI0 A;  2MEK A;  1SEB D;  4BZA A;  2NR2 A;  1I4Q A;  1HTO A;  1KTK A;  4OVU A;  2C9W B;  2YEP B;  2KQ7 A;  2KLG A;  4WQO B;  2L0F A;  4BKS D;  1CZP A;  4H2A A;  2NBU A;  2VRR B;  2WWZ A;  4NAW A;  2PVG C;  1D4B A;  4IM2 A;  4NQL B;  1Y8R C;  2KTF A;  3RD2 A;  2QJL A;  3PTF C;  1DOY A;  3V05 A;  1QOB A;  1V5T A;  1SE4 A;  5E6N A;  3VTU A;  3MJW A;  1L4D B;  2JYT A;  4W9H A;  2LMC A;  4GIV A;  1WXQ A;  3DPD A;  5JHA A;  3P4Q B;  2FCS A;  1GB4 A;  1LGR A;  1EF5 A;  1WXA A;  2UYZ B;  2ASQ A;  2J42 A;  3VDZ A;  3H8H A;  4C80 A;  3H6N A;  2A5U A;  2YLM A;  2K8C A;  2LGX A;  1VR9 A;  2AQ3 B;  3DHI C;  1I4H A;  3N30 A;  4ANV A;  2V0G A;  3P2B A;  3L54 A;  2LGS A;  4A55 A;  1FMA D;  3RZF A;  4P7I A;  1FXT B;  3VAW A;  4C56 C;  1V80 A;  3MTN B;  1J7C A;  1Q0W B;  3UIP B;  3L10 B;  1TBE A;  1WMH B;  4IDI A;  3AE9 B;  2KK8 A;  4LTU A;  2BKR B;  1MG4 A;  4A9A A;  2FIF A;  1ZXI A;  2JZP A;  3VFK A;  2AEH A;  4W9F A;  1XXG A;  1ESF A;  4IW0 A;  1K53 A;  1AYF A;  3O13 A;  4G3X B;  5LXI B;  1R4M I;  2WNM A;  4KVG B;  1X1M A;  4W9D A;  2K3U A;  5H8Y E;  5J2R A;  1FXA A;  1KLG D;  4DDI D;  3VVW B;  2N7E A;  4W9J A;  3KYD D;  4W9I A;  1WFY A;  3Q8B A;  1WX7 A;  5D3I B;  2Y5B B;  3NZS A;  4FBJ B;  4KDI C;  2CHZ A;  3HVD A;  4MEM A;  2HJ1 A;  4RH6 A;  1XCT L;  1UH6 A;  1HZ6 A;  2CJN A;  3A9J B;  2G1E A;  3KWV A;  3PLU A;  3K9P B;  2GOW A;  3DBH I;  1M94 A;  3TEY A;  4CHK A;  1IUE A;  2V3N A;  5AUK A;  1SJH D;  3B2F A;  3AMZ A;  4HEA 1;  3WCQ A;  4JL9 A;  4RM9 A;  4YSY B;  4EE2 A;  1WGD A;  4ZHP A;  1ROE A;  2K8B A;  4GLS C;  3ZJT A;  5IA7 A;  3JSV A;  1C78 A;  3DDC B;  3AEE B;  2E3T A;  4BOS C;  3AM9 A;  2IJ0 A;  3GP7 A;  3LYY A;  1L7Y A;  3PHW B;  1MHH E;  3L08 A;  5BYR A;  3M95 A;  1MVK A;  3DBS A;  1MHX A;  4FJZ A;  1XQQ A;  1ZPS A;  2XK5 A;  2WXO A;  3DCG A;  1MPE A;  3LXF A;  3U4E G;  5BYS A;  2MJD A;  1L5P A;  4KX6 B;  2C60 A;  1QF6 A;  1C4A A;  1TIF A;  4IKG A;  1ZXH A;  4ACF A;  3FIL A;  2CHX A;  2GBR A;  3L17 A;  3E56 A;  3TEZ A;  3VUX A;  5KHQ A;  1T0Y A;  4PT5 A;  3U30 A;  4MSQ B;  3A1Q A;  4MJS A;  3B0A A;  1WJ6 A;  1UWX A;  5T8I A;  1N63 A;  3BVG A;  1V49 A;  3BYY B;  3V62 A;  1UGJ A;  2RD0 A;  4L1B A;  1C1Y B;  1VZ8 A;  2KTR B;  2NTS A;  1KRH A;  5AEK B;  3Q8C A;  1D5Z C;  2QDF A;  2V9H A;  1I42 A;  1WJU A;  2M1M A;  3TMP B;  3NVZ A;  1N62 A;  4W9C A;  4FLH A;  2BKF A;  4GOC A;  1FO4 A;  3TIX A;  3W1Y A;  1ZUD 2;  3RT3 B;  3QAR A;  1WF9 A;  2N1W A;  4A8X C;  1PGX A;  3RMK C;  2QIE B;  3U8Z A;  4C7Z A;  1V9J A;  3PVL A;  3PRM B;  1WM2 A;  5FKA C;  1IP9 A;  4RCO A;  2NPT B;  1LO5 D;  1GAQ B;  2B76 B;  1YJJ A;  2J0M A;  2QHO A;  4XGA B;  4PYZ A;  5G5H A;  2KC1 A;  5DPS A;  1BML C;  2FCM A;  4LDT B;  3L16 A;  4YXD B;  2WXJ A;  4BKS A;  2BYT A;  5JH5 C;  4MSM B;  5DCN A;  1HA5 A;  3PT2 B;  1WWT A;  1GJZ A;  2WXM A;  4MGZ E;  4S17 A;  1OEY J;  1TT5 B;  2JXT A;  1UEL A;  2MJE A;  1UNS A;  4S0R A;  2GBN A;  2LI5 A;  1YNT E;  1T0R C;  1XF5 L;  4HLE A;  4WWM A;  1NEN B;  2KQS A;  2L8J A;  1NYR A;  3NHE B;  1I4P A;  3QIJ A;  1YQ4 B;  2IND C;  1KH0 A;  2KQ4 X;  4MAC A;  1QOF A;  2LRU A;  2BVC A;  2ZW0 A;  4ARI A;  1SXT A;  5AZH A;  1TGZ B;  4HJK A;  2WXQ A;  4DBG A;  3AE4 B;  1QQR A;  1I4X A;  4L23 A;  1GC7 A;  3A9K A;  2DBY A;  5C3J B;  5D2M B;  3QX1 A;  1VZ6 A;  4EFO A;  1UBQ A;  2MA9 B;  3AUL A;  3D32 A;  3MFG A;  2KDI A;  3S2A A;  2PEA A;  4HRS A;  4I6L B;  4HPM B;  2G4S A;  3RUL A;  3A33 B;  3ZRC A;  2MLB A;  3APC A;  4WJO A;  1C79 A;  2MJ3 A;  3QQ8 B;  3GB1 A;  4LNK A;  3KYC D;  2RPQ A;  2DYO A;  2KD0 A;  1UF0 A;  5IP4 D;  2K9X A;  3UQB A;  1E7P B;  2KO3 A;  3ZW3 A;  4AUQ C;  2BS4 B;  2IYD B;  3EFC A;  1P1A A;  4KKI A;  2MW5 A;  1JCK B;  2ZVO A;  4MGK E;  3UQA A;  2TSS A;  4KSK C;  1E7V A;  1L6V A;  3APF A;  2R61 A;  1R4N B;  3ML9 A;  5J18 A;  1IBX B;  3M63 B;  4NAM A;  3R2I A;  5KHO A;  2PVO D;  2VH2 A;  2N9K A;  2DZI A;  4ZRK A;  4W9L A;  3N1X C;  4A3O A;  2J4X A;  1J7B A;  5E6J A;  2WYQ A;  2O6V D;  1I7H A;  3ZIM A;  5DPW A;  3PO0 A;  4ARC A;  1GPX A;  2JUO A;  1NDD A;  1F77 A;  2FAZ A;  1E8W A;  1YN4 A;  3IAS 1;  1E5W A;  4C7Y A;  1FNU A;  3AB5 A;  4L2Y A;  4NY0 A;  3AEG B;  4GXB A;  1YOV B;  3H7P A;  2LJI A;  2KWC A;  3ZKJ C;  1UUP A;  2AWT A;  1D5M C;  4RGO S;  3ZTC A;  4KZ0 A;  3N32 A;  4GGQ A;  2LHD A;  3AXC A;  1AW7 A;  2DAF A;  3Q3F A;  4KIK A;  3V61 A;  4US8 A;  2IO3 B;  3TJP A;  4YTM B;  4RNA A;  2V3S A;  1HEZ E;  2OJR A;  3SFE B;  1NI2 A;  5EDS A;  2ZW1 A;  4M02 A;  2BW2 A;  3HUI A;  5BO4 B;  1TKY A;  1VCB A;  3QHT A;  3B9J A;  2KMA A;  5HFY A;  4I6P A;  3R7Q A;  4HK2 A;  4HVB A;  3VR9 B;  4DXG A;  4Q2J A;  3Q3O C;  3NVV A;  1SE3 A;  4RMA A;  4XX5 A;  1V1O A;  1TY2 A;  4MDK E;  2O2V B;  2JPH A;  2LXC A;  1PYW D;  4W9E A;  2ZPY A;  4LJO B;  2MBE A;  3V6E B;  3EFU A;  4EUT A;  4GDL B;  1V97 A;  2J0J A;  3PPA A;  5I4D A;  1EWY C;  2ZVN A;  2HTM E;  4IWQ A;  1SE2 A;  1ZW7 A;  3MC8 A;  4K81 A;  5IAA C;  3Q6B A;  3AN1 A;  1VRA B;  1K8R B;  2WXK A;  4WUR A;  1FFV A;  2WS3 B;  3KW5 B;  2J52 A;  1Z2M A;  3T3N A;  4WJN A;  1C77 A;  1HQR D;  1P9D U;  2WDQ B;  3ZRF A;  1OTR B;  2WXG A;  2CR5 A; 
#chains in the Genus database with same CATH homology
 4A9A A;  3BII D;  1ZXI A;  2JZP A;  2WDV B;  1FXI A;  1NEK B;  1K52 A;  2BS2 B;  1XXG A;  1RYJ A;  3NVW A;  1ESF A;  1FRR A;  1SIJ A;  3P63 A;  1EU3 A;  1K53 A;  5D7G A;  1AYF A;  3O13 A;  2JSV X;  2ACZ B;  2WNM A;  2V3P A;  2WQY B;  1QT9 A;  2K3U A;  1D6E C;  5EE0 A;  5H8Y E;  2H88 B;  5BMH A;  3BVZ A;  2EEL A;  1FXA A;  1PGA A;  2N0S B;  1KLG D;  3FC4 A;  3AEF B;  4YSZ B;  1CQV A;  2EKI A;  2PIA A;  1ACC A;  3Q8B A;  1JWB D;  1ZE3 D;  1ENF A;  2M0A A;  5D3I B;  2WXI A;  4JE3 B;  2DWQ A;  3Q8A A;  2WXH A;  1P7E A;  1XCQ L;  1YN3 A;  3HVD A;  2J53 A;  2W54 A;  4XDD A;  3W2D A;  3MP9 A;  3HVZ A;  4YT0 B;  4RH6 A;  1UWM A;  1XCT L;  2KAJ A;  3E9S A;  1MI0 A;  1OFF A;  4REZ A;  1HZ6 A;  2CJN A;  1B9R A;  2G1E A;  3KWV A;  1NI3 A;  2SEB D;  2N9L A;  2AQ2 B;  3TEY A;  3AED B;  4NZL B;  1Y56 A;  3TUO A;  1KF6 B;  2E6X A;  1IUE A;  3IT4 B;  4P6V F;  2V3N A;  3EA6 A;  3IXS A;  3AEB B;  2WDR B;  3AEC B;  5AUK A;  1SJH D;  3B2F A;  2IGD A;  5JXV A;  3DWM A;  2W3S A;  2H89 B;  4ZHO A;  3AMZ A;  4HEA 1;  4N6E B;  3RPF C;  1JRP A;  2K0P A;  3FIL B;  3WCQ A;  1SSN A;  4YSY B;  2LUM A;  1YJI A;  1R7S A;  4EE2 A;  4TQ1 A;  1E10 A;  3P1M A;  3SR6 A;  4ZHP A;  1ROE A;  4GLS C;  4XDC A;  3V3X A;  1RM6 C;  3ZJT A;  1C4C A;  1FD6 A;  3RFZ B;  1BXT A;  2ON8 A;  1PGB A;  1N61 A;  1C76 A;  4A6Q A;  1BUI C;  1C78 A;  1T5X D;  1TYG B;  2PW9 A;  2RMM A;  1FIQ A;  4US9 A;  3AEE B;  2E3T A;  2WXP A;  3BVM A;  4RGN A;  4ZRP A;  2W55 A;  2LGI A;  4USA A;  4NAW B;  3VRA B;  2KN4 A;  3AM9 A;  1F2R I;  3AE2 B;  2IJ0 A;  3GP7 A;  5LNK 1;  1QIL A;  3LYY A;  3BK2 A;  1MHH E;  4OZA A;  5BYR A;  4XWW A;  1HZ5 A;  1MVK A;  2IDY A;  2Q5W D;  2Y5P A;  3MC0 B;  1VDV A;  2VZK D;  2WXF A;  1MHX A;  1JQ4 A;  3AE3 B;  1IBX A;  4RF1 A;  1GOZ A;  1ZPS A;  2WXO A;  1MPE A;  1NYQ A;  3LXF A;  2RDH A;  1TKE A;  3SFD B;  3U4E G;  5BYS A;  1KFY B;  1XLN A;  2M56 B;  2MJD A;  1L5P A;  2RPV A;  1J7A A;  1ZOY B;  4KX6 B;  1L0X B;  2CU3 A;  1QF6 A;  1C4A A;  3I9V 1;  2IGG A;  4IKG A;  1ZXH A;  2FE8 A;  2QEJ C;  2NTT A;  1DYQ A;  1QLB B;  3BK1 A;  1PFD A;  3FIL A;  2OHF A;  1VZ7 A;  2AQ1 B;  3E56 A;  5BYQ A;  4YSX B;  1WYG A;  3U2S C;  3TEZ A;  4PT5 A;  4M0W A;  3U52 E;  1TS4 A;  4AQ7 A;  1GB1 A;  3T3O A;  3UI3 A;  1I4R A;  4KGT A;  1UWX A;  5T8I A;  1QOA A;  2XN9 C;  1N63 A;  3BVG A;  4RF0 A;  3BYY B;  1STE A;  2K22 A;  2RDG A;  1UGJ A;  3AE6 B;  1P7F A;  4L1B A;  5H92 C;  4CQN A;  1VZ8 A;  2M19 A;  2NTS A;  1KRH A;  4R3D A;  2I2Y A;  4WQM A;  3Q8C A;  2HDE A;  2W3R A;  1ZDV A;  1D5Z C;  2WP9 B;  1V1P B;  1FFU A;  4OZC A;  4LLG M;  3CIR B;  3KQ4 A;  5AUI A;  1IGC A;  2BS3 B;  1C9F A;  5G5G A;  1V8C A;  4WH4 A;  3J9C A;  3NVZ A;  1VJK A;  1M4V A;  1EWC A;  2K5P A;  3EUB 2;  2L83 A;  4HKQ A;  1N62 A;  4TMA B;  2PLP A;  4KKJ A;  3URY A;  5C2T B;  3TEW A;  4JPS A;  4XE0 A;  1FO4 A;  3B2G A;  1TY0 A;  1RFK A;  1ZUD 2;  4JWS C;  4RGT A;  3Q69 A;  2WXN A;  4ZYS A;  1HXY D;  4A8X C;  4P16 A;  1PGX A;  1TS5 A;  3BYT B;  3SEB A;  2QIE B;  3DWG C;  3BWU D;  4C7Z A;  4TQ0 A;  4ITK A;  4OW0 A;  5EE3 A;  3FAH A;  4B0M A;  1CJE A;  5FKA C;  3GS2 A;  1XLP A;  4AS1 A;  4RCO A;  3BZD B;  3IT6 B;  4KGR A;  1B1Z A;  1LO5 D;  1JWA D;  2ONQ A;  1GAQ B;  2B76 B;  3NS1 A;  1YJJ A;  2BBC A;  1ET6 A;  4YTN B;  3P42 A;  2KAC A;  1K50 A;  3R2T A;  3AE1 B;  1YQ3 B;  5G5H A;  1K51 A;  2KMM A;  2JU6 X;  1BML C;  4YXD B;  3HRD D;  4OHJ A;  2WXJ A;  3ZGZ A;  4LK0 M;  2BYT A;  1QKZ A;  2GRI A;  2WU5 B;  1IGD A;  2L32 A;  1HA5 A;  2WXR A;  5HHD G;  1TS2 A;  1WWT A;  4HJG E;  2WXM A;  2KWD A;  4FXC A;  1OQQ A;  1FEH A;  3W5U B;  2L1A A;  4MH8 A;  2FBW B;  4WAF A;  2JXT A;  1AWD A;  1I4G A;  2MJE A;  1UNS A;  2LEK A;  1SBB B;  3LB8 C;  4N59 A;  4GDK B;  1YNT E;  3W1S A;  2L52 A;  1XF5 L;  3Q8F A;  4WWM A;  2DYM A;  1NEN B;  5HG2 A;  2BB6 A;  1XLQ A;  1NYR A;  1TKG A;  2NMQ A;  1JW9 D;  1I4P A;  1YQ4 B;  3Q8E A;  2BT6 A;  4OZB A;  1KH0 A;  2KQ4 X;  2LHE A;  4MAC A;  1QOF A;  4B0E A;  2ZW0 A;  1L6U A;  4UDU C;  4XWT A;  4ARI A;  4MM3 B;  1SXT A;  5FK9 C;  2PKO A;  1C4P A;  1PUT A;  1EU4 A;  2WXQ A;  3ZJV A;  4N58 A;  3AE4 B;  1QQR A;  1I4X A;  4L23 A;  2G9H D;  3P4S B;  5C3J B;  2DBY A;  2ICI A;  1F2R C;  3U7Z A;  1VZ6 A;  4ZRQ A;  5GXG B;  2QIL A;  3MFG A;  3ETR A;  1F0Z A;  2QSD A;  2JYE A;  3CWI A;  2W82 A;  3EGR A;  2QMT A;  3ZJU A;  1FNV A;  3AE8 B;  3P4R B;  4HRS A;  3PZ8 A;  3MHZ A;  2Y5C A;  1JRO A;  3P4P B;  3AEA B;  1JML A;  1C79 A;  4TSS A;  3I57 A;  4HKZ E;  3ZQ4 A;  2MJ3 A;  4WIP A;  3GB1 A;  1E0Z A;  1FCL A;  2DYO A;  2LFI A;  1ZP0 B;  2K9X A;  3ZYY X;  3N9Y C;  5D3D A;  4DXF A;  1E7P B;  1TS3 A;  2BS4 B;  2V4I B;  4O1N A;  2XNA C;  5FR3 A;  1QOG A;  4KKI A;  2DLB A;  2MH7 A;  1YN5 A;  3TSS A;  1WRI A;  1JCK B;  2JX5 A;  2JWU A;  3AE5 B;  4OVZ A;  2N7J A;  4NJC A;  2TSS A;  3C8Y A;  1JAL A;  1L6V A;  3NRZ A;  3VQI A;  3VR8 B;  3KLS X;  2I38 A;  2R61 A;  2YEP F;  1IBX B;  2VZK B;  1V1P A;  4NAM A;  5HI1 A;  1N60 A;  4YWG G;  3R2I A;  1YMH E;  2PVO D;  4HRO A;  1OQR A;  1EM7 A;  2N9K A;  4IOI E;  2INP E;  4RGM A;  1KLU D;  3NVY A;  2J4X A;  1L0Y B;  3AV8 A;  1J7B A;  5E6J A;  2IPK D;  2INN E;  1PDX A;  4JX1 C;  2Z8L A;  1RWS A;  1I7H A;  2AX5 A;  1XO3 A;  3PO0 A;  2GI9 A;  4ARC A;  2PMV A;  1GPX A;  1FNW A;  2WU2 B;  1F77 A;  5MPO A;  1YN4 A;  3IAS 1;  4DQO C;  1DGJ A;  4JWU C;  1FM0 D;  4C7Y A;  1FNU A;  1N5X A;  3AB5 A;  4L2Y A;  3AEG B;  2BB5 A;  3PZ7 A;  4KGS A;  4A90 A;  1Q10 A;  2OED A;  1L4Z B;  2LJI A;  3MJ5 A;  2MEK A;  2X38 A;  1T6B X;  1SEB D;  2WXL A;  1UUP A;  1FCC C;  1D5M C;  1I4Q A;  1KTK A;  1FRD A;  1JWU D;  4RGO S;  3W9C B;  2YEP B;  2PTL A;  1N5W A;  2SAK A;  2LHD A;  1AW7 A;  3IAM 1;  2IGH A;  1CZP A;  3W5V B;  4H2A A;  5TSS A;  1CK1 A;  4US8 A;  2PVG C;  1D4B A;  3ABV B;  1E9M A;  2QJL A;  1WGK A;  4YTM B;  4RNA A;  1E6E B;  1DOY A;  4MT5 A;  1HEZ E;  4YTP B;  3SFE B;  3V05 A;  1QOB A;  1SE4 A;  2Y3A A;  1A70 A;  2ZW1 A;  4RFB A;  2FUG 1;  1ET9 A;  2BW2 A;  3HUI A;  1L4D B;  2JYT A;  2KDM A;  2WLB A;  1TKY A;  3B9J A;  2LMC A;  3L4P A;  1XLO A;  3AE7 B;  1WXQ A;  3KWL A;  5HFY A;  1DOI A;  1D5X C;  1VLB A;  3VR9 B;  1SJE D;  3P4Q B;  5BMI A;  4DXG A;  4Q2J A;  1XEE A;  3NVV A;  1GB4 A;  2CJO A;  1SE3 A;  1JWM D;  3NUH B;  1V1O A;  1TY2 A;  4J3O D;  3OWE B;  1DOX A;  2J42 A;  4C80 A;  2GB1 A;  3H8H A;  1PYW D;  4ZOH C;  2D5G A;  2BTE A;  5EE9 A;  1NVI D;  1VR9 A;  2AQ3 B;  1I4H A;  4D2K A;  4GDL B;  1V97 A;  5EE1 A;  2V0G A;  1JWS D;  5I4D A;  3VRB B;  1EWY C;  1T3Q A;  1L0V B;  2HTM E;  4A55 A;  1FMA D;  1SE2 A;  1SF0 A;  4C56 C;  1WSP A;  3AN1 A;  1VRA B;  2WXK A;  4WUR A;  3R8B A;  1FFV A;  2WS3 B;  3T3N A;  2J52 A;  1J7C A;  2JQR B;  3NZ3 A;  1C77 A;  1HQR D;  1SB3 C;  1TZO A;  2WDQ B;  3TEX A;  4IDI A;  3AE9 B;  3AH7 A;  1ZDX A;  5BMG A;  4LTU A;  1TJE A;  2WXG A;  1AN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...