4N6EB

Crystal structure of amycolatopsis orientalis bexx/cyso complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
89
structure length
89
Chain Sequence
AVTVSIPTILRTHTGGEKSVEAKGATVLEIIDDVESRHAGIKARLVKEEKLHRFINVYVNDEDVRFSGGLEAEVKDGDTLTILPAVAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Co-opting sulphur-carrier proteins from primary metabolic pathways for 2-thiosugar biosynthesis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Lyase/biosynthetic protein
molecule keywords Putative thiosugar synthase
total genus 22
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2013-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4n6eB00
1WXQA 2MJ3A 3NRZA 1N61A 1QOBA 2K9XA 4A9AA 1FM0D 3AEEB 3W5UB 4WWMA 4C7YA 5EE0A 1QT9A 4KX6B 1JWAD 1QLBB 1XO3A 3AE8B 4N59A 1SB3C 3NVWA 1E0ZA 1RM6C 1SF0A 1IUEA 2L83A 3SFDB 5EE3A 2WS3B 4C7ZA 3AM9A 4JWUC 1FXIA 2KAJA 3AEGB 4US8A 4P6VF 3ETRA 3AH7A 2AX5A 3AEFB 5G5GA 1I7HA 2M19A 1N5XA 2EKIA 2FBWB 2K5PA 4N58A 3HRDD 4US9A 1YQ3B 4HRSA 1J7CA 4YTNB 1NYRA 5EE9A 4YT0B 1DGJA 5GXGB 3AE1B 1PFDA 2K22A 2JX5A 4YTPB 5AUKA 1NENB 1PDXA 1E7PB 1TYGB 1XLQA 1WRIA 3VRBB 1YQ4B 1JW9D 1TKYA 2L52A 3RPFC 2W54A 1WWTA 2WDQB 1RFKA 3AEAB 1OQRA 3FC4A 4JWSC 5EE1A 2MH7A 2JQRB 2M56B 2QIEB 4HROA 1L6VA 1KF6B 1QOFA 1TKGA 3AV8A 1YJJA 1F0ZA 2OHFA 2QJLA 2W3RA 3CWIA 2PVGC 1TKEA 2HTME 1AWDA 1ZOYB 2MJEA 3B2GA 1KRHA 1L0VB 2WDRB 3CIRB 1OFFA 3B2FA 1EWYC 2N0SB 3VR9B 1WYGA 4ZOHC 2E3TA 2PIAA 1NYQA 1B9RA 1FXAA 1JWBD 2B76B 2DBYA 5C2TB 1RYJA 1VJKA 2BS3B 3AB5A 1CZPA 3L4PA 2Q5WD 3NVVA 1T3QA 2PKOA 3WCQA 1J7AA 4USAA 2MJDA 2BT6A 2H89B 1N60A 5AUIA 2BS2B 3AMZA 1E10A 1FFUA 1QF6A 2KMMA 1JROA 1KFYB 5MPOA 1L6UA 1VLBA 3NVYA 1FMAD 1NEKB 1ZP0B 3HUIA 1WGKA 3AE9B 2WP9B 2PVOD 3LXFA 1TJEA 3W5VB 1GPXA 2DWQA 1L5PA 2WDVB 1E9MA 1AYFA 1OQQA 4ITKA 3DWGC 1A70A 1R7SA 3DWMA 3VR8B 3AE6B 2H88B 1J7BA 4YTMB 3ABVB 1UWMA 1DOYA 3LB8C 1XLPA 1VDVA 1JALA 2CU3A 3AECB 1E6EB 3NS1A 4JX1C 5G5HA 2LEKA 4ZHOA 1SIJA 1XLOA 3AE2B 3P4QB 2CJOA 1NI3A 1ZXIA 3AE5B 4WQMA 2WLBA 4YSYB 4YSZB 3SFEB 3P4RB 3SR6A 5H8YE 4YSXB 4C80A 1RWSA 4FXCA 4IDIA 1N63A 1FRRA 3KWLA 1XLNA 1N5WA 1FO4A 3B9JA 3BIID 1YJIA 1CJEA 3AEBB 3VRAB 1V97A 3HVZA 1DOIA 2W3SA 2WU2B 3PO0A 2BS4B 1PUTA 1V8CA 3P1MA 1JRPA 1N62A 2Y5CA 1QOAA 2G1EA 3NVZA 2WU5B 3W9CB 3P4PB 2WQYB 4LTUA 4N6EB 1FFVA 4ZHPA 1FRDA 3AEDB 5H92C 5C3JB 1QOGA 3P4SB 3AE4B 3EUB2 1ROEA 1ZUD2 2ACZB 3ZYYX 1GAQB 3AN1A 2CJNA 2W55A 3AE7B 3P63A 4YXDB 1DOXA 3AE3B 1JQ4A 3FAHA 1FIQA 1NVID
chains in the Genus database with same CATH superfamily
1VCBA 1P7FA 5EE0A 1MJDA 3O65B 4WAFA 3NVWA 3R7QA 1L2NA 2L83A 2O2VB 4BOZB 2MHJA 2M19A 4FHJA 3ZVVA 2KC2A 2KN4A 4TMAB 2BBCA 3V05A 3V60A 3KYDD 1UH6A 4I6PA 4P7IA 4AWJA 3U7ZA 2INPE 3RI7C 1JW9D 2QIEB 3EGRA 1LM8B 2ASQA 1IYFA 1AN8A 2WXGA 1OFFA 3ZUNA 2JY6A 2J0MA 2LI5A 2FUG1 4DXAB 2BS3B 2Y3AA 1XT9B 5E6NA 4RGMA 4K3CA 4ZDVA 2MJDA 5AUIA 4KKIA 2NMQA 5MPOA 5IN7A 1WGKA 3LXFA 1TJEA 4REZA 1ZDXA 2L05A 2SAKA 3ZDMC 1HXYD 5G5HA 4ZHOA 1GOZA 2LEKA 4FBJB 1JWSD 3ML8A 2KZRA 4F7ZA 3WANA 1P98A 4PK1A 3A9KB 4KIKB 2KJRA 5IO9A 1G6JA 3ZLZA 1UZXB 2DAJA 1DOIA 3GE8C 2NTTA 3V61A 2XEWA 3U4EG 3W9CB 2WXFA 2JF5A 2IGDA 2KMCA 2FIDA 5LXHA 5J18A 1FIQA 4PYZA 1WXQA 1QOBA 1WJ6A 1Y56A 3PTFC 1SE9A 1KOTA 1TZ1A 2V0GA 3LDZE 4P1CC 1TS2A 3T9LA 3HVDA 2INNE 4MEMA 1ET9A 1YQ3B 4XDDA 4GIVA 1SBBB 2JWZA 1F9JA 2R61A 2LRUA 1JWMD 1WZ3A 5EDSA 3DVNV 4BVUC 3HM3A 3Q8BA 2JYTA 2IO0B 1OQRA 1WFYA 1AARA 1WXAA 2PJHA 2VZKD 3RYTA 2MBOA 1V81A 3L10B 2QJLA 4JLCA 3B2GA 3MJWA 2ZEQA 2E3TA 1JWBD 5J2RA 3IAS1 1L4DB 3HIZA 1L4ZB 3DBHB 3DVGX 3U2SC 4IOIE 3GOEA 3KYCD 1C78A 3CMMB 3VTVA 2RDHA 5AZFA 3UIPB 2CS4A 2W82A 3DBSA 1K53A 2DX5B 4PT5A 5E6JA 4DQOC 1WI0A 3DPDA 4RM8A 3VTUA 1XLPA 4W9EA 1JALA 1WF9A 2OJRA 3V6CB 4I6LB 1WYWB 1FRRA 3FILA 3RULA 4NPNA 4YWGG 4WQOB 2QILA 1V97A 3NZUA 2W3SA 1V8CA 1N62A 2KQ4X 2ZNVC 1QOAA 5DPRA 1GC6A 3P4PB 2K0PA 4YXDB 1HZ5A 1GG3A 1YMHE 3W1SC 1NVID 3V62A 1UBIA 2GOWA 1HE8A 5BO4B 4RF1A 1EU3A 4N59A 2K8BA 1MHHE 5G55A 4XC2A 4JWUC 3RD2A 1WX9A 3EA6A 1WE7A 4RCOA 1N5XA 2FBWB 4AJWA 3N30A 1GC7A 1T0RC 3RFZB 2QC8A 3H6NA 1E7PB 2W54A 3SHQA 1RRBA 3WA0A 2OHFA 1Q0WB 2R2QA 1AWDA 3RNBC 3KLSX 2RDGA 1WMHB 1WE6A 3ZXVA 4RNAA 4MGYE 1E8XA 4HKQA 1I4QA 2LVPA 2N7JA 3JSVB 2FCMA 3O13A 2KNBA 2WXHA 3L17A 3RNGC 4FN2A 2MX2A 1QF6A 2NS5A 1WR6E 4M8NA 1TZOA 1L6UA 4LCDE 4EUTA 2QCZA 3VQIA 1GB4A 2JPHA 3U30A 1J0GA 1Q10A 3X23A 1SEBD 4JX1C 1F2RI 2WXKA 3R3MA 2WXRA 2AL3A 1WM2A 3EECA 4MGKE 2M0XA 3NG0A 3VH3B 2J0KA 3BIID 4ICUA 3PO0A 3EFUA 2INDC 1M4VA 2HTHA 3H7PA 2GBNA 2WXOA 4HWIB 3P4SB 3AE4B 2DHZA 2ZW1A 3PRZA 4A8XC 2WXNA 4A9AA 4LNKA 1F1HA 1FD6A 3UIOB 2MP2B 1C3TA 2KJ6A 3UI3A 1SF0A 1XEEA 4C56C 4J3OD 1ZKHA 3PSEB 3AEFB 2JXTA 1NYRA 4C00A 3ZRCA 3C8YA 3U52E 1V80A 3TJPA 1DYQA 1RFKA 1V1PA 3QHTA 2JZPA 3N3KB 5EE1A 1YOVB 1RAXA 3VAWA 1L6VA 2JT4B 2KTRA 1UF0A 2W3RA 4O1NA 4LK0M 1STEA 1IGDA 4A6QA 3E56A 2PEAA 3R8BA 3EFCA 2D10A 4AOFA 3VVWB 1C4PA 2DZJA 2JZZA 2Q5WD 2MWSB 4XYCA 4NJ6A 1XCTL 3IT4B 1I4RA 3TUOA 4D2KA 3QJZA 4B9KA 2PW9A 2BS2B 3M63B 1I4GA 4XZ4A 3PS6A 1Z5SB 2DZMA 2K8HA 2LHDA 3GP7A 2UYZB 4NAWA 4RH6A 2EMTA 2IGGA 4J6IA 3CF6E 1UWXA 1E90A 1C9FA 1D5XC 3QIJA 2KFKB 4FXCA 3A9JA 2WNMA 1FO4A 5DPSA 3TIXA 4FLHA 2N1WA 3RCZA 2R2OA 1V2YA 5I4DA 4ANVA 2Y5CA 2C60A 4M02A 2O2VA 5C3JB 1ROEA 4HJGE 3LJ3A 1R4MI 4DXFA 2RPVA 4BBNF 3ZJUA 1SSNA 2REXA 3B0AA 3W5UB 3R2TA 1MPEA 1PGBA 1RM6C 1WGHA 3ZNHB 1SJHD 3RN9C 1T0SC 3I63C 4HRSA 3CSTA 4WJPA 5EE9A 2HJ1A 2K22A 1UD7A 1SXTA 1EM7A 4E3CA 3NUHB 4NJ7A 4NAMA 1K52A 1TY2A 2KOXA 4WJQA 2GLSA 2ZPYA 1WM3A 1SIFA 1C77A 5C2TB 5LNK1 2BF8B 4LNIA 4ACFA 4MJSA 1K8RB 1H4RA 1YN4A 2IO1B 3NOBA 3M95A 4KZCA 1ZE3D 1MI0A 1TS5A 3NVYA 2ZCBA 3AE9B 5TR5A 4FA6A 2BYTA 1L5PA 1L7YA 4YTMB 4KKJA 4RGTA 3OLMD 3ABVB 1UWMA 3ECIA 4FULA 4BOSC 4RMAA 3IVFA 4RF0A 3IG3A 3AE2B 3P4QB 4R3DA 1WJUA 2LHEA 5D6JB 3DHIC 2G3QB 3AE5B 4WQMA 2WXMA 4YSYB 4YSZB 3SFEB 3P4RB 4MH0E 4HCPB 3Q3JA 1FNWA 4CQNA 3IHPC 1PGXA 2AQ2B 1CJEA 5HFYA 2KACA 2WU2B 2RR9A 4NQLB 4XE0A 3NZSA 3AN1A 2CJNA 2W55A 2KDBA 2AQ3B 2J0JA 1JQ4A 1GPXA 1OQYA 1FPYA 4MSQB 4GLSC 1WIAA 4IWQA 2IGHA 1QT9A 4KX6B 3AE8B 1SB3C 1P9DU 1TBEA 1MHXA 4C7ZA 2N7DA 1MVKA 2WHIA 1D6EC 4B0MA 1ZPSA 4DHJD 4II3B 4YT0B 4GDKB 4W9GA 2WDTB 4EZLA 1TYGB 1WR1A 3AEAB 4WURA 3Q3FA 2LD9A 2G4SA 4HKZE 1P0RA 1YJJA 4HPLB 1TKEA 3ZIMA 2KVZA 2I2YA 2XK5B 2FE8A 3UGBB 2PIAA 4C4VA 2OEDA 3L4PA 5DPWA 4OZAA 2J42A 5CTRC 1X1MA 4G3XB 2MRPA 3PLUA 5JHBA 2H89B 2N4FA 1B1ZA 4MH8A 2WX0A 2WGSA 4K1RB 1BT0A 5D94A 1T0QC 3H7SA 3RT3B 4S0RA 4XX5A 4WWNA 5BYQA 1ZGUB 4PYUA 2HD5B 4OZCA 2WLBA 1T5XD 3B08A 4M00A 4EKUA 2NBVB 2MBBB 2AWTA 3AEBB 3HVZA 2ON8A 1WXSA 1LXDA 3KWVA 4DHJB 4GB9A 1V86A 2IO3B 1NI2A 5T8IA 2GBKA 5H92C 3H1UA 4NQKE 4P16A 1ZUD2 4PS8A 2N9LA 1I42A 3IAM1 2K9XA 1V49A 3HHMA 3QA8A 3GB1A 3ZRFA 2RD0A 3EC8A 4IUMB 2BYEA 1IUEA 3EHVA 3VXWA 2L0FA 4MM3A 3L08A 3DBRI 1I7HA 1WGDA 2KWDA 2N9EB 2WXIA 4FHKA 4KGSA 1J7CA 1XQQA 2FUHB 4PS7A 3AE1B 3RZWC 1QQRA 4XDCA 1AW7A 1I4XA 5TSSA 2MQJA 2NCNA 4GSWA 2Z0DB 1QOFA 2WWZA 2CHWA 3ZQ4A 3BVZA 2PVGC 3CIRB 4KGTA 4WAAA 3K9PB 3ZW3A 5L83A 2YVCA 2M17A 1NYQA 2B76B 3PPAA 2KYWA 3BY4B 4W9JA 2BGFA 5FR3A 1K50A 2FCNA 1XCQL 3QC8B 3AMZA 4S17A 1FFUA 2LXCA 2KMMA 2ZVNA 1JROA 3GZNI 1VLBA 3LYYA 3ZJVA 4CO7A 3E9SA 4EFOA 2D3AA 1D4BA 1VZ6A 3ZTDA 3FILB 2DAFA 3AECB 4W9CA 3L16A 2I1JA 5FK9C 2IYDB 2SEBD 4B0EA 3U8ZA 2KN5A 4OVZA 1RWSA 2AEHA 1WMHA 2MSED 5BYRA 3A4RA 4ZRPA 3Q8FA 1BMLC 2L1AA 3A33B 5LLIA 2EKEC 2WU5B 2WQYB 1SJED 4EZKA 2V9HA 1WH3A 3SU8X 4BFRA 4AS1A 1GJZA 4M0WB 2FCQA 2MBQA 2LJIA 3DCGA 3U7DA 1XO3A 1YIWA 3KH0A 2O6VB 3NHEB 4DHZB 5G5GA 1YJ1A 2MLBA 3N1XC 3UINB 1QKZA 3M62B 3PRPB 1WXVA 2B3AA 2KWUB 2GB1A 3TL5A 3FC4A 2JQRB 4TQ1A 3FKYA 1KF6B 3AV8A 2L7RA 5JH5C 1ZOYB 4C4VB 4ARCA 3Q8CA 2N9PC 4NNJB 4WWOA 4ZOHC 3GS2A 2WXQA 2LGYA 1YQBA 1CZPA 4TUUA 4KV2A 2PKOA 2LVQA 4JGHB 3BVMA 1V1PB 3L13A 4MDKE 4FADA 1KJTA 3DVGY 1CMXB 3V3XA 2XBBC 3VR8B 4AP4C 2O6VD 3LB8C 3Q8AA 2V1YA 3Q3NC 1VD2A 4HPMB 4IC7B 2GBJA 2M0AA 2MW5A 3MHZA 2ICIA 3A9KA 4KIKA 4BBNC 1XLNA 4RFBA 2FNJB 3P42A 1BUIC 2INCC 4L1BA 3H7PB 2KLCA 3OG5A 2PPHA 3MFGA 3R7RA 2N9KA 3AI5A 4CHKA 2KLGA 3MP9A 1QOGA 2VRRB 4K7WA 4DBGA 3ZKJC 2WXJA 2BW2A 4ASWC 1YN3A 1C79A 4GDLA 1J19A 1OEYA 3BVGA 4X57B 2QSDA 4HDQA 5IAAC 1ZDVA 2GMIC 1D5ZC 3VH4B 1JMLA 1YNTE 2VH2A 5AUKA 2ZVOA 2KDMA 2KWCA 1FXTB 3VRBB 1EWCA 1T6BX 1YQ4B 2CU1A 2G45B 2LGXA 1WWTA 2WDQB 4FJYA 3RPFC 2MBEA 5DPTA 1TY0A 3OWEB 4FJZA 4GDLB 2FIFA 4ANXA 1R4MB 1I35A 2K1FA 2N0SB 1LFDA 4DK5A 5IP4D 3TEZA 4ZRQA 5E6OA 4HJKA 2BKRB 5GMVA 2YEPB 4IM2A 4JPSA 2QMTA 4NAWB 4KGRA 4MJSB 3T8MA 4YL8A 1UBQA 1NEKB 5HKHA 2K3UA 3RNAC 2RPQA 3KUZA 1C1YB 1AYFA 4ITKA 1TS3A 4XWWA 2CHZA 4DDID 2CU3A 3PHWB 2KFJA 4WJOA 4XWTA 4W9HA 3N1YC 2MEKA 2PLPA 2LRWA 3ML9A 4KDLB 4OZBA 4LNNA 1ET6A 1ZXHA 4MM3B 5L95C 2EELA 3VRAB 4ANWA 5BMIA 3MTNB 1EUVB 4KSLC 3IXSA 4ZHPA 3C19A 2IPKD 4DDGD 2MP2A 1XF5L 3HM6X 3UQAA 4NZLB 4C7YA 2N7EA 3JVZX 3N20C 1EF1A 1JWAD 1TS4A 1L0XB 2K6QA 1UELA 5EE3A 3AM9A 2C5LC 1E8WA 2AYOB 3HRDD 1UUPA 4YTNB 4TQ0A 1SE2A 2LGSA 1V1OA 1PFDA 2D11A 1KLUD 1PDXA 3QARA 2LVOA 5D2MB 1KM7A 3URYA 2MH7A 2M56B 1XD3B 4N9F4 3RUIB 3MC9A 1U4AA 4BKSD 1L0VB 2WDRB 2KX3A 3D32A 1PYWD 4G0NB 4K7UA 3RNFC 2DBYA 1FCCC 3AB5A 4KSKC 2ZW0A 2KJHB 2N9XA 4DWFA 3PT2B 2LASA 1N60A 1E10A 1JRUA 4HDOA 1E7VA 2GBRA 2PE6B 2OJWA 2M1MA 3DVNU 1E9MA 4MACA 3DWGC 2JRIB 2KMAA 5JXVA 4HK2A 1SIJA 3BWUD 4A3PA 2CJOA 4K7SA 1N63A 4TSSA 4HXDA 1WGRA 1WSPA 3Q6BA 1Y8RC 1C4CA 1PUTA 4DHZE 1GNUA 2ZCCA 2KTFA 1F77A 3ZGZA 3NVZA 2WXLA 1EF5A 1FFVA 3APDA 3AEDB 1L0YB 1D5MC 2JWUA 3BZDB 2KHWB 3ONSA 2MJ3A 3TEXA 2XN9C 2D2QA 3T3OA 2KDEB 1FM0D 4WWMA 3VFKA 1E0ZA 5IOIA 1Q5WB 4EZJA 3ENEA 1ISNA 2KAJA 4AUQC 3AH7A 3A1QB 4JL9A 3UF8A 3AU5A 3PZDA 4IM3A 3TEWA 4RM9A 1WRIA 2BB6A 2W9NA 4JWSC 3JYUA 4M0WA 3X0WA 1A5RA 1Q1OA 4GN1A 1HEZE 2MJEA 1EO6A 2BQQA 1JCKB 4M01A 2I1KA 2BWES 4W9IA 3NS8A 2UU7A 1VJKA 2YEPF 2DYMA 3QAQA 3QK0A 4W9FA 4P1BC 2C7MB 2LFIA 2MBHA 3DOWA 2L3ZA 3MHSD 1HTQA 3VUWA 3RNEC 1V5TA 4E74A 1FMAD 2MCNB 4LDTD 4K81A 2WP9B 1FCLA 3PV1A 4AJYB 2IY1B 4ZRIA 3DBLI 4LJOB 1H8CA 4QAYA 2KO3A 2HDEA 1LO5D 1WX8A 4II2B 3Q3MC 4NY0A 5C1ZA 2KKCA 2QHOA 2KDFB 1NDDA 3KWLA 5D3IB 2ZPNA 2IY0B 4GOCA 2K39A 2K6DB 1RFAA 1FNUA 4OVVA 1QILA 3Q8EA 3CSFA 3P2BA 2Z8LA 1DOXA 3PVLA 2VZKB 5IKCM 2RGFA 1ZW7A 3Q69A 1ENFA 1C4AA 1QLBB 4Q2JA 2UWQA 4ANUA 2J53A 3ZXRA 1T0YA 3PHXB 3ETRA 4OVUA 2EKIA 2DYOA 4LNFA 3NY5A 4HEA1 3ALBA 2D5GA 2RDBC 2NPTB 2X8XX 1OTRB 3I3TB 1HQRD 2PE9A 2JX5A 2ZJDA 4I6NB 1XLQA 1UGMA 3PRMB 4MSMB 1I4HA 4MGZE 2QDFA 2DZIA 4K3BA 4RGNA 4A20A 2D3CA 2JSVX 5BMHA 3BK1A 3A9JB 3VDZA 2LUEA 4OHJA 4HCNB 2Z0EB 2AQ1B 3BK2A 2L76A 2V4IB 5J17A 1E8ZA 1ZP0B 3HUIA 2JUOA 2PVOD 3KUDB 3W5VB 1JWUD 1OQQA 4H2AA 1A70A 4CYEA 3AE6B 2H88B 1J7BA 3AXCA 3SEBA 3VHTC 1VDVA 3TBLD 3NS1A 1E6EB 3I9V1 2KVRA 1IP9A 2EMSA 3QWZB 3VUYA 3DHHC 1QZEA 4ZYNA 3WALA 2KK8A 4KZ0A 1PQSA 3TSSA 4LLGM 4AQ7A 4ARIA 2BS4B 5JHAA 3B1LX 2IJ0A 3P1MA 3H9DA 3MC0B 1XXGA 2JXXA 3SD5A 1GAQB 1J8CA 1VZ8A 1C76A 5LXIB 2LZ6A 2KQSA 5FR6A 5JZEB 2A4ZA 3GE3C 4EEWA 5KHQA 1P1AA 2J7QB 1WGYA 4MT5A 3HK0A 3SDLC 2ZNVB 5D3DA 1MFWA 5AZGA 1S3SG 1Z2MA 2G4DB 5GXGB 2QEJC 3ZDTA 3RZFA 3DQVA 2JZ3B 1F52A 4RGOS 4HROA 1TIFA 3ZTCA 5D7GA 4BKGA 3Q2AC 4L23A 2IO2B 4JQWC 2IDYA 1VRAB 2FCSA 2GI9A 2V4LA 3Q14C 1WYGA 2XK5A 1P7EA 1YD8U 2Y5BB 3A4SC 1I4PA 2L8JA 4ZYSA 1VZ7A 4EE2A 5AEKB 2KC1A 3TMPB 1WGGA 2CKHB 1TT5B 4G50A 1WJNA 1IGCA 4MGIE 2RSUA 2C7HA 2L0TA 2WDVB 2AL6A 1XLOA 1SGHA 4WIPA 3SR6A 5H8YE 3KW5B 4IDIA 1GUAB 2KT7A 4WJNA 3RMKC 3IFWB 3ZNGC 4URKA 2RMMA 5CHWA 5HHDG 3KVFB 1IBXB 3NZ3A 3PREA 3VUXA 2BYFA 1YN5A 1MG4A 4LTUA 1LGRA 3KUCB 4HLEA 5HG2A 3IT6B 3P63A 5HI1A 3T3NA 2WYQA 3NRZA 1N61A 1M94A 2IBIB 2NVUI 3DHGC 4GMVA 2LXAA 2CHXA 2O6VA 2BPSA 2I38A 3W1SA 3DBLB 2X38A 2Z59B 2WS3B 4US8A 1FXIA 5DCNA 4P6VF 2LGIA 1OEYJ 4N58A 2M4NA 4ZRKA 3S2AA 3PLVA 4YTPB 1NENB 2E6XA 2DNFA 3WAMA 2KANA 2JU6X 3ZJTA 2WXPA 3L54A 4A3OA 2OOBB 2JYEA 2NTSA 3CWIA 2IZVB 2LUMA 1KRHA 2D07B 4W9LA 2NPTA 4GXBA 3VR9B 1B9RA 1FXAA 3OJ3A 2J4XA 2Y5PA 3C0RB 1V5OA 3I5JC 1T3QA 4ICVA 2KFKA 4W9DA 1S1QB 2DYBA 1SE4A 3TCAA 4F1SA 1TGZB 4EOYA 2M8SA 2G9HD 2LWPA 4IWOA 2KXJA 3J9CA 4F8CB 1NI3A 1ZXIA 3ZNZB 1VR9A 2C7NB 2NBUA 2J52A 3GZNB 4DXGA 3M3JA 1YJIA 1V6EA 4KVGB 2V3NA 2DZKA 2DENB 3L0WB 2G1EA 3IBEA 4B95A 1KLVA 4OW0A 1GB1A 4N6EB 1FRDA 2XNAC 1R4NB 3ZYYX 2NBWB 2CR5A 3AE7B 3AE3B 3FAHA 5E6PA 5FKAC 1E5WA 3JSVA 1NBFC 5CX3A 3SFDB 4IG7B 3APFA 3AEGB 4US9A 1HA5A 1F2RC 2JRHA 4ZRJA 3UQBA 5CHFA 3DBRB 2JVCA 1RLFA 4LJPB 2YLMA 1TKYA 2LGDA 2TSSA 2KQ7A 5IA7A 2L32A 4KDIC 1YX6B 5AZHA 4WH4A 2BYVE 2HTME 3DDCB 4BKSA 3QQ8B 1EWYC 1WY8A 3APCA 4IWPA 4M8MA 3H8HA 2V3SA 1RYJA 1KLGD 3NVVA 3PZ7A 4A90A 2KTRB 3I57A 3N32A 3PZ8A 2PTLA 3K9OB 4JE3B 1KH0A 2N1VA 1KFYB 2WX1A 2HJ8A 5G2NA 5BMGA 3OAWA 1HTOA 1ESFA 1R7SA 3DWMA 3OJ4B 5KHOA 1DOYA 2BKFA 4NJCA 3W2DA 2KWVB 4GDKA 2L00B 4IKGA 1LQBA 4HPPA 4C80A 3W1YA 4TKNA 3B9JA 4LNOA 4W9KA 5C23A 1E8YA 3BYYB 4HVBA 4UDUC 3WIMA 1HZ6A 4PS3A 2FAZA 1D3ZA 3WAPA 1FEHA 2BWFA 3V6EB 1V9JA 1FNVA 3AEEB 3AULA 3VTWA 1SE3A 2V3PA 2LMCA 1IBXA 1PGAA 4G11A 3TEYA 3ZNID 2AX5A 2GBMA 2K5PA 1UGJA 1WXMA 5CHVC 3ZO5B 1UNSA 3N1ZC 1DGJA 2BTEA 1MG8A 2KX0A 4BZAA 3MC8A 3AU4A 2K25A 3QCAA 2L52A 2VH1A 3WAOA 1TKGA 1F0ZA 3NJTA 3B2FA 3R2IA 1K51A 3QX1A 2D3BA 2GRIA 3KQ4A 4B6WA 3BINA 2HE7A 1BXTA 3WCQA 4JIOU 1J7AA 4USAA 3MJ5A 2ZZPB 2BT6A 2PMVA 3DBHI 4GGQA 4IW0A 1WJ4A 4WWPA 2KD0A 1WX7A 1KTKA 2DWQA 3Q3OC 1P3QU 1TTNA 2MA9B 1R4NI 4BAXA 3RNCC 1ACCA 2KDIA 2D3GA 1N6ZA 4LDTB 1YX5B 2A5UA 1EU4A 4L2YA 4YSXB 4TV3A 2C9WB 1CK1A 1N5WA 2LJ5A 4GU2A 5BYSA 2NR2A 1CQVA 3PGEA 3BYTB 1WRDB 2K8CA 1JRPA 2BB5A 3A1QA 4A55A 4E71A 2DLBA 1OGWA 1WZ0A 4FJVB 2BVCA 3N9YC 4IM0A 2ONQA 3EUB2 2ACZB 1IPGA 4XGAB 3JW0X 4MELA 4BKTA 3R66C 1E7UA
chains in the Genus database with same CATH topology
4DXFA 1P7FA 2RPVA 3ZJUA 1SSNA 3W5UB 2WXJA 5EE0A 2BW2A 3R2TA 1MPEA 1PGBA 4WAFA 1YN3A 3NVWA 1RM6C 1C79A 2L83A 3BVGA 1SJHD 2M19A 4MT5A 2QSDA 1ZDVA 4HRSA 5D3DA 1D5ZC 2KN4A 4TMAB 2BBCA 5EE9A 3V05A 5GXGB 2QEJC 1JMLA 1YNTE 2K22A 5AUKA 2KDMA 3U7ZA 2INPE 3VRBB 1EWCA 1JW9D 1T6BX 1YQ4B 3RPFC 1WWTA 2WDQB 1SXTA 1EM7A 4RGOS 3NUHB 2QIEB 3EGRA 4HROA 5D7GA 1TY0A 4NAMA 3OWEB 4L23A 1K52A 4GDLB 1TY2A 1AN8A 2IDYA 2WXGA 1OFFA 1VRAB 2GI9A 2N0SB 1WYGA 1C77A 1P7EA 2FUG1 1I4PA 4ZYSA 5C2TB 2BS3B 1VZ7A 5LNK1 4EE2A 3TEZA 4ZRQA 2Y3AA 4RGMA 2YEPB 4JPSA 1YN4A 2QMTA 4NAWB 2MJDA 5AUIA 4KKIA 2NMQA 4KGRA 1ZE3D 1MI0A 1IGCA 1TS5A 5MPOA 3NVYA 1NEKB 2K3UA 1WGKA 3AE9B 3LXFA 1TJEA 4REZA 2BYTA 1L5PA 2WDVB 1AYFA 1ZDXA 4ITKA 1TS3A 4YTMB 4KKJA 4RGTA 4XWWA 2SAKA 3ABVB 1HXYD 1UWMA 2CU3A 5G5HA 1GOZA 4ZHOA 4RF0A 4XWTA 2LEKA 1JWSD 1XLOA 3AE2B 3P4QB 4R3DA 2LHEA 4WIPA 2MEKA 3AE5B 2PLPA 4WQMA 2WXMA 4YSYB 4YSZB 3SFEB 3P4RB 3SR6A 5H8YE 4IDIA 4OZBA 1FNWA 4CQNA 1ET6A 1PGXA 1ZXHA 2AQ2B 4MM3B 1CJEA 5HFYA 2EELA 3VRAB 2KACA 2RMMA 1DOIA 2NTTA 5HHDG 2WU2B 1IBXB 5BMIA 3NZ3A 3U4EG 1YN5A 4XE0A 3IXSA 3W9CB 4LTUA 4ZHPA 2WXFA 5HG2A 2IGDA 3IT6B 3AN1A 2CJNA 2W55A 3P63A 2AQ3B 2IPKD 5HI1A 1JQ4A 3T3NA 1FIQA 1GPXA 1WXQA 3NRZA 1XF5L 1N61A 1QOBA 4GLSC 4NZLB 1Y56A 2IGHA 4C7YA 1QT9A 4KX6B 1JWAD 1TS4A 3AE8B 1SB3C 1L0XB 2I38A 3W1SA 2V0GA 2X38A 1MHXA 4C7ZA 5EE3A 2WS3B 1MVKA 1TS2A 3AM9A 1FXIA 3HVDA 4US8A 4P6VF 2INNE 1D6EC 4B0MA 2LGIA 1ZPSA 4N58A 3HRDD 1UUPA 1ET9A 1YQ3B 4XDDA 4YTNB 4TQ0A 1SE2A 1SBBB 4YT0B 2R61A 1V1OA 1PFDA 4GDKB 4YTPB 1KLUD 1JWMD 1NENB 1PDXA 2E6XA 1TYGB 3Q8BA 2JYTA 3AEAB 4WURA 1OQRA 2JU6X 3URYA 3ZJTA 2MH7A 2WXPA 2M56B 4HKZE 2VZKD 1YJJA 2JYEA 2NTSA 2QJLA 3CWIA 1TKEA 3B2GA 2LUMA 1KRHA 1L0VB 2WDRB 2I2YA 1PYWD 2FE8A 3VR9B 2E3TA 2PIAA 1B9RA 1FXAA 1JWBD 2DBYA 3IAS1 1FCCC 1L4DB 3AB5A 2J4XA 1L4ZB 2OEDA 2Y5PA 3L4PA 2J42A 2ZW0A 4OZAA 4IOIE 3U2SC 1T3QA 1C78A 2H89B 1N60A 2RDHA 1E10A 1B1ZA 1SE4A 4MH8A 2W82A 1K53A 4PT5A 5E6JA 4DQOC 1E9MA 2G9HD 3DWGC 4MACA 1XLPA 5BYQA 1JALA 5JXVA 1SIJA 3J9CA 3BWUD 2CJOA 1NI3A 4OZCA 1ZXIA 2WLBA 1T5XD 1VR9A 1N63A 1FRRA 4TSSA 2J52A 3FILA 4DXGA 1YJIA 4YWGG 2QILA 3AEBB 1V97A 1WSPA 2ON8A 2V3NA 3HVZA 2W3SA 1C4CA 1PUTA 1V8CA 3KWVA 1N62A 2KQ4X 1QOAA 2G1EA 1F77A 3ZGZA 3NVZA 5T8IA 4OW0A 2WXLA 3P4PB 4N6EB 1GB1A 1FFVA 1FRDA 3AEDB 2K0PA 5H92C 2XNAC 3ZYYX 1L0YB 1D5MC 1ZUD2 2JWUA 3BZDB 4P16A 4YXDB 3AE7B 2N9LA 1HZ5A 3AE3B 1YMHE 3FAHA 3IAM1 1NVID 2MJ3A 3TEXA 2XN9C 3T3OA 2K9XA 5FKAC 1FM0D 4WWMA 3GB1A 4RF1A 1EU3A 4N59A 1E0ZA 1MHHE 1IUEA 3SFDB 4JWUC 2KAJA 3AEGB 3EA6A 3AH7A 1I7HA 2WXIA 1N5XA 2FBWB 2KWDA 4RCOA 4US9A 4KGSA 1HA5A 1J7CA 1F2RC 3RFZB 3TEWA 3AE1B 1E7PB 1QQRA 4XDCA 1AW7A 1I4XA 1WRIA 5TSSA 1TKYA 2TSSA 2BB6A 2W54A 4JWSC 4M0WA 2L32A 1QOFA 3ZQ4A 2OHFA 1HEZE 3BVZA 2PVGC 2HTME 1AWDA 2MJEA 4WH4A 3KLSX 3CIRB 4KGTA 1JCKB 2RDGA 1EWYC 4RNAA 1NYQA 2B76B 3H8HA 4HKQA 1I4QA 1RYJA 1VJKA 2YEPF 2N7JA 1KLGD 2DYMA 3NVVA 3O13A 5FR3A 3PZ7A 1K50A 4A90A 3I57A 2WXHA 3PZ8A 2PTLA 4JE3B 1XCQL 2LFIA 3AMZA 1KH0A 1FFUA 1QF6A 2KMMA 1JROA 1KFYB 1TZOA 1L6UA 1VLBA 1FMAD 3LYYA 3ZJVA 3E9SA 5BMGA 2WP9B 1D4BA 3VQIA 1VZ6A 1FCLA 1GB4A 3FILB 1ESFA 1R7SA 3DWMA 1Q10A 1DOYA 1SEBD 4NJCA 3AECB 3W2DA 4JX1C 1F2RI 2WXKA 2HDEA 4IKGA 5FK9C 2WXRA 1LO5D 2SEBD 4B0EA 4OVZA 4C80A 1RWSA 3KWLA 5BYRA 5D3IB 3B9JA 3BIID 4ZRPA 3Q8FA 1BMLC 3PO0A 2L1AA 1M4VA 3BYYB 1FNUA 4UDUC 1QILA 2WU5B 3Q8EA 2WQYB 1HZ6A 2WXOA 1SJED 3P4SB 3AE4B 2Z8LA 1DOXA 1FEHA 4AS1A 2ZW1A 2VZKB 4A8XC 2WXNA 4A9AA 1FNVA 2LJIA 3AEEB 1SE3A 3Q69A 1FD6A 1ENFA 1C4AA 1QLBB 2V3PA 1XO3A 2LMCA 4Q2JA 1IBXA 3UI3A 4C56C 1SF0A 1PGAA 1XEEA 2J53A 4J3OD 3TEYA 3ETRA 2AX5A 3AEFB 5G5GA 2EKIA 2DYOA 2K5PA 4HEA1 1QKZA 1UGJA 2D5GA 2JXTA 1NYRA 1UNSA 3C8YA 1DGJA 1HQRD 3U52E 2BTEA 2GB1A 2JX5A 1XLQA 2L52A 3FC4A 1DYQA 1RFKA 1I4HA 1V1PA 2JZPA 5EE1A 2JQRB 4TQ1A 1L6VA 1KF6B 1TKGA 3AV8A 4RGNA 1F0ZA 2W3RA 2JSVX 1ZOYB 4O1NA 3B2FA 3R2IA 3Q8CA 1K51A 1STEA 4LK0M 5BMHA 1IGDA 4ARCA 2GRIA 3BK1A 4A6QA 4ZOHC 3E56A 3R8BA 3KQ4A 4OHJA 3GS2A 2WXQA 1C4PA 1CZPA 2Q5WD 2PKOA 1BXTA 3WCQA 1XCTL 2AQ1B 1I4RA 3IT4B 3TUOA 4D2KA 1J7AA 4USAA 3BK2A 3MJ5A 3BVMA 2BT6A 2PMVA 1V1PB 2PW9A 2BS2B 2V4IB 1I4GA 1ZP0B 3HUIA 2PVOD 3W5VB 1JWUD 1KTKA 3V3XA 2DWQA 1OQQA 2LHDA 3GP7A 4H2AA 1A70A 3VR8B 3AE6B 2H88B 1J7BA 3SEBA 4RH6A 3LB8C 1VDVA 3Q8AA 1ACCA 3NS1A 1E6EB 2IGGA 3I9V1 1UWXA 2M0AA 1C9FA 1EU4A 3MHZA 4L2YA 4YSXB 1D5XC 4FXCA 2ICIA 1XLNA 2WNMA 1CK1A 1N5WA 1FO4A 5BYSA 3TSSA 1CQVA 4RFBA 3BYTB 4LLGM 3P42A 4AQ7A 4ARIA 1BUIC 5I4DA 2BS4B 4L1BA 2IJ0A 1JRPA 2BB5A 3P1MA 2Y5CA 4A55A 2DLBA 3MFGA 2N9KA 3MC0B 1XXGA 3MP9A 3N9YC 1QOGA 5C3JB 2ONQA 3EUB2 1ROEA 2ACZB 1GAQB 1VZ8A 4HJGE 1C76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXQ A;  2MJ3 A;  3NRZ A;  1N61 A;  1QOB A;  2K9X A;  4A9A A;  1FM0 D;  3AEE B;  3W5U B;  4WWM A;  4C7Y A;  5EE0 A;  1QT9 A;  4KX6 B;  1JWA D;  1QLB B;  1XO3 A;  3AE8 B;  4N59 A;  1SB3 C;  3NVW A;  1E0Z A;  1RM6 C;  1SF0 A;  1IUE A;  2L83 A;  3SFD B;  5EE3 A;  2WS3 B;  4C7Z A;  3AM9 A;  4JWU C;  1FXI A;  2KAJ A;  3AEG B;  4US8 A;  4P6V F;  3ETR A;  3AH7 A;  2AX5 A;  3AEF B;  5G5G A;  1I7H A;  2M19 A;  1N5X A;  2EKI A;  2FBW B;  2K5P A;  4N58 A;  3HRD D;  4US9 A;  1YQ3 B;  4HRS A;  1J7C A;  4YTN B;  1NYR A;  5EE9 A;  4YT0 B;  1DGJ A;  5GXG B;  3AE1 B;  1PFD A;  2K22 A;  2JX5 A;  4YTP B;  5AUK A;  1NEN B;  1PDX A;  1E7P B;  1TYG B;  1XLQ A;  1WRI A;  3VRB B;  1YQ4 B;  1JW9 D;  1TKY A;  2L52 A;  3RPF C;  2W54 A;  1WWT A;  2WDQ B;  1RFK A;  3AEA B;  1OQR A;  3FC4 A;  4JWS C;  5EE1 A;  2MH7 A;  2JQR B;  2M56 B;  2QIE B;  4HRO A;  1L6V A;  1KF6 B;  1QOF A;  1TKG A;  3AV8 A;  1YJJ A;  1F0Z A;  2OHF A;  2QJL A;  2W3R A;  3CWI A;  2PVG C;  1TKE A;  2HTM E;  1AWD A;  1ZOY B;  2MJE A;  3B2G A;  1KRH A;  1L0V B;  2WDR B;  3CIR B;  1OFF A;  3B2F A;  1EWY C;  2N0S B;  3VR9 B;  1WYG A;  4ZOH C;  2E3T A;  2PIA A;  1NYQ A;  1B9R A;  1FXA A;  1JWB D;  2B76 B;  2DBY A;  5C2T B;  1RYJ A;  1VJK A;  2BS3 B;  3AB5 A;  1CZP A;  3L4P A;  2Q5W D;  3NVV A;  1T3Q A;  2PKO A;  3WCQ A;  1J7A A;  4USA A;  2MJD A;  2BT6 A;  2H89 B;  1N60 A;  5AUI A;  2BS2 B;  3AMZ A;  1E10 A;  1FFU A;  1QF6 A;  2KMM A;  1JRO A;  1KFY B;  5MPO A;  1L6U A;  1VLB A;  3NVY A;  1FMA D;  1NEK B;  1ZP0 B;  3HUI A;  1WGK A;  3AE9 B;  2WP9 B;  2PVO D;  3LXF A;  1TJE A;  3W5V B;  1GPX A;  2DWQ A;  1L5P A;  2WDV B;  1E9M A;  1AYF A;  1OQQ A;  4ITK A;  3DWG C;  1A70 A;  1R7S A;  3DWM A;  3VR8 B;  3AE6 B;  2H88 B;  1J7B A;  4YTM B;  3ABV B;  1UWM A;  1DOY A;  3LB8 C;  1XLP A;  1VDV A;  1JAL A;  2CU3 A;  3AEC B;  1E6E B;  3NS1 A;  4JX1 C;  5G5H A;  2LEK A;  4ZHO A;  1SIJ A;  1XLO A;  3AE2 B;  3P4Q B;  2CJO A;  1NI3 A;  1ZXI A;  3AE5 B;  4WQM A;  2WLB A;  4YSY B;  4YSZ B;  3SFE B;  3P4R B;  3SR6 A;  5H8Y E;  4YSX B;  4C80 A;  1RWS A;  4FXC A;  4IDI A;  1N63 A;  1FRR A;  3KWL A;  1XLN A;  1N5W A;  1FO4 A;  3B9J A;  3BII D;  1YJI A;  1CJE A;  3AEB B;  3VRA B;  1V97 A;  3HVZ A;  1DOI A;  2W3S A;  2WU2 B;  3PO0 A;  2BS4 B;  1PUT A;  1V8C A;  3P1M A;  1JRP A;  1N62 A;  2Y5C A;  1QOA A;  2G1E A;  3NVZ A;  2WU5 B;  3W9C B;  3P4P B;  2WQY B;  4LTU A;  4N6E B;  1FFV A;  4ZHP A;  1FRD A;  3AED B;  5H92 C;  5C3J B;  1QOG A;  3P4S B;  3AE4 B;  3EUB 2;  1ROE A;  1ZUD 2;  2ACZ B;  3ZYY X;  1GAQ B;  3AN1 A;  2CJN A;  2W55 A;  3AE7 B;  3P63 A;  4YXD B;  1DOX A;  3AE3 B;  1JQ4 A;  3FAH A;  1FIQ A;  1NVI D; 
#chains in the Genus database with same CATH topology
 1VCB A;  1P7F A;  5EE0 A;  1MJD A;  3O65 B;  4WAF A;  3NVW A;  3R7Q A;  1L2N A;  2L83 A;  2O2V B;  4BOZ B;  2MHJ A;  2M19 A;  4FHJ A;  3ZVV A;  2KC2 A;  2KN4 A;  4TMA B;  2BBC A;  3V05 A;  3V60 A;  3KYD D;  1UH6 A;  4I6P A;  4P7I A;  4AWJ A;  3U7Z A;  2INP E;  3RI7 C;  1JW9 D;  2QIE B;  3EGR A;  1LM8 B;  2ASQ A;  1IYF A;  1AN8 A;  2WXG A;  1OFF A;  3ZUN A;  2JY6 A;  2J0M A;  2LI5 A;  2FUG 1;  4DXA B;  2BS3 B;  2Y3A A;  1XT9 B;  5E6N A;  4RGM A;  4K3C A;  4ZDV A;  2MJD A;  5AUI A;  4KKI A;  2NMQ A;  5MPO A;  5IN7 A;  1WGK A;  3LXF A;  1TJE A;  4REZ A;  1ZDX A;  2L05 A;  2SAK A;  3ZDM C;  1HXY D;  5G5H A;  4ZHO A;  1GOZ A;  2LEK A;  4FBJ B;  1JWS D;  3ML8 A;  2KZR A;  4F7Z A;  3WAN A;  1P98 A;  4PK1 A;  3A9K B;  4KIK B;  2KJR A;  5IO9 A;  1G6J A;  3ZLZ A;  1UZX B;  2DAJ A;  1DOI A;  3GE8 C;  2NTT A;  3V61 A;  2XEW A;  3U4E G;  3W9C B;  2WXF A;  2JF5 A;  2IGD A;  2KMC A;  2FID A;  5LXH A;  5J18 A;  1FIQ A;  4PYZ A;  1WXQ A;  1QOB A;  1WJ6 A;  1Y56 A;  3PTF C;  1SE9 A;  1KOT A;  1TZ1 A;  2V0G A;  3LDZ E;  4P1C C;  1TS2 A;  3T9L A;  3HVD A;  2INN E;  4MEM A;  1ET9 A;  1YQ3 B;  4XDD A;  4GIV A;  1SBB B;  2JWZ A;  1F9J A;  2R61 A;  2LRU A;  1JWM D;  1WZ3 A;  5EDS A;  3DVN V;  4BVU C;  3HM3 A;  3Q8B A;  2JYT A;  2IO0 B;  1OQR A;  1WFY A;  1AAR A;  1WXA A;  2PJH A;  2VZK D;  3RYT A;  2MBO A;  1V81 A;  3L10 B;  2QJL A;  4JLC A;  3B2G A;  3MJW A;  2ZEQ A;  2E3T A;  1JWB D;  5J2R A;  3IAS 1;  1L4D B;  3HIZ A;  1L4Z B;  3DBH B;  3DVG X;  3U2S C;  4IOI E;  3GOE A;  3KYC D;  1C78 A;  3CMM B;  3VTV A;  2RDH A;  5AZF A;  3UIP B;  2CS4 A;  2W82 A;  3DBS A;  1K53 A;  2DX5 B;  4PT5 A;  5E6J A;  4DQO C;  1WI0 A;  3DPD A;  4RM8 A;  3VTU A;  1XLP A;  4W9E A;  1JAL A;  1WF9 A;  2OJR A;  3V6C B;  4I6L B;  1WYW B;  1FRR A;  3FIL A;  3RUL A;  4NPN A;  4YWG G;  4WQO B;  2QIL A;  1V97 A;  3NZU A;  2W3S A;  1V8C A;  1N62 A;  2KQ4 X;  2ZNV C;  1QOA A;  5DPR A;  1GC6 A;  3P4P B;  2K0P A;  4YXD B;  1HZ5 A;  1GG3 A;  1YMH E;  3W1S C;  1NVI D;  3V62 A;  1UBI A;  2GOW A;  1HE8 A;  5BO4 B;  4RF1 A;  1EU3 A;  4N59 A;  2K8B A;  1MHH E;  5G55 A;  4XC2 A;  4JWU C;  3RD2 A;  1WX9 A;  3EA6 A;  1WE7 A;  4RCO A;  1N5X A;  2FBW B;  4AJW A;  3N30 A;  1GC7 A;  1T0R C;  3RFZ B;  2QC8 A;  3H6N A;  1E7P B;  2W54 A;  3SHQ A;  1RRB A;  3WA0 A;  2OHF A;  1Q0W B;  2R2Q A;  1AWD A;  3RNB C;  3KLS X;  2RDG A;  1WMH B;  1WE6 A;  3ZXV A;  4RNA A;  4MGY E;  1E8X A;  4HKQ A;  1I4Q A;  2LVP A;  2N7J A;  3JSV B;  2FCM A;  3O13 A;  2KNB A;  2WXH A;  3L17 A;  3RNG C;  4FN2 A;  2MX2 A;  1QF6 A;  2NS5 A;  1WR6 E;  4M8N A;  1TZO A;  1L6U A;  4LCD E;  4EUT A;  2QCZ A;  3VQI A;  1GB4 A;  2JPH A;  3U30 A;  1J0G A;  1Q10 A;  3X23 A;  1SEB D;  4JX1 C;  1F2R I;  2WXK A;  3R3M A;  2WXR A;  2AL3 A;  1WM2 A;  3EEC A;  4MGK E;  2M0X A;  3NG0 A;  3VH3 B;  2J0K A;  3BII D;  4ICU A;  3PO0 A;  3EFU A;  2IND C;  1M4V A;  2HTH A;  3H7P A;  2GBN A;  2WXO A;  4HWI B;  3P4S B;  3AE4 B;  2DHZ A;  2ZW1 A;  3PRZ A;  4A8X C;  2WXN A;  4A9A A;  4LNK A;  1F1H A;  1FD6 A;  3UIO B;  2MP2 B;  1C3T A;  2KJ6 A;  3UI3 A;  1SF0 A;  1XEE A;  4C56 C;  4J3O D;  1ZKH A;  3PSE B;  3AEF B;  2JXT A;  1NYR A;  4C00 A;  3ZRC A;  3C8Y A;  3U52 E;  1V80 A;  3TJP A;  1DYQ A;  1RFK A;  1V1P A;  3QHT A;  2JZP A;  3N3K B;  5EE1 A;  1YOV B;  1RAX A;  3VAW A;  1L6V A;  2JT4 B;  2KTR A;  1UF0 A;  2W3R A;  4O1N A;  4LK0 M;  1STE A;  1IGD A;  4A6Q A;  3E56 A;  2PEA A;  3R8B A;  3EFC A;  2D10 A;  4AOF A;  3VVW B;  1C4P A;  2DZJ A;  2JZZ A;  2Q5W D;  2MWS B;  4XYC A;  4NJ6 A;  1XCT L;  3IT4 B;  1I4R A;  3TUO A;  4D2K A;  3QJZ A;  4B9K A;  2PW9 A;  2BS2 B;  3M63 B;  1I4G A;  4XZ4 A;  3PS6 A;  1Z5S B;  2DZM A;  2K8H A;  2LHD A;  3GP7 A;  2UYZ B;  4NAW A;  4RH6 A;  2EMT A;  2IGG A;  4J6I A;  3CF6 E;  1UWX A;  1E90 A;  1C9F A;  1D5X C;  3QIJ A;  2KFK B;  4FXC A;  3A9J A;  2WNM A;  1FO4 A;  5DPS A;  3TIX A;  4FLH A;  2N1W A;  3RCZ A;  2R2O A;  1V2Y A;  5I4D A;  4ANV A;  2Y5C A;  2C60 A;  4M02 A;  2O2V A;  5C3J B;  1ROE A;  4HJG E;  3LJ3 A;  1R4M I;  4DXF A;  2RPV A;  4BBN F;  3ZJU A;  1SSN A;  2REX A;  3B0A A;  3W5U B;  3R2T A;  1MPE A;  1PGB A;  1RM6 C;  1WGH A;  3ZNH B;  1SJH D;  3RN9 C;  1T0S C;  3I63 C;  4HRS A;  3CST A;  4WJP A;  5EE9 A;  2HJ1 A;  2K22 A;  1UD7 A;  1SXT A;  1EM7 A;  4E3C A;  3NUH B;  4NJ7 A;  4NAM A;  1K52 A;  1TY2 A;  2KOX A;  4WJQ A;  2GLS A;  2ZPY A;  1WM3 A;  1SIF A;  1C77 A;  5C2T B;  5LNK 1;  2BF8 B;  4LNI A;  4ACF A;  4MJS A;  1K8R B;  1H4R A;  1YN4 A;  2IO1 B;  3NOB A;  3M95 A;  4KZC A;  1ZE3 D;  1MI0 A;  1TS5 A;  3NVY A;  2ZCB A;  3AE9 B;  5TR5 A;  4FA6 A;  2BYT A;  1L5P A;  1L7Y A;  4YTM B;  4KKJ A;  4RGT A;  3OLM D;  3ABV B;  1UWM A;  3ECI A;  4FUL A;  4BOS C;  4RMA A;  3IVF A;  4RF0 A;  3IG3 A;  3AE2 B;  3P4Q B;  4R3D A;  1WJU A;  2LHE A;  5D6J B;  3DHI C;  2G3Q B;  3AE5 B;  4WQM A;  2WXM A;  4YSY B;  4YSZ B;  3SFE B;  3P4R B;  4MH0 E;  4HCP B;  3Q3J A;  1FNW A;  4CQN A;  3IHP C;  1PGX A;  2AQ2 B;  1CJE A;  5HFY A;  2KAC A;  2WU2 B;  2RR9 A;  4NQL B;  4XE0 A;  3NZS A;  3AN1 A;  2CJN A;  2W55 A;  2KDB A;  2AQ3 B;  2J0J A;  1JQ4 A;  1GPX A;  1OQY A;  1FPY A;  4MSQ B;  4GLS C;  1WIA A;  4IWQ A;  2IGH A;  1QT9 A;  4KX6 B;  3AE8 B;  1SB3 C;  1P9D U;  1TBE A;  1MHX A;  4C7Z A;  2N7D A;  1MVK A;  2WHI A;  1D6E C;  4B0M A;  1ZPS A;  4DHJ D;  4II3 B;  4YT0 B;  4GDK B;  4W9G A;  2WDT B;  4EZL A;  1TYG B;  1WR1 A;  3AEA B;  4WUR A;  3Q3F A;  2LD9 A;  2G4S A;  4HKZ E;  1P0R A;  1YJJ A;  4HPL B;  1TKE A;  3ZIM A;  2KVZ A;  2I2Y A;  2XK5 B;  2FE8 A;  3UGB B;  2PIA A;  4C4V A;  2OED A;  3L4P A;  5DPW A;  4OZA A;  2J42 A;  5CTR C;  1X1M A;  4G3X B;  2MRP A;  3PLU A;  5JHB A;  2H89 B;  2N4F A;  1B1Z A;  4MH8 A;  2WX0 A;  2WGS A;  4K1R B;  1BT0 A;  5D94 A;  1T0Q C;  3H7S A;  3RT3 B;  4S0R A;  4XX5 A;  4WWN A;  5BYQ A;  1ZGU B;  4PYU A;  2HD5 B;  4OZC A;  2WLB A;  1T5X D;  3B08 A;  4M00 A;  4EKU A;  2NBV B;  2MBB B;  2AWT A;  3AEB B;  3HVZ A;  2ON8 A;  1WXS A;  1LXD A;  3KWV A;  4DHJ B;  4GB9 A;  1V86 A;  2IO3 B;  1NI2 A;  5T8I A;  2GBK A;  5H92 C;  3H1U A;  4NQK E;  4P16 A;  1ZUD 2;  4PS8 A;  2N9L A;  1I42 A;  3IAM 1;  2K9X A;  1V49 A;  3HHM A;  3QA8 A;  3GB1 A;  3ZRF A;  2RD0 A;  3EC8 A;  4IUM B;  2BYE A;  1IUE A;  3EHV A;  3VXW A;  2L0F A;  4MM3 A;  3L08 A;  3DBR I;  1I7H A;  1WGD A;  2KWD A;  2N9E B;  2WXI A;  4FHK A;  4KGS A;  1J7C A;  1XQQ A;  2FUH B;  4PS7 A;  3AE1 B;  3RZW C;  1QQR A;  4XDC A;  1AW7 A;  1I4X A;  5TSS A;  2MQJ A;  2NCN A;  4GSW A;  2Z0D B;  1QOF A;  2WWZ A;  2CHW A;  3ZQ4 A;  3BVZ A;  2PVG C;  3CIR B;  4KGT A;  4WAA A;  3K9P B;  3ZW3 A;  5L83 A;  2YVC A;  2M17 A;  1NYQ A;  2B76 B;  3PPA A;  2KYW A;  3BY4 B;  4W9J A;  2BGF A;  5FR3 A;  1K50 A;  2FCN A;  1XCQ L;  3QC8 B;  3AMZ A;  4S17 A;  1FFU A;  2LXC A;  2KMM A;  2ZVN A;  1JRO A;  3GZN I;  1VLB A;  3LYY A;  3ZJV A;  4CO7 A;  3E9S A;  4EFO A;  2D3A A;  1D4B A;  1VZ6 A;  3ZTD A;  3FIL B;  2DAF A;  3AEC B;  4W9C A;  3L16 A;  2I1J A;  5FK9 C;  2IYD B;  2SEB D;  4B0E A;  3U8Z A;  2KN5 A;  4OVZ A;  1RWS A;  2AEH A;  1WMH A;  2MSE D;  5BYR A;  3A4R A;  4ZRP A;  3Q8F A;  1BML C;  2L1A A;  3A33 B;  5LLI A;  2EKE C;  2WU5 B;  2WQY B;  1SJE D;  4EZK A;  2V9H A;  1WH3 A;  3SU8 X;  4BFR A;  4AS1 A;  1GJZ A;  4M0W B;  2FCQ A;  2MBQ A;  2LJI A;  3DCG A;  3U7D A;  1XO3 A;  1YIW A;  3KH0 A;  2O6V B;  3NHE B;  4DHZ B;  5G5G A;  1YJ1 A;  2MLB A;  3N1X C;  3UIN B;  1QKZ A;  3M62 B;  3PRP B;  1WXV A;  2B3A A;  2KWU B;  2GB1 A;  3TL5 A;  3FC4 A;  2JQR B;  4TQ1 A;  3FKY A;  1KF6 B;  3AV8 A;  2L7R A;  5JH5 C;  1ZOY B;  4C4V B;  4ARC A;  3Q8C A;  2N9P C;  4NNJ B;  4WWO A;  4ZOH C;  3GS2 A;  2WXQ A;  2LGY A;  1YQB A;  1CZP A;  4TUU A;  4KV2 A;  2PKO A;  2LVQ A;  4JGH B;  3BVM A;  1V1P B;  3L13 A;  4MDK E;  4FAD A;  1KJT A;  3DVG Y;  1CMX B;  3V3X A;  2XBB C;  3VR8 B;  4AP4 C;  2O6V D;  3LB8 C;  3Q8A A;  2V1Y A;  3Q3N C;  1VD2 A;  4HPM B;  4IC7 B;  2GBJ A;  2M0A A;  2MW5 A;  3MHZ A;  2ICI A;  3A9K A;  4KIK A;  4BBN C;  1XLN A;  4RFB A;  2FNJ B;  3P42 A;  1BUI C;  2INC C;  4L1B A;  3H7P B;  2KLC A;  3OG5 A;  2PPH A;  3MFG A;  3R7R A;  2N9K A;  3AI5 A;  4CHK A;  2KLG A;  3MP9 A;  1QOG A;  2VRR B;  4K7W A;  4DBG A;  3ZKJ C;  2WXJ A;  2BW2 A;  4ASW C;  1YN3 A;  1C79 A;  4GDL A;  1J19 A;  1OEY A;  3BVG A;  4X57 B;  2QSD A;  4HDQ A;  5IAA C;  1ZDV A;  2GMI C;  1D5Z C;  3VH4 B;  1JML A;  1YNT E;  2VH2 A;  5AUK A;  2ZVO A;  2KDM A;  2KWC A;  1FXT B;  3VRB B;  1EWC A;  1T6B X;  1YQ4 B;  2CU1 A;  2G45 B;  2LGX A;  1WWT A;  2WDQ B;  4FJY A;  3RPF C;  2MBE A;  5DPT A;  1TY0 A;  3OWE B;  4FJZ A;  4GDL B;  2FIF A;  4ANX A;  1R4M B;  1I35 A;  2K1F A;  2N0S B;  1LFD A;  4DK5 A;  5IP4 D;  3TEZ A;  4ZRQ A;  5E6O A;  4HJK A;  2BKR B;  5GMV A;  2YEP B;  4IM2 A;  4JPS A;  2QMT A;  4NAW B;  4KGR A;  4MJS B;  3T8M A;  4YL8 A;  1UBQ A;  1NEK B;  5HKH A;  2K3U A;  3RNA C;  2RPQ A;  3KUZ A;  1C1Y B;  1AYF A;  4ITK A;  1TS3 A;  4XWW A;  2CHZ A;  4DDI D;  2CU3 A;  3PHW B;  2KFJ A;  4WJO A;  4XWT A;  4W9H A;  3N1Y C;  2MEK A;  2PLP A;  2LRW A;  3ML9 A;  4KDL B;  4OZB A;  4LNN A;  1ET6 A;  1ZXH A;  4MM3 B;  5L95 C;  2EEL A;  3VRA B;  4ANW A;  5BMI A;  3MTN B;  1EUV B;  4KSL C;  3IXS A;  4ZHP A;  3C19 A;  2IPK D;  4DDG D;  2MP2 A;  1XF5 L;  3HM6 X;  3UQA A;  4NZL B;  4C7Y A;  2N7E A;  3JVZ X;  3N20 C;  1EF1 A;  1JWA D;  1TS4 A;  1L0X B;  2K6Q A;  1UEL A;  5EE3 A;  3AM9 A;  2C5L C;  1E8W A;  2AYO B;  3HRD D;  1UUP A;  4YTN B;  4TQ0 A;  1SE2 A;  2LGS A;  1V1O A;  1PFD A;  2D11 A;  1KLU D;  1PDX A;  3QAR A;  2LVO A;  5D2M B;  1KM7 A;  3URY A;  2MH7 A;  2M56 B;  1XD3 B;  4N9F 4;  3RUI B;  3MC9 A;  1U4A A;  4BKS D;  1L0V B;  2WDR B;  2KX3 A;  3D32 A;  1PYW D;  4G0N B;  4K7U A;  3RNF C;  2DBY A;  1FCC C;  3AB5 A;  4KSK C;  2ZW0 A;  2KJH B;  2N9X A;  4DWF A;  3PT2 B;  2LAS A;  1N60 A;  1E10 A;  1JRU A;  4HDO A;  1E7V A;  2GBR A;  2PE6 B;  2OJW A;  2M1M A;  3DVN U;  1E9M A;  4MAC A;  3DWG C;  2JRI B;  2KMA A;  5JXV A;  4HK2 A;  1SIJ A;  3BWU D;  4A3P A;  2CJO A;  4K7S A;  1N63 A;  4TSS A;  4HXD A;  1WGR A;  1WSP A;  3Q6B A;  1Y8R C;  1C4C A;  1PUT A;  4DHZ E;  1GNU A;  2ZCC A;  2KTF A;  1F77 A;  3ZGZ A;  3NVZ A;  2WXL A;  1EF5 A;  1FFV A;  3APD A;  3AED B;  1L0Y B;  1D5M C;  2JWU A;  3BZD B;  2KHW B;  3ONS A;  2MJ3 A;  3TEX A;  2XN9 C;  2D2Q A;  3T3O A;  2KDE B;  1FM0 D;  4WWM A;  3VFK A;  1E0Z A;  5IOI A;  1Q5W B;  4EZJ A;  3ENE A;  1ISN A;  2KAJ A;  4AUQ C;  3AH7 A;  3A1Q B;  4JL9 A;  3UF8 A;  3AU5 A;  3PZD A;  4IM3 A;  3TEW A;  4RM9 A;  1WRI A;  2BB6 A;  2W9N A;  4JWS C;  3JYU A;  4M0W A;  3X0W A;  1A5R A;  1Q1O A;  4GN1 A;  1HEZ E;  2MJE A;  1EO6 A;  2BQQ A;  1JCK B;  4M01 A;  2I1K A;  2BWE S;  4W9I A;  3NS8 A;  2UU7 A;  1VJK A;  2YEP F;  2DYM A;  3QAQ A;  3QK0 A;  4W9F A;  4P1B C;  2C7M B;  2LFI A;  2MBH A;  3DOW A;  2L3Z A;  3MHS D;  1HTQ A;  3VUW A;  3RNE C;  1V5T A;  4E74 A;  1FMA D;  2MCN B;  4LDT D;  4K81 A;  2WP9 B;  1FCL A;  3PV1 A;  4AJY B;  2IY1 B;  4ZRI A;  3DBL I;  4LJO B;  1H8C A;  4QAY A;  2KO3 A;  2HDE A;  1LO5 D;  1WX8 A;  4II2 B;  3Q3M C;  4NY0 A;  5C1Z A;  2KKC A;  2QHO A;  2KDF B;  1NDD A;  3KWL A;  5D3I B;  2ZPN A;  2IY0 B;  4GOC A;  2K39 A;  2K6D B;  1RFA A;  1FNU A;  4OVV A;  1QIL A;  3Q8E A;  3CSF A;  3P2B A;  2Z8L A;  1DOX A;  3PVL A;  2VZK B;  5IKC M;  2RGF A;  1ZW7 A;  3Q69 A;  1ENF A;  1C4A A;  1QLB B;  4Q2J A;  2UWQ A;  4ANU A;  2J53 A;  3ZXR A;  1T0Y A;  3PHX B;  3ETR A;  4OVU A;  2EKI A;  2DYO A;  4LNF A;  3NY5 A;  4HEA 1;  3ALB A;  2D5G A;  2RDB C;  2NPT B;  2X8X X;  1OTR B;  3I3T B;  1HQR D;  2PE9 A;  2JX5 A;  2ZJD A;  4I6N B;  1XLQ A;  1UGM A;  3PRM B;  4MSM B;  1I4H A;  4MGZ E;  2QDF A;  2DZI A;  4K3B A;  4RGN A;  4A20 A;  2D3C A;  2JSV X;  5BMH A;  3BK1 A;  3A9J B;  3VDZ A;  2LUE A;  4OHJ A;  4HCN B;  2Z0E B;  2AQ1 B;  3BK2 A;  2L76 A;  2V4I B;  5J17 A;  1E8Z A;  1ZP0 B;  3HUI A;  2JUO A;  2PVO D;  3KUD B;  3W5V B;  1JWU D;  1OQQ A;  4H2A A;  1A70 A;  4CYE A;  3AE6 B;  2H88 B;  1J7B A;  3AXC A;  3SEB A;  3VHT C;  1VDV A;  3TBL D;  3NS1 A;  1E6E B;  3I9V 1;  2KVR A;  1IP9 A;  2EMS A;  3QWZ B;  3VUY A;  3DHH C;  1QZE A;  4ZYN A;  3WAL A;  2KK8 A;  4KZ0 A;  1PQS A;  3TSS A;  4LLG M;  4AQ7 A;  4ARI A;  2BS4 B;  5JHA A;  3B1L X;  2IJ0 A;  3P1M A;  3H9D A;  3MC0 B;  1XXG A;  2JXX A;  3SD5 A;  1GAQ B;  1J8C A;  1VZ8 A;  1C76 A;  5LXI B;  2LZ6 A;  2KQS A;  5FR6 A;  5JZE B;  2A4Z A;  3GE3 C;  4EEW A;  5KHQ A;  1P1A A;  2J7Q B;  1WGY A;  4MT5 A;  3HK0 A;  3SDL C;  2ZNV B;  5D3D A;  1MFW A;  5AZG A;  1S3S G;  1Z2M A;  2G4D B;  5GXG B;  2QEJ C;  3ZDT A;  3RZF A;  3DQV A;  2JZ3 B;  1F52 A;  4RGO S;  4HRO A;  1TIF A;  3ZTC A;  5D7G A;  4BKG A;  3Q2A C;  4L23 A;  2IO2 B;  4JQW C;  2IDY A;  1VRA B;  2FCS A;  2GI9 A;  2V4L A;  3Q14 C;  1WYG A;  2XK5 A;  1P7E A;  1YD8 U;  2Y5B B;  3A4S C;  1I4P A;  2L8J A;  4ZYS A;  1VZ7 A;  4EE2 A;  5AEK B;  2KC1 A;  3TMP B;  1WGG A;  2CKH B;  1TT5 B;  4G50 A;  1WJN A;  1IGC A;  4MGI E;  2RSU A;  2C7H A;  2L0T A;  2WDV B;  2AL6 A;  1XLO A;  1SGH A;  4WIP A;  3SR6 A;  5H8Y E;  3KW5 B;  4IDI A;  1GUA B;  2KT7 A;  4WJN A;  3RMK C;  3IFW B;  3ZNG C;  4URK A;  2RMM A;  5CHW A;  5HHD G;  3KVF B;  1IBX B;  3NZ3 A;  3PRE A;  3VUX A;  2BYF A;  1YN5 A;  1MG4 A;  4LTU A;  1LGR A;  3KUC B;  4HLE A;  5HG2 A;  3IT6 B;  3P63 A;  5HI1 A;  3T3N A;  2WYQ A;  3NRZ A;  1N61 A;  1M94 A;  2IBI B;  2NVU I;  3DHG C;  4GMV A;  2LXA A;  2CHX A;  2O6V A;  2BPS A;  2I38 A;  3W1S A;  3DBL B;  2X38 A;  2Z59 B;  2WS3 B;  4US8 A;  1FXI A;  5DCN A;  4P6V F;  2LGI A;  1OEY J;  4N58 A;  2M4N A;  4ZRK A;  3S2A A;  3PLV A;  4YTP B;  1NEN B;  2E6X A;  2DNF A;  3WAM A;  2KAN A;  2JU6 X;  3ZJT A;  2WXP A;  3L54 A;  4A3O A;  2OOB B;  2JYE A;  2NTS A;  3CWI A;  2IZV B;  2LUM A;  1KRH A;  2D07 B;  4W9L A;  2NPT A;  4GXB A;  3VR9 B;  1B9R A;  1FXA A;  3OJ3 A;  2J4X A;  2Y5P A;  3C0R B;  1V5O A;  3I5J C;  1T3Q A;  4ICV A;  2KFK A;  4W9D A;  1S1Q B;  2DYB A;  1SE4 A;  3TCA A;  4F1S A;  1TGZ B;  4EOY A;  2M8S A;  2G9H D;  2LWP A;  4IWO A;  2KXJ A;  3J9C A;  4F8C B;  1NI3 A;  1ZXI A;  3ZNZ B;  1VR9 A;  2C7N B;  2NBU A;  2J52 A;  3GZN B;  4DXG A;  3M3J A;  1YJI A;  1V6E A;  4KVG B;  2V3N A;  2DZK A;  2DEN B;  3L0W B;  2G1E A;  3IBE A;  4B95 A;  1KLV A;  4OW0 A;  1GB1 A;  4N6E B;  1FRD A;  2XNA C;  1R4N B;  3ZYY X;  2NBW B;  2CR5 A;  3AE7 B;  3AE3 B;  3FAH A;  5E6P A;  5FKA C;  1E5W A;  3JSV A;  1NBF C;  5CX3 A;  3SFD B;  4IG7 B;  3APF A;  3AEG B;  4US9 A;  1HA5 A;  1F2R C;  2JRH A;  4ZRJ A;  3UQB A;  5CHF A;  3DBR B;  2JVC A;  1RLF A;  4LJP B;  2YLM A;  1TKY A;  2LGD A;  2TSS A;  2KQ7 A;  5IA7 A;  2L32 A;  4KDI C;  1YX6 B;  5AZH A;  4WH4 A;  2BYV E;  2HTM E;  3DDC B;  4BKS A;  3QQ8 B;  1EWY C;  1WY8 A;  3APC A;  4IWP A;  4M8M A;  3H8H A;  2V3S A;  1RYJ A;  1KLG D;  3NVV A;  3PZ7 A;  4A90 A;  2KTR B;  3I57 A;  3N32 A;  3PZ8 A;  2PTL A;  3K9O B;  4JE3 B;  1KH0 A;  2N1V A;  1KFY B;  2WX1 A;  2HJ8 A;  5G2N A;  5BMG A;  3OAW A;  1HTO A;  1ESF A;  1R7S A;  3DWM A;  3OJ4 B;  5KHO A;  1DOY A;  2BKF A;  4NJC A;  3W2D A;  2KWV B;  4GDK A;  2L00 B;  4IKG A;  1LQB A;  4HPP A;  4C80 A;  3W1Y A;  4TKN A;  3B9J A;  4LNO A;  4W9K A;  5C23 A;  1E8Y A;  3BYY B;  4HVB A;  4UDU C;  3WIM A;  1HZ6 A;  4PS3 A;  2FAZ A;  1D3Z A;  3WAP A;  1FEH A;  2BWF A;  3V6E B;  1V9J A;  1FNV A;  3AEE B;  3AUL A;  3VTW A;  1SE3 A;  2V3P A;  2LMC A;  1IBX A;  1PGA A;  4G11 A;  3TEY A;  3ZNI D;  2AX5 A;  2GBM A;  2K5P A;  1UGJ A;  1WXM A;  5CHV C;  3ZO5 B;  1UNS A;  3N1Z C;  1DGJ A;  2BTE A;  1MG8 A;  2KX0 A;  4BZA A;  3MC8 A;  3AU4 A;  2K25 A;  3QCA A;  2L52 A;  2VH1 A;  3WAO A;  1TKG A;  1F0Z A;  3NJT A;  3B2F A;  3R2I A;  1K51 A;  3QX1 A;  2D3B A;  2GRI A;  3KQ4 A;  4B6W A;  3BIN A;  2HE7 A;  1BXT A;  3WCQ A;  4JIO U;  1J7A A;  4USA A;  3MJ5 A;  2ZZP B;  2BT6 A;  2PMV A;  3DBH I;  4GGQ A;  4IW0 A;  1WJ4 A;  4WWP A;  2KD0 A;  1WX7 A;  1KTK A;  2DWQ A;  3Q3O C;  1P3Q U;  1TTN A;  2MA9 B;  1R4N I;  4BAX A;  3RNC C;  1ACC A;  2KDI A;  2D3G A;  1N6Z A;  4LDT B;  1YX5 B;  2A5U A;  1EU4 A;  4L2Y A;  4YSX B;  4TV3 A;  2C9W B;  1CK1 A;  1N5W A;  2LJ5 A;  4GU2 A;  5BYS A;  2NR2 A;  1CQV A;  3PGE A;  3BYT B;  1WRD B;  2K8C A;  1JRP A;  2BB5 A;  3A1Q A;  4A55 A;  4E71 A;  2DLB A;  1OGW A;  1WZ0 A;  4FJV B;  2BVC A;  3N9Y C;  4IM0 A;  2ONQ A;  3EUB 2;  2ACZ B;  1IPG A;  4XGA B;  3JW0 X;  4MEL A;  4BKT A;  3R66 C;  1E7U A; 
#chains in the Genus database with same CATH homology
 4DXF A;  1P7F A;  2RPV A;  3ZJU A;  1SSN A;  3W5U B;  2WXJ A;  5EE0 A;  2BW2 A;  3R2T A;  1MPE A;  1PGB A;  4WAF A;  1YN3 A;  3NVW A;  1RM6 C;  1C79 A;  2L83 A;  3BVG A;  1SJH D;  2M19 A;  4MT5 A;  2QSD A;  1ZDV A;  4HRS A;  5D3D A;  1D5Z C;  2KN4 A;  4TMA B;  2BBC A;  5EE9 A;  3V05 A;  5GXG B;  2QEJ C;  1JML A;  1YNT E;  2K22 A;  5AUK A;  2KDM A;  3U7Z A;  2INP E;  3VRB B;  1EWC A;  1JW9 D;  1T6B X;  1YQ4 B;  3RPF C;  1WWT A;  2WDQ B;  1SXT A;  1EM7 A;  4RGO S;  3NUH B;  2QIE B;  3EGR A;  4HRO A;  5D7G A;  1TY0 A;  4NAM A;  3OWE B;  4L23 A;  1K52 A;  4GDL B;  1TY2 A;  1AN8 A;  2IDY A;  2WXG A;  1OFF A;  1VRA B;  2GI9 A;  2N0S B;  1WYG A;  1C77 A;  1P7E A;  2FUG 1;  1I4P A;  4ZYS A;  5C2T B;  2BS3 B;  1VZ7 A;  5LNK 1;  4EE2 A;  3TEZ A;  4ZRQ A;  2Y3A A;  4RGM A;  2YEP B;  4JPS A;  1YN4 A;  2QMT A;  4NAW B;  2MJD A;  5AUI A;  4KKI A;  2NMQ A;  4KGR A;  1ZE3 D;  1MI0 A;  1IGC A;  1TS5 A;  5MPO A;  3NVY A;  1NEK B;  2K3U A;  1WGK A;  3AE9 B;  3LXF A;  1TJE A;  4REZ A;  2BYT A;  1L5P A;  2WDV B;  1AYF A;  1ZDX A;  4ITK A;  1TS3 A;  4YTM B;  4KKJ A;  4RGT A;  4XWW A;  2SAK A;  3ABV B;  1HXY D;  1UWM A;  2CU3 A;  5G5H A;  1GOZ A;  4ZHO A;  4RF0 A;  4XWT A;  2LEK A;  1JWS D;  1XLO A;  3AE2 B;  3P4Q B;  4R3D A;  2LHE A;  4WIP A;  2MEK A;  3AE5 B;  2PLP A;  4WQM A;  2WXM A;  4YSY B;  4YSZ B;  3SFE B;  3P4R B;  3SR6 A;  5H8Y E;  4IDI A;  4OZB A;  1FNW A;  4CQN A;  1ET6 A;  1PGX A;  1ZXH A;  2AQ2 B;  4MM3 B;  1CJE A;  5HFY A;  2EEL A;  3VRA B;  2KAC A;  2RMM A;  1DOI A;  2NTT A;  5HHD G;  2WU2 B;  1IBX B;  5BMI A;  3NZ3 A;  3U4E G;  1YN5 A;  4XE0 A;  3IXS A;  3W9C B;  4LTU A;  4ZHP A;  2WXF A;  5HG2 A;  2IGD A;  3IT6 B;  3AN1 A;  2CJN A;  2W55 A;  3P63 A;  2AQ3 B;  2IPK D;  5HI1 A;  1JQ4 A;  3T3N A;  1FIQ A;  1GPX A;  1WXQ A;  3NRZ A;  1XF5 L;  1N61 A;  1QOB A;  4GLS C;  4NZL B;  1Y56 A;  2IGH A;  4C7Y A;  1QT9 A;  4KX6 B;  1JWA D;  1TS4 A;  3AE8 B;  1SB3 C;  1L0X B;  2I38 A;  3W1S A;  2V0G A;  2X38 A;  1MHX A;  4C7Z A;  5EE3 A;  2WS3 B;  1MVK A;  1TS2 A;  3AM9 A;  1FXI A;  3HVD A;  4US8 A;  4P6V F;  2INN E;  1D6E C;  4B0M A;  2LGI A;  1ZPS A;  4N58 A;  3HRD D;  1UUP A;  1ET9 A;  1YQ3 B;  4XDD A;  4YTN B;  4TQ0 A;  1SE2 A;  1SBB B;  4YT0 B;  2R61 A;  1V1O A;  1PFD A;  4GDK B;  4YTP B;  1KLU D;  1JWM D;  1NEN B;  1PDX A;  2E6X A;  1TYG B;  3Q8B A;  2JYT A;  3AEA B;  4WUR A;  1OQR A;  2JU6 X;  3URY A;  3ZJT A;  2MH7 A;  2WXP A;  2M56 B;  4HKZ E;  2VZK D;  1YJJ A;  2JYE A;  2NTS A;  2QJL A;  3CWI A;  1TKE A;  3B2G A;  2LUM A;  1KRH A;  1L0V B;  2WDR B;  2I2Y A;  1PYW D;  2FE8 A;  3VR9 B;  2E3T A;  2PIA A;  1B9R A;  1FXA A;  1JWB D;  2DBY A;  3IAS 1;  1FCC C;  1L4D B;  3AB5 A;  2J4X A;  1L4Z B;  2OED A;  2Y5P A;  3L4P A;  2J42 A;  2ZW0 A;  4OZA A;  4IOI E;  3U2S C;  1T3Q A;  1C78 A;  2H89 B;  1N60 A;  2RDH A;  1E10 A;  1B1Z A;  1SE4 A;  4MH8 A;  2W82 A;  1K53 A;  4PT5 A;  5E6J A;  4DQO C;  1E9M A;  2G9H D;  3DWG C;  4MAC A;  1XLP A;  5BYQ A;  1JAL A;  5JXV A;  1SIJ A;  3J9C A;  3BWU D;  2CJO A;  1NI3 A;  4OZC A;  1ZXI A;  2WLB A;  1T5X D;  1VR9 A;  1N63 A;  1FRR A;  4TSS A;  2J52 A;  3FIL A;  4DXG A;  1YJI A;  4YWG G;  2QIL A;  3AEB B;  1V97 A;  1WSP A;  2ON8 A;  2V3N A;  3HVZ A;  2W3S A;  1C4C A;  1PUT A;  1V8C A;  3KWV A;  1N62 A;  2KQ4 X;  1QOA A;  2G1E A;  1F77 A;  3ZGZ A;  3NVZ A;  5T8I A;  4OW0 A;  2WXL A;  3P4P B;  4N6E B;  1GB1 A;  1FFV A;  1FRD A;  3AED B;  2K0P A;  5H92 C;  2XNA C;  3ZYY X;  1L0Y B;  1D5M C;  1ZUD 2;  2JWU A;  3BZD B;  4P16 A;  4YXD B;  3AE7 B;  2N9L A;  1HZ5 A;  3AE3 B;  1YMH E;  3FAH A;  3IAM 1;  1NVI D;  2MJ3 A;  3TEX A;  2XN9 C;  3T3O A;  2K9X A;  5FKA C;  1FM0 D;  4WWM A;  3GB1 A;  4RF1 A;  1EU3 A;  4N59 A;  1E0Z A;  1MHH E;  1IUE A;  3SFD B;  4JWU C;  2KAJ A;  3AEG B;  3EA6 A;  3AH7 A;  1I7H A;  2WXI A;  1N5X A;  2FBW B;  2KWD A;  4RCO A;  4US9 A;  4KGS A;  1HA5 A;  1J7C A;  1F2R C;  3RFZ B;  3TEW A;  3AE1 B;  1E7P B;  1QQR A;  4XDC A;  1AW7 A;  1I4X A;  1WRI A;  5TSS A;  1TKY A;  2TSS A;  2BB6 A;  2W54 A;  4JWS C;  4M0W A;  2L32 A;  1QOF A;  3ZQ4 A;  2OHF A;  1HEZ E;  3BVZ A;  2PVG C;  2HTM E;  1AWD A;  2MJE A;  4WH4 A;  3KLS X;  3CIR B;  4KGT A;  1JCK B;  2RDG A;  1EWY C;  4RNA A;  1NYQ A;  2B76 B;  3H8H A;  4HKQ A;  1I4Q A;  1RYJ A;  1VJK A;  2YEP F;  2N7J A;  1KLG D;  2DYM A;  3NVV A;  3O13 A;  5FR3 A;  3PZ7 A;  1K50 A;  4A90 A;  3I57 A;  2WXH A;  3PZ8 A;  2PTL A;  4JE3 B;  1XCQ L;  2LFI A;  3AMZ A;  1KH0 A;  1FFU A;  1QF6 A;  2KMM A;  1JRO A;  1KFY B;  1TZO A;  1L6U A;  1VLB A;  1FMA D;  3LYY A;  3ZJV A;  3E9S A;  5BMG A;  2WP9 B;  1D4B A;  3VQI A;  1VZ6 A;  1FCL A;  1GB4 A;  3FIL B;  1ESF A;  1R7S A;  3DWM A;  1Q10 A;  1DOY A;  1SEB D;  4NJC A;  3AEC B;  3W2D A;  4JX1 C;  1F2R I;  2WXK A;  2HDE A;  4IKG A;  5FK9 C;  2WXR A;  1LO5 D;  2SEB D;  4B0E A;  4OVZ A;  4C80 A;  1RWS A;  3KWL A;  5BYR A;  5D3I B;  3B9J A;  3BII D;  4ZRP A;  3Q8F A;  1BML C;  3PO0 A;  2L1A A;  1M4V A;  3BYY B;  1FNU A;  4UDU C;  1QIL A;  2WU5 B;  3Q8E A;  2WQY B;  1HZ6 A;  2WXO A;  1SJE D;  3P4S B;  3AE4 B;  2Z8L A;  1DOX A;  1FEH A;  4AS1 A;  2ZW1 A;  2VZK B;  4A8X C;  2WXN A;  4A9A A;  1FNV A;  2LJI A;  3AEE B;  1SE3 A;  3Q69 A;  1FD6 A;  1ENF A;  1C4A A;  1QLB B;  2V3P A;  1XO3 A;  2LMC A;  4Q2J A;  1IBX A;  3UI3 A;  4C56 C;  1SF0 A;  1PGA A;  1XEE A;  2J53 A;  4J3O D;  3TEY A;  3ETR A;  2AX5 A;  3AEF B;  5G5G A;  2EKI A;  2DYO A;  2K5P A;  4HEA 1;  1QKZ A;  1UGJ A;  2D5G A;  2JXT A;  1NYR A;  1UNS A;  3C8Y A;  1DGJ A;  1HQR D;  3U52 E;  2BTE A;  2GB1 A;  2JX5 A;  1XLQ A;  2L52 A;  3FC4 A;  1DYQ A;  1RFK A;  1I4H A;  1V1P A;  2JZP A;  5EE1 A;  2JQR B;  4TQ1 A;  1L6V A;  1KF6 B;  1TKG A;  3AV8 A;  4RGN A;  1F0Z A;  2W3R A;  2JSV X;  1ZOY B;  4O1N A;  3B2F A;  3R2I A;  3Q8C A;  1K51 A;  1STE A;  4LK0 M;  5BMH A;  1IGD A;  4ARC A;  2GRI A;  3BK1 A;  4A6Q A;  4ZOH C;  3E56 A;  3R8B A;  3KQ4 A;  4OHJ A;  3GS2 A;  2WXQ A;  1C4P A;  1CZP A;  2Q5W D;  2PKO A;  1BXT A;  3WCQ A;  1XCT L;  2AQ1 B;  1I4R A;  3IT4 B;  3TUO A;  4D2K A;  1J7A A;  4USA A;  3BK2 A;  3MJ5 A;  3BVM A;  2BT6 A;  2PMV A;  1V1P B;  2PW9 A;  2BS2 B;  2V4I B;  1I4G A;  1ZP0 B;  3HUI A;  2PVO D;  3W5V B;  1JWU D;  1KTK A;  3V3X A;  2DWQ A;  1OQQ A;  2LHD A;  3GP7 A;  4H2A A;  1A70 A;  3VR8 B;  3AE6 B;  2H88 B;  1J7B A;  3SEB A;  4RH6 A;  3LB8 C;  1VDV A;  3Q8A A;  1ACC A;  3NS1 A;  1E6E B;  2IGG A;  3I9V 1;  1UWX A;  2M0A A;  1C9F A;  1EU4 A;  3MHZ A;  4L2Y A;  4YSX B;  1D5X C;  4FXC A;  2ICI A;  1XLN A;  2WNM A;  1CK1 A;  1N5W A;  1FO4 A;  5BYS A;  3TSS A;  1CQV A;  4RFB A;  3BYT B;  4LLG M;  3P42 A;  4AQ7 A;  4ARI A;  1BUI C;  5I4D A;  2BS4 B;  4L1B A;  2IJ0 A;  1JRP A;  2BB5 A;  3P1M A;  2Y5C A;  4A55 A;  2DLB A;  3MFG A;  2N9K A;  3MC0 B;  1XXG A;  3MP9 A;  3N9Y C;  1QOG A;  5C3J B;  2ONQ A;  3EUB 2;  1ROE A;  2ACZ B;  1GAQ B;  1VZ8 A;  4HJG E;  1C76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...