4N6EB

Crystal structure of amycolatopsis orientalis bexx/cyso complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
89
structure length
89
Chain Sequence
AVTVSIPTILRTHTGGEKSVEAKGATVLEIIDDVESRHAGIKARLVKEEKLHRFINVYVNDEDVRFSGGLEAEVKDGDTLTILPAVAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Co-opting sulphur-carrier proteins from primary metabolic pathways for 2-thiosugar biosynthesis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Lyase/biosynthetic protein
molecule keywords Putative thiosugar synthase
total genus 22
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2013-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4n6eB00
1YJIA 1RYJA 2B76B 1WRIA 3PO0A 4ITKA 4N59A 4ZHPA 2CJNA 2M56B 2MJ3A 4USAA 4YSZB 1RWSA 4C80A 1F0ZA 1TKEA 2JX5A 1QOFA 2PIAA 5EE3A 4YT0B 1XLOA 1CZPA 4P6VF 1KF6B 3P1MA 1WWTA 2KAJA 4C7ZA 1KFYB 2MH7A 3B9JA 4HRSA 4C7YA 5EE0A 3P4PB 2WDRB 4JWSC 4US9A 1VLBA 4JX1C 2DBYA 3VRAB 1J7CA 1FXAA 2H89B 2KMMA 3NVYA 4FXCA 2FBWB 3LXFA 3AE1B 2CU3A 3AE2B 3NVVA 3W9CB 3AN1A 3W5UB 2MJDA 1J7BA 4US8A 1SB3C 2PVGC 1YJJA 3HVZA 4YTPB 1JROA 4WWMA 5GXGB 1N63A 4KX6B 1B9RA 3AE9B 1A70A 3L4PA 5AUIA 2Q5WD 3AE6B 1QOBA 1N5XA 1FRRA 1DOIA 1XLQA 1XO3A 2DWQA 3VR8B 2WU5B 5H8YE 1NI3A 2OHFA 2WS3B 3VR9B 3WCQA 3ETRA 1QF6A 1ZUD2 1FMAD 2L52A 3P4RB 2W3SA 2W54A 1JW9D 1ROEA 1RFKA 2E3TA 3FC4A 4YXDB 1TKGA 1ZOYB 1L0VB 2ACZB 1GAQB 1NVID 3AE4B 1L6VA 1J7AA 3AE7B 4JWUC 1N62A 2BS4B 1JWAD 1AWDA 2WP9B 1FFUA 1FIQA 1QLBB 5EE1A 1KRHA 4N6EB 2JQRB 2WQYB 2CJOA 1VDVA 1PUTA 2H88B 4ZOHC 2W55A 3NVWA 3SR6A 1DOXA 2EKIA 1ZP0B 1WYGA 3AEDB 2WLBA 2LEKA 1OQRA 1QOGA 2PKOA 3ABVB 3AE8B 3AM9A 3HRDD 1ZXIA 2AX5A 5C2TB 1FM0D 1L5PA 3BIID 1JQ4A 3RPFC 3EUB2 2WDQB 1FFVA 3FAHA 2N0SB 3SFEB 2QJLA 2BT6A 3AEEB 3NRZA 3NVZA 1E0ZA 2BS3B 4YSYB 1TJEA 1E7PB 3B2GA 2WDVB 3P63A 1N60A 3CIRB 5G5GA 2W3RA 2BS2B 3AV8A 2QIEB 1IUEA 1N5WA 3AEGB 4ZHOA 1RM6C 1OQQA 3ZYYX 5MPOA 1OFFA 4YTMB 3AB5A 5G5HA 1DOYA 3P4QB 1PFDA 5H92C 3AE5B 1XLPA 3KWLA 2PVOD 4LTUA 3W5VB 1GPXA 1NYQA 1NEKB 3P4SB 4WQMA 1QOAA 3HUIA 1TYGB 3CWIA 1VJKA 1WGKA 2L83A 4YSXB 3AEFB 2Y5CA 1AYFA 2G1EA 1FXIA 2K22A 3B2FA 5AUKA 1NENB 1E9MA 1QT9A 1V8CA 1N61A 1XLNA 1YQ3B 3DWMA 5C3JB 3LB8C 1T3QA 3AMZA 1E6EB 4HROA 3SFDB 1FRDA 2M19A 3AE3B 1CJEA 1I7HA 3AEAB 1TKYA 1WXQA 1R7SA 4YTNB 1UWMA 3NS1A 3AECB 1L6UA 2K9XA 2HTME 1DGJA 2K5PA 1JRPA 2MJEA 2WU2B 3DWGC 4A9AA 1NYRA 1SIJA 3VRBB 4N58A 1SF0A 4IDIA 1PDXA 1YQ4B 1V97A 3AEBB 1E10A 1EWYC 3AH7A 1FO4A 5EE9A 1JALA 1JWBD
chains in the Genus database with same CATH superfamily
3V60A 4DBGA 1RYJA 3PO0A 4MJSB 4LNKA 4ZYNA 4EZKA 1WSPA 4PT5A 2KDIA 4M8MA 5J2RA 2J53A 2WDRB 3ML8A 3VVWB 3Q8EA 3VQIA 2EELA 3LYYA 1TY2A 3QK0A 1PGBA 1Z2MA 1WJ4A 1SB3C 5DPSA 2N9LA 3MC8A 1GJZA 2ICIA 1YN3A 1YX6B 1PQSA 2IGGA 1A70A 2NTTA 3PLUA 1DOIA 3V6EB 2Z8LA 5H8YE 2NMQA 3ETRA 2L52A 3DBRI 3FC4A 1E8ZA 3AE4B 2D10A 1Z5SB 1JWAD 2BF8B 1D5MC 2ZPYA 1I4XA 1Q1OA 1QLBB 5C23A 1BT0A 4DDGD 4ZOHC 1TS3A 2ON8A 4JE3B 2AEHA 1E8XA 4LDTD 1QOGA 3HRDD 4W9FA 3H7PA 4W9JA 2BTEA 1FFVA 2V3SA 4KIKA 5J17A 3B2GA 3OAWA 3OJ4B 4GDKA 4ZRKA 2PJHA 2W3RA 3AV8A 4EZJA 1IUEA 3AEGB 2N1WA 5BO4B 2MA9B 5G5HA 3CF6E 3P4QB 2L0FA 4B6WA 2DZMA 4DXGA 3P4SB 4WQMA 2LXAA 4AQ7A 4CYEA 1SJHD 3BK2A 2DAFA 2WXPA 1E6EB 2Z0DB 3KUZA 4DWFA 1XCTL 2NTSA 3A4SC 3VUWA 3EHVA 4ANUA 2KN5A 3VTUA 5BMHA 5AZGA 1UNSA 3HM3A 1EWYC 3A9KA 4G11A 1LGRA 2KDBA 4DQOC 4ITKA 1T0RC 2W9NA 1OEYJ 1E90A 2YLMA 4FJZA 2KO3A 4IWQA 3P1MA 2PMVA 3SU8X 4HRSA 4HKQA 1WMHB 3CSFA 5D3IB 2VH1A 4JX1C 1UH6A 3ZNHB 2FBWB 1HTOA 3M95A 2ZVOA 1OEYA 1V1PA 2Z59B 1TIFA 1Q0WB 4G3XB 2ZNVB 1XD3B 2WGSA 4ANWA 2UU7A 3PVLA 4HDOA 4FHJA 3QHTA 4G50A 3RCZA 1P3QU 2K39A 2NPTB 1JWSD 5BYQA 2QC8A 4M8NA 4KGRA 3TSSA 2RDGA 4KSLC 3ZLZA 2BGFA 3QJZA 3N30A 3VTWA 2PKOA 4KGSA 1WRDB 2MP2A 1C4AA 1WE6A 2WDQB 4E3CA 4K3BA 1E0ZA 3O13A 1TJEA 3A9JB 2BS2B 2FUHB 2KMAA 2PE9A 4IC7B 2IGDA 4ZHOA 1GC7A 3C8YA 3AE5B 1TYGB 4WJPA 1VJKA 1JWUD 1FXIA 3B08A 3WAOA 5AUKA 4B0MA 1QT9A 1JWMD 1N61A 5C3JB 2KZRA 3EFCA 5LNK1 4AOFA 1L2NA 1WXSA 2CR5A 2DLBA 1QZEA 3AEAB 2B3AA 1WXVA 3QC8B 2BW2A 3PSEB 2WX1A 2FIDA 5J18A 1TBEA 4LK0M 4C4VB 1ZE3D 3E56A 1F52A 3D32A 1QQRA 4IWOA 1V5TA 3P4PB 3R66C 3TIXA 1SE4A 4BOZB 2GMIC 2TSSA 2IO2B 2RMMA 2INCC 4W9KA 1YOVB 1V81A 2INDC 2MX2A 3N9YC 3DVNU 5CX3A 3RULA 3GOEA 2J0JA 3W1SC 4C00A 1V9JA 2XK5A 4GDLB 4A3PA 2D11A 2WXNA 1IP9A 5E6NA 3RUIB 4OVZA 1L6VA 4JWUC 4NNJB 2BS4B 4GXBA 2KX0A 3SR6A 2W55A 2Y5BB 5JHAA 4RGTA 3OLMD 3U52E 3QQ8B 3U8ZA 3NG0A 5DPWA 1R4MB 4H2AA 3SFEB 1JMLA 4GGQA 3RNAC 1XF5L 4FLHA 2QIEB 4YL8A 4BOSC 1VR9A 1C3TA 2ONQA 1UBQA 4DXFA 5DPTA 4I6NB 2QSDA 1XLNA 1P9DU 3X23A 3PT2B 3LJ3A 4CO7A 2JSVX 4A3OA 4HROA 1FRDA 2KFKA 3IG3A 3R7RA 4MACA 4R3DA 4HK2A 2MJEA 3JSVB 2L32A 1NYRA 2KWCA 1WGGA 1E10A 3QCAA 4I6LB 2D3AA 1RLFA 3I3TB 4P1BC 4WURA 2M17A 1K53A 2M0XA 1F0ZA 2KJRA 2NS5A 1SE2A 2NBUA 4AJWA 1XLOA 4ZRJA 2LGDA 4REZA 2J0KA 1V86A 5TR5A 1J8CA 2DBYA 4E71A 3I5JC 2LASA 2KMMA 1GNUA 3PS6A 2FCMA 2BYVE 3NVVA 3AE2B 5JXVA 4EE2A 1J7BA 5KHQA 2C9WB 4OZBA 3NZ3A 4IG7B 1SGHA 2E6XA 2KD0A 1HQRD 3ZDMC 4ZDVA 2RPQA 4F7ZA 1EO6A 1WX8A 1WY8A 2MBQA 1KLGD 5D6JB 2QMTA 4LDTB 3PREA 2WXQA 3TUOA 5HG2A 3MFGA 4LNIA 3V61A 1WZ0A 3A1QA 3PZ8A 3GB1A 1ZXIA 2VRRB 1L5PA 3ML9A 4EEWA 3MJ5A 3WIMA 1JRUA 4DHZE 3CIRB 3IT6B 1RM6C 4MH0E 3AB5A 5G55A 3IAS1 3W5VB 4LTUA 3RYTA 3VAWA 1UBIA 4FJYA 2KK8A 2KVZA 2WXMA 2KX3A 1TS2A 3DBHI 2JU6X 3RMKC 2I38A 2W82A 1WXQA 3H8HA 3IXSA 2K9XA 2WU2B 3ZTDA 3NJTA 1YN5A 2KFJA 1GOZA 4LNOA 3ECIA 3DHHC 4YSZB 3SD5A 4FADA 2CHXA 1V2YA 4JGHB 1NBFC 1D4BA 4YT0B 1LO5D 2KAJA 3B9JA 2MCNB 5LXIB 1R4NB 4E74A 4BAXA 1VLBA 2IZVB 3TBLD 3L0WB 4LCDE 1N6ZA 1ZPSA 4LLGM 4B0EA 1IBXB 2G3QB 1STEA 2OJRA 4MM3B 4ZRPA 2KACA 1I4HA 2KJHB 5AZHA 1C79A 2WP9B 1EU3A 4PYUA 1E7UA 1FPYA 3ABVB 1R4MI 3EFUA 5IKCM 4BBNC 4MT5A 2ZW0A 2N9EB 5D2MB 4WJOA 3Q6BA 3U7DA 4TKNA 3X0WA 1T6BX 2DHZA 4XDDA 3KQ4A 3T3NA 3ZGZA 4YSXB 2D3GA 3KYDD 1YQ3B 2LI5A 4FJVB 1I7HA 1WR1A 4KZCA 3NS1A 1T0YA 1UGJA 3AECB 3T3OA 3N1YC 2G4DB 2RDHA 2WXIA 3MC0B 3V6CB 2IDYA 1D5XC 1JWBD 4OZCA 3R8BA 4IM3A 4O1NA 1WM2A 2HE7A 3GE3C 3BY4B 3UF8A 2KANA 3VXWA 3N1XC 2I2YA 3RNBC 3Q8AA 4JIOU 5EE0A 1Q5WB 2REXA 3HIZA 3L13A 3BZDB 3H7PB 4BZAA 1FXAA 2JZ3B 5LXHA 4KIKB 2IJ0A 1L4ZB 1P7EA 4GDKB 1ET6A 5GXGB 1N63A 1I4GA 1YMHE 3JVZX 2LRUA 4IM0A 1NI3A 2LMCA 4K7SA 4HLEA 1FMAD 2KWDA 1PYWD 4W9LA 2RGFA 2ZW1A 4M02A 1V80A 1FCLA 3CSTA 1SJED 3RI7C 3ZUNA 1NDDA 1RRBA 1VD2A 2JQRB 3GZNI 2RDBC 4L2YA 1UD7A 3TL5A 2KC1A 4GOCA 5C2TB 2LZ6A 1LQBA 3A9KB 2LGXA 3OWEB 2BT6A 4XWTA 3RT3B 2IY1B 1T0SC 2WYQA 4IWPA 4W9HA 3RZWC 3TEYA 4MELA 1WJUA 2HTHA 2YEPF 4BKGA 1C78A 2JXXA 2PVOD 4I6PA 4XYCA 3RNEC 3V3XA 1TGZB 1WMHA 4NPNA 3AEFB 4ACFA 2LUMA 4B95A 4EZLA 5E6PA 2A4ZA 1C4CA 5HI1A 2MHJA 1MHXA 2O6VB 3DQVA 5D7GA 1XEEA 1WE7A 1FNUA 2G9HD 2ZJDA 2DZIA 1SIJA 2VZKD 4TSSA 4NQLB 1WX9A 1ZGUB 1H4RA 2KQ7A 3C0RB 2MLBA 2NPTA 3O65B 2Y3AA 4HWIB 3ZJTA 2V4IB 1S3SG 1KFYB 3B0AA 1HEZE 2H89B 2HD5B 2K8BA 4XC2A 3IHPC 2LUEA 2V9HA 3BVGA 1YJJA 3HVZA 3A9JA 1P0RA 3WA0A 4HJKA 3H7SA 4NQKE 3RFZB 2IYDB 2L1AA 4W9DA 2V3NA 3DOWA 3ZTCA 4OZAA 2Y5PA 2CS4A 1ENFA 4RFBA 2WQYB 2CJOA 1VDVA 1UZXB 3AI5A 1SEBD 3QX1A 3H9DA 4XE0A 1C4PA 2FCSA 3TEWA 3AEEB 3NVZA 4XGAB 2O6VD 1F1HA 1TZOA 2C7NB 3FILB 3KWVA 5IN7A 3CMMB 4A8XC 4C4VA 3ONSA 3ZXRA 4LNNA 4YTMB 4IKGA 1H8CA 2BVCA 3CWIA 2Y5CA 2JVCA 3TMPB 3GS2A 4NJ7A 1B1ZA 4HPPA 2LD9A 1LM8B 2D2QA 1CJEA 5FR3A 4KDIC 4ANVA 4KV2A 2MQJA 4ANXA 3L10B 4A9AA 4EKUA 1GB4A 4N58A 4RM8A 1YQ4B 4NZLB 3U4EG 3APCA 5E6JA 4GN1A 3Q3FA 4HCPB 1VZ6A 4K81A 4PS8A 4USAA 2V3PA 3DHIC 1AN8A 5D3DA 5BMIA 1WXMA 1ACCA 4A90A 1VZ8A 4W9EA 3R7QA 3A33B 5HHDG 2CU1A 1FXTB 3ZNZB 4JWSC 4W9IA 5JH5C 2NBWB 3EECA 3Q3MC 2NVUI 2L7RA 4BFRA 2PPHA 3DDCB 2O2VA 4TMAB 3PLVA 2WWZA 4P1CC 1QOBA 2K8CA 1E5WA 5HFYA 2WDTB 2XEWA 1ROEA 3VHTC 3IVFA 4B9KA 4IM2A 1D6EC 5EE1A 3APDA 5L83A 2FNJB 2LEKA 3JSVA 1OQRA 3AULA 3UINB 5FKAC 3RPFC 4II2B 3FAHA 1XQQA 1S1QB 2XNAC 4FN2A 3TEZA 2GBJA 1M4VA 4L23A 3KYCD 2KHWB 3IFWB 3UIPB 4M01A 4NAWB 5IA7A 2LVOA 4Q2JA 4CQNA 3B2FA 2MWSB 2N7DA 4N9F4 2M8SA 4DHJD 2X38A 3UGBB 3U30A 3DBSA 3DWGC 3WALA 2MBBB 3VRBB 2DZJA 3A4RA 5EE9A 1WI0A 1WR6E 2M56B 4AS1A 1KOTA 4HEA1 3JW0X 1QOFA 2DZKA 1PGXA 5EE3A 1CZPA 2KC2A 4ICUA 2WXRA 1U4AA 1WWTA 4RH6A 4C7ZA 3PHXB 2K6DB 1F77A 4AUQC 4BKSA 1J7CA 1A5RA 1FCCC 2ZEQA 4RGNA 1E7VA 3AN1A 1FD6A 2LVPA 3EGRA 2BB6A 3R2TA 4WWMA 1IYFA 2D3CA 2WXHA 1SBBB 1M94A 3AE6B 1E8WA 2WU5B 2WS3B 2UWQA 3IT4B 3BVMA 1ISNA 2KDMA 3KW5B 1WX7A 2FCQA 2FUG1 1NVID 1Y8RC 3AE7B 3UQAA 2R2OA 2YEPB 4YWGG 2LJ5A 2KXJA 3RZFA 2H88B 2LVQA 2KN4A 3NVWA 2L0TA 3QIJA 3RNCC 1YD8U 1HE8A 2AX5A 2ZVNA 4DXAB 4WJQA 2BKFA 4M0WB 2PTLA 5DCNA 5JHBA 4XDCA 2PEAA 3SDLC 2ZNVC 2G45B 4TQ1A 1OFFA 1DOYA 2MW5A 5LLIA 2LGSA 5DPRA 1QOAA 2KTRB 4F1SA 3H1UA 1ZDXA 3TCAA 2MEKA 2JRIB 2DYBA 3R2IA 2WXKA 1T3QA 2EMTA 3L54A 2KKCA 3ZJUA 1Y56A 1VCBA 2R61A 2RSUA 2V1YA 1CK1A 2GRIA 3RNFC 1YX5B 3ZRFA 4RF1A 1F2RC 2FCNA 3LDZE 1IBXA 3JYUA 1QILA 2WHIA 4LNFA 4P16A 1I4PA 2G4SA 2MJ3A 3HM6X 1D3ZA 2L8JA 1PGAA 2LFIA 2XN9C 4WQOB 2D3BA 1TKEA 3PV1A 4TQ0A 4MDKE 1ZXHA 2J0MA 3MHZA 1KF6B 3QA8A 2JT4B 3DVGX 2K3UA 2GLSA 2KLGA 4DHZB 1NI2A 1T0QC 4MGIE 2ZCCA 2DENB 2KDFB 1ZDVA 2RR9A 3VUXA 1UF0A 2JZPA 1OTRB 1N5XA 2DWQA 2DAJA 2NR2A 3BYTB 4JLCA 1QF6A 2GBNA 2W54A 4G0NB 2MRPA 2WXGA 1F2RI 3GP7A 1YQBA 4TV3A 2AL6A 2WXJA 1J0GA 3I9V1 3BWUD 3DBLI 3M62B 4IW0A 3AE8B 3I63C 1FM0D 3MTNB 2M0AA 1C9FA 4GB9A 3RD2A 4JL9A 4YSYB 2FAZA 1R4NI 1TS4A 1MI0A 3ZO5B 1N5WA 2DYOA 1OGWA 4IOIE 1OQQA 5JZEB 2Z0EB 3AU5A 1YN4A 3VTVA 2LJIA 4HKZE 3ZRCA 3IAM1 2KVRA 2L83A 4MSQB 2LRWA 2G1EA 4WH4A 2V0GA 1K50A 3MP9A 3DVNV 3ZQ4A 2K1FA 2N9KA 1D5ZC 2BWES 3ZKJC 1BXTA 3L16A 4GIVA 4NY0A 2MBEA 3SEBA 4DK5A 3HVDA 2KWUB 1RAXA 3ALBA 2K25A 1SE3A 2D07B 1WFYA 4C80A 1HZ5A 1G6JA 4UDUC 2AQ1B 4ZRQA 4GMVA 2PW9A 3PZDA 3J9CA 3NHEB 5T8IA 2JPHA 1I42A 3EC8A 2D5GA 3AE1B 4ASWC 4US8A 2PVGC 2BB5A 3KH0A 2Q5WD 3VR8B 3OJ3A 2E3TA 3NZUA 3APFA 2J7QB 1BMLC 1N62A 2L3ZA 2WXOA 1Q10A 2O6VA 4QAYA 3NZSA 5CHWA 3AEDB 1IGCA 1ZP0B 2GOWA 2HDEA 1V5OA 3KVFB 3BIID 1X1MA 3EUB2 1TS5A 3NRZA 3T9LA 1L0YB 3NY5A 2MSED 3DVGY 2FE8A 2QDFA 1J19A 2C7HA 2WX0A 2K0PA 2KDEB 3KWLA 3KUCB 4L1BA 4ARIA 1WGYA 4S0RA 2BBCA 5G2NA 1NENB 4RNAA 2MBOA 3MHSD 1KJTA 1WF9A 1I4RA 2OOBB 1SSNA 3VUYA 4RF0A 1UWXA 2VH2A 1L6UA 1TTNA 1DYQA 4FHKA 3HK0A 1WM3A 3VH4B 2HJ8A 2CJNA 4X57B 4PYZA 2JXTA 3NUHB 1RWSA 4RM9A 3DBLB 2PIAA 4MSMB 1I35A 1KLVA 2LHEA 5IOIA 3TJPA 5BMGA 2ZCBA 3VRAB 3IBEA 4FXCA 4WWNA 3W9CB 2M1MA 2ZPNA 3W5UB 2M4NA 2JY6A 3FILA 4DDID 4J3OD 4YTPB 1EM7A 1IPGA 1P7FA 1B9RA 1CMXB 1XLQA 1XO3A 1KLUD 2OHFA 4BBNF 5E6OA 3WCQA 3ZW3A 4BKTA 1ZUD2 1WYWB 1JW9D 3DPDA 1WH3A 3Q8BA 4MJSA 1ZOYB 2ACZB 1J7AA 4K7UA 4KKIA 4RGOS 3P42A 1WGRA 4K3CA 1PUTA 1EUVB 3ZJVA 3AM9A 3PZ7A 2JZZA 4MGZE 2AL3A 3UI3A 4HXDA 4HJGE 2N0SB 3P63A 3HHMA 3AXCA 1YJ1A 1WGDA 2K8HA 3Q69A 3ZDTA 4DHJB 3AU4A 4XWWA 2AWTA 2RD0A 4GSWA 1WGKA 3P2BA 2GBKA 4URKA 1TY0A 1BUIC 1MJDA 3PRMB 2SAKA 5I4DA 1C77A 4HCNB 4IUMB 2WNMA 3N1ZC 2ZZPB 2AYOB 2M19A 2O2VB 4WWPA 2JYEA 1ESFA 2OJWA 1DGJA 3Q3JA 4II3B 5AEKB 1SF0A 3RN9C 3AH7A 4HPMB 2GBMA 1YJIA 1WRIA 4ZHPA 4CHKA 2QILA 1FNWA 3N20C 4BKSD 4FA6A 1AW7A 2PLPA 4KDLB 4MH8A 4C7YA 3BYYB 2QHOA 4FBJB 1HZ6A 1OQYA 3M3JA 3W1SA 3Q8FA 3ZVVA 4WAFA 3ZIMA 2LGYA 4KX6B 5FR6A 1YIWA 3K9PB 4C56C 1EU4A 2DX5B 4RCOA 2X8XX 4NAWA 2NCNA 2W3SA 1E8YA 3NS8A 5GMVA 2BYTA 1GAQB 2KYWA 3UIOB 4KGTA 2CHWA 2LHDA 1KRHA 1MG4A 3PRZA 2WXFA 3PHWB 3Q14C 3Q3NC 4OVUA 2WLBA 1WZ3A 1HTQA 4MEMA 1XCQL 1JQ4A 4KZ0A 4PS3A 1WJ6A 4PK1A 1UELA 1K52A 2CKHB 1V1PB 2CHZA 2N7JA 4MGKE 2VZKB 4RGMA 5MPOA 4NJCA 5H92C 2HJ1A 2QCZA 4HDQA 2INNE 2IO0B 4JQWC 1AYFA 1EF5A 2EMSA 2K22A 2RPVA 2V4LA 3AMZA 1T5XD 4GLSC 2BYFA 2KOXA 2K5PA 2KT7A 1RFAA 2MP2B 3AEBB 1V97A 3S2AA 5IAAC 2BPSA 2KJ6A 3EA6A 4K1RB 2B76B 4N59A 1C1YB 5D94A 1HA5A 2GB1A 2AQ3B 2KMCA 2SEBD 1MPEA 4OVVA 3WAMA 4KSKC 2I1KA 4P6VF 3WAPA 4A55A 2LWPA 2WXLA 4S17A 4MGYE 2MH7A 2L00B 4ZRIA 3NVYA 4M0WA 2INPE 4XX5A 4AJYB 3L4PA 3QWZB 3U7ZA 3M63B 3VR9B 2IY0B 2KTRA 4EFOA 3P4RB 1RFKA 2K6QA 4NAMA 1MFWA 4HVBA 2LGIA 3MJWA 1FIQA 4EUTA 2IO1B 1EF1A 2KNBA 4W9GA 4F8CB 1IGDA 4OHJA 2BS3B 2N4FA 3NOBA 1E7PB 1KTKA 5CTRC 4W9CA 2JUOA 3ZXVA 4TUUA 2AQ2B 1V1OA 1NYQA 4LJOB 2A5UA 2XK5B 4GDLA 5KHOA 4AWJA 3N3KB 3URYA 1WGHA 2YVCA 1WJNA 4JPSA 3GE8C 3N32A 2QEJC 3MC9A 3LB8C 5IO9A 3U2SC 2J52A 3SFDB 4WWOA 2BKRB 2N9XA 1SE9A 2JWUA 1GUAB 1HXYD 4BVUC 5FK9C 4IDIA 3DHGC 5BYRA 5IP4D 2I1JA 5BYSA 2ASQA 3FKYA 2JRHA 1SXTA 1V49A 1KM7A 2JX5A 2J42A 4WJNA 2JWZA 2JF5A 3C19A 2NBVB 4US9A 4OW0A 5CHVC 4A20A 1XT9B 4P7IA 1FEHA 3TEXA 2KLCA 2CU3A 3ENEA 2DNFA 2KFKB 1UUPA 4RMAA 2L76A 2MBHA 3AE9B 2N9PC 5AUIA 1VRAB 4AP4C 3L08A 4YXDB 2J4XA 1L0VB 1FNVA 1FFUA 1LFDA 1TZ1A 1DOXA 2BYEA 2EKIA 1WYGA 1C76A 5CHFA 2IGHA 2KTFA 4HPLB 1GG3A 3VDZA 1MHHE 2KQ4X 2QJLA 2L05A 2FIFA 4M00A 2WDVB 5EDSA 1F9JA 3E9SA 2DYMA 3OG5A 3ZYYX 1MVKA 2BQQA 1P1AA 1GPXA 1XLPA 1NEKB 1JCKB 2N1VA 3I57A 3RNGC 2C7MB 2IPKD 1V8CA 1E9MA 3BK1A 1GB1A 3B1LX 3DCGA 1WIAA 1YNTE 1L4DB 3DBRB 3BVZA 3Q2AC 1VZ7A 1KH0A 1ZW7A 2HTME 3A1QB 1JRPA 5C1ZA 1LXDA 1PDXA 1K51A 1K8RB 1FO4A 2IO3B 3H6NA 4J6IA 3T8MA 1EWCA 4EOYA 2XBBC 4K7WA 1L7YA 2C60A 3K9OB 2BWFA 4LJPB 4A6QA 2N7EA 3SHQA 1WXAA 1QKZA 4D2KA 2GI9A 1XXGA 3PRPB 3UQBA 3LXFA 1L0XB 4XZ4A 2MJDA 4KKJA 5HKHA 2KQSA 3ZNGC 1JROA 4ARCA 2IBIB 1FRRA 4WIPA 3PTFC 2R2QA 3QAQA 4KVGB 1SIFA 5L95C 1TKGA 3Q8CA 1UGMA 3VH3B 1AWDA 3GZNB 3W1YA 3R3MA 3W2DA 4N6EB 2PE6B 2OEDA 3PPAA 5TSSA 2LXCA 3BINA 1ET9A 3KUDB 1GC6A 1P98A 2JYTA 1AARA 1N60A 2GBRA 4PS7A 5G5GA 4GU2A 2UYZB 3DBHB 1MG8A 1PFDA 1I4QA 3HUIA 4ICVA 2EKEC 3KLSX 4FULA 4MM3A 3DWMA 2C5LC 1V6EA 1TT5B 1CQVA 2KWVB 3AE3B 5AZFA 4ZYSA 3V05A 1TKYA 1R7SA 4YTNB 3Q3OC 1UWMA 3V62A 3PGEA 3QARA 4NJ6A 3WANA 4WAAA 3VFKA 1ZKHA 3L17A 1JALA 3ZNID
chains in the Genus database with same CATH topology
1YJIA 1RYJA 3PO0A 1WRIA 4ZHPA 2M56B 4YSZB 2QILA 4AS1A 1FNWA 1WSPA 4PT5A 4HEA1 1QOFA 1PGXA 5EE3A 1D4BA 4YT0B 1AW7A 2PLPA 1CZPA 2WXRA 1WWTA 2J53A 4RH6A 1LO5D 2KAJA 4MH8A 4C7ZA 3B9JA 4C7YA 3BYYB 2WDRB 1F77A 1VLBA 1HZ6A 3Q8EA 1J7CA 1FCCC 3VQIA 2EELA 3LYYA 4RGNA 1TY2A 3W1SA 3AN1A 1FD6A 1PGBA 3Q8FA 1SB3C 2N9LA 3EGRA 2BB6A 3R2TA 2ICIA 1YN3A 4WWMA 1ZPSA 4WAFA 4KX6B 2IGGA 1A70A 4LLGM 2WXHA 2NTTA 1EU4A 4B0EA 4C56C 1SBBB 3AE6B 1DOIA 2WU5B 2Z8LA 5H8YE 4RCOA 2NMQA 2WS3B 3IT4B 1IBXB 3ETRA 2L52A 3BVMA 2W3SA 2KDMA 1STEA 3FC4A 2BYTA 4MM3B 2FUG1 4ZRPA 1GAQB 1NVID 3AE4B 3AE7B 2KACA 1I4HA 4KGTA 1JWAD 1D5MC 2YEPB 1C79A 2WP9B 1EU3A 1I4XA 2LHDA 4YWGG 1QLBB 1KRHA 2H88B 1TS3A 4ZOHC 2KN4A 2WXFA 2ON8A 3NVWA 4JE3B 2WLBA 1QOGA 3HRDD 3ABVB 1XCQL 2AX5A 1JQ4A 2BTEA 1FFVA 2PTLA 1K52A 3B2GA 4XDCA 4MT5A 1V1PB 2ZW0A 2N7JA 2W3RA 3AV8A 1IUEA 3AEGB 4RGMA 2VZKB 5MPOA 4TQ1A 1T6BX 1OFFA 5G5HA 1DOYA 3P4QB 4NJCA 4XDDA 5H92C 4DXGA 3P4SB 4WQMA 1QOAA 2INNE 1ZDXA 3KQ4A 4AQ7A 3T3NA 4YSXB 3ZGZA 1AYFA 1SJHD 2K22A 2MEKA 1YQ3B 3R2IA 3BK2A 2RPVA 2WXPA 2WXKA 1T3QA 3AMZA 1E6EB 1T5XD 1XCTL 1Y56A 2NTSA 3ZJUA 2R61A 1I7HA 4GLSC 3T3OA 3NS1A 1CK1A 1UGJA 3AECB 2GRIA 2K5PA 4RF1A 1F2RC 5BMHA 2RDHA 1IBXA 3AEBB 1UNSA 1V97A 1EWYC 1QILA 2WXIA 3MC0B 4DQOC 2IDYA 1D5XC 1JWBD 4OZCA 3R8BA 3EA6A 4P16A 1I4PA 2B76B 4ITKA 4N59A 4O1NA 1HA5A 2GB1A 2MJ3A 2AQ3B 2LFIA 1PGAA 2XN9C 1TKEA 2SEBD 4TQ0A 1MPEA 1ZXHA 4P6VF 3MHZA 1KF6B 2PMVA 3P1MA 4A55A 2I2YA 2WXLA 3Q8AA 2MH7A 4HRSA 4HKQA 2K3UA 5EE0A 5D3IB 3BZDB 4JX1C 1FXAA 3NVYA 4M0WA 2IJ0A 2FBWB 1L4ZB 1ZDVA 1P7EA 4GDKB 1V1PA 2INPE 1ET6A 5GXGB 1N63A 1I4GA 1YMHE 2JZPA 3L4PA 1N5XA 2DWQA 3U7ZA 3BYTB 1NI3A 2LMCA 3VR9B 1QF6A 1FMAD 2KWDA 3P4RB 1PYWD 2W54A 1RFKA 2ZW1A 2WXGA 1F2RI 3GP7A 1JWSD 1FCLA 5BYQA 1SJED 4KGRA 4NAMA 3TSSA 2RDGA 2LGIA 2WXJA 3I9V1 1FIQA 2JQRB 3BWUD 4L2YA 2PKOA 3AE8B 4KGSA 5C2TB 1FM0D 1C4AA 2M0AA 1IGDA 2WDQB 4OHJA 1C9FA 3OWEB 2BT6A 1E0ZA 2BS3B 3O13A 1TJEA 4XWTA 4YSYB 1E7PB 1KTKA 1TS4A 3TEYA 2BS2B 1MI0A 1N5WA 2YEPF 2DYOA 4IOIE 2IGDA 4ZHOA 1OQQA 1C78A 1YN4A 1V1OA 2AQ2B 3C8YA 2LJIA 3AE5B 4HKZE 3IAM1 2PVOD 1NYQA 3V3XA 1TYGB 1VJKA 2L83A 3AEFB 3URYA 1JWUD 2G1EA 1FXIA 2LUMA 4B0MA 5AUKA 4JPSA 1QT9A 1JWMD 1N61A 2QEJC 4WH4A 5C3JB 2V0GA 3LB8C 5LNK1 1K50A 3U2SC 3MP9A 1C4CA 2J52A 5HI1A 3SFDB 2DLBA 3ZQ4A 1MHXA 3AEAB 2N9KA 1D5ZC 2JWUA 1XEEA 5D7GA 1FNUA 2G9HD 1HXYD 2BW2A 1BXTA 1SIJA 2VZKD 4TSSA 5FK9C 4IDIA 5BYRA 3SEBA 3HVDA 2Y3AA 5BYSA 1SE3A 3ZJTA 2V4IB 1SXTA 4LK0M 1ZE3D 4C80A 1HZ5A 3E56A 2JX5A 4UDUC 2J42A 1QQRA 2AQ1B 1KFYB 4ZRQA 2PW9A 3J9CA 3P4PB 4US9A 4OW0A 1HEZE 5T8IA 1SE4A 2H89B 2TSSA 1FEHA 3TEXA 2D5GA 2RMMA 2CU3A 3AE1B 4US8A 3BVGA 2PVGC 1UUPA 1YJJA 3HVZA 3N9YC 3AE9B 2BB5A 5AUIA 2Q5WD 3VR8B 1VRAB 4GDLB 2WXNA 2E3TA 4YXDB 3RFZB 2J4XA 2L1AA 4OVZA 1L0VB 1FNVA 1L6VA 2V3NA 1BMLC 4JWUC 4OZAA 2Y5PA 1N62A 1ENFA 2BS4B 1Q10A 2WXOA 1FFUA 4RFBA 2WQYB 2CJOA 1VDVA 3SR6A 1DOXA 2W55A 2EKIA 1IGCA 1ZP0B 1WYGA 3AEDB 4RGTA 2HDEA 1C76A 1SEBD 2IGHA 3U52E 3BIID 4XE0A 1MHHE 1C4PA 3EUB2 1TS5A 2KQ4X 4H2AA 3SFEB 3TEWA 2QJLA 3AEEB 3NRZA 3NVZA 1TZOA 3KWVA 3FILB 1L0YB 2WDVB 1JMLA 1XF5L 3E9SA 2QIEB 4A8XC 2DYMA 2FE8A 3ZYYX 1MVKA 1VR9A 4YTMB 2ONQA 4IKGA 2K0PA 3KWLA 1XLPA 1GPXA 4L1BA 4ARIA 4DXFA 1NEKB 2BBCA 1JCKB 3CWIA 3I57A 2Y5CA 2IPKD 2QSDA 1NENB 1E9MA 1V8CA 1XLNA 3BK1A 4RNAA 3GS2A 1GB1A 1B1ZA 2JSVX 1I4RA 4HROA 1SSNA 1YNTE 1FRDA 1CJEA 1L4DB 3BVZA 4RF0A 5FR3A 4MACA 1UWXA 4R3DA 1VZ7A 1KH0A 1L6UA 2HTME 1DYQA 2MJEA 1JRPA 4A9AA 2L32A 1NYRA 1GB4A 4N58A 1E10A 1PDXA 1YQ4B 1K51A 1FO4A 4NZLB 3U4EG 5E6JA 1VZ6A 2CJNA 4WURA 2V3PA 4USAA 2JXTA 1AN8A 3NUHB 1K53A 1RWSA 1F0ZA 1SE2A 1EWCA 5D3DA 2PIAA 5BMIA 1ACCA 1XLOA 4A90A 1VZ8A 4REZA 5HHDG 2LHEA 4A6QA 4JWSC 1QKZA 5BMGA 2DBYA 3VRAB 4D2KA 2GI9A 2KMMA 4FXCA 1XXGA 3LXFA 1L0XB 3AE2B 3NVVA 3W9CB 5JXVA 3W5UB 4EE2A 2MJDA 1J7BA 3FILA 4KKJA 4J3OD 4OZBA 4YTPB 3NZ3A 1EM7A 4TMAB 1JROA 2E6XA 1P7FA 4ARCA 1HQRD 1B9RA 1QOBA 1XLQA 1FRRA 1XO3A 4WIPA 1KLUD 5HFYA 2OHFA 3WCQA 1ZUD2 1JW9D 1ROEA 3Q8BA 1KLGD 1TKGA 2QMTA 1ZOYB 2ACZB 1J7AA 2WXQA 3Q8CA 3TUOA 5HG2A 4KKIA 1AWDA 4RGOS 3P42A 1D6EC 5EE1A 3MFGA 3W2DA 4N6EB 2OEDA 1PUTA 3PZ8A 2LEKA 1OQRA 3ZJVA 3AM9A 3GB1A 1ZXIA 3PZ7A 5TSSA 1L5PA 5FKAC 3UI3A 3RPFC 3MJ5A 4HJGE 3FAHA 2N0SB 1ET9A 2XNAC 2JYTA 3P63A 1N60A 3TEZA 3CIRB 5G5GA 3IT6B 1M4VA 4L23A 3Q69A 1RM6C 3AB5A 3IAS1 1PFDA 3W5VB 4LTUA 4XWWA 1I4QA 4NAWB 3HUIA 1WGKA 3KLSX 4Q2JA 4CQNA 1TY0A 1BUIC 2WXMA 3B2FA 3DWMA 2SAKA 5I4DA 1C77A 1TS2A 1CQVA 2JU6X 2WNMA 2I38A 3AE3B 2M19A 2W82A 4ZYSA 3V05A 2X38A 1TKYA 1WXQA 1R7SA 4YTNB 3H8HA 1UWMA 2JYEA 3DWGC 3IXSA 2K9XA 1ESFA 1DGJA 2WU2B 1YN5A 3VRBB 1SF0A 1GOZA 3AH7A 5EE9A 1JALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJI A;  1RYJ A;  2B76 B;  1WRI A;  3PO0 A;  4ITK A;  4N59 A;  4ZHP A;  2CJN A;  2M56 B;  2MJ3 A;  4USA A;  4YSZ B;  1RWS A;  4C80 A;  1F0Z A;  1TKE A;  2JX5 A;  1QOF A;  2PIA A;  5EE3 A;  4YT0 B;  1XLO A;  1CZP A;  4P6V F;  1KF6 B;  3P1M A;  1WWT A;  2KAJ A;  4C7Z A;  1KFY B;  2MH7 A;  3B9J A;  4HRS A;  4C7Y A;  5EE0 A;  3P4P B;  2WDR B;  4JWS C;  4US9 A;  1VLB A;  4JX1 C;  2DBY A;  3VRA B;  1J7C A;  1FXA A;  2H89 B;  2KMM A;  3NVY A;  4FXC A;  2FBW B;  3LXF A;  3AE1 B;  2CU3 A;  3AE2 B;  3NVV A;  3W9C B;  3AN1 A;  3W5U B;  2MJD A;  1J7B A;  4US8 A;  1SB3 C;  2PVG C;  1YJJ A;  3HVZ A;  4YTP B;  1JRO A;  4WWM A;  5GXG B;  1N63 A;  4KX6 B;  1B9R A;  3AE9 B;  1A70 A;  3L4P A;  5AUI A;  2Q5W D;  3AE6 B;  1QOB A;  1N5X A;  1FRR A;  1DOI A;  1XLQ A;  1XO3 A;  2DWQ A;  3VR8 B;  2WU5 B;  5H8Y E;  1NI3 A;  2OHF A;  2WS3 B;  3VR9 B;  3WCQ A;  3ETR A;  1QF6 A;  1ZUD 2;  1FMA D;  2L52 A;  3P4R B;  2W3S A;  2W54 A;  1JW9 D;  1ROE A;  1RFK A;  2E3T A;  3FC4 A;  4YXD B;  1TKG A;  1ZOY B;  1L0V B;  2ACZ B;  1GAQ B;  1NVI D;  3AE4 B;  1L6V A;  1J7A A;  3AE7 B;  4JWU C;  1N62 A;  2BS4 B;  1JWA D;  1AWD A;  2WP9 B;  1FFU A;  1FIQ A;  1QLB B;  5EE1 A;  1KRH A;  4N6E B;  2JQR B;  2WQY B;  2CJO A;  1VDV A;  1PUT A;  2H88 B;  4ZOH C;  2W55 A;  3NVW A;  3SR6 A;  1DOX A;  2EKI A;  1ZP0 B;  1WYG A;  3AED B;  2WLB A;  2LEK A;  1OQR A;  1QOG A;  2PKO A;  3ABV B;  3AE8 B;  3AM9 A;  3HRD D;  1ZXI A;  2AX5 A;  5C2T B;  1FM0 D;  1L5P A;  3BII D;  1JQ4 A;  3RPF C;  3EUB 2;  2WDQ B;  1FFV A;  3FAH A;  2N0S B;  3SFE B;  2QJL A;  2BT6 A;  3AEE B;  3NRZ A;  3NVZ A;  1E0Z A;  2BS3 B;  4YSY B;  1TJE A;  1E7P B;  3B2G A;  2WDV B;  3P63 A;  1N60 A;  3CIR B;  5G5G A;  2W3R A;  2BS2 B;  3AV8 A;  2QIE B;  1IUE A;  1N5W A;  3AEG B;  4ZHO A;  1RM6 C;  1OQQ A;  3ZYY X;  5MPO A;  1OFF A;  4YTM B;  3AB5 A;  5G5H A;  1DOY A;  3P4Q B;  1PFD A;  5H92 C;  3AE5 B;  1XLP A;  3KWL A;  2PVO D;  4LTU A;  3W5V B;  1GPX A;  1NYQ A;  1NEK B;  3P4S B;  4WQM A;  1QOA A;  3HUI A;  1TYG B;  3CWI A;  1VJK A;  1WGK A;  2L83 A;  4YSX B;  3AEF B;  2Y5C A;  1AYF A;  2G1E A;  1FXI A;  2K22 A;  3B2F A;  5AUK A;  1NEN B;  1E9M A;  1QT9 A;  1V8C A;  1N61 A;  1XLN A;  1YQ3 B;  3DWM A;  5C3J B;  3LB8 C;  1T3Q A;  3AMZ A;  1E6E B;  4HRO A;  3SFD B;  1FRD A;  2M19 A;  3AE3 B;  1CJE A;  1I7H A;  3AEA B;  1TKY A;  1WXQ A;  1R7S A;  4YTN B;  1UWM A;  3NS1 A;  3AEC B;  1L6U A;  2K9X A;  2HTM E;  1DGJ A;  2K5P A;  1JRP A;  2MJE A;  2WU2 B;  3DWG C;  4A9A A;  1NYR A;  1SIJ A;  3VRB B;  4N58 A;  1SF0 A;  4IDI A;  1PDX A;  1YQ4 B;  1V97 A;  3AEB B;  1E10 A;  1EWY C;  3AH7 A;  1FO4 A;  5EE9 A;  1JAL A;  1JWB D; 
#chains in the Genus database with same CATH topology
 3V60 A;  4DBG A;  1RYJ A;  3PO0 A;  4MJS B;  4LNK A;  4ZYN A;  4EZK A;  1WSP A;  4PT5 A;  2KDI A;  4M8M A;  5J2R A;  2J53 A;  2WDR B;  3ML8 A;  3VVW B;  3Q8E A;  3VQI A;  2EEL A;  3LYY A;  1TY2 A;  3QK0 A;  1PGB A;  1Z2M A;  1WJ4 A;  1SB3 C;  5DPS A;  2N9L A;  3MC8 A;  1GJZ A;  2ICI A;  1YN3 A;  1YX6 B;  1PQS A;  2IGG A;  1A70 A;  2NTT A;  3PLU A;  1DOI A;  3V6E B;  2Z8L A;  5H8Y E;  2NMQ A;  3ETR A;  2L52 A;  3DBR I;  3FC4 A;  1E8Z A;  3AE4 B;  2D10 A;  1Z5S B;  1JWA D;  2BF8 B;  1D5M C;  2ZPY A;  1I4X A;  1Q1O A;  1QLB B;  5C23 A;  1BT0 A;  4DDG D;  4ZOH C;  1TS3 A;  2ON8 A;  4JE3 B;  2AEH A;  1E8X A;  4LDT D;  1QOG A;  3HRD D;  4W9F A;  3H7P A;  4W9J A;  2BTE A;  1FFV A;  2V3S A;  4KIK A;  5J17 A;  3B2G A;  3OAW A;  3OJ4 B;  4GDK A;  4ZRK A;  2PJH A;  2W3R A;  3AV8 A;  4EZJ A;  1IUE A;  3AEG B;  2N1W A;  5BO4 B;  2MA9 B;  5G5H A;  3CF6 E;  3P4Q B;  2L0F A;  4B6W A;  2DZM A;  4DXG A;  3P4S B;  4WQM A;  2LXA A;  4AQ7 A;  4CYE A;  1SJH D;  3BK2 A;  2DAF A;  2WXP A;  1E6E B;  2Z0D B;  3KUZ A;  4DWF A;  1XCT L;  2NTS A;  3A4S C;  3VUW A;  3EHV A;  4ANU A;  2KN5 A;  3VTU A;  5BMH A;  5AZG A;  1UNS A;  3HM3 A;  1EWY C;  3A9K A;  4G11 A;  1LGR A;  2KDB A;  4DQO C;  4ITK A;  1T0R C;  2W9N A;  1OEY J;  1E90 A;  2YLM A;  4FJZ A;  2KO3 A;  4IWQ A;  3P1M A;  2PMV A;  3SU8 X;  4HRS A;  4HKQ A;  1WMH B;  3CSF A;  5D3I B;  2VH1 A;  4JX1 C;  1UH6 A;  3ZNH B;  2FBW B;  1HTO A;  3M95 A;  2ZVO A;  1OEY A;  1V1P A;  2Z59 B;  1TIF A;  1Q0W B;  4G3X B;  2ZNV B;  1XD3 B;  2WGS A;  4ANW A;  2UU7 A;  3PVL A;  4HDO A;  4FHJ A;  3QHT A;  4G50 A;  3RCZ A;  1P3Q U;  2K39 A;  2NPT B;  1JWS D;  5BYQ A;  2QC8 A;  4M8N A;  4KGR A;  3TSS A;  2RDG A;  4KSL C;  3ZLZ A;  2BGF A;  3QJZ A;  3N30 A;  3VTW A;  2PKO A;  4KGS A;  1WRD B;  2MP2 A;  1C4A A;  1WE6 A;  2WDQ B;  4E3C A;  4K3B A;  1E0Z A;  3O13 A;  1TJE A;  3A9J B;  2BS2 B;  2FUH B;  2KMA A;  2PE9 A;  4IC7 B;  2IGD A;  4ZHO A;  1GC7 A;  3C8Y A;  3AE5 B;  1TYG B;  4WJP A;  1VJK A;  1JWU D;  1FXI A;  3B08 A;  3WAO A;  5AUK A;  4B0M A;  1QT9 A;  1JWM D;  1N61 A;  5C3J B;  2KZR A;  3EFC A;  5LNK 1;  4AOF A;  1L2N A;  1WXS A;  2CR5 A;  2DLB A;  1QZE A;  3AEA B;  2B3A A;  1WXV A;  3QC8 B;  2BW2 A;  3PSE B;  2WX1 A;  2FID A;  5J18 A;  1TBE A;  4LK0 M;  4C4V B;  1ZE3 D;  3E56 A;  1F52 A;  3D32 A;  1QQR A;  4IWO A;  1V5T A;  3P4P B;  3R66 C;  3TIX A;  1SE4 A;  4BOZ B;  2GMI C;  2TSS A;  2IO2 B;  2RMM A;  2INC C;  4W9K A;  1YOV B;  1V81 A;  2IND C;  2MX2 A;  3N9Y C;  3DVN U;  5CX3 A;  3RUL A;  3GOE A;  2J0J A;  3W1S C;  4C00 A;  1V9J A;  2XK5 A;  4GDL B;  4A3P A;  2D11 A;  2WXN A;  1IP9 A;  5E6N A;  3RUI B;  4OVZ A;  1L6V A;  4JWU C;  4NNJ B;  2BS4 B;  4GXB A;  2KX0 A;  3SR6 A;  2W55 A;  2Y5B B;  5JHA A;  4RGT A;  3OLM D;  3U52 E;  3QQ8 B;  3U8Z A;  3NG0 A;  5DPW A;  1R4M B;  4H2A A;  3SFE B;  1JML A;  4GGQ A;  3RNA C;  1XF5 L;  4FLH A;  2QIE B;  4YL8 A;  4BOS C;  1VR9 A;  1C3T A;  2ONQ A;  1UBQ A;  4DXF A;  5DPT A;  4I6N B;  2QSD A;  1XLN A;  1P9D U;  3X23 A;  3PT2 B;  3LJ3 A;  4CO7 A;  2JSV X;  4A3O A;  4HRO A;  1FRD A;  2KFK A;  3IG3 A;  3R7R A;  4MAC A;  4R3D A;  4HK2 A;  2MJE A;  3JSV B;  2L32 A;  1NYR A;  2KWC A;  1WGG A;  1E10 A;  3QCA A;  4I6L B;  2D3A A;  1RLF A;  3I3T B;  4P1B C;  4WUR A;  2M17 A;  1K53 A;  2M0X A;  1F0Z A;  2KJR A;  2NS5 A;  1SE2 A;  2NBU A;  4AJW A;  1XLO A;  4ZRJ A;  2LGD A;  4REZ A;  2J0K A;  1V86 A;  5TR5 A;  1J8C A;  2DBY A;  4E71 A;  3I5J C;  2LAS A;  2KMM A;  1GNU A;  3PS6 A;  2FCM A;  2BYV E;  3NVV A;  3AE2 B;  5JXV A;  4EE2 A;  1J7B A;  5KHQ A;  2C9W B;  4OZB A;  3NZ3 A;  4IG7 B;  1SGH A;  2E6X A;  2KD0 A;  1HQR D;  3ZDM C;  4ZDV A;  2RPQ A;  4F7Z A;  1EO6 A;  1WX8 A;  1WY8 A;  2MBQ A;  1KLG D;  5D6J B;  2QMT A;  4LDT B;  3PRE A;  2WXQ A;  3TUO A;  5HG2 A;  3MFG A;  4LNI A;  3V61 A;  1WZ0 A;  3A1Q A;  3PZ8 A;  3GB1 A;  1ZXI A;  2VRR B;  1L5P A;  3ML9 A;  4EEW A;  3MJ5 A;  3WIM A;  1JRU A;  4DHZ E;  3CIR B;  3IT6 B;  1RM6 C;  4MH0 E;  3AB5 A;  5G55 A;  3IAS 1;  3W5V B;  4LTU A;  3RYT A;  3VAW A;  1UBI A;  4FJY A;  2KK8 A;  2KVZ A;  2WXM A;  2KX3 A;  1TS2 A;  3DBH I;  2JU6 X;  3RMK C;  2I38 A;  2W82 A;  1WXQ A;  3H8H A;  3IXS A;  2K9X A;  2WU2 B;  3ZTD A;  3NJT A;  1YN5 A;  2KFJ A;  1GOZ A;  4LNO A;  3ECI A;  3DHH C;  4YSZ B;  3SD5 A;  4FAD A;  2CHX A;  1V2Y A;  4JGH B;  1NBF C;  1D4B A;  4YT0 B;  1LO5 D;  2KAJ A;  3B9J A;  2MCN B;  5LXI B;  1R4N B;  4E74 A;  4BAX A;  1VLB A;  2IZV B;  3TBL D;  3L0W B;  4LCD E;  1N6Z A;  1ZPS A;  4LLG M;  4B0E A;  1IBX B;  2G3Q B;  1STE A;  2OJR A;  4MM3 B;  4ZRP A;  2KAC A;  1I4H A;  2KJH B;  5AZH A;  1C79 A;  2WP9 B;  1EU3 A;  4PYU A;  1E7U A;  1FPY A;  3ABV B;  1R4M I;  3EFU A;  5IKC M;  4BBN C;  4MT5 A;  2ZW0 A;  2N9E B;  5D2M B;  4WJO A;  3Q6B A;  3U7D A;  4TKN A;  3X0W A;  1T6B X;  2DHZ A;  4XDD A;  3KQ4 A;  3T3N A;  3ZGZ A;  4YSX B;  2D3G A;  3KYD D;  1YQ3 B;  2LI5 A;  4FJV B;  1I7H A;  1WR1 A;  4KZC A;  3NS1 A;  1T0Y A;  1UGJ A;  3AEC B;  3T3O A;  3N1Y C;  2G4D B;  2RDH A;  2WXI A;  3MC0 B;  3V6C B;  2IDY A;  1D5X C;  1JWB D;  4OZC A;  3R8B A;  4IM3 A;  4O1N A;  1WM2 A;  2HE7 A;  3GE3 C;  3BY4 B;  3UF8 A;  2KAN A;  3VXW A;  3N1X C;  2I2Y A;  3RNB C;  3Q8A A;  4JIO U;  5EE0 A;  1Q5W B;  2REX A;  3HIZ A;  3L13 A;  3BZD B;  3H7P B;  4BZA A;  1FXA A;  2JZ3 B;  5LXH A;  4KIK B;  2IJ0 A;  1L4Z B;  1P7E A;  4GDK B;  1ET6 A;  5GXG B;  1N63 A;  1I4G A;  1YMH E;  3JVZ X;  2LRU A;  4IM0 A;  1NI3 A;  2LMC A;  4K7S A;  4HLE A;  1FMA D;  2KWD A;  1PYW D;  4W9L A;  2RGF A;  2ZW1 A;  4M02 A;  1V80 A;  1FCL A;  3CST A;  1SJE D;  3RI7 C;  3ZUN A;  1NDD A;  1RRB A;  1VD2 A;  2JQR B;  3GZN I;  2RDB C;  4L2Y A;  1UD7 A;  3TL5 A;  2KC1 A;  4GOC A;  5C2T B;  2LZ6 A;  1LQB A;  3A9K B;  2LGX A;  3OWE B;  2BT6 A;  4XWT A;  3RT3 B;  2IY1 B;  1T0S C;  2WYQ A;  4IWP A;  4W9H A;  3RZW C;  3TEY A;  4MEL A;  1WJU A;  2HTH A;  2YEP F;  4BKG A;  1C78 A;  2JXX A;  2PVO D;  4I6P A;  4XYC A;  3RNE C;  3V3X A;  1TGZ B;  1WMH A;  4NPN A;  3AEF B;  4ACF A;  2LUM A;  4B95 A;  4EZL A;  5E6P A;  2A4Z A;  1C4C A;  5HI1 A;  2MHJ A;  1MHX A;  2O6V B;  3DQV A;  5D7G A;  1XEE A;  1WE7 A;  1FNU A;  2G9H D;  2ZJD A;  2DZI A;  1SIJ A;  2VZK D;  4TSS A;  4NQL B;  1WX9 A;  1ZGU B;  1H4R A;  2KQ7 A;  3C0R B;  2MLB A;  2NPT A;  3O65 B;  2Y3A A;  4HWI B;  3ZJT A;  2V4I B;  1S3S G;  1KFY B;  3B0A A;  1HEZ E;  2H89 B;  2HD5 B;  2K8B A;  4XC2 A;  3IHP C;  2LUE A;  2V9H A;  3BVG A;  1YJJ A;  3HVZ A;  3A9J A;  1P0R A;  3WA0 A;  4HJK A;  3H7S A;  4NQK E;  3RFZ B;  2IYD B;  2L1A A;  4W9D A;  2V3N A;  3DOW A;  3ZTC A;  4OZA A;  2Y5P A;  2CS4 A;  1ENF A;  4RFB A;  2WQY B;  2CJO A;  1VDV A;  1UZX B;  3AI5 A;  1SEB D;  3QX1 A;  3H9D A;  4XE0 A;  1C4P A;  2FCS A;  3TEW A;  3AEE B;  3NVZ A;  4XGA B;  2O6V D;  1F1H A;  1TZO A;  2C7N B;  3FIL B;  3KWV A;  5IN7 A;  3CMM B;  4A8X C;  4C4V A;  3ONS A;  3ZXR A;  4LNN A;  4YTM B;  4IKG A;  1H8C A;  2BVC A;  3CWI A;  2Y5C A;  2JVC A;  3TMP B;  3GS2 A;  4NJ7 A;  1B1Z A;  4HPP A;  2LD9 A;  1LM8 B;  2D2Q A;  1CJE A;  5FR3 A;  4KDI C;  4ANV A;  4KV2 A;  2MQJ A;  4ANX A;  3L10 B;  4A9A A;  4EKU A;  1GB4 A;  4N58 A;  4RM8 A;  1YQ4 B;  4NZL B;  3U4E G;  3APC A;  5E6J A;  4GN1 A;  3Q3F A;  4HCP B;  1VZ6 A;  4K81 A;  4PS8 A;  4USA A;  2V3P A;  3DHI C;  1AN8 A;  5D3D A;  5BMI A;  1WXM A;  1ACC A;  4A90 A;  1VZ8 A;  4W9E A;  3R7Q A;  3A33 B;  5HHD G;  2CU1 A;  1FXT B;  3ZNZ B;  4JWS C;  4W9I A;  5JH5 C;  2NBW B;  3EEC A;  3Q3M C;  2NVU I;  2L7R A;  4BFR A;  2PPH A;  3DDC B;  2O2V A;  4TMA B;  3PLV A;  2WWZ A;  4P1C C;  1QOB A;  2K8C A;  1E5W A;  5HFY A;  2WDT B;  2XEW A;  1ROE A;  3VHT C;  3IVF A;  4B9K A;  4IM2 A;  1D6E C;  5EE1 A;  3APD A;  5L83 A;  2FNJ B;  2LEK A;  3JSV A;  1OQR A;  3AUL A;  3UIN B;  5FKA C;  3RPF C;  4II2 B;  3FAH A;  1XQQ A;  1S1Q B;  2XNA C;  4FN2 A;  3TEZ A;  2GBJ A;  1M4V A;  4L23 A;  3KYC D;  2KHW B;  3IFW B;  3UIP B;  4M01 A;  4NAW B;  5IA7 A;  2LVO A;  4Q2J A;  4CQN A;  3B2F A;  2MWS B;  2N7D A;  4N9F 4;  2M8S A;  4DHJ D;  2X38 A;  3UGB B;  3U30 A;  3DBS A;  3DWG C;  3WAL A;  2MBB B;  3VRB B;  2DZJ A;  3A4R A;  5EE9 A;  1WI0 A;  1WR6 E;  2M56 B;  4AS1 A;  1KOT A;  4HEA 1;  3JW0 X;  1QOF A;  2DZK A;  1PGX A;  5EE3 A;  1CZP A;  2KC2 A;  4ICU A;  2WXR A;  1U4A A;  1WWT A;  4RH6 A;  4C7Z A;  3PHX B;  2K6D B;  1F77 A;  4AUQ C;  4BKS A;  1J7C A;  1A5R A;  1FCC C;  2ZEQ A;  4RGN A;  1E7V A;  3AN1 A;  1FD6 A;  2LVP A;  3EGR A;  2BB6 A;  3R2T A;  4WWM A;  1IYF A;  2D3C A;  2WXH A;  1SBB B;  1M94 A;  3AE6 B;  1E8W A;  2WU5 B;  2WS3 B;  2UWQ A;  3IT4 B;  3BVM A;  1ISN A;  2KDM A;  3KW5 B;  1WX7 A;  2FCQ A;  2FUG 1;  1NVI D;  1Y8R C;  3AE7 B;  3UQA A;  2R2O A;  2YEP B;  4YWG G;  2LJ5 A;  2KXJ A;  3RZF A;  2H88 B;  2LVQ A;  2KN4 A;  3NVW A;  2L0T A;  3QIJ A;  3RNC C;  1YD8 U;  1HE8 A;  2AX5 A;  2ZVN A;  4DXA B;  4WJQ A;  2BKF A;  4M0W B;  2PTL A;  5DCN A;  5JHB A;  4XDC A;  2PEA A;  3SDL C;  2ZNV C;  2G45 B;  4TQ1 A;  1OFF A;  1DOY A;  2MW5 A;  5LLI A;  2LGS A;  5DPR A;  1QOA A;  2KTR B;  4F1S A;  3H1U A;  1ZDX A;  3TCA A;  2MEK A;  2JRI B;  2DYB A;  3R2I A;  2WXK A;  1T3Q A;  2EMT A;  3L54 A;  2KKC A;  3ZJU A;  1Y56 A;  1VCB A;  2R61 A;  2RSU A;  2V1Y A;  1CK1 A;  2GRI A;  3RNF C;  1YX5 B;  3ZRF A;  4RF1 A;  1F2R C;  2FCN A;  3LDZ E;  1IBX A;  3JYU A;  1QIL A;  2WHI A;  4LNF A;  4P16 A;  1I4P A;  2G4S A;  2MJ3 A;  3HM6 X;  1D3Z A;  2L8J A;  1PGA A;  2LFI A;  2XN9 C;  4WQO B;  2D3B A;  1TKE A;  3PV1 A;  4TQ0 A;  4MDK E;  1ZXH A;  2J0M A;  3MHZ A;  1KF6 B;  3QA8 A;  2JT4 B;  3DVG X;  2K3U A;  2GLS A;  2KLG A;  4DHZ B;  1NI2 A;  1T0Q C;  4MGI E;  2ZCC A;  2DEN B;  2KDF B;  1ZDV A;  2RR9 A;  3VUX A;  1UF0 A;  2JZP A;  1OTR B;  1N5X A;  2DWQ A;  2DAJ A;  2NR2 A;  3BYT B;  4JLC A;  1QF6 A;  2GBN A;  2W54 A;  4G0N B;  2MRP A;  2WXG A;  1F2R I;  3GP7 A;  1YQB A;  4TV3 A;  2AL6 A;  2WXJ A;  1J0G A;  3I9V 1;  3BWU D;  3DBL I;  3M62 B;  4IW0 A;  3AE8 B;  3I63 C;  1FM0 D;  3MTN B;  2M0A A;  1C9F A;  4GB9 A;  3RD2 A;  4JL9 A;  4YSY B;  2FAZ A;  1R4N I;  1TS4 A;  1MI0 A;  3ZO5 B;  1N5W A;  2DYO A;  1OGW A;  4IOI E;  1OQQ A;  5JZE B;  2Z0E B;  3AU5 A;  1YN4 A;  3VTV A;  2LJI A;  4HKZ E;  3ZRC A;  3IAM 1;  2KVR A;  2L83 A;  4MSQ B;  2LRW A;  2G1E A;  4WH4 A;  2V0G A;  1K50 A;  3MP9 A;  3DVN V;  3ZQ4 A;  2K1F A;  2N9K A;  1D5Z C;  2BWE S;  3ZKJ C;  1BXT A;  3L16 A;  4GIV A;  4NY0 A;  2MBE A;  3SEB A;  4DK5 A;  3HVD A;  2KWU B;  1RAX A;  3ALB A;  2K25 A;  1SE3 A;  2D07 B;  1WFY A;  4C80 A;  1HZ5 A;  1G6J A;  4UDU C;  2AQ1 B;  4ZRQ A;  4GMV A;  2PW9 A;  3PZD A;  3J9C A;  3NHE B;  5T8I A;  2JPH A;  1I42 A;  3EC8 A;  2D5G A;  3AE1 B;  4ASW C;  4US8 A;  2PVG C;  2BB5 A;  3KH0 A;  2Q5W D;  3VR8 B;  3OJ3 A;  2E3T A;  3NZU A;  3APF A;  2J7Q B;  1BML C;  1N62 A;  2L3Z A;  2WXO A;  1Q10 A;  2O6V A;  4QAY A;  3NZS A;  5CHW A;  3AED B;  1IGC A;  1ZP0 B;  2GOW A;  2HDE A;  1V5O A;  3KVF B;  3BII D;  1X1M A;  3EUB 2;  1TS5 A;  3NRZ A;  3T9L A;  1L0Y B;  3NY5 A;  2MSE D;  3DVG Y;  2FE8 A;  2QDF A;  1J19 A;  2C7H A;  2WX0 A;  2K0P A;  2KDE B;  3KWL A;  3KUC B;  4L1B A;  4ARI A;  1WGY A;  4S0R A;  2BBC A;  5G2N A;  1NEN B;  4RNA A;  2MBO A;  3MHS D;  1KJT A;  1WF9 A;  1I4R A;  2OOB B;  1SSN A;  3VUY A;  4RF0 A;  1UWX A;  2VH2 A;  1L6U A;  1TTN A;  1DYQ A;  4FHK A;  3HK0 A;  1WM3 A;  3VH4 B;  2HJ8 A;  2CJN A;  4X57 B;  4PYZ A;  2JXT A;  3NUH B;  1RWS A;  4RM9 A;  3DBL B;  2PIA A;  4MSM B;  1I35 A;  1KLV A;  2LHE A;  5IOI A;  3TJP A;  5BMG A;  2ZCB A;  3VRA B;  3IBE A;  4FXC A;  4WWN A;  3W9C B;  2M1M A;  2ZPN A;  3W5U B;  2M4N A;  2JY6 A;  3FIL A;  4DDI D;  4J3O D;  4YTP B;  1EM7 A;  1IPG A;  1P7F A;  1B9R A;  1CMX B;  1XLQ A;  1XO3 A;  1KLU D;  2OHF A;  4BBN F;  5E6O A;  3WCQ A;  3ZW3 A;  4BKT A;  1ZUD 2;  1WYW B;  1JW9 D;  3DPD A;  1WH3 A;  3Q8B A;  4MJS A;  1ZOY B;  2ACZ B;  1J7A A;  4K7U A;  4KKI A;  4RGO S;  3P42 A;  1WGR A;  4K3C A;  1PUT A;  1EUV B;  3ZJV A;  3AM9 A;  3PZ7 A;  2JZZ A;  4MGZ E;  2AL3 A;  3UI3 A;  4HXD A;  4HJG E;  2N0S B;  3P63 A;  3HHM A;  3AXC A;  1YJ1 A;  1WGD A;  2K8H A;  3Q69 A;  3ZDT A;  4DHJ B;  3AU4 A;  4XWW A;  2AWT A;  2RD0 A;  4GSW A;  1WGK A;  3P2B A;  2GBK A;  4URK A;  1TY0 A;  1BUI C;  1MJD A;  3PRM B;  2SAK A;  5I4D A;  1C77 A;  4HCN B;  4IUM B;  2WNM A;  3N1Z C;  2ZZP B;  2AYO B;  2M19 A;  2O2V B;  4WWP A;  2JYE A;  1ESF A;  2OJW A;  1DGJ A;  3Q3J A;  4II3 B;  5AEK B;  1SF0 A;  3RN9 C;  3AH7 A;  4HPM B;  2GBM A;  1YJI A;  1WRI A;  4ZHP A;  4CHK A;  2QIL A;  1FNW A;  3N20 C;  4BKS D;  4FA6 A;  1AW7 A;  2PLP A;  4KDL B;  4MH8 A;  4C7Y A;  3BYY B;  2QHO A;  4FBJ B;  1HZ6 A;  1OQY A;  3M3J A;  3W1S A;  3Q8F A;  3ZVV A;  4WAF A;  3ZIM A;  2LGY A;  4KX6 B;  5FR6 A;  1YIW A;  3K9P B;  4C56 C;  1EU4 A;  2DX5 B;  4RCO A;  2X8X X;  4NAW A;  2NCN A;  2W3S A;  1E8Y A;  3NS8 A;  5GMV A;  2BYT A;  1GAQ B;  2KYW A;  3UIO B;  4KGT A;  2CHW A;  2LHD A;  1KRH A;  1MG4 A;  3PRZ A;  2WXF A;  3PHW B;  3Q14 C;  3Q3N C;  4OVU A;  2WLB A;  1WZ3 A;  1HTQ A;  4MEM A;  1XCQ L;  1JQ4 A;  4KZ0 A;  4PS3 A;  1WJ6 A;  4PK1 A;  1UEL A;  1K52 A;  2CKH B;  1V1P B;  2CHZ A;  2N7J A;  4MGK E;  2VZK B;  4RGM A;  5MPO A;  4NJC A;  5H92 C;  2HJ1 A;  2QCZ A;  4HDQ A;  2INN E;  2IO0 B;  4JQW C;  1AYF A;  1EF5 A;  2EMS A;  2K22 A;  2RPV A;  2V4L A;  3AMZ A;  1T5X D;  4GLS C;  2BYF A;  2KOX A;  2K5P A;  2KT7 A;  1RFA A;  2MP2 B;  3AEB B;  1V97 A;  3S2A A;  5IAA C;  2BPS A;  2KJ6 A;  3EA6 A;  4K1R B;  2B76 B;  4N59 A;  1C1Y B;  5D94 A;  1HA5 A;  2GB1 A;  2AQ3 B;  2KMC A;  2SEB D;  1MPE A;  4OVV A;  3WAM A;  4KSK C;  2I1K A;  4P6V F;  3WAP A;  4A55 A;  2LWP A;  2WXL A;  4S17 A;  4MGY E;  2MH7 A;  2L00 B;  4ZRI A;  3NVY A;  4M0W A;  2INP E;  4XX5 A;  4AJY B;  3L4P A;  3QWZ B;  3U7Z A;  3M63 B;  3VR9 B;  2IY0 B;  2KTR A;  4EFO A;  3P4R B;  1RFK A;  2K6Q A;  4NAM A;  1MFW A;  4HVB A;  2LGI A;  3MJW A;  1FIQ A;  4EUT A;  2IO1 B;  1EF1 A;  2KNB A;  4W9G A;  4F8C B;  1IGD A;  4OHJ A;  2BS3 B;  2N4F A;  3NOB A;  1E7P B;  1KTK A;  5CTR C;  4W9C A;  2JUO A;  3ZXV A;  4TUU A;  2AQ2 B;  1V1O A;  1NYQ A;  4LJO B;  2A5U A;  2XK5 B;  4GDL A;  5KHO A;  4AWJ A;  3N3K B;  3URY A;  1WGH A;  2YVC A;  1WJN A;  4JPS A;  3GE8 C;  3N32 A;  2QEJ C;  3MC9 A;  3LB8 C;  5IO9 A;  3U2S C;  2J52 A;  3SFD B;  4WWO A;  2BKR B;  2N9X A;  1SE9 A;  2JWU A;  1GUA B;  1HXY D;  4BVU C;  5FK9 C;  4IDI A;  3DHG C;  5BYR A;  5IP4 D;  2I1J A;  5BYS A;  2ASQ A;  3FKY A;  2JRH A;  1SXT A;  1V49 A;  1KM7 A;  2JX5 A;  2J42 A;  4WJN A;  2JWZ A;  2JF5 A;  3C19 A;  2NBV B;  4US9 A;  4OW0 A;  5CHV C;  4A20 A;  1XT9 B;  4P7I A;  1FEH A;  3TEX A;  2KLC A;  2CU3 A;  3ENE A;  2DNF A;  2KFK B;  1UUP A;  4RMA A;  2L76 A;  2MBH A;  3AE9 B;  2N9P C;  5AUI A;  1VRA B;  4AP4 C;  3L08 A;  4YXD B;  2J4X A;  1L0V B;  1FNV A;  1FFU A;  1LFD A;  1TZ1 A;  1DOX A;  2BYE A;  2EKI A;  1WYG A;  1C76 A;  5CHF A;  2IGH A;  2KTF A;  4HPL B;  1GG3 A;  3VDZ A;  1MHH E;  2KQ4 X;  2QJL A;  2L05 A;  2FIF A;  4M00 A;  2WDV B;  5EDS A;  1F9J A;  3E9S A;  2DYM A;  3OG5 A;  3ZYY X;  1MVK A;  2BQQ A;  1P1A A;  1GPX A;  1XLP A;  1NEK B;  1JCK B;  2N1V A;  3I57 A;  3RNG C;  2C7M B;  2IPK D;  1V8C A;  1E9M A;  3BK1 A;  1GB1 A;  3B1L X;  3DCG A;  1WIA A;  1YNT E;  1L4D B;  3DBR B;  3BVZ A;  3Q2A C;  1VZ7 A;  1KH0 A;  1ZW7 A;  2HTM E;  3A1Q B;  1JRP A;  5C1Z A;  1LXD A;  1PDX A;  1K51 A;  1K8R B;  1FO4 A;  2IO3 B;  3H6N A;  4J6I A;  3T8M A;  1EWC A;  4EOY A;  2XBB C;  4K7W A;  1L7Y A;  2C60 A;  3K9O B;  2BWF A;  4LJP B;  4A6Q A;  2N7E A;  3SHQ A;  1WXA A;  1QKZ A;  4D2K A;  2GI9 A;  1XXG A;  3PRP B;  3UQB A;  3LXF A;  1L0X B;  4XZ4 A;  2MJD A;  4KKJ A;  5HKH A;  2KQS A;  3ZNG C;  1JRO A;  4ARC A;  2IBI B;  1FRR A;  4WIP A;  3PTF C;  2R2Q A;  3QAQ A;  4KVG B;  1SIF A;  5L95 C;  1TKG A;  3Q8C A;  1UGM A;  3VH3 B;  1AWD A;  3GZN B;  3W1Y A;  3R3M A;  3W2D A;  4N6E B;  2PE6 B;  2OED A;  3PPA A;  5TSS A;  2LXC A;  3BIN A;  1ET9 A;  3KUD B;  1GC6 A;  1P98 A;  2JYT A;  1AAR A;  1N60 A;  2GBR A;  4PS7 A;  5G5G A;  4GU2 A;  2UYZ B;  3DBH B;  1MG8 A;  1PFD A;  1I4Q A;  3HUI A;  4ICV A;  2EKE C;  3KLS X;  4FUL A;  4MM3 A;  3DWM A;  2C5L C;  1V6E A;  1TT5 B;  1CQV A;  2KWV B;  3AE3 B;  5AZF A;  4ZYS A;  3V05 A;  1TKY A;  1R7S A;  4YTN B;  3Q3O C;  1UWM A;  3V62 A;  3PGE A;  3QAR A;  4NJ6 A;  3WAN A;  4WAA A;  3VFK A;  1ZKH A;  3L17 A;  1JAL A;  3ZNI D; 
#chains in the Genus database with same CATH homology
 1YJI A;  1RYJ A;  3PO0 A;  1WRI A;  4ZHP A;  2M56 B;  4YSZ B;  2QIL A;  4AS1 A;  1FNW A;  1WSP A;  4PT5 A;  4HEA 1;  1QOF A;  1PGX A;  5EE3 A;  1D4B A;  4YT0 B;  1AW7 A;  2PLP A;  1CZP A;  2WXR A;  1WWT A;  2J53 A;  4RH6 A;  1LO5 D;  2KAJ A;  4MH8 A;  4C7Z A;  3B9J A;  4C7Y A;  3BYY B;  2WDR B;  1F77 A;  1VLB A;  1HZ6 A;  3Q8E A;  1J7C A;  1FCC C;  3VQI A;  2EEL A;  3LYY A;  4RGN A;  1TY2 A;  3W1S A;  3AN1 A;  1FD6 A;  1PGB A;  3Q8F A;  1SB3 C;  2N9L A;  3EGR A;  2BB6 A;  3R2T A;  2ICI A;  1YN3 A;  4WWM A;  1ZPS A;  4WAF A;  4KX6 B;  2IGG A;  1A70 A;  4LLG M;  2WXH A;  2NTT A;  1EU4 A;  4B0E A;  4C56 C;  1SBB B;  3AE6 B;  1DOI A;  2WU5 B;  2Z8L A;  5H8Y E;  4RCO A;  2NMQ A;  2WS3 B;  3IT4 B;  1IBX B;  3ETR A;  2L52 A;  3BVM A;  2W3S A;  2KDM A;  1STE A;  3FC4 A;  2BYT A;  4MM3 B;  2FUG 1;  4ZRP A;  1GAQ B;  1NVI D;  3AE4 B;  3AE7 B;  2KAC A;  1I4H A;  4KGT A;  1JWA D;  1D5M C;  2YEP B;  1C79 A;  2WP9 B;  1EU3 A;  1I4X A;  2LHD A;  4YWG G;  1QLB B;  1KRH A;  2H88 B;  1TS3 A;  4ZOH C;  2KN4 A;  2WXF A;  2ON8 A;  3NVW A;  4JE3 B;  2WLB A;  1QOG A;  3HRD D;  3ABV B;  1XCQ L;  2AX5 A;  1JQ4 A;  2BTE A;  1FFV A;  2PTL A;  1K52 A;  3B2G A;  4XDC A;  4MT5 A;  1V1P B;  2ZW0 A;  2N7J A;  2W3R A;  3AV8 A;  1IUE A;  3AEG B;  4RGM A;  2VZK B;  5MPO A;  4TQ1 A;  1T6B X;  1OFF A;  5G5H A;  1DOY A;  3P4Q B;  4NJC A;  4XDD A;  5H92 C;  4DXG A;  3P4S B;  4WQM A;  1QOA A;  2INN E;  1ZDX A;  3KQ4 A;  4AQ7 A;  3T3N A;  4YSX B;  3ZGZ A;  1AYF A;  1SJH D;  2K22 A;  2MEK A;  1YQ3 B;  3R2I A;  3BK2 A;  2RPV A;  2WXP A;  2WXK A;  1T3Q A;  3AMZ A;  1E6E B;  1T5X D;  1XCT L;  1Y56 A;  2NTS A;  3ZJU A;  2R61 A;  1I7H A;  4GLS C;  3T3O A;  3NS1 A;  1CK1 A;  1UGJ A;  3AEC B;  2GRI A;  2K5P A;  4RF1 A;  1F2R C;  5BMH A;  2RDH A;  1IBX A;  3AEB B;  1UNS A;  1V97 A;  1EWY C;  1QIL A;  2WXI A;  3MC0 B;  4DQO C;  2IDY A;  1D5X C;  1JWB D;  4OZC A;  3R8B A;  3EA6 A;  4P16 A;  1I4P A;  2B76 B;  4ITK A;  4N59 A;  4O1N A;  1HA5 A;  2GB1 A;  2MJ3 A;  2AQ3 B;  2LFI A;  1PGA A;  2XN9 C;  1TKE A;  2SEB D;  4TQ0 A;  1MPE A;  1ZXH A;  4P6V F;  3MHZ A;  1KF6 B;  2PMV A;  3P1M A;  4A55 A;  2I2Y A;  2WXL A;  3Q8A A;  2MH7 A;  4HRS A;  4HKQ A;  2K3U A;  5EE0 A;  5D3I B;  3BZD B;  4JX1 C;  1FXA A;  3NVY A;  4M0W A;  2IJ0 A;  2FBW B;  1L4Z B;  1ZDV A;  1P7E A;  4GDK B;  1V1P A;  2INP E;  1ET6 A;  5GXG B;  1N63 A;  1I4G A;  1YMH E;  2JZP A;  3L4P A;  1N5X A;  2DWQ A;  3U7Z A;  3BYT B;  1NI3 A;  2LMC A;  3VR9 B;  1QF6 A;  1FMA D;  2KWD A;  3P4R B;  1PYW D;  2W54 A;  1RFK A;  2ZW1 A;  2WXG A;  1F2R I;  3GP7 A;  1JWS D;  1FCL A;  5BYQ A;  1SJE D;  4KGR A;  4NAM A;  3TSS A;  2RDG A;  2LGI A;  2WXJ A;  3I9V 1;  1FIQ A;  2JQR B;  3BWU D;  4L2Y A;  2PKO A;  3AE8 B;  4KGS A;  5C2T B;  1FM0 D;  1C4A A;  2M0A A;  1IGD A;  2WDQ B;  4OHJ A;  1C9F A;  3OWE B;  2BT6 A;  1E0Z A;  2BS3 B;  3O13 A;  1TJE A;  4XWT A;  4YSY B;  1E7P B;  1KTK A;  1TS4 A;  3TEY A;  2BS2 B;  1MI0 A;  1N5W A;  2YEP F;  2DYO A;  4IOI E;  2IGD A;  4ZHO A;  1OQQ A;  1C78 A;  1YN4 A;  1V1O A;  2AQ2 B;  3C8Y A;  2LJI A;  3AE5 B;  4HKZ E;  3IAM 1;  2PVO D;  1NYQ A;  3V3X A;  1TYG B;  1VJK A;  2L83 A;  3AEF B;  3URY A;  1JWU D;  2G1E A;  1FXI A;  2LUM A;  4B0M A;  5AUK A;  4JPS A;  1QT9 A;  1JWM D;  1N61 A;  2QEJ C;  4WH4 A;  5C3J B;  2V0G A;  3LB8 C;  5LNK 1;  1K50 A;  3U2S C;  3MP9 A;  1C4C A;  2J52 A;  5HI1 A;  3SFD B;  2DLB A;  3ZQ4 A;  1MHX A;  3AEA B;  2N9K A;  1D5Z C;  2JWU A;  1XEE A;  5D7G A;  1FNU A;  2G9H D;  1HXY D;  2BW2 A;  1BXT A;  1SIJ A;  2VZK D;  4TSS A;  5FK9 C;  4IDI A;  5BYR A;  3SEB A;  3HVD A;  2Y3A A;  5BYS A;  1SE3 A;  3ZJT A;  2V4I B;  1SXT A;  4LK0 M;  1ZE3 D;  4C80 A;  1HZ5 A;  3E56 A;  2JX5 A;  4UDU C;  2J42 A;  1QQR A;  2AQ1 B;  1KFY B;  4ZRQ A;  2PW9 A;  3J9C A;  3P4P B;  4US9 A;  4OW0 A;  1HEZ E;  5T8I A;  1SE4 A;  2H89 B;  2TSS A;  1FEH A;  3TEX A;  2D5G A;  2RMM A;  2CU3 A;  3AE1 B;  4US8 A;  3BVG A;  2PVG C;  1UUP A;  1YJJ A;  3HVZ A;  3N9Y C;  3AE9 B;  2BB5 A;  5AUI A;  2Q5W D;  3VR8 B;  1VRA B;  4GDL B;  2WXN A;  2E3T A;  4YXD B;  3RFZ B;  2J4X A;  2L1A A;  4OVZ A;  1L0V B;  1FNV A;  1L6V A;  2V3N A;  1BML C;  4JWU C;  4OZA A;  2Y5P A;  1N62 A;  1ENF A;  2BS4 B;  1Q10 A;  2WXO A;  1FFU A;  4RFB A;  2WQY B;  2CJO A;  1VDV A;  3SR6 A;  1DOX A;  2W55 A;  2EKI A;  1IGC A;  1ZP0 B;  1WYG A;  3AED B;  4RGT A;  2HDE A;  1C76 A;  1SEB D;  2IGH A;  3U52 E;  3BII D;  4XE0 A;  1MHH E;  1C4P A;  3EUB 2;  1TS5 A;  2KQ4 X;  4H2A A;  3SFE B;  3TEW A;  2QJL A;  3AEE B;  3NRZ A;  3NVZ A;  1TZO A;  3KWV A;  3FIL B;  1L0Y B;  2WDV B;  1JML A;  1XF5 L;  3E9S A;  2QIE B;  4A8X C;  2DYM A;  2FE8 A;  3ZYY X;  1MVK A;  1VR9 A;  4YTM B;  2ONQ A;  4IKG A;  2K0P A;  3KWL A;  1XLP A;  1GPX A;  4L1B A;  4ARI A;  4DXF A;  1NEK B;  2BBC A;  1JCK B;  3CWI A;  3I57 A;  2Y5C A;  2IPK D;  2QSD A;  1NEN B;  1E9M A;  1V8C A;  1XLN A;  3BK1 A;  4RNA A;  3GS2 A;  1GB1 A;  1B1Z A;  2JSV X;  1I4R A;  4HRO A;  1SSN A;  1YNT E;  1FRD A;  1CJE A;  1L4D B;  3BVZ A;  4RF0 A;  5FR3 A;  4MAC A;  1UWX A;  4R3D A;  1VZ7 A;  1KH0 A;  1L6U A;  2HTM E;  1DYQ A;  2MJE A;  1JRP A;  4A9A A;  2L32 A;  1NYR A;  1GB4 A;  4N58 A;  1E10 A;  1PDX A;  1YQ4 B;  1K51 A;  1FO4 A;  4NZL B;  3U4E G;  5E6J A;  1VZ6 A;  2CJN A;  4WUR A;  2V3P A;  4USA A;  2JXT A;  1AN8 A;  3NUH B;  1K53 A;  1RWS A;  1F0Z A;  1SE2 A;  1EWC A;  5D3D A;  2PIA A;  5BMI A;  1ACC A;  1XLO A;  4A90 A;  1VZ8 A;  4REZ A;  5HHD G;  2LHE A;  4A6Q A;  4JWS C;  1QKZ A;  5BMG A;  2DBY A;  3VRA B;  4D2K A;  2GI9 A;  2KMM A;  4FXC A;  1XXG A;  3LXF A;  1L0X B;  3AE2 B;  3NVV A;  3W9C B;  5JXV A;  3W5U B;  4EE2 A;  2MJD A;  1J7B A;  3FIL A;  4KKJ A;  4J3O D;  4OZB A;  4YTP B;  3NZ3 A;  1EM7 A;  4TMA B;  1JRO A;  2E6X A;  1P7F A;  4ARC A;  1HQR D;  1B9R A;  1QOB A;  1XLQ A;  1FRR A;  1XO3 A;  4WIP A;  1KLU D;  5HFY A;  2OHF A;  3WCQ A;  1ZUD 2;  1JW9 D;  1ROE A;  3Q8B A;  1KLG D;  1TKG A;  2QMT A;  1ZOY B;  2ACZ B;  1J7A A;  2WXQ A;  3Q8C A;  3TUO A;  5HG2 A;  4KKI A;  1AWD A;  4RGO S;  3P42 A;  1D6E C;  5EE1 A;  3MFG A;  3W2D A;  4N6E B;  2OED A;  1PUT A;  3PZ8 A;  2LEK A;  1OQR A;  3ZJV A;  3AM9 A;  3GB1 A;  1ZXI A;  3PZ7 A;  5TSS A;  1L5P A;  5FKA C;  3UI3 A;  3RPF C;  3MJ5 A;  4HJG E;  3FAH A;  2N0S B;  1ET9 A;  2XNA C;  2JYT A;  3P63 A;  1N60 A;  3TEZ A;  3CIR B;  5G5G A;  3IT6 B;  1M4V A;  4L23 A;  3Q69 A;  1RM6 C;  3AB5 A;  3IAS 1;  1PFD A;  3W5V B;  4LTU A;  4XWW A;  1I4Q A;  4NAW B;  3HUI A;  1WGK A;  3KLS X;  4Q2J A;  4CQN A;  1TY0 A;  1BUI C;  2WXM A;  3B2F A;  3DWM A;  2SAK A;  5I4D A;  1C77 A;  1TS2 A;  1CQV A;  2JU6 X;  2WNM A;  2I38 A;  3AE3 B;  2M19 A;  2W82 A;  4ZYS A;  3V05 A;  2X38 A;  1TKY A;  1WXQ A;  1R7S A;  4YTN B;  3H8H A;  1UWM A;  2JYE A;  3DWG C;  3IXS A;  2K9X A;  1ESF A;  1DGJ A;  2WU2 B;  1YN5 A;  3VRB B;  1SF0 A;  1GOZ A;  3AH7 A;  5EE9 A;  1JAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...