4N6EB

Crystal structure of amycolatopsis orientalis bexx/cyso complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
89
structure length
89
Chain Sequence
AVTVSIPTILRTHTGGEKSVEAKGATVLEIIDDVESRHAGIKARLVKEEKLHRFINVYVNDEDVRFSGGLEAEVKDGDTLTILPAVAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/biosynthetic protein
molecule keywords Putative thiosugar synthase
publication title Co-opting sulphur-carrier proteins from primary metabolic pathways for 2-thiosugar biosynthesis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
total genus 22
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2013-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4n6eB00
3AMZA 2WU2B 1R7SA 4N6EB 3W5VB 1KFYB 1NENB 1N60A 3AB5A 1B9RA 3AEAB 1L0VB 1XLOA 2HTME 1OFFA 1PUTA 2N0SB 5AUKA 1J7AA 2W55A 3AE2B 3VR8B 4YSYB 4US9A 1E6EB 1YJIA 1N5WA 3SFDB 4YSZB 2Y5CA 1RWSA 1FM0D 1GAQB 1L6UA 1ZP0B 4JWSC 1XLPA 1TKGA 1QOGA 1V97A 1TKYA 3P4QB 1QT9A 1F0ZA 2H88B 1NEKB 1WXQA 3B2FA 2MH7A 3HRDD 1WWTA 2WLBA 2MJEA 2H89B 3P4RB 1E10A 5EE1A 2K5PA 1DOYA 1FXAA 1YJJA 2AX5A 3KWLA 3AN1A 1EWYC 3LB8C 3CIRB 1JALA 3NVWA 3VRAB 2K9XA 1FMAD 1QOBA 1KF6B 2BS3B 1WYGA 2LEKA 1QLBB 1XO3A 5EE0A 2QIEB 1DOIA 1N63A 2CJNA 3AM9A 3AE6B 3NVVA 5H92C 4WQMA 1OQRA 2EKIA 1WGKA 3FAHA 3P4SB 2BS4B 4JX1C 4WWMA 1OQQA 1ROEA 1IUEA 3AEFB 3AECB 1DGJA 5GXGB 1I7HA 1YQ3B 1WRIA 1AYFA 3AE1B 1N62A 3SR6A 3AE5B 2DWQA 2WU5B 3P63A 1YQ4B 1CZPA 4USAA 3SFEB 3AEEB 1QOAA 1SIJA 1ZOYB 2BT6A 4YTNB 1E7PB 1XLQA 1FFVA 2CU3A 3B9JA 3NS1A 2PIAA 4YTMB 2E3TA 1FRRA 3P1MA 3AEGB 2K22A 2WS3B 2M19A 3WCQA 2CJOA 4P6VF 1NYRA 3ABVB 3AE4B 3AE7B 3LXFA 3PO0A 1J7BA 3AE3B 2PVOD 2W3RA 3P4PB 1JWBD 2JQRB 2WQYB 1VLBA 5C2TB 4C80A 1FRDA 1JW9D 1QF6A 4IDIA 1PDXA 1SF0A 4A9AA 1XLNA 4JWUC 1RM6C 1FFUA 3AEDB 1RYJA 3ZYYX 3FC4A 1RFKA 2PKOA 4HROA 5MPOA 1GPXA 1A70A 1FXIA 3EUB2 3W9CB 1ZUD2 3CWIA 4US8A 5C3JB 2G1EA 2L83A 2OHFA 2WDVB 1NYQA 3ETRA 4N58A 2FBWB 1QOFA 2WDRB 4C7YA 4YSXB 1FO4A 1NI3A 2W3SA 5H8YE 3RPFC 4YT0B 1L6VA 4HRSA 2MJ3A 2Q5WD 2BS2B 1TKEA 3HVZA 3W5UB 1E9MA 1ZXIA 5G5HA 1L5PA 2KMMA 3AH7A 3VR9B 4YXDB 1DOXA 2B76B 1KRHA 1UWMA 3AE8B 4N59A 4LTUA 2PVGC 2DBYA 5G5GA 2WDQB 4C7ZA 2ACZB 3L4PA 5AUIA 5EE9A 1VJKA 4ZHPA 1TYGB 4ZOHC 1AWDA 1CJEA 2WP9B 1JQ4A 1VDVA 1FIQA 2MJDA 4ZHOA 1NVID 3AEBB 1TJEA 1V8CA 1E0ZA 2QJLA 1J7CA 3DWGC 1JROA 1JWAD 3NRZA 4ITKA 4KX6B 1JRPA 2L52A 1SB3C 1N61A 2M56B 1N5XA 3HUIA 5EE3A 1T3QA 3AE9B 3AV8A 3DWMA 3NVYA 3NVZA 3B2GA 2W54A 4FXCA 2JX5A 4YTPB 3BIID 1PFDA 2KAJA 3VRBB
chains in the Genus database with same CATH superfamily
3AMZA 5L83A 4NAWB 1NENB 1FCLA 2MW5A 4BFRA 1J7AA 3U52E 4XWWA 3QA8A 3M3JA 2NCNA 3URYA 3P4QB 4DHZB 3Q2AC 2H88B 4GGQA 1IBXB 1F77A 1V5OA 1C1YB 4BKSA 2WXPA 3ML8A 2MBOA 5EE1A 1EM7A 3DCGA 4W9EA 3ZJUA 1T6BX 4GXBA 2C7NB 4W9JA 2KXJA 2LWPA 2BWES 3NZ3A 4IW0A 3SR6A 4WIPA 1SE3A 2NMQA 4KV2A 3KH0A 2EKEC 4RH6A 3ZJVA 4YWGG 4F1SA 3BVGA 2M0XA 3T8MA 2KWUB 2GBKA 1IBXA 2FUG1 2KN5A 3EUB2 2RDGA 5C3JB 3N1ZC 3NZUA 2G1EA 4OVZA 2M1MA 4M00A 4GN1A 3IG3A 2K6QA 3PSEB 1VZ6A 4RF0A 3W5UB 3VR9B 1ZE3D 4KZCA 4YXDB 3PS6A 1UF0A 2PE6B 4J3OD 5AUIA 1HTQA 3AULA 3ENEA 2JUOA 3OAWA 3AXCA 2MEKA 2N7DA 2IDYA 2K0PA 2JWUA 4FJVB 1CQVA 2K8CA 2W3RA 3AB5A 2DENB 1PUTA 4GDKB 1T0SC 2PJHA 2G3QB 3PV1A 4LNNA 4A90A 1D3ZA 4CO7A 4WJPA 1WXQA 4RGTA 1TS3A 4DXAB 2VH2A 1ACCA 4HWIB 3TCAA 1WYGA 3QK0A 2KOXA 2QIEB 2CJNA 1HXYD 3QIJA 2BS4B 2O6VB 1DGJA 1WJUA 2ZZPB 2N7JA 2KNBA 4S17A 2JWZA 5BYRA 2C60A 5AZFA 2AL6A 2M19A 1HEZE 3SHQA 4P6VF 3AE4B 3AE3B 1ZDXA 4IKGA 3TEYA 3V6EB 1L4DB 4JWUC 3Q14C 4RCOA 2GRIA 1V1OA 1LXDA 4FLHA 1WY8A 2G9HD 1PYWD 1Z5SB 3N1XC 1FNUA 1WRDB 3NG0A 3GZNB 2DYOA 1V1PB 2ZNVB 3ZTDA 2JU6X 2WX1A 2NPTB 1HA5A 2NBUA 3R3MA 2O6VA 2BYVE 4B0MA 1I4PA 5J17A 2DNFA 1UWMA 3VHTC 5G5GA 3VXWA 3QAQA 1JQ4A 5AZGA 5DCNA 1L0YB 1TJEA 2QJLA 4WAAA 1JROA 1MVKA 1JRPA 2JXTA 3ZKJC 2QDFA 2J52A 2KQSA 3VRBB 1K52A 2HD5B 3A9JA 3W5VB 1N60A 1L7YA 2MCNB 2C7MB 3P2BA 2JF5A 3AE2B 2W55A 4OVUA 4FULA 3SFDB 1ZP0B 1SXTA 2GBJA 3EFUA 4DHZE 4ARCA 1L2NA 2NPTA 1KLGD 2IY0B 2EELA 1ZDVA 1E10A 3VH4B 5BYSA 3U2SC 1FMAD 3PLVA 1WJ4A 4HKQA 3PRZA 1XXGA 2ZEQA 3DBSA 4XDCA 3IT6B 5GXGB 2IPKD 2WU5B 3HM6X 4WWPA 1SIJA 1J0GA 3RD2A 4HCPB 1WE7A 1TT5B 2LJ5A 1OEYA 3U8ZA 2ZW1A 3PRPB 1EU4A 1VLBA 4LK0M 4RM9A 3MTNB 2M8SA 4HROA 4HDOA 4BOZB 5L95C 3BK2A 4GU2A 2WDRB 5BMGA 2LMCA 4YSXB 2RPVA 3Q3JA 4S0RA 4RGNA 3VQIA 2DZIA 2BS2B 2A4ZA 2XNAC 1TGZB 2AEHA 1KLUD 2WDQB 2AYOB 4PYUA 1TS5A 4ANVA 2DAJA 3HIZA 2MHJA 4NJ7A 4HVBA 2EMSA 4K3BA 3Q3MC 2PTLA 3B2GA 1VD2A 3IT4B 3R8BA 3RI7C 4K3CA 4BBNC 3WALA 2DYMA 3SD5A 2G4DB 4EE2A 1VRAB 3AEAB 4LJPB 1L0VB 2HTME 2IGHA 2PMVA 4LNKA 4JL9A 4ZRJA 1N5WA 2IJ0A 2L05A 3BK1A 1B1ZA 1LFDA 3DBRB 2CS4A 1V86A 4XWTA 2KQ4X 1FXAA 2Y5PA 3NVWA 3HVDA 1QOBA 4OW0A 5EE0A 1R4NB 5H92C 2L0FA 2KDMA 2WXRA 2EKIA 4YL8A 3EGRA 3PZ8A 3DBRI 3ZQ4A 1HZ6A 4HJKA 1I7HA 2LGDA 4OHJA 1WRIA 2KDBA 2NBWB 1QOAA 4KIKB 5IP4D 1MI0A 2PIAA 3NS8A 1R4NI 2J4XA 2LVOA 4P16A 2L1AA 4DDGD 2BKFA 4FA6A 2KK8A 3N3KB 3P4PB 4IOIE 1JWBD 2JQRB 2HJ8A 2OJWA 3X23A 1QF6A 1PDXA 4HJGE 2GBMA 3RNGC 2QEJC 5MPOA 1FXIA 4RGOS 1NYQA 2KHWB 1QOFA 3MHZA 3W1SA 1T0RC 1F52A 3OWEB 4HDQA 4LNIA 3V3XA 1ZXHA 4G11A 4DXGA 3APCA 3LYYA 2NTSA 4TKNA 4ZHPA 1FD6A 1WH3A 3ZRCA 4AJYB 2KTRB 4M01A 2RMMA 4ICUA 2MJDA 1K51A 2Z59B 2J0MA 3NJTA 2KX0A 2J0KA 4EUTA 1SB3C 4HCNB 3NVYA 3QCAA 1GC7A 4WJNA 2PW9A 1H8CA 1ZW7A 4MDKE 1OTRB 4MEMA 1FPYA 1XD3B 4RFBA 3GS2A 1XLOA 4ASWC 2A5UA 4GOCA 4ZRPA 3VR8B 3LJ3A 4P1BC 2KDEB 1JWUD 2D10A 1MG8A 2N9PC 3MJWA 3ZDTA 5DPWA 3ZXRA 3NVVA 3SEBA 1E90A 1D6EC 2AQ2B 2KTRA 5HFYA 3AECB 2WXHA 4II2B 5AEKB 2JY6A 3QARA 2GMIC 4XDDA 1P7EA 4MJSB 3P1MA 4ICVA 4WJQA 2KJRA 1J7BA 2KDIA 2BW2A 3A4RA 1TBEA 2LHEA 1RRBA 3MHSD 2QCZA 2VZKD 3RNBC 2PKOA 2K1FA 1ENFA 4US8A 1WGHA 5DPRA 4WWOA 2JYEA 4LDTD 3L17A 1J8CA 3P42A 3PPAA 1L6VA 4FN2A 4TMAB 2ZPYA 2QSDA 5D7GA 3APFA 4FADA 2MA9B 2CU1A 4F7ZA 5TSSA 1VJKA 2DAFA 2KTFA 1V81A 1L4ZB 1RAXA 4MJSA 2ZJDA 2MBQA 4DQOC 1V5TA 2I38A 4OVVA 3GB1A 5TR5A 1K50A 1N61A 1WE6A 3Q8AA 1YN3A 3A1QB 4YTPB 4EZKA 4KKIA 3V61A 4DXFA 2BWFA 2N0SB 4IWPA 3AI5A 4BKSD 4HLEA 3UI3A 3RYTA 4YSYB 3ZO5B 1YJIA 1GAQB 4IM0A 1TKYA 1VCBA 4BAXA 5CHFA 3UIOB 2VH1A 1K8RB 5D6JB 1N63A 1OEYJ 3P4SB 4WWMA 2FCQA 2G4SA 3RZFA 2GBNA 1P7FA 3AE1B 1FNVA 2DWQA 3Q3NC 5IO9A 4BOSC 2CU3A 2INNE 2NTTA 2NBVB 3TBLD 3T3OA 5C2TB 3RT3B 4A9AA 1XLNA 3RNEC 2R61A 2V3SA 2REXA 4AWJA 4CHKA 5KHQA 1EU3A 2BKRB 3RZWC 2AQ1B 4AQ7A 3A33B 4AS1A 4B6WA 4DHJD 4W9HA 4A6QA 4M0WB 3QC8B 1NBFC 2RSUA 3RPFC 2MP2B 2MJ3A 2BPSA 4NAWA 3BVZA 1TKEA 4ZDVA 4IWQA 1WXMA 2GI9A 3Q6BA 1L5PA 4GDLB 4OZBA 5G5HA 1KRHA 2GBRA 3ZVVA 2CHWA 2ON8A 5FR6A 1E8YA 3C19A 3KW5B 4ZOHC 2D5GA 3IXSA 3PZ7A 4K7UA 1UH6A 3CSTA 4K7SA 3ZNZB 2WDTB 3NUHB 1WGDA 2WHIA 2WX0A 4NY0A 3HHMA 1I4GA 4JQWC 2JX5A 4W9KA 1WR6E 3IHPC 1SE4A 3EHVA 1TIFA 1GUAB 3H7SA 4MSMB 1IGDA 1D5XC 2LXAA 2O2VB 2LD9A 1EF1A 4DWFA 2MP2A 1YIWA 1SBBB 5JZEB 4KVGB 4C4VB 1GJZA 1GG3A 4L1BA 1MJDA 2V3PA 1L0XB 3FKYA 3RN9C 5JHBA 2WXQA 1WXAA 1XO3A 3NY5A 1DOIA 4P1CC 3N9YC 2AL3A 1WGKA 2IGGA 4JX1C 2V1YA 4IM3A 3KWVA 2KDFB 3AE5B 1VZ8A 3UINB 3NS1A 2WXJA 2ZVNA 1R4MB 3AEGB 3ZIMA 2ONQA 3H7PB 2NS5A 1WJ6A 1QKZA 1JW9D 4IDIA 5IA7A 1SF0A 1R4MI 4DK5A 4GSWA 1RYJA 1U4AA 4A8XC 3DVNU 4TSSA 1PGAA 4YT0B 3KYCD 4HPPA 4TUUA 3DBLB 3HVZA 1V2YA 2C5LC 2L0TA 1DOXA 2KANA 4GDKA 5LXIB 2CKHB 4C7ZA 4OZAA 5HHDG 1DYQA 2BVCA 3DBLI 1Y56A 4X57B 4XGAB 2IGDA 2MBBB 2J0JA 1WR1A 4Q2JA 3H7PA 4G50A 4RNAA 4M02A 2WWZA 2KACA 2JRHA 3QQ8B 3ZNHB 1E8XA 2KQ7A 2L7RA 4TQ1A 4NZLB 1OQYA 1YMHE 5D2MB 3GZNI 2RGFA 4JWSC 3IBEA 3PTFC 3Q69A 3VH3B 3WA0A 2YVCA 2K39A 2FCMA 3VUWA 3JSVB 2B3AA 2MJEA 1SE2A 4C56C 3CIRB 3N30A 5D3IB 3AM9A 1EF5A 1WZ3A 1ESFA 1WI0A 3PHXB 3A4SC 1EWCA 2LUEA 1MG4A 3V6CB 3MC8A 2NVUI 2BYEA 1V1PA 3I3TB 3H9DA 1I4RA 4P7IA 1VR9A 2Y3AA 3AE7B 3TEWA 1UUPA 3K9PB 2KMCA 1YN5A 3L10B 1P3QU 1UWXA 1RM6C 2LFIA 3B08A 4LCDE 4ARIA 2JZPA 4MACA 2IO1B 1E8ZA 5LNK1 2X8XX 3VAWA 2WXGA 4C7YA 4JPSA 1T0YA 3U4EG 5AZHA 3R2IA 2V9HA 3DOWA 4HRSA 1I4QA 1QZEA 1E7VA 4EOYA 1Z2MA 2IY1B 2TSSA 4AUQC 2I1KA 3Q8CA 3PT2B 2ACZB 3L4PA 3QX1A 3K9OB 5EE9A 2RDBC 2WP9B 1NDDA 2JPHA 3L54A 4G3XB 2DX5B 3B0AA 3VUYA 2PE9A 3BYTB 1PQSA 2GLSA 2KX3A 4MGZE 2BTEA 3Q3OC 1FCCC 2W9NA 2ZNVC 1XQQA 1F2RI 2D3GA 1V6EA 2AWTA 3E9SA 5KHOA 2CR5A 4WJOA 3S2AA 3UQAA 2HDEA 2KWDA 2K3UA 3D32A 4UDUC 4EEWA 2N1WA 2QMTA 3TJPA 2KFJA 2K5PA 2BS3B 1P98A 2OEDA 2YEPB 4NQKE 3PREA 1OQQA 3KQ4A 4EZJA 3W2DA 1AYFA 2ASQA 1CZPA 1D5MC 5CTRC 4E71A 2PPHA 5E6OA 2D3AA 1UELA 3PO0A 2KLGA 2PVOD 3GOEA 4GLSC 1LGRA 2I2YA 1FRDA 4KDIC 4OZCA 3MC9A 4WAFA 3MC0B 3CSFA 1FFUA 1M94A 2FUHB 2OHFA 2D3CA 2WXOA 1YJ1A 1XT9B 2IYDB 3BZDB 4PS8A 3QJZA 2INCC 5IN7A 1V9JA 1ISNA 1ZXIA 3EFCA 1SE9A 4MGYE 3I9V1 5HKHA 1TYGB 4RMAA 3ZLZA 1VDVA 4E74A 2V0GA 3QHTA 4ZHOA 4F8CB 1V8CA 2JSVX 2FAZA 3NRZA 3PLUA 1MFWA 2X38A 1H4RA 3E56A 3JVZX 4MSQB 3U7DA 3EECA 1B9RA 3OJ4B 4W9CA 5D3DA 1IYFA 2CHXA 2HE7A 1BUIC 1WXSA 1RWSA 4KIKA 2MBEA 2MSED 1M4VA 2QC8A 2MWSB 2V4LA 4KGRA 3P4RB 2XK5B 2KT7A 3KWLA 2MX2A 3VRAB 3T9LA 2KN4A 1QLBB 3ZDMC 5D94A 1SJHD 1ET9A 3Q3FA 3WIMA 4WQMA 2K25A 4NJCA 1JRUA 2QILA 4IG7B 2M4NA 1N62A 4USAA 2L3ZA 4MGKE 2Z8LA 4YTNB 1ZGUB 4HKZE 2V4IB 2UU7A 3DDCB 3UGBB 3DVGY 2DZKA 2GB1A 3U30A 3U7ZA 1J19A 2WQYB 4IC7B 2D2QA 4TV3A 1JWSD 2L00B 1YX6B 3W1SC 2LRUA 1SSNA 2EMTA 1SGHA 1S1QB 2INDC 2L83A 4CYEA 2K8HA 2XK5A 4LNFA 3ZTCA 4AJWA 3VUXA 3JW0X 2N4FA 1WZ0A 2UYZB 1SIFA 2WXFA 3DBHB 4ANWA 3TSSA 2R2QA 1AN8A 4LJOB 1AWDA 2KYWA 2N9XA 2FIFA 3SDLC 1NVID 4A3PA 3AEBB 4JLCA 1J7CA 2MQJA 1HZ5A 2M56B 1SEBD 2LRWA 3DBHI 1T3QA 4L23A 2VZKB 3ZNGC 1WJNA 2BYTA 1LO5D 3H6NA 2RPQA 1OFFA 4LDTB 3UIPB 1JWMD 5BMIA 3TIXA 3IAS1 3RULA 3R7RA 1E6EB 2XBBC 1FM0D 3IFWB 3KVFB 3HM3A 1NI2A 1TKGA 4HK2A 4WWNA 4AP4C 4KKJA 2H89B 2OJRA 3AN1A 2K9XA 1F9JA 1HE8A 3OG5A 4GB9A 2ZCCA 3DHHC 1PGBA 1IUEA 4II3B 2ZPNA 3EA6A 1STEA 4KSKC 4JIOU 3X0WA 1CK1A 1E7PB 1FFVA 1UGMA 5CHVC 3WCQA 2CJOA 4FBJB 3WANA 1WGYA 3KUZA 4G0NB 3NHEB 2LVQA 3OLMD 1WMHB 4PS7A 4WURA 5EDSA 3AEDB 1I4HA 4NPNA 3UF8A 1GPXA 4AOFA 4N58A 3PZDA 1F1HA 4K7WA 2KC2A 2PEAA 2RR9A 4KDLB 1KTKA 5H8YE 3A1QA 3Q8FA 4B0EA 1RLFA 4ZRKA 1C77A 1TY0A 2KLCA 1Q10A 1P1AA 3AH7A 1WYWB 4O1NA 2B76B 2N9LA 3TEZA 4A3OA 3GE3C 5T8IA 2LJIA 5LLIA 3KLSX 5C23A 1T0QC 3ZNID 4PYZA 3RUIB 4BBNF 2L52A 3TUOA 3FILB 3L0WB 3WAMA 3N20C 1WMHA 4A20A 3I63C 4MGIE 2JZ3B 4DHJB 5AUKA 3JYUA 1C79A 1TZOA 1C78A 1F0ZA 1QT9A 2KD0A 2ZW0A 3N1YC 4EZLA 3M62B 4M8MA 2UWQA 1JALA 2QHOA 3ONSA 4I6PA 4DDID 3C0RB 2K6DB 4HPLB 2JRIB 2IZVB 2V3NA 4M0WA 2BT6A 3FILA 5J18A 2JT4B 3PGEA 5CX3A 2BYFA 4RGMA 1UNSA 1KH0A 1K53A 1I4XA 2YLMA 2KWCA 4GDLA 3R2TA 4EFOA 4ZYSA 4W9FA 4A55A 2BBCA 4LLGM 3O65B 1WFYA 1WGRA 1LQBA 2N7EA 1BMLC 5FK9C 3OJ3A 3SU8X 3VTVA 1XCQL 4W9GA 1FXTB 1UBQA 1FO4A 2RD0A 1AARA 2J7QB 3TMPB 2ZVOA 2Q5WD 3H1UA 2W82A 1C3TA 3R7QA 1OGWA 4N59A 2O2VA 4K81A 3I5JC 2YEPF 2C9WB 1GC6A 1FEHA 1CJEA 2IO3B 3GP7A 5BMHA 3MJ5A 2WGSA 4J6IA 4C4VA 1Y8RC 1AW7A 4ITKA 3L08A 3H8HA 2O6VD 2KFKB 3R66C 2R2OA 5G2NA 1IP9A 4L2YA 5E6JA 4MH0E 4FJZA 1JCKB 1WIAA 2L32A 3PHWB 4US9A 4MELA 1L6UA 4PT5A 2BB6A 1V97A 2MH7A 3PVLA 4XYCA 2MRPA 2BGFA 1C4CA 1KM7A 3KUCB 3MP9A 3TL5A 2CHZA 1QQRA 2LEKA 3EC8A 1GNUA 4BKTA 1BT0A 4XX5A 3RMKC 3WAOA 3A9JB 4KGTA 3AEFB 2SEBD 1I35A 1YN4A 2KWVB 3SFEB 2KFKA 3ALBA 2FE8A 1XLQA 3B9JA 4IUMB 3W1YA 3L16A 4ANXA 3BINA 4I6LB 4XC2A 3ABVB 4K1RB 3LXFA 2WYQA 4XZ4A 2LGXA 5IOIA 2WXMA 2LXCA 3ECIA 2N9KA 3DPDA 1G6JA 2HTHA 1ZUD2 1UBIA 3I57A 3ETRA 2FBWB 3KUDB 1A5RA 2DLBA 4NJ6A 2DYBA 2Z0DB 1UGJA 4HEA1 4W9LA 2BF8B 2ICIA 3M63B 1TY2A 2KMMA 3APDA 3Q8BA 1C4PA 1UZXB 2PVGC 2DBYA 2Y5BB 5G55A 1JMLA 2E6XA 3IAM1 1TTNA 1KJTA 3JSVA 4LNOA 4FJYA 3RCZA 1N5XA 3HUIA 5EE3A 3W9CB 3AV8A 4NNJB 2JXXA 2SAKA 4R3DA 4N6EB 1KFYB 4D2KA 1YQBA 1Q0WB 4KSLC 5CHWA 4WQOB 2LGIA 2LVPA 2L76A 1Q5WB 4YSZB 1RFAA 2MBHA 1XLPA 2N9EB 2FCNA 3ML9A 1I42A 1NEKB 2WXIA 4RF1A 2G45B 4TQ0A 4QAYA 1WM2A 4C00A 2D11A 1P0RA 1KF6B 1XCTL 1EO6A 1C4AA 1V49A 1WM3A 3DVGX 4W9DA 4XE0A 4NAMA 2LGSA 2JZZA 1YQ3B 2AQ3B 2WXLA 5JHAA 3P63A 3LDZE 1S3SG 1VZ7A 4FHJA 2C7HA 1D5ZC 1WX7A 2LZ6A 3O13A 2DZMA 5I4DA 3PRMB 1GOZA 1WSPA 3C8YA 4BVUC 1WGGA 1YNTE 3FC4A 3BY4B 3CF6E 1TS2A 2KMAA 3CWIA 2WDVB 3ZJTA 2FCSA 5E6NA 1WX8A 1YOVB 2KC1A 1X1MA 4I6NB 4IWOA 2KKCA 1YX5B 2IO0B 4MH8A 5E6PA 3T3NA 3AE8B 4MT5A 2JVCA 2IBIB 2PLPA 3AU4A 2KVRA 1WX9A 3ZW3A 1WXVA 1ET6A 2M0AA 2OOBB 2KJHB 1CMXB 3GE8C 2W54A 4FXCA 3BIID 1FNWA 1QILA 2WU2B 2NR2A 1R7SA 5HI1A 1UD7A 2Z0EB 5FKAC 2XN9C 1KLVA 4M8NA 5JH5C 1IPGA 2MLBA 5JXVA 2FNJB 1GB4A 2L8JA 3ZUNA 3HRDD 1WWTA 2WLBA 3B1LX 3J9CA 2AX5A 4GIVA 3LB8C 2BB5A 3VTUA 1D4BA 1MPEA 1F2RC 2BQQA 1P9DU 1V80A 5LXHA 2DZJA 2VRRB 1ROEA 4WH4A 2IO2B 4B9KA 1EUVB 1YQ4B 1C76A 1YD8U 1ZOYB 2LGYA 3BVMA 3ZXVA 2ZCBA 4ANUA 1FRRA 2K22A 2WS3B 1TS4A 2XEWA 5BO4B 1Q1OA 5HG2A 3TEXA 2KZRA 4DBGA 3BWUD 3NOBA 2GOWA 3RNCC 3IVFA 3A9KB 1LM8B 1RFKA 2K8BA 1A70A 4CQNA 4URKA 1N6ZA 1MHHE 4E3CA 3ZRFA 4W9IA 1NI3A 2WXNA 2LUMA 3AU5A 3RNAC 1KOTA 3MFGA 2J53A 1IGCA 1BXTA 1TZ1A 3V60A 1E9MA 3L13A 1MHXA 5BYQA 2JYTA 1XF5L 2WXKA 2FIDA 4JGHB 2D07B 2N1VA 4GMVA 3DWGC 2I1JA 3BYYB 3NZSA 4MM3B 1E7UA 1XEEA 4B95A 4HXDA 3VFKA 5IKCM 2J42A 3Q8EA 1PFDA 1HTOA 3A9KA 3V62A 1HQRD 5FR3A 4REZA 2Y5CA 3UQBA 1QOGA 1E8WA 2KJ6A 1PGXA 3B2FA 3VVWB 4BKGA 3RNFC 2DHZA 4ACFA 1DOYA 1YJJA 4BZAA 1EWYC 4ZRIA 2INPE 2RDHA 5GMVA 1GB1A 1C9FA 3AE6B 4PS3A 3HK0A 1OQRA 2HJ1A 3FAHA 4N9F4 5DPSA 4PK1A 3DVNV 3QWZB 5J2RA 3VTWA 4NQLB 3AEEB 2M17A 4MM3A 4YTMB 2D3BA 2E3TA 4JE3B 3DHGC 3VDZA 1NYRA 1WF9A 3CMMB 4KZ0A 1T5XD 2LASA 4C80A 1SJED 3V05A 3RFZB 2KVZA 4KGSA 3DQVA 2LI5A 4RM8A 3ZYYX 4ZYNA 2W3SA 3DHIC 2LHDA 3M95A 4EKUA 2WNMA 1ZKHA 2KO3A 3WAPA 4LTUA 5IAAC 3ZGZA 1FIQA 3N32A 1E0ZA 1JWAD 4HPMB 4KX6B 5C1ZA 1E5WA 1ZPSA 4IM2A 3DWMA 3AE9B 4FHKA 3NVZA 4H2AA 4ZRQA 5DPTA 2KAJA 3KYDD
chains in the Genus database with same CATH topology
3AMZA 4NAWB 1NENB 4RFBA 1FCLA 3GS2A 1XLOA 1JCKB 1F2RI 1J7AA 4ZRPA 3VR8B 2L32A 4US9A 3U52E 3E9SA 4XWWA 1L6UA 4PT5A 2BB6A 1V97A 3URYA 3P4QB 2H88B 2HDEA 2KWDA 1IBXB 1F77A 2K3UA 2MH7A 4UDUC 2WXPA 2QMTA 1JWUD 1C4CA 5EE1A 2K5PA 1EM7A 3ZJUA 3MP9A 1T6BX 2BS3B 1QQRA 2OEDA 2LEKA 2YEPB 3NVVA 3SEBA 1D6EC 2AQ2B 3NZ3A 5HFYA 4KGTA 1OQQA 3KQ4A 3AEFB 3AECB 3W2DA 2SEBD 2WXHA 1AYFA 3SR6A 1YN4A 4WIPA 1SE3A 1CZPA 2NMQA 3SFEB 2FE8A 1D5MC 1XLQA 3B9JA 4XDDA 1P7EA 3P1MA 4RH6A 3ZJVA 3ABVB 3LXFA 4YWGG 3PO0A 1J7BA 2PVOD 4GLSC 2BW2A 2I2YA 1FRDA 2LHEA 2WXMA 3BVGA 4OZCA 4WAFA 3MC0B 1FFUA 2VZKD 2N9KA 2PKOA 1IBXA 2FUG1 1ENFA 3EUB2 4US8A 1ZUD2 3I57A 2RDGA 5C3JB 2G1EA 2OHFA 3ETRA 2FBWB 2JYEA 2WXOA 4OVZA 2DLBA 3P42A 1L6VA 1UGJA 4TMAB 3BZDB 4HEA1 1VZ6A 2QSDA 5D7GA 2ICIA 4RF0A 1TY2A 3W5UB 1ZXIA 3VR9B 1ZE3D 2KMMA 4YXDB 4J3OD 3Q8BA 1C4PA 2PVGC 2DBYA 3I9V1 5AUIA 5TSSA 1VJKA 1TYGB 1JMLA 1VDVA 2E6XA 3IAM1 2V0GA 1L4ZB 2MEKA 4ZHOA 1V8CA 2JSVX 4DQOC 2I38A 3GB1A 3NRZA 1K50A 1N61A 1N5XA 3HUIA 5EE3A 2IDYA 2X38A 3AV8A 3Q8AA 3W9CB 2K0PA 2JWUA 3E56A 1YN3A 1CQVA 4YTPB 4KKIA 4DXFA 2W3RA 2SAKA 4R3DA 4N6EB 1KFYB 3AB5A 4D2KA 1B9RA 5D3DA 2N0SB 1PUTA 1BUIC 2LGIA 3UI3A 4GDKB 4YSYB 1YJIA 4YSZB 1RWSA 1GAQB 1XLPA 1TKYA 4A90A 1M4VA 1NEKB 1WXQA 4RGTA 2WXIA 1TS3A 4KGRA 4RF1A 4TQ0A 3P4RB 1ACCA 3KWLA 3VRAB 1KF6B 2KN4A 1WYGA 1XCTL 1QLBB 2QIEB 1N63A 2CJNA 1SJHD 1ET9A 1C4AA 1HXYD 4WQMA 3P4SB 4WWMA 4XE0A 2BS4B 4NJCA 4NAMA 2QILA 1DGJA 1YQ3B 1P7FA 2AQ3B 3AE1B 1N62A 2WXLA 1FNVA 2DWQA 2N7JA 3P63A 4USAA 2Z8LA 4YTNB 2CU3A 1VZ7A 5BYRA 1D5ZC 2INNE 4HKZE 2M19A 1HEZE 2NTTA 2V4IB 4P6VF 3O13A 3AE4B 5I4DA 3AE3B 1ZDXA 4IKGA 2GB1A 3T3OA 1GOZA 1WSPA 3U7ZA 2WQYB 3C8YA 5C2TB 3TEYA 1JWSD 1L4DB 4A9AA 1XLNA 2R61A 4JWUC 1YNTE 1SSNA 4RCOA 3FC4A 1TS2A 2GRIA 1EU3A 1V1OA 3CWIA 2G9HD 2WDVB 1PYWD 2AQ1B 2L83A 4AQ7A 3ZJTA 4AS1A 1FNUA 4A6QA 2DYOA 3RPFC 1V1PB 2JU6X 2MJ3A 1HA5A 3BVZA 1TKEA 2GI9A 5G5HA 1L5PA 4GDLB 4OZBA 4B0MA 1I4PA 4MH8A 3T3NA 1KRHA 1UWMA 3AE8B 2WXFA 4MT5A 5G5GA 3TSSA 2ON8A 1AN8A 4ZOHC 1AWDA 2PLPA 2D5GA 3IXSA 1JQ4A 3PZ7A 1NVID 3NUHB 1L0YB 1ET6A 1TJEA 3AEBB 2QJLA 1J7CA 1HZ5A 1JROA 1MVKA 2M0AA 1JRPA 2JXTA 2M56B 1I4GA 1SEBD 1T3QA 2W54A 4FXCA 4L23A 2VZKB 2JX5A 2J52A 3BIID 1FNWA 2BYTA 3VRBB 1QILA 2WU2B 1LO5D 1K52A 1R7SA 5HI1A 1SE4A 3W5VB 1N60A 5FKAC 2XN9C 1OFFA 1IGDA 3AE2B 2W55A 1JWMD 5BMIA 3IAS1 1D5XC 1E6EB 3SFDB 1FM0D 5JXVA 1ZP0B 1SXTA 1TKGA 1GB4A 4ARCA 3HRDD 1SBBB 4KKJA 1KLGD 1WWTA 2WLBA 4L1BA 2H89B 2EELA 1ZDVA 1E10A 3J9CA 2V3PA 5BYSA 2AX5A 3U2SC 3AN1A 2BB5A 3LB8C 1D4BA 2K9XA 1L0XB 1FMAD 1MPEA 2WXQA 1F2RC 1XO3A 4HKQA 1DOIA 3N9YC 1XXGA 1WGKA 2IGGA 1PGBA 4JX1C 1ROEA 4WH4A 1IUEA 4XDCA 3IT6B 5GXGB 3EA6A 2IPKD 1STEA 3KWVA 3AE5B 1VZ8A 2WU5B 1YQ4B 1C76A 1CK1A 1SIJA 1ZOYB 3BVMA 1E7PB 3NS1A 1FFVA 2WXJA 1FRRA 3AEGB 2K22A 2WS3B 3WCQA 2CJOA 1TS4A 2ONQA 2ZW1A 5HG2A 1EU4A 1QKZA 1VLBA 3TEXA 1JW9D 3BWUD 4IDIA 4LK0M 1SF0A 4WURA 3AEDB 1I4HA 1RYJA 1GPXA 1RFKA 4HROA 1A70A 4CQNA 3BK2A 4A8XC 1MHHE 4N58A 2WDRB 5BMGA 1KTKA 2LMCA 4YSXB 2RPVA 1NI3A 5H8YE 2WXNA 2LUMA 4TSSA 1PGAA 4RGNA 3VQIA 4YT0B 3Q8FA 3MFGA 4B0EA 2J53A 1IGCA 1C77A 2BS2B 3HVZA 1TY0A 1BXTA 2XNAC 1E9MA 1Q10A 3AH7A 1DOXA 4O1NA 1MHXA 2B76B 5BYQA 2JYTA 1XF5L 2WXKA 2N9LA 3TEZA 1KLUD 2WDQB 4C7ZA 5T8IA 2LJIA 4OZAA 5HHDG 1DYQA 3KLSX 1TS5A 1Y56A 2IGDA 3DWGC 4Q2JA 2L52A 3TUOA 3BYYB 3FILB 4MM3B 4RNAA 2KACA 1XEEA 2PTLA 3B2GA 3IT4B 3R8BA 2J42A 3Q8EA 1PFDA 2DYMA 4EE2A 1VRAB 3AEAB 4TQ1A 1L0VB 2HTME 2IGHA 2PMVA 4NZLB 5AUKA 1YMHE 1C79A 1TZOA 1HQRD 5FR3A 4REZA 1N5WA 2Y5CA 2IJ0A 4JWSC 1C78A 1QOGA 1F0ZA 1PGXA 1QT9A 3BK1A 3Q69A 3B2FA 1B1ZA 2ZW0A 2MJEA 4XWTA 2KQ4X 1DOYA 1FXAA 1YJJA 1SE2A 1EWYC 2Y5PA 4C56C 3CIRB 1JALA 3NVWA 3HVDA 1QOBA 2INPE 2RDHA 4OW0A 1GB1A 5EE0A 5D3IB 3AM9A 1C9FA 3AE6B 5H92C 2KDMA 2WXRA 1OQRA 2EKIA 1ESFA 3EGRA 3FAHA 3PZ8A 3ZQ4A 1HZ6A 1I7HA 4OHJA 1WRIA 1EWCA 2V3NA 3AEEB 1QOAA 2BT6A 3FILA 4M0WA 1MI0A 4YTMB 1V1PA 2PIAA 2E3TA 4JE3B 2J4XA 1I4RA 4RGMA 1UNSA 1KH0A 1K53A 1VR9A 2L1AA 2Y3AA 4P16A 1I4XA 1NYRA 3AE7B 3TEWA 1UUPA 3R2TA 4ZYSA 3P4PB 4IOIE 1JWBD 1YN5A 1T5XD 2JQRB 4A55A 4C80A 1SJED 2BBCA 3V05A 4LLGM 3RFZB 1QF6A 1PDXA 4HJGE 1UWXA 1RM6C 4KGSA 2LFIA 2QEJC 5FK9C 1BMLC 3ZYYX 5MPOA 4ARIA 1FXIA 2JZPA 4MACA 5LNK1 4RGOS 1XCQL 1NYQA 1QOFA 2WXGA 3MHZA 3W1SA 4C7YA 1FO4A 2W3SA 3OWEB 4JPSA 3U4EG 3R2IA 2LHDA 3V3XA 4HRSA 2Q5WD 1I4QA 1ZXHA 4DXGA 3LYYA 2WNMA 2W82A 2NTSA 2TSSA 3Q8CA 4N59A 4LTUA 2YEPF 2ACZB 3L4PA 5EE9A 4ZHPA 1FEHA 1FD6A 1CJEA 2WP9B 3ZGZA 2RMMA 1FIQA 3GP7A 2MJDA 1K51A 3MJ5A 5BMHA 1E0ZA 1AW7A 1JWAD 4ITKA 3H8HA 4KX6B 3BYTB 1ZPSA 1SB3C 3DWMA 3AE9B 3NVYA 3NVZA 4H2AA 2PW9A 2BTEA 4L2YA 4ZRQA 5E6JA 1FCCC 2KAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AMZ A;  2WU2 B;  1R7S A;  4N6E B;  3W5V B;  1KFY B;  1NEN B;  1N60 A;  3AB5 A;  1B9R A;  3AEA B;  1L0V B;  1XLO A;  2HTM E;  1OFF A;  1PUT A;  2N0S B;  5AUK A;  1J7A A;  2W55 A;  3AE2 B;  3VR8 B;  4YSY B;  4US9 A;  1E6E B;  1YJI A;  1N5W A;  3SFD B;  4YSZ B;  2Y5C A;  1RWS A;  1FM0 D;  1GAQ B;  1L6U A;  1ZP0 B;  4JWS C;  1XLP A;  1TKG A;  1QOG A;  1V97 A;  1TKY A;  3P4Q B;  1QT9 A;  1F0Z A;  2H88 B;  1NEK B;  1WXQ A;  3B2F A;  2MH7 A;  3HRD D;  1WWT A;  2WLB A;  2MJE A;  2H89 B;  3P4R B;  1E10 A;  5EE1 A;  2K5P A;  1DOY A;  1FXA A;  1YJJ A;  2AX5 A;  3KWL A;  3AN1 A;  1EWY C;  3LB8 C;  3CIR B;  1JAL A;  3NVW A;  3VRA B;  2K9X A;  1FMA D;  1QOB A;  1KF6 B;  2BS3 B;  1WYG A;  2LEK A;  1QLB B;  1XO3 A;  5EE0 A;  2QIE B;  1DOI A;  1N63 A;  2CJN A;  3AM9 A;  3AE6 B;  3NVV A;  5H92 C;  4WQM A;  1OQR A;  2EKI A;  1WGK A;  3FAH A;  3P4S B;  2BS4 B;  4JX1 C;  4WWM A;  1OQQ A;  1ROE A;  1IUE A;  3AEF B;  3AEC B;  1DGJ A;  5GXG B;  1I7H A;  1YQ3 B;  1WRI A;  1AYF A;  3AE1 B;  1N62 A;  3SR6 A;  3AE5 B;  2DWQ A;  2WU5 B;  3P63 A;  1YQ4 B;  1CZP A;  4USA A;  3SFE B;  3AEE B;  1QOA A;  1SIJ A;  1ZOY B;  2BT6 A;  4YTN B;  1E7P B;  1XLQ A;  1FFV A;  2CU3 A;  3B9J A;  3NS1 A;  2PIA A;  4YTM B;  2E3T A;  1FRR A;  3P1M A;  3AEG B;  2K22 A;  2WS3 B;  2M19 A;  3WCQ A;  2CJO A;  4P6V F;  1NYR A;  3ABV B;  3AE4 B;  3AE7 B;  3LXF A;  3PO0 A;  1J7B A;  3AE3 B;  2PVO D;  2W3R A;  3P4P B;  1JWB D;  2JQR B;  2WQY B;  1VLB A;  5C2T B;  4C80 A;  1FRD A;  1JW9 D;  1QF6 A;  4IDI A;  1PDX A;  1SF0 A;  4A9A A;  1XLN A;  4JWU C;  1RM6 C;  1FFU A;  3AED B;  1RYJ A;  3ZYY X;  3FC4 A;  1RFK A;  2PKO A;  4HRO A;  5MPO A;  1GPX A;  1A70 A;  1FXI A;  3EUB 2;  3W9C B;  1ZUD 2;  3CWI A;  4US8 A;  5C3J B;  2G1E A;  2L83 A;  2OHF A;  2WDV B;  1NYQ A;  3ETR A;  4N58 A;  2FBW B;  1QOF A;  2WDR B;  4C7Y A;  4YSX B;  1FO4 A;  1NI3 A;  2W3S A;  5H8Y E;  3RPF C;  4YT0 B;  1L6V A;  4HRS A;  2MJ3 A;  2Q5W D;  2BS2 B;  1TKE A;  3HVZ A;  3W5U B;  1E9M A;  1ZXI A;  5G5H A;  1L5P A;  2KMM A;  3AH7 A;  3VR9 B;  4YXD B;  1DOX A;  2B76 B;  1KRH A;  1UWM A;  3AE8 B;  4N59 A;  4LTU A;  2PVG C;  2DBY A;  5G5G A;  2WDQ B;  4C7Z A;  2ACZ B;  3L4P A;  5AUI A;  5EE9 A;  1VJK A;  4ZHP A;  1TYG B;  4ZOH C;  1AWD A;  1CJE A;  2WP9 B;  1JQ4 A;  1VDV A;  1FIQ A;  2MJD A;  4ZHO A;  1NVI D;  3AEB B;  1TJE A;  1V8C A;  1E0Z A;  2QJL A;  1J7C A;  3DWG C;  1JRO A;  1JWA D;  3NRZ A;  4ITK A;  4KX6 B;  1JRP A;  2L52 A;  1SB3 C;  1N61 A;  2M56 B;  1N5X A;  3HUI A;  5EE3 A;  1T3Q A;  3AE9 B;  3AV8 A;  3DWM A;  3NVY A;  3NVZ A;  3B2G A;  2W54 A;  4FXC A;  2JX5 A;  4YTP B;  3BII D;  1PFD A;  2KAJ A;  3VRB B; 
#chains in the Genus database with same CATH topology
 3AMZ A;  5L83 A;  4NAW B;  1NEN B;  1FCL A;  2MW5 A;  4BFR A;  1J7A A;  3U52 E;  4XWW A;  3QA8 A;  3M3J A;  2NCN A;  3URY A;  3P4Q B;  4DHZ B;  3Q2A C;  2H88 B;  4GGQ A;  1IBX B;  1F77 A;  1V5O A;  1C1Y B;  4BKS A;  2WXP A;  3ML8 A;  2MBO A;  5EE1 A;  1EM7 A;  3DCG A;  4W9E A;  3ZJU A;  1T6B X;  4GXB A;  2C7N B;  4W9J A;  2KXJ A;  2LWP A;  2BWE S;  3NZ3 A;  4IW0 A;  3SR6 A;  4WIP A;  1SE3 A;  2NMQ A;  4KV2 A;  3KH0 A;  2EKE C;  4RH6 A;  3ZJV A;  4YWG G;  4F1S A;  3BVG A;  2M0X A;  3T8M A;  2KWU B;  2GBK A;  1IBX A;  2FUG 1;  2KN5 A;  3EUB 2;  2RDG A;  5C3J B;  3N1Z C;  3NZU A;  2G1E A;  4OVZ A;  2M1M A;  4M00 A;  4GN1 A;  3IG3 A;  2K6Q A;  3PSE B;  1VZ6 A;  4RF0 A;  3W5U B;  3VR9 B;  1ZE3 D;  4KZC A;  4YXD B;  3PS6 A;  1UF0 A;  2PE6 B;  4J3O D;  5AUI A;  1HTQ A;  3AUL A;  3ENE A;  2JUO A;  3OAW A;  3AXC A;  2MEK A;  2N7D A;  2IDY A;  2K0P A;  2JWU A;  4FJV B;  1CQV A;  2K8C A;  2W3R A;  3AB5 A;  2DEN B;  1PUT A;  4GDK B;  1T0S C;  2PJH A;  2G3Q B;  3PV1 A;  4LNN A;  4A90 A;  1D3Z A;  4CO7 A;  4WJP A;  1WXQ A;  4RGT A;  1TS3 A;  4DXA B;  2VH2 A;  1ACC A;  4HWI B;  3TCA A;  1WYG A;  3QK0 A;  2KOX A;  2QIE B;  2CJN A;  1HXY D;  3QIJ A;  2BS4 B;  2O6V B;  1DGJ A;  1WJU A;  2ZZP B;  2N7J A;  2KNB A;  4S17 A;  2JWZ A;  5BYR A;  2C60 A;  5AZF A;  2AL6 A;  2M19 A;  1HEZ E;  3SHQ A;  4P6V F;  3AE4 B;  3AE3 B;  1ZDX A;  4IKG A;  3TEY A;  3V6E B;  1L4D B;  4JWU C;  3Q14 C;  4RCO A;  2GRI A;  1V1O A;  1LXD A;  4FLH A;  1WY8 A;  2G9H D;  1PYW D;  1Z5S B;  3N1X C;  1FNU A;  1WRD B;  3NG0 A;  3GZN B;  2DYO A;  1V1P B;  2ZNV B;  3ZTD A;  2JU6 X;  2WX1 A;  2NPT B;  1HA5 A;  2NBU A;  3R3M A;  2O6V A;  2BYV E;  4B0M A;  1I4P A;  5J17 A;  2DNF A;  1UWM A;  3VHT C;  5G5G A;  3VXW A;  3QAQ A;  1JQ4 A;  5AZG A;  5DCN A;  1L0Y B;  1TJE A;  2QJL A;  4WAA A;  1JRO A;  1MVK A;  1JRP A;  2JXT A;  3ZKJ C;  2QDF A;  2J52 A;  2KQS A;  3VRB B;  1K52 A;  2HD5 B;  3A9J A;  3W5V B;  1N60 A;  1L7Y A;  2MCN B;  2C7M B;  3P2B A;  2JF5 A;  3AE2 B;  2W55 A;  4OVU A;  4FUL A;  3SFD B;  1ZP0 B;  1SXT A;  2GBJ A;  3EFU A;  4DHZ E;  4ARC A;  1L2N A;  2NPT A;  1KLG D;  2IY0 B;  2EEL A;  1ZDV A;  1E10 A;  3VH4 B;  5BYS A;  3U2S C;  1FMA D;  3PLV A;  1WJ4 A;  4HKQ A;  3PRZ A;  1XXG A;  2ZEQ A;  3DBS A;  4XDC A;  3IT6 B;  5GXG B;  2IPK D;  2WU5 B;  3HM6 X;  4WWP A;  1SIJ A;  1J0G A;  3RD2 A;  4HCP B;  1WE7 A;  1TT5 B;  2LJ5 A;  1OEY A;  3U8Z A;  2ZW1 A;  3PRP B;  1EU4 A;  1VLB A;  4LK0 M;  4RM9 A;  3MTN B;  2M8S A;  4HRO A;  4HDO A;  4BOZ B;  5L95 C;  3BK2 A;  4GU2 A;  2WDR B;  5BMG A;  2LMC A;  4YSX B;  2RPV A;  3Q3J A;  4S0R A;  4RGN A;  3VQI A;  2DZI A;  2BS2 B;  2A4Z A;  2XNA C;  1TGZ B;  2AEH A;  1KLU D;  2WDQ B;  2AYO B;  4PYU A;  1TS5 A;  4ANV A;  2DAJ A;  3HIZ A;  2MHJ A;  4NJ7 A;  4HVB A;  2EMS A;  4K3B A;  3Q3M C;  2PTL A;  3B2G A;  1VD2 A;  3IT4 B;  3R8B A;  3RI7 C;  4K3C A;  4BBN C;  3WAL A;  2DYM A;  3SD5 A;  2G4D B;  4EE2 A;  1VRA B;  3AEA B;  4LJP B;  1L0V B;  2HTM E;  2IGH A;  2PMV A;  4LNK A;  4JL9 A;  4ZRJ A;  1N5W A;  2IJ0 A;  2L05 A;  3BK1 A;  1B1Z A;  1LFD A;  3DBR B;  2CS4 A;  1V86 A;  4XWT A;  2KQ4 X;  1FXA A;  2Y5P A;  3NVW A;  3HVD A;  1QOB A;  4OW0 A;  5EE0 A;  1R4N B;  5H92 C;  2L0F A;  2KDM A;  2WXR A;  2EKI A;  4YL8 A;  3EGR A;  3PZ8 A;  3DBR I;  3ZQ4 A;  1HZ6 A;  4HJK A;  1I7H A;  2LGD A;  4OHJ A;  1WRI A;  2KDB A;  2NBW B;  1QOA A;  4KIK B;  5IP4 D;  1MI0 A;  2PIA A;  3NS8 A;  1R4N I;  2J4X A;  2LVO A;  4P16 A;  2L1A A;  4DDG D;  2BKF A;  4FA6 A;  2KK8 A;  3N3K B;  3P4P B;  4IOI E;  1JWB D;  2JQR B;  2HJ8 A;  2OJW A;  3X23 A;  1QF6 A;  1PDX A;  4HJG E;  2GBM A;  3RNG C;  2QEJ C;  5MPO A;  1FXI A;  4RGO S;  1NYQ A;  2KHW B;  1QOF A;  3MHZ A;  3W1S A;  1T0R C;  1F52 A;  3OWE B;  4HDQ A;  4LNI A;  3V3X A;  1ZXH A;  4G11 A;  4DXG A;  3APC A;  3LYY A;  2NTS A;  4TKN A;  4ZHP A;  1FD6 A;  1WH3 A;  3ZRC A;  4AJY B;  2KTR B;  4M01 A;  2RMM A;  4ICU A;  2MJD A;  1K51 A;  2Z59 B;  2J0M A;  3NJT A;  2KX0 A;  2J0K A;  4EUT A;  1SB3 C;  4HCN B;  3NVY A;  3QCA A;  1GC7 A;  4WJN A;  2PW9 A;  1H8C A;  1ZW7 A;  4MDK E;  1OTR B;  4MEM A;  1FPY A;  1XD3 B;  4RFB A;  3GS2 A;  1XLO A;  4ASW C;  2A5U A;  4GOC A;  4ZRP A;  3VR8 B;  3LJ3 A;  4P1B C;  2KDE B;  1JWU D;  2D10 A;  1MG8 A;  2N9P C;  3MJW A;  3ZDT A;  5DPW A;  3ZXR A;  3NVV A;  3SEB A;  1E90 A;  1D6E C;  2AQ2 B;  2KTR A;  5HFY A;  3AEC B;  2WXH A;  4II2 B;  5AEK B;  2JY6 A;  3QAR A;  2GMI C;  4XDD A;  1P7E A;  4MJS B;  3P1M A;  4ICV A;  4WJQ A;  2KJR A;  1J7B A;  2KDI A;  2BW2 A;  3A4R A;  1TBE A;  2LHE A;  1RRB A;  3MHS D;  2QCZ A;  2VZK D;  3RNB C;  2PKO A;  2K1F A;  1ENF A;  4US8 A;  1WGH A;  5DPR A;  4WWO A;  2JYE A;  4LDT D;  3L17 A;  1J8C A;  3P42 A;  3PPA A;  1L6V A;  4FN2 A;  4TMA B;  2ZPY A;  2QSD A;  5D7G A;  3APF A;  4FAD A;  2MA9 B;  2CU1 A;  4F7Z A;  5TSS A;  1VJK A;  2DAF A;  2KTF A;  1V81 A;  1L4Z B;  1RAX A;  4MJS A;  2ZJD A;  2MBQ A;  4DQO C;  1V5T A;  2I38 A;  4OVV A;  3GB1 A;  5TR5 A;  1K50 A;  1N61 A;  1WE6 A;  3Q8A A;  1YN3 A;  3A1Q B;  4YTP B;  4EZK A;  4KKI A;  3V61 A;  4DXF A;  2BWF A;  2N0S B;  4IWP A;  3AI5 A;  4BKS D;  4HLE A;  3UI3 A;  3RYT A;  4YSY B;  3ZO5 B;  1YJI A;  1GAQ B;  4IM0 A;  1TKY A;  1VCB A;  4BAX A;  5CHF A;  3UIO B;  2VH1 A;  1K8R B;  5D6J B;  1N63 A;  1OEY J;  3P4S B;  4WWM A;  2FCQ A;  2G4S A;  3RZF A;  2GBN A;  1P7F A;  3AE1 B;  1FNV A;  2DWQ A;  3Q3N C;  5IO9 A;  4BOS C;  2CU3 A;  2INN E;  2NTT A;  2NBV B;  3TBL D;  3T3O A;  5C2T B;  3RT3 B;  4A9A A;  1XLN A;  3RNE C;  2R61 A;  2V3S A;  2REX A;  4AWJ A;  4CHK A;  5KHQ A;  1EU3 A;  2BKR B;  3RZW C;  2AQ1 B;  4AQ7 A;  3A33 B;  4AS1 A;  4B6W A;  4DHJ D;  4W9H A;  4A6Q A;  4M0W B;  3QC8 B;  1NBF C;  2RSU A;  3RPF C;  2MP2 B;  2MJ3 A;  2BPS A;  4NAW A;  3BVZ A;  1TKE A;  4ZDV A;  4IWQ A;  1WXM A;  2GI9 A;  3Q6B A;  1L5P A;  4GDL B;  4OZB A;  5G5H A;  1KRH A;  2GBR A;  3ZVV A;  2CHW A;  2ON8 A;  5FR6 A;  1E8Y A;  3C19 A;  3KW5 B;  4ZOH C;  2D5G A;  3IXS A;  3PZ7 A;  4K7U A;  1UH6 A;  3CST A;  4K7S A;  3ZNZ B;  2WDT B;  3NUH B;  1WGD A;  2WHI A;  2WX0 A;  4NY0 A;  3HHM A;  1I4G A;  4JQW C;  2JX5 A;  4W9K A;  1WR6 E;  3IHP C;  1SE4 A;  3EHV A;  1TIF A;  1GUA B;  3H7S A;  4MSM B;  1IGD A;  1D5X C;  2LXA A;  2O2V B;  2LD9 A;  1EF1 A;  4DWF A;  2MP2 A;  1YIW A;  1SBB B;  5JZE B;  4KVG B;  4C4V B;  1GJZ A;  1GG3 A;  4L1B A;  1MJD A;  2V3P A;  1L0X B;  3FKY A;  3RN9 C;  5JHB A;  2WXQ A;  1WXA A;  1XO3 A;  3NY5 A;  1DOI A;  4P1C C;  3N9Y C;  2AL3 A;  1WGK A;  2IGG A;  4JX1 C;  2V1Y A;  4IM3 A;  3KWV A;  2KDF B;  3AE5 B;  1VZ8 A;  3UIN B;  3NS1 A;  2WXJ A;  2ZVN A;  1R4M B;  3AEG B;  3ZIM A;  2ONQ A;  3H7P B;  2NS5 A;  1WJ6 A;  1QKZ A;  1JW9 D;  4IDI A;  5IA7 A;  1SF0 A;  1R4M I;  4DK5 A;  4GSW A;  1RYJ A;  1U4A A;  4A8X C;  3DVN U;  4TSS A;  1PGA A;  4YT0 B;  3KYC D;  4HPP A;  4TUU A;  3DBL B;  3HVZ A;  1V2Y A;  2C5L C;  2L0T A;  1DOX A;  2KAN A;  4GDK A;  5LXI B;  2CKH B;  4C7Z A;  4OZA A;  5HHD G;  1DYQ A;  2BVC A;  3DBL I;  1Y56 A;  4X57 B;  4XGA B;  2IGD A;  2MBB B;  2J0J A;  1WR1 A;  4Q2J A;  3H7P A;  4G50 A;  4RNA A;  4M02 A;  2WWZ A;  2KAC A;  2JRH A;  3QQ8 B;  3ZNH B;  1E8X A;  2KQ7 A;  2L7R A;  4TQ1 A;  4NZL B;  1OQY A;  1YMH E;  5D2M B;  3GZN I;  2RGF A;  4JWS C;  3IBE A;  3PTF C;  3Q69 A;  3VH3 B;  3WA0 A;  2YVC A;  2K39 A;  2FCM A;  3VUW A;  3JSV B;  2B3A A;  2MJE A;  1SE2 A;  4C56 C;  3CIR B;  3N30 A;  5D3I B;  3AM9 A;  1EF5 A;  1WZ3 A;  1ESF A;  1WI0 A;  3PHX B;  3A4S C;  1EWC A;  2LUE A;  1MG4 A;  3V6C B;  3MC8 A;  2NVU I;  2BYE A;  1V1P A;  3I3T B;  3H9D A;  1I4R A;  4P7I A;  1VR9 A;  2Y3A A;  3AE7 B;  3TEW A;  1UUP A;  3K9P B;  2KMC A;  1YN5 A;  3L10 B;  1P3Q U;  1UWX A;  1RM6 C;  2LFI A;  3B08 A;  4LCD E;  4ARI A;  2JZP A;  4MAC A;  2IO1 B;  1E8Z A;  5LNK 1;  2X8X X;  3VAW A;  2WXG A;  4C7Y A;  4JPS A;  1T0Y A;  3U4E G;  5AZH A;  3R2I A;  2V9H A;  3DOW A;  4HRS A;  1I4Q A;  1QZE A;  1E7V A;  4EOY A;  1Z2M A;  2IY1 B;  2TSS A;  4AUQ C;  2I1K A;  3Q8C A;  3PT2 B;  2ACZ B;  3L4P A;  3QX1 A;  3K9O B;  5EE9 A;  2RDB C;  2WP9 B;  1NDD A;  2JPH A;  3L54 A;  4G3X B;  2DX5 B;  3B0A A;  3VUY A;  2PE9 A;  3BYT B;  1PQS A;  2GLS A;  2KX3 A;  4MGZ E;  2BTE A;  3Q3O C;  1FCC C;  2W9N A;  2ZNV C;  1XQQ A;  1F2R I;  2D3G A;  1V6E A;  2AWT A;  3E9S A;  5KHO A;  2CR5 A;  4WJO A;  3S2A A;  3UQA A;  2HDE A;  2KWD A;  2K3U A;  3D32 A;  4UDU C;  4EEW A;  2N1W A;  2QMT A;  3TJP A;  2KFJ A;  2K5P A;  2BS3 B;  1P98 A;  2OED A;  2YEP B;  4NQK E;  3PRE A;  1OQQ A;  3KQ4 A;  4EZJ A;  3W2D A;  1AYF A;  2ASQ A;  1CZP A;  1D5M C;  5CTR C;  4E71 A;  2PPH A;  5E6O A;  2D3A A;  1UEL A;  3PO0 A;  2KLG A;  2PVO D;  3GOE A;  4GLS C;  1LGR A;  2I2Y A;  1FRD A;  4KDI C;  4OZC A;  3MC9 A;  4WAF A;  3MC0 B;  3CSF A;  1FFU A;  1M94 A;  2FUH B;  2OHF A;  2D3C A;  2WXO A;  1YJ1 A;  1XT9 B;  2IYD B;  3BZD B;  4PS8 A;  3QJZ A;  2INC C;  5IN7 A;  1V9J A;  1ISN A;  1ZXI A;  3EFC A;  1SE9 A;  4MGY E;  3I9V 1;  5HKH A;  1TYG B;  4RMA A;  3ZLZ A;  1VDV A;  4E74 A;  2V0G A;  3QHT A;  4ZHO A;  4F8C B;  1V8C A;  2JSV X;  2FAZ A;  3NRZ A;  3PLU A;  1MFW A;  2X38 A;  1H4R A;  3E56 A;  3JVZ X;  4MSQ B;  3U7D A;  3EEC A;  1B9R A;  3OJ4 B;  4W9C A;  5D3D A;  1IYF A;  2CHX A;  2HE7 A;  1BUI C;  1WXS A;  1RWS A;  4KIK A;  2MBE A;  2MSE D;  1M4V A;  2QC8 A;  2MWS B;  2V4L A;  4KGR A;  3P4R B;  2XK5 B;  2KT7 A;  3KWL A;  2MX2 A;  3VRA B;  3T9L A;  2KN4 A;  1QLB B;  3ZDM C;  5D94 A;  1SJH D;  1ET9 A;  3Q3F A;  3WIM A;  4WQM A;  2K25 A;  4NJC A;  1JRU A;  2QIL A;  4IG7 B;  2M4N A;  1N62 A;  4USA A;  2L3Z A;  4MGK E;  2Z8L A;  4YTN B;  1ZGU B;  4HKZ E;  2V4I B;  2UU7 A;  3DDC B;  3UGB B;  3DVG Y;  2DZK A;  2GB1 A;  3U30 A;  3U7Z A;  1J19 A;  2WQY B;  4IC7 B;  2D2Q A;  4TV3 A;  1JWS D;  2L00 B;  1YX6 B;  3W1S C;  2LRU A;  1SSN A;  2EMT A;  1SGH A;  1S1Q B;  2IND C;  2L83 A;  4CYE A;  2K8H A;  2XK5 A;  4LNF A;  3ZTC A;  4AJW A;  3VUX A;  3JW0 X;  2N4F A;  1WZ0 A;  2UYZ B;  1SIF A;  2WXF A;  3DBH B;  4ANW A;  3TSS A;  2R2Q A;  1AN8 A;  4LJO B;  1AWD A;  2KYW A;  2N9X A;  2FIF A;  3SDL C;  1NVI D;  4A3P A;  3AEB B;  4JLC A;  1J7C A;  2MQJ A;  1HZ5 A;  2M56 B;  1SEB D;  2LRW A;  3DBH I;  1T3Q A;  4L23 A;  2VZK B;  3ZNG C;  1WJN A;  2BYT A;  1LO5 D;  3H6N A;  2RPQ A;  1OFF A;  4LDT B;  3UIP B;  1JWM D;  5BMI A;  3TIX A;  3IAS 1;  3RUL A;  3R7R A;  1E6E B;  2XBB C;  1FM0 D;  3IFW B;  3KVF B;  3HM3 A;  1NI2 A;  1TKG A;  4HK2 A;  4WWN A;  4AP4 C;  4KKJ A;  2H89 B;  2OJR A;  3AN1 A;  2K9X A;  1F9J A;  1HE8 A;  3OG5 A;  4GB9 A;  2ZCC A;  3DHH C;  1PGB A;  1IUE A;  4II3 B;  2ZPN A;  3EA6 A;  1STE A;  4KSK C;  4JIO U;  3X0W A;  1CK1 A;  1E7P B;  1FFV A;  1UGM A;  5CHV C;  3WCQ A;  2CJO A;  4FBJ B;  3WAN A;  1WGY A;  3KUZ A;  4G0N B;  3NHE B;  2LVQ A;  3OLM D;  1WMH B;  4PS7 A;  4WUR A;  5EDS A;  3AED B;  1I4H A;  4NPN A;  3UF8 A;  1GPX A;  4AOF A;  4N58 A;  3PZD A;  1F1H A;  4K7W A;  2KC2 A;  2PEA A;  2RR9 A;  4KDL B;  1KTK A;  5H8Y E;  3A1Q A;  3Q8F A;  4B0E A;  1RLF A;  4ZRK A;  1C77 A;  1TY0 A;  2KLC A;  1Q10 A;  1P1A A;  3AH7 A;  1WYW B;  4O1N A;  2B76 B;  2N9L A;  3TEZ A;  4A3O A;  3GE3 C;  5T8I A;  2LJI A;  5LLI A;  3KLS X;  5C23 A;  1T0Q C;  3ZNI D;  4PYZ A;  3RUI B;  4BBN F;  2L52 A;  3TUO A;  3FIL B;  3L0W B;  3WAM A;  3N20 C;  1WMH A;  4A20 A;  3I63 C;  4MGI E;  2JZ3 B;  4DHJ B;  5AUK A;  3JYU A;  1C79 A;  1TZO A;  1C78 A;  1F0Z A;  1QT9 A;  2KD0 A;  2ZW0 A;  3N1Y C;  4EZL A;  3M62 B;  4M8M A;  2UWQ A;  1JAL A;  2QHO A;  3ONS A;  4I6P A;  4DDI D;  3C0R B;  2K6D B;  4HPL B;  2JRI B;  2IZV B;  2V3N A;  4M0W A;  2BT6 A;  3FIL A;  5J18 A;  2JT4 B;  3PGE A;  5CX3 A;  2BYF A;  4RGM A;  1UNS A;  1KH0 A;  1K53 A;  1I4X A;  2YLM A;  2KWC A;  4GDL A;  3R2T A;  4EFO A;  4ZYS A;  4W9F A;  4A55 A;  2BBC A;  4LLG M;  3O65 B;  1WFY A;  1WGR A;  1LQB A;  2N7E A;  1BML C;  5FK9 C;  3OJ3 A;  3SU8 X;  3VTV A;  1XCQ L;  4W9G A;  1FXT B;  1UBQ A;  1FO4 A;  2RD0 A;  1AAR A;  2J7Q B;  3TMP B;  2ZVO A;  2Q5W D;  3H1U A;  2W82 A;  1C3T A;  3R7Q A;  1OGW A;  4N59 A;  2O2V A;  4K81 A;  3I5J C;  2YEP F;  2C9W B;  1GC6 A;  1FEH A;  1CJE A;  2IO3 B;  3GP7 A;  5BMH A;  3MJ5 A;  2WGS A;  4J6I A;  4C4V A;  1Y8R C;  1AW7 A;  4ITK A;  3L08 A;  3H8H A;  2O6V D;  2KFK B;  3R66 C;  2R2O A;  5G2N A;  1IP9 A;  4L2Y A;  5E6J A;  4MH0 E;  4FJZ A;  1JCK B;  1WIA A;  2L32 A;  3PHW B;  4US9 A;  4MEL A;  1L6U A;  4PT5 A;  2BB6 A;  1V97 A;  2MH7 A;  3PVL A;  4XYC A;  2MRP A;  2BGF A;  1C4C A;  1KM7 A;  3KUC B;  3MP9 A;  3TL5 A;  2CHZ A;  1QQR A;  2LEK A;  3EC8 A;  1GNU A;  4BKT A;  1BT0 A;  4XX5 A;  3RMK C;  3WAO A;  3A9J B;  4KGT A;  3AEF B;  2SEB D;  1I35 A;  1YN4 A;  2KWV B;  3SFE B;  2KFK A;  3ALB A;  2FE8 A;  1XLQ A;  3B9J A;  4IUM B;  3W1Y A;  3L16 A;  4ANX A;  3BIN A;  4I6L B;  4XC2 A;  3ABV B;  4K1R B;  3LXF A;  2WYQ A;  4XZ4 A;  2LGX A;  5IOI A;  2WXM A;  2LXC A;  3ECI A;  2N9K A;  3DPD A;  1G6J A;  2HTH A;  1ZUD 2;  1UBI A;  3I57 A;  3ETR A;  2FBW B;  3KUD B;  1A5R A;  2DLB A;  4NJ6 A;  2DYB A;  2Z0D B;  1UGJ A;  4HEA 1;  4W9L A;  2BF8 B;  2ICI A;  3M63 B;  1TY2 A;  2KMM A;  3APD A;  3Q8B A;  1C4P A;  1UZX B;  2PVG C;  2DBY A;  2Y5B B;  5G55 A;  1JML A;  2E6X A;  3IAM 1;  1TTN A;  1KJT A;  3JSV A;  4LNO A;  4FJY A;  3RCZ A;  1N5X A;  3HUI A;  5EE3 A;  3W9C B;  3AV8 A;  4NNJ B;  2JXX A;  2SAK A;  4R3D A;  4N6E B;  1KFY B;  4D2K A;  1YQB A;  1Q0W B;  4KSL C;  5CHW A;  4WQO B;  2LGI A;  2LVP A;  2L76 A;  1Q5W B;  4YSZ B;  1RFA A;  2MBH A;  1XLP A;  2N9E B;  2FCN A;  3ML9 A;  1I42 A;  1NEK B;  2WXI A;  4RF1 A;  2G45 B;  4TQ0 A;  4QAY A;  1WM2 A;  4C00 A;  2D11 A;  1P0R A;  1KF6 B;  1XCT L;  1EO6 A;  1C4A A;  1V49 A;  1WM3 A;  3DVG X;  4W9D A;  4XE0 A;  4NAM A;  2LGS A;  2JZZ A;  1YQ3 B;  2AQ3 B;  2WXL A;  5JHA A;  3P63 A;  3LDZ E;  1S3S G;  1VZ7 A;  4FHJ A;  2C7H A;  1D5Z C;  1WX7 A;  2LZ6 A;  3O13 A;  2DZM A;  5I4D A;  3PRM B;  1GOZ A;  1WSP A;  3C8Y A;  4BVU C;  1WGG A;  1YNT E;  3FC4 A;  3BY4 B;  3CF6 E;  1TS2 A;  2KMA A;  3CWI A;  2WDV B;  3ZJT A;  2FCS A;  5E6N A;  1WX8 A;  1YOV B;  2KC1 A;  1X1M A;  4I6N B;  4IWO A;  2KKC A;  1YX5 B;  2IO0 B;  4MH8 A;  5E6P A;  3T3N A;  3AE8 B;  4MT5 A;  2JVC A;  2IBI B;  2PLP A;  3AU4 A;  2KVR A;  1WX9 A;  3ZW3 A;  1WXV A;  1ET6 A;  2M0A A;  2OOB B;  2KJH B;  1CMX B;  3GE8 C;  2W54 A;  4FXC A;  3BII D;  1FNW A;  1QIL A;  2WU2 B;  2NR2 A;  1R7S A;  5HI1 A;  1UD7 A;  2Z0E B;  5FKA C;  2XN9 C;  1KLV A;  4M8N A;  5JH5 C;  1IPG A;  2MLB A;  5JXV A;  2FNJ B;  1GB4 A;  2L8J A;  3ZUN A;  3HRD D;  1WWT A;  2WLB A;  3B1L X;  3J9C A;  2AX5 A;  4GIV A;  3LB8 C;  2BB5 A;  3VTU A;  1D4B A;  1MPE A;  1F2R C;  2BQQ A;  1P9D U;  1V80 A;  5LXH A;  2DZJ A;  2VRR B;  1ROE A;  4WH4 A;  2IO2 B;  4B9K A;  1EUV B;  1YQ4 B;  1C76 A;  1YD8 U;  1ZOY B;  2LGY A;  3BVM A;  3ZXV A;  2ZCB A;  4ANU A;  1FRR A;  2K22 A;  2WS3 B;  1TS4 A;  2XEW A;  5BO4 B;  1Q1O A;  5HG2 A;  3TEX A;  2KZR A;  4DBG A;  3BWU D;  3NOB A;  2GOW A;  3RNC C;  3IVF A;  3A9K B;  1LM8 B;  1RFK A;  2K8B A;  1A70 A;  4CQN A;  4URK A;  1N6Z A;  1MHH E;  4E3C A;  3ZRF A;  4W9I A;  1NI3 A;  2WXN A;  2LUM A;  3AU5 A;  3RNA C;  1KOT A;  3MFG A;  2J53 A;  1IGC A;  1BXT A;  1TZ1 A;  3V60 A;  1E9M A;  3L13 A;  1MHX A;  5BYQ A;  2JYT A;  1XF5 L;  2WXK A;  2FID A;  4JGH B;  2D07 B;  2N1V A;  4GMV A;  3DWG C;  2I1J A;  3BYY B;  3NZS A;  4MM3 B;  1E7U A;  1XEE A;  4B95 A;  4HXD A;  3VFK A;  5IKC M;  2J42 A;  3Q8E A;  1PFD A;  1HTO A;  3A9K A;  3V62 A;  1HQR D;  5FR3 A;  4REZ A;  2Y5C A;  3UQB A;  1QOG A;  1E8W A;  2KJ6 A;  1PGX A;  3B2F A;  3VVW B;  4BKG A;  3RNF C;  2DHZ A;  4ACF A;  1DOY A;  1YJJ A;  4BZA A;  1EWY C;  4ZRI A;  2INP E;  2RDH A;  5GMV A;  1GB1 A;  1C9F A;  3AE6 B;  4PS3 A;  3HK0 A;  1OQR A;  2HJ1 A;  3FAH A;  4N9F 4;  5DPS A;  4PK1 A;  3DVN V;  3QWZ B;  5J2R A;  3VTW A;  4NQL B;  3AEE B;  2M17 A;  4MM3 A;  4YTM B;  2D3B A;  2E3T A;  4JE3 B;  3DHG C;  3VDZ A;  1NYR A;  1WF9 A;  3CMM B;  4KZ0 A;  1T5X D;  2LAS A;  4C80 A;  1SJE D;  3V05 A;  3RFZ B;  2KVZ A;  4KGS A;  3DQV A;  2LI5 A;  4RM8 A;  3ZYY X;  4ZYN A;  2W3S A;  3DHI C;  2LHD A;  3M95 A;  4EKU A;  2WNM A;  1ZKH A;  2KO3 A;  3WAP A;  4LTU A;  5IAA C;  3ZGZ A;  1FIQ A;  3N32 A;  1E0Z A;  1JWA D;  4HPM B;  4KX6 B;  5C1Z A;  1E5W A;  1ZPS A;  4IM2 A;  3DWM A;  3AE9 B;  4FHK A;  3NVZ A;  4H2A A;  4ZRQ A;  5DPT A;  2KAJ A;  3KYD D; 
#chains in the Genus database with same CATH homology
 3AMZ A;  4NAW B;  1NEN B;  4RFB A;  1FCL A;  3GS2 A;  1XLO A;  1JCK B;  1F2R I;  1J7A A;  4ZRP A;  3VR8 B;  2L32 A;  4US9 A;  3U52 E;  3E9S A;  4XWW A;  1L6U A;  4PT5 A;  2BB6 A;  1V97 A;  3URY A;  3P4Q B;  2H88 B;  2HDE A;  2KWD A;  1IBX B;  1F77 A;  2K3U A;  2MH7 A;  4UDU C;  2WXP A;  2QMT A;  1JWU D;  1C4C A;  5EE1 A;  2K5P A;  1EM7 A;  3ZJU A;  3MP9 A;  1T6B X;  2BS3 B;  1QQR A;  2OED A;  2LEK A;  2YEP B;  3NVV A;  3SEB A;  1D6E C;  2AQ2 B;  3NZ3 A;  5HFY A;  4KGT A;  1OQQ A;  3KQ4 A;  3AEF B;  3AEC B;  3W2D A;  2SEB D;  2WXH A;  1AYF A;  3SR6 A;  1YN4 A;  4WIP A;  1SE3 A;  1CZP A;  2NMQ A;  3SFE B;  2FE8 A;  1D5M C;  1XLQ A;  3B9J A;  4XDD A;  1P7E A;  3P1M A;  4RH6 A;  3ZJV A;  3ABV B;  3LXF A;  4YWG G;  3PO0 A;  1J7B A;  2PVO D;  4GLS C;  2BW2 A;  2I2Y A;  1FRD A;  2LHE A;  2WXM A;  3BVG A;  4OZC A;  4WAF A;  3MC0 B;  1FFU A;  2VZK D;  2N9K A;  2PKO A;  1IBX A;  2FUG 1;  1ENF A;  3EUB 2;  4US8 A;  1ZUD 2;  3I57 A;  2RDG A;  5C3J B;  2G1E A;  2OHF A;  3ETR A;  2FBW B;  2JYE A;  2WXO A;  4OVZ A;  2DLB A;  3P42 A;  1L6V A;  1UGJ A;  4TMA B;  3BZD B;  4HEA 1;  1VZ6 A;  2QSD A;  5D7G A;  2ICI A;  4RF0 A;  1TY2 A;  3W5U B;  1ZXI A;  3VR9 B;  1ZE3 D;  2KMM A;  4YXD B;  4J3O D;  3Q8B A;  1C4P A;  2PVG C;  2DBY A;  3I9V 1;  5AUI A;  5TSS A;  1VJK A;  1TYG B;  1JML A;  1VDV A;  2E6X A;  3IAM 1;  2V0G A;  1L4Z B;  2MEK A;  4ZHO A;  1V8C A;  2JSV X;  4DQO C;  2I38 A;  3GB1 A;  3NRZ A;  1K50 A;  1N61 A;  1N5X A;  3HUI A;  5EE3 A;  2IDY A;  2X38 A;  3AV8 A;  3Q8A A;  3W9C B;  2K0P A;  2JWU A;  3E56 A;  1YN3 A;  1CQV A;  4YTP B;  4KKI A;  4DXF A;  2W3R A;  2SAK A;  4R3D A;  4N6E B;  1KFY B;  3AB5 A;  4D2K A;  1B9R A;  5D3D A;  2N0S B;  1PUT A;  1BUI C;  2LGI A;  3UI3 A;  4GDK B;  4YSY B;  1YJI A;  4YSZ B;  1RWS A;  1GAQ B;  1XLP A;  1TKY A;  4A90 A;  1M4V A;  1NEK B;  1WXQ A;  4RGT A;  2WXI A;  1TS3 A;  4KGR A;  4RF1 A;  4TQ0 A;  3P4R B;  1ACC A;  3KWL A;  3VRA B;  1KF6 B;  2KN4 A;  1WYG A;  1XCT L;  1QLB B;  2QIE B;  1N63 A;  2CJN A;  1SJH D;  1ET9 A;  1C4A A;  1HXY D;  4WQM A;  3P4S B;  4WWM A;  4XE0 A;  2BS4 B;  4NJC A;  4NAM A;  2QIL A;  1DGJ A;  1YQ3 B;  1P7F A;  2AQ3 B;  3AE1 B;  1N62 A;  2WXL A;  1FNV A;  2DWQ A;  2N7J A;  3P63 A;  4USA A;  2Z8L A;  4YTN B;  2CU3 A;  1VZ7 A;  5BYR A;  1D5Z C;  2INN E;  4HKZ E;  2M19 A;  1HEZ E;  2NTT A;  2V4I B;  4P6V F;  3O13 A;  3AE4 B;  5I4D A;  3AE3 B;  1ZDX A;  4IKG A;  2GB1 A;  3T3O A;  1GOZ A;  1WSP A;  3U7Z A;  2WQY B;  3C8Y A;  5C2T B;  3TEY A;  1JWS D;  1L4D B;  4A9A A;  1XLN A;  2R61 A;  4JWU C;  1YNT E;  1SSN A;  4RCO A;  3FC4 A;  1TS2 A;  2GRI A;  1EU3 A;  1V1O A;  3CWI A;  2G9H D;  2WDV B;  1PYW D;  2AQ1 B;  2L83 A;  4AQ7 A;  3ZJT A;  4AS1 A;  1FNU A;  4A6Q A;  2DYO A;  3RPF C;  1V1P B;  2JU6 X;  2MJ3 A;  1HA5 A;  3BVZ A;  1TKE A;  2GI9 A;  5G5H A;  1L5P A;  4GDL B;  4OZB A;  4B0M A;  1I4P A;  4MH8 A;  3T3N A;  1KRH A;  1UWM A;  3AE8 B;  2WXF A;  4MT5 A;  5G5G A;  3TSS A;  2ON8 A;  1AN8 A;  4ZOH C;  1AWD A;  2PLP A;  2D5G A;  3IXS A;  1JQ4 A;  3PZ7 A;  1NVI D;  3NUH B;  1L0Y B;  1ET6 A;  1TJE A;  3AEB B;  2QJL A;  1J7C A;  1HZ5 A;  1JRO A;  1MVK A;  2M0A A;  1JRP A;  2JXT A;  2M56 B;  1I4G A;  1SEB D;  1T3Q A;  2W54 A;  4FXC A;  4L23 A;  2VZK B;  2JX5 A;  2J52 A;  3BII D;  1FNW A;  2BYT A;  3VRB B;  1QIL A;  2WU2 B;  1LO5 D;  1K52 A;  1R7S A;  5HI1 A;  1SE4 A;  3W5V B;  1N60 A;  5FKA C;  2XN9 C;  1OFF A;  1IGD A;  3AE2 B;  2W55 A;  1JWM D;  5BMI A;  3IAS 1;  1D5X C;  1E6E B;  3SFD B;  1FM0 D;  5JXV A;  1ZP0 B;  1SXT A;  1TKG A;  1GB4 A;  4ARC A;  3HRD D;  1SBB B;  4KKJ A;  1KLG D;  1WWT A;  2WLB A;  4L1B A;  2H89 B;  2EEL A;  1ZDV A;  1E10 A;  3J9C A;  2V3P A;  5BYS A;  2AX5 A;  3U2S C;  3AN1 A;  2BB5 A;  3LB8 C;  1D4B A;  2K9X A;  1L0X B;  1FMA D;  1MPE A;  2WXQ A;  1F2R C;  1XO3 A;  4HKQ A;  1DOI A;  3N9Y C;  1XXG A;  1WGK A;  2IGG A;  1PGB A;  4JX1 C;  1ROE A;  4WH4 A;  1IUE A;  4XDC A;  3IT6 B;  5GXG B;  3EA6 A;  2IPK D;  1STE A;  3KWV A;  3AE5 B;  1VZ8 A;  2WU5 B;  1YQ4 B;  1C76 A;  1CK1 A;  1SIJ A;  1ZOY B;  3BVM A;  1E7P B;  3NS1 A;  1FFV A;  2WXJ A;  1FRR A;  3AEG B;  2K22 A;  2WS3 B;  3WCQ A;  2CJO A;  1TS4 A;  2ONQ A;  2ZW1 A;  5HG2 A;  1EU4 A;  1QKZ A;  1VLB A;  3TEX A;  1JW9 D;  3BWU D;  4IDI A;  4LK0 M;  1SF0 A;  4WUR A;  3AED B;  1I4H A;  1RYJ A;  1GPX A;  1RFK A;  4HRO A;  1A70 A;  4CQN A;  3BK2 A;  4A8X C;  1MHH E;  4N58 A;  2WDR B;  5BMG A;  1KTK A;  2LMC A;  4YSX B;  2RPV A;  1NI3 A;  5H8Y E;  2WXN A;  2LUM A;  4TSS A;  1PGA A;  4RGN A;  3VQI A;  4YT0 B;  3Q8F A;  3MFG A;  4B0E A;  2J53 A;  1IGC A;  1C77 A;  2BS2 B;  3HVZ A;  1TY0 A;  1BXT A;  2XNA C;  1E9M A;  1Q10 A;  3AH7 A;  1DOX A;  4O1N A;  1MHX A;  2B76 B;  5BYQ A;  2JYT A;  1XF5 L;  2WXK A;  2N9L A;  3TEZ A;  1KLU D;  2WDQ B;  4C7Z A;  5T8I A;  2LJI A;  4OZA A;  5HHD G;  1DYQ A;  3KLS X;  1TS5 A;  1Y56 A;  2IGD A;  3DWG C;  4Q2J A;  2L52 A;  3TUO A;  3BYY B;  3FIL B;  4MM3 B;  4RNA A;  2KAC A;  1XEE A;  2PTL A;  3B2G A;  3IT4 B;  3R8B A;  2J42 A;  3Q8E A;  1PFD A;  2DYM A;  4EE2 A;  1VRA B;  3AEA B;  4TQ1 A;  1L0V B;  2HTM E;  2IGH A;  2PMV A;  4NZL B;  5AUK A;  1YMH E;  1C79 A;  1TZO A;  1HQR D;  5FR3 A;  4REZ A;  1N5W A;  2Y5C A;  2IJ0 A;  4JWS C;  1C78 A;  1QOG A;  1F0Z A;  1PGX A;  1QT9 A;  3BK1 A;  3Q69 A;  3B2F A;  1B1Z A;  2ZW0 A;  2MJE A;  4XWT A;  2KQ4 X;  1DOY A;  1FXA A;  1YJJ A;  1SE2 A;  1EWY C;  2Y5P A;  4C56 C;  3CIR B;  1JAL A;  3NVW A;  3HVD A;  1QOB A;  2INP E;  2RDH A;  4OW0 A;  1GB1 A;  5EE0 A;  5D3I B;  3AM9 A;  1C9F A;  3AE6 B;  5H92 C;  2KDM A;  2WXR A;  1OQR A;  2EKI A;  1ESF A;  3EGR A;  3FAH A;  3PZ8 A;  3ZQ4 A;  1HZ6 A;  1I7H A;  4OHJ A;  1WRI A;  1EWC A;  2V3N A;  3AEE B;  1QOA A;  2BT6 A;  3FIL A;  4M0W A;  1MI0 A;  4YTM B;  1V1P A;  2PIA A;  2E3T A;  4JE3 B;  2J4X A;  1I4R A;  4RGM A;  1UNS A;  1KH0 A;  1K53 A;  1VR9 A;  2L1A A;  2Y3A A;  4P16 A;  1I4X A;  1NYR A;  3AE7 B;  3TEW A;  1UUP A;  3R2T A;  4ZYS A;  3P4P B;  4IOI E;  1JWB D;  1YN5 A;  1T5X D;  2JQR B;  4A55 A;  4C80 A;  1SJE D;  2BBC A;  3V05 A;  4LLG M;  3RFZ B;  1QF6 A;  1PDX A;  4HJG E;  1UWX A;  1RM6 C;  4KGS A;  2LFI A;  2QEJ C;  5FK9 C;  1BML C;  3ZYY X;  5MPO A;  4ARI A;  1FXI A;  2JZP A;  4MAC A;  5LNK 1;  4RGO S;  1XCQ L;  1NYQ A;  1QOF A;  2WXG A;  3MHZ A;  3W1S A;  4C7Y A;  1FO4 A;  2W3S A;  3OWE B;  4JPS A;  3U4E G;  3R2I A;  2LHD A;  3V3X A;  4HRS A;  2Q5W D;  1I4Q A;  1ZXH A;  4DXG A;  3LYY A;  2WNM A;  2W82 A;  2NTS A;  2TSS A;  3Q8C A;  4N59 A;  4LTU A;  2YEP F;  2ACZ B;  3L4P A;  5EE9 A;  4ZHP A;  1FEH A;  1FD6 A;  1CJE A;  2WP9 B;  3ZGZ A;  2RMM A;  1FIQ A;  3GP7 A;  2MJD A;  1K51 A;  3MJ5 A;  5BMH A;  1E0Z A;  1AW7 A;  1JWA D;  4ITK A;  3H8H A;  4KX6 B;  3BYT B;  1ZPS A;  1SB3 C;  3DWM A;  3AE9 B;  3NVY A;  3NVZ A;  4H2A A;  2PW9 A;  2BTE A;  4L2Y A;  4ZRQ A;  5E6J A;  1FCC C;  2KAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...