2W9NA

Crystal structure of linear di-ubiquitin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
148
structure length
148
Chain Sequence
QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Discrimination of Structurally Equivalent Lys 63-Linked and Linear Polyubiquitin Chains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords UBIQUITIN
total genus 40
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2009-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2w9nA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2w9nA02
2FUHB 2GBMA 4ZRIA 5E6NA 2FIDA 3PGEA 4G50A 4JIOU 1PQSA 1XD3B 4RMAA 2AWTA 3RULA 4DK5A 2KDIA 2NCNA 1J19A 2I1JA 2NBUA 1Z2MA 2MX2A 3W1SA 1XT9B 4KIKA 2R2OA 2FCNA 3LJ3A 2IO0B 1V49A 2LXCA 4BKSD 3WALA 4B95A 3V6EB 3X23A 2ZCCA 1LM8B 3UIPB 4W9LA 4PYUA 3VUXA 2MRPA 2BPSA 2FNJB 2NVUI 3ZRCA 2DHZA 4GMVA 4IC7B 1KM7A 1YIWA 3QQ8B 4W9EA 1P3QU 2IO2B 2K8CA 2KXJA 2ZCBA 4NNJB 3ENEA 4WAAA 2KMCA 3VTWA 2G4SA 4HDOA 2WX1A 1WXVA 4KDLB 4GDLA 2JF5A 4I6LB 2KFKB 2N1VA 3NOBA 1BT0A 4K7WA 2DZMA 4J6IA 4A3OA 4FLHA 4EKUA 1WGYA 3H1UA 4DHJB 5HKHA 2MBOA 4MGKE 3VH3B 4W9DA 4TQ1A 1Q5WB 4F1SA 3PRPB 3KH0A 3JSVA 5AZHA 2BYEA 3EECA 2WYQA 1OGWA 3L54A 4MDKE 2O6VB 2D10A 3RCZA 3ZDMC 3NHEB 4HDQA 4K1RB 1G6JA 1J0GA 2LWPA 2LVOA 4HK2A 3APCA 2LRUA 2MSED 1WM2A 1OTRB 2BGFA 3PPAA 3WANA 4NJ7A 5D94A 4GSWA 1U4AA 2REXA 2N7DA 1WMHB 5AZFA 3VQIA 4AJWA 2KN5A 3A4SC 1E8YA 1RRBA 4ANUA 3UQAA 4GN1A 3N30A 1RLFA 2O6VA 3ZKJC 3CSFA 1WXAA 2KC2A 2OOBB 4XC2A 4EZJA 3M62B 3PT2B 5JHAA 2BYVE 2M8SA 3DVGY 4DHZB 2RR9A 2KZRA 4EFOA 3TBLD 3D32A 2BYFA 4MGYE 4W9HA 2C9WB 3KUDB 2MBHA 3PRMB 2LGDA 2UYZB 4NAWA 4FJZA 5E6OA 3VDZA 2KOXA 4EEWA 4FJVB 5DPRA 2PJHA 3SDLC 3W1SC 4MM3A 1V9JA 2DAFA 5E6PA 2N1WA 3VFKA 4XZ4A 1LQBA 4PS3A 3CSTA 3WAOA 4W9JA 4LJOB 2KX3A 1WJ4A 2CHZA 3U8ZA 3SU8X 2D07B 2JXXA 2KQSA 5AEKB 2JY6A 4XX5A 2G3QB 2RPQA 4MJSB 2KC1A 1R4MI 1IPGA 2G4DB 2EMSA 2OJRA 4HLEA 2LRWA 2MWSB 2NBWB 3APFA 3R3MA 4MGIE 3UINB 4YL8A 4A3PA 4MEMA 2O2VB 1NDDA 2J0JA 3ZNID 3DVNV 1EF1A 5CTRC 2JRIB 2LGYA 2KX0A 1WE7A 1E8WA 3A33B 4IM2A 3DCGA 2GOWA 3M3JA 3ZO5B 4RM9A 4WWPA 2N9PC 3I3TB 1J8CA 3ZRFA 3M63B 4IM3A 2KWVB 2RGFA 2O2VA 3GZNI 2ZPYA 2AL3A 1CMXB 1P1AA 4P7IA 4ZDVA 5GMVA 1S1QB 5D7GA 2KO3A 2CS4A 3KYCD 2YVCA 3SHQA 4B6WA 2IBIB 5CHWA 1V80A 3ZIMA 3WA0A 2L00B 2MA9B 3L08A 5DPSA 2KDBA 3GOEA 3IHPC 4MH0E 4TUUA 2JUOA 4NQKE 2BWFA 2J0KA 3L0WB 2K8BA 2KTFA 2WX0A 1EF5A 2L7RA 3AI5A 4AP4C 1V5OA 3NZUA 2KKCA 3CMMB 4MSQB 2KDEB 1S3SG 1V81A 2QHOA 1C1YB 3ZLZA 1HE8A 4PS8A 4DWFA 2HD5B 5JHBA 2LASA 5G55A 3DPDA 3A1QB 4IM0A 4MJSA 2AYOB 2MBBB 1WGGA 4URKA 4JLCA 3K9PB 3N32A 4HWIB 4KDIC 2L3ZA 5AZGA 5J17A 4HPLB 4GU2A 1EO6A 1E5WA 3PRZA 4ANWA 4I6NB 1WM3A 1WIAA 2V3SA 3IVFA 4BKTA 4HCPB 2I1KA 2PPHA 3A9KA 4HCNB 1KJTA 2JT4B 3KUCB 2HE7A 1KOTA 2XEWA 3O65B 4A20A 4CO7A 5C1ZA 1TGZB 1WE6A 1XQQA 5D6JB 2L0FA 3TJPA 1ZGUB 3AU4A 5BO4B 3NS8A 4JL9A 4IUMB 2BKRB 1WJ6A 2Z59B 4TQ0A 2KJHB 3ECIA 3QC8B 5JH5C 1KLVA 2ZNVB 3MHSD 2MBEA 1IP9A 1D3ZA 3PSEB 4IG7B 3EHVA 5FR6A 4JGHB 2M0XA 1OEYA 3CF6E 2J7QB 4M0WB 1H8CA 4FADA 4GDKA 2LVPA 3M95A 4HVBA 1C3TA 2DZKA 3K9OB 1I35A 1Q0WB 2W9NA 1VCBA 2BF8B 2C7HA 2K6QA 1WX8A 1SIFA 1LXDA 4K7SA 1TBEA 2KMAA 2J0MA 3UGBB 3WIMA 5L95C 1Z5SB 4AOFA 2KJ6A 2MP2B 3RD2A 1VD2A 2LGXA 1MG8A 2WWZA 3KVFB 4TV3A 3QIJA 5TR5A 3DBLI 3ZW3A 3ML9A 3B1LX 3OJ3A 1E7UA 5KHOA 3A4RA 1WXMA 1SGHA 2KJRA 2Y5BB 2MW5A 2L0TA 1V5TA 3PS6A 1UGMA 2GBRA 2JZZA 3UQBA 2GBJA 3V62A 1E90A 1WGDA 1ZKHA 4JQWC 3WAPA 3PHWB 4KSLC 2ZZPB 2LXAA 3EC8A 4DDGD 4BBNC 4CYEA 4LCDE 2K39A 5DPWA 4N9F4 1WGRA 1L7YA 1E8ZA 2Z0DB 1AARA 1WMHA 3U7DA 2IO1B 3ZNGC 4G11A 2GMIC 3OLMD 2RSUA 4GOCA 2LJ5A 3JW0X 4BKSA 1WX7A 2DYMA 2CR5A 4M8NA 3VAWA 1FXTB 2ZJDA 4W9GA 5KHQA 1M94A 4G3XB 3N3KB 4NY0A 3MTNB 4II3B 2FCSA 4NAWB 4WWNA 2M4NA 3OAWA 4IWPA 2D3GA 3HIZA 3VTUA 4OVUA 4ANVA 4WWOA 4W9FA 3IFWB 2K6DB 3H7PB 3W1YA 3DBHI 1UD7A 1LFDA 4W9KA 3KUZA 3PHXB 2MCNB 2KWUB 2ZVNA 3V60A 1WF9A 2IO3B 3NZSA 2Z0EB 3L16A 3U30A 3V6CB 2B3AA 1WRDB 2N9XA 3ZNZB 3WAMA 3AULA 3A9JA 3VXWA 2IYDB 3H7SA 4IW0A 5LXHA 1WXSA 5CHVC 3PZDA 2CHXA 3HHMA 4AJYB 3PV1A 2KLGA 1UZXB 3R66C 3V61A 2KLCA 4EUTA 3AU5A 4LJPB 4GB9A 4FA6A 3PTFC 3QCAA 3QA8A 3ML8A 4ZYNA 4KVGB 5DCNA 3VVWB 1WYWB 1T0YA 3DDCB 2G45B 2KTRB 3UIOB 3AXCA 4DBGA 4TKNA 5IAAC 4E3CA 1YD8U 2DX5B 4MELA 2WDTB 2FIFA 4E71A 4AUQC 1WZ0A 2O6VD 4W9IA 3RZFA 1WY8A 4PS7A 3DBSA 2V1YA 2DZJA 2KWCA 1UH6A 2HJ8A 3BINA 3VTVA 3TCAA 1K8RB 2CKHB 2CHWA 3IBEA 4DHJD 4HPMB 2K8HA 4EZLA 5LLIA 4BOZB 3ZVVA 2DZIA 5IA7A 4BOSC 2L8JA 2MBQA 2DENB 3L13A 4HXDA 4GDKB 2M17A 1YX6B 4FHJA 2C7MB 2XBBC 3QWZB 3DQVA 3C0RB 2KD0A 4EZKA 4KIKB 4LDTB 2JPHA 3OJ4B 1F9JA 2L05A 2IY0B 2D2QA 1H4RA 1WZ3A 2KVRA 3B08A 3TL5A 4GXBA 2ZNVC 4WQOB 2ZPNA 4IWOA 1WX9A 1NBFC 4K81A 1EUVB 1P98A 4MSMB 1L2NA 3ALBA 3HM6X 1WGHA 2UWQA 4DHZE 3VUYA 2JRHA 1WI0A 1WR1A 1GC6A 4FBJB 2LVQA 3SD5A 1I42A 1GNUA 1X1MA 4GGQA 1ZW7A 4F8CB 3TMPB 1V6EA 2MQJA 2V4LA 1YX5B 3X0WA 5EDSA 3DVGX 2A5UA 2JWZA 2LUEA 3EFUA 3PREA 4GDLB 4LDTD 4WJOA 4HJKA 2C60A 3PLVA 2JZ3B 4FJYA 3VUWA 5LXIB 1P0RA 3PLUA 2AEHA 3Q3JA 2D11A 2XK5B 2LZ6A 2ZVOA 3KW5B 2RD0A 4G0NB 1RAXA 2FCQA 2AL6A 2MLBA 3ZDTA 1RFAA 3QJZA 3RZWC 2IY1B 3JYUA 3APDA 2LD9A 2NS5A 2EMTA 5J2RA 3BY4B 4WJQA 2LI5A 2A4ZA 2GBNA 4ASWC 3T8MA 4ANXA 2MP2A 1QZEA 2XK5A 5G2NA 2IZVB 1WJUA 2EKEC 4FULA 4NJ6A 3ZTCA 4B9KA 4KV2A 2N7EA 3IG3A 3MJWA 3RYTA 2BWES 3ZNHB 3QX1A 3H7PA 2KFKA 2PE9A 4CHKA 2BKFA 2NR2A 4DXAB 4II2B 2KQ7A 2DYOA 2FAZA 5C23A 3QARA 3JSVB 4AWJA 1E7VA 3T9LA 5L83A 3R7QA 1YQBA 2DAJA 1R4NI 2KFJA 3HK0A 4MGZE 4IWQA 2KHWB 2C7NB 2KNBA 1E8XA 4KZCA 2CU1A 3B0AA 3Q3FA 2KK8A 5CX3A 4DDID 3ZTDA 1OEYJ 5DPTA 1UBIA 2L76A 3S2AA 1NI2A 1WJNA 4GIVA 4K7UA 4NPNA 4W9CA 1A5RA 1IYFA 1ISNA 2ZEQA 1GG3A 3H9DA 1WFYA 2KANA 4ZRKA 1Q1OA 2N9EB 4OVVA 4M8MA 4BKGA 1GC7A 2K1FA 4WJNA 3HM3A 5D2MB 3R7RA 1SE9A 1UBQA 3KYDD 4NQLB 2HTHA 2PEAA 4X57B 1TZ1A 4KZ0A 2PE6B 2VRRB 1V86A 1JRUA 1V2YA 2FCMA 2N4FA 3DVNU 4FHKA 4EOYA 4E74A 4F7ZA 2M1MA 4FN2A 3VH4B 3L17A 4BFRA 4ICUA 3NY5A 3ZUNA 1WR6E 4KSKC 2NBVB 1P9DU 4I6PA 3UF8A 2C5LC 3QK0A 3A9KB 3DOWA 2ASQA 4BBNF 3JVZX 3P2BA 2YLMA 1Y8RC 2KTRA 2JVCA 3H6NA 2NPTA 4ICVA 1TTNA 2K25A 3LDZE 4PYZA 3QHTA 4BVUC 2KDFB 3L10B 5CHFA 3VHTC 5JZEB 3ONSA 4ZRJA 1GUAB 1OQYA 1WH3A 4RM8A 1UELA 2GBKA 3A9JB 3DBRI 3QAQA 2DYBA 3RUIB 1GJZA 2NPTB 4WJPA 3A1QA 3TIXA 5J18A 3RT3B 3PVLA 1YJ1A 2R2QA
chains in the Genus database with same CATH superfamily
2FUHB 5E6NA 3AE7B 4G50A 1FNUA 4YTPB 3RPFC 1Z2MA 2BVCA 2R2OA 2WDVB 1SJED 4B95A 2H88B 3IXSA 3IT6B 1HTOA 1CK1A 2M56B 2BPSA 2FNJB 3B2FA 4IC7B 1YIWA 3QQ8B 1P3QU 3R2IA 1WSPA 2KXJA 4NNJB 3ENEA 4KDLB 4GDLA 2KFKB 3NOBA 4K7WA 1TS2A 1ZP0B 1FRDA 1ZUD2 1GPXA 4TQ1A 3N1XC 3AV8A 3LB8C 3EECA 2BT6A 1FPYA 3ZDMC 4K1RB 3APCA 2LRUA 2MSED 1WM2A 1OTRB 2Z8LA 5BMGA 4AJWA 2DNFA 1E8YA 4ANUA 2KC2A 4XC2A 5JHAA 4DHZB 2WXHA 2IGGA 4EFOA 1R4NB 1CQVA 2BYFA 4MGYE 3KUDB 2LGDA 3AE1B 4NAWA 4EEWA 4FJVB 5DPRA 3RNBC 3W1SC 4MM3A 2YEPF 3HUIA 4XZ4A 1J7BA 2VH2A 3IAM1 2JYTA 1WJ4A 2KT7A 1RM6C 3U8ZA 4XWWA 2KQSA 3NG0A 2G4DB 1JWBD 3W5UB 2OJRA 4HLEA 2L32A 3R3MA 3P63A 4A3PA 4YL8A 3NVWA 3ZNID 5CTRC 2KX0A 3VRAB 3A33B 3DCGA 1J8CA 3M63B 5D7GA 3Q14C 1IGDA 2YVCA 3SHQA 4B6WA 4S0RA 3WA0A 2MA9B 2MJDA 2KDBA 4MH0E 4NQKE 2K22A 2K8BA 1TIFA 2KTFA 4AP4C 1V5OA 2KKCA 1HE8A 4PS8A 2HD5B 3Q3NC 2LASA 5JHBA 3DPDA 4IM0A 2WU2B 2MBBB 4URKA 3SR6A 3AEBB 2D3CA 1ZDXA 2PW9A 2ZW1A 1WIAA 2V3SA 3IVFA 5BMIA 4HCPB 3KUCB 2RMMA 3O65B 2N9KA 3Q8CA 1WE6A 3NS8A 4BAXA 4IUMB 1WJ6A 1K51A 2ZNVB 2MBEA 5FR6A 4JGHB 1VZ8A 3TUOA 2M0XA 3CF6E 3CWIA 2WXFA 4GDKA 3M95A 1Q0WB 3AE2B 2BF8B 2K6QA 1WX8A 1ESFA 1VD2A 1MG4A 1R7SA 1HTQA 3RNGC 1V5TA 3PS6A 4C4VB 1UGMA 3UQBA 3WAPA 4JQWC 2ZZPB 3EC8A 4CYEA 4LCDE 3N1ZC 1ZE3D 3ABVB 2K39A 3NZ3A 1L7YA 1E8ZA 2Z0DB 2IO1B 1I4RA 3GE8C 1D4BA 3OLMD 4GOCA 1JWMD 2CR5A 3BYTB 4M8NA 5KHQA 1M94A 4G3XB 3AECB 3OAWA 1E7PB 3IFWB 3W1YA 1LFDA 4W9KA 3KUZA 2ACZB 3ZJVA 2ZVNA 3EA6A 2IO3B 2Z0EB 3V6CB 4RF1A 3NVYA 2I38A 3AN1A 1WRDB 3PZ8A 1F2RC 1WXSA 5CHVC 4J3OD 3HHMA 3PV1A 1N62A 2ICIA 2PVGC 2AQ1B 1UZXB 4N58A 5IOIA 2LHEA 3ML8A 4YSZB 3GB1A 4KVGB 2JXTA 3UIOB 3AXCA 3SFEB 3OWEB 1UUPA 5HFYA 3L4PA 4LNOA 4W9IA 3RZFA 2BS2B 1SXTA 2INCC 3BVZA 4DHJD 4HPMB 2PTLA 4A90A 2DZIA 2MBQA 4ZYSA 4K3BA 3H8HA 3N20C 1TKYA 2L05A 3IT4B 3TL5A 2ZNVC 3BIID 4K81A 1P98A 4MSMB 4KGRA 3SFDB 1VR9A 1WGHA 3VUYA 4FBJB 2LVQA 4GGQA 1ZW7A 3TMPB 1F77A 2V4LA 4GDLB 4R3DA 2C60A 1TY2A 2JZ3B 5LXIB 3PLUA 2RPVA 3KW5B 2RD0A 4AQ7A 3JYUA 3APDA 4L23A 3W2DA 1SE4A 1KFYB 4WJQA 1TKGA 3ZTCA 1WJUA 1TY0A 2OEDA 3H7PA 1C4AA 2PE9A 1YJIA 2BBCA 5C23A 2DYOA 3JSVB 2ONQA 3R7QA 2WDQB 1E0ZA 2KFJA 2N9LA 4Q2JA 4RGOS 5GXGB 2WXKA 2CU1A 3Q3FA 4DDID 3MC9A 1NI2A 4K7UA 1A5RA 2ZEQA 3HVDA 2WXMA 4ZRKA 2N9EB 4OVVA 2RDHA 4WJNA 2KWDA 3HM3A 2QJLA 2QEJC 3DVNU 4EOYA 4FHKA 4FN2A 2WP9B 3VH4B 4ICUA 4XE0A 4NAMA 2WXIA 5C2TB 2C5LC 1FM0D 3DOWA 3U7ZA 2V3NA 1Y8RC 1QF6A 2KTRA 4KGTA 2KDFB 3L10B 3VHTC 1GUAB 1GJZA 5FR3A 3DBRI 3BZDB 3RUIB 2J52A 3J9CA 3PVLA 2R2QA 2GBMA 2FIDA 4P1BC 4JIOU 1AN8A 1XD3B 4RMAA 4OZCA 1DGJA 2NBUA 4LNNA 4WAFA 2MX2A 3W1SA 4KIKA 2FCNA 5AUIA 3ETRA 3WALA 1EWYC 2W3RA 1LM8B 2M0AA 2L83A 3UIPB 5C3JB 3R8BA 1KM7A 4W9EA 1VLBA 4ZRQA 2V9HA 1J7CA 2KMCA 2G4SA 2WX1A 4I6LB 2N1VA 5AUKA 4A3OA 3AM9A 1WGYA 1N60A 3EGRA 2IGHA 4MGKE 1IGCA 1ZPSA 3VH3B 1M4VA 2CJNA 1PDXA 2V3PA 4MT5A 4F1SA 3PRPB 2MEKA 3KH0A 3JSVA 5AZHA 1MHHE 2BYEA 2J53A 2WYQA 3ZXRA 3NHEB 4HDQA 2DWQA 2LVOA 4HK2A 4XDCA 3PPAA 4NJ7A 1TT5B 1OQRA 2BQQA 4UDUC 4HROA 4C56C 3UQAA 1ZXHA 4GN1A 3N30A 1RLFA 3ZKJC 3U52E 2RDBC 2W54A 3DVGY 1QILA 3AEGB 2LGSA 3E9SA 4W9HA 3PRMB 2UYZB 5E6OA 3SDLC 2N1WA 1SB3C 3PO0A 1YOVB 2JXXA 5AEKB 4RCOA 2JY6A 4XX5A 2PMVA 2WLBA 1QOGA 1T5XD 3B2GA 2LRWA 3APFA 3BYYB 3UINB 2O2VB 2JRIB 4XGAB 3Q3MC 4OW0A 1E8WA 4IM2A 2PLPA 3M3JA 3ZO5B 4WWPA 4B0MA 2WXLA 3FKYA 3DHGC 4P7IA 1CMXB 1P1AA 3B9JA 3KYCD 2IBIB 5CHWA 3ZIMA 2L00B 3GOEA 3I63C 2JUOA 2L7RA 3AI5A 3CMMB 1ROEA 2KDEB 1S3SG 2QHOA 1C1YB 2LFIA 4S17A 3VRBB 4JX1C 2L3ZA 4HPLB 1TS3A 2WXRA 3KWVA 1NI3A 1E5WA 3PRZA 4I6NB 1WM3A 1HXYD 4IKGA 3A9KA 4HCNB 4ZOHC 1KJTA 2LJIA 1KOTA 4ARCA 4M0WA 3TJPA 5BYSA 2BKRB 1DOIA 4TQ0A 1JQ4A 5JH5C 1NEKB 3PSEB 1NYRA 1FNVA 1XLOA 3DBRB 1J7AA 3AE8B 2W55A 3AE6B 2ZW0A 1WYGA 4JE3B 2KVZA 4M02A 2LVPA 1PFDA 1C3TA 4ZHOA 1FXIA 3K9OB 4HKZE 4BZAA 1TBEA 1BXTA 1Z5SB 2SEBD 3KVFB 2WWZA 5TR5A 3QIJA 3ZW3A 5D3DA 3ML9A 5KHOA 1C76A 1MVKA 2MW5A 2H89B 2UU7A 2GBJA 3V62A 1PGXA 3PHWB 2LXAA 2D3BA 3O13A 4DXGA 1SEBD 1P7EA 1AARA 1WMHA 4G11A 1EU3A 3ZJUA 1NENB 1FXTB 4W9GA 5HI1A 4NY0A 3N3KB 3MTNB 1LGRA 1OQQA 4WWNA 2M4NA 2D3GA 3VTUA 4WWOA 4W9FA 3PZ7A 3ZGZA 2HDEA 1UD7A 1FFUA 3PHXB 5IKCM 1WF9A 1A70A 3U30A 2W82A 4A6QA 4A55A 4C80A 2EKIA 3ZNZB 3AULA 3A9JA 1QOBA 3H7SA 4IW0A 3WCQA 5LXHA 2E6XA 3PZDA 2CHXA 3Q8EA 4AJYB 2NTSA 2KLGA 2DBYA 4YTNB 3R66C 3AU5A 4RH6A 3QCAA 5DCNA 1WYWB 2KTRB 4DBGA 2WXNA 4E3CA 2DX5B 1AWDA 2WDTB 1I4QA 1QQRA 1WZ0A 2AQ2B 3NUHB 3AEFB 1L6VA 2DZJA 2KWCA 1UH6A 3IBEA 2K8HA 1P7FA 3ZVVA 5IA7A 2JWUA 2L8JA 1K53A 1OFFA 3L13A 4HXDA 4GDKB 2M17A 1YX6B 2PKOA 2WQYB 3Q2AC 1KF6B 3DQVA 2WXOA 4KIKB 2JPHA 3OJ4B 1RYJA 2IY0B 2D2QA 1GB4A 2LGIA 1WZ3A 3B08A 4GXBA 4IWOA 4YSYB 1WX9A 3DWGC 3ALBA 1B9RA 4DHZE 1VJKA 2JRHA 1WR1A 1GC6A 4IOIE 3ZJTA 2MQJA 2KAJA 2DLBA 5IN7A 4LDTD 2JWZA 1MJDA 2TSSA 1V97A 3RNCC 3DBHB 3I5JC 1P0RA 3Q3JA 2YEPB 4RF0A 1T3QA 2LZ6A 2AL6A 3ZDTA 4QAYA 2IY1B 2MHJA 3HVZA 2NS5A 5J2RA 1JW9D 2LI5A 4ASWC 3T8MA 2MP2A 1QZEA 1N6ZA 1C79A 2EKEC 2IZVB 1E9MA 3AE9B 3RYTA 2BWES 3QX1A 3DBLB 2KMMA 4CHKA 1DOYA 1D5XC 2IPKD 1FFVA 1L0YB 4OZAA 4NZLB 2DAJA 2QCZA 2JSVX 3HK0A 1TS5A 3IAS1 1UBIA 1WJNA 4GIVA 1YNTE 1IYFA 5G5HA 3MHZA 1E6EB 1GC7A 4NQLB 3Q8BA 2HTHA 2PEAA 4KZ0A 1V86A 1V2YA 2FCMA 2N4FA 2KDMA 2M1MA 4BFRA 3HRDD 3EFCA 3NY5A 2QDFA 4C7YA 1FD6A 3C8YA 3UF8A 1SIJA 3QK0A 4DXFA 2LHDA 3MC8A 3VR9B 3JVZX 2J4XA 3H6NA 2NPTA 2K25A 2XN9C 1JROA 4JWUC 3BK2A 4ZRJA 1OQYA 1WH3A 4RM8A 1DYQA 1UELA 3AEEB 4WJPA 3RT3B 4NJCA 2WXPA 3ZXVA 5LNK1 4ZRIA 3PGEA 4M01A 1PQSA 3RULA 4DK5A 2NCNA 1J19A 1XT9B 3LJ3A 1V49A 3R2TA 2LXCA 4BKSD 4N6EB 1HA5A 1R4MB 1AYFA 1N61A 3V6EB 2JQRB 2V4IB 4W9LA 2BYTA 5HG2A 2MRPA 3ZRCA 4GMVA 2IO2B 2K8CA 1AW7A 2ZCBA 4WAAA 3VTWA 1ZOYB 1WXVA 1UGJA 2JF5A 1GAQB 4J6IA 2INNE 2DZMA 4EKUA 4FLHA 2VZKD 3H1UA 4DHJB 2MBOA 3N9YC 1GB1A 1C77A 4OZBA 1PGAA 4MDKE 3L54A 2O6VB 2D10A 2GLSA 4YWGG 1G6JA 1HZ5A 2LWPA 3V3XA 1VDVA 2HTME 4GSWA 1U4AA 5D94A 2N7DA 3A4SC 2BTEA 4RFBA 4WIPA 1YN5A 3CSFA 2OOBB 4EZJA 3ZQ4A 3RFZB 3TEZA 2WS3B 3I9V1 3E56A 2WGSA 2RR9A 2JU6X 2K9XA 3TBLD 3BVGA 1SE2A 4FJZA 2BW2A 2DAFA 3GS2A 3CSTA 3WAOA 4LJOB 2KX3A 1I4GA 1TYGB 2CHZA 3SU8X 2D07B 5T8IA 1YMHE 2G3QB 4DQOC 4LTUA 1R4MI 1UNSA 1IPGA 2KC1A 4WQMA 2MWSB 2NBWB 1NDDA 4HEA1 4LK0M 4A9AA 3DVNV 1EF1A 2XNAC 1TJEA 5I4DA 1WE7A 2MJEA 4RM9A 1ZXIA 3N1YC 1JWSD 2N9PC 2O2VA 2AL3A 4ZDVA 5GMVA 3TSSA 4US8A 1JWAD 1V80A 1CJEA 4C7ZA 4YTMB 1V1PA 3IHPC 4TUUA 2J0KA 1FIQA 1FCCC 1MPEA 3NZUA 3P4SB 1L4ZB 3ZLZA 5G55A 4MJSA 2AYOB 3K9PB 2MH7A 4EE2A 2B76B 5AZGA 5J17A 3RNEC 4ANWA 4BKTA 3T3NA 2PPHA 2JT4B 2XEWA 4CO7A 5C1ZA 1EM7A 5BO4B 4JL9A 4KKIA 2KJHB 3QC8B 3MHSD 3RNFC 2J7QB 1T0RC 4M0WB 1T6BX 1XLNA 4LLGM 3Q6BA 3W5VB 4HVBA 2DZKA 1E10A 5EE3A 2W9NA 3RNAC 1SIFA 4K7SA 2KMAA 1JRPA 3UGBB 5L95C 1ACCA 3DHHC 2KJ6A 2R61A 3T3OA 4C4VA 3I57A 3DBLI 5FKAC 1BMLC 3B1LX 1WXMA 4JWSC 2KJRA 2JYEA 2WHIA 4K3CA 1ZKHA 1T0QC 2AQ3B 4KSLC 5DPWA 3U7DA 5FK9C 2RSUA 3BVMA 4BKSA 1WX7A 4PT5A 1XLQA 3VAWA 1V8CA 3HIZA 1EWCA 4KGSA 2MCNB 3KWLA 3NZSA 3L16A 5E6JA 3FC4A 2EELA 4P16A 1YN4A 3VXWA 1IBXA 2IYDB 2WXJA 4LNKA 4ACFA 2M19A 4KKJA 2KLCA 4EUTA 4YXDB 2VH1A 4LJPB 4GB9A 3PTFC 4ZYNA 1FEHA 4XDDA 1T0YA 2J42A 3DDCB 1K52A 1BUIC 5IAAC 1QLBB 4MELA 2FIFA 4E71A 1D6EC 1WY8A 4PS7A 3MP9A 2V1YA 1DOXA 3FILB 3TCAA 1K8RB 2CKHB 1D5MC 2PVOD 1KLUD 2QMTA 3DHIC 5BYQA 4EZLA 5LLIA 4CQNA 1RFKA 4MH8A 4BOSC 3Q69A 3W9CB 4MACA 2C7MB 1ET6A 3QWZB 3C0RB 2KD0A 3RI7C 1XF5L 1YJJA 1L6UA 3V05A 4WQOB 1KTKA 3HM6X 1HQRD 4ZRPA 3UI3A 1X1MA 1L4DB 1YX5B 5EDSA 1L0VB 2A5UA 2LUEA 2IJ0A 3PREA 4HJKA 3PLVA 2G1EA 3SEBA 2AEHA 3P4PB 2XK5B 2ZVOA 2FCQA 2MLBA 1PYWD 1JALA 1EU4A 1KH0A 2JZPA 2EMTA 2E3TA 2Y5CA 3BY4B 2FBWB 2A4ZA 5MPOA 3RMKC 2GBNA 1TS4A 5G2NA 1QT9A 4FULA 1T0SC 4KV2A 2N7EA 3MJWA 3ZNHB 2KFKA 5EE0A 2ON8A 1CZPA 4II2B 5IO9A 2KQ7A 3NRZA 3QARA 1E7VA 3T9LA 2OJWA 2KHWB 2KNBA 1B1ZA 1E8XA 5CX3A 3P4QB 4RNAA 5DPTA 2L76A 4RGTA 4W9CA 1WGKA 3H9DA 1WFYA 2KANA 5D2MB 3R7RA 2GRIA 4X57B 3URYA 2AX5A 1SF0A 2VRRB 1JRUA 2G9HD 2JX5A 2WXGA 3RN9C 4E74A 4KX6B 3ZUNA 1F0ZA 1WR6E 1JWUD 4KSKC 1MI0A 3FILA 1N5WA 1SE3A 1P9DU 1F52A 1MHXA 1YQ4B 1I7HA 1N5XA 2JVCA 4A8XC 4ICVA 4PK1A 2L1AA 3LDZE 4BVUC 2X38A 2WU5B 5CHFA 5JZEB 3ONSA 2GBKA 3A9JB 2DYBA 2LUMA 3TIXA 5J18A 3P1MA 2PJHA 1YJ1A 3AE4B 1ZDVA 1IUEA 4TSSA 2AWTA 2W3SA 2KDIA 2I1JA 2IO0B 3Q8AA 4YT0B 3X23A 1STEA 2ZCCA 1XLPA 2K3UA 4PYUA 3VUXA 4IDIA 2NVUI 2DHZA 2FUG1 5G5GA 2QC8A 2KYWA 3AEDB 4HDOA 1I4PA 3P42A 1BT0A 2OHFA 2QILA 4WWMA 5JXVA 1VZ6A 5HKHA 4HRSA 4W9DA 4JPSA 1C4CA 1Q5WB 3TEXA 2KQ4X 4AS1A 3MJ5A 1OGWA 3RCZA 2INDC 1J0GA 3DWMA 5D3IB 2BGFA 3LXFA 3WANA 5AZFA 2REXA 3VQIA 1WMHB 2X8XX 2D5GA 2KN5A 1RRBA 2O6VA 1WXAA 3M62B 3PT2B 2WNMA 5BMHA 4OVZA 2BYVE 2M8SA 2KZRA 1MFWA 3MFGA 3D32A 3AE3B 2C9WB 3VDZA 1I4HA 2MBHA 4XYCA 5EE9A 2KOXA 3Q3OC 2PIAA 3AH7A 1V9JA 1XCQL 2L52A 5E6PA 3VFKA 1LQBA 4PS3A 2I2YA 2SAKA 4W9JA 2WDRB 3TEYA 2RPQA 4MJSB 2EMSA 2IDYA 4USAA 4WH4A 4OHJA 4MGIE 1L0XB 4MEMA 2J0JA 1WXQA 2LGYA 3GE3C 2GOWA 3I3TB 3BWUD 3ZRFA 4ARIA 1XCTL 4IM3A 2KWVB 2NTTA 2RDGA 2CJOA 2RGFA 3GZNI 2ZPYA 1S1QB 2KO3A 2CS4A 3CIRB 3L08A 1HEZE 5DPSA 2BWFA 3L0WB 2WX0A 4YSXB 3NVZA 1EF5A 4FXCA 4MSQB 4WURA 5TSSA 1V81A 4DWFA 2LEKA 3A1QB 2MJ3A 4LNIA 1WGGA 4JLCA 3N32A 4HWIB 4KDIC 2Y5PA 3AMZA 4GU2A 1EO6A 1VZ7A 2I1KA 1SJHD 4US9A 2HE7A 4A20A 1TGZB 1XQQA 5D6JB 2L0FA 1ZGUB 3AU4A 1N63A 2Z59B 3ECIA 2V0GA 1KLVA 1IP9A 1D3ZA 4IG7B 4P6VF 3EHVA 4XWTA 4RGNA 4B0EA 1OEYA 1KLGD 1PUTA 3AE5B 1H8CA 4FADA 1I35A 1VCBA 2C7HA 1LXDA 2QIEB 2J0MA 3WIMA 4AOFA 1QKZA 2MP2B 3RD2A 2LGXA 1MG8A 4TV3A 4HPPA 3OJ3A 1E7UA 3A4RA 5BYRA 1SGHA 2Y5BB 2L0TA 1FRRA 2FE8A 2N7JA 2GBRA 2JZZA 3NS1A 1E90A 1WGDA 3AB5A 2BB6A 4DDGD 4BBNC 4L2YA 4N9F4 1WGRA 3ZNGC 3ZYYX 2GMIC 3NJTA 2LJ5A 3JW0X 2DYMA 2ZJDA 1C4PA 4II3B 2FCSA 2VZKB 2INPE 4NAWB 4IWPA 4ANVA 4OVUA 3LYYA 2K6DB 3H7PB 4MM3B 3DBHI 2IGDA 3KQ4A 3VR8B 2KWUB 3V60A 2B3AA 1ENFA 1FNWA 2N9XA 1TKEA 1F1HA 3WAMA 4L1BA 3U4EG 3V61A 1XXGA 4FA6A 1SSNA 3QA8A 2NMQA 3VVWB 2K5PA 1C9FA 1L5PA 2G45B 3TEWA 2QSDA 4TKNA 1YD8U 1RWSA 1K50A 3P4RB 1XO3A 4AUQC 2LMCA 2O6VD 3OG5A 1FXAA 3DBSA 1UWXA 3BINA 2HJ8A 4M00A 3VTVA 1FMAD 2CHWA 4HKQA 4BOZB 4O1NA 2DENB 4TMAB 1GOZA 2GB1A 4FHJA 2XBBC 1JCKB 4EZKA 4LDTB 1HZ6A 3U2SC 1F9JA 2BS3B 3BK1A 1H4RA 2KVRA 2ZPNA 1V1PB 3GZNB 1NBFC 1EUVB 1L2NA 3FAHA 2UWQA 5H92C 1WI0A 2KACA 3SD5A 1I42A 1GNUA 4F8CB 1V6EA 1YN3A 1D5ZC 3X0WA 3DVGX 3Q8FA 1Q10A 3EFUA 4WJOA 3NVVA 3EUB2 4FJYA 3VUWA 2D11A 2WXQA 1QOFA 1UWMA 2BS4B 1KRHA 4G0NB 1RAXA 1RFAA 3QJZA 3RZWC 1UF0A 2LD9A 3C19A 5IP4D 1V1OA 4ANXA 2BB5A 2XK5A 4NJ6A 1FCLA 1F2RI 4B9KA 3IG3A 1YQ3B 1WWTA 1PGBA 1VRAB 2BKFA 1C78A 2NR2A 4DXAB 2K0PA 2FAZA 1TZOA 4C00A 3KLSX 4AWJA 5L83A 1YQBA 1R4NI 1IBXB 1QOAA 4MGZE 2N0SB 4IWQA 1NYQA 2C7NB 4KZCA 4RGMA 1SBBB 3B0AA 2KK8A 3ZTDA 1OEYJ 2D3AA 3S2AA 4NPNA 1FO4A 1ISNA 2Y3AA 4N59A 1GG3A 4LNFA 3MC0B 4GLSC 1Q1OA 4M8MA 4BKGA 2K1FA 4H2AA 1SE9A 1UBQA 3KYDD 4D2KA 1TZ1A 2PE6B 4F7ZA 5EE1A 3L17A 3AEAB 2Q5WD 2GI9A 4REZA 4ITKA 2NBVB 4I6PA 5HHDG 3A9KB 2ASQA 5H8YE 4BBNF 3P2BA 1XEEA 2YLMA 1NVID 2HJ1A 4HJGE 1TTNA 2KN4A 4PYZA 1ET9A 3QHTA 4ZHPA 1LO5D 3QAQA 2NPTB 2CU3A 3A1QA 1I4XA 1JMLA 4P1CC 1Y56A 3GP7A 1WRIA
chains in the Genus database with same CATH topology
2FUHB 2GBMA 4ZRIA 5E6NA 2FIDA 3PGEA 4G50A 4JIOU 1PQSA 1XD3B 4RMAA 2AWTA 3RULA 4DK5A 2KDIA 2NCNA 1J19A 2I1JA 2NBUA 1Z2MA 2MX2A 3W1SA 1XT9B 4KIKA 2R2OA 2FCNA 3LJ3A 2IO0B 1V49A 2LXCA 4BKSD 3WALA 4B95A 3V6EB 3X23A 2ZCCA 1LM8B 3UIPB 4W9LA 4PYUA 3VUXA 2MRPA 2BPSA 2FNJB 2NVUI 3ZRCA 2DHZA 4GMVA 4IC7B 1KM7A 1YIWA 3QQ8B 4W9EA 1P3QU 2IO2B 2K8CA 2KXJA 2ZCBA 4NNJB 3ENEA 4WAAA 2KMCA 3VTWA 2G4SA 4HDOA 2WX1A 1WXVA 4KDLB 4GDLA 2JF5A 4I6LB 2KFKB 2N1VA 3NOBA 1BT0A 4K7WA 2DZMA 4J6IA 4A3OA 4FLHA 4EKUA 1WGYA 3H1UA 4DHJB 5HKHA 2MBOA 4MGKE 3VH3B 4W9DA 4TQ1A 1Q5WB 4F1SA 3PRPB 3KH0A 3JSVA 5AZHA 2BYEA 3EECA 2WYQA 1OGWA 3L54A 4MDKE 2O6VB 2D10A 3RCZA 3ZDMC 3NHEB 4HDQA 4K1RB 1G6JA 1J0GA 2LWPA 2LVOA 4HK2A 3APCA 2LRUA 2MSED 1WM2A 1OTRB 2BGFA 3PPAA 3WANA 4NJ7A 5D94A 4GSWA 1U4AA 2REXA 2N7DA 1WMHB 5AZFA 3VQIA 4AJWA 2KN5A 3A4SC 1E8YA 1RRBA 4ANUA 3UQAA 4GN1A 3N30A 1RLFA 2O6VA 3ZKJC 3CSFA 1WXAA 2KC2A 2OOBB 4XC2A 4EZJA 3M62B 3PT2B 5JHAA 2BYVE 2M8SA 3DVGY 4DHZB 2RR9A 2KZRA 4EFOA 3TBLD 3D32A 2BYFA 4MGYE 4W9HA 2C9WB 3KUDB 2MBHA 3PRMB 2LGDA 2UYZB 4NAWA 4FJZA 5E6OA 3VDZA 2KOXA 4EEWA 4FJVB 5DPRA 2PJHA 3SDLC 3W1SC 4MM3A 1V9JA 2DAFA 5E6PA 2N1WA 3VFKA 4XZ4A 1LQBA 4PS3A 3CSTA 3WAOA 4W9JA 4LJOB 2KX3A 1WJ4A 2CHZA 3U8ZA 3SU8X 2D07B 2JXXA 2KQSA 5AEKB 2JY6A 4XX5A 2G3QB 2RPQA 4MJSB 2KC1A 1R4MI 1IPGA 2G4DB 2EMSA 2OJRA 4HLEA 2LRWA 2MWSB 2NBWB 3APFA 3R3MA 4MGIE 3UINB 4YL8A 4A3PA 4MEMA 2O2VB 1NDDA 2J0JA 3ZNID 3DVNV 1EF1A 5CTRC 2JRIB 2LGYA 2KX0A 1WE7A 1E8WA 3A33B 4IM2A 3DCGA 2GOWA 3M3JA 3ZO5B 4RM9A 4WWPA 2N9PC 3I3TB 1J8CA 3ZRFA 3M63B 4IM3A 2KWVB 2RGFA 2O2VA 3GZNI 2ZPYA 2AL3A 1CMXB 1P1AA 4P7IA 4ZDVA 5GMVA 1S1QB 5D7GA 2KO3A 2CS4A 3KYCD 2YVCA 3SHQA 4B6WA 2IBIB 5CHWA 1V80A 3ZIMA 3WA0A 2L00B 2MA9B 3L08A 5DPSA 2KDBA 3GOEA 3IHPC 4MH0E 4TUUA 2JUOA 4NQKE 2BWFA 2J0KA 3L0WB 2K8BA 2KTFA 2WX0A 1EF5A 2L7RA 3AI5A 4AP4C 1V5OA 3NZUA 2KKCA 3CMMB 4MSQB 2KDEB 1S3SG 1V81A 2QHOA 1C1YB 3ZLZA 1HE8A 4PS8A 4DWFA 2HD5B 5JHBA 2LASA 5G55A 3DPDA 3A1QB 4IM0A 4MJSA 2AYOB 2MBBB 1WGGA 4URKA 4JLCA 3K9PB 3N32A 4HWIB 4KDIC 2L3ZA 5AZGA 5J17A 4HPLB 4GU2A 1EO6A 1E5WA 3PRZA 4ANWA 4I6NB 1WM3A 1WIAA 2V3SA 3IVFA 4BKTA 4HCPB 2I1KA 2PPHA 3A9KA 4HCNB 1KJTA 2JT4B 3KUCB 2HE7A 1KOTA 2XEWA 3O65B 4A20A 4CO7A 5C1ZA 1TGZB 1WE6A 1XQQA 5D6JB 2L0FA 3TJPA 1ZGUB 3AU4A 5BO4B 3NS8A 4JL9A 4IUMB 2BKRB 1WJ6A 2Z59B 4TQ0A 2KJHB 3ECIA 3QC8B 5JH5C 1KLVA 2ZNVB 3MHSD 2MBEA 1IP9A 1D3ZA 3PSEB 4IG7B 3EHVA 5FR6A 4JGHB 2M0XA 1OEYA 3CF6E 2J7QB 4M0WB 1H8CA 4FADA 4GDKA 2LVPA 3M95A 4HVBA 1C3TA 2DZKA 3K9OB 1I35A 1Q0WB 2W9NA 1VCBA 2BF8B 2C7HA 2K6QA 1WX8A 1SIFA 1LXDA 4K7SA 1TBEA 2KMAA 2J0MA 3UGBB 3WIMA 5L95C 1Z5SB 4AOFA 2KJ6A 2MP2B 3RD2A 1VD2A 2LGXA 1MG8A 2WWZA 3KVFB 4TV3A 3QIJA 5TR5A 3DBLI 3ZW3A 3ML9A 3B1LX 3OJ3A 1E7UA 5KHOA 3A4RA 1WXMA 1SGHA 2KJRA 2Y5BB 2MW5A 2L0TA 1V5TA 3PS6A 1UGMA 2GBRA 2JZZA 3UQBA 2GBJA 3V62A 1E90A 1WGDA 1ZKHA 4JQWC 3WAPA 3PHWB 4KSLC 2ZZPB 2LXAA 3EC8A 4DDGD 4BBNC 4CYEA 4LCDE 2K39A 5DPWA 4N9F4 1WGRA 1L7YA 1E8ZA 2Z0DB 1AARA 1WMHA 3U7DA 2IO1B 3ZNGC 4G11A 2GMIC 3OLMD 2RSUA 4GOCA 2LJ5A 3JW0X 4BKSA 1WX7A 2DYMA 2CR5A 4M8NA 3VAWA 1FXTB 2ZJDA 4W9GA 5KHQA 1M94A 4G3XB 3N3KB 4NY0A 3MTNB 4II3B 2FCSA 4NAWB 4WWNA 2M4NA 3OAWA 4IWPA 2D3GA 3HIZA 3VTUA 4OVUA 4ANVA 4WWOA 4W9FA 3IFWB 2K6DB 3H7PB 3W1YA 3DBHI 1UD7A 1LFDA 4W9KA 3KUZA 3PHXB 2MCNB 2KWUB 2ZVNA 3V60A 1WF9A 2IO3B 3NZSA 2Z0EB 3L16A 3U30A 3V6CB 2B3AA 1WRDB 2N9XA 3ZNZB 3WAMA 3AULA 3A9JA 3VXWA 2IYDB 3H7SA 4IW0A 5LXHA 1WXSA 5CHVC 3PZDA 2CHXA 3HHMA 4AJYB 3PV1A 2KLGA 1UZXB 3R66C 3V61A 2KLCA 4EUTA 3AU5A 4LJPB 4GB9A 4FA6A 3PTFC 3QCAA 3QA8A 3ML8A 4ZYNA 4KVGB 5DCNA 3VVWB 1WYWB 1T0YA 3DDCB 2G45B 2KTRB 3UIOB 3AXCA 4DBGA 4TKNA 5IAAC 4E3CA 1YD8U 2DX5B 4MELA 2WDTB 2FIFA 4E71A 4AUQC 1WZ0A 2O6VD 4W9IA 3RZFA 1WY8A 4PS7A 3DBSA 2V1YA 2DZJA 2KWCA 1UH6A 2HJ8A 3BINA 3VTVA 3TCAA 1K8RB 2CKHB 2CHWA 3IBEA 4DHJD 4HPMB 2K8HA 4EZLA 5LLIA 4BOZB 3ZVVA 2DZIA 5IA7A 4BOSC 2L8JA 2MBQA 2DENB 3L13A 4HXDA 4GDKB 2M17A 1YX6B 4FHJA 2C7MB 2XBBC 3QWZB 3DQVA 3C0RB 2KD0A 4EZKA 4KIKB 4LDTB 2JPHA 3OJ4B 1F9JA 2L05A 2IY0B 2D2QA 1H4RA 1WZ3A 2KVRA 3B08A 3TL5A 4GXBA 2ZNVC 4WQOB 2ZPNA 4IWOA 1WX9A 1NBFC 4K81A 1EUVB 1P98A 4MSMB 1L2NA 3ALBA 3HM6X 1WGHA 2UWQA 4DHZE 3VUYA 2JRHA 1WI0A 1WR1A 1GC6A 4FBJB 2LVQA 3SD5A 1I42A 1GNUA 1X1MA 4GGQA 1ZW7A 4F8CB 3TMPB 1V6EA 2MQJA 2V4LA 1YX5B 3X0WA 5EDSA 3DVGX 2A5UA 2JWZA 2LUEA 3EFUA 3PREA 4GDLB 4LDTD 4WJOA 4HJKA 2C60A 3PLVA 2JZ3B 4FJYA 3VUWA 5LXIB 1P0RA 3PLUA 2AEHA 3Q3JA 2D11A 2XK5B 2LZ6A 2ZVOA 3KW5B 2RD0A 4G0NB 1RAXA 2FCQA 2AL6A 2MLBA 3ZDTA 1RFAA 3QJZA 3RZWC 2IY1B 3JYUA 3APDA 2LD9A 2NS5A 2EMTA 5J2RA 3BY4B 4WJQA 2LI5A 2A4ZA 2GBNA 4ASWC 3T8MA 4ANXA 2MP2A 1QZEA 2XK5A 5G2NA 2IZVB 1WJUA 2EKEC 4FULA 4NJ6A 3ZTCA 4B9KA 4KV2A 2N7EA 3IG3A 3MJWA 3RYTA 2BWES 3ZNHB 3QX1A 3H7PA 2KFKA 2PE9A 4CHKA 2BKFA 2NR2A 4DXAB 4II2B 2KQ7A 2DYOA 2FAZA 5C23A 3QARA 3JSVB 4AWJA 1E7VA 3T9LA 5L83A 3R7QA 1YQBA 2DAJA 1R4NI 2KFJA 3HK0A 4MGZE 4IWQA 2KHWB 2C7NB 2KNBA 1E8XA 4KZCA 2CU1A 3B0AA 3Q3FA 2KK8A 5CX3A 4DDID 3ZTDA 1OEYJ 5DPTA 1UBIA 2L76A 3S2AA 1NI2A 1WJNA 4GIVA 4K7UA 4NPNA 4W9CA 1A5RA 1IYFA 1ISNA 2ZEQA 1GG3A 3H9DA 1WFYA 2KANA 4ZRKA 1Q1OA 2N9EB 4OVVA 4M8MA 4BKGA 1GC7A 2K1FA 4WJNA 3HM3A 5D2MB 3R7RA 1SE9A 1UBQA 3KYDD 4NQLB 2HTHA 2PEAA 4X57B 1TZ1A 4KZ0A 2PE6B 2VRRB 1V86A 1JRUA 1V2YA 2FCMA 2N4FA 3DVNU 4FHKA 4EOYA 4E74A 4F7ZA 2M1MA 4FN2A 3VH4B 3L17A 4BFRA 4ICUA 3NY5A 3ZUNA 1WR6E 4KSKC 2NBVB 1P9DU 4I6PA 3UF8A 2C5LC 3QK0A 3A9KB 3DOWA 2ASQA 4BBNF 3JVZX 3P2BA 2YLMA 1Y8RC 2KTRA 2JVCA 3H6NA 2NPTA 4ICVA 1TTNA 2K25A 3LDZE 4PYZA 3QHTA 4BVUC 2KDFB 3L10B 5CHFA 3VHTC 5JZEB 3ONSA 4ZRJA 1GUAB 1OQYA 1WH3A 4RM8A 1UELA 2GBKA 3A9JB 3DBRI 3QAQA 2DYBA 3RUIB 1GJZA 2NPTB 4WJPA 3A1QA 3TIXA 5J18A 3RT3B 3PVLA 1YJ1A 2R2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FUH B;  2GBM A;  4ZRI A;  5E6N A;  2FID A;  3PGE A;  4G50 A;  4JIO U;  1PQS A;  1XD3 B;  4RMA A;  2AWT A;  3RUL A;  4DK5 A;  2KDI A;  2NCN A;  1J19 A;  2I1J A;  2NBU A;  1Z2M A;  2MX2 A;  3W1S A;  1XT9 B;  4KIK A;  2R2O A;  2FCN A;  3LJ3 A;  2IO0 B;  1V49 A;  2LXC A;  4BKS D;  3WAL A;  4B95 A;  3V6E B;  3X23 A;  2ZCC A;  1LM8 B;  3UIP B;  4W9L A;  4PYU A;  3VUX A;  2MRP A;  2BPS A;  2FNJ B;  2NVU I;  3ZRC A;  2DHZ A;  4GMV A;  4IC7 B;  1KM7 A;  1YIW A;  3QQ8 B;  4W9E A;  1P3Q U;  2IO2 B;  2K8C A;  2KXJ A;  2ZCB A;  4NNJ B;  3ENE A;  4WAA A;  2KMC A;  3VTW A;  2G4S A;  4HDO A;  2WX1 A;  1WXV A;  4KDL B;  4GDL A;  2JF5 A;  4I6L B;  2KFK B;  2N1V A;  3NOB A;  1BT0 A;  4K7W A;  2DZM A;  4J6I A;  4A3O A;  4FLH A;  4EKU A;  1WGY A;  3H1U A;  4DHJ B;  5HKH A;  2MBO A;  4MGK E;  3VH3 B;  4W9D A;  4TQ1 A;  1Q5W B;  4F1S A;  3PRP B;  3KH0 A;  3JSV A;  5AZH A;  2BYE A;  3EEC A;  2WYQ A;  1OGW A;  3L54 A;  4MDK E;  2O6V B;  2D10 A;  3RCZ A;  3ZDM C;  3NHE B;  4HDQ A;  4K1R B;  1G6J A;  1J0G A;  2LWP A;  2LVO A;  4HK2 A;  3APC A;  2LRU A;  2MSE D;  1WM2 A;  1OTR B;  2BGF A;  3PPA A;  3WAN A;  4NJ7 A;  5D94 A;  4GSW A;  1U4A A;  2REX A;  2N7D A;  1WMH B;  5AZF A;  3VQI A;  4AJW A;  2KN5 A;  3A4S C;  1E8Y A;  1RRB A;  4ANU A;  3UQA A;  4GN1 A;  3N30 A;  1RLF A;  2O6V A;  3ZKJ C;  3CSF A;  1WXA A;  2KC2 A;  2OOB B;  4XC2 A;  4EZJ A;  3M62 B;  3PT2 B;  5JHA A;  2BYV E;  2M8S A;  3DVG Y;  4DHZ B;  2RR9 A;  2KZR A;  4EFO A;  3TBL D;  3D32 A;  2BYF A;  4MGY E;  4W9H A;  2C9W B;  3KUD B;  2MBH A;  3PRM B;  2LGD A;  2UYZ B;  4NAW A;  4FJZ A;  5E6O A;  3VDZ A;  2KOX A;  4EEW A;  4FJV B;  5DPR A;  2PJH A;  3SDL C;  3W1S C;  4MM3 A;  1V9J A;  2DAF A;  5E6P A;  2N1W A;  3VFK A;  4XZ4 A;  1LQB A;  4PS3 A;  3CST A;  3WAO A;  4W9J A;  4LJO B;  2KX3 A;  1WJ4 A;  2CHZ A;  3U8Z A;  3SU8 X;  2D07 B;  2JXX A;  2KQS A;  5AEK B;  2JY6 A;  4XX5 A;  2G3Q B;  2RPQ A;  4MJS B;  2KC1 A;  1R4M I;  1IPG A;  2G4D B;  2EMS A;  2OJR A;  4HLE A;  2LRW A;  2MWS B;  2NBW B;  3APF A;  3R3M A;  4MGI E;  3UIN B;  4YL8 A;  4A3P A;  4MEM A;  2O2V B;  1NDD A;  2J0J A;  3ZNI D;  3DVN V;  1EF1 A;  5CTR C;  2JRI B;  2LGY A;  2KX0 A;  1WE7 A;  1E8W A;  3A33 B;  4IM2 A;  3DCG A;  2GOW A;  3M3J A;  3ZO5 B;  4RM9 A;  4WWP A;  2N9P C;  3I3T B;  1J8C A;  3ZRF A;  3M63 B;  4IM3 A;  2KWV B;  2RGF A;  2O2V A;  3GZN I;  2ZPY A;  2AL3 A;  1CMX B;  1P1A A;  4P7I A;  4ZDV A;  5GMV A;  1S1Q B;  5D7G A;  2KO3 A;  2CS4 A;  3KYC D;  2YVC A;  3SHQ A;  4B6W A;  2IBI B;  5CHW A;  1V80 A;  3ZIM A;  3WA0 A;  2L00 B;  2MA9 B;  3L08 A;  5DPS A;  2KDB A;  3GOE A;  3IHP C;  4MH0 E;  4TUU A;  2JUO A;  4NQK E;  2BWF A;  2J0K A;  3L0W B;  2K8B A;  2KTF A;  2WX0 A;  1EF5 A;  2L7R A;  3AI5 A;  4AP4 C;  1V5O A;  3NZU A;  2KKC A;  3CMM B;  4MSQ B;  2KDE B;  1S3S G;  1V81 A;  2QHO A;  1C1Y B;  3ZLZ A;  1HE8 A;  4PS8 A;  4DWF A;  2HD5 B;  5JHB A;  2LAS A;  5G55 A;  3DPD A;  3A1Q B;  4IM0 A;  4MJS A;  2AYO B;  2MBB B;  1WGG A;  4URK A;  4JLC A;  3K9P B;  3N32 A;  4HWI B;  4KDI C;  2L3Z A;  5AZG A;  5J17 A;  4HPL B;  4GU2 A;  1EO6 A;  1E5W A;  3PRZ A;  4ANW A;  4I6N B;  1WM3 A;  1WIA A;  2V3S A;  3IVF A;  4BKT A;  4HCP B;  2I1K A;  2PPH A;  3A9K A;  4HCN B;  1KJT A;  2JT4 B;  3KUC B;  2HE7 A;  1KOT A;  2XEW A;  3O65 B;  4A20 A;  4CO7 A;  5C1Z A;  1TGZ B;  1WE6 A;  1XQQ A;  5D6J B;  2L0F A;  3TJP A;  1ZGU B;  3AU4 A;  5BO4 B;  3NS8 A;  4JL9 A;  4IUM B;  2BKR B;  1WJ6 A;  2Z59 B;  4TQ0 A;  2KJH B;  3ECI A;  3QC8 B;  5JH5 C;  1KLV A;  2ZNV B;  3MHS D;  2MBE A;  1IP9 A;  1D3Z A;  3PSE B;  4IG7 B;  3EHV A;  5FR6 A;  4JGH B;  2M0X A;  1OEY A;  3CF6 E;  2J7Q B;  4M0W B;  1H8C A;  4FAD A;  4GDK A;  2LVP A;  3M95 A;  4HVB A;  1C3T A;  2DZK A;  3K9O B;  1I35 A;  1Q0W B;  2W9N A;  1VCB A;  2BF8 B;  2C7H A;  2K6Q A;  1WX8 A;  1SIF A;  1LXD A;  4K7S A;  1TBE A;  2KMA A;  2J0M A;  3UGB B;  3WIM A;  5L95 C;  1Z5S B;  4AOF A;  2KJ6 A;  2MP2 B;  3RD2 A;  1VD2 A;  2LGX A;  1MG8 A;  2WWZ A;  3KVF B;  4TV3 A;  3QIJ A;  5TR5 A;  3DBL I;  3ZW3 A;  3ML9 A;  3B1L X;  3OJ3 A;  1E7U A;  5KHO A;  3A4R A;  1WXM A;  1SGH A;  2KJR A;  2Y5B B;  2MW5 A;  2L0T A;  1V5T A;  3PS6 A;  1UGM A;  2GBR A;  2JZZ A;  3UQB A;  2GBJ A;  3V62 A;  1E90 A;  1WGD A;  1ZKH A;  4JQW C;  3WAP A;  3PHW B;  4KSL C;  2ZZP B;  2LXA A;  3EC8 A;  4DDG D;  4BBN C;  4CYE A;  4LCD E;  2K39 A;  5DPW A;  4N9F 4;  1WGR A;  1L7Y A;  1E8Z A;  2Z0D B;  1AAR A;  1WMH A;  3U7D A;  2IO1 B;  3ZNG C;  4G11 A;  2GMI C;  3OLM D;  2RSU A;  4GOC A;  2LJ5 A;  3JW0 X;  4BKS A;  1WX7 A;  2DYM A;  2CR5 A;  4M8N A;  3VAW A;  1FXT B;  2ZJD A;  4W9G A;  5KHQ A;  1M94 A;  4G3X B;  3N3K B;  4NY0 A;  3MTN B;  4II3 B;  2FCS A;  4NAW B;  4WWN A;  2M4N A;  3OAW A;  4IWP A;  2D3G A;  3HIZ A;  3VTU A;  4OVU A;  4ANV A;  4WWO A;  4W9F A;  3IFW B;  2K6D B;  3H7P B;  3W1Y A;  3DBH I;  1UD7 A;  1LFD A;  4W9K A;  3KUZ A;  3PHX B;  2MCN B;  2KWU B;  2ZVN A;  3V60 A;  1WF9 A;  2IO3 B;  3NZS A;  2Z0E B;  3L16 A;  3U30 A;  3V6C B;  2B3A A;  1WRD B;  2N9X A;  3ZNZ B;  3WAM A;  3AUL A;  3A9J A;  3VXW A;  2IYD B;  3H7S A;  4IW0 A;  5LXH A;  1WXS A;  5CHV C;  3PZD A;  2CHX A;  3HHM A;  4AJY B;  3PV1 A;  2KLG A;  1UZX B;  3R66 C;  3V61 A;  2KLC A;  4EUT A;  3AU5 A;  4LJP B;  4GB9 A;  4FA6 A;  3PTF C;  3QCA A;  3QA8 A;  3ML8 A;  4ZYN A;  4KVG B;  5DCN A;  3VVW B;  1WYW B;  1T0Y A;  3DDC B;  2G45 B;  2KTR B;  3UIO B;  3AXC A;  4DBG A;  4TKN A;  5IAA C;  4E3C A;  1YD8 U;  2DX5 B;  4MEL A;  2WDT B;  2FIF A;  4E71 A;  4AUQ C;  1WZ0 A;  2O6V D;  4W9I A;  3RZF A;  1WY8 A;  4PS7 A;  3DBS A;  2V1Y A;  2DZJ A;  2KWC A;  1UH6 A;  2HJ8 A;  3BIN A;  3VTV A;  3TCA A;  1K8R B;  2CKH B;  2CHW A;  3IBE A;  4DHJ D;  4HPM B;  2K8H A;  4EZL A;  5LLI A;  4BOZ B;  3ZVV A;  2DZI A;  5IA7 A;  4BOS C;  2L8J A;  2MBQ A;  2DEN B;  3L13 A;  4HXD A;  4GDK B;  2M17 A;  1YX6 B;  4FHJ A;  2C7M B;  2XBB C;  3QWZ B;  3DQV A;  3C0R B;  2KD0 A;  4EZK A;  4KIK B;  4LDT B;  2JPH A;  3OJ4 B;  1F9J A;  2L05 A;  2IY0 B;  2D2Q A;  1H4R A;  1WZ3 A;  2KVR A;  3B08 A;  3TL5 A;  4GXB A;  2ZNV C;  4WQO B;  2ZPN A;  4IWO A;  1WX9 A;  1NBF C;  4K81 A;  1EUV B;  1P98 A;  4MSM B;  1L2N A;  3ALB A;  3HM6 X;  1WGH A;  2UWQ A;  4DHZ E;  3VUY A;  2JRH A;  1WI0 A;  1WR1 A;  1GC6 A;  4FBJ B;  2LVQ A;  3SD5 A;  1I42 A;  1GNU A;  1X1M A;  4GGQ A;  1ZW7 A;  4F8C B;  3TMP B;  1V6E A;  2MQJ A;  2V4L A;  1YX5 B;  3X0W A;  5EDS A;  3DVG X;  2A5U A;  2JWZ A;  2LUE A;  3EFU A;  3PRE A;  4GDL B;  4LDT D;  4WJO A;  4HJK A;  2C60 A;  3PLV A;  2JZ3 B;  4FJY A;  3VUW A;  5LXI B;  1P0R A;  3PLU A;  2AEH A;  3Q3J A;  2D11 A;  2XK5 B;  2LZ6 A;  2ZVO A;  3KW5 B;  2RD0 A;  4G0N B;  1RAX A;  2FCQ A;  2AL6 A;  2MLB A;  3ZDT A;  1RFA A;  3QJZ A;  3RZW C;  2IY1 B;  3JYU A;  3APD A;  2LD9 A;  2NS5 A;  2EMT A;  5J2R A;  3BY4 B;  4WJQ A;  2LI5 A;  2A4Z A;  2GBN A;  4ASW C;  3T8M A;  4ANX A;  2MP2 A;  1QZE A;  2XK5 A;  5G2N A;  2IZV B;  1WJU A;  2EKE C;  4FUL A;  4NJ6 A;  3ZTC A;  4B9K A;  4KV2 A;  2N7E A;  3IG3 A;  3MJW A;  3RYT A;  2BWE S;  3ZNH B;  3QX1 A;  3H7P A;  2KFK A;  2PE9 A;  4CHK A;  2BKF A;  2NR2 A;  4DXA B;  4II2 B;  2KQ7 A;  2DYO A;  2FAZ A;  5C23 A;  3QAR A;  3JSV B;  4AWJ A;  1E7V A;  3T9L A;  5L83 A;  3R7Q A;  1YQB A;  2DAJ A;  1R4N I;  2KFJ A;  3HK0 A;  4MGZ E;  4IWQ A;  2KHW B;  2C7N B;  2KNB A;  1E8X A;  4KZC A;  2CU1 A;  3B0A A;  3Q3F A;  2KK8 A;  5CX3 A;  4DDI D;  3ZTD A;  1OEY J;  5DPT A;  1UBI A;  2L76 A;  3S2A A;  1NI2 A;  1WJN A;  4GIV A;  4K7U A;  4NPN A;  4W9C A;  1A5R A;  1IYF A;  1ISN A;  2ZEQ A;  1GG3 A;  3H9D A;  1WFY A;  2KAN A;  4ZRK A;  1Q1O A;  2N9E B;  4OVV A;  4M8M A;  4BKG A;  1GC7 A;  2K1F A;  4WJN A;  3HM3 A;  5D2M B;  3R7R A;  1SE9 A;  1UBQ A;  3KYD D;  4NQL B;  2HTH A;  2PEA A;  4X57 B;  1TZ1 A;  4KZ0 A;  2PE6 B;  2VRR B;  1V86 A;  1JRU A;  1V2Y A;  2FCM A;  2N4F A;  3DVN U;  4FHK A;  4EOY A;  4E74 A;  4F7Z A;  2M1M A;  4FN2 A;  3VH4 B;  3L17 A;  4BFR A;  4ICU A;  3NY5 A;  3ZUN A;  1WR6 E;  4KSK C;  2NBV B;  1P9D U;  4I6P A;  3UF8 A;  2C5L C;  3QK0 A;  3A9K B;  3DOW A;  2ASQ A;  4BBN F;  3JVZ X;  3P2B A;  2YLM A;  1Y8R C;  2KTR A;  2JVC A;  3H6N A;  2NPT A;  4ICV A;  1TTN A;  2K25 A;  3LDZ E;  4PYZ A;  3QHT A;  4BVU C;  2KDF B;  3L10 B;  5CHF A;  3VHT C;  5JZE B;  3ONS A;  4ZRJ A;  1GUA B;  1OQY A;  1WH3 A;  4RM8 A;  1UEL A;  2GBK A;  3A9J B;  3DBR I;  3QAQ A;  2DYB A;  3RUI B;  1GJZ A;  2NPT B;  4WJP A;  3A1Q A;  3TIX A;  5J18 A;  3RT3 B;  3PVL A;  1YJ1 A;  2R2Q A; 
#chains in the Genus database with same CATH topology
 2FUH B;  5E6N A;  3AE7 B;  4G50 A;  1FNU A;  4YTP B;  3RPF C;  1Z2M A;  2BVC A;  2R2O A;  2WDV B;  1SJE D;  4B95 A;  2H88 B;  3IXS A;  3IT6 B;  1HTO A;  1CK1 A;  2M56 B;  2BPS A;  2FNJ B;  3B2F A;  4IC7 B;  1YIW A;  3QQ8 B;  1P3Q U;  3R2I A;  1WSP A;  2KXJ A;  4NNJ B;  3ENE A;  4KDL B;  4GDL A;  2KFK B;  3NOB A;  4K7W A;  1TS2 A;  1ZP0 B;  1FRD A;  1ZUD 2;  1GPX A;  4TQ1 A;  3N1X C;  3AV8 A;  3LB8 C;  3EEC A;  2BT6 A;  1FPY A;  3ZDM C;  4K1R B;  3APC A;  2LRU A;  2MSE D;  1WM2 A;  1OTR B;  2Z8L A;  5BMG A;  4AJW A;  2DNF A;  1E8Y A;  4ANU A;  2KC2 A;  4XC2 A;  5JHA A;  4DHZ B;  2WXH A;  2IGG A;  4EFO A;  1R4N B;  1CQV A;  2BYF A;  4MGY E;  3KUD B;  2LGD A;  3AE1 B;  4NAW A;  4EEW A;  4FJV B;  5DPR A;  3RNB C;  3W1S C;  4MM3 A;  2YEP F;  3HUI A;  4XZ4 A;  1J7B A;  2VH2 A;  3IAM 1;  2JYT A;  1WJ4 A;  2KT7 A;  1RM6 C;  3U8Z A;  4XWW A;  2KQS A;  3NG0 A;  2G4D B;  1JWB D;  3W5U B;  2OJR A;  4HLE A;  2L32 A;  3R3M A;  3P63 A;  4A3P A;  4YL8 A;  3NVW A;  3ZNI D;  5CTR C;  2KX0 A;  3VRA B;  3A33 B;  3DCG A;  1J8C A;  3M63 B;  5D7G A;  3Q14 C;  1IGD A;  2YVC A;  3SHQ A;  4B6W A;  4S0R A;  3WA0 A;  2MA9 B;  2MJD A;  2KDB A;  4MH0 E;  4NQK E;  2K22 A;  2K8B A;  1TIF A;  2KTF A;  4AP4 C;  1V5O A;  2KKC A;  1HE8 A;  4PS8 A;  2HD5 B;  3Q3N C;  2LAS A;  5JHB A;  3DPD A;  4IM0 A;  2WU2 B;  2MBB B;  4URK A;  3SR6 A;  3AEB B;  2D3C A;  1ZDX A;  2PW9 A;  2ZW1 A;  1WIA A;  2V3S A;  3IVF A;  5BMI A;  4HCP B;  3KUC B;  2RMM A;  3O65 B;  2N9K A;  3Q8C A;  1WE6 A;  3NS8 A;  4BAX A;  4IUM B;  1WJ6 A;  1K51 A;  2ZNV B;  2MBE A;  5FR6 A;  4JGH B;  1VZ8 A;  3TUO A;  2M0X A;  3CF6 E;  3CWI A;  2WXF A;  4GDK A;  3M95 A;  1Q0W B;  3AE2 B;  2BF8 B;  2K6Q A;  1WX8 A;  1ESF A;  1VD2 A;  1MG4 A;  1R7S A;  1HTQ A;  3RNG C;  1V5T A;  3PS6 A;  4C4V B;  1UGM A;  3UQB A;  3WAP A;  4JQW C;  2ZZP B;  3EC8 A;  4CYE A;  4LCD E;  3N1Z C;  1ZE3 D;  3ABV B;  2K39 A;  3NZ3 A;  1L7Y A;  1E8Z A;  2Z0D B;  2IO1 B;  1I4R A;  3GE8 C;  1D4B A;  3OLM D;  4GOC A;  1JWM D;  2CR5 A;  3BYT B;  4M8N A;  5KHQ A;  1M94 A;  4G3X B;  3AEC B;  3OAW A;  1E7P B;  3IFW B;  3W1Y A;  1LFD A;  4W9K A;  3KUZ A;  2ACZ B;  3ZJV A;  2ZVN A;  3EA6 A;  2IO3 B;  2Z0E B;  3V6C B;  4RF1 A;  3NVY A;  2I38 A;  3AN1 A;  1WRD B;  3PZ8 A;  1F2R C;  1WXS A;  5CHV C;  4J3O D;  3HHM A;  3PV1 A;  1N62 A;  2ICI A;  2PVG C;  2AQ1 B;  1UZX B;  4N58 A;  5IOI A;  2LHE A;  3ML8 A;  4YSZ B;  3GB1 A;  4KVG B;  2JXT A;  3UIO B;  3AXC A;  3SFE B;  3OWE B;  1UUP A;  5HFY A;  3L4P A;  4LNO A;  4W9I A;  3RZF A;  2BS2 B;  1SXT A;  2INC C;  3BVZ A;  4DHJ D;  4HPM B;  2PTL A;  4A90 A;  2DZI A;  2MBQ A;  4ZYS A;  4K3B A;  3H8H A;  3N20 C;  1TKY A;  2L05 A;  3IT4 B;  3TL5 A;  2ZNV C;  3BII D;  4K81 A;  1P98 A;  4MSM B;  4KGR A;  3SFD B;  1VR9 A;  1WGH A;  3VUY A;  4FBJ B;  2LVQ A;  4GGQ A;  1ZW7 A;  3TMP B;  1F77 A;  2V4L A;  4GDL B;  4R3D A;  2C60 A;  1TY2 A;  2JZ3 B;  5LXI B;  3PLU A;  2RPV A;  3KW5 B;  2RD0 A;  4AQ7 A;  3JYU A;  3APD A;  4L23 A;  3W2D A;  1SE4 A;  1KFY B;  4WJQ A;  1TKG A;  3ZTC A;  1WJU A;  1TY0 A;  2OED A;  3H7P A;  1C4A A;  2PE9 A;  1YJI A;  2BBC A;  5C23 A;  2DYO A;  3JSV B;  2ONQ A;  3R7Q A;  2WDQ B;  1E0Z A;  2KFJ A;  2N9L A;  4Q2J A;  4RGO S;  5GXG B;  2WXK A;  2CU1 A;  3Q3F A;  4DDI D;  3MC9 A;  1NI2 A;  4K7U A;  1A5R A;  2ZEQ A;  3HVD A;  2WXM A;  4ZRK A;  2N9E B;  4OVV A;  2RDH A;  4WJN A;  2KWD A;  3HM3 A;  2QJL A;  2QEJ C;  3DVN U;  4EOY A;  4FHK A;  4FN2 A;  2WP9 B;  3VH4 B;  4ICU A;  4XE0 A;  4NAM A;  2WXI A;  5C2T B;  2C5L C;  1FM0 D;  3DOW A;  3U7Z A;  2V3N A;  1Y8R C;  1QF6 A;  2KTR A;  4KGT A;  2KDF B;  3L10 B;  3VHT C;  1GUA B;  1GJZ A;  5FR3 A;  3DBR I;  3BZD B;  3RUI B;  2J52 A;  3J9C A;  3PVL A;  2R2Q A;  2GBM A;  2FID A;  4P1B C;  4JIO U;  1AN8 A;  1XD3 B;  4RMA A;  4OZC A;  1DGJ A;  2NBU A;  4LNN A;  4WAF A;  2MX2 A;  3W1S A;  4KIK A;  2FCN A;  5AUI A;  3ETR A;  3WAL A;  1EWY C;  2W3R A;  1LM8 B;  2M0A A;  2L83 A;  3UIP B;  5C3J B;  3R8B A;  1KM7 A;  4W9E A;  1VLB A;  4ZRQ A;  2V9H A;  1J7C A;  2KMC A;  2G4S A;  2WX1 A;  4I6L B;  2N1V A;  5AUK A;  4A3O A;  3AM9 A;  1WGY A;  1N60 A;  3EGR A;  2IGH A;  4MGK E;  1IGC A;  1ZPS A;  3VH3 B;  1M4V A;  2CJN A;  1PDX A;  2V3P A;  4MT5 A;  4F1S A;  3PRP B;  2MEK A;  3KH0 A;  3JSV A;  5AZH A;  1MHH E;  2BYE A;  2J53 A;  2WYQ A;  3ZXR A;  3NHE B;  4HDQ A;  2DWQ A;  2LVO A;  4HK2 A;  4XDC A;  3PPA A;  4NJ7 A;  1TT5 B;  1OQR A;  2BQQ A;  4UDU C;  4HRO A;  4C56 C;  3UQA A;  1ZXH A;  4GN1 A;  3N30 A;  1RLF A;  3ZKJ C;  3U52 E;  2RDB C;  2W54 A;  3DVG Y;  1QIL A;  3AEG B;  2LGS A;  3E9S A;  4W9H A;  3PRM B;  2UYZ B;  5E6O A;  3SDL C;  2N1W A;  1SB3 C;  3PO0 A;  1YOV B;  2JXX A;  5AEK B;  4RCO A;  2JY6 A;  4XX5 A;  2PMV A;  2WLB A;  1QOG A;  1T5X D;  3B2G A;  2LRW A;  3APF A;  3BYY B;  3UIN B;  2O2V B;  2JRI B;  4XGA B;  3Q3M C;  4OW0 A;  1E8W A;  4IM2 A;  2PLP A;  3M3J A;  3ZO5 B;  4WWP A;  4B0M A;  2WXL A;  3FKY A;  3DHG C;  4P7I A;  1CMX B;  1P1A A;  3B9J A;  3KYC D;  2IBI B;  5CHW A;  3ZIM A;  2L00 B;  3GOE A;  3I63 C;  2JUO A;  2L7R A;  3AI5 A;  3CMM B;  1ROE A;  2KDE B;  1S3S G;  2QHO A;  1C1Y B;  2LFI A;  4S17 A;  3VRB B;  4JX1 C;  2L3Z A;  4HPL B;  1TS3 A;  2WXR A;  3KWV A;  1NI3 A;  1E5W A;  3PRZ A;  4I6N B;  1WM3 A;  1HXY D;  4IKG A;  3A9K A;  4HCN B;  4ZOH C;  1KJT A;  2LJI A;  1KOT A;  4ARC A;  4M0W A;  3TJP A;  5BYS A;  2BKR B;  1DOI A;  4TQ0 A;  1JQ4 A;  5JH5 C;  1NEK B;  3PSE B;  1NYR A;  1FNV A;  1XLO A;  3DBR B;  1J7A A;  3AE8 B;  2W55 A;  3AE6 B;  2ZW0 A;  1WYG A;  4JE3 B;  2KVZ A;  4M02 A;  2LVP A;  1PFD A;  1C3T A;  4ZHO A;  1FXI A;  3K9O B;  4HKZ E;  4BZA A;  1TBE A;  1BXT A;  1Z5S B;  2SEB D;  3KVF B;  2WWZ A;  5TR5 A;  3QIJ A;  3ZW3 A;  5D3D A;  3ML9 A;  5KHO A;  1C76 A;  1MVK A;  2MW5 A;  2H89 B;  2UU7 A;  2GBJ A;  3V62 A;  1PGX A;  3PHW B;  2LXA A;  2D3B A;  3O13 A;  4DXG A;  1SEB D;  1P7E A;  1AAR A;  1WMH A;  4G11 A;  1EU3 A;  3ZJU A;  1NEN B;  1FXT B;  4W9G A;  5HI1 A;  4NY0 A;  3N3K B;  3MTN B;  1LGR A;  1OQQ A;  4WWN A;  2M4N A;  2D3G A;  3VTU A;  4WWO A;  4W9F A;  3PZ7 A;  3ZGZ A;  2HDE A;  1UD7 A;  1FFU A;  3PHX B;  5IKC M;  1WF9 A;  1A70 A;  3U30 A;  2W82 A;  4A6Q A;  4A55 A;  4C80 A;  2EKI A;  3ZNZ B;  3AUL A;  3A9J A;  1QOB A;  3H7S A;  4IW0 A;  3WCQ A;  5LXH A;  2E6X A;  3PZD A;  2CHX A;  3Q8E A;  4AJY B;  2NTS A;  2KLG A;  2DBY A;  4YTN B;  3R66 C;  3AU5 A;  4RH6 A;  3QCA A;  5DCN A;  1WYW B;  2KTR B;  4DBG A;  2WXN A;  4E3C A;  2DX5 B;  1AWD A;  2WDT B;  1I4Q A;  1QQR A;  1WZ0 A;  2AQ2 B;  3NUH B;  3AEF B;  1L6V A;  2DZJ A;  2KWC A;  1UH6 A;  3IBE A;  2K8H A;  1P7F A;  3ZVV A;  5IA7 A;  2JWU A;  2L8J A;  1K53 A;  1OFF A;  3L13 A;  4HXD A;  4GDK B;  2M17 A;  1YX6 B;  2PKO A;  2WQY B;  3Q2A C;  1KF6 B;  3DQV A;  2WXO A;  4KIK B;  2JPH A;  3OJ4 B;  1RYJ A;  2IY0 B;  2D2Q A;  1GB4 A;  2LGI A;  1WZ3 A;  3B08 A;  4GXB A;  4IWO A;  4YSY B;  1WX9 A;  3DWG C;  3ALB A;  1B9R A;  4DHZ E;  1VJK A;  2JRH A;  1WR1 A;  1GC6 A;  4IOI E;  3ZJT A;  2MQJ A;  2KAJ A;  2DLB A;  5IN7 A;  4LDT D;  2JWZ A;  1MJD A;  2TSS A;  1V97 A;  3RNC C;  3DBH B;  3I5J C;  1P0R A;  3Q3J A;  2YEP B;  4RF0 A;  1T3Q A;  2LZ6 A;  2AL6 A;  3ZDT A;  4QAY A;  2IY1 B;  2MHJ A;  3HVZ A;  2NS5 A;  5J2R A;  1JW9 D;  2LI5 A;  4ASW C;  3T8M A;  2MP2 A;  1QZE A;  1N6Z A;  1C79 A;  2EKE C;  2IZV B;  1E9M A;  3AE9 B;  3RYT A;  2BWE S;  3QX1 A;  3DBL B;  2KMM A;  4CHK A;  1DOY A;  1D5X C;  2IPK D;  1FFV A;  1L0Y B;  4OZA A;  4NZL B;  2DAJ A;  2QCZ A;  2JSV X;  3HK0 A;  1TS5 A;  3IAS 1;  1UBI A;  1WJN A;  4GIV A;  1YNT E;  1IYF A;  5G5H A;  3MHZ A;  1E6E B;  1GC7 A;  4NQL B;  3Q8B A;  2HTH A;  2PEA A;  4KZ0 A;  1V86 A;  1V2Y A;  2FCM A;  2N4F A;  2KDM A;  2M1M A;  4BFR A;  3HRD D;  3EFC A;  3NY5 A;  2QDF A;  4C7Y A;  1FD6 A;  3C8Y A;  3UF8 A;  1SIJ A;  3QK0 A;  4DXF A;  2LHD A;  3MC8 A;  3VR9 B;  3JVZ X;  2J4X A;  3H6N A;  2NPT A;  2K25 A;  2XN9 C;  1JRO A;  4JWU C;  3BK2 A;  4ZRJ A;  1OQY A;  1WH3 A;  4RM8 A;  1DYQ A;  1UEL A;  3AEE B;  4WJP A;  3RT3 B;  4NJC A;  2WXP A;  3ZXV A;  5LNK 1;  4ZRI A;  3PGE A;  4M01 A;  1PQS A;  3RUL A;  4DK5 A;  2NCN A;  1J19 A;  1XT9 B;  3LJ3 A;  1V49 A;  3R2T A;  2LXC A;  4BKS D;  4N6E B;  1HA5 A;  1R4M B;  1AYF A;  1N61 A;  3V6E B;  2JQR B;  2V4I B;  4W9L A;  2BYT A;  5HG2 A;  2MRP A;  3ZRC A;  4GMV A;  2IO2 B;  2K8C A;  1AW7 A;  2ZCB A;  4WAA A;  3VTW A;  1ZOY B;  1WXV A;  1UGJ A;  2JF5 A;  1GAQ B;  4J6I A;  2INN E;  2DZM A;  4EKU A;  4FLH A;  2VZK D;  3H1U A;  4DHJ B;  2MBO A;  3N9Y C;  1GB1 A;  1C77 A;  4OZB A;  1PGA A;  4MDK E;  3L54 A;  2O6V B;  2D10 A;  2GLS A;  4YWG G;  1G6J A;  1HZ5 A;  2LWP A;  3V3X A;  1VDV A;  2HTM E;  4GSW A;  1U4A A;  5D94 A;  2N7D A;  3A4S C;  2BTE A;  4RFB A;  4WIP A;  1YN5 A;  3CSF A;  2OOB B;  4EZJ A;  3ZQ4 A;  3RFZ B;  3TEZ A;  2WS3 B;  3I9V 1;  3E56 A;  2WGS A;  2RR9 A;  2JU6 X;  2K9X A;  3TBL D;  3BVG A;  1SE2 A;  4FJZ A;  2BW2 A;  2DAF A;  3GS2 A;  3CST A;  3WAO A;  4LJO B;  2KX3 A;  1I4G A;  1TYG B;  2CHZ A;  3SU8 X;  2D07 B;  5T8I A;  1YMH E;  2G3Q B;  4DQO C;  4LTU A;  1R4M I;  1UNS A;  1IPG A;  2KC1 A;  4WQM A;  2MWS B;  2NBW B;  1NDD A;  4HEA 1;  4LK0 M;  4A9A A;  3DVN V;  1EF1 A;  2XNA C;  1TJE A;  5I4D A;  1WE7 A;  2MJE A;  4RM9 A;  1ZXI A;  3N1Y C;  1JWS D;  2N9P C;  2O2V A;  2AL3 A;  4ZDV A;  5GMV A;  3TSS A;  4US8 A;  1JWA D;  1V80 A;  1CJE A;  4C7Z A;  4YTM B;  1V1P A;  3IHP C;  4TUU A;  2J0K A;  1FIQ A;  1FCC C;  1MPE A;  3NZU A;  3P4S B;  1L4Z B;  3ZLZ A;  5G55 A;  4MJS A;  2AYO B;  3K9P B;  2MH7 A;  4EE2 A;  2B76 B;  5AZG A;  5J17 A;  3RNE C;  4ANW A;  4BKT A;  3T3N A;  2PPH A;  2JT4 B;  2XEW A;  4CO7 A;  5C1Z A;  1EM7 A;  5BO4 B;  4JL9 A;  4KKI A;  2KJH B;  3QC8 B;  3MHS D;  3RNF C;  2J7Q B;  1T0R C;  4M0W B;  1T6B X;  1XLN A;  4LLG M;  3Q6B A;  3W5V B;  4HVB A;  2DZK A;  1E10 A;  5EE3 A;  2W9N A;  3RNA C;  1SIF A;  4K7S A;  2KMA A;  1JRP A;  3UGB B;  5L95 C;  1ACC A;  3DHH C;  2KJ6 A;  2R61 A;  3T3O A;  4C4V A;  3I57 A;  3DBL I;  5FKA C;  1BML C;  3B1L X;  1WXM A;  4JWS C;  2KJR A;  2JYE A;  2WHI A;  4K3C A;  1ZKH A;  1T0Q C;  2AQ3 B;  4KSL C;  5DPW A;  3U7D A;  5FK9 C;  2RSU A;  3BVM A;  4BKS A;  1WX7 A;  4PT5 A;  1XLQ A;  3VAW A;  1V8C A;  3HIZ A;  1EWC A;  4KGS A;  2MCN B;  3KWL A;  3NZS A;  3L16 A;  5E6J A;  3FC4 A;  2EEL A;  4P16 A;  1YN4 A;  3VXW A;  1IBX A;  2IYD B;  2WXJ A;  4LNK A;  4ACF A;  2M19 A;  4KKJ A;  2KLC A;  4EUT A;  4YXD B;  2VH1 A;  4LJP B;  4GB9 A;  3PTF C;  4ZYN A;  1FEH A;  4XDD A;  1T0Y A;  2J42 A;  3DDC B;  1K52 A;  1BUI C;  5IAA C;  1QLB B;  4MEL A;  2FIF A;  4E71 A;  1D6E C;  1WY8 A;  4PS7 A;  3MP9 A;  2V1Y A;  1DOX A;  3FIL B;  3TCA A;  1K8R B;  2CKH B;  1D5M C;  2PVO D;  1KLU D;  2QMT A;  3DHI C;  5BYQ A;  4EZL A;  5LLI A;  4CQN A;  1RFK A;  4MH8 A;  4BOS C;  3Q69 A;  3W9C B;  4MAC A;  2C7M B;  1ET6 A;  3QWZ B;  3C0R B;  2KD0 A;  3RI7 C;  1XF5 L;  1YJJ A;  1L6U A;  3V05 A;  4WQO B;  1KTK A;  3HM6 X;  1HQR D;  4ZRP A;  3UI3 A;  1X1M A;  1L4D B;  1YX5 B;  5EDS A;  1L0V B;  2A5U A;  2LUE A;  2IJ0 A;  3PRE A;  4HJK A;  3PLV A;  2G1E A;  3SEB A;  2AEH A;  3P4P B;  2XK5 B;  2ZVO A;  2FCQ A;  2MLB A;  1PYW D;  1JAL A;  1EU4 A;  1KH0 A;  2JZP A;  2EMT A;  2E3T A;  2Y5C A;  3BY4 B;  2FBW B;  2A4Z A;  5MPO A;  3RMK C;  2GBN A;  1TS4 A;  5G2N A;  1QT9 A;  4FUL A;  1T0S C;  4KV2 A;  2N7E A;  3MJW A;  3ZNH B;  2KFK A;  5EE0 A;  2ON8 A;  1CZP A;  4II2 B;  5IO9 A;  2KQ7 A;  3NRZ A;  3QAR A;  1E7V A;  3T9L A;  2OJW A;  2KHW B;  2KNB A;  1B1Z A;  1E8X A;  5CX3 A;  3P4Q B;  4RNA A;  5DPT A;  2L76 A;  4RGT A;  4W9C A;  1WGK A;  3H9D A;  1WFY A;  2KAN A;  5D2M B;  3R7R A;  2GRI A;  4X57 B;  3URY A;  2AX5 A;  1SF0 A;  2VRR B;  1JRU A;  2G9H D;  2JX5 A;  2WXG A;  3RN9 C;  4E74 A;  4KX6 B;  3ZUN A;  1F0Z A;  1WR6 E;  1JWU D;  4KSK C;  1MI0 A;  3FIL A;  1N5W A;  1SE3 A;  1P9D U;  1F52 A;  1MHX A;  1YQ4 B;  1I7H A;  1N5X A;  2JVC A;  4A8X C;  4ICV A;  4PK1 A;  2L1A A;  3LDZ E;  4BVU C;  2X38 A;  2WU5 B;  5CHF A;  5JZE B;  3ONS A;  2GBK A;  3A9J B;  2DYB A;  2LUM A;  3TIX A;  5J18 A;  3P1M A;  2PJH A;  1YJ1 A;  3AE4 B;  1ZDV A;  1IUE A;  4TSS A;  2AWT A;  2W3S A;  2KDI A;  2I1J A;  2IO0 B;  3Q8A A;  4YT0 B;  3X23 A;  1STE A;  2ZCC A;  1XLP A;  2K3U A;  4PYU A;  3VUX A;  4IDI A;  2NVU I;  2DHZ A;  2FUG 1;  5G5G A;  2QC8 A;  2KYW A;  3AED B;  4HDO A;  1I4P A;  3P42 A;  1BT0 A;  2OHF A;  2QIL A;  4WWM A;  5JXV A;  1VZ6 A;  5HKH A;  4HRS A;  4W9D A;  4JPS A;  1C4C A;  1Q5W B;  3TEX A;  2KQ4 X;  4AS1 A;  3MJ5 A;  1OGW A;  3RCZ A;  2IND C;  1J0G A;  3DWM A;  5D3I B;  2BGF A;  3LXF A;  3WAN A;  5AZF A;  2REX A;  3VQI A;  1WMH B;  2X8X X;  2D5G A;  2KN5 A;  1RRB A;  2O6V A;  1WXA A;  3M62 B;  3PT2 B;  2WNM A;  5BMH A;  4OVZ A;  2BYV E;  2M8S A;  2KZR A;  1MFW A;  3MFG A;  3D32 A;  3AE3 B;  2C9W B;  3VDZ A;  1I4H A;  2MBH A;  4XYC A;  5EE9 A;  2KOX A;  3Q3O C;  2PIA A;  3AH7 A;  1V9J A;  1XCQ L;  2L52 A;  5E6P A;  3VFK A;  1LQB A;  4PS3 A;  2I2Y A;  2SAK A;  4W9J A;  2WDR B;  3TEY A;  2RPQ A;  4MJS B;  2EMS A;  2IDY A;  4USA A;  4WH4 A;  4OHJ A;  4MGI E;  1L0X B;  4MEM A;  2J0J A;  1WXQ A;  2LGY A;  3GE3 C;  2GOW A;  3I3T B;  3BWU D;  3ZRF A;  4ARI A;  1XCT L;  4IM3 A;  2KWV B;  2NTT A;  2RDG A;  2CJO A;  2RGF A;  3GZN I;  2ZPY A;  1S1Q B;  2KO3 A;  2CS4 A;  3CIR B;  3L08 A;  1HEZ E;  5DPS A;  2BWF A;  3L0W B;  2WX0 A;  4YSX B;  3NVZ A;  1EF5 A;  4FXC A;  4MSQ B;  4WUR A;  5TSS A;  1V81 A;  4DWF A;  2LEK A;  3A1Q B;  2MJ3 A;  4LNI A;  1WGG A;  4JLC A;  3N32 A;  4HWI B;  4KDI C;  2Y5P A;  3AMZ A;  4GU2 A;  1EO6 A;  1VZ7 A;  2I1K A;  1SJH D;  4US9 A;  2HE7 A;  4A20 A;  1TGZ B;  1XQQ A;  5D6J B;  2L0F A;  1ZGU B;  3AU4 A;  1N63 A;  2Z59 B;  3ECI A;  2V0G A;  1KLV A;  1IP9 A;  1D3Z A;  4IG7 B;  4P6V F;  3EHV A;  4XWT A;  4RGN A;  4B0E A;  1OEY A;  1KLG D;  1PUT A;  3AE5 B;  1H8C A;  4FAD A;  1I35 A;  1VCB A;  2C7H A;  1LXD A;  2QIE B;  2J0M A;  3WIM A;  4AOF A;  1QKZ A;  2MP2 B;  3RD2 A;  2LGX A;  1MG8 A;  4TV3 A;  4HPP A;  3OJ3 A;  1E7U A;  3A4R A;  5BYR A;  1SGH A;  2Y5B B;  2L0T A;  1FRR A;  2FE8 A;  2N7J A;  2GBR A;  2JZZ A;  3NS1 A;  1E90 A;  1WGD A;  3AB5 A;  2BB6 A;  4DDG D;  4BBN C;  4L2Y A;  4N9F 4;  1WGR A;  3ZNG C;  3ZYY X;  2GMI C;  3NJT A;  2LJ5 A;  3JW0 X;  2DYM A;  2ZJD A;  1C4P A;  4II3 B;  2FCS A;  2VZK B;  2INP E;  4NAW B;  4IWP A;  4ANV A;  4OVU A;  3LYY A;  2K6D B;  3H7P B;  4MM3 B;  3DBH I;  2IGD A;  3KQ4 A;  3VR8 B;  2KWU B;  3V60 A;  2B3A A;  1ENF A;  1FNW A;  2N9X A;  1TKE A;  1F1H A;  3WAM A;  4L1B A;  3U4E G;  3V61 A;  1XXG A;  4FA6 A;  1SSN A;  3QA8 A;  2NMQ A;  3VVW B;  2K5P A;  1C9F A;  1L5P A;  2G45 B;  3TEW A;  2QSD A;  4TKN A;  1YD8 U;  1RWS A;  1K50 A;  3P4R B;  1XO3 A;  4AUQ C;  2LMC A;  2O6V D;  3OG5 A;  1FXA A;  3DBS A;  1UWX A;  3BIN A;  2HJ8 A;  4M00 A;  3VTV A;  1FMA D;  2CHW A;  4HKQ A;  4BOZ B;  4O1N A;  2DEN B;  4TMA B;  1GOZ A;  2GB1 A;  4FHJ A;  2XBB C;  1JCK B;  4EZK A;  4LDT B;  1HZ6 A;  3U2S C;  1F9J A;  2BS3 B;  3BK1 A;  1H4R A;  2KVR A;  2ZPN A;  1V1P B;  3GZN B;  1NBF C;  1EUV B;  1L2N A;  3FAH A;  2UWQ A;  5H92 C;  1WI0 A;  2KAC A;  3SD5 A;  1I42 A;  1GNU A;  4F8C B;  1V6E A;  1YN3 A;  1D5Z C;  3X0W A;  3DVG X;  3Q8F A;  1Q10 A;  3EFU A;  4WJO A;  3NVV A;  3EUB 2;  4FJY A;  3VUW A;  2D11 A;  2WXQ A;  1QOF A;  1UWM A;  2BS4 B;  1KRH A;  4G0N B;  1RAX A;  1RFA A;  3QJZ A;  3RZW C;  1UF0 A;  2LD9 A;  3C19 A;  5IP4 D;  1V1O A;  4ANX A;  2BB5 A;  2XK5 A;  4NJ6 A;  1FCL A;  1F2R I;  4B9K A;  3IG3 A;  1YQ3 B;  1WWT A;  1PGB A;  1VRA B;  2BKF A;  1C78 A;  2NR2 A;  4DXA B;  2K0P A;  2FAZ A;  1TZO A;  4C00 A;  3KLS X;  4AWJ A;  5L83 A;  1YQB A;  1R4N I;  1IBX B;  1QOA A;  4MGZ E;  2N0S B;  4IWQ A;  1NYQ A;  2C7N B;  4KZC A;  4RGM A;  1SBB B;  3B0A A;  2KK8 A;  3ZTD A;  1OEY J;  2D3A A;  3S2A A;  4NPN A;  1FO4 A;  1ISN A;  2Y3A A;  4N59 A;  1GG3 A;  4LNF A;  3MC0 B;  4GLS C;  1Q1O A;  4M8M A;  4BKG A;  2K1F A;  4H2A A;  1SE9 A;  1UBQ A;  3KYD D;  4D2K A;  1TZ1 A;  2PE6 B;  4F7Z A;  5EE1 A;  3L17 A;  3AEA B;  2Q5W D;  2GI9 A;  4REZ A;  4ITK A;  2NBV B;  4I6P A;  5HHD G;  3A9K B;  2ASQ A;  5H8Y E;  4BBN F;  3P2B A;  1XEE A;  2YLM A;  1NVI D;  2HJ1 A;  4HJG E;  1TTN A;  2KN4 A;  4PYZ A;  1ET9 A;  3QHT A;  4ZHP A;  1LO5 D;  3QAQ A;  2NPT B;  2CU3 A;  3A1Q A;  1I4X A;  1JML A;  4P1C C;  1Y56 A;  3GP7 A;  1WRI A; 
#chains in the Genus database with same CATH homology
 2FUH B;  2GBM A;  4ZRI A;  5E6N A;  2FID A;  3PGE A;  4G50 A;  4JIO U;  1PQS A;  1XD3 B;  4RMA A;  2AWT A;  3RUL A;  4DK5 A;  2KDI A;  2NCN A;  1J19 A;  2I1J A;  2NBU A;  1Z2M A;  2MX2 A;  3W1S A;  1XT9 B;  4KIK A;  2R2O A;  2FCN A;  3LJ3 A;  2IO0 B;  1V49 A;  2LXC A;  4BKS D;  3WAL A;  4B95 A;  3V6E B;  3X23 A;  2ZCC A;  1LM8 B;  3UIP B;  4W9L A;  4PYU A;  3VUX A;  2MRP A;  2BPS A;  2FNJ B;  2NVU I;  3ZRC A;  2DHZ A;  4GMV A;  4IC7 B;  1KM7 A;  1YIW A;  3QQ8 B;  4W9E A;  1P3Q U;  2IO2 B;  2K8C A;  2KXJ A;  2ZCB A;  4NNJ B;  3ENE A;  4WAA A;  2KMC A;  3VTW A;  2G4S A;  4HDO A;  2WX1 A;  1WXV A;  4KDL B;  4GDL A;  2JF5 A;  4I6L B;  2KFK B;  2N1V A;  3NOB A;  1BT0 A;  4K7W A;  2DZM A;  4J6I A;  4A3O A;  4FLH A;  4EKU A;  1WGY A;  3H1U A;  4DHJ B;  5HKH A;  2MBO A;  4MGK E;  3VH3 B;  4W9D A;  4TQ1 A;  1Q5W B;  4F1S A;  3PRP B;  3KH0 A;  3JSV A;  5AZH A;  2BYE A;  3EEC A;  2WYQ A;  1OGW A;  3L54 A;  4MDK E;  2O6V B;  2D10 A;  3RCZ A;  3ZDM C;  3NHE B;  4HDQ A;  4K1R B;  1G6J A;  1J0G A;  2LWP A;  2LVO A;  4HK2 A;  3APC A;  2LRU A;  2MSE D;  1WM2 A;  1OTR B;  2BGF A;  3PPA A;  3WAN A;  4NJ7 A;  5D94 A;  4GSW A;  1U4A A;  2REX A;  2N7D A;  1WMH B;  5AZF A;  3VQI A;  4AJW A;  2KN5 A;  3A4S C;  1E8Y A;  1RRB A;  4ANU A;  3UQA A;  4GN1 A;  3N30 A;  1RLF A;  2O6V A;  3ZKJ C;  3CSF A;  1WXA A;  2KC2 A;  2OOB B;  4XC2 A;  4EZJ A;  3M62 B;  3PT2 B;  5JHA A;  2BYV E;  2M8S A;  3DVG Y;  4DHZ B;  2RR9 A;  2KZR A;  4EFO A;  3TBL D;  3D32 A;  2BYF A;  4MGY E;  4W9H A;  2C9W B;  3KUD B;  2MBH A;  3PRM B;  2LGD A;  2UYZ B;  4NAW A;  4FJZ A;  5E6O A;  3VDZ A;  2KOX A;  4EEW A;  4FJV B;  5DPR A;  2PJH A;  3SDL C;  3W1S C;  4MM3 A;  1V9J A;  2DAF A;  5E6P A;  2N1W A;  3VFK A;  4XZ4 A;  1LQB A;  4PS3 A;  3CST A;  3WAO A;  4W9J A;  4LJO B;  2KX3 A;  1WJ4 A;  2CHZ A;  3U8Z A;  3SU8 X;  2D07 B;  2JXX A;  2KQS A;  5AEK B;  2JY6 A;  4XX5 A;  2G3Q B;  2RPQ A;  4MJS B;  2KC1 A;  1R4M I;  1IPG A;  2G4D B;  2EMS A;  2OJR A;  4HLE A;  2LRW A;  2MWS B;  2NBW B;  3APF A;  3R3M A;  4MGI E;  3UIN B;  4YL8 A;  4A3P A;  4MEM A;  2O2V B;  1NDD A;  2J0J A;  3ZNI D;  3DVN V;  1EF1 A;  5CTR C;  2JRI B;  2LGY A;  2KX0 A;  1WE7 A;  1E8W A;  3A33 B;  4IM2 A;  3DCG A;  2GOW A;  3M3J A;  3ZO5 B;  4RM9 A;  4WWP A;  2N9P C;  3I3T B;  1J8C A;  3ZRF A;  3M63 B;  4IM3 A;  2KWV B;  2RGF A;  2O2V A;  3GZN I;  2ZPY A;  2AL3 A;  1CMX B;  1P1A A;  4P7I A;  4ZDV A;  5GMV A;  1S1Q B;  5D7G A;  2KO3 A;  2CS4 A;  3KYC D;  2YVC A;  3SHQ A;  4B6W A;  2IBI B;  5CHW A;  1V80 A;  3ZIM A;  3WA0 A;  2L00 B;  2MA9 B;  3L08 A;  5DPS A;  2KDB A;  3GOE A;  3IHP C;  4MH0 E;  4TUU A;  2JUO A;  4NQK E;  2BWF A;  2J0K A;  3L0W B;  2K8B A;  2KTF A;  2WX0 A;  1EF5 A;  2L7R A;  3AI5 A;  4AP4 C;  1V5O A;  3NZU A;  2KKC A;  3CMM B;  4MSQ B;  2KDE B;  1S3S G;  1V81 A;  2QHO A;  1C1Y B;  3ZLZ A;  1HE8 A;  4PS8 A;  4DWF A;  2HD5 B;  5JHB A;  2LAS A;  5G55 A;  3DPD A;  3A1Q B;  4IM0 A;  4MJS A;  2AYO B;  2MBB B;  1WGG A;  4URK A;  4JLC A;  3K9P B;  3N32 A;  4HWI B;  4KDI C;  2L3Z A;  5AZG A;  5J17 A;  4HPL B;  4GU2 A;  1EO6 A;  1E5W A;  3PRZ A;  4ANW A;  4I6N B;  1WM3 A;  1WIA A;  2V3S A;  3IVF A;  4BKT A;  4HCP B;  2I1K A;  2PPH A;  3A9K A;  4HCN B;  1KJT A;  2JT4 B;  3KUC B;  2HE7 A;  1KOT A;  2XEW A;  3O65 B;  4A20 A;  4CO7 A;  5C1Z A;  1TGZ B;  1WE6 A;  1XQQ A;  5D6J B;  2L0F A;  3TJP A;  1ZGU B;  3AU4 A;  5BO4 B;  3NS8 A;  4JL9 A;  4IUM B;  2BKR B;  1WJ6 A;  2Z59 B;  4TQ0 A;  2KJH B;  3ECI A;  3QC8 B;  5JH5 C;  1KLV A;  2ZNV B;  3MHS D;  2MBE A;  1IP9 A;  1D3Z A;  3PSE B;  4IG7 B;  3EHV A;  5FR6 A;  4JGH B;  2M0X A;  1OEY A;  3CF6 E;  2J7Q B;  4M0W B;  1H8C A;  4FAD A;  4GDK A;  2LVP A;  3M95 A;  4HVB A;  1C3T A;  2DZK A;  3K9O B;  1I35 A;  1Q0W B;  2W9N A;  1VCB A;  2BF8 B;  2C7H A;  2K6Q A;  1WX8 A;  1SIF A;  1LXD A;  4K7S A;  1TBE A;  2KMA A;  2J0M A;  3UGB B;  3WIM A;  5L95 C;  1Z5S B;  4AOF A;  2KJ6 A;  2MP2 B;  3RD2 A;  1VD2 A;  2LGX A;  1MG8 A;  2WWZ A;  3KVF B;  4TV3 A;  3QIJ A;  5TR5 A;  3DBL I;  3ZW3 A;  3ML9 A;  3B1L X;  3OJ3 A;  1E7U A;  5KHO A;  3A4R A;  1WXM A;  1SGH A;  2KJR A;  2Y5B B;  2MW5 A;  2L0T A;  1V5T A;  3PS6 A;  1UGM A;  2GBR A;  2JZZ A;  3UQB A;  2GBJ A;  3V62 A;  1E90 A;  1WGD A;  1ZKH A;  4JQW C;  3WAP A;  3PHW B;  4KSL C;  2ZZP B;  2LXA A;  3EC8 A;  4DDG D;  4BBN C;  4CYE A;  4LCD E;  2K39 A;  5DPW A;  4N9F 4;  1WGR A;  1L7Y A;  1E8Z A;  2Z0D B;  1AAR A;  1WMH A;  3U7D A;  2IO1 B;  3ZNG C;  4G11 A;  2GMI C;  3OLM D;  2RSU A;  4GOC A;  2LJ5 A;  3JW0 X;  4BKS A;  1WX7 A;  2DYM A;  2CR5 A;  4M8N A;  3VAW A;  1FXT B;  2ZJD A;  4W9G A;  5KHQ A;  1M94 A;  4G3X B;  3N3K B;  4NY0 A;  3MTN B;  4II3 B;  2FCS A;  4NAW B;  4WWN A;  2M4N A;  3OAW A;  4IWP A;  2D3G A;  3HIZ A;  3VTU A;  4OVU A;  4ANV A;  4WWO A;  4W9F A;  3IFW B;  2K6D B;  3H7P B;  3W1Y A;  3DBH I;  1UD7 A;  1LFD A;  4W9K A;  3KUZ A;  3PHX B;  2MCN B;  2KWU B;  2ZVN A;  3V60 A;  1WF9 A;  2IO3 B;  3NZS A;  2Z0E B;  3L16 A;  3U30 A;  3V6C B;  2B3A A;  1WRD B;  2N9X A;  3ZNZ B;  3WAM A;  3AUL A;  3A9J A;  3VXW A;  2IYD B;  3H7S A;  4IW0 A;  5LXH A;  1WXS A;  5CHV C;  3PZD A;  2CHX A;  3HHM A;  4AJY B;  3PV1 A;  2KLG A;  1UZX B;  3R66 C;  3V61 A;  2KLC A;  4EUT A;  3AU5 A;  4LJP B;  4GB9 A;  4FA6 A;  3PTF C;  3QCA A;  3QA8 A;  3ML8 A;  4ZYN A;  4KVG B;  5DCN A;  3VVW B;  1WYW B;  1T0Y A;  3DDC B;  2G45 B;  2KTR B;  3UIO B;  3AXC A;  4DBG A;  4TKN A;  5IAA C;  4E3C A;  1YD8 U;  2DX5 B;  4MEL A;  2WDT B;  2FIF A;  4E71 A;  4AUQ C;  1WZ0 A;  2O6V D;  4W9I A;  3RZF A;  1WY8 A;  4PS7 A;  3DBS A;  2V1Y A;  2DZJ A;  2KWC A;  1UH6 A;  2HJ8 A;  3BIN A;  3VTV A;  3TCA A;  1K8R B;  2CKH B;  2CHW A;  3IBE A;  4DHJ D;  4HPM B;  2K8H A;  4EZL A;  5LLI A;  4BOZ B;  3ZVV A;  2DZI A;  5IA7 A;  4BOS C;  2L8J A;  2MBQ A;  2DEN B;  3L13 A;  4HXD A;  4GDK B;  2M17 A;  1YX6 B;  4FHJ A;  2C7M B;  2XBB C;  3QWZ B;  3DQV A;  3C0R B;  2KD0 A;  4EZK A;  4KIK B;  4LDT B;  2JPH A;  3OJ4 B;  1F9J A;  2L05 A;  2IY0 B;  2D2Q A;  1H4R A;  1WZ3 A;  2KVR A;  3B08 A;  3TL5 A;  4GXB A;  2ZNV C;  4WQO B;  2ZPN A;  4IWO A;  1WX9 A;  1NBF C;  4K81 A;  1EUV B;  1P98 A;  4MSM B;  1L2N A;  3ALB A;  3HM6 X;  1WGH A;  2UWQ A;  4DHZ E;  3VUY A;  2JRH A;  1WI0 A;  1WR1 A;  1GC6 A;  4FBJ B;  2LVQ A;  3SD5 A;  1I42 A;  1GNU A;  1X1M A;  4GGQ A;  1ZW7 A;  4F8C B;  3TMP B;  1V6E A;  2MQJ A;  2V4L A;  1YX5 B;  3X0W A;  5EDS A;  3DVG X;  2A5U A;  2JWZ A;  2LUE A;  3EFU A;  3PRE A;  4GDL B;  4LDT D;  4WJO A;  4HJK A;  2C60 A;  3PLV A;  2JZ3 B;  4FJY A;  3VUW A;  5LXI B;  1P0R A;  3PLU A;  2AEH A;  3Q3J A;  2D11 A;  2XK5 B;  2LZ6 A;  2ZVO A;  3KW5 B;  2RD0 A;  4G0N B;  1RAX A;  2FCQ A;  2AL6 A;  2MLB A;  3ZDT A;  1RFA A;  3QJZ A;  3RZW C;  2IY1 B;  3JYU A;  3APD A;  2LD9 A;  2NS5 A;  2EMT A;  5J2R A;  3BY4 B;  4WJQ A;  2LI5 A;  2A4Z A;  2GBN A;  4ASW C;  3T8M A;  4ANX A;  2MP2 A;  1QZE A;  2XK5 A;  5G2N A;  2IZV B;  1WJU A;  2EKE C;  4FUL A;  4NJ6 A;  3ZTC A;  4B9K A;  4KV2 A;  2N7E A;  3IG3 A;  3MJW A;  3RYT A;  2BWE S;  3ZNH B;  3QX1 A;  3H7P A;  2KFK A;  2PE9 A;  4CHK A;  2BKF A;  2NR2 A;  4DXA B;  4II2 B;  2KQ7 A;  2DYO A;  2FAZ A;  5C23 A;  3QAR A;  3JSV B;  4AWJ A;  1E7V A;  3T9L A;  5L83 A;  3R7Q A;  1YQB A;  2DAJ A;  1R4N I;  2KFJ A;  3HK0 A;  4MGZ E;  4IWQ A;  2KHW B;  2C7N B;  2KNB A;  1E8X A;  4KZC A;  2CU1 A;  3B0A A;  3Q3F A;  2KK8 A;  5CX3 A;  4DDI D;  3ZTD A;  1OEY J;  5DPT A;  1UBI A;  2L76 A;  3S2A A;  1NI2 A;  1WJN A;  4GIV A;  4K7U A;  4NPN A;  4W9C A;  1A5R A;  1IYF A;  1ISN A;  2ZEQ A;  1GG3 A;  3H9D A;  1WFY A;  2KAN A;  4ZRK A;  1Q1O A;  2N9E B;  4OVV A;  4M8M A;  4BKG A;  1GC7 A;  2K1F A;  4WJN A;  3HM3 A;  5D2M B;  3R7R A;  1SE9 A;  1UBQ A;  3KYD D;  4NQL B;  2HTH A;  2PEA A;  4X57 B;  1TZ1 A;  4KZ0 A;  2PE6 B;  2VRR B;  1V86 A;  1JRU A;  1V2Y A;  2FCM A;  2N4F A;  3DVN U;  4FHK A;  4EOY A;  4E74 A;  4F7Z A;  2M1M A;  4FN2 A;  3VH4 B;  3L17 A;  4BFR A;  4ICU A;  3NY5 A;  3ZUN A;  1WR6 E;  4KSK C;  2NBV B;  1P9D U;  4I6P A;  3UF8 A;  2C5L C;  3QK0 A;  3A9K B;  3DOW A;  2ASQ A;  4BBN F;  3JVZ X;  3P2B A;  2YLM A;  1Y8R C;  2KTR A;  2JVC A;  3H6N A;  2NPT A;  4ICV A;  1TTN A;  2K25 A;  3LDZ E;  4PYZ A;  3QHT A;  4BVU C;  2KDF B;  3L10 B;  5CHF A;  3VHT C;  5JZE B;  3ONS A;  4ZRJ A;  1GUA B;  1OQY A;  1WH3 A;  4RM8 A;  1UEL A;  2GBK A;  3A9J B;  3DBR I;  3QAQ A;  2DYB A;  3RUI B;  1GJZ A;  2NPT B;  4WJP A;  3A1Q A;  3TIX A;  5J18 A;  3RT3 B;  3PVL A;  1YJ1 A;  2R2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...