2W9NA

Crystal structure of linear di-ubiquitin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
148
structure length
148
Chain Sequence
QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords UBIQUITIN
publication title Molecular Discrimination of Structurally Equivalent Lys 63-Linked and Linear Polyubiquitin Chains.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2009-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2w9nA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2w9nA02
3CSTA 2MSED 1E7UA 1P0RA 1WGYA 4KDLB 3ZVVA 2V3SA 1WGHA 3CMMB 3RT3B 4JLCA 4W9HA 1Q1OA 1YX6B 3HM6X 4HDQA 2R2QA 5CHWA 4W9FA 1EF5A 2XEWA 3UINB 4DBGA 3JSVB 2D10A 2KJHB 3ALBA 3ZRFA 4BKSD 3M95A 2ZCCA 3RULA 3W1YA 1X1MA 1ZW7A 4W9LA 1RFAA 2YVCA 3C0RB 1VCBA 1WMHA 2FCSA 2KDEB 4IWPA 5E6OA 2L7RA 3VH3B 3DBHI 3DCGA 4ANXA 2A5UA 1Q0WB 2DZJA 1Y8RC 5DPTA 4MEMA 3AI5A 3WA0A 2C7HA 4M8MA 2WDTB 3A4RA 4IM3A 2NBVB 3EFUA 3R3MA 3GZNI 2KC2A 4P7IA 2LWPA 3RCZA 2JXXA 2KMCA 2Z59B 2C60A 2FIFA 1L7YA 4RM8A 1WYWB 3A4SC 2JRHA 4KDIC 3ENEA 4AOFA 2AYOB 1OTRB 3ML8A 2DENB 2G45B 2MBHA 4M0WB 4EOYA 1CMXB 3TMPB 1V5TA 2MBQA 2K39A 1RLFA 4AUQC 3L17A 4NY0A 1H4RA 2O6VB 4BKTA 3S2AA 3VXWA 1FXTB 4WWPA 1QZEA 2N4FA 3H9DA 3R7QA 3ZUNA 1WX9A 3QIJA 3OAWA 3SD5A 4AJWA 2RSUA 4ASWC 3VQIA 1UD7A 1UZXB 2KFKA 3DBSA 4A20A 2MBBB 4I6LB 4FULA 4W9DA 2WYQA 4W9IA 1WI0A 2MA9B 4GSWA 3SU8X 3EC8A 1OGWA 2GBMA 2C5LC 2MLBA 2CHZA 4M8NA 3L54A 3DVGX 1WH3A 2XK5A 3PLUA 4JIOU 1F9JA 2FCMA 3ZNGC 2EKEC 1GNUA 3T8MA 2C7MB 1WIAA 1YQBA 3VDZA 3AULA 2JVCA 3QJZA 2LZ6A 2D07B 4WAAA 5BO4B 2JWZA 3ZLZA 2MBEA 3DVNV 5E6NA 1H8CA 3I3TB 2KWVB 2KJ6A 3R66C 4HWIB 5EDSA 1LQBA 4ZRJA 4ANUA 4BBNF 3B08A 4F7ZA 1U4AA 3NZUA 3RYTA 2KQSA 3A1QA 3LDZE 4IUMB 2KLCA 2LGDA 3QK0A 2XK5B 5HKHA 4W9CA 2N7EA 3TBLD 5G55A 1WGDA 3WAMA 4W9JA 4EZKA 3QHTA 3NHEB 4FJYA 4JL9A 2KXJA 2ZCBA 4KV2A 3ZDMC 4URKA 2NBWB 3P2BA 3UIPB 3L16A 4HCNB 5J18A 1KM7A 2N7DA 4WWNA 2KX0A 2KO3A 2G4SA 1AARA 3A1QB 4KIKA 3H1UA 2ZEQA 2N9PC 5LXIB 3K9PB 3PREA 3VH4B 2GBJA 2I1KA 3TIXA 3UQAA 2IY1B 3DOWA 1XT9B 3N32A 2CS4A 2K8HA 1J0GA 1E8WA 4MJSA 5LXHA 2D11A 2IBIB 3U7DA 3ML9A 2BYVE 2NCNA 1YX5B 1E5WA 4FN2A 2XBBC 3DBRI 1GC6A 3NS8A 4PS7A 2IO3B 3AU5A 2IO0B 3QX1A 3T9LA 5D2MB 4CYEA 2MWSB 1Z5SB 2BYFA 3HM3A 4KIKB 4NAWA 1WJNA 2L76A 2KZRA 3WAPA 1P1AA 3ZW3A 3UQBA 4ZDVA 1I42A 4MH0E 1T0YA 2AWTA 4MSQB 2V4LA 3N30A 4NJ6A 3ZNID 1RRBA 3EHVA 3D32A 3PHWB 2DZMA 4JQWC 3V60A 2WX0A 1WR6E 2KKCA 3DBLI 1WE7A 4E74A 2NR2A 3B0AA 3PLVA 3SHQA 4DHJB 1GUAB 4II3B 3RUIB 4G3XB 1E8XA 2BWFA 3PV1A 2MP2A 2K6DB 1IP9A 2DX5B 3DVGY 4NAWB 4WQOB 4ANWA 3GOEA 1P3QU 1VD2A 2FIDA 3ZIMA 2OOBB 1C3TA 3CF6E 3ZRCA 3KW5B 3KYDD 2MRPA 2LVOA 1TTNA 2BF8B 3DQVA 1UELA 3X23A 3AXCA 4K7UA 3PHXB 4FJVB 4GU2A 4MM3A 4RM9A 2KJRA 4BKSA 1WZ0A 2YLMA 3PSEB 4LDTB 1GC7A 3W1SC 2BYEA 2KLGA 2Z0EB 1TGZB 2O6VD 2ZJDA 2J0JA 2NS5A 2LJ5A 5JHBA 2LRWA 1WMHB 2MQJA 1WM2A 4RMAA 2GBRA 2L00B 3VAWA 2KMAA 3AU4A 1ZGUB 3PRZA 2Z0DB 2VRRB 3KH0A 3PTFC 1E8ZA 3IFWB 4G11A 2NPTA 1V49A 4GXBA 2MW5A 4PS8A 5GMVA 1WJ4A 4IWOA 3KUDB 3PZDA 1V86A 3APFA 1V81A 4BOZB 4K7WA 5D6JB 2AL6A 1WXMA 3QQ8B 5AZFA 2FCQA 2WX1A 3MJWA 2DHZA 3DPDA 2FCNA 2LGXA 4K7SA 4GDKA 1IYFA 5C1ZA 4B6WA 1JRUA 3L13A 2M1MA 3ECIA 1SE9A 4XC2A 1TBEA 2KANA 1WZ3A 1RAXA 1BT0A 2N1VA 3UGBB 4IWQA 1WE6A 4IC7B 1YIWA 2L0FA 4NQLB 3M3JA 5KHOA 3EECA 2KC1A 3A9JA 5J2RA 1PQSA 2ZNVC 4DHZB 2KK8A 3N3KB 4PYUA 2M4NA 4ZRIA 4EUTA 4F8CB 2A4ZA 4GDLA 2BKFA 3NOBA 2IO1B 3H7PA 3PVLA 2L8JA 2M8SA 4NQKE 1KOTA 4GDKB 2KTRA 1LM8B 5FR6A 1GG3A 4B9KA 2KFKB 3L10B 4E71A 3H6NA 3VTWA 4DDGD 3W1SA 3A33B 3V6CB 2HD5B 4HVBA 3A9JB 1WM3A 2BKRB 3M63B 3QCAA 3VUXA 2JY6A 4DXAB 4EZLA 4MGKE 1UGMA 2CHXA 2KD0A 4PYZA 1EO6A 1NBFC 4G0NB 4GDLB 2LXCA 5G2NA 4MGZE 5D7GA 1OQYA 4BBNC 2V1YA 2UWQA 5LLIA 3PT2B 3WANA 3BY4B 1C1YB 2PE9A 1P9DU 5IAAC 4TV3A 1SGHA 2KTRB 4TQ1A 2ZZPB 2K1FA 2JT4B 2KN5A 3PRPB 4WJQA 2KTFA 4LJOB 2NVUI 1V5OA 4KZ0A 4IG7B 3VUYA 2J0MA 3LJ3A 2M0XA 4W9GA 2DYOA 4A3PA 4DWFA 3IG3A 1J19A 1E90A 1XD3B 2CKHB 2EMTA 2GOWA 2LGYA 1SIFA 2LRUA 4GN1A 2HJ8A 1OEYA 3JYUA 2MX2A 4GMVA 1S1QB 2JF5A 5E6PA 5DPRA 4XZ4A 3PPAA 2CR5A 3IHPC 4WWOA 4F1SA 1V9JA 4FA6A 3RZFA 2KDIA 2CU1A 1WRDB 4DHJD 5DPSA 4CHKA 3KVFB 2K6QA 1V2YA 4HDOA 1S3SG 4NPNA 1E7VA 4WJOA 2PJHA 4MGIE 4FBJB 2ZPNA 2RR9A 2ASQA 4IM0A 4EFOA 3KUCB 4HCPB 4E3CA 2JZ3B 3V61A 5TR5A 3APDA 4JGHB 1WX7A 3ZKJC 3TL5A 3VHTC 2JPHA 4OVVA 1WF9A 3JVZX 4MJSB 2D3GA 2D2QA 2LXAA 3L0WB 4BKGA 4FADA 2PE6B 2KVRA 5D94A 4KSKC 3OJ4B 1OEYJ 2WWZA 1UBIA 3HK0A 3VUWA 2K8CA 2B3AA 2L3ZA 2O2VA 5L83A 1ZKHA 3HHMA 3DDCB 3QWZB 1Z2MA 4WJPA 2C7NB 4DHZE 2N9XA 3UF8A 2ZVNA 2KX3A 3IBEA 2LVQA 2N9EB 2BWES 2MCNB 3NY5A 4ZYNA 2ZPYA 4II2B 3Q3FA 4N9F4 4DDID 4EKUA 1WX8A 5CHVC 5KHQA 2LI5A 1WJ6A 5CHFA 1YJ1A 3WAOA 3ZTCA 2R2OA 3ZNZB 2JRIB 4BFRA 4K1RB 4LCDE 1WR1A 1WY8A 2MP2B 2O2VB 4HK2A 3WIMA 4CO7A 4HPLB 4NNJB 2KQ7A 2RPQA 3VFKA 1TZ1A 2FAZA 3O65B 4HJKA 4DK5A 1KJTA 1EUVB 3ZO5B 4GB9A 4BVUC 4J6IA 4EZJA 1J8CA 2JZZA 2KNBA 1Q5WB 1M94A 1LFDA 2BPSA 2K25A 2KOXA 3ZDTA 2O6VA 1E8YA 4HLEA 2FNJB 4WJNA 3PGEA 2L0TA 2IZVB 3V6EB 4TUUA 3DVNU 2KWUB 4GGQA 2DYBA 3QARA 3CSFA 2IO2B 2G3QB 4FHJA 4K81A 4YL8A 2NPTB 4A3OA 4ZRKA 4HXDA 2HE7A 3VTUA 3VTVA 3RD2A 4AJYB 2AEHA 1I35A 2N1WA 2QHOA 2OJRA 3ONSA 5J17A 1IPGA 4IW0A 1LXDA 2M17A 4KVGB 1V80A 5JZEB 2LUEA 5L95C 3U30A 4MGYE 5IA7A 1ISNA 4GOCA 1XQQA 2JUOA 2KFJA 3OJ3A 3HIZA 4MELA 2IY0B 1L2NA 5AZHA 3VVWB 3WALA 5JH5C 3PS6A 4PS3A 4ANVA 1A5RA 4ICVA 2Y5BB 3MTNB 2UYZB 1NI2A 5CTRC 4FLHA 1WFYA 5DCNA 2G4DB 2KDFB 2GMIC 4TKNA 3U8ZA 4XX5A 2EMSA 2MBOA 4I6PA 5AEKB 3M62B 4BOSC 3NZSA 2LASA 4I6NB 3MHSD 1KLVA 3SDLC 2LVPA 3JW0X 2HTHA 2K8BA 3H7PB 3UIOB 3V62A 2KDBA 3QA8A 1R4NI 2LD9A 3A9KA 1UH6A 1WXSA 3BINA 1MG8A 2DZIA 4NJ7A 1WXVA 3APCA 2KWCA 5CX3A 3RZWC 1HE8A 4W9KA 2PPHA 2I1JA 3IVFA 1P98A 3L08A 2RGFA 1GJZA 2DYMA 2NBUA 4ICUA 4MSMB 4GIVA 2PEAA 4KSLC 3TJPA 2GBKA 4HPMB 3ZTDA 4FJZA 1G6JA 3R7RA 1V6EA 1D3ZA 3TCAA 2RD0A 1WJUA 2W9NA 5C23A 5AZGA 2FUHB 3A9KB 1UBQA 2REXA 2ZVOA 3B1LX 4KZCA 4AWJA 2CHWA 3QAQA 4X57B 4TQ0A 1YD8U 2BGFA 1EF1A 3Q3JA 4LJPB 1R4MI 1K8RB 3K9OB 3X0WA 2GBNA 2AL3A 2DAJA 4FHKA 4MDKE 4EEWA 4B95A 4G50A 5JHAA 2DZKA 1WGRA 4AP4C 3ZNHB 5DPWA 3KYCD 4W9EA 3JSVA 2DAFA 2IYDB 4OVUA 2J7QB 2L05A 1WGGA 2C9WB 1NDDA 4IM2A 3H7SA 3OLMD 3QC8B 3PRMB 2ZNVB 4LDTD 2KHWB 3KUZA 2J0KA 1WXAA
chains in the Genus database with same CATH superfamily
2IGGA 2MSED 1UGJA 1MI0A 2WGSA 2PVOD 4W9HA 2R2QA 4K3BA 4JWUC 3RULA 3W1YA 4W9LA 1RFAA 1VCBA 4N58A 1JRPA 3DBHI 3DCGA 2WDRB 3Q3NC 4M0WA 3AN1A 4MEMA 2DLBA 3WA0A 2C7HA 2WDTB 4WIPA 2WXNA 1T6BX 1YN3A 3A4SC 4KDIC 1B9RA 1C79A 4AOFA 3P63A 2OJWA 2MBHA 1EWYC 2QILA 1RLFA 4L23A 4KGSA 3VR8B 3RNEC 2O6VB 3S2AA 3VXWA 2N4FA 2MJEA 5T8IA 3SD5A 1JW9D 3VQIA 1UD7A 1N61A 2KFKA 4US9A 2JSVX 2WYQA 4W9IA 2MA9B 2PVGC 1TS3A 4M8NA 1XLQA 1FFUA 1WH3A 3FILA 2FCMA 2EKEC 1GNUA 1YQBA 3AULA 3QJZA 5BO4B 1JWBD 2JWZA 2MBEA 3I3TB 2KWVB 3R66C 1I4PA 2WHIA 4ANUA 4F7ZA 2BB6A 3NZUA 3RYTA 1MFWA 2KQSA 1NYQA 1Y56A 1LGRA 2LGDA 2WNMA 2XK5B 4W9CA 2N7EA 5D3DA 4EZKA 3QHTA 5GXGB 2KMMA 3L16A 4YT0B 1KM7A 1SJHD 3LXFA 2BB5A 2KO3A 1FRDA 4DQOC 1AARA 3AEDB 3Q6BA 4O1NA 2ZEQA 1ACCA 5LXIB 2XNAC 3T3OA 3Q14C 2IY1B 1OFFA 5LXHA 2D11A 1R7SA 1YX5B 5BYRA 2IO0B 2MJDA 1WGKA 4CYEA 1VLBA 2MWSB 1Z5SB 1F1HA 1FIQA 1WJNA 2KZRA 4YWGG 3WAPA 3RFZB 4ZDVA 1T0YA 1XCQL 4NJ6A 3PHWB 2DZMA 2WX0A 2CU3A 1WE7A 2NR2A 2M19A 1C4CA 4DHJB 4G3XB 2BWFA 1IUEA 1IP9A 2WU5B 2INCC 1VD2A 2FIDA 3ZIMA 2OOBB 1C3TA 2LGIA 4NJCA 4LTUA 2YEPF 3X23A 4K7UA 4FJVB 1IGDA 3AEEB 4GU2A 3AMZA 5G5HA 4US8A 3W1SC 1TGZB 2O6VD 1T0SC 2LRWA 2KT7A 2KAJA 1WM2A 1FO4A 2L00B 3VAWA 3BYTB 4G11A 3KH0A 3PTFC 3EGRA 1L4DB 4MM3B 3APFA 2KYWA 5D6JB 2WS3B 3AECB 2FCQA 3MJWA 4GDKA 1FD6A 1CQVA 1XXGA 1JRUA 3L13A 4J3OD 1F2RC 3BVZA 3EUB2 1RAXA 3UGBB 4IWQA 3M3JA 5J2RA 4F8CB 1SF0A 1SB3C 2BKFA 4RGTA 2IO1B 1SBBB 3HRDD 1TKGA 2KACA 1MG4A 1LM8B 2KTRA 1FM0D 5FR6A 4B9KA 1DYQA 4DDGD 4XWWA 3V6CB 2HD5B 2JY6A 1UGMA 3IAS1 4B0EA 1FXIA 1VZ6A 3Q8BA 3PT2B 3WANA 2ZZPB 1QLBB 2JT4B 2KN5A 2KTFA 3NVWA 3AB5A 5IN7A 4W9GA 3IG3A 2WXHA 1F77A 2CKHB 2EMTA 1PDXA 2LRUA 4GMVA 2JU6X 3AH7A 4XZ4A 2CR5A 3IHPC 1V9JA 4FA6A 1JROA 2KDIA 2CU1A 4DHJD 4NPNA 1E7VA 2OEDA 2ZPNA 2JZ3B 1I4GA 1ET9A 3ZKJC 1WX7A 1ET6A 2JPHA 2XN9C 2D3GA 1RFKA 3L0WB 4FADA 5D94A 3VUWA 1UBIA 2VH2A 1ZKHA 3HHMA 4WJPA 2ZVNA 1TYGB 1PUTA 3IBEA 2LVQA 2MCNB 3NY5A 2E3TA 2CJNA 5CHVC 5KHQA 2H88B 3WAOA 3ZTCA 4ZOHC 4BFRA 4K1RB 3FAHA 1WY8A 4HPLB 1EUVB 1L0XB 2QSDA 1J8CA 2VH1A 1M94A 2LEKA 2BS4B 2L1AA 1E8YA 4IDIA 4RF1A 4PK1A 3V6EB 3DVNU 2DYBA 3AE6B 2RDGA 2NPTB 4A3OA 2D5GA 4DXGA 2FBWB 3RD2A 4AJYB 1I35A 2QHOA 5EE0A 5JZEB 4KVGB 5L95C 4WH4A 1F2RI 5IA7A 1XQQA 2JUOA 2IY0B 3VVWB 3PS6A 2DWQA 1ZDVA 2PTLA 4ICVA 2FE8A 1NI2A 1WFYA 3AEFB 3N1ZC 1CJEA 1K51A 2WP9B 1N5WA 2GMIC 4TKNA 2EMSA 5AEKB 1YMHE 3M62B 2LASA 1XEEA 4I6NB 4JE3B 1KLVA 1V97A 3H8HA 2EELA 2LVPA 3RNCC 5HG2A 3QA8A 1DOYA 1UH6A 2WQYB 1VDVA 3R8BA 4NJ7A 2W54A 3APCA 3E9SA 5HFYA 2Y3AA 1TKYA 1P98A 2K3UA 1L4ZB 4KSLC 3TJPA 4HPMB 1G6JA 2K22A 1AW7A 3TCAA 2GI9A 2FUHB 3A9KB 1N5XA 1HZ5A 2DAJA 1MPEA 3BZDB 3JSVA 2IYDB 1NDDA 4IM2A 3QC8B 5E6JA 2KN4A 4OHJA 2WDQB 1I4HA 1HXYD 1WXAA 1GC7A 1TKEA 1P0RA 1WGYA 3ZVVA 1WGHA 5IKCM 4M01A 5IO9A 2MEKA 5CHWA 4W9FA 1EF5A 2XEWA 4DBGA 2D10A 3ZJUA 2ZCCA 3E56A 3NRZA 1FRRA 5E6OA 4ANXA 2A5UA 2INDC 2WXRA 3AI5A 5EE3A 2LFIA 1WRIA 3R3MA 3N1YC 3GZNI 2NTTA 1C76A 3RCZA 4ZHPA 2FIFA 1KF6B 1WYWB 3TUOA 1BXTA 2GLSA 1ENFA 1N6ZA 4AS1A 2DENB 2G45B 4M0WB 4P16A 4LLGM 1TY0A 2K39A 3L17A 4NY0A 4C7YA 1MHXA 1WXQA 2W82A 3ZUNA 3R7QA 1WX9A 3IT6B 4ASWC 1MHHE 4A20A 3DBSA 2MBBB 2DBYA 5FR3A 1WI0A 4C80A 2GBMA 2C5LC 3AEAB 2CHZA 3L54A 3NG0A 1BMLC 1F9JA 3EFCA 2LHDA 3ZNGC 3T8MA 2INNE 3ZGZA 3DVNV 2G9HD 1H8CA 1XLPA 4ZRJA 3RMKC 4BBNF 5FKAC 1YJIA 1KLUD 5G5GA 1DOXA 5C2TB 3FILB 4YSXB 3TBLD 1UNSA 3AE2B 4FJYA 3NHEB 2WLBA 2ZCBA 3AE4B 2ACZB 2NBWB 4WWNA 1RWSA 2G4SA 1ZOYB 2RDBC 4KIKA 2Y5PA 1XF5L 1IBXA 2N9PC 3MHZA 3K9PB 4KX6B 3VH4B 2GBJA 2I1KA 2KQ4X 3BYYB 2CS4A 2K8HA 1E8WA 4MJSA 3EA6A 3ML9A 2NCNA 1T5XD 1E5WA 1KRHA 3P4PB 3QX1A 2PMVA 1N63A 3J9CA 1YOVB 2BYFA 4NAWA 5D3IB 1JALA 2NTSA 1DGJA 2WXGA 2MJ3A 3PZ8A 4ACFA 4JPSA 3D32A 3V60A 1QOBA 3Q8AA 3PLVA 4HKQA 1SE4A 4II3B 1E8XA 4RF0A 1N62A 2KWDA 3PV1A 3ZJTA 2ZW0A 3Q8FA 1QOFA 4WQOB 3AE7B 3ZRCA 3KW5B 2MRPA 3ZQ4A 1TTNA 4R3DA 3DQVA 1UELA 3AXCA 2KJRA 4A9AA 3PSEB 4LDTB 4CQNA 2ZJDA 2LHEA 2J0JA 2NS5A 4L1BA 1WMHB 2LUMA 2KMAA 3AU4A 1ZGUB 2VRRB 4LK0M 4PS8A 1E8ZA 5H92C 1V49A 2Z8LA 5GMVA 4MT5A 4HRSA 1WJ4A 3KQ4A 3KUDB 1V81A 3BIID 5AZFA 5C1ZA 4B6WA 1V1OA 3ECIA 1SE9A 1TBEA 3AE8B 1WZ3A 2K0PA 1WE6A 2L0FA 3A9JA 2KK8A 1EU4A 4PYUA 4ZRIA 4GDLA 3NOBA 2N7JA 3H7PA 3PVLA 3W5VB 4GDKB 4DXFA 2QIEB 4RGOS 1GG3A 4XE0A 4E71A 1P7EA 3H6NA 2L52A 5MPOA 3GZNB 3A33B 3W1SA 4HVBA 1WM3A 2BKRB 3NZ3A 4MGKE 2CHXA 2KD0A 1D4BA 4M02A 4G0NB 2LXCA 3MP9A 2UWQA 4XYCA 1C1YB 5IAAC 1RYJA 2KTRB 2JXTA 5LNK1 1TY2A 2V3NA 4IG7B 2J0MA 3VR9B 4A3PA 2N0SB 3L4PA 1J19A 3NVYA 1FCCC 2GOWA 1SIFA 4OZBA 2QDFA 2JF5A 2BS3B 5DPRA 3LB8C 3PPAA 3SFEB 1XCTL 2M0AA 4WWOA 4F1SA 3P4RB 3RZFA 3AM9A 1I4RA 5DPSA 1MVKA 3N1XC 4FBJB 2ASQA 1GAQB 4EFOA 3KUCB 3I63C 1YQ3B 2BQQA 3APDA 4P6VF 4RCOA 2LXAA 1FNWA 3Q3OC 3OJ4B 3HK0A 4TMAB 2B3AA 3HVZA 2C7NB 1UWXA 2N9XA 3B9JA 1V8CA 4WQMA 2KX3A 2IJ0A 2N9EB 1I4QA 2BWES 1M4VA 3Q69A 4ZYNA 2ZPYA 4N9F4 4EKUA 1WJ6A 1YJ1A 2AX5A 2R2OA 3ZNZB 2JRIB 2WXOA 4XDDA 2MP2B 4CO7A 1TZ1A 2FAZA 2K5PA 4DK5A 1NEKB 1KJTA 4J6IA 4EZJA 4JX1C 2JZZA 4YTMB 1GB1A 2X8XX 2K25A 2KOXA 3ZDTA 2NMQA 2O6VA 3AE5B 3DWGC 4BAXA 3PGEA 3R2TA 5BYQA 2BS2B 3CWIA 3CSFA 1SSNA 2IO2B 4YL8A 4ZRKA 2HE7A 3V3XA 2ICIA 2N1WA 2OJRA 2LUEA 1ISNA 2KFJA 1L2NA 5AZHA 3WALA 5JH5C 4PS3A 3I5JC 2WU2B 2ZW1A 2WXPA 5CTRC 2UU7A 4FLHA 5DCNA 2VZKB 3ZXRA 4BOSC 2LJIA 1Q10A 2HTHA 3V62A 4HROA 2LD9A 3RN9C 1WXSA 3BINA 4OZCA 3AEBB 4OW0A 3RZWC 1I4XA 3O13A 4W9KA 1FEHA 3IVFA 4L2YA 4QAYA 1WYGA 2V9HA 4ICUA 3WCQA 4GIVA 2PEAA 2RDHA 3ZTDA 1D3ZA 1V1PA 2W9NA 5C23A 2JWUA 2ZVOA 3B1LX 4X57B 2BGFA 4LJPB 4Q2JA 1F0ZA 1NI3A 1XLNA 2AL3A 2G1EA 4G50A 2DZKA 4HEA1 2DAFA 4OVUA 1WGGA 3ABVB 1T0QC 5BMIA 2I2YA 3OLMD 3SR6A 1E0ZA 1QQRA 4XWTA 3PRMB 3URYA 1HTQA 1YQ4B 3KUZA 1L6VA 2LGSA 1T3QA 4YSYB 3CSTA 2V3SA 3CMMB 3RT3B 1Q1OA 1YX6B 1I7HA 3JSVB 1R4NB 2W55A 2KJHB 3ALBA 3U4EG 2JX5A 3ZRFA 4BKSD 3M95A 1X1MA 4GLSC 1ZW7A 2WXMA 2YVCA 4PT5A 3C0RB 2FCSA 4IWPA 3NVZA 1HQRD 4XGAB 2DZJA 1P7FA 4M8MA 3A4RA 3EFUA 3P4SB 2LWPA 4YSZB 2JXXA 3TEZA 2Q5WD 2KMCA 2Z59B 1L7YA 2JRHA 1OTRB 3ML8A 1ZP0B 3TSSA 2MBQA 3W2DA 1H4RA 3W5UB 1FXTB 4WWPA 3U52E 3TEWA 3QIJA 1L5PA 3OAWA 2RSUA 1NENB 4XDCA 4FULA 3SU8X 1OGWA 1CZPA 3DVGX 3PLUA 2BBCA 1WIAA 2LZ6A 2D07B 4TSSA 3OWEB 2KJ6A 5EDSA 1OQQA 3RNBC 4YXDB 4KGRA 3A1QA 1B1ZA 1IGCA 3LDZE 4IUMB 5HI1A 1ZUD2 4A8XC 3QK0A 2WXQA 3WAMA 2YEPB 4KV2A 3ZDMC 2QEJC 4URKA 3UIPB 4HCNB 2N7DA 1D5ZC 2KX0A 3NVVA 1VJKA 5TSSA 3C8YA 5BMHA 4FXCA 3PREA 3DHIC 3TIXA 1E10A 2WXJA 3N32A 4RGNA 3BVGA 2IBIB 3P42A 2BYVE 3OG5A 2XBBC 1NVID 1GC6A 3NS8A 2IO3B 3AU5A 3T9LA 3DHHC 3HM3A 4KIKB 2L76A 1FFVA 1I42A 2AWTA 2V4LA 3N30A 1RRBA 4JQWC 4LNKA 3VRBB 3DBLI 4E74A 3SHQA 1GUAB 3RUIB 2DX5B 1N60A 4NAWB 4ANWA 3GOEA 3TEXA 3CF6E 3KYDD 2V3PA 2AQ3B 3HVDA 4OVZA 4RM9A 1WZ0A 3BWUD 2YLMA 4ZRQA 2LMCA 2LJ5A 5IOIA 2MQJA 3BVMA 3PRZA 2Z0DB 4RH6A 2NPTA 2MW5A 3Q3MC 1GOZA 1E7PB 1SJED 3I9V1 1SE2A 3AE3B 4WURA 3PZDA 1ROEA 3DBRB 3RI7C 3UI3A 2PW9A 4BOZB 4K7WA 2AL6A 1WXMA 2JQRB 1NYRA 3QQ8B 1ZDXA 2WX1A 2DHZA 3DPDA 2LGXA 4K7SA 4LNOA 2M1MA 4XC2A 2D3CA 2K9XA 1BT0A 2JZPA 4WWMA 4YTNB 1C78A 1QKZA 3EECA 2KC1A 3VRAB 1PQSA 4DHZB 3N3KB 2M4NA 4EUTA 2QCZA 3AE9B 1K53A 2WXFA 4NQKE 1KOTA 2KFKB 3L10B 4USAA 3A9JB 3VUXA 4ZYSA 4DXAB 2J53A 1NBFC 3BK1A 4GDLB 1D5MC 4MGZE 5D7GA 2L83A 5LLIA 2IDYA 4TV3A 1SGHA 4REZA 1EWCA 4WJQA 2NVUI 3B2FA 4KZ0A 1HA5A 1FNUA 2M0XA 2DYOA 4DWFA 1XD3B 5EE9A 4MACA 2LGYA 3U2SC 2HJ8A 1OEYA 3GB1A 2DNFA 4CHKA 2K6QA 4HDOA 1S3SG 3FKYA 4WJOA 2PJHA 4MGIE 1FMAD 2RR9A 3Q8EA 2TSSA 4HCPB 4E3CA 5TR5A 4JGHB 3TL5A 1PGBA 1PFDA 1CK1A 4OVVA 3JVZX 4BKGA 1FPYA 2KVRA 4KSKC 1OEYJ 2WWZA 5L83A 4AQ7A 2O2VA 2OHFA 3DDCB 1Z2MA 3QWZB 4DHZE 3UF8A 2PLPA 1OQRA 4ZHOA 3GE3C 1TS5A 4A55A 5AUKA 1J7AA 1AYFA 4C7ZA 2LI5A 1SEBD 1XO3A 1A70A 4LCDE 3ETRA 4HK2A 3Q2AC 3WIMA 2RPQA 2GB1A 3VFKA 4C4VA 1VRAB 4A6QA 2N9KA 4N59A 4BVUC 2KNBA 2ONQA 4HKZE 4ITKA 4HLEA 2BPSA 2FNJB 4WJNA 2IZVB 3IAM1 4TUUA 2BVCA 2KWUB 4GGQA 1ZXHA 2WXLA 4ZRPA 1UF0A 2G3QB 3N9YC 4K81A 4S0RA 3DBLB 1STEA 3VTUA 4P1BC 3VTVA 3ZYYX 1HZ6A 2AEHA 3ONSA 2D3AA 1KTKA 4IW0A 1LXDA 2HTME 2M17A 3P1MA 1FXAA 3U30A 4GOCA 4MELA 3OJ3A 3HIZA 3GE8C 1A5RA 2HDEA 2Y5BB 3GP7A 3P4QB 2KDFB 4YTPB 4C00A 4M00A 2MBOA 4I6PA 2JYTA 3MHSD 3SDLC 2K8BA 4RGMA 3UIOB 2KDBA 1R4NI 1PYWD 1MG8A 2DZIA 1WXVA 2KWCA 5CX3A 1HE8A 3PZ7A 2PPHA 1ZPSA 4RFBA 2I1JA 3GS2A 2DYMA 1VZ8A 3R2IA 4MSMB 2GBKA 4FJZA 3ZJVA 2RD0A 1BUIC 1UBQA 4KZCA 3QAQA 2CJOA 1YD8U 1EF1A 4C56C 1K8RB 3K9OB 3X0WA 4FHKA 4MH8A 5JHAA 4AP4C 1KH0A 3KYCD 1RM6C 1D6EC 2C9WB 2J52A 1V1PB 1TZOA 2ZNVB 4LDTD 1E6EB 2KHWB 1E7UA 4KDLB 4JLCA 3HM6X 4HDQA 1FNVA 3UINB 1GB4A 1FCLA 3KLSX 3MC0B 3SFDB 1DOIA 1WMHA 4B0MA 2KDEB 4HJGE 2L7RA 3VH3B 1Q0WB 1Y8RC 5DPTA 3SEBA 2ON8A 2BW2A 4IM3A 2NBVB 2KC2A 4P7IA 1TS4A 2V0GA 1R4MB 5BYSA 2QJLA 2C60A 4RM8A 3U7ZA 1UUPA 1AWDA 2FUG1 3ENEA 2AYOB 3AE1B 4EOYA 2BT6A 1CMXB 3TMPB 1V5TA 4AUQC 1ZXIA 5BMGA 3IT4B 1QZEA 3H9DA 2W3SA 4AJWA 2WXKA 1UZXB 1YNTE 4I6LB 4W9DA 4GSWA 3EC8A 4WAFA 1QILA 2MLBA 1K50A 3MC8A 2XK5A 4JIOU 2D3BA 3VDZA 2C7MB 2WXIA 1TS2A 2M56B 2JVCA 4WAAA 3Q8CA 3ZLZA 5E6NA 3DBHB 2N9LA 3NJTA 4HWIB 1LQBA 3B08A 2QC8A 1U4AA 2EKIA 1L0YB 2KLCA 4NZLB 3NS1A 4H2AA 1EU3A 5HKHA 2AQ2B 2INPE 5G55A 1WGDA 3HUIA 4W9JA 2B76B 4JL9A 3RNGC 2KXJA 1JWSD 3P2BA 2BTEA 3C19A 5J18A 1L6UA 3A1QB 3H1UA 2PIAA 2PKOA 4EE2A 1QOGA 1QF6A 1YJJA 2R61A 3UQAA 3DOWA 1XT9B 1J0GA 3U7DA 4FN2A 3DBRI 4PS7A 5D2MB 1P1AA 3ZW3A 3UQBA 1YN5A 4MH0E 4MSQB 3ZNID 3EHVA 1XLOA 2HJ1A 1JCKB 1WR6E 2KKCA 2JYEA 3B0AA 2MHJA 1KFYB 2MP2A 2K6DB 1SE3A 1VZ7A 3DVGY 3I57A 1P3QU 4OZAA 1HTOA 2LVOA 2BF8B 3AV8A 3PHXB 4MM3A 4BKSA 2BYEA 2KLGA 1ZE3D 1C77A 2Z0EB 4BZAA 3BK2A 5JHBA 4RMAA 3ZXVA 2GBRA 3MJ5A 2KDMA 4BKTA 3IFWB 4GXBA 4IWOA 2KVZA 2BYTA 1V86A 2VZKD 5AUIA 2IGDA 3LYYA 3W9CB 1IYFA 2FCNA 2RMMA 3DHGC 1K52A 2KANA 2J42A 4RNAA 2N1VA 4IC7B 1YIWA 2Y5CA 4NQLB 5KHOA 1J7CA 2ZNVC 1WSPA 2A4ZA 3B2GA 2E6XA 1WWTA 4JWSC 2W3RA 2L8JA 2M8SA 4LNNA 4LNFA 5FK9C 1MJDA 3VTWA 3M63B 3MFGA 3QCAA 4HPPA 4EZLA 5HHDG 4PYZA 3V05A 1EO6A 3MC9A 5G2NA 4BBNC 1OQYA 2V1YA 3KWLA 3BY4B 2PE9A 1P9DU 4TQ1A 4KGTA 2K1FA 3PRPB 4LJOB 1V5OA 1J7BA 3CIRB 3VUYA 1L0VB 3LJ3A 1E90A 1SXTA 4KKIA 5EE1A 4GN1A 3JYUA 3IXSA 3NUHB 2MX2A 1S1QB 5E6PA 3N20C 2IPKD 3PO0A 1WRDB 1JWUD 3KVFB 1V2YA 4KKJA 4UDUC 2V4IB 1IBXB 4IM0A 1QT9A 3V61A 3VHTC 2SAKA 1WF9A 4MJSB 2D2QA 3KWVA 2PE6B 4ARCA 2K8CA 1ESFA 2L3ZA 1VR9A 2L32A 3RNFC 3RPFC 3TEYA 1UWMA 4II2B 3Q3FA 4DDID 1WX8A 5CHFA 4S17A 1WR1A 2O2VB 1F52A 4NNJB 2KQ7A 4HJKA 3O65B 1T0RC 2QMTA 3ZO5B 1Q5WB 3RNAC 3FC4A 3DWMA 1LFDA 1PGXA 3AEGB 2L0TA 2WDVB 2RPVA 1QOAA 3QARA 4C4VB 1D5XC 2IGHA 4FHJA 4HXDA 1C4AA 3T3NA 2I38A 5J17A 1IPGA 1JWMD 1E9MA 1V80A 4MGYE 1TJEA 4ARIA 4ANVA 3MTNB 4P1CC 2MH7A 2UYZB 5C3JB 1JMLA 1C4PA 1KLGD 2G4DB 3U8ZA 4LNIA 4XX5A 2GRIA 3NZSA 2H89B 3JW0X 3H7PB 1GPXA 4NAMA 2X38A 3A9KA 1C9FA 2J4XA 4D2KA 1JWAD 3L08A 2RGFA 1GJZA 1YN4A 2NBUA 5JXVA 1LO5D 4N6EB 3R7RA 1V6EA 1PGAA 1WJUA 5AZGA 2REXA 4AWJA 1HEZE 2CHWA 4IOIE 4TQ0A 1JQ4A 3Q3JA 1R4MI 5I4DA 2GBNA 4MDKE 4EEWA 4B95A 1WGRA 3ZNHB 4A90A 2AQ1B 5DPWA 4W9EA 2SEBD 5H8YE 4IKGA 1SIJA 1TIFA 2J7QB 2L05A 1TT5B 3H7SA 1EM7A 4K3CA 5IP4D 1AN8A 2J0KA 4GB9A
chains in the Genus database with same CATH topology
3CSTA 2MSED 1E7UA 1P0RA 1WGYA 4KDLB 3ZVVA 2V3SA 1WGHA 3CMMB 3RT3B 4JLCA 4W9HA 1Q1OA 1YX6B 3HM6X 4HDQA 2R2QA 5CHWA 4W9FA 1EF5A 2XEWA 3UINB 4DBGA 3JSVB 2D10A 2KJHB 3ALBA 3ZRFA 4BKSD 3M95A 2ZCCA 3RULA 3W1YA 1X1MA 1ZW7A 4W9LA 1RFAA 2YVCA 3C0RB 1VCBA 1WMHA 2FCSA 2KDEB 4IWPA 5E6OA 2L7RA 3VH3B 3DBHI 3DCGA 4ANXA 2A5UA 1Q0WB 2DZJA 1Y8RC 5DPTA 4MEMA 3AI5A 3WA0A 2C7HA 4M8MA 2WDTB 3A4RA 4IM3A 2NBVB 3EFUA 3R3MA 3GZNI 2KC2A 4P7IA 2LWPA 3RCZA 2JXXA 2KMCA 2Z59B 2C60A 2FIFA 1L7YA 4RM8A 1WYWB 3A4SC 2JRHA 4KDIC 3ENEA 4AOFA 2AYOB 1OTRB 3ML8A 2DENB 2G45B 2MBHA 4M0WB 4EOYA 1CMXB 3TMPB 1V5TA 2MBQA 2K39A 1RLFA 4AUQC 3L17A 4NY0A 1H4RA 2O6VB 4BKTA 3S2AA 3VXWA 1FXTB 4WWPA 1QZEA 2N4FA 3H9DA 3R7QA 3ZUNA 1WX9A 3QIJA 3OAWA 3SD5A 4AJWA 2RSUA 4ASWC 3VQIA 1UD7A 1UZXB 2KFKA 3DBSA 4A20A 2MBBB 4I6LB 4FULA 4W9DA 2WYQA 4W9IA 1WI0A 2MA9B 4GSWA 3SU8X 3EC8A 1OGWA 2GBMA 2C5LC 2MLBA 2CHZA 4M8NA 3L54A 3DVGX 1WH3A 2XK5A 3PLUA 4JIOU 1F9JA 2FCMA 3ZNGC 2EKEC 1GNUA 3T8MA 2C7MB 1WIAA 1YQBA 3VDZA 3AULA 2JVCA 3QJZA 2LZ6A 2D07B 4WAAA 5BO4B 2JWZA 3ZLZA 2MBEA 3DVNV 5E6NA 1H8CA 3I3TB 2KWVB 2KJ6A 3R66C 4HWIB 5EDSA 1LQBA 4ZRJA 4ANUA 4BBNF 3B08A 4F7ZA 1U4AA 3NZUA 3RYTA 2KQSA 3A1QA 3LDZE 4IUMB 2KLCA 2LGDA 3QK0A 2XK5B 5HKHA 4W9CA 2N7EA 3TBLD 5G55A 1WGDA 3WAMA 4W9JA 4EZKA 3QHTA 3NHEB 4FJYA 4JL9A 2KXJA 2ZCBA 4KV2A 3ZDMC 4URKA 2NBWB 3P2BA 3UIPB 3L16A 4HCNB 5J18A 1KM7A 2N7DA 4WWNA 2KX0A 2KO3A 2G4SA 1AARA 3A1QB 4KIKA 3H1UA 2ZEQA 2N9PC 5LXIB 3K9PB 3PREA 3VH4B 2GBJA 2I1KA 3TIXA 3UQAA 2IY1B 3DOWA 1XT9B 3N32A 2CS4A 2K8HA 1J0GA 1E8WA 4MJSA 5LXHA 2D11A 2IBIB 3U7DA 3ML9A 2BYVE 2NCNA 1YX5B 1E5WA 4FN2A 2XBBC 3DBRI 1GC6A 3NS8A 4PS7A 2IO3B 3AU5A 2IO0B 3QX1A 3T9LA 5D2MB 4CYEA 2MWSB 1Z5SB 2BYFA 3HM3A 4KIKB 4NAWA 1WJNA 2L76A 2KZRA 3WAPA 1P1AA 3ZW3A 3UQBA 4ZDVA 1I42A 4MH0E 1T0YA 2AWTA 4MSQB 2V4LA 3N30A 4NJ6A 3ZNID 1RRBA 3EHVA 3D32A 3PHWB 2DZMA 4JQWC 3V60A 2WX0A 1WR6E 2KKCA 3DBLI 1WE7A 4E74A 2NR2A 3B0AA 3PLVA 3SHQA 4DHJB 1GUAB 4II3B 3RUIB 4G3XB 1E8XA 2BWFA 3PV1A 2MP2A 2K6DB 1IP9A 2DX5B 3DVGY 4NAWB 4WQOB 4ANWA 3GOEA 1P3QU 1VD2A 2FIDA 3ZIMA 2OOBB 1C3TA 3CF6E 3ZRCA 3KW5B 3KYDD 2MRPA 2LVOA 1TTNA 2BF8B 3DQVA 1UELA 3X23A 3AXCA 4K7UA 3PHXB 4FJVB 4GU2A 4MM3A 4RM9A 2KJRA 4BKSA 1WZ0A 2YLMA 3PSEB 4LDTB 1GC7A 3W1SC 2BYEA 2KLGA 2Z0EB 1TGZB 2O6VD 2ZJDA 2J0JA 2NS5A 2LJ5A 5JHBA 2LRWA 1WMHB 2MQJA 1WM2A 4RMAA 2GBRA 2L00B 3VAWA 2KMAA 3AU4A 1ZGUB 3PRZA 2Z0DB 2VRRB 3KH0A 3PTFC 1E8ZA 3IFWB 4G11A 2NPTA 1V49A 4GXBA 2MW5A 4PS8A 5GMVA 1WJ4A 4IWOA 3KUDB 3PZDA 1V86A 3APFA 1V81A 4BOZB 4K7WA 5D6JB 2AL6A 1WXMA 3QQ8B 5AZFA 2FCQA 2WX1A 3MJWA 2DHZA 3DPDA 2FCNA 2LGXA 4K7SA 4GDKA 1IYFA 5C1ZA 4B6WA 1JRUA 3L13A 2M1MA 3ECIA 1SE9A 4XC2A 1TBEA 2KANA 1WZ3A 1RAXA 1BT0A 2N1VA 3UGBB 4IWQA 1WE6A 4IC7B 1YIWA 2L0FA 4NQLB 3M3JA 5KHOA 3EECA 2KC1A 3A9JA 5J2RA 1PQSA 2ZNVC 4DHZB 2KK8A 3N3KB 4PYUA 2M4NA 4ZRIA 4EUTA 4F8CB 2A4ZA 4GDLA 2BKFA 3NOBA 2IO1B 3H7PA 3PVLA 2L8JA 2M8SA 4NQKE 1KOTA 4GDKB 2KTRA 1LM8B 5FR6A 1GG3A 4B9KA 2KFKB 3L10B 4E71A 3H6NA 3VTWA 4DDGD 3W1SA 3A33B 3V6CB 2HD5B 4HVBA 3A9JB 1WM3A 2BKRB 3M63B 3QCAA 3VUXA 2JY6A 4DXAB 4EZLA 4MGKE 1UGMA 2CHXA 2KD0A 4PYZA 1EO6A 1NBFC 4G0NB 4GDLB 2LXCA 5G2NA 4MGZE 5D7GA 1OQYA 4BBNC 2V1YA 2UWQA 5LLIA 3PT2B 3WANA 3BY4B 1C1YB 2PE9A 1P9DU 5IAAC 4TV3A 1SGHA 2KTRB 4TQ1A 2ZZPB 2K1FA 2JT4B 2KN5A 3PRPB 4WJQA 2KTFA 4LJOB 2NVUI 1V5OA 4KZ0A 4IG7B 3VUYA 2J0MA 3LJ3A 2M0XA 4W9GA 2DYOA 4A3PA 4DWFA 3IG3A 1J19A 1E90A 1XD3B 2CKHB 2EMTA 2GOWA 2LGYA 1SIFA 2LRUA 4GN1A 2HJ8A 1OEYA 3JYUA 2MX2A 4GMVA 1S1QB 2JF5A 5E6PA 5DPRA 4XZ4A 3PPAA 2CR5A 3IHPC 4WWOA 4F1SA 1V9JA 4FA6A 3RZFA 2KDIA 2CU1A 1WRDB 4DHJD 5DPSA 4CHKA 3KVFB 2K6QA 1V2YA 4HDOA 1S3SG 4NPNA 1E7VA 4WJOA 2PJHA 4MGIE 4FBJB 2ZPNA 2RR9A 2ASQA 4IM0A 4EFOA 3KUCB 4HCPB 4E3CA 2JZ3B 3V61A 5TR5A 3APDA 4JGHB 1WX7A 3ZKJC 3TL5A 3VHTC 2JPHA 4OVVA 1WF9A 3JVZX 4MJSB 2D3GA 2D2QA 2LXAA 3L0WB 4BKGA 4FADA 2PE6B 2KVRA 5D94A 4KSKC 3OJ4B 1OEYJ 2WWZA 1UBIA 3HK0A 3VUWA 2K8CA 2B3AA 2L3ZA 2O2VA 5L83A 1ZKHA 3HHMA 3DDCB 3QWZB 1Z2MA 4WJPA 2C7NB 4DHZE 2N9XA 3UF8A 2ZVNA 2KX3A 3IBEA 2LVQA 2N9EB 2BWES 2MCNB 3NY5A 4ZYNA 2ZPYA 4II2B 3Q3FA 4N9F4 4DDID 4EKUA 1WX8A 5CHVC 5KHQA 2LI5A 1WJ6A 5CHFA 1YJ1A 3WAOA 3ZTCA 2R2OA 3ZNZB 2JRIB 4BFRA 4K1RB 4LCDE 1WR1A 1WY8A 2MP2B 2O2VB 4HK2A 3WIMA 4CO7A 4HPLB 4NNJB 2KQ7A 2RPQA 3VFKA 1TZ1A 2FAZA 3O65B 4HJKA 4DK5A 1KJTA 1EUVB 3ZO5B 4GB9A 4BVUC 4J6IA 4EZJA 1J8CA 2JZZA 2KNBA 1Q5WB 1M94A 1LFDA 2BPSA 2K25A 2KOXA 3ZDTA 2O6VA 1E8YA 4HLEA 2FNJB 4WJNA 3PGEA 2L0TA 2IZVB 3V6EB 4TUUA 3DVNU 2KWUB 4GGQA 2DYBA 3QARA 3CSFA 2IO2B 2G3QB 4FHJA 4K81A 4YL8A 2NPTB 4A3OA 4ZRKA 4HXDA 2HE7A 3VTUA 3VTVA 3RD2A 4AJYB 2AEHA 1I35A 2N1WA 2QHOA 2OJRA 3ONSA 5J17A 1IPGA 4IW0A 1LXDA 2M17A 4KVGB 1V80A 5JZEB 2LUEA 5L95C 3U30A 4MGYE 5IA7A 1ISNA 4GOCA 1XQQA 2JUOA 2KFJA 3OJ3A 3HIZA 4MELA 2IY0B 1L2NA 5AZHA 3VVWB 3WALA 5JH5C 3PS6A 4PS3A 4ANVA 1A5RA 4ICVA 2Y5BB 3MTNB 2UYZB 1NI2A 5CTRC 4FLHA 1WFYA 5DCNA 2G4DB 2KDFB 2GMIC 4TKNA 3U8ZA 4XX5A 2EMSA 2MBOA 4I6PA 5AEKB 3M62B 4BOSC 3NZSA 2LASA 4I6NB 3MHSD 1KLVA 3SDLC 2LVPA 3JW0X 2HTHA 2K8BA 3H7PB 3UIOB 3V62A 2KDBA 3QA8A 1R4NI 2LD9A 3A9KA 1UH6A 1WXSA 3BINA 1MG8A 2DZIA 4NJ7A 1WXVA 3APCA 2KWCA 5CX3A 3RZWC 1HE8A 4W9KA 2PPHA 2I1JA 3IVFA 1P98A 3L08A 2RGFA 1GJZA 2DYMA 2NBUA 4ICUA 4MSMB 4GIVA 2PEAA 4KSLC 3TJPA 2GBKA 4HPMB 3ZTDA 4FJZA 1G6JA 3R7RA 1V6EA 1D3ZA 3TCAA 2RD0A 1WJUA 2W9NA 5C23A 5AZGA 2FUHB 3A9KB 1UBQA 2REXA 2ZVOA 3B1LX 4KZCA 4AWJA 2CHWA 3QAQA 4X57B 4TQ0A 1YD8U 2BGFA 1EF1A 3Q3JA 4LJPB 1R4MI 1K8RB 3K9OB 3X0WA 2GBNA 2AL3A 2DAJA 4FHKA 4MDKE 4EEWA 4B95A 4G50A 5JHAA 2DZKA 1WGRA 4AP4C 3ZNHB 5DPWA 3KYCD 4W9EA 3JSVA 2DAFA 2IYDB 4OVUA 2J7QB 2L05A 1WGGA 2C9WB 1NDDA 4IM2A 3H7SA 3OLMD 3QC8B 3PRMB 2ZNVB 4LDTD 2KHWB 3KUZA 2J0KA 1WXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CST A;  2MSE D;  1E7U A;  1P0R A;  1WGY A;  4KDL B;  3ZVV A;  2V3S A;  1WGH A;  3CMM B;  3RT3 B;  4JLC A;  4W9H A;  1Q1O A;  1YX6 B;  3HM6 X;  4HDQ A;  2R2Q A;  5CHW A;  4W9F A;  1EF5 A;  2XEW A;  3UIN B;  4DBG A;  3JSV B;  2D10 A;  2KJH B;  3ALB A;  3ZRF A;  4BKS D;  3M95 A;  2ZCC A;  3RUL A;  3W1Y A;  1X1M A;  1ZW7 A;  4W9L A;  1RFA A;  2YVC A;  3C0R B;  1VCB A;  1WMH A;  2FCS A;  2KDE B;  4IWP A;  5E6O A;  2L7R A;  3VH3 B;  3DBH I;  3DCG A;  4ANX A;  2A5U A;  1Q0W B;  2DZJ A;  1Y8R C;  5DPT A;  4MEM A;  3AI5 A;  3WA0 A;  2C7H A;  4M8M A;  2WDT B;  3A4R A;  4IM3 A;  2NBV B;  3EFU A;  3R3M A;  3GZN I;  2KC2 A;  4P7I A;  2LWP A;  3RCZ A;  2JXX A;  2KMC A;  2Z59 B;  2C60 A;  2FIF A;  1L7Y A;  4RM8 A;  1WYW B;  3A4S C;  2JRH A;  4KDI C;  3ENE A;  4AOF A;  2AYO B;  1OTR B;  3ML8 A;  2DEN B;  2G45 B;  2MBH A;  4M0W B;  4EOY A;  1CMX B;  3TMP B;  1V5T A;  2MBQ A;  2K39 A;  1RLF A;  4AUQ C;  3L17 A;  4NY0 A;  1H4R A;  2O6V B;  4BKT A;  3S2A A;  3VXW A;  1FXT B;  4WWP A;  1QZE A;  2N4F A;  3H9D A;  3R7Q A;  3ZUN A;  1WX9 A;  3QIJ A;  3OAW A;  3SD5 A;  4AJW A;  2RSU A;  4ASW C;  3VQI A;  1UD7 A;  1UZX B;  2KFK A;  3DBS A;  4A20 A;  2MBB B;  4I6L B;  4FUL A;  4W9D A;  2WYQ A;  4W9I A;  1WI0 A;  2MA9 B;  4GSW A;  3SU8 X;  3EC8 A;  1OGW A;  2GBM A;  2C5L C;  2MLB A;  2CHZ A;  4M8N A;  3L54 A;  3DVG X;  1WH3 A;  2XK5 A;  3PLU A;  4JIO U;  1F9J A;  2FCM A;  3ZNG C;  2EKE C;  1GNU A;  3T8M A;  2C7M B;  1WIA A;  1YQB A;  3VDZ A;  3AUL A;  2JVC A;  3QJZ A;  2LZ6 A;  2D07 B;  4WAA A;  5BO4 B;  2JWZ A;  3ZLZ A;  2MBE A;  3DVN V;  5E6N A;  1H8C A;  3I3T B;  2KWV B;  2KJ6 A;  3R66 C;  4HWI B;  5EDS A;  1LQB A;  4ZRJ A;  4ANU A;  4BBN F;  3B08 A;  4F7Z A;  1U4A A;  3NZU A;  3RYT A;  2KQS A;  3A1Q A;  3LDZ E;  4IUM B;  2KLC A;  2LGD A;  3QK0 A;  2XK5 B;  5HKH A;  4W9C A;  2N7E A;  3TBL D;  5G55 A;  1WGD A;  3WAM A;  4W9J A;  4EZK A;  3QHT A;  3NHE B;  4FJY A;  4JL9 A;  2KXJ A;  2ZCB A;  4KV2 A;  3ZDM C;  4URK A;  2NBW B;  3P2B A;  3UIP B;  3L16 A;  4HCN B;  5J18 A;  1KM7 A;  2N7D A;  4WWN A;  2KX0 A;  2KO3 A;  2G4S A;  1AAR A;  3A1Q B;  4KIK A;  3H1U A;  2ZEQ A;  2N9P C;  5LXI B;  3K9P B;  3PRE A;  3VH4 B;  2GBJ A;  2I1K A;  3TIX A;  3UQA A;  2IY1 B;  3DOW A;  1XT9 B;  3N32 A;  2CS4 A;  2K8H A;  1J0G A;  1E8W A;  4MJS A;  5LXH A;  2D11 A;  2IBI B;  3U7D A;  3ML9 A;  2BYV E;  2NCN A;  1YX5 B;  1E5W A;  4FN2 A;  2XBB C;  3DBR I;  1GC6 A;  3NS8 A;  4PS7 A;  2IO3 B;  3AU5 A;  2IO0 B;  3QX1 A;  3T9L A;  5D2M B;  4CYE A;  2MWS B;  1Z5S B;  2BYF A;  3HM3 A;  4KIK B;  4NAW A;  1WJN A;  2L76 A;  2KZR A;  3WAP A;  1P1A A;  3ZW3 A;  3UQB A;  4ZDV A;  1I42 A;  4MH0 E;  1T0Y A;  2AWT A;  4MSQ B;  2V4L A;  3N30 A;  4NJ6 A;  3ZNI D;  1RRB A;  3EHV A;  3D32 A;  3PHW B;  2DZM A;  4JQW C;  3V60 A;  2WX0 A;  1WR6 E;  2KKC A;  3DBL I;  1WE7 A;  4E74 A;  2NR2 A;  3B0A A;  3PLV A;  3SHQ A;  4DHJ B;  1GUA B;  4II3 B;  3RUI B;  4G3X B;  1E8X A;  2BWF A;  3PV1 A;  2MP2 A;  2K6D B;  1IP9 A;  2DX5 B;  3DVG Y;  4NAW B;  4WQO B;  4ANW A;  3GOE A;  1P3Q U;  1VD2 A;  2FID A;  3ZIM A;  2OOB B;  1C3T A;  3CF6 E;  3ZRC A;  3KW5 B;  3KYD D;  2MRP A;  2LVO A;  1TTN A;  2BF8 B;  3DQV A;  1UEL A;  3X23 A;  3AXC A;  4K7U A;  3PHX B;  4FJV B;  4GU2 A;  4MM3 A;  4RM9 A;  2KJR A;  4BKS A;  1WZ0 A;  2YLM A;  3PSE B;  4LDT B;  1GC7 A;  3W1S C;  2BYE A;  2KLG A;  2Z0E B;  1TGZ B;  2O6V D;  2ZJD A;  2J0J A;  2NS5 A;  2LJ5 A;  5JHB A;  2LRW A;  1WMH B;  2MQJ A;  1WM2 A;  4RMA A;  2GBR A;  2L00 B;  3VAW A;  2KMA A;  3AU4 A;  1ZGU B;  3PRZ A;  2Z0D B;  2VRR B;  3KH0 A;  3PTF C;  1E8Z A;  3IFW B;  4G11 A;  2NPT A;  1V49 A;  4GXB A;  2MW5 A;  4PS8 A;  5GMV A;  1WJ4 A;  4IWO A;  3KUD B;  3PZD A;  1V86 A;  3APF A;  1V81 A;  4BOZ B;  4K7W A;  5D6J B;  2AL6 A;  1WXM A;  3QQ8 B;  5AZF A;  2FCQ A;  2WX1 A;  3MJW A;  2DHZ A;  3DPD A;  2FCN A;  2LGX A;  4K7S A;  4GDK A;  1IYF A;  5C1Z A;  4B6W A;  1JRU A;  3L13 A;  2M1M A;  3ECI A;  1SE9 A;  4XC2 A;  1TBE A;  2KAN A;  1WZ3 A;  1RAX A;  1BT0 A;  2N1V A;  3UGB B;  4IWQ A;  1WE6 A;  4IC7 B;  1YIW A;  2L0F A;  4NQL B;  3M3J A;  5KHO A;  3EEC A;  2KC1 A;  3A9J A;  5J2R A;  1PQS A;  2ZNV C;  4DHZ B;  2KK8 A;  3N3K B;  4PYU A;  2M4N A;  4ZRI A;  4EUT A;  4F8C B;  2A4Z A;  4GDL A;  2BKF A;  3NOB A;  2IO1 B;  3H7P A;  3PVL A;  2L8J A;  2M8S A;  4NQK E;  1KOT A;  4GDK B;  2KTR A;  1LM8 B;  5FR6 A;  1GG3 A;  4B9K A;  2KFK B;  3L10 B;  4E71 A;  3H6N A;  3VTW A;  4DDG D;  3W1S A;  3A33 B;  3V6C B;  2HD5 B;  4HVB A;  3A9J B;  1WM3 A;  2BKR B;  3M63 B;  3QCA A;  3VUX A;  2JY6 A;  4DXA B;  4EZL A;  4MGK E;  1UGM A;  2CHX A;  2KD0 A;  4PYZ A;  1EO6 A;  1NBF C;  4G0N B;  4GDL B;  2LXC A;  5G2N A;  4MGZ E;  5D7G A;  1OQY A;  4BBN C;  2V1Y A;  2UWQ A;  5LLI A;  3PT2 B;  3WAN A;  3BY4 B;  1C1Y B;  2PE9 A;  1P9D U;  5IAA C;  4TV3 A;  1SGH A;  2KTR B;  4TQ1 A;  2ZZP B;  2K1F A;  2JT4 B;  2KN5 A;  3PRP B;  4WJQ A;  2KTF A;  4LJO B;  2NVU I;  1V5O A;  4KZ0 A;  4IG7 B;  3VUY A;  2J0M A;  3LJ3 A;  2M0X A;  4W9G A;  2DYO A;  4A3P A;  4DWF A;  3IG3 A;  1J19 A;  1E90 A;  1XD3 B;  2CKH B;  2EMT A;  2GOW A;  2LGY A;  1SIF A;  2LRU A;  4GN1 A;  2HJ8 A;  1OEY A;  3JYU A;  2MX2 A;  4GMV A;  1S1Q B;  2JF5 A;  5E6P A;  5DPR A;  4XZ4 A;  3PPA A;  2CR5 A;  3IHP C;  4WWO A;  4F1S A;  1V9J A;  4FA6 A;  3RZF A;  2KDI A;  2CU1 A;  1WRD B;  4DHJ D;  5DPS A;  4CHK A;  3KVF B;  2K6Q A;  1V2Y A;  4HDO A;  1S3S G;  4NPN A;  1E7V A;  4WJO A;  2PJH A;  4MGI E;  4FBJ B;  2ZPN A;  2RR9 A;  2ASQ A;  4IM0 A;  4EFO A;  3KUC B;  4HCP B;  4E3C A;  2JZ3 B;  3V61 A;  5TR5 A;  3APD A;  4JGH B;  1WX7 A;  3ZKJ C;  3TL5 A;  3VHT C;  2JPH A;  4OVV A;  1WF9 A;  3JVZ X;  4MJS B;  2D3G A;  2D2Q A;  2LXA A;  3L0W B;  4BKG A;  4FAD A;  2PE6 B;  2KVR A;  5D94 A;  4KSK C;  3OJ4 B;  1OEY J;  2WWZ A;  1UBI A;  3HK0 A;  3VUW A;  2K8C A;  2B3A A;  2L3Z A;  2O2V A;  5L83 A;  1ZKH A;  3HHM A;  3DDC B;  3QWZ B;  1Z2M A;  4WJP A;  2C7N B;  4DHZ E;  2N9X A;  3UF8 A;  2ZVN A;  2KX3 A;  3IBE A;  2LVQ A;  2N9E B;  2BWE S;  2MCN B;  3NY5 A;  4ZYN A;  2ZPY A;  4II2 B;  3Q3F A;  4N9F 4;  4DDI D;  4EKU A;  1WX8 A;  5CHV C;  5KHQ A;  2LI5 A;  1WJ6 A;  5CHF A;  1YJ1 A;  3WAO A;  3ZTC A;  2R2O A;  3ZNZ B;  2JRI B;  4BFR A;  4K1R B;  4LCD E;  1WR1 A;  1WY8 A;  2MP2 B;  2O2V B;  4HK2 A;  3WIM A;  4CO7 A;  4HPL B;  4NNJ B;  2KQ7 A;  2RPQ A;  3VFK A;  1TZ1 A;  2FAZ A;  3O65 B;  4HJK A;  4DK5 A;  1KJT A;  1EUV B;  3ZO5 B;  4GB9 A;  4BVU C;  4J6I A;  4EZJ A;  1J8C A;  2JZZ A;  2KNB A;  1Q5W B;  1M94 A;  1LFD A;  2BPS A;  2K25 A;  2KOX A;  3ZDT A;  2O6V A;  1E8Y A;  4HLE A;  2FNJ B;  4WJN A;  3PGE A;  2L0T A;  2IZV B;  3V6E B;  4TUU A;  3DVN U;  2KWU B;  4GGQ A;  2DYB A;  3QAR A;  3CSF A;  2IO2 B;  2G3Q B;  4FHJ A;  4K81 A;  4YL8 A;  2NPT B;  4A3O A;  4ZRK A;  4HXD A;  2HE7 A;  3VTU A;  3VTV A;  3RD2 A;  4AJY B;  2AEH A;  1I35 A;  2N1W A;  2QHO A;  2OJR A;  3ONS A;  5J17 A;  1IPG A;  4IW0 A;  1LXD A;  2M17 A;  4KVG B;  1V80 A;  5JZE B;  2LUE A;  5L95 C;  3U30 A;  4MGY E;  5IA7 A;  1ISN A;  4GOC A;  1XQQ A;  2JUO A;  2KFJ A;  3OJ3 A;  3HIZ A;  4MEL A;  2IY0 B;  1L2N A;  5AZH A;  3VVW B;  3WAL A;  5JH5 C;  3PS6 A;  4PS3 A;  4ANV A;  1A5R A;  4ICV A;  2Y5B B;  3MTN B;  2UYZ B;  1NI2 A;  5CTR C;  4FLH A;  1WFY A;  5DCN A;  2G4D B;  2KDF B;  2GMI C;  4TKN A;  3U8Z A;  4XX5 A;  2EMS A;  2MBO A;  4I6P A;  5AEK B;  3M62 B;  4BOS C;  3NZS A;  2LAS A;  4I6N B;  3MHS D;  1KLV A;  3SDL C;  2LVP A;  3JW0 X;  2HTH A;  2K8B A;  3H7P B;  3UIO B;  3V62 A;  2KDB A;  3QA8 A;  1R4N I;  2LD9 A;  3A9K A;  1UH6 A;  1WXS A;  3BIN A;  1MG8 A;  2DZI A;  4NJ7 A;  1WXV A;  3APC A;  2KWC A;  5CX3 A;  3RZW C;  1HE8 A;  4W9K A;  2PPH A;  2I1J A;  3IVF A;  1P98 A;  3L08 A;  2RGF A;  1GJZ A;  2DYM A;  2NBU A;  4ICU A;  4MSM B;  4GIV A;  2PEA A;  4KSL C;  3TJP A;  2GBK A;  4HPM B;  3ZTD A;  4FJZ A;  1G6J A;  3R7R A;  1V6E A;  1D3Z A;  3TCA A;  2RD0 A;  1WJU A;  2W9N A;  5C23 A;  5AZG A;  2FUH B;  3A9K B;  1UBQ A;  2REX A;  2ZVO A;  3B1L X;  4KZC A;  4AWJ A;  2CHW A;  3QAQ A;  4X57 B;  4TQ0 A;  1YD8 U;  2BGF A;  1EF1 A;  3Q3J A;  4LJP B;  1R4M I;  1K8R B;  3K9O B;  3X0W A;  2GBN A;  2AL3 A;  2DAJ A;  4FHK A;  4MDK E;  4EEW A;  4B95 A;  4G50 A;  5JHA A;  2DZK A;  1WGR A;  4AP4 C;  3ZNH B;  5DPW A;  3KYC D;  4W9E A;  3JSV A;  2DAF A;  2IYD B;  4OVU A;  2J7Q B;  2L05 A;  1WGG A;  2C9W B;  1NDD A;  4IM2 A;  3H7S A;  3OLM D;  3QC8 B;  3PRM B;  2ZNV B;  4LDT D;  2KHW B;  3KUZ A;  2J0K A;  1WXA A; 
#chains in the Genus database with same CATH topology
 2IGG A;  2MSE D;  1UGJ A;  1MI0 A;  2WGS A;  2PVO D;  4W9H A;  2R2Q A;  4K3B A;  4JWU C;  3RUL A;  3W1Y A;  4W9L A;  1RFA A;  1VCB A;  4N58 A;  1JRP A;  3DBH I;  3DCG A;  2WDR B;  3Q3N C;  4M0W A;  3AN1 A;  4MEM A;  2DLB A;  3WA0 A;  2C7H A;  2WDT B;  4WIP A;  2WXN A;  1T6B X;  1YN3 A;  3A4S C;  4KDI C;  1B9R A;  1C79 A;  4AOF A;  3P63 A;  2OJW A;  2MBH A;  1EWY C;  2QIL A;  1RLF A;  4L23 A;  4KGS A;  3VR8 B;  3RNE C;  2O6V B;  3S2A A;  3VXW A;  2N4F A;  2MJE A;  5T8I A;  3SD5 A;  1JW9 D;  3VQI A;  1UD7 A;  1N61 A;  2KFK A;  4US9 A;  2JSV X;  2WYQ A;  4W9I A;  2MA9 B;  2PVG C;  1TS3 A;  4M8N A;  1XLQ A;  1FFU A;  1WH3 A;  3FIL A;  2FCM A;  2EKE C;  1GNU A;  1YQB A;  3AUL A;  3QJZ A;  5BO4 B;  1JWB D;  2JWZ A;  2MBE A;  3I3T B;  2KWV B;  3R66 C;  1I4P A;  2WHI A;  4ANU A;  4F7Z A;  2BB6 A;  3NZU A;  3RYT A;  1MFW A;  2KQS A;  1NYQ A;  1Y56 A;  1LGR A;  2LGD A;  2WNM A;  2XK5 B;  4W9C A;  2N7E A;  5D3D A;  4EZK A;  3QHT A;  5GXG B;  2KMM A;  3L16 A;  4YT0 B;  1KM7 A;  1SJH D;  3LXF A;  2BB5 A;  2KO3 A;  1FRD A;  4DQO C;  1AAR A;  3AED B;  3Q6B A;  4O1N A;  2ZEQ A;  1ACC A;  5LXI B;  2XNA C;  3T3O A;  3Q14 C;  2IY1 B;  1OFF A;  5LXH A;  2D11 A;  1R7S A;  1YX5 B;  5BYR A;  2IO0 B;  2MJD A;  1WGK A;  4CYE A;  1VLB A;  2MWS B;  1Z5S B;  1F1H A;  1FIQ A;  1WJN A;  2KZR A;  4YWG G;  3WAP A;  3RFZ B;  4ZDV A;  1T0Y A;  1XCQ L;  4NJ6 A;  3PHW B;  2DZM A;  2WX0 A;  2CU3 A;  1WE7 A;  2NR2 A;  2M19 A;  1C4C A;  4DHJ B;  4G3X B;  2BWF A;  1IUE A;  1IP9 A;  2WU5 B;  2INC C;  1VD2 A;  2FID A;  3ZIM A;  2OOB B;  1C3T A;  2LGI A;  4NJC A;  4LTU A;  2YEP F;  3X23 A;  4K7U A;  4FJV B;  1IGD A;  3AEE B;  4GU2 A;  3AMZ A;  5G5H A;  4US8 A;  3W1S C;  1TGZ B;  2O6V D;  1T0S C;  2LRW A;  2KT7 A;  2KAJ A;  1WM2 A;  1FO4 A;  2L00 B;  3VAW A;  3BYT B;  4G11 A;  3KH0 A;  3PTF C;  3EGR A;  1L4D B;  4MM3 B;  3APF A;  2KYW A;  5D6J B;  2WS3 B;  3AEC B;  2FCQ A;  3MJW A;  4GDK A;  1FD6 A;  1CQV A;  1XXG A;  1JRU A;  3L13 A;  4J3O D;  1F2R C;  3BVZ A;  3EUB 2;  1RAX A;  3UGB B;  4IWQ A;  3M3J A;  5J2R A;  4F8C B;  1SF0 A;  1SB3 C;  2BKF A;  4RGT A;  2IO1 B;  1SBB B;  3HRD D;  1TKG A;  2KAC A;  1MG4 A;  1LM8 B;  2KTR A;  1FM0 D;  5FR6 A;  4B9K A;  1DYQ A;  4DDG D;  4XWW A;  3V6C B;  2HD5 B;  2JY6 A;  1UGM A;  3IAS 1;  4B0E A;  1FXI A;  1VZ6 A;  3Q8B A;  3PT2 B;  3WAN A;  2ZZP B;  1QLB B;  2JT4 B;  2KN5 A;  2KTF A;  3NVW A;  3AB5 A;  5IN7 A;  4W9G A;  3IG3 A;  2WXH A;  1F77 A;  2CKH B;  2EMT A;  1PDX A;  2LRU A;  4GMV A;  2JU6 X;  3AH7 A;  4XZ4 A;  2CR5 A;  3IHP C;  1V9J A;  4FA6 A;  1JRO A;  2KDI A;  2CU1 A;  4DHJ D;  4NPN A;  1E7V A;  2OED A;  2ZPN A;  2JZ3 B;  1I4G A;  1ET9 A;  3ZKJ C;  1WX7 A;  1ET6 A;  2JPH A;  2XN9 C;  2D3G A;  1RFK A;  3L0W B;  4FAD A;  5D94 A;  3VUW A;  1UBI A;  2VH2 A;  1ZKH A;  3HHM A;  4WJP A;  2ZVN A;  1TYG B;  1PUT A;  3IBE A;  2LVQ A;  2MCN B;  3NY5 A;  2E3T A;  2CJN A;  5CHV C;  5KHQ A;  2H88 B;  3WAO A;  3ZTC A;  4ZOH C;  4BFR A;  4K1R B;  3FAH A;  1WY8 A;  4HPL B;  1EUV B;  1L0X B;  2QSD A;  1J8C A;  2VH1 A;  1M94 A;  2LEK A;  2BS4 B;  2L1A A;  1E8Y A;  4IDI A;  4RF1 A;  4PK1 A;  3V6E B;  3DVN U;  2DYB A;  3AE6 B;  2RDG A;  2NPT B;  4A3O A;  2D5G A;  4DXG A;  2FBW B;  3RD2 A;  4AJY B;  1I35 A;  2QHO A;  5EE0 A;  5JZE B;  4KVG B;  5L95 C;  4WH4 A;  1F2R I;  5IA7 A;  1XQQ A;  2JUO A;  2IY0 B;  3VVW B;  3PS6 A;  2DWQ A;  1ZDV A;  2PTL A;  4ICV A;  2FE8 A;  1NI2 A;  1WFY A;  3AEF B;  3N1Z C;  1CJE A;  1K51 A;  2WP9 B;  1N5W A;  2GMI C;  4TKN A;  2EMS A;  5AEK B;  1YMH E;  3M62 B;  2LAS A;  1XEE A;  4I6N B;  4JE3 B;  1KLV A;  1V97 A;  3H8H A;  2EEL A;  2LVP A;  3RNC C;  5HG2 A;  3QA8 A;  1DOY A;  1UH6 A;  2WQY B;  1VDV A;  3R8B A;  4NJ7 A;  2W54 A;  3APC A;  3E9S A;  5HFY A;  2Y3A A;  1TKY A;  1P98 A;  2K3U A;  1L4Z B;  4KSL C;  3TJP A;  4HPM B;  1G6J A;  2K22 A;  1AW7 A;  3TCA A;  2GI9 A;  2FUH B;  3A9K B;  1N5X A;  1HZ5 A;  2DAJ A;  1MPE A;  3BZD B;  3JSV A;  2IYD B;  1NDD A;  4IM2 A;  3QC8 B;  5E6J A;  2KN4 A;  4OHJ A;  2WDQ B;  1I4H A;  1HXY D;  1WXA A;  1GC7 A;  1TKE A;  1P0R A;  1WGY A;  3ZVV A;  1WGH A;  5IKC M;  4M01 A;  5IO9 A;  2MEK A;  5CHW A;  4W9F A;  1EF5 A;  2XEW A;  4DBG A;  2D10 A;  3ZJU A;  2ZCC A;  3E56 A;  3NRZ A;  1FRR A;  5E6O A;  4ANX A;  2A5U A;  2IND C;  2WXR A;  3AI5 A;  5EE3 A;  2LFI A;  1WRI A;  3R3M A;  3N1Y C;  3GZN I;  2NTT A;  1C76 A;  3RCZ A;  4ZHP A;  2FIF A;  1KF6 B;  1WYW B;  3TUO A;  1BXT A;  2GLS A;  1ENF A;  1N6Z A;  4AS1 A;  2DEN B;  2G45 B;  4M0W B;  4P16 A;  4LLG M;  1TY0 A;  2K39 A;  3L17 A;  4NY0 A;  4C7Y A;  1MHX A;  1WXQ A;  2W82 A;  3ZUN A;  3R7Q A;  1WX9 A;  3IT6 B;  4ASW C;  1MHH E;  4A20 A;  3DBS A;  2MBB B;  2DBY A;  5FR3 A;  1WI0 A;  4C80 A;  2GBM A;  2C5L C;  3AEA B;  2CHZ A;  3L54 A;  3NG0 A;  1BML C;  1F9J A;  3EFC A;  2LHD A;  3ZNG C;  3T8M A;  2INN E;  3ZGZ A;  3DVN V;  2G9H D;  1H8C A;  1XLP A;  4ZRJ A;  3RMK C;  4BBN F;  5FKA C;  1YJI A;  1KLU D;  5G5G A;  1DOX A;  5C2T B;  3FIL B;  4YSX B;  3TBL D;  1UNS A;  3AE2 B;  4FJY A;  3NHE B;  2WLB A;  2ZCB A;  3AE4 B;  2ACZ B;  2NBW B;  4WWN A;  1RWS A;  2G4S A;  1ZOY B;  2RDB C;  4KIK A;  2Y5P A;  1XF5 L;  1IBX A;  2N9P C;  3MHZ A;  3K9P B;  4KX6 B;  3VH4 B;  2GBJ A;  2I1K A;  2KQ4 X;  3BYY B;  2CS4 A;  2K8H A;  1E8W A;  4MJS A;  3EA6 A;  3ML9 A;  2NCN A;  1T5X D;  1E5W A;  1KRH A;  3P4P B;  3QX1 A;  2PMV A;  1N63 A;  3J9C A;  1YOV B;  2BYF A;  4NAW A;  5D3I B;  1JAL A;  2NTS A;  1DGJ A;  2WXG A;  2MJ3 A;  3PZ8 A;  4ACF A;  4JPS A;  3D32 A;  3V60 A;  1QOB A;  3Q8A A;  3PLV A;  4HKQ A;  1SE4 A;  4II3 B;  1E8X A;  4RF0 A;  1N62 A;  2KWD A;  3PV1 A;  3ZJT A;  2ZW0 A;  3Q8F A;  1QOF A;  4WQO B;  3AE7 B;  3ZRC A;  3KW5 B;  2MRP A;  3ZQ4 A;  1TTN A;  4R3D A;  3DQV A;  1UEL A;  3AXC A;  2KJR A;  4A9A A;  3PSE B;  4LDT B;  4CQN A;  2ZJD A;  2LHE A;  2J0J A;  2NS5 A;  4L1B A;  1WMH B;  2LUM A;  2KMA A;  3AU4 A;  1ZGU B;  2VRR B;  4LK0 M;  4PS8 A;  1E8Z A;  5H92 C;  1V49 A;  2Z8L A;  5GMV A;  4MT5 A;  4HRS A;  1WJ4 A;  3KQ4 A;  3KUD B;  1V81 A;  3BII D;  5AZF A;  5C1Z A;  4B6W A;  1V1O A;  3ECI A;  1SE9 A;  1TBE A;  3AE8 B;  1WZ3 A;  2K0P A;  1WE6 A;  2L0F A;  3A9J A;  2KK8 A;  1EU4 A;  4PYU A;  4ZRI A;  4GDL A;  3NOB A;  2N7J A;  3H7P A;  3PVL A;  3W5V B;  4GDK B;  4DXF A;  2QIE B;  4RGO S;  1GG3 A;  4XE0 A;  4E71 A;  1P7E A;  3H6N A;  2L52 A;  5MPO A;  3GZN B;  3A33 B;  3W1S A;  4HVB A;  1WM3 A;  2BKR B;  3NZ3 A;  4MGK E;  2CHX A;  2KD0 A;  1D4B A;  4M02 A;  4G0N B;  2LXC A;  3MP9 A;  2UWQ A;  4XYC A;  1C1Y B;  5IAA C;  1RYJ A;  2KTR B;  2JXT A;  5LNK 1;  1TY2 A;  2V3N A;  4IG7 B;  2J0M A;  3VR9 B;  4A3P A;  2N0S B;  3L4P A;  1J19 A;  3NVY A;  1FCC C;  2GOW A;  1SIF A;  4OZB A;  2QDF A;  2JF5 A;  2BS3 B;  5DPR A;  3LB8 C;  3PPA A;  3SFE B;  1XCT L;  2M0A A;  4WWO A;  4F1S A;  3P4R B;  3RZF A;  3AM9 A;  1I4R A;  5DPS A;  1MVK A;  3N1X C;  4FBJ B;  2ASQ A;  1GAQ B;  4EFO A;  3KUC B;  3I63 C;  1YQ3 B;  2BQQ A;  3APD A;  4P6V F;  4RCO A;  2LXA A;  1FNW A;  3Q3O C;  3OJ4 B;  3HK0 A;  4TMA B;  2B3A A;  3HVZ A;  2C7N B;  1UWX A;  2N9X A;  3B9J A;  1V8C A;  4WQM A;  2KX3 A;  2IJ0 A;  2N9E B;  1I4Q A;  2BWE S;  1M4V A;  3Q69 A;  4ZYN A;  2ZPY A;  4N9F 4;  4EKU A;  1WJ6 A;  1YJ1 A;  2AX5 A;  2R2O A;  3ZNZ B;  2JRI B;  2WXO A;  4XDD A;  2MP2 B;  4CO7 A;  1TZ1 A;  2FAZ A;  2K5P A;  4DK5 A;  1NEK B;  1KJT A;  4J6I A;  4EZJ A;  4JX1 C;  2JZZ A;  4YTM B;  1GB1 A;  2X8X X;  2K25 A;  2KOX A;  3ZDT A;  2NMQ A;  2O6V A;  3AE5 B;  3DWG C;  4BAX A;  3PGE A;  3R2T A;  5BYQ A;  2BS2 B;  3CWI A;  3CSF A;  1SSN A;  2IO2 B;  4YL8 A;  4ZRK A;  2HE7 A;  3V3X A;  2ICI A;  2N1W A;  2OJR A;  2LUE A;  1ISN A;  2KFJ A;  1L2N A;  5AZH A;  3WAL A;  5JH5 C;  4PS3 A;  3I5J C;  2WU2 B;  2ZW1 A;  2WXP A;  5CTR C;  2UU7 A;  4FLH A;  5DCN A;  2VZK B;  3ZXR A;  4BOS C;  2LJI A;  1Q10 A;  2HTH A;  3V62 A;  4HRO A;  2LD9 A;  3RN9 C;  1WXS A;  3BIN A;  4OZC A;  3AEB B;  4OW0 A;  3RZW C;  1I4X A;  3O13 A;  4W9K A;  1FEH A;  3IVF A;  4L2Y A;  4QAY A;  1WYG A;  2V9H A;  4ICU A;  3WCQ A;  4GIV A;  2PEA A;  2RDH A;  3ZTD A;  1D3Z A;  1V1P A;  2W9N A;  5C23 A;  2JWU A;  2ZVO A;  3B1L X;  4X57 B;  2BGF A;  4LJP B;  4Q2J A;  1F0Z A;  1NI3 A;  1XLN A;  2AL3 A;  2G1E A;  4G50 A;  2DZK A;  4HEA 1;  2DAF A;  4OVU A;  1WGG A;  3ABV B;  1T0Q C;  5BMI A;  2I2Y A;  3OLM D;  3SR6 A;  1E0Z A;  1QQR A;  4XWT A;  3PRM B;  3URY A;  1HTQ A;  1YQ4 B;  3KUZ A;  1L6V A;  2LGS A;  1T3Q A;  4YSY B;  3CST A;  2V3S A;  3CMM B;  3RT3 B;  1Q1O A;  1YX6 B;  1I7H A;  3JSV B;  1R4N B;  2W55 A;  2KJH B;  3ALB A;  3U4E G;  2JX5 A;  3ZRF A;  4BKS D;  3M95 A;  1X1M A;  4GLS C;  1ZW7 A;  2WXM A;  2YVC A;  4PT5 A;  3C0R B;  2FCS A;  4IWP A;  3NVZ A;  1HQR D;  4XGA B;  2DZJ A;  1P7F A;  4M8M A;  3A4R A;  3EFU A;  3P4S B;  2LWP A;  4YSZ B;  2JXX A;  3TEZ A;  2Q5W D;  2KMC A;  2Z59 B;  1L7Y A;  2JRH A;  1OTR B;  3ML8 A;  1ZP0 B;  3TSS A;  2MBQ A;  3W2D A;  1H4R A;  3W5U B;  1FXT B;  4WWP A;  3U52 E;  3TEW A;  3QIJ A;  1L5P A;  3OAW A;  2RSU A;  1NEN B;  4XDC A;  4FUL A;  3SU8 X;  1OGW A;  1CZP A;  3DVG X;  3PLU A;  2BBC A;  1WIA A;  2LZ6 A;  2D07 B;  4TSS A;  3OWE B;  2KJ6 A;  5EDS A;  1OQQ A;  3RNB C;  4YXD B;  4KGR A;  3A1Q A;  1B1Z A;  1IGC A;  3LDZ E;  4IUM B;  5HI1 A;  1ZUD 2;  4A8X C;  3QK0 A;  2WXQ A;  3WAM A;  2YEP B;  4KV2 A;  3ZDM C;  2QEJ C;  4URK A;  3UIP B;  4HCN B;  2N7D A;  1D5Z C;  2KX0 A;  3NVV A;  1VJK A;  5TSS A;  3C8Y A;  5BMH A;  4FXC A;  3PRE A;  3DHI C;  3TIX A;  1E10 A;  2WXJ A;  3N32 A;  4RGN A;  3BVG A;  2IBI B;  3P42 A;  2BYV E;  3OG5 A;  2XBB C;  1NVI D;  1GC6 A;  3NS8 A;  2IO3 B;  3AU5 A;  3T9L A;  3DHH C;  3HM3 A;  4KIK B;  2L76 A;  1FFV A;  1I42 A;  2AWT A;  2V4L A;  3N30 A;  1RRB A;  4JQW C;  4LNK A;  3VRB B;  3DBL I;  4E74 A;  3SHQ A;  1GUA B;  3RUI B;  2DX5 B;  1N60 A;  4NAW B;  4ANW A;  3GOE A;  3TEX A;  3CF6 E;  3KYD D;  2V3P A;  2AQ3 B;  3HVD A;  4OVZ A;  4RM9 A;  1WZ0 A;  3BWU D;  2YLM A;  4ZRQ A;  2LMC A;  2LJ5 A;  5IOI A;  2MQJ A;  3BVM A;  3PRZ A;  2Z0D B;  4RH6 A;  2NPT A;  2MW5 A;  3Q3M C;  1GOZ A;  1E7P B;  1SJE D;  3I9V 1;  1SE2 A;  3AE3 B;  4WUR A;  3PZD A;  1ROE A;  3DBR B;  3RI7 C;  3UI3 A;  2PW9 A;  4BOZ B;  4K7W A;  2AL6 A;  1WXM A;  2JQR B;  1NYR A;  3QQ8 B;  1ZDX A;  2WX1 A;  2DHZ A;  3DPD A;  2LGX A;  4K7S A;  4LNO A;  2M1M A;  4XC2 A;  2D3C A;  2K9X A;  1BT0 A;  2JZP A;  4WWM A;  4YTN B;  1C78 A;  1QKZ A;  3EEC A;  2KC1 A;  3VRA B;  1PQS A;  4DHZ B;  3N3K B;  2M4N A;  4EUT A;  2QCZ A;  3AE9 B;  1K53 A;  2WXF A;  4NQK E;  1KOT A;  2KFK B;  3L10 B;  4USA A;  3A9J B;  3VUX A;  4ZYS A;  4DXA B;  2J53 A;  1NBF C;  3BK1 A;  4GDL B;  1D5M C;  4MGZ E;  5D7G A;  2L83 A;  5LLI A;  2IDY A;  4TV3 A;  1SGH A;  4REZ A;  1EWC A;  4WJQ A;  2NVU I;  3B2F A;  4KZ0 A;  1HA5 A;  1FNU A;  2M0X A;  2DYO A;  4DWF A;  1XD3 B;  5EE9 A;  4MAC A;  2LGY A;  3U2S C;  2HJ8 A;  1OEY A;  3GB1 A;  2DNF A;  4CHK A;  2K6Q A;  4HDO A;  1S3S G;  3FKY A;  4WJO A;  2PJH A;  4MGI E;  1FMA D;  2RR9 A;  3Q8E A;  2TSS A;  4HCP B;  4E3C A;  5TR5 A;  4JGH B;  3TL5 A;  1PGB A;  1PFD A;  1CK1 A;  4OVV A;  3JVZ X;  4BKG A;  1FPY A;  2KVR A;  4KSK C;  1OEY J;  2WWZ A;  5L83 A;  4AQ7 A;  2O2V A;  2OHF A;  3DDC B;  1Z2M A;  3QWZ B;  4DHZ E;  3UF8 A;  2PLP A;  1OQR A;  4ZHO A;  3GE3 C;  1TS5 A;  4A55 A;  5AUK A;  1J7A A;  1AYF A;  4C7Z A;  2LI5 A;  1SEB D;  1XO3 A;  1A70 A;  4LCD E;  3ETR A;  4HK2 A;  3Q2A C;  3WIM A;  2RPQ A;  2GB1 A;  3VFK A;  4C4V A;  1VRA B;  4A6Q A;  2N9K A;  4N59 A;  4BVU C;  2KNB A;  2ONQ A;  4HKZ E;  4ITK A;  4HLE A;  2BPS A;  2FNJ B;  4WJN A;  2IZV B;  3IAM 1;  4TUU A;  2BVC A;  2KWU B;  4GGQ A;  1ZXH A;  2WXL A;  4ZRP A;  1UF0 A;  2G3Q B;  3N9Y C;  4K81 A;  4S0R A;  3DBL B;  1STE A;  3VTU A;  4P1B C;  3VTV A;  3ZYY X;  1HZ6 A;  2AEH A;  3ONS A;  2D3A A;  1KTK A;  4IW0 A;  1LXD A;  2HTM E;  2M17 A;  3P1M A;  1FXA A;  3U30 A;  4GOC A;  4MEL A;  3OJ3 A;  3HIZ A;  3GE8 C;  1A5R A;  2HDE A;  2Y5B B;  3GP7 A;  3P4Q B;  2KDF B;  4YTP B;  4C00 A;  4M00 A;  2MBO A;  4I6P A;  2JYT A;  3MHS D;  3SDL C;  2K8B A;  4RGM A;  3UIO B;  2KDB A;  1R4N I;  1PYW D;  1MG8 A;  2DZI A;  1WXV A;  2KWC A;  5CX3 A;  1HE8 A;  3PZ7 A;  2PPH A;  1ZPS A;  4RFB A;  2I1J A;  3GS2 A;  2DYM A;  1VZ8 A;  3R2I A;  4MSM B;  2GBK A;  4FJZ A;  3ZJV A;  2RD0 A;  1BUI C;  1UBQ A;  4KZC A;  3QAQ A;  2CJO A;  1YD8 U;  1EF1 A;  4C56 C;  1K8R B;  3K9O B;  3X0W A;  4FHK A;  4MH8 A;  5JHA A;  4AP4 C;  1KH0 A;  3KYC D;  1RM6 C;  1D6E C;  2C9W B;  2J52 A;  1V1P B;  1TZO A;  2ZNV B;  4LDT D;  1E6E B;  2KHW B;  1E7U A;  4KDL B;  4JLC A;  3HM6 X;  4HDQ A;  1FNV A;  3UIN B;  1GB4 A;  1FCL A;  3KLS X;  3MC0 B;  3SFD B;  1DOI A;  1WMH A;  4B0M A;  2KDE B;  4HJG E;  2L7R A;  3VH3 B;  1Q0W B;  1Y8R C;  5DPT A;  3SEB A;  2ON8 A;  2BW2 A;  4IM3 A;  2NBV B;  2KC2 A;  4P7I A;  1TS4 A;  2V0G A;  1R4M B;  5BYS A;  2QJL A;  2C60 A;  4RM8 A;  3U7Z A;  1UUP A;  1AWD A;  2FUG 1;  3ENE A;  2AYO B;  3AE1 B;  4EOY A;  2BT6 A;  1CMX B;  3TMP B;  1V5T A;  4AUQ C;  1ZXI A;  5BMG A;  3IT4 B;  1QZE A;  3H9D A;  2W3S A;  4AJW A;  2WXK A;  1UZX B;  1YNT E;  4I6L B;  4W9D A;  4GSW A;  3EC8 A;  4WAF A;  1QIL A;  2MLB A;  1K50 A;  3MC8 A;  2XK5 A;  4JIO U;  2D3B A;  3VDZ A;  2C7M B;  2WXI A;  1TS2 A;  2M56 B;  2JVC A;  4WAA A;  3Q8C A;  3ZLZ A;  5E6N A;  3DBH B;  2N9L A;  3NJT A;  4HWI B;  1LQB A;  3B08 A;  2QC8 A;  1U4A A;  2EKI A;  1L0Y B;  2KLC A;  4NZL B;  3NS1 A;  4H2A A;  1EU3 A;  5HKH A;  2AQ2 B;  2INP E;  5G55 A;  1WGD A;  3HUI A;  4W9J A;  2B76 B;  4JL9 A;  3RNG C;  2KXJ A;  1JWS D;  3P2B A;  2BTE A;  3C19 A;  5J18 A;  1L6U A;  3A1Q B;  3H1U A;  2PIA A;  2PKO A;  4EE2 A;  1QOG A;  1QF6 A;  1YJJ A;  2R61 A;  3UQA A;  3DOW A;  1XT9 B;  1J0G A;  3U7D A;  4FN2 A;  3DBR I;  4PS7 A;  5D2M B;  1P1A A;  3ZW3 A;  3UQB A;  1YN5 A;  4MH0 E;  4MSQ B;  3ZNI D;  3EHV A;  1XLO A;  2HJ1 A;  1JCK B;  1WR6 E;  2KKC A;  2JYE A;  3B0A A;  2MHJ A;  1KFY B;  2MP2 A;  2K6D B;  1SE3 A;  1VZ7 A;  3DVG Y;  3I57 A;  1P3Q U;  4OZA A;  1HTO A;  2LVO A;  2BF8 B;  3AV8 A;  3PHX B;  4MM3 A;  4BKS A;  2BYE A;  2KLG A;  1ZE3 D;  1C77 A;  2Z0E B;  4BZA A;  3BK2 A;  5JHB A;  4RMA A;  3ZXV A;  2GBR A;  3MJ5 A;  2KDM A;  4BKT A;  3IFW B;  4GXB A;  4IWO A;  2KVZ A;  2BYT A;  1V86 A;  2VZK D;  5AUI A;  2IGD A;  3LYY A;  3W9C B;  1IYF A;  2FCN A;  2RMM A;  3DHG C;  1K52 A;  2KAN A;  2J42 A;  4RNA A;  2N1V A;  4IC7 B;  1YIW A;  2Y5C A;  4NQL B;  5KHO A;  1J7C A;  2ZNV C;  1WSP A;  2A4Z A;  3B2G A;  2E6X A;  1WWT A;  4JWS C;  2W3R A;  2L8J A;  2M8S A;  4LNN A;  4LNF A;  5FK9 C;  1MJD A;  3VTW A;  3M63 B;  3MFG A;  3QCA A;  4HPP A;  4EZL A;  5HHD G;  4PYZ A;  3V05 A;  1EO6 A;  3MC9 A;  5G2N A;  4BBN C;  1OQY A;  2V1Y A;  3KWL A;  3BY4 B;  2PE9 A;  1P9D U;  4TQ1 A;  4KGT A;  2K1F A;  3PRP B;  4LJO B;  1V5O A;  1J7B A;  3CIR B;  3VUY A;  1L0V B;  3LJ3 A;  1E90 A;  1SXT A;  4KKI A;  5EE1 A;  4GN1 A;  3JYU A;  3IXS A;  3NUH B;  2MX2 A;  1S1Q B;  5E6P A;  3N20 C;  2IPK D;  3PO0 A;  1WRD B;  1JWU D;  3KVF B;  1V2Y A;  4KKJ A;  4UDU C;  2V4I B;  1IBX B;  4IM0 A;  1QT9 A;  3V61 A;  3VHT C;  2SAK A;  1WF9 A;  4MJS B;  2D2Q A;  3KWV A;  2PE6 B;  4ARC A;  2K8C A;  1ESF A;  2L3Z A;  1VR9 A;  2L32 A;  3RNF C;  3RPF C;  3TEY A;  1UWM A;  4II2 B;  3Q3F A;  4DDI D;  1WX8 A;  5CHF A;  4S17 A;  1WR1 A;  2O2V B;  1F52 A;  4NNJ B;  2KQ7 A;  4HJK A;  3O65 B;  1T0R C;  2QMT A;  3ZO5 B;  1Q5W B;  3RNA C;  3FC4 A;  3DWM A;  1LFD A;  1PGX A;  3AEG B;  2L0T A;  2WDV B;  2RPV A;  1QOA A;  3QAR A;  4C4V B;  1D5X C;  2IGH A;  4FHJ A;  4HXD A;  1C4A A;  3T3N A;  2I38 A;  5J17 A;  1IPG A;  1JWM D;  1E9M A;  1V80 A;  4MGY E;  1TJE A;  4ARI A;  4ANV A;  3MTN B;  4P1C C;  2MH7 A;  2UYZ B;  5C3J B;  1JML A;  1C4P A;  1KLG D;  2G4D B;  3U8Z A;  4LNI A;  4XX5 A;  2GRI A;  3NZS A;  2H89 B;  3JW0 X;  3H7P B;  1GPX A;  4NAM A;  2X38 A;  3A9K A;  1C9F A;  2J4X A;  4D2K A;  1JWA D;  3L08 A;  2RGF A;  1GJZ A;  1YN4 A;  2NBU A;  5JXV A;  1LO5 D;  4N6E B;  3R7R A;  1V6E A;  1PGA A;  1WJU A;  5AZG A;  2REX A;  4AWJ A;  1HEZ E;  2CHW A;  4IOI E;  4TQ0 A;  1JQ4 A;  3Q3J A;  1R4M I;  5I4D A;  2GBN A;  4MDK E;  4EEW A;  4B95 A;  1WGR A;  3ZNH B;  4A90 A;  2AQ1 B;  5DPW A;  4W9E A;  2SEB D;  5H8Y E;  4IKG A;  1SIJ A;  1TIF A;  2J7Q B;  2L05 A;  1TT5 B;  3H7S A;  1EM7 A;  4K3C A;  5IP4 D;  1AN8 A;  2J0K A;  4GB9 A; 
#chains in the Genus database with same CATH homology
 3CST A;  2MSE D;  1E7U A;  1P0R A;  1WGY A;  4KDL B;  3ZVV A;  2V3S A;  1WGH A;  3CMM B;  3RT3 B;  4JLC A;  4W9H A;  1Q1O A;  1YX6 B;  3HM6 X;  4HDQ A;  2R2Q A;  5CHW A;  4W9F A;  1EF5 A;  2XEW A;  3UIN B;  4DBG A;  3JSV B;  2D10 A;  2KJH B;  3ALB A;  3ZRF A;  4BKS D;  3M95 A;  2ZCC A;  3RUL A;  3W1Y A;  1X1M A;  1ZW7 A;  4W9L A;  1RFA A;  2YVC A;  3C0R B;  1VCB A;  1WMH A;  2FCS A;  2KDE B;  4IWP A;  5E6O A;  2L7R A;  3VH3 B;  3DBH I;  3DCG A;  4ANX A;  2A5U A;  1Q0W B;  2DZJ A;  1Y8R C;  5DPT A;  4MEM A;  3AI5 A;  3WA0 A;  2C7H A;  4M8M A;  2WDT B;  3A4R A;  4IM3 A;  2NBV B;  3EFU A;  3R3M A;  3GZN I;  2KC2 A;  4P7I A;  2LWP A;  3RCZ A;  2JXX A;  2KMC A;  2Z59 B;  2C60 A;  2FIF A;  1L7Y A;  4RM8 A;  1WYW B;  3A4S C;  2JRH A;  4KDI C;  3ENE A;  4AOF A;  2AYO B;  1OTR B;  3ML8 A;  2DEN B;  2G45 B;  2MBH A;  4M0W B;  4EOY A;  1CMX B;  3TMP B;  1V5T A;  2MBQ A;  2K39 A;  1RLF A;  4AUQ C;  3L17 A;  4NY0 A;  1H4R A;  2O6V B;  4BKT A;  3S2A A;  3VXW A;  1FXT B;  4WWP A;  1QZE A;  2N4F A;  3H9D A;  3R7Q A;  3ZUN A;  1WX9 A;  3QIJ A;  3OAW A;  3SD5 A;  4AJW A;  2RSU A;  4ASW C;  3VQI A;  1UD7 A;  1UZX B;  2KFK A;  3DBS A;  4A20 A;  2MBB B;  4I6L B;  4FUL A;  4W9D A;  2WYQ A;  4W9I A;  1WI0 A;  2MA9 B;  4GSW A;  3SU8 X;  3EC8 A;  1OGW A;  2GBM A;  2C5L C;  2MLB A;  2CHZ A;  4M8N A;  3L54 A;  3DVG X;  1WH3 A;  2XK5 A;  3PLU A;  4JIO U;  1F9J A;  2FCM A;  3ZNG C;  2EKE C;  1GNU A;  3T8M A;  2C7M B;  1WIA A;  1YQB A;  3VDZ A;  3AUL A;  2JVC A;  3QJZ A;  2LZ6 A;  2D07 B;  4WAA A;  5BO4 B;  2JWZ A;  3ZLZ A;  2MBE A;  3DVN V;  5E6N A;  1H8C A;  3I3T B;  2KWV B;  2KJ6 A;  3R66 C;  4HWI B;  5EDS A;  1LQB A;  4ZRJ A;  4ANU A;  4BBN F;  3B08 A;  4F7Z A;  1U4A A;  3NZU A;  3RYT A;  2KQS A;  3A1Q A;  3LDZ E;  4IUM B;  2KLC A;  2LGD A;  3QK0 A;  2XK5 B;  5HKH A;  4W9C A;  2N7E A;  3TBL D;  5G55 A;  1WGD A;  3WAM A;  4W9J A;  4EZK A;  3QHT A;  3NHE B;  4FJY A;  4JL9 A;  2KXJ A;  2ZCB A;  4KV2 A;  3ZDM C;  4URK A;  2NBW B;  3P2B A;  3UIP B;  3L16 A;  4HCN B;  5J18 A;  1KM7 A;  2N7D A;  4WWN A;  2KX0 A;  2KO3 A;  2G4S A;  1AAR A;  3A1Q B;  4KIK A;  3H1U A;  2ZEQ A;  2N9P C;  5LXI B;  3K9P B;  3PRE A;  3VH4 B;  2GBJ A;  2I1K A;  3TIX A;  3UQA A;  2IY1 B;  3DOW A;  1XT9 B;  3N32 A;  2CS4 A;  2K8H A;  1J0G A;  1E8W A;  4MJS A;  5LXH A;  2D11 A;  2IBI B;  3U7D A;  3ML9 A;  2BYV E;  2NCN A;  1YX5 B;  1E5W A;  4FN2 A;  2XBB C;  3DBR I;  1GC6 A;  3NS8 A;  4PS7 A;  2IO3 B;  3AU5 A;  2IO0 B;  3QX1 A;  3T9L A;  5D2M B;  4CYE A;  2MWS B;  1Z5S B;  2BYF A;  3HM3 A;  4KIK B;  4NAW A;  1WJN A;  2L76 A;  2KZR A;  3WAP A;  1P1A A;  3ZW3 A;  3UQB A;  4ZDV A;  1I42 A;  4MH0 E;  1T0Y A;  2AWT A;  4MSQ B;  2V4L A;  3N30 A;  4NJ6 A;  3ZNI D;  1RRB A;  3EHV A;  3D32 A;  3PHW B;  2DZM A;  4JQW C;  3V60 A;  2WX0 A;  1WR6 E;  2KKC A;  3DBL I;  1WE7 A;  4E74 A;  2NR2 A;  3B0A A;  3PLV A;  3SHQ A;  4DHJ B;  1GUA B;  4II3 B;  3RUI B;  4G3X B;  1E8X A;  2BWF A;  3PV1 A;  2MP2 A;  2K6D B;  1IP9 A;  2DX5 B;  3DVG Y;  4NAW B;  4WQO B;  4ANW A;  3GOE A;  1P3Q U;  1VD2 A;  2FID A;  3ZIM A;  2OOB B;  1C3T A;  3CF6 E;  3ZRC A;  3KW5 B;  3KYD D;  2MRP A;  2LVO A;  1TTN A;  2BF8 B;  3DQV A;  1UEL A;  3X23 A;  3AXC A;  4K7U A;  3PHX B;  4FJV B;  4GU2 A;  4MM3 A;  4RM9 A;  2KJR A;  4BKS A;  1WZ0 A;  2YLM A;  3PSE B;  4LDT B;  1GC7 A;  3W1S C;  2BYE A;  2KLG A;  2Z0E B;  1TGZ B;  2O6V D;  2ZJD A;  2J0J A;  2NS5 A;  2LJ5 A;  5JHB A;  2LRW A;  1WMH B;  2MQJ A;  1WM2 A;  4RMA A;  2GBR A;  2L00 B;  3VAW A;  2KMA A;  3AU4 A;  1ZGU B;  3PRZ A;  2Z0D B;  2VRR B;  3KH0 A;  3PTF C;  1E8Z A;  3IFW B;  4G11 A;  2NPT A;  1V49 A;  4GXB A;  2MW5 A;  4PS8 A;  5GMV A;  1WJ4 A;  4IWO A;  3KUD B;  3PZD A;  1V86 A;  3APF A;  1V81 A;  4BOZ B;  4K7W A;  5D6J B;  2AL6 A;  1WXM A;  3QQ8 B;  5AZF A;  2FCQ A;  2WX1 A;  3MJW A;  2DHZ A;  3DPD A;  2FCN A;  2LGX A;  4K7S A;  4GDK A;  1IYF A;  5C1Z A;  4B6W A;  1JRU A;  3L13 A;  2M1M A;  3ECI A;  1SE9 A;  4XC2 A;  1TBE A;  2KAN A;  1WZ3 A;  1RAX A;  1BT0 A;  2N1V A;  3UGB B;  4IWQ A;  1WE6 A;  4IC7 B;  1YIW A;  2L0F A;  4NQL B;  3M3J A;  5KHO A;  3EEC A;  2KC1 A;  3A9J A;  5J2R A;  1PQS A;  2ZNV C;  4DHZ B;  2KK8 A;  3N3K B;  4PYU A;  2M4N A;  4ZRI A;  4EUT A;  4F8C B;  2A4Z A;  4GDL A;  2BKF A;  3NOB A;  2IO1 B;  3H7P A;  3PVL A;  2L8J A;  2M8S A;  4NQK E;  1KOT A;  4GDK B;  2KTR A;  1LM8 B;  5FR6 A;  1GG3 A;  4B9K A;  2KFK B;  3L10 B;  4E71 A;  3H6N A;  3VTW A;  4DDG D;  3W1S A;  3A33 B;  3V6C B;  2HD5 B;  4HVB A;  3A9J B;  1WM3 A;  2BKR B;  3M63 B;  3QCA A;  3VUX A;  2JY6 A;  4DXA B;  4EZL A;  4MGK E;  1UGM A;  2CHX A;  2KD0 A;  4PYZ A;  1EO6 A;  1NBF C;  4G0N B;  4GDL B;  2LXC A;  5G2N A;  4MGZ E;  5D7G A;  1OQY A;  4BBN C;  2V1Y A;  2UWQ A;  5LLI A;  3PT2 B;  3WAN A;  3BY4 B;  1C1Y B;  2PE9 A;  1P9D U;  5IAA C;  4TV3 A;  1SGH A;  2KTR B;  4TQ1 A;  2ZZP B;  2K1F A;  2JT4 B;  2KN5 A;  3PRP B;  4WJQ A;  2KTF A;  4LJO B;  2NVU I;  1V5O A;  4KZ0 A;  4IG7 B;  3VUY A;  2J0M A;  3LJ3 A;  2M0X A;  4W9G A;  2DYO A;  4A3P A;  4DWF A;  3IG3 A;  1J19 A;  1E90 A;  1XD3 B;  2CKH B;  2EMT A;  2GOW A;  2LGY A;  1SIF A;  2LRU A;  4GN1 A;  2HJ8 A;  1OEY A;  3JYU A;  2MX2 A;  4GMV A;  1S1Q B;  2JF5 A;  5E6P A;  5DPR A;  4XZ4 A;  3PPA A;  2CR5 A;  3IHP C;  4WWO A;  4F1S A;  1V9J A;  4FA6 A;  3RZF A;  2KDI A;  2CU1 A;  1WRD B;  4DHJ D;  5DPS A;  4CHK A;  3KVF B;  2K6Q A;  1V2Y A;  4HDO A;  1S3S G;  4NPN A;  1E7V A;  4WJO A;  2PJH A;  4MGI E;  4FBJ B;  2ZPN A;  2RR9 A;  2ASQ A;  4IM0 A;  4EFO A;  3KUC B;  4HCP B;  4E3C A;  2JZ3 B;  3V61 A;  5TR5 A;  3APD A;  4JGH B;  1WX7 A;  3ZKJ C;  3TL5 A;  3VHT C;  2JPH A;  4OVV A;  1WF9 A;  3JVZ X;  4MJS B;  2D3G A;  2D2Q A;  2LXA A;  3L0W B;  4BKG A;  4FAD A;  2PE6 B;  2KVR A;  5D94 A;  4KSK C;  3OJ4 B;  1OEY J;  2WWZ A;  1UBI A;  3HK0 A;  3VUW A;  2K8C A;  2B3A A;  2L3Z A;  2O2V A;  5L83 A;  1ZKH A;  3HHM A;  3DDC B;  3QWZ B;  1Z2M A;  4WJP A;  2C7N B;  4DHZ E;  2N9X A;  3UF8 A;  2ZVN A;  2KX3 A;  3IBE A;  2LVQ A;  2N9E B;  2BWE S;  2MCN B;  3NY5 A;  4ZYN A;  2ZPY A;  4II2 B;  3Q3F A;  4N9F 4;  4DDI D;  4EKU A;  1WX8 A;  5CHV C;  5KHQ A;  2LI5 A;  1WJ6 A;  5CHF A;  1YJ1 A;  3WAO A;  3ZTC A;  2R2O A;  3ZNZ B;  2JRI B;  4BFR A;  4K1R B;  4LCD E;  1WR1 A;  1WY8 A;  2MP2 B;  2O2V B;  4HK2 A;  3WIM A;  4CO7 A;  4HPL B;  4NNJ B;  2KQ7 A;  2RPQ A;  3VFK A;  1TZ1 A;  2FAZ A;  3O65 B;  4HJK A;  4DK5 A;  1KJT A;  1EUV B;  3ZO5 B;  4GB9 A;  4BVU C;  4J6I A;  4EZJ A;  1J8C A;  2JZZ A;  2KNB A;  1Q5W B;  1M94 A;  1LFD A;  2BPS A;  2K25 A;  2KOX A;  3ZDT A;  2O6V A;  1E8Y A;  4HLE A;  2FNJ B;  4WJN A;  3PGE A;  2L0T A;  2IZV B;  3V6E B;  4TUU A;  3DVN U;  2KWU B;  4GGQ A;  2DYB A;  3QAR A;  3CSF A;  2IO2 B;  2G3Q B;  4FHJ A;  4K81 A;  4YL8 A;  2NPT B;  4A3O A;  4ZRK A;  4HXD A;  2HE7 A;  3VTU A;  3VTV A;  3RD2 A;  4AJY B;  2AEH A;  1I35 A;  2N1W A;  2QHO A;  2OJR A;  3ONS A;  5J17 A;  1IPG A;  4IW0 A;  1LXD A;  2M17 A;  4KVG B;  1V80 A;  5JZE B;  2LUE A;  5L95 C;  3U30 A;  4MGY E;  5IA7 A;  1ISN A;  4GOC A;  1XQQ A;  2JUO A;  2KFJ A;  3OJ3 A;  3HIZ A;  4MEL A;  2IY0 B;  1L2N A;  5AZH A;  3VVW B;  3WAL A;  5JH5 C;  3PS6 A;  4PS3 A;  4ANV A;  1A5R A;  4ICV A;  2Y5B B;  3MTN B;  2UYZ B;  1NI2 A;  5CTR C;  4FLH A;  1WFY A;  5DCN A;  2G4D B;  2KDF B;  2GMI C;  4TKN A;  3U8Z A;  4XX5 A;  2EMS A;  2MBO A;  4I6P A;  5AEK B;  3M62 B;  4BOS C;  3NZS A;  2LAS A;  4I6N B;  3MHS D;  1KLV A;  3SDL C;  2LVP A;  3JW0 X;  2HTH A;  2K8B A;  3H7P B;  3UIO B;  3V62 A;  2KDB A;  3QA8 A;  1R4N I;  2LD9 A;  3A9K A;  1UH6 A;  1WXS A;  3BIN A;  1MG8 A;  2DZI A;  4NJ7 A;  1WXV A;  3APC A;  2KWC A;  5CX3 A;  3RZW C;  1HE8 A;  4W9K A;  2PPH A;  2I1J A;  3IVF A;  1P98 A;  3L08 A;  2RGF A;  1GJZ A;  2DYM A;  2NBU A;  4ICU A;  4MSM B;  4GIV A;  2PEA A;  4KSL C;  3TJP A;  2GBK A;  4HPM B;  3ZTD A;  4FJZ A;  1G6J A;  3R7R A;  1V6E A;  1D3Z A;  3TCA A;  2RD0 A;  1WJU A;  2W9N A;  5C23 A;  5AZG A;  2FUH B;  3A9K B;  1UBQ A;  2REX A;  2ZVO A;  3B1L X;  4KZC A;  4AWJ A;  2CHW A;  3QAQ A;  4X57 B;  4TQ0 A;  1YD8 U;  2BGF A;  1EF1 A;  3Q3J A;  4LJP B;  1R4M I;  1K8R B;  3K9O B;  3X0W A;  2GBN A;  2AL3 A;  2DAJ A;  4FHK A;  4MDK E;  4EEW A;  4B95 A;  4G50 A;  5JHA A;  2DZK A;  1WGR A;  4AP4 C;  3ZNH B;  5DPW A;  3KYC D;  4W9E A;  3JSV A;  2DAF A;  2IYD B;  4OVU A;  2J7Q B;  2L05 A;  1WGG A;  2C9W B;  1NDD A;  4IM2 A;  3H7S A;  3OLM D;  3QC8 B;  3PRM B;  2ZNV B;  4LDT D;  2KHW B;  3KUZ A;  2J0K A;  1WXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...