2W9NA

Crystal structure of linear di-ubiquitin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
148
structure length
148
Chain Sequence
QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Discrimination of Structurally Equivalent Lys 63-Linked and Linear Polyubiquitin Chains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords UBIQUITIN
total genus 40
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2009-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2w9nA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2w9nA02
2IY1B 1EUVB 2BYEA 2BYFA 4GMVA 1WM3A 2G4SA 4MJSA 2J0JA 4NQLB 2IBIB 3PRMB 3K9OB 4MGIE 2MA9B 1H8CA 2XEWA 2L7RA 3A9KB 4LDTD 4NY0A 4KSKC 4EEWA 3NHEB 3L13A 3DQVA 4RM8A 4CHKA 5JZEB 1IYFA 3ZDMC 2K8CA 3M95A 3IBEA 3SU8X 1ZW7A 3W1SA 2KWUB 4RMAA 5HKHA 2BWES 5IA7A 4DK5A 4NQKE 1KOTA 2LJ5A 4M0WB 2L0TA 2BWFA 4W9FA 5DCNA 3OJ4B 5EDSA 4W9EA 2JZ3B 4DHJB 1I35A 4GDLB 3X23A 2CHXA 2LVPA 4PYUA 4GN1A 5KHOA 4MGKE 1QZEA 3ZRFA 4MDKE 2WX1A 5C1ZA 2MBBB 3EHVA 2LGDA 1E8YA 1WE6A 4WJNA 2JPHA 2KTFA 4MELA 2KDFB 3SD5A 4F8CB 4W9JA 1WJUA 4LJOB 3QJZA 3HHMA 4ANVA 4HCNB 1LQBA 3VFKA 2R2QA 1RAXA 3DBSA 4W9GA 4G3XB 3APFA 2KX0A 2M4NA 4KVGB 4ANWA 3JW0X 2I1JA 2IYDB 3VAWA 4K7WA 1YD8U 3KUDB 4NAWB 5G55A 3V6CB 4EFOA 3TBLD 3CSTA 1YJ1A 2D10A 3VUWA 3W1YA 3RD2A 5J2RA 1TZ1A 2KDEB 1KLVA 1WX9A 2LXAA 5E6NA 3B08A 3PS6A 3ZNGC 3VUXA 4ZYNA 2KWCA 4W9DA 4WJPA 4X57B 1E7UA 1LM8B 3EFUA 2KXJA 2KVRA 3DVGX 2MX2A 4PS7A 1JRUA 4GDKA 2KNBA 2AWTA 3QWZB 2KC2A 4IM2A 4FHJA 4FULA 2MBEA 1K8RB 2O2VA 3DBLI 4JGHB 4E71A 2GMIC 2M1MA 2LRWA 2N1VA 2JRIB 1SE9A 5LXHA 3PLUA 3RYTA 3TL5A 1V2YA 4HDQA 4KV2A 4I6LB 4K7UA 1OEYA 3DDCB 1WGGA 3SDLC 3RUIB 4WWPA 3WA0A 2V4LA 3APDA 3EECA 1E8XA 4GU2A 1WE7A 3ML9A 4MGZE 2KMCA 3AXCA 3JVZX 3P2BA 4NAWA 4FADA 3PLVA 5D6JB 2WYQA 3KUZA 2A5UA 4M8MA 1EO6A 1WJ6A 3QAQA 2XK5A 5DPSA 2EMSA 2L05A 4HDOA 2OOBB 4URKA 2GOWA 3BY4B 4JQWC 5J18A 3WIMA 1L7YA 1WIAA 4MJSB 2IZVB 4WWNA 1V5TA 1UD7A 2DYOA 3PZDA 3TIXA 1CMXB 4FJZA 2J0KA 3PSEB 2GBKA 4GDKB 4BFRA 4E74A 2MW5A 3CMMB 4TV3A 2LGXA 3QHTA 4AWJA 1WMHB 2JF5A 2M17A 2ZVOA 3KYDD 4IUMB 1Q5WB 2NBWB 1XT9B 2KTRA 3QCAA 4IM0A 1GC7A 3H7SA 2RD0A 3ZLZA 2FIFA 4XZ4A 2R2OA 3ZNZB 2PJHA 4WAAA 4WJQA 3V61A 2J0MA 2LI5A 3D32A 2IO0B 2A4ZA 2BKRB 5E6OA 1TTNA 2RGFA 4IWPA 1L2NA 4G11A 3QX1A 3V62A 4EZJA 2KO3A 4HLEA 1WR6E 3BINA 3HM3A 4GGQA 4GOCA 4IC7B 4NJ7A 1NI2A 4BOSC 4MH0E 2KMAA 2MWSB 2ZNVC 4ZRIA 3VXWA 1P9DU 1UGMA 3PREA 5CHWA 2KZRA 1WXSA 2L76A 4TQ1A 3ZRCA 1I42A 2XK5B 2V1YA 3PGEA 3A4RA 2LVQA 1C1YB 2JT4B 4JL9A 2GBMA 2C9WB 1WFYA 2QHOA 2KTRB 4ZRKA 1E8ZA 5JHBA 1VD2A 4HVBA 4M8NA 1GUAB 1V80A 2L8JA 3A9JA 2RR9A 2D3GA 4J6IA 4W9IA 3TJPA 1SIFA 1XQQA 4DHZB 4EOYA 2BPSA 2UYZB 4IG7B 4NNJB 2BKFA 3A9KA 4BVUC 1P98A 1WXVA 3WAMA 2WWZA 2N7EA 5E6PA 4BOZB 2HD5B 2OJRA 2RSUA 2KDBA 3NZSA 4DDGD 3IHPC 3DPDA 4BBNF 5AEKB 2DYMA 3A1QB 3VQIA 1WJ4A 3QIJA 2KLCA 2DAFA 2ZZPB 1Q1OA 1WJNA 1WGRA 2JWZA 3N32A 4JLCA 4PS3A 4RM9A 4WWOA 2DAJA 2O6VD 3T8MA 4FBJB 1J0GA 1WYWB 3ENEA 2REXA 1OQYA 2M8SA 1R4MI 2KHWB 3GZNI 3RCZA 3T9LA 1G6JA 3H7PA 1H4RA 2D11A 5GMVA 3WAOA 1BT0A 1WY8A 2NVUI 4EKUA 3PHWB 2HE7A 2CKHB 2N4FA 3ZKJC 3RT3B 3DVGY 3UINB 1T0YA 1J8CA 3DVNV 2IO1B 4JIOU 1Y8RC 2DZIA 2NCNA 2NS5A 2LUEA 4PYZA 2K6QA 2PPHA 2DZKA 2KDIA 4ZDVA 1KJTA 1A5RA 2MBOA 3ECIA 2MCNB 3U30A 3R66C 4MM3A 5AZGA 4YL8A 3JYUA 2PEAA 3APCA 4MEMA 5BO4B 1UH6A 3NY5A 3UF8A 4BKSA 1AARA 2D07B 4LJPB 2GBNA 4K81A 3ZTDA 4MSMB 3KH0A 4KSLC 4DBGA 3MJWA 5KHQA 3UIPB 2XBBC 3DOWA 4LCDE 2FCSA 4E3CA 2YVCA 3ML8A 2ZVNA 4FLHA 1FXTB 3U8ZA 5D7GA 4DHJD 2MP2A 3RZWC 3ZO5B 3EC8A 3ALBA 2UWQA 2C7MB 2Z0DB 2V3SA 1S1QB 2KFKB 3AU4A 4G50A 3KVFB 4XX5A 4AOFA 2C7NB 1GJZA 1SGHA 3OAWA 5IAAC 1TGZB 2GBJA 3L08A 2HTHA 2EKEC 2LASA 2AYOB 4AJYB 1V5OA 4CYEA 1WZ3A 4II2B 2MBHA 1EF5A 2G3QB 4XC2A 4DXAB 2CHZA 2NBUA 1UZXB 2CU1A 2O2VB 4GIVA 3ONSA 3PT2B 2KKCA 2FNJB 2FCMA 3IG3A 4LDTB 4BBNC 3ZW3A 3L10B 4F1SA 5L95C 3VHTC 4HPLB 2KK8A 3RZFA 2MP2B 2YLMA 4FHKA 1D3ZA 2N9EB 1S3SG 3UIOB 1NDDA 2O6VA 2W9NA 2PE6B 1OGWA 4HWIB 2ASQA 5CHFA 1LFDA 2PE9A 4FN2A 2ZCBA 2I1KA 4KIKB 5DPRA 2NBVB 1WGYA 2GBRA 3R7RA 1X1MA 1WH3A 2MBQA 3NZUA 1UBIA 2KWVB 4MSQB 2Z59B 4A3OA 1NBFC 1P3QU 5JH5C 3VH4B 2RPQA 3OJ3A 4OVUA 5G2NA 3PV1A 4GDLA 3HIZA 2G45B 3PRPB 2K6DB 3UQBA 1V9JA 1XD3B 2LXCA 3VTVA 3N3KB 4AJWA 2L0FA 2FCNA 3DVNU 3PVLA 3O65B 2N9XA 3IFWB 2FCQA 5TR5A 4K7SA 1KM7A 4A20A 1RRBA 1UELA 3M62B 4W9HA 1R4NI 3NS8A 5LLIA 3U7DA 1WRDB 3VDZA 2JUOA 4HJKA 4W9CA 1OEYJ 3IVFA 5CHVC 2LWPA 4GSWA 4NJ6A 1LXDA 2ZPNA 3A9JB 2L3ZA 1P0RA 1WGDA 4BKSD 4ANXA 2ZEQA 5CX3A 2L00B 2C5LC 4BKGA 1WZ0A 2IO3B 1V86A 2FUHB 2KC1A 2ZJDA 2M0XA 2WX0A 1WXMA 2IO2B 2N9PC 2BYVE 1ZGUB 3GOEA 4IM3A 4ANUA 2KQ7A 2KN5A 1WF9A 4GXBA 4HXDA 4WJOA 4EZLA 2MSED 4AUQC 5J17A 3B0AA 4EZKA 1GNUA 3KYCD 4II3B 4KZ0A 4A3PA 2FIDA 2JZZA 2CS4A 2N7DA 2KD0A 2AEHA 2DHZA 3DCGA 2K8BA 1RFAA 3Q3FA 4W9LA 2MLBA 2C60A 2C7HA 4TKNA 4TQ0A 2HJ8A 3QC8B 4HCPB 3M63B 3L17A 3V6EB 2G4DB 2K25A 3PPAA 2ZCCA 3CF6E 2K39A 4OVVA 3NOBA 2DZJA 2JVCA 5D2MB 4F7ZA 3ZNID 3I3TB 3ZDTA 3JSVA 1E7VA 2D2QA 3HM6X 5AZFA 2NR2A 4GB9A 4EUTA 2IY0B 4I6PA 4HK2A 1YQBA 2LVOA 2ZPYA 1Z5SB 3A1QA 4P7IA 3KW5B 2DZMA 3M3JA 3Q3JA 3MTNB 1IP9A 1M94A 5CTRC 4AP4C 3WAPA 2LD9A 2NPTA 1E90A 1WR1A 3OLMD 3PHXB 3CSFA 2CHWA 3QK0A 4B6WA 5DPWA 4HPMB 4DWFA 1WX8A 1P1AA 2KANA 2JY6A 1V81A 3H1UA 4IW0A 3K9PB 3RULA 2DYBA 3AU5A 4PS8A 1J19A 1WGHA 3VTUA 1IPGA 3VTWA 2KLGA 2FAZA 3A4SC 3VUYA 4ASWC 1E8WA 2BF8B 4FJVB 1EF1A 1PQSA 3B1LX 3QA8A 3SHQA 3AULA 3LJ3A 3WANA 5C23A 2EMTA 3JSVB 3L54A 4G0NB 4I6NB 3ZTCA 4DDID 3H9DA 1MG8A 3H6NA 4K1RB 2VRRB 1Z2MA 4KIKA 3MHSD 3TMPB 3L0WB 4IWQA 1VCBA 3WALA 4IWOA 2N1WA 4W9KA 2DX5B 2JRHA 3C0RB 4B95A 3QARA 2LZ6A 2Y5BB 4MGYE 5LXIB 2BGFA 2KJRA 2NPTB 4ZRJA 2AL6A 3HK0A 4FJYA 3N30A 2J7QB 2KX3A 4KZCA 5JHAA 3PRZA 4CO7A 3V60A 4NPNA 2WDTB 3S2AA 3QQ8B 5D94A 1E5WA 2LRUA 3ZVVA 4N9F4 1RLFA 3L16A 4BKTA 2AL3A 1V6EA 2MRPA 1HE8A 3ZNHB 1U4AA 5L83A 3VH3B 3VVWB 1WM2A 3ZIMA 1TBEA 3A33B 4KDIC 5AZHA 2KJHB 4ICVA 1Q0WB 4KDLB 1V49A 1YX6B 3LDZE 3DBRI 2MQJA 5FR6A 3UQAA 1YIWA 2KQSA 3R7QA 3R3MA 3KUCB 1YX5B 2B3AA 2KJ6A 1GC6A 2O6VB 4ICUA 4WQOB 2K1FA 2KFKA 2Z0EB 3X0WA 4B9KA 4FA6A 1ZKHA 2KOXA 1ISNA 1UBQA 3UGBB 3TCAA 2JXXA 2LGYA 1OTRB 3AI5A 3H7PB 1WX7A 5DPTA 3PTFC 3ZUNA 1WMHA 3W1SC 1WI0A 1GG3A 2CR5A 2K8HA 2DENB 4DHZE 2KFJA 3DBHI 1WXAA 4TUUA 1F9JA 1C3TA 2ZNVB
chains in the Genus database with same CATH superfamily
1EUVB 1P7FA 3NVZA 1XXGA 3PRMB 1N6ZA 3LYYA 3NHEB 3L13A 1OQQA 4RM8A 4CHKA 1I4GA 5JZEB 1IYFA 3IBEA 1ZW7A 3W1SA 3GZNB 2GI9A 1ZDXA 1KOTA 4W9FA 1E0ZA 1I35A 2CHXA 4GN1A 4P1CC 1ZPSA 2LGDA 1N5WA 1WE6A 4WJNA 3HRDD 5TSSA 2KDFB 2CU3A 3EGRA 3VFKA 1ENFA 2M0AA 4M01A 3DBSA 4W9GA 2M4NA 2IYDB 4XYCA 4RH6A 2L32A 4K7WA 1TT5B 1YD8U 2HTME 2RDBC 3GE3C 3KUDB 5G55A 4M0WA 2BQQA 2KDEB 1PUTA 2PMVA 1V8CA 3VUXA 1KRHA 4WJPA 1TZOA 3CIRB 1ZE3D 1LM8B 1D6EC 3DVGX 3N9YC 4PS7A 3QWZB 2VZKD 4FULA 1K8RB 2O2VA 1HTOA 2LRWA 2JRIB 1SE9A 2VH2A 1EM7A 1OEYA 1WGGA 3RUIB 4WWPA 3APDA 1WE7A 4NAWA 3JVZX 5D6JB 4M8MA 4LNFA 5DPSA 2XK5A 1FNUA 1CJEA 3Q8AA 2OOBB 4URKA 2GOWA 3WIMA 1MPEA 1TIFA 4WWNA 4FJZA 2DNFA 4B0EA 3CMMB 3Q8BA 2LGXA 4OZCA 3KYDD 3AE5B 1GC7A 1YJIA 4XZ4A 2R2OA 3BWUD 4WAAA 4WJQA 3ZNZB 1ROEA 1NVID 1CQVA 3D32A 5MPOA 1J7CA 2A4ZA 2QSDA 2IDYA 5EE3A 4IWPA 1L2NA 4EZJA 4HLEA 1WR6E 4GOCA 4KKJA 4BOSC 4MH0E 2KMAA 3KWLA 1P9DU 2I38A 1NEKB 1DOYA 4O1NA 1VJKA 4KGSA 1ESFA 1I4XA 1I42A 5BYRA 2IGGA 4JL9A 3RNAC 2CJOA 2GBMA 1WFYA 3RFZB 2KTRB 1V1PA 1V80A 4J6IA 2RR9A 4YXDB 4W9IA 1SBBB 4NNJB 2BB5A 3A9KA 2BVCA 2WWZA 2N7EA 3R8BA 4BOZB 2RSUA 3NZSA 3A1QB 3VQIA 1FPYA 4PS3A 4WWOA 4MACA 2DAJA 4FBJB 1OQYA 3RCZA 3H8HA 1G6JA 2D11A 1R4MB 2G9HD 1BT0A 1TKGA 1WY8A 3MC0B 2XNAC 2HJ1A 1JWAD 2DLBA 4PYZA 3RMKC 1BXTA 1N62A 2KDIA 2BBCA 3ECIA 4MM3A 4YL8A 5H8YE 4YSYB 2PEAA 3APCA 2PVGC 4CQNA 3ZQ4A 1AARA 4LJPB 2GBNA 4K81A 4MSMB 3ZJVA 3KH0A 2D3BA 2XBBC 2V3PA 2YVCA 3ML8A 1FXTB 3U8ZA 4LNNA 4DHJD 2C7MB 4G50A 3OAWA 1QQRA 2PVOD 1WZ3A 1YMHE 3URYA 2KKCA 3AEFB 2FNJB 4BBNC 4P1BC 5EE9A 4RGNA 4WAFA 2KK8A 1IUEA 1UWMA 2V4IB 3GB1A 1XEEA 1D3ZA 2JYEA 1E6EB 1S3SG 3E9SA 4WIPA 2PE6B 4HWIB 3DHHC 1VLBA 2GRIA 4A3OA 3VRAB 3VH4B 5G2NA 1FXIA 3PV1A 4GDLA 1KLUD 1XD3B 2IJ0A 4AJWA 2FCNA 3I57A 2N9XA 3IFWB 2FCQA 2BW2A 1KM7A 3ABVB 1KTKA 4W9HA 4OZBA 1F1HA 2WLBA 3NJTA 4OW0A 5CHVC 4NJ6A 2ZPNA 2CJNA 1V86A 4IM3A 4ANUA 1J7AA 2KN5A 2RPVA 1RM6C 4GXBA 4WJOA 3RNGC 2MSED 4EZKA 1IBXB 3KYCD 4HPPA 4MT5A 2FIDA 2CS4A 2AEHA 2DHZA 3DCGA 3Q3FA 4W9LA 1FXAA 2MLBA 2R61A 4TQ0A 4P16A 3M63B 1ET9A 3AE2B 3NOBA 2JVCA 4IDIA 5T8IA 2IY0B 1YQBA 3KW5B 1TS4A 2JQRB 1QILA 2WU2B 1E90A 2CHWA 3QK0A 1SE3A 4DXFA 4LNKA 2JY6A 3K9PB 3VTUA 4PS8A 3TEXA 2KLGA 2WDQB 3A4SC 2BF8B 3RPFC 1EF1A 1JWMD 2ZW0A 3N20C 2QJLA 3JSVB 3L54A 2MHJA 1UNSA 1C4CA 1JQ4A 1Z2MA 1I4QA 4HRSA 3AE9B 3L4PA 3AB5A 4IWOA 4W9KA 3C0RB 4BZAA 2W54A 3E56A 4KX6B 2LZ6A 4ZOHC 5LXIB 4YTNB 2SEBD 2D5GA 2AL6A 5JHAA 4CO7A 3OG5A 3V60A 4NPNA 5D94A 3T3OA 2H89B 3ZXRA 3L16A 2AL3A 4IKGA 3VH3B 1WM2A 4KDIC 2KJHB 4M00A 1XO3A 4OHJA 1YX6B 2TSSA 3LDZE 3DBRI 5FR6A 1YIWA 1QT9A 3KUCB 2KFKA 1T0SC 1ISNA 1CZPA 2W3RA 3MP9A 2LUMA 3TCAA 2LGYA 3AI5A 4YT0B 3PTFC 1WI0A 2DENB 2KFJA 2V3NA 5IOIA 1C3TA 2IY1B 1ZOYB 4GMVA 4MJSA 1WM3A 2J0JA 4MGIE 2XEWA 2L7RA 3A9KB 5BMIA 1FEHA 2B76B 2N7JA 1RYJA 3SFEB 4C00A 2KWUB 1AN8A 5IA7A 4DK5A 3MJ5A 2LJ5A 2K5PA 4M0WB 4RGOS 5DCNA 3OJ4B 2JZ3B 4DHJB 4WH4A 3X23A 2LVPA 4ZRPA 1ZP0B 4MGKE 1OFFA 1C9FA 4MDKE 2WX1A 2MBBB 2D3AA 1E8YA 1FFUA 1EWYC 3AEBB 3QJZA 2WXIA 3W2DA 3Q3NC 5C3JB 4G3XB 3LXFA 2WXQA 4NAWB 4C7YA 3V6CB 1L0XB 3CSTA 1YJ1A 3W1YA 3RD2A 3AE4B 3Q3MC 3PS6A 4W9DA 1E7UA 3TUOA 2KC2A 1Y56A 4FHJA 5FR3A 4JGHB 4E71A 1HA5A 1YN5A 1TKYA 2ICIA 3RN9C 3VR8B 4B0MA 3SDLC 3EECA 1E8XA 3N1XC 1WRIA 3PO0A 4MGZE 2W82A 3AXCA 3PLVA 3TSSA 2WYQA 1UGJA 3R2IA 3QAQA 2H88B 5H92C 2EMSA 1NYQA 2L05A 2SAKA 2KMMA 1JRPA 1WSPA 4MJSB 3AEGB 3FILA 4BFRA 2GBKA 3QHTA 3IXSA 1WMHB 3SFDB 2NBWB 2GB1A 1XT9B 2KTRA 3QCAA 3W9CB 2LHDA 2PJHA 5FKAC 2LI5A 5C2TB 2BKRB 5E6OA 3ZGZA 1L0VB 5EE0A 3AEAB 2KO3A 3BINA 4IC7B 1NI2A 4ZRIA 1T0RC 1GOZA 3PREA 1ZDVA 2L52A 2MJDA 4TQ1A 3PGEA 3IAM1 2PLPA 1E8ZA 3NUHB 1GUAB 2L8JA 3AH7A 1P7EA 1XQQA 4EOYA 2BPSA 2UYZB 4BVUC 3WAMA 4BBNF 4HKZE 2V0GA 3W5UB 3QIJA 1N61A 2JWZA 1WGRA 2O6VD 1J0GA 2KHWB 3GP7A 3GZNI 1JW9D 2MH7A 1Q10A 3PHWB 4LLGM 2CKHB 3I5JC 3RT3B 3UINB 2WNMA 4JIOU 5IKCM 2NCNA 2K6QA 3Q2AC 2LJIA 2W55A 1A5RA 3V05A 2MCNB 1FMAD 5AZGA 3JYUA 5BO4B 2Z8LA 3UF8A 2D07B 3UI3A 3ZTDA 3NG0A 4KSLC 4DBGA 1F2RI 3DOWA 4E3CA 4FLHA 2ZVNA 1QOBA 3RZWC 3EC8A 3HVDA 4N6EB 4YSZB 2PW9A 1SGHA 2GBJA 2PIAA 2AYOB 2FE8A 2HDEA 1ZXIA 2G3QB 4XC2A 4ZRQA 1MFWA 3ZJUA 1KF6B 4GIVA 1HXYD 3ONSA 2WXNA 3IG3A 4JWUC 3ZW3A 3L10B 1NENB 4K3BA 4F1SA 1T3QA 3RZFA 2MP2B 2WGSA 1FD6A 4FHKA 1SEBD 2QC8A 1NDDA 2W9NA 1V97A 1OGWA 4RNAA 3NVYA 2I1KA 5DPRA 3N1YC 4N58A 1X1MA 1WH3A 1UBIA 3FKYA 2Z59B 1P3QU 2PTLA 2WP9B 2RPQA 3BYTB 2RMMA 3PRPB 2K6DB 1V9JA 2L0FA 3PVLA 3O65B 1TKEA 1SSNA 4K7SA 5LLIA 2JX5A 4M02A 3U7DA 2WXGA 4P6VF 1WRDB 1UUPA 4W9CA 2BS2B 4GSWA 1LXDA 5JXVA 3Q8FA 2ONQA 4BKSD 5CX3A 2C5LC 4BKGA 2MJEA 2M0XA 1WXMA 3GOEA 3R2TA 1L4DB 3SR6A 4LNIA 2JSVX 1R7SA 2K22A 3MHZA 4EZLA 4AUQC 1GNUA 1M4VA 4II3B 1SF0A 4ARCA 1C76A 1RFAA 1K52A 2C60A 1ZXHA 4HCPB 2WU5B 2K39A 1B1ZA 3ZNID 2LEKA 3JSVA 3HM6X 3BK1A 4I6PA 4P7IA 1Z5SB 2DZMA 3MTNB 3AE8B 2KACA 2LD9A 1D4BA 1WR1A 3OLMD 1JALA 4IOIE 3CSFA 4B6WA 5DPWA 1PFDA 1V81A 4IW0A 2DYBA 1J19A 1IPGA 4LNOA 3VUYA 3P1MA 4FJVB 3O13A 3U7ZA 4ZHPA 2EMTA 2WXOA 3PZ8A 3ZTCA 3H9DA 1MG8A 4K1RB 3WALA 2Y5BB 1N63A 4MGYE 4A6QA 4REZA 4ZRJA 3HK0A 2QDFA 4FJYA 3N30A 4KZCA 4MH8A 3S2AA 3I9V1 2WXKA 2K9XA 1V6EA 2MRPA 1XLQA 2J4XA 1TBEA 3AEDB 3A33B 5E6JA 2OEDA 4KDLB 4A55A 3UQAA 4JWSC 4DXGA 1YX5B 4C56C 3ETRA 2ON8A 3IAS1 2KJ6A 4WWMA 1GC6A 2O6VB 2K1FA 4OVZA 2PKOA 2KOXA 4YWGG 1UBQA 2L1AA 1YOVB 3W1SC 1EU3A 1C4AA 1WXAA 1BMLC 4OZAA 1IGCA 4NQLB 3DWGC 3K9OB 2AQ3B 2MA9B 4NY0A 1TS2A 4KSKC 3NVWA 3DQVA 2KWDA 2EELA 3ZDMC 4L1BA 3AE3B 1L6UA 1XLNA 2BWES 4PK1A 3DWMA 3ZJTA 2L0TA 5EDSA 5D3DA 2EKIA 2YEPB 2MEKA 4PYUA 4RF1A 1QZEA 1YQ3B 3ZRFA 5C1ZA 3EHVA 1FCCC 2BT6A 3AE7B 2JPHA 3SD5A 4F8CB 3MFGA 1WJUA 4LJOB 3HHMA 4ANVA 1LQBA 2INCC 4ITKA 2K3UA 3APFA 2KX0A 2X38A 4KVGB 1TJEA 4NJCA 1VRAB 2BTEA 5J2RA 3KWVA 1TS5A 5E6NA 3VRBB 3B08A 1HEZE 3ZNGC 1RWSA 3MC9A 3EFUA 1SE4A 2KVRA 2MX2A 2DBYA 2KNBA 4LK0M 2IGHA 2K0PA 1EU4A 3DBLI 2M1MA 2N1VA 2JZPA 5LXHA 3C19A 4XWTA 3PLUA 3TL5A 1V2YA 4HDQA 4ZYSA 3DDCB 1L4ZB 3WA0A 2V4LA 2WXPA 4A90A 3Q3OC 4GU2A 2QCZA 4QAYA 2KMCA 3P2BA 1XLPA 3KUZA 2A5UA 1WWTA 5J18A 2LHEA 3BY4B 4JQWC 2NTTA 4KGTA 4D2KA 4UDUC 1L7YA 1V5TA 2DYOA 3B2FA 5IP4D 4E74A 2J0KA 4GDKB 2MW5A 4TV3A 1YNTE 2N9KA 1GPXA 2M17A 2JF5A 2ZVOA 4IUMB 1Q5WB 1DGJA 4IM0A 2RD0A 3ZLZA 2FIFA 1QOAA 1VR9A 3V61A 3VR9B 2IO0B 3DBLB 1TTNA 2AQ2B 4G11A 3V62A 4GGQA 3DBHB 2KYWA 3KLSX 2ZNVC 2WHIA 3OWEB 3VXWA 3GE8C 1K50A 3Q14C 5FK9C 1WXSA 1UF0A 2LVQA 1C1YB 2WXMA 3A4RA 1YQ4B 4XE0A 1OQRA 2C9WB 2QHOA 4ZRKA 5JHBA 4HVBA 4M8NA 1YN3A 3A9JA 5AUIA 3TJPA 1SIFA 3P4PB 4DHZE 1KFYB 2HD5B 2OJRA 1E10A 2KDBA 3IHPC 3DPDA 3P4RB 2BYTA 2ZZPB 1WJNA 4JLCA 1YJJA 3ENEA 2ZW1A 3H7PA 3WAOA 2NVUI 4EKUA 4BAXA 2HE7A 1T0YA 4US9A 1SJED 1J8CA 3DVNV 1Y8RC 2DZIA 2LUEA 5EE1A 2PPHA 2DZKA 4ZDVA 2FUG1 1KJTA 3R66C 4MEMA 1UH6A 3BK2A 1KLGD 1FM0D 5KHQA 1K53A 3UIPB 4LCDE 2FCSA 4RGTA 1F2RC 2IPKD 4R3DA 5D7GA 2N9LA 2ACZB 2Y3AA 3BIID 4C4VB 3ALBA 2UWQA 4A8XC 4XX5A 2KFKB 4AOFA 3KVFB 2C7NB 5IAAC 3L08A 2XN9C 4XWWA 2LASA 1FFVA 1V5OA 4CYEA 4II2B 2MBHA 2NBUA 1SE2A 1UZXB 2QIEB 2CU1A 2BS4B 2OJWA 2W3SA 4HPLB 5HFYA 1C78A 1ACCA 2N9EB 3AV8A 3SEBA 2O6VA 3UIOB 2L83A 5CHFA 2ASQA 2Y5CA 2LGIA 2ZCBA 3DBRB 1WGYA 2GBRA 2MBQA 2KWVB 4MSQB 1NBFC 5JH5C 3OJ3A 3DHGC 4OVUA 4USAA 2Y5PA 2LXCA 3N3KB 2LFIA 4YSXB 2KDMA 3M62B 3NS8A 1N60A 2LGSA 4RGMA 1LGRA 2JUOA 4HJKA 3VDZA 1OEYJ 1VDVA 4JPSA 2INNE 2L3ZA 2ZEQA 4C7ZA 2L00B 4HEA1 1KH0A 4FXCA 2FUHB 2ZJDA 2WX0A 2IO2B 1JWBD 1ZGUB 2QILA 2WXLA 2KQ7A 2RDHA 4HXDA 1HZ6A 3B0AA 4A3PA 2KD0A 4H2AA 1J7BA 3T3NA 1WXQA 4A9AA 3QC8B 3V6EB 1JROA 4TSSA 3PPAA 2ZCCA 1T6BX 3CF6E 4OVVA 2KAJA 5GXGB 3I3TB 3ZDTA 1I4HA 2I2YA 4KKIA 1FIQA 3RNEC 2LVOA 4NZLB 3MC8A 4ACFA 1IBXA 2AQ1B 1QOFA 4NAMA 3WAPA 1AYFA 3PHXB 2KVZA 4ZHOA 3Q8EA 2WXHA 2WQYB 4L2YA 3CWIA 4US8A 2KANA 2UU7A 3J9CA 3BVZA 3RULA 1WGHA 3VTWA 1TS3A 2FAZA 4RF0A 3B1LX 1I4PA 1MJDA 2X8XX 3WANA 5I4DA 2Q5WD 4G0NB 4I6NB 1JCKB 4K3CA 3H6NA 4JE3B 2VRRB 4XGAB 1QKZA 3MHSD 3ZYYX 3TMPB 4IWQA 3U2SC 3AM9A 4KGRA 2DX5B 2JRHA 2J42A 3QARA 2WXJA 3Q69A 2JU6X 2BGFA 2KJRA 2NPTB 3AE1B 3HUIA 2WDRB 2INPE 3QQ8B 2LRUA 4YTMB 2QEJC 1B9RA 1K51A 1SIJA 3P4QB 1HTQA 1RLFA 4BKTA 3WCQA 2N0SB 4EE2A 1HE8A 1U4AA 3VVWB 1F0ZA 5AZHA 1V49A 3R3MA 5IO9A 4RFBA 2B3AA 4ICUA 4B9KA 4FA6A 2NMQA 1ZKHA 1FNWA 3RI7C 2JXXA 5DPTA 1WX7A 5AUKA 3PZ7A 1GG3A 2CR5A 2M56B 1F9JA 1DOXA 5BMHA 2BYEA 2BYFA 2G4SA 2IBIB 1H8CA 1AW7A 2J53A 4LDTD 4EEWA 4WQMA 3TEYA 2RDGA 2K8CA 3M95A 5D3IB 3SU8X 4C4VA 1PYWD 4RMAA 5HKHA 4NQKE 1FNVA 1PGBA 4XDCA 2BWFA 2VH1A 4W9EA 3AN1A 4PT5A 4J3OD 4GDLB 5KHOA 1F77A 3IT6B 1TYGB 2KTFA 4MELA 4W9JA 3TEZA 4LTUA 5IN7A 4HCNB 1SJHD 2LMCA 2R2QA 1NI3A 1RAXA 3GS2A 4ANWA 3JW0X 2I1JA 1GB1A 3VAWA 4S17A 1RFKA 1L5PA 4EFOA 3TBLD 2D10A 3VUWA 3P42A 1TZ1A 1KLVA 1WX9A 2LXAA 3TEWA 4TMAB 3NS1A 2WXFA 1FO4A 4ZYNA 1EWCA 1R4NB 2KWCA 3AEEB 4HJGE 4X57B 5BYQA 2KXJA 1MVKA 1JRUA 3V3XA 4GDKA 1FRRA 3NRZA 3FAHA 2AWTA 3B9JA 4IM2A 2MBEA 1HQRD 2GMIC 3RYTA 1SXTA 4KV2A 4I6LB 4K7UA 1T0QC 2GLSA 1MI0A 3BYYB 2WXRA 3ML9A 3BVMA 4FADA 3I63C 1WJ6A 1EO6A 4HDOA 1PDXA 1WIAA 2IZVB 1UD7A 3PZDA 3TIXA 1CMXB 5LNK1 3PSEB 4Q2JA 4AWJA 3EA6A 3H7SA 4XDDA 4WURA 2BB6A 2J0MA 4HKQA 4AQ7A 1VZ7A 2RGFA 1YN4A 3QX1A 3HM3A 4NJ7A 2IGDA 2MWSB 3FILB 2FBWB 1UGMA 5CHWA 1E7PB 2KZRA 4L23A 2L76A 1QOGA 3ZRCA 2XK5B 1GAQB 2V1YA 2JT4B 1PGXA 1C77A 1NYRA 1VD2A 3FC4A 2D3GA 2KT7A 4DHZB 1CK1A 4IG7B 2BKFA 1P98A 1WXVA 5E6PA 4DDGD 3U52E 5AEKB 2DYMA 4JX1C 1WJ4A 1L0YB 2KLCA 1QF6A 1HZ5A 2DAFA 1Q1OA 2JYTA 4RM9A 3N32A 1FCLA 3T8MA 1WYWB 1V1OA 2REXA 2M8SA 1R4MI 5G5GA 3T9LA 1H4RA 5GMVA 3B2GA 1I7HA 3EUB2 2N4FA 3RNFC 3W5VB 3Q6BA 3ZKJC 1PGAA 3DVGY 1N5XA 2WDVB 1C79A 2IO1B 2NS5A 1V1PB 2MBOA 1JWSD 3U30A 1VZ6A 1IGDA 3NY5A 4BKSA 4N59A 2M19A 3MJWA 2KQ4X 1I4RA 1TY2A 1VZ8A 3N1ZC 3RNBC 3DHIC 2MP2A 3ZO5B 2Z0DB 2V3SA 1S1QB 3AU4A 2OHFA 1GJZA 1TGZB 2HTHA 2EKEC 4AJYB 1EF5A 1XLOA 4DXAB 3P63A 4AS1A 2CHZA 4MM3B 1A70A 1XF5L 1XCQL 5HHDG 2O2VB 1LO5D 1DOIA 3PT2B 1BUIC 2FCMA 4LDTB 5BYSA 5L95C 3VHTC 1WGKA 1D5MC 2YLMA 1LFDA 2PE9A 4KIKB 4FN2A 2NBVB 1GB4A 3R7RA 3NZUA 3HIZA 2G45B 3UQBA 2VZKB 3VTVA 1XCTL 3DVNU 3AECB 5TR5A 4A20A 4S0RA 1RRBA 1UELA 1R4NI 3HVZA 4DQOC 2J52A 3IVFA 2LWPA 3NVVA 3A9JB 1P0RA 1WGDA 4ANXA 1WZ0A 2IO3B 2QMTA 2KC1A 3P4SB 2N9PC 2BYVE 5HG2A 2G1EA 2DWQA 2E6XA 1C4PA 1WF9A 2BS3B 3ZXVA 4ARIA 5J17A 3Q8CA 3BVGA 4KZ0A 3BZDB 2JZZA 1AWDA 2D3CA 2N7DA 3KQ4A 2E3TA 3NZ3A 4YTPB 2K8BA 2C7HA 4TKNA 1ZUD2 2HJ8A 5G5HA 3RNCC 3L17A 1JWUD 2G4DB 2K25A 5D2MB 2DZJA 4F7ZA 1E7VA 2D2QA 5AZFA 1MG4A 2NR2A 4GB9A 4EUTA 4RCOA 1DYQA 4HK2A 2ZPYA 3A1QA 1D5XC 1D5ZC 3M3JA 3IT4B 3Q3JA 1IP9A 1M94A 5CTRC 4AP4C 2NPTA 1FRDA 3AE6B 2YEPF 4HPMB 4DWFA 1WX8A 1P1AA 3AMZA 3H1UA 1UWXA 4C80A 3AU5A 2NTSA 4ASWC 1E8WA 1JMLA 1PQSA 3SHQA 3QA8A 3AULA 3LJ3A 5C23A 4DDID 2WS3B 2JWUA 1E9MA 2JXTA 4KIKA 5HI1A 2AX5A 3L0WB 1MHHE 1VCBA 2N1WA 1STEA 4B95A 1ET6A 3EFCA 2INDC 2J7QB 2KX3A 3PRZA 2WDTB 1E5WA 1TY0A 3ZVVA 4N9F4 5L83A 3ZNHB 3ZIMA 1SB3C 1WYGA 3C8YA 4ICVA 1Q0WB 1QLBB 2MQJA 1L6VA 2KQSA 3R7QA 5BMGA 4WQOB 1T5XD 2Z0EB 3X0WA 2V9HA 3U4EG 1F52A 4GLSC 3UGBB 3H7PB 1OTRB 1MHXA 3ZUNA 2MJ3A 1WMHA 2KN4A 3LB8C 4HROA 2K8HA 3DBHI 4TUUA 2ZNVB
chains in the Genus database with same CATH topology
2IY1B 1EUVB 2BYEA 2BYFA 4GMVA 1WM3A 2G4SA 4MJSA 2J0JA 4NQLB 2IBIB 3PRMB 3K9OB 4MGIE 2MA9B 1H8CA 2XEWA 2L7RA 3A9KB 4LDTD 4NY0A 4KSKC 4EEWA 3NHEB 3L13A 3DQVA 4RM8A 4CHKA 5JZEB 1IYFA 3ZDMC 2K8CA 3M95A 3IBEA 3SU8X 1ZW7A 3W1SA 2KWUB 4RMAA 5HKHA 2BWES 5IA7A 4DK5A 4NQKE 1KOTA 2LJ5A 4M0WB 2L0TA 2BWFA 4W9FA 5DCNA 3OJ4B 5EDSA 4W9EA 2JZ3B 4DHJB 1I35A 4GDLB 3X23A 2CHXA 2LVPA 4PYUA 4GN1A 5KHOA 4MGKE 1QZEA 3ZRFA 4MDKE 2WX1A 5C1ZA 2MBBB 3EHVA 2LGDA 1E8YA 1WE6A 4WJNA 2JPHA 2KTFA 4MELA 2KDFB 3SD5A 4F8CB 4W9JA 1WJUA 4LJOB 3QJZA 3HHMA 4ANVA 4HCNB 1LQBA 3VFKA 2R2QA 1RAXA 3DBSA 4W9GA 4G3XB 3APFA 2KX0A 2M4NA 4KVGB 4ANWA 3JW0X 2I1JA 2IYDB 3VAWA 4K7WA 1YD8U 3KUDB 4NAWB 5G55A 3V6CB 4EFOA 3TBLD 3CSTA 1YJ1A 2D10A 3VUWA 3W1YA 3RD2A 5J2RA 1TZ1A 2KDEB 1KLVA 1WX9A 2LXAA 5E6NA 3B08A 3PS6A 3ZNGC 3VUXA 4ZYNA 2KWCA 4W9DA 4WJPA 4X57B 1E7UA 1LM8B 3EFUA 2KXJA 2KVRA 3DVGX 2MX2A 4PS7A 1JRUA 4GDKA 2KNBA 2AWTA 3QWZB 2KC2A 4IM2A 4FHJA 4FULA 2MBEA 1K8RB 2O2VA 3DBLI 4JGHB 4E71A 2GMIC 2M1MA 2LRWA 2N1VA 2JRIB 1SE9A 5LXHA 3PLUA 3RYTA 3TL5A 1V2YA 4HDQA 4KV2A 4I6LB 4K7UA 1OEYA 3DDCB 1WGGA 3SDLC 3RUIB 4WWPA 3WA0A 2V4LA 3APDA 3EECA 1E8XA 4GU2A 1WE7A 3ML9A 4MGZE 2KMCA 3AXCA 3JVZX 3P2BA 4NAWA 4FADA 3PLVA 5D6JB 2WYQA 3KUZA 2A5UA 4M8MA 1EO6A 1WJ6A 3QAQA 2XK5A 5DPSA 2EMSA 2L05A 4HDOA 2OOBB 4URKA 2GOWA 3BY4B 4JQWC 5J18A 3WIMA 1L7YA 1WIAA 4MJSB 2IZVB 4WWNA 1V5TA 1UD7A 2DYOA 3PZDA 3TIXA 1CMXB 4FJZA 2J0KA 3PSEB 2GBKA 4GDKB 4BFRA 4E74A 2MW5A 3CMMB 4TV3A 2LGXA 3QHTA 4AWJA 1WMHB 2JF5A 2M17A 2ZVOA 3KYDD 4IUMB 1Q5WB 2NBWB 1XT9B 2KTRA 3QCAA 4IM0A 1GC7A 3H7SA 2RD0A 3ZLZA 2FIFA 4XZ4A 2R2OA 3ZNZB 2PJHA 4WAAA 4WJQA 3V61A 2J0MA 2LI5A 3D32A 2IO0B 2A4ZA 2BKRB 5E6OA 1TTNA 2RGFA 4IWPA 1L2NA 4G11A 3QX1A 3V62A 4EZJA 2KO3A 4HLEA 1WR6E 3BINA 3HM3A 4GGQA 4GOCA 4IC7B 4NJ7A 1NI2A 4BOSC 4MH0E 2KMAA 2MWSB 2ZNVC 4ZRIA 3VXWA 1P9DU 1UGMA 3PREA 5CHWA 2KZRA 1WXSA 2L76A 4TQ1A 3ZRCA 1I42A 2XK5B 2V1YA 3PGEA 3A4RA 2LVQA 1C1YB 2JT4B 4JL9A 2GBMA 2C9WB 1WFYA 2QHOA 2KTRB 4ZRKA 1E8ZA 5JHBA 1VD2A 4HVBA 4M8NA 1GUAB 1V80A 2L8JA 3A9JA 2RR9A 2D3GA 4J6IA 4W9IA 3TJPA 1SIFA 1XQQA 4DHZB 4EOYA 2BPSA 2UYZB 4IG7B 4NNJB 2BKFA 3A9KA 4BVUC 1P98A 1WXVA 3WAMA 2WWZA 2N7EA 5E6PA 4BOZB 2HD5B 2OJRA 2RSUA 2KDBA 3NZSA 4DDGD 3IHPC 3DPDA 4BBNF 5AEKB 2DYMA 3A1QB 3VQIA 1WJ4A 3QIJA 2KLCA 2DAFA 2ZZPB 1Q1OA 1WJNA 1WGRA 2JWZA 3N32A 4JLCA 4PS3A 4RM9A 4WWOA 2DAJA 2O6VD 3T8MA 4FBJB 1J0GA 1WYWB 3ENEA 2REXA 1OQYA 2M8SA 1R4MI 2KHWB 3GZNI 3RCZA 3T9LA 1G6JA 3H7PA 1H4RA 2D11A 5GMVA 3WAOA 1BT0A 1WY8A 2NVUI 4EKUA 3PHWB 2HE7A 2CKHB 2N4FA 3ZKJC 3RT3B 3DVGY 3UINB 1T0YA 1J8CA 3DVNV 2IO1B 4JIOU 1Y8RC 2DZIA 2NCNA 2NS5A 2LUEA 4PYZA 2K6QA 2PPHA 2DZKA 2KDIA 4ZDVA 1KJTA 1A5RA 2MBOA 3ECIA 2MCNB 3U30A 3R66C 4MM3A 5AZGA 4YL8A 3JYUA 2PEAA 3APCA 4MEMA 5BO4B 1UH6A 3NY5A 3UF8A 4BKSA 1AARA 2D07B 4LJPB 2GBNA 4K81A 3ZTDA 4MSMB 3KH0A 4KSLC 4DBGA 3MJWA 5KHQA 3UIPB 2XBBC 3DOWA 4LCDE 2FCSA 4E3CA 2YVCA 3ML8A 2ZVNA 4FLHA 1FXTB 3U8ZA 5D7GA 4DHJD 2MP2A 3RZWC 3ZO5B 3EC8A 3ALBA 2UWQA 2C7MB 2Z0DB 2V3SA 1S1QB 2KFKB 3AU4A 4G50A 3KVFB 4XX5A 4AOFA 2C7NB 1GJZA 1SGHA 3OAWA 5IAAC 1TGZB 2GBJA 3L08A 2HTHA 2EKEC 2LASA 2AYOB 4AJYB 1V5OA 4CYEA 1WZ3A 4II2B 2MBHA 1EF5A 2G3QB 4XC2A 4DXAB 2CHZA 2NBUA 1UZXB 2CU1A 2O2VB 4GIVA 3ONSA 3PT2B 2KKCA 2FNJB 2FCMA 3IG3A 4LDTB 4BBNC 3ZW3A 3L10B 4F1SA 5L95C 3VHTC 4HPLB 2KK8A 3RZFA 2MP2B 2YLMA 4FHKA 1D3ZA 2N9EB 1S3SG 3UIOB 1NDDA 2O6VA 2W9NA 2PE6B 1OGWA 4HWIB 2ASQA 5CHFA 1LFDA 2PE9A 4FN2A 2ZCBA 2I1KA 4KIKB 5DPRA 2NBVB 1WGYA 2GBRA 3R7RA 1X1MA 1WH3A 2MBQA 3NZUA 1UBIA 2KWVB 4MSQB 2Z59B 4A3OA 1NBFC 1P3QU 5JH5C 3VH4B 2RPQA 3OJ3A 4OVUA 5G2NA 3PV1A 4GDLA 3HIZA 2G45B 3PRPB 2K6DB 3UQBA 1V9JA 1XD3B 2LXCA 3VTVA 3N3KB 4AJWA 2L0FA 2FCNA 3DVNU 3PVLA 3O65B 2N9XA 3IFWB 2FCQA 5TR5A 4K7SA 1KM7A 4A20A 1RRBA 1UELA 3M62B 4W9HA 1R4NI 3NS8A 5LLIA 3U7DA 1WRDB 3VDZA 2JUOA 4HJKA 4W9CA 1OEYJ 3IVFA 5CHVC 2LWPA 4GSWA 4NJ6A 1LXDA 2ZPNA 3A9JB 2L3ZA 1P0RA 1WGDA 4BKSD 4ANXA 2ZEQA 5CX3A 2L00B 2C5LC 4BKGA 1WZ0A 2IO3B 1V86A 2FUHB 2KC1A 2ZJDA 2M0XA 2WX0A 1WXMA 2IO2B 2N9PC 2BYVE 1ZGUB 3GOEA 4IM3A 4ANUA 2KQ7A 2KN5A 1WF9A 4GXBA 4HXDA 4WJOA 4EZLA 2MSED 4AUQC 5J17A 3B0AA 4EZKA 1GNUA 3KYCD 4II3B 4KZ0A 4A3PA 2FIDA 2JZZA 2CS4A 2N7DA 2KD0A 2AEHA 2DHZA 3DCGA 2K8BA 1RFAA 3Q3FA 4W9LA 2MLBA 2C60A 2C7HA 4TKNA 4TQ0A 2HJ8A 3QC8B 4HCPB 3M63B 3L17A 3V6EB 2G4DB 2K25A 3PPAA 2ZCCA 3CF6E 2K39A 4OVVA 3NOBA 2DZJA 2JVCA 5D2MB 4F7ZA 3ZNID 3I3TB 3ZDTA 3JSVA 1E7VA 2D2QA 3HM6X 5AZFA 2NR2A 4GB9A 4EUTA 2IY0B 4I6PA 4HK2A 1YQBA 2LVOA 2ZPYA 1Z5SB 3A1QA 4P7IA 3KW5B 2DZMA 3M3JA 3Q3JA 3MTNB 1IP9A 1M94A 5CTRC 4AP4C 3WAPA 2LD9A 2NPTA 1E90A 1WR1A 3OLMD 3PHXB 3CSFA 2CHWA 3QK0A 4B6WA 5DPWA 4HPMB 4DWFA 1WX8A 1P1AA 2KANA 2JY6A 1V81A 3H1UA 4IW0A 3K9PB 3RULA 2DYBA 3AU5A 4PS8A 1J19A 1WGHA 3VTUA 1IPGA 3VTWA 2KLGA 2FAZA 3A4SC 3VUYA 4ASWC 1E8WA 2BF8B 4FJVB 1EF1A 1PQSA 3B1LX 3QA8A 3SHQA 3AULA 3LJ3A 3WANA 5C23A 2EMTA 3JSVB 3L54A 4G0NB 4I6NB 3ZTCA 4DDID 3H9DA 1MG8A 3H6NA 4K1RB 2VRRB 1Z2MA 4KIKA 3MHSD 3TMPB 3L0WB 4IWQA 1VCBA 3WALA 4IWOA 2N1WA 4W9KA 2DX5B 2JRHA 3C0RB 4B95A 3QARA 2LZ6A 2Y5BB 4MGYE 5LXIB 2BGFA 2KJRA 2NPTB 4ZRJA 2AL6A 3HK0A 4FJYA 3N30A 2J7QB 2KX3A 4KZCA 5JHAA 3PRZA 4CO7A 3V60A 4NPNA 2WDTB 3S2AA 3QQ8B 5D94A 1E5WA 2LRUA 3ZVVA 4N9F4 1RLFA 3L16A 4BKTA 2AL3A 1V6EA 2MRPA 1HE8A 3ZNHB 1U4AA 5L83A 3VH3B 3VVWB 1WM2A 3ZIMA 1TBEA 3A33B 4KDIC 5AZHA 2KJHB 4ICVA 1Q0WB 4KDLB 1V49A 1YX6B 3LDZE 3DBRI 2MQJA 5FR6A 3UQAA 1YIWA 2KQSA 3R7QA 3R3MA 3KUCB 1YX5B 2B3AA 2KJ6A 1GC6A 2O6VB 4ICUA 4WQOB 2K1FA 2KFKA 2Z0EB 3X0WA 4B9KA 4FA6A 1ZKHA 2KOXA 1ISNA 1UBQA 3UGBB 3TCAA 2JXXA 2LGYA 1OTRB 3AI5A 3H7PB 1WX7A 5DPTA 3PTFC 3ZUNA 1WMHA 3W1SC 1WI0A 1GG3A 2CR5A 2K8HA 2DENB 4DHZE 2KFJA 3DBHI 1WXAA 4TUUA 1F9JA 1C3TA 2ZNVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IY1 B;  1EUV B;  2BYE A;  2BYF A;  4GMV A;  1WM3 A;  2G4S A;  4MJS A;  2J0J A;  4NQL B;  2IBI B;  3PRM B;  3K9O B;  4MGI E;  2MA9 B;  1H8C A;  2XEW A;  2L7R A;  3A9K B;  4LDT D;  4NY0 A;  4KSK C;  4EEW A;  3NHE B;  3L13 A;  3DQV A;  4RM8 A;  4CHK A;  5JZE B;  1IYF A;  3ZDM C;  2K8C A;  3M95 A;  3IBE A;  3SU8 X;  1ZW7 A;  3W1S A;  2KWU B;  4RMA A;  5HKH A;  2BWE S;  5IA7 A;  4DK5 A;  4NQK E;  1KOT A;  2LJ5 A;  4M0W B;  2L0T A;  2BWF A;  4W9F A;  5DCN A;  3OJ4 B;  5EDS A;  4W9E A;  2JZ3 B;  4DHJ B;  1I35 A;  4GDL B;  3X23 A;  2CHX A;  2LVP A;  4PYU A;  4GN1 A;  5KHO A;  4MGK E;  1QZE A;  3ZRF A;  4MDK E;  2WX1 A;  5C1Z A;  2MBB B;  3EHV A;  2LGD A;  1E8Y A;  1WE6 A;  4WJN A;  2JPH A;  2KTF A;  4MEL A;  2KDF B;  3SD5 A;  4F8C B;  4W9J A;  1WJU A;  4LJO B;  3QJZ A;  3HHM A;  4ANV A;  4HCN B;  1LQB A;  3VFK A;  2R2Q A;  1RAX A;  3DBS A;  4W9G A;  4G3X B;  3APF A;  2KX0 A;  2M4N A;  4KVG B;  4ANW A;  3JW0 X;  2I1J A;  2IYD B;  3VAW A;  4K7W A;  1YD8 U;  3KUD B;  4NAW B;  5G55 A;  3V6C B;  4EFO A;  3TBL D;  3CST A;  1YJ1 A;  2D10 A;  3VUW A;  3W1Y A;  3RD2 A;  5J2R A;  1TZ1 A;  2KDE B;  1KLV A;  1WX9 A;  2LXA A;  5E6N A;  3B08 A;  3PS6 A;  3ZNG C;  3VUX A;  4ZYN A;  2KWC A;  4W9D A;  4WJP A;  4X57 B;  1E7U A;  1LM8 B;  3EFU A;  2KXJ A;  2KVR A;  3DVG X;  2MX2 A;  4PS7 A;  1JRU A;  4GDK A;  2KNB A;  2AWT A;  3QWZ B;  2KC2 A;  4IM2 A;  4FHJ A;  4FUL A;  2MBE A;  1K8R B;  2O2V A;  3DBL I;  4JGH B;  4E71 A;  2GMI C;  2M1M A;  2LRW A;  2N1V A;  2JRI B;  1SE9 A;  5LXH A;  3PLU A;  3RYT A;  3TL5 A;  1V2Y A;  4HDQ A;  4KV2 A;  4I6L B;  4K7U A;  1OEY A;  3DDC B;  1WGG A;  3SDL C;  3RUI B;  4WWP A;  3WA0 A;  2V4L A;  3APD A;  3EEC A;  1E8X A;  4GU2 A;  1WE7 A;  3ML9 A;  4MGZ E;  2KMC A;  3AXC A;  3JVZ X;  3P2B A;  4NAW A;  4FAD A;  3PLV A;  5D6J B;  2WYQ A;  3KUZ A;  2A5U A;  4M8M A;  1EO6 A;  1WJ6 A;  3QAQ A;  2XK5 A;  5DPS A;  2EMS A;  2L05 A;  4HDO A;  2OOB B;  4URK A;  2GOW A;  3BY4 B;  4JQW C;  5J18 A;  3WIM A;  1L7Y A;  1WIA A;  4MJS B;  2IZV B;  4WWN A;  1V5T A;  1UD7 A;  2DYO A;  3PZD A;  3TIX A;  1CMX B;  4FJZ A;  2J0K A;  3PSE B;  2GBK A;  4GDK B;  4BFR A;  4E74 A;  2MW5 A;  3CMM B;  4TV3 A;  2LGX A;  3QHT A;  4AWJ A;  1WMH B;  2JF5 A;  2M17 A;  2ZVO A;  3KYD D;  4IUM B;  1Q5W B;  2NBW B;  1XT9 B;  2KTR A;  3QCA A;  4IM0 A;  1GC7 A;  3H7S A;  2RD0 A;  3ZLZ A;  2FIF A;  4XZ4 A;  2R2O A;  3ZNZ B;  2PJH A;  4WAA A;  4WJQ A;  3V61 A;  2J0M A;  2LI5 A;  3D32 A;  2IO0 B;  2A4Z A;  2BKR B;  5E6O A;  1TTN A;  2RGF A;  4IWP A;  1L2N A;  4G11 A;  3QX1 A;  3V62 A;  4EZJ A;  2KO3 A;  4HLE A;  1WR6 E;  3BIN A;  3HM3 A;  4GGQ A;  4GOC A;  4IC7 B;  4NJ7 A;  1NI2 A;  4BOS C;  4MH0 E;  2KMA A;  2MWS B;  2ZNV C;  4ZRI A;  3VXW A;  1P9D U;  1UGM A;  3PRE A;  5CHW A;  2KZR A;  1WXS A;  2L76 A;  4TQ1 A;  3ZRC A;  1I42 A;  2XK5 B;  2V1Y A;  3PGE A;  3A4R A;  2LVQ A;  1C1Y B;  2JT4 B;  4JL9 A;  2GBM A;  2C9W B;  1WFY A;  2QHO A;  2KTR B;  4ZRK A;  1E8Z A;  5JHB A;  1VD2 A;  4HVB A;  4M8N A;  1GUA B;  1V80 A;  2L8J A;  3A9J A;  2RR9 A;  2D3G A;  4J6I A;  4W9I A;  3TJP A;  1SIF A;  1XQQ A;  4DHZ B;  4EOY A;  2BPS A;  2UYZ B;  4IG7 B;  4NNJ B;  2BKF A;  3A9K A;  4BVU C;  1P98 A;  1WXV A;  3WAM A;  2WWZ A;  2N7E A;  5E6P A;  4BOZ B;  2HD5 B;  2OJR A;  2RSU A;  2KDB A;  3NZS A;  4DDG D;  3IHP C;  3DPD A;  4BBN F;  5AEK B;  2DYM A;  3A1Q B;  3VQI A;  1WJ4 A;  3QIJ A;  2KLC A;  2DAF A;  2ZZP B;  1Q1O A;  1WJN A;  1WGR A;  2JWZ A;  3N32 A;  4JLC A;  4PS3 A;  4RM9 A;  4WWO A;  2DAJ A;  2O6V D;  3T8M A;  4FBJ B;  1J0G A;  1WYW B;  3ENE A;  2REX A;  1OQY A;  2M8S A;  1R4M I;  2KHW B;  3GZN I;  3RCZ A;  3T9L A;  1G6J A;  3H7P A;  1H4R A;  2D11 A;  5GMV A;  3WAO A;  1BT0 A;  1WY8 A;  2NVU I;  4EKU A;  3PHW B;  2HE7 A;  2CKH B;  2N4F A;  3ZKJ C;  3RT3 B;  3DVG Y;  3UIN B;  1T0Y A;  1J8C A;  3DVN V;  2IO1 B;  4JIO U;  1Y8R C;  2DZI A;  2NCN A;  2NS5 A;  2LUE A;  4PYZ A;  2K6Q A;  2PPH A;  2DZK A;  2KDI A;  4ZDV A;  1KJT A;  1A5R A;  2MBO A;  3ECI A;  2MCN B;  3U30 A;  3R66 C;  4MM3 A;  5AZG A;  4YL8 A;  3JYU A;  2PEA A;  3APC A;  4MEM A;  5BO4 B;  1UH6 A;  3NY5 A;  3UF8 A;  4BKS A;  1AAR A;  2D07 B;  4LJP B;  2GBN A;  4K81 A;  3ZTD A;  4MSM B;  3KH0 A;  4KSL C;  4DBG A;  3MJW A;  5KHQ A;  3UIP B;  2XBB C;  3DOW A;  4LCD E;  2FCS A;  4E3C A;  2YVC A;  3ML8 A;  2ZVN A;  4FLH A;  1FXT B;  3U8Z A;  5D7G A;  4DHJ D;  2MP2 A;  3RZW C;  3ZO5 B;  3EC8 A;  3ALB A;  2UWQ A;  2C7M B;  2Z0D B;  2V3S A;  1S1Q B;  2KFK B;  3AU4 A;  4G50 A;  3KVF B;  4XX5 A;  4AOF A;  2C7N B;  1GJZ A;  1SGH A;  3OAW A;  5IAA C;  1TGZ B;  2GBJ A;  3L08 A;  2HTH A;  2EKE C;  2LAS A;  2AYO B;  4AJY B;  1V5O A;  4CYE A;  1WZ3 A;  4II2 B;  2MBH A;  1EF5 A;  2G3Q B;  4XC2 A;  4DXA B;  2CHZ A;  2NBU A;  1UZX B;  2CU1 A;  2O2V B;  4GIV A;  3ONS A;  3PT2 B;  2KKC A;  2FNJ B;  2FCM A;  3IG3 A;  4LDT B;  4BBN C;  3ZW3 A;  3L10 B;  4F1S A;  5L95 C;  3VHT C;  4HPL B;  2KK8 A;  3RZF A;  2MP2 B;  2YLM A;  4FHK A;  1D3Z A;  2N9E B;  1S3S G;  3UIO B;  1NDD A;  2O6V A;  2W9N A;  2PE6 B;  1OGW A;  4HWI B;  2ASQ A;  5CHF A;  1LFD A;  2PE9 A;  4FN2 A;  2ZCB A;  2I1K A;  4KIK B;  5DPR A;  2NBV B;  1WGY A;  2GBR A;  3R7R A;  1X1M A;  1WH3 A;  2MBQ A;  3NZU A;  1UBI A;  2KWV B;  4MSQ B;  2Z59 B;  4A3O A;  1NBF C;  1P3Q U;  5JH5 C;  3VH4 B;  2RPQ A;  3OJ3 A;  4OVU A;  5G2N A;  3PV1 A;  4GDL A;  3HIZ A;  2G45 B;  3PRP B;  2K6D B;  3UQB A;  1V9J A;  1XD3 B;  2LXC A;  3VTV A;  3N3K B;  4AJW A;  2L0F A;  2FCN A;  3DVN U;  3PVL A;  3O65 B;  2N9X A;  3IFW B;  2FCQ A;  5TR5 A;  4K7S A;  1KM7 A;  4A20 A;  1RRB A;  1UEL A;  3M62 B;  4W9H A;  1R4N I;  3NS8 A;  5LLI A;  3U7D A;  1WRD B;  3VDZ A;  2JUO A;  4HJK A;  4W9C A;  1OEY J;  3IVF A;  5CHV C;  2LWP A;  4GSW A;  4NJ6 A;  1LXD A;  2ZPN A;  3A9J B;  2L3Z A;  1P0R A;  1WGD A;  4BKS D;  4ANX A;  2ZEQ A;  5CX3 A;  2L00 B;  2C5L C;  4BKG A;  1WZ0 A;  2IO3 B;  1V86 A;  2FUH B;  2KC1 A;  2ZJD A;  2M0X A;  2WX0 A;  1WXM A;  2IO2 B;  2N9P C;  2BYV E;  1ZGU B;  3GOE A;  4IM3 A;  4ANU A;  2KQ7 A;  2KN5 A;  1WF9 A;  4GXB A;  4HXD A;  4WJO A;  4EZL A;  2MSE D;  4AUQ C;  5J17 A;  3B0A A;  4EZK A;  1GNU A;  3KYC D;  4II3 B;  4KZ0 A;  4A3P A;  2FID A;  2JZZ A;  2CS4 A;  2N7D A;  2KD0 A;  2AEH A;  2DHZ A;  3DCG A;  2K8B A;  1RFA A;  3Q3F A;  4W9L A;  2MLB A;  2C60 A;  2C7H A;  4TKN A;  4TQ0 A;  2HJ8 A;  3QC8 B;  4HCP B;  3M63 B;  3L17 A;  3V6E B;  2G4D B;  2K25 A;  3PPA A;  2ZCC A;  3CF6 E;  2K39 A;  4OVV A;  3NOB A;  2DZJ A;  2JVC A;  5D2M B;  4F7Z A;  3ZNI D;  3I3T B;  3ZDT A;  3JSV A;  1E7V A;  2D2Q A;  3HM6 X;  5AZF A;  2NR2 A;  4GB9 A;  4EUT A;  2IY0 B;  4I6P A;  4HK2 A;  1YQB A;  2LVO A;  2ZPY A;  1Z5S B;  3A1Q A;  4P7I A;  3KW5 B;  2DZM A;  3M3J A;  3Q3J A;  3MTN B;  1IP9 A;  1M94 A;  5CTR C;  4AP4 C;  3WAP A;  2LD9 A;  2NPT A;  1E90 A;  1WR1 A;  3OLM D;  3PHX B;  3CSF A;  2CHW A;  3QK0 A;  4B6W A;  5DPW A;  4HPM B;  4DWF A;  1WX8 A;  1P1A A;  2KAN A;  2JY6 A;  1V81 A;  3H1U A;  4IW0 A;  3K9P B;  3RUL A;  2DYB A;  3AU5 A;  4PS8 A;  1J19 A;  1WGH A;  3VTU A;  1IPG A;  3VTW A;  2KLG A;  2FAZ A;  3A4S C;  3VUY A;  4ASW C;  1E8W A;  2BF8 B;  4FJV B;  1EF1 A;  1PQS A;  3B1L X;  3QA8 A;  3SHQ A;  3AUL A;  3LJ3 A;  3WAN A;  5C23 A;  2EMT A;  3JSV B;  3L54 A;  4G0N B;  4I6N B;  3ZTC A;  4DDI D;  3H9D A;  1MG8 A;  3H6N A;  4K1R B;  2VRR B;  1Z2M A;  4KIK A;  3MHS D;  3TMP B;  3L0W B;  4IWQ A;  1VCB A;  3WAL A;  4IWO A;  2N1W A;  4W9K A;  2DX5 B;  2JRH A;  3C0R B;  4B95 A;  3QAR A;  2LZ6 A;  2Y5B B;  4MGY E;  5LXI B;  2BGF A;  2KJR A;  2NPT B;  4ZRJ A;  2AL6 A;  3HK0 A;  4FJY A;  3N30 A;  2J7Q B;  2KX3 A;  4KZC A;  5JHA A;  3PRZ A;  4CO7 A;  3V60 A;  4NPN A;  2WDT B;  3S2A A;  3QQ8 B;  5D94 A;  1E5W A;  2LRU A;  3ZVV A;  4N9F 4;  1RLF A;  3L16 A;  4BKT A;  2AL3 A;  1V6E A;  2MRP A;  1HE8 A;  3ZNH B;  1U4A A;  5L83 A;  3VH3 B;  3VVW B;  1WM2 A;  3ZIM A;  1TBE A;  3A33 B;  4KDI C;  5AZH A;  2KJH B;  4ICV A;  1Q0W B;  4KDL B;  1V49 A;  1YX6 B;  3LDZ E;  3DBR I;  2MQJ A;  5FR6 A;  3UQA A;  1YIW A;  2KQS A;  3R7Q A;  3R3M A;  3KUC B;  1YX5 B;  2B3A A;  2KJ6 A;  1GC6 A;  2O6V B;  4ICU A;  4WQO B;  2K1F A;  2KFK A;  2Z0E B;  3X0W A;  4B9K A;  4FA6 A;  1ZKH A;  2KOX A;  1ISN A;  1UBQ A;  3UGB B;  3TCA A;  2JXX A;  2LGY A;  1OTR B;  3AI5 A;  3H7P B;  1WX7 A;  5DPT A;  3PTF C;  3ZUN A;  1WMH A;  3W1S C;  1WI0 A;  1GG3 A;  2CR5 A;  2K8H A;  2DEN B;  4DHZ E;  2KFJ A;  3DBH I;  1WXA A;  4TUU A;  1F9J A;  1C3T A;  2ZNV B; 
#chains in the Genus database with same CATH topology
 1EUV B;  1P7F A;  3NVZ A;  1XXG A;  3PRM B;  1N6Z A;  3LYY A;  3NHE B;  3L13 A;  1OQQ A;  4RM8 A;  4CHK A;  1I4G A;  5JZE B;  1IYF A;  3IBE A;  1ZW7 A;  3W1S A;  3GZN B;  2GI9 A;  1ZDX A;  1KOT A;  4W9F A;  1E0Z A;  1I35 A;  2CHX A;  4GN1 A;  4P1C C;  1ZPS A;  2LGD A;  1N5W A;  1WE6 A;  4WJN A;  3HRD D;  5TSS A;  2KDF B;  2CU3 A;  3EGR A;  3VFK A;  1ENF A;  2M0A A;  4M01 A;  3DBS A;  4W9G A;  2M4N A;  2IYD B;  4XYC A;  4RH6 A;  2L32 A;  4K7W A;  1TT5 B;  1YD8 U;  2HTM E;  2RDB C;  3GE3 C;  3KUD B;  5G55 A;  4M0W A;  2BQQ A;  2KDE B;  1PUT A;  2PMV A;  1V8C A;  3VUX A;  1KRH A;  4WJP A;  1TZO A;  3CIR B;  1ZE3 D;  1LM8 B;  1D6E C;  3DVG X;  3N9Y C;  4PS7 A;  3QWZ B;  2VZK D;  4FUL A;  1K8R B;  2O2V A;  1HTO A;  2LRW A;  2JRI B;  1SE9 A;  2VH2 A;  1EM7 A;  1OEY A;  1WGG A;  3RUI B;  4WWP A;  3APD A;  1WE7 A;  4NAW A;  3JVZ X;  5D6J B;  4M8M A;  4LNF A;  5DPS A;  2XK5 A;  1FNU A;  1CJE A;  3Q8A A;  2OOB B;  4URK A;  2GOW A;  3WIM A;  1MPE A;  1TIF A;  4WWN A;  4FJZ A;  2DNF A;  4B0E A;  3CMM B;  3Q8B A;  2LGX A;  4OZC A;  3KYD D;  3AE5 B;  1GC7 A;  1YJI A;  4XZ4 A;  2R2O A;  3BWU D;  4WAA A;  4WJQ A;  3ZNZ B;  1ROE A;  1NVI D;  1CQV A;  3D32 A;  5MPO A;  1J7C A;  2A4Z A;  2QSD A;  2IDY A;  5EE3 A;  4IWP A;  1L2N A;  4EZJ A;  4HLE A;  1WR6 E;  4GOC A;  4KKJ A;  4BOS C;  4MH0 E;  2KMA A;  3KWL A;  1P9D U;  2I38 A;  1NEK B;  1DOY A;  4O1N A;  1VJK A;  4KGS A;  1ESF A;  1I4X A;  1I42 A;  5BYR A;  2IGG A;  4JL9 A;  3RNA C;  2CJO A;  2GBM A;  1WFY A;  3RFZ B;  2KTR B;  1V1P A;  1V80 A;  4J6I A;  2RR9 A;  4YXD B;  4W9I A;  1SBB B;  4NNJ B;  2BB5 A;  3A9K A;  2BVC A;  2WWZ A;  2N7E A;  3R8B A;  4BOZ B;  2RSU A;  3NZS A;  3A1Q B;  3VQI A;  1FPY A;  4PS3 A;  4WWO A;  4MAC A;  2DAJ A;  4FBJ B;  1OQY A;  3RCZ A;  3H8H A;  1G6J A;  2D11 A;  1R4M B;  2G9H D;  1BT0 A;  1TKG A;  1WY8 A;  3MC0 B;  2XNA C;  2HJ1 A;  1JWA D;  2DLB A;  4PYZ A;  3RMK C;  1BXT A;  1N62 A;  2KDI A;  2BBC A;  3ECI A;  4MM3 A;  4YL8 A;  5H8Y E;  4YSY B;  2PEA A;  3APC A;  2PVG C;  4CQN A;  3ZQ4 A;  1AAR A;  4LJP B;  2GBN A;  4K81 A;  4MSM B;  3ZJV A;  3KH0 A;  2D3B A;  2XBB C;  2V3P A;  2YVC A;  3ML8 A;  1FXT B;  3U8Z A;  4LNN A;  4DHJ D;  2C7M B;  4G50 A;  3OAW A;  1QQR A;  2PVO D;  1WZ3 A;  1YMH E;  3URY A;  2KKC A;  3AEF B;  2FNJ B;  4BBN C;  4P1B C;  5EE9 A;  4RGN A;  4WAF A;  2KK8 A;  1IUE A;  1UWM A;  2V4I B;  3GB1 A;  1XEE A;  1D3Z A;  2JYE A;  1E6E B;  1S3S G;  3E9S A;  4WIP A;  2PE6 B;  4HWI B;  3DHH C;  1VLB A;  2GRI A;  4A3O A;  3VRA B;  3VH4 B;  5G2N A;  1FXI A;  3PV1 A;  4GDL A;  1KLU D;  1XD3 B;  2IJ0 A;  4AJW A;  2FCN A;  3I57 A;  2N9X A;  3IFW B;  2FCQ A;  2BW2 A;  1KM7 A;  3ABV B;  1KTK A;  4W9H A;  4OZB A;  1F1H A;  2WLB A;  3NJT A;  4OW0 A;  5CHV C;  4NJ6 A;  2ZPN A;  2CJN A;  1V86 A;  4IM3 A;  4ANU A;  1J7A A;  2KN5 A;  2RPV A;  1RM6 C;  4GXB A;  4WJO A;  3RNG C;  2MSE D;  4EZK A;  1IBX B;  3KYC D;  4HPP A;  4MT5 A;  2FID A;  2CS4 A;  2AEH A;  2DHZ A;  3DCG A;  3Q3F A;  4W9L A;  1FXA A;  2MLB A;  2R61 A;  4TQ0 A;  4P16 A;  3M63 B;  1ET9 A;  3AE2 B;  3NOB A;  2JVC A;  4IDI A;  5T8I A;  2IY0 B;  1YQB A;  3KW5 B;  1TS4 A;  2JQR B;  1QIL A;  2WU2 B;  1E90 A;  2CHW A;  3QK0 A;  1SE3 A;  4DXF A;  4LNK A;  2JY6 A;  3K9P B;  3VTU A;  4PS8 A;  3TEX A;  2KLG A;  2WDQ B;  3A4S C;  2BF8 B;  3RPF C;  1EF1 A;  1JWM D;  2ZW0 A;  3N20 C;  2QJL A;  3JSV B;  3L54 A;  2MHJ A;  1UNS A;  1C4C A;  1JQ4 A;  1Z2M A;  1I4Q A;  4HRS A;  3AE9 B;  3L4P A;  3AB5 A;  4IWO A;  4W9K A;  3C0R B;  4BZA A;  2W54 A;  3E56 A;  4KX6 B;  2LZ6 A;  4ZOH C;  5LXI B;  4YTN B;  2SEB D;  2D5G A;  2AL6 A;  5JHA A;  4CO7 A;  3OG5 A;  3V60 A;  4NPN A;  5D94 A;  3T3O A;  2H89 B;  3ZXR A;  3L16 A;  2AL3 A;  4IKG A;  3VH3 B;  1WM2 A;  4KDI C;  2KJH B;  4M00 A;  1XO3 A;  4OHJ A;  1YX6 B;  2TSS A;  3LDZ E;  3DBR I;  5FR6 A;  1YIW A;  1QT9 A;  3KUC B;  2KFK A;  1T0S C;  1ISN A;  1CZP A;  2W3R A;  3MP9 A;  2LUM A;  3TCA A;  2LGY A;  3AI5 A;  4YT0 B;  3PTF C;  1WI0 A;  2DEN B;  2KFJ A;  2V3N A;  5IOI A;  1C3T A;  2IY1 B;  1ZOY B;  4GMV A;  4MJS A;  1WM3 A;  2J0J A;  4MGI E;  2XEW A;  2L7R A;  3A9K B;  5BMI A;  1FEH A;  2B76 B;  2N7J A;  1RYJ A;  3SFE B;  4C00 A;  2KWU B;  1AN8 A;  5IA7 A;  4DK5 A;  3MJ5 A;  2LJ5 A;  2K5P A;  4M0W B;  4RGO S;  5DCN A;  3OJ4 B;  2JZ3 B;  4DHJ B;  4WH4 A;  3X23 A;  2LVP A;  4ZRP A;  1ZP0 B;  4MGK E;  1OFF A;  1C9F A;  4MDK E;  2WX1 A;  2MBB B;  2D3A A;  1E8Y A;  1FFU A;  1EWY C;  3AEB B;  3QJZ A;  2WXI A;  3W2D A;  3Q3N C;  5C3J B;  4G3X B;  3LXF A;  2WXQ A;  4NAW B;  4C7Y A;  3V6C B;  1L0X B;  3CST A;  1YJ1 A;  3W1Y A;  3RD2 A;  3AE4 B;  3Q3M C;  3PS6 A;  4W9D A;  1E7U A;  3TUO A;  2KC2 A;  1Y56 A;  4FHJ A;  5FR3 A;  4JGH B;  4E71 A;  1HA5 A;  1YN5 A;  1TKY A;  2ICI A;  3RN9 C;  3VR8 B;  4B0M A;  3SDL C;  3EEC A;  1E8X A;  3N1X C;  1WRI A;  3PO0 A;  4MGZ E;  2W82 A;  3AXC A;  3PLV A;  3TSS A;  2WYQ A;  1UGJ A;  3R2I A;  3QAQ A;  2H88 B;  5H92 C;  2EMS A;  1NYQ A;  2L05 A;  2SAK A;  2KMM A;  1JRP A;  1WSP A;  4MJS B;  3AEG B;  3FIL A;  4BFR A;  2GBK A;  3QHT A;  3IXS A;  1WMH B;  3SFD B;  2NBW B;  2GB1 A;  1XT9 B;  2KTR A;  3QCA A;  3W9C B;  2LHD A;  2PJH A;  5FKA C;  2LI5 A;  5C2T B;  2BKR B;  5E6O A;  3ZGZ A;  1L0V B;  5EE0 A;  3AEA B;  2KO3 A;  3BIN A;  4IC7 B;  1NI2 A;  4ZRI A;  1T0R C;  1GOZ A;  3PRE A;  1ZDV A;  2L52 A;  2MJD A;  4TQ1 A;  3PGE A;  3IAM 1;  2PLP A;  1E8Z A;  3NUH B;  1GUA B;  2L8J A;  3AH7 A;  1P7E A;  1XQQ A;  4EOY A;  2BPS A;  2UYZ B;  4BVU C;  3WAM A;  4BBN F;  4HKZ E;  2V0G A;  3W5U B;  3QIJ A;  1N61 A;  2JWZ A;  1WGR A;  2O6V D;  1J0G A;  2KHW B;  3GP7 A;  3GZN I;  1JW9 D;  2MH7 A;  1Q10 A;  3PHW B;  4LLG M;  2CKH B;  3I5J C;  3RT3 B;  3UIN B;  2WNM A;  4JIO U;  5IKC M;  2NCN A;  2K6Q A;  3Q2A C;  2LJI A;  2W55 A;  1A5R A;  3V05 A;  2MCN B;  1FMA D;  5AZG A;  3JYU A;  5BO4 B;  2Z8L A;  3UF8 A;  2D07 B;  3UI3 A;  3ZTD A;  3NG0 A;  4KSL C;  4DBG A;  1F2R I;  3DOW A;  4E3C A;  4FLH A;  2ZVN A;  1QOB A;  3RZW C;  3EC8 A;  3HVD A;  4N6E B;  4YSZ B;  2PW9 A;  1SGH A;  2GBJ A;  2PIA A;  2AYO B;  2FE8 A;  2HDE A;  1ZXI A;  2G3Q B;  4XC2 A;  4ZRQ A;  1MFW A;  3ZJU A;  1KF6 B;  4GIV A;  1HXY D;  3ONS A;  2WXN A;  3IG3 A;  4JWU C;  3ZW3 A;  3L10 B;  1NEN B;  4K3B A;  4F1S A;  1T3Q A;  3RZF A;  2MP2 B;  2WGS A;  1FD6 A;  4FHK A;  1SEB D;  2QC8 A;  1NDD A;  2W9N A;  1V97 A;  1OGW A;  4RNA A;  3NVY A;  2I1K A;  5DPR A;  3N1Y C;  4N58 A;  1X1M A;  1WH3 A;  1UBI A;  3FKY A;  2Z59 B;  1P3Q U;  2PTL A;  2WP9 B;  2RPQ A;  3BYT B;  2RMM A;  3PRP B;  2K6D B;  1V9J A;  2L0F A;  3PVL A;  3O65 B;  1TKE A;  1SSN A;  4K7S A;  5LLI A;  2JX5 A;  4M02 A;  3U7D A;  2WXG A;  4P6V F;  1WRD B;  1UUP A;  4W9C A;  2BS2 B;  4GSW A;  1LXD A;  5JXV A;  3Q8F A;  2ONQ A;  4BKS D;  5CX3 A;  2C5L C;  4BKG A;  2MJE A;  2M0X A;  1WXM A;  3GOE A;  3R2T A;  1L4D B;  3SR6 A;  4LNI A;  2JSV X;  1R7S A;  2K22 A;  3MHZ A;  4EZL A;  4AUQ C;  1GNU A;  1M4V A;  4II3 B;  1SF0 A;  4ARC A;  1C76 A;  1RFA A;  1K52 A;  2C60 A;  1ZXH A;  4HCP B;  2WU5 B;  2K39 A;  1B1Z A;  3ZNI D;  2LEK A;  3JSV A;  3HM6 X;  3BK1 A;  4I6P A;  4P7I A;  1Z5S B;  2DZM A;  3MTN B;  3AE8 B;  2KAC A;  2LD9 A;  1D4B A;  1WR1 A;  3OLM D;  1JAL A;  4IOI E;  3CSF A;  4B6W A;  5DPW A;  1PFD A;  1V81 A;  4IW0 A;  2DYB A;  1J19 A;  1IPG A;  4LNO A;  3VUY A;  3P1M A;  4FJV B;  3O13 A;  3U7Z A;  4ZHP A;  2EMT A;  2WXO A;  3PZ8 A;  3ZTC A;  3H9D A;  1MG8 A;  4K1R B;  3WAL A;  2Y5B B;  1N63 A;  4MGY E;  4A6Q A;  4REZ A;  4ZRJ A;  3HK0 A;  2QDF A;  4FJY A;  3N30 A;  4KZC A;  4MH8 A;  3S2A A;  3I9V 1;  2WXK A;  2K9X A;  1V6E A;  2MRP A;  1XLQ A;  2J4X A;  1TBE A;  3AED B;  3A33 B;  5E6J A;  2OED A;  4KDL B;  4A55 A;  3UQA A;  4JWS C;  4DXG A;  1YX5 B;  4C56 C;  3ETR A;  2ON8 A;  3IAS 1;  2KJ6 A;  4WWM A;  1GC6 A;  2O6V B;  2K1F A;  4OVZ A;  2PKO A;  2KOX A;  4YWG G;  1UBQ A;  2L1A A;  1YOV B;  3W1S C;  1EU3 A;  1C4A A;  1WXA A;  1BML C;  4OZA A;  1IGC A;  4NQL B;  3DWG C;  3K9O B;  2AQ3 B;  2MA9 B;  4NY0 A;  1TS2 A;  4KSK C;  3NVW A;  3DQV A;  2KWD A;  2EEL A;  3ZDM C;  4L1B A;  3AE3 B;  1L6U A;  1XLN A;  2BWE S;  4PK1 A;  3DWM A;  3ZJT A;  2L0T A;  5EDS A;  5D3D A;  2EKI A;  2YEP B;  2MEK A;  4PYU A;  4RF1 A;  1QZE A;  1YQ3 B;  3ZRF A;  5C1Z A;  3EHV A;  1FCC C;  2BT6 A;  3AE7 B;  2JPH A;  3SD5 A;  4F8C B;  3MFG A;  1WJU A;  4LJO B;  3HHM A;  4ANV A;  1LQB A;  2INC C;  4ITK A;  2K3U A;  3APF A;  2KX0 A;  2X38 A;  4KVG B;  1TJE A;  4NJC A;  1VRA B;  2BTE A;  5J2R A;  3KWV A;  1TS5 A;  5E6N A;  3VRB B;  3B08 A;  1HEZ E;  3ZNG C;  1RWS A;  3MC9 A;  3EFU A;  1SE4 A;  2KVR A;  2MX2 A;  2DBY A;  2KNB A;  4LK0 M;  2IGH A;  2K0P A;  1EU4 A;  3DBL I;  2M1M A;  2N1V A;  2JZP A;  5LXH A;  3C19 A;  4XWT A;  3PLU A;  3TL5 A;  1V2Y A;  4HDQ A;  4ZYS A;  3DDC B;  1L4Z B;  3WA0 A;  2V4L A;  2WXP A;  4A90 A;  3Q3O C;  4GU2 A;  2QCZ A;  4QAY A;  2KMC A;  3P2B A;  1XLP A;  3KUZ A;  2A5U A;  1WWT A;  5J18 A;  2LHE A;  3BY4 B;  4JQW C;  2NTT A;  4KGT A;  4D2K A;  4UDU C;  1L7Y A;  1V5T A;  2DYO A;  3B2F A;  5IP4 D;  4E74 A;  2J0K A;  4GDK B;  2MW5 A;  4TV3 A;  1YNT E;  2N9K A;  1GPX A;  2M17 A;  2JF5 A;  2ZVO A;  4IUM B;  1Q5W B;  1DGJ A;  4IM0 A;  2RD0 A;  3ZLZ A;  2FIF A;  1QOA A;  1VR9 A;  3V61 A;  3VR9 B;  2IO0 B;  3DBL B;  1TTN A;  2AQ2 B;  4G11 A;  3V62 A;  4GGQ A;  3DBH B;  2KYW A;  3KLS X;  2ZNV C;  2WHI A;  3OWE B;  3VXW A;  3GE8 C;  1K50 A;  3Q14 C;  5FK9 C;  1WXS A;  1UF0 A;  2LVQ A;  1C1Y B;  2WXM A;  3A4R A;  1YQ4 B;  4XE0 A;  1OQR A;  2C9W B;  2QHO A;  4ZRK A;  5JHB A;  4HVB A;  4M8N A;  1YN3 A;  3A9J A;  5AUI A;  3TJP A;  1SIF A;  3P4P B;  4DHZ E;  1KFY B;  2HD5 B;  2OJR A;  1E10 A;  2KDB A;  3IHP C;  3DPD A;  3P4R B;  2BYT A;  2ZZP B;  1WJN A;  4JLC A;  1YJJ A;  3ENE A;  2ZW1 A;  3H7P A;  3WAO A;  2NVU I;  4EKU A;  4BAX A;  2HE7 A;  1T0Y A;  4US9 A;  1SJE D;  1J8C A;  3DVN V;  1Y8R C;  2DZI A;  2LUE A;  5EE1 A;  2PPH A;  2DZK A;  4ZDV A;  2FUG 1;  1KJT A;  3R66 C;  4MEM A;  1UH6 A;  3BK2 A;  1KLG D;  1FM0 D;  5KHQ A;  1K53 A;  3UIP B;  4LCD E;  2FCS A;  4RGT A;  1F2R C;  2IPK D;  4R3D A;  5D7G A;  2N9L A;  2ACZ B;  2Y3A A;  3BII D;  4C4V B;  3ALB A;  2UWQ A;  4A8X C;  4XX5 A;  2KFK B;  4AOF A;  3KVF B;  2C7N B;  5IAA C;  3L08 A;  2XN9 C;  4XWW A;  2LAS A;  1FFV A;  1V5O A;  4CYE A;  4II2 B;  2MBH A;  2NBU A;  1SE2 A;  1UZX B;  2QIE B;  2CU1 A;  2BS4 B;  2OJW A;  2W3S A;  4HPL B;  5HFY A;  1C78 A;  1ACC A;  2N9E B;  3AV8 A;  3SEB A;  2O6V A;  3UIO B;  2L83 A;  5CHF A;  2ASQ A;  2Y5C A;  2LGI A;  2ZCB A;  3DBR B;  1WGY A;  2GBR A;  2MBQ A;  2KWV B;  4MSQ B;  1NBF C;  5JH5 C;  3OJ3 A;  3DHG C;  4OVU A;  4USA A;  2Y5P A;  2LXC A;  3N3K B;  2LFI A;  4YSX B;  2KDM A;  3M62 B;  3NS8 A;  1N60 A;  2LGS A;  4RGM A;  1LGR A;  2JUO A;  4HJK A;  3VDZ A;  1OEY J;  1VDV A;  4JPS A;  2INN E;  2L3Z A;  2ZEQ A;  4C7Z A;  2L00 B;  4HEA 1;  1KH0 A;  4FXC A;  2FUH B;  2ZJD A;  2WX0 A;  2IO2 B;  1JWB D;  1ZGU B;  2QIL A;  2WXL A;  2KQ7 A;  2RDH A;  4HXD A;  1HZ6 A;  3B0A A;  4A3P A;  2KD0 A;  4H2A A;  1J7B A;  3T3N A;  1WXQ A;  4A9A A;  3QC8 B;  3V6E B;  1JRO A;  4TSS A;  3PPA A;  2ZCC A;  1T6B X;  3CF6 E;  4OVV A;  2KAJ A;  5GXG B;  3I3T B;  3ZDT A;  1I4H A;  2I2Y A;  4KKI A;  1FIQ A;  3RNE C;  2LVO A;  4NZL B;  3MC8 A;  4ACF A;  1IBX A;  2AQ1 B;  1QOF A;  4NAM A;  3WAP A;  1AYF A;  3PHX B;  2KVZ A;  4ZHO A;  3Q8E A;  2WXH A;  2WQY B;  4L2Y A;  3CWI A;  4US8 A;  2KAN A;  2UU7 A;  3J9C A;  3BVZ A;  3RUL A;  1WGH A;  3VTW A;  1TS3 A;  2FAZ A;  4RF0 A;  3B1L X;  1I4P A;  1MJD A;  2X8X X;  3WAN A;  5I4D A;  2Q5W D;  4G0N B;  4I6N B;  1JCK B;  4K3C A;  3H6N A;  4JE3 B;  2VRR B;  4XGA B;  1QKZ A;  3MHS D;  3ZYY X;  3TMP B;  4IWQ A;  3U2S C;  3AM9 A;  4KGR A;  2DX5 B;  2JRH A;  2J42 A;  3QAR A;  2WXJ A;  3Q69 A;  2JU6 X;  2BGF A;  2KJR A;  2NPT B;  3AE1 B;  3HUI A;  2WDR B;  2INP E;  3QQ8 B;  2LRU A;  4YTM B;  2QEJ C;  1B9R A;  1K51 A;  1SIJ A;  3P4Q B;  1HTQ A;  1RLF A;  4BKT A;  3WCQ A;  2N0S B;  4EE2 A;  1HE8 A;  1U4A A;  3VVW B;  1F0Z A;  5AZH A;  1V49 A;  3R3M A;  5IO9 A;  4RFB A;  2B3A A;  4ICU A;  4B9K A;  4FA6 A;  2NMQ A;  1ZKH A;  1FNW A;  3RI7 C;  2JXX A;  5DPT A;  1WX7 A;  5AUK A;  3PZ7 A;  1GG3 A;  2CR5 A;  2M56 B;  1F9J A;  1DOX A;  5BMH A;  2BYE A;  2BYF A;  2G4S A;  2IBI B;  1H8C A;  1AW7 A;  2J53 A;  4LDT D;  4EEW A;  4WQM A;  3TEY A;  2RDG A;  2K8C A;  3M95 A;  5D3I B;  3SU8 X;  4C4V A;  1PYW D;  4RMA A;  5HKH A;  4NQK E;  1FNV A;  1PGB A;  4XDC A;  2BWF A;  2VH1 A;  4W9E A;  3AN1 A;  4PT5 A;  4J3O D;  4GDL B;  5KHO A;  1F77 A;  3IT6 B;  1TYG B;  2KTF A;  4MEL A;  4W9J A;  3TEZ A;  4LTU A;  5IN7 A;  4HCN B;  1SJH D;  2LMC A;  2R2Q A;  1NI3 A;  1RAX A;  3GS2 A;  4ANW A;  3JW0 X;  2I1J A;  1GB1 A;  3VAW A;  4S17 A;  1RFK A;  1L5P A;  4EFO A;  3TBL D;  2D10 A;  3VUW A;  3P42 A;  1TZ1 A;  1KLV A;  1WX9 A;  2LXA A;  3TEW A;  4TMA B;  3NS1 A;  2WXF A;  1FO4 A;  4ZYN A;  1EWC A;  1R4N B;  2KWC A;  3AEE B;  4HJG E;  4X57 B;  5BYQ A;  2KXJ A;  1MVK A;  1JRU A;  3V3X A;  4GDK A;  1FRR A;  3NRZ A;  3FAH A;  2AWT A;  3B9J A;  4IM2 A;  2MBE A;  1HQR D;  2GMI C;  3RYT A;  1SXT A;  4KV2 A;  4I6L B;  4K7U A;  1T0Q C;  2GLS A;  1MI0 A;  3BYY B;  2WXR A;  3ML9 A;  3BVM A;  4FAD A;  3I63 C;  1WJ6 A;  1EO6 A;  4HDO A;  1PDX A;  1WIA A;  2IZV B;  1UD7 A;  3PZD A;  3TIX A;  1CMX B;  5LNK 1;  3PSE B;  4Q2J A;  4AWJ A;  3EA6 A;  3H7S A;  4XDD A;  4WUR A;  2BB6 A;  2J0M A;  4HKQ A;  4AQ7 A;  1VZ7 A;  2RGF A;  1YN4 A;  3QX1 A;  3HM3 A;  4NJ7 A;  2IGD A;  2MWS B;  3FIL B;  2FBW B;  1UGM A;  5CHW A;  1E7P B;  2KZR A;  4L23 A;  2L76 A;  1QOG A;  3ZRC A;  2XK5 B;  1GAQ B;  2V1Y A;  2JT4 B;  1PGX A;  1C77 A;  1NYR A;  1VD2 A;  3FC4 A;  2D3G A;  2KT7 A;  4DHZ B;  1CK1 A;  4IG7 B;  2BKF A;  1P98 A;  1WXV A;  5E6P A;  4DDG D;  3U52 E;  5AEK B;  2DYM A;  4JX1 C;  1WJ4 A;  1L0Y B;  2KLC A;  1QF6 A;  1HZ5 A;  2DAF A;  1Q1O A;  2JYT A;  4RM9 A;  3N32 A;  1FCL A;  3T8M A;  1WYW B;  1V1O A;  2REX A;  2M8S A;  1R4M I;  5G5G A;  3T9L A;  1H4R A;  5GMV A;  3B2G A;  1I7H A;  3EUB 2;  2N4F A;  3RNF C;  3W5V B;  3Q6B A;  3ZKJ C;  1PGA A;  3DVG Y;  1N5X A;  2WDV B;  1C79 A;  2IO1 B;  2NS5 A;  1V1P B;  2MBO A;  1JWS D;  3U30 A;  1VZ6 A;  1IGD A;  3NY5 A;  4BKS A;  4N59 A;  2M19 A;  3MJW A;  2KQ4 X;  1I4R A;  1TY2 A;  1VZ8 A;  3N1Z C;  3RNB C;  3DHI C;  2MP2 A;  3ZO5 B;  2Z0D B;  2V3S A;  1S1Q B;  3AU4 A;  2OHF A;  1GJZ A;  1TGZ B;  2HTH A;  2EKE C;  4AJY B;  1EF5 A;  1XLO A;  4DXA B;  3P63 A;  4AS1 A;  2CHZ A;  4MM3 B;  1A70 A;  1XF5 L;  1XCQ L;  5HHD G;  2O2V B;  1LO5 D;  1DOI A;  3PT2 B;  1BUI C;  2FCM A;  4LDT B;  5BYS A;  5L95 C;  3VHT C;  1WGK A;  1D5M C;  2YLM A;  1LFD A;  2PE9 A;  4KIK B;  4FN2 A;  2NBV B;  1GB4 A;  3R7R A;  3NZU A;  3HIZ A;  2G45 B;  3UQB A;  2VZK B;  3VTV A;  1XCT L;  3DVN U;  3AEC B;  5TR5 A;  4A20 A;  4S0R A;  1RRB A;  1UEL A;  1R4N I;  3HVZ A;  4DQO C;  2J52 A;  3IVF A;  2LWP A;  3NVV A;  3A9J B;  1P0R A;  1WGD A;  4ANX A;  1WZ0 A;  2IO3 B;  2QMT A;  2KC1 A;  3P4S B;  2N9P C;  2BYV E;  5HG2 A;  2G1E A;  2DWQ A;  2E6X A;  1C4P A;  1WF9 A;  2BS3 B;  3ZXV A;  4ARI A;  5J17 A;  3Q8C A;  3BVG A;  4KZ0 A;  3BZD B;  2JZZ A;  1AWD A;  2D3C A;  2N7D A;  3KQ4 A;  2E3T A;  3NZ3 A;  4YTP B;  2K8B A;  2C7H A;  4TKN A;  1ZUD 2;  2HJ8 A;  5G5H A;  3RNC C;  3L17 A;  1JWU D;  2G4D B;  2K25 A;  5D2M B;  2DZJ A;  4F7Z A;  1E7V A;  2D2Q A;  5AZF A;  1MG4 A;  2NR2 A;  4GB9 A;  4EUT A;  4RCO A;  1DYQ A;  4HK2 A;  2ZPY A;  3A1Q A;  1D5X C;  1D5Z C;  3M3J A;  3IT4 B;  3Q3J A;  1IP9 A;  1M94 A;  5CTR C;  4AP4 C;  2NPT A;  1FRD A;  3AE6 B;  2YEP F;  4HPM B;  4DWF A;  1WX8 A;  1P1A A;  3AMZ A;  3H1U A;  1UWX A;  4C80 A;  3AU5 A;  2NTS A;  4ASW C;  1E8W A;  1JML A;  1PQS A;  3SHQ A;  3QA8 A;  3AUL A;  3LJ3 A;  5C23 A;  4DDI D;  2WS3 B;  2JWU A;  1E9M A;  2JXT A;  4KIK A;  5HI1 A;  2AX5 A;  3L0W B;  1MHH E;  1VCB A;  2N1W A;  1STE A;  4B95 A;  1ET6 A;  3EFC A;  2IND C;  2J7Q B;  2KX3 A;  3PRZ A;  2WDT B;  1E5W A;  1TY0 A;  3ZVV A;  4N9F 4;  5L83 A;  3ZNH B;  3ZIM A;  1SB3 C;  1WYG A;  3C8Y A;  4ICV A;  1Q0W B;  1QLB B;  2MQJ A;  1L6V A;  2KQS A;  3R7Q A;  5BMG A;  4WQO B;  1T5X D;  2Z0E B;  3X0W A;  2V9H A;  3U4E G;  1F52 A;  4GLS C;  3UGB B;  3H7P B;  1OTR B;  1MHX A;  3ZUN A;  2MJ3 A;  1WMH A;  2KN4 A;  3LB8 C;  4HRO A;  2K8H A;  3DBH I;  4TUU A;  2ZNV B; 
#chains in the Genus database with same CATH homology
 2IY1 B;  1EUV B;  2BYE A;  2BYF A;  4GMV A;  1WM3 A;  2G4S A;  4MJS A;  2J0J A;  4NQL B;  2IBI B;  3PRM B;  3K9O B;  4MGI E;  2MA9 B;  1H8C A;  2XEW A;  2L7R A;  3A9K B;  4LDT D;  4NY0 A;  4KSK C;  4EEW A;  3NHE B;  3L13 A;  3DQV A;  4RM8 A;  4CHK A;  5JZE B;  1IYF A;  3ZDM C;  2K8C A;  3M95 A;  3IBE A;  3SU8 X;  1ZW7 A;  3W1S A;  2KWU B;  4RMA A;  5HKH A;  2BWE S;  5IA7 A;  4DK5 A;  4NQK E;  1KOT A;  2LJ5 A;  4M0W B;  2L0T A;  2BWF A;  4W9F A;  5DCN A;  3OJ4 B;  5EDS A;  4W9E A;  2JZ3 B;  4DHJ B;  1I35 A;  4GDL B;  3X23 A;  2CHX A;  2LVP A;  4PYU A;  4GN1 A;  5KHO A;  4MGK E;  1QZE A;  3ZRF A;  4MDK E;  2WX1 A;  5C1Z A;  2MBB B;  3EHV A;  2LGD A;  1E8Y A;  1WE6 A;  4WJN A;  2JPH A;  2KTF A;  4MEL A;  2KDF B;  3SD5 A;  4F8C B;  4W9J A;  1WJU A;  4LJO B;  3QJZ A;  3HHM A;  4ANV A;  4HCN B;  1LQB A;  3VFK A;  2R2Q A;  1RAX A;  3DBS A;  4W9G A;  4G3X B;  3APF A;  2KX0 A;  2M4N A;  4KVG B;  4ANW A;  3JW0 X;  2I1J A;  2IYD B;  3VAW A;  4K7W A;  1YD8 U;  3KUD B;  4NAW B;  5G55 A;  3V6C B;  4EFO A;  3TBL D;  3CST A;  1YJ1 A;  2D10 A;  3VUW A;  3W1Y A;  3RD2 A;  5J2R A;  1TZ1 A;  2KDE B;  1KLV A;  1WX9 A;  2LXA A;  5E6N A;  3B08 A;  3PS6 A;  3ZNG C;  3VUX A;  4ZYN A;  2KWC A;  4W9D A;  4WJP A;  4X57 B;  1E7U A;  1LM8 B;  3EFU A;  2KXJ A;  2KVR A;  3DVG X;  2MX2 A;  4PS7 A;  1JRU A;  4GDK A;  2KNB A;  2AWT A;  3QWZ B;  2KC2 A;  4IM2 A;  4FHJ A;  4FUL A;  2MBE A;  1K8R B;  2O2V A;  3DBL I;  4JGH B;  4E71 A;  2GMI C;  2M1M A;  2LRW A;  2N1V A;  2JRI B;  1SE9 A;  5LXH A;  3PLU A;  3RYT A;  3TL5 A;  1V2Y A;  4HDQ A;  4KV2 A;  4I6L B;  4K7U A;  1OEY A;  3DDC B;  1WGG A;  3SDL C;  3RUI B;  4WWP A;  3WA0 A;  2V4L A;  3APD A;  3EEC A;  1E8X A;  4GU2 A;  1WE7 A;  3ML9 A;  4MGZ E;  2KMC A;  3AXC A;  3JVZ X;  3P2B A;  4NAW A;  4FAD A;  3PLV A;  5D6J B;  2WYQ A;  3KUZ A;  2A5U A;  4M8M A;  1EO6 A;  1WJ6 A;  3QAQ A;  2XK5 A;  5DPS A;  2EMS A;  2L05 A;  4HDO A;  2OOB B;  4URK A;  2GOW A;  3BY4 B;  4JQW C;  5J18 A;  3WIM A;  1L7Y A;  1WIA A;  4MJS B;  2IZV B;  4WWN A;  1V5T A;  1UD7 A;  2DYO A;  3PZD A;  3TIX A;  1CMX B;  4FJZ A;  2J0K A;  3PSE B;  2GBK A;  4GDK B;  4BFR A;  4E74 A;  2MW5 A;  3CMM B;  4TV3 A;  2LGX A;  3QHT A;  4AWJ A;  1WMH B;  2JF5 A;  2M17 A;  2ZVO A;  3KYD D;  4IUM B;  1Q5W B;  2NBW B;  1XT9 B;  2KTR A;  3QCA A;  4IM0 A;  1GC7 A;  3H7S A;  2RD0 A;  3ZLZ A;  2FIF A;  4XZ4 A;  2R2O A;  3ZNZ B;  2PJH A;  4WAA A;  4WJQ A;  3V61 A;  2J0M A;  2LI5 A;  3D32 A;  2IO0 B;  2A4Z A;  2BKR B;  5E6O A;  1TTN A;  2RGF A;  4IWP A;  1L2N A;  4G11 A;  3QX1 A;  3V62 A;  4EZJ A;  2KO3 A;  4HLE A;  1WR6 E;  3BIN A;  3HM3 A;  4GGQ A;  4GOC A;  4IC7 B;  4NJ7 A;  1NI2 A;  4BOS C;  4MH0 E;  2KMA A;  2MWS B;  2ZNV C;  4ZRI A;  3VXW A;  1P9D U;  1UGM A;  3PRE A;  5CHW A;  2KZR A;  1WXS A;  2L76 A;  4TQ1 A;  3ZRC A;  1I42 A;  2XK5 B;  2V1Y A;  3PGE A;  3A4R A;  2LVQ A;  1C1Y B;  2JT4 B;  4JL9 A;  2GBM A;  2C9W B;  1WFY A;  2QHO A;  2KTR B;  4ZRK A;  1E8Z A;  5JHB A;  1VD2 A;  4HVB A;  4M8N A;  1GUA B;  1V80 A;  2L8J A;  3A9J A;  2RR9 A;  2D3G A;  4J6I A;  4W9I A;  3TJP A;  1SIF A;  1XQQ A;  4DHZ B;  4EOY A;  2BPS A;  2UYZ B;  4IG7 B;  4NNJ B;  2BKF A;  3A9K A;  4BVU C;  1P98 A;  1WXV A;  3WAM A;  2WWZ A;  2N7E A;  5E6P A;  4BOZ B;  2HD5 B;  2OJR A;  2RSU A;  2KDB A;  3NZS A;  4DDG D;  3IHP C;  3DPD A;  4BBN F;  5AEK B;  2DYM A;  3A1Q B;  3VQI A;  1WJ4 A;  3QIJ A;  2KLC A;  2DAF A;  2ZZP B;  1Q1O A;  1WJN A;  1WGR A;  2JWZ A;  3N32 A;  4JLC A;  4PS3 A;  4RM9 A;  4WWO A;  2DAJ A;  2O6V D;  3T8M A;  4FBJ B;  1J0G A;  1WYW B;  3ENE A;  2REX A;  1OQY A;  2M8S A;  1R4M I;  2KHW B;  3GZN I;  3RCZ A;  3T9L A;  1G6J A;  3H7P A;  1H4R A;  2D11 A;  5GMV A;  3WAO A;  1BT0 A;  1WY8 A;  2NVU I;  4EKU A;  3PHW B;  2HE7 A;  2CKH B;  2N4F A;  3ZKJ C;  3RT3 B;  3DVG Y;  3UIN B;  1T0Y A;  1J8C A;  3DVN V;  2IO1 B;  4JIO U;  1Y8R C;  2DZI A;  2NCN A;  2NS5 A;  2LUE A;  4PYZ A;  2K6Q A;  2PPH A;  2DZK A;  2KDI A;  4ZDV A;  1KJT A;  1A5R A;  2MBO A;  3ECI A;  2MCN B;  3U30 A;  3R66 C;  4MM3 A;  5AZG A;  4YL8 A;  3JYU A;  2PEA A;  3APC A;  4MEM A;  5BO4 B;  1UH6 A;  3NY5 A;  3UF8 A;  4BKS A;  1AAR A;  2D07 B;  4LJP B;  2GBN A;  4K81 A;  3ZTD A;  4MSM B;  3KH0 A;  4KSL C;  4DBG A;  3MJW A;  5KHQ A;  3UIP B;  2XBB C;  3DOW A;  4LCD E;  2FCS A;  4E3C A;  2YVC A;  3ML8 A;  2ZVN A;  4FLH A;  1FXT B;  3U8Z A;  5D7G A;  4DHJ D;  2MP2 A;  3RZW C;  3ZO5 B;  3EC8 A;  3ALB A;  2UWQ A;  2C7M B;  2Z0D B;  2V3S A;  1S1Q B;  2KFK B;  3AU4 A;  4G50 A;  3KVF B;  4XX5 A;  4AOF A;  2C7N B;  1GJZ A;  1SGH A;  3OAW A;  5IAA C;  1TGZ B;  2GBJ A;  3L08 A;  2HTH A;  2EKE C;  2LAS A;  2AYO B;  4AJY B;  1V5O A;  4CYE A;  1WZ3 A;  4II2 B;  2MBH A;  1EF5 A;  2G3Q B;  4XC2 A;  4DXA B;  2CHZ A;  2NBU A;  1UZX B;  2CU1 A;  2O2V B;  4GIV A;  3ONS A;  3PT2 B;  2KKC A;  2FNJ B;  2FCM A;  3IG3 A;  4LDT B;  4BBN C;  3ZW3 A;  3L10 B;  4F1S A;  5L95 C;  3VHT C;  4HPL B;  2KK8 A;  3RZF A;  2MP2 B;  2YLM A;  4FHK A;  1D3Z A;  2N9E B;  1S3S G;  3UIO B;  1NDD A;  2O6V A;  2W9N A;  2PE6 B;  1OGW A;  4HWI B;  2ASQ A;  5CHF A;  1LFD A;  2PE9 A;  4FN2 A;  2ZCB A;  2I1K A;  4KIK B;  5DPR A;  2NBV B;  1WGY A;  2GBR A;  3R7R A;  1X1M A;  1WH3 A;  2MBQ A;  3NZU A;  1UBI A;  2KWV B;  4MSQ B;  2Z59 B;  4A3O A;  1NBF C;  1P3Q U;  5JH5 C;  3VH4 B;  2RPQ A;  3OJ3 A;  4OVU A;  5G2N A;  3PV1 A;  4GDL A;  3HIZ A;  2G45 B;  3PRP B;  2K6D B;  3UQB A;  1V9J A;  1XD3 B;  2LXC A;  3VTV A;  3N3K B;  4AJW A;  2L0F A;  2FCN A;  3DVN U;  3PVL A;  3O65 B;  2N9X A;  3IFW B;  2FCQ A;  5TR5 A;  4K7S A;  1KM7 A;  4A20 A;  1RRB A;  1UEL A;  3M62 B;  4W9H A;  1R4N I;  3NS8 A;  5LLI A;  3U7D A;  1WRD B;  3VDZ A;  2JUO A;  4HJK A;  4W9C A;  1OEY J;  3IVF A;  5CHV C;  2LWP A;  4GSW A;  4NJ6 A;  1LXD A;  2ZPN A;  3A9J B;  2L3Z A;  1P0R A;  1WGD A;  4BKS D;  4ANX A;  2ZEQ A;  5CX3 A;  2L00 B;  2C5L C;  4BKG A;  1WZ0 A;  2IO3 B;  1V86 A;  2FUH B;  2KC1 A;  2ZJD A;  2M0X A;  2WX0 A;  1WXM A;  2IO2 B;  2N9P C;  2BYV E;  1ZGU B;  3GOE A;  4IM3 A;  4ANU A;  2KQ7 A;  2KN5 A;  1WF9 A;  4GXB A;  4HXD A;  4WJO A;  4EZL A;  2MSE D;  4AUQ C;  5J17 A;  3B0A A;  4EZK A;  1GNU A;  3KYC D;  4II3 B;  4KZ0 A;  4A3P A;  2FID A;  2JZZ A;  2CS4 A;  2N7D A;  2KD0 A;  2AEH A;  2DHZ A;  3DCG A;  2K8B A;  1RFA A;  3Q3F A;  4W9L A;  2MLB A;  2C60 A;  2C7H A;  4TKN A;  4TQ0 A;  2HJ8 A;  3QC8 B;  4HCP B;  3M63 B;  3L17 A;  3V6E B;  2G4D B;  2K25 A;  3PPA A;  2ZCC A;  3CF6 E;  2K39 A;  4OVV A;  3NOB A;  2DZJ A;  2JVC A;  5D2M B;  4F7Z A;  3ZNI D;  3I3T B;  3ZDT A;  3JSV A;  1E7V A;  2D2Q A;  3HM6 X;  5AZF A;  2NR2 A;  4GB9 A;  4EUT A;  2IY0 B;  4I6P A;  4HK2 A;  1YQB A;  2LVO A;  2ZPY A;  1Z5S B;  3A1Q A;  4P7I A;  3KW5 B;  2DZM A;  3M3J A;  3Q3J A;  3MTN B;  1IP9 A;  1M94 A;  5CTR C;  4AP4 C;  3WAP A;  2LD9 A;  2NPT A;  1E90 A;  1WR1 A;  3OLM D;  3PHX B;  3CSF A;  2CHW A;  3QK0 A;  4B6W A;  5DPW A;  4HPM B;  4DWF A;  1WX8 A;  1P1A A;  2KAN A;  2JY6 A;  1V81 A;  3H1U A;  4IW0 A;  3K9P B;  3RUL A;  2DYB A;  3AU5 A;  4PS8 A;  1J19 A;  1WGH A;  3VTU A;  1IPG A;  3VTW A;  2KLG A;  2FAZ A;  3A4S C;  3VUY A;  4ASW C;  1E8W A;  2BF8 B;  4FJV B;  1EF1 A;  1PQS A;  3B1L X;  3QA8 A;  3SHQ A;  3AUL A;  3LJ3 A;  3WAN A;  5C23 A;  2EMT A;  3JSV B;  3L54 A;  4G0N B;  4I6N B;  3ZTC A;  4DDI D;  3H9D A;  1MG8 A;  3H6N A;  4K1R B;  2VRR B;  1Z2M A;  4KIK A;  3MHS D;  3TMP B;  3L0W B;  4IWQ A;  1VCB A;  3WAL A;  4IWO A;  2N1W A;  4W9K A;  2DX5 B;  2JRH A;  3C0R B;  4B95 A;  3QAR A;  2LZ6 A;  2Y5B B;  4MGY E;  5LXI B;  2BGF A;  2KJR A;  2NPT B;  4ZRJ A;  2AL6 A;  3HK0 A;  4FJY A;  3N30 A;  2J7Q B;  2KX3 A;  4KZC A;  5JHA A;  3PRZ A;  4CO7 A;  3V60 A;  4NPN A;  2WDT B;  3S2A A;  3QQ8 B;  5D94 A;  1E5W A;  2LRU A;  3ZVV A;  4N9F 4;  1RLF A;  3L16 A;  4BKT A;  2AL3 A;  1V6E A;  2MRP A;  1HE8 A;  3ZNH B;  1U4A A;  5L83 A;  3VH3 B;  3VVW B;  1WM2 A;  3ZIM A;  1TBE A;  3A33 B;  4KDI C;  5AZH A;  2KJH B;  4ICV A;  1Q0W B;  4KDL B;  1V49 A;  1YX6 B;  3LDZ E;  3DBR I;  2MQJ A;  5FR6 A;  3UQA A;  1YIW A;  2KQS A;  3R7Q A;  3R3M A;  3KUC B;  1YX5 B;  2B3A A;  2KJ6 A;  1GC6 A;  2O6V B;  4ICU A;  4WQO B;  2K1F A;  2KFK A;  2Z0E B;  3X0W A;  4B9K A;  4FA6 A;  1ZKH A;  2KOX A;  1ISN A;  1UBQ A;  3UGB B;  3TCA A;  2JXX A;  2LGY A;  1OTR B;  3AI5 A;  3H7P B;  1WX7 A;  5DPT A;  3PTF C;  3ZUN A;  1WMH A;  3W1S C;  1WI0 A;  1GG3 A;  2CR5 A;  2K8H A;  2DEN B;  4DHZ E;  2KFJ A;  3DBH I;  1WXA A;  4TUU A;  1F9J A;  1C3T A;  2ZNV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...