2W9NA

Crystal structure of linear di-ubiquitin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
148
structure length
148
Chain Sequence
QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN
publication title Molecular Discrimination of Structurally Equivalent Lys 63-Linked and Linear Polyubiquitin Chains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 40
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2009-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2w9nA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2w9nA02
2NBWB 3AULA 2LGYA 3L0WB 3H7SA 1D3ZA 4NPNA 1P1AA 1WE6A 3L54A 2IYDB 1NBFC 1OTRB 2V1YA 4W9HA 3PRPB 4W9DA 2L0TA 2KWVB 2JZZA 2ZPYA 3A9KA 2LVPA 1SGHA 2KDFB 1E7VA 2PJHA 5GMVA 2DZMA 3KW5B 1LXDA 2KDEB 2DAJA 3QQ8B 1OGWA 1V81A 1LQBA 3OAWA 4CYEA 4ASWC 4KVGB 4XC2A 5D6JB 5J18A 3A9JA 1ISNA 3WAMA 3GOEA 2J0JA 1GC6A 3UQBA 2N7DA 2KKCA 3S2AA 2DENB 2BPSA 5D2MB 4HVBA 1I42A 1R4NI 2KX0A 1P3QU 1KOTA 4HCPB 1WZ3A 1Z5SB 2O6VA 5DPWA 2GBMA 3L10B 2WX1A 4FJYA 4K81A 2G45B 3L16A 1E8ZA 2JRIB 3ECIA 4OVUA 1EO6A 3VTVA 2MBHA 3OLMD 3DVNU 3PVLA 2KWCA 3PPAA 4ANUA 4ZRIA 4WJQA 2CKHB 3B0AA 5AZFA 2CHXA 2BF8B 2YVCA 3L17A 3SDLC 1WGRA 5KHOA 4ZRKA 3VQIA 4AWJA 1E5WA 1J19A 1RLFA 1WX9A 2ZCBA 4FLHA 1WJUA 2DHZA 2ZVNA 4N9F4 2JY6A 2CR5A 3N32A 4M8NA 4BKTA 3U7DA 2DYOA 4W9EA 1HE8A 3ZTDA 4AJYB 2N4FA 1V5OA 3A1QB 2LVOA 4B95A 3TMPB 2CU1A 2LRUA 2BWES 3PS6A 2KQSA 3K9OB 2K6DB 3D32A 3IHPC 2JRHA 2BKRB 4B6WA 4EZLA 1H4RA 3IVFA 2BKFA 4FHJA 2AEHA 2N1VA 4TUUA 4FA6A 3PT2B 3EC8A 2L05A 3VXWA 2UWQA 4MSQB 1GC7A 2AYOB 2KOXA 4BFRA 2ZNVB 2MBQA 4K7UA 3R7QA 2NPTB 3T9LA 2JT4B 1C3TA 1VCBA 3Q3FA 3L13A 3RZFA 3DBSA 4KIKB 2MLBA 2M4NA 4RMAA 2HD5B 3CMMB 4HPLB 2RGFA 4ZRJA 2L3ZA 4JQWC 2M0XA 1WGHA 3MHSD 2LGDA 3ZRFA 3IBEA 2RR9A 2MP2B 5CHVC 1WM3A 3UGBB 5E6OA 3ZUNA 2RD0A 5KHQA 2C60A 1OQYA 5LXHA 1WGDA 4BVUC 2FIDA 1E90A 1WJ6A 3X0WA 1Q0WB 4G0NB 4EKUA 2BYEA 1ZW7A 2OJRA 4GOCA 2IO1B 4HDQA 4KSKC 3PREA 4BOZB 4EZKA 3KYCD 2C5LC 1E7UA 2MW5A 2NR2A 2AL6A 5HKHA 2L0FA 1YIWA 4BKGA 2KMCA 3C0RB 2BWFA 4GN1A 3QC8B 1RFAA 3ZVVA 2PEAA 3VH4B 2I1JA 4FULA 2MQJA 2D07B 4NNJB 5AZHA 1Q1OA 2HE7A 2JXXA 2KMAA 1S1QB 3DVNV 3KH0A 4GMVA 4ANVA 4GDLB 3RCZA 3V6EB 1WRDB 3NZUA 1VD2A 4MGKE 2EMSA 2REXA 3DDCB 4PS8A 4ANWA 4PS7A 2FNJB 4I6LB 3KUZA 5AEKB 2ASQA 3B1LX 1WX7A 4KV2A 2RSUA 3PV1A 2K1FA 2KLGA 2ZEQA 4IM2A 2A4ZA 2DYMA 3PHXB 1WGYA 4A20A 3PRZA 3H9DA 2M1MA 5EDSA 4MJSA 1UBIA 3PTFC 5IA7A 4JIOU 4EFOA 2KANA 1WXVA 4IG7B 1V86A 4EEWA 4BOSC 2Y5BB 3M95A 4G11A 2I1KA 4HK2A 3VTUA 4NAWB 2Z0EB 1C1YB 2D11A 1GNUA 1WXMA 2XBBC 3DBLI 4BBNC 4IC7B 1TBEA 1WR1A 1Y8RC 3R66C 5TR5A 2WDTB 2O6VD 3A1QA 3R3MA 4XZ4A 2GBNA 2R2QA 5AZGA 4F1SA 3U30A 1G6JA 4DHZE 3ZNGC 1ZKHA 2DZIA 3SU8X 3DPDA 2BYVE 2K6QA 3M62B 3AU5A 2KO3A 2JZ3B 4JL9A 2R2OA 1QZEA 4IM3A 1IYFA 2WX0A 3NZSA 3VFKA 2KK8A 2KVRA 3TCAA 1X1MA 3JSVB 4M8MA 1YX5B 4MJSB 3ALBA 4HLEA 1CMXB 4FJZA 1YJ1A 2NPTA 2KJ6A 4NJ7A 2LXAA 1YX6B 4KIKA 3V62A 4GGQA 2J7QB 3NOBA 3ZO5B 3UQAA 2FCNA 4W9LA 4WAAA 2LGXA 3ZNHB 3M63B 1A5RA 2LJ5A 3A33B 1WJNA 2B3AA 1LFDA 1K8RB 2NCNA 4JLCA 5JZEB 4GDKA 1WX8A 2MP2A 4IUMB 3QX1A 1WFYA 3HK0A 1AARA 3I3TB 4DHZB 3M3JA 2IZVB 5JHAA 4HDOA 3SHQA 5J17A 4ICUA 5C1ZA 3H6NA 2MBEA 3HHMA 2KXJA 3WANA 1L7YA 1PQSA 1JRUA 3TIXA 1EUVB 1I35A 4DBGA 2JF5A 4I6PA 1NI2A 4HCNB 4WWOA 2RPQA 1EF1A 3JYUA 3VTWA 3PSEB 3U8ZA 1Z2MA 3RULA 3VAWA 3MJWA 3ONSA 4K7WA 3UF8A 2IY0B 2CS4A 5G2NA 3DBRI 3DCGA 2LXCA 4W9CA 1SE9A 4IW0A 4DHJD 4KZ0A 2HTHA 3BY4B 1ZGUB 2C7NB 1WJ4A 5CX3A 3RYTA 3VHTC 4W9JA 3LJ3A 2M8SA 4HXDA 4GDKB 2FCMA 3A4SC 4GDLA 2KDIA 2KZRA 2FAZA 4ZDVA 1UH6A 2GOWA 3B08A 3OJ3A 2GBKA 2K8BA 2JPHA 1J8CA 4BBNF 1WXAA 3VDZA 4TQ0A 1GG3A 4ZYNA 4WJOA 2IY1B 4F7ZA 2KWUB 3KUCB 3DVGY 3AXCA 3VUYA 1V80A 1V9JA 3N3KB 3T8MA 2BYFA 4I6NB 4DK5A 2O2VB 3R7RA 4DDGD 4RM9A 1M94A 2KTRA 1UELA 3ZDMC 5E6NA 4G3XB 1OEYA 3CSFA 4NAWA 1BT0A 2GBJA 2IBIB 4HWIB 3TBLD 4KDIC 1U4AA 1XQQA 4GXBA 4MEMA 4DWFA 5G55A 3JVZX 4F8CB 2LVQA 1TTNA 3VH3B 2KJRA 4FHKA 4NQKE 4HJKA 2V4LA 1Q5WB 1WH3A 4W9KA 4BKSA 4PS3A 3V60A 1S3SG 2KDBA 1WR6E 2UYZB 1WZ0A 5FR6A 2KHWB 3QCAA 2L8JA 2FUHB 4WJPA 1WMHA 2ZCCA 4CO7A 2N9EB 3PLUA 3ZDTA 3ZNZB 3QARA 3JSVA 3ML9A 2KQ7A 4LDTB 4LCDE 1UZXB 3W1SC 4IM0A 2AL3A 1KM7A 2KTRB 4G50A 4IWPA 1TGZB 4KDLB 1XD3B 2MBBB 2KFKB 1T0YA 4K1RB 4EUTA 4E71A 3K9PB 2PE6B 3WIMA 1E8YA 2PE9A 1WGGA 3ZNID 5JHBA 4FBJB 4NY0A 3QIJA 4MH0E 4J6IA 2CHZA 5CTRC 3JW0X 2K39A 2KC1A 2LASA 4IWQA 3NHEB 3H1UA 2N9XA 3PGEA 3EFUA 1IPGA 2N7EA 2C7MB 1WIAA 2NS5A 4MDKE 1E8XA 5LXIB 1WMHB 3SD5A 3QAQA 5DPTA 2LI5A 1WM2A 1LM8B 5LLIA 2Z59B 2D10A 3BINA 3CSTA 3OJ4B 2A5UA 5E6PA 4URKA 1IP9A 3AI5A 1UGMA 5DPRA 1GJZA 4DXAB 3RUIB 4CHKA 1FXTB 1YQBA 3RD2A 2D3GA 2KJHB 3ZIMA 4KSLC 5DPSA 1YD8U 1P9DU 3QJZA 3QK0A 1GUAB 4K7SA 3H7PB 2J0KA 4EOYA 4PYZA 3KVFB 3V61A 2NVUI 3TL5A 3ZRCA 4WWPA 3RZWC 3W1YA 1WYWB 3KYDD 3DQVA 3V6CB 2GMIC 3WALA 4B9KA 3APFA 2EMTA 3A4RA 4KZCA 1P0RA 1TZ1A 4AJWA 4FJVB 1L2NA 1SIFA 3A9KB 2KNBA 3HIZA 2V3SA 1R4MI 1WY8A 3EECA 5L83A 3CF6E 4PYUA 2XEWA 4TQ1A 4X57B 2XK5A 1NDDA 2WWZA 1WI0A 2FCSA 4A3OA 2W9NA 2DZKA 2MRPA 3A9JB 5J2RA 5IAAC 2NBVB 3VUWA 2O2VA 2EKEC 2MX2A 3ML8A 4XX5A 1F9JA 4AOFA 5BO4B 4GB9A 4FN2A 2LD9A 3NY5A 4MSMB 3ZLZA 5L95C 3X23A 2KLCA 3PHWB 4AP4C 2O6VB 2ZVOA 4AUQC 2GBRA 2K8HA 3L08A 2AWTA 2N1WA 3UINB 3HM6X 5CHFA 3WAOA 3PRMB 5D94A 3WAPA 2LUEA 1WF9A 3Q3JA 2K25A 2ZPNA 4W9GA 2J0MA 3IG3A 2C9WB 3ENEA 4OVVA 2MSED 1KJTA 1V5TA 4W9IA 2Z0DB 3DOWA 2MCNB 3UIPB 2ZJDA 4MGIE 4WJNA 2KX3A 2JUOA 1UD7A 3APDA 3W1SA 1H8CA 4LDTD 4P7IA 2KFJA 4M0WB 2DZJA 3ZW3A 2OOBB 5D7GA 3ZKJC 4W9FA 2LZ6A 2XK5B 3KUDB 4MM3A 5JH5C 2L7RA 3QWZB 3O65B 3PLVA 2PPHA 2ZNVC 5CHWA 4YL8A 2G4DB 5C23A 2JWZA 3LDZE 1V6EA 2IO0B 3VVWB 2YLMA 2K8CA 4IWOA 1E8WA 2DAFA 2IO3B 2KC2A 2KFKA 3DVGX 4DDID 4GSWA 2D2QA 2MWSB 1WXSA 4JGHB 4WQOB 3VUXA 3HM3A 3EHVA 2LWPA 2C7HA 3RT3B 2NBUA 3TJPA 1KLVA 1J0GA 4GU2A 4TKNA 4TV3A 4NJ6A 4BKSD 4ICVA 2L76A 2WYQA 3WA0A 1RRBA 3DBHI 1V49A 3ZTCA 3QHTA 4MGYE 4E74A 2KD0A 3GZNI 2VRRB 3PZDA 3MTNB 1V2YA 5DCNA 2FCQA 4E3CA 2BGFA 2KTFA 2G3QB 4ANXA 4A3PA 3APCA 2KN5A 1P98A 1EF5A 2M17A 4EZJA 2ZZPB 4FADA 3N30A 3IFWB 4LJOB 2CHWA 1MG8A 4II2B 4DHJB 1UBQA 2QHOA 3UIOB 1OEYJ 2MBOA 2N9PC 4NQLB 1WE7A 3NS8A 4II3B 4GIVA 2IO2B 3QA8A 2DYBA 1XT9B 2DX5B 2L00B 3H7PA 4LJPB 4RM8A 2JVCA 4HPMB 4MELA 4MGZE 4WWNA 1RAXA 3AU4A 3P2BA 2FIFA 2LRWA 2HJ8A 2MA9B 2G4SA
chains in the Genus database with same CATH superfamily
1D5ZC 2NBWB 2BVCA 3H7SA 1D3ZA 1MJDA 3L54A 2IYDB 1FNWA 4YT0B 2ZPYA 2LVPA 1SGHA 4OVZA 1E7VA 2PJHA 5GMVA 2DZMA 2WXHA 1FRRA 3AMZA 2H89B 4ASWC 2KT7A 3WAMA 3GOEA 2E6XA 2BPSA 2INPE 1I42A 3R2IA 4HCPB 1Z5SB 2V0GA 2JRIB 4P1BC 2FBWB 4ANUA 2CHXA 2WNMA 4ZRKA 3VQIA 1FFUA 1EWYC 4AWJA 1J19A 2QMTA 3PO0A 2ZCBA 1HZ6A 2QCZA 2ZVNA 4N9F4 2Q5WD 4BZAA 3E56A 4W9EA 2AX5A 1HE8A 4AJYB 4DXGA 3A1QB 1V5OA 3TEZA 2CU1A 4XWWA 1TS2A 2WXJA 2N1VA 3PT2B 1TS5A 3EC8A 1GPXA 1TJEA 1VZ6A 1VCBA 2MLBA 1IUEA 4HPLB 2IPKD 3Q6BA 2OHFA 4JQWC 1XO3A 1ZE3D 1WGHA 3Q14C 3IBEA 2M19A 1KLUD 1TY2A 4JX1C 4A55A 4HKZE 1MVKA 1OQYA 1WJ6A 1E90A 4J3OD 4G0NB 4EKUA 1ZW7A 2OJRA 4GOCA 3PREA 4EZKA 4GLSC 4LNFA 2NR2A 2AL6A 2B76B 4C7ZA 3C0RB 2BWFA 2I1JA 5AZHA 4DQOC 2KMAA 5GXGB 2PMVA 1I4GA 4GDLB 3EUB2 4RGNA 1FRDA 2REXA 4PS8A 1VDVA 1HTOA 3B1LX 1WX7A 2CJOA 3PV1A 3SEBA 4LNNA 2ZEQA 1L0YB 5AUIA 4H2AA 2DYMA 1HZ5A 3PRZA 2M1MA 4MJSA 1UBIA 3GB1A 2KANA 4IG7B 1XLPA 4G11A 3KWVA 5FKAC 1KLGD 4NAWB 1C1YB 2XBBC 4IC7B 2N7JA 3B2GA 1DGJA 2KVZA 3A1QA 2GBNA 3Q3OC 3DPDA 3M62B 3URYA 1QZEA 2BW2A 1LO5D 1FM0D 1IYFA 1FCLA 2KK8A 3TCAA 1YQ4B 3JSVB 1KH0A 1I4PA 3P4SB 2MJEA 4FJZA 3Q8CA 2KJ6A 3I57A 2LXAA 4GGQA 1ZXHA 2LGXA 1A5RA 1WJNA 3DBRB 2WDRB 3QX1A 3NS1A 1FFVA 3I3TB 4DHZB 1KTKA 5JHAA 4OHJA 5J17A 5C1ZA 3H6NA 3NVVA 4TMAB 2HDEA 1EUVB 1NI2A 2RPQA 3PZ8A 3U8ZA 1I4QA 3RULA 4QAYA 3UF8A 5MPOA 2IY0B 3N1YC 3U52E 4RH6A 2ZW1A 3DCGA 4W9CA 3Q3NC 4KZ0A 2HTHA 3RYTA 4W9JA 4HXDA 4GDKB 3VR8B 4GDLA 2KDIA 3UI3A 2JPHA 4BBNF 3VDZA 1GG3A 2IY1B 1F2RC 1NEKB 2KWUB 5D3IB 3AXCA 4ZHPA 1V9JA 3N3KB 1FXAA 2O2VB 4JWSC 4L23A 1UELA 2WU2B 3CSFA 4NAWA 4HWIB 3TBLD 1M4VA 1U4AA 1XQQA 2QSDA 1XEEA 1GB4A 2V4LA 2JQRB 4W9KA 4OZBA 4BKSA 2WXLA 1P7EA 2FUG1 5FR6A 3PLUA 3ZNZB 3H8HA 3JSVA 3C19A 1KM7A 2KTRB 1SF0A 3GE8C 4KDLB 1XD3B 2MBBB 2KFKB 4K1RB 4A90A 1PYWD 4E71A 1RFKA 1FNVA 1WGGA 3ZNID 2WLBA 4RGMA 3QIJA 3JW0X 1YNTE 4A9AA 4AS1A 3H1UA 1YJJA 1F77A 2IGGA 2INNE 2H88B 4MH8A 1WM2A 3CSTA 5BYSA 4R3DA 1IP9A 3AI5A 1UGMA 5DPRA 1GJZA 1FXTB 4C56C 1F1HA 4KGTA 4CYEA 3J9CA 2I2YA 3A4RA 2E3TA 2OEDA 3A9KB 3U2SC 3HIZA 4X57B 1ET6A 2XK5A 1WI0A 1TKYA 2FCSA 1ZDXA 2MRPA 5J2RA 2NBVB 2O2VA 2EKEC 3W2DA 4FN2A 3AV8A 2LGIA 2O6VB 2GBRA 1KFYB 3WAPA 3Q3JA 4ARIA 2K25A 2ZPNA 1F0ZA 3UIPB 1ZUD2 2KFJA 5D7GA 4MM3A 2L7RA 2WXNA 3PLVA 2ZNVC 5CHWA 1J7CA 1K53A 4DDID 3NVYA 2KFKA 4GSWA 4RGTA 4D2KA 1WXSA 4XWTA 1TKGA 2NBUA 2WXQA 4GU2A 1B9RA 2KACA 4BKSD 1C77A 4MACA 3DBHI 1V49A 3ZTCA 3QHTA 3PZDA 4Q2JA 2FCQA 4C00A 2BGFA 2KN5A 1FNUA 2WS3B 4FADA 1QILA 2QHOA 1DYQA 2MBOA 2N9PC 1WE7A 2ICIA 3MHZA 2IO2B 2DYBA 1XT9B 4RM8A 1QF6A 2JVCA 1JWUD 1I4XA 3BY4B 2FIFA 2INDC 1T5XD 3W9CB 3L0WB 1P1AA 1NBFC 1OTRB 2V1YA 2WXKA 4UDUC 1V1PA 1T6BX 3A9KA 4NZLB 1F52A 3KW5B 3R8BA 2DAJA 1TT5B 1OGWA 3OAWA 4JPSA 5D6JB 3UQBA 1GC6A 2NTSA 3S2AA 2DENB 1JWMD 4HVBA 1R4NI 2QILA 5IO9A 4C80A 4LLGM 2O6VA 3L10B 4K81A 3AB5A 4S17A 4OVUA 1VZ8A 1JW9D 1N5WA 2MBHA 3PVLA 2HTME 4WJQA 2CKHB 2DWQA 4PT5A 3PZ7A 2Y5CA 5KHOA 1C76A 1RLFA 3TEYA 3GE3C 2CR5A 2PTLA 2BQQA 4M8NA 4BKTA 3U7DA 2X38A 3B9JA 2LVOA 4B95A 4BAXA 2PIAA 3TMPB 1YJIA 1UWXA 2BKRB 4EZLA 4AQ7A 5IP4D 2GLSA 4FHJA 4TUUA 3MFGA 2L05A 2UWQA 1GC7A 2ZNVB 4K7UA 3AEDB 1K52A 2RGFA 4ZRJA 1N61A 5CHVC 1L6UA 2CU3A 3UGBB 4OZCA 5E6OA 3OWEB 3RN9C 1JALA 3RI7C 3ZXRA 2BYEA 4KSKC 2MW5A 1N62A 3ETRA 1K50A 3VH4B 1ZDVA 3BVZA 4FULA 2HE7A 1IGCA 3AE6B 3RCZA 4MGKE 4ZYSA 3DBLB 1XCTL 1LGRA 1QOGA 3KUZA 5AEKB 1VR9A 3RNCC 3H9DA 5EDSA 3PTFC 3AEGB 1SE3A 4BOSC 3M95A 1KF6B 1EM7A 2I1KA 4HK2A 3DHHC 3VTUA 3HVDA 2Z0EB 3P63A 2V3NA 3T3OA 3RNAC 1TBEA 4ACFA 2O6VD 1JROA 2R2QA 4YXDB 3U30A 2DZIA 2K6QA 3AU5A 4JL9A 2BS3B 2K0PA 2V9HA 3P4PB 3NZSA 2RPVA 3VFKA 3N1XC 4MJSB 4HLEA 1R4MB 1CMXB 1YJ1A 4NJ7A 3TUOA 2GI9A 3UQAA 3BK2A 4W9LA 4WAAA 3M63B 2B3AA 2NCNA 5IN7A 4HRSA 1WX8A 2LEKA 1RM6C 1SB3C 1MI0A 1E9MA 2WXPA 3WANA 1PQSA 3TIXA 2KQ4X 4M00A 1ZPSA 2EELA 4I6PA 2M56B 3IXSA 2JZPA 1C4AA 3KWLA 3DBRI 1I4HA 1QQRA 3U7ZA 4IW0A 1FD6A 1ZGUB 2C7NB 4ZOHC 3VHTC 3NUHB 1AW7A 4RNAA 2FCMA 3A4SC 1FO4A 2KZRA 4RCOA 4LNIA 3OJ3A 2K8BA 1J8CA 4OZAA 3KUCB 2KAJA 2BS2B 1WGKA 4I6NB 4DK5A 1M94A 2AQ2B 4G3XB 1QLBB 4HJGE 1UGJA 4DWFA 2YEPB 5I4DA 3BWUD 4F8CB 1QOAA 1QOFA 1BUIC 3T3NA 4HJKA 2WXMA 1WH3A 2SEBD 4HEA1 3V60A 1S3SG 2KDBA 1E10A 2UYZB 3AE7B 2KHWB 4WJPA 2FUHB 3BZDB 1C4PA 3QARA 3CWIA 1UZXB 3AE8B 4IM0A 2AL3A 2JYTA 4G50A 1TGZB 4P1CC 4EUTA 3K9PB 2PE9A 3P4RB 3ZXVA 4MH0E 2N0SB 2CHZA 4J6IA 3Q8FA 2KC1A 3NHEB 2N9XA 2UU7A 3P4QB 3EFUA 1DOYA 4K3CA 3BVMA 5LXIB 3QAQA 5LLIA 3OJ4B 4URKA 4REZA 4DXAB 2K3UA 4CHKA 1YQBA 1TS3A 3ZIMA 1UNSA 5C3JB 4KSLC 5DPSA 5HFYA 2LGSA 3H7PB 4PYZA 3KVFB 3TL5A 3DHIC 3RZWC 1WYWB 3WALA 4B9KA 2AQ3B 2EMTA 2PVOD 1XXGA 1TZ1A 4L2YA 1L2NA 1SIFA 3R2TA 2XEWA 1ZOYB 1NDDA 2WWZA 4A3OA 5LNK1 1HXYD 1ZP0B 3AM9A 4GB9A 4A6QA 2QEJC 4MSMB 2IGHA 3X23A 3N1ZC 4WIPA 2ZVOA 3L08A 2AWTA 5CHFA 5D94A 3DHGC 1YN4A 2MEKA 4YTMB 3IG3A 3ENEA 1KJTA 1V5TA 4WJNA 2JUOA 3W1SA 1Q10A 1H8CA 5JXVA 2LFIA 2RDGA 2LZ6A 2XK5B 5JH5C 3QWZB 5T8IA 2PPHA 2G4DB 1MPEA 3LDZE 1V6EA 5HHDG 2IO0B 3VVWB 2K8CA 4IWOA 1E8WA 2IO3B 3DVGX 2AQ1B 4WH4A 4C7YA 3VUXA 3AH7A 2MH7A 2C7HA 3EHVA 3TJPA 1J0GA 4ICVA 2L76A 2WYQA 1RRBA 4XYCA 3GZNI 2I38A 4IKGA 1JWBD 2G3QB 1P98A 4MM3B 1SIJA 1MHXA 2QIEB 5G5GA 3CIRB 4DHJB 1UBQA 3UIOB 1FMAD 4NQLB 4II3B 2RDBC 3QA8A 3H7PA 2DX5B 2JX5A 4HPMB 1UUPA 3P2BA 5J18A 1JWSD 2J42A 2WGSA 3AULA 4W9HA 1I4RA 4W9DA 2L0TA 2KWVB 1N6ZA 2WXGA 2JZZA 2PVGC 1ET9A 2KDFB 2KDEB 2FE8A 3QQ8B 1XLNA 1V81A 2ACZB 5BYQA 1ENFA 2L83A 4KVGB 4ARCA 1SSNA 4EE2A 1N5XA 3BVGA 2N7DA 1JQ4A 3BK1A 1YN5A 2MJDA 5D2MB 2MJ3A 1KOTA 1WZ3A 4FJYA 1FPYA 3L16A 1EO6A 1YN3A 3OLMD 1KRHA 3PPAA 4ZRIA 1V1PB 3B0AA 2BF8B 3L17A 2WHIA 3SDLC 1WGRA 3MJ5A 4C4VA 4FLHA 1WJUA 3Q3MC 4N6EB 2M0AA 2DHZA 3N32A 1ACCA 4O1NA 3ZTDA 4YTNB 2LHDA 1T0RC 2KQSA 4XDDA 3K9OB 4ZRQA 1PGAA 1H4RA 3IVFA 2BKFA 5FK9C 2AEHA 1AN8A 3VXWA 4MSQB 2GRIA 4BFRA 2MBQA 3R7QA 3T9LA 2NPTB 1C3TA 2KYWA 3RZFA 1SEBD 2M4NA 4RMAA 1AWDA 2L3ZA 2M0XA 2LGDA 3HVZA 1PGBA 1WM3A 3N9YC 2RDHA 2RD0A 1NENB 5LXHA 3X0WA 1Q0WB 3AE4B 2IO1B 3ZJUA 3MC0B 1DOIA 1E7UA 2C5LC 4YSXB 2L0FA 2Z8LA 1YIWA 4BKGA 4US9A 1GB1A 3QC8B 3ZVVA 3ZJTA 2PEAA 3FILA 3NVZA 1DOXA 3RNEC 1Q1OA 3KH0A 3NZ3A 4GMVA 2LJIA 3AEBB 5EE3A 3V6EB 1WRDB 3NZUA 1VD2A 1STEA 2EMSA 3DDCB 2KMMA 4ANWA 1XCQL 4KV2A 2K1FA 2KLGA 4B0MA 1IBXB 3PHXB 4IOIE 3AE2B 3BYTB 1UF0A 1WXVA 1V86A 2WQYB 2BYTA 2N9LA 1T0QC 1WXMA 3DBLI 2L52A 3E9SA 3C8YA 1WXQA 2W3SA 2WDTB 1G6JA 4DHZE 2L1AA 3SU8X 1JRPA 3ZNGC 3VRAB 2PW9A 2BYVE 2KO3A 2R2OA 4IM3A 2WX0A 1WWTA 1X1MA 3ALBA 1ZXIA 4WURA 2NPTA 1TIFA 1L0XB 3ZO5B 5AUKA 3MP9A 3ZNHB 4RF1A 3A33B 4K3BA 5BMIA 4ZRPA 5JZEB 1LFDA 2IGDA 4JLCA 1E0ZA 1BXTA 1HA5A 1GAQB 2IZVB 4HDOA 1J7AA 2G1EA 4ICUA 3LB8C 2MBEA 3HHMA 2QC8A 1I35A 2JF5A 1MHHE 3RNBC 4HCNB 4WWOA 1EF1A 2XNAC 2JU6X 1RYJA 1FCCC 1XLOA 3JYUA 3PSEB 1D6EC 1Z2MA 3VTWA 3ZGZA 1TYGB 1SE9A 4DHJD 3AE1B 4NJCA 1NVID 3LJ3A 3FC4A 4ZDVA 1UH6A 2GBKA 4OW0A 1JWAD 1WXAA 5HG2A 4S0RA 4ZYNA 4M02A 4WJOA 4F7ZA 3DBHB 3DVGY 1IBXA 3LXFA 4P16A 3T8MA 4DDGD 3P42A 3FAHA 3VR9B 1BT0A 2GBJA 2W82A 2KDMA 5H8YE 4MEMA 3JVZX 5G5HA 4YSYB 1TTNA 3VH3B 2KJRA 4FHKA 4NQKE 3MC8A 3NJTA 5BYRA 3QCAA 2PLPA 1WMHA 2ZCCA 4KGRA 2J53A 1J7BA 3AE3B 4LCDE 4KGSA 3W1SC 3SFEB 4IWPA 2J52A 2IDYA 1T0YA 1TKEA 3WIMA 1C4CA 3HUIA 4NY0A 1CJEA 2WP9B 5CTRC 1A70A 1R4NB 3Q69A 3FKYA 1WYGA 4YSZB 4IWQA 1XF5L 3I5JC 3PGEA 2N9KA 2INCC 3AN1A 1IPGA 2KWDA 2N7EA 1VLBA 2NS5A 3OG5A 4HROA 1E8XA 2K22A 5DPTA 2LI5A 3TEXA 3AECB 2D10A 3RUIB 2BB5A 3RD2A 2D3GA 2KJHB 1SE2A 2WXIA 1NYQA 3QJZA 3QK0A 1GUAB 2JSVX 2J0KA 4EOYA 3ZRCA 2NVUI 4DXFA 3KYDD 3DQVA 3KLSX 3V6CB 4KZCA 1K51A 1P0RA 4AJWA 4FJVB 3DWGC 2KNBA 3U4EG 1WY8A 3EECA 3CF6E 4PYUA 2VZKB 1B1ZA 1CQVA 5BMHA 2W9NA 1VRAB 3A9JB 5IAAC 3VUWA 2MX2A 4XX5A 1RWSA 2LD9A 3ZLZA 5L95C 1JMLA 2KLCA 3PHWB 4XDCA 1YQ3B 5TSSA 2N1WA 3PRMB 2OJWA 2WXRA 1QKZA 2J0MA 4W9GA 2C9WB 2K5PA 4OVVA 2MSED 2MCNB 1OFFA 3DOWA 5E6JA 4MGIE 1UD7A 4RF0A 3GS2A 3NRZA 4LDTD 4P7IA 3LYYA 3BIID 4M0WB 2DZJA 2OOBB 1ESFA 2W55A 1D5MC 2Y3AA 3V3XA 3O13A 2MWSB 3AE5B 4WQOB 1L4DB 3HM3A 1CK1A 2LWPA 3EFCA 3RT3B 4TV3A 3WA0A 4MGYE 1WSPA 4NAMA 1V2YA 1JCKB 1NI3A 2KTFA 1EU3A 1V8CA 4ANXA 1EF5A 2ZZPB 3IFWB 4LJOB 1AYFA 2CHWA 4II2B 2VH1A 2W54A 3NS8A 2J4XA 4GIVA 2L00B 4MELA 4MGZE 3RNGC 1L0VB 3Q2AC 2LRWA 5EE0A 5HI1A 2G4SA 1TS4A 2LGYA 3NG0A 1V97A 4NPNA 1WE6A 3PRPB 4IDIA 4JWUC 2MHJA 1VJKA 1MFWA 1C78A 1LXDA 2NMQA 1YOVB 1LQBA 1WRIA 4XC2A 3A9JA 1ISNA 2J0JA 4ZHOA 2KKCA 1N60A 2KX0A 1P3QU 1FIQA 1SXTA 5DPWA 1I7HA 2GBMA 1ROEA 2WX1A 2G45B 2G9HD 3W5VB 4B0EA 1E8ZA 3ECIA 4JE3B 3EGRA 3VTVA 4TSSA 1CZPA 3DVNU 2KWCA 5EE1A 2WDVB 5AZFA 2YVCA 3RFZB 4HPPA 1E5WA 3Q8BA 1WX9A 3AEEB 4M0WA 2JY6A 1QT9A 4ITKA 2WXOA 2DYOA 2N4FA 2LRUA 1N63A 2BWES 3PS6A 1HEZE 2DNFA 2K6DB 3D32A 3IHPC 2JRHA 1L5PA 4B6WA 3GP7A 5H92C 4WAFA 2KN4A 4FA6A 2AYOB 2KOXA 1HTQA 2JT4B 2RMMA 3Q3FA 3L13A 4C4VB 3DBSA 4KIKB 1SBBB 1Y56A 2HD5B 3CMMB 1PDXA 4XE0A 3W5UB 3MHSD 1D4BA 3ZRFA 2RR9A 2MP2B 1IGDA 1FXIA 4KKJA 3EA6A 3IT4B 1F2RI 3ZUNA 3ZYYX 5KHQA 2Y5PA 4MT5A 2C60A 1WGDA 4BVUC 5IOIA 2FIDA 4FXCA 1L4ZB 4HDQA 4LNKA 4BOZB 3KYCD 5HKHA 2KMCA 4GN1A 4P6VF 1RFAA 2MQJA 2D07B 4NNJB 2JXXA 3DVNV 2JXTA 1S1QB 4ANVA 3P1MA 2BBCA 4RGOS 2QDFA 4PS7A 2FNJB 2VH2A 4I6LB 2ASQA 2RSUA 4IM2A 2A4ZA 1D5XC 2TSSA 1WGYA 4A20A 2JWUA 2BB6A 4WWMA 5IA7A 4JIOU 4EFOA 2PKOA 2VZKD 4EEWA 2Y5BB 1OQQA 3FILB 2D11A 1GNUA 1UWMA 1C9FA 4BBNC 1WR1A 1Y8RC 3HRDD 3R66C 5TR5A 4XZ4A 3R3MA 4F1SA 5AZGA 4WQMA 1ZKHA 1C79A 2JZ3B 4US8A 4KKIA 2KVRA 4M8MA 1YX5B 4HKQA 2X8XX 1E6EB 1YX6B 4KIKA 3V62A 2J7QB 3NOBA 2FCNA 4M01A 4PK1A 1E7PB 2LJ5A 3WCQA 1K8RB 4GDKA 3VRBB 3AEAB 3B2FA 4IUMB 2MP2A 1WFYA 4YTPB 3HK0A 1AARA 3V05A 1TZOA 3M3JA 1YMHE 2WDQB 3SHQA 3ZQ4A 4RFBA 5IKCM 2KXJA 2XN9C 1L7YA 1JRUA 1SE4A 4DBGA 1EWCA 3VAWA 1XLQA 3IAS1 3MJWA 3ONSA 4K7WA 2CS4A 5G2NA 2LXCA 4USAA 1PFDA 5CX3A 1WJ4A 4L1BA 1OQRA 1T0SC 2HJ1A 2M8SA 2FAZA 1HQRD 2GOWA 3B08A 4TQ0A 1GOZA 2ONQA 1SJED 2SAKA 3GZNB 3VUYA 3DWMA 1V80A 1EU4A 2BYFA 3R7RA 4RM9A 2KTRA 3ZDMC 2JYEA 5E6NA 1MG4A 1OEYA 2BTEA 2V3PA 2IBIB 4KDIC 3IAM1 2V4IB 4A8XC 4GXBA 5G55A 2LVQA 3SFDB 1Q5WB 2NTTA 4PS3A 3ABVB 1WR6E 4LNOA 3IT6B 3AEFB 1WZ0A 4CO7A 2L8JA 2N9EB 3ZDTA 4KX6B 3ML9A 4LDTB 2KQ7A 4YWGG 3RMKC 1VZ7A 2D5GA 1P7FA 3N20C 1TY0A 4LK0M 2W3RA 3NVWA 2PE6B 1E8YA 5JHBA 3SR6A 5C2TB 4FBJB 2K39A 2LASA 2QJLA 2C7MB 1WIAA 1PGXA 4MDKE 1L6VA 2DBYA 2CJNA 1WMHB 5D3DA 3SD5A 3I9V1 2LHEA 1LM8B 3MC9A 2Z59B 3BINA 3L4PA 4N58A 2A5UA 5E6PA 2K9XA 3Q8AA 1PUTA 1YD8U 1P9DU 4K7SA 2WXFA 3V61A 4WWPA 2EKIA 3W1YA 2D3AA 3RNFC 3BYYB 2GMIC 3TSSA 3APFA 4XGAB 5BMGA 2V3SA 1R4MI 5L83A 4TQ1A 2DZKA 2YEPF 2BS4B 3ML8A 4AOFA 1F9JA 5BO4B 3NY5A 4AP4C 2D3BA 4LTUA 4AUQC 3WAOA 2K8HA 3UINB 5EE9A 2R61A 3HM6X 1V1OA 2LUEA 1SJHD 1WF9A 4W9IA 3TEWA 2Z0DB 2ZJDA 1NYRA 2LUMA 2KX3A 3APDA 1QOBA 2GB1A 3ZW3A 3ZKJC 4W9FA 4CQNA 3KUDB 3ZJVA 3O65B 4YL8A 5C23A 2JWZA 2ZW0A 2YLMA 2WU5B 2DAFA 2KC2A 1BMLC 2ON8A 2D2QA 2BT6A 4JGHB 1KLVA 3RPFC 4TKNA 4NJ6A 4E74A 5FR3A 2KD0A 2VRRB 3I63C 3MTNB 5DCNA 2L32A 4E3CA 4A3PA 3APCA 1R7SA 2M17A 4EZJA 3N30A 3Q8EA 1MG8A 1T3QA 2D3CA 1OEYJ 3KQ4A 1FEHA 3AE9B 2DLBA 2LMCA 4LJPB 4WWNA 1RAXA 3AU4A 2IJ0A 2HJ8A 2MA9B 4N59A
chains in the Genus database with same CATH topology
2NBWB 3AULA 2LGYA 3L0WB 3H7SA 1D3ZA 4NPNA 1P1AA 1WE6A 3L54A 2IYDB 1NBFC 1OTRB 2V1YA 4W9HA 3PRPB 4W9DA 2L0TA 2KWVB 2JZZA 2ZPYA 3A9KA 2LVPA 1SGHA 2KDFB 1E7VA 2PJHA 5GMVA 2DZMA 3KW5B 1LXDA 2KDEB 2DAJA 3QQ8B 1OGWA 1V81A 1LQBA 3OAWA 4CYEA 4ASWC 4KVGB 4XC2A 5D6JB 5J18A 3A9JA 1ISNA 3WAMA 3GOEA 2J0JA 1GC6A 3UQBA 2N7DA 2KKCA 3S2AA 2DENB 2BPSA 5D2MB 4HVBA 1I42A 1R4NI 2KX0A 1P3QU 1KOTA 4HCPB 1WZ3A 1Z5SB 2O6VA 5DPWA 2GBMA 3L10B 2WX1A 4FJYA 4K81A 2G45B 3L16A 1E8ZA 2JRIB 3ECIA 4OVUA 1EO6A 3VTVA 2MBHA 3OLMD 3DVNU 3PVLA 2KWCA 3PPAA 4ANUA 4ZRIA 4WJQA 2CKHB 3B0AA 5AZFA 2CHXA 2BF8B 2YVCA 3L17A 3SDLC 1WGRA 5KHOA 4ZRKA 3VQIA 4AWJA 1E5WA 1J19A 1RLFA 1WX9A 2ZCBA 4FLHA 1WJUA 2DHZA 2ZVNA 4N9F4 2JY6A 2CR5A 3N32A 4M8NA 4BKTA 3U7DA 2DYOA 4W9EA 1HE8A 3ZTDA 4AJYB 2N4FA 1V5OA 3A1QB 2LVOA 4B95A 3TMPB 2CU1A 2LRUA 2BWES 3PS6A 2KQSA 3K9OB 2K6DB 3D32A 3IHPC 2JRHA 2BKRB 4B6WA 4EZLA 1H4RA 3IVFA 2BKFA 4FHJA 2AEHA 2N1VA 4TUUA 4FA6A 3PT2B 3EC8A 2L05A 3VXWA 2UWQA 4MSQB 1GC7A 2AYOB 2KOXA 4BFRA 2ZNVB 2MBQA 4K7UA 3R7QA 2NPTB 3T9LA 2JT4B 1C3TA 1VCBA 3Q3FA 3L13A 3RZFA 3DBSA 4KIKB 2MLBA 2M4NA 4RMAA 2HD5B 3CMMB 4HPLB 2RGFA 4ZRJA 2L3ZA 4JQWC 2M0XA 1WGHA 3MHSD 2LGDA 3ZRFA 3IBEA 2RR9A 2MP2B 5CHVC 1WM3A 3UGBB 5E6OA 3ZUNA 2RD0A 5KHQA 2C60A 1OQYA 5LXHA 1WGDA 4BVUC 2FIDA 1E90A 1WJ6A 3X0WA 1Q0WB 4G0NB 4EKUA 2BYEA 1ZW7A 2OJRA 4GOCA 2IO1B 4HDQA 4KSKC 3PREA 4BOZB 4EZKA 3KYCD 2C5LC 1E7UA 2MW5A 2NR2A 2AL6A 5HKHA 2L0FA 1YIWA 4BKGA 2KMCA 3C0RB 2BWFA 4GN1A 3QC8B 1RFAA 3ZVVA 2PEAA 3VH4B 2I1JA 4FULA 2MQJA 2D07B 4NNJB 5AZHA 1Q1OA 2HE7A 2JXXA 2KMAA 1S1QB 3DVNV 3KH0A 4GMVA 4ANVA 4GDLB 3RCZA 3V6EB 1WRDB 3NZUA 1VD2A 4MGKE 2EMSA 2REXA 3DDCB 4PS8A 4ANWA 4PS7A 2FNJB 4I6LB 3KUZA 5AEKB 2ASQA 3B1LX 1WX7A 4KV2A 2RSUA 3PV1A 2K1FA 2KLGA 2ZEQA 4IM2A 2A4ZA 2DYMA 3PHXB 1WGYA 4A20A 3PRZA 3H9DA 2M1MA 5EDSA 4MJSA 1UBIA 3PTFC 5IA7A 4JIOU 4EFOA 2KANA 1WXVA 4IG7B 1V86A 4EEWA 4BOSC 2Y5BB 3M95A 4G11A 2I1KA 4HK2A 3VTUA 4NAWB 2Z0EB 1C1YB 2D11A 1GNUA 1WXMA 2XBBC 3DBLI 4BBNC 4IC7B 1TBEA 1WR1A 1Y8RC 3R66C 5TR5A 2WDTB 2O6VD 3A1QA 3R3MA 4XZ4A 2GBNA 2R2QA 5AZGA 4F1SA 3U30A 1G6JA 4DHZE 3ZNGC 1ZKHA 2DZIA 3SU8X 3DPDA 2BYVE 2K6QA 3M62B 3AU5A 2KO3A 2JZ3B 4JL9A 2R2OA 1QZEA 4IM3A 1IYFA 2WX0A 3NZSA 3VFKA 2KK8A 2KVRA 3TCAA 1X1MA 3JSVB 4M8MA 1YX5B 4MJSB 3ALBA 4HLEA 1CMXB 4FJZA 1YJ1A 2NPTA 2KJ6A 4NJ7A 2LXAA 1YX6B 4KIKA 3V62A 4GGQA 2J7QB 3NOBA 3ZO5B 3UQAA 2FCNA 4W9LA 4WAAA 2LGXA 3ZNHB 3M63B 1A5RA 2LJ5A 3A33B 1WJNA 2B3AA 1LFDA 1K8RB 2NCNA 4JLCA 5JZEB 4GDKA 1WX8A 2MP2A 4IUMB 3QX1A 1WFYA 3HK0A 1AARA 3I3TB 4DHZB 3M3JA 2IZVB 5JHAA 4HDOA 3SHQA 5J17A 4ICUA 5C1ZA 3H6NA 2MBEA 3HHMA 2KXJA 3WANA 1L7YA 1PQSA 1JRUA 3TIXA 1EUVB 1I35A 4DBGA 2JF5A 4I6PA 1NI2A 4HCNB 4WWOA 2RPQA 1EF1A 3JYUA 3VTWA 3PSEB 3U8ZA 1Z2MA 3RULA 3VAWA 3MJWA 3ONSA 4K7WA 3UF8A 2IY0B 2CS4A 5G2NA 3DBRI 3DCGA 2LXCA 4W9CA 1SE9A 4IW0A 4DHJD 4KZ0A 2HTHA 3BY4B 1ZGUB 2C7NB 1WJ4A 5CX3A 3RYTA 3VHTC 4W9JA 3LJ3A 2M8SA 4HXDA 4GDKB 2FCMA 3A4SC 4GDLA 2KDIA 2KZRA 2FAZA 4ZDVA 1UH6A 2GOWA 3B08A 3OJ3A 2GBKA 2K8BA 2JPHA 1J8CA 4BBNF 1WXAA 3VDZA 4TQ0A 1GG3A 4ZYNA 4WJOA 2IY1B 4F7ZA 2KWUB 3KUCB 3DVGY 3AXCA 3VUYA 1V80A 1V9JA 3N3KB 3T8MA 2BYFA 4I6NB 4DK5A 2O2VB 3R7RA 4DDGD 4RM9A 1M94A 2KTRA 1UELA 3ZDMC 5E6NA 4G3XB 1OEYA 3CSFA 4NAWA 1BT0A 2GBJA 2IBIB 4HWIB 3TBLD 4KDIC 1U4AA 1XQQA 4GXBA 4MEMA 4DWFA 5G55A 3JVZX 4F8CB 2LVQA 1TTNA 3VH3B 2KJRA 4FHKA 4NQKE 4HJKA 2V4LA 1Q5WB 1WH3A 4W9KA 4BKSA 4PS3A 3V60A 1S3SG 2KDBA 1WR6E 2UYZB 1WZ0A 5FR6A 2KHWB 3QCAA 2L8JA 2FUHB 4WJPA 1WMHA 2ZCCA 4CO7A 2N9EB 3PLUA 3ZDTA 3ZNZB 3QARA 3JSVA 3ML9A 2KQ7A 4LDTB 4LCDE 1UZXB 3W1SC 4IM0A 2AL3A 1KM7A 2KTRB 4G50A 4IWPA 1TGZB 4KDLB 1XD3B 2MBBB 2KFKB 1T0YA 4K1RB 4EUTA 4E71A 3K9PB 2PE6B 3WIMA 1E8YA 2PE9A 1WGGA 3ZNID 5JHBA 4FBJB 4NY0A 3QIJA 4MH0E 4J6IA 2CHZA 5CTRC 3JW0X 2K39A 2KC1A 2LASA 4IWQA 3NHEB 3H1UA 2N9XA 3PGEA 3EFUA 1IPGA 2N7EA 2C7MB 1WIAA 2NS5A 4MDKE 1E8XA 5LXIB 1WMHB 3SD5A 3QAQA 5DPTA 2LI5A 1WM2A 1LM8B 5LLIA 2Z59B 2D10A 3BINA 3CSTA 3OJ4B 2A5UA 5E6PA 4URKA 1IP9A 3AI5A 1UGMA 5DPRA 1GJZA 4DXAB 3RUIB 4CHKA 1FXTB 1YQBA 3RD2A 2D3GA 2KJHB 3ZIMA 4KSLC 5DPSA 1YD8U 1P9DU 3QJZA 3QK0A 1GUAB 4K7SA 3H7PB 2J0KA 4EOYA 4PYZA 3KVFB 3V61A 2NVUI 3TL5A 3ZRCA 4WWPA 3RZWC 3W1YA 1WYWB 3KYDD 3DQVA 3V6CB 2GMIC 3WALA 4B9KA 3APFA 2EMTA 3A4RA 4KZCA 1P0RA 1TZ1A 4AJWA 4FJVB 1L2NA 1SIFA 3A9KB 2KNBA 3HIZA 2V3SA 1R4MI 1WY8A 3EECA 5L83A 3CF6E 4PYUA 2XEWA 4TQ1A 4X57B 2XK5A 1NDDA 2WWZA 1WI0A 2FCSA 4A3OA 2W9NA 2DZKA 2MRPA 3A9JB 5J2RA 5IAAC 2NBVB 3VUWA 2O2VA 2EKEC 2MX2A 3ML8A 4XX5A 1F9JA 4AOFA 5BO4B 4GB9A 4FN2A 2LD9A 3NY5A 4MSMB 3ZLZA 5L95C 3X23A 2KLCA 3PHWB 4AP4C 2O6VB 2ZVOA 4AUQC 2GBRA 2K8HA 3L08A 2AWTA 2N1WA 3UINB 3HM6X 5CHFA 3WAOA 3PRMB 5D94A 3WAPA 2LUEA 1WF9A 3Q3JA 2K25A 2ZPNA 4W9GA 2J0MA 3IG3A 2C9WB 3ENEA 4OVVA 2MSED 1KJTA 1V5TA 4W9IA 2Z0DB 3DOWA 2MCNB 3UIPB 2ZJDA 4MGIE 4WJNA 2KX3A 2JUOA 1UD7A 3APDA 3W1SA 1H8CA 4LDTD 4P7IA 2KFJA 4M0WB 2DZJA 3ZW3A 2OOBB 5D7GA 3ZKJC 4W9FA 2LZ6A 2XK5B 3KUDB 4MM3A 5JH5C 2L7RA 3QWZB 3O65B 3PLVA 2PPHA 2ZNVC 5CHWA 4YL8A 2G4DB 5C23A 2JWZA 3LDZE 1V6EA 2IO0B 3VVWB 2YLMA 2K8CA 4IWOA 1E8WA 2DAFA 2IO3B 2KC2A 2KFKA 3DVGX 4DDID 4GSWA 2D2QA 2MWSB 1WXSA 4JGHB 4WQOB 3VUXA 3HM3A 3EHVA 2LWPA 2C7HA 3RT3B 2NBUA 3TJPA 1KLVA 1J0GA 4GU2A 4TKNA 4TV3A 4NJ6A 4BKSD 4ICVA 2L76A 2WYQA 3WA0A 1RRBA 3DBHI 1V49A 3ZTCA 3QHTA 4MGYE 4E74A 2KD0A 3GZNI 2VRRB 3PZDA 3MTNB 1V2YA 5DCNA 2FCQA 4E3CA 2BGFA 2KTFA 2G3QB 4ANXA 4A3PA 3APCA 2KN5A 1P98A 1EF5A 2M17A 4EZJA 2ZZPB 4FADA 3N30A 3IFWB 4LJOB 2CHWA 1MG8A 4II2B 4DHJB 1UBQA 2QHOA 3UIOB 1OEYJ 2MBOA 2N9PC 4NQLB 1WE7A 3NS8A 4II3B 4GIVA 2IO2B 3QA8A 2DYBA 1XT9B 2DX5B 2L00B 3H7PA 4LJPB 4RM8A 2JVCA 4HPMB 4MELA 4MGZE 4WWNA 1RAXA 3AU4A 3P2BA 2FIFA 2LRWA 2HJ8A 2MA9B 2G4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NBW B;  3AUL A;  2LGY A;  3L0W B;  3H7S A;  1D3Z A;  4NPN A;  1P1A A;  1WE6 A;  3L54 A;  2IYD B;  1NBF C;  1OTR B;  2V1Y A;  4W9H A;  3PRP B;  4W9D A;  2L0T A;  2KWV B;  2JZZ A;  2ZPY A;  3A9K A;  2LVP A;  1SGH A;  2KDF B;  1E7V A;  2PJH A;  5GMV A;  2DZM A;  3KW5 B;  1LXD A;  2KDE B;  2DAJ A;  3QQ8 B;  1OGW A;  1V81 A;  1LQB A;  3OAW A;  4CYE A;  4ASW C;  4KVG B;  4XC2 A;  5D6J B;  5J18 A;  3A9J A;  1ISN A;  3WAM A;  3GOE A;  2J0J A;  1GC6 A;  3UQB A;  2N7D A;  2KKC A;  3S2A A;  2DEN B;  2BPS A;  5D2M B;  4HVB A;  1I42 A;  1R4N I;  2KX0 A;  1P3Q U;  1KOT A;  4HCP B;  1WZ3 A;  1Z5S B;  2O6V A;  5DPW A;  2GBM A;  3L10 B;  2WX1 A;  4FJY A;  4K81 A;  2G45 B;  3L16 A;  1E8Z A;  2JRI B;  3ECI A;  4OVU A;  1EO6 A;  3VTV A;  2MBH A;  3OLM D;  3DVN U;  3PVL A;  2KWC A;  3PPA A;  4ANU A;  4ZRI A;  4WJQ A;  2CKH B;  3B0A A;  5AZF A;  2CHX A;  2BF8 B;  2YVC A;  3L17 A;  3SDL C;  1WGR A;  5KHO A;  4ZRK A;  3VQI A;  4AWJ A;  1E5W A;  1J19 A;  1RLF A;  1WX9 A;  2ZCB A;  4FLH A;  1WJU A;  2DHZ A;  2ZVN A;  4N9F 4;  2JY6 A;  2CR5 A;  3N32 A;  4M8N A;  4BKT A;  3U7D A;  2DYO A;  4W9E A;  1HE8 A;  3ZTD A;  4AJY B;  2N4F A;  1V5O A;  3A1Q B;  2LVO A;  4B95 A;  3TMP B;  2CU1 A;  2LRU A;  2BWE S;  3PS6 A;  2KQS A;  3K9O B;  2K6D B;  3D32 A;  3IHP C;  2JRH A;  2BKR B;  4B6W A;  4EZL A;  1H4R A;  3IVF A;  2BKF A;  4FHJ A;  2AEH A;  2N1V A;  4TUU A;  4FA6 A;  3PT2 B;  3EC8 A;  2L05 A;  3VXW A;  2UWQ A;  4MSQ B;  1GC7 A;  2AYO B;  2KOX A;  4BFR A;  2ZNV B;  2MBQ A;  4K7U A;  3R7Q A;  2NPT B;  3T9L A;  2JT4 B;  1C3T A;  1VCB A;  3Q3F A;  3L13 A;  3RZF A;  3DBS A;  4KIK B;  2MLB A;  2M4N A;  4RMA A;  2HD5 B;  3CMM B;  4HPL B;  2RGF A;  4ZRJ A;  2L3Z A;  4JQW C;  2M0X A;  1WGH A;  3MHS D;  2LGD A;  3ZRF A;  3IBE A;  2RR9 A;  2MP2 B;  5CHV C;  1WM3 A;  3UGB B;  5E6O A;  3ZUN A;  2RD0 A;  5KHQ A;  2C60 A;  1OQY A;  5LXH A;  1WGD A;  4BVU C;  2FID A;  1E90 A;  1WJ6 A;  3X0W A;  1Q0W B;  4G0N B;  4EKU A;  2BYE A;  1ZW7 A;  2OJR A;  4GOC A;  2IO1 B;  4HDQ A;  4KSK C;  3PRE A;  4BOZ B;  4EZK A;  3KYC D;  2C5L C;  1E7U A;  2MW5 A;  2NR2 A;  2AL6 A;  5HKH A;  2L0F A;  1YIW A;  4BKG A;  2KMC A;  3C0R B;  2BWF A;  4GN1 A;  3QC8 B;  1RFA A;  3ZVV A;  2PEA A;  3VH4 B;  2I1J A;  4FUL A;  2MQJ A;  2D07 B;  4NNJ B;  5AZH A;  1Q1O A;  2HE7 A;  2JXX A;  2KMA A;  1S1Q B;  3DVN V;  3KH0 A;  4GMV A;  4ANV A;  4GDL B;  3RCZ A;  3V6E B;  1WRD B;  3NZU A;  1VD2 A;  4MGK E;  2EMS A;  2REX A;  3DDC B;  4PS8 A;  4ANW A;  4PS7 A;  2FNJ B;  4I6L B;  3KUZ A;  5AEK B;  2ASQ A;  3B1L X;  1WX7 A;  4KV2 A;  2RSU A;  3PV1 A;  2K1F A;  2KLG A;  2ZEQ A;  4IM2 A;  2A4Z A;  2DYM A;  3PHX B;  1WGY A;  4A20 A;  3PRZ A;  3H9D A;  2M1M A;  5EDS A;  4MJS A;  1UBI A;  3PTF C;  5IA7 A;  4JIO U;  4EFO A;  2KAN A;  1WXV A;  4IG7 B;  1V86 A;  4EEW A;  4BOS C;  2Y5B B;  3M95 A;  4G11 A;  2I1K A;  4HK2 A;  3VTU A;  4NAW B;  2Z0E B;  1C1Y B;  2D11 A;  1GNU A;  1WXM A;  2XBB C;  3DBL I;  4BBN C;  4IC7 B;  1TBE A;  1WR1 A;  1Y8R C;  3R66 C;  5TR5 A;  2WDT B;  2O6V D;  3A1Q A;  3R3M A;  4XZ4 A;  2GBN A;  2R2Q A;  5AZG A;  4F1S A;  3U30 A;  1G6J A;  4DHZ E;  3ZNG C;  1ZKH A;  2DZI A;  3SU8 X;  3DPD A;  2BYV E;  2K6Q A;  3M62 B;  3AU5 A;  2KO3 A;  2JZ3 B;  4JL9 A;  2R2O A;  1QZE A;  4IM3 A;  1IYF A;  2WX0 A;  3NZS A;  3VFK A;  2KK8 A;  2KVR A;  3TCA A;  1X1M A;  3JSV B;  4M8M A;  1YX5 B;  4MJS B;  3ALB A;  4HLE A;  1CMX B;  4FJZ A;  1YJ1 A;  2NPT A;  2KJ6 A;  4NJ7 A;  2LXA A;  1YX6 B;  4KIK A;  3V62 A;  4GGQ A;  2J7Q B;  3NOB A;  3ZO5 B;  3UQA A;  2FCN A;  4W9L A;  4WAA A;  2LGX A;  3ZNH B;  3M63 B;  1A5R A;  2LJ5 A;  3A33 B;  1WJN A;  2B3A A;  1LFD A;  1K8R B;  2NCN A;  4JLC A;  5JZE B;  4GDK A;  1WX8 A;  2MP2 A;  4IUM B;  3QX1 A;  1WFY A;  3HK0 A;  1AAR A;  3I3T B;  4DHZ B;  3M3J A;  2IZV B;  5JHA A;  4HDO A;  3SHQ A;  5J17 A;  4ICU A;  5C1Z A;  3H6N A;  2MBE A;  3HHM A;  2KXJ A;  3WAN A;  1L7Y A;  1PQS A;  1JRU A;  3TIX A;  1EUV B;  1I35 A;  4DBG A;  2JF5 A;  4I6P A;  1NI2 A;  4HCN B;  4WWO A;  2RPQ A;  1EF1 A;  3JYU A;  3VTW A;  3PSE B;  3U8Z A;  1Z2M A;  3RUL A;  3VAW A;  3MJW A;  3ONS A;  4K7W A;  3UF8 A;  2IY0 B;  2CS4 A;  5G2N A;  3DBR I;  3DCG A;  2LXC A;  4W9C A;  1SE9 A;  4IW0 A;  4DHJ D;  4KZ0 A;  2HTH A;  3BY4 B;  1ZGU B;  2C7N B;  1WJ4 A;  5CX3 A;  3RYT A;  3VHT C;  4W9J A;  3LJ3 A;  2M8S A;  4HXD A;  4GDK B;  2FCM A;  3A4S C;  4GDL A;  2KDI A;  2KZR A;  2FAZ A;  4ZDV A;  1UH6 A;  2GOW A;  3B08 A;  3OJ3 A;  2GBK A;  2K8B A;  2JPH A;  1J8C A;  4BBN F;  1WXA A;  3VDZ A;  4TQ0 A;  1GG3 A;  4ZYN A;  4WJO A;  2IY1 B;  4F7Z A;  2KWU B;  3KUC B;  3DVG Y;  3AXC A;  3VUY A;  1V80 A;  1V9J A;  3N3K B;  3T8M A;  2BYF A;  4I6N B;  4DK5 A;  2O2V B;  3R7R A;  4DDG D;  4RM9 A;  1M94 A;  2KTR A;  1UEL A;  3ZDM C;  5E6N A;  4G3X B;  1OEY A;  3CSF A;  4NAW A;  1BT0 A;  2GBJ A;  2IBI B;  4HWI B;  3TBL D;  4KDI C;  1U4A A;  1XQQ A;  4GXB A;  4MEM A;  4DWF A;  5G55 A;  3JVZ X;  4F8C B;  2LVQ A;  1TTN A;  3VH3 B;  2KJR A;  4FHK A;  4NQK E;  4HJK A;  2V4L A;  1Q5W B;  1WH3 A;  4W9K A;  4BKS A;  4PS3 A;  3V60 A;  1S3S G;  2KDB A;  1WR6 E;  2UYZ B;  1WZ0 A;  5FR6 A;  2KHW B;  3QCA A;  2L8J A;  2FUH B;  4WJP A;  1WMH A;  2ZCC A;  4CO7 A;  2N9E B;  3PLU A;  3ZDT A;  3ZNZ B;  3QAR A;  3JSV A;  3ML9 A;  2KQ7 A;  4LDT B;  4LCD E;  1UZX B;  3W1S C;  4IM0 A;  2AL3 A;  1KM7 A;  2KTR B;  4G50 A;  4IWP A;  1TGZ B;  4KDL B;  1XD3 B;  2MBB B;  2KFK B;  1T0Y A;  4K1R B;  4EUT A;  4E71 A;  3K9P B;  2PE6 B;  3WIM A;  1E8Y A;  2PE9 A;  1WGG A;  3ZNI D;  5JHB A;  4FBJ B;  4NY0 A;  3QIJ A;  4MH0 E;  4J6I A;  2CHZ A;  5CTR C;  3JW0 X;  2K39 A;  2KC1 A;  2LAS A;  4IWQ A;  3NHE B;  3H1U A;  2N9X A;  3PGE A;  3EFU A;  1IPG A;  2N7E A;  2C7M B;  1WIA A;  2NS5 A;  4MDK E;  1E8X A;  5LXI B;  1WMH B;  3SD5 A;  3QAQ A;  5DPT A;  2LI5 A;  1WM2 A;  1LM8 B;  5LLI A;  2Z59 B;  2D10 A;  3BIN A;  3CST A;  3OJ4 B;  2A5U A;  5E6P A;  4URK A;  1IP9 A;  3AI5 A;  1UGM A;  5DPR A;  1GJZ A;  4DXA B;  3RUI B;  4CHK A;  1FXT B;  1YQB A;  3RD2 A;  2D3G A;  2KJH B;  3ZIM A;  4KSL C;  5DPS A;  1YD8 U;  1P9D U;  3QJZ A;  3QK0 A;  1GUA B;  4K7S A;  3H7P B;  2J0K A;  4EOY A;  4PYZ A;  3KVF B;  3V61 A;  2NVU I;  3TL5 A;  3ZRC A;  4WWP A;  3RZW C;  3W1Y A;  1WYW B;  3KYD D;  3DQV A;  3V6C B;  2GMI C;  3WAL A;  4B9K A;  3APF A;  2EMT A;  3A4R A;  4KZC A;  1P0R A;  1TZ1 A;  4AJW A;  4FJV B;  1L2N A;  1SIF A;  3A9K B;  2KNB A;  3HIZ A;  2V3S A;  1R4M I;  1WY8 A;  3EEC A;  5L83 A;  3CF6 E;  4PYU A;  2XEW A;  4TQ1 A;  4X57 B;  2XK5 A;  1NDD A;  2WWZ A;  1WI0 A;  2FCS A;  4A3O A;  2W9N A;  2DZK A;  2MRP A;  3A9J B;  5J2R A;  5IAA C;  2NBV B;  3VUW A;  2O2V A;  2EKE C;  2MX2 A;  3ML8 A;  4XX5 A;  1F9J A;  4AOF A;  5BO4 B;  4GB9 A;  4FN2 A;  2LD9 A;  3NY5 A;  4MSM B;  3ZLZ A;  5L95 C;  3X23 A;  2KLC A;  3PHW B;  4AP4 C;  2O6V B;  2ZVO A;  4AUQ C;  2GBR A;  2K8H A;  3L08 A;  2AWT A;  2N1W A;  3UIN B;  3HM6 X;  5CHF A;  3WAO A;  3PRM B;  5D94 A;  3WAP A;  2LUE A;  1WF9 A;  3Q3J A;  2K25 A;  2ZPN A;  4W9G A;  2J0M A;  3IG3 A;  2C9W B;  3ENE A;  4OVV A;  2MSE D;  1KJT A;  1V5T A;  4W9I A;  2Z0D B;  3DOW A;  2MCN B;  3UIP B;  2ZJD A;  4MGI E;  4WJN A;  2KX3 A;  2JUO A;  1UD7 A;  3APD A;  3W1S A;  1H8C A;  4LDT D;  4P7I A;  2KFJ A;  4M0W B;  2DZJ A;  3ZW3 A;  2OOB B;  5D7G A;  3ZKJ C;  4W9F A;  2LZ6 A;  2XK5 B;  3KUD B;  4MM3 A;  5JH5 C;  2L7R A;  3QWZ B;  3O65 B;  3PLV A;  2PPH A;  2ZNV C;  5CHW A;  4YL8 A;  2G4D B;  5C23 A;  2JWZ A;  3LDZ E;  1V6E A;  2IO0 B;  3VVW B;  2YLM A;  2K8C A;  4IWO A;  1E8W A;  2DAF A;  2IO3 B;  2KC2 A;  2KFK A;  3DVG X;  4DDI D;  4GSW A;  2D2Q A;  2MWS B;  1WXS A;  4JGH B;  4WQO B;  3VUX A;  3HM3 A;  3EHV A;  2LWP A;  2C7H A;  3RT3 B;  2NBU A;  3TJP A;  1KLV A;  1J0G A;  4GU2 A;  4TKN A;  4TV3 A;  4NJ6 A;  4BKS D;  4ICV A;  2L76 A;  2WYQ A;  3WA0 A;  1RRB A;  3DBH I;  1V49 A;  3ZTC A;  3QHT A;  4MGY E;  4E74 A;  2KD0 A;  3GZN I;  2VRR B;  3PZD A;  3MTN B;  1V2Y A;  5DCN A;  2FCQ A;  4E3C A;  2BGF A;  2KTF A;  2G3Q B;  4ANX A;  4A3P A;  3APC A;  2KN5 A;  1P98 A;  1EF5 A;  2M17 A;  4EZJ A;  2ZZP B;  4FAD A;  3N30 A;  3IFW B;  4LJO B;  2CHW A;  1MG8 A;  4II2 B;  4DHJ B;  1UBQ A;  2QHO A;  3UIO B;  1OEY J;  2MBO A;  2N9P C;  4NQL B;  1WE7 A;  3NS8 A;  4II3 B;  4GIV A;  2IO2 B;  3QA8 A;  2DYB A;  1XT9 B;  2DX5 B;  2L00 B;  3H7P A;  4LJP B;  4RM8 A;  2JVC A;  4HPM B;  4MEL A;  4MGZ E;  4WWN A;  1RAX A;  3AU4 A;  3P2B A;  2FIF A;  2LRW A;  2HJ8 A;  2MA9 B;  2G4S A; 
#chains in the Genus database with same CATH topology
 1D5Z C;  2NBW B;  2BVC A;  3H7S A;  1D3Z A;  1MJD A;  3L54 A;  2IYD B;  1FNW A;  4YT0 B;  2ZPY A;  2LVP A;  1SGH A;  4OVZ A;  1E7V A;  2PJH A;  5GMV A;  2DZM A;  2WXH A;  1FRR A;  3AMZ A;  2H89 B;  4ASW C;  2KT7 A;  3WAM A;  3GOE A;  2E6X A;  2BPS A;  2INP E;  1I42 A;  3R2I A;  4HCP B;  1Z5S B;  2V0G A;  2JRI B;  4P1B C;  2FBW B;  4ANU A;  2CHX A;  2WNM A;  4ZRK A;  3VQI A;  1FFU A;  1EWY C;  4AWJ A;  1J19 A;  2QMT A;  3PO0 A;  2ZCB A;  1HZ6 A;  2QCZ A;  2ZVN A;  4N9F 4;  2Q5W D;  4BZA A;  3E56 A;  4W9E A;  2AX5 A;  1HE8 A;  4AJY B;  4DXG A;  3A1Q B;  1V5O A;  3TEZ A;  2CU1 A;  4XWW A;  1TS2 A;  2WXJ A;  2N1V A;  3PT2 B;  1TS5 A;  3EC8 A;  1GPX A;  1TJE A;  1VZ6 A;  1VCB A;  2MLB A;  1IUE A;  4HPL B;  2IPK D;  3Q6B A;  2OHF A;  4JQW C;  1XO3 A;  1ZE3 D;  1WGH A;  3Q14 C;  3IBE A;  2M19 A;  1KLU D;  1TY2 A;  4JX1 C;  4A55 A;  4HKZ E;  1MVK A;  1OQY A;  1WJ6 A;  1E90 A;  4J3O D;  4G0N B;  4EKU A;  1ZW7 A;  2OJR A;  4GOC A;  3PRE A;  4EZK A;  4GLS C;  4LNF A;  2NR2 A;  2AL6 A;  2B76 B;  4C7Z A;  3C0R B;  2BWF A;  2I1J A;  5AZH A;  4DQO C;  2KMA A;  5GXG B;  2PMV A;  1I4G A;  4GDL B;  3EUB 2;  4RGN A;  1FRD A;  2REX A;  4PS8 A;  1VDV A;  1HTO A;  3B1L X;  1WX7 A;  2CJO A;  3PV1 A;  3SEB A;  4LNN A;  2ZEQ A;  1L0Y B;  5AUI A;  4H2A A;  2DYM A;  1HZ5 A;  3PRZ A;  2M1M A;  4MJS A;  1UBI A;  3GB1 A;  2KAN A;  4IG7 B;  1XLP A;  4G11 A;  3KWV A;  5FKA C;  1KLG D;  4NAW B;  1C1Y B;  2XBB C;  4IC7 B;  2N7J A;  3B2G A;  1DGJ A;  2KVZ A;  3A1Q A;  2GBN A;  3Q3O C;  3DPD A;  3M62 B;  3URY A;  1QZE A;  2BW2 A;  1LO5 D;  1FM0 D;  1IYF A;  1FCL A;  2KK8 A;  3TCA A;  1YQ4 B;  3JSV B;  1KH0 A;  1I4P A;  3P4S B;  2MJE A;  4FJZ A;  3Q8C A;  2KJ6 A;  3I57 A;  2LXA A;  4GGQ A;  1ZXH A;  2LGX A;  1A5R A;  1WJN A;  3DBR B;  2WDR B;  3QX1 A;  3NS1 A;  1FFV A;  3I3T B;  4DHZ B;  1KTK A;  5JHA A;  4OHJ A;  5J17 A;  5C1Z A;  3H6N A;  3NVV A;  4TMA B;  2HDE A;  1EUV B;  1NI2 A;  2RPQ A;  3PZ8 A;  3U8Z A;  1I4Q A;  3RUL A;  4QAY A;  3UF8 A;  5MPO A;  2IY0 B;  3N1Y C;  3U52 E;  4RH6 A;  2ZW1 A;  3DCG A;  4W9C A;  3Q3N C;  4KZ0 A;  2HTH A;  3RYT A;  4W9J A;  4HXD A;  4GDK B;  3VR8 B;  4GDL A;  2KDI A;  3UI3 A;  2JPH A;  4BBN F;  3VDZ A;  1GG3 A;  2IY1 B;  1F2R C;  1NEK B;  2KWU B;  5D3I B;  3AXC A;  4ZHP A;  1V9J A;  3N3K B;  1FXA A;  2O2V B;  4JWS C;  4L23 A;  1UEL A;  2WU2 B;  3CSF A;  4NAW A;  4HWI B;  3TBL D;  1M4V A;  1U4A A;  1XQQ A;  2QSD A;  1XEE A;  1GB4 A;  2V4L A;  2JQR B;  4W9K A;  4OZB A;  4BKS A;  2WXL A;  1P7E A;  2FUG 1;  5FR6 A;  3PLU A;  3ZNZ B;  3H8H A;  3JSV A;  3C19 A;  1KM7 A;  2KTR B;  1SF0 A;  3GE8 C;  4KDL B;  1XD3 B;  2MBB B;  2KFK B;  4K1R B;  4A90 A;  1PYW D;  4E71 A;  1RFK A;  1FNV A;  1WGG A;  3ZNI D;  2WLB A;  4RGM A;  3QIJ A;  3JW0 X;  1YNT E;  4A9A A;  4AS1 A;  3H1U A;  1YJJ A;  1F77 A;  2IGG A;  2INN E;  2H88 B;  4MH8 A;  1WM2 A;  3CST A;  5BYS A;  4R3D A;  1IP9 A;  3AI5 A;  1UGM A;  5DPR A;  1GJZ A;  1FXT B;  4C56 C;  1F1H A;  4KGT A;  4CYE A;  3J9C A;  2I2Y A;  3A4R A;  2E3T A;  2OED A;  3A9K B;  3U2S C;  3HIZ A;  4X57 B;  1ET6 A;  2XK5 A;  1WI0 A;  1TKY A;  2FCS A;  1ZDX A;  2MRP A;  5J2R A;  2NBV B;  2O2V A;  2EKE C;  3W2D A;  4FN2 A;  3AV8 A;  2LGI A;  2O6V B;  2GBR A;  1KFY B;  3WAP A;  3Q3J A;  4ARI A;  2K25 A;  2ZPN A;  1F0Z A;  3UIP B;  1ZUD 2;  2KFJ A;  5D7G A;  4MM3 A;  2L7R A;  2WXN A;  3PLV A;  2ZNV C;  5CHW A;  1J7C A;  1K53 A;  4DDI D;  3NVY A;  2KFK A;  4GSW A;  4RGT A;  4D2K A;  1WXS A;  4XWT A;  1TKG A;  2NBU A;  2WXQ A;  4GU2 A;  1B9R A;  2KAC A;  4BKS D;  1C77 A;  4MAC A;  3DBH I;  1V49 A;  3ZTC A;  3QHT A;  3PZD A;  4Q2J A;  2FCQ A;  4C00 A;  2BGF A;  2KN5 A;  1FNU A;  2WS3 B;  4FAD A;  1QIL A;  2QHO A;  1DYQ A;  2MBO A;  2N9P C;  1WE7 A;  2ICI A;  3MHZ A;  2IO2 B;  2DYB A;  1XT9 B;  4RM8 A;  1QF6 A;  2JVC A;  1JWU D;  1I4X A;  3BY4 B;  2FIF A;  2IND C;  1T5X D;  3W9C B;  3L0W B;  1P1A A;  1NBF C;  1OTR B;  2V1Y A;  2WXK A;  4UDU C;  1V1P A;  1T6B X;  3A9K A;  4NZL B;  1F52 A;  3KW5 B;  3R8B A;  2DAJ A;  1TT5 B;  1OGW A;  3OAW A;  4JPS A;  5D6J B;  3UQB A;  1GC6 A;  2NTS A;  3S2A A;  2DEN B;  1JWM D;  4HVB A;  1R4N I;  2QIL A;  5IO9 A;  4C80 A;  4LLG M;  2O6V A;  3L10 B;  4K81 A;  3AB5 A;  4S17 A;  4OVU A;  1VZ8 A;  1JW9 D;  1N5W A;  2MBH A;  3PVL A;  2HTM E;  4WJQ A;  2CKH B;  2DWQ A;  4PT5 A;  3PZ7 A;  2Y5C A;  5KHO A;  1C76 A;  1RLF A;  3TEY A;  3GE3 C;  2CR5 A;  2PTL A;  2BQQ A;  4M8N A;  4BKT A;  3U7D A;  2X38 A;  3B9J A;  2LVO A;  4B95 A;  4BAX A;  2PIA A;  3TMP B;  1YJI A;  1UWX A;  2BKR B;  4EZL A;  4AQ7 A;  5IP4 D;  2GLS A;  4FHJ A;  4TUU A;  3MFG A;  2L05 A;  2UWQ A;  1GC7 A;  2ZNV B;  4K7U A;  3AED B;  1K52 A;  2RGF A;  4ZRJ A;  1N61 A;  5CHV C;  1L6U A;  2CU3 A;  3UGB B;  4OZC A;  5E6O A;  3OWE B;  3RN9 C;  1JAL A;  3RI7 C;  3ZXR A;  2BYE A;  4KSK C;  2MW5 A;  1N62 A;  3ETR A;  1K50 A;  3VH4 B;  1ZDV A;  3BVZ A;  4FUL A;  2HE7 A;  1IGC A;  3AE6 B;  3RCZ A;  4MGK E;  4ZYS A;  3DBL B;  1XCT L;  1LGR A;  1QOG A;  3KUZ A;  5AEK B;  1VR9 A;  3RNC C;  3H9D A;  5EDS A;  3PTF C;  3AEG B;  1SE3 A;  4BOS C;  3M95 A;  1KF6 B;  1EM7 A;  2I1K A;  4HK2 A;  3DHH C;  3VTU A;  3HVD A;  2Z0E B;  3P63 A;  2V3N A;  3T3O A;  3RNA C;  1TBE A;  4ACF A;  2O6V D;  1JRO A;  2R2Q A;  4YXD B;  3U30 A;  2DZI A;  2K6Q A;  3AU5 A;  4JL9 A;  2BS3 B;  2K0P A;  2V9H A;  3P4P B;  3NZS A;  2RPV A;  3VFK A;  3N1X C;  4MJS B;  4HLE A;  1R4M B;  1CMX B;  1YJ1 A;  4NJ7 A;  3TUO A;  2GI9 A;  3UQA A;  3BK2 A;  4W9L A;  4WAA A;  3M63 B;  2B3A A;  2NCN A;  5IN7 A;  4HRS A;  1WX8 A;  2LEK A;  1RM6 C;  1SB3 C;  1MI0 A;  1E9M A;  2WXP A;  3WAN A;  1PQS A;  3TIX A;  2KQ4 X;  4M00 A;  1ZPS A;  2EEL A;  4I6P A;  2M56 B;  3IXS A;  2JZP A;  1C4A A;  3KWL A;  3DBR I;  1I4H A;  1QQR A;  3U7Z A;  4IW0 A;  1FD6 A;  1ZGU B;  2C7N B;  4ZOH C;  3VHT C;  3NUH B;  1AW7 A;  4RNA A;  2FCM A;  3A4S C;  1FO4 A;  2KZR A;  4RCO A;  4LNI A;  3OJ3 A;  2K8B A;  1J8C A;  4OZA A;  3KUC B;  2KAJ A;  2BS2 B;  1WGK A;  4I6N B;  4DK5 A;  1M94 A;  2AQ2 B;  4G3X B;  1QLB B;  4HJG E;  1UGJ A;  4DWF A;  2YEP B;  5I4D A;  3BWU D;  4F8C B;  1QOA A;  1QOF A;  1BUI C;  3T3N A;  4HJK A;  2WXM A;  1WH3 A;  2SEB D;  4HEA 1;  3V60 A;  1S3S G;  2KDB A;  1E10 A;  2UYZ B;  3AE7 B;  2KHW B;  4WJP A;  2FUH B;  3BZD B;  1C4P A;  3QAR A;  3CWI A;  1UZX B;  3AE8 B;  4IM0 A;  2AL3 A;  2JYT A;  4G50 A;  1TGZ B;  4P1C C;  4EUT A;  3K9P B;  2PE9 A;  3P4R B;  3ZXV A;  4MH0 E;  2N0S B;  2CHZ A;  4J6I A;  3Q8F A;  2KC1 A;  3NHE B;  2N9X A;  2UU7 A;  3P4Q B;  3EFU A;  1DOY A;  4K3C A;  3BVM A;  5LXI B;  3QAQ A;  5LLI A;  3OJ4 B;  4URK A;  4REZ A;  4DXA B;  2K3U A;  4CHK A;  1YQB A;  1TS3 A;  3ZIM A;  1UNS A;  5C3J B;  4KSL C;  5DPS A;  5HFY A;  2LGS A;  3H7P B;  4PYZ A;  3KVF B;  3TL5 A;  3DHI C;  3RZW C;  1WYW B;  3WAL A;  4B9K A;  2AQ3 B;  2EMT A;  2PVO D;  1XXG A;  1TZ1 A;  4L2Y A;  1L2N A;  1SIF A;  3R2T A;  2XEW A;  1ZOY B;  1NDD A;  2WWZ A;  4A3O A;  5LNK 1;  1HXY D;  1ZP0 B;  3AM9 A;  4GB9 A;  4A6Q A;  2QEJ C;  4MSM B;  2IGH A;  3X23 A;  3N1Z C;  4WIP A;  2ZVO A;  3L08 A;  2AWT A;  5CHF A;  5D94 A;  3DHG C;  1YN4 A;  2MEK A;  4YTM B;  3IG3 A;  3ENE A;  1KJT A;  1V5T A;  4WJN A;  2JUO A;  3W1S A;  1Q10 A;  1H8C A;  5JXV A;  2LFI A;  2RDG A;  2LZ6 A;  2XK5 B;  5JH5 C;  3QWZ B;  5T8I A;  2PPH A;  2G4D B;  1MPE A;  3LDZ E;  1V6E A;  5HHD G;  2IO0 B;  3VVW B;  2K8C A;  4IWO A;  1E8W A;  2IO3 B;  3DVG X;  2AQ1 B;  4WH4 A;  4C7Y A;  3VUX A;  3AH7 A;  2MH7 A;  2C7H A;  3EHV A;  3TJP A;  1J0G A;  4ICV A;  2L76 A;  2WYQ A;  1RRB A;  4XYC A;  3GZN I;  2I38 A;  4IKG A;  1JWB D;  2G3Q B;  1P98 A;  4MM3 B;  1SIJ A;  1MHX A;  2QIE B;  5G5G A;  3CIR B;  4DHJ B;  1UBQ A;  3UIO B;  1FMA D;  4NQL B;  4II3 B;  2RDB C;  3QA8 A;  3H7P A;  2DX5 B;  2JX5 A;  4HPM B;  1UUP A;  3P2B A;  5J18 A;  1JWS D;  2J42 A;  2WGS A;  3AUL A;  4W9H A;  1I4R A;  4W9D A;  2L0T A;  2KWV B;  1N6Z A;  2WXG A;  2JZZ A;  2PVG C;  1ET9 A;  2KDF B;  2KDE B;  2FE8 A;  3QQ8 B;  1XLN A;  1V81 A;  2ACZ B;  5BYQ A;  1ENF A;  2L83 A;  4KVG B;  4ARC A;  1SSN A;  4EE2 A;  1N5X A;  3BVG A;  2N7D A;  1JQ4 A;  3BK1 A;  1YN5 A;  2MJD A;  5D2M B;  2MJ3 A;  1KOT A;  1WZ3 A;  4FJY A;  1FPY A;  3L16 A;  1EO6 A;  1YN3 A;  3OLM D;  1KRH A;  3PPA A;  4ZRI A;  1V1P B;  3B0A A;  2BF8 B;  3L17 A;  2WHI A;  3SDL C;  1WGR A;  3MJ5 A;  4C4V A;  4FLH A;  1WJU A;  3Q3M C;  4N6E B;  2M0A A;  2DHZ A;  3N32 A;  1ACC A;  4O1N A;  3ZTD A;  4YTN B;  2LHD A;  1T0R C;  2KQS A;  4XDD A;  3K9O B;  4ZRQ A;  1PGA A;  1H4R A;  3IVF A;  2BKF A;  5FK9 C;  2AEH A;  1AN8 A;  3VXW A;  4MSQ B;  2GRI A;  4BFR A;  2MBQ A;  3R7Q A;  3T9L A;  2NPT B;  1C3T A;  2KYW A;  3RZF A;  1SEB D;  2M4N A;  4RMA A;  1AWD A;  2L3Z A;  2M0X A;  2LGD A;  3HVZ A;  1PGB A;  1WM3 A;  3N9Y C;  2RDH A;  2RD0 A;  1NEN B;  5LXH A;  3X0W A;  1Q0W B;  3AE4 B;  2IO1 B;  3ZJU A;  3MC0 B;  1DOI A;  1E7U A;  2C5L C;  4YSX B;  2L0F A;  2Z8L A;  1YIW A;  4BKG A;  4US9 A;  1GB1 A;  3QC8 B;  3ZVV A;  3ZJT A;  2PEA A;  3FIL A;  3NVZ A;  1DOX A;  3RNE C;  1Q1O A;  3KH0 A;  3NZ3 A;  4GMV A;  2LJI A;  3AEB B;  5EE3 A;  3V6E B;  1WRD B;  3NZU A;  1VD2 A;  1STE A;  2EMS A;  3DDC B;  2KMM A;  4ANW A;  1XCQ L;  4KV2 A;  2K1F A;  2KLG A;  4B0M A;  1IBX B;  3PHX B;  4IOI E;  3AE2 B;  3BYT B;  1UF0 A;  1WXV A;  1V86 A;  2WQY B;  2BYT A;  2N9L A;  1T0Q C;  1WXM A;  3DBL I;  2L52 A;  3E9S A;  3C8Y A;  1WXQ A;  2W3S A;  2WDT B;  1G6J A;  4DHZ E;  2L1A A;  3SU8 X;  1JRP A;  3ZNG C;  3VRA B;  2PW9 A;  2BYV E;  2KO3 A;  2R2O A;  4IM3 A;  2WX0 A;  1WWT A;  1X1M A;  3ALB A;  1ZXI A;  4WUR A;  2NPT A;  1TIF A;  1L0X B;  3ZO5 B;  5AUK A;  3MP9 A;  3ZNH B;  4RF1 A;  3A33 B;  4K3B A;  5BMI A;  4ZRP A;  5JZE B;  1LFD A;  2IGD A;  4JLC A;  1E0Z A;  1BXT A;  1HA5 A;  1GAQ B;  2IZV B;  4HDO A;  1J7A A;  2G1E A;  4ICU A;  3LB8 C;  2MBE A;  3HHM A;  2QC8 A;  1I35 A;  2JF5 A;  1MHH E;  3RNB C;  4HCN B;  4WWO A;  1EF1 A;  2XNA C;  2JU6 X;  1RYJ A;  1FCC C;  1XLO A;  3JYU A;  3PSE B;  1D6E C;  1Z2M A;  3VTW A;  3ZGZ A;  1TYG B;  1SE9 A;  4DHJ D;  3AE1 B;  4NJC A;  1NVI D;  3LJ3 A;  3FC4 A;  4ZDV A;  1UH6 A;  2GBK A;  4OW0 A;  1JWA D;  1WXA A;  5HG2 A;  4S0R A;  4ZYN A;  4M02 A;  4WJO A;  4F7Z A;  3DBH B;  3DVG Y;  1IBX A;  3LXF A;  4P16 A;  3T8M A;  4DDG D;  3P42 A;  3FAH A;  3VR9 B;  1BT0 A;  2GBJ A;  2W82 A;  2KDM A;  5H8Y E;  4MEM A;  3JVZ X;  5G5H A;  4YSY B;  1TTN A;  3VH3 B;  2KJR A;  4FHK A;  4NQK E;  3MC8 A;  3NJT A;  5BYR A;  3QCA A;  2PLP A;  1WMH A;  2ZCC A;  4KGR A;  2J53 A;  1J7B A;  3AE3 B;  4LCD E;  4KGS A;  3W1S C;  3SFE B;  4IWP A;  2J52 A;  2IDY A;  1T0Y A;  1TKE A;  3WIM A;  1C4C A;  3HUI A;  4NY0 A;  1CJE A;  2WP9 B;  5CTR C;  1A70 A;  1R4N B;  3Q69 A;  3FKY A;  1WYG A;  4YSZ B;  4IWQ A;  1XF5 L;  3I5J C;  3PGE A;  2N9K A;  2INC C;  3AN1 A;  1IPG A;  2KWD A;  2N7E A;  1VLB A;  2NS5 A;  3OG5 A;  4HRO A;  1E8X A;  2K22 A;  5DPT A;  2LI5 A;  3TEX A;  3AEC B;  2D10 A;  3RUI B;  2BB5 A;  3RD2 A;  2D3G A;  2KJH B;  1SE2 A;  2WXI A;  1NYQ A;  3QJZ A;  3QK0 A;  1GUA B;  2JSV X;  2J0K A;  4EOY A;  3ZRC A;  2NVU I;  4DXF A;  3KYD D;  3DQV A;  3KLS X;  3V6C B;  4KZC A;  1K51 A;  1P0R A;  4AJW A;  4FJV B;  3DWG C;  2KNB A;  3U4E G;  1WY8 A;  3EEC A;  3CF6 E;  4PYU A;  2VZK B;  1B1Z A;  1CQV A;  5BMH A;  2W9N A;  1VRA B;  3A9J B;  5IAA C;  3VUW A;  2MX2 A;  4XX5 A;  1RWS A;  2LD9 A;  3ZLZ A;  5L95 C;  1JML A;  2KLC A;  3PHW B;  4XDC A;  1YQ3 B;  5TSS A;  2N1W A;  3PRM B;  2OJW A;  2WXR A;  1QKZ A;  2J0M A;  4W9G A;  2C9W B;  2K5P A;  4OVV A;  2MSE D;  2MCN B;  1OFF A;  3DOW A;  5E6J A;  4MGI E;  1UD7 A;  4RF0 A;  3GS2 A;  3NRZ A;  4LDT D;  4P7I A;  3LYY A;  3BII D;  4M0W B;  2DZJ A;  2OOB B;  1ESF A;  2W55 A;  1D5M C;  2Y3A A;  3V3X A;  3O13 A;  2MWS B;  3AE5 B;  4WQO B;  1L4D B;  3HM3 A;  1CK1 A;  2LWP A;  3EFC A;  3RT3 B;  4TV3 A;  3WA0 A;  4MGY E;  1WSP A;  4NAM A;  1V2Y A;  1JCK B;  1NI3 A;  2KTF A;  1EU3 A;  1V8C A;  4ANX A;  1EF5 A;  2ZZP B;  3IFW B;  4LJO B;  1AYF A;  2CHW A;  4II2 B;  2VH1 A;  2W54 A;  3NS8 A;  2J4X A;  4GIV A;  2L00 B;  4MEL A;  4MGZ E;  3RNG C;  1L0V B;  3Q2A C;  2LRW A;  5EE0 A;  5HI1 A;  2G4S A;  1TS4 A;  2LGY A;  3NG0 A;  1V97 A;  4NPN A;  1WE6 A;  3PRP B;  4IDI A;  4JWU C;  2MHJ A;  1VJK A;  1MFW A;  1C78 A;  1LXD A;  2NMQ A;  1YOV B;  1LQB A;  1WRI A;  4XC2 A;  3A9J A;  1ISN A;  2J0J A;  4ZHO A;  2KKC A;  1N60 A;  2KX0 A;  1P3Q U;  1FIQ A;  1SXT A;  5DPW A;  1I7H A;  2GBM A;  1ROE A;  2WX1 A;  2G45 B;  2G9H D;  3W5V B;  4B0E A;  1E8Z A;  3ECI A;  4JE3 B;  3EGR A;  3VTV A;  4TSS A;  1CZP A;  3DVN U;  2KWC A;  5EE1 A;  2WDV B;  5AZF A;  2YVC A;  3RFZ B;  4HPP A;  1E5W A;  3Q8B A;  1WX9 A;  3AEE B;  4M0W A;  2JY6 A;  1QT9 A;  4ITK A;  2WXO A;  2DYO A;  2N4F A;  2LRU A;  1N63 A;  2BWE S;  3PS6 A;  1HEZ E;  2DNF A;  2K6D B;  3D32 A;  3IHP C;  2JRH A;  1L5P A;  4B6W A;  3GP7 A;  5H92 C;  4WAF A;  2KN4 A;  4FA6 A;  2AYO B;  2KOX A;  1HTQ A;  2JT4 B;  2RMM A;  3Q3F A;  3L13 A;  4C4V B;  3DBS A;  4KIK B;  1SBB B;  1Y56 A;  2HD5 B;  3CMM B;  1PDX A;  4XE0 A;  3W5U B;  3MHS D;  1D4B A;  3ZRF A;  2RR9 A;  2MP2 B;  1IGD A;  1FXI A;  4KKJ A;  3EA6 A;  3IT4 B;  1F2R I;  3ZUN A;  3ZYY X;  5KHQ A;  2Y5P A;  4MT5 A;  2C60 A;  1WGD A;  4BVU C;  5IOI A;  2FID A;  4FXC A;  1L4Z B;  4HDQ A;  4LNK A;  4BOZ B;  3KYC D;  5HKH A;  2KMC A;  4GN1 A;  4P6V F;  1RFA A;  2MQJ A;  2D07 B;  4NNJ B;  2JXX A;  3DVN V;  2JXT A;  1S1Q B;  4ANV A;  3P1M A;  2BBC A;  4RGO S;  2QDF A;  4PS7 A;  2FNJ B;  2VH2 A;  4I6L B;  2ASQ A;  2RSU A;  4IM2 A;  2A4Z A;  1D5X C;  2TSS A;  1WGY A;  4A20 A;  2JWU A;  2BB6 A;  4WWM A;  5IA7 A;  4JIO U;  4EFO A;  2PKO A;  2VZK D;  4EEW A;  2Y5B B;  1OQQ A;  3FIL B;  2D11 A;  1GNU A;  1UWM A;  1C9F A;  4BBN C;  1WR1 A;  1Y8R C;  3HRD D;  3R66 C;  5TR5 A;  4XZ4 A;  3R3M A;  4F1S A;  5AZG A;  4WQM A;  1ZKH A;  1C79 A;  2JZ3 B;  4US8 A;  4KKI A;  2KVR A;  4M8M A;  1YX5 B;  4HKQ A;  2X8X X;  1E6E B;  1YX6 B;  4KIK A;  3V62 A;  2J7Q B;  3NOB A;  2FCN A;  4M01 A;  4PK1 A;  1E7P B;  2LJ5 A;  3WCQ A;  1K8R B;  4GDK A;  3VRB B;  3AEA B;  3B2F A;  4IUM B;  2MP2 A;  1WFY A;  4YTP B;  3HK0 A;  1AAR A;  3V05 A;  1TZO A;  3M3J A;  1YMH E;  2WDQ B;  3SHQ A;  3ZQ4 A;  4RFB A;  5IKC M;  2KXJ A;  2XN9 C;  1L7Y A;  1JRU A;  1SE4 A;  4DBG A;  1EWC A;  3VAW A;  1XLQ A;  3IAS 1;  3MJW A;  3ONS A;  4K7W A;  2CS4 A;  5G2N A;  2LXC A;  4USA A;  1PFD A;  5CX3 A;  1WJ4 A;  4L1B A;  1OQR A;  1T0S C;  2HJ1 A;  2M8S A;  2FAZ A;  1HQR D;  2GOW A;  3B08 A;  4TQ0 A;  1GOZ A;  2ONQ A;  1SJE D;  2SAK A;  3GZN B;  3VUY A;  3DWM A;  1V80 A;  1EU4 A;  2BYF A;  3R7R A;  4RM9 A;  2KTR A;  3ZDM C;  2JYE A;  5E6N A;  1MG4 A;  1OEY A;  2BTE A;  2V3P A;  2IBI B;  4KDI C;  3IAM 1;  2V4I B;  4A8X C;  4GXB A;  5G55 A;  2LVQ A;  3SFD B;  1Q5W B;  2NTT A;  4PS3 A;  3ABV B;  1WR6 E;  4LNO A;  3IT6 B;  3AEF B;  1WZ0 A;  4CO7 A;  2L8J A;  2N9E B;  3ZDT A;  4KX6 B;  3ML9 A;  4LDT B;  2KQ7 A;  4YWG G;  3RMK C;  1VZ7 A;  2D5G A;  1P7F A;  3N20 C;  1TY0 A;  4LK0 M;  2W3R A;  3NVW A;  2PE6 B;  1E8Y A;  5JHB A;  3SR6 A;  5C2T B;  4FBJ B;  2K39 A;  2LAS A;  2QJL A;  2C7M B;  1WIA A;  1PGX A;  4MDK E;  1L6V A;  2DBY A;  2CJN A;  1WMH B;  5D3D A;  3SD5 A;  3I9V 1;  2LHE A;  1LM8 B;  3MC9 A;  2Z59 B;  3BIN A;  3L4P A;  4N58 A;  2A5U A;  5E6P A;  2K9X A;  3Q8A A;  1PUT A;  1YD8 U;  1P9D U;  4K7S A;  2WXF A;  3V61 A;  4WWP A;  2EKI A;  3W1Y A;  2D3A A;  3RNF C;  3BYY B;  2GMI C;  3TSS A;  3APF A;  4XGA B;  5BMG A;  2V3S A;  1R4M I;  5L83 A;  4TQ1 A;  2DZK A;  2YEP F;  2BS4 B;  3ML8 A;  4AOF A;  1F9J A;  5BO4 B;  3NY5 A;  4AP4 C;  2D3B A;  4LTU A;  4AUQ C;  3WAO A;  2K8H A;  3UIN B;  5EE9 A;  2R61 A;  3HM6 X;  1V1O A;  2LUE A;  1SJH D;  1WF9 A;  4W9I A;  3TEW A;  2Z0D B;  2ZJD A;  1NYR A;  2LUM A;  2KX3 A;  3APD A;  1QOB A;  2GB1 A;  3ZW3 A;  3ZKJ C;  4W9F A;  4CQN A;  3KUD B;  3ZJV A;  3O65 B;  4YL8 A;  5C23 A;  2JWZ A;  2ZW0 A;  2YLM A;  2WU5 B;  2DAF A;  2KC2 A;  1BML C;  2ON8 A;  2D2Q A;  2BT6 A;  4JGH B;  1KLV A;  3RPF C;  4TKN A;  4NJ6 A;  4E74 A;  5FR3 A;  2KD0 A;  2VRR B;  3I63 C;  3MTN B;  5DCN A;  2L32 A;  4E3C A;  4A3P A;  3APC A;  1R7S A;  2M17 A;  4EZJ A;  3N30 A;  3Q8E A;  1MG8 A;  1T3Q A;  2D3C A;  1OEY J;  3KQ4 A;  1FEH A;  3AE9 B;  2DLB A;  2LMC A;  4LJP B;  4WWN A;  1RAX A;  3AU4 A;  2IJ0 A;  2HJ8 A;  2MA9 B;  4N59 A; 
#chains in the Genus database with same CATH homology
 2NBW B;  3AUL A;  2LGY A;  3L0W B;  3H7S A;  1D3Z A;  4NPN A;  1P1A A;  1WE6 A;  3L54 A;  2IYD B;  1NBF C;  1OTR B;  2V1Y A;  4W9H A;  3PRP B;  4W9D A;  2L0T A;  2KWV B;  2JZZ A;  2ZPY A;  3A9K A;  2LVP A;  1SGH A;  2KDF B;  1E7V A;  2PJH A;  5GMV A;  2DZM A;  3KW5 B;  1LXD A;  2KDE B;  2DAJ A;  3QQ8 B;  1OGW A;  1V81 A;  1LQB A;  3OAW A;  4CYE A;  4ASW C;  4KVG B;  4XC2 A;  5D6J B;  5J18 A;  3A9J A;  1ISN A;  3WAM A;  3GOE A;  2J0J A;  1GC6 A;  3UQB A;  2N7D A;  2KKC A;  3S2A A;  2DEN B;  2BPS A;  5D2M B;  4HVB A;  1I42 A;  1R4N I;  2KX0 A;  1P3Q U;  1KOT A;  4HCP B;  1WZ3 A;  1Z5S B;  2O6V A;  5DPW A;  2GBM A;  3L10 B;  2WX1 A;  4FJY A;  4K81 A;  2G45 B;  3L16 A;  1E8Z A;  2JRI B;  3ECI A;  4OVU A;  1EO6 A;  3VTV A;  2MBH A;  3OLM D;  3DVN U;  3PVL A;  2KWC A;  3PPA A;  4ANU A;  4ZRI A;  4WJQ A;  2CKH B;  3B0A A;  5AZF A;  2CHX A;  2BF8 B;  2YVC A;  3L17 A;  3SDL C;  1WGR A;  5KHO A;  4ZRK A;  3VQI A;  4AWJ A;  1E5W A;  1J19 A;  1RLF A;  1WX9 A;  2ZCB A;  4FLH A;  1WJU A;  2DHZ A;  2ZVN A;  4N9F 4;  2JY6 A;  2CR5 A;  3N32 A;  4M8N A;  4BKT A;  3U7D A;  2DYO A;  4W9E A;  1HE8 A;  3ZTD A;  4AJY B;  2N4F A;  1V5O A;  3A1Q B;  2LVO A;  4B95 A;  3TMP B;  2CU1 A;  2LRU A;  2BWE S;  3PS6 A;  2KQS A;  3K9O B;  2K6D B;  3D32 A;  3IHP C;  2JRH A;  2BKR B;  4B6W A;  4EZL A;  1H4R A;  3IVF A;  2BKF A;  4FHJ A;  2AEH A;  2N1V A;  4TUU A;  4FA6 A;  3PT2 B;  3EC8 A;  2L05 A;  3VXW A;  2UWQ A;  4MSQ B;  1GC7 A;  2AYO B;  2KOX A;  4BFR A;  2ZNV B;  2MBQ A;  4K7U A;  3R7Q A;  2NPT B;  3T9L A;  2JT4 B;  1C3T A;  1VCB A;  3Q3F A;  3L13 A;  3RZF A;  3DBS A;  4KIK B;  2MLB A;  2M4N A;  4RMA A;  2HD5 B;  3CMM B;  4HPL B;  2RGF A;  4ZRJ A;  2L3Z A;  4JQW C;  2M0X A;  1WGH A;  3MHS D;  2LGD A;  3ZRF A;  3IBE A;  2RR9 A;  2MP2 B;  5CHV C;  1WM3 A;  3UGB B;  5E6O A;  3ZUN A;  2RD0 A;  5KHQ A;  2C60 A;  1OQY A;  5LXH A;  1WGD A;  4BVU C;  2FID A;  1E90 A;  1WJ6 A;  3X0W A;  1Q0W B;  4G0N B;  4EKU A;  2BYE A;  1ZW7 A;  2OJR A;  4GOC A;  2IO1 B;  4HDQ A;  4KSK C;  3PRE A;  4BOZ B;  4EZK A;  3KYC D;  2C5L C;  1E7U A;  2MW5 A;  2NR2 A;  2AL6 A;  5HKH A;  2L0F A;  1YIW A;  4BKG A;  2KMC A;  3C0R B;  2BWF A;  4GN1 A;  3QC8 B;  1RFA A;  3ZVV A;  2PEA A;  3VH4 B;  2I1J A;  4FUL A;  2MQJ A;  2D07 B;  4NNJ B;  5AZH A;  1Q1O A;  2HE7 A;  2JXX A;  2KMA A;  1S1Q B;  3DVN V;  3KH0 A;  4GMV A;  4ANV A;  4GDL B;  3RCZ A;  3V6E B;  1WRD B;  3NZU A;  1VD2 A;  4MGK E;  2EMS A;  2REX A;  3DDC B;  4PS8 A;  4ANW A;  4PS7 A;  2FNJ B;  4I6L B;  3KUZ A;  5AEK B;  2ASQ A;  3B1L X;  1WX7 A;  4KV2 A;  2RSU A;  3PV1 A;  2K1F A;  2KLG A;  2ZEQ A;  4IM2 A;  2A4Z A;  2DYM A;  3PHX B;  1WGY A;  4A20 A;  3PRZ A;  3H9D A;  2M1M A;  5EDS A;  4MJS A;  1UBI A;  3PTF C;  5IA7 A;  4JIO U;  4EFO A;  2KAN A;  1WXV A;  4IG7 B;  1V86 A;  4EEW A;  4BOS C;  2Y5B B;  3M95 A;  4G11 A;  2I1K A;  4HK2 A;  3VTU A;  4NAW B;  2Z0E B;  1C1Y B;  2D11 A;  1GNU A;  1WXM A;  2XBB C;  3DBL I;  4BBN C;  4IC7 B;  1TBE A;  1WR1 A;  1Y8R C;  3R66 C;  5TR5 A;  2WDT B;  2O6V D;  3A1Q A;  3R3M A;  4XZ4 A;  2GBN A;  2R2Q A;  5AZG A;  4F1S A;  3U30 A;  1G6J A;  4DHZ E;  3ZNG C;  1ZKH A;  2DZI A;  3SU8 X;  3DPD A;  2BYV E;  2K6Q A;  3M62 B;  3AU5 A;  2KO3 A;  2JZ3 B;  4JL9 A;  2R2O A;  1QZE A;  4IM3 A;  1IYF A;  2WX0 A;  3NZS A;  3VFK A;  2KK8 A;  2KVR A;  3TCA A;  1X1M A;  3JSV B;  4M8M A;  1YX5 B;  4MJS B;  3ALB A;  4HLE A;  1CMX B;  4FJZ A;  1YJ1 A;  2NPT A;  2KJ6 A;  4NJ7 A;  2LXA A;  1YX6 B;  4KIK A;  3V62 A;  4GGQ A;  2J7Q B;  3NOB A;  3ZO5 B;  3UQA A;  2FCN A;  4W9L A;  4WAA A;  2LGX A;  3ZNH B;  3M63 B;  1A5R A;  2LJ5 A;  3A33 B;  1WJN A;  2B3A A;  1LFD A;  1K8R B;  2NCN A;  4JLC A;  5JZE B;  4GDK A;  1WX8 A;  2MP2 A;  4IUM B;  3QX1 A;  1WFY A;  3HK0 A;  1AAR A;  3I3T B;  4DHZ B;  3M3J A;  2IZV B;  5JHA A;  4HDO A;  3SHQ A;  5J17 A;  4ICU A;  5C1Z A;  3H6N A;  2MBE A;  3HHM A;  2KXJ A;  3WAN A;  1L7Y A;  1PQS A;  1JRU A;  3TIX A;  1EUV B;  1I35 A;  4DBG A;  2JF5 A;  4I6P A;  1NI2 A;  4HCN B;  4WWO A;  2RPQ A;  1EF1 A;  3JYU A;  3VTW A;  3PSE B;  3U8Z A;  1Z2M A;  3RUL A;  3VAW A;  3MJW A;  3ONS A;  4K7W A;  3UF8 A;  2IY0 B;  2CS4 A;  5G2N A;  3DBR I;  3DCG A;  2LXC A;  4W9C A;  1SE9 A;  4IW0 A;  4DHJ D;  4KZ0 A;  2HTH A;  3BY4 B;  1ZGU B;  2C7N B;  1WJ4 A;  5CX3 A;  3RYT A;  3VHT C;  4W9J A;  3LJ3 A;  2M8S A;  4HXD A;  4GDK B;  2FCM A;  3A4S C;  4GDL A;  2KDI A;  2KZR A;  2FAZ A;  4ZDV A;  1UH6 A;  2GOW A;  3B08 A;  3OJ3 A;  2GBK A;  2K8B A;  2JPH A;  1J8C A;  4BBN F;  1WXA A;  3VDZ A;  4TQ0 A;  1GG3 A;  4ZYN A;  4WJO A;  2IY1 B;  4F7Z A;  2KWU B;  3KUC B;  3DVG Y;  3AXC A;  3VUY A;  1V80 A;  1V9J A;  3N3K B;  3T8M A;  2BYF A;  4I6N B;  4DK5 A;  2O2V B;  3R7R A;  4DDG D;  4RM9 A;  1M94 A;  2KTR A;  1UEL A;  3ZDM C;  5E6N A;  4G3X B;  1OEY A;  3CSF A;  4NAW A;  1BT0 A;  2GBJ A;  2IBI B;  4HWI B;  3TBL D;  4KDI C;  1U4A A;  1XQQ A;  4GXB A;  4MEM A;  4DWF A;  5G55 A;  3JVZ X;  4F8C B;  2LVQ A;  1TTN A;  3VH3 B;  2KJR A;  4FHK A;  4NQK E;  4HJK A;  2V4L A;  1Q5W B;  1WH3 A;  4W9K A;  4BKS A;  4PS3 A;  3V60 A;  1S3S G;  2KDB A;  1WR6 E;  2UYZ B;  1WZ0 A;  5FR6 A;  2KHW B;  3QCA A;  2L8J A;  2FUH B;  4WJP A;  1WMH A;  2ZCC A;  4CO7 A;  2N9E B;  3PLU A;  3ZDT A;  3ZNZ B;  3QAR A;  3JSV A;  3ML9 A;  2KQ7 A;  4LDT B;  4LCD E;  1UZX B;  3W1S C;  4IM0 A;  2AL3 A;  1KM7 A;  2KTR B;  4G50 A;  4IWP A;  1TGZ B;  4KDL B;  1XD3 B;  2MBB B;  2KFK B;  1T0Y A;  4K1R B;  4EUT A;  4E71 A;  3K9P B;  2PE6 B;  3WIM A;  1E8Y A;  2PE9 A;  1WGG A;  3ZNI D;  5JHB A;  4FBJ B;  4NY0 A;  3QIJ A;  4MH0 E;  4J6I A;  2CHZ A;  5CTR C;  3JW0 X;  2K39 A;  2KC1 A;  2LAS A;  4IWQ A;  3NHE B;  3H1U A;  2N9X A;  3PGE A;  3EFU A;  1IPG A;  2N7E A;  2C7M B;  1WIA A;  2NS5 A;  4MDK E;  1E8X A;  5LXI B;  1WMH B;  3SD5 A;  3QAQ A;  5DPT A;  2LI5 A;  1WM2 A;  1LM8 B;  5LLI A;  2Z59 B;  2D10 A;  3BIN A;  3CST A;  3OJ4 B;  2A5U A;  5E6P A;  4URK A;  1IP9 A;  3AI5 A;  1UGM A;  5DPR A;  1GJZ A;  4DXA B;  3RUI B;  4CHK A;  1FXT B;  1YQB A;  3RD2 A;  2D3G A;  2KJH B;  3ZIM A;  4KSL C;  5DPS A;  1YD8 U;  1P9D U;  3QJZ A;  3QK0 A;  1GUA B;  4K7S A;  3H7P B;  2J0K A;  4EOY A;  4PYZ A;  3KVF B;  3V61 A;  2NVU I;  3TL5 A;  3ZRC A;  4WWP A;  3RZW C;  3W1Y A;  1WYW B;  3KYD D;  3DQV A;  3V6C B;  2GMI C;  3WAL A;  4B9K A;  3APF A;  2EMT A;  3A4R A;  4KZC A;  1P0R A;  1TZ1 A;  4AJW A;  4FJV B;  1L2N A;  1SIF A;  3A9K B;  2KNB A;  3HIZ A;  2V3S A;  1R4M I;  1WY8 A;  3EEC A;  5L83 A;  3CF6 E;  4PYU A;  2XEW A;  4TQ1 A;  4X57 B;  2XK5 A;  1NDD A;  2WWZ A;  1WI0 A;  2FCS A;  4A3O A;  2W9N A;  2DZK A;  2MRP A;  3A9J B;  5J2R A;  5IAA C;  2NBV B;  3VUW A;  2O2V A;  2EKE C;  2MX2 A;  3ML8 A;  4XX5 A;  1F9J A;  4AOF A;  5BO4 B;  4GB9 A;  4FN2 A;  2LD9 A;  3NY5 A;  4MSM B;  3ZLZ A;  5L95 C;  3X23 A;  2KLC A;  3PHW B;  4AP4 C;  2O6V B;  2ZVO A;  4AUQ C;  2GBR A;  2K8H A;  3L08 A;  2AWT A;  2N1W A;  3UIN B;  3HM6 X;  5CHF A;  3WAO A;  3PRM B;  5D94 A;  3WAP A;  2LUE A;  1WF9 A;  3Q3J A;  2K25 A;  2ZPN A;  4W9G A;  2J0M A;  3IG3 A;  2C9W B;  3ENE A;  4OVV A;  2MSE D;  1KJT A;  1V5T A;  4W9I A;  2Z0D B;  3DOW A;  2MCN B;  3UIP B;  2ZJD A;  4MGI E;  4WJN A;  2KX3 A;  2JUO A;  1UD7 A;  3APD A;  3W1S A;  1H8C A;  4LDT D;  4P7I A;  2KFJ A;  4M0W B;  2DZJ A;  3ZW3 A;  2OOB B;  5D7G A;  3ZKJ C;  4W9F A;  2LZ6 A;  2XK5 B;  3KUD B;  4MM3 A;  5JH5 C;  2L7R A;  3QWZ B;  3O65 B;  3PLV A;  2PPH A;  2ZNV C;  5CHW A;  4YL8 A;  2G4D B;  5C23 A;  2JWZ A;  3LDZ E;  1V6E A;  2IO0 B;  3VVW B;  2YLM A;  2K8C A;  4IWO A;  1E8W A;  2DAF A;  2IO3 B;  2KC2 A;  2KFK A;  3DVG X;  4DDI D;  4GSW A;  2D2Q A;  2MWS B;  1WXS A;  4JGH B;  4WQO B;  3VUX A;  3HM3 A;  3EHV A;  2LWP A;  2C7H A;  3RT3 B;  2NBU A;  3TJP A;  1KLV A;  1J0G A;  4GU2 A;  4TKN A;  4TV3 A;  4NJ6 A;  4BKS D;  4ICV A;  2L76 A;  2WYQ A;  3WA0 A;  1RRB A;  3DBH I;  1V49 A;  3ZTC A;  3QHT A;  4MGY E;  4E74 A;  2KD0 A;  3GZN I;  2VRR B;  3PZD A;  3MTN B;  1V2Y A;  5DCN A;  2FCQ A;  4E3C A;  2BGF A;  2KTF A;  2G3Q B;  4ANX A;  4A3P A;  3APC A;  2KN5 A;  1P98 A;  1EF5 A;  2M17 A;  4EZJ A;  2ZZP B;  4FAD A;  3N30 A;  3IFW B;  4LJO B;  2CHW A;  1MG8 A;  4II2 B;  4DHJ B;  1UBQ A;  2QHO A;  3UIO B;  1OEY J;  2MBO A;  2N9P C;  4NQL B;  1WE7 A;  3NS8 A;  4II3 B;  4GIV A;  2IO2 B;  3QA8 A;  2DYB A;  1XT9 B;  2DX5 B;  2L00 B;  3H7P A;  4LJP B;  4RM8 A;  2JVC A;  4HPM B;  4MEL A;  4MGZ E;  4WWN A;  1RAX A;  3AU4 A;  3P2B A;  2FIF A;  2LRW A;  2HJ8 A;  2MA9 B;  2G4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...