3NY5A

Crystal structure of the rbd domain of serine/threonine-protein kinase b-raf from homo sapiens. northeast structural genomics consortium target hr4694f
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
83
structure length
80
Chain Sequence
HMQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQKKPIGWDTDISWLTGEELHVEVLENVPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title Crystal structure of the RBD domain of serine/threonine-protein kinase B-raf from Homo sapiens.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 17
structure length 80
sequence length 83
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ny5A01
4GXBA 4JGHB 3A9JA 2V1YA 3TL5A 4KZCA 3V6EB 1LM8B 2O6VA 2KTRA 4FHKA 1TBEA 4IM3A 3VTWA 3PRMB 4HPMB 4FA6A 5D7GA 4FLHA 3ZNID 3AXCA 2D10A 4IG7B 2JZ3B 4I6LB 4WJQA 4DBGA 3DQVA 3A9JB 4XC2A 4K81A 1I35A 2O6VB 2KTRB 1WH3A 2LUEA 2GBMA 2YLMA 3DBSA 3ECIA 3PVLA 3HK0A 2AWTA 1V6EA 4LDTD 3PT2B 4BBNC 1WIAA 3BY4B 4JQWC 1VD2A 4WJPA 5DPWA 4NPNA 5AZGA 2M1MA 3A33B 3O65B 3SHQA 3KYDD 4ZDVA 3BINA 1KLVA 2I1KA 3L10B 3QCAA 4MSQB 3TIXA 1OTRB 4ANUA 1IP9A 4KDLB 3N3KB 2JF5A 3UINB 3PHXB 1P1AA 2KMCA 2KX0A 2KJ6A 2L05A 3APDA 4FHJA 3A1QA 4HJKA 2K1FA 3ZLZA 1RFAA 1WJ4A 2LVPA 3H6NA 4PS3A 5HKHA 2LXAA 2KQ7A 3PRZA 3ONSA 3UIPB 2LGDA 2HTHA 4FJVB 1WR6E 2BPSA 2OJRA 4JL9A 4W9FA 3RYTA 3VUXA 3DPDA 2L00B 2KFJA 2FUHB 2LRUA 2MSED 4FADA 2ZCCA 3V62A 4G3XB 1YIWA 2BYEA 1UH6A 3SD5A 3H1UA 2NBUA 2DAJA 2LASA 4IWPA 4F7ZA 1UELA 3OJ4B 4NQKE 3B1LX 3H7PB 4NJ6A 5D6JB 5DPSA 2ASQA 1OEYA 2ZVOA 2EKEC 1RLFA 1K8RB 1GJZA 3CMMB 1VCBA 2L0TA 2ZNVB 1L7YA 2FNJB 2EMSA 3V6CB 4TUUA 3JYUA 2ZNVC 3IHPC 3CSTA 4IM0A 4I6PA 4GDKA 4FULA 4YL8A 2JZZA 4M8MA 2FCNA 1Y8RC 1X1MA 4WJNA 2N7EA 1AARA 3KUDB 3PHWB 3U7DA 2L7RA 4GDLA 3ENEA 2GBJA 4DXAB 3L54A 4GDKB 3EHVA 3ZKJC 1V9JA 2WYQA 3H9DA 1KOTA 5L95C 2MLBA 1WZ0A 2LWPA 3LDZE 4RM8A 5AZHA 2MBBB 3ZTDA 1G6JA 3JW0X 2NVUI 2BF8B 2G4DB 3K9PB 3WA0A 4A20A 2HE7A 3VAWA 3APFA 1YX6B 2KFKA 2KWCA 3KVFB 4EUTA 2PEAA 4HCNB 5D2MB 1R4MI 3M62B 2K8HA 5G2NA 4CO7A 2A5UA 4TQ1A 2AYOB 2DZJA 3SDLC 3Q3FA 3AI5A 3RD2A 4HPLB 2DYMA 1V86A 3VDZA 1E8ZA 4PS7A 2KDIA 2IZVB 3GOEA 5DPTA 1EF5A 2MP2A 3TMPB 4WQOB 1H8CA 1WE6A 3TJPA 4P7IA 2O6VD 2ZEQA 3ZDTA 1LFDA 1OEYJ 1WGDA 2N9PC 1EO6A 1YX5B 2C60A 2KK8A 2D2QA 4GIVA 4BOZB 4B6WA 1I42A 1J0GA 3Q3JA 4CYEA 2B3AA 3ZVVA 3GZNI 2OOBB 2N1WA 4HXDA 5E6PA 1OGWA 5G55A 3VH3B 2KTFA 3ZUNA 1V49A 3UQBA 3N32A 3X0WA 1T0YA 4WWOA 2IY1B 3QWZB 2RGFA 1WJUA 2IO3B 3PREA 3U8ZA 2C5LC 2RPQA 3RCZA 4F1SA 2V4LA 2BKFA 1UD7A 2FCMA 3NZSA 4IWOA 1WGHA 2NBVB 3DBRI 3ZW3A 4AP4C 2MBEA 1SGHA 3PLVA 3R7QA 3WIMA 3RT3B 4KIKB 1E5WA 2QHOA 1V81A 5LXIB 2DHZA 3ML8A 4HDOA 4W9GA 4W9KA 4OVUA 4BOSC 4IC7B 3QIJA 3H7SA 3R7RA 2N7DA 3WAPA 3L16A 3ZIMA 1E90A 4B9KA 4DK5A 2KO3A 1S3SG 2D11A 2R2QA 5CHVC 4DHJB 1WXSA 4GGQA 1UBIA 2A4ZA 2BGFA 3EC8A 2PJHA 1Q5WB 2GBNA 4NAWB 2NCNA 5C23A 4HWIB 4DDGD 4K1RB 3PLUA 3L17A 1WZ3A 2M17A 4MGKE 3APCA 2JVCA 3MTNB 3NHEB 3WALA 2BYFA 2DZKA 2KC2A 3AULA 2HD5B 2MX2A 2NS5A 1GC7A 5J17A 2WDTB 2FCQA 1F9JA 5JH5C 2ZVNA 4HLEA 2AL3A 4K7UA 1UBQA 1WJ6A 1WR1A 3QHTA 3D32A 3L13A 4JIOU 4TKNA 4TV3A 3T9LA 1ISNA 2K25A 3M3JA 2VRRB 5FR6A 4E74A 3H7PA 1FXTB 1XD3B 2BYVE 2L8JA 1WX9A 1NI2A 4M8NA 5JHBA 4MH0E 2PE9A 2W9NA 4FJYA 4EOYA 2M8SA 2KDFB 4KZ0A 3ZNHB 4EKUA 4I6NB 1MG8A 3X23A 2KKCA 4BKSA 4DDID 3W1YA 2FIDA 4G0NB 4DHZB 2BWFA 3VUWA 4GN1A 4MGIE 4ANVA 2LRWA 4II3B 4NJ7A 2J0MA 1WRDB 5J2RA 5AEKB 4PYZA 3SU8X 2NBWB 4B95A 2IYDB 4WAAA 3DVGX 2O2VB 3PGEA 2C7NB 3A9KB 1OQYA 4AJWA 1KJTA 2J0KA 3WANA 5J18A 2MBOA 3PV1A 1YQBA 1SIFA 3TBLD 4AUQC 4LJPB 4ZRJA 1U4AA 3RUIB 2J0JA 2DAFA 2K6QA 3VFKA 2KZRA 3QAQA 3PS6A 2KNBA 2MBHA 4W9LA 3JSVA 4IUMB 2K39A 2MW5A 5C1ZA 1C3TA 3WAMA 1TTNA 1E7UA 2CHZA 3NOBA 5TR5A 2KN5A 4OVVA 2N1VA 2BWES 4WJOA 5E6OA 5DCNA 1UGMA 1P9DU 3P2BA 4AJYB 4PS8A 4A3OA 3WAOA 2JT4B 3JSVB 4KDIC 3QQ8B 1UZXB 3CF6E 2J7QB 4MJSA 4GOCA 3QC8B 3VQIA 4LCDE 5JHAA 1WJNA 3EECA 3UIOB 1IPGA 2XK5B 2KDBA 2EMTA 1WMHB 2KANA 4FBJB 4A3PA 2D3GA 3DCGA 3ZO5B 1SE9A 2MBQA 4MJSB 2KX3A 3ZTCA 2KD0A 2JRIB 2JWZA 4W9IA 4DHJD 2CU1A 4URKA 1ZW7A 2LGYA 2Z59B 3QA8A 3DBHI 1C1YB 3L0WB 2KMAA 4ANWA 2IO1B 4XX5A 3DVNU 2MQJA 3NY5A 5GMVA 5JZEB 4J6IA 3W1SC 2C7HA 5IA7A 3VHTC 3PRPB 1V2YA 2REXA 2L0FA 4MGYE 4WWNA 2KWUB 1J19A 1WX8A 1WGGA 2DYOA 3N30A 3R66C 3ZRCA 1GNUA 4KIKA 3I3TB 2LXCA 4TQ0A 1QZEA 3ALBA 4EEWA 3A4SC 5EDSA 4AOFA 4RM9A 1Z5SB 1P3QU 2DZIA 3OAWA 1BT0A 3DDCB 1TZ1A 1V80A 2L3ZA 4BKTA 1EUVB 3MJWA 1P0RA 4BFRA 2WX0A 3IVFA 5L83A 4W9EA 4ZYNA 1M94A 4HDQA 2WX1A 1D3ZA 4NAWA 4W9DA 5LLIA 4G50A 2R2OA 3HHMA 3NS8A 2XEWA 4MSMB 5DPRA 2LVOA 5KHOA 4ASWC 2ZCBA 3DVGY 4NNJB 4HCPB 5LXHA 4BKSD 3EFUA 4ZRIA 4GMVA 1WM3A 2Z0EB 2NR2A 3QJZA 4EFOA 1KM7A 2KLCA 1GC6A 4EZLA 2BKRB 3JVZX 3M95A 5KHQA 2JY6A 3KUCB 2N9EB 5CX3A 3VVWB 3B0AA 1YJ1A 4XZ4A 1WM2A 2G45B 3T8MA 3KUZA 1WX7A 4FN2A 5BO4B 4MDKE 4W9CA 2FAZA 3ZNGC 2JPHA 1GG3A 3DOWA 3VXWA 3CSFA 4AWJA 1Q1OA 3KYCD 2D07B 2ZJDA 3R3MA 2UYZB 2JUOA 3QX1A 2MRPA 2DYBA 1S1QB 4EZKA 2IO2B 2C9WB 2NPTA 3K9OB 1XQQA 3A4RA 2RSUA 4M0WB 2KLGA 1RRBA 1XT9B 2L76A 1V5OA 2O2VA 4II2B 3A9KA 2DENB 2KWVB 1A5RA 1Z2MA 2NPTB 2DZMA 3VUYA 3L08A 1H4RA 3RZWC 4N9F4 1E7VA 2IBIB 3A1QB 1WGRA 2GMIC 1NBFC 1HE8A 4E3CA 4IWQA 2KJHB 2LI5A 3DVNV 3U30A 2LJ5A 4K7WA 1NDDA 2FIFA 1LQBA 5CHWA 1WXMA 4KSKC 5AZFA 4K7SA 2LD9A 3UGBB 2CR5A 2Z0DB 3RULA 2ZZPB 5IAAC 1IYFA 1WFYA 1CMXB 2PPHA 4LDTB 1E8XA 1E8WA 2KC1A 4IM2A 4MELA 4KV2A 2HJ8A 1GUAB 4RMAA 2K6DB 1PQSA 5CHFA 1WYWB 3PTFC 4NQLB 2K8CA 2CHXA 2I1JA 3HIZA 1LXDA 2XK5A 2KVRA 2DX5B 4BBNF 4EZJA 4W9JA 4FJZA 1WMHA 2N4FA 3AU4A 4GU2A 1WGYA 2LVQA 3UF8A 1WI0A 1V5TA 3KH0A 2C7MB 2KXJA 4MM3A 4MGZE 1WE7A 4WWPA 4ZRKA 2GBRA 2N9XA 3S2AA 4ICVA 2YVCA 2MWSB 3QARA 1EF1A 3AU5A 2MCNB 3W1SA 3LJ3A 4NY0A 5D94A 3V61A 3QK0A 2LGXA 1ZKHA 2CKHB 2ZPYA 2GOWA 3OJ3A 4KVGB 1L2NA 1WY8A 4GDLB 3C0RB 4X57B 2M4NA 1JRUA 2UWQA 4KSLC 2IO0B 3ML9A 3PZDA 3ZNZB 1P98A 2JRHA 1YD8U 2KJRA 3MHSD 2XBBC 4G11A 3ZDMC 4ANXA 2KQSA 2PE6B 2LZ6A 2V3SA 3OLMD 3UQAA 3ZRFA 4E71A 2G4SA 2K8BA 1WF9A 1R4NI 1WXVA 2M0XA 2MA9B 1Q0WB 3M63B 4IW0A 3VTVA 4DHZE 2KDEB 2KFKB 4GB9A 2WWZA 3HM6X 4GSWA 4LJOB 3IG3A 2ZPNA 3RZFA 1TGZB 2Y5BB 3KW5B 4ICUA 2KOXA 4W9HA 3V60A 2FCSA 4JLCA 4F8CB 2MP2B 5CTRC 4DWFA 1ZGUB 3NZUA 1WXAA 3VTUA 4CHKA 2CHWA 1J8CA 4PYUA 3PSEB 2AL6A 2KHWB 3TCAA 1E8YA 2AEHA 2CS4A 1RAXA 3HM3A 2GBKA 2JXXA 3B08A 4BKGA 4BVUC 2IY0B 3VH4B 2RD0A 4HVBA 3IBEA 4MEMA 2G3QB 3IFWB 3PPAA 5E6NA 4HK2A 2RR9A 3DBLI
chains in the Genus database with same CATH superfamily
4GXBA 3V6EB 1XLNA 3AEAB 3SR6A 4FHKA 1RWSA 4HROA 4FA6A 2RPVA 2JZ3B 2JX5A 4WJQA 1I7HA 1V1PB 2YLMA 3PT2B 4BBNC 1SF0A 2M1MA 2J4XA 4ZDVA 1CJEA 1MVKA 1IP9A 1DGJA 2ICIA 3UINB 2KYWA 1K51A 2K1FA 3MP9A 4PS3A 2M56B 1WR6E 4W9FA 3DPDA 2KFJA 3Q8AA 1C76A 1C4PA 1UH6A 3H1UA 2NBUA 2LASA 3TEYA 1I4XA 3OJ4B 2AQ1B 3B1LX 2WXIA 3AEFB 3H7PB 4NJ6A 4P1BC 5DPSA 1AW7A 1QOGA 1WWTA 2LGIA 5D3IB 1VCBA 4RNAA 2J53A 1L7YA 2FNJB 2DNFA 3V6CB 4US8A 2ZNVC 3CSTA 1A70A 4I6PA 1IGDA 4GDKA 1CZPA 1WXQA 3Q69A 2SEBD 1Y8RC 1X1MA 3GS2A 2AX5A 3PHWB 2GBJA 4DXAB 3L54A 4GDKB 4A8XC 1SE2A 1FD6A 4RM8A 4WQMA 1G6JA 1TKYA 1SIJA 2BF8B 3E56A 1SBBB 2GLSA 2KWCA 1R4MI 4JX1C 4B0MA 3DBRB 3VDZA 5DPTA 2IZVB 3GOEA 2MP2A 3TEWA 3TJPA 3ZJUA 1YNTE 2ZEQA 4P7IA 1VR9A 1OEYJ 5FKAC 1TY0A 1C77A 4GIVA 4CYEA 3SFDB 3GZNI 2X38A 2KMMA 3VH3B 1OGWA 3UQBA 3N32A 2WXHA 2IY1B 3U8ZA 2RPQA 4XWWA 1CQVA 3NZSA 3I63C 1FNUA 3R7QA 3P63A 2QHOA 3ML8A 4W9KA 4BOSC 2AQ2B 3H7SA 3QIJA 1TS2A 2KO3A 1ZOYB 1ZXIA 1UBIA 2PJHA 1YQ3B 2MHJA 3L17A 4OVZA 2M17A 3MTNB 3I9V1 2DZKA 5IKCM 2HD5B 4C7ZA 3DHGC 2BW2A 5JH5C 2ACZB 4XE0A 1SXTA 1UBQA 1L6VA 4TKNA 3D32A 4JIOU 5L95C 3M3JA 2VRRB 1XD3B 2L8JA 1NI2A 5EE9A 2KDFB 3ZNHB 4EKUA 1MG8A 5HG2A 2FIDA 1M4VA 2BWFA 3VUWA 2LRWA 4II3B 4Q2JA 4WAAA 1TIFA 1KLGD 1KJTA 3WANA 5J18A 5E6JA 2CJNA 1YQBA 1SE4A 3TBLD 3RUIB 3RNBC 2DAFA 4A9AA 1FMAD 4LTUA 4R3DA 2MW5A 2CHZA 4ARCA 2KN5A 2N1VA 1R4NB 1C79A 3U2SC 1KLUD 3LXFA 3TUOA 1I4GA 2WDRB 2JT4B 3QQ8B 5BYQA 2J7QB 3PZ7A 4GOCA 2JSVX 1ACCA 1IPGA 2XK5B 3BIID 4ZRPA 3ZO5B 2N0SB 1E0ZA 4HKQA 3CWIA 4PT5A 1ZW7A 3DBHI 1C1YB 3N9YC 3W5VB 4RGTA 4XX5A 1AN8A 3DVNU 2M0AA 2MQJA 4C4VA 3DBLB 2IDYA 1FFVA 2L0FA 2MJDA 1WX8A 1WGGA 3N30A 4KIKA 3I3TB 1QZEA 3A4SC 4AOFA 1Z5SB 1P3QU 1QOBA 1TZ1A 4ZHPA 4BFRA 1SSNA 4W9EA 4ZYNA 2Z8LA 4HDQA 2WX1A 1D3ZA 4W9DA 5LLIA 1GAQB 3HHMA 3CIRB 4MSMB 5KHOA 3DVGY 4NNJB 3AE1B 1HXYD 4OHJA 3Q2AC 1KM7A 4M00A 4HJGE 4EZLA 5C2TB 1QILA 3RNGC 1WM2A 2G45B 3T8MA 2PVGC 3KUZA 4MDKE 3ZNGC 2JPHA 1RM6C 5TSSA 2DLBA 1HQRD 3IAM1 4M0WB 3A4RA 1GOZA 2L76A 3GP7A 1HEZE 2QMTA 1QLBB 2L32A 1NVID 1XLPA 2DENB 3A9KA 2GRIA 3VUYA 1H4RA 3B2FA 2IBIB 3A1QB 1NBFC 1HE8A 1UGJA 1GB4A 1DYQA 3U30A 1PUTA 1T0QC 1WXMA 3UGBB 1FXAA 1XF5L 4HEA1 1CMXB 1E8WA 5BYSA 1STEA 2WS3B 4KV2A 2D5GA 4OZAA 2CHXA 3AN1A 2KVRA 1UF0A 1JALA 1WMHA 4GU2A 1YJIA 3AE4B 1V5TA 2KXJA 3ZGZA 4ICVA 3QARA 2J52A 2LGXA 2GOWA 3OJ3A 1C4CA 4GDLB 1IBXA 2UWQA 1SJED 2IO0B 1XLOA 2JRHA 1YD8U 2XBBC 3ZDMC 1DOXA 1KRHA 2V3SA 3UQAA 1OQQA 3NRZA 1AWDA 1R4NI 4IW0A 3IG3A 2ZPNA 3URYA 2Y5BB 1GPXA 3WCQA 1KF6B 3ETRA 4DWFA 3NZUA 1WXAA 3VTUA 2WXMA 1XCTL 3PSEB 2AL6A 5G5GA 1E8YA 1RAXA 4AQ7A 2JXXA 5HHDG 3IBEA 2G3QB 3IFWB 4HK2A 3AXCA 1E7PB 3DBLI 2Y5CA 4JGHB 3IXSA 1LM8B 3VTWA 1L4ZB 3PRMB 4HPMB 4KGTA 4FLHA 3AE7B 3R2IA 5EE0A 4I6LB 4DBGA 4XC2A 1I35A 2LUEA 3DBSA 3ECIA 1GB1A 2MJEA 3RPFC 4WJPA 5AZGA 2JXTA 3A33B 5IOIA 3O65B 3SHQA 3KYDD 1KLVA 4MSQB 2KMCA 2L05A 4FHJA 1OQRA 4HJKA 4XDCA 1RFAA 1WJ4A 2H88B 3H6NA 2LXAA 3ONSA 2HTHA 4FJVB 4JL9A 2BPSA 3AEDB 5JXVA 2MSED 4FADA 3ZYYX 1XEEA 5T8IA 1HZ5A 4F7ZA 4YXDB 3P4RB 5D6JB 3NZ3A 5C3JB 2ASQA 1K50A 2ZVOA 1RLFA 1K8RB 1R4MB 2I2YA 3EFCA 2ZW1A 2WXJA 4IM0A 1HTQA 3ZJTA 4WJNA 3KWVA 1AARA 1QOAA 2WXKA 3ENEA 3ZKJC 1V9JA 3H9DA 1KOTA 3GZNB 2GB1A 1NEKB 2FUG1 2WXRA 4A20A 2LFIA 3B9JA 1CK1A 4IDIA 1V97A 4WIPA 2K8HA 5G2NA 4RGOS 4L23A 2A5UA 4CO7A 2DZJA 1F1HA 2M19A 1V86A 4O1NA 4WQOB 1H8CA 2K9XA 4AS1A 1LFDA 3AECB 1YX5B 2D2QA 4BOZB 1N61A 1J0GA 3BK1A 1WGKA 2WXGA 2N1WA 2GI9A 5E6PA 3ZUNA 4WWOA 1L6UA 2UU7A 3PREA 3RCZA 2LJIA 4M01A 2BKFA 2FCMA 1L0VB 1V1PA 3AM9A 3HVZA 3ZW3A 3U52E 3PLVA 3KWLA 3N20C 3WIMA 3NS1A 3RT3B 4MT5A 1RFKA 1FEHA 1HZ6A 2I38A 3FC4A 4HDOA 4W9GA 2JYTA 3L16A 5CHVC 2BGFA 2RDGA 3EC8A 5C23A 4NAWB 3DHIC 3PLUA 4MGKE 2X8XX 3WALA 2BYFA 2QJLA 3AULA 2MX2A 5HFYA 2XNAC 5J17A 3HUIA 1T0SC 2ZVNA 1WJ6A 3QHTA 4TV3A 4JE3B 1ISNA 2K25A 4E74A 3H7PA 1FXTB 3MC9A 1J7AA 2PE9A 4FJYA 3AB5A 3PZ8A 4I6NB 3TSSA 2KKCA 1PYWD 4DDID 3W1YA 4OZBA 4DHZB 4GN1A 1WRDB 1ENFA 3SU8X 2NBWB 4B95A 2K5PA 2WDVB 4KGSA 4REZA 2KQ4X 1F2RC 4LNNA 2C7NB 4LNKA 1XLQA 2J0KA 1ESFA 3PV1A 3MHZA 1SIFA 4LJPB 3DBHB 1P7EA 3VFKA 1VDVA 4RGNA 4IUMB 1TS3A 1E7UA 2PMVA 4OVVA 1FPYA 3W9CB 3P2BA 1L0XB 2R61A 1T0RC 4PS8A 1I4QA 2HJ1A 1K52A 3CF6E 3T3NA 3UIOB 2EMTA 2D3GA 1SE9A 3ZTCA 2KX3A 4TSSA 2J42A 2JRIB 4W9IA 3RNEC 1F77A 2LGYA 2V4IB 4JWSC 2IO1B 3RNCC 4YSYB 5GMVA 5JZEB 1RYJA 3W1SC 2C7HA 3DWGC 3VHTC 5IA7A 1V2YA 3AH7A 4WWNA 2IPKD 2KWUB 2WXLA 4S17A 2DYOA 2IGDA 3ZRCA 1GNUA 2IGGA 4PK1A 2LXCA 4TQ0A 4EEWA 3OAWA 3V3XA 1BT0A 1TYGB 4D2KA 4KKIA 2H89B 1V80A 4G50A 2R2OA 3BYTB 2VZKB 1FNVA 1N5WA 4ASWC 5LXHA 3EFUA 1PFDA 3V05A 3QJZA 1JWBD 1GC6A 2BKRB 3JVZX 3M95A 2JY6A 5CX3A 3P42A 3VVWB 1YJ1A 1C9FA 1WSPA 5BO4B 2BQQA 2BB5A 4AWJA 1JQ4A 1ZXHA 2D07B 2ZJDA 3AE5B 1XT9B 1V5OA 1FRDA 4C7YA 1N5XA 4II2B 1A5RA 2JU6X 3BYYB 3L08A 1YN4A 4KGRA 4IWQA 2KJHB 2LI5A 3DVNV 1HTOA 2FBWB 4K7WA 5CHWA 4K7SA 2LD9A 3KQ4A 2CR5A 3P4PB 1IYFA 1WFYA 1ZDXA 2PPHA 4LDTB 2KVZA 2BS2B 1IUEA 4RMAA 1PQSA 4YTNB 1NYQA 2ZW0A 5CHFA 2K8CA 4XYCA 4YWGG 3N1YC 3HIZA 4QAYA 2XK5A 2E6XA 2DX5B 4BBNF 4FJZA 1WGYA 3UF8A 2C7MB 2WXOA 1WE7A 3N1XC 4WWPA 2N9XA 1KTKA 2QILA 2MWSB 3RFZB 2MCNB 3W1SA 2VZKD 1ZKHA 4KVGB 2MH7A 2M4NA 1SB3C 2PLPA 4G11A 2PE6B 3OLMD 3UI3A 2K8BA 1WXVA 2MA9B 1Q0WB 3VRBB 4DHZE 2KFKB 2WWZA 3R8BA 4GSWA 3RZFA 1TGZB 3KW5B 2WQYB 4ICUA 4LK0M 2FCSA 1J7BA 4F8CB 3AEBB 1J8CA 4PYUA 3ZQ4A 3Q3NC 2AEHA 4A55A 1FXIA 3B08A 1C4AA 4BVUC 2IY0B 2N9KA 2TSSA 4MEMA 1VZ8A 4M02A 2EELA 2O6VA 2N9LA 5D7GA 3B2GA 4LNIA 4JWUC 5GXGB 2WU2B 1UWXA 2O6VB 1WH3A 2GBMA 4WAFA 1PGAA 3PVLA 3AE2B 1V6EA 4LDTD 3BY4B 4M0WA 4JQWC 4NPNA 5MPOA 1R7SA 3BINA 2I1KA 3L10B 4YTPB 1ZPSA 1OTRB 4ANUA 2JF5A 3PHXB 2KX0A 1T5XD 2IJ0A 2OJWA 2V3NA 4ARIA 3A1QA 1VRAB 3O13A 1JWMD 3ZLZA 2LVPA 2KQ7A 3RYTA 3VUXA 2FUHB 2LRUA 4A90A 3P4SB 4G3XB 1QF6A 3SD5A 4L1BA 5IO9A 1ZUD2 4NAMA 4IWPA 2HTME 1I4PA 1UELA 4NQKE 4P1CC 5IP4D 3NVYA 2BB6A 4LNFA 3CMMB 4RFBA 2L0TA 1FM0D 2EMSA 4TUUA 3IHPC 3SEBA 1JWUD 1KFYB 4FULA 2JZZA 1MG4A 2L7RA 4GDLA 1XCQL 4LLGM 3EHVA 2WYQA 2EKIA 3MC0B 3LDZE 5AZHA 2MBBB 2Y3AA 3JW0X 2NVUI 2G4DB 3K9PB 3VAWA 3APFA 3KVFB 4EUTA 4HKZE 3P4QB 2AYOB 3Q3FA 1VZ6A 3AI5A 4YTMB 3RD2A 3EUB2 4N6EB 4PS7A 3TMPB 1EF5A 1N60A 2B76B 2O6VD 2WXNA 4N58A 2LMCA 3ZDTA 1WGDA 2C60A 2KK8A 1YQ4B 2B3AA 2KDMA 1FIQA 2KTFA 1V49A 1DOYA 3X0WA 1T0YA 1TKEA 1E9MA 4OZCA 2RGFA 1WJUA 2IO3B 2C5LC 4F1SA 2V4LA 2INPE 4H2AA 1UD7A 3IT4B 4IWOA 3LYYA 1WGHA 4AP4C 2MBEA 1SGHA 2ON8A 4N59A 2CU3A 1V81A 5LXIB 2DHZA 4GLSC 2YEPF 1E90A 1S3SG 4DHJB 1J7CA 2GBNA 3AEGB 1WZ3A 3APCA 2Y5PA 3BVMA 1D5MC 1GC7A 3AMZA 2FCQA 4DXGA 1WR1A 2JWUA 1C78A 3L13A 3LB8C 2XN9C 1TY2A 3T9LA 1FRRA 5FR6A 2BYVE 2WXFA 2W9NA 4EOYA 1MHXA 1VLBA 4BKSA 4NZLB 4B0EA 4G0NB 2WXPA 1QT9A 4MGIE 4NJ7A 2W55A 5AEKB 4PYZA 2O2VB 1YJJA 1OQYA 4WH4A 3TEZA 4WWMA 4AUQC 4ZRJA 4FXCA 1U4AA 3Q8FA 1JWSD 2KZRA 3QAQA 1C3TA 3WAMA 1TTNA 3NOBA 2L1AA 5DCNA 4BAXA 4KDIC 4MJSA 4LCDE 4DXFA 3EECA 1D6EC 2KDBA 4ZYSA 2AQ3B 4FBJB 3DCGA 4MJSB 2MBQA 2WGSA 1UUPA 4URKA 4DHJD 2HDEA 2LGSA 2Z59B 3QA8A 2KMAA 5FR3A 4C56C 2INNE 2W3RA 1SE3A 3NY5A 3ZXRA 1JCKB 4YSZB 3PRPB 1BXTA 2MEKA 2REXA 4MGYE 3L4PA 4ITKA 5EDSA 1IGCA 1T3QA 2DZIA 2IGHA 3IAS1 3DDCB 2L3ZA 4BKTA 1EUVB 2V9HA 1N6ZA 2WX0A 3IVFA 3DWMA 1YOVB 4NAWA 2KN4A 5EE1A 4K3CA 2QSDA 5DPRA 2LEKA 2ZCBA 4HCPB 2WU5B 4BKSD 3BVZA 1YN5A 2Z0EB 3AEEB 4EFOA 3OG5A 1P7FA 1V8CA 4NJCA 4C00A 2FE8A 5KHQA 3KUCB 4XDDA 3B0AA 4KKJA 4XZ4A 2QDFA 1JWAD 1WX7A 4FN2A 4RGMA 2FAZA 2PVOD 1GG3A 1E10A 1Q1OA 3KYCD 3R3MA 2UYZB 2L83A 4EZKA 5IN7A 2RMMA 2NPTA 3K9OB 2KLGA 2LHDA 1I4HA 1MPEA 3U7ZA 2QIEB 4DQOC 1TS4A 1VJKA 3RMKC 1Z2MA 2NPTB 3RZWC 4N9F4 1E7VA 1JMLA 2INCC 2GMIC 1BMLC 3DHHC 2KWDA 1NDDA 2FIFA 1LQBA 4KSKC 5AZFA 3P1MA 3RULA 5IAAC 1EWYC 1E8XA 2KC1A 4IM2A 3FKYA 2HJ8A 1ZP0B 1WYWB 4NQLB 2I1JA 3GE3C 1OFFA 1ROEA 3W2DA 1LXDA 1N63A 1XXGA 4EZJA 2N4FA 3AU4A 3IT6B 4WURA 1D5ZC 1WI0A 5BYRA 2N7JA 3KH0A 4MM3A 4MACA 4MGZE 3ZJVA 1KH0A 2YVCA 3GE8C 1EF1A 2DWQA 4C80A 1FCLA 3LJ3A 1L2NA 4MM3B 1WY8A 4X57B 4KSLC 3ML9A 3PZDA 5LNK1 3ZNZB 1P98A 3I57A 3MHSD 1Q10A 4ANXA 3H8HA 2KQSA 4KX6B 3NVZA 3ZRFA 4E71A 3VTVA 5AUKA 3VR8B 4GB9A 3HM6X 1WYGA 4LJOB 1LGRA 1MJDA 4W9HA 3V60A 4JLCA 2WP9B 2MP2B 5CTRC 4TMAB 3NJTA 3BVGA 2PKOA 4J3OD 2D3AA 3TCAA 2CS4A 2KACA 3HM3A 4XWTA 4BKGA 2PW9A 3VH4B 2RD0A 4HVBA 3PPAA 2G1EA 2DBYA 3ZXVA 3A9JA 2V1YA 3AE6B 4KZCA 3TL5A 2KTRA 4IM3A 1TBEA 1QQRA 3ZNID 1WRIA 3BK2A 2D10A 2L52A 4IG7B 3ABVB 2JQRB 3DQVA 3A9JB 4K81A 2KTRB 3HK0A 2AWTA 5DPWA 4JPSA 1WIAA 1VD2A 1LO5D 3QCAA 1N62A 3TIXA 4KDLB 5FK9C 3N3KB 2ONQA 1P1AA 2KJ6A 3U4EG 3APDA 2LUMA 5HKHA 3PRZA 3R2TA 3UIPB 4RH6A 2LGDA 3T3OA 2OJRA 2L00B 2E3TA 2ZCCA 3Q14C 3V62A 1YIWA 2BYEA 2VH1A 2DAJA 1JW9D 3SFEB 4YT0B 1NI3A 1OEYA 1QKZA 2EKEC 1ET9A 1GJZA 1MFWA 1NENB 2ZNVB 2JYEA 4CQNA 3JYUA 2BTEA 4YL8A 4M8MA 2FCNA 4ZHOA 2N7EA 3KUDB 3U7DA 1L5PA 1NYRA 2MLBA 4MH8A 1WZ0A 2LWPA 3Q8EA 1QOFA 3FILA 3ZTDA 3WA0A 2HE7A 1YX6B 2KFKA 2JZPA 2PEAA 5HI1A 4HCNB 4XGAB 5D2MB 3M62B 4P16A 4OW0A 3FILB 4TQ1A 2MJ3A 3SDLC 1D4BA 4HPLB 2DYMA 1PGXA 1E8ZA 2KDIA 1V1OA 4YSXB 1WE6A 3RNAC 2N9PC 1I4RA 1SJHD 1EO6A 2BT6A 4B6WA 1I42A 3Q3JA 3ZVVA 2OOBB 2KAJA 2K22A 4HXDA 5G55A 1TZOA 2W3SA 3EA6A 3QWZB 3Q8BA 5BMGA 4BZAA 4C4VB 3BZDB 2NBVB 3DBRI 2V3PA 4KIKB 1B1ZA 5I4DA 1E5WA 2LHEA 4OVUA 4IC7B 3R7RA 4DK5A 3WAPA 2N7DA 3ZIMA 4B9KA 2D11A 2R2QA 1WXSA 4GGQA 2A4ZA 1EM7A 1Q5WB 1JRPA 2NCNA 4DDGD 4HWIB 4K1RB 2JVCA 3PO0A 3NHEB 4ACFA 2W82A 2KC2A 2NS5A 3AE8B 1PGBA 2WDTB 3FAHA 1F9JA 3EGRA 2BS3B 4HLEA 2AL3A 4K7UA 2K0PA 5AUIA 1WX9A 4M8NA 5JHBA 4MH0E 2INDC 2M8SA 4KZ0A 3X23A 4US9A 2SAKA 1UWMA 2WHIA 1BUIC 3Q3OC 1T6BX 4ANVA 2BS4B 2J0MA 5J2RA 3Q3MC 4HRSA 3N1ZC 3W5UB 2IYDB 3NVVA 3DVGX 3AV8A 3PGEA 1HA5A 3A9KB 1EWCA 4AJWA 2MBOA 1FO4A 5BMHA 1YMHE 2OHFA 2PIAA 2BYTA 2J0JA 2QC8A 4USAA 5H92C 2K6QA 3PS6A 2KNBA 2MBHA 4W9LA 1PDXA 3JSVA 5C1ZA 2K39A 2YEPB 1TT5B 5TR5A 3VR9B 2WXQA 4WJOA 2BWES 5E6OA 1UGMA 1P9DU 1XO3A 2OEDA 2VH2A 4AJYB 3GB1A 4A3OA 3WAOA 1MHHE 1F2RI 3JSVB 1L4DB 1UZXB 3VQIA 3QC8B 5JHAA 1WJNA 3RN9C 1EU4A 1DOIA 2PTLA 3KLSX 3NUHB 1WMHB 2KANA 4A3PA 2KD0A 1TS5A 2JWZA 2CU1A 4EE2A 4IOIE 2K3UA 1SEBD 3L0WB 4ANWA 2BBCA 3MFGA 4J6IA 3I5JC 4P6VF 1IBXB 1J19A 3R66C 1YN3A 3RNFC 3ALBA 4RM9A 4UDUC 5H8YE 1K53A 3NVWA 1JROA 4LNOA 2BVCA 3MJWA 1P0RA 4HPPA 5L83A 1M94A 4K3BA 1FCCC 1Y56A 3NS8A 2XEWA 2LVOA 4S0RA 2RDHA 4ZRIA 3AE9B 4GMVA 1WM3A 3VRAB 1D5XC 2D3BA 2WDQB 1FNWA 2NR2A 4RCOA 3J9CA 2KLCA 5G5HA 1EU3A 2KT7A 2NTTA 3OWEB 2N9EB 2RDBC 1AYFA 2NTSA 1F0ZA 4W9CA 3E9SA 3DOWA 3VXWA 3CSFA 4RF0A 2JUOA 3QX1A 3MJ5A 2MRPA 1S1QB 2DYBA 2G9HD 2IO2B 2NMQA 2C9WB 1FFUA 1XQQA 2RSUA 2WLBA 1RRBA 1ET6A 2O2VA 1VZ7A 2KWVB 1ZDVA 2DZMA 1TJEA 1WGRA 1L0YB 4E3CA 2Q5WD 2CJOA 2LJ5A 5D3DA 2Z0DB 2ZZPB 3BWUD 4MELA 1F52A 3NG0A 3Q8CA 4RF1A 1MI0A 1GUAB 2K6DB 2WNMA 3PTFC 2V0GA 4ZOHC 4A6QA 4L2YA 4W9JA 2LVQA 4ZRQA 4ZRKA 2GBRA 3S2AA 2QEJC 3AU5A 4NY0A 5D94A 3V61A 3QK0A 2CKHB 2ZPYA 3HVDA 3C0RB 5BMIA 1JRUA 2KJRA 2W54A 2LZ6A 3C19A 3RI7C 1TKGA 5EE3A 2G4SA 1WF9A 2M0XA 3M63B 2KDEB 3C8YA 3Q6BA 1E6EB 4IKGA 1B9RA 2KOXA 1ZGUB 3TEXA 4CHKA 2CHWA 2D3CA 2KHWB 2QCZA 2GBKA 3HRDD 3MC8A 3AE3B 1UNSA 1ZE3D 5E6NA 2RR9A
chains in the Genus database with same CATH topology
4GXBA 4JGHB 3A9JA 2V1YA 3TL5A 4KZCA 3V6EB 1LM8B 2O6VA 2KTRA 4FHKA 1TBEA 4IM3A 3VTWA 3PRMB 4HPMB 4FA6A 5D7GA 4FLHA 3ZNID 3AXCA 2D10A 4IG7B 2JZ3B 4I6LB 4WJQA 4DBGA 3DQVA 3A9JB 4XC2A 4K81A 1I35A 2O6VB 2KTRB 1WH3A 2LUEA 2GBMA 2YLMA 3DBSA 3ECIA 3PVLA 3HK0A 2AWTA 1V6EA 4LDTD 3PT2B 4BBNC 1WIAA 3BY4B 4JQWC 1VD2A 4WJPA 5DPWA 4NPNA 5AZGA 2M1MA 3A33B 3O65B 3SHQA 3KYDD 4ZDVA 3BINA 1KLVA 2I1KA 3L10B 3QCAA 4MSQB 3TIXA 1OTRB 4ANUA 1IP9A 4KDLB 3N3KB 2JF5A 3UINB 3PHXB 1P1AA 2KMCA 2KX0A 2KJ6A 2L05A 3APDA 4FHJA 3A1QA 4HJKA 2K1FA 3ZLZA 1RFAA 1WJ4A 2LVPA 3H6NA 4PS3A 5HKHA 2LXAA 2KQ7A 3PRZA 3ONSA 3UIPB 2LGDA 2HTHA 4FJVB 1WR6E 2BPSA 2OJRA 4JL9A 4W9FA 3RYTA 3VUXA 3DPDA 2L00B 2KFJA 2FUHB 2LRUA 2MSED 4FADA 2ZCCA 3V62A 4G3XB 1YIWA 2BYEA 1UH6A 3SD5A 3H1UA 2NBUA 2DAJA 2LASA 4IWPA 4F7ZA 1UELA 3OJ4B 4NQKE 3B1LX 3H7PB 4NJ6A 5D6JB 5DPSA 2ASQA 1OEYA 2ZVOA 2EKEC 1RLFA 1K8RB 1GJZA 3CMMB 1VCBA 2L0TA 2ZNVB 1L7YA 2FNJB 2EMSA 3V6CB 4TUUA 3JYUA 2ZNVC 3IHPC 3CSTA 4IM0A 4I6PA 4GDKA 4FULA 4YL8A 2JZZA 4M8MA 2FCNA 1Y8RC 1X1MA 4WJNA 2N7EA 1AARA 3KUDB 3PHWB 3U7DA 2L7RA 4GDLA 3ENEA 2GBJA 4DXAB 3L54A 4GDKB 3EHVA 3ZKJC 1V9JA 2WYQA 3H9DA 1KOTA 5L95C 2MLBA 1WZ0A 2LWPA 3LDZE 4RM8A 5AZHA 2MBBB 3ZTDA 1G6JA 3JW0X 2NVUI 2BF8B 2G4DB 3K9PB 3WA0A 4A20A 2HE7A 3VAWA 3APFA 1YX6B 2KFKA 2KWCA 3KVFB 4EUTA 2PEAA 4HCNB 5D2MB 1R4MI 3M62B 2K8HA 5G2NA 4CO7A 2A5UA 4TQ1A 2AYOB 2DZJA 3SDLC 3Q3FA 3AI5A 3RD2A 4HPLB 2DYMA 1V86A 3VDZA 1E8ZA 4PS7A 2KDIA 2IZVB 3GOEA 5DPTA 1EF5A 2MP2A 3TMPB 4WQOB 1H8CA 1WE6A 3TJPA 4P7IA 2O6VD 2ZEQA 3ZDTA 1LFDA 1OEYJ 1WGDA 2N9PC 1EO6A 1YX5B 2C60A 2KK8A 2D2QA 4GIVA 4BOZB 4B6WA 1I42A 1J0GA 3Q3JA 4CYEA 2B3AA 3ZVVA 3GZNI 2OOBB 2N1WA 4HXDA 5E6PA 1OGWA 5G55A 3VH3B 2KTFA 3ZUNA 1V49A 3UQBA 3N32A 3X0WA 1T0YA 4WWOA 2IY1B 3QWZB 2RGFA 1WJUA 2IO3B 3PREA 3U8ZA 2C5LC 2RPQA 3RCZA 4F1SA 2V4LA 2BKFA 1UD7A 2FCMA 3NZSA 4IWOA 1WGHA 2NBVB 3DBRI 3ZW3A 4AP4C 2MBEA 1SGHA 3PLVA 3R7QA 3WIMA 3RT3B 4KIKB 1E5WA 2QHOA 1V81A 5LXIB 2DHZA 3ML8A 4HDOA 4W9GA 4W9KA 4OVUA 4BOSC 4IC7B 3QIJA 3H7SA 3R7RA 2N7DA 3WAPA 3L16A 3ZIMA 1E90A 4B9KA 4DK5A 2KO3A 1S3SG 2D11A 2R2QA 5CHVC 4DHJB 1WXSA 4GGQA 1UBIA 2A4ZA 2BGFA 3EC8A 2PJHA 1Q5WB 2GBNA 4NAWB 2NCNA 5C23A 4HWIB 4DDGD 4K1RB 3PLUA 3L17A 1WZ3A 2M17A 4MGKE 3APCA 2JVCA 3MTNB 3NHEB 3WALA 2BYFA 2DZKA 2KC2A 3AULA 2HD5B 2MX2A 2NS5A 1GC7A 5J17A 2WDTB 2FCQA 1F9JA 5JH5C 2ZVNA 4HLEA 2AL3A 4K7UA 1UBQA 1WJ6A 1WR1A 3QHTA 3D32A 3L13A 4JIOU 4TKNA 4TV3A 3T9LA 1ISNA 2K25A 3M3JA 2VRRB 5FR6A 4E74A 3H7PA 1FXTB 1XD3B 2BYVE 2L8JA 1WX9A 1NI2A 4M8NA 5JHBA 4MH0E 2PE9A 2W9NA 4FJYA 4EOYA 2M8SA 2KDFB 4KZ0A 3ZNHB 4EKUA 4I6NB 1MG8A 3X23A 2KKCA 4BKSA 4DDID 3W1YA 2FIDA 4G0NB 4DHZB 2BWFA 3VUWA 4GN1A 4MGIE 4ANVA 2LRWA 4II3B 4NJ7A 2J0MA 1WRDB 5J2RA 5AEKB 4PYZA 3SU8X 2NBWB 4B95A 2IYDB 4WAAA 3DVGX 2O2VB 3PGEA 2C7NB 3A9KB 1OQYA 4AJWA 1KJTA 2J0KA 3WANA 5J18A 2MBOA 3PV1A 1YQBA 1SIFA 3TBLD 4AUQC 4LJPB 4ZRJA 1U4AA 3RUIB 2J0JA 2DAFA 2K6QA 3VFKA 2KZRA 3QAQA 3PS6A 2KNBA 2MBHA 4W9LA 3JSVA 4IUMB 2K39A 2MW5A 5C1ZA 1C3TA 3WAMA 1TTNA 1E7UA 2CHZA 3NOBA 5TR5A 2KN5A 4OVVA 2N1VA 2BWES 4WJOA 5E6OA 5DCNA 1UGMA 1P9DU 3P2BA 4AJYB 4PS8A 4A3OA 3WAOA 2JT4B 3JSVB 4KDIC 3QQ8B 1UZXB 3CF6E 2J7QB 4MJSA 4GOCA 3QC8B 3VQIA 4LCDE 5JHAA 1WJNA 3EECA 3UIOB 1IPGA 2XK5B 2KDBA 2EMTA 1WMHB 2KANA 4FBJB 4A3PA 2D3GA 3DCGA 3ZO5B 1SE9A 2MBQA 4MJSB 2KX3A 3ZTCA 2KD0A 2JRIB 2JWZA 4W9IA 4DHJD 2CU1A 4URKA 1ZW7A 2LGYA 2Z59B 3QA8A 3DBHI 1C1YB 3L0WB 2KMAA 4ANWA 2IO1B 4XX5A 3DVNU 2MQJA 3NY5A 5GMVA 5JZEB 4J6IA 3W1SC 2C7HA 5IA7A 3VHTC 3PRPB 1V2YA 2REXA 2L0FA 4MGYE 4WWNA 2KWUB 1J19A 1WX8A 1WGGA 2DYOA 3N30A 3R66C 3ZRCA 1GNUA 4KIKA 3I3TB 2LXCA 4TQ0A 1QZEA 3ALBA 4EEWA 3A4SC 5EDSA 4AOFA 4RM9A 1Z5SB 1P3QU 2DZIA 3OAWA 1BT0A 3DDCB 1TZ1A 1V80A 2L3ZA 4BKTA 1EUVB 3MJWA 1P0RA 4BFRA 2WX0A 3IVFA 5L83A 4W9EA 4ZYNA 1M94A 4HDQA 2WX1A 1D3ZA 4NAWA 4W9DA 5LLIA 4G50A 2R2OA 3HHMA 3NS8A 2XEWA 4MSMB 5DPRA 2LVOA 5KHOA 4ASWC 2ZCBA 3DVGY 4NNJB 4HCPB 5LXHA 4BKSD 3EFUA 4ZRIA 4GMVA 1WM3A 2Z0EB 2NR2A 3QJZA 4EFOA 1KM7A 2KLCA 1GC6A 4EZLA 2BKRB 3JVZX 3M95A 5KHQA 2JY6A 3KUCB 2N9EB 5CX3A 3VVWB 3B0AA 1YJ1A 4XZ4A 1WM2A 2G45B 3T8MA 3KUZA 1WX7A 4FN2A 5BO4B 4MDKE 4W9CA 2FAZA 3ZNGC 2JPHA 1GG3A 3DOWA 3VXWA 3CSFA 4AWJA 1Q1OA 3KYCD 2D07B 2ZJDA 3R3MA 2UYZB 2JUOA 3QX1A 2MRPA 2DYBA 1S1QB 4EZKA 2IO2B 2C9WB 2NPTA 3K9OB 1XQQA 3A4RA 2RSUA 4M0WB 2KLGA 1RRBA 1XT9B 2L76A 1V5OA 2O2VA 4II2B 3A9KA 2DENB 2KWVB 1A5RA 1Z2MA 2NPTB 2DZMA 3VUYA 3L08A 1H4RA 3RZWC 4N9F4 1E7VA 2IBIB 3A1QB 1WGRA 2GMIC 1NBFC 1HE8A 4E3CA 4IWQA 2KJHB 2LI5A 3DVNV 3U30A 2LJ5A 4K7WA 1NDDA 2FIFA 1LQBA 5CHWA 1WXMA 4KSKC 5AZFA 4K7SA 2LD9A 3UGBB 2CR5A 2Z0DB 3RULA 2ZZPB 5IAAC 1IYFA 1WFYA 1CMXB 2PPHA 4LDTB 1E8XA 1E8WA 2KC1A 4IM2A 4MELA 4KV2A 2HJ8A 1GUAB 4RMAA 2K6DB 1PQSA 5CHFA 1WYWB 3PTFC 4NQLB 2K8CA 2CHXA 2I1JA 3HIZA 1LXDA 2XK5A 2KVRA 2DX5B 4BBNF 4EZJA 4W9JA 4FJZA 1WMHA 2N4FA 3AU4A 4GU2A 1WGYA 2LVQA 3UF8A 1WI0A 1V5TA 3KH0A 2C7MB 2KXJA 4MM3A 4MGZE 1WE7A 4WWPA 4ZRKA 2GBRA 2N9XA 3S2AA 4ICVA 2YVCA 2MWSB 3QARA 1EF1A 3AU5A 2MCNB 3W1SA 3LJ3A 4NY0A 5D94A 3V61A 3QK0A 2LGXA 1ZKHA 2CKHB 2ZPYA 2GOWA 3OJ3A 4KVGB 1L2NA 1WY8A 4GDLB 3C0RB 4X57B 2M4NA 1JRUA 2UWQA 4KSLC 2IO0B 3ML9A 3PZDA 3ZNZB 1P98A 2JRHA 1YD8U 2KJRA 3MHSD 2XBBC 4G11A 3ZDMC 4ANXA 2KQSA 2PE6B 2LZ6A 2V3SA 3OLMD 3UQAA 3ZRFA 4E71A 2G4SA 2K8BA 1WF9A 1R4NI 1WXVA 2M0XA 2MA9B 1Q0WB 3M63B 4IW0A 3VTVA 4DHZE 2KDEB 2KFKB 4GB9A 2WWZA 3HM6X 4GSWA 4LJOB 3IG3A 2ZPNA 3RZFA 1TGZB 2Y5BB 3KW5B 4ICUA 2KOXA 4W9HA 3V60A 2FCSA 4JLCA 4F8CB 2MP2B 5CTRC 4DWFA 1ZGUB 3NZUA 1WXAA 3VTUA 4CHKA 2CHWA 1J8CA 4PYUA 3PSEB 2AL6A 2KHWB 3TCAA 1E8YA 2AEHA 2CS4A 1RAXA 3HM3A 2GBKA 2JXXA 3B08A 4BKGA 4BVUC 2IY0B 3VH4B 2RD0A 4HVBA 3IBEA 4MEMA 2G3QB 3IFWB 3PPAA 5E6NA 4HK2A 2RR9A 3DBLI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GXB A;  4JGH B;  3A9J A;  2V1Y A;  3TL5 A;  4KZC A;  3V6E B;  1LM8 B;  2O6V A;  2KTR A;  4FHK A;  1TBE A;  4IM3 A;  3VTW A;  3PRM B;  4HPM B;  4FA6 A;  5D7G A;  4FLH A;  3ZNI D;  3AXC A;  2D10 A;  4IG7 B;  2JZ3 B;  4I6L B;  4WJQ A;  4DBG A;  3DQV A;  3A9J B;  4XC2 A;  4K81 A;  1I35 A;  2O6V B;  2KTR B;  1WH3 A;  2LUE A;  2GBM A;  2YLM A;  3DBS A;  3ECI A;  3PVL A;  3HK0 A;  2AWT A;  1V6E A;  4LDT D;  3PT2 B;  4BBN C;  1WIA A;  3BY4 B;  4JQW C;  1VD2 A;  4WJP A;  5DPW A;  4NPN A;  5AZG A;  2M1M A;  3A33 B;  3O65 B;  3SHQ A;  3KYD D;  4ZDV A;  3BIN A;  1KLV A;  2I1K A;  3L10 B;  3QCA A;  4MSQ B;  3TIX A;  1OTR B;  4ANU A;  1IP9 A;  4KDL B;  3N3K B;  2JF5 A;  3UIN B;  3PHX B;  1P1A A;  2KMC A;  2KX0 A;  2KJ6 A;  2L05 A;  3APD A;  4FHJ A;  3A1Q A;  4HJK A;  2K1F A;  3ZLZ A;  1RFA A;  1WJ4 A;  2LVP A;  3H6N A;  4PS3 A;  5HKH A;  2LXA A;  2KQ7 A;  3PRZ A;  3ONS A;  3UIP B;  2LGD A;  2HTH A;  4FJV B;  1WR6 E;  2BPS A;  2OJR A;  4JL9 A;  4W9F A;  3RYT A;  3VUX A;  3DPD A;  2L00 B;  2KFJ A;  2FUH B;  2LRU A;  2MSE D;  4FAD A;  2ZCC A;  3V62 A;  4G3X B;  1YIW A;  2BYE A;  1UH6 A;  3SD5 A;  3H1U A;  2NBU A;  2DAJ A;  2LAS A;  4IWP A;  4F7Z A;  1UEL A;  3OJ4 B;  4NQK E;  3B1L X;  3H7P B;  4NJ6 A;  5D6J B;  5DPS A;  2ASQ A;  1OEY A;  2ZVO A;  2EKE C;  1RLF A;  1K8R B;  1GJZ A;  3CMM B;  1VCB A;  2L0T A;  2ZNV B;  1L7Y A;  2FNJ B;  2EMS A;  3V6C B;  4TUU A;  3JYU A;  2ZNV C;  3IHP C;  3CST A;  4IM0 A;  4I6P A;  4GDK A;  4FUL A;  4YL8 A;  2JZZ A;  4M8M A;  2FCN A;  1Y8R C;  1X1M A;  4WJN A;  2N7E A;  1AAR A;  3KUD B;  3PHW B;  3U7D A;  2L7R A;  4GDL A;  3ENE A;  2GBJ A;  4DXA B;  3L54 A;  4GDK B;  3EHV A;  3ZKJ C;  1V9J A;  2WYQ A;  3H9D A;  1KOT A;  5L95 C;  2MLB A;  1WZ0 A;  2LWP A;  3LDZ E;  4RM8 A;  5AZH A;  2MBB B;  3ZTD A;  1G6J A;  3JW0 X;  2NVU I;  2BF8 B;  2G4D B;  3K9P B;  3WA0 A;  4A20 A;  2HE7 A;  3VAW A;  3APF A;  1YX6 B;  2KFK A;  2KWC A;  3KVF B;  4EUT A;  2PEA A;  4HCN B;  5D2M B;  1R4M I;  3M62 B;  2K8H A;  5G2N A;  4CO7 A;  2A5U A;  4TQ1 A;  2AYO B;  2DZJ A;  3SDL C;  3Q3F A;  3AI5 A;  3RD2 A;  4HPL B;  2DYM A;  1V86 A;  3VDZ A;  1E8Z A;  4PS7 A;  2KDI A;  2IZV B;  3GOE A;  5DPT A;  1EF5 A;  2MP2 A;  3TMP B;  4WQO B;  1H8C A;  1WE6 A;  3TJP A;  4P7I A;  2O6V D;  2ZEQ A;  3ZDT A;  1LFD A;  1OEY J;  1WGD A;  2N9P C;  1EO6 A;  1YX5 B;  2C60 A;  2KK8 A;  2D2Q A;  4GIV A;  4BOZ B;  4B6W A;  1I42 A;  1J0G A;  3Q3J A;  4CYE A;  2B3A A;  3ZVV A;  3GZN I;  2OOB B;  2N1W A;  4HXD A;  5E6P A;  1OGW A;  5G55 A;  3VH3 B;  2KTF A;  3ZUN A;  1V49 A;  3UQB A;  3N32 A;  3X0W A;  1T0Y A;  4WWO A;  2IY1 B;  3QWZ B;  2RGF A;  1WJU A;  2IO3 B;  3PRE A;  3U8Z A;  2C5L C;  2RPQ A;  3RCZ A;  4F1S A;  2V4L A;  2BKF A;  1UD7 A;  2FCM A;  3NZS A;  4IWO A;  1WGH A;  2NBV B;  3DBR I;  3ZW3 A;  4AP4 C;  2MBE A;  1SGH A;  3PLV A;  3R7Q A;  3WIM A;  3RT3 B;  4KIK B;  1E5W A;  2QHO A;  1V81 A;  5LXI B;  2DHZ A;  3ML8 A;  4HDO A;  4W9G A;  4W9K A;  4OVU A;  4BOS C;  4IC7 B;  3QIJ A;  3H7S A;  3R7R A;  2N7D A;  3WAP A;  3L16 A;  3ZIM A;  1E90 A;  4B9K A;  4DK5 A;  2KO3 A;  1S3S G;  2D11 A;  2R2Q A;  5CHV C;  4DHJ B;  1WXS A;  4GGQ A;  1UBI A;  2A4Z A;  2BGF A;  3EC8 A;  2PJH A;  1Q5W B;  2GBN A;  4NAW B;  2NCN A;  5C23 A;  4HWI B;  4DDG D;  4K1R B;  3PLU A;  3L17 A;  1WZ3 A;  2M17 A;  4MGK E;  3APC A;  2JVC A;  3MTN B;  3NHE B;  3WAL A;  2BYF A;  2DZK A;  2KC2 A;  3AUL A;  2HD5 B;  2MX2 A;  2NS5 A;  1GC7 A;  5J17 A;  2WDT B;  2FCQ A;  1F9J A;  5JH5 C;  2ZVN A;  4HLE A;  2AL3 A;  4K7U A;  1UBQ A;  1WJ6 A;  1WR1 A;  3QHT A;  3D32 A;  3L13 A;  4JIO U;  4TKN A;  4TV3 A;  3T9L A;  1ISN A;  2K25 A;  3M3J A;  2VRR B;  5FR6 A;  4E74 A;  3H7P A;  1FXT B;  1XD3 B;  2BYV E;  2L8J A;  1WX9 A;  1NI2 A;  4M8N A;  5JHB A;  4MH0 E;  2PE9 A;  2W9N A;  4FJY A;  4EOY A;  2M8S A;  2KDF B;  4KZ0 A;  3ZNH B;  4EKU A;  4I6N B;  1MG8 A;  3X23 A;  2KKC A;  4BKS A;  4DDI D;  3W1Y A;  2FID A;  4G0N B;  4DHZ B;  2BWF A;  3VUW A;  4GN1 A;  4MGI E;  4ANV A;  2LRW A;  4II3 B;  4NJ7 A;  2J0M A;  1WRD B;  5J2R A;  5AEK B;  4PYZ A;  3SU8 X;  2NBW B;  4B95 A;  2IYD B;  4WAA A;  3DVG X;  2O2V B;  3PGE A;  2C7N B;  3A9K B;  1OQY A;  4AJW A;  1KJT A;  2J0K A;  3WAN A;  5J18 A;  2MBO A;  3PV1 A;  1YQB A;  1SIF A;  3TBL D;  4AUQ C;  4LJP B;  4ZRJ A;  1U4A A;  3RUI B;  2J0J A;  2DAF A;  2K6Q A;  3VFK A;  2KZR A;  3QAQ A;  3PS6 A;  2KNB A;  2MBH A;  4W9L A;  3JSV A;  4IUM B;  2K39 A;  2MW5 A;  5C1Z A;  1C3T A;  3WAM A;  1TTN A;  1E7U A;  2CHZ A;  3NOB A;  5TR5 A;  2KN5 A;  4OVV A;  2N1V A;  2BWE S;  4WJO A;  5E6O A;  5DCN A;  1UGM A;  1P9D U;  3P2B A;  4AJY B;  4PS8 A;  4A3O A;  3WAO A;  2JT4 B;  3JSV B;  4KDI C;  3QQ8 B;  1UZX B;  3CF6 E;  2J7Q B;  4MJS A;  4GOC A;  3QC8 B;  3VQI A;  4LCD E;  5JHA A;  1WJN A;  3EEC A;  3UIO B;  1IPG A;  2XK5 B;  2KDB A;  2EMT A;  1WMH B;  2KAN A;  4FBJ B;  4A3P A;  2D3G A;  3DCG A;  3ZO5 B;  1SE9 A;  2MBQ A;  4MJS B;  2KX3 A;  3ZTC A;  2KD0 A;  2JRI B;  2JWZ A;  4W9I A;  4DHJ D;  2CU1 A;  4URK A;  1ZW7 A;  2LGY A;  2Z59 B;  3QA8 A;  3DBH I;  1C1Y B;  3L0W B;  2KMA A;  4ANW A;  2IO1 B;  4XX5 A;  3DVN U;  2MQJ A;  3NY5 A;  5GMV A;  5JZE B;  4J6I A;  3W1S C;  2C7H A;  5IA7 A;  3VHT C;  3PRP B;  1V2Y A;  2REX A;  2L0F A;  4MGY E;  4WWN A;  2KWU B;  1J19 A;  1WX8 A;  1WGG A;  2DYO A;  3N30 A;  3R66 C;  3ZRC A;  1GNU A;  4KIK A;  3I3T B;  2LXC A;  4TQ0 A;  1QZE A;  3ALB A;  4EEW A;  3A4S C;  5EDS A;  4AOF A;  4RM9 A;  1Z5S B;  1P3Q U;  2DZI A;  3OAW A;  1BT0 A;  3DDC B;  1TZ1 A;  1V80 A;  2L3Z A;  4BKT A;  1EUV B;  3MJW A;  1P0R A;  4BFR A;  2WX0 A;  3IVF A;  5L83 A;  4W9E A;  4ZYN A;  1M94 A;  4HDQ A;  2WX1 A;  1D3Z A;  4NAW A;  4W9D A;  5LLI A;  4G50 A;  2R2O A;  3HHM A;  3NS8 A;  2XEW A;  4MSM B;  5DPR A;  2LVO A;  5KHO A;  4ASW C;  2ZCB A;  3DVG Y;  4NNJ B;  4HCP B;  5LXH A;  4BKS D;  3EFU A;  4ZRI A;  4GMV A;  1WM3 A;  2Z0E B;  2NR2 A;  3QJZ A;  4EFO A;  1KM7 A;  2KLC A;  1GC6 A;  4EZL A;  2BKR B;  3JVZ X;  3M95 A;  5KHQ A;  2JY6 A;  3KUC B;  2N9E B;  5CX3 A;  3VVW B;  3B0A A;  1YJ1 A;  4XZ4 A;  1WM2 A;  2G45 B;  3T8M A;  3KUZ A;  1WX7 A;  4FN2 A;  5BO4 B;  4MDK E;  4W9C A;  2FAZ A;  3ZNG C;  2JPH A;  1GG3 A;  3DOW A;  3VXW A;  3CSF A;  4AWJ A;  1Q1O A;  3KYC D;  2D07 B;  2ZJD A;  3R3M A;  2UYZ B;  2JUO A;  3QX1 A;  2MRP A;  2DYB A;  1S1Q B;  4EZK A;  2IO2 B;  2C9W B;  2NPT A;  3K9O B;  1XQQ A;  3A4R A;  2RSU A;  4M0W B;  2KLG A;  1RRB A;  1XT9 B;  2L76 A;  1V5O A;  2O2V A;  4II2 B;  3A9K A;  2DEN B;  2KWV B;  1A5R A;  1Z2M A;  2NPT B;  2DZM A;  3VUY A;  3L08 A;  1H4R A;  3RZW C;  4N9F 4;  1E7V A;  2IBI B;  3A1Q B;  1WGR A;  2GMI C;  1NBF C;  1HE8 A;  4E3C A;  4IWQ A;  2KJH B;  2LI5 A;  3DVN V;  3U30 A;  2LJ5 A;  4K7W A;  1NDD A;  2FIF A;  1LQB A;  5CHW A;  1WXM A;  4KSK C;  5AZF A;  4K7S A;  2LD9 A;  3UGB B;  2CR5 A;  2Z0D B;  3RUL A;  2ZZP B;  5IAA C;  1IYF A;  1WFY A;  1CMX B;  2PPH A;  4LDT B;  1E8X A;  1E8W A;  2KC1 A;  4IM2 A;  4MEL A;  4KV2 A;  2HJ8 A;  1GUA B;  4RMA A;  2K6D B;  1PQS A;  5CHF A;  1WYW B;  3PTF C;  4NQL B;  2K8C A;  2CHX A;  2I1J A;  3HIZ A;  1LXD A;  2XK5 A;  2KVR A;  2DX5 B;  4BBN F;  4EZJ A;  4W9J A;  4FJZ A;  1WMH A;  2N4F A;  3AU4 A;  4GU2 A;  1WGY A;  2LVQ A;  3UF8 A;  1WI0 A;  1V5T A;  3KH0 A;  2C7M B;  2KXJ A;  4MM3 A;  4MGZ E;  1WE7 A;  4WWP A;  4ZRK A;  2GBR A;  2N9X A;  3S2A A;  4ICV A;  2YVC A;  2MWS B;  3QAR A;  1EF1 A;  3AU5 A;  2MCN B;  3W1S A;  3LJ3 A;  4NY0 A;  5D94 A;  3V61 A;  3QK0 A;  2LGX A;  1ZKH A;  2CKH B;  2ZPY A;  2GOW A;  3OJ3 A;  4KVG B;  1L2N A;  1WY8 A;  4GDL B;  3C0R B;  4X57 B;  2M4N A;  1JRU A;  2UWQ A;  4KSL C;  2IO0 B;  3ML9 A;  3PZD A;  3ZNZ B;  1P98 A;  2JRH A;  1YD8 U;  2KJR A;  3MHS D;  2XBB C;  4G11 A;  3ZDM C;  4ANX A;  2KQS A;  2PE6 B;  2LZ6 A;  2V3S A;  3OLM D;  3UQA A;  3ZRF A;  4E71 A;  2G4S A;  2K8B A;  1WF9 A;  1R4N I;  1WXV A;  2M0X A;  2MA9 B;  1Q0W B;  3M63 B;  4IW0 A;  3VTV A;  4DHZ E;  2KDE B;  2KFK B;  4GB9 A;  2WWZ A;  3HM6 X;  4GSW A;  4LJO B;  3IG3 A;  2ZPN A;  3RZF A;  1TGZ B;  2Y5B B;  3KW5 B;  4ICU A;  2KOX A;  4W9H A;  3V60 A;  2FCS A;  4JLC A;  4F8C B;  2MP2 B;  5CTR C;  4DWF A;  1ZGU B;  3NZU A;  1WXA A;  3VTU A;  4CHK A;  2CHW A;  1J8C A;  4PYU A;  3PSE B;  2AL6 A;  2KHW B;  3TCA A;  1E8Y A;  2AEH A;  2CS4 A;  1RAX A;  3HM3 A;  2GBK A;  2JXX A;  3B08 A;  4BKG A;  4BVU C;  2IY0 B;  3VH4 B;  2RD0 A;  4HVB A;  3IBE A;  4MEM A;  2G3Q B;  3IFW B;  3PPA A;  5E6N A;  4HK2 A;  2RR9 A;  3DBL I; 
#chains in the Genus database with same CATH topology
 4GXB A;  3V6E B;  1XLN A;  3AEA B;  3SR6 A;  4FHK A;  1RWS A;  4HRO A;  4FA6 A;  2RPV A;  2JZ3 B;  2JX5 A;  4WJQ A;  1I7H A;  1V1P B;  2YLM A;  3PT2 B;  4BBN C;  1SF0 A;  2M1M A;  2J4X A;  4ZDV A;  1CJE A;  1MVK A;  1IP9 A;  1DGJ A;  2ICI A;  3UIN B;  2KYW A;  1K51 A;  2K1F A;  3MP9 A;  4PS3 A;  2M56 B;  1WR6 E;  4W9F A;  3DPD A;  2KFJ A;  3Q8A A;  1C76 A;  1C4P A;  1UH6 A;  3H1U A;  2NBU A;  2LAS A;  3TEY A;  1I4X A;  3OJ4 B;  2AQ1 B;  3B1L X;  2WXI A;  3AEF B;  3H7P B;  4NJ6 A;  4P1B C;  5DPS A;  1AW7 A;  1QOG A;  1WWT A;  2LGI A;  5D3I B;  1VCB A;  4RNA A;  2J53 A;  1L7Y A;  2FNJ B;  2DNF A;  3V6C B;  4US8 A;  2ZNV C;  3CST A;  1A70 A;  4I6P A;  1IGD A;  4GDK A;  1CZP A;  1WXQ A;  3Q69 A;  2SEB D;  1Y8R C;  1X1M A;  3GS2 A;  2AX5 A;  3PHW B;  2GBJ A;  4DXA B;  3L54 A;  4GDK B;  4A8X C;  1SE2 A;  1FD6 A;  4RM8 A;  4WQM A;  1G6J A;  1TKY A;  1SIJ A;  2BF8 B;  3E56 A;  1SBB B;  2GLS A;  2KWC A;  1R4M I;  4JX1 C;  4B0M A;  3DBR B;  3VDZ A;  5DPT A;  2IZV B;  3GOE A;  2MP2 A;  3TEW A;  3TJP A;  3ZJU A;  1YNT E;  2ZEQ A;  4P7I A;  1VR9 A;  1OEY J;  5FKA C;  1TY0 A;  1C77 A;  4GIV A;  4CYE A;  3SFD B;  3GZN I;  2X38 A;  2KMM A;  3VH3 B;  1OGW A;  3UQB A;  3N32 A;  2WXH A;  2IY1 B;  3U8Z A;  2RPQ A;  4XWW A;  1CQV A;  3NZS A;  3I63 C;  1FNU A;  3R7Q A;  3P63 A;  2QHO A;  3ML8 A;  4W9K A;  4BOS C;  2AQ2 B;  3H7S A;  3QIJ A;  1TS2 A;  2KO3 A;  1ZOY B;  1ZXI A;  1UBI A;  2PJH A;  1YQ3 B;  2MHJ A;  3L17 A;  4OVZ A;  2M17 A;  3MTN B;  3I9V 1;  2DZK A;  5IKC M;  2HD5 B;  4C7Z A;  3DHG C;  2BW2 A;  5JH5 C;  2ACZ B;  4XE0 A;  1SXT A;  1UBQ A;  1L6V A;  4TKN A;  3D32 A;  4JIO U;  5L95 C;  3M3J A;  2VRR B;  1XD3 B;  2L8J A;  1NI2 A;  5EE9 A;  2KDF B;  3ZNH B;  4EKU A;  1MG8 A;  5HG2 A;  2FID A;  1M4V A;  2BWF A;  3VUW A;  2LRW A;  4II3 B;  4Q2J A;  4WAA A;  1TIF A;  1KLG D;  1KJT A;  3WAN A;  5J18 A;  5E6J A;  2CJN A;  1YQB A;  1SE4 A;  3TBL D;  3RUI B;  3RNB C;  2DAF A;  4A9A A;  1FMA D;  4LTU A;  4R3D A;  2MW5 A;  2CHZ A;  4ARC A;  2KN5 A;  2N1V A;  1R4N B;  1C79 A;  3U2S C;  1KLU D;  3LXF A;  3TUO A;  1I4G A;  2WDR B;  2JT4 B;  3QQ8 B;  5BYQ A;  2J7Q B;  3PZ7 A;  4GOC A;  2JSV X;  1ACC A;  1IPG A;  2XK5 B;  3BII D;  4ZRP A;  3ZO5 B;  2N0S B;  1E0Z A;  4HKQ A;  3CWI A;  4PT5 A;  1ZW7 A;  3DBH I;  1C1Y B;  3N9Y C;  3W5V B;  4RGT A;  4XX5 A;  1AN8 A;  3DVN U;  2M0A A;  2MQJ A;  4C4V A;  3DBL B;  2IDY A;  1FFV A;  2L0F A;  2MJD A;  1WX8 A;  1WGG A;  3N30 A;  4KIK A;  3I3T B;  1QZE A;  3A4S C;  4AOF A;  1Z5S B;  1P3Q U;  1QOB A;  1TZ1 A;  4ZHP A;  4BFR A;  1SSN A;  4W9E A;  4ZYN A;  2Z8L A;  4HDQ A;  2WX1 A;  1D3Z A;  4W9D A;  5LLI A;  1GAQ B;  3HHM A;  3CIR B;  4MSM B;  5KHO A;  3DVG Y;  4NNJ B;  3AE1 B;  1HXY D;  4OHJ A;  3Q2A C;  1KM7 A;  4M00 A;  4HJG E;  4EZL A;  5C2T B;  1QIL A;  3RNG C;  1WM2 A;  2G45 B;  3T8M A;  2PVG C;  3KUZ A;  4MDK E;  3ZNG C;  2JPH A;  1RM6 C;  5TSS A;  2DLB A;  1HQR D;  3IAM 1;  4M0W B;  3A4R A;  1GOZ A;  2L76 A;  3GP7 A;  1HEZ E;  2QMT A;  1QLB B;  2L32 A;  1NVI D;  1XLP A;  2DEN B;  3A9K A;  2GRI A;  3VUY A;  1H4R A;  3B2F A;  2IBI B;  3A1Q B;  1NBF C;  1HE8 A;  1UGJ A;  1GB4 A;  1DYQ A;  3U30 A;  1PUT A;  1T0Q C;  1WXM A;  3UGB B;  1FXA A;  1XF5 L;  4HEA 1;  1CMX B;  1E8W A;  5BYS A;  1STE A;  2WS3 B;  4KV2 A;  2D5G A;  4OZA A;  2CHX A;  3AN1 A;  2KVR A;  1UF0 A;  1JAL A;  1WMH A;  4GU2 A;  1YJI A;  3AE4 B;  1V5T A;  2KXJ A;  3ZGZ A;  4ICV A;  3QAR A;  2J52 A;  2LGX A;  2GOW A;  3OJ3 A;  1C4C A;  4GDL B;  1IBX A;  2UWQ A;  1SJE D;  2IO0 B;  1XLO A;  2JRH A;  1YD8 U;  2XBB C;  3ZDM C;  1DOX A;  1KRH A;  2V3S A;  3UQA A;  1OQQ A;  3NRZ A;  1AWD A;  1R4N I;  4IW0 A;  3IG3 A;  2ZPN A;  3URY A;  2Y5B B;  1GPX A;  3WCQ A;  1KF6 B;  3ETR A;  4DWF A;  3NZU A;  1WXA A;  3VTU A;  2WXM A;  1XCT L;  3PSE B;  2AL6 A;  5G5G A;  1E8Y A;  1RAX A;  4AQ7 A;  2JXX A;  5HHD G;  3IBE A;  2G3Q B;  3IFW B;  4HK2 A;  3AXC A;  1E7P B;  3DBL I;  2Y5C A;  4JGH B;  3IXS A;  1LM8 B;  3VTW A;  1L4Z B;  3PRM B;  4HPM B;  4KGT A;  4FLH A;  3AE7 B;  3R2I A;  5EE0 A;  4I6L B;  4DBG A;  4XC2 A;  1I35 A;  2LUE A;  3DBS A;  3ECI A;  1GB1 A;  2MJE A;  3RPF C;  4WJP A;  5AZG A;  2JXT A;  3A33 B;  5IOI A;  3O65 B;  3SHQ A;  3KYD D;  1KLV A;  4MSQ B;  2KMC A;  2L05 A;  4FHJ A;  1OQR A;  4HJK A;  4XDC A;  1RFA A;  1WJ4 A;  2H88 B;  3H6N A;  2LXA A;  3ONS A;  2HTH A;  4FJV B;  4JL9 A;  2BPS A;  3AED B;  5JXV A;  2MSE D;  4FAD A;  3ZYY X;  1XEE A;  5T8I A;  1HZ5 A;  4F7Z A;  4YXD B;  3P4R B;  5D6J B;  3NZ3 A;  5C3J B;  2ASQ A;  1K50 A;  2ZVO A;  1RLF A;  1K8R B;  1R4M B;  2I2Y A;  3EFC A;  2ZW1 A;  2WXJ A;  4IM0 A;  1HTQ A;  3ZJT A;  4WJN A;  3KWV A;  1AAR A;  1QOA A;  2WXK A;  3ENE A;  3ZKJ C;  1V9J A;  3H9D A;  1KOT A;  3GZN B;  2GB1 A;  1NEK B;  2FUG 1;  2WXR A;  4A20 A;  2LFI A;  3B9J A;  1CK1 A;  4IDI A;  1V97 A;  4WIP A;  2K8H A;  5G2N A;  4RGO S;  4L23 A;  2A5U A;  4CO7 A;  2DZJ A;  1F1H A;  2M19 A;  1V86 A;  4O1N A;  4WQO B;  1H8C A;  2K9X A;  4AS1 A;  1LFD A;  3AEC B;  1YX5 B;  2D2Q A;  4BOZ B;  1N61 A;  1J0G A;  3BK1 A;  1WGK A;  2WXG A;  2N1W A;  2GI9 A;  5E6P A;  3ZUN A;  4WWO A;  1L6U A;  2UU7 A;  3PRE A;  3RCZ A;  2LJI A;  4M01 A;  2BKF A;  2FCM A;  1L0V B;  1V1P A;  3AM9 A;  3HVZ A;  3ZW3 A;  3U52 E;  3PLV A;  3KWL A;  3N20 C;  3WIM A;  3NS1 A;  3RT3 B;  4MT5 A;  1RFK A;  1FEH A;  1HZ6 A;  2I38 A;  3FC4 A;  4HDO A;  4W9G A;  2JYT A;  3L16 A;  5CHV C;  2BGF A;  2RDG A;  3EC8 A;  5C23 A;  4NAW B;  3DHI C;  3PLU A;  4MGK E;  2X8X X;  3WAL A;  2BYF A;  2QJL A;  3AUL A;  2MX2 A;  5HFY A;  2XNA C;  5J17 A;  3HUI A;  1T0S C;  2ZVN A;  1WJ6 A;  3QHT A;  4TV3 A;  4JE3 B;  1ISN A;  2K25 A;  4E74 A;  3H7P A;  1FXT B;  3MC9 A;  1J7A A;  2PE9 A;  4FJY A;  3AB5 A;  3PZ8 A;  4I6N B;  3TSS A;  2KKC A;  1PYW D;  4DDI D;  3W1Y A;  4OZB A;  4DHZ B;  4GN1 A;  1WRD B;  1ENF A;  3SU8 X;  2NBW B;  4B95 A;  2K5P A;  2WDV B;  4KGS A;  4REZ A;  2KQ4 X;  1F2R C;  4LNN A;  2C7N B;  4LNK A;  1XLQ A;  2J0K A;  1ESF A;  3PV1 A;  3MHZ A;  1SIF A;  4LJP B;  3DBH B;  1P7E A;  3VFK A;  1VDV A;  4RGN A;  4IUM B;  1TS3 A;  1E7U A;  2PMV A;  4OVV A;  1FPY A;  3W9C B;  3P2B A;  1L0X B;  2R61 A;  1T0R C;  4PS8 A;  1I4Q A;  2HJ1 A;  1K52 A;  3CF6 E;  3T3N A;  3UIO B;  2EMT A;  2D3G A;  1SE9 A;  3ZTC A;  2KX3 A;  4TSS A;  2J42 A;  2JRI B;  4W9I A;  3RNE C;  1F77 A;  2LGY A;  2V4I B;  4JWS C;  2IO1 B;  3RNC C;  4YSY B;  5GMV A;  5JZE B;  1RYJ A;  3W1S C;  2C7H A;  3DWG C;  3VHT C;  5IA7 A;  1V2Y A;  3AH7 A;  4WWN A;  2IPK D;  2KWU B;  2WXL A;  4S17 A;  2DYO A;  2IGD A;  3ZRC A;  1GNU A;  2IGG A;  4PK1 A;  2LXC A;  4TQ0 A;  4EEW A;  3OAW A;  3V3X A;  1BT0 A;  1TYG B;  4D2K A;  4KKI A;  2H89 B;  1V80 A;  4G50 A;  2R2O A;  3BYT B;  2VZK B;  1FNV A;  1N5W A;  4ASW C;  5LXH A;  3EFU A;  1PFD A;  3V05 A;  3QJZ A;  1JWB D;  1GC6 A;  2BKR B;  3JVZ X;  3M95 A;  2JY6 A;  5CX3 A;  3P42 A;  3VVW B;  1YJ1 A;  1C9F A;  1WSP A;  5BO4 B;  2BQQ A;  2BB5 A;  4AWJ A;  1JQ4 A;  1ZXH A;  2D07 B;  2ZJD A;  3AE5 B;  1XT9 B;  1V5O A;  1FRD A;  4C7Y A;  1N5X A;  4II2 B;  1A5R A;  2JU6 X;  3BYY B;  3L08 A;  1YN4 A;  4KGR A;  4IWQ A;  2KJH B;  2LI5 A;  3DVN V;  1HTO A;  2FBW B;  4K7W A;  5CHW A;  4K7S A;  2LD9 A;  3KQ4 A;  2CR5 A;  3P4P B;  1IYF A;  1WFY A;  1ZDX A;  2PPH A;  4LDT B;  2KVZ A;  2BS2 B;  1IUE A;  4RMA A;  1PQS A;  4YTN B;  1NYQ A;  2ZW0 A;  5CHF A;  2K8C A;  4XYC A;  4YWG G;  3N1Y C;  3HIZ A;  4QAY A;  2XK5 A;  2E6X A;  2DX5 B;  4BBN F;  4FJZ A;  1WGY A;  3UF8 A;  2C7M B;  2WXO A;  1WE7 A;  3N1X C;  4WWP A;  2N9X A;  1KTK A;  2QIL A;  2MWS B;  3RFZ B;  2MCN B;  3W1S A;  2VZK D;  1ZKH A;  4KVG B;  2MH7 A;  2M4N A;  1SB3 C;  2PLP A;  4G11 A;  2PE6 B;  3OLM D;  3UI3 A;  2K8B A;  1WXV A;  2MA9 B;  1Q0W B;  3VRB B;  4DHZ E;  2KFK B;  2WWZ A;  3R8B A;  4GSW A;  3RZF A;  1TGZ B;  3KW5 B;  2WQY B;  4ICU A;  4LK0 M;  2FCS A;  1J7B A;  4F8C B;  3AEB B;  1J8C A;  4PYU A;  3ZQ4 A;  3Q3N C;  2AEH A;  4A55 A;  1FXI A;  3B08 A;  1C4A A;  4BVU C;  2IY0 B;  2N9K A;  2TSS A;  4MEM A;  1VZ8 A;  4M02 A;  2EEL A;  2O6V A;  2N9L A;  5D7G A;  3B2G A;  4LNI A;  4JWU C;  5GXG B;  2WU2 B;  1UWX A;  2O6V B;  1WH3 A;  2GBM A;  4WAF A;  1PGA A;  3PVL A;  3AE2 B;  1V6E A;  4LDT D;  3BY4 B;  4M0W A;  4JQW C;  4NPN A;  5MPO A;  1R7S A;  3BIN A;  2I1K A;  3L10 B;  4YTP B;  1ZPS A;  1OTR B;  4ANU A;  2JF5 A;  3PHX B;  2KX0 A;  1T5X D;  2IJ0 A;  2OJW A;  2V3N A;  4ARI A;  3A1Q A;  1VRA B;  3O13 A;  1JWM D;  3ZLZ A;  2LVP A;  2KQ7 A;  3RYT A;  3VUX A;  2FUH B;  2LRU A;  4A90 A;  3P4S B;  4G3X B;  1QF6 A;  3SD5 A;  4L1B A;  5IO9 A;  1ZUD 2;  4NAM A;  4IWP A;  2HTM E;  1I4P A;  1UEL A;  4NQK E;  4P1C C;  5IP4 D;  3NVY A;  2BB6 A;  4LNF A;  3CMM B;  4RFB A;  2L0T A;  1FM0 D;  2EMS A;  4TUU A;  3IHP C;  3SEB A;  1JWU D;  1KFY B;  4FUL A;  2JZZ A;  1MG4 A;  2L7R A;  4GDL A;  1XCQ L;  4LLG M;  3EHV A;  2WYQ A;  2EKI A;  3MC0 B;  3LDZ E;  5AZH A;  2MBB B;  2Y3A A;  3JW0 X;  2NVU I;  2G4D B;  3K9P B;  3VAW A;  3APF A;  3KVF B;  4EUT A;  4HKZ E;  3P4Q B;  2AYO B;  3Q3F A;  1VZ6 A;  3AI5 A;  4YTM B;  3RD2 A;  3EUB 2;  4N6E B;  4PS7 A;  3TMP B;  1EF5 A;  1N60 A;  2B76 B;  2O6V D;  2WXN A;  4N58 A;  2LMC A;  3ZDT A;  1WGD A;  2C60 A;  2KK8 A;  1YQ4 B;  2B3A A;  2KDM A;  1FIQ A;  2KTF A;  1V49 A;  1DOY A;  3X0W A;  1T0Y A;  1TKE A;  1E9M A;  4OZC A;  2RGF A;  1WJU A;  2IO3 B;  2C5L C;  4F1S A;  2V4L A;  2INP E;  4H2A A;  1UD7 A;  3IT4 B;  4IWO A;  3LYY A;  1WGH A;  4AP4 C;  2MBE A;  1SGH A;  2ON8 A;  4N59 A;  2CU3 A;  1V81 A;  5LXI B;  2DHZ A;  4GLS C;  2YEP F;  1E90 A;  1S3S G;  4DHJ B;  1J7C A;  2GBN A;  3AEG B;  1WZ3 A;  3APC A;  2Y5P A;  3BVM A;  1D5M C;  1GC7 A;  3AMZ A;  2FCQ A;  4DXG A;  1WR1 A;  2JWU A;  1C78 A;  3L13 A;  3LB8 C;  2XN9 C;  1TY2 A;  3T9L A;  1FRR A;  5FR6 A;  2BYV E;  2WXF A;  2W9N A;  4EOY A;  1MHX A;  1VLB A;  4BKS A;  4NZL B;  4B0E A;  4G0N B;  2WXP A;  1QT9 A;  4MGI E;  4NJ7 A;  2W55 A;  5AEK B;  4PYZ A;  2O2V B;  1YJJ A;  1OQY A;  4WH4 A;  3TEZ A;  4WWM A;  4AUQ C;  4ZRJ A;  4FXC A;  1U4A A;  3Q8F A;  1JWS D;  2KZR A;  3QAQ A;  1C3T A;  3WAM A;  1TTN A;  3NOB A;  2L1A A;  5DCN A;  4BAX A;  4KDI C;  4MJS A;  4LCD E;  4DXF A;  3EEC A;  1D6E C;  2KDB A;  4ZYS A;  2AQ3 B;  4FBJ B;  3DCG A;  4MJS B;  2MBQ A;  2WGS A;  1UUP A;  4URK A;  4DHJ D;  2HDE A;  2LGS A;  2Z59 B;  3QA8 A;  2KMA A;  5FR3 A;  4C56 C;  2INN E;  2W3R A;  1SE3 A;  3NY5 A;  3ZXR A;  1JCK B;  4YSZ B;  3PRP B;  1BXT A;  2MEK A;  2REX A;  4MGY E;  3L4P A;  4ITK A;  5EDS A;  1IGC A;  1T3Q A;  2DZI A;  2IGH A;  3IAS 1;  3DDC B;  2L3Z A;  4BKT A;  1EUV B;  2V9H A;  1N6Z A;  2WX0 A;  3IVF A;  3DWM A;  1YOV B;  4NAW A;  2KN4 A;  5EE1 A;  4K3C A;  2QSD A;  5DPR A;  2LEK A;  2ZCB A;  4HCP B;  2WU5 B;  4BKS D;  3BVZ A;  1YN5 A;  2Z0E B;  3AEE B;  4EFO A;  3OG5 A;  1P7F A;  1V8C A;  4NJC A;  4C00 A;  2FE8 A;  5KHQ A;  3KUC B;  4XDD A;  3B0A A;  4KKJ A;  4XZ4 A;  2QDF A;  1JWA D;  1WX7 A;  4FN2 A;  4RGM A;  2FAZ A;  2PVO D;  1GG3 A;  1E10 A;  1Q1O A;  3KYC D;  3R3M A;  2UYZ B;  2L83 A;  4EZK A;  5IN7 A;  2RMM A;  2NPT A;  3K9O B;  2KLG A;  2LHD A;  1I4H A;  1MPE A;  3U7Z A;  2QIE B;  4DQO C;  1TS4 A;  1VJK A;  3RMK C;  1Z2M A;  2NPT B;  3RZW C;  4N9F 4;  1E7V A;  1JML A;  2INC C;  2GMI C;  1BML C;  3DHH C;  2KWD A;  1NDD A;  2FIF A;  1LQB A;  4KSK C;  5AZF A;  3P1M A;  3RUL A;  5IAA C;  1EWY C;  1E8X A;  2KC1 A;  4IM2 A;  3FKY A;  2HJ8 A;  1ZP0 B;  1WYW B;  4NQL B;  2I1J A;  3GE3 C;  1OFF A;  1ROE A;  3W2D A;  1LXD A;  1N63 A;  1XXG A;  4EZJ A;  2N4F A;  3AU4 A;  3IT6 B;  4WUR A;  1D5Z C;  1WI0 A;  5BYR A;  2N7J A;  3KH0 A;  4MM3 A;  4MAC A;  4MGZ E;  3ZJV A;  1KH0 A;  2YVC A;  3GE8 C;  1EF1 A;  2DWQ A;  4C80 A;  1FCL A;  3LJ3 A;  1L2N A;  4MM3 B;  1WY8 A;  4X57 B;  4KSL C;  3ML9 A;  3PZD A;  5LNK 1;  3ZNZ B;  1P98 A;  3I57 A;  3MHS D;  1Q10 A;  4ANX A;  3H8H A;  2KQS A;  4KX6 B;  3NVZ A;  3ZRF A;  4E71 A;  3VTV A;  5AUK A;  3VR8 B;  4GB9 A;  3HM6 X;  1WYG A;  4LJO B;  1LGR A;  1MJD A;  4W9H A;  3V60 A;  4JLC A;  2WP9 B;  2MP2 B;  5CTR C;  4TMA B;  3NJT A;  3BVG A;  2PKO A;  4J3O D;  2D3A A;  3TCA A;  2CS4 A;  2KAC A;  3HM3 A;  4XWT A;  4BKG A;  2PW9 A;  3VH4 B;  2RD0 A;  4HVB A;  3PPA A;  2G1E A;  2DBY A;  3ZXV A;  3A9J A;  2V1Y A;  3AE6 B;  4KZC A;  3TL5 A;  2KTR A;  4IM3 A;  1TBE A;  1QQR A;  3ZNI D;  1WRI A;  3BK2 A;  2D10 A;  2L52 A;  4IG7 B;  3ABV B;  2JQR B;  3DQV A;  3A9J B;  4K81 A;  2KTR B;  3HK0 A;  2AWT A;  5DPW A;  4JPS A;  1WIA A;  1VD2 A;  1LO5 D;  3QCA A;  1N62 A;  3TIX A;  4KDL B;  5FK9 C;  3N3K B;  2ONQ A;  1P1A A;  2KJ6 A;  3U4E G;  3APD A;  2LUM A;  5HKH A;  3PRZ A;  3R2T A;  3UIP B;  4RH6 A;  2LGD A;  3T3O A;  2OJR A;  2L00 B;  2E3T A;  2ZCC A;  3Q14 C;  3V62 A;  1YIW A;  2BYE A;  2VH1 A;  2DAJ A;  1JW9 D;  3SFE B;  4YT0 B;  1NI3 A;  1OEY A;  1QKZ A;  2EKE C;  1ET9 A;  1GJZ A;  1MFW A;  1NEN B;  2ZNV B;  2JYE A;  4CQN A;  3JYU A;  2BTE A;  4YL8 A;  4M8M A;  2FCN A;  4ZHO A;  2N7E A;  3KUD B;  3U7D A;  1L5P A;  1NYR A;  2MLB A;  4MH8 A;  1WZ0 A;  2LWP A;  3Q8E A;  1QOF A;  3FIL A;  3ZTD A;  3WA0 A;  2HE7 A;  1YX6 B;  2KFK A;  2JZP A;  2PEA A;  5HI1 A;  4HCN B;  4XGA B;  5D2M B;  3M62 B;  4P16 A;  4OW0 A;  3FIL B;  4TQ1 A;  2MJ3 A;  3SDL C;  1D4B A;  4HPL B;  2DYM A;  1PGX A;  1E8Z A;  2KDI A;  1V1O A;  4YSX B;  1WE6 A;  3RNA C;  2N9P C;  1I4R A;  1SJH D;  1EO6 A;  2BT6 A;  4B6W A;  1I42 A;  3Q3J A;  3ZVV A;  2OOB B;  2KAJ A;  2K22 A;  4HXD A;  5G55 A;  1TZO A;  2W3S A;  3EA6 A;  3QWZ B;  3Q8B A;  5BMG A;  4BZA A;  4C4V B;  3BZD B;  2NBV B;  3DBR I;  2V3P A;  4KIK B;  1B1Z A;  5I4D A;  1E5W A;  2LHE A;  4OVU A;  4IC7 B;  3R7R A;  4DK5 A;  3WAP A;  2N7D A;  3ZIM A;  4B9K A;  2D11 A;  2R2Q A;  1WXS A;  4GGQ A;  2A4Z A;  1EM7 A;  1Q5W B;  1JRP A;  2NCN A;  4DDG D;  4HWI B;  4K1R B;  2JVC A;  3PO0 A;  3NHE B;  4ACF A;  2W82 A;  2KC2 A;  2NS5 A;  3AE8 B;  1PGB A;  2WDT B;  3FAH A;  1F9J A;  3EGR A;  2BS3 B;  4HLE A;  2AL3 A;  4K7U A;  2K0P A;  5AUI A;  1WX9 A;  4M8N A;  5JHB A;  4MH0 E;  2IND C;  2M8S A;  4KZ0 A;  3X23 A;  4US9 A;  2SAK A;  1UWM A;  2WHI A;  1BUI C;  3Q3O C;  1T6B X;  4ANV A;  2BS4 B;  2J0M A;  5J2R A;  3Q3M C;  4HRS A;  3N1Z C;  3W5U B;  2IYD B;  3NVV A;  3DVG X;  3AV8 A;  3PGE A;  1HA5 A;  3A9K B;  1EWC A;  4AJW A;  2MBO A;  1FO4 A;  5BMH A;  1YMH E;  2OHF A;  2PIA A;  2BYT A;  2J0J A;  2QC8 A;  4USA A;  5H92 C;  2K6Q A;  3PS6 A;  2KNB A;  2MBH A;  4W9L A;  1PDX A;  3JSV A;  5C1Z A;  2K39 A;  2YEP B;  1TT5 B;  5TR5 A;  3VR9 B;  2WXQ A;  4WJO A;  2BWE S;  5E6O A;  1UGM A;  1P9D U;  1XO3 A;  2OED A;  2VH2 A;  4AJY B;  3GB1 A;  4A3O A;  3WAO A;  1MHH E;  1F2R I;  3JSV B;  1L4D B;  1UZX B;  3VQI A;  3QC8 B;  5JHA A;  1WJN A;  3RN9 C;  1EU4 A;  1DOI A;  2PTL A;  3KLS X;  3NUH B;  1WMH B;  2KAN A;  4A3P A;  2KD0 A;  1TS5 A;  2JWZ A;  2CU1 A;  4EE2 A;  4IOI E;  2K3U A;  1SEB D;  3L0W B;  4ANW A;  2BBC A;  3MFG A;  4J6I A;  3I5J C;  4P6V F;  1IBX B;  1J19 A;  3R66 C;  1YN3 A;  3RNF C;  3ALB A;  4RM9 A;  4UDU C;  5H8Y E;  1K53 A;  3NVW A;  1JRO A;  4LNO A;  2BVC A;  3MJW A;  1P0R A;  4HPP A;  5L83 A;  1M94 A;  4K3B A;  1FCC C;  1Y56 A;  3NS8 A;  2XEW A;  2LVO A;  4S0R A;  2RDH A;  4ZRI A;  3AE9 B;  4GMV A;  1WM3 A;  3VRA B;  1D5X C;  2D3B A;  2WDQ B;  1FNW A;  2NR2 A;  4RCO A;  3J9C A;  2KLC A;  5G5H A;  1EU3 A;  2KT7 A;  2NTT A;  3OWE B;  2N9E B;  2RDB C;  1AYF A;  2NTS A;  1F0Z A;  4W9C A;  3E9S A;  3DOW A;  3VXW A;  3CSF A;  4RF0 A;  2JUO A;  3QX1 A;  3MJ5 A;  2MRP A;  1S1Q B;  2DYB A;  2G9H D;  2IO2 B;  2NMQ A;  2C9W B;  1FFU A;  1XQQ A;  2RSU A;  2WLB A;  1RRB A;  1ET6 A;  2O2V A;  1VZ7 A;  2KWV B;  1ZDV A;  2DZM A;  1TJE A;  1WGR A;  1L0Y B;  4E3C A;  2Q5W D;  2CJO A;  2LJ5 A;  5D3D A;  2Z0D B;  2ZZP B;  3BWU D;  4MEL A;  1F52 A;  3NG0 A;  3Q8C A;  4RF1 A;  1MI0 A;  1GUA B;  2K6D B;  2WNM A;  3PTF C;  2V0G A;  4ZOH C;  4A6Q A;  4L2Y A;  4W9J A;  2LVQ A;  4ZRQ A;  4ZRK A;  2GBR A;  3S2A A;  2QEJ C;  3AU5 A;  4NY0 A;  5D94 A;  3V61 A;  3QK0 A;  2CKH B;  2ZPY A;  3HVD A;  3C0R B;  5BMI A;  1JRU A;  2KJR A;  2W54 A;  2LZ6 A;  3C19 A;  3RI7 C;  1TKG A;  5EE3 A;  2G4S A;  1WF9 A;  2M0X A;  3M63 B;  2KDE B;  3C8Y A;  3Q6B A;  1E6E B;  4IKG A;  1B9R A;  2KOX A;  1ZGU B;  3TEX A;  4CHK A;  2CHW A;  2D3C A;  2KHW B;  2QCZ A;  2GBK A;  3HRD D;  3MC8 A;  3AE3 B;  1UNS A;  1ZE3 D;  5E6N A;  2RR9 A; 
#chains in the Genus database with same CATH homology
 4GXB A;  4JGH B;  3A9J A;  2V1Y A;  3TL5 A;  4KZC A;  3V6E B;  1LM8 B;  2O6V A;  2KTR A;  4FHK A;  1TBE A;  4IM3 A;  3VTW A;  3PRM B;  4HPM B;  4FA6 A;  5D7G A;  4FLH A;  3ZNI D;  3AXC A;  2D10 A;  4IG7 B;  2JZ3 B;  4I6L B;  4WJQ A;  4DBG A;  3DQV A;  3A9J B;  4XC2 A;  4K81 A;  1I35 A;  2O6V B;  2KTR B;  1WH3 A;  2LUE A;  2GBM A;  2YLM A;  3DBS A;  3ECI A;  3PVL A;  3HK0 A;  2AWT A;  1V6E A;  4LDT D;  3PT2 B;  4BBN C;  1WIA A;  3BY4 B;  4JQW C;  1VD2 A;  4WJP A;  5DPW A;  4NPN A;  5AZG A;  2M1M A;  3A33 B;  3O65 B;  3SHQ A;  3KYD D;  4ZDV A;  3BIN A;  1KLV A;  2I1K A;  3L10 B;  3QCA A;  4MSQ B;  3TIX A;  1OTR B;  4ANU A;  1IP9 A;  4KDL B;  3N3K B;  2JF5 A;  3UIN B;  3PHX B;  1P1A A;  2KMC A;  2KX0 A;  2KJ6 A;  2L05 A;  3APD A;  4FHJ A;  3A1Q A;  4HJK A;  2K1F A;  3ZLZ A;  1RFA A;  1WJ4 A;  2LVP A;  3H6N A;  4PS3 A;  5HKH A;  2LXA A;  2KQ7 A;  3PRZ A;  3ONS A;  3UIP B;  2LGD A;  2HTH A;  4FJV B;  1WR6 E;  2BPS A;  2OJR A;  4JL9 A;  4W9F A;  3RYT A;  3VUX A;  3DPD A;  2L00 B;  2KFJ A;  2FUH B;  2LRU A;  2MSE D;  4FAD A;  2ZCC A;  3V62 A;  4G3X B;  1YIW A;  2BYE A;  1UH6 A;  3SD5 A;  3H1U A;  2NBU A;  2DAJ A;  2LAS A;  4IWP A;  4F7Z A;  1UEL A;  3OJ4 B;  4NQK E;  3B1L X;  3H7P B;  4NJ6 A;  5D6J B;  5DPS A;  2ASQ A;  1OEY A;  2ZVO A;  2EKE C;  1RLF A;  1K8R B;  1GJZ A;  3CMM B;  1VCB A;  2L0T A;  2ZNV B;  1L7Y A;  2FNJ B;  2EMS A;  3V6C B;  4TUU A;  3JYU A;  2ZNV C;  3IHP C;  3CST A;  4IM0 A;  4I6P A;  4GDK A;  4FUL A;  4YL8 A;  2JZZ A;  4M8M A;  2FCN A;  1Y8R C;  1X1M A;  4WJN A;  2N7E A;  1AAR A;  3KUD B;  3PHW B;  3U7D A;  2L7R A;  4GDL A;  3ENE A;  2GBJ A;  4DXA B;  3L54 A;  4GDK B;  3EHV A;  3ZKJ C;  1V9J A;  2WYQ A;  3H9D A;  1KOT A;  5L95 C;  2MLB A;  1WZ0 A;  2LWP A;  3LDZ E;  4RM8 A;  5AZH A;  2MBB B;  3ZTD A;  1G6J A;  3JW0 X;  2NVU I;  2BF8 B;  2G4D B;  3K9P B;  3WA0 A;  4A20 A;  2HE7 A;  3VAW A;  3APF A;  1YX6 B;  2KFK A;  2KWC A;  3KVF B;  4EUT A;  2PEA A;  4HCN B;  5D2M B;  1R4M I;  3M62 B;  2K8H A;  5G2N A;  4CO7 A;  2A5U A;  4TQ1 A;  2AYO B;  2DZJ A;  3SDL C;  3Q3F A;  3AI5 A;  3RD2 A;  4HPL B;  2DYM A;  1V86 A;  3VDZ A;  1E8Z A;  4PS7 A;  2KDI A;  2IZV B;  3GOE A;  5DPT A;  1EF5 A;  2MP2 A;  3TMP B;  4WQO B;  1H8C A;  1WE6 A;  3TJP A;  4P7I A;  2O6V D;  2ZEQ A;  3ZDT A;  1LFD A;  1OEY J;  1WGD A;  2N9P C;  1EO6 A;  1YX5 B;  2C60 A;  2KK8 A;  2D2Q A;  4GIV A;  4BOZ B;  4B6W A;  1I42 A;  1J0G A;  3Q3J A;  4CYE A;  2B3A A;  3ZVV A;  3GZN I;  2OOB B;  2N1W A;  4HXD A;  5E6P A;  1OGW A;  5G55 A;  3VH3 B;  2KTF A;  3ZUN A;  1V49 A;  3UQB A;  3N32 A;  3X0W A;  1T0Y A;  4WWO A;  2IY1 B;  3QWZ B;  2RGF A;  1WJU A;  2IO3 B;  3PRE A;  3U8Z A;  2C5L C;  2RPQ A;  3RCZ A;  4F1S A;  2V4L A;  2BKF A;  1UD7 A;  2FCM A;  3NZS A;  4IWO A;  1WGH A;  2NBV B;  3DBR I;  3ZW3 A;  4AP4 C;  2MBE A;  1SGH A;  3PLV A;  3R7Q A;  3WIM A;  3RT3 B;  4KIK B;  1E5W A;  2QHO A;  1V81 A;  5LXI B;  2DHZ A;  3ML8 A;  4HDO A;  4W9G A;  4W9K A;  4OVU A;  4BOS C;  4IC7 B;  3QIJ A;  3H7S A;  3R7R A;  2N7D A;  3WAP A;  3L16 A;  3ZIM A;  1E90 A;  4B9K A;  4DK5 A;  2KO3 A;  1S3S G;  2D11 A;  2R2Q A;  5CHV C;  4DHJ B;  1WXS A;  4GGQ A;  1UBI A;  2A4Z A;  2BGF A;  3EC8 A;  2PJH A;  1Q5W B;  2GBN A;  4NAW B;  2NCN A;  5C23 A;  4HWI B;  4DDG D;  4K1R B;  3PLU A;  3L17 A;  1WZ3 A;  2M17 A;  4MGK E;  3APC A;  2JVC A;  3MTN B;  3NHE B;  3WAL A;  2BYF A;  2DZK A;  2KC2 A;  3AUL A;  2HD5 B;  2MX2 A;  2NS5 A;  1GC7 A;  5J17 A;  2WDT B;  2FCQ A;  1F9J A;  5JH5 C;  2ZVN A;  4HLE A;  2AL3 A;  4K7U A;  1UBQ A;  1WJ6 A;  1WR1 A;  3QHT A;  3D32 A;  3L13 A;  4JIO U;  4TKN A;  4TV3 A;  3T9L A;  1ISN A;  2K25 A;  3M3J A;  2VRR B;  5FR6 A;  4E74 A;  3H7P A;  1FXT B;  1XD3 B;  2BYV E;  2L8J A;  1WX9 A;  1NI2 A;  4M8N A;  5JHB A;  4MH0 E;  2PE9 A;  2W9N A;  4FJY A;  4EOY A;  2M8S A;  2KDF B;  4KZ0 A;  3ZNH B;  4EKU A;  4I6N B;  1MG8 A;  3X23 A;  2KKC A;  4BKS A;  4DDI D;  3W1Y A;  2FID A;  4G0N B;  4DHZ B;  2BWF A;  3VUW A;  4GN1 A;  4MGI E;  4ANV A;  2LRW A;  4II3 B;  4NJ7 A;  2J0M A;  1WRD B;  5J2R A;  5AEK B;  4PYZ A;  3SU8 X;  2NBW B;  4B95 A;  2IYD B;  4WAA A;  3DVG X;  2O2V B;  3PGE A;  2C7N B;  3A9K B;  1OQY A;  4AJW A;  1KJT A;  2J0K A;  3WAN A;  5J18 A;  2MBO A;  3PV1 A;  1YQB A;  1SIF A;  3TBL D;  4AUQ C;  4LJP B;  4ZRJ A;  1U4A A;  3RUI B;  2J0J A;  2DAF A;  2K6Q A;  3VFK A;  2KZR A;  3QAQ A;  3PS6 A;  2KNB A;  2MBH A;  4W9L A;  3JSV A;  4IUM B;  2K39 A;  2MW5 A;  5C1Z A;  1C3T A;  3WAM A;  1TTN A;  1E7U A;  2CHZ A;  3NOB A;  5TR5 A;  2KN5 A;  4OVV A;  2N1V A;  2BWE S;  4WJO A;  5E6O A;  5DCN A;  1UGM A;  1P9D U;  3P2B A;  4AJY B;  4PS8 A;  4A3O A;  3WAO A;  2JT4 B;  3JSV B;  4KDI C;  3QQ8 B;  1UZX B;  3CF6 E;  2J7Q B;  4MJS A;  4GOC A;  3QC8 B;  3VQI A;  4LCD E;  5JHA A;  1WJN A;  3EEC A;  3UIO B;  1IPG A;  2XK5 B;  2KDB A;  2EMT A;  1WMH B;  2KAN A;  4FBJ B;  4A3P A;  2D3G A;  3DCG A;  3ZO5 B;  1SE9 A;  2MBQ A;  4MJS B;  2KX3 A;  3ZTC A;  2KD0 A;  2JRI B;  2JWZ A;  4W9I A;  4DHJ D;  2CU1 A;  4URK A;  1ZW7 A;  2LGY A;  2Z59 B;  3QA8 A;  3DBH I;  1C1Y B;  3L0W B;  2KMA A;  4ANW A;  2IO1 B;  4XX5 A;  3DVN U;  2MQJ A;  3NY5 A;  5GMV A;  5JZE B;  4J6I A;  3W1S C;  2C7H A;  5IA7 A;  3VHT C;  3PRP B;  1V2Y A;  2REX A;  2L0F A;  4MGY E;  4WWN A;  2KWU B;  1J19 A;  1WX8 A;  1WGG A;  2DYO A;  3N30 A;  3R66 C;  3ZRC A;  1GNU A;  4KIK A;  3I3T B;  2LXC A;  4TQ0 A;  1QZE A;  3ALB A;  4EEW A;  3A4S C;  5EDS A;  4AOF A;  4RM9 A;  1Z5S B;  1P3Q U;  2DZI A;  3OAW A;  1BT0 A;  3DDC B;  1TZ1 A;  1V80 A;  2L3Z A;  4BKT A;  1EUV B;  3MJW A;  1P0R A;  4BFR A;  2WX0 A;  3IVF A;  5L83 A;  4W9E A;  4ZYN A;  1M94 A;  4HDQ A;  2WX1 A;  1D3Z A;  4NAW A;  4W9D A;  5LLI A;  4G50 A;  2R2O A;  3HHM A;  3NS8 A;  2XEW A;  4MSM B;  5DPR A;  2LVO A;  5KHO A;  4ASW C;  2ZCB A;  3DVG Y;  4NNJ B;  4HCP B;  5LXH A;  4BKS D;  3EFU A;  4ZRI A;  4GMV A;  1WM3 A;  2Z0E B;  2NR2 A;  3QJZ A;  4EFO A;  1KM7 A;  2KLC A;  1GC6 A;  4EZL A;  2BKR B;  3JVZ X;  3M95 A;  5KHQ A;  2JY6 A;  3KUC B;  2N9E B;  5CX3 A;  3VVW B;  3B0A A;  1YJ1 A;  4XZ4 A;  1WM2 A;  2G45 B;  3T8M A;  3KUZ A;  1WX7 A;  4FN2 A;  5BO4 B;  4MDK E;  4W9C A;  2FAZ A;  3ZNG C;  2JPH A;  1GG3 A;  3DOW A;  3VXW A;  3CSF A;  4AWJ A;  1Q1O A;  3KYC D;  2D07 B;  2ZJD A;  3R3M A;  2UYZ B;  2JUO A;  3QX1 A;  2MRP A;  2DYB A;  1S1Q B;  4EZK A;  2IO2 B;  2C9W B;  2NPT A;  3K9O B;  1XQQ A;  3A4R A;  2RSU A;  4M0W B;  2KLG A;  1RRB A;  1XT9 B;  2L76 A;  1V5O A;  2O2V A;  4II2 B;  3A9K A;  2DEN B;  2KWV B;  1A5R A;  1Z2M A;  2NPT B;  2DZM A;  3VUY A;  3L08 A;  1H4R A;  3RZW C;  4N9F 4;  1E7V A;  2IBI B;  3A1Q B;  1WGR A;  2GMI C;  1NBF C;  1HE8 A;  4E3C A;  4IWQ A;  2KJH B;  2LI5 A;  3DVN V;  3U30 A;  2LJ5 A;  4K7W A;  1NDD A;  2FIF A;  1LQB A;  5CHW A;  1WXM A;  4KSK C;  5AZF A;  4K7S A;  2LD9 A;  3UGB B;  2CR5 A;  2Z0D B;  3RUL A;  2ZZP B;  5IAA C;  1IYF A;  1WFY A;  1CMX B;  2PPH A;  4LDT B;  1E8X A;  1E8W A;  2KC1 A;  4IM2 A;  4MEL A;  4KV2 A;  2HJ8 A;  1GUA B;  4RMA A;  2K6D B;  1PQS A;  5CHF A;  1WYW B;  3PTF C;  4NQL B;  2K8C A;  2CHX A;  2I1J A;  3HIZ A;  1LXD A;  2XK5 A;  2KVR A;  2DX5 B;  4BBN F;  4EZJ A;  4W9J A;  4FJZ A;  1WMH A;  2N4F A;  3AU4 A;  4GU2 A;  1WGY A;  2LVQ A;  3UF8 A;  1WI0 A;  1V5T A;  3KH0 A;  2C7M B;  2KXJ A;  4MM3 A;  4MGZ E;  1WE7 A;  4WWP A;  4ZRK A;  2GBR A;  2N9X A;  3S2A A;  4ICV A;  2YVC A;  2MWS B;  3QAR A;  1EF1 A;  3AU5 A;  2MCN B;  3W1S A;  3LJ3 A;  4NY0 A;  5D94 A;  3V61 A;  3QK0 A;  2LGX A;  1ZKH A;  2CKH B;  2ZPY A;  2GOW A;  3OJ3 A;  4KVG B;  1L2N A;  1WY8 A;  4GDL B;  3C0R B;  4X57 B;  2M4N A;  1JRU A;  2UWQ A;  4KSL C;  2IO0 B;  3ML9 A;  3PZD A;  3ZNZ B;  1P98 A;  2JRH A;  1YD8 U;  2KJR A;  3MHS D;  2XBB C;  4G11 A;  3ZDM C;  4ANX A;  2KQS A;  2PE6 B;  2LZ6 A;  2V3S A;  3OLM D;  3UQA A;  3ZRF A;  4E71 A;  2G4S A;  2K8B A;  1WF9 A;  1R4N I;  1WXV A;  2M0X A;  2MA9 B;  1Q0W B;  3M63 B;  4IW0 A;  3VTV A;  4DHZ E;  2KDE B;  2KFK B;  4GB9 A;  2WWZ A;  3HM6 X;  4GSW A;  4LJO B;  3IG3 A;  2ZPN A;  3RZF A;  1TGZ B;  2Y5B B;  3KW5 B;  4ICU A;  2KOX A;  4W9H A;  3V60 A;  2FCS A;  4JLC A;  4F8C B;  2MP2 B;  5CTR C;  4DWF A;  1ZGU B;  3NZU A;  1WXA A;  3VTU A;  4CHK A;  2CHW A;  1J8C A;  4PYU A;  3PSE B;  2AL6 A;  2KHW B;  3TCA A;  1E8Y A;  2AEH A;  2CS4 A;  1RAX A;  3HM3 A;  2GBK A;  2JXX A;  3B08 A;  4BKG A;  4BVU C;  2IY0 B;  3VH4 B;  2RD0 A;  4HVB A;  3IBE A;  4MEM A;  2G3Q B;  3IFW B;  3PPA A;  5E6N A;  4HK2 A;  2RR9 A;  3DBL I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...