3NY5A

Crystal structure of the rbd domain of serine/threonine-protein kinase b-raf from homo sapiens. northeast structural genomics consortium target hr4694f
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
83
structure length
80
Chain Sequence
HMQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQKKPIGWDTDISWLTGEELHVEVLENVPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Serine/threonine-protein kinase B-raf
publication title Crystal structure of the RBD domain of serine/threonine-protein kinase B-raf from Homo sapiens.
rcsb
source organism Homo sapiens
total genus 17
structure length 80
sequence length 83
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ny5A01
5CHVC 4ICUA 4JGHB 1Q1OA 1T0YA 1E8WA 2CS4A 4WQOB 3RD2A 4WWOA 3ZVVA 1WM2A 2FCSA 2YLMA 5DPSA 1PQSA 3SU8X 1WYWB 2N9EB 1L7YA 2M17A 3DQVA 2ZVNA 3OJ3A 1TBEA 2KTRB 1NDDA 2G45B 1UD7A 4FHKA 3NZUA 1V6EA 4TV3A 4W9JA 2MCNB 1WMHA 2DX5B 4OVVA 1E8XA 4M0WB 2LGYA 4BKTA 4F1SA 4EOYA 3B1LX 4B6WA 4EFOA 5FR6A 1WMHB 2J0KA 2L8JA 3JYUA 4MSQB 1ISNA 3ZTCA 3ZRFA 2GBJA 2KX3A 2FCNA 2KC1A 3DBRI 3LJ3A 4IC7B 4KDLB 3U7DA 2JZ3B 4E3CA 1WXMA 3RCZA 3CF6E 3WIMA 2K6QA 2ZVOA 4IW0A 4GIVA 1Q0WB 3H1UA 2KMAA 4W9LA 4GU2A 2KXJA 2M1MA 4DXAB 2LVOA 2RPQA 1YX6B 4LDTB 3MTNB 4FJZA 4MELA 2UWQA 2G3QB 3UQBA 2J0JA 3K9PB 3L17A 1WXSA 2L7RA 4FADA 3AU4A 4LDTD 3L08A 1KLVA 2DZMA 2KN5A 3KW5B 1UBQA 3ZDTA 2KD0A 1WFYA 3BINA 4TQ1A 3A1QA 1WR1A 2NBUA 5D6JB 1WH3A 2KDIA 3QK0A 4F7ZA 1S3SG 3A1QB 1WE7A 2IZVB 3DVNU 5BO4B 2JRIB 3VUWA 3SHQA 4DDGD 4PS7A 4W9FA 1Z2MA 2DHZA 3ZDMC 1J0GA 2N1VA 4W9DA 5KHOA 2L3ZA 3L10B 3DDCB 2CKHB 1KJTA 5E6PA 1WGHA 5DPTA 3PREA 4BBNC 3UIOB 2BGFA 1WJNA 4II3B 1YQBA 2L76A 2C7HA 4ZDVA 2JT4B 1MG8A 4FBJB 3RT3B 4BKSA 1VCBA 4HVBA 2XK5A 1ZW7A 3TBLD 3QAQA 2IYDB 2ZEQA 3D32A 1KOTA 2XK5B 3ML9A 3U30A 1Z5SB 2CR5A 3QA8A 4NJ6A 3VAWA 1RRBA 5JHBA 2MBEA 2BKRB 4GDLA 5E6OA 3ZRCA 4BOSC 4FULA 3PT2B 3V62A 4BOZB 3QIJA 4GDLB 3ZNHB 2DZKA 2RSUA 2ZPNA 4IM3A 2ZNVB 2KNBA 3QC8B 1I42A 3DVNV 3OAWA 2IO2B 4G0NB 5C23A 3HM6X 1VD2A 4K7UA 3KUCB 1WXAA 4IG7B 3DOWA 2GMIC 2YVCA 2MW5A 2K6DB 2LUEA 2C60A 3IVFA 3PHXB 4WJOA 2WX0A 1ZGUB 1Y8RC 1E8YA 1I35A 4MEMA 3M3JA 5G55A 3TJPA 3H7PA 1NI2A 3ZTDA 1V81A 2AWTA 4FJYA 4XX5A 4ZRJA 4GSWA 3VTWA 3H7PB 2GBNA 5LXIB 1YIWA 3ZO5B 3V6EB 2V4LA 4FLHA 1H4RA 2MSED 3APCA 2KQ7A 4KSKC 2KC2A 4NPNA 4CO7A 3KYDD 2WYQA 1A5RA 3QHTA 4HXDA 2DAJA 4IWQA 2N4FA 4WAAA 4RM8A 3ZIMA 3ZW3A 1CMXB 4EUTA 2NR2A 2OOBB 4HCNB 3W1SA 1U4AA 3CSTA 5E6NA 3JSVA 1RAXA 2EKEC 2ZPYA 2EMTA 3HIZA 4GXBA 5D2MB 3JSVB 1NBFC 1QZEA 1E8ZA 2L0TA 2RR9A 2ZJDA 3TL5A 2IBIB 4GGQA 4MGYE 4W9EA 4HLEA 2LD9A 2LRWA 4K7SA 3VVWB 2HJ8A 2DYBA 3V61A 4TKNA 2Z0DB 3ZLZA 1WR6E 2JVCA 2HTHA 5GMVA 1EF1A 1P9DU 2M0XA 2G4SA 1H8CA 1J8CA 3UQAA 2EMSA 1JRUA 2KZRA 3TMPB 2ASQA 4ANVA 1SGHA 2LVQA 2D3GA 5CHWA 2JRHA 4K1RB 4W9KA 2BYEA 4KDIC 3ECIA 2WWZA 3H7SA 2LGDA 2NS5A 3IFWB 4EKUA 1E7VA 4EZLA 5AEKB 3H9DA 1L2NA 4HDOA 2LGXA 3EC8A 3IG3A 4MGIE 2JWZA 3PV1A 5G2NA 5J18A 3TIXA 1IPGA 2BWES 4PYUA 1FXTB 2KOXA 2CHZA 1WJUA 4E74A 5C1ZA 2FNJB 3UIPB 3B0AA 3ALBA 4ZYNA 5TR5A 2KDBA 4G50A 2M4NA 2FIDA 2M8SA 3NS8A 3RUIB 4DHZE 3NY5A 4URKA 1YJ1A 3ZNGC 4AJYB 2KWCA 5DCNA 1J19A 2D11A 3VQIA 4MSMB 3VHTC 1K8RB 3T8MA 1V5TA 1UELA 3BY4B 2MBQA 2PJHA 2KK8A 1E5WA 5DPRA 2K39A 4JQWC 1LXDA 4GN1A 1WE6A 4DDID 4II2B 3HK0A 2ZNVC 2JUOA 3UINB 1C3TA 5JH5C 2I1JA 2BYVE 1RLFA 4IWPA 4ANWA 2KDEB 1TZ1A 3A4RA 3DVGY 3NZSA 1E7UA 3X23A 3A9KA 3KH0A 4IM2A 2UYZB 2W9NA 2MLBA 3A9KB 2MWSB 3DBSA 3N3KB 4EZJA 5D94A 4YL8A 3DBLI 2K25A 2JF5A 3PTFC 2KJ6A 2BYFA 3T9LA 3DVGX 2MP2A 3PZDA 3EECA 2C5LC 2IY1B 2MP2B 2LASA 3JW0X 1OTRB 3PLUA 1BT0A 2KQSA 4BFRA 2K8HA 2C7NB 3N30A 2WDTB 4KZ0A 5HKHA 1OEYJ 3L54A 4B95A 2A5UA 2GBKA 4BKSD 2NVUI 2FAZA 3C0RB 4X57B 2LRUA 2REXA 2KWUB 1GNUA 4LJPB 4WWPA 2PEAA 4MM3A 4RM9A 1X1MA 5CX3A 1V2YA 2G4DB 1LM8B 4NJ7A 3AU5A 4GMVA 1WXVA 1P1AA 4IUMB 5DPWA 4HWIB 2KMCA 2MRPA 4G11A 2LI5A 2CHXA 2KJRA 1OQYA 4E71A 2L00B 4N9F4 3DPDA 3VFKA 3PRMB 4AWJA 4PS3A 2Z59B 3PPAA 4K81A 3R7QA 2LXCA 4WJQA 1M94A 4WWNA 1E90A 3KUZA 3QQ8B 4M8NA 1D3ZA 3W1YA 3SD5A 2BKFA 2J7QB 4HDQA 3IBEA 3ZKJC 2K8BA 3AXCA 2O6VA 2AEHA 3PVLA 3QJZA 4B9KA 3L13A 5AZFA 2KTFA 1UGMA 5JZEB 3V60A 2O6VB 2LZ6A 2FIFA 1WX9A 4NQLB 3QX1A 3IHPC 3L0WB 4K7WA 4J6IA 4AP4C 4FHJA 4GOCA 4FJVB 4MGZE 4ANUA 4HJKA 1Q5WB 3R7RA 3GOEA 3PSEB 2CHWA 2K8CA 2MBHA 3A9JA 5L95C 2I1KA 1TTNA 1UZXB 2D2QA 3A9JB 3A33B 4FA6A 2AL6A 1WRDB 4WJPA 2L0FA 4RMAA 1LFDA 2KO3A 4PYZA 2JXXA 2ZCCA 3VTVA 4A3OA 4NAWA 3HM3A 2GBMA 4AOFA 3WANA 4KSLC 2KANA 4DK5A 1XT9B 4DBGA 3KUDB 1V9JA 5CTRC 3L16A 2FCQA 2MA9B 3KVFB 4FN2A 4I6LB 4M8MA 5D7GA 3ZUNA 1OEYA 3N32A 3PLVA 3NOBA 3M62B 4HPMB 4KVGB 4MDKE 4DHZB 2DENB 2K1FA 5IA7A 3JVZX 1IP9A 2N7DA 4GDKA 2HD5B 3RZFA 2Y5BB 1F9JA 4KZCA 2KDFB 4GDKB 2KTRA 2R2QA 4ICVA 5J2RA 1P3QU 1S1QB 3H6NA 2LVPA 3SDLC 3ML8A 3QWZB 4CHKA 3M95A 2MBOA 4DWFA 2V1YA 2GBRA 4NQKE 2KX0A 3RULA 3WA0A 2LJ5A 3DBHI 3PHWB 4KIKA 4ZRIA 2D10A 3X0WA 2XBBC 5L83A 3NHEB 4AJWA 1YD8U 2KVRA 3RYTA 3PS6A 4KIKB 3WAPA 3TCAA 2RD0A 1IYFA 1WJ4A 2KJHB 4BVUC 1P0RA 3S2AA 4IM0A 1RFAA 1WGGA 2PE9A 3WALA 1WJ6A 3PGEA 4MGKE 3VDZA 3APFA 4TUUA 3VUXA 2LXAA 4AUQC 5KHQA 3VH4B 4BKGA 3Q3JA 1WIAA 3RZWC 5IAAC 2IO0B 2KFKA 2PPHA 2IY0B 4I6NB 2V3SA 4JIOU 1P98A 4MJSA 2KFKB 3P2BA 2IO3B 3OJ4B 3Q3FA 3DCGA 4MJSB 4W9HA 1GG3A 5LLIA 3B08A 3WAMA 4ASWC 2NBWB 2KFJA 2VRRB 2NBVB 2PE6B 4EZKA 3ENEA 2Z0EB 4EEWA 2C9WB 4LJOB 1WGRA 3EFUA 4HCPB 1SIFA 3VXWA 4PS8A 4LCDE 2ZZPB 1WF9A 2HE7A 2GOWA 3O65B 4NY0A 1C1YB 1ZKHA 1KM7A 3UGBB 5J17A 1V80A 1GUAB 2FUHB 2KLGA 3AULA 4GB9A 2CU1A 3VTUA 5EDSA 4KV2A 4W9IA 1UBIA 2B3AA 2BPSA 3MHSD 3LDZE 4TQ0A 3VH3B 2A4ZA 2WX1A 4I6PA 4XC2A 3ONSA 2RGFA 3APDA 4OVUA 1V86A 4DHJB 2N1WA 1WZ3A 3W1SC 2BWFA 4ANXA 1GC7A 3QARA 3R3MA 3MJWA 1R4NI 2D07B 4DHJD 4WJNA 1WI0A 3PRZA 2NPTA 1WM3A 2DZIA 1XD3B 3CMMB 2DAFA 5AZHA 4ZRKA 1WX8A 3ZNZB 1R4MI 1WGYA 2DZJA 2NPTB 3WAOA 4NNJB 3R66C 2KHWB 4P7IA 2JZZA 3OLMD 4A3PA 4F8CB 2J0MA 3GZNI 4CYEA 2NCNA 2FCMA 1GJZA 2DYOA 2JPHA 2L05A 2MQJA 1G6JA 2N9PC 4W9GA 2N7EA 2DYMA 2LWPA 2N9XA 3ZNID 1AARA 3K9OB 4HPLB 4MH0E 2JY6A 3V6CB 1WX7A 2MX2A 3KYCD 4W9CA 2O2VA 4HK2A 2KKCA 1EUVB 1SE9A 2O6VD 2O2VB 4JLCA 3M63B 3U8ZA 2KLCA 3I3TB 4IWOA 1TGZB 3A4SC 1HE8A 1UH6A 1EO6A 3HHMA 3EHVA 3VUYA 4A20A 5LXHA 1WY8A 1YX5B 2AL3A 2MBBB 2OJRA 1XQQA 1WZ0A 2QHOA 1V49A 5JHAA 1WGDA 3UF8A 3AI5A 2ZCBA 4NAWB 3CSFA 2KWVB 5AZGA 2BF8B 3PRPB 4JL9A 1GC6A 2C7MB 2R2OA 1LQBA 2XEWA 2AYOB 4G3XB 1V5OA 1OGWA 5CHFA 1EF5A 2IO1B 4BBNF 3QCAA 4XZ4A
chains in the Genus database with same CATH superfamily
3BYTB 5CHVC 1QF6A 3E9SA 3AV8A 1Q1OA 1E8WA 2DWQA 1DYQA 1WM2A 2YLMA 4ACFA 1FFUA 4JE3B 2ZVNA 1L4ZB 2MCNB 3DWGC 1FPYA 1WMHA 3MJ5A 4OVVA 4BKTA 4M0WB 1E0ZA 5BYQA 4B6WA 1ZXIA 4MSQB 2PTLA 3ZTCA 3ZRFA 2M0AA 2WHIA 2KC1A 1HTOA 3AH7A 2RPVA 4LK0M 3NRZA 3CF6E 3WIMA 1T0SC 1V8CA 1ROEA 4WH4A 2KMAA 2GRIA 4LDTB 3MTNB 4FJZA 1TJEA 2UWQA 2G3QB 2J0JA 3K9PB 1UWMA 3ZDTA 1WFYA 3BINA 3A1QA 3B2FA 3IXSA 2JWUA 1WH3A 3QK0A 4F7ZA 3DVNU 1TIFA 1Z2MA 4W9DA 5KHOA 1JALA 4US9A 3PREA 4BBNC 1OFFA 1YQBA 3R8BA 2L76A 2C7HA 4ZDVA 1MG8A 2MHJA 2KWDA 2IYDB 3DBRB 2ZEQA 3ML9A 3U30A 1Z5SB 1D4BA 3QA8A 3VAWA 1HQRD 2EKIA 4UDUC 3KWLA 4GDLA 1N60A 4FULA 3PT2B 3QIJA 4Q2JA 2DZKA 4JWUC 2RDGA 3AE1B 4IM3A 3QC8B 3DVNV 3NVZA 2IO2B 1VD2A 3KUCB 1GAQB 1VJKA 1WXAA 2CU3A 3I63C 3NG0A 2C60A 1VRAB 3PHXB 4WJOA 2L32A 2WX0A 3T3OA 1E8YA 3VR8B 5G55A 1V81A 2HTME 3Q14C 2GBNA 5IN7A 1YIWA 2V4LA 4KSKC 2KC2A 4NPNA 3KYDD 2WYQA 1A5RA 4HXDA 1N61A 4WAAA 3ZIMA 3Q6BA 2OOBB 4IDIA 3W1SA 1U4AA 1D5MC 3JSVA 5BYSA 3AEEB 1NBFC 1QZEA 2L0TA 3U4EG 3IT6B 2LD9A 2LRWA 4K7SA 3V61A 3DHGC 4P1CC 2YEPB 2M0XA 1J8CA 3TMPB 4K1RB 4W9KA 5C2TB 2NS5A 1E7VA 1XXGA 3LB8C 2D3CA 4HDOA 3IG3A 2JWZA 4RNAA 4KGRA 3AEGB 1TKEA 3FKYA 2W55A 3B0AA 3MHZA 2M4NA 2LGSA 4LNKA 1Y56A 4URKA 3ZNGC 2W3SA 1K8RB 1UELA 2KK8A 4XWTA 4ARIA 2K39A 1WE6A 5JH5C 4IWPA 1F0ZA 4ANWA 2KDEB 3DVGY 1ET9A 3A9KA 3N1ZC 3KH0A 1V97A 2QDFA 2MLBA 5AUIA 1C79A 3N3KB 4KKIA 5D94A 1JWSD 2OJWA 2MP2A 2J52A 1BT0A 4BFRA 1SJHD 2WDTB 5HKHA 4NJCA 1YJJA 4BKSD 2NVUI 3HRDD 2AQ2B 4X57B 2KWUB 1GNUA 2JYEA 1X1MA 5CX3A 2G4DB 3BZDB 3AU5A 4GMVA 4ZYSA 3N9YC 4IUMB 4HWIB 2WXHA 3RPFC 4N9F4 4PS3A 3PPAA 1F2RC 4WJQA 1E90A 3QQ8B 3AEDB 1D3ZA 1DGJA 2KMMA 3SD5A 4HDQA 3AXCA 4WWMA 5AZFA 5JZEB 1BMLC 3DBLB 2FIFA 1WX9A 3ZJVA 3L0WB 4L23A 4FHJA 4GOCA 3MC0B 3RNBC 3R7RA 2CHWA 2K8CA 2PIAA 2MBHA 2I1KA 1TTNA 2XNAC 1IGCA 2D2QA 2N7JA 3GS2A 3TEXA 2VH2A 4XDCA 4A55A 3AE6B 4O1NA 2JXXA 2ZCCA 4PYZA 2LFIA 3VTVA 2GBMA 3V05A 4KSLC 2KYWA 3R2TA 1TS5A 5CTRC 3L16A 4EE2A 3Q69A 5D7GA 1OEYA 3NVYA 2BYTA 2WXPA 4KGSA 2WU5B 4JX1C 4KZCA 2KDFB 1E9MA 2PW9A 4LNFA 5J2RA 2LVPA 4H2AA 3ML8A 3M95A 4M0WA 1F1HA 3Q8CA 4NQKE 3IT4B 3WA0A 4YTNB 3PHWB 4ZRIA 2HJ1A 1IYFA 3WAPA 4KIKB 1OQRA 5FR3A 3AN1A 4IM0A 2E6XA 1WJ6A 3PGEA 3VDZA 3URYA 2MEKA 4BKGA 1WIAA 2IO0B 2V3SA 4MJSA 2KVZA 5HI1A 4ASWC 1EU4A 3B08A 1GB4A 1ZE3D 2KFJA 4RH6A 4EZKA 5T8IA 3ENEA 1C4CA 1XLQA 4BZAA 1ZKHA 5J17A 2KLGA 3VTUA 4KV2A 1HEZE 2WDVB 1NVID 1XEEA 3VH3B 2JZPA 4DHJB 2N1WA 3W1SC 2BWFA 1R4NI 4WQMA 1WI0A 3MFGA 2IGHA 1TY2A 1TT5B 1DOXA 1BUIC 2WXFA 3CMMB 1WX8A 4A3PA 3OLMD 3ZXVA 1GJZA 2JPHA 2RDHA 2N9PC 1D5XC 1UWXA 2N9XA 4HPLB 2JY6A 3V6CB 1WX7A 1F2RI 2XN9C 3PZ7A 2O6VD 2O2VB 3U52E 2LMCA 4HKQA 3Q3NC 3I3TB 4OZAA 3A4SC 4ITKA 1HE8A 1QOBA 2V9HA 1EO6A 2AL3A 3RNFC 1QOAA 4RGTA 1ZUD2 4KKJA 3PRPB 2XEWA 4HJGE 3W9CB 1FFVA 3FILB 1R4MB 5CHFA 4BBNF 4RGNA 2BS4B 4ICUA 3PZ8A 1T0YA 2X8XX 4WQOB 3RD2A 4K3CA 3KLSX 3VRAB 5DPSA 1YJIA 2N9EB 1L7YA 2M17A 3DQVA 2NTTA 5E6JA 1NDDA 1UD7A 4W9JA 3NZUA 4F1SA 1E8XA 2LGYA 5BMIA 4PK1A 1I4RA 4JPSA 5FR6A 1SEBD 3HVDA 2GBJA 2BQQA 4KDLB 3LJ3A 4S0RA 1N6ZA 1P7EA 3RI7C 3U7DA 4E3CA 3RCZA 2K6QA 4IW0A 4ZRPA 4W9LA 3N1XC 2M1MA 4RF0A 2RPQA 1J7CA 4MELA 3L17A 1C78A 3L08A 2KN5A 2NTSA 2FBWB 4TQ1A 2MJ3A 2NBUA 2W82A 2IZVB 2K9XA 2G1EA 3BWUD 3ZDMC 2N1VA 2L3ZA 1KJTA 5BMGA 2WXJA 1YN5A 1EU3A 1WJNA 4LNIA 4II3B 3RNAC 5JXVA 2XK5B 2K3UA 1FEHA 1EWYC 2AQ3B 2GI9A 1NYQA 4XDDA 4WIPA 2RSUA 1JRPA 1MHXA 3OAWA 4G0NB 3HM6X 1FO4A 2MW5A 4D2KA 1Y8RC 3FC4A 1I35A 1TKYA 4MEMA 2M19A 1NI2A 3ZTDA 2AWTA 3H7PB 5D3DA 3ZO5B 3V6EB 1YMHE 2MSED 4CO7A 2DAJA 2N4FA 1D6EC 1SJED 3ZW3A 1MI0A 4EUTA 4HCNB 2NR2A 3CSTA 5E6NA 2EKEC 2DLBA 1I7HA 3SFDB 1C77A 2ZJDA 3TL5A 2IBIB 4W9EA 1C4AA 2DYBA 4TKNA 3GE8C 3ZLZA 2HTHA 5GMVA 3U7ZA 1EF1A 1P9DU 2G4SA 2HDEA 2EMSA 3RNGC 2ASQA 2BYEA 4KDIC 2WWZA 3H7SA 5AEKB 1GOZA 4JWSC 3H9DA 3BVZA 1TY0A 2JXTA 4KX6B 3TIXA 4C4VB 5J18A 1FRDA 3LXFA 1SF0A 2FNJB 3UIPB 4OZCA 3CWIA 1MJDA 3W5VB 2BB5A 1WXQA 4LNOA 2KWCA 5DCNA 1J19A 2D11A 4P6VF 3BY4B 2MBQA 3EGRA 5DPRA 2Q5WD 4K3BA 5G5GA 1P7FA 3UINB 1C3TA 1KF6B 3KWVA 2UYZB 3DBSA 5EE9A 2LGIA 3PTFC 3T9LA 3DVGX 3EECA 2IY1B 2LASA 1YQ4B 1V1PA 2KQSA 1C9FA 4KZ0A 4B95A 1QOGA 2A5UA 2GBKA 2LRUA 4WWPA 3ZYYX 3GB1A 1STEA 2Y5PA 1V2YA 4MM3B 2DBYA 4NJ7A 1P1AA 1RFKA 2KMCA 3P63A 2CHXA 2KJRA 2L00B 3AM9A 3RMKC 4PT5A 3VFKA 2SEBD 4M8NA 2J7QB 1XCQL 3W2DA 1WYGA 2K8BA 2AEHA 2O6VB 3E56A 3IHPC 1T6BX 2R61A 2UU7A 2J53A 4FJVB 3DHHC 4HJKA 3AE4B 3C19A 3A9JA 2INNE 2NMQA 2Y5CA 2AL6A 2AX5A 4OZBA 2L0FA 4RMAA 1LFDA 4AQ7A 1IBXB 1ET6A 4YT0B 3HM3A 3TUOA 4GLSC 2Z8LA 3KUDB 1OQQA 3KVFB 3V3XA 4FN2A 3N32A 2J42A 1FCCC 1C76A 2WXRA 1IGDA 3JVZX 1HTQA 4HRSA 4XE0A 4RCOA 2INPE 3PO0A 4A90A 2WDQB 4GDKB 2R2QA 2L52A 3SDLC 3H6NA 2GBRA 1KTKA 1LO5D 1WRIA 1KLUD 3DBHI 1MG4A 3AB5A 2XBBC 3NHEB 3VR9B 3PS6A 3TCAA 2RD0A 2KJHB 4BVUC 1WGGA 4TUUA 2LXAA 2JX5A 2PPHA 1CZPA 2KFKA 1AN8A 2IY0B 3N1YC 4I6NB 4JIOU 1RM6C 3P2BA 1K52A 4W9HA 4EEWA 2C9WB 3EFUA 4HCPB 1SIFA 1KFYB 2VH1A 1WF9A 2GOWA 1AW7A 1YNTE 4OHJA 1V80A 4XGAB 1XLNA 4W9IA 2SAKA 2BPSA 1SE2A 2WX1A 4XC2A 1RWSA 4OVUA 1V86A 4HEA1 4IKGA 1WZ3A 3MJWA 1FIQA 1XLOA 1CJEA 2FUG1 2NPTA 2KAJA 3IAM1 3SEBA 5AZHA 3GP7A 3WAOA 1FNVA 2JZZA 2J0MA 4CYEA 5BYRA 2FCMA 3AE2B 2FE8A 1I4HA 1G6JA 3U2SC 3NVVA 2N7EA 2DYMA 2MJEA 3BVGA 2RMMA 4N58A 1KRHA 3KYCD 1EUVB 1SE9A 2BS2B 3Q2AC 3EHVA 3C8YA 4A20A 4OW0A 1YX5B 2OJRA 4C00A 4YTMB 4WAFA 1V49A 1WGDA 2KACA 1R4NB 3CSFA 2KQ4X 4NAWB 1LQBA 1PGXA 2AYOB 5BMHA 1V5OA 5HHDG 2VZKD 1E6EB 3AE9B 4A8XC 1EF5A 2ONQA 4XZ4A 3NS1A 1UF0A 1L4DB 4JGHB 2CS4A 3N20C 1DOIA 3ZVVA 4OVZA 3ABVB 3W5UB 3WCQA 3SU8X 3OJ3A 1L0XB 3ZGZA 1TBEA 2G45B 4YTPB 1I4QA 4TV3A 4DQOC 2DX5B 2OEDA 5MPOA 4EOYA 3B1LX 4EFOA 4LNNA 4C4VA 1WMHB 2J0KA 1ISNA 2KX3A 2FCNA 1WXMA 4GIVA 1Q0WB 3H1UA 2WDRB 4XWWA 4GU2A 2KXJA 4DXAB 2LVOA 1YX6B 4AS1A 1A70A 3ZQ4A 4FADA 2WXNA 4LDTD 1KLVA 2DZMA 1UBQA 1F52A 2CJOA 1N5WA 5D6JB 3A1QB 1WE7A 2QC8A 3VUWA 3SHQA 1TS3A 4PS7A 3I5JC 3BIID 2DHZA 4M02A 1TYGB 3L10B 3DDCB 1MHHE 2CKHB 1WGHA 5DPTA 5IKCM 3DWMA 3TEYA 2L83A 3UIOB 2BGFA 4MT5A 2JT4B 3TBLD 1ACCA 1VZ6A 1SXTA 3D32A 1QKZA 1RRBA 2MBEA 2BKRB 5E6OA 3ZRCA 1JWMD 1TKGA 4BOZB 4GDLB 3ZNHB 2ZNVB 4B0MA 2BVCA 4RGMA 4K7UA 2WGSA 4IG7B 2GMIC 2YVCA 1HA5A 5IP4D 3IVFA 5G5HA 1L6VA 3M3JA 1QILA 3TJPA 4FJYA 4GSWA 3VTWA 1GPXA 2W3RA 4FLHA 2V3PA 2KQ7A 2LEKA 1WGKA 3QHTA 1ESFA 5GXGB 3P4SB 1ZPSA 1J7BA 1V1OA 4FXCA 1RAXA 2INDC 2ZPYA 2EMTA 4GXBA 5D2MB 3JSVB 1E8ZA 2RR9A 2QILA 4GGQA 4HLEA 1IBXA 2E3TA 1XF5L 1H8CA 3UQAA 1SGHA 2D3GA 5CHWA 4B0EA 4CQNA 4EKUA 1K50A 1K53A 2LGXA 2WXMA 1JW9D 4MGIE 4L1BA 1IPGA 4US8A 4PYUA 4ARCA 2KOXA 3AE7B 1WJUA 5TR5A 4ZYNA 2FIDA 1I4XA 3NS8A 2BTEA 3VQIA 2V4IB 4MSMB 1V5TA 4C80A 4NZLB 1E5WA 4ZOHC 4C56C 1FNWA 3HK0A 2PVOD 3J9CA 3ZJUA 1RLFA 3MC9A 3RFZB 3A4RA 3NZSA 2KT7A 5AUKA 2W9NA 3A9KB 2DNFA 1FMAD 2KJ6A 4P16A 2BYFA 3NJTA 1GB1A 2WNMA 5HFYA 2C5LC 2BBCA 2MP2B 3JW0X 2EELA 2C7NB 1OEYJ 1HZ6A 2H88B 4RF1A 3ETRA 2FAZA 4LJPB 4YSYB 2QMTA 4USAA 2PEAA 5EE1A 1NENB 3P4PB 4KGTA 1WXVA 3BK1A 1FM0D 2N0SB 4G11A 2ACZB 1PFDA 2D3AA 2LXCA 1M94A 4L2YA 4WWNA 1IUEA 2BKFA 3PVLA 4B9KA 3Q8AA 5D3IB 3L13A 1ZXHA 2KTFA 3LYYA 4NQLB 1WSPA 4MGZE 1D5ZC 1FRRA 1Q5WB 3Q3OC 1ZP0B 3GOEA 3PSEB 2LHEA 2ON8A 1N5XA 1WWTA 3BYYB 1DOYA 2BB6A 5L95C 1UZXB 2IJ0A 3A33B 4FA6A 1F77A 2KO3A 2WXGA 4NAWA 2KANA 1K51A 1XT9B 2VZKB 3P1MA 4I6LB 4M8MA 1B1ZA 3ZUNA 2V3NA 4REZA 3NOBA 4MDKE 4HPMB 4KVGB 2DENB 4N6EB 1IP9A 2N7DA 4N59A 2HD5B 3RZFA 2Y5BB 1NI3A 1F9JA 1JWBD 5IOIA 1P3QU 1JWAD 2IDYA 4ZHPA 2V1YA 3FAHA 3EUB2 2KX0A 3RULA 5C3JB 1JMLA 2LUMA 4KIKA 4HPPA 1YD8U 2KVRA 4A9AA 1P0RA 3S2AA 1RFAA 2PE9A 4AUQC 4MGKE 3MP9A 1FXIA 1N62A 5KHQA 3VH4B 3Q3JA 5IAAC 1P98A 1QLBB 3Q3FA 2IO3B 3OJ4B 4MJSB 5LLIA 1GG3A 2J4XA 3WAMA 2NBWB 2VRRB 3I57A 1WGRA 3VXWA 4PS8A 2HE7A 3O65B 4NY0A 4YWGG 3B2GA 1KM7A 5EE3A 3UGBB 4YXDB 2FUHB 3AE8B 4M00A 3AULA 4GB9A 4M01A 5EDSA 1XLPA 4C7ZA 2H89B 1UBIA 1J7AA 2B3AA 2BT6A 3MHSD 2PLPA 3LDZE 4TQ0A 2A4ZA 2MJDA 3R3MA 3DBHB 2D07B 4DHJD 4WJNA 1VZ7A 3KQ4A 2AQ1B 3PRZA 1WM3A 2DZIA 1XD3B 2DAFA 3ZNZB 3RNEC 3R66C 3NVWA 3GZNI 2NCNA 2MQJA 1QQRA 2X38A 4RFBA 3ZNID 4MH8A 1AARA 2JSVX 2MX2A 2O2VA 4HK2A 2KKCA 3AECB 1YN4A 2IGGA 2KN4A 3U8ZA 2KLCA 4IWOA 1TGZB 1EM7A 5I4DA 3BVMA 3VUYA 1EWCA 1WY8A 1XQQA 2D3BA 2QHOA 4J3OD 2WXIA 3UF8A 2W54A 2ZCBA 5AZGA 1JQ4A 1TZOA 2KWVB 2BF8B 3EFCA 3NZ3A 3FILA 2R2OA 4P1BC 3BK2A 3B9JA 1OGWA 3H8HA 2IO1B 3TEWA 4WWOA 2FCSA 1PQSA 3VRBB 1WYWB 1NEKB 1HZ5A 4WURA 1FD6A 4S17A 2KTRB 4TMAB 4FHKA 1V6EA 1C4PA 1B9RA 2L8JA 3RNCC 3JYUA 2I2YA 2MH7A 1L0VB 1ZDVA 3TEZA 3DBRI 4IC7B 1T3QA 2JZ3B 2ZVOA 2PKOA 1SIJA 3UQBA 3DHIC 1WXSA 2L7RA 3AU4A 5TSSA 1ZDXA 3KW5B 2KD0A 1WR1A 1SE4A 2ICIA 2KDIA 1N63A 1S3SG 3AEFB 5BO4B 2JRIB 3I9V1 4DDGD 4W9FA 1E10A 1SB3C 1J0GA 2RDBC 3L4PA 1VLBA 5E6PA 4FBJB 3RT3B 4BKSA 1VCBA 4HVBA 2XK5A 1ZW7A 4R3DA 3QAQA 2QEJC 4NAMA 1KOTA 4RGOS 1YQ3B 1L5PA 2CR5A 4NJ6A 1FCLA 5JHBA 3NUHB 2BW2A 1YOVB 4BOSC 3V62A 2ZPNA 3P42A 1MPEA 2KNBA 3O13A 1I42A 5C23A 1SE3A 4ZHOA 4DXFA 3DOWA 3Q8FA 1ZOYB 2K6DB 3AMZA 2LUEA 1R7SA 4HROA 1ZGUB 5IO9A 1CQVA 3CIRB 2QCZA 3H7PA 4XX5A 4ZRJA 5LXIB 1H4RA 3APCA 4IWQA 4RM8A 1CMXB 1T0QC 2KDMA 3IAS1 3HIZA 1T0RC 1BXTA 4MGYE 3VVWB 2HJ8A 4IOIE 2Z0DB 1WR6E 2JVCA 2I38A 1NYRA 1LGRA 2KZRA 1JRUA 4ANVA 3AE3B 2CJNA 2LVQA 2JRHA 3ECIA 2LGDA 3IFWB 4EZLA 4YSZB 1L2NA 3EC8A 3PV1A 5G2NA 2BWES 1Q10A 2GB1A 1FXTB 2CHZA 4E74A 5C1ZA 3ALBA 1YN3A 2KDBA 4G50A 1CK1A 2M8SA 3RUIB 4DHZE 2WXLA 3NY5A 1YJ1A 4AJYB 2PVGC 3VHTC 3T8MA 2PJHA 3MC8A 1MFWA 4JQWC 2WXKA 1LXDA 4GN1A 4DDID 4HKZE 4II2B 2ZNVC 2JUOA 2PMVA 2I1JA 2LHDA 2BYVE 1TZ1A 3X23A 1E7UA 1L6UA 4IM2A 2WXOA 2BS3B 1PGAA 2MWSB 2WP9B 4YL8A 3DBLI 2K25A 2JF5A 2V0GA 1KLGD 3PZDA 3AE5B 1OTRB 3PLUA 2K8HA 2WQYB 3N30A 1V1PB 3Q3MC 3L54A 1FNUA 3C0RB 2REXA 2WS3B 2JQRB 5H8YE 3OG5A 4MM3A 4RM9A 1MVKA 5EE0A 1LM8B 4C7YA 5DPWA 4LTUA 2MRPA 2LI5A 4E71A 1OQYA 2TSSA 1JCKB 3DPDA 3PRMB 4AWJA 3T3NA 3P4RB 2Z59B 4K81A 3R7QA 1PYWD 2INCC 3KUZA 1QT9A 1HXYD 2WU2B 3W1YA 4BAXA 2WLBA 3IBEA 2Y3AA 3ZKJC 2O6VA 3QJZA 1UGMA 3V60A 4LLGM 2LZ6A 3QX1A 4K7WA 4J6IA 4AP4C 4ANUA 1KH0A 3ZJTA 3A9JB 3TSSA 1WRDB 4WJPA 5FKAC 2ZW1A 4TSSA 4A3OA 1ENFA 3WANA 4AOFA 4DK5A 1I4PA 3OWEB 2LJIA 4DBGA 1V9JA 2IGDA 2N9KA 4A6QA 2FCQA 2MA9B 1JROA 3RN9C 1SSNA 2N9LA 3PLVA 1RYJA 3M62B 4DHZB 2K1FA 2WXQA 5IA7A 1UNSA 2K0PA 4GDKA 1UGJA 2YEPF 2KTRA 3AEAB 1QOFA 4ICVA 1S1QB 4CHKA 3QWZB 2MBOA 4DWFA 2ZW0A 4XYCA 2LJ5A 1SBBB 3X0WA 2D10A 5L83A 1TS4A 3R2IA 3HVZA 4AJWA 3RYTA 3Q8BA 2JYTA 1WJ4A 3AEBB 3P4QB 3WALA 2OHFA 1TS2A 3VUXA 3APFA 1FXAA 3RZWC 3HUIA 5FK9C 2KFKB 3DCGA 2JU6X 2NBVB 2PE6B 1VZ8A 2Z0EB 4LJOB 1M4VA 2ZZPB 4LCDE 1C1YB 1T5XD 1AWDA 2GLSA 1GUAB 5HG2A 2CU1A 3UI3A 1XO3A 1JWUD 2L1AA 4I6PA 2K22A 3ONSA 2RGFA 3APDA 4ANXA 1GC7A 3QARA 2D5GA 4EZJA 4ZRKA 3ZXRA 1R4MI 1WGYA 2DZJA 2NPTB 4NNJB 3EA6A 2KHWB 4P7IA 4F8CB 5LNK1 1I4GA 3Q8EA 2DYOA 2L05A 1PDXA 1PUTA 4W9GA 1UUPA 1VDVA 2LWPA 1PGBA 4MACA 4ZRQA 2K5PA 4MH0E 3K9OB 2QSDA 1L0YB 4W9CA 3SFEB 2G9HD 4JLCA 3M63B 2QIEB 1XCTL 4YSXB 1UH6A 2M56B 3HHMA 5LXHA 2MBBB 1AYFA 4QAYA 1E7PB 3GE3C 2B76B 1WZ0A 5JHAA 4DXGA 3AI5A 5H92C 2IPKD 4JL9A 1VR9A 3SR6A 1GC6A 2C7MB 2QJLA 4G3XB 3QCAA 3GZNB
chains in the Genus database with same CATH topology
5CHVC 4ICUA 4JGHB 1Q1OA 1T0YA 1E8WA 2CS4A 4WQOB 3RD2A 4WWOA 3ZVVA 1WM2A 2FCSA 2YLMA 5DPSA 1PQSA 3SU8X 1WYWB 2N9EB 1L7YA 2M17A 3DQVA 2ZVNA 3OJ3A 1TBEA 2KTRB 1NDDA 2G45B 1UD7A 4FHKA 3NZUA 1V6EA 4TV3A 4W9JA 2MCNB 1WMHA 2DX5B 4OVVA 1E8XA 4M0WB 2LGYA 4BKTA 4F1SA 4EOYA 3B1LX 4B6WA 4EFOA 5FR6A 1WMHB 2J0KA 2L8JA 3JYUA 4MSQB 1ISNA 3ZTCA 3ZRFA 2GBJA 2KX3A 2FCNA 2KC1A 3DBRI 3LJ3A 4IC7B 4KDLB 3U7DA 2JZ3B 4E3CA 1WXMA 3RCZA 3CF6E 3WIMA 2K6QA 2ZVOA 4IW0A 4GIVA 1Q0WB 3H1UA 2KMAA 4W9LA 4GU2A 2KXJA 2M1MA 4DXAB 2LVOA 2RPQA 1YX6B 4LDTB 3MTNB 4FJZA 4MELA 2UWQA 2G3QB 3UQBA 2J0JA 3K9PB 3L17A 1WXSA 2L7RA 4FADA 3AU4A 4LDTD 3L08A 1KLVA 2DZMA 2KN5A 3KW5B 1UBQA 3ZDTA 2KD0A 1WFYA 3BINA 4TQ1A 3A1QA 1WR1A 2NBUA 5D6JB 1WH3A 2KDIA 3QK0A 4F7ZA 1S3SG 3A1QB 1WE7A 2IZVB 3DVNU 5BO4B 2JRIB 3VUWA 3SHQA 4DDGD 4PS7A 4W9FA 1Z2MA 2DHZA 3ZDMC 1J0GA 2N1VA 4W9DA 5KHOA 2L3ZA 3L10B 3DDCB 2CKHB 1KJTA 5E6PA 1WGHA 5DPTA 3PREA 4BBNC 3UIOB 2BGFA 1WJNA 4II3B 1YQBA 2L76A 2C7HA 4ZDVA 2JT4B 1MG8A 4FBJB 3RT3B 4BKSA 1VCBA 4HVBA 2XK5A 1ZW7A 3TBLD 3QAQA 2IYDB 2ZEQA 3D32A 1KOTA 2XK5B 3ML9A 3U30A 1Z5SB 2CR5A 3QA8A 4NJ6A 3VAWA 1RRBA 5JHBA 2MBEA 2BKRB 4GDLA 5E6OA 3ZRCA 4BOSC 4FULA 3PT2B 3V62A 4BOZB 3QIJA 4GDLB 3ZNHB 2DZKA 2RSUA 2ZPNA 4IM3A 2ZNVB 2KNBA 3QC8B 1I42A 3DVNV 3OAWA 2IO2B 4G0NB 5C23A 3HM6X 1VD2A 4K7UA 3KUCB 1WXAA 4IG7B 3DOWA 2GMIC 2YVCA 2MW5A 2K6DB 2LUEA 2C60A 3IVFA 3PHXB 4WJOA 2WX0A 1ZGUB 1Y8RC 1E8YA 1I35A 4MEMA 3M3JA 5G55A 3TJPA 3H7PA 1NI2A 3ZTDA 1V81A 2AWTA 4FJYA 4XX5A 4ZRJA 4GSWA 3VTWA 3H7PB 2GBNA 5LXIB 1YIWA 3ZO5B 3V6EB 2V4LA 4FLHA 1H4RA 2MSED 3APCA 2KQ7A 4KSKC 2KC2A 4NPNA 4CO7A 3KYDD 2WYQA 1A5RA 3QHTA 4HXDA 2DAJA 4IWQA 2N4FA 4WAAA 4RM8A 3ZIMA 3ZW3A 1CMXB 4EUTA 2NR2A 2OOBB 4HCNB 3W1SA 1U4AA 3CSTA 5E6NA 3JSVA 1RAXA 2EKEC 2ZPYA 2EMTA 3HIZA 4GXBA 5D2MB 3JSVB 1NBFC 1QZEA 1E8ZA 2L0TA 2RR9A 2ZJDA 3TL5A 2IBIB 4GGQA 4MGYE 4W9EA 4HLEA 2LD9A 2LRWA 4K7SA 3VVWB 2HJ8A 2DYBA 3V61A 4TKNA 2Z0DB 3ZLZA 1WR6E 2JVCA 2HTHA 5GMVA 1EF1A 1P9DU 2M0XA 2G4SA 1H8CA 1J8CA 3UQAA 2EMSA 1JRUA 2KZRA 3TMPB 2ASQA 4ANVA 1SGHA 2LVQA 2D3GA 5CHWA 2JRHA 4K1RB 4W9KA 2BYEA 4KDIC 3ECIA 2WWZA 3H7SA 2LGDA 2NS5A 3IFWB 4EKUA 1E7VA 4EZLA 5AEKB 3H9DA 1L2NA 4HDOA 2LGXA 3EC8A 3IG3A 4MGIE 2JWZA 3PV1A 5G2NA 5J18A 3TIXA 1IPGA 2BWES 4PYUA 1FXTB 2KOXA 2CHZA 1WJUA 4E74A 5C1ZA 2FNJB 3UIPB 3B0AA 3ALBA 4ZYNA 5TR5A 2KDBA 4G50A 2M4NA 2FIDA 2M8SA 3NS8A 3RUIB 4DHZE 3NY5A 4URKA 1YJ1A 3ZNGC 4AJYB 2KWCA 5DCNA 1J19A 2D11A 3VQIA 4MSMB 3VHTC 1K8RB 3T8MA 1V5TA 1UELA 3BY4B 2MBQA 2PJHA 2KK8A 1E5WA 5DPRA 2K39A 4JQWC 1LXDA 4GN1A 1WE6A 4DDID 4II2B 3HK0A 2ZNVC 2JUOA 3UINB 1C3TA 5JH5C 2I1JA 2BYVE 1RLFA 4IWPA 4ANWA 2KDEB 1TZ1A 3A4RA 3DVGY 3NZSA 1E7UA 3X23A 3A9KA 3KH0A 4IM2A 2UYZB 2W9NA 2MLBA 3A9KB 2MWSB 3DBSA 3N3KB 4EZJA 5D94A 4YL8A 3DBLI 2K25A 2JF5A 3PTFC 2KJ6A 2BYFA 3T9LA 3DVGX 2MP2A 3PZDA 3EECA 2C5LC 2IY1B 2MP2B 2LASA 3JW0X 1OTRB 3PLUA 1BT0A 2KQSA 4BFRA 2K8HA 2C7NB 3N30A 2WDTB 4KZ0A 5HKHA 1OEYJ 3L54A 4B95A 2A5UA 2GBKA 4BKSD 2NVUI 2FAZA 3C0RB 4X57B 2LRUA 2REXA 2KWUB 1GNUA 4LJPB 4WWPA 2PEAA 4MM3A 4RM9A 1X1MA 5CX3A 1V2YA 2G4DB 1LM8B 4NJ7A 3AU5A 4GMVA 1WXVA 1P1AA 4IUMB 5DPWA 4HWIB 2KMCA 2MRPA 4G11A 2LI5A 2CHXA 2KJRA 1OQYA 4E71A 2L00B 4N9F4 3DPDA 3VFKA 3PRMB 4AWJA 4PS3A 2Z59B 3PPAA 4K81A 3R7QA 2LXCA 4WJQA 1M94A 4WWNA 1E90A 3KUZA 3QQ8B 4M8NA 1D3ZA 3W1YA 3SD5A 2BKFA 2J7QB 4HDQA 3IBEA 3ZKJC 2K8BA 3AXCA 2O6VA 2AEHA 3PVLA 3QJZA 4B9KA 3L13A 5AZFA 2KTFA 1UGMA 5JZEB 3V60A 2O6VB 2LZ6A 2FIFA 1WX9A 4NQLB 3QX1A 3IHPC 3L0WB 4K7WA 4J6IA 4AP4C 4FHJA 4GOCA 4FJVB 4MGZE 4ANUA 4HJKA 1Q5WB 3R7RA 3GOEA 3PSEB 2CHWA 2K8CA 2MBHA 3A9JA 5L95C 2I1KA 1TTNA 1UZXB 2D2QA 3A9JB 3A33B 4FA6A 2AL6A 1WRDB 4WJPA 2L0FA 4RMAA 1LFDA 2KO3A 4PYZA 2JXXA 2ZCCA 3VTVA 4A3OA 4NAWA 3HM3A 2GBMA 4AOFA 3WANA 4KSLC 2KANA 4DK5A 1XT9B 4DBGA 3KUDB 1V9JA 5CTRC 3L16A 2FCQA 2MA9B 3KVFB 4FN2A 4I6LB 4M8MA 5D7GA 3ZUNA 1OEYA 3N32A 3PLVA 3NOBA 3M62B 4HPMB 4KVGB 4MDKE 4DHZB 2DENB 2K1FA 5IA7A 3JVZX 1IP9A 2N7DA 4GDKA 2HD5B 3RZFA 2Y5BB 1F9JA 4KZCA 2KDFB 4GDKB 2KTRA 2R2QA 4ICVA 5J2RA 1P3QU 1S1QB 3H6NA 2LVPA 3SDLC 3ML8A 3QWZB 4CHKA 3M95A 2MBOA 4DWFA 2V1YA 2GBRA 4NQKE 2KX0A 3RULA 3WA0A 2LJ5A 3DBHI 3PHWB 4KIKA 4ZRIA 2D10A 3X0WA 2XBBC 5L83A 3NHEB 4AJWA 1YD8U 2KVRA 3RYTA 3PS6A 4KIKB 3WAPA 3TCAA 2RD0A 1IYFA 1WJ4A 2KJHB 4BVUC 1P0RA 3S2AA 4IM0A 1RFAA 1WGGA 2PE9A 3WALA 1WJ6A 3PGEA 4MGKE 3VDZA 3APFA 4TUUA 3VUXA 2LXAA 4AUQC 5KHQA 3VH4B 4BKGA 3Q3JA 1WIAA 3RZWC 5IAAC 2IO0B 2KFKA 2PPHA 2IY0B 4I6NB 2V3SA 4JIOU 1P98A 4MJSA 2KFKB 3P2BA 2IO3B 3OJ4B 3Q3FA 3DCGA 4MJSB 4W9HA 1GG3A 5LLIA 3B08A 3WAMA 4ASWC 2NBWB 2KFJA 2VRRB 2NBVB 2PE6B 4EZKA 3ENEA 2Z0EB 4EEWA 2C9WB 4LJOB 1WGRA 3EFUA 4HCPB 1SIFA 3VXWA 4PS8A 4LCDE 2ZZPB 1WF9A 2HE7A 2GOWA 3O65B 4NY0A 1C1YB 1ZKHA 1KM7A 3UGBB 5J17A 1V80A 1GUAB 2FUHB 2KLGA 3AULA 4GB9A 2CU1A 3VTUA 5EDSA 4KV2A 4W9IA 1UBIA 2B3AA 2BPSA 3MHSD 3LDZE 4TQ0A 3VH3B 2A4ZA 2WX1A 4I6PA 4XC2A 3ONSA 2RGFA 3APDA 4OVUA 1V86A 4DHJB 2N1WA 1WZ3A 3W1SC 2BWFA 4ANXA 1GC7A 3QARA 3R3MA 3MJWA 1R4NI 2D07B 4DHJD 4WJNA 1WI0A 3PRZA 2NPTA 1WM3A 2DZIA 1XD3B 3CMMB 2DAFA 5AZHA 4ZRKA 1WX8A 3ZNZB 1R4MI 1WGYA 2DZJA 2NPTB 3WAOA 4NNJB 3R66C 2KHWB 4P7IA 2JZZA 3OLMD 4A3PA 4F8CB 2J0MA 3GZNI 4CYEA 2NCNA 2FCMA 1GJZA 2DYOA 2JPHA 2L05A 2MQJA 1G6JA 2N9PC 4W9GA 2N7EA 2DYMA 2LWPA 2N9XA 3ZNID 1AARA 3K9OB 4HPLB 4MH0E 2JY6A 3V6CB 1WX7A 2MX2A 3KYCD 4W9CA 2O2VA 4HK2A 2KKCA 1EUVB 1SE9A 2O6VD 2O2VB 4JLCA 3M63B 3U8ZA 2KLCA 3I3TB 4IWOA 1TGZB 3A4SC 1HE8A 1UH6A 1EO6A 3HHMA 3EHVA 3VUYA 4A20A 5LXHA 1WY8A 1YX5B 2AL3A 2MBBB 2OJRA 1XQQA 1WZ0A 2QHOA 1V49A 5JHAA 1WGDA 3UF8A 3AI5A 2ZCBA 4NAWB 3CSFA 2KWVB 5AZGA 2BF8B 3PRPB 4JL9A 1GC6A 2C7MB 2R2OA 1LQBA 2XEWA 2AYOB 4G3XB 1V5OA 1OGWA 5CHFA 1EF5A 2IO1B 4BBNF 3QCAA 4XZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CHV C;  4ICU A;  4JGH B;  1Q1O A;  1T0Y A;  1E8W A;  2CS4 A;  4WQO B;  3RD2 A;  4WWO A;  3ZVV A;  1WM2 A;  2FCS A;  2YLM A;  5DPS A;  1PQS A;  3SU8 X;  1WYW B;  2N9E B;  1L7Y A;  2M17 A;  3DQV A;  2ZVN A;  3OJ3 A;  1TBE A;  2KTR B;  1NDD A;  2G45 B;  1UD7 A;  4FHK A;  3NZU A;  1V6E A;  4TV3 A;  4W9J A;  2MCN B;  1WMH A;  2DX5 B;  4OVV A;  1E8X A;  4M0W B;  2LGY A;  4BKT A;  4F1S A;  4EOY A;  3B1L X;  4B6W A;  4EFO A;  5FR6 A;  1WMH B;  2J0K A;  2L8J A;  3JYU A;  4MSQ B;  1ISN A;  3ZTC A;  3ZRF A;  2GBJ A;  2KX3 A;  2FCN A;  2KC1 A;  3DBR I;  3LJ3 A;  4IC7 B;  4KDL B;  3U7D A;  2JZ3 B;  4E3C A;  1WXM A;  3RCZ A;  3CF6 E;  3WIM A;  2K6Q A;  2ZVO A;  4IW0 A;  4GIV A;  1Q0W B;  3H1U A;  2KMA A;  4W9L A;  4GU2 A;  2KXJ A;  2M1M A;  4DXA B;  2LVO A;  2RPQ A;  1YX6 B;  4LDT B;  3MTN B;  4FJZ A;  4MEL A;  2UWQ A;  2G3Q B;  3UQB A;  2J0J A;  3K9P B;  3L17 A;  1WXS A;  2L7R A;  4FAD A;  3AU4 A;  4LDT D;  3L08 A;  1KLV A;  2DZM A;  2KN5 A;  3KW5 B;  1UBQ A;  3ZDT A;  2KD0 A;  1WFY A;  3BIN A;  4TQ1 A;  3A1Q A;  1WR1 A;  2NBU A;  5D6J B;  1WH3 A;  2KDI A;  3QK0 A;  4F7Z A;  1S3S G;  3A1Q B;  1WE7 A;  2IZV B;  3DVN U;  5BO4 B;  2JRI B;  3VUW A;  3SHQ A;  4DDG D;  4PS7 A;  4W9F A;  1Z2M A;  2DHZ A;  3ZDM C;  1J0G A;  2N1V A;  4W9D A;  5KHO A;  2L3Z A;  3L10 B;  3DDC B;  2CKH B;  1KJT A;  5E6P A;  1WGH A;  5DPT A;  3PRE A;  4BBN C;  3UIO B;  2BGF A;  1WJN A;  4II3 B;  1YQB A;  2L76 A;  2C7H A;  4ZDV A;  2JT4 B;  1MG8 A;  4FBJ B;  3RT3 B;  4BKS A;  1VCB A;  4HVB A;  2XK5 A;  1ZW7 A;  3TBL D;  3QAQ A;  2IYD B;  2ZEQ A;  3D32 A;  1KOT A;  2XK5 B;  3ML9 A;  3U30 A;  1Z5S B;  2CR5 A;  3QA8 A;  4NJ6 A;  3VAW A;  1RRB A;  5JHB A;  2MBE A;  2BKR B;  4GDL A;  5E6O A;  3ZRC A;  4BOS C;  4FUL A;  3PT2 B;  3V62 A;  4BOZ B;  3QIJ A;  4GDL B;  3ZNH B;  2DZK A;  2RSU A;  2ZPN A;  4IM3 A;  2ZNV B;  2KNB A;  3QC8 B;  1I42 A;  3DVN V;  3OAW A;  2IO2 B;  4G0N B;  5C23 A;  3HM6 X;  1VD2 A;  4K7U A;  3KUC B;  1WXA A;  4IG7 B;  3DOW A;  2GMI C;  2YVC A;  2MW5 A;  2K6D B;  2LUE A;  2C60 A;  3IVF A;  3PHX B;  4WJO A;  2WX0 A;  1ZGU B;  1Y8R C;  1E8Y A;  1I35 A;  4MEM A;  3M3J A;  5G55 A;  3TJP A;  3H7P A;  1NI2 A;  3ZTD A;  1V81 A;  2AWT A;  4FJY A;  4XX5 A;  4ZRJ A;  4GSW A;  3VTW A;  3H7P B;  2GBN A;  5LXI B;  1YIW A;  3ZO5 B;  3V6E B;  2V4L A;  4FLH A;  1H4R A;  2MSE D;  3APC A;  2KQ7 A;  4KSK C;  2KC2 A;  4NPN A;  4CO7 A;  3KYD D;  2WYQ A;  1A5R A;  3QHT A;  4HXD A;  2DAJ A;  4IWQ A;  2N4F A;  4WAA A;  4RM8 A;  3ZIM A;  3ZW3 A;  1CMX B;  4EUT A;  2NR2 A;  2OOB B;  4HCN B;  3W1S A;  1U4A A;  3CST A;  5E6N A;  3JSV A;  1RAX A;  2EKE C;  2ZPY A;  2EMT A;  3HIZ A;  4GXB A;  5D2M B;  3JSV B;  1NBF C;  1QZE A;  1E8Z A;  2L0T A;  2RR9 A;  2ZJD A;  3TL5 A;  2IBI B;  4GGQ A;  4MGY E;  4W9E A;  4HLE A;  2LD9 A;  2LRW A;  4K7S A;  3VVW B;  2HJ8 A;  2DYB A;  3V61 A;  4TKN A;  2Z0D B;  3ZLZ A;  1WR6 E;  2JVC A;  2HTH A;  5GMV A;  1EF1 A;  1P9D U;  2M0X A;  2G4S A;  1H8C A;  1J8C A;  3UQA A;  2EMS A;  1JRU A;  2KZR A;  3TMP B;  2ASQ A;  4ANV A;  1SGH A;  2LVQ A;  2D3G A;  5CHW A;  2JRH A;  4K1R B;  4W9K A;  2BYE A;  4KDI C;  3ECI A;  2WWZ A;  3H7S A;  2LGD A;  2NS5 A;  3IFW B;  4EKU A;  1E7V A;  4EZL A;  5AEK B;  3H9D A;  1L2N A;  4HDO A;  2LGX A;  3EC8 A;  3IG3 A;  4MGI E;  2JWZ A;  3PV1 A;  5G2N A;  5J18 A;  3TIX A;  1IPG A;  2BWE S;  4PYU A;  1FXT B;  2KOX A;  2CHZ A;  1WJU A;  4E74 A;  5C1Z A;  2FNJ B;  3UIP B;  3B0A A;  3ALB A;  4ZYN A;  5TR5 A;  2KDB A;  4G50 A;  2M4N A;  2FID A;  2M8S A;  3NS8 A;  3RUI B;  4DHZ E;  3NY5 A;  4URK A;  1YJ1 A;  3ZNG C;  4AJY B;  2KWC A;  5DCN A;  1J19 A;  2D11 A;  3VQI A;  4MSM B;  3VHT C;  1K8R B;  3T8M A;  1V5T A;  1UEL A;  3BY4 B;  2MBQ A;  2PJH A;  2KK8 A;  1E5W A;  5DPR A;  2K39 A;  4JQW C;  1LXD A;  4GN1 A;  1WE6 A;  4DDI D;  4II2 B;  3HK0 A;  2ZNV C;  2JUO A;  3UIN B;  1C3T A;  5JH5 C;  2I1J A;  2BYV E;  1RLF A;  4IWP A;  4ANW A;  2KDE B;  1TZ1 A;  3A4R A;  3DVG Y;  3NZS A;  1E7U A;  3X23 A;  3A9K A;  3KH0 A;  4IM2 A;  2UYZ B;  2W9N A;  2MLB A;  3A9K B;  2MWS B;  3DBS A;  3N3K B;  4EZJ A;  5D94 A;  4YL8 A;  3DBL I;  2K25 A;  2JF5 A;  3PTF C;  2KJ6 A;  2BYF A;  3T9L A;  3DVG X;  2MP2 A;  3PZD A;  3EEC A;  2C5L C;  2IY1 B;  2MP2 B;  2LAS A;  3JW0 X;  1OTR B;  3PLU A;  1BT0 A;  2KQS A;  4BFR A;  2K8H A;  2C7N B;  3N30 A;  2WDT B;  4KZ0 A;  5HKH A;  1OEY J;  3L54 A;  4B95 A;  2A5U A;  2GBK A;  4BKS D;  2NVU I;  2FAZ A;  3C0R B;  4X57 B;  2LRU A;  2REX A;  2KWU B;  1GNU A;  4LJP B;  4WWP A;  2PEA A;  4MM3 A;  4RM9 A;  1X1M A;  5CX3 A;  1V2Y A;  2G4D B;  1LM8 B;  4NJ7 A;  3AU5 A;  4GMV A;  1WXV A;  1P1A A;  4IUM B;  5DPW A;  4HWI B;  2KMC A;  2MRP A;  4G11 A;  2LI5 A;  2CHX A;  2KJR A;  1OQY A;  4E71 A;  2L00 B;  4N9F 4;  3DPD A;  3VFK A;  3PRM B;  4AWJ A;  4PS3 A;  2Z59 B;  3PPA A;  4K81 A;  3R7Q A;  2LXC A;  4WJQ A;  1M94 A;  4WWN A;  1E90 A;  3KUZ A;  3QQ8 B;  4M8N A;  1D3Z A;  3W1Y A;  3SD5 A;  2BKF A;  2J7Q B;  4HDQ A;  3IBE A;  3ZKJ C;  2K8B A;  3AXC A;  2O6V A;  2AEH A;  3PVL A;  3QJZ A;  4B9K A;  3L13 A;  5AZF A;  2KTF A;  1UGM A;  5JZE B;  3V60 A;  2O6V B;  2LZ6 A;  2FIF A;  1WX9 A;  4NQL B;  3QX1 A;  3IHP C;  3L0W B;  4K7W A;  4J6I A;  4AP4 C;  4FHJ A;  4GOC A;  4FJV B;  4MGZ E;  4ANU A;  4HJK A;  1Q5W B;  3R7R A;  3GOE A;  3PSE B;  2CHW A;  2K8C A;  2MBH A;  3A9J A;  5L95 C;  2I1K A;  1TTN A;  1UZX B;  2D2Q A;  3A9J B;  3A33 B;  4FA6 A;  2AL6 A;  1WRD B;  4WJP A;  2L0F A;  4RMA A;  1LFD A;  2KO3 A;  4PYZ A;  2JXX A;  2ZCC A;  3VTV A;  4A3O A;  4NAW A;  3HM3 A;  2GBM A;  4AOF A;  3WAN A;  4KSL C;  2KAN A;  4DK5 A;  1XT9 B;  4DBG A;  3KUD B;  1V9J A;  5CTR C;  3L16 A;  2FCQ A;  2MA9 B;  3KVF B;  4FN2 A;  4I6L B;  4M8M A;  5D7G A;  3ZUN A;  1OEY A;  3N32 A;  3PLV A;  3NOB A;  3M62 B;  4HPM B;  4KVG B;  4MDK E;  4DHZ B;  2DEN B;  2K1F A;  5IA7 A;  3JVZ X;  1IP9 A;  2N7D A;  4GDK A;  2HD5 B;  3RZF A;  2Y5B B;  1F9J A;  4KZC A;  2KDF B;  4GDK B;  2KTR A;  2R2Q A;  4ICV A;  5J2R A;  1P3Q U;  1S1Q B;  3H6N A;  2LVP A;  3SDL C;  3ML8 A;  3QWZ B;  4CHK A;  3M95 A;  2MBO A;  4DWF A;  2V1Y A;  2GBR A;  4NQK E;  2KX0 A;  3RUL A;  3WA0 A;  2LJ5 A;  3DBH I;  3PHW B;  4KIK A;  4ZRI A;  2D10 A;  3X0W A;  2XBB C;  5L83 A;  3NHE B;  4AJW A;  1YD8 U;  2KVR A;  3RYT A;  3PS6 A;  4KIK B;  3WAP A;  3TCA A;  2RD0 A;  1IYF A;  1WJ4 A;  2KJH B;  4BVU C;  1P0R A;  3S2A A;  4IM0 A;  1RFA A;  1WGG A;  2PE9 A;  3WAL A;  1WJ6 A;  3PGE A;  4MGK E;  3VDZ A;  3APF A;  4TUU A;  3VUX A;  2LXA A;  4AUQ C;  5KHQ A;  3VH4 B;  4BKG A;  3Q3J A;  1WIA A;  3RZW C;  5IAA C;  2IO0 B;  2KFK A;  2PPH A;  2IY0 B;  4I6N B;  2V3S A;  4JIO U;  1P98 A;  4MJS A;  2KFK B;  3P2B A;  2IO3 B;  3OJ4 B;  3Q3F A;  3DCG A;  4MJS B;  4W9H A;  1GG3 A;  5LLI A;  3B08 A;  3WAM A;  4ASW C;  2NBW B;  2KFJ A;  2VRR B;  2NBV B;  2PE6 B;  4EZK A;  3ENE A;  2Z0E B;  4EEW A;  2C9W B;  4LJO B;  1WGR A;  3EFU A;  4HCP B;  1SIF A;  3VXW A;  4PS8 A;  4LCD E;  2ZZP B;  1WF9 A;  2HE7 A;  2GOW A;  3O65 B;  4NY0 A;  1C1Y B;  1ZKH A;  1KM7 A;  3UGB B;  5J17 A;  1V80 A;  1GUA B;  2FUH B;  2KLG A;  3AUL A;  4GB9 A;  2CU1 A;  3VTU A;  5EDS A;  4KV2 A;  4W9I A;  1UBI A;  2B3A A;  2BPS A;  3MHS D;  3LDZ E;  4TQ0 A;  3VH3 B;  2A4Z A;  2WX1 A;  4I6P A;  4XC2 A;  3ONS A;  2RGF A;  3APD A;  4OVU A;  1V86 A;  4DHJ B;  2N1W A;  1WZ3 A;  3W1S C;  2BWF A;  4ANX A;  1GC7 A;  3QAR A;  3R3M A;  3MJW A;  1R4N I;  2D07 B;  4DHJ D;  4WJN A;  1WI0 A;  3PRZ A;  2NPT A;  1WM3 A;  2DZI A;  1XD3 B;  3CMM B;  2DAF A;  5AZH A;  4ZRK A;  1WX8 A;  3ZNZ B;  1R4M I;  1WGY A;  2DZJ A;  2NPT B;  3WAO A;  4NNJ B;  3R66 C;  2KHW B;  4P7I A;  2JZZ A;  3OLM D;  4A3P A;  4F8C B;  2J0M A;  3GZN I;  4CYE A;  2NCN A;  2FCM A;  1GJZ A;  2DYO A;  2JPH A;  2L05 A;  2MQJ A;  1G6J A;  2N9P C;  4W9G A;  2N7E A;  2DYM A;  2LWP A;  2N9X A;  3ZNI D;  1AAR A;  3K9O B;  4HPL B;  4MH0 E;  2JY6 A;  3V6C B;  1WX7 A;  2MX2 A;  3KYC D;  4W9C A;  2O2V A;  4HK2 A;  2KKC A;  1EUV B;  1SE9 A;  2O6V D;  2O2V B;  4JLC A;  3M63 B;  3U8Z A;  2KLC A;  3I3T B;  4IWO A;  1TGZ B;  3A4S C;  1HE8 A;  1UH6 A;  1EO6 A;  3HHM A;  3EHV A;  3VUY A;  4A20 A;  5LXH A;  1WY8 A;  1YX5 B;  2AL3 A;  2MBB B;  2OJR A;  1XQQ A;  1WZ0 A;  2QHO A;  1V49 A;  5JHA A;  1WGD A;  3UF8 A;  3AI5 A;  2ZCB A;  4NAW B;  3CSF A;  2KWV B;  5AZG A;  2BF8 B;  3PRP B;  4JL9 A;  1GC6 A;  2C7M B;  2R2O A;  1LQB A;  2XEW A;  2AYO B;  4G3X B;  1V5O A;  1OGW A;  5CHF A;  1EF5 A;  2IO1 B;  4BBN F;  3QCA A;  4XZ4 A; 
#chains in the Genus database with same CATH topology
 3BYT B;  5CHV C;  1QF6 A;  3E9S A;  3AV8 A;  1Q1O A;  1E8W A;  2DWQ A;  1DYQ A;  1WM2 A;  2YLM A;  4ACF A;  1FFU A;  4JE3 B;  2ZVN A;  1L4Z B;  2MCN B;  3DWG C;  1FPY A;  1WMH A;  3MJ5 A;  4OVV A;  4BKT A;  4M0W B;  1E0Z A;  5BYQ A;  4B6W A;  1ZXI A;  4MSQ B;  2PTL A;  3ZTC A;  3ZRF A;  2M0A A;  2WHI A;  2KC1 A;  1HTO A;  3AH7 A;  2RPV A;  4LK0 M;  3NRZ A;  3CF6 E;  3WIM A;  1T0S C;  1V8C A;  1ROE A;  4WH4 A;  2KMA A;  2GRI A;  4LDT B;  3MTN B;  4FJZ A;  1TJE A;  2UWQ A;  2G3Q B;  2J0J A;  3K9P B;  1UWM A;  3ZDT A;  1WFY A;  3BIN A;  3A1Q A;  3B2F A;  3IXS A;  2JWU A;  1WH3 A;  3QK0 A;  4F7Z A;  3DVN U;  1TIF A;  1Z2M A;  4W9D A;  5KHO A;  1JAL A;  4US9 A;  3PRE A;  4BBN C;  1OFF A;  1YQB A;  3R8B A;  2L76 A;  2C7H A;  4ZDV A;  1MG8 A;  2MHJ A;  2KWD A;  2IYD B;  3DBR B;  2ZEQ A;  3ML9 A;  3U30 A;  1Z5S B;  1D4B A;  3QA8 A;  3VAW A;  1HQR D;  2EKI A;  4UDU C;  3KWL A;  4GDL A;  1N60 A;  4FUL A;  3PT2 B;  3QIJ A;  4Q2J A;  2DZK A;  4JWU C;  2RDG A;  3AE1 B;  4IM3 A;  3QC8 B;  3DVN V;  3NVZ A;  2IO2 B;  1VD2 A;  3KUC B;  1GAQ B;  1VJK A;  1WXA A;  2CU3 A;  3I63 C;  3NG0 A;  2C60 A;  1VRA B;  3PHX B;  4WJO A;  2L32 A;  2WX0 A;  3T3O A;  1E8Y A;  3VR8 B;  5G55 A;  1V81 A;  2HTM E;  3Q14 C;  2GBN A;  5IN7 A;  1YIW A;  2V4L A;  4KSK C;  2KC2 A;  4NPN A;  3KYD D;  2WYQ A;  1A5R A;  4HXD A;  1N61 A;  4WAA A;  3ZIM A;  3Q6B A;  2OOB B;  4IDI A;  3W1S A;  1U4A A;  1D5M C;  3JSV A;  5BYS A;  3AEE B;  1NBF C;  1QZE A;  2L0T A;  3U4E G;  3IT6 B;  2LD9 A;  2LRW A;  4K7S A;  3V61 A;  3DHG C;  4P1C C;  2YEP B;  2M0X A;  1J8C A;  3TMP B;  4K1R B;  4W9K A;  5C2T B;  2NS5 A;  1E7V A;  1XXG A;  3LB8 C;  2D3C A;  4HDO A;  3IG3 A;  2JWZ A;  4RNA A;  4KGR A;  3AEG B;  1TKE A;  3FKY A;  2W55 A;  3B0A A;  3MHZ A;  2M4N A;  2LGS A;  4LNK A;  1Y56 A;  4URK A;  3ZNG C;  2W3S A;  1K8R B;  1UEL A;  2KK8 A;  4XWT A;  4ARI A;  2K39 A;  1WE6 A;  5JH5 C;  4IWP A;  1F0Z A;  4ANW A;  2KDE B;  3DVG Y;  1ET9 A;  3A9K A;  3N1Z C;  3KH0 A;  1V97 A;  2QDF A;  2MLB A;  5AUI A;  1C79 A;  3N3K B;  4KKI A;  5D94 A;  1JWS D;  2OJW A;  2MP2 A;  2J52 A;  1BT0 A;  4BFR A;  1SJH D;  2WDT B;  5HKH A;  4NJC A;  1YJJ A;  4BKS D;  2NVU I;  3HRD D;  2AQ2 B;  4X57 B;  2KWU B;  1GNU A;  2JYE A;  1X1M A;  5CX3 A;  2G4D B;  3BZD B;  3AU5 A;  4GMV A;  4ZYS A;  3N9Y C;  4IUM B;  4HWI B;  2WXH A;  3RPF C;  4N9F 4;  4PS3 A;  3PPA A;  1F2R C;  4WJQ A;  1E90 A;  3QQ8 B;  3AED B;  1D3Z A;  1DGJ A;  2KMM A;  3SD5 A;  4HDQ A;  3AXC A;  4WWM A;  5AZF A;  5JZE B;  1BML C;  3DBL B;  2FIF A;  1WX9 A;  3ZJV A;  3L0W B;  4L23 A;  4FHJ A;  4GOC A;  3MC0 B;  3RNB C;  3R7R A;  2CHW A;  2K8C A;  2PIA A;  2MBH A;  2I1K A;  1TTN A;  2XNA C;  1IGC A;  2D2Q A;  2N7J A;  3GS2 A;  3TEX A;  2VH2 A;  4XDC A;  4A55 A;  3AE6 B;  4O1N A;  2JXX A;  2ZCC A;  4PYZ A;  2LFI A;  3VTV A;  2GBM A;  3V05 A;  4KSL C;  2KYW A;  3R2T A;  1TS5 A;  5CTR C;  3L16 A;  4EE2 A;  3Q69 A;  5D7G A;  1OEY A;  3NVY A;  2BYT A;  2WXP A;  4KGS A;  2WU5 B;  4JX1 C;  4KZC A;  2KDF B;  1E9M A;  2PW9 A;  4LNF A;  5J2R A;  2LVP A;  4H2A A;  3ML8 A;  3M95 A;  4M0W A;  1F1H A;  3Q8C A;  4NQK E;  3IT4 B;  3WA0 A;  4YTN B;  3PHW B;  4ZRI A;  2HJ1 A;  1IYF A;  3WAP A;  4KIK B;  1OQR A;  5FR3 A;  3AN1 A;  4IM0 A;  2E6X A;  1WJ6 A;  3PGE A;  3VDZ A;  3URY A;  2MEK A;  4BKG A;  1WIA A;  2IO0 B;  2V3S A;  4MJS A;  2KVZ A;  5HI1 A;  4ASW C;  1EU4 A;  3B08 A;  1GB4 A;  1ZE3 D;  2KFJ A;  4RH6 A;  4EZK A;  5T8I A;  3ENE A;  1C4C A;  1XLQ A;  4BZA A;  1ZKH A;  5J17 A;  2KLG A;  3VTU A;  4KV2 A;  1HEZ E;  2WDV B;  1NVI D;  1XEE A;  3VH3 B;  2JZP A;  4DHJ B;  2N1W A;  3W1S C;  2BWF A;  1R4N I;  4WQM A;  1WI0 A;  3MFG A;  2IGH A;  1TY2 A;  1TT5 B;  1DOX A;  1BUI C;  2WXF A;  3CMM B;  1WX8 A;  4A3P A;  3OLM D;  3ZXV A;  1GJZ A;  2JPH A;  2RDH A;  2N9P C;  1D5X C;  1UWX A;  2N9X A;  4HPL B;  2JY6 A;  3V6C B;  1WX7 A;  1F2R I;  2XN9 C;  3PZ7 A;  2O6V D;  2O2V B;  3U52 E;  2LMC A;  4HKQ A;  3Q3N C;  3I3T B;  4OZA A;  3A4S C;  4ITK A;  1HE8 A;  1QOB A;  2V9H A;  1EO6 A;  2AL3 A;  3RNF C;  1QOA A;  4RGT A;  1ZUD 2;  4KKJ A;  3PRP B;  2XEW A;  4HJG E;  3W9C B;  1FFV A;  3FIL B;  1R4M B;  5CHF A;  4BBN F;  4RGN A;  2BS4 B;  4ICU A;  3PZ8 A;  1T0Y A;  2X8X X;  4WQO B;  3RD2 A;  4K3C A;  3KLS X;  3VRA B;  5DPS A;  1YJI A;  2N9E B;  1L7Y A;  2M17 A;  3DQV A;  2NTT A;  5E6J A;  1NDD A;  1UD7 A;  4W9J A;  3NZU A;  4F1S A;  1E8X A;  2LGY A;  5BMI A;  4PK1 A;  1I4R A;  4JPS A;  5FR6 A;  1SEB D;  3HVD A;  2GBJ A;  2BQQ A;  4KDL B;  3LJ3 A;  4S0R A;  1N6Z A;  1P7E A;  3RI7 C;  3U7D A;  4E3C A;  3RCZ A;  2K6Q A;  4IW0 A;  4ZRP A;  4W9L A;  3N1X C;  2M1M A;  4RF0 A;  2RPQ A;  1J7C A;  4MEL A;  3L17 A;  1C78 A;  3L08 A;  2KN5 A;  2NTS A;  2FBW B;  4TQ1 A;  2MJ3 A;  2NBU A;  2W82 A;  2IZV B;  2K9X A;  2G1E A;  3BWU D;  3ZDM C;  2N1V A;  2L3Z A;  1KJT A;  5BMG A;  2WXJ A;  1YN5 A;  1EU3 A;  1WJN A;  4LNI A;  4II3 B;  3RNA C;  5JXV A;  2XK5 B;  2K3U A;  1FEH A;  1EWY C;  2AQ3 B;  2GI9 A;  1NYQ A;  4XDD A;  4WIP A;  2RSU A;  1JRP A;  1MHX A;  3OAW A;  4G0N B;  3HM6 X;  1FO4 A;  2MW5 A;  4D2K A;  1Y8R C;  3FC4 A;  1I35 A;  1TKY A;  4MEM A;  2M19 A;  1NI2 A;  3ZTD A;  2AWT A;  3H7P B;  5D3D A;  3ZO5 B;  3V6E B;  1YMH E;  2MSE D;  4CO7 A;  2DAJ A;  2N4F A;  1D6E C;  1SJE D;  3ZW3 A;  1MI0 A;  4EUT A;  4HCN B;  2NR2 A;  3CST A;  5E6N A;  2EKE C;  2DLB A;  1I7H A;  3SFD B;  1C77 A;  2ZJD A;  3TL5 A;  2IBI B;  4W9E A;  1C4A A;  2DYB A;  4TKN A;  3GE8 C;  3ZLZ A;  2HTH A;  5GMV A;  3U7Z A;  1EF1 A;  1P9D U;  2G4S A;  2HDE A;  2EMS A;  3RNG C;  2ASQ A;  2BYE A;  4KDI C;  2WWZ A;  3H7S A;  5AEK B;  1GOZ A;  4JWS C;  3H9D A;  3BVZ A;  1TY0 A;  2JXT A;  4KX6 B;  3TIX A;  4C4V B;  5J18 A;  1FRD A;  3LXF A;  1SF0 A;  2FNJ B;  3UIP B;  4OZC A;  3CWI A;  1MJD A;  3W5V B;  2BB5 A;  1WXQ A;  4LNO A;  2KWC A;  5DCN A;  1J19 A;  2D11 A;  4P6V F;  3BY4 B;  2MBQ A;  3EGR A;  5DPR A;  2Q5W D;  4K3B A;  5G5G A;  1P7F A;  3UIN B;  1C3T A;  1KF6 B;  3KWV A;  2UYZ B;  3DBS A;  5EE9 A;  2LGI A;  3PTF C;  3T9L A;  3DVG X;  3EEC A;  2IY1 B;  2LAS A;  1YQ4 B;  1V1P A;  2KQS A;  1C9F A;  4KZ0 A;  4B95 A;  1QOG A;  2A5U A;  2GBK A;  2LRU A;  4WWP A;  3ZYY X;  3GB1 A;  1STE A;  2Y5P A;  1V2Y A;  4MM3 B;  2DBY A;  4NJ7 A;  1P1A A;  1RFK A;  2KMC A;  3P63 A;  2CHX A;  2KJR A;  2L00 B;  3AM9 A;  3RMK C;  4PT5 A;  3VFK A;  2SEB D;  4M8N A;  2J7Q B;  1XCQ L;  3W2D A;  1WYG A;  2K8B A;  2AEH A;  2O6V B;  3E56 A;  3IHP C;  1T6B X;  2R61 A;  2UU7 A;  2J53 A;  4FJV B;  3DHH C;  4HJK A;  3AE4 B;  3C19 A;  3A9J A;  2INN E;  2NMQ A;  2Y5C A;  2AL6 A;  2AX5 A;  4OZB A;  2L0F A;  4RMA A;  1LFD A;  4AQ7 A;  1IBX B;  1ET6 A;  4YT0 B;  3HM3 A;  3TUO A;  4GLS C;  2Z8L A;  3KUD B;  1OQQ A;  3KVF B;  3V3X A;  4FN2 A;  3N32 A;  2J42 A;  1FCC C;  1C76 A;  2WXR A;  1IGD A;  3JVZ X;  1HTQ A;  4HRS A;  4XE0 A;  4RCO A;  2INP E;  3PO0 A;  4A90 A;  2WDQ B;  4GDK B;  2R2Q A;  2L52 A;  3SDL C;  3H6N A;  2GBR A;  1KTK A;  1LO5 D;  1WRI A;  1KLU D;  3DBH I;  1MG4 A;  3AB5 A;  2XBB C;  3NHE B;  3VR9 B;  3PS6 A;  3TCA A;  2RD0 A;  2KJH B;  4BVU C;  1WGG A;  4TUU A;  2LXA A;  2JX5 A;  2PPH A;  1CZP A;  2KFK A;  1AN8 A;  2IY0 B;  3N1Y C;  4I6N B;  4JIO U;  1RM6 C;  3P2B A;  1K52 A;  4W9H A;  4EEW A;  2C9W B;  3EFU A;  4HCP B;  1SIF A;  1KFY B;  2VH1 A;  1WF9 A;  2GOW A;  1AW7 A;  1YNT E;  4OHJ A;  1V80 A;  4XGA B;  1XLN A;  4W9I A;  2SAK A;  2BPS A;  1SE2 A;  2WX1 A;  4XC2 A;  1RWS A;  4OVU A;  1V86 A;  4HEA 1;  4IKG A;  1WZ3 A;  3MJW A;  1FIQ A;  1XLO A;  1CJE A;  2FUG 1;  2NPT A;  2KAJ A;  3IAM 1;  3SEB A;  5AZH A;  3GP7 A;  3WAO A;  1FNV A;  2JZZ A;  2J0M A;  4CYE A;  5BYR A;  2FCM A;  3AE2 B;  2FE8 A;  1I4H A;  1G6J A;  3U2S C;  3NVV A;  2N7E A;  2DYM A;  2MJE A;  3BVG A;  2RMM A;  4N58 A;  1KRH A;  3KYC D;  1EUV B;  1SE9 A;  2BS2 B;  3Q2A C;  3EHV A;  3C8Y A;  4A20 A;  4OW0 A;  1YX5 B;  2OJR A;  4C00 A;  4YTM B;  4WAF A;  1V49 A;  1WGD A;  2KAC A;  1R4N B;  3CSF A;  2KQ4 X;  4NAW B;  1LQB A;  1PGX A;  2AYO B;  5BMH A;  1V5O A;  5HHD G;  2VZK D;  1E6E B;  3AE9 B;  4A8X C;  1EF5 A;  2ONQ A;  4XZ4 A;  3NS1 A;  1UF0 A;  1L4D B;  4JGH B;  2CS4 A;  3N20 C;  1DOI A;  3ZVV A;  4OVZ A;  3ABV B;  3W5U B;  3WCQ A;  3SU8 X;  3OJ3 A;  1L0X B;  3ZGZ A;  1TBE A;  2G45 B;  4YTP B;  1I4Q A;  4TV3 A;  4DQO C;  2DX5 B;  2OED A;  5MPO A;  4EOY A;  3B1L X;  4EFO A;  4LNN A;  4C4V A;  1WMH B;  2J0K A;  1ISN A;  2KX3 A;  2FCN A;  1WXM A;  4GIV A;  1Q0W B;  3H1U A;  2WDR B;  4XWW A;  4GU2 A;  2KXJ A;  4DXA B;  2LVO A;  1YX6 B;  4AS1 A;  1A70 A;  3ZQ4 A;  4FAD A;  2WXN A;  4LDT D;  1KLV A;  2DZM A;  1UBQ A;  1F52 A;  2CJO A;  1N5W A;  5D6J B;  3A1Q B;  1WE7 A;  2QC8 A;  3VUW A;  3SHQ A;  1TS3 A;  4PS7 A;  3I5J C;  3BII D;  2DHZ A;  4M02 A;  1TYG B;  3L10 B;  3DDC B;  1MHH E;  2CKH B;  1WGH A;  5DPT A;  5IKC M;  3DWM A;  3TEY A;  2L83 A;  3UIO B;  2BGF A;  4MT5 A;  2JT4 B;  3TBL D;  1ACC A;  1VZ6 A;  1SXT A;  3D32 A;  1QKZ A;  1RRB A;  2MBE A;  2BKR B;  5E6O A;  3ZRC A;  1JWM D;  1TKG A;  4BOZ B;  4GDL B;  3ZNH B;  2ZNV B;  4B0M A;  2BVC A;  4RGM A;  4K7U A;  2WGS A;  4IG7 B;  2GMI C;  2YVC A;  1HA5 A;  5IP4 D;  3IVF A;  5G5H A;  1L6V A;  3M3J A;  1QIL A;  3TJP A;  4FJY A;  4GSW A;  3VTW A;  1GPX A;  2W3R A;  4FLH A;  2V3P A;  2KQ7 A;  2LEK A;  1WGK A;  3QHT A;  1ESF A;  5GXG B;  3P4S B;  1ZPS A;  1J7B A;  1V1O A;  4FXC A;  1RAX A;  2IND C;  2ZPY A;  2EMT A;  4GXB A;  5D2M B;  3JSV B;  1E8Z A;  2RR9 A;  2QIL A;  4GGQ A;  4HLE A;  1IBX A;  2E3T A;  1XF5 L;  1H8C A;  3UQA A;  1SGH A;  2D3G A;  5CHW A;  4B0E A;  4CQN A;  4EKU A;  1K50 A;  1K53 A;  2LGX A;  2WXM A;  1JW9 D;  4MGI E;  4L1B A;  1IPG A;  4US8 A;  4PYU A;  4ARC A;  2KOX A;  3AE7 B;  1WJU A;  5TR5 A;  4ZYN A;  2FID A;  1I4X A;  3NS8 A;  2BTE A;  3VQI A;  2V4I B;  4MSM B;  1V5T A;  4C80 A;  4NZL B;  1E5W A;  4ZOH C;  4C56 C;  1FNW A;  3HK0 A;  2PVO D;  3J9C A;  3ZJU A;  1RLF A;  3MC9 A;  3RFZ B;  3A4R A;  3NZS A;  2KT7 A;  5AUK A;  2W9N A;  3A9K B;  2DNF A;  1FMA D;  2KJ6 A;  4P16 A;  2BYF A;  3NJT A;  1GB1 A;  2WNM A;  5HFY A;  2C5L C;  2BBC A;  2MP2 B;  3JW0 X;  2EEL A;  2C7N B;  1OEY J;  1HZ6 A;  2H88 B;  4RF1 A;  3ETR A;  2FAZ A;  4LJP B;  4YSY B;  2QMT A;  4USA A;  2PEA A;  5EE1 A;  1NEN B;  3P4P B;  4KGT A;  1WXV A;  3BK1 A;  1FM0 D;  2N0S B;  4G11 A;  2ACZ B;  1PFD A;  2D3A A;  2LXC A;  1M94 A;  4L2Y A;  4WWN A;  1IUE A;  2BKF A;  3PVL A;  4B9K A;  3Q8A A;  5D3I B;  3L13 A;  1ZXH A;  2KTF A;  3LYY A;  4NQL B;  1WSP A;  4MGZ E;  1D5Z C;  1FRR A;  1Q5W B;  3Q3O C;  1ZP0 B;  3GOE A;  3PSE B;  2LHE A;  2ON8 A;  1N5X A;  1WWT A;  3BYY B;  1DOY A;  2BB6 A;  5L95 C;  1UZX B;  2IJ0 A;  3A33 B;  4FA6 A;  1F77 A;  2KO3 A;  2WXG A;  4NAW A;  2KAN A;  1K51 A;  1XT9 B;  2VZK B;  3P1M A;  4I6L B;  4M8M A;  1B1Z A;  3ZUN A;  2V3N A;  4REZ A;  3NOB A;  4MDK E;  4HPM B;  4KVG B;  2DEN B;  4N6E B;  1IP9 A;  2N7D A;  4N59 A;  2HD5 B;  3RZF A;  2Y5B B;  1NI3 A;  1F9J A;  1JWB D;  5IOI A;  1P3Q U;  1JWA D;  2IDY A;  4ZHP A;  2V1Y A;  3FAH A;  3EUB 2;  2KX0 A;  3RUL A;  5C3J B;  1JML A;  2LUM A;  4KIK A;  4HPP A;  1YD8 U;  2KVR A;  4A9A A;  1P0R A;  3S2A A;  1RFA A;  2PE9 A;  4AUQ C;  4MGK E;  3MP9 A;  1FXI A;  1N62 A;  5KHQ A;  3VH4 B;  3Q3J A;  5IAA C;  1P98 A;  1QLB B;  3Q3F A;  2IO3 B;  3OJ4 B;  4MJS B;  5LLI A;  1GG3 A;  2J4X A;  3WAM A;  2NBW B;  2VRR B;  3I57 A;  1WGR A;  3VXW A;  4PS8 A;  2HE7 A;  3O65 B;  4NY0 A;  4YWG G;  3B2G A;  1KM7 A;  5EE3 A;  3UGB B;  4YXD B;  2FUH B;  3AE8 B;  4M00 A;  3AUL A;  4GB9 A;  4M01 A;  5EDS A;  1XLP A;  4C7Z A;  2H89 B;  1UBI A;  1J7A A;  2B3A A;  2BT6 A;  3MHS D;  2PLP A;  3LDZ E;  4TQ0 A;  2A4Z A;  2MJD A;  3R3M A;  3DBH B;  2D07 B;  4DHJ D;  4WJN A;  1VZ7 A;  3KQ4 A;  2AQ1 B;  3PRZ A;  1WM3 A;  2DZI A;  1XD3 B;  2DAF A;  3ZNZ B;  3RNE C;  3R66 C;  3NVW A;  3GZN I;  2NCN A;  2MQJ A;  1QQR A;  2X38 A;  4RFB A;  3ZNI D;  4MH8 A;  1AAR A;  2JSV X;  2MX2 A;  2O2V A;  4HK2 A;  2KKC A;  3AEC B;  1YN4 A;  2IGG A;  2KN4 A;  3U8Z A;  2KLC A;  4IWO A;  1TGZ B;  1EM7 A;  5I4D A;  3BVM A;  3VUY A;  1EWC A;  1WY8 A;  1XQQ A;  2D3B A;  2QHO A;  4J3O D;  2WXI A;  3UF8 A;  2W54 A;  2ZCB A;  5AZG A;  1JQ4 A;  1TZO A;  2KWV B;  2BF8 B;  3EFC A;  3NZ3 A;  3FIL A;  2R2O A;  4P1B C;  3BK2 A;  3B9J A;  1OGW A;  3H8H A;  2IO1 B;  3TEW A;  4WWO A;  2FCS A;  1PQS A;  3VRB B;  1WYW B;  1NEK B;  1HZ5 A;  4WUR A;  1FD6 A;  4S17 A;  2KTR B;  4TMA B;  4FHK A;  1V6E A;  1C4P A;  1B9R A;  2L8J A;  3RNC C;  3JYU A;  2I2Y A;  2MH7 A;  1L0V B;  1ZDV A;  3TEZ A;  3DBR I;  4IC7 B;  1T3Q A;  2JZ3 B;  2ZVO A;  2PKO A;  1SIJ A;  3UQB A;  3DHI C;  1WXS A;  2L7R A;  3AU4 A;  5TSS A;  1ZDX A;  3KW5 B;  2KD0 A;  1WR1 A;  1SE4 A;  2ICI A;  2KDI A;  1N63 A;  1S3S G;  3AEF B;  5BO4 B;  2JRI B;  3I9V 1;  4DDG D;  4W9F A;  1E10 A;  1SB3 C;  1J0G A;  2RDB C;  3L4P A;  1VLB A;  5E6P A;  4FBJ B;  3RT3 B;  4BKS A;  1VCB A;  4HVB A;  2XK5 A;  1ZW7 A;  4R3D A;  3QAQ A;  2QEJ C;  4NAM A;  1KOT A;  4RGO S;  1YQ3 B;  1L5P A;  2CR5 A;  4NJ6 A;  1FCL A;  5JHB A;  3NUH B;  2BW2 A;  1YOV B;  4BOS C;  3V62 A;  2ZPN A;  3P42 A;  1MPE A;  2KNB A;  3O13 A;  1I42 A;  5C23 A;  1SE3 A;  4ZHO A;  4DXF A;  3DOW A;  3Q8F A;  1ZOY B;  2K6D B;  3AMZ A;  2LUE A;  1R7S A;  4HRO A;  1ZGU B;  5IO9 A;  1CQV A;  3CIR B;  2QCZ A;  3H7P A;  4XX5 A;  4ZRJ A;  5LXI B;  1H4R A;  3APC A;  4IWQ A;  4RM8 A;  1CMX B;  1T0Q C;  2KDM A;  3IAS 1;  3HIZ A;  1T0R C;  1BXT A;  4MGY E;  3VVW B;  2HJ8 A;  4IOI E;  2Z0D B;  1WR6 E;  2JVC A;  2I38 A;  1NYR A;  1LGR A;  2KZR A;  1JRU A;  4ANV A;  3AE3 B;  2CJN A;  2LVQ A;  2JRH A;  3ECI A;  2LGD A;  3IFW B;  4EZL A;  4YSZ B;  1L2N A;  3EC8 A;  3PV1 A;  5G2N A;  2BWE S;  1Q10 A;  2GB1 A;  1FXT B;  2CHZ A;  4E74 A;  5C1Z A;  3ALB A;  1YN3 A;  2KDB A;  4G50 A;  1CK1 A;  2M8S A;  3RUI B;  4DHZ E;  2WXL A;  3NY5 A;  1YJ1 A;  4AJY B;  2PVG C;  3VHT C;  3T8M A;  2PJH A;  3MC8 A;  1MFW A;  4JQW C;  2WXK A;  1LXD A;  4GN1 A;  4DDI D;  4HKZ E;  4II2 B;  2ZNV C;  2JUO A;  2PMV A;  2I1J A;  2LHD A;  2BYV E;  1TZ1 A;  3X23 A;  1E7U A;  1L6U A;  4IM2 A;  2WXO A;  2BS3 B;  1PGA A;  2MWS B;  2WP9 B;  4YL8 A;  3DBL I;  2K25 A;  2JF5 A;  2V0G A;  1KLG D;  3PZD A;  3AE5 B;  1OTR B;  3PLU A;  2K8H A;  2WQY B;  3N30 A;  1V1P B;  3Q3M C;  3L54 A;  1FNU A;  3C0R B;  2REX A;  2WS3 B;  2JQR B;  5H8Y E;  3OG5 A;  4MM3 A;  4RM9 A;  1MVK A;  5EE0 A;  1LM8 B;  4C7Y A;  5DPW A;  4LTU A;  2MRP A;  2LI5 A;  4E71 A;  1OQY A;  2TSS A;  1JCK B;  3DPD A;  3PRM B;  4AWJ A;  3T3N A;  3P4R B;  2Z59 B;  4K81 A;  3R7Q A;  1PYW D;  2INC C;  3KUZ A;  1QT9 A;  1HXY D;  2WU2 B;  3W1Y A;  4BAX A;  2WLB A;  3IBE A;  2Y3A A;  3ZKJ C;  2O6V A;  3QJZ A;  1UGM A;  3V60 A;  4LLG M;  2LZ6 A;  3QX1 A;  4K7W A;  4J6I A;  4AP4 C;  4ANU A;  1KH0 A;  3ZJT A;  3A9J B;  3TSS A;  1WRD B;  4WJP A;  5FKA C;  2ZW1 A;  4TSS A;  4A3O A;  1ENF A;  3WAN A;  4AOF A;  4DK5 A;  1I4P A;  3OWE B;  2LJI A;  4DBG A;  1V9J A;  2IGD A;  2N9K A;  4A6Q A;  2FCQ A;  2MA9 B;  1JRO A;  3RN9 C;  1SSN A;  2N9L A;  3PLV A;  1RYJ A;  3M62 B;  4DHZ B;  2K1F A;  2WXQ A;  5IA7 A;  1UNS A;  2K0P A;  4GDK A;  1UGJ A;  2YEP F;  2KTR A;  3AEA B;  1QOF A;  4ICV A;  1S1Q B;  4CHK A;  3QWZ B;  2MBO A;  4DWF A;  2ZW0 A;  4XYC A;  2LJ5 A;  1SBB B;  3X0W A;  2D10 A;  5L83 A;  1TS4 A;  3R2I A;  3HVZ A;  4AJW A;  3RYT A;  3Q8B A;  2JYT A;  1WJ4 A;  3AEB B;  3P4Q B;  3WAL A;  2OHF A;  1TS2 A;  3VUX A;  3APF A;  1FXA A;  3RZW C;  3HUI A;  5FK9 C;  2KFK B;  3DCG A;  2JU6 X;  2NBV B;  2PE6 B;  1VZ8 A;  2Z0E B;  4LJO B;  1M4V A;  2ZZP B;  4LCD E;  1C1Y B;  1T5X D;  1AWD A;  2GLS A;  1GUA B;  5HG2 A;  2CU1 A;  3UI3 A;  1XO3 A;  1JWU D;  2L1A A;  4I6P A;  2K22 A;  3ONS A;  2RGF A;  3APD A;  4ANX A;  1GC7 A;  3QAR A;  2D5G A;  4EZJ A;  4ZRK A;  3ZXR A;  1R4M I;  1WGY A;  2DZJ A;  2NPT B;  4NNJ B;  3EA6 A;  2KHW B;  4P7I A;  4F8C B;  5LNK 1;  1I4G A;  3Q8E A;  2DYO A;  2L05 A;  1PDX A;  1PUT A;  4W9G A;  1UUP A;  1VDV A;  2LWP A;  1PGB A;  4MAC A;  4ZRQ A;  2K5P A;  4MH0 E;  3K9O B;  2QSD A;  1L0Y B;  4W9C A;  3SFE B;  2G9H D;  4JLC A;  3M63 B;  2QIE B;  1XCT L;  4YSX B;  1UH6 A;  2M56 B;  3HHM A;  5LXH A;  2MBB B;  1AYF A;  4QAY A;  1E7P B;  3GE3 C;  2B76 B;  1WZ0 A;  5JHA A;  4DXG A;  3AI5 A;  5H92 C;  2IPK D;  4JL9 A;  1VR9 A;  3SR6 A;  1GC6 A;  2C7M B;  2QJL A;  4G3X B;  3QCA A;  3GZN B; 
#chains in the Genus database with same CATH homology
 5CHV C;  4ICU A;  4JGH B;  1Q1O A;  1T0Y A;  1E8W A;  2CS4 A;  4WQO B;  3RD2 A;  4WWO A;  3ZVV A;  1WM2 A;  2FCS A;  2YLM A;  5DPS A;  1PQS A;  3SU8 X;  1WYW B;  2N9E B;  1L7Y A;  2M17 A;  3DQV A;  2ZVN A;  3OJ3 A;  1TBE A;  2KTR B;  1NDD A;  2G45 B;  1UD7 A;  4FHK A;  3NZU A;  1V6E A;  4TV3 A;  4W9J A;  2MCN B;  1WMH A;  2DX5 B;  4OVV A;  1E8X A;  4M0W B;  2LGY A;  4BKT A;  4F1S A;  4EOY A;  3B1L X;  4B6W A;  4EFO A;  5FR6 A;  1WMH B;  2J0K A;  2L8J A;  3JYU A;  4MSQ B;  1ISN A;  3ZTC A;  3ZRF A;  2GBJ A;  2KX3 A;  2FCN A;  2KC1 A;  3DBR I;  3LJ3 A;  4IC7 B;  4KDL B;  3U7D A;  2JZ3 B;  4E3C A;  1WXM A;  3RCZ A;  3CF6 E;  3WIM A;  2K6Q A;  2ZVO A;  4IW0 A;  4GIV A;  1Q0W B;  3H1U A;  2KMA A;  4W9L A;  4GU2 A;  2KXJ A;  2M1M A;  4DXA B;  2LVO A;  2RPQ A;  1YX6 B;  4LDT B;  3MTN B;  4FJZ A;  4MEL A;  2UWQ A;  2G3Q B;  3UQB A;  2J0J A;  3K9P B;  3L17 A;  1WXS A;  2L7R A;  4FAD A;  3AU4 A;  4LDT D;  3L08 A;  1KLV A;  2DZM A;  2KN5 A;  3KW5 B;  1UBQ A;  3ZDT A;  2KD0 A;  1WFY A;  3BIN A;  4TQ1 A;  3A1Q A;  1WR1 A;  2NBU A;  5D6J B;  1WH3 A;  2KDI A;  3QK0 A;  4F7Z A;  1S3S G;  3A1Q B;  1WE7 A;  2IZV B;  3DVN U;  5BO4 B;  2JRI B;  3VUW A;  3SHQ A;  4DDG D;  4PS7 A;  4W9F A;  1Z2M A;  2DHZ A;  3ZDM C;  1J0G A;  2N1V A;  4W9D A;  5KHO A;  2L3Z A;  3L10 B;  3DDC B;  2CKH B;  1KJT A;  5E6P A;  1WGH A;  5DPT A;  3PRE A;  4BBN C;  3UIO B;  2BGF A;  1WJN A;  4II3 B;  1YQB A;  2L76 A;  2C7H A;  4ZDV A;  2JT4 B;  1MG8 A;  4FBJ B;  3RT3 B;  4BKS A;  1VCB A;  4HVB A;  2XK5 A;  1ZW7 A;  3TBL D;  3QAQ A;  2IYD B;  2ZEQ A;  3D32 A;  1KOT A;  2XK5 B;  3ML9 A;  3U30 A;  1Z5S B;  2CR5 A;  3QA8 A;  4NJ6 A;  3VAW A;  1RRB A;  5JHB A;  2MBE A;  2BKR B;  4GDL A;  5E6O A;  3ZRC A;  4BOS C;  4FUL A;  3PT2 B;  3V62 A;  4BOZ B;  3QIJ A;  4GDL B;  3ZNH B;  2DZK A;  2RSU A;  2ZPN A;  4IM3 A;  2ZNV B;  2KNB A;  3QC8 B;  1I42 A;  3DVN V;  3OAW A;  2IO2 B;  4G0N B;  5C23 A;  3HM6 X;  1VD2 A;  4K7U A;  3KUC B;  1WXA A;  4IG7 B;  3DOW A;  2GMI C;  2YVC A;  2MW5 A;  2K6D B;  2LUE A;  2C60 A;  3IVF A;  3PHX B;  4WJO A;  2WX0 A;  1ZGU B;  1Y8R C;  1E8Y A;  1I35 A;  4MEM A;  3M3J A;  5G55 A;  3TJP A;  3H7P A;  1NI2 A;  3ZTD A;  1V81 A;  2AWT A;  4FJY A;  4XX5 A;  4ZRJ A;  4GSW A;  3VTW A;  3H7P B;  2GBN A;  5LXI B;  1YIW A;  3ZO5 B;  3V6E B;  2V4L A;  4FLH A;  1H4R A;  2MSE D;  3APC A;  2KQ7 A;  4KSK C;  2KC2 A;  4NPN A;  4CO7 A;  3KYD D;  2WYQ A;  1A5R A;  3QHT A;  4HXD A;  2DAJ A;  4IWQ A;  2N4F A;  4WAA A;  4RM8 A;  3ZIM A;  3ZW3 A;  1CMX B;  4EUT A;  2NR2 A;  2OOB B;  4HCN B;  3W1S A;  1U4A A;  3CST A;  5E6N A;  3JSV A;  1RAX A;  2EKE C;  2ZPY A;  2EMT A;  3HIZ A;  4GXB A;  5D2M B;  3JSV B;  1NBF C;  1QZE A;  1E8Z A;  2L0T A;  2RR9 A;  2ZJD A;  3TL5 A;  2IBI B;  4GGQ A;  4MGY E;  4W9E A;  4HLE A;  2LD9 A;  2LRW A;  4K7S A;  3VVW B;  2HJ8 A;  2DYB A;  3V61 A;  4TKN A;  2Z0D B;  3ZLZ A;  1WR6 E;  2JVC A;  2HTH A;  5GMV A;  1EF1 A;  1P9D U;  2M0X A;  2G4S A;  1H8C A;  1J8C A;  3UQA A;  2EMS A;  1JRU A;  2KZR A;  3TMP B;  2ASQ A;  4ANV A;  1SGH A;  2LVQ A;  2D3G A;  5CHW A;  2JRH A;  4K1R B;  4W9K A;  2BYE A;  4KDI C;  3ECI A;  2WWZ A;  3H7S A;  2LGD A;  2NS5 A;  3IFW B;  4EKU A;  1E7V A;  4EZL A;  5AEK B;  3H9D A;  1L2N A;  4HDO A;  2LGX A;  3EC8 A;  3IG3 A;  4MGI E;  2JWZ A;  3PV1 A;  5G2N A;  5J18 A;  3TIX A;  1IPG A;  2BWE S;  4PYU A;  1FXT B;  2KOX A;  2CHZ A;  1WJU A;  4E74 A;  5C1Z A;  2FNJ B;  3UIP B;  3B0A A;  3ALB A;  4ZYN A;  5TR5 A;  2KDB A;  4G50 A;  2M4N A;  2FID A;  2M8S A;  3NS8 A;  3RUI B;  4DHZ E;  3NY5 A;  4URK A;  1YJ1 A;  3ZNG C;  4AJY B;  2KWC A;  5DCN A;  1J19 A;  2D11 A;  3VQI A;  4MSM B;  3VHT C;  1K8R B;  3T8M A;  1V5T A;  1UEL A;  3BY4 B;  2MBQ A;  2PJH A;  2KK8 A;  1E5W A;  5DPR A;  2K39 A;  4JQW C;  1LXD A;  4GN1 A;  1WE6 A;  4DDI D;  4II2 B;  3HK0 A;  2ZNV C;  2JUO A;  3UIN B;  1C3T A;  5JH5 C;  2I1J A;  2BYV E;  1RLF A;  4IWP A;  4ANW A;  2KDE B;  1TZ1 A;  3A4R A;  3DVG Y;  3NZS A;  1E7U A;  3X23 A;  3A9K A;  3KH0 A;  4IM2 A;  2UYZ B;  2W9N A;  2MLB A;  3A9K B;  2MWS B;  3DBS A;  3N3K B;  4EZJ A;  5D94 A;  4YL8 A;  3DBL I;  2K25 A;  2JF5 A;  3PTF C;  2KJ6 A;  2BYF A;  3T9L A;  3DVG X;  2MP2 A;  3PZD A;  3EEC A;  2C5L C;  2IY1 B;  2MP2 B;  2LAS A;  3JW0 X;  1OTR B;  3PLU A;  1BT0 A;  2KQS A;  4BFR A;  2K8H A;  2C7N B;  3N30 A;  2WDT B;  4KZ0 A;  5HKH A;  1OEY J;  3L54 A;  4B95 A;  2A5U A;  2GBK A;  4BKS D;  2NVU I;  2FAZ A;  3C0R B;  4X57 B;  2LRU A;  2REX A;  2KWU B;  1GNU A;  4LJP B;  4WWP A;  2PEA A;  4MM3 A;  4RM9 A;  1X1M A;  5CX3 A;  1V2Y A;  2G4D B;  1LM8 B;  4NJ7 A;  3AU5 A;  4GMV A;  1WXV A;  1P1A A;  4IUM B;  5DPW A;  4HWI B;  2KMC A;  2MRP A;  4G11 A;  2LI5 A;  2CHX A;  2KJR A;  1OQY A;  4E71 A;  2L00 B;  4N9F 4;  3DPD A;  3VFK A;  3PRM B;  4AWJ A;  4PS3 A;  2Z59 B;  3PPA A;  4K81 A;  3R7Q A;  2LXC A;  4WJQ A;  1M94 A;  4WWN A;  1E90 A;  3KUZ A;  3QQ8 B;  4M8N A;  1D3Z A;  3W1Y A;  3SD5 A;  2BKF A;  2J7Q B;  4HDQ A;  3IBE A;  3ZKJ C;  2K8B A;  3AXC A;  2O6V A;  2AEH A;  3PVL A;  3QJZ A;  4B9K A;  3L13 A;  5AZF A;  2KTF A;  1UGM A;  5JZE B;  3V60 A;  2O6V B;  2LZ6 A;  2FIF A;  1WX9 A;  4NQL B;  3QX1 A;  3IHP C;  3L0W B;  4K7W A;  4J6I A;  4AP4 C;  4FHJ A;  4GOC A;  4FJV B;  4MGZ E;  4ANU A;  4HJK A;  1Q5W B;  3R7R A;  3GOE A;  3PSE B;  2CHW A;  2K8C A;  2MBH A;  3A9J A;  5L95 C;  2I1K A;  1TTN A;  1UZX B;  2D2Q A;  3A9J B;  3A33 B;  4FA6 A;  2AL6 A;  1WRD B;  4WJP A;  2L0F A;  4RMA A;  1LFD A;  2KO3 A;  4PYZ A;  2JXX A;  2ZCC A;  3VTV A;  4A3O A;  4NAW A;  3HM3 A;  2GBM A;  4AOF A;  3WAN A;  4KSL C;  2KAN A;  4DK5 A;  1XT9 B;  4DBG A;  3KUD B;  1V9J A;  5CTR C;  3L16 A;  2FCQ A;  2MA9 B;  3KVF B;  4FN2 A;  4I6L B;  4M8M A;  5D7G A;  3ZUN A;  1OEY A;  3N32 A;  3PLV A;  3NOB A;  3M62 B;  4HPM B;  4KVG B;  4MDK E;  4DHZ B;  2DEN B;  2K1F A;  5IA7 A;  3JVZ X;  1IP9 A;  2N7D A;  4GDK A;  2HD5 B;  3RZF A;  2Y5B B;  1F9J A;  4KZC A;  2KDF B;  4GDK B;  2KTR A;  2R2Q A;  4ICV A;  5J2R A;  1P3Q U;  1S1Q B;  3H6N A;  2LVP A;  3SDL C;  3ML8 A;  3QWZ B;  4CHK A;  3M95 A;  2MBO A;  4DWF A;  2V1Y A;  2GBR A;  4NQK E;  2KX0 A;  3RUL A;  3WA0 A;  2LJ5 A;  3DBH I;  3PHW B;  4KIK A;  4ZRI A;  2D10 A;  3X0W A;  2XBB C;  5L83 A;  3NHE B;  4AJW A;  1YD8 U;  2KVR A;  3RYT A;  3PS6 A;  4KIK B;  3WAP A;  3TCA A;  2RD0 A;  1IYF A;  1WJ4 A;  2KJH B;  4BVU C;  1P0R A;  3S2A A;  4IM0 A;  1RFA A;  1WGG A;  2PE9 A;  3WAL A;  1WJ6 A;  3PGE A;  4MGK E;  3VDZ A;  3APF A;  4TUU A;  3VUX A;  2LXA A;  4AUQ C;  5KHQ A;  3VH4 B;  4BKG A;  3Q3J A;  1WIA A;  3RZW C;  5IAA C;  2IO0 B;  2KFK A;  2PPH A;  2IY0 B;  4I6N B;  2V3S A;  4JIO U;  1P98 A;  4MJS A;  2KFK B;  3P2B A;  2IO3 B;  3OJ4 B;  3Q3F A;  3DCG A;  4MJS B;  4W9H A;  1GG3 A;  5LLI A;  3B08 A;  3WAM A;  4ASW C;  2NBW B;  2KFJ A;  2VRR B;  2NBV B;  2PE6 B;  4EZK A;  3ENE A;  2Z0E B;  4EEW A;  2C9W B;  4LJO B;  1WGR A;  3EFU A;  4HCP B;  1SIF A;  3VXW A;  4PS8 A;  4LCD E;  2ZZP B;  1WF9 A;  2HE7 A;  2GOW A;  3O65 B;  4NY0 A;  1C1Y B;  1ZKH A;  1KM7 A;  3UGB B;  5J17 A;  1V80 A;  1GUA B;  2FUH B;  2KLG A;  3AUL A;  4GB9 A;  2CU1 A;  3VTU A;  5EDS A;  4KV2 A;  4W9I A;  1UBI A;  2B3A A;  2BPS A;  3MHS D;  3LDZ E;  4TQ0 A;  3VH3 B;  2A4Z A;  2WX1 A;  4I6P A;  4XC2 A;  3ONS A;  2RGF A;  3APD A;  4OVU A;  1V86 A;  4DHJ B;  2N1W A;  1WZ3 A;  3W1S C;  2BWF A;  4ANX A;  1GC7 A;  3QAR A;  3R3M A;  3MJW A;  1R4N I;  2D07 B;  4DHJ D;  4WJN A;  1WI0 A;  3PRZ A;  2NPT A;  1WM3 A;  2DZI A;  1XD3 B;  3CMM B;  2DAF A;  5AZH A;  4ZRK A;  1WX8 A;  3ZNZ B;  1R4M I;  1WGY A;  2DZJ A;  2NPT B;  3WAO A;  4NNJ B;  3R66 C;  2KHW B;  4P7I A;  2JZZ A;  3OLM D;  4A3P A;  4F8C B;  2J0M A;  3GZN I;  4CYE A;  2NCN A;  2FCM A;  1GJZ A;  2DYO A;  2JPH A;  2L05 A;  2MQJ A;  1G6J A;  2N9P C;  4W9G A;  2N7E A;  2DYM A;  2LWP A;  2N9X A;  3ZNI D;  1AAR A;  3K9O B;  4HPL B;  4MH0 E;  2JY6 A;  3V6C B;  1WX7 A;  2MX2 A;  3KYC D;  4W9C A;  2O2V A;  4HK2 A;  2KKC A;  1EUV B;  1SE9 A;  2O6V D;  2O2V B;  4JLC A;  3M63 B;  3U8Z A;  2KLC A;  3I3T B;  4IWO A;  1TGZ B;  3A4S C;  1HE8 A;  1UH6 A;  1EO6 A;  3HHM A;  3EHV A;  3VUY A;  4A20 A;  5LXH A;  1WY8 A;  1YX5 B;  2AL3 A;  2MBB B;  2OJR A;  1XQQ A;  1WZ0 A;  2QHO A;  1V49 A;  5JHA A;  1WGD A;  3UF8 A;  3AI5 A;  2ZCB A;  4NAW B;  3CSF A;  2KWV B;  5AZG A;  2BF8 B;  3PRP B;  4JL9 A;  1GC6 A;  2C7M B;  2R2O A;  1LQB A;  2XEW A;  2AYO B;  4G3X B;  1V5O A;  1OGW A;  5CHF A;  1EF5 A;  2IO1 B;  4BBN F;  3QCA A;  4XZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...