2UYZB

Non-covalent complex between ubc9 and sumo1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
78
structure length
78
Chain Sequence
MEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords SUMO-CONJUGATING ENZYME UBC9
publication title Noncovalent interaction between Ubc9 and SUMO promotes SUMO chain formation.
pubmed doi rcsb
source organism Mus musculus
total genus 18
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2007-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2uyzB00
4NJ7A 1BT0A 3A4SC 3APDA 4JL9A 1P98A 4FA6A 1LXDA 2IO2B 4ANUA 2L76A 3JYUA 1IYFA 2CHXA 3NZUA 2GBJA 4GB9A 2A4ZA 1ISNA 3KVFB 4MGKE 3VFKA 3PRMB 4AJYB 1JRUA 3DDCB 4NJ6A 2KDBA 3Q3JA 4HDQA 2REXA 2JZ3B 5JHAA 1WJNA 2NPTB 3N30A 4GGQA 2EMTA 1FXTB 2M0XA 2NVUI 2OJRA 4MGIE 3HK0A 2WX0A 1WGDA 3RZWC 2HJ8A 4NY0A 3DCGA 3KW5B 3ZIMA 1WXAA 3TCAA 1VD2A 1WF9A 3P2BA 2DZMA 4MJSB 5JHBA 2L0TA 2C7HA 2MP2A 1YJ1A 3TJPA 4HK2A 2DENB 3A9JA 1A5RA 4GIVA 4HXDA 3PRZA 2BYVE 3PZDA 4MH0E 2G45B 1TZ1A 4DHJB 1E8YA 2KMCA 3QC8B 2KVRA 5EDSA 2KFJA 2C7MB 4URKA 1TGZB 4GDLB 3VHTC 2I1KA 2IY1B 3CSFA 2KOXA 4HPLB 3C0RB 2BKFA 2XK5A 3QARA 1V5OA 4FHKA 3U30A 4HDOA 2ZNVB 2D10A 2O6VA 4KDLB 3VVWB 4DXAB 2W9NA 1QZEA 2KANA 1YIWA 2CHZA 2MSED 4M8MA 1V6EA 2M1MA 4FHJA 2LVQA 4BKGA 2KKCA 2FUHB 2BGFA 2HTHA 3KUCB 3N32A 3PLVA 3WALA 4WJQA 4J6IA 2BWES 3UQAA 3HHMA 2KTRA 2AL6A 2R2QA 4EEWA 4JGHB 1SE9A 4HWIB 3WANA 3KUZA 3AU4A 2M8SA 2K6QA 3M95A 1V9JA 4G3XB 4IM2A 4DDGD 2FCSA 4FJVB 2LUEA 4DHZB 3V62A 4RMAA 3OJ4B 3HM3A 3W1YA 3S2AA 3VH3B 2ASQA 4EOYA 1ZGUB 2LGDA 2NR2A 1L7YA 4MM3A 5DPTA 1KM7A 3UINB 3H6NA 2DHZA 3ZDTA 1E8ZA 2M4NA 4GMVA 3WAOA 3ZUNA 2L00B 2NPTA 3IFWB 3A9JB 2BWFA 5LXIB 3I3TB 2MBEA 3PTFC 2AL3A 3QX1A 4KZCA 1G6JA 4MJSA 3JSVA 3DVGX 2WX1A 2PE9A 4ANWA 1WJ4A 4FADA 2RPQA 1E8XA 4WAAA 2DAFA 1R4NI 2KJHB 4FJZA 5KHOA 1HE8A 3MJWA 1EF1A 1S3SG 4JQWC 4A3PA 5C1ZA 5CHFA 2XK5B 3APFA 3ECIA 2KZRA 3MHSD 4K81A 2O6VB 4KIKA 2KDEB 4HCPB 4GDLA 3VDZA 3KYDD 3R66C 3PLUA 2L7RA 5J2RA 3CSTA 2KHWB 4PYUA 3WIMA 1WGGA 2KMAA 3LJ3A 1E90A 4CHKA 1WM2A 3TL5A 4FULA 1GG3A 4HLEA 2LXAA 3VXWA 2PPHA 1UBIA 2G4SA 2BYEA 1WJ6A 2RR9A 4MDKE 4NAWA 4EFOA 4WJNA 5IAAC 3QJZA 2N1WA 2C5LC 3NS8A 1WE6A 2K8CA 2L0FA 4IWPA 3H7SA 3HIZA 3KUDB 3V61A 2GMIC 4W9GA 3SHQA 2JWZA 3D32A 2C9WB 5L95C 3HM6X 2IO0B 4GDKA 1J19A 1WR1A 3QA8A 3T8MA 2V4LA 4AOFA 2DAJA 2AWTA 2XBBC 3W1SA 2DX5B 3MTNB 2L05A 4W9FA 4TUUA 5E6NA 2JRHA 4IC7B 3DVNU 4GSWA 3NZSA 4HPMB 4JIOU 4MGZE 4PS8A 3DQVA 4DK5A 5J17A 1WGRA 4FN2A 1V80A 5D2MB 4EZLA 3JSVB 1RAXA 2MWSB 3VAWA 4LJOB 2DZKA 4N9F4 3ZW3A 3TBLD 4W9LA 4EKUA 4LJPB 3A9KA 2LXCA 4DHJD 4W9DA 5G2NA 2V1YA 2K8HA 5D7GA 4HCNB 2GBKA 4PS3A 1P3QU 1WXSA 2JT4B 4FBJB 1NI2A 4AWJA 3U7DA 2ZZPB 2MA9B 4AJWA 2KLGA 4BKSD 4K1RB 4K7UA 4KIKB 3PREA 2C60A 1J0GA 1E5WA 1E7UA 3RYTA 2LZ6A 3VTWA 2N9PC 2NBVB 2ZVNA 4IG7B 2D3GA 2V3SA 4GXBA 3ZTDA 3UIPB 4EUTA 4DHZE 3L54A 1WX8A 1OEYJ 4ZRIA 1SIFA 3AULA 4WJPA 4B6WA 3IHPC 3TMPB 4EZJA 2FCMA 3OLMD 1TTNA 2LGYA 4NAWB 4WWPA 3PHWB 4I6PA 1I42A 4W9KA 2JRIB 3WA0A 2MBOA 3ML9A 3OJ3A 3SDLC 5D6JB 3UQBA 2ZEQA 1KLVA 2KC2A 3ZO5B 4P7IA 3X0WA 4GN1A 4RM8A 3ZKJC 2KWUB 1OGWA 2GBRA 3NOBA 2MBBB 4IM0A 1LQBA 4PYZA 1WX7A 4KSKC 4KZ0A 5LLIA 3RULA 1Z5SB 3ONSA 3VQIA 4A3OA 4ZRKA 4GDKB 1YQBA 2DYMA 4LDTB 1RLFA 2IY0B 5GMVA 2UWQA 5D94A 4ASWC 2NBWB 4HVBA 3AXCA 1WJUA 2CR5A 5CHVC 3A1QA 3PHXB 4ZRJA 1UELA 2ZPNA 4BVUC 4G50A 5DPRA 2KX0A 4TKNA 2MBHA 4AUQC 3V60A 4EZKA 3QQ8B 2KD0A 3JW0X 2DZJA 4IWQA 3NY5A 2BYFA 2KFKA 2BF8B 3QWZB 4IUMB 1GC7A 4KDIC 4MELA 2KQ7A 2B3AA 2KLCA 3A9KB 3DVGY 4K7WA 4WWNA 3H7PA 4NPNA 1EF5A 4BBNF 4KV2A 4IM3A 4DWFA 4HJKA 5JZEB 1WZ0A 2DYBA 2KDIA 2KN5A 4I6NB 2LVPA 3V6EB 2CS4A 2NBUA 2JY6A 2D11A 2Z0EB 3IBEA 1E7VA 1NDDA 1PQSA 1KOTA 1UGMA 2O6VD 4WQOB 1ZW7A 3LDZE 1NBFC 3CMMB 3R3MA 3AU5A 4G0NB 2L3ZA 3L0WB 3PSEB 3EFUA 3DOWA 1WRDB 3ZVVA 2A5UA 3K9OB 1GC6A 3PRPB 2JPHA 2LASA 1P0RA 2ZCCA 2FNJB 1VCBA 3L16A 3GZNI 2QHOA 1GJZA 2N4FA 2ZVOA 5DPSA 1C3TA 3R7RA 1MG8A 2LGXA 2LD9A 4YL8A 4K7SA 3ZTCA 3IVFA 4PS7A 4ZDVA 1C1YB 3WAMA 2WWZA 1YX6B 2IBIB 4ZYNA 2L8JA 3M63B 4BOSC 4JLCA 1OQYA 2KNBA 1LFDA 2D07B 4TQ0A 2YLMA 3A1QB 2KC1A 3PVLA 5CHWA 1V49A 4ICUA 1XD3B 4MEMA 2HE7A 3AI5A 3DBLI 1UBQA 2WYQA 3L10B 3JVZX 3L13A 2JVCA 3QIJA 1SGHA 4W9IA 3V6CB 2GBMA 2KFKB 1WGYA 2CKHB 1XT9B 1EUVB 4IWOA 3ZRFA 2FIFA 3ZNGC 1GNUA 1LM8B 5G55A 1H8CA 5AZFA 2Z59B 2N9XA 3SD5A 2K1FA 4F7ZA 1WH3A 4W9EA 1GUAB 3ZLZA 3ZNHB 3H7PB 4X57B 4DDID 1P9DU 4G11A 3RZFA 3QAQA 3DPDA 4BFRA 1V5TA 1WM3A 1M94A 3B1LX 1IP9A 4KVGB 3VUXA 1P1AA 1ZKHA 2LRWA 1V2YA 2AYOB 2NS5A 3QK0A 2KJ6A 2J0JA 3ZDMC 1RFAA 4E71A 1WIAA 2MBQA 2OOBB 3T9LA 3N3KB 4XX5A 2N7EA 5C23A 2KX3A 3VUWA 2KQSA 1WE7A 3ML8A 2EMSA 1V81A 2MCNB 5L83A 2Z0DB 4MSMB 4OVUA 5TR5A 2YVCA 2FCNA 4E3CA 4F8CB 2N7DA 5DCNA 2IZVB 5AEKB 2G4DB 2ZCBA 2LWPA 2O2VB 4B9KA 1EO6A 3TIXA 4NNJB 4CYEA 5HKHA 3Q3FA 4W9HA 4M0WB 2JXXA 2FAZA 3UF8A 2RD0A 3B0AA 5E6PA 2KO3A 3ENEA 3DVNV 4ANVA 1AARA 2G3QB 4WWOA 4OVVA 2J7QB 3SU8X 2R2OA 2KWVB 3PT2B 2KJRA 2IYDB 3KH0A 3RT3B 4F1SA 2PE6B 4LDTD 4XZ4A 2IO3B 3UIOB 1F9JA 1OEYA 4B95A 2RGFA 5E6OA 4LCDE 2BKRB 4W9JA 2AEHA 2JZZA 2J0MA 2MRPA 1TBEA 2KK8A 2KWCA 3BY4B 3GOEA 4A20A 4MSQB 4FJYA 5KHQA 1WMHA 2LRUA 2ZPYA 1H4RA 3WAPA 1WI0A 5IA7A 3KYCD 1K8RB 3PS6A 4II2B 4KSLC 4ICVA 3R7QA 3ZNID 1CMXB 3H1UA 3ZNZB 5DPWA 1T0YA 3VTUA 3VUYA 1IPGA 3BINA 3IG3A 2VRRB 3ALBA 3APCA 3PV1A 4NQKE 2GOWA 2JUOA 4W9CA 4GOCA 1WXVA 2JF5A 1Q5WB 1I35A 3B08A 4IW0A 4GU2A 2M17A 1UD7A 1XQQA 2PEAA 2IO1B 2MQJA 3X23A 1WFYA 1UZXB 4NQLB 4DBGA 1WGHA 5AZGA 3M62B 2KTFA 1S1QB 4AP4C 3PGEA 3RUIB 2I1JA 4ANXA 4M8NA 2NCNA 1R4MI 2CU1A 3ZRCA 1WR6E 2WDTB 2MW5A 1V86A 4CO7A 3VH4B 2MP2B 3QHTA 1D3ZA 5LXHA 3EHVA 4FLHA 4RM9A 2LI5A 2LVOA 1L2NA 4TV3A 2K8BA 2XEWA 3EECA 3OAWA 4TQ1A 3UGBB 2DYOA 2O2VA 1WYWB 2ZJDA 2K6DB 5CTRC 5AZHA 1E8WA 2K39A 1Y8RC 2BPSA 2ZNVC 4XC2A 1WXMA 3U8ZA 1Q1OA 4BBNC 2PJHA 3QCAA 1WZ3A 2KDFB 2DZIA 3M3JA 1KJTA 2N9EB 2LJ5A 2MLBA 4WJOA 4BOZB 1YX5B 2C7NB 3NHEB 1OTRB 1Q0WB 2J0KA 5FR6A 2N1VA 5JH5C 2HD5B 1RRBA 2KXJA 3EC8A 4BKSA 4MGYE 1U4AA 2FCQA 1WMHB 1WY8A 3RCZA 3VTVA 3A33B 3A4RA 1WX9A 2RSUA 5CX3A 2UYZB 1YD8U 1X1MA 2FIDA 3K9PB 5BO4B 2D2QA 2CHWA 3H9DA 4E74A 3DBHI 2KTRB 4BKTA 3DBSA 3W1SC 2K25A 2Y5BB 3RD2A 1Z2MA 3L08A 3O65B 2GBNA 1UH6A 4II3B 1J8CA 3L17A 3DBRI 5J18A 3PPAA 2MX2A 3CF6E 2EKEC 4I6LB
chains in the Genus database with same CATH superfamily
3A4SC 1YJJA 1JCKB 2IO2B 4ANUA 1V8CA 4OW0A 2L76A 3NZUA 1MFWA 1FM0D 1ISNA 1QLBB 2WXNA 3AV8A 1JRUA 3DDCB 4NJ6A 4YT0B 1FD6A 2KDBA 3N30A 4GGQA 2OJRA 2M0XA 1WGDA 1NYQA 3DCGA 3MP9A 3TCAA 3P2BA 1T0RC 4L1BA 5JHBA 3SR6A 2HJ1A 1XLNA 4HK2A 2FUG1 3T3NA 2KVZA 3PZDA 4MH0E 2G45B 2FE8A 2KMCA 2KFJA 2C7MB 4GDLB 1FIQA 3GB1A 3VHTC 2V3NA 3CSFA 2KOXA 1M4VA 3Q3NC 1SJED 1FRDA 2PKOA 1V5OA 2ZNVB 3VVWB 1SSNA 2RDBC 4LNKA 1V6EA 4FHJA 2KKCA 2BGFA 1EU3A 2BWES 1JALA 3NVWA 1XLOA 2KTRA 1P7FA 1QT9A 2AQ3B 3AU4A 4DDGD 4XYCA 4FJVB 4DHZB 2LEKA 3VH3B 3TEZA 2ASQA 1F52A 2LGDA 2JXTA 2ONQA 1L7YA 1KM7A 3UINB 3VRBB 1UWXA 3H6NA 1E10A 2J4XA 4GMVA 2L00B 2L32A 3DWGC 1AN8A 3I3TB 3Q3OC 1RWSA 3GS2A 4KGRA 4LK0M 1E8XA 2WXRA 1TS5A 2DAFA 2KJHB 3RN9C 1EF1A 1S3SG 4JQWC 2XK5B 3ECIA 4KIKA 4K81A 3U2SC 1XCQL 4GDLA 3R66C 2IPKD 2ICIA 1JWBD 3CSTA 2MJEA 1HEZE 1V1PA 1PYWD 1E90A 2BTEA 3W9CB 2LXAA 1FMAD 4MDKE 2RR9A 5IAAC 3B2FA 5JXVA 2ZW0A 3TSSA 4IWPA 4W9GA 3LXFA 2XNAC 1J19A 1B9RA 1GB4A 2V4LA 1E6EB 2AWTA 2XBBC 3W1SA 2DX5B 4TUUA 1XEEA 2JRHA 3AEBB 4OZCA 1JQ4A 5J17A 4DK5A 4WAFA 1WGRA 3ETRA 5D2MB 3RNBC 1RAXA 3E56A 1QOAA 1IGDA 3Q3MC 2PVGC 4W9DA 3RMKC 2V1YA 2GBKA 4OZAA 4PS3A 3BIID 2RMMA 1NI2A 2WXLA 2ZZPB 4XDCA 2ZVNA 1ZXIA 2J42A 4DHZE 3AULA 2H89B 1JWSD 3IHPC 4EZJA 4NAWB 3PHWB 1I42A 1YNTE 3ML9A 3Q8EA 3UQBA 5D6JB 1KLVA 3ZO5B 2NTTA 1L5PA 2KWUB 1FO4A 3L4PA 4PYZA 2G1EA 1WX7A 4KSKC 5LLIA 1PGXA 1I7HA 1ZE3D 4R3DA 1TS3A 1YQ4B 2H88B 2CR5A 3PHXB 1UELA 4BVUC 4G50A 2KX0A 3AE4B 3J9CA 3FILA 1ZOYB 2KD0A 3JW0X 2BYFA 3NUHB 2KFKA 2BF8B 3QWZB 5IOIA 1GC7A 1KH0A 4MELA 1KFYB 1WGKA 1ZP0B 1AW7A 4BBNF 4HJKA 1RM6C 4JX1C 2DYBA 4I6NB 4EE2A 1TS2A 2QEJC 2D11A 2Z0EB 3RNFC 1E7VA 3FC4A 1P7EA 3LDZE 1K52A 2JWUA 4G0NB 3AU5A 3RNAC 1D5ZC 3ZXVA 1JWMD 1HQRD 3ZVVA 2JX5A 5BMGA 2LASA 2WXKA 1VCBA 4LNFA 3Q8FA 3R7RA 2LGXA 2WHIA 4YL8A 4NAMA 1L0YB 3AE8B 4BOSC 3ZGZA 2KNBA 2YLMA 3A1QB 3PVLA 5CHWA 1KTKA 1V49A 1F77A 3JVZX 3QIJA 3ZJTA 1SGHA 3ZRFA 4US8A 3ZNGC 1LM8B 2Z59B 3SD5A 2KN4A 2CU3A 4X57B 4G11A 3QAQA 4BFRA 4KVGB 3VUXA 1PDXA 2K9XA 5I4DA 3RNCC 1V2YA 2NS5A 3QK0A 4US9A 2WXPA 1RFAA 1WIAA 3N3KB 4XX5A 2W82A 2KQSA 1PGAA 1WE7A 2EMSA 5L83A 2Z0DB 4F8CB 1FXAA 1T0SC 2BT6A 3NZ3A 2QDFA 3H8HA 3TIXA 4CYEA 5HKHA 4M0WB 5E6PA 4ZRQA 1QOBA 1L0VB 2NMQA 1SBBB 4ACFA 2Q5WD 4OVVA 2YEPB 2IO3B 3SFDB 2WGSA 2BKRB 2AEHA 5FKAC 2J0MA 2KK8A 3DHHC 4A20A 4MSQB 5KHQA 2ZPYA 5IA7A 3I5JC 1PUTA 1K8RB 4KSLC 3ZNID 3C19A 1T0YA 3VTUA 1FCCC 2VRRB 3APCA 4NQKE 2JUOA 3AEFB 4HROA 1FRRA 1Q10A 1NEKB 4GU2A 1CK1A 3X23A 5GXGB 1UZXB 3NS1A 1S1QB 4AP4C 4ANXA 4M8NA 2NCNA 1MVKA 1T3QA 1WR6E 2WDTB 3KLSX 2MP2B 3WCQA 3EGRA 1D3ZA 1L2NA 4TV3A 3N9YC 2ZJDA 2K6DB 2ZNVC 1Y8RC 2BPSA 3U8ZA 4BBNC 1WXMA 1WXQA 3VRAB 4M0WA 1KJTA 4YSZB 5JH5C 3NHEB 5FR6A 1Q0WB 2UU7A 3VR8B 1RRBA 2KXJA 2V4IB 3EC8A 1FPYA 4MGYE 1WMHB 4JE3B 2UYZB 3I63C 1YD8U 2FIDA 1ET6A 2Y5CA 4YWGG 3W1SC 2K25A 2J53A 1IBXB 2K22A 1E7PB 1TY0A 3AE7B 3W5VB 2GBNA 1XO3A 4FA6A 3NVZA 4S17A 1UNSA 3JYUA 1I4PA 4MM3B 2JQRB 3KVFB 1FCLA 1DYQA 4MGKE 1TY2A 3PRMB 1WYGA 4ZRPA 2HDEA 1N5WA 5JHAA 1F1HA 1CZPA 3HK0A 2HJ8A 3KW5B 1WXAA 1VD2A 1R7SA 1UF0A 2MP2A 2BS3B 1YJ1A 3AE5B 1A5RA 1EWYC 1L0XB 5C3JB 2K5PA 2Z8LA 1PFDA 3C0RB 3HVZA 5C2TB 3QARA 4WURA 4HDOA 1C4AA 2D10A 2GRIA 2JYEA 4KDLB 2W9NA 2KANA 1YIWA 2MSED 2X8XX 2M1MA 1VRAB 2FUHB 3AM9A 2HTHA 3PLVA 2KT7A 4WJQA 3FAHA 2WDVB 2AL6A 2R2QA 1IBXA 3M95A 2K6QA 1V9JA 3DHIC 3N1ZC 2FCSA 1LGRA 2LUEA 2PW9A 3V62A 4MT5A 2NR2A 2QIEB 1D5MC 4MM3A 1FNVA 1XLPA 1QKZA 3MFGA 2DHZA 4YTMB 1FNWA 2YEPF 3WAOA 2DLBA 4OZBA 3ZUNA 4N6EB 3PTFC 3JSVA 2WX1A 1WJ4A 1E0ZA 4WAAA 1R4NI 5KHOA 1HE8A 3MJWA 2KZRA 1A70A 4HCPB 4ARCA 1QF6A 3TEXA 2QCZA 2L7RA 2LMCA 3WIMA 1WGGA 2KMAA 3LJ3A 4CHKA 3MC0B 1WM2A 2D3CA 4USAA 4A55A 4HLEA 2PPHA 1UBIA 5IO9A 1HXYD 2IDYA 4EFOA 4WJNA 2N1WA 1SJHD 5BMIA 1K51A 1WE6A 2L0FA 3KUDB 3SHQA 1BUIC 3ZYYX 3D32A 2WDRB 3AN1A 2IO0B 4GDKA 1WR1A 2WXQA 4AOFA 5D3IB 2L05A 4KKIA 1JROA 5E6NA 3Q2AC 1YQ3B 4GSWA 4A9AA 5IN7A 4HPMB 4RFBA 4K3CA 1HA5A 2MWSB 2LHDA 3ZQ4A 4LJPB 2LXCA 5G2NA 1WWTA 3NVYA 3U7DA 2KLGA 3I9V1 4KIKB 1TKYA 2NBVB 5BYQA 2D3GA 1V1PB 3TMPB 2FCMA 4WWPA 2BQQA 4I6PA 2WXFA 3AEEB 3WA0A 2MBOA 1N63A 4HRSA 3X0WA 1ZXHA 4GN1A 1I4RA 2PLPA 5LNK1 1HZ6A 3P1MA 4KZ0A 1Z5SB 3ONSA 2UWQA 2IGHA 4ASWC 4HVBA 1WJUA 5CHVC 4RGMA 2W3RA 3GE3C 3BK2A 3V60A 4EZKA 3B9JA 4XDDA 5AUKA 4IUMB 3DVGY 2INCC 2D3BA 3Q8BA 3H7PA 4NPNA 4RF1A 4KV2A 5JZEB 1WZ0A 1MHHE 2NBUA 2JY6A 4C80A 1PQSA 3UI3A 1D6EC 3ABVB 2VZKD 4L2YA 4DXGA 1WRDB 1FFUA 3K9OB 2JPHA 4C56C 3CWIA 2ZCCA 3GE8C 4A6QA 2N4FA 1KF6B 1MG8A 2V9HA 2W3SA 1YX6B 2E3TA 2IBIB 3M63B 4JLCA 1OQYA 2SAKA 2KC1A 4J3OD 1XD3B 4MEMA 3AI5A 3L10B 3FILB 2JVCA 1B1ZA 4DQOC 3V6CB 5BYRA 2KFKB 3U4EG 1WGYA 1XT9B 2WXOA 4C7ZA 4IWOA 2OEDA 2QSDA 4IOIE 1H8CA 4C4VB 2K1FA 4WQMA 4W9EA 5EE1A 1GUAB 4DDID 3RZFA 3LYYA 3DPDA 1WM3A 1M94A 2M19A 3KWVA 1ZKHA 4B0MA 2LRWA 3NJTA 2AYOB 3Q14C 1K50A 3ZDMC 5C23A 4REZA 1V81A 4A90A 5TR5A 4E3CA 2FCNA 2N7DA 5DCNA 2IZVB 4HJGE 4HKQA 4NNJB 2KQ4X 3UF8A 2RD0A 3B0AA 2JYTA 2J7QB 4YTNB 2R2OA 1ZPSA 3RT3B 2Y3AA 4F1SA 3URYA 4LDTD 1GOZA 4N58A 5E6OA 4C00A 2Y5PA 3SEBA 3T3OA 1TBEA 2KWCA 1SXTA 1C77A 1WI0A 1J7CA 1I4XA 4II2B 1ZDVA 1CMXB 3W2DA 3H1UA 1IPGA 3ALBA 2L1AA 2JSVX 4GOCA 3LB8C 3B08A 4C4VA 1SE4A 1UD7A 1XQQA 2M17A 3MJ5A 3E9SA 1WGHA 3RUIB 2I1JA 2INDC 1UGJA 1F2RI 2MH7A 1FXIA 2CU1A 1V86A 3QHTA 4FLHA 2J52A 2LVOA 3DBHB 3P4SB 4O1NA 4WIPA 3V3XA 2NTSA 2DYOA 3AB5A 4XWWA 1WYWB 5CTRC 1E8WA 2KDFB 2DZIA 5HHDG 2MLBA 2GB1A 1YX5B 2AQ2B 2N1VA 2HD5B 2PTLA 1WY8A 1WX9A 1NI3A 4YXDB 3K9PB 2D2QA 2CHWA 3H9DA 3DBHI 2GI9A 4ARIA 3DBSA 2KMMA 1Z2MA 3L08A 1AWDA 1UH6A 5J18A 3PPAA 2MX2A 3CF6E 1UWMA 4NJ7A 3APDA 1P98A 1LXDA 1IYFA 2GBJA 4GB9A 2A4ZA 2WS3B 1JWAD 3EA6A 4AJYB 1NENB 3Q3JA 2REXA 2NPTB 3NRZA 5T8IA 2EMTA 1FXTB 2L52A 2WX0A 4NY0A 3ZIMA 1KLGD 3IAM1 4MJSB 2I38A 2DENB 3A9JA 4GIVA 1XF5L 4HXDA 2BYVE 2RDGA 4M02A 1DOIA 1OFFA 1TZ1A 4PK1A 3QC8B 2MJDA 5EDSA 1TGZB 2R61A 2I1KA 1C78A 2BKFA 4AQ7A 3U30A 2O6VA 4D2KA 2CHZA 4Q2JA 4M8MA 2LVQA 3P4RB 4BKGA 3N1XC 3HHMA 1WSPA 4JGHB 2DBYA 3KUZA 3WANA 2M8SA 4IM2A 4G3XB 3Q8AA 1I4QA 4XWTA 3W1YA 3S2AA 2M0AA 4EOYA 1ZGUB 1L4ZB 5DPTA 4NZLB 3ZDTA 1E8ZA 1RYJA 2NPTA 2KAJA 4M01A 4ITKA 3O13A 2MBEA 1G6JA 4MJSA 1ACCA 2OJWA 3KQ4A 4ANWA 4FADA 3PO0A 4A3PA 3MHSD 3VDZA 1IUEA 3PLUA 5J2RA 2VZKB 2KHWB 1NVID 2KYWA 1TIFA 1GG3A 3AEGB 2RDHA 1WJ6A 2BB5A 2CJNA 2X38A 2KACA 3BVZA 1QOFA 3H7SA 3PZ7A 4C7YA 3AE3B 3V61A 2GMIC 3P42A 2JWZA 5L95C 1NYRA 3T8MA 1HZ5A 4WWMA 2GLSA 4KX6B 2LJIA 4A8XC 3KWLA 4HKZE 3DVNU 3NZSA 1QILA 4HEA1 4JIOU 4MGZE 4PS8A 3DQVA 4EZLA 1V80A 3JSVB 3VAWA 4RGNA 3ZW3A 2DZKA 3TBLD 1YMHE 4W9LA 3A9KA 4DHJD 1ENFA 2KWDA 1P3QU 2JT4B 2WLBA 2MA9B 4N59A 3AE6B 4K1RB 1J0GA 3PREA 2C60A 1E5WA 1E7UA 2LZ6A 3VTWA 1T6BX 4P1CC 2V3SA 1MG4A 3ZTDA 2WXMA 2VH1A 3UIPB 3L54A 1OEYJ 1TKGA 2MHJA 4MH8A 2LGYA 1RFKA 4W9KA 2XN9C 2ZEQA 1Y56A 4P7IA 4RM8A 3ZKJC 1OGWA 4IM0A 1LQBA 3RULA 3VQIA 4A3OA 4GDKB 2V3PA 4LDTB 1R4NB 3RNGC 1DGJA 1D4BA 2ZPNA 5DPRA 4TKNA 2LHEA 2DZJA 4IWQA 3NY5A 4NJCA 4KDIC 4K7WA 4WWNA 3ZJVA 4IM3A 2TSSA 4DWFA 1JW9D 2KDIA 2KN5A 2LVPA 2CS4A 3U7ZA 3TEWA 3R2IA 2O6VD 4WQOB 3IAS1 4RCOA 1J7BA 3CMMB 3DBLB 2L3ZA 1VZ8A 3L0WB 1C4PA 4RH6A 3DOWA 3P4PB 4MACA 5AUIA 1XLQA 2DWQA 1SB3C 3OWEB 3PRPB 4ZHOA 1TJEA 2WXIA 1P0RA 3HVDA 3L16A 2FNJB 1V1OA 2QHOA 2BVCA 2ZVOA 5DPSA 1F2RC 3BK1A 2LD9A 4LNOA 4PS7A 4ZDVA 3IT4B 1C1YB 2DNFA 4ZYNA 2L8JA 1LFDA 2D07B 3NG0A 3MHZA 3N20C 4ICUA 2HE7A 3DBLI 2WYQA 4YTPB 1IGCA 1UUPA 2CKHB 1EWCA 2FIFA 1GNUA 5G55A 2N9XA 4K3BA 4F7ZA 3ZLZA 3H7PB 3B1LX 1P1AA 2V0GA 5D3DA 1FNUA 4IKGA 4E71A 1YJIA 2WU2B 2MBQA 1N62A 2N7EA 1VR9A 2FBWB 2KX3A 2MCNB 4B0EA 4MSMB 4OVUA 2YVCA 1SF0A 5AEKB 1VLBA 2G4DB 2ZCBA 1DOXA 1EO6A 3TUOA 5IKCM 1GPXA 2WDQB 3ZJUA 2JXXA 2KO3A 3ENEA 4RNAA 1AARA 2G3QB 4KGTA 4HPPA 2IJ0A 3SU8X 2KWVB 3PT2B 2KJRA 2IYDB 3KH0A 1ET9A 4KGSA 4XZ4A 3UIOB 4B95A 2RGFA 3RI7C 4LCDE 4YSYB 2JZZA 2MRPA 1N6ZA 5HFYA 2QC8A 4FJYA 1OQRA 2SEBD 4ICVA 2EELA 2K3UA 3CIRB 2INPE 3IT6B 3BINA 1GB1A 2N9KA 1FEHA 2BS4B 1I35A 1MHXA 2PEAA 1ROEA 2MQJA 1PGBA 3EFCA 1CQVA 3BZDB 5AZGA 3M62B 1YN4A 3BVGA 3Q6BA 3PGEA 4L23A 3ZRCA 4DXFA 4CO7A 5LXHA 2ACZB 2G9HD 2LI5A 1N60A 3EECA 3OAWA 4TQ1A 3UGBB 5EE0A 5AZHA 1SE3A 2PIAA 2PJHA 1WZ3A 3U52E 1J7AA 4UDUC 3AEDB 2QILA 4LNIA 4RF0A 1V97A 2J0KA 1C9FA 4BKSA 2FCQA 4M00A 2HTME 2N0SB 3VTVA 3A33B 3A4RA 3IXSA 2LUMA 2RSUA 5CX3A 2IGDA 2BS2B 1X1MA 3RNEC 1E9MA 4XE0A 4E74A 1XCTL 3V05A 3AEAB 3O65B 4II3B 1J8CA 2IGGA 3B2GA 2EKEC 4I6LB 1BT0A 4JL9A 2CHXA 4LLGM 2JZPA 2WU5B 1ZDXA 1D5XC 3VFKA 4HDQA 2JZ3B 1WJNA 4P6VF 4MGIE 2NVUI 3RZWC 1TT5B 2BYTA 1WF9A 2DZMA 2L0TA 2C7HA 3TJPA 2CJOA 1C79A 3PRZA 4AS1A 4DHJB 1E8YA 2KVRA 4URKA 4JWUC 1F0ZA 2IY1B 4TSSA 4HPLB 2L83A 2XK5A 4FHKA 2LGSA 4DXAB 1QZEA 2M56B 2PMVA 3KUCB 3N32A 3I57A 3WALA 1JRPA 4J6IA 3UQAA 3AE2B 4BAXA 1L6VA 2K0PA 3AECB 4EEWA 1SE9A 4HWIB 4RMAA 1HTOA 3OJ4B 4PT5A 3HM3A 5FR3A 5EE9A 4CQNA 2QMTA 2EKIA 3EUB2 2M4NA 4JWSC 3IFWB 3A9JB 2BWFA 3TEYA 5LXIB 2AL3A 3QX1A 4KZCA 1WRIA 3DHGC 3DVGX 1YN3A 3ZXRA 2PE9A 2QJLA 5G5GA 4KKJA 2RPQA 1T5XD 4FJZA 4P16A 5C1ZA 5CHFA 3APFA 2N7JA 2O6VB 3SFEB 2KDEB 3BYYB 3KYDD 4PYUA 5BMHA 1SIJA 3BWUD 4JPSA 1STEA 3TL5A 2I2YA 4FULA 5HG2A 3VXWA 2G4SA 2BYEA 4NAWA 3QJZA 2C5LC 2OHFA 3NS8A 1KRHA 3P4QB 2K8CA 3HIZA 2PVOD 2C9WB 3HM6X 3QA8A 5FK9C 2DAJA 1GAQB 4W9FA 3MTNB 4IC7B 1FFVA 3W5UB 3AE1B 4FN2A 1HTQA 4LJOB 3PZ8A 4N9F4 4S0RA 4EKUA 2K8HA 2ZW1A 3C8YA 4HCNB 5D7GA 4FBJB 1WXSA 4AWJA 2WP9B 1N5XA 4AJWA 4BKSD 4K7UA 3RYTA 3OG5A 4H2AA 2N9PC 4IG7B 3Q8CA 2LFIA 1VZ6A 4GXBA 4EUTA 5E6JA 3P63A 1WX8A 4ZRIA 1EM7A 1SIFA 4WJPA 4B6WA 4LTUA 3OLMD 1TTNA 1I4HA 1TS4A 2JRIB 4RGOS 3OJ3A 4RGTA 5G5HA 3AE9B 3SDLC 2KC2A 1VZ7A 4FXCA 2GBRA 2ON8A 3NOBA 4BZAA 2MBBB 1YN5A 4ZRKA 1SEBD 1YQBA 2DYMA 3HUIA 3NVVA 1RLFA 2IY0B 5GMVA 1OQQA 5D94A 2NBWB 3AXCA 3BYTB 1N61A 3A1QA 4ZRJA 2MBHA 4AUQC 3QQ8B 5TSSA 1L6UA 1XXGA 3DWMA 1TYGB 3GZNB 2KQ7A 2B3AA 2KLCA 1MPEA 3GP7A 3A9KB 2AQ1B 1EF5A 4GLSC 3V6EB 5HI1A 3IBEA 4P1BC 4YSXB 3RFZB 1NDDA 1KOTA 1UGMA 1ZW7A 2D5GA 1TZOA 1NBFC 3R3MA 2B76B 1I4GA 3PSEB 3EFUA 1AYFA 4XGAB 2A5UA 2MEKA 1GC6A 2AX5A 2KDMA 4QAYA 4TMAB 3GZNI 1MJDA 1GJZA 4ZHPA 3VR9B 1C3TA 3HRDD 3AH7A 4K7SA 3ZTCA 3IVFA 3WAMA 2WWZA 3MC8A 1EU4A 2D3AA 4ZYSA 4TQ0A 2WXGA 3L13A 1UBQA 1JMLA 4W9IA 2GBMA 1EUVB 1VDVA 5AZFA 1WH3A 3ZNHB 1P9DU 2N9LA 1V5TA 1IP9A 2W55A 2BW2A 2LGIA 2WXJA 2KJ6A 2J0JA 2OOBB 2WXHA 1LO5D 3T9LA 3VUWA 1L4DB 2BB6A 3ML8A 2WNMA 2RPVA 2LWPA 2O2VB 4B9KA 3BVMA 3FKYA 3Q3FA 4W9HA 4ZOHC 2FAZA 1KLUD 1TKEA 3DVNV 5MPOA 4ANVA 4WWOA 3Q69A 2PE6B 1F9JA 1OEYA 4W9JA 3BY4B 3GOEA 3N1YC 2E6XA 1R4MB 1WMHA 2LRUA 4WH4A 1H4RA 3WAPA 5BYSA 3KYCD 3PS6A 1C4CA 1YOVB 3R7QA 3ZNZB 5DPWA 5H92C 3VUYA 3IG3A 3PV1A 2GOWA 4W9CA 1JWUD 1WXVA 2JF5A 1Q5WB 4IW0A 2IO1B 2JU6X 3R8BA 1ZUD2 5IP4D 1DOYA 2BBCA 1WFYA 4NQLB 4DBGA 2KTFA 1QOGA 1C76A 1R4MI 2MW5A 1ESFA 1VJKA 3VH4B 3EHVA 3AMZA 4RM9A 2W54A 5H8YE 2MJ3A 2K8BA 2XEWA 2O2VA 2K39A 4IDIA 4XC2A 1Q1OA 3DBRB 3QCAA 1SE2A 3M3JA 2N9EB 2LJ5A 4WJOA 4BOZB 2C7NB 1OTRB 1BMLC 1T0QC 1U4AA 4LNNA 2VH2A 3RCZA 2WQYB 4OHJA 1MI0A 5EE3A 3MC9A 2INNE 4OVZA 5BO4B 2KTRB 4BKTA 3R2TA 1BXTA 2Y5BB 3RD2A 1K53A 3L17A 1CJEA 1QQRA 3DBRI 3RPFC
chains in the Genus database with same CATH topology
4NJ7A 1BT0A 3A4SC 3APDA 4JL9A 1P98A 4FA6A 1LXDA 2IO2B 4ANUA 2L76A 3JYUA 1IYFA 2CHXA 3NZUA 2GBJA 4GB9A 2A4ZA 1ISNA 3KVFB 4MGKE 3VFKA 3PRMB 4AJYB 1JRUA 3DDCB 4NJ6A 2KDBA 3Q3JA 4HDQA 2REXA 2JZ3B 5JHAA 1WJNA 2NPTB 3N30A 4GGQA 2EMTA 1FXTB 2M0XA 2NVUI 2OJRA 4MGIE 3HK0A 2WX0A 1WGDA 3RZWC 2HJ8A 4NY0A 3DCGA 3KW5B 3ZIMA 1WXAA 3TCAA 1VD2A 1WF9A 3P2BA 2DZMA 4MJSB 5JHBA 2L0TA 2C7HA 2MP2A 1YJ1A 3TJPA 4HK2A 2DENB 3A9JA 1A5RA 4GIVA 4HXDA 3PRZA 2BYVE 3PZDA 4MH0E 2G45B 1TZ1A 4DHJB 1E8YA 2KMCA 3QC8B 2KVRA 5EDSA 2KFJA 2C7MB 4URKA 1TGZB 4GDLB 3VHTC 2I1KA 2IY1B 3CSFA 2KOXA 4HPLB 3C0RB 2BKFA 2XK5A 3QARA 1V5OA 4FHKA 3U30A 4HDOA 2ZNVB 2D10A 2O6VA 4KDLB 3VVWB 4DXAB 2W9NA 1QZEA 2KANA 1YIWA 2CHZA 2MSED 4M8MA 1V6EA 2M1MA 4FHJA 2LVQA 4BKGA 2KKCA 2FUHB 2BGFA 2HTHA 3KUCB 3N32A 3PLVA 3WALA 4WJQA 4J6IA 2BWES 3UQAA 3HHMA 2KTRA 2AL6A 2R2QA 4EEWA 4JGHB 1SE9A 4HWIB 3WANA 3KUZA 3AU4A 2M8SA 2K6QA 3M95A 1V9JA 4G3XB 4IM2A 4DDGD 2FCSA 4FJVB 2LUEA 4DHZB 3V62A 4RMAA 3OJ4B 3HM3A 3W1YA 3S2AA 3VH3B 2ASQA 4EOYA 1ZGUB 2LGDA 2NR2A 1L7YA 4MM3A 5DPTA 1KM7A 3UINB 3H6NA 2DHZA 3ZDTA 1E8ZA 2M4NA 4GMVA 3WAOA 3ZUNA 2L00B 2NPTA 3IFWB 3A9JB 2BWFA 5LXIB 3I3TB 2MBEA 3PTFC 2AL3A 3QX1A 4KZCA 1G6JA 4MJSA 3JSVA 3DVGX 2WX1A 2PE9A 4ANWA 1WJ4A 4FADA 2RPQA 1E8XA 4WAAA 2DAFA 1R4NI 2KJHB 4FJZA 5KHOA 1HE8A 3MJWA 1EF1A 1S3SG 4JQWC 4A3PA 5C1ZA 5CHFA 2XK5B 3APFA 3ECIA 2KZRA 3MHSD 4K81A 2O6VB 4KIKA 2KDEB 4HCPB 4GDLA 3VDZA 3KYDD 3R66C 3PLUA 2L7RA 5J2RA 3CSTA 2KHWB 4PYUA 3WIMA 1WGGA 2KMAA 3LJ3A 1E90A 4CHKA 1WM2A 3TL5A 4FULA 1GG3A 4HLEA 2LXAA 3VXWA 2PPHA 1UBIA 2G4SA 2BYEA 1WJ6A 2RR9A 4MDKE 4NAWA 4EFOA 4WJNA 5IAAC 3QJZA 2N1WA 2C5LC 3NS8A 1WE6A 2K8CA 2L0FA 4IWPA 3H7SA 3HIZA 3KUDB 3V61A 2GMIC 4W9GA 3SHQA 2JWZA 3D32A 2C9WB 5L95C 3HM6X 2IO0B 4GDKA 1J19A 1WR1A 3QA8A 3T8MA 2V4LA 4AOFA 2DAJA 2AWTA 2XBBC 3W1SA 2DX5B 3MTNB 2L05A 4W9FA 4TUUA 5E6NA 2JRHA 4IC7B 3DVNU 4GSWA 3NZSA 4HPMB 4JIOU 4MGZE 4PS8A 3DQVA 4DK5A 5J17A 1WGRA 4FN2A 1V80A 5D2MB 4EZLA 3JSVB 1RAXA 2MWSB 3VAWA 4LJOB 2DZKA 4N9F4 3ZW3A 3TBLD 4W9LA 4EKUA 4LJPB 3A9KA 2LXCA 4DHJD 4W9DA 5G2NA 2V1YA 2K8HA 5D7GA 4HCNB 2GBKA 4PS3A 1P3QU 1WXSA 2JT4B 4FBJB 1NI2A 4AWJA 3U7DA 2ZZPB 2MA9B 4AJWA 2KLGA 4BKSD 4K1RB 4K7UA 4KIKB 3PREA 2C60A 1J0GA 1E5WA 1E7UA 3RYTA 2LZ6A 3VTWA 2N9PC 2NBVB 2ZVNA 4IG7B 2D3GA 2V3SA 4GXBA 3ZTDA 3UIPB 4EUTA 4DHZE 3L54A 1WX8A 1OEYJ 4ZRIA 1SIFA 3AULA 4WJPA 4B6WA 3IHPC 3TMPB 4EZJA 2FCMA 3OLMD 1TTNA 2LGYA 4NAWB 4WWPA 3PHWB 4I6PA 1I42A 4W9KA 2JRIB 3WA0A 2MBOA 3ML9A 3OJ3A 3SDLC 5D6JB 3UQBA 2ZEQA 1KLVA 2KC2A 3ZO5B 4P7IA 3X0WA 4GN1A 4RM8A 3ZKJC 2KWUB 1OGWA 2GBRA 3NOBA 2MBBB 4IM0A 1LQBA 4PYZA 1WX7A 4KSKC 4KZ0A 5LLIA 3RULA 1Z5SB 3ONSA 3VQIA 4A3OA 4ZRKA 4GDKB 1YQBA 2DYMA 4LDTB 1RLFA 2IY0B 5GMVA 2UWQA 5D94A 4ASWC 2NBWB 4HVBA 3AXCA 1WJUA 2CR5A 5CHVC 3A1QA 3PHXB 4ZRJA 1UELA 2ZPNA 4BVUC 4G50A 5DPRA 2KX0A 4TKNA 2MBHA 4AUQC 3V60A 4EZKA 3QQ8B 2KD0A 3JW0X 2DZJA 4IWQA 3NY5A 2BYFA 2KFKA 2BF8B 3QWZB 4IUMB 1GC7A 4KDIC 4MELA 2KQ7A 2B3AA 2KLCA 3A9KB 3DVGY 4K7WA 4WWNA 3H7PA 4NPNA 1EF5A 4BBNF 4KV2A 4IM3A 4DWFA 4HJKA 5JZEB 1WZ0A 2DYBA 2KDIA 2KN5A 4I6NB 2LVPA 3V6EB 2CS4A 2NBUA 2JY6A 2D11A 2Z0EB 3IBEA 1E7VA 1NDDA 1PQSA 1KOTA 1UGMA 2O6VD 4WQOB 1ZW7A 3LDZE 1NBFC 3CMMB 3R3MA 3AU5A 4G0NB 2L3ZA 3L0WB 3PSEB 3EFUA 3DOWA 1WRDB 3ZVVA 2A5UA 3K9OB 1GC6A 3PRPB 2JPHA 2LASA 1P0RA 2ZCCA 2FNJB 1VCBA 3L16A 3GZNI 2QHOA 1GJZA 2N4FA 2ZVOA 5DPSA 1C3TA 3R7RA 1MG8A 2LGXA 2LD9A 4YL8A 4K7SA 3ZTCA 3IVFA 4PS7A 4ZDVA 1C1YB 3WAMA 2WWZA 1YX6B 2IBIB 4ZYNA 2L8JA 3M63B 4BOSC 4JLCA 1OQYA 2KNBA 1LFDA 2D07B 4TQ0A 2YLMA 3A1QB 2KC1A 3PVLA 5CHWA 1V49A 4ICUA 1XD3B 4MEMA 2HE7A 3AI5A 3DBLI 1UBQA 2WYQA 3L10B 3JVZX 3L13A 2JVCA 3QIJA 1SGHA 4W9IA 3V6CB 2GBMA 2KFKB 1WGYA 2CKHB 1XT9B 1EUVB 4IWOA 3ZRFA 2FIFA 3ZNGC 1GNUA 1LM8B 5G55A 1H8CA 5AZFA 2Z59B 2N9XA 3SD5A 2K1FA 4F7ZA 1WH3A 4W9EA 1GUAB 3ZLZA 3ZNHB 3H7PB 4X57B 4DDID 1P9DU 4G11A 3RZFA 3QAQA 3DPDA 4BFRA 1V5TA 1WM3A 1M94A 3B1LX 1IP9A 4KVGB 3VUXA 1P1AA 1ZKHA 2LRWA 1V2YA 2AYOB 2NS5A 3QK0A 2KJ6A 2J0JA 3ZDMC 1RFAA 4E71A 1WIAA 2MBQA 2OOBB 3T9LA 3N3KB 4XX5A 2N7EA 5C23A 2KX3A 3VUWA 2KQSA 1WE7A 3ML8A 2EMSA 1V81A 2MCNB 5L83A 2Z0DB 4MSMB 4OVUA 5TR5A 2YVCA 2FCNA 4E3CA 4F8CB 2N7DA 5DCNA 2IZVB 5AEKB 2G4DB 2ZCBA 2LWPA 2O2VB 4B9KA 1EO6A 3TIXA 4NNJB 4CYEA 5HKHA 3Q3FA 4W9HA 4M0WB 2JXXA 2FAZA 3UF8A 2RD0A 3B0AA 5E6PA 2KO3A 3ENEA 3DVNV 4ANVA 1AARA 2G3QB 4WWOA 4OVVA 2J7QB 3SU8X 2R2OA 2KWVB 3PT2B 2KJRA 2IYDB 3KH0A 3RT3B 4F1SA 2PE6B 4LDTD 4XZ4A 2IO3B 3UIOB 1F9JA 1OEYA 4B95A 2RGFA 5E6OA 4LCDE 2BKRB 4W9JA 2AEHA 2JZZA 2J0MA 2MRPA 1TBEA 2KK8A 2KWCA 3BY4B 3GOEA 4A20A 4MSQB 4FJYA 5KHQA 1WMHA 2LRUA 2ZPYA 1H4RA 3WAPA 1WI0A 5IA7A 3KYCD 1K8RB 3PS6A 4II2B 4KSLC 4ICVA 3R7QA 3ZNID 1CMXB 3H1UA 3ZNZB 5DPWA 1T0YA 3VTUA 3VUYA 1IPGA 3BINA 3IG3A 2VRRB 3ALBA 3APCA 3PV1A 4NQKE 2GOWA 2JUOA 4W9CA 4GOCA 1WXVA 2JF5A 1Q5WB 1I35A 3B08A 4IW0A 4GU2A 2M17A 1UD7A 1XQQA 2PEAA 2IO1B 2MQJA 3X23A 1WFYA 1UZXB 4NQLB 4DBGA 1WGHA 5AZGA 3M62B 2KTFA 1S1QB 4AP4C 3PGEA 3RUIB 2I1JA 4ANXA 4M8NA 2NCNA 1R4MI 2CU1A 3ZRCA 1WR6E 2WDTB 2MW5A 1V86A 4CO7A 3VH4B 2MP2B 3QHTA 1D3ZA 5LXHA 3EHVA 4FLHA 4RM9A 2LI5A 2LVOA 1L2NA 4TV3A 2K8BA 2XEWA 3EECA 3OAWA 4TQ1A 3UGBB 2DYOA 2O2VA 1WYWB 2ZJDA 2K6DB 5CTRC 5AZHA 1E8WA 2K39A 1Y8RC 2BPSA 2ZNVC 4XC2A 1WXMA 3U8ZA 1Q1OA 4BBNC 2PJHA 3QCAA 1WZ3A 2KDFB 2DZIA 3M3JA 1KJTA 2N9EB 2LJ5A 2MLBA 4WJOA 4BOZB 1YX5B 2C7NB 3NHEB 1OTRB 1Q0WB 2J0KA 5FR6A 2N1VA 5JH5C 2HD5B 1RRBA 2KXJA 3EC8A 4BKSA 4MGYE 1U4AA 2FCQA 1WMHB 1WY8A 3RCZA 3VTVA 3A33B 3A4RA 1WX9A 2RSUA 5CX3A 2UYZB 1YD8U 1X1MA 2FIDA 3K9PB 5BO4B 2D2QA 2CHWA 3H9DA 4E74A 3DBHI 2KTRB 4BKTA 3DBSA 3W1SC 2K25A 2Y5BB 3RD2A 1Z2MA 3L08A 3O65B 2GBNA 1UH6A 4II3B 1J8CA 3L17A 3DBRI 5J18A 3PPAA 2MX2A 3CF6E 2EKEC 4I6LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJ7 A;  1BT0 A;  3A4S C;  3APD A;  4JL9 A;  1P98 A;  4FA6 A;  1LXD A;  2IO2 B;  4ANU A;  2L76 A;  3JYU A;  1IYF A;  2CHX A;  3NZU A;  2GBJ A;  4GB9 A;  2A4Z A;  1ISN A;  3KVF B;  4MGK E;  3VFK A;  3PRM B;  4AJY B;  1JRU A;  3DDC B;  4NJ6 A;  2KDB A;  3Q3J A;  4HDQ A;  2REX A;  2JZ3 B;  5JHA A;  1WJN A;  2NPT B;  3N30 A;  4GGQ A;  2EMT A;  1FXT B;  2M0X A;  2NVU I;  2OJR A;  4MGI E;  3HK0 A;  2WX0 A;  1WGD A;  3RZW C;  2HJ8 A;  4NY0 A;  3DCG A;  3KW5 B;  3ZIM A;  1WXA A;  3TCA A;  1VD2 A;  1WF9 A;  3P2B A;  2DZM A;  4MJS B;  5JHB A;  2L0T A;  2C7H A;  2MP2 A;  1YJ1 A;  3TJP A;  4HK2 A;  2DEN B;  3A9J A;  1A5R A;  4GIV A;  4HXD A;  3PRZ A;  2BYV E;  3PZD A;  4MH0 E;  2G45 B;  1TZ1 A;  4DHJ B;  1E8Y A;  2KMC A;  3QC8 B;  2KVR A;  5EDS A;  2KFJ A;  2C7M B;  4URK A;  1TGZ B;  4GDL B;  3VHT C;  2I1K A;  2IY1 B;  3CSF A;  2KOX A;  4HPL B;  3C0R B;  2BKF A;  2XK5 A;  3QAR A;  1V5O A;  4FHK A;  3U30 A;  4HDO A;  2ZNV B;  2D10 A;  2O6V A;  4KDL B;  3VVW B;  4DXA B;  2W9N A;  1QZE A;  2KAN A;  1YIW A;  2CHZ A;  2MSE D;  4M8M A;  1V6E A;  2M1M A;  4FHJ A;  2LVQ A;  4BKG A;  2KKC A;  2FUH B;  2BGF A;  2HTH A;  3KUC B;  3N32 A;  3PLV A;  3WAL A;  4WJQ A;  4J6I A;  2BWE S;  3UQA A;  3HHM A;  2KTR A;  2AL6 A;  2R2Q A;  4EEW A;  4JGH B;  1SE9 A;  4HWI B;  3WAN A;  3KUZ A;  3AU4 A;  2M8S A;  2K6Q A;  3M95 A;  1V9J A;  4G3X B;  4IM2 A;  4DDG D;  2FCS A;  4FJV B;  2LUE A;  4DHZ B;  3V62 A;  4RMA A;  3OJ4 B;  3HM3 A;  3W1Y A;  3S2A A;  3VH3 B;  2ASQ A;  4EOY A;  1ZGU B;  2LGD A;  2NR2 A;  1L7Y A;  4MM3 A;  5DPT A;  1KM7 A;  3UIN B;  3H6N A;  2DHZ A;  3ZDT A;  1E8Z A;  2M4N A;  4GMV A;  3WAO A;  3ZUN A;  2L00 B;  2NPT A;  3IFW B;  3A9J B;  2BWF A;  5LXI B;  3I3T B;  2MBE A;  3PTF C;  2AL3 A;  3QX1 A;  4KZC A;  1G6J A;  4MJS A;  3JSV A;  3DVG X;  2WX1 A;  2PE9 A;  4ANW A;  1WJ4 A;  4FAD A;  2RPQ A;  1E8X A;  4WAA A;  2DAF A;  1R4N I;  2KJH B;  4FJZ A;  5KHO A;  1HE8 A;  3MJW A;  1EF1 A;  1S3S G;  4JQW C;  4A3P A;  5C1Z A;  5CHF A;  2XK5 B;  3APF A;  3ECI A;  2KZR A;  3MHS D;  4K81 A;  2O6V B;  4KIK A;  2KDE B;  4HCP B;  4GDL A;  3VDZ A;  3KYD D;  3R66 C;  3PLU A;  2L7R A;  5J2R A;  3CST A;  2KHW B;  4PYU A;  3WIM A;  1WGG A;  2KMA A;  3LJ3 A;  1E90 A;  4CHK A;  1WM2 A;  3TL5 A;  4FUL A;  1GG3 A;  4HLE A;  2LXA A;  3VXW A;  2PPH A;  1UBI A;  2G4S A;  2BYE A;  1WJ6 A;  2RR9 A;  4MDK E;  4NAW A;  4EFO A;  4WJN A;  5IAA C;  3QJZ A;  2N1W A;  2C5L C;  3NS8 A;  1WE6 A;  2K8C A;  2L0F A;  4IWP A;  3H7S A;  3HIZ A;  3KUD B;  3V61 A;  2GMI C;  4W9G A;  3SHQ A;  2JWZ A;  3D32 A;  2C9W B;  5L95 C;  3HM6 X;  2IO0 B;  4GDK A;  1J19 A;  1WR1 A;  3QA8 A;  3T8M A;  2V4L A;  4AOF A;  2DAJ A;  2AWT A;  2XBB C;  3W1S A;  2DX5 B;  3MTN B;  2L05 A;  4W9F A;  4TUU A;  5E6N A;  2JRH A;  4IC7 B;  3DVN U;  4GSW A;  3NZS A;  4HPM B;  4JIO U;  4MGZ E;  4PS8 A;  3DQV A;  4DK5 A;  5J17 A;  1WGR A;  4FN2 A;  1V80 A;  5D2M B;  4EZL A;  3JSV B;  1RAX A;  2MWS B;  3VAW A;  4LJO B;  2DZK A;  4N9F 4;  3ZW3 A;  3TBL D;  4W9L A;  4EKU A;  4LJP B;  3A9K A;  2LXC A;  4DHJ D;  4W9D A;  5G2N A;  2V1Y A;  2K8H A;  5D7G A;  4HCN B;  2GBK A;  4PS3 A;  1P3Q U;  1WXS A;  2JT4 B;  4FBJ B;  1NI2 A;  4AWJ A;  3U7D A;  2ZZP B;  2MA9 B;  4AJW A;  2KLG A;  4BKS D;  4K1R B;  4K7U A;  4KIK B;  3PRE A;  2C60 A;  1J0G A;  1E5W A;  1E7U A;  3RYT A;  2LZ6 A;  3VTW A;  2N9P C;  2NBV B;  2ZVN A;  4IG7 B;  2D3G A;  2V3S A;  4GXB A;  3ZTD A;  3UIP B;  4EUT A;  4DHZ E;  3L54 A;  1WX8 A;  1OEY J;  4ZRI A;  1SIF A;  3AUL A;  4WJP A;  4B6W A;  3IHP C;  3TMP B;  4EZJ A;  2FCM A;  3OLM D;  1TTN A;  2LGY A;  4NAW B;  4WWP A;  3PHW B;  4I6P A;  1I42 A;  4W9K A;  2JRI B;  3WA0 A;  2MBO A;  3ML9 A;  3OJ3 A;  3SDL C;  5D6J B;  3UQB A;  2ZEQ A;  1KLV A;  2KC2 A;  3ZO5 B;  4P7I A;  3X0W A;  4GN1 A;  4RM8 A;  3ZKJ C;  2KWU B;  1OGW A;  2GBR A;  3NOB A;  2MBB B;  4IM0 A;  1LQB A;  4PYZ A;  1WX7 A;  4KSK C;  4KZ0 A;  5LLI A;  3RUL A;  1Z5S B;  3ONS A;  3VQI A;  4A3O A;  4ZRK A;  4GDK B;  1YQB A;  2DYM A;  4LDT B;  1RLF A;  2IY0 B;  5GMV A;  2UWQ A;  5D94 A;  4ASW C;  2NBW B;  4HVB A;  3AXC A;  1WJU A;  2CR5 A;  5CHV C;  3A1Q A;  3PHX B;  4ZRJ A;  1UEL A;  2ZPN A;  4BVU C;  4G50 A;  5DPR A;  2KX0 A;  4TKN A;  2MBH A;  4AUQ C;  3V60 A;  4EZK A;  3QQ8 B;  2KD0 A;  3JW0 X;  2DZJ A;  4IWQ A;  3NY5 A;  2BYF A;  2KFK A;  2BF8 B;  3QWZ B;  4IUM B;  1GC7 A;  4KDI C;  4MEL A;  2KQ7 A;  2B3A A;  2KLC A;  3A9K B;  3DVG Y;  4K7W A;  4WWN A;  3H7P A;  4NPN A;  1EF5 A;  4BBN F;  4KV2 A;  4IM3 A;  4DWF A;  4HJK A;  5JZE B;  1WZ0 A;  2DYB A;  2KDI A;  2KN5 A;  4I6N B;  2LVP A;  3V6E B;  2CS4 A;  2NBU A;  2JY6 A;  2D11 A;  2Z0E B;  3IBE A;  1E7V A;  1NDD A;  1PQS A;  1KOT A;  1UGM A;  2O6V D;  4WQO B;  1ZW7 A;  3LDZ E;  1NBF C;  3CMM B;  3R3M A;  3AU5 A;  4G0N B;  2L3Z A;  3L0W B;  3PSE B;  3EFU A;  3DOW A;  1WRD B;  3ZVV A;  2A5U A;  3K9O B;  1GC6 A;  3PRP B;  2JPH A;  2LAS A;  1P0R A;  2ZCC A;  2FNJ B;  1VCB A;  3L16 A;  3GZN I;  2QHO A;  1GJZ A;  2N4F A;  2ZVO A;  5DPS A;  1C3T A;  3R7R A;  1MG8 A;  2LGX A;  2LD9 A;  4YL8 A;  4K7S A;  3ZTC A;  3IVF A;  4PS7 A;  4ZDV A;  1C1Y B;  3WAM A;  2WWZ A;  1YX6 B;  2IBI B;  4ZYN A;  2L8J A;  3M63 B;  4BOS C;  4JLC A;  1OQY A;  2KNB A;  1LFD A;  2D07 B;  4TQ0 A;  2YLM A;  3A1Q B;  2KC1 A;  3PVL A;  5CHW A;  1V49 A;  4ICU A;  1XD3 B;  4MEM A;  2HE7 A;  3AI5 A;  3DBL I;  1UBQ A;  2WYQ A;  3L10 B;  3JVZ X;  3L13 A;  2JVC A;  3QIJ A;  1SGH A;  4W9I A;  3V6C B;  2GBM A;  2KFK B;  1WGY A;  2CKH B;  1XT9 B;  1EUV B;  4IWO A;  3ZRF A;  2FIF A;  3ZNG C;  1GNU A;  1LM8 B;  5G55 A;  1H8C A;  5AZF A;  2Z59 B;  2N9X A;  3SD5 A;  2K1F A;  4F7Z A;  1WH3 A;  4W9E A;  1GUA B;  3ZLZ A;  3ZNH B;  3H7P B;  4X57 B;  4DDI D;  1P9D U;  4G11 A;  3RZF A;  3QAQ A;  3DPD A;  4BFR A;  1V5T A;  1WM3 A;  1M94 A;  3B1L X;  1IP9 A;  4KVG B;  3VUX A;  1P1A A;  1ZKH A;  2LRW A;  1V2Y A;  2AYO B;  2NS5 A;  3QK0 A;  2KJ6 A;  2J0J A;  3ZDM C;  1RFA A;  4E71 A;  1WIA A;  2MBQ A;  2OOB B;  3T9L A;  3N3K B;  4XX5 A;  2N7E A;  5C23 A;  2KX3 A;  3VUW A;  2KQS A;  1WE7 A;  3ML8 A;  2EMS A;  1V81 A;  2MCN B;  5L83 A;  2Z0D B;  4MSM B;  4OVU A;  5TR5 A;  2YVC A;  2FCN A;  4E3C A;  4F8C B;  2N7D A;  5DCN A;  2IZV B;  5AEK B;  2G4D B;  2ZCB A;  2LWP A;  2O2V B;  4B9K A;  1EO6 A;  3TIX A;  4NNJ B;  4CYE A;  5HKH A;  3Q3F A;  4W9H A;  4M0W B;  2JXX A;  2FAZ A;  3UF8 A;  2RD0 A;  3B0A A;  5E6P A;  2KO3 A;  3ENE A;  3DVN V;  4ANV A;  1AAR A;  2G3Q B;  4WWO A;  4OVV A;  2J7Q B;  3SU8 X;  2R2O A;  2KWV B;  3PT2 B;  2KJR A;  2IYD B;  3KH0 A;  3RT3 B;  4F1S A;  2PE6 B;  4LDT D;  4XZ4 A;  2IO3 B;  3UIO B;  1F9J A;  1OEY A;  4B95 A;  2RGF A;  5E6O A;  4LCD E;  2BKR B;  4W9J A;  2AEH A;  2JZZ A;  2J0M A;  2MRP A;  1TBE A;  2KK8 A;  2KWC A;  3BY4 B;  3GOE A;  4A20 A;  4MSQ B;  4FJY A;  5KHQ A;  1WMH A;  2LRU A;  2ZPY A;  1H4R A;  3WAP A;  1WI0 A;  5IA7 A;  3KYC D;  1K8R B;  3PS6 A;  4II2 B;  4KSL C;  4ICV A;  3R7Q A;  3ZNI D;  1CMX B;  3H1U A;  3ZNZ B;  5DPW A;  1T0Y A;  3VTU A;  3VUY A;  1IPG A;  3BIN A;  3IG3 A;  2VRR B;  3ALB A;  3APC A;  3PV1 A;  4NQK E;  2GOW A;  2JUO A;  4W9C A;  4GOC A;  1WXV A;  2JF5 A;  1Q5W B;  1I35 A;  3B08 A;  4IW0 A;  4GU2 A;  2M17 A;  1UD7 A;  1XQQ A;  2PEA A;  2IO1 B;  2MQJ A;  3X23 A;  1WFY A;  1UZX B;  4NQL B;  4DBG A;  1WGH A;  5AZG A;  3M62 B;  2KTF A;  1S1Q B;  4AP4 C;  3PGE A;  3RUI B;  2I1J A;  4ANX A;  4M8N A;  2NCN A;  1R4M I;  2CU1 A;  3ZRC A;  1WR6 E;  2WDT B;  2MW5 A;  1V86 A;  4CO7 A;  3VH4 B;  2MP2 B;  3QHT A;  1D3Z A;  5LXH A;  3EHV A;  4FLH A;  4RM9 A;  2LI5 A;  2LVO A;  1L2N A;  4TV3 A;  2K8B A;  2XEW A;  3EEC A;  3OAW A;  4TQ1 A;  3UGB B;  2DYO A;  2O2V A;  1WYW B;  2ZJD A;  2K6D B;  5CTR C;  5AZH A;  1E8W A;  2K39 A;  1Y8R C;  2BPS A;  2ZNV C;  4XC2 A;  1WXM A;  3U8Z A;  1Q1O A;  4BBN C;  2PJH A;  3QCA A;  1WZ3 A;  2KDF B;  2DZI A;  3M3J A;  1KJT A;  2N9E B;  2LJ5 A;  2MLB A;  4WJO A;  4BOZ B;  1YX5 B;  2C7N B;  3NHE B;  1OTR B;  1Q0W B;  2J0K A;  5FR6 A;  2N1V A;  5JH5 C;  2HD5 B;  1RRB A;  2KXJ A;  3EC8 A;  4BKS A;  4MGY E;  1U4A A;  2FCQ A;  1WMH B;  1WY8 A;  3RCZ A;  3VTV A;  3A33 B;  3A4R A;  1WX9 A;  2RSU A;  5CX3 A;  2UYZ B;  1YD8 U;  1X1M A;  2FID A;  3K9P B;  5BO4 B;  2D2Q A;  2CHW A;  3H9D A;  4E74 A;  3DBH I;  2KTR B;  4BKT A;  3DBS A;  3W1S C;  2K25 A;  2Y5B B;  3RD2 A;  1Z2M A;  3L08 A;  3O65 B;  2GBN A;  1UH6 A;  4II3 B;  1J8C A;  3L17 A;  3DBR I;  5J18 A;  3PPA A;  2MX2 A;  3CF6 E;  2EKE C;  4I6L B; 
#chains in the Genus database with same CATH topology
 3A4S C;  1YJJ A;  1JCK B;  2IO2 B;  4ANU A;  1V8C A;  4OW0 A;  2L76 A;  3NZU A;  1MFW A;  1FM0 D;  1ISN A;  1QLB B;  2WXN A;  3AV8 A;  1JRU A;  3DDC B;  4NJ6 A;  4YT0 B;  1FD6 A;  2KDB A;  3N30 A;  4GGQ A;  2OJR A;  2M0X A;  1WGD A;  1NYQ A;  3DCG A;  3MP9 A;  3TCA A;  3P2B A;  1T0R C;  4L1B A;  5JHB A;  3SR6 A;  2HJ1 A;  1XLN A;  4HK2 A;  2FUG 1;  3T3N A;  2KVZ A;  3PZD A;  4MH0 E;  2G45 B;  2FE8 A;  2KMC A;  2KFJ A;  2C7M B;  4GDL B;  1FIQ A;  3GB1 A;  3VHT C;  2V3N A;  3CSF A;  2KOX A;  1M4V A;  3Q3N C;  1SJE D;  1FRD A;  2PKO A;  1V5O A;  2ZNV B;  3VVW B;  1SSN A;  2RDB C;  4LNK A;  1V6E A;  4FHJ A;  2KKC A;  2BGF A;  1EU3 A;  2BWE S;  1JAL A;  3NVW A;  1XLO A;  2KTR A;  1P7F A;  1QT9 A;  2AQ3 B;  3AU4 A;  4DDG D;  4XYC A;  4FJV B;  4DHZ B;  2LEK A;  3VH3 B;  3TEZ A;  2ASQ A;  1F52 A;  2LGD A;  2JXT A;  2ONQ A;  1L7Y A;  1KM7 A;  3UIN B;  3VRB B;  1UWX A;  3H6N A;  1E10 A;  2J4X A;  4GMV A;  2L00 B;  2L32 A;  3DWG C;  1AN8 A;  3I3T B;  3Q3O C;  1RWS A;  3GS2 A;  4KGR A;  4LK0 M;  1E8X A;  2WXR A;  1TS5 A;  2DAF A;  2KJH B;  3RN9 C;  1EF1 A;  1S3S G;  4JQW C;  2XK5 B;  3ECI A;  4KIK A;  4K81 A;  3U2S C;  1XCQ L;  4GDL A;  3R66 C;  2IPK D;  2ICI A;  1JWB D;  3CST A;  2MJE A;  1HEZ E;  1V1P A;  1PYW D;  1E90 A;  2BTE A;  3W9C B;  2LXA A;  1FMA D;  4MDK E;  2RR9 A;  5IAA C;  3B2F A;  5JXV A;  2ZW0 A;  3TSS A;  4IWP A;  4W9G A;  3LXF A;  2XNA C;  1J19 A;  1B9R A;  1GB4 A;  2V4L A;  1E6E B;  2AWT A;  2XBB C;  3W1S A;  2DX5 B;  4TUU A;  1XEE A;  2JRH A;  3AEB B;  4OZC A;  1JQ4 A;  5J17 A;  4DK5 A;  4WAF A;  1WGR A;  3ETR A;  5D2M B;  3RNB C;  1RAX A;  3E56 A;  1QOA A;  1IGD A;  3Q3M C;  2PVG C;  4W9D A;  3RMK C;  2V1Y A;  2GBK A;  4OZA A;  4PS3 A;  3BII D;  2RMM A;  1NI2 A;  2WXL A;  2ZZP B;  4XDC A;  2ZVN A;  1ZXI A;  2J42 A;  4DHZ E;  3AUL A;  2H89 B;  1JWS D;  3IHP C;  4EZJ A;  4NAW B;  3PHW B;  1I42 A;  1YNT E;  3ML9 A;  3Q8E A;  3UQB A;  5D6J B;  1KLV A;  3ZO5 B;  2NTT A;  1L5P A;  2KWU B;  1FO4 A;  3L4P A;  4PYZ A;  2G1E A;  1WX7 A;  4KSK C;  5LLI A;  1PGX A;  1I7H A;  1ZE3 D;  4R3D A;  1TS3 A;  1YQ4 B;  2H88 B;  2CR5 A;  3PHX B;  1UEL A;  4BVU C;  4G50 A;  2KX0 A;  3AE4 B;  3J9C A;  3FIL A;  1ZOY B;  2KD0 A;  3JW0 X;  2BYF A;  3NUH B;  2KFK A;  2BF8 B;  3QWZ B;  5IOI A;  1GC7 A;  1KH0 A;  4MEL A;  1KFY B;  1WGK A;  1ZP0 B;  1AW7 A;  4BBN F;  4HJK A;  1RM6 C;  4JX1 C;  2DYB A;  4I6N B;  4EE2 A;  1TS2 A;  2QEJ C;  2D11 A;  2Z0E B;  3RNF C;  1E7V A;  3FC4 A;  1P7E A;  3LDZ E;  1K52 A;  2JWU A;  4G0N B;  3AU5 A;  3RNA C;  1D5Z C;  3ZXV A;  1JWM D;  1HQR D;  3ZVV A;  2JX5 A;  5BMG A;  2LAS A;  2WXK A;  1VCB A;  4LNF A;  3Q8F A;  3R7R A;  2LGX A;  2WHI A;  4YL8 A;  4NAM A;  1L0Y B;  3AE8 B;  4BOS C;  3ZGZ A;  2KNB A;  2YLM A;  3A1Q B;  3PVL A;  5CHW A;  1KTK A;  1V49 A;  1F77 A;  3JVZ X;  3QIJ A;  3ZJT A;  1SGH A;  3ZRF A;  4US8 A;  3ZNG C;  1LM8 B;  2Z59 B;  3SD5 A;  2KN4 A;  2CU3 A;  4X57 B;  4G11 A;  3QAQ A;  4BFR A;  4KVG B;  3VUX A;  1PDX A;  2K9X A;  5I4D A;  3RNC C;  1V2Y A;  2NS5 A;  3QK0 A;  4US9 A;  2WXP A;  1RFA A;  1WIA A;  3N3K B;  4XX5 A;  2W82 A;  2KQS A;  1PGA A;  1WE7 A;  2EMS A;  5L83 A;  2Z0D B;  4F8C B;  1FXA A;  1T0S C;  2BT6 A;  3NZ3 A;  2QDF A;  3H8H A;  3TIX A;  4CYE A;  5HKH A;  4M0W B;  5E6P A;  4ZRQ A;  1QOB A;  1L0V B;  2NMQ A;  1SBB B;  4ACF A;  2Q5W D;  4OVV A;  2YEP B;  2IO3 B;  3SFD B;  2WGS A;  2BKR B;  2AEH A;  5FKA C;  2J0M A;  2KK8 A;  3DHH C;  4A20 A;  4MSQ B;  5KHQ A;  2ZPY A;  5IA7 A;  3I5J C;  1PUT A;  1K8R B;  4KSL C;  3ZNI D;  3C19 A;  1T0Y A;  3VTU A;  1FCC C;  2VRR B;  3APC A;  4NQK E;  2JUO A;  3AEF B;  4HRO A;  1FRR A;  1Q10 A;  1NEK B;  4GU2 A;  1CK1 A;  3X23 A;  5GXG B;  1UZX B;  3NS1 A;  1S1Q B;  4AP4 C;  4ANX A;  4M8N A;  2NCN A;  1MVK A;  1T3Q A;  1WR6 E;  2WDT B;  3KLS X;  2MP2 B;  3WCQ A;  3EGR A;  1D3Z A;  1L2N A;  4TV3 A;  3N9Y C;  2ZJD A;  2K6D B;  2ZNV C;  1Y8R C;  2BPS A;  3U8Z A;  4BBN C;  1WXM A;  1WXQ A;  3VRA B;  4M0W A;  1KJT A;  4YSZ B;  5JH5 C;  3NHE B;  5FR6 A;  1Q0W B;  2UU7 A;  3VR8 B;  1RRB A;  2KXJ A;  2V4I B;  3EC8 A;  1FPY A;  4MGY E;  1WMH B;  4JE3 B;  2UYZ B;  3I63 C;  1YD8 U;  2FID A;  1ET6 A;  2Y5C A;  4YWG G;  3W1S C;  2K25 A;  2J53 A;  1IBX B;  2K22 A;  1E7P B;  1TY0 A;  3AE7 B;  3W5V B;  2GBN A;  1XO3 A;  4FA6 A;  3NVZ A;  4S17 A;  1UNS A;  3JYU A;  1I4P A;  4MM3 B;  2JQR B;  3KVF B;  1FCL A;  1DYQ A;  4MGK E;  1TY2 A;  3PRM B;  1WYG A;  4ZRP A;  2HDE A;  1N5W A;  5JHA A;  1F1H A;  1CZP A;  3HK0 A;  2HJ8 A;  3KW5 B;  1WXA A;  1VD2 A;  1R7S A;  1UF0 A;  2MP2 A;  2BS3 B;  1YJ1 A;  3AE5 B;  1A5R A;  1EWY C;  1L0X B;  5C3J B;  2K5P A;  2Z8L A;  1PFD A;  3C0R B;  3HVZ A;  5C2T B;  3QAR A;  4WUR A;  4HDO A;  1C4A A;  2D10 A;  2GRI A;  2JYE A;  4KDL B;  2W9N A;  2KAN A;  1YIW A;  2MSE D;  2X8X X;  2M1M A;  1VRA B;  2FUH B;  3AM9 A;  2HTH A;  3PLV A;  2KT7 A;  4WJQ A;  3FAH A;  2WDV B;  2AL6 A;  2R2Q A;  1IBX A;  3M95 A;  2K6Q A;  1V9J A;  3DHI C;  3N1Z C;  2FCS A;  1LGR A;  2LUE A;  2PW9 A;  3V62 A;  4MT5 A;  2NR2 A;  2QIE B;  1D5M C;  4MM3 A;  1FNV A;  1XLP A;  1QKZ A;  3MFG A;  2DHZ A;  4YTM B;  1FNW A;  2YEP F;  3WAO A;  2DLB A;  4OZB A;  3ZUN A;  4N6E B;  3PTF C;  3JSV A;  2WX1 A;  1WJ4 A;  1E0Z A;  4WAA A;  1R4N I;  5KHO A;  1HE8 A;  3MJW A;  2KZR A;  1A70 A;  4HCP B;  4ARC A;  1QF6 A;  3TEX A;  2QCZ A;  2L7R A;  2LMC A;  3WIM A;  1WGG A;  2KMA A;  3LJ3 A;  4CHK A;  3MC0 B;  1WM2 A;  2D3C A;  4USA A;  4A55 A;  4HLE A;  2PPH A;  1UBI A;  5IO9 A;  1HXY D;  2IDY A;  4EFO A;  4WJN A;  2N1W A;  1SJH D;  5BMI A;  1K51 A;  1WE6 A;  2L0F A;  3KUD B;  3SHQ A;  1BUI C;  3ZYY X;  3D32 A;  2WDR B;  3AN1 A;  2IO0 B;  4GDK A;  1WR1 A;  2WXQ A;  4AOF A;  5D3I B;  2L05 A;  4KKI A;  1JRO A;  5E6N A;  3Q2A C;  1YQ3 B;  4GSW A;  4A9A A;  5IN7 A;  4HPM B;  4RFB A;  4K3C A;  1HA5 A;  2MWS B;  2LHD A;  3ZQ4 A;  4LJP B;  2LXC A;  5G2N A;  1WWT A;  3NVY A;  3U7D A;  2KLG A;  3I9V 1;  4KIK B;  1TKY A;  2NBV B;  5BYQ A;  2D3G A;  1V1P B;  3TMP B;  2FCM A;  4WWP A;  2BQQ A;  4I6P A;  2WXF A;  3AEE B;  3WA0 A;  2MBO A;  1N63 A;  4HRS A;  3X0W A;  1ZXH A;  4GN1 A;  1I4R A;  2PLP A;  5LNK 1;  1HZ6 A;  3P1M A;  4KZ0 A;  1Z5S B;  3ONS A;  2UWQ A;  2IGH A;  4ASW C;  4HVB A;  1WJU A;  5CHV C;  4RGM A;  2W3R A;  3GE3 C;  3BK2 A;  3V60 A;  4EZK A;  3B9J A;  4XDD A;  5AUK A;  4IUM B;  3DVG Y;  2INC C;  2D3B A;  3Q8B A;  3H7P A;  4NPN A;  4RF1 A;  4KV2 A;  5JZE B;  1WZ0 A;  1MHH E;  2NBU A;  2JY6 A;  4C80 A;  1PQS A;  3UI3 A;  1D6E C;  3ABV B;  2VZK D;  4L2Y A;  4DXG A;  1WRD B;  1FFU A;  3K9O B;  2JPH A;  4C56 C;  3CWI A;  2ZCC A;  3GE8 C;  4A6Q A;  2N4F A;  1KF6 B;  1MG8 A;  2V9H A;  2W3S A;  1YX6 B;  2E3T A;  2IBI B;  3M63 B;  4JLC A;  1OQY A;  2SAK A;  2KC1 A;  4J3O D;  1XD3 B;  4MEM A;  3AI5 A;  3L10 B;  3FIL B;  2JVC A;  1B1Z A;  4DQO C;  3V6C B;  5BYR A;  2KFK B;  3U4E G;  1WGY A;  1XT9 B;  2WXO A;  4C7Z A;  4IWO A;  2OED A;  2QSD A;  4IOI E;  1H8C A;  4C4V B;  2K1F A;  4WQM A;  4W9E A;  5EE1 A;  1GUA B;  4DDI D;  3RZF A;  3LYY A;  3DPD A;  1WM3 A;  1M94 A;  2M19 A;  3KWV A;  1ZKH A;  4B0M A;  2LRW A;  3NJT A;  2AYO B;  3Q14 C;  1K50 A;  3ZDM C;  5C23 A;  4REZ A;  1V81 A;  4A90 A;  5TR5 A;  4E3C A;  2FCN A;  2N7D A;  5DCN A;  2IZV B;  4HJG E;  4HKQ A;  4NNJ B;  2KQ4 X;  3UF8 A;  2RD0 A;  3B0A A;  2JYT A;  2J7Q B;  4YTN B;  2R2O A;  1ZPS A;  3RT3 B;  2Y3A A;  4F1S A;  3URY A;  4LDT D;  1GOZ A;  4N58 A;  5E6O A;  4C00 A;  2Y5P A;  3SEB A;  3T3O A;  1TBE A;  2KWC A;  1SXT A;  1C77 A;  1WI0 A;  1J7C A;  1I4X A;  4II2 B;  1ZDV A;  1CMX B;  3W2D A;  3H1U A;  1IPG A;  3ALB A;  2L1A A;  2JSV X;  4GOC A;  3LB8 C;  3B08 A;  4C4V A;  1SE4 A;  1UD7 A;  1XQQ A;  2M17 A;  3MJ5 A;  3E9S A;  1WGH A;  3RUI B;  2I1J A;  2IND C;  1UGJ A;  1F2R I;  2MH7 A;  1FXI A;  2CU1 A;  1V86 A;  3QHT A;  4FLH A;  2J52 A;  2LVO A;  3DBH B;  3P4S B;  4O1N A;  4WIP A;  3V3X A;  2NTS A;  2DYO A;  3AB5 A;  4XWW A;  1WYW B;  5CTR C;  1E8W A;  2KDF B;  2DZI A;  5HHD G;  2MLB A;  2GB1 A;  1YX5 B;  2AQ2 B;  2N1V A;  2HD5 B;  2PTL A;  1WY8 A;  1WX9 A;  1NI3 A;  4YXD B;  3K9P B;  2D2Q A;  2CHW A;  3H9D A;  3DBH I;  2GI9 A;  4ARI A;  3DBS A;  2KMM A;  1Z2M A;  3L08 A;  1AWD A;  1UH6 A;  5J18 A;  3PPA A;  2MX2 A;  3CF6 E;  1UWM A;  4NJ7 A;  3APD A;  1P98 A;  1LXD A;  1IYF A;  2GBJ A;  4GB9 A;  2A4Z A;  2WS3 B;  1JWA D;  3EA6 A;  4AJY B;  1NEN B;  3Q3J A;  2REX A;  2NPT B;  3NRZ A;  5T8I A;  2EMT A;  1FXT B;  2L52 A;  2WX0 A;  4NY0 A;  3ZIM A;  1KLG D;  3IAM 1;  4MJS B;  2I38 A;  2DEN B;  3A9J A;  4GIV A;  1XF5 L;  4HXD A;  2BYV E;  2RDG A;  4M02 A;  1DOI A;  1OFF A;  1TZ1 A;  4PK1 A;  3QC8 B;  2MJD A;  5EDS A;  1TGZ B;  2R61 A;  2I1K A;  1C78 A;  2BKF A;  4AQ7 A;  3U30 A;  2O6V A;  4D2K A;  2CHZ A;  4Q2J A;  4M8M A;  2LVQ A;  3P4R B;  4BKG A;  3N1X C;  3HHM A;  1WSP A;  4JGH B;  2DBY A;  3KUZ A;  3WAN A;  2M8S A;  4IM2 A;  4G3X B;  3Q8A A;  1I4Q A;  4XWT A;  3W1Y A;  3S2A A;  2M0A A;  4EOY A;  1ZGU B;  1L4Z B;  5DPT A;  4NZL B;  3ZDT A;  1E8Z A;  1RYJ A;  2NPT A;  2KAJ A;  4M01 A;  4ITK A;  3O13 A;  2MBE A;  1G6J A;  4MJS A;  1ACC A;  2OJW A;  3KQ4 A;  4ANW A;  4FAD A;  3PO0 A;  4A3P A;  3MHS D;  3VDZ A;  1IUE A;  3PLU A;  5J2R A;  2VZK B;  2KHW B;  1NVI D;  2KYW A;  1TIF A;  1GG3 A;  3AEG B;  2RDH A;  1WJ6 A;  2BB5 A;  2CJN A;  2X38 A;  2KAC A;  3BVZ A;  1QOF A;  3H7S A;  3PZ7 A;  4C7Y A;  3AE3 B;  3V61 A;  2GMI C;  3P42 A;  2JWZ A;  5L95 C;  1NYR A;  3T8M A;  1HZ5 A;  4WWM A;  2GLS A;  4KX6 B;  2LJI A;  4A8X C;  3KWL A;  4HKZ E;  3DVN U;  3NZS A;  1QIL A;  4HEA 1;  4JIO U;  4MGZ E;  4PS8 A;  3DQV A;  4EZL A;  1V80 A;  3JSV B;  3VAW A;  4RGN A;  3ZW3 A;  2DZK A;  3TBL D;  1YMH E;  4W9L A;  3A9K A;  4DHJ D;  1ENF A;  2KWD A;  1P3Q U;  2JT4 B;  2WLB A;  2MA9 B;  4N59 A;  3AE6 B;  4K1R B;  1J0G A;  3PRE A;  2C60 A;  1E5W A;  1E7U A;  2LZ6 A;  3VTW A;  1T6B X;  4P1C C;  2V3S A;  1MG4 A;  3ZTD A;  2WXM A;  2VH1 A;  3UIP B;  3L54 A;  1OEY J;  1TKG A;  2MHJ A;  4MH8 A;  2LGY A;  1RFK A;  4W9K A;  2XN9 C;  2ZEQ A;  1Y56 A;  4P7I A;  4RM8 A;  3ZKJ C;  1OGW A;  4IM0 A;  1LQB A;  3RUL A;  3VQI A;  4A3O A;  4GDK B;  2V3P A;  4LDT B;  1R4N B;  3RNG C;  1DGJ A;  1D4B A;  2ZPN A;  5DPR A;  4TKN A;  2LHE A;  2DZJ A;  4IWQ A;  3NY5 A;  4NJC A;  4KDI C;  4K7W A;  4WWN A;  3ZJV A;  4IM3 A;  2TSS A;  4DWF A;  1JW9 D;  2KDI A;  2KN5 A;  2LVP A;  2CS4 A;  3U7Z A;  3TEW A;  3R2I A;  2O6V D;  4WQO B;  3IAS 1;  4RCO A;  1J7B A;  3CMM B;  3DBL B;  2L3Z A;  1VZ8 A;  3L0W B;  1C4P A;  4RH6 A;  3DOW A;  3P4P B;  4MAC A;  5AUI A;  1XLQ A;  2DWQ A;  1SB3 C;  3OWE B;  3PRP B;  4ZHO A;  1TJE A;  2WXI A;  1P0R A;  3HVD A;  3L16 A;  2FNJ B;  1V1O A;  2QHO A;  2BVC A;  2ZVO A;  5DPS A;  1F2R C;  3BK1 A;  2LD9 A;  4LNO A;  4PS7 A;  4ZDV A;  3IT4 B;  1C1Y B;  2DNF A;  4ZYN A;  2L8J A;  1LFD A;  2D07 B;  3NG0 A;  3MHZ A;  3N20 C;  4ICU A;  2HE7 A;  3DBL I;  2WYQ A;  4YTP B;  1IGC A;  1UUP A;  2CKH B;  1EWC A;  2FIF A;  1GNU A;  5G55 A;  2N9X A;  4K3B A;  4F7Z A;  3ZLZ A;  3H7P B;  3B1L X;  1P1A A;  2V0G A;  5D3D A;  1FNU A;  4IKG A;  4E71 A;  1YJI A;  2WU2 B;  2MBQ A;  1N62 A;  2N7E A;  1VR9 A;  2FBW B;  2KX3 A;  2MCN B;  4B0E A;  4MSM B;  4OVU A;  2YVC A;  1SF0 A;  5AEK B;  1VLB A;  2G4D B;  2ZCB A;  1DOX A;  1EO6 A;  3TUO A;  5IKC M;  1GPX A;  2WDQ B;  3ZJU A;  2JXX A;  2KO3 A;  3ENE A;  4RNA A;  1AAR A;  2G3Q B;  4KGT A;  4HPP A;  2IJ0 A;  3SU8 X;  2KWV B;  3PT2 B;  2KJR A;  2IYD B;  3KH0 A;  1ET9 A;  4KGS A;  4XZ4 A;  3UIO B;  4B95 A;  2RGF A;  3RI7 C;  4LCD E;  4YSY B;  2JZZ A;  2MRP A;  1N6Z A;  5HFY A;  2QC8 A;  4FJY A;  1OQR A;  2SEB D;  4ICV A;  2EEL A;  2K3U A;  3CIR B;  2INP E;  3IT6 B;  3BIN A;  1GB1 A;  2N9K A;  1FEH A;  2BS4 B;  1I35 A;  1MHX A;  2PEA A;  1ROE A;  2MQJ A;  1PGB A;  3EFC A;  1CQV A;  3BZD B;  5AZG A;  3M62 B;  1YN4 A;  3BVG A;  3Q6B A;  3PGE A;  4L23 A;  3ZRC A;  4DXF A;  4CO7 A;  5LXH A;  2ACZ B;  2G9H D;  2LI5 A;  1N60 A;  3EEC A;  3OAW A;  4TQ1 A;  3UGB B;  5EE0 A;  5AZH A;  1SE3 A;  2PIA A;  2PJH A;  1WZ3 A;  3U52 E;  1J7A A;  4UDU C;  3AED B;  2QIL A;  4LNI A;  4RF0 A;  1V97 A;  2J0K A;  1C9F A;  4BKS A;  2FCQ A;  4M00 A;  2HTM E;  2N0S B;  3VTV A;  3A33 B;  3A4R A;  3IXS A;  2LUM A;  2RSU A;  5CX3 A;  2IGD A;  2BS2 B;  1X1M A;  3RNE C;  1E9M A;  4XE0 A;  4E74 A;  1XCT L;  3V05 A;  3AEA B;  3O65 B;  4II3 B;  1J8C A;  2IGG A;  3B2G A;  2EKE C;  4I6L B;  1BT0 A;  4JL9 A;  2CHX A;  4LLG M;  2JZP A;  2WU5 B;  1ZDX A;  1D5X C;  3VFK A;  4HDQ A;  2JZ3 B;  1WJN A;  4P6V F;  4MGI E;  2NVU I;  3RZW C;  1TT5 B;  2BYT A;  1WF9 A;  2DZM A;  2L0T A;  2C7H A;  3TJP A;  2CJO A;  1C79 A;  3PRZ A;  4AS1 A;  4DHJ B;  1E8Y A;  2KVR A;  4URK A;  4JWU C;  1F0Z A;  2IY1 B;  4TSS A;  4HPL B;  2L83 A;  2XK5 A;  4FHK A;  2LGS A;  4DXA B;  1QZE A;  2M56 B;  2PMV A;  3KUC B;  3N32 A;  3I57 A;  3WAL A;  1JRP A;  4J6I A;  3UQA A;  3AE2 B;  4BAX A;  1L6V A;  2K0P A;  3AEC B;  4EEW A;  1SE9 A;  4HWI B;  4RMA A;  1HTO A;  3OJ4 B;  4PT5 A;  3HM3 A;  5FR3 A;  5EE9 A;  4CQN A;  2QMT A;  2EKI A;  3EUB 2;  2M4N A;  4JWS C;  3IFW B;  3A9J B;  2BWF A;  3TEY A;  5LXI B;  2AL3 A;  3QX1 A;  4KZC A;  1WRI A;  3DHG C;  3DVG X;  1YN3 A;  3ZXR A;  2PE9 A;  2QJL A;  5G5G A;  4KKJ A;  2RPQ A;  1T5X D;  4FJZ A;  4P16 A;  5C1Z A;  5CHF A;  3APF A;  2N7J A;  2O6V B;  3SFE B;  2KDE B;  3BYY B;  3KYD D;  4PYU A;  5BMH A;  1SIJ A;  3BWU D;  4JPS A;  1STE A;  3TL5 A;  2I2Y A;  4FUL A;  5HG2 A;  3VXW A;  2G4S A;  2BYE A;  4NAW A;  3QJZ A;  2C5L C;  2OHF A;  3NS8 A;  1KRH A;  3P4Q B;  2K8C A;  3HIZ A;  2PVO D;  2C9W B;  3HM6 X;  3QA8 A;  5FK9 C;  2DAJ A;  1GAQ B;  4W9F A;  3MTN B;  4IC7 B;  1FFV A;  3W5U B;  3AE1 B;  4FN2 A;  1HTQ A;  4LJO B;  3PZ8 A;  4N9F 4;  4S0R A;  4EKU A;  2K8H A;  2ZW1 A;  3C8Y A;  4HCN B;  5D7G A;  4FBJ B;  1WXS A;  4AWJ A;  2WP9 B;  1N5X A;  4AJW A;  4BKS D;  4K7U A;  3RYT A;  3OG5 A;  4H2A A;  2N9P C;  4IG7 B;  3Q8C A;  2LFI A;  1VZ6 A;  4GXB A;  4EUT A;  5E6J A;  3P63 A;  1WX8 A;  4ZRI A;  1EM7 A;  1SIF A;  4WJP A;  4B6W A;  4LTU A;  3OLM D;  1TTN A;  1I4H A;  1TS4 A;  2JRI B;  4RGO S;  3OJ3 A;  4RGT A;  5G5H A;  3AE9 B;  3SDL C;  2KC2 A;  1VZ7 A;  4FXC A;  2GBR A;  2ON8 A;  3NOB A;  4BZA A;  2MBB B;  1YN5 A;  4ZRK A;  1SEB D;  1YQB A;  2DYM A;  3HUI A;  3NVV A;  1RLF A;  2IY0 B;  5GMV A;  1OQQ A;  5D94 A;  2NBW B;  3AXC A;  3BYT B;  1N61 A;  3A1Q A;  4ZRJ A;  2MBH A;  4AUQ C;  3QQ8 B;  5TSS A;  1L6U A;  1XXG A;  3DWM A;  1TYG B;  3GZN B;  2KQ7 A;  2B3A A;  2KLC A;  1MPE A;  3GP7 A;  3A9K B;  2AQ1 B;  1EF5 A;  4GLS C;  3V6E B;  5HI1 A;  3IBE A;  4P1B C;  4YSX B;  3RFZ B;  1NDD A;  1KOT A;  1UGM A;  1ZW7 A;  2D5G A;  1TZO A;  1NBF C;  3R3M A;  2B76 B;  1I4G A;  3PSE B;  3EFU A;  1AYF A;  4XGA B;  2A5U A;  2MEK A;  1GC6 A;  2AX5 A;  2KDM A;  4QAY A;  4TMA B;  3GZN I;  1MJD A;  1GJZ A;  4ZHP A;  3VR9 B;  1C3T A;  3HRD D;  3AH7 A;  4K7S A;  3ZTC A;  3IVF A;  3WAM A;  2WWZ A;  3MC8 A;  1EU4 A;  2D3A A;  4ZYS A;  4TQ0 A;  2WXG A;  3L13 A;  1UBQ A;  1JML A;  4W9I A;  2GBM A;  1EUV B;  1VDV A;  5AZF A;  1WH3 A;  3ZNH B;  1P9D U;  2N9L A;  1V5T A;  1IP9 A;  2W55 A;  2BW2 A;  2LGI A;  2WXJ A;  2KJ6 A;  2J0J A;  2OOB B;  2WXH A;  1LO5 D;  3T9L A;  3VUW A;  1L4D B;  2BB6 A;  3ML8 A;  2WNM A;  2RPV A;  2LWP A;  2O2V B;  4B9K A;  3BVM A;  3FKY A;  3Q3F A;  4W9H A;  4ZOH C;  2FAZ A;  1KLU D;  1TKE A;  3DVN V;  5MPO A;  4ANV A;  4WWO A;  3Q69 A;  2PE6 B;  1F9J A;  1OEY A;  4W9J A;  3BY4 B;  3GOE A;  3N1Y C;  2E6X A;  1R4M B;  1WMH A;  2LRU A;  4WH4 A;  1H4R A;  3WAP A;  5BYS A;  3KYC D;  3PS6 A;  1C4C A;  1YOV B;  3R7Q A;  3ZNZ B;  5DPW A;  5H92 C;  3VUY A;  3IG3 A;  3PV1 A;  2GOW A;  4W9C A;  1JWU D;  1WXV A;  2JF5 A;  1Q5W B;  4IW0 A;  2IO1 B;  2JU6 X;  3R8B A;  1ZUD 2;  5IP4 D;  1DOY A;  2BBC A;  1WFY A;  4NQL B;  4DBG A;  2KTF A;  1QOG A;  1C76 A;  1R4M I;  2MW5 A;  1ESF A;  1VJK A;  3VH4 B;  3EHV A;  3AMZ A;  4RM9 A;  2W54 A;  5H8Y E;  2MJ3 A;  2K8B A;  2XEW A;  2O2V A;  2K39 A;  4IDI A;  4XC2 A;  1Q1O A;  3DBR B;  3QCA A;  1SE2 A;  3M3J A;  2N9E B;  2LJ5 A;  4WJO A;  4BOZ B;  2C7N B;  1OTR B;  1BML C;  1T0Q C;  1U4A A;  4LNN A;  2VH2 A;  3RCZ A;  2WQY B;  4OHJ A;  1MI0 A;  5EE3 A;  3MC9 A;  2INN E;  4OVZ A;  5BO4 B;  2KTR B;  4BKT A;  3R2T A;  1BXT A;  2Y5B B;  3RD2 A;  1K53 A;  3L17 A;  1CJE A;  1QQR A;  3DBR I;  3RPF C; 
#chains in the Genus database with same CATH homology
 4NJ7 A;  1BT0 A;  3A4S C;  3APD A;  4JL9 A;  1P98 A;  4FA6 A;  1LXD A;  2IO2 B;  4ANU A;  2L76 A;  3JYU A;  1IYF A;  2CHX A;  3NZU A;  2GBJ A;  4GB9 A;  2A4Z A;  1ISN A;  3KVF B;  4MGK E;  3VFK A;  3PRM B;  4AJY B;  1JRU A;  3DDC B;  4NJ6 A;  2KDB A;  3Q3J A;  4HDQ A;  2REX A;  2JZ3 B;  5JHA A;  1WJN A;  2NPT B;  3N30 A;  4GGQ A;  2EMT A;  1FXT B;  2M0X A;  2NVU I;  2OJR A;  4MGI E;  3HK0 A;  2WX0 A;  1WGD A;  3RZW C;  2HJ8 A;  4NY0 A;  3DCG A;  3KW5 B;  3ZIM A;  1WXA A;  3TCA A;  1VD2 A;  1WF9 A;  3P2B A;  2DZM A;  4MJS B;  5JHB A;  2L0T A;  2C7H A;  2MP2 A;  1YJ1 A;  3TJP A;  4HK2 A;  2DEN B;  3A9J A;  1A5R A;  4GIV A;  4HXD A;  3PRZ A;  2BYV E;  3PZD A;  4MH0 E;  2G45 B;  1TZ1 A;  4DHJ B;  1E8Y A;  2KMC A;  3QC8 B;  2KVR A;  5EDS A;  2KFJ A;  2C7M B;  4URK A;  1TGZ B;  4GDL B;  3VHT C;  2I1K A;  2IY1 B;  3CSF A;  2KOX A;  4HPL B;  3C0R B;  2BKF A;  2XK5 A;  3QAR A;  1V5O A;  4FHK A;  3U30 A;  4HDO A;  2ZNV B;  2D10 A;  2O6V A;  4KDL B;  3VVW B;  4DXA B;  2W9N A;  1QZE A;  2KAN A;  1YIW A;  2CHZ A;  2MSE D;  4M8M A;  1V6E A;  2M1M A;  4FHJ A;  2LVQ A;  4BKG A;  2KKC A;  2FUH B;  2BGF A;  2HTH A;  3KUC B;  3N32 A;  3PLV A;  3WAL A;  4WJQ A;  4J6I A;  2BWE S;  3UQA A;  3HHM A;  2KTR A;  2AL6 A;  2R2Q A;  4EEW A;  4JGH B;  1SE9 A;  4HWI B;  3WAN A;  3KUZ A;  3AU4 A;  2M8S A;  2K6Q A;  3M95 A;  1V9J A;  4G3X B;  4IM2 A;  4DDG D;  2FCS A;  4FJV B;  2LUE A;  4DHZ B;  3V62 A;  4RMA A;  3OJ4 B;  3HM3 A;  3W1Y A;  3S2A A;  3VH3 B;  2ASQ A;  4EOY A;  1ZGU B;  2LGD A;  2NR2 A;  1L7Y A;  4MM3 A;  5DPT A;  1KM7 A;  3UIN B;  3H6N A;  2DHZ A;  3ZDT A;  1E8Z A;  2M4N A;  4GMV A;  3WAO A;  3ZUN A;  2L00 B;  2NPT A;  3IFW B;  3A9J B;  2BWF A;  5LXI B;  3I3T B;  2MBE A;  3PTF C;  2AL3 A;  3QX1 A;  4KZC A;  1G6J A;  4MJS A;  3JSV A;  3DVG X;  2WX1 A;  2PE9 A;  4ANW A;  1WJ4 A;  4FAD A;  2RPQ A;  1E8X A;  4WAA A;  2DAF A;  1R4N I;  2KJH B;  4FJZ A;  5KHO A;  1HE8 A;  3MJW A;  1EF1 A;  1S3S G;  4JQW C;  4A3P A;  5C1Z A;  5CHF A;  2XK5 B;  3APF A;  3ECI A;  2KZR A;  3MHS D;  4K81 A;  2O6V B;  4KIK A;  2KDE B;  4HCP B;  4GDL A;  3VDZ A;  3KYD D;  3R66 C;  3PLU A;  2L7R A;  5J2R A;  3CST A;  2KHW B;  4PYU A;  3WIM A;  1WGG A;  2KMA A;  3LJ3 A;  1E90 A;  4CHK A;  1WM2 A;  3TL5 A;  4FUL A;  1GG3 A;  4HLE A;  2LXA A;  3VXW A;  2PPH A;  1UBI A;  2G4S A;  2BYE A;  1WJ6 A;  2RR9 A;  4MDK E;  4NAW A;  4EFO A;  4WJN A;  5IAA C;  3QJZ A;  2N1W A;  2C5L C;  3NS8 A;  1WE6 A;  2K8C A;  2L0F A;  4IWP A;  3H7S A;  3HIZ A;  3KUD B;  3V61 A;  2GMI C;  4W9G A;  3SHQ A;  2JWZ A;  3D32 A;  2C9W B;  5L95 C;  3HM6 X;  2IO0 B;  4GDK A;  1J19 A;  1WR1 A;  3QA8 A;  3T8M A;  2V4L A;  4AOF A;  2DAJ A;  2AWT A;  2XBB C;  3W1S A;  2DX5 B;  3MTN B;  2L05 A;  4W9F A;  4TUU A;  5E6N A;  2JRH A;  4IC7 B;  3DVN U;  4GSW A;  3NZS A;  4HPM B;  4JIO U;  4MGZ E;  4PS8 A;  3DQV A;  4DK5 A;  5J17 A;  1WGR A;  4FN2 A;  1V80 A;  5D2M B;  4EZL A;  3JSV B;  1RAX A;  2MWS B;  3VAW A;  4LJO B;  2DZK A;  4N9F 4;  3ZW3 A;  3TBL D;  4W9L A;  4EKU A;  4LJP B;  3A9K A;  2LXC A;  4DHJ D;  4W9D A;  5G2N A;  2V1Y A;  2K8H A;  5D7G A;  4HCN B;  2GBK A;  4PS3 A;  1P3Q U;  1WXS A;  2JT4 B;  4FBJ B;  1NI2 A;  4AWJ A;  3U7D A;  2ZZP B;  2MA9 B;  4AJW A;  2KLG A;  4BKS D;  4K1R B;  4K7U A;  4KIK B;  3PRE A;  2C60 A;  1J0G A;  1E5W A;  1E7U A;  3RYT A;  2LZ6 A;  3VTW A;  2N9P C;  2NBV B;  2ZVN A;  4IG7 B;  2D3G A;  2V3S A;  4GXB A;  3ZTD A;  3UIP B;  4EUT A;  4DHZ E;  3L54 A;  1WX8 A;  1OEY J;  4ZRI A;  1SIF A;  3AUL A;  4WJP A;  4B6W A;  3IHP C;  3TMP B;  4EZJ A;  2FCM A;  3OLM D;  1TTN A;  2LGY A;  4NAW B;  4WWP A;  3PHW B;  4I6P A;  1I42 A;  4W9K A;  2JRI B;  3WA0 A;  2MBO A;  3ML9 A;  3OJ3 A;  3SDL C;  5D6J B;  3UQB A;  2ZEQ A;  1KLV A;  2KC2 A;  3ZO5 B;  4P7I A;  3X0W A;  4GN1 A;  4RM8 A;  3ZKJ C;  2KWU B;  1OGW A;  2GBR A;  3NOB A;  2MBB B;  4IM0 A;  1LQB A;  4PYZ A;  1WX7 A;  4KSK C;  4KZ0 A;  5LLI A;  3RUL A;  1Z5S B;  3ONS A;  3VQI A;  4A3O A;  4ZRK A;  4GDK B;  1YQB A;  2DYM A;  4LDT B;  1RLF A;  2IY0 B;  5GMV A;  2UWQ A;  5D94 A;  4ASW C;  2NBW B;  4HVB A;  3AXC A;  1WJU A;  2CR5 A;  5CHV C;  3A1Q A;  3PHX B;  4ZRJ A;  1UEL A;  2ZPN A;  4BVU C;  4G50 A;  5DPR A;  2KX0 A;  4TKN A;  2MBH A;  4AUQ C;  3V60 A;  4EZK A;  3QQ8 B;  2KD0 A;  3JW0 X;  2DZJ A;  4IWQ A;  3NY5 A;  2BYF A;  2KFK A;  2BF8 B;  3QWZ B;  4IUM B;  1GC7 A;  4KDI C;  4MEL A;  2KQ7 A;  2B3A A;  2KLC A;  3A9K B;  3DVG Y;  4K7W A;  4WWN A;  3H7P A;  4NPN A;  1EF5 A;  4BBN F;  4KV2 A;  4IM3 A;  4DWF A;  4HJK A;  5JZE B;  1WZ0 A;  2DYB A;  2KDI A;  2KN5 A;  4I6N B;  2LVP A;  3V6E B;  2CS4 A;  2NBU A;  2JY6 A;  2D11 A;  2Z0E B;  3IBE A;  1E7V A;  1NDD A;  1PQS A;  1KOT A;  1UGM A;  2O6V D;  4WQO B;  1ZW7 A;  3LDZ E;  1NBF C;  3CMM B;  3R3M A;  3AU5 A;  4G0N B;  2L3Z A;  3L0W B;  3PSE B;  3EFU A;  3DOW A;  1WRD B;  3ZVV A;  2A5U A;  3K9O B;  1GC6 A;  3PRP B;  2JPH A;  2LAS A;  1P0R A;  2ZCC A;  2FNJ B;  1VCB A;  3L16 A;  3GZN I;  2QHO A;  1GJZ A;  2N4F A;  2ZVO A;  5DPS A;  1C3T A;  3R7R A;  1MG8 A;  2LGX A;  2LD9 A;  4YL8 A;  4K7S A;  3ZTC A;  3IVF A;  4PS7 A;  4ZDV A;  1C1Y B;  3WAM A;  2WWZ A;  1YX6 B;  2IBI B;  4ZYN A;  2L8J A;  3M63 B;  4BOS C;  4JLC A;  1OQY A;  2KNB A;  1LFD A;  2D07 B;  4TQ0 A;  2YLM A;  3A1Q B;  2KC1 A;  3PVL A;  5CHW A;  1V49 A;  4ICU A;  1XD3 B;  4MEM A;  2HE7 A;  3AI5 A;  3DBL I;  1UBQ A;  2WYQ A;  3L10 B;  3JVZ X;  3L13 A;  2JVC A;  3QIJ A;  1SGH A;  4W9I A;  3V6C B;  2GBM A;  2KFK B;  1WGY A;  2CKH B;  1XT9 B;  1EUV B;  4IWO A;  3ZRF A;  2FIF A;  3ZNG C;  1GNU A;  1LM8 B;  5G55 A;  1H8C A;  5AZF A;  2Z59 B;  2N9X A;  3SD5 A;  2K1F A;  4F7Z A;  1WH3 A;  4W9E A;  1GUA B;  3ZLZ A;  3ZNH B;  3H7P B;  4X57 B;  4DDI D;  1P9D U;  4G11 A;  3RZF A;  3QAQ A;  3DPD A;  4BFR A;  1V5T A;  1WM3 A;  1M94 A;  3B1L X;  1IP9 A;  4KVG B;  3VUX A;  1P1A A;  1ZKH A;  2LRW A;  1V2Y A;  2AYO B;  2NS5 A;  3QK0 A;  2KJ6 A;  2J0J A;  3ZDM C;  1RFA A;  4E71 A;  1WIA A;  2MBQ A;  2OOB B;  3T9L A;  3N3K B;  4XX5 A;  2N7E A;  5C23 A;  2KX3 A;  3VUW A;  2KQS A;  1WE7 A;  3ML8 A;  2EMS A;  1V81 A;  2MCN B;  5L83 A;  2Z0D B;  4MSM B;  4OVU A;  5TR5 A;  2YVC A;  2FCN A;  4E3C A;  4F8C B;  2N7D A;  5DCN A;  2IZV B;  5AEK B;  2G4D B;  2ZCB A;  2LWP A;  2O2V B;  4B9K A;  1EO6 A;  3TIX A;  4NNJ B;  4CYE A;  5HKH A;  3Q3F A;  4W9H A;  4M0W B;  2JXX A;  2FAZ A;  3UF8 A;  2RD0 A;  3B0A A;  5E6P A;  2KO3 A;  3ENE A;  3DVN V;  4ANV A;  1AAR A;  2G3Q B;  4WWO A;  4OVV A;  2J7Q B;  3SU8 X;  2R2O A;  2KWV B;  3PT2 B;  2KJR A;  2IYD B;  3KH0 A;  3RT3 B;  4F1S A;  2PE6 B;  4LDT D;  4XZ4 A;  2IO3 B;  3UIO B;  1F9J A;  1OEY A;  4B95 A;  2RGF A;  5E6O A;  4LCD E;  2BKR B;  4W9J A;  2AEH A;  2JZZ A;  2J0M A;  2MRP A;  1TBE A;  2KK8 A;  2KWC A;  3BY4 B;  3GOE A;  4A20 A;  4MSQ B;  4FJY A;  5KHQ A;  1WMH A;  2LRU A;  2ZPY A;  1H4R A;  3WAP A;  1WI0 A;  5IA7 A;  3KYC D;  1K8R B;  3PS6 A;  4II2 B;  4KSL C;  4ICV A;  3R7Q A;  3ZNI D;  1CMX B;  3H1U A;  3ZNZ B;  5DPW A;  1T0Y A;  3VTU A;  3VUY A;  1IPG A;  3BIN A;  3IG3 A;  2VRR B;  3ALB A;  3APC A;  3PV1 A;  4NQK E;  2GOW A;  2JUO A;  4W9C A;  4GOC A;  1WXV A;  2JF5 A;  1Q5W B;  1I35 A;  3B08 A;  4IW0 A;  4GU2 A;  2M17 A;  1UD7 A;  1XQQ A;  2PEA A;  2IO1 B;  2MQJ A;  3X23 A;  1WFY A;  1UZX B;  4NQL B;  4DBG A;  1WGH A;  5AZG A;  3M62 B;  2KTF A;  1S1Q B;  4AP4 C;  3PGE A;  3RUI B;  2I1J A;  4ANX A;  4M8N A;  2NCN A;  1R4M I;  2CU1 A;  3ZRC A;  1WR6 E;  2WDT B;  2MW5 A;  1V86 A;  4CO7 A;  3VH4 B;  2MP2 B;  3QHT A;  1D3Z A;  5LXH A;  3EHV A;  4FLH A;  4RM9 A;  2LI5 A;  2LVO A;  1L2N A;  4TV3 A;  2K8B A;  2XEW A;  3EEC A;  3OAW A;  4TQ1 A;  3UGB B;  2DYO A;  2O2V A;  1WYW B;  2ZJD A;  2K6D B;  5CTR C;  5AZH A;  1E8W A;  2K39 A;  1Y8R C;  2BPS A;  2ZNV C;  4XC2 A;  1WXM A;  3U8Z A;  1Q1O A;  4BBN C;  2PJH A;  3QCA A;  1WZ3 A;  2KDF B;  2DZI A;  3M3J A;  1KJT A;  2N9E B;  2LJ5 A;  2MLB A;  4WJO A;  4BOZ B;  1YX5 B;  2C7N B;  3NHE B;  1OTR B;  1Q0W B;  2J0K A;  5FR6 A;  2N1V A;  5JH5 C;  2HD5 B;  1RRB A;  2KXJ A;  3EC8 A;  4BKS A;  4MGY E;  1U4A A;  2FCQ A;  1WMH B;  1WY8 A;  3RCZ A;  3VTV A;  3A33 B;  3A4R A;  1WX9 A;  2RSU A;  5CX3 A;  2UYZ B;  1YD8 U;  1X1M A;  2FID A;  3K9P B;  5BO4 B;  2D2Q A;  2CHW A;  3H9D A;  4E74 A;  3DBH I;  2KTR B;  4BKT A;  3DBS A;  3W1S C;  2K25 A;  2Y5B B;  3RD2 A;  1Z2M A;  3L08 A;  3O65 B;  2GBN A;  1UH6 A;  4II3 B;  1J8C A;  3L17 A;  3DBR I;  5J18 A;  3PPA A;  2MX2 A;  3CF6 E;  2EKE C;  4I6L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...