2UYZB

Non-covalent complex between ubc9 and sumo1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
78
structure length
78
Chain Sequence
MEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-CONJUGATING ENZYME UBC9
publication title Noncovalent interaction between Ubc9 and SUMO promotes SUMO chain formation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 18
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2007-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2uyzB00
4GDKA 3PGEA 4XZ4A 2AWTA 4KSKC 5AZGA 3UQBA 1WF9A 3D32A 3N32A 2KMCA 2KNBA 2ZVNA 2CHWA 3U30A 2XBBC 4KSLC 2WYQA 1E8ZA 2KFKA 1Z2MA 1H8CA 2KX3A 3CSTA 3VH3B 2MBBB 1TZ1A 1UGMA 2NBUA 4CO7A 2IO1B 2MSED 3SDLC 2MBHA 3L0WB 2KWCA 3AU4A 3VAWA 3OJ4B 1KLVA 5CTRC 2MW5A 1YJ1A 2MBOA 2Y5BB 2JRHA 4ZRIA 3O65B 2K8HA 4I6NB 2N9XA 2KK8A 2EMSA 5C1ZA 2NBWB 2GBKA 3ZDTA 1BT0A 1WJ4A 2IO2B 1SGHA 4WJOA 4FHKA 3TJPA 1XQQA 1ZKHA 2KWUB 2ZNVC 4MELA 2J7QB 2BYEA 4MM3A 2J0JA 4CYEA 3H7PA 2LJ5A 4ZRKA 1TGZB 4HPMB 4OVVA 1PQSA 3CF6E 1I42A 2JZZA 2K8BA 2M0XA 4HDOA 4A20A 2DYMA 1SE9A 3T9LA 2YLMA 2C9WB 1UD7A 3A9KB 3JSVB 3AU5A 3WAOA 1YQBA 2L0FA 4EOYA 1P3QU 2FCMA 3LDZE 1WXSA 4KDIC 5D6JB 2KJRA 2ZNVB 2IY0B 2IYDB 3ZIMA 1Z5SB 2MQJA 3PHXB 4G0NB 2KWVB 3PVLA 4FLHA 4WJQA 3B1LX 3ONSA 3PZDA 1IPGA 3DCGA 2NR2A 4MGKE 5FR6A 3R66C 2KQSA 3V6CB 2NPTB 2LXCA 3U7DA 4LDTD 2D3GA 5DCNA 5KHQA 1VCBA 1WGGA 1P0RA 1CMXB 4EUTA 2MCNB 1A5RA 2ZVOA 3H6NA 3HM3A 2MA9B 4NJ7A 4BKTA 4TQ1A 2GBNA 3VXWA 3WIMA 3OAWA 4DHJB 2C60A 2LRUA 3PLVA 1WE7A 4GB9A 3UF8A 4PS3A 1XT9B 4PS8A 4AOFA 3VTWA 3RZWC 3VTVA 2JPHA 3AULA 2N9EB 2D11A 3I3TB 5E6OA 2G3QB 2BPSA 2DAJA 3KVFB 2DENB 4FJYA 2UWQA 4KDLB 2V4LA 3IG3A 1V2YA 5DPTA 2KC2A 1V86A 5AZFA 2KOXA 2KJ6A 2KDFB 3TCAA 2RSUA 4G50A 2LWPA 2V1YA 1T0YA 4GDLA 3ZNID 1WXMA 4W9DA 2JT4B 5G55A 3ZNGC 2FUHB 4MGZE 2NS5A 1R4NI 2KVRA 2HD5B 2RR9A 2IBIB 1P9DU 2DHZA 4B6WA 2AEHA 2REXA 4ASWC 3VUWA 4BBNC 3DBSA 4MJSA 5IAAC 2KZRA 3UIOB 2MWSB 3PTFC 3DBHI 4MSQB 4EEWA 4HCPB 3H1UA 4ICVA 1Q5WB 3ZNHB 2L76A 1E8XA 5DPWA 1LQBA 1OQYA 3R3MA 2LI5A 2ZJDA 4W9HA 2NBVB 2LZ6A 4EKUA 3QAQA 4K7UA 1V5OA 1TTNA 4WJNA 1LM8B 1OTRB 3A9KA 3JSVA 3KUCB 4GN1A 3QQ8B 4G3XB 2KD0A 3SD5A 4BOSC 2KHWB 4GIVA 3EHVA 2FCQA 2LASA 3A9JB 3VH4B 3ZRFA 2K6QA 2LGYA 3UIPB 4TKNA 2BGFA 3BINA 3L13A 3TIXA 2LGXA 2Z0DB 4LJOB 3ECIA 1RLFA 4KIKB 4LCDE 3ZO5B 1WYWB 3DPDA 2BF8B 1UZXB 2NPTA 4HCNB 4F7ZA 3APDA 3HK0A 3Q3JA 1WRDB 4W9EA 4AWJA 4I6PA 2FIFA 1YX5B 4WWPA 5D7GA 3W1YA 5J18A 3HIZA 1RFAA 2GBRA 3VHTC 3PT2B 4ZDVA 3VQIA 3ML8A 3Q3FA 3R7RA 4KV2A 3MTNB 2MBEA 3PS6A 2KLGA 2JUOA 2D2QA 4HXDA 1WM3A 2JVCA 2HTHA 3KH0A 1J8CA 2O2VA 2KXJA 2CR5A 1UH6A 2AL6A 2ZPNA 2KQ7A 4HVBA 2ZEQA 3DBRI 2LRWA 2N9PC 2LXAA 4IWQA 4BVUC 1WY8A 3LJ3A 2LVOA 3VTUA 4NAWB 4TQ0A 2M1MA 1H4RA 4W9GA 2M17A 4NJ6A 2O6VB 4BOZB 3BY4B 2C7NB 2PEAA 5EDSA 3H7SA 3VUXA 1UBQA 3NHEB 2OOBB 5DPRA 4FN2A 3VFKA 3EECA 2JRIB 1WZ3A 3QCAA 4NPNA 5L95C 1RAXA 2Z0EB 2K25A 4I6LB 4TV3A 2KANA 2OJRA 2JF5A 3RYTA 3S2AA 4B95A 1NI2A 5BO4B 2BKFA 4FULA 2FNJB 3V62A 4DWFA 3W1SC 1I35A 3RZFA 4PYZA 4GSWA 2DZJA 3DOWA 4CHKA 1VD2A 3L08A 1V6EA 2MRPA 3C0RB 4HDQA 5CHVC 2KDEB 4GGQA 3NOBA 5D94A 2K1FA 3TL5A 1WJUA 1WGYA 1WX8A 4E71A 3DBLI 4EZKA 2PJHA 1LXDA 2EMTA 2WWZA 2L7RA 3PV1A 1E5WA 2DYBA 5J2RA 3A4SC 3PRPB 3A9JA 1UELA 4GDKB 2Z59B 5TR5A 4JGHB 1IYFA 3RD2A 2PE6B 3QJZA 4K7WA 1E7UA 4OVUA 1WGRA 4KIKA 2CHZA 3QX1A 2KX0A 1WI0A 2G4DB 1MG8A 3QWZB 1GG3A 3PSEB 4KVGB 4W9CA 4WWNA 3ZKJC 5LLIA 2BKRB 2DZKA 2NVUI 2A5UA 3AXCA 3WA0A 3ZTCA 1G6JA 4IG7B 1NBFC 4EFOA 1AARA 4FJVB 4WAAA 3V61A 2AL3A 4DXAB 3SU8X 3T8MA 3A1QB 1V9JA 2V3SA 2CKHB 5AZHA 1OEYJ 1OGWA 2K39A 3AI5A 3RCZA 1EO6A 4IWPA 4DDGD 1WH3A 4EZJA 2GMIC 1EUVB 1D3ZA 4HLEA 5LXHA 3MJWA 4WQOB 1WM2A 2DAFA 1P98A 3M95A 3P2BA 4W9JA 3HM6X 2WDTB 2KMAA 1Q0WB 4GMVA 4RM9A 4AUQC 3EC8A 5GMVA 3WAMA 4NQLB 1GNUA 1Y8RC 3PRMB 5J17A 2LGDA 3H9DA 3M62B 2O6VA 3QIJA 1V49A 1HE8A 3ZW3A 2DX5B 3KYCD 4M0WB 2KTRB 3IVFA 3NZSA 4W9IA 4AJYB 4G11A 2C5LC 2JY6A 2L3ZA 4IM3A 2XK5B 4W9LA 5G2NA 1GC7A 4FA6A 4LJPB 2C7HA 3IBEA 2DZIA 5CX3A 2M4NA 4W9FA 4M8NA 3R7QA 2KN5A 2FIDA 2UYZB 4ZYNA 1WGDA 2FCSA 2KC1A 4EZLA 3QARA 2BWFA 5C23A 4MDKE 4X57B 5JHAA 1ZW7A 5JHBA 4XC2A 3RT3B 4DK5A 2I1KA 5E6NA 1WIAA 3VDZA 2LVQA 1WR1A 2PE9A 1RRBA 2ZZPB 3K9OB 2NCNA 1KM7A 5D2MB 4IWOA 3EFUA 4FHJA 3DVGX 2KTFA 4GXBA 1J0GA 4NY0A 1WFYA 2W9NA 2BWES 1WJNA 4DDID 2JZ3B 2J0MA 3APCA 1WJ6A 2DZMA 4K1RB 2L05A 3W1SA 2IZVB 4KZ0A 2CHXA 2N7EA 3ZUNA 5CHFA 3WAPA 2B3AA 2CU1A 2JWZA 3KUDB 1ZGUB 3NS8A 2KDBA 3X23A 4BBNF 3L10B 3PLUA 1WMHB 4TUUA 2JXXA 2GBJA 2KJHB 2LUEA 2KFJA 4DHJD 4WWOA 4N9F4 1EF5A 1K8RB 3NY5A 3L16A 2L00B 3B0AA 1QZEA 3IFWB 2EKEC 4MSMB 3PREA 4ANVA 4ANUA 3UINB 3RUIB 4NQKE 4ZRJA 1KJTA 2D10A 4W9KA 4GDLB 1V80A 2MBQA 3ML9A 3A1QA 1YD8U 1OEYA 2R2OA 4HK2A 1KOTA 3U8ZA 4PYUA 3ZDMC 3JW0X 3B08A 1L2NA 2FAZA 3L54A 1S3SG 4JL9A 4E3CA 4P7IA 1EF1A 3ZRCA 1V5TA 4RM8A 2ASQA 2DYOA 3PRZA 2MP2B 3ZTDA 2N1WA 2RGFA 4KZCA 4MEMA 2N7DA 3DVNU 3M3JA 1GJZA 2WX0A 4MJSB 4HWIB 1P1AA 2VRRB 3JYUA 2CS4A 2LD9A 3APFA 4IC7B 4JIOU 2C7MB 3VUYA 3VVWB 2D07B 1GUAB 4AP4C 3QA8A 1V81A 1R4MI 2KTRA 4JLCA 1YX6B 3KW5B 5E6PA 3ZVVA 4WJPA 2XK5A 2BYVE 4DBGA 2FCNA 3CSFA 3NZUA 1WZ0A 5CHWA 2RD0A 4HPLB 1E90A 1SIFA 3A4RA 4MGIE 1U4AA 1XD3B 2G4SA 2MX2A 2ZPYA 1YIWA 3WALA 4FJZA 3SHQA 3PPAA 5L83A 2YVCA 3N3KB 4DHZE 1E7VA 3MHSD 3QC8B 4A3OA 1Q1OA 2N1VA 3IHPC 2KFKB 3ENEA 4URKA 1M94A 4BFRA 3X0WA 1UBIA 4MH0E 1C1YB 3DDCB 4HJKA 4FBJB 4MGYE 2WX1A 1ISNA 3JVZX 3KYDD 3TMPB 3OJ3A 4K81A 5JH5C 3QHTA 3WANA 4JQWC 4II3B 2O2VB 4F8CB 4PS7A 1F9JA 4IUMB 3UGBB 1LFDA 4B9KA 4M8MA 1WMHA 2MLBA 4RMAA 3KUZA 4YL8A 3V6EB 3GOEA 2RPQA 4DHZB 4AJWA 4FADA 1FXTB 3K9PB 1NDDA 2KKCA 4NAWA 4NNJB 3N30A 3ZNZB 3H7PB 1GC6A 1WXAA 4BKSA 4ANWA 3DVGY 4A3PA 2GOWA 2KO3A 1WX9A 3DQVA 2AYOB 3QK0A 3M63B 4GOCA 1WE6A 2I1JA 2LVPA 4ICUA 1WX7A 2K8CA 3OLMD 2G45B 4IM2A 3V60A 3L17A 3ALBA 5LXIB 2M8SA 4LDTB 3A33B 4XX5A 3GZNI 1C3TA 1E8WA 3RULA 2XEWA 3ZLZA 4K7SA 2J0KA 2L0TA 4BKSD 2R2QA 2BYFA 1JRUA 2ZCCA 5AEKB 2O6VD 1IP9A 1WR6E 2MP2A 4BKGA 5JZEB 1X1MA 2GBMA 2KDIA 2QHOA 2ZCBA 3PHWB 4II2B 4F1SA 1J19A 3UQAA 2HJ8A 2KLCA 1WGHA 5HKHA 1E8YA 1WXVA 2L8JA 1TBEA 2IO0B 1L7YA 4J6IA 3TBLD 4GU2A 2IO3B 3CMMB 4IW0A 3HHMA 4E74A 2HE7A 4ANXA 4IM0A 5IA7A 5DPSA 3DVNV 1S1QB 2IY1B 2N4FA 2PPHA 2A4ZA 2K6DB 5KHOA
chains in the Genus database with same CATH superfamily
1IGDA 4XZ4A 2AWTA 5AZGA 3D32A 2KMCA 2KDMA 5EE9A 2WYQA 1TS3A 2KX3A 2LEKA 1TZ1A 1FXAA 4IKGA 3VAWA 3ZYYX 5CTRC 2V9HA 2MW5A 1FRRA 3O65B 1JWMD 2QMTA 2N9XA 4N59A 2GBKA 4S0RA 2MH7A 5I4DA 1BT0A 1SGHA 4WJOA 3TJPA 2ZNVC 5BYRA 2J7QB 4YSXB 2J0JA 4CYEA 4ZRKA 1TGZB 1PQSA 2EKIA 3T9LA 2YLMA 4KKJA 3A9KB 3AU5A 2JXTA 1YQBA 2L0FA 1WGKA 3T3NA 1MG4A 2KJRA 5IKCM 4K3CA 4WJQA 2ACZB 2NR2A 3R66C 2E3TA 2LXCA 5DCNA 1F77A 1P0RA 1CMXB 4FXCA 3KWVA 1N5XA 3VXWA 3AE1B 3WIMA 2C60A 3PLVA 4GB9A 3N1ZC 4AOFA 3VTVA 3AULA 2N9EB 1V1PB 3I3TB 1LO5D 5AUIA 2Y5CA 4REZA 1J7AA 1FMAD 2KOXA 5AZFA 2WNMA 2RSUA 4G50A 4GDLA 2JT4B 5G55A 3LXFA 3N20C 1N60A 2QSDA 1P9DU 2K22A 1FCLA 2REXA 4O1NA 1XEEA 1OQQA 4Q2JA 3PTFC 4MSQB 3H1UA 4QAYA 3AE4B 3IAS1 3ZNHB 5DPWA 4W9HA 3RNEC 2LJIA 2LZ6A 4EKUA 1I4PA 3QAQA 4K7UA 2GI9A 1LM8B 2D3AA 4GN1A 2H89B 4G3XB 3SD5A 2KT7A 4GIVA 1JQ4A 2K6QA 1K51A 3L13A 2LGXA 2Z0DB 1K52A 2OEDA 4L23A 1L4ZB 4LCDE 1WYWB 4HCNB 2NPTA 2XNAC 1N6ZA 3HK0A 1B9RA 4W9EA 5D7GA 1KLUD 1PUTA 4ZDVA 5JXVA 3R7RA 2MBEA 2WLBA 3AV8A 4HJGE 1ET6A 2HTHA 1TS5A 2KXJA 2AL6A 2ZPNA 4HVBA 4ZHOA 2FBWB 2ZEQA 1E7PB 2LRWA 2LXAA 1WY8A 3W5VB 2M1MA 4W9GA 1TS2A 2I38A 3TSSA 4BOZB 2PEAA 3Q3OC 3H7SA 3VUXA 1NVID 5DPRA 3QCAA 2N0SB 2BVCA 4I6LB 2WXNA 3NVWA 4B95A 1STEA 3V62A 4FULA 1I35A 4GSWA 3DOWA 4XWWA 1V6EA 3C0RB 4HDQA 2KDEB 4GGQA 5D94A 1WJUA 2VZKD 1XO3A 4M02A 5G5GA 3DBLI 4EZKA 4PT5A 2V4IB 4HROA 3A9JA 1UELA 3IXSA 3NG0A 2RDGA 1XLQA 3RD2A 1E7UA 2KX0A 2BKRB 2DZKA 3WA0A 1NBFC 4EFOA 4FJVB 2IDYA 4WAAA 5AZHA 2PIAA 2B76B 4EZJA 2GMIC 1EUVB 1D3ZA 2D3CA 1P7EA 2DAFA 3M95A 3IT4B 4DXGA 2WDTB 2Q5WD 4AUQC 5J17A 2LGDA 3H9DA 3M62B 1N61A 1HE8A 3N1YC 3IVFA 4G11A 2L3ZA 2C7HA 3V3XA 5CX3A 1SEBD 2PW9A 3EFCA 4M8NA 2FIDA 1JCKB 1WGDA 2FCSA 2KC1A 2W3SA 4EZLA 4MDKE 1ZW7A 2KMMA 5JHBA 3RT3B 3P4PB 3VR8B 1SE2A 1KM7A 1RWSA 2RDBC 4FHJA 1L6VA 2KTFA 4C7YA 1J0GA 2BWES 2J0MA 1SF0A 2AQ3B 4KZ0A 2WXKA 4C80A 2JWZA 3KUDB 4NZLB 1PGXA 1WMHB 2JXXA 2L52A 3SR6A 4ANVA 5EE0A 3ETRA 4ZRQA 2TSSA 4GDLB 1V80A 2MBQA 2X8XX 3AE6B 3A1QA 4MT5A 4WQMA 4P6VF 1KOTA 1MVKA 3U8ZA 3U7ZA 3L54A 1S3SG 4E3CA 1SE4A 3R2IA 2WHIA 2DYOA 2N1WA 4BZAA 3DVNU 4WH4A 2MJDA 3JYUA 2CS4A 2INPE 2JQRB 2D07B 1GUAB 3EUB2 2N9KA 2KTRA 1IGCA 1WZ0A 2WXMA 1XCQL 1E90A 1SIFA 1VZ7A 1SB3C 3A4RA 1XD3B 2G4SA 1QILA 2ZPYA 1YIWA 3PPAA 2J53A 2HTME 4XYCA 1HQRD 3E56A 4JE3B 4OZCA 1K53A 3AB5A 2KFKB 2EELA 1M94A 4BFRA 3X0WA 3RNFC 2R61A 1IBXB 1JWAD 3JVZX 2K3UA 3TMPB 1KLGD 5JH5C 2WXPA 1D5ZC 4OVZA 1QOAA 2V3NA 4F8CB 1FNWA 4IUMB 5IOIA 4B9KA 4M8MA 3VR9B 3KUZA 2BT6A 1D6EC 3GOEA 2RPQA 1N63A 4AJWA 4MM3B 1NENB 4NNJB 4MH8A 3MJ5A 2IJ0A 2AYOB 1VZ8A 3QK0A 1FIQA 1MHHE 1WE6A 3CWIA 2K8CA 2PMVA 3V60A 1EU4A 5LXIB 1E8WA 1T0RC 2N7JA 4RGOS 3RNGC 3ZGZA 1WR6E 2MP2A 1X1MA 3PHWB 3Q3NC 3O13A 4F1SA 1J19A 4PK1A 3GE3C 1VLBA 1EWYC 1E8YA 2L8JA 1LGRA 1NI3A 5BYQA 1HZ5A 4OZAA 1E9MA 4HEA1 2N4FA 3BK2A 2PPHA 3MHZA 4BBNC 3PGEA 2VH2A 1QOFA 2KNBA 4ARIA 2L83A 2XBBC 4NAMA 1TY2A 1H8CA 3CSTA 1GB1A 1KF6B 1YN4A 3SDLC 2MBHA 1I4RA 3AU4A 3OJ4B 3OWEB 1KLVA 2WS3B 2Y5BB 3W2DA 2EMSA 3W9CB 2BW2A 3RPFC 3ZDTA 3BZDB 4FHKA 1ENFA 1T6BX 1ZKHA 2KWUB 1PFDA 2BYEA 2INNE 2E6XA 3H7PA 4HPMB 2J42A 5H92C 2JZZA 4M0WA 3T3OA 1UD7A 3JSVB 3WAOA 4OHJA 3LDZE 4HKZE 2L1AA 2IYDB 1Z5SB 3AEDB 2KWVB 3B1LX 1JALA 3PZDA 3DCGA 4LNFA 2JX5A 2KQSA 3U7DA 2JWUA 5D3IB 1WGGA 2MCNB 1A5RA 1PYWD 2ZVOA 4NJ7A 3Q8FA 3NRZA 1AN8A 1L0VB 3OAWA 2BB5A 2V3PA 1WE7A 4PS3A 1XT9B 2JZPA 2DBYA 1EWCA 2DENB 3RNBC 1V2YA 1T0QC 2KDFB 4IDIA 4C4VA 3BVGA 4LNKA 2LWPA 2V1YA 1WXMA 4W9DA 1MJDA 4MGZE 3TUOA 1WYGA 3DWMA 3GB1A 4ASWC 2VZKB 1JROA 1KTKA 1DOXA 1HZ6A 2WXQA 4MJSA 4RF0A 3DBLB 2KZRA 3DBHI 2CU3A 1BMLC 3RNCC 1E8XA 1OQYA 3R3MA 1HTQA 2GRIA 3QQ8B 1JMLA 3EHVA 4RGNA 2LASA 1XLOA 3PZ8A 2LGYA 3UIPB 2BGFA 2MJ3A 4LJOB 3ECIA 2LGSA 3ZO5B 2UU7A 2BF8B 3DPDA 1T5XD 4RCOA 5IP4D 1C4AA 2ICIA 3Q3JA 1WRDB 1GB4A 4AWJA 1YJIA 3W1YA 3RFZB 1XLPA 3ML8A 1KRHA 4KV2A 3MTNB 3PS6A 3EA6A 2KLGA 4US8A 1Q10A 2IGHA 4HXDA 4ZOHC 1I4GA 1WM3A 2JVCA 1QKZA 2K9XA 1J8CA 1UH6A 4YTPB 1FD6A 4IWQA 4BVUC 3LJ3A 2LVOA 2JYEA 1AWDA 3BY4B 1J7CA 5EDSA 4YTNB 3NHEB 3VFKA 4NPNA 2LHEA 1T3QA 2K25A 1NI2A 5BO4B 2BKFA 2FNJB 4YSYB 1L6UA 2WDQB 2DZJA 4CHKA 1VD2A 3L08A 2PTLA 2BTEA 2M19A 3NOBA 3MC9A 3TL5A 3AEBB 1E5WA 1QF6A 3A4SC 4AQ7A 2Z59B 5TR5A 4KIKA 1WI0A 1MG8A 3QWZB 4KVGB 5LLIA 3AXCA 1G6JA 1SJHD 3V61A 3T8MA 1ZDXA 1V9JA 2V3SA 2CKHB 1OEYJ 1OGWA 2K39A 1DYQA 4DDGD 2VH1A 4WQOB 3B2GA 3BIID 2WXRA 3EC8A 3WAMA 1GNUA 5AUKA 5IN7A 2O6VA 2ON8A 4B0EA 4M0WB 3NZSA 4FA6A 2XK5B 1ZUD2 3R8BA 3IBEA 2DZIA 3B9JA 4W9FA 2UYZB 1F2RI 3QARA 5C23A 1WWTA 4DK5A 2LVQA 1WR1A 2PE9A 2W3RA 2ZZPB 2YEPF 2NCNA 4ZYSA 4IWOA 3P42A 3DVGX 4NY0A 4RH6A 2WU5B 1ZXIA 3Q8AA 2DZMA 1C76A 2W82A 4MACA 2IZVB 2BYTA 2N7EA 2LGIA 5CHFA 2B3AA 3NS8A 5BMGA 2GBJA 2KJHB 2LUEA 2KFJA 4WWOA 2BS4B 1N5WA 4MSMB 2EKEC 3PREA 3UINB 3RUIB 1YJJA 4NQKE 4C4VB 1KJTA 2OHFA 3Q2AC 1QOGA 1OEYA 2KQ4X 4JL9A 2OJWA 2ASQA 3PRZA 2N7DA 2WX0A 4MJSB 2VRRB 4A90A 1ZP0B 1GPXA 2DLBA 2LD9A 4IC7B 1TKYA 3TEYA 2C7MB 2MJEA 3VUYA 4RNAA 3C19A 4D2KA 3I9V1 1VJKA 4KGRA 1R4MI 4LNOA 4LK0M 5CHWA 1V8CA 3WALA 1UWMA 1D5MC 2YVCA 3BWUD 3N3KB 1E7VA 3MHSD 4A3OA 4HRSA 1FFUA 2SEBD 1UBIA 4MH0E 1FM0D 3U2SC 2INCC 1WXQA 4II3B 1F52A 4C56C 4PS7A 3UGBB 2MLBA 4FADA 5TSSA 1NDDA 2KKCA 1NYRA 3N30A 1XXGA 2WXGA 3GP7A 3DQVA 1VR9A 1D4BA 4ICUA 4IM2A 3OLMD 3AH7A 2G45B 3L17A 3Q6BA 2M8SA 1HTOA 3RULA 3ZLZA 3EGRA 2LMCA 4NJCA 1JRUA 2ZCCA 3ZJTA 1IP9A 1AW7A 2KDIA 1YN3A 2QHOA 1XF5L 1TT5B 4ITKA 1WGHA 5HKHA 1UUPA 4C7ZA 1L7YA 3TBLD 1D5XC 4GU2A 5HG2A 4IW0A 3CMMB 4KGTA 3B2FA 1S1QB 2G1EA 3CIRB 2K6DB 5KHOA 3BYYB 4KSKC 1SJED 4DQOC 2ZVNA 2CHWA 3U30A 1TS4A 1Z2MA 5G5HA 2MBBB 4HPPA 4YXDB 2NBUA 1QLBB 2I2YA 2IO1B 2KWCA 1FRDA 4OW0A 1JWSD 1F2RC 4ZRIA 3DBHB 5C1ZA 1ACCA 2D3BA 4MELA 3AN1A 1MFWA 4OZBA 1CK1A 2LJ5A 3AEAB 3CF6E 2M0XA 4HDOA 4A20A 2C9WB 1P3QU 2FCMA 1WXSA 5D6JB 2IY0B 3ZIMA 2MQJA 3PHXB 4G0NB 3ONSA 3E9SA 5FR3A 3SFDB 5FR6A 1JWUD 3N9YC 3V6CB 1YN5A 3AEEB 2NPTB 5EE3A 4EUTA 1SBBB 3HM3A 4TQ1A 2GBNA 3HUIA 2LRUA 5MPOA 1BUIC 3AE3B 4XGAB 3VTWA 4TSSA 3C8YA 3U52E 2K0PA 1CJEA 2G3QB 2BPSA 2DAJA 2WXOA 4FJYA 2UWQA 3IG3A 1FXIA 1V86A 2KJ6A 3WCQA 1ZE3D 3ZNID 1NYQA 1P7FA 4UDUC 3ZNGC 3AE8B 2NS5A 1R4NI 2PVGC 2HD5B 2IBIB 2DHZA 2WP9B 4B6WA 2AEHA 3VUWA 3DBSA 3UIOB 2MWSB 2AQ1B 3VRAB 4EEWA 1Q5WB 1AYFA 1LQBA 2LI5A 2ZJDA 1V5OA 1K50A 4XDDA 1OTRB 3A9KA 1I4HA 3KUCB 3URYA 3Q8BA 3P63A 2FCQA 3VH4B 3A9JB 3ZRFA 3TIXA 3KLSX 4RGMA 1YNTE 1RLFA 1CQVA 4DXFA 3AMZA 4I6PA 2FIFA 1YX5B 4WWPA 2QIEB 3HIZA 4USAA 3PT2B 3VQIA 2KAJA 3ABVB 3AE2B 2D5GA 3NVVA 1TJEA 2KQ7A 3DBRI 2N9PC 1XLNA 1L0YB 3VTUA 2W55A 1H4RA 1XCTL 3AECB 1GAQB 1SSNA 2JSVX 3Q69A 1WRIA 3I57A 1MI0A 2M56B 3EECA 4LNNA 2JRIB 3DWGC 2M0AA 1TIFA 2QJLA 1PGAA 2JF5A 3RYTA 3S2AA 4DWFA 3RI7C 3W1SC 3ZJVA 3RZFA 2IGGA 1FNVA 2H88B 1OQRA 5CHVC 2KACA 1WGYA 1WX8A 1V97A 1I4QA 4LTUA 2PJHA 1LXDA 2EMTA 2LFIA 2WWZA 2L7RA 3W5UB 3PV1A 1F1HA 2DYBA 4YSZB 3PRPB 1MPEA 2CHZA 3QX1A 2G4DB 1GG3A 3ZKJC 2NVUI 2A5UA 1QOBA 3ZTCA 4IG7B 2AL3A 3Q14C 3NVYA 3SU8X 3A1QB 1L4DB 2NTSA 1HA5A 4IWPA 1UF0A 2LUMA 1RYJA 3RN9C 5LXHA 3MJWA 2BS3B 1WM2A 1JW9D 1P98A 1SXTA 1R4MB 5BMIA 2KMAA 2XN9C 5H8YE 1B1ZA 1Q0WB 2INDC 3BK1A 1FO4A 4NQLB 3PRMB 3QIJA 2DX5B 2QC8A 1IUEA 2KTRB 4W9IA 2C5LC 5G2NA 1GC7A 2WXJA 4LJPB 5E6JA 2M4NA 3R7QA 4ZYNA 2BWFA 4X57B 4LNIA 2LHDA 4S17A 2BQQA 5E6NA 1RRBA 1UWXA 2RDHA 3K9OB 1HEZE 1V1OA 3EFUA 4A8XC 1WFYA 2W9NA 3AE7B 4DDID 3APCA 1WJ6A 2CHXA 3ZUNA 4BBNF 3X23A 1ZGUB 3U4EG 3L10B 3PLUA 1FCCC 4N9F4 1K8RB 3NY5A 2WDRB 2J52A 1QZEA 3B0AA 4ANUA 4W9KA 3ML9A 4L1BA 1ZOYB 2R2OA 4HK2A 3ZDMC 1UGJA 1GOZA 2FAZA 4P7IA 1EF1A 1CZPA 3ZRCA 4BAXA 3N1XC 1C9FA 2MP2B 2RPVA 3M3JA 4HWIB 4TMAB 5BYSA 4R3DA 4WAFA 3APFA 4JIOU 3VVWB 4AP4C 3QA8A 3DHHC 4JLCA 3ZXRA 5E6PA 3ZVVA 2PVOD 1T0SC 4DBGA 2FCNA 4WURA 3CSFA 3NZUA 2RD0A 2MHJA 2JU6X 4M01A 2BS2B 4EE2A 3SHQA 3BYTB 5L83A 1PGBA 3IT6B 4IOIE 1QT9A 1Q1OA 2IGDA 2N1VA 3IHPC 2DNFA 4URKA 3H8HA 3DDCB 4HJKA 3RNAC 4MGYE 2WX1A 1ISNA 1FPYA 1L0XB 3KYDD 2FUG1 3OJ3A 4K81A 3QHTA 3WANA 2V0GA 1F9JA 1DOIA 2ONQA 1WMHA 3V6EB 4YL8A 2SAKA 1FFVA 4DHZB 1FXTB 3K9PB 4NAWA 3ZNZB 3H7PB 1GC6A 4BKSA 3DVGY 4RFBA 2KO3A 1WX9A 1KH0A 4GOCA 4JWSC 3A33B 4A6QA 3GZNI 4P16A 3P4RB 2XEWA 2J0KA 4A55A 4ACFA 5JZEB 2GBMA 1ZDVA 2ZCBA 2NTTA 1SIJA 2KLCA 1WXVA 1TBEA 4J6IA 2IO3B 1EU3A 3AM9A 1TYGB 4M00A 4IM0A 3V05A 1C79A 1EM7A 5DPSA 2IY1B 4GDKA 2YEPB 2NMQA 3I5JC 3SEBA 2WDVB 3UQBA 4AS1A 1WF9A 3N32A 4YWGG 3AE9B 4KSLC 1E8ZA 2KFKA 4XDCA 4A9AA 1L5PA 1TY0A 3VH3B 3P4SB 1R4NB 1UGMA 2WXFA 4CO7A 1RFKA 2ZW0A 2MSED 3L0WB 1DOYA 1IBXA 1A70A 1YJ1A 2MBOA 2JRHA 1JWBD 2K8HA 4I6NB 2KK8A 2NBWB 1WJ4A 2IO2B 4JPSA 1XQQA 1PDXA 4MM3A 2K5PA 1MHXA 4OVVA 1I42A 2K8BA 2DYMA 4ARCA 1SE9A 1N62A 3NVZA 4EOYA 3TEWA 2AQ2B 4KDIC 4L2YA 2ZNVB 4FLHA 3PVLA 3NUHB 1IPGA 1SE3A 4MGKE 1E10A 4LDTD 3RMKC 3J9CA 2BBCA 4C00A 2D3GA 5KHQA 1VCBA 1OFFA 3H6NA 4BKTA 2MA9B 5BMHA 3DBRB 4DHJB 1E0ZA 3UF8A 4PS8A 3RZWC 2JPHA 3R2TA 2D11A 3GS2A 5HHDG 5E6OA 3KVFB 5HFYA 4KDLB 2V4LA 5DPTA 2KC2A 3TCAA 2WXIA 1Y56A 1T0YA 2FUHB 2JYTA 5FKAC 2KVRA 2CJNA 2RR9A 4N6EB 2GLSA 3L4PA 5EE1A 3PZ7A 3GE8C 2ZW1A 5IAAC 2QCZA 4HCPB 4ICVA 3TEZA 2L76A 5C2TB 5T8IA 2NBVB 1TTNA 4WJNA 3JSVA 2W54A 4WIPA 2KD0A 4P1BC 4BOSC 2IPKD 2KHWB 2X38A 1I4XA 4TKNA 1R7SA 3BINA 1VRAB 1BXTA 4KIKB 1UZXB 4F7ZA 3APDA 3NS1A 5J18A 1RFAA 2GBRA 3VHTC 3SFEB 3ZXVA 3Q3FA 3FILA 1F0ZA 2QDFA 3BVMA 2JUOA 2D2QA 1NEKB 3IAM1 3KH0A 2O2VA 2CR5A 3HVZA 4ZRPA 4J3OD 4XE0A 2WGSA 2Z8LA 4TQ0A 4NAWB 5LNK1 2M17A 1VDVA 4NJ6A 2O6VB 1ZXHA 2C7NB 1UBQA 2OOBB 2DWQA 3DHIC 4FN2A 1C77A 1WZ3A 3MP9A 5L95C 1RAXA 2Z0EB 3ZQ4A 4TV3A 1UNSA 2KANA 5FK9C 2OJRA 5HI1A 1HXYD 4LLGM 4YT0B 2QEJC 2WXHA 1YQ3B 4PYZA 3BVZA 2MRPA 4ZHPA 3AE5B 2K1FA 4E71A 5J2RA 4CQNA 4GDKB 2WU2B 3OG5A 4JGHB 1IYFA 2PE6B 3QJZA 4K7WA 4OVUA 1WGRA 3AEFB 2GB1A 4W9CA 3PSEB 4WWNA 5C3JB 1E6EB 2PLPA 3MC8A 3VRBB 1AARA 1I7HA 4DXAB 3AI5A 3RCZA 1FEHA 1EO6A 3NZ3A 4HKQA 1YQ4B 4P1CC 1WH3A 4HLEA 1ET9A 3P2BA 4W9JA 3FKYA 3HM6X 4RM9A 4GMVA 5GMVA 1Y8RC 2PKOA 4K3BA 1V49A 3ZW3A 3KYCD 3KWLA 2AX5A 4AJYB 5D3DA 2JY6A 4W9LA 4IM3A 3Q3MC 3FAHA 2KN5A 1DGJA 2KYWA 5JHAA 1KFYB 4XC2A 2I1KA 3VDZA 1WIAA 1JRPA 2FE8A 3P4QB 4GLSC 2HJ1A 5D2MB 1ROEA 3Q8EA 4GXBA 1WJNA 3MFGA 2JZ3B 4K1RB 2L05A 3W1SA 3WAPA 2CU1A 2KDBA 4TUUA 2Y3AA 1V1PA 5IO9A 3I63C 4DHJD 1EF5A 3L16A 1C4PA 1WSPA 2L00B 1ESFA 4H2AA 3IFWB 3GZNB 4ZRJA 4JX1C 2D10A 4RF1A 4RGTA 1YD8U 4PYUA 3JW0X 3B08A 4JWUC 1L2NA 2N9LA 4KKIA 1V5TA 1M4VA 1VZ6A 4RM8A 3ZTDA 1GJZA 2RGFA 2WQYB 4KZCA 4MEMA 5GXGB 3HRDD 1P1AA 3AEGB 2Y5PA 3HVDA 2G9HD 1V81A 1YX6B 3KW5B 4WJPA 2HDEA 2XK5A 2BYVE 4KGSA 4HPLB 3LB8C 4MGIE 1U4AA 4WWMA 2MX2A 4YTMB 4FJZA 3DHGC 3KQ4A 3NJTA 4DHZE 1ZPSA 1RM6C 3QC8B 3ZJUA 2MEKA 3ENEA 4N58A 4XWTA 1C1YB 3FILB 4FBJB 4KX6B 3LYYA 2L32A 4JQWC 2O2VB 1LFDA 1YMHE 4RMAA 1FNUA 3UI3A 4ANWA 1WXAA 2WXLA 1C78A 4A3PA 2J4XA 2GOWA 3M63B 2I1JA 2LVPA 1WX7A 3ALBA 1QQRA 4B0MA 4LDTB 1C3TA 4XX5A 2KN4A 4BKSD 2BB6A 4K7SA 2L0TA 1YOVB 2R2QA 2BYFA 1TKGA 5AEKB 3TEXA 2O6VD 4BKGA 3Q8CA 2RMMA 3PO0A 1TKEA 2QILA 4II2B 3UQAA 2KVZA 2HJ8A 1C4CA 2IO0B 2KWDA 1J7BA 3MC0B 3HHMA 4E74A 2HE7A 4ANXA 3FC4A 5IA7A 1TZOA 4US9A 3DVNV 2CJOA 2A4ZA 3P1MA
chains in the Genus database with same CATH topology
4GDKA 3PGEA 4XZ4A 2AWTA 4KSKC 5AZGA 3UQBA 1WF9A 3D32A 3N32A 2KMCA 2KNBA 2ZVNA 2CHWA 3U30A 2XBBC 4KSLC 2WYQA 1E8ZA 2KFKA 1Z2MA 1H8CA 2KX3A 3CSTA 3VH3B 2MBBB 1TZ1A 1UGMA 2NBUA 4CO7A 2IO1B 2MSED 3SDLC 2MBHA 3L0WB 2KWCA 3AU4A 3VAWA 3OJ4B 1KLVA 5CTRC 2MW5A 1YJ1A 2MBOA 2Y5BB 2JRHA 4ZRIA 3O65B 2K8HA 4I6NB 2N9XA 2KK8A 2EMSA 5C1ZA 2NBWB 2GBKA 3ZDTA 1BT0A 1WJ4A 2IO2B 1SGHA 4WJOA 4FHKA 3TJPA 1XQQA 1ZKHA 2KWUB 2ZNVC 4MELA 2J7QB 2BYEA 4MM3A 2J0JA 4CYEA 3H7PA 2LJ5A 4ZRKA 1TGZB 4HPMB 4OVVA 1PQSA 3CF6E 1I42A 2JZZA 2K8BA 2M0XA 4HDOA 4A20A 2DYMA 1SE9A 3T9LA 2YLMA 2C9WB 1UD7A 3A9KB 3JSVB 3AU5A 3WAOA 1YQBA 2L0FA 4EOYA 1P3QU 2FCMA 3LDZE 1WXSA 4KDIC 5D6JB 2KJRA 2ZNVB 2IY0B 2IYDB 3ZIMA 1Z5SB 2MQJA 3PHXB 4G0NB 2KWVB 3PVLA 4FLHA 4WJQA 3B1LX 3ONSA 3PZDA 1IPGA 3DCGA 2NR2A 4MGKE 5FR6A 3R66C 2KQSA 3V6CB 2NPTB 2LXCA 3U7DA 4LDTD 2D3GA 5DCNA 5KHQA 1VCBA 1WGGA 1P0RA 1CMXB 4EUTA 2MCNB 1A5RA 2ZVOA 3H6NA 3HM3A 2MA9B 4NJ7A 4BKTA 4TQ1A 2GBNA 3VXWA 3WIMA 3OAWA 4DHJB 2C60A 2LRUA 3PLVA 1WE7A 4GB9A 3UF8A 4PS3A 1XT9B 4PS8A 4AOFA 3VTWA 3RZWC 3VTVA 2JPHA 3AULA 2N9EB 2D11A 3I3TB 5E6OA 2G3QB 2BPSA 2DAJA 3KVFB 2DENB 4FJYA 2UWQA 4KDLB 2V4LA 3IG3A 1V2YA 5DPTA 2KC2A 1V86A 5AZFA 2KOXA 2KJ6A 2KDFB 3TCAA 2RSUA 4G50A 2LWPA 2V1YA 1T0YA 4GDLA 3ZNID 1WXMA 4W9DA 2JT4B 5G55A 3ZNGC 2FUHB 4MGZE 2NS5A 1R4NI 2KVRA 2HD5B 2RR9A 2IBIB 1P9DU 2DHZA 4B6WA 2AEHA 2REXA 4ASWC 3VUWA 4BBNC 3DBSA 4MJSA 5IAAC 2KZRA 3UIOB 2MWSB 3PTFC 3DBHI 4MSQB 4EEWA 4HCPB 3H1UA 4ICVA 1Q5WB 3ZNHB 2L76A 1E8XA 5DPWA 1LQBA 1OQYA 3R3MA 2LI5A 2ZJDA 4W9HA 2NBVB 2LZ6A 4EKUA 3QAQA 4K7UA 1V5OA 1TTNA 4WJNA 1LM8B 1OTRB 3A9KA 3JSVA 3KUCB 4GN1A 3QQ8B 4G3XB 2KD0A 3SD5A 4BOSC 2KHWB 4GIVA 3EHVA 2FCQA 2LASA 3A9JB 3VH4B 3ZRFA 2K6QA 2LGYA 3UIPB 4TKNA 2BGFA 3BINA 3L13A 3TIXA 2LGXA 2Z0DB 4LJOB 3ECIA 1RLFA 4KIKB 4LCDE 3ZO5B 1WYWB 3DPDA 2BF8B 1UZXB 2NPTA 4HCNB 4F7ZA 3APDA 3HK0A 3Q3JA 1WRDB 4W9EA 4AWJA 4I6PA 2FIFA 1YX5B 4WWPA 5D7GA 3W1YA 5J18A 3HIZA 1RFAA 2GBRA 3VHTC 3PT2B 4ZDVA 3VQIA 3ML8A 3Q3FA 3R7RA 4KV2A 3MTNB 2MBEA 3PS6A 2KLGA 2JUOA 2D2QA 4HXDA 1WM3A 2JVCA 2HTHA 3KH0A 1J8CA 2O2VA 2KXJA 2CR5A 1UH6A 2AL6A 2ZPNA 2KQ7A 4HVBA 2ZEQA 3DBRI 2LRWA 2N9PC 2LXAA 4IWQA 4BVUC 1WY8A 3LJ3A 2LVOA 3VTUA 4NAWB 4TQ0A 2M1MA 1H4RA 4W9GA 2M17A 4NJ6A 2O6VB 4BOZB 3BY4B 2C7NB 2PEAA 5EDSA 3H7SA 3VUXA 1UBQA 3NHEB 2OOBB 5DPRA 4FN2A 3VFKA 3EECA 2JRIB 1WZ3A 3QCAA 4NPNA 5L95C 1RAXA 2Z0EB 2K25A 4I6LB 4TV3A 2KANA 2OJRA 2JF5A 3RYTA 3S2AA 4B95A 1NI2A 5BO4B 2BKFA 4FULA 2FNJB 3V62A 4DWFA 3W1SC 1I35A 3RZFA 4PYZA 4GSWA 2DZJA 3DOWA 4CHKA 1VD2A 3L08A 1V6EA 2MRPA 3C0RB 4HDQA 5CHVC 2KDEB 4GGQA 3NOBA 5D94A 2K1FA 3TL5A 1WJUA 1WGYA 1WX8A 4E71A 3DBLI 4EZKA 2PJHA 1LXDA 2EMTA 2WWZA 2L7RA 3PV1A 1E5WA 2DYBA 5J2RA 3A4SC 3PRPB 3A9JA 1UELA 4GDKB 2Z59B 5TR5A 4JGHB 1IYFA 3RD2A 2PE6B 3QJZA 4K7WA 1E7UA 4OVUA 1WGRA 4KIKA 2CHZA 3QX1A 2KX0A 1WI0A 2G4DB 1MG8A 3QWZB 1GG3A 3PSEB 4KVGB 4W9CA 4WWNA 3ZKJC 5LLIA 2BKRB 2DZKA 2NVUI 2A5UA 3AXCA 3WA0A 3ZTCA 1G6JA 4IG7B 1NBFC 4EFOA 1AARA 4FJVB 4WAAA 3V61A 2AL3A 4DXAB 3SU8X 3T8MA 3A1QB 1V9JA 2V3SA 2CKHB 5AZHA 1OEYJ 1OGWA 2K39A 3AI5A 3RCZA 1EO6A 4IWPA 4DDGD 1WH3A 4EZJA 2GMIC 1EUVB 1D3ZA 4HLEA 5LXHA 3MJWA 4WQOB 1WM2A 2DAFA 1P98A 3M95A 3P2BA 4W9JA 3HM6X 2WDTB 2KMAA 1Q0WB 4GMVA 4RM9A 4AUQC 3EC8A 5GMVA 3WAMA 4NQLB 1GNUA 1Y8RC 3PRMB 5J17A 2LGDA 3H9DA 3M62B 2O6VA 3QIJA 1V49A 1HE8A 3ZW3A 2DX5B 3KYCD 4M0WB 2KTRB 3IVFA 3NZSA 4W9IA 4AJYB 4G11A 2C5LC 2JY6A 2L3ZA 4IM3A 2XK5B 4W9LA 5G2NA 1GC7A 4FA6A 4LJPB 2C7HA 3IBEA 2DZIA 5CX3A 2M4NA 4W9FA 4M8NA 3R7QA 2KN5A 2FIDA 2UYZB 4ZYNA 1WGDA 2FCSA 2KC1A 4EZLA 3QARA 2BWFA 5C23A 4MDKE 4X57B 5JHAA 1ZW7A 5JHBA 4XC2A 3RT3B 4DK5A 2I1KA 5E6NA 1WIAA 3VDZA 2LVQA 1WR1A 2PE9A 1RRBA 2ZZPB 3K9OB 2NCNA 1KM7A 5D2MB 4IWOA 3EFUA 4FHJA 3DVGX 2KTFA 4GXBA 1J0GA 4NY0A 1WFYA 2W9NA 2BWES 1WJNA 4DDID 2JZ3B 2J0MA 3APCA 1WJ6A 2DZMA 4K1RB 2L05A 3W1SA 2IZVB 4KZ0A 2CHXA 2N7EA 3ZUNA 5CHFA 3WAPA 2B3AA 2CU1A 2JWZA 3KUDB 1ZGUB 3NS8A 2KDBA 3X23A 4BBNF 3L10B 3PLUA 1WMHB 4TUUA 2JXXA 2GBJA 2KJHB 2LUEA 2KFJA 4DHJD 4WWOA 4N9F4 1EF5A 1K8RB 3NY5A 3L16A 2L00B 3B0AA 1QZEA 3IFWB 2EKEC 4MSMB 3PREA 4ANVA 4ANUA 3UINB 3RUIB 4NQKE 4ZRJA 1KJTA 2D10A 4W9KA 4GDLB 1V80A 2MBQA 3ML9A 3A1QA 1YD8U 1OEYA 2R2OA 4HK2A 1KOTA 3U8ZA 4PYUA 3ZDMC 3JW0X 3B08A 1L2NA 2FAZA 3L54A 1S3SG 4JL9A 4E3CA 4P7IA 1EF1A 3ZRCA 1V5TA 4RM8A 2ASQA 2DYOA 3PRZA 2MP2B 3ZTDA 2N1WA 2RGFA 4KZCA 4MEMA 2N7DA 3DVNU 3M3JA 1GJZA 2WX0A 4MJSB 4HWIB 1P1AA 2VRRB 3JYUA 2CS4A 2LD9A 3APFA 4IC7B 4JIOU 2C7MB 3VUYA 3VVWB 2D07B 1GUAB 4AP4C 3QA8A 1V81A 1R4MI 2KTRA 4JLCA 1YX6B 3KW5B 5E6PA 3ZVVA 4WJPA 2XK5A 2BYVE 4DBGA 2FCNA 3CSFA 3NZUA 1WZ0A 5CHWA 2RD0A 4HPLB 1E90A 1SIFA 3A4RA 4MGIE 1U4AA 1XD3B 2G4SA 2MX2A 2ZPYA 1YIWA 3WALA 4FJZA 3SHQA 3PPAA 5L83A 2YVCA 3N3KB 4DHZE 1E7VA 3MHSD 3QC8B 4A3OA 1Q1OA 2N1VA 3IHPC 2KFKB 3ENEA 4URKA 1M94A 4BFRA 3X0WA 1UBIA 4MH0E 1C1YB 3DDCB 4HJKA 4FBJB 4MGYE 2WX1A 1ISNA 3JVZX 3KYDD 3TMPB 3OJ3A 4K81A 5JH5C 3QHTA 3WANA 4JQWC 4II3B 2O2VB 4F8CB 4PS7A 1F9JA 4IUMB 3UGBB 1LFDA 4B9KA 4M8MA 1WMHA 2MLBA 4RMAA 3KUZA 4YL8A 3V6EB 3GOEA 2RPQA 4DHZB 4AJWA 4FADA 1FXTB 3K9PB 1NDDA 2KKCA 4NAWA 4NNJB 3N30A 3ZNZB 3H7PB 1GC6A 1WXAA 4BKSA 4ANWA 3DVGY 4A3PA 2GOWA 2KO3A 1WX9A 3DQVA 2AYOB 3QK0A 3M63B 4GOCA 1WE6A 2I1JA 2LVPA 4ICUA 1WX7A 2K8CA 3OLMD 2G45B 4IM2A 3V60A 3L17A 3ALBA 5LXIB 2M8SA 4LDTB 3A33B 4XX5A 3GZNI 1C3TA 1E8WA 3RULA 2XEWA 3ZLZA 4K7SA 2J0KA 2L0TA 4BKSD 2R2QA 2BYFA 1JRUA 2ZCCA 5AEKB 2O6VD 1IP9A 1WR6E 2MP2A 4BKGA 5JZEB 1X1MA 2GBMA 2KDIA 2QHOA 2ZCBA 3PHWB 4II2B 4F1SA 1J19A 3UQAA 2HJ8A 2KLCA 1WGHA 5HKHA 1E8YA 1WXVA 2L8JA 1TBEA 2IO0B 1L7YA 4J6IA 3TBLD 4GU2A 2IO3B 3CMMB 4IW0A 3HHMA 4E74A 2HE7A 4ANXA 4IM0A 5IA7A 5DPSA 3DVNV 1S1QB 2IY1B 2N4FA 2PPHA 2A4ZA 2K6DB 5KHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GDK A;  3PGE A;  4XZ4 A;  2AWT A;  4KSK C;  5AZG A;  3UQB A;  1WF9 A;  3D32 A;  3N32 A;  2KMC A;  2KNB A;  2ZVN A;  2CHW A;  3U30 A;  2XBB C;  4KSL C;  2WYQ A;  1E8Z A;  2KFK A;  1Z2M A;  1H8C A;  2KX3 A;  3CST A;  3VH3 B;  2MBB B;  1TZ1 A;  1UGM A;  2NBU A;  4CO7 A;  2IO1 B;  2MSE D;  3SDL C;  2MBH A;  3L0W B;  2KWC A;  3AU4 A;  3VAW A;  3OJ4 B;  1KLV A;  5CTR C;  2MW5 A;  1YJ1 A;  2MBO A;  2Y5B B;  2JRH A;  4ZRI A;  3O65 B;  2K8H A;  4I6N B;  2N9X A;  2KK8 A;  2EMS A;  5C1Z A;  2NBW B;  2GBK A;  3ZDT A;  1BT0 A;  1WJ4 A;  2IO2 B;  1SGH A;  4WJO A;  4FHK A;  3TJP A;  1XQQ A;  1ZKH A;  2KWU B;  2ZNV C;  4MEL A;  2J7Q B;  2BYE A;  4MM3 A;  2J0J A;  4CYE A;  3H7P A;  2LJ5 A;  4ZRK A;  1TGZ B;  4HPM B;  4OVV A;  1PQS A;  3CF6 E;  1I42 A;  2JZZ A;  2K8B A;  2M0X A;  4HDO A;  4A20 A;  2DYM A;  1SE9 A;  3T9L A;  2YLM A;  2C9W B;  1UD7 A;  3A9K B;  3JSV B;  3AU5 A;  3WAO A;  1YQB A;  2L0F A;  4EOY A;  1P3Q U;  2FCM A;  3LDZ E;  1WXS A;  4KDI C;  5D6J B;  2KJR A;  2ZNV B;  2IY0 B;  2IYD B;  3ZIM A;  1Z5S B;  2MQJ A;  3PHX B;  4G0N B;  2KWV B;  3PVL A;  4FLH A;  4WJQ A;  3B1L X;  3ONS A;  3PZD A;  1IPG A;  3DCG A;  2NR2 A;  4MGK E;  5FR6 A;  3R66 C;  2KQS A;  3V6C B;  2NPT B;  2LXC A;  3U7D A;  4LDT D;  2D3G A;  5DCN A;  5KHQ A;  1VCB A;  1WGG A;  1P0R A;  1CMX B;  4EUT A;  2MCN B;  1A5R A;  2ZVO A;  3H6N A;  3HM3 A;  2MA9 B;  4NJ7 A;  4BKT A;  4TQ1 A;  2GBN A;  3VXW A;  3WIM A;  3OAW A;  4DHJ B;  2C60 A;  2LRU A;  3PLV A;  1WE7 A;  4GB9 A;  3UF8 A;  4PS3 A;  1XT9 B;  4PS8 A;  4AOF A;  3VTW A;  3RZW C;  3VTV A;  2JPH A;  3AUL A;  2N9E B;  2D11 A;  3I3T B;  5E6O A;  2G3Q B;  2BPS A;  2DAJ A;  3KVF B;  2DEN B;  4FJY A;  2UWQ A;  4KDL B;  2V4L A;  3IG3 A;  1V2Y A;  5DPT A;  2KC2 A;  1V86 A;  5AZF A;  2KOX A;  2KJ6 A;  2KDF B;  3TCA A;  2RSU A;  4G50 A;  2LWP A;  2V1Y A;  1T0Y A;  4GDL A;  3ZNI D;  1WXM A;  4W9D A;  2JT4 B;  5G55 A;  3ZNG C;  2FUH B;  4MGZ E;  2NS5 A;  1R4N I;  2KVR A;  2HD5 B;  2RR9 A;  2IBI B;  1P9D U;  2DHZ A;  4B6W A;  2AEH A;  2REX A;  4ASW C;  3VUW A;  4BBN C;  3DBS A;  4MJS A;  5IAA C;  2KZR A;  3UIO B;  2MWS B;  3PTF C;  3DBH I;  4MSQ B;  4EEW A;  4HCP B;  3H1U A;  4ICV A;  1Q5W B;  3ZNH B;  2L76 A;  1E8X A;  5DPW A;  1LQB A;  1OQY A;  3R3M A;  2LI5 A;  2ZJD A;  4W9H A;  2NBV B;  2LZ6 A;  4EKU A;  3QAQ A;  4K7U A;  1V5O A;  1TTN A;  4WJN A;  1LM8 B;  1OTR B;  3A9K A;  3JSV A;  3KUC B;  4GN1 A;  3QQ8 B;  4G3X B;  2KD0 A;  3SD5 A;  4BOS C;  2KHW B;  4GIV A;  3EHV A;  2FCQ A;  2LAS A;  3A9J B;  3VH4 B;  3ZRF A;  2K6Q A;  2LGY A;  3UIP B;  4TKN A;  2BGF A;  3BIN A;  3L13 A;  3TIX A;  2LGX A;  2Z0D B;  4LJO B;  3ECI A;  1RLF A;  4KIK B;  4LCD E;  3ZO5 B;  1WYW B;  3DPD A;  2BF8 B;  1UZX B;  2NPT A;  4HCN B;  4F7Z A;  3APD A;  3HK0 A;  3Q3J A;  1WRD B;  4W9E A;  4AWJ A;  4I6P A;  2FIF A;  1YX5 B;  4WWP A;  5D7G A;  3W1Y A;  5J18 A;  3HIZ A;  1RFA A;  2GBR A;  3VHT C;  3PT2 B;  4ZDV A;  3VQI A;  3ML8 A;  3Q3F A;  3R7R A;  4KV2 A;  3MTN B;  2MBE A;  3PS6 A;  2KLG A;  2JUO A;  2D2Q A;  4HXD A;  1WM3 A;  2JVC A;  2HTH A;  3KH0 A;  1J8C A;  2O2V A;  2KXJ A;  2CR5 A;  1UH6 A;  2AL6 A;  2ZPN A;  2KQ7 A;  4HVB A;  2ZEQ A;  3DBR I;  2LRW A;  2N9P C;  2LXA A;  4IWQ A;  4BVU C;  1WY8 A;  3LJ3 A;  2LVO A;  3VTU A;  4NAW B;  4TQ0 A;  2M1M A;  1H4R A;  4W9G A;  2M17 A;  4NJ6 A;  2O6V B;  4BOZ B;  3BY4 B;  2C7N B;  2PEA A;  5EDS A;  3H7S A;  3VUX A;  1UBQ A;  3NHE B;  2OOB B;  5DPR A;  4FN2 A;  3VFK A;  3EEC A;  2JRI B;  1WZ3 A;  3QCA A;  4NPN A;  5L95 C;  1RAX A;  2Z0E B;  2K25 A;  4I6L B;  4TV3 A;  2KAN A;  2OJR A;  2JF5 A;  3RYT A;  3S2A A;  4B95 A;  1NI2 A;  5BO4 B;  2BKF A;  4FUL A;  2FNJ B;  3V62 A;  4DWF A;  3W1S C;  1I35 A;  3RZF A;  4PYZ A;  4GSW A;  2DZJ A;  3DOW A;  4CHK A;  1VD2 A;  3L08 A;  1V6E A;  2MRP A;  3C0R B;  4HDQ A;  5CHV C;  2KDE B;  4GGQ A;  3NOB A;  5D94 A;  2K1F A;  3TL5 A;  1WJU A;  1WGY A;  1WX8 A;  4E71 A;  3DBL I;  4EZK A;  2PJH A;  1LXD A;  2EMT A;  2WWZ A;  2L7R A;  3PV1 A;  1E5W A;  2DYB A;  5J2R A;  3A4S C;  3PRP B;  3A9J A;  1UEL A;  4GDK B;  2Z59 B;  5TR5 A;  4JGH B;  1IYF A;  3RD2 A;  2PE6 B;  3QJZ A;  4K7W A;  1E7U A;  4OVU A;  1WGR A;  4KIK A;  2CHZ A;  3QX1 A;  2KX0 A;  1WI0 A;  2G4D B;  1MG8 A;  3QWZ B;  1GG3 A;  3PSE B;  4KVG B;  4W9C A;  4WWN A;  3ZKJ C;  5LLI A;  2BKR B;  2DZK A;  2NVU I;  2A5U A;  3AXC A;  3WA0 A;  3ZTC A;  1G6J A;  4IG7 B;  1NBF C;  4EFO A;  1AAR A;  4FJV B;  4WAA A;  3V61 A;  2AL3 A;  4DXA B;  3SU8 X;  3T8M A;  3A1Q B;  1V9J A;  2V3S A;  2CKH B;  5AZH A;  1OEY J;  1OGW A;  2K39 A;  3AI5 A;  3RCZ A;  1EO6 A;  4IWP A;  4DDG D;  1WH3 A;  4EZJ A;  2GMI C;  1EUV B;  1D3Z A;  4HLE A;  5LXH A;  3MJW A;  4WQO B;  1WM2 A;  2DAF A;  1P98 A;  3M95 A;  3P2B A;  4W9J A;  3HM6 X;  2WDT B;  2KMA A;  1Q0W B;  4GMV A;  4RM9 A;  4AUQ C;  3EC8 A;  5GMV A;  3WAM A;  4NQL B;  1GNU A;  1Y8R C;  3PRM B;  5J17 A;  2LGD A;  3H9D A;  3M62 B;  2O6V A;  3QIJ A;  1V49 A;  1HE8 A;  3ZW3 A;  2DX5 B;  3KYC D;  4M0W B;  2KTR B;  3IVF A;  3NZS A;  4W9I A;  4AJY B;  4G11 A;  2C5L C;  2JY6 A;  2L3Z A;  4IM3 A;  2XK5 B;  4W9L A;  5G2N A;  1GC7 A;  4FA6 A;  4LJP B;  2C7H A;  3IBE A;  2DZI A;  5CX3 A;  2M4N A;  4W9F A;  4M8N A;  3R7Q A;  2KN5 A;  2FID A;  2UYZ B;  4ZYN A;  1WGD A;  2FCS A;  2KC1 A;  4EZL A;  3QAR A;  2BWF A;  5C23 A;  4MDK E;  4X57 B;  5JHA A;  1ZW7 A;  5JHB A;  4XC2 A;  3RT3 B;  4DK5 A;  2I1K A;  5E6N A;  1WIA A;  3VDZ A;  2LVQ A;  1WR1 A;  2PE9 A;  1RRB A;  2ZZP B;  3K9O B;  2NCN A;  1KM7 A;  5D2M B;  4IWO A;  3EFU A;  4FHJ A;  3DVG X;  2KTF A;  4GXB A;  1J0G A;  4NY0 A;  1WFY A;  2W9N A;  2BWE S;  1WJN A;  4DDI D;  2JZ3 B;  2J0M A;  3APC A;  1WJ6 A;  2DZM A;  4K1R B;  2L05 A;  3W1S A;  2IZV B;  4KZ0 A;  2CHX A;  2N7E A;  3ZUN A;  5CHF A;  3WAP A;  2B3A A;  2CU1 A;  2JWZ A;  3KUD B;  1ZGU B;  3NS8 A;  2KDB A;  3X23 A;  4BBN F;  3L10 B;  3PLU A;  1WMH B;  4TUU A;  2JXX A;  2GBJ A;  2KJH B;  2LUE A;  2KFJ A;  4DHJ D;  4WWO A;  4N9F 4;  1EF5 A;  1K8R B;  3NY5 A;  3L16 A;  2L00 B;  3B0A A;  1QZE A;  3IFW B;  2EKE C;  4MSM B;  3PRE A;  4ANV A;  4ANU A;  3UIN B;  3RUI B;  4NQK E;  4ZRJ A;  1KJT A;  2D10 A;  4W9K A;  4GDL B;  1V80 A;  2MBQ A;  3ML9 A;  3A1Q A;  1YD8 U;  1OEY A;  2R2O A;  4HK2 A;  1KOT A;  3U8Z A;  4PYU A;  3ZDM C;  3JW0 X;  3B08 A;  1L2N A;  2FAZ A;  3L54 A;  1S3S G;  4JL9 A;  4E3C A;  4P7I A;  1EF1 A;  3ZRC A;  1V5T A;  4RM8 A;  2ASQ A;  2DYO A;  3PRZ A;  2MP2 B;  3ZTD A;  2N1W A;  2RGF A;  4KZC A;  4MEM A;  2N7D A;  3DVN U;  3M3J A;  1GJZ A;  2WX0 A;  4MJS B;  4HWI B;  1P1A A;  2VRR B;  3JYU A;  2CS4 A;  2LD9 A;  3APF A;  4IC7 B;  4JIO U;  2C7M B;  3VUY A;  3VVW B;  2D07 B;  1GUA B;  4AP4 C;  3QA8 A;  1V81 A;  1R4M I;  2KTR A;  4JLC A;  1YX6 B;  3KW5 B;  5E6P A;  3ZVV A;  4WJP A;  2XK5 A;  2BYV E;  4DBG A;  2FCN A;  3CSF A;  3NZU A;  1WZ0 A;  5CHW A;  2RD0 A;  4HPL B;  1E90 A;  1SIF A;  3A4R A;  4MGI E;  1U4A A;  1XD3 B;  2G4S A;  2MX2 A;  2ZPY A;  1YIW A;  3WAL A;  4FJZ A;  3SHQ A;  3PPA A;  5L83 A;  2YVC A;  3N3K B;  4DHZ E;  1E7V A;  3MHS D;  3QC8 B;  4A3O A;  1Q1O A;  2N1V A;  3IHP C;  2KFK B;  3ENE A;  4URK A;  1M94 A;  4BFR A;  3X0W A;  1UBI A;  4MH0 E;  1C1Y B;  3DDC B;  4HJK A;  4FBJ B;  4MGY E;  2WX1 A;  1ISN A;  3JVZ X;  3KYD D;  3TMP B;  3OJ3 A;  4K81 A;  5JH5 C;  3QHT A;  3WAN A;  4JQW C;  4II3 B;  2O2V B;  4F8C B;  4PS7 A;  1F9J A;  4IUM B;  3UGB B;  1LFD A;  4B9K A;  4M8M A;  1WMH A;  2MLB A;  4RMA A;  3KUZ A;  4YL8 A;  3V6E B;  3GOE A;  2RPQ A;  4DHZ B;  4AJW A;  4FAD A;  1FXT B;  3K9P B;  1NDD A;  2KKC A;  4NAW A;  4NNJ B;  3N30 A;  3ZNZ B;  3H7P B;  1GC6 A;  1WXA A;  4BKS A;  4ANW A;  3DVG Y;  4A3P A;  2GOW A;  2KO3 A;  1WX9 A;  3DQV A;  2AYO B;  3QK0 A;  3M63 B;  4GOC A;  1WE6 A;  2I1J A;  2LVP A;  4ICU A;  1WX7 A;  2K8C A;  3OLM D;  2G45 B;  4IM2 A;  3V60 A;  3L17 A;  3ALB A;  5LXI B;  2M8S A;  4LDT B;  3A33 B;  4XX5 A;  3GZN I;  1C3T A;  1E8W A;  3RUL A;  2XEW A;  3ZLZ A;  4K7S A;  2J0K A;  2L0T A;  4BKS D;  2R2Q A;  2BYF A;  1JRU A;  2ZCC A;  5AEK B;  2O6V D;  1IP9 A;  1WR6 E;  2MP2 A;  4BKG A;  5JZE B;  1X1M A;  2GBM A;  2KDI A;  2QHO A;  2ZCB A;  3PHW B;  4II2 B;  4F1S A;  1J19 A;  3UQA A;  2HJ8 A;  2KLC A;  1WGH A;  5HKH A;  1E8Y A;  1WXV A;  2L8J A;  1TBE A;  2IO0 B;  1L7Y A;  4J6I A;  3TBL D;  4GU2 A;  2IO3 B;  3CMM B;  4IW0 A;  3HHM A;  4E74 A;  2HE7 A;  4ANX A;  4IM0 A;  5IA7 A;  5DPS A;  3DVN V;  1S1Q B;  2IY1 B;  2N4F A;  2PPH A;  2A4Z A;  2K6D B;  5KHO A; 
#chains in the Genus database with same CATH topology
 1IGD A;  4XZ4 A;  2AWT A;  5AZG A;  3D32 A;  2KMC A;  2KDM A;  5EE9 A;  2WYQ A;  1TS3 A;  2KX3 A;  2LEK A;  1TZ1 A;  1FXA A;  4IKG A;  3VAW A;  3ZYY X;  5CTR C;  2V9H A;  2MW5 A;  1FRR A;  3O65 B;  1JWM D;  2QMT A;  2N9X A;  4N59 A;  2GBK A;  4S0R A;  2MH7 A;  5I4D A;  1BT0 A;  1SGH A;  4WJO A;  3TJP A;  2ZNV C;  5BYR A;  2J7Q B;  4YSX B;  2J0J A;  4CYE A;  4ZRK A;  1TGZ B;  1PQS A;  2EKI A;  3T9L A;  2YLM A;  4KKJ A;  3A9K B;  3AU5 A;  2JXT A;  1YQB A;  2L0F A;  1WGK A;  3T3N A;  1MG4 A;  2KJR A;  5IKC M;  4K3C A;  4WJQ A;  2ACZ B;  2NR2 A;  3R66 C;  2E3T A;  2LXC A;  5DCN A;  1F77 A;  1P0R A;  1CMX B;  4FXC A;  3KWV A;  1N5X A;  3VXW A;  3AE1 B;  3WIM A;  2C60 A;  3PLV A;  4GB9 A;  3N1Z C;  4AOF A;  3VTV A;  3AUL A;  2N9E B;  1V1P B;  3I3T B;  1LO5 D;  5AUI A;  2Y5C A;  4REZ A;  1J7A A;  1FMA D;  2KOX A;  5AZF A;  2WNM A;  2RSU A;  4G50 A;  4GDL A;  2JT4 B;  5G55 A;  3LXF A;  3N20 C;  1N60 A;  2QSD A;  1P9D U;  2K22 A;  1FCL A;  2REX A;  4O1N A;  1XEE A;  1OQQ A;  4Q2J A;  3PTF C;  4MSQ B;  3H1U A;  4QAY A;  3AE4 B;  3IAS 1;  3ZNH B;  5DPW A;  4W9H A;  3RNE C;  2LJI A;  2LZ6 A;  4EKU A;  1I4P A;  3QAQ A;  4K7U A;  2GI9 A;  1LM8 B;  2D3A A;  4GN1 A;  2H89 B;  4G3X B;  3SD5 A;  2KT7 A;  4GIV A;  1JQ4 A;  2K6Q A;  1K51 A;  3L13 A;  2LGX A;  2Z0D B;  1K52 A;  2OED A;  4L23 A;  1L4Z B;  4LCD E;  1WYW B;  4HCN B;  2NPT A;  2XNA C;  1N6Z A;  3HK0 A;  1B9R A;  4W9E A;  5D7G A;  1KLU D;  1PUT A;  4ZDV A;  5JXV A;  3R7R A;  2MBE A;  2WLB A;  3AV8 A;  4HJG E;  1ET6 A;  2HTH A;  1TS5 A;  2KXJ A;  2AL6 A;  2ZPN A;  4HVB A;  4ZHO A;  2FBW B;  2ZEQ A;  1E7P B;  2LRW A;  2LXA A;  1WY8 A;  3W5V B;  2M1M A;  4W9G A;  1TS2 A;  2I38 A;  3TSS A;  4BOZ B;  2PEA A;  3Q3O C;  3H7S A;  3VUX A;  1NVI D;  5DPR A;  3QCA A;  2N0S B;  2BVC A;  4I6L B;  2WXN A;  3NVW A;  4B95 A;  1STE A;  3V62 A;  4FUL A;  1I35 A;  4GSW A;  3DOW A;  4XWW A;  1V6E A;  3C0R B;  4HDQ A;  2KDE B;  4GGQ A;  5D94 A;  1WJU A;  2VZK D;  1XO3 A;  4M02 A;  5G5G A;  3DBL I;  4EZK A;  4PT5 A;  2V4I B;  4HRO A;  3A9J A;  1UEL A;  3IXS A;  3NG0 A;  2RDG A;  1XLQ A;  3RD2 A;  1E7U A;  2KX0 A;  2BKR B;  2DZK A;  3WA0 A;  1NBF C;  4EFO A;  4FJV B;  2IDY A;  4WAA A;  5AZH A;  2PIA A;  2B76 B;  4EZJ A;  2GMI C;  1EUV B;  1D3Z A;  2D3C A;  1P7E A;  2DAF A;  3M95 A;  3IT4 B;  4DXG A;  2WDT B;  2Q5W D;  4AUQ C;  5J17 A;  2LGD A;  3H9D A;  3M62 B;  1N61 A;  1HE8 A;  3N1Y C;  3IVF A;  4G11 A;  2L3Z A;  2C7H A;  3V3X A;  5CX3 A;  1SEB D;  2PW9 A;  3EFC A;  4M8N A;  2FID A;  1JCK B;  1WGD A;  2FCS A;  2KC1 A;  2W3S A;  4EZL A;  4MDK E;  1ZW7 A;  2KMM A;  5JHB A;  3RT3 B;  3P4P B;  3VR8 B;  1SE2 A;  1KM7 A;  1RWS A;  2RDB C;  4FHJ A;  1L6V A;  2KTF A;  4C7Y A;  1J0G A;  2BWE S;  2J0M A;  1SF0 A;  2AQ3 B;  4KZ0 A;  2WXK A;  4C80 A;  2JWZ A;  3KUD B;  4NZL B;  1PGX A;  1WMH B;  2JXX A;  2L52 A;  3SR6 A;  4ANV A;  5EE0 A;  3ETR A;  4ZRQ A;  2TSS A;  4GDL B;  1V80 A;  2MBQ A;  2X8X X;  3AE6 B;  3A1Q A;  4MT5 A;  4WQM A;  4P6V F;  1KOT A;  1MVK A;  3U8Z A;  3U7Z A;  3L54 A;  1S3S G;  4E3C A;  1SE4 A;  3R2I A;  2WHI A;  2DYO A;  2N1W A;  4BZA A;  3DVN U;  4WH4 A;  2MJD A;  3JYU A;  2CS4 A;  2INP E;  2JQR B;  2D07 B;  1GUA B;  3EUB 2;  2N9K A;  2KTR A;  1IGC A;  1WZ0 A;  2WXM A;  1XCQ L;  1E90 A;  1SIF A;  1VZ7 A;  1SB3 C;  3A4R A;  1XD3 B;  2G4S A;  1QIL A;  2ZPY A;  1YIW A;  3PPA A;  2J53 A;  2HTM E;  4XYC A;  1HQR D;  3E56 A;  4JE3 B;  4OZC A;  1K53 A;  3AB5 A;  2KFK B;  2EEL A;  1M94 A;  4BFR A;  3X0W A;  3RNF C;  2R61 A;  1IBX B;  1JWA D;  3JVZ X;  2K3U A;  3TMP B;  1KLG D;  5JH5 C;  2WXP A;  1D5Z C;  4OVZ A;  1QOA A;  2V3N A;  4F8C B;  1FNW A;  4IUM B;  5IOI A;  4B9K A;  4M8M A;  3VR9 B;  3KUZ A;  2BT6 A;  1D6E C;  3GOE A;  2RPQ A;  1N63 A;  4AJW A;  4MM3 B;  1NEN B;  4NNJ B;  4MH8 A;  3MJ5 A;  2IJ0 A;  2AYO B;  1VZ8 A;  3QK0 A;  1FIQ A;  1MHH E;  1WE6 A;  3CWI A;  2K8C A;  2PMV A;  3V60 A;  1EU4 A;  5LXI B;  1E8W A;  1T0R C;  2N7J A;  4RGO S;  3RNG C;  3ZGZ A;  1WR6 E;  2MP2 A;  1X1M A;  3PHW B;  3Q3N C;  3O13 A;  4F1S A;  1J19 A;  4PK1 A;  3GE3 C;  1VLB A;  1EWY C;  1E8Y A;  2L8J A;  1LGR A;  1NI3 A;  5BYQ A;  1HZ5 A;  4OZA A;  1E9M A;  4HEA 1;  2N4F A;  3BK2 A;  2PPH A;  3MHZ A;  4BBN C;  3PGE A;  2VH2 A;  1QOF A;  2KNB A;  4ARI A;  2L83 A;  2XBB C;  4NAM A;  1TY2 A;  1H8C A;  3CST A;  1GB1 A;  1KF6 B;  1YN4 A;  3SDL C;  2MBH A;  1I4R A;  3AU4 A;  3OJ4 B;  3OWE B;  1KLV A;  2WS3 B;  2Y5B B;  3W2D A;  2EMS A;  3W9C B;  2BW2 A;  3RPF C;  3ZDT A;  3BZD B;  4FHK A;  1ENF A;  1T6B X;  1ZKH A;  2KWU B;  1PFD A;  2BYE A;  2INN E;  2E6X A;  3H7P A;  4HPM B;  2J42 A;  5H92 C;  2JZZ A;  4M0W A;  3T3O A;  1UD7 A;  3JSV B;  3WAO A;  4OHJ A;  3LDZ E;  4HKZ E;  2L1A A;  2IYD B;  1Z5S B;  3AED B;  2KWV B;  3B1L X;  1JAL A;  3PZD A;  3DCG A;  4LNF A;  2JX5 A;  2KQS A;  3U7D A;  2JWU A;  5D3I B;  1WGG A;  2MCN B;  1A5R A;  1PYW D;  2ZVO A;  4NJ7 A;  3Q8F A;  3NRZ A;  1AN8 A;  1L0V B;  3OAW A;  2BB5 A;  2V3P A;  1WE7 A;  4PS3 A;  1XT9 B;  2JZP A;  2DBY A;  1EWC A;  2DEN B;  3RNB C;  1V2Y A;  1T0Q C;  2KDF B;  4IDI A;  4C4V A;  3BVG A;  4LNK A;  2LWP A;  2V1Y A;  1WXM A;  4W9D A;  1MJD A;  4MGZ E;  3TUO A;  1WYG A;  3DWM A;  3GB1 A;  4ASW C;  2VZK B;  1JRO A;  1KTK A;  1DOX A;  1HZ6 A;  2WXQ A;  4MJS A;  4RF0 A;  3DBL B;  2KZR A;  3DBH I;  2CU3 A;  1BML C;  3RNC C;  1E8X A;  1OQY A;  3R3M A;  1HTQ A;  2GRI A;  3QQ8 B;  1JML A;  3EHV A;  4RGN A;  2LAS A;  1XLO A;  3PZ8 A;  2LGY A;  3UIP B;  2BGF A;  2MJ3 A;  4LJO B;  3ECI A;  2LGS A;  3ZO5 B;  2UU7 A;  2BF8 B;  3DPD A;  1T5X D;  4RCO A;  5IP4 D;  1C4A A;  2ICI A;  3Q3J A;  1WRD B;  1GB4 A;  4AWJ A;  1YJI A;  3W1Y A;  3RFZ B;  1XLP A;  3ML8 A;  1KRH A;  4KV2 A;  3MTN B;  3PS6 A;  3EA6 A;  2KLG A;  4US8 A;  1Q10 A;  2IGH A;  4HXD A;  4ZOH C;  1I4G A;  1WM3 A;  2JVC A;  1QKZ A;  2K9X A;  1J8C A;  1UH6 A;  4YTP B;  1FD6 A;  4IWQ A;  4BVU C;  3LJ3 A;  2LVO A;  2JYE A;  1AWD A;  3BY4 B;  1J7C A;  5EDS A;  4YTN B;  3NHE B;  3VFK A;  4NPN A;  2LHE A;  1T3Q A;  2K25 A;  1NI2 A;  5BO4 B;  2BKF A;  2FNJ B;  4YSY B;  1L6U A;  2WDQ B;  2DZJ A;  4CHK A;  1VD2 A;  3L08 A;  2PTL A;  2BTE A;  2M19 A;  3NOB A;  3MC9 A;  3TL5 A;  3AEB B;  1E5W A;  1QF6 A;  3A4S C;  4AQ7 A;  2Z59 B;  5TR5 A;  4KIK A;  1WI0 A;  1MG8 A;  3QWZ B;  4KVG B;  5LLI A;  3AXC A;  1G6J A;  1SJH D;  3V61 A;  3T8M A;  1ZDX A;  1V9J A;  2V3S A;  2CKH B;  1OEY J;  1OGW A;  2K39 A;  1DYQ A;  4DDG D;  2VH1 A;  4WQO B;  3B2G A;  3BII D;  2WXR A;  3EC8 A;  3WAM A;  1GNU A;  5AUK A;  5IN7 A;  2O6V A;  2ON8 A;  4B0E A;  4M0W B;  3NZS A;  4FA6 A;  2XK5 B;  1ZUD 2;  3R8B A;  3IBE A;  2DZI A;  3B9J A;  4W9F A;  2UYZ B;  1F2R I;  3QAR A;  5C23 A;  1WWT A;  4DK5 A;  2LVQ A;  1WR1 A;  2PE9 A;  2W3R A;  2ZZP B;  2YEP F;  2NCN A;  4ZYS A;  4IWO A;  3P42 A;  3DVG X;  4NY0 A;  4RH6 A;  2WU5 B;  1ZXI A;  3Q8A A;  2DZM A;  1C76 A;  2W82 A;  4MAC A;  2IZV B;  2BYT A;  2N7E A;  2LGI A;  5CHF A;  2B3A A;  3NS8 A;  5BMG A;  2GBJ A;  2KJH B;  2LUE A;  2KFJ A;  4WWO A;  2BS4 B;  1N5W A;  4MSM B;  2EKE C;  3PRE A;  3UIN B;  3RUI B;  1YJJ A;  4NQK E;  4C4V B;  1KJT A;  2OHF A;  3Q2A C;  1QOG A;  1OEY A;  2KQ4 X;  4JL9 A;  2OJW A;  2ASQ A;  3PRZ A;  2N7D A;  2WX0 A;  4MJS B;  2VRR B;  4A90 A;  1ZP0 B;  1GPX A;  2DLB A;  2LD9 A;  4IC7 B;  1TKY A;  3TEY A;  2C7M B;  2MJE A;  3VUY A;  4RNA A;  3C19 A;  4D2K A;  3I9V 1;  1VJK A;  4KGR A;  1R4M I;  4LNO A;  4LK0 M;  5CHW A;  1V8C A;  3WAL A;  1UWM A;  1D5M C;  2YVC A;  3BWU D;  3N3K B;  1E7V A;  3MHS D;  4A3O A;  4HRS A;  1FFU A;  2SEB D;  1UBI A;  4MH0 E;  1FM0 D;  3U2S C;  2INC C;  1WXQ A;  4II3 B;  1F52 A;  4C56 C;  4PS7 A;  3UGB B;  2MLB A;  4FAD A;  5TSS A;  1NDD A;  2KKC A;  1NYR A;  3N30 A;  1XXG A;  2WXG A;  3GP7 A;  3DQV A;  1VR9 A;  1D4B A;  4ICU A;  4IM2 A;  3OLM D;  3AH7 A;  2G45 B;  3L17 A;  3Q6B A;  2M8S A;  1HTO A;  3RUL A;  3ZLZ A;  3EGR A;  2LMC A;  4NJC A;  1JRU A;  2ZCC A;  3ZJT A;  1IP9 A;  1AW7 A;  2KDI A;  1YN3 A;  2QHO A;  1XF5 L;  1TT5 B;  4ITK A;  1WGH A;  5HKH A;  1UUP A;  4C7Z A;  1L7Y A;  3TBL D;  1D5X C;  4GU2 A;  5HG2 A;  4IW0 A;  3CMM B;  4KGT A;  3B2F A;  1S1Q B;  2G1E A;  3CIR B;  2K6D B;  5KHO A;  3BYY B;  4KSK C;  1SJE D;  4DQO C;  2ZVN A;  2CHW A;  3U30 A;  1TS4 A;  1Z2M A;  5G5H A;  2MBB B;  4HPP A;  4YXD B;  2NBU A;  1QLB B;  2I2Y A;  2IO1 B;  2KWC A;  1FRD A;  4OW0 A;  1JWS D;  1F2R C;  4ZRI A;  3DBH B;  5C1Z A;  1ACC A;  2D3B A;  4MEL A;  3AN1 A;  1MFW A;  4OZB A;  1CK1 A;  2LJ5 A;  3AEA B;  3CF6 E;  2M0X A;  4HDO A;  4A20 A;  2C9W B;  1P3Q U;  2FCM A;  1WXS A;  5D6J B;  2IY0 B;  3ZIM A;  2MQJ A;  3PHX B;  4G0N B;  3ONS A;  3E9S A;  5FR3 A;  3SFD B;  5FR6 A;  1JWU D;  3N9Y C;  3V6C B;  1YN5 A;  3AEE B;  2NPT B;  5EE3 A;  4EUT A;  1SBB B;  3HM3 A;  4TQ1 A;  2GBN A;  3HUI A;  2LRU A;  5MPO A;  1BUI C;  3AE3 B;  4XGA B;  3VTW A;  4TSS A;  3C8Y A;  3U52 E;  2K0P A;  1CJE A;  2G3Q B;  2BPS A;  2DAJ A;  2WXO A;  4FJY A;  2UWQ A;  3IG3 A;  1FXI A;  1V86 A;  2KJ6 A;  3WCQ A;  1ZE3 D;  3ZNI D;  1NYQ A;  1P7F A;  4UDU C;  3ZNG C;  3AE8 B;  2NS5 A;  1R4N I;  2PVG C;  2HD5 B;  2IBI B;  2DHZ A;  2WP9 B;  4B6W A;  2AEH A;  3VUW A;  3DBS A;  3UIO B;  2MWS B;  2AQ1 B;  3VRA B;  4EEW A;  1Q5W B;  1AYF A;  1LQB A;  2LI5 A;  2ZJD A;  1V5O A;  1K50 A;  4XDD A;  1OTR B;  3A9K A;  1I4H A;  3KUC B;  3URY A;  3Q8B A;  3P63 A;  2FCQ A;  3VH4 B;  3A9J B;  3ZRF A;  3TIX A;  3KLS X;  4RGM A;  1YNT E;  1RLF A;  1CQV A;  4DXF A;  3AMZ A;  4I6P A;  2FIF A;  1YX5 B;  4WWP A;  2QIE B;  3HIZ A;  4USA A;  3PT2 B;  3VQI A;  2KAJ A;  3ABV B;  3AE2 B;  2D5G A;  3NVV A;  1TJE A;  2KQ7 A;  3DBR I;  2N9P C;  1XLN A;  1L0Y B;  3VTU A;  2W55 A;  1H4R A;  1XCT L;  3AEC B;  1GAQ B;  1SSN A;  2JSV X;  3Q69 A;  1WRI A;  3I57 A;  1MI0 A;  2M56 B;  3EEC A;  4LNN A;  2JRI B;  3DWG C;  2M0A A;  1TIF A;  2QJL A;  1PGA A;  2JF5 A;  3RYT A;  3S2A A;  4DWF A;  3RI7 C;  3W1S C;  3ZJV A;  3RZF A;  2IGG A;  1FNV A;  2H88 B;  1OQR A;  5CHV C;  2KAC A;  1WGY A;  1WX8 A;  1V97 A;  1I4Q A;  4LTU A;  2PJH A;  1LXD A;  2EMT A;  2LFI A;  2WWZ A;  2L7R A;  3W5U B;  3PV1 A;  1F1H A;  2DYB A;  4YSZ B;  3PRP B;  1MPE A;  2CHZ A;  3QX1 A;  2G4D B;  1GG3 A;  3ZKJ C;  2NVU I;  2A5U A;  1QOB A;  3ZTC A;  4IG7 B;  2AL3 A;  3Q14 C;  3NVY A;  3SU8 X;  3A1Q B;  1L4D B;  2NTS A;  1HA5 A;  4IWP A;  1UF0 A;  2LUM A;  1RYJ A;  3RN9 C;  5LXH A;  3MJW A;  2BS3 B;  1WM2 A;  1JW9 D;  1P98 A;  1SXT A;  1R4M B;  5BMI A;  2KMA A;  2XN9 C;  5H8Y E;  1B1Z A;  1Q0W B;  2IND C;  3BK1 A;  1FO4 A;  4NQL B;  3PRM B;  3QIJ A;  2DX5 B;  2QC8 A;  1IUE A;  2KTR B;  4W9I A;  2C5L C;  5G2N A;  1GC7 A;  2WXJ A;  4LJP B;  5E6J A;  2M4N A;  3R7Q A;  4ZYN A;  2BWF A;  4X57 B;  4LNI A;  2LHD A;  4S17 A;  2BQQ A;  5E6N A;  1RRB A;  1UWX A;  2RDH A;  3K9O B;  1HEZ E;  1V1O A;  3EFU A;  4A8X C;  1WFY A;  2W9N A;  3AE7 B;  4DDI D;  3APC A;  1WJ6 A;  2CHX A;  3ZUN A;  4BBN F;  3X23 A;  1ZGU B;  3U4E G;  3L10 B;  3PLU A;  1FCC C;  4N9F 4;  1K8R B;  3NY5 A;  2WDR B;  2J52 A;  1QZE A;  3B0A A;  4ANU A;  4W9K A;  3ML9 A;  4L1B A;  1ZOY B;  2R2O A;  4HK2 A;  3ZDM C;  1UGJ A;  1GOZ A;  2FAZ A;  4P7I A;  1EF1 A;  1CZP A;  3ZRC A;  4BAX A;  3N1X C;  1C9F A;  2MP2 B;  2RPV A;  3M3J A;  4HWI B;  4TMA B;  5BYS A;  4R3D A;  4WAF A;  3APF A;  4JIO U;  3VVW B;  4AP4 C;  3QA8 A;  3DHH C;  4JLC A;  3ZXR A;  5E6P A;  3ZVV A;  2PVO D;  1T0S C;  4DBG A;  2FCN A;  4WUR A;  3CSF A;  3NZU A;  2RD0 A;  2MHJ A;  2JU6 X;  4M01 A;  2BS2 B;  4EE2 A;  3SHQ A;  3BYT B;  5L83 A;  1PGB A;  3IT6 B;  4IOI E;  1QT9 A;  1Q1O A;  2IGD A;  2N1V A;  3IHP C;  2DNF A;  4URK A;  3H8H A;  3DDC B;  4HJK A;  3RNA C;  4MGY E;  2WX1 A;  1ISN A;  1FPY A;  1L0X B;  3KYD D;  2FUG 1;  3OJ3 A;  4K81 A;  3QHT A;  3WAN A;  2V0G A;  1F9J A;  1DOI A;  2ONQ A;  1WMH A;  3V6E B;  4YL8 A;  2SAK A;  1FFV A;  4DHZ B;  1FXT B;  3K9P B;  4NAW A;  3ZNZ B;  3H7P B;  1GC6 A;  4BKS A;  3DVG Y;  4RFB A;  2KO3 A;  1WX9 A;  1KH0 A;  4GOC A;  4JWS C;  3A33 B;  4A6Q A;  3GZN I;  4P16 A;  3P4R B;  2XEW A;  2J0K A;  4A55 A;  4ACF A;  5JZE B;  2GBM A;  1ZDV A;  2ZCB A;  2NTT A;  1SIJ A;  2KLC A;  1WXV A;  1TBE A;  4J6I A;  2IO3 B;  1EU3 A;  3AM9 A;  1TYG B;  4M00 A;  4IM0 A;  3V05 A;  1C79 A;  1EM7 A;  5DPS A;  2IY1 B;  4GDK A;  2YEP B;  2NMQ A;  3I5J C;  3SEB A;  2WDV B;  3UQB A;  4AS1 A;  1WF9 A;  3N32 A;  4YWG G;  3AE9 B;  4KSL C;  1E8Z A;  2KFK A;  4XDC A;  4A9A A;  1L5P A;  1TY0 A;  3VH3 B;  3P4S B;  1R4N B;  1UGM A;  2WXF A;  4CO7 A;  1RFK A;  2ZW0 A;  2MSE D;  3L0W B;  1DOY A;  1IBX A;  1A70 A;  1YJ1 A;  2MBO A;  2JRH A;  1JWB D;  2K8H A;  4I6N B;  2KK8 A;  2NBW B;  1WJ4 A;  2IO2 B;  4JPS A;  1XQQ A;  1PDX A;  4MM3 A;  2K5P A;  1MHX A;  4OVV A;  1I42 A;  2K8B A;  2DYM A;  4ARC A;  1SE9 A;  1N62 A;  3NVZ A;  4EOY A;  3TEW A;  2AQ2 B;  4KDI C;  4L2Y A;  2ZNV B;  4FLH A;  3PVL A;  3NUH B;  1IPG A;  1SE3 A;  4MGK E;  1E10 A;  4LDT D;  3RMK C;  3J9C A;  2BBC A;  4C00 A;  2D3G A;  5KHQ A;  1VCB A;  1OFF A;  3H6N A;  4BKT A;  2MA9 B;  5BMH A;  3DBR B;  4DHJ B;  1E0Z A;  3UF8 A;  4PS8 A;  3RZW C;  2JPH A;  3R2T A;  2D11 A;  3GS2 A;  5HHD G;  5E6O A;  3KVF B;  5HFY A;  4KDL B;  2V4L A;  5DPT A;  2KC2 A;  3TCA A;  2WXI A;  1Y56 A;  1T0Y A;  2FUH B;  2JYT A;  5FKA C;  2KVR A;  2CJN A;  2RR9 A;  4N6E B;  2GLS A;  3L4P A;  5EE1 A;  3PZ7 A;  3GE8 C;  2ZW1 A;  5IAA C;  2QCZ A;  4HCP B;  4ICV A;  3TEZ A;  2L76 A;  5C2T B;  5T8I A;  2NBV B;  1TTN A;  4WJN A;  3JSV A;  2W54 A;  4WIP A;  2KD0 A;  4P1B C;  4BOS C;  2IPK D;  2KHW B;  2X38 A;  1I4X A;  4TKN A;  1R7S A;  3BIN A;  1VRA B;  1BXT A;  4KIK B;  1UZX B;  4F7Z A;  3APD A;  3NS1 A;  5J18 A;  1RFA A;  2GBR A;  3VHT C;  3SFE B;  3ZXV A;  3Q3F A;  3FIL A;  1F0Z A;  2QDF A;  3BVM A;  2JUO A;  2D2Q A;  1NEK B;  3IAM 1;  3KH0 A;  2O2V A;  2CR5 A;  3HVZ A;  4ZRP A;  4J3O D;  4XE0 A;  2WGS A;  2Z8L A;  4TQ0 A;  4NAW B;  5LNK 1;  2M17 A;  1VDV A;  4NJ6 A;  2O6V B;  1ZXH A;  2C7N B;  1UBQ A;  2OOB B;  2DWQ A;  3DHI C;  4FN2 A;  1C77 A;  1WZ3 A;  3MP9 A;  5L95 C;  1RAX A;  2Z0E B;  3ZQ4 A;  4TV3 A;  1UNS A;  2KAN A;  5FK9 C;  2OJR A;  5HI1 A;  1HXY D;  4LLG M;  4YT0 B;  2QEJ C;  2WXH A;  1YQ3 B;  4PYZ A;  3BVZ A;  2MRP A;  4ZHP A;  3AE5 B;  2K1F A;  4E71 A;  5J2R A;  4CQN A;  4GDK B;  2WU2 B;  3OG5 A;  4JGH B;  1IYF A;  2PE6 B;  3QJZ A;  4K7W A;  4OVU A;  1WGR A;  3AEF B;  2GB1 A;  4W9C A;  3PSE B;  4WWN A;  5C3J B;  1E6E B;  2PLP A;  3MC8 A;  3VRB B;  1AAR A;  1I7H A;  4DXA B;  3AI5 A;  3RCZ A;  1FEH A;  1EO6 A;  3NZ3 A;  4HKQ A;  1YQ4 B;  4P1C C;  1WH3 A;  4HLE A;  1ET9 A;  3P2B A;  4W9J A;  3FKY A;  3HM6 X;  4RM9 A;  4GMV A;  5GMV A;  1Y8R C;  2PKO A;  4K3B A;  1V49 A;  3ZW3 A;  3KYC D;  3KWL A;  2AX5 A;  4AJY B;  5D3D A;  2JY6 A;  4W9L A;  4IM3 A;  3Q3M C;  3FAH A;  2KN5 A;  1DGJ A;  2KYW A;  5JHA A;  1KFY B;  4XC2 A;  2I1K A;  3VDZ A;  1WIA A;  1JRP A;  2FE8 A;  3P4Q B;  4GLS C;  2HJ1 A;  5D2M B;  1ROE A;  3Q8E A;  4GXB A;  1WJN A;  3MFG A;  2JZ3 B;  4K1R B;  2L05 A;  3W1S A;  3WAP A;  2CU1 A;  2KDB A;  4TUU A;  2Y3A A;  1V1P A;  5IO9 A;  3I63 C;  4DHJ D;  1EF5 A;  3L16 A;  1C4P A;  1WSP A;  2L00 B;  1ESF A;  4H2A A;  3IFW B;  3GZN B;  4ZRJ A;  4JX1 C;  2D10 A;  4RF1 A;  4RGT A;  1YD8 U;  4PYU A;  3JW0 X;  3B08 A;  4JWU C;  1L2N A;  2N9L A;  4KKI A;  1V5T A;  1M4V A;  1VZ6 A;  4RM8 A;  3ZTD A;  1GJZ A;  2RGF A;  2WQY B;  4KZC A;  4MEM A;  5GXG B;  3HRD D;  1P1A A;  3AEG B;  2Y5P A;  3HVD A;  2G9H D;  1V81 A;  1YX6 B;  3KW5 B;  4WJP A;  2HDE A;  2XK5 A;  2BYV E;  4KGS A;  4HPL B;  3LB8 C;  4MGI E;  1U4A A;  4WWM A;  2MX2 A;  4YTM B;  4FJZ A;  3DHG C;  3KQ4 A;  3NJT A;  4DHZ E;  1ZPS A;  1RM6 C;  3QC8 B;  3ZJU A;  2MEK A;  3ENE A;  4N58 A;  4XWT A;  1C1Y B;  3FIL B;  4FBJ B;  4KX6 B;  3LYY A;  2L32 A;  4JQW C;  2O2V B;  1LFD A;  1YMH E;  4RMA A;  1FNU A;  3UI3 A;  4ANW A;  1WXA A;  2WXL A;  1C78 A;  4A3P A;  2J4X A;  2GOW A;  3M63 B;  2I1J A;  2LVP A;  1WX7 A;  3ALB A;  1QQR A;  4B0M A;  4LDT B;  1C3T A;  4XX5 A;  2KN4 A;  4BKS D;  2BB6 A;  4K7S A;  2L0T A;  1YOV B;  2R2Q A;  2BYF A;  1TKG A;  5AEK B;  3TEX A;  2O6V D;  4BKG A;  3Q8C A;  2RMM A;  3PO0 A;  1TKE A;  2QIL A;  4II2 B;  3UQA A;  2KVZ A;  2HJ8 A;  1C4C A;  2IO0 B;  2KWD A;  1J7B A;  3MC0 B;  3HHM A;  4E74 A;  2HE7 A;  4ANX A;  3FC4 A;  5IA7 A;  1TZO A;  4US9 A;  3DVN V;  2CJO A;  2A4Z A;  3P1M A; 
#chains in the Genus database with same CATH homology
 4GDK A;  3PGE A;  4XZ4 A;  2AWT A;  4KSK C;  5AZG A;  3UQB A;  1WF9 A;  3D32 A;  3N32 A;  2KMC A;  2KNB A;  2ZVN A;  2CHW A;  3U30 A;  2XBB C;  4KSL C;  2WYQ A;  1E8Z A;  2KFK A;  1Z2M A;  1H8C A;  2KX3 A;  3CST A;  3VH3 B;  2MBB B;  1TZ1 A;  1UGM A;  2NBU A;  4CO7 A;  2IO1 B;  2MSE D;  3SDL C;  2MBH A;  3L0W B;  2KWC A;  3AU4 A;  3VAW A;  3OJ4 B;  1KLV A;  5CTR C;  2MW5 A;  1YJ1 A;  2MBO A;  2Y5B B;  2JRH A;  4ZRI A;  3O65 B;  2K8H A;  4I6N B;  2N9X A;  2KK8 A;  2EMS A;  5C1Z A;  2NBW B;  2GBK A;  3ZDT A;  1BT0 A;  1WJ4 A;  2IO2 B;  1SGH A;  4WJO A;  4FHK A;  3TJP A;  1XQQ A;  1ZKH A;  2KWU B;  2ZNV C;  4MEL A;  2J7Q B;  2BYE A;  4MM3 A;  2J0J A;  4CYE A;  3H7P A;  2LJ5 A;  4ZRK A;  1TGZ B;  4HPM B;  4OVV A;  1PQS A;  3CF6 E;  1I42 A;  2JZZ A;  2K8B A;  2M0X A;  4HDO A;  4A20 A;  2DYM A;  1SE9 A;  3T9L A;  2YLM A;  2C9W B;  1UD7 A;  3A9K B;  3JSV B;  3AU5 A;  3WAO A;  1YQB A;  2L0F A;  4EOY A;  1P3Q U;  2FCM A;  3LDZ E;  1WXS A;  4KDI C;  5D6J B;  2KJR A;  2ZNV B;  2IY0 B;  2IYD B;  3ZIM A;  1Z5S B;  2MQJ A;  3PHX B;  4G0N B;  2KWV B;  3PVL A;  4FLH A;  4WJQ A;  3B1L X;  3ONS A;  3PZD A;  1IPG A;  3DCG A;  2NR2 A;  4MGK E;  5FR6 A;  3R66 C;  2KQS A;  3V6C B;  2NPT B;  2LXC A;  3U7D A;  4LDT D;  2D3G A;  5DCN A;  5KHQ A;  1VCB A;  1WGG A;  1P0R A;  1CMX B;  4EUT A;  2MCN B;  1A5R A;  2ZVO A;  3H6N A;  3HM3 A;  2MA9 B;  4NJ7 A;  4BKT A;  4TQ1 A;  2GBN A;  3VXW A;  3WIM A;  3OAW A;  4DHJ B;  2C60 A;  2LRU A;  3PLV A;  1WE7 A;  4GB9 A;  3UF8 A;  4PS3 A;  1XT9 B;  4PS8 A;  4AOF A;  3VTW A;  3RZW C;  3VTV A;  2JPH A;  3AUL A;  2N9E B;  2D11 A;  3I3T B;  5E6O A;  2G3Q B;  2BPS A;  2DAJ A;  3KVF B;  2DEN B;  4FJY A;  2UWQ A;  4KDL B;  2V4L A;  3IG3 A;  1V2Y A;  5DPT A;  2KC2 A;  1V86 A;  5AZF A;  2KOX A;  2KJ6 A;  2KDF B;  3TCA A;  2RSU A;  4G50 A;  2LWP A;  2V1Y A;  1T0Y A;  4GDL A;  3ZNI D;  1WXM A;  4W9D A;  2JT4 B;  5G55 A;  3ZNG C;  2FUH B;  4MGZ E;  2NS5 A;  1R4N I;  2KVR A;  2HD5 B;  2RR9 A;  2IBI B;  1P9D U;  2DHZ A;  4B6W A;  2AEH A;  2REX A;  4ASW C;  3VUW A;  4BBN C;  3DBS A;  4MJS A;  5IAA C;  2KZR A;  3UIO B;  2MWS B;  3PTF C;  3DBH I;  4MSQ B;  4EEW A;  4HCP B;  3H1U A;  4ICV A;  1Q5W B;  3ZNH B;  2L76 A;  1E8X A;  5DPW A;  1LQB A;  1OQY A;  3R3M A;  2LI5 A;  2ZJD A;  4W9H A;  2NBV B;  2LZ6 A;  4EKU A;  3QAQ A;  4K7U A;  1V5O A;  1TTN A;  4WJN A;  1LM8 B;  1OTR B;  3A9K A;  3JSV A;  3KUC B;  4GN1 A;  3QQ8 B;  4G3X B;  2KD0 A;  3SD5 A;  4BOS C;  2KHW B;  4GIV A;  3EHV A;  2FCQ A;  2LAS A;  3A9J B;  3VH4 B;  3ZRF A;  2K6Q A;  2LGY A;  3UIP B;  4TKN A;  2BGF A;  3BIN A;  3L13 A;  3TIX A;  2LGX A;  2Z0D B;  4LJO B;  3ECI A;  1RLF A;  4KIK B;  4LCD E;  3ZO5 B;  1WYW B;  3DPD A;  2BF8 B;  1UZX B;  2NPT A;  4HCN B;  4F7Z A;  3APD A;  3HK0 A;  3Q3J A;  1WRD B;  4W9E A;  4AWJ A;  4I6P A;  2FIF A;  1YX5 B;  4WWP A;  5D7G A;  3W1Y A;  5J18 A;  3HIZ A;  1RFA A;  2GBR A;  3VHT C;  3PT2 B;  4ZDV A;  3VQI A;  3ML8 A;  3Q3F A;  3R7R A;  4KV2 A;  3MTN B;  2MBE A;  3PS6 A;  2KLG A;  2JUO A;  2D2Q A;  4HXD A;  1WM3 A;  2JVC A;  2HTH A;  3KH0 A;  1J8C A;  2O2V A;  2KXJ A;  2CR5 A;  1UH6 A;  2AL6 A;  2ZPN A;  2KQ7 A;  4HVB A;  2ZEQ A;  3DBR I;  2LRW A;  2N9P C;  2LXA A;  4IWQ A;  4BVU C;  1WY8 A;  3LJ3 A;  2LVO A;  3VTU A;  4NAW B;  4TQ0 A;  2M1M A;  1H4R A;  4W9G A;  2M17 A;  4NJ6 A;  2O6V B;  4BOZ B;  3BY4 B;  2C7N B;  2PEA A;  5EDS A;  3H7S A;  3VUX A;  1UBQ A;  3NHE B;  2OOB B;  5DPR A;  4FN2 A;  3VFK A;  3EEC A;  2JRI B;  1WZ3 A;  3QCA A;  4NPN A;  5L95 C;  1RAX A;  2Z0E B;  2K25 A;  4I6L B;  4TV3 A;  2KAN A;  2OJR A;  2JF5 A;  3RYT A;  3S2A A;  4B95 A;  1NI2 A;  5BO4 B;  2BKF A;  4FUL A;  2FNJ B;  3V62 A;  4DWF A;  3W1S C;  1I35 A;  3RZF A;  4PYZ A;  4GSW A;  2DZJ A;  3DOW A;  4CHK A;  1VD2 A;  3L08 A;  1V6E A;  2MRP A;  3C0R B;  4HDQ A;  5CHV C;  2KDE B;  4GGQ A;  3NOB A;  5D94 A;  2K1F A;  3TL5 A;  1WJU A;  1WGY A;  1WX8 A;  4E71 A;  3DBL I;  4EZK A;  2PJH A;  1LXD A;  2EMT A;  2WWZ A;  2L7R A;  3PV1 A;  1E5W A;  2DYB A;  5J2R A;  3A4S C;  3PRP B;  3A9J A;  1UEL A;  4GDK B;  2Z59 B;  5TR5 A;  4JGH B;  1IYF A;  3RD2 A;  2PE6 B;  3QJZ A;  4K7W A;  1E7U A;  4OVU A;  1WGR A;  4KIK A;  2CHZ A;  3QX1 A;  2KX0 A;  1WI0 A;  2G4D B;  1MG8 A;  3QWZ B;  1GG3 A;  3PSE B;  4KVG B;  4W9C A;  4WWN A;  3ZKJ C;  5LLI A;  2BKR B;  2DZK A;  2NVU I;  2A5U A;  3AXC A;  3WA0 A;  3ZTC A;  1G6J A;  4IG7 B;  1NBF C;  4EFO A;  1AAR A;  4FJV B;  4WAA A;  3V61 A;  2AL3 A;  4DXA B;  3SU8 X;  3T8M A;  3A1Q B;  1V9J A;  2V3S A;  2CKH B;  5AZH A;  1OEY J;  1OGW A;  2K39 A;  3AI5 A;  3RCZ A;  1EO6 A;  4IWP A;  4DDG D;  1WH3 A;  4EZJ A;  2GMI C;  1EUV B;  1D3Z A;  4HLE A;  5LXH A;  3MJW A;  4WQO B;  1WM2 A;  2DAF A;  1P98 A;  3M95 A;  3P2B A;  4W9J A;  3HM6 X;  2WDT B;  2KMA A;  1Q0W B;  4GMV A;  4RM9 A;  4AUQ C;  3EC8 A;  5GMV A;  3WAM A;  4NQL B;  1GNU A;  1Y8R C;  3PRM B;  5J17 A;  2LGD A;  3H9D A;  3M62 B;  2O6V A;  3QIJ A;  1V49 A;  1HE8 A;  3ZW3 A;  2DX5 B;  3KYC D;  4M0W B;  2KTR B;  3IVF A;  3NZS A;  4W9I A;  4AJY B;  4G11 A;  2C5L C;  2JY6 A;  2L3Z A;  4IM3 A;  2XK5 B;  4W9L A;  5G2N A;  1GC7 A;  4FA6 A;  4LJP B;  2C7H A;  3IBE A;  2DZI A;  5CX3 A;  2M4N A;  4W9F A;  4M8N A;  3R7Q A;  2KN5 A;  2FID A;  2UYZ B;  4ZYN A;  1WGD A;  2FCS A;  2KC1 A;  4EZL A;  3QAR A;  2BWF A;  5C23 A;  4MDK E;  4X57 B;  5JHA A;  1ZW7 A;  5JHB A;  4XC2 A;  3RT3 B;  4DK5 A;  2I1K A;  5E6N A;  1WIA A;  3VDZ A;  2LVQ A;  1WR1 A;  2PE9 A;  1RRB A;  2ZZP B;  3K9O B;  2NCN A;  1KM7 A;  5D2M B;  4IWO A;  3EFU A;  4FHJ A;  3DVG X;  2KTF A;  4GXB A;  1J0G A;  4NY0 A;  1WFY A;  2W9N A;  2BWE S;  1WJN A;  4DDI D;  2JZ3 B;  2J0M A;  3APC A;  1WJ6 A;  2DZM A;  4K1R B;  2L05 A;  3W1S A;  2IZV B;  4KZ0 A;  2CHX A;  2N7E A;  3ZUN A;  5CHF A;  3WAP A;  2B3A A;  2CU1 A;  2JWZ A;  3KUD B;  1ZGU B;  3NS8 A;  2KDB A;  3X23 A;  4BBN F;  3L10 B;  3PLU A;  1WMH B;  4TUU A;  2JXX A;  2GBJ A;  2KJH B;  2LUE A;  2KFJ A;  4DHJ D;  4WWO A;  4N9F 4;  1EF5 A;  1K8R B;  3NY5 A;  3L16 A;  2L00 B;  3B0A A;  1QZE A;  3IFW B;  2EKE C;  4MSM B;  3PRE A;  4ANV A;  4ANU A;  3UIN B;  3RUI B;  4NQK E;  4ZRJ A;  1KJT A;  2D10 A;  4W9K A;  4GDL B;  1V80 A;  2MBQ A;  3ML9 A;  3A1Q A;  1YD8 U;  1OEY A;  2R2O A;  4HK2 A;  1KOT A;  3U8Z A;  4PYU A;  3ZDM C;  3JW0 X;  3B08 A;  1L2N A;  2FAZ A;  3L54 A;  1S3S G;  4JL9 A;  4E3C A;  4P7I A;  1EF1 A;  3ZRC A;  1V5T A;  4RM8 A;  2ASQ A;  2DYO A;  3PRZ A;  2MP2 B;  3ZTD A;  2N1W A;  2RGF A;  4KZC A;  4MEM A;  2N7D A;  3DVN U;  3M3J A;  1GJZ A;  2WX0 A;  4MJS B;  4HWI B;  1P1A A;  2VRR B;  3JYU A;  2CS4 A;  2LD9 A;  3APF A;  4IC7 B;  4JIO U;  2C7M B;  3VUY A;  3VVW B;  2D07 B;  1GUA B;  4AP4 C;  3QA8 A;  1V81 A;  1R4M I;  2KTR A;  4JLC A;  1YX6 B;  3KW5 B;  5E6P A;  3ZVV A;  4WJP A;  2XK5 A;  2BYV E;  4DBG A;  2FCN A;  3CSF A;  3NZU A;  1WZ0 A;  5CHW A;  2RD0 A;  4HPL B;  1E90 A;  1SIF A;  3A4R A;  4MGI E;  1U4A A;  1XD3 B;  2G4S A;  2MX2 A;  2ZPY A;  1YIW A;  3WAL A;  4FJZ A;  3SHQ A;  3PPA A;  5L83 A;  2YVC A;  3N3K B;  4DHZ E;  1E7V A;  3MHS D;  3QC8 B;  4A3O A;  1Q1O A;  2N1V A;  3IHP C;  2KFK B;  3ENE A;  4URK A;  1M94 A;  4BFR A;  3X0W A;  1UBI A;  4MH0 E;  1C1Y B;  3DDC B;  4HJK A;  4FBJ B;  4MGY E;  2WX1 A;  1ISN A;  3JVZ X;  3KYD D;  3TMP B;  3OJ3 A;  4K81 A;  5JH5 C;  3QHT A;  3WAN A;  4JQW C;  4II3 B;  2O2V B;  4F8C B;  4PS7 A;  1F9J A;  4IUM B;  3UGB B;  1LFD A;  4B9K A;  4M8M A;  1WMH A;  2MLB A;  4RMA A;  3KUZ A;  4YL8 A;  3V6E B;  3GOE A;  2RPQ A;  4DHZ B;  4AJW A;  4FAD A;  1FXT B;  3K9P B;  1NDD A;  2KKC A;  4NAW A;  4NNJ B;  3N30 A;  3ZNZ B;  3H7P B;  1GC6 A;  1WXA A;  4BKS A;  4ANW A;  3DVG Y;  4A3P A;  2GOW A;  2KO3 A;  1WX9 A;  3DQV A;  2AYO B;  3QK0 A;  3M63 B;  4GOC A;  1WE6 A;  2I1J A;  2LVP A;  4ICU A;  1WX7 A;  2K8C A;  3OLM D;  2G45 B;  4IM2 A;  3V60 A;  3L17 A;  3ALB A;  5LXI B;  2M8S A;  4LDT B;  3A33 B;  4XX5 A;  3GZN I;  1C3T A;  1E8W A;  3RUL A;  2XEW A;  3ZLZ A;  4K7S A;  2J0K A;  2L0T A;  4BKS D;  2R2Q A;  2BYF A;  1JRU A;  2ZCC A;  5AEK B;  2O6V D;  1IP9 A;  1WR6 E;  2MP2 A;  4BKG A;  5JZE B;  1X1M A;  2GBM A;  2KDI A;  2QHO A;  2ZCB A;  3PHW B;  4II2 B;  4F1S A;  1J19 A;  3UQA A;  2HJ8 A;  2KLC A;  1WGH A;  5HKH A;  1E8Y A;  1WXV A;  2L8J A;  1TBE A;  2IO0 B;  1L7Y A;  4J6I A;  3TBL D;  4GU2 A;  2IO3 B;  3CMM B;  4IW0 A;  3HHM A;  4E74 A;  2HE7 A;  4ANX A;  4IM0 A;  5IA7 A;  5DPS A;  3DVN V;  1S1Q B;  2IY1 B;  2N4F A;  2PPH A;  2A4Z A;  2K6D B;  5KHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...