2UYZB

Non-covalent complex between ubc9 and sumo1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
78
structure length
78
Chain Sequence
MEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-CONJUGATING ENZYME UBC9
publication title Noncovalent interaction between Ubc9 and SUMO promotes SUMO chain formation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 18
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2007-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2uyzB00
1VCBA 4RM8A 4KVGB 1NI2A 3AXCA 4TKNA 3PLUA 4ICVA 4BVUC 2CHXA 2LXAA 3QARA 4KZCA 4PS3A 3NHEB 2UWQA 3RCZA 2C60A 4AOFA 3A9JB 3W1SC 4HWIB 4JQWC 3HHMA 1WGRA 3HIZA 3QJZA 2LJ5A 4KZ0A 4TV3A 3V61A 4KV2A 4AJWA 3ZRCA 4DHZE 1Y8RC 4IM3A 4FHJA 3ZDMC 4ZRJA 2CHWA 3ZVVA 3EFUA 2RPQA 4X57B 3VH3B 3B0AA 3VTWA 3ZNZB 4B6WA 2MWSB 1IYFA 4BBNF 1Z5SB 4NNJB 1YX6B 2AYOB 2KWUB 2LRWA 1OQYA 2KJ6A 5DPWA 4MSMB 1M94A 4W9IA 1WX7A 3Q3JA 1E8ZA 2D2QA 2LUEA 3VHTC 1LQBA 2VRRB 2K8BA 4JGHB 2O6VA 2K25A 2M17A 4AWJA 4PYUA 4ANWA 4MH0E 1L7YA 3APCA 2DHZA 3PRZA 4TQ0A 2YVCA 1SE9A 1UBIA 2BYFA 3CSFA 4IM2A 2IO2B 3ZW3A 3A33B 2HJ8A 3KYCD 5AZGA 1RLFA 2J0MA 1V49A 3TIXA 2FIDA 2J0JA 2MBQA 1WGHA 3TBLD 4HCPB 4BOSC 1YX5B 2IZVB 4G11A 4NJ7A 3PRMB 3A4RA 3SU8X 4M0WB 1T0YA 4II3B 5DPSA 1GJZA 3L13A 2WYQA 4JLCA 4PYZA 2JZZA 1WFYA 2NS5A 3RULA 4MJSB 2JPHA 3R7QA 3N3KB 2N9PC 2FCNA 1OGWA 1LFDA 1SGHA 2G4SA 4J6IA 4MGYE 2B3AA 3CF6E 4RMAA 2Z59B 5KHQA 1RRBA 2O6VD 2LVOA 2LD9A 5CTRC 2K1FA 3IBEA 3KUCB 2OJRA 3TMPB 4LJPB 4HK2A 2MA9B 3TJPA 3JYUA 1IPGA 4KIKA 3WALA 2LVQA 3VXWA 2IO0B 4F1SA 3HM6X 2LGDA 3ZLZA 2PJHA 4CYEA 1WI0A 2KC1A 2KTRB 1QZEA 2I1KA 2N9XA 2L05A 4WWNA 5G55A 4NAWA 4FN2A 1OEYA 3QAQA 3WAMA 1WX8A 4M8MA 4HLEA 3ML8A 1H4RA 1I35A 3NZUA 3L54A 4EFOA 4G3XB 2DZIA 2K6DB 3ZNGC 1TBEA 1P3QU 3X23A 4BFRA 4KSLC 2QHOA 1NBFC 3CSTA 2LZ6A 2MW5A 5IAAC 3VUXA 4LJOB 4K1RB 3ZIMA 2CU1A 3PSEB 4MEMA 2L0FA 2EMTA 1E8YA 1LM8B 2BGFA 3M62B 2NBWB 3VUYA 1EUVB 4GB9A 5D7GA 4EZJA 2IBIB 3QX1A 2MBOA 1Z2MA 3IHPC 3HK0A 1D3ZA 3VFKA 4IWOA 1L2NA 3P2BA 4FJYA 2K8HA 4W9GA 3QWZB 1KLVA 3B08A 2M8SA 2KMAA 2JF5A 5EDSA 2JY6A 3VTVA 2EKEC 3EECA 3DVNU 3LJ3A 3U7DA 4NQKE 1WZ3A 3PVLA 2ZEQA 5BO4B 4HVBA 2KWCA 1R4MI 2FCSA 2Y5BB 3A1QB 2IYDB 1WXVA 3AI5A 3QCAA 4AJYB 4ZRKA 1KOTA 2G45B 2HTHA 3GZNI 3DVGX 4LDTD 2AL6A 4DHJB 2DZMA 1S1QB 5D94A 4EZKA 4MELA 4GDLB 5AEKB 3OJ3A 1E7UA 1WXMA 4FADA 3DQVA 2C7MB 2BKRB 2EMSA 2ZNVC 2K8CA 4GDKA 5AZHA 2MP2B 3L0WB 1I42A 5CX3A 1V81A 1EF1A 2JVCA 1WGGA 3KUZA 4IUMB 4EUTA 2MSED 2MX2A 4A3PA 3ECIA 5CHFA 4EKUA 2ZNVB 4FJZA 2IO3B 4I6PA 5DPTA 2KDEB 2V3SA 3KYDD 4WJNA 4XZ4A 3AU4A 4WWOA 2MRPA 2CKHB 2KQ7A 2DX5B 2KX3A 3JVZX 1BT0A 4WQOB 2I1JA 1WE7A 1WXAA 5J2RA 1C3TA 1OTRB 2MCNB 2LWPA 5J17A 1GNUA 3R66C 1WH3A 2C7NB 3PS6A 2L8JA 3SD5A 2DYBA 2D07B 4PS7A 4FA6A 4CHKA 1WMHA 2HD5B 2KFKB 1WE6A 2KDBA 2FAZA 4JIOU 2IO1B 4GN1A 4ICUA 4NQLB 4DDGD 5JZEB 2D10A 1NDDA 4II2B 1WIAA 5CHVC 3RD2A 3TL5A 1AARA 4DWFA 3A9KB 4DHZB 1WX9A 4LCDE 3CMMB 4MDKE 4KDIC 3MTNB 4FLHA 3QHTA 1J19A 3APFA 1UH6A 2M1MA 2KMCA 1CMXB 4B9KA 2DAJA 3VUWA 2AWTA 2G4DB 2LRUA 4DXAB 3ZNHB 4ANVA 1WJUA 3V6CB 1GC6A 3PGEA 2MBHA 2NBUA 1GC7A 5IA7A 1XQQA 2FUHB 2NPTB 3JSVA 4GIVA 2NR2A 4TUUA 1P9DU 2J7QB 3PPAA 2D11A 3IVFA 5TR5A 2KFJA 2RSUA 1WF9A 2RGFA 3NZSA 4ZRIA 3RZFA 3DBHI 2KLGA 3WAOA 2KOXA 2A5UA 2N9EB 2KXJA 3H7PB 3M63B 4E3CA 4MM3A 4W9LA 2BWFA 1RAXA 3IFWB 4ZDVA 4XX5A 2GBJA 4WJPA 1K8RB 2DZJA 4E71A 2NCNA 3VQIA 3PZDA 1WRDB 3V60A 3OLMD 1UZXB 2JWZA 2N1WA 3PREA 2JZ3B 2OOBB 1GUAB 1VD2A 1V80A 3IG3A 4ANXA 2KC2A 2L0TA 3R3MA 3U30A 2ZPNA 3DDCB 5HKHA 1WR6E 4F8CB 2KO3A 4URKA 2M4NA 3A9JA 1EO6A 2WDTB 4ASWC 1V6EA 4P7IA 3VVWB 1TGZB 3PRPB 2KJRA 2IY0B 4W9EA 4DDID 4FJVB 4BKGA 1U4AA 3ZTDA 1R4NI 4IM0A 4GOCA 3W1SA 1UELA 4FBJB 2GBMA 1C1YB 1JRUA 2AEHA 2KQSA 1XT9B 4IG7B 5E6NA 5E6OA 2RR9A 2MLBA 4FULA 4PS8A 4RM9A 1WR1A 2DYMA 3DBRI 4NY0A 2ZJDA 4W9HA 2O6VB 2KKCA 5JHBA 2GBNA 1GG3A 3GOEA 4IWQA 4OVUA 1E90A 3RYTA 3DPDA 3KVFB 4MSQB 1OEYJ 1SIFA 1E5WA 2GBRA 1P1AA 3N32A 3Q3FA 4KDLB 4YL8A 2BYEA 2KDIA 4IWPA 4HPMB 3UQBA 1UBQA 4I6LB 3T9LA 3ZO5B 2DAFA 2V1YA 3N30A 4A3OA 2KVRA 2LI5A 2ZCCA 2WWZA 4W9JA 3SDLC 2IY1B 4NPNA 1X1MA 2FCMA 1Q5WB 1WGYA 2LGXA 4GGQA 2C5LC 1YD8U 3RUIB 4W9FA 3O65B 5CHWA 1TZ1A 2L7RA 4MJSA 2KTFA 4NJ6A 1ZGUB 2R2QA 4N9F4 3ZKJC 2KX0A 2V4LA 3L08A 2KDFB 1E8WA 2O2VB 2KJHB 2BF8B 1P98A 3V6EB 3WA0A 3APDA 3DVNV 1V5OA 3X0WA 1J8CA 1V9JA 3BINA 2ZZPB 1WM3A 2N1VA 3ALBA 1EF5A 2J0KA 1WM2A 3BY4B 3UINB 3UIPB 2MBEA 5G2NA 4KIKB 3RZWC 1MG8A 2G3QB 3VH4B 4WJOA 4GU2A 1UD7A 2LGYA 4K7WA 1H8CA 4AUQC 2LASA 2AL3A 3C0RB 2NVUI 2KTRA 2ZVNA 4NAWB 2KWVB 4K7UA 5L83A 4BOZB 2FCQA 3M95A 3TCAA 2BYVE 2N4FA 3A4SC 2MBBB 4LDTB 4BKTA 4BKSA 4MGZE 3ENEA 4WAAA 4TQ1A 4FHKA 1KM7A 1TTNA 5JHAA 1E7VA 2JRHA 3QA8A 3DVGY 1WJ6A 4EZLA 2MQJA 4E74A 3UQAA 3KUDB 3DOWA 3M3JA 2L76A 2Z0DB 5FR6A 4IC7B 4HXDA 2KD0A 4M8NA 1RFAA 1WJNA 2NBVB 2HE7A 3S2AA 2JUOA 5E6PA 2WX1A 3AU5A 1HE8A 2K39A 3L17A 1E8XA 2JRIB 5LXHA 1A5RA 3R7RA 2FNJB 4W9DA 1WXSA 4HJKA 1WJ4A 1WZ0A 2JT4B 4W9CA 2KN5A 3WAPA 4K81A 3U8ZA 3B1LX 2PEAA 1PQSA 1V2YA 3ONSA 3KH0A 5DPRA 5C23A 3OAWA 2KHWB 2D3GA 3UF8A 3KW5B 5LLIA 3H6NA 2KNBA 3A1QA 1V5TA 1WYWB 3I3TB 4WJQA 2KZRA 3MJWA 4KSKC 5LXIB 4HPLB 4BKSD 3PLVA 3ZUNA 4ZYNA 2YLMA 2XK5B 3JW0X 2C9WB 3NY5A 4GMVA 3QK0A 4GDLA 5GMVA 3OJ4B 3PTFC 2GOWA 3W1YA 4B95A 3UIOB 5D2MB 5KHOA 4GDKB 3DBLI 3EC8A 2ZPYA 2REXA 3H7SA 2CS4A 2MP2A 4WWPA 4ANUA 3H1UA 3PHWB 2N7DA 3DBSA 1UGMA 3ML9A 1Q0WB 4IW0A 4K7SA 5DCNA 3SHQA 5C1ZA 3PT2B 2O2VA 1YJ1A 3H9DA 2LXCA 3PHXB 3QQ8B 2ASQA 1S3SG 3RT3B 4A20A 1V86A 2GBKA 1Q1OA 4JL9A 3VDZA 1J0GA 1F9JA 1WY8A 5JH5C 4BBNC 4DK5A 2KANA 3WANA 3DCGA 4OVVA 3L10B 3K9OB 3VTUA 3ZRFA 4EEWA 3ZDTA 2LVPA 2RD0A 2PE9A 4EOYA 1YIWA 2BKFA 4DBGA 2A4ZA 2WX0A 4DHJD 5D6JB 1WMHB 2BWES 2L3ZA 4MGKE 3ZTCA 5J18A 3MHSD 4MGIE 2CHZA 2KFKA 2N7EA 1G6JA 2PPHA 3LDZE 3HM3A 2R2OA 2C7HA 4W9KA 3V62A 3T8MA 3A9KA 4CO7A 5AZFA 3K9PB 5L95C 2KK8A 3NS8A 2M0XA 4AP4C 3D32A 4GSWA 2JXXA 3EHVA 3QIJA 1P0RA 1WGDA 1ZW7A 2DENB 2PE6B 2ZVOA 3JSVB 2BPSA 4HDQA 2FIFA 3UGBB 1LXDA 2NPTA 4XC2A 4GXBA 1YQBA 2DZKA 3L16A 3PV1A 3WIMA 2CR5A 1FXTB 1ISNA 2DYOA 2ZCBA 3NOBA 2XBBC 4I6NB 3ZNID 4F7ZA 1ZKHA 3QC8B 4G0NB 2Z0EB 2K6QA 2L00B 1XD3B 2W9NA 3AULA 2UYZB 3H7PA 1IP9A 2KLCA 1KJTA 2XK5A 4HDOA 2GMIC 4HCNB 2XEWA 3VAWA 4G50A
chains in the Genus database with same CATH superfamily
2KYWA 3RNFC 3PLUA 1JALA 1I4QA 3RCZA 1MHXA 1JRPA 3A9JB 3W1SC 3HHMA 3QJZA 4S0RA 3ZVVA 2RPQA 3B0AA 4B6WA 1IYFA 1F0ZA 1Z5SB 2KWUB 2LRWA 4OZBA 1E8ZA 1N6ZA 2D2QA 1LQBA 3Q8CA 3RPFC 4AWJA 3APCA 2BYFA 1JWBD 4XDDA 3B9JA 4MT5A 4GLSC 1RLFA 1QT9A 2J0MA 1V49A 2J0JA 1WGHA 3TBLD 1YX5B 2IZVB 2WU5B 4NJ7A 3A4RA 1VLBA 4M0WB 3GB1A 4II3B 5DPSA 2WYQA 4BAXA 1DOIA 2JPHA 2M19A 3EGRA 1LFDA 1SGHA 5KHQA 2B3AA 2LFIA 3CF6E 3W2DA 2KN4A 2MA9B 4P6VF 2LVQA 3VXWA 2LGDA 3ZLZA 4CYEA 1B1ZA 1LO5D 3NJTA 3QAQA 4HJGE 1WX8A 3NZUA 4G3XB 2K6DB 3P63A 2DLBA 4BFRA 2LZ6A 2BBCA 4J3OD 1ENFA 1J7CA 1E8YA 2BGFA 1VZ7A 2V0GA 3TUOA 4GB9A 4EZJA 3VFKA 4L2YA 1PUTA 1ZXHA 1KLVA 2KMAA 2JF5A 2EKEC 3EECA 3LJ3A 2KWCA 2IYDB 4AJYB 3DHGC 4A55A 5HI1A 1S1QB 3NVZA 1J7AA 2K8CA 3VRAB 1TY2A 1FEHA 3KUZA 3ZYYX 4RF0A 1T6BX 4A3PA 2ZNVB 4FJZA 5DPTA 2KDEB 3AU4A 3IT6B 2CKHB 1NI3A 3JVZX 5J2RA 1C3TA 1GNUA 2C7NB 3SD5A 2DYBA 5D3IB 3TEYA 4RNAA 2KFKB 2IJ0A 2IO1B 4ICUA 2D10A 1WIAA 1YMHE 1NYQA 4KDIC 4FLHA 1SE4A 1UH6A 3P4PB 2G4DB 1WJUA 2BS2B 1GC7A 2FUHB 2NPTB 1JWMD 5HHDG 1SE2A 2J7QB 3P42A 3MC0B 3P4QB 3IVFA 3WAOA 3URYA 2KOXA 1E10A 2PTLA 4E3CA 4ZDVA 4W9LA 4WJPA 3P4RB 2DZJA 4E71A 2CJOA 3PZDA 3SR6A 1GAQB 3OLMD 4US8A 1UZXB 3AE7B 4RH6A 2JWZA 2JZ3B 2XNAC 2K9XA 1D5ZC 2PW9A 3NVYA 2NTSA 3AEAB 3Q3NC 2KO3A 3AEBB 2WDTB 2WXLA 3MP9A 3AE6B 4BKGA 3KQ4A 4GOCA 2K22A 1FMAD 2WXKA 1UELA 3AM9A 4FBJB 3B2GA 1XT9B 2MLBA 4RM9A 2ZJDA 5JHBA 3GOEA 1FM0D 1E90A 2DNFA 3DPDA 1RWSA 1E5WA 2GBRA 3Q3FA 2DBYA 4N58A 4O1NA 4ZHPA 4IWPA 4HPMB 4WAFA 4AS1A 1YQ3B 3N30A 1XLPA 2K5PA 3SDLC 2IY1B 3W5VB 2LGXA 1QLBB 2C5LC 4W9FA 1TZ1A 2INDC 4WIPA 5T8IA 3ZKJC 3L08A 2N9LA 2LGIA 3P4SB 3DVNV 3X0WA 1FXAA 1V5OA 1V9JA 3BINA 2ZZPB 3ALBA 3UIPB 1MG8A 1XCTL 5FR3A 5H8YE 4GU2A 4KKIA 1QKZA 3AB5A 3M95A 3TCAA 1SB3C 3A4SC 4LDTB 4BKTA 4TQ1A 1TTNA 1E7VA 3I5JC 4YWGG 2JRHA 4R3DA 3QA8A 3UQAA 2IGDA 2V9HA 2HE7A 2OJWA 1DOYA 3BVGA 2GLSA 3BK2A 3R7RA 1PFDA 4HJKA 1WJ4A 1PQSA 2D3GA 2W3RA 3KW5B 2INCC 3I3TB 3MJWA 2Z8LA 4BKSD 3ZJVA 3ZUNA 2XK5B 2OHFA 3NY5A 4GMVA 3KWVA 5KHOA 3DBLI 3EC8A 2ZPYA 3H7SA 3SHQA 5DCNA 3PT2B 1BXTA 2O2VA 1YJ1A 3PO0A 1S3SG 1T0SC 3RT3B 3V05A 1V86A 4XGAB 3MFGA 3VDZA 1J0GA 1NEKB 1SSNA 4DK5A 2KANA 4JPSA 3DCGA 3L10B 3VTUA 3ZRFA 3NUHB 3ZDTA 3W5UB 4EOYA 2N9KA 2A4ZA 2WX0A 1TYGB 3R8BA 4MGKE 3LXFA 1G6JA 1TS4A 2BB6A 2JYEA 1T0QC 3V62A 3T8MA 1WSPA 1KTKA 1UWXA 5L95C 3NS8A 3QIJA 1ZW7A 4N6EB 3JSVB 2HJ1A 3L16A 3I57A 2DYOA 4I6NB 3QC8B 2FBWB 1N61A 1J7BA 4MM3B 3H7PA 3DBHB 1KJTA 3I9V1 4C4VB 2LMCA 1VCBA 4RM8A 2CU3A 2LXAA 2UWQA 4AOFA 3DWMA 1WGRA 2WDVB 4TV3A 1XCQL 4IKGA 4C7ZA 2MH7A 2KVZA 2WXJA 4DHZE 2LEKA 3EFUA 1FCLA 4NNJB 4PK1A 2AX5A 1JWAD 5DPWA 1M94A 2L32A 3Q3JA 2LUEA 2VRRB 2K8BA 1FRDA 4KX6B 2K25A 1DGJA 3Q3OC 3GE3C 1N5WA 1L7YA 2DHZA 2YVCA 1UBIA 2IO2B 3A33B 2LUMA 2HJ8A 3MHZA 3ZXVA 2FIDA 4HCPB 4HROA 4HKQA 3L13A 1WFYA 2NS5A 3N3KB 2N9PC 2FCNA 1N60A 1EM7A 1RRBA 1C78A 2O6VD 3BVMA 2Y3AA 1C4CA 3KUCB 3IBEA 2BS4B 1ZE3D 2QJLA 3ZGZA 3JYUA 4KIKA 2QCZA 3AH7A 1WI0A 2KTRB 2I1KA 5G55A 1OEYA 5BYQA 2JYTA 3AN1A 3L54A 2WXGA 1TBEA 3X23A 5IAAC 3ZIMA 2MHJA 3PSEB 1WXQA 4MEMA 2EMTA 2LHEA 3IHPC 3NVVA 4RCOA 3P2BA 4FJYA 3QWZB 3B08A 5EDSA 3U7DA 4NQKE 1WZ3A 1NYRA 4HVBA 1R4MI 2FCSA 1N5XA 3A1QB 3RNEC 1D5MC 2HTHA 2RPVA 3GZNI 1V1PA 3GP7A 2AL6A 4DHJB 5AEKB 5D94A 2EELA 1E7UA 1WXMA 2MJ3A 1FNVA 2C7MB 4YSZB 2EMSA 4ARCA 4GDKA 5AZHA 2MP2B 2WXIA 1V81A 1EF1A 3Q8FA 3AE2B 2MX2A 4EKUA 2QSDA 3Q8AA 4DXGA 2V3SA 2L83A 1OQQA 4XZ4A 1ACCA 2I1JA 1WE7A 5IOIA 1OTRB 4LNIA 3R66C 1WH3A 3IAM1 4AQ7A 5E6JA 4FA6A 4TMAB 1FNWA 4C7YA 2Y5PA 1NDDA 4II2B 4DWFA 4ZHOA 1N62A 4OVZA 1WX9A 4NZLB 1TKYA 3MTNB 4D2KA 2WS3B 1M4VA 3QHTA 1J19A 3APFA 2KMCA 1YQ4B 1IGDA 2AWTA 4DXAB 1V8CA 3PGEA 2NBUA 1XQQA 1MG4A 4GIVA 4RF1A 2NR2A 4TUUA 3PPAA 2D11A 4XWTA 2KFJA 3DBHI 4WQMA 1GB4A 3M63B 1E9MA 4C80A 2GBJA 1K8RB 3LB8C 2NCNA 1MPEA 4NAMA 1WGKA 1TS2A 2OOBB 1V80A 5BYRA 1JROA 3AEFB 3Q69A 3U30A 2ZPNA 3DDCB 5HKHA 1SF0A 3V3XA 4URKA 1EO6A 3VVWB 1TGZB 4L23A 3PRPB 2LHDA 2IY0B 2LJIA 4DDID 4FJVB 1R4NI 4IM0A 1ZDVA 2AEHA 3OG5A 4FULA 4PS8A 3DBRI 4W9HA 2GBNA 2W3SA 4IWQA 4P1CC 3RYTA 1FFUA 1D4BA 4MSQB 1OEYJ 1SIFA 2BW2A 1SBBB 4KDLB 2BVCA 3NRZA 4P1BC 3BVZA 3UQBA 3T9LA 4I6LB 3ZO5B 2V1YA 4A3OA 1MVKA 2LI5A 2WWZA 2BT6A 1OQRA 2GI9A 4W9JA 3BIID 1Q5WB 1WGYA 4GGQA 1YD8U 2JX5A 2L7RA 2JZPA 4MJSA 1RFKA 1SIJA 4YTPB 2KX0A 2V4LA 2KDFB 2KJHB 4PT5A 1P98A 3V6EB 2QMTA 1XLOA 2HDEA 1L6VA 2INNE 3BY4B 3RZWC 1P7FA 3CWIA 4ZOHC 2LGYA 3AECB 1H8CA 2AL3A 3C0RB 5G5GA 1VRAB 2ZVNA 4K7UA 2JSVX 3I63C 4YTMB 3B2FA 1HZ5A 2BYVE 4NJCA 4BKSA 2PMVA 4FHKA 1JWSD 4B0MA 2JWUA 3MC8A 2MQJA 4E74A 5HG2A 5MPOA 5IO9A 2QEJC 4M8NA 2NBVB 1HTOA 4UDUC 1C9FA 1R7SA 2W54A 1A5RA 1Q10A 1WXSA 1STEA 2JT4B 4W9CA 1JW9D 4K81A 1IUEA 2VH1A 3B1LX 4M00A 2PEAA 1MJDA 5GXGB 3ONSA 5DPRA 2KHWB 5LLIA 3H6NA 5LNK1 2E6XA 4C56C 1WYWB 2IDYA 5LXIB 1GOZA 1MI0A 1HZ6A 4HPLB 3PLVA 4ZYNA 2YLMA 1EWCA 2C9WB 2MJDA 3QK0A 4GDLA 4IDIA 1YJJA 1MFWA 2REXA 2WXPA 1L0XB 3Q2AC 3PHWB 1K53A 2N7DA 3C19A 3DBSA 4K7SA 4QAYA 2IGGA 1KLGD 3PHXB 3QQ8B 2ASQA 2G9HD 5FK9C 3OWEB 2GBKA 1Q1OA 4MACA 5G5HA 3NVWA 1WY8A 5JH5C 4BBNC 2L52A 2H89B 2WXNA 3AEGB 2RDGA 2M0AA 2RD0A 1YNTE 1AWDA 5D6JB 2BWES 3ZTCA 2L3ZA 2N7EA 1QOFA 1YJIA 2PPHA 3MC9A 3LDZE 3HM3A 1TIFA 1TKGA 2C7HA 4CO7A 1KLUD 3A9KA 3K9PB 3D32A 2WLBA 1YN4A 3EHVA 1P0RA 2AQ1B 3P1MA 2DENB 2ZVOA 3O13A 2FUG1 1GB1A 4GXBA 1YQBA 2DZKA 2CR5A 2XBBC 1HA5A 3ZNID 1D6EC 1ZKHA 2K6QA 2M56B 1XD3B 2WU2B 3AULA 1C76A 2XK5A 4HDOA 3Q3MC 2WGSA 4S17A 4RGOS 4KVGB 1UGJA 1NI2A 4XE0A 2J42A 2CHXA 4KZCA 1FCCC 3NHEB 2IPKD 4JQWC 2KWDA 2EKIA 3HIZA 2LJ5A 2CJNA 3AE1B 4KV2A 3ZRCA 3ZDMC 4ZRJA 2CHWA 3VH3B 4X57B 2MWSB 4BBNF 2BYTA 3IT4B 2PVOD 1OQYA 4MSMB 4W9IA 5IP4D 2SAKA 4WH4A 4JGHB 2O6VA 1A70A 3AEEB 4ANWA 4MH0E 3CSFA 1SE9A 3ZW3A 3KYCD 5AZGA 1DOXA 3TIXA 1F2RC 2MBQA 1AN8A 4G11A 2WP9B 1HQRD 3E9SA 4LTUA 1GJZA 3N1ZC 4PYZA 2JZZA 2JXTA 1E7PB 1MHHE 4ZYSA 1E6EB 3UI3A 2W82A 2G4SA 4HPPA 3PZ7A 4MGYE 4ZRQA 4A90A 1LGRA 5D3DA 2LVOA 2LD9A 5CTRC 2N0SB 4TSSA 2OJRA 3AV8A 2WXFA 3TMPB 4C4VA 4LJPB 4HK2A 3TJPA 2WXHA 3FKYA 1IPGA 3WALA 5BMIA 4M02A 1XXGA 3HM6X 2PJHA 2KC1A 3SFDB 1KF6B 2N9XA 2L05A 2KDMA 4NAWA 4FN2A 1K52A 2W55A 4M8MA 1I35A 3ML8A 4A8XC 4LNKA 2DZIA 3ZNGC 2J52A 4RFBA 2MW5A 4WURA 1XLQA 4LJOB 4K1RB 2CU1A 1SE3A 3M62B 2JQRB 2NBWB 1HXYD 1EUVB 2IBIB 3QX1A 1Z2MA 3MJ5A 3DHHC 1UWMA 2K8HA 2M8SA 5C3JB 2JY6A 3VTVA 1QOBA 1L4ZB 3PVLA 2ZEQA 5BO4B 4RGTA 2Q5WD 2I38A 1T5XD 4C00A 2PIAA 4A9AA 3QCAA 1KOTA 1ET6A 2B76B 4LDTD 2V3NA 3OJ3A 3DQVA 4OZAA 4XWWA 2JVCA 4EUTA 2MSED 1EWYC 2IO3B 4WJNA 3KYDD 3ZJUA 2ZW0A 2DX5B 1ZP0B 1BT0A 1C77A 3R2IA 5J17A 2MEKA 3KWLA 4RGMA 2RMMA 2L8JA 2D07B 4LK0M 4A6QA 4PS7A 4CHKA 1WMHA 1WE6A 2KDBA 3RNGC 4NQLB 4DDGD 2YEPF 5JZEB 5CHVC 3RD2A 1AARA 2WXQA 4LCDE 3CMMB 4MDKE 1DYQA 1XO3A 1GPXA 1AW7A 3NZ3A 3VUWA 3ZNHB 4ANVA 2Y5CA 1IBXB 1P9DU 1VR9A 1FD6A 2RSUA 4JX1C 1WF9A 4ZRIA 2KLGA 1I4HA 2A5UA 1I4PA 3H7PB 1RAXA 4KGRA 4XX5A 3Q14C 1YOVB 1VZ8A 3RNBC 3VQIA 1WRDB 3V60A 4ARIA 1JQ4A 1VD2A 3RI7C 3R3MA 2L0TA 1B9RA 2QC8A 2M4NA 3A9JA 4ASWC 1V6EA 4P7IA 3GE8C 2ICIA 2L1AA 4W9EA 1U4AA 5JXVA 4M01A 2GBMA 1C1YB 3BYTB 2KQSA 5H92C 1TS3A 4RGNA 5E6NA 2RR9A 4B0EA 1WR1A 2DYMA 4NY0A 3WCQA 1V97A 1T0RC 1P1AA 3BZDB 1I4RA 4OW0A 3SFEB 4YSXB 2KVRA 2KQ4X 4LNOA 1WRIA 4M0WA 4NPNA 1X1MA 2FCMA 3HRDD 1YN5A 3RUIB 3O65B 5CHWA 2KTFA 4NJ6A 1ZGUB 2R2QA 4N9F4 1TJEA 4KGTA 3VRBB 2BF8B 3HVZA 3APDA 1J8CA 1PGXA 1EF5A 2J0KA 3U2SC 3UINB 3U4EG 2MBEA 5G2NA 3CIRB 4KIKB 1ZPSA 3VH4B 4K7WA 4CQNA 4AUQC 2LASA 2NVUI 5L83A 2KWVB 1QOGA 2N4FA 4MGZE 4WAAA 2FE8A 5JHAA 1XLNA 2WDRB 3DVGY 1WJ6A 3N1YC 2G1EA 3J9CA 3KUDB 1CZPA 2DWQA 4XDCA 2L76A 2Z0DB 5FR6A 4IC7B 2KD0A 1RFAA 3S2AA 5BMHA 5E6PA 2X38A 3L17A 3AU5A 2WX1A 1HE8A 1HEZE 1SJHD 5LXHA 4W9DA 3FILB 1ZDXA 1P7EA 1I4XA 3KH0A 3OAWA 2KNBA 1HTQA 1V5TA 1V1PB 4KSKC 2J53A 2WXMA 2WXOA 2QDFA 3Q6BA 3PTFC 5BMGA 2WNMA 3W1YA 3UIOB 5EE1A 2PLPA 3TEZA 4GDKB 3Q8EA 1QQRA 4ANUA 4JWSC 4BZAA 3ML9A 1Q0WB 4IW0A 5C1ZA 3PZ8A 4ZRPA 3H9DA 2LXCA 1JWUD 2BQQA 4JL9A 1F9JA 3ABVB 1CQVA 4USAA 3WANA 2K3UA 2BB5A 4OVVA 1IGCA 4HEA1 2LVPA 1KH0A 2INPE 2SEBD 4DBGA 4DHJD 3AE5B 1ZXIA 4P16A 3MHSD 4MGIE 2VZKB 2KFKA 2KACA 5IN7A 2R2OA 3GS2A 3U7ZA 1N63A 4W9KA 5AZFA 1V1OA 4AP4C 3DHIC 4GSWA 2JXXA 4LLGM 4N59A 1WGDA 1SXTA 2PE6B 3UGBB 3KLSX 1LXDA 2NPTA 4XC2A 3WIMA 5AUIA 3N9YC 1FXTB 1ISNA 3NOBA 2ZCBA 3HUIA 2V3PA 4F7ZA 3N1XC 3RNCC 4G0NB 2OEDA 2Z0EB 2UU7A 2W9NA 3VR9B 2UYZB 1IP9A 2HTME 2KLCA 4LNFA 4ACFA 5TSSA 2GMIC 4WWMA 4G50A 1JMLA 3AXCA 4TKNA 3ZXRA 4ICVA 4BVUC 3QARA 2WQYB 2ON8A 4PS3A 2C60A 2WDQB 3DBLB 2I2YA 4HWIB 1TZOA 4KZ0A 5IKCM 3V61A 4AJWA 3H8HA 1Y8RC 4IM3A 4FHJA 3VTWA 3ZNZB 1YX6B 2AYOB 2KJ6A 3T3OA 1WX7A 3VHTC 3EA6A 3RNAC 3IXSA 4KGSA 2RDBC 2M17A 1CJEA 3RFZB 4PYUA 3PRZA 4TQ0A 4IM2A 4OHJA 4BOSC 3PRMB 3ZQ4A 3SU8X 1F52A 4EE2A 1WYGA 1T0YA 4JLCA 3RULA 4MJSB 2IGHA 3R7QA 1PGAA 1OGWA 2BS3B 4J6IA 4RMAA 3TSSA 2Z59B 2ZW1A 2XN9C 2K1FA 2VZKD 4JE3B 4YT0B 2IO0B 4F1SA 1QZEA 1C4AA 2AQ2B 1JCKB 4WWNA 3WAMA 4HLEA 1H4RA 3DWGC 4EFOA 2RDHA 1P3QU 4HRSA 4KSLC 2QHOA 1NBFC 3CSTA 3VUXA 2WXRA 2L0FA 2D3CA 2H88B 1LM8B 1BUIC 3VUYA 1TY0A 5D7GA 2MBOA 3HK0A 2YEPB 1D3ZA 4IWOA 1L2NA 4W9GA 1CK1A 1ZOYB 3T3NA 2D3AA 2QIEB 3DVNU 2ACZB 1T3QA 1WWTA 2Y5BB 1FPYA 1WXVA 3AI5A 4ZRKA 1L0YB 2G45B 1RM6C 1KFYB 3DVGX 2DZMA 4EZKA 4MELA 4GDLB 4FADA 2R61A 2BKRB 1OFFA 2ZNVC 3L0WB 3AE3B 4YXDB 1I42A 4REZA 5CX3A 2GB1A 1QF6A 1WGGA 4IUMB 1TT5B 1FXIA 3ECIA 5CHFA 4I6PA 3U52E 1TKEA 4DXFA 2AQ3B 1NVID 2D5GA 3EFCA 2MRPA 4WWOA 2KQ7A 2KX3A 5BYSA 4WQOB 1XEEA 1WXAA 3L4PA 2NTTA 2MCNB 3AE8B 1E0ZA 2LWPA 1TS5A 2LGSA 3W9CB 3PS6A 3AMZA 1ET9A 1ZUD2 3BWUD 3C8YA 2HD5B 1FIQA 1XF5L 2FAZA 4JIOU 2VH2A 4GN1A 5EE0A 4LNNA 3TL5A 3A9KB 4DHZB 1K51A 2M1MA 1CMXB 3LYYA 1I4GA 2DAJA 4B9KA 2LRUA 3N20C 4DQOC 3V6CB 1GC6A 2MBHA 3FC4A 5IA7A 3JSVA 2V4IB 1K50A 3AEDB 5TR5A 2RGFA 3NZSA 3RZFA 1I7HA 2N9EB 1C4PA 1UUPA 2JU6X 2KXJA 4MM3A 2BWFA 3IFWB 4ITKA 1R4MB 5EE3A 1FRRA 1RYJA 3GZNB 4XYCA 4Q2JA 2N1WA 3PREA 1GUAB 1SEBD 3IG3A 4K3CA 4ANXA 2KC2A 3EUB2 1WR6E 1FFVA 4F8CB 5I4DA 2X8XX 3Q8BA 2BTEA 1AYFA 3ZJTA 2KJRA 2KMMA 3ZTDA 3SEBA 1PGBA 3W1SA 1ESFA 4IG7B 1JRUA 5E6OA 1L4DB 2N7JA 2O6VB 2KKCA 3AE9B 1GG3A 4OVUA 3NG0A 3KVFB 4US9A 4KKJA 3N32A 5FKAC 4YL8A 2BYEA 2KDIA 1QILA 1YN3A 1UBQA 2DAFA 2D3BA 1F77A 2ZCCA 1F2RI 4YSYB 1EU3A 1VJKA 1IBXA 1UF0A 2J4XA 1Y56A 4K3BA 2WHIA 1E8WA 2O2VB 3WA0A 2ONQA 4L1BA 2PVGC 1WM3A 2N1VA 4YTNB 1WM2A 1NENB 2G3QB 1L6UA 1QOAA 4WJOA 3RN9C 1UD7A 1VDVA 3ETRA 2K0PA 2KTRA 1VZ6A 4NAWB 4BOZB 2FCQA 2MBBB 2MJEA 4HKZE 3ENEA 1KM7A 1L0VB 2PKOA 4EZLA 4JWUC 3DOWA 3M3JA 4HXDA 1WJNA 1FNUA 3BYYB 2JUOA 1R4NB 2K39A 1E8XA 2JRIB 1UNSA 2KAJA 2FNJB 1WZ0A 2KN5A 3WAPA 3U8ZA 3DBRB 1V2YA 4FXCA 5C23A 3UF8A 1ROEA 4MH8A 3A1QA 4WJQA 2NMQA 2KZRA 5HFYA 5C2TB 1C79A 3JW0X 5EE9A 5GMVA 3OJ4B 2GOWA 3IAS1 4B95A 5D2MB 1BMLC 2CS4A 2MP2A 3NS1A 4WWPA 3H1UA 1UGMA 1EU4A 4H2AA 3RMKC 4A20A 3BK1A 1L5PA 3K9OB 1F1HA 4EEWA 5AUKA 2PE9A 1YIWA 2BKFA 3FAHA 1PYWD 1WMHB 5J18A 2CHZA 1FO4A 3R2TA 3TEWA 3AE4B 2QILA 2TSSA 1SJED 2KK8A 1D5XC 2M0XA 1KRHA 3VR8B 2GRIA 2BPSA 4HDQA 2FIFA 2E3TA 4IOIE 3FILA 3PV1A 4OZCA 3E56A 3TEXA 3HVDA 2L00B 2KT7A 4HCNB 2XEWA 1PDXA 3VAWA
chains in the Genus database with same CATH topology
1VCBA 4RM8A 4KVGB 1NI2A 3AXCA 4TKNA 3PLUA 4ICVA 4BVUC 2CHXA 2LXAA 3QARA 4KZCA 4PS3A 3NHEB 2UWQA 3RCZA 2C60A 4AOFA 3A9JB 3W1SC 4HWIB 4JQWC 3HHMA 1WGRA 3HIZA 3QJZA 2LJ5A 4KZ0A 4TV3A 3V61A 4KV2A 4AJWA 3ZRCA 4DHZE 1Y8RC 4IM3A 4FHJA 3ZDMC 4ZRJA 2CHWA 3ZVVA 3EFUA 2RPQA 4X57B 3VH3B 3B0AA 3VTWA 3ZNZB 4B6WA 2MWSB 1IYFA 4BBNF 1Z5SB 4NNJB 1YX6B 2AYOB 2KWUB 2LRWA 1OQYA 2KJ6A 5DPWA 4MSMB 1M94A 4W9IA 1WX7A 3Q3JA 1E8ZA 2D2QA 2LUEA 3VHTC 1LQBA 2VRRB 2K8BA 4JGHB 2O6VA 2K25A 2M17A 4AWJA 4PYUA 4ANWA 4MH0E 1L7YA 3APCA 2DHZA 3PRZA 4TQ0A 2YVCA 1SE9A 1UBIA 2BYFA 3CSFA 4IM2A 2IO2B 3ZW3A 3A33B 2HJ8A 3KYCD 5AZGA 1RLFA 2J0MA 1V49A 3TIXA 2FIDA 2J0JA 2MBQA 1WGHA 3TBLD 4HCPB 4BOSC 1YX5B 2IZVB 4G11A 4NJ7A 3PRMB 3A4RA 3SU8X 4M0WB 1T0YA 4II3B 5DPSA 1GJZA 3L13A 2WYQA 4JLCA 4PYZA 2JZZA 1WFYA 2NS5A 3RULA 4MJSB 2JPHA 3R7QA 3N3KB 2N9PC 2FCNA 1OGWA 1LFDA 1SGHA 2G4SA 4J6IA 4MGYE 2B3AA 3CF6E 4RMAA 2Z59B 5KHQA 1RRBA 2O6VD 2LVOA 2LD9A 5CTRC 2K1FA 3IBEA 3KUCB 2OJRA 3TMPB 4LJPB 4HK2A 2MA9B 3TJPA 3JYUA 1IPGA 4KIKA 3WALA 2LVQA 3VXWA 2IO0B 4F1SA 3HM6X 2LGDA 3ZLZA 2PJHA 4CYEA 1WI0A 2KC1A 2KTRB 1QZEA 2I1KA 2N9XA 2L05A 4WWNA 5G55A 4NAWA 4FN2A 1OEYA 3QAQA 3WAMA 1WX8A 4M8MA 4HLEA 3ML8A 1H4RA 1I35A 3NZUA 3L54A 4EFOA 4G3XB 2DZIA 2K6DB 3ZNGC 1TBEA 1P3QU 3X23A 4BFRA 4KSLC 2QHOA 1NBFC 3CSTA 2LZ6A 2MW5A 5IAAC 3VUXA 4LJOB 4K1RB 3ZIMA 2CU1A 3PSEB 4MEMA 2L0FA 2EMTA 1E8YA 1LM8B 2BGFA 3M62B 2NBWB 3VUYA 1EUVB 4GB9A 5D7GA 4EZJA 2IBIB 3QX1A 2MBOA 1Z2MA 3IHPC 3HK0A 1D3ZA 3VFKA 4IWOA 1L2NA 3P2BA 4FJYA 2K8HA 4W9GA 3QWZB 1KLVA 3B08A 2M8SA 2KMAA 2JF5A 5EDSA 2JY6A 3VTVA 2EKEC 3EECA 3DVNU 3LJ3A 3U7DA 4NQKE 1WZ3A 3PVLA 2ZEQA 5BO4B 4HVBA 2KWCA 1R4MI 2FCSA 2Y5BB 3A1QB 2IYDB 1WXVA 3AI5A 3QCAA 4AJYB 4ZRKA 1KOTA 2G45B 2HTHA 3GZNI 3DVGX 4LDTD 2AL6A 4DHJB 2DZMA 1S1QB 5D94A 4EZKA 4MELA 4GDLB 5AEKB 3OJ3A 1E7UA 1WXMA 4FADA 3DQVA 2C7MB 2BKRB 2EMSA 2ZNVC 2K8CA 4GDKA 5AZHA 2MP2B 3L0WB 1I42A 5CX3A 1V81A 1EF1A 2JVCA 1WGGA 3KUZA 4IUMB 4EUTA 2MSED 2MX2A 4A3PA 3ECIA 5CHFA 4EKUA 2ZNVB 4FJZA 2IO3B 4I6PA 5DPTA 2KDEB 2V3SA 3KYDD 4WJNA 4XZ4A 3AU4A 4WWOA 2MRPA 2CKHB 2KQ7A 2DX5B 2KX3A 3JVZX 1BT0A 4WQOB 2I1JA 1WE7A 1WXAA 5J2RA 1C3TA 1OTRB 2MCNB 2LWPA 5J17A 1GNUA 3R66C 1WH3A 2C7NB 3PS6A 2L8JA 3SD5A 2DYBA 2D07B 4PS7A 4FA6A 4CHKA 1WMHA 2HD5B 2KFKB 1WE6A 2KDBA 2FAZA 4JIOU 2IO1B 4GN1A 4ICUA 4NQLB 4DDGD 5JZEB 2D10A 1NDDA 4II2B 1WIAA 5CHVC 3RD2A 3TL5A 1AARA 4DWFA 3A9KB 4DHZB 1WX9A 4LCDE 3CMMB 4MDKE 4KDIC 3MTNB 4FLHA 3QHTA 1J19A 3APFA 1UH6A 2M1MA 2KMCA 1CMXB 4B9KA 2DAJA 3VUWA 2AWTA 2G4DB 2LRUA 4DXAB 3ZNHB 4ANVA 1WJUA 3V6CB 1GC6A 3PGEA 2MBHA 2NBUA 1GC7A 5IA7A 1XQQA 2FUHB 2NPTB 3JSVA 4GIVA 2NR2A 4TUUA 1P9DU 2J7QB 3PPAA 2D11A 3IVFA 5TR5A 2KFJA 2RSUA 1WF9A 2RGFA 3NZSA 4ZRIA 3RZFA 3DBHI 2KLGA 3WAOA 2KOXA 2A5UA 2N9EB 2KXJA 3H7PB 3M63B 4E3CA 4MM3A 4W9LA 2BWFA 1RAXA 3IFWB 4ZDVA 4XX5A 2GBJA 4WJPA 1K8RB 2DZJA 4E71A 2NCNA 3VQIA 3PZDA 1WRDB 3V60A 3OLMD 1UZXB 2JWZA 2N1WA 3PREA 2JZ3B 2OOBB 1GUAB 1VD2A 1V80A 3IG3A 4ANXA 2KC2A 2L0TA 3R3MA 3U30A 2ZPNA 3DDCB 5HKHA 1WR6E 4F8CB 2KO3A 4URKA 2M4NA 3A9JA 1EO6A 2WDTB 4ASWC 1V6EA 4P7IA 3VVWB 1TGZB 3PRPB 2KJRA 2IY0B 4W9EA 4DDID 4FJVB 4BKGA 1U4AA 3ZTDA 1R4NI 4IM0A 4GOCA 3W1SA 1UELA 4FBJB 2GBMA 1C1YB 1JRUA 2AEHA 2KQSA 1XT9B 4IG7B 5E6NA 5E6OA 2RR9A 2MLBA 4FULA 4PS8A 4RM9A 1WR1A 2DYMA 3DBRI 4NY0A 2ZJDA 4W9HA 2O6VB 2KKCA 5JHBA 2GBNA 1GG3A 3GOEA 4IWQA 4OVUA 1E90A 3RYTA 3DPDA 3KVFB 4MSQB 1OEYJ 1SIFA 1E5WA 2GBRA 1P1AA 3N32A 3Q3FA 4KDLB 4YL8A 2BYEA 2KDIA 4IWPA 4HPMB 3UQBA 1UBQA 4I6LB 3T9LA 3ZO5B 2DAFA 2V1YA 3N30A 4A3OA 2KVRA 2LI5A 2ZCCA 2WWZA 4W9JA 3SDLC 2IY1B 4NPNA 1X1MA 2FCMA 1Q5WB 1WGYA 2LGXA 4GGQA 2C5LC 1YD8U 3RUIB 4W9FA 3O65B 5CHWA 1TZ1A 2L7RA 4MJSA 2KTFA 4NJ6A 1ZGUB 2R2QA 4N9F4 3ZKJC 2KX0A 2V4LA 3L08A 2KDFB 1E8WA 2O2VB 2KJHB 2BF8B 1P98A 3V6EB 3WA0A 3APDA 3DVNV 1V5OA 3X0WA 1J8CA 1V9JA 3BINA 2ZZPB 1WM3A 2N1VA 3ALBA 1EF5A 2J0KA 1WM2A 3BY4B 3UINB 3UIPB 2MBEA 5G2NA 4KIKB 3RZWC 1MG8A 2G3QB 3VH4B 4WJOA 4GU2A 1UD7A 2LGYA 4K7WA 1H8CA 4AUQC 2LASA 2AL3A 3C0RB 2NVUI 2KTRA 2ZVNA 4NAWB 2KWVB 4K7UA 5L83A 4BOZB 2FCQA 3M95A 3TCAA 2BYVE 2N4FA 3A4SC 2MBBB 4LDTB 4BKTA 4BKSA 4MGZE 3ENEA 4WAAA 4TQ1A 4FHKA 1KM7A 1TTNA 5JHAA 1E7VA 2JRHA 3QA8A 3DVGY 1WJ6A 4EZLA 2MQJA 4E74A 3UQAA 3KUDB 3DOWA 3M3JA 2L76A 2Z0DB 5FR6A 4IC7B 4HXDA 2KD0A 4M8NA 1RFAA 1WJNA 2NBVB 2HE7A 3S2AA 2JUOA 5E6PA 2WX1A 3AU5A 1HE8A 2K39A 3L17A 1E8XA 2JRIB 5LXHA 1A5RA 3R7RA 2FNJB 4W9DA 1WXSA 4HJKA 1WJ4A 1WZ0A 2JT4B 4W9CA 2KN5A 3WAPA 4K81A 3U8ZA 3B1LX 2PEAA 1PQSA 1V2YA 3ONSA 3KH0A 5DPRA 5C23A 3OAWA 2KHWB 2D3GA 3UF8A 3KW5B 5LLIA 3H6NA 2KNBA 3A1QA 1V5TA 1WYWB 3I3TB 4WJQA 2KZRA 3MJWA 4KSKC 5LXIB 4HPLB 4BKSD 3PLVA 3ZUNA 4ZYNA 2YLMA 2XK5B 3JW0X 2C9WB 3NY5A 4GMVA 3QK0A 4GDLA 5GMVA 3OJ4B 3PTFC 2GOWA 3W1YA 4B95A 3UIOB 5D2MB 5KHOA 4GDKB 3DBLI 3EC8A 2ZPYA 2REXA 3H7SA 2CS4A 2MP2A 4WWPA 4ANUA 3H1UA 3PHWB 2N7DA 3DBSA 1UGMA 3ML9A 1Q0WB 4IW0A 4K7SA 5DCNA 3SHQA 5C1ZA 3PT2B 2O2VA 1YJ1A 3H9DA 2LXCA 3PHXB 3QQ8B 2ASQA 1S3SG 3RT3B 4A20A 1V86A 2GBKA 1Q1OA 4JL9A 3VDZA 1J0GA 1F9JA 1WY8A 5JH5C 4BBNC 4DK5A 2KANA 3WANA 3DCGA 4OVVA 3L10B 3K9OB 3VTUA 3ZRFA 4EEWA 3ZDTA 2LVPA 2RD0A 2PE9A 4EOYA 1YIWA 2BKFA 4DBGA 2A4ZA 2WX0A 4DHJD 5D6JB 1WMHB 2BWES 2L3ZA 4MGKE 3ZTCA 5J18A 3MHSD 4MGIE 2CHZA 2KFKA 2N7EA 1G6JA 2PPHA 3LDZE 3HM3A 2R2OA 2C7HA 4W9KA 3V62A 3T8MA 3A9KA 4CO7A 5AZFA 3K9PB 5L95C 2KK8A 3NS8A 2M0XA 4AP4C 3D32A 4GSWA 2JXXA 3EHVA 3QIJA 1P0RA 1WGDA 1ZW7A 2DENB 2PE6B 2ZVOA 3JSVB 2BPSA 4HDQA 2FIFA 3UGBB 1LXDA 2NPTA 4XC2A 4GXBA 1YQBA 2DZKA 3L16A 3PV1A 3WIMA 2CR5A 1FXTB 1ISNA 2DYOA 2ZCBA 3NOBA 2XBBC 4I6NB 3ZNID 4F7ZA 1ZKHA 3QC8B 4G0NB 2Z0EB 2K6QA 2L00B 1XD3B 2W9NA 3AULA 2UYZB 3H7PA 1IP9A 2KLCA 1KJTA 2XK5A 4HDOA 2GMIC 4HCNB 2XEWA 3VAWA 4G50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VCB A;  4RM8 A;  4KVG B;  1NI2 A;  3AXC A;  4TKN A;  3PLU A;  4ICV A;  4BVU C;  2CHX A;  2LXA A;  3QAR A;  4KZC A;  4PS3 A;  3NHE B;  2UWQ A;  3RCZ A;  2C60 A;  4AOF A;  3A9J B;  3W1S C;  4HWI B;  4JQW C;  3HHM A;  1WGR A;  3HIZ A;  3QJZ A;  2LJ5 A;  4KZ0 A;  4TV3 A;  3V61 A;  4KV2 A;  4AJW A;  3ZRC A;  4DHZ E;  1Y8R C;  4IM3 A;  4FHJ A;  3ZDM C;  4ZRJ A;  2CHW A;  3ZVV A;  3EFU A;  2RPQ A;  4X57 B;  3VH3 B;  3B0A A;  3VTW A;  3ZNZ B;  4B6W A;  2MWS B;  1IYF A;  4BBN F;  1Z5S B;  4NNJ B;  1YX6 B;  2AYO B;  2KWU B;  2LRW A;  1OQY A;  2KJ6 A;  5DPW A;  4MSM B;  1M94 A;  4W9I A;  1WX7 A;  3Q3J A;  1E8Z A;  2D2Q A;  2LUE A;  3VHT C;  1LQB A;  2VRR B;  2K8B A;  4JGH B;  2O6V A;  2K25 A;  2M17 A;  4AWJ A;  4PYU A;  4ANW A;  4MH0 E;  1L7Y A;  3APC A;  2DHZ A;  3PRZ A;  4TQ0 A;  2YVC A;  1SE9 A;  1UBI A;  2BYF A;  3CSF A;  4IM2 A;  2IO2 B;  3ZW3 A;  3A33 B;  2HJ8 A;  3KYC D;  5AZG A;  1RLF A;  2J0M A;  1V49 A;  3TIX A;  2FID A;  2J0J A;  2MBQ A;  1WGH A;  3TBL D;  4HCP B;  4BOS C;  1YX5 B;  2IZV B;  4G11 A;  4NJ7 A;  3PRM B;  3A4R A;  3SU8 X;  4M0W B;  1T0Y A;  4II3 B;  5DPS A;  1GJZ A;  3L13 A;  2WYQ A;  4JLC A;  4PYZ A;  2JZZ A;  1WFY A;  2NS5 A;  3RUL A;  4MJS B;  2JPH A;  3R7Q A;  3N3K B;  2N9P C;  2FCN A;  1OGW A;  1LFD A;  1SGH A;  2G4S A;  4J6I A;  4MGY E;  2B3A A;  3CF6 E;  4RMA A;  2Z59 B;  5KHQ A;  1RRB A;  2O6V D;  2LVO A;  2LD9 A;  5CTR C;  2K1F A;  3IBE A;  3KUC B;  2OJR A;  3TMP B;  4LJP B;  4HK2 A;  2MA9 B;  3TJP A;  3JYU A;  1IPG A;  4KIK A;  3WAL A;  2LVQ A;  3VXW A;  2IO0 B;  4F1S A;  3HM6 X;  2LGD A;  3ZLZ A;  2PJH A;  4CYE A;  1WI0 A;  2KC1 A;  2KTR B;  1QZE A;  2I1K A;  2N9X A;  2L05 A;  4WWN A;  5G55 A;  4NAW A;  4FN2 A;  1OEY A;  3QAQ A;  3WAM A;  1WX8 A;  4M8M A;  4HLE A;  3ML8 A;  1H4R A;  1I35 A;  3NZU A;  3L54 A;  4EFO A;  4G3X B;  2DZI A;  2K6D B;  3ZNG C;  1TBE A;  1P3Q U;  3X23 A;  4BFR A;  4KSL C;  2QHO A;  1NBF C;  3CST A;  2LZ6 A;  2MW5 A;  5IAA C;  3VUX A;  4LJO B;  4K1R B;  3ZIM A;  2CU1 A;  3PSE B;  4MEM A;  2L0F A;  2EMT A;  1E8Y A;  1LM8 B;  2BGF A;  3M62 B;  2NBW B;  3VUY A;  1EUV B;  4GB9 A;  5D7G A;  4EZJ A;  2IBI B;  3QX1 A;  2MBO A;  1Z2M A;  3IHP C;  3HK0 A;  1D3Z A;  3VFK A;  4IWO A;  1L2N A;  3P2B A;  4FJY A;  2K8H A;  4W9G A;  3QWZ B;  1KLV A;  3B08 A;  2M8S A;  2KMA A;  2JF5 A;  5EDS A;  2JY6 A;  3VTV A;  2EKE C;  3EEC A;  3DVN U;  3LJ3 A;  3U7D A;  4NQK E;  1WZ3 A;  3PVL A;  2ZEQ A;  5BO4 B;  4HVB A;  2KWC A;  1R4M I;  2FCS A;  2Y5B B;  3A1Q B;  2IYD B;  1WXV A;  3AI5 A;  3QCA A;  4AJY B;  4ZRK A;  1KOT A;  2G45 B;  2HTH A;  3GZN I;  3DVG X;  4LDT D;  2AL6 A;  4DHJ B;  2DZM A;  1S1Q B;  5D94 A;  4EZK A;  4MEL A;  4GDL B;  5AEK B;  3OJ3 A;  1E7U A;  1WXM A;  4FAD A;  3DQV A;  2C7M B;  2BKR B;  2EMS A;  2ZNV C;  2K8C A;  4GDK A;  5AZH A;  2MP2 B;  3L0W B;  1I42 A;  5CX3 A;  1V81 A;  1EF1 A;  2JVC A;  1WGG A;  3KUZ A;  4IUM B;  4EUT A;  2MSE D;  2MX2 A;  4A3P A;  3ECI A;  5CHF A;  4EKU A;  2ZNV B;  4FJZ A;  2IO3 B;  4I6P A;  5DPT A;  2KDE B;  2V3S A;  3KYD D;  4WJN A;  4XZ4 A;  3AU4 A;  4WWO A;  2MRP A;  2CKH B;  2KQ7 A;  2DX5 B;  2KX3 A;  3JVZ X;  1BT0 A;  4WQO B;  2I1J A;  1WE7 A;  1WXA A;  5J2R A;  1C3T A;  1OTR B;  2MCN B;  2LWP A;  5J17 A;  1GNU A;  3R66 C;  1WH3 A;  2C7N B;  3PS6 A;  2L8J A;  3SD5 A;  2DYB A;  2D07 B;  4PS7 A;  4FA6 A;  4CHK A;  1WMH A;  2HD5 B;  2KFK B;  1WE6 A;  2KDB A;  2FAZ A;  4JIO U;  2IO1 B;  4GN1 A;  4ICU A;  4NQL B;  4DDG D;  5JZE B;  2D10 A;  1NDD A;  4II2 B;  1WIA A;  5CHV C;  3RD2 A;  3TL5 A;  1AAR A;  4DWF A;  3A9K B;  4DHZ B;  1WX9 A;  4LCD E;  3CMM B;  4MDK E;  4KDI C;  3MTN B;  4FLH A;  3QHT A;  1J19 A;  3APF A;  1UH6 A;  2M1M A;  2KMC A;  1CMX B;  4B9K A;  2DAJ A;  3VUW A;  2AWT A;  2G4D B;  2LRU A;  4DXA B;  3ZNH B;  4ANV A;  1WJU A;  3V6C B;  1GC6 A;  3PGE A;  2MBH A;  2NBU A;  1GC7 A;  5IA7 A;  1XQQ A;  2FUH B;  2NPT B;  3JSV A;  4GIV A;  2NR2 A;  4TUU A;  1P9D U;  2J7Q B;  3PPA A;  2D11 A;  3IVF A;  5TR5 A;  2KFJ A;  2RSU A;  1WF9 A;  2RGF A;  3NZS A;  4ZRI A;  3RZF A;  3DBH I;  2KLG A;  3WAO A;  2KOX A;  2A5U A;  2N9E B;  2KXJ A;  3H7P B;  3M63 B;  4E3C A;  4MM3 A;  4W9L A;  2BWF A;  1RAX A;  3IFW B;  4ZDV A;  4XX5 A;  2GBJ A;  4WJP A;  1K8R B;  2DZJ A;  4E71 A;  2NCN A;  3VQI A;  3PZD A;  1WRD B;  3V60 A;  3OLM D;  1UZX B;  2JWZ A;  2N1W A;  3PRE A;  2JZ3 B;  2OOB B;  1GUA B;  1VD2 A;  1V80 A;  3IG3 A;  4ANX A;  2KC2 A;  2L0T A;  3R3M A;  3U30 A;  2ZPN A;  3DDC B;  5HKH A;  1WR6 E;  4F8C B;  2KO3 A;  4URK A;  2M4N A;  3A9J A;  1EO6 A;  2WDT B;  4ASW C;  1V6E A;  4P7I A;  3VVW B;  1TGZ B;  3PRP B;  2KJR A;  2IY0 B;  4W9E A;  4DDI D;  4FJV B;  4BKG A;  1U4A A;  3ZTD A;  1R4N I;  4IM0 A;  4GOC A;  3W1S A;  1UEL A;  4FBJ B;  2GBM A;  1C1Y B;  1JRU A;  2AEH A;  2KQS A;  1XT9 B;  4IG7 B;  5E6N A;  5E6O A;  2RR9 A;  2MLB A;  4FUL A;  4PS8 A;  4RM9 A;  1WR1 A;  2DYM A;  3DBR I;  4NY0 A;  2ZJD A;  4W9H A;  2O6V B;  2KKC A;  5JHB A;  2GBN A;  1GG3 A;  3GOE A;  4IWQ A;  4OVU A;  1E90 A;  3RYT A;  3DPD A;  3KVF B;  4MSQ B;  1OEY J;  1SIF A;  1E5W A;  2GBR A;  1P1A A;  3N32 A;  3Q3F A;  4KDL B;  4YL8 A;  2BYE A;  2KDI A;  4IWP A;  4HPM B;  3UQB A;  1UBQ A;  4I6L B;  3T9L A;  3ZO5 B;  2DAF A;  2V1Y A;  3N30 A;  4A3O A;  2KVR A;  2LI5 A;  2ZCC A;  2WWZ A;  4W9J A;  3SDL C;  2IY1 B;  4NPN A;  1X1M A;  2FCM A;  1Q5W B;  1WGY A;  2LGX A;  4GGQ A;  2C5L C;  1YD8 U;  3RUI B;  4W9F A;  3O65 B;  5CHW A;  1TZ1 A;  2L7R A;  4MJS A;  2KTF A;  4NJ6 A;  1ZGU B;  2R2Q A;  4N9F 4;  3ZKJ C;  2KX0 A;  2V4L A;  3L08 A;  2KDF B;  1E8W A;  2O2V B;  2KJH B;  2BF8 B;  1P98 A;  3V6E B;  3WA0 A;  3APD A;  3DVN V;  1V5O A;  3X0W A;  1J8C A;  1V9J A;  3BIN A;  2ZZP B;  1WM3 A;  2N1V A;  3ALB A;  1EF5 A;  2J0K A;  1WM2 A;  3BY4 B;  3UIN B;  3UIP B;  2MBE A;  5G2N A;  4KIK B;  3RZW C;  1MG8 A;  2G3Q B;  3VH4 B;  4WJO A;  4GU2 A;  1UD7 A;  2LGY A;  4K7W A;  1H8C A;  4AUQ C;  2LAS A;  2AL3 A;  3C0R B;  2NVU I;  2KTR A;  2ZVN A;  4NAW B;  2KWV B;  4K7U A;  5L83 A;  4BOZ B;  2FCQ A;  3M95 A;  3TCA A;  2BYV E;  2N4F A;  3A4S C;  2MBB B;  4LDT B;  4BKT A;  4BKS A;  4MGZ E;  3ENE A;  4WAA A;  4TQ1 A;  4FHK A;  1KM7 A;  1TTN A;  5JHA A;  1E7V A;  2JRH A;  3QA8 A;  3DVG Y;  1WJ6 A;  4EZL A;  2MQJ A;  4E74 A;  3UQA A;  3KUD B;  3DOW A;  3M3J A;  2L76 A;  2Z0D B;  5FR6 A;  4IC7 B;  4HXD A;  2KD0 A;  4M8N A;  1RFA A;  1WJN A;  2NBV B;  2HE7 A;  3S2A A;  2JUO A;  5E6P A;  2WX1 A;  3AU5 A;  1HE8 A;  2K39 A;  3L17 A;  1E8X A;  2JRI B;  5LXH A;  1A5R A;  3R7R A;  2FNJ B;  4W9D A;  1WXS A;  4HJK A;  1WJ4 A;  1WZ0 A;  2JT4 B;  4W9C A;  2KN5 A;  3WAP A;  4K81 A;  3U8Z A;  3B1L X;  2PEA A;  1PQS A;  1V2Y A;  3ONS A;  3KH0 A;  5DPR A;  5C23 A;  3OAW A;  2KHW B;  2D3G A;  3UF8 A;  3KW5 B;  5LLI A;  3H6N A;  2KNB A;  3A1Q A;  1V5T A;  1WYW B;  3I3T B;  4WJQ A;  2KZR A;  3MJW A;  4KSK C;  5LXI B;  4HPL B;  4BKS D;  3PLV A;  3ZUN A;  4ZYN A;  2YLM A;  2XK5 B;  3JW0 X;  2C9W B;  3NY5 A;  4GMV A;  3QK0 A;  4GDL A;  5GMV A;  3OJ4 B;  3PTF C;  2GOW A;  3W1Y A;  4B95 A;  3UIO B;  5D2M B;  5KHO A;  4GDK B;  3DBL I;  3EC8 A;  2ZPY A;  2REX A;  3H7S A;  2CS4 A;  2MP2 A;  4WWP A;  4ANU A;  3H1U A;  3PHW B;  2N7D A;  3DBS A;  1UGM A;  3ML9 A;  1Q0W B;  4IW0 A;  4K7S A;  5DCN A;  3SHQ A;  5C1Z A;  3PT2 B;  2O2V A;  1YJ1 A;  3H9D A;  2LXC A;  3PHX B;  3QQ8 B;  2ASQ A;  1S3S G;  3RT3 B;  4A20 A;  1V86 A;  2GBK A;  1Q1O A;  4JL9 A;  3VDZ A;  1J0G A;  1F9J A;  1WY8 A;  5JH5 C;  4BBN C;  4DK5 A;  2KAN A;  3WAN A;  3DCG A;  4OVV A;  3L10 B;  3K9O B;  3VTU A;  3ZRF A;  4EEW A;  3ZDT A;  2LVP A;  2RD0 A;  2PE9 A;  4EOY A;  1YIW A;  2BKF A;  4DBG A;  2A4Z A;  2WX0 A;  4DHJ D;  5D6J B;  1WMH B;  2BWE S;  2L3Z A;  4MGK E;  3ZTC A;  5J18 A;  3MHS D;  4MGI E;  2CHZ A;  2KFK A;  2N7E A;  1G6J A;  2PPH A;  3LDZ E;  3HM3 A;  2R2O A;  2C7H A;  4W9K A;  3V62 A;  3T8M A;  3A9K A;  4CO7 A;  5AZF A;  3K9P B;  5L95 C;  2KK8 A;  3NS8 A;  2M0X A;  4AP4 C;  3D32 A;  4GSW A;  2JXX A;  3EHV A;  3QIJ A;  1P0R A;  1WGD A;  1ZW7 A;  2DEN B;  2PE6 B;  2ZVO A;  3JSV B;  2BPS A;  4HDQ A;  2FIF A;  3UGB B;  1LXD A;  2NPT A;  4XC2 A;  4GXB A;  1YQB A;  2DZK A;  3L16 A;  3PV1 A;  3WIM A;  2CR5 A;  1FXT B;  1ISN A;  2DYO A;  2ZCB A;  3NOB A;  2XBB C;  4I6N B;  3ZNI D;  4F7Z A;  1ZKH A;  3QC8 B;  4G0N B;  2Z0E B;  2K6Q A;  2L00 B;  1XD3 B;  2W9N A;  3AUL A;  2UYZ B;  3H7P A;  1IP9 A;  2KLC A;  1KJT A;  2XK5 A;  4HDO A;  2GMI C;  4HCN B;  2XEW A;  3VAW A;  4G50 A; 
#chains in the Genus database with same CATH topology
 2KYW A;  3RNF C;  3PLU A;  1JAL A;  1I4Q A;  3RCZ A;  1MHX A;  1JRP A;  3A9J B;  3W1S C;  3HHM A;  3QJZ A;  4S0R A;  3ZVV A;  2RPQ A;  3B0A A;  4B6W A;  1IYF A;  1F0Z A;  1Z5S B;  2KWU B;  2LRW A;  4OZB A;  1E8Z A;  1N6Z A;  2D2Q A;  1LQB A;  3Q8C A;  3RPF C;  4AWJ A;  3APC A;  2BYF A;  1JWB D;  4XDD A;  3B9J A;  4MT5 A;  4GLS C;  1RLF A;  1QT9 A;  2J0M A;  1V49 A;  2J0J A;  1WGH A;  3TBL D;  1YX5 B;  2IZV B;  2WU5 B;  4NJ7 A;  3A4R A;  1VLB A;  4M0W B;  3GB1 A;  4II3 B;  5DPS A;  2WYQ A;  4BAX A;  1DOI A;  2JPH A;  2M19 A;  3EGR A;  1LFD A;  1SGH A;  5KHQ A;  2B3A A;  2LFI A;  3CF6 E;  3W2D A;  2KN4 A;  2MA9 B;  4P6V F;  2LVQ A;  3VXW A;  2LGD A;  3ZLZ A;  4CYE A;  1B1Z A;  1LO5 D;  3NJT A;  3QAQ A;  4HJG E;  1WX8 A;  3NZU A;  4G3X B;  2K6D B;  3P63 A;  2DLB A;  4BFR A;  2LZ6 A;  2BBC A;  4J3O D;  1ENF A;  1J7C A;  1E8Y A;  2BGF A;  1VZ7 A;  2V0G A;  3TUO A;  4GB9 A;  4EZJ A;  3VFK A;  4L2Y A;  1PUT A;  1ZXH A;  1KLV A;  2KMA A;  2JF5 A;  2EKE C;  3EEC A;  3LJ3 A;  2KWC A;  2IYD B;  4AJY B;  3DHG C;  4A55 A;  5HI1 A;  1S1Q B;  3NVZ A;  1J7A A;  2K8C A;  3VRA B;  1TY2 A;  1FEH A;  3KUZ A;  3ZYY X;  4RF0 A;  1T6B X;  4A3P A;  2ZNV B;  4FJZ A;  5DPT A;  2KDE B;  3AU4 A;  3IT6 B;  2CKH B;  1NI3 A;  3JVZ X;  5J2R A;  1C3T A;  1GNU A;  2C7N B;  3SD5 A;  2DYB A;  5D3I B;  3TEY A;  4RNA A;  2KFK B;  2IJ0 A;  2IO1 B;  4ICU A;  2D10 A;  1WIA A;  1YMH E;  1NYQ A;  4KDI C;  4FLH A;  1SE4 A;  1UH6 A;  3P4P B;  2G4D B;  1WJU A;  2BS2 B;  1GC7 A;  2FUH B;  2NPT B;  1JWM D;  5HHD G;  1SE2 A;  2J7Q B;  3P42 A;  3MC0 B;  3P4Q B;  3IVF A;  3WAO A;  3URY A;  2KOX A;  1E10 A;  2PTL A;  4E3C A;  4ZDV A;  4W9L A;  4WJP A;  3P4R B;  2DZJ A;  4E71 A;  2CJO A;  3PZD A;  3SR6 A;  1GAQ B;  3OLM D;  4US8 A;  1UZX B;  3AE7 B;  4RH6 A;  2JWZ A;  2JZ3 B;  2XNA C;  2K9X A;  1D5Z C;  2PW9 A;  3NVY A;  2NTS A;  3AEA B;  3Q3N C;  2KO3 A;  3AEB B;  2WDT B;  2WXL A;  3MP9 A;  3AE6 B;  4BKG A;  3KQ4 A;  4GOC A;  2K22 A;  1FMA D;  2WXK A;  1UEL A;  3AM9 A;  4FBJ B;  3B2G A;  1XT9 B;  2MLB A;  4RM9 A;  2ZJD A;  5JHB A;  3GOE A;  1FM0 D;  1E90 A;  2DNF A;  3DPD A;  1RWS A;  1E5W A;  2GBR A;  3Q3F A;  2DBY A;  4N58 A;  4O1N A;  4ZHP A;  4IWP A;  4HPM B;  4WAF A;  4AS1 A;  1YQ3 B;  3N30 A;  1XLP A;  2K5P A;  3SDL C;  2IY1 B;  3W5V B;  2LGX A;  1QLB B;  2C5L C;  4W9F A;  1TZ1 A;  2IND C;  4WIP A;  5T8I A;  3ZKJ C;  3L08 A;  2N9L A;  2LGI A;  3P4S B;  3DVN V;  3X0W A;  1FXA A;  1V5O A;  1V9J A;  3BIN A;  2ZZP B;  3ALB A;  3UIP B;  1MG8 A;  1XCT L;  5FR3 A;  5H8Y E;  4GU2 A;  4KKI A;  1QKZ A;  3AB5 A;  3M95 A;  3TCA A;  1SB3 C;  3A4S C;  4LDT B;  4BKT A;  4TQ1 A;  1TTN A;  1E7V A;  3I5J C;  4YWG G;  2JRH A;  4R3D A;  3QA8 A;  3UQA A;  2IGD A;  2V9H A;  2HE7 A;  2OJW A;  1DOY A;  3BVG A;  2GLS A;  3BK2 A;  3R7R A;  1PFD A;  4HJK A;  1WJ4 A;  1PQS A;  2D3G A;  2W3R A;  3KW5 B;  2INC C;  3I3T B;  3MJW A;  2Z8L A;  4BKS D;  3ZJV A;  3ZUN A;  2XK5 B;  2OHF A;  3NY5 A;  4GMV A;  3KWV A;  5KHO A;  3DBL I;  3EC8 A;  2ZPY A;  3H7S A;  3SHQ A;  5DCN A;  3PT2 B;  1BXT A;  2O2V A;  1YJ1 A;  3PO0 A;  1S3S G;  1T0S C;  3RT3 B;  3V05 A;  1V86 A;  4XGA B;  3MFG A;  3VDZ A;  1J0G A;  1NEK B;  1SSN A;  4DK5 A;  2KAN A;  4JPS A;  3DCG A;  3L10 B;  3VTU A;  3ZRF A;  3NUH B;  3ZDT A;  3W5U B;  4EOY A;  2N9K A;  2A4Z A;  2WX0 A;  1TYG B;  3R8B A;  4MGK E;  3LXF A;  1G6J A;  1TS4 A;  2BB6 A;  2JYE A;  1T0Q C;  3V62 A;  3T8M A;  1WSP A;  1KTK A;  1UWX A;  5L95 C;  3NS8 A;  3QIJ A;  1ZW7 A;  4N6E B;  3JSV B;  2HJ1 A;  3L16 A;  3I57 A;  2DYO A;  4I6N B;  3QC8 B;  2FBW B;  1N61 A;  1J7B A;  4MM3 B;  3H7P A;  3DBH B;  1KJT A;  3I9V 1;  4C4V B;  2LMC A;  1VCB A;  4RM8 A;  2CU3 A;  2LXA A;  2UWQ A;  4AOF A;  3DWM A;  1WGR A;  2WDV B;  4TV3 A;  1XCQ L;  4IKG A;  4C7Z A;  2MH7 A;  2KVZ A;  2WXJ A;  4DHZ E;  2LEK A;  3EFU A;  1FCL A;  4NNJ B;  4PK1 A;  2AX5 A;  1JWA D;  5DPW A;  1M94 A;  2L32 A;  3Q3J A;  2LUE A;  2VRR B;  2K8B A;  1FRD A;  4KX6 B;  2K25 A;  1DGJ A;  3Q3O C;  3GE3 C;  1N5W A;  1L7Y A;  2DHZ A;  2YVC A;  1UBI A;  2IO2 B;  3A33 B;  2LUM A;  2HJ8 A;  3MHZ A;  3ZXV A;  2FID A;  4HCP B;  4HRO A;  4HKQ A;  3L13 A;  1WFY A;  2NS5 A;  3N3K B;  2N9P C;  2FCN A;  1N60 A;  1EM7 A;  1RRB A;  1C78 A;  2O6V D;  3BVM A;  2Y3A A;  1C4C A;  3KUC B;  3IBE A;  2BS4 B;  1ZE3 D;  2QJL A;  3ZGZ A;  3JYU A;  4KIK A;  2QCZ A;  3AH7 A;  1WI0 A;  2KTR B;  2I1K A;  5G55 A;  1OEY A;  5BYQ A;  2JYT A;  3AN1 A;  3L54 A;  2WXG A;  1TBE A;  3X23 A;  5IAA C;  3ZIM A;  2MHJ A;  3PSE B;  1WXQ A;  4MEM A;  2EMT A;  2LHE A;  3IHP C;  3NVV A;  4RCO A;  3P2B A;  4FJY A;  3QWZ B;  3B08 A;  5EDS A;  3U7D A;  4NQK E;  1WZ3 A;  1NYR A;  4HVB A;  1R4M I;  2FCS A;  1N5X A;  3A1Q B;  3RNE C;  1D5M C;  2HTH A;  2RPV A;  3GZN I;  1V1P A;  3GP7 A;  2AL6 A;  4DHJ B;  5AEK B;  5D94 A;  2EEL A;  1E7U A;  1WXM A;  2MJ3 A;  1FNV A;  2C7M B;  4YSZ B;  2EMS A;  4ARC A;  4GDK A;  5AZH A;  2MP2 B;  2WXI A;  1V81 A;  1EF1 A;  3Q8F A;  3AE2 B;  2MX2 A;  4EKU A;  2QSD A;  3Q8A A;  4DXG A;  2V3S A;  2L83 A;  1OQQ A;  4XZ4 A;  1ACC A;  2I1J A;  1WE7 A;  5IOI A;  1OTR B;  4LNI A;  3R66 C;  1WH3 A;  3IAM 1;  4AQ7 A;  5E6J A;  4FA6 A;  4TMA B;  1FNW A;  4C7Y A;  2Y5P A;  1NDD A;  4II2 B;  4DWF A;  4ZHO A;  1N62 A;  4OVZ A;  1WX9 A;  4NZL B;  1TKY A;  3MTN B;  4D2K A;  2WS3 B;  1M4V A;  3QHT A;  1J19 A;  3APF A;  2KMC A;  1YQ4 B;  1IGD A;  2AWT A;  4DXA B;  1V8C A;  3PGE A;  2NBU A;  1XQQ A;  1MG4 A;  4GIV A;  4RF1 A;  2NR2 A;  4TUU A;  3PPA A;  2D11 A;  4XWT A;  2KFJ A;  3DBH I;  4WQM A;  1GB4 A;  3M63 B;  1E9M A;  4C80 A;  2GBJ A;  1K8R B;  3LB8 C;  2NCN A;  1MPE A;  4NAM A;  1WGK A;  1TS2 A;  2OOB B;  1V80 A;  5BYR A;  1JRO A;  3AEF B;  3Q69 A;  3U30 A;  2ZPN A;  3DDC B;  5HKH A;  1SF0 A;  3V3X A;  4URK A;  1EO6 A;  3VVW B;  1TGZ B;  4L23 A;  3PRP B;  2LHD A;  2IY0 B;  2LJI A;  4DDI D;  4FJV B;  1R4N I;  4IM0 A;  1ZDV A;  2AEH A;  3OG5 A;  4FUL A;  4PS8 A;  3DBR I;  4W9H A;  2GBN A;  2W3S A;  4IWQ A;  4P1C C;  3RYT A;  1FFU A;  1D4B A;  4MSQ B;  1OEY J;  1SIF A;  2BW2 A;  1SBB B;  4KDL B;  2BVC A;  3NRZ A;  4P1B C;  3BVZ A;  3UQB A;  3T9L A;  4I6L B;  3ZO5 B;  2V1Y A;  4A3O A;  1MVK A;  2LI5 A;  2WWZ A;  2BT6 A;  1OQR A;  2GI9 A;  4W9J A;  3BII D;  1Q5W B;  1WGY A;  4GGQ A;  1YD8 U;  2JX5 A;  2L7R A;  2JZP A;  4MJS A;  1RFK A;  1SIJ A;  4YTP B;  2KX0 A;  2V4L A;  2KDF B;  2KJH B;  4PT5 A;  1P98 A;  3V6E B;  2QMT A;  1XLO A;  2HDE A;  1L6V A;  2INN E;  3BY4 B;  3RZW C;  1P7F A;  3CWI A;  4ZOH C;  2LGY A;  3AEC B;  1H8C A;  2AL3 A;  3C0R B;  5G5G A;  1VRA B;  2ZVN A;  4K7U A;  2JSV X;  3I63 C;  4YTM B;  3B2F A;  1HZ5 A;  2BYV E;  4NJC A;  4BKS A;  2PMV A;  4FHK A;  1JWS D;  4B0M A;  2JWU A;  3MC8 A;  2MQJ A;  4E74 A;  5HG2 A;  5MPO A;  5IO9 A;  2QEJ C;  4M8N A;  2NBV B;  1HTO A;  4UDU C;  1C9F A;  1R7S A;  2W54 A;  1A5R A;  1Q10 A;  1WXS A;  1STE A;  2JT4 B;  4W9C A;  1JW9 D;  4K81 A;  1IUE A;  2VH1 A;  3B1L X;  4M00 A;  2PEA A;  1MJD A;  5GXG B;  3ONS A;  5DPR A;  2KHW B;  5LLI A;  3H6N A;  5LNK 1;  2E6X A;  4C56 C;  1WYW B;  2IDY A;  5LXI B;  1GOZ A;  1MI0 A;  1HZ6 A;  4HPL B;  3PLV A;  4ZYN A;  2YLM A;  1EWC A;  2C9W B;  2MJD A;  3QK0 A;  4GDL A;  4IDI A;  1YJJ A;  1MFW A;  2REX A;  2WXP A;  1L0X B;  3Q2A C;  3PHW B;  1K53 A;  2N7D A;  3C19 A;  3DBS A;  4K7S A;  4QAY A;  2IGG A;  1KLG D;  3PHX B;  3QQ8 B;  2ASQ A;  2G9H D;  5FK9 C;  3OWE B;  2GBK A;  1Q1O A;  4MAC A;  5G5H A;  3NVW A;  1WY8 A;  5JH5 C;  4BBN C;  2L52 A;  2H89 B;  2WXN A;  3AEG B;  2RDG A;  2M0A A;  2RD0 A;  1YNT E;  1AWD A;  5D6J B;  2BWE S;  3ZTC A;  2L3Z A;  2N7E A;  1QOF A;  1YJI A;  2PPH A;  3MC9 A;  3LDZ E;  3HM3 A;  1TIF A;  1TKG A;  2C7H A;  4CO7 A;  1KLU D;  3A9K A;  3K9P B;  3D32 A;  2WLB A;  1YN4 A;  3EHV A;  1P0R A;  2AQ1 B;  3P1M A;  2DEN B;  2ZVO A;  3O13 A;  2FUG 1;  1GB1 A;  4GXB A;  1YQB A;  2DZK A;  2CR5 A;  2XBB C;  1HA5 A;  3ZNI D;  1D6E C;  1ZKH A;  2K6Q A;  2M56 B;  1XD3 B;  2WU2 B;  3AUL A;  1C76 A;  2XK5 A;  4HDO A;  3Q3M C;  2WGS A;  4S17 A;  4RGO S;  4KVG B;  1UGJ A;  1NI2 A;  4XE0 A;  2J42 A;  2CHX A;  4KZC A;  1FCC C;  3NHE B;  2IPK D;  4JQW C;  2KWD A;  2EKI A;  3HIZ A;  2LJ5 A;  2CJN A;  3AE1 B;  4KV2 A;  3ZRC A;  3ZDM C;  4ZRJ A;  2CHW A;  3VH3 B;  4X57 B;  2MWS B;  4BBN F;  2BYT A;  3IT4 B;  2PVO D;  1OQY A;  4MSM B;  4W9I A;  5IP4 D;  2SAK A;  4WH4 A;  4JGH B;  2O6V A;  1A70 A;  3AEE B;  4ANW A;  4MH0 E;  3CSF A;  1SE9 A;  3ZW3 A;  3KYC D;  5AZG A;  1DOX A;  3TIX A;  1F2R C;  2MBQ A;  1AN8 A;  4G11 A;  2WP9 B;  1HQR D;  3E9S A;  4LTU A;  1GJZ A;  3N1Z C;  4PYZ A;  2JZZ A;  2JXT A;  1E7P B;  1MHH E;  4ZYS A;  1E6E B;  3UI3 A;  2W82 A;  2G4S A;  4HPP A;  3PZ7 A;  4MGY E;  4ZRQ A;  4A90 A;  1LGR A;  5D3D A;  2LVO A;  2LD9 A;  5CTR C;  2N0S B;  4TSS A;  2OJR A;  3AV8 A;  2WXF A;  3TMP B;  4C4V A;  4LJP B;  4HK2 A;  3TJP A;  2WXH A;  3FKY A;  1IPG A;  3WAL A;  5BMI A;  4M02 A;  1XXG A;  3HM6 X;  2PJH A;  2KC1 A;  3SFD B;  1KF6 B;  2N9X A;  2L05 A;  2KDM A;  4NAW A;  4FN2 A;  1K52 A;  2W55 A;  4M8M A;  1I35 A;  3ML8 A;  4A8X C;  4LNK A;  2DZI A;  3ZNG C;  2J52 A;  4RFB A;  2MW5 A;  4WUR A;  1XLQ A;  4LJO B;  4K1R B;  2CU1 A;  1SE3 A;  3M62 B;  2JQR B;  2NBW B;  1HXY D;  1EUV B;  2IBI B;  3QX1 A;  1Z2M A;  3MJ5 A;  3DHH C;  1UWM A;  2K8H A;  2M8S A;  5C3J B;  2JY6 A;  3VTV A;  1QOB A;  1L4Z B;  3PVL A;  2ZEQ A;  5BO4 B;  4RGT A;  2Q5W D;  2I38 A;  1T5X D;  4C00 A;  2PIA A;  4A9A A;  3QCA A;  1KOT A;  1ET6 A;  2B76 B;  4LDT D;  2V3N A;  3OJ3 A;  3DQV A;  4OZA A;  4XWW A;  2JVC A;  4EUT A;  2MSE D;  1EWY C;  2IO3 B;  4WJN A;  3KYD D;  3ZJU A;  2ZW0 A;  2DX5 B;  1ZP0 B;  1BT0 A;  1C77 A;  3R2I A;  5J17 A;  2MEK A;  3KWL A;  4RGM A;  2RMM A;  2L8J A;  2D07 B;  4LK0 M;  4A6Q A;  4PS7 A;  4CHK A;  1WMH A;  1WE6 A;  2KDB A;  3RNG C;  4NQL B;  4DDG D;  2YEP F;  5JZE B;  5CHV C;  3RD2 A;  1AAR A;  2WXQ A;  4LCD E;  3CMM B;  4MDK E;  1DYQ A;  1XO3 A;  1GPX A;  1AW7 A;  3NZ3 A;  3VUW A;  3ZNH B;  4ANV A;  2Y5C A;  1IBX B;  1P9D U;  1VR9 A;  1FD6 A;  2RSU A;  4JX1 C;  1WF9 A;  4ZRI A;  2KLG A;  1I4H A;  2A5U A;  1I4P A;  3H7P B;  1RAX A;  4KGR A;  4XX5 A;  3Q14 C;  1YOV B;  1VZ8 A;  3RNB C;  3VQI A;  1WRD B;  3V60 A;  4ARI A;  1JQ4 A;  1VD2 A;  3RI7 C;  3R3M A;  2L0T A;  1B9R A;  2QC8 A;  2M4N A;  3A9J A;  4ASW C;  1V6E A;  4P7I A;  3GE8 C;  2ICI A;  2L1A A;  4W9E A;  1U4A A;  5JXV A;  4M01 A;  2GBM A;  1C1Y B;  3BYT B;  2KQS A;  5H92 C;  1TS3 A;  4RGN A;  5E6N A;  2RR9 A;  4B0E A;  1WR1 A;  2DYM A;  4NY0 A;  3WCQ A;  1V97 A;  1T0R C;  1P1A A;  3BZD B;  1I4R A;  4OW0 A;  3SFE B;  4YSX B;  2KVR A;  2KQ4 X;  4LNO A;  1WRI A;  4M0W A;  4NPN A;  1X1M A;  2FCM A;  3HRD D;  1YN5 A;  3RUI B;  3O65 B;  5CHW A;  2KTF A;  4NJ6 A;  1ZGU B;  2R2Q A;  4N9F 4;  1TJE A;  4KGT A;  3VRB B;  2BF8 B;  3HVZ A;  3APD A;  1J8C A;  1PGX A;  1EF5 A;  2J0K A;  3U2S C;  3UIN B;  3U4E G;  2MBE A;  5G2N A;  3CIR B;  4KIK B;  1ZPS A;  3VH4 B;  4K7W A;  4CQN A;  4AUQ C;  2LAS A;  2NVU I;  5L83 A;  2KWV B;  1QOG A;  2N4F A;  4MGZ E;  4WAA A;  2FE8 A;  5JHA A;  1XLN A;  2WDR B;  3DVG Y;  1WJ6 A;  3N1Y C;  2G1E A;  3J9C A;  3KUD B;  1CZP A;  2DWQ A;  4XDC A;  2L76 A;  2Z0D B;  5FR6 A;  4IC7 B;  2KD0 A;  1RFA A;  3S2A A;  5BMH A;  5E6P A;  2X38 A;  3L17 A;  3AU5 A;  2WX1 A;  1HE8 A;  1HEZ E;  1SJH D;  5LXH A;  4W9D A;  3FIL B;  1ZDX A;  1P7E A;  1I4X A;  3KH0 A;  3OAW A;  2KNB A;  1HTQ A;  1V5T A;  1V1P B;  4KSK C;  2J53 A;  2WXM A;  2WXO A;  2QDF A;  3Q6B A;  3PTF C;  5BMG A;  2WNM A;  3W1Y A;  3UIO B;  5EE1 A;  2PLP A;  3TEZ A;  4GDK B;  3Q8E A;  1QQR A;  4ANU A;  4JWS C;  4BZA A;  3ML9 A;  1Q0W B;  4IW0 A;  5C1Z A;  3PZ8 A;  4ZRP A;  3H9D A;  2LXC A;  1JWU D;  2BQQ A;  4JL9 A;  1F9J A;  3ABV B;  1CQV A;  4USA A;  3WAN A;  2K3U A;  2BB5 A;  4OVV A;  1IGC A;  4HEA 1;  2LVP A;  1KH0 A;  2INP E;  2SEB D;  4DBG A;  4DHJ D;  3AE5 B;  1ZXI A;  4P16 A;  3MHS D;  4MGI E;  2VZK B;  2KFK A;  2KAC A;  5IN7 A;  2R2O A;  3GS2 A;  3U7Z A;  1N63 A;  4W9K A;  5AZF A;  1V1O A;  4AP4 C;  3DHI C;  4GSW A;  2JXX A;  4LLG M;  4N59 A;  1WGD A;  1SXT A;  2PE6 B;  3UGB B;  3KLS X;  1LXD A;  2NPT A;  4XC2 A;  3WIM A;  5AUI A;  3N9Y C;  1FXT B;  1ISN A;  3NOB A;  2ZCB A;  3HUI A;  2V3P A;  4F7Z A;  3N1X C;  3RNC C;  4G0N B;  2OED A;  2Z0E B;  2UU7 A;  2W9N A;  3VR9 B;  2UYZ B;  1IP9 A;  2HTM E;  2KLC A;  4LNF A;  4ACF A;  5TSS A;  2GMI C;  4WWM A;  4G50 A;  1JML A;  3AXC A;  4TKN A;  3ZXR A;  4ICV A;  4BVU C;  3QAR A;  2WQY B;  2ON8 A;  4PS3 A;  2C60 A;  2WDQ B;  3DBL B;  2I2Y A;  4HWI B;  1TZO A;  4KZ0 A;  5IKC M;  3V61 A;  4AJW A;  3H8H A;  1Y8R C;  4IM3 A;  4FHJ A;  3VTW A;  3ZNZ B;  1YX6 B;  2AYO B;  2KJ6 A;  3T3O A;  1WX7 A;  3VHT C;  3EA6 A;  3RNA C;  3IXS A;  4KGS A;  2RDB C;  2M17 A;  1CJE A;  3RFZ B;  4PYU A;  3PRZ A;  4TQ0 A;  4IM2 A;  4OHJ A;  4BOS C;  3PRM B;  3ZQ4 A;  3SU8 X;  1F52 A;  4EE2 A;  1WYG A;  1T0Y A;  4JLC A;  3RUL A;  4MJS B;  2IGH A;  3R7Q A;  1PGA A;  1OGW A;  2BS3 B;  4J6I A;  4RMA A;  3TSS A;  2Z59 B;  2ZW1 A;  2XN9 C;  2K1F A;  2VZK D;  4JE3 B;  4YT0 B;  2IO0 B;  4F1S A;  1QZE A;  1C4A A;  2AQ2 B;  1JCK B;  4WWN A;  3WAM A;  4HLE A;  1H4R A;  3DWG C;  4EFO A;  2RDH A;  1P3Q U;  4HRS A;  4KSL C;  2QHO A;  1NBF C;  3CST A;  3VUX A;  2WXR A;  2L0F A;  2D3C A;  2H88 B;  1LM8 B;  1BUI C;  3VUY A;  1TY0 A;  5D7G A;  2MBO A;  3HK0 A;  2YEP B;  1D3Z A;  4IWO A;  1L2N A;  4W9G A;  1CK1 A;  1ZOY B;  3T3N A;  2D3A A;  2QIE B;  3DVN U;  2ACZ B;  1T3Q A;  1WWT A;  2Y5B B;  1FPY A;  1WXV A;  3AI5 A;  4ZRK A;  1L0Y B;  2G45 B;  1RM6 C;  1KFY B;  3DVG X;  2DZM A;  4EZK A;  4MEL A;  4GDL B;  4FAD A;  2R61 A;  2BKR B;  1OFF A;  2ZNV C;  3L0W B;  3AE3 B;  4YXD B;  1I42 A;  4REZ A;  5CX3 A;  2GB1 A;  1QF6 A;  1WGG A;  4IUM B;  1TT5 B;  1FXI A;  3ECI A;  5CHF A;  4I6P A;  3U52 E;  1TKE A;  4DXF A;  2AQ3 B;  1NVI D;  2D5G A;  3EFC A;  2MRP A;  4WWO A;  2KQ7 A;  2KX3 A;  5BYS A;  4WQO B;  1XEE A;  1WXA A;  3L4P A;  2NTT A;  2MCN B;  3AE8 B;  1E0Z A;  2LWP A;  1TS5 A;  2LGS A;  3W9C B;  3PS6 A;  3AMZ A;  1ET9 A;  1ZUD 2;  3BWU D;  3C8Y A;  2HD5 B;  1FIQ A;  1XF5 L;  2FAZ A;  4JIO U;  2VH2 A;  4GN1 A;  5EE0 A;  4LNN A;  3TL5 A;  3A9K B;  4DHZ B;  1K51 A;  2M1M A;  1CMX B;  3LYY A;  1I4G A;  2DAJ A;  4B9K A;  2LRU A;  3N20 C;  4DQO C;  3V6C B;  1GC6 A;  2MBH A;  3FC4 A;  5IA7 A;  3JSV A;  2V4I B;  1K50 A;  3AED B;  5TR5 A;  2RGF A;  3NZS A;  3RZF A;  1I7H A;  2N9E B;  1C4P A;  1UUP A;  2JU6 X;  2KXJ A;  4MM3 A;  2BWF A;  3IFW B;  4ITK A;  1R4M B;  5EE3 A;  1FRR A;  1RYJ A;  3GZN B;  4XYC A;  4Q2J A;  2N1W A;  3PRE A;  1GUA B;  1SEB D;  3IG3 A;  4K3C A;  4ANX A;  2KC2 A;  3EUB 2;  1WR6 E;  1FFV A;  4F8C B;  5I4D A;  2X8X X;  3Q8B A;  2BTE A;  1AYF A;  3ZJT A;  2KJR A;  2KMM A;  3ZTD A;  3SEB A;  1PGB A;  3W1S A;  1ESF A;  4IG7 B;  1JRU A;  5E6O A;  1L4D B;  2N7J A;  2O6V B;  2KKC A;  3AE9 B;  1GG3 A;  4OVU A;  3NG0 A;  3KVF B;  4US9 A;  4KKJ A;  3N32 A;  5FKA C;  4YL8 A;  2BYE A;  2KDI A;  1QIL A;  1YN3 A;  1UBQ A;  2DAF A;  2D3B A;  1F77 A;  2ZCC A;  1F2R I;  4YSY B;  1EU3 A;  1VJK A;  1IBX A;  1UF0 A;  2J4X A;  1Y56 A;  4K3B A;  2WHI A;  1E8W A;  2O2V B;  3WA0 A;  2ONQ A;  4L1B A;  2PVG C;  1WM3 A;  2N1V A;  4YTN B;  1WM2 A;  1NEN B;  2G3Q B;  1L6U A;  1QOA A;  4WJO A;  3RN9 C;  1UD7 A;  1VDV A;  3ETR A;  2K0P A;  2KTR A;  1VZ6 A;  4NAW B;  4BOZ B;  2FCQ A;  2MBB B;  2MJE A;  4HKZ E;  3ENE A;  1KM7 A;  1L0V B;  2PKO A;  4EZL A;  4JWU C;  3DOW A;  3M3J A;  4HXD A;  1WJN A;  1FNU A;  3BYY B;  2JUO A;  1R4N B;  2K39 A;  1E8X A;  2JRI B;  1UNS A;  2KAJ A;  2FNJ B;  1WZ0 A;  2KN5 A;  3WAP A;  3U8Z A;  3DBR B;  1V2Y A;  4FXC A;  5C23 A;  3UF8 A;  1ROE A;  4MH8 A;  3A1Q A;  4WJQ A;  2NMQ A;  2KZR A;  5HFY A;  5C2T B;  1C79 A;  3JW0 X;  5EE9 A;  5GMV A;  3OJ4 B;  2GOW A;  3IAS 1;  4B95 A;  5D2M B;  1BML C;  2CS4 A;  2MP2 A;  3NS1 A;  4WWP A;  3H1U A;  1UGM A;  1EU4 A;  4H2A A;  3RMK C;  4A20 A;  3BK1 A;  1L5P A;  3K9O B;  1F1H A;  4EEW A;  5AUK A;  2PE9 A;  1YIW A;  2BKF A;  3FAH A;  1PYW D;  1WMH B;  5J18 A;  2CHZ A;  1FO4 A;  3R2T A;  3TEW A;  3AE4 B;  2QIL A;  2TSS A;  1SJE D;  2KK8 A;  1D5X C;  2M0X A;  1KRH A;  3VR8 B;  2GRI A;  2BPS A;  4HDQ A;  2FIF A;  2E3T A;  4IOI E;  3FIL A;  3PV1 A;  4OZC A;  3E56 A;  3TEX A;  3HVD A;  2L00 B;  2KT7 A;  4HCN B;  2XEW A;  1PDX A;  3VAW A; 
#chains in the Genus database with same CATH homology
 1VCB A;  4RM8 A;  4KVG B;  1NI2 A;  3AXC A;  4TKN A;  3PLU A;  4ICV A;  4BVU C;  2CHX A;  2LXA A;  3QAR A;  4KZC A;  4PS3 A;  3NHE B;  2UWQ A;  3RCZ A;  2C60 A;  4AOF A;  3A9J B;  3W1S C;  4HWI B;  4JQW C;  3HHM A;  1WGR A;  3HIZ A;  3QJZ A;  2LJ5 A;  4KZ0 A;  4TV3 A;  3V61 A;  4KV2 A;  4AJW A;  3ZRC A;  4DHZ E;  1Y8R C;  4IM3 A;  4FHJ A;  3ZDM C;  4ZRJ A;  2CHW A;  3ZVV A;  3EFU A;  2RPQ A;  4X57 B;  3VH3 B;  3B0A A;  3VTW A;  3ZNZ B;  4B6W A;  2MWS B;  1IYF A;  4BBN F;  1Z5S B;  4NNJ B;  1YX6 B;  2AYO B;  2KWU B;  2LRW A;  1OQY A;  2KJ6 A;  5DPW A;  4MSM B;  1M94 A;  4W9I A;  1WX7 A;  3Q3J A;  1E8Z A;  2D2Q A;  2LUE A;  3VHT C;  1LQB A;  2VRR B;  2K8B A;  4JGH B;  2O6V A;  2K25 A;  2M17 A;  4AWJ A;  4PYU A;  4ANW A;  4MH0 E;  1L7Y A;  3APC A;  2DHZ A;  3PRZ A;  4TQ0 A;  2YVC A;  1SE9 A;  1UBI A;  2BYF A;  3CSF A;  4IM2 A;  2IO2 B;  3ZW3 A;  3A33 B;  2HJ8 A;  3KYC D;  5AZG A;  1RLF A;  2J0M A;  1V49 A;  3TIX A;  2FID A;  2J0J A;  2MBQ A;  1WGH A;  3TBL D;  4HCP B;  4BOS C;  1YX5 B;  2IZV B;  4G11 A;  4NJ7 A;  3PRM B;  3A4R A;  3SU8 X;  4M0W B;  1T0Y A;  4II3 B;  5DPS A;  1GJZ A;  3L13 A;  2WYQ A;  4JLC A;  4PYZ A;  2JZZ A;  1WFY A;  2NS5 A;  3RUL A;  4MJS B;  2JPH A;  3R7Q A;  3N3K B;  2N9P C;  2FCN A;  1OGW A;  1LFD A;  1SGH A;  2G4S A;  4J6I A;  4MGY E;  2B3A A;  3CF6 E;  4RMA A;  2Z59 B;  5KHQ A;  1RRB A;  2O6V D;  2LVO A;  2LD9 A;  5CTR C;  2K1F A;  3IBE A;  3KUC B;  2OJR A;  3TMP B;  4LJP B;  4HK2 A;  2MA9 B;  3TJP A;  3JYU A;  1IPG A;  4KIK A;  3WAL A;  2LVQ A;  3VXW A;  2IO0 B;  4F1S A;  3HM6 X;  2LGD A;  3ZLZ A;  2PJH A;  4CYE A;  1WI0 A;  2KC1 A;  2KTR B;  1QZE A;  2I1K A;  2N9X A;  2L05 A;  4WWN A;  5G55 A;  4NAW A;  4FN2 A;  1OEY A;  3QAQ A;  3WAM A;  1WX8 A;  4M8M A;  4HLE A;  3ML8 A;  1H4R A;  1I35 A;  3NZU A;  3L54 A;  4EFO A;  4G3X B;  2DZI A;  2K6D B;  3ZNG C;  1TBE A;  1P3Q U;  3X23 A;  4BFR A;  4KSL C;  2QHO A;  1NBF C;  3CST A;  2LZ6 A;  2MW5 A;  5IAA C;  3VUX A;  4LJO B;  4K1R B;  3ZIM A;  2CU1 A;  3PSE B;  4MEM A;  2L0F A;  2EMT A;  1E8Y A;  1LM8 B;  2BGF A;  3M62 B;  2NBW B;  3VUY A;  1EUV B;  4GB9 A;  5D7G A;  4EZJ A;  2IBI B;  3QX1 A;  2MBO A;  1Z2M A;  3IHP C;  3HK0 A;  1D3Z A;  3VFK A;  4IWO A;  1L2N A;  3P2B A;  4FJY A;  2K8H A;  4W9G A;  3QWZ B;  1KLV A;  3B08 A;  2M8S A;  2KMA A;  2JF5 A;  5EDS A;  2JY6 A;  3VTV A;  2EKE C;  3EEC A;  3DVN U;  3LJ3 A;  3U7D A;  4NQK E;  1WZ3 A;  3PVL A;  2ZEQ A;  5BO4 B;  4HVB A;  2KWC A;  1R4M I;  2FCS A;  2Y5B B;  3A1Q B;  2IYD B;  1WXV A;  3AI5 A;  3QCA A;  4AJY B;  4ZRK A;  1KOT A;  2G45 B;  2HTH A;  3GZN I;  3DVG X;  4LDT D;  2AL6 A;  4DHJ B;  2DZM A;  1S1Q B;  5D94 A;  4EZK A;  4MEL A;  4GDL B;  5AEK B;  3OJ3 A;  1E7U A;  1WXM A;  4FAD A;  3DQV A;  2C7M B;  2BKR B;  2EMS A;  2ZNV C;  2K8C A;  4GDK A;  5AZH A;  2MP2 B;  3L0W B;  1I42 A;  5CX3 A;  1V81 A;  1EF1 A;  2JVC A;  1WGG A;  3KUZ A;  4IUM B;  4EUT A;  2MSE D;  2MX2 A;  4A3P A;  3ECI A;  5CHF A;  4EKU A;  2ZNV B;  4FJZ A;  2IO3 B;  4I6P A;  5DPT A;  2KDE B;  2V3S A;  3KYD D;  4WJN A;  4XZ4 A;  3AU4 A;  4WWO A;  2MRP A;  2CKH B;  2KQ7 A;  2DX5 B;  2KX3 A;  3JVZ X;  1BT0 A;  4WQO B;  2I1J A;  1WE7 A;  1WXA A;  5J2R A;  1C3T A;  1OTR B;  2MCN B;  2LWP A;  5J17 A;  1GNU A;  3R66 C;  1WH3 A;  2C7N B;  3PS6 A;  2L8J A;  3SD5 A;  2DYB A;  2D07 B;  4PS7 A;  4FA6 A;  4CHK A;  1WMH A;  2HD5 B;  2KFK B;  1WE6 A;  2KDB A;  2FAZ A;  4JIO U;  2IO1 B;  4GN1 A;  4ICU A;  4NQL B;  4DDG D;  5JZE B;  2D10 A;  1NDD A;  4II2 B;  1WIA A;  5CHV C;  3RD2 A;  3TL5 A;  1AAR A;  4DWF A;  3A9K B;  4DHZ B;  1WX9 A;  4LCD E;  3CMM B;  4MDK E;  4KDI C;  3MTN B;  4FLH A;  3QHT A;  1J19 A;  3APF A;  1UH6 A;  2M1M A;  2KMC A;  1CMX B;  4B9K A;  2DAJ A;  3VUW A;  2AWT A;  2G4D B;  2LRU A;  4DXA B;  3ZNH B;  4ANV A;  1WJU A;  3V6C B;  1GC6 A;  3PGE A;  2MBH A;  2NBU A;  1GC7 A;  5IA7 A;  1XQQ A;  2FUH B;  2NPT B;  3JSV A;  4GIV A;  2NR2 A;  4TUU A;  1P9D U;  2J7Q B;  3PPA A;  2D11 A;  3IVF A;  5TR5 A;  2KFJ A;  2RSU A;  1WF9 A;  2RGF A;  3NZS A;  4ZRI A;  3RZF A;  3DBH I;  2KLG A;  3WAO A;  2KOX A;  2A5U A;  2N9E B;  2KXJ A;  3H7P B;  3M63 B;  4E3C A;  4MM3 A;  4W9L A;  2BWF A;  1RAX A;  3IFW B;  4ZDV A;  4XX5 A;  2GBJ A;  4WJP A;  1K8R B;  2DZJ A;  4E71 A;  2NCN A;  3VQI A;  3PZD A;  1WRD B;  3V60 A;  3OLM D;  1UZX B;  2JWZ A;  2N1W A;  3PRE A;  2JZ3 B;  2OOB B;  1GUA B;  1VD2 A;  1V80 A;  3IG3 A;  4ANX A;  2KC2 A;  2L0T A;  3R3M A;  3U30 A;  2ZPN A;  3DDC B;  5HKH A;  1WR6 E;  4F8C B;  2KO3 A;  4URK A;  2M4N A;  3A9J A;  1EO6 A;  2WDT B;  4ASW C;  1V6E A;  4P7I A;  3VVW B;  1TGZ B;  3PRP B;  2KJR A;  2IY0 B;  4W9E A;  4DDI D;  4FJV B;  4BKG A;  1U4A A;  3ZTD A;  1R4N I;  4IM0 A;  4GOC A;  3W1S A;  1UEL A;  4FBJ B;  2GBM A;  1C1Y B;  1JRU A;  2AEH A;  2KQS A;  1XT9 B;  4IG7 B;  5E6N A;  5E6O A;  2RR9 A;  2MLB A;  4FUL A;  4PS8 A;  4RM9 A;  1WR1 A;  2DYM A;  3DBR I;  4NY0 A;  2ZJD A;  4W9H A;  2O6V B;  2KKC A;  5JHB A;  2GBN A;  1GG3 A;  3GOE A;  4IWQ A;  4OVU A;  1E90 A;  3RYT A;  3DPD A;  3KVF B;  4MSQ B;  1OEY J;  1SIF A;  1E5W A;  2GBR A;  1P1A A;  3N32 A;  3Q3F A;  4KDL B;  4YL8 A;  2BYE A;  2KDI A;  4IWP A;  4HPM B;  3UQB A;  1UBQ A;  4I6L B;  3T9L A;  3ZO5 B;  2DAF A;  2V1Y A;  3N30 A;  4A3O A;  2KVR A;  2LI5 A;  2ZCC A;  2WWZ A;  4W9J A;  3SDL C;  2IY1 B;  4NPN A;  1X1M A;  2FCM A;  1Q5W B;  1WGY A;  2LGX A;  4GGQ A;  2C5L C;  1YD8 U;  3RUI B;  4W9F A;  3O65 B;  5CHW A;  1TZ1 A;  2L7R A;  4MJS A;  2KTF A;  4NJ6 A;  1ZGU B;  2R2Q A;  4N9F 4;  3ZKJ C;  2KX0 A;  2V4L A;  3L08 A;  2KDF B;  1E8W A;  2O2V B;  2KJH B;  2BF8 B;  1P98 A;  3V6E B;  3WA0 A;  3APD A;  3DVN V;  1V5O A;  3X0W A;  1J8C A;  1V9J A;  3BIN A;  2ZZP B;  1WM3 A;  2N1V A;  3ALB A;  1EF5 A;  2J0K A;  1WM2 A;  3BY4 B;  3UIN B;  3UIP B;  2MBE A;  5G2N A;  4KIK B;  3RZW C;  1MG8 A;  2G3Q B;  3VH4 B;  4WJO A;  4GU2 A;  1UD7 A;  2LGY A;  4K7W A;  1H8C A;  4AUQ C;  2LAS A;  2AL3 A;  3C0R B;  2NVU I;  2KTR A;  2ZVN A;  4NAW B;  2KWV B;  4K7U A;  5L83 A;  4BOZ B;  2FCQ A;  3M95 A;  3TCA A;  2BYV E;  2N4F A;  3A4S C;  2MBB B;  4LDT B;  4BKT A;  4BKS A;  4MGZ E;  3ENE A;  4WAA A;  4TQ1 A;  4FHK A;  1KM7 A;  1TTN A;  5JHA A;  1E7V A;  2JRH A;  3QA8 A;  3DVG Y;  1WJ6 A;  4EZL A;  2MQJ A;  4E74 A;  3UQA A;  3KUD B;  3DOW A;  3M3J A;  2L76 A;  2Z0D B;  5FR6 A;  4IC7 B;  4HXD A;  2KD0 A;  4M8N A;  1RFA A;  1WJN A;  2NBV B;  2HE7 A;  3S2A A;  2JUO A;  5E6P A;  2WX1 A;  3AU5 A;  1HE8 A;  2K39 A;  3L17 A;  1E8X A;  2JRI B;  5LXH A;  1A5R A;  3R7R A;  2FNJ B;  4W9D A;  1WXS A;  4HJK A;  1WJ4 A;  1WZ0 A;  2JT4 B;  4W9C A;  2KN5 A;  3WAP A;  4K81 A;  3U8Z A;  3B1L X;  2PEA A;  1PQS A;  1V2Y A;  3ONS A;  3KH0 A;  5DPR A;  5C23 A;  3OAW A;  2KHW B;  2D3G A;  3UF8 A;  3KW5 B;  5LLI A;  3H6N A;  2KNB A;  3A1Q A;  1V5T A;  1WYW B;  3I3T B;  4WJQ A;  2KZR A;  3MJW A;  4KSK C;  5LXI B;  4HPL B;  4BKS D;  3PLV A;  3ZUN A;  4ZYN A;  2YLM A;  2XK5 B;  3JW0 X;  2C9W B;  3NY5 A;  4GMV A;  3QK0 A;  4GDL A;  5GMV A;  3OJ4 B;  3PTF C;  2GOW A;  3W1Y A;  4B95 A;  3UIO B;  5D2M B;  5KHO A;  4GDK B;  3DBL I;  3EC8 A;  2ZPY A;  2REX A;  3H7S A;  2CS4 A;  2MP2 A;  4WWP A;  4ANU A;  3H1U A;  3PHW B;  2N7D A;  3DBS A;  1UGM A;  3ML9 A;  1Q0W B;  4IW0 A;  4K7S A;  5DCN A;  3SHQ A;  5C1Z A;  3PT2 B;  2O2V A;  1YJ1 A;  3H9D A;  2LXC A;  3PHX B;  3QQ8 B;  2ASQ A;  1S3S G;  3RT3 B;  4A20 A;  1V86 A;  2GBK A;  1Q1O A;  4JL9 A;  3VDZ A;  1J0G A;  1F9J A;  1WY8 A;  5JH5 C;  4BBN C;  4DK5 A;  2KAN A;  3WAN A;  3DCG A;  4OVV A;  3L10 B;  3K9O B;  3VTU A;  3ZRF A;  4EEW A;  3ZDT A;  2LVP A;  2RD0 A;  2PE9 A;  4EOY A;  1YIW A;  2BKF A;  4DBG A;  2A4Z A;  2WX0 A;  4DHJ D;  5D6J B;  1WMH B;  2BWE S;  2L3Z A;  4MGK E;  3ZTC A;  5J18 A;  3MHS D;  4MGI E;  2CHZ A;  2KFK A;  2N7E A;  1G6J A;  2PPH A;  3LDZ E;  3HM3 A;  2R2O A;  2C7H A;  4W9K A;  3V62 A;  3T8M A;  3A9K A;  4CO7 A;  5AZF A;  3K9P B;  5L95 C;  2KK8 A;  3NS8 A;  2M0X A;  4AP4 C;  3D32 A;  4GSW A;  2JXX A;  3EHV A;  3QIJ A;  1P0R A;  1WGD A;  1ZW7 A;  2DEN B;  2PE6 B;  2ZVO A;  3JSV B;  2BPS A;  4HDQ A;  2FIF A;  3UGB B;  1LXD A;  2NPT A;  4XC2 A;  4GXB A;  1YQB A;  2DZK A;  3L16 A;  3PV1 A;  3WIM A;  2CR5 A;  1FXT B;  1ISN A;  2DYO A;  2ZCB A;  3NOB A;  2XBB C;  4I6N B;  3ZNI D;  4F7Z A;  1ZKH A;  3QC8 B;  4G0N B;  2Z0E B;  2K6Q A;  2L00 B;  1XD3 B;  2W9N A;  3AUL A;  2UYZ B;  3H7P A;  1IP9 A;  2KLC A;  1KJT A;  2XK5 A;  4HDO A;  2GMI C;  4HCN B;  2XEW A;  3VAW A;  4G50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...