4HJGE

Meditope-enabled trastuzumab
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
62
structure length
62
Chain Sequence
EVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYAALLAKVNGEYTADLEDGGNHMNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trastuzumab light chain
publication title Identification and grafting of a unique peptide-binding site in the Fab framework of monoclonal antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 17
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2012-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4hjgE00
2IGDA 2JWUA 1HEZE 4IOIE 1FD6A 4IKGA 2OEDA 5HFYA 1GB1A 3V3XA 3FILA 1PGXA 2RMMA 2GI9A 1K52A 2ON8A 1P7EA 1KH0A 1PGBA 2PW9A 4HKZE 4KGRA 2IGGA 1MHXA 4GLSC 4OZAA 4WH4A 1XCQL 2ONQA 1F2RC 5JXVA 1FCLA 2JSVX 2IGHA 1MPEA 3GB1A 1HZ5A 4MACA 4OZCA 2LGIA 2LUMA 2JZPA 2PLPA 1GB4A 1K50A 1F2RI 1UWXA 1C9FA 1YNTE 1MHHE 1IBXB 5BMIA 5HI1A 3FILB 2KACA 3MP9A 1K51A 1IGCA 1MI0A 5HHDG 2N9KA 5HG2A 1JMLA 2JU6X 2PTLA 1XF5L 2QMTA 2LHDA 2NMQA 1YMHE 1MVKA 5BMGA 1FCCC 2N7JA 4HJGE 5BMHA 4KGSA 1IGDA 2I2YA 2EELA 1HZ6A 1EM7A 2JXTA 2J53A 1D4BA 2KWDA 1P7FA 2ZW0A 1XCTL 2I38A 1ZXHA 1IBXA 2ZW1A 2J52A 1K53A 2KN4A 2RPVA 3UI3A 1PGAA 2GB1A 2QSDA 4OZBA 2K0PA 1QKZA 2KDMA 4KGTA 2N9LA 1Q10A 2KQ4X 4D2KA 2LHEA
chains in the Genus database with same CATH superfamily
1C79A 1WI0A 2SAKA 4AJYB 4GDKA 4WWOA 2HTME 2WXHA 4FHJA 1GPXA 1I4HA 1FNUA 2K39A 3U2SC 2BVCA 4W9JA 2KFKA 4II3B 1LQBA 1PYWD 2CHWA 1JWBD 3KUDB 2LGXA 4JWUC 3VAWA 4A9AA 1C77A 2AL3A 2D11A 3AECB 2IGGA 1MHXA 3QWZB 3PS6A 1D5XC 1XCQL 1OQQA 3RZWC 4ARIA 1YJ1A 4QAYA 4FJZA 2QDFA 2JSVX 2KTFA 2V3SA 1SIFA 1WH3A 1HZ5A 3DBHI 2EKIA 1E8ZA 3Q3OC 2WWZA 4KKJA 5FKAC 1QOAA 4DDGD 3PRZA 4OW0A 2G45B 3PT2B 2KWCA 2WU5B 2BWFA 2D3GA 1OQRA 5HHDG 5HKHA 3AB5A 5JHBA 1I4PA 4FJYA 4PYZA 1WFYA 4A3PA 1MFWA 2X38A 3ZRFA 2W3SA 4M8MA 4N6EB 1WJ6A 1N60A 3BWUD 2L3ZA 5AZFA 4B0MA 1TS2A 3NVZA 3MHSD 3L54A 2K6DB 3IAS1 1C4PA 4XX5A 1DYQA 2EMSA 4ZOHC 4BKTA 3LJ3A 3ZYYX 3MFGA 1WGHA 3JVZX 2WDQB 2J52A 2LXCA 2LEKA 1V86A 2RPVA 3QAQA 3UI3A 3FKYA 1L0YB 1P9DU 2RPQA 1OTRB 2K0PA 3CSFA 4KV2A 4K7UA 4C56C 3P2BA 1E10A 4KSLC 3N9YC 3R2IA 3ALBA 1FRRA 1S3SG 3W1SA 1WXSA 3DVGX 1TS5A 2K8BA 1WR6E 2K25A 4KIKB 3VH3B 5LXIB 4MDKE 4K7SA 3TUOA 1SIJA 1QOGA 1DOXA 2ZNVC 2I1KA 1E7UA 4DHJB 2WS3B 2DYBA 4YTPB 2KQ7A 4JL9A 4MSQB 2C60A 4ANXA 2G1EA 1JWAD 3LXFA 1JWSD 3R3MA 3VR8B 3J9CA 3ZNID 3GOEA 1N5WA 2DNFA 3E56A 1N6ZA 4H2AA 2LXAA 4K81A 4MACA 5I4DA 2KOXA 2PLPA 3UIOB 3UIPB 3ZDMC 1XLOA 2C7NB 4GDKB 5C23A 4DHJD 1EF5A 1OFFA 2RD0A 4N59A 1SGHA 1SE4A 1E9MA 1S1QB 2PTLA 4HROA 3QIJA 1KLVA 3HUIA 3ZNHB 1MVKA 4ZRKA 2L52A 2QHOA 1ENFA 1WXAA 1XCTL 2AQ3B 3RYTA 1UZXB 2ZCBA 2W3RA 1H4RA 3I3TB 3L4PA 3MC0B 1ZUD2 4BAXA 3ZGZA 3B2FA 2RDHA 2V4LA 2C9WB 4IWQA 1VD2A 4BBNC 1J19A 4KGTA 2J42A 4HKQA 2JWZA 4XDDA 1J0GA 2BB5A 1TZ1A 3NZUA 3CSTA 1WXVA 2BYFA 3WALA 1HTQA 3K9OB 2INDC 4ANVA 1FO4A 4FLHA 3BY4B 1PGBA 1LFDA 4HKZE 4ANWA 5E6OA 2G4DB 1FNWA 3AN1A 1Z2MA 4DDID 1TBEA 2LVOA 1KOTA 2AEHA 1TIFA 1GB4A 4W9LA 4DXFA 4W9GA 1F2RI 5EE0A 3VUWA 1J7BA 1WR1A 4KZCA 1ZPSA 3KWVA 3W2DA 4RGNA 4NJ6A 2INCC 5HI1A 4K7WA 2KMAA 5D94A 2KJHB 2MBHA 4O1NA 1UF0A 4ZHOA 2XN9C 5BMGA 3TEXA 3NY5A 3W9CB 1SE3A 2N7JA 1EUVB 4HJGE 4JWSC 4XC2A 2GLSA 4KVGB 2J53A 1GC6A 1WZ0A 2ZW1A 4CYEA 3W1YA 2HE7A 4WQMA 3S2AA 3L16A 3B2GA 2GB1A 2Z0DB 4RGOS 1IUEA 3R66C 2WXQA 3HVZA 3DBLB 1V1PA 2KDMA 4MM3A 4FADA 1TKYA 4DQOC 3PLUA 3RN9C 4N9F4 3RT3B 1N61A 1KLUD 3SU8X 2BT6A 2L1AA 1WYWB 1YQ4B 2QCZA 4TKNA 2JYTA 4MSMB 2IY0B 3X23A 1E8XA 1LXDA 3U30A 3RD2A 4C4VB 2KXJA 4FXCA 4BBNF 3ZTDA 2L0TA 3EFCA 2KKCA 2D3BA 3PZDA 1EWCA 3N20C 3NJTA 1XQQA 3M95A 2EKEC 4MH8A 2E6XA 3U7DA 1M4VA 1TS4A 3D32A 1QLBB 2IO1B 1K50A 1NVID 1GOZA 4KKIA 4LK0M 2JZZA 2L7RA 2K22A 2LGDA 3APDA 1I4RA 2WDTB 1WM3A 4HCPB 3H1UA 1GUAB 3RNBC 1ZKHA 5IN7A 1ET9A 3HRDD 3B0AA 3AE9B 4JE3B 5FR6A 4OHJA 5HG2A 3T3NA 2LFIA 1OEYJ 3ECIA 2J0MA 4NAWA 4IUMB 1YMHE 1KM7A 2KYWA 4G11A 3V6CB 3UQBA 1SBBB 3V6EB 1QQRA 1T3QA 4G0NB 3Q8BA 2JT4B 3GP7A 1C78A 1D4BA 3H6NA 2KD0A 4M8NA 1QT9A 2BYVE 2VH2A 1IBXA 1UBIA 3WAOA 2REXA 3H9DA 2G4SA 5G5HA 4WWPA 1VR9A 3Q6BA 1DGJA 3EGRA 2FCMA 2IO2B 2CS4A 2IGDA 1V81A 3C8YA 5D2MB 4B95A 2V3PA 4WIPA 1K8RB 4RNAA 2IPKD 2K8CA 3NS1A 2MA9B 1J7CA 4MH0E 4P6VF 5FK9C 2QIEB 5JHAA 3SR6A 1JRUA 1NDDA 3RNAC 3QX1A 2RDBC 1EU4A 5E6NA 4RGTA 3VFKA 1ZOYB 4FA6A 4GDLB 4YT0B 5D6JB 1V1PB 1TKEA 3PO0A 4GB9A 2LUMA 2NTTA 2Y5BB 2D5GA 4WJNA 2KTRB 3DBRB 1HA5A 3O65B 4WQOB 1L0XB 2D07B 4ZRIA 2VRRB 4GN1A 2FE8A 3AE6B 1KF6B 1E5WA 5DPTA 3PRPB 1CQVA 1VZ7A 3WA0A 1B9RA 4IM0A 2DBYA 1EU3A 2C7MB 3DVNU 3RPFC 2BQQA 1E0ZA 4GU2A 2CHXA 3ZXVA 4RH6A 3TIXA 4GXBA 3JSVA 5AUKA 2NVUI 3UF8A 1IPGA 1ESFA 2CU1A 3DVGY 1LGRA 3RZFA 4DHZE 4YXDB 2FCQA 1GG3A 2PVOD 2CU3A 2AX5A 2XK5B 4WWMA 2KAJA 1L5PA 4EZJA 3RMKC 2IDYA 2EMTA 2JZ3B 3AU4A 1J7AA 1KFYB 2O6VD 2HD5B 3L0WB 2CKHB 2M0XA 2NBWB 2W82A 2BS3B 4JIOU 1N5XA 1J8CA 4NAMA 4PS3A 3BK1A 3TCAA 3NOBA 4A90A 2IO3B 2K9XA 4ZYSA 2BKFA 4WWNA 1V5OA 4RM9A 3HM3A 3PZ8A 1YJIA 5T8IA 1YN3A 1RM6C 1RYJA 2V0GA 3DVNV 1F0ZA 4LNNA 3V61A 5KHOA 1WY8A 3L10B 4A6QA 3B9JA 3WAMA 3KVFB 1ZDVA 5IAAC 1V49A 4KDIC 2M0AA 4HPMB 3NUHB 2GMIC 3GE3C 3C19A 2WXKA 4MGIE 2OJWA 4GIVA 3RNFC 2GBKA 3A9KB 2DENB 1WXQA 2L83A 2SEBD 3SFDB 4DK5A 4DHZB 2V3NA 2BYEA 4NQLB 1KLGD 3RFZB 4HVBA 3PRMB 1AYFA 1XF5L 1WE7A 2NMQA 2C7HA 3DBRI 4LNFA 2BW2A 4CO7A 3V05A 2I2YA 3H7PA 3H7SA 1VRAB 1EM7A 1UNSA 2KFJA 1UWMA 1BUIC 2LUEA 4YTNB 1FEHA 2YEPF 2NS5A 3U7ZA 4OVZA 3I57A 2DAJA 2BF8B 2LWPA 4HWIB 3HHMA 4DWFA 4LTUA 4IWOA 3PLVA 1FM0D 2KO3A 2BYTA 3WANA 2KHWB 2KN5A 3JSVB 1C1YB 4IDIA 1WGKA 3TEWA 1GB1A 4PS8A 3V3XA 5CHFA 1Q5WB 2WXOA 2ON8A 1YQBA 2ZPNA 3VDZA 4MGZE 3AH7A 2GBMA 2XBBC 4ITKA 2KDBA 3Q3MC 2PW9A 3CIRB 4NPNA 4OZAA 3KWLA 3A9JB 4C00A 1AW7A 2Q5WD 2MSED 3EFUA 4IG7B 2L00B 4MT5A 1WWTA 1BT0A 2KJRA 1WJUA 2RDGA 5CTRC 2WXMA 4I6NB 1TT5B 2ZCCA 4HCNB 5IOIA 2LMCA 2AQ1B 3E9SA 2H88B 2BWES 1RLFA 2VZKB 4G50A 5CHWA 2PEAA 4PYUA 2LD9A 1UGMA 2GBJA 3W5VB 4GSWA 2I1JA 1OQYA 2GRIA 4YSXB 1IGDA 3QC8B 2ZW0A 3P42A 4LJOB 2KFKB 4J6IA 3SEBA 3MJWA 2KT7A 2R2OA 4RCOA 1C3TA 3IG3A 5D3DA 4W9FA 5CX3A 4FN2A 2M4NA 2M56B 2OOBB 3BK2A 2CR5A 3VTWA 4DXAB 3ZJTA 1TYGB 2DZIA 3H8HA 1IP9A 4RF0A 1FD6A 3H7PB 5HFYA 1V9JA 2M1MA 3VVWB 4YSYB 1JW9D 4A3OA 1OEYA 1K52A 2KNBA 4NNJB 5H92C 3TEYA 1JWMD 3APFA 2OJRA 4KGRA 2MBQA 4URKA 3W1SC 1F9JA 3R7QA 2JRIB 3FC4A 3IXSA 2J4XA 1L4ZB 4R3DA 2JZPA 4KSKC 2LJ5A 1STEA 2NPTA 3N32A 3SD5A 1V5TA 4NJCA 3OJ3A 4I6PA 1FFVA 4OVVA 2IO0B 4FBJB 1UGJA 4RFBA 1D5ZC 2FAZA 4OVUA 3OJ4B 2VH1A 3ZJUA 2NR2A 5BMHA 4KGSA 1BMLC 5TR5A 4E3CA 2O2VA 5GXGB 4AUQC 3Q8AA 3N1XC 1WGYA 3SDLC 1TY0A 3NVWA 2LRUA 2KQSA 3T9LA 4WAAA 2J0JA 2NTSA 2KC1A 4W9KA 2KDEB 2KQ4X 1RWSA 1WJNA 4BKSA 3QK0A 4ZYNA 2OEDA 3WAPA 3TEZA 2UU7A 1CZPA 2ACZB 2KX0A 4HDOA 2WDRB 1Q1OA 2D10A 1Y8RC 2QEJC 1KH0A 3ML9A 3VTUA 2JF5A 2XNAC 2ZVNA 3Q14C 1V1OA 1D6EC 2RR9A 4TV3A 4ICUA 4IC7B 1WE6A 3DHGC 4A20A 1GAQB 3T8MA 4BVUC 5EE1A 3UINB 4BKGA 4MGYE 4WURA 3AE8B 1FXAA 4W9CA 1TKGA 4GGQA 2KWUB 4ZRPA 1LO5D 1XLQA 3MP9A 1V8CA 2R2QA 2N9KA 2JU6X 2W55A 5L95C 2WDVB 1AN8A 1I7HA 4EE2A 3ZKJC 2WXNA 4FULA 5G2NA 3Q3FA 1HTOA 5FR3A 1VZ6A 2AL6A 2GOWA 2J7QB 3BVMA 4WAFA 5H8YE 2EELA 2KX3A 3QQ8B 1WYGA 5C2TB 1T0SC 3HM6X 1FXTB 3I5JC 3DWGC 2HJ1A 1YX5B 1SEBD 1D5MC 2I38A 4XGAB 1FXIA 1K53A 2DZJA 2KN4A 2LVPA 1FNVA 2FIFA 4XE0A 3VR9B 1ET6A 2JRHA 3PSEB 2N9LA 4TMAB 4HDQA 1AWDA 2MJDA 3MHZA 1WGDA 4LJPB 2MJEA 1L0VB 4IOIE 5C1ZA 2LGSA 1I35A 4ANUA 3AE5B 5D7GA 3AXCA 2O2VB 1FRDA 4DBGA 1RFAA 3PTFC 1UD7A 1WJ4A 5BYRA 3AM9A 3QJZA 1H8CA 1XD3B 3P4RB 3PZ7A 5JZEB 3V62A 3T3OA 3ZVVA 3EUB2 2LZ6A 1ZGUB 2IGHA 2PIAA 1P0RA 3GB1A 4HPPA 3U52E 4AJWA 2L0FA 2XEWA 3NZ3A 1QZEA 1PFDA 3VUYA 4P16A 1T0YA 2JPHA 5J2RA 1EO6A 2ZVOA 1YNTE 4A8XC 3ML8A 3FAHA 1AARA 3PHWB 3GS2A 1B1ZA 1TZOA 2MQJA 1VLBA 3ZLZA 3Q3JA 4HEA1 4HLEA 3NVYA 3AE3B 2PVGC 4MM3B 2DWQA 4PK1A 4TSSA 1V97A 3Q69A 4HJKA 1F77A 2JYEA 4L2YA 3KUZA 4PS7A 2PPHA 1WX9A 2UWQA 2JXTA 2FCSA 4K3BA 2N0SB 3BINA 5DPWA 1I4GA 4GOCA 1MG4A 4UDUC 1WZ3A 5AZHA 3IBEA 1ZE3D 3P1MA 3MC9A 4P1BC 3VTVA 4K1RB 4EKUA 4IM2A 2DLBA 3C0RB 1X1MA 2MLBA 3K9PB 2DZKA 1VCBA 1HEZE 2QJLA 4IKGA 5LXHA 2IY1B 1WSPA 3WCQA 2L8JA 4EZKA 4LNOA 2B3AA 1OGWA 4E71A 4M01A 1TY2A 3DBSA 4LNIA 4NAWB 3L13A 1JROA 4FJVB 3PHXB 2YLMA 3AV8A 2PE6B 4YWGG 3SHQA 2JQRB 4W9IA 2LGIA 4FHKA 3NHEB 4AOFA 1FFUA 3ZNZB 1T5XD 2YEPB 3BYTB 3BYYB 3M3JA 2X8XX 3OWEB 1XXGA 3IFWB 4LNKA 4KIKA 1IBXB 2LASA 1CK1A 5BMIA 1QOFA 3RNCC 4PT5A 1L7YA 2N9PC 4EEWA 4YL8A 5E6JA 1PUTA 4ZRQA 4JQWC 2Z0EB 3TMPB 3OAWA 1YD8U 3DQVA 3P63A 2WXFA 2AWTA 1HZ6A 2A5UA 3I63C 1P1AA 3A4SC 2WU2B 2ZEQA 1RRBA 4BOZB 3AEGB 1QILA 2E3TA 4TUUA 1ZXHA 2WX0A 2HTHA 2BS4B 2MRPA 3QHTA 4C7ZA 1WX7A 3LDZE 3DHHC 3AI5A 3ZRCA 2BS2B 4OZBA 5LLIA 1YQ3B 3M62B 1T0QC 3AMZA 3EC8A 2KMMA 2DAFA 2KDFB 1A5RA 3VUXA 2MEKA 2KWVB 1JWUD 4IWPA 5DPSA 2LJIA 2D3AA 4N58A 1RAXA 1ZP0B 3IAM1 1WIAA 1MG8A 2D2QA 4I6LB 3Q3NC 4ZRJA 2WXGA 1NENB 1FIQA 3IT6B 4ZDVA 1F2RC 2QILA 1FCLA 1SJHD 1I4XA 3RUIB 2ZJDA 1L6VA 4OZCA 5LNK1 4W9HA 5G55A 4C7YA 1L2NA 4AQ7A 3ONSA 5AZGA 3I9V1 2A4ZA 3AE7B 4L23A 2HDEA 3NZSA 3MC8A 3WIMA 1FMAD 1MI0A 3P4PB 2MX2A 2L05A 4USAA 2W54A 2WYQA 2PMVA 3AEFB 3ENEA 4ICVA 1R4MB 2JUOA 3VRBB 5IKCM 2K3UA 3RNGC 1E90A 4RM8A 3DHIC 4Q2JA 2N9XA 1NI3A 3N3KB 4RF1A 3HIZA 2MCNB 2Z8LA 3QA8A 2MBEA 4TQ1A 2TSSA 2PE9A 2B76B 2LHEA 1YOVB 1TS3A 3AEBB 3OLMD 2BGFA 5EE9A 2M19A 1N63A 4E74A 2WX1A 3JW0X 2VZKD 3VXWA 4MGKE 1CMXB 4B0EA 5J17A 3M63B 3ZDTA 4F7ZA 2WQYB 2FBWB 1I4QA 3ZXRA 3URYA 1HQRD 2DX5B 3NVVA 4LLGM 5AUIA 3ZIMA 3R8BA 2ZNVB 2GBNA 1V80A 5G5GA 5JXVA 2MJ3A 1Q0WB 1XO3A 2H89B 2KLCA 3MJ5A 3ZNGC 1HXYD 2IYDB 1XT9B 2WNMA 2KMCA 1YN4A 1UWXA 4JGHB 2Y3AA 3PVLA 2KLGA 1FPYA 4KDLB 4S17A 1DOYA 2ICIA 1QOBA 4XZ4A 1KRHA 3IVFA 5GMVA 3ZUNA 1GJZA 1E7PB 2KACA 1XLNA 1WX8A 4C4VA 4ARCA 2LHDA 2DYOA 1KTKA 3APCA 1Z5SB 3A33B 1ZXIA 2CJOA 3B1LX 1HE8A 1SJED 1GC7A 4TQ0A 4P1CC 5J18A 2BB6A 5EDSA 5DCNA 2CHZA 2AYOB 1SE9A 3A1QA 4AWJA 1R7SA 3Q8CA 1L6UA 1P7FA 3QCAA 1JQ4A 1NYQA 5IA7A 4EFOA 3PPAA 3UQAA 4CQNA 1JALA 2WXRA 3L17A 5TSSA 1C76A 2UYZB 5BYQA 4US9A 2LVQA 3CWIA 1R4MI 1PQSA 2V9HA 1PGAA 3UGBB 2L32A 4K3CA 2WXJA 5CHVC 4WJOA 4ZHPA 3VQIA 1SXTA 3P4SB 4G3XB 3GZNB 2V1YA 1R4NB 2C5LC 4KZ0A 4JPSA 5BO4B 4HRSA 2JWUA 1WGRA 2INPE 3P4QB 3W5UB 1M94A 1WGGA 3FILA 1F52A 2KZRA 4F1SA 3ZTCA 3KYDD 1NBFC 4EOYA 2PJHA 4LDTB 5L83A 1JCKB 3X0WA 3VRAB 2DYMA 4HK2A 4REZA 1E7VA 1MPEA 4M02A 4B9KA 2JX5A 4BFRA 3N1YC 4L1BA 4XWTA 3TSSA 3AU5A 1YN5A 2W9NA 3TL5A 2MW5A 3IHPC 2WXIA 3BVZA 3CF6E 1K51A 2N1VA 1UUPA 3A4RA 1TJEA 3OG5A 4LDTD 1SSNA 1WXMA 1JMLA 1RFKA 3RCZA 2M17A 2Z59B 2N4FA 1U4AA 4GMVA 2BTEA 1EF1A 2N9EB 3KUCB 1D3ZA 3B08A 3PGEA 1YX6B 4RGMA 2MH7A 5IP4D 4P7IA 4GDLA 4W9EA 3VHTC 3AEAB 4DXGA 4C80A 2KK8A 4MEMA 4CHKA 2KWDA 4M0WA 1XLPA 1IYFA 2CJNA 2KTRA 2KJ6A 2DHZA 4IM3A 4KX6B 3ZO5B 1NEKB 1QF6A 2L76A 4A55A 4BZAA 1ACCA 1WM2A 1P3QU 2KVZA 2LRWA 3Q2AC 4HXDA 3PREA 1UBQA 3HK0A 2K5PA 1QKZA 3DPDA 2FNJB 1L4DB 2Y5PA 2O6VA 2NCNA 2NPTB 4MELA 2N7DA 2K1FA 2KANA 3EECA 3ZQ4A 4NZLB 2AQ2B 2NBUA 3A1QB 1PGXA 3AE4B 3AE2B 4EZLA 3KQ4A 3Q8FA 2RMMA 2GI9A 3ZJVA 5BYSA 2BKRB 3AE1B 2XK5A 3ETRA 5IO9A 3IT4B 3GZNI 2Y5CA 4NY0A 4YSZB 1R4NI 1WRIA 3V60A 1T0RC 3DCGA 1TTNA 1WMHA 4W9DA 4WH4A 1NI2A 2D3CA 3DWMA 1P98A 2BPSA 2PKOA 4US8A 2ONQA 1SB3C 3U8ZA 4ACFA 3U4EG 3KYCD 2DZMA 2JVCA 1EWYC 3EHVA 1A70A 3BIID 4F8CB 1E6EB 2IZVB 3KH0A 3N30A 1UELA 3DDCB 3FILB 2MP2A 2WXPA 1E8WA 2GBRA 4YTMB 4IW0A 1T6BX 4MJSA 3DOWA 2WLBA 3CMMB 3AULA 2J0KA 2R61A 3RULA 4RMAA 2V4IB 2HJ8A 2M8SA 1ZW7A 4ASWC 2MHJA 3N1ZC 2MBBB 3R2TA 1VJKA 4AP4C 3MTNB 4XYCA 4S0RA 2ZPYA 2WXLA 3A9KA 1YJJA 2INNE 2G9HD 4WJPA 4BOSC 2N1WA 5KHQA 1LM8B 2IJ0A 1ROEA 1SE2A 2K6QA 2OHFA 2QSDA 4AS1A 3ABVB 3DBLI 1VDVA 1ZDXA 2WHIA 3KLSX 2RSUA 3EA6A 1Q10A 5MPOA 2FUG1 2KVRA 4D2KA 3HVDA 5D3IB 4BKSD 5DPRA 2FUHB 3L08A 4EUTA 1F1HA 3DBHB 1KJTA 5EE3A 1Y56A 3BVGA 4M0WB 1N62A 3RI7C 1XEEA 1CJEA 1YIWA 3QARA 1P7EA 3R7RA 1WF9A 2MBOA 3NG0A 3TJPA 4GLSC 4XWWA 1UH6A 1G6JA 2KDIA 1GNUA 3Q8EA 4LCDE 2NBVB 1MJDA 3ZW3A 1VZ8A 2MWSB 2O6VB 1NYRA 4WJQA 2LI5A 3NRZA 2BBCA 2QC8A 1C9FA 4NJ7A 1MHHE 2ZZPB 5C3JB 3KW5B 2FIDA 3AEEB 3VH4B 1IGCA 2LGYA 1JRPA 1I42A 4B6WA 2JXXA 3LB8C 2QMTA 4NQKE 2K8HA 2G3QB 3TBLD 1SF0A 1WRDB 1PDXA 2WP9B 3AEDB 4JLCA 1WMHB 3A9JA 2FCNA 1FCCC 4HPLB 5AEKB 4J3OD 3JYUA 1E8YA 4XDCA 5E6PA 2IBIB 2N7EA 2ASQA 3PV1A 5JH5C 2YVCA 3SFEB 2RGFA 1BXTA 3GE8C 1TGZB 4II2B 1V2YA 1DOIA 1ISNA 2KC2A 1V6EA 2MP2B 4JX1C 1C4AA 2WGSA 3RNEC 3LYYA 4MJSB 4X57B 1C4CA 4M00A 3BZDB 3NS8A 3O13A 2JY6A
chains in the Genus database with same CATH topology
1C79A 1TS3A 2IGDA 3AEBB 1RWSA 3C8YA 5EE9A 2M19A 1N63A 2V3PA 4WIPA 2SAKA 4RNAA 2OEDA 2HTME 3TEZA 2IPKD 2WXHA 1CZPA 1GPXA 1I4HA 2VZKD 1FNUA 2ACZB 3NS1A 3U2SC 4B0EA 2WDRB 1J7CA 2WQYB 4P6VF 5FK9C 2FBWB 1I4QA 2QIEB 1PYWD 3SR6A 1JWBD 3URYA 2QEJC 4JWUC 1HQRD 1KH0A 4A9AA 2XNAC 1C77A 1V1OA 2IGGA 3AECB 3NVVA 1MHXA 4LLGM 5AUIA 1EU4A 3R8BA 1D5XC 4RGTA 1XCQL 1OQQA 1D6EC 1ZOYB 5G5GA 4ARIA 5JXVA 4GDLB 2MJ3A 2JSVX 4YT0B 1V1PB 1XO3A 1TKEA 2H89B 3PO0A 1HZ5A 2EKIA 3MJ5A 1HXYD 2LUMA 1GAQB 4KKJA 5FKAC 1QOAA 2NTTA 2WNMA 2D5GA 5EE1A 1YN4A 1UWXA 2Y3AA 1HA5A 1L0XB 4WURA 3AE8B 1FXAA 1TKGA 1DOYA 2ICIA 4OW0A 2FE8A 3AE6B 1KF6B 1QOBA 2WU5B 4ZRPA 1LO5D 1XLQA 1KRHA 1E7PB 2KACA 1XLNA 3MP9A 1V8CA 1CQVA 1OQRA 1VZ7A 5HHDG 2N9KA 3AB5A 1B9RA 3RPFC 2DBYA 1EU3A 2JU6X 2W55A 1I4PA 2WDVB 4ARCA 1AN8A 1I7HA 2X38A 4EE2A 2LHDA 2DYOA 2W3SA 4N6EB 1KTKA 1E0ZA 4RH6A 1ZXIA 2WXNA 1N60A 3BWUD 5FR3A 1VZ6A 2CJOA 1SJED 4B0MA 3BVMA 4WAFA 5AUKA 1TS2A 3NVZA 5H8YE 4TQ0A 2BB6A 2EELA 3IAS1 1WYGA 1C4PA 5C2TB 1ESFA 1DYQA 1R7SA 3DWGC 1L6UA 1P7FA 3Q8CA 1JQ4A 1NYQA 4ZOHC 4YXDB 1SEBD 1D5MC 2I38A 4CQNA 1JALA 3ZYYX 3MFGA 2WXRA 5TSSA 2PVOD 2CU3A 2WDQB 1C76A 2AX5A 2J52A 2LEKA 4WWMA 1FXIA 5BYQA 1K53A 2KAJA 4US9A 1L5PA 2KN4A 3CWIA 2RPVA 2IDYA 3UI3A 1FNVA 1PGAA 1L0YB 1J7AA 2K0PA 1KFYB 4XE0A 3VR9B 1ET6A 2L32A 2WXJA 4ZHPA 2N9LA 4TMAB 3VQIA 1SXTA 3P4SB 4C56C 1E10A 1AWDA 2MJDA 3MHZA 3N9YC 3R2IA 2W82A 2BS3B 1N5XA 4JPSA 4NAMA 4HRSA 2JWUA 1FRRA 2INPE 3BK1A 3W1SA 2MJEA 1L0VB 4IOIE 1TS5A 3P4QB 3W5UB 4A90A 3AE5B 5D7GA 2K9XA 4ZYSA 3TUOA 1FRDA 1SIJA 3FILA 1QOGA 3PZ8A 1YJIA 1DOXA 2WS3B 5T8IA 1YN3A 1RM6C 4YTPB 1RYJA 2V0GA 5BYRA 1F0ZA 3AM9A 2G1EA 1JWAD 3LXFA 1JWSD 1JCKB 3VR8B 3P4RB 3J9CA 3PZ7A 3VRAB 2DYMA 1N5WA 4A6QA 3E56A 3B9JA 4REZA 3T3OA 3EUB2 1ZDVA 4H2AA 2IGHA 2M0AA 2PIAA 1MPEA 3GB1A 4MACA 3NUHB 5I4DA 3U52E 2WXKA 2JX5A 2PLPA 3NZ3A 1PFDA 4P16A 4L1BA 4XWTA 1YNTE 1XLOA 4GDKB 3TSSA 4A8XC 1YN5A 1WXQA 3FAHA 1OFFA 2L83A 2SEBD 2WXIA 3GS2A 3BVZA 1B1ZA 4N59A 3SFDB 2V3NA 1TZOA 1VLBA 1K51A 1KLGD 3RFZB 1UUPA 1SE4A 1TJEA 1E9MA 4HEA1 1SSNA 3NVYA 1JMLA 1AYFA 1RFKA 1XF5L 2PTLA 4HROA 3AE3B 2PVGC 3HUIA 4MM3B 2BTEA 2DWQA 2NMQA 4TSSA 1MVKA 1V97A 3Q69A 1F77A 2JYEA 4L2YA 4RGMA 2MH7A 2BW2A 3V05A 2L52A 3AEAB 2I2YA 4DXGA 4C80A 1VRAB 1EM7A 1UNSA 2JXTA 1ENFA 2KWDA 4M0WA 1XLPA 2CJNA 2N0SB 1UWMA 1BUIC 4KX6B 1XCTL 2AQ3B 4YTNB 1FEHA 1NEKB 1QF6A 1I4GA 2YEPF 4A55A 2W3RA 4UDUC 3L4PA 3MC0B 3U7ZA 4OVZA 1ZUD2 1ACCA 3ZGZA 3B2FA 3I57A 1ZE3D 3P1MA 2RDHA 2K5PA 1QKZA 1L4DB 2Y5PA 2DLBA 4KGTA 2J42A 4LTUA 4HKQA 1FM0D 4XDDA 2BYTA 1HEZE 2QJLA 4IKGA 2BB5A 4IDIA 1WGKA 3ZQ4A 3TEWA 1WSPA 4NZLB 1GB1A 3V3XA 2AQ2B 3WCQA 1PGXA 3AE4B 3AE2B 2WXOA 3KQ4A 3Q8FA 2RMMA 2GI9A 3ZJVA 1FO4A 2ON8A 5BYSA 3AE1B 3AH7A 3ETRA 3IT4B 1TY2A 4ITKA 2Y5CA 1PGBA 2PW9A 3CIRB 4YSZB 4HKZE 1WRIA 4NAWB 1JROA 4OZAA 3KWLA 4WH4A 3AV8A 1AW7A 1FNWA 2PKOA 3DWMA 4US8A 2ONQA 2Q5WD 1SB3C 3AN1A 4YWGG 3U4EG 2JQRB 4MT5A 1WWTA 2LGIA 1EWYC 1GB4A 2RDGA 1FFUA 4DXFA 1T5XD 1A70A 2YEPB 2WXMA 3BYTB 3BYYB 1F2RI 3BIID 1E6EB 5EE0A 1J7BA 3OWEB 1XXGA 1IBXB 1ZPSA 2LMCA 3KWVA 3W2DA 2AQ1B 4RGNA 3E9SA 1CK1A 5HI1A 5BMIA 3FILB 2H88B 1QOFA 2WXPA 2VZKB 4YTMB 4PT5A 1T6BX 4O1NA 2WLBA 4ZHOA 2XN9C 5BMGA 5E6JA 3TEXA 3W5VB 1PUTA 4ZRQA 3W9CB 1SE3A 2N7JA 2GRIA 2R61A 4HJGE 4JWSC 2V4IB 4YSXB 1IGDA 3P63A 2WXFA 1HZ6A 2J53A 2WU2B 3R2TA 3AEGB 1VJKA 2ZW0A 3P42A 1QILA 2E3TA 1ZXHA 3SEBA 2ZW1A 2WXLA 2BS4B 4RCOA 1YJJA 2INNE 4C7ZA 2G9HD 4WQMA 3B2GA 5D3DA 2IJ0A 1ROEA 1SE2A 2GB1A 2OHFA 2QSDA 2BS2B 4OZBA 4AS1A 3ABVB 1YQ3B 4RGOS 1IUEA 1VDVA 2M56B 2WXQA 3HVZA 1V1PA 1ZDXA 3KLSX 2KDMA 3BK2A 1TKYA 4DQOC 5MPOA 3EA6A 1Q10A 3AMZA 2FUG1 4D2KA 3HVDA 2KMMA 5D3IB 3ZJTA 1TYGB 1N61A 1KLUD 3H8HA 2BT6A 2L1AA 4RF0A 1FD6A 5HFYA 2MEKA 1YQ4B 2JYTA 5EE3A 1JWUD 1Y56A 3BVGA 2LJIA 4N58A 1N62A 4YSYB 1JW9D 1ZP0B 1XEEA 1CJEA 3IAM1 1K52A 1P7EA 5H92C 3TEYA 1JWMD 4FXCA 2WXGA 4KGRA 4GLSC 1NENB 1EWCA 4XWWA 1FIQA 3IT6B 3Q8EA 1F2RC 2QILA 3FC4A 1FCLA 1SJHD 1I4XA 3IXSA 2E6XA 4MH8A 2J4XA 1M4VA 1VZ8A 1TS4A 1L4ZB 1L6VA 1NYRA 4OZCA 1QLBB 4R3DA 5LNK1 2JZPA 1K50A 1NVID 1STEA 1GOZA 4KKIA 4LK0M 3NRZA 4C7YA 2K22A 2BBCA 4NJCA 4AQ7A 3I9V1 1C9FA 1MHHE 1I4RA 5C3JB 3AE7B 4L23A 2HDEA 1FFVA 3AEEB 1ET9A 3HRDD 1FMAD 3AE9B 4JE3B 1IGCA 1MI0A 3P4PB 4OHJA 1UGJA 4RFBA 5HG2A 1JRPA 3T3NA 2LFIA 4USAA 1D5ZC 2W54A 3LB8C 2QMTA 1SF0A 2PMVA 1PDXA 3AEFB 2WP9B 1YMHE 3AEDB 3VRBB 1FCCC 3ZJUA 2K3UA 5BMHA 4KGSA 4J3OD 1SBBB 1QQRA 1BMLC 4XDCA 4Q2JA 1T3QA 3Q8BA 5GXGB 3GP7A 1C78A 3Q8AA 1D4BA 1NI3A 3SFEB 1BXTA 1QT9A 1DOIA 1IBXA 4RF1A 1TY0A 3NVWA 5G5HA 4JX1C 1C4AA 2Z8LA 2NTSA 1VR9A 3LYYA 1DGJA 4TQ1A 3EGRA 1C4CA 3BZDB 2TSSA 3O13A 2KQ4X 2B76B 2LHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IGD A;  2JWU A;  1HEZ E;  4IOI E;  1FD6 A;  4IKG A;  2OED A;  5HFY A;  1GB1 A;  3V3X A;  3FIL A;  1PGX A;  2RMM A;  2GI9 A;  1K52 A;  2ON8 A;  1P7E A;  1KH0 A;  1PGB A;  2PW9 A;  4HKZ E;  4KGR A;  2IGG A;  1MHX A;  4GLS C;  4OZA A;  4WH4 A;  1XCQ L;  2ONQ A;  1F2R C;  5JXV A;  1FCL A;  2JSV X;  2IGH A;  1MPE A;  3GB1 A;  1HZ5 A;  4MAC A;  4OZC A;  2LGI A;  2LUM A;  2JZP A;  2PLP A;  1GB4 A;  1K50 A;  1F2R I;  1UWX A;  1C9F A;  1YNT E;  1MHH E;  1IBX B;  5BMI A;  5HI1 A;  3FIL B;  2KAC A;  3MP9 A;  1K51 A;  1IGC A;  1MI0 A;  5HHD G;  2N9K A;  5HG2 A;  1JML A;  2JU6 X;  2PTL A;  1XF5 L;  2QMT A;  2LHD A;  2NMQ A;  1YMH E;  1MVK A;  5BMG A;  1FCC C;  2N7J A;  4HJG E;  5BMH A;  4KGS A;  1IGD A;  2I2Y A;  2EEL A;  1HZ6 A;  1EM7 A;  2JXT A;  2J53 A;  1D4B A;  2KWD A;  1P7F A;  2ZW0 A;  1XCT L;  2I38 A;  1ZXH A;  1IBX A;  2ZW1 A;  2J52 A;  1K53 A;  2KN4 A;  2RPV A;  3UI3 A;  1PGA A;  2GB1 A;  2QSD A;  4OZB A;  2K0P A;  1QKZ A;  2KDM A;  4KGT A;  2N9L A;  1Q10 A;  2KQ4 X;  4D2K A;  2LHE A; 
#chains in the Genus database with same CATH topology
 1C79 A;  1WI0 A;  2SAK A;  4AJY B;  4GDK A;  4WWO A;  2HTM E;  2WXH A;  4FHJ A;  1GPX A;  1I4H A;  1FNU A;  2K39 A;  3U2S C;  2BVC A;  4W9J A;  2KFK A;  4II3 B;  1LQB A;  1PYW D;  2CHW A;  1JWB D;  3KUD B;  2LGX A;  4JWU C;  3VAW A;  4A9A A;  1C77 A;  2AL3 A;  2D11 A;  3AEC B;  2IGG A;  1MHX A;  3QWZ B;  3PS6 A;  1D5X C;  1XCQ L;  1OQQ A;  3RZW C;  4ARI A;  1YJ1 A;  4QAY A;  4FJZ A;  2QDF A;  2JSV X;  2KTF A;  2V3S A;  1SIF A;  1WH3 A;  1HZ5 A;  3DBH I;  2EKI A;  1E8Z A;  3Q3O C;  2WWZ A;  4KKJ A;  5FKA C;  1QOA A;  4DDG D;  3PRZ A;  4OW0 A;  2G45 B;  3PT2 B;  2KWC A;  2WU5 B;  2BWF A;  2D3G A;  1OQR A;  5HHD G;  5HKH A;  3AB5 A;  5JHB A;  1I4P A;  4FJY A;  4PYZ A;  1WFY A;  4A3P A;  1MFW A;  2X38 A;  3ZRF A;  2W3S A;  4M8M A;  4N6E B;  1WJ6 A;  1N60 A;  3BWU D;  2L3Z A;  5AZF A;  4B0M A;  1TS2 A;  3NVZ A;  3MHS D;  3L54 A;  2K6D B;  3IAS 1;  1C4P A;  4XX5 A;  1DYQ A;  2EMS A;  4ZOH C;  4BKT A;  3LJ3 A;  3ZYY X;  3MFG A;  1WGH A;  3JVZ X;  2WDQ B;  2J52 A;  2LXC A;  2LEK A;  1V86 A;  2RPV A;  3QAQ A;  3UI3 A;  3FKY A;  1L0Y B;  1P9D U;  2RPQ A;  1OTR B;  2K0P A;  3CSF A;  4KV2 A;  4K7U A;  4C56 C;  3P2B A;  1E10 A;  4KSL C;  3N9Y C;  3R2I A;  3ALB A;  1FRR A;  1S3S G;  3W1S A;  1WXS A;  3DVG X;  1TS5 A;  2K8B A;  1WR6 E;  2K25 A;  4KIK B;  3VH3 B;  5LXI B;  4MDK E;  4K7S A;  3TUO A;  1SIJ A;  1QOG A;  1DOX A;  2ZNV C;  2I1K A;  1E7U A;  4DHJ B;  2WS3 B;  2DYB A;  4YTP B;  2KQ7 A;  4JL9 A;  4MSQ B;  2C60 A;  4ANX A;  2G1E A;  1JWA D;  3LXF A;  1JWS D;  3R3M A;  3VR8 B;  3J9C A;  3ZNI D;  3GOE A;  1N5W A;  2DNF A;  3E56 A;  1N6Z A;  4H2A A;  2LXA A;  4K81 A;  4MAC A;  5I4D A;  2KOX A;  2PLP A;  3UIO B;  3UIP B;  3ZDM C;  1XLO A;  2C7N B;  4GDK B;  5C23 A;  4DHJ D;  1EF5 A;  1OFF A;  2RD0 A;  4N59 A;  1SGH A;  1SE4 A;  1E9M A;  1S1Q B;  2PTL A;  4HRO A;  3QIJ A;  1KLV A;  3HUI A;  3ZNH B;  1MVK A;  4ZRK A;  2L52 A;  2QHO A;  1ENF A;  1WXA A;  1XCT L;  2AQ3 B;  3RYT A;  1UZX B;  2ZCB A;  2W3R A;  1H4R A;  3I3T B;  3L4P A;  3MC0 B;  1ZUD 2;  4BAX A;  3ZGZ A;  3B2F A;  2RDH A;  2V4L A;  2C9W B;  4IWQ A;  1VD2 A;  4BBN C;  1J19 A;  4KGT A;  2J42 A;  4HKQ A;  2JWZ A;  4XDD A;  1J0G A;  2BB5 A;  1TZ1 A;  3NZU A;  3CST A;  1WXV A;  2BYF A;  3WAL A;  1HTQ A;  3K9O B;  2IND C;  4ANV A;  1FO4 A;  4FLH A;  3BY4 B;  1PGB A;  1LFD A;  4HKZ E;  4ANW A;  5E6O A;  2G4D B;  1FNW A;  3AN1 A;  1Z2M A;  4DDI D;  1TBE A;  2LVO A;  1KOT A;  2AEH A;  1TIF A;  1GB4 A;  4W9L A;  4DXF A;  4W9G A;  1F2R I;  5EE0 A;  3VUW A;  1J7B A;  1WR1 A;  4KZC A;  1ZPS A;  3KWV A;  3W2D A;  4RGN A;  4NJ6 A;  2INC C;  5HI1 A;  4K7W A;  2KMA A;  5D94 A;  2KJH B;  2MBH A;  4O1N A;  1UF0 A;  4ZHO A;  2XN9 C;  5BMG A;  3TEX A;  3NY5 A;  3W9C B;  1SE3 A;  2N7J A;  1EUV B;  4HJG E;  4JWS C;  4XC2 A;  2GLS A;  4KVG B;  2J53 A;  1GC6 A;  1WZ0 A;  2ZW1 A;  4CYE A;  3W1Y A;  2HE7 A;  4WQM A;  3S2A A;  3L16 A;  3B2G A;  2GB1 A;  2Z0D B;  4RGO S;  1IUE A;  3R66 C;  2WXQ A;  3HVZ A;  3DBL B;  1V1P A;  2KDM A;  4MM3 A;  4FAD A;  1TKY A;  4DQO C;  3PLU A;  3RN9 C;  4N9F 4;  3RT3 B;  1N61 A;  1KLU D;  3SU8 X;  2BT6 A;  2L1A A;  1WYW B;  1YQ4 B;  2QCZ A;  4TKN A;  2JYT A;  4MSM B;  2IY0 B;  3X23 A;  1E8X A;  1LXD A;  3U30 A;  3RD2 A;  4C4V B;  2KXJ A;  4FXC A;  4BBN F;  3ZTD A;  2L0T A;  3EFC A;  2KKC A;  2D3B A;  3PZD A;  1EWC A;  3N20 C;  3NJT A;  1XQQ A;  3M95 A;  2EKE C;  4MH8 A;  2E6X A;  3U7D A;  1M4V A;  1TS4 A;  3D32 A;  1QLB B;  2IO1 B;  1K50 A;  1NVI D;  1GOZ A;  4KKI A;  4LK0 M;  2JZZ A;  2L7R A;  2K22 A;  2LGD A;  3APD A;  1I4R A;  2WDT B;  1WM3 A;  4HCP B;  3H1U A;  1GUA B;  3RNB C;  1ZKH A;  5IN7 A;  1ET9 A;  3HRD D;  3B0A A;  3AE9 B;  4JE3 B;  5FR6 A;  4OHJ A;  5HG2 A;  3T3N A;  2LFI A;  1OEY J;  3ECI A;  2J0M A;  4NAW A;  4IUM B;  1YMH E;  1KM7 A;  2KYW A;  4G11 A;  3V6C B;  3UQB A;  1SBB B;  3V6E B;  1QQR A;  1T3Q A;  4G0N B;  3Q8B A;  2JT4 B;  3GP7 A;  1C78 A;  1D4B A;  3H6N A;  2KD0 A;  4M8N A;  1QT9 A;  2BYV E;  2VH2 A;  1IBX A;  1UBI A;  3WAO A;  2REX A;  3H9D A;  2G4S A;  5G5H A;  4WWP A;  1VR9 A;  3Q6B A;  1DGJ A;  3EGR A;  2FCM A;  2IO2 B;  2CS4 A;  2IGD A;  1V81 A;  3C8Y A;  5D2M B;  4B95 A;  2V3P A;  4WIP A;  1K8R B;  4RNA A;  2IPK D;  2K8C A;  3NS1 A;  2MA9 B;  1J7C A;  4MH0 E;  4P6V F;  5FK9 C;  2QIE B;  5JHA A;  3SR6 A;  1JRU A;  1NDD A;  3RNA C;  3QX1 A;  2RDB C;  1EU4 A;  5E6N A;  4RGT A;  3VFK A;  1ZOY B;  4FA6 A;  4GDL B;  4YT0 B;  5D6J B;  1V1P B;  1TKE A;  3PO0 A;  4GB9 A;  2LUM A;  2NTT A;  2Y5B B;  2D5G A;  4WJN A;  2KTR B;  3DBR B;  1HA5 A;  3O65 B;  4WQO B;  1L0X B;  2D07 B;  4ZRI A;  2VRR B;  4GN1 A;  2FE8 A;  3AE6 B;  1KF6 B;  1E5W A;  5DPT A;  3PRP B;  1CQV A;  1VZ7 A;  3WA0 A;  1B9R A;  4IM0 A;  2DBY A;  1EU3 A;  2C7M B;  3DVN U;  3RPF C;  2BQQ A;  1E0Z A;  4GU2 A;  2CHX A;  3ZXV A;  4RH6 A;  3TIX A;  4GXB A;  3JSV A;  5AUK A;  2NVU I;  3UF8 A;  1IPG A;  1ESF A;  2CU1 A;  3DVG Y;  1LGR A;  3RZF A;  4DHZ E;  4YXD B;  2FCQ A;  1GG3 A;  2PVO D;  2CU3 A;  2AX5 A;  2XK5 B;  4WWM A;  2KAJ A;  1L5P A;  4EZJ A;  3RMK C;  2IDY A;  2EMT A;  2JZ3 B;  3AU4 A;  1J7A A;  1KFY B;  2O6V D;  2HD5 B;  3L0W B;  2CKH B;  2M0X A;  2NBW B;  2W82 A;  2BS3 B;  4JIO U;  1N5X A;  1J8C A;  4NAM A;  4PS3 A;  3BK1 A;  3TCA A;  3NOB A;  4A90 A;  2IO3 B;  2K9X A;  4ZYS A;  2BKF A;  4WWN A;  1V5O A;  4RM9 A;  3HM3 A;  3PZ8 A;  1YJI A;  5T8I A;  1YN3 A;  1RM6 C;  1RYJ A;  2V0G A;  3DVN V;  1F0Z A;  4LNN A;  3V61 A;  5KHO A;  1WY8 A;  3L10 B;  4A6Q A;  3B9J A;  3WAM A;  3KVF B;  1ZDV A;  5IAA C;  1V49 A;  4KDI C;  2M0A A;  4HPM B;  3NUH B;  2GMI C;  3GE3 C;  3C19 A;  2WXK A;  4MGI E;  2OJW A;  4GIV A;  3RNF C;  2GBK A;  3A9K B;  2DEN B;  1WXQ A;  2L83 A;  2SEB D;  3SFD B;  4DK5 A;  4DHZ B;  2V3N A;  2BYE A;  4NQL B;  1KLG D;  3RFZ B;  4HVB A;  3PRM B;  1AYF A;  1XF5 L;  1WE7 A;  2NMQ A;  2C7H A;  3DBR I;  4LNF A;  2BW2 A;  4CO7 A;  3V05 A;  2I2Y A;  3H7P A;  3H7S A;  1VRA B;  1EM7 A;  1UNS A;  2KFJ A;  1UWM A;  1BUI C;  2LUE A;  4YTN B;  1FEH A;  2YEP F;  2NS5 A;  3U7Z A;  4OVZ A;  3I57 A;  2DAJ A;  2BF8 B;  2LWP A;  4HWI B;  3HHM A;  4DWF A;  4LTU A;  4IWO A;  3PLV A;  1FM0 D;  2KO3 A;  2BYT A;  3WAN A;  2KHW B;  2KN5 A;  3JSV B;  1C1Y B;  4IDI A;  1WGK A;  3TEW A;  1GB1 A;  4PS8 A;  3V3X A;  5CHF A;  1Q5W B;  2WXO A;  2ON8 A;  1YQB A;  2ZPN A;  3VDZ A;  4MGZ E;  3AH7 A;  2GBM A;  2XBB C;  4ITK A;  2KDB A;  3Q3M C;  2PW9 A;  3CIR B;  4NPN A;  4OZA A;  3KWL A;  3A9J B;  4C00 A;  1AW7 A;  2Q5W D;  2MSE D;  3EFU A;  4IG7 B;  2L00 B;  4MT5 A;  1WWT A;  1BT0 A;  2KJR A;  1WJU A;  2RDG A;  5CTR C;  2WXM A;  4I6N B;  1TT5 B;  2ZCC A;  4HCN B;  5IOI A;  2LMC A;  2AQ1 B;  3E9S A;  2H88 B;  2BWE S;  1RLF A;  2VZK B;  4G50 A;  5CHW A;  2PEA A;  4PYU A;  2LD9 A;  1UGM A;  2GBJ A;  3W5V B;  4GSW A;  2I1J A;  1OQY A;  2GRI A;  4YSX B;  1IGD A;  3QC8 B;  2ZW0 A;  3P42 A;  4LJO B;  2KFK B;  4J6I A;  3SEB A;  3MJW A;  2KT7 A;  2R2O A;  4RCO A;  1C3T A;  3IG3 A;  5D3D A;  4W9F A;  5CX3 A;  4FN2 A;  2M4N A;  2M56 B;  2OOB B;  3BK2 A;  2CR5 A;  3VTW A;  4DXA B;  3ZJT A;  1TYG B;  2DZI A;  3H8H A;  1IP9 A;  4RF0 A;  1FD6 A;  3H7P B;  5HFY A;  1V9J A;  2M1M A;  3VVW B;  4YSY B;  1JW9 D;  4A3O A;  1OEY A;  1K52 A;  2KNB A;  4NNJ B;  5H92 C;  3TEY A;  1JWM D;  3APF A;  2OJR A;  4KGR A;  2MBQ A;  4URK A;  3W1S C;  1F9J A;  3R7Q A;  2JRI B;  3FC4 A;  3IXS A;  2J4X A;  1L4Z B;  4R3D A;  2JZP A;  4KSK C;  2LJ5 A;  1STE A;  2NPT A;  3N32 A;  3SD5 A;  1V5T A;  4NJC A;  3OJ3 A;  4I6P A;  1FFV A;  4OVV A;  2IO0 B;  4FBJ B;  1UGJ A;  4RFB A;  1D5Z C;  2FAZ A;  4OVU A;  3OJ4 B;  2VH1 A;  3ZJU A;  2NR2 A;  5BMH A;  4KGS A;  1BML C;  5TR5 A;  4E3C A;  2O2V A;  5GXG B;  4AUQ C;  3Q8A A;  3N1X C;  1WGY A;  3SDL C;  1TY0 A;  3NVW A;  2LRU A;  2KQS A;  3T9L A;  4WAA A;  2J0J A;  2NTS A;  2KC1 A;  4W9K A;  2KDE B;  2KQ4 X;  1RWS A;  1WJN A;  4BKS A;  3QK0 A;  4ZYN A;  2OED A;  3WAP A;  3TEZ A;  2UU7 A;  1CZP A;  2ACZ B;  2KX0 A;  4HDO A;  2WDR B;  1Q1O A;  2D10 A;  1Y8R C;  2QEJ C;  1KH0 A;  3ML9 A;  3VTU A;  2JF5 A;  2XNA C;  2ZVN A;  3Q14 C;  1V1O A;  1D6E C;  2RR9 A;  4TV3 A;  4ICU A;  4IC7 B;  1WE6 A;  3DHG C;  4A20 A;  1GAQ B;  3T8M A;  4BVU C;  5EE1 A;  3UIN B;  4BKG A;  4MGY E;  4WUR A;  3AE8 B;  1FXA A;  4W9C A;  1TKG A;  4GGQ A;  2KWU B;  4ZRP A;  1LO5 D;  1XLQ A;  3MP9 A;  1V8C A;  2R2Q A;  2N9K A;  2JU6 X;  2W55 A;  5L95 C;  2WDV B;  1AN8 A;  1I7H A;  4EE2 A;  3ZKJ C;  2WXN A;  4FUL A;  5G2N A;  3Q3F A;  1HTO A;  5FR3 A;  1VZ6 A;  2AL6 A;  2GOW A;  2J7Q B;  3BVM A;  4WAF A;  5H8Y E;  2EEL A;  2KX3 A;  3QQ8 B;  1WYG A;  5C2T B;  1T0S C;  3HM6 X;  1FXT B;  3I5J C;  3DWG C;  2HJ1 A;  1YX5 B;  1SEB D;  1D5M C;  2I38 A;  4XGA B;  1FXI A;  1K53 A;  2DZJ A;  2KN4 A;  2LVP A;  1FNV A;  2FIF A;  4XE0 A;  3VR9 B;  1ET6 A;  2JRH A;  3PSE B;  2N9L A;  4TMA B;  4HDQ A;  1AWD A;  2MJD A;  3MHZ A;  1WGD A;  4LJP B;  2MJE A;  1L0V B;  4IOI E;  5C1Z A;  2LGS A;  1I35 A;  4ANU A;  3AE5 B;  5D7G A;  3AXC A;  2O2V B;  1FRD A;  4DBG A;  1RFA A;  3PTF C;  1UD7 A;  1WJ4 A;  5BYR A;  3AM9 A;  3QJZ A;  1H8C A;  1XD3 B;  3P4R B;  3PZ7 A;  5JZE B;  3V62 A;  3T3O A;  3ZVV A;  3EUB 2;  2LZ6 A;  1ZGU B;  2IGH A;  2PIA A;  1P0R A;  3GB1 A;  4HPP A;  3U52 E;  4AJW A;  2L0F A;  2XEW A;  3NZ3 A;  1QZE A;  1PFD A;  3VUY A;  4P16 A;  1T0Y A;  2JPH A;  5J2R A;  1EO6 A;  2ZVO A;  1YNT E;  4A8X C;  3ML8 A;  3FAH A;  1AAR A;  3PHW B;  3GS2 A;  1B1Z A;  1TZO A;  2MQJ A;  1VLB A;  3ZLZ A;  3Q3J A;  4HEA 1;  4HLE A;  3NVY A;  3AE3 B;  2PVG C;  4MM3 B;  2DWQ A;  4PK1 A;  4TSS A;  1V97 A;  3Q69 A;  4HJK A;  1F77 A;  2JYE A;  4L2Y A;  3KUZ A;  4PS7 A;  2PPH A;  1WX9 A;  2UWQ A;  2JXT A;  2FCS A;  4K3B A;  2N0S B;  3BIN A;  5DPW A;  1I4G A;  4GOC A;  1MG4 A;  4UDU C;  1WZ3 A;  5AZH A;  3IBE A;  1ZE3 D;  3P1M A;  3MC9 A;  4P1B C;  3VTV A;  4K1R B;  4EKU A;  4IM2 A;  2DLB A;  3C0R B;  1X1M A;  2MLB A;  3K9P B;  2DZK A;  1VCB A;  1HEZ E;  2QJL A;  4IKG A;  5LXH A;  2IY1 B;  1WSP A;  3WCQ A;  2L8J A;  4EZK A;  4LNO A;  2B3A A;  1OGW A;  4E71 A;  4M01 A;  1TY2 A;  3DBS A;  4LNI A;  4NAW B;  3L13 A;  1JRO A;  4FJV B;  3PHX B;  2YLM A;  3AV8 A;  2PE6 B;  4YWG G;  3SHQ A;  2JQR B;  4W9I A;  2LGI A;  4FHK A;  3NHE B;  4AOF A;  1FFU A;  3ZNZ B;  1T5X D;  2YEP B;  3BYT B;  3BYY B;  3M3J A;  2X8X X;  3OWE B;  1XXG A;  3IFW B;  4LNK A;  4KIK A;  1IBX B;  2LAS A;  1CK1 A;  5BMI A;  1QOF A;  3RNC C;  4PT5 A;  1L7Y A;  2N9P C;  4EEW A;  4YL8 A;  5E6J A;  1PUT A;  4ZRQ A;  4JQW C;  2Z0E B;  3TMP B;  3OAW A;  1YD8 U;  3DQV A;  3P63 A;  2WXF A;  2AWT A;  1HZ6 A;  2A5U A;  3I63 C;  1P1A A;  3A4S C;  2WU2 B;  2ZEQ A;  1RRB A;  4BOZ B;  3AEG B;  1QIL A;  2E3T A;  4TUU A;  1ZXH A;  2WX0 A;  2HTH A;  2BS4 B;  2MRP A;  3QHT A;  4C7Z A;  1WX7 A;  3LDZ E;  3DHH C;  3AI5 A;  3ZRC A;  2BS2 B;  4OZB A;  5LLI A;  1YQ3 B;  3M62 B;  1T0Q C;  3AMZ A;  3EC8 A;  2KMM A;  2DAF A;  2KDF B;  1A5R A;  3VUX A;  2MEK A;  2KWV B;  1JWU D;  4IWP A;  5DPS A;  2LJI A;  2D3A A;  4N58 A;  1RAX A;  1ZP0 B;  3IAM 1;  1WIA A;  1MG8 A;  2D2Q A;  4I6L B;  3Q3N C;  4ZRJ A;  2WXG A;  1NEN B;  1FIQ A;  3IT6 B;  4ZDV A;  1F2R C;  2QIL A;  1FCL A;  1SJH D;  1I4X A;  3RUI B;  2ZJD A;  1L6V A;  4OZC A;  5LNK 1;  4W9H A;  5G55 A;  4C7Y A;  1L2N A;  4AQ7 A;  3ONS A;  5AZG A;  3I9V 1;  2A4Z A;  3AE7 B;  4L23 A;  2HDE A;  3NZS A;  3MC8 A;  3WIM A;  1FMA D;  1MI0 A;  3P4P B;  2MX2 A;  2L05 A;  4USA A;  2W54 A;  2WYQ A;  2PMV A;  3AEF B;  3ENE A;  4ICV A;  1R4M B;  2JUO A;  3VRB B;  5IKC M;  2K3U A;  3RNG C;  1E90 A;  4RM8 A;  3DHI C;  4Q2J A;  2N9X A;  1NI3 A;  3N3K B;  4RF1 A;  3HIZ A;  2MCN B;  2Z8L A;  3QA8 A;  2MBE A;  4TQ1 A;  2TSS A;  2PE9 A;  2B76 B;  2LHE A;  1YOV B;  1TS3 A;  3AEB B;  3OLM D;  2BGF A;  5EE9 A;  2M19 A;  1N63 A;  4E74 A;  2WX1 A;  3JW0 X;  2VZK D;  3VXW A;  4MGK E;  1CMX B;  4B0E A;  5J17 A;  3M63 B;  3ZDT A;  4F7Z A;  2WQY B;  2FBW B;  1I4Q A;  3ZXR A;  3URY A;  1HQR D;  2DX5 B;  3NVV A;  4LLG M;  5AUI A;  3ZIM A;  3R8B A;  2ZNV B;  2GBN A;  1V80 A;  5G5G A;  5JXV A;  2MJ3 A;  1Q0W B;  1XO3 A;  2H89 B;  2KLC A;  3MJ5 A;  3ZNG C;  1HXY D;  2IYD B;  1XT9 B;  2WNM A;  2KMC A;  1YN4 A;  1UWX A;  4JGH B;  2Y3A A;  3PVL A;  2KLG A;  1FPY A;  4KDL B;  4S17 A;  1DOY A;  2ICI A;  1QOB A;  4XZ4 A;  1KRH A;  3IVF A;  5GMV A;  3ZUN A;  1GJZ A;  1E7P B;  2KAC A;  1XLN A;  1WX8 A;  4C4V A;  4ARC A;  2LHD A;  2DYO A;  1KTK A;  3APC A;  1Z5S B;  3A33 B;  1ZXI A;  2CJO A;  3B1L X;  1HE8 A;  1SJE D;  1GC7 A;  4TQ0 A;  4P1C C;  5J18 A;  2BB6 A;  5EDS A;  5DCN A;  2CHZ A;  2AYO B;  1SE9 A;  3A1Q A;  4AWJ A;  1R7S A;  3Q8C A;  1L6U A;  1P7F A;  3QCA A;  1JQ4 A;  1NYQ A;  5IA7 A;  4EFO A;  3PPA A;  3UQA A;  4CQN A;  1JAL A;  2WXR A;  3L17 A;  5TSS A;  1C76 A;  2UYZ B;  5BYQ A;  4US9 A;  2LVQ A;  3CWI A;  1R4M I;  1PQS A;  2V9H A;  1PGA A;  3UGB B;  2L32 A;  4K3C A;  2WXJ A;  5CHV C;  4WJO A;  4ZHP A;  3VQI A;  1SXT A;  3P4S B;  4G3X B;  3GZN B;  2V1Y A;  1R4N B;  2C5L C;  4KZ0 A;  4JPS A;  5BO4 B;  4HRS A;  2JWU A;  1WGR A;  2INP E;  3P4Q B;  3W5U B;  1M94 A;  1WGG A;  3FIL A;  1F52 A;  2KZR A;  4F1S A;  3ZTC A;  3KYD D;  1NBF C;  4EOY A;  2PJH A;  4LDT B;  5L83 A;  1JCK B;  3X0W A;  3VRA B;  2DYM A;  4HK2 A;  4REZ A;  1E7V A;  1MPE A;  4M02 A;  4B9K A;  2JX5 A;  4BFR A;  3N1Y C;  4L1B A;  4XWT A;  3TSS A;  3AU5 A;  1YN5 A;  2W9N A;  3TL5 A;  2MW5 A;  3IHP C;  2WXI A;  3BVZ A;  3CF6 E;  1K51 A;  2N1V A;  1UUP A;  3A4R A;  1TJE A;  3OG5 A;  4LDT D;  1SSN A;  1WXM A;  1JML A;  1RFK A;  3RCZ A;  2M17 A;  2Z59 B;  2N4F A;  1U4A A;  4GMV A;  2BTE A;  1EF1 A;  2N9E B;  3KUC B;  1D3Z A;  3B08 A;  3PGE A;  1YX6 B;  4RGM A;  2MH7 A;  5IP4 D;  4P7I A;  4GDL A;  4W9E A;  3VHT C;  3AEA B;  4DXG A;  4C80 A;  2KK8 A;  4MEM A;  4CHK A;  2KWD A;  4M0W A;  1XLP A;  1IYF A;  2CJN A;  2KTR A;  2KJ6 A;  2DHZ A;  4IM3 A;  4KX6 B;  3ZO5 B;  1NEK B;  1QF6 A;  2L76 A;  4A55 A;  4BZA A;  1ACC A;  1WM2 A;  1P3Q U;  2KVZ A;  2LRW A;  3Q2A C;  4HXD A;  3PRE A;  1UBQ A;  3HK0 A;  2K5P A;  1QKZ A;  3DPD A;  2FNJ B;  1L4D B;  2Y5P A;  2O6V A;  2NCN A;  2NPT B;  4MEL A;  2N7D A;  2K1F A;  2KAN A;  3EEC A;  3ZQ4 A;  4NZL B;  2AQ2 B;  2NBU A;  3A1Q B;  1PGX A;  3AE4 B;  3AE2 B;  4EZL A;  3KQ4 A;  3Q8F A;  2RMM A;  2GI9 A;  3ZJV A;  5BYS A;  2BKR B;  3AE1 B;  2XK5 A;  3ETR A;  5IO9 A;  3IT4 B;  3GZN I;  2Y5C A;  4NY0 A;  4YSZ B;  1R4N I;  1WRI A;  3V60 A;  1T0R C;  3DCG A;  1TTN A;  1WMH A;  4W9D A;  4WH4 A;  1NI2 A;  2D3C A;  3DWM A;  1P98 A;  2BPS A;  2PKO A;  4US8 A;  2ONQ A;  1SB3 C;  3U8Z A;  4ACF A;  3U4E G;  3KYC D;  2DZM A;  2JVC A;  1EWY C;  3EHV A;  1A70 A;  3BII D;  4F8C B;  1E6E B;  2IZV B;  3KH0 A;  3N30 A;  1UEL A;  3DDC B;  3FIL B;  2MP2 A;  2WXP A;  1E8W A;  2GBR A;  4YTM B;  4IW0 A;  1T6B X;  4MJS A;  3DOW A;  2WLB A;  3CMM B;  3AUL A;  2J0K A;  2R61 A;  3RUL A;  4RMA A;  2V4I B;  2HJ8 A;  2M8S A;  1ZW7 A;  4ASW C;  2MHJ A;  3N1Z C;  2MBB B;  3R2T A;  1VJK A;  4AP4 C;  3MTN B;  4XYC A;  4S0R A;  2ZPY A;  2WXL A;  3A9K A;  1YJJ A;  2INN E;  2G9H D;  4WJP A;  4BOS C;  2N1W A;  5KHQ A;  1LM8 B;  2IJ0 A;  1ROE A;  1SE2 A;  2K6Q A;  2OHF A;  2QSD A;  4AS1 A;  3ABV B;  3DBL I;  1VDV A;  1ZDX A;  2WHI A;  3KLS X;  2RSU A;  3EA6 A;  1Q10 A;  5MPO A;  2FUG 1;  2KVR A;  4D2K A;  3HVD A;  5D3I B;  4BKS D;  5DPR A;  2FUH B;  3L08 A;  4EUT A;  1F1H A;  3DBH B;  1KJT A;  5EE3 A;  1Y56 A;  3BVG A;  4M0W B;  1N62 A;  3RI7 C;  1XEE A;  1CJE A;  1YIW A;  3QAR A;  1P7E A;  3R7R A;  1WF9 A;  2MBO A;  3NG0 A;  3TJP A;  4GLS C;  4XWW A;  1UH6 A;  1G6J A;  2KDI A;  1GNU A;  3Q8E A;  4LCD E;  2NBV B;  1MJD A;  3ZW3 A;  1VZ8 A;  2MWS B;  2O6V B;  1NYR A;  4WJQ A;  2LI5 A;  3NRZ A;  2BBC A;  2QC8 A;  1C9F A;  4NJ7 A;  1MHH E;  2ZZP B;  5C3J B;  3KW5 B;  2FID A;  3AEE B;  3VH4 B;  1IGC A;  2LGY A;  1JRP A;  1I42 A;  4B6W A;  2JXX A;  3LB8 C;  2QMT A;  4NQK E;  2K8H A;  2G3Q B;  3TBL D;  1SF0 A;  1WRD B;  1PDX A;  2WP9 B;  3AED B;  4JLC A;  1WMH B;  3A9J A;  2FCN A;  1FCC C;  4HPL B;  5AEK B;  4J3O D;  3JYU A;  1E8Y A;  4XDC A;  5E6P A;  2IBI B;  2N7E A;  2ASQ A;  3PV1 A;  5JH5 C;  2YVC A;  3SFE B;  2RGF A;  1BXT A;  3GE8 C;  1TGZ B;  4II2 B;  1V2Y A;  1DOI A;  1ISN A;  2KC2 A;  1V6E A;  2MP2 B;  4JX1 C;  1C4A A;  2WGS A;  3RNE C;  3LYY A;  4MJS B;  4X57 B;  1C4C A;  4M00 A;  3BZD B;  3NS8 A;  3O13 A;  2JY6 A; 
#chains in the Genus database with same CATH homology
 1C79 A;  1TS3 A;  2IGD A;  3AEB B;  1RWS A;  3C8Y A;  5EE9 A;  2M19 A;  1N63 A;  2V3P A;  4WIP A;  2SAK A;  4RNA A;  2OED A;  2HTM E;  3TEZ A;  2IPK D;  2WXH A;  1CZP A;  1GPX A;  1I4H A;  2VZK D;  1FNU A;  2ACZ B;  3NS1 A;  3U2S C;  4B0E A;  2WDR B;  1J7C A;  2WQY B;  4P6V F;  5FK9 C;  2FBW B;  1I4Q A;  2QIE B;  1PYW D;  3SR6 A;  1JWB D;  3URY A;  2QEJ C;  4JWU C;  1HQR D;  1KH0 A;  4A9A A;  2XNA C;  1C77 A;  1V1O A;  2IGG A;  3AEC B;  3NVV A;  1MHX A;  4LLG M;  5AUI A;  1EU4 A;  3R8B A;  1D5X C;  4RGT A;  1XCQ L;  1OQQ A;  1D6E C;  1ZOY B;  5G5G A;  4ARI A;  5JXV A;  4GDL B;  2MJ3 A;  2JSV X;  4YT0 B;  1V1P B;  1XO3 A;  1TKE A;  2H89 B;  3PO0 A;  1HZ5 A;  2EKI A;  3MJ5 A;  1HXY D;  2LUM A;  1GAQ B;  4KKJ A;  5FKA C;  1QOA A;  2NTT A;  2WNM A;  2D5G A;  5EE1 A;  1YN4 A;  1UWX A;  2Y3A A;  1HA5 A;  1L0X B;  4WUR A;  3AE8 B;  1FXA A;  1TKG A;  1DOY A;  2ICI A;  4OW0 A;  2FE8 A;  3AE6 B;  1KF6 B;  1QOB A;  2WU5 B;  4ZRP A;  1LO5 D;  1XLQ A;  1KRH A;  1E7P B;  2KAC A;  1XLN A;  3MP9 A;  1V8C A;  1CQV A;  1OQR A;  1VZ7 A;  5HHD G;  2N9K A;  3AB5 A;  1B9R A;  3RPF C;  2DBY A;  1EU3 A;  2JU6 X;  2W55 A;  1I4P A;  2WDV B;  4ARC A;  1AN8 A;  1I7H A;  2X38 A;  4EE2 A;  2LHD A;  2DYO A;  2W3S A;  4N6E B;  1KTK A;  1E0Z A;  4RH6 A;  1ZXI A;  2WXN A;  1N60 A;  3BWU D;  5FR3 A;  1VZ6 A;  2CJO A;  1SJE D;  4B0M A;  3BVM A;  4WAF A;  5AUK A;  1TS2 A;  3NVZ A;  5H8Y E;  4TQ0 A;  2BB6 A;  2EEL A;  3IAS 1;  1WYG A;  1C4P A;  5C2T B;  1ESF A;  1DYQ A;  1R7S A;  3DWG C;  1L6U A;  1P7F A;  3Q8C A;  1JQ4 A;  1NYQ A;  4ZOH C;  4YXD B;  1SEB D;  1D5M C;  2I38 A;  4CQN A;  1JAL A;  3ZYY X;  3MFG A;  2WXR A;  5TSS A;  2PVO D;  2CU3 A;  2WDQ B;  1C76 A;  2AX5 A;  2J52 A;  2LEK A;  4WWM A;  1FXI A;  5BYQ A;  1K53 A;  2KAJ A;  4US9 A;  1L5P A;  2KN4 A;  3CWI A;  2RPV A;  2IDY A;  3UI3 A;  1FNV A;  1PGA A;  1L0Y B;  1J7A A;  2K0P A;  1KFY B;  4XE0 A;  3VR9 B;  1ET6 A;  2L32 A;  2WXJ A;  4ZHP A;  2N9L A;  4TMA B;  3VQI A;  1SXT A;  3P4S B;  4C56 C;  1E10 A;  1AWD A;  2MJD A;  3MHZ A;  3N9Y C;  3R2I A;  2W82 A;  2BS3 B;  1N5X A;  4JPS A;  4NAM A;  4HRS A;  2JWU A;  1FRR A;  2INP E;  3BK1 A;  3W1S A;  2MJE A;  1L0V B;  4IOI E;  1TS5 A;  3P4Q B;  3W5U B;  4A90 A;  3AE5 B;  5D7G A;  2K9X A;  4ZYS A;  3TUO A;  1FRD A;  1SIJ A;  3FIL A;  1QOG A;  3PZ8 A;  1YJI A;  1DOX A;  2WS3 B;  5T8I A;  1YN3 A;  1RM6 C;  4YTP B;  1RYJ A;  2V0G A;  5BYR A;  1F0Z A;  3AM9 A;  2G1E A;  1JWA D;  3LXF A;  1JWS D;  1JCK B;  3VR8 B;  3P4R B;  3J9C A;  3PZ7 A;  3VRA B;  2DYM A;  1N5W A;  4A6Q A;  3E56 A;  3B9J A;  4REZ A;  3T3O A;  3EUB 2;  1ZDV A;  4H2A A;  2IGH A;  2M0A A;  2PIA A;  1MPE A;  3GB1 A;  4MAC A;  3NUH B;  5I4D A;  3U52 E;  2WXK A;  2JX5 A;  2PLP A;  3NZ3 A;  1PFD A;  4P16 A;  4L1B A;  4XWT A;  1YNT E;  1XLO A;  4GDK B;  3TSS A;  4A8X C;  1YN5 A;  1WXQ A;  3FAH A;  1OFF A;  2L83 A;  2SEB D;  2WXI A;  3GS2 A;  3BVZ A;  1B1Z A;  4N59 A;  3SFD B;  2V3N A;  1TZO A;  1VLB A;  1K51 A;  1KLG D;  3RFZ B;  1UUP A;  1SE4 A;  1TJE A;  1E9M A;  4HEA 1;  1SSN A;  3NVY A;  1JML A;  1AYF A;  1RFK A;  1XF5 L;  2PTL A;  4HRO A;  3AE3 B;  2PVG C;  3HUI A;  4MM3 B;  2BTE A;  2DWQ A;  2NMQ A;  4TSS A;  1MVK A;  1V97 A;  3Q69 A;  1F77 A;  2JYE A;  4L2Y A;  4RGM A;  2MH7 A;  2BW2 A;  3V05 A;  2L52 A;  3AEA B;  2I2Y A;  4DXG A;  4C80 A;  1VRA B;  1EM7 A;  1UNS A;  2JXT A;  1ENF A;  2KWD A;  4M0W A;  1XLP A;  2CJN A;  2N0S B;  1UWM A;  1BUI C;  4KX6 B;  1XCT L;  2AQ3 B;  4YTN B;  1FEH A;  1NEK B;  1QF6 A;  1I4G A;  2YEP F;  4A55 A;  2W3R A;  4UDU C;  3L4P A;  3MC0 B;  3U7Z A;  4OVZ A;  1ZUD 2;  1ACC A;  3ZGZ A;  3B2F A;  3I57 A;  1ZE3 D;  3P1M A;  2RDH A;  2K5P A;  1QKZ A;  1L4D B;  2Y5P A;  2DLB A;  4KGT A;  2J42 A;  4LTU A;  4HKQ A;  1FM0 D;  4XDD A;  2BYT A;  1HEZ E;  2QJL A;  4IKG A;  2BB5 A;  4IDI A;  1WGK A;  3ZQ4 A;  3TEW A;  1WSP A;  4NZL B;  1GB1 A;  3V3X A;  2AQ2 B;  3WCQ A;  1PGX A;  3AE4 B;  3AE2 B;  2WXO A;  3KQ4 A;  3Q8F A;  2RMM A;  2GI9 A;  3ZJV A;  1FO4 A;  2ON8 A;  5BYS A;  3AE1 B;  3AH7 A;  3ETR A;  3IT4 B;  1TY2 A;  4ITK A;  2Y5C A;  1PGB A;  2PW9 A;  3CIR B;  4YSZ B;  4HKZ E;  1WRI A;  4NAW B;  1JRO A;  4OZA A;  3KWL A;  4WH4 A;  3AV8 A;  1AW7 A;  1FNW A;  2PKO A;  3DWM A;  4US8 A;  2ONQ A;  2Q5W D;  1SB3 C;  3AN1 A;  4YWG G;  3U4E G;  2JQR B;  4MT5 A;  1WWT A;  2LGI A;  1EWY C;  1GB4 A;  2RDG A;  1FFU A;  4DXF A;  1T5X D;  1A70 A;  2YEP B;  2WXM A;  3BYT B;  3BYY B;  1F2R I;  3BII D;  1E6E B;  5EE0 A;  1J7B A;  3OWE B;  1XXG A;  1IBX B;  1ZPS A;  2LMC A;  3KWV A;  3W2D A;  2AQ1 B;  4RGN A;  3E9S A;  1CK1 A;  5HI1 A;  5BMI A;  3FIL B;  2H88 B;  1QOF A;  2WXP A;  2VZK B;  4YTM B;  4PT5 A;  1T6B X;  4O1N A;  2WLB A;  4ZHO A;  2XN9 C;  5BMG A;  5E6J A;  3TEX A;  3W5V B;  1PUT A;  4ZRQ A;  3W9C B;  1SE3 A;  2N7J A;  2GRI A;  2R61 A;  4HJG E;  4JWS C;  2V4I B;  4YSX B;  1IGD A;  3P63 A;  2WXF A;  1HZ6 A;  2J53 A;  2WU2 B;  3R2T A;  3AEG B;  1VJK A;  2ZW0 A;  3P42 A;  1QIL A;  2E3T A;  1ZXH A;  3SEB A;  2ZW1 A;  2WXL A;  2BS4 B;  4RCO A;  1YJJ A;  2INN E;  4C7Z A;  2G9H D;  4WQM A;  3B2G A;  5D3D A;  2IJ0 A;  1ROE A;  1SE2 A;  2GB1 A;  2OHF A;  2QSD A;  2BS2 B;  4OZB A;  4AS1 A;  3ABV B;  1YQ3 B;  4RGO S;  1IUE A;  1VDV A;  2M56 B;  2WXQ A;  3HVZ A;  1V1P A;  1ZDX A;  3KLS X;  2KDM A;  3BK2 A;  1TKY A;  4DQO C;  5MPO A;  3EA6 A;  1Q10 A;  3AMZ A;  2FUG 1;  4D2K A;  3HVD A;  2KMM A;  5D3I B;  3ZJT A;  1TYG B;  1N61 A;  1KLU D;  3H8H A;  2BT6 A;  2L1A A;  4RF0 A;  1FD6 A;  5HFY A;  2MEK A;  1YQ4 B;  2JYT A;  5EE3 A;  1JWU D;  1Y56 A;  3BVG A;  2LJI A;  4N58 A;  1N62 A;  4YSY B;  1JW9 D;  1ZP0 B;  1XEE A;  1CJE A;  3IAM 1;  1K52 A;  1P7E A;  5H92 C;  3TEY A;  1JWM D;  4FXC A;  2WXG A;  4KGR A;  4GLS C;  1NEN B;  1EWC A;  4XWW A;  1FIQ A;  3IT6 B;  3Q8E A;  1F2R C;  2QIL A;  3FC4 A;  1FCL A;  1SJH D;  1I4X A;  3IXS A;  2E6X A;  4MH8 A;  2J4X A;  1M4V A;  1VZ8 A;  1TS4 A;  1L4Z B;  1L6V A;  1NYR A;  4OZC A;  1QLB B;  4R3D A;  5LNK 1;  2JZP A;  1K50 A;  1NVI D;  1STE A;  1GOZ A;  4KKI A;  4LK0 M;  3NRZ A;  4C7Y A;  2K22 A;  2BBC A;  4NJC A;  4AQ7 A;  3I9V 1;  1C9F A;  1MHH E;  1I4R A;  5C3J B;  3AE7 B;  4L23 A;  2HDE A;  1FFV A;  3AEE B;  1ET9 A;  3HRD D;  1FMA D;  3AE9 B;  4JE3 B;  1IGC A;  1MI0 A;  3P4P B;  4OHJ A;  1UGJ A;  4RFB A;  5HG2 A;  1JRP A;  3T3N A;  2LFI A;  4USA A;  1D5Z C;  2W54 A;  3LB8 C;  2QMT A;  1SF0 A;  2PMV A;  1PDX A;  3AEF B;  2WP9 B;  1YMH E;  3AED B;  3VRB B;  1FCC C;  3ZJU A;  2K3U A;  5BMH A;  4KGS A;  4J3O D;  1SBB B;  1QQR A;  1BML C;  4XDC A;  4Q2J A;  1T3Q A;  3Q8B A;  5GXG B;  3GP7 A;  1C78 A;  3Q8A A;  1D4B A;  1NI3 A;  3SFE B;  1BXT A;  1QT9 A;  1DOI A;  1IBX A;  4RF1 A;  1TY0 A;  3NVW A;  5G5H A;  4JX1 C;  1C4A A;  2Z8L A;  2NTS A;  1VR9 A;  3LYY A;  1DGJ A;  4TQ1 A;  3EGR A;  1C4C A;  3BZD B;  2TSS A;  3O13 A;  2KQ4 X;  2B76 B;  2LHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...