4HJGE

Meditope-enabled trastuzumab
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
62
structure length
62
Chain Sequence
EVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYAALLAKVNGEYTADLEDGGNHMNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Trastuzumab light chain
publication title Identification and grafting of a unique peptide-binding site in the Fab framework of monoclonal antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2012-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4hjgE00
1XCQL 2EELA 1IBXA 5JXVA 2J53A 1C9FA 4IOIE 3FILB 2IGGA 2LUMA 1F2RC 2OEDA 1FCCC 5HI1A 1K53A 1F2RI 1K52A 2RPVA 1YMHE 1JMLA 3UI3A 1K51A 2N7JA 2QMTA 2GB1A 1XF5L 2PLPA 1HZ6A 2JZPA 1UWXA 4KGTA 1GB4A 2GI9A 3FILA 5HFYA 1ZXHA 2I2YA 4HJGE 2PW9A 2KN4A 1PGBA 3V3XA 3GB1A 1HEZE 2ZW0A 3MP9A 2NMQA 2JWUA 2KACA 2PTLA 2KQ4X 2ON8A 2N9LA 1IBXB 1PGXA 1FD6A 1IGDA 4MACA 1MVKA 5BMIA 1XCTL 1FCLA 2J52A 4OZCA 2LGIA 2LHDA 2QSDA 2LHEA 2I38A 1EM7A 2ONQA 1MI0A 1P7FA 1MHHE 1K50A 4HKZE 1D4BA 5BMHA 1P7EA 5BMGA 4GLSC 2RMMA 1IGCA 1Q10A 2JXTA 2IGHA 4OZBA 5HG2A 1MHXA 1GB1A 1YNTE 2N9KA 4D2KA 2JSVX 4KGRA 4KGSA 2K0PA 1KH0A 4OZAA 1HZ5A 2ZW1A 1PGAA 4IKGA 2KDMA 5HHDG 1MPEA 2JU6X 4WH4A 2IGDA 2KWDA 1QKZA
chains in the Genus database with same CATH superfamily
3EUB2 3O13A 1IPGA 4P16A 2QJLA 1R7SA 4K81A 3P4SB 1SIJA 1E7PB 1IP9A 2H88B 1KLGD 4MH0E 1L4ZB 1HTQA 2RD0A 4IUMB 1J8CA 1U4AA 3HM6X 1N5WA 3N1XC 3ZNZB 2SAKA 2O2VB 2KJ6A 2W82A 3H1UA 2ASQA 2KJHB 3GZNI 1XLOA 1EF1A 1B1ZA 1FXIA 3Q3NC 1GC7A 2BKFA 1TY0A 4GMVA 5TR5A 4DHZE 3M62B 1L0XB 2JRIB 1YOVB 1JW9D 5E6OA 1WGHA 2GOWA 4DXFA 3NRZA 3VR8B 3Q8BA 3DVNV 1PUTA 2JPHA 4LDTD 3SU8X 3NOBA 3VHTC 1Y8RC 1QF6A 4ZHPA 3KYCD 3BWUD 4FHJA 3EECA 4TSSA 2LHEA 1K8RB 4TV3A 1FM0D 3VUYA 3Q3MC 1N62A 3PTFC 4NY0A 4BBNC 4W9EA 3VAWA 5CHVC 1L2NA 2DX5B 3I9V1 1E8WA 2IGHA 4OZBA 2JYTA 3KUZA 2KQ7A 3DVNU 5EE0A 2M4NA 2FCSA 3S2AA 4PT5A 1V6EA 4WAFA 4AS1A 2JRHA 2Q5WD 3SDLC 2KOXA 4TQ0A 1J19A 4C4VA 4YSZB 2FCNA 3FILB 3P63A 4TKNA 2QHOA 3P4QB 2KT7A 1CMXB 2YVCA 2KDFB 2PE6B 2Y5BB 4ARCA 1V80A 2MHJA 2J0KA 1YX5B 2DENB 4RNAA 4FJYA 2WS3B 4WAAA 1M94A 1XF5L 2V4LA 2JZPA 1UWXA 3AE1B 4P6VF 3B1LX 2NS5A 2XNAC 2YEPF 2NTTA 4P1BC 1TS5A 2FCQA 3BVGA 5AUKA 4ARIA 1Q0WB 4AP4C 3T3NA 3NVVA 2R2OA 2PMVA 4MACA 4RH6A 4XWTA 3ZLZA 2W54A 2LGDA 1T0SC 2SEBD 1RWSA 4C56C 5DPTA 1J0GA 1FXTB 4HRSA 4MM3A 2LVQA 2KN5A 3C19A 3A4SC 1ZKHA 1DOIA 2AWTA 4YXDB 2JYEA 3M95A 2M8SA 2QILA 4USAA 1GB1A 3WALA 2WXMA 3RNFC 5KHQA 3L0WB 4MDKE 1QLBB 1WRDB 4XGAB 1WMHB 2L76A 3CF6E 3DBHI 3R2IA 2KHWB 2I2YA 1OQYA 5IN7A 3I3TB 4RMAA 3D32A 2M0AA 4WJNA 1XLQA 3VUXA 3ONSA 2D3GA 2IDYA 4DK5A 3QARA 4RGOS 1WWTA 4YSXB 1KOTA 4RGNA 3ZXVA 1TJEA 1ZUD2 3DHGC 4A9AA 2FIDA 5FKAC 4LLGM 5BYQA 4RGTA 1WX8A 3MHSD 4YL8A 1WJUA 3L10B 4LNNA 1D5MC 2MRPA 3KVFB 3APDA 1M4VA 4EEWA 1J7AA 2L05A 1H8CA 3CMMB 3VTWA 2LGSA 3AE9B 2K8HA 4X57B 3W9CB 4K3BA 3B9JA 3QK0A 3IAS1 2V1YA 2Y3AA 1IUEA 1DOYA 2M1MA 1PGXA 3RD2A 5BMIA 1VJKA 1FCLA 2IO2B 4ANUA 5EE9A 3W5VB 2J4XA 1HXYD 3PT2B 3TEZA 2FNJB 2CKHB 4N58A 3W5UB 4PK1A 3ZKJC 4JL9A 1E90A 4WQOB 3SEBA 1VCBA 2L1AA 3H6NA 5LNK1 2HDEA 2RMMA 5T8IA 2LGXA 1Q10A 2C7HA 4NAMA 2JXTA 4WWMA 4YTPB 2C7NB 4IWPA 3H9DA 4C00A 2GBNA 3KLSX 5D2MB 4DQOC 1UBQA 3J9CA 1SF0A 1YN5A 3DWGC 2G1EA 4WH4A 5L95C 1WGGA 2D3CA 3Q3FA 1EO6A 3Q3JA 1WX7A 4BKSA 2MEKA 2WDRB 4OHJA 4GOCA 3RNEC 4S0RA 5G2NA 3DCGA 3V05A 4FADA 3PS6A 2G3QB 3HVDA 3UGBB 3KUCB 1T0YA 3Q8CA 3HUIA 4MM3B 4K3CA 2D3BA 3LDZE 4IWOA 4AJWA 4W9FA 4K7SA 2QC8A 1FRDA 3HK0A 2E6XA 1C4PA 3OG5A 3ZNID 2ZCBA 3NVZA 1IYFA 4MGZE 1ENFA 3AB5A 1E8XA 1QZEA 1H4RA 2V0GA 4CYEA 2HJ8A 2IO1B 1WGDA 2GI9A 2MWSB 2JVCA 2KC1A 1ZXHA 3HIZA 3N1ZC 4LJPB 2NBVB 3RCZA 2KFJA 5H92C 3V3XA 1E6EB 2JZZA 5EE3A 1GJZA 2K22A 4OVVA 2KACA 3RNCC 1ZW7A 2PVGC 1V81A 3EA6A 5DPSA 1UBIA 3VTUA 3A1QA 2INCC 2LJIA 4HJKA 2KO3A 3FAHA 4FLHA 2X38A 3AU4A 1KF6B 1STEA 1HE8A 4NNJB 2KFKB 2BF8B 1DYQA 3WANA 1D3ZA 1ET6A 1V2YA 5IKCM 4GLSC 1TIFA 4US8A 3URYA 2L32A 2CJNA 4AQ7A 3PZ7A 3JSVA 2OHFA 3PVLA 4MGIE 3PV1A 4CQNA 4NPNA 3QJZA 1WGRA 1ISNA 3ZGZA 2AYOB 2EKIA 5JXVA 2K5PA 5BO4B 4EKUA 3GE3C 3ZUNA 5EDSA 2IGGA 4MJSB 4W9CA 3AM9A 3AEDB 3T3OA 2JQRB 1F2RI 2M0XA 2MLBA 4S17A 2WXGA 1ET9A 3PLVA 2PEAA 2GMIC 3B2GA 1JROA 5I4DA 2GRIA 5LXIB 3RT3B 3LYYA 3U7ZA 1T0RC 1VD2A 2ZNVC 5G5GA 1XLPA 3AE8B 4HPLB 2INPE 4R3DA 4OW0A 2AL3A 2IY1B 1PGBA 4GDKB 3TMPB 1V9JA 3ZYYX 2JUOA 4HXDA 1I4QA 4F8CB 4DBGA 2WU5B 1TKEA 2BQQA 1V86A 2ZZPB 1UGMA 1EUVB 1IGDA 1RM6C 2N9EB 4JGHB 2INNE 2JY6A 1WF9A 4KSLC 2DAFA 1V1PA 2KDEB 1EWCA 2X8XX 3PGEA 1JRPA 4HPPA 1P7FA 2K9XA 2IO0B 2EMTA 3AMZA 4B0MA 1KFYB 1YQBA 2TSSA 4RF0A 4LTUA 3B2FA 1WGYA 3GZNB 5C3JB 4A55A 3NY5A 1GNUA 2UYZB 2N1VA 2NCNA 4WWNA 3ETRA 3N32A 1NI3A 1F1HA 5FR6A 3W2DA 5HHDG 2RDHA 2N9XA 2MW5A 2QEJC 2C7MB 3OWEB 1XCQL 2VZKD 2KTRA 2WXLA 4E71A 4N9F4 2DYOA 1JRUA 3A9JA 3NZUA 4QAYA 2IJ0A 3NVYA 1I4XA 2CR5A 5LXHA 2K3UA 1YMHE 4LDTB 3TEWA 1E8ZA 3UI3A 1JWSD 2RSUA 1K51A 2KYWA 4E3CA 1UF0A 2PPHA 1FFVA 3PRMB 1HZ6A 3CSFA 2FUG1 2XK5A 2LEKA 1KM7A 5C1ZA 1V1OA 3MTNB 4HVBA 3JSVB 4PS8A 1SXTA 2QIEB 4ANXA 4RM8A 4GN1A 1UZXB 2RPQA 1TS2A 1S1QB 2JWUA 1E7VA 2KQ4X 1BUIC 1NEKB 1C4AA 1WR6E 3A33B 2VH1A 3DHHC 1FIQA 1ZDVA 2KD0A 5FK9C 3B08A 3QA8A 1WYGA 3R3MA 5TSSA 1MJDA 3RZFA 4HKZE 3MHZA 3IG3A 3VVWB 4KV2A 1WX9A 3ZJVA 3AN1A 2LZ6A 2E3TA 3APCA 1RYJA 1IGCA 4EOYA 2BB5A 4NQLB 4BZAA 3FC4A 4JLCA 1YJ1A 2KWUB 2OOBB 1Q1OA 3WAOA 2IYDB 2JX5A 4URKA 4ZDVA 4BFRA 4M02A 2JU6X 2IGDA 5D7GA 1NBFC 3NZSA 3BIID 4ZRKA 2WXNA 2AQ3B 2XBBC 3AE6B 4W9GA 1WE7A 3W1SC 3HHMA 3AEGB 1F52A 4YTMB 1V1PB 3L4PA 1C9FA 4GU2A 3L13A 2Z8LA 4RFBA 2KVZA 1V97A 1JMLA 2LVOA 1YJJA 4G3XB 2QMTA 3TUOA 4WWPA 4B0EA 4W9KA 2J7QB 1GB4A 1MG4A 1UD7A 2GBKA 3TEXA 3GS2A 1V5TA 2BGFA 5HFYA 2KKCA 2C60A 1YN4A 4ZOHC 3K9OB 4RF1A 4N6EB 2DWQA 2WX0A 3RNGC 2L0FA 4M8MA 2LFIA 3DBHB 4LNIA 1FD6A 1FNUA 2B76B 1WY8A 3VDZA 4DWFA 2MCNB 1L0YB 2ZJDA 2CHXA 4IDIA 1PQSA 1WRIA 2WXOA 4DXGA 1TBEA 3QQ8B 1FPYA 1LGRA 4KSKC 1MHHE 1FFUA 2MJEA 3ZVVA 5G5HA 2BPSA 2EKEC 3DOWA 1TS3A 1JWUD 4ZRIA 2ZPNA 1MG8A 2Y5PA 1XXGA 4EZJA 3IAM1 5HG2A 2C9WB 2FE8A 2GBJA 2KX3A 4JX1C 2A4ZA 2CJOA 3MFGA 2L7RA 3JVZX 3M63B 4B95A 2V3PA 2KDMA 3RUIB 1A5RA 4TUUA 1ZXIA 2BB6A 2UU7A 1WYWB 1J7BA 3R7QA 5CX3A 2EMSA 1I4RA 1VDVA 2DZIA 3X23A 1ESFA 1I35A 1N61A 4KIKA 2NPTA 5MPOA 2O6VA 2ZVOA 2JT4B 4PYUA 1Y56A 2LUMA 1QT9A 1C77A 4I6PA 1D6EC 5HI1A 3DBSA 4M01A 2MH7A 1C1YB 1QILA 4W9IA 4GGQA 2N7EA 1I7HA 4GSWA 1OGWA 1CQVA 1YD8U 4IC7B 5AEKB 1ZDXA 1XQQA 4LNKA 2I1JA 2IBIB 2LD9A 5JH5C 5IOIA 3X0WA 1WI0A 4GB9A 1T5XD 1WJ4A 2DZMA 3WCQA 4EZKA 3BINA 2G4DB 3AU5A 2N0SB 5C2TB 3MC9A 2PIAA 3N20C 3NVWA 3WA0A 4IM2A 2MBBB 3I63C 2DLBA 5CHFA 4BOZB 2K8CA 4MT5A 1BMLC 1N6ZA 4AJYB 1VR9A 3NS8A 4FBJB 3BVMA 1UUPA 5G55A 3P42A 4NQKE 2J42A 1LXDA 1MHXA 3MC0B 4C4VB 1VZ6A 4AOFA 1HZ5A 3Q8AA 3N30A 3DBRB 1SBBB 4O1NA 2BWFA 2KQSA 3VR9B 1Z2MA 3SHQA 2K1FA 3H7SA 4ICVA 1N5XA 4HPMB 1PDXA 3ML9A 2UWQA 1QOFA 2OEDA 3ZRCA 1NVID 1UH6A 4MGYE 4BOSC 4EE2A 5IO9A 1TTNA 3ZNGC 3N1YC 4HK2A 1PFDA 2GB1A 1QOGA 2KANA 1KRHA 4WQMA 1SE3A 1WSPA 1JWMD 3LJ3A 1P98A 2NMQA 3PPAA 1L5PA 2KWVB 3ZDTA 1RFKA 3Q2AC 2WXHA 1CJEA 1MVKA 3AEBB 3C0RB 4FN2A 2ZEQA 5LLIA 4LNFA 2J52A 1JCKB 2O6VB 1ACCA 4XDCA 1JWBD 2WXQA 2V3NA 5D6JB 2I38A 2A5UA 3DBRI 2H89B 2M17A 4ASWC 2W3RA 1D4BA 2LI5A 1P1AA 1P3QU 3JYUA 3U7DA 4KDLB 1WXSA 2INDC 4HDQA 1SJHD 5AZGA 2LWPA 1VZ8A 3QCAA 3VTVA 1WH3A 1YNTE 2N9KA 4OZAA 2GBRA 3UINB 1NI2A 1PGAA 3O65B 1RFAA 3WIMA 1YQ3B 2B3AA 2WXJA 1EU4A 2LXCA 3U4EG 3L16A 2J53A 1WXMA 5C23A 2GLSA 1FEHA 2AQ1B 1EU3A 2KMCA 3KWVA 1T3QA 2K25A 4C7YA 2KWCA 1DGJA 3KWLA 1YN3A 4RGMA 1EWYC 1MFWA 4CHKA 1NENB 1XEEA 3P1MA 5IAAC 2DZJA 2MX2A 3IVFA 3RZWC 3GP7A 2WHIA 3AEAB 2N4FA 2KN4A 4JPSA 1TYGB 1XLNA 2O2VA 2D11A 2L8JA 1WXAA 3NJTA 4ACFA 3PLUA 3H7PA 1OEYJ 4TQ1A 1JWAD 1ROEA 2I1KA 1OTRB 1TGZB 1YIWA 5AZHA 3VH3B 1DOXA 4W9LA 1MI0A 5BYRA 2V9HA 2VZKB 4I6LB 2IPKD 4DHJD 2KMMA 2FCMA 2WDVB 1E7UA 1WR1A 2V3SA 2KMAA 2CHWA 1SGHA 1SE2A 2K6QA 2WLBA 4MGKE 3TBLD 2WGSA 5BYSA 4II3B 1D5ZC 4NJ7A 2LMCA 2BS4B 4GXBA 1L0VB 2KDBA 3HM3A 2DZKA 2L83A 4IW0A 4KGSA 4KZCA 4P1CC 1KH0A 1WM2A 3Q8EA 3W1SA 3KW5B 4HKQA 3QWZB 1V49A 3DVGY 1XD3B 4M00A 4G50A 3Q14C 4J6IA 2KWDA 5JHAA 3IT4B 2WXIA 2FUHB 4AWJA 4GIVA 1TKGA 2WDTB 5E6PA 1TY2A 2QCZA 4EZLA 3L54A 4ZRJA 5AZFA 4J3OD 3U8ZA 3RNBC 1FO4A 1V5OA 2DHZA 5J17A 1VRAB 3ABVB 2K6DB 2N7JA 1E9MA 3UIPB 4XC2A 4YTNB 4BAXA 3TIXA 4KGTA 2VH2A 4FXCA 4MEMA 3PZ8A 1C3TA 3A1QB 3FILA 1Q5WB 2KLCA 3E9SA 2WDQB 4MELA 2OJWA 3ZO5B 4LJOB 4L1BA 2LXAA 2CU1A 2JXXA 2WU2B 2M56B 3PO0A 3ZXRA 4WJPA 5D94A 3K9PB 3C8YA 3V6CB 4HWIB 3AI5A 4A3PA 4HLEA 2DNFA 4OVZA 2BS2B 5D3DA 2M19A 2HTME 2QSDA 1TZ1A 4NZLB 2BYVE 4OVUA 4XE0A 2V4IB 1P0RA 3AE7B 3L17A 4FJZA 3IFWB 5JZEB 3ZQ4A 3AE3B 2LVPA 5L83A 1SE9A 3HRDD 4JQWC 2LJ5A 3A9KA 2WXFA 2MBHA 4KGRA 3UF8A 1L4DB 1XT9B 2K0PA 3AE2B 3AEFB 2BVCA 4JIOU 3ZW3A 4ICUA 1L6VA 4KKIA 4CO7A 2CS4A 2WXKA 4US9A 3APFA 4ZYSA 4RM9A 3TEYA 4G11A 4IM0A 4KKJA 4W9DA 3VRBB 2WWZA 2WXRA 3RMKC 3H7PB 5E6JA 4F7ZA 3BK1A 1WJ6A 2D3AA 1OFFA 2D07B 4KX6B 1R4MI 1WMHA 1K53A 2HJ1A 3UQBA 4BKTA 3TCAA 1FXAA 3FKYA 1KTKA 3E56A 1KJTA 2PLPA 1I42A 5HKHA 3IHPC 4M0WA 3P2BA 1SB3C 3R66C 2PW9A 1LM8B 2W9NA 2IO3B 3GB1A 2N7DA 2AL6A 2N9PC 1GC6A 1WJNA 2MA9B 5D3IB 1P9DU 2Z0EB 3IT6B 4IM3A 3GE8C 2KTFA 3AECB 2PTLA 2ON8A 5GXGB 2FIFA 1QOAA 2G4SA 1NYRA 1LQBA 2J0MA 3ALBA 4BKGA 3WAMA 1KLVA 1JQ4A 1TZOA 1UNSA 1ZGUB 1XO3A 3QX1A 4W9HA 5J2RA 1TS4A 3BY4B 3MJWA 2BBCA 2DYBA 4B6WA 3NHEB 3U52E 3KYDD 4Q2JA 2KTRB 2AQ2B 2HE7A 4BVUC 2D2QA 2LUEA 3A9JB 5FR3A 1NDDA 4N59A 2KJRA 2MJDA 3TSSA 3QHTA 2BYTA 4FA6A 1HTOA 3RULA 2MBEA 1WXVA 2HD5B 2MBQA 1AARA 3RYTA 3VFKA 3MJ5A 2BS3B 2XK5B 4PS3A 3QAQA 1L7YA 3AXCA 3B0AA 1GPXA 3EFCA 4FJVB 3P4RB 1K52A 2KX0A 4JWSC 2J0JA 4XWWA 4EUTA 2MBOA 2LASA 3Q69A 1VLBA 4PS7A 1ZE3D 3A9KB 4NJCA 2QDFA 1BT0A 2R2QA 4ZRPA 2BKRB 5GMVA 2JWZA 4ANVA 2WYQA 2KK8A 2ZPYA 2ZW0A 2FBWB 3MP9A 2BYEA 3EHVA 3NG0A 3N3KB 3SR6A 3SFDB 3VUWA 3T9LA 3GOEA 4AUQC 2MP2A 4NAWA 3AEEB 1TT5B 2KLGA 1WIAA 4WWOA 3LB8C 2LHDA 3DDCB 4XX5A 4MSQB 2CHZA 2WNMA 4ITKA 1KLUD 3R2TA 1A70A 4A8XC 1VZ7A 4W9JA 1F0ZA 3PHXB 4MH8A 4EFOA 2KVRA 2RDBC 4REZA 2ICIA 4M0WB 1GAQB 4UDUC 1WE6A 2JSVX 2YLMA 4WURA 3WAPA 1E10A 2ZVNA 3V60A 3AE4B 1RRBA 2KFKA 2LRWA 1YJIA 1CZPA 1G6JA 3VRAB 2XN9C 1QKZA 4ANWA 4HDOA 2BWES 5JHBA 3KUDB 1AW7A 1IBXA 1EF5A 3OJ4B 2W55A 2CU3A 3M3JA 4IOIE 1I4GA 2WX1A 3DHIC 1UGJA 4DHZB 1SSNA 3SFEB 1AYFA 4LK0M 2Z59B 3BVZA 2LGYA 1FNVA 2LRUA 4P7IA 3ECIA 1Z5SB 4IG7B 1AWDA 3CSTA 3T8MA 2BYFA 4II2B 4WJOA 1C79A 3CIRB 4ZYNA 3ZTDA 4A3OA 3UIOB 2KXJA 4F1SA 3ENEA 1WZ3A 3W1YA 2DYMA 4FHKA 1TKYA 3I57A 4YT0B 4MJSA 4C7ZA 3L08A 3ZRFA 1S3SG 1C76A 2G45B 2XEWA 3Q8FA 5AUIA 1WM3A 3QIJA 3DBLB 4JWUC 4KZ0A 2K8BA 2N9LA 1FMAD 4GDLA 3JW0X 1B9RA 1I4PA 2RR9A 3ML8A 4DXAB 4XDDA 4YWGG 1WFYA 1YQ4B 3QC8B 4G0NB 4XZ4A 1EM7A 1GOZA 4GDKA 2ONQA 3VH4B 1K50A 4I6NB 1PYWD 5BMHA 1J7CA 2OJRA 4RCOA 5DPWA 1AN8A 3DQVA 4LCDE 4K7UA 4WIPA 5E6NA 2L00B 4PYZA 3Q3OC 1SEBD 4HCNB 3BZDB 4L23A 4TMAB 3PREA 2NPTB 1C4CA 4KIKB 2Y5CA 2G9HD 5CTRC 1QOBA 1V8CA 3OAWA 3SD5A 3MC8A 4IWQA 4WJQA 3NZ3A 3NUHB 3R7RA 3ZDMC 2EELA 2AEHA 3KQ4A 3A4RA 2MQJA 3AH7A 1RLFA 1X1MA 2MP2B 3U30A 4NAWB 5H8YE 1E5WA 2MSED 5DCNA 2BT6A 3RNAC 2PKOA 1F2RC 5KHOA 3DPDA 3DBLI 2D10A 5EE1A 3PSEB 2KC2A 3BK2A 1YX6B 1R4NB 2AX5A 4L2YA 3TJPA 1E8YA 3ZTCA 4BBNF 3N9YC 3OLMD 4XYCA 4M8NA 3HVZA 4DHJB 2YEPB 2KNBA 1I4HA 2IZVB 3LXFA 2BTEA 3TL5A 1HQRD 3RN9C 2ACZB 1FRRA 2GBMA 2R61A 5IA7A 3BYTB 1N63A 2L52A 2JF5A 1IBXB 1N60A 4K1RB 3ZJTA 4FULA 2L3ZA 4OZCA 2LGIA 1WGKA 2NBWB 2JZ3B 1D5XC 1LO5D 1E0ZA 2O6VD 4KVGB 2DAJA 3KH0A 4DDGD 1P7EA 2BW2A 2WQYB 3P4PB 5IP4D 4K7WA 1CK1A 1GUAB 2KDIA 1OQQA 4LNOA 1C78A 1SJED 2HTHA 3R8BA 3ZJUA 3CWIA 2ZCCA 1ZOYB 2ZNVB 3V6EB 4B9KA 3NS1A 3AE5B 1R4NI 3EGRA 4A90A 3PZDA 3BYYB 4ZRQA 3U2SC 1T0QC 3V61A 4A6QA 3H8HA 4GDLB 1HA5A 3EFUA 1SE4A 2NVUI 1L6UA 3ZIMA 3RPFC 2RGFA 1UWMA 1ZP0B 2WP9B 2D5GA 1FCCC 4HEA1 1SIFA 3PRZA 1WZ0A 2NTSA 2RPVA 3UQAA 1GG3A 3DWMA 3I5JC 3VQIA 1OEYA 4HROA 1F9JA 2NR2A 3V62A 1RAXA 1UELA 3RI7C 4E74A 4ZHOA 2KAJA 2K39A 4YSYB 1QQRA 5J18A 2PVOD 1FNWA 4HJGE 2VRRB 2PJHA 3EC8A 4H2AA 4C80A 1HEZE 1JALA 2W3SA 3OJ3A 4KDIC 3VXWA 4A20A 4NJ6A 1XCTL 3RFZB 3IXSA 2Z0DB 1WXQA 2REXA 3IBEA 5CHWA 4MSMB 2MJ3A 1R4MB 5BMGA 2KZRA 2C5LC 1LFDA 1F77A 2L0TA 1T6BX 1ZPSA 2IY0B 1BXTA 2RDGA 3Q6BA 4BKSD 2WXPA 2FAZA 1OQRA 4JE3B 3AULA 4D2KA 3PHWB 2PE9A 4DDID 2N1WA 2ZW1A 4IKGA 3ZNHB 2DBYA 1NYQA 3DVGX 2NBUA 1MPEA 3PRPB 3AV8A 5DPRA 4HCPB
chains in the Genus database with same CATH topology
3EUB2 3O13A 3ZGZA 4P16A 1N5XA 2QJLA 2EKIA 5JXVA 2K5PA 1R7SA 3P4SB 1SIJA 1E7PB 3MJ5A 2BS3B 1PDXA 2H88B 1KLGD 1L4ZB 1N5WA 2IGGA 2SAKA 1GPXA 1QOFA 2OEDA 3AM9A 1NVID 3AEDB 3P4RB 2JQRB 1F2RI 2W82A 1K52A 3T3OA 4JWSC 4EE2A 2WXGA 1ET9A 4XWWA 3B2GA 1XLOA 1JROA 5I4DA 2GRIA 1B1ZA 1FXIA 3Q69A 1VLBA 3LYYA 1PFDA 2GB1A 1ZE3D 1TY0A 1QOGA 3U7ZA 4NJCA 1L0XB 1KRHA 4WQMA 5G5GA 1XLPA 3AE8B 2INPE 1SE3A 4OW0A 4R3DA 4ZRPA 1WSPA 1JWMD 1PGBA 1JW9D 4GDKB 3ZYYX 2ZW0A 3MP9A 2FBWB 2NMQA 4DXFA 1L5PA 1I4QA 3NRZA 3VR8B 2WU5B 3Q8BA 3SR6A 1TKEA 1RFKA 2WXHA 3SFDB 1PUTA 1IGDA 1RM6C 1CJEA 1MVKA 3AEBB 1QF6A 2INNE 3AEEB 2J52A 1JCKB 4ZHPA 1V1PA 3BWUD 3LB8C 1EWCA 2LHDA 1ACCA 4XDCA 1JWBD 2WXQA 2LHEA 2V3NA 4TSSA 1FM0D 2I38A 2WNMA 4ITKA 1JRPA 1KLUD 2H89B 3R2TA 1P7FA 1A70A 2K9XA 2W3RA 1D4BA 3AMZA 4B0MA 1N62A 1KFYB 4A8XC 2TSSA 1VZ7A 4RF0A 1F0ZA 4MH8A 4LTUA 3B2FA 5C3JB 3I9V1 1SJHD 4REZA 2ICIA 2IGHA 4OZBA 2JYTA 1GAQB 5EE0A 1VZ8A 4A55A 4UDUC 1YNTE 2N9KA 2JSVX 3ETRA 4WURA 1E10A 1NI3A 4OZAA 1PGAA 3AE4B 3W2DA 5HHDG 4PT5A 4WAFA 2RDHA 1YJIA 1CZPA 3VRAB 4AS1A 2QEJC 1YQ3B 2XN9C 1QKZA 2Q5WD 3OWEB 1XCQL 2VZKD 2WXJA 1AW7A 1IBXA 2WXLA 1EU4A 2W55A 3U4EG 4TQ0A 2DYOA 2CU3A 2J53A 4YSZB 1FEHA 2AQ1B 4IOIE 1I4GA 3FILB 1EU3A 2IJ0A 3P63A 3NVYA 1UGJA 3KWVA 3P4QB 1T3QA 4C7YA 1SSNA 3SFEB 1AYFA 1I4XA 4LK0M 4ARCA 3BVZA 1FNVA 2K3UA 1DGJA 1YMHE 4RNAA 3KWLA 1YN3A 3TEWA 4RGMA 3UI3A 1JWSD 2WS3B 1AWDA 1K51A 1EWYC 1NENB 1C79A 1XEEA 3P1MA 3CIRB 1FFVA 1XF5L 1HZ6A 2JZPA 1UWXA 3AE1B 4P6VF 2FUG1 2DYMA 2LEKA 2XNAC 2YEPF 3GP7A 1TKYA 1V1OA 3I57A 3AEAB 4YT0B 2NTTA 4C7ZA 2KN4A 1TS5A 1SXTA 2QIEB 4JPSA 1TYGB 1XLNA 1C76A 3Q8FA 5AUIA 3BVGA 5AUKA 1TS2A 4ARIA 4JWUC 2JWUA 3T3NA 2KQ4X 2N9LA 1BUIC 1NEKB 1C4AA 3NVVA 4RH6A 2PMVA 1FMAD 4MACA 4XWTA 2W54A 1FIQA 1ZDVA 1B9RA 1I4PA 5FK9C 2SEBD 4XDDA 4TQ1A 1WYGA 4YWGG 1JWAD 1ROEA 1RWSA 4C56C 1DOXA 1YQ4B 5TSSA 1EM7A 4HRSA 1GOZA 2ONQA 1MI0A 5BYRA 2VZKB 1K50A 1PYWD 2IPKD 3MHZA 2KMMA 2WDVB 4HKZE 5BMHA 1J7CA 1DOIA 4RCOA 3ZJVA 3AN1A 2E3TA 1AN8A 1SE2A 4YXDB 1RYJA 2WLBA 1IGCA 2JYEA 4WIPA 5BYSA 1D5ZC 2BB5A 2QILA 4USAA 3FC4A 1SEBD 1GB1A 3BZDB 2LMCA 4L23A 4TMAB 2WXMA 2BS4B 1C4CA 1L0VB 2Y5CA 2L83A 4KGSA 2G9HD 1KH0A 1QOBA 3W1SA 3Q8EA 1QLBB 4HKQA 2JX5A 1V8CA 2JU6X 2IGDA 5D7GA 2KWDA 3R2IA 2I2YA 3IT4B 2WXIA 3BIID 3NZ3A 3NUHB 2WXNA 2EELA 2AQ3B 1TKGA 3KQ4A 3AH7A 3AE6B 1TY2A 4NAWB 5H8YE 3AEGB 4YTMB 1V1PB 3L4PA 1C9FA 2M0AA 2BT6A 1XLQA 4J3OD 2Z8LA 2PKOA 1F2RC 2IDYA 4RFBA 1FO4A 4RGOS 1WWTA 4YSXB 1V97A 4RGNA 1VRAB 1JMLA 1TJEA 1ZUD2 5EE1A 1YJJA 3BK2A 4A9AA 3ABVB 2AX5A 5FKAC 4LLGM 4L2YA 5BYQA 2N7JA 2QMTA 1E9MA 4RGTA 4YTNB 3TUOA 4KGTA 4B0EA 3N9YC 4FXCA 1D5MC 1GB4A 3PZ8A 1M4VA 3FILA 3TEXA 3E9SA 3HVZA 2WDQB 3GS2A 5HFYA 2YEPB 1J7AA 1I4HA 1YN4A 4L1BA 3LXFA 4ZOHC 2BTEA 4RF1A 3AE9B 4N6EB 1HQRD 2DWQA 2ACZB 2WU2B 3W9CB 3B9JA 2M56B 1FRRA 3IAS1 3PO0A 2R61A 2Y3AA 2LFIA 3BYTB 1IUEA 1N63A 2L52A 3C8YA 1DOYA 1IBXB 1PGXA 1N60A 1FD6A 1FNUA 3ZJTA 5BMIA 1VJKA 2B76B 4OVZA 2BS2B 1FCLA 5D3DA 1L0YB 4IDIA 2M19A 5EE9A 4OZCA 3W5VB 2LGIA 1WGKA 1WRIA 2HTME 2QSDA 2WXOA 2J4XA 1D5XC 1LO5D 1E0ZA 4DXGA 1HXYD 4NZLB 3TEZA 1MHHE 4XE0A 2V4IB 3W5UB 4N58A 3AE7B 1FFUA 1P7EA 2BW2A 2WQYB 2MJEA 3P4PB 3SEBA 3ZQ4A 1CK1A 2L1AA 3AE3B 5G5HA 1TS3A 3HRDD 1OQQA 1JWUD 2HDEA 2RMMA 5T8IA 5LNK1 1C78A 2Y5PA 1Q10A 1XXGA 1SJED 4NAMA 2JXTA 4WWMA 4YTPB 3IAM1 3R8BA 5HG2A 2FE8A 3ZJUA 2WXFA 4JX1C 4KGRA 3CWIA 2CJOA 3MFGA 1L4DB 2K0PA 3AE2B 3KLSX 1ZOYB 3AEFB 2V3PA 4DQOC 2KDMA 3J9CA 1L6VA 1SF0A 4KKIA 1YN5A 2WXKA 3DWGC 3NS1A 2G1EA 3AE5B 3EGRA 4WH4A 4US9A 4A90A 4ZYSA 1ZXIA 3BYYB 4ZRQA 3U2SC 2BB6A 2MEKA 1J7BA 3TEYA 2WDRB 4OHJA 4A6QA 4KKJA 3H8HA 1I4RA 1VDVA 4GDLB 1HA5A 3VRBB 1SE4A 2WXRA 1ESFA 3V05A 5E6JA 3BK1A 1N61A 5MPOA 1L6UA 3RPFC 3HVDA 1UWMA 3Q8CA 1Y56A 2LUMA 1QT9A 1C77A 1OFFA 1ZP0B 2D5GA 2WP9B 3HUIA 4MM3B 4KX6B 1D6EC 1FCCC 4HEA1 5HI1A 1K53A 2NTSA 2RPVA 2MH7A 1QILA 3DWMA 1FRDA 2E6XA 1C4PA 1FXAA 3VQIA 4HROA 1I7HA 3NVZA 1KTKA 3E56A 2PLPA 1CQVA 1ENFA 3AB5A 2V0GA 4M0WA 1ZDXA 2GI9A 4ZHOA 2KAJA 4YSYB 1QQRA 1SB3C 1ZXHA 2PVOD 1FNWA 4HJGE 2PW9A 5H92C 3V3XA 1E6EB 4H2AA 4C80A 3GB1A 1HEZE 1JALA 5EE3A 2K22A 5D3IB 2W3SA 1T5XD 3IT6B 3WCQA 3AECB 2KACA 2PTLA 2ON8A 2PVGC 3EA6A 2N0SB 5GXGB 1XCTL 3RFZB 5C2TB 2PIAA 1QOAA 3NVWA 1NYRA 2LJIA 3IXSA 1WXQA 1JQ4A 1TZOA 1UNSA 2DLBA 1XO3A 3FAHA 1TS4A 2X38A 1KF6B 1STEA 2BBCA 4MT5A 1BMLC 3U52E 1VR9A 2MJ3A 1DYQA 5BMGA 1ET6A 3BVMA 1UUPA 4Q2JA 4GLSC 3P42A 1F77A 1T6BX 1ZPSA 2J42A 1BXTA 2AQ2B 2RDGA 1MHXA 3MC0B 3URYA 2WXPA 4US8A 5FR3A 1OQRA 2L32A 4JE3B 2CJNA 4N59A 4D2KA 1VZ6A 4AQ7A 3PZ7A 2OHFA 1HZ5A 2ZW1A 3Q8AA 4IKGA 2DBYA 1NYQA 4CQNA 4O1NA 1SBBB 2MJDA 1MPEA 3TSSA 3AV8A 2BYTA 3VR9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XCQ L;  2EEL A;  1IBX A;  5JXV A;  2J53 A;  1C9F A;  4IOI E;  3FIL B;  2IGG A;  2LUM A;  1F2R C;  2OED A;  1FCC C;  5HI1 A;  1K53 A;  1F2R I;  1K52 A;  2RPV A;  1YMH E;  1JML A;  3UI3 A;  1K51 A;  2N7J A;  2QMT A;  2GB1 A;  1XF5 L;  2PLP A;  1HZ6 A;  2JZP A;  1UWX A;  4KGT A;  1GB4 A;  2GI9 A;  3FIL A;  5HFY A;  1ZXH A;  2I2Y A;  4HJG E;  2PW9 A;  2KN4 A;  1PGB A;  3V3X A;  3GB1 A;  1HEZ E;  2ZW0 A;  3MP9 A;  2NMQ A;  2JWU A;  2KAC A;  2PTL A;  2KQ4 X;  2ON8 A;  2N9L A;  1IBX B;  1PGX A;  1FD6 A;  1IGD A;  4MAC A;  1MVK A;  5BMI A;  1XCT L;  1FCL A;  2J52 A;  4OZC A;  2LGI A;  2LHD A;  2QSD A;  2LHE A;  2I38 A;  1EM7 A;  2ONQ A;  1MI0 A;  1P7F A;  1MHH E;  1K50 A;  4HKZ E;  1D4B A;  5BMH A;  1P7E A;  5BMG A;  4GLS C;  2RMM A;  1IGC A;  1Q10 A;  2JXT A;  2IGH A;  4OZB A;  5HG2 A;  1MHX A;  1GB1 A;  1YNT E;  2N9K A;  4D2K A;  2JSV X;  4KGR A;  4KGS A;  2K0P A;  1KH0 A;  4OZA A;  1HZ5 A;  2ZW1 A;  1PGA A;  4IKG A;  2KDM A;  5HHD G;  1MPE A;  2JU6 X;  4WH4 A;  2IGD A;  2KWD A;  1QKZ A; 
#chains in the Genus database with same CATH topology
 3EUB 2;  3O13 A;  1IPG A;  4P16 A;  2QJL A;  1R7S A;  4K81 A;  3P4S B;  1SIJ A;  1E7P B;  1IP9 A;  2H88 B;  1KLG D;  4MH0 E;  1L4Z B;  1HTQ A;  2RD0 A;  4IUM B;  1J8C A;  1U4A A;  3HM6 X;  1N5W A;  3N1X C;  3ZNZ B;  2SAK A;  2O2V B;  2KJ6 A;  2W82 A;  3H1U A;  2ASQ A;  2KJH B;  3GZN I;  1XLO A;  1EF1 A;  1B1Z A;  1FXI A;  3Q3N C;  1GC7 A;  2BKF A;  1TY0 A;  4GMV A;  5TR5 A;  4DHZ E;  3M62 B;  1L0X B;  2JRI B;  1YOV B;  1JW9 D;  5E6O A;  1WGH A;  2GOW A;  4DXF A;  3NRZ A;  3VR8 B;  3Q8B A;  3DVN V;  1PUT A;  2JPH A;  4LDT D;  3SU8 X;  3NOB A;  3VHT C;  1Y8R C;  1QF6 A;  4ZHP A;  3KYC D;  3BWU D;  4FHJ A;  3EEC A;  4TSS A;  2LHE A;  1K8R B;  4TV3 A;  1FM0 D;  3VUY A;  3Q3M C;  1N62 A;  3PTF C;  4NY0 A;  4BBN C;  4W9E A;  3VAW A;  5CHV C;  1L2N A;  2DX5 B;  3I9V 1;  1E8W A;  2IGH A;  4OZB A;  2JYT A;  3KUZ A;  2KQ7 A;  3DVN U;  5EE0 A;  2M4N A;  2FCS A;  3S2A A;  4PT5 A;  1V6E A;  4WAF A;  4AS1 A;  2JRH A;  2Q5W D;  3SDL C;  2KOX A;  4TQ0 A;  1J19 A;  4C4V A;  4YSZ B;  2FCN A;  3FIL B;  3P63 A;  4TKN A;  2QHO A;  3P4Q B;  2KT7 A;  1CMX B;  2YVC A;  2KDF B;  2PE6 B;  2Y5B B;  4ARC A;  1V80 A;  2MHJ A;  2J0K A;  1YX5 B;  2DEN B;  4RNA A;  4FJY A;  2WS3 B;  4WAA A;  1M94 A;  1XF5 L;  2V4L A;  2JZP A;  1UWX A;  3AE1 B;  4P6V F;  3B1L X;  2NS5 A;  2XNA C;  2YEP F;  2NTT A;  4P1B C;  1TS5 A;  2FCQ A;  3BVG A;  5AUK A;  4ARI A;  1Q0W B;  4AP4 C;  3T3N A;  3NVV A;  2R2O A;  2PMV A;  4MAC A;  4RH6 A;  4XWT A;  3ZLZ A;  2W54 A;  2LGD A;  1T0S C;  2SEB D;  1RWS A;  4C56 C;  5DPT A;  1J0G A;  1FXT B;  4HRS A;  4MM3 A;  2LVQ A;  2KN5 A;  3C19 A;  3A4S C;  1ZKH A;  1DOI A;  2AWT A;  4YXD B;  2JYE A;  3M95 A;  2M8S A;  2QIL A;  4USA A;  1GB1 A;  3WAL A;  2WXM A;  3RNF C;  5KHQ A;  3L0W B;  4MDK E;  1QLB B;  1WRD B;  4XGA B;  1WMH B;  2L76 A;  3CF6 E;  3DBH I;  3R2I A;  2KHW B;  2I2Y A;  1OQY A;  5IN7 A;  3I3T B;  4RMA A;  3D32 A;  2M0A A;  4WJN A;  1XLQ A;  3VUX A;  3ONS A;  2D3G A;  2IDY A;  4DK5 A;  3QAR A;  4RGO S;  1WWT A;  4YSX B;  1KOT A;  4RGN A;  3ZXV A;  1TJE A;  1ZUD 2;  3DHG C;  4A9A A;  2FID A;  5FKA C;  4LLG M;  5BYQ A;  4RGT A;  1WX8 A;  3MHS D;  4YL8 A;  1WJU A;  3L10 B;  4LNN A;  1D5M C;  2MRP A;  3KVF B;  3APD A;  1M4V A;  4EEW A;  1J7A A;  2L05 A;  1H8C A;  3CMM B;  3VTW A;  2LGS A;  3AE9 B;  2K8H A;  4X57 B;  3W9C B;  4K3B A;  3B9J A;  3QK0 A;  3IAS 1;  2V1Y A;  2Y3A A;  1IUE A;  1DOY A;  2M1M A;  1PGX A;  3RD2 A;  5BMI A;  1VJK A;  1FCL A;  2IO2 B;  4ANU A;  5EE9 A;  3W5V B;  2J4X A;  1HXY D;  3PT2 B;  3TEZ A;  2FNJ B;  2CKH B;  4N58 A;  3W5U B;  4PK1 A;  3ZKJ C;  4JL9 A;  1E90 A;  4WQO B;  3SEB A;  1VCB A;  2L1A A;  3H6N A;  5LNK 1;  2HDE A;  2RMM A;  5T8I A;  2LGX A;  1Q10 A;  2C7H A;  4NAM A;  2JXT A;  4WWM A;  4YTP B;  2C7N B;  4IWP A;  3H9D A;  4C00 A;  2GBN A;  3KLS X;  5D2M B;  4DQO C;  1UBQ A;  3J9C A;  1SF0 A;  1YN5 A;  3DWG C;  2G1E A;  4WH4 A;  5L95 C;  1WGG A;  2D3C A;  3Q3F A;  1EO6 A;  3Q3J A;  1WX7 A;  4BKS A;  2MEK A;  2WDR B;  4OHJ A;  4GOC A;  3RNE C;  4S0R A;  5G2N A;  3DCG A;  3V05 A;  4FAD A;  3PS6 A;  2G3Q B;  3HVD A;  3UGB B;  3KUC B;  1T0Y A;  3Q8C A;  3HUI A;  4MM3 B;  4K3C A;  2D3B A;  3LDZ E;  4IWO A;  4AJW A;  4W9F A;  4K7S A;  2QC8 A;  1FRD A;  3HK0 A;  2E6X A;  1C4P A;  3OG5 A;  3ZNI D;  2ZCB A;  3NVZ A;  1IYF A;  4MGZ E;  1ENF A;  3AB5 A;  1E8X A;  1QZE A;  1H4R A;  2V0G A;  4CYE A;  2HJ8 A;  2IO1 B;  1WGD A;  2GI9 A;  2MWS B;  2JVC A;  2KC1 A;  1ZXH A;  3HIZ A;  3N1Z C;  4LJP B;  2NBV B;  3RCZ A;  2KFJ A;  5H92 C;  3V3X A;  1E6E B;  2JZZ A;  5EE3 A;  1GJZ A;  2K22 A;  4OVV A;  2KAC A;  3RNC C;  1ZW7 A;  2PVG C;  1V81 A;  3EA6 A;  5DPS A;  1UBI A;  3VTU A;  3A1Q A;  2INC C;  2LJI A;  4HJK A;  2KO3 A;  3FAH A;  4FLH A;  2X38 A;  3AU4 A;  1KF6 B;  1STE A;  1HE8 A;  4NNJ B;  2KFK B;  2BF8 B;  1DYQ A;  3WAN A;  1D3Z A;  1ET6 A;  1V2Y A;  5IKC M;  4GLS C;  1TIF A;  4US8 A;  3URY A;  2L32 A;  2CJN A;  4AQ7 A;  3PZ7 A;  3JSV A;  2OHF A;  3PVL A;  4MGI E;  3PV1 A;  4CQN A;  4NPN A;  3QJZ A;  1WGR A;  1ISN A;  3ZGZ A;  2AYO B;  2EKI A;  5JXV A;  2K5P A;  5BO4 B;  4EKU A;  3GE3 C;  3ZUN A;  5EDS A;  2IGG A;  4MJS B;  4W9C A;  3AM9 A;  3AED B;  3T3O A;  2JQR B;  1F2R I;  2M0X A;  2MLB A;  4S17 A;  2WXG A;  1ET9 A;  3PLV A;  2PEA A;  2GMI C;  3B2G A;  1JRO A;  5I4D A;  2GRI A;  5LXI B;  3RT3 B;  3LYY A;  3U7Z A;  1T0R C;  1VD2 A;  2ZNV C;  5G5G A;  1XLP A;  3AE8 B;  4HPL B;  2INP E;  4R3D A;  4OW0 A;  2AL3 A;  2IY1 B;  1PGB A;  4GDK B;  3TMP B;  1V9J A;  3ZYY X;  2JUO A;  4HXD A;  1I4Q A;  4F8C B;  4DBG A;  2WU5 B;  1TKE A;  2BQQ A;  1V86 A;  2ZZP B;  1UGM A;  1EUV B;  1IGD A;  1RM6 C;  2N9E B;  4JGH B;  2INN E;  2JY6 A;  1WF9 A;  4KSL C;  2DAF A;  1V1P A;  2KDE B;  1EWC A;  2X8X X;  3PGE A;  1JRP A;  4HPP A;  1P7F A;  2K9X A;  2IO0 B;  2EMT A;  3AMZ A;  4B0M A;  1KFY B;  1YQB A;  2TSS A;  4RF0 A;  4LTU A;  3B2F A;  1WGY A;  3GZN B;  5C3J B;  4A55 A;  3NY5 A;  1GNU A;  2UYZ B;  2N1V A;  2NCN A;  4WWN A;  3ETR A;  3N32 A;  1NI3 A;  1F1H A;  5FR6 A;  3W2D A;  5HHD G;  2RDH A;  2N9X A;  2MW5 A;  2QEJ C;  2C7M B;  3OWE B;  1XCQ L;  2VZK D;  2KTR A;  2WXL A;  4E71 A;  4N9F 4;  2DYO A;  1JRU A;  3A9J A;  3NZU A;  4QAY A;  2IJ0 A;  3NVY A;  1I4X A;  2CR5 A;  5LXH A;  2K3U A;  1YMH E;  4LDT B;  3TEW A;  1E8Z A;  3UI3 A;  1JWS D;  2RSU A;  1K51 A;  2KYW A;  4E3C A;  1UF0 A;  2PPH A;  1FFV A;  3PRM B;  1HZ6 A;  3CSF A;  2FUG 1;  2XK5 A;  2LEK A;  1KM7 A;  5C1Z A;  1V1O A;  3MTN B;  4HVB A;  3JSV B;  4PS8 A;  1SXT A;  2QIE B;  4ANX A;  4RM8 A;  4GN1 A;  1UZX B;  2RPQ A;  1TS2 A;  1S1Q B;  2JWU A;  1E7V A;  2KQ4 X;  1BUI C;  1NEK B;  1C4A A;  1WR6 E;  3A33 B;  2VH1 A;  3DHH C;  1FIQ A;  1ZDV A;  2KD0 A;  5FK9 C;  3B08 A;  3QA8 A;  1WYG A;  3R3M A;  5TSS A;  1MJD A;  3RZF A;  4HKZ E;  3MHZ A;  3IG3 A;  3VVW B;  4KV2 A;  1WX9 A;  3ZJV A;  3AN1 A;  2LZ6 A;  2E3T A;  3APC A;  1RYJ A;  1IGC A;  4EOY A;  2BB5 A;  4NQL B;  4BZA A;  3FC4 A;  4JLC A;  1YJ1 A;  2KWU B;  2OOB B;  1Q1O A;  3WAO A;  2IYD B;  2JX5 A;  4URK A;  4ZDV A;  4BFR A;  4M02 A;  2JU6 X;  2IGD A;  5D7G A;  1NBF C;  3NZS A;  3BII D;  4ZRK A;  2WXN A;  2AQ3 B;  2XBB C;  3AE6 B;  4W9G A;  1WE7 A;  3W1S C;  3HHM A;  3AEG B;  1F52 A;  4YTM B;  1V1P B;  3L4P A;  1C9F A;  4GU2 A;  3L13 A;  2Z8L A;  4RFB A;  2KVZ A;  1V97 A;  1JML A;  2LVO A;  1YJJ A;  4G3X B;  2QMT A;  3TUO A;  4WWP A;  4B0E A;  4W9K A;  2J7Q B;  1GB4 A;  1MG4 A;  1UD7 A;  2GBK A;  3TEX A;  3GS2 A;  1V5T A;  2BGF A;  5HFY A;  2KKC A;  2C60 A;  1YN4 A;  4ZOH C;  3K9O B;  4RF1 A;  4N6E B;  2DWQ A;  2WX0 A;  3RNG C;  2L0F A;  4M8M A;  2LFI A;  3DBH B;  4LNI A;  1FD6 A;  1FNU A;  2B76 B;  1WY8 A;  3VDZ A;  4DWF A;  2MCN B;  1L0Y B;  2ZJD A;  2CHX A;  4IDI A;  1PQS A;  1WRI A;  2WXO A;  4DXG A;  1TBE A;  3QQ8 B;  1FPY A;  1LGR A;  4KSK C;  1MHH E;  1FFU A;  2MJE A;  3ZVV A;  5G5H A;  2BPS A;  2EKE C;  3DOW A;  1TS3 A;  1JWU D;  4ZRI A;  2ZPN A;  1MG8 A;  2Y5P A;  1XXG A;  4EZJ A;  3IAM 1;  5HG2 A;  2C9W B;  2FE8 A;  2GBJ A;  2KX3 A;  4JX1 C;  2A4Z A;  2CJO A;  3MFG A;  2L7R A;  3JVZ X;  3M63 B;  4B95 A;  2V3P A;  2KDM A;  3RUI B;  1A5R A;  4TUU A;  1ZXI A;  2BB6 A;  2UU7 A;  1WYW B;  1J7B A;  3R7Q A;  5CX3 A;  2EMS A;  1I4R A;  1VDV A;  2DZI A;  3X23 A;  1ESF A;  1I35 A;  1N61 A;  4KIK A;  2NPT A;  5MPO A;  2O6V A;  2ZVO A;  2JT4 B;  4PYU A;  1Y56 A;  2LUM A;  1QT9 A;  1C77 A;  4I6P A;  1D6E C;  5HI1 A;  3DBS A;  4M01 A;  2MH7 A;  1C1Y B;  1QIL A;  4W9I A;  4GGQ A;  2N7E A;  1I7H A;  4GSW A;  1OGW A;  1CQV A;  1YD8 U;  4IC7 B;  5AEK B;  1ZDX A;  1XQQ A;  4LNK A;  2I1J A;  2IBI B;  2LD9 A;  5JH5 C;  5IOI A;  3X0W A;  1WI0 A;  4GB9 A;  1T5X D;  1WJ4 A;  2DZM A;  3WCQ A;  4EZK A;  3BIN A;  2G4D B;  3AU5 A;  2N0S B;  5C2T B;  3MC9 A;  2PIA A;  3N20 C;  3NVW A;  3WA0 A;  4IM2 A;  2MBB B;  3I63 C;  2DLB A;  5CHF A;  4BOZ B;  2K8C A;  4MT5 A;  1BML C;  1N6Z A;  4AJY B;  1VR9 A;  3NS8 A;  4FBJ B;  3BVM A;  1UUP A;  5G55 A;  3P42 A;  4NQK E;  2J42 A;  1LXD A;  1MHX A;  3MC0 B;  4C4V B;  1VZ6 A;  4AOF A;  1HZ5 A;  3Q8A A;  3N30 A;  3DBR B;  1SBB B;  4O1N A;  2BWF A;  2KQS A;  3VR9 B;  1Z2M A;  3SHQ A;  2K1F A;  3H7S A;  4ICV A;  1N5X A;  4HPM B;  1PDX A;  3ML9 A;  2UWQ A;  1QOF A;  2OED A;  3ZRC A;  1NVI D;  1UH6 A;  4MGY E;  4BOS C;  4EE2 A;  5IO9 A;  1TTN A;  3ZNG C;  3N1Y C;  4HK2 A;  1PFD A;  2GB1 A;  1QOG A;  2KAN A;  1KRH A;  4WQM A;  1SE3 A;  1WSP A;  1JWM D;  3LJ3 A;  1P98 A;  2NMQ A;  3PPA A;  1L5P A;  2KWV B;  3ZDT A;  1RFK A;  3Q2A C;  2WXH A;  1CJE A;  1MVK A;  3AEB B;  3C0R B;  4FN2 A;  2ZEQ A;  5LLI A;  4LNF A;  2J52 A;  1JCK B;  2O6V B;  1ACC A;  4XDC A;  1JWB D;  2WXQ A;  2V3N A;  5D6J B;  2I38 A;  2A5U A;  3DBR I;  2H89 B;  2M17 A;  4ASW C;  2W3R A;  1D4B A;  2LI5 A;  1P1A A;  1P3Q U;  3JYU A;  3U7D A;  4KDL B;  1WXS A;  2IND C;  4HDQ A;  1SJH D;  5AZG A;  2LWP A;  1VZ8 A;  3QCA A;  3VTV A;  1WH3 A;  1YNT E;  2N9K A;  4OZA A;  2GBR A;  3UIN B;  1NI2 A;  1PGA A;  3O65 B;  1RFA A;  3WIM A;  1YQ3 B;  2B3A A;  2WXJ A;  1EU4 A;  2LXC A;  3U4E G;  3L16 A;  2J53 A;  1WXM A;  5C23 A;  2GLS A;  1FEH A;  2AQ1 B;  1EU3 A;  2KMC A;  3KWV A;  1T3Q A;  2K25 A;  4C7Y A;  2KWC A;  1DGJ A;  3KWL A;  1YN3 A;  4RGM A;  1EWY C;  1MFW A;  4CHK A;  1NEN B;  1XEE A;  3P1M A;  5IAA C;  2DZJ A;  2MX2 A;  3IVF A;  3RZW C;  3GP7 A;  2WHI A;  3AEA B;  2N4F A;  2KN4 A;  4JPS A;  1TYG B;  1XLN A;  2O2V A;  2D11 A;  2L8J A;  1WXA A;  3NJT A;  4ACF A;  3PLU A;  3H7P A;  1OEY J;  4TQ1 A;  1JWA D;  1ROE A;  2I1K A;  1OTR B;  1TGZ B;  1YIW A;  5AZH A;  3VH3 B;  1DOX A;  4W9L A;  1MI0 A;  5BYR A;  2V9H A;  2VZK B;  4I6L B;  2IPK D;  4DHJ D;  2KMM A;  2FCM A;  2WDV B;  1E7U A;  1WR1 A;  2V3S A;  2KMA A;  2CHW A;  1SGH A;  1SE2 A;  2K6Q A;  2WLB A;  4MGK E;  3TBL D;  2WGS A;  5BYS A;  4II3 B;  1D5Z C;  4NJ7 A;  2LMC A;  2BS4 B;  4GXB A;  1L0V B;  2KDB A;  3HM3 A;  2DZK A;  2L83 A;  4IW0 A;  4KGS A;  4KZC A;  4P1C C;  1KH0 A;  1WM2 A;  3Q8E A;  3W1S A;  3KW5 B;  4HKQ A;  3QWZ B;  1V49 A;  3DVG Y;  1XD3 B;  4M00 A;  4G50 A;  3Q14 C;  4J6I A;  2KWD A;  5JHA A;  3IT4 B;  2WXI A;  2FUH B;  4AWJ A;  4GIV A;  1TKG A;  2WDT B;  5E6P A;  1TY2 A;  2QCZ A;  4EZL A;  3L54 A;  4ZRJ A;  5AZF A;  4J3O D;  3U8Z A;  3RNB C;  1FO4 A;  1V5O A;  2DHZ A;  5J17 A;  1VRA B;  3ABV B;  2K6D B;  2N7J A;  1E9M A;  3UIP B;  4XC2 A;  4YTN B;  4BAX A;  3TIX A;  4KGT A;  2VH2 A;  4FXC A;  4MEM A;  3PZ8 A;  1C3T A;  3A1Q B;  3FIL A;  1Q5W B;  2KLC A;  3E9S A;  2WDQ B;  4MEL A;  2OJW A;  3ZO5 B;  4LJO B;  4L1B A;  2LXA A;  2CU1 A;  2JXX A;  2WU2 B;  2M56 B;  3PO0 A;  3ZXR A;  4WJP A;  5D94 A;  3K9P B;  3C8Y A;  3V6C B;  4HWI B;  3AI5 A;  4A3P A;  4HLE A;  2DNF A;  4OVZ A;  2BS2 B;  5D3D A;  2M19 A;  2HTM E;  2QSD A;  1TZ1 A;  4NZL B;  2BYV E;  4OVU A;  4XE0 A;  2V4I B;  1P0R A;  3AE7 B;  3L17 A;  4FJZ A;  3IFW B;  5JZE B;  3ZQ4 A;  3AE3 B;  2LVP A;  5L83 A;  1SE9 A;  3HRD D;  4JQW C;  2LJ5 A;  3A9K A;  2WXF A;  2MBH A;  4KGR A;  3UF8 A;  1L4D B;  1XT9 B;  2K0P A;  3AE2 B;  3AEF B;  2BVC A;  4JIO U;  3ZW3 A;  4ICU A;  1L6V A;  4KKI A;  4CO7 A;  2CS4 A;  2WXK A;  4US9 A;  3APF A;  4ZYS A;  4RM9 A;  3TEY A;  4G11 A;  4IM0 A;  4KKJ A;  4W9D A;  3VRB B;  2WWZ A;  2WXR A;  3RMK C;  3H7P B;  5E6J A;  4F7Z A;  3BK1 A;  1WJ6 A;  2D3A A;  1OFF A;  2D07 B;  4KX6 B;  1R4M I;  1WMH A;  1K53 A;  2HJ1 A;  3UQB A;  4BKT A;  3TCA A;  1FXA A;  3FKY A;  1KTK A;  3E56 A;  1KJT A;  2PLP A;  1I42 A;  5HKH A;  3IHP C;  4M0W A;  3P2B A;  1SB3 C;  3R66 C;  2PW9 A;  1LM8 B;  2W9N A;  2IO3 B;  3GB1 A;  2N7D A;  2AL6 A;  2N9P C;  1GC6 A;  1WJN A;  2MA9 B;  5D3I B;  1P9D U;  2Z0E B;  3IT6 B;  4IM3 A;  3GE8 C;  2KTF A;  3AEC B;  2PTL A;  2ON8 A;  5GXG B;  2FIF A;  1QOA A;  2G4S A;  1NYR A;  1LQB A;  2J0M A;  3ALB A;  4BKG A;  3WAM A;  1KLV A;  1JQ4 A;  1TZO A;  1UNS A;  1ZGU B;  1XO3 A;  3QX1 A;  4W9H A;  5J2R A;  1TS4 A;  3BY4 B;  3MJW A;  2BBC A;  2DYB A;  4B6W A;  3NHE B;  3U52 E;  3KYD D;  4Q2J A;  2KTR B;  2AQ2 B;  2HE7 A;  4BVU C;  2D2Q A;  2LUE A;  3A9J B;  5FR3 A;  1NDD A;  4N59 A;  2KJR A;  2MJD A;  3TSS A;  3QHT A;  2BYT A;  4FA6 A;  1HTO A;  3RUL A;  2MBE A;  1WXV A;  2HD5 B;  2MBQ A;  1AAR A;  3RYT A;  3VFK A;  3MJ5 A;  2BS3 B;  2XK5 B;  4PS3 A;  3QAQ A;  1L7Y A;  3AXC A;  3B0A A;  1GPX A;  3EFC A;  4FJV B;  3P4R B;  1K52 A;  2KX0 A;  4JWS C;  2J0J A;  4XWW A;  4EUT A;  2MBO A;  2LAS A;  3Q69 A;  1VLB A;  4PS7 A;  1ZE3 D;  3A9K B;  4NJC A;  2QDF A;  1BT0 A;  2R2Q A;  4ZRP A;  2BKR B;  5GMV A;  2JWZ A;  4ANV A;  2WYQ A;  2KK8 A;  2ZPY A;  2ZW0 A;  2FBW B;  3MP9 A;  2BYE A;  3EHV A;  3NG0 A;  3N3K B;  3SR6 A;  3SFD B;  3VUW A;  3T9L A;  3GOE A;  4AUQ C;  2MP2 A;  4NAW A;  3AEE B;  1TT5 B;  2KLG A;  1WIA A;  4WWO A;  3LB8 C;  2LHD A;  3DDC B;  4XX5 A;  4MSQ B;  2CHZ A;  2WNM A;  4ITK A;  1KLU D;  3R2T A;  1A70 A;  4A8X C;  1VZ7 A;  4W9J A;  1F0Z A;  3PHX B;  4MH8 A;  4EFO A;  2KVR A;  2RDB C;  4REZ A;  2ICI A;  4M0W B;  1GAQ B;  4UDU C;  1WE6 A;  2JSV X;  2YLM A;  4WUR A;  3WAP A;  1E10 A;  2ZVN A;  3V60 A;  3AE4 B;  1RRB A;  2KFK A;  2LRW A;  1YJI A;  1CZP A;  1G6J A;  3VRA B;  2XN9 C;  1QKZ A;  4ANW A;  4HDO A;  2BWE S;  5JHB A;  3KUD B;  1AW7 A;  1IBX A;  1EF5 A;  3OJ4 B;  2W55 A;  2CU3 A;  3M3J A;  4IOI E;  1I4G A;  2WX1 A;  3DHI C;  1UGJ A;  4DHZ B;  1SSN A;  3SFE B;  1AYF A;  4LK0 M;  2Z59 B;  3BVZ A;  2LGY A;  1FNV A;  2LRU A;  4P7I A;  3ECI A;  1Z5S B;  4IG7 B;  1AWD A;  3CST A;  3T8M A;  2BYF A;  4II2 B;  4WJO A;  1C79 A;  3CIR B;  4ZYN A;  3ZTD A;  4A3O A;  3UIO B;  2KXJ A;  4F1S A;  3ENE A;  1WZ3 A;  3W1Y A;  2DYM A;  4FHK A;  1TKY A;  3I57 A;  4YT0 B;  4MJS A;  4C7Z A;  3L08 A;  3ZRF A;  1S3S G;  1C76 A;  2G45 B;  2XEW A;  3Q8F A;  5AUI A;  1WM3 A;  3QIJ A;  3DBL B;  4JWU C;  4KZ0 A;  2K8B A;  2N9L A;  1FMA D;  4GDL A;  3JW0 X;  1B9R A;  1I4P A;  2RR9 A;  3ML8 A;  4DXA B;  4XDD A;  4YWG G;  1WFY A;  1YQ4 B;  3QC8 B;  4G0N B;  4XZ4 A;  1EM7 A;  1GOZ A;  4GDK A;  2ONQ A;  3VH4 B;  1K50 A;  4I6N B;  1PYW D;  5BMH A;  1J7C A;  2OJR A;  4RCO A;  5DPW A;  1AN8 A;  3DQV A;  4LCD E;  4K7U A;  4WIP A;  5E6N A;  2L00 B;  4PYZ A;  3Q3O C;  1SEB D;  4HCN B;  3BZD B;  4L23 A;  4TMA B;  3PRE A;  2NPT B;  1C4C A;  4KIK B;  2Y5C A;  2G9H D;  5CTR C;  1QOB A;  1V8C A;  3OAW A;  3SD5 A;  3MC8 A;  4IWQ A;  4WJQ A;  3NZ3 A;  3NUH B;  3R7R A;  3ZDM C;  2EEL A;  2AEH A;  3KQ4 A;  3A4R A;  2MQJ A;  3AH7 A;  1RLF A;  1X1M A;  2MP2 B;  3U30 A;  4NAW B;  5H8Y E;  1E5W A;  2MSE D;  5DCN A;  2BT6 A;  3RNA C;  2PKO A;  1F2R C;  5KHO A;  3DPD A;  3DBL I;  2D10 A;  5EE1 A;  3PSE B;  2KC2 A;  3BK2 A;  1YX6 B;  1R4N B;  2AX5 A;  4L2Y A;  3TJP A;  1E8Y A;  3ZTC A;  4BBN F;  3N9Y C;  3OLM D;  4XYC A;  4M8N A;  3HVZ A;  4DHJ B;  2YEP B;  2KNB A;  1I4H A;  2IZV B;  3LXF A;  2BTE A;  3TL5 A;  1HQR D;  3RN9 C;  2ACZ B;  1FRR A;  2GBM A;  2R61 A;  5IA7 A;  3BYT B;  1N63 A;  2L52 A;  2JF5 A;  1IBX B;  1N60 A;  4K1R B;  3ZJT A;  4FUL A;  2L3Z A;  4OZC A;  2LGI A;  1WGK A;  2NBW B;  2JZ3 B;  1D5X C;  1LO5 D;  1E0Z A;  2O6V D;  4KVG B;  2DAJ A;  3KH0 A;  4DDG D;  1P7E A;  2BW2 A;  2WQY B;  3P4P B;  5IP4 D;  4K7W A;  1CK1 A;  1GUA B;  2KDI A;  1OQQ A;  4LNO A;  1C78 A;  1SJE D;  2HTH A;  3R8B A;  3ZJU A;  3CWI A;  2ZCC A;  1ZOY B;  2ZNV B;  3V6E B;  4B9K A;  3NS1 A;  3AE5 B;  1R4N I;  3EGR A;  4A90 A;  3PZD A;  3BYY B;  4ZRQ A;  3U2S C;  1T0Q C;  3V61 A;  4A6Q A;  3H8H A;  4GDL B;  1HA5 A;  3EFU A;  1SE4 A;  2NVU I;  1L6U A;  3ZIM A;  3RPF C;  2RGF A;  1UWM A;  1ZP0 B;  2WP9 B;  2D5G A;  1FCC C;  4HEA 1;  1SIF A;  3PRZ A;  1WZ0 A;  2NTS A;  2RPV A;  3UQA A;  1GG3 A;  3DWM A;  3I5J C;  3VQI A;  1OEY A;  4HRO A;  1F9J A;  2NR2 A;  3V62 A;  1RAX A;  1UEL A;  3RI7 C;  4E74 A;  4ZHO A;  2KAJ A;  2K39 A;  4YSY B;  1QQR A;  5J18 A;  2PVO D;  1FNW A;  4HJG E;  2VRR B;  2PJH A;  3EC8 A;  4H2A A;  4C80 A;  1HEZ E;  1JAL A;  2W3S A;  3OJ3 A;  4KDI C;  3VXW A;  4A20 A;  4NJ6 A;  1XCT L;  3RFZ B;  3IXS A;  2Z0D B;  1WXQ A;  2REX A;  3IBE A;  5CHW A;  4MSM B;  2MJ3 A;  1R4M B;  5BMG A;  2KZR A;  2C5L C;  1LFD A;  1F77 A;  2L0T A;  1T6B X;  1ZPS A;  2IY0 B;  1BXT A;  2RDG A;  3Q6B A;  4BKS D;  2WXP A;  2FAZ A;  1OQR A;  4JE3 B;  3AUL A;  4D2K A;  3PHW B;  2PE9 A;  4DDI D;  2N1W A;  2ZW1 A;  4IKG A;  3ZNH B;  2DBY A;  1NYQ A;  3DVG X;  2NBU A;  1MPE A;  3PRP B;  3AV8 A;  5DPR A;  4HCP B; 
#chains in the Genus database with same CATH homology
 3EUB 2;  3O13 A;  3ZGZ A;  4P16 A;  1N5X A;  2QJL A;  2EKI A;  5JXV A;  2K5P A;  1R7S A;  3P4S B;  1SIJ A;  1E7P B;  3MJ5 A;  2BS3 B;  1PDX A;  2H88 B;  1KLG D;  1L4Z B;  1N5W A;  2IGG A;  2SAK A;  1GPX A;  1QOF A;  2OED A;  3AM9 A;  1NVI D;  3AED B;  3P4R B;  2JQR B;  1F2R I;  2W82 A;  1K52 A;  3T3O A;  4JWS C;  4EE2 A;  2WXG A;  1ET9 A;  4XWW A;  3B2G A;  1XLO A;  1JRO A;  5I4D A;  2GRI A;  1B1Z A;  1FXI A;  3Q69 A;  1VLB A;  3LYY A;  1PFD A;  2GB1 A;  1ZE3 D;  1TY0 A;  1QOG A;  3U7Z A;  4NJC A;  1L0X B;  1KRH A;  4WQM A;  5G5G A;  1XLP A;  3AE8 B;  2INP E;  1SE3 A;  4OW0 A;  4R3D A;  4ZRP A;  1WSP A;  1JWM D;  1PGB A;  1JW9 D;  4GDK B;  3ZYY X;  2ZW0 A;  3MP9 A;  2FBW B;  2NMQ A;  4DXF A;  1L5P A;  1I4Q A;  3NRZ A;  3VR8 B;  2WU5 B;  3Q8B A;  3SR6 A;  1TKE A;  1RFK A;  2WXH A;  3SFD B;  1PUT A;  1IGD A;  1RM6 C;  1CJE A;  1MVK A;  3AEB B;  1QF6 A;  2INN E;  3AEE B;  2J52 A;  1JCK B;  4ZHP A;  1V1P A;  3BWU D;  3LB8 C;  1EWC A;  2LHD A;  1ACC A;  4XDC A;  1JWB D;  2WXQ A;  2LHE A;  2V3N A;  4TSS A;  1FM0 D;  2I38 A;  2WNM A;  4ITK A;  1JRP A;  1KLU D;  2H89 B;  3R2T A;  1P7F A;  1A70 A;  2K9X A;  2W3R A;  1D4B A;  3AMZ A;  4B0M A;  1N62 A;  1KFY B;  4A8X C;  2TSS A;  1VZ7 A;  4RF0 A;  1F0Z A;  4MH8 A;  4LTU A;  3B2F A;  5C3J B;  3I9V 1;  1SJH D;  4REZ A;  2ICI A;  2IGH A;  4OZB A;  2JYT A;  1GAQ B;  5EE0 A;  1VZ8 A;  4A55 A;  4UDU C;  1YNT E;  2N9K A;  2JSV X;  3ETR A;  4WUR A;  1E10 A;  1NI3 A;  4OZA A;  1PGA A;  3AE4 B;  3W2D A;  5HHD G;  4PT5 A;  4WAF A;  2RDH A;  1YJI A;  1CZP A;  3VRA B;  4AS1 A;  2QEJ C;  1YQ3 B;  2XN9 C;  1QKZ A;  2Q5W D;  3OWE B;  1XCQ L;  2VZK D;  2WXJ A;  1AW7 A;  1IBX A;  2WXL A;  1EU4 A;  2W55 A;  3U4E G;  4TQ0 A;  2DYO A;  2CU3 A;  2J53 A;  4YSZ B;  1FEH A;  2AQ1 B;  4IOI E;  1I4G A;  3FIL B;  1EU3 A;  2IJ0 A;  3P63 A;  3NVY A;  1UGJ A;  3KWV A;  3P4Q B;  1T3Q A;  4C7Y A;  1SSN A;  3SFE B;  1AYF A;  1I4X A;  4LK0 M;  4ARC A;  3BVZ A;  1FNV A;  2K3U A;  1DGJ A;  1YMH E;  4RNA A;  3KWL A;  1YN3 A;  3TEW A;  4RGM A;  3UI3 A;  1JWS D;  2WS3 B;  1AWD A;  1K51 A;  1EWY C;  1NEN B;  1C79 A;  1XEE A;  3P1M A;  3CIR B;  1FFV A;  1XF5 L;  1HZ6 A;  2JZP A;  1UWX A;  3AE1 B;  4P6V F;  2FUG 1;  2DYM A;  2LEK A;  2XNA C;  2YEP F;  3GP7 A;  1TKY A;  1V1O A;  3I57 A;  3AEA B;  4YT0 B;  2NTT A;  4C7Z A;  2KN4 A;  1TS5 A;  1SXT A;  2QIE B;  4JPS A;  1TYG B;  1XLN A;  1C76 A;  3Q8F A;  5AUI A;  3BVG A;  5AUK A;  1TS2 A;  4ARI A;  4JWU C;  2JWU A;  3T3N A;  2KQ4 X;  2N9L A;  1BUI C;  1NEK B;  1C4A A;  3NVV A;  4RH6 A;  2PMV A;  1FMA D;  4MAC A;  4XWT A;  2W54 A;  1FIQ A;  1ZDV A;  1B9R A;  1I4P A;  5FK9 C;  2SEB D;  4XDD A;  4TQ1 A;  1WYG A;  4YWG G;  1JWA D;  1ROE A;  1RWS A;  4C56 C;  1DOX A;  1YQ4 B;  5TSS A;  1EM7 A;  4HRS A;  1GOZ A;  2ONQ A;  1MI0 A;  5BYR A;  2VZK B;  1K50 A;  1PYW D;  2IPK D;  3MHZ A;  2KMM A;  2WDV B;  4HKZ E;  5BMH A;  1J7C A;  1DOI A;  4RCO A;  3ZJV A;  3AN1 A;  2E3T A;  1AN8 A;  1SE2 A;  4YXD B;  1RYJ A;  2WLB A;  1IGC A;  2JYE A;  4WIP A;  5BYS A;  1D5Z C;  2BB5 A;  2QIL A;  4USA A;  3FC4 A;  1SEB D;  1GB1 A;  3BZD B;  2LMC A;  4L23 A;  4TMA B;  2WXM A;  2BS4 B;  1C4C A;  1L0V B;  2Y5C A;  2L83 A;  4KGS A;  2G9H D;  1KH0 A;  1QOB A;  3W1S A;  3Q8E A;  1QLB B;  4HKQ A;  2JX5 A;  1V8C A;  2JU6 X;  2IGD A;  5D7G A;  2KWD A;  3R2I A;  2I2Y A;  3IT4 B;  2WXI A;  3BII D;  3NZ3 A;  3NUH B;  2WXN A;  2EEL A;  2AQ3 B;  1TKG A;  3KQ4 A;  3AH7 A;  3AE6 B;  1TY2 A;  4NAW B;  5H8Y E;  3AEG B;  4YTM B;  1V1P B;  3L4P A;  1C9F A;  2M0A A;  2BT6 A;  1XLQ A;  4J3O D;  2Z8L A;  2PKO A;  1F2R C;  2IDY A;  4RFB A;  1FO4 A;  4RGO S;  1WWT A;  4YSX B;  1V97 A;  4RGN A;  1VRA B;  1JML A;  1TJE A;  1ZUD 2;  5EE1 A;  1YJJ A;  3BK2 A;  4A9A A;  3ABV B;  2AX5 A;  5FKA C;  4LLG M;  4L2Y A;  5BYQ A;  2N7J A;  2QMT A;  1E9M A;  4RGT A;  4YTN B;  3TUO A;  4KGT A;  4B0E A;  3N9Y C;  4FXC A;  1D5M C;  1GB4 A;  3PZ8 A;  1M4V A;  3FIL A;  3TEX A;  3E9S A;  3HVZ A;  2WDQ B;  3GS2 A;  5HFY A;  2YEP B;  1J7A A;  1I4H A;  1YN4 A;  4L1B A;  3LXF A;  4ZOH C;  2BTE A;  4RF1 A;  3AE9 B;  4N6E B;  1HQR D;  2DWQ A;  2ACZ B;  2WU2 B;  3W9C B;  3B9J A;  2M56 B;  1FRR A;  3IAS 1;  3PO0 A;  2R61 A;  2Y3A A;  2LFI A;  3BYT B;  1IUE A;  1N63 A;  2L52 A;  3C8Y A;  1DOY A;  1IBX B;  1PGX A;  1N60 A;  1FD6 A;  1FNU A;  3ZJT A;  5BMI A;  1VJK A;  2B76 B;  4OVZ A;  2BS2 B;  1FCL A;  5D3D A;  1L0Y B;  4IDI A;  2M19 A;  5EE9 A;  4OZC A;  3W5V B;  2LGI A;  1WGK A;  1WRI A;  2HTM E;  2QSD A;  2WXO A;  2J4X A;  1D5X C;  1LO5 D;  1E0Z A;  4DXG A;  1HXY D;  4NZL B;  3TEZ A;  1MHH E;  4XE0 A;  2V4I B;  3W5U B;  4N58 A;  3AE7 B;  1FFU A;  1P7E A;  2BW2 A;  2WQY B;  2MJE A;  3P4P B;  3SEB A;  3ZQ4 A;  1CK1 A;  2L1A A;  3AE3 B;  5G5H A;  1TS3 A;  3HRD D;  1OQQ A;  1JWU D;  2HDE A;  2RMM A;  5T8I A;  5LNK 1;  1C78 A;  2Y5P A;  1Q10 A;  1XXG A;  1SJE D;  4NAM A;  2JXT A;  4WWM A;  4YTP B;  3IAM 1;  3R8B A;  5HG2 A;  2FE8 A;  3ZJU A;  2WXF A;  4JX1 C;  4KGR A;  3CWI A;  2CJO A;  3MFG A;  1L4D B;  2K0P A;  3AE2 B;  3KLS X;  1ZOY B;  3AEF B;  2V3P A;  4DQO C;  2KDM A;  3J9C A;  1L6V A;  1SF0 A;  4KKI A;  1YN5 A;  2WXK A;  3DWG C;  3NS1 A;  2G1E A;  3AE5 B;  3EGR A;  4WH4 A;  4US9 A;  4A90 A;  4ZYS A;  1ZXI A;  3BYY B;  4ZRQ A;  3U2S C;  2BB6 A;  2MEK A;  1J7B A;  3TEY A;  2WDR B;  4OHJ A;  4A6Q A;  4KKJ A;  3H8H A;  1I4R A;  1VDV A;  4GDL B;  1HA5 A;  3VRB B;  1SE4 A;  2WXR A;  1ESF A;  3V05 A;  5E6J A;  3BK1 A;  1N61 A;  5MPO A;  1L6U A;  3RPF C;  3HVD A;  1UWM A;  3Q8C A;  1Y56 A;  2LUM A;  1QT9 A;  1C77 A;  1OFF A;  1ZP0 B;  2D5G A;  2WP9 B;  3HUI A;  4MM3 B;  4KX6 B;  1D6E C;  1FCC C;  4HEA 1;  5HI1 A;  1K53 A;  2NTS A;  2RPV A;  2MH7 A;  1QIL A;  3DWM A;  1FRD A;  2E6X A;  1C4P A;  1FXA A;  3VQI A;  4HRO A;  1I7H A;  3NVZ A;  1KTK A;  3E56 A;  2PLP A;  1CQV A;  1ENF A;  3AB5 A;  2V0G A;  4M0W A;  1ZDX A;  2GI9 A;  4ZHO A;  2KAJ A;  4YSY B;  1QQR A;  1SB3 C;  1ZXH A;  2PVO D;  1FNW A;  4HJG E;  2PW9 A;  5H92 C;  3V3X A;  1E6E B;  4H2A A;  4C80 A;  3GB1 A;  1HEZ E;  1JAL A;  5EE3 A;  2K22 A;  5D3I B;  2W3S A;  1T5X D;  3IT6 B;  3WCQ A;  3AEC B;  2KAC A;  2PTL A;  2ON8 A;  2PVG C;  3EA6 A;  2N0S B;  5GXG B;  1XCT L;  3RFZ B;  5C2T B;  2PIA A;  1QOA A;  3NVW A;  1NYR A;  2LJI A;  3IXS A;  1WXQ A;  1JQ4 A;  1TZO A;  1UNS A;  2DLB A;  1XO3 A;  3FAH A;  1TS4 A;  2X38 A;  1KF6 B;  1STE A;  2BBC A;  4MT5 A;  1BML C;  3U52 E;  1VR9 A;  2MJ3 A;  1DYQ A;  5BMG A;  1ET6 A;  3BVM A;  1UUP A;  4Q2J A;  4GLS C;  3P42 A;  1F77 A;  1T6B X;  1ZPS A;  2J42 A;  1BXT A;  2AQ2 B;  2RDG A;  1MHX A;  3MC0 B;  3URY A;  2WXP A;  4US8 A;  5FR3 A;  1OQR A;  2L32 A;  4JE3 B;  2CJN A;  4N59 A;  4D2K A;  1VZ6 A;  4AQ7 A;  3PZ7 A;  2OHF A;  1HZ5 A;  2ZW1 A;  3Q8A A;  4IKG A;  2DBY A;  1NYQ A;  4CQN A;  4O1N A;  1SBB B;  2MJD A;  1MPE A;  3TSS A;  3AV8 A;  2BYT A;  3VR9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...