1JWUD

Crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b2
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
239
structure length
232
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Structural, energetic, and functional analysis of a protein-protein interface at distinct stages of affinity maturation
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jwuD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwuD02
5I4DA 2QILA 5D3IB 1SE3A 5D3DA 3TSSA 1JWMD 1BXTA 2WV6D 1LT6D 1LTAD 1TY0A 4Z9CB 1V1PA 1FD7D 1KLUD 3BZDB 3BYTB 2XN9C 1BCPC 1L0XB 3DWAA 3EFXD 1S5DD 3W2DA 1XTCD 1I4XA 3URYA 1UNSA 1SE4A 1JWSD 1PRTF 4C56C 1D5ZC 1S5BD 2SEBD 1SE2A 4L6TB 1RDPD 3KLSX 5FKAC 5ELFA 3R8BA 3R2TA 1D6EC 1EU4A 1EWCA 1SJED 5ELCA 1F77A 1KTKA 1YN5A 1PZID 1LTTD 3R2IA 4RGMA 1PTOC 5ELBA 1ESFA 1V1PB 3EA6A 2TSSA 2NTSA 1HA5A 1S5ED 2J4XA 1PRTD 2G9HD 2IPKD 1SJHD 1V1OA 1XXGA 1DJRD 1PTOB 3BVGA 1S5FD 1ENFA 1AW7A 1I4GA 1STEA 1HTLD 4O1NA 4TSSA 1FGBD 1HXYD 1LTID 2Z8LA 2IJ0A 2NTTA 3CHBD 3OWEB 1LT3D 3MFGA 2CHBD 2XRSD 1BCPB 1JR0D 1I4PA 1SEBD 2AQ2B 1AN8A 1BCPF 1KLGD 1FNWA 1HQRD 1MD2D 1LTBD 1I4QA 1EEID 1I4HA 1S5CD 2ICIA 2RDGA 3BVZA 1TY2A 4BWGB 4RGTA 4L63B 4K6LA 3V05A 1EEFD 1EFID 4DXFA 3GP7A 1D5XC 1LLRD 2R61A 1CHQD 1PTOF 1SXTA 2AQ1B 1CK1A 4RFBA 1BCPD 1GOZA 1SBBB 2QEJC 1PZKD 3DWQA 4OHJA 1LTRD 2RDHA 1DYQA 1B1ZA 3SEBA 4RCOA 1LTSD 1LT5D 1TS2A 1T5XD 2O2LD 3BYYB 1JQYD 1M4VA 4NZLB 1B44D 1QILA 1PRTC 1YN3A 4RGNA 3MC0B 1PTOD 1UUPA 5TSSA 1JWUD 1PYWD 3O13A 1RD9D 2XNAC 1FNUA 1LO5D 1LTGD 1PRTB 3BVMA 1CT1D 1LT4D 1YN4A 4RGOS 2AQ3B 1EU3A 1JCKB 1TS5A 1RCVD 1RF2D 1CQVA 1D5MC 1G8ZD 1PZJD 2XRQD 1ET6A 4UDUC 5FK9C 4RHRA 1TS4A 5ELDA 1ET9A 4RHSA 1TS3A 4RH6A 1CHPD 1FNVA 3DWPA 5ELEA 4DXGA 1I4RA 4ZYSA 1PTOH 1L0YB
chains in the Genus database with same CATH superfamily
4YTPB 2IO2B 4HJ9A 1BO0A 1WRIA 3X3NA 3K0XA 3TEXA 4JQWC 1AE2A 1FEHA 4HRSA 5AUKA 4EOYA 1GC6A 2EKEC 1GUSA 1GKHA 4XT3B 4DR6Q 3I57A 3EFXD 1C3TA 5A2QL 1XTCD 2HJ1A 4G3XB 4DXAB 4BY7B 2BE5C 2BS2B 3PGZA 4AP4C 1UWVA 2ZJRA 3H09A 2WB1G 4KDLB 5FKAC 4RF0A 4ABNA 2LVOA 2D62A 4A3IB 3ZNZB 1EOTA 2HCIA 4LF6L 1D6EC 2JA8G 4U673 2NUCA 1YNTE 2KHWB 1I50H 2YTYA 4JPBW 1E1TA 1KL9A 3EVQA 4N9F4 1L1OA 3HEJA 5JJZA 5BMHA 1S1QB 4XE0A 1ESFA 1K53A 5AUIA 1S4ZA 1IKLA 2WHIA 3VRBB 3M7NA 4DAYB 3VYTA 3TJPA 5BYSA 4FO2A 2KOXA 2K04A 1FXAA 1DONA 3EBEA 1V1OA 1MJEA 2WXJA 1E24A 3KUCB 4K8IA 2B29A 4FHKA 1S40A 1I4GA 4X66Q 2NVQB 1F2LA 3HHMA 3CC7A 1HFGA 2WDVB 1ZKOA 3GZNB 4GOPC 1QUQA 4LK1C 2JK8A 1CZPA 1WM2A 2MGSA 2EVBA 5I9PA 5ISRA 2O6VA 3GE3C 4L23A 1QVCA 1BCPB 5C44B 1VQLA 4R8IA 1G291 2LGIA 3I5JC 3GQBA 5FO8B 2EOTA 2I5MX 3S16H 2DYBA 5HY6A 2L55A 3BVZA 2F4IA 4PS3A 4C3HH 4I6NB 5KHQA 2L76A 4K6LA 3U50C 1HRJA 2CU3A 2JRHA 1PYSB 1G6JA 2Z6KA 1EZ6A 3TEZA 2X6LA 3PRZA 4E71A 2F0QA 3GP7A 2I1JA 2MBQA 3QIAA 4WH4A 3GTPB 2V3PA 2W3RA 2AQ1B 1MPEA 3BZKA 4RKLA 3DPDA 1A3UA 4QJFA 2D5GA 2PJHA 3QB3A 2F4VQ 1B9NA 1HJPA 1Q1BA 4HAEA 1K50A 1BBXC 3FILB 2L32A 4IJHA 3RN5A 2KWCA 1WIAA 2EJGC 3T3OA 1QNUA 3UDIA 4K1RB 4JIOU 4RCOA 3S24A 1HZ6A 1YNXA 3Q8BA 3VTWA 4KKIA 2A73B 4OX9Q 2IGDA 3HM6X 5JVG3 1Y1WH 1ICFB 4YT0B 2PO4A 5IP9G 3MC9A 5D6JB 2Y0SB 4WJ4A 3WANA 5IE8A 3NQIA 1F2ZA 4JOIC 3N9YC 1CKMA 2KJ6A 4K7UA 1PQSA 1PYWD 4FF4A 4CJ0B 1X56A 3RD2A 1FNUA 5A35A 2CVRA 2FINB 5I2XA 3F2DA 4AIMA 1J5EQ 1BVSA 1HUMA 1VMCA 2WAQB 5FLXc 1Q5WB 1GUTA 2CJOA 2H89B 1A2UA 3PCOB 4AJWA 5J1ZA 3N3KB 2ASQA 3D3RA 4RHRA 3J80i 1HQMC 1WZ0A 3HM3A 2KD0A 4LFAQ 1PHJA 1K73C 4HPMB 1Y8PB 2MP1A 2LXJA 1N9WA 1K83B 3S2AA 3VR3A 4DAPA 3FC4A 2JN4A 4G7HC 4I7AA 3EGRA 1EYGA 2F3IA 2EY6A 1F9JA 4HCPB 3AU5A 3WIMA 4Z9CB 2R2OA 2WKDA 1QVFA 2D10A 1L0XB 2K50A 3ZDMC 2JA6B 2BTEA 2OF1A 2N9PC 3IRBA 2KVZA 2JF5A 1V5OA 2XIWA 3SDLC 1STHA 4A3FG 2RHQB 3D31A 4MT5A 2PVGC 2WXQA 4PYZA 1SNOA 4C3JG 1K8OA 4DR1L 1UGMA 2E5LQ 3CIRB 1KOTA 4G4KA 1B3QA 3ULJA 2D2CC 4LF5L 1N6ZA 4EKUA 2RSUA 4GN5A 3I2ZA 2LJ5A 1H8CA 5C3EH 4LF7L 2L3ZA 3FKYA 2M9VA 3L0WB 2KECA 1DJRD 3TBIB 1Y14B 5IAAC 4ASWC 1HEZE 1GC7A 3MHSD 2M56B 1VMPA 4K0KQ 4XYCA 2O5IC 5LHY1 4GN4B 5BN5A 4NMZA 5C4XH 3ICEA 3KLSA 4LNIA 2JEBI 4YHHL 2QGQA 2HD3A 3MFGA 4ZHPA 1B2TA 2FBWB 4NXNL 1AN8A 3FDTA 3ZLZA 4YSXB 3QG1A 1WYWB 3N52A 2V0GA 4CJ1B 1B50A 4RGTA 3QC8B 4BY1G 2JSVX 1HZ9A 2KJXA 1IBKQ 5D14A 4BVUC 2GRIA 1GPXA 4N58A 4EQPA 1HHVA 3G6EA 2WXPA 5FJ8G 3AECB 5D94A 4PQXA 4IUUA 2ZXOA 5G5HA 1TWAB 4K2LA 4A3LG 2NVYH 3S14H 1EY9A 1GUAB 1TWHH 1OXTA 1FRRA 3LNNA 4S17A 5IP9H 2IDYA 2UWQA 3B2GA 3FP9A 2K39A 1NAPA 2RGFA 1LTSD 3P20A 1LT5D 1W6KA 2O2LD 4GDKB 2M19A 4KHPL 2KN4A 2MBBB 1X3PA 1B44D 3PRMB 4HVBA 2MBOA 4K7WA 2MHJA 4YY3Q 4JG2A 5IY0A 4JBKA 3TEWA 1S3SG 2D9UA 3S2DB 4NQKE 1TWCB 4A3CG 2GBJA 1VQJA 2BYFA 3ZUNA 1X55A 2RD0A 3AULA 5HHDG 1OQYA 3GTKB 1SYEA 1XT9B 2CFMA 1WR1A 1Q82C 3BVMA 4B3SL 5JOBA 2JSOA 2PZWA 2Q2UA 4DQOC 2RPQA 3NS8A 2LWPA 4NXMQ 2Q5WD 3JAMc 2IWHA 3BIID 1CKOA 4P2CB 5MPOA 5KNCA 3HOZG 1F1HA 1YJJA 3ZRCA 2ICEC 3CD6A 3K5NA 4G0NB 3I63C 1FCLA 2MLBA 5BYQA 3RI7C 1GUWA 1TVXA 1STGA 3KDFB 2PQAB 3RLNA 2DENB 1TWFH 4DV7Q 2KX3A 1MBYA 2K6DB 4JI8Q 4JI4L 2KWDA 1B9MA 3QO2A 1CZWA 1JB7A 4YSZB 2IW3A 3W1SC 2OEDA 5EKIA 5DEHA 5LXHA 3I56A 1YD8U 2KYWA 4NAWB 2Y5PA 2EXDA 5JZEB 4O2DA 4C3JH 3AB9A 4KHZA 5KNBA 1RIPA 1Z5SB 3E5SA 2J52A 2HE7A 2MO0A 2N1VA 3GE8C 2JWZA 4DBGA 3H7PA 4KV6A 2NN6I 3MJWA 1IW7D 2VY3A 3KF8A 2BH2A 3GTJB 2BYEA 4LCDE 2NVTB 4TQ1A 4HJ5A 1H9JA 2DX5B 2HTHA 3Q6SA 4M8AA 2CKZB 5J3BA 2B2WC 2K0PA 2AWOA 4BBNF 2C7NB 2I5HA 2YVCA 4DV0Q 5EGTA 1PYBA 2N88A 2UUCQ 4WJOA 1Q10A 4LF8L 4DV5L 3NELA 1XXGA 3PGEA 1I42A 3QOJA 1I6HB 3TP8A 3PO3B 1HTLD 1KDAA 1N62A 3L4PA 1UF0A 4KGTA 2HD5B 4LDTD 5EE9A 1FGBD 1Q86C 1XPRA 2IX0A 4R4OA 4HJAA 3A7AB 1ENCA 1WSPA 1JJCB 3U52E 1ASZA 3P1MA 1PH8A 1E8WA 4W9CA 1YIWA 1G51A 2VUMB 2TMPA 3TDQA 1G2TA 1H9RA 1WFYA 1ONLA 2MP2A 1I4HA 2FIFA 2YTXA 2W3SA 3WCQA 5C2TB 5FJ8H 3I4MG 1R7SA 3MEFA 3VYUA 1XF5L 2BBCA 4G7ZC 4XTCS 2JYEA 4DUYL 1EFID 3VUXA 2PPHA 1PLFA 4Q0FA 1FL0A 4HIMA 1MSHA 1AYFA 3B0AA 4S3SA 5G2NA 2ZTCA 1VS0A 3NVVA 1S3OA 5GAHC 4MIUA 1IW7C 3R3MA 1WD0A 1XNRL 1GOZA 1WTOA 5IGDA 4NAMA 2K8BA 2YEPF 1VQGA 4IOCA 1O78A 1L1OB 5ELOA 4M02A 4JBWA 3AH7A 1O7IA 4A3CH 2MEKA 1NYQA 3KOJA 1HR0L 2KHSA 2N55A 3CU7A 2KEEA 1QILA 3I4OA 4HDOA 1JOKA 1JROA 2JYOA 2MUYA 2PMZE 4B9XA 1WX8A 2K5HA 3GTGH 5C23A 4RF1A 3TN2A 4CDCC 2KO3A 3RZDH 4A3GB 1YBYA 4FF3A 5DLQE 2WXHA 4G50A 1Y1VG 2CU1A 4EVOA 1SFOH 4LJPB 1NI3A 2R7ZG 2AQ3B 2GA4B 4MELA 4KZCA 1QUQB 4DV3Q 1QZGA 1ZXIA 2O6VB 3S2HB 4K14A 3J7AF 2QC8A 2PYKA 3WOEA 3VR2A 2JZPA 3S1QH 1E6EB 1JRPA 3DM3A 2N78A 4A3DG 1E5WA 1X65A 5FR3A 1WJNA 5AZGA 1CHPD 2JYTA 3L7ZC 4DXGA 3J81E 2NCNA 2G5DA 4A3JB 4II3B 3ZKJC 5EDSA 1FFUA 2KJHB 4KK7A 1PH4A 1L2NA 1I94Q 3S15H 1CTMA 4MGYE 1T0SC 3QARA 5LNK1 4XQNA 2RF4A 2N9XA 3SR6A 4MGKE 2D0OA 3AYHB 3VR4A 4IFDJ 1QOAA 2IO3B 2D3CA 3R7RA 3D4WA 3UINB 2PW9A 4US8A 3J81i 1JWSD 1SAPA 2VNUD 2D07B 1SNCA 1D5ZC 2NYZD 3K57A 5LMNQ 2EYLA 3FVQA 4QL5A 1JJ2A 1JRUA 1WGGA 1DOMA 2KOLA 3PUZA 4ZRPA 5DCNA 4IUQA 1IHZA 2AWNA 2JA8B 2F0PA 1C4CA 2CQOA 1MVKA 1XD3B 4WIPA 2FCQA 3EHVA 3PHWB 3ZO5B 3NHHA 1V1PB 2LMCB 5BR8Q 4CJ2C 1XMOQ 3LB8C 1NBWA 3RFZB 3ZNHB 4NW2A 1I3QB 1C4AA 2UU7A 1FCCC 4PV1C 3S17B 1Q1OA 2G9HD 1XX8A 1SJHD 3KLRA 4CKEA 2FCNA 4MH8A 4A4IA 3AMZA 4BA2I 1EY4A 1WI0A 2K5DA 3VUYA 3SK4A 4DR7Q 4DF7A 3GTOB 4A3MB 2JX5A 1JW9D 4C7YA 2BH8A 3H0GG 4KJNA 4BS9A 5M5XB 3MTSA 4ZKCB 2LVQA 5JXVA 3EUB2 4B0MA 1C0AA 1KF6B 1HCZA 2NZOA 3I4MH 1K52A 1YX6B 2VXWA 3A33B 4A90A 1I4PA 3UF8A 1ML0D 1IBLQ 1F2YA 1MD2D 1I4QA 3N20C 3KFUA 4YIJA 1EOVA 2NB0A 4B95A 3HKZG 1K8GA 2ZZPB 4ZHOA 1AEXA 4FXGC 3ULLA 1UWXA 4DV4L 3NWTA 2CHZA 2QCZA 3PO2G 5LXIB 3EJIA 3NHEB 4WWOA 1YHAA 3AB5A 4Y7NB 4DXFA 4UHVA 4KD3A 3CF6E 4EE2A 2K33A 1Q90A 4NNJB 3A74A 1KJTA 3T56B 4JK1C 2WXFA 2C5CA 2NBFA 2V4IB 4GSWA 4JV5L 2JT4B 4EEWA 4J3OD 1GJXA 4RFBA 5C3WA 2KK8A 3OJ3A 3CPFA 2M1MA 3E56A 4OHJA 1OEYA 2RDHA 1GHKA 3D32A 3DCGA 2LGXA 4JI7Q 3A54A 3W1SA 1J8CA 1QE6A 3IFWB 3PT2B 2B63B 3QR8A 1QNKA 1Y1VH 5JAVA 1PFDA 3L16A 1HTOA 5TSSA 1GVPA 1N60A 3W1GA 3Q8CA 1VF7A 3VR5A 4OWTB 4DR2Q 4IM0A 4C7ZA 2O2VB 4A3DH 2E2JB 3VR9B 4I6PA 4WWPA 1RCVD 3SU8X 2DJFC 5C4ZA 1VCIA 1G8ZD 4B3TQ 1IKMA 5IYDG 3RNUA 2F0JA 1C7YA 2N7DA 1C48A 4XT1B 2L0FA 3AEAB 3K5LA 5GXGB 1PTOH 1WJ4A 4JC0A 1VRAB 2KZRA 1N32Q 2A6ED 1MHHE 4LJZC 3GTQH 2SNMA 1JQ4A 4JI6Q 3NENA 2WFWA 5FLMH 1VLBA 2PW5A 4GIVA 1D7QA 3W2DA 1GUNA 4EFOA 2IL8A 2PMVA 2UUBQ 1NSNS 5EQ0A 3NQTA 3VYRA 4RNAA 3HZXA 2F0FA 3PLUA 4N6EB 1OEYJ 1SE2A 2G4SA 2KC1A 4A3FB 2KJRA 3VR8B 1RDPD 1T5EA 1UELA 2B2YC 3MXGA 1P3QU 3P75A 3R3OA 2V1YA 3DOWA 4A3PA 3E9HA 1SYGA 3X0WA 5ELCA 4DUZL 1KTKA 3UIOB 3KLWA 4L8JA 3P42A 1CSPA 4IURA 4ZAIA 5ELBA 4KY6A 4B9KA 1JB3A 2A1AA 1SIFA 5CMDA 4EUTA 3CP0A 1GXDC 4QGUA 2ZNVB 3H0GH 3D4DA 4B3MQ 4EZLA 1V81A 1C4QA 2QDBA 1IL8A 4GNXC 2HHHL 3FRPB 1K28A 2EIFA 4L5QA 2KLGA 2JA7G 1QOHA 3BWUD 1FVIA 5LMUL 1B7YB 3FKIB 1IP9A 4AUQC 4G57A 3DBHI 2DZKA 2CCZA 5CV5A 2A69D 3H7SA 4H7BA 1TIFA 1XJVA 4HWIB 2A6EC 1S5CD 3PO2H 1VQMA 1AFPA 3N1ZC 2EJFC 4GOPB 5KYLA 4X64L 2O5JC 1V97A 3T1HQ 2Z59B 2MSED 4KI0A 4BY1B 1KD1C 4R3DA 1X3EA 4LF9Q 2LASA 5HGQA 4IUVA 3SGIA 3CCQA 3P4RB 4UP8A 4PYUA 2A6HD 2E2IH 1JICA 4DV1L 2Q8IB 3Q3FA 1SIJA 2C35B 1F9RA 3H7PB 4WORA 1HZAA 1STYA 4FDBA 3NRZA 4ZRJA 3R7QA 3QX1A 2HIXA 3KF8B 3UI2A 3EN2A 1YZ6A 5EBDA 4JYAL 3P63A 1WCMB 1E7UA 5KEEA 1D2BA 4YWGG 3HOVH 1VQHA 1ESRA 1WOCA 5J2RA 4REZA 2F0MA 4EQ5A 1KQSA 3GTLB 2K3UA 2C9OA 2QKIC 1R4NI 2BT6A 3ABVB 3TBLD 3VDZA 4A20A 4H02A 2INCC 3OAWA 1WXMA 4AQ7A 3PZDA 1TKWB 3K80C 4ICUA 2KDEB 1SMXA 4HROA 1FGUA 1A62A 4IPGA 4DR3Q 2PMZB 3PF4A 3N30A 1JT8A 3OLMD 1EQQA 5C1ZA 1IBXB 2PQAA 3J7AV 1GAQB 1D3ZA 1LTGD 2XTIA 5IYDH 1YQ3B 4M00A 3NPPA 1WGRA 2LGDA 2F0SA 3DBHB 1N61A 3EFUA 3I4NB 1HNXQ 2HDEA 2JPHA 2L1BA 2B39A 2L00B 2ZJPA 1VDZA 2JY6A 1QKZA 2A69C 3E9IA 1HZBA 3NJTA 2EMSA 4JI5Q 1IXRA 3HOZB 3U4ZA 2LFIA 3H3VH 3KJPA 4F1SA 3ER0A 3V61A 1MI2A 2RDFA 1Q46A 1RJTA 5IO9A 3ZRFA 5AEKB 5CBEE 1EM7A 3PV0A 2KDFB 4A3BG 1SE3A 3PIO3 1FJGL 3I7FA 2A6HC 3TSSA 1RTOA 2A68D 1TYGB 2PEAA 4G11A 3U4VA 2AYOB 3JSVB 3MAQA 1IL2A 1Y1WG 4GOCA 2ZM6L 1HTPA 3F2BA 4X57B 1UNSA 1SE4A 3PV1A 4OXPA 3K0YA 3CPWA 1KRTA 3MXUA 4FLHA 4ZRQA 2K5PA 4TRDA 4CKCA 4HIKA 1R4NB 5CORA 1XMQQ 4IWPA 1N36L 2F1MA 4HK2A 2K32A 1NJIC 2B2VC 4QCLA 1KH0A 1IPGA 2BB5A 1EU4A 4J6IA 1DGSA 1E1OA 4AQYQ 4TQ0A 1F77A 1SGHA 1U4RA 4KGSA 1PZID 2F0TA 4B3RL 1PH6A 1WTQA 3K58A 4DK3C 1J7AA 1ILQA 3DMUA 3V60A 1TBEA 3MXNB 2WXLA 3HOYB 2KTRB 4N8FA 2DLBA 4B0EA 4ANVA 4TVAB 1A0IA 2E2DC 5JPNC 3J81j 2JA7H 2MWSB 1TTNA 3R66C 4K3BA 1Z2MA 4US9A 2QMTA 4ZYNA 2I0QA 3EQLC 4GLXA 2R92G 4A3EH 1S5FD 4HKZE 4W9GA 1SROA 1YNJD 4KKTA 4O1NA 5EPJA 4CQNA 1ACCA 3FPPA 4UP7A 1YJ9A 2VQFQ 2BOSA 3QIJA 4JGHB 2PE6B 4BBRG 1YI2A 1PFMA 2EYHA 2EYMA 3OWFA 4OVUA 2P5ZX 4V0BA 3GD7A 1L2FA 1WYGA 1ZOYB 1KRHA 2WXGA 2A68C 1FMAD 2K1BA 5T1IA 2MX2A 2ICIA 2NZHA 4L63B 4F7XA 4JI0Q 5IWAQ 1BQQT 1E2ZA 2MPMA 4A6QA 4RG1A 2ZEQA 3ZYYX 4WAFA 1S72A 2R61A 4QMGA 1CHQD 2HDMA 3T4AC 1P8LA 3AE2B 1O7LA 2BCOA 1LV9A 1UE5A 1EO6A 5C3EG 3P2BA 1VQKA 2WXMA 4AYBG 4FYDA 3HOWG 3ML8A 4ULLA 1YJNA 4A93G 4YL8A 5AZFA 4DV2Q 3KYHC 1A70A 2KQSA 3J80c 4DHJD 3GB1A 2VQEQ 5C4XG 3IBEA 1F9PA 1RAXA 3PHXB 2I5LX 3DVGX 2QEXA 4A9AA 1CKNA 2UUAQ 4DN4M 4DK5A 2K03A 3SHQA 1YNJC 5KNDA 4DAMA 1LO5D 1FIQA 2XWJB 1NUCA 1EIYB 3KF6B 4BKSD 1WGDA 1BR9A 3A9KB 1WZ3A 1QZEA 1EWYC 5C0XI 1D5MC 1PZJD 2L0TA 3CCVA 4IPCA 3DQVA 4TV3A 4X6AH 4L5TA 1SE9A 2EELA 3Q6BA 4DR6L 2RVLA 2K8CA 4A3BH 3BS1A 4FVMA 2JA5G 4CDEC 1T6BX 2FMCA 2R6GA 3CMMB 2Y5CA 4WURA 4ZYSA 4CGYB 2RSNA 5BN4A 3S1NB 1MFWA 1XCTL 1H9SA 5IGFA 3HOUG 2ZCBA 4N9TA 2QILA 3I91A 3AEEB 3QOLA 3APDA 1V49A 5EPLA 2B76B 2L7RA 1V1PA 4HMJA 2LMCA 5J22A 4IWOA 2B8FA 1FXTB 3TP7A 1S5DD 3LDZE 5JEAJ 4XWTA 2ONQA 1HH2P 4ZQ3A 3OW2A 1KABA 3FMCA 3I8ZA 4MTNA 4IM3A 1X32A 4ANUA 3U7DA 5ELFA 3QK0A 2XWBB 2VZAA 3U9SA 5IODA 4X66L 4TQUS 2LHDA 4S0RA 4OONA 2WLBA 4MNOA 3U8ZA 3QHTA 2SNSA 2W54A 3EA6A 3SR1A 5LMNW 2R92H 1D4BA 1T9HA 1P1AA 4I6LB 2INPE 5GROA 2XEWA 5EE1A 1HA5A 3L08A 4PS8A 3PUYA 4J8QA 4XZ4A 5GADC 4C2MB 3CQZB 1XLPA 2PZTA 4LLGM 4XDXA 2D3GA 4RM9A 4BBRH 3E6ZX 4NPNA 2IZVB 1WGKA 4WQOB 2WB1E 3DLLA 3SFDB 1D1IA 2CH4W 2KLCA 2IX3A 3DXJC 4OIKA 3MC8A 1JOQA 4MGZE 1KHIA 2DY8A 2EZVA 2J42A 4W9HA 1R4QB 4IPDA 3VTVA 4KN7C 5COYA 2F4VL 2AUJD 4ZKBB 2J53A 3EFCA 5E6JA 3IL8A 4E3CA 3HG9A 3A4RA 1B4OA 3E0EA 4A3KG 1ZP0B 2HQEA 1FPYA 2WGSA 3RNBC 2KQ7A 2I38A 1WH3A 4OX9L 2JZ3B 5ELNA 5F2DA 3S1RH 3AE9B 2FXQA 4IUNA 1F2MA 4LUZA 4IUTA 3KVFB 1SXTA 2NVXB 1VDVA 3HOWH 2MJ8A 3STBD 4AYBE 4KGRA 4A93H 2PLPA 3BINA 2F0UA 4NJ6A 1BCPD 4HIOA 3I4LA 3LWEA 3S1MH 4OO1G 3MTNB 2MW5A 2O2VA 3AEDB 2IBIB 4MACA 3RMKC 5FLXE 4K5WA 2FMMA 1J5EL 3T1YQ 2UYZB 3UGBB 4OZBA 3QAQA 3AXCA 5IYCG 2D0PA 4MHEA 3Q22A 3M3YH 1JQYD 5HURA 1DZ1A 2OJWA 4K3CA 5GMVA 3S9WA 4ZUJA 1EF5A 1GJZA 1SYFA 4IG7B 4JI3Q 3IT6B 4HCEA 1SNPA 4FP5D 1PTOD 4LFAL 2VW9A 1TGZB 5LL6X 3NVWA 3ITPA 3V62A 4IJLA 1NVID 4JE3B 4KKJA 3GTMB 2KFKA 1AZPA 1YNND 3K7AH 3B08A 1VQNA 4ID6A 1A8VA 1CT1D 3Q8AA 1BUVT 1WTRA 4QY7A 1EU3A 2JA5H 1ZEQX 1PFSA 2R3ZA 3WAPA 1STAA 4LFCQ 4YXDB 3RLFA 1WJ6A 4C3IB 2JWUA 2ZW0A 3GOEA 1G91A 2K4KA 3HOUH 1EQVA 4LDTB 4NDXA 4R4IA 4BBSG 4RHSA 2H88B 3RZOB 1Q0WB 1I6VC 2K25A 4BXXH 4DV6L 4HPLB 2YU9H 3DBSA 4MN3A 1VQIA 1QCBD 2H1EA 3SXHA 1L6VA 1X1MA 2LEKA 3RT3B 2J0KA 1NEKB 4LNNA 3ZIMA 3AE3B 1BXTA 3HRDD 2E5LL 5GQOA 2K14A 2KBNA 1YQ4B 4WAAA 2BA1A 3STBC 1TR5A 1E2WA 4LTUA 1BCPC 3DWAA 4DGZA 2FCSA 5JJKA 1QJOA 3Q8EA 5CX3A 1YJWA 1G6PA 1OXVA 3A56A 4QIWE 3T16A 3PSIA 4L6TB 4X62Q 1LUZA 2E2HH 3HOXG 3D8GA 3DVNV 1VQ9A 2MHVA 4YCWA 3R2TA 3R8BA 2F0OA 2LVPA 1G6ZA 1WI5A 2LGSA 4DR4Q 3CCEA 3M4OB 2M0XA 2X8XX 4K0KL 1QQRA 4OVZA 3R2IA 1MJCA 1PTOC 2Z6BA 2JQRB 4KX6B 3HK0A 5M5WH 3W3AA 3DVNU 2WXRA 4URKA 3NTIA 5M5YH 1PVOA 4IN3A 1YNNC 5IT9c 3K5OA 1HNWQ 1PRTD 3NBHB 3CKIB 1TWGH 4GOPA 2BS3B 4L5SA 1Q3LA 2R93G 1EIHA 3Q0AA 1HNZQ 2PNRC 1Z47A 3ONAB 4II2B 4C4VB 2UXDQ 2BYVE 4LW1A 2KMAA 1WTHA 4P16A 1STEA 4K81A 3L9AX 1KXLA 1IBKL 2LGYA 3VVWB 1M1KC 1WRDB 5EKKA 2N9KA 1KAWA 2KCNA 2EMTA 3WAMA 2INDC 3PUXA 2VL6A 2KUMA 1EY7A 4A3KH 2G4DB 4GLSC 2F0IA 1UEBA 2GVAA 3I3TB 3MZ5A 1LTBD 3OTOQ 2X6GA 1VZ8A 1XNQQ 1RTNA 3Q2AC 4XXEA 3N1YC 4IFDG 2JXXA 2MFIA 2G9DA 5D7GA 4R4QA 1VQ7A 3APFA 2ID0A 1I50B 2KANA 3DEPA 4OO1H 1OTCA 3O65B 4KKUA 2A4ZA 3EC8A 2Z4HA 1PV4A 2N49A 4B08A 4YY3L 1VQBA 4GDLB 4NJCA 5M3MG 1SSNA 1Y56A 5JHBA 1GB1A 2B2UC 4LMQD 5EPKA 1IBXA 4JPSA 5IYCH 5IN7A 3RR5A 1U4PA 1ZDVA 2R7FA 4EZJA 2AMCB 1OTRB 2N8NA 4JOIA 1PGBA 1Q8KA 4RAUC 3C3LA 2WXOA 2IX1A 2PIAA 5FLXL 2F0HA 4NXML 2A19A 1M8AA 1PRTC 2JZZA 4ICVA 4POGA 3SE0A 3RULA 1PA6A 2H4OA 1V86A 2K5NA 2KX0A 3PTFC 2DGYA 3FKIH 4JI2Q 2AKWB 4GU2A 2J7ZA 1W2BA 1LYLA 4KSLC 1EUJA 4X65Q 3S16B 3UDFA 4QQBX 1DGJA 4ITKA 1MKHA 3PQIA 3UIPB 4BY7G 4BBSH 4C3HB 1K8AC 1PGAA 3T13A 1WJUA 4DV7L 1Y8OB 3JSVA 1XO3A 4POFA 4JI8L 2K5VA 3VA5A 4UDUC 1H95A 4A3IG 5J18A 1WFQA 3GV3A 3QWNA 4O0AA 3V2TA 3C8YA 3ZGZA 4K6DA 3BDCA 3BK1A 1C4PA 2MRPA 1P9DU 3Q14C 2KMCA 4BKSA 1QF6A 3AU7A 2W82A 3X23A 1GNUA 4ARIA 2MBEA 2L9HA 1VQ4A 2ZXRA 3VA7A 3KYCD 3DEOA 3MJ5A 5DPSA 2PI2E 4F7ZA 3UE1A 1DCZA 2OTLA 3AEFB 1SDFA 2BGFA 1EQTA 1ZGUB 3BG3A 1UD7A 2DYMA 1K3BC 5CV4A 5E7NA 3BYTB 3MXNA 3HOXH 1Y1WB 2KTRA 1EWIA 2XSCA 2FAZA 1RL2A 3CAMA 5DM73 4DNRB 3RZFA 1S5BD 4DV0L 4LUVA 4MJSB 5I9OA 2UUCL 1HFNA 4GN3B 2Q8RE 3LXFA 3Q3MC 4C00A 5C44G 2AWTA 1C9FA 3H3VC 1EWCA 1YEZA 2IT1A 1V6EA 1W3SA 1RLFA 4P71A 1CKNB 2B2TC 3AE1B 4HSVA 2R93H 1RM6C 3I55A 1X6OA 3NUHB 4FN2A 4KJOA 2CQAA 5HI1A 2KQ3A 1E10A 3PREA 2KDMA 2REXA 2M4NA 3BVGA 1WGHA 1U9RA 3EIVA 4OZAA 1AW7A 5M3FH 2GMIC 2QW7A 3DDCB 1WMHA 2M00A 4MEMA 1BUIC 1Q1EA 3ALBA 4A76A 2K6AA 1VR9A 2KWVB 4P1BC 2WB1B 5AZHA 3F8TA 1TU2B 5FLMG 2CS4A 2F0GA 3G6JB 2DAJA 2CHBD 4IFDH 4B9WA 1H9SB 1C8CA 5C4JH 1TT5B 3Q3NC 4XDCA 4GNXB 4A8XC 1E8XA 5BMIA 1AP0A 1FNWA 1JJGA 1GUGA 1HQRD 2LZ6A 4E6IA 1QVGA 2UU9Q 2IGHA 5IP4D 5AJ3Q 3CCLA 3P4QB 5CV6A 5M3MH 1KDCA 1EY0A 1L4DB 2HDLA 4PS7A 4DR5Q 1PH1A 2CJNA 4RWSC 4F88A 1D5XC 1EUVB 3H8HA 1R9TH 1UE6A 2WAQG 1Z6HA 1B9RA 1G2SA 4FULA 2B3AA 3KWLA 3TRZA 4GXBA 2ZTDA 5C3EB 3BJUA 5CTRC 2Z1CA 2IY0B 4AWJA 2EPBA 4AYBB 1Y69U 3KF6A 2C9WB 1DOXA 3A9KA 4LFBQ 1QOBA 3BK2A 2H5XA 2G1EA 4DV3L 2F3WA 2OHFA 4ZCKA 3PIOA 2IHFA 1FR3A 5C4XB 2DN8A 2AHOB 3JAML 4BY7H 5CGKA 4X3SA 3MC0B 1HZ5A 2HT1A 3PF5A 1O80A 2CKHB 4L1BA 1N34Q 5KGUA 3NZUA 4DA2A 4APVA 4A3IH 2JA6G 3C1EA 2VS1A 4P75A 1I94L 1LT4D 1P7EA 1WE7A 2N9EB 3I9V1 2CR5A 2ZT9C 2JQOA 3IKJA 4LF4Q 2KC2A 4KZ0A 3HVZA 3AE8B 4GKJQ 4CDDC 4KMUC 4JI1Q 1OQRA 1N5XA 2BW2A 2OOBB 4RH6A 2K05A 4PT5A 5IGBA 3ZJTA 2NVYB 5LMNL 1I4RA 3S14B 1LGRA 3NWSA 4W9LA 1TWHB 4HDQA 2V1CC 3RYTA 2MBHA 5KYIA 5I4DA 3HOVG 3A1QA 2NVQH 2WDRB 1EWHA 1WJJA 5D3DA 3MP9A 2E76C 2QIEB 4HJKA 3KJOA 3L10B 4JX1C 3MFYA 2RMMA 1KLUD 2LXCA 1SN8A 2J0TD 3N1XC 1K0SA 5BR8L 4HEA1 5C44H 1XMOL 4MSQB 1VQPA 1X54A 1IYFA 4JW0A 1ZKHA 3UDXA 2B8GA 4N59A 3H91A 2PQEA 4P1CC 3Q23A 1RFKA 2B2WA 2LS01 3RUZA 2FUHB 3B1LX 1ZYRD 3UQAA 3H6NA 4DR7L 1SJED 1UWMA 2NBUA 1U4MA 1JE5A 1KFYB 2IHEA 4OO1I 4RGMA 3APCA 1U0LA 1VZ7A 2FNJB 1C78A 3U30A 1EFWA 3DHIC 3I3CA 2L11A 2TSSA 3GTPH 3TS2A 4XQJA 5IKCM 3LYYA 5IOIA 3GDEA 3RNAC 1P98A 2KFKB 3BU2A 1H4RA 1S5ED 2BDNA 3H15A 1KNAA 1IBLL 1X3QA 1T0RC 4IW0A 4OZCA 1L1OC 2QA4A 3IVFA 4GKKQ 2VB3X 5KRUA 1JOOA 2KWUB 4EQOA 2BS4B 2ZPNA 3DHGC 1TWFB 3D0FA 3NE5B 3ZJVA 5IIFA 3V96A 1DM0B 4YWMA 4ALPA 3LWUA 2UXBQ 1NI2A 2W9NA 3VAWA 1JR0D 2PE9A 4MGIE 3W5VB 2GN5A 4C3JB 1BCPF 5KHOA 3AFQA 3JVZX 2K75A 1ZW7A 2K28A 1GHJA 4KY5A 1NMGA 1SLJA 3AI5A 2RDGA 4WJWA 5C3XA 3OJ4B 1UE1A 3R93A 4W9FA 2L05A 3NTKA 4JYAQ 1L0VB 4HCNB 3NP8A 2Z0SA 1N5WA 3CRKC 4JI7L 2DBYA 2QJLA 4WJNA 1TIID 3C19A 4P74A 4FXDA 5C0XJ 1HE8A 3L54A 1RHPA 1PTOF 4UP9A 5JPMC 2QF7A 3G71A 1RYJA 1L4ZB 2V9HA 1ZYRC 2Z6KC 1K83H 1LM0A 2MQHA 4XYOA 5IYBG 4A75A 1EL0A 2YEPB 1E7PB 2EYFA 5K36G 1WXQA 2C60A 4QF4A 1GD7A 4DR2L 4A3EG 3OSOA 4W9DA 1SNQA 4ANWA 1HPCA 4JWUC 1KNEA 2L1AA 2K5WA 2BKFA 3IXSA 4E74A 4B3TL 3HKZE 2MJDA 2IY5B 1QB5D 3NTHA 2JA6H 1H9KA 1LM8B 1A5RA 1BT0A 3QQ8B 1KC8C 1UUPA 2KEDA 5M9OA 2XNAC 2ASBA 4YCVA 4LUOA 1IBMQ 1FRDA 4JVZA 2SAKA 2W55A 3RN9C 3OYYA 3I72A 4K2KA 3HFZB 5LL6S 1LACA 2E3TA 1N32L 5CC4A 1JCKB 4KV2A 2PW7A 1CQVA 1T3QA 2D5DA 4R4CA 1MIUA 4XYQA 4JI6L 2IYDB 3KBGA 5J39A 2LJIA 1BNZA 2L4NA 5IP7G 2LUMA 5HKHA 1TZ1A 3E9SA 3RN2A 4HIDA 3NZSA 4PZ8A 3RNGC 1ZE3D 4DKAC 5GAEC 1ILPA 2F0VA 2L52A 2Z0EB 1A3VA 1VQCA 1VQOA 1CMXB 4PG3A 2RCNA 1N33Q 2WP8J 4FXKC 2DZIA 3IFTA 4MSMB 2CW0D 2RPVA 4ARCA 3AE5B 1MI0A 3SD5A 3PO3G 3NBHA 4B3RQ 2NBVB 3DBRI 1PRTF 2D3AA 2YV5A 1X9NA 2PPBC 3CC4A 5EBCA 4C4VA 4DDGD 3RZDB 5BN3A 2JP1A 2M8SA 4B3ML 1UBQA 4UPAA 4JCVE 3PZ7A 3Q69A 5IGGA 1SFOB 2VUMG 2L5TA 3CW2C 3GO5A 1LTTD 2WKCA 3A55A 4QB4A 3FEWX 2YLMA 2QDLA 3CWIA 1T0QC 1PH2A 4DHJB 2DAFA 1U4AA 4KY7A 3S1QB 3ZXVA 1TWAH 4GZYC 3M85A 4DAVA 4JLCA 2DHZA 4NP5A 2MQJA 2KCMA 2PZUA 4HXDA 4ZOHC 1PXUA 2L0CA 4LF6Q 1DOIA 1ENFA 3T1HL 3S15B 4M0WB 3M63B 3G48A 4M8NA 4I65A 3CCJA 4HMIA 4LF9L 5G5GA 3Q3JA 5K5PA 3LGJA 1KLVA 4GDLA 2K7VA 4ODGA 3W5OA 2INNE 4OWWB 3S2DH 1A3TA 1DOKA 3M7GA 1TWCH 1UZXB 1UAPA 5G3LD 2JA9A 2YTVA 4EZKA 3GTKH 4XC2A 2KTFA 2LKVA 2CW0C 3OMGA 3CF5A 3VXWA 1JALA 2CWAA 4A3GG 3ML9A 3DBRB 1NENB 1M90C 4IPHA 1MSGA 5IYBH 1EY5A 2IO1B 2X38A 1V43A 4ME5A 2XGTA 3WOFA 5K36H 1E7VA 2G3QB 3MHZA 5E4WC 3V6CB 1YVCA 1Y8NB 4PMWA 2L8JA 4MH0E 3CMEA 1XLNA 3M62B 1B53A 1CK1A 1KRSA 3K8AA 2Z0DB 5C5MA 1W6JA 2RSOA 2LHEA 3KUDB 4XWWA 4GMVA 5DM63 3A9JA 1IZ6A 1EIGA 1RODA 1WX9A 1CSQA 3E3XA 4A3JG 3VUWA 4X3KA 1HNXL 4IOAA 4JI5L 1HR0W 3RNCC 4AS1A 1Q81C 4ZUIA 3I4MB 3VTUA 3RZWC 1II3A 4KHVA 2UXCL 3I70A 3AFPA 2NS5A 3KQ4A 1JC7A 1H9MA 3J7YW 3Q8FA 4BAXA 1EYDA 1ENAA 1EYAA 2EE1A 1WMHB 4EQNA 5IP7H 3NEMA 1SNDA 3GTJH 4M1UB 2NVTH 1RF2D 3SK5A 1AH9A 5HFYA 3TCAA 2ES2A 2XRQD 3WDNA 5L83A 5FK9C 1OGWA 4QUCA 2ZNVC 4MJSA 5T1GA 2CHXA 3A0JA 1K9MC 3G4SA 3KYDD 1E0ZA 3G7LA 4CKBA 3W1YA 1OFFA 1XMQL 1I6HH 3PO3H 1TXYA 3RNFC 3RCZA 4AQYL 1XYIA 2FHTA 3KK7A 2B2YA 4KIKA 1V1QA 5E1FA 1QZHA 1J8IA 1Y1VB 4A3MG 2GB1A 3URYA 5E6NA 2VUMH 2R7ZB 4KN4C 4C56C 2VB2X 1OXSC 5I6WA 3VQIA 2SEBD 3KWVA 4AH6A 4KDIC 2ZJDA 4C80A 4QUFA 3AU4A 2R7DA 2HIVA 5LLIA 4HSPA 3IAS1 1J19A 2ZW1A 3L13A 4FJYA 4TKNA 4A3DB 5H1SE 4H2AA 1BDOA 1F2RC 1ZUD2 2QHOA 2VQFL 1V9PA 3FAHA 3U58A 1X3GA 2NN6H 4GNXA 2RHSB 3N6RA 4R9WA 4IC7B 1NCVA 2I07B 1FFVA 4BXXG 1NYRA 1XPUA 2J0JA 4ZK9B 1X3FA 2GBNA 4WJQA 3W9CB 1HTQA 1PTOB 2RBMA 3NZ3A 5T8IA 3MHBA 4DR1Q 1UE7A 2OT2A 4JI0L 5IWAL 4YTNB 5HGTA 1N63A 1VZ6A 4JL9A 3GTQB 3T3NA 1J0GA 3M9BA 2NTTA 3NSWA 1A15A 1D8LA 4LF5Q 4WWNA 1LTLA 4HLEA 3DHHC 3H6MA 5EAYA 1SEBD 2EQSA 3D6WA 1I7HA 4LF7Q 2VZKD 1KLGD 1CFMA 2B63G 4A3GH 3A1QB 3IAM1 3NS1A 4MM3A 3AE4B 1HUNA 1AE3A 4OW0A 5JEAH 1ZXTA 2EYJA 2CHWA 1HA6A 2M17A 3DWGC 2DZJA 4F8CB 2DNCA 3J80E 3S2HH 4HEDA 5IOCA 4DV2L 3NUCA 4YHHQ 2VQEL 3OW7A 4ME3A 4GN1A 1B70B 1SYCA 2J7QB 3TIXA 4HJ7A 1YJIA 3K9PB 4W9IA 2JE6I 3AV8A 4NXNQ 3DUZA 3Q8DA 1L0WA 2UUAL 4A3JH 1WD1A 3H0GB 1PUTA 3GV6A 1V9JA 3F2UA 3ZVVA 5DAUA 4UY8C 2Z9HA 1WTPA 1B1ZA 4CO7A 4ZLTF 2N7EA 3SK6A 2KQ4X 3BYYB 2N9LA 4JWSC 1VQAA 2NBWB 2N4FA 4XGAB 3K7UC 3ULPA 5JJLA 2KMMA 3PZ8A 1IYUA 2LSSA 3HKZB 2XVSA 1MGSA 4NB3A 4IO9A 4FHJA 2V4DA 4PZ6A 1JMLA 4C1NK 1EY6A 3PO2B 1WXAA 1EYCA 4FF1A 1PRTB 4O42A 2GBKA 2JA8H 3H3VI 4XIGS 4DV6Q 1XCQL 2WNMA 3NVYA 4KHPQ 4W9JA 1ZPSA 1RFAA 1NR2A 4LNQA 1GG3A 4HPPA 2E2IB 1NE3A 4DK6C 4FF2A 1ET9A 1I3QH 2V3SA 1MHWC 3S17H 3UQBA 2JXMB 2NMQA 5JHAA 4A3OA 3K59A 3OHXC 1OXXK 1L0YB 2CWPA 5NUCA 4NY0A 4B3SQ 3NG0A 5G55A 3GTOH 4A3MH 3HOVB 4P73A 3MVVA 3PIPA 4EGVA 1VCBA 2DYOA 1U4LA 4XQQA 2WV6D 1KDBA 3C1FA 3RD4A 3HS0C 5M5XH 1TY0A 1EF1A 2WP9B 4K7SA 1SRUA 4M8MA 2BVCA 4CHKA 2EYPA 3ND9A 4ILWA 2B2VA 4N8X1 3VR6A 1VD2A 4K5XA 4DDID 5BYRA 1IYVA 3ECIA 1EY8A 4XX5A 3CCSA 2ENBA 4IUPA 5EKLA 1ASYA 2FCMA 3FKIG 1AZQA 5E6PA 5CYUA 1FO4A 5IGEA 3ND8A 3BZCA 3HVDA 4ZDVA 4RA8A 4JI4Q 5CBAE 2KAJA 4Y7NH 2XK5B 1Q7YC 1PDQA 1IUEA 2WXKA 2DY7A 3K5MA 1IGDA 1U5KA 1L5PA 2AL6A 1WWTA 1V8CA 3W1BA 2RKSA 4R4TA 4IDIA 3OIQA 2OWOA 2WX1A 4YWLA 1YHBA 2ZCCA 2Q2HA 3NXWA 4OELB 3RMHA 4DNTB 1E8YA 1PMRA 2B63H 3SHLA 2IGGA 1HXYD 1WCMG 3A7LA 3NK9A 2K01A 4D2KA 1EQRA 4M01A 3ONSA 2WX0A 4TMAB 1T0YA 3B2FA 4U68A 3CRLC 3L3OC 1BBWA 1LQBA 2ZPYA 3L17A 2AL3A 4LF8Q 2MJ3A 4DV5Q 1PDXA 2DZMA 2FUG1 5C3JB 1OXUA 3RLOA 2KDIA 1BOSA 3I90A 5CHWA 2E2JH 1XQQA 2AEHA 1SNMA 2ACZB 5CV7A 3T1YL 1K0RA 4LAAA 2A5UA 3TQYA 2LXAA 5E6OA 3WALA 1EEFD 4DHZE 2GVBA 2VH1A 1SYDA 4W9EA 1SF0A 1O7ZA 1EZ8A 1K8MA 2EXZA 2QCPX 5CV8A 3J80L 2K9XA 2ON8A 2JU6X 1J9OA 3DM1A 3I4NG 3PSEB 4JI3L 3FHWA 4HR7B 2FIDA 2NPTA 3C0RB 2WQYB 3ZNID 3PPAA 2D11A 1SBBB 1YHQA 2JA7B 2BQQA 4X3TA 3J9CA 3A5ZB 5E4XA 2MA9B 4A3EB 3ENEA 1PH3A 2BYTA 3Q3OC 3ZW3A 5M3FG 3M4QA 4DUYQ 4LFCL 2M0AA 4WQMA 1NY4A 1WM3A 2M2LA 1FM0D 1C76A 4GGQA 2LY7A 1WR6E 4PNYA 3AEGB 1WVLA 2KN5A 2WYQA 1XNRQ 1JWUD 4F8MA 3O13A 3TS0A 4A3FH 1E7ZA 2KFJA 2C7MB 3TEHB 2YYZA 2BKRB 2LRWA 4FJZA 3KBXA 3PO0A 2PI2A 4C1NI 2ZXPA 3ERSX 3L2PA 2K6QA 1DD2A 3ZQ4A 1HR0Q 2CH4A 2PNHA 2E74C 3ZJUA 4RKBA 1ZXHA 3AQQA 3PRPB 4OVVA 2WS3B 2L83A 4YSYB 1XWEA 1C79A 1CI3M 3CCUA 3JAME 1YITA 3JYUA 4K5VA 1C1YB 4BKGA 1D1KA 4N9PA 4X62L 2LUEA 5BMGA 3HOYG 4DK1A 2D3BA 3DWMA 4XDDA 1K3RA 1SSOA 1VQ5A 2Q2TA 1LT6D 2RQXA 1LTAD 4DR4L 1J7CA 2MH7A 4HKQA 1R4MI 3MXPA 1FD7D 4IQZA 4AOFA 5IT9E 3JAMi 1BBUA 3VRAB 2OQ0A 1PGXA 4HCSA 3IG3A 2NR2A 3X3MA 3A9JB 1HNWL 4IKGA 1OQQA 3KLSX 3A8IE 3J81c 1HNZL 3AE7B 5DPRA 4M0WA 1CJEA 1JORA 5JJIA 4BY1H 2BDOA 2UXDL 2LD9A 3T8MA 3KH0A 3CSTA 1Z7TA 5BO4B 4DU9A 1XEEA 4IUMB 2KDBA 2MO1A 2C7HA 5D2MB 1QOFA 2BWES 1F0ZA 4YWKA 1TKEA 1WTWA 2VH2A 3NY5A 4L2YA 3A8JE 3MA2B 1VQEA 4IOIE 4A3BB 1F9SA 4A3LH 5G3LF 3TP6A 1DXMA 2EY5A 3BDLA 2WXNA 3F2CA 5FO7B 1UEAB 1WCMH 3OTOL 2R2QA 4IM2A 2DUDA 4G7OC 1XNQL 4Q5VA 1WTXA 1QT9A 1E2VA 3GTLH 1Q8IA 1MHXA 2GI9A 2MJEA 2ALYB 4PMCA 2Y3AA 3WAOA 3ZTDA 3JC66 1ISNA 3OWEB 1FXIA 3RPFC 1LT3D 2HJ8A 1B3AA 2KCTA 3C46A 1M94A 2AQ2B 3RNEC 3T51B 4LJOB 4J1MA 1V8QA 2WWZA 2WINB 3MWYW 2AX5A 1CM9A 1YIJA 3HKSA 2ZJQA 3W5UB 4FXCA 1FYCA 1R4MB 2PCFB 4KKSA 2A8VA 2F0WA 1F52A 1I35A 3B6YA 1CA5A 1VQ8A 1VQ6A 3C2PA 1YQBA 3I4NH 4KIKB 2HCCA 2HQLA 2L12A 1XPOA 1E8ZA 5C4HA 5CHVC 3HOZH 4CDFC 1K51A 3PIP3 4W9KA 1YJ1A 4USAA 3UDGA 1CUKA 2R92B 3OOCA 3U7ZA 4BFRA 1LABA 4H44C 3LJ3A 3V3XA 1TT2A 3EECA 3M4YA 4JI2L 5FR6A 3ZXRA 3PLVA 1PZKD 4X65L 1I5FA 2FJ2A 3VDYA 1RRBA 4PMBA 4BOSC 4BBRB 3ZNGC 3I73A 1AWDA 3SEBA 1V5TA 1NDDA 2JVCA 4DV4Q 5CR3A 1T5XD 2OXPA 4LWCA 3JW0X 4LNKA 2JJQA 5EJWA 3A8KE 2Y0SG 1TJEA 5IA7A 1YN3A 3TP5A 3CMAA 4JV5Q 3E0JA 2QDFA 4CBVA 4ZRKA 4DAYA 4FADA 2F03A 4QAYA 1KIXA 4J15A 1MG4A 1J6QA 4IZ8A 3DBLI 2WXIA 1JMCA 2ZVNA 1WYDA 5IGCA 2EYOA 3T9LA 2OTJA 2NVUI 2LRUA 4MM3B 3S1RB 1TS4A 4P72A 2JEAI 3HOYH 2D2QA 3AEBB 2EJMA 3PS6A 1F9QA 2N3SA 1YOVB 1FNVA 3HOWB 5ELEA 4ANXA 3H94A 4DPGA 4A93B 3CXCA 2RDBC 1SR3A 1SB3C 3S1MB 2JUOA 2I1KA 4NKLA 4MTKA 4RMAA 1PFBA 5D3IB 3CCRA 4KLKA 1AARA 1JWMD 4IWQA 4OGQC 1V80A 3V6EB 5C0XG 1CZGA 1PH9A 3KUPA 3BZDB 3M3YB 5D65A 4GB9A 4RM8A 4PZ7A 2GBRA 2PVOD 3WA0A 3TUOA 1I4XA 4CYEA 5DPWA 4Q2JA 2WACA 2K1FA 4HTHA 4R1JA 5IT9L 4Y52H 1VQDA 1TZOA 2IO0B 1NTGA 2J0MA 2LFNA 3K7AB 1NNXA 2E75C 2F0KA 3ERQA 1JWBD 1VJKA 2KXJA 3PVLA 3KUZA 4WJPA 2JA5B 1WTVA 1STNA 3FILA 1YN5A 2BB6A 4MDKE 4V190 2KCCA 1Z9FA 3UE0A 3VYSA 2FFKB 5GAGC 3ZTCA 3SFEB 4DNIA 3HOUB 1BMLC 3TL5A 2I46A 3WWVA 1BKBA 4K8JA 5AFWA 2NTSA 3ZJYC 1J7BA 3DBLB 3U4EG 2J4XA 4WFN3 1FD6A 2F0DA 2DNFA 3AE6B 2UU9L 2YU9B 2O6VD 3RUIB 5AJ3L 5E3FA 1LXDA 2KHJA 4DUZQ 1PFNA 4IALA 2QSDA 4TKOB 2SDFA 1LTID 4EX5A 5KIXA 2K8HA 4ACFA 2K5QA 4DR5L 2Z8LA 1YX5B 3CHBD 1GM5A 1QLBB 2N7JA 1E90A 3ETRA 3GS2A 3B9JA 4JBMA 4QIWB 3QA8A 1V2YA 4MZ9A 1MJDA 3AEVA 1XLOA 3NOBA 3AN1A 5C6AA 3H9DA 2I2YA 1EEID 2LXKA 2E2HB 2EKIA 4BWGB 1TY2A 2R7ZH 4LFBL 1ROEA 4L5RC 2B2UA 2HHHQ 5HG2A 1WXSA 3V05A 3D4RA 3PMFA 4X3UA 5LMUQ 1LFDA 4DHZB 1LLRD 5M5WB 5H92C 1TQOA 5M5YB 2V4LA 4C3IG 3F1ZA 1Y8RC 3EROA 4WWMA 3S1NH 1TWGB 1N34L 4X64Q 4J6HA 4RCNA 1K8RB 3HP3A 1VQFA 1WX7A 1NR4A 2OEOA 4HJ8A 3U2SC 4YTMB 1TS2A 5L37A 2Y0SE 4HJGE 3ZDTA 1JE4A 1HZCA 4LF4L 4DV1Q 3J81L 1SMYD 1XTDA 4UAIA 4GKJL 2B3GA 2F3VA 2WIIB 2O4XA 4RGNA 4ZRZA 4JI1L 4A3KB 2KNBA 2K52A 3TEYA 5FO9B 4FA6A 2JXTA 1RD9D 2OCEA 1PH5A 2WAQE 3M95A 2KVMA 4GS3A 2C5LC 5I6YA 1YN4A 4RGOS 2WDQB 1QOGA 1TS5A 2F52A 3KW5B 1F2RI 1WXVA 4R8NA 1B8AA 3J7A5 4TUUA 2EDGA 1ET6A 4OL7A 2KA7A 1XLQA 2BA0A 3BY4B 3HIZA 5TR5A 4FNFA 4DWFA 2EY2A 1O7YA 1P16A 2Q2IA 3PUVA 2HUGA 1TS3A 3SK8A 1P7FA 3TMPB 2GLSA 4BA1I 2KVRA 4C2MH 3CQZH 4CHTB 5C0XH 3OPOA 2MCNB 4OIJA 1ZDXA 2KACA 3IHPC 5CHFA 4B6WA 4WRDA 1UGJA 5H8YE 1WY8A 5EE3A 2XK5A 5A2QE 3HRZC 3Q24A 3IFDA 1VF5C 3LX0A 2IY1B 2XN9C 2NPTB 3TMEA 1L7YA 3VFKA 4LNFA 2EY1A 3A4SC 3NBIA 1E3PA 2RCFA 1PH7A 3K81C 1E22A 2B2TA 2X69A 2PTLA 2MNAA 2DNEA 2F0LA 1DOYA 5CV9A 1FJGQ 4GKKL 4NQLB 2KENA 3VH4B 4BBSB 5C5LA 1WE6A 1SMYC 2UUBL 2NWGA 1ICWA 2V3NA 2VRRB 3HUIA 3OG5A 4PK1A 1GUOA 3P4PB 1QG7A 4WJ3M 2ZM6Q 2E8GA 3NVZA 1SYBA 2OQKA 4FJVB 4GDKA 4H13C 2NVXH 4NJ7A 5JVH3 2UXBL 1GB4A 1E0BA 3P7JA 4ZRIA 2AUKA 2BF8B 3TZUA 4LNOA 2IPKD 4P7IA 1KAAA 2N0SB 5DNFA 1N36Q 1P0RA 1C77A 3SVMA 3IT4B 3H1UA 3P4SB 4BOZB 3M4PA 4IFDI 1NMFA 5DPTA 4H0LC 1KM7A 3BDOA 4TSSA 2FE8A 1GO3E 2ZVOA 1Q12A 3GTGB 2PKOA 2WDTB 2WU2B 2WU5B 1RWSA 3M3JA 3P1HA 1OO9B 2IJ0A 1NBFC 2KT7A 3VH3B 1N8RC 1L6UA 3HOXB 2JRIB 3IAYA 1WF9A 3CSFA 4GLVB 2XRSD 4DK0A 3QWZB 2ATWA 3L0OA 3J7ZC 3TZDA 4AJYB 1IYJB 3DHQA 3OIPA 3K9OB 3GTMH 4F87A 1C9OA 2XBBC 4NPSA 4RMFA 4KVGB 1SE8A 4GLAC 5L95C 1WGYA 4C3IH 2GBMA 3KDFA 1STBA 3A5UA 1A63A 1JWAD 1UH6A 4JBJA 4KD4A 2R93B 2NZ1D 2RA4A 4C3HG 4DFAA 3TREA 3RZOH 2NN6G 4P6VF 2F0NA 1CQFA 2DJGC 2SOBA 2RR9A 2GOWA 4NAWA 2QEJC 4OEMB 5J17A 1IBML 2BE5D 4HN7A 2MP2B 1EIFA 2KHIA 4YCUA 3DWQA 2OJRA 3QCAA 1LTRD 2UXCQ 4KTAA 1E9MA 1DYQA 3HGBA 1R4PB 5M3FB 3AMUA 2HTME 2Y5BB 1TKGA 1TKYA 1M4VA 2E6XA 3UI3A 5I2YA 4NZLB 1RKNA 3QJZA 5EE0A 4A55A 2A5HA 1A6XA 1CA6A 1YMHE 1QWYA 2Z4IA 3MEHA 4KSKC 3K6OA 3U9OA 5C4JB 2BPSA 2K22A 4BKTA 1BF4A 3N32A 3DVGY 2Q8TA 5JEAG 3T53B 3CCMA 2G45B 3AM9A 3CC2A 4BZAA 2N1WA 3M4OH 1N33L 1MG8A 2A74C 3OMCA 5M3MB 3VHTC 2F0EA 1UBIA 2KKCA 2ZTEA 4I7ZC 4DR3L 3QJYA 4LK0M 4BBNC 4FBJB 5ELDA 1A2TA 4OWXB 1R9TB 1DOLA 3SDZA 5FOBB 3GZNI 2BWFA 3DWPA 1IGCA 3PUWA 2DWQA 3D6CA 5JH5C 3FPUB 2L15A 2VZKB 2LI5A
chains in the Genus database with same CATH topology
4YTPB 1BO0A 1WRIA 3X3NA 3TEXA 1FEHA 4HRSA 5AUKA 1GUSA 4XT3B 3I57A 3EFXD 5A2QL 1XTCD 4BY7B 2BE5C 2BS2B 3H09A 5FKAC 4RF0A 4ABNA 2D62A 4A3IB 1EOTA 2HCIA 1D6EC 4U673 2NUCA 1YNTE 3EVQA 3HEJA 5JJZA 5BMHA 4XE0A 1ESFA 1K53A 5AUIA 1S4ZA 1IKLA 3VRBB 5BYSA 3M7NA 3RFZB 3VYTA 4FO2A 2K04A 1FXAA 1DONA 1V1OA 2WXJA 4K8IA 1I4GA 2NVQB 1F2LA 1HFGA 2WDVB 1ZKOA 4LK1C 1CZPA 2MGSA 2EVBA 5I9PA 5ISRA 4L23A 1BCPB 5C44B 4R8IA 1G291 2LGIA 3GQBA 5FO8B 2EOTA 2L55A 3BVZA 2F4IA 4K6LA 1HRJA 2CU3A 1EZ6A 3TEZA 2X6LA 2F0QA 3GP7A 3QIAA 4WH4A 3GTPB 2V3PA 2W3RA 2AQ1B 1MPEA 4RKLA 1A3UA 2D5GA 3QB3A 1B9NA 1Q1BA 4HAEA 3FILB 1K50A 1BBXC 3T3OA 2L32A 2EJGC 1QNUA 4RCOA 1HZ6A 3Q8BA 4KKIA 2A73B 2IGDA 5JVG3 4YT0B 2PO4A 2Y0SB 3NQIA 1F2ZA 3N9YC 1PYWD 4FF4A 4CJ0B 1FNUA 5A35A 2CVRA 2FINB 5I2XA 1HUMA 1VMCA 2WAQB 2CJOA 1GUTA 2H89B 1A2UA 5J1ZA 3D3RA 4RHRA 1HQMC 1Y8PB 2MP1A 1K83B 3VR3A 4DAPA 3FC4A 4G7HC 3EGRA 2EY6A 4Z9CB 2WKDA 1L0XB 2JA6B 2BTEA 2OF1A 2XIWA 1STHA 3D31A 4MT5A 2PVGC 2WXQA 1SNOA 4C3JG 1K8OA 3CIRB 4G4KA 2D2CC 2M9VA 2KECA 1DJRD 3TBIB 1HEZE 2M56B 1VMPA 2O5IC 5LHY1 5BN5A 4NMZA 3KLSA 2JEBI 3MFGA 4ZHPA 1B2TA 2FBWB 1AN8A 3FDTA 4YSXB 3QG1A 3N52A 2V0GA 4CJ1B 1B50A 4RGTA 2JSVX 2KJXA 5D14A 2GRIA 1GPXA 4N58A 4EQPA 1HHVA 2WXPA 3AECB 4PQXA 4IUUA 2ZXOA 5G5HA 1TWAB 4K2LA 1EY9A 1OXTA 1FRRA 3LNNA 2IDYA 3B2GA 1NAPA 4GDKB 1LTSD 3P20A 1LT5D 1W6KA 2O2LD 2M19A 2KN4A 1X3PA 1B44D 3TEWA 2D9UA 3S2DB 1TWCB 5HHDG 3GTKB 1SYEA 3BVMA 5JOBA 2JSOA 2PZWA 4DQOC 2Q5WD 2IWHA 3BIID 4P2CB 5MPOA 5KNCA 1YJJA 2ICEC 3K5NA 1FCLA 5BYQA 1GUWA 1TVXA 1STGA 1MBYA 2KWDA 1B9MA 3QO2A 1CZWA 4YSZB 2IW3A 2OEDA 5EKIA 5DEHA 4NAWB 2Y5PA 3AB9A 4KHZA 5KNBA 3E5SA 2J52A 4KV6A 2NN6I 1IW7D 3KF8A 3GTJB 2NVTB 4TQ1A 1H9JA 3Q6SA 4M8AA 2B2WC 2K0PA 2AWOA 5EGTA 2N88A 1Q10A 1XXGA 3QOJA 1I6HB 3TP8A 3PO3B 1HTLD 1KDAA 1N62A 3L4PA 4KGTA 5EE9A 1FGBD 2IX0A 3A7AB 1ENCA 1WSPA 3U52E 3P1MA 2VUMB 2TMPA 3TDQA 1G2TA 1H9RA 2W3SA 1ONLA 1I4HA 3WCQA 5C2TB 1R7SA 3VYUA 1XF5L 2BBCA 4G7ZC 4XTCS 2JYEA 1EFID 1PLFA 4Q0FA 1MSHA 1AYFA 4S3SA 3NVVA 4MIUA 1IW7C 1WD0A 1GOZA 1WTOA 5IGDA 4NAMA 2YEPF 1O78A 4JBWA 3AH7A 2MEKA 1NYQA 2KHSA 2N55A 3CU7A 2KEEA 1QILA 1JOKA 1JROA 2JYOA 2MUYA 4B9XA 4RF1A 3TN2A 4A3GB 4FF3A 2WXHA 4EVOA 1NI3A 2AQ3B 2GA4B 1ZXIA 3S2HB 4K14A 3J7AF 2PYKA 3WOEA 3VR2A 2JZPA 1E6EB 1JRPA 5FR3A 1CHPD 2JYTA 3L7ZC 4DXGA 3J81E 4A3JB 1FFUA 4KK7A 1CTMA 5LNK1 4XQNA 3SR6A 3VR4A 4IFDJ 1QOAA 3D4WA 2PW9A 4US8A 1JWSD 1SAPA 2VNUD 1SNCA 1D5ZC 2NYZD 3K57A 2WXOA 2EYLA 3FVQA 4ZRPA 1DOMA 2KOLA 3PUZA 4IUQA 1IHZA 2AWNA 2JA8B 2F0PA 1C4CA 1MVKA 4WIPA 3NHHA 1V1PB 2LMCB 4CJ2C 3LB8C 4NW2A 1I3QB 1C4AA 1FCCC 4PV1C 3S17B 4MH8A 2G9HD 1XX8A 1SJHD 3KLRA 4CKEA 3AMZA 4BA2I 1EY4A 2K5DA 3SK4A 4DF7A 3GTOB 4A3MB 2JX5A 1JW9D 4C7YA 4KJNA 4BS9A 5M5XB 3MTSA 4ZKCB 5JXVA 3EUB2 4B0MA 1KF6B 1HCZA 1K52A 2VXWA 4A90A 1I4PA 1ML0D 1F2YA 1MD2D 1I4QA 4YIJA 2NB0A 4ZHOA 1AEXA 4FXGC 1UWXA 3NWTA 3EJIA 4EE2A 3AB5A 4Y7NB 4DXFA 4KD3A 2K33A 1Q90A 3T56B 4JK1C 2WXFA 2C5CA 2NBFA 2V4IB 4J3OD 1GJXA 4RFBA 5C3WA 3E56A 4OHJA 2RDHA 1GHKA 3A54A 3W1SA 1QE6A 2B63B 1QNKA 5JAVA 1PFDA 5TSSA 1N60A 3Q8CA 1VF7A 3VR5A 4C7ZA 2E2JB 3VR9B 1RCVD 5C4ZA 1VCIA 1G8ZD 1IKMA 2F0JA 1C48A 4XT1B 3AEAB 3K5LA 5GXGB 1PTOH 1VRAB 2A6ED 1MHHE 4LJZC 2SNMA 1JQ4A 1VLBA 2PW5A 3W2DA 1GUNA 2IL8A 2PMVA 1NSNS 5EQ0A 3NQTA 3VYRA 4RNAA 3HZXA 2F0FA 4N6EB 1SE2A 3VR8B 4A3FB 1RDPD 1T5EA 2B2YC 3MXGA 3P75A 3R3OA 1SYGA 5ELCA 1KTKA 3P42A 4L8JA 4IURA 4ZAIA 5ELBA 4KY6A 1JB3A 5CMDA 1GXDC 3D4DA 1C4QA 2QDBA 1IL8A 3FRPB 1QOHA 3BWUD 3FKIB 4G57A 5CV5A 2A69D 4H7BA 2A6EC 1S5CD 1AFPA 2EJFC 2O5JC 5KYLA 1V97A 4KI0A 4BY1B 4R3DA 4IUVA 3P4RB 2A6HD 1JICA 2Q8IB 1SIJA 1F9RA 3NRZA 4WORA 1STYA 3UI2A 5EBDA 3P63A 1WCMB 4YWGG 5KEEA 1D2BA 1ESRA 4REZA 2F0MA 3GTLB 2K3UA 2C9OA 2QKIC 2BT6A 3ABVB 4AQ7A 1TKWB 4HROA 2PMZB 1IBXB 3J7AV 1GAQB 1LTGD 1YQ3B 3NPPA 2F0SA 1N61A 3I4NB 2HDEA 2L1BA 2B39A 1VDZA 1QKZA 2A69C 3HOZB 2LFIA 1MI2A 2RDFA 1RJTA 5CBEE 1EM7A 3PV0A 1SE3A 3PIO3 2A6HC 3TSSA 1RTOA 2A68D 1TYGB 3MAQA 1HTPA 1UNSA 1SE4A 3K0YA 3MXUA 4ZRQA 2K5PA 4TRDA 4CKCA 5CORA 2F1MA 2K32A 2B2VC 4QCLA 1KH0A 2BB5A 1EU4A 4TQ0A 1F77A 1U4RA 4KGSA 1PZID 2F0TA 1WTQA 3K58A 1J7AA 1ILQA 3DMUA 2WXLA 3HOYB 2DLBA 4B0EA 2E2DC 5JPNC 4US9A 2QMTA 3EQLC 1S5FD 4HKZE 1YNJD 4KKTA 4O1NA 5EPJA 4CQNA 1ACCA 3FPPA 2BOSA 1PFMA 2EYHA 2EYMA 3OWFA 4V0BA 3GD7A 1WYGA 1ZOYB 1KRHA 2WXGA 2A68C 1FMAD 2K1BA 5T1IA 2ICIA 4L63B 4F7XA 1BQQT 1E2ZA 2MPMA 4A6QA 3ZYYX 4WAFA 2R61A 4QMGA 1CHQD 2HDMA 3T4AC 3AE2B 1O7LA 2BCOA 1LV9A 2WXMA 4FYDA 4ULLA 1A70A 3GB1A 1F9PA 4A9AA 4DN4M 2K03A 1YNJC 5KNDA 1LO5D 1FIQA 2XWJB 1NUCA 1BR9A 1EWYC 5C0XI 1D5MC 1PZJD 2EELA 2RVLA 3BS1A 4FVMA 1T6BX 2FMCA 2R6GA 2Y5CA 4WURA 4ZYSA 4CGYB 2RSNA 5BN4A 3S1NB 1XCTL 1H9SA 5IGFA 4N9TA 2QILA 3I91A 3AEEB 3QOLA 5EPLA 2B76B 1V1PA 4HMJA 2LMCA 5J22A 2B8FA 3TP7A 1S5DD 5JEAJ 4XWTA 2ONQA 4ZQ3A 1KABA 3FMCA 3I8ZA 1X32A 5ELFA 2XWBB 3U9SA 5IODA 4TQUS 2LHDA 2WLBA 2SNSA 2W54A 3EA6A 3SR1A 1D4BA 2INPE 5EE1A 1HA5A 3PUYA 4J8QA 4C2MB 3CQZB 1XLPA 2PZTA 4LLGM 4XDXA 3E6ZX 1WGKA 3SFDB 1D1IA 2IX3A 3DXJC 4OIKA 1JOQA 2EZVA 2DY8A 2J42A 1R4QB 4KN7C 5COYA 2J53A 2AUJD 4ZKBB 5E6JA 3IL8A 3HG9A 1B4OA 1ZP0B 2HQEA 2I38A 5F2DA 3AE9B 4IUNA 1F2MA 4IUTA 1SXTA 2NVXB 1VDVA 2MJ8A 4KGRA 2PLPA 2F0UA 1BCPD 3I4LA 3LWEA 4OO1G 4MACA 3AEDB 5FLXE 4K5WA 2FMMA 4OZBA 4MHEA 3Q22A 1JQYD 5HURA 1DZ1A 3S9WA 4ZUJA 1SYFA 3IT6B 4HCEA 1SNPA 4FP5D 1PTOD 3NVWA 5LL6X 3ITPA 1NVID 4JE3B 4KKJA 3GTMB 1AZPA 1YNND 3Q8AA 4ID6A 1CT1D 1BUVT 1WTRA 1EU3A 1ZEQX 2R3ZA 4YXDB 1STAA 3RLFA 4C3IB 2JWUA 2ZW0A 1G91A 1EQVA 4NDXA 4RHSA 2H88B 3RZOB 1I6VC 4MN3A 1QCBD 2H1EA 3SXHA 1L6VA 2LEKA 1NEKB 3AE3B 1BXTA 3HRDD 1YQ4B 2BA1A 1TR5A 1E2WA 4LTUA 1BCPC 3DWAA 4DGZA 1QJOA 3Q8EA 1OXVA 3A56A 3T16A 4L6TB 3D8GA 2MHVA 3R8BA 3R2TA 2F0OA 1G6ZA 3M4OB 1QQRA 4OVZA 3R2IA 1PTOC 2JQRB 4KX6B 3W3AA 2WXRA 3NTIA 4IN3A 1YNNC 3K5OA 1PRTD 3CKIB 2BS3B 1Q3LA 1EIHA 3Q0AA 2PNRC 1Z47A 3ONAB 4P16A 1STEA 3L9AX 5EKKA 2N9KA 2KCNA 3PUXA 2KUMA 1EY7A 4GLSC 2F0IA 3MZ5A 1LTBD 2X6GA 1VZ8A 1RTNA 4XXEA 4IFDG 2G9DA 5D7GA 2ID0A 1I50B 3DEPA 4OO1H 4KKUA 2Z4HA 4NJCA 4B08A 4GDLB 1SSNA 1Y56A 1GB1A 2B2UC 4LMQD 5EPKA 1IBXA 4JPSA 1U4PA 1ZDVA 1PGBA 4RAUC 3C3LA 2IX1A 2PIAA 5FLXL 2F0HA 1M8AA 1PRTC 3SE0A 2H4OA 2J7ZA 3S16B 1DGJA 4ITKA 4C3HB 1PGAA 3T13A 1Y8OB 1XO3A 3VA5A 4UDUC 3ZGZA 3GV3A 3QWNA 3V2TA 3C8YA 4K6DA 3BDCA 3BK1A 1C4PA 1QF6A 3AU7A 2W82A 4ARIA 2L9HA 2ZXRA 3VA7A 3MJ5A 3DEOA 1DCZA 3AEFB 1SDFA 1EQTA 3BG3A 2DYMA 5CV4A 3BYTB 3MXNA 1Y1WB 2XSCA 5DM73 4DNRB 1S5BD 5I9OA 1HFNA 2Q8RE 3LXFA 1C9FA 3H3VC 1EWCA 2IT1A 2B2TC 3AE1B 4HSVA 1RM6C 3NUHB 4KJOA 2CQAA 5HI1A 2KQ3A 1E10A 2KDMA 3BVGA 1U9RA 4OZAA 1AW7A 2M00A 1BUIC 1Q1EA 2K6AA 1VR9A 2WB1B 1TU2B 2F0GA 3G6JB 2CHBD 4IFDH 4B9WA 1H9SB 1C8CA 4XDCA 4A8XC 1AP0A 1FNWA 1GUGA 1HQRD 4E6IA 2IGHA 3P4QB 5CV6A 1KDCA 1EY0A 1L4DB 2HDLA 2CJNA 4RWSC 4F88A 1D5XC 3H8HA 1B9RA 1Z6HA 1G2SA 3KWLA 5C3EB 2Z1CA 2EPBA 4AYBB 1Y69U 1DOXA 1QOBA 3BK2A 2G1EA 2F3WA 2OHFA 1FR3A 5C4XB 2DN8A 3JAML 5CGKA 4X3SA 3MC0B 1HZ5A 1O80A 4L1BA 5KGUA 4DA2A 3C1EA 1P7EA 1LT4D 3I9V1 2ZT9C 3IKJA 3HVZA 3AE8B 1OQRA 4KMUC 1N5XA 2BW2A 4RH6A 2K05A 4PT5A 5IGBA 3ZJTA 2NVYB 3S14B 1I4RA 3NWSA 1TWHB 5KYIA 5I4DA 2WDRB 1EWHA 5D3DA 3MP9A 2E76C 2QIEB 4JX1C 3MFYA 2RMMA 1KLUD 2J0TD 4HEA1 2B8GA 4N59A 3H91A 2PQEA 3Q23A 1RFKA 2B2WA 2LS01 3RUZA 1ZYRD 1SJED 1UWMA 1U4MA 1KFYB 4OO1I 4RGMA 1VZ7A 1C78A 3I3CA 2L11A 2TSSA 4XQJA 3LYYA 1S5ED 2BDNA 1KNAA 1X3QA 4OZCA 2VB3X 5KRUA 1JOOA 4EQOA 2BS4B 1TWFB 3NE5B 3ZJVA 5IIFA 3V96A 1DM0B 3LWUA 3W5VB 1JR0D 4C3JB 1BCPF 2K28A 1GHJA 4KY5A 2RDGA 4WJWA 5C3XA 3R93A 3NTKA 1L0VB 3NP8A 2QJLA 1N5WA 3CRKC 2DBYA 1TIID 4FXDA 5C0XJ 1RHPA 1PTOF 5JPMC 2QF7A 1RYJA 1L4ZB 1ZYRC 4XYOA 1EL0A 2YEPB 1E7PB 2EYFA 5K36G 1WXQA 4QF4A 3OSOA 1SNQA 1HPCA 4JWUC 1KNEA 2L1AA 2K5WA 3IXSA 2MJDA 1QB5D 3NTHA 1H9KA 1UUPA 2KEDA 5M9OA 2XNAC 2SAKA 1FRDA 2W55A 3I72A 4K2KA 5LL6S 1LACA 2E3TA 5CC4A 1JCKB 2PW7A 1CQVA 1T3QA 2D5DA 4XYQA 2LJIA 2LUMA 3KBGA 5J39A 1BNZA 2L4NA 3E9SA 1ZE3D 1ILPA 2F0VA 2L52A 1A3VA 2WP8J 4FXKC 3IFTA 2CW0D 2RPVA 4ARCA 3AE5B 1MI0A 3NBHA 1PRTF 2PPBC 5EBCA 3RZDB 5BN3A 2JP1A 3Q69A 3PZ7A 5IGGA 1SFOB 2L5TA 3GO5A 1LTTD 2WKCA 3A55A 4QB4A 3FEWX 3CWIA 4KY7A 3S1QB 4GZYC 3M85A 4DAVA 4NP5A 2PZUA 4ZOHC 1PXUA 2L0CA 1DOIA 1ENFA 3S15B 4I65A 4HMIA 5G5GA 5K5PA 2K7VA 4ODGA 2INNE 1A3TA 1DOKA 3M7GA 1UAPA 5G3LD 2LKVA 2CW0C 3OMGA 1JALA 1NENB 2X38A 1MSGA 1EY5A 1V43A 4ME5A 3WOFA 5K36H 3MHZA 5E4WC 1Y8NB 4PMWA 1XLNA 1B53A 1CK1A 5C5MA 1W6JA 2RSOA 2LHEA 4XWWA 5DM63 1EIGA 1RODA 4X3KA 4AS1A 4ZUIA 3I4MB 1II3A 4KHVA 3KQ4A 3I70A 3Q8FA 1JC7A 1H9MA 3J7YW 1EYDA 1ENAA 1EYAA 2EE1A 4EQNA 1SNDA 4M1UB 1RF2D 3SK5A 5HFYA 2XRQD 3WDNA 5FK9C 4QUCA 5T1GA 1E0ZA 3G7LA 4CKBA 1OFFA 1XYIA 2FHTA 3KK7A 2B2YA 5E1FA 1J8IA 1Y1VB 2GB1A 3URYA 2R7ZB 3VQIA 4KN4C 4C56C 5I6WA 1OXSC 2VB2X 2SEBD 3KWVA 4C80A 4QUFA 4HSPA 3IAS1 2ZW1A 4A3DB 4H2AA 1BDOA 1F2RC 1ZUD2 3FAHA 2NN6H 3N6RA 4R9WA 1NCVA 2I07B 1FFVA 1NYRA 3W9CB 4ZK9B 1PTOB 2RBMA 3NZ3A 5T8IA 3MHBA 2OT2A 4YTNB 5HGTA 1N63A 1VZ6A 3GTQB 3T3NA 2NTTA 3NSWA 1A15A 3H6MA 1SEBD 3D6WA 1I7HA 2VZKD 1KLGD 1CFMA 3NS1A 3IAM1 3AE4B 1HUNA 4OW0A 5JEAH 1ZXTA 2EYJA 1HA6A 3DWGC 2DNCA 3J80E 4HEDA 5IOCA 3NUCA 3OW7A 1SYCA 1YJIA 2JE6I 3AV8A 3DUZA 1WD1A 3H0GB 1PUTA 3GV6A 3F2UA 5DAUA 1WTPA 1B1ZA 4ZLTF 3SK6A 2KQ4X 3BYYB 2N9LA 4JWSC 2KMMA 3PZ8A 1IYUA 3HKZB 2XVSA 1MGSA 2V4DA 1JMLA 4C1NK 1EY6A 3PO2B 1EYCA 4FF1A 1PRTB 4O42A 4XIGS 1XCQL 2WNMA 3NVYA 1ZPSA 1NR2A 2E2IB 4FF2A 1ET9A 2JXMB 2NMQA 3K59A 3OHXC 5NUCA 1OXXK 1L0YB 3HOVB 3MVVA 2DYOA 4EGVA 1U4LA 4XQQA 2WV6D 1KDBA 3C1FA 3RD4A 3HS0C 2WP9B 1TY0A 2EYPA 3ND9A 4ILWA 2B2VA 3VR6A 4K5XA 5BYRA 1IYVA 1EY8A 2ENBA 4IUPA 5EKLA 1AZQA 5CYUA 1FO4A 5IGEA 3ND8A 3HVDA 4RA8A 5CBAE 2KAJA 1PDQA 1IUEA 2WXKA 2DY7A 3K5MA 1IGDA 1L5PA 1WWTA 1V8CA 2RKSA 4IDIA 3OIQA 3NXWA 3RMHA 4DNTB 1PMRA 3SHLA 2IGGA 1HXYD 3A7LA 3NK9A 4D2KA 2K01A 4TMAB 3B2FA 4U68A 3CRLC 3L3OC 2MJ3A 5C3JB 1PDXA 2FUG1 1OXUA 1BOSA 3I90A 1SNMA 2ACZB 5CV7A 4LAAA 1EEFD 1SYDA 1SF0A 1O7ZA 1EZ8A 1K8MA 2EXZA 2QCPX 5CV8A 3J80L 2K9XA 2ON8A 2JU6X 1J9OA 3DM1A 4HR7B 2WQYB 1SBBB 2JA7B 4X3TA 3J9CA 5E4XA 4A3EB 2BYTA 2M0AA 4WQMA 2M2LA 1FM0D 1C76A 2LY7A 4PNYA 3AEGB 1WVLA 1JWUD 4F8MA 3O13A 2YYZA 3KBXA 3PO0A 4C1NI 2ZXPA 3ZQ4A 1DD2A 2E74C 3ZJUA 4RKBA 1ZXHA 2WS3B 2L83A 4YSYB 1XWEA 1C79A 1CI3M 3JAME 4K5VA 1D1KA 4N9PA 5BMGA 4DK1A 3DWMA 4XDDA 1SSOA 1LT6D 2RQXA 1LTAD 1J7CA 2MH7A 4HKQA 3MXPA 1FD7D 4IQZA 5IT9E 3VRAB 1PGXA 4HCSA 3X3MA 4IKGA 1OQQA 3KLSX 3A8IE 3AE7B 4M0WA 1CJEA 1JORA 2BDOA 1Z7TA 4DU9A 1XEEA 1QOFA 1F0ZA 1TKEA 1WTWA 4L2YA 3A8JE 3MA2B 4IOIE 4A3BB 1F9SA 5G3LF 3TP6A 1DXMA 2EY5A 3BDLA 2WXNA 5FO7B 1UEAB 4G7OC 4Q5VA 1WTXA 1QT9A 1E2VA 2GI9A 1Q8IA 1MHXA 2MJEA 2Y3AA 4PMCA 1FXIA 3OWEB 3RPFC 1LT3D 1B3AA 3C46A 2AQ2B 3T51B 4J1MA 1V8QA 2WINB 3MWYW 2AX5A 1CM9A 3W5UB 4FXCA 1FYCA 2PCFB 4KKSA 2F0WA 1CA5A 3C2PA 2HCCA 2L12A 5C4HA 4USAA 1K51A 3PIP3 2R92B 3OOCA 3U7ZA 1LABA 4H44C 3V3XA 1TT2A 3M4YA 1PZKD 2FJ2A 4PMBA 4BBRB 3I73A 1AWDA 3SEBA 5CR3A 1T5XD 2OXPA 5EJWA 3A8KE 1TJEA 1YN3A 3TP5A 3E0JA 4CBVA 4DAYA 2F03A 4IZ8A 2WXIA 5IGCA 2EYOA 4MM3B 3S1RB 1TS4A 2JEAI 3AEBB 2EJMA 1F9QA 1FNVA 3HOWB 5ELEA 3H94A 4A93B 1SB3C 3S1MB 4NKLA 1PFBA 5D3IB 1JWMD 4OGQC 5C0XG 1CZGA 3KUPA 3BZDB 3M3YB 5D65A 2PVOD 3TUOA 1I4XA 4Q2JA 2WACA 4HTHA 5IT9L 1TZOA 2LFNA 3K7AB 2E75C 3ERQA 2F0KA 1JWBD 1VJKA 2JA5B 1WTVA 1STNA 3FILA 1YN5A 2BB6A 4V190 2KCCA 3VYSA 2FFKB 3SFEB 3HOUB 1BMLC 2I46A 1J7BA 4K8JA 5AFWA 2NTSA 3U4EG 2J4XA 4WFN3 1FD6A 2F0DA 3AE6B 2YU9B 5E3FA 1PFNA 4IALA 2QSDA 4TKOB 2SDFA 1LTID 5KIXA 2K5QA 2Z8LA 3CHBD 1QLBB 2N7JA 3ETRA 3GS2A 3B9JA 4QIWB 1XLOA 3AN1A 5C6AA 2I2YA 1EEID 2E2HB 2EKIA 4BWGB 1TY2A 1ROEA 2B2UA 5HG2A 3V05A 3D4RA 3PMFA 4X3UA 1LLRD 5M5WB 5H92C 1TQOA 5M5YB 4C3IG 3EROA 4WWMA 1TWGB 4J6HA 4RCNA 3HP3A 1NR4A 2OEOA 3U2SC 4YTMB 1TS2A 4HJGE 1JE4A 3J81L 1SMYD 4UAIA 2F3VA 2WIIB 2O4XA 4RGNA 4ZRZA 4A3KB 3TEYA 5FO9B 2JXTA 1RD9D 2KVMA 5I6YA 1YN4A 4RGOS 2WDQB 1QOGA 1TS5A 1F2RI 4R8NA 2EDGA 1ET6A 4OL7A 2KA7A 1XLQA 2BA0A 5BMIA 4FNFA 2EY2A 1O7YA 3PUVA 2HUGA 1TS3A 3SK8A 1P7FA 4BA1I 4CHTB 5C0XH 3OPOA 4OIJA 1ZDXA 2KACA 4WRDA 1UGJA 5H8YE 5EE3A 5A2QE 3HRZC 3Q24A 3IFDA 1VF5C 3LX0A 2XN9C 3TMEA 2EY1A 3NBIA 2B2TA 2X69A 2PTLA 2DNEA 2F0LA 1DOYA 5CV9A 4BBSB 5C5LA 1SMYC 2NWGA 1ICWA 2V3NA 3HUIA 1GUOA 3P4PB 1QG7A 3NVZA 1SYBA 4H13C 5JVH3 1GB4A 1E0BA 3P7JA 2AUKA 3TZUA 2IPKD 1KAAA 2N0SB 5DNFA 1C77A 3SVMA 3IT4B 3P4SB 4IFDI 4H0LC 3BDOA 4TSSA 2FE8A 1Q12A 3GTGB 2PKOA 2WU2B 2WU5B 1RWSA 3P1HA 1OO9B 2IJ0A 1L6UA 3HOXB 3IAYA 4DK0A 2XRSD 3TZDA 3DHQA 3OIPA 4F87A 1STBA 1JWAD 4KD4A 2R