1JWUD

Crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b2
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
239
structure length
232
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Structural, energetic, and functional analysis of a protein-protein interface at distinct stages of affinity maturation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 68
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jwuD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwuD02
3R2TA 1PRTB 5D3DA 1CHPD 2J4XA 1LTRD 3BVMA 1LTSD 2ICIA 3O13A 1I4PA 3BVGA 1JWSD 5I4DA 1HTLD 1TY0A 1S5ED 2R61A 1V1OA 2TSSA 2CHBD 2IPKD 4OHJA 5ELDA 1F77A 1PTOD 1KTKA 3OWEB 1AN8A 1I4QA 1BCPB 1S5BD 1FNWA 1PZKD 1DJRD 3SEBA 1EEFD 1SJHD 3BZDB 1JQYD 1PTOF 2AQ3B 1HXYD 1EWCA 1D5ZC 1LTGD 1SE3A 3KLSX 2RDGA 1RDPD 3EFXD 4Z9CB 1BXTA 4UDUC 1LTTD 1PTOH 5TSSA 1YN3A 1LT4D 1LTAD 1RD9D 4TSSA 2WV6D 5ELBA 1ET9A 1I4GA 3URYA 1MD2D 1EEID 2QEJC 1STEA 1LT3D 2O2LD 2XN9C 2NTTA 1JWUD 1PTOC 1SEBD 1TS4A 4RHSA 1LTID 1EU3A 5FK9C 3GP7A 1EFID 1JCKB 3BYTB 3R8BA 1FNVA 1S5CD 3MC0B 1TS5A 1D5XC 1UUPA 4O1NA 1JR0D 1YN5A 1S5FD 1SE2A 1L0XB 2XNAC 2QILA 1AW7A 1B44D 1PRTD 1PRTC 2RDHA 4RFBA 2XRSD 1FD7D 5FKAC 1YN4A 4RGOS 1SBBB 5D3IB 3DWAA 2Z8LA 1XXGA 2AQ2B 2G9HD 4L63B 1PZID 1D5MC 1HQRD 1V1PB 1SE4A 3DWPA 1HA5A 1I4HA 4RGTA 1PRTF 1TS3A 5ELFA 1BCPD 1BCPC 1PYWD 1KLUD 4BWGB 1QILA 2IJ0A 4C56C 1L0YB 1PZJD 1KLGD 4DXGA 1XTCD 3TSSA 3CHBD 1DYQA 1TY2A 1LT5D 1V1PA 4RGMA 1I4XA 2NTSA 1TS2A 1BCPF 4RHRA 4DXFA 1M4VA 2XRQD 1T5XD 1LTBD 1CK1A 1CT1D 2AQ1B 1RCVD 4RCOA 4ZYSA 1UNSA 3W2DA 1FGBD 1ESFA 1ET6A 1LO5D 3DWQA 3BVZA 4K6LA 4RGNA 1S5DD 1PTOB 1SXTA 3BYYB 1CHQD 1FNUA 3MFGA 3EA6A 1RF2D 5ELEA 3R2IA 1GOZA 1LLRD 2SEBD 1D6EC 1LT6D 1G8ZD 1SJED 1ENFA 4NZLB 4L6TB 1B1ZA 1I4RA 1EU4A 1JWMD 5ELCA 3V05A 1CQVA 4RH6A
chains in the Genus database with same CATH superfamily
2XEWA 3GTGB 1FXAA 1KM7A 1EL0A 2Y0SB 4IUUA 2L0TA 4F88A 2NVXB 1U5KA 4XDXA 2LVQA 1I4PA 2GLSA 2XK5A 2B29A 3Q3FA 1GHKA 4W9FA 4AJYB 2ID0A 4IPHA 1VQ5A 1WX7A 2IYDB 5BO4B 3W9CB 3RUZA 3M7NA 2D2CC 4IDIA 1PH8A 4GSWA 4IZ8A 4ME3A 4YHHQ 3PO2G 4JW0A 2ON8A 3A4RA 1QZGA 4B3TL 3J7ZC 4I6PA 3DHIC 3IAS1 2RPVA 3HM6X 3B9JA 1X3FA 3MJ5A 3FP9A 3G7LA 2FNJB 2MJDA 4DQOC 4GKJQ 1D5ZC 1WJNA 4NMZA 2R93B 1X9NA 1R4MI 3GTPB 4DA2A 4A3LH 3Q8BA 3TQYA 4XYCA 2MP1A 4LFCL 2JA6B 1LTAD 1RD9D 2VUMG 1ET9A 4J6HA 2PNRC 3SR1A 2A68D 2BYEA 4ZUIA 2CJNA 3DWGC 1KDCA 4NJCA 1EOTA 1MJEA 1ZEQX 2K28A 2LS01 4M8AA 2ZM6Q 5JJZA 3PV0A 2VB2X 4P2CB 4MIUA 1BKBA 5JAVA 5M3MH 4U673 3Q23A 4HEA1 3PO2H 4IJHA 4X62L 2J0TD 4AQ7A 1WYWB 2CWAA 1QKZA 3PUZA 3RT3B 1XLOA 3A55A 2JWZA 2WB1G 4L8JA 4OIJA 4DR2Q 3EHVA 3FILB 4W9JA 2MHVA 3DCGA 4GN1A 3Q6BA 2ALYB 2CKZB 4DR5L 3MHZA 4YXDB 2N1WA 4HJAA 5IGBA 1B44D 1JB7A 3K6OA 2BW2A 3VR5A 2JZZA 2F0OA 2E2JH 4JI5Q 1FD7D 2Z4IA 1K8GA 3QB3A 3H7SA 1V8CA 4BOSC 3PVLA 5BYSA 4JYAL 2Y3AA 3CMAA 2JA5G 1UE7A 3D31A 2DY8A 2F0LA 2F0IA 2VQFL 1VQ8A 2WYQA 3ZQ4A 1U4LA 1VQKA 2A4ZA 3NK9A 2K39A 2WXHA 4N59A 4FLHA 1C9FA 3HOZH 2EYHA 3ZDTA 4JI0L 4KKTA 1QVFA 3ZGZA 1I4HA 4WJWA 2K5QA 4MGIE 3ONAB 1Z2MA 3BG3A 3LWEA 2D5GA 2NWGA 1SLJA 5IWAQ 4NJ6A 3I7FA 4MZ9A 3C3LA 3RZDB 4LF9Q 4DUYL 1Q90A 2C9WB 4FBJB 4CO7A 4F1SA 1QVGA 4W9HA 5HY6A 1J7BA 1NYRA 5DCNA 4C3HG 3ZW3A 3UQBA 4S3SA 4LCDE 2WXOA 2NS5A 3PO2B 1R7SA 2EDGA 4JBJA 3DBLI 4HJ5A 2EQSA 5LMNW 3EROA 1MJCA 1ML0D 1LTBD 1PGBA 4RMFA 2KOXA 5IN7A 1G51A 1K3BC 1AE2A 1KNEA 2AQ1B 4F8CB 2L4NA 1MIUA 2NVQB 1SSNA 5FLMH 2PZTA 1X32A 2L55A 5DEHA 2JA5H 3BVZA 3M62B 1RYJA 4MJSB 3IL8A 3FILA 3KF6B 5DM73 2RSNA 4WIPA 1CHQD 1KDBA 1PFDA 3EA6A 1XMQQ 2VUMB 5ELEA 4DWFA 4ICUA 1YI2A 5IODA 2KANA 4IM3A 4EOYA 4GDKA 2IY5B 2QSDA 4XWTA 4QQBX 3P4PB 1BT0A 1CUKA 2IGDA 1EU4A 2J0JA 5EJWA 3JAMi 2FINB 2KAJA 3G6JB 1IBXB 3Q8AA 1J8IA 3R2TA 1NDDA 4K3CA 4P1CC 3VR9B 4IURA 2A69C 4OGQC 2JX5A 2ICIA 4G7OC 4ZRPA 1E7PB 4RF0A 4TV3A 3W1SC 4DHJD 2NMQA 1SNQA 3GV3A 2CW0C 1BDOA 2PZUA 2WB1B 5ELNA 1GHJA 3VYSA 4PZ6A 5IT9c 1Z9FA 3J81i 1VQ4A 1UZXB 1XWEA 3SDZA 1K51A 5BMGA 3ONSA 1K50A 4E74A 4KN7C 4MACA 1AN8A 4GNXB 3WANA 4ASWC 5EKLA 5L83A 1WTQA 1SYDA 2JA5B 1EEFD 3H94A 4BKSD 2ONQA 2ZT9C 1JQYD 4TRDA 1EWCA 1B2TA 4JI1Q 3VA7A 1EZ6A 4DFAA 5DPRA 4MJSA 1GB1A 3FEWX 1VQEA 3S1RH 3I4MH 5G5HA 2L00B 1OQQA 3DXJC 5ELBA 1OTCA 2DYMA 4IPCA 1K73C 4N9F4 1WJUA 3V60A 2PZWA 3KDFB 4LFCQ 3CCUA 1WMHA 4C3HB 4L5QA 2GBJA 3IT4B 2XN9C 1IGDA 2K1BA 4MSMB 3R3OA 3LDZE 5IO9A 2EYFA 1HHVA 2G9DA 1RHPA 1D4BA 3AEFB 1JCKB 4XXEA 1R9TB 3FC4A 4W9CA 3UIOB 5BN4A 2CR5A 1SR3A 3UQAA 4YWLA 1H8CA 3VYRA 2C9OA 4XGAB 3TEHB 1RTOA 2IZVB 4X62Q 3KJOA 2LJIA 1G91A 2ZVNA 3NHEB 3P42A 3FRPB 5CYUA 1C7YA 1PH2A 2EJFC 4B95A 2L9HA 3HOUH 2E8GA 2K5WA 3ML8A 4KKJA 3UINB 1K0RA 5CV4A 5IGCA 4DR5Q 1PQSA 3KUPA 1L6UA 2KFKA 3I70A 4BY1G 4JBKA 4DHJB 5C0XJ 1XPUA 1H95A 3AFPA 3Q69A 1SNCA 2G9HD 3D3RA 3AECB 2G5DA 4MGYE 1L2NA 1F1HA 1VQLA 4JYAQ 3OHXC 1RIPA 2KWVB 2VQFQ 2NPTB 5GADC 4QIWB 1R4MB 4GKKL 4JI0Q 1N32L 1TWGB 3DBHI 4B0EA 2A6HC 3U8ZA 3B2FA 3E3XA 5IY0A 4DUYQ 2CJOA 1DYQA 3LJ3A 1STGA 1J8CA 1WOCA 4X3SA 5CV7A 3VR4A 2UXDL 1QOFA 4XQQA 2ZNVB 3ZNHB 4HVBA 4MTKA 4WJNA 5IGFA 2BE5C 3U58A 3V61A 3MHSD 4YWMA 3ITPA 1ZYRC 2L11A 4R4OA 3HOXG 3QR8A 4EZLA 1PTOB 1XMOQ 2WGSA 2B2YA 2KEDA 2Y0SE 3AFQA 1L4ZB 1HFNA 2PPBC 3VUXA 3OJ3A 1W6KA 4POFA 4OZBA 4IC7B 1L1OC 1EO6A 2KX3A 4RM8A 4KIKB 4MGZE 5J18A 3PV1A 3APCA 4AOFA 2VZAA 4NKLA 2JA7H 3DHHC 1GPXA 1QB5D 2JK8A 4JOIC 5KHQA 1TVXA 5C4JH 2Z6KA 1OTRB 2G45B 2NPTA 3BK2A 3KWVA 4HR7B 4IUMB 1PUTA 4R1JA 2K8BA 1JWSD 3J9CA 3UE0A 2TSSA 4LF6L 2DZMA 2I5HA 4XTCS 1I7HA 3PGEA 1DXMA 3Q0AA 4BY7G 3HOXH 4P74A 3AU5A 2QC8A 4H13C 3DBLB 1P9DU 3ABVB 2NVUI 4BY1B 2NZ1D 1FMAD 4PZ7A 4ZCKA 1EQRA 1S40A 2SNMA 2FCNA 3GE3C 1SJHD 4A3DG 3VRAB 4XE0A 3U30A 2RCFA 3KW5B 1JW9D 1E22A 3HIZA 2C5LC 1HPCA 1A70A 2GBRA 2F0TA 2O4XA 4IJLA 1STYA 5J39A 1DD2A 3S9WA 2B63B 1TZOA 3ZNID 4KSLC 4JI7L 4LUZA 3NPPA 5IKCM 5EPKA 2WDTB 5KEEA 1E24A 4KIKA 3E0EA 4K1RB 2WXNA 1K52A 1IKLA 4N8FA 4OX9L 4ARIA 1Q8IA 3N6RA 3PREA 3IT6B 4LNOA 4LFAQ 3IFWB 4J6IA 1TS5A 3MEFA 2BDOA 2L32A 2HJ8A 5I9OA 2NN6G 4BBRG 2QDBA 5T1GA 4A3DH 5M3FG 5KRUA 2JPHA 3PSEB 3GTOH 3ERQA 3ZJYC 1A8VA 2I07B 2K3UA 2L0FA 5FO8B 1B7YB 2QHOA 2RSOA 5IGGA 2Q2TA 1WRIA 3HOVG 1Y1VH 2F0PA 2A6ED 2ACZB 2C35B 5EE9A 3UF8A 1T0YA 1JMLA 4RMAA 1BBWA 1JB3A 2MNAA 1GG3A 1D5MC 2DX5B 2K5HA 1XNQQ 2FJ2A 2D10A 1PH4A 2WIIB 4HMIA 1ROEA 2JZ3B 1D7QA 2N9PC 4MGKE 2WDVB 4DK3C 4L5RC 1BCPC 3VR3A 5AFWA 5HGTA 4V0BA 2YEPF 1LUZA 1FR3A 3W5UB 1I6HB 3TSSA 1CFMA 1IW7C 4TQUS 1N32Q 2ZPYA 5C5LA 1YQ3B 2BTEA 4HCEA 1JJ2A 3HOWG 1WRDB 2NN6H 4A3IH 1O7ZA 4BY7B 1AP0A 2D3CA 1ZXHA 2B3GA 3DPDA 1FCLA 4W9KA 2K1FA 2B3AA 3JVZX 2C5CA 3CCJA 1LTLA 2KVZA 4NAMA 4P6VF 4PMBA 3I5JC 3NG0A 4C7YA 4US8A 3GTKH 4FYDA 4M01A 2R7DA 3NHHA 3CMEA 5C3XA 4RCNA 4IWQA 2K5VA 4JX1C 2UXDQ 4A3DB 4HXDA 4BKTA 3JYUA 5FR3A 2A74C 1BBXC 2OQKA 1WTOA 1Q1OA 1WSPA 1XF5L 3Q2AC 4C1NI 3RNGC 2K6AA 1XEEA 3FKYA 3QK0A 5CGKA 1C76A 4DV2L 4POGA 3A7LA 1PGAA 3PRMB 4HIOA 3RN9C 1WI5A 2ZZPB 1VQJA 4R4QA 4DR4Q 1VQCA 3OWFA 4M00A 4JPSA 5LLIA 2KC1A 2WB1E 3A5ZB 4LUVA 3G71A 4QMGA 1ENFA 3K5MA 1V81A 4NZLB 3APFA 1RAXA 2ENBA 3VTUA 3SHLA 2IHEA 1PFMA 3HOWH 1QCBD 4RH6A 1ASZA 1UBQA 3H3VH 1VZ8A 2IWHA 3AB9A 2DJFC 4IN3A 2GI9A 3AE2B 3BVGA 2WKCA 2WU5B 3KWLA 1UF0A 2WXJA 4BBRB 2ICEC 1WGRA 3PO0A 4WWPA 5M3FB 3U9OA 2M1MA 3SK4A 3OWEB 3S15H 2JN4A 2VQEQ 4LF8L 1AYFA 3HOVB 2BYVE 1RLFA 4XDDA 5F2DA 4AP4C 4ZYNA 1Q86C 4JQWC 3T16A 5FLXL 2GB1A 4QCLA 3X3NA 1SYEA 1WTVA 3EVQA 3J80c 2KBNA 3CRKC 1ZKHA 4KGTA 3AEGB 2N9LA 1UAPA 1Y69U 1A3VA 1PDQA 3JAME 1S3OA 2WDRB 4IFDJ 1PMRA 5GXGB 4AJWA 3FHWA 3NEMA 2DY7A 1J5EQ 3QJZA 1NE3A 3RN5A 3EECA 4QY7A 4A3KG 2L7RA 2EYJA 1ILPA 1U4AA 2QEJC 3HOWB 1K0SA 4HDQA 4IUPA 1JOQA 5G3LD 4JI7Q 4RHSA 1Q1BA 3W5VB 2CU3A 5J22A 5FK9C 4FN2A 4WURA 2K01A 1L7YA 1R4QB 2KFJA 3DVNU 4M8MA 4IG7B 1WCMG 3IFTA 1YHQA 3MA2B 2DYOA 2LHDA 4CDEC 3TZDA 2DYBA 2KACA 1E2WA 4OX9Q 1V5OA 2JXTA 3S15B 3N3KB 4DDGD 3NQTA 3GTQB 3ML9A 1C8CA 2YVCA 5NUCA 3NUCA 4JI3Q 4MEMA 4KGRA 4KZCA 4QIWE 3A1QA 3HFZB 3MXNB 2CHZA 2KJHB 4WWOA 2CCZA 4NJ7A 3NSWA 2KWCA 4AQYQ 1YN4A 4KMUC 3X3MA 5IGDA 2PJHA 4II2B 4WWMA 1PH5A 4M1UB 4USAA 5D94A 2E3TA 5CMDA 1JQ4A 2IY0B 1MKHA 3KF8B 1TKYA 1VD2A 1FRDA 2LD9A 3FVQA 2ZW0A 4GMVA 3U52E 2WQYB 2LFNA 3AE7B 3AMZA 2J53A 3P63A 2E74C 3MWYW 1I3QB 4MDKE 3DVGY 5JZEB 4MM3B 2L3ZA 1B9NA 1EQVA 5JEAJ 2VNUD 1BVSA 1WCMH 3E5SA 1B70B 1LV9A 1IZ6A 2C7MB 4FXKC 2H89B 3PQIA 2OTJA 3ETRA 3OLMD 2FCMA 1CQFA 2D0OA 1G6PA 4DV7L 3R7RA 1YEZA 3AE5B 2A8VA 1M4VA 1AZPA 4J15A 2WXPA 3NOBA 3PZ8A 2LXJA 3AU4A 2ZTEA 3DUZA 5K5PA 5LHY1 1CT1D 1O7YA 4CJ0B 3P2BA 4OO1I 2AMCB 4A76A 1X1MA 1UNSA 2L1BA 1FGBD 4PMCA 2INPE 2MP2B 4RGNA 3NUHB 3LWUA 4ITKA 2MCNB 3Q3NC 3MXPA 3VQIA 1CKMA 1FNUA 3SFDB 3MXNA 4LUOA 3P75A 4WJ4A 2AWOA 1EQQA 3BJUA 4A3KB 4GIVA 1YJWA 1GOZA 4DV2Q 4A3CH 2DLBA 2JUOA 2KNBA 4DXAB 1D6EC 3K59A 4HIKA 3I73A 1FPYA 1DOIA 3KF8A 1UE1A 2FXQA 3BIID 3M63B 3U4ZA 2LMCB 1IXRA 3G48A 1HTOA 1E8ZA 4KSKC 1CHPD 3P1MA 4EGVA 2EE1A 2CHXA 4W9IA 2R6GA 3MP9A 3T51B 1E5WA 2J42A 4RA8A 2F52A 4YCVA 1VQFA 4GOPC 3I55A 3RZOH 5I4DA 1LGRA 2LVOA 4DN4M 2W82A 3DHGC 4MM3A 3SK5A 3NTKA 1P0RA 2INCC 4GOCA 4WAFA 4CDFC 3MFYA 1EIFA 1SROA 1EY6A 4DU9A 4K5XA 1Q0WB 5CR3A 4ZKBB 4A93B 2MQJA 2KN4A 4XQNA 1S5BD 1XLQA 2IO2B 1EWYC 2BS3B 4F7XA 1DJRD 2GRIA 3R3MA 4LDTD 3Q3MC 3SEBA 4LF8Q 4J8QA 2KUMA 3CF6E 2B8FA 4IFDI 1MHHE 1YMHE 1B8AA 2PLPA 2WHIA 2ZCCA 4G50A 4FF1A 5BN5A 5JJLA 2WXGA 1LTGD 3VRBB 2Q5WD 1C3TA 4A3GH 2RDGA 1KABA 4UDUC 1E8WA 1EF5A 4KHZA 1DGSA 3I91A 1YNJC 3S17B 3O65B 1VMPA 2UUCL 1B50A 4LNFA 4JI2L 4A3EG 3K9PB 3DVGX 4BS9A 2LRUA 4DK1A 4M0WB 4FA6A 4JCVE 2KX0A 2YV5A 5E4WC 1TWCB 2NTTA 1EY9A 3RMKC 1EY0A 3FMCA 5LMUQ 4QJFA 3BYTB 2N49A 4XIGS 1WZ0A 2LMCA 4JI8L 3MC0B 3KBGA 3K81C 2JYTA 1YBYA 2F4IA 1D5XC 3STBC 3M4QA 1N36L 4G7HC 4JLCA 5CHWA 5EKKA 4X64L 5BN3A 4RFBA 4W9LA 5LNK1 1TXYA 3DWAA 4A3EH 4R4TA 4OO1G 2L1AA 1P98A 5HKHA 3KUZA 1NVID 1F9RA 3AEAB 1TS3A 5ELFA 1VQ9A 4DR7Q 4PK1A 1KLUD 2QCPX 2Z9HA 4FJZA 3T1HQ 1GKHA 4M02A 4DAMA 3ZTCA 1Y14B 1YITA 3T9LA 3U50C 3WIMA 3J7AV 2B76B 4ALPA 3D6WA 4NXNQ 2F0QA 1I4XA 4M0WA 3FAHA 4C3JB 4JI5L 2R7FA 2M56B 2A69D 3J80i 2MFIA 2WXLA 3SR6A 1J0GA 2B2UC 1YHAA 4DV7Q 2I0QA 3HOYG 1RCVD 2CW0D 3F8TA 1CZGA 1GC7A 5E1FA 3CKIB 1ESFA 3QHTA 2D5DA 1T9HA 2DAJA 2OOBB 1YJ9A 3A4SC 3PHWB 1WTPA 4LF9L 5IT9E 4JL9A 2JQRB 2V4LA 3TEZA 1SDFA 4A3EB 1V2YA 2DENB 2PW9A 2XTIA 1C0AA 2K75A 1C4CA 2KQ4X 4WJQA 1SJED 1LFDA 1HTQA 3ZJVA 4ZDVA 4LK1C 2B2VC 2N7EA 1WIAA 2JJQA 2L12A 3U7DA 4MHEA 2EY5A 2ES2A 1VQNA 4E3CA 4DR6L 2YYZA 2WXRA 3O13A 4N58A 4A20A 1JALA 2WX1A 2B39A 5C4HA 1CKNB 1XTDA 5EBCA 2ZCBA 4W9GA 1XNRQ 4DGZA 3HOYH 2AL6A 3RUIB 3E9SA 4A3OA 1GVPA 4HCSA 3F2UA 4DR3Q 3A54A 1PH1A 4IWOA 2ZJRA 3PUYA 1X6OA 3ZO5B 2EZVA 4HCNB 4NQLB 1PZKD 4U68A 3TP7A 4YT0B 2KJXA 1QOHA 2M8SA 1IL8A 1M94A 3UDXA 3P4QB 1B9RA 3UDGA 4FHKA 5D14A 5FOBB 1VQDA 1HZ5A 1OFFA 1N9WA 1EUJA 3B0AA 3NVZA 2BWES 2X6GA 4N9TA 4NY0A 3M85A 4WJPA 3I2ZA 1SNPA 1IGCA 4ZOHC 1V9JA 1MD2D 5E7NA 1JRUA 4EEWA 2RVLA 3D0FA 1IKMA 1HQMC 3U4VA 2UUCQ 1K8OA 2NBWB 4JI2Q 3K5OA 1NSNS 2JWUA 4ANWA 2OF1A 1TS4A 1FFVA 3VUYA 4ANXA 4L5TA 3M4PA 5M3MG 1T0RC 4X57B 1NEKB 4HKZE 3MC8A 3HOYB 3DVNV 1TIID 3IXSA 1MHWC 3U4EG 1PV4A 1CKNA 2KHJA 4JI8Q 3SXHA 2EY1A 4WH4A 1TTNA 4HSVA 4JI1L 4F87A 2F3IA 3I4NG 3ALBA 1UWVA 1F2MA 1L0XB 1E7ZA 1STNA 1N36Q 3TEXA 1PRTC 1JORA 2MPMA 2PIAA 4X64Q 1WX8A 1ZYRD 3SK8A 2UXCL 3VA5A 4GLVB 4ULLA 3CIRB 3OPOA 1AH9A 4L63B 1NI2A 3HOZG 1WXVA 4GLSC 3ZUNA 4H2AA 3CQZH 3DWPA 4JC0A 1PYWD 1WXSA 3X0WA 2V0GA 1I5FA 3T56B 1A15A 1E7VA 1RWSA 2OEDA 3NZUA 2MJEA 3UE1A 3GTMH 2AUKA 1LXDA 2K8CA 2LZ6A 2CQAA 1F2RI 1LT5D 3RR5A 3KJPA 3I4NH 3A8IE 3OMCA 2MSED 4P75A 4GXBA 2VW9A 2LJ5A 3N1ZC 3UGBB 4HJGE 1CI3M 1T5XD 2ZTCA 1XJVA 1SYCA 2E75C 1S3SG 1XD3B 4HDOA 4A3PA 2WACA 3RNUA 2BB6A 4GDKB 1NENB 4KY5A 5GAEC 3W2DA 3ECIA 5FLMG 3OAWA 2F0SA 4YY3Q 1SNOA 1I6VC 3E9IA 2V3PA 4CGYB 1C78A 1E2VA 1CA6A 4KTAA 1NR4A 1L0WA 2A5UA 4WAAA 3CWIA 4WQMA 2K03A 5CHVC 3I56A 2O5JC 4N6EB 3C1EA 3C19A 1OXVA 4NAWB 4FADA 1ACCA 4OWWB 1DCZA 3TMEA 1SSOA 1QG7A 2N88A 3D8GA 4LFBQ 4BBNC 2MJ8A 5M3MB 2MRPA 5CX3A 4TQ0A 3IAM1 5JXVA 4DV0Q 1LTRD 3GTMB 4DR6Q 3BDOA 4HIDA 1XO3A 1TY0A 4FJYA 1BUVT 2K4KA 3I4NB 3A9KB 1F0ZA 1XMOL 5AUIA 5JVG3 5I6WA 2HCIA 1DOKA 1ZGUB 2F03A 4UHVA 1E6EB 4B6WA 2MX2A 2E2JB 2D3GA 3D4DA 1SFOH 4OVZA 3WAMA 4IOCA 4K0KQ 2G4DB 2D0PA 3T13A 4W9DA 5EE0A 3VTWA 3LX0A 1HZBA 1WMHB 1WVLA 3HOZB 3B2GA 4BKSA 4GLAC 2PQAB 1V49A 2NZOA 4B0MA 3DEPA 1YZ6A 3U7ZA 5C6AA 3MXGA 4K5WA 3I4MG 1CSPA 2JXMB 3PIO3 1KD1C 1WXQA 2K6QA 4KX6B 2MWSB 1R4NI 1LT4D 5E6OA 2Q2UA 3S2DH 4A55A 4KY6A 3ZXRA 3V2TA 2DNFA 3BU2A 1EEID 4DV6L 1GJXA 3OG5A 4JPBW 1OQRA 1JJGA 1BMLC 2O2LD 4OZAA 5COYA 2SDFA 2FCSA 4NAWA 3KH0A 4FNFA 1FJGL 4PZ8A 2JYEA 1B3AA 4JBMA 1VF7A 1EU3A 3S1NH 4ZRIA 3TREA 4KD3A 1MVKA 2KFKB 3GD7A 4LLGM 2YU9H 4UP7A 2MLBA 1IW7D 1SMXA 1ZDXA 5C2TB 5HFYA 3CC4A 1VQHA 1HR0L 4PYUA 3T1YQ 1TWHH 3LGJA 3EBEA 3QOLA 1CA5A 4EQNA 5AZGA 5IP9G 2JY6A 3A9KA 4LF7Q 3HOUG 4GGQA 1SGHA 5JPMC 4RG1A 3RLOA 3EUB2 1NY4A 2K25A 4NQKE 1DONA 1SN8A 3WAPA 2MGSA 2UXCQ 2WU2B 2Q2HA 1HA5A 1F9QA 2PQAA 3K9OB 4XZ4A 1AEXA 3SDLC 1TWFH 4ZKCB 4JOIA 4LFAL 4Y52H 4ANUA 2IJ0A 3PPAA 3FPUB 3J7YW 1JT8A 2KCCA 3A7AB 2HTHA 1BUIC 2KDFB 1ZDVA 4N8X1 3L0OA 4KGSA 3S2AA 1GUGA 1TR5A 2LFIA 2GN5A 2PE9A 2RBMA 1Q46A 1V1PA 4QB4A 3QIJA 3E9HA 5FR6A 1YJIA 2EELA 5IP9H 3A0JA 1BQQT 3R7QA 3HEJA 5FLXc 3GTJH 2FCQA 4ZRZA 3MZ5A 1E3PA 4ILWA 4JWUC 3KQ4A 2AYOB 1TWHB 3CC2A 4CYEA 1AFPA 1Y8OB 1IYJB 4IPGA 3CCSA 1XNQL 2K9XA 2RSUA 5GAGC 4JV5Q 4I6LB 5HI1A 1B3QA 1K3RA 4OWXB 2CH4W 3S1RB 5DAUA 3I4MB 5MPOA 3ERSX 2Q8RE 3T53B 2IO0B 3Q3JA 3ZRCA 4TVAB 1T6BX 5C3WA 3FKIG 4MH8A 1BNZA 2UYZB 3R66C 2PQEA 5IYBG 2NN6I 5D6JB 2RF4A 1ZP0B 2DBYA 3PLUA 3TCAA 1YNND 2GVBA 3T3OA 1XPOA 2E5LQ 5JVH3 2HJ1A 3RZWC 3OIQA 4QUFA 2JA7G 1GAQB 4GN3B 1S72A 3I72A 3A56A 3ND8A 5J3BA 1V5TA 3LYYA 4KVGB 1LTSD 2NVTH 4EX5A 1Y56A 1VQPA 2O6VD 5JJIA 2YEPB 3DBRI 1E7UA 4RNAA 1X3QA 1U4RA 4OHJA 2IPKD 2JZPA 1KOTA 4GDLB 2X8XX 2L15A 3GTJB 3OTOL 4UAIA 4DR1Q 2JRHA 4I7AA 3HOUB 2RMMA 1UGMA 4DR4L 2BYFA 2KN5A 4AIMA 2A73B 2KC2A 1EYCA 1MBYA 1B9MA 5AUKA 1TT2A 3FKIH 2EVBA 4KHVA 4HPMB 2KVMA 5IYBH 1W2BA 2AQ3B 1HNZL 3EN2A 4M8NA 1FL0A 4KLKA 2DN8A 1WFQA 1SE3A 3EJIA 3H3VI 3TUOA 1IP9A 3PT2B 3KLSX 3Q24A 1RDPD 3L17A 1WF9A 2DUDA 3VHTC 1L2FA 3FDTA 3PHXB 3A9JB 1STBA 2Q8IB 2FHTA 2V3NA 1FO4A 3ZNGC 5E6NA 1E10A 2MBQA 1WGYA 2KXJA 3AE1B 2VQEL 1Q81C 5E3FA 3IBEA 4A75A 4DV6Q 2DAFA 2PMZE 1BOSA 1B53A 1BO0A 1SYBA 3VYUA 3SD5A 3AULA 4B3RQ 3GP7A 2K22A 1FJGQ 2VS1A 1S5CD 2KEEA 1WM2A 2L8JA 1A0IA 2ZXPA 3D32A 2RCNA 1PXUA 4ICVA 2NZHA 3ZNZB 2KZRA 4XDCA 4O1NA 1YN5A 1HH2P 2MO1A 1S5FD 5CV8A 2BWFA 1C1YB 1F2LA 4GDLA 3QQ8B 1NNXA 1HR0Q 5IA7A 2LXKA 4A6QA 5IP4D 1AW7A 2M9VA 1J5EL 1Y1VG 1HFGA 2K32A 3FKIB 3BS1A 1G6ZA 4EUTA 3CW2C 3I57A 3ZVVA 1K53A 2HDMA 4ZAIA 2F0MA 2BH2A 1WXAA 1C48A 2W55A 2V1CC 1IUEA 2JA7B 1FIQA 1JOKA 5C4JB 3TN2A 4GNXC 5K36H 2HUGA 1QOBA 1EY7A 2MEKA 4TKOB 1F9PA 3TZUA 2LXCA 1LQBA 3VVWB 3T3NA 1R4NB 3C46A 3RYTA 3A9JA 2YLMA 5DM63 4QGUA 3SU8X 1J9OA 1IPGA 4IPDA 4JI3L 1WD1A 4K5VA 4A3IG 1K8AC 3H91A 3HOXB 2LGXA 4IM2A 2K50A 1ICWA 2R7ZG 4NPNA 2W3SA 1UBIA 1BCPF 3NQIA 1C79A 1P3QU 4OVVA 4AQYL 4TQ1A 2F4VQ 2KO3A 3OJ4B 1BR9A 3HGBA 2WNMA 4O0AA 2BKRB 2UUBQ 3CPWA 3QJYA 3NZSA 1XLNA 4PT5A 1K8MA 3TIXA 4X66Q 5C3EG 1V86A 4L23A 4ABNA 4DNIA 1WJJA 2F0VA 4HTHA 2R2QA 2WS3B 3L2PA 3R2IA 1VCBA 2R3ZA 1LLRD 2GVAA 2BVCA 3VYTA 5KHOA 3VTVA 1D1IA 3ZKJC 1QNUA 4WJ3M 4CBVA 3BWUD 3H8HA 3RD2A 2QEXA 1SYGA 2BKFA 2B2YC 3P7JA 5A2QE 4B9XA 2AL3A 1VDZA 3OYYA 1EYGA 4DF7A 1YNJD 2R7ZH 1HNWL 2J4XA 4HKQA 1EIYB 3PIPA 1XQQA 4K14A 2UWQA 5M5YH 3QWNA 4IQZA 3PUWA 4NDXA 5JH5C 2MBHA 4LK0M 3E6ZX 4XT1B 4FF4A 3GTOB 2LGDA 2IW3A 3KK7A 1IBLL 2EMTA 1A63A 2N4FA 1UE5A 4DPGA 4DHZB 1Y1VB 3OTOQ 5C3EH 1YHBA 1Q8KA 1KL9A 1U9RA 4Y7NH 2K52A 1WD0A 3TP8A 3STBD 4CJ2C 4DDID 2YTVA 3W1BA 1PTOF 3CCQA 3Q8CA 2J7ZA 1VS0A 1M90C 3M4OH 5CV6A 4IUNA 1HNZQ 4YTPB 4A8XC 1G6JA 2WP9B 2ZNVC 5CBAE 1MFWA 3PCOB 2OEOA 4CDDC 2I1JA 5D7GA 4K6DA 5FO9B 4A3IB 1STEA 2JP1A 2R7ZB 3ER0A 4GS3A 1KHIA 1N5XA 1PTOC 2VZKD 3A1QB 4KD4A 3BDLA 3GTKB 4A3BG 3T4AC 5M5YB 2KD0A 2KA7A 3N52A 1EFID 3DHQA 4S0RA 3QOJA 4K8IA 4G11A 4FULA 4DV3Q 3DBSA 1GO3E 4QUCA 3DBRB 1UUPA 2F0DA 2G1EA 1WR6E 3JW0X 3MVVA 5JJKA 1IYVA 4HMJA 3CP0A 3CCRA 3BDCA 2F3VA 4YL8A 2JVCA 2XNAC 4URKA 1JOOA 4Y7NB 3B6YA 2RDHA 3U2SC 4YCUA 2EYOA 5GROA 3W1YA 1N8RC 1YD8U 3GS2A 2GBNA 2M0XA 3AU7A 1WWTA 2QF7A 5E4XA 1PZID 5ISRA 3RNFC 3J81E 3SK6A 3V6CB 1FGUA 5LMUL 2VRRB 2EXZA 2RQXA 2EYLA 3VR6A 1RKNA 1WM3A 4A3BH 2I5LX 5C4XG 1QZEA 1PFBA 2PVGC 3WA0A 1HUMA 1P7FA 4GOPA 3RNCC 3PSIA 1AARA 4DK5A 5EE3A 4DUZQ 1UWXA 2LSSA 2WINB 4HRSA 1LM0A 3HRDD 1MG4A 3T8MA 2J0MA 3HVDA 4ARCA 2BBCA 3K0XA 4C1NK 4DK0A 2BH8A 1H9KA 1PH7A 4OXPA 4K8JA 2DHZA 2LI5A 1KDAA 1E1OA 2ASBA 3PUVA 1RFKA 1IBMQ 1F9SA 1E8XA 2CU1A 2K8HA 4FXCA 4HPPA 1QLBB 1S1QB 4DR7L 3RCZA 2VZKB 4Q2JA 2KVRA 2LUMA 3T1HL 3IAYA 3EQLC 3NVYA 1E8YA 1RF2D 4A3CG 1P1AA 4HWIB 4A4IA 4MTNA 5KNDA 1YJ1A 2KHIA 1E2ZA 5L37A 5C4XH 4NXNL 4MSQB 2OJWA 2IY1B 3H6NA 2SAKA 4IM0A 2BS4B 1GXDC 4YSXB 4A3BB 1E1TA 4IALA 4JIOU 5C0XH 3ZIMA 2UU9Q 1HRJA 5IOCA 1A3UA 1XT9B 1SAPA 4LNNA 1HNWQ 3NJTA 1CMXB 4JI6L 2VY3A 4ID6A 2AWTA 4PQXA 1FNWA 1Q7YC 1IBLQ 4PS3A 1EY4A 5KIXA 1P8LA 1ZUD2 1OO9B 4PV1C 4IUQA 2K5NA 3MJWA 2HD3A 3PGZA 2HIXA 4OL7A 4JI4Q 3KVFB 1Y8PB 4MT5A 1STHA 3S2HH 1LM8B 4A3GG 2W9NA 2Y5BB 2B2WA 4XYOA 4Z9CB 1BF4A 1VZ7A 2Z0DB 5LMNQ 5C4XB 4AWJA 5BMIA 1F2ZA 2VL6A 2HQEA 2ZXOA 1GC6A 1XNRL 4ZLTF 2WV6D 5AEKB 1I4GA 1WCMB 3URYA 4A3MG 1N63A 4G3XB 3X23A 4DR3L 2HT1A 3JSVA 2L83A 3S24A 3HKZE 3AN1A 4XYQA 1KJTA 3RNEC 4A9AA 5ELOA 4P71A 3SVMA 4UY8C 1C77A 4LNKA 1YJNA 2L52A 4H7BA 5DNFA 5M9OA 1TWAH 3L0WB 3C1FA 1WGHA 1WYGA 3KYDD 3H0GG 2IBIB 4X3KA 1XCTL 3J7AF 4C7ZA 3RN2A 4XQJA 1PH6A 2A6EC 1TBEA 1UH6A 5H1SE 4LF5L 1J6QA 1WJ4A 3N32A 2KQ3A 5IIFA 3S2HB 3QA8A 4A3MH 1I94L 1HQRD 1Y1WG 1SE4A 2WXQA 3L16A 2B2VA 3HVZA 3MAQA 2DZJA 4CKCA 3CCVA 3S14H 1O7LA 3RZOB 4BWGB 3GZNB 1DOYA 1VQIA 2Q2IA 1WTWA 1V1QA 3NTIA 1HE8A 3AYHB 1IL2A 1XYIA 4LNIA 2BB5A 1LYLA 1HZ9A 2I5MX 1EY8A 1TKEA 2K6DB 1XCQL 2N7DA 3H0GH 2CS4A 1AZQA 4REZA 2K0PA 2F0FA 3ZLZA 4YIJA 2KECA 2FFKB 4ZYSA 4V190 4EZJA 1JWBD 2KLCA 4A3GB 3GB1A 3H3VC 4CHKA 5M5XH 4KI0A 5IYDH 1YQBA 2KHWB 1O7IA 4YSZB 1Y1WH 1ZXTA 4G7ZC 2OXPA 5FO7B 1GUWA 1J7CA 1SF0A 3GDEA 1GUOA 4A3MB 4LDTB 2JEAI 1F2YA 5E6PA 2FUHB 2KMAA 2ASQA 5EDSA 1OQYA 4HJ7A 4O2DA 1VQ7A 3HUIA 1UEBA 2HQLA 2LEKA 2EJMA 1HUNA 3S16H 3S14B 3DWMA 5ELCA 3N30A 3I4LA 4DNTB 1A6XA 2EKEC 4NXMQ 4JE3B 4DHZE 1I42A 3M9BA 5D3DA 5CBEE 3UI3A 1QT9A 1CJEA 4WQOB 4HSPA 2KWDA 3ZXVA 5DPSA 2MA9B 4YY3L 1GD7A 1S5ED 4A3FG 2D11A 3A33B 3I3CA 2GBKA 5IYCG 3W5OA 5ELDA 1F77A 4H44C 4OWTB 3UDIA 2PE6B 1KTKA 1QUQA 3H0GB 1VF5C 1DM0B 2WXIA 4FJVB 3AQQA 5EE1A 1IBKL 5C1ZA 1C4QA 1KH0A 4JI6Q 2DZIA 4RF1A 3ZDMC 2E2IH 3W1GA 1L0VB 3GO5A 3K5LA 4BA2I 2EOTA 1M8AA 1H9SB 5M5XB 2C7HA 4QL5A 2FIFA 1ZXIA 2PCFB 1Y1WB 1M1KC 4LFBL 3SFEB 1HXYD 3DEOA 4Q5VA 4CJ1B 1U4PA 2BDNA 4DV0L 1KRTA 3CRLC 3NP8A 3P1HA 3EFXD 4R3DA 2JE6I 1T0QC 3HZXA 1YN3A 2LRWA 2M0AA 4OELB 3Q8FA 1ASYA 3K0YA 4IUVA 3S16B 3KYCD 1MSHA 3N1YC 4NB3A 2JEBI 4A3FH 4RM9A 3HHMA 5IYCH 4LF4L 4K0KL 1Q1EA 2HTME 1X3PA 3EIVA 2QW7A 2WDQB 1RRBA 4HCPB 3DLLA 2JA6G 2VH1A 2F0NA 1FNVA 2KDMA 4X65L 3OW7A 3TDQA 2PYKA 2NVXH 3AH7A 2VXWA 1QNKA 3NS1A 1SE2A 2IO3B 4ZUJA 1ZE3D 1JC7A 4S17A 2L05A 1LACA 4F7ZA 4DV1L 4ACFA 2XIWA 2A1AA 2DNEA 2HCCA 2PNHA 2WP8J 3AE6B 3HS0C 4JK1C 4LF5Q 1H9SA 5KGUA 1A2UA 3H7PB 2F3WA 4RGTA 3ZYYX 2OTLA 1PRTF 2QA4A 1I94Q 1WE7A 3ULJA 2R93H 2W3RA 5A35A 3GTPH 3IKJA 2VB3X 2A6HD 3NTHA 4J1MA 2MHJA 2JA6H 3T1YL 3V96A 4A3FB 1PVOA 1EM7A 2BPSA 2F0WA 1QVCA 1E90A 2N7JA 2EIFA 2FMMA 3LXFA 2D62A 2MUYA 1HEZE 3QIAA 4LF7L 3G6EA 1S4ZA 2GBMA 3H1UA 4UP8A 2NTSA 1TS2A 4OONA 2XRQD 1TZ1A 2PMZB 2B2TC 2BE5D 2WKDA 4P1BC 3HRZC 2PO4A 2LASA 2LGYA 3PZ7A 4FVMA 4JVZA 3RLFA 4DAYA 2PPHA 4K6LA 3IRBA 5HGQA 5JEAG 5LXHA 4C80A 1QOAA 3PIOA 4WWNA 2DJGC 3TRZA 1MSGA 5GQOA 3ND9A 3RZFA 1ILQA 4FF2A 3W1SA 2N9EB 2DGYA 1I4RA 2OT2A 2M19A 3RMHA 1L4DB 5CV9A 1SE9A 3H7PA 5JOBA 2UXBL 2K04A 3CCEA 3L9AX 3WAOA 4TKNA 1Q82C 4KKUA 3GTLH 4RKLA 4JV5L 2WXFA 1HTPA 4OIKA 1V1OA 3RZDH 2PVOD 2PKOA 2FIDA 3L13A 3QAQA 2KWUB 3DQVA 3U9SA 4BBNF 5DLQE 1KFYB 3HK0A 1FVIA 1H9JA 2LUEA 1Z6HA 1I4QA 3I9V1 5JEAH 3TS2A 3APDA 4HEDA 3VR2A 3QCAA 2HDLA 1IBKQ 4HJKA 1KNAA 3RNBC 4HJ8A 1J7AA 2E5LL 2AEHA 1TKGA 1V43A 3CQZB 3TBIB 1SB3C 2KENA 2NVQH 3EFUA 3TP5A 4AS1A 3GOEA 2HHHQ 3NXWA 1HJPA 4A3JG 4WORA 1JICA 1VQOA 3MTNB 4L2YA 1Q5WB 2N3SA 1PA6A 4YSYB 3AEVA 2VUMH 4DR1L 1ZKOA 3NZ3A 3NE5B 2OJRA 4WFN3 5A2QL 1KRHA 3VDZA 1UELA 3AEEB 2WXKA 3L3OC 2EMSA 3I8ZA 1Q12A 3GTLB 5KNCA 3KLRA 3EGRA 4ZHOA 2K14A 4LF4Q 5LXIB 1SIFA 3PS6A 4LNQA 1MG8A 4BXXG 1YVCA 1OEYA 2W54A 5BR8Q 1VR9A 1L1OB 5KYLA 3UIPB 4X65Q 1D3ZA 1H4RA 4TUUA 1X56A 4RWSC 2KTRB 1N34Q 1YQ4B 1WGDA 4A3JH 4RGOS 3WALA 1ZW7A 2D07B 4K3BA 3M3JA 2IDYA 2Z4HA 2IO1B 3CD6A 3TMPB 1FEHA 4DV1Q 2V3SA 1V1PB 2EY6A 2KDBA 4R8IA 4B3RL 1BCPD 2E76C 2PW5A 4GLXA 1QE6A 1RM6C 2QGQA 4C56C 4OZCA 5IE8A 3OMGA 2IX3A 3BY4B 1KC8C 4BXXH 4B3SL 1YX6B 1HZAA 3E0JA 1EWHA 4C3HH 1YNXA 3B08A 3QARA 1SFOB 4FXDA 4MH0E 2EKIA 1WGKA 2PEAA 2JSVX 4BZAA 1MI2A 5I9PA 4US9A 1R9TH 1JJCB 2D9UA 1SMYC 4GN4B 1YIWA 4KKSA 1ET6A 1V97A 1L1OA 2NB0A 1NAPA 2PMVA 4UP9A 3JAML 4A3JB 1WYDA 4KDLB 3WOEA 1FFUA 2KTRA 2CWPA 1NI3A 3S2DB 1JRPA 4HLEA 4NPSA 1KRSA 3I90A 4B3TQ 4CDCC 4CHTB 1KAWA 2YTYA 5M5WH 1QJOA 4R4IA 2WAQE 1N6ZA 2JT4B 3N20C 1CM9A 1SYFA 3J81L 3PTFC 4OVUA 3H09A 4YCWA 1IYUA 4PG3A 4DAVA 3S1NB 2F4VL 4KJOA 1CQVA 2EYMA 1UD7A 1K83H 5HG2A 2ZXRA 3TP6A 2BA1A 2I2YA 4TMAB 3KF6A 1PHJA 2YU9B 2QIEB 2N0SB 4ME5A 5CTRC 3KOJA 2UUBL 2UXBQ 3TL5A 4ZQ3A 1TWGH 1BBUA 4LTUA 5GMVA 3H6MA 3H15A 1HCZA 3HP3A 4X66L 2OQ0A 4C2MH 1PTOD 2D3BA 1FRRA 1SE8A 1NJIC 3HKZG 2OWOA 1BCPB 1WJ6A 4PS7A 4PS8A 4AUQC 1JE4A 3C8YA 1IBXA 2YTXA 1EIHA 2UUAL 1NYQA 2IX1A 1KIXA 1SIJA 2ZPNA 4JGHB 1VZ6A 2KJRA 1ONLA 3QX1A 1NBWA 1TWFB 3WDNA 3NBHB 2KT7A 1CKOA 2N9XA 2QDFA 3S1QH 2I1KA 1A62A 4GNXA 4BFRA 1PTOH 5G5GA 5M5WB 4OEMB 3VXWA 4KV6A 3J80E 3EFCA 2JQOA 3KYHC 4CKEA 4JBWA 1R4PB 2NBFA 2NYZD 3BINA 1K83B 5J1ZA 2XVSA 4XWWA 5CHFA 1JWUD 3RLNA 4L5SA 1MJDA 4ZHPA 1WI0A 1MI0A 5C3JB 2K5DA 4R9WA 1J19A 4P16A 3AE4B 5T8IA 3PRPB 2B63G 4C2MB 1GUNA 4BAXA 2K7VA 1Q3LA 5IGEA 2J52A 1JR0D 2KKCA 2EPBA 3KDFA 4FF3A 2B8GA 5IP7G 4FHJA 5AZHA 4XX5A 4FP5D 5G2NA 1GUSA 3BZKA 2QILA 1WZ3A 4IW0A 4DBGA 3KUCB 1XLPA 4AYBG 1VQMA 1OGWA 5FKAC 3CC7A 1A2TA 1K9MC 5JPNC 1SBBB 1GM5A 2KLGA 3UI2A 4I6NB 4PNYA 5FJ8G 4BY1H 2GOWA 4E6IA 1ENAA 1NTGA 2A68C 3S1QB 3IFDA 2JA9A 4P73A 5KNBA 3Q8DA 2AX5A 4HROA 3PF4A 1G291 5K36G 4DAPA 1HZ6A 4WJOA 2NVTB 3NBHA 4DV3L 1RODA 4XT3B 3L10B 4G57A 4FXGC 1EY5A 1A5RA 2M17A 2UU7A 1E9MA 2B63H 1CTMA 2RGFA 3PMFA 3D4RA 2LVPA 5IP7H 1X3GA 2JU6X 2KDEB 3HKZB 5C44G 3Q3OC 4RHRA 4B3SQ 5JHAA 1P16A 3GE8C 4MN3A 1O78A 5EAYA 3RD4A 1YIJA 2BT6A 1QF6A 1X54A 1EFWA 2O6VB 5CC4A 3AXCA 2AWNA 3RULA 2A19A 2F0EA 4LW1A 2NUCA 5FJ8H 3P4RB 3MHBA 2ZTDA 1GNUA 3BK1A 3BYYB 3KUDB 1RJTA 5J2RA 2PI2A 3NWSA 2P5ZX 1FXTB 1GJZA 2G3QB 3PUXA 4HPLB 4ZRQA 3VH3B 4IO9A 3PLVA 2WLBA 1VQAA 4DUZL 2M2LA 1L5PA 3AM9A 1YOVB 2F0JA 2RA4A 3DMUA 3OSOA 3NWTA 2XWBB 3K5NA 1JWMD 1STAA 3V05A 2ATWA 3CSTA 4YWGG 1I35A 1Y8RC 2V4IB 5C44H 2NBVB 3BVMA 1N62A 1IBML 4B3ML 2DZKA 2KTFA 3F1ZA 2BYTA 1WY8A 2RD0A 4II3B 3J81j 1I6HH 4EQPA 3DOWA 1WH3A 4G0NB 1UGJA 2X6LA 3K80C 2OHFA 4BY7H 1O80A 4P72A 2D2QA 5EKIA 4AYBB 1KAAA 1VMCA 2IX0A 1MGSA 1KQSA 2EYPA 1HNXL 4IKGA 1EYAA 3NRZA 2BF8B 4B08A 1EUVB 2L76A 3CCMA 2UUAQ 2F0GA 4B9WA 2O6VA 4ZRJA 5D2MB 3VH4B 5C0XI 1QQRA 3K57A 2QKIC 2JF5A 2UU9L 2ZEQA 1L6VA 2EJGC 2E2HH 2R92G 3V6EB 4CKBA 1LTTD 4LJZC 3L4PA 5TSSA 2CQOA 2Z6BA 3GQBA 1PH3A 4TSSA 4O42A 4NW2A 3K7UC 5LL6X 2K05A 3TS0A 3AE8B 2IGGA 4OW0A 4BVUC 1MPEA 1FCCC 4HIMA 3B1LX 4EZKA 3AMUA 2QJLA 5C44B 5BYRA 2EXDA 4JWSC 1E0ZA 4LJOB 3SE0A 3AE9B 5EGTA 4BA1I 1WGGA 2Z6KC 1PGXA 4QF4A 2NVYH 3NELA 1PDXA 4N9PA 2IL8A 2LWPA 1VRAB 2RPQA 2H1EA 2L5TA 4JI4L 4GKKQ 5I2YA 1X55A 1QZHA 2Z0SA 3KLWA 2JXXA 1V80A 4BBRH 1FD6A 4L1BA 1JE5A 3K8AA 1TYGB 3VAWA 5LMNL 5M3FH 5H92C 5C5MA 1Q10A 2Q8TA 4IOIE 5IT9L 3A8KE 3DM3A 3K58A 3SGIA 4I7ZC 2R92H 1A3TA 4KY7A 3HOVH 3GZNI 5G55A 3TJPA 2E2DC 2LY7A 5D3IB 4GOPB 2V1YA 4YTMB 2HDEA 5AZFA 1I50H 1DOLA 1FXIA 2E2HB 3CF5A 2EY2A 2BCOA 2FBWB 4MELA 5CV5A 2DNCA 3HKSA 1F2RC 4GU2A 4EE2A 1YNTE 1YX5B 1UE6A 1PLFA 2V9HA 5EPLA 3BZCA 4KKIA 3KBXA 4EVOA 2XSCA 2WWZA 1L0YB 1PZJD 3AEBB 2NCNA 4DXGA 3L7ZC 2H88B 2D3AA 1N61A 3KFUA 3QO2A 4R8NA 2LGIA 3NENA 3VUWA 1V8QA 1PYSB 3N9YC 2NVYB 4GN5A 1W6JA 4RGMA 2MH7A 5I2XA 3C0RB 5C3EB 3PZDA 1D1KA 3OOCA 5C4ZA 2MBBB 3DBHB 1U0LA 3WCQA 3QC8B 4HAEA 2V4DA 5L95C 3CCLA 4KHPL 3AV8A 3TBLD 2QMTA 3M4OB 4DK6C 3EC8A 3LB8C 3V3XA 1KF6B 5HURA 1VQ6A 1WFYA 1S5DD 4LF6Q 2R92B 3GTQH 1D8LA 1ESRA 1N5WA 5IOIA 3MFGA 1P7EA 3LNNA 1N33L 1I50B 2Y5PA 3I3TB 4EKUA 2OCEA 1DOMA 3F2CA 1SRUA 1Y8NB 2MW5A 2LXAA 5J17A 2SEBD 1E0BA 1LT6D 1U4MA 1NUCA 1G8ZD 2CVRA 1YNNC 1VLBA 2FAZA 4C00A 1UEAB 1OEYJ 4Q0FA 4C4VB 1SEBD 2RDBC 4H0LC 5C0XG 5GAHC 3S1MH 2C7NB 1SNMA 4BOZB 4ANVA 2XWJB 1JWAD 1W3SA 1K8RB 1HZCA 2N55A 1I3QH 4DV4L 2Z0EB 2FMCA 1RL2A 2R61A 2CHBD 5H8YE 4AH6A 2GMIC 2ZJQA 1HA6A 4QAYA 3AI5A 4JG2A 1JROA 4NP5A 4B3MQ 5LL6S 2JA8G 2KMCA 2NR2A 2GA4B 3NVWA 3OW2A 3IHPC 5C23A 1PH9A 2WXMA 3ZJUA 1WTHA 3KLSA 3PIP3 1KLVA 1II3A 3I4OA 3SHQA 2RDFA 4K7SA 4C3IG 2KMMA 2M4NA 4A90A 3IVFA 2L0CA 1K28A 3BZDB 3JSVB 3PF5A 2ZW1A 1HNXQ 3AEDB 3D4WA 2N8NA 4KN4C 2PW7A 4NXML 2BA0A 1PFSA 3PO3G 1NBFC 1JMCA 2Z59B 3L08A 4A93G 1V6EA 1DGJA 1YJJA 1XPRA 1ISNA 2I46A 4DNRB 4B9KA 1TJEA 4A3KH 3MTSA 2O2VB 4K81A 4PYZA 5JHBA 1IYFA 1LT3D 2N78A 1WTXA 4D2KA 2PI2E 2H4OA 3S1MB 1G2SA 2KK8A 4KZ0A 4YTNB 4FDBA 2CKHB 1LTID 2X38A 1V9PA 4C4VA 3MEHA 2JA8H 2HD5B 3R8BA 1RFAA 3AB5A 4I65A 3RFZB 4KV2A 2FE8A 1VQGA 2KCTA 3Q8EA 3FPPA 3WWVA 3ULPA 4C3IH 1VQBA 2KHSA 1EWIA 1NMFA 2IGHA 1UWMA 3RPFC 3QWZB 3DM1A 2XGTA 3CU7A 3PO3H 4DV5L 1PRTD 1Z47A 4A93H 5DPTA 4K2LA 1B4OA 1T0SC 4GZYC 3N1XC 4H02A 2J0KA 4J3OD 4NNJB 4X6AH 2INDC 1TU2B 2JSOA 1AE3A 4EQ5A 4XC2A 2TMPA 1TGZB 1WX9A 2AHOB 5CORA 2JYOA 2B2UA 4KJNA 3S17H 3VR8B 1XTCD 3CHBD 2R2OA 3V62A 2BOSA 2KCNA 2O2VA 2MJ3A 3E56A 5EPJA 1TY2A 2JA8B 2WAQG 2IT1A 4DXFA 5IAAC 1TWCH 2CH4A 2F0KA 5DPWA 4ZRKA 5AJ3L 1CSQA 1CK1A 4C3IB 5BYQA 4ZK9B 3W3AA 4LMQD 2K5PA 5E6JA 3ICEA 4HN7A 1N60A 4LWCA 2H5XA 3PO3B 5EQ0A 3CSFA 1WR1A 3DWQA 2KDIA 5IYDG 4KHPQ 3NY5A 1NCVA 1NMGA 1TQOA 2O5IC 2G4SA 1SXTA 4C3JG 1Z5SB 2BS2B 1PYBA 3ZTDA 3A74A 2MBOA 4DKAC 2FUG1 4HK2A 1AWDA 2SNSA 1C9OA 1VCIA 2NBUA 3QG1A 1N33Q 4IOAA 2WFWA 4L6TB 4P7IA 3G4SA 1B1ZA 1EYDA 1QUQB 2F1MA 4UPAA 2MP2A 1HR0W 4RKBA 4AYBE 3R93A 1PRTB 3A5UA 3CMMB 1XX8A 1WTRA 3WOFA 1TWAB 1HTLD 1X65A 3ULLA 1H9RA 3ZJTA 4YHHL 1IHZA 3L54A 3TEWA 4DV4Q 4RAUC 1C4PA 1CZWA 1D2BA 3ENEA 4C3JH 3F2DA 2N9KA 4K2KA 1KXLA 1LABA 4GKJL 1ICFB 3JC66 4EQOA 3DDCB 3HG9A 2HIVA 1OXUA 3MXUA 1FYCA 1Z7TA 1TIFA 2KJ6A 4K7UA 2J7QB 1T5EA 2DWQA 2ZJPA 3P4SB 3M3YH 2BQQA 1FM0D 2SOBA 1F9JA 4R4CA 1BXTA 3VFKA 3M7GA 2WX0A 2A5HA 1VDVA 1C4AA 3J7A5 1WE6A 2ZM6L 2Y5CA 4CQNA 2JRIB 1PFNA 2QCZA 1EZ8A 1TT5B 3Q6SA 5KYIA 1ZPSA 2WAQB 3A8JE 2B2WC 1F52A 2KYWA 4APVA 4FO2A 2F0HA 4F8MA 1T3QA 4PMWA 4BBSG 4LJPB 2RKSA 2CFMA 3D6CA 2F0UA 2Y0SG 2B2TA 2RR9A 1H9MA 3CXCA 2AKWB 4DR2L 3IG3A 1WXMA 3Q14C 3NS8A 3JAMc 5G3LF 2VH2A 2HHHL 2BGFA 2N1VA 1X3EA 3CPFA 4E71A 4ODGA 2LGSA 1DZ1A 2XRSD 3J81c 2HE7A 4K7WA 3C2PA 3K7AH 4DV5Q 2MQHA 2LHEA 3AE3B 1SMYD 2Z8LA 1XXGA 1G2TA 4GB9A 2AQ2B 3UDFA 5I6YA 3M3YB 4OO1H 3NVVA 4WRDA 2ZVOA 2I38A 2QDLA 5IWAL 4KK7A 1GB4A 1QWYA 4EFOA 2INNE 5BMHA 2R93G 3I63C 2XK5B 1RTNA 3J80L 1QOGA 4YWKA 1QILA 5BR8L 4BBSH 2M00A 4IUTA 3GTGH 1ZOYB 5T1IA 1KLGD 4IWPA 1EOVA 2X69A 2Z1CA 1GUAB 4LAAA 4DAYB 4IFDG 1EF1A 2REXA 4HJ9A 4X3UA 4BKGA 3TEYA 2C60A 3P20A 2KCMA 1N34L 3PRZA 2MO0A 3RNAC 1CZPA 1OXXK 2ZJDA 3NBIA 2LKVA 5EBDA 2E2IB 2PTLA 2CHWA 5TR5A 4RCOA 3M95A 5AJ3Q 1EQTA 1SNDA 5FLXE 3Q22A 1LO5D 3OIPA 3HM3A 2KQ7A 1DOXA 2KOLA 1XMQL 1MHXA 2KQSA 2AUJD 1OXTA 3GV6A 3K7AB 2E6XA 3RI7C 2K33A 3CAMA 1NR2A 2RHSB 4MNOA 4KDIC 3ZRFA 1OXSC 2RHQB 3F2BA 1VJKA 1ENCA 4G4KA 3M4YA 2IHFA 1EIGA 3MC9A 4X3TA 2MBEA 4W9EA 5HHDG 3H9DA 1TKWB 4A3LG 4IFDH 4BBSB 3VDYA 1GUTA 2XBBC 5D65A
chains in the Genus database with same CATH topology
3GTGB 1FXAA 1EL0A 2Y0SB 4IUUA 4F88A 2NVXB 4XDXA 1I4PA 1GHKA 2ID0A 3W9CB 3RUZA 3M7NA 2D2CC 4IDIA 4IZ8A 2ON8A 3IAS1 2RPVA 3B9JA 3MJ5A 3G7LA 2MJDA 4DQOC 1D5ZC 4NMZA 2R93B 3GTPB 4DA2A 3Q8BA 2MP1A 2JA6B 1LTAD 1RD9D 1ET9A 4J6HA 2PNRC 3SR1A 2A68D 4ZUIA 2CJNA 3DWGC 1KDCA 4NJCA 1EOTA 1ZEQX 2K28A 2LS01 4M8AA 5JJZA 3PV0A 2VB2X 4P2CB 4MIUA 5JAVA 4U673 3Q23A 4HEA1 2J0TD 4AQ7A 1QKZA 3PUZA 1XLOA 3A55A 4ZOHC 4L8JA 4OIJA 3FILB 2MHVA 3MHZA 4YXDB 5IGBA 1B44D 3K6OA 2BW2A 3VR5A 2F0OA 1FD7D 2Z4IA 3QB3A 5BYSA 1V8CA 2Y3AA 3D31A 2DY8A 2F0LA 2F0IA 3ZQ4A 1U4LA 2WXHA 4N59A 3NK9A 1C9FA 2EYHA 3ZGZA 4KKTA 1I4HA 4WJWA 2K5QA 3ONAB 3BG3A 3LWEA 2D5GA 2NWGA 3C3LA 3RZDB 1Q90A 1J7BA 1NYRA 4C3HG 4S3SA 2WXOA 3PO2B 1R7SA 2EDGA 3EROA 1ML0D 1PGBA 1LTBD 1KNEA 2AQ1B 2L4NA 2NVQB 1SSNA 2PZTA 1X32A 2L55A 5DEHA 3BVZA 1RYJA 3IL8A 3FILA 5DM73 2RSNA 4WIPA 1CHQD 1KDBA 1PFDA 3EA6A 2VUMB 5ELEA 5IODA 2QSDA 4XWTA 3P4PB 2IGDA 1EU4A 5EJWA 2FINB 2KAJA 3G6JB 1IBXB 3Q8AA 1J8IA 3R2TA 3VR9B 4IURA 2A69C 4OGQC 2JX5A 2ICIA 4G7OC 4ZRPA 1E7PB 4RF0A 2NMQA 1SNQA 3GV3A 2CW0C 1BDOA 2PZUA 2WB1B 3VYSA 1GHJA 5BMGA 1XWEA 3SDZA 1K51A 1K50A 4KN7C 4MACA 1AN8A 5EKLA 1WTQA 1SYDA 2JA5B 1EEFD 3H94A 2ONQA 2ZT9C 1JQYD 4TRDA 1EWCA 1B2TA 3VA7A 1EZ6A 4DFAA 1GB1A 3FEWX 5G5HA 1OQQA 3DXJC 5ELBA 2DYMA 2PZWA 4C3HB 3IT4B 2XN9C 1IGDA 2K1BA 3R3OA 2EYFA 1HHVA 2G9DA 1RHPA 1D4BA 3AEFB 1JCKB 4XXEA 1R9TB 3FC4A 5BN4A 3VYRA 2C9OA 1RTOA 2LJIA 3P42A 1G91A 3FRPB 5CYUA 2EJFC 2L9HA 2K5WA 4KKJA 5CV4A 5IGCA 3KUPA 1L6UA 3I70A 5C0XJ 3Q69A 1SNCA 2G9HD 3D3RA 3AECB 3OHXC 4QIWB 4B0EA 1TWGB 2A6HC 3B2FA 2CJOA 1DYQA 1STGA 3VR4A 4X3SA 5CV7A 1QOFA 4XQQA 5IGFA 2BE5C 3ITPA 1ZYRC 2L11A 1PTOB 2B2YA 2KEDA 1L4ZB 1HFNA 2PPBC 1W6KA 4OZBA 4NKLA 1GPXA 1QB5D 1TVXA 3KWVA 3BK2A 4HR7B 1PUTA 3J9CA 1JWSD 2TSSA 4XTCS 1I7HA 1DXMA 3Q0AA 4H13C 3ABVB 4BY1B 2NZ1D 1FMAD 2SNMA 1SJHD 3VRAB 4XE0A 1JW9D 1HPCA 1A70A 2F0TA 2O4XA 1STYA 5J39A 1DD2A 3S9WA 2B63B 1TZOA 3NPPA 5EPKA 5KEEA 2WXNA 1K52A 1IKLA 4ARIA 1Q8IA 3N6RA 3IT6B 1TS5A 2BDOA 2L32A 5I9OA 2NN6G 2QDBA 5T1GA 5KRUA 2K3UA 3ERQA 2I07B 5FO8B 2RSOA 5IGGA 1WRIA 2F0PA 2A6ED 2ACZB 5EE9A 1JMLA 1JB3A 1D5MC 2FJ2A 2WIIB 4HMIA 1ROEA 2WDVB 1BCPC 3VR3A 5AFWA 5HGTA 4V0BA 2YEPF 1FR3A 3W5UB 1I6HB 3TSSA 1CFMA 1IW7C 4TQUS 5C5LA 1YQ3B 2BTEA 4HCEA 2NN6H 4BY7B 1O7ZA 1AP0A 1FCLA 1ZXHA 2C5CA 4NAMA 4P6VF 4PMBA 4C7YA 4US8A 4FYDA 3NHHA 5C3XA 4RCNA 4JX1C 4A3DB 5FR3A 2A74C 1BBXC 1WTOA 1WSPA 1XF5L 4C1NI 2K6AA 1XEEA 5CGKA 1C76A 3A7LA 1PGAA 3OWFA 4JPSA 4QMGA 1ENFA 3K5MA 4NZLB 2ENBA 3SHLA 1PFMA 1QCBD 4RH6A 1VZ8A 2IWHA 3AB9A 4IN3A 3AE2B 2GI9A 3BVGA 2WKCA 2WU5B 3KWLA 2WXJA 4BBRB 2ICEC 3PO0A 5M3FB 3U9OA 3SK4A 3OWEB 1AYFA 3HOVB 4XDDA 5F2DA 3T16A 5FLXL 2GB1A 4QCLA 3X3NA 1SYEA 1WTVA 3EVQA 3CRKC 4KGTA 3AEGB 2N9LA 1UAPA 1Y69U 1A3VA 1PDQA 3JAME 2WDRB 4IFDJ 1PMRA 5GXGB 2DY7A 2EYJA 1ILPA 2QEJC 3HOWB 4IUPA 1JOQA 5G3LD 4RHSA 1Q1BA 3W5VB 2CU3A 5J22A 5FK9C 4WURA 2K01A 1R4QB 3IFTA 3MA2B 2DYOA 2LHDA 3TZDA 2KACA 1E2WA 2JXTA 3S15B 3NQTA 3GTQB 1C8CA 5NUCA 3NUCA 4KGRA 3NSWA 1YN4A 4KMUC 3X3MA 5IGDA 4USAA 4WWMA 4M1UB 2E3TA 5CMDA 1JQ4A 1TKYA 1FRDA 3FVQA 2ZW0A 3U52E 2WQYB 2LFNA 3AE7B 3AMZA 2J53A 3P63A 2E74C 3MWYW 1I3QB 4MM3B 1B9NA 1EQVA 5JEAJ 2VNUD 3E5SA 1LV9A 4FXKC 2H89B 3ETRA 1CQFA 3AE5B 1M4VA 1AZPA 2WXPA 3PZ8A 3DUZA 5K5PA 5LHY1 1CT1D 1O7YA 4CJ0B 4OO1I 1UNSA 2L1BA 1FGBD 4PMCA 2INPE 4RGNA 3NUHB 3LWUA 4ITKA 3MXPA 3VQIA 1FNUA 3MXNA 3P75A 2AWOA 4A3KB 1GOZA 2DLBA 1D6EC 3K59A 3I73A 1DOIA 3KF8A 3BIID 2LMCB 1CHPD 3P1MA 4EGVA 2EE1A 2R6GA 3MP9A 3T51B 2J42A 4RA8A 5I4DA 2W82A 4DN4M 3SK5A 3NTKA 4WAFA 3MFYA 4DU9A 1EY6A 4K5XA 5CR3A 4ZKBB 4A93B 2KN4A 4XQNA 1S5BD 1XLQA 1EWYC 2BS3B 4F7XA 1DJRD 2GRIA 3SEBA 4J8QA 2KUMA 2B8FA 4IFDI 1MHHE 1YMHE 2PLPA 4FF1A 5BN5A 3VRBB 2WXGA 1LTGD 2Q5WD 2RDGA 1KABA 4UDUC 4KHZA 3I91A 1YNJC 3S17B 1VMPA 1B50A 4BS9A 4DK1A 5E4WC 1TWCB 2NTTA 1EY9A 1EY0A 3FMCA 2LMCA 3BYTB 4XIGS 3MC0B 3KBGA 2JYTA 2F4IA 1D5XC 4G7HC 5EKKA 5BN3A 4RFBA 5LNK1 3DWAA 4OO1G 2L1AA 1NVID 1F9RA 3AEAB 5ELFA 1TS3A 1KLUD 2QCPX 3J7AV 2B76B 3D6WA 2F0QA 1I4XA 4M0WA 3FAHA 4C3JB 2M56B 2A69D 3SR6A 2WXLA 2B2UC 1RCVD 2CW0D 1CZGA 5E1FA 3CKIB 1ESFA 2D5DA 1WTPA 5IT9E 2JQRB 3TEZA 1SDFA 4A3EB 2PW9A 1C4CA 2KQ4X 1SJED 3ZJVA 4LK1C 2B2VC 2L12A 4MHEA 2EY5A 2YYZA 2WXRA 3O13A 4N58A 1JALA 2B39A 5C4HA 5EBCA 4DGZA 3E9SA 4HCSA 3F2UA 3A54A 3PUYA 2EZVA 1PZKD 4U68A 3TP7A 4YT0B 2KJXA 1QOHA 1IL8A 3P4QB 1B9RA 5D14A 5FOBB 1HZ5A 1OFFA 3NVZA 2X6GA 4N9TA 3M85A 1SNPA 1IGCA 1MD2D 2RVLA 1IKMA 1HQMC 1K8OA 3K5OA 1NSNS 2JWUA 2OF1A 1TS4A 1FFVA 1NEKB 4HKZE 3HOYB 1TIID 3IXSA 3U4EG 4WH4A 3SXHA 3SFDB 2EY1A 4HSVA 4F87A 1F2MA 1L0XB 1STNA 3TEXA 1PRTC 1JORA 2MPMA 2PIAA 1ZYRD 3SK8A 3VA5A 4ULLA 3CIRB 3OPOA 4L63B 4GLSC 4H2AA 3DWPA 1PYWD 2V0GA 3T56B 1A15A 1RWSA 2OEDA 2MJEA 2AUKA 2CQAA 1F2RI 1LT5D 3A8IE 3OMCA 4HJGE 1CI3M 1T5XD 1SYCA 2E75C 2WACA 2BB6A 4GDKB 1NENB 4KY5A 3W2DA 2F0SA 1SNOA 1I6VC 2V3PA 4CGYB 1C78A 1E2VA 1CA6A 4KTAA 1NR4A 3CWIA 4WQMA 2K03A 2O5JC 4N6EB 3C1EA 1OXVA 4NAWB 1ACCA 1DCZA 3TMEA 1SSOA 1QG7A 2N88A 3D8GA 2MJ8A 5M3MB 4TQ0A 3IAM1 5JXVA 1LTRD 3GTMB 1XO3A 3BDOA 1TY0A 1BUVT 3I4NB 1F0ZA 5AUIA 5JVG3 5I6WA 2HCIA 1DOKA 2F03A 1E6EB 2E2JB 3D4DA 4OVZA 3T13A 5EE0A 3LX0A 1WVLA 3HOZB 3B2GA 4B0MA 3DEPA 3U7ZA 5C6AA 3MXGA 4K5WA 1WXQA 2JXMB 3PIO3 4KX6B 1LT4D 4A55A 4KY6A 3V2TA 1EEID 1GJXA 1OQRA 1BMLC 2O2LD 4OZAA 5COYA 2SDFA 4FNFA 2JYEA 1B3AA 1VF7A 1EU3A 4KD3A 1MVKA 3GD7A 4LLGM 5C2TB 1IW7D 1ZDXA 5HFYA 3T3OA 3QOLA 1CA5A 4EQNA 5JPMC 3EUB2 1DONA 2MGSA 2WU2B 1HA5A 1F9QA 1AEXA 4ZKCB 2IJ0A 3FPUB 3J7YW 2KCCA 3A7AB 1BUIC 1ZDVA 4KGSA 1GUGA 1TR5A 2LFIA 2RBMA 1V1PA 4QB4A 1YJIA 2EELA 1BQQT 3HEJA 4ZRZA 3MZ5A 4ILWA 4JWUC 3KQ4A 1TWHB 1AFPA 1Y8OB 2K9XA 5HI1A 3S1RB 5DAUA 3I4MB 5MPOA 2Q8RE 3T53B 1T6BX 4MH8A 5C3WA 1BNZA 2PQEA 2NN6I 1ZP0B 2DBYA 1YNND 5JVH3 3OIQA 4QUFA 1GAQB 3I72A 3A56A 3ND8A 3LYYA 1LTSD 1Y56A 2YEPB 4RNAA 1X3QA 1U4RA 4OHJA 2IPKD 2JZPA 4GDLB 3GTJB 4UAIA 3HOUB 2RMMA 2A73B 1EYCA 1MBYA 1B9MA 5AUKA 1TT2A 4KHVA 2EVBA 2KVMA 2AQ3B 2DN8A 3EJIA 1SE3A 3TUOA 3KLSX 3Q24A 1RDPD 3FDTA 1STBA 2Q8IB 2FHTA 2V3NA 1FO4A 1E10A 3AE1B 5E3FA 1BOSA 1B53A 1BO0A 1SYBA 3VYUA 3GP7A 2K22A 1S5CD 2KEEA 2ZXPA 1PXUA 4XDCA 4O1NA 1YN5A 1S5FD 5CV8A 1F2LA 4A6QA 1AW7A 2M9VA 2K32A 1HFGA 3FKIB 3BS1A 1G6ZA 3I57A 1K53A 2HDMA 4ZAIA 2F0MA 1C48A 2W55A 1IUEA 2JA7B 1FIQA 1JOKA 5C4JB 3TN2A 5K36H 1QOBA 2HUGA 1EY7A 2MEKA 4TKOB 1F9PA 3TZUA 3T3NA 3C46A 5DM63 1J9OA 1WD1A 4K5VA 3H91A 3HOXB 1ICWA 2W3SA 1BCPF 3NQIA 1C79A 4TQ1A 1BR9A 3HGBA 2WNMA 3QJYA 1XLNA 4PT5A 1K8MA 4L23A 4ABNA 2F0VA 4HTHA 2WS3B 3R2IA 2R3ZA 1LLRD 3VYTA 1D1IA 1QNUA 4CBVA 3BWUD 3H8HA 1SYGA 2B2YC 3P7JA 5A2QE 4B9XA 1VDZA 4DF7A 1YNJD 2J4XA 4HKQA 4K14A 3QWNA 4IQZA 3PUWA 4NDXA 4LK0M 3E6ZX 4XT1B 4FF4A 3GTOB 2IW3A 3KK7A 1Y1VB 1U9RA 1WD0A 3TP8A 4CJ2C 1PTOF 3Q8CA 2J7ZA 5CV6A 4IUNA 4YTPB 4A8XC 2WP9B 5CBAE 2OEOA 5D7GA 4K6DA 5FO9B 4A3IB 1STEA 2JP1A 2R7ZB 1N5XA 1PTOC 2VZKD 4KD4A 3BDLA 3GTKB 3T4AC 5M5YB 2KA7A 3N52A 1EFID 3DHQA 3QOJA 4K8IA 4QUCA 1UUPA 2F0DA 2G1EA 3MVVA 1IYVA 4HMJA 3BDCA 2F3VA 2XNAC 1JOOA 4Y7NB 2RDHA 3U2SC 2EYOA 3GS2A 3AU7A 1WWTA 2QF7A 5E4XA 1PZID 5ISRA 3J81E 3SK6A 2EXZA 2RQXA 2EYLA 3VR6A 1RKNA 1PFBA 2PVGC 1HUMA 1P7FA 5EE3A 1UWXA 2WINB 4HRSA 3HRDD 3HVDA 4ARCA 2BBCA 4C1NK 4DK0A 3AE3B 1H9KA 4K8JA 1KDAA 3PUVA 1RFKA 1F9SA 4FXCA 1QLBB 2VZKB 4Q2JA 2LUMA 3IAYA 3EQLC 3NVYA 1RF2D 5KNDA 1E2ZA 2SAKA 2BS4B 1GXDC 4YSXB 4A3BB 4IALA 5C0XH 1HRJA 5IOCA 1A3UA 1SAPA 4ID6A 4PQXA 1FNWA 1EY4A 5KIXA 1ZUD2 1OO9B 4PV1C 4IUQA 4OL7A 1Y8PB 4MT5A 1STHA 2B2WA 4XYOA 4Z9CB 1BF4A 1VZ7A 5C4XB 5BMIA 1F2ZA 2HQEA 2ZXOA 4ZLTF 2WV6D 1I4GA 1WCMB 3URYA 1N63A 2L83A 3AN1A 4XYQA 4A9AA 3SVMA 1C77A 2L52A 4H7BA 5DNFA 5M9OA 3C1FA 1WYGA 4X3KA 1XCTL 3J7AF 4C7ZA 4XQJA 2A6EC 2KQ3A 5IIFA 3S2HB 1HQRD 1SE4A 2WXQA 2B2VA 3HVZA 3MAQA 4CKCA 1O7LA 3RZOB 4BWGB 1DOYA 1WTWA 3NTIA 1XYIA 2BB5A 1EY8A 1TKEA 1XCQL 1AZQA 4REZA 2K0PA 2F0FA 4YIJA 2KECA 2FFKB 4ZYSA 4V190 1JWBD 4A3GB 3GB1A 3H3VC 4KI0A 4YSZB 1ZXTA 4G7ZC 2OXPA 5FO7B 1GUWA 1J7CA 1SF0A 1GUOA 4A3MB 2JEAI 1F2YA 3HUIA 2LEKA 2EJMA 1HUNA 3S14B 3DWMA 5ELCA 3I4LA 4DNTB 1A6XA 4JE3B 5D3DA 5CBEE 3UI3A 1QT9A 1CJEA 4HSPA 2KWDA 1S5ED 3I3CA 5ELDA 1F77A 4H44C 1KTKA 3H0GB 1VF5C 1DM0B 2WXIA 5EE1A 1C4QA 1KH0A 4RF1A 1L0VB 3GO5A 3K5LA 4BA2I 2EOTA 1M8AA 1H9SB 5M5XB 1ZXIA 2PCFB 1Y1WB 3SFEB 1HXYD 3DEOA 4Q5VA 4CJ1B 1U4PA 2BDNA 3CRLC 3NP8A 3P1HA 3EFXD 4R3DA 2JE6I 1YN3A 3HZXA 2M0AA 3Q8FA 3K0YA 4IUVA 3S16B 1MSHA 2JEBI 1Q1EA 2HTME 1X3PA 2WDQB 2F0NA 1FNVA 2KDMA 3OW7A 3TDQA 2PYKA 3AH7A 2VXWA 1QNKA 3NS1A 1SE2A 4ZUJA 1ZE3D 1JC7A 1LACA 2XIWA 2HCCA 2DNEA 2WP8J 3AE6B 3HS0C 4JK1C 1H9SA 5KGUA 1A2UA 2F3WA 4RGTA 3ZYYX 1PRTF 2W3RA 5A35A 3IKJA 2VB3X 2A6HD 3NTHA 4J1MA 4A3FB 3V96A 1EM7A 2F0WA 2N7JA 2FMMA 3LXFA 2D62A 2MUYA 1HEZE 3QIAA 1S4ZA 2NTSA 1TS2A 2XRQD 2PMZB 2B2TC 2BE5D 2WKDA 3HRZC 2PO4A 3PZ7A 4FVMA 3RLFA 4DAYA 4K6LA 5JEAG 4C80A 1QOAA 1MSGA 3ND9A 1ILQA 4FF2A 3W1SA 2OT2A 1I4RA 2M19A 3RMHA 1L4DB 5CV9A 5JOBA 2K04A 3L9AX 4KKUA 4RKLA 2WXFA 1HTPA 4OIKA 1V1OA 2PVOD 2PKOA 3U9SA 1KFYB 1H9JA 1Z6HA 1I4QA 3I9V1 5JEAH 4HEDA 3VR2A 2HDLA 1KNAA 1J7AA 1TKGA 1V43A 3CQZB 3TBIB 1SB3C 3TP5A 4AS1A 3NXWA 4WORA 1JICA 4L2YA 4YSYB 1ZKOA 3NZ3A 3NE5B 4WFN3 5A2QL 1KRHA 3AEEB 2WXKA 3L3OC 3I8ZA 1Q12A 3GTLB 5KNCA 3KLRA 3EGRA 4ZHOA 2W54A 1VR9A 5KYLA 4RWSC 1YQ4B 4RGOS 2IDYA 2Z4HA 1FEHA 1V1PB 2EY6A 4R8IA 1BCPD 2E76C 2PW5A 1QE6A 1RM6C 4C56C 4OZCA 3OMGA 2IX3A 3E0JA 1EWHA 1SFOB 4FXDA 2EKIA 1WGKA 2JSVX 1MI2A 5I9PA 4US9A 2D9UA 1SMYC 4KKSA 1ET6A 1V97A 2NB0A 1NAPA 2PMVA 4A3JB 3JAML 3WOEA 1FFUA 1NI3A 3S2DB 1JRPA 3I90A 4CHTB 1QJOA 1CM9A 1SYFA 3J81L 3H09A 1IYUA 4DAVA 3S1NB 4KJOA 1CQVA 2EYMA 5HG2A 2I2YA 2ZXRA 3TP6A 2BA1A 4TMAB 2YU9B 2QIEB 2N0SB 4ME5A 4ZQ3A 4LTUA 3H6MA 1HCZA 3HP3A 1PTOD 1FRRA 1IBXA 1BCPB 1JE4A 3C8YA 1EIHA 1NYQA 2IX1A 1SIJA 1VZ6A 1ONLA 1TWFB 3WDNA 1PTOH 5G5GA 5M5WB 4KV6A 3J80E 4CKEA 4JBWA 1R4PB 2NBFA 2NYZD 1K83B 5J1ZA 2XVSA 4XWWA 1JWUD 4ZHPA 1MI0A 5C3JB 2K5DA 4R9WA 4P16A 3AE4B 5T8IA 4C2MB 1GUNA 2K7VA 1Q3LA 5IGEA 2J52A 1JR0D 2EPBA 4FF3A 2B8GA 4FP5D 1GUSA 2QILA 1XLPA 5FKAC 1A2TA 5JPNC 1SBBB 3UI2A 4PNYA 4E6IA 1ENAA 2A68C 3S1QB 3IFDA 5KNBA 2AX5A 4HROA 1G291 5K36G 4DAPA 1HZ6A 2NVTB 3NBHA 1RODA 4XT3B 4G57A 4FXGC 1EY5A 1E9MA 1CTMA 3PMFA 3D4RA 2JU6X 3HKZB 4RHRA 4MN3A 1O78A 3RD4A 2BT6A 1QF6A 5CC4A 2AWNA 2F0EA 3P4RB 2NUCA 3MHBA 3BK1A 3BYYB 1RJTA 3NWSA 3PUXA 4ZRQA 2WLBA 2M2LA 1L5PA 3AM9A 2F0JA 2RA4A 3DMUA 3OSOA 3NWTA 2XWBB 3K5NA 1JWMD 1STAA 3V05A 4YWGG 2V4IB 3BVMA 1N62A 2BYTA 4EQPA 1UGJA 2X6LA 2OHFA 1O80A 5EKIA 4AYBB 1KAAA 1VMCA 2IX0A 1MGSA 2EYPA 4IKGA 1EYAA 3NRZA 4B08A 2F0GA 4B9WA 5C0XI 1QQRA 3K57A 2QKIC 1L6VA 2EJGC 4CKBA 1LTTD 4LJZC 3L4PA 5TSSA 3GQBA 3AE8B 4TSSA 4O42A 4NW2A 5LL6X 2K05A 2IGGA 4OW0A 1MPEA 1FCCC 3AMUA 2QJLA 5C44B 5BYRA 4JWSC 1E0ZA 3SE0A 3AE9B 5EGTA 4BA1I 1PGXA 4QF4A 1PDXA 4N9PA 2IL8A 1VRAB 2H1EA 2L5TA 5I2YA 1FD6A 4L1BA 1TYGB 5H92C 5C5MA 1Q10A 2Q8TA 4IOIE 5IT9L 3A8KE 3K58A 4I7ZC 1A3TA 4KY7A 2E2DC 2LY7A 5D3IB 4YTMB 2HDEA 1DOLA 1FXIA 2E2HB 2EY2A 2BCOA 2FBWB 5CV5A 2DNCA 1F2RC 4EE2A 1YNTE 1PLFA 5EPLA 4KKIA 3KBXA 4EVOA 2XSCA 3AEBB 1L0YB 1PZJD 4DXGA 3L7ZC 2H88B 1N61A 2LGIA 3QO2A 4R8NA 1V8QA 3N9YC 2NVYB 1W6JA 4RGMA 2MH7A 5I2XA 5C3EB 1D1KA 3OOCA 5C4ZA 3WCQA 4HAEA 2V4DA 3AV8A 2QMTA 3M4OB 3LB8C 3V3XA 1KF6B 5HURA 1S5DD 2R92B 1ESRA 1N5WA 3MFGA 1P7EA 3LNNA 1I50B 2Y5PA 1DOMA 1Y8NB 2SEBD 1E0BA 1LT6D 1U4MA 1NUCA 1G8ZD 2CVRA 1YNNC 1VLBA 1UEAB 4Q0FA 1SEBD 4H0LC 5C0XG 1SNMA 2XWJB 1JWAD 2N55A 2FMCA 2R61A 5H8YE 2CHBD 1HA6A 1JROA 4NP5A 5LL6S 2GA4B 3NVWA 3ZJUA 2WXMA 3PIP3 3KLSA 1II3A 2RDFA 4C3IG 2KMMA 4A90A 2L0CA 3BZDB 2ZW1A 3AEDB 3D4WA 4KN4C 2PW7A 2BA0A 1DGJA 1YJJA 2I46A 4DNRB 1TJEA 3MTSA 1LT3D 1WTXA 4D2KA 2H4OA 3S1MB 1G2SA 4YTNB 1LTID 2X38A 3MEHA 3R8BA 3AB5A 4I65A 3RFZB 2FE8A 3Q8EA 3FPPA 2KHSA 2IGHA 1UWMA 3RPFC 3DM1A 3CU7A 1PRTD 1Z47A 4K2LA 1B4OA 4GZYC 4J3OD 1TU2B 2JSOA 2TMPA 5CORA 2JYOA 2B2UA 4KJNA 3VR8B 1XTCD 3CHBD 2BOSA 2KCNA 3E56A 2MJ3A 5EPJA 1TY2A 2JA8B 2IT1A 4DXFA 2F0KA 5BYQA 1CK1A 4C3IB 4ZK9B 3W3AA 4LMQD 2K5PA 5E6JA 4HN7A 1N60A 3PO3B 5EQ0A 3DWQA 1NCVA 2O5IC 1TQOA 1SXTA 4C3JG 2BS2B 2FUG1 1AWDA 2SNSA 1VCIA 3QG1A 4L6TB 1B1ZA 1EYDA 2F1MA 4RKBA 3R93A 1PRTB 1XX8A 1WTRA 3WOFA 1TWAB 1HTLD 1H9RA 3ZJTA 1IHZA 3TEWA 4RAUC 1C4PA 1CZWA 1D2BA 2N9KA 4K2KA 1LABA 4EQOA 3HG9A 1OXUA 1FYCA 1Z7TA 3MXUA 1T5EA 2DWQA 3P4SB 1FM0D 2SOBA 1BXTA 3M7GA 2A5HA 1VDVA 1C4AA 2Y5CA 4CQNA 1PFNA 1EZ8A 3Q6SA 5KYIA 1ZPSA 2WAQB 3A8JE 2B2WC 4FO2A 2F0HA 4F8MA 1T3QA 4PMWA 2RKSA 3D6CA 2F0UA 2B2TA 1H9MA 5G3LF 4ODGA 1DZ1A 2XRSD 3C2PA 2LHEA 1SMYD