1JWUD

Crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b2
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
239
structure length
232
Chain Sequence
b'ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Structural, energetic, and functional analysis of a protein-protein interface at distinct stages of affinity maturation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 68
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jwuD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwuD02
1G8ZD 3BZDB 1JWMD 4BWGB 4O1NA 2RDGA 3EA6A 2IPKD 2XN9C 3DWPA 2Z8LA 1LTRD 1D6EC 1FNWA 1S5BD 5FKAC 3SEBA 3OWEB 2AQ3B 1PRTB 1V1PA 3BYYB 1KLUD 5TSSA 1EU4A 1LO5D 2NTSA 1KLGD 1QILA 1HTLD 2ICIA 5ELBA 4TSSA 1PRTD 1V1PB 1EEID 1PTOB 1JWSD 1TS5A 1HQRD 2XNAC 3BVMA 3BVGA 2TSSA 4RGNA 1EU3A 3GP7A 1TY2A 1B1ZA 1F77A 2RDHA 1PTOD 1EWCA 3BYTB 1YN3A 3CHBD 5ELCA 1AW7A 1BXTA 1CQVA 1SE2A 1I4XA 1SE4A 3MC0B 1LTSD 2R61A 2WV6D 4RCOA 1GOZA 5I4DA 1FNVA 1CHPD 4Z9CB 1JR0D 1I4RA 1PZKD 1RD9D 1BCPF 3W2DA 4K6LA 1S5DD 1EEFD 1XTCD 1JCKB 5D3DA 4DXGA 1EFID 1RCVD 1S5CD 3MFGA 5ELEA 1I4HA 4NZLB 1UUPA 1ESFA 2QEJC 1SEBD 1AN8A 1D5ZC 3O13A 1SBBB 3KLSX 2XRSD 1ENFA 1BCPC 4RFBA 5ELDA 4RGTA 1I4PA 1LTAD 1MD2D 1B44D 2J4XA 1LTTD 3TSSA 1S5ED 2CHBD 1FNUA 1FD7D 1D5XC 4UDUC 3URYA 3R8BA 1TS3A 1TY0A 1SJED 3DWAA 1UNSA 5D3IB 1PZID 1CK1A 1ET9A 1S5FD 1CHQD 5FK9C 1D5MC 3R2TA 1CT1D 4RGMA 2NTTA 3V05A 1LT4D 1PRTF 1DJRD 1HXYD 1XXGA 1TS2A 1V1OA 1L0YB 1L0XB 1LLRD 4RHRA 1LTBD 2AQ1B 3BVZA 3EFXD 4RGOS 1BCPB 1PTOF 1KTKA 4RHSA 5ELFA 4L6TB 4DXFA 2AQ2B 2IJ0A 2O2LD 4ZYSA 1SXTA 1I4QA 3R2IA 1BCPD 1HA5A 1DYQA 1LTID 1SE3A 1PRTC 1LT3D 1PZJD 2XRQD 1PYWD 2SEBD 1YN5A 1M4VA 1JWUD 1FGBD 1LT6D 1LTGD 4L63B 1JQYD 1RDPD 4C56C 1PTOC 1YN4A 3DWQA 4OHJA 1TS4A 1ET6A 2G9HD 1I4GA 2QILA 1LT5D 1SJHD 1RF2D 4RH6A 1T5XD 1STEA 1PTOH
chains in the Genus database with same CATH superfamily
3HOZB 2L76A 3W9CB 3BZDB 3MC9A 2KANA 2EJMA 3TEHB 1H9KA 2XN9C 3GTKH 2R3ZA 3D31A 2MBOA 4PQXA 4DV5L 4IFDI 2REXA 4OVZA 1RYJA 4BKTA 3AYHB 1SN8A 2W55A 2DLBA 3DXJC 3R3MA 5CHFA 1V81A 1PDQA 3DQVA 3L3OC 3DDCB 3LX0A 2LRUA 1EWHA 4X64Q 4IFDJ 5K36H 1K3RA 4WURA 5ELBA 2MEKA 3W5VB 1TXYA 4FXDA 1I50B 4ZRQA 3AXCA 2V1CC 3B6YA 1K0SA 4A4IA 3ULJA 4DR2L 1UELA 3KUCB 1I5FA 4AYBB 4ZK9B 4B3MQ 2IO0B 3UIOB 4DK0A 2RDHA 1Q8IA 1E2ZA 3Q69A 1YHAA 3CHBD 4CKEA 3AH7A 4MM3A 3RZFA 2F4IA 1HNXL 1BQQT 1BT0A 2NVQB 4KY7A 1WTVA 1LTSD 2X69A 4KVGB 4DV5Q 1GC7A 2H89B 1FNVA 2PZWA 1WZ3A 3SFDB 5FR6A 1P3QU 1NCVA 1WGDA 1XLOA 1PZKD 3E9SA 2XGTA 4DV7L 2MUYA 1FIQA 3RZOH 2AX5A 3LWEA 4KTAA 3GTJH 1XPUA 2FUHB 1NSNS 2UUAL 3A55A 3NS8A 4WJQA 1XMQQ 4HDOA 4FXGC 1RM6C 3F2BA 3L0OA 1YX5B 4GN4B 2G1EA 2I5HA 4Y7NB 4CHKA 2F0OA 1FXTB 4NZLB 3BDLA 4M8NA 1E7VA 4FHKA 4MTKA 3GV3A 4DNTB 1ESFA 1JE4A 2CJOA 1WX7A 4IALA 1K8RB 4R4OA 2B2VC 5LL6S 3A54A 1YX6B 4EOYA 3NTHA 3KLSX 2N55A 1R4MB 3RPFC 3QB3A 4R9WA 3ZJYC 2K22A 1LM0A 2Q2HA 1PGBA 4N6EB 3CIRB 2LD9A 2LWPA 1PDXA 4MIUA 2HIXA 3CWIA 4HMJA 3FP9A 4OIJA 1R4NB 1FO4A 4DR3Q 1WTQA 2JZZA 2HQEA 3NP8A 5EJWA 5DPWA 4LF9L 2ENBA 3VHTC 4HWIB 3GTOH 1FVIA 1PZID 3NSWA 4XQQA 1DONA 2KWCA 4MH8A 2D3BA 4YWMA 3ONAB 1D5MC 1IXRA 2A4ZA 3PS6A 2MQHA 4GNXA 1DD2A 1XCQL 5CMDA 2BW2A 4WWMA 4KGTA 3H1UA 1L0YB 4HEA1 4ZKCB 2I5MX 4QF4A 5I6YA 3BVZA 3L2PA 1HNWL 2L12A 5ELOA 4ZRJA 1BBXC 4KKIA 5C4JB 5E6NA 3Q3NC 2CKHB 4R4TA 4Q5VA 1SNPA 2MHVA 4ZYSA 2O4XA 5I9PA 1I4QA 2HIVA 3AE7B 4GN3B 2CHXA 3NHEB 3WALA 2E76C 2GMIC 1NR4A 2F4VL 3BIID 1JWUD 1LTGD 2K5PA 5FOBB 5EE9A 4HVBA 1LV9A 1XNRL 2KAJA 2V9HA 3L10B 1RL2A 4ACFA 2GVAA 2EYMA 3AN1A 5CV6A 1E24A 1V49A 4PG3A 1WJUA 3APFA 3UE0A 2H4OA 1BBWA 1SJHD 3R7QA 3VUYA 3V61A 2PNRC 3LXFA 3M3YB 3T4AC 1IHZA 4MH0E 4MZ9A 1TWFH 3U9SA 4DV1L 1P1AA 4DK6C 2IY5B 3AEAB 4A9AA 5J3BA 2IPKD 2N3SA 3K80C 4HIDA 3S16B 3M4PA 2N88A 3STBC 1LTRD 3E56A 1BKBA 4WJWA 4JQWC 1FNWA 4JC0A 4EQPA 1AFPA 1Z5SB 5IGFA 4ABNA 2Q2TA 2F4VQ 4K5WA 1OFFA 1RLFA 2A5UA 2BS2B 4K3CA 3TP5A 5TSSA 2WXMA 3I72A 2C60A 4CDCC 1C9FA 4TSSA 1XNRQ 2QCPX 1A6XA 1TS5A 1PH4A 3C2PA 3QK0A 1WFQA 4IJHA 2E8GA 2Y0SG 2K28A 2AL3A 1PFSA 1QUQA 2I2YA 4PYZA 1A8VA 2GLSA 5EKKA 4S17A 3ENEA 2A74C 2NUCA 1YHBA 4QUCA 1CQVA 4ULLA 3SK4A 1WWTA 1QVCA 2IWHA 1DOIA 3HHMA 5M3FB 2ZJPA 4K0KQ 2NMQA 2B8FA 3M4OB 1HA6A 2JZ3B 4BBNF 3UI2A 5FR3A 3PZDA 4O0AA 4EKUA 2M17A 1Q90A 4CBVA 5C6AA 4DHZE 3RLNA 1Y14B 1A15A 5IAAC 3GD7A 1HZ5A 3IKJA 4LW1A 1PH9A 1JJGA 2M0AA 3WAMA 1GUAB 3RNAC 1EUVB 2JK8A 4CDDC 5M5XB 5C4XB 5M9OA 3AFQA 1S5CD 2KHWB 4JOIA 4WJOA 4LF4Q 1QOBA 2A73B 5M3MH 1UUPA 1Y1VB 1MFWA 4NJ6A 4OZCA 1SEBD 2K8HA 1FCCC 1D5ZC 3A5ZB 5EPKA 1PHJA 3DBHI 3OTOL 3TEYA 2HTHA 3TIXA 2JT4B 1LTTD 5C3EB 2O6VA 3H91A 1RTNA 5M5WH 5EKLA 4POGA 2KVZA 2F52A 2OOBB 1Z47A 1UEBA 2IT1A 2K1BA 4YTPB 2MGSA 1L0WA 4B6WA 2UXBQ 4BBSH 5C1ZA 1TR5A 1NJIC 1DJRD 1HXYD 2YTVA 1MPEA 2AWTA 1VQBA 3FKYA 5JXVA 1JB7A 2RD0A 3AE6B 4FNFA 5IYCH 3UIPB 4IM2A 2WAQB 1B9NA 4OWXB 1KC8C 4FA6A 2O2LD 1EY5A 1MSGA 3LDZE 2NVTH 3U50C 1SE3A 3MTSA 1MJCA 2XRQD 4YIJA 2K5DA 4A3DG 4ZYNA 2JF5A 4GIVA 1I94Q 4P16A 3BDOA 4PZ8A 3ZDMC 1KDAA 5DPTA 5CYUA 3K7AH 3I55A 3L16A 2JRHA 2Q8TA 3PO3H 1SYCA 1G2SA 3NVWA 3EHVA 5IT9L 4JYAL 5NUCA 3GTKB 2BBCA 5D14A 2KD0A 3QWNA 1N5XA 3J7AV 4LDTD 1LUZA 5BMIA 3M3JA 4GKJQ 2A8VA 1STEA 3AFPA 4I7AA 1SDFA 1OXSC 2E6XA 1VQ7A 3Q6BA 5C0XI 2DJGC 2MBQA 3CKIB 4W9CA 4LFAL 2QMTA 2RPQA 3IVFA 2HT1A 2HDMA 4BBRG 4ZDVA 3PUWA 5IA7A 3SHLA 1WY8A 5C0XJ 1PLFA 2RA4A 2IZVB 2ONQA 3P42A 4LJPB 2WDRB 1HEZE 4A3FG 4EFOA 1WI0A 2FE8A 3IL8A 4AYBE 1SFOB 3GB1A 1TWAB 4GDKA 4JLCA 2YV5A 3DBHB 1R4PB 4FXCA 1PH2A 2TSSA 2FHTA 5GAHC 2JEBI 3G71A 1XEEA 2NZOA 3K6OA 2F3WA 2DJFC 2MP2A 2CHWA 3W3AA 4USAA 3I4OA 2VB2X 1YIWA 3N32A 3GV6A 1YOVB 3UQAA 1K83H 2KVRA 3I4LA 3VR3A 4OX9Q 2R92G 4DWFA 1EUJA 1YNXA 1I4RA 3X3MA 3GTQH 3RNBC 1D7QA 1RD9D 3E3XA 5J22A 1HZCA 3EECA 2RQXA 4EUTA 1SYBA 1WVLA 4HCNB 3PUYA 1JWBD 1HZ6A 2WDQB 2K8BA 1X55A 1IGCA 2L3ZA 2SDFA 5C4HA 4IOAA 2QDFA 1F9QA 1P7EA 3SK8A 1XQQA 3J81j 3PUZA 1EY9A 1T0YA 2ID0A 1ZUD2 2NPTA 2DNCA 2F0PA 2M2LA 1ICFB 4GOPC 2EOTA 1A63A 2HCCA 5DAUA 5ELDA 2PJHA 2D0OA 4FO2A 4CDFC 2QF7A 5G3LF 1S5ED 2CHBD 4H7BA 1HNZL 2EYJA 2LGIA 4EZKA 5T1IA 2DYBA 4AOFA 2MH7A 3CPWA 2ZXRA 5TR5A 4DGZA 1STAA 1C4PA 4DAYA 4HPLB 1WMHB 5EE3A 4JPBW 5J17A 4M1UB 1SNCA 2K5HA 2F0MA 1C0AA 4OONA 1CFMA 2F0NA 4X3KA 5I2XA 2ZVNA 3AULA 5FO7B 1YBYA 5E6JA 1N8RC 1B2TA 5JJIA 1PRTF 2B2TC 4BA1I 1XLQA 4LF7L 1I7HA 3KW5B 1IGDA 4C00A 5C3JB 4QIWB 3TZUA 3OJ4B 2WXLA 3FC4A 1HNZQ 4RA8A 3K7UC 3A74A 4DXFA 2L1AA 2CR5A 3KF8B 4RWSC 3T3NA 4KGRA 3TS2A 2WIIB 3AB9A 3TP7A 1E7UA 2AEHA 2C7HA 4IOIE 2F0WA 4JPSA 3MXGA 2IGHA 3AE3B 2HD3A 4OW0A 2LEKA 3FVQA 1M4VA 2GI9A 2KJXA 4KIKA 2CH4W 2SOBA 4DV6Q 1AARA 4LDTB 4O42A 1SE9A 1TS4A 4EGVA 2JXTA 3H8HA 2N49A 4IUMB 1QOAA 3VR8B 3RD4A 2G9HD 4LF7Q 1EYDA 1LT5D 3HVDA 2PVGC 1UWVA 3KF6A 5G3LD 4ICUA 1UE7A 2VQEL 2I5LX 4BKGA 4BWGB 3P2BA 4H02A 2N0SB 3ZQ4A 2NBUA 1EWIA 2WS3B 2L52A 2N9EB 1CZGA 4A3JG 4K1RB 2AUJD 1KM7A 2Y5CA 2BOSA 2NBVB 2FIFA 5CORA 2AQ3B 3D4RA 3CW2C 1Q5WB 3UF8A 4K7SA 3HUIA 3VH4B 1PMRA 1YQ3B 2K04A 3J7YW 2MX2A 3NUCA 1PRTD 1PH7A 2WXJA 3C8YA 2VZKD 1VZ8A 4E6IA 1I3QH 5IN7A 1F77A 1U0LA 2GA4B 1X3EA 3KJOA 4HRSA 4ZRKA 4WAAA 1VQJA 1WIAA 4IPCA 4X62Q 3MXPA 4K5VA 1VS0A 4C1NK 2AHOB 4FHJA 2GRIA 3AE8B 1GOZA 1QNUA 3AI5A 1H9SA 4ASWC 3P1HA 2KX0A 3GQBA 3L7ZC 1HTQA 4JV5L 2JYEA 1RWSA 1KLVA 4UP9A 1OXUA 5FLXc 4QGUA 3TRZA 3BY4B 3IFDA 5J2RA 4LF6L 2CJNA 2WXRA 3C0RB 4QMGA 3Q3MC 1H8CA 2J7ZA 4NY0A 1MGSA 2K5WA 1HUMA 1TBEA 2B2WA 4BY1G 1SIJA 4NXNQ 4LFBL 1CKOA 2JA6G 5JEAG 1AWDA 4BKSA 3S14H 1E6EB 3NY5A 3A9KA 4B0MA 4LF8Q 2V0GA 1WR6E 2OT2A 4R4IA 3FILB 3P4RB 1SYFA 2R93B 3MHBA 1SNOA 5KEEA 1FPYA 1GC6A 1LTAD 4HJGE 1YNJC 2Y3AA 2C5CA 4JWUC 2DZKA 4KHPL 1AH9A 5KNDA 3MHSD 4R3DA 1STHA 1FCLA 1JC7A 3I4NB 3J7AF 3S2HB 2INDC 4BBSB 1TWHB 3QC8B 2NVXH 4JV5Q 2MJ3A 3CXCA 1OGWA 4IUVA 3NQIA 1TKGA 3L0WB 4LF6Q 2BYEA 2LGYA 4A3MB 1F9PA 3DWMA 3R2TA 2F0TA 5CV9A 4EE2A 5L37A 2VL6A 4LFBQ 1B50A 2A6HD 1UE6A 3CAMA 1YNNC 2WAQE 2JSOA 4CJ0B 1ISNA 1SLJA 2LMCB 1UZXB 2Q2IA 1QG7A 3SR1A 4GXBA 1EYAA 2J0TD 4A3DH 2ZW1A 3DWGC 3B08A 5ISRA 4PS3A 1G2TA 2TMPA 1HPCA 1SXTA 1X6OA 2Z6KC 4NQKE 1IBKL 4HCSA 3OPOA 1HR0L 3PO3B 1TJEA 1UF0A 2C5LC 3VH3B 3RZDH 1TGZB 4HMIA 4HJ5A 1PYWD 3I90A 1PGXA 2F1MA 1A3UA 4JK1C 4HCPB 1OTRB 3KYDD 3ZO5B 3H09A 2JA7H 2KLGA 5F2DA 1WXMA 2JYTA 4LWCA 1B70B 2VW9A 3CF6E 3VR4A 1MHXA 2JEAI 3AE1B 1JQ4A 4EQOA 4QUFA 1NTGA 1NAPA 2A68C 3ZRCA 3ZJUA 5BMHA 3HOXH 4DDID 4U68A 1JICA 3CQZH 2CCZA 3S1QH 2BF8B 2NCNA 4W9DA 3V62A 1YQ4B 4R1JA 4DAVA 1EIHA 3FDTA 1TT5B 5IP9G 4HR7B 1VDZA 5AJ3Q 1YJ9A 4R4QA 2C9WB 3HK0A 1BF4A 1JW9D 4QQBX 2FIDA 3NVYA 3HOVG 2MW5A 4P71A 1V1QA 1PRTB 2EY1A 2FCNA 3K8AA 4N59A 2VZKB 2QKIC 3H3VC 1F9SA 4OIKA 2JA5H 3E0JA 4PK1A 2WX0A 2ZCBA 3M4QA 1JWSD 1EF1A 1IBXB 4IC7B 1X3FA 4YCWA 3NVZA 5C3XA 3I63C 4N9TA 2L11A 2SNSA 2ZZPB 1C4QA 3H3VH 4XQJA 1FM0D 4G3XB 3GTQB 2R92H 1NE3A 1SE2A 1EQQA 1I4XA 1O7IA 4LFCL 2K03A 5JAVA 1KXLA 1WCMB 2WKCA 1N36L 4B3SL 2UXDL 4KHZA 1RRBA 2J52A 3EUB2 3VXWA 3A8KE 1J8CA 1VQ9A 2KWUB 1SMYC 2UUBL 1T9HA 1XTDA 2EE1A 1ZXTA 3R93A 3A33B 4HJ9A 4Q2JA 1NBWA 3NXWA 5E1FA 3UDFA 3P4PB 3CU7A 4ANVA 3ZXRA 3PLVA 3Q8AA 4KKTA 1S5DD 3SFEB 3SE0A 1ZDXA 3QR8A 4JI1L 2K6AA 3IBEA 3OLMD 1UH6A 2D3GA 2JSVX 3NS1A 4GDLA 4EZJA 1MIUA 1EYGA 3HOYG 1AN8A 1IUEA 1SMXA 1W6JA 1SBBB 5J39A 2B63H 1HE8A 1KRHA 3HFZB 5EBDA 3CRLC 4UY8C 4WWNA 2IO2B 4NMZA 1I4PA 5GAGC 3Q6SA 3A5UA 5CHWA 1IW7C 4F1SA 1IBML 1T0RC 1UWXA 1FNUA 1FD7D 2AWNA 4DV0L 1QKZA 4JI0L 1U4RA 1LTLA 1PFBA 4I7ZC 2UUBQ 2QSDA 1YNJD 3ZW3A 3MAQA 2Q8RE 5E4XA 1N6ZA 1L1OA 1XNQQ 1Q46A 1RJTA 3I56A 2EVBA 4JL9A 5CX3A 1AP0A 1V6EA 1VRAB 2PCFB 1TIID 2B8GA 1YIJA 2RCNA 3PQIA 2X6GA 2UU9L 2JXMB 4GZYC 4HROA 2C9OA 1V8QA 1KHIA 2KEDA 2D2QA 5LNK1 1EOTA 4YCVA 1Y8NB 2K1FA 2K6QA 1H9RA 5E4WC 2WHIA 1J7BA 2AQ1B 2PE9A 1Q1BA 2ZW0A 3H9DA 3U9OA 5EE1A 2INPE 5LMNQ 4KY6A 3RNUA 3NBHA 5A2QE 2EZVA 4A3KG 1JRPA 2BB5A 1FL0A 3RUZA 1JE5A 1B3AA 3VDYA 1XPOA 1J19A 1MG8A 2FAZA 5DCNA 1LYLA 5J18A 4ID6A 3VAWA 2YU9B 2O5IC 3A1QB 1RDPD 4OVUA 1GUTA 3IAYA 3MA2B 1V5TA 4DUZQ 1BO0A 1J7CA 4YSZB 4OO1G 5EAYA 2LHDA 2N9LA 3ZGZA 4P2CB 1LABA 1O7ZA 1RF2D 2C35B 1K8OA 2RDFA 4A3JH 1DOMA 2JN4A 4MEMA 1V80A 2VQFL 5ELNA 1RHPA 4I6PA 2Y0SB 1KABA 1NR2A 3GO5A 3NENA 2W3RA 3N30A 3GTPB 2JX5A 2PEAA 4KN4C 3TL5A 2HTME 1D6EC 1X32A 1V1PA 3S1MB 3EFUA 3PO2G 2MLBA 2HD5B 2BYTA 3LJ3A 1VMPA 2NR2A 4RGNA 1PA6A 4IKGA 1QWYA 4MGYE 4N8FA 3OG5A 4DR1L 4BS9A 4MACA 3TJPA 3Q8DA 1TWCH 1XO3A 2Z9HA 1KJTA 4ODGA 2ZNVC 4GLSC 4FADA 2NZHA 2F0KA 2VQFQ 2KWDA 2INCC 3U4VA 3QQ8B 2R61A 4RKBA 4JI4L 2VUMH 1K53A 2WV6D 4C3HB 2B3AA 3KWVA 3OAWA 4CDEC 3T9LA 1EIYB 3N52A 2E5LL 4L8JA 1R9TH 2PPBC 2IL8A 2ZEQA 1E0BA 4BY1H 3S14B 5G2NA 5LLIA 4K6LA 1EY7A 2RGFA 2JA6H 5JEAH 3I73A 1KRTA 3CP0A 3KQ4A 3GE3C 3SD5A 4EEWA 3D4DA 5ELEA 5CV5A 1EY6A 1S1QB 4O2DA 2MA9B 1ILQA 4ZLTF 2LJ5A 2M1MA 4DA2A 3FEWX 5CV4A 4IDIA 4DR1Q 3ICEA 1Y56A 2E3TA 3H3VI 1XLPA 2KCMA 2A69D 3RN9C 4WH4A 1BCPC 3S9WA 1STYA 1F2LA 5DPRA 4JI4Q 4M0WA 1EYCA 3RNEC 5JZEB 1B53A 1NEKB 2E5LQ 2YYZA 4XGAB 4J15A 1J5EL 2PVOD 4KLKA 1V9PA 2JA8G 2FINB 3U4EG 2MP1A 5AZGA 1XD3B 1HZBA 3TN2A 1F9RA 5FO9B 3DLLA 2O2VB 2R2QA 5IYBG 3G6EA 3FKIG 4DR2Q 4DV4L 5IO9A 1YI2A 1LQBA 5KGUA 1OQQA 1TS2A 4G50A 4PNYA 2MQJA 3NBIA 4EZLA 3RLOA 1KRSA 2PLPA 3DBRI 3N1ZC 2OF1A 3VTUA 2FCSA 3RN5A 2OJWA 3U2SC 1Z2MA 4PZ6A 4R8IA 1KTKA 1HNXQ 1QVFA 1CKMA 2H1EA 1RFAA 3NHHA 3AEEB 1CSQA 3QIAA 4AUQC 2KACA 2FNJB 2CH4A 1LTID 2K3UA 1LT3D 5IP4D 2SEBD 4DV7Q 4B3RL 3SXHA 1ZYRC 1FGBD 4A3BG 3KH0A 3U52E 3F8TA 2KX3A 1JQYD 2UUAQ 2WXNA 2FXQA 4BBRB 4YWLA 3DWQA 1OXXK 4WJ3M 4APVA 2WB1G 4DV4Q 4XWWA 1YMHE 4A3FB 4A6QA 5IP9H 4X65L 2BYVE 4B0EA 4W9KA 4PS7A 4HN7A 2PTLA 2IX1A 3AECB 4OEMB 3M85A 4ZRPA 1M94A 2F0UA 1JWMD 4DK1A 5LHY1 2UUCL 3HOVH 1F2MA 4BY7H 4MJSB 5KHQA 2DNEA 1XLNA 4FF3A 5DPSA 4X57B 3PRPB 1BNZA 2BA0A 1E3PA 4UP8A 2V3PA 1E1TA 2LGXA 4LF9Q 2Y5BB 1EU4A 3VYRA 1H95A 2R92B 3DEPA 3BK1A 4N9F4 3QOLA 3BVMA 4WAFA 2GN5A 5CBEE 2CW0C 2WGSA 1VCIA 3ETRA 2KECA 2K75A 3S24A 2B2WC 3CCUA 3RN2A 2NN6H 3HKZG 1W2BA 2D3CA 4DHJD 2UUCQ 1Q82C 4AWJA 4CQNA 2HUGA 5KIXA 4A3CH 1HNWQ 1FFVA 3AB5A 2L8JA 1M8AA 4UHVA 4TKNA 2ZM6L 5JJZA 5KYLA 2L05A 1II3A 4JW0A 3JSVB 3W2DA 1JT8A 2YVCA 2KC2A 3HOYH 3DBRB 1S40A 1KD1C 1I4HA 4US9A 2KDFB 3S17B 5IE8A 4LJOB 3KUPA 4A3IG 2FJ2A 4TVAB 4I6LB 3D0FA 2RVLA 4JG2A 3J80L 1JWAD 3SHQA 1X9NA 4X66L 2X38A 1ACCA 3EQLC 1MG4A 4WJPA 2L0FA 3LYYA 3W1SA 2DNFA 4DV1Q 1N63A 4MSMB 2J4XA 4JI8L 2X6LA 4GKKL 2K5NA 1SAPA 4YWKA 1WGYA 3L4PA 5KHOA 1D5XC 1M1KC 4UDUC 1UBIA 2WWZA 3CC7A 2KTRB 2F0GA 2DZIA 3PIPA 3S1NH 1SJED 3T53B 3H0GG 1HZ9A 2ZT9C 4FF1A 3E9HA 3JAML 1HHVA 3PLUA 3ZDTA 1ET9A 3AM9A 1EM7A 1GUOA 1G291 2A1AA 1GB4A 2LVPA 1EZ8A 1E5WA 4L2YA 3KDFB 2FCMA 4A90A 3K9OB 2EYOA 3VDZA 3P75A 4PMCA 4ZQ3A 1PUTA 1VCBA 3AEDB 1ZEQX 4R4CA 4HLEA 4FF4A 4GKKQ 4JBMA 4A3KH 3ZJTA 3MVVA 4P73A 5FLMH 3PRMB 3RUIB 1AE2A 2WDVB 1TTNA 4DBGA 4US8A 2BKFA 3I70A 3QWZB 1KOTA 4G7OC 2D5DA 4KN7C 4J3OD 4C3IG 2N9KA 3OOCA 2K5VA 1WXQA 2JQOA 3T3OA 5AFWA 1N9WA 4OO1H 2D10A 3CSFA 1ZXIA 4ARIA 2Q8IB 2MBEA 4A3JB 5HHDG 3D32A 1YNTE 4ME5A 1KIXA 1SSOA 3GOEA 1EQRA 1JRUA 1NYRA 4FXKC 3PVLA 3W5OA 4OZAA 5T8IA 4K14A 3T1YL 1DGJA 2Y0SE 3HOUB 3AE2B 4JE3B 3NUHB 1K3BC 2KQ3A 1T5XD 1ESRA 1QCBD 2B2YA 3OTOQ 4NB3A 2LFIA 2D62A 1PH8A 5AZFA 2ALYB 1S72A 3JSVA 2MBHA 3ULLA 3AEVA 1I42A 4GLXA 2PE6B 3PO2H 2R2OA 1QB5D 1IL8A 2JWUA 3M7GA 3HOWG 5KYIA 3IT6B 3PGZA 3TS0A 1SR3A 3CRKC 4IUUA 3CMMB 1NUCA 3C1EA 4TRDA 3NRZA 3BYYB 4YSYB 3G7LA 1Z9FA 2NTSA 2L7RA 5BO4B 1CSPA 1MHHE 1RKNA 2KDBA 3J81L 4ANWA 2MJ8A 2Z59B 4W9GA 1IBLL 2MWSB 3Q23A 2PI2E 4YCUA 3T1YQ 4K81A 2JU6X 4DHJB 2JA7G 2LGSA 1GHJA 4AQ7A 3E9IA 2JVCA 3DBLI 4OGQC 4WQOB 1E9MA 5IYDG 1AW7A 2KCNA 2FBWB 1WE7A 3MC0B 1WTOA 2B2UA 2JA6B 1WD0A 4RCOA 1G6ZA 1ILPA 3HOXG 2NBWB 4CJ2C 1KF6B 1CJEA 2CVRA 1WF9A 2D11A 4B08A 2F0EA 5D65A 1STGA 4JI5L 2BPSA 2IGDA 1ZKOA 5IY0A 4QB4A 1L6VA 5GMVA 4CKCA 1MI0A 2GBMA 2R7ZG 1TIFA 3CMAA 2MO1A 1YJNA 3PREA 4FJYA 4DF7A 3STBD 4DR6L 1J7AA 1L1OC 3P4SB 4REZA 3KYHC 2L83A 1T5EA 3PIOA 1O7LA 1IBLQ 1J9OA 1VQIA 3N6RA 1WX9A 4W9LA 4JYAQ 1KL9A 2OXPA 2RHQB 3GE8C 2JA5G 2WP9B 3O13A 3MWYW 3DVGX 5HFYA 2RR9A 3FMCA 1X56A 3J9CA 2LJIA 1B44D 3MJ5A 1WOCA 2LY7A 2JA8H 3RZOB 3GTJB 2MCNB 3VFKA 1CM9A 3BG3A 4NW2A 2EKIA 3PT2B 4LFAQ 4NXML 4WQMA 4MGIE 3VRBB 1TS3A 5C5LA 4HXDA 5L95C 4N8X1 1UNSA 3AE5B 1JJ2A 1BBUA 3WIMA 5IYBH 3FKIH 4P75A 4P74A 1VF7A 1VF5C 1GUGA 3NJTA 1RODA 3U58A 4M8MA 1Y1WG 1E8YA 4I6NB 4MELA 2F3VA 3PPAA 1KNAA 2NVYH 4ME3A 1Q81C 1PGAA 4ZHOA 3ALBA 2UXCL 3A8JE 1X3GA 2K14A 2KUMA 1P8LA 3QOJA 1L2FA 4IOCA 4XX5A 2KK8A 2M56B 4IURA 2RBMA 4EX5A 1WD1A 2B63G 3GTOB 2LVOA 1WTXA 4A3BH 3R2IA 4LNFA 4H13C 1I6HH 2XWJB 3RZWC 5KNBA 4ZAIA 5JJKA 2EQSA 1YN5A 1ONLA 1F52A 4L63B 2EYHA 5BYSA 3DBLB 3ERQA 1PTOC 2R7FA 2F0FA 5BR8L 1QE6A 4OHJA 4XT3B 4CJ1B 2UYZB 2IYDB 1WSPA 2I1JA 3RR5A 3CC2A 3EFCA 1VZ7A 2UXCQ 4OZBA 4XDXA 5IP7H 1PTOH 4XQNA 2NWGA 4YTMB 4NJ7A 3MXUA 4HJ7A 1EIGA 2V3SA 4DQOC 3TREA 2BS3B 4TQ1A 3C46A 2NS5A 1V86A 2RMMA 5I2YA 3DWPA 3ABVB 3ZTCA 2Z8LA 3D4WA 4LNQA 2WXPA 2YEPF 3D3RA 5HURA 4AJWA 4AIMA 4ZRZA 3AU4A 1GB1A 1NI3A 4OO1I 3KYCD 3OJ3A 5CR3A 4XIGS 3GZNI 1LO5D 1QILA 3S2DH 3SVMA 2OTJA 1BVSA 2KDMA 2KDIA 4IWOA 4C3JG 1TWFB 2XNAC 2JA9A 1K50A 1LM8B 1OEYJ 4A3EG 1GKHA 1DOXA 1K8AC 3M63B 3VRAB 5FLXE 4HPPA 1R7SA 1ZP0B 2EIFA 1FGUA 2VNUD 1JOKA 5E6OA 5JHAA 1IKLA 4BOZB 1K8MA 1TVXA 4IUNA 4JIOU 1I6VC 1MBYA 5T1GA 4DR5L 5EBCA 2LXKA 1UD7A 2FMMA 2DWQA 5GADC 2IY1B 4G11A 3DPDA 3KOJA 1EEFD 1KDBA 4A3IH 2RPVA 4J6IA 2QIEB 4H2AA 1WX8A 3PV0A 4DXGA 1GUNA 3DVGY 5C3EG 4W9IA 1N34L 2GOWA 1VLBA 3IG3A 5BN5A 1ZDVA 4PMBA 4EQNA 1WYDA 2VH1A 1CKNB 1TWGH 3S1NB 3QAQA 1GNUA 4NKLA 2VQEQ 4RGTA 4JI6L 2JY6A 4NQLB 2LS01 2K33A 3J7A5 1GJZA 2L0CA 2A5HA 3H0GH 1LACA 5DLQE 1WMHA 2JYOA 3I2ZA 2L9HA 3GTLH 4HDQA 3FAHA 3L13A 2B29A 1F2RC 3PHXB 5M3MB 3P4QB 2VUMG 2KJHB 3QJYA 4YT0B 4BFRA 4KZCA 5H92C 4WWPA 4OWWB 4E3CA 3ND8A 3RULA 1CT1D 4FJZA 2NTTA 1H9JA 4IJLA 4L5RC 5IIFA 3EJIA 3UDXA 4H44C 3R66C 3DBSA 2ZXPA 1V1OA 2XVSA 4RM8A 5IGDA 4RHRA 1WYWB 4GNXC 1MI2A 3KF8A 1EY8A 1WJJA 3KBGA 3W1BA 4JI6Q 3EFXD 2J7QB 5M5WB 1V43A 2MSED 3P20A 4C3IH 3V2TA 4M01A 2EXDA 3F2CA 2UWQA 3WA0A 3DCGA 4KKUA 2K9XA 2EY5A 2Z0EB 5BMGA 3MEHA 5IOCA 1IPGA 4YSXB 3LNNA 2G45B 1BUVT 2L15A 1DYQA 3H94A 1OTCA 2KYWA 5JPNC 3TUOA 1PQSA 5I6WA 1LT6D 5IOIA 1NY4A 4WFN3 2OTLA 1HZAA 1D4BA 2AKWB 5CBAE 3QX1A 4RMFA 1AZPA 1YJJA 3K59A 1VR9A 1BDOA 3X0WA 2C7MB 2PW9A 3PO2B 1I4GA 3DHIC 1MSHA 4GN1A 4KJNA 3EBEA 2NVTB 4GLVB 4LUZA 4RGOS 2KDEB 1I50H 3RT3B 4HSPA 5I9OA 1E7PB 1SROA 1E2VA 3HOWH 4FF2A 4B3TL 2RDGA 2I0QA 3C1FA 1C9OA 4RG1A 3M4YA 4POFA 4KHPQ 3Q3OC 1D1KA 1E22A 3K7AB 4KK7A 1VQOA 1K9MC 3DHGC 4NJCA 1S5BD 1Y8RC 3OWEB 2MO0A 1QZHA 2NVQH 5LXIB 1E10A 1BUIC 2ZTDA 1FRRA 1T6BX 2LXAA 1F2YA 3I3TB 1FJGL 4WJNA 1EEID 2G4SA 5G5GA 4NPNA 4AP4C 2N9PC 5IYDH 1NNXA 3E6ZX 1J8IA 1WRIA 4AQYL 2ZTEA 1ZOYB 3CF5A 3ER0A 5LXHA 1JORA 2KFKB 2PZUA 4Y7NH 2WXKA 1BXTA 4LUOA 1VQ5A 2Z6BA 2F0HA 1IYUA 2BS4B 1ENCA 4KHVA 2A6EC 2K39A 3A9JB 3QA8A 1S3OA 4FDBA 3W1SC 2RSUA 2R7ZH 3TBIB 3E0EA 3CCRA 1IBKQ 1HR0Q 2KFJA 1S4ZA 4BY7G 2KHSA 3KLSA 4FYDA 2A19A 4L1BA 3I91A 1Y8OB 2F0QA 2M19A 2B3GA 2EDGA 4JI7L 5LMNW 2WXHA 4II2B 3UGBB 1FD6A 2SNMA 3WCQA 4ILWA 3OW2A 4C7ZA 1FJGQ 1V97A 3W1YA 3MFGA 2ZVOA 2LRWA 4AS1A 3B9JA 2QA4A 5KNCA 2JA8B 2DZMA 3FILA 4F8MA 4AQYQ 1OEYA 3PUVA 2IX0A 5FJ8H 4PZ7A 1K83B 3SK6A 1KFYB 3L08A 3LGJA 2WYQA 2YEPB 4JOIC 4IO9A 1E8WA 4G0NB 2LSSA 4LAAA 2CU1A 4FLHA 2EPBA 5C44G 1VQNA 1U5KA 1GUSA 2BA1A 4JBKA 5GROA 1MD2D 1K73C 4NAWB 4MT5A 4PV1C 2KVMA 3M7NA 1CI3M 1JJCB 2PKOA 2NN6G 4XDDA 5DNFA 4XXEA 1VQLA 1EQTA 1WTRA 3RCZA 2F0IA 1PXUA 4A3CG 1QOGA 2F0JA 1JB3A 1Y1WH 1PFNA 4LK1C 2NBFA 3F2UA 1A2TA 5A35A 5FK9C 1CHQD 2K25A 2WU5B 2ZJDA 4LCDE 1VQHA 3ITPA 2LMCA 1YHQA 4GSWA 4QL5A 2OEOA 1DZ1A 2GBNA 4IUQA 2GBKA 4A3BB 3K5MA 1LLRD 1I6HB 3IXSA 4KSKC 1LTBD 2IHEA 3EC8A 4LTUA 4A3GG 2ZXOA 4GOPB 1MVKA 3CSTA 4LFCQ 2WB1B 2I38A 1N36Q 4B3SQ 2B2YC 2UXDQ 3T1HL 4AH6A 2GBJA 2OCEA 3V96A 4A75A 4A76A 3M3YH 3X3NA 2KENA 2PZTA 3V3XA 1PZJD 1TKEA 2XSCA 3HGBA 5KRUA 1T3QA 4CGYB 2G3QB 1WTWA 3PIP3 3E5SA 2KNBA 1X54A 4JI1Q 2PQEA 4DV2L 3S16H 5JJLA 4PMWA 1YN4A 3Q2AC 1C76A 4LK0M 1F2RI 4DAPA 3S2AA 3KLRA 1M90C 2I07B 2M4NA 2QILA 3OIPA 2Z1CA 1NI2A 2DYMA 4A93G 3VR6A 2V4DA 1YJIA 3OW7A 3MXNB 4ZUJA 2D3AA 3EGRA 1SF0A 1IYFA 1YNND 2XK5B 2KLCA 3T1HQ 3K9PB 1IBMQ 2D5GA 3MHZA 4KDLB 1LXDA 4DV0Q 4J1MA 3AMZA 3I7FA 4IN3A 4JI0Q 4F87A 2G9DA 4IM3A 3HKZB 1D8LA 2BCOA 2QGQA 4C3JH 2RSNA 5FLMG 3K0XA 1VQPA 1EFWA 4K7WA 4W9HA 1IBXA 1XMOL 4A3EH 4AJYB 3KUDB 1A2UA 4DV2Q 1WGKA 5D6JB 4YHHL 1PYSB 2F0LA 1YJ1A 1RTOA 5JH5C 4F7XA 4LUVA 1EZ6A 1Y69U 2UU9Q 1N33L 1L4ZB 2LZ6A 3WDNA 3J80E 2DUDA 1L6UA 2KEEA 2SAKA 1IZ6A 2EYPA 1DGSA 4K6DA 4KV6A 1FR3A 4EQ5A 3MFYA 5M5XH 1GJXA 2BGFA 3HIZA 2LVQA 1C77A 1UE5A 3IFTA 2A68D 2WXQA 1JOOA 4DR4L 3Q3FA 4MM3B 2D2CC 2WX1A 3PZ7A 3TMPB 2R6GA 1XF5L 5IGCA 2N4FA 3NVVA 3JAME 3DM3A 1TQOA 4WJ4A 3OYYA 1XMOQ 5C3EH 4N58A 1ML0D 4XDCA 1I3QB 3PGEA 1CZPA 4DV3L 2ICEC 1P7FA 1V2YA 3W5UB 2R93G 4YHHQ 1TYGB 2JRIB 3I57A 3UI3A 3L9AX 4CKBA 3B2FA 5M5YH 3H0GB 4GOPA 2O5JC 1JMLA 3TEWA 3IAM1 2QEJC 3T16A 3ULPA 3VUWA 4H0LC 4WRDA 2ACZB 3GTLB 1F0ZA 3H6MA 4KI0A 1V8CA 2EY6A 4FN2A 2XRSD 2KZRA 2G4DB 3K5LA 3HS0C 3ZNID 4A3MG 2E2HH 1WJ4A 1UAPA 2XEWA 3EN2A 5CGKA 4PT5A 4DR4Q 1WM2A 2JXXA 2DBYA 3KUZA 1D3ZA 1TY0A 2K6DB 3V60A 3NTIA 1Q1EA 3L54A 1ZE3D 3DUZA 2Z0SA 3J80c 1VQEA 1XYIA 2ES2A 1Y8PB 2Q5WD 2M00A 3HEJA 5D3IB 4X64L 3ZNGC 1BMLC 1VQAA 2KHJA 1SMYD 2B2TA 2ASBA 1B9RA 4XYCA 2K5QA 3K0YA 2O6VD 2JE6I 1ICWA 3G6JB 3V05A 4B3ML 1HTOA 2RF4A 3F1ZA 1NVID 1T0SC 2V3NA 1U4AA 4FULA 5GQOA 2BWFA 4TQ0A 4GNXB 3JAMc 1C7YA 5JOBA 2XTIA 5HGTA 3K5NA 3H6NA 2NVXB 3ZRFA 5C5MA 2FMCA 4QJFA 2C7NB 3KWLA 4BZAA 3DHHC 5ELFA 4OVVA 1NMGA 1U4MA 5EKIA 2AQ2B 4DAMA 1D2BA 1XX8A 3VTVA 1TT2A 4IPHA 3CCJA 3A1QA 2VS1A 1FXAA 3F2DA 1IW7D 1GO3E 4HJ8A 2KO3A 1GVPA 1X3QA 2E75C 4K2LA 2WQYB 3Q0AA 1KH0A 4BXXG 1XMQL 3J81E 1X3PA 4C56C 1RAXA 2B76B 3LWUA 5DM63 4ZCKA 3HOWB 4FJVB 1SYGA 3HZXA 4HIOA 3A7LA 1ET6A 1STNA 2AL6A 5IT9E 4A3DB 3PF4A 4B95A 4BOSC 3ZYYX 5C4ZA 1SFOH 1TWAH 2R7DA 1SE8A 1GUWA 3RZDB 1G8ZD 4RNAA 4O1NA 3NEMA 5HI1A 4DFAA 4MSQB 3K5OA 4P6VF 2JA7B 2BH2A 1OXVA 4R8NA 2LGDA 4DR3L 5CC4A 1J5EQ 2CKZB 2BQQA 2YTYA 1QLBB 1SYEA 3I4MG 1NENB 2MBBB 1KLGD 1N60A 3HOXB 5JVG3 3ZVVA 2EYLA 3CQZB 3S1QB 2BKRB 2EJFC 1N62A 2DY8A 3IRBA 2QEXA 1HQRD 1E2WA 1WCMG 2GVBA 1F1HA 3BINA 4HJKA 2F0DA 1EU3A 3GP7A 1TY2A 1A3TA 1NDDA 2KMAA 2PI2A 2R7ZB 3D6CA 1FFUA 3D6WA 3ND9A 3BYTB 1NYQA 1YN3A 1W3SA 1YVCA 4MTNA 5EQ0A 1VQMA 1WE6A 2GBRA 4ARCA 3RYTA 1TKWB 3ML9A 5DM73 1QUQB 3QCAA 3J81c 4X3SA 1EWYC 1ZW7A 1Q7YC 2QC8A 5I4DA 2JA5B 1YITA 4HSVA 3U7ZA 4IWPA 1VQDA 5IP7G 3OIQA 1HFNA 2DYOA 5IT9c 1JOQA 3ZUNA 1BCPF 3MP9A 4B3RQ 1AEXA 2N1WA 2RKSA 4MNOA 1ASYA 2DZJA 4FP5D 1AYFA 1E0ZA 1N5WA 4E74A 4NAMA 4HCEA 2KOLA 1J0GA 3NZ3A 5CV7A 5C44H 3C19A 3N9YC 4BBNC 3OMGA 3OSOA 3PTFC 2WACA 1EY0A 1WTHA 4X65Q 1F9JA 3DM1A 3HKSA 4S0RA 1ENFA 2DENB 4RFBA 2RSOA 5C0XH 4QY7A 3VR9B 4M8AA 2EELA 1Y1WB 3TSSA 4NNJB 3VYSA 3JVZX 4FVMA 4LNKA 1E8ZA 3R8BA 2PIAA 3VR2A 1SYDA 1B3QA 3HG9A 1QT9A 3EVQA 2L0TA 3B1LX 1XCTL 2XWBB 2O6VB 4HPMB 2O2VA 4GOCA 4K5XA 2IO3B 2KMCA 2B63B 2NYZD 3Q22A 3J80i 3IFWB 1RFKA 2L55A 2FFKB 3K81C 1P98A 2LKVA 2JPHA 3WAPA 4A3GH 1E7ZA 4F8CB 3PRZA 1CZWA 2WB1E 4HKQA 3WWVA 1VQFA 1IYJB 1C4AA 5IGBA 1MKHA 2Z6KA 3VA7A 4N9PA 5IWAL 5C2TB 1TZ1A 4TQUS 2UU7A 4K0KL 3JAMi 1SNQA 5K5PA 2ZJRA 4YY3L 1BCPD 5A2QL 2CHZA 2JP1A 4DUYL 3QHTA 1ENAA 3V6EB 2ZM6Q 2INNE 3MTNB 4LNOA 2XIWA 1JMCA 1G91A 1ZXHA 1PV4A 1VQKA 2EJGC 4A93H 4LF4L 4L5SA 3IHPC 5HG2A 2H5XA 4JI2L 3NG0A 3FPPA 3APCA 5JEAJ 4MJSA 3PSIA 1SNDA 4HTHA 2N8NA 4HAEA 1AE3A 1B4OA 2K0PA 2N7EA 1ROEA 4X66Q 5IWAQ 4C3JB 2EYFA 3CD6A 3HKZE 3H15A 4ZHPA 3RNFC 1XT9B 3EA6A 4JI8Q 4A3EB 1DOLA 1FXIA 1BR9A 1HTPA 3FPUB 4YY3Q 3FRPB 5J1ZA 2ZPNA 3DVNU 3SDZA 2WXIA 2OEDA 1K28A 4JBWA 5EPJA 4DUYQ 3Q8BA 5COYA 4MDKE 3R7RA 4WORA 1CA5A 1G51A 3UQBA 5HY6A 3NTKA 4KKSA 2E2DC 2KCTA 2NZ1D 4LJZC 2UXBL 1B8AA 2AWOA 3HOZG 2WXOA 4M00A 3BVGA 1G6JA 3ZIMA 1N61A 2J42A 4JI2Q 1ZKHA 4C3HG 5HGQA 1RIPA 4GDKB 1ZYRD 3BDCA 3WOFA 1WZ0A 3SR6A 2WXGA 4RF1A 3GTGH 4DXAB 2L1BA 1O78A 1QOHA 2K7VA 4C1NI 4IPGA 4NP5A 4W9FA 2L00B 5G5HA 4MN3A 2IW3A 5D2MB 1SB3C 4BA2I 1K8GA 3B0AA 2MP2B 1QZEA 2QJLA 5IGGA 4KDIC 1UEAB 3J81i 5M5YB 2R93H 4ICVA 4JWSC 4G57A 1PH6A 4AYBG 1I94L 4YWGG 2KQSA 3ZNZB 2PMVA 4TUUA 4JCVE 3I4NH 1TWCB 1JCKB 2K32A 3A7AB 5D3DA 2LUEA 3S2HH 4KSLC 1TWHH 3A0JA 4G7HC 2N9XA 2E2HB 4DN4M 3BS1A 2MJDA 2VUMB 3VYTA 4A3MH 3CCEA 2VRRB 1WGGA 4GKJL 2M9VA 3DHQA 2LASA 4D2KA 1R9TB 1OQRA 2CW0D 3EIVA 2KTRA 2ZNVB 4TMAB 3RNGC 2EY2A 4ITKA 4BY1B 2NPTB 2NB0A 3URYA 2K50A 3WOEA 4ZOHC 2V4LA 4BKSD 3DWAA 1JROA 1GD7A 1UE1A 3NQTA 1PFDA 4KY5A 2JQRB 3Q8CA 5HKHA 1I35A 4C2MH 4HEDA 1C3TA 3KDFA 4DAYB 1OO9B 2WXFA 4C4VB 4RGMA 2BVCA 2LI5A 4K7UA 1STBA 2HQLA 4OWTB 5CTRC 2WU2B 2CS4A 3AU5A 2KQ7A 4A3PA 1VD2A 3ERSX 3TMEA 3S15H 4LLGM 2NN6I 1P16A 3MZ5A 1VQ6A 5GXGB 1BCPB 1LGRA 1T0QC 4XYQA 4RHSA 5FJ8G 4G7ZC 2IJ0A 1WFYA 4OX9L 3SDLC 4ALPA 2IHFA 2I46A 4BXXH 1PVOA 3NZUA 4CO7A 1PRTC 4JI5Q 3JW0X 4IUPA 3TZDA 3NELA 2L32A 2W9NA 1MHWC 4IUTA 3H7PB 4URKA 4IFDG 1IYVA 2HJ1A 4DR6Q 3AE9B 5JHBA 4A20A 3DEOA 1QQRA 3CPFA 2N1VA 2OJRA 3DVNV 3BWUD 4IW0A 2IY0B 4KIKB 5EPLA 5JVH3 1EO6A 2JZPA 1Z7TA 1L4DB 2ON8A 4RH6A 1PYBA 2W3SA 1OXTA 2N7JA 3TEZA 3VYUA 3KLWA 2KJ6A 1GPXA 4DK5A 3AEBB 3KFUA 1YQBA 4RKLA 3Q8FA 1NBFC 2I1KA 3KF6B 3I4MH 3C3LA 2JWZA 4RF0A 2KTFA 2ZCCA 3MEFA 4NXMQ 5E7NA 1K52A 2D07B 1WXVA 2VH2A 3BU2A 3VA5A 3OMCA 1J6QA 3HM3A 4DKAC 4RAUC 1WCMH 1HH2P 1E1OA 2H88B 2M0XA 3GTMH 3P7JA 4ZUIA 4G4KA 3RMHA 1WJNA 3KK7A 1WXSA 2LFNA 2L5TA 4LNNA 2K52A 5CV8A 3HOVB 4BY7B 1H4RA 3PZ8A 1YEZA 2E2JH 4YXDB 4DNIA 2CU3A 2JUOA 1EWCA 1SRUA 4UP7A 3CCQA 1S3SG 4J8QA 4RM9A 5C3WA 2ZPYA 3IT4B 2ATWA 5IKCM 4IWQA 1SE4A 1O80A 3AU7A 1VQ8A 3AEFB 2BT6A 1WTPA 1CTMA 1EQVA 4GMVA 2J0JA 4WWOA 4Y52H 3D8GA 1JR0D 5C44B 2HJ8A 4C4VA 2A6HC 3I3CA 1H9SB 3N20C 1SNMA 3U4ZA 4JI3L 3K57A 1V9JA 2F0VA 3NWSA 4B9WA 4DV6L 4A3LG 3VUXA 4DDGD 1RCVD 4OELB 4IZ8A 5IGEA 2D9UA 5BR8Q 1Q0WB 2K8CA 4MGKE 3O65B 3Q14C 4OL7A 5M3FG 3TEXA 3WANA 1EL0A 2MHJA 3CCSA 2EMSA 1L2NA 1MJDA 2DGYA 1IKMA 2W54A 2KJRA 4CHTB 2DAJA 3ZNHB 2QHOA 3A9KB 5D94A 2QW7A 3A8IE 5LMUL 3S1RH 3H7PA 3HOYB 5C4XG 2KQ4X 2KHIA 2PMZB 4L5QA 4A55A 2Q2UA 4A3GB 3UE1A 1E8XA 5JPMC 1Y1VG 4FBJB 2BWES 1ZPSA 4C80A 4JI3Q 2W82A 2VB3X 2VY3A 3T51B 1MJEA 1WH3A 1F2ZA 1CK1A 1S5FD 1U9RA 2ZJQA 3Q3JA 1U4LA 4QAYA 3ZLZA 2IGGA 3RFZB 2B2VA 1K51A 5BYQA 3AEGB 2CWAA 1TU2B 1W6KA 3VR5A 1LT4D 3CMEA 3P63A 4ZRIA 2KN4A 2YU9H 2J0MA 4TV3A 3M95A 3QO2A 5H8YE 1L0XB 3K58A 3UDGA 3PHWB 4XWTA 5BYRA 2K05A 2LHEA 4X6AH 4OXPA 4QCLA 1PTOF 4X62L 2WLBA 1YD8U 3B2GA 3TBLD 5LMUQ 2WP8J 2BE5C 3KJPA 4WIPA 2PO4A 4KD4A 4DR5Q 4A93B 1NMFA 1Q8KA 2KCCA 3Q24A 1QVGA 1A70A 1UGMA 3L17A 4K2KA 4NPSA 4KZ0A 2WFWA 3HOUG 1GAQB 2IDYA 2E2IH 2K4KA 3M62B 3GTPH 4HJAA 4ZKBB 4LF5L 4W9EA 3R3OA 1HR0W 1A62A 3N1YC 4NXNL 3OHXC 1ASZA 2WAQG 4A3KB 3S1MH 1N34Q 3TQYA 2PQAB 1KDCA 1WRDB 1TZOA 5DEHA 3AMUA 4LF8L 3PCOB 5LL6X 1EF5A 2KKCA 3U30A 4F7ZA 1EOVA 1L5PA 2EXZA 1WM3A 1WXAA 3NPPA 5EDSA 3CCMA 3PSEB 1UGJA 1EIFA 3GZNB 1C78A 1XPRA 2AUKA 2L4NA 1AZQA 1WGHA 2Z0DB 3I8ZA 1C48A 1GG3A 2QCZA 1DCZA 2B39A 4L5TA 5FKAC 3SEBA 2F3IA 1HRJA 4XTCS 3HOZH 2KOXA 5G55A 3RD2A 3T56B 3EROA 2OWOA 3GTGB 4C3HH 1DM0B 1HFGA 2VZAA 2ZTCA 3SK5A 4LF5Q 3UINB 1QJOA 4HKZE 2F03A 3AQQA 3BZKA 1PH1A 1N32L 3A4RA 5ELCA 5EE0A 5AEKB 4P1BC 2KWVB 5BN3A 3ONSA 4XT1B 1VQ4A 2N78A 5K36G 1B1ZA 3VQIA 3ZXVA 2PW7A 2IBIB 2WNMA 1PTOD 3HM6X 4YL8A 1HCZA 3NWTA 2ASQA 2F0SA 3I5JC 1CUKA 3HP3A 1CQFA 2LXJA 4TKOB 1JALA 3V6CB 2BDNA 1VZ6A 4K8JA 4DK3C 3Q8EA 1C1YB 1CHPD 2KT7A 1ZGUB 1IL2A 3G48A 2JJQA 4J6HA 1QOFA 3P1MA 3PMFA 4CYEA 5AUIA 1Q3LA 2AMCB 1A3VA 1FYCA 2PYKA 4KJOA 1N32Q 1Q1OA 2LXCA 4GGQA 4P7IA 1CKNA 2WKDA 4XZ4A 4ANUA 3SGIA 3PV1A 3ZJVA 2FUG1 5AZHA 4KGSA 3GS2A 4I65A 5EGTA 2J53A 4HK2A 3M9BA 4GDLB 3MC8A 2Y5PA 2K01A 1WI5A 2HCIA 3U7DA 5AJ3L 2WDTB 4DU9A 1X65A 4C2MB 4B3TQ 2XBBC 2HE7A 1KQSA 2J0KA 3HRDD 3ZTDA 3G4SA 2OHFA 2YLMA 3LB8C 1B9MA 3PUXA 2BB6A 4IQZA 1SIFA 3NZSA 1OQYA 2PQAA 3RLFA 4JX1C 1WGRA 5CHVC 3S15B 2M8SA 3AE4B 1GXDC 1L1OB 2CWPA 3NOBA 1E90A 1WR1A 4X3UA 4HIMA 2RCFA 1Q86C 4BVUC 3RI7C 2MJEA 1H9MA 4C7YA 4BBRH 2LUMA 2KMMA 2EKEC 1PH3A 4IPDA 5E6PA 2PPHA 4RMAA 1FEHA 4A3FH 2NVUI 3FKIB 2QDBA 5IODA 1LFDA 2MNAA 3A4SC 4GLAC 2KA7A 2MFIA 2V4IB 4IFDH 1VQCA 1EY4A 4K3BA 4GS3A 5C0XG 3HVZA 3KVFB 3VVWB 2BE5D 4KKJA 3ML8A 2NVYB 3JC66 3NBHB 4PYUA 5C4JH 4JI7Q 4IM0A 4P72A 2PW5A 3BJUA 5D7GA 2HDLA 4LMQD 4DR7L 1C4CA 3MJWA 2BTEA 1Z6HA 2IX3A 4IG7B 3I4MB 2KC1A 3WAOA 3TDQA 1PH5A 1D1IA 3U8ZA 4KD3A 1B7YB 4Q0FA 4UPAA 3QIJA 4A8XC 2MPMA 1UBQA 4BAXA 1XWEA 3FHWA 4XC2A 1TKYA 1DXMA 1U4PA 2IO1B 3GTMB 2Z4HA 4U673 1QF6A 1VDVA 2V1YA 2FCQA 4RCNA 3T13A 1A5RA 1VMCA 3BZCA 4MHEA 1P0RA 4LNIA 3TCAA 2E74C 2E2JB 5FO8B 1XNQL 3HRZC 1KLUD 5AUKA 3W1GA 1K0RA 4JGHB 5L83A 1HTLD 2ICIA 2A69C 1V1PB 1PTOB 4L6TB 2DAFA 2RDBC 4DNRB 4DR7Q 3ECIA 1FMAD 1SGHA 2KFKA 3N1XC 3H7SA 3T8MA 3DMUA 3J7ZC 3A9JA 4B9XA 4KX6B 4P1CC 1C79A 5FLXL 4HIKA 2DHZA 3UDIA 4A3OA 1QZGA 5MPOA 3NK9A 2BH8A 5E3FA 3S17H 2MRPA 5LMNL 3S2DB 3RMKC 3I9V1 1GHKA 4Z9CB 4XE0A 4EVOA 2AYOB 4A3LH 3DOWA 2B2UC 4W9JA 3A56A 3OWFA 2N7DA 2HHHL 4KMUC 1PFMA 4S3SA 5M3FH 4MGZE 3CCLA 1KAWA 1XTCD 2VXWA 4JBJA 3M4OH 2Z4IA 1Q12A 1YJWA 3X23A 1EFID 4DUZL 4QIWE 4DHZB 2GB1A 1QNKA 1L0VB 1DOYA 3S1RB 2KXJA 2WINB 3VTWA 1L7YA 4NAWA 1P9DU 3NE5B 5M3MG 2PMZE 5C4XH 4UAIA 1CA6A 4XYOA 3CC4A 1KNEA 4F88A 3TP8A 1KAAA 3QG1A 4X3TA 1GM5A 1Y1VH 1Q10A 2KN5A 2OQ0A 2X8XX 4II3B 5GAEC 4A3IB 1WYGA 2BDOA 3AV8A 4M02A 3BK2A 1R4QB 4M0WB 3PO0A 3RNCC 3TP6A 2A6ED 1WJ6A 2HHHQ 5C23A 1O7YA 4B9KA 1HJPA 3ZKJC 1IP9A 1YZ6A 2G5DA 3KBXA 1TWGB 2EMTA 4V0BA 4GB9A 5H1SE 3QARA 2CQOA 1CMXB 1X1MA 4DPGA 4JVZA 1FRDA 1HQMC 3APDA 2PNHA 1XXGA 2P5ZX 1N33Q 4GU2A 2OQKA 1C8CA 4PS8A 3I4NG 2QDLA 4BBSG 2BYFA 1G6PA 4E71A 2KBNA 2E2IB 2DX5B 3HOUH 4KV2A 2RHSB 4K8IA 1DOKA 2CFMA 2DN8A 5IYCG 1VJKA 1HA5A 1VQGA 4ANXA 1R4MI 1BOSA 2HDEA 1HUNA 3JYUA 2CQAA 1A0IA 3GDEA 3QJZA 1SSNA 3SU8X 4L23A 4DV3Q 4V190 5BN4A 3PF5A 1R4NI 3N3KB 4YTNB 4NDXA 2DY7A 4C3IB 3IAS1 3MXNA 2D0PA 1UWMA 1XJVA 2XK5A 3PIO3 3PO3G 1V5OA 3CCVA 4GN5A 2YTXA
chains in the Genus database with same CATH topology
3HOZB 3W9CB 3BZDB 2EJMA 1H9KA 2XN9C 3ZJTA 2R3ZA 3D31A 4OVZA 4PQXA 4IFDI 1RYJA 2W55A 2DLBA 3DXJC 1PDQA 3L3OC 3LX0A 1EWHA 4IFDJ 5K36H 3W5VB 4WURA 5ELBA 2MEKA 4FXDA 1I50B 4ZRQA 4AYBB 4ZK9B 4DK0A 2RDHA 1Q8IA 1E2ZA 3Q69A 3CHBD 4CKEA 3AH7A 2F4IA 1BQQT 2NVQB 4KY7A 1WTVA 1LTSD 2X69A 2H89B 1FNVA 2PZWA 3SFDB 1NCVA 1XLOA 1PZKD 3E9SA 2MUYA 1FIQA 2AX5A 3LWEA 4KTAA 1NSNS 3A55A 4FXGC 1RM6C 2G1EA 4Y7NB 2F0OA 4NZLB 3BDLA 3GV3A 4DNTB 1ESFA 1JE4A 2CJOA 4IALA 2B2VC 5LL6S 3A54A 3NTHA 3KLSX 2N55A 3RPFC 3QB3A 4R9WA 2K22A 1PGBA 4N6EB 3CIRB 1PDXA 4MIUA 3CWIA 4HMJA 1FO4A 4OIJA 1WTQA 2HQEA 3NP8A 5EJWA 2ENBA 1PZID 3NSWA 4XQQA 1DONA 4MH8A 3ONAB 1D5MC 1XCQL 1DD2A 5CMDA 2BW2A 4WWMA 4KGTA 1L0YB 4HEA1 4ZKCB 4QF4A 5I6YA 3BVZA 2L12A 1BBXC 4KKIA 5C4JB 4Q5VA 1SNPA 2MHVA 4ZYSA 2O4XA 5I9PA 1I4QA 3AE7B 2E76C 1NR4A 3BIID 1JWUD 1LTGD 2K5PA 5FOBB 5EE9A 1LV9A 2KAJA 2EYMA 3AN1A 5CV6A 2H4OA 1SJHD 2PNRC 3LXFA 3M3YB 3T4AC 1IHZA 3U9SA 3AEAB 4A9AA 2IPKD 3S16B 2N88A 3E56A 1LTRD 4WJWA 1FNWA 4EQPA 1AFPA 5IGFA 4ABNA 1OFFA 4K5WA 2BS2B 3TP5A 5TSSA 2WXMA 3I72A 1C9FA 4TSSA 2QCPX 1A6XA 1TS5A 3C2PA 2I2YA 2K28A 5EKKA 2A74C 2NUCA 4QUCA 4ULLA 1CQVA 3SK4A 1WWTA 2IWHA 1DOIA 5M3FB 2NMQA 2B8FA 3M4OB 1HA6A 5FR3A 3UI2A 1Q90A 4CBVA 5C6AA 1A15A 3GD7A 1HZ5A 3IKJA 2M0AA 5M5XB 5C4XB 5M9OA 1S5CD 1QOBA 2A73B 1UUPA 1Y1VB 4OZCA 1SEBD 1FCCC 1D5ZC 5EPKA 3TEYA 1LTTD 5C3EB 3H91A 1RTNA 5EKLA 4YTPB 1Z47A 2IT1A 2K1BA 2MGSA 1TR5A 1DJRD 1HXYD 1MPEA 5JXVA 3AE6B 4FNFA 2WAQB 1B9NA 2O2LD 1EY5A 1MSGA 1SE3A 3MTSA 2XRQD 4YIJA 2K5DA 4P16A 3BDOA 1KDAA 5CYUA 2Q8TA 1SYCA 1G2SA 3NVWA 5IT9L 5NUCA 3GTKB 2BBCA 5D14A 3QWNA 1N5XA 3J7AV 5BMIA 1STEA 1SDFA 1OXSC 2E6XA 5C0XI 3CKIB 2QMTA 2HDMA 3PUWA 3SHLA 2ONQA 5C0XJ 1PLFA 2RA4A 3P42A 2WDRB 1HEZE 2FE8A 3IL8A 1SFOB 3GB1A 1TWAB 1R4PB 4FXCA 2TSSA 2FHTA 2JEBI 1XEEA 3K6OA 2F3WA 3W3AA 4USAA 2VB2X 3GV6A 3I4LA 3VR3A 1I4RA 3X3MA 1RD9D 5J22A 2RQXA 1SYBA 1WVLA 3PUYA 1JWBD 1HZ6A 2WDQB 1IGCA 2SDFA 5C4HA 1F9QA 1P7EA 3SK8A 3PUZA 1EY9A 2ID0A 1ZUD2 2DNCA 2F0PA 2M2LA 2EOTA 2HCCA 5DAUA 5ELDA 4FO2A 2QF7A 5G3LF 1S5ED 2CHBD 4H7BA 2LGIA 2EYJA 5T1IA 2MH7A 2ZXRA 4DGZA 1STAA 1C4PA 4DAYA 5EE3A 4M1UB 1SNCA 2F0MA 4X3KA 1CFMA 2F0NA 5I2XA 5FO7B 5E6JA 1B2TA 1PRTF 2B2TC 4BA1I 1XLQA 1I7HA 1IGDA 5C3JB 4QIWB 3TZUA 2WXLA 3FC4A 4RA8A 4DXFA 2L1AA 4RWSC 3T3NA 4KGRA 2WIIB 3AB9A 3TP7A 4IOIE 2F0WA 4JPSA 3MXGA 2IGHA 3AE3B 4OW0A 2LEKA 3FVQA 1M4VA 2GI9A 2KJXA 2SOBA 4O42A 2JXTA 1TS4A 4EGVA 3H8HA 3VR8B 1QOAA 3RD4A 2G9HD 1EYDA 1LT5D 3HVDA 2PVGC 5G3LD 4BWGB 2N0SB 3ZQ4A 2WS3B 2L52A 1CZGA 2AUJD 2Y5CA 2BOSA 5CORA 2AQ3B 3D4RA 3HUIA 1PMRA 1YQ3B 2K04A 3J7YW 3NUCA 1PRTD 2WXJA 3C8YA 2VZKD 1VZ8A 4E6IA 1F77A 2GA4B 4HRSA 3MXPA 4K5VA 4C1NK 2GRIA 3AE8B 1GOZA 1QNUA 1H9SA 3P1HA 3GQBA 3L7ZC 2JYEA 1RWSA 1OXUA 3IFDA 2CJNA 2WXRA 4QMGA 2J7ZA 1MGSA 2K5WA 1HUMA 2B2WA 1SIJA 1AWDA 5JEAG 1E6EB 4B0MA 2V0GA 2OT2A 3FILB 3P4RB 1SYFA 2R93B 3MHBA 1SNOA 5KEEA 1LTAD 4HJGE 1YNJC 2Y3AA 2C5CA 4JWUC 1FCLA 5KNDA 4R3DA 1STHA 1JC7A 3I4NB 3J7AF 3S2HB 4BBSB 1TWHB 2MJ3A 4IUVA 3NQIA 1TKGA 4A3MB 1F9PA 3DWMA 3R2TA 2F0TA 5CV9A 4EE2A 1B50A 2A6HD 1YNNC 2JSOA 4CJ0B 2LMCB 1QG7A 3SR1A 1EYAA 2J0TD 2ZW1A 3DWGC 5ISRA 1G2TA 2TMPA 1HPCA 1SXTA 4HCSA 3OPOA 3PO3B 1TJEA 4HMIA 1PYWD 3I90A 1PGXA 2F1MA 1A3UA 4JK1C 3H09A 5F2DA 2JYTA 1JQ4A 3VR4A 1MHXA 2JEAI 3AE1B 4EQOA 4QUFA 1NAPA 2A68C 3ZJUA 5BMHA 4U68A 1JICA 1YQ4B 4DAVA 1EIHA 3FDTA 4HR7B 1VDZA 1BF4A 1JW9D 3NVYA 1PRTB 2EY1A 4N59A 2VZKB 2QKIC 3H3VC 1F9SA 4OIKA 3E0JA 1IBXB 1JWSD 3NVZA 5C3XA 4N9TA 2L11A 2SNSA 1C4QA 4XQJA 1FM0D 3GTQB 1SE2A 1I4XA 2K03A 5JAVA 1WCMB 2WKCA 4KHZA 2J52A 3EUB2 3A8KE 1SMYC 3R93A 2EE1A 1ZXTA 4Q2JA 3NXWA 5E1FA 3P4PB 3CU7A 3SFEB 3Q8AA 4KKTA 1S5DD 3SE0A 1ZDXA 2K6AA 2JSVX 3NS1A 1AN8A 1IUEA 1W6JA 1KRHA 1SBBB 5J39A 5EBDA 3CRLC 4NMZA 1I4PA 3Q6SA 1IW7C 1UWXA 1FNUA 1FD7D 2AWNA 1QKZA 1U4RA 4I7ZC 1PFBA 2QSDA 1YNJD 3MAQA 2Q8RE 5E4XA 1RJTA 2EVBA 1AP0A 1VRAB 2PCFB 1TIID 2B8GA 2X6GA 4GZYC 2JXMB 4HROA 2C9OA 1V8QA 2KEDA 5LNK1 1EOTA 1Y8NB 1H9RA 5E4WC 1J7BA 2AQ1B 1Q1BA 2ZW0A 3U9OA 5EE1A 2INPE 4KY6A 3NBHA 5A2QE 2EZVA 1JRPA 2BB5A 3RUZA 1B3AA 4ID6A 2YU9B 2O5IC 1RDPD 1GUTA 3IAYA 3MA2B 1BO0A 1J7CA 4YSZB 4OO1G 2LHDA 2N9LA 3ZGZA 4P2CB 1LABA 1O7ZA 1RF2D 1K8OA 2RDFA 1DOMA 1RHPA 2Y0SB 1KABA 1NR2A 3GO5A 2W3RA 3GTPB 2JX5A 4KN4C 2HTME 1D6EC 1X32A 1V1PA 3S1MB 2BYTA 1VMPA 4RGNA 4IKGA 1QWYA 4BS9A 4MACA 1XO3A 4GLSC 4ODGA 2F0KA 2KWDA 2R61A 4RKBA 1K53A 2WV6D 4C3HB 3KWVA 3N52A 4L8JA 2PPBC 2IL8A 1E0BA 3S14B 4K6LA 1EY7A 5JEAH 3I73A 3KQ4A 3D4DA 5ELEA 5CV5A 1EY6A 1ILQA 4ZLTF 4IDIA 4DA2A 3FEWX 5CV4A 1Y56A 2E3TA 1XLPA 2A69D 4WH4A 1BCPC 3S9WA 1STYA 1F2LA 4M0WA 1EYCA 1B53A 1NEKB 2YYZA 2PVOD 2FINB 3U4EG 2MP1A 3TN2A 1F9RA 5FO9B 5KGUA 1OQQA 1TS2A 4PNYA 3NBIA 2PLPA 2OF1A 3U2SC 4R8IA 1KTKA 2H1EA 3AEEB 3NHHA 3QIAA 2KACA 2K3UA 1LTID 1LT3D 2SEBD 3SXHA 1ZYRC 1FGBD 3U52E 1JQYD 2WXNA 4BBRB 3DWQA 1OXXK 4XWWA 1YMHE 4A3FB 4A6QA 4B0EA 4HN7A 2PTLA 2IX1A 3AECB 4ZRPA 3M85A 2F0UA 1JWMD 4DK1A 5LHY1 1F2MA 2DNEA 1XLNA 4FF3A 1BNZA 2BA0A 2V3PA 1EU4A 3VYRA 2R92B 3DEPA 3BK1A 3QOLA 3BVMA 4WAFA 5CBEE 2CW0C 1VCIA 3ETRA 2KECA 2B2WC 2NN6H 4CQNA 2HUGA 5KIXA 1FFVA 3AB5A 1M8AA 5JJZA 5KYLA 1II3A 3W2DA 1I4HA 4US9A 3S17B 3KUPA 2FJ2A 2RVLA 3J80L 1JWAD 2X38A 1ACCA 3EQLC 3LYYA 3W1SA 1N63A 2J4XA 3L4PA 2X6LA 1SAPA 1D5XC 4UDUC 2F0GA 1SJED 3T53B 4FF1A 2ZT9C 3JAML 1HHVA 1ET9A 3AM9A 1EM7A 1GUOA 1G291 1GB4A 1EZ8A 4L2YA 4A90A 2EYOA 3P75A 4PMCA 4ZQ3A 1PUTA 3AEDB 1ZEQX 4FF4A 3MVVA 2WDVB 4US8A 3I70A 4G7OC 2D5DA 4KN7C 4J3OD 4C3IG 2N9KA 3OOCA 1WXQA 3T3OA 5AFWA 4OO1H 4ARIA 1ZXIA 2Q8IB 4A3JB 5HHDG 1YNTE 4ME5A 1SSOA 1NYRA 4FXKC 4OZAA 5T8IA 4K14A 1DGJA 3HOUB 3AE2B 4JE3B 3NUHB 2KQ3A 1T5XD 1QCBD 1ESRA 2B2YA 2LFIA 2D62A 1QB5D 1IL8A 2JWUA 3M7GA 5KYIA 3IT6B 3CRKC 4IUUA 1NUCA 3C1EA 4TRDA 3NRZA 3BYYB 4YSYB 3G7LA 2NTSA 1MHHE 1RKNA 3J81L 2MJ8A 3Q23A 2JU6X 4AQ7A 1GHJA 4OGQC 1E9MA 1AW7A 2KCNA 2FBWB 3MC0B 1WTOA 2B2UA 2JA6B 1WD0A 4RCOA 1G6ZA 1ILPA 4CJ2C 1KF6B 1CJEA 2CVRA 4B08A 2F0EA 5D65A 1STGA 2IGDA 1ZKOA 1L6VA 4QB4A 4CKCA 1MI0A 4DF7A 3P4SB 1J7AA 4REZA 2L83A 1T5EA 1O7LA 1J9OA 3N6RA 2OXPA 2WP9B 3O13A 3MWYW 5HFYA 3FMCA 3J9CA 2LJIA 1B44D 3MJ5A 2LY7A 3RZOB 3GTJB 1CM9A 3BG3A 4NW2A 2EKIA 4WQMA 3VRBB 1TS3A 5C5LA 1UNSA 3AE5B 1VF7A 1VF5C 1GUGA 1RODA 2F3VA 1KNAA 1PGAA 4ZHOA 3A8JE 2KUMA 3QOJA 2M56B 4IURA 2RBMA 1WD1A 3GTOB 1WTXA 3R2IA 4H13C 2XWJB 5KNBA 4ZAIA 1YN5A 1ONLA 4L63B 2EYHA 5BYSA 3ERQA 1PTOC 2F0FA 1QE6A 4OHJA 4XT3B 4CJ1B 1WSPA 1VZ7A 4OZBA 4XDXA 1PTOH 4XQNA 2NWGA 4YTMB 3MXUA 4DQOC 1EIGA 2BS3B 4TQ1A 3C46A 2RMMA 5I2YA 3DWPA 3ABVB 2Z8LA 3D4WA 2WXPA 2YEPF 3D3RA 5HURA 4ZRZA 1GB1A 1NI3A 4OO1I 5CR3A 4XIGS 1LO5D 1QILA 3SVMA 2KDMA 4C3JG 1TWFB 2XNAC 1K50A 1DOXA 3VRAB 5FLXE 1R7SA 1ZP0B 2VNUD 1JOKA 1IKLA 1K8MA 1TVXA 4IUNA 1I6VC 1MBYA 5T1GA 5EBCA 2FMMA 2DWQA 1EEFD 1KDBA 2RPVA 2QIEB 4H2AA 3PV0A 4DXGA 1GUNA 1VLBA 5BN5A 1ZDVA 4PMBA 4EQNA 3S1NB 4NKLA 4RGTA 2LS01 2K33A 2L0CA 2A5HA 1LACA 2JYOA 2L9HA 3FAHA 1F2RC 5M3MB 3P4QB 3QJYA 4YT0B 5H92C 3ND8A 1CT1D 2NTTA 1H9JA 5IIFA 3EJIA 4H44C 2ZXPA 1V1OA 2XVSA 5IGDA 4RHRA 1MI2A 3KF8A 1EY8A 3KBGA 3EFXD 5M5WB 1V43A 3P20A 3V2TA 4KKUA 2K9XA 2EY5A 5BMGA 3MEHA 5IOCA 4YSXB 3LNNA 1BUVT 3H94A 1DYQA 5JPNC 3TUOA 5I6WA 1LT6D 4WFN3 1D4BA 5CBAE 1AZPA 1YJJA 3K59A 1VR9A 1BDOA 2PW9A 3PO2B 1I4GA 1MSHA 4KJNA 2NVTB 4RGOS 4HSPA 5I9OA 1E7PB 1E2VA 4FF2A 2RDGA 3C1FA 3M4YA 1D1KA 3K7AB 4KK7A 4NJCA 1S5BD 3OWEB 1E10A 1BUIC 1FRRA 1T6BX 1F2YA 1EEID 5G5GA 3E6ZX 1J8IA 1WRIA 1ZOYB 1JORA 2PZUA 2WXKA 1BXTA 2BS4B 2F0HA 1IYUA 1ENCA 4KHVA 2A6EC 3TBIB 1S4ZA 2KHSA 3KLSA 4FYDA 4L1BA 3I91A 1Y8OB 2F0QA 2M19A 2WXHA 2EDGA 1FD6A 2SNMA 3WCQA 4ILWA 4C7ZA 1V97A 3MFGA 4AS1A 3B9JA 5KNCA 2JA8B 3FILA 4F8MA 3PUVA 2IX0A 3SK6A 1K83B 1KFYB 2YEPB 4LAAA 2EPBA 2BA1A 1GUSA 1MD2D 4NAWB 4MT5A 4PV1C 2KVMA 3M7NA 1CI3M 2PKOA 4XDDA 2NN6G 5DNFA 4XXEA 1EQTA 1WTRA 2F0IA 1PXUA 1QOGA 2F0JA 1JB3A 1PFNA 4LK1C 2NBFA 3F2UA 1A2TA 5A35A 5FK9C 1CHQD 2WU5B 3ITPA 2LMCA 2OEOA 1DZ1A 4IUQA 4A3BB 3K5MA 1LLRD 1I6HB 3IXSA 1LTBD 4LTUA 1MVKA 2ZXOA 2WB1B 2I38A 2B2YC 3V96A 3X3NA 2PZTA 3V3XA 1PZJD 1TKEA 2XSCA 3HGBA 5KRUA 1T3QA 4CGYB 1WTWA 3PIP3 3E5SA 2PQEA 4PMWA 1YN4A 4LK0M 1C76A 1F2RI 4DAPA 3KLRA 2I07B 2QILA 3OIPA 2Z1CA 2DYMA 3VR6A 2V4DA 1YJIA 3OW7A 3EGRA 4ZUJA 1SF0A 1YNND 2D5GA 3MHZA 4J1MA 3AMZA 4IN3A 4F87A 2G9DA 3HKZB 2BCOA 2RSNA 1IBXA 1A2UA 1WGKA 2F0LA 1RTOA 4F7XA 1EZ6A 1Y69U 1L4ZB 3WDNA 3J80E 1L6UA 2KEEA 2SAKA 2EYPA 4K6DA 4KV6A 1FR3A 3MFYA 1GJXA 1C77A 3IFTA 2A68D 2WXQA 1JOOA 4MM3B 2D2CC 3PZ7A 2R6GA 1XF5L 5IGCA 3NVVA 3JAME 1TQOA 4XDCA 4N58A 1ML0D 1I3QB 1CZPA 2ICEC 1P7FA 3W5UB 3I57A 1TYGB 3UI3A 3L9AX 4CKBA 3B2FA 3H0GB 2O5JC 1JMLA 3TEWA 3IAM1 2QEJC 3T16A 4H0LC 4WRDA 2ACZB 3GTLB 1F0ZA 3H6MA 4KI0A 1V8CA 2EY6A 2XRSD 3K5LA 3HS0C 1UAPA 4PT5A 5CGKA 2DBYA 1TY0A 3NTIA 1Q1EA 1ZE3D 3DUZA 1XYIA 1Y8PB 2Q5WD 2M00A 3HEJA 5D3IB 1BMLC 1SMYD 2B2TA 1B9RA 2K5QA 3K0YA 2JE6I 1ICWA 3G6JB 3V05A 1NVID 2V3NA 4TQ0A 5JOBA 3K5NA 5HGTA 2NVXB 5C5MA 2FMCA 3KWLA 5ELFA 5EKIA 1U4MA 2AQ2B 1D2BA 1XX8A 1TT2A 1FXAA 1IW7D 1X3QA 2E75C 4K2LA 2WQYB 3Q0AA 1KH0A 3J81E 1X3PA 4C56C 2B76B 3LWUA 5DM63 3HOWB 1SYGA 3HZXA 3A7LA 1ET6A 1STNA 5IT9E 4A3DB 3ZYYX 5C4ZA 1GUWA 3RZDB 1G8ZD 4RNAA 4O1NA 5HI1A 4DFAA 3K5OA 4P6VF 2JA7B 1OXVA 4R8NA 5CC4A 1QLBB 1SYEA 1NENB 1KLGD 1N60A 3HOXB 5JVG3 2EYLA 3CQZB 3S1QB 2EJFC 1N62A 2DY8A 1HQRD 1E2WA 2F0DA 1EU3A 3GP7A 1TY2A 1A3TA 2R7ZB 1NYQA 3D6CA 1FFUA 3D6WA 3ND9A 3BYTB 1YN3A 5EQ0A 4ARCA 1TKWB 5DM73 4X3SA 1EWYC 5I4DA 2JA5B 3U7ZA 4HSVA 1HFNA 3OIQA 2DYOA 1JOQA 1BCPF 3MP9A 1AEXA 2RKSA 4FP5D 1AYFA 1E0ZA 1N5WA 4NAMA 4HCEA 2KOLA 3NZ3A 5CV7A 3N9YC 3OMGA 3OSOA 2WACA 1EY0A 3DM1A 1ENFA 4RFBA 2RSOA 5C0XH 3VR9B 4M8AA 2EELA 1Y1WB 3TSSA 3VYSA 4FVMA 3R8BA 2PIAA 3VR2A 1SYDA 1QT9A 3HG9A 3EVQA 1XCTL 2XWBB 4K5XA 2B63B 2NYZD 3Q22A 1RFKA 2L55A 2FFKB 2LKVA 1CZWA 4HKQA 1C4AA 5IGBA 5C2TB 3VA7A 4N9PA 4TQUS 1SNQA 5K5PA 1BCPD 5A2QL 2JP1A 1ENAA 2INNE 2XIWA 1G91A 1ZXHA 2EJGC 5HG2A 3FPPA 5JEAJ 1SNDA 4HTHA 4HAEA 2K0PA 1B4OA 1ROEA 4C3JB 2EYFA 4ZHPA 3EA6A 4A3EB 1DOLA 1FXIA 1BR9A 1HTPA 3FPUB 3FRPB 5J1ZA 3SDZA 2WXIA 2OEDA 4JBWA 5EPJA 3Q8BA 5COYA 4WORA 1CA5A 3NTKA 4KKSA 2E2DC 2NZ1D 4LJZC 2AWOA 2WXOA 3BVGA 1N61A 2J42A 4C3HG 3SR6A 4GDKB 1ZYRD 3BDCA 3WOFA 2WXGA 4RF1A 2L1BA 1O78A 4C1NI 1QOHA 2K7VA 4NP5A 5G5HA 4MN3A 2IW3A 1SB3C 4BA2I 2QJLA 5IGGA 1UEAB 5M5YB 4JWSC 4G57A 4YWGG 2PMVA 1TWCB 1JCKB 2K32A 3A7AB 5D3DA 4G7HC 2E2HB 4DN4M 3BS1A 2MJDA 2VUMB 3VYTA 2M9VA 3DHQA 4D2KA 1R9TB 1OQRA 2CW0D 4TMAB 2EY2A 4ITKA 4BY1B 2NB0A 3URYA 3WOEA 4ZOHC 3DWAA 1JROA 1PFDA 3NQTA 2JQRB 4KY5A 3Q8CA 4HEDA 1OO9B 2WXFA 4RGMA 1STBA 2WU2B 3TMEA 4LLGM 2NN6I 3MZ5A 5GXGB 1BCPB 4XYQA 4RHSA 4G7ZC 2IJ0A 2I46A 1PRTC 4IUPA 3TZDA 2L32A 4IUTA 4IFDG 1IYVA 3AE9B 3DEOA 1QQRA 3BWUD 5EPLA 5JVH3 2JZPA 1Z7TA 1L4DB 2ON8A 4RH6A 2W3SA 1OXTA 2N7JA 3TEZA 3VYUA 1GPXA 3AEBB 4RKLA 3Q8FA 4RF0A 3C3LA 1K52A 3VA5A 3OMCA 4RAUC 2H88B 3P7JA 4ZUIA 4G4KA 3RMHA 3KK7A 2LFNA 2L5TA 5CV8A 3HOVB 4BY7B 3PZ8A 4YXDB 2CU3A 1EWCA 4J8QA 5C3WA 3IT4B 1SE4A 1O80A 3AU7A 3AEFB 2BT6A 1WTPA 1CTMA 1EQVA 3D8GA 1JR0D 5C44B 2A6HC 3I3CA 1H9SB 1SNMA 3K57A 2F0VA 3NWSA 4B9WA 1RCVD 4IZ8A 5IGEA 2D9UA 3TEXA 4OL7A 1EL0A 1IKMA 2W54A 4CHTB 3A8IE 3HOYB 2KQ4X 2PMZB 4A55A 4A3GB 5JPMC 1ZPSA 4C80A 2W82A 2VB3X 3T51B 1F2ZA 1CK1A 1S5FD 1U9RA 3RFZB 1U4LA 2IGGA 2B2VA 1K51A 5BYQA 3AEGB 1TU2B 1W6KA 3VR5A 1LT4D 3P63A 2KN4A 5H8YE 3QO2A 1L0XB 3K58A 4XWTA 5BYRA 2K05A 2LHEA 4QCLA 1PTOF 2WLBA 3B2GA 2WP8J 2BE5C 4WIPA 2PO4A 4KD4A 4A93B 1A70A 2KCCA 3Q24A 4K2KA 1GAQB 2IDYA 4ZKBB 3R3OA 3OHXC 4A3KB 1KDCA 1TZOA 5DEHA 3AMUA 5LL6X 1L5PA 2EXZA 3NPPA 1UGJA 1C78A 2AUKA 2L4NA 1AZQA 3I8ZA 1C48A 1DCZA 2B39A 5FKAC 3SEBA 1HRJA 4XTCS 3T56B 3EROA 3GTGB 1DM0B 1HFGA 3SK5A 1QJOA 4HKZE 2F03A 5ELCA 5EE0A 5BN3A 4XT1B 5K36G 3VQIA 1B1ZA 2PW7A 2WNMA 1PTOD 1HCZA 3NWTA 2F0SA 3HP3A 1CQFA 4TKOB 1JALA 2BDNA 1VZ6A 4K8JA 3Q8EA 1CHPD 4J6HA 1QOFA 3P1MA 3PMFA 5AUIA 1Q3LA 1A3VA 1FYCA 2PYKA 4KJOA 2WKDA 3ZJVA 2FUG1 4KGSA 3GS2A 4I65A 5EGTA 2J53A 4GDLB 2Y5PA 2K01A 2HCIA 4DU9A 4C2MB 3HRDD 2OHFA 3LB8C 1B9MA 3PUXA 2BB6A 4IQZA 3RLFA 4JX1C 3S15B 3AE4B 1GXDC 4X3UA 2MJEA 1H9MA 4C7YA 2LUMA 2KMMA 1FEHA 3FKIB 2QDBA 5IODA 2KA7A 2V4IB 4IFDH 1EY4A 5C0XG 3HVZA 2BE5D 4KKJA 2NVYB 2PW5A 5D7GA 2HDLA 4LMQD 1C4CA 2BTEA 1Z6HA 2IX3A 3I4MB 3TDQA 1D1IA 4KD3A 4Q0FA 4A8XC 2MPMA 1XWEA 1TKYA 1DXMA 1U4PA 3GTMB 2Z4HA 4U673 1QF6A 1VDVA 4RCNA 3T13A 1VMCA 4MHEA 2E74C 2E2JB 5FO8B 3HRZC 1KLUD 5AUKA 1HTLD 2ICIA 2A69C 1V1PB 1PTOB 4L6TB 4DNRB 1FMAD 3DMUA 4B9XA 4KX6B 1C79A 5FLXL 5MPOA 3NK9A 5E3FA 3S2DB 3I9V1 1GHKA 4Z9CB 4XE0