1JWUD

Crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b2
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
239
structure length
232
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Structural, energetic, and functional analysis of a protein-protein interface at distinct stages of affinity maturation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 68
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jwuD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwuD02
1D6EC 3DWQA 1EU3A 1UNSA 1EEFD 1FD7D 1LTTD 1SBBB 2Z8LA 2O2LD 4OHJA 2QEJC 2RDHA 5ELFA 2ICIA 1SE2A 1I4HA 1HTLD 2XRSD 1EWCA 2AQ3B 1TY0A 1CHPD 4UDUC 2RDGA 1PTOH 1ESFA 1SE4A 3TSSA 1DJRD 1V1PB 1G8ZD 1LO5D 1PZJD 1BCPF 1KTKA 1QILA 3DWAA 1LTAD 4O1NA 3V05A 4RFBA 3KLSX 1YN3A 1BXTA 1SXTA 2QILA 3BYTB 3R8BA 4DXFA 1TY2A 2AQ1B 3R2TA 4RCOA 1S5CD 4RGOS 1S5FD 2TSSA 1S5ED 1CHQD 5I4DA 1JCKB 1I4GA 1KLGD 3BVMA 1PRTF 1RF2D 1PTOB 1T5XD 1LT6D 1KLUD 1XTCD 1PTOC 1LTBD 1TS5A 2NTTA 4RGTA 1DYQA 1V1OA 1HXYD 1JWSD 1I4RA 1AW7A 1RD9D 1RDPD 1YN5A 1SJED 1LLRD 1CQVA 1TS3A 5D3DA 1GOZA 1CK1A 2CHBD 1RCVD 1HQRD 1PZKD 1LTGD 1LTID 1FNUA 3MC0B 1EEID 1ET9A 1I4XA 1UUPA 1ET6A 4RHRA 2NTSA 1I4PA 1D5ZC 1B1ZA 1LT3D 1PZID 1JQYD 5ELBA 4L63B 1PYWD 1CT1D 1FNWA 1AN8A 3DWPA 1LT4D 1MD2D 5ELEA 1JWUD 1TS4A 2G9HD 1BCPB 3BYYB 1D5XC 1BCPC 2XN9C 1EU4A 1EFID 3BVGA 3GP7A 1TS2A 5TSSA 1ENFA 4Z9CB 4RGNA 1SJHD 1LTSD 5ELCA 1S5DD 1LTRD 3O13A 1PTOD 1PRTB 2IPKD 2XNAC 1B44D 1STEA 4RHSA 1PRTC 1M4VA 3R2IA 4NZLB 1BCPD 2R61A 2SEBD 3MFGA 1LT5D 1F77A 3EFXD 3EA6A 3URYA 2IJ0A 2WV6D 3W2DA 4BWGB 5D3IB 5FKAC 3SEBA 1L0XB 1JR0D 1FNVA 3CHBD 1XXGA 3BZDB 4C56C 1FGBD 1SE3A 4K6LA 1PTOF 1PRTD 1V1PA 2J4XA 4TSSA 5FK9C 4DXGA 1YN4A 1SEBD 1S5BD 2XRQD 5ELDA 1HA5A 1D5MC 4ZYSA 1I4QA 4RGMA 3BVZA 1L0YB 4L6TB 4RH6A 3OWEB 1JWMD 2AQ2B
chains in the Genus database with same CATH superfamily
3P20A 3U9OA 3BK2A 3DVNV 5MPOA 2DHZA 2DZIA 2K5PA 3HOXH 2O2LD 1QF6A 5LMUL 1S72A 3RT3B 4DWFA 3A55A 3M3YH 1EIFA 2EKEC 2KQ7A 2NMQA 2PJHA 3NUHB 1KJTA 2L11A 1D4BA 3M85A 2M17A 4E71A 1VZ6A 4B9WA 4F8MA 1C76A 3CKIB 1B9NA 1SYDA 1KH0A 1LGRA 2BF8B 3EBEA 3H0GG 4S3SA 3T16A 3RNFC 2E2HH 4A3BH 3HVZA 1O7IA 3W1SC 4JE3B 3T53B 4HJGE 3Q3MC 1V5TA 3W5VB 1IL2A 1E90A 2ID0A 4AOFA 3A4SC 1QB5D 2BS4B 2V1CC 2L7RA 4ICVA 4A3IB 2Q2TA 2K0PA 2C60A 1LTBD 1TS5A 2XSCA 4GDKB 2OWOA 4KSLC 4YTNB 2ZT9C 2D3AA 1TKEA 4JYAL 1EL0A 4LUVA 2FUHB 2AMCB 3UI3A 4DAYA 4CDDC 1BQQT 1TWGH 2EELA 4GGQA 3D31A 4XYQA 3PO3B 1NR4A 2Q8RE 1Q12A 4DV7L 3RZDB 4BBNC 1IP9A 2CHBD 1KNAA 2LXJA 2M1MA 4EQOA 2K8HA 1U0LA 4HMIA 3VYTA 5FLMG 3RZDH 3W3AA 1WR1A 3MJ5A 4M02A 1I4XA 3VR3A 2L00B 4W9LA 5CMDA 4FXKC 5I9PA 2WHIA 2IHEA 1Y14B 1L4DB 1PZID 3DXJC 2GI9A 2NVXH 4W9CA 1SMYD 3Q24A 4JLCA 4MJSA 2BDOA 5EKKA 1TS4A 4JQWC 2N4FA 2WB1E 3ZYYX 3MXNB 1WJNA 3Q8EA 2E2HB 4KDLB 1AYFA 1CSQA 1I6VC 2UUCL 3PRPB 3VUWA 4DNTB 3I91A 2DLBA 3S14H 1E10A 2JSOA 4OVZA 3SFDB 4FXGC 4HIMA 2V4DA 1R4QB 3KYCD 1HNXL 2MJEA 4JX1C 3HOUH 3IAM1 4X3KA 3O65B 3LDZE 4RMFA 1C8CA 2UXDQ 4EFOA 1YMHE 4GN3B 5KHOA 2XTIA 5C3EG 2MSED 4HXDA 3C46A 4LK1C 1E1TA 1VQLA 3K9OB 1ILQA 3M4QA 3F1ZA 1F77A 3V6EB 1L2NA 1WJ6A 3AE3B 3X3MA 2ENBA 2FINB 2QSDA 4OVUA 4L8JA 4HEDA 2WIIB 4DR2Q 2XIWA 1SAPA 2K52A 4KD3A 1ACCA 1SNPA 3I4LA 1A6XA 1P3QU 2KMMA 2FIDA 3VR5A 4C00A 1BUVT 2J0MA 3MHBA 1TKGA 4JI7L 2IZVB 1PRTD 1EZ8A 2QGQA 2CHWA 3A4RA 4PS8A 1FFVA 1LXDA 4S17A 3RNBC 1D5MC 4IPDA 4HN7A 3HVDA 1VRAB 3VH4B 1I35A 2WINB 2CU3A 3VAWA 4LF4L 1UEAB 1T6BX 1A8VA 1IW7C 2NZHA 2PQAB 4H0LC 4XXEA 3MEFA 1RFAA 2K6DB 4IWQA 2NVXB 4RH6A 3AEDB 1RIPA 3A7AB 2N1VA 4LFBL 1G291 3PF5A 2Z6KA 3NUCA 1GUSA 4LF7Q 1HUNA 3ZDTA 3ZXRA 4ZYNA 4DDID 3AMUA 2Z8LA 1JC7A 4M0WA 4NAWA 1XNRQ 2NB0A 2ICIA 1CJEA 1RFKA 4IQZA 1TWHH 1K9MC 3RR5A 5BN4A 3HOYG 2WAQG 1TT2A 3NWSA 3IG3A 2AQ3B 1FJGQ 2Y0SB 2E5LL 2LGSA 4ZKBB 2RGFA 1KAWA 4A9AA 4PG3A 3HOUB 4MT5A 4UDUC 3HGBA 5A35A 1S4ZA 1E8XA 1B7YB 5I6YA 3S16H 1IPGA 2Z0EB 1G8ZD 3PIPA 1U9RA 1LTAD 4J1MA 5IYCH 4GLXA 2BA0A 3KLSX 1BXTA 3IFTA 1EY8A 4DK1A 3DBLI 1F9SA 3D3RA 2QILA 3CCSA 4USAA 1I6HH 3UGBB 3FHWA 5IO9A 1F2ZA 3R2TA 5IP9G 4HIDA 2ZJQA 4K1RB 3J80c 2ICEC 1WMHA 2H1EA 1RKNA 2KTFA 5BR8L 1I94Q 2B2TC 1WWTA 4GU2A 5IP7G 1RF2D 5M3FG 2SOBA 2ZXPA 1I50H 3RNEC 1LT6D 4DU9A 2KHSA 3NP8A 2K01A 1ZXHA 3NBHB 5JJZA 2F0KA 2EY6A 4GOPC 3QQ8B 1X65A 1WCMG 3FVQA 4L23A 3DBHI 4B95A 2V3SA 2F3IA 1GUAB 1ZKHA 2ACZB 4A3MH 3UINB 4EEWA 1PLFA 4LNNA 2LRWA 2FE8A 2X38A 1BKBA 5M3MG 3JAML 3KQ4A 3WAOA 3NG0A 1CTMA 3AULA 2DN8A 2B63G 4YY3Q 3HOVG 4AQ7A 3CQZH 4OWXB 1WGKA 3ZJUA 2LY7A 4EUTA 4N9F4 2OTLA 1VR9A 2JEAI 2L05A 3E56A 2CR5A 4FHJA 2R7ZG 1JMLA 4MGYE 3S16B 4DK5A 1VQ6A 2PMZE 2Q2UA 1EY5A 3RZOH 4MEMA 3Q23A 4X3TA 2V9HA 3DEPA 2JVCA 3T4AC 2QDBA 1I6HB 1NNXA 1MFWA 4ULLA 4X66L 4G50A 5JPNC 1YQ3B 5C5LA 2ZXOA 2I5HA 2M8SA 3R3MA 1IYFA 2MEKA 2PLPA 3IXSA 4LFCQ 4LF9Q 4L5TA 1I50B 1M94A 2EZVA 1Q1EA 1QOFA 3CCVA 4MTNA 4FF3A 1T3QA 4B3RQ 1HR0Q 4GB9A 4IJHA 1EYGA 4NY0A 3KWVA 4ZRZA 5AZGA 5G2NA 3GO5A 3N20C 3N9YC 3GTLH 2WB1G 5T1IA 3EHVA 2DY8A 4E6IA 4IZ8A 1OXXK 1DOMA 3NQIA 4ME5A 4IDIA 3OMGA 4DR4Q 2EQSA 4U673 2WXOA 5CHWA 5AEKB 4J6HA 1PH4A 4HIKA 4K8IA 4DDGD 2F4IA 1U4RA 1HPCA 3J81L 1KAAA 1LV9A 3CQZB 3QX1A 1IHZA 1YQ4B 2ZEQA 4GLSC 3NPPA 1GHKA 4C3JH 4GN4B 3I4NG 1WSPA 3U58A 3U2SC 1E0BA 1P7FA 2A19A 1EU3A 4YXDB 4KZCA 3N6RA 3BS1A 1LTTD 1W6KA 3RZOB 4YSYB 3SK6A 4JV5Q 3DHHC 2CU1A 3ONSA 1HNWL 3S1MB 2XRSD 3AB5A 2NVYB 5G3LD 1O7ZA 1EY6A 3DBLB 1C4QA 2IDYA 2RDFA 4QIWB 1PA6A 1HFNA 2EY1A 4XT3B 4DN4M 2GVBA 3P75A 5KNDA 3ZJTA 2KWCA 4DHJD 5KYLA 4DR1Q 2BPSA 2DX5B 1GJXA 4IFDH 1WX9A 1IBLL 3HRDD 1MJEA 2D5GA 1TY2A 2REXA 3NRZA 4RCOA 4WURA 3V62A 2IW3A 5KIXA 1RM6C 2DZMA 3ZTDA 2TSSA 1PH3A 1S5ED 1GM5A 2MO0A 2UU9Q 3A5UA 1WYDA 5DPSA 2LXAA 3BINA 2JA8H 3FC4A 3MVVA 2M9VA 2KMCA 1XTCD 1E2VA 3DBHB 2EJMA 5GAEC 1S3SG 2OHFA 1GUOA 3HOZH 1H9RA 1IKMA 4A3KH 4K0KL 1FFUA 1AW7A 4C3JB 1E2WA 1OQQA 2DYMA 2ZTCA 3PV0A 1JOKA 5LMNL 4BVUC 2K05A 1CZWA 3LYYA 3MP9A 1E8YA 3J7A5 2PW5A 4C2MH 2B39A 4F8CB 1JWAD 2RSUA 4G7HC 3CCEA 1EEID 2K03A 2HIXA 1IUEA 3FILB 3TEXA 2JWZA 4L1BA 2KJ6A 4ANWA 4DAVA 3Q69A 2JYOA 4CHTB 1K3BC 2MP2B 2RD0A 2PYKA 4O2DA 4UP7A 2KMAA 2KEDA 4A3EG 4NAMA 1WGGA 5AUKA 3RULA 2EYHA 1DOXA 3WDNA 3H0GH 5LXIB 4PZ7A 3I55A 4JI6L 2FAZA 2XVSA 3VH3B 2YTYA 4X64L 3GP7A 5DPWA 4N9PA 3K5OA 5G5GA 1SFOH 2JF5A 3TEYA 1MIUA 1ONLA 1KXLA 1QOAA 2JU6X 3TBLD 1GC6A 1RYJA 5GAGC 1LTRD 4B3TQ 3WCQA 4NDXA 4DFAA 4DUZQ 2JA8B 3L4PA 1DGJA 1E7VA 1BCPD 4JOIA 2HD5B 1KNEA 4FJYA 3PIP3 4IPGA 1HNZL 3EA6A 3HOZB 1AE3A 2A68D 4P71A 2JK8A 2IJ0A 3C1FA 4A3KB 2WXGA 2WU2B 5F2DA 4F7XA 2MRPA 3H1UA 3Q8CA 2V4IB 1U4LA 1PFNA 1FNVA 1Q5WB 1QKZA 2J0TD 5E6JA 5BMGA 1FGBD 4PQXA 1YJIA 1QWYA 3ZXVA 3H8HA 1STNA 4OZCA 2F0SA 4H44C 2WKDA 4C2MB 1Q90A 2UUAQ 1J19A 5IGFA 5FLMH 2LZ6A 3NHEB 2O6VB 3RD2A 1TZOA 1EYCA 1TKWB 1J5EQ 3VR8B 5CORA 1E22A 1KDAA 3Q8FA 5J17A 1CKNB 3Q8DA 1XPUA 2C9WB 2V0GA 1Q3LA 5CV5A 1NTGA 3H0GB 3ZTCA 1PYSB 4OHJA 2BYFA 5ELFA 3SDLC 3R7RA 2VH2A 4XDCA 4AP4C 2K5QA 4R1JA 5C4JH 1SFOB 1U4PA 5BYQA 4TQ0A 1E0ZA 1QNUA 2IY1B 1KRSA 4YHHL 1VQ9A 3NZSA 1QJOA 1PTOH 5C0XJ 1XMQL 3SK8A 1X3QA 1Z47A 1KTKA 5IOCA 4DR3L 2IX3A 2Q5WD 5KNBA 4NW2A 2WWZA 4A3GG 1V8CA 4HJAA 5EKLA 2B76B 4CKCA 3HM3A 2NVQB 1CHQD 4XIGS 1SYGA 1JW9D 1P0RA 2ZCBA 5AJ3Q 2N9XA 4OWWB 3AM9A 3P63A 3OTOL 5FR3A 3OPOA 3AV8A 2E76C 1D7QA 3UDIA 1HZ5A 4C3HG 1ROEA 2KQ4X 4RGTA 2PZTA 1IYUA 4UY8C 1VMCA 1N32Q 2CS4A 4FVMA 4G0NB 5L83A 2N0SB 2JWUA 1VQJA 2KO3A 3RLOA 4NNJB 2K50A 5JPMC 2UU7A 2G5DA 1STAA 1VDZA 2NYZD 1JRUA 4ZUJA 4DAPA 5HGQA 1WH3A 3LJ3A 5C3WA 1F2LA 1LTGD 2L5TA 4ZDVA 1KIXA 4R4IA 1H9SB 1YEZA 2KCNA 1UUPA 3HOYH 3J7AF 3AE5B 2F0LA 3HEJA 5C4JB 3H15A 4BBSH 4MGZE 3VUXA 4FA6A 3P1HA 4C7YA 4MZ9A 3GTOB 1KRTA 2D3CA 2J52A 1GUNA 1XEEA 4WJ3M 2F4VL 4R9WA 1G6PA 3L54A 1KLVA 2KANA 1YJ1A 5C3EB 1E24A 1QZHA 3C8YA 5EE9A 3X0WA 1N36Q 3EUB2 3GOEA 5CTRC 3R7QA 2H4OA 1K8AC 2PMVA 2YTXA 2UWQA 2NN6H 5TSSA 1RRBA 5GQOA 1J8CA 3WAMA 4POFA 3LXFA 3T1HQ 3CC4A 3AEBB 4ZRPA 3O13A 3IT4B 4KLKA 1XLNA 2KTRB 3QJZA 4BBRG 3GTJH 2N3SA 3AQQA 4LW1A 3K8AA 3BDCA 2INDC 3PUZA 1EQQA 5J22A 4LFAL 1QQRA 1V81A 4KHPQ 1FIQA 1WCMH 3E9IA 1JWBD 1D1KA 4A3OA 2X69A 2JP1A 3GTMH 3I3CA 2RPQA 2JZZA 3MJWA 4KY7A 1N60A 3MHSD 4E3CA 1PGBA 5BYSA 2N9PC 1UWVA 3RNGC 4FLHA 3TZDA 2A69C 4FP5D 4C4VA 4X3UA 1E7UA 1JT8A 5D94A 3SD5A 2B63H 3HOYB 2WAQB 3HOVH 5EE3A 4ZHOA 2JE6I 1SRUA 4W9JA 5CV4A 2NBUA 4WWOA 3V3XA 3QOLA 2H89B 2BGFA 2DZJA 5GADC 1ZP0B 5IYBH 2R7ZH 3OWFA 3JAME 4IALA 2ASBA 1SBBB 1BT0A 4WJPA 4GDKA 5LXHA 5C23A 2NCNA 5HGTA 5JEAJ 2KZRA 4DV2Q 1VS0A 3U4ZA 3FAHA 2EVBA 2GBNA 1WXAA 4NXNQ 5FLXL 1TY0A 1PGXA 5IT9c 5C1ZA 1G91A 2KDMA 3A1QB 1UE1A 3AI5A 4IUNA 1K83B 5AZFA 2H5XA 5JEAG 4JI2L 5D6JB 1B3QA 1DJRD 1V1PB 3MXPA 5M3FB 2Y5BB 3D32A 5DLQE 4P1BC 2LFIA 2F0UA 2LRUA 3I2ZA 4RFBA 1PH6A 3GTJB 3J7AV 4LDTB 4ZHPA 4KV2A 2BYTA 3BYTB 2Y5CA 2YEPB 1WCMB 1C4AA 2Q2IA 3ZVVA 1PYBA 2MBBB 4K14A 4GNXB 2K75A 4DV1L 4A3FG 1VQKA 1WE6A 2CQOA 2SAKA 1KLGD 1W6JA 2CH4A 2LMCA 4OXPA 3V2TA 4LNOA 5M3MB 2KT7A 4URKA 1MBYA 4JI4Q 3MXNA 1R4MI 5EDSA 2B63B 4FULA 3KLSA 3HOVB 1NDDA 2K22A 1C9OA 3L08A 3VYUA 4WJQA 3PSIA 3RCZA 1RD9D 4TUUA 2G4SA 4FO2A 4EQNA 4YY3L 1LLRD 4HJ8A 2R7ZB 2C35B 1XNQL 2O2VA 3T1YQ 2MJ8A 1J7CA 3E3XA 4ZKCB 2SNMA 1Q82C 3APDA 1UWMA 1ENAA 3MWYW 4DR5L 4H2AA 5H1SE 4NXMQ 1O7LA 5T8IA 2KDBA 3A0JA 2RR9A 2IO0B 5KYIA 2HJ8A 2F52A 3KDFB 1A63A 3KUZA 3KK7A 1MI2A 1K52A 4KKJA 2KDIA 1GHJA 3NY5A 1LT4D 1MD2D 2A6ED 4F1SA 2B2VC 2MBEA 4IW0A 4ANUA 5JAVA 1PDXA 1OXVA 2NPTB 2FCNA 3CWIA 1BDOA 4OL7A 1NENB 4ZRIA 1VLBA 1SYCA 2IGDA 3VDZA 2WB1B 4YT0B 2WYQA 3I9V1 2PQAA 2FIFA 1ZXTA 1FMAD 2W82A 3ZJVA 1QOGA 2OEDA 2LASA 1TT5B 3PCOB 3PZDA 3F2BA 3R2IA 3SGIA 1TGZB 4WJ4A 2KWDA 4JI3Q 4B3SL 2Y5PA 3RI7C 4JOIC 1RTNA 1BF4A 3WWVA 2WXMA 4JBWA 2R93H 3U8ZA 3QR8A 3I4NB 2FHTA 1L7YA 3CHBD 4HROA 2KJXA 2IY0B 3WANA 3Q6SA 1HZ9A 3AU7A 4R3DA 3I7FA 4N8FA 3RNCC 1S5BD 2IGGA 1WX7A 4IKGA 1MHWC 1A5RA 4JBJA 3OAWA 5KEEA 4KHZA 3BVZA 2OJRA 1SDFA 3P4QB 2K7VA 1AARA 1C79A 2NR2A 2D11A 2E2IH 2MJ3A 1YNNC 2PIAA 5LNK1 5C4XG 4BKGA 2ZM6L 1N34L 4DV0Q 4WORA 4PT5A 1O7YA 3B6YA 2JYTA 2BVCA 1OO9B 4UAIA 3AU4A 1MJCA 3S2AA 3NVWA 2RDHA 4DV5L 1EIHA 2IX1A 3NBHA 4P72A 2Z6BA 2K4KA 4KVGB 1IBKL 1F2YA 4YSZB 2E8GA 2C9OA 4DR1L 1Y56A 3UDXA 4RG1A 4A3IH 3LNNA 1M90C 3H3VH 2O5IC 3A9KA 4HKZE 5E1FA 3DVGY 3UIOB 1DZ1A 1GKHA 3U7ZA 2CW0C 1KD1C 1SIJA 3AMZA 5IAAC 2LXKA 2LVPA 2KN5A 2KHJA 5H92C 1KOTA 4Q5VA 4AUQC 4H02A 4J6IA 3Q8BA 2F0VA 1L0VB 2BH8A 1AFPA 1OGWA 4IUMB 2I38A 4BBNF 1R4MB 5IWAL 2JYEA 3TS0A 3TEWA 3BVMA 3RD4A 4LF5Q 2YVCA 1WTRA 3I3TB 4LJPB 3OOCA 4AYBE 2NTTA 2F0JA 1VQAA 1EY4A 2J7QB 2OJWA 1UD7A 4YSXB 2HE7A 5IA7A 3IL8A 4XDXA 3QB3A 3G7LA 1RDPD 4E74A 3B08A 2E2IB 2N7JA 3JVZX 3FRPB 3AECB 2RHSB 4A3EB 4FHKA 1WI0A 4OZBA 4Q2JA 3SXHA 3NTIA 1HQRD 2UXBL 2ZW0A 2CJOA 4UP9A 2KFKA 1JICA 2WXFA 1F9RA 2C5CA 2DZKA 1Q46A 2L8JA 1KHIA 1ET6A 1K53A 3PZ8A 5I2XA 4AQYQ 5A2QL 1LT3D 2IY5B 2LD9A 1WFQA 3HKSA 4NMZA 2JA7G 1WI5A 5HURA 3DWPA 4F88A 1SNCA 3F2DA 4IOCA 5DPTA 4GKKL 2ZNVB 1C3TA 4DV6L 2KJRA 3CCLA 3DHIC 1PV4A 4A3GH 5C0XH 1GUWA 1EM7A 1JMCA 1YI2A 2F0TA 3UIPB 1WOCA 1HEZE 5JVH3 2MQHA 1AWDA 1OEYA 2JXXA 3C2PA 2GN5A 1AZQA 4K81A 3TN2A 2F1MA 5AZHA 4V190 3IHPC 1OXUA 2DYOA 4AH6A 1TJEA 1OXSC 3H91A 3M9BA 3BY4B 1EQTA 3QOJA 1K3RA 1OQYA 2JSVX 3PHWB 1O80A 4LF8Q 1V43A 4CKEA 3EECA 2FUG1 3Q3JA 3Q0AA 4BWGB 1L0WA 1WXVA 2NBWB 3D4RA 3NZUA 2K5DA 3STBC 4BOZB 3LWEA 4TKNA 1HFGA 2VY3A 1VQ4A 2K5HA 3DLLA 1R9TB 1K8OA 1Z5SB 1X3EA 2VZKB 1WTOA 3I4OA 3S1NH 4DV3Q 1WD0A 4XYCA 3HUIA 5JVG3 1MG8A 1Z7TA 1FYCA 3K5NA 5L95C 3VA7A 1J7BA 5FJ8G 2H88B 3C0RB 3CRLC 1EUVB 4QF4A 1HA5A 2K8CA 5CR3A 4DV4Q 4HRSA 3U7DA 2AL6A 3QCAA 1N33Q 3L13A 2IWHA 1T0SC 4YWKA 4M8AA 1JWMD 3DDCB 1NBWA 2YV5A 3L7ZC 2ZW1A 4JL9A 5CV7A 3N1XC 1V9PA 3LX0A 4KTAA 3ER0A 2LS01 4OONA 4LF6L 4DR6Q 1DM0B 1Y1VG 1TZ1A 1ZW7A 2AL3A 5BMHA 2O4XA 2SNSA 4JI8Q 4A3GB 3JAMc 3LWUA 1EF1A 3CU7A 3ZO5B 1VQCA 3L16A 2IGHA 4L5RC 1GUTA 4A90A 1T0RC 4RM9A 1Q10A 4KKIA 3MHZA 4O1NA 3E0EA 4BBRH 3VTVA 3U50C 4C3HB 2IHFA 4LWCA 2F0OA 5AJ3L 2A6EC 5CBAE 4DR7L 3NELA 1M1KC 4II3B 4HK2A 4DXFA 2O5JC 1WYGA 1GO3E 1OFFA 3FILA 1I3QH 1S5CD 4REZA 1WYWB 1V8QA 1SNDA 4B3MQ 1N32L 2VRRB 4JIOU 2PNRC 4NQKE 2MP2A 2RVLA 3AH7A 3PRMB 3S1NB 1ISNA 1KLUD 2J0KA 3W9CB 1V1OA 4YTPB 1RODA 2L55A 1HXYD 4GOPB 2MCNB 2N9KA 2B2WC 3ETRA 3TIXA 4DHZB 4CQNA 3A8KE 1MPEA 1IBML 2WLBA 3VYSA 1F9JA 1TQOA 4QUCA 2LGYA 4XYOA 4HMJA 5LLIA 4PZ8A 2Q8IB 2ZVOA 1H9MA 3ZW3A 3U52E 2E75C 5J2RA 1I4PA 2VQFQ 4KI0A 3SHQA 1B1ZA 3P7JA 4IPHA 3J81j 3C19A 3D4WA 3TZUA 4R4TA 3K7UC 1KL9A 5JEAH 3NE5B 4BOSC 1VCBA 1IYJB 4JI5L 1B8AA 4BBRB 4KHVA 2QF7A 4GN5A 5FLXE 5IGBA 4BZAA 1XWEA 3TP6A 3B2GA 4BA2I 3FKYA 2B3AA 1I3QB 3QHTA 4PNYA 3FP9A 4OVVA 2VB3X 4JI0Q 1SJHD 2PW9A 2E74C 3CSFA 4RA8A 4MIUA 2EYMA 4ITKA 1CKNA 2KC2A 4NZLB 2SEBD 4CGYB 2AUJD 2KVZA 3TCAA 2WV6D 1B70B 4JC0A 3F8TA 1EQRA 2C7HA 3Q2AC 5EJWA 1WXQA 1HH2P 4K2LA 3I8ZA 3A54A 4A3LG 3ZJYC 1F2RC 4A3PA 1YHQA 5DEHA 3A9JB 4TV3A 3VTUA 4G4KA 3P1MA 1C4PA 3S1MH 3M3JA 5ELDA 3SE0A 1YJNA 3CMMB 5ISRA 1G2SA 2NVYH 2CHXA 4P1CC 4GS3A 3RLNA 1C0AA 2IL8A 4G7ZC 3NWTA 4GKJL 1FL0A 1VQPA 1EY7A 4I6NB 4OGQC 3EC8A 5H8YE 3EQLC 2K39A 2EOTA 1PH9A 2PI2A 2HJ1A 3BK1A 3BWUD 1L1OC 4DK0A 5I9OA 5EBCA 1FPYA 1ZE3D 1KC8C 3DVGX 5HHDG 1N9WA 2N49A 3BDOA 4HDOA 1Q7YC 3Q8AA 4AJWA 4IURA 4CO7A 4Q0FA 2KWVB 3D6CA 2FBWB 1NYRA 1E7ZA 2RDGA 2EJGC 3BG3A 4WJOA 3S2HH 1WR6E 3KBGA 3GB1A 1X9NA 4KGSA 2BB5A 2GOWA 5TR5A 3E5SA 3HFZB 2IO2B 1BMLC 1YN3A 1F1HA 3PRZA 1H9SA 5LHY1 1C1YB 3ZLZA 2W3RA 1TWAH 1N5XA 1S5FD 2FNJB 3T9LA 1TR5A 3QWZB 1JB3A 2BTEA 3EJIA 2F0QA 2L9HA 1PRTF 2KAJA 2VQEL 5C44G 2K04A 4B9XA 4Y52H 1EOTA 3VR6A 1WGDA 3CPFA 2BE5D 1JWSD 2FMMA 2LFNA 4RKBA 2D2QA 3ULPA 4YWGG 4PV1C 2K6AA 1C48A 1YN5A 2MA9B 2CKHB 1NSNS 4WAAA 4JK1C 4LNIA 5C4XH 5M5YH 3NBIA 1SMYC 1E3PA 4OX9Q 2R2QA 3CCQA 1CK1A 2AWNA 1IXRA 3KVFB 4X65Q 1CQFA 1UGJA 1X3FA 5M5WH 5I6WA 1ET9A 4FF4A 4BY1G 3N3KB 4D2KA 4EVOA 1M8AA 3B0AA 2K25A 3GV6A 1X55A 2I46A 2D07B 4J8QA 2AX5A 4P75A 1FNWA 5FOBB 1XPRA 3S24A 5K36G 3S2HB 1JWUD 3K58A 1FEHA 3ZGZA 1YNTE 2RSOA 4CJ2C 3H6NA 3QA8A 1H9JA 2QA4A 3GE3C 1C78A 4CDFC 4M01A 2FXQA 4KJOA 5ELOA 1TWAB 5COYA 3SFEB 4M8NA 4QAYA 4RGNA 2HHHQ 2IBIB 2MP1A 1S5DD 4X62Q 3U4EG 2I07B 2JJQA 3CCMA 1PTOD 3FMCA 4ZRQA 3AEFB 1B9MA 4K7SA 1PRTC 2B2YA 4ZRKA 2HDLA 5ELNA 1XMOL 3SVMA 3KWLA 3U30A 1QOHA 3CC7A 1WXMA 3H9DA 5DAUA 3P4PB 1S40A 2Y0SE 1EQVA 2MGSA 2BKFA 2UXCQ 1CA5A 2QDFA 2WGSA 1CFMA 1GG3A 2LGIA 5EAYA 1VD2A 2KXJA 4PK1A 2B8FA 3L17A 3ERQA 2A8VA 5C4XB 3BZDB 3R93A 3S9WA 5M5YB 1SSNA 3A1QA 1NBFC 4W9EA 1IKLA 4RF0A 5EKIA 2ZTEA 1V1PA 5LMUQ 3PO2G 4DXGA 2WNMA 1E1OA 5M5WB 4A8XC 4NPNA 3IBEA 1GXDC 1VQIA 3SU8X 1MSHA 5LMNW 1FO4A 5KHQA 1JRPA 3BZCA 4BY7G 3T3NA 4BA1I 4GNXA 1PFDA 4LTUA 4JI1L 1WTXA 1SLJA 3KYHC 4A93G 2BS2B 2UUBL 1JJCB 2KCMA 4HPLB 2A6HD 1CKOA 1L6UA 3KUCB 1MVKA 4M0WB 5E6PA 1I4HA 1EWHA 3QK0A 2NVQH 2KJHB 3A8IE 3RNUA 4K2KA 4DAMA 3GDEA 3AFQA 4HKQA 1G2TA 3MA2B 5E7NA 1MJDA 1WF9A 3AFPA 1LO5D 2PCFB 1QZEA 1P1AA 1QLBB 2WP9B 4JYAQ 5EPJA 3DM3A 5D65A 1C77A 2R7DA 3NSWA 4RKLA 1UEBA 4OO1G 4EE2A 3OW2A 4WIPA 1B2TA 4DUYQ 2BYVE 4U68A 4DV7Q 1QVGA 1VQGA 1E8ZA 3KDFA 1WJUA 2ZPYA 2KX0A 4G7OC 2XK5B 1S1QB 3AE4B 1YOVB 1RHPA 1DOLA 5CHFA 2Z6KC 4DQOC 2GBRA 3TJPA 3RMHA 1DYQA 4LDTD 3D6WA 5FJ8H 3HOXG 2NPTA 4B08A 4KD4A 3DOWA 4V0BA 4IO9A 4JW0A 3GTOH 2BA1A 4X6AH 1WFYA 1WX8A 3PLUA 2OTJA 3RUIB 3S1RH 1DONA 3VRBB 2JA7B 3N1ZC 3SR1A 5D3DA 3ALBA 4JVZA 5C3EH 4PYZA 3CF5A 2I5LX 1Y1VH 1PZKD 3EFUA 5J39A 2OOBB 3I90A 3QIJA 2D2CC 2RMMA 4A3BG 1HNXQ 5G3LF 1F0ZA 2EDGA 4R4QA 2F0NA 3DVNU 1SGHA 2RBMA 1NE3A 3KF6B 2MJDA 4R4OA 3PUVA 2K6QA 2FJ2A 5IGGA 4HWIB 3SHLA 3T51B 5IY0A 2Q2HA 2PTLA 2F0HA 1X56A 2Z1CA 5C5MA 5FR6A 5CGKA 3TP8A 5E3FA 3N30A 2KFJA 4XQNA 1NMGA 1L5PA 4PYUA 3PMFA 1ZDXA 1B53A 3CW2C 4OZAA 4JI7Q 4LCDE 3JYUA 1JQ4A 1T0YA 2N88A 1WIAA 2BQQA 2G3QB 2LWPA 4B0EA 1LYLA 2KDEB 3CF6E 4LF4Q 1K0SA 1ZXIA 2JT4B 3IFWB 1BO0A 4KJNA 3W2DA 3MZ5A 2EYPA 1L0XB 4QIWE 2K33A 4P6VF 4LFBQ 3S1RB 3CXCA 2PZUA 3RZFA 4IUQA 1A70A 4KY5A 4IN3A 1PTOF 1Y8OB 3KUPA 1ML0D 2MLBA 3Q6BA 3WALA 1D1IA 2UXDL 1Y1VB 2L83A 1HHVA 3S2DH 1JE5A 4XX5A 1PGAA 5IP9H 2GBMA 5CX3A 3HHMA 3W1SA 2E5LQ 2PE9A 1I4QA 2VXWA 4IUUA 1J6QA 1OTRB 1L0YB 3FEWX 1K83H 2RDBC 4FN2A 1VQEA 5IP7H 4BKSA 5BN5A 4DR2L 1MHXA 5M3FH 2N78A 1N61A 4C1NI 1EWIA 4WAFA 3NTHA 3HOUG 2MQJA 1ZOYB 3M62B 4N59A 1WTHA 1T9HA 3SK4A 2KNBA 3AE7B 5T1GA 1PQSA 4GSWA 5JH5C 5IN7A 3L3OC 1F9PA 1SNQA 3G48A 1SF0A 1HTLD 4GLVB 5BR8Q 1STBA 1TWCH 2EXDA 3M7GA 2R3ZA 3JAMi 2HQLA 3EIVA 2VL6A 1VDVA 4TKOB 2WX1A 3S15H 5JOBA 3TSSA 1ZPSA 2HUGA 1EY9A 2ZTDA 5M3MH 4R8IA 1BCPF 4B3ML 3V96A 5JJIA 4LF7L 1U4AA 2M0XA 2NBVB 3R8BA 1YNJD 2DNFA 1XNRL 1V6EA 2AQ1B 4I7ZC 1KQSA 2BWFA 2W3SA 1V9JA 2D3GA 1SB3C 2D5DA 1HTPA 1FJGL 3KF8B 1WGHA 1WM3A 4A3LH 4ABNA 3RLFA 4FDBA 1PTOC 3QIAA 3VR2A 3ZUNA 3E6ZX 4W9DA 4L5SA 3S2DB 4KIKB 4A75A 3M95A 5CV8A 1BOSA 5IODA 2L3ZA 2PPHA 4JGHB 4XQQA 2W55A 3QAQA 2CCZA 1L4ZB 1PFBA 3HKZE 1IZ6A 4W9KA 4EZJA 4EZKA 1UBIA 1II3A 2E6XA 4MH8A 2DNCA 2QCPX 2VH1A 2LHDA 4BKSD 1CQVA 1GUGA 1HQMC 1G51A 1TS3A 1UE6A 2JQOA 4HCSA 2ATWA 2IYDB 2W9NA 2F0PA 5E6NA 1I94L 1VCIA 4XWWA 1QOBA 4X66Q 1FNUA 1PH7A 2L76A 3NTKA 1LTLA 3TMEA 1R4NI 2NZ1D 3ERSX 1TWCB 3CCUA 3DMUA 1WTQA 4HCPB 3J80i 2KACA 4UP8A 3CRKC 2BH2A 3S15B 5ELBA 1WM2A 1N62A 2PE6B 2WX0A 2KQ3A 3KUDB 2L1AA 4AJYB 4MSQB 1HA6A 2ES2A 2G9HD 2EIFA 3PUWA 4ZK9B 1E9MA 4GN1A 1BCPC 4FBJB 3KH0A 4QQBX 4CHKA 3T8MA 1VJKA 3QC8B 2KKCA 1TWFH 2A68C 1KF6B 2GRIA 4IUPA 3I4NH 2K8BA 2WACA 5JJLA 2BT6A 1LTSD 4G57A 1A2UA 3IT6B 4PZ6A 2WFWA 4IOIE 4PS7A 3ZNHB 1JROA 2JXTA 3J81E 2XNAC 1PUTA 2JX5A 3K81C 2QIEB 4A3MG 1FRRA 1KFYB 4N9TA 3ZKJC 1A62A 3TRZA 3TQYA 1OQRA 1ICWA 4H13C 2IT1A 4HTHA 2VW9A 4JBKA 1SIFA 4YTMB 4CDEC 1IBXB 1FR3A 3MTNB 2NWGA 4C56C 4GLAC 3DBSA 1NI3A 3K9PB 5M5XH 4LK0M 3KOJA 2EYOA 1EIGA 3QG1A 3ZDMC 3PHXB 2KBNA 4LFCL 4LF9L 3CD6A 5L37A 1HNWQ 2M4NA 3HZXA 4RWSC 2B8GA 3TDQA 1IGCA 4BY1H 4B3RL 1HR0L 2L32A 1YHBA 4KN4C 3B9JA 3ML8A 3NOBA 4KKSA 3E9SA 4L6TB 2WXIA 1H9KA 5J1ZA 4AS1A 2B2TA 3OW7A 3VDYA 1X54A 1E5WA 4CDCC 3OWEB 3H7PB 3I57A 2PI2E 2N55A 1GD7A 4K6DA 4TMAB 2LGXA 4X3SA 2KYWA 1YITA 1VQNA 1IBLQ 3APCA 4DR4L 3T56B 1SN8A 3PIOA 1TWFB 4GOPA 1YJ9A 3I5JC 3M4OH 1EWCA 1TIID 1CHPD 1XCQL 4DK3C 3NENA 4IM0A 2D62A 5JHBA 2EYLA 3ABVB 5FO8B 1WTVA 1UWXA 4K5VA 4RCNA 1S3OA 3V05A 5C44B 4OO1I 1LM8B 4C3IG 1VMPA 1L2FA 3TBIB 4XTCS 5BN3A 5DM63 4K0KQ 1FM0D 3EROA 2M00A 1YNXA 4JV5L 2VB2X 5IT9L 3UF8A 2CH4W 4XT1B 3PGEA 4GDLB 4ZAIA 1Q8KA 1XO3A 4A3EH 5M5XB 1MGSA 3PO2H 1P7EA 4ID6A 1ZUD2 3L10B 2EE1A 4MGKE 4RMAA 3EVQA 4OELB 5KRUA 4FF2A 2RKSA 3DWMA 1Z6HA 5IGEA 1VQ8A 1NEKB 2D0PA 3ZRFA 2MHJA 4AWJA 1IGDA 3K7AH 4GZYC 4BY1B 1I4RA 3PGZA 1EO6A 1CA6A 1J8IA 4BY7H 2JQRB 4FXDA 3HOWG 3KLWA 5LL6S 4A3CG 1R4NB 4FJVB 2KOXA 3CPWA 2M2LA 3AEVA 1GOZA 4XC2A 4IJLA 2BCOA 4ZQ3A 5C3XA 2UU9L 4JI6Q 2BDNA 4A93H 4MNOA 4X64Q 2JXMB 1LTID 3CMAA 4DK6C 1VF7A 4MM3B 1FRDA 3X23A 4EGVA 3M4OB 2MW5A 1FVIA 1XYIA 4K8JA 4IFDG 1D2BA 1XLOA 1D5ZC 2MWSB 1YZ6A 4MTKA 1N63A 2JZ3B 3KW5B 4HEA1 1SE8A 3HKZG 1XLPA 3ITPA 5ELEA 2MUYA 5G5HA 1HNZQ 3W1BA 4IUVA 3A9JA 2WAQE 3JC66 2E2JH 5K5PA 4QCLA 3OJ4B 1VQHA 4HIOA 3QO2A 1C9FA 3X3NA 4OO1H 2R6GA 2IO3B 5HG2A 4I65A 2XBBC 1R9TH 2HCCA 1JORA 4HPPA 1TU2B 1L6VA 2K14A 4PMWA 3LGJA 4QGUA 3J7YW 5EE0A 1P8LA 3PO2B 2KHIA 2DAFA 1DGSA 4I7AA 3FPPA 2KLGA 3AE2B 1YX6B 2JA9A 2MBOA 4M00A 4B6WA 3K7AB 1K73C 2INCC 3FDTA 5D14A 1ILPA 5JJKA 3TREA 1YNJC 4HPMB 4BY7B 2Z9HA 1UGMA 3LB8C 1WRIA 2DAJA 2LHEA 3RUZA 4ZRJA 4DA2A 4BXXG 3E9HA 1SE3A 2QCZA 4G11A 4HJKA 4B3TL 3WIMA 4A93B 4A3JG 1N8RC 3N1YC 2QW7A 2HD3A 3K80C 3ND9A 4K5WA 4DUZL 2LXCA 2DWQA 3P2BA 2VS1A 4WWPA 2PMZB 2YU9B 5D2MB 3I4MG 3G6JB 3H6MA 4ZYSA 1BUIC 3OIQA 1V97A 1GB4A 1QVCA 1F2RI 1UH6A 4YHHQ 4LUOA 1XMQQ 2JY6A 1BBUA 4DR3Q 4ZCKA 3V6CB 4C3HH 4W9IA 1N5WA 1JE4A 5EBDA 3MC9A 3C3LA 2E2JB 1QUQB 3K0YA 4O0AA 2I5MX 1TTNA 1LQBA 3PPAA 2UUAL 1Q8IA 3DPDA 3MTSA 4MGIE 1JB7A 3K0XA 4ALPA 1HTOA 4DBGA 4TRDA 2EYJA 1WGRA 1J5EL 3OTOQ 2I1KA 3P4SB 2HT1A 3BU2A 4DUYL 5CYUA 2CQAA 3CCRA 2Y3AA 3AU5A 4L2YA 4X57B 5E6OA 3RFZB 2F0IA 1XQQA 3U4VA 3HOXB 4WWNA 1ZEQX 3M3YB 3W1YA 4NB3A 4WFN3 2CKZB 4UHVA 1PFSA 1JCKB 1YJWA 2VUMG 1LABA 4JPBW 1SR3A 4MN3A 4LUZA 4HJ9A 3HG9A 2GBKA 2LUMA 4W9FA 5J18A 4GXBA 4IC7B 3NVZA 1ASZA 2HCIA 3MXUA 1AEXA 3H3VC 1JOOA 1YIJA 2JA5G 3D8GA 2KLCA 2ZJDA 2LMCB 2XGTA 2WXNA 2ALYB 4ASWC 3A8JE 4A3BB 3HM6X 2ZNVC 2V4LA 3DCGA 2F3VA 1XX8A 2CVRA 2F4VQ 2FCMA 4C7ZA 1SYEA 2N9LA 1Z9FA 3RYTA 1NUCA 3BDLA 3UDFA 3PO3H 1JOQA 4JPSA 1PH2A 2N7EA 2OT2A 2O2VB 1STYA 4CJ1B 1K8RB 2F0FA 2QKIC 3WOEA 2J42A 1X3GA 1NY4A 2PVOD 3MC0B 4BAXA 3PF4A 1STGA 2C7NB 1BBXC 4MHEA 2YYZA 5IOIA 2ZPNA 1BVSA 5DNFA 4HCNB 3EFCA 2QEXA 1HE8A 1XF5L 3B2FA 3CIRB 1TWGB 2D0OA 3GV3A 3J9CA 1DOIA 3K5MA 3WOFA 1NYQA 1Q1OA 2K5VA 2L15A 3D4DA 1B9RA 1X1MA 4G3XB 4LFAQ 2G45B 1TYGB 2UYZB 1D5XC 3AEGB 3A7LA 2MBHA 4A4IA 1XT9B 2ZVNA 1ICFB 5C2TB 1EFID 2ON8A 3HRZC 3VYRA 3NHHA 1RWSA 3PV1A 4C80A 2L0CA 3PIO3 1Y1WG 2GMIC 5CBEE 2LUEA 1KM7A 3V61A 1GJZA 3TEHB 1XD3B 1A0IA 4IUTA 3DHQA 3OMCA 5C6AA 3JSVB 4RHSA 1M4VA 5KNCA 3SDZA 4HCEA 1QCBD 4Y7NH 3WAPA 2R61A 3MXGA 4YCWA 3IVFA 5NUCA 1YJJA 2CFMA 2MO1A 4AYBG 1YQBA 3I70A 4DXAB 5EPKA 3J81c 3MAQA 1N36L 1OTCA 2PVGC 1H8CA 1E2ZA 4J3OD 5D3IB 2VNUD 2YLMA 3S14B 4BBSG 3ZNGC 1XXGA 4OIJA 4F7ZA 4YIJA 2LJ5A 4TQ1A 1F52A 1D8LA 1SE9A 1Y8PB 5DM73 3T1HL 1YHAA 1MI0A 2NS5A 4EX5A 1E8WA 2A74C 4A3DG 2O6VA 2ZZPB 3BZKA 2N9EB 4P73A 3A5ZB 3VVWB 4BKTA 4RGMA 2LSSA 3S1QH 4FYDA 4NQLB 3G71A 4A3FH 2NN6G 4L5QA 4KHPL 1YD8U 3APFA 4JI2Q 2B3GA 1LACA 2L1BA 4RM8A 3OHXC 4DNRB 4ARCA 1NVID 4CKBA 2XK5A 2QC8A 1B4OA 1K28A 3D0FA 2WXJA 2Z0DB 4WRDA 2BKRB 1L1OB 4NKLA 2KECA 1V1QA 3ZRCA 1VQ7A 3GTPH 4DV1Q 5M9OA 4IPCA 1AZPA 2I0QA 2GBJA 1ZKOA 2WDTB 1MSGA 2EY5A 3VRAB 5JHAA 4KN7C 2DBYA 2HDEA 1OXTA 5EE1A 4ZOHC 3DWAA 3A9KB 1QILA 4Y7NB 3B1LX 1CZPA 5I2YA 4EQ5A 1WY8A 1GB1A 4P7IA 5CV6A 3CC2A 3I72A 5EQ0A 1TWHB 2EMTA 2CHZA 4NJ7A 4DV2L 2DYBA 2KC1A 1EYDA 2QHOA 4JCVE 1XNQQ 4NXNL 2K9XA 2WXLA 2OF1A 3KF6A 2R92G 1VQMA 4ME3A 1YBYA 1I5FA 2LJIA 5IYBG 3S17H 4DR5Q 5IE8A 3AE1B 1HZBA 3H7SA 3DHGC 4XQJA 2E2DC 2PQEA 3HS0C 5E4WC 2O6VD 4I6PA 1VZ7A 4KX6B 3CSTA 1T5EA 3S1QB 3RNAC 1Q0WB 4US8A 4A3FB 1JJGA 5BMIA 1AH9A 3H94A 2JA6G 4ARIA 2MHVA 3UI2A 4ACFA 3ULJA 3IFDA 3OIPA 1H95A 3VTWA 1DOYA 5JXVA 1Q81C 1VZ8A 4IFDI 4NJCA 4HR7B 2HTME 3Q3OC 4XGAB 4EKUA 4QJFA 2KFKB 3I56A 1V49A 3GTPB 4JBMA 4JI4L 2RCFA 3PSEB 3TP5A 1B3AA 4MSMB 3OLMD 2MH7A 5CHVC 2JRHA 2L4NA 4JWUC 2X6LA 3VR9B 3UQAA 3PVLA 4DF7A 4B3SQ 1UE7A 4A3MB 2D9UA 1SYBA 1HZCA 3PUXA 4C3IH 1XPOA 2DNEA 3QJYA 1VQOA 5FO9B 3T1YL 2L52A 3M7NA 5HFYA 1SSOA 3VA5A 3J80L 3BVGA 3OG5A 4DAYB 4NXML 1JALA 2DENB 1Z2MA 4DGZA 4Z9CB 5ELCA 2AWTA 4IWPA 2EY2A 2KTRA 2PPBC 3VUYA 3TS2A 1J7AA 3W5UB 1U4MA 3A33B 1PRTB 3S17B 3ENEA 3P42A 3ML9A 1KABA 4YWMA 1ZDVA 2GVAA 1VQBA 2RSNA 3AN1A 5IT9E 4MACA 3NXWA 3TUOA 1PMRA 2DGYA 3PT2B 3M4YA 1F2MA 1G6ZA 2KVMA 1EZ6A 5FKAC 4YWLA 2ZM6Q 1N34Q 5AUIA 5GROA 3HOWH 4A3CH 2LI5A 3RN2A 1CM9A 3JW0X 4MJSB 4P2CB 3I73A 3RN5A 3E0JA 4DV5Q 2ZXRA 3M63B 1SEBD 2AKWB 2CJNA 3G6EA 1FCCC 1PH5A 1LFDA 2LVQA 1IBKQ 3FKIG 2FMCA 2ZCCA 3RPFC 3TL5A 1IL8A 5CV9A 1Q86C 4KSKC 1QZGA 4JI3L 5CC4A 2W54A 4EQPA 2IO1B 3DM1A 4KKTA 1MKHA 4DPGA 1T0QC 3GTLB 2PKOA 1WRDB 4ZLTF 3A56A 3IAYA 3KF8A 3PO0A 1HUMA 5IGCA 4ODGA 2A69D 4C3IB 2AYOB 2D3BA 2KCTA 4HLEA 4KIKA 1QG7A 5JZEB 1SE2A 2EMSA 4DHZE 1U5KA 3F2UA 1GPXA 4ICUA 3W1GA 1ASYA 1CZGA 5IWAQ 5IYDG 2KVRA 2I2YA 4GOCA 1RJTA 4NP5A 2R93G 4F87A 2G4DB 1P9DU 1TIFA 4IOAA 1GAQB 1EF5A 1PZJD 2P5ZX 4YL8A 4DV0L 2ZJPA 3FPUB 1UZXB 1ZYRD 1TKYA 2KUMA 1WVLA 2WDQB 5G55A 4OW0A 4RAUC 4IM2A 3AEAB 3AYHB 5GMVA 2QMTA 4FJZA 5BO4B 1PH1A 2X8XX 4APVA 2JA7H 4HVBA 3HOWB 2AHOB 1UBQA 4HDQA 1SROA 4WJWA 3N32A 2Z0SA 3M4PA 2UXBQ 3T13A 4BXXH 2B2UA 4LJZC 2B2VA 4DNIA 2N8NA 4A3JH 5C3JB 4NAWB 5A2QE 1SMXA 2I1JA 2BW2A 3KFUA 2DUDA 3I4MH 2J0JA 1V2YA 3KYDD 1EYAA 2WXQA 1D3ZA 2YTVA 1BBWA 2K32A 4POGA 4CYEA 2EXZA 2A73B 2INNE 4K7WA 5J3BA 2PEAA 1WZ0A 4GKKQ 1PHJA 3HKZB 3BIID 2M0AA 4A3IG 1ENCA 2C5LC 1RCVD 4DV6Q 4LF5L 3NJTA 4N8X1 4PMCA 3UQBA 4CJ0B 1FD6A 2WKCA 1MHHE 1IYVA 4RHRA 2NTSA 4LNQA 1WMHB 3Q14C 1IBXA 1A3TA 1CUKA 3NQTA 2TMPA 2NZOA 4L63B 3PO3G 4ANVA 4MELA 4XDDA 1K0RA 2V1YA 3VQIA 2JEBI 1KDCA 4YCVA 5HKHA 2XN9C 3IAS1 4K3BA 4NJ6A 1I7HA 3GQBA 2R2OA 1A3VA 3NEMA 1K8MA 4LMQD 2L0FA 5IKCM 2WXHA 4US9A 3PLVA 1NJIC 2PNHA 1FXAA 2VUMH 4AQYL 1DD2A 1GC7A 3QARA 3H7PA 4BFRA 2IPKD 2UUCQ 1B44D 1RTOA 4A3JB 4JWSC 2JA5H 2WDVB 4OWTB 4QUFA 3PREA 3GTKH 3C1EA 1LT5D 3I4MB 3URYA 3EN2A 3CP0A 1VF5C 2XEWA 2ZJRA 1RLFA 3P4RB 1VQFA 2XWBB 1I42A 2F0WA 1CMXB 3TMPB 4B9KA 2KA7A 5GAHC 4FF1A 2A5UA 2Z59B 1X3PA 4LF6Q 1EOVA 2KENA 3NZ3A 3OJ3A 4IG7B 1XJVA 4EOYA 4K6LA 2J4XA 1CI3M 4RF1A 2CWPA 3IRBA 1YN4A 2GLSA 2FFKB 2NN6I 1FCLA 2XRQD 4HJ5A 2HDMA 4QL5A 2AWOA 2CWAA 2M56B 3J7ZC 4LF8L 1SNOA 2Z4IA 4LAAA 3CAMA 4R4CA 5C0XG 4GDLA 5FLXc 1GVPA 3NK9A 4DKAC 3PTFC 4NPSA 3NS1A 4WH4A 3L2PA 2AQ2B 1D6EC 3DWQA 1UNSA 4II2B 4DR7Q 2Z4HA 1LM0A 4C1NK 2X6GA 2KWUB 4DHJB 5DPRA 2QEJC 1EIYB 4DV3L 2WU5B 3TEZA 4KK7A 2A4ZA 2KQSA 3K6OA 1Y1WH 1UELA 2HQEA 3G4SA 4DV4L 1YNND 1TXYA 4A76A 3PUYA 2VUMB 2EYFA 3K5LA 1N33L 1SE4A 4S0RA 3AE9B 3VFKA 2WXKA 2KHWB 1Y8RC 1W3SA 2JA5B 4LJOB 2KEEA 4CBVA 3GTKB 1ZGUB 1F9QA 3U9SA 1CKMA 4DR6L 4P74A 2PW7A 4MM3A 2BE5C 4R8NA 4RGOS 4JI8L 1IBMQ 3DBRI 2Y0SG 5IGDA 2K5NA 1FGUA 5AFWA 2NBFA 2OQ0A 5HY6A 1PH8A 1HZAA 3BJUA 4QMGA 2RPVA 4XWTA 1PTOB 2CW0D 3ICEA 3ZNZB 2DJGC 3PS6A 4YCUA 4LNKA 3HIZA 4A3DH 4WQMA 4IM3A 2XWJB 1WTWA 3RMKC 4KGRA 3WA0A 4W9GA 2NUCA 3SK5A 3DEOA 1V5OA 4A20A 2KCCA 1V80A 3OYYA 1SJED 3A74A 3L9AX 4TQUS 4JI5Q 3GTQH 2E3TA 3L0WB 2WP8J 1K51A 4IWOA 4WQOB 1NMFA 2BB6A 4KGTA 3AB9A 1A3UA 4HJ7A 2F0EA 3Q3NC 5LL6X 3ECIA 4OEMB 3VXWA 2OQKA 2MNAA 2BBCA 2BYEA 4I6LB 2WS3B 3ZIMA 1Y1WB 3GZNI 4B0MA 3R3OA 1NI2A 1G6JA 2RQXA 1PYWD 3HK0A 5EGTA 1JJ2A 2K1FA 4LNFA 5BYRA 3F2CA 1BCPB 1FXTB 3BYYB 3QWNA 3V60A 4ZUIA 1WZ3A 2KOLA 1AE2A 3KBXA 3W5OA 3ZNID 3KJOA 4AYBB 1EU4A 1UF0A 1XCTL 3UE1A 1ENFA 2AUKA 4GIVA 4BBSB 2EJFC 1STHA 2F0DA 4W9HA 1E6EB 2R92H 2VQFL 2WQYB 1XTDA 4TVAB 1DOKA 3NVYA 1SYFA 2PO4A 4HSVA 4K5XA 5IYCG 3GTGH 4A3DB 3MFGA 1DXMA 1QUQA 1XLQA 4KZ0A 2RCNA 2V3PA 1ZYRC 1FXIA 2YEPF 1K8GA 5GXGB 2HIVA 3T3OA 3L0OA 1YX5B 4GKJQ 4FNFA 3SEBA 5IP4D 3ONAB 1A2TA 1PDQA 4OIKA 2JA6H 1JR0D 3J81i 1AP0A 3GTQB 2JPHA 4JI0L 2F03A 5IIFA 2LGDA 5FK9C 1BR9A 4TSSA 3CMEA 4UPAA 5DCNA 2M19A 2L0TA 1DCZA 2A6HC 4QY7A 2G1EA 2A5HA 3VHTC 2EPBA 3H09A 4PMBA 2JRIB 3STBD 2KX3A 3GTMB 3R66C 4P16A 4H7BA 5C44H 2F0MA 3VR4A 1Y69U 1TBEA 1OEYJ 1EEFD 3PZ7A 1FD7D 2DY7A 4XE0A 2OCEA 1C7YA 2B2YC 3OSOA 2FCQA 2JUOA 1NAPA 2V3NA 2K3UA 2B2WA 2EKIA 2LVOA 4WJNA 3ULLA 4N6EB 4A55A 2BWES 2LEKA 2R92B 2VQEQ 1ESFA 1WJ4A 1HZ6A 1C4CA 2KDFB 4GMVA 3DBRB 1PVOA 3J80E 5HI1A 3GTGB 1Y8NB 2RF4A 4BS9A 4M1UB 3RZWC 2QDLA 3ZQ4A 1SXTA 2LKVA 5E4XA 2WXPA 4RNAA 1ESRA 1J9OA 1P98A 3NS8A 2F0GA 2OXPA 1WD1A 4HSPA 1GNUA 1RL2A 2JA6B 1N6ZA 2D10A 2C7MB 1YIWA 3MFYA 4ILWA 4QB4A 5I4DA 1VQ5A 5K36H 1I4GA 1PXUA 1SNMA 4GNXC 2VZKD 3GS2A 3DQVA 1R4PB 2AEHA 1UAPA 1T5XD 3Q22A 4K3CA 5C4ZA 2B2UC 2MBQA 1W2BA 2NVUI 2GB1A 2WDRB 3FKIH 2WXRA 1KDBA 1LUZA 1EFWA 1IW7D 3ND8A 2G9DA 3GD7A 4FXCA 1CSPA 2A1AA 3H3VI 2NVTH 2B29A 1H4RA 1QNKA 2Q8TA 1V86A 4A6QA 2N1WA 3KLRA 1X32A 4AIMA 1YVCA 5KGUA 2JZPA 4KV6A 1QVFA 3GZNB 4ANXA 2KD0A 3SR6A 3JSVA 3AE6B 1R7SA 1HR0W 1EWYC 4PS3A 2K1BA 2BS3B 4KY6A 1RAXA 2PZWA 3TP7A 1EY0A 5LMNQ 1B50A 2FCSA 1P16A 2KN4A 3MC8A 5IYDH 4C3JG 4EZLA 3Q3FA 1JQYD 1K50A 3AE8B 1EUJA 3IKJA 2J53A 4J15A 1XMOQ 1CT1D 4M8MA 1AN8A 3K57A 4KDIC 2MX2A 4JG2A 4OX9L 3NVVA 3CCJA 2N7DA 4WWMA 1QT9A 1HCZA 4X65L 1UE5A 2MPMA 2F3WA 5C4HA 3K59A 3UDGA 1TS2A 3UE0A 3HP3A 2QJLA 2IX0A 2RA4A 3EGRA 4MDKE 3I63C 4IFDJ 2KK8A 1HJPA 1O78A 1HTQA 1STEA 1E7PB 2ONQA 2K28A 1TVXA 4XZ4A 4HAEA 2YU9H 1L1OA 4O42A 1NR2A 1BNZA 3FKIB 3DWGC 3EFXD 4FADA 2VZAA 1NCVA 4N58A 2GA4B 1A15A 4LLGM 2OEOA 3DUZA 4JI1Q 2NVTB 1WJJA 4MH0E 2RHQB 1QE6A 2BOSA 2HHHL 2UUBQ 2L12A 4X62L 3GE8C 3AXCA 2JA8G 2SDFA 2INPE 2J7ZA 1WGYA 4K7UA 5C0XI 1PFMA 3MEHA 2R7FA 5EPLA 1J0GA 1WE7A 2JN4A 3HOZG 3N52A 2ASQA 4C4VB 2HTHA 3KJPA 5FO7B 4A3KG 1MG4A 1VQDA 1X6OA 1WTPA 1Q1BA 2MFIA 4KMUC 1HRJA 3RN9C 3PQIA 2UXCL 2K5WA 2R93B 5D7GA 3AEEB 4KKUA 1WXSA 1KRHA 2DJFC
chains in the Genus database with same CATH topology
3P20A 3U9OA 3BK2A 5MPOA 2K5PA 2O2LD 1QF6A 3A55A 2NMQA 3NUHB 1D4BA 2L11A 3M85A 1VZ6A 4B9WA 4F8MA 1C76A 3CKIB 1B9NA 1SYDA 1KH0A 4S3SA 3T16A 3HVZA 4JE3B 3T53B 4HJGE 3W5VB 2ID0A 1QB5D 2BS4B 4A3IB 2K0PA 1LTBD 1TS5A 2XSCA 4GDKB 4YTNB 2ZT9C 1TKEA 1EL0A 3UI3A 4DAYA 1BQQT 2EELA 3D31A 4XYQA 3PO3B 1NR4A 2Q8RE 1Q12A 3RZDB 2CHBD 1KNAA 4EQOA 4HMIA 3VYTA 3MJ5A 3W3AA 1I4XA 3VR3A 5CMDA 4FXKC 5I9PA 1L4DB 1PZID 3DXJC 2GI9A 1SMYD 3Q24A 2BDOA 5EKKA 1TS4A 3ZYYX 3Q8EA 2E2HB 1AYFA 1I6VC 4DNTB 3I91A 2DLBA 1E10A 2JSOA 4OVZA 3SFDB 4FXGC 2V4DA 1R4QB 2MJEA 4JX1C 3IAM1 4X3KA 1C8CA 1YMHE 3C46A 4LK1C 1ILQA 1F77A 3AE3B 3X3MA 2ENBA 2FINB 2QSDA 4L8JA 4HEDA 2WIIB 2XIWA 1SAPA 4KD3A 1ACCA 1SNPA 3I4LA 1A6XA 2KMMA 3VR5A 1BUVT 3MHBA 1TKGA 1PRTD 1EZ8A 1FFVA 1D5MC 3HVDA 4HN7A 1VRAB 2WINB 2CU3A 1UEAB 1T6BX 1IW7C 4H0LC 4XXEA 2NVXB 4RH6A 3AEDB 4L1BA 3A7AB 1G291 1HUNA 3NUCA 1GUSA 3AMUA 2Z8LA 1JC7A 4M0WA 1CJEA 2NB0A 2ICIA 1RFKA 4IQZA 5BN4A 1TT2A 3NWSA 2AQ3B 2Y0SB 4ZKBB 4A9AA 3HOUB 4MT5A 4UDUC 3HGBA 5A35A 1S4ZA 5I6YA 1G8ZD 1U9RA 1LTAD 4J1MA 2BA0A 3KLSX 1BXTA 3IFTA 1EY8A 4DK1A 4USAA 1F9SA 3D3RA 2QILA 1F2ZA 3R2TA 2ICEC 2H1EA 1RKNA 1WWTA 2B2TC 1RF2D 2SOBA 2ZXPA 1LT6D 4DU9A 2KHSA 3NP8A 2K01A 1ZXHA 5JJZA 2F0KA 2EY6A 3FVQA 4L23A 2ACZB 1PLFA 2FE8A 2X38A 3JAML 3KQ4A 1CTMA 2DN8A 4AQ7A 1WGKA 3ZJUA 2LY7A 1VR9A 2JEAI 3E56A 1JMLA 3S16B 1EY5A 3Q23A 4X3TA 3DEPA 3T4AC 2QDBA 1I6HB 4ULLA 5JPNC 1YQ3B 5C5LA 2ZXOA 2MEKA 2PLPA 3IXSA 1I50B 2EZVA 1Q1EA 1QOFA 4FF3A 1T3QA 3KWVA 4ZRZA 3GO5A 3N9YC 5T1IA 2DY8A 4E6IA 4IZ8A 1OXXK 1DOMA 3NQIA 4ME5A 4IDIA 3OMGA 4U673 2WXOA 4J6HA 4K8IA 2F4IA 1U4RA 1HPCA 3J81L 1KAAA 1LV9A 3CQZB 4GLSC 1IHZA 1YQ4B 3NPPA 1GHKA 1WSPA 3U2SC 1E0BA 1P7FA 1EU3A 4YXDB 3N6RA 3BS1A 1LTTD 1W6KA 3RZOB 4YSYB 3SK6A 3S1MB 2XRSD 3AB5A 2NVYB 5G3LD 1O7ZA 1EY6A 1C4QA 2IDYA 2RDFA 4QIWB 1HFNA 2EY1A 4XT3B 4DN4M 3P75A 5KNDA 3ZJTA 5KYLA 1GJXA 4IFDH 3NRZA 3HRDD 2D5GA 1TY2A 4WURA 4RCOA 2IW3A 5KIXA 1RM6C 2TSSA 1S5ED 3FC4A 3MVVA 2M9VA 1XTCD 1E2VA 2EJMA 2OHFA 1GUOA 1H9RA 1IKMA 1FFUA 1AW7A 4C3JB 1E2WA 1OQQA 2DYMA 3PV0A 1JOKA 2K05A 1CZWA 3LYYA 3MP9A 2PW5A 2B39A 1JWAD 4G7HC 1EEID 2K03A 1IUEA 3FILB 3TEXA 4DAVA 3Q69A 2JYOA 4CHTB 2PYKA 2KEDA 4NAMA 5AUKA 2EYHA 1DOXA 3WDNA 2XVSA 3GP7A 4N9PA 3K5OA 5G5GA 3TEYA 1ONLA 1QOAA 2JU6X 1RYJA 1LTRD 3WCQA 4NDXA 4DFAA 2JA8B 3L4PA 1DGJA 1BCPD 1KNEA 3PIP3 3EA6A 3HOZB 2A68D 2IJ0A 3C1FA 4A3KB 2WXGA 2WU2B 5F2DA 4F7XA 3Q8CA 2V4IB 1U4LA 1PFNA 1FNVA 1QKZA 5BMGA 2J0TD 5E6JA 1FGBD 4PQXA 1YJIA 1QWYA 3H8HA 1STNA 4OZCA 2F0SA 4H44C 2WKDA 4C2MB 1Q90A 5IGFA 1TZOA 1EYCA 1TKWB 5CORA 1KDAA 3Q8FA 2V0GA 1Q3LA 5CV5A 3H0GB 4OHJA 5ELFA 4XDCA 2K5QA 1SFOB 1U4PA 5BYQA 4TQ0A 1E0ZA 1QNUA 1QJOA 1PTOH 5C0XJ 3SK8A 1X3QA 1Z47A 1KTKA 5IOCA 2IX3A 2Q5WD 5KNBA 4NW2A 1V8CA 5EKLA 2B76B 4CKCA 2NVQB 1CHQD 4XIGS 1SYGA 1JW9D 3AM9A 3P63A 5FR3A 3OPOA 3AV8A 2E76C 1HZ5A 4C3HG 1ROEA 2KQ4X 4RGTA 2PZTA 1IYUA 1VMCA 4FVMA 2N0SB 2JWUA 5JPMC 1STAA 1VDZA 2NYZD 4ZUJA 4DAPA 5C3WA 1F2LA 1LTGD 2L5TA 3J7AF 1H9SB 2KCNA 1UUPA 3AE5B 2F0LA 3HEJA 5C4JB 3P1HA 4C7YA 3GTOB 2J52A 1GUNA 1XEEA 4R9WA 5C3EB 3C8YA 5EE9A 3EUB2 2H4OA 2PMVA 2NN6H 5TSSA 3LXFA 3AEBB 3O13A 3IT4B 1XLNA 3BDCA 3PUZA 1QQRA 5J22A 1FIQA 1JWBD 1D1KA 2X69A 2JP1A 3I3CA 4KY7A 1N60A 1PGBA 5BYSA 3TZDA 2A69C 4FP5D 4X3UA 3HOYB 2WAQB 5EE3A 4ZHOA 2JE6I 5CV4A 3V3XA 3QOLA 2H89B 1ZP0B 3OWFA 3JAME 4IALA 1SBBB 5HGTA 5JEAJ 3FAHA 2EVBA 5FLXL 1TY0A 1PGXA 1G91A 2KDMA 4IUNA 1K83B 5JEAG 1DJRD 1V1PB 3MXPA 5M3FB 2LFIA 2F0UA 4RFBA 3GTJB 3J7AV 4ZHPA 2BYTA 3BYTB 2Y5CA 2YEPB 1WCMB 1C4AA 4K14A 2SAKA 1KLGD 1W6JA 2LMCA 3V2TA 5M3MB 1MBYA 3MXNA 2B63B 3KLSA 3HOVB 2K22A 3VYUA 1RD9D 4FO2A 4EQNA 1LLRD 2R7ZB 1J7CA 2MJ8A 4ZKCB 2SNMA 1UWMA 1ENAA 3MWYW 4H2AA 5T8IA 1O7LA 5KYIA 3KK7A 1MI2A 1K52A 4KKJA 1GHJA 1LT4D 1MD2D 2A6ED 2B2VC 5JAVA 1PDXA 1OXVA 3CWIA 1BDOA 4OL7A 1NENB 1VLBA 1SYCA 2IGDA 2WB1B 4YT0B 3I9V1 1ZXTA 1FMAD 2W82A 3ZJVA 1QOGA 2OEDA 3R2IA 2KWDA 2Y5PA 1RTNA 1BF4A 2WXMA 4JBWA 3I4NB 2FHTA 4HROA 3CHBD 2KJXA 3Q6SA 3AU7A 4R3DA 1S5BD 2IGGA 4IKGA 5KEEA 4KHZA 3BVZA 1SDFA 3P4QB 2K7VA 1C79A 2PIAA 5LNK1 2MJ3A 1YNNC 4WORA 4PT5A 1O7YA 2JYTA 1OO9B 4UAIA 3NVWA 2RDHA 1EIHA 2IX1A 3NBHA 1F2YA 4YSZB 2C9OA 1Y56A 4HKZE 3LNNA 2O5IC 5E1FA 1DZ1A 3U7ZA 2CW0C 1SIJA 3AMZA 5H92C 4Q5VA 3Q8BA 2F0VA 1L0VB 1AFPA 2I38A 2JYEA 3TEWA 3BVMA 3RD4A 1WTRA 3OOCA 2NTTA 2F0JA 1EY4A 4YSXB 3IL8A 4XDXA 3QB3A 3G7LA 1RDPD 2E2IB 2N7JA 3FRPB 3AECB 4A3EB 4OZBA 4Q2JA 3SXHA 3NTIA 1HQRD 2ZW0A 2CJOA 1JICA 2WXFA 1F9RA 2C5CA 1ET6A 1K53A 3PZ8A 5I2XA 5A2QL 1LT3D 4NMZA 5HURA 3DWPA 4F88A 1SNCA 5C0XH 1GUWA 1EM7A 2F0TA 1HEZE 5JVH3 1AWDA 3C2PA 1AZQA 3TN2A 2F1MA 4V190 1OXUA 2DYOA 1TJEA 1OXSC 3H91A 1EQTA 3QOJA 2JSVX 1O80A 1V43A 4CKEA 2FUG1 3Q0AA 4BWGB 3D4RA 2K5DA 3LWEA 1HFGA 1R9TB 1K8OA 2VZKB 1WTOA 1WD0A 3HUIA 5JVG3 1Z7TA 1FYCA 3K5NA 3VA7A 1J7BA 2H88B 3CRLC 4QF4A 1HA5A 5CR3A 4HRSA 2IWHA 4M8AA 1JWMD 3L7ZC 2ZW1A 5CV7A 3LX0A 4KTAA 2LS01 1DM0B 5BMHA 2O4XA 2SNSA 4A3GB 3LWUA 3CU7A 2IGHA 1GUTA 4A90A 1Q10A 4KKIA 3MHZA 4O1NA 4C3HB 2F0OA 2A6EC 5CBAE 4DXFA 2O5JC 1WYGA 1OFFA 3FILA 1S5CD 4REZA 1V8QA 1SNDA 2PNRC 3AH7A 2RVLA 3S1NB 1KLUD 3W9CB 1V1OA 4YTPB 1RODA 2L55A 1HXYD 2N9KA 2B2WC 3ETRA 4CQNA 3A8KE 1MPEA 2WLBA 3VYSA 1TQOA 4QUCA 4XYOA 4HMJA 2Q8IB 1H9MA 3U52E 2E75C 1I4PA 4KI0A 1B1ZA 3P7JA 3D4WA 3TZUA 5JEAH 3NE5B 4BBRB 4KHVA 2QF7A 5IGBA 5FLXE 1XWEA 3TP6A 3B2GA 4BA2I 1I3QB 4PNYA 2VB3X 2PW9A 1SJHD 2E74C 4RA8A 4MIUA 2EYMA 4ITKA 4NZLB 2SEBD 4CGYB 2AUJD 2WV6D 5EJWA 1WXQA 4K2LA 3I8ZA 3A54A 1F2RC 5DEHA 4G4KA 3P1MA 1C4PA 5ELDA 3SE0A 5ISRA 1G2SA 2IL8A 4G7ZC 3NWTA 1EY7A 4OGQC 5H8YE 3EQLC 2EOTA 3BK1A 3BWUD 4DK0A 5I9OA 5EBCA 1ZE3D 5HHDG 3BDOA 3Q8AA 4IURA 4Q0FA 3D6CA 2FBWB 1NYRA 2RDGA 2EJGC 3BG3A 3KBGA 3GB1A 4KGSA 2BB5A 3E5SA 1BMLC 1YN3A 1H9SA 5LHY1 2W3RA 1N5XA 1S5FD 1TR5A 2BTEA 1JB3A 3EJIA 2F0QA 2L9HA 1PRTF 2KAJA 2K04A 4B9XA 1EOTA 3VR6A 2BE5D 1JWSD 2FMMA 2LFNA 4RKBA 4YWGG 4PV1C 2K6AA 1C48A 1YN5A 1NSNS 4JK1C 3NBIA 1SMYC 1CK1A 2AWNA 1CQFA 1UGJA 5I6WA 1ET9A 4FF4A 4D2KA 4EVOA 1M8AA 3GV6A 2I46A 4J8QA 2AX5A 5FOBB 1FNWA 5K36G 3S2HB 1JWUD 3K58A 1FEHA 3ZGZA 1YNTE 2RSOA 4CJ2C 1H9JA 1C78A 4KJOA 1TWAB 5COYA 3SFEB 4RGNA 2MP1A 1S5DD 3U4EG 2I07B 1PTOD 3FMCA 4ZRQA 3AEFB 1B9MA 1PRTC 2B2YA 2HDLA 3SVMA 3KWLA 1QOHA 3P4PB 5DAUA 1EQVA 2MGSA 1CA5A 1CFMA 2LGIA 2B8FA 3ERQA 5C4XB 3BZDB 3R93A 3S9WA 5M5YB 1SSNA 1IKLA 4RF0A 5EKIA 1V1PA 4DXGA 2WNMA 5M5WB 4A8XC 1GXDC 1MSHA 1FO4A 1JRPA 3T3NA 4BA1I 1PFDA 4LTUA 1WTXA 2BS2B 2A6HD 1L6UA 1MVKA 1I4HA 1EWHA 3A8IE 4K2KA 4HKQA 1G2TA 3MA2B 1LO5D 2PCFB 1QLBB 2WP9B 5EPJA 5D65A 1C77A 3NSWA 4RKLA 4OO1G 4EE2A 4WIPA 1B2TA 4U68A 4G7OC 3AE4B 1RHPA 1DOLA 4DQOC 3RMHA 1DYQA 3D6WA 4B08A 4KD4A 4V0BA 2BA1A 1DONA 3VRBB 2JA7B 3SR1A 5D3DA 1PZKD 5J39A 3I90A 2D2CC 2RMMA 1F0ZA 5G3LF 2EDGA 2F0NA 2MJDA 2RBMA 3PUVA 2FJ2A 5IGGA 3SHLA 3T51B 2PTLA 2F0HA 2Z1CA 5C5MA 5CGKA 3TP8A 5E3FA 4XQNA 1L5PA 3PMFA 1ZDXA 1B53A 4OZAA 1JQ4A 2N88A 4B0EA 1ZXIA 1BO0A 4KJNA 3W2DA 3MZ5A 2EYPA 1L0XB 2K33A 4P6VF 3S1RB 2PZUA 4IUQA 1A70A 4KY5A 4IN3A 1PTOF 1Y8OB 3KUPA 1ML0D 1D1IA 2L83A 1Y1VB 1HHVA 1PGAA 3W1SA 1I4QA 2VXWA 4IUUA 1L0YB 3FEWX 5BN5A 1MHXA 1N61A 4C1NI 4WAFA 3NTHA 1ZOYB 4N59A 3SK4A 3AE7B 5T1GA 3L3OC 1F9PA 1SNQA 1SF0A 1HTLD 1STBA 3M7GA 2R3ZA 1VDVA 4TKOB 5JOBA 3TSSA 1ZPSA 2HUGA 1EY9A 4R8IA 1BCPF 3V96A 3R8BA 1YNJD 2AQ1B 4I7ZC 2W3SA 1SB3C 2D5DA 1HTPA 4ABNA 3RLFA 1PTOC 3QIAA 3VR2A 3E6ZX 3S2DB 5CV8A 1BOSA 5IODA 4XQQA 2W55A 1L4ZB 1PFBA 1II3A 2E6XA 4MH8A 2DNCA 2QCPX 2LHDA 1CQVA 1GUGA 1HQMC 1TS3A 4HCSA 2F0PA 4XWWA 1VCIA 1QOBA 1FNUA 3NTKA 3TMEA 2NZ1D 1TWCB 1WTQA 3DMUA 2KACA 3CRKC 3S15B 5ELBA 1N62A 2KQ3A 2L1AA 1HA6A 2G9HD 3PUWA 1E9MA 4ZK9B 1BCPC 1VJKA 2A68C 1KF6B 2GRIA 4IUPA 2WACA 2BT6A 1LTSD 4G57A 1A2UA 3IT6B 4IOIE 1JROA 2JXTA 3J81E 2XNAC 1PUTA 2JX5A 2QIEB 1FRRA 1KFYB 4N9TA 1OQRA 1ICWA 4H13C 2IT1A 4HTHA 4YTMB 1IBXB 1FR3A 2NWGA 4C56C 1NI3A 4LK0M 2EYOA 1EIGA 3QG1A 3HZXA 4RWSC 2B8GA 3TDQA 1IGCA 2L32A 4KN4C 3B9JA 4KKSA 3E9SA 4L6TB 2WXIA 1H9KA 5J1ZA 4AS1A 2B2TA 3OW7A 3OWEB 3I57A 2N55A 4K6DA 4TMAB 4X3SA 3T56B 1TWFB 1EWCA 1TIID 1CHPD 1XCQL 2D62A 2EYLA 3ABVB 5FO8B 1WTVA 1UWXA 4K5VA 4RCNA 3V05A 5C44B 4OO1I 4C3IG 1VMPA 5BN3A 3TBIB 4XTCS 5DM63 1FM0D 3EROA 2M00A 2VB2X 5IT9L 4XT1B 4GDLB 4ZAIA 1XO3A 5M5XB 1MGSA 1P7EA 1ZUD2 4ID6A 2EE1A 3EVQA 5KRUA 4FF2A 2RKSA 3DWMA 1Z6HA 5IGEA 1NEKB 1IGDA 4GZYC 4BY1B 1I4RA 1CA6A 1J8IA 2JQRB 4FXDA 5LL6S 2M2LA 1GOZA 4ZQ3A 2BCOA 5C3XA 2BDNA 2JXMB 1LTID 1VF7A 4MM3B 1FRDA 4EGVA 3M4OB 1XYIA 1D2BA 4K8JA 4IFDG 1XLOA 1D5ZC 1N63A 4HEA1 1XLPA 3ITPA 5ELEA 2MUYA 5G5HA 4IUVA 5K5PA 4QCLA 3QO2A 1C9FA 3X3NA 4OO1H 2R6GA 5HG2A 4I65A 2HCCA 1JORA 1TU2B 1L6VA 3J7YW 4PMWA 5EE0A 3PO2B 3FPPA 3AE2B 3K7AB 3FDTA 5D14A 1ILPA 1YNJC 4BY7B 3LB8C 1WRIA 2LHEA 3RUZA 4DA2A 1SE3A 4A93B 3ND9A 4K5WA 2DWQA 2PMZB 2YU9B 3G6JB 3H6MA 4ZYSA 1BUIC 3OIQA 1V97A 1GB4A 1F2RI 1N5WA 1JE4A 5EBDA 3C3LA 2E2JB 3K0YA 1Q8IA 3MTSA 4TRDA 2EYJA 3P4SB 5CYUA 2CQAA 2Y3AA 4L2YA 3RFZB 2F0IA 3HOXB 1ZEQX 3M3YB 4WFN3 1JCKB 1LABA 4MN3A 2LUMA 3HG9A 3NVZA 2HCIA 3MXUA 1AEXA 3H3VC 1JOOA 3D8GA 2LMCB 2WXNA 3A8JE 4A3BB 2F3VA 1XX8A 2CVRA 4C7ZA 1SYEA 2N9LA 1NUCA 3BDLA 4JPSA 1JOQA 2OT2A 1STYA 4CJ1B 2F0FA 2QKIC 3WOEA 2J42A 2PVOD 3MC0B 1STGA 1BBXC 4MHEA 2YYZA 5DNFA 3B2FA 1XF5L 3CIRB 1TWGB 3GV3A 3J9CA 1DOIA 3K5MA 3WOFA 1NYQA 3D4DA 1B9RA 1TYGB 1D5XC 3AEGB 3A7LA 5C2TB 1EFID 2ON8A 3HRZC 3VYRA 3NHHA 1RWSA 4C80A 2L0CA 3PIO3 5CBEE 4IUTA 3DHQA 3OMCA 5C6AA 4RHSA 1M4VA 5KNCA 3SDZA 4HCEA 1QCBD 2R61A 3MXGA 5NUCA 1YJJA 3I70A 5EPKA 3MAQA 2PVGC 1E2ZA 4J3OD 5D3IB 2VNUD 3S14B 1XXGA 4OIJA 4YIJA 4TQ1A 1Y8PB 5DM73 1MI0A 2A74C 4RGMA 4FYDA 2NN6G 1LACA 2L1BA 4DNRB 3OHXC 4ARCA 1NVID 4CKBA 1B4OA 2WXJA 4WRDA 4NKLA 2KECA 5M9OA 3VRAB 1AZPA 1ZKOA 1MSGA 2EY5A 4KN7C 2DBYA 2HDEA 1OXTA 5EE1A 4ZOHC 3DWAA 1QILA 4Y7NB 1CZPA 5I2YA 1GB1A 5CV6A 3I72A 5EQ0A 1TWHB 1EYDA 2K9XA 2WXLA 2OF1A 3AE1B 4XQJA 2E2DC 2PQEA 3HS0C 5E4WC 1VZ7A 4KX6B 1T5EA 3S1QB 4US8A 4A3FB 5BMIA 4ARIA 3H94A 2MHVA 3UI2A 3IFDA 3OIPA 1DOYA 5JXVA 1VZ8A 4IFDI 4NJCA 4HR7B 2HTME 3GTPB 3TP5A 1B3AA 2MH7A 2L4NA 4JWUC 2X6LA 3VR9B 4DF7A 4A3MB 2D9UA 1SYBA 3PUXA 3VR8B 5HFYA 2DNEA 3QJYA 2L52A 5FO9B 3M7NA 1SSOA 3VA5A 3J80L 3BVGA 1JALA 4DGZA 4Z9CB 5ELCA 2EY2A 2PPBC 3W5UB 1J7AA 1U4MA 3P42A 1PRTB 3S17B 1KABA 1ZDVA 2RSNA 3AN1A 5IT9E 4MACA 3NXWA 3TUOA 1PMRA 3M4YA 1F2MA 1G6ZA 2KVMA 1EZ6A 5FKAC 5AUIA 1CM9A 4P2CB 3I73A 3E0JA 2ZXRA 1SEBD 2CJNA 1FCCC 3RPFC 2FMCA 1IL8A 5CV9A 5CC4A 2W54A 4EQPA 3DM1A 4KKTA 3GTLB 2PKOA 4ZLTF 3A56A 3IAYA 3KF8A 3PO0A 1HUMA 5IGCA 4ODGA 2A69D 4C3IB 1QG7A 1SE2A 3F2UA 1GPXA 1CZGA 2I2YA 1RJTA 4NP5A 4F87A 1GAQB 1PZJD 3FPUB 1ZYRD 1TKYA 2KUMA 1WVLA 2WDQB 4OW0A 4RAUC 3AEAB 2QMTA 3HOWB 4WJWA 3T13A 2B2UA 4LJZC 2B2VA 5C3JB 4NAWB 5A2QE 2BW2A 1EYAA 2WXQA 2K32A 2EXZA 2A73B 2INNE 3HKZB 3BIID 2M0AA 1ENCA 1RCVD 4PMCA 4CJ0B 1FD6A 2WKCA 1MHHE 1IYVA 4RHRA 2NTSA 1IBXA 1A3TA 3NQTA 2TMPA 4L63B 4XDDA 3VQIA 2JEBI 1KDCA 2XN9C 3IAS1 1I7HA 3GQBA 1A3VA 1K8MA 4LMQD 2WXHA 4US9A 1FXAA 1DD2A 2IPKD 1B44D 1RTOA 4A3JB 4JWSC 2WDVB 4QUFA 3C1EA 1LT5D 3I4MB 3URYA 1VF5C 3P4RB 2XWBB 2F0WA 2KA7A 3NZ3A 4FF1A 1X3PA 4K6LA 2J4XA 1CI3M 4RF1A 1YN4A 2FFKB 2NN6I 1FCLA 2XRQD 2HDMA 2AWOA 2M56B 1SNOA 2Z4IA 4LAAA 5C0XG 3NK9A 3NS1A 4WH4A 2AQ2B 1D6EC 3DWQA 1UNSA 2Z4HA 4C1NK 2X6GA 2QEJC 2WU5B 3TEZA 4KK7A 3K6OA 2HQEA 1YNND 3PUYA 2VUMB 2EYFA 3K5LA 1SE4A 3AE9B 2WXKA 2JA5B 2KEEA 4CBVA 3GTKB 1F9QA 3U9SA 2PW7A 2BE5C 4R8NA 4RGOS 5IGDA 5AFWA 2NBFA 4QMGA 2RPVA 4XWTA 1PTOB 2CW0D 4WQMA 2XWJB 1WTWA 4KGRA 2NUCA 3SK5A 3DEOA 2KCCA 4TQUS 1SJED 3L9AX 2E3TA 2WP8J 1K51A 4KGTA 2BB6A 3AB9A 1A3UA 2F0EA 5LL6X 2BBCA 2WS3B 1Y1WB 4B0MA 3R3OA 2RQXA 1PYWD 5EGTA 5BYRA 1BCPB 3BYYB 3QWNA 4ZUIA 2KOLA 3KBXA 4AYBB 1EU4A 1XCTL 1ENFA 2AUKA 4BBSB 2EJFC 1STHA 2F0DA 1E6EB 2WQYB 1DOKA 3NVYA 1SYFA 2PO4A 4HSVA 4K5XA 4A3DB 3MFGA 1DXMA 1XLQA 2V3PA 1ZYRC 1FXIA 2YEPF 3T3OA 5GXGB 4FNFA 3SEBA 3ONAB 1A2TA 1PDQA 4OIKA 1JR0D 1AP0A 3GTQB 2F03A 5IIFA 5FK9C 1BR9A 4TSSA 2M19A 1DCZA 2A6HC 2G1EA 2A5HA 2EPBA 3H09A 4PMBA 3GTMB 4P16A 4H7BA 2F0MA 3VR4A 1Y69U 4XE0A 1EEFD 3PZ7A 1FD7D 2DY7A 2B2YC 3OSOA 1NAPA 2V3NA 2K3UA 2B2WA 2EKIA 4N6EB 4A55A 2LEKA 2R92B 1ESFA 1HZ6A 1C4CA 3J80E 5HI1A 3GTGB 1Y8NB 4BS9A 4M1UB 3ZQ4A 1SXTA 2LKVA 5E4XA 2WXPA 4RNAA 1ESRA 1J9OA 2F0GA 2OXPA 1WD1A 4HSPA 4ZRPA 2JA6B 3MFYA 4ILWA 5I4DA 4QB4A 5K36H 2LJIA 1I4GA 1PXUA 1SNMA 2VZKD 3GS2A 1R4PB 1UAPA 1T5XD 3Q22A 5C4ZA 2B2UC 2GB1A 2WDRB 2WXRA 1KDBA 1IW7D 3ND8A 2G9DA 3GD7A 4FXCA 4A6QA 1QNKA 2Q8TA 3KLRA 1X32A 5KGUA 2JZPA 4KV6A 3SR6A 3AE6B 1R7SA 1EWYC 2K1BA 2BS3B 4KY6A 2PZWA 3TP7A 1EY0A 1B50A