2MH7A

Solution structure of oxidized [2fe-2s] ferredoxin petf from chlamydomonas reinhardtii
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
101
structure length
101
Chain Sequence
MYKVTLKTPSGDKTIECPADTYILDAAEEAGLDLPYSCRAGACSSCAGKVAAGTVDQSDQSFLDDAQMGNGFVLTCVAYPTSDCTIQTHQEEALYENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin, chloroplastic
publication title Redirecting Elctrons from Photosystem I to Hydrogenase: Towards Increased Hydrogen Production in Algae
rcsb
source organism Chlamydomonas reinhardtii
molecule tags Oxidoreductase
total genus 17
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2mh7A00
5EE9A 3W9CB 2M19A 2M56B 1FMAD 3AEGB 5H92C 1L6UA 3P4RB 4A9AA 2AX5A 4YXDB 3CIRB 2JX5A 5C3JB 3AE3B 4N58A 1ZOYB 2FBWB 5AUIA 1J7BA 1TYGB 1WXQA 1L5PA 4C7ZA 3DWGC 1RM6C 1TKEA 4ZHPA 1QOAA 1SB3C 3SR6A 3AE2B 1N62A 2BS2B 2E3TA 1FFVA 1E0ZA 1E10A 4YSYB 4JX1C 5C2TB 3P4SB 2WDQB 2L83A 1QOGA 3BIID 2K5PA 2MJ3A 1GPXA 2G1EA 2H89B 1RWSA 5G5HA 3AEDB 1UWMA 1YQ4B 5EE1A 1JW9D 1NI3A 1N61A 1SIJA 1WWTA 3EUB2 4WQMA 3RPFC 1XLPA 1WYGA 1VDVA 2CJNA 2W3RA 1NVID 4US9A 2BS4B 1JWAD 1YQ3B 1ZXIA 1N60A 1CJEA 3HUIA 2CU3A 1ZP0B 1PDXA 3FAHA 4ITKA 4YTPB 1E7PB 1XLQA 2Y5CA 1SF0A 1QOFA 1FXIA 2PVOD 2MJDA 2BS3B 3VRAB 4P6VF 3AECB 1EWYC 1JWBD 1F0ZA 3AN1A 1OQRA 1OQQA 1V97A 2WU5B 4FXCA 5GXGB 3VRBB 1KF6B 3AEBB 3AE6B 5AUKA 4USAA 4YTNB 3DWMA 3SFEB 2W54A 2WP9B 1NYRA 1N5WA 1XO3A 3LXFA 1QOBA 1NENB 2LEKA 3AE1B 1JRPA 4JWUC 1VJKA 2QJLA 1DOXA 3LB8C 1VLBA 1A70A 3NVZA 1J7CA 3HVZA 1E6EB 2W55A 1YJIA 3AMZA 3P1MA 3VR8B 3NRZA 5MPOA 3KWLA 3ETRA 3AB5A 3AE9B 3AV8A 3VR9B 3W5UB 1KRHA 3PO0A 3B9JA 2PVGC 2W3SA 3HRDD 3AE7B 1FRRA 2H88B 1XLNA 2JQRB 5EE0A 5G5GA 1IUEA 1T3QA 3L4PA 2Q5WD 3ZYYX 4IDIA 1V8CA 3P63A 3P4QB 1DOIA 1ZUD2 1GAQB 2WDVB 2DWQA 4WWMA 4YSZB 4US8A 2HTME 2PKOA 3NVVA 2K22A 1PUTA 2DBYA 2KMMA 1DOYA 1RFKA 3AM9A 3FC4A 1L6VA 2QIEB 1TKYA 1QLBB 2WS3B 3ABVB 4N6EB 1AWDA 1CZPA 1OFFA 4ZOHC 1NYQA 1I7HA 1ROEA 4YTMB 4HRSA 1YJJA 2B76B 4JWSC 3AEFB 3AH7A 2N0SB 2WU2B 3NVYA 5EE3A 1J7AA 1L0VB 1AYFA 1NEKB 1TKGA 1WRIA 2OHFA 2WQYB 5H8YE 4ZHOA 1FFUA 1FO4A 4YT0B 2KAJA 1TJEA 3AEEB 3WCQA 1JQ4A 2MJEA 1QF6A 2EKIA 2L52A 2ACZB 4N59A 1PFDA 1B9RA 3NS1A 1E9MA 1FRDA 1XLOA 2WDRB 3AEAB 2CJOA 2WLBA 3CWIA 4C80A 1FM0D 3B2GA 3W5VB 2PIAA 3NVWA 1JROA 1FXAA 2MH7A 3SFDB 1DGJA 3AE4B 4C7YA 2K9XA 3AE8B 1N63A 1FIQA 1WGKA 4KX6B 4LTUA 3B2FA 4YSXB 1JALA 4HROA 1RYJA 3AE5B 1R7SA 1N5XA 2BT6A 3P4PB 1KFYB 1QT9A
chains in the Genus database with same CATH superfamily
2INDC 1XQQA 1FMAD 1Y8RC 3CIRB 3AE3B 3FILA 3DWGC 3VHTC 1TZOA 3IVFA 2OJWA 3ALBA 1YOVB 4NPNA 3GZNI 1WF9A 3A4SC 5D7GA 3JSVB 4BOSC 3N30A 4KGTA 4HDQA 3DVGY 1T0SC 4FHJA 4M00A 2WHIA 3GE8C 1MJDA 4ARIA 2NTSA 4HPPA 2PW9A 2ZPNA 4K81A 3APFA 5FKAC 2SAKA 2LI5A 2JWUA 3RCZA 1V86A 3AE6B 3MJ5A 1HZ5A 1QOBA 2GLSA 4W9EA 1N6ZA 2O6VD 2Y5BB 2D10A 3M95A 2KWUB 4HVBA 4WWPA 4EZKA 2BTEA 1HEZE 3I9V1 2IGHA 2BB6A 2DAJA 3TMPB 3PRMB 2AQ2B 2G45B 3DBSA 1T5XD 3OG5A 4K7WA 1IBXB 2KZRA 1SJED 1BUIC 4JWSC 5EE3A 1RLFA 4A3OA 4HCNB 4JE3B 2VZKD 2MBBB 5JH5C 5J18A 3VTWA 1XLOA 2FE8A 3K9PB 2KJ6A 2KKCA 1UF0A 1EM7A 2PIAA 1JWUD 4KX6B 2N7JA 1I4PA 1E8YA 2LJ5A 3P2BA 2MP2A 3AEGB 1V5TA 2IPKD 3U8ZA 4W9HA 1E7UA 4IOIE 1SE2A 1GJZA 1V1PA 2FCQA 2KDEB 1WXQA 4PT5A 3VH3B 2INPE 4LJPB 3T9LA 4NAMA 1I4GA 4M02A 1SIJA 3ZUNA 1IPGA 1V2YA 4MH8A 4FJYA 3TUOA 1YJ1A 1NVID 2CHXA 3LYYA 4EUTA 3PS6A 3EHVA 5D3IB 3AI5A 2JWZA 5IA7A 2BYTA 2QMTA 1U4AA 2D2QA 2IZVB 2JT4B 1KF6B 2D07B 3DBHI 3Q69A 1Q0WB 2WP9B 1WFYA 3PZ8A 1KM7A 2ZNVB 4MH0E 3KUZA 1LQBA 2K1FA 5AZHA 2GRIA 3NRZA 4XX5A 4GN1A 3GE3C 3VR9B 4PYZA 1YIWA 4A8XC 3PO0A 1MG4A 1SE9A 3O65B 1T3QA 1T0RC 2WXNA 3RNGC 3ZYYX 2XNAC 2CKHB 4K1RB 2IBIB 2YLMA 3DDCB 1L6VA 1OFFA 2J7QB 2PE9A 2KQ7A 2KANA 4HRSA 1V1OA 3NS8A 2AL3A 3NVYA 1FO4A 1YN3A 2EELA 1GNUA 4K7SA 1CMXB 2WDRB 1FCLA 1FM0D 5TR5A 1S3SG 4RGNA 4NQLB 2KWCA 3KW5B 1MVKA 2KLGA 3DBRI 4ICVA 2WXJA 3BWUD 3C8YA 3W9CB 4AOFA 4QAYA 4FA6A 1WX8A 1J0GA 4K3BA 2MHJA 4GU2A 4EOYA 3ENEA 3MHSD 2MRPA 1N62A 2K3UA 2KJRA 2ZW0A 2Z8LA 2AQ1B 4M8MA 2LGYA 2L0TA 2ZEQA 1QOGA 1JWMD 2LXAA 1Z5SB 3EUB2 2JZ3B 2ASQA 2K8HA 1E8XA 4REZA 1VDVA 4US9A 4AS1A 2NR2A 3DQVA 1IGCA 5E6PA 3W1SA 2KC1A 5CHFA 2K6DB 1FXIA 2ZJDA 3H7PA 3PZ7A 4AWJA 4P1BC 2KVRA 3NHEB 3VVWB 2MBHA 3AEBB 3SFEB 2BKFA 2RDHA 2ZVNA 3BVZA 3EFCA 3Q3NC 4KDLB 3VR8B 3TCAA 3AV8A 2KACA 2WXOA 5AEKB 1C4PA 4FHKA 1LFDA 4DWFA 1V8CA 2JVCA 4NNJB 4WWMA 2IY1B 1TS2A 3W2DA 2C7MB 4NZLB 4L1BA 3NZ3A 1CZPA 2BYFA 1C3TA 2JSVX 1M4VA 1WRIA 4KSKC 4JL9A 1R4MI 3MP9A 1GOZA 3ML8A 3TEWA 5IN7A 3CWIA 2SEBD 1P3QU 4JPSA 2V1YA 3RZFA 5IOIA 2RMMA 1STEA 4LTUA 4YSXB 3N32A 4ZYSA 1JALA 4LCDE 2RDGA 1WM2A 2K0PA 1VD2A 2DYBA 1CQVA 2M19A 2OEDA 2RD0A 4ANUA 1ACCA 3KH0A 3Q3JA 2Z0EB 1P7FA 4EKUA 4W9CA 1UELA 1I42A 2BS2B 4HJKA 2LUEA 3Q8AA 1PGBA 3DPDA 1LXDA 3ZNGC 2IDYA 2L83A 1V5OA 1GPXA 4EE2A 5EE1A 3B1LX 3BZDB 1WWTA 4WQMA 1XXGA 2W3RA 3WIMA 2FIDA 3R2TA 1VRAB 1CJEA 4ITKA 1ZP0B 3PLVA 4ZDVA 3H9DA 1QKZA 1E90A 5DPWA 3VRAB 4F8CB 2V4IB 4ICUA 1V97A 2WU5B 3ZXVA 4GOCA 3VRBB 3DWMA 4B95A 3QJZA 3N1XC 5DPTA 4M0WA 5FK9C 4DHZE 1XD3B 3AB5A 4NAWA 1VZ6A 1SEBD 4P7IA 4MJSA 1IUEA 1GB1A 4C4VB 2DZIA 2UU7A 5D94A 4BZAA 4B9KA 2HTME 3EECA 4DXFA 2KXJA 2N9KA 3T3NA 5GMVA 2MQJA 2JZZA 4OZBA 1RFAA 2NBUA 1K50A 4DBGA 3P42A 2WQYB 1D3ZA 3ZO5B 2KAJA 4K7UA 4N9F4 3AEEB 2GBJA 2MJEA 3ONSA 4FJVB 4BBNF 3EC8A 3A9JB 3CSTA 4CYEA 3L0WB 1JROA 3NZUA 1YMHE 4OZCA 3AE8B 3ZTDA 2I2YA 2KDIA 2JXXA 1GC7A 2FCMA 2MBEA 2Z0DB 2KVZA 5DPRA 2PJHA 4AQ7A 5AUIA 1ZDXA 2QC8A 2N1WA 1EWCA 2MLBA 1FFVA 4GIVA 4WJOA 3VUWA 1E7VA 2R2OA 4PYUA 3I57A 3RNEC 1I4RA 1N61A 3MFGA 1JCKB 1WYGA 2BS4B 3FAHA 2X8XX 5HFYA 3A1QA 5BYRA 2I1KA 2J42A 2G3QB 4AJYB 1F2RC 2NCNA 3DBLB 1TIFA 4A3PA 3U4EG 1N5WA 1VZ7A 4EEWA 2G9HD 3LXFA 2KK8A 3QC8B 4JWUC 3MC8A 4KIKB 3NVZA 5MPOA 4XDDA 2GMIC 2LHEA 3HRDD 2WXGA 1UZXB 5C1ZA 2QHOA 4MM3A 2O6VA 3GS2A 3TJPA 2K22A 4XC2A 2Y5PA 3ABVB 2WS3B 2JXTA 1AWDA 2IY0B 3WAOA 1AN8A 2KQ4X 4HKZE 5BO4B 1MHXA 3FILB 3BK2A 3KQ4A 4G11A 1F77A 4LJOB 3IT6B 4ACFA 4BFRA 1PFDA 3R8BA 1TBEA 3NS1A 2K8CA 1PGAA 2CJOA 3B2GA 4MACA 4GXBA 1MG8A 2R61A 1DGJA 4KZCA 1TT5B 2ZCCA 4C7YA 2WX0A 1YX6B 4IKGA 3AE7B 4M8NA 2WX1A 2QILA 1L6UA 3R3MA 3H7SA 4XWTA 5CHVC 1L4ZB 1TYGB 1FD6A 4C7ZA 4ZYNA 4C56C 3L54A 1HZ6A 4K3CA 4ZRQA 2NBWB 4MEMA 1UBQA 5IKCM 5AZGA 2UWQA 1BXTA 1N60A 4OVVA 3L13A 3B0AA 1CK1A 5BYQA 1IP9A 2J53A 3Q14C 2J0KA 5LLIA 2DHZA 2M8SA 4G0NB 4ARCA 3BYYB 3S2AA 2LGSA 5J17A 3ZLZA 1MFWA 1YJIA 4L23A 1KRHA 3OWEB 2JQRB 5CHWA 1UBIA 1H8CA 4RCOA 1UGMA 4KKJA 3RNAC 4W9DA 3JYUA 3JVZX 5E6JA 3PSEB 2M4NA 3KLSX 3IBEA 2MP2B 1MI0A 2V4LA 3TEXA 1E5WA 1YN5A 4IWQA 1C9FA 5LXHA 1C4AA 5IAAC 1V1PB 4GLSC 1L4DB 1OTRB 5H8YE 3X23A 2KTRA 2LD9A 1KLUD 5HKHA 2L52A 3VXWA 2N4FA 1TY0A 4N59A 4MGZE 2IO2B 3RMKC 4OW0A 1F1HA 1SGHA 3UQBA 2ZCBA 3W5VB 2MBOA 4DDID 2LXCA 1WGHA 4RM9A 2KNBA 1RYJA 3U7ZA 2PLPA 2CS4A 2B3AA 5EE9A 3KWVA 5H92C 1YD8U 4WJNA 1YQBA 4L2YA 1WX9A 1WGGA 2KJHB 4C00A 2KFKA 4KGSA 4FLHA 5EDSA 4RGOS 1Q1OA 3UQAA 4YSYB 3T3OA 2W82A 3TEZA 1OEYA 2QSDA 2MX2A 3RD2A 2G1EA 2H89B 2JUOA 5IP4D 1K52A 1XLPA 4PS8A 4HXDA 1YQ3B 4JIOU 4X57B 1FXTB 2N9XA 1EF1A 3HVDA 2V3NA 1SSNA 1ZDVA 1OQRA 3ZJTA 2WXIA 3RNBC 2L1AA 5E6OA 4WWOA 3I3TB 4MDKE 4XYCA 5E6NA 4M01A 3ETRA 3W5UB 2TSSA 2I1JA 4YWGG 1RAXA 5EE0A 3B08A 1VCBA 2J52A 4TSSA 1DOIA 2WDVB 4H2AA 3ZNHB 1RFKA 2QIEB 2GBRA 2GBMA 3Q3MC 1J7AA 1NEKB 2DAFA 1JQ4A 5G2NA 1K51A 2CHZA 2KOXA 2FCSA 3QAQA 2KDBA 2XBBC 3RUIB 1WXMA 1WGDA 1LGRA 2KMAA 4HPLB 4WJQA 1GC6A 2BYEA 3H7PB 2L7RA 2JRIB 2M1MA 1J7BA 5FR3A 1FNWA 1L2NA 4NY0A 1SB3C 1WH3A 1E10A 1KOTA 2MW5A 3U2SC 4JLCA 2L32A 3DVNV 2FUG1 2N9PC 4TKNA 3M63B 3AEDB 4ANXA 3RPFC 1UUPA 1K53A 3FKYA 1I35A 1XF5L 2CU3A 1XLQA 3PPAA 1WYWB 2D5GA 4AJWA 5JZEB 3T8MA 3IT4B 3PT2B 5JHAA 1ZE3D 4PS3A 1OQQA 3U30A 3APCA 3ZGZA 3TBLD 2N7EA 1ZXHA 4I6NB 2KTFA 3H1UA 3HVZA 1E6EB 2NPTA 2GB1A 3RYTA 2W9NA 3Q8FA 4NJ7A 4WURA 2L00B 1T0YA 1XLNA 3RULA 1UGJA 3Q2AC 4DDGD 3P4QB 3V05A 2DWQA 2MSED 1R4NB 3NVVA 2DBYA 2KMMA 3URYA 4ZRJA 4LNFA 2KX3A 2VH1A 1J8CA 1NYQA 2DYMA 3RFZB 2WYQA 1G6JA 4IUMB 4YT0B 1K8RB 3Q6BA 2EKIA 2KYWA 4CHKA 4C80A 1FRDA 3RZWC 3RNFC 4AUQC 3L10B 1YN4A 3GB1A 3VDZA 1TS5A 4KKIA 3AE4B 1FIQA 2LGXA 2RSUA 3P4PB 2YEPB 3OJ4B 2DX5B 1KFYB 3KUCB 1SIFA 4LNKA 2XN9C 3WANA 1WXAA 4HPMB 3PREA 1HTOA 4XDCA 3QA8A 2MCNB 2JU6X 2IJ0A 2LMCA 1T6BX 4HCPB 4CQNA 1TZ1A 2IO1B 4M0WB 4WIPA 2O2VB 1V80A 2K5PA 1RWSA 2KWDA 4NAWB 1I4QA 4MJSB 4DQOC 2HDEA 2N9LA 3C19A 4FBJB 4S17A 1HA5A 1SE4A 1F0ZA 4USAA 4YTNB 4HKQA 2KWVB 1J19A 4LNNA 1P98A 2LEKA 3PV1A 4ASWC 2INCC 1A70A 1S1QB 3PVLA 2CU1A 3APDA 3BY4B 3B9JA 2RPQA 3ZXRA 2C7HA 3L4PA 1WZ3A 1WJ4A 1TS3A 3DBLI 4US8A 2LFIA 3ZJVA 3VAWA 4IWOA 1D5ZC 4DXGA 2JF5A 4PK1A 4MGIE 2O2VA 1KLGD 1FNUA 4HK2A 3N3KB 3SD5A 3WCQA 2NS5A 1B9RA 4FADA 4NQKE 3RT3B 2A5UA 3ZNID 3SDLC 2MH7A 3IAM1 3AE5B 3TSSA 1QT9A 3V6EB 2OJRA 3ML9A 1MHHE 3A1QB 2AX5A 2JX5A 2X38A 2M17A 5J2RA 3ZJUA 4AP4C 2DLBA 1WIAA 1TKEA 2J0MA 3X0WA 1V81A 1E0ZA 2BQQA 4JX1C 3ZVVA 1WXVA 2MJ3A 2WXHA 3BK1A 1Y56A 3SEBA 3MC9A 3A9KA 5LNK1 4MM3B 1TTNA 2ZVOA 2EMSA 4IW0A 3ZIMA 2O6VB 4YTPB 1E7PB 3QWZB 1NDDA 3IFWB 3DHHC 3N1ZC 2IO0B 4HWIB 2AYOB 3A4RA 3MTNB 2VRRB 1D5MC 3N9YC 2OOBB 1Q10A 2GBKA 4O1NA 4RFBA 4BAXA 3DHIC 2W55A 1LO5D 1EF5A 3Q8EA 1HTQA 4YL8A 2PVGC 2D3BA 1HQRD 3AXCA 4RGMA 2KDFB 2BPSA 5G5GA 2EKEC 4ANVA 3PHWB 2E6XA 2L76A 2VZKB 3I5JC 4YSZB 2PKOA 1YNTE 3LDZE 1OQYA 2BB5A 1FEHA 1B1ZA 5JHBA 5I4DA 2FNJB 2OHFA 4IM3A 3VQIA 5KHQA 1TJEA 1UH6A 3ECIA 1SBBB 4EZJA 1SXTA 2I38A 2HE7A 1FXAA 4RMAA 1N63A 4HROA 2WXLA 1PYWD 2D3CA 4LK0M 4XGAB 3R7QA 3MC0B 3WAMA 5DPSA 4XWWA 2Y3AA 1ZW7A 2HJ1A 2N1VA 3RN9C 4RH6A 2WXFA 5G5HA 3WAPA 3NOBA 1QZEA 2CJNA 2ZPYA 2AL6A 3AU5A 1ZXIA 2C7NB 3VUYA 1SF0A 3MJWA 1WXSA 2LVPA 1JWBD 4E71A 3HHMA 3VUXA 4FXCA 3NG0A 4OVZA 3IAS1 4HEA1 3A33B 2G4SA 4BKGA 2FAZA 4NJ6A 2KTRB 1DOXA 2LJIA 3P1MA 3AMZA 4EZLA 1NBFC 4A20A 1IGDA 1E8WA 5BYSA 2H88B 1P0RA 2GBNA 3IG3A 1ZKHA 4GGQA 3H8HA 1DOYA 3L16A 5HG2A 2DENB 3FC4A 3NY5A 4G50A 1TKYA 1ET9A 4TV3A 3N20C 4LDTD 2Z59B 4WWNA 1QILA 3QHTA 2KFKB 4ZHOA 1HXYD 4KVGB 4IM2A 5D3DA 1QF6A 2IGDA 3M3JA 4ZRKA 4BKTA 2K6QA 2WLBA 3ZNZB 3VH4B 2FUHB 4GDLA 3SFDB 1WGKA 2C60A 4ZRPA 4TQ0A 1R7SA 3AEFB 1NI2A 1OEYJ 2GOWA 2IO3B 4IM0A 1EO6A 2K8BA 2V3PA 4IG7B 4KSLC 5JXVA 3PRZA 2RDBC 4LNOA 1RM6C 3SHQA 5BMGA 3P4SB 2WDQB 4F1SA 2NVUI 2ON8A 1UWMA 4J3OD 2LGDA 1C79A 5KHOA 4A6QA 1A5RA 1JWAD 4IC7B 2LRWA 2XEWA 4HDOA 4WAAA 1SJHD 5HI1A 3U52E 3EA6A 2GI9A 2PVOD 2JYEA 2KN4A 3EFUA 1TS4A 3HM3A 2MBQA 3QK0A 2JRHA 3E9SA 1WMHB 1FCCC 2W54A 1XO3A 2V9HA 4A90A 1XCQL 5C23A 1JWSD 4NJCA 3JSVA 3AE9B 3GOEA 2BBCA 2W3SA 2LUMA 4BKSD 2RPVA 3RNCC 3ZDTA 2ICIA 4IWPA 1HE8A 1PUTA 1Q5WB 4DHJD 4E3CA 4BBNC 2PMVA 4CO7A 1L0VB 1TKGA 1PGXA 1FFUA 1D6EC 5FR6A 2C9WB 1LM8B 2EMTA 1E9MA 3H6NA 1KLVA 1R4NI 3NVWA 2V3SA 3D32A 3PLUA 3IHPC 3GZNB 2KC2A 4KZ0A 4J6IA 1IBXA 1KJTA 4HLEA 1WMHA 3ZQ4A 5C3JB 2PPHA 4N58A 1ZOYB 1ET6A 2FBWB 3HIZA 2LWPA 2FCNA 1ZPSA 2KX0A 4WAFA 4G3XB 4JGHB 4MELA 1F52A 1XT9B 4WJPA 1L0XB 3BYTB 2NPTB 3VTUA 2J0JA 2ZW1A 3R66C 1JW9D 1TY2A 4GSWA 1V49A 1P9DU 4EFOA 5L83A 4BVUC 2KDMA 1UD7A 2HD5B 3AECB 2YEPF 1F2RI 2MWSB 3AN1A 4RF0A 3KYDD 2QDFA 3WALA 3J9CA 1WSPA 4S0RA 1NYRA 3AE1B 1NENB 1GUAB 1VLBA 4RF1A 1RRBA 4BOZB 3V6CB 4Q2JA 3ZTCA 2KLCA 1FRRA 2Q5WD 3VTVA 1C78A 4ZRIA 3NJTA 2QEJC 1XEEA 5T8IA 3U7DA 4OVUA 2BF8B 1QLBB 3KUDB 1ROEA 4E74A 4DHZB 3AH7A 2C5LC 2WU2B 4F7ZA 1AYFA 2XK5B 3Q3OC 2A4ZA 2LHDA 1FNVA 2L05A 1KH0A 1E8ZA 2LGIA 3PTFC 4W9FA 3PRPB 2LASA 2HJ8A 2KN5A 2PTLA 2QCZA 4RNAA 3DVGX 3B2FA 1WY8A 2BT6A 2AEHA 1ENFA 1EU4A 3C0RB 4YXDB 2LZ6A 1WJNA 3OJ3A 2MEKA 1IYFA 3CF6E 1H4RA 1PQSA 1L5PA 4MSQB 4P16A 3CSFA 1QOAA 3I63C 3SR6A 3AE2B 3HK0A 2IYDB 5C2TB 3BIID 3DBHB 2PE6B 1YQ4B 2AQ3B 2HTHA 4GDKB 4RM8A 2ZZPB 1SE3A 1WGRA 1XCTL 2BGFA 2JYTA 2MJDA 3RI7C 2D11A 2XK5A 2IGGA 1X1MA 2WXQA 2NTTA 1EU3A 1F9JA 3VFKA 3MHZA 2DYOA 3LJ3A 3Q8CA 1JRPA 1VJKA 3LB8C 2G4DB 1Z2MA 4B6WA 5D2MB 3QARA 3Q8BA 3KWLA 4JQWC 2ONQA 4IDIA 3Q3FA 3UI3A 4TQ1A 3K9OB 2LVQA 4XE0A 1WJ6A 4N6EB 4PS7A 3WA0A 1WM3A 2ZNVC 2JPHA 4YTMB 2B76B 3DBRB 4MGKE 1WI0A 2VH2A 2D3GA 2WNMA 4KGRA 2FIFA 4MT5A 2JY6A 2ACZB 3TEYA 4II2B 4GDKA 3AEAB 5HHDG 2NMQA 1ISNA 1AARA 1D4BA 2YVCA 3E56A 3A9KB 4XZ4A 1DYQA 3W1SC 3DHGC 4DK5A 1WR6E 4LNIA 4A9AA 3UIPB 2N7DA 2INNE 4P1CC 2AWTA 2BYVE 1ZGUB 4ZHPA 2E3TA 2LRUA 1P1AA 2DZMA 2WXKA 2BWES 2WXPA 2WXMA 4OZAA 1UWXA 2WDTB 3ZRFA 1KTKA 1I4XA 4B0EA 3BINA 3L17A 1NI3A 1WE6A 1EUVB 1I4HA 5DCNA 4LDTB 3HUIA 4DXAB 3L08A 4A55A 2Y5CA 1WRDB 3KYCD 1TGZB 2BS3B 4P6VF 1WJUA 1C1YB 5D6JB 4W9JA 5GXGB 1WE7A 5AUKA 2WXRA 3NZSA 4KDIC 1GB4A 1T0QC 3DOWA 2QJLA 2WGSA 4FJZA 1J7CA 2M0XA 4W9IA 3ZW3A 3BVGA 1VR9A 1V6EA 1ESFA 2DNFA 4TUUA 4WH4A 1BT0A 3P63A 3OAWA 1R4MB 3SU8X 5TSSA 2L3ZA 3NUHB 2KHWB 2D3AA 2KT7A 3PGEA 1GG3A 4URKA 3AM9A 2KD0A 1AW7A 2CHWA 4I6PA 2KO3A 4RGTA 3QIJA 1YJJA 2WWZA 2KMCA 3KVFB 1P7EA 1WX7A 3W1YA 3M62B 3OLMD 2BWFA 2NBVB 3GP7A 3IXSA 4I6LB 1L0YB 5BMIA 2RR9A 4MGYE 4C4VA 2DZKA 2K9XA 5CX3A 2M0AA 1OGWA 3PZDA 4R3DA 3HM6X 3QCAA 2J4XA 1C4CA 1N5XA 3ZRCA 2M56B 3EGRA 3P4RB 2LVOA 1BMLC 3UINB 1M94A 2K39A 1JRUA 2KQSA 1WZ0A 3V60A 4ANWA 3TL5A 3AULA 2K25A 3A9JA 3UF8A 1C76A 4W9KA 3DCGA 4DHJB 3V62A 3JW0X 3N1YC 1WR1A 3O13A 3R7RA 1MPEA 2BVCA 2L8JA 4KV2A 1C77A 4GB9A 4HJGE 2BW2A 4FN2A 1PDXA 3V61A 4WQOB 2BKRB 2L0FA 4W9LA 1QOFA 4FULA 1EWYC 3UGBB 3PHXB 5LXIB 1QQRA 2RGFA 4II3B 3R2IA 3V3XA 3BVMA 4UDUC 5G55A 1UNSA 1YX5B 2REXA 3CMMB 4GMVA 1D5XC 1VZ8A 4GDLB 4LLGM 4OHJA 3AU4A 1FPYA 3QQ8B 3QX1A 1ZUD2 1GAQB 2CR5A 5AZFA 5L95C 3ZKJC 2N9EB 4MSMB 4ZOHC 4BKSA 1I7HA 4TMAB 1V9JA 3UIOB 5BMHA 2KFJA 2V0GA 2N0SB 2UYZB 5CTRC 3TIXA 2R2QA 4KIKA 4D2KA 2DZJA 3DVNU 2MA9B 2JZPA 4W9GA 2PEAA 1WGYA 5IO9A 4B0MA 3ZDMC 1L7YA 1JMLA
chains in the Genus database with same CATH topology
1IBXA 2XN9C 1FMAD 3ZQ4A 3CIRB 5C3JB 3AE3B 4AQ7A 4N58A 1ZOYB 1ET6A 2FBWB 4XDCA 5AUIA 1ZPSA 2JU6X 2IJ0A 1ZDXA 4WAFA 3FILA 3DWGC 2LMCA 1TZOA 1T6BX 1EWCA 1FFVA 4CQNA 1L0XB 3BYTB 4WIPA 5D7GA 2K5PA 3I57A 1RWSA 2ZW1A 4KGTA 2KWDA 1JW9D 1TY2A 4NAWB 1I4RA 1N61A 3MFGA 1JCKB 1I4QA 1WYGA 4DQOC 2HDEA 2BS4B 2KDMA 3FAHA 4ARIA 2NTSA 2N9LA 2PW9A 5HFYA 5FKAC 5BYRA 2J42A 2SAKA 1HA5A 1SE4A 2JWUA 2YEPF 3AECB 1F2RI 1F0ZA 3AN1A 4RF0A 1F2RC 3AE6B 3J9CA 1WSPA 4USAA 4YTNB 4HKQA 3MJ5A 1NYRA 3U4EG 1N5WA 1VZ7A 1HZ5A 2G9HD 1QOBA 1NENB 2LEKA 3AE1B 3LXFA 4JWUC 1VLBA 1A70A 3NVZA 4RF1A 4Q2JA 5MPOA 4XDDA 3B9JA 2LHEA 2BTEA 1HEZE 2WXGA 1FRRA 3HRDD 3I9V1 2IGHA 2BB6A 2Q5WD 3L4PA 1C78A 2AQ2B 2QEJC 1XEEA 3GS2A 1TS3A 1T5XD 5T8IA 4US8A 2LFIA 3ZJVA 2K22A 1IBXB 2Y5PA 1QLBB 2WS3B 2JXTA 3ABVB 1AWDA 1ROEA 1SJED 1AN8A 1BUIC 1D5ZC 4JWSC 4DXGA 3AH7A 2WU2B 2KQ4X 4HKZE 5EE3A 1AYFA 1KLGD 1FNUA 1MHXA 3FILB 3BK2A 3KQ4A 2LHDA 3WCQA 1F77A 1FNVA 3IT6B 4JE3B 2VZKD 1KH0A 1PFDA 2LGIA 3R8BA 3NS1A 1XLOA 1B9RA 2FE8A 1PGAA 2CJOA 3B2GA 4MACA 1EM7A 2PIAA 2MH7A 2R61A 1DGJA 4C7YA 2PTLA 1JWUD 4KX6B 4RNAA 2N7JA 3B2FA 3IAM1 3AE5B 3TSSA 4IKGA 2BT6A 1I4PA 3AE7B 1QT9A 2QILA 1ENFA 1MHHE 1EU4A 3AEGB 1L6UA 4YXDB 2IPKD 2AX5A 2JX5A 2X38A 4XWTA 4IOIE 1SE2A 1L4ZB 2MEKA 3ZJUA 1V1PA 1TYGB 1WXQA 2DLBA 4PT5A 1L5PA 1FD6A 4C7ZA 1TKEA 4P16A 1QOAA 3SR6A 3AE2B 2INPE 4C56C 1E0ZA 4JX1C 5C2TB 1HZ6A 4ZRQA 4NAMA 3BIID 2MJ3A 2WXHA 3BK1A 1I4GA 1Y56A 1YQ4B 3SEBA 1SIJA 2AQ3B 4MH8A 4GDKB 3TUOA 5LNK1 1NVID 1BXTA 4MM3B 3LYYA 1N60A 1SE3A 5D3IB 4YTPB 1CK1A 1E7PB 1XCTL 2JYTA 5BYQA 2MJDA 2BYTA 2QMTA 2J53A 2IGGA 2WXQA 2NTTA 1EU3A 1KF6B 3MHZA 3Q69A 1D5MC 2WP9B 3N9YC 2DYOA 1Q10A 4ARCA 3Q8CA 3BYYB 3PZ8A 4O1NA 1JRPA 4RFBA 1VJKA 3LB8C 2GRIA 2W55A 1YJIA 1LO5D 3NRZA 3Q8BA 3KWLA 3Q8EA 3VR9B 4L23A 1KRHA 3PO0A 4A8XC 2PVGC 1HQRD 4RGMA 3OWEB 2JQRB 5G5GA 1T3QA 4RCOA 2WXNA 2ONQA 3ZYYX 2E6XA 2XNAC 4IDIA 4KKJA 2VZKB 3UI3A 4YSZB 4TQ1A 5E6JA 3KLSX 2PKOA 1YNTE 4XE0A 1L6VA 1MI0A 3TEXA 2BB5A 1YN5A 1C9FA 1FEHA 4N6EB 1OFFA 1B1ZA 4YTMB 1C4AA 4HRSA 1V1OA 2B76B 5I4DA 1V1PB 4GLSC 3NVYA 1L4DB 2OHFA 1FO4A 1YN3A 5H8YE 3VQIA 1TJEA 2EELA 2WNMA 4KGRA 1KLUD 2L52A 4MT5A 2ACZB 1SBBB 3TEYA 1TY0A 4N59A 2WDRB 4OW0A 3AEAB 1SXTA 2I38A 1FCLA 5HHDG 1FM0D 3W5VB 2NMQA 1D4BA 1FXAA 3E56A 1N63A 4RGNA 4HROA 1RYJA 3U7ZA 1MVKA 2PLPA 1DYQA 2WXJA 2WXLA 5EE9A 1PYWD 3BWUD 3KWVA 3C8YA 3W9CB 4A9AA 5H92C 4LK0M 3MC0B 4L2YA 2INNE 4XWWA 2Y3AA 4KGSA 4ZHPA 4RGOS 1N62A 2K3UA 2E3TA 2ZW0A 2WXKA 2Z8LA 4YSYB 2AQ1B 3T3OA 2WXPA 4RH6A 2WXMA 2W82A 1UWXA 2WXFA 4OZAA 3TEZA 1QOGA 2QSDA 1KTKA 1I4XA 1JWMD 2G1EA 4B0EA 2H89B 5G5HA 1NI3A 1K52A 3EUB2 1XLPA 1I4HA 4REZA 1VDVA 2CJNA 4US9A 4AS1A 1YQ3B 3HUIA 1ZXIA 1IGCA 4A55A 3W1SA 2Y5CA 1SF0A 1FXIA 3HVDA 2BS3B 2V3NA 4P6VF 1JWBD 1SSNA 1ZDVA 3PZ7A 1OQRA 3ZJTA 2WXIA 4FXCA 5GXGB 4OVZA 5AUKA 3AEBB 3IAS1 4HEA1 2WXRA 3SFEB 2L1AA 1GB4A 2RDHA 3BVZA 1DOXA 2QJLA 1J7CA 2LJIA 3P1MA 3AMZA 3VR8B 3BVGA 3ETRA 3W5UB 3AV8A 1VR9A 2KACA 1IGDA 2TSSA 2WXOA 5BYSA 4YWGG 1ESFA 2H88B 1C4PA 5EE0A 4WH4A 1V8CA 3P63A 2J52A 4TSSA 1DOIA 2WDVB 5TSSA 4WWMA 3NUHB 1TS2A 3H8HA 3W2DA 1DOYA 4H2AA 1RFKA 4NZLB 3AM9A 3FC4A 2QIEB 5HG2A 4L1BA 1TKYA 3NZ3A 1ET9A 1AW7A 1CZPA 4RGTA 1YJJA 2JSVX 1QILA 1M4VA 1J7AA 1NEKB 1WRIA 1P7EA 4ZHOA 1HXYD 1JQ4A 5D3DA 1QF6A 2IGDA 1K51A 3GP7A 3IXSA 3MP9A 1GOZA 3TEWA 3CWIA 2SEBD 2WLBA 1L0YB 4JPSA 5BMIA 3SFDB 2RMMA 2K9XA 1STEA 1WGKA 4LTUA 4YSXB 2M0AA 4ZYSA 4R3DA 1JALA 4ZRPA 4TQ0A 2J4XA 1C4CA 1R7SA 1N5XA 2RDGA 3AEFB 2K0PA 1CQVA 2M19A 2M56B 3EGRA 2V3PA 3P4RB 5JXVA 1BMLC 2OEDA 1J7BA 5FR3A 1FNWA 1ACCA 1RM6C 1P7FA 1SB3C 2BS2B 1E10A 3Q8AA 1PGBA 5BMGA 3P4SB 2WDQB 3U2SC 2IDYA 2L32A 2L83A 1C76A 1GPXA 2FUG1 4EE2A 2ON8A 3AEDB 1UWMA 4J3OD 5EE1A 3BZDB 1C79A 1WWTA 4WQMA 3RPFC 4A6QA 1XXGA 3O13A 2W3RA 1MPEA 3R2TA 1UUPA 1JWAD 1K53A 1VRAB 1CJEA 1C77A 1XF5L 2BW2A 2CU3A 1ZP0B 1PDXA 4HJGE 4ITKA 1SJHD 5HI1A 1XLQA 3U52E 2D5GA 3EA6A 1QKZA 1QOFA 2GI9A 2PVOD 2JYEA 3IT4B 2KN4A 3VRAB 2V4IB 1TS4A 1EWYC 1ZE3D 1OQQA 1V97A 2WU5B 3VRBB 3E9SA 3DWMA 1FCCC 2W54A 3ZGZA 1QQRA 1XO3A 1ZXHA 4A90A 3R2IA 3V3XA 1XCQL 1JWSD 3BVMA 3HVZA 4M0WA 1E6EB 4UDUC 1UNSA 2GB1A 4NJCA 5FK9C 3Q8FA 3AB5A 3AE9B 2BBCA 1VZ6A 4WURA 1SEBD 2W3SA 2LUMA 1XLNA 1D5XC 1VZ8A 4GDLB 1IUEA 1UGJA 4LLGM 4OHJA 1GB1A 2RPVA 3P4QB 1ZUD2 1GAQB 3V05A 2DWQA 2ICIA 2HTME 3NVVA 1PUTA 2DBYA 2KMMA 3URYA 4DXFA 4ZOHC 1NYQA 1I7HA 2N9KA 4TMAB 2PMVA 3T3NA 5BMHA 4OZBA 2DYMA 1K50A 2V0GA 3RFZB 2N0SB 3P42A 1L0VB 2WQYB 1TKGA 1PGXA 1FFUA 4YT0B 2KAJA 1D6EC 3AEEB 2MJEA 2EKIA 4D2KA 2JZPA 4C80A 1E9MA 1FRDA 1YN4A 3NVWA 3GB1A 1JROA 1TS5A 1YMHE 4KKIA 3AE4B 4OZCA 3AE8B 4B0MA 2I2YA 1FIQA 1JMLA 3P4PB 2YEPB 1KFYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EE9 A;  3W9C B;  2M19 A;  2M56 B;  1FMA D;  3AEG B;  5H92 C;  1L6U A;  3P4R B;  4A9A A;  2AX5 A;  4YXD B;  3CIR B;  2JX5 A;  5C3J B;  3AE3 B;  4N58 A;  1ZOY B;  2FBW B;  5AUI A;  1J7B A;  1TYG B;  1WXQ A;  1L5P A;  4C7Z A;  3DWG C;  1RM6 C;  1TKE A;  4ZHP A;  1QOA A;  1SB3 C;  3SR6 A;  3AE2 B;  1N62 A;  2BS2 B;  2E3T A;  1FFV A;  1E0Z A;  1E10 A;  4YSY B;  4JX1 C;  5C2T B;  3P4S B;  2WDQ B;  2L83 A;  1QOG A;  3BII D;  2K5P A;  2MJ3 A;  1GPX A;  2G1E A;  2H89 B;  1RWS A;  5G5H A;  3AED B;  1UWM A;  1YQ4 B;  5EE1 A;  1JW9 D;  1NI3 A;  1N61 A;  1SIJ A;  1WWT A;  3EUB 2;  4WQM A;  3RPF C;  1XLP A;  1WYG A;  1VDV A;  2CJN A;  2W3R A;  1NVI D;  4US9 A;  2BS4 B;  1JWA D;  1YQ3 B;  1ZXI A;  1N60 A;  1CJE A;  3HUI A;  2CU3 A;  1ZP0 B;  1PDX A;  3FAH A;  4ITK A;  4YTP B;  1E7P B;  1XLQ A;  2Y5C A;  1SF0 A;  1QOF A;  1FXI A;  2PVO D;  2MJD A;  2BS3 B;  3VRA B;  4P6V F;  3AEC B;  1EWY C;  1JWB D;  1F0Z A;  3AN1 A;  1OQR A;  1OQQ A;  1V97 A;  2WU5 B;  4FXC A;  5GXG B;  3VRB B;  1KF6 B;  3AEB B;  3AE6 B;  5AUK A;  4USA A;  4YTN B;  3DWM A;  3SFE B;  2W54 A;  2WP9 B;  1NYR A;  1N5W A;  1XO3 A;  3LXF A;  1QOB A;  1NEN B;  2LEK A;  3AE1 B;  1JRP A;  4JWU C;  1VJK A;  2QJL A;  1DOX A;  3LB8 C;  1VLB A;  1A70 A;  3NVZ A;  1J7C A;  3HVZ A;  1E6E B;  2W55 A;  1YJI A;  3AMZ A;  3P1M A;  3VR8 B;  3NRZ A;  5MPO A;  3KWL A;  3ETR A;  3AB5 A;  3AE9 B;  3AV8 A;  3VR9 B;  3W5U B;  1KRH A;  3PO0 A;  3B9J A;  2PVG C;  2W3S A;  3HRD D;  3AE7 B;  1FRR A;  2H88 B;  1XLN A;  2JQR B;  5EE0 A;  5G5G A;  1IUE A;  1T3Q A;  3L4P A;  2Q5W D;  3ZYY X;  4IDI A;  1V8C A;  3P63 A;  3P4Q B;  1DOI A;  1ZUD 2;  1GAQ B;  2WDV B;  2DWQ A;  4WWM A;  4YSZ B;  4US8 A;  2HTM E;  2PKO A;  3NVV A;  2K22 A;  1PUT A;  2DBY A;  2KMM A;  1DOY A;  1RFK A;  3AM9 A;  3FC4 A;  1L6V A;  2QIE B;  1TKY A;  1QLB B;  2WS3 B;  3ABV B;  4N6E B;  1AWD A;  1CZP A;  1OFF A;  4ZOH C;  1NYQ A;  1I7H A;  1ROE A;  4YTM B;  4HRS A;  1YJJ A;  2B76 B;  4JWS C;  3AEF B;  3AH7 A;  2N0S B;  2WU2 B;  3NVY A;  5EE3 A;  1J7A A;  1L0V B;  1AYF A;  1NEK B;  1TKG A;  1WRI A;  2OHF A;  2WQY B;  5H8Y E;  4ZHO A;  1FFU A;  1FO4 A;  4YT0 B;  2KAJ A;  1TJE A;  3AEE B;  3WCQ A;  1JQ4 A;  2MJE A;  1QF6 A;  2EKI A;  2L52 A;  2ACZ B;  4N59 A;  1PFD A;  1B9R A;  3NS1 A;  1E9M A;  1FRD A;  1XLO A;  2WDR B;  3AEA B;  2CJO A;  2WLB A;  3CWI A;  4C80 A;  1FM0 D;  3B2G A;  3W5V B;  2PIA A;  3NVW A;  1JRO A;  1FXA A;  2MH7 A;  3SFD B;  1DGJ A;  3AE4 B;  4C7Y A;  2K9X A;  3AE8 B;  1N63 A;  1FIQ A;  1WGK A;  4KX6 B;  4LTU A;  3B2F A;  4YSX B;  1JAL A;  4HRO A;  1RYJ A;  3AE5 B;  1R7S A;  1N5X A;  2BT6 A;  3P4P B;  1KFY B;  1QT9 A; 
#chains in the Genus database with same CATH topology
 2IND C;  1XQQ A;  1FMA D;  1Y8R C;  3CIR B;  3AE3 B;  3FIL A;  3DWG C;  3VHT C;  1TZO A;  3IVF A;  2OJW A;  3ALB A;  1YOV B;  4NPN A;  3GZN I;  1WF9 A;  3A4S C;  5D7G A;  3JSV B;  4BOS C;  3N30 A;  4KGT A;  4HDQ A;  3DVG Y;  1T0S C;  4FHJ A;  4M00 A;  2WHI A;  3GE8 C;  1MJD A;  4ARI A;  2NTS A;  4HPP A;  2PW9 A;  2ZPN A;  4K81 A;  3APF A;  5FKA C;  2SAK A;  2LI5 A;  2JWU A;  3RCZ A;  1V86 A;  3AE6 B;  3MJ5 A;  1HZ5 A;  1QOB A;  2GLS A;  4W9E A;  1N6Z A;  2O6V D;  2Y5B B;  2D10 A;  3M95 A;  2KWU B;  4HVB A;  4WWP A;  4EZK A;  2BTE A;  1HEZ E;  3I9V 1;  2IGH A;  2BB6 A;  2DAJ A;  3TMP B;  3PRM B;  2AQ2 B;  2G45 B;  3DBS A;  1T5X D;  3OG5 A;  4K7W A;  1IBX B;  2KZR A;  1SJE D;  1BUI C;  4JWS C;  5EE3 A;  1RLF A;  4A3O A;  4HCN B;  4JE3 B;  2VZK D;  2MBB B;  5JH5 C;  5J18 A;  3VTW A;  1XLO A;  2FE8 A;  3K9P B;  2KJ6 A;  2KKC A;  1UF0 A;  1EM7 A;  2PIA A;  1JWU D;  4KX6 B;  2N7J A;  1I4P A;  1E8Y A;  2LJ5 A;  3P2B A;  2MP2 A;  3AEG B;  1V5T A;  2IPK D;  3U8Z A;  4W9H A;  1E7U A;  4IOI E;  1SE2 A;  1GJZ A;  1V1P A;  2FCQ A;  2KDE B;  1WXQ A;  4PT5 A;  3VH3 B;  2INP E;  4LJP B;  3T9L A;  4NAM A;  1I4G A;  4M02 A;  1SIJ A;  3ZUN A;  1IPG A;  1V2Y A;  4MH8 A;  4FJY A;  3TUO A;  1YJ1 A;  1NVI D;  2CHX A;  3LYY A;  4EUT A;  3PS6 A;  3EHV A;  5D3I B;  3AI5 A;  2JWZ A;  5IA7 A;  2BYT A;  2QMT A;  1U4A A;  2D2Q A;  2IZV B;  2JT4 B;  1KF6 B;  2D07 B;  3DBH I;  3Q69 A;  1Q0W B;  2WP9 B;  1WFY A;  3PZ8 A;  1KM7 A;  2ZNV B;  4MH0 E;  3KUZ A;  1LQB A;  2K1F A;  5AZH A;  2GRI A;  3NRZ A;  4XX5 A;  4GN1 A;  3GE3 C;  3VR9 B;  4PYZ A;  1YIW A;  4A8X C;  3PO0 A;  1MG4 A;  1SE9 A;  3O65 B;  1T3Q A;  1T0R C;  2WXN A;  3RNG C;  3ZYY X;  2XNA C;  2CKH B;  4K1R B;  2IBI B;  2YLM A;  3DDC B;  1L6V A;  1OFF A;  2J7Q B;  2PE9 A;  2KQ7 A;  2KAN A;  4HRS A;  1V1O A;  3NS8 A;  2AL3 A;  3NVY A;  1FO4 A;  1YN3 A;  2EEL A;  1GNU A;  4K7S A;  1CMX B;  2WDR B;  1FCL A;  1FM0 D;  5TR5 A;  1S3S G;  4RGN A;  4NQL B;  2KWC A;  3KW5 B;  1MVK A;  2KLG A;  3DBR I;  4ICV A;  2WXJ A;  3BWU D;  3C8Y A;  3W9C B;  4AOF A;  4QAY A;  4FA6 A;  1WX8 A;  1J0G A;  4K3B A;  2MHJ A;  4GU2 A;  4EOY A;  3ENE A;  3MHS D;  2MRP A;  1N62 A;  2K3U A;  2KJR A;  2ZW0 A;  2Z8L A;  2AQ1 B;  4M8M A;  2LGY A;  2L0T A;  2ZEQ A;  1QOG A;  1JWM D;  2LXA A;  1Z5S B;  3EUB 2;  2JZ3 B;  2ASQ A;  2K8H A;  1E8X A;  4REZ A;  1VDV A;  4US9 A;  4AS1 A;  2NR2 A;  3DQV A;  1IGC A;  5E6P A;  3W1S A;  2KC1 A;  5CHF A;  2K6D B;  1FXI A;  2ZJD A;  3H7P A;  3PZ7 A;  4AWJ A;  4P1B C;  2KVR A;  3NHE B;  3VVW B;  2MBH A;  3AEB B;  3SFE B;  2BKF A;  2RDH A;  2ZVN A;  3BVZ A;  3EFC A;  3Q3N C;  4KDL B;  3VR8 B;  3TCA A;  3AV8 A;  2KAC A;  2WXO A;  5AEK B;  1C4P A;  4FHK A;  1LFD A;  4DWF A;  1V8C A;  2JVC A;  4NNJ B;  4WWM A;  2IY1 B;  1TS2 A;  3W2D A;  2C7M B;  4NZL B;  4L1B A;  3NZ3 A;  1CZP A;  2BYF A;  1C3T A;  2JSV X;  1M4V A;  1WRI A;  4KSK C;  4JL9 A;  1R4M I;  3MP9 A;  1GOZ A;  3ML8 A;  3TEW A;  5IN7 A;  3CWI A;  2SEB D;  1P3Q U;  4JPS A;  2V1Y A;  3RZF A;  5IOI A;  2RMM A;  1STE A;  4LTU A;  4YSX B;  3N32 A;  4ZYS A;  1JAL A;  4LCD E;  2RDG A;  1WM2 A;  2K0P A;  1VD2 A;  2DYB A;  1CQV A;  2M19 A;  2OED A;  2RD0 A;  4ANU A;  1ACC A;  3KH0 A;  3Q3J A;  2Z0E B;  1P7F A;  4EKU A;  4W9C A;  1UEL A;  1I42 A;  2BS2 B;  4HJK A;  2LUE A;  3Q8A A;  1PGB A;  3DPD A;  1LXD A;  3ZNG C;  2IDY A;  2L83 A;  1V5O A;  1GPX A;  4EE2 A;  5EE1 A;  3B1L X;  3BZD B;  1WWT A;  4WQM A;  1XXG A;  2W3R A;  3WIM A;  2FID A;  3R2T A;  1VRA B;  1CJE A;  4ITK A;  1ZP0 B;  3PLV A;  4ZDV A;  3H9D A;  1QKZ A;  1E90 A;  5DPW A;  3VRA B;  4F8C B;  2V4I B;  4ICU A;  1V97 A;  2WU5 B;  3ZXV A;  4GOC A;  3VRB B;  3DWM A;  4B95 A;  3QJZ A;  3N1X C;  5DPT A;  4M0W A;  5FK9 C;  4DHZ E;  1XD3 B;  3AB5 A;  4NAW A;  1VZ6 A;  1SEB D;  4P7I A;  4MJS A;  1IUE A;  1GB1 A;  4C4V B;  2DZI A;  2UU7 A;  5D94 A;  4BZA A;  4B9K A;  2HTM E;  3EEC A;  4DXF A;  2KXJ A;  2N9K A;  3T3N A;  5GMV A;  2MQJ A;  2JZZ A;  4OZB A;  1RFA A;  2NBU A;  1K50 A;  4DBG A;  3P42 A;  2WQY B;  1D3Z A;  3ZO5 B;  2KAJ A;  4K7U A;  4N9F 4;  3AEE B;  2GBJ A;  2MJE A;  3ONS A;  4FJV B;  4BBN F;  3EC8 A;  3A9J B;  3CST A;  4CYE A;  3L0W B;  1JRO A;  3NZU A;  1YMH E;  4OZC A;  3AE8 B;  3ZTD A;  2I2Y A;  2KDI A;  2JXX A;  1GC7 A;  2FCM A;  2MBE A;  2Z0D B;  2KVZ A;  5DPR A;  2PJH A;  4AQ7 A;  5AUI A;  1ZDX A;  2QC8 A;  2N1W A;  1EWC A;  2MLB A;  1FFV A;  4GIV A;  4WJO A;  3VUW A;  1E7V A;  2R2O A;  4PYU A;  3I57 A;  3RNE C;  1I4R A;  1N61 A;  3MFG A;  1JCK B;  1WYG A;  2BS4 B;  3FAH A;  2X8X X;  5HFY A;  3A1Q A;  5BYR A;  2I1K A;  2J42 A;  2G3Q B;  4AJY B;  1F2R C;  2NCN A;  3DBL B;  1TIF A;  4A3P A;  3U4E G;  1N5W A;  1VZ7 A;  4EEW A;  2G9H D;  3LXF A;  2KK8 A;  3QC8 B;  4JWU C;  3MC8 A;  4KIK B;  3NVZ A;  5MPO A;  4XDD A;  2GMI C;  2LHE A;  3HRD D;  2WXG A;  1UZX B;  5C1Z A;  2QHO A;  4MM3 A;  2O6V A;  3GS2 A;  3TJP A;  2K22 A;  4XC2 A;  2Y5P A;  3ABV B;  2WS3 B;  2JXT A;  1AWD A;  2IY0 B;  3WAO A;  1AN8 A;  2KQ4 X;  4HKZ E;  5BO4 B;  1MHX A;  3FIL B;  3BK2 A;  3KQ4 A;  4G11 A;  1F77 A;  4LJO B;  3IT6 B;  4ACF A;  4BFR A;  1PFD A;  3R8B A;  1TBE A;  3NS1 A;  2K8C A;  1PGA A;  2CJO A;  3B2G A;  4MAC A;  4GXB A;  1MG8 A;  2R61 A;  1DGJ A;  4KZC A;  1TT5 B;  2ZCC A;  4C7Y A;  2WX0 A;  1YX6 B;  4IKG A;  3AE7 B;  4M8N A;  2WX1 A;  2QIL A;  1L6U A;  3R3M A;  3H7S A;  4XWT A;  5CHV C;  1L4Z B;  1TYG B;  1FD6 A;  4C7Z A;  4ZYN A;  4C56 C;  3L54 A;  1HZ6 A;  4K3C A;  4ZRQ A;  2NBW B;  4MEM A;  1UBQ A;  5IKC M;  5AZG A;  2UWQ A;  1BXT A;  1N60 A;  4OVV A;  3L13 A;  3B0A A;  1CK1 A;  5BYQ A;  1IP9 A;  2J53 A;  3Q14 C;  2J0K A;  5LLI A;  2DHZ A;  2M8S A;  4G0N B;  4ARC A;  3BYY B;  3S2A A;  2LGS A;  5J17 A;  3ZLZ A;  1MFW A;  1YJI A;  4L23 A;  1KRH A;  3OWE B;  2JQR B;  5CHW A;  1UBI A;  1H8C A;  4RCO A;  1UGM A;  4KKJ A;  3RNA C;  4W9D A;  3JYU A;  3JVZ X;  5E6J A;  3PSE B;  2M4N A;  3KLS X;  3IBE A;  2MP2 B;  1MI0 A;  2V4L A;  3TEX A;  1E5W A;  1YN5 A;  4IWQ A;  1C9F A;  5LXH A;  1C4A A;  5IAA C;  1V1P B;  4GLS C;  1L4D B;  1OTR B;  5H8Y E;  3X23 A;  2KTR A;  2LD9 A;  1KLU D;  5HKH A;  2L52 A;  3VXW A;  2N4F A;  1TY0 A;  4N59 A;  4MGZ E;  2IO2 B;  3RMK C;  4OW0 A;  1F1H A;  1SGH A;  3UQB A;  2ZCB A;  3W5V B;  2MBO A;  4DDI D;  2LXC A;  1WGH A;  4RM9 A;  2KNB A;  1RYJ A;  3U7Z A;  2PLP A;  2CS4 A;  2B3A A;  5EE9 A;  3KWV A;  5H92 C;  1YD8 U;  4WJN A;  1YQB A;  4L2Y A;  1WX9 A;  1WGG A;  2KJH B;  4C00 A;  2KFK A;  4KGS A;  4FLH A;  5EDS A;  4RGO S;  1Q1O A;  3UQA A;  4YSY B;  3T3O A;  2W82 A;  3TEZ A;  1OEY A;  2QSD A;  2MX2 A;  3RD2 A;  2G1E A;  2H89 B;  2JUO A;  5IP4 D;  1K52 A;  1XLP A;  4PS8 A;  4HXD A;  1YQ3 B;  4JIO U;  4X57 B;  1FXT B;  2N9X A;  1EF1 A;  3HVD A;  2V3N A;  1SSN A;  1ZDV A;  1OQR A;  3ZJT A;  2WXI A;  3RNB C;  2L1A A;  5E6O A;  4WWO A;  3I3T B;  4MDK E;  4XYC A;  5E6N A;  4M01 A;  3ETR A;  3W5U B;  2TSS A;  2I1J A;  4YWG G;  1RAX A;  5EE0 A;  3B08 A;  1VCB A;  2J52 A;  4TSS A;  1DOI A;  2WDV B;  4H2A A;  3ZNH B;  1RFK A;  2QIE B;  2GBR A;  2GBM A;  3Q3M C;  1J7A A;  1NEK B;  2DAF A;  1JQ4 A;  5G2N A;  1K51 A;  2CHZ A;  2KOX A;  2FCS A;  3QAQ A;  2KDB A;  2XBB C;  3RUI B;  1WXM A;  1WGD A;  1LGR A;  2KMA A;  4HPL B;  4WJQ A;  1GC6 A;  2BYE A;  3H7P B;  2L7R A;  2JRI B;  2M1M A;  1J7B A;  5FR3 A;  1FNW A;  1L2N A;  4NY0 A;  1SB3 C;  1WH3 A;  1E10 A;  1KOT A;  2MW5 A;  3U2S C;  4JLC A;  2L32 A;  3DVN V;  2FUG 1;  2N9P C;  4TKN A;  3M63 B;  3AED B;  4ANX A;  3RPF C;  1UUP A;  1K53 A;  3FKY A;  1I35 A;  1XF5 L;  2CU3 A;  1XLQ A;  3PPA A;  1WYW B;  2D5G A;  4AJW A;  5JZE B;  3T8M A;  3IT4 B;  3PT2 B;  5JHA A;  1ZE3 D;  4PS3 A;  1OQQ A;  3U30 A;  3APC A;  3ZGZ A;  3TBL D;  2N7E A;  1ZXH A;  4I6N B;  2KTF A;  3H1U A;  3HVZ A;  1E6E B;  2NPT A;  2GB1 A;  3RYT A;  2W9N A;  3Q8F A;  4NJ7 A;  4WUR A;  2L00 B;  1T0Y A;  1XLN A;  3RUL A;  1UGJ A;  3Q2A C;  4DDG D;  3P4Q B;  3V05 A;  2DWQ A;  2MSE D;  1R4N B;  3NVV A;  2DBY A;  2KMM A;  3URY A;  4ZRJ A;  4LNF A;  2KX3 A;  2VH1 A;  1J8C A;  1NYQ A;  2DYM A;  3RFZ B;  2WYQ A;  1G6J A;  4IUM B;  4YT0 B;  1K8R B;  3Q6B A;  2EKI A;  2KYW A;  4CHK A;  4C80 A;  1FRD A;  3RZW C;  3RNF C;  4AUQ C;  3L10 B;  1YN4 A;  3GB1 A;  3VDZ A;  1TS5 A;  4KKI A;  3AE4 B;  1FIQ A;  2LGX A;  2RSU A;  3P4P B;  2YEP B;  3OJ4 B;  2DX5 B;  1KFY B;  3KUC B;  1SIF A;  4LNK A;  2XN9 C;  3WAN A;  1WXA A;  4HPM B;  3PRE A;  1HTO A;  4XDC A;  3QA8 A;  2MCN B;  2JU6 X;  2IJ0 A;  2LMC A;  1T6B X;  4HCP B;  4CQN A;  1TZ1 A;  2IO1 B;  4M0W B;  4WIP A;  2O2V B;  1V80 A;  2K5P A;  1RWS A;  2KWD A;  4NAW B;  1I4Q A;  4MJS B;  4DQO C;  2HDE A;  2N9L A;  3C19 A;  4FBJ B;  4S17 A;  1HA5 A;  1SE4 A;  1F0Z A;  4USA A;  4YTN B;  4HKQ A;  2KWV B;  1J19 A;  4LNN A;  1P98 A;  2LEK A;  3PV1 A;  4ASW C;  2INC C;  1A70 A;  1S1Q B;  3PVL A;  2CU1 A;  3APD A;  3BY4 B;  3B9J A;  2RPQ A;  3ZXR A;  2C7H A;  3L4P A;  1WZ3 A;  1WJ4 A;  1TS3 A;  3DBL I;  4US8 A;  2LFI A;  3ZJV A;  3VAW A;  4IWO A;  1D5Z C;  4DXG A;  2JF5 A;  4PK1 A;  4MGI E;  2O2V A;  1KLG D;  1FNU A;  4HK2 A;  3N3K B;  3SD5 A;  3WCQ A;  2NS5 A;  1B9R A;  4FAD A;  4NQK E;  3RT3 B;  2A5U A;  3ZNI D;  3SDL C;  2MH7 A;  3IAM 1;  3AE5 B;  3TSS A;  1QT9 A;  3V6E B;  2OJR A;  3ML9 A;  1MHH E;  3A1Q B;  2AX5 A;  2JX5 A;  2X38 A;  2M17 A;  5J2R A;  3ZJU A;  4AP4 C;  2DLB A;  1WIA A;  1TKE A;  2J0M A;  3X0W A;  1V81 A;  1E0Z A;  2BQQ A;  4JX1 C;  3ZVV A;  1WXV A;  2MJ3 A;  2WXH A;  3BK1 A;  1Y56 A;  3SEB A;  3MC9 A;  3A9K A;  5LNK 1;  4MM3 B;  1TTN A;  2ZVO A;  2EMS A;  4IW0 A;  3ZIM A;  2O6V B;  4YTP B;  1E7P B;  3QWZ B;  1NDD A;  3IFW B;  3DHH C;  3N1Z C;  2IO0 B;  4HWI B;  2AYO B;  3A4R A;  3MTN B;  2VRR B;  1D5M C;  3N9Y C;  2OOB B;  1Q10 A;  2GBK A;  4O1N A;  4RFB A;  4BAX A;  3DHI C;  2W55 A;  1LO5 D;  1EF5 A;  3Q8E A;  1HTQ A;  4YL8 A;  2PVG C;  2D3B A;  1HQR D;  3AXC A;  4RGM A;  2KDF B;  2BPS A;  5G5G A;  2EKE C;  4ANV A;  3PHW B;  2E6X A;  2L76 A;  2VZK B;  3I5J C;  4YSZ B;  2PKO A;  1YNT E;  3LDZ E;  1OQY A;  2BB5 A;  1FEH A;  1B1Z A;  5JHB A;  5I4D A;  2FNJ B;  2OHF A;  4IM3 A;  3VQI A;  5KHQ A;  1TJE A;  1UH6 A;  3ECI A;  1SBB B;  4EZJ A;  1SXT A;  2I38 A;  2HE7 A;  1FXA A;  4RMA A;  1N63 A;  4HRO A;  2WXL A;  1PYW D;  2D3C A;  4LK0 M;  4XGA B;  3R7Q A;  3MC0 B;  3WAM A;  5DPS A;  4XWW A;  2Y3A A;  1ZW7 A;  2HJ1 A;  2N1V A;  3RN9 C;  4RH6 A;  2WXF A;  5G5H A;  3WAP A;  3NOB A;  1QZE A;  2CJN A;  2ZPY A;  2AL6 A;  3AU5 A;  1ZXI A;  2C7N B;  3VUY A;  1SF0 A;  3MJW A;  1WXS A;  2LVP A;  1JWB D;  4E71 A;  3HHM A;  3VUX A;  4FXC A;  3NG0 A;  4OVZ A;  3IAS 1;  4HEA 1;  3A33 B;  2G4S A;  4BKG A;  2FAZ A;  4NJ6 A;  2KTR B;  1DOX A;  2LJI A;  3P1M A;  3AMZ A;  4EZL A;  1NBF C;  4A20 A;  1IGD A;  1E8W A;  5BYS A;  2H88 B;  1P0R A;  2GBN A;  3IG3 A;  1ZKH A;  4GGQ A;  3H8H A;  1DOY A;  3L16 A;  5HG2 A;  2DEN B;  3FC4 A;  3NY5 A;  4G50 A;  1TKY A;  1ET9 A;  4TV3 A;  3N20 C;  4LDT D;  2Z59 B;  4WWN A;  1QIL A;  3QHT A;  2KFK B;  4ZHO A;  1HXY D;  4KVG B;  4IM2 A;  5D3D A;  1QF6 A;  2IGD A;  3M3J A;  4ZRK A;  4BKT A;  2K6Q A;  2WLB A;  3ZNZ B;  3VH4 B;  2FUH B;  4GDL A;  3SFD B;  1WGK A;  2C60 A;  4ZRP A;  4TQ0 A;  1R7S A;  3AEF B;  1NI2 A;  1OEY J;  2GOW A;  2IO3 B;  4IM0 A;  1EO6 A;  2K8B A;  2V3P A;  4IG7 B;  4KSL C;  5JXV A;  3PRZ A;  2RDB C;  4LNO A;  1RM6 C;  3SHQ A;  5BMG A;  3P4S B;  2WDQ B;  4F1S A;  2NVU I;  2ON8 A;  1UWM A;  4J3O D;  2LGD A;  1C79 A;  5KHO A;  4A6Q A;  1A5R A;  1JWA D;  4IC7 B;  2LRW A;  2XEW A;  4HDO A;  4WAA A;  1SJH D;  5HI1 A;  3U52 E;  3EA6 A;  2GI9 A;  2PVO D;  2JYE A;  2KN4 A;  3EFU A;  1TS4 A;  3HM3 A;  2MBQ A;  3QK0 A;  2JRH A;  3E9S A;  1WMH B;  1FCC C;  2W54 A;  1XO3 A;  2V9H A;  4A90 A;  1XCQ L;  5C23 A;  1JWS D;  4NJC A;  3JSV A;  3AE9 B;  3GOE A;  2BBC A;  2W3S A;  2LUM A;  4BKS D;  2RPV A;  3RNC C;  3ZDT A;  2ICI A;  4IWP A;  1HE8 A;  1PUT A;  1Q5W B;  4DHJ D;  4E3C A;  4BBN C;  2PMV A;  4CO7 A;  1L0V B;  1TKG A;  1PGX A;  1FFU A;  1D6E C;  5FR6 A;  2C9W B;  1LM8 B;  2EMT A;  1E9M A;  3H6N A;  1KLV A;  1R4N I;  3NVW A;  2V3S A;  3D32 A;  3PLU A;  3IHP C;  3GZN B;  2KC2 A;  4KZ0 A;  4J6I A;  1IBX A;  1KJT A;  4HLE A;  1WMH A;  3ZQ4 A;  5C3J B;  2PPH A;  4N58 A;  1ZOY B;  1ET6 A;  2FBW B;  3HIZ A;  2LWP A;  2FCN A;  1ZPS A;  2KX0 A;  4WAF A;  4G3X B;  4JGH B;  4MEL A;  1F52 A;  1XT9 B;  4WJP A;  1L0X B;  3BYT B;  2NPT B;  3VTU A;  2J0J A;  2ZW1 A;  3R66 C;  1JW9 D;  1TY2 A;  4GSW A;  1V49 A;  1P9D U;  4EFO A;  5L83 A;  4BVU C;  2KDM A;  1UD7 A;  2HD5 B;  3AEC B;  2YEP F;  1F2R I;  2MWS B;  3AN1 A;  4RF0 A;  3KYD D;  2QDF A;  3WAL A;  3J9C A;  1WSP A;  4S0R A;  1NYR A;  3AE1 B;  1NEN B;  1GUA B;  1VLB A;  4RF1 A;  1RRB A;  4BOZ B;  3V6C B;  4Q2J A;  3ZTC A;  2KLC A;  1FRR A;  2Q5W D;  3VTV A;  1C78 A;  4ZRI A;  3NJT A;  2QEJ C;  1XEE A;  5T8I A;  3U7D A;  4OVU A;  2BF8 B;  1QLB B;  3KUD B;  1ROE A;  4E74 A;  4DHZ B;  3AH7 A;  2C5L C;  2WU2 B;  4F7Z A;  1AYF A;  2XK5 B;  3Q3O C;  2A4Z A;  2LHD A;  1FNV A;  2L05 A;  1KH0 A;  1E8Z A;  2LGI A;  3PTF C;  4W9F A;  3PRP B;  2LAS A;  2HJ8 A;  2KN5 A;  2PTL A;  2QCZ A;  4RNA A;  3DVG X;  3B2F A;  1WY8 A;  2BT6 A;  2AEH A;  1ENF A;  1EU4 A;  3C0R B;  4YXD B;  2LZ6 A;  1WJN A;  3OJ3 A;  2MEK A;  1IYF A;  3CF6 E;  1H4R A;  1PQS A;  1L5P A;  4MSQ B;  4P16 A;  3CSF A;  1QOA A;  3I63 C;  3SR6 A;  3AE2 B;  3HK0 A;  2IYD B;  5C2T B;  3BII D;  3DBH B;  2PE6 B;  1YQ4 B;  2AQ3 B;  2HTH A;  4GDK B;  4RM8 A;  2ZZP B;  1SE3 A;  1WGR A;  1XCT L;  2BGF A;  2JYT A;  2MJD A;  3RI7 C;  2D11 A;  2XK5 A;  2IGG A;  1X1M A;  2WXQ A;  2NTT A;  1EU3 A;  1F9J A;  3VFK A;  3MHZ A;  2DYO A;  3LJ3 A;  3Q8C A;  1JRP A;  1VJK A;  3LB8 C;  2G4D B;  1Z2M A;  4B6W A;  5D2M B;  3QAR A;  3Q8B A;  3KWL A;  4JQW C;  2ONQ A;  4IDI A;  3Q3F A;  3UI3 A;  4TQ1 A;  3K9O B;  2LVQ A;  4XE0 A;  1WJ6 A;  4N6E B;  4PS7 A;  3WA0 A;  1WM3 A;  2ZNV C;  2JPH A;  4YTM B;  2B76 B;  3DBR B;  4MGK E;  1WI0 A;  2VH2 A;  2D3G A;  2WNM A;  4KGR A;  2FIF A;  4MT5 A;  2JY6 A;  2ACZ B;  3TEY A;  4II2 B;  4GDK A;  3AEA B;  5HHD G;  2NMQ A;  1ISN A;  1AAR A;  1D4B A;  2YVC A;  3E56 A;  3A9K B;  4XZ4 A;  1DYQ A;  3W1S C;  3DHG C;  4DK5 A;  1WR6 E;  4LNI A;  4A9A A;  3UIP B;  2N7D A;  2INN E;  4P1C C;  2AWT A;  2BYV E;  1ZGU B;  4ZHP A;  2E3T A;  2LRU A;  1P1A A;  2DZM A;  2WXK A;  2BWE S;  2WXP A;  2WXM A;  4OZA A;  1UWX A;  2WDT B;  3ZRF A;  1KTK A;  1I4X A;  4B0E A;  3BIN A;  3L17 A;  1NI3 A;  1WE6 A;  1EUV B;  1I4H A;  5DCN A;  4LDT B;  3HUI A;  4DXA B;  3L08 A;  4A55 A;  2Y5C A;  1WRD B;  3KYC D;  1TGZ B;  2BS3 B;  4P6V F;  1WJU A;  1C1Y B;  5D6J B;  4W9J A;  5GXG B;  1WE7 A;  5AUK A;  2WXR A;  3NZS A;  4KDI C;  1GB4 A;  1T0Q C;  3DOW A;  2QJL A;  2WGS A;  4FJZ A;  1J7C A;  2M0X A;  4W9I A;  3ZW3 A;  3BVG A;  1VR9 A;  1V6E A;  1ESF A;  2DNF A;  4TUU A;  4WH4 A;  1BT0 A;  3P63 A;  3OAW A;  1R4M B;  3SU8 X;  5TSS A;  2L3Z A;  3NUH B;  2KHW B;  2D3A A;  2KT7 A;  3PGE A;  1GG3 A;  4URK A;  3AM9 A;  2KD0 A;  1AW7 A;  2CHW A;  4I6P A;  2KO3 A;  4RGT A;  3QIJ A;  1YJJ A;  2WWZ A;  2KMC A;  3KVF B;  1P7E A;  1WX7 A;  3W1Y A;  3M62 B;  3OLM D;  2BWF A;  2NBV B;  3GP7 A;  3IXS A;  4I6L B;  1L0Y B;  5BMI A;  2RR9 A;  4MGY E;  4C4V A;  2DZK A;  2K9X A;  5CX3 A;  2M0A A;  1OGW A;  3PZD A;  4R3D A;  3HM6 X;  3QCA A;  2J4X A;  1C4C A;  1N5X A;  3ZRC A;  2M56 B;  3EGR A;  3P4R B;  2LVO A;  1BML C;  3UIN B;  1M94 A;  2K39 A;  1JRU A;  2KQS A;  1WZ0 A;  3V60 A;  4ANW A;  3TL5 A;  3AUL A;  2K25 A;  3A9J A;  3UF8 A;  1C76 A;  4W9K A;  3DCG A;  4DHJ B;  3V62 A;  3JW0 X;  3N1Y C;  1WR1 A;  3O13 A;  3R7R A;  1MPE A;  2BVC A;  2L8J A;  4KV2 A;  1C77 A;  4GB9 A;  4HJG E;  2BW2 A;  4FN2 A;  1PDX A;  3V61 A;  4WQO B;  2BKR B;  2L0F A;  4W9L A;  1QOF A;  4FUL A;  1EWY C;  3UGB B;  3PHX B;  5LXI B;  1QQR A;  2RGF A;  4II3 B;  3R2I A;  3V3X A;  3BVM A;  4UDU C;  5G55 A;  1UNS A;  1YX5 B;  2REX A;  3CMM B;  4GMV A;  1D5X C;  1VZ8 A;  4GDL B;  4LLG M;  4OHJ A;  3AU4 A;  1FPY A;  3QQ8 B;  3QX1 A;  1ZUD 2;  1GAQ B;  2CR5 A;  5AZF A;  5L95 C;  3ZKJ C;  2N9E B;  4MSM B;  4ZOH C;  4BKS A;  1I7H A;  4TMA B;  1V9J A;  3UIO B;  5BMH A;  2KFJ A;  2V0G A;  2N0S B;  2UYZ B;  5CTR C;  3TIX A;  2R2Q A;  4KIK A;  4D2K A;  2DZJ A;  3DVN U;  2MA9 B;  2JZP A;  4W9G A;  2PEA A;  1WGY A;  5IO9 A;  4B0M A;  3ZDM C;  1L7Y A;  1JML A; 
#chains in the Genus database with same CATH homology
 1IBX A;  2XN9 C;  1FMA D;  3ZQ4 A;  3CIR B;  5C3J B;  3AE3 B;  4AQ7 A;  4N58 A;  1ZOY B;  1ET6 A;  2FBW B;  4XDC A;  5AUI A;  1ZPS A;  2JU6 X;  2IJ0 A;  1ZDX A;  4WAF A;  3FIL A;  3DWG C;  2LMC A;  1TZO A;  1T6B X;  1EWC A;  1FFV A;  4CQN A;  1L0X B;  3BYT B;  4WIP A;  5D7G A;  2K5P A;  3I57 A;  1RWS A;  2ZW1 A;  4KGT A;  2KWD A;  1JW9 D;  1TY2 A;  4NAW B;  1I4R A;  1N61 A;  3MFG A;  1JCK B;  1I4Q A;  1WYG A;  4DQO C;  2HDE A;  2BS4 B;  2KDM A;  3FAH A;  4ARI A;  2NTS A;  2N9L A;  2PW9 A;  5HFY A;  5FKA C;  5BYR A;  2J42 A;  2SAK A;  1HA5 A;  1SE4 A;  2JWU A;  2YEP F;  3AEC B;  1F2R I;  1F0Z A;  3AN1 A;  4RF0 A;  1F2R C;  3AE6 B;  3J9C A;  1WSP A;  4USA A;  4YTN B;  4HKQ A;  3MJ5 A;  1NYR A;  3U4E G;  1N5W A;  1VZ7 A;  1HZ5 A;  2G9H D;  1QOB A;  1NEN B;  2LEK A;  3AE1 B;  3LXF A;  4JWU C;  1VLB A;  1A70 A;  3NVZ A;  4RF1 A;  4Q2J A;  5MPO A;  4XDD A;  3B9J A;  2LHE A;  2BTE A;  1HEZ E;  2WXG A;  1FRR A;  3HRD D;  3I9V 1;  2IGH A;  2BB6 A;  2Q5W D;  3L4P A;  1C78 A;  2AQ2 B;  2QEJ C;  1XEE A;  3GS2 A;  1TS3 A;  1T5X D;  5T8I A;  4US8 A;  2LFI A;  3ZJV A;  2K22 A;  1IBX B;  2Y5P A;  1QLB B;  2WS3 B;  2JXT A;  3ABV B;  1AWD A;  1ROE A;  1SJE D;  1AN8 A;  1BUI C;  1D5Z C;  4JWS C;  4DXG A;  3AH7 A;  2WU2 B;  2KQ4 X;  4HKZ E;  5EE3 A;  1AYF A;  1KLG D;  1FNU A;  1MHX A;  3FIL B;  3BK2 A;  3KQ4 A;  2LHD A;  3WCQ A;  1F77 A;  1FNV A;  3IT6 B;  4JE3 B;  2VZK D;  1KH0 A;  1PFD A;  2LGI A;  3R8B A;  3NS1 A;  1XLO A;  1B9R A;  2FE8 A;  1PGA A;  2CJO A;  3B2G A;  4MAC A;  1EM7 A;  2PIA A;  2MH7 A;  2R61 A;  1DGJ A;  4C7Y A;  2PTL A;  1JWU D;  4KX6 B;  4RNA A;  2N7J A;  3B2F A;  3IAM 1;  3AE5 B;  3TSS A;  4IKG A;  2BT6 A;  1I4P A;  3AE7 B;  1QT9 A;  2QIL A;  1ENF A;  1MHH E;  1EU4 A;  3AEG B;  1L6U A;  4YXD B;  2IPK D;  2AX5 A;  2JX5 A;  2X38 A;  4XWT A;  4IOI E;  1SE2 A;  1L4Z B;  2MEK A;  3ZJU A;  1V1P A;  1TYG B;  1WXQ A;  2DLB A;  4PT5 A;  1L5P A;  1FD6 A;  4C7Z A;  1TKE A;  4P16 A;  1QOA A;  3SR6 A;  3AE2 B;  2INP E;  4C56 C;  1E0Z A;  4JX1 C;  5C2T B;  1HZ6 A;  4ZRQ A;  4NAM A;  3BII D;  2MJ3 A;  2WXH A;  3BK1 A;  1I4G A;  1Y56 A;  1YQ4 B;  3SEB A;  1SIJ A;  2AQ3 B;  4MH8 A;  4GDK B;  3TUO A;  5LNK 1;  1NVI D;  1BXT A;  4MM3 B;  3LYY A;  1N60 A;  1SE3 A;  5D3I B;  4YTP B;  1CK1 A;  1E7P B;  1XCT L;  2JYT A;  5BYQ A;  2MJD A;  2BYT A;  2QMT A;  2J53 A;  2IGG A;  2WXQ A;  2NTT A;  1EU3 A;  1KF6 B;  3MHZ A;  3Q69 A;  1D5M C;  2WP9 B;  3N9Y C;  2DYO A;  1Q10 A;  4ARC A;  3Q8C A;  3BYY B;  3PZ8 A;  4O1N A;  1JRP A;  4RFB A;  1VJK A;  3LB8 C;  2GRI A;  2W55 A;  1YJI A;  1LO5 D;  3NRZ A;  3Q8B A;  3KWL A;  3Q8E A;  3VR9 B;  4L23 A;  1KRH A;  3PO0 A;  4A8X C;  2PVG C;  1HQR D;  4RGM A;  3OWE B;  2JQR B;  5G5G A;  1T3Q A;  4RCO A;  2WXN A;  2ONQ A;  3ZYY X;  2E6X A;  2XNA C;  4IDI A;  4KKJ A;  2VZK B;  3UI3 A;  4YSZ B;  4TQ1 A;  5E6J A;  3KLS X;  2PKO A;  1YNT E;  4XE0 A;  1L6V A;  1MI0 A;  3TEX A;  2BB5 A;  1YN5 A;  1C9F A;  1FEH A;  4N6E B;  1OFF A;  1B1Z A;  4YTM B;  1C4A A;  4HRS A;  1V1O A;  2B76 B;  5I4D A;  1V1P B;  4GLS C;  3NVY A;  1L4D B;  2OHF A;  1FO4 A;  1YN3 A;  5H8Y E;  3VQI A;  1TJE A;  2EEL A;  2WNM A;  4KGR A;  1KLU D;  2L52 A;  4MT5 A;  2ACZ B;  1SBB B;  3TEY A;  1TY0 A;  4N59 A;  2WDR B;  4OW0 A;  3AEA B;  1SXT A;  2I38 A;  1FCL A;  5HHD G;  1FM0 D;  3W5V B;  2NMQ A;  1D4B A;  1FXA A;  3E56 A;  1N63 A;  4RGN A;  4HRO A;  1RYJ A;  3U7Z A;  1MVK A;  2PLP A;  1DYQ A;  2WXJ A;  2WXL A;  5EE9 A;  1PYW D;  3BWU D;  3KWV A;  3C8Y A;  3W9C B;  4A9A A;  5H92 C;  4LK0 M;  3MC0 B;  4L2Y A;  2INN E;  4XWW A;  2Y3A A;  4KGS A;  4ZHP A;  4RGO S;  1N62 A;  2K3U A;  2E3T A;  2ZW0 A;  2WXK A;  2Z8L A;  4YSY B;  2AQ1 B;  3T3O A;  2WXP A;  4RH6 A;  2WXM A;  2W82 A;  1UWX A;  2WXF A;  4OZA A;  3TEZ A;  1QOG A;  2QSD A;  1KTK A;  1I4X A;  1JWM D;  2G1E A;  4B0E A;  2H89 B;  5G5H A;  1NI3 A;  1K52 A;  3EUB 2;  1XLP A;  1I4H A;  4REZ A;  1VDV A;  2CJN A;  4US9 A;  4AS1 A;  1YQ3 B;  3HUI A;  1ZXI A;  1IGC A;  4A55 A;  3W1S A;  2Y5C A;  1SF0 A;  1FXI A;  3HVD A;  2BS3 B;  2V3N A;  4P6V F;  1JWB D;  1SSN A;  1ZDV A;  3PZ7 A;  1OQR A;  3ZJT A;  2WXI A;  4FXC A;  5GXG B;  4OVZ A;  5AUK A;  3AEB B;  3IAS 1;  4HEA 1;  2WXR A;  3SFE B;  2L1A A;  1GB4 A;  2RDH A;  3BVZ A;  1DOX A;  2QJL A;  1J7C A;  2LJI A;  3P1M A;  3AMZ A;  3VR8 B;  3BVG A;  3ETR A;  3W5U B;  3AV8 A;  1VR9 A;  2KAC A;  1IGD A;  2TSS A;  2WXO A;  5BYS A;  4YWG G;  1ESF A;  2H88 B;  1C4P A;  5EE0 A;  4WH4 A;  1V8C A;  3P63 A;  2J52 A;  4TSS A;  1DOI A;  2WDV B;  5TSS A;  4WWM A;  3NUH B;  1TS2 A;  3H8H A;  3W2D A;  1DOY A;  4H2A A;  1RFK A;  4NZL B;  3AM9 A;  3FC4 A;  2QIE B;  5HG2 A;  4L1B A;  1TKY A;  3NZ3 A;  1ET9 A;  1AW7 A;  1CZP A;  4RGT A;  1YJJ A;  2JSV X;  1QIL A;  1M4V A;  1J7A A;  1NEK B;  1WRI A;  1P7E A;  4ZHO A;  1HXY D;  1JQ4 A;  5D3D A;  1QF6 A;  2IGD A;  1K51 A;  3GP7 A;  3IXS A;  3MP9 A;  1GOZ A;  3TEW A;  3CWI A;  2SEB D;  2WLB A;  1L0Y B;  4JPS A;  5BMI A;  3SFD B;  2RMM A;  2K9X A;  1STE A;  1WGK A;  4LTU A;  4YSX B;  2M0A A;  4ZYS A;  4R3D A;  1JAL A;  4ZRP A;  4TQ0 A;  2J4X A;  1C4C A;  1R7S A;  1N5X A;  2RDG A;  3AEF B;  2K0P A;  1CQV A;  2M19 A;  2M56 B;  3EGR A;  2V3P A;  3P4R B;  5JXV A;  1BML C;  2OED A;  1J7B A;  5FR3 A;  1FNW A;  1ACC A;  1RM6 C;  1P7F A;  1SB3 C;  2BS2 B;  1E10 A;  3Q8A A;  1PGB A;  5BMG A;  3P4S B;  2WDQ B;  3U2S C;  2IDY A;  2L32 A;  2L83 A;  1C76 A;  1GPX A;  2FUG 1;  4EE2 A;  2ON8 A;  3AED B;  1UWM A;  4J3O D;  5EE1 A;  3BZD B;  1C79 A;  1WWT A;  4WQM A;  3RPF C;  4A6Q A;  1XXG A;  3O13 A;  2W3R A;  1MPE A;  3R2T A;  1UUP A;  1JWA D;  1K53 A;  1VRA B;  1CJE A;  1C77 A;  1XF5 L;  2BW2 A;  2CU3 A;  1ZP0 B;  1PDX A;  4HJG E;  4ITK A;  1SJH D;  5HI1 A;  1XLQ A;  3U52 E;  2D5G A;  3EA6 A;  1QKZ A;  1QOF A;  2GI9 A;  2PVO D;  2JYE A;  3IT4 B;  2KN4 A;  3VRA B;  2V4I B;  1TS4 A;  1EWY C;  1ZE3 D;  1OQQ A;  1V97 A;  2WU5 B;  3VRB B;  3E9S A;  3DWM A;  1FCC C;  2W54 A;  3ZGZ A;  1QQR A;  1XO3 A;  1ZXH A;  4A90 A;  3R2I A;  3V3X A;  1XCQ L;  1JWS D;  3BVM A;  3HVZ A;  4M0W A;  1E6E B;  4UDU C;  1UNS A;  2GB1 A;  4NJC A;  5FK9 C;  3Q8F A;  3AB5 A;  3AE9 B;  2BBC A;  1VZ6 A;  4WUR A;  1SEB D;  2W3S A;  2LUM A;  1XLN A;  1D5X C;  1VZ8 A;  4GDL B;  1IUE A;  1UGJ A;  4LLG M;  4OHJ A;  1GB1 A;  2RPV A;  3P4Q B;  1ZUD 2;  1GAQ B;  3V05 A;  2DWQ A;  2ICI A;  2HTM E;  3NVV A;  1PUT A;  2DBY A;  2KMM A;  3URY A;  4DXF A;  4ZOH C;  1NYQ A;  1I7H A;  2N9K A;  4TMA B;  2PMV A;  3T3N A;  5BMH A;  4OZB A;  2DYM A;  1K50 A;  2V0G A;  3RFZ B;  2N0S B;  3P42 A;  1L0V B;  2WQY B;  1TKG A;  1PGX A;  1FFU A;  4YT0 B;  2KAJ A;  1D6E C;  3AEE B;  2MJE A;  2EKI A;  4D2K A;  2JZP A;  4C80 A;  1E9M A;  1FRD A;  1YN4 A;  3NVW A;  3GB1 A;  1JRO A;  1TS5 A;  1YMH E;  4KKI A;  3AE4 B;  4OZC A;  3AE8 B;  4B0M A;  2I2Y A;  1FIQ A;  1JML A;  3P4P B;  2YEP B;  1KFY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...