2MH7A

Solution structure of oxidized [2fe-2s] ferredoxin petf from chlamydomonas reinhardtii
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
101
structure length
101
Chain Sequence
MYKVTLKTPSGDKTIECPADTYILDAAEEAGLDLPYSCRAGACSSCAGKVAAGTVDQSDQSFLDDAQMGNGFVLTCVAYPTSDCTIQTHQEEALYENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferredoxin, chloroplastic
publication title Redirecting Elctrons from Photosystem I to Hydrogenase: Towards Increased Hydrogen Production in Algae
rcsb
source organism Chlamydomonas reinhardtii
total genus 17
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2mh7A00
1JQ4A 2WQYB 1IUEA 1ZOYB 2W3RA 2K9XA 3L4PA 4IDIA 3RPFC 1SB3C 2PVOD 3ZYYX 3CWIA 3AE4B 4JWSC 1YQ4B 2B76B 1N5XA 1GAQB 3BIID 1QOAA 3VRBB 2M19A 3FAHA 1GPXA 1TKEA 1WRIA 2M56B 3WCQA 2EKIA 1B9RA 1N61A 1L6VA 3AEBB 4FXCA 3AEAB 1N60A 3SR6A 2G1EA 3SFEB 4HROA 2W55A 2PIAA 1XLPA 3AM9A 3AE9B 1L5PA 1RM6C 4JWUC 3DWGC 1RWSA 2WDQB 1EWYC 4YTMB 1DOXA 1TKYA 4KX6B 3B2GA 1JALA 4N6EB 4C7ZA 2QJLA 4A9AA 5AUKA 3LB8C 1DGJA 1UWMA 1XLOA 1NVID 1QOFA 2JX5A 1QT9A 1ZXIA 3AEEB 4LTUA 3NVVA 1QOBA 1N5WA 3DWMA 1L0VB 1NYRA 2K22A 5EE3A 2DBYA 1XLNA 1FIQA 2BS2B 3AECB 1PUTA 1FRRA 2ACZB 2MH7A 1SIJA 2WS3B 1RFKA 1YJJA 1JWAD 5EE9A 1E6EB 2PVGC 3P4QB 1VDVA 1FMAD 2OHFA 4US8A 2L83A 2MJDA 3NVZA 3AE1B 2AX5A 1V97A 1OFFA 1AWDA 2BS3B 2MJ3A 3AE6B 1ROEA 2WDVB 4YTPB 3NRZA 1RYJA 3AN1A 1J7CA 1TJEA 5G5HA 1ZP0B 2H88B 1JW9D 4P6VF 1QF6A 1YJIA 2WDRB 3AEFB 1CZPA 3AE5B 1OQRA 4YT0B 2PKOA 3VR9B 4YSXB 3P4PB 5C2TB 1PDXA 3HUIA 3P1MA 3AMZA 1VJKA 1XLQA 2K5PA 1E9MA 2WU2B 1KF6B 1A70A 3NVYA 3AE3B 2Y5CA 3AH7A 2MJEA 2QIEB 2BT6A 3AB5A 2N0SB 2DWQA 1SF0A 3AEDB 3LXFA 4US9A 1WXQA 2CJNA 1JWBD 2BS4B 3FC4A 1OQQA 3AV8A 1DOIA 1N63A 2WP9B 3AE7B 5GXGB 3AE2B 1AYFA 1FXIA 1V8CA 1ZUD2 2L52A 3PO0A 3CIRB 1JRPA 4N58A 4YSZB 1FM0D 2LEKA 1YQ3B 4ITKA 1J7BA 3SFDB 1E0ZA 1FFVA 1QOGA 2H89B 3B9JA 1PFDA 1WYGA 1KFYB 5C3JB 4USAA 1FO4A 1F0ZA 1FRDA 1VLBA 2WLBA 3P4RB 3P4SB 1FFUA 3EUB2 3HRDD 3B2FA 1I7HA 1JROA 3ABVB 2JQRB 4JX1C 1TYGB 3NS1A 2Q5WD 1NENB 1WGKA 4WWMA 1WWTA 3VRAB 1XO3A 3AEGB 5H8YE 2E3TA 4ZHOA 5EE0A 4YSYB 1TKGA 1NEKB 3AE8B 2CJOA 1QLBB 3NVWA 4C80A 4YTNB 2CU3A 4N59A 5MPOA 1NYQA 5H92C 2W3SA 5EE1A 1NI3A 1R7SA 1T3QA 5AUIA 3W5UB 3KWLA 4ZOHC 4WQMA 1L6UA 1E7PB 2KMMA 2W54A 4YXDB 1DOYA 4HRSA 3P63A 3ETRA 3HVZA 2FBWB 3W5VB 2WU5B 1CJEA 2HTME 5G5GA 4ZHPA 1E10A 1KRHA 1J7AA 1FXAA 1N62A 3W9CB 3VR8B 4C7YA 2KAJA
chains in the Genus database with same CATH superfamily
2M0AA 1IUEA 1D4BA 3V05A 1GUAB 3N20C 1GB4A 1WMHB 3A33B 3KWVA 1GOZA 3RCZA 2LHEA 1UUPA 1SSNA 1GAQB 2M19A 5EDSA 3Q3JA 4FXCA 4XDDA 2G45B 2N9KA 3AEAB 1TT5B 3ZNZB 5FR6A 1RM6C 2MBHA 2MRPA 3I63C 2J0MA 3MP9A 2K8HA 2VZKB 1VR9A 5BMIA 2AQ3B 3H7PA 3GE3C 1SE9A 2O6VB 5DPTA 1LXDA 3H7SA 2MJDA 1ROEA 3B0AA 2KO3A 1TTNA 2ONQA 2D07B 4P6VF 2C60A 4XYCA 4GDLB 4YT0B 3IT4B 1C4CA 3M62B 2OJRA 2DZJA 4MH8A 1QKZA 2J42A 3PRMB 2ZPNA 3HIZA 1D5ZC 4EFOA 1JWBD 4AJYB 3DBHB 2IGDA 4MGZE 1IGDA 2GLSA 3PO0A 4W9DA 2LJIA 3QWZB 3WALA 2UU7A 2L76A 2NTTA 4JQWC 2DZMA 1VLBA 4KIKA 3P4SB 1F2RC 1TYGB 3R2IA 2IGGA 3PV1A 3B1LX 2HDEA 1KTKA 2EMTA 5MPOA 2W3SA 3OAWA 1R4NI 2V4LA 3HK0A 3DVGY 4EZLA 3O13A 1SEBD 1RLFA 2XN9C 1FXAA 4WWNA 2MJEA 3AULA 3ZYYX 4AJWA 3PS6A 1Z5SB 2PVOD 2INPE 4B9KA 3NG0A 2MX2A 1TKEA 1Q10A 2JZPA 1L6VA 2MLBA 3UGBB 1L4DB 1WGGA 2PIAA 5IO9A 4W9KA 3P2BA 1OEYA 3T9LA 3TEYA 1QOFA 1N5WA 4GN1A 1XLNA 2MP2A 1CQVA 1WXMA 2IO2B 2KWVB 1KOTA 2AX5A 1AWDA 1H4RA 3R2TA 2GB1A 3H6NA 5KHOA 4FA6A 1ACCA 1OEYJ 1IP9A 1T0SC 1I42A 3PHWB 3U30A 4MEMA 2AQ1B 1PDXA 3L16A 1WX8A 1IPGA 2KC1A 2NPTB 4MGIE 4UDUC 4B0EA 1ESFA 1WGYA 3MC0B 2DWQA 3Q8CA 3RNAC 3HVDA 5BYSA 2BWFA 3ZKJC 2BYFA 2L0TA 4P1CC 3R3MA 4ZRPA 3CIRB 3KQ4A 2VH1A 3RD2A 2KDEB 1YX6B 4ITKA 1BUIC 2H89B 2IO0B 2K39A 5IAAC 1MHXA 1WWTA 3BYTB 2VZKD 4ANXA 3TJPA 4YTNB 4EEWA 2N1VA 1JRUA 4DK5A 4TMAB 3KW5B 5G55A 2C7HA 1R4NB 2G4DB 4II2B 3Q8EA 2MWSB 4IDIA 4PYZA 3BVGA 3W1YA 1YQ4B 4GGQA 5L83A 3BIID 5G2NA 4TSSA 3VTVA 4KGTA 1PGBA 2PTLA 4MSQB 5GMVA 2LXCA 1I35A 1XEEA 4K3CA 2XBBC 2WDQB 1FCLA 4K7UA 3NZUA 4TKNA 3LB8C 1I4GA 4MDKE 2KZRA 1L0VB 2LGSA 2LGXA 2X38A 2GBMA 4KVGB 2ACZB 4MM3A 2D11A 4A6QA 2CU1A 2ZVOA 1XCQL 1V97A 2LUMA 5DPRA 4A3OA 2GBNA 2WXMA 4XGAB 2L32A 4DXAB 4MGKE 2J0JA 2DHZA 3P1MA 3ZXVA 3R7QA 3I57A 5J2RA 2IDYA 2HE7A 3FILB 4URKA 1E8XA 1WF9A 1DYQA 2LUEA 1C1YB 3APCA 2K3UA 1JRPA 1FM0D 2RDHA 2JU6X 4IWOA 4DXFA 4RM8A 2CKHB 4IW0A 1WR6E 3IVFA 4K1RB 3MJWA 1I4PA 3KLSX 1ZXHA 2WXRA 3EHVA 1V49A 4BAXA 2CJOA 4RGOS 3ZVVA 1NYQA 2BTEA 1F52A 3W5UB 2BWES 4W9HA 3EC8A 3RZWC 1DOYA 4GSWA 1P9DU 2WXJA 3PVLA 5CHVC 3W9CB 3TEZA 4LNIA 1FPYA 2KYWA 1VZ8A 2KWDA 2Y5PA 5TR5A 3ZQ4A 3N1ZC 3EFUA 2ZEQA 1QOAA 4C56C 1N6ZA 2JYEA 3JVZX 4OZBA 3EA6A 3SR6A 3MHZA 3N1XC 1PYWD 2BPSA 1YOVB 3H9DA 1GJZA 2DZKA 1L4ZB 1XLOA 1MFWA 1JWSD 1XQQA 3TIXA 3R66C 2V0GA 3NZ3A 1E7UA 4LCDE 4WJPA 1YX5B 2DYMA 2KHWB 3M95A 2H88B 1X1MA 3Q69A 3I5JC 4IKGA 5LNK1 4RCOA 3DQVA 3RN9C 1WRDB 1A70A 4C00A 2N7DA 2CS4A 2BT6A 2GRIA 4TV3A 3MFGA 5AEKB 3ZTCA 3NOBA 2MCNB 3LXFA 4W9GA 3CMMB 4W9IA 2IGHA 3HHMA 4G0NB 4KKJA 4G3XB 3J9CA 3O65B 2FCQA 3MTNB 2LEKA 3E56A 1EO6A 2KX0A 1JWMD 4NJ7A 3VUXA 2KKCA 3KYDD 2PLPA 4BOZB 1HTQA 1I7HA 2JQRB 4EUTA 1WGKA 2KDMA 4I6PA 1QLBB 1TY0A 5EE1A 4NQLB 5AUIA 1RRBA 3WAOA 2IYDB 3W2DA 2WXPA 4HK2A 1Q5WB 3TUOA 2WXQA 2HTME 4LDTB 1KH0A 1UNSA 1V5TA 3DHHC 2J53A 4HEA1 3RULA 2KNBA 3B08A 3Q3OC 2WYQA 5HG2A 1KM7A 2HTHA 4EZJA 2QDFA 1XLPA 3AE9B 4HJKA 3JYUA 1KJTA 3BVZA 1EWYC 3RNFC 4NJCA 2ZPYA 2ASQA 2IO1B 3AEEB 5IOIA 1V9JA 3NVVA 2DBYA 3AU5A 2JRIB 1RFKA 1NBFC 1FMAD 5FK9C 3NVZA 2RDGA 3BVMA 3AE6B 4TQ0A 4ICUA 1TJEA 3H1UA 3R7RA 3AEFB 3QARA 1M4VA 1WXSA 4OZAA 2KMAA 3QA8A 1D5MC 2D3AA 4DBGA 4REZA 1E9MA 2WU2B 1XXGA 5JHBA 3C19A 3NVYA 2MW5A 2KK8A 4NJ6A 4US9A 4B6WA 3V60A 5C1ZA 2IY0B 3AE2B 1WMHA 2I1JA 1D3ZA 4AOFA 1QOGA 4KDIC 4HDQA 2AQ2B 2NS5A 2WLBA 1QQRA 4B95A 2KDFB 1JROA 4WURA 2BYVE 2AEHA 2MBOA 3V62A 2INDC 1TGZB 1R7SA 3DVNV 2O6VA 4RGMA 2JWUA 1UBQA 3P63A 1E8ZA 2G3QB 4ZHPA 4M00A 1V5OA 2RPVA 2E6XA 1J7AA 3M63B 3RNEC 4AP4C 4HROA 4GDLA 3LJ3A 1SB3C 4C4VB 1K51A 2I1KA 2KFKB 4GDKB 1D6EC 3TEWA 4MGYE 2QILA 1HXYD 4PS3A 1EF5A 3PPAA 4HJGE 2ZW1A 2WXFA 2KD0A 2PEAA 1DGJA 1QOBA 3APDA 3OG5A 2NMQA 2KFJA 2YEPB 4YL8A 2RD0A 3AECB 2WS3B 1SIJA 4DHJB 5EE9A 4YTPB 4L1BA 4M0WB 4MJSB 2QC8A 2QMTA 2FUG1 5C23A 2VH2A 1YJIA 2J4XA 1WSPA 1CZPA 3W1SC 4KGSA 4HCNB 2JY6A 2M17A 3EFCA 4LDTD 3H8HA 3DBRI 2KWUB 4FLHA 5D2MB 2L52A 1HE8A 1V8CA 1FXTB 5E6OA 1MG4A 3IAS1 3SHQA 2FCMA 1K52A 1Y8RC 1Z2MA 1BMLC 3VAWA 1FRDA 1CK1A 3EUB2 1FD6A 3K9OB 3ABVB 4H2AA 2XEWA 1LQBA 1TKGA 2L05A 1WGHA 3Q8BA 1OQYA 4PK1A 1C77A 3I3TB 4R3DA 4I6NB 4M01A 4NAMA 4BOSC 3N9YC 2Y3AA 4W9CA 2TSSA 1WJNA 1BT0A 2JZ3B 1FNVA 3ML9A 2JYTA 2NPTA 4JWSC 1N5XA 3VRBB 1I4QA 1EUVB 2AYOB 1ZDVA 4GU2A 1I4XA 2WXKA 1V2YA 3FKYA 2KQ4X 5IA7A 4ARIA 3ZJTA 4FADA 1NVID 4BKTA 1EU3A 2FIFA 1UF0A 3TL5A 2FNJB 3UF8A 2KVZA 3QC8B 3QX1A 3P4QB 2V3SA 3PZDA 2INCC 1EU4A 2GBKA 4DDGD 3ZDMC 1A5RA 3N30A 2K5PA 2KXJA 4HKQA 4LJOB 2G4SA 2KMCA 2X8XX 3DHGC 4PS7A 3URYA 1T0QC 1SE4A 3I9V1 3NUHB 1YNTE 5CHWA 4HVBA 1V1PB 2KTRB 3UINB 1SF0A 2J7QB 3VDZA 2N9LA 5TSSA 2KN5A 3PGEA 5C3JB 3S2AA 3B2FA 4EZKA 3KYCD 3PZ7A 5H8YE 2CR5A 3ALBA 3ZJUA 2PMVA 1E90A 4GLSC 1YIWA 3KWLA 1T0RC 4RGTA 3GS2A 3IG3A 3BWUD 3VUWA 3AU4A 3OJ4B 3QCAA 1VD2A 1V80A 2W3RA 1WFYA 4KSKC 3CWIA 1HZ6A 4RFBA 4EE2A 4DQOC 2DYBA 1WIAA 1HEZE 2M56B 3WCQA 3FILA 2EKIA 2DYOA 2O6VD 3SFEB 2KX3A 2K8CA 3Q2AC 3V6EB 4MELA 4KSLC 3OJ3A 4S0RA 2G9HD 4XX5A 4A9AA 4HKZE 1UWMA 5E6NA 4O1NA 3DWMA 4IWQA 3U7ZA 3RZFA 1VDVA 4US8A 4OHJA 3KVFB 2MJ3A 4XZ4A 3ZDTA 4WJOA 3ENEA 3DBLI 1EM7A 5G5HA 1YJ1A 3BYYB 2DNFA 3AE5B 1T0YA 2BKRB 2RGFA 2YEPF 5D94A 4OW0A 2UWQA 4G11A 2EKEC 3AH7A 2Y5CA 4RNAA 1MVKA 1TBEA 1WZ3A 3MC8A 2LWPA 4E71A 1Q1OA 2FE8A 2R61A 1E8WA 4K81A 4HWIB 3KUDB 2GBJA 3L54A 1UH6A 4QAYA 2ZZPB 3RNGC 4RM9A 1J7BA 2KOXA 4PS8A 2C9WB 4LNKA 3PZ8A 1L0YB 2BB6A 3DPDA 4L23A 1AARA 2KANA 1RAXA 3VFKA 4S17A 1YQBA 1V6EA 2LGDA 3ZRFA 4NY0A 1H8CA 2WX1A 2C7NB 2SAKA 2XK5B 1RFAA 1SBBB 2KMMA 2QCZA 1VCBA 1SIFA 3ETRA 3W1SA 4CYEA 2MA9B 2BB5A 2KVRA 5I4DA 4ASWC 3RPFC 3LDZE 4N9F4 2DAFA 1QZEA 5T8IA 2JXXA 1V1OA 2WXLA 2D3GA 1V86A 3CSTA 4BFRA 2W55A 3UIOB 4LNNA 4JIOU 2JWZA 4G50A 3PRPB 5BYRA 3ZIMA 1ZW7A 3Q3FA 4XWWA 2GBRA 2L0FA 1STEA 1YJJA 2N9EB 4B0MA 2ON8A 2Y5BB 1R4MI 2SEBD 1HQRD 1YD8U 1VJKA 2B3AA 2KDBA 4HPPA 2N1WA 1WJ4A 2QIEB 1AW7A 2WXHA 4M8NA 3WAPA 4ZDVA 1OTRB 1OQQA 3U2SC 4GOCA 3RNBC 1FXIA 2FAZA 1WE6A 2BF8B 4YSZB 4ANVA 1T5XD 1PGXA 1FNUA 4ICVA 1J8CA 1FFVA 2C5LC 1WX7A 4FJYA 3NHEB 2Z0DB 3HRDD 4OVZA 3T3NA 1XO3A 1GC7A 3JSVB 2L8JA 3NVWA 1WJ6A 2WXGA 4FHJA 4LNFA 3A9JB 3Q8FA 2PE6B 3RT3B 2W54A 4P7IA 4YXDB 4HDOA 1YN4A 5G5GA 4C7YA 2AWTA 4K3BA 3KUZA 5E6PA 2MBQA 3AE4B 3L17A 1TZOA 2BGFA 3NS8A 1UGJA 4XWTA 4JPSA 4E74A 1L5PA 4Q2JA 2WGSA 3EECA 3QIJA 3QAQA 3L0WB 2BQQA 2LVQA 5L95C 3KH0A 3TBLD 4IM0A 1NYRA 2BBCA 5JZEB 3N3KB 2KC2A 1FRRA 1IYFA 3MHSD 3LYYA 3L08A 1OFFA 3X0WA 4HCPB 2NTSA 1ZDXA 2BYEA 2RR9A 4KV2A 3ONSA 3QHTA 3PTFC 3P4PB 1MG8A 1R4MB 4CHKA 1SXTA 1WH3A 4I6LB 4DHZE 1UBIA 1WXQA 3FC4A 4J6IA 5GXGB 2MBEA 2IPKD 4C4VA 5J18A 3K9PB 2KFKA 1I4RA 4GDKA 3TEXA 3P42A 1WYWB 1E0ZA 3SFDB 2HJ1A 3IAM1 3ZO5B 1F0ZA 1WXVA 2A5UA 1L2NA 2LI5A 1I4HA 2QEJC 1IBXA 5JHAA 4WQOB 5JH5C 5EE0A 2HD5B 4N59A 3AXCA 4LJPB 2W9NA 5CHFA 1L6UA 1ZGUB 3OWEB 3ZJVA 1KLVA 4M0WA 2FBWB 4MJSA 4A20A 2K0PA 1E10A 2N9PC 3DCGA 2KAJA 4KGRA 1JQ4A 1L0XB 3L4PA 1F77A 2KJHB 4HXDA 2IBIB 1LM8B 1WY8A 3ZXRA 4XE0A 2XNAC 1KLGD 4MT5A 1UD7A 4WIPA 1N61A 5JXVA 3AEBB 2G1EA 2KJ6A 3AM9A 1DOXA 1HA5A 1GG3A 1TS4A 3DBHI 3IT6B 3VH3B 3RI7C 1WI0A 1UWXA 2JUOA 3NJTA 4WWOA 3IBEA 2DENB 1E7VA 5EE3A 1XT9B 4CQNA 3T8MA 3A4SC 3N1YC 3AN1A 4W9LA 1ZKHA 5DCNA 1XF5L 2LVPA 1K53A 4OVVA 2K25A 1IBXB 1SE3A 4KZ0A 4DHZB 1WXAA 3A9KB 2MEKA 5BYQA 1LFDA 3AEDB 1E8YA 2CJNA 2ZW0A 1DOIA 1P0RA 2WP9B 2JF5A 2W82A 1SJHD 1ZUD2 4F1SA 5FR3A 1YN3A 1SGHA 2QSDA 1XD3B 5KHQA 4FJZA 2CHZA 4XC2A 2L3ZA 3DDCB 2JPHA 1C3TA 4IUMB 2FIDA 2E3TA 4K7SA 3AE8B 2R2OA 4C80A 2ZJDA 2MSED 5H92C 1WGDA 1NI3A 3VTUA 1T3QA 4NAWB 3PREA 2L7RA 2LJ5A 2ZCBA 2WDTB 1P7EA 2RDBC 1CJEA 2IJ0A 1PQSA 3T3OA 4A90A 2V1YA 2JXTA 2HJ8A 1JCKB 3VHTC 3TMPB 1FCCC 1T6BX 5D6JB 2PPHA 1V1PA 1WRIA 2KTRA 4IWPA 4P1BC 1TIFA 3EGRA 1WE7A 4X57B 2KLCA 4JWUC 1RWSA 3GZNI 4N6EB 1JWUD 2N4FA 4LTUA 1QT9A 1SE2A 3BINA 4BKSA 1P98A 2Z0EB 1FIQA 5CTRC 3U4EG 2MH7A 1UELA 1WR1A 4FHKA 4WJNA 5IKCM 2PVGC 2ZVNA 2OHFA 4ZYSA 1K8RB 1Q0WB 1JW9D 2DLBA 1OQRA 2NBWB 3U8ZA 3ZNID 5C2TB 3DVNU 3AMZA 2J52A 3V6CB 3ECIA 1UZXB 2YLMA 4M8MA 3U52E 5LLIA 2N0SB 3SD5A 2C7MB 2IY1B 2LVOA 5AZHA 2RSUA 2I38A 4LK0M 3BK2A 2K6DB 4FJVB 4AQ7A 3CSFA 4D2KA 1MJDA 3B9JA 1WM2A 3Q14C 3H7PB 2EELA 1GNUA 4FN2A 3NS1A 2RPQA 4MACA 2DZIA 3NZSA 2AL3A 3MC9A 4RH6A 4WQMA 3PLUA 3SDLC 4XDCA 2JT4B 3KUCB 3DBRB 2WXIA 1V81A 2Z59B 3GOEA 3VH4B 2V3NA 3TSSA 5J17A 2N7JA 2BYTA 1ZOYB 5HHDG 2KJRA 1C4AA 1M94A 4IG7B 1OGWA 1VRAB 3FAHA 2YVCA 1B9RA 4ZRQA 1TZ1A 3IXSA 3ML8A 1N60A 1J19A 3OLMD 4DHJD 2JRHA 4KIKB 3SEBA 3MJ5A 1IGCA 1TKYA 2QJLA 3E9SA 4KKIA 3WANA 1ZXIA 2PE9A 4HLEA 3GZNB 3DVGX 1JWAD 4LNOA 2K6QA 2NVUI 2WDVB 1SJED 1ZP0B 1QF6A 3V61A 3APFA 1P1AA 2XK5A 2UYZB 2CHWA 3PLVA 4M02A 2N7EA 1LGRA 3AV8A 4LLGM 4TUUA 3WIMA 1C76A 3RYTA 1WX9A 4N58A 4GXBA 4IOIE 4EKUA 4OVUA 4WWPA 1G6JA 2MP2B 3P4RB 2L1AA 2I2YA 1J0GA 4DXGA 4W9JA 3VRAB 2KLGA 3AEGB 4FBJB 3ZW3A 4ANUA 4NNJB 3RNCC 3QQ8B 1KLUD 3GE8C 1TY2A 2JVCA 3NY5A 2BW2A 2KT7A 1GC6A 5HI1A 1CMXB 2Z8LA 3VVWB 3IFWB 1NDDA 2WWZA 3HVZA 2WU5B 2M1MA 4ZRJA 4BKGA 1N62A 2M8SA 3VR8B 4A3PA 5HFYA 2WQYB 2REXA 3UQBA 4A55A 4JE3B 4JL9A 3TCAA 1VZ6A 2M4NA 2D5GA 1TS5A 2ZNVB 1HZ5A 3PRZA 2EMSA 2MHJA 3L10B 5D3IB 3DWGC 4F7ZA 4YTMB 4KX6B 2LGIA 3B2GA 4WAFA 5AUKA 3QJZA 2FCSA 2JX5A 2NBVB 1C78A 3DOWA 2QHOA 3JSVA 4HPMB 3L13A 1S1QB 4W9EA 2JZZA 2PW9A 3A9JA 3X23A 3ZNGC 1FNWA 1KF6B 1YN5A 4II3B 1D5XC 4PT5A 1WZ0A 4BKSD 2FCNA 3ZGZA 3PHXB 1F2RI 2BS4B 4HPLB 2LFIA 3AE7B 4NPNA 2KDIA 1U4AA 1AYFA 2WX0A 2V4IB 1F9JA 5IP4D 5IN7A 1YQ3B 1MPEA 1ZPSA 4NQKE 3ZUNA 1WYGA 1KFYB 2KWCA 2ZCCA 4PYUA 1FO4A 2GOWA 4MM3B 1Y56A 5D7GA 3DBLB 3Q3MC 4KDLB 4W9FA 1NEKB 1YMHE 3BZDB 1TS2A 2CU3A 3A4RA 2V3PA 2WNMA 1B1ZA 2NR2A 4ZYNA 5HKHA 4E3CA 2N9XA 3Q3NC 3W5VB 5LXHA 2RMMA 3ZRCA 2LGYA 1JMLA 5BMHA 2WXNA 4GB9A 3C8YA 1ISNA 4ARCA 2VRRB 4TQ1A 3A1QA 2B76B 4BZAA 2WHIA 1GPXA 1ZE3D 4BBNC 2D10A 4ANWA 4KZCA 5D3DA 3BY4B 1WM3A 2JSVX 2AL6A 2LRWA 4WJQA 4RMAA 1BXTA 4BBNF 2K8BA 3JW0X 3HM3A 4C7ZA 2LHDA 5DPSA 3VUYA 4GIVA 3SU8X 2J0KA 2BS2B 1PGAA 1PUTA 2O2VA 4BVUC 2L83A 2GMIC 2DX5B 3ZTDA 4IC7B 3C0RB 3NRZA 4OZCA 5E6JA 2WDRB 2PKOA 4YSXB 1UGMA 4IM2A 5BO4B 4AUQC 1MI0A 2L00B 3CF6E 3DHIC 5FKAC 3V3XA 4AS1A 1N63A 2IZVB 2INNE 4DWFA 3R8BA 4CO7A 1ET6A 1VZ7A 2GI9A 2IO3B 4K7WA 4WH4A 4IM3A 2LD9A 1FEHA 3QK0A 3BK1A 2WXOA 2DAJA 1K50A 3WAMA 1FFUA 3A1QB 1EF1A 4RGNA 3N32A 4WWMA 4WAAA 4ZHOA 2LZ6A 5LXIB 1E5WA 2MQJA 2NBUA 1S3SG 2OJWA 4ZRIA 4ZOHC 3HM6X 5AZGA 2OOBB 4HRSA 2OEDA 4L2YA 4MH0E 2NCNA 2A4ZA 2V9HA 1WGRA 1XCTL 4A8XC 4FULA 2O2VB 2K9XA 4ZRKA 5BMGA 4JLCA 3A9KA 1C79A 2KQ7A 1QILA 3AI5A 1TS3A 2K1FA 3DBSA 3Q8AA 1HTOA 1P7FA 1F1HA 2KTFA 3PSEB 1JALA 2ZNVC 1NI2A 1ET9A 4EOYA 1C4PA 3PT2B 1EWCA 2LRUA 3U7DA 3M3JA 2K22A 3IHPC 4P16A 4NZLB 1E6EB 1LO5D 2D3CA 3VXWA 1C9FA 3AE1B 5CX3A 2BS3B 2KN4A 4RF1A 1RYJA 1J7CA 3WA0A 3VR9B 3VTWA 4NAWA 3HUIA 1XLQA 1WJUA 3AE3B 3GP7A 4J3OD 4GMVA 3AB5A 3UIPB 4ACFA 2LXAA 2KACA 2KQSA 4F8CB 2ICIA 3RFZB 4AWJA 3VQIA 4DDID 4RF0A 3D32A 1AN8A 1PFDA 2BVCA 4USAA 3ZLZA 2M0XA 2FUHB 3UI3A 3RUIB 4JX1C 2Q5WD 1MHHE 1NENB 1P3QU 3RMKC 2PJHA 1GB1A 2D2QA 2MBBB 4YSYB 5DPWA 4JGHB 2R2QA 3ZNHB 2LMCA 3Q6BA 3GB1A 5AZFA 1E7PB 2D3BA 4MSMB 2CHXA 2LASA 1L7YA 4YWGG 3UQAA 1KRHA 1ENFA 2BKFA
chains in the Genus database with same CATH topology
2N7JA 2M0AA 1IUEA 1ZOYB 2J53A 3V05A 2BYTA 4HEA1 5HHDG 3RPFC 1D4BA 1GB4A 1C4AA 5T8IA 3KWVA 1GOZA 1V1OA 2LHEA 1UUPA 1SSNA 1GAQB 5HG2A 1VRAB 2M19A 2WXLA 3FAHA 1B9RA 4ZRQA 3IXSA 4FXCA 4XDDA 3AEAB 2N9KA 1N60A 2W55A 1XLPA 3AE9B 1RM6C 3BVZA 3SEBA 1EWYC 3MJ5A 1IGCA 1TKYA 3MP9A 2QJLA 4NJCA 5BYRA 3E9SA 4KKIA 2VZKB 1ZXIA 3AEEB 1VR9A 3NVVA 5BMIA 4XWWA 2DBYA 2AQ3B 1STEA 1RFKA 1YJJA 1JWAD 1FMAD 2MJDA 3NVZA 2ON8A 2RDGA 5FK9C 3BVMA 4B0MA 3AE6B 4TQ0A 1ROEA 2WDVB 1SJED 1TJEA 2ONQA 1ZP0B 4P6VF 1QF6A 3AEFB 2SEBD 1HQRD 1M4VA 4GDLB 4YT0B 4OZAA 1D5MC 1VJKA 4REZA 1E9MA 2WU2B 3IT4B 1XXGA 3NVYA 1C4CA 2QIEB 4MH8A 1AW7A 1QKZA 2WXHA 2J42A 4US9A 1D5ZC 1JWBD 1OQQA 3AV8A 4LLGM 1C76A 3U2SC 3AE2B 2IGDA 1FXIA 1IGDA 3PO0A 2LJIA 4N58A 4YSZB 4IOIE 1T5XD 1PGXA 1FNUA 1FFVA 1QOGA 2AQ2B 2NTTA 1VLBA 2WLBA 3P4RB 3P4SB 2L1AA 3HRDD 1QQRA 2I2YA 1F2RC 1JROA 4OVZA 4DXGA 1TYGB 3R2IA 4WURA 2IGGA 3VRAB 3T3NA 1XO3A 3AEGB 2HDEA 3NVWA 1KTKA 1KLUD 5MPOA 2W3SA 1TY2A 1R7SA 2BW2A 2WXGA 4RGMA 5HI1A 3Q8FA 2JWUA 2Z8LA 2W54A 4YXDB 3P63A 3HVZA 1YN4A 2WU5B 5G5GA 3O13A 4ZHPA 1SEBD 2RPVA 2E6XA 1J7AA 2XN9C 1FXAA 1N62A 3VR8B 4C7YA 5HFYA 2MJEA 4HROA 2WQYB 3ZYYX 1SB3C 2PVOD 4A55A 3AE4B 4JE3B 2INPE 1TZOA 1K51A 4GDKB 1D6EC 1UGJA 1VZ6A 3TEWA 1TKEA 1Q10A 4XWTA 2JZPA 2D5GA 2QILA 1TS5A 1L6VA 1HXYD 4JPSA 1HZ5A 1L4DB 4HJGE 2PIAA 1L5PA 5D3IB 3DWGC 4Q2JA 4YTMB 4KX6B 2LGIA 2ZW1A 3B2GA 4WAFA 2WXFA 5AUKA 1DGJA 2JX5A 3TEYA 1QOFA 1QOBA 1N5WA 1C78A 1NYRA 2NMQA 2YEPB 2BBCA 1XLNA 3AECB 1CQVA 1FRRA 2WS3B 1SIJA 5EE9A 3LYYA 2AX5A 1OFFA 1AWDA 3R2TA 4L1BA 4YTPB 2GB1A 2NTSA 1ACCA 2QMTA 2FUG1 1ZDXA 1YJIA 2J4XA 1WSPA 1CZPA 2AQ1B 3P4PB 2PW9A 1PDXA 4KGSA 4UDUC 4B0EA 1FNWA 1ESFA 1KF6B 1YN5A 1D5XC 3MC0B 3H8HA 4PT5A 1SXTA 2DWQA 3Q8CA 3HVDA 5BYSA 3ZGZA 1F2RI 1WXQA 2BS4B 3FC4A 2LFIA 3AE7B 5GXGB 2IPKD 1AYFA 1V8CA 2L52A 2V4IB 4ZRPA 1I4RA 3CIRB 3KQ4A 3TEXA 3P42A 1YQ3B 1MPEA 1ZPSA 3IAS1 4ITKA 1E0ZA 3SFDB 1BUIC 3IAM1 1K52A 2H89B 1WYGA 1KFYB 1BMLC 1FO4A 1F0ZA 1FRDA 1CK1A 3EUB2 4MM3B 1FD6A 1Y56A 5D7GA 3ABVB 1I4HA 1MHXA 2QEJC 1IBXA 4H2AA 1WWTA 3BYTB 5EE0A 1TKGA 2VZKD 1NEKB 1YMHE 3BZDB 1TS2A 4YTNB 2CU3A 4N59A 3Q8BA 2V3PA 2WNMA 1B1ZA 1L6UA 3OWEB 1C77A 3ZJVA 4R3DA 4TMAB 4M0WA 2FBWB 3W5VB 2RMMA 2K0PA 4NAMA 1E10A 1JMLA 3N9YC 2WXNA 2Y3AA 5BMHA 2TSSA 3C8YA 2KAJA 3Q8EA 4KGRA 4ARCA 1JQ4A 1L0XB 3L4PA 4IDIA 1FNVA 1F77A 4TQ1A 2JYTA 3BVGA 4JWSC 1YQ4B 2B76B 1N5XA 4XE0A 3BIID 3VRBB 1I4QA 1KLGD 2XNAC 4MT5A 1GPXA 1ZE3D 4TSSA 4WIPA 1N61A 4KGTA 5JXVA 3AEBB 1PGBA 2PTLA 5D3DA 1ZDVA 2G1EA 2JSVX 1XEEA 3AM9A 1I4XA 2WXKA 2WDQB 1BXTA 1FCLA 2KQ4X 1DOXA 1HA5A 4C7ZA 4ARIA 3ZJTA 1TS4A 3IT6B 3LB8C 1I4GA 1NVID 2LHDA 1UWXA 1EU3A 1L0VB 2X38A 5EE3A 2BS2B 1PGAA 1PUTA 2ACZB 4CQNA 3P4QB 4A6QA 2L83A 1XCQL 1V97A 2LUMA 3NRZA 3AN1A 4OZCA 5E6JA 2WXMA 2WDRB 1EU4A 1XF5L 2L32A 2PKOA 1K53A 4YSXB 3P1MA 1IBXB 1SE3A 2K5PA 1MI0A 4HKQA 2MEKA 3URYA 3I57A 1SE4A 3I9V1 2IDYA 1YNTE 3NUHB 5BYQA 1V1PB 3FILB 1SF0A 3AEDB 2CJNA 2ZW0A 5FKAC 1DYQA 3V3XA 1DOIA 4AS1A 1N63A 2WP9B 2INNE 2W82A 1SJHD 1ZUD2 2K3UA 2N9LA 3R8BA 1ET6A 1VZ7A 2GI9A 1JRPA 1FM0D 4WH4A 5TSSA 5FR3A 1FEHA 2JU6X 2RDHA 1YN3A 4DXFA 2QSDA 3BK1A 2WXOA 5C3JB 1K50A 1FFUA 3B2FA 4RGNA 1I4PA 3KLSX 4WWMA 1ZXHA 3PZ7A 4ZHOA 2WXRA 5H8YE 2E3TA 3ZJUA 3AE8B 2PMVA 2CJOA 4C80A 4RGOS 4GLSC 1NYQA 5H92C 2BTEA 1NI3A 1T3QA 3W5UB 4NAWB 3KWLA 4ZOHC 4RGTA 1DOYA 4HRSA 1P7EA 2OEDA 4L2YA 3GS2A 1CJEA 3BWUD 2WXJA 2IJ0A 1XCTL 3W9CB 3TEZA 4A8XC 3T3OA 4A90A 1VZ8A 2JXTA 2W3RA 2K9XA 5BMGA 2KWDA 3CWIA 1HZ6A 1C79A 1JCKB 2Y5PA 1QILA 4RFBA 4EE2A 4DQOC 3ZQ4A 1FCCC 1T6BX 1QOAA 1TS3A 4C56C 1HEZE 1V1PA 1WRIA 2M56B 2JYEA 2EKIA 3FILA 3WCQA 2DYOA 3EGRA 3Q8AA 4OZBA 3EA6A 3SR6A 3SFEB 3MHZA 1P7FA 1PYWD 4JWUC 1RWSA 2G9HD 1JALA 4N6EB 1ET9A 4A9AA 1L4ZB 4HKZE 1C4PA 1JWUD 1EWCA 1UWMA 1XLOA 4LTUA 1QT9A 4O1NA 1SE2A 3DWMA 1JWSD 2K22A 3U7ZA 2V0GA 1FIQA 4P16A 3U4EG 2MH7A 3NZ3A 4NZLB 1E6EB 1LO5D 2PVGC 1VDVA 2OHFA 4US8A 1C9FA 3AE1B 4OHJA 2BS3B 2MJ3A 2KN4A 2DYMA 4RF1A 4ZYSA 1RYJA 1J7CA 1EM7A 5G5HA 2H88B 1JW9D 3BYYB 3AE5B 3Q69A 2DLBA 1OQRA 2YEPF 3VR9B 5C2TB 4OW0A 3HUIA 3AMZA 2J52A 4IKGA 5LNK1 1XLQA 4RCOA 1A70A 3AE3B 2Y5CA 3AH7A 4RNAA 3GP7A 1MVKA 4J3OD 2BT6A 2GRIA 3U52E 3MFGA 3AB5A 2N0SB 3LXFA 2KACA 2IGHA 4KKJA 2I38A 2FE8A 4LK0M 2ICIA 2R61A 3BK2A 3J9CA 3RFZB 4AQ7A 2LEKA 3VQIA 3E56A 4D2KA 1JWMD 1J7BA 4RF0A 1AN8A 3B9JA 1PFDA 4USAA 3PZ8A 1L0YB 2EELA 3UI3A 2BB6A 2PLPA 4L23A 1I7HA 2JQRB 4JX1C 3NS1A 2Q5WD 1MHHE 1NENB 1WGKA 4MACA 2KDMA 1GB1A 4YSYB 1QLBB 1TY0A 5EE1A 5AUIA 2LMCA 4RH6A 2SAKA 4WQMA 3GB1A 1E7PB 2KMMA 1SBBB 4XDCA 3W2DA 2WXPA 4YWGG 3ETRA 3W1SA 2WXIA 3TUOA 2WXQA 2HTME 2BB5A 1KH0A 5I4DA 1KRHA 1UNSA 1ENFA 2V3NA 3TSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQ4 A;  2WQY B;  1IUE A;  1ZOY B;  2W3R A;  2K9X A;  3L4P A;  4IDI A;  3RPF C;  1SB3 C;  2PVO D;  3ZYY X;  3CWI A;  3AE4 B;  4JWS C;  1YQ4 B;  2B76 B;  1N5X A;  1GAQ B;  3BII D;  1QOA A;  3VRB B;  2M19 A;  3FAH A;  1GPX A;  1TKE A;  1WRI A;  2M56 B;  3WCQ A;  2EKI A;  1B9R A;  1N61 A;  1L6V A;  3AEB B;  4FXC A;  3AEA B;  1N60 A;  3SR6 A;  2G1E A;  3SFE B;  4HRO A;  2W55 A;  2PIA A;  1XLP A;  3AM9 A;  3AE9 B;  1L5P A;  1RM6 C;  4JWU C;  3DWG C;  1RWS A;  2WDQ B;  1EWY C;  4YTM B;  1DOX A;  1TKY A;  4KX6 B;  3B2G A;  1JAL A;  4N6E B;  4C7Z A;  2QJL A;  4A9A A;  5AUK A;  3LB8 C;  1DGJ A;  1UWM A;  1XLO A;  1NVI D;  1QOF A;  2JX5 A;  1QT9 A;  1ZXI A;  3AEE B;  4LTU A;  3NVV A;  1QOB A;  1N5W A;  3DWM A;  1L0V B;  1NYR A;  2K22 A;  5EE3 A;  2DBY A;  1XLN A;  1FIQ A;  2BS2 B;  3AEC B;  1PUT A;  1FRR A;  2ACZ B;  2MH7 A;  1SIJ A;  2WS3 B;  1RFK A;  1YJJ A;  1JWA D;  5EE9 A;  1E6E B;  2PVG C;  3P4Q B;  1VDV A;  1FMA D;  2OHF A;  4US8 A;  2L83 A;  2MJD A;  3NVZ A;  3AE1 B;  2AX5 A;  1V97 A;  1OFF A;  1AWD A;  2BS3 B;  2MJ3 A;  3AE6 B;  1ROE A;  2WDV B;  4YTP B;  3NRZ A;  1RYJ A;  3AN1 A;  1J7C A;  1TJE A;  5G5H A;  1ZP0 B;  2H88 B;  1JW9 D;  4P6V F;  1QF6 A;  1YJI A;  2WDR B;  3AEF B;  1CZP A;  3AE5 B;  1OQR A;  4YT0 B;  2PKO A;  3VR9 B;  4YSX B;  3P4P B;  5C2T B;  1PDX A;  3HUI A;  3P1M A;  3AMZ A;  1VJK A;  1XLQ A;  2K5P A;  1E9M A;  2WU2 B;  1KF6 B;  1A70 A;  3NVY A;  3AE3 B;  2Y5C A;  3AH7 A;  2MJE A;  2QIE B;  2BT6 A;  3AB5 A;  2N0S B;  2DWQ A;  1SF0 A;  3AED B;  3LXF A;  4US9 A;  1WXQ A;  2CJN A;  1JWB D;  2BS4 B;  3FC4 A;  1OQQ A;  3AV8 A;  1DOI A;  1N63 A;  2WP9 B;  3AE7 B;  5GXG B;  3AE2 B;  1AYF A;  1FXI A;  1V8C A;  1ZUD 2;  2L52 A;  3PO0 A;  3CIR B;  1JRP A;  4N58 A;  4YSZ B;  1FM0 D;  2LEK A;  1YQ3 B;  4ITK A;  1J7B A;  3SFD B;  1E0Z A;  1FFV A;  1QOG A;  2H89 B;  3B9J A;  1PFD A;  1WYG A;  1KFY B;  5C3J B;  4USA A;  1FO4 A;  1F0Z A;  1FRD A;  1VLB A;  2WLB A;  3P4R B;  3P4S B;  1FFU A;  3EUB 2;  3HRD D;  3B2F A;  1I7H A;  1JRO A;  3ABV B;  2JQR B;  4JX1 C;  1TYG B;  3NS1 A;  2Q5W D;  1NEN B;  1WGK A;  4WWM A;  1WWT A;  3VRA B;  1XO3 A;  3AEG B;  5H8Y E;  2E3T A;  4ZHO A;  5EE0 A;  4YSY B;  1TKG A;  1NEK B;  3AE8 B;  2CJO A;  1QLB B;  3NVW A;  4C80 A;  4YTN B;  2CU3 A;  4N59 A;  5MPO A;  1NYQ A;  5H92 C;  2W3S A;  5EE1 A;  1NI3 A;  1R7S A;  1T3Q A;  5AUI A;  3W5U B;  3KWL A;  4ZOH C;  4WQM A;  1L6U A;  1E7P B;  2KMM A;  2W54 A;  4YXD B;  1DOY A;  4HRS A;  3P63 A;  3ETR A;  3HVZ A;  2FBW B;  3W5V B;  2WU5 B;  1CJE A;  2HTM E;  5G5G A;  4ZHP A;  1E10 A;  1KRH A;  1J7A A;  1FXA A;  1N62 A;  3W9C B;  3VR8 B;  4C7Y A;  2KAJ A; 
#chains in the Genus database with same CATH topology
 2M0A A;  1IUE A;  1D4B A;  3V05 A;  1GUA B;  3N20 C;  1GB4 A;  1WMH B;  3A33 B;  3KWV A;  1GOZ A;  3RCZ A;  2LHE A;  1UUP A;  1SSN A;  1GAQ B;  2M19 A;  5EDS A;  3Q3J A;  4FXC A;  4XDD A;  2G45 B;  2N9K A;  3AEA B;  1TT5 B;  3ZNZ B;  5FR6 A;  1RM6 C;  2MBH A;  2MRP A;  3I63 C;  2J0M A;  3MP9 A;  2K8H A;  2VZK B;  1VR9 A;  5BMI A;  2AQ3 B;  3H7P A;  3GE3 C;  1SE9 A;  2O6V B;  5DPT A;  1LXD A;  3H7S A;  2MJD A;  1ROE A;  3B0A A;  2KO3 A;  1TTN A;  2ONQ A;  2D07 B;  4P6V F;  2C60 A;  4XYC A;  4GDL B;  4YT0 B;  3IT4 B;  1C4C A;  3M62 B;  2OJR A;  2DZJ A;  4MH8 A;  1QKZ A;  2J42 A;  3PRM B;  2ZPN A;  3HIZ A;  1D5Z C;  4EFO A;  1JWB D;  4AJY B;  3DBH B;  2IGD A;  4MGZ E;  1IGD A;  2GLS A;  3PO0 A;  4W9D A;  2LJI A;  3QWZ B;  3WAL A;  2UU7 A;  2L76 A;  2NTT A;  4JQW C;  2DZM A;  1VLB A;  4KIK A;  3P4S B;  1F2R C;  1TYG B;  3R2I A;  2IGG A;  3PV1 A;  3B1L X;  2HDE A;  1KTK A;  2EMT A;  5MPO A;  2W3S A;  3OAW A;  1R4N I;  2V4L A;  3HK0 A;  3DVG Y;  4EZL A;  3O13 A;  1SEB D;  1RLF A;  2XN9 C;  1FXA A;  4WWN A;  2MJE A;  3AUL A;  3ZYY X;  4AJW A;  3PS6 A;  1Z5S B;  2PVO D;  2INP E;  4B9K A;  3NG0 A;  2MX2 A;  1TKE A;  1Q10 A;  2JZP A;  1L6V A;  2MLB A;  3UGB B;  1L4D B;  1WGG A;  2PIA A;  5IO9 A;  4W9K A;  3P2B A;  1OEY A;  3T9L A;  3TEY A;  1QOF A;  1N5W A;  4GN1 A;  1XLN A;  2MP2 A;  1CQV A;  1WXM A;  2IO2 B;  2KWV B;  1KOT A;  2AX5 A;  1AWD A;  1H4R A;  3R2T A;  2GB1 A;  3H6N A;  5KHO A;  4FA6 A;  1ACC A;  1OEY J;  1IP9 A;  1T0S C;  1I42 A;  3PHW B;  3U30 A;  4MEM A;  2AQ1 B;  1PDX A;  3L16 A;  1WX8 A;  1IPG A;  2KC1 A;  2NPT B;  4MGI E;  4UDU C;  4B0E A;  1ESF A;  1WGY A;  3MC0 B;  2DWQ A;  3Q8C A;  3RNA C;  3HVD A;  5BYS A;  2BWF A;  3ZKJ C;  2BYF A;  2L0T A;  4P1C C;  3R3M A;  4ZRP A;  3CIR B;  3KQ4 A;  2VH1 A;  3RD2 A;  2KDE B;  1YX6 B;  4ITK A;  1BUI C;  2H89 B;  2IO0 B;  2K39 A;  5IAA C;  1MHX A;  1WWT A;  3BYT B;  2VZK D;  4ANX A;  3TJP A;  4YTN B;  4EEW A;  2N1V A;  1JRU A;  4DK5 A;  4TMA B;  3KW5 B;  5G55 A;  2C7H A;  1R4N B;  2G4D B;  4II2 B;  3Q8E A;  2MWS B;  4IDI A;  4PYZ A;  3BVG A;  3W1Y A;  1YQ4 B;  4GGQ A;  5L83 A;  3BII D;  5G2N A;  4TSS A;  3VTV A;  4KGT A;  1PGB A;  2PTL A;  4MSQ B;  5GMV A;  2LXC A;  1I35 A;  1XEE A;  4K3C A;  2XBB C;  2WDQ B;  1FCL A;  4K7U A;  3NZU A;  4TKN A;  3LB8 C;  1I4G A;  4MDK E;  2KZR A;  1L0V B;  2LGS A;  2LGX A;  2X38 A;  2GBM A;  4KVG B;  2ACZ B;  4MM3 A;  2D11 A;  4A6Q A;  2CU1 A;  2ZVO A;  1XCQ L;  1V97 A;  2LUM A;  5DPR A;  4A3O A;  2GBN A;  2WXM A;  4XGA B;  2L32 A;  4DXA B;  4MGK E;  2J0J A;  2DHZ A;  3P1M A;  3ZXV A;  3R7Q A;  3I57 A;  5J2R A;  2IDY A;  2HE7 A;  3FIL B;  4URK A;  1E8X A;  1WF9 A;  1DYQ A;  2LUE A;  1C1Y B;  3APC A;  2K3U A;  1JRP A;  1FM0 D;  2RDH A;  2JU6 X;  4IWO A;  4DXF A;  4RM8 A;  2CKH B;  4IW0 A;  1WR6 E;  3IVF A;  4K1R B;  3MJW A;  1I4P A;  3KLS X;  1ZXH A;  2WXR A;  3EHV A;  1V49 A;  4BAX A;  2CJO A;  4RGO S;  3ZVV A;  1NYQ A;  2BTE A;  1F52 A;  3W5U B;  2BWE S;  4W9H A;  3EC8 A;  3RZW C;  1DOY A;  4GSW A;  1P9D U;  2WXJ A;  3PVL A;  5CHV C;  3W9C B;  3TEZ A;  4LNI A;  1FPY A;  2KYW A;  1VZ8 A;  2KWD A;  2Y5P A;  5TR5 A;  3ZQ4 A;  3N1Z C;  3EFU A;  2ZEQ A;  1QOA A;  4C56 C;  1N6Z A;  2JYE A;  3JVZ X;  4OZB A;  3EA6 A;  3SR6 A;  3MHZ A;  3N1X C;  1PYW D;  2BPS A;  1YOV B;  3H9D A;  1GJZ A;  2DZK A;  1L4Z B;  1XLO A;  1MFW A;  1JWS D;  1XQQ A;  3TIX A;  3R66 C;  2V0G A;  3NZ3 A;  1E7U A;  4LCD E;  4WJP A;  1YX5 B;  2DYM A;  2KHW B;  3M95 A;  2H88 B;  1X1M A;  3Q69 A;  3I5J C;  4IKG A;  5LNK 1;  4RCO A;  3DQV A;  3RN9 C;  1WRD B;  1A70 A;  4C00 A;  2N7D A;  2CS4 A;  2BT6 A;  2GRI A;  4TV3 A;  3MFG A;  5AEK B;  3ZTC A;  3NOB A;  2MCN B;  3LXF A;  4W9G A;  3CMM B;  4W9I A;  2IGH A;  3HHM A;  4G0N B;  4KKJ A;  4G3X B;  3J9C A;  3O65 B;  2FCQ A;  3MTN B;  2LEK A;  3E56 A;  1EO6 A;  2KX0 A;  1JWM D;  4NJ7 A;  3VUX A;  2KKC A;  3KYD D;  2PLP A;  4BOZ B;  1HTQ A;  1I7H A;  2JQR B;  4EUT A;  1WGK A;  2KDM A;  4I6P A;  1QLB B;  1TY0 A;  5EE1 A;  4NQL B;  5AUI A;  1RRB A;  3WAO A;  2IYD B;  3W2D A;  2WXP A;  4HK2 A;  1Q5W B;  3TUO A;  2WXQ A;  2HTM E;  4LDT B;  1KH0 A;  1UNS A;  1V5T A;  3DHH C;  2J53 A;  4HEA 1;  3RUL A;  2KNB A;  3B08 A;  3Q3O C;  2WYQ A;  5HG2 A;  1KM7 A;  2HTH A;  4EZJ A;  2QDF A;  1XLP A;  3AE9 B;  4HJK A;  3JYU A;  1KJT A;  3BVZ A;  1EWY C;  3RNF C;  4NJC A;  2ZPY A;  2ASQ A;  2IO1 B;  3AEE B;  5IOI A;  1V9J A;  3NVV A;  2DBY A;  3AU5 A;  2JRI B;  1RFK A;  1NBF C;  1FMA D;  5FK9 C;  3NVZ A;  2RDG A;  3BVM A;  3AE6 B;  4TQ0 A;  4ICU A;  1TJE A;  3H1U A;  3R7R A;  3AEF B;  3QAR A;  1M4V A;  1WXS A;  4OZA A;  2KMA A;  3QA8 A;  1D5M C;  2D3A A;  4DBG A;  4REZ A;  1E9M A;  2WU2 B;  1XXG A;  5JHB A;  3C19 A;  3NVY A;  2MW5 A;  2KK8 A;  4NJ6 A;  4US9 A;  4B6W A;  3V60 A;  5C1Z A;  2IY0 B;  3AE2 B;  1WMH A;  2I1J A;  1D3Z A;  4AOF A;  1QOG A;  4KDI C;  4HDQ A;  2AQ2 B;  2NS5 A;  2WLB A;  1QQR A;  4B95 A;  2KDF B;  1JRO A;  4WUR A;  2BYV E;  2AEH A;  2MBO A;  3V62 A;  2IND C;  1TGZ B;  1R7S A;  3DVN V;  2O6V A;  4RGM A;  2JWU A;  1UBQ A;  3P63 A;  1E8Z A;  2G3Q B;  4ZHP A;  4M00 A;  1V5O A;  2RPV A;  2E6X A;  1J7A A;  3M63 B;  3RNE C;  4AP4 C;  4HRO A;  4GDL A;  3LJ3 A;  1SB3 C;  4C4V B;  1K51 A;  2I1K A;  2KFK B;  4GDK B;  1D6E C;  3TEW A;  4MGY E;  2QIL A;  1HXY D;  4PS3 A;  1EF5 A;  3PPA A;  4HJG E;  2ZW1 A;  2WXF A;  2KD0 A;  2PEA A;  1DGJ A;  1QOB A;  3APD A;  3OG5 A;  2NMQ A;  2KFJ A;  2YEP B;  4YL8 A;  2RD0 A;  3AEC B;  2WS3 B;  1SIJ A;  4DHJ B;  5EE9 A;  4YTP B;  4L1B A;  4M0W B;  4MJS B;  2QC8 A;  2QMT A;  2FUG 1;  5C23 A;  2VH2 A;  1YJI A;  2J4X A;  1WSP A;  1CZP A;  3W1S C;  4KGS A;  4HCN B;  2JY6 A;  2M17 A;  3EFC A;  4LDT D;  3H8H A;  3DBR I;  2KWU B;  4FLH A;  5D2M B;  2L52 A;  1HE8 A;  1V8C A;  1FXT B;  5E6O A;  1MG4 A;  3IAS 1;  3SHQ A;  2FCM A;  1K52 A;  1Y8R C;  1Z2M A;  1BML C;  3VAW A;  1FRD A;  1CK1 A;  3EUB 2;  1FD6 A;  3K9O B;  3ABV B;  4H2A A;  2XEW A;  1LQB A;  1TKG A;  2L05 A;  1WGH A;  3Q8B A;  1OQY A;  4PK1 A;  1C77 A;  3I3T B;  4R3D A;  4I6N B;  4M01 A;  4NAM A;  4BOS C;  3N9Y C;  2Y3A A;  4W9C A;  2TSS A;  1WJN A;  1BT0 A;  2JZ3 B;  1FNV A;  3ML9 A;  2JYT A;  2NPT A;  4JWS C;  1N5X A;  3VRB B;  1I4Q A;  1EUV B;  2AYO B;  1ZDV A;  4GU2 A;  1I4X A;  2WXK A;  1V2Y A;  3FKY A;  2KQ4 X;  5IA7 A;  4ARI A;  3ZJT A;  4FAD A;  1NVI D;  4BKT A;  1EU3 A;  2FIF A;  1UF0 A;  3TL5 A;  2FNJ B;  3UF8 A;  2KVZ A;  3QC8 B;  3QX1 A;  3P4Q B;  2V3S A;  3PZD A;  2INC C;  1EU4 A;  2GBK A;  4DDG D;  3ZDM C;  1A5R A;  3N30 A;  2K5P A;  2KXJ A;  4HKQ A;  4LJO B;  2G4S A;  2KMC A;  2X8X X;  3DHG C;  4PS7 A;  3URY A;  1T0Q C;  1SE4 A;  3I9V 1;  3NUH B;  1YNT E;  5CHW A;  4HVB A;  1V1P B;  2KTR B;  3UIN B;  1SF0 A;  2J7Q B;  3VDZ A;  2N9L A;  5TSS A;  2KN5 A;  3PGE A;  5C3J B;  3S2A A;  3B2F A;  4EZK A;  3KYC D;  3PZ7 A;  5H8Y E;  2CR5 A;  3ALB A;  3ZJU A;  2PMV A;  1E90 A;  4GLS C;  1YIW A;  3KWL A;  1T0R C;  4RGT A;  3GS2 A;  3IG3 A;  3BWU D;  3VUW A;  3AU4 A;  3OJ4 B;  3QCA A;  1VD2 A;  1V80 A;  2W3R A;  1WFY A;  4KSK C;  3CWI A;  1HZ6 A;  4RFB A;  4EE2 A;  4DQO C;  2DYB A;  1WIA A;  1HEZ E;  2M56 B;  3WCQ A;  3FIL A;  2EKI A;  2DYO A;  2O6V D;  3SFE B;  2KX3 A;  2K8C A;  3Q2A C;  3V6E B;  4MEL A;  4KSL C;  3OJ3 A;  4S0R A;  2G9H D;  4XX5 A;  4A9A A;  4HKZ E;  1UWM A;  5E6N A;  4O1N A;  3DWM A;  4IWQ A;  3U7Z A;  3RZF A;  1VDV A;  4US8 A;  4OHJ A;  3KVF B;  2MJ3 A;  4XZ4 A;  3ZDT A;  4WJO A;  3ENE A;  3DBL I;  1EM7 A;  5G5H A;  1YJ1 A;  3BYY B;  2DNF A;  3AE5 B;  1T0Y A;  2BKR B;  2RGF A;  2YEP F;  5D94 A;  4OW0 A;  2UWQ A;  4G11 A;  2EKE C;  3AH7 A;  2Y5C A;  4RNA A;  1MVK A;  1TBE A;  1WZ3 A;  3MC8 A;  2LWP A;  4E71 A;  1Q1O A;  2FE8 A;  2R61 A;  1E8W A;  4K81 A;  4HWI B;  3KUD B;  2GBJ A;  3L54 A;  1UH6 A;  4QAY A;  2ZZP B;  3RNG C;  4RM9 A;  1J7B A;  2KOX A;  4PS8 A;  2C9W B;  4LNK A;  3PZ8 A;  1L0Y B;  2BB6 A;  3DPD A;  4L23 A;  1AAR A;  2KAN A;  1RAX A;  3VFK A;  4S17 A;  1YQB A;  1V6E A;  2LGD A;  3ZRF A;  4NY0 A;  1H8C A;  2WX1 A;  2C7N B;  2SAK A;  2XK5 B;  1RFA A;  1SBB B;  2KMM A;  2QCZ A;  1VCB A;  1SIF A;  3ETR A;  3W1S A;  4CYE A;  2MA9 B;  2BB5 A;  2KVR A;  5I4D A;  4ASW C;  3RPF C;  3LDZ E;  4N9F 4;  2DAF A;  1QZE A;  5T8I A;  2JXX A;  1V1O A;  2WXL A;  2D3G A;  1V86 A;  3CST A;  4BFR A;  2W55 A;  3UIO B;  4LNN A;  4JIO U;  2JWZ A;  4G50 A;  3PRP B;  5BYR A;  3ZIM A;  1ZW7 A;  3Q3F A;  4XWW A;  2GBR A;  2L0F A;  1STE A;  1YJJ A;  2N9E B;  4B0M A;  2ON8 A;  2Y5B B;  1R4M I;  2SEB D;  1HQR D;  1YD8 U;  1VJK A;  2B3A A;  2KDB A;  4HPP A;  2N1W A;  1WJ4 A;  2QIE B;  1AW7 A;  2WXH A;  4M8N A;  3WAP A;  4ZDV A;  1OTR B;  1OQQ A;  3U2S C;  4GOC A;  3RNB C;  1FXI A;  2FAZ A;  1WE6 A;  2BF8 B;  4YSZ B;  4ANV A;  1T5X D;  1PGX A;  1FNU A;  4ICV A;  1J8C A;  1FFV A;  2C5L C;  1WX7 A;  4FJY A;  3NHE B;  2Z0D B;  3HRD D;  4OVZ A;  3T3N A;  1XO3 A;  1GC7 A;  3JSV B;  2L8J A;  3NVW A;  1WJ6 A;  2WXG A;  4FHJ A;  4LNF A;  3A9J B;  3Q8F A;  2PE6 B;  3RT3 B;  2W54 A;  4P7I A;  4YXD B;  4HDO A;  1YN4 A;  5G5G A;  4C7Y A;  2AWT A;  4K3B A;  3KUZ A;  5E6P A;  2MBQ A;  3AE4 B;  3L17 A;  1TZO A;  2BGF A;  3NS8 A;  1UGJ A;  4XWT A;  4JPS A;  4E74 A;  1L5P A;  4Q2J A;  2WGS A;  3EEC A;  3QIJ A;  3QAQ A;  3L0W B;  2BQQ A;  2LVQ A;  5L95 C;  3KH0 A;  3TBL D;  4IM0 A;  1NYR A;  2BBC A;  5JZE B;  3N3K B;  2KC2 A;  1FRR A;  1IYF A;  3MHS D;  3LYY A;  3L08 A;  1OFF A;  3X0W A;  4HCP B;  2NTS A;  1ZDX A;  2BYE A;  2RR9 A;  4KV2 A;  3ONS A;  3QHT A;  3PTF C;  3P4P B;  1MG8 A;  1R4M B;  4CHK A;  1SXT A;  1WH3 A;  4I6L B;  4DHZ E;  1UBI A;  1WXQ A;  3FC4 A;  4J6I A;  5GXG B;  2MBE A;  2IPK D;  4C4V A;  5J18 A;  3K9P B;  2KFK A;  1I4R A;  4GDK A;  3TEX A;  3P42 A;  1WYW B;  1E0Z A;  3SFD B;  2HJ1 A;  3IAM 1;  3ZO5 B;  1F0Z A;  1WXV A;  2A5U A;  1L2N A;  2LI5 A;  1I4H A;  2QEJ C;  1IBX A;  5JHA A;  4WQO B;  5JH5 C;  5EE0 A;  2HD5 B;  4N59 A;  3AXC A;  4LJP B;  2W9N A;  5CHF A;  1L6U A;  1ZGU B;  3OWE B;  3ZJV A;  1KLV A;  4M0W A;  2FBW B;  4MJS A;  4A20 A;  2K0P A;  1E10 A;  2N9P C;  3DCG A;  2KAJ A;  4KGR A;  1JQ4 A;  1L0X B;  3L4P A;  1F77 A;  2KJH B;  4HXD A;  2IBI B;  1LM8 B;  1WY8 A;  3ZXR A;  4XE0 A;  2XNA C;  1KLG D;  4MT5 A;  1UD7 A;  4WIP A;  1N61 A;  5JXV A;  3AEB B;  2G1E A;  2KJ6 A;  3AM9 A;  1DOX A;  1HA5 A;  1GG3 A;  1TS4 A;  3DBH I;  3IT6 B;  3VH3 B;  3RI7 C;  1WI0 A;  1UWX A;  2JUO A;  3NJT A;  4WWO A;  3IBE A;  2DEN B;  1E7V A;  5EE3 A;  1XT9 B;  4CQN A;  3T8M A;  3A4S C;  3N1Y C;  3AN1 A;  4W9L A;  1ZKH A;  5DCN A;  1XF5 L;  2LVP A;  1K53 A;  4OVV A;  2K25 A;  1IBX B;  1SE3 A;  4KZ0 A;  4DHZ B;  1WXA A;  3A9K B;  2MEK A;  5BYQ A;  1LFD A;  3AED B;  1E8Y A;  2CJN A;  2ZW0 A;  1DOI A;  1P0R A;  2WP9 B;  2JF5 A;  2W82 A;  1SJH D;  1ZUD 2;  4F1S A;  5FR3 A;  1YN3 A;  1SGH A;  2QSD A;  1XD3 B;  5KHQ A;  4FJZ A;  2CHZ A;  4XC2 A;  2L3Z A;  3DDC B;  2JPH A;  1C3T A;  4IUM B;  2FID A;  2E3T A;  4K7S A;  3AE8 B;  2R2O A;  4C80 A;  2ZJD A;  2MSE D;  5H92 C;  1WGD A;  1NI3 A;  3VTU A;  1T3Q A;  4NAW B;  3PRE A;  2L7R A;  2LJ5 A;  2ZCB A;  2WDT B;  1P7E A;  2RDB C;  1CJE A;  2IJ0 A;  1PQS A;  3T3O A;  4A90 A;  2V1Y A;  2JXT A;  2HJ8 A;  1JCK B;  3VHT C;  3TMP B;  1FCC C;  1T6B X;  5D6J B;  2PPH A;  1V1P A;  1WRI A;  2KTR A;  4IWP A;  4P1B C;  1TIF A;  3EGR A;  1WE7 A;  4X57 B;  2KLC A;  4JWU C;  1RWS A;  3GZN I;  4N6E B;  1JWU D;  2N4F A;  4LTU A;  1QT9 A;  1SE2 A;  3BIN A;  4BKS A;  1P98 A;  2Z0E B;  1FIQ A;  5CTR C;  3U4E G;  2MH7 A;  1UEL A;  1WR1 A;  4FHK A;  4WJN A;  5IKC M;  2PVG C;  2ZVN A;  2OHF A;  4ZYS A;  1K8R B;  1Q0W B;  1JW9 D;  2DLB A;  1OQR A;  2NBW B;  3U8Z A;  3ZNI D;  5C2T B;  3DVN U;  3AMZ A;  2J52 A;  3V6C B;  3ECI A;  1UZX B;  2YLM A;  4M8M A;  3U52 E;  5LLI A;  2N0S B;  3SD5 A;  2C7M B;  2IY1 B;  2LVO A;  5AZH A;  2RSU A;  2I38 A;  4LK0 M;  3BK2 A;  2K6D B;  4FJV B;  4AQ7 A;  3CSF A;  4D2K A;  1MJD A;  3B9J A;  1WM2 A;  3Q14 C;  3H7P B;  2EEL A;  1GNU A;  4FN2 A;  3NS1 A;  2RPQ A;  4MAC A;  2DZI A;  3NZS A;  2AL3 A;  3MC9 A;  4RH6 A;  4WQM A;  3PLU A;  3SDL C;  4XDC A;  2JT4 B;  3KUC B;  3DBR B;  2WXI A;  1V81 A;  2Z59 B;  3GOE A;  3VH4 B;  2V3N A;  3TSS A;  5J17 A;  2N7J A;  2BYT A;  1ZOY B;  5HHD G;  2KJR A;  1C4A A;  1M94 A;  4IG7 B;  1OGW A;  1VRA B;  3FAH A;  2YVC A;  1B9R A;  4ZRQ A;  1TZ1 A;  3IXS A;  3ML8 A;  1N60 A;  1J19 A;  3OLM D;  4DHJ D;  2JRH A;  4KIK B;  3SEB A;  3MJ5 A;  1IGC A;  1TKY A;  2QJL A;  3E9S A;  4KKI A;  3WAN A;  1ZXI A;  2PE9 A;  4HLE A;  3GZN B;  3DVG X;  1JWA D;  4LNO A;  2K6Q A;  2NVU I;  2WDV B;  1SJE D;  1ZP0 B;  1QF6 A;  3V61 A;  3APF A;  1P1A A;  2XK5 A;  2UYZ B;  2CHW A;  3PLV A;  4M02 A;  2N7E A;  1LGR A;  3AV8 A;  4LLG M;  4TUU A;  3WIM A;  1C76 A;  3RYT A;  1WX9 A;  4N58 A;  4GXB A;  4IOI E;  4EKU A;  4OVU A;  4WWP A;  1G6J A;  2MP2 B;  3P4R B;  2L1A A;  2I2Y A;  1J0G A;  4DXG A;  4W9J A;  3VRA B;  2KLG A;  3AEG B;  4FBJ B;  3ZW3 A;  4ANU A;  4NNJ B;  3RNC C;  3QQ8 B;  1KLU D;  3GE8 C;  1TY2 A;  2JVC A;  3NY5 A;  2BW2 A;  2KT7 A;  1GC6 A;  5HI1 A;  1CMX B;  2Z8L A;  3VVW B;  3IFW B;  1NDD A;  2WWZ A;  3HVZ A;  2WU5 B;  2M1M A;  4ZRJ A;  4BKG A;  1N62 A;  2M8S A;  3VR8 B;  4A3P A;  5HFY A;  2WQY B;  2REX A;  3UQB A;  4A55 A;  4JE3 B;  4JL9 A;  3TCA A;  1VZ6 A;  2M4N A;  2D5G A;  1TS5 A;  2ZNV B;  1HZ5 A;  3PRZ A;  2EMS A;  2MHJ A;  3L10 B;  5D3I B;  3DWG C;  4F7Z A;  4YTM B;  4KX6 B;  2LGI A;  3B2G A;  4WAF A;  5AUK A;  3QJZ A;  2FCS A;  2JX5 A;  2NBV B;  1C78 A;  3DOW A;  2QHO A;  3JSV A;  4HPM B;  3L13 A;  1S1Q B;  4W9E A;  2JZZ A;  2PW9 A;  3A9J A;  3X23 A;  3ZNG C;  1FNW A;  1KF6 B;  1YN5 A;  4II3 B;  1D5X C;  4PT5 A;  1WZ0 A;  4BKS D;  2FCN A;  3ZGZ A;  3PHX B;  1F2R I;  2BS4 B;  4HPL B;  2LFI A;  3AE7 B;  4NPN A;  2KDI A;  1U4A A;  1AYF A;  2WX0 A;  2V4I B;  1F9J A;  5IP4 D;  5IN7 A;  1YQ3 B;  1MPE A;  1ZPS A;  4NQK E;  3ZUN A;  1WYG A;  1KFY B;  2KWC A;  2ZCC A;  4PYU A;  1FO4 A;  2GOW A;  4MM3 B;  1Y56 A;  5D7G A;  3DBL B;  3Q3M C;  4KDL B;  4W9F A;  1NEK B;  1YMH E;  3BZD B;  1TS2 A;  2CU3 A;  3A4R A;  2V3P A;  2WNM A;  1B1Z A;  2NR2 A;  4ZYN A;  5HKH A;  4E3C A;  2N9X A;  3Q3N C;  3W5V B;  5LXH A;  2RMM A;  3ZRC A;  2LGY A;  1JML A;  5BMH A;  2WXN A;  4GB9 A;  3C8Y A;  1ISN A;  4ARC A;  2VRR B;  4TQ1 A;  3A1Q A;  2B76 B;  4BZA A;  2WHI A;  1GPX A;  1ZE3 D;  4BBN C;  2D10 A;  4ANW A;  4KZC A;  5D3D A;  3BY4 B;  1WM3 A;  2JSV X;  2AL6 A;  2LRW A;  4WJQ A;  4RMA A;  1BXT A;  4BBN F;  2K8B A;  3JW0 X;  3HM3 A;  4C7Z A;  2LHD A;  5DPS A;  3VUY A;  4GIV A;  3SU8 X;  2J0K A;  2BS2 B;  1PGA A;  1PUT A;  2O2V A;  4BVU C;  2L83 A;  2GMI C;  2DX5 B;  3ZTD A;  4IC7 B;  3C0R B;  3NRZ A;  4OZC A;  5E6J A;  2WDR B;  2PKO A;  4YSX B;  1UGM A;  4IM2 A;  5BO4 B;  4AUQ C;  1MI0 A;  2L00 B;  3CF6 E;  3DHI C;  5FKA C;  3V3X A;  4AS1 A;  1N63 A;  2IZV B;  2INN E;  4DWF A;  3R8B A;  4CO7 A;  1ET6 A;  1VZ7 A;  2GI9 A;  2IO3 B;  4K7W A;  4WH4 A;  4IM3 A;  2LD9 A;  1FEH A;  3QK0 A;  3BK1 A;  2WXO A;  2DAJ A;  1K50 A;  3WAM A;  1FFU A;  3A1Q B;  1EF1 A;  4RGN A;  3N32 A;  4WWM A;  4WAA A;  4ZHO A;  2LZ6 A;  5LXI B;  1E5W A;  2MQJ A;  2NBU A;  1S3S G;  2OJW A;  4ZRI A;  4ZOH C;  3HM6 X;  5AZG A;  2OOB B;  4HRS A;  2OED A;  4L2Y A;  4MH0 E;  2NCN A;  2A4Z A;  2V9H A;  1WGR A;  1XCT L;  4A8X C;  4FUL A;  2O2V B;  2K9X A;  4ZRK A;  5BMG A;  4JLC A;  3A9K A;  1C79 A;  2KQ7 A;  1QIL A;  3AI5 A;  1TS3 A;  2K1F A;  3DBS A;  3Q8A A;  1HTO A;  1P7F A;  1F1H A;  2KTF A;  3PSE B;  1JAL A;  2ZNV C;  1NI2 A;  1ET9 A;  4EOY A;  1C4P A;  3PT2 B;  1EWC A;  2LRU A;  3U7D A;  3M3J A;  2K22 A;  3IHP C;  4P16 A;  4NZL B;  1E6E B;  1LO5 D;  2D3C A;  3VXW A;  1C9F A;  3AE1 B;  5CX3 A;  2BS3 B;  2KN4 A;  4RF1 A;  1RYJ A;  1J7C A;  3WA0 A;  3VR9 B;  3VTW A;  4NAW A;  3HUI A;  1XLQ A;  1WJU A;  3AE3 B;  3GP7 A;  4J3O D;  4GMV A;  3AB5 A;  3UIP B;  4ACF A;  2LXA A;  2KAC A;  2KQS A;  4F8C B;  2ICI A;  3RFZ B;  4AWJ A;  3VQI A;  4DDI D;  4RF0 A;  3D32 A;  1AN8 A;  1PFD A;  2BVC A;  4USA A;  3ZLZ A;  2M0X A;  2FUH B;  3UI3 A;  3RUI B;  4JX1 C;  2Q5W D;  1MHH E;  1NEN B;  1P3Q U;  3RMK C;  2PJH A;  1GB1 A;  2D2Q A;  2MBB B;  4YSY B;  5DPW A;  4JGH B;  2R2Q A;  3ZNH B;  2LMC A;  3Q6B A;  3GB1 A;  5AZF A;  1E7P B;  2D3B A;  4MSM B;  2CHX A;  2LAS A;  1L7Y A;  4YWG G;  3UQA A;  1KRH A;  1ENF A;  2BKF A; 
#chains in the Genus database with same CATH homology
 2N7J A;  2M0A A;  1IUE A;  1ZOY B;  2J53 A;  3V05 A;  2BYT A;  4HEA 1;  5HHD G;  3RPF C;  1D4B A;  1GB4 A;  1C4A A;  5T8I A;  3KWV A;  1GOZ A;  1V1O A;  2LHE A;  1UUP A;  1SSN A;  1GAQ B;  5HG2 A;  1VRA B;  2M19 A;  2WXL A;  3FAH A;  1B9R A;  4ZRQ A;  3IXS A;  4FXC A;  4XDD A;  3AEA B;  2N9K A;  1N60 A;  2W55 A;  1XLP A;  3AE9 B;  1RM6 C;  3BVZ A;  3SEB A;  1EWY C;  3MJ5 A;  1IGC A;  1TKY A;  3MP9 A;  2QJL A;  4NJC A;  5BYR A;  3E9S A;  4KKI A;  2VZK B;  1ZXI A;  3AEE B;  1VR9 A;  3NVV A;  5BMI A;  4XWW A;  2DBY A;  2AQ3 B;  1STE A;  1RFK A;  1YJJ A;  1JWA D;  1FMA D;  2MJD A;  3NVZ A;  2ON8 A;  2RDG A;  5FK9 C;  3BVM A;  4B0M A;  3AE6 B;  4TQ0 A;  1ROE A;  2WDV B;  1SJE D;  1TJE A;  2ONQ A;  1ZP0 B;  4P6V F;  1QF6 A;  3AEF B;  2SEB D;  1HQR D;  1M4V A;  4GDL B;  4YT0 B;  4OZA A;  1D5M C;  1VJK A;  4REZ A;  1E9M A;  2WU2 B;  3IT4 B;  1XXG A;  3NVY A;  1C4C A;  2QIE B;  4MH8 A;  1AW7 A;  1QKZ A;  2WXH A;  2J42 A;  4US9 A;  1D5Z C;  1JWB D;  1OQQ A;  3AV8 A;  4LLG M;  1C76 A;  3U2S C;  3AE2 B;  2IGD A;  1FXI A;  1IGD A;  3PO0 A;  2LJI A;  4N58 A;  4YSZ B;  4IOI E;  1T5X D;  1PGX A;  1FNU A;  1FFV A;  1QOG A;  2AQ2 B;  2NTT A;  1VLB A;  2WLB A;  3P4R B;  3P4S B;  2L1A A;  3HRD D;  1QQR A;  2I2Y A;  1F2R C;  1JRO A;  4OVZ A;  4DXG A;  1TYG B;  3R2I A;  4WUR A;  2IGG A;  3VRA B;  3T3N A;  1XO3 A;  3AEG B;  2HDE A;  3NVW A;  1KTK A;  1KLU D;  5MPO A;  2W3S A;  1TY2 A;  1R7S A;  2BW2 A;  2WXG A;  4RGM A;  5HI1 A;  3Q8F A;  2JWU A;  2Z8L A;  2W54 A;  4YXD B;  3P63 A;  3HVZ A;  1YN4 A;  2WU5 B;  5G5G A;  3O13 A;  4ZHP A;  1SEB D;  2RPV A;  2E6X A;  1J7A A;  2XN9 C;  1FXA A;  1N62 A;  3VR8 B;  4C7Y A;  5HFY A;  2MJE A;  4HRO A;  2WQY B;  3ZYY X;  1SB3 C;  2PVO D;  4A55 A;  3AE4 B;  4JE3 B;  2INP E;  1TZO A;  1K51 A;  4GDK B;  1D6E C;  1UGJ A;  1VZ6 A;  3TEW A;  1TKE A;  1Q10 A;  4XWT A;  2JZP A;  2D5G A;  2QIL A;  1TS5 A;  1L6V A;  1HXY D;  4JPS A;  1HZ5 A;  1L4D B;  4HJG E;  2PIA A;  1L5P A;  5D3I B;  3DWG C;  4Q2J A;  4YTM B;  4KX6 B;  2LGI A;  2ZW1 A;  3B2G A;  4WAF A;  2WXF A;  5AUK A;  1DGJ A;  2JX5 A;  3TEY A;  1QOF A;  1QOB A;  1N5W A;  1C78 A;  1NYR A;  2NMQ A;  2YEP B;  2BBC A;  1XLN A;  3AEC B;  1CQV A;  1FRR A;  2WS3 B;  1SIJ A;  5EE9 A;  3LYY A;  2AX5 A;  1OFF A;  1AWD A;  3R2T A;  4L1B A;  4YTP B;  2GB1 A;  2NTS A;  1ACC A;  2QMT A;  2FUG 1;  1ZDX A;  1YJI A;  2J4X A;  1WSP A;  1CZP A;  2AQ1 B;  3P4P B;  2PW9 A;  1PDX A;  4KGS A;  4UDU C;  4B0E A;  1FNW A;  1ESF A;  1KF6 B;  1YN5 A;  1D5X C;  3MC0 B;  3H8H A;  4PT5 A;  1SXT A;  2DWQ A;  3Q8C A;  3HVD A;  5BYS A;  3ZGZ A;  1F2R I;  1WXQ A;  2BS4 B;  3FC4 A;  2LFI A;  3AE7 B;  5GXG B;  2IPK D;  1AYF A;  1V8C A;  2L52 A;  2V4I B;  4ZRP A;  1I4R A;  3CIR B;  3KQ4 A;  3TEX A;  3P42 A;  1YQ3 B;  1MPE A;  1ZPS A;  3IAS 1;  4ITK A;  1E0Z A;  3SFD B;  1BUI C;  3IAM 1;  1K52 A;  2H89 B;  1WYG A;  1KFY B;  1BML C;  1FO4 A;  1F0Z A;  1FRD A;  1CK1 A;  3EUB 2;  4MM3 B;  1FD6 A;  1Y56 A;  5D7G A;  3ABV B;  1I4H A;  1MHX A;  2QEJ C;  1IBX A;  4H2A A;  1WWT A;  3BYT B;  5EE0 A;  1TKG A;  2VZK D;  1NEK B;  1YMH E;  3BZD B;  1TS2 A;  4YTN B;  2CU3 A;  4N59 A;  3Q8B A;  2V3P A;  2WNM A;  1B1Z A;  1L6U A;  3OWE B;  1C77 A;  3ZJV A;  4R3D A;  4TMA B;  4M0W A;  2FBW B;  3W5V B;  2RMM A;  2K0P A;  4NAM A;  1E10 A;  1JML A;  3N9Y C;  2WXN A;  2Y3A A;  5BMH A;  2TSS A;  3C8Y A;  2KAJ A;  3Q8E A;  4KGR A;  4ARC A;  1JQ4 A;  1L0X B;  3L4P A;  4IDI A;  1FNV A;  1F77 A;  4TQ1 A;  2JYT A;  3BVG A;  4JWS C;  1YQ4 B;  2B76 B;  1N5X A;  4XE0 A;  3BII D;  3VRB B;  1I4Q A;  1KLG D;  2XNA C;  4MT5 A;  1GPX A;  1ZE3 D;  4TSS A;  4WIP A;  1N61 A;  4KGT A;  5JXV A;  3AEB B;  1PGB A;  2PTL A;  5D3D A;  1ZDV A;  2G1E A;  2JSV X;  1XEE A;  3AM9 A;  1I4X A;  2WXK A;  2WDQ B;  1BXT A;  1FCL A;  2KQ4 X;  1DOX A;  1HA5 A;  4C7Z A;  4ARI A;  3ZJT A;  1TS4 A;  3IT6 B;  3LB8 C;  1I4G A;  1NVI D;  2LHD A;  1UWX A;  1EU3 A;  1L0V B;  2X38 A;  5EE3 A;  2BS2 B;  1PGA A;  1PUT A;  2ACZ B;  4CQN A;  3P4Q B;  4A6Q A;  2L83 A;  1XCQ L;  1V97 A;  2LUM A;  3NRZ A;  3AN1 A;  4OZC A;  5E6J A;  2WXM A;  2WDR B;  1EU4 A;  1XF5 L;  2L32 A;  2PKO A;  1K53 A;  4YSX B;  3P1M A;  1IBX B;  1SE3 A;  2K5P A;  1MI0 A;  4HKQ A;  2MEK A;  3URY A;  3I57 A;  1SE4 A;  3I9V 1;  2IDY A;  1YNT E;  3NUH B;  5BYQ A;  1V1P B;  3FIL B;  1SF0 A;  3AED B;  2CJN A;  2ZW0 A;  5FKA C;  1DYQ A;  3V3X A;  1DOI A;  4AS1 A;  1N63 A;  2WP9 B;  2INN E;  2W82 A;  1SJH D;  1ZUD 2;  2K3U A;  2N9L A;  3R8B A;  1ET6 A;  1VZ7 A;  2GI9 A;  1JRP A;  1FM0 D;  4WH4 A;  5TSS A;  5FR3 A;  1FEH A;  2JU6 X;  2RDH A;  1YN3 A;  4DXF A;  2QSD A;  3BK1 A;  2WXO A;  5C3J B;  1K50 A;  1FFU A;  3B2F A;  4RGN A;  1I4P A;  3KLS X;  4WWM A;  1ZXH A;  3PZ7 A;  4ZHO A;  2WXR A;  5H8Y E;  2E3T A;  3ZJU A;  3AE8 B;  2PMV A;  2CJO A;  4C80 A;  4RGO S;  4GLS C;  1NYQ A;  5H92 C;  2BTE A;  1NI3 A;  1T3Q A;  3W5U B;  4NAW B;  3KWL A;  4ZOH C;  4RGT A;  1DOY A;  4HRS A;  1P7E A;  2OED A;  4L2Y A;  3GS2 A;  1CJE A;  3BWU D;  2WXJ A;  2IJ0 A;  1XCT L;  3W9C B;  3TEZ A;  4A8X C;  3T3O A;  4A90 A;  1VZ8 A;  2JXT A;  2W3R A;  2K9X A;  5BMG A;  2KWD A;  3CWI A;  1HZ6 A;  1C79 A;  1JCK B;  2Y5P A;  1QIL A;  4RFB A;  4EE2 A;  4DQO C;  3ZQ4 A;  1FCC C;  1T6B X;  1QOA A;  1TS3 A;  4C56 C;  1HEZ E;  1V1P A;  1WRI A;  2M56 B;  2JYE A;  2EKI A;  3FIL A;  3WCQ A;  2DYO A;  3EGR A;  3Q8A A;  4OZB A;  3EA6 A;  3SR6 A;  3SFE B;  3MHZ A;  1P7F A;  1PYW D;  4JWU C;  1RWS A;  2G9H D;  1JAL A;  4N6E B;  1ET9 A;  4A9A A;  1L4Z B;  4HKZ E;  1C4P A;  1JWU D;  1EWC A;  1UWM A;  1XLO A;  4LTU A;  1QT9 A;  4O1N A;  1SE2 A;  3DWM A;  1JWS D;  2K22 A;  3U7Z A;  2V0G A;  1FIQ A;  4P16 A;  3U4E G;  2MH7 A;  3NZ3 A;  4NZL B;  1E6E B;  1LO5 D;  2PVG C;  1VDV A;  2OHF A;  4US8 A;  1C9F A;  3AE1 B;  4OHJ A;  2BS3 B;  2MJ3 A;  2KN4 A;  2DYM A;  4RF1 A;  4ZYS A;  1RYJ A;  1J7C A;  1EM7 A;  5G5H A;  2H88 B;  1JW9 D;  3BYY B;  3AE5 B;  3Q69 A;  2DLB A;  1OQR A;  2YEP F;  3VR9 B;  5C2T B;  4OW0 A;  3HUI A;  3AMZ A;  2J52 A;  4IKG A;  5LNK 1;  1XLQ A;  4RCO A;  1A70 A;  3AE3 B;  2Y5C A;  3AH7 A;  4RNA A;  3GP7 A;  1MVK A;  4J3O D;  2BT6 A;  2GRI A;  3U52 E;  3MFG A;  3AB5 A;  2N0S B;  3LXF A;  2KAC A;  2IGH A;  4KKJ A;  2I38 A;  2FE8 A;  4LK0 M;  2ICI A;  2R61 A;  3BK2 A;  3J9C A;  3RFZ B;  4AQ7 A;  2LEK A;  3VQI A;  3E56 A;  4D2K A;  1JWM D;  1J7B A;  4RF0 A;  1AN8 A;  3B9J A;  1PFD A;  4USA A;  3PZ8 A;  1L0Y B;  2EEL A;  3UI3 A;  2BB6 A;  2PLP A;  4L23 A;  1I7H A;  2JQR B;  4JX1 C;  3NS1 A;  2Q5W D;  1MHH E;  1NEN B;  1WGK A;  4MAC A;  2KDM A;  1GB1 A;  4YSY B;  1QLB B;  1TY0 A;  5EE1 A;  5AUI A;  2LMC A;  4RH6 A;  2SAK A;  4WQM A;  3GB1 A;  1E7P B;  2KMM A;  1SBB B;  4XDC A;  3W2D A;  2WXP A;  4YWG G;  3ETR A;  3W1S A;  2WXI A;  3TUO A;  2WXQ A;  2HTM E;  2BB5 A;  1KH0 A;  5I4D A;  1KRH A;  1UNS A;  1ENF A;  2V3N A;  3TSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...