2KACA

Nmr solution structure of kx6e protl mutant
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
64
structure length
64
Chain Sequence
b'MEEVTIKANLIFANGSTQTAEFEGTFEEATSEAYAYADTLEEDNGEWTVDVADEGYTLNIEFAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein L
molecule tags Immune system
source organism Peptostreptococcus magnus
publication title Structural basis for the aminoacid composition of proteins from halophilic archea
pubmed doi rcsb
total genus 15
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2008-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2kacA00
2IGGA 5BMIA 5BMHA 2KWDA 2JWUA 2ONQA 1Q10A 1K53A 2LUMA 1K50A 2JZPA 5HI1A 1PGBA 1JMLA 2LHEA 5HHDG 4OZBA 2ON8A 2JSVX 2QMTA 1MHXA 1XCTL 3V3XA 1GB4A 2KACA 1D4BA 1MI0A 4GLSC 1IGDA 2J53A 4KGTA 1C9FA 1MVKA 2EELA 2RPVA 4KGRA 1P7EA 2PLPA 4IKGA 3FILA 1HEZE 2QSDA 1HZ6A 3GB1A 4OZAA 2JU6X 2ZW1A 2LGIA 5BMGA 2IGHA 2ZW0A 1F2RI 1K52A 2JXTA 4D2KA 2I2YA 3MP9A 2KDMA 4HJGE 1XF5L 1EM7A 3FILB 1QKZA 1IBXB 2N7JA 1FCCC 1GB1A 2N9KA 4HKZE 1F2RC 2J52A 2N9LA 4MACA 1FD6A 1YNTE 1MPEA 2KN4A 2K0PA 2I38A 4OZCA 1XCQL 1UWXA 4IOIE 2LHDA 2PTLA 1K51A 1MHHE 1IBXA 1PGAA 1YMHE 2PW9A 1FCLA 2GB1A 1IGCA 2OEDA 4WH4A 1P7FA 2GI9A 5HG2A 2NMQA 1KH0A 3UI3A 1ZXHA 2IGDA 5JXVA 5HFYA 1PGXA 1HZ5A 2KQ4X 2RMMA 4KGSA
chains in the Genus database with same CATH superfamily
5BYSA 2BKFA 1V1PA 5BMIA 1D5MC 2LRWA 2KHWB 4JLCA 4AOFA 1EO6A 4JIOU 3UQBA 2KMMA 1PUTA 3DBSA 2BPSA 1WJ6A 4P1BC 3R7QA 5HHDG 3WCQA 5MPOA 1SJHD 2QC8A 1C1YB 4LDTB 3R8BA 3B2FA 2LUEA 3V05A 2PJHA 1TGZB 3Q8FA 2NBUA 4FBJB 1JWBD 4HRSA 3GB1A 1I4XA 1JWSD 2LGIA 2WU5B 3VQIA 2AL6A 2G4SA 1D3ZA 1QT9A 4GDKB 2KQSA 3ZLZA 3BYYB 4XDCA 4PK1A 4XC2A 2KFKB 3AEAB 1JQ4A 5IA7A 2FNJB 4W9LA 4MSQB 2AL3A 3JYUA 2KDBA 3N32A 4HKZE 2LVOA 4NJCA 2DAJA 3AI5A 4M0WA 4TQ0A 3CSTA 2MBEA 2JRIB 2PEAA 1SXTA 3PSEB 1UWXA 3QCAA 2BGFA 2LHDA 4II2B 3PHWB 1RM6C 3IBEA 2D11A 2QEJC 3NZSA 1P1AA 4JWUC 3NS8A 4ZYSA 1TY0A 4LCDE 3ZJVA 2OJRA 4LJOB 1FFVA 1TY2A 2DBYA 3UI3A 4OHJA 3M63B 1C4CA 3ETRA 3MHSD 3O65B 1EUVB 1PGXA 3TEZA 4FADA 2CJOA 1VLBA 5KHQA 3I57A 4F1SA 1Q1OA 5BYRA 2JWUA 3WALA 3GE3C 1Z5SB 3PLUA 3P63A 4W9KA 3TJPA 3VXWA 2MH7A 3V62A 2ZCBA 4NQKE 4TUUA 1YQ3B 4JQWC 1JMLA 4N58A 1ZGUB 2RDHA 3APFA 2MBBB 1S3SG 2K1FA 4G50A 5J17A 3KVFB 1KLUD 2H89B 5C23A 3KUCB 2ZPNA 5L83A 3BK2A 1GUAB 3URYA 4ZDVA 4MDKE 4LLGM 1XLNA 4XZ4A 2RR9A 3OWEB 4RGMA 1JROA 3L08A 4EZJA 4ICVA 4DXGA 1N63A 4B6WA 2DYOA 3QARA 4RGOS 3BVMA 1TS4A 3VTVA 2KK8A 2VZKB 1LGRA 1YN3A 3ZQ4A 2KZRA 2AYOB 4IC7B 3DVGX 4BOZB 1GC6A 2HE7A 2KLCA 2N1WA 3L13A 3MC9A 3L54A 1L6UA 5AUKA 3RCZA 4MJSB 2LJIA 3T3OA 2IO2B 4GDKA 1E9MA 3NVVA 2KN5A 4REZA 2OEDA 1GOZA 1WXVA 3VUWA 4W9CA 4HK2A 4FA6A 1XLOA 5EE9A 1UGMA 4ZRPA 3PRPB 1B1ZA 4XGAB 4S0RA 1FRDA 2L76A 4RH6A 3TEYA 2KQ4X 5CHFA 2K9XA 3TUOA 4WWMA 1YOVB 2H88B 2KWDA 3VHTC 5E6OA 2FCQA 4KIKA 1WM2A 3QK0A 5AZGA 5I4DA 4YTNB 4JWSC 2L32A 3SD5A 4EUTA 3ZJTA 1T0SC 1ZXIA 2GRIA 3ZKJC 2JF5A 3I5JC 4TV3A 1FXAA 3OAWA 2LGXA 3U30A 3I63C 4MGKE 1EWYC 2L05A 2J53A 3PS6A 3MTNB 4MH8A 1M4VA 5G2NA 4CQNA 2G3QB 2KWCA 1P98A 5GXGB 3H8HA 3TIXA 4GN1A 2CU3A 4IKGA 4WURA 3WAMA 1QOBA 1UH6A 5EDSA 5TSSA 3M3JA 3P4QB 4XX5A 2MCNB 3N30A 1A70A 1TS3A 1ZP0B 2MSED 2RPQA 2VH1A 3PGEA 4XE0A 3QC8B 3BZDB 3KLSX 1ZE3D 3MP9A 2KDMA 3AE9B 1EM7A 2D3BA 1WGKA 4E71A 3NRZA 2JWZA 4BKTA 4HEA1 1N5XA 2CR5A 2CHXA 1ZOYB 3IFWB 1WXMA 3VFKA 1YJIA 4IWQA 3PZ8A 2BS4B 2MJEA 3VR9B 4KKJA 3NUHB 1MHHE 1IBXA 1RFKA 2LVPA 4AQ7A 3QX1A 4E3CA 2WU2B 4ARIA 3C19A 3ZIMA 2Z0EB 4DDID 5JXVA 5JZEB 4DHZE 3HHMA 1MG8A 4DK5A 2KC2A 2NVUI 2W55A 1WMHA 4OVVA 4TSSA 1FEHA 3NJTA 3SHQA 5CTRC 3K9PB 4WAAA 1RAXA 2KFKA 5T8IA 2N9XA 3ML9A 3RUIB 4C80A 4S17A 2K5PA 3RNGC 3LYYA 2J0MA 1B9RA 4M01A 4IM0A 5IOIA 1J0GA 1GPXA 2IO1B 1OQRA 2DYMA 1WXQA 4KKIA 4KGRA 1P7EA 1WH3A 2WYQA 4HROA 5E6JA 1K8RB 1E8ZA 1KLGD 4WAFA 1DOIA 1V5TA 1ZUD2 2MBQA 1HXYD 2Q5WD 2WXRA 3S2AA 3ZXVA 5BO4B 3ZJUA 2RGFA 1JALA 3GP7A 4A9AA 1EU4A 3DPDA 1KRHA 3HM3A 3PPAA 1AYFA 2BS3B 2XK5B 3HK0A 2J42A 4A3OA 4G11A 4A3PA 1C76A 3AEFB 5AZFA 2ZVOA 2Z59B 1NDDA 2QILA 3PHXB 4ZOHC 1WI0A 2WGSA 2K6DB 2KTRA 2OOBB 1V1OA 2K0PA 1IYFA 1JRUA 1Q0WB 1SB3C 2BYTA 4YSXB 1SIJA 2LXCA 1TKYA 1E8YA 4PYZA 1V86A 2RDBC 3L4PA 1FCLA 2NBWB 4OW0A 3LJ3A 1BXTA 4ZHPA 1E8XA 1WZ3A 1KTKA 2WXKA 5D94A 3B9JA 2QIEB 1HA5A 2EKEC 1JCKB 1WFYA 2HJ8A 1XXGA 2DX5B 2JX5A 3DBLI 4IWPA 2MJDA 2KDIA 3O13A 2E3TA 4IM3A 1RWSA 3ZO5B 5FR6A 2REXA 2L8JA 2JZPA 3IT4B 2OHFA 3Q2AC 4KX6B 3N20C 1UZXB 2WDTB 1ACCA 1WZ0A 1MHXA 2LGSA 4W9JA 4H2AA 5LXIB 2BT6A 4KSKC 2L0FA 2PMVA 4PYUA 4DHZB 2FIDA 4J6IA 4HWIB 4EEWA 4KGTA 2MP2B 3W2DA 4MJSA 2BTEA 4DHJD 3KH0A 4WWOA 2O6VB 4K81A 2O6VD 2KJ6A 3H7PB 1YIWA 2BQQA 1VRAB 1L2NA 2XN9C 5C1ZA 2JXTA 4FN2A 4BFRA 3HVDA 2SEBD 4NY0A 5L95C 2NR2A 1T6BX 1I7HA 3W1YA 2BVCA 1QOFA 1WX8A 1JWUD 3RNEC 5LXHA 3A9JB 1FNUA 1Y8RC 3EGRA 4CO7A 1TT5B 3UGBB 4OZCA 2BWFA 3C0RB 3GE8C 2C7MB 4MT5A 3CF6E 2KXJA 1K51A 2MLBA 1JWMD 2JXXA 4GDLA 2X38A 1N61A 1SSNA 4TQ1A 4WH4A 2DYBA 2DZKA 2NS5A 1KH0A 2JPHA 1P9DU 4RFBA 2N9EB 1ET9A 4FXCA 4CYEA 1C4PA 3DCGA 1SBBB 2OJWA 3A1QA 4ITKA 3R2TA 2HDEA 4N9F4 5J2RA 2LRUA 2KVZA 4UDUC 5IP4D 1Q10A 4PS3A 3TBLD 1ENFA 1CJEA 3M62B 1WGRA 3RULA 2N0SB 1WSPA 4CHKA 3ZYYX 3Q69A 5IAAC 5J18A 2QMTA 3RT3B 3VRBB 4DQOC 3IT6B 1DYQA 4ANWA 4HDOA 1QILA 3V6EB 4F7ZA 1FXIA 2M56B 2NPTB 3DOWA 3RZFA 1IPGA 2K8HA 3AE1B 3OLMD 2YVCA 1WYWB 1SEBD 3RFZB 3FC4A 4B0EA 2PVGC 3N3KB 1P0RA 2ZJDA 3R3MA 3WIMA 2I1KA 3MJWA 1F2RI 4WWPA 2CHWA 3VRAB 4D2KA 2I2YA 5JHBA 1PYWD 3DBLB 2PE9A 3NVYA 3L17A 1CK1A 1WJ4A 1MJDA 4M8MA 3NG0A 1T0QC 4RF1A 2V1YA 3AN1A 1N6ZA 1DGJA 2E6XA 4G3XB 4MACA 1FD6A 3QWZB 1MPEA 2DNFA 2CU1A 2ZNVC 5DPTA 1LQBA 3UIOB 2V0GA 1PFDA 2DZIA 3RNBC 3H7PA 1Z2MA 2WHIA 1WGYA 2W82A 3ZNID 2DZJA 1VDVA 3C8YA 2IY0B 2GBJA 2NTTA 2WXOA 2Y5CA 4B95A 2LVQA 3M95A 2L7RA 1FM0D 2NMQA 1XQQA 3APCA 3AEEB 3L16A 4RNAA 2LASA 4LNKA 5D3DA 4DXFA 2IBIB 4YTMB 3A1QB 4EZLA 3EFUA 1T0YA 3Q8BA 3IHPC 4NZLB 1PDXA 2WQYB 4JX1C 4PS8A 2KD0A 4K3BA 2MP2A 4RMAA 2NCNA 4BZAA 4OZBA 1NVID 4MH0E 3P4RB 1RLFA 2JRHA 1D4BA 4NAWA 2SAKA 3VTUA 1XLPA 3RPFC 4W9FA 4KZ0A 4IG7B 2ICIA 4M8NA 3VR8B 2FE8A 1HZ6A 1BUIC 2KTFA 4OZAA 2V9HA 3BWUD 4WQOB 2INCC 2WXHA 1G6JA 2KMAA 5AUIA 3VUYA 1R4MB 2WXMA 2M0AA 2Y3AA 3H7SA 5TR5A 1TZOA 1OQYA 2GMIC 2KMCA 4MELA 2MBOA 3HVZA 1FCCC 3RYTA 4NAMA 2C7NB 3TL5A 1C3TA 2D10A 4ZRIA 1YN5A 1XLQA 4WJQA 3KWVA 4WWNA 4LJPB 2A5UA 2PTLA 4EE2A 2DZMA 1R4MI 3DVNV 3V60A 2X8XX 3J9CA 3ZXRA 4JE3B 2PW9A 1LXDA 3U2SC 4J3OD 4USAA 2INDC 4IM2A 1P7FA 3N1XC 3IXSA 4ASWC 2O2VB 3KUZA 4TMAB 1E7PB 3B0AA 4KGSA 4JPSA 1YJ1A 2TSSA 2KANA 2LFIA 1YJJA 2D3GA 2L1AA 2YEPF 4LTUA 2ZEQA 2LWPA 1HTOA 3W1SC 3RMKC 3DVGY 3E56A 1WRDB 1UELA 1C78A 3A9JA 3LXFA 3KUDB 4KV2A 3RI7C 2WXIA 3CIRB 4FJVB 1EWCA 5GMVA 3AEBB 3CSFA 3RZWC 4HPPA 2C9WB 1JWAD 3ONSA 3DWMA 1UGJA 4W9HA 1D6EC 4IWOA 1WR1A 1CMXB 1ISNA 2LD9A 4GSWA 1GNUA 1WYGA 3QA8A 3ZNZB 1SJED 2WX1A 4YTPB 2G9HD 1WGHA 4PS7A 2LEKA 2MHJA 2BB6A 4ZRJA 4ARCA 3AXCA 4HKQA 2LGYA 2GLSA 3HUIA 4L1BA 3W5VB 5BYQA 3TCAA 4NPNA 3LDZE 3BY4B 1YMHE 2KYWA 3WAOA 4MM3B 2RSUA 4W9GA 4C56C 1L4DB 4AP4C 1I4RA 4FJZA 3BIID 4HXDA 2V3NA 3A9KB 2KO3A 1YQ4B 3P1MA 2C7HA 1STEA 4P7IA 3SU8X 1L7YA 2IGGA 2L0TA 1SIFA 5BMHA 1K53A 2LUMA 2XEWA 3SDLC 2CHZA 2N1VA 3MFGA 2WWZA 4GDLB 2EMSA 1TTNA 2PIAA 4ZRKA 1J7BA 2WDRB 1VD2A 1LFDA 2JSVX 4EKUA 4RCOA 4I6PA 3FKYA 1XCTL 3L0WB 3V3XA 2KACA 3SFDB 2N7DA 2QJLA 4HCPB 3K9OB 5AEKB 2V4IB 1SE3A 1J7AA 1XEEA 4DWFA 3FILA 4OVUA 1YX6B 1HEZE 2BF8B 3ZUNA 4RGTA 1NYQA 3FAHA 4WJNA 2IGHA 2J0JA 1UUPA 3U4EG 1RYJA 2JT4B 3NY5A 3W1SA 4XDDA 2C60A 1OEYA 2WXGA 3T8MA 3FILB 3P2BA 1YD8U 1AN8A 4W9EA 4AJYB 1GB1A 3Q8EA 4MGYE 3ALBA 4NQLB 2GOWA 1YNTE 4N59A 1KLVA 5D2MB 3RD2A 3DWGC 2WXLA 1E0ZA 3ECIA 5AZHA 1I4PA 2HTME 4NAWB 2QHOA 2LMCA 1I42A 1WX9A 4L2YA 2B76B 3KYCD 1UD7A 2VH2A 1UF0A 5C3JB 1N5WA 2O6VA 3U7ZA 3DVNU 2M8SA 1X1MA 2XK5A 3A9KA 4IOIE 4BAXA 3X0WA 3IAS1 2ONQA 2AQ2B 2D07B 2IY1B 4KVGB 4RM9A 3P4SB 1KJTA 1EU3A 2WP9B 2AQ3B 2YLMA 4LNNA 1SE9A 3AU4A 2ON8A 2N9PC 4US9A 2W54A 2K6QA 2D3AA 1V8CA 1FMAD 3VAWA 2K8BA 1OQQA 2WXQA 2CS4A 2V3PA 2K25A 3HIZA 1MFWA 5IKCM 2INPE 4LNIA 1ET6A 3AB5A 3W9CB 2ZW0A 5IN7A 3JW0X 2IO3B 3PTFC 3NOBA 4HJGE 4FHJA 4EFOA 1FXTB 3TEWA 3T9LA 2UYZB 3NHEB 1UWMA 2KT7A 3Q3JA 4GOCA 5DPWA 1ROEA 4FHKA 1M94A 3CMMB 4M0WB 3VH3B 3A4RA 2LJ5A 5CHWA 1NI2A 4KZCA 2WLBA 2ZNVB 1PGAA 3PLVA 4DDGD 1FRRA 4FJYA 1WE6A 4LDTD 5H8YE 5JH5C 3MC8A 2KJRA 1C77A 2DHZA 2WDVB 4I6LB 1E7VA 3PREA 3EC8A 4LNFA 1WY8A 2WDQB 3AE8B 1R4NB 4HDQA 4URKA 2IPKD 1FNVA 1PGBA 1V6EA 3OJ3A 1GAQB 4NJ6A 4XWTA 4MSMB 4AJWA 1NEKB 4RGNA 3PRZA 1QF6A 3AE4B 1FPYA 3QJZA 1F0ZA 1R4NI 3PV1A 1QOGA 3I9V1 2IJ0A 1IUEA 3BK1A 1MVKA 2VRRB 2D2QA 1E6EB 2KKCA 2RPVA 4YSZB 3AE3B 4PT5A 3AEGB 2CJNA 2QSDA 1C4AA 1WWTA 3AULA 2KC1A 1OTRB 4ZHOA 4K7WA 4RF0A 1ZDXA 2KWUB 2KVRA 2KQ7A 4RM8A 3QIJA 3AMZA 1IBXB 1WIAA 2KX3A 1JW9D 4C7YA 4BKSA 3MHZA 2N9LA 4R3DA 2AEHA 3AE5B 2W9NA 2BB5A 2EKIA 3GOEA 1I4HA 3H1UA 2I38A 4BBNC 3U52E 2NBVB 1I35A 1J8CA 1WRIA 3KQ4A 4YSYB 3I3TB 5IO9A 1DOXA 3V61A 4P6VF 4M02A 1GJZA 2INNE 4K1RB 4DBGA 4KDIC 3SFEB 1TZ1A 2R61A 3JSVA 2M4NA 2KFJA 2M17A 4KSLC 4GMVA 3ZNGC 1WX7A 1VR9A 4BBNF 3U8ZA 2FCNA 4ZRQA 3TMPB 2ZPYA 1F9JA 3GZNB 1V49A 1FNWA 3AEDB 5H92C 2FUG1 1D5ZC 4C7ZA 5KHOA 2LHEA 2IDYA 5EE0A 5FKAC 1V80A 3PZ7A 3IVFA 3DBRI 2ASQA 1XT9B 2V3SA 3EHVA 2ZZPB 1ESFA 3IAM1 3ABVB 3SR6A 3TEXA 2AWTA 1IGDA 2N4FA 4ACFA 3N1YC 2IYDB 1EF1A 1A5RA 4US8A 3VDZA 5LNK1 4KIKB 4P1CC 2ZW1A 2BYVE 2WXFA 1QQRA 4WJPA 5JHAA 2WXNA 1OFFA 1XF5L 3D32A 1P3QU 5G5GA 2BS2B 1ZW7A 3W5UB 4E74A 2N7JA 2D5GA 2W3RA 2N9KA 1YQBA 1GC7A 4MGIE 2WX0A 3LB8C 4C4VB 2GBRA 3HM6X 1VJKA 1SGHA 2G45B 3AECB 4AUQC 4A55A 2FAZA 4Q2JA 1VZ8A 4GB9A 2MEKA 2NTSA 3VUXA 2WXJA 2QCZA 3DHHC 1XO3A 1H4RA 2J4XA 2HD5B 1L0XB 1SE2A 2KTRB 2LZ6A 1IP9A 5HG2A 4N6EB 1WM3A 4BOSC 1ZXHA 1TKGA 3PT2B 2JZZA 1I4QA 1LO5D 4WJOA 3VVWB 1JRPA 1U4AA 3KYDD 2WS3B 1WGGA 1TS5A 3VH4B 1HTQA 3MJ5A 2UU7A 4K7SA 4DHJB 1E5WA 4X57B 3ZNHB 2K39A 3WA0A 4MGZE 4I6NB 3RN9C 5FK9C 1MI0A 1V2YA 1RRBA 2YEPB 3ZTCA 1WJNA 3R2IA 1C9FA 1AW7A 3U7DA 3DHGC 1WMHB 3NZ3A 3AE7B 2PLPA 4MM3A 3Q14C 4HLEA 1AWDA 2JU6X 5BMGA 2IZVB 1GG3A 4WQMA 1MG4A 1F1HA 1J19A 1L5PA 1K52A 3NVWA 2XNAC 1F52A 1AARA 3OG5A 4ZYNA 2JZ3B 2GBKA 1V1PB 2JQRB 1TJEA 3EA6A 1QKZA 1UNSA 4FLHA 4YT0B 5EE1A 5FR3A 1KF6B 1HE8A 1V9JA 3ZW3A 3AE2B 3ZDMC 3UIPB 3DBHI 2KAJA 3KWLA 3PRMB 4ANVA 2GI9A 4WIPA 5DCNA 4KDLB 1L4ZB 4FULA 4GU2A 3BYTB 3EFCA 4G0NB 1N60A 3Q3FA 1NYRA 3RNFC 1UBQA 4MEMA 2RMMA 2KOXA 1E7UA 3QQ8B 1C79A 2VZKD 3Q3MC 1L0YB 4IDIA 3Q8CA 1K50A 2DLBA 2Y5PA 3HRDD 1ZDVA 2LI5A 1FIQA 1Q5WB 3H6NA 4JL9A 5DPRA 4BVUC 2I1JA 2MW5A 3ZVVA 3WAPA 1TBEA 4IUMB 4O1NA 2BW2A 1KOTA 3IG3A 2L00B 4BKSD 2M0XA 2ACZB 2IO0B 2LXAA 1I4GA 1WXAA 2KDFB 4LK0M 3ZGZA 4II3B 2K3UA 4C00A 4YXDB 3R66C 2KDEB 4L23A 1E10A 4HJKA 4F8CB 2Z8LA 4ICUA 2BBCA 1NBFC 2MQJA 3N9YC 4QAYA 2ZVNA 2J52A 4LNOA 3H9DA 4AWJA 4JGHB 3NZUA 2J7QB 4B9KA 2JYTA 3P4PB 3OJ4B 4W9DA 2M19A 3A33B 1HQRD 5LLIA 1V5OA 4A8XC 3Q3OC 2JY6A 1IGCA 1L0VB 1OGWA 2JUOA 3ZRFA 5D7GA 4B0MA 1NI3A 1VZ6A 2GBMA 4GGQA 4EOYA 5DPSA 2KWVB 2V4LA 4HVBA 2N7EA 1V97A 3BVZA 1DOYA 5D6JB 4P16A 2EMTA 2K22A 1XD3B 3AH7A 2HJ1A 2BKRB 3TSSA 2JYEA 4AS1A 2KNBA 4XWWA 4EZKA 3Q3NC 1BT0A 3UINB 1V81A 1J7CA 4GIVA 3X23A 4ANUA 1R7SA 1FO4A 1PQSA 1BMLC 2DENB 3DBHB 2UWQA 2BYEA 3DQVA 1WXSA 3P42A 4ANXA 3CWIA 3B2GA 1QOAA 1WJUA 3ENEA 2HTHA 2AQ1B 2NPTA 4NJ7A 2FCSA 3JSVB 3ZDTA 2JVCA 3NVZA 1D5XC 1KM7A 1TS2A 2CKHB 2BYFA 1SF0A 3E9SA 4BKGA 2WXPA 4A90A 4A6QA 4HCNB 3B08A 2DWQA 3PO0A 2LGDA 2MWSB 3AV8A 1S1QB 3V6CB 4DXAB 4HPMB 1F2RC 2KN4A 3AU5A 3BINA 4C4VA 1XCQL 2PPHA 3EUB2 3BVGA 2Y5BB 2FBWB 5E6NA 2L83A 2GB1A 1QLBB 2RD0A 5G55A 5EE3A 2B3AA 4YL8A 3AM9A 3Q6BA 1WR6E 2PE6B 3MC0B 3B1LX 1CQVA 1L6VA 4K7UA 1HZ5A 2GBNA 2M1MA 4XYCA 1T3QA 2L52A 1WE7A 3UF8A 3Q8AA 2FCMA 2A4ZA 3JVZX 3R7RA 5HI1A 1TKEA 1CZPA 1VCBA 2J0KA 1RFAA 1LM8B 3AE6B 3DHIC 3NS1A 3DBRB 3QHTA 2RDGA 1E8WA 1GB4A 4OVZA 1OEYJ 1ZKHA 2MRPA 2MX2A 2ZCCA 3KW5B 4HPLB 4GLSC 2DAFA 1WGDA 2FUHB 2XBBC 3GZNI 2L3ZA 4IW0A 1FFUA 4K3CA 2EELA 2BWES 1F77A 3PVLA 2C5LC 1E90A 2G4DB 3RNCC 5CHVC 5HKHA 4M00A 3SEBA 1YN4A 3QAQA 2G1EA 3A4SC 4A20A 3UQAA 1QZEA 3PZDA 5CX3A 1T5XD 1YX5B 4GXBA 3DDCB 3WANA 2R2OA 1NENB 5E6PA 5C2TB 2PKOA 2D3CA 3ZTDA 1TYGB 1N62A 1EF5A 2KX0A 2Z0DB 1ZPSA 5D3IB 1T0RC 3ML8A 3N1ZC 1KFYB 4TKNA 1VZ7A 2MJ3A 3L10B 4W9IA 1TIFA 3VTWA 3RNAC 3T3NA 3GS2A 2MBHA 4NNJB 2AX5A 2W3SA 2R2QA 5G5HA 1SE4A 3ZRCA 2K8CA 2KJHB 3EECA 1UBIA 2IGDA 3APDA 2KLGA 2QDFA 2MA9B 1H8CA 2O2VA 2PVOD 5HFYA 2WNMA 4YWGG 1Y56A 1WF9A 2FIFA
chains in the Genus database with same CATH topology
5BYSA 2JX5A 1V1PA 2IGGA 5BMIA 1JRPA 2MJDA 1D5MC 5BMHA 3O13A 2E3TA 1RWSA 1K53A 2LUMA 2JZPA 2KMMA 3MFGA 2WS3B 4GDLB 1PUTA 3IT4B 1TS5A 2OHFA 3MJ5A 4KX6B 5HHDG 2PIAA 3WCQA 1SJHD 5MPOA 1J7BA 2WDRB 2JSVX 1ACCA 1MHXA 4RCOA 4H2AA 1XCTL 3R8BA 3V3XA 2KACA 3B2FA 2BT6A 3SFDB 2PMVA 2QJLA 5FK9C 1MI0A 2YEPB 3V05A 4KGTA 3R2IA 2V4IB 3W2DA 1C9FA 2BTEA 1SE3A 1J7AA 1AW7A 1XEEA 3Q8FA 3NZ3A 3AE7B 2PLPA 3FILA 1JWBD 1HEZE 4HRSA 4RGTA 3GB1A 1AWDA 1I4XA 1NYQA 2JU6X 3FAHA 1JWSD 2LGIA 2WU5B 5BMGA 3VQIA 4WQMA 2IGHA 1VRAB 1L5PA 1QT9A 1K52A 2XN9C 1UUPA 3NVWA 2XNAC 4GDKB 1RYJA 3U4EG 2JXTA 3W1SA 4XDDA 3HVDA 2SEBD 3BYYB 4XDCA 2WXGA 1T6BX 1I7HA 3FILB 3AEAB 1JQ4A 1AN8A 1V1PB 2JQRB 1TJEA 3EA6A 1QOFA 1QKZA 1JWUD 1UNSA 4YT0B 3Q8EA 1GB1A 5EE1A 4HKZE 5FR3A 1KF6B 4NJCA 1FNUA 4M0WA 4TQ0A 3EGRA 1YNTE 4N59A 3DWGC 2WXLA 3AE2B 4OZCA 1E0ZA 1SXTA 1UWXA 4MT5A 2LHDA 1K51A 1I4PA 1RM6C 1JWMD 2KAJA 2HTME 4NAWB 3KWLA 2QEJC 2X38A 1N61A 4JWUC 1SSNA 2LMCA 4TQ1A 4ZYSA 4WH4A 1TY0A 2GI9A 4WIPA 4L2YA 3ZJVA 1FFVA 1L4ZB 1TY2A 2B76B 1KH0A 2DBYA 3BYTB 3UI3A 4RFBA 1N5WA 1ET9A 4OHJA 1N60A 5C3JB 4FXCA 1C4PA 1C4CA 1SBBB 1NYRA 3ETRA 3U7ZA 4ITKA 1PGXA 3R2TA 3TEZA 2HDEA 2RMMA 4IOIE 2CJOA 1VLBA 3IAS1 3I57A 5BYRA 2JWUA 2ONQA 4UDUC 2AQ2B 1C79A 1Q10A 2VZKD 1ENFA 1CJEA 3P63A 1L0YB 2MH7A 4IDIA 3Q8CA 1K50A 3P4SB 2DLBA 1YQ3B 2Y5PA 1EU3A 3HRDD 2N0SB 1JMLA 1WSPA 2WP9B 2AQ3B 4N58A 3ZYYX 3Q69A 2RDHA 1ZDVA 1FIQA 2ON8A 2QMTA 4US9A 3VRBB 2W54A 4DQOC 3IT6B 1DYQA 1V8CA 1FMAD 1KLUD 1QILA 2H89B 4O1NA 2BW2A 1FXIA 2M56B 1OQQA 3AE1B 1SEBD 2WXQA 3BK2A 3RFZB 3FC4A 3URYA 2V3PA 4B0EA 2ACZB 2PVGC 4LLGM 1I4GA 1XLNA 4LK0M 3ZGZA 2K3UA 3OWEB 2INPE 4RGMA 4YXDB 1JROA 1ET6A 3AB5A 3W9CB 2ZW0A 1F2RI 3VRAB 4D2KA 4DXGA 1N63A 2I2YA 1PYWD 4L23A 1E10A 4HJGE 2DYOA 2Z8LA 3NVYA 4RGOS 1CK1A 3BVMA 3TEWA 2BBCA 1TS4A 4RF1A 2VZKB 3N9YC 3AN1A 1DGJA 1UWMA 1YN3A 3ZQ4A 2E6XA 2J52A 1ROEA 4MACA 1FD6A 1MPEA 2V0GA 1PFDA 2JYTA 1L6UA 3P4PB 5AUKA 2M19A 2WLBA 1HQRD 1PGAA 3T3OA 2LJIA 2W82A 1E9MA 3NVVA 4A8XC 1I4QA 1VDVA 1FRRA 4REZA 2OEDA 1IGCA 1L0VB 1GOZA 3C8YA 2NTTA 2WXOA 2Y5CA 5H8YE 5D7GA 1FM0D 4B0MA 2NMQA 1XLOA 1NI3A 1VZ6A 5EE9A 3AEEB 1C77A 4RNAA 2WDVB 4ZRPA 5D3DA 1B1ZA 4DXFA 1FRDA 4RH6A 3TEYA 2KQ4X 1V97A 3BVZA 2K9XA 3TUOA 4YTMB 2WDQB 1DOYA 4WWMA 3AE8B 4P16A 2H88B 2K22A 2KWDA 3Q8BA 3AH7A 4NZLB 3TSSA 2IPKD 2JYEA 1PDXA 2WQYB 4AS1A 4XWWA 5I4DA 4YTNB 4JWSC 4JX1C 1FNVA 2L32A 1PGBA 3ZJTA 1GAQB 4XWTA 1ZXIA 2GRIA 1J7CA 4OZBA 1NVID 1R7SA 3P4RB 1NEKB 4RGNA 1FXAA 1FO4A 1BMLC 1QF6A 1D4BA 3AE4B 3P42A 1F0ZA 2SAKA 3CWIA 1XLPA 3RPFC 1EWYC 2J53A 1QOGA 3I9V1 2ICIA 1M4VA 2IJ0A 1IUEA 3BK1A 4MH8A 3B2GA 4CQNA 1MVKA 1QOAA 3VR8B 5GXGB 2AQ1B 3H8HA 1E6EB 2RPVA 4YSZB 2CU3A 3AE3B 2FE8A 4IKGA 4PT5A 3AEGB 2CJNA 4WURA 1QOBA 2QSDA 1HZ6A 1BUIC 4OZAA 5TSSA 1C4AA 1WWTA 3P4QB 3BWUD 3NVZA 1D5XC 1A70A 1TS3A 1ZP0B 4XE0A 1TS2A 2WXHA 3BZDB 3KLSX 5AUIA 4ZHOA 2WXMA 1ZE3D 3MP9A 1SF0A 2M0AA 2KDMA 2Y3AA 3E9SA 4RF0A 1TZOA 3AE9B 1EM7A 1ZDXA 1WGKA 2WXPA 4A90A 4A6QA 3NRZA 2DWQA 3PO0A 4HEA1 3HVZA 3AMZA 1IBXB 1FCCC 1N5XA 4NAMA 3AV8A 1ZOYB 1JW9D 4C7YA 1F2RC 3MHZA 2N9LA 1YJIA 4R3DA 2KN4A 1YN5A 3AE5B 1XLQA 2BB5A 2EKIA 1I4HA 3PZ8A 2BS4B 2I38A 2MJEA 3VR9B 3KWVA 1XCQL 4KKJA 3U52E 3NUHB 2PTLA 4EE2A 1MHHE 3EUB2 3BVGA 1IBXA 1RFKA 3J9CA 1WRIA 3KQ4A 4JE3B 2FBWB 4YSYB 2PW9A 1DOXA 2L83A 3U2SC 4J3OD 4USAA 2GB1A 4P6VF 1QLBB 4AQ7A 1P7FA 2INNE 3IXSA 5EE3A 3SFEB 2WU2B 3AM9A 4ARIA 3MC0B 2R61A 1CQVA 1L6VA 5JXVA 4TMAB 1E7PB 1VR9A 1HZ5A 4KGSA 4JPSA 4ZRQA 1T3QA 2W55A 2L52A 4TSSA 1FEHA 2TSSA 2LFIA 3Q8AA 1YJJA 2L1AA 2YEPF 1FNWA 4LTUA 5HI1A 3AEDB 1TKEA 5H92C 2FUG1 1D5ZC 4C7ZA 5T8IA 1CZPA 3E56A 2LHEA 2IDYA 4C80A 5EE0A 3AE6B 5FKAC 1C78A 3PZ7A 2K5PA 3LXFA 3NS1A 3LYYA 2RDGA 1ESFA 3IAM1 2WXIA 3ABVB 3CIRB 4OVZA 1B9RA 1GB4A 1GPXA 3SR6A 1EWCA 3TEXA 4GLSC 1IGDA 3AEBB 1OQRA 2DYMA 1WXQA 1JWAD 1FFUA 3DWMA 2EELA 1UGJA 4KGRA 4KKIA 1P7EA 4HROA 5E6JA 4US8A 5LNK1 1F77A 1KLGD 4WAFA 1DOIA 1ZUD2 2ZW1A 1HXYD 3SEBA 1YN4A 2Q5WD 1D6EC 2WXRA 3ZJUA 2WXFA 1QQRA 2G1EA 1JALA 3GP7A 4A9AA 1EU4A 1WYGA 1SJED 2WXNA 1KRHA 1OFFA 4YTPB 1T5XD 1XF5L 1AYFA 2BS3B 1NENB 5G5GA 2BS2B 2G9HD 3W5UB 5C2TB 2J42A 2PKOA 1C76A 2LEKA 2N7JA 3AEFB 2D5GA 2BB6A 2QILA 2W3RA 1TYGB 4ARCA 2N9KA 1N62A 4ZOHC 4HKQA 3LB8C 1ZPSA 3HUIA 1VJKA 5D3IB 1V1OA 2K0PA 4L1BA 3W5VB 5BYQA 1SB3C 3AECB 4YSXB 2BYTA 1SIJA 4A55A 1TKYA 1KFYB 1VZ7A 2MJ3A 4Q2JA 1VZ8A 3L4PA 1YMHE 2MEKA 2NTSA 2WXJA 1FCLA 1XO3A 3T3NA 4MM3B 4OW0A 1BXTA 2J4XA 3GS2A 1L0XB 1SE2A 4C56C 4ZHPA 1L4DB 2AX5A 2W3SA 1I4RA 1KTKA 5G5HA 2WXKA 1SE4A 3BIID 4N6EB 5HG2A 3B9JA 2V3NA 1ZXHA 2IGDA 2QIEB 1TKGA 1HA5A 1YQ4B 3P1MA 1JCKB 2PVOD 5HFYA 1STEA 2WNMA 4YWGG 1XXGA 1Y56A 1LO5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IGG A;  5BMI A;  5BMH A;  2KWD A;  2JWU A;  2ONQ A;  1Q10 A;  1K53 A;  2LUM A;  1K50 A;  2JZP A;  5HI1 A;  1PGB A;  1JML A;  2LHE A;  5HHD G;  4OZB A;  2ON8 A;  2JSV X;  2QMT A;  1MHX A;  1XCT L;  3V3X A;  1GB4 A;  2KAC A;  1D4B A;  1MI0 A;  4GLS C;  1IGD A;  2J53 A;  4KGT A;  1C9F A;  1MVK A;  2EEL A;  2RPV A;  4KGR A;  1P7E A;  2PLP A;  4IKG A;  3FIL A;  1HEZ E;  2QSD A;  1HZ6 A;  3GB1 A;  4OZA A;  2JU6 X;  2ZW1 A;  2LGI A;  5BMG A;  2IGH A;  2ZW0 A;  1F2R I;  1K52 A;  2JXT A;  4D2K A;  2I2Y A;  3MP9 A;  2KDM A;  4HJG E;  1XF5 L;  1EM7 A;  3FIL B;  1QKZ A;  1IBX B;  2N7J A;  1FCC C;  1GB1 A;  2N9K A;  4HKZ E;  1F2R C;  2J52 A;  2N9L A;  4MAC A;  1FD6 A;  1YNT E;  1MPE A;  2KN4 A;  2K0P A;  2I38 A;  4OZC A;  1XCQ L;  1UWX A;  4IOI E;  2LHD A;  2PTL A;  1K51 A;  1MHH E;  1IBX A;  1PGA A;  1YMH E;  2PW9 A;  1FCL A;  2GB1 A;  1IGC A;  2OED A;  4WH4 A;  1P7F A;  2GI9 A;  5HG2 A;  2NMQ A;  1KH0 A;  3UI3 A;  1ZXH A;  2IGD A;  5JXV A;  5HFY A;  1PGX A;  1HZ5 A;  2KQ4 X;  2RMM A;  4KGS A; 
#chains in the Genus database with same CATH topology
 5BYS A;  2BKF A;  1V1P A;  5BMI A;  1D5M C;  2LRW A;  2KHW B;  4JLC A;  4AOF A;  1EO6 A;  4JIO U;  3UQB A;  2KMM A;  1PUT A;  3DBS A;  2BPS A;  1WJ6 A;  4P1B C;  3R7Q A;  5HHD G;  3WCQ A;  5MPO A;  1SJH D;  2QC8 A;  1C1Y B;  4LDT B;  3R8B A;  3B2F A;  2LUE A;  3V05 A;  2PJH A;  1TGZ B;  3Q8F A;  2NBU A;  4FBJ B;  1JWB D;  4HRS A;  3GB1 A;  1I4X A;  1JWS D;  2LGI A;  2WU5 B;  3VQI A;  2AL6 A;  2G4S A;  1D3Z A;  1QT9 A;  4GDK B;  2KQS A;  3ZLZ A;  3BYY B;  4XDC A;  4PK1 A;  4XC2 A;  2KFK B;  3AEA B;  1JQ4 A;  5IA7 A;  2FNJ B;  4W9L A;  4MSQ B;  2AL3 A;  3JYU A;  2KDB A;  3N32 A;  4HKZ E;  2LVO A;  4NJC A;  2DAJ A;  3AI5 A;  4M0W A;  4TQ0 A;  3CST A;  2MBE A;  2JRI B;  2PEA A;  1SXT A;  3PSE B;  1UWX A;  3QCA A;  2BGF A;  2LHD A;  4II2 B;  3PHW B;  1RM6 C;  3IBE A;  2D11 A;  2QEJ C;  3NZS A;  1P1A A;  4JWU C;  3NS8 A;  4ZYS A;  1TY0 A;  4LCD E;  3ZJV A;  2OJR A;  4LJO B;  1FFV A;  1TY2 A;  2DBY A;  3UI3 A;  4OHJ A;  3M63 B;  1C4C A;  3ETR A;  3MHS D;  3O65 B;  1EUV B;  1PGX A;  3TEZ A;  4FAD A;  2CJO A;  1VLB A;  5KHQ A;  3I57 A;  4F1S A;  1Q1O A;  5BYR A;  2JWU A;  3WAL A;  3GE3 C;  1Z5S B;  3PLU A;  3P63 A;  4W9K A;  3TJP A;  3VXW A;  2MH7 A;  3V62 A;  2ZCB A;  4NQK E;  4TUU A;  1YQ3 B;  4JQW C;  1JML A;  4N58 A;  1ZGU B;  2RDH A;  3APF A;  2MBB B;  1S3S G;  2K1F A;  4G50 A;  5J17 A;  3KVF B;  1KLU D;  2H89 B;  5C23 A;  3KUC B;  2ZPN A;  5L83 A;  3BK2 A;  1GUA B;  3URY A;  4ZDV A;  4MDK E;  4LLG M;  1XLN A;  4XZ4 A;  2RR9 A;  3OWE B;  4RGM A;  1JRO A;  3L08 A;  4EZJ A;  4ICV A;  4DXG A;  1N63 A;  4B6W A;  2DYO A;  3QAR A;  4RGO S;  3BVM A;  1TS4 A;  3VTV A;  2KK8 A;  2VZK B;  1LGR A;  1YN3 A;  3ZQ4 A;  2KZR A;  2AYO B;  4IC7 B;  3DVG X;  4BOZ B;  1GC6 A;  2HE7 A;  2KLC A;  2N1W A;  3L13 A;  3MC9 A;  3L54 A;  1L6U A;  5AUK A;  3RCZ A;  4MJS B;  2LJI A;  3T3O A;  2IO2 B;  4GDK A;  1E9M A;  3NVV A;  2KN5 A;  4REZ A;  2OED A;  1GOZ A;  1WXV A;  3VUW A;  4W9C A;  4HK2 A;  4FA6 A;  1XLO A;  5EE9 A;  1UGM A;  4ZRP A;  3PRP B;  1B1Z A;  4XGA B;  4S0R A;  1FRD A;  2L76 A;  4RH6 A;  3TEY A;  2KQ4 X;  5CHF A;  2K9X A;  3TUO A;  4WWM A;  1YOV B;  2H88 B;  2KWD A;  3VHT C;  5E6O A;  2FCQ A;  4KIK A;  1WM2 A;  3QK0 A;  5AZG A;  5I4D A;  4YTN B;  4JWS C;  2L32 A;  3SD5 A;  4EUT A;  3ZJT A;  1T0S C;  1ZXI A;  2GRI A;  3ZKJ C;  2JF5 A;  3I5J C;  4TV3 A;  1FXA A;  3OAW A;  2LGX A;  3U30 A;  3I63 C;  4MGK E;  1EWY C;  2L05 A;  2J53 A;  3PS6 A;  3MTN B;  4MH8 A;  1M4V A;  5G2N A;  4CQN A;  2G3Q B;  2KWC A;  1P98 A;  5GXG B;  3H8H A;  3TIX A;  4GN1 A;  2CU3 A;  4IKG A;  4WUR A;  3WAM A;  1QOB A;  1UH6 A;  5EDS A;  5TSS A;  3M3J A;  3P4Q B;  4XX5 A;  2MCN B;  3N30 A;  1A70 A;  1TS3 A;  1ZP0 B;  2MSE D;  2RPQ A;  2VH1 A;  3PGE A;  4XE0 A;  3QC8 B;  3BZD B;  3KLS X;  1ZE3 D;  3MP9 A;  2KDM A;  3AE9 B;  1EM7 A;  2D3B A;  1WGK A;  4E71 A;  3NRZ A;  2JWZ A;  4BKT A;  4HEA 1;  1N5X A;  2CR5 A;  2CHX A;  1ZOY B;  3IFW B;  1WXM A;  3VFK A;  1YJI A;  4IWQ A;  3PZ8 A;  2BS4 B;  2MJE A;  3VR9 B;  4KKJ A;  3NUH B;  1MHH E;  1IBX A;  1RFK A;  2LVP A;  4AQ7 A;  3QX1 A;  4E3C A;  2WU2 B;  4ARI A;  3C19 A;  3ZIM A;  2Z0E B;  4DDI D;  5JXV A;  5JZE B;  4DHZ E;  3HHM A;  1MG8 A;  4DK5 A;  2KC2 A;  2NVU I;  2W55 A;  1WMH A;  4OVV A;  4TSS A;  1FEH A;  3NJT A;  3SHQ A;  5CTR C;  3K9P B;  4WAA A;  1RAX A;  2KFK A;  5T8I A;  2N9X A;  3ML9 A;  3RUI B;  4C80 A;  4S17 A;  2K5P A;  3RNG C;  3LYY A;  2J0M A;  1B9R A;  4M01 A;  4IM0 A;  5IOI A;  1J0G A;  1GPX A;  2IO1 B;  1OQR A;  2DYM A;  1WXQ A;  4KKI A;  4KGR A;  1P7E A;  1WH3 A;  2WYQ A;  4HRO A;  5E6J A;  1K8R B;  1E8Z A;  1KLG D;  4WAF A;  1DOI A;  1V5T A;  1ZUD 2;  2MBQ A;  1HXY D;  2Q5W D;  2WXR A;  3S2A A;  3ZXV A;  5BO4 B;  3ZJU A;  2RGF A;  1JAL A;  3GP7 A;  4A9A A;  1EU4 A;  3DPD A;  1KRH A;  3HM3 A;  3PPA A;  1AYF A;  2BS3 B;  2XK5 B;  3HK0 A;  2J42 A;  4A3O A;  4G11 A;  4A3P A;  1C76 A;  3AEF B;  5AZF A;  2ZVO A;  2Z59 B;  1NDD A;  2QIL A;  3PHX B;  4ZOH C;  1WI0 A;  2WGS A;  2K6D B;  2KTR A;  2OOB B;  1V1O A;  2K0P A;  1IYF A;  1JRU A;  1Q0W B;  1SB3 C;  2BYT A;  4YSX B;  1SIJ A;  2LXC A;  1TKY A;  1E8Y A;  4PYZ A;  1V86 A;  2RDB C;  3L4P A;  1FCL A;  2NBW B;  4OW0 A;  3LJ3 A;  1BXT A;  4ZHP A;  1E8X A;  1WZ3 A;  1KTK A;  2WXK A;  5D94 A;  3B9J A;  2QIE B;  1HA5 A;  2EKE C;  1JCK B;  1WFY A;  2HJ8 A;  1XXG A;  2DX5 B;  2JX5 A;  3DBL I;  4IWP A;  2MJD A;  2KDI A;  3O13 A;  2E3T A;  4IM3 A;  1RWS A;  3ZO5 B;  5FR6 A;  2REX A;  2L8J A;  2JZP A;  3IT4 B;  2OHF A;  3Q2A C;  4KX6 B;  3N20 C;  1UZX B;  2WDT B;  1ACC A;  1WZ0 A;  1MHX A;  2LGS A;  4W9J A;  4H2A A;  5LXI B;  2BT6 A;  4KSK C;  2L0F A;  2PMV A;  4PYU A;  4DHZ B;  2FID A;  4J6I A;  4HWI B;  4EEW A;  4KGT A;  2MP2 B;  3W2D A;  4MJS A;  2BTE A;  4DHJ D;  3KH0 A;  4WWO A;  2O6V B;  4K81 A;  2O6V D;  2KJ6 A;  3H7P B;  1YIW A;  2BQQ A;  1VRA B;  1L2N A;  2XN9 C;  5C1Z A;  2JXT A;  4FN2 A;  4BFR A;  3HVD A;  2SEB D;  4NY0 A;  5L95 C;  2NR2 A;  1T6B X;  1I7H A;  3W1Y A;  2BVC A;  1QOF A;  1WX8 A;  1JWU D;  3RNE C;  5LXH A;  3A9J B;  1FNU A;  1Y8R C;  3EGR A;  4CO7 A;  1TT5 B;  3UGB B;  4OZC A;  2BWF A;  3C0R B;  3GE8 C;  2C7M B;  4MT5 A;  3CF6 E;  2KXJ A;  1K51 A;  2MLB A;  1JWM D;  2JXX A;  4GDL A;  2X38 A;  1N61 A;  1SSN A;  4TQ1 A;  4WH4 A;  2DYB A;  2DZK A;  2NS5 A;  1KH0 A;  2JPH A;  1P9D U;  4RFB A;  2N9E B;  1ET9 A;  4FXC A;  4CYE A;  1C4P A;  3DCG A;  1SBB B;  2OJW A;  3A1Q A;  4ITK A;  3R2T A;  2HDE A;  4N9F 4;  5J2R A;  2LRU A;  2KVZ A;  4UDU C;  5IP4 D;  1Q10 A;  4PS3 A;  3TBL D;  1ENF A;  1CJE A;  3M62 B;  1WGR A;  3RUL A;  2N0S B;  1WSP A;  4CHK A;  3ZYY X;  3Q69 A;  5IAA C;  5J18 A;  2QMT A;  3RT3 B;  3VRB B;  4DQO C;  3IT6 B;  1DYQ A;  4ANW A;  4HDO A;  1QIL A;  3V6E B;  4F7Z A;  1FXI A;  2M56 B;  2NPT B;  3DOW A;  3RZF A;  1IPG A;  2K8H A;  3AE1 B;  3OLM D;  2YVC A;  1WYW B;  1SEB D;  3RFZ B;  3FC4 A;  4B0E A;  2PVG C;  3N3K B;  1P0R A;  2ZJD A;  3R3M A;  3WIM A;  2I1K A;  3MJW A;  1F2R I;  4WWP A;  2CHW A;  3VRA B;  4D2K A;  2I2Y A;  5JHB A;  1PYW D;  3DBL B;  2PE9 A;  3NVY A;  3L17 A;  1CK1 A;  1WJ4 A;  1MJD A;  4M8M A;  3NG0 A;  1T0Q C;  4RF1 A;  2V1Y A;  3AN1 A;  1N6Z A;  1DGJ A;  2E6X A;  4G3X B;  4MAC A;  1FD6 A;  3QWZ B;  1MPE A;  2DNF A;  2CU1 A;  2ZNV C;  5DPT A;  1LQB A;  3UIO B;  2V0G A;  1PFD A;  2DZI A;  3RNB C;  3H7P A;  1Z2M A;  2WHI A;  1WGY A;  2W82 A;  3ZNI D;  2DZJ A;  1VDV A;  3C8Y A;  2IY0 B;  2GBJ A;  2NTT A;  2WXO A;  2Y5C A;  4B95 A;  2LVQ A;  3M95 A;  2L7R A;  1FM0 D;  2NMQ A;  1XQQ A;  3APC A;  3AEE B;  3L16 A;  4RNA A;  2LAS A;  4LNK A;  5D3D A;  4DXF A;  2IBI B;  4YTM B;  3A1Q B;  4EZL A;  3EFU A;  1T0Y A;  3Q8B A;  3IHP C;  4NZL B;  1PDX A;  2WQY B;  4JX1 C;  4PS8 A;  2KD0 A;  4K3B A;  2MP2 A;  4RMA A;  2NCN A;  4BZA A;  4OZB A;  1NVI D;  4MH0 E;  3P4R B;  1RLF A;  2JRH A;  1D4B A;  4NAW A;  2SAK A;  3VTU A;  1XLP A;  3RPF C;  4W9F A;  4KZ0 A;  4IG7 B;  2ICI A;  4M8N A;  3VR8 B;  2FE8 A;  1HZ6 A;  1BUI C;  2KTF A;  4OZA A;  2V9H A;  3BWU D;  4WQO B;  2INC C;  2WXH A;  1G6J A;  2KMA A;  5AUI A;  3VUY A;  1R4M B;  2WXM A;  2M0A A;  2Y3A A;  3H7S A;  5TR5 A;  1TZO A;  1OQY A;  2GMI C;  2KMC A;  4MEL A;  2MBO A;  3HVZ A;  1FCC C;  3RYT A;  4NAM A;  2C7N B;  3TL5 A;  1C3T A;  2D10 A;  4ZRI A;  1YN5 A;  1XLQ A;  4WJQ A;  3KWV A;  4WWN A;  4LJP B;  2A5U A;  2PTL A;  4EE2 A;  2DZM A;  1R4M I;  3DVN V;  3V60 A;  2X8X X;  3J9C A;  3ZXR A;  4JE3 B;  2PW9 A;  1LXD A;  3U2S C;  4J3O D;  4USA A;  2IND C;  4IM2 A;  1P7F A;  3N1X C;  3IXS A;  4ASW C;  2O2V B;  3KUZ A;  4TMA B;  1E7P B;  3B0A A;  4KGS A;  4JPS A;  1YJ1 A;  2TSS A;  2KAN A;  2LFI A;  1YJJ A;  2D3G A;  2L1A A;  2YEP F;  4LTU A;  2ZEQ A;  2LWP A;  1HTO A;  3W1S C;  3RMK C;  3DVG Y;  3E56 A;  1WRD B;  1UEL A;  1C78 A;  3A9J A;  3LXF A;  3KUD B;  4KV2 A;  3RI7 C;  2WXI A;  3CIR B;  4FJV B;  1EWC A;  5GMV A;  3AEB B;  3CSF A;  3RZW C;  4HPP A;  2C9W B;  1JWA D;  3ONS A;  3DWM A;  1UGJ A;  4W9H A;  1D6E C;  4IWO A;  1WR1 A;  1CMX B;  1ISN A;  2LD9 A;  4GSW A;  1GNU A;  1WYG A;  3QA8 A;  3ZNZ B;  1SJE D;  2WX1 A;  4YTP B;  2G9H D;  1WGH A;  4PS7 A;  2LEK A;  2MHJ A;  2BB6 A;  4ZRJ A;  4ARC A;  3AXC A;  4HKQ A;  2LGY A;  2GLS A;  3HUI A;  4L1B A;  3W5V B;  5BYQ A;  3TCA A;  4NPN A;  3LDZ E;  3BY4 B;  1YMH E;  2KYW A;  3WAO A;  4MM3 B;  2RSU A;  4W9G A;  4C56 C;  1L4D B;  4AP4 C;  1I4R A;  4FJZ A;  3BII D;  4HXD A;  2V3N A;  3A9K B;  2KO3 A;  1YQ4 B;  3P1M A;  2C7H A;  1STE A;  4P7I A;  3SU8 X;  1L7Y A;  2IGG A;  2L0T A;  1SIF A;  5BMH A;  1K53 A;  2LUM A;  2XEW A;  3SDL C;  2CHZ A;  2N1V A;  3MFG A;  2WWZ A;  4GDL B;  2EMS A;  1TTN A;  2PIA A;  4ZRK A;  1J7B A;  2WDR B;  1VD2 A;  1LFD A;  2JSV X;  4EKU A;  4RCO A;  4I6P A;  3FKY A;  1XCT L;  3L0W B;  3V3X A;  2KAC A;  3SFD B;  2N7D A;  2QJL A;  4HCP B;  3K9O B;  5AEK B;  2V4I B;  1SE3 A;  1J7A A;  1XEE A;  4DWF A;  3FIL A;  4OVU A;  1YX6 B;  1HEZ E;  2BF8 B;  3ZUN A;  4RGT A;  1NYQ A;  3FAH A;  4WJN A;  2IGH A;  2J0J A;  1UUP A;  3U4E G;  1RYJ A;  2JT4 B;  3NY5 A;  3W1S A;  4XDD A;  2C60 A;  1OEY A;  2WXG A;  3T8M A;  3FIL B;  3P2B A;  1YD8 U;  1AN8 A;  4W9E A;  4AJY B;  1GB1 A;  3Q8E A;  4MGY E;  3ALB A;  4NQL B;  2GOW A;  1YNT E;  4N59 A;  1KLV A;  5D2M B;  3RD2 A;  3DWG C;  2WXL A;  1E0Z A;  3ECI A;  5AZH A;  1I4P A;  2HTM E;  4NAW B;  2QHO A;  2LMC A;  1I42 A;  1WX9 A;  4L2Y A;  2B76 B;  3KYC D;  1UD7 A;  2VH2 A;  1UF0 A;  5C3J B;  1N5W A;  2O6V A;  3U7Z A;  3DVN U;  2M8S A;  1X1M A;  2XK5 A;  3A9K A;  4IOI E;  4BAX A;  3X0W A;  3IAS 1;  2ONQ A;  2AQ2 B;  2D07 B;  2IY1 B;  4KVG B;  4RM9 A;  3P4S B;  1KJT A;  1EU3 A;  2WP9 B;  2AQ3 B;  2YLM A;  4LNN A;  1SE9 A;  3AU4 A;  2ON8 A;  2N9P C;  4US9 A;  2W54 A;  2K6Q A;  2D3A A;  1V8C A;  1FMA D;  3VAW A;  2K8B A;  1OQQ A;  2WXQ A;  2CS4 A;  2V3P A;  2K25 A;  3HIZ A;  1MFW A;  5IKC M;  2INP E;  4LNI A;  1ET6 A;  3AB5 A;  3W9C B;  2ZW0 A;  5IN7 A;  3JW0 X;  2IO3 B;  3PTF C;  3NOB A;  4HJG E;  4FHJ A;  4EFO A;  1FXT B;  3TEW A;  3T9L A;  2UYZ B;  3NHE B;  1UWM A;  2KT7 A;  3Q3J A;  4GOC A;  5DPW A;  1ROE A;  4FHK A;  1M94 A;  3CMM B;  4M0W B;  3VH3 B;  3A4R A;  2LJ5 A;  5CHW A;  1NI2 A;  4KZC A;  2WLB A;  2ZNV B;  1PGA A;  3PLV A;  4DDG D;  1FRR A;  4FJY A;  1WE6 A;  4LDT D;  5H8Y E;  5JH5 C;  3MC8 A;  2KJR A;  1C77 A;  2DHZ A;  2WDV B;  4I6L B;  1E7V A;  3PRE A;  3EC8 A;  4LNF A;  1WY8 A;  2WDQ B;  3AE8 B;  1R4N B;  4HDQ A;  4URK A;  2IPK D;  1FNV A;  1PGB A;  1V6E A;  3OJ3 A;  1GAQ B;  4NJ6 A;  4XWT A;  4MSM B;  4AJW A;  1NEK B;  4RGN A;  3PRZ A;  1QF6 A;  3AE4 B;  1FPY A;  3QJZ A;  1F0Z A;  1R4N I;  3PV1 A;  1QOG A;  3I9V 1;  2IJ0 A;  1IUE A;  3BK1 A;  1MVK A;  2VRR B;  2D2Q A;  1E6E B;  2KKC A;  2RPV A;  4YSZ B;  3AE3 B;  4PT5 A;  3AEG B;  2CJN A;  2QSD A;  1C4A A;  1WWT A;  3AUL A;  2KC1 A;  1OTR B;  4ZHO A;  4K7W A;  4RF0 A;  1ZDX A;  2KWU B;  2KVR A;  2KQ7 A;  4RM8 A;  3QIJ A;  3AMZ A;  1IBX B;  1WIA A;  2KX3 A;  1JW9 D;  4C7Y A;  4BKS A;  3MHZ A;  2N9L A;  4R3D A;  2AEH A;  3AE5 B;  2W9N A;  2BB5 A;  2EKI A;  3GOE A;  1I4H A;  3H1U A;  2I38 A;  4BBN C;  3U52 E;  2NBV B;  1I35 A;  1J8C A;  1WRI A;  3KQ4 A;  4YSY B;  3I3T B;  5IO9 A;  1DOX A;  3V61 A;  4P6V F;  4M02 A;  1GJZ A;  2INN E;  4K1R B;  4DBG A;  4KDI C;  3SFE B;  1TZ1 A;  2R61 A;  3JSV A;  2M4N A;  2KFJ A;  2M17 A;  4KSL C;  4GMV A;  3ZNG C;  1WX7 A;  1VR9 A;  4BBN F;  3U8Z A;  2FCN A;  4ZRQ A;  3TMP B;  2ZPY A;  1F9J A;  3GZN B;  1V49 A;  1FNW A;  3AED B;  5H92 C;  2FUG 1;  1D5Z C;  4C7Z A;  5KHO A;  2LHE A;  2IDY A;  5EE0 A;  5FKA C;  1V80 A;  3PZ7 A;  3IVF A;  3DBR I;  2ASQ A;  1XT9 B;  2V3S A;  3EHV A;  2ZZP B;  1ESF A;  3IAM 1;  3ABV B;  3SR6 A;  3TEX A;  2AWT A;  1IGD A;  2N4F A;  4ACF A;  3N1Y C;  2IYD B;  1EF1 A;  1A5R A;  4US8 A;  3VDZ A;  5LNK 1;  4KIK B;  4P1C C;  2ZW1 A;  2BYV E;  2WXF A;  1QQR A;  4WJP A;  5JHA A;  2WXN A;  1OFF A;  1XF5 L;  3D32 A;  1P3Q U;  5G5G A;  2BS2 B;  1ZW7 A;  3W5U B;  4E74 A;  2N7J A;  2D5G A;  2W3R A;  2N9K A;  1YQB A;  1GC7 A;  4MGI E;  2WX0 A;  3LB8 C;  4C4V B;  2GBR A;  3HM6 X;  1VJK A;  1SGH A;  2G45 B;  3AEC B;  4AUQ C;  4A55 A;  2FAZ A;  4Q2J A;  1VZ8 A;  4GB9 A;  2MEK A;  2NTS A;  3VUX A;  2WXJ A;  2QCZ A;  3DHH C;  1XO3 A;  1H4R A;  2J4X A;  2HD5 B;  1L0X B;  1SE2 A;  2KTR B;  2LZ6 A;  1IP9 A;  5HG2 A;  4N6E B;  1WM3 A;  4BOS C;  1ZXH A;  1TKG A;  3PT2 B;  2JZZ A;  1I4Q A;  1LO5 D;  4WJO A;  3VVW B;  1JRP A;  1U4A A;  3KYD D;  2WS3 B;  1WGG A;  1TS5 A;  3VH4 B;  1HTQ A;  3MJ5 A;  2UU7 A;  4K7S A;  4DHJ B;  1E5W A;  4X57 B;  3ZNH B;  2K39 A;  3WA0 A;  4MGZ E;  4I6N B;  3RN9 C;  5FK9 C;  1MI0 A;  1V2Y A;  1RRB A;  2YEP B;  3ZTC A;  1WJN A;  3R2I A;  1C9F A;  1AW7 A;  3U7D A;  3DHG C;  1WMH B;  3NZ3 A;  3AE7 B;  2PLP A;  4MM3 A;  3Q14 C;  4HLE A;  1AWD A;  2JU6 X;  5BMG A;  2IZV B;  1GG3 A;  4WQM A;  1MG4 A;  1F1H A;  1J19 A;  1L5P A;  1K52 A;  3NVW A;  2XNA C;  1F52 A;  1AAR A;  3OG5 A;  4ZYN A;  2JZ3 B;  2GBK A;  1V1P B;  2JQR B;  1TJE A;  3EA6 A;  1QKZ A;  1UNS A;  4FLH A;  4YT0 B;  5EE1 A;  5FR3 A;  1KF6 B;  1HE8 A;  1V9J A;  3ZW3 A;  3AE2 B;  3ZDM C;  3UIP B;  3DBH I;  2KAJ A;  3KWL A;  3PRM B;  4ANV A;  2GI9 A;  4WIP A;  5DCN A;  4KDL B;  1L4Z B;  4FUL A;  4GU2 A;  3BYT B;  3EFC A;  4G0N B;  1N60 A;  3Q3F A;  1NYR A;  3RNF C;  1UBQ A;  4MEM A;  2RMM A;  2KOX A;  1E7U A;  3QQ8 B;  1C79 A;  2VZK D;  3Q3M C;  1L0Y B;  4IDI A;  3Q8C A;  1K50 A;  2DLB A;  2Y5P A;  3HRD D;  1ZDV A;  2LI5 A;  1FIQ A;  1Q5W B;  3H6N A;  4JL9 A;  5DPR A;  4BVU C;  2I1J A;  2MW5 A;  3ZVV A;  3WAP A;  1TBE A;  4IUM B;  4O1N A;  2BW2 A;  1KOT A;  3IG3 A;  2L00 B;  4BKS D;  2M0X A;  2ACZ B;  2IO0 B;  2LXA A;  1I4G A;  1WXA A;  2KDF B;  4LK0 M;  3ZGZ A;  4II3 B;  2K3U A;  4C00 A;  4YXD B;  3R66 C;  2KDE B;  4L23 A;  1E10 A;  4HJK A;  4F8C B;  2Z8L A;  4ICU A;  2BBC A;  1NBF C;  2MQJ A;  3N9Y C;  4QAY A;  2ZVN A;  2J52 A;  4LNO A;  3H9D A;  4AWJ A;  4JGH B;  3NZU A;  2J7Q B;  4B9K A;  2JYT A;  3P4P B;  3OJ4 B;  4W9D A;  2M19 A;  3A33 B;  1HQR D;  5LLI A;  1V5O A;  4A8X C;  3Q3O C;  2JY6 A;  1IGC A;  1L0V B;  1OGW A;  2JUO A;  3ZRF A;  5D7G A;  4B0M A;  1NI3 A;  1VZ6 A;  2GBM A;  4GGQ A;  4EOY A;  5DPS A;  2KWV B;  2V4L A;  4HVB A;  2N7E A;  1V97 A;  3BVZ A;  1DOY A;  5D6J B;  4P16 A;  2EMT A;  2K22 A;  1XD3 B;  3AH7 A;  2HJ1 A;  2BKR B;  3TSS A;  2JYE A;  4AS1 A;  2KNB A;  4XWW A;  4EZK A;  3Q3N C;  1BT0 A;  3UIN B;  1V81 A;  1J7C A;  4GIV A;  3X23 A;  4ANU A;  1R7S A;  1FO4 A;  1PQS A;  1BML C;  2DEN B;  3DBH B;  2UWQ A;  2BYE A;  3DQV A;  1WXS A;  3P42 A;  4ANX A;  3CWI A;  3B2G A;  1QOA A;  1WJU A;  3ENE A;  2HTH A;  2AQ1 B;  2NPT A;  4NJ7 A;  2FCS A;  3JSV B;  3ZDT A;  2JVC A;  3NVZ A;  1D5X C;  1KM7 A;  1TS2 A;  2CKH B;  2BYF A;  1SF0 A;  3E9S A;  4BKG A;  2WXP A;  4A90 A;  4A6Q A;  4HCN B;  3B08 A;  2DWQ A;  3PO0 A;  2LGD A;  2MWS B;  3AV8 A;  1S1Q B;  3V6C B;  4DXA B;  4HPM B;  1F2R C;  2KN4 A;  3AU5 A;  3BIN A;  4C4V A;  1XCQ L;  2PPH A;  3EUB 2;  3BVG A;  2Y5B B;  2FBW B;  5E6N A;  2L83 A;  2GB1 A;  1QLB B;  2RD0 A;  5G55 A;  5EE3 A;  2B3A A;  4YL8 A;  3AM9 A;  3Q6B A;  1WR6 E;  2PE6 B;  3MC0 B;  3B1L X;  1CQV A;  1L6V A;  4K7U A;  1HZ5 A;  2GBN A;  2M1M A;  4XYC A;  1T3Q A;  2L52 A;  1WE7 A;  3UF8 A;  3Q8A A;  2FCM A;  2A4Z A;  3JVZ X;  3R7R A;  5HI1 A;  1TKE A;  1CZP A;  1VCB A;  2J0K A;  1RFA A;  1LM8 B;  3AE6 B;  3DHI C;  3NS1 A;  3DBR B;  3QHT A;  2RDG A;  1E8W A;  1GB4 A;  4OVZ A;  1OEY J;  1ZKH A;  2MRP A;  2MX2 A;  2ZCC A;  3KW5 B;  4HPL B;  4GLS C;  2DAF A;  1WGD A;  2FUH B;  2XBB C;  3GZN I;  2L3Z A;  4IW0 A;  1FFU A;  4K3C A;  2EEL A;  2BWE S;  1F77 A;  3PVL A;  2C5L C;  1E90 A;  2G4D B;  3RNC C;  5CHV C;  5HKH A;  4M00 A;  3SEB A;  1YN4 A;  3QAQ A;  2G1E A;  3A4S C;  4A20 A;  3UQA A;  1QZE A;  3PZD A;  5CX3 A;  1T5X D;  1YX5 B;  4GXB A;  3DDC B;  3WAN A;  2R2O A;  1NEN B;  5E6P A;  5C2T B;  2PKO A;  2D3C A;  3ZTD A;  1TYG B;  1N62 A;  1EF5 A;  2KX0 A;  2Z0D B;  1ZPS A;  5D3I B;  1T0R C;  3ML8 A;  3N1Z C;  1KFY B;  4TKN A;  1VZ7 A;  2MJ3 A;  3L10 B;  4W9I A;  1TIF A;  3VTW A;  3RNA C;  3T3N A;  3GS2 A;  2MBH A;  4NNJ B;  2AX5 A;  2W3S A;  2R2Q A;  5G5H A;  1SE4 A;  3ZRC A;  2K8C A;  2KJH B;  3EEC A;  1UBI A;  2IGD A;  3APD A;  2KLG A;  2QDF A;  2MA9 B;  1H8C A;  2O2V A;  2PVO D;  5HFY A;  2WNM A;  4YWG G;  1Y56 A;  1WF9 A;  2FIF A; 
#chains in the Genus database with same CATH homology
 5BYS A;  2JX5 A;  1V1P A;  2IGG A;  5BMI A;  1JRP A;  2MJD A;  1D5M C;  5BMH A;  3O13 A;  2E3T A;  1RWS A;  1K53 A;  2LUM A;  2JZP A;  2KMM A;  3MFG A;  2WS3 B;  4GDL B;  1PUT A;  3IT4 B;  1TS5 A;  2OHF A;  3MJ5 A;  4KX6 B;  5HHD G;  2PIA A;  3WCQ A;  1SJH D;  5MPO A;  1J7B A;  2WDR B;  2JSV X;  1ACC A;  1MHX A;  4RCO A;  4H2A A;  1XCT L;  3R8B A;  3V3X A;  2KAC A;  3B2F A;  2BT6 A;  3SFD B;  2PMV A;  2QJL A;  5FK9 C;  1MI0 A;  2YEP B;  3V05 A;  4KGT A;  3R2I A;  2V4I B;  3W2D A;  1C9F A;  2BTE A;  1SE3 A;  1J7A A;  1AW7 A;  1XEE A;  3Q8F A;  3NZ3 A;  3AE7 B;  2PLP A;  3FIL A;  1JWB D;  1HEZ E;  4HRS A;  4RGT A;  3GB1 A;  1AWD A;  1I4X A;  1NYQ A;  2JU6 X;  3FAH A;  1JWS D;  2LGI A;  2WU5 B;  5BMG A;  3VQI A;  4WQM A;  2IGH A;  1VRA B;  1L5P A;  1QT9 A;  1K52 A;  2XN9 C;  1UUP A;  3NVW A;  2XNA C;  4GDK B;  1RYJ A;  3U4E G;  2JXT A;  3W1S A;  4XDD A;  3HVD A;  2SEB D;  3BYY B;  4XDC A;  2WXG A;  1T6B X;  1I7H A;  3FIL B;  3AEA B;  1JQ4 A;  1AN8 A;  1V1P B;  2JQR B;  1TJE A;  3EA6 A;  1QOF A;  1QKZ A;  1JWU D;  1UNS A;  4YT0 B;  3Q8E A;  1GB1 A;  5EE1 A;  4HKZ E;  5FR3 A;  1KF6 B;  4NJC A;  1FNU A;  4M0W A;  4TQ0 A;  3EGR A;  1YNT E;  4N59 A;  3DWG C;  2WXL A;  3AE2 B;  4OZC A;  1E0Z A;  1SXT A;  1UWX A;  4MT5 A;  2LHD A;  1K51 A;  1I4P A;  1RM6 C;  1JWM D;  2KAJ A;  2HTM E;  4NAW B;  3KWL A;  2QEJ C;  2X38 A;  1N61 A;  4JWU C;  1SSN A;  2LMC A;  4TQ1 A;  4ZYS A;  4WH4 A;  1TY0 A;  2GI9 A;  4WIP A;  4L2Y A;  3ZJV A;  1FFV A;  1L4Z B;  1TY2 A;  2B76 B;  1KH0 A;  2DBY A;  3BYT B;  3UI3 A;  4RFB A;  1N5W A;  1ET9 A;  4OHJ A;  1N60 A;  5C3J B;  4FXC A;  1C4P A;  1C4C A;  1SBB B;  1NYR A;  3ETR A;  3U7Z A;  4ITK A;  1PGX A;  3R2T A;  3TEZ A;  2HDE A;  2RMM A;  4IOI E;  2CJO A;  1VLB A;  3IAS 1;  3I57 A;  5BYR A;  2JWU A;  2ONQ A;  4UDU C;  2AQ2 B;  1C79 A;  1Q10 A;  2VZK D;  1ENF A;  1CJE A;  3P63 A;  1L0Y B;  2MH7 A;  4IDI A;  3Q8C A;  1K50 A;  3P4S B;  2DLB A;  1YQ3 B;  2Y5P A;  1EU3 A;  3HRD D;  2N0S B;  1JML A;  1WSP A;  2WP9 B;  2AQ3 B;  4N58 A;  3ZYY X;  3Q69 A;  2RDH A;  1ZDV A;  1FIQ A;  2ON8 A;  2QMT A;  4US9 A;  3VRB B;  2W54 A;  4DQO C;  3IT6 B;  1DYQ A;  1V8C A;  1FMA D;  1KLU D;  1QIL A;  2H89 B;  4O1N A;  2BW2 A;  1FXI A;  2M56 B;  1OQQ A;  3AE1 B;  1SEB D;  2WXQ A;  3BK2 A;  3RFZ B;  3FC4 A;  3URY A;  2V3P A;  4B0E A;  2ACZ B;  2PVG C;  4LLG M;  1I4G A;  1XLN A;  4LK0 M;  3ZGZ A;  2K3U A;  3OWE B;  2INP E;  4RGM A;  4YXD B;  1JRO A;  1ET6 A;  3AB5 A;  3W9C B;  2ZW0 A;  1F2R I;  3VRA B;  4D2K A;  4DXG A;  1N63 A;  2I2Y A;  1PYW D;  4L23 A;  1E10 A;  4HJG E;  2DYO A;  2Z8L A;  3NVY A;  4RGO S;  1CK1 A;  3BVM A;  3TEW A;  2BBC A;  1TS4 A;  4RF1 A;  2VZK B;  3N9Y C;  3AN1 A;  1DGJ A;  1UWM A;  1YN3 A;  3ZQ4 A;  2E6X A;  2J52 A;  1ROE A;  4MAC A;  1FD6 A;  1MPE A;  2V0G A;  1PFD A;  2JYT A;  1L6U A;  3P4P B;  5AUK A;  2M19 A;  2WLB A;  1HQR D;  1PGA A;  3T3O A;  2LJI A;  2W82 A;  1E9M A;  3NVV A;  4A8X C;  1I4Q A;  1VDV A;  1FRR A;  4REZ A;  2OED A;  1IGC A;  1L0V B;  1GOZ A;  3C8Y A;  2NTT A;  2WXO A;  2Y5C A;  5H8Y E;  5D7G A;  1FM0 D;  4B0M A;  2NMQ A;  1XLO A;  1NI3 A;  1VZ6 A;  5EE9 A;  3AEE B;  1C77 A;  4RNA A;  2WDV B;  4ZRP A;  5D3D A;  1B1Z A;  4DXF A;  1FRD A;  4RH6 A;  3TEY A;  2KQ4 X;  1V97 A;  3BVZ A;  2K9X A;  3TUO A;  4YTM B;  2WDQ B;  1DOY A;  4WWM A;  3AE8 B;  4P16 A;  2H88 B;  2K22 A;  2KWD A;  3Q8B A;  3AH7 A;  4NZL B;  3TSS A;  2IPK D;  2JYE A;  1PDX A;  2WQY B;  4AS1 A;  4XWW A;  5I4D A;  4YTN B;  4JWS C;  4JX1 C;  1FNV A;  2L32 A;  1PGB A;  3ZJT A;  1GAQ B;  4XWT A;  1ZXI A;  2GRI A;  1J7C A;  4OZB A;  1NVI D;  1R7S A;  3P4R B;  1NEK B;  4RGN A;  1FXA A;  1FO4 A;  1BML C;  1QF6 A;  1D4B A;  3AE4 B;  3P42 A;  1F0Z A;  2SAK A;  3CWI A;  1XLP A;  3RPF C;  1EWY C;  2J53 A;  1QOG A;  3I9V 1;  2ICI A;  1M4V A;  2IJ0 A;  1IUE A;  3BK1 A;  4MH8 A;  3B2G A;  4CQN A;  1MVK A;  1QOA A;  3VR8 B;  5GXG B;  2AQ1 B;  3H8H A;  1E6E B;  2RPV A;  4YSZ B;  2CU3 A;  3AE3 B;  2FE8 A;  4IKG A;  4PT5 A;  3AEG B;  2CJN A;  4WUR A;  1QOB A;  2QSD A;  1HZ6 A;  1BUI C;  4OZA A;  5TSS A;  1C4A A;  1WWT A;  3P4Q B;  3BWU D;  3NVZ A;  1D5X C;  1A70 A;  1TS3 A;  1ZP0 B;  4XE0 A;  1TS2 A;  2WXH A;  3BZD B;  3KLS X;  5AUI A;  4ZHO A;  2WXM A;  1ZE3 D;  3MP9 A;  1SF0 A;  2M0A A;  2KDM A;  2Y3A A;  3E9S A;  4RF0 A;  1TZO A;  3AE9 B;  1EM7 A;  1ZDX A;  1WGK A;  2WXP A;  4A90 A;  4A6Q A;  3NRZ A;  2DWQ A;  3PO0 A;  4HEA 1;  3HVZ A;  3AMZ A;  1IBX B;  1FCC C;  1N5X A;  4NAM A;  3AV8 A;  1ZOY B;  1JW9 D;  4C7Y A;  1F2R C;  3MHZ A;  2N9L A;  1YJI A;  4R3D A;  2KN4 A;  1YN5 A;  3AE5 B;  1XLQ A;  2BB5 A;  2EKI A;  1I4H A;  3PZ8 A;  2BS4 B;  2I38 A;  2MJE A;  3VR9 B;  3KWV A;  1XCQ L;  4KKJ A;  3U52 E;  3NUH B;  2PTL A;  4EE2 A;  1MHH E;  3EUB 2;  3BVG A;  1IBX A;  1RFK A;  3J9C A;  1WRI A;  3KQ4 A;  4JE3 B;  2FBW B;  4YSY B;  2PW9 A;  1DOX A;  2L83 A;  3U2S C;  4J3O D;  4USA A;  2GB1 A;  4P6V F;  1QLB B;  4AQ7 A;  1P7F A;  2INN E;  3IXS A;  5EE3 A;  3SFE B;  2WU2 B;  3AM9 A;  4ARI A;  3MC0 B;  2R61 A;  1CQV A;  1L6V A;  5JXV A;  4TMA B;  1E7P B;  1VR9 A;  1HZ5 A;  4KGS A;  4JPS A;  4ZRQ A;  1T3Q A;  2W55 A;  2L52 A;  4TSS A;  1FEH A;  2TSS A;  2LFI A;  3Q8A A;  1YJJ A;  2L1A A;  2YEP F;  1FNW A;  4LTU A;  5HI1 A;  3AED B;  1TKE A;  5H92 C;  2FUG 1;  1D5Z C;  4C7Z A;  5T8I A;  1CZP A;  3E56 A;  2LHE A;  2IDY A;  4C80 A;  5EE0 A;  3AE6 B;  5FKA C;  1C78 A;  3PZ7 A;  2K5P A;  3LXF A;  3NS1 A;  3LYY A;  2RDG A;  1ESF A;  3IAM 1;  2WXI A;  3ABV B;  3CIR B;  4OVZ A;  1B9R A;  1GB4 A;  1GPX A;  3SR6 A;  1EWC A;  3TEX A;  4GLS C;  1IGD A;  3AEB B;  1OQR A;  2DYM A;  1WXQ A;  1JWA D;  1FFU A;  3DWM A;  2EEL A;  1UGJ A;  4KGR A;  4KKI A;  1P7E A;  4HRO A;  5E6J A;  4US8 A;  5LNK 1;  1F77 A;  1KLG D;  4WAF A;  1DOI A;  1ZUD 2;  2ZW1 A;  1HXY D;  3SEB A;  1YN4 A;  2Q5W D;  1D6E C;  2WXR A;  3ZJU A;  2WXF A;  1QQR A;  2G1E A;  1JAL A;  3GP7 A;  4A9A A;  1EU4 A;  1WYG A;  1SJE D;  2WXN A;  1KRH A;  1OFF A;  4YTP B;  1T5X D;  1XF5 L;  1AYF A;  2BS3 B;  1NEN B;  5G5G A;  2BS2 B;  2G9H D;  3W5U B;  5C2T B;  2J42 A;  2PKO A;  1C76 A;  2LEK A;  2N7J A;  3AEF B;  2D5G A;  2BB6 A;  2QIL A;  2W3R A;  1TYG B;  4ARC A;  2N9K A;  1N62 A;  4ZOH C;  4HKQ A;  3LB8 C;  1ZPS A;  3HUI A;  1VJK A;  5D3I B;  1V1O A;  2K0P A;  4L1B A;  3W5V B;  5BYQ A;  1SB3 C;  3AEC B;  4YSX B;  2BYT A;  1SIJ A;  4A55 A;  1TKY A;  1KFY B;  1VZ7 A;  2MJ3 A;  4Q2J A;  1VZ8 A;  3L4P A;  1YMH E;  2MEK A;  2NTS A;  2WXJ A;  1FCL A;  1XO3 A;  3T3N A;  4MM3 B;  4OW0 A;  1BXT A;  2J4X A;  3GS2 A;  1L0X B;  1SE2 A;  4C56 C;  4ZHP A;  1L4D B;  2AX5 A;  2W3S A;  1I4R A;  1KTK A;  5G5H A;  2WXK A;  1SE4 A;  3BII D;  4N6E B;  5HG2 A;  3B9J A;  2V3N A;  1ZXH A;  2IGD A;  2QIE B;  1TKG A;  1HA5 A;  1YQ4 B;  3P1M A;  1JCK B;  2PVO D;  5HFY A;  1STE A;  2WNM A;  4YWG G;  1XXG A;  1Y56 A;  1LO5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...