2KACA

Nmr solution structure of kx6e protl mutant
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
64
structure length
64
Chain Sequence
MEEVTIKANLIFANGSTQTAEFEGTFEEATSEAYAYADTLEEDNGEWTVDVADEGYTLNIEFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Protein L
publication title Structural basis for the aminoacid composition of proteins from halophilic archea
pubmed doi rcsb
source organism Peptostreptococcus magnus
total genus 15
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2008-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2kacA00
1FCLA 2PW9A 4GLSC 4IOIE 5HHDG 1IGCA 3UI3A 3MP9A 2JWUA 4HKZE 2K0PA 2ON8A 2RPVA 1QKZA 1JMLA 1FD6A 2JSVX 1MHHE 3V3XA 1MI0A 5JXVA 1YNTE 1F2RC 3FILB 1PGXA 2QSDA 4OZBA 1P7EA 2LHDA 1MHXA 1C9FA 2KQ4X 4OZAA 1PGBA 2IGGA 2LHEA 2IGDA 3FILA 2KACA 1HZ5A 2N9KA 4MACA 1HZ6A 2N7JA 1K52A 2GB1A 1HEZE 2JZPA 2KDMA 2ONQA 2I38A 2QMTA 2J52A 2PTLA 4WH4A 1D4BA 1FCCC 1GB1A 1UWXA 5HI1A 2GI9A 2N9LA 2IGHA 2NMQA 1PGAA 4KGRA 1MVKA 5BMHA 2KN4A 2ZW0A 2OEDA 4KGSA 2LUMA 1XF5L 4KGTA 2I2YA 1Q10A 1XCQL 5HFYA 1K53A 1YMHE 4OZCA 1MPEA 1IBXB 3GB1A 1K50A 2PLPA 1P7FA 1KH0A 1IGDA 1ZXHA 2JU6X 5BMIA 2J53A 2JXTA 1XCTL 4D2KA 5BMGA 2RMMA 2EELA 1F2RI 1EM7A 4HJGE 4IKGA 1IBXA 1K51A 2KWDA 2LGIA 5HG2A 2ZW1A 1GB4A
chains in the Genus database with same CATH superfamily
4RGTA 1TBEA 2ZPNA 1E10A 4RM9A 2G4SA 3A1QB 1N63A 3MFGA 3UQBA 4DQOC 4IUMB 1IPGA 1GAQB 3EECA 1WX7A 3DBSA 2JPHA 2JRIB 1WJUA 2KDBA 1RWSA 3Q3NC 2M4NA 2XK5A 4CYEA 4K7WA 3APFA 2LGYA 4WJNA 2DENB 3NS1A 4A3OA 4ANUA 1UNSA 4YXDB 1WXVA 2JY6A 1STEA 1NEKB 4KZ0A 1R7SA 2WXLA 2I1KA 2K9XA 3OAWA 1VRAB 2HE7A 5DPWA 2AEHA 1I4PA 1UWXA 4W9LA 2LZ6A 4RGOS 5GMVA 5C2TB 2KJRA 1WMHA 2M19A 3RYTA 3P1MA 3EHVA 1LM8B 2J0KA 2MBOA 2WDVB 4BBNC 1Q10A 4M02A 2BBCA 2JXXA 2B76B 1OQRA 3PLVA 4XC2A 4WAAA 4GDLB 4LJOB 3M63B 2KZRA 3EUB2 1ZXHA 5IOIA 1KRHA 2MCNB 2AQ2B 5JHAA 1C78A 1SJHD 3ZJUA 1UF0A 4EZKA 5KHOA 4EOYA 2D11A 1FFVA 4BKTA 1Q1OA 2D10A 4HEA1 2KOXA 3RCZA 4X57B 3MC0B 2ICIA 3LB8C 3WALA 2A5UA 2WXRA 1BMLC 2V0GA 4N58A 5I4DA 5J2RA 1VD2A 4E74A 4LTUA 1JWBD 1YJ1A 5E6OA 2PJHA 3DBLB 4ZRKA 3R66C 3NRZA 4ZRPA 3FKYA 1MHHE 4MJSA 3DWMA 1CK1A 5GXGB 5G5HA 1N62A 4MM3A 3SR6A 1UWMA 1VR9A 3H9DA 2MJDA 1NVID 2QIEB 5AZFA 4MGYE 4EFOA 2VH2A 3DVGY 1SIFA 1R4MI 4MT5A 3NS8A 4KV2A 1JQ4A 2M1MA 3H1UA 2NBWB 1RM6C 2VRRB 2KJ6A 3RT3B 5E6PA 1WY8A 5BO4B 2MRPA 4WWOA 3ETRA 3PO0A 1WE7A 3MTNB 1RAXA 4XWTA 1V80A 2ZZPB 2MJ3A 2IGHA 2JRHA 4REZA 1MVKA 4GIVA 1YIWA 1T0RC 4L1BA 5FKAC 4W9KA 4B0EA 1KFYB 5HFYA 1K53A 2Y5PA 2JZ3B 2QHOA 3AE5B 4B6WA 1IYFA 2RDBC 1J8CA 2KX0A 3R7RA 1E5WA 1WXQA 3I5JC 5FK9C 2LRUA 1TT5B 2XK5B 1SE4A 2L0TA 4D2KA 1XLQA 3H7SA 2FIFA 2KYWA 1I35A 1L2NA 2WXFA 1GOZA 4GDKB 4RGNA 3AMZA 2FUG1 2M56B 1WJ4A 1FNVA 3W2DA 2KC2A 2M0XA 1ZOYB 3TMPB 4AWJA 3TBLD 2KTFA 3GE3C 4NZLB 3ZKJC 1AW7A 1F77A 3VTUA 4LLGM 4YSYB 2YVCA 2KWVB 3MHSD 2NPTB 5IAAC 2E3TA 4C80A 2KWUB 4M00A 4BZAA 4W9IA 1WMHB 3BY4B 2JYEA 2WX0A 1L5PA 3PT2B 3L08A 4K7UA 5AUKA 4OZBA 3JW0X 4IW0A 2SAKA 3QJZA 1J0GA 3RN9C 2PVOD 1EU3A 4G3XB 4C56C 1E8WA 1GG3A 3PZ7A 3L0WB 4WAFA 4NNJB 4L2YA 3C19A 1QT9A 1C4CA 1QQRA 2V4LA 3Q14C 1IUEA 1E7UA 4HPMB 4N59A 1ZGUB 2G1EA 1OTRB 2KMCA 3UGBB 4W9JA 3SFDB 3PV1A 3V6CB 2N9LA 3I3TB 3Q8FA 2WDRB 5G55A 3ALBA 2PE9A 4GN1A 4NQLB 2O6VD 2I2YA 4RM8A 1E90A 2ZNVB 2BWFA 1TS4A 4M0WA 2LMCA 4LNKA 4XZ4A 1FEHA 1JWSD 4EUTA 2L00B 1XCTL 4P1BC 2AQ3B 2FAZA 5D2MB 1YN3A 2KDIA 3HM3A 3DWGC 4C7ZA 1ZUD2 1DOYA 1HTOA 1L0YB 2JVCA 2C5LC 1TZOA 3PZ8A 1FXIA 1V81A 2DLBA 4A9AA 3ZIMA 1V1OA 3CMMB 4W9GA 5DPTA 1RFKA 1XXGA 2HJ1A 1D5ZC 4LNFA 1LGRA 2BT6A 2EMTA 1L6VA 3KW5B 4YTPB 1N61A 3HK0A 2QILA 3ZYYX 1IP9A 4PS3A 2LASA 2QEJC 2MBHA 1VZ6A 3PREA 3DPDA 1MJDA 3UINB 3RNEC 2KQ4X 4KIKA 3N20C 4NQKE 5IP4D 4RMAA 3CSFA 1WI0A 1E7VA 1SSNA 2KFKB 3DVNV 3GE8C 2IPKD 4A20A 2KO3A 2BVCA 2N1VA 3BK1A 2BF8B 1XQQA 2PTLA 1DYQA 1ZDVA 5CHWA 2N9EB 1UELA 3ZUNA 4E3CA 1VJKA 1OFFA 1XD3B 4W9CA 4W9EA 2M17A 3AE3B 2KK8A 3PSEB 2A4ZA 5AZGA 2C60A 2K8CA 3AU5A 1JW9D 2WDQB 1J19A 2KC1A 2WXGA 3E56A 3I57A 1TGZB 3U8ZA 3NVWA 1F2RI 4IKGA 2OHFA 1HQRD 1WRDB 2DAJA 5AZHA 3AN1A 1EWYC 2BKFA 3AEBB 3RMKC 5DPSA 2INDC 2NS5A 5MPOA 1GUAB 4IOIE 2KXJA 4ASWC 5LXHA 2FIDA 5JXVA 3EFUA 3QARA 2VZKB 3UIOB 1F2RC 2R61A 4DHJD 1PGXA 2MP2B 4IDIA 5IN7A 2XNAC 3QQ8B 2OJWA 2IZVB 4A8XC 3AH7A 1RYJA 2AL6A 3KVFB 4B0MA 3PLUA 3PTFC 1DOXA 3MJWA 2CJOA 2W54A 3VRAB 3ZQ4A 2R2QA 1SB3C 4JWSC 1FPYA 4S17A 1P9DU 2BS4B 3E9SA 1P0RA 2BS3B 4NAWA 1L4ZB 1F0ZA 3B2GA 2N9XA 3NHEB 4DWFA 2QMTA 3KH0A 2GOWA 1S3SG 4HPPA 4WIPA 1EO6A 2KTRA 1ZXIA 2REXA 5IA7A 3S2AA 4ITKA 1PGAA 2MEKA 2WXOA 2N7DA 4KGRA 2W55A 3FAHA 1SE2A 4YSZB 2O2VA 4WJOA 4YL8A 1OEYA 3Q8CA 1KJTA 2JQRB 2JYTA 4OZCA 4K1RB 3OJ3A 3KYDD 2Z59B 4FJZA 2L7RA 4GB9A 2E6XA 3NY5A 3L54A 5BMIA 3Q3FA 1QOAA 1I7HA 3AE4B 2D3GA 3VH3B 1YD8U 3JYUA 4HKQA 4R3DA 2BGFA 2KWDA 2AWTA 1NYRA 2GBJA 1V97A 2KVRA 1ZW7A 1HE8A 4YWGG 4JE3B 3UI3A 3MP9A 3ENEA 2LGDA 4YSXB 2L32A 2NTSA 1KLGD 4ICVA 3B08A 3DBLI 4W9DA 2WQYB 5BYSA 1PYWD 1AWDA 2H88B 2IDYA 4MH0E 4YTNB 4GOCA 3KLSX 4ANXA 5AUIA 1C79A 4GMVA 3O65B 2WGSA 2W3SA 2EKIA 4C4VB 4WQMA 1TS3A 3AECB 1F52A 2RPQA 3WAPA 4K3CA 4UDUC 4E71A 1A70A 3NUHB 1HZ5A 2LVOA 3AE7B 3EGRA 2IY1B 2KWCA 3WANA 3EA6A 2W9NA 2VH1A 1EUVB 2MSED 2JWZA 3N1XC 3R8BA 4IM0A 1LQBA 4OVUA 2MBQA 4WWNA 3U52E 2MA9B 1WGDA 1LO5D 4LDTD 2QCZA 1DGJA 2FBWB 5C1ZA 4W9FA 3SD5A 4IC7B 1XT9B 3APCA 4I6NB 4US9A 1UUPA 3IT6B 3PRZA 1D3ZA 4K3BA 3N32A 3ZXVA 1K50A 2WXMA 3N1YC 3TSSA 2ZJDA 5D3IB 3TEYA 4FLHA 1G6JA 4MELA 3AM9A 3Q6BA 4HROA 1AYFA 3AEDB 1WJNA 4N6EB 2DBYA 3BK2A 4AS1A 3W1SA 2BKRB 1WYWB 3A4SC 4BAXA 2J0JA 5HHDG 2G3QB 2ON8A 4EZLA 2MQJA 1D5XC 1RFAA 5TR5A 1M94A 4BKSD 3A9KA 2XN9C 2IBIB 4JQWC 3RD2A 3DVGX 4FJYA 4YT0B 1Z2MA 2LWPA 2LGXA 3FILB 3ZO5B 3LJ3A 3W1YA 3ZNZB 5IKCM 4DK5A 2K1FA 4M8NA 1XO3A 2G4DB 2M0AA 3TEXA 3H6NA 3AE2B 3CWIA 4OW0A 2J7QB 2AL3A 3Q2AC 4AQ7A 3LYYA 2KDMA 2ONQA 2PMVA 3NVYA 2C7MB 4HDQA 1SGHA 3AI5A 1SIJA 3TCAA 3VXWA 1FCCC 3Q3JA 1C76A 1TKEA 4PK1A 2WU2B 4XDCA 2WYQA 2XEWA 1FRRA 3Q3OC 4BFRA 1QF6A 3ZGZA 4PS7A 2FCNA 4KZCA 1WXSA 2ACZB 2KT7A 4I6LB 3R7QA 3TJPA 3HHMA 1IBXB 3N3KB 3VH4B 4N9F4 1WH3A 1DOIA 2H89B 1ESFA 1KH0A 1TTNA 4J6IA 3GS2A 2QC8A 1B9RA 4HVBA 1MG4A 4ZRJA 1WSPA 3W5UB 1E6EB 2NBUA 1FXTB 3MHZA 2DYMA 4QAYA 2PW9A 1BT0A 4GLSC 1SE3A 1D6EC 3P4SB 3VR8B 1MFWA 2ZNVC 1YOVB 3Q8EA 4DHZB 2D07B 4GXBA 3AXCA 1MI0A 5J17A 3BVMA 1XLOA 4EZJA 2BW2A 2AX5A 3PPAA 3PRMB 3WAMA 1QZEA 2ZCBA 3B0AA 2KMMA 3JSVA 1L4DB 4H2AA 5D7GA 1UD7A 3NZSA 1N60A 2DZMA 3V60A 3OWEB 1WR6E 3UIPB 2YLMA 4S0RA 1QILA 3HIZA 3ZRCA 1V1PA 3NZ3A 4L23A 5TSSA 1H8CA 3L17A 1V9JA 3X23A 2J42A 3J9CA 1WX8A 1C4PA 1WGRA 1WZ3A 4WH4A 1D4BA 2BB5A 3W9CB 3UQAA 2IO1B 4MH8A 4G11A 1EWCA 3RNFC 1J7AA 2Y5BB 2HJ8A 2PKOA 3I9V1 2KQ7A 3KUCB 1CZPA 1SEBD 1N6ZA 3D32A 5LLIA 3SFEB 5T8IA 2UYZB 5EDSA 2ZVOA 2JXTA 1OEYJ 1WYGA 2RMMA 1ZE3D 5H8YE 2RDHA 1EM7A 1WE6A 3ZRFA 1E8ZA 3BIID 1K51A 1XLPA 4MJSB 1SE9A 1GB4A 3U7ZA 4NPNA 1WGGA 4MM3B 5BYQA 4F7ZA 4K7SA 1RLFA 2K0PA 2L76A 3N9YC 2HD5B 2Z0EB 3DHIC 5EE3A 2YEPF 4P16A 2WDTB 2D3CA 1I4HA 3BWUD 4F8CB 4ICUA 3DVNU 2PE6B 4M01A 1P7EA 3AB5A 1C9FA 1C1YB 2WXKA 2Z8LA 1BXTA 3ABVB 1D5MC 2KAJA 4BOZB 3WCQA 2GBRA 2JUOA 2FCMA 1J7BA 3VVWB 3IVFA 1ET6A 2KACA 4KDLB 3EFCA 1WGKA 4TUUA 4TMAB 1HZ6A 1FIQA 3N1ZC 1NENB 2L0FA 4HDOA 2KD0A 4P1CC 2NBVB 4ZRIA 1ROEA 5AEKB 3L10B 1X1MA 3WIMA 3V05A 3URYA 4J3OD 3UF8A 1Y56A 2FE8A 3KYCD 4FHJA 4ARIA 3VR9B 3LXFA 5E6NA 2DAFA 2GBKA 2NMQA 3VAWA 3P2BA 5BMHA 1TS5A 4CO7A 3T3OA 5JZEB 3NVZA 4C00A 2ZPYA 3C8YA 3TEZA 1P1AA 3GB1A 1YN4A 2NVUI 3IT4B 2EKEC 3QWZB 2JX5A 4GGQA 4P7IA 3O13A 1FXAA 3ZXRA 1EU4A 3NJTA 2ASQA 5LNK1 5HG2A 4JL9A 2IO3B 2I1JA 1FCLA 4DHZE 1GC6A 4KSLC 4XGAB 1WXAA 2K25A 1J7CA 4FN2A 5G5GA 1ACCA 3ZNGC 3T3NA 2K39A 4RNAA 2BQQA 2FUHB 5CHFA 5EE1A 2RPVA 4HCPB 3IBEA 1QKZA 4AUQC 5L83A 2QDFA 4RGMA 2KVZA 2LRWA 4WQOB 4OVZA 3KWLA 3ZLZA 5BYRA 3C0RB 1UZXB 5J18A 1WRIA 3A1QA 1C3TA 1JWAD 2KANA 1Q5WB 2DZKA 3HM6X 4NJ7A 1L6UA 3RI7C 4OZAA 1H4RA 2HTME 2LD9A 2C9WB 3CSTA 2L3ZA 2N0SB 5CX3A 2CU3A 1QOGA 2LHEA 3RZWC 1YX5B 1WGHA 3JVZX 4MEMA 3QC8B 3M3JA 3SDLC 3Q3MC 3NZUA 3H8HA 2C7HA 2DX5B 1KM7A 3EC8A 2XBBC 1L7YA 1VCBA 4HCNB 2CHWA 4M0WB 2MHJA 3OG5A 2LUEA 2DHZA 3KWVA 2PVGC 1TKYA 3DCGA 3QIJA 3KUZA 2PIAA 4RH6A 2OEDA 4KGTA 2TSSA 3ECIA 4TKNA 1I4QA 4F1SA 2IO0B 2KX3A 3RNAC 2NCNA 3AEAB 4ZHPA 4WWMA 1T6BX 2X8XX 3A9JA 4ZHOA 2WXJA 1GC7A 2KKCA 1V5OA 3TUOA 1R4NB 1K8RB 1OQYA 2L8JA 1UH6A 2LGIA 3A4RA 1JRPA 2LI5A 4MGZE 2IY0B 2CJNA 3GOEA 2EMSA 2G9HD 2L52A 4A3PA 1EF5A 2WXNA 2BWES 1WZ0A 1VZ8A 1FO4A 3RNGC 4CHKA 1FFUA 2W3RA 1JMLA 1FD6A 4KIKB 3GZNB 2GBNA 1WJ6A 1GJZA 1WIAA 2BYVE 3DHGC 3VUWA 3RFZB 1N5WA 1T3QA 1WM3A 5CHVC 4DXFA 2J0MA 2KHWB 1Q0WB 4DXAB 3W5VB 4TV3A 4PS8A 2IGGA 2JT4B 3T9LA 2INCC 2K6DB 4YTMB 4RF0A 1TY0A 2VZKD 3RPFC 1C77A 3BYYB 2WX1A 1VLBA 2GB1A 4K81A 2YEPB 1FNUA 4EKUA 3DBRB 4JIOU 1V8CA 4P6VF 2IYDB 3TL5A 1TYGB 1TZ1A 1YQBA 4EEWA 1VZ7A 2GRIA 3B9JA 2V3NA 2LUMA 4ZYNA 4AJYB 3IHPC 4JPSA 4JX1C 1T5XD 1YMHE 4MGKE 2LEKA 1V49A 2WS3B 3AEEB 3VRBB 1UGMA 2CHZA 3ZTDA 2PLPA 3B2FA 2L83A 1QOFA 4I6PA 2SEBD 3DHHC 2WXIA 1XEEA 2WXHA 3Q8AA 2R2OA 2KJHB 3AE9B 5FR3A 1YJIA 3MC9A 2O6VA 3IG3A 3NG0A 3ZW3A 1UGJA 4HPLB 3U30A 4JLCA 4W9HA 1CQVA 3ML9A 4LNIA 4TQ0A 3WA0A 5KHQA 3APDA 3N30A 4GDKA 3MC8A 2RGFA 2JZZA 4O1NA 1E0ZA 4LCDE 3HUIA 3PGEA 1XLNA 2N4FA 4FULA 4NAWB 1YQ4B 4NJ6A 2KNBA 4NY0A 2MJEA 3V6EB 2MBBB 1FM0D 1WFYA 2KLGA 2NPTA 1AARA 4HLEA 1ZDXA 2ZCCA 2G45B 3A9JB 1E8XA 2KTRB 2N1WA 3L4PA 2N9KA 2NR2A 1I4RA 4KKIA 2N7JA 1K52A 4KVGB 2O2VB 4AJWA 1L0XB 1HEZE 3CIRB 3K9OB 1GB1A 2DWQA 3ZDMC 3L16A 3AV8A 4KSKC 1ET9A 1JRUA 1XF5L 2AYOB 3Q69A 1XCQL 3M95A 2DYBA 1SJED 2Z0DB 1FRDA 4URKA 1KLUD 1P7FA 2UU7A 1I42A 1NI2A 1V2YA 3GP7A 1VDVA 2LFIA 3DDCB 2WU5B 1OGWA 3BINA 4RCOA 4MSMB 1ZP0B 2K8BA 4XDDA 3W1SC 1BUIC 1QOBA 2CR5A 2Y5CA 5LXIB 4HXDA 2WHIA 2K22A 2LXAA 4BOSC 4GU2A 3PRPB 2V9HA 1T0YA 3ZJVA 3HVDA 4HKZE 2OOBB 4FA6A 4II3B 3QK0A 1RRBA 3V3XA 4XE0A 4LNNA 1JROA 1JCKB 3AEGB 1CMXB 2HDEA 2K3UA 4HK2A 2W82A 1AN8A 3RUIB 1NI3A 2LHDA 1WGYA 4ZRQA 4G50A 1PDXA 3U7DA 4XYCA 3DQVA 4ANVA 4GSWA 1NYQA 1I4XA 2O6VB 4ZDVA 1KLVA 2RD0A 3KUDB 4WJQA 2IJ0A 1OQQA 2DZIA 2JZPA 2GBMA 4HJKA 4MGIE 2K5PA 3VQIA 3RZFA 2KFKA 4FADA 3VUXA 2BTEA 2ZW0A 2RSUA 1ENFA 3BZDB 4KGSA 2CHXA 3HRDD 2OJRA 3AE8B 2JF5A 3P4QB 1MPEA 1FNWA 4DXGA 5G2NA 3ZTCA 3PZDA 3IAM1 4FXCA 2MX2A 4C7YA 1PUTA 1Z5SB 4A55A 2WLBA 4BKGA 4B95A 1KOTA 3PHWB 3AEFB 3TIXA 3VFKA 5C23A 1QLBB 3OLMD 1L0VB 1WX9A 4DDGD 1U4AA 3P4PB 1GPXA 3A9KB 3BVZA 4PT5A 1V6EA 1FMAD 3ZJTA 3ZVVA 4IM3A 2BYTA 2D3BA 4TSSA 4EE2A 4JWUC 1PQSA 4ACFA 1UBQA 5HKHA 3DBHI 2JWUA 3SEBA 4PYZA 1SBBB 1TKGA 4ZYSA 4MDKE 3ONSA 3VHTC 3R2IA 3AE1B 2N7EA 2FNJB 3R3MA 5EE0A 1JALA 2DYOA 2QSDA 2INPE 1R4MB 2N9PC 3RNBC 2ZVNA 3IFWB 1WM2A 2K6QA 2NTTA 5C3JB 4XWWA 2MH7A 3FC4A 2MW5A 3NVVA 2D2QA 2MP2A 2MBEA 1T0QC 4MACA 3K9PB 5H92C 4B9KA 3CF6E 1MG8A 4WJPA 2L05A 2QJLA 2I38A 4WWPA 2X38A 1ZKHA 3B1LX 2LXCA 1S1QB 1F1HA 3QX1A 2GI9A 4ARCA 3LDZE 3X0WA 1KTKA 4IM2A 4HRSA 1HTQA 1JWUD 2ZEQA 3AU4A 2BS2B 1UBIA 2GLSA 3QA8A 2HTHA 1LXDA 2JU6X 4LNOA 5DPRA 1P3QU 1V5TA 1WXMA 2EELA 2V1YA 3QCAA 1Y8RC 2BYFA 5IO9A 4HJGE 3PHXB 4DHJB 1R4NI 4A6QA 1JWMD 2BPSA 3RNCC 3WAOA 3JSVB 4FBJB 1WF9A 2IO2B 2WNMA 5JHBA 1E9MA 3M62B 2CS4A 1NBFC 2JSVX 4IWPA 3H7PA 1HA5A 2V3SA 4WURA 2LVPA 3GZNI 4A90A 1WR1A 3Q8BA 3RULA 3V61A 1V1PB 3BYTB 1HXYD 1T0SC 3DBHB 1I4GA 5JH5C 1P98A 2DZJA 4BKSA 3VDZA 4LJPB 2IGDA 2WXPA 2RDGA 4KX6B 2INNE 2PPHA 4PYUA 4BVUC 4C4VA 2J52A 4NJCA 2WP9B 1B1ZA 2J4XA 3DBRI 3U4EG 5FR6A 3DOWA 5HI1A 3IAS1 4XX5A 2LJIA 4Q2JA 2KFJA 2D5GA 2WWZA 2MWSB 2MLBA 3ZNHB 5D3DA 5D6JB 4JGHB 2Y3AA 1GNUA 3SU8X 4OVVA 2DNFA 4OHJA 3ZDTA 4AP4C 2KN5A 3KQ4A 2BYEA 1M4VA 5D94A 2KDFB 1LFDA 5CTRC 1TJEA 3QAQA 5L95C 1E7PB 4HWIB 2ZW1A 5EE9A 2KMAA 3A33B 4LK0M 1TIFA 4ANWA 1WWTA 1SF0A 1N5XA 1IGCA 3ML8A 1ZPSA 4FJVB 1ISNA 2K8HA 1TS2A 3MJ5A 1NDDA 1C4AA 1YQ3B 4AOFA 1YNTE 2FCQA 3T8MA 4GDLA 2BB6A 4BBNF 4FHKA 1MHXA 2L1AA 3P42A 2Q5WD 2LJ5A 4DDID 4DBGA 4LDTB 2B3AA 4KDIC 3AE6B 1PGBA 3OJ4B 1TY2A 5DCNA 3FILA 1SXTA 4MSQB 4TQ1A 3PVLA 1YN5A 2LGSA 4US8A 2V4IB 4IG7B 1A5RA 1E8YA 4CQNA 2GMIC 1KF6B 3BVGA 2AQ1B 3L13A 3SHQA 2KN4A 5E6JA 2KLCA 2CKHB 4RFBA 1V86A 2KDEB 3QHTA 2CU1A 3H7PB 2PEAA 3TEWA 2WXQA 4ZOHC 2V3PA 3VTVA 3I63C 3IXSA 1PFDA 3V62A 4IWQA 1CJEA 1IGDA 3VUYA 3P4RB 2J53A 2UWQA 2FCSA 3AULA 2M8SA 5BMGA 1YJJA 3P63A 4G0NB 3PS6A 2RR9A 4II2B 2D3AA 1YX6B 4KKJA 4NAMA 3ZNID 4RF1A 4M8MA 3U2SC 4IWOA 2C7NB 1IBXA 1F9JA 4USAA 3NOBA 3HVZA 3VTWA 3R2TA 2KQSA 1EF1A 2LVQA
chains in the Genus database with same CATH topology
4RGTA 4MM3B 5MPOA 4IOIE 1E10A 5BYQA 3HVDA 4HKZE 1N63A 2K0PA 3N9YC 3MFGA 5EE3A 4DQOC 2YEPF 1GAQB 3V3XA 4P16A 5JXVA 4XE0A 1I4HA 3BWUD 2VZKB 1JROA 1JCKB 1F2RC 3AEGB 2R61A 2HDEA 2K3UA 1PGXA 4IDIA 2W82A 1RWSA 1AN8A 2XNAC 4A8XC 1P7EA 3AH7A 1NI3A 2LHDA 3AB5A 1RYJA 4ZRQA 2WXKA 1C9FA 2Z8LA 1BXTA 1PDXA 3ABVB 3NS1A 4B0MA 1D5MC 2KAJA 3WCQA 1DOXA 2CJOA 2W54A 3VRAB 1J7BA 3ZQ4A 1UNSA 1SB3C 1ET6A 2KACA 1NYQA 1WGKA 1I4XA 4JWSC 4YXDB 1STEA 1NEKB 2BS4B 1R7SA 3E9SA 4TMAB 1HZ6A 1FIQA 2BS3B 2IJ0A 1NENB 2WXLA 1L4ZB 1F0ZA 1OQQA 1ROEA 2JZPA 3B2GA 2K9XA 2QMTA 1VRAB 3V05A 3URYA 2K5PA 4J3OD 4WIPA 1I4PA 3VQIA 1Y56A 2FE8A 1ZXIA 1UWXA 4ARIA 4RGOS 3VR9B 4ITKA 5C2TB 3LXFA 2NMQA 1PGAA 2MEKA 2WXOA 4KGRA 2BTEA 2W55A 5BMHA 2M19A 1SE2A 3FAHA 2ZW0A 4YSZB 1TS5A 1ENFA 3BZDB 3P1MA 4KGSA 3T3OA 3HRDD 2WDVB 3NVZA 1Q10A 3AE8B 3Q8CA 2BBCA 3C8YA 2JQRB 2JYTA 1MPEA 3P4QB 4OZCA 1FNWA 3TEZA 2B76B 4DXGA 3GB1A 1OQRA 1YN4A 3IT4B 3IAM1 4GDLB 4FXCA 2E6XA 3EUB2 4C7YA 1ZXHA 5BMIA 1PUTA 1KRHA 2AQ2B 4A55A 2JX5A 2WLBA 1C78A 1SJHD 3O13A 3ZJUA 1QOAA 1I7HA 3AE4B 3AEFB 1FXAA 1QLBB 1EU4A 1L0VB 1FFVA 4HKQA 4R3DA 2KWDA 3P4PB 5LNK1 5HG2A 1GPXA 4HEA1 3BVZA 4PT5A 1FMAD 1NYRA 3ZJTA 3MC0B 1FCLA 2BYTA 2ICIA 4TSSA 1V97A 3LB8C 4YWGG 4EE2A 4JWUC 2WXRA 1BMLC 1J7CA 4JE3B 4N58A 5I4DA 2V0GA 5G5GA 3UI3A 4LTUA 1JWBD 3MP9A 1ACCA 2JWUA 3SEBA 3T3NA 4ZYSA 1SBBB 1TKGA 4RNAA 5EE1A 4YSXB 2RPVA 2L32A 2NTSA 1KLGD 1QKZA 3NRZA 4ZRPA 1MHHE 2WQYB 5BYSA 1PYWD 1AWDA 2H88B 2IDYA 4RGMA 3DWMA 4YTNB 3KLSX 3R2IA 3AE1B 1CK1A 5GXGB 5G5HA 1N62A 5EE0A 5AUIA 1JALA 3SR6A 1UWMA 4OVZA 2DYOA 2QSDA 3KWLA 5BYRA 1C79A 1VR9A 2INPE 2MJDA 1NVID 2QIEB 1WRIA 1JWAD 2W3SA 2EKIA 1L6UA 2NTTA 4MT5A 4OZAA 4WQMA 2HTME 1JQ4A 5C3JB 1TS3A 2N0SB 3AECB 2CU3A 4XWWA 1QOGA 1RM6C 2LHEA 2MH7A 3FC4A 3NVVA 4UDUC 1A70A 3NUHB 1HZ5A 3AE7B 3EGRA 4MACA 3H8HA 5H92C 3EA6A 3R8BA 2QJLA 2I38A 3ETRA 3PO0A 2X38A 3U52E 1LO5D 4XWTA 1DGJA 2MJ3A 3KWVA 2GI9A 2FBWB 2PVGC 4ARCA 1TKYA 2IGHA 4REZA 1KTKA 1MVKA 2PIAA 4RH6A 2OEDA 4HRSA 4L1BA 4US9A 1UUPA 5FKAC 4KGTA 3IT6B 4B0EA 1KFYB 1JWUD 2TSSA 1K53A 5HFYA 2Y5PA 3AE5B 1I4QA 2BS2B 1K50A 2WXMA 3TSSA 3AEAB 1WXQA 4ZHPA 4WWMA 2JU6X 5FK9C 5D3IB 1T6BX 3TEYA 1SE4A 4D2KA 1XLQA 4ZHOA 2WXJA 2EELA 3AM9A 2WXFA 1GOZA 4GDKB 4RGNA 4HJGE 3TUOA 4HROA 1AYFA 3AEDB 2LGIA 2DBYA 3BK2A 4N6EB 3AMZA 1JRPA 4AS1A 2FUG1 3W1SA 2M56B 2CJNA 4A6QA 1FNVA 2G9HD 1JWMD 2L52A 3W2DA 1ZOYB 5HHDG 2WXNA 4NZLB 1AW7A 1F77A 4LLGM 4YSYB 1VZ8A 1FO4A 2WNMA 1E9MA 2ON8A 1FFUA 2W3RA 1JMLA 1FD6A 2JSVX 1D5XC 2E3TA 4C80A 1HA5A 2XN9C 4WURA 2JYEA 4YT0B 3RFZB 3FILB 4A90A 1N5WA 1T3QA 1L5PA 3Q8BA 5AUKA 1V1PB 4OZBA 3BYTB 4DXFA 1HXYD 2SAKA 1XO3A 1I4GA 2M0AA 3W5VB 3TEXA 2PVOD 1EU3A 3AE2B 3CWIA 4OW0A 2IGGA 2IGDA 4C56C 2WXPA 4YTMB 2RDGA 4RF0A 4KX6B 3PZ7A 2INNE 4AQ7A 1TY0A 2VZKD 4WAFA 3RPFC 4L2YA 1C77A 3BYYB 1QT9A 1C4CA 1VLBA 3LYYA 2GB1A 2YEPB 2KDMA 2ONQA 1QQRA 1FNUA 2PMVA 3NVYA 2J52A 1IUEA 1SIJA 4NJCA 1FCCC 1V8CA 4N59A 2WP9B 1B1ZA 1C76A 1TKEA 2J4XA 4P6VF 2WU2B 4XDCA 1TYGB 2G1EA 3U4EG 1FRRA 5HI1A 3SFDB 3IAS1 1QF6A 2N9LA 3ZGZA 1VZ7A 2LJIA 3Q8FA 2WDRB 2GRIA 3B9JA 2V3NA 2ACZB 2LUMA 4Q2JA 2D5GA 2I2YA 4JPSA 4JX1C 1T5XD 1YMHE 1TS4A 2LEKA 5D3DA 4M0WA 1IBXB 2WS3B 3AEEB 3VRBB 1DOIA 2H89B 2LMCA 2PLPA 3B2FA 1ESFA 1KH0A 2L83A 1QOFA 2Y3AA 2SEBD 2WXIA 1FEHA 1XEEA 1JWSD 2WXHA 4OHJA 3Q8AA 1XCTL 3KQ4A 3GS2A 1M4VA 2AQ3B 3AE9B 1B9RA 5FR3A 1YJIA 1YN3A 1WSPA 3W5UB 3DWGC 4C7ZA 1E6EB 1ZUD2 1DOYA 1L0YB 1TJEA 1UGJA 1E7PB 1TZOA 3PZ8A 1FXIA 2DLBA 4A9AA 1V1OA 2ZW1A 5EE9A 3MHZA 2DYMA 4LK0M 1RFKA 1CQVA 1XXGA 2PW9A 4GLSC 1SE3A 1D6EC 3P4SB 1WWTA 1SF0A 1N5XA 3VR8B 4TQ0A 1D5ZC 1IGCA 1ZPSA 3Q8EA 1TS2A 2BT6A 3MJ5A 4O1NA 1L6VA 4YTPB 1N61A 1E0ZA 1MI0A 1C4AA 3BVMA 1XLOA 1YQ3B 2QILA 1YNTE 2BW2A 2AX5A 3ZYYX 3HUIA 1XLNA 2BB6A 2QEJC 2KMMA 1L4DB 4H2AA 1VZ6A 4NAWB 1YQ4B 1MHXA 2L1AA 2MJEA 5D7GA 3P42A 2Q5WD 1FM0D 1N60A 2KQ4X 3OWEB 3AE6B 1PGBA 1ZDXA 1TY2A 3FILA 1QILA 1SSNA 1SXTA 3L4PA 4TQ1A 2N9KA 2IPKD 1V1PA 3NZ3A 4L23A 1I4RA 5TSSA 4KKIA 2N7JA 1K52A 3BK1A 1YN5A 4US8A 1L0XB 1HEZE 2J42A 3J9CA 1C4PA 2V4IB 3CIRB 2PTLA 1DYQA 1ZDVA 4WH4A 1D4BA 2BB5A 4CQNA 1GB1A 2DWQA 3W9CB 4MH8A 1VJKA 1EWCA 3AV8A 1J7AA 1ET9A 1KF6B 3BVGA 1OFFA 2PKOA 2AQ1B 3I9V1 3AE3B 2KN4A 5E6JA 4RFBA 1CZPA 1SEBD 1XF5L 3Q69A 1XCQL 3TEWA 2WXQA 1SJED 4ZOHC 1FRDA 2V3PA 3SFEB 3IXSA 1JW9D 1KLUD 1PFDA 1P7FA 5T8IA 3GP7A 2WDQB 1CJEA 1IGDA 1VDVA 2LFIA 3P4RB 2J53A 2JXTA 2WXGA 2WU5B 1WYGA 3E56A 1YJJA 2RMMA 3I57A 1ZE3D 5BMGA 3P63A 4RCOA 1ZP0B 4XDDA 3NVWA 5H8YE 1F2RI 1BUIC 2RDHA 1EM7A 4KKJA 4NAMA 1QOBA 4RF1A 3U2SC 4IKGA 2OHFA 2Y5CA 1IBXA 3BIID 4USAA 1K51A 1XLPA 1HQRD 2K22A 3HVZA 3R2TA 3AN1A 1EWYC 3AEBB 1GB4A 3U7ZA 3ZJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FCL A;  2PW9 A;  4GLS C;  4IOI E;  5HHD G;  1IGC A;  3UI3 A;  3MP9 A;  2JWU A;  4HKZ E;  2K0P A;  2ON8 A;  2RPV A;  1QKZ A;  1JML A;  1FD6 A;  2JSV X;  1MHH E;  3V3X A;  1MI0 A;  5JXV A;  1YNT E;  1F2R C;  3FIL B;  1PGX A;  2QSD A;  4OZB A;  1P7E A;  2LHD A;  1MHX A;  1C9F A;  2KQ4 X;  4OZA A;  1PGB A;  2IGG A;  2LHE A;  2IGD A;  3FIL A;  2KAC A;  1HZ5 A;  2N9K A;  4MAC A;  1HZ6 A;  2N7J A;  1K52 A;  2GB1 A;  1HEZ E;  2JZP A;  2KDM A;  2ONQ A;  2I38 A;  2QMT A;  2J52 A;  2PTL A;  4WH4 A;  1D4B A;  1FCC C;  1GB1 A;  1UWX A;  5HI1 A;  2GI9 A;  2N9L A;  2IGH A;  2NMQ A;  1PGA A;  4KGR A;  1MVK A;  5BMH A;  2KN4 A;  2ZW0 A;  2OED A;  4KGS A;  2LUM A;  1XF5 L;  4KGT A;  2I2Y A;  1Q10 A;  1XCQ L;  5HFY A;  1K53 A;  1YMH E;  4OZC A;  1MPE A;  1IBX B;  3GB1 A;  1K50 A;  2PLP A;  1P7F A;  1KH0 A;  1IGD A;  1ZXH A;  2JU6 X;  5BMI A;  2J53 A;  2JXT A;  1XCT L;  4D2K A;  5BMG A;  2RMM A;  2EEL A;  1F2R I;  1EM7 A;  4HJG E;  4IKG A;  1IBX A;  1K51 A;  2KWD A;  2LGI A;  5HG2 A;  2ZW1 A;  1GB4 A; 
#chains in the Genus database with same CATH topology
 4RGT A;  1TBE A;  2ZPN A;  1E10 A;  4RM9 A;  2G4S A;  3A1Q B;  1N63 A;  3MFG A;  3UQB A;  4DQO C;  4IUM B;  1IPG A;  1GAQ B;  3EEC A;  1WX7 A;  3DBS A;  2JPH A;  2JRI B;  1WJU A;  2KDB A;  1RWS A;  3Q3N C;  2M4N A;  2XK5 A;  4CYE A;  4K7W A;  3APF A;  2LGY A;  4WJN A;  2DEN B;  3NS1 A;  4A3O A;  4ANU A;  1UNS A;  4YXD B;  1WXV A;  2JY6 A;  1STE A;  1NEK B;  4KZ0 A;  1R7S A;  2WXL A;  2I1K A;  2K9X A;  3OAW A;  1VRA B;  2HE7 A;  5DPW A;  2AEH A;  1I4P A;  1UWX A;  4W9L A;  2LZ6 A;  4RGO S;  5GMV A;  5C2T B;  2KJR A;  1WMH A;  2M19 A;  3RYT A;  3P1M A;  3EHV A;  1LM8 B;  2J0K A;  2MBO A;  2WDV B;  4BBN C;  1Q10 A;  4M02 A;  2BBC A;  2JXX A;  2B76 B;  1OQR A;  3PLV A;  4XC2 A;  4WAA A;  4GDL B;  4LJO B;  3M63 B;  2KZR A;  3EUB 2;  1ZXH A;  5IOI A;  1KRH A;  2MCN B;  2AQ2 B;  5JHA A;  1C78 A;  1SJH D;  3ZJU A;  1UF0 A;  4EZK A;  5KHO A;  4EOY A;  2D11 A;  1FFV A;  4BKT A;  1Q1O A;  2D10 A;  4HEA 1;  2KOX A;  3RCZ A;  4X57 B;  3MC0 B;  2ICI A;  3LB8 C;  3WAL A;  2A5U A;  2WXR A;  1BML C;  2V0G A;  4N58 A;  5I4D A;  5J2R A;  1VD2 A;  4E74 A;  4LTU A;  1JWB D;  1YJ1 A;  5E6O A;  2PJH A;  3DBL B;  4ZRK A;  3R66 C;  3NRZ A;  4ZRP A;  3FKY A;  1MHH E;  4MJS A;  3DWM A;  1CK1 A;  5GXG B;  5G5H A;  1N62 A;  4MM3 A;  3SR6 A;  1UWM A;  1VR9 A;  3H9D A;  2MJD A;  1NVI D;  2QIE B;  5AZF A;  4MGY E;  4EFO A;  2VH2 A;  3DVG Y;  1SIF A;  1R4M I;  4MT5 A;  3NS8 A;  4KV2 A;  1JQ4 A;  2M1M A;  3H1U A;  2NBW B;  1RM6 C;  2VRR B;  2KJ6 A;  3RT3 B;  5E6P A;  1WY8 A;  5BO4 B;  2MRP A;  4WWO A;  3ETR A;  3PO0 A;  1WE7 A;  3MTN B;  1RAX A;  4XWT A;  1V80 A;  2ZZP B;  2MJ3 A;  2IGH A;  2JRH A;  4REZ A;  1MVK A;  4GIV A;  1YIW A;  1T0R C;  4L1B A;  5FKA C;  4W9K A;  4B0E A;  1KFY B;  5HFY A;  1K53 A;  2Y5P A;  2JZ3 B;  2QHO A;  3AE5 B;  4B6W A;  1IYF A;  2RDB C;  1J8C A;  2KX0 A;  3R7R A;  1E5W A;  1WXQ A;  3I5J C;  5FK9 C;  2LRU A;  1TT5 B;  2XK5 B;  1SE4 A;  2L0T A;  4D2K A;  1XLQ A;  3H7S A;  2FIF A;  2KYW A;  1I35 A;  1L2N A;  2WXF A;  1GOZ A;  4GDK B;  4RGN A;  3AMZ A;  2FUG 1;  2M56 B;  1WJ4 A;  1FNV A;  3W2D A;  2KC2 A;  2M0X A;  1ZOY B;  3TMP B;  4AWJ A;  3TBL D;  2KTF A;  3GE3 C;  4NZL B;  3ZKJ C;  1AW7 A;  1F77 A;  3VTU A;  4LLG M;  4YSY B;  2YVC A;  2KWV B;  3MHS D;  2NPT B;  5IAA C;  2E3T A;  4C80 A;  2KWU B;  4M00 A;  4BZA A;  4W9I A;  1WMH B;  3BY4 B;  2JYE A;  2WX0 A;  1L5P A;  3PT2 B;  3L08 A;  4K7U A;  5AUK A;  4OZB A;  3JW0 X;  4IW0 A;  2SAK A;  3QJZ A;  1J0G A;  3RN9 C;  2PVO D;  1EU3 A;  4G3X B;  4C56 C;  1E8W A;  1GG3 A;  3PZ7 A;  3L0W B;  4WAF A;  4NNJ B;  4L2Y A;  3C19 A;  1QT9 A;  1C4C A;  1QQR A;  2V4L A;  3Q14 C;  1IUE A;  1E7U A;  4HPM B;  4N59 A;  1ZGU B;  2G1E A;  1OTR B;  2KMC A;  3UGB B;  4W9J A;  3SFD B;  3PV1 A;  3V6C B;  2N9L A;  3I3T B;  3Q8F A;  2WDR B;  5G55 A;  3ALB A;  2PE9 A;  4GN1 A;  4NQL B;  2O6V D;  2I2Y A;  4RM8 A;  1E90 A;  2ZNV B;  2BWF A;  1TS4 A;  4M0W A;  2LMC A;  4LNK A;  4XZ4 A;  1FEH A;  1JWS D;  4EUT A;  2L00 B;  1XCT L;  4P1B C;  2AQ3 B;  2FAZ A;  5D2M B;  1YN3 A;  2KDI A;  3HM3 A;  3DWG C;  4C7Z A;  1ZUD 2;  1DOY A;  1HTO A;  1L0Y B;  2JVC A;  2C5L C;  1TZO A;  3PZ8 A;  1FXI A;  1V81 A;  2DLB A;  4A9A A;  3ZIM A;  1V1O A;  3CMM B;  4W9G A;  5DPT A;  1RFK A;  1XXG A;  2HJ1 A;  1D5Z C;  4LNF A;  1LGR A;  2BT6 A;  2EMT A;  1L6V A;  3KW5 B;  4YTP B;  1N61 A;  3HK0 A;  2QIL A;  3ZYY X;  1IP9 A;  4PS3 A;  2LAS A;  2QEJ C;  2MBH A;  1VZ6 A;  3PRE A;  3DPD A;  1MJD A;  3UIN B;  3RNE C;  2KQ4 X;  4KIK A;  3N20 C;  4NQK E;  5IP4 D;  4RMA A;  3CSF A;  1WI0 A;  1E7V A;  1SSN A;  2KFK B;  3DVN V;  3GE8 C;  2IPK D;  4A20 A;  2KO3 A;  2BVC A;  2N1V A;  3BK1 A;  2BF8 B;  1XQQ A;  2PTL A;  1DYQ A;  1ZDV A;  5CHW A;  2N9E B;  1UEL A;  3ZUN A;  4E3C A;  1VJK A;  1OFF A;  1XD3 B;  4W9C A;  4W9E A;  2M17 A;  3AE3 B;  2KK8 A;  3PSE B;  2A4Z A;  5AZG A;  2C60 A;  2K8C A;  3AU5 A;  1JW9 D;  2WDQ B;  1J19 A;  2KC1 A;  2WXG A;  3E56 A;  3I57 A;  1TGZ B;  3U8Z A;  3NVW A;  1F2R I;  4IKG A;  2OHF A;  1HQR D;  1WRD B;  2DAJ A;  5AZH A;  3AN1 A;  1EWY C;  2BKF A;  3AEB B;  3RMK C;  5DPS A;  2IND C;  2NS5 A;  5MPO A;  1GUA B;  4IOI E;  2KXJ A;  4ASW C;  5LXH A;  2FID A;  5JXV A;  3EFU A;  3QAR A;  2VZK B;  3UIO B;  1F2R C;  2R61 A;  4DHJ D;  1PGX A;  2MP2 B;  4IDI A;  5IN7 A;  2XNA C;  3QQ8 B;  2OJW A;  2IZV B;  4A8X C;  3AH7 A;  1RYJ A;  2AL6 A;  3KVF B;  4B0M A;  3PLU A;  3PTF C;  1DOX A;  3MJW A;  2CJO A;  2W54 A;  3VRA B;  3ZQ4 A;  2R2Q A;  1SB3 C;  4JWS C;  1FPY A;  4S17 A;  1P9D U;  2BS4 B;  3E9S A;  1P0R A;  2BS3 B;  4NAW A;  1L4Z B;  1F0Z A;  3B2G A;  2N9X A;  3NHE B;  4DWF A;  2QMT A;  3KH0 A;  2GOW A;  1S3S G;  4HPP A;  4WIP A;  1EO6 A;  2KTR A;  1ZXI A;  2REX A;  5IA7 A;  3S2A A;  4ITK A;  1PGA A;  2MEK A;  2WXO A;  2N7D A;  4KGR A;  2W55 A;  3FAH A;  1SE2 A;  4YSZ B;  2O2V A;  4WJO A;  4YL8 A;  1OEY A;  3Q8C A;  1KJT A;  2JQR B;  2JYT A;  4OZC A;  4K1R B;  3OJ3 A;  3KYD D;  2Z59 B;  4FJZ A;  2L7R A;  4GB9 A;  2E6X A;  3NY5 A;  3L54 A;  5BMI A;  3Q3F A;  1QOA A;  1I7H A;  3AE4 B;  2D3G A;  3VH3 B;  1YD8 U;  3JYU A;  4HKQ A;  4R3D A;  2BGF A;  2KWD A;  2AWT A;  1NYR A;  2GBJ A;  1V97 A;  2KVR A;  1ZW7 A;  1HE8 A;  4YWG G;  4JE3 B;  3UI3 A;  3MP9 A;  3ENE A;  2LGD A;  4YSX B;  2L32 A;  2NTS A;  1KLG D;  4ICV A;  3B08 A;  3DBL I;  4W9D A;  2WQY B;  5BYS A;  1PYW D;  1AWD A;  2H88 B;  2IDY A;  4MH0 E;  4YTN B;  4GOC A;  3KLS X;  4ANX A;  5AUI A;  1C79 A;  4GMV A;  3O65 B;  2WGS A;  2W3S A;  2EKI A;  4C4V B;  4WQM A;  1TS3 A;  3AEC B;  1F52 A;  2RPQ A;  3WAP A;  4K3C A;  4UDU C;  4E71 A;  1A70 A;  3NUH B;  1HZ5 A;  2LVO A;  3AE7 B;  3EGR A;  2IY1 B;  2KWC A;  3WAN A;  3EA6 A;  2W9N A;  2VH1 A;  1EUV B;  2MSE D;  2JWZ A;  3N1X C;  3R8B A;  4IM0 A;  1LQB A;  4OVU A;  2MBQ A;  4WWN A;  3U52 E;  2MA9 B;  1WGD A;  1LO5 D;  4LDT D;  2QCZ A;  1DGJ A;  2FBW B;  5C1Z A;  4W9F A;  3SD5 A;  4IC7 B;  1XT9 B;  3APC A;  4I6N B;  4US9 A;  1UUP A;  3IT6 B;  3PRZ A;  1D3Z A;  4K3B A;  3N32 A;  3ZXV A;  1K50 A;  2WXM A;  3N1Y C;  3TSS A;  2ZJD A;  5D3I B;  3TEY A;  4FLH A;  1G6J A;  4MEL A;  3AM9 A;  3Q6B A;  4HRO A;  1AYF A;  3AED B;  1WJN A;  4N6E B;  2DBY A;  3BK2 A;  4AS1 A;  3W1S A;  2BKR B;  1WYW B;  3A4S C;  4BAX A;  2J0J A;  5HHD G;  2G3Q B;  2ON8 A;  4EZL A;  2MQJ A;  1D5X C;  1RFA A;  5TR5 A;  1M94 A;  4BKS D;  3A9K A;  2XN9 C;  2IBI B;  4JQW C;  3RD2 A;  3DVG X;  4FJY A;  4YT0 B;  1Z2M A;  2LWP A;  2LGX A;  3FIL B;  3ZO5 B;  3LJ3 A;  3W1Y A;  3ZNZ B;  5IKC M;  4DK5 A;  2K1F A;  4M8N A;  1XO3 A;  2G4D B;  2M0A A;  3TEX A;  3H6N A;  3AE2 B;  3CWI A;  4OW0 A;  2J7Q B;  2AL3 A;  3Q2A C;  4AQ7 A;  3LYY A;  2KDM A;  2ONQ A;  2PMV A;  3NVY A;  2C7M B;  4HDQ A;  1SGH A;  3AI5 A;  1SIJ A;  3TCA A;  3VXW A;  1FCC C;  3Q3J A;  1C76 A;  1TKE A;  4PK1 A;  2WU2 B;  4XDC A;  2WYQ A;  2XEW A;  1FRR A;  3Q3O C;  4BFR A;  1QF6 A;  3ZGZ A;  4PS7 A;  2FCN A;  4KZC A;  1WXS A;  2ACZ B;  2KT7 A;  4I6L B;  3R7Q A;  3TJP A;  3HHM A;  1IBX B;  3N3K B;  3VH4 B;  4N9F 4;  1WH3 A;  1DOI A;  2H89 B;  1ESF A;  1KH0 A;  1TTN A;  4J6I A;  3GS2 A;  2QC8 A;  1B9R A;  4HVB A;  1MG4 A;  4ZRJ A;  1WSP A;  3W5U B;  1E6E B;  2NBU A;  1FXT B;  3MHZ A;  2DYM A;  4QAY A;  2PW9 A;  1BT0 A;  4GLS C;  1SE3 A;  1D6E C;  3P4S B;  3VR8 B;  1MFW A;  2ZNV C;  1YOV B;  3Q8E A;  4DHZ B;  2D07 B;  4GXB A;  3AXC A;  1MI0 A;  5J17 A;  3BVM A;  1XLO A;  4EZJ A;  2BW2 A;  2AX5 A;  3PPA A;  3PRM B;  3WAM A;  1QZE A;  2ZCB A;  3B0A A;  2KMM A;  3JSV A;  1L4D B;  4H2A A;  5D7G A;  1UD7 A;  3NZS A;  1N60 A;  2DZM A;  3V60 A;  3OWE B;  1WR6 E;  3UIP B;  2YLM A;  4S0R A;  1QIL A;  3HIZ A;  3ZRC A;  1V1P A;  3NZ3 A;  4L23 A;  5TSS A;  1H8C A;  3L17 A;  1V9J A;  3X23 A;  2J42 A;  3J9C A;  1WX8 A;  1C4P A;  1WGR A;  1WZ3 A;  4WH4 A;  1D4B A;  2BB5 A;  3W9C B;  3UQA A;  2IO1 B;  4MH8 A;  4G11 A;  1EWC A;  3RNF C;  1J7A A;  2Y5B B;  2HJ8 A;  2PKO A;  3I9V 1;  2KQ7 A;  3KUC B;  1CZP A;  1SEB D;  1N6Z A;  3D32 A;  5LLI A;  3SFE B;  5T8I A;  2UYZ B;  5EDS A;  2ZVO A;  2JXT A;  1OEY J;  1WYG A;  2RMM A;  1ZE3 D;  5H8Y E;  2RDH A;  1EM7 A;  1WE6 A;  3ZRF A;  1E8Z A;  3BII D;  1K51 A;  1XLP A;  4MJS B;  1SE9 A;  1GB4 A;  3U7Z A;  4NPN A;  1WGG A;  4MM3 B;  5BYQ A;  4F7Z A;  4K7S A;  1RLF A;  2K0P A;  2L76 A;  3N9Y C;  2HD5 B;  2Z0E B;  3DHI C;  5EE3 A;  2YEP F;  4P16 A;  2WDT B;  2D3C A;  1I4H A;  3BWU D;  4F8C B;  4ICU A;  3DVN U;  2PE6 B;  4M01 A;  1P7E A;  3AB5 A;  1C9F A;  1C1Y B;  2WXK A;  2Z8L A;  1BXT A;  3ABV B;  1D5M C;  2KAJ A;  4BOZ B;  3WCQ A;  2GBR A;  2JUO A;  2FCM A;  1J7B A;  3VVW B;  3IVF A;  1ET6 A;  2KAC A;  4KDL B;  3EFC A;  1WGK A;  4TUU A;  4TMA B;  1HZ6 A;  1FIQ A;  3N1Z C;  1NEN B;  2L0F A;  4HDO A;  2KD0 A;  4P1C C;  2NBV B;  4ZRI A;  1ROE A;  5AEK B;  3L10 B;  1X1M A;  3WIM A;  3V05 A;  3URY A;  4J3O D;  3UF8 A;  1Y56 A;  2FE8 A;  3KYC D;  4FHJ A;  4ARI A;  3VR9 B;  3LXF A;  5E6N A;  2DAF A;  2GBK A;  2NMQ A;  3VAW A;  3P2B A;  5BMH A;  1TS5 A;  4CO7 A;  3T3O A;  5JZE B;  3NVZ A;  4C00 A;  2ZPY A;  3C8Y A;  3TEZ A;  1P1A A;  3GB1 A;  1YN4 A;  2NVU I;  3IT4 B;  2EKE C;  3QWZ B;  2JX5 A;  4GGQ A;  4P7I A;  3O13 A;  1FXA A;  3ZXR A;  1EU4 A;  3NJT A;  2ASQ A;  5LNK 1;  5HG2 A;  4JL9 A;  2IO3 B;  2I1J A;  1FCL A;  4DHZ E;  1GC6 A;  4KSL C;  4XGA B;  1WXA A;  2K25 A;  1J7C A;  4FN2 A;  5G5G A;  1ACC A;  3ZNG C;  3T3N A;  2K39 A;  4RNA A;  2BQQ A;  2FUH B;  5CHF A;  5EE1 A;  2RPV A;  4HCP B;  3IBE A;  1QKZ A;  4AUQ C;  5L83 A;  2QDF A;  4RGM A;  2KVZ A;  2LRW A;  4WQO B;  4OVZ A;  3KWL A;  3ZLZ A;  5BYR A;  3C0R B;  1UZX B;  5J18 A;  1WRI A;  3A1Q A;  1C3T A;  1JWA D;  2KAN A;  1Q5W B;  2DZK A;  3HM6 X;  4NJ7 A;  1L6U A;  3RI7 C;  4OZA A;  1H4R A;  2HTM E;  2LD9 A;  2C9W B;  3CST A;  2L3Z A;  2N0S B;  5CX3 A;  2CU3 A;  1QOG A;  2LHE A;  3RZW C;  1YX5 B;  1WGH A;  3JVZ X;  4MEM A;  3QC8 B;  3M3J A;  3SDL C;  3Q3M C;  3NZU A;  3H8H A;  2C7H A;  2DX5 B;  1KM7 A;  3EC8 A;  2XBB C;  1L7Y A;  1VCB A;  4HCN B;  2CHW A;  4M0W B;  2MHJ A;  3OG5 A;  2LUE A;  2DHZ A;  3KWV A;  2PVG C;  1TKY A;  3DCG A;  3QIJ A;  3KUZ A;  2PIA A;  4RH6 A;  2OED A;  4KGT A;  2TSS A;  3ECI A;  4TKN A;  1I4Q A;  4F1S A;  2IO0 B;  2KX3 A;  3RNA C;  2NCN A;  3AEA B;  4ZHP A;  4WWM A;  1T6B X;  2X8X X;  3A9J A;  4ZHO A;  2WXJ A;  1GC7 A;  2KKC A;  1V5O A;  3TUO A;  1R4N B;  1K8R B;  1OQY A;  2L8J A;  1UH6 A;  2LGI A;  3A4R A;  1JRP A;  2LI5 A;  4MGZ E;  2IY0 B;  2CJN A;  3GOE A;  2EMS A;  2G9H D;  2L52 A;  4A3P A;  1EF5 A;  2WXN A;  2BWE S;  1WZ0 A;  1VZ8 A;  1FO4 A;  3RNG C;  4CHK A;  1FFU A;  2W3R A;  1JML A;  1FD6 A;  4KIK B;  3GZN B;  2GBN A;  1WJ6 A;  1GJZ A;  1WIA A;  2BYV E;  3DHG C;  3VUW A;  3RFZ B;  1N5W A;  1T3Q A;  1WM3 A;  5CHV C;  4DXF A;  2J0M A;  2KHW B;  1Q0W B;  4DXA B;  3W5V B;  4TV3 A;  4PS8 A;  2IGG A;  2JT4 B;  3T9L A;  2INC C;  2K6D B;  4YTM B;  4RF0 A;  1TY0 A;  2VZK D;  3RPF C;  1C77 A;  3BYY B;  2WX1 A;  1VLB A;  2GB1 A;  4K81 A;  2YEP B;  1FNU A;  4EKU A;  3DBR B;  4JIO U;  1V8C A;  4P6V F;  2IYD B;  3TL5 A;  1TYG B;  1TZ1 A;  1YQB A;  4EEW A;  1VZ7 A;  2GRI A;  3B9J A;  2V3N A;  2LUM A;  4ZYN A;  4AJY B;  3IHP C;  4JPS A;  4JX1 C;  1T5X D;  1YMH E;  4MGK E;  2LEK A;  1V49 A;  2WS3 B;  3AEE B;  3VRB B;  1UGM A;  2CHZ A;  3ZTD A;  2PLP A;  3B2F A;  2L83 A;  1QOF A;  4I6P A;  2SEB D;  3DHH C;  2WXI A;  1XEE A;  2WXH A;  3Q8A A;  2R2O A;  2KJH B;  3AE9 B;  5FR3 A;  1YJI A;  3MC9 A;  2O6V A;  3IG3 A;  3NG0 A;  3ZW3 A;  1UGJ A;  4HPL B;  3U30 A;  4JLC A;  4W9H A;  1CQV A;  3ML9 A;  4LNI A;  4TQ0 A;  3WA0 A;  5KHQ A;  3APD A;  3N30 A;  4GDK A;  3MC8 A;  2RGF A;  2JZZ A;  4O1N A;  1E0Z A;  4LCD E;  3HUI A;  3PGE A;  1XLN A;  2N4F A;  4FUL A;  4NAW B;  1YQ4 B;  4NJ6 A;  2KNB A;  4NY0 A;  2MJE A;  3V6E B;  2MBB B;  1FM0 D;  1WFY A;  2KLG A;  2NPT A;  1AAR A;  4HLE A;  1ZDX A;  2ZCC A;  2G45 B;  3A9J B;  1E8X A;  2KTR B;  2N1W A;  3L4P A;  2N9K A;  2NR2 A;  1I4R A;  4KKI A;  2N7J A;  1K52 A;  4KVG B;  2O2V B;  4AJW A;  1L0X B;  1HEZ E;  3CIR B;  3K9O B;  1GB1 A;  2DWQ A;  3ZDM C;  3L16 A;  3AV8 A;  4KSK C;  1ET9 A;  1JRU A;  1XF5 L;  2AYO B;  3Q69 A;  1XCQ L;  3M95 A;  2DYB A;  1SJE D;  2Z0D B;  1FRD A;  4URK A;  1KLU D;  1P7F A;  2UU7 A;  1I42 A;  1NI2 A;  1V2Y A;  3GP7 A;  1VDV A;  2LFI A;  3DDC B;  2WU5 B;  1OGW A;  3BIN A;  4RCO A;  4MSM B;  1ZP0 B;  2K8B A;  4XDD A;  3W1S C;  1BUI C;  1QOB A;  2CR5 A;  2Y5C A;  5LXI B;  4HXD A;  2WHI A;  2K22 A;  2LXA A;  4BOS C;  4GU2 A;  3PRP B;  2V9H A;  1T0Y A;  3ZJV A;  3HVD A;  4HKZ E;  2OOB B;  4FA6 A;  4II3 B;  3QK0 A;  1RRB A;  3V3X A;  4XE0 A;  4LNN A;  1JRO A;  1JCK B;  3AEG B;  1CMX B;  2HDE A;  2K3U A;  4HK2 A;  2W82 A;  1AN8 A;  3RUI B;  1NI3 A;  2LHD A;  1WGY A;  4ZRQ A;  4G50 A;  1PDX A;  3U7D A;  4XYC A;  3DQV A;  4ANV A;  4GSW A;  1NYQ A;  1I4X A;  2O6V B;  4ZDV A;  1KLV A;  2RD0 A;  3KUD B;  4WJQ A;  2IJ0 A;  1OQQ A;  2DZI A;  2JZP A;  2GBM A;  4HJK A;  4MGI E;  2K5P A;  3VQI A;  3RZF A;  2KFK A;  4FAD A;  3VUX A;  2BTE A;  2ZW0 A;  2RSU A;  1ENF A;  3BZD B;  4KGS A;  2CHX A;  3HRD D;  2OJR A;  3AE8 B;  2JF5 A;  3P4Q B;  1MPE A;  1FNW A;  4DXG A;  5G2N A;  3ZTC A;  3PZD A;  3IAM 1;  4FXC A;  2MX2 A;  4C7Y A;  1PUT A;  1Z5S B;  4A55 A;  2WLB A;  4BKG A;  4B95 A;  1KOT A;  3PHW B;  3AEF B;  3TIX A;  3VFK A;  5C23 A;  1QLB B;  3OLM D;  1L0V B;  1WX9 A;  4DDG D;  1U4A A;  3P4P B;  1GPX A;  3A9K B;  3BVZ A;  4PT5 A;  1V6E A;  1FMA D;  3ZJT A;  3ZVV A;  4IM3 A;  2BYT A;  2D3B A;  4TSS A;  4EE2 A;  4JWU C;  1PQS A;  4ACF A;  1UBQ A;  5HKH A;  3DBH I;  2JWU A;  3SEB A;  4PYZ A;  1SBB B;  1TKG A;  4ZYS A;  4MDK E;  3ONS A;  3VHT C;  3R2I A;  3AE1 B;  2N7E A;  2FNJ B;  3R3M A;  5EE0 A;  1JAL A;  2DYO A;  2QSD A;  2INP E;  1R4M B;  2N9P C;  3RNB C;  2ZVN A;  3IFW B;  1WM2 A;  2K6Q A;  2NTT A;  5C3J B;  4XWW A;  2MH7 A;  3FC4 A;  2MW5 A;  3NVV A;  2D2Q A;  2MP2 A;  2MBE A;  1T0Q C;  4MAC A;  3K9P B;  5H92 C;  4B9K A;  3CF6 E;  1MG8 A;  4WJP A;  2L05 A;  2QJL A;  2I38 A;  4WWP A;  2X38 A;  1ZKH A;  3B1L X;  2LXC A;  1S1Q B;  1F1H A;  3QX1 A;  2GI9 A;  4ARC A;  3LDZ E;  3X0W A;  1KTK A;  4IM2 A;  4HRS A;  1HTQ A;  1JWU D;  2ZEQ A;  3AU4 A;  2BS2 B;  1UBI A;  2GLS A;  3QA8 A;  2HTH A;  1LXD A;  2JU6 X;  4LNO A;  5DPR A;  1P3Q U;  1V5T A;  1WXM A;  2EEL A;  2V1Y A;  3QCA A;  1Y8R C;  2BYF A;  5IO9 A;  4HJG E;  3PHX B;  4DHJ B;  1R4N I;  4A6Q A;  1JWM D;  2BPS A;  3RNC C;  3WAO A;  3JSV B;  4FBJ B;  1WF9 A;  2IO2 B;  2WNM A;  5JHB A;  1E9M A;  3M62 B;  2CS4 A;  1NBF C;  2JSV X;  4IWP A;  3H7P A;  1HA5 A;  2V3S A;  4WUR A;  2LVP A;  3GZN I;  4A90 A;  1WR1 A;  3Q8B A;  3RUL A;  3V61 A;  1V1P B;  3BYT B;  1HXY D;  1T0S C;  3DBH B;  1I4G A;  5JH5 C;  1P98 A;  2DZJ A;  4BKS A;  3VDZ A;  4LJP B;  2IGD A;  2WXP A;  2RDG A;  4KX6 B;  2INN E;  2PPH A;  4PYU A;  4BVU C;  4C4V A;  2J52 A;  4NJC A;  2WP9 B;  1B1Z A;  2J4X A;  3DBR I;  3U4E G;  5FR6 A;  3DOW A;  5HI1 A;  3IAS 1;  4XX5 A;  2LJI A;  4Q2J A;  2KFJ A;  2D5G A;  2WWZ A;  2MWS B;  2MLB A;  3ZNH B;  5D3D A;  5D6J B;  4JGH B;  2Y3A A;  1GNU A;  3SU8 X;  4OVV A;  2DNF A;  4OHJ A;  3ZDT A;  4AP4 C;  2KN5 A;  3KQ4 A;  2BYE A;  1M4V A;  5D94 A;  2KDF B;  1LFD A;  5CTR C;  1TJE A;  3QAQ A;  5L95 C;  1E7P B;  4HWI B;  2ZW1 A;  5EE9 A;  2KMA A;  3A33 B;  4LK0 M;  1TIF A;  4ANW A;  1WWT A;  1SF0 A;  1N5X A;  1IGC A;  3ML8 A;  1ZPS A;  4FJV B;  1ISN A;  2K8H A;  1TS2 A;  3MJ5 A;  1NDD A;  1C4A A;  1YQ3 B;  4AOF A;  1YNT E;  2FCQ A;  3T8M A;  4GDL A;  2BB6 A;  4BBN F;  4FHK A;  1MHX A;  2L1A A;  3P42 A;  2Q5W D;  2LJ5 A;  4DDI D;  4DBG A;  4LDT B;  2B3A A;  4KDI C;  3AE6 B;  1PGB A;  3OJ4 B;  1TY2 A;  5DCN A;  3FIL A;  1SXT A;  4MSQ B;  4TQ1 A;  3PVL A;  1YN5 A;  2LGS A;  4US8 A;  2V4I B;  4IG7 B;  1A5R A;  1E8Y A;  4CQN A;  2GMI C;  1KF6 B;  3BVG A;  2AQ1 B;  3L13 A;  3SHQ A;  2KN4 A;  5E6J A;  2KLC A;  2CKH B;  4RFB A;  1V86 A;  2KDE B;  3QHT A;  2CU1 A;  3H7P B;  2PEA A;  3TEW A;  2WXQ A;  4ZOH C;  2V3P A;  3VTV A;  3I63 C;  3IXS A;  1PFD A;  3V62 A;  4IWQ A;  1CJE A;  1IGD A;  3VUY A;  3P4R B;  2J53 A;  2UWQ A;  2FCS A;  3AUL A;  2M8S A;  5BMG A;  1YJJ A;  3P63 A;  4G0N B;  3PS6 A;  2RR9 A;  4II2 B;  2D3A A;  1YX6 B;  4KKJ A;  4NAM A;  3ZNI D;  4RF1 A;  4M8M A;  3U2S C;  4IWO A;  2C7N B;  1IBX A;  1F9J A;  4USA A;  3NOB A;  3HVZ A;  3VTW A;  3R2T A;  2KQS A;  1EF1 A;  2LVQ A; 
#chains in the Genus database with same CATH homology
 4RGT A;  4MM3 B;  5MPO A;  4IOI E;  1E10 A;  5BYQ A;  3HVD A;  4HKZ E;  1N63 A;  2K0P A;  3N9Y C;  3MFG A;  5EE3 A;  4DQO C;  2YEP F;  1GAQ B;  3V3X A;  4P16 A;  5JXV A;  4XE0 A;  1I4H A;  3BWU D;  2VZK B;  1JRO A;  1JCK B;  1F2R C;  3AEG B;  2R61 A;  2HDE A;  2K3U A;  1PGX A;  4IDI A;  2W82 A;  1RWS A;  1AN8 A;  2XNA C;  4A8X C;  1P7E A;  3AH7 A;  1NI3 A;  2LHD A;  3AB5 A;  1RYJ A;  4ZRQ A;  2WXK A;  1C9F A;  2Z8L A;  1BXT A;  1PDX A;  3ABV B;  3NS1 A;  4B0M A;  1D5M C;  2KAJ A;  3WCQ A;  1DOX A;  2CJO A;  2W54 A;  3VRA B;  1J7B A;  3ZQ4 A;  1UNS A;  1SB3 C;  1ET6 A;  2KAC A;  1NYQ A;  1WGK A;  1I4X A;  4JWS C;  4YXD B;  1STE A;  1NEK B;  2BS4 B;  1R7S A;  3E9S A;  4TMA B;  1HZ6 A;  1FIQ A;  2BS3 B;  2IJ0 A;  1NEN B;  2WXL A;  1L4Z B;  1F0Z A;  1OQQ A;  1ROE A;  2JZP A;  3B2G A;  2K9X A;  2QMT A;  1VRA B;  3V05 A;  3URY A;  2K5P A;  4J3O D;  4WIP A;  1I4P A;  3VQI A;  1Y56 A;  2FE8 A;  1ZXI A;  1UWX A;  4ARI A;  4RGO S;  3VR9 B;  4ITK A;  5C2T B;  3LXF A;  2NMQ A;  1PGA A;  2MEK A;  2WXO A;  4KGR A;  2BTE A;  2W55 A;  5BMH A;  2M19 A;  1SE2 A;  3FAH A;  2ZW0 A;  4YSZ B;  1TS5 A;  1ENF A;  3BZD B;  3P1M A;  4KGS A;  3T3O A;  3HRD D;  2WDV B;  3NVZ A;  1Q10 A;  3AE8 B;  3Q8C A;  2BBC A;  3C8Y A;  2JQR B;  2JYT A;  1MPE A;  3P4Q B;  4OZC A;  1FNW A;  3TEZ A;  2B76 B;  4DXG A;  3GB1 A;  1OQR A;  1YN4 A;  3IT4 B;  3IAM 1;  4GDL B;  4FXC A;  2E6X A;  3EUB 2;  4C7Y A;  1ZXH A;  5BMI A;  1PUT A;  1KRH A;  2AQ2 B;  4A55 A;  2JX5 A;  2WLB A;  1C78 A;  1SJH D;  3O13 A;  3ZJU A;  1QOA A;  1I7H A;  3AE4 B;  3AEF B;  1FXA A;  1QLB B;  1EU4 A;  1L0V B;  1FFV A;  4HKQ A;  4R3D A;  2KWD A;  3P4P B;  5LNK 1;  5HG2 A;  1GPX A;  4HEA 1;  3BVZ A;  4PT5 A;  1FMA D;  1NYR A;  3ZJT A;  3MC0 B;  1FCL A;  2BYT A;  2ICI A;  4TSS A;  1V97 A;  3LB8 C;  4YWG G;  4EE2 A;  4JWU C;  2WXR A;  1BML C;  1J7C A;  4JE3 B;  4N58 A;  5I4D A;  2V0G A;  5G5G A;  3UI3 A;  4LTU A;  1JWB D;  3MP9 A;  1ACC A;  2JWU A;  3SEB A;  3T3N A;  4ZYS A;  1SBB B;  1TKG A;  4RNA A;  5EE1 A;  4YSX B;  2RPV A;  2L32 A;  2NTS A;  1KLG D;  1QKZ A;  3NRZ A;  4ZRP A;  1MHH E;  2WQY B;  5BYS A;  1PYW D;  1AWD A;  2H88 B;  2IDY A;  4RGM A;  3DWM A;  4YTN B;  3KLS X;  3R2I A;  3AE1 B;  1CK1 A;  5GXG B;  5G5H A;  1N62 A;  5EE0 A;  5AUI A;  1JAL A;  3SR6 A;  1UWM A;  4OVZ A;  2DYO A;  2QSD A;  3KWL A;  5BYR A;  1C79 A;  1VR9 A;  2INP E;  2MJD A;  1NVI D;  2QIE B;  1WRI A;  1JWA D;  2W3S A;  2EKI A;  1L6U A;  2NTT A;  4MT5 A;  4OZA A;  4WQM A;  2HTM E;  1JQ4 A;  5C3J B;  1TS3 A;  2N0S B;  3AEC B;  2CU3 A;  4XWW A;  1QOG A;  1RM6 C;  2LHE A;  2MH7 A;  3FC4 A;  3NVV A;  4UDU C;  1A70 A;  3NUH B;  1HZ5 A;  3AE7 B;  3EGR A;  4MAC A;  3H8H A;  5H92 C;  3EA6 A;  3R8B A;  2QJL A;  2I38 A;  3ETR A;  3PO0 A;  2X38 A;  3U52 E;  1LO5 D;  4XWT A;  1DGJ A;  2MJ3 A;  3KWV A;  2GI9 A;  2FBW B;  2PVG C;  4ARC A;  1TKY A;  2IGH A;  4REZ A;  1KTK A;  1MVK A;  2PIA A;  4RH6 A;  2OED A;  4HRS A;  4L1B A;  4US9 A;  1UUP A;  5FKA C;  4KGT A;  3IT6 B;  4B0E A;  1KFY B;  1JWU D;  2TSS A;  1K53 A;  5HFY A;  2Y5P A;  3AE5 B;  1I4Q A;  2BS2 B;  1K50 A;  2WXM A;  3TSS A;  3AEA B;  1WXQ A;  4ZHP A;  4WWM A;  2JU6 X;  5FK9 C;  5D3I B;  1T6B X;  3TEY A;  1SE4 A;  4D2K A;  1XLQ A;  4ZHO A;  2WXJ A;  2EEL A;  3AM9 A;  2WXF A;  1GOZ A;  4GDK B;  4RGN A;  4HJG E;  3TUO A;  4HRO A;  1AYF A;  3AED B;  2LGI A;  2DBY A;  3BK2 A;  4N6E B;  3AMZ A;  1JRP A;  4AS1 A;  2FUG 1;  3W1S A;  2M56 B;  2CJN A;  4A6Q A;  1FNV A;  2G9H D;  1JWM D;  2L52 A;  3W2D A;  1ZOY B;  5HHD G;  2WXN A;  4NZL B;  1AW7 A;  1F77 A;  4LLG M;  4YSY B;  1VZ8 A;  1FO4 A;  2WNM A;  1E9M A;  2ON8 A;  1FFU A;  2W3R A;  1JML A;  1FD6 A;  2JSV X;  1D5X C;  2E3T A;  4C80 A;  1HA5 A;  2XN9 C;  4WUR A;  2JYE A;  4YT0 B;  3RFZ B;  3FIL B;  4A90 A;  1N5W A;  1T3Q A;  1L5P A;  3Q8B A;  5AUK A;  1V1P B;  4OZB A;  3BYT B;  4DXF A;  1HXY D;  2SAK A;  1XO3 A;  1I4G A;  2M0A A;  3W5V B;  3TEX A;  2PVO D;  1EU3 A;  3AE2 B;  3CWI A;  4OW0 A;  2IGG A;  2IGD A;  4C56 C;  2WXP A;  4YTM B;  2RDG A;  4RF0 A;  4KX6 B;  3PZ7 A;  2INN E;  4AQ7 A;  1TY0 A;  2VZK D;  4WAF A;  3RPF C;  4L2Y A;  1C77 A;  3BYY B;  1QT9 A;  1C4C A;  1VLB A;  3LYY A;  2GB1 A;  2YEP B;  2KDM A;  2ONQ A;  1QQR A;  1FNU A;  2PMV A;  3NVY A;  2J52 A;  1IUE A;  1SIJ A;  4NJC A;  1FCC C;  1V8C A;  4N59 A;  2WP9 B;  1B1Z A;  1C76 A;  1TKE A;  2J4X A;  4P6V F;  2WU2 B;  4XDC A;  1TYG B;  2G1E A;  3U4E G;  1FRR A;  5HI1 A;  3SFD B;  3IAS 1;  1QF6 A;  2N9L A;  3ZGZ A;  1VZ7 A;  2LJI A;  3Q8F A;  2WDR B;  2GRI A;  3B9J A;  2V3N A;  2ACZ B;  2LUM A;  4Q2J A;  2D5G A;  2I2Y A;  4JPS A;  4JX1 C;  1T5X D;  1YMH E;  1TS4 A;  2LEK A;  5D3D A;  4M0W A;  1IBX B;  2WS3 B;  3AEE B;  3VRB B;  1DOI A;  2H89 B;  2LMC A;  2PLP A;  3B2F A;  1ESF A;  1KH0 A;  2L83 A;  1QOF A;  2Y3A A;  2SEB D;  2WXI A;  1FEH A;  1XEE A;  1JWS D;  2WXH A;  4OHJ A;  3Q8A A;  1XCT L;  3KQ4 A;  3GS2 A;  1M4V A;  2AQ3 B;  3AE9 B;  1B9R A;  5FR3 A;  1YJI A;  1YN3 A;  1WSP A;  3W5U B;  3DWG C;  4C7Z A;  1E6E B;  1ZUD 2;  1DOY A;  1L0Y B;  1TJE A;  1UGJ A;  1E7P B;  1TZO A;  3PZ8 A;  1FXI A;  2DLB A;  4A9A A;  1V1O A;  2ZW1 A;  5EE9 A;  3MHZ A;  2DYM A;  4LK0 M;  1RFK A;  1CQV A;  1XXG A;  2PW9 A;  4GLS C;  1SE3 A;  1D6E C;  3P4S B;  1WWT A;  1SF0 A;  1N5X A;  3VR8 B;  4TQ0 A;  1D5Z C;  1IGC A;  1ZPS A;  3Q8E A;  1TS2 A;  2BT6 A;  3MJ5 A;  4O1N A;  1L6V A;  4YTP B;  1N61 A;  1E0Z A;  1MI0 A;  1C4A A;  3BVM A;  1XLO A;  1YQ3 B;  2QIL A;  1YNT E;  2BW2 A;  2AX5 A;  3ZYY X;  3HUI A;  1XLN A;  2BB6 A;  2QEJ C;  2KMM A;  1L4D B;  4H2A A;  1VZ6 A;  4NAW B;  1YQ4 B;  1MHX A;  2L1A A;  2MJE A;  5D7G A;  3P42 A;  2Q5W D;  1FM0 D;  1N60 A;  2KQ4 X;  3OWE B;  3AE6 B;  1PGB A;  1ZDX A;  1TY2 A;  3FIL A;  1QIL A;  1SSN A;  1SXT A;  3L4P A;  4TQ1 A;  2N9K A;  2IPK D;  1V1P A;  3NZ3 A;  4L23 A;  1I4R A;  5TSS A;  4KKI A;  2N7J A;  1K52 A;  3BK1 A;  1YN5 A;  4US8 A;  1L0X B;  1HEZ E;  2J42 A;  3J9C A;  1C4P A;  2V4I B;  3CIR B;  2PTL A;  1DYQ A;  1ZDV A;  4WH4 A;  1D4B A;  2BB5 A;  4CQN A;  1GB1 A;  2DWQ A;  3W9C B;  4MH8 A;  1VJK A;  1EWC A;  3AV8 A;  1J7A A;  1ET9 A;  1KF6 B;  3BVG A;  1OFF A;  2PKO A;  2AQ1 B;  3I9V 1;  3AE3 B;  2KN4 A;  5E6J A;  4RFB A;  1CZP A;  1SEB D;  1XF5 L;  3Q69 A;  1XCQ L;  3TEW A;  2WXQ A;  1SJE D;  4ZOH C;  1FRD A;  2V3P A;  3SFE B;  3IXS A;  1JW9 D;  1KLU D;  1PFD A;  1P7F A;  5T8I A;  3GP7 A;  2WDQ B;  1CJE A;  1IGD A;  1VDV A;  2LFI A;  3P4R B;  2J53 A;  2JXT A;  2WXG A;  2WU5 B;  1WYG A;  3E56 A;  1YJJ A;  2RMM A;  3I57 A;  1ZE3 D;  5BMG A;  3P63 A;  4RCO A;  1ZP0 B;  4XDD A;  3NVW A;  5H8Y E;  1F2R I;  1BUI C;  2RDH A;  1EM7 A;  4KKJ A;  4NAM A;  1QOB A;  4RF1 A;  3U2S C;  4IKG A;  2OHF A;  2Y5C A;  1IBX A;  3BII D;  4USA A;  1K51 A;  1XLP A;  1HQR D;  2K22 A;  3HVZ A;  3R2T A;  3AN1 A;  1EWY C;  3AEB B;  1GB4 A;  3U7Z A;  3ZJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...