2VH2A

Crystal structure of cell divison protein ftsq from yersinia enterecolitica
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
202
structure length
201
Chain Sequence
PLSKLVVTGERHYTTNDDIRQAILSLGAPGTFMTQDVNIIQQQIERLPWIQQASVRKQWPDELKIHLVEYVPFARWNDLHMVDEQGRSFSVPSERVGKQKLPLLYGPEGSEQDVLEGYRAINKVLAANKYQLKMVAMSARHSWQLALDNDVRLELGRDDRMGRLQRFIELYPMLQQPDKRVSYVDLRYETGAAIGWAPVFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords CELL DIVISION PROTEIN FTSQ
publication title Structural and Mutational Analysis of Cell Division Protein Ftsq
pubmed doi rcsb
source organism Yersinia enterocolitica
total genus 30
structure length 201
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03799 FtsQ Cell division protein FtsQ
A PF08478 POTRA_1 POTRA domain, FtsQ-type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2vh2A01
3.40.50.11690 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vh2A02
2VH1A 2QCZA 2VH2A 2QDFA 2X8XX 4C4VB 4XGAB 2MHJA 4QAYA 3EFCA 4C4VA 4C00A 3Q6BA 4K3CA 3MC8A 4PK1A 3NJTA 4BZAA 3OG5A 3MC9A 2V9HA 4K3BA
chains in the Genus database with same CATH superfamily
3R5SA 2YWRA 3N0RA 4WERA 4X92A 1U1EA 2ZS8A 4IUBS 1ECFA 2Z0MA 4RX1A 1OX6A 3GNSA 2AF4C 1C9NA 2QLMA 1HFWA 1MG0A 2C7RA 4MV3A 3RDPA 3DQVA 1CW2B 2P78A 1R8YA 4R68A 3E9ZA 2FVXA 2RAUA 4NMHA 3WR5A 3DULA 1Z5GA 5LMNB 2UYOA 1EE9A 1SCNE 4JJIA 2W00A 3CVJA 5BXQC 4LF8B 3BF8A 4DV5B 1QH1B 1SVMA 2KFKB 4GQAA 3IP6A 4BJ5A 4JB2A 1YZTA 2OXCA 3GD5A 5BYRA 4DQVA 5KNDD 1ZM4A 3P2IA 3KJEA 4JIOU 4QHTA 5AJYA 5JMTA 1AWDA 1STEA 4OU5A 1NVGA 4FU0A 1E7YA 2QX9A 2VDUE 3QIJA 3DAPA 1A7JA 1ZCAA 1O03A 3WALA 4BOZB 3TAUA 4GOJA 2FN9A 2WX1A 4K03A 1BX0A 3DOEA 1HORA 2Z57A 1ZUIA 2PL9A 4RTPA 2KOXA 4RDCA 3NTOA 4QNMA 4FZ5A 4EVQA 4WESA 2JH8A 3CEHA 3GRPA 2Q4TA 5JWHA 4ZEMA 1HDCA 1YR8A 4YRKA 2INDC 1R6TA 4PY2A 3ZGNA 4HNUA 2CMGA 4MKFA 1YB6A 3KK0A 2VWGA 2I2XB 4JB3A 4QM6A 3CF6E 3LUAA 1KERA 4CIBA 1MN6A 5H82A 1ZRHA 1OH5A 1IWOA 2Z5VA 1C9YA 1XXHE 4UHJA 4BNWA 4CHTA 1XN4A 2WWRA 3GH1A 4KHPB 3PE4A 1UWLA 2R8RA 1RZRD 3DVNV 5IZ4A 1CC1S 4ZAFA 3M81A 2JJ2D 3KYCD 3AGPA 4KQ9A 1X7WA 2ZCVA 1GR1A 1ZKDA 2XUGA 4LZPA 3SYNA 4UQPA 1P9OA 1J9EA 3QVJA 4W7SA 5FQOA 1UPAA 4H4CA 1LM8B 3ZU2A 4CIWA 2D4HA 3EEBA 2QL7A 1FFDA 2O7RA 1WGHA 2L3ZA 4DM4A 4K3CA 4B84A 4TVKA 5COAA 1KDRA 4UBOA 2VDQB 2XF2A 4QQKA 1ML4A 2RH4A 5K6TA 1WV1A 3PQ4A 3H6HA 1Y1QA 4WNAA 2HBYA 2WQZA 3AEZA 4RHEA 2Z09A 2IYUA 3CUEF 4AG6A 5IHPA 1Y34E 2XUIA 3FI0A 1MFWA 3NV7A 1JYFA 1FRQA 1GUAB 5KTPA 1JWBB 3PP8A 1VI5A 5KVQA 5AUKA 2IHBA 2WXPA 3I3TB 1Z28A 2GKSA 3N58A 4FHJA 2NZJA 1TQ4A 2UYHA 2WWZA 3HVIA 3QXSA 4PEVA 1W4BA 4IIBA 2WAYA 1IBMB 2GJKA 2VQ3A 5HG0A 3UEOA 3VTVA 3D8RA 1DEHA 4BQPA 2KT7A 4GP6A 4CMCA 4BMPB 2CSUA 1IL0A 3EQ6A 5BT9A 3ABZA 3IHKA 3H5OA 3NM5A 3OICA 2O2CA 4KQEA 3C7KA 2C9BA 5CFOA 1T1RA 3H99A 2B30A 4OA5A 4C5CA 1KMHA 5BN5B 1LSUA 2H0AA 3QMMA 4KFSA 3S8EA 2UU9B 2QYHA 1O7JA 3PSEB 1PG5A 2CCJA 3VQTA 2GBIA 4F8EA 3V61A 3EF0A 2ZYWX 2AE2A 2XOEA 4KQHA 1ATIA 3KXDA 2X8XX 4F3CA 2ACKA 3TPCA 4E46A 4W9MC 2KDEB 1ZYUA 2FTKE 3WLSA 2CL6X 3SYLA 5T67A 3G8BA 2GAAA 4L3WA 1TM7E 4HGZA 1STOA 1A9OA 4F4CA 1PT9A 5JVDF 3SE0A 1AMNA 2CL0X 1IOVA 2RGDA 4LTMA 5HCNA 2I6SA 3ROGA 4BX8A 2Q3CA 4EECA 4A7PA 2QTMA 4M8NA 3JAWB 2GAFA 1ZZEA 3WLHA 4J76A 5CYPA 3HR4A 1J90A 1KU6A 1LDGA 2I1KA 2CT8A 2GD2A 3L0WB 4DAOA 4QASA 2EL7A 4ZT5A 1EWCA 5LBTA 1KC1A 1VLBA 4L6AA 4DXAB 4EHKA 3EQ7A 2XYGA 1CVIA 1OYVA 1U3FA 2AFHE 5D6OA 1MV5A 4ZCRA 2CFSA 3PJDA 1WH3A 2CFTA 2XD9A 1CP2A 2WF8A 1KU0A 2ARKA 4LC0A 2LWPA 1OA0A 1N6KA 2DQ4A 1T36A 3E8XA 5COQA 3N7TA 2C8JA 2QD1A 5A04A 1BXGB 2G6TA 4IWQA 1PE0A 1NTRA 2GTIA 1TYAE 2YUTA 2BH2A 3H2BA 4KSKC 3DWGA 1X19A 3GLIA 5K8UA 1HLPA 4NNJA 4YCNA 1SUSA 4GKKB 1IQUA 2VUTA 2IODA 3F8TA 3WWZA 3DXZA 2ZJ3A 1L4YA 2ZUCA 4HKTA 3ER6A 3WLTA 4US0R 2AC7A 5JXGA 4ZDIA 3HHMA 2MINA 1QP0A 1DJPA 1EMDA 4Z0TA 3VBEA 3B1KA 2VDWA 3HJBA 3ST7A 5E6JA 2MT9A 3HHPA 3U4CA 3I5YA 4M76B 5BNTA 4TXNA 4UU1A 4KQ2A 1EVEA 3SFVA 4V3CA 4M99A 3HMQA 5IXSA 3NR2A 3NBYC 5J63A 3PJFA 1L8AA 3U9LA 4PFJA 1ESEA 2EIHA 5L4NA 2A67A 4R9NA 4OJKA 4Z1MD 2HUNA 5D5QA 3HM3A 3M5DA 2BEUB 3ABRB 5JYBA 1H4SA 4J03A 3BE8A 4HBZA 2RDGA 4DL9A 4UMDA 1VGQA 2GBNA 1ZVJA 1B1CA 2Y1LA 1E0JA 5IKOA 1ZIOA 3DE7X 1MH9A 1L3IA 1ZUWA 2VK4A 3VDRA 4PYNA 1PK7A 5JAUA 1UZAA 3DHWC 2ERYA 1W85B 3K0AA 3P19A 1GL9B 3QU9A 2O2SA 3U5TA 2OV1A 1KQGA 4UEOA 3A6LA 1YA8A 3CW2A 1JKJB 2WIFA 4MWEA 4BFZA 3V55A 2IHVA 4AP9A 2KX3A 3CB2A 3TRFA 3MB8A 3I2GA 2VNAA 2UXCB 2WIKA 3QF7A 5CITA 3I8OA 1GM5A 4KQWA 2CXOA 4F84A 4EY3A 1E8WA 1X7YB 2NUBA 4KFCA 1TZKA 1RPAA 3BWEA 4NFSA 4E5MA 3K92A 4KYIB 1JH9A 3GUVA 5JARA 3QEAZ 3VMMA 1H1TA 2OMEA 2FZGA 3HXKA 3RVQA 5H3LA 4DYVA 1UEIA 3ROEA 4OLJA 2WHRA 5ALFA 3UH1A 1UJCA 3QKUA 4GWKA 1PKEA 1FP2A 3UFBA 1SU6A 3QTBA 4QOEA 2QVXX 4HJRA 4Q4JA 2WJHA 3BDAA 4MRVA 2VPTA 4PRLA 4LHSA 4P1BC 1RABA 4UXIA 4KMOA 1UOPA 1WKCA 1W8DA 4GVXA 2P27A 3BE5A 2AN3A 5FOSA 3EH2A 2HA3A 5AKYA 4AY4A 4K6OA 3KDSE 2GLSA 2B0CA 3W5JA 5AKXA 2V3VA 2IH5A 4TLCA 1JIXA 1VDMA 3O65B 4WA7A 4KXFB 1N7IA 1PO7A 1ISRA 3W0LB 3HP7A 3ADBA 5HIMA 1ULTA 3E1KA 3UV3A 1KGSA 1CV2A 2HA6A 2F3SA 3I2JA 4DILA 2ECKA 3PLNA 2XNHA 4NBLA 3UJ7A 4FPXA 3SQNA 4OM7A 3OKPA 2R7AA 1NLUA 4HZUA 5KTSA 1CKEA 3KUZA 1E2PA 3GGSA 1UBNA 3PHJA 5PNTA 4PYJA 2HPVA 3CUUA 1C5KA 1M0TA 3UTDA 1HWYA 3HXMA 1A04A 4FP9A 4M9CA 1YFKA 4MJ7A 2AOXA 3AU5A 2NU7A 1P2TA 1E8ZA 2LKCA 4LYGA 2FZKA 1V4BA 5WRFA 2ZXUA 1PW5A 2O23A 1NVAA 1JU9A 4KKJA 3DZKA 2IO2B 2PL1A 4PONA 2C0QA 2ZBEA 3NXSA 1QHSA 3ITEA 1KHTA 1OPRA 4FZRA 3RAFC 3QVKA 1GDDA 1EP9A 4FA6A 3ECAA 4M8IA 3GFRA 1C3OA 3DUFB 2J9XB 4RKFA 5ISMA 3N9IA 5ILQA 3L02A 3UO8B 3IDOA 1VKHA 2C83A 3GVCA 1SUPA 4EMTA 5THXA 5I6DA 2QNIA 3ZV7A 3WGVA 3JARB 4KTTE 4LZAA 3VAZA 1SKYE 4B3IA 2JH3A 4RDHA 5B3JC 3W90A 5AKJA 4J0GA 3JQ8B 7ADHA 5D5PA 3GARA 3ZQ4A 3ROZA 4RV4A 5EPOA 2Z1MA 5MGBA 4MS1A 1D9ZA 3WNDA 4YQFA 4FD3A 3DHYA 1YN5A 4IIVA 4QYMA 4E2YA 3OFKA 1RC8A 1QPGA 2NVUB 4NIMA 2O8NA 1VRCA 2AX5A 4AK9A 1V3QE 1F48A 4KIKA 1W73A 4KXQA 4YPOA 3JQ9C 2WNHA 3HNOA 5G0TA 3DEZA 1NKSA 4C7YA 4P36A 3OETA 2B8TA 5FWYB 1SXJA 4OFBA 2BFMA 1T8SA 5JO0A 4KSCA 3EJ6A 4K86A 2D4AA 2QYTA 4FSHA 3TLAA 4PYIA 2JX5A 1Z0UA 4G5OA 4GL4A 3GZ4A 4LQCA 3CWCA 1YNTE 4TVSA 3ZWYA 4H0FA 2F00A 1WZCA 1YONA 1KBOA 1MVNA 5KZMB 3NEAA 1FXWA 1H93A 1NT4A 2JEZA 9LDBA 3EZGA 2RGGA 5CHFA 3D6HA 4G01B 4CL2A 4WMLA 3SZLA 3ESQA 2YVAA 2H07A 1Q0RA 1B15A 3OOHA 2PBZA 5EZ6B 1QFMA 3DF9A 2F1OA 1SUFA 1MOPA 3AVUA 4FFBB 1KEWA 4NV3A 1ZN2A 3Q8KA 2IBTA 2H59A 2QI9F 3QVMA 1MABB 1T1EA 2A9KA 2V7GA 3A4NA 4D8UA 1CX9B 2GCGA 4JFRA 3WMGA 3T7RA 4KGTA 5CIWA 1VMDA 4C7BA 1L4DB 3W1EA 1XEWY 3E7FA 5IULC 2YN0A 3RO7A 1E79D 2C4UA 3DR3A 3EAGA 3CX7A 1UKAA 2Q4DA 1G0NA 2Q2OA 5FL3A 4JVLA 1XTSA 2RSUA 2X2EA 1Z5UA 1ENOA 5FBVB 1K89A 2UZ1A 3VKFA 2ILVA 4BCDA 5LP6F 2ZPNA 2DFNA 4NKRA 3EPRA 3TEYA 2XDQA 2BYFA 4TKUA 4GKAA 3TQOA 3I58A 5EIFA 5IAOA 2WQYB 2FAZA 4BMNA 2I4TA 5H4HA 3HXQA 1ZIYA 1ZI6A 1EX6A 2O6VD 4BQEA 2KE5A 2NXWA 4FYVA 3MFQA 1M2WA 5EVCA 5TGTA 2C31A 1KEEB 3IEUA 5JSUA 3QKWA 4BS9A 3IERA 5AQEA 3HGTA 3SFTA 5TE9A 4HGPA 8MHTA 2JFPA 3NXKA 1E8DA 3FTDA 5LR6A 3ZCUA 2ZUTA 4D9CA 4ANWA 4H1VA 1YS7A 3GR6A 3V1KA 1GAXA 3CJQA 3QMPA 1T4GA 1TC1A 4X20B 1A5AB 3AZOA 3U49A 3ZU6A 1DIRA 1R0WA 2C5SA 1WU8A 2DKFA 3LQQA 4RA9B 3ZZ1A 4KE7A 1B8PA 4PHGA 2PKXA 1Q84A 3H0KA 1LU9A 2BHNA 2OCDA 3QE0A 4HYTA 5HTKA 1H6CA 2H7CA 1C9JA 5FA6A 2OOSA 1QR2A 1CMXB 2GKOA 1XZAA 1NXOA 4UOZA 1J06A 1YJ1A 3E9EA 2BZSA 1XZKA 2XMQA 2I67A 4HPJB 1NG1A 5EA2A 5FJJA 1M2VA 3ERCA 1SY7A 5IASA 2HT1A 1XNJA 1F2UB 1YB5A 4RVSA 3TYXA 2XCIA 3VO9A 2WXHA 4JJ8A 2LGJA 4QXOA 1RQLA 3A10A 1UT8A 3ANYB 2G0AA 3B7WA 4M1MA 1RKUA 1NF2A 1WDWB 4XSGA 1BN7A 4CHKA 4TZKA 5L3QA 1NZDA 2RARA 1NR1A 4C3OB 2ANCA 2QT1A 4F60A 3K9GA 3JATB 4OH7A 5H4GA 1NPDA 3TIFA 4QT0A 3X2FA 5LYJA 3JWIA 3R7NA 1PVDA 1OZFA 1EHIA 5H16A 1ISJA 4HMPA 4E5UA 1K68A 2FEXA 1JXOA 3N07A 3F7OA 3ZHRA 2OXFA 2HXGA 1YOVB 2XNCA 4FFNA 3AEGB 2QXTA 5BVGB 4YCSA 1OAAA 2EYUA 4PO1A 5IKCM 3PE6A 2RHCA 3UUWA 3U4QB 2AWNA 5KC8A 1M1ZA 1E7UA 3RNOA 4Q3OA 3JWGA 4DJTA 4LDPA 2GAJA 2NAPA 3NHWA 3K05A 1XMJA 4ED9A 3EA0A 3T1VA 1YS4A 3E1GA 3CGGA 4MR7B 1TM5E 3D7SA 4HXYA 2PX5A 5CU7A 3U4AA 4QXAA 1G2PA 3A9UA 3K2QA 3VSAA 5F3DA 1D6MA 2OYRA 1YX6B 1W6RA 3DDCA 4O59O 4IDPA 2ACEA 5D6JB 3LMKA 3VUWA 3ZWPA 4TV9A 5JEDA 4Y2SA 3IT1A 3TO5A 1TFRA 4PQYA 2ZWPA 4S1NA 2IJGX 1VL6A 5K3OA 3SVTA 4AUEA 2JDID 3WSTA 1Z6TA 1EXDA 2FW1A 1BGWA 3WZ2A 4UC0A 1TY0A 4K9KA 1EFHA 1SBHA 2X4IA 4CF7A 5CA0F 3P20A 3FB4A 2MR6A 4FYHA 2WDPA 4KEAA 1P2FA 1Y8RC 2BFAA 4Z4EA 3HU5A 2A6PA 3D1VA 4LTNA 3CUSA 4BFXA 5BO4B 1F0NA 4EVSA 2B1QA 4F5EA 2GBPA 3H04A 2O2VB 4JNCA 1SHJA 1C8BA 1SWWA 1Z0KA 2L42A 1IDOA 2WSSD 1RP7A 2KMCA 1QWOA 1UQUA 2PGJA 2Q8NA 3TQSA 3JD2A 3GZNB 2Q2WA 1NNUA 4W9HA 1LW6E 1OXMA 1Y1KE 3A6GA 4AYXA 5CHWA 1OGYA 4IDEA 4HRAA 3GEIA 3NMUF 4UHEA 4F3NA 3DYIA 4B74A 5GY7A 4TXLA 2FG6C 4RNDB 1IZ9A 7AT1A 4X63A 4MEAA 4OQMA 1YE8A 4K6HA 4ZTZB 4JL6A 3C3JA 1DFHA 1OEYA 4LOKA 4MGEA 5JCXA 1VL1A 1HSZA 2XB2A 3Q7QA 2YS7A 4ZDJA 2EZ4A 3Q3IA 4TZTA 2BJHA 1QHNA 5CXQA 1C9DB 1XPUA 2K5UA 4ZC8A 3I0MA 3OFSA 1DKRA 1F6DA 2IWRA 5JXWA 5C46F 2QE7A 3AXSA 3IAFA 2C1XA 2GXSA 2HA5A 3G3EA 2JFVA 4U6QA 1GJRA 4Z4CA 2OORC 1V1RA 3PPIA 4R1UA 4Y6RA 1RVDA 2HLHA 1P75A 5TB5A 1Q0SA 4J6EA 4QFMA 4O0MA 1T9KA 1YV9A 3ORYA 2R3SA 2DKNA 4GR4A 1JLLB 2LCIA 1WPQA 4ZPJA 1UIMA 4REZA 3CNEA 3SIXA 4DB2A 5DDIP 1GZ7A 1R6DA 4OMUA 2BFCB 4D26A 4YAKA 1T3QA 1IHUA 4WXEA 2KJRA 2DZMA 3U5ZB 1RXSA 1BXZA 4HN4B 1PP4A 2VSOA 1CU1A 1K3FA 3A9RA 5FPQA 2CMDA 4QVKA 3STXA 4X54A 5LCXA 2N4FA 4QGGA 1OV4A 4DLVA 3K8ZA 4YASA 4RWZA 1NVUQ 3DFFA 5GV8A 3AL0C 3P4UA 2FIFA 2YTZA 3LCRA 2JGFA 4XYMA 3EH1A 4H7KA 3UT5B 2DEUA 1CR2A 1N9GB 1M34B 1RWXA 4FCWA 2W2QA 3SDBA 3C85A 3VZBA 3BG5A 3TFOA 4H08A 4EX7A 3IESA 4DMHA 2PSSA 2JIZD 1QCDA 2FZCA 3UWSA 4NCBA 3S27A 3U1VA 1ISGA 1JF8A 1SB3C 5FI1B 2B36A 1DC3A 3C8UA 4YROA 2J09A 5CJPA 4DC0A 3K0HA 2H3HA 3N2ZB 4F8YA 4OPMA 4QUKA 3IEVA 3O2JA 4ALNA 4XD7A 2AR0A 2WXIA 1C4PA 1WXSA 2NSJA 3AHIA 1M0WA 2Z83A 4H7FA 2XB8A 3G0BA 4C5AA 2BGUA 2IELA 3HIZA 2W5UA 1RM0A 1KOLA 4M0WB 1EF1A 3JTMA 2BMFA 2OC4A 3BZWA 4BQSA 4YMGA 5G3YA 1U7PA 2O8EB 2QNBA 4DAEA 2C9WB 4NZOA 2F6RA 1LSOA 4R1TA 1R9JA 2XE4A 3COJA 5F12A 4YLEA 4A0SA 3UV6A 3LQKA 1JEEA 2YJ5A 4JLSA 2COUA 2EZ9A 4FONA 2O06A 4OA8A 3UK6A 1ZSNA 2K7FA 3C3YA 4GN1A 3ADDA 5U1PA 1Z4KA 4S1VA 3LX5A 3MPOA 2C9OA 2GEKA 2HLNA 2OCAA 3AIKA 2Z2XA 1OLUB 4F86A 4WWHA 1XRMA 2Z58A 4B46A 3C1TA 4ZCMA 2GAOA 3F5MA 3I6MA 3DBOB 1D3AA 1WKBA 1E1QA 3O1HB 4LNIA 4RSMA 1CZPA 2RGWA 4IH1A 2OGUA 5HE8A 2GHRA 3RUIA 1RE0A 3M6FA 4OBBA 4MUMA 3HRDD 4BE9A 4KN8A 1SA0B 1W4AA 4EQZA 1JZQA 1DBSA 2ZT8A 3IOBA 3GUYA 2X3FA 3NHRA 1OAKA 3OAAA 4KXLA 2QILA 1WDLA 1COWD 4A1OA 2HYIC 3AI3A 4JWUC 4ROTA 1RC1A 1TQDA 5TMDA 1DBWA 3WLKX 3WOVA 2HWKA 4CFYA 6PFKA 3RVSA 2XB9A 3ZLZA 5DCUA 2WC1A 3NKLA 4KE8A 3L0SA 5FF9A 4EPVA 3T7IA 5C2TB 3LV8A 2WM8A 1XGKA 4OAOA 1MJ5A 1GQSA 4LSWA 4TQGA 1DADA 1J97A 1V11B 3LUPA 1RQ2A 3EHEA 3SD7A 3OT4A 2BGKA 4YB8A 5KC9A 1E1KA 3AB5A 3E18A 4QPZA 1BFKA 5A1TA 2XQVA 1T5OA 2F1JA 3T5PA 3OLQA 4E13A 2PJZA 1H2HA 1MEJA 3DKVA 3QK7A 4OUDA 2ORWA 3HKEB 4Q4DA 3U9TA 5CFMA 3SXUA 3EGWA 2VDVE 2G4CA 3MQ4A 1GPJA 4P9NA 3H2GA 1L8LA 1U5BB 3A1VA 3OTWA 1H0RA 1GFSA 2IH4A 3DDWA 2P6NA 4ZT3A 1GTG1 4O8CA 3FRJA 1Q1BA 1R4AA 3TXYA 4A0GA 4GHWA 8ADHA 1D8TA 3VUFA 1LS6A 3OZCA 4W7HA 3R5XA 3IKTA 3CRQA 2CLEB 1ZICA 4J8PA 4BXOB 4NU0A 4UFNA 2NO1A 3E35A 2JJ8A 3GELA 4F4IA 2BPOA 1EFCA 1EIZA 2R6ZA 4OBXA 2X42A 4G1MB 2QN1A 3G5LA 1CQXA 4XEHA 9ATCA 2VHYA 2RHMA 3WTBA 4ICUA 2WHPA 5JS2A 4XA8A 3MGGA 2WPNA 4QE3A 3M6IA 4IM0A 3SBOA 2QV7A 4JLJA 4RF1A 1NVXQ 3TD2A 1TK9A 5CB4F 4EPYA 1L7DA 1N2EA 1THTA 2OHFA 1ZH8A 1XLVA 5JH7A 2FSHA 1ZJZA 3UOAB 4AJIA 1F2DA 2XGMA 5AJWA 4NEQA 4E3WA 2UUCB 1B16A 1KDOA 1U0LA 5J9FA 3F6CA 1O95A 1X8KA 3VNQA 5K3EA 5DISB 1KARA 1RHUA 4PIPA 4MV7A 3LF2A 1MPEA 1EGMB 2KTFA 4BTEA 1X1QA 3QBTA 2F62A 3B3FA 4ND8B 4R3DA 3R3ZA 5HSGA 2F3PA 4NENB 4ESEA 2NQTA 1CIPA 5FPSA 5JALA 1Z34A 3UB2A 4DSAA 3BK1A 3BIJA 3NLLA 2GRJA 2O8FB 1J42A 3VH2A 1SXGA 3F78A 2HGSA 2GZRA 1ZKHA 2LHDA 4US1R 1L5GB 1CQIA 1G8FA 5HGXA 4GGQA 4OMFG 2NM0A 1J4AA 3E70C 2E4XA 1M6VB 2AMLA 4H7DA 2Q4BA 1E2IA 3LY9A 1U2TA 5FJIA 2JI6A 3ZY5A 3EGXA 4GLSC 4Q1AA 3PC3A 5IT9A 4LDAA 4KZKA 3GLHE 2IUFA 4RWEA 3IP9A 2J9FA 3M3HA 2AZMA 2RDHA 3SX0A 3AHEA 3B08A 4DWOA 1KJ8A 1AGRA 3MIZA 3F9IA 2JIQA 4BDSA 2I91A 3DEIA 1RRGA 2DFVA 2QYSA 1RFKA 3L5KA 3K6SB 3WL6A 4EHNA 1Y8CA 1SIJA 3LFUA 4LE1A 4DNOA 1P3Y1 3DOJA 2WQ7A 4M86A 1WMFA 3I6QA 4JHLA 3VU0A 2VLBA 2H65A 1HQKA 2O05A 3G5MA 4C4TA 3GE3C 2HMWA 2OTCA 4JLMA 1NXXA 3OEYA 4I6NB 4MQ6A 4Y98A 3QARA 3NOBA 2PZFA 3GI1A 4KNWA 5EZYB 1W47A 1BVUA 4J7UA 3ZCQA 3I83A 4CIAA 2XUKA 3O92A 1GPMA 2K39A 4B45A 4BFTA 4M1WA 5F4ZA 4HDNA 4BEJA 4PZZA 5H0IA 3EPJA 1YKSA 4AG5A 1EAMA 5HDQA 2UV8A 3SXPA 1YH3A 3T4UA 3QLUA 1UBUS 4BGVA 2ZIXB 3WWCA 1MHXA 2H4XA 1ORVA 1ZXBA 2E89A 3GRFA 2DECA 1ISIA 3QWHA 3LPCA 4YRNA 3UA3A 4NOKA 2WF9A 2ZUWA 5BUCA 5K9ZA 4CT5A 1JZSA 4I6JA 1U8YA 4JGIA 5T4EA 1YB2A 5IAJA 1H6BA 2I3GA 4XE5A 2PH5A 1R4MB 3PTAA 3F6BX 1C1XA 1X86B 1DOHA 4PC2A 4AWAA 2R48A 5G4KB 1LEHA 1PZMA 5FKAC 5JE8A 4WOCA 4MWBA 4M0FA 2YIVX 3IBFA 3NCHA 3BWDD 2IO0B 3NYQA 1QZXA 5M2QA 3H9JA 1TTTA 4NEGA 1CWUA 2ZIGA 1IQPA 1D2NA 1NMSA 5C5EA 4MKGA 3ZV6A 2DFPA 4ICVA 2VATA 4XPIB 4DABA 4ZCPA 2J3KA 3EXIB 3G2IA 4R98A 1XDGA 4BBZA 3OQOA 3CNNA 1NJSA 2RGNC 4LJAA 3ZKAA 2DG2A 4CPDA 1ZVMA 4YJ2A 4FEAA 3OWEB 1ISPA 1Y9AA 3L1KA 5AOVA 3M2TA 1MIHA 1GSHA 1SUEA 3E81A 4NZYA 1VIVA 2BMWA 1SE2A 3ZIAA 4P0TA 2ZXFA 3DV9A 3OQMA 1EE2A 3VH4A 2L52A 4Q9IA 3VPHA 2FW9A 2GEJA 3IA2A 1KJYA 3CTMA 2MRPA 1DB3A 2BMVA 4DEVA 1VHTA 4ZVUA 2H29A 5DPWA 1UWCA 1NHWA 4L0QA 3GEGA 4P84A 4LVOA 2Y0BA 4KQXA 1TF5A 3KKPA 1P2GA 2FWPA 2GYUA 1G17A 4XIYA 3HXTA 2WVGA 2M8SA 1XQ1A 4EI9A 4YC7A 2BEWB 1MMFB 4EYEA 1LLFA 3B52X 2QM0A 1KKLA 2QX6A 4TQ1A 1LQ2A 2M56B 2NPTA 1E8YA 5BR7A 1XMXA 2X15A 1U4OA 1ZC3A 5EE3A 2GK7A 3WJ1A 4KC0A 2H6EA 1ACJA 1A8HA 3AR8A 5J5AA 3ZW3A 1QRRA 4BVHA 3GPBA 3GLFA 2D10A 3LWDA 3IJRA 4GYKA 1QILA 3H7IA 3N9YC 3PPYA 4IICA 3RU9A 3GZTB 1UT5A 1P9NA 4C0LA 1ML3A 1NGSA 4P2BA 3ZHSA 1F2VA 3HCRA 2ZZNA 1KZ4A 1PCXA 1YT5A 2MHCA 4BMZA 3CNHA 3L0OA 4I55F 2FW0A 4I4LA 3MTEA 1V41E 2VUIB 3B0AA 4HDRB 1A27A 4NK4A 5FPHA 1UBRS 4TVBA 1RRBA 1P9DU 4LVUA 3O9MA 3PS6A 3SG0A 1E9CA 1YFJA 3TSWA 1RI1A 2VZ0A 1Z5SB 4IW0A 1FD6A 1W9HA 5AK4A 4ESVA 2Z2YA 1IATA 2PUDA 1MG4A 4RQAA 4RW0A 5ED0A 1ZM9A 2HU5A 2C04A 4LOLA 1VJ5A 4UHFA 2HN9A 1HE8B 1KOFA 4J3FA 3KLOA 2R7KA 1BCSA 4OI2A 3LH5A 1Q1ZA 4QFDA 4DHZB 4JJFA 4PG7A 4C43A 1U81A 2P6OA 1V81A 1OIXA 2H17A 4AXXA 3BB3A 4OOFA 3CLHA 4H27A 1DXYA 3QI7A 2N3ZA 2L18A 4JI7B 2G0TA 3KG2A 5EKSA 3ABVB 1WP9A 1A9XB 1B76A 2C07A 4GX5A 5MPOA 1CNMA 3CW9A 5F2OA 3UGKA 4C07A 1K5PA 1Y56A 1HXHA 2AOUB 4LLGM 1ZCFA 3IP8A 2CVPA 1WMHB 4MACA 1VOTA 1ZW6A 3ICEA 4Z8XA 3AOGA 1EUZA 1F1JA 2AI3A 3BCSA 4RHUA 5TV2A 3R41A 3K32A 3LAWA 3FCAA 4EPTA 4H15A 3KVNA 3GIDA 4LQLA 2WTBA 3UMBA 1LD3A 1K7FB 3BSWA 2VBFA 1W5AA 3A14A 4YCAA 3DOIA 3C4VA 2JZCA 2C8KA 1SD1A 1WSBA 2PZAA 4A1FA 3AETA 1OA1A 3LLSA 4X41A 4QSHA 2ZETA 4COOA 3IXLA 1QOFA 3JWEA 2UYCA 4F3KA 1E4EA 3OHPA 3MHZA 4UUPA 5C5IA 5KHQA 3GFBA 3OLVA 1EUDB 5DTMA 2VA9A 2KWDA 2XBMA 1W46A 2R6R1 4YP5A 2L05A 2VK2A 3FBTA 5KOJA 3K1ZA 4B0OA 3OF5A 2KTRA 3K53A 3U1TA 5D7NA 2VJNA 2IS2A 5KTYA 5CB6A 3L4BC 5CT6A 1UMBA 3E2IA 3TKAA 3W6PA 3IAM1 1IH8A 1PJ8A 5HOQA 1TQHA 2UUAB 2IOHA 4ONEA 4D7AA 3OWXA 1I13A 3QUQA 1DO8A 4LDRA 3X0DA 4LQDA 4TT3D 4HRXA 2VNJA 1JDJA 3N5KA 3UWOA 1NC1A 5EUQB 3SHQA 2JCVA 5KVAA 3R4CA 2FUEA 1E61A 1GG5A 3QUBA 1JG6A 1FA9A 5JSKA 2BM8A 3EIQA 1YJAA 5KNLA 4MGZE 5BOSA 2OAGA 5LXTF 1N8TA 2GBLA 1M74A 2WU4A 1JR3D 3MCZA 3RRJA 3M4YA 5KTRA 4ZCTA 2I9KA 5BNFA 3C6MA 2PQ6A 4TUYB 1JFRA 1Q12A 1KJQA 1ECGA 5LN1A 1ZD5A 5FT9A 4GPEA 1MQ9A 5ALLA 5TQ0A 3Q0EA 3DCJA 1WXEA 1B41A 3B9RA 3WQRA 3PL1A 2NO9A 2G9QA 3D6TB 5EE1A 3C5CA 1B3BA 5AI8A 4F92B 5IUKC 3LA8A 1PJBA 3H1GA 1UCFA 5HKKD 3SOPA 2DNFA 2B94A 1AHNA 5CD9A 1N6IA 3MUNA 1A9YA 2K8BA 3HDTA 2W6ZA 3K6KA 2IL1A 1W4CA 1SXQA 3KUDA 4TKLA 5DX0A 4ZRMA 4YRTA 4X1KB 4K26A 1UK7A 3D4NA 1A4UA 2V7QA 3RVLA 3DHEA 1EH5A 1DXHA 2HMVA 3BMQA 1IJBA 5AT1A 4R83A 2ID9A 4PS0A 4RVUA 4HQLA 3B48A 1RAEA 1FP7A 4QAQA 4JBLA 4E51A 3T1OA 3H4MA 5AW5A 1RW4A 3GRYA 2W0MA 4WXYB 3G0DA 2GEUA 5LA6F 4FC7A 2XJ4A 1J7CA 5KNBA 4DBVO 2PKOA 5ALGA 5IYZF 7REQB 1LPSA 4LYDA 4L28A 3ENEA 3LFHA 1NNLA 1L5SA 4MB6A 1FP1D 2Y68A 4ODIA 2ZYGA 5B1HA 3ZI7A 1JHXA 3L77A 3N8HA 5CB0A 4KRFA 4QOJA 3O0TA 3MTBA 1QLJA 4MV4A 3IBSA 5H3CA 2ZP1A 4OVVA 3QNUA 1IRIA 3TR6A 4F1WA 5FCDA 3C97A 2O3QA 1ZNWA 3R0XA 1IZ0A 3WO1A 3PT9A 4DR5B 2IPOA 2ZYTX 2WILA 2CL5A 3ZVKA 2ZSDA 3ONVA 3WK8A 3S2SA 3OG5A 1GNVA 4YTEA 4C0HA 4MVCA 3ZD6A 3FH0A 4I7EA 3ZDFA 2FWRA 4FNOA 4EYSA 1T9DA 4AMVA 4A23A 4R2XA 4E3CA 1ONSA 1RRKA 3DTTA 1YR1A 2WTEA 3KHSA 3A9KB 5FAKA 1ZU4A 2XA2A 2WFAA 3D32A 3LKBA 3N2IA 1Q77A 2I6GA 4CCYA 4JZKA 3ASVA 3F4BA 4RVDA 3CX8A 2FSPA 1TBEA 3GH3A 2WM9B 1S2MA 1QH8A 2Y4OA 4BKMA 1ZNXA 3QK0A 3R0VA 1E4OA 3W04A 2HWXA 3VNUA 2UZ0A 3KTAB 1CS0B 5IUNC 4YJHB 1P5JA 4V2IA 3VVLA 5LDDC 1U0JA 1J19A 4RK6A 4JI4B 5TQ2B 2PTGA 3TVTA 4AJ9A 4H7PA 5KHOC 3BQNB 4PVDA 4C88A 1GV0A 3PWSA 3FHOA 3D4PA 5AI0A 5F7OA 1FS5A 4B2IA 1BMDA 2DX5B 3MBOA 3C3BA 3A1TA 4UFPA 1BMFD 4OAPA 3QV1A 1TL7C 4K7JA 3U7GA 4JSTA 1TM1E 1L5WA 2X8JB 2JZ3B 5HJ7A 1MXHA 2GYWA 2JHPA 2H9AA 3UT6A 3NFYA 3NTVA 3BBPA 4HGYA 5TSSA 3NQ41 1IHPA 2IV7A 5HZMA 1BS1A 3KJZA 4HEJA 4IOJA 5C23A 3H87A 1ZL0A 4BPBA 1SC4A 3NAQA 2WZDA 4JWSC 3UMJA 1D5ZC 3HCDA 1V1JA 4GR9A 3FNRA 4PYOA 2P65A 3GJ4A 1FUUA 1N8NA 2F3RA 1QH9A 2GNOA 4MCIA 4BP8A 1N34B 1YJQA 5DNCA 1U7UA 2DZKA 2LI5A 1Z82A 1GAQB 3HNPA 5LNK1 4RFSA 4AG3A 3HVHA 4BX3A 1K6IA 4OIFA 1BYUA 2IKSA 2B1IA 4Z7NB 4EG0A 1NV9A 1JVNA 4ZEWA 2F59A 5SYAA 3A11A 1YBAA 4LE0A 3DBRB 4FLHA 3GG2A 1VSUA 4N18A 2PUJA 3L04A 1M7BA 4RH3A 1HOTA 1X38A 4RKRA 3U7HB 4YV1A 3EHVA 5IZCC 1Q0UA 3JSAA 1LTQA 1NBEA 3UWKA 4UCXA 3GT0A 1QCCA 1VP3A 3LY7A 4O2BA 4E03A 4BUZA 2BJWA 4PWYA 5AXAA 2VL7A 1P1FA 3V6EB 3SPXA 2Y5CA 1AO3A 2V3SA 4TKNA 2GCOB 4WN9B 5KVCA 4A6EA 4I36A 4K7SA 4K7UA 2X9NA 2Q8QA 3F96A 3NP9A 4WEOA 1GCOA 4H1WA 3KYBA 3SKYA 5E4FA 3JR7A 2Y1CA 5FFNA 2OQIA 3CWQA 2JKZA 1SE3A 2YS6A 2W2TA 5G0WA 3ZDMC 4D6PA 3CH6A 5ES3A 3ZGXA 3DCGA 1G3RA 4HSGA 3BULA 4DV7B 3GEDA 1MGOA 3V7WA 5KYTA 3AM1A 3LOPA 3DJFA 2B92A 5FOTA 5EIXA 1O8CA 2HPZA 1JDPA 3FCSB 1VL2A 2PX2A 3OTGA 1UJ6A 4ZQEA 4N6OA 1ORIA 2ACVA 4WW0A 3WDSA 1H0HA 3OU7A 4I0WB 3TUOA 2IU4A 3FJYA 3LDHA 1D2GA 3TGWA 3F3KA 2I2WA 5FTLA 3NHYA 5DGTA 2FSVC 2V0CA 4KKVA 1U2EA 3EC8A 2WXKA 3IXSA 4O4IA 3R20A 4B82A 1R12A 4BKSA 3VPXA 4RMJA 2IKQA 4TLAA 4YP9A 5BSHA 4W5WA 3ZDTA 4V2UA 2J6CA 2ZSAA 3V7NA 5FLXA 1VB5A 1M6EX 1NF8A 2RHDA 2ZWMA 3IOEA 5K3AA 3PQ3A 4S1TA 2YJZA 1LY1A 1G59A 2H2HA 4MW1A 3ONWA 1OVGA 3ZWAA 5EJIA 2XMZA 4D2IA 3K6JA 1F20A 4NYMR 3NWBA 1Y80A 2V0NA 1NXTA 2ID7A 1XOIA 5LQCA 5LP1A 2CUTA 1VA5A 3AJRA 1CUEA 1N77A 3ZC3A 1LPBB 4LUCA 4Z2AA 1W88B 5IPFA 1GAJA 3GGPA 1XRRA 3QP9A 2KHZA 3UAWA 1AS3A 1FFAA 3GUZA 4MQFB 1CLEA 2WXMA 1WUJS 2R1TB 2DY1A 4JPSA 1JDVA 1H66A 3IUJA 2KMLA 4LDTB 1CHDA 4EHJA 1JG1A 4K9SA 3VH3A 3LLUA 1XV5A 5JNWA 3JSXA 2Z0DB 4QOFA 4FGKA 3KM0A 1KEUA 3RLIA 4B33A 5EIAA 3OIFA 3AN1A 4FKMA 1K53A 4D92A 3I73A 5FTNA 1B73A 2G7MC 5EMLA 4HTFA 3DDOA 4H6VA 1M83A 1NRIA 4GYYA 1A3CA 5JU6A 4DA7A 2WU2B 4CKBA 4L5CA 1DOIA 4QU8A 4C80A 4WWMA 3NBZC 3K4QA 3TKLA 2H9YA 2WSLA 3QW4B 4M9UA 1VIMA 1DUSA 2OSBA 4ZPXA 4W5QA 4G0XA 4LY0A 2WZBA 4CG2A 4MO9A 5FWXB 2OM6A 4ZYLA 4AMBA 4HDQB 1YRWA 3GOEA 5JCJA 2AMJA 2PHZA 1FZQA 1O4VA 3LFTA 3DV2A 4D8YA 4OQEA 1K88A 5KQRA 4W9KA 3EOZA 4FBGA 1I4LD 1VZ7A 5JMPA 2JIMA 1Z06A 3RYFB 2WB4A 4IRMA 4AX8A 1Q22A 4GXTA 4QOIA 4DNPA 3RHFA 4EB6B 1UQRA 4BMOB 1H42A 3ML9A 3PKZA 3ZE2B 2PXAA 4B6OA 4GWLA 2OFFA 5AW9A 3UKOA 2JGMA 2D74A 2PW9A 1IN6A 1U5CA 1NU8A 1VJDA 2I54A 4CLDA 3RGGA 3KP1A 3KELA 1REQA 2J0KA 1P17A 4I3GA 3RU3A 4EUEA 1NVMB 1QGUB 1QKKA 4ZRJA 4WKPA 1I32A 5F9HA 2P40A 3SQMA 4DEXA 3KQQA 1DJNA 1G2IA 4M9ZA 2RR9A 1YRAA 1F8XA 5BUQA 3EF1A 3LHSA 4FIZA 1NRWA 3BD8A 3NPMA 5IJAA 2C7GA 2B4KA 4DRYA 2J5KA 2DY0A 1JG3A 1YXMA 2HJVA 3ER8A 1J00A 4F5WA 3KHUA 1EP2B 3AR7A 4EGCB 4DDTA 4K8RB 2Y5PA 4WY5A 3VRBB 2ZRJA 4GGMX 4JDUA 1I0LA 1K5HA 2GLTA 2C0PA 4BJ6A 2ZW0A 3PRMB 4ETMA 3GBVA 2O19A 1FMJA 3FDIA 4OHZA 2WINI 1XPJA 4ASUD 3H1AA 3ZW8A 3I01A 3WBBA 4UCWA 3DAYA 4MGYR 2Z8ZA 4RABA 2I2AA 1KQ3A 1EFPB 5DBHX 2IZ6A 1R0LA 4D0NA 4E2ZA 1B42A 5EWJB 1MENA 2P2NA 5CA1A 1KORA 1L5VA 1WGKA 1JWSD 2AD1A 2Z56A 5K8JB 3P4QB 4Y2RA 4RPLA 2I4MA 1NLZA 2JK0A 3GY0A 1XAIA 1ZCZA 4TS1A 7ABPA 1L5LA 2RKOA 1WM1A 4FINA 4HATA 2GZDA 3JQFA 3EN0A 1A50B 1X1BA 1V37A 1A4XA 5C7LO 1O89A 5J4YA 4EE2A 2H4YA 1I0IA 3NW9A 1AQUA 4TWRA 1DCMA 3ONDA 2X9VA 4GDFA 1EP1B 5FPTA 5DNUA 1V3UA 2ZM5A 4US9A 3KTOA 4PBSA 2YV4A 3OIVA 2ZVOA 5HR5A 1CZNA 2ZQ5A 2JJQA 3G2NA 2H92A 5ED4A 4GNKA 2ZW1A 1CCWA 2DRIA 1L4KA 2Q5OA 2H5LA 1YRLA 5GZ3A 3K1AA 3CVOA 2OK8A 5KPDA 1GPAA 2G70A 1ZMOA 1BSVA 3IUEA 3L01A 4KDEA 1E6EA 4A3OA 4ZCLA 5HNKA 1E2EA 4WJNA 5LQUA 5IG2A 3OP1A 1T8TA 2AFRA 3T1YB 2W8ZA 2NO5A 1BW9B 2O3TA 1OJLA 2JIDA 1MD9A 3GLHB 4G4GA 2Q9AA 5BQ3A 4FWTA 2X76A 5A5VA 4BKGA 1YB7A 1FFGA 3GDFA 4ZJPA 5TPZA 5KQSA 3ZE1B 1KIMA 2J42A 3EX7C 4ZYXA 3RVRA 2V8BA 3K35A 2WHIA 3MUFA 2AYOB 3RFXA 1OW3B 3KLBA 2ZIZA 3AVYA 4X7PA 3D54D 3WCQA 1LDMA 4EUFA 3AEFB 1P31A 3OM0A 3B2EA 2WD7B 3L7BA 1N2CE 5HP4A 4JR1A 4BZWA 2QJLA 1CG6A 2BTOA 1QOBA 2AA3A 4AC9A 4NCXA 1WXGA 2OGSA 4Y2PA 3UQZA 3AEAB 1DKOA 4MQEA 4BKPA 1JAXA 4KXUA 3EZ7A 1EAYA 3DBIA 4ER5A 1XU4A 2XMBA 5HS4A 3UMYA 1F38A 2H7YA 5DTRA 1HT2E 5BNIA 3LYYA 4Q3AA 2XITA 4V0KA 1GNLA 4V3BA 5JDCC 3TLZA 3QHAA 5A9SB 1HG0A 3ND7A 4PX9A 1F0ZA 1SOAA 1EWRA 1FP4B 3T1NA 3AJAA 3GYBA 3KLSX 5G4LA 1FEHA 4W9NA 3IJEB 4BNDA 1E8XA 2Q5EA 1U0HC 3VPGA 1G8KA 1PR1A 1PQ4A 2OXTA 1JX6A 2GRUA 3ZLBA 2W6JA 1EU3A 2IU0A 1DG3A 4OGFA 4BAUA 2H31A 4Z9AA 1XMPA 3EDYA 4YDQA 2ZRDA 3KT3A 1MP0A 1Z5VA 2H63A 1BA2A 2O8CA 3HUIA 2O07A 2IZ5A 5AIAA 3P0JA 2YJNA 1Q14A 4XDDA 1ULHA 2RGXA 2XSZD 4FJ2A 3DE3X 1G21E 1URPA 3EMDA 4GM0A 2LUEA 1KF0A 1XDBA 2R97A 2IV3A 4WFQA 1XYYA 4W4TA 3HUTA 3C5WP 2ZI6A 2HZBA 3G7UA 3SHTA 1QIEA 1UF9A 5K0LA 4LJ4A 3H11A 5K3BA 1O0CA 5JQGA 3QXGA 3DPIA 3ZRCA 3F7TA 1NAIA 3COYA 4W9RA 5K8TA 3L07A 3GQBA 3IUQA 4C21A 2CYBA 2IDKA 2B82A 3S7ZA 4TSSA 5EMNA 3HYLA 2ANBA 2O1SA 1CQVA 2YEPB 2Y1WA 5ALZA 5CVVA 3E0XA 3TLEA 3M4ZA 2PLWA 1C3XA 1KYZA 4UHKA 1Q7BA 2Z9BA 4XFKA 1KDVA 3LZ6A 3IOYA 4MYRA 3M63B 3BEDA 2PV0A 3FAZA 4FS8A 4YONB 3FSGA 3PDIB 4B31A 3FPSA 3ZJYA 4U6NA 2AGVA 2HMUA 4QD3A 3LBHA 5EG5A 3CKLA 4L5AA 2PGDA 2COKA 1EFKA 1QF7A 2DQZA 4O4HB 1YQDA 1DX6A 3VYRB 5I7SA 2WNIA 1QB8A 1V5IA 4EHIA 2RK3A 4J0DA 5JY1A 1CULC 2R9VA 4Y6QA 4LNNA 2BCGY 3D43A 4JLNA 4L4XA 4LSZA 4URWR 1VJCA 4NDAA 2Z8YM 4XQCA 3S2YA 2YHIA 1QCZA 3V05A 1ICIA 4CL8A 3A1QA 1RXCA 3BB1A 1EINA 5C5CA 1JAZA 3RTCA 3WGYA 1V4NA 3X1XA 2VR1A 2CGEA 4MM3A 2R96A 2OYCA 3T7SA 3UJNA 2X9QA 1NNEA 4OW0A 2Q62A 2WMYA 2JLCA 4NG4A 3VR5H 3D6NB 1CY6A 1W9MA 2TSYB 3T3OA 4I9HA 5GONB 1YVRA 2FDXA 4MYHA 4Q3CA 3NVKI 4ZI2A 1Q7CA 2PR7A 3JW8A 3IHTA 2V9HA 3DL0A 5A4IS 4R1LA 3D4IA 3I53A 3E7DA 3ND6A 5AM3A 5JCOC 1ZNQO 3DE5X 1SJHD 3WGUA 1P0IA 5JXHA 3AHHA 3D7NA 4OQFA 4DRXA 4F5ZA 1B2RA 3AVOA 3V32A 4CM4B 2C2HA 2P91A 3U61B 1QF6A 1SC9A 4HQ0A 3CSTA 5B5SA 3KVFB 4F71A 2YVCA 1L7PA 3RNAC 5LLDA 1NVBA 3L6OO 1XUOA 2JJYA 5BSRA 1E18A 4ZVTA 1ZUNA 5INTA 4J16C 5JZSA 3ZRFA 3ZWVA 2WAAA 1IGDA 5GP1A 4WJOA 5GMOA 1MEOA 4NCIA 1ZGGA 3DBLA 4EY8A 4JSYA 3SLRA 2N9EB 1PK9A 1XQQA 4B6PA 3N39C 3IMKA 1RLOA 4X7MA 4NONA 4BBNF 4DDID 3KXKA 3DE2X 5AH0A 2N9LA 4L16A 4J91A 5J58A 1FCLA 4U0KA 5KMGA 2NYUA 3TZ6A 2ZLBA 2I34A 1ORHA 2NUAB 4XDYA 3VSDA 1YULA 2EZ8A 3KJIA 1UT6A 2BLLA 3H9BA 3FGNA 4G1FA 1DG9A 1X74A 1MW8X 5KSZA 3IXQA 4Q7JB 1JYEA 2HDHA 4U9UA 1G20A 1TIPA 1VPTA 4ZAYA 2R0QC 2Q45A 4NTZA 5DCNA 4CM9A 3O7MA 4KR2A 1HMPA 2AZDA 4P7BA 4D82A 2VH2A 3BVZA 4GECA 2V4LA 5E6OA 5JNVA 3JRWA 3AOEA 4FFDA 2FPPB 2VYND 1I33A 1T0BA 4GU2A 4JJ6A 1PZFA 4PLHA 2Z3VA 2IYRA 4ZN6A 3G59A 4Q3NA 4B3FX 2Q9UA 1G6KA 1T2UA 1HQRD 1KH2A 1LK7A 3CSSA 4I6PA 3FLBA 1LBEA 2G71A 1VKOA 1R2QA 3RFVA 4IWPA 3OQNA 2IEYA 4R1PA 1II0A 4ZRPA 4WZBE 1HE4A 4KW7A 3WNCA 3SHOA 2INPE 4F38A 2R6HA 1FFUA 3MHSD 4JOCA 1Z0AA 3BM5A 2EC5A 5CFZA 4XLLA 5JPDA 2HA4A 1GLVA 4JB0A 4PX5A 3O1JC 1OKKD 3UB4A 4LF6B 1WHSA 4P80A 2CUNA 1QFXA 1PDOA 3VPCA 2P7HA 1Y3FE 4JKOA 3JYHA 4IHJB 5HUJA 4I4NA 2KW5A 2VZ8A 4ZCQA 1XVLA 1MJGA 1EX7A 1NVFA 2DAPA 1L4FA 5FTJA 5FEMA 3EFOA 3KL2A 4EO7A 4TXMA 2HU2A 1D6SA 2PU5A 1EWVA 3DVAB 3G13A 2G36A 4OX9Y 4C0WA 1BMQA 3MZ0A 1BE6A 3VZRA 2QMQA 1S7GA 2ZE8A 1JRPA 3A31A 4MV9A 5DNEA 2QGNA 2RI0A 3PREA 5GJCA 2VSXA 4M1OA 2YWFA 4D3SA 3WBJA 3O74A 2KJQA 1UBKS 1GL3A 1P7VA 3OKAA 1VR9A 1Z0FA 4OKSA 1LRJA 2ZB7A 2B20A 3PYLA 4YK7A 2JIPA 3A0RB 3SM9A 2V1YA 5C3MA 3JVZX 1T5XD 3PPWA 5DW0A 4L5YA 1Q2UA 5AW1A 3PT2B 8ATCA 3SFEB 2X1VA 1A4IA 3ZNQA 2B6HA 1C3JA 3A7DA 2XK5A 2PY6A 4QJ5A 3LXFA 5HWSA 3KTFA 3TD9A 3W4IA 4MUEA 4Z2YA 1XXHB 1AN9A 1M7HA 2E49A 1PLJA 3DEHA 1T0QC 3G2JA 3OAWA 3JW0X 5LZ7A 2OBNA 4MUHA 4GDLA 1EB8A 5A2GA 2IGBA 4IXTA 4D42A 3C3PA 5FLYA 3O1IC 2ERCA 2G76A 5CIQA 2ZVNA 4DLTA 1M76A 4OFZA 4G5FA 2R7NA 4E1VA 1OLSB 3T5TA 4NE2A 1KVSA 1S3FA 4DCSA 1PGAA 3R3UA 2YQZA 1F3LA 3T12A 4OHPA 3QEBZ 4BCBA 4XX5A 4NZMA 3QLJA 1YZGA 2FMUA 4RY8A 2IOQA 3HA2A 3EY9A 2BDTA 4QTYA 3HA7A 3ELUA 3WAGA 4Q4AA 4HDKB 2NYVA 1A8UA 2WHXA 2ABWA 2WHQA 3GQVA 3BQMB 2MTBA 4M8SA 2PE9A 3FNGA 4ZMRA 4HVAA 3INYA 2PIDA 2QTAA 4QGFA 4HGQA 4MK4A 3DTVA 3LSTA 3DE4X 2VSFA 1QO0D 3O4IA 4EG4A 3QG5A 3D7RA 4BJ3A 1UBGA 3QGMA 3RYHA 1TVKA 1CZOA 3UMVA 5JJBA 1FMLA 2VTBB 3J7TA 1KZ1A 3QCAA 4J7XA 5AI6A 4JK3A 2BKLA 4MMYB 4OHVA 2FQXA 2I2DA 3B6KA 4XRRA 3NHPA 5TSDA 2QN7A 2G5GX 3DAGA 2VNHA 1YUMA 1AVTA 5CH3A 2DH5A 4BFRA 1XTKA 1UR5A 5K8LA 4DLXA 1OFUA 3BYZA 2LZ6A 3QPWA 3VYWA 2L2QA 3ET4A 4YJ3A 4M0KA 1WXWA 5B6JA 1P45A 3N87A 4V0ME 5IEJA 1AA9A 5CDFE 3ETDA 2DHRA 1Y8QA 1U2RA 8AT1A 1VBNA 3V48A 4ZXFA 2C2BA 4LNKA 3Q6NA 3UMMA 1VRVA 3G9QA 4HBGA 2GCPA 5AVJA 4HB3A 2ODPA 1R7RA 4IUMB 4YUVA 4OD0A 1ILWA 1NIPA 3VI3B 4CNQA 1WZ3A 4R6WA 3GVPA 3QF4B 1DUVG 1UMCA 4MWGA 2ZRKA 5C7YA 4GEKA 3B8HA 5FB3A 4A8HA 3BZUA 2MBQA 1Y4ZA 1E98A 1JFTA 1Z4IA 5J40A 1P1CA 3WYAA 2BM9A 4DMRA 4CYEA 5DW3A 5GIPE 4EJFA 2CVHA 3KT8A 5M04A 4YACA 1QLBB 1ZOOA 3PIRA 4JP5A 1WFYA 3E9SA 4N8EA 4FEYA 1DRKA 3DOFA 4ZT6A 2Q6LA 1O4WA 4NNOA 1L5RA 3NHJA 4KBGA 4QGHA 2V58A 1E7VA 3AVTA 4P4SA 4J1TA 3VPSA 1WQ1R 3KKNA 1YR2A 2AFHB 2CBXA 1MDFA 4H7EA 2FEOA 5C31A 3L8YA 4P92A 3EMBA 4XD2A 2BCJQ 4GI2A 4KRXA 5K0TA 3QBJA 4UEKA 3E9YA 4UMVA 4UEQA 1EFLA 2C7MB 2NSHA 3MT8A 5DT9A 3H2JA 2FX3A 4L8LA 4BLUA 3GLGE 3UA4A 2NPOA 4M7OA 5DH9A 2OA0A 3IDFA 5FUQA 1YASA 2I8AA 3MS2A 4RFLA 3NDRA 3QJZA 2QJWA 4DLYA 5ADUS 2EARA 2YOFA 1E2KA 4O63O 3Q7RA 1RPJA 5CDGA 1T9BA 1I9CA 1ZUD2 4F6LA 1XJCA 1L4ZB 3VO2A 3WLEA 1GN9A 2DLBA 4PG6A 3BYTB 4CM6A 2C2YA 1T6NA 4FYWA 1LZLA 2KLGA 3D5QA 2IZ0A 2R00A 3ZCTA 1TU3A 2XNSA 4EUSA 3GJRA 3A33B 3H3FA 3ICWA 1QJCA 4EVRA 3VFKA 1FMTA 4FQ5A 1JWAD 4BVAA 2UXBB 3VSBA 3NHFA 2JAQA 3FCXA 3TMAA 4EG1A 1AKWA 2J0UB 4OHWA 3UAVA 2DMRA 4PSCA 3GLTA 3L46A 1IMJA 3W2HA 4O3FA 4OSPA 2GJSA 2G0NA 3PTLA 3HUEA 1NENB 4XUDA 4MV6A 3WMFA 4DK5A 4MRRA 4L4ZA 1JB1A 4Z7QB 1YU6A 4BBAA 2VAVA 1YZVA 2PKYX 3DEJA 3OIUA 4K3VA 3VYTB 2RPVA 1PNQA 4F3RA 2L1AA 1PL7A 4N54A 2KM1A 3F7MA 4C2UA 1JFSA 2OESA 3HQ4O 1VPWA 5LQNA 2QCZA 2WXRA 2YFHA 1KPHA 4W9IA 2YN2A 2WWHA 1ZL2A 3U19A 1FNSA 3R7FA 3H1FA 4H0NA 3EXAA 4HQNA 1IMOA 4D41A 1VYTA 4C7OB 1O9BA 1K86A 3FOFC 1KO5A 4MPJA 1X87A 4QVIA 5HG2A 1YRQA 3MHPA 3ITKA 3DO6A 1IOLA 1UJNA 4R8KA 1AHIA 1U0BB 3RMKC 3RKUA 2HJ1A 3PDHA 1XXLA 2GFHA 4ZVLA 1SJED 3O13A 2XZPA 3BIXA 1PV1A 4CM8B 1GGJA 1KH0A 1SKUA 1E3SA 1RJ9B 5HCUA 1JQEA 4HQFA 2YXEA 3I9KA 2P3QA 5TLSA 1DLIA 3UGJA 3KT0A 2CLIB 2HFJA 2H57A 4E07A 3WGTA 3A6JA 4W5TA 4MW7A 2IEGA 1POXA 3E2MA 1K52A 1DL5A 4DDGD 3OSZA 2ACZB 1AUQA 2QKYA 1WR8A 2V59A 1T2VA 4Z6KA 4DSZA 2CXQA 3DNPA 1GSAA 3GJ0A 5C35A 1FLDA 3KKEA 3PC6A 1SO8A 1XT9B 2WT4A 1SK9A 4TYMA 2DJ5A 3PSAA 3PRYA 2AVDA 4GM4A 1YS6A 2H7XA 1IVYA 4G09A 5DNWA 3EPKA 1ZI8A 2BTQA 4XARA 2ZJ2A 2PH7A 2XXAA 4EKEA 5K0ZA 3OSUA 1PZHA 4CL0A 3GJ8A 2X2PA 4HFRA 3PB3A 1Z88A 5LOVA 4UPVA 1OI3A 1M67A 1K6EA 4KK3A 1EM8B 5BMIA 2GASA 1FO4A 2LMCA 4UE2A 3U3DA 3ABOB 1SB8A 1XCLA 4L4UA 1UD7A 5REQB 4B81A 3T9EA 4BFUA 3ZLTA 5LL6P 1YQ9A 3CF4A 3OLYA 3UENA 1WNFA 2X0IA 1N33B 4E5SA 2YYSA 1OBFO 3UHFA 5HXAA 4WKGA 5EIOA 3FR7A 4MQMA 2IE0A 1XALA 1K8RA 1VKJA 2ZJBA 4WKOA 1WG8A 4GM1A 1K8XB 4ADSG 5AKIA 4WLEA 5TF4A 1JH8A 3D5EA 3IP3A 2O0KA 1XZHA 4FYPA 3STUA 5EDSA 2ZWAA 2GCIA 3TB6A 1A4RA 4Q7EA 3DUWA 4WKCA 1EBBA 1I4RA 4MVJF 1XZMA 4H35A 2GM5A 4YIHA 3Q98A 1LTKA 2E5LB 5JWRA 3SEZA 2WIJA 3A6FA 3LZCA 2JZOA 2XKKA 4RQUA 2BV3A 3UJPA 3W5SA 3Q41A 1KE1A 1YIDA 3U80A 4PS8A 3NU1A 1GDTA 1U0TA 4ER7A 3ENNA 1G64A 2POCA 4XFJA 5EMKA 2YXLA 4ZOLA 4JGGA 1WQ4A 1B9RA 1WVMA 2YC4C 1SKYB 5LWQA 4Q19A 4U39A 2DXIA 3PFCA 2X5NA 4I5DA 3K1YA 2KACA 3TJPA 4IIDA 5B2ZA 3FGOA 1WGRA 1T0UA 3AY3A 2IY9A 2V8OA 5FP0A 2SKDA 1VHLA 1NI4B 3C3KA 4YLGA 4B9AA 2MSEB 1II9A 1ZRSA 3JVUA 4XR4A 4PN7A 2I2YA 1PTJC 2YQ4A 4Y6GB 3RTEA 2G9HD 3PGLA 4B95A 4RHYA 3X23A 3DHGC 2R61A 3G2MA 3ZZMA 2LKDA 1OY1A 5DM1A 3DBHB 1CQZA 2VZKD 2FN8A 5GV7A 3NGLA 3T0GA 2IHTA 1N7HA 1FMCA 2QTFA 2WJ3A 3EXFA 2KAJA 4EMBA 3OO1A 1RAIA 4DR4B 1WUKS 2ZIFA 3LUBA 4K8OA 3KZOA 1CEQA 1SCUB 4S2UA 3CPJB 1KI1A 1LXDA 1D2CA 4Y3UA 2J53A 4G81A 1E3WB 3HDJA 4CF3A 3E03A 4BFVA 1RRVA 5IBCA 4BEVA 1FNMA 4LKRA 3CW8X 4WL0A 2RB4A 3PDUA 3E27A 4RKYA 1T5HX 2E4UA 3M6AA 4MUYA 3V1UA 3DAFA 3VR0A 2PWYA 1ZMRA 2DQKA 3ESBA 2DWPA 4HD8A 2J3HA 3V3KA 4HADA 1PJQA 5I51A 2PS9A 1I7SB 1GRVA 1X8XA 3SQXA 4A20A 2QSYA 3OQIB 2BUBA 5FUYA 1CERA 3DMNA 4X00A 2B98A 3WV5A 3CF6R 5JI2E 1NDDA 2YVQA 1NVID 1ZMTA 2ZW9A 5EZYF 1XPRA 5A7HA 1NF9A 2Q5FA 5D84A 2A84A 1ZLYA 4KDRA 2AI2A 1CUGA 2VBGA 1JR4A 2FWIA 1NURA 5LLSA 1L5FA 1E1CA 1V8FA 1W52X 1XQXA 2DHCA 3T8MA 3IVXA 3FETA 3EYWA 2C82A 2XKJE 3PEUA 1KY2A 2RBKA 2HHJA 3D8UA 3P2YA 1Z18A 4A15A 3G8AA 2FK7A 2GX6A 1E4VA 3MCAA 4ALLA 1MVKA 1U31A 1T5DX 3DR5A 5ALMA 3GJXC 5BURA 3PUXA 2K6GA 3RS8A 3QXXA 3PUYA 1EUYA 2MA9B 5BQXA 4NEHB 2J0JA 2GJAA 4OJQA 3LRXA 3SS7X 2GF0A 3GJSA 4QGSA 4YECA 3OE7A 2VRBA 4G0PA 2A86A 1NVTA 1ZN8A 2MBOA 1Z75A 2G4DB 1R1DA 2ZJ1A 4AJ4A 1L7RA 3P0IA 5KB3A 2NXNA 4Y8VA 2XUAA 4WA8A 5I4DA 1X42A 3DSRA 2QA5A 3VU3A 3O4HA 5J47A 4MWSA 4JLKA 3PXUA 1M1YE 5FKJA 3HRHA 3IEPA 4KMMA 3OJFA 3LOUA 4XCQA 3C6ZA 4O29A 2QTVA 1JNYA 1M7GA 4MS3B 2JVCA 2FDCA 4JT9A 2I03A 2C9DA 4L02A 2GBJA 3EXEA 4HLEA 1JPUA 1GUYA 3C3XA 1AQLA 1LXCA 1G9TA 1LJLA 4RVFA 3S7TA 1XRSB 2WWXA 4ZV7A 4WECA 1GTRA 2O2IA 1S8NA 4W5HA 1COZA 4U0JA 3SEQA 4X7RA 4WNYA 2JFZA 3IQDB 2PZJA 3A1CA 3TX2A 2XB4A 4DIKA 2WJWA 3VJLA 3W77A 1R50A 3RSCA 5BXYA 3M2PA 1XAGA 1PR9A 2CXNA 3NP7A 3AKEA 5I3ZA 1LPPA 5T8KA 4UVIA 1YSCA 4FE3A 2IX9A 3BFPA 1G3MA 2ZOSA 3M3PA 4XVRA 4ALMA 2WXQA 3TLGB 2RGAA 4G8DA 5BY2A 1FSFA 1NVVR 1XFAA 1S3SG 4NJEB 2JIZA 1SQ0A 1US8A 3JASA 2YJ3A 5CLHA 1D2AA 2CNDA 1QP7A 2YV2A 3HDYA 2JY6A 5CK5A 4INAA 4BBNC 4RJJA 5EKTA 1T8RA 2RDBC 1XWIA 1K3TA 1SRQA 3PUIA 4MJSA 2AQ2B 4F6RA 4ZYYA 3HKCA 1VPVA 4WLOA 3DMYA 3BFJA 4WNCA 1KY5A 4CMKA 3B13B 3MCUA 1FRVA 4KE6A 1X9HA 1J8MF 1T9GR 2J0MA 4A2CA 2VAPA 1BGVA 2W70A 4U1RA 2FHPA 1TKYA 2JGIA 3DS8A 4ETIA 3TD6A 4QOHA 3ZTYA 1INLA 2PUBA 3HB5X 4JD5A 1CZKA 1P9LA 4CCSA 2IYWA 2A59A 5IK2A 4CDGA 2GHQA 2WT8A 1S2DA 2W82A 2H00A 3BK7A 4D97A 4RAQA 4J4TA 2Y92A 4UW9A 5HIAA 2ATEA 2JVKA 2WJYA 1JEYB 2ISCA 4BX2A 2R751 1DWUA 2AL6A 2GBMA 5FL7D 4MSQB 2H1LA 1BGXT 1QWSA 2KWUB 2WLBA 2CCGA 1TZJA 2OFXA 4DJEC 4IIJA 4YTMB 5DM60 4JWTA 4BV8A 4YUZA 2YXPX 1FUIA 4GNRA 3WMRA 4KR0A 3OCYA 3DMHA 3L7CA 1KFBB 3GBPA 4XGKA 2NU8A 4UTOA 2V6IA 2I38A 1WMDA 5KJCA 3I28A 1VKNA 3P0HA 2QD3A 2C2MA 2X40A 4L9AA 4XVHA 4EARA 2GN9A 2A7QA 4MVJH 3CVYA 1OIVA 4B3HA 2XKAA 4PT5A 1U4NA 3KT6A 3PA6A 3R9XB 3R7DA 3NCTA 1QS0B 2GUWA 1NUSA 3OZUA 3PC8C 4JBGA 4YTPB 1EFVA 1Y82A 2QUHA 4BNXA 2IYSA 4NZPA 2IP4A 4L7QA 2PUFA 1B6GA 3ED1A 4NBNA 3KR2A 5EZQA 1O9HA 3RREA 2HI0A 4KGZA 2WFMA 2GEDA 4GEGA 1ZPSA 2JHCA 4HX5A 4W9CA 2P6PA 1D4FA 4I5IA 4NAUA 4N7BA 2MSDB 4KVFA 5JBIA 2OBXA 1IK4A 1HT1E 1WKVA 3AUJB 4AUQC 3QKSA 4QNRA 1HK7A 2OM2A 5HFYA 4JLBA 2MCFA 4I8XA 1DC4A 4AP6A 4XVUA 1JQLB 4Z99A 3PEWA 4KYTA 4C56C 4U2GA 3EEOA 4TVOA 5HRAA 1N2GA 3I63C 3EB9A 5ABPA 3I8SA 3H5IA 2ZTMA 5IO9A 1GZ5A 1JDBB 2OBFA 1G18A 1E1RA 1B1AA 1RR6A 1AH2A 2FUKA 3RROA 5DI3B 2NUPB 4HKZE 4DCPA 1VPEA 3B2GA 1UBJS 3OQ6A 1IEXA 4C04A 4KKIA 2IVFA 2ZPAA 4NJMA 3EPPA 4X1IA 1K9VF 1UZMA 4P4LA 2CU3A 2V9CA 5CG2A 2R6FA 3KJFA 1J07A 1J7JA 4C87A 1E7PB 4LW8A 3DPDA 4KQFA 3A26A 2JASA 3KLMX 3DC2A 1EXWA 2GZ3A 2JWUA 2ODWA 3CVWA 1R3UA 3H7PA 2DWCA 4RH1A 5IXYA 1NTOA 2IVZA 2OAQ1 4XZ4A 1D6JA 4JVNA 3TPFA 5A4JA 3G5UA 4YXFA 5B1YA 5CCEA 1UKCA 4WZZA 1XTPA 3QE9Y 5TVKA 3RSQA 3ND9A 1RZ3A 4TUYF 1R9NA 4B2PA 1YJ8A 4R01A 1UINA 5HYVA 3I6IA 3C16C 1JNXX 3WHKA 1ET6A 3EGDA 3MOSA 3DZHA 3OTQA 4V24A 1MCZA 2Y66A 1WABA 3ITDA 1HZZC 3I9MA 1KI2A 4UVEA 1OCEA 4U4AA 2QTWB 4YV2A 1SIUA 3IVMA 1YBMA 1RBYA 3UHOA 1G5QA 3TNFA 4RQBA 3JD1A 1JHVA 1K97A 4HNQA 4LNUA 1EWYA 4A8JB 2QX8A 3N28A 5DZSA 4TLLB 3ET5A 1F17A 2WB2A 2C4MA 3UZUA 4MWZA 2X5XA 2GSDA 1Y4UA 3UMFA 4RMAA 2NU6A 2H0RA 3OCJA 4PIMA 1EFDN 5CBPA 2V65A 2PSHA 3VHTC 2YZKA 2VHTA 3PX3A 4AN1A 1DWQA 4FFLA 1I2ZA 2F43A 3L7YA 4IDAA 2W9XA 4AJWA 4Q3LA 4OMDA 5CAEA 2ONJA 1F14A 2QZ4A 3NOQA 4L6IA 5CEJA 4K6KA 2HO5A 5H80A 5B6PA 2G17A 1VDVA 4WV3A 1UOQA 3DNFA 2IS6A 2YWBA 3SX4A 5T57A 3LX4A 4DARA 2QG9A 2YOHA 2DAFA 4Y9DA 2G07A 1VE9A 3A1SA 3I04M 1X0VA 3DZGA 3HUFA 1HNWB 2ZJYA 3RABA 3TLKA 2VSNA 4RM2A 3W6OA 2HQBA 1I94B 4U7HA 4F9EA 1H0KA 4DNXA 3IE1A 5TRTA 1A8QA 4U8GA 4ALIA 2FPXA 1N57A 3WHPA 1TQ2A 3BAFA 3IKJA 4RORA 2EFCB 3HRKA 1NAHA 1R37A 1KYTA 1MX1A 1JWBD 3I1IA 1W1UA 4X61A 4AKSA 4AY2A 2ZR8A 3PFNA 2AC2A 1UDRA 3VR5D 1M6NA 4PXAA 3H9GA 3MAAC 1Z2AA 4KPYA 2Q5IA 2CXUA 1TO6A 1AXGA 2IGHA 1YQWA 4PO3X 1I1NA 2EX1A 3OU6A 3UANA 4LISA 3N5CA 1E7RA 3DMGA 4LF9B 2A1TR 4F12A 3CUTA 4LMBA 3DB1A 4NL4H 4DKJA 4OUKX 3BQ9A 1RAAA 4I50B 3MUEA 3HB4X 4KQCA 1G4HA 1DQSA 1J9ZA 4DCTA 5FAXA 4TQ9A 3SHWA 2HM7A 3K0KA 2PSDA 1XT6A 2QLBA 3LDZE 3X0WA 4IIFA 3ZD9A 3E5HA 2D54A 3IEIA 2DQYA 2ZVJA 3EQZA 1YC5A 1DPFA 3Q2OA 1I01A 4YMWA 4TL7A 4UDUC 1DRUA 2FZEA 3BSSA 3GDWA 5HBGA 2GFQA 3ZI4A 1C4XA 3HP4A 4MQUA 5YASA 3BE6A 4LX0A 3B9PA 1MTOA 2FZ4A 3WIEA 3QVOA 1T43A 2BS2B 1NBMA 2YJ4A 3UK7A 1Y6QA 3IKLA 3N2KA 4H6PA 3USCS 1PEDA 3E82A 1SVIA 3L40A 2HSDA 2FNJB 3RD2A 4ROSA 4FHDA 3UPUA 2BISA 3RSHA 4FXCA 1QONA 3ELDA 3V62A 3EEQA 1XSEA 5AK0A 3BMNA 4IXMA 2FLVA 3IE2A 5DIFA 5AM1A 1RT9A 3ZHYA 2H2AA 1EWQA 1XXGA 1ECLA 4D45A 5KAMA 9MHTA 2CNBA 3IBYA 1QJ4A 1CY2A 2CHQA 1OGIA 3GFTA 4M1QA 4XDHA 1OF1A 5HGJA 1RP1A 4E74A 3FN4A 3RK0A 1EF5A 1ULSA 4P5EA 1P7PA 2PH1A 2Y27A 4TTJA 1P7ZA 1I7QB 4W8GA 5IVHA 1GCAA 1O57A 1NATA 1W49A 3OO0A 3IIKA 3LECA 4XRGA 2PLRA 4D0RA 3KJXA 3NEYA 1I30A 2GZMA 5KTKA 3G0GA 4G23A 3M6VA 2GJ4A 3WAMA 3VR6A 1KZ9A 1FC0A 4PC1A 4N8DA 3UK2A 1QX4A 2CHVA 1WB5A 1E5VA 1KETA 1L6VA 4FOLA 1VLZA 1LWNA 3HDQA 4DQUA 4B4WA 4I1VA 2QN8A 4YS6A 1D04A 4DWWA 2FCNA 4P82A 2IBSA 2MH7A 4BE7B 4ID9A 3FCCA 5BOVA 3GHHA 2QSUA 3C6KA 4DUGA 3JV7A 4BNIA 2QRHA 1PFDA 3ZW9A 5E4YA 3DVQX 3OA2A 4H3HB 4JC0A 1OX5A 3FCYA 3DLTA 4MRMA 3PQCA 4LHEA 1VI2A 5D94A 1MB2A 2N0SB 1WRBA 3KJNA 4TTSA 2D3GA 3VJMA 1SZCA 3LCUA 3L41A 2XY4A 2JCXA 3ZJUA 3RRZA 3NAMA 4ZA2A 2KBFA 2XRMA 1TTNA 1Z4OA 4LWOA 1BKDR 1MO6A 2O8VA 5GGYA 3UJ8A 5K5EA 2C60A 2BI7A 3TCAA 5L6LB 2B6NA 2DBVO 3DL4A 2L0TA 4RK0A 4WH4A 3EVDA 2W6PA 4DG5A 2JLWA 3LCVB 1UAAA 1Z6PA 1EZ1A 2BONA 3QWFA 5KYKA 5L6MB 3L7KA 4WOBA 4YALA 4JUBA 1DSSG 1XA4A 2B9EA 3ZHUA 1NR5A 4N48A 4TSRA 3APFA 3ZH2A 2W90A 4YYZA 5DBOA 1VHWA 2JZPA 2PGOA 4C0KA 1HFJA 4YRPA 3QG1A 4Y6OA 1LX6A 2A4ZA 3RKSA 2P8SA 3KUKA 1I4DD 4LYHA 2GA8A 3EIFA 1SUDA 3HN7A 3IAS1 3T1TA 2XKBA 2JGEA 3HMKA 3VR2D 4BO3A 4Q1VA 3T54A 1GKYA 5AUPB 3ETLA 3TSOA 2VJLA 1KPGA 4YAGA 3M89A 2OY0A 2DPLA 1ZMBA 3AE4B 1XRQA 3X1YA 1VCOA 1U0EA 3IULA 1P77A 1P4HA 4INJA 2HJHA 4WJPA 3T5AA 1GQFA 1FU4A 1RPZA 2B7LA 1BU8A 3X44A 3QWAA 2K6DB 1O2DA 1LFAA 4DV4B 4U00A 5TR5A 3LZDA 1JBKA 4HDOA 4R0VA 1C80A 1EIWA 3HL0A 4LS3A 3I4CA 1MLDA 4O02B 5EHZA 4O8ZA 1E9AA 5T4BA 4Z5XA 3PQ5A 1Q7EA 3PKIA 1EFRD 2VI5A 3OPYB 2DPXA 3BL6A 3AERB 3AV8A 3CA8A 5D3KA 5KOHA 2YVUA 4KN5A 3KSZO 2IIQA 4R9UC 4Q00A 4CLRB 1C1YB 3DOUA 1R8JA 1Z16A 4HNGA 1KO1A 1RQRA 1PT5A 2VA8A 1JTFA 3IIIA 1VSQA 4Z51A 2W43A 3EZ9A 2JGNA 3LM8A 4RJIA 3ZO5B 1U6KA 4R84A 4OLBA 4TL8A 3FSEA 7YASA 3W1SC 4I81A 3REGA 3Q0IA 4ZOBA 3WICA 1PD0A 2RGBA 1U11A 3Q3NC 1LSSA 2AG5A 4XB1A 5JJLA 2XBUA 5JZ9A 1TEZA 2JC3A 1H1DA 1FNVA 3ZZTA 4G0YA 4W63A 4P1ZA 1ODLA 3I9OA 1USIA 3L5OA 5KNDA 2KK8A 3WYBA 5I45A 3VX4A 4KRGA 5I9LA 1ORRA 3PHLA 1EBUA 3A27A 2XX3A 4V0QA 1RVV1 5JSZB 2Y5BB 2HR1A 5BYSA 1BDMA 3E5NA 3U2SC 4JUAA 1V3VA 5MF6A 2FPOA 5HIKA 1WOYA 1USUA 2R8XA 4ZYVA 1W2HA 5FRDA 3V8RA 4A0QA 5G5GA 1LVHA 1DDGA 2LRUA 1V6AA 1I5OA 2XUZA 1C0EA 5KTNA 4GBED 2G1EA 3WX0A 2QF7A 5H8YE 1Q0QA 5J2UB 4HK4A 1Z0IA 3FKYA 4U9IS 2REXA 3X1MA 4CDMA 5IBPA 3DMFA 2AQ3B 2PUCA 3UQAA 1YQUA 1BQ4A 3KD3A 2UWQA 3EDRA 1O5IA 2GZSA 4F11A 1D1QA 5K4AA 2CCKA 1VE1A 2DYBA 1GVNB 2MYNA 1QQTA 2OHXA 1WSAA 1MAAA 1L5HA 1N63A 3RYCB 1TM3E 5DSZA 4BOSC 1FNNA 1WW2A 2Z30A 3CZMA 1VM6A 3A58B 2VRRB 1MX3A 1J20A 1RAHA 3O8QB 5EQDA 3D8BA 4W9JA 4I1SA 1LPOA 4PANA 2C9ZA 4GC5A 2Z04A 1P5FA 3I34X 4DJDC 4CDRA 2P77A 2GBCA 4WBSA 3OBIA 1RZRA 2OILA 4YLYA 3FYUA 1ZH4A 2VT3A 4OVZA 1P91A 4F6CA 3O4VA 3H1PA 1Z8NA 2JJ2A 3KYCA 4NH0A 3AI7A 1T9AA 1XA0A 5H02A 4JVMA 4E5KA 3BJMA 2Y77A 1BYIA 3PHWB 1AKTA 3EUB2 3WL3A 3RJTA 2QBYB 2PL3A 4CBVA 3A1FA 4RGVA 1IE3A 4PSVA 5JQWA 2OCYC 2PT6A 4HVCA 2V7BA 5FFFA 2D7JA 1FUYB 2JANA 1QGAA 3KUXA 4TZ6A 5IVKA 2MMGA 3J81k 2Z6UA 2O50A 2B4RO 2VXOA 5FHRA 1HE5A 1I2DA 2MSNA 5HIIA 2XYPA 2NADA 4KQGA 2EP5A 5HX7A 2YBDA 3M49A 1H9BA 4RGQA 1OB2A 4MKIA 4GBMA 3TJRA 1F6BA 3QEMB 4E6PA 5K05A 1H2BA 4IVRA 1JHZA 5A1JA 3GOQA 3KQOA 1YK1A 3I0ZA 3F46A 4MXDA 4P5DA 3H8WA 4JUDX 4B9KA 1CUYA 4OHKA 2AL3A 4RLSA 3U6KA 1H6DA 2BEVB 2ATVA 4JP2A 3MEQA 1GILA 3WFJA 4C3UA 3TBLD 2DUUA 1V0JA 2DB3A 5F23A 13PKA 3COPA 2PX4A 4CKWB 2H08A 4ZJUA 3PGXA 3A4LA 5ELLA 3FYHA 1SM4A 2CEKA 4YI3A 3N7UA 1DPGA 2MSWA 1Q0HA 1ULAA 2GOYA 1KI9A 2D07B 5BRAA 3T4PA 4DA0A 3QU7A 2QRLA 3G68A 2ZIEA 4EG5A 2GD0A 5IRCD 4EUHA 3ZTDA 4IMRA 3RQSA 4CQLA 2OPHA 4I9GA 4GE3A 5A5GA 1HDYA 4A55A 1DTEA 3T34A 4MAAA 4MI1A 5JO9A 1JJBA 2P67A 3P42A 3VPAA 4KSLC 1FX0A 2HX1A 5EGNA 4MGIE 4MYCA 2W9NA 2B3TA 4W82A 3C3CA 1XIVA 1RAXA 3CH4B 2EG9A 3PZDA 2XUHA 2KS6A 5EKUA 3TK1A 1KWKA 1XZIA 2XB6A 4HEQA 4IIHA 4BGIA 3GYGA 1U80A 1XX6A 3ZDAA 4OQDA 2EFEB 3K30A 1N5KA 3QLVA 5L3SB 5AYVA 4GSWA 1R0XA 1XMOB 3U44A 4KLRA 5ALDA 2EU8A 4IYJA 1P1JA 5FUMA 3K0CA 3FWPA 4J9VA 4P98A 1YS2X 3PVSA 5DMXA 1FNDA 3AUFA 1FFCA 1NXSA 1JI3A 2YXBA 4D98A 2WDTB 3K1TA 4RV5A 5FQNA 5M5BA 2IA5A 3GCXA 2BFEB 4FWBA 2JLRA 5E2AA 1ZD2P 4D3FA 1QV9A 2XN9C 2CB9A 1R9MA 4CEJB 4XQ9A 4ZRIA 1PGJA 3C6YA 5I7WA 1AY0A 4G1EB 4BBPA 3IOCA 4LWPA 4JAVC 2QNRA 2Q3JA 1WCWA 2JLVA 5ENVA 4RO0A 1U02A 3GMSA 3F49S 4OXKA 2OB1A 1ZBDA 3M4XA 2BIFA 1Y6JA 2EMSA 2E6KA 1NMEA 3BS4A 4QYWA 2IIBA 1L1RA 3JVDA 4S12A 4YXWD 4DC1A 1Q50A 2PA3A 3EEIA 4EENA 1KDPA 3O8OA 2YASA 4OK6A 2VSQA 1IBKB 3V2GA 2BKAA 4GWGA 2OQRA 5AVKA 4G4SO 1D3ZA 3KOYA 4MMZB 2PSFA 4BU1A 2VPPA 4DMCA 4X71A 1XK6A 5GZ6A 4BNYA 1EWKA 4Z1MA 4G8CA 1KFYB 4WWNA 4GZ3A 1QR6A 4FZJA 3WKAA 2BKFA 4LOHA 3RAEC 3HCNA 4BGUA 3K5IA 3RRBA 4KGVA 1YQ4B 4MVJP 3TNJA 3GMIA 4CT4B 5L8VA 5DRTA 2Q6VA 2G04A 2PWBA 3Q6IA 5EP1A 1J1ZA 3AKCA 5G2NA 1QGYA 2ATXA 1T6BX 3KIPA 1IJFA 3NT4A 3AIOA 2YEPF 5KQMA 1K6JA 4KV2A 2IF2A 5CNMA 2WJPA 1AQJA 2NZYA 4UTVA 1X0XA 3DCYA 3I32A 3KKMA 2L82A 1HI9A 1AGNA 5NULA 2OO3A 1Z39A 1N7GA 1MDBA 4D44A 5DPRA 2QSJA 4K2AA 4BMSA 1YAHA 2ZSEA 3TL6A 3H8JA 4J29A 2EKQA 1J0EA 1P5HA 1XCPA 3SCZA 4B5LA 1FCCC 1G3QA 1C3LA 4O4HF 3THYB 2BB6A 2F7SA 3H1BA 2A8YA 2F3UA 3N2NA 2P9HA 3HZOA 1XRJA 3UMRA 3KUUA 2IY8A 2J31A 1JJ7A 2Q6IA 4RETA 4LWZA 3DHNA 1AJEA 4L2IB 2QTLA 5KYNA 2LD4A 4NHOA 4PZEA 4G0MA 5EHGA 2GZHA 1QORA 2M17A 2OO5C 1MQAA 4QATA 4AD8A 2DCMA 1O94C 4U63A 1TX4B 1JUDA 4HPPA 1X7ZB 2FPGB 3L8CA 2DWQA 5SZHB 3KPJA 5GONF 4BB9A 2BBTA 3KQWA 1PWXA 1U63A 4U8HA 1R4NA 2UVPA 1YJ5A 2D2EA 3TIVA 4TTIA 2YBEA 3KU1A 3EOBI 4EF6A 4HFNA 3ZXSA 2HADA 1OX4A 3O38A 2W6NA 2C2WA 3KQYA 4CLXA 3DWMA 1WLSA 1TPYA 3WJAA 1I24A 2ONQA 5G3ZA 4HN9A 3VAYA 2IC5A 4JENA 1PZNA 4YIKA 1R0YA 2PRKA 1JWMD 2O5VA 2MDTA 5J4KA 4TMFA 2F8LA 4R1SA 5JFGA 3W2DA 2IHZA 1GLNA 3IKVA 4DM7A 2RHLA 2R8BA 2QWXA 5K0BA 1UODA 3QKRB 2OJRA 2P90A 2RI6A 4CG3A 1I7NA 4OLFA 4QAYA 3L0ZA 1GVHA 2XF8A 1WRIA 4EHFA 4PAWA 1TU4A 2QZZA 5LQJA 3WRYC 3GGCA 4C7VA 1VCNA 1V26A 3D5TA 1LTHR 3ORFA 1Y3BE 1U2DC 4AZ3A 5A3VA 3W6NA 3RYIA 4ZJZA 2YJ6A 1E60A 2K7ZA 3WRWA 1MAVA 4D8TA 3RYTC 2JG3A 3KQSA 3FRHA 1B26A 3MCTA 4YMHA 1SVKA 1Q7RA 2WYUA 3OZBA 1J0CA 3NIFB 3TEXA 2GR9A 3TNDA 4EJ6A 4PSAA 3HYCA 1GG2A 1CZHA 5GJWC 3EVTA 1TUGA 3R3VA 2QW0X 1FNBA 4JDPA 1E0SA 5KOIA 3TF5A 1TA9A 4CTOA 2JL1A 3MOGA 4R40A 3EIOA 4QPJC 4BN4A 4R3WA 3T9DA 1MXFA 5IDYA 4D9GA 1RTTA 1H8HD 2XOKD 2C7HA 2O48X 3AEQB 4U2KA 2HV8A 1I80A 1J8FA 2PXHA 4EABA 3A6HA 3MFYA 1L6IA 3O8DA 2X7HA 3MT9A 2LZ0A 2PR2A 3GAAA 1KZYC 5F73A 2Q3EA 2VBIA 4QEDA 1IYZA 3RH0A 4U3JA 4WQOB 4YT8A 3MGBA 1Z5OA 2PRIA 4B4DA 1Z2DA 2V9ZA 4A2WA 4R4JA 5DTJA 4DCUA 4E33A 2D1TA 2VCEA 1VHDA 3T5MA 1CF4A 4IHJF 3SZUA 3BRQA 5CM8B 1NOIA 2HIAA 4JI1B 4IBOA 1A2OA 2PJUA 4FMCB 1W5EA 2GA9A 4CFSA 1EWTA 1JFFA 2JJMA 5HRCA 1GZ3A 5E6RA 1WF9A 2OV6A