2VH2A

Crystal structure of cell divison protein ftsq from yersinia enterecolitica
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
202
structure length
201
Chain Sequence
PLSKLVVTGERHYTTNDDIRQAILSLGAPGTFMTQDVNIIQQQIERLPWIQQASVRKQWPDELKIHLVEYVPFARWNDLHMVDEQGRSFSVPSERVGKQKLPLLYGPEGSEQDVLEGYRAINKVLAANKYQLKMVAMSARHSWQLALDNDVRLELGRDDRMGRLQRFIELYPMLQQPDKRVSYVDLRYETGAAIGWAPVFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mutational Analysis of Cell Division Protein Ftsq
pubmed doi rcsb
source organism Yersinia enterocolitica
molecule tags Cell cycle
molecule keywords CELL DIVISION PROTEIN FTSQ
total genus 30
structure length 201
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03799 FtsQ Cell division protein FtsQ
A PF08478 POTRA_1 POTRA domain, FtsQ-type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2vh2A01
3.40.50.11690 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vh2A02
2VH2A 4QAYA 3Q6BA 3OG5A 3EFCA 3NJTA 4PK1A 4BZAA 2X8XX 4K3CA 4C4VA 2MHJA 2V9HA 3MC9A 4C00A 3MC8A 2QCZA 4K3BA 4XGAB 2VH1A 4C4VB 2QDFA
chains in the Genus database with same CATH superfamily
1Z5WA 1F4PA 1MAHA 5A6VA 3J81A 2DWQA 2IOFK 3OU2A 2ZIEA 4L9RA 2ZQZA 1RPJA 3SYKA 3UFBA 4IPTA 4HFMA 1QOGA 3BGVA 2QORA 3ILYA 1P4GA 4JJEA 2F55A 4WDRA 2C4NA 1X7WB 2CL0X 5CFQA 1TI7A 2J0QA 4MTCA 2GLSA 2IUTA 4OJTA 3TE7A 1KK0A 1MOPA 1F20A 1Z15A 2A3NA 2JGNA 3LMKA 2QIOA 2FPIB 4QUAA 4UVGA 4YECA 1Z9BA 2H00A 4MYTA 4P4GA 5EP4A 5ICGA 5J2UF 4N5IX 1U0HC 4CFZA 4HH3C 4YS6A 5F2NA 3GT0A 2XJ4A 4J0IA 1A88A 2O1SA 3WFJA 1NX9A 5B4VA 1ZJYA 3QHTA 4YONB 3S99A 2DR0A 1JS1X 1TVMA 1Z62A 4I55B 2X7XA 1JLLB 1N63A 2QDFA 3F78A 3KNZA 3G8DA 4U2CA 4WCFB 4HR7A 3UGQA 3WGJA 2PUCA 4O1IA 1A72A 1N5DA 2OAQ1 4P35A 2BP7A 4DNOA 1TMOA 2R1ZA 4C3OB 1QF7A 1H2EA 2V7BA 3M3JA 4I6LB 3AH7A 1KHHA 2DUWA 4BQSA 1JF8A 2J5BA 2L7RA 3AONB 3EBPA 3GRYA 3G1UA 3U4QA 2EKEC 5BSWA 4I6PA 3D1LA 3P63A 3UIOB 3F4KA 5AKIA 3SEQA 2ZI7A 3TKYA 5T4BA 5C8YF 1OFUA 2XMGA 3BRWD 4K26A 4EUEA 1TZ1A 3A2KA 2J0MA 1E98A 1GTZA 4MKZA 4P16A 2QRVA 2WUDA 4GOXA 4QDUA 4MARA 2XZPA 4LWQA 1OTXA 3Q2AC 2EMSA 2OG1A 3KEGA 1M6HA 3EYAA 5FO0A 4DQUA 4BX2A 4KPFC 3ANLA 2AKEA 2B1IA 1P5FA 2D07B 2GZSA 3PUWA 1KE1A 3L54A 4Q7LA 1EE1A 4G3XB 3ANSA 2VJQA 3GLQA 4UAJA 1DUVG 2OFOA 2O8CA 2FR8A 3DW1X 2JD1A 1SE9A 1MRZA 4CTKA 1UNSA 4GSWA 3VR8B 2EWWA 1JJIA 4RY8A 4ZT7A 3EWAA 4FZ5A 1ZJ5A 3C48A 3NEJA 4MW7A 4KREA 2IV3A 1JG3A 3RUEA 3H7PA 2TSYB 3L8FA 4OLFA 4WZBA 1AOXA 1KP3A 1BS9A 1A2BA 1H9BA 4GPTA 4G1FA 4RM2A 2JAOA 2JBWA 1IYZA 1DS6A 2OQIA 4V0LA 1WE6A 3BIWA 3O6VA 3KK0A 4HV4A 1U8ZA 4AI6A 4DTCA 4KI0A 4GR4A 1KDRA 3O2JA 4MPPA 5FI1B 2Z3VA 3Q9NA 4V38A 3SNKA 2O06A 2FW0A 1HTWA 4D43A 5ADWA 4AURA 4ZYWA 4IM2A 4OAPA 4ER5A 2HLNA 4PVCA 5CX1A 1Z2EA 3VXWA 2C4KA 4HQOA 3I2GA 4WBSA 4CQMB 3TR0A 3ZTWA 1R9GA 3MJSA 4U8GA 2XA1A 3O9ZA 4FMCF 5JR3A 5D8DA 3VSAA 5IT0A 5BQ3A 2YHIB 2AV6A 3PHIA 2AZDA 4EQ6B 4B6QA 1MTOA 4K3UA 3QGMA 2G5TA 2IOFA 1Y7LA 3W2HA 4JE3B 3B89A 2KX0A 3VNAA 2H2DA 3C7CB 3NVDA 1IWBB 1CR2A 4INPA 4JB3A 1ZUIA 3BH6A 3RTEA 4C6TA 4IV8A 7REQB 1W85A 2C7OA 3WHLA 4GLBA 4ZHQF 3L17A 4KXMA 2XE8A 1D3ZA 3QE3A 5IJ9A 5KQGA 3AHIA 3OE5A 4YT8A 1WEHA 3F6PA 2XNSA 4A5SA 4DR1B 2V5UA 4IO1A 2NVOA 3AHDA 3JAWA 3ND7A 4OLBA 1FMLA 3AUAA 1DRJA 5FP0A 4DY4A 1ZC4A 4XSGA 3A9SA 1JWMD 3T9BA 5CK4A 4AL4A 4CDNA 3HZZA 2W3SA 1OX6A 3A1WA 3QFSA 3QVJA 1IJKA 1XTRA 1Z3CA 4R7GA 5IBPA 4ZODA 2IHKA 1C79A 3PGMA 5JPDA 2BH2A 2HCBA 3DCJA 2HWYA 1T8PA 3OPMA 3QYAA 4FGLA 1Z12A 1T6XA 4W9NC 3UMJA 4AG6A 4D4LA 3UATA 1EESA 3I45A 2CK3A 4O2LA 1E79A 1P4HA 3OJXA 4L73A 1VR9A 1R6UA 3M6XA 3OP4A 2FPOA 4GGQA 2XMDA 2XMCA 3R3HA 1KFJB 4YLYA 1ESDA 1BZYA 5A4DA 3PRJA 2H8GA 2NUTB 3N58A 2Z5FA 4ZT4A 3HKBA 3PZDA 3NHJA 4TUYF 3HO6A 4BQQA 1LV8A 1M5TA 3LUFA 5A5DA 2P75A 4LRUA 2VHTA 2OXRA 1X8LA 1IUNA 2RD0A 2B5WA 5DXFA 3CB2A 1FS5A 1HLDA 2CFTA 1EP9A 1FYEA 1Z33A 2WG2A 4X0EA 2NQ2C 3SHFA 3NC0C 3QJ5A 3T5CA 4YRFA 5JQWA 2X1LA 2AOVA 1GPMA 2E6UX 3O4GA 3FRIA 4YUXA 3L4JA 3ZDDA 3KCQA 4RSRA 2BS4B 3PQ7A 2GR9A 3HJBA 2A9OA 2PLNA 2BKVA 4KN8A 3M95A 3G5AA 1YVRA 3I04M 1W4ZA 2BMJA 1AKWA 2IE0A 1AKNA 2GLUA 4IH9A 2PSSA 2AI1A 2G5GX 2E37A 3JWPA 1PU2A 1MA0A 2JJ2D 3Q41A 3R0XA 4PC3A 3RHTA 5JS8A 2Q5CA 4O2AA 3TQFA 4FZRA 4N58A 5DOVA 2HH9A 1NKVA 2DHEA 2I54A 3HACA 4M1QA 4P4SA 2YV2A 4G9BA 2HD4A 4U3JA 2VP4A 1SXJE 5J40A 4ECEA 4EFMA 2VK8A 1F2TA 5LXTB 3GR6A 4X7PA 1GN8A 1A2QA 3KUKA 3OF5A 4M1SA 4YROA 1E0JA 1LW7A 3ISVA 3A9JB 4DC0A 3K5HA 3KR2A 3CPHA 5K3FB 5BP7A 5CLFA 1LBEA 3FI0A 1PT8A 1I4QA 1WF3A 1E92A 2VZ8A 2WXFA 2C8LA 4GOOD 4OQFA 4R2XA 4UJ5A 5F5NA 1VYVA 3VPGA 2ZE7A 3H83A 2J9YB 4HQLA 3UW1A 2NYVA 3TSYA 4NAVA 1JQDA 4HLUC 3UTDA 3ICEA 4O2BF 5FI3A 1TFUA 3TLBA 1YK0A 3DL2A 3NJTA 2WIDA 4G50A 4O8ZA 4YGYA 3C70A 4YVFA 3DMFA 5JS2A 3S0JA 5CLIA 5J17A 3LZCA 5IVKA 3SSNA 5COAA 4PCVA 1CZKA 1WWTA 4KKJA 1UDAA 1JDTA 3LYHA 4B9EA 1XEWX 3Q5GA 2C97A 2B5VA 1WRBA 4O63O 3A6GA 1UKCA 5B3AA 1TECE 2J1LA 1G8SA 2YNMC 5GGYA 2WKQA 3CRNA 2H4WA 5JHGB 1JR3E 2E0IA 5CNJA 1EM7A 2UU7A 3F3YA 3RSHA 3LDUA 4LY6A 3UMVA 4PTYA 2PSEA 5KTYA 1SK9A 4PNEA 4RZUA 1CRQA 4GXNA 4RJLA 3MP9A 1DBVO 3A1QA 2ODWA 4Q3DA 3LJ3A 5JEEA 4AB1A 1GGNA 1QV6A 4QRDA 1DUIA 1VI6A 1C1HA 4CCSA 1GPKA 1JB9A 1GC7A 2WPNA 3K9HA 3LT5A 4YP5A 3Q8BA 1O9HA 2UVQA 2SKCA 1MX1A 3OOEA 4P3YA 4PBSA 4BX0A 5ENZA 2PH5A 3RS5A 1AK2A 3WK6A 1CYEA 1Z0DA 1YCFA 4KXXA 1XRQA 3ANMA 4D81A 2Q07A 4UU8A 5CT5A 2K6DB 3U40A 4D42A 4JYPA 1G9TA 3BWMA 1IHXA 2VTBA 3MB5A 4YASA 2PE6B 3OQNA 4LFBB 3UW3A 3S70A 3KSAC 1HQCA 4JQZA 3QVVA 3RVPA 1KEEA 3AKCA 4Q3CA 3WYEA 3QBJA 5CJPA 1MIOA 1ID8A 4PGGA 4Y1EA 1WKCA 3B1FA 2VS1A 1LVUA 1G8JA 3H4IA 2O2JA 4FULA 1G18A 2R61A 3P42A 1ZN8A 1MMFB 2QT0A 1FQKA 3G1TA 4NVRA 5DW0A 2ZT5A 5G4KB 1WXAA 5HX7A 4RTMA 3PTFC 2P4QA 3NHEB 4GL4A 5ALNA 4EB6A 4UU1A 2OHOA 2AMJA 4MB0A 4GMFA 3ZZTA 1I3MA 4HNAB 3NC1C 4TUUA 2JFQA 1GKYA 3ND8A 4Q3EA 3PC8A 5AM0A 3OWHA 4F4DA 5JMTA 3LDGA 2MSDB 3DAFA 3NIBA 3PFKA 2NUPB 4R05A 1B00A 1JEAA 3A05A 3IH5A 4PWYA 5G0TA 4JITA 3KOWA 1SVOA 2FN3A 4LJ4A 3G2QA 4L16A 4UHBA 3RLFA 2C7NB 2NVUA 3U1VA 2AW3A 4F3CA 5C7LO 3ZI0A 2UVPB 4HNUA 2HA4A 2PUVA 1F2UA 3QQPA 1E8NA 1W19A 4YMGA 4CKWB 1JDNA 4RTRA 1G8KA 2KVZA 1DTWA 3OE1A 3JR7A 4WCDA 4ZFNA 1E7YA 3AE4B 3DOJA 4HTFA 1LNSA 2F90A 3C8HA 3GX1A 4G5FA 4WE3A 4HL6A 2OGWA 3C5EA 1MIOB 3DLBA 2OV3A 4Z49A 1ENYA 4XXHA 2UZ1B 5EQJB 3A14A 3ZLUA 2NZ2A 3E84A 1SCAA 3O74A 3W7VA 4HPJB 1I7QB 2Z2KA 1DLIA 4CYEA 2CB0A 2GAIA 1SB3C 1XMJA 4RMNA 3WGLA 1T0JB 2COEA 4KNVA 2XCSB 3PCRB 1O58A 2SCUA 1E3DA 2ZJ8A 2OQRA 1HDEA 4S1NA 1DV1A 5D85A 4YSXB 2AFVA 1D4AA 4R8MA 2NUPA 4NZLB 4YAJA 4M54A 1R5BA 2DY0A 3ESXA 5TB5A 1KDVA 3WC4A 2GN9A 2IPLA 2IA5A 1C3EA 1OA1A 2GBCA 2Q1WA 2ACWA 1SKAA 3MB8A 3VFKA 1P18A 4MVJE 4D80A 3BILA 4BB0A 3OVMA 4PNZA 2ZPTX 3KKEA 1CUJA 5DXAA 1E3MA 1C3XA 1U0EA 2C4TA 4ILEA 4GRIA 4Q48A 5T41A 3W9UA 3TRJA 2DFVA 3LOQA 3TM4A 1PUJA 3DFIA 2W8ZA 3ELBA 4ARBA 1RYDA 1J4AA 4P2BA 1LBSA 1LLQA 2OZVA 2P90A 1R6TA 3IV6A 3QW4B 4S35A 5U1PA 3B7WA 1I7HA 4B87A 5JBIA 3U60B 3ZU4A 2OBMA 4YRIA 5EMHA 3MHPA 4X65B 4Q93A 1GL3A 3N1YC 1QQRA 4HOYA 2WKWA 4ZVTA 2HCFA 1GGVA 4N0DA 5GJWC 4D0RA 1FFCA 5LLSA 2Z30A 1K92A 4RFBA 1GZ7A 1IEVA 1NY6A 1JLSA 2FSSA 4UHFA 5JCOA 3A2NA 1LA2A 1WPQA 1Z4KA 4JGIA 2H18A 3M6WA 2HE7A 1KRHA 1MJNA 1UZLA 2Z4SA 3KBOA 3BXEA 1WXVA 1UDRA 3A0RB 3R7WB 3WTCA 1E6LA 1NW4A 4W5JA 2GYUA 3KT8A 4Z9FA 1FNSA 1Y89A 1IM2A 2N1BA 2XGGA 3W8NA 4POOA 2GD0A 1W59A 2TECE 2WNSA 3LUHA 5AVYA 2YWEA 3L8YA 4Q9AA 5JZVA 5BMVB 3UY4A 2AFHB 1TT5B 2B99A 2V3WA 4QYIA 4ZZ1A 2ZI3A 1V2YA 2CFSA 3CU5A 3UNXA 1NBME 4YUWA 3VJMA 1T5XD 4U9UA 5TS3A 2BBCA 3VUFA 1ZCJA 2KI5A 3W1EA 3SMQA 2C88A 1OLUA 2NPIA 3VYVA 1KIFA 2Q5HA 2QSZA 4U6QA 4KNYA 3CKYA 3NP9A 1V97A 3V8QA 1M74A 3B9JA 4HEJA 4YAEA 4CTMA 2OGZA 2OB2A 3H6KA 1AARA 4V0KA 1O87A 4MPJA 3ZYZA 4NSNA 1V4BA 5DHRA 4TN5A 1C1YB 1ODFA 4IXDA 3EISA 5KDDA 1HA3A 4OJQA 4RD3A 4FCWA 4MCHA 4KQ2A 1V7PC 1C29B 4HJKA 3M1AA 2AMLA 4Q1BA 5C8YB 3QLJA 5AEKB 3IBSA 3OIYA 4OQ4A 1GB1A 1P8JA 2V96A 5BOSB 3EECA 3K1JA 3NUHB 1EGMB 1Z7YA 4KO2S 3UJBA 4DWOA 2L0XA 2GESA 2FW1A 3OTWA 1QHFA 1XZMA 5HFYA 1U94A 2ZXEA 3EGXB 3LX6A 4RMHA 2QLLA 4DBGA 4BO8A 4ZV4A 5JZBA 4KHZA 4RETA 1JEYB 2IP4A 1WYGA 3HKBB 4KGXA 2RGXA 1NVUQ 2HBRA 3SD7A 3EVFA 3ML8A 2ZTVA 4Y2JA 4NJOA 4ISBA 1JT9A 3RUFA 3K0CA 4JL5A 5K8LA 2B8JA 1OZHA 1Q7EA 2B8WA 2WJAA 4AF6A 2C9ZA 2JHFA 1JX6A 1M8GA 3EEFA 3WRXA 4ARZB 3ZW7A 1KOFA 2GARA 3MJ4A 4WESB 2FUNB 3CE9A 3EULA 3D4OA 4W6QA 3DG9A 4HGRA 4BYMA 1OUMA 4JLJA 2WM9B 5AVJA 4RPLA 2P3QA 2VC2B 1GNVA 4ZHQB 1G21B 1J8MF 2AJLI 2JKVA 3MW8A 4CTNA 2RGNC 2PV7A 2NSLA 2V3SA 1FRFS 4WCFC 4QX6A 1Y63A 3SM3A 2UYHA 1AVTA 2H1RA 1SC1A 3KQOA 3O4FA 3UAWA 3H2GA 4TVKA 3TX6A 1PYWD 1WI0A 1SVUA 3H16A 3QXGA 4KX3A 2BSQA 1HDYA 3FRJA 4Q34A 3WKAA 4CMEC 3KTOA 5DX1A 1BGVA 4DJTA 4IEIA 1E6EA 5BWMA 3PEEA 4HNVA 4L8VA 1TLFA 1YHYA 3IDSA 3LX8A 1FSZA 3ZLZA 4MW5A 4Y9RA 4B3TB 1XAGA 2ILVA 2CNKA 2B3TA 3F46A 3F9RA 4X8MA 5D01A 4BZAA 4Y0VA 3A2MA 1E8YA 2ZRGA 3LVRE 1C3VA 3PCXA 3PHJA 4J07A 5T64A 3ZDBA 2ZYRA 3D1JA 1O6FA 4JHLA 2DTXA 3U3XA 2W2KB 1KERA 2H8KA 5D7GA 2GXQA 4M3NA 5IBQA 2W42A 2F1IA 1IJFA 3CRW1 2FPWA 1P9LA 4OZBA 1M94A 4O4HA 3KUZA 2VNIA 5CFMA 4KQIA 2AA3A 5CK5A 4I1PA 2FFAA 2YOFA 1E79D 4NIMA 4F91B 3NU1A 1HKHA 4MACA 1IG0A 4EX7A 4M01A 4CPDA 4AJKA 3WGUA 5CG1A 4G81A 5CYGA 1KJYA 4I1UA 1T3SA 1ZGBA 1PGBA 4F6CA 1U0NA 3DVAA 3AOEA 4Q1EA 4GIVA 1QHEA 1WKVA 4RK6A 3TQTA 1LXDA 2I7XA 3D6UA 4CCYB 4DEXA 3SXPA 2V98A 4DHJB 2YBEA 2JBHA 4Q6BA 4N0PA 4EO7A 4K9SA 1GT91 1TU0A 3N7TA 4WIAA 4YCMA 2AOTA 4EATA 1NLMA 3FTPA 1WVGA 1XELA 1X1QA 3JRNA 1JLKA 1RHRA 3AR7A 4EG6A 3DM5A 2JFZA 3H1PA 3RVLA 1NYLA 3U4CA 4Z4FA 1E10A 4MA4A 3WJ1A 4BNLA 1NYRA 1V5WA 2HQRA 3A9UA 4Y6OA 5K6RA 4XGKA 3QC8B 4D6YA 2A0YA 3GAZA 1T9GR 5LQDA 4A2QA 3BWBA 4YV7A 5IVDA 4IGAA 3AECB 3GP8A 4DILA 4EZKA 4DLYA 4ZOLA 4MGZE 3PKJA 3L8GA 3QX3A 1JSRA 5D86A 2Y5BB 1ZO8A 4XARA 2ZSDA 2WYWA 3MYRA 1H4SA 3X0DA 5F64A 4KQFA 4QRIA 4X62B 3BXZA 3P1MA 1BVRA 3ZDYB 3KQLA 4AK9A 5EA2A 4C7BA 1GNTA 4N3NA 4QARA 1IY0A 2VK1A 3TMAA 4I46A 1W49A 4IIDA 4U9IS 1U0GA 1PK7A 2AOXA 1SCUB 1X15A 1G20E 2HWXA 3GROA 1E6CA 4N0EA 1MA3A 3SJUA 1SUFA 3THYA 1SHTX 3FFTA 4KXQA 1BDMA 5IAEA 4E46A 4R8SA 1P2BA 5TPWB 5IF3A 3AKZA 3FOEC 5H70A 3WNBA 4MDEA 1G8MA 1US8B 2GFHA 3HJAA 2JIBA 4FQ7A 3V6CB 1UKVY 1OEYJ 4IUBS 3ETJA 4NQKE 2FUHB 1K6MA 1FFEA 4YGXB 3Q2IA 1ZSNA 1QM5A 4GBGA 1BXGA 3TLGB 5KOHA 4Y6SA 2P1RA 1Q16A 2VWPA 1VCHA 2BKRB 1W5TA 2X7HA 4KQXA 4RD1A 4ZTBA 4TQUS 5ALYA 3DMHA 4WXRA 1KEVA 1VPWA 5CVEA 4KZCA 5JWRA 1YVEI 1O5IA 3BYZA 5CW1A 3RFVA 3UJCA 4ALKA 2C99A 2BQQA 1ZK1A 2YMLA 1Z3IX 3LECA 2NW6A 5CLHA 4TV9F 4ZPJA 3ZCQA 3KSBC 2CE2X 4WNIA 3DPDA 3GFPA 2H07A 1MN6A 3FWZA 1KMIY 2NV2B 1COWA 3KZNA 1T0BA 1OT5A 2INGX 1A8HA 1YIOA 2DENB 2EZ4A 3ET4A 3GD5A 1THGA 2QMEA 3O65B 2OV8A 1YI0A 3S28A 3KDSE 3U7IA 1NBOA 2R48A 3WI7A 4BMXA 4EG1A 3QJGA 2DKOA 3D3NA 5AVVA 3GLRA 3G2KA 4US1R 3OQIA 2ZIVB 3U7DA 3WNQA 4B3DA 1PN3A 4KCGA 1XC7A 2E4YA 4NBTA 1JFTA 2FPIA 4RGBA 2F1JA 2IOYA 4BATA 4C4SA 2H7VA 5ENVA 3GB9A 1QIFA 1B4DA 1XCPA 1BMLC 1NJGA 2Y0DA 3MMSA 4AMZA 2MYTA 5JYBA 4ZRKA 4CV0A 4ES6A 2VCHA 4KQWA 3TTVA 4MHOA 1Q0UA 2GPYA 3RT3B 1C8BA 4BLUA 3QMVA 1MCZA 2XDWA 3D43A 1JHMA 4U5QA 4X93A 1MENA 2AZTA 2IHUA 1RZRA 1UJ4A 2JJMA 4HWOA 1JEQB 1TYAE 1T2EA 3S44A 1T0IA 3ACDA 3GJXC 4QFBA 1RYEA 4S1VA 3EVGA 3U13A 4YRDA 4AZSA 2OLKA 2ZZMA 1BROA 1R4MA 1BH6A 4YJ2A 1M7BA 2G67A 4NZ9A 3GDOA 4OREX 3GLGA 3V8EA 1VYTA 3NWOA 1VZ8A 2BYEA 5EL0A 5DI9A 2CN1A 5BV0A 1L6UA 3BA6A 2JA1A 3RQSA 3S68A 2NMVA 2VJDA 2ZUSA 2JAHA 4EKNB 5A9RA 2O4CA 1IULA 3SEFA 3PFCA 4KVAA 2QL7A 1R10A 4N01A 1YH3A 2JZNA 1IXZA 1PJ3A 1KQNA 3A6ZA 5KTTA 3DZ8A 2H51A 1E9VA 2HW8A 4FLMA 2WU2B 4LK0M 3QWHA 4ZVOA 5HR5A 3ANNA 3SDZA 1SKQA 1Q91A 1AKQA 3AR2A 1FX0B 4NOMA 2PLRA 5TQJA 5M29A 1MJDA 1E7RA 3IODA 2EFYA 1PUXA 2WP8J 1TY0A 1XHEA 3KBBA 1ONNA 3B1ZA 4EHKA 3AJEA 3G0GA 3KV1A 4URWR 4KX5A 5FLYA 4AJOA 4DSNA 5BY2A 2X13A 1W7AA 2AXNA 3UT5A 3KU4A 3GIDA 1R4NB 1OXXK 1Z17A 3EOAI 5I6DA 1YMQA 1QRAA 3V3KA 1LLCA 1ZH0A 5AYVA 1BXRA 4B17A 5ES4B 1QK4A 1GFIA 4LY0A 2AXPA 2XUOA 3A7DA 4DSZA 4QGHA 4XR9A 4AMUA 1JG6A 1U81A 3X0WA 1C9NA 2WXPA 2FWBA 3T9DA 5JQGA 4GW3A 2XZOA 1FVHA 1KFCB 3SBOA 1EINA 2J52A 3KAPA 1TW3A 4RD4A 4WKCA 5LP6C 5JLJA 1A8IA 1RXYA 2O05A 3KUDB 1ONOA 1E2IA 2SKDA 1YJ1A 2PJHA 1SNYA 2KN4A 1CJMA 4MP3A 5FEUA 1UAGA 1CJEA 3ZX4A 4F8CB 1P0RA 3FCYA 4FGUA 4GQAA 3WLKX 2ISSD 5CNMA 5E3HA 3Q3EA 3OTGA 1XU4A 2HIMA 2H2GA 1XEAA 1BKYA 1O6ZA 3E70C 3O26A 3WLQA 4BP3A 3ROEA 3OCZA 3KQSA 3P2OA 2YWRA 2C3YA 4K0RA 5AKGA 4YYEA 4MVJG 4HGOA 1AG9A 3Q8CA 1W76A 3EEIA 4B45A 1JQKA 5IASA 1GNSA 4EVIA 2ZUBA 3HWSA 4EL5A 4GM4A 2RSUA 1JQJC 3KSRA 3QPDA 3FVVA 4XUGB 3AE9B 1Z2PX 3TRDA 2GBGA 1DQSA 1RZ3A 1YAHA 2YXLA 1RC8A 3N76A 1JFVA 1RRMA 2SCUB 1IBCA 3EGOA 3OZ7A 3UWKA 4TXHA 3W3ZB 4C1BA 3ZU5A 4CKBB 2D62A 2QYOA 1NOIA 2NTSA 2WM3A 4QOHA 5ALJA 3GEMA 5A05A 4C5BA 4EG5A 1RXWA 4YRRA 2VDOB 1UAAA 2WXNA 4OG2A 3T3MB 2B7CA 3WOHA 4C7VA 5L45A 3GZNB 5IAAA 1AKRA 3R8CA 2PIDA 1YE8A 5AJWA 3PZ8A 3D6AA 1IM5A 1J2EA 4YUZA 2H1IA 4P0PB 3DVQX 1QH1B 4C4OA 2EEZA 1JFLA 3DDOA 1GPNA 1LZLA 3IR5A 3OHMA 4RGYA 3SX0A 4N0QA 1UBTS 1EXMA 4EUHA 1CW2B 1V4VA 1EXDA 2LFIA 3OUUA 5IHPA 1RQ2A 4B3MB 3C6QA 5KSWB 3SIXA 2ZUWA 1ZAKA 4KAAA 1G7TA 3TW0A 4C9BA 3HNPA 3NZUA 4KRFA 2LKDA 2P9ZA 2I0FA 4NRDA 2OHIA 5CEJA 1B8PA 1O5OA 3QVMA 2G1KA 3D8BA 4M4SA 1CDEA 1A69A 3T7SA 1UJMA 1O96B 1G5QA 3VRBB 1JFRA 4N0MA 4PPNA 4WGFA 2DX7A 4OMCA 3MMXA 3OFNA 1SXGA 1W5FA 1XZHA 3OZWA 5TJ9A 1C9JA 4EEKA 1ODSA 4KR6A 4PTZA 4IXMA 3MM4A 1NMQA 3HHMA 2BSAA 2QJRA 3BIID 1EQ2A 2XUIA 4J43A 1CUAA 1VCIA 2NT4A 5KYWB 2JF0A 2ZPAA 3TUJC 1EIWA 2DWPA 1JNXX 1M2VB 2X0IA 2ABWA 2H5IA 4GLOA 1C5KA 1M34E 4JJFA 1LC3A 4QOIA 4AJEA 2CD9A 1PYDA 1NXSA 2UDPA 1B93A 3ITDA 4AJWA 4MUJA 3PQFA 4B4OA 3EIUA 2OJRA 2RGFA 2QAIA 4K8OA 3VU9A 3V2GA 1IFXA 3QVWA 5CLGA 1V3UA 4XWOA 4P8RA 5C5DA 3TXXA 3WDLA 2E5LB 1I6LA 4EFOA 1ZU5A 1Z6GA 2XWSA 4N8EA 1WBJB 3LHDA 4RA6B 4C00A 3C8DA 2ZRKA 5DT2A 1DL5A 3ZO5B 1SU6A 3A3NA 4RO0A 2ICIA 3GJ7A 1UZXB 2PR7A 2TMDA 1NVVQ 2E55A 2DH6A 3EQ8A 3RH0A 3D8UA 3I6IA 1CT9A 1PDWA 1L5LA 3O82A 3DOIA 4CE6A 3TNDA 4K9DA 1E9SA 1L4ZB 1YZFA 3RK4A 5BNIA 2DZIA 4LDTB 3ROZA 2R0QC 2OORA 4MO9A 4U2EA 1PQPA 3PRZA 1ST2A 4JJGA 4D41A 1HZJA 2GKGA 4DJ5X 3KKOA 2A1TS 5FTLA 4JU9A 3VSEA 5FV7A 4D56A 5FWXB 1TAGA 1QMPA 5HCNA 1MZVA 4QVIA 2P62A 1IDOA 1S3GA 1LX6A 3WDMA 3WP1B 3EXIB 1TAQA 3CZQA 3NTQA 4B7CA 3IERA 3ESCA 2FEPA 3GI1A 4HH0A 1AGRA 2L1AA 3LWBA 4GE0A 4JUDX 5GOZA 5H80A 1GARA 4RDCA 1WY5A 2D0PB 3QK7A 4OM8A 4X7RA 1OXTA 3L41A 1E90A 3I5YA 4MYUA 3LP6A 5F7OA 2KLHA 1N1GA 4LWZA 4I1YA 3PTLA 3NHUA 3KVNA 3SS9X 1ISGA 2BBOA 3O4IA 2JFVA 1N6RA 1P9NA 1G6Q1 3EGEA 3ACCA 4HKTA 1WSWA 4J9VA 2EKPA 3PQDA 4MKGA 3H65A 4PAGA 4NMHA 3GN1A 1PI3A 3I57A 1DJPA 4OI0A 4MCIA 4Q7MB 1FLVA 1B7GO 3ED5A 3GAAA 3PLNA 3IUJA 2P6NA 1AGNA 3W6PA 4BAZA 3R4VA 3DBLI 3NZEA 1AZWA 1UBNA 3HBLA 1OIXA 2WWTA 2Z6AA 1J33A 3A1NA 1RKQA 2W7TA 1NNEA 4ROSA 3WB9A 2VDVE 3WAPA 4E22A 1DFGA 3H86A 4N3GA 2DERA 4XYBA 4OHVA 2PVCA 3CHYA 4BP1A 2OCIA 2KB0A 1D2AA 2HBZA 1RRPA 2ZBVA 2VPIA 5BSTA 1NXWA 1O95C 3N7AA 1YL6A 2Z98A 4NE7A 5HBRA 3SYNA 4BTVA 1R8XA 4EOYA 3TD2A 4V0OA 5DTMA 3IQHX 2ECFA 1IPHA 4JU8A 1LSSA 4E2ZA 1LK5A 1QOFA 4ZCPA 4XLTA 2A5FA 2ZVJA 5ELXA 3B5EA 1UWLA 4QPJC 4M0WB 1MJGM 3WLMA 3NS1A 4LMRA 3RU3A 4KQ9A 3OLCX 4TMXA 3V6EB 5BWCA 3DEFA 1P1CA 4BTLA 1J2JA 1PNOA 1O1YA 1R0LA 2ZVOA 1PL0A 2XD9A 3ROKA 3ZPXA 4R9RA 2EG5A 3HP1A 5JH7A 2F1RA 2VTDA 1KDPA 3F2VA 1PL8A 2ZYUX 3JARA 5B3KA 3DC7A 3ZY4A 5K0EA 4KXFB 2X4GA 1BYUA 1VKRA 4H1UA 4OAOA 3W04A 4C88A 3AVUA 1XXHE 1L4LA 2JZPA 3ZDTA 1QVWA 4IICA 3TEJA 3FNFA 3MD9A 1SWVA 1X1EA 5FPKA 5JCJA 3B52X 4JDUA 2P5SA 3C6YA 4ZI3A 5LD2C 1XPRA 2LWIA 2AUMA 4JBXA 3N8GA 3RAEC 3T1QA 4XDGA 5K4AA 3FPBA 2I6FA 2FSFA 3A1VA 1EJ2A 5DM60 1TCCA 5EG5A 4BNKA 4JLMA 3QF7A 2GLXA 4RD2A 1WLSA 3DAYA 3NRCA 3K9WA 4I5IA 5AHRA 1NYTA 1NU8A 4JODA 1JRLA 1KI3A 5KTPA 3IFWB 5KJEA 1OHHD 5CT9A 3CX7A 5F35A 3QKSB 2G06A 3R0VA 5AVQA 1PJBA 1XLVA 4AS1A 3MXTA 4RTPA 4C7OA 3IURA 4LXQA 4QKQA 4N5MA 5GADl 5IKOA 2GPNA 3TWOA 4LHVA 5FOSA 2FSVC 5CH8A 1BU8A 4MKRA 4TGLA 1R0ZA 5FL7A 3WL6A 3MRVA 4ZHOA 1XZDA 4YAKA 1BHSA 4NAMA 5M5BA 1U3TA 1DOAA 3RKUA 1EMDA 3BD7A 7MDHA 4EJ2A 4M9SA 4KFUA 3OIGA 2GI9A 5AICA 4G56A 4FFWA 3U44A 1H3NA 4J0HA 4P0QB 3EC7A 4DB2A 3R9XB 3P2JA 1RHUA 4J4BA 1ESNA 3A6KA 3F6RA 5CIYA 4HK2A 2EYQA 2NO1A 1NJ8A 3ESDA 2F59A 2IYNA 4YMWA 1UBIA 1LBHA 2A4MA 2ZYHA 3TJRA 4AXBA 5HKBA 2QUAA 1ULBA 1F8GA 4LGMA 5FF9A 1NVFA 3TLYA 4KFCA 3HV0A 1J39A 4UNSA 1N8NA 2OC9A 4FFRA 1Q0RA 3N9YC 1BJRE 4MWZA 2XV1A 4M8SA 4A92A 1DFHA 1L7QA 4WY5A 3FWNA 1KY2A 4RD6A 4DWWA 2NV0A 3U4IA 3U19A 5L3SB 1DO2A 2TYSB 5BN4B 4MWGA 1I1NA 2G1JA 1ZMRA 1TEZA 1GDTA 1CQIA 2P40A 3B3QA 3BHNA 3LSTA 4E6EA 1KA9H 1OASA 1PVOA 1NJ6A 4FBMA 4GM0A 2VZEA 2OAP1 4GVLA 4XWGA 3U44B 3C8ZA 3E35A 2FQQA 3HYLA 4IGKA 3Q6NA 1GLVA 2A33A 1MPEA 1A9YA 3H7AA 4LBVA 2JLVA 1QOPB 5C80A 3PT9A 3OFSA 2C84A 4RZ2A 5L7YA 3RSFA 4BFVA 2F8LA 1NBMA 1RRBA 5LZ4A 4RY9A 1A98A 1AUPA 2I6QA 4NATA 4JP3A 4XLZA 2C78A 2ZS7A 2CMDA 4URFA 4UPDA 4CV1A 1XKTA 2H85A 4XASA 3UTCA 4O3MA 4KB5A 2IGHA 1VKNA 2VFAA 1YZQA 4L08A 1ADYA 1PS8A 3JPYA 1DEHA 3COPA 1A8QA 5AW2A 2BHNA 5JC1A 3X2EA 4NEQA 2GASA 2BS2B 2G3YA 2BELA 2RBEA 3U4HA 3F7MA 2DJ5A 3KKNA 1J56A 4A4DA 2O57A 2QMZA 4RGVA 2VH5R 1H2BA 1M6WA 2EFDB 3BMNA 3AP3A 1ORWA 3OEHA 2RJOA 3HDYA 3PIRA 4D9IA 5LQCA 3N2KA 1W85B 5F7ZA 3CBQA 2O0MA 2KMCA 3KJZA 4NNJA 1FRVA 1CY8A 1UZAA 3M4JA 5KWSA 4WN9A 5AHOA 4P1ZA 1WDLA 1KPGA 4KMMA 5IMSA 4I4CA 2BEVA 3U39A 1K0UA 2HDNB 5FD8A 1XP8A 3L82B 4FN2A 1IJBA 2B0CA 2Y93A 2RK6A 2ZRNA 3IL2A 1H8HA 3EASA 4WINA 3WB0A 5AM4A 5B7NA 1E5WA 5CDHA 1G6OA 1L4MA 1NDDA 1TO6A 1UPCA 2FQ1A 2GFIA 2XUQA 3CG0A 3OQHA 4JP2A 3WCQA 2OTCA 4KXUA 3WGGA 4DY6A 5JS6A 1FMTA 2N9EB 3QVGA 1CUGA 3PGXA 1M0WA 2DQKA 2ZLBA 3HN6A 2HA5A 1BJTA 4DV3B 2PYDA 3RSZA 1KEPA 2ZWPA 5GPBA 2DHCA 4R2JA 4ETMA 3RRJA 5DM2A 2RH9B 3CTPA 3HUFA 3JS5A 2RHCA 3WYBA 1P1BA 1CJSA 3WFIA 2OCDA 3ZOZA 1NQVA 2EF1A 4MINA 1RHKA 3KYCD 4AWBA 4AQDA 4G1MB 4MUNA 1TBEA 5MN4A 1O7JA 2XMBA 1GLGA 4WOJA 3WY9A 3IRUA 2IYVA 2QRGA 1RAHA 2XY4A 2CW5A 3EXIA 4MGIE 4YRKA 4L5JA 5KJFA 2N9PC 3EXFB 3QKRA 4YTMB 1PQYA 1G8PA 2OAEA 4CBVA 2VXCA 1E1CB 1Z2NX 4MAMA 4D8XA 1WCIA 5KX5B 2R87A 4RNAA 4DRZA 3I64A 1UOEA 3IVGA 4O4LF 4B3CA 1C9FA 2FZ4A 5FKAC 3BVGA 1JQEA 2BBTA 4QXOA 4HAXA 3VX3A 4ZEMA 1O2DA 2ADOA 5C46F 5FI0B 4NH4A 3DZKA 1EFPB 3BL6A 4R1SA 1SBZA 2FLVA 5DU2A 1QFXA 3RAJA 1UJ5A 1YR1A 2PWAA 2RI0A 2Z2JA 7REQA 2XRMA 2BRUC 2WGSA 5L7WA 3KHTA 1KSJA 3AESA 3G7UA 3ZE9A 1Q15A 2CJXA 2VYND 1L4DB 5IC6A 1CF4A 1E66A 1T4DA 2IH4A 2BFCB 1AKTA 4J8PA 5KHLB 2C77A 2ZSBA 5H7XA 1IXKA 2PSDA 2R96A 4Q7JB 2C2KA 4N82A 4OQQA 2A86A 4O2AB 3W06A 2NPOA 2R68A 1BKDR 4MVJD 1A5RA 1DT3A 2PAFA 1T6BX 2PTLA 2EX4A 3EXAA 3F5SA 3HSSA 2LCFA 4IKPA 1V5OA 5DNWA 4YMLA 2PH7A 2I55A 3LX4A 4H27A 3GG2A 3MJHA 3W8DA 4ZTUB 4XC2A 1GTVA 1Z18A 3P9PA 2FPGA 1T10A 4L4YA 1L8OA 1PFWA 2PEZA 2LVQA 3O38A 3W1VA 4KWHA 3IVRA 4RM8A 2DNFA 3QFRA 2XQFA 3LDHA 1OFUX 4TRJA 1ENFA 2AI3A 3NVMB 5EZYA 2FPLA 1W1UA 5HW0A 4N65A 2SECE 2AEFA 2FBWB 2L0FA 4XIJA 3NMUF 2BKXA 4NENB 2IZZA 3JQRA 2RDMA 1TZCA 4DG5A 3P1JA 1CWUA 3BSWA 2BI7A 3E15A 4C4TA 1Y6QA 3WQQA 4BWVA 2Z8YA 5LYJF 1YB6A 2QG4A 1NAIA 4C80A 1MEJA 3VPAA 3D0OA 3MMPA 1BEEA 2C9DA 3ZQUA 5UKDA 4TVSA 5LXHA 5BWNA 4HDMA 1EF1A 2Y68A 4RGMA 1M1YE 1RHQA 1YRYE 2AF3C 2CXRA 2ZROA 4NARA 5IT9A 1XPOA 4JOCA 1C1XA 2YIDA 4Q1CA 4ZA2A 1L5NA 1DKUA 4DA0A 2BPSA 1DRKA 1E3LA 4YJGA 1Y4DE 3RU9A 1IHYA 3W4KA 5FA5A 1A50B 4CR6A 2CXXA 1M8PA 2L19A 2W2PA 1FSSA 5FDFA 3NCHA 2PKRA 2FG7C 4KX6B 2EKQA 3VUXA 4ZI7A 2JCBA 4XM2A 5B4TA 3U37A 1XZEA 5EHQA 1VL2A 1W29A 1WZNA 3MWGA 5K51A 3GPBA 5EZYF 3LRXA 3RIEA 3CR8A 4EZEA 2AN1A 2WICA 1NI3A 3HNOA 4W5NA 3KYJB 1CJUC 2H7CA 1XRRA 4HB2A 1SOWA 1U4OA 5CCDA 4DRYA 4DQLA 4X45A 1JWAD 1Z6XA 2A7XA 4YCAA 5GVRA 2HQOA 2GZ3A 4F9FA 1SU4A 2NO4A 4MW0A 1B42A 1KKUA 3WR5A 4WLVA 5B7GA 4MMXB 1R6VA 4EMUA 4JWUC 1EJBA 2VJCA 4GLLA 2PX8A 4XIFA 2MYNA 1U2SA 3O0DA 2QJFA 4PXSA 5E1BA 5JTUA 1FS6A 4RAOA 3W2DA 2QWXA 1GL7A 1W8DA 1FXWA 1K6EA 4BAXA 2E82A 4E5SA 1D2MA 3WMFA 5FFFA 4H1HA 4X95A 1YZLA 2XDYA 1N6HA 5DCUA 4B31A 3OA0A 4DV5B 4ARCA 1Z39A 4EO4A 4KFTA 4EY6A 1BEUB 3M5PA 4CR8A 3SFVA 1EWRA 4U00A 4OLJA 1KVTA 5G5GA 4CLXA 5BMOA 1R50A 4OHBA 1TIBA 4TKUA 4WZAA 4YH1A 3NHRA 2Z6QA 3N87A 4KKVA 2A14A 4CIVA 4FZ3A 1MQ9A 2UXBB 4G09A 2R47A 1GAJA 1ZG3A 3H0EA 3KLMX 2I62A 4DR4B 3R7LA 1PJLA 3L1UA 4MRAA 3ENEA 4DNXA 4GR9A 4GXQA 3AR9A 1KC3A 2KYWA 2RDGA 1FUKA 1XXHB 2GN1A 2OGTA 4E08A 1G8GA 2ZB8A 4V1CB 3L08A 2N0SA 2CJWB 2IQ5A 2VNKA 3O31A 4JBIA 4BIIA 1X1AA 1TUIA 4QYSA 2GZMA 3B12A 1PZXA 4C20A 4F56A 1FFYA 3GT7A 5MDHA 2FKAA 1F5SA 3M5WA 4LG1A 1KMHA 2CF5A 4HDSA 4HJGE 4MVWA 4NZYA 4D8UA 3TIXB 5DN6A 3ZYYX 1QRDA 1VI5A 1N1DA 4BMSA 4JX9A 4C0KA 5WRFA 4QM7A 5A5VA 2O8FA 2YJ5A 3I9MA 1SVSA 2VNJA 2VRNA 2Z9BA 4BNXA 2X7JA 1MAWA 1LJLA 4JB8A 3UT5B 4KHPB 2YVLA 2YX1A 3KS9A 3PI7A 2D10A 3HFJA 2X6TA 1EFHA 2FP4B 2PK3A 1WMSA 3NPAA 4DLNA 3T5AA 3IHWA 4A73A 2B92A 3CX8A 1V35A 3G68A 3GXBA 1VKJA 3IFSA 1C0KA 1E99A 1YR8A 3WGKA 4HSEA 2ACKA 2V55B 1WSBA 1Q57A 3PLAE 1ZUNA 1L5MA 1OR8A 1QH0A 1DARA 2R5FA 5ALPA 4RC9A 4UUNA 4M21A 5KPJA 1SU8A 2WPDA 3KUCA 4UM5A 3OAAD 4YCLA 3MHSD 1XCLA 4MQEA 1T6YA 1BQ3A 1RBMA 4BKSD 4BNVA 4OXNA 5HZHA 1C4XA 3SR4A 4C22A 1QGYA 5CFRA 1GTL1 5FJJA 4TRMA 5H4HA 3BRWA 4MQFB 2P4HX 1CMXB 5FAKA 2V03A 1I4XA 4N5DA 1E9RA 3AWDA 3FUUA 1JDPA 1K8YB 1W88A 4HDSB 1JXAA 4ZAYA 3V1TC 4PS1A 2D2FA 2W6PA 4PAMA 2YDYA 5LUBA 3IOYA 4QBTA 1KIAA 4K6FA 3HVDA 3MEQA 4HWTA 2V7XA 4NJCA 1DDIA 5BV7A 3N6RA 1LQUA 1YCHA 3WIMA 2CS4A 1U2TA 1ZIXA 3ABQB 5ECYA 3CCCA 4DMUB 3HCEA 3MWJA 2X1VA 4LXYA 4NDAA 3ZKJC 1U3CA 4HWPA 4Q4AA 5HF6A 4EB8A 2AC7A 5HRCA 4WEQA 2J8ZA 1OY1A 2BKLA 4OGFA 3N5CA 1CEEA 4QFDA 3H1FA 3KOXA 4RGNA 3AQIA 4TLLB 3ILHA 3SDLC 2JL1A 5KTSA 1G21E 3QNWA 2VDLB 1BXTA 2YWFA 4J03A 1CE8A 4ZIRA 2WNHA 3WYFA 4DDID 2IHNA 3ZS9A 2O7QA 1ZMOA 3AZPA 4C7KA 4D8WA 1TM1E 1WHSB 1XO1A 1QANA 1Z5GA 2QYHA 1NXOA 5J2RA 2WAYA 2GDZA 3E7WA 4JLDA 4UAVA 4EHAA 4OATA 1G4AE 3PF9A 4IC7B 4PIVA 4CMEA 2L76A 3MC1A 5P8WA 1X1BA 3T4XA 3WNDA 1XYYA 5K6TA 3LQ4A 4JQOA 1YMHE 1UFOA 2P9EA 3BXPA 1TFRA 1MB9A 2CMHA 2G40A 4GRAA 4WGGA 3QP9A 1Y7TA 1QVAA 1AE1A 1VBFA 2YDXA 3HCFA 3MGGA 2B7LA 1AO3A 2FLWA 2HHLA 3VZCA 2BFPA 3C7TA 2AT1A 4EW2A 5C53B 3SKXA 1UM8A 3PEFA 2JPHA 4FFBA 4MUXA 1UD7A 3OIWA 1MLDA 2HTFA 1TMGE 2PS0A 2R25B 4IEFB 4WN3A 2YLMA 3A8TA 4ZRDA 4FJ0A 4AWAA 4C0SA 2ANBA 1OQAA 3ZY5A 1ZEJA 3NWPA 3FY4A 3SIRA 2JIRA 2QVZX 1JIVA 1WXXA 1KJIA 4RX1A 4ZT5A 4KWCA 3A33B 4EYQA 1CETA 3EGDB 5BR4A 2QX4A 4BB5A 4V39A 5JNVA 4HAYA 1XUOA 4GX1A 4P3KA 2EBFX 2O3JA 3L8EA 1LCIA 1EUQA 3U2QA 1BWQA 1GGEA 1RM3A 5EVJA 1GG8A 2I7TA 3PI6A 4CM9D 1QB7A 3DZGA 1R0SA 3Q88A 4R7TA 3TAHA 3FTDA 2ONYA 2LASA 2DETA 4HWRA 1NFRA 4AD8A 4B6PA 3E5NA 5E95A 4X66B 2H92A 4IKEA 4CHGA 3OT1B 1R37A 4G5GA 3RYIB 4HQFA 4ITKA 3L84A 4V3BA 2ZCJA 1EU1A 1EX7A 1H05A 4KV9A 4QSMA 4UM9B 1ADJA 2LD9A 4DGQA 3U7GA 1C9KA 2XVZA 4L1KA 5G1NA 3PDHA 2BHTA 2RR9A 3MUNA 1PVVA 4KIJA 4WKPA 1EAMA 5LOVA 4RIHA 3G5MA 4HCNB 4A9AA 1FP4A 1GQFA 3B20A 3DZDA 1AUOA 3A6DA 1SVNA 2J42A 1XNJA 3OLXA 4DHZE 5EJAA 1KAQA 1ACLA 1NRWA 2GMIC 2WTMA 1D8AA 1GUZA 2H7XA 4HWKA 4I9HA 2G80A 4N5NA 4WOBA 4FHEA 5DX8A 4EFLA 3Q3MC 1NQ5A 2B4YA 3ZXYA 3MWLA 1SB8A 3K0KA 5JATA 1YI8A 2JW5A 1O9BA 3GJZA 3IUEA 1QB8A 3O7MA 4CVNA 2GOWA 1SQGA 3L0CA 1F06A 1GG9A 2LIVA 3GMDA 2IUFA 4IIUA 2DU8A 5J1TB 2EKIA 5IUNC 5HGXA 3MCUA 3QG1A 1XNGA 2ZUCA 4KW7A 4PPQA 4RHYA 4TSFD 1B0AA 5EZYB 3WO1A 3A3OA 5IDQA 4OKIA 3WISA 4E14A 4TVOA 3RMKC 1XRJA 2KQ4X 1XTPA 2O3RA 4G5SA 1WGKA 1Y8RB 3WMEA 5HHTA 3HB0A 4KIWA 3AEDB 3WKBA 3FF1A 5GXGB 2BM1A 3HJHA 3I6YA 4ISCA 3SN6A 4FS3A 4N3CA 3QFHA 5EE5B 4WY2A 3FSJX 1FEHA 1VL1A 3SZLA 1EX6A 1K7EB 1C0PA 4WWOA 3FKYA 1HFKA 1H4QA 2IBIB 4B2PA 4FNMA 1GC6A 1K9VF 1N2CA 1DXYA 2BW0A 1NLFA 2C0CA 2BVCA 1JKJB 2YWHA 1KDYA 3OZUA 2WR8A 3AY0A 3G2NA 4I5EA 1QFSA 4JI5B 3U81A 1BT0A 1YC5A 1EB9A 4FMDF 5BYQA 4YJGB 1TYCA 4O4IA 1TUEA 4JDPA 3GRKA 4PPYA 5FUXA 1RHMA 2WUVA 4E13A 1ULHA 4FEAA 1SC6A 4KGVA 3ZHRA 2H1LA 2Q3EA 1NNLA 4BZWA 2UXDB 4QM6A 1P29A 2WF9A 5EHIA 2P6PA 1FDWA 4TLBA 3U7JA 4YHHB 2VO1A 1ARZA 2GUGA 4BNJA 4C08A 1L7XA 5JQGB 4RUKA 4CUZA 3EZNA 5CVTA 3WAGA 1YIWA 1IOZA 2BL4A 4QL3A 2NMQA 4GI5A 3EXG1 1QYDA 2BHRA 4UUPA 4Q00A 4EHJA 2PYZA 4HXFB 2P9TA 4DARA 4GS5A 5L95A 5LZ5A 1T8YA 4W1QA 2D1FA 3ZE8A 2GZDA 3R9KA 1QOBA 4QNNA 1JG4A 1OB2A 1GCIA 2CVQA 5HQTA 2ZETA 2XSZD 3GGSA 3HV2A 1A9SA 2DFKB 3R5FA 4LJ7A 4DSTA 1OH7A 1XPUA 2WJPA 4FWBA 5E9JA 1XI2A 3UXYA 1WXFA 1OZAA 1WZUA 2R2AA 1AUXA 1F6BA 1N1MA 4O4JF 4TRRA 2OOSA 1T34A 1MW9X 3N53A 5MN5A 1ODCA 3CNBA 4QUBA 4ZALA 16PKA 2FY8A 2G4VA 1PS9A 2O8DB 2H52A 4PYKA 2OEDA 3OZDA 2BFCA 1RLTA 2ZUUA 2KJ6A 1DJLA 1B6TA 3E9RA 4M0FA 2FEMA 2GD1O 2GN8A 2JCXA 4AP4C 3KLBA 1SVMA 4OFWA 2J9RA 3A1QB 4R69A 1GJRA 5AKHA 4DL9A 3M6IA 5KX5F 2RGUA 2JJ1D 2Y9MB 3VPDA 3L6UA 4F7WA 2Y4OA 2QJLA 4XZ4A 2B25A 2MBQA 3G2JA 1JAYA 1X1TA 1N2CE 3ER9A 4M83A 4QEZA 2Q0XA 5AXDA 4YJFA 4YCCA 3F6SA 5CNKA 5TX7A 2MP2B 1M3SA 2H9YA 2QKYA 4OHRA 4DF3A 3R0ZA 1HRDA 4NZZA 1QQBA 4BO0A 1QHGA 3MS2A 2QDXA 4HYTA 2PEAA 5EIWA 5LJIA 3WLOA 2GK4A 3GD7A 5A4MS 2C9OA 3FCEA 1TJYA 4HTFB 4ITUA 4LRSB 4IBOA 5L6LB 3MIZA 1G0OA 5FUWA 3GA0A 4HNRA 4II7A 1IAVA 1W9MA 1XWIA 3SDBA 2QVLA 1V6EA 1O97C 3PSAA 3KAJA 3UYLA 5IC4A 5G3ZA 3ZGNA 1QBGA 4JVSB 2ERXA 1LDBA 3D5EA 4C4AA 1RC0A 4WBNF 2GILA 3CF6R 2IF2A 2AWTA 1GPXA 1RABA 3IQEA 3CG4A 1Z2MA 4HNAA 2WIKA 4S12A 4AN4A 1YZVA 2G9ZA 4CL2A 4HUJA 3NRJA 3EQ7A 3OLQA 2EX0A 2VHUA 2XDQA 3FN4A 5HI1A 1A8UA 1J21A 5EIBC 4WV3A 5L6MB 3PXBA 1WUHS 1PV1A 3F47A 3ISJA 4M9RA 4WNAB 2GB1A 2OK7A 1V39A 1UJ2A 3GWZA 3P8ZA 3NT5A 7AT1A 3ZKAA 2ZIWB 4IF6A 3BERA 2O54A 3CBGA 5ALRA 4WL0A 2D7DA 3UHAA 4RKYA 2ZTHA 3IOEA 4Z3KA 3W6ZA 2IVZA 2OV1A 4QGSA 1IXYA 3BTUA 1EFDN 4MPTA 4CU2A 2IJGX 5J4VA 2AZXA 4JYAB 1EZZA 1D5CA 2DWUA 4Q05A 1N8KA 2I22A 1ACCA 1SVIA 2PD3A 5DKFA 3LZ6A 3VDQA 1UT8A 5C32A 2GCGA 3OG5A 4QGAA 3KQHA 1YKSA 2N7DA 4UBJA 3FRHA 4JJIA 1OI4A 2HF7A 4DVJA 5BQXA 1CUCA 2ODAA 4LQ4A 4E5YA 1GRRA 4RHCA 3H8WA 4OP3A 2OE2A 3DWFA 4P22A 3GVIA 3HVKA 5JMWA 3EZGA 3VR0A 4XPIB 1E8XA 1ZONA 4X1YA 2RIPA 3UJNA 4KE7A 3LPMA 5JD3A 3BY4B 4K3CA 4F3NA 5KNDD 3PJEA 4GDFA 3CNOA 4MQ4A 1G2IA 1G9XA 1SZPA 1AN8A 2NT3A 3GLHB 3JU3A 3QPUA 1HLPA 5D3ZA 3OMXA 4ZWNA 2O2XA 5CT4A 2OM6A 1JJVA 2J0EA 1YS9A 2XCRB 2E85A 1M33A 1C9YA 3MRSA 1L5GB 1L4EA 2GJSA 3WL7A 1A7JA 5TT1A 1RLMA 2ID9A 3FH0A 4GBJA 2WD8A 3PHGA 4D96A 4M6WB 4Q4HB 1K86A 1RRKA 3TTUA 3TEZA 1T2VA 3E3MA 3VR3D 2JLQA 3GY0A 3HE3A 3IAM6 4EVSA 1KTKA 5EP1A 2HEIA 1I30A 2OZPA 4PR3A 4ZQFA 1U7TA 2Z3WA 1YU9A 4KKXB 5ADHA 5DASA 5JH7B 3ZHQA 1LLFA 2BGRA 1JWUD 3PZ7A 2WE7A 4QEKA 3RW9A 3R5HA 5LIRA 5JCPA 4TYYA 1TKCA 3F6YA 3GBVA 4BO2A 1WUYA 2DHQA 2W0MA 3C4JA 1NR5A 3HDHA 2JVKA 2FI1A 4P5DA 3SKYA 3NNNA 4FLHA 5HKHA 3DGFC 4AWXA 5K4HA 1QHSA 4LF7B 3JWHA 1R0KA 1XBTA 2BIFA 3HZOA 2HNAA 4RA9A 3ANTA 1Y8ZA 1CRWG 3TJZA 3R09A 2QN8A 3IUSA 1CIPA 4I1SA 3BRCA 5TS2A 5BMHA 1EP1B 4JUCA 13PKA 1SGWA 5EGSA 4BE7B 3KC2A 3Q14C 1UBSB 3JQGB 2C7MB 4ROTA 3K0SA 3AYXB 2H06A 1NQOA 3QSGA 1JP7A 3OZVA 5L83A 2L32A 3L4BC 3ZRCA 3EDOA 3I1IA 2N9KA 3BWUD 5G4KA 1GQ2A 3L04A 2WXIA 1WXWA 4X00A 2QM8A 3KTAA 3Q3GE 3EARA 1BRMA 2CLKB 2GKSA 4P92A 3SHTA 3OJFA 5DSTA 3GCZA 4X6XA 1WNTA 3P9SA 3EG5A 4JXZA 1GVHA 3I30X 3B2QA 2XUHA 4AC9A 2AXEA 2G5PA 1PJTA 2ILTA 1B8UA 4H0CA 3LQYA 4POAA 2DOKA 3AVYA 2D1TA 1QZXA 3K9LA 3JQAA 2IIVA 2ZSUA 2DHDA 1O8CA 1PFGA 4YRGA 3IEKA 3CVVA 3OCVA 1QUEA 2JF5A 3IHLA 1Y56A 2C5HA 2R8PA 2SKEA 1NVGA 2UVPA 2II6A 3HBMA 4LC0A 1E9AA 3RS7A 2BJWA 2XBUA 5B6PA 5JDCA 3AB7A 3LUPA 2KC2A 3AR6A 4FW8A 3CO5A 4MQLA 2OECA 4LFCB 3D6FA 4M7OA 2IPAB 3RYHB 2WHEA 2CFOA 2F1HA 4TQ9A 4CLEA 5DN9A 3SSAA 1BRTA 1C2TA 1H8CA 1ESEA 1I7NA 1THMA 2WJYA 3FWKA 3GO4A 3ON5A 3W5SA 2C57A 2F3PA 2XYPA 1NT2A 1XALA 3WLAA 4DQDA 4ZO9A 1A5AB 3GFGA 4WEOA 1ECLA 2R11A 3FXAA 4A1OA 1J8DA 4GSKA 4TV3A 2OHGA 2A7QA 5AHKA 3EW7A 5HFAA 3N2GA 3ORQA 2DPMA 2AN4A 4FIZA 2HAEA 3V8MA 1L8LA 5TR5A 1OGIA 3ZDRA 2HA0A 3QUSA 1XF1A 1WE2A 1J0BA 1JWAB 2ZW0A 3FYUB 1F51E 2PUDA 2XE4A 4WJPA 3LCJA 2WT9A 3C4VA 3E82A 2QD1A 4J76A 3E9MA 4X20A 3TQRA 1V1JA 3WWYA 4C05A 1ZMXA 3MTNB 3CRVA 1Z38A 4NPCA 1TTPB 1ZVJA 2OLEA 5BV1A 1FXUA 2WYOA 4B73A 2WMYA 4ZKEA 2KDBA 3EWIA 1UPFA 4LJ6A 5ABPA 2BS3B 3JQ9A 6REQA 1TJNA 5H02A 3WIOA 1HTQA 3X1DA 4KSCA 1YVDA 3EPJA 1EFRD 1QG2A 2VBFA 4HAZA 3M6LA 1DC8A 1N0IA 1TEXA 1Q12A 3EGVA 4AAYA 4Q4CA 1AW7A 2CHWA 4QWWA 1ZINA 4JD5A 1KI2A 3O47A 1OC2A 1RT9A 4AP5A 4EELA 1AQLA 5DSZA 4G1VA 4MLZA 3O94A 2Q3MA 3CRMA 4QU0A 1O77A 3GEEA 3P0IA 5JCZA 1XROA 1VSQA 1ZBQA 3C7AA 3BYTB 1GA1A 1UKBA 2I71A 3QNMA 5CTJA 4RQTA 1DC5A 2DC1A 2BRUA 2BN4A 2VHEA 3GVXA 3QITA 4DN6A 3AF6A 4YL8A 1NMSA 1UJCA 3B8EA 2G76A 3CLTD 3HEBA 1ZESA 4W99A 3TR6A 2JAXA 2V97A 3NIFB 2R751 4YO7A 2HMAA 2X2FA 3AEUA 5FQOA 4ZTZB 4D0GA 4JL9A 3SGLA 3T0GA 4UOZA 3GJ8A 3N6VA 5K3DA 1I4OA 5IK2D 3PE6A 1BN7A 3N30A 5K7SA 1SMKA 3W1YA 4KDRA 2ZQYA 1I24A 4FD3A 5BYBA 1JCKB 1QZTA 3H18A 4ID3A 3FE2A 5G02A 3WZLA 1DC4A 2C58A 1O95A 1XEXB 3HWX1 1SE3A 2CJOA 3K9OB 1FDTA 1HDIA 2A1UB 3SLGA 1JI0A 5HA5A 4ZU3A 1Y82A 3HBAA 1QIHA 1ECCA 4N9F4 3ZDXB 4KTTE 3BCRA 5DW3A 4XE0A 1CUZA 1FP4B 2PJZA 1SA0B 3UF8A 3IVAA 1XLNA 3FMVA 3H17A 3NAZA 4TLAA 4BJ6A 2V9PA 3DUWA 1RAAA 2MR6A 1YDMA 5DBEX 4JPSA 1WDMA 1ZXBA 2WSLA 3E8SA 1TYZA 1WF9A 1DDOA 1OI7A 1UPBA 2I80A 2XTMA 3F5MA 1Q92A 4MR9B 3VDMA 3VKWA 2C5LA 2YL2A 1DADA 3CVYA 3LH5A 2JCVA 1UXGA 2PJDA 5ITWA 1ZOIA 2RBGA 4D79A 4BP9A 2ECOA 5I7OA 1K2VN 3LBIA 1GPBA 2XOXA 4LTDA 1S1MA 1IUEA 4HPWA 1PR4A 5CPFA 4LWPA 1II8B 3V33A 3VYUB 2J0SA 1G19A 2APJA 2JC3A 3L0PA 3H87A 4B48A 3AUSA 3CA8A 4FKZA 3VC2A 2YYZA 1CUVA 4F5ZA 2ZT6A 3K09C 4HG2A 1P81A 3PVCA 4CKBA 2FSPA 3JYPA 3GJQA 4HYQA 4JSRA 1T8WA 1MVLA 2JLCA 5A3RA 1KAHA 2K0PA 1ICIA 3C3MA 1ESCA 3GLGE 3ICVA 4YJ2F 2OHHA 3I0NA 3P0EA 1P98A 3R77A 4Q37A 5ALZA 3UMGA 5AW7A 4PSKA 5FULA 1L6IA 2OO7A 3EJWA 1Y9DA 3MRXA 4RS4A 4URHA 4WJZA 4ZPXA 4CT4B 4HBGA 4EPRA 1K7XB 2REQB 2WNIA 4LNAA 3T15A 1JU3A 4ZI2A 1VFNA 1SUEA 1IUOA 1QZEA 1VJCA 2V4UA 2V6MA 1KDOA 3KYDA 1OKKD 1OAOA 4TXJA 1F8FA 4FT4A 1CQXA 3ZYCA 3ONWA 2KJRA 2ZUTA 4MX8A 3BB3A 4M8KA 4PXYA 4FHCA 4V0RA 1TF2A 2CNNA 5E7JA 4H4DA 4QXRA 4REQB 2CD7A 2D3GA 3L6RA 3L5KA 4IFIA 4YK7A 3VC7A 3QLUC 3NHFA 3TEFA 2O8FB 4JJAA 4B6JA 4B7AA 1S3SG 3Q9LA 2PKEA 1Z0KA 3G8BA 4LDPA 4QFMA 4Q9IA 4Y0AA 5KOJB 1TCVA 1JPUA 4MGYR 1H4TA 2EP7A 3GT3A 2Q45A 3MC0B 3QE2A 3SIPA 4DDTA 1TYEB 1OT3A 2IYTA 4PQEA 4G0OA 1U0OC 4WLUA 3M62B 1GZ6A 2Q41A 4BFUA 4PTLA 1FU7A 3R9IA 1MFZA 4DV6B 2QR5A 2CLEB 2ZTMA 4FDTA 5U9CA 5JSFA 4ERNA 3WGTA 3Q8KA 1W0JD 3IPCA 2V0CA 1RQGA 3SM9A 4Y6RA 3PQCA 3OEYA 4MRMA 5IS2A 1ZM3A 1E1YA 4KRGA 3T0IA 4MNTA 5B1EA 2YS7A 5F1OA 2C7HA 3EA6A 2NO0A 3H3XA 3QIJA 1ZD8A 4UMFA 4YMHA 4KLAA 3N2IA 4LBWA 1R1DA 2BSXA 3EXHA 4RENA 1NM5C 5ALEA 1F9JA 1F6WA 1RKXA 1IEQA 3KJEA 4Q7KA 4S1TA 4BGDA 4R81A 3FETA 3C1OA 5DNAA 4EKIA 4DDUA 3EGDA 1Q0LA 1ZOPA 2CWWA 2NZ8A 7ADHA 1NW8A 2W5UA 3PC7A 4MSUA 1YUBA 5B7QA 4JI0B 2OL4A 3G2PA 4LPKA 2FX5A 4IMPA 1SXTA 4YXDB 1CJKC 1JRPA 1QE3A 2C4HA 2DFDA 1REQB 2PO7A 2WT4A 2ROQA 4RH6A 2ZJ0A 1I13A 4GOJA 3UJPA 3E4CA 3Q9UA 5EJ8A 3R8FA 4GDKA 1KZ6A 1X8XA 2KT7A 4OM7A 2DPGA 4UNQA 2I33A 3T0FA 3H8HA 5I7RA 3G6WA 1I36A 5FA8A 4R54A 1ZVQA 3GCWA 6YASA 1M0TA 3DZJA 2ADMA 4PF1A 1T1IA 5DPTA 1WHSA 4JV5B 4J6EA 3I72A 5EE9A 2JRHA 1MOZA 2RH4A 2Y1DA 1I1OA 3C3PA 3R3UA 2RARA 2B8EA 2W8BA 2BUAA 3I04A 2Q3LA 3VC1A 4EF4A 2UZIR 2WXOA 2QU8A 4RHUA 4H7EA 3Q8EA 1Y5MA 2DR3A 2GBNA 3NEAA 5G1OA 4I5FA 1OBVA 2FPKA 2Y6VA 5JVDF 2R6GA 3MS7A 4CV2A 4E4RA 4MB6A 4UHCA 4MVJP 2VHJA 3U56A 3U7EB 4KQ6A 3RUIB 4OI1A 3CR3C 2I1VB 4CEJB 3D2CA 3IQZA 4ZCQA 2QK4A 3AU8A 3MXOA 5KYWA 2RHDA 5BN1A 2AWOA 1ECJA 5HTKA 2P3LA 1TMYA 2QW0X 3UANA 3WSVA 5E3JA 3I4CA 1UC5B 1YD7A 4MKHA 3SBXA 3TW4A 2OK8A 4FHKA 3PFWO 5BVHB 5JSUA 1REQA 2GWRA 1B6SA 3DHYA 5DK6A 2JGLA 1D2CA 3FZGA 2EKDA 1XF9A 3LIIA 4H6XA 1QCYA 4FJYA 4J9UE 5F3RA 3S2ZA 1DEOA 1V7ZA 2Y1EA 3PXCX 2WPDD 4O4HF 4R1QA 3TCKA 4AJHA 1I14A 3AU4A 3O03A 2GN0A 3QEBZ 5HIIA 3OZAA 3HN7A 2PUHA 2D11A 4B0PA 1NAHA 3DQZA 3BWXA 4RPGA 4Y9DA 3TRIA 3AEBB 3N1ZC 4HROA 1S2NA 4C2BA 1VG0B 1YBHA 4Q9NA 4JBWA 2R60A 2YZ7A 1J97A 4W9JA 3AV0B 1NL3A 3H7IA 1Y6FA 3HB7A 4FXPA 3TINA 3NR2A 1K5HA 1M2WA 2VH2A 4BGVA 4BV3A 5TQ2B 3U16A 1SH7A 4A0FA 3FKJA 1B8NA 2PKYX 2R8YA 4FR0A 3OPYB 5A7HA 3A1CA 3I9OA 3NDIA 1IGCA 4N40A 4P83A 4RHXA 3LDAA 4RH3A 3VMFA 5HUHA 2OUKA 2ZBGA 3FOBA 1GNUA 3KJNA 1GU0A 1Y37A 2A9FA 3KXDA 4MS3A 5JZMA 5L4LA 4BB9A 4HUQB 1XGKA 3T95A 5D1HA 1XTUA 4BFYA 4WKNA 3CEAA 3MPUA 1J8FA 3GJ4A 5CNIA 4YP6A 4LZNA 3GDHA 4HJRA 3CNHA 2IDZA 2R62A 3MA0A 4YAGA 4PLYA 2E9SA 3FPSA 1RAGA 1V1RA 1FD6A 1RZUA 1P7ZA 4BQOA 3WFZA 3G9QA 4MVYA 3DVLA 1RWXA 3FNGA 2PA0A 2IZ1A 3C98A 2GBLA 2ZJ2A 1V5IA 3ADBA 1QRUA 3I34X 4NS4A 2O5CA 1UC8A 1N25A 2G36A 2KACA 3JAKB 2QV7A 2NP7A 4CM4A 4MWEA 2B4QA 1FPMA 1PR6A 3ZHYA 4MP8A 1E1CA 4BLQA 3UK0A 3LFHA 3OIFA 4LTMA 5FB3A 3SVTA 3APCA 1OI3A 3H8SA 4JIOU 4I5GA 2UUAB 2ZIGA 1QU3A 1KJQA 3CX4A 4P0TA 4ZDJA 3KKKA 5CVUA 3OBIA 4JI7B 1N5MA 3ORRA 3U0BA 3OJEA 3EN0A 3NTOA 4R9SA 1WOYA 3L6OO 1SHJA 4K81A 4DXAB 2JIOA 3QTTA 5AW8A 4ZGBA 1DP4A 3CXRA 3VDXA 3FMOB 1E7WA 1FP2A 1N7GA 1OBCA 2P0EA 1Y3AA 1GNQA 5GOTA 2VP0A 1LPBB 1Q7BA 3QHPA 5CP8A 3ZIUA 5MFPA 2CHVA 4CG0A 4FJVB 5EEHA 2JH9A 2QAGB 4X1KB 4CKWA 4QEDA 4BMCA 2OUIA 1IN7A 5IT4A 4K9KA 4QXMA 1NOJA 1XHFA 1U4NA 3CSTA 1UCFA 3G3EA 3G79A 4KDIC 3NM4A 1LPSA 4X94A 2G9NA 3KJHA 3KPWA 4NYIR 4HLNA 3CLHA 1C4CA 5FBLB 1KDZA 1FMCA 5JXWA 1UXOA 1DQYA 1D2GA 1QF9A 5JXVA 3SHWA 4GOCA 4NV1A 2QN2A 1BU5A 1C9EA 3N8NA 4AO7A 3AOGA 5DTRA 1AO0A 3NONA 4UEOA 3SHQA 3I1YA 4FUQA 1G60A 3A4NA 1RS0A 2ZS9A 3N0WA 1VJTA 4FFVA 3LC7O 4WXHA 3OJCA 2R7KA 5EMNA 3LQQA 1H2XA 4B9AA 1BMFA 1C1XB 3G23A 4BDTA 3RQIA 2X8LA 4ON9A 3M7IA 4BYGA 2CCGA 4BMOB 2YNMA 3T9CA 5KYKA 1BTOA 4W9LA 3VVBA 1BE6A 2QY6A 3DFKA 1P3QU 1TPZA 2IZ5A 3PD0A 5BWOA 4OMDA 1V11A 3TEMA 2EFCB 4EAQA 1RE1A 1QWSA 2ZUVA 2IEZA 4MLCA 2XSZA 3NYQA 3TUOA 3TQCA 3IT0A 2RC6A 3GCXA 1HO3A 4R9VA 1Z22A 1H0RA 4DIFA 4KP7A 1NPDA 1XRLA 1WSPA 4IINA 5IP4D 3ET5A 1B6RA 2FE4A 2H16A 4KTVE 4BNIA 2ZJYA 3WP0A 4C6RA 5K8CA 3PQ2A 3TRFA 4M9QA 1CR0A 3FLAA 5CT6A 2YJ3A 5ED0A 1UFQA 5DMXA 2VUSA 5IYZA 2BONA 1SM4A 3W3AA 5EWLB 2I76A 1W35A 2D5GA 2PLWA 1THTA 3CZAA 2XXAA 2QP4A 4YEDA 1AS2A 3BGIA 3LP5A 4KXVA 4FHGA 2XTAA 2GVNA 4CCWA 4EPXA 2IRWA 3STTA 1A4RA 2QX7A 1YN3A 1OU4A 4DADA 3TSZA 1SEVA 2IYLD 4LV5B 2L42A 3O5AA 4ABTA 1CY0A 1HE1C 2N9LA 1F8YA 1M6VB 2FN8A 3KWJA 1JEJA 1LM8B 1M2EA 1VRAB 1YL5A 1NR1A 1A5TA 2W71A 2X3UA 1U99A 3C5VA 1HGXA 3IQDB 3JYHA 4LJLA 4N9QA 4RANA 3U2SC 1NUAA 3BSYA 4WFKA 4IQFA 2G1AA 4MEJA 4QOFA 4EUFA 5D00A 3GJ5A 1M2KA 3T3EA 3MFGA 1NFQA 4IYJA 2DBQA 2DYOA 4CIXA 2FOXA 1QYWA 3RV4A 2VP3A 1U0TA 2VRBA 4KGTA 4V3CA 2FMHA 3C3YA 2N47A 3D6MA 2J6HA 4OJMX 4W9HA 2EAUA 3WL8A 1CC1S 4LRTB 3PUKA 2YVCA 3ROFA 2AEHA 2WHIA 1OWPA 4Y98A 3TPCA 1RRGA 4G0UA 2CJPA 2O7RA 2BT4A 3JZAA 3HGTA 2XA9A 4TMYA 1T5HX 4BKQA 2O3QA 2P4UA 1D03A 2VJOA 4L6AA 1CFZA 1W4RA 4IHKA 1EA7A 1RJDA 2ACVA 1SC9A 3QX8A 5DEOA 3UAZA 1SEBD 3C6MA 4OXXA 2FZEA 3WV4A 3VTUA 2G07A 1Y6ZA 1CBUA 2WWHA 3VJKA 5J1SB 3GUYA 4L2YA 3G8YA 1BXKA 5KTMA 4O1NA 1ULSA 3RAPR 4BO4A 2PGOA 1D6SA 4J6FA 1R12A 5DCNA 2LR0A 4IS2A 4PZCA 4K6KA 4XAQA 3DBRI 5F23A 2AEEA 1XT9B 5FTJA 1LPOA 3AP2A 3KB6A 5FL7D 1PR9A 4YRLA 5AW4A 1LWOA 4BPBA 1K1EA 3RSOA 1ZVKA 2KLCA 3Q69A 4ND1A 4I81A 5LWHA 1AK1A 3AETB 3O92A 1MP0A 4U39A 5ER9A 2X58A 5AVRA 2J0VA 5D3MA 2IE8A 3DDNA 3S4YA 5KWVA 1CQIB 1L0BA 3U62A 4ZOBA 4A23A 4WJQA 2ON6A 1SIWA 3KZXA 4QUHA 2VHYA 4EEWA 2OCKA 2P77A 1K06A 4KO4S 4UXJA 5A5FA 2FB9A 2C4UA 2KMLA 3PTAA 2VIIA 2IXFA 2LBPA 2Q3HA 1X1DA 2PMDA 4NESA 4PCUA 1C77A 5HQ3A 1F14A 4YN3A 2UZ1A 2W9NA 1OZGA 1ISHA 2J07A 2OBNA 3FDJA 1I5EA 3LY9A 3QPWA 3RWBA 3T7IA 4KLRA 3WZ2A 3DT6A 3DV0B 3ZU2A 5B2EA 4HLEA 1GPH1 5AM3A 1CQZA 2HADA 2ZRAA 3HR8A 3GLFE 4IWPA 2XPCA 2VKTA 3MUEA 3N2KB 3L7JA 3N59A 4JEIA 4OI4A 2M17A 4RQAA 2DUJA 4D46A 3WLLA 4TQ0A 3AH8A 4HNQA 1N5LA 2GT1A 4RHTA 4PSCA 1HFEL 3IP5A 4I4TA 5EUBA 3IIEA 4PU0A 4B2YA 3HKCB 3RJZA 4GZLA 3C19A 1ZM4A 4QYXA 4UBIA 3NP7A 2N9UA 2ZEJA 3L0DA 4TWJA 3S1AB 2A5DA 1QUFA 4P1BC 2YW2A 1Z82A 4FKMA 3CRRA 4R2MA 5IEJA 3WICA 3O93A 3FHJA 2QN6A 4H1VA 2WX1A 4KYUA 5D1NA 3RYCB 1QHHB 4KVFA 3ASUA 4JN6B 3VU1A 3D0RA 4IWXA 4WNYA 5ALGA 3O8QB 1CUDA 4NCJA 4ZRNA 3ZY6A 1TX4B 4NPNA 3DMNA 1AUQA 3E7DA 1PDVA 3I01A 1EM8A 4CDGA 1IVSA 1R5JA 2J3IA 1IY2A 3S2YA 1O4VA 4DLZA 3LUDA 4NYJQ 2OMKA 2IYWA 2WJ4A 1CQVA 4UULA 4CW7A 5AI0A 1QC5A 4LDZA 5BO4B 2GPBA 3AF1A 3AOEC 4I08A 5LZ9A 2NO9A 1EVYA 1JXOA 2H17A 4XR4A 4P9NA 3FR8A 4R3NA 3NDBB 3OZBA 4WVFA 2IYYA 4GPAA 4GVXA 4P81A 3P2IA 4HD8A 4LX0A 4GLFA 1RJWA 1DXOA 5BUCA 2WYVA 1W47A 1TMKA 5TSDA 3NTUA 4XFKA 1L5PA 3HCCA 1RLUA 4FUTA 4JLBA 4Q3LA 4B44A 4H3VA 1IE3A 4YJ3F 4XJXA 4NMWA 2HK9A 3W5JA 2KMAA 3ZDFA 2P79A 2HA7A 1XKXA 1DT5A 1KI9A 2ZRFA 5IN5A 2Z2IA 4EM6A 1EM8B 2DE0X 4BVKA 1ZOYB 3ABVB 4GGMX 4B6RA 4DV4B 4ER0A 2O6HA 2IEBA 4AIIA 1XZLA 4WQOB 1T4GA 1KYQA 3M9WA 2ZBEA 1FSFA 4JBNA 3VXKA 4RIIA 1G5PA 1GYRA 4RAQA 2Z3ZA 4XTRA 5K8TA 1RFGE 4YACA 3QKSA 4E4TA 1WXHA 4QQRA 5FLEX 1GPWB 3HKDB 4XX1A 3U4MA 3FYCA 4J1TC 2WOOA 2PBZA 1VJ5A 4EBFA 2WYUA 2A0WA 3URKA 1N2GA 4KWTA 1IZYA 1GTSA 4I6NB 3KG2A 3T5MA 3ZDZB 4II2A 4YWGG 1RI2A 1RPAA 2Q0SA 3F97A 1A9ZA 5IJZA 2RK3A 5B7PA 2HYIC 1H2WA 1O3YA 5KI6A 4Z7QB 1B73A 2DKFA 2I66A 1JMYA 2PU5A 5DTQA 3D3WA 3QW2A 4BWYA 4CQLB 4LS3A 4EENA 1D7OA 4P38A 3LVQE 4RJJA 5FK9C 3RR2A 3P9RA 3CSDA 3NBYC 1D6EC 2EKBA 5HKAA 2XXAB 5CR9A 2L18A 4B6SA 3UC9A 1JW9B 1Z63A 3VSDA 3E2MA 3U61B 3V62A 1IXRC 3B9PA 3HEMA 4UJ3A 3ZWQA 1VXOA 1U80A 2QLJA 2XGSA 1C9DB 3ZV7A 3TR5A 3E9CA 4R84A 3ZNPA 1IOVA 3HXKA 3IPXA 4RCOA 1I1QB 4WXPA 1ORHA 3TSCA 2AOWA 3PC8C 4LXHA 2IU3A 5KYYB 1N2SA 2JLSA 3EY9A 1JH9A 2OYRA 1AA6A 5DXJA 4J16A 2GEJA 1T13A 3GFBA 1CFJA 1X87A 4JKYA 4EA6A 1EFVB 1U9IA 3V2UA 2WAAA 1VBKA 1AQUA 2BFWA 1R64A 2FMUA 1E20A 2P11A 2Q1TA 3ASYA 5GZ1A 1YQEA 2D74A 4RJKA 2IYZA 2D3BA 2GX6A 3E03A 4PX5A 3MQFA 4FI3F 2W2TA 3BK2A 5JS1A 1NY5A 4PX2A 4INZA 1HX7A 2LKCA 3M82A 3ESZA 3K73O 5PGMA 3DVGX 2J09A 1Q1QA 1WVIA 1K4YA 1M1ZA 4M36A 5DWVA 3IAAA 1E5VA 4MRPA 4WWPA 4BQIA 2Z8LA 2W2NA 3DOHA 1FMFA 3ADCA 3V7FA 2CYAA 2PBLA 2KQ7A 1DQNA 1GUAA 1IHOA 4C4VA 3IIJA 5CFZA 4WERA 1XB2A 2RG7A 2VTVA 4IDOA 4MAFA 3ODGA 1PBTA 3GQBA 1E4EA 3NETA 1B0ZA 1OJLA 2B7BA 5A0TA 1E3QA 5FORA 3RS4A 2F43B 2E1RA 3MZ0A 3FWHA 2FGJA 5EUQB 1NLUA 2V5AA 1PEAA 4GDLA 1G5FA 1I4TD 3IUBA 2LV8A 4R9NA 4RVUA 4ZAFA 2INDC 1U7PA 3OMWA 3EHDA 4LGVA 3ZXSA 1IZ8A 2X8JB 4XIGS 1DKPA 2YZ2A 4L72A 4BBJA 1NR7A 3RADC 2P6OA 2V0NA 4UREA 1EP3B 4G2NA 5KQPA 3T4UA 2CF6A 3ELDA 1I4GA 4DYDA 5H16A 2XT9A 2EERA 2YY5A 3W0LB 5K0LA 1LKZA 3RVDA 3NS8A 3CGGA 2GJ9A 1E1RD 3P5SA 5AVOA 1KF0A 1AUVA 2B37A 4WBNB 3S2AA 2FIDA 2QP3A 1RP7A 2KVRA 2PM8A 3ADOA 3ICCA 4YHBA 3VTWA 3HPQA 1SXQA 5I8ZA 3FHLA 3H0KA 1M1NB 1TLLA 3B2GA 2FXIA 2BMFA 1WIWA 2VN8A 4QPCA 2LGDA 2A5GA 4ZJZA 1W36B 1L2TA 1WUIS 2DP4E 4L6CA 4K3BA 4WJNA 1IY1A 2FQXA 3PNMA 1ORRA 1RQ7A 4ZCTA 1M5RA 1TD9A 2IYQA 2QJOA 3VZQA 3LYLA 3R75A 3RRFA 3VPSA 3WMXA 3NVVA 3LHFA 2HJWA 1MAUA 2K2QB 4F7DA 1XEFA 3G1WA 2G83A 3CCBA 2GD6A 4UPEA 3MD0A 2XXBA 1OWMA 2NU7A 3GJ0A 4ZU1X 1BUIC 3KHSA 2WXRA 2X40A 1FFWA 3GFOA 3C5HA 2B8TA 2JFHA 1RQNA 1ET9A 1W4LA 5IK2A 3BWDD 1T29A 2HTEA 5JYCA 5EIBD 2MYUA 1P73A 4JOQA 5JXIA 4OO3A 2H89B 5D3IB 1NYQA 1PHPA 4NBRA 3WDSA 1QLWA 4MJSA 5AP9A 4UQPA 621PA 2XEDA 5IVIA 5SYMA 3BJIC 2JJQA 1Q6YA 4ZZ2A 2C07A 3TZHA 3IULA 3CRZA 2DB3A 1LFAA 1U5CA 5LA6A 1T3QA 3BPSA 4K9PA 3QLVC 4CM7A 4ZOAA 1Z37A 4QYMA 1AZTA 1ZDVA 1XRPA 3LKBA 1KZGB 2C96A 4BCCA 4UNPA 3OU7A 2X9QA 5FBVB 1HE4A 5JRJA 3H8JA 4JCOA 3U4DA 1YZKA 2D1SA 2JJ8A 4PYIA 2AVDA 4M0LA 4R98A 3IOCA 3ONVA 2YIJA 1DJOA 2O20A 3QARA 3ZBQA 3EBOA 2H29A 3NFYA 4YRAA 3BK7A 3EZFA 2REXB 4AY4A 4O0LA 4RFSA 2PZMA 4G1UC 1I5OA 3PDIA 4J0JA 4QJ3A 2FCNA 5DULA 1KEKA 5D3DA 1SVLA 3R74A 5A4AA 3I1FA 4RZXA 4WAAA 1QG6A 1U9YA 4ETIA 5I7UA 1VLMA 4HDKA 4Q4AB 3IPYA 3O84A 3EC8A 1W5EA 4P86A 2HU5A 2CUNA 5BVHA 5K2OA 1GQSA 4P33A 4ENSA 1Q0SA 2EG9A 1F38A 3O83A 5CXSA 2ONZA 3ZVNA 1PGPA 2Y1FA 4FX2A 3BH7A 2ATEA 4P4UA 3F6BX 2ODPA 4IZOA 1KGDA 1ZD4A 2G28A 3ESRA 3QEOA 3QENA 4HMQA 1FTYA 3AU5A 4K6MA 2J3EA 3VAAA 1VL8A 5AI9A 1P3DA 4LTNA 3WQBA 2W70A 1NXQA 1ZNXA 1ZUD1 4LIPD 3U0VA 2I3ZA 2H57A 2IXTA 4UHHA 2ZBRA 3VQTA 1F4VA 4ENVA 1BXZA 4JC8A 5EFOA 1YZ3A 5A04A 1SD2A 2VYVD 3QVTA 5HXAA 4ZVRA 1JN0A 4ENPA 2EXXA 2YJ6A 4CV3A 4A8JC 2VATA 2XHEA 4NJMB 2HFJA 2IL1A 4NU5A 1GN9A 3TD6A 4H6WA 4OW0A 1AHNA 2J32A 3WHKA 3IPRA 2C98A 4C4XA 2NIPA 4CG3A 1XLTA 1EG2A 3VPFA 4P82A 5A3SA 2F3SA 3ZEIA 4ZN6A 2I2BA 4LFAB 1XCMA 5H3CA 4LWOA 2ERYA 2HK6A 1FJ2A 1ADGA 2QE7D 2Y8EA 3U3MA 1YULA 2HLDA 4ER7A 2QMYA 4B09A 2FUEA 1EX9A 3REQA 1Y3BE 5T8IA 1UOQA 1CY2A 3R7NA 3BIJA 1Z7GA 2AB0A 2Q9BA 3WJ7A 3WLJA 2H6EA 1V3TA 3OKAA 4MDYA 2GPWA 2ST1A 3ILXA 1L6VA 4EHLA 3AUYA 4AFNA 2AG8A 1YRAA 3V7WA 1GR1A 1VLJA 5G0VA 2WAMA 5E6SB 4NZOA 4V02A 2FMXA 1NW7A 3FOAA 2JCGA 5FPYA 3ZLTA 4YCNA 1Q7GA 5CURA 4LN1A 5JECA 1RXCA 3COWA 2XAAA 3FGOA 4S1WA 5EN4A 5FEMA 4IJQA 3RVQA 3QIAA 3CVUA 4C2UA 4HH4A 2H7YA 1K6JA 2YTZA 3JQCA 1OLSA 4MIEA 3CLTC 4DIKA 1APBA 4ETNA 1PWZA 2NU9A 1BVYF 3L8HA 4XB2A 1FIUA 3C8YA 5BWLA 2HF8A 1U04A 4NOLA 3AE2B 1R18A 1UDWA 1W52X 4RZIA 3FD8A 5K0ZA 3THWB 1YI1A 2WMNB 3FBTA 2WYHA 3LQKA 4HBZA 1VKZA 2XWPA 4PGMA 3REQB 3T1TA 5F1PA 1ZQ1A 4XVRA 2VF2A 4BVGA 4QD3A 3JCZA 1JJ7A 3TIIA 5HJ7A 1G2QA 1J09A 3C3XA 4CM9A 3C6KA 2OCLA 5T4FA 1J42A