2VH2A

Crystal structure of cell divison protein ftsq from yersinia enterecolitica
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
202
structure length
201
Chain Sequence
b'PLSKLVVTGERHYTTNDDIRQAILSLGAPGTFMTQDVNIIQQQIERLPWIQQASVRKQWPDELKIHLVEYVPFARWNDLHMVDEQGRSFSVPSERVGKQKLPLLYGPEGSEQDVLEGYRAINKVLAANKYQLKMVAMSARHSWQLALDNDVRLELGRDDRMGRLQRFIELYPMLQQPDKRVSYVDLRYETGAAIGWAPVFI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN FTSQ
publication title Structural and Mutational Analysis of Cell Division Protein Ftsq
pubmed doi rcsb
source organism Yersinia enterocolitica
molecule tags Cell cycle
total genus 30
structure length 201
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03799 FtsQ Cell division protein FtsQ
A PF08478 POTRA_1 POTRA domain, FtsQ-type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2vh2A01
3.40.50.11690 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vh2A02
4C4VA 4BZAA 2V9HA 4C4VB 2VH2A 4QAYA 4XGAB 4C00A 2QDFA 2QCZA 3MC8A 3NJTA 2VH1A 4K3BA 4PK1A 2MHJA 4K3CA 3EFCA 3MC9A 3Q6BA 3OG5A 2X8XX
chains in the Genus database with same CATH superfamily
4HH0A 5FUMA 1V39A 4X8LA 4Y6RA 3URKA 3ZDQA 1JEQB 5JXWA 1KAEA 1G41A 3ACBA 2ZATA 4YFYA 1BMLC 3PPYA 2CLMB 3HDTA 3IAEA 3P9RA 4LVUA 1K3TA 2X5NA 4KMOA 5AQEA 3TXYA 1R74A 3L8EA 1CZUA 1HC7A 1WXXA 4F4CA 3CX4A 3DEZA 1S5PA 3I2YX 4JY7A 3NT2A 4RHXA 1SVNA 4OHMA 3BINA 4S1VA 4OXYA 1P4RA 4KBYA 5GPBA 3DNFA 4GI5A 3EDCA 4A3SA 2QBYB 2HWWA 4YEDA 1P9LA 3FUUA 2HC9A 4PZAA 5J2TF 2CLFB 1YH3A 3M81A 1JMLA 3A8TA 4FS8A 1N36B 1NUAA 5G0VA 4U7JA 1RT9A 3CE6A 2ZDQA 1XN4A 3CWCA 2EZ9A 4GNRA 1VDVA 1P2DA 2D4HA 4I9HA 1T8WA 4JLBA 4GO1A 3CM0A 5FLXA 1R88A 2QN1A 2Q4EA 4QD3A 1YQEA 5EIOA 3K70C 3TSAA 2GPWA 4B8ZA 4DA8A 3G5UA 5E8RA 8ABPA 1BD3A 5F78A 4P2BA 3I92A 3CS3A 5EIXA 3BL5A 5GTDA 4NJ7A 2GAIA 2SKEA 3OURA 2K3UA 5F98A 1Z8DA 4I8IA 1LY1A 2H63A 2OHJA 2JLCA 5KJEA 2QJOA 1FP4A 2XMSA 4GQIA 4M1TA 4FB4A 3KD2A 5KQGA 3WA0A 4NZPA 2GSDA 2OHGA 2G67A 3AVUA 3LY5A 1P4HA 1L4DB 4B85A 4O5OA 1THTA 4LRSB 4NZLB 2F1KA 1FU7A 4IZOA 3V9PA 3I72A 2GCGA 4P3PA 4EG3A 4GBGA 4UULA 2VPQA 3D4NA 4QOIA 4HOYA 3WANA 1RHUA 4A8TA 4L9WA 4RPCA 1WY7A 4QOHA 3W1SC 1NBEA 3WRYC 1ZVQA 2H2DA 1SC1A 5KNDH 1ZC4A 1HTBA 1BEUB 1F6DA 4L9SA 3FLBA 1WJUA 4Q21A 3FYUC 4HZUA 1H6BA 4US1R 1G66A 5I9LA 2NUPA 4N54A 2BEUB 3EASA 2ZJ6A 2ZVJA 1ZP0B 2P2ZA 3OQPA 3AZPA 4L74A 3Q0EA 3V8QA 3ZNPA 2QMZA 2JJQA 1IHPA 3H0EA 4JWTA 2BMWA 4YY3B 4LSMA 4RTQA 5LDDC 3W6UA 4I66A 1KXZA 2I4LA 3F6RA 1EVKA 1GEEA 3GFTA 5FBWB 1E1RA 5TXGA 1L4UA 4KPFC 4R7GA 3C6MA 1OASA 4PGGA 4TLDA 4A91A 4NYMQ 1NC3A 5C0OE 2IYLD 4E2ZA 4S0RA 2Q49A 5JCZA 3CRMA 4A6EA 2FW0A 2MSLA 4LV6A 3E7FA 1CU1A 5BRJA 1OQQA 4YIHA 3DLPX 2AW3A 4PZCA 5LNK6 3V05A 3JATB 3G8AA 4Y2HA 3OCWA 3HKBB 1XG5A 5A3RA 1Z5PA 3L1UA 1SVIA 4ZV9A 3BA6A 1X1TA 3AM5A 1ZXHA 1MPEA 1CR6A 1HBJA 1KWKA 3TOXA 5AM1A 3BZBA 2YYZA 5G4LA 1M2NA 3LVFO 4CCYB 4G9BA 4GU5A 4W5RA 2A0KA 3BK2A 2I3DA 3M2PA 4IIHA 1ZK0A 2EAUA 4IMIB 3ZW9A 1CY2A 3PEUA 4BRUA 1OLSB 3JQ8A 3Q41A 3M8KA 4UZEA 3IOEA 4PYNA 4Q3LA 1GCOA 1HTOA 3CO5A 2ORYA 4BKTA 3IP1A 2JRLA 3KSDO 4IQ4A 1IXSB 4NF2A 4TL7A 3LHSA 3ZI0A 2L52A 4WI1A 2QMHA 3DHHC 1PT7A 4KLNA 1HGXA 4WUTA 4ZTZB 3NTOA 4DHEA 1R3UA 3TL2A 3GX1A 3DUWA 4DMCA 3F4KA 3Q7QA 1GGEA 1TJ3A 1LLQA 1QFMA 5ER6A 1NSYA 4I1IA 5J2UF 1VL2A 2PYDA 2ZJ1A 4YREA 3WDKA 1Q1NA 3EXEA 3DKVA 5K5EA 2IZ6A 5D3QA 1UJ6A 1GZHB 2NZUG 1LGRA 4MEAA 4PZPA 5HIJA 3MRSA 4GR4A 2O3UA 3B6EA 3E8XA 3HJUA 1QH8A 2WSLA 1KU0A 3SEZA 3AEFB 5CVDA 3EWSA 4UTPA 3ZUNA 2V1UA 3FJOA 4HGRA 3H3FA 1YGYA 4US9A 4QBHA 3PGA1 1A27A 2HJGA 4OYYA 1PEKE 2G6BA 3IHWA 4WLEA 3ZEAA 3UI3A 3WYNA 1P98A 1FXWF 5HCUA 4OXIA 4FKZA 2VNSA 1YUBA 3GEDA 5ALDA 2QXUA 3GLQA 3I9LA 4NCIA 1R6AA 2H7VA 3MWFA 3QOXA 4WNIA 1IN1A 4RLSA 1ISPA 3I83A 4UJ5A 3KZXA 4XEHA 3U9SA 4W9GA 5JZSA 3B7PA 1YFZA 4Q7JB 1H2AS 4MS1A 2DOKA 1C3EA 4LFBB 2JFHA 2PRKA 2EW2A 3B70A 4KDCA 1CLUA 1AMNA 2W4IA 2GNPA 2R8EA 2HRDA 1MI0A 2ZRGA 1F1JA 3TE7A 5FHQA 3ZLZA 2NVBA 1IM2A 4D3SA 4DT1A 1C76A 3OOEA 3NNNA 5E0OA 3NJ8A 2GAFA 4BMDA 2PTHA 2ZBRA 2AJDA 1T2CA 3MJRA 3HXQA 2Y0BA 1YNTE 3UMFA 1EJ2A 1Z2EA 2GESA 4BRZA 2D13A 5AUNB 1FDOA 2NTTA 4OHKA 4QQRA 3GLTA 1GSOA 3GYBA 4B71A 1U8ZA 1X80A 2FG6C 2JHGA 2QM3A 4UBLA 4I4LA 3GLFE 1AXRA 5CA1A 2R61A 1LGYA 3PNSA 2KW5A 1ADGA 4PC1A 3N39C 2LGXA 5HE8A 5G4KA 2P3SA 2PKCA 3AUFA 5AKEA 2BVNA 3SC3A 2OESA 4Q16A 4IP0A 1JLLA 5ALWA 4UZFA 4J0CA 1XJ0A 3RS2A 2BTOA 2VTDA 3VR6H 2RJOA 1F8UA 3ZGLA 4YRPA 2JLQA 2A30A 4BKRA 1A5AB 2GTHA 1P77A 3P4YA 2VCEA 1DHTA 3JSAA 3HH8A 3USCS 2ZNVC 1NUQA 1QOAA 4D25A 4KNVA 4UDYX 2C98A 3RIMA 5JQGF 3OCZA 2D1RA 3ZJ5A 2GEKA 1XLOA 1KMNA 1L6VA 5GIOE 2JG3A 3BMQA 3ZJVA 4AN0A 2M1ZA 2PY6A 1GQ2A 1IUNA 2VQDA 5IHPA 3DFMA 4BBJA 3V1LA 1LO5D 1EVIA 3KKPA 5HQ3B 4G0VA 4BWYA 2D11A 4II2A 1E1YA 2J31A 5C3UA 1WZUA 2WHPA 5BV8A 1E2FA 4GSLA 1GA6A 4RLQA 4R8KA 1NT2A 4RGOS 1QHFA 2XWSA 3R2TA 3N7TA 1UFVA 3ONDA 1E90A 5FI1B 4OMFG 5FUYA 3RBAA 5GM1A 2XYPA 1PL7A 3WNDA 3INRA 2O7NA 4XPIA 2AL6A 2FW1A 4DCOA 5K3FA 4B73A 1FMFA 2IK8A 3N5KA 2Z4RA 3ETRA 4OHVA 1IN6A 3ETLA 3FDFA 4HN9A 1PNOA 4NNJA 3O5AA 2HF2A 4Y2VA 2ZAOA 3Q88A 3OTGA 3SYMA 4KAJA 5AJTA 2N42A 3AKYA 3WLNA 4ZQIA 3M34A 2GEJA 3X1MA 2VF7A 3AE8B 1CQIB 3ZE2B 1I6MA 2X15A 4R5MA 1E8ZA 1E9DA 2NSLA 5D5HA 4IXWA 3RUIA 3DVNV 1ZZGA 4KWEA 1GRVA 4CDRA 4ZRKA 4CM5A 5CFNA 1ISMA 2HXGA 5AYVA 1GAQA 3EA0A 4G1UC 2PMVA 3FAKA 1QDUA 1EDOA 5I5GA 5TR5A 5J59A 3EAGA 3UG6A 4CF6A 1XCJA 4LHYA 1XP8A 3HN2A 5J1TB 3CY6A 1SB8A 4AZVA 1ISFA 5FULA 3SKVA 2QRKA 5JXGA 3BTSA 3U49A 5D1NA 3IUYA 2NPTA 4M98A 3MT0A 2GPYA 3IT2A 5J4HA 1FTSA 1RRGA 4PXSA 2RHGB 2JNWA 4XOUA 1CS0B 3RUAA 4CMGA 3IJRA 3D9QX 3EZ6A 1N9ZA 2AZDA 5DGCA 4KJXA 2LUOA 2YMLA 4D96A 3FYHA 3NYIA 2CUTA 1AHNA 5EIEA 5IO9A 2BV3A 1NI3A 3RFFA 2ZR0A 1KS9A 2DKNA 4R40A 1TEVA 4MLDA 4Q3EA 5J2TA 2C7RA 1FZTA 1WZCA 1CJUC 1RMTA 5G55A 2YDXA 4H2AA 1MGPA 3FSGD 4MITA 1M2VA 3AEBB 1NOKA 4FMDB 2BSQA 4K8OA 1L4MA 4P6VF 4WADA 3IVCA 4IR7A 3WKCA 4OBEA 5CB8A 3SC6A 3IESA 4DWJA 4F93B 2NBUA 5IC5A 5JADA 2R65A 1YZUA 4EK9A 2QVCA 3CUEF 2OHHA 3O8DA 2YQ4A 3CGWA 2HSDA 3NH6A 3IEVA 5G1PA 4Q9IA 4O2BB 5JS2A 1TM4E 4U8HA 2BFDB 3KSBC 1KKMA 5A4IS 3GLIB 1ST2A 4X1OA 4TKMA 1VMKA 13PKA 1JDBB 1E4EB 2H9YA 1WJGA 2QSDA 3STUA 1U7OA 4HHEA 3AY0A 3G59A 2JBHA 4YS6A 1NDHA 2CJFA 4GVLA 3VTVA 2ALJA 2K4MA 4JMPA 1T5XD 1ADBA 4ETNA 4BUCA 2C2BA 4GPIB 3QSYA 2IO3B 1Z6GA 2AWNA 2UAGA 3A0UA 4LQCA 2N4FA 1J9EA 2F9FA 4BNXA 5THQA 5IUJC 3P19A 2DGDA 2F90A 3QA3E 3K92A 1EWTA 1P1KA 2P68A 4HAVA 1G17A 1HYQA 4KSYA 1Q14A 4I0WB 4P33A 1YQTA 1H0HA 4RD2A 1NJ8A 3L4BC 1JWLA 1PG0A 2O4CA 4JUAA 2IEYA 2IGTA 1GGHA 1OFUA 1VRVA 2WWTA 3GDWA 2G45B 1IN8A 1CX9B 4CMCA 4QAJA 2WR8A 1ECPA 3PSHA 4HLDA 3MMSA 4WXPA 2PZJA 3ND7A 1PRYA 2WT9A 4M83A 3REOA 4M1WA 4HGPA 2KMMA 3ZGZA 4U1RA 4UTNA 1JB1A 2BOVA 2CNWD 3AETA 3RSQA 2HTFA 5FOSA 2ZXFA 2OEPA 1YXMA 2GA8A 1Y7PA 2BRUA 3JQGA 4TL9A 1JLRA 2P27A 4UUQA 4FTWA 2PRJA 5F4ZA 1QGOA 3HB0A 1NMEA 4ON9A 4TMYA 4TZ0A 2A67A 3BVZA 4BKMA 1XKLA 3EUB2 3LC7O 4MVJP 2W83A 4R2LA 1L6UA 1UJNA 3UB4A 2G9NA 1U8FO 2JL1A 3C5WP 3HJGA 4IH4A 1OFUX 4TXHA 3OA2A 1HZZA 2Q5FA 4M1QA 1C50A 4BN5A 1UC9A 4M9CA 1MCZA 2X0IA 5DCLA 4U6QA 1LC3A 3BD9A 4JK3A 2KKCA 4KVGB 5AIAA 3JD2A 5U1PA 4JC5A 5L95C 3K9FC 2CYCA 5EWLA 3BEDA 1PAUA 3IAS6 5C4MA 4TTAA 4PNHA 2FSIA 1MFZA 5G0WA 3KUXA 4R7ZA 3OH8A 2XQFA 1WSPA 4B47A 3TYXA 1O4WA 4LZAA 4FD2A 1WKBA 1D9XA 3M6WA 2FA9A 4X94A 5LYJF 4MO2A 3MHSD 4MICA 4BNKA 3OAAA 2R2AA 1K3UB 4Q9HA 1JWUD 1TY0A 1PE0A 3ICCA 1LQTA 3RRNA 4AJ2A 2HW8A 3KL4A 2DTXA 5LP6F 3BL8A 3P2EA 3LUCA 2QNIA 3PYLA 4L2IA 1KF0A 4X8HA 4XLLA 2FPUA 5KHOA 1GHTA 4KE9A 3QX3A 4F1SA 4Q3NA 4KV7A 3RC7A 5EEHA 1J8FA 3AE9B 1GXSB 4DQ0A 3U09A 2OK8A 5LZ9A 3ZDRA 2GK7A 3V42A 6CHYA 3L1IA 3O4JA 5J2UA 1JJFA 5EJ4A 1KRWA 1BVYF 3KTFA 5EHZA 4PRKA 5JDCA 2QRGA 4LECA 5I4CA 3I0NA 1VB5A 3R7WB 3OZIA 4ARIA 4FGSA 5TGTA 4WGFA 1Z63A 1JR3D 3DONA 1WDTA 2RI6A 2XCIA 4KO8A 4CPDA 2QJLA 1GPYA 1GGVA 1X8XA 3RJ9A 3VAYA 1Z9BA 1LXCA 3GU3A 5T41A 3IBSA 1TK3A 2RI0A 4B84A 3IG3A 2GBRA 1TVKB 4HH3C 2VA8A 3LHFA 3JWGA 2ZIEA 1FXWA 1UBJS 3F9CA 4ZJPA 1H23A 3I9MA 2H1CA 1ZNXA 3IUMA 5FFMA 3RT1A 4Q1VA 4JWKA 4Y67A 4D6XA 4L07A 5CXSA 1YU9A 3DM9B 2J5QA 3CZ5A 1UXJA 4RFVA 1GQSA 3SXJA 1NRWA 4UPVA 3HJTA 2GERA 4QBGB 3VM6A 3X3HA 3D64A 3AEUA 3B1YA 3H16A 3KE9A 4UTOA 2WWXA 4MKHA 3DHEA 3R9XA 2WF8A 1FX1A 2PS1A 4PPGA 4A0FA 4JXKA 5DHFA 3P71T 4TKVA 4U4AA 3A6EA 1KAQA 1IY1A 4KQJA 4BWVA 2O57A 4LXQA 4J03A 5IG2A 3FCAA 2QQEA 1RAXA 1SE4A 4X00A 3JW8A 2AOWA 4G0OA 1T0UA 3BWUD 4L4ZA 4P84A 5HJ2A 4BGIA 1Y56A 7ADHA 3R6TA 5IAAC 3V7YA 2GLSA 4FDUA 3ZHSA 4ZVOA 1LI5A 3ECSA 3EXHA 2LWPA 1KBQA 4DR7B 4K2HA 1WGRA 4NBWA 4BAZA 1OGWA 1KPGA 4WXHA 3FFWA 3EZFA 4EJ0A 2BHSA 4ETIA 1ZH2A 5GIPE 4QXRA 3ESXA 4XARA 5F23A 1J0CA 1YRYE 3NGXA 1NU8A 2A1UA 4HSEA 1L4HA 2PCLA 4W9EA 1JZTA 3AUKA 3QLUA 4DQDA 2JLVA 1NXSA 2CXSA 4USAA 2RHJA 1YULA 1POXA 2G5GX 1ZK1A 4N7RA 4YP9A 1UT5A 4PLFA 3BE5A 2WKRA 1E3EA 4HKTA 2BZSA 4MPPA 5F12A 1ML3A 3W79A 5BMGA 1VMDA 1QH1A 4DM7A 2VSOA 1A9RA 4B0MA 2XA2A 3F71A 4OVZA 5JQGA 5CNJA 1WXAA 1EJBA 3L0DA 1M74A 1UBIA 1ZPSA 3NG1A 1E3JA 3KM0A 1DKUA 4LI0A 3WWZA 1FUIA 1S2NA 1YJ8A 2ASEA 1RJDA 3BCHA 4NL4H 1SCKA 2W7TA 3RW9A 5G02A 4LSZA 3RT7A 3I5JC 4KXXA 3SFTA 3V4RA 1C1DB 1PHRA 3P94A 4MVXA 4DIKA 2QGNA 1DRJA 2C2GA 1OU0A 3TFWA 3PQEA 5HF5A 5LQDA 5H3CA 4F97A 5EWMB 2D5IA 3CPSA 4QGSA 2OY0A 5F1YA 4AFNA 3DEHA 2YC4C 3FGNA 4QARA 2CNKA 2J5BA 4L4XA 5IF3A 2O7VA 3C7AA 4P1ZA 5ALQA 1P62B 2FZ5A 3WMFA 3RIXA 3A1SA 2DHEA 3PPIA 4ZYXA 3N75A 2JVKA 5IC6A 2V1YA 1N6NA 5FX2A 1K92A 3GT4A 1U2RA 3ZOZA 2V59A 1TT5A 1JYFA 2O2GA 4INOA 1PJ4A 1RWMA 2VP6A 3E27A 4E5PA 1MIOA 3P9YA 4LDTB 3PNBA 1KI4A 2Z3VA 2F8MA 3GELA 1S2OA 3NGMA 2W93A 3PRZA 4WVFA 3LC1O 2WYVA 4Y9UA 3FNHA 4TL6A 5K45A 4QULA 4EH1A 5BUQA 2PSEA 3MS7A 2PT5A 1R6UA 1I8TA 3KPJA 3QPUA 4FT4A 4EMUA 4L50A 5TS2A 5FV4A 2JZCA 3VYUB 4AO7A 3ZGYA 3AG5A 3KTOA 4S3MA 221PA 2WC1A 3FLMA 1G9TA 4NYIQ 4Z49A 3J81k 3WJ1A 1V49A 4YJHB 1S2LA 5AW4A 4GLJA 1FOEB 2L42A 4XYCA 3KYDA 4L4YA 4YLYA 1WXIA 1PYDA 2ZRHA 3ZJYA 3NDBB 1KH2A 1A5BB 3GAZA 4M7WA 1KRHA 4MAAA 5BYBA 4CMIB 3HEMA 1QK3A 3DEAA 3UCFA 4PC2A 4YCNA 3DFUA 2DM6A 1IAVA 4IIXA 3EVTA 4QOGA 1VG8A 1QF9A 3O95A 3WGTA 1Y98A 2C2MA 3HJNA 4ZCIA 1Q84A 4MQMA 2C97A 1U04A 4JBXA 4I4TF 1WMSA 2DFKB 1KKLA 3I6QA 2CKMA 4CR8A 4V0QA 2KN4A 1X14A 2FFJA 3H3JA 5FIUA 1LLDA 2WSMA 1VKRA 2BELA 3CBQA 4HAUA 2J1LA 3G68A 1HXHA 3O7WA 4IDHA 1C4OA 4ROSA 1XZBA 1JHUA 1M8PA 4N6GA 3OLWA 1UKBA 5IWAB 1C7ZA 4CT0A 4TMXA 1I10A 2JCXA 1XDGA 1FSZA 3ABQB 4U9IS 3PUXA 3DWGC 4FYPA 4HVBA 4OSEA 1KC3A 4UPDA 3GJ8A 1JFVA 2QZ9A 4CG3A 3EHEA 5ARCA 3CU5A 5HZMA 3OVMA 2JHAA 4HX2A 3P26A 4K1XA 1NVVQ 1VLJA 2YEPB 3DMDA 3GVPA 2I2XB 3U44A 3VR6A 3E2IA 2JIZD 2AN4A 2GN0A 3V1MA 3MMPA 2Q3JA 3RLIA 1H6CA 2HMAA 3NHYA 2FF7A 3OKAA 2CLCX 1CB0A 3AOGA 4HLUC 3BXPA 3VNUA 2NMQA 5IVPA 4Q4CA 4TVOA 3MZ0A 1ZQ1A 1OX5A 1DVRA 1JHMA 2O2EA 4MS4A 5DRTA 2Y0PA 1MDFA 3BCRA 1OC4A 2CBZA 4MW4A 3M6FA 5CX3A 3HDHA 2K8HA 2QLBA 4NX2A 1Z26A 4E1AA 4ZV4A 3C24A 1T5BA 4IJ5A 3HSYA 3W3ZB 4C2AA 4KQXA 1STEA 1GPNA 3SS9X 3Q2KA 4B76A 4PCLA 3HP7A 2Q2NA 2VZ0A 1C7RA 2TMYA 1EE2A 3QLVA 2I3GA 3RYTC 4ZVNA 1BQEA 1PSZA 2X8JA 1D8AA 4L22A 4AL4A 3IQIX 3PS9A 3PHHA 2XMZA 3FVVA 2PUGA 3SYRA 4TRJA 1ZN7A 1KO5A 1L8AA 2XVZA 1NV9A 5I7OA 1N0VC 4AYWA 1QK5A 2D3WA 2BI7A 1G2OA 3DWFA 4BNNA 2J41A 3ZDTA 3W4IA 2R8BA 3C8DA 4IHJB 3BREA 4MV9A 3K71B 2VQSA 2W6MA 3ZTTA 2YNMC 4TTVA 3N2LA 1DRKA 2ZLBA 3WQBA 4YDQA 3GZ4A 5L6MB 1JCKB 3PCTA 3GH1A 2ZRLA 3PC8C 2CV2A 1M5RA 2B1JA 5FP0A 1LSJA 2CHQA 2NUAB 2QPTA 2IZ5A 4QUEA 2V7BA 2B61A 3KJGA 5DWQA 1ZINA 5C2TB 1M54A 1XWWA 3L04A 1QZZA 4YUAA 4BJ3A 5JZVA 4C4SA 2CMDA 3E3NA 3A04A 1E66A 1RBYA 2IUFA 1IEVA 4XCQA 3E9ZA 4V03A 4ZQGA 3BWCA 3SZ3A 4F4FA 2KLHA 4IWPA 3NP7A 4BCBA 1GPDG 2MQJA 1C1YB 2ERXA 5CA0F 5F9FA 2GXQA 4OXXA 4NU6A 2ZEJA 10MHA 3VNRA 4RSGA 4OZCA 1M7BA 3L8HA 2FVXA 3PFNA 1B15A 3H4IA 2WLBA 2RSLA 4YIKA 2H5JA 3PGVA 1OH8A 5G5GA 2ZYTX 3QK0A 2GPBA 4MYHA 4MMYB 1GZDA 4Y9RA 3BQNB 1KJJA 2LGSA 4DPKA 1JI3A 1K66A 1C29B 5LP6A 2IP4A 2AC7A 4RCZA 1Q5WB 3GWZA 1NMQA 5JI3E 4MV6A 5I7AA 3IEIA 1P5RA 2B83A 4RL6A 3SCZA 3DH0A 3LPLA 4UNSA 1GTZA 3KH0A 2HJ8A 2VBGA 4OV6B 2JPDA 3VH2A 3KXKA 2X19A 5HTKA 3CXUA 1MGOA 5A6VA 4WOCA 1TLFA 3SFEB 2IOQA 3JAMA 4P92A 3GLHA 1GTG1 2BUCA 2KWUB 2GD0A 2ZTMA 4PXAA 1SU4A 4RA6A 3ZQKA 9LDBA 3OBIA 3WWOA 1BU8A 1IJFA 3MYYA 1O9BA 3NTQA 5AW5A 1G5PA 1USKA 5BMVF 4WPGA 1QHNA 4QPZA 2ZT7A 4BGDA 3VTAA 5CCEA 3L0OA 1IOLA 1TKCA 5ITWA 1NC1A 1RYNA 3IKVA 2RHOA 1AS3A 1OHHA 2WICA 4C7VA 1PGQA 4X45A 5KI6A 1USWA 1ZAYA 4PE5B 1J8VA 4XAQA 3CC8A 4MYTA 1N5OX 4XJXA 2IHUA 4LDTD 4R69A 2JARA 4F2PA 5EOVA 5FUQA 5B1HA 4A0HA 4GMXA 3HL4A 5C81A 1BDIA 3OM0A 3N8KA 1KO8A 1YKSA 2WTEA 3RNOA 2Z5GA 4ZCRA 4J90A 3K5IA 2ZUWA 3A1UA 2WFLB 1UBTS 2GD1O 4H1TA 1WIAA 2O0HA 2IXEA 2IQ5A 4NK4A 4N76A 3STHA 1E4OA 3OT5A 4OBXA 5K0ZA 3R7AA 3MYRA 1Y3IA 4RE6A 4KFSA 1KI2A 1MC4A 5T4BA 2BBTA 2IP1A 1ORWA 4GL4A 2HJ9A 5HKKD 1WABA 5CXXA 2BGMA 5DNWA 2EKLA 5F5XA 4YRAA 4A8JC 3RVMA 4BE9A 4BVBA 2Y0EA 3GMIA 3IPLA 4LBWA 5DTEA 4G97A 4UUPA 5HRCA 3U26A 2CXUA 3DPIA 1FVFA 1JMVA 1L5YA 5C1DA 2P0AA 3VXKA 1Z07A 4HJXA 5DBHX 1I24A 1YT5A 5JAHA 4ZVLA 1TIKA 1GQFA 4TXLA 1XCLA 2KFKB 2VHJA 1M2OB 7MDHA 3SR0A 3FDJA 1NSTA 1NF3A 2ATCA 1OZFA 2J7QB 3R9WA 3C48A 2ZUTA 1U63A 3FPGA 3OZDA 4DC0A 3TGPA 1C30B 4P7JA 1EFRA 5KOHB 2CFCA 1BS2A 1ECBA 2Q9AA 3L0WB 4CM9A 2EFGA 2QAIA 1JDJA 2HCTA 4R8LA 3KJFA 1PQYA 3TB4A 1DIHA 1M5UA 2KC1A 1V7CA 3I2GA 9LDTA 2WINI 3UAYA 3NOBA 1TA0A 1G7CA 4G37A 4MAFA 2WXKA 3UA4A 3FN4A 2BE7A 3H1PA 1NJ5A 1Z15A 4EJMA 2ZQ5A 3CG4A 1ACMA 2D4AA 2OXIA 1L8QA 4D56A 1XHFA 1MFPA 4PHFA 4JLKA 3SR4A 3SC2B 3X1WA 1TO1E 1WFYA 1JE0A 4REQA 3PRKE 1NFQA 4AK9A 3LXXA 4XDDA 2QAJA 2Y0CA 4DZTA 2Z58A 1N2BA 5A7HA 1VD2A 4I4NA 3JYQA 2GKGA 2EKPA 2HMSA 3D1LA 2BW2A 4EVIA 1DAHA 5CT9A 2HPAA 2O59A 5EXSA 3UOWA 2J48A 1TC1A 3TLCA 4CM6A 3D3WB 4L23A 3GJTA 2XMRA 4E88A 5AK5A 2XT9A 3O3OB 2XB2A 3WIBA 1YCGA 3GLGA 3P8ZA 1LV8A 3OPNA 1RWXA 4E3CA 4BVKA 3KZNA 1KFEB 2Q3DA 4ALKA 4MRVA 3BD8A 1YBVA 3KOYA 1M1XB 4BXOA 4YASA 2VTBA 4KJZA 2HA0A 2X8WA 1O97D 2KOXA 4MR9B 1YVEI 4DDKA 2RH9B 1N2IA 2Z8LA 3ZNOA 5FTJA 2J9ZB 1L2NA 3LW8A 2WVGA 3MXTA 1WUIS 2R6R1 1MOQA 3GRKA 1IG0A 1NV8A 1Z06A 1LD3A 1ZISA 3B3GA 3IQWA 2LFIA 1VG9B 5KYWA 3WFIA 3GW8A 1FJXA 3IKLA 5BWMA 2XVAA 3UMYA 2RDHA 2MINA 2NU6A 3H6GA 4PPFA 2CLEB 3KDPA 3M6IA 3KUCA 4I4TA 5A6SA 3S2UA 1L3CA 4E11A 2HHAA 1SMKA 1U80A 3UYLA 1VXRA 5DK6A 2FEWB 1T2VA 4AMUA 3GROA 4CM8B 3OEHD 1E79A 5G41A 2P1RA 5HF9A 1FRDA 3RS0A 5IWCA 1T4GA 2AMVA 3D6HA 1G21E 3E84A 1HDRA 4CLOB 4QBKA 3RS7A 2IX3A 1G63A 2FX3A 1Y4DE 1EG7A 3HM2A 1RWPA 3FKSD 4N7MA 1I35A 2EL9A 1VHWA 4JKYA 1VCOA 3AGQA 2KZRA 4Y9SA 4EI8A 3FE2A 3HRHA 1E9VA 4TV8F 4D4KA 3PS6A 3U62A 3GWGA 1BH2A 1P3QU 4MROA 5JDIA 1DGJA 4O6VA 2YOHA 4PPNA 4I14A 1KMCA 1IPGA 3MJ5A 1Z0SA 3P9SA 1ENYA 1T2EA 3GBVA 1DUVG 4Z8YA 3N2KA 3MHTA 4B3FX 1XEXB 3HABA 2PRIA 5JJCA 1T3QA 4B3HA 2ANBA 1XK6A 3NUHB 1U2EA 3O26A 4K9PA 1CR4A 3HL0A 3W8NA 4P08A 3DZGA 1R5OA 1HYBA 4D5GA 4MUKA 2IIQA 1RE0A 1V25A 2R6JA 3RWOA 4WLNA 2O2ZA 3EJ6A 2OV2A 5JCJD 1N1GA 1LPPA 4XYEA 1YB7A 2D2QA 3OCUA 2OM6A 4HDMB 2ZWPA 4K5QA 4IKPA 1RQ7A 3VX4A 1CJSA 1G8AA 4FR0A 4PZLA 1X13A 3NHUA 3WHLA 4BKQA 1EM8B 3P5SA 1P2FA 1WYWB 1HLPA 2MA9B 4DS3A 2HIGA 4YRJA 4X7MA 3LO5A 3E4DA 1T5SA 1HFWA 2ACVA 2AB0A 5TF4A 5BVGA 4DLPA 4HRSA 5CH5A 1H8ED 4F84A 1VPEA 2MHCA 1IAQA 4LV8B 1N2CB 2XN9C 1Y48E 1M34B 3R7FA 5KB3A 1N5RA 2WJAA 2OYCA 5FQOA 2EJUA 3RF7A 3ORFA 3FILB 1OXVA 2A84A 3P4SB 4UDXX 2BEWA 3S1AB 2FLKA 3A3YA 4BV8A 1VRWA 5JCOA 3WWCA 2O3RA 2PD6A 3PZRA 4IJQA 1SQFA 5CIYA 3L8DA 1Z73A 4H7DA 2KC2A 1ZKDA 3P2BA 3VU0A 1SUIA 3SEFA 4WZBA 3RUDA 3DDWA 1DJNA 4XD7A 4IGFA 3USZA 3T9LA 2RE8A 2I2FA 5EE1A 1KETA 4L8VA 2BWFA 1G55A 3HWX1 1Y82A 1VECA 5F77A 2FP4B 4KRGA 3CB4A 4WNAA 4YRKA 1ZAKA 2AT1A 5CA0A 1FK8A 3W2EA 1YS1X 3IMEA 5D3IB 3A9KB 1N0WA 1GLVA 4PRZA 2EKZA 2IQIA 4ESVA 1CXZA 3W4KA 1OH5A 3Q69A 3WLFA 1I5OA 3MP9A 2LJIA 2X76A 3A1FA 4RFSB 4MW1A 4ER6A 3MELA 2AG5A 3FSEA 2KB0A 3MTEA 4O1MA 4MUXA 4MA5A 3GGCA 2WAYA 2XWPA 2Z2ZA 5B53A 1CRWG 3N5CA 4PC3A 3DFIA 1TECE 3ZO5B 1WRIA 5ALNA 3PKIA 4C9BA 2ICAA 1AB6A 5CDYA 5B2EA 3O0TA 5FPKA 3UH0A 3TW8A 1F1HA 3GFFA 2WP0A 1TYAE 3LBFA 4TTIA 3BVMA 2BGTA 1YQBA 1BWRA 1NBWB 2PX6A 3WAOA 1P1BA 4V0NA 1IZZA 2CXOA 2IZ0A 3B1WA 4HZGA 3L5KA 5I01A 4G5GA 2GPTA 1WM3A 4DA4A 3AEQA 3RHTA 1YO6A 4F4IA 1K50A 1MJNA 4FWBA 1KYYA 3GPDG 3G13A 4TKZA 2OENG 2QTBA 2X1MA 3PLNA 4MWOA 2PU7A 2KANA 3ADDA 2C9WB 1PS0A 1OX6A 3ELBA 2OB2A 4IFEA 5DYGA 2QN7A 2ZRJA 3COZA 2GD2A 3MMZA 4LF5B 2D0DA 5BMVA 1YV9A 1U3GA 2VJPA 4O1IA 1RHQA 4M8LA 2K2QB 1U31A 3TJMA 4BO3A 4Q03A 2J53A 3DCYA 2YJTD 5HHTA 4LDPA 3L7MA 2OUKA 4DIMA 3ZYCA 1O54A 4OCZA 2OK7A 4WY5A 1E6KA 1W5EA 2HRZA 4HPWA 1WV0A 4EG0A 2R25B 4HWRA 4BBNF 2DZKA 1ESZA 1EK6A 3QPAA 3C7DB 3M6UA 1GKUB 2WKPA 3L3BA 5KQPA 5D6JB 3ZD9A 5E9QA 4K86A 4M46A 3C0KA 1BCSB 1MR3F 3ZXIA 2QUBA 5ULLA 1RZ3A 3V2GA 2CXQA 3H83A 4KX6B 3Q2OA 2QP9X 4ZU3A 4W5WA 4NBNA 3UHJA 3PGJA 4RY8A 4MSUA 3R7SA 2WKSA 5JV5A 3K1AA 1HYEA 3NZSA 3MJHA 2AR7A 1KDOA 2APJA 5KNCD 3QELB 3OIWA 4RZUA 3RKUA 2VHYA 2WOJA 5A06A 4WN3A 5CFQA 3A37A 5EWJB 2IPKD 5JVDB 5F2KA 5BV7A 3BHJA 1OFIA 2D1YA 3ROMA 4B74A 1VG0B 2VZ8A 3TLEA 3AESA 3WGJA 4OHFA 3ZHCA 4IIFA 1HE5A 1AQIA 3I0MA 1H22A 1U7XA 3WK5A 3P97A 3IRVA 1LX7A 3AGPA 2WMDA 4ZEWA 1ZIPA 1IL0A 4DLWA 1XMXA 3HCCA 3OX3A 2Z95A 4C7BA 1T3GA 2P6NA 2IYWA 4JZYA 3AWIA 1YB4A 4Z99A 1ZQ9A 1IB6A 2X4GA 1QHHA 2Y2VA 2C54A 3UQZA 2Y71A 1FEHA 4AURA 1FTQA 5BYAA 5CGQB 3WMGA 3LKDA 2GAJA 4JC0A 4DLUA 4YI3A 2XEWA 4K81B 2BGJA 4BCCA 3ZX4A 5JSQA 1YBMA 1CIJA 3G88A 3RROA 4FE3A 3WB2A 3WGQA 3AVQA 3SIPA 4JHXA 1ZJ6A 3HXMA 3N05A 1IFXA 2IDZA 2X6QA 1ZMRA 2PKOA 1M1NB 3A70A 5F3WB 1NXPA 3A6GA 1QAQA 3TIXA 4L5BA 1KP2A 1QG6A 3ZV5A 4UQPA 1U3WA 1F5SA 5AVKA 4GM0A 3GH3A 3IOMA 1R15A 3GP7A 1MP0A 3RYCA 5HFAA 2XGOA 2HLNA 5A5VA 4ZMRA 1U8CB 3KPYA 2C88A 2LD4A 4LWOA 2QVBA 4HTAA 3R7DA 4IUDS 2AR0A 3DEFA 1ZWLA 4E2YA 2Q7OE 2YHSA 4CIXA 1NGSA 2IKSA 3RG8A 3UMVA 3CWIA 1JDVA 4HPXB 2P4EA 3AERB 4EUFA 4O3MA 3EQ8A 4EAAA 4YMGA 3GG9A 5DIZA 4UBKA 4AJ1A 4H3VA 2CL5A 1U4NA 3W9BA 2XB6A 4WMLA 2O2VB 2ZOSA 4INJA 4LCDE 4M0DA 1OQYA 4BQFA 1PW7A 4KPUA 3V3TA 4LZWA 1X77A 4E5SA 1IN5A 4P7IA 1Z16A 4EYQA 3HRKA 3NNSA 1VL8A 5LOVB 3MFGA 4M1OA 1ZOIA 1V6EA 3NBMA 4NJEA 2F43B 1D5CA 3OI7A 2GETA 3A4MA 1V41E 1R7SA 3PNVA 2ZIZA 4TVKA 5T3UA 3KKZA 2FSSA 1UPFA 1X1BA 1VRCA 3ADKA 3M70A 3PICA 3EBOA 3K0KA 4J0EA 3HJFA 2K8BA 1CJMA 2A9JA 3I2HA 1D2GA 4DEVA 1JQJC 1QLHA 3STXA 1CK4A 3FZYA 2AFIB 4Y6PA 1F2VA 4RD0A 5AM0A 4HV4A 1U28A 4L3VA 1GAWA 4NIMA 3CQ9A 3KUZA 1VDMA 3BFKA 1ZONA 3FNIA 1B8OA 3CR8A 1G20E 4UEWA 4Z1OA 3QMMA 1FLVA 4ZI2A 4MVJD 5AHWA 1AUXA 2N9XA 4ZI7B 1WY5A 3WXMA 1VZ8A 2BJHA 3IJPA 4JFAA 2Z30A 1RC8A 2IYNA 3DTYA 1ILEA 1KIFA 2IU0A 3B2GA 4DSZA 3U31A 1RXWA 5BT8A 3RZFA 1D6MA 4EQ6B 3VYSB 3ZGXA 2E85A 3B9PA 3O21A 3HIZA 3P9PA 2IPXA 4WZAB 4UAVA 1YQQA 4GP9A 3NALA 3C74A 6REQA 1J5EB 2BCEA 3IT6B 4WNYA 3WGZA 1L9KA 4G3XA 3PYXA 3TX6A 4FFPA 1UBGA 3D5EA 3SFDB 1E9SA 1MC5A 3DC7A 2HCFA 4ARUA 3BORA 1HH4A 2J3HA 1YZNA 3UG7A 3X2SA 4D8TA 4TTSA 2BR4A 2I7DA 3HXPA 5EYPA 2ZBUA 4YSYB 1MQSA 1V11A 5BYQA 1MDBA 3OFSA 3LWZA 1M8FA 1T0HB 2Y2UA 3OPMA 4X61A 3HVZA 4PEVA 3QUCA 2QU8A 5LIRA 4G41A 5CX4A 1WMFA 4QATA 4MUHA 1VIMA 2FPRA 4MQ6A 4NMWA 1ZXLA 3GRPA 1F9JA 1DT3A 4MCAA 4TV8A 5L6LB 5TPZD 1DCMA 1S3GA 3U7QA 1JDTA 1BD4A 3Q9NA 2ZJBA 3QE3A 4URFA 4KO1S 3G49A 2IPAB 3R2JA 4ZT3A 3V4PB 1ZMTA 3G8YA 4HWGA 4ERNA 2VJNA 2ADMA 4TQAA 6ABPA 1DJMA 4BNTA 4E1VA 1Z6AA 3RC2A 1ZE3D 4CU2A 2FZVA 3ZDZB 2PH3A 4LY3A 1G4HA 3FPBA 4BNYA 1OTXA 1UBKS 1YVDA 1XTVA 4QUGA 1XTIA 5GM2A 1RWOA 3BE6A 3TMYA 2G70A 3ZWOA 4C29A 4DDID 2ERYA 3KSUA 4OAPA 5FOQA 5AKGA 4N0EA 1Z2MA 4BUJA 3MTNB 9MHTA 4ZIRB 1KJ8A 1O8BA 3ZIAA 5H70A 3AIMA 1S89A 3FJYA 1UIMA 1AGXA 3A6KA 2IX9A 3HWRA 1D2RA 2O07A 1JEAA 4WD3A 4EFKA 4Q7MB 1U7WA 3RC1A 1NVTA 4ND7A 3T9FA 2XCQA 3M4XA 2UZAA 4PYLA 2XSZA 3SEBA 3DBRI 3NM6B 4NEGA 3STTA 4K6HA 4PTYA 1YC2A 2G1UA 1D6SA 3MBKA 2J8ZA 4JLNA 4LNUA 1ZMOA 3HZRA 2MRPA 2OOSA 1JSRA 4M1KA 4FDMA 2C4WA 1Q11A 4QRIA 1ODCA 3E35A 5ECWA 3WFZA 1EP1B 2H9AA 4OGGA 1W59A 1JG1A 2V7VA 1AZLA 2OCXA 3PC7A 3FDZA 2GBCA 4XVRA 3EYAA 5IKMA 3JYUA 4JB2A 5AFSA 3JS5A 5H8YE 2LV8A 4LF9B 4OB8A 4IL5A 3Q40A 5AK3A 1BDBA 2UUCB 2EKDA 2GR9A 4RVCA 2NT4A 3AIOA 4E31A 3UA3A 2LRHA 4ZAYA 4L4RA 5REQB 3K16A 4JH0A 1SKAA 3I6IA 2BMJA 5D00A 1GNPA 3KALA 1W35A 4KXLA 1XPJA 5TQ0B 1XDSA 1NURA 2B8NA 3VDMA 1T2NA 2PT7A 2PJHA 3QTLA 2X0EA 1TO2E 2HSJA 4U7GA 4YQYA 3QX1A 1UBSB 3LKZA 1XTTA 4L02A 4B48A 3OETA 4GMGA 1H5QA 1VCIA 4NZOA 1Y5LA 4MM3B 1QJCA 4XIGS 5DLDA 4Y6SA 1YL6A 5JTUA 2BYTA 3VNBA 4RCYA 2GO1A 2QTTA 3I5XA 3QH4A 3PRHA 1DKOA 4XDZA 2BGUA 2GBJA 3EVAA 2NTJA 2O2SA 1XSEA 3IOYA 3S5JA 1U8UA 2IFTA 1ISIA 5CEJA 3JCZA 2BHTA 3PRPB 1TGVA 1OT3A 3Q3JA 4U3JB 1N9KA 1M0WA 4L4SA 5LLIA 3COPA 1W4CA 2VKQA 3OHMA 1H2HA 1RQXA 4KIFA 1U0FA 1XOIA 2AQ3B 1L4FA 1RPJA 2JIQA 3D31A 1OQAA 3DOJA 2NS5A 1Q57A 3G23A 4MRNA 1XX6A 3H1AA 1RJ9B 4X41A 5AW3A 1KH0A 1E1QD 3H18A 3CW2A 4KYTA 5EJGA 3HK2A 2VJKA 1GO2A 2XW6A 4AXXA 1AHHA 3AEGB 1ZH8A 4F7ZA 1DXYA 4FYIA 2QMQA 1G3UA 2R96A 2WFZA 2ZUUA 3DAFA 2WHXA 4LRWA 1NF2A 3URMA 4YP0A 4JYPA 3OQOA 5ETJA 2JRHA 3BJZA 3KWFA 2QJTA 2VATA 3ZWQA 4LWQA 2Z4TA 3ZZ1A 2AJLI 5D01A 1RNLA 1T35A 4CKBA 5E7MA 2VZLA 1BMFD 2ZTLA 3W5BA 3VH4B 3CNOA 3K9NA 3BMOB 1BUIC 3PX7A 721PA 3AXCA 1MRSA 2PGXA 1P9NA 4RBNA 4YLEA 1XZQA 3PC2A 1WMDA 1ZN8A 4QFBA 2PMDA 2VDPB 3FZGA 2JGRA 3R8FA 2D3GA 2ZK7A 4C4ZA 2OCYC 3FHTA 2NTVA 4LHWA 2DRIA 4KFCA 2Q27A 1B0UA 4J4HA 3LNCA 1RZRD 4MDHA 2WFAA 3F3YA 2BHRA 4NU5A 1QIDA 4B4OA 1VRAB 3I73A 2NAPA 2IV3A 4KQHA 1G5HA 2DUUA 5EQFA 3SS7X 4BZXA 1EVJA 3RM3A 2BRUC 2EP8A 4RYLA 1P75A 4P4SA 3RRMA 1T6ZA 1GUFA 1GJZA 1RKVA 1F38A 3CVYA 2AXNA 2KX7A 2UVPB 1PFQA 2NO6A 3E9MA 3O7MA 3ZY4A 2MJEA 3HE3A 1AJEA 2EFCB 3EXFB 1AXGA 5D3MA 3DQQA 1HZZC 2QVXX 3K15A 1OQRA 3CFYA 4LK3A 1G6Q1 1C0LA 1SVUA 4DXDA 4CMAA 1I4PA 2G0AA 2J3DA 4XC2A 2VDWB 1W8IA 2Y66A 3KJIA 1YB5A 3Q8EA 1E6CA 5AHOA 4OI1A 3FYCA 5KNDA 2BFNA 3RH0A 4JX1C 3V46A 1PQSA 2NQ2C 2QLFA 5CYOA 3PIRA 1YE5A 4CTMA 1TYEB 3TLXA 4AG5A 5KTKA 2K7ZA 5IT5A 4OA5A 1EA5A 2PKWA 5CP8A 3VUEA 1I2AA 3D5TA 5GVSA 3U2SC 3UJHA 3VDNB 5D8DA 1T6BY 3V8RA 4AZSA 4QBTA 4OP3A 1ZL0A 3CUTA 4V38A 4QTUB 5LQSA 5AR1A 1RXYA 3CJTA 4E46A 5B2ZA 1Z75A 2CLIB 5T6BA 5H1YA 1FUYB 1WF6A 5JBIA 4UC0A 3GVHA 4MR8B 2Z6UA 1MHHE 5CB6A 5WRFA 2N1WA 5KHOC 1P45A 3BIID 1FPQA 2H00A 2H51A 5ESWA 1T0PA 3GJ6A 3ZRFA 4MQUA 3WIEA 1Z45A 3NIWA 3N0VA 1AUPA 1TYGB 4NBLA 1BFUA 1Y5NA 3JR3A 4AT1A 4G8DA 1JLSA 5A0FA 2WWVD 2ZI4A 5JDCC 1N3BA 1UXKA 4TUYB 4N47A 5ICGA 2FRDA 4EMBA 3QARA 3L0ZA 2K5UA 4NMXB 2B6HA 1J8CA 1G60A 3NBFA 3DUFA 4E5UA 3L4PA 1QSGA 4N1AA 2UXBB 1CDEA 3SZUA 2JASA 3TD9A 1ZJ4A 1RYFA 1RYHA 2WSBA 1XXGA 2B9EA 1OLXB 1NLUA 4DDUA 1QHXA 5INTA 3Q3MC 3P20A 3IQZA 3LUPA 4S1NA 5AW9A 2KJRA 2I6TA 2W2LA 2LGJA 4IV5A 2G71A 1K52A 5A3SA 4HTFA 4YAEA 1YJQA 3KT0A 2AD5A 4MVJM 4QYWA 1SKYB 4UTVA 5I7HA 3C6BA 1KSGA 5DBIA 1TIPA 4KLRA 2BEVB 3ZHYA 5A71A 5LBTA 2KX3A 4PYJA 1XAJA 2PGJA 5EP1A 4TXNA 3VFKA 1KJIA 2RC5A 1AMUA 821PA 3HCBA 1GG8A 2CHUA 1PD0A 4B40A 4CV3A 1MOZA 3R6DA 4FZ3A 1N77A 3FOWA 5J1SB 3G9QA 4ZVRA 2Q0XA 2ECKA 4CGZA 1ZI8A 5C7OO 1HTWA 2O2JA 1UZUA 1HOXA 3EXHC 1UC4B 1HE4A 3AR4A 2VRCA 2JX5A 2AG0A 5TLSA 1SG0A 1RFAA 3A4NA 1PV1A 4LDQA 3IUQA 1KARA 4L9RA 4HDRA 4RKQA 4O2BF 5LL6P 4M00A 2CLDX 2QI9F 2RH8A 1LRKA 2ATVA 5CXUA 2P9TA 5JSFA 3QLUC 4LHEA 4FW8A 2OSBA 3DVQX 3LCJA 4FOLA 3QY0A 1Y6JA 1KO4A 1J25A 1LNQA 4M89A 4ZC1A 3KTDA 4QNMA 1RLFA 1ISSA 3VPDA 4DUGD 3ROQA 4RTSA 2PA3A 4ZVMA 3U0VA 2H5EA 2M1MA 4FR5A 3SYNA 4HB3A 1Y8AA 2PUDA 3EH1A 3EVBA 2YV1A 3BIXA 4AQDA 1MF7A 1JAXA 1UM8A 4HB4A 2CSXA 3T9DA 3D4BA 2AZTA 1ZBQA 5KOJB 4MWSA 4DZRA 4YO8A 3KWJA 2V3WA 4H18A 3PE3A 1U5BA 4OQQA 3TEJA 1B1ZA 1N2ZA 4Y1RA 5E9JA 4Q9AA 4RYDA 3RYIB 4MKXA 3JD0A 4KGTA 4NVRA 3DKPA 1L0VB 2E1PA 2R9VA 4PW0A 3B1JA 3CH4B 1JMKC 3IHTA 1O95D 4IM0A 2PVGC 1AZSC 2JI9A 4Y6QA 3V1UA 1Q7BA 2R87A 3NATA 2RDMA 4YRSA 4AJWA 4GYWA 1UWXA 4G9EA 5DCNA 3NFRA 4IDIA 3NORA 4DRXA 1V1MA 2VSNA 3ST7A 1QGED 3L7BA 4LI3X 4J0KA 4ICUA 4GYYA 4QNNA 3RS5A 5DCWA 4P1CC 3GJ7A 4DVJA 1WU8A 1GITA 4PLWA 3LGAA 2REQB 1SIFA 3TZ6A 2JLZA 3H2HA 2IIPA 3RYFA 3F2VA 5C1ZA 3WLAA 1M0EA 1KEVA 3AQ4A 2OV6A 3ROXA 5A4AA 2JA1A 2HY7A 3A9UA 4W9MC 3LP6A 3I2IA 1EDBA 5EKSA 2B34A 4ER7A 4Q0MA 1XUOA 3DAPA 2CCKA 3HJAA 3IQXA 5GQSA 4E4TA 2H0AA 2VBIA 3GRFA 1CS4C 2Y1XA 4DJTA 4EKYA 3U4CA 3DLHA 5B1IA 1QP8A 2ZRBA 3RS8A 1DBSA 2GPNA 2JQRB 1L5QA 5C3MA 3KT8A 2AOVA 3CKLA 2ZSEA 1WXEA 1DJLA 2DJ5A 4FZJA 4I6PA 5BWLA 3AB3A 1XA0A 3OOWA 3BHIA 3DM5A 3OFJA 1YCDA 5L3VA 3SLGA 3BTVA 1TT7A 1F48A 3NEAA 2XVXA 3OM9A 2V4ZA 1TUIA 1T2DA 1VKOA 4PU0A 5C1BA 1V16B 4IIDA 3ER8A 4TXMA 2H8KA 3TBLD 1C81A 2A57A 4S05A 3SG0A 5DI3B 2LKCA 3ZGVA 3TIFA 2I2WA 4DJEC 2DAJA 2QRHA 3GQBA 3CB2A 2INCC 4N5LA 2WBLC 5ALFA 2RHDA 4CFZA 3KJHA 3H9GA 4ZZ0A 1CWUA 3K32A 3OA0A 3TIVA 4Y2RA 3P4RB 2IF0A 2DHZA 3VTWA 1AOXA 2NW6A 5J17A 1PYGA 4ZDIA 5EY5B 1KYWA 4MKFA 3N8NA 4C43A 4FN2A 3H8SA 1FB5A 4BV2A 1I2DA 1T13A 1NTOA 1JXAA 3NH9A 1USUA 3HYRA 3GUCA 1J7BA 1WX7A 3JD4A 1WZEA 1TF5A 1EO6A 3C4VA 3VR2A 4MX8A 3COWA 4H7IA 2IXFA 3C6XA 4FINA 4TLBA 2BFWA 1CUZA 4OQEA 1KJZA 1QGUB 2IHBA 4CL3A 3M4JA 3HU2A 2AA3A 5C23A 1KY5A 3KKLA 4D8UA 1IZ7A 3STVA 1U0NA 1DX9A 2FMTA 3EWNA 4M9QA 4FYKA 1OWMA 1RQGA 3EQ2A 5LQAA 1H8CA 3PEFA 3HR7A 1QGAA 2ISSD 4WWPA 1AYFA 2DWUA 3QRWA 3IELA 1I1OA 1X2EA 2O3QA 5AI6A 4UHBA 1UK8A 4QUDA 2BMDA 1X7WB 2BB6A 4KQ9A 3BILA 3SQMA 3R24A 2AQKA 2ZUEA 1VZ7A 1FFSA 1ZR2A 1JU4A 3SZGA 1DBQA 3ZVKA 5D1HA 1FSSA 2O2XA 1M83A 2GYYA 5HJ5A 5PGMA 3I6MA 1BXRB 1RRMA 5K03A 5LYJA 3V9AA 4YTEA 1Y6FA 3PTLA 3ROFA 2WXFA 1U90A 3CF4A 3PX3A 5GP1A 1U1IA 2YRFA 1VR9A 4QKQA 3R5XA 4LC1A 4GX0A 3PZDA 3QIJA 1T4CA 1HDCA 1VPLA 2JIOA 4GWGA 4YH1A 4UM9B 4TKLA 4DKXA 4QTZA 4TM8A 4IVRA 4ZKEA 5TQ2A 3U3OA 1K86A 2V0GA 4UAGA 5EL0A 5D3ZA 3NKLA 3SOZA 2AFHA 2P9YA 3H6KA 1PR2A 2P9ZA 4GIVA 2RGEA 1YZKA 4H7JA 1SXQA 3PUIA 2TECE 1TCBA 1YKGA 4EL5A 1I4RA 3ESRA 2H1OA 4ZN6A 3QLVC 2QR2A 1TLLA 4BFXA 4GPAA 2R5NA 4M0MA 1MC1A 4A0RA 4KZPA 3JY6A 2RHWA 3HR4A 3EXG2 5BSMA 4PX9A 4MMZB 4H15A 4FYYA 5JD5A 4C1BA 1L1EA 4BJ1A 3X2FA 1ID8A 1P9WA 4J1SA 2BBOA 1T5TA 3AI7A 4O29A 1VP3A 4ANFA 5IKCM 1NONA 4JMLA 5B12A 1EXDA 2DLCX 3NC4A 4M37A 2I99A 4OIFA 1JSLA 3LYAA 4OYHA 3RRZA 1WX8A 3L84A 3HKDB 5AVSA 5CDGA 2WS3B 4M88A 4K3UA 3OD1A 4ZYYA 2E6KA 3H7PA 1L7EA 3S2GA 3ZD7A 1MO6A 6ADHA 3HXKA 3MGBA 2MCFA 4GXTA 3V32A 5KOYA 4CM4B 3NCTA 3UAVA 4H4DA 2JFUA 1S2IA 1UWLA 1TM2A 1EESA 1DC7A 1VKHA 4MKRA 5A62A 3RTBA 1HE1C 4QUIA 1V47A 1M1YE 2WVHA 3TJPA 5COAA 3F73A 1P6QA 3RODA 3D6AA 3QUBA 1PSWA 2O0MA 4Q9NA 2X8LA 5L45A 4AKGA 1YZGA 2R44A 2ZREA 1JU3A 2GBLA 2V3VA 1QQ7A 5EA2A 5JS8A 1MQ9A 2YWFA 1N5MA 2OFPA 3UFXB 4IIBA 3WL8A 4AP9A 4NFSA 3SZLA 2IBIB 1QZXA 2WIFA 3C3AA 3I9JA 5JMTA 4A0SA 2RK4A 1Y63A 3UJDA 4BV3A 3BB4A 4MVWA 4BMYA 2WXJA 4UVHA 1NZJA 1Q0HA 3ZS9A 2UZ1B 5ENVA 3SDZA 1WM2A 3ESAA 3WJAA 2JEZA 4UUNA 5EJIA 2KDIA 4G50A 3GAAA 4FOPA 5LP6C 1WDKA 2HHCA 3WGUA 5CVUA 3VAZA 4UCWA 3JWIA 1GQOA 2B4TO 3V6MA 3FROA 2QX7A 1Z83A 1G1MA 1VJGA 1D03A 4PGFA 1E5XA 2BFEB 1IJEA 2QL9A 1SE3A 1DADA 3EPRA 2I0FA 1W4RA 2JBAA 3LT0A 1W0KA 3GA0A 5TMEA 4R1QA 1E58A 1QKIA 2KJQA 2WTBA 1DJOA 4I19A 3OJXA 4AKHA 1YJIA 4ENVA 3GRVA 4UOQA 1K5GA 1SC6A 1SAYA 4LXYA 1MQAA 3SDLC 5F3RA 3CUYA 3B8EA 4AF7A 3SVLA 1L5HB 1A8HA 5FA6A 2KBEA 5BQXA 2G1AA 2OG1A 5AXAA 2O8NA 3NAGA 4OUDB 2OCIA 4XFJA 4GOND 1E3WB 4B45A 1HLDA 3AI3A 1G3MA 3NTUA 5ITSA 3EAFA 4TVBA 3G2QA 3VHLB 3AP2A 5BRNA 1T5OA 4XYLA 4IRMA 4BU0A 1MJDA 3HA2A 3VJLA 1TPYA 2MR6A 5IKXA 3GJ4A 4I2NA 4J6IA 5CLHA 2EKQA 2IC5A 1P17A 1PQ4A 4WBXC 4CLRB 5IH3A 1WAMA 4O2RA 4GZ5A 1RR6A 3WL4A 2MTBA 5C8YF 2KD0A 5HCIA 2NO5A 3ZDEA 1XJ5A 2DFTA 1WY8A 4DIEA 4CF3A 2AYZA 1DAEA 1E7SA 2PWZA 2F00A 3P7MA 3GZNB 2HB6A 2Q1TA 1SN7A 1JDSA 3SICE 3OZAA 2OILA 1TM7E 4GICA 2Z04A 3RTEA 1D3ZA 3IVFA 2FX5A 2I6SA 4PQRA 4HUJA 4JYMA 1I1QB 2Q7XA 4ZYZA 2NM0A 3OOSA 1NE7A 1HE8B 3S2ZA 4PR3A 2WDQB 3LXFA 5F51A 2DWQA 1JIKA 4ZICA 4JBGA 2VRBA 1C4AA 3IMFA 3T3NA 1QTRA 4I3FA 3SGLA 3QKTA 3NBZC 1KI3A 4MELA 3EFHA 1Z5OA 3EUEA 3RHZA 2OBLA 1F2UB 4LWPA 3LWDA 4NFHA 4ZARA 3H0CA 4IM7A 2TSYB 1AQJA 2BP7B 4P4TA 5HOEA 2H54A 1S1QB 4BQNA 2DQKA 4EFDA 3OD5A 2XJ4A 4N0QA 4DG8A 1UH6A 4GKJB 4RW0A 1DC8A 3G89A 4V24A 5KQMA 1CRQA 1X7HA 3TW4A 4I08A 4C20A 3RVQA 4TZTA 3EZLA 4X1IA 1G8GA 4S1OA 2Z83A 4HQLA 4L6CA 1P39A 2NMVA 1JBQA 2WLTA 3DAYA 1IYFA 2XZTA 1KJQA 2VXBA 2WXMA 2PA0A 4QGBA 3LSTA 4FS3A 3WK9A 3E7PA 5DGDA 1JPJA 1CZOA 4ASWC 3CEHA 1GUAA 3ELWA 4A92A 3HG7A 3QZUA 1RAAA 3L7AA 3NHBA 1AURA 2ON6A 1P5JA 2CHXA 5BYRA 1ECLA 2P5TB 1DXHA 3CEPB 5H81A 4DR5B 4P4GA 3VO8A 2XNAC 3QXSA 3PP8A 1X9HA 4H1HA 1MJ5A 1NMZA 4BKGA 3M49A 1UIRA 4QC2A 3PZ8A 3ODPA 1FFWA 4RAOA 1JRLA 3DD5A 4UFOA 3MTQA 4RK4A 2WKWA 4UFPA 5EP2A 2CMHA 2ZZPB 1MJFA 1P60A 4R1NA 3TS1A 3O8OA 3WQRA 1HWYA 1B6TA 6YASA 1N3IA 3C3YA 2YYSA 1C9MA 1O89A 3ICPA 4UM9D 3CNQS 3SP1A 5LU8A 1IUOA 3NHEB 5DHSA 1JIIA 2LHEA 4J29A 1WXGA 5AM3A 4GI2A 4LOIA 4FYMA 1YQ3B 2XE8A 3O74A 1Q10A 1IOVA 2XYQA 3NHFA 1C7QA 3H5WA 3GMTA 5IM5A 3Q14C 4Y3UA 3W6NA 1QLWA 1A2OA 1JQDA 3SZMA 2BAGA 1L1RA 1NKSA 3K8QA 4Q34A 1GC7A 4C7JA 5KO2A 1L5LA 3TSCA 1XE3A 2NP7A 3NS1A 2BC9A 4WBNF 1CD5A 4CJXA 1ABBA 4DV3B 4W1RA 2C95A 4LDNA 4KMRA 2BMFA 4NAVA 2FQQA 1SBTA 3KQMA 1V4NA 2ZRIA 5F7XA 3TI9A 3KSMA 4LQ4A 5EPOA 2GLXA 4CNBA 1EUCB 1Z13A 1LTKA 3LUJA 3FCEA 1NP6A 1P7WA 1XMJA 3FH0A 4RDIA 4MRPA 3LXMA 4UEQA 1ZC3A 5KWSA 3UCXA 2QLJA 5KYUB 2A14A 4MQBA 4GRAA 1V1RA 3DVGX 1T0IA 3N6RA 1CY8A 1OLUA 2LEKA 5SY4A 3OO1A 2OC9A 1Q12A 1K7CA 4G0ZA 2C84A 3Q3FA 3S44A 1NDQA 5GINE 1XZIA 3D6NB 1WETA 3VOBA 2AKEA 3GUVA 4IBOA 4QUJA 1T9AA 3R7WA 1H66A 1K8ZB 3V61A 3U4EG 1KLVA 4C07A 5A3QA 5JAOA 3KVRA 1IBXB 4HSGA 3U3MA 4MHSA 2X2FA 3E70C 5J3JA 4EYSA 2ZAMA 4K9KA 2RHCA 3KCQA 3VOTA 5G5HA 3RVKA 1Q0ZA 1TBEA 4FB5A 1DKMA 3KDAA 4IDGA 4OLJA 1A96A 3R5TA 3E4CA 3ZI4A 4NZMA 3C4QA 3FB1A 1I4EB 2WJZB 4WVLA 5LC1A 2ZVNA 3AJDA 5EIHA 3PCXA 1IVSA 1WXVA 4PHGA 4Q1EA 4OX9Y 3IAHA 3OTHA 4GGMX 3K8YA 3DE6X 2ZS8A 4A5SA 2VSXA 1MPXA 1D4BA 5CLIA 3JRXA 4FFOA 2BYVE 4JJ6A 2PMWB 3EGXA 2FXIA 5JDIC 5L7YA 1JFSA 1C9NA 1H0RA 4NQZA 3CRW1 1AH2A 4GKAA 3GJZA 4YK7A 5IVHA 4B3MB 2YV5A 5AW8A 2EC5A 4GW3A 2JLWA 1QHYA 1CY0A 3I64A 2B20A 3VO2A 5KSZA 4ANWA 2IEAA 4TMAB 4JL5A 1XRQA 1C0IA 2XTZA 4CEJB 3RAJA 4MUAA 1OWOA 3JRNA 5FYDA 5ENZA 3EOZA 1I6WA 1XPOA 2RIPA 3BBLA 3JWPA 2J3EA 4PPQA 3UPDA 3RSSA 2GEVA 3AI5A 1S2DA 5CURA 1UKCA 4AY3A 2V9ZA 3WSWA 1CYDA 2C7HA 5DF1A 4PZ0A 4KGVA 4YPVA 2IHYA 2JCGA 3DL7A 2KMLA 2IS1A 4ZRIA 4N12A 3L08A 2BGFA 1QUFA 4DDTA 3WYAA 1MENA 1EBBA 5HEKA 1EHIA 3HKEA 4RHCA 4XLZA 1Y80A 2J0EA 3D3NA 3F47A 3VKVA 3QEMB 5JSKA 3T8YA 1ZUNB 3HU3A 2ZT8A 2Q50A 1ZS9A 4GI1A 1TJEA 3CJRA 3LC0A 3VU3A 3IJEB 1A70A 1TKRA 4IIJB 5K51A 5K8LA 3X2EA 5JCOC 3Q4GA 2M19A 4UD6A 3TQOA 1YN5A 1NVKA 2AX4A 2VUUA 4FUTA 4QDTA 5L3SB 1YOVA 1CZLA 1JW9B 2GAOA 3G7SA 4M8KA 3OEEA 3EA6A 2GLUA 2PPVA 5JYDA 5DNVA 4AIIA 2B82A 3FLAA 3NTVA 1QRUA 3ERCA 4AJPA 1QV9A 3UV6A 4IV0A 3K0FB 2A9PA 4TWAA 2D7CA 1X3SA 3FNEA 3QI2A 3RQIA 2PX3A 3UF8A 4AO6A 3MSXA 1GZ5A 1SXGA 1Q20A 1W49A 4MUYA 4WFIA 1UMCA 2YW9A 4JT2A 3QX7A 2EBUA 4HCNB 3Q7EA 1XZEA 1QR2A 4LRQA 1NXWA 4UU0A 1XALA 3LQ2A 1OXXK 1K8QA 4V0LA 5FO0A 3VPBA 3KLMX 2E4ZA 2GN6A 1N4AA 4F3KA 4YJ2F 1N7IA 1CP2A 4ALIA 3KXPA 1T8TA 5GJBA 1Z38A 1VIVA 4DXAA 1WDLA 2AEJA 5DN6D 5FBKA 3CEMA 5CITA 4IDNA 2P0YA 3PA6A 4UM5A 2FPIA 3ZH9B 4QVKA 1K2WA 5JHHB 4D0LB 1VA5A 1P4GA 3QKRA 2DENB 5JT1A 3VNSA 3HKCB 3LD9A 4NS1A 1A2QA 1NJ2A 1KEEB 1UBRS 1ZNQO 4Q4LA 3PUKA 4GWLA 3BC1A 4ZYSA 3N2ZB 5AUQA 5AH0A 4AQYB 2XXAA 2PVPA 3D7NA 3NANA 2A5YB 2COUA 4E74A 4O2LA 1NYTA 3ZV3A 1JAIA 4J2TA 3UXMA 3VTKA 3JPYA 5AVRA 2KDBA 4MYUA 1WSDA 2WYWA 1Y4AE 2JH3A 2XKKA 4YTPB 2JGLA 4RIIA 2HA6A 4J49A 2UV8A 4PX3A 5KSWB 5K2OA 4NECA 1X7XB 2YMMA 4A6PA 1JHYA 1QYXA 1E8MA 1ESNA 1W2HA 3H2SA 1CV2A 4OATA 2OT3B 4JPSA 3SF0A 1BA2A 4R98A 3B9QA 4KN8A 5CUQA 4JOSA 3AR7A 4PIPA 5C8YA 3D4PA 1VE9A 4IEFB 2FW7A 1A2BA 3EZ2A 1PZMA 4UVEA 5IAJA 1M76A 3DOOA 1XYYA 3LLUA 4IIEA 1M75A 2FTKE 4Y7DA 2DVMA 4NV3A 3D43A 2RGCA 3P2KA 3NMUF 5K3OA 1KE1A 3KQOA 2H4JA 1KIMA 5ENDA 5K09A 2R5WA 4N59A 1PZEA 1FS6A 2J46A 4X66B 2WYOA 1Q2XA 8MHTA 1JIVA 4B2LA 1AN9A 4BB9A 3U7ZA 2C9OA 4DE5A 3S3TA 4XUDA 5JNVA 5FORA 2JHCA 4OHZA 2N75A 1U9JA 2WG1A 4UTXA 4TSKA 3H5TA 3Q3HA 1IHOA 4L0DA 4D9HA 1AN0A 4FNOA 3R76A 1R12A 2KHWB 3K0CA 3G6WA 3OAWA 5A5EA 4JLVA 2GN4A 1U3DA 4N5IX 2AVNA 3OFND 3OZFA 1VYHA 2DHRA 3FVQA 5T4HA 1DNPA 2XUDA 3T9CA 2Q3BA 1I4TD 1Z2DA 3TINA 4R2JA 3ILYA 4PHHA 2PX0A 5EHNA 4YRBA 2VYFA 3ANSA 2CNNA 2QDXA 1RCFA 2OFXA 2E5WA 3N3BC 1IUPA 3DWMA 4E21A 3TOCA 4F6LA 4KQWA 5FUVA 2B4KA 4K9OA 4XTRA 4KRXA 3VOAA 1YBFA 3K53A 2OAP1 3WNZA 2Q45A 1S01A 3E9RA 4DYDA 1WW3A 3Q6NA 4REMA 4YSZB 2ZQZA 1SQ5A 1ETHA 3U4QB 2FN4A 3UT6A 1ZMBA 1TTQB 4FWTA 2RHHA 4JR0A 3GXOA 4BNFA 3GPIA 1QYWA 3LG2A 3ACDA 2OJRA 3SQOA 3T5CA 4BC0A 1VCBA 2IH2A 1YE8A 3DKKA 1TYZA 2W58A 4XWWA 4TYPA 1LZLA 5D5QA 3S8MA 1CQPA 2WSSD 5HPYB 1JT2A 3G82C 3GUHA 4XFKA 3EUFA 3ZKWB 1FP1D 1BHJA 1RYMA 4I5FA 2GA9A 3N8GA 2NVOA 1DXQA 1T8SA 1ONSA 3Q11A 3N76A 4DQOC 1U0SY 4LC9A 1I4QA 3ETCA 2IYXA 1ST3A 2VWPA 5IYZB 4KRFA 2YYYA 1DJQA 1BHQ1 4D9GA 4HLCA 2R1TA 3AI2A 4LF4B 4LGCA 4KH1A 1ZY2A 1LEHA 1RCUA 3GIDA 1ZA1A 1FQOA 4OJTA 4BNIA 3CLUC 4N6OA 2DLBA 1VI5A 3T7TA 3A7DA 1XKTA 1N1MA 2MLBA 2PGOA 1WUYA 4R9UC 5MGBA 1D6JA 3MUNA 2A0YA 2IJ0A 3VVWB 4PHCA 3OEHA 4QYIA 1U8XX 1MG5A 3UMJA 1B23P 4KX5A 1T2UA 4D3ZA 5JAIA 3SD5A 2FUG6 3GGGA 1EEHA 1U28C 5AVUA 4MA0A 4WBNA 4PSVA 2BMVA 1BMTA 1TK2A 4MQFA 4YDRA 4FN5A 4KBFA 1EDEA 2LP4Y 3WGOA 2V7UA 1GEGA 2BD0A 4QFMA 4M55A 3UK7A 1CSEE 3HYNA 1C4WA 3FFBA 2D3BA 2RPQA 1Z2NX 2VPWA 4Y0NA 3T99A 2J0UA 1Y6ZA 2OGUA 2X2EA 3R23A 3MINA 1ABEA 2HXYA 4FSXA 2HLPA 1OBFO 2V7PA 4P32A 1TVMA 2OD2A 3CEAA 3MCAA 1JW9D 3C8YA 2DZMA 1Q1AA 4X8MA 3UUWA 1SEPA 3DVAA 4FGUA 1LKZA 3JALB 3I2FA 2NZ8A 2J9RA 1ENZA 2JAUA 4BLTA 2Q2WA 4D4IA 3ZU2A 4CN9A 1U1CA 2VDMB 4A6QA 2QXYA 3DE0X 4H1VA 4BVHA 2O8CA 1GTVA 4H16A 1YB1A 2Y5PA 5IK2D 3KOXA 4J9UE 4MJ3A 4R9SA 2ET6A 2OHXA 4TM7A 1NY6A 1WA5A 1KHHA 3E81A 3ON5A 3BRQA 3ZY2A 3ADBA 5B3JA 2CN1A 1HEZE 1RWNA 2QAGB 2NV2B 3H6HA 3SSAA 4RZHA 1O94D 3G0HA 1U0EA 4ARVA 1SXJB 5TGZA 2OR3A 1PZXA 3BKXA 5L7TA 3CTPA 2W43A 1E6EB 2XVMA 5KYGA 2CJWB 4B7AA 4CKEB 3JVDA 3X1KA 1LS6A 3FPLA 2ILTA 2OO3A 4NYIR 2UKDA 4WW0A 1B16A 4G5SA 2BYFA 1FSPA 2PBLA 5KU7A 3TLGA 1O57A 2J59A 2VHZA 2DKFA 4PGHA 4HMQA 1PV4A 2IY7A 4W5NA 3EIXA 4ZRMA 4KAFA 5CNIA 2XDQA 4YA6A 5TF0A 3E15A 2ID7A 5AWFC 2H06A 1STOA 2HMUA 1L7DA 3GF4A 1YR3A 1QCDA 1PFYA 3A1EA 2OYRA 5IA7A 5KINB 5I7UA 1KYTA 3AHCA 3PXCX 3L7OA 1D7OA 4V1CA 1MTZA 3HPQA 3L8CA 3SSOA 3O1JC 3HZHA 1R0LA 4OLBA 1W581 3I1JA 4CTNA 5JVDF 1ULHA 2F8SA 1FX0A 3A1DA 3JYPA 3PEWA 3AY7A 5HP4A 5G2NA 3EZ7A 4J07A 3K2BA 4DC1A 2XNJA 1K5DA 3LKBA 3RCZA 2GX6A 2O8EA 5HFYA 3Q7PA 1MHPA 2WK1A 5J63A 4CL0A 6GPBA 3ZBPA 1F0YA 1MUUA 3CLHA 2NBVB 2ZB2A 3GOQA 5GZ1A 2W6ID 5J4VA 3QPCA 1WD5A 1X0VA 3UC5A 1YZHA 3VUYA 2Q3FA 4NE7A 4OHOA 2BF8B 3LPMA 1S3SA 5FR2A 1V95A 1MW8X 3LT1A 4A6XA 4E5NA 4JQSA 2KFKA 5L3ZA 4DOMA 4ZU6X 4KZKA 4GXQA 1IATA 3KJNA 4BKSD 1VCMA 2CE2X 4KVAA 3T4EA 2AK2A 3ND9A 1NVVR 4HDSB 3CZRA 3HBMA 4IY1A 2EL7A 3D3EA 2OCAA 1SGHA 4A23A 3UOAB 4UTZA 4MWDA 1EZ4A 5I9NA 4DPMA 1XHEA 2Q2QA 3TQTA 3VDZA 4B09A 4NAWA 2FWBA 4F5ZA 2PUEA 2ZIFA 3VPFA 4B6JA 3TM5A 3CPEA 1O6BA 3N9YC 4EY6A 3TBKA 1UC8A 4EYGA 3P0IA 3FTDA 4HKZE 4LXGA 3PO0A 4GZ6A 1EAYA 1P74A 1ZJZA 3VR0A 4P54A 1FU8A 3B1FA 1DKPA 5JD4A 1I7HA 2CVOA 3ONSA 1SKBA 1DP4A 1TIBA 2WDTB 2ZPUA 1Q74A 1LPSA 4OJQA 2QD5A 1U4SA 1GPLA 5C31A 4YJ2A 3JTEA 5LUBA 2SKDA 3HBJA 1V71A 3HVUA 1HG0A 1BG6A 1E59A 2TMGA 1OFVA 3RQSA 1G291 2RAUA 2C00A 1UJ2A 2ZCUA 4RH0A 4FBLA 2K25A 4WN9B 3TAUA 1FSGA 5LOVF 1LCIA 4MUNA 5CM9C 4MVCA 3D7SA 3AU9A 4ARBA 3ZIUA 2VT2A 1FNCA 2QYHA 2WFMA 2ONZA 1FFXA 4F04A 3BFJA 1TS5A 1SZDA 4WY8A 4JLCA 1C9KA 5CFMA 3AVWA 3RJ5A 4E7OA 3ZNHB 3EDMA 4KG7A 2QJRA 3DZIA 2ZSKA 5KVSA 1PU2A 4NDNE 1YAJA 2AQ2B 1HT2E 4F91B 1J0GA 3IAFA 4Q48A 4E51A 3IHKA 1VA4A 2ESRA 4OB7A 2PLWA 2L32A 4OZBA 1RQRA 4CIWA 1MQ8B 4L73A 5GMOA 3CX7A 3REFA 3IQFA 1NBME 6Q21A 2J9FB 3DNPA 2H3HA 4URXR 3NCHA 1L5ZA 5AKZA 4PS3A 4PFKA 1AQUA 4PS8A 2AL3A 3L43A 1H0KA 2QUKA 4GDKA 1QG2A 2ZYRA 1DDIA 4HNAB 5FOVA 3ZR4B 3I0ZA 1ADYA 4RNCA 1FP6A 2J0VA 1R0KA 1KJNA 4BBNC 4H7FA 4ENTA 3HA3A 4I9GA 1FVXA 4MGIR 5DNYB 3RBVA 5EKXA 1EZZA 2V5UA 2L76A 2V6BA 3V1NA 1UXOA 4H6PA 4MUEA 1RYYA 4QGHA 1F4VA 4NZZA 4FNAA 3MT9A 1IEXA 4BOSC 4GF5A 3Q9LA 1G8PA 3TSWA 4HR7A 1GSIA 3NBQA 3W7VA 1OEYJ 1FYEA 2H7YA 2WABA 3HBLA 5BVHB 3E53A 4EG6A 2EJTA 2W3RA 3LX8A 2QSZA 5CPFA 1AKWA 2GILA 4B3JA 1P0IA 3UW3A 3WB0A 1VLMA 1X38A 3DLCA 2C2YA 1K4MA 2KMCA 3KKOA 5AZGA 2VPZA 4RA9A 1R4ZA 2Q6TA 3EDQA 3JVUA 3K1YA 1IMOA 4OQYA 4FNGA 5CTRC 4RQUA 3OE5A 4ND4A 4MIEA 1RP1A 3BH7A 2P6PA 4E5KA 4PWYA 3V8BA 1P29A 2YMQA 4WKOA 2VSYA 3VSDA 1LUAA 3OZCA 1JHDA 1XYVA 2OVBA 4AF6A 1PEYA 4WA7A 1YJXA 2A5GA 1TAQA 4XE5A 3IAM1 2I4NA 3RWMB 4RF4A 9ATCA 4IDQA 2QJFA 3WIMA 2OC4A 3VR9B 3RRYA 3HZZA 5COBA 3OX2A 1O0CA 1N6OA 1UBOS 1JXQA 2UZ3A 4EFOA 1JEQA 3OT4A 4HDNB 4PY2A 1ZGUB 2FNJB 3PLAE 2O1SA 3C87A 1C9JA 4LVOA 3VTZA 3L77A 3F9IA 1GZUA 2VFAA 2IKQA 3VZQA 1JHZA 4QOFA 3ZWVA 3O9MA 1D4AA 4IUBS 5I51A 2CHGA 3QVOA 1ARZA 4UE2A 2QBYA 4ZPXA 5HIKA 2EF0A 3NVKI 5DP1A 1P19A 2CVHA 1J7JA 1WKVA 4IHQA 1JG7A 1RU3A 1CY4A 2WMNB 1SXJD 3GVCA 4W1QA 1H94A 1EFLA 4FMDF 2AH5A 2JVJA 3W9YA 1XDDA 1P31A 3D4LA 3TOZA 1QO0D 2EJVA 4YXFA 2CHVA 3HWSA 4WKCA 3O75A 1SOAA 2AXEA 2DYMA 3SNHA 4L16A 1WSAA 2ZW1A 2WSIA 3R41A 1M34A 1I4WA 1XZAA 1Z0AA 4IWOA 4KFTA 1MVOA 4WJKB 3GGJA 5DT9A 1XF5L 5L51A 5AESA 2B78A 3S1AA 2B8WA 3I12A 4IM3A 1WCXA 4CIAA 1R9JA 1MKYA 3INTA 1I0IA 2MMCA 1CJKC 2Z8YM 5KDLA 3IXQA 3NDJA 2INGX 1X7DA 1CDOA 1PDVA 3EWAA 1ORTA 1QHGA 1X39A 4B6QA 2CVFA 3OY7A 3U3JA 1ZEMA 2FRDC 1SXIA 3CRVA 3QYFA 2C29D 4L1BA 1D6EC 5AVYA 3DTVB 1NP3A 2IZ1A 4OL9A 2HFKA 3R75A 4F5EA 3I1FA 3F9RA 1AS2A 1A8QA 4CZ2A 1J0DA 1E2MA 2I03A 2ZJ4A 1WMHB 3T7JA 2XNKA 5LZ8A 2ACKA 2BEUA 3OPYB 2X7JA 3UJ6A 5JJBA 4UNQA 2OBMA 1H85A 1NL3A 2XGMA 1X7ZB 5J23A 2Y5BB 5C2JB 3T1QA 4F8EA 1YD8U 2A92A 4OK5A 3PGMA 3CSDA 1BX1A 4Y7CA 4ZZ1A 4OHBA 2IHZA 3NWJA 4GOLD 4X84A 2ZWAA 5K6RA 2PH1A 2IZVB 1KAMA 4F2WA 5HVNA 1EXMA 1EFPB 4Y98A 4ETMA 4FIZA 1REQB 1VLQA 2WVJA 4GPTA 1XZKA 5G40A 3GUUA 5DNAA 2H1RA 3JATA 5JH7B 1ISHA 1UM9B 1MRZA 3HKBA 4HB0A 1EAMA 1MEEA 2BCJQ 4QPJC 3ZDMC 2FN9A 4YUZA 4D46A 4EGFA 4Y0VA 2G07A 4BPBA 1COZA 3N70A 4YMTA 3QYJA 2BKFA 5AW6A 1GT6A 4CCYA 2QN3A 4K9QA 1CZKA 4QGAA 1QK4A 3CZ9A 1WW8A 4L0CA 5HK8A 3F96A 2XMPA 4ZAFA 3H9JA 5K01A 4AKIA 1YFJA 1IC6A 1CVIA 3FSGA 1OLSA 4BZZA 1YB6A 2D1FA 1G16A 1NI4B 2HMTA 2PFGA 2EBWA 4UHJA 3PJRA 1W19A 2LHDA 4W99A 5C32A 1RW4A 3CUSA 1AV6A 4R0NA 3BXFA 4MQLA 4I5DA 2PUFA 1B6RA 4FFBB 3S2EA 2IOYA 5KKAA 3IDZA 1ATIA 2F3RA 4LMAA 2X4DA 4N40A 2H1WA 1PDOA 2FWIA 1TQ4A 2WUVA 3GLFB 4FFDA 1ISJA 1CFZA 3K0HA 3QLEA 3ETJA 3GE3C 5AM5A 2HF9A 3NJRA 2F62A 3HC7A 1MIHA 2JFPA 2HRCA 3JZFA 4JD5A 2FGKA 5I4IA 5FNVB 1JWAB 1QKKA 4X65B 3HDQA 2PV0A 2PX4A 1B7GO 3GFQA 2YIVX 3FF1A 5KNBD 1KYXA 3MERA 2PBRA 2KDMA 1KSHA 3UN1A 3EEQA 4LF6B 2AFRA 1E69A 2PSSA 1MVKA 2FG7C 4ZRPA 1O87A 3GT7A 3OLQA 1LVGA 4OP2A 2LBPA 2B7CA 4OFBA 2IVFA 1JKMA 3EX7C 3IP6A 1ZOYB 2H4YA 2SCUB 2ZQYA 1GTRA 3QFSA 5DNUA 3O4VA 5HKOA 4LZLA 4RKWA 3DWIA 1XPUA 1X1EA 1V48A 1FYVA 2VNIA 4A73A 4QEKA 1KZ6A 5FXMA 1JJVA 1AHPA 2X8BA 2MH7A 4CMKA 3TDKA 3R1IA 1QWOA 4R8SA 2N9EB 3QCAA 1DBPA 2J0QA 2CNWA 3MTBA 2JIMA 5JY1A 3PNOA 5ALJA 2PQMA 4PSCA 1YDFA 2I1VB 3Q8LA 2V3CC 5DT2A 4X97A 3I2JA 2QC8A 3O6VA 1LI7A 2C7NB 1GTL1 1HV8A 4DVGA 5DM4A 1E5TA 2AD1A 2AF4C 1N62A 4UDUC 1NNI1 3PUHA 4JI4B 4C3UA 3GI1A 2C9DA 3GYGA 1TGZB 2VF4X 2O0JA 3RVNA 4JNCA 3PZ7A 2RPVA 2GM4A 3A9VA 4AX4A 5D84A 5A1TA 1TIFA 2QRPA 4LS3A 2Z1NA 4PBTA 4EGJA 1W52X 4ZO9A 5JWOA 3WWEA 1COWD 1N2JA 4RETA 3UJ9A 4DQXA 4ZD6A 1T1EA 4U2BA 2A5JA 4EKDA 1E1QA 4CU5A 2EU8A 1UWKA 1FF9A 5K0BA 3TD6A 2JT4B 4AX8A 4LNNA 2MJDA 1S3FA 2JAQA 1JHOA 1S9HA 3QNUA 1RP7A 2X3UA 3C98A 1U7PA 3TAXA 3AP3A 2JJ1D 4P3XA 3P96A 3APDA 4GE0A 2Y1WA 2RHLA 5HMLA 4N65A 3PVSA 3LVRE 1KFBB 4KPGA 3VRHA 4WWMA 1TMYA 3APFA 5EJEA 1BMFA 5EFOA 4BMVA 4TUYF 2QRJA 1R4MB 1CJTC 3O9VA 3P0HA 2GM3A 2VJDA 3LXUX 3WISA 1ZEJA 2RK3A 4D26A 3VI3B 1RHMA 4QAQA 2R6HA 3RVBA 3JQ7B 2IUSA 4RMHA 1JLHA 1P3DA 3HVIA 5F73A 3ZD6A 1Z74A 4R1PA 2RBGA 3R2IA 4M9SA 1C3OB 3L7YA 4JI0B 2I3BA 4RJLA 2YVQA 1RZRA 1U5AA 2AHOA 4HF7A 4ZI3A 1YZFA 1U3CA 3A11A 4F4HA 2OLEA 1QNFA 3N9IA 4OEHA 2ZE6A 1ZYUA 4E2WA 5HQ3A 2I7VA 1JR3A 3CYFA 4C3OB 3LUBA 2WJVA 3EGOA 1F0NA 5CCDA 4JE3B 4RQTA 5EJ8A 4LYDA 4M01A 1B2RA 2LCIA 5EG5A 2PCJA 4ND8B 1AMOA 3RWBA 3GD7A 4RMNA 3UBMA 2VK8A 2XYRA 3UPTA 4LXXA 3HSSA 5JJKA 2L82A 3DYBA 3RNFC 3DTVD 3D5QA 2W0MA 1E9CA 4LFAB 3BOSA 1P9OA 1Z5WA 5ICCA 3AR6A 3C4JA 4R05A 1C4XA 3AE7B 2PX8A 9ABPA 4M1YA 5KYKA 1OWLA 4NYMR 4NXNB 4JKOA 3IVRA 4MOWA 5KREA 1CQIA 3W7AA 2HJRA 1RXUA 2NQTA 5CLJA 4BDSA 4XX1A 4U8GA 2PVSA 3W9SA 3TFOA 2WD7B 4JHLA 1AQYA 1U7HA 3KB2A 3V4VB 2CJOA 3PI7A 4C89A 4C14A 3B36A 1ZDXA 4H9GA 1P7PA 3SAJA 1EF5A 1BNCA 1JA0A 2O05A 2RKOA 1L7MA 5AI8A 4W8GA 4QYTA 4ARAA 5DBFA 1NVWQ 2Y8EA 5FTLA 2EFHB 1AZTA 4F5YA 5CHVC 3HA5A 3SIWA 4BX3A 1G5IA 4M7PA 2RBKA 2MBQA 1JTEA 2Z59B 2ADFA 4MA4A 3DEKA 3EEYA 1WBDA 2NUBA 1E0ZA 4FMPA 3IR7A 1KTIA 4JITA 1A4UA 4ZCQA 3UK0A 1CS0A 5UKDA 1PJZA 1X1AA 3OJOA 2VJMB 1SFRA 3T3OA 2FV8A 1RMYA 2NTSA 5EI5A 4L76A 1UD7A 2EIHA 3TNDA 3IPAA 1NQ5A