2VH2A

Crystal structure of cell divison protein ftsq from yersinia enterecolitica
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
202
structure length
201
Chain Sequence
PLSKLVVTGERHYTTNDDIRQAILSLGAPGTFMTQDVNIIQQQIERLPWIQQASVRKQWPDELKIHLVEYVPFARWNDLHMVDEQGRSFSVPSERVGKQKLPLLYGPEGSEQDVLEGYRAINKVLAANKYQLKMVAMSARHSWQLALDNDVRLELGRDDRMGRLQRFIELYPMLQQPDKRVSYVDLRYETGAAIGWAPVFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN FTSQ
publication title Structural and Mutational Analysis of Cell Division Protein Ftsq
pubmed doi rcsb
source organism Yersinia enterocolitica
molecule tags Cell cycle
total genus 30
structure length 201
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03799 FtsQ Cell division protein FtsQ
A PF08478 POTRA_1 POTRA domain, FtsQ-type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2vh2A01
3.40.50.11690 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vh2A02
4C00A 2VH1A 4C4VB 4QAYA 3OG5A 4C4VA 4XGAB 4BZAA 2X8XX 3MC9A 4K3BA 2VH2A 3NJTA 3Q6BA 4PK1A 3EFCA 2V9HA 3MC8A 2QDFA 2QCZA 4K3CA 2MHJA
chains in the Genus database with same CATH superfamily
4MACA 2QD1A 4MHOA 4QQRA 1EXVA 3VJKA 3IERA 4GX0A 1ISNA 4Z7QB 5EMHA 1PIWA 4I0WB 3UJHA 1Y5MA 4NYIQ 2HCTA 5FI3A 4TZ0A 2ZXFA 1MO6A 4YY3B 4PRZA 5A7FA 1NF8A 2A30A 1W59A 4B75A 3FOFC 4C1NA 3BL8A 5B37A 1PS9A 3EB9A 4M1QA 3D64A 1JPNA 1NY5A 2X7JA 1R6BX 1JWAD 2QUZA 4F6CA 3H99A 3IEXA 2OBLA 2N7JA 1M2WA 3W5UB 1YQ3B 2P9YA 4IJ6A 1MPXA 1P2BA 1RRPA 3T7EA 1KI2A 1UBTS 2QT9A 4ENSA 1CY6A 5E9QA 3P1JA 3QU4A 4J76A 4JXJA 2Q7XA 1SXJC 4HQFA 4LTNA 4ARCA 1JXQA 3RIGA 4F72A 3KVVA 3L1KA 2LDBA 1Z36A 1YDGA 3LSYA 3T1NA 3CUEF 3QX8A 4QTZA 2VRNA 3MSXA 1IFXA 3GPCA 1JDZA 4CYMA 2A58A 4HNRA 4RV5A 3T61A 3PICA 5EERA 1BJKA 1LI5A 4HFRA 5IYZF 1T3TA 2QTWB 2BI8A 3GLTA 3WDKA 1B9RA 3O91A 3N6RA 3QX3A 1G8JA 2BQQA 5C1IA 3AE7B 5DNYB 1J21A 2C4KA 5DU2A 3OC0A 2JYEA 1P44A 1GCUA 1NJ8A 3BGWA 4FWIB 3P9XA 3T41A 3LXUX 4J4TA 4EABA 1YRLA 1ECBA 3VKUA 1V8FA 4D8XA 1KMIY 3IGFA 5J2TB 2A0XA 4YTPB 2W0MA 4PGGA 3GEGA 3KHKA 3AEYA 3G1TA 3TIXA 3HBAA 4URYR 5JNSA 4JQOA 3C8YA 2C3MA 2JC3A 5DTJA 4CW7A 4BQFA 2YLMA 2YFKA 1SBYA 3P45A 4TMZA 1FS6A 2DYKA 1FL9A 3D43A 1J00A 2C77A 3IEPA 2MYPA 3G13A 5U1PA 4WK4B 6PFKA 1Q11A 5E7QA 3EHVA 2H52A 2O0JA 3JTMA 4WVLA 1XTPA 4HK4A 1SQ5A 3C6QA 4RY2A 1U7XA 1F38A 1RR6A 3K0KA 2P41A 1OJLA 4M0EA 3V3XA 1P7VA 3AERB 3SC6A 1GNSA 3N05A 3QPVA 4FBGA 4DCVA 2INPE 3SQWA 1HTWA 3K31A 2A57A 4LRTB 2JBWA 3DPDA 1VG8A 2PLFA 1JVBA 4LZJA 4HDKA 3EBPA 4BKRA 1JXMA 4JEMA 3EAQA 2BKAA 3W6ZA 4CVNA 3Q40A 3RW9A 4IZ6A 4RK1A 3GLGB 2VAPA 1M2OA 3DXXA 1W29A 4GGQA 4ARUA 4ZYZA 1HT3A 1Z18A 3KHTA 5K2OA 2FMXA 3B89A 3B7WA 1LW6E 5J2RA 4C7ZA 2BMDA 3O8NA 4Z4FA 4TTRA 3H8VA 4KAJA 1CB7A 4TPKA 5ECDA 2IHYA 5JCPA 4OHVA 3G17A 1Z13A 5BRAA 4B2IA 1SR8A 2H1CA 3OQPA 3ZRFA 1AQLA 4JBLA 1XDZA 4MO9A 3P32A 3ZVVA 2ZIXB 1JAXA 4M2LA 4F86A 2LKCA 3EIOA 4YP1A 4KQJA 1N33B 3SMVA 1V35A 3VR2D 5KHOA 2WINI 5IZCC 5DRTA 4C4OA 4C7KA 2NZWA 5TMBA 4KPUA 4O2AB 4QWWA 5FR6A 3OUTA 5CGZA 1W8IA 3K6JA 1N5DA 1UWMA 2ZP1A 1VRWA 2WQ6A 1H6CA 3V4ZA 4OOEA 1K0UA 6REQA 5BT9A 3LLCA 3PKIA 3KU1A 1DKOA 2C4TA 1H6DA 5CFRA 1H2ZA 3UG6A 1IOVA 5FJJA 4CTMA 5CB4F 3AE2B 4CG1A 4AKEA 1QC5B 3VTAA 2XWBF 3FSGD 2OGZA 2VBIA 5ERYA 2H18A 1SZPA 4FFDA 5EIXA 2A7XA 4EGQA 4L28A 4Y1RA 2LUEA 2OZKA 3H9DA 5CB4B 2VK1A 3LYLA 1WR8A 3RJZA 3WJ2A 3QVXA 1P2SA 4YAIA 1LXDA 1QRAA 4LQ4A 2I6SA 2ZI9A 1RQRA 4PLTA 2QD2A 4RGTA 2DYMA 1UT8A 2FZ5A 3U3RA 3APCA 3C48A 4WFIA 4UM9B 1YB1A 5ANRB 4MVJA 4Q1DA 3G79A 4WVFA 2PGXA 2CCJA 4W6QA 1PK8A 1TU4A 1CVRA 4OUKX 3WLAA 1G2IA 3VAWA 3RRJA 4X9XA 4RPJA 2REXB 4AZ3A 1EUDA 1O5IA 3A37A 1WJNA 3ZDRA 4BYGA 1A5SB 3EAFA 4NFLA 3ZEIA 2RGEA 1LV8A 3SOZA 1GTZA 3N8GA 2DUUA 1UEJA 2FN8A 1EAMA 3ABOB 5EJEA 4ZYUA 1QFJA 4G81A 4BNVA 2OBYA 3PPXA 2XQJA 2I03A 3T9AA 2BKUA 4MNTA 5DIZA 1L8QA 4QO7A 1SOAA 2D5GA 3NOXA 1KJIA 4B4UA 5BQPA 3ZWVA 5J23A 3HXQA 3Q6BA 2H1WA 4DCJA 4P5PA 2X5NA 3GXOA 1WB5A 3BIFA 3VZDA 1JEAA 2FEKA 1I4TD 2I4RA 4YRGA 1T6NA 3H5AA 1YBFA 3GX1A 2QYHA 1XCGB 3KTFA 2ZR0A 5DXJA 3AFHA 2R4TA 3LK6A 4RMIA 1FSSA 1G5RA 3BF8A 4ARIA 3TVTA 2V1YA 4BLUA 2GYYA 3MJ4A 1PDWA 2HMVA 1RCUA 4TWIA 2MT9A 1PUJA 3UGBB 1QUEA 3MFQA 5MHTA 4IXNA 2Q3DA 4G5QA 3SX2A 3F7TA 3KHSA 1G5TA 2PWPA 3GLIA 4JYAB 5JSYA 3C14C 3IA2A 5KJ1A 4HAXA 3GN2A 1B00A 3R7NA 2DHRA 2A35A 4RSHA 2HA3A 2Y66A 1JW9B 2MSLA 4LYJA 2CKMA 1ST3A 1H2RS 2RHGB 2X41A 3COJA 3TQOA 5A3VA 1RLJA 4F8YA 3TZLA 4BASA 1JLLA 4O1NA 3U7FB 4M7WA 1SUIA 1X1BA 3QARA 3UUEA 4EZBA 3IQWA 1YK0A 5LZ4A 3TFQA 3MINA 1R6VA 5IN5A 1LQTA 2WWWA 1VGQA 1RJDA 4JT8A 3EUFA 2FR8A 3H6GA 1YACA 4NYMQ 3OKFA 2Q4RA 3U7JA 3FLAA 2CEKA 2QS9A 4AJLA 4EY8A 4Y2RA 5B1DA 3PITA 3ZHYA 3SEZA 1A9OA 1MN6A 4DM4A 1FDWA 3FCUB 1E98A 2FLVA 3AR9A 1ZONA 3OFNA 1ZE3D 1CE8A 3PX3A 4M02A 1CVIA 5BWMA 2GD2A 2QTRA 1P1AA 4EMSA 5A1JA 1U1DA 1XA0A 4X1YA 2Q2QA 4QTXA 5FLXA 1A27A 2X0DA 3VU9A 4EKEA 4ZAFA 3OD5A 2J6BA 1U04A 4QUBA 3VBCA 2BHSA 2H5JA 1CKEA 3TB4A 1W4AA 4J1QA 5CYFA 3R7WA 1T36A 4XKJA 3I6QA 4HXYA 3AZQA 3V55A 1Y1TA 1N2ZA 5ADWA 2VRRB 4I19A 1QX4A 4O4HA 1WDTA 2FG6C 4BZQA 3DZFA 3WGIA 3EMVA 3HUTA 1Z3CA 4FJ0A 4LMAA 3QEOA 2BRUA 4O4LF 2P35A 1TI7A 2IGGA 1JH8A 3UGKA 1E7PB 2D4HA 1H5UA 2O14A 1R4MI 4CCWA 3O2JA 3TH5A 1K63A 2Y2VA 1VHQA 5AHRA 4Y18A 5AKZA 4O4LB 1QVAA 4RZXA 2ID4A 1JBQA 3PS9A 4QE3A 5L83A 2C99A 5C35A 2C5LA 4GIBA 1G8PA 2H65A 3BRQA 4HXDA 2RDMA 4L5AA 3WAJA 2IO0B 1Y9AA 4EO4A 2XBLA 1LLCA 1E64A 2DAFA 2ZVPX 3U3ZA 3AKYA 2V9HA 4TTPA 1W0JA 2BE7A 1ITZA 1P7WA 4G23A 1V6EA 5KS2A 3A05A 3FLMA 1YUNA 2ZAYA 5K09A 1RIFA 1UK9A 1OY1A 5HFNA 2Z95A 1HETA 4RUKA 2CXOA 1KXJA 5FQOA 2IYAA 3A11A 4AXXA 4P5DA 2LJIA 2QTZA 5SZHB 5CBPB 3QLJA 4R6WA 1SB8A 3M3HA 4IIHA 1GZ4A 4XUCA 4D4IA 2WLSA 4NTZA 1QH8A 3RWBA 1KETA 4TYYA 1C30A 2VQDA 2ERCA 2EBUA 3U7QA 1W4LA 2O05A 4W7HA 3R24A 1YOVA 4GMGA 4TMTA 1SBIA 1CIPA 3ORHA 3G1UA 1E7VA 1NUSA 1FMTA 2Q5CA 3Q85A 5F7OA 4Q9IA 3TI7A 2ZKLA 4A2PA 4YJFA 2PWBA 3AJDA 4MVJE 1I9CA 2ZW1A 3CLRC 4DCSA 1R5NA 1WX7A 2GZDA 2C9OA 3IJEB 4FHFA 1B3RA 3M1IA 5HQ3B 1PNTA 3SNKA 4PRKA 3AI1A 1ZIPA 5F3DA 4EUEA 3ICEA 2A5UA 3GZTB 5AW9A 4C6TA 2E0IA 2XZPA 3BOSA 1OEYA 3R3HA 3CG4A 3ZTCA 4UEKA 1D2RA 4ZVVA 2J9FB 3CF4A 3JYQA 5CIQA 1L4BA 3M6MD 4LJYA 2I1VB 3VTFA 5B3JC 1PKEA 5FO0A 2VEDA 4RADA 1T2DA 4MSMB 1RXWA 2IGTA 3VNRA 4MSQB 1O9GA 1CD5A 2RSLA 5D3KA 3OX2A 2HJGA 4B5LA 1P73A 2J5RA 3SHFA 3OKPA 3SJUA 3OI7A 2XKKA 4ZJZA 2IY7A 1H93A 4M98A 1HNZB 1TAGA 3PGXA 4EYGA 3HJCA 3KPYA 3I6BA 1FVFA 5GINE 3HJTA 2V7EA 1PFWA 3S8YA 4C6SA 1NI5A 4PYRA 3P0RA 1H3NA 4JPSA 2R2OA 2ZTMA 2ZRPA 4ZPXA 4D4KA 3QVMA 4D92A 3TGLA 1SVLA 2QK4A 4B3CA 4MV5A 5IDXA 2QNIA 2W2TA 1ZDXA 3H1AA 3WSWA 2LDXA 4BB0A 4N6EB 3R7DA 3RFUA 1UQRA 5LYJA 5CLIA 3VNUA 4KZPA 4ESHA 3OQOA 1AZWA 1CEYA 1CEXA 5HA5A 3TDNA 5C1DA 3WAGA 2L18A 5FORA 1YJ8A 4I4TA 3NP7A 3QXSA 3RFVA 1O95D 3FVRA 4BKPA 2AOUA 5LQAA 1GG5A 2ZVNA 4DS3A 1ESCA 2EQBA 4KSLC 5FPHA 3RFTA 1NQTA 1QHHB 2V7BA 4MV3A 3FH0A 3ZX4A 3ITEA 4PC3A 1NVTA 2NNLD 1WY7A 2NV2B 2EZ8A 5IX8A 2ZRCA 4CTJA 3ZXVA 4GHWA 4WNAB 1VB3A 1PGNA 1ZVJA 2RH5A 3OF2A 1XZCA 2CJFA 1ILWA 1MI0A 4J0EA 2HLHA 1XD2A 4HC4A 4PT5A 3BVZA 4PZLA 5JQGB 4WKNA 7ADHA 3UVEA 3VC1A 2HQSA 5K45A 1MJFA 1OF1A 3QOWA 3AFMA 4J16C 4HXEB 5BT8A 4EYEA 3I04M 5ED4A 3H1FA 2MSCB 3N0XA 2AG8A 2PXHA 2VRWA 3C98A 1GLGA 2MR6A 3FYTA 5E4FA 3L04A 1BHSA 1FDUA 1QAMA 2ZQZA 2DP4E 4BKQA 4IOJA 4YMSA 4EJMA 4PYIA 5KEIA 5BN4B 5K6AC 4E2YA 3OMXA 1DDGA 2OHXA 4OXNA 3HCBA 4R16A 2XNSA 5H7XA 3CEJA 5BVGA 2ZATA 3P0JA 3L7KA 4OQ4A 2JDID 4IHJB 4KKVA 2XB2A 1NI3A 1BRMA 3L6RA 4GOCA 1YBHA 2XVAA 2BGMA 1PYWD 1NPDA 4F85A 1IAVA 2YEPF 1ISPA 1D2GA 4LHEA 1XTKA 1D9XA 5DYTA 1U1GA 3SFZA 1OWNA 4B8WA 2PX5A 3LY8A 1HFEL 4GZMA 5I9SA 4B3MB 1BEZA 2YEPB 1OFIA 4U7GA 4BWGA 5ICGA 2X1HA 2HPVA 1VPDA 3OQ6A 1AQUA 5JHGB 1XPOA 3DPUA 2M0AA 4KN9S 3M6LA 2PKWA 4X20B 4XIIA 2NACA 3DO5A 1OLSB 5AJZA 4QLAA 1F2TB 3SE7A 3L4BA 2AI3A 1LJ8A 1R6TA 3A6PC 4BQOA 4W9IA 4LDZA 2Q4DA 4EM6A 4TMYA 2UUOA 2XDWA 4DQLA 4UTPA 4QSHA 3LCMA 1E94E 1M10A 4ZV9A 1YC2A 4WLNA 4X1IB 1JQDA 3F46A 5IJ9B 3VPCA 3VRBB 2GF0A 3D7NA 2JHFA 1GQYA 3SNHA 2RJ3A 4A5SA 5EUMA 3ROEA 1FTWA 1JR6A 4YRAA 5KCZA 3KYCD 5J4YA 2QJRA 4ILEA 2D2EA 2F3QA 3SQMA 3N2GB 1BHO1 3OPXA 3BE8A 4RAOA 3G7UA 2XCUA 1NNLA 3E1SA 2GEUA 4Y1FA 5HZHA 5COBA 3DVLA 4MW9A 2WBLC 4BFTA 3HNPA 5G0SA 4K9MA 3V7WA 3F4LA 1P72A 1DOHA 1ZU4A 3E2MA 4OUDB 5EAIA 1H3EA 1GL7A 2FEOA 3CH4B 3S2AA 1T5LA 3KR1A 2VUUA 4UJ5A 1WTCA 3O3CA 1OBVA 2AR7A 1ZAKA 3HL0A 3DHNA 2XSZD 4QTYA 5IYZA 3MQFA 1DEOA 3AOGA 3UJ6A 1G3QA 2JGAA 5DF1A 3SYTA 1K1EA 3GJ0A 4D9MA 4AL4A 1A8PA 2HDWA 4JVNA 3UQYS 4PSVA 1TW2A 3RZFA 1Y4UA 5EXEA 1NA5A 2QTLA 4MJLA 3BFPA 1PFVA 1FP2A 4KDFA 4KAXA 4PNHA 2QTHA 2J7PA 2GXUA 4YK7A 3LL4A 4X6UA 4EECA 3E84A 4GBED 5AM3A 2G6BA 2I7XA 1MO5A 4ZYVA 1M1UA 3WRVA 3SD5A 4EKGA 3H4TA 5CLFA 1KTIA 1CUYA 2H4JA 3NBUA 3ZIAA 4U2GA 1RCFA 1IPEA 1M1XB 2ECQA 2C9ZA 4OFBA 1RHKA 1JRLA 2HZ7A 5DI3B 3OG9A 3LTNC 1YKSA 4CM9D 2CV2A 3VPDA 4X8LA 4XH9B 2PVOD 4DJAA 1G16A 1XJ5A 5FR1A 4KIGA 2V3VA 2X77A 2PD4A 4MKFA 4RA6A 4NBNA 3UI3A 4TTVA 4LRSB 2FCRA 4YRPA 1ZQ9A 3UV6A 2W6PA 2JKZA 4DW8A 5KYGA 1TK9A 1SIWA 2EJBA 3NUGA 1B14A 2ACKA 3FMOB 4C1BA 3JQRA 3V05A 3TFWA 3MW8A 1YE8A 4RHXA 5L4SA 1OIWA 1DEAA 3GA0A 4LE2A 4QYTA 1WUTA 4PLFA 3EY4A 4QGBA 4RIGA 3EFUA 4PYJA 4JKIA 3QXGA 1JFLA 1V1RB 3TIXB 2XD4A 1WRBA 1SBQA 1EB8A 1LBEA 4G0QA 5DNCA 4P5EA 3THYA 5JASA 5KSPA 4ZQIA 4DSTA 1UOQA 4MDHA 4MM3B 1ZR4A 1RXYA 1E9AA 2JIZA 5TS3A 1L5PA 3MELA 2ZIXA 5FEUA 4JXZA 3W3AD 4MGKR 4HWOA 3ZQUA 4LTMA 1RQPA 3IVRA 2Y93A 1DL5A 4Y2JA 3R09A 3HBJA 3ND6A 1KY5A 3OLVA 2FPKA 4D25A 3DP7A 1OJ7A 4YCJA 3KJHA 3WDSA 3BHMA 4UNIA 2WABA 2W2VA 4II2B 4IQ8A 4WCDA 3GRAA 4E5DA 2R8RA 3S2ZA 4REQA 3DMGA 2A9RA 4C9BA 3IAFA 1Q10A 3I04A 1KYXA 3B3GA 5B7NA 2DHEA 4DREA 3RIXA 1L9KA 4LJKA 1D4OA 2G28A 3OCWA 2UZAA 5J47A 3HHPA 4DXGA 1JYSA 1RRCA 1G291 3HEMA 5AESA 4Z49A 1GN8A 3IKMB 3CSDA 4JD5A 5CB4A 3NHJA 1LNQA 4ARSA 3A8TA 2PX8A 3A4LA 4FFNA 1PWEA 5CD1A 2NUPA 3TUIC 1WMSA 3BCRA 1FFYA 4B46A 1XZHA 4TTSA 2FR1A 3NH6A 2PUEA 5HKOA 4C76A 1TKBA 3CLKA 3S27A 1NW6A 4TWJA 1A8IA 1VHJA 4CM4A 1JQJC 2Z2YA 4L75A 2XT0A 3IEVA 5EKSA 4DIUA 1KZ1A 3MJVA 3Q7TA 3M5WA 4MUNA 3EXHA 5B3LA 4KPUB 4NFYA 1U31A 4TLDA 4V0QA 2PD3A 3AR4A 5KTKA 1ZRNA 2RGUA 2K22A 2IUUA 4C0SA 5B7QA 3TG8A 1DINA 4I5DA 3ETNA 6REQB 3GDFA 2BF4A 1C4AA 3JW0X 3X1ZA 1KZ7B 4CIVA 3CT4A 2C84A 1ECLA 4AT1A 5AJYA 2H1HA 2VJCA 5IW8A 3GYGA 3Q0IA 2F64A 4JP3A 2DPXA 1ISRA 5ALJA 2HL6A 2X8BA 5CVDA 2WU2B 1YU9A 4KQ6A 2Y1WA 4YXWD 3IUPA 2LNDA 1Q44A 1J7AA 3TNJA 3EIHA 5HK8A 4DDGD 3AUYA 5F7ZA 2QIOA 3RYTA 1TJ4A 1ZEMA 1GP2A 2A92A 1LSUA 3BIOA 4XM0A 1CB0A 4CIXA 3OQBA 2BB6A 1C7QA 1GCIA 1OKKA 5EKXA 4LI3X 1GRVA 2OVBA 2J7QB 1H8HD 2P5YA 1Y6RA 4YIHA 5HXAA 3GUUA 1UBEA 2PTLA 1ORRA 3DWMA 2CS4A 1G8KA 4X93A 3IIIA 1V1PB 3AONB 3IE2A 2BS2B 3EWNA 1H9AA 1A1VA 1XZIA 2LV8A 3RRBA 2F1RA 4C05A 1SH7A 4ZN6A 3FHCB 4TKMA 3ET5A 3MBOA 1NE2A 4XR9A 4K0RA 4LGMA 4CCAA 1NUQA 4K6HA 4QRDA 4BX8A 4JB0A 3U09A 1CHDA 1VP3A 3AEBB 1F5NA 5JMPA 5BQ5A 5AW4A 3D9QX 5G2NA 2WXJA 3N87A 2JJYA 5J17A 2ZR7A 2HWKA 3GGOA 3ASVA 2NU6A 4B6OA 3IIEA 3QE2A 1EMDA 3GG9A 2P2DA 3MQ2A 2XMDA 5A4KA 3KXKA 4CEIA 1NJ1A 3NKLA 5IDYA 1V3QE 1W5TA 5CX4A 3NS8A 3KQYA 4JLSA 3SQXA 2V96A 3EMKA 4LJPB 3TFOA 4CG2A 3HYCA 4OXKA 1I14A 1N6HA 4TLEA 3VXKA 2J85A 4MQLA 3JQPA 1YHYA 5GONF 1MG5A 1YZVA 5LMUB 3DF7A 5KNBH 3OWOA 1ZX1A 3R5JA 2P9HA 2MMGA 4RY8A 1H05A 3BWBA 3GLIB 4YC7A 2XXBA 3LIIA 4MGHA 2HWUA 1CUXA 5GONB 2M98A 3WGUA 4R7ZA 4OHCA 3UO8B 2J4XA 3GUYA 2Q2OA 2QVBA 3KVNA 5FFNA 3IO3A 1CZRA 1Y8AA 3GLGE 3JWGA 5FYQA 3IP1A 1MIHA 2QX7A 5K8IA 3MVEA 5ALOA 1O4WA 3QWAA 2WFZA 2R5WA 4FOLA 1KI6A 3AHHA 3O92A 1K4YA 3GOQA 3WI7A 2X40A 2G25A 2FFQA 1ZBQA 2I7VA 4CF4A 4XA8A 4QG3A 4JC8A 2HEIA 1JX6A 4Y2GA 5CDTA 4ZARA 1ZOYB 1IJKA 1L7YA 2I8AA 5KX5F 4JJKA 4O4LA 5LQDA 5P21A 5BSTA 3NCTA 3U1TA 1XVIA 1Q7GA 2JAHA 1J25A 5KX5B 1U3GA 4LHVA 1YVRA 4TMVA 4TXLA 4UHBA 2J0EA 3D8SA 1X7GA 3ETCA 4F1JA 4ZJYA 2V3NA 4WJOA 2BAGA 2HSJA 1VKRA 1T0RC 2CHVA 1S2DA 1I7SB 3R3XA 3U81A 2PRKA 3BE4A 1H8EA 2PUTA 3QELA 3VU9B 2AZTA 1Q5WB 4ZQCB 3SSAA 3R7WB 2I78A 1T36B 5CBPA 1UPBA 1AQYA 2FW7A 1E0JA 1P0MA 1WS6A 4OHBA 3RTBA 4D99A 3CNQS 1L4NA 2RE8A 1XPJA 2CB0A 5KINB 3HNRA 1BAPA 4FX2A 4I8XA 4K87A 4V0SA 1SUSA 3UV3A 2VDWB 5F78A 1JKJA 4TL8A 3JQFA 4H7JA 2VCEA 1UKAA 4K9LA 2X0IA 3PJFA 1CRPA 3OT1B 4J2OA 2QUJA 1Z5GA 1EGAA 2NS5A 3GJ7A 3BWMA 1DFHA 3V7NA 3V4LA 1MPTA 3E9YA 2YXLA 4WBNF 3HVJA 3DCIA 5B4UA 3Q5EA 1KQ3A 5AW3A 1PD1A 4ZHQF 3B8HA 2FDRA 3TMKA 5J3JA 1ZD3A 5COAA 3L13A 5HQ3A 2ORVA 3PGJA 1SC6A 3UJDA 4BNIA 1TMGE 4UW9A 4ZHQB 4BUZA 4MWSA 1WDKA 2FPSA 4OP2A 1O03A 3GPDG 2J9FA 1ECFA 1TU0A 2C78A 1E1RD 1AHIA 2CEAA 2IPLA 1SVKA 2RK3A 3CVUA 4PX3A 1P7FA 2XDYA 3AR3A 3LF2A 3ZG6A 3YASA 1MXHA 2ZBFA 2CHEA 1P0RA 1UKBA 4CUZA 3RTCA 1QH8B 1JSCA 2QZSA 5EIBD 4RLFA 5DEOA 2ZTLA 1ORDA 1JAHA 1UC8A 3U7QB 2CXXA 5JUWA 1KZYC 2PBZA 1VL1A 4A2WA 4INAA 5E6JA 4N3AA 1OR8A 1XP8A 2FX3A 3VR6H 1M5UA 3OO0A 1TQ4A 4AJHA 1YB2A 4BNWA 4KIFA 3JQ8A 1YRWA 4BBPA 1YMUA 2OK7A 2QLJA 4EYOA 2X6RA 5PNTA 2C92A 1Q2UA 1G9TA 3CU5A 1XHFA 5EHQA 4UUBA 3BWCA 1VLZA 1V16A 2FHSA 4BBZA 1ATIA 4IL5A 2OENG 1SD2A 2FRVA 1E1LA 4C2UA 1YL7A 3B2NA 3AEDB 3IFSA 1U0LA 1L0XB 3AEKA 3EXG1 4FDTA 2YWBA 2J3EA 4Q7LA 1ULTA 4BVLA 1M8JA 1PNOA 4R1MA 1JWUD 3WQQA 3DOFA 5TGZA 3QQ5A 1KORA 2XB8A 4QT0A 1G9XA 2I80A 4M86A 3ROXA 1ONOA 3ABIA 5L4LA 3X0DA 3LT4A 5J5AA 1KOLA 5KDOA 4NG4A 4MAFA 2ORIA 1AUPA 1K9SA 1QHHA 5JJLA 2PX3A 2H5IA 3L8FA 1XCOA 3DE3X 1PR4A 3A9CA 1PVOA 1FZTA 4KPFC 1MEOA 3QU9A 1JSXA 4RGQA 3K96A 3Q41A 3IMCA 2XCLA 2FETA 4EZIA 2VAXA 1SPXA 5JWHA 3VR9B 3ZE0B 5T67A 1N2HA 2WIKA 3NGXA 3IP8A 4GOLD 3K0EA 1LF0A 5CCDA 4EHDA 5G0TA 1SCKA 1SCDA 3EXIA 4H16A 3L6UA 4Y2UA 1PG5A 2BJVA 2CBXA 1XZ8A 3BHNA 5FTLA 5KWJA 1DJLA 2I4IA 2QMZA 4NU0A 2K39A 4C3OB 3ACBA 3DWGC 1ZK0A 1YFJA 2XT6A 5AOCA 2VDVE 4IIJF 1HTQA 4I2VA 3V4FA 4J1NA 3W5SA 2F3SA 3E7WA 4AKSA 3REGA 4LOJA 4N0EA 5BN4A 2JZZA 4B8YA 2VP9A 4J8PA 4I4TB 2WJ6A 4JXXA 3TX6A 1R4NA 5KTMA 1CRWG 5D6NA 1KDZA 5AK6A 4HS4A 2AOUB 3ELUA 3LVBA 5F5NA 3J7AC 4ITKA 2HYIC 4EI8A 3PDJA 1QRSA 2W8BA 3PA8A 4DJFC 4RSGA 1PWXA 3CNBA 3RI3A 4IJUA 3MEQA 3FCEA 5CRIA 1I42A 4DE5A 3H5NA 1YKGA 1FUYB 1KTKA 1K0FA 4O5OA 2APJA 3AX6A 4X97A 2JHCA 3UJAA 1F6DA 1E4EB 1Z0UA 4MAMA 3PYXA 1XD2B 3COPA 4Y2QA 5BPFA 3AY6A 1VYHA 2VJDA 4B3DA 2N9PC 3AKZA 4JBXA 3A4NA 4X20A 3NAZA 5CT8A 3VNVA 3MBKA 2QD4A 4G0YA 3TM4A 4RZSA 2IS4A 4KXYA 4OB6A 5B1HA 2HH9A 2JRCA 2M17A 3K0SA 4GZ3A 3HY3A 4QUKA 2AC4A 3O4JA 4FNGA 2WM9B 5DNUA 2O07A 4X1IA 3LCJA 5FR3A 3ETLA 4WI1A 1KHTA 7YASA 4TRNA 2PW9A 2V4LA 1AV6A 4OBXA 3X1WA 3ZCSA 1FTYA 3N2GA 2Q41A 4ZCLA 3C3MA 4IINA 4CF7A 2BGWA 3ESYA 4WA7A 1UOPA 1S1MA 4AP6A 1T9CA 3I6IA 1M72A 1A5TA 3AEZA 1T1GA 1Z25A 5BSEA 5HEKA 2NT3A 3KBOA 2OP1A 3FXAA 4OUDA 3ZGXA 4R1UA 2FVYA 2JFYA 4NQZA 4FLFA 3ENZA 2GHQA 4KK4A 1WCXA 3BJRA 3NTXA 4KWIA 4AZ0A 1F3LA 1CZNA 3R76A 1ODIA 1TVMA 2E4VA 4DQUA 1XHEA 4HDOB 1IMOA 5B3AA 4LQLA 1YAJA 4QNNA 3ZJYA 3RU3A 4A3SA 4LJAA 3PQCA 3HJRA 2WKPA 2D2XA 3UZUA 1MRNA 2L0FA 2QSZA 5EMKA 2JFHA 1SGHA 4QUGA 3GE3C 5I7VA 1VA5A 2QQFA 2P3SA 2Q5HA 4ENRA 3V8NA 2IZZA 1XX6A 4IIBA 4J0QA 2RGAA 2R87A 1R5OA 3VDRA 2ZRNA 1N5WA 2QD3A 3AVQA 2FGJA 1EBFA 1BMFD 1AY0A 2GKSA 1A69A 2O2JA 1TW3A 1CJTC 5BNWA 2YRXA 5D3QA 5E7MA 4FYMA 3G2OA 1MAVA 4PLYA 4FULA 1F6WA 4W82A 4LE0A 5BYRA 2QT1A 3GBSA 3UWOA 1OAOA 3ED1A 2G8NA 1MIOA 3H8SA 5DI3A 4M01A 5I3CA 1Z4LA 4YCSA 2B92A 1XZJA 4FI3F 3OQIB 1MG4A 2XX3A 2A86A 4S3MA 1UAYA 1UPCA 3JRWA 4R2LA 3VISA 1U6IA 4LDNA 4LVNA 3MUFA 5K0JA 1EU4A 1KC1A 3IBSA 5JD3A 4DUGA 2XQIA 1JG7A 3AEEB 3OZUA 1P2UA 5CK4A 1DRWA 1QVZA 3OJCA 1N36B 3L6BA 5IYZB 2QRNA 3M95A 4OX9Y 4G4JA 1I1OA 5HR5A 3B5IA 3AR2A 2PE9A 4QC2A 3WB9A 4TYWA 4ARAA 4KO8A 3PPWA 1TZOA 4Z2AA 2GA9A 1Y6FA 1F4LA 3ZLZA 2ZVQX 4OG2A 1JB9A 4ZGGA 2NZ8A 2QGNA 1SXQA 3E6AA 4DLBA 3COVA 1L7BA 2C8LA 4KPGA 1V1RA 4CL8A 2Q3BA 1RI5A 5JI3E 4JBGA 5C2TB 2HSGA 4ZT5A 1ISGA 4BOZB 2BR4A 3QIVA 3FKSA 1Z4JA 4EHIA 1IXSB 4OI4A 1JHPA 3E05A 4UQPA 4MM3A 3TEMA 1A8QA 5T8IA 2AOVA 4L6AA 1OZ0A 3DZ8A 1R66A 2UZ1A 3UGTA 1C81A 3HJUA 1BYUA 2N3ZA 1KPIA 3N6XA 1B4DA 1GUAB 5A1TA 3ZH2A 4HV4A 1X8JA 1HK7A 1PGOA 2Z5VA 2EX4A 4W5HA 3S55A 3JVUA 1WZ2A 4CPDA 2ONYA 1AN0A 3C41J 521PA 1I4HA 3G89A 5L9AA 1XZEA 2PVSA 2ATXA 2DBQA 1AV7A 1PQUA 4S1WA 3BZDB 4JI8B 5BMOA 2WMOB 1WV1A 4II2A 3PNSA 1T3QA 3IJPA 3HL4A 1XVVA 3HVRA 2HJHA 2LZ0A 4C30A 5JSZA 3ICWA 4AZSA 1WQ4A 2BBSA 4RA6B 4J3NA 3E9CA 3GRKA 2QJLA 1M7HA 4M3NA 3TOZA 1JQ5A 2XYQA 1ZOIA 1N0WA 4R98A 3QK7A 5EQDA 4Q1VA 3EQ9A 1JTVA 3ZK9A 4ASUD 3MRXA 4RDCA 4MQ6A 3PE3A 3P4PB 1QZZA 1PFKA 1YVUA 3AP1A 4CEHB 1NG1A 1KF6B 3ZH9B 4NWIA 4BFZA 2KWVB 2IYVA 1TPYA 4WK6A 1TCVA 4A8JC 1E9EA 1ZHHA 4ZMBA 4RKFA 3THYB 4LBZA 1PSZA 3ZXSA 4CM6A 3AHCA 2NU8A 2VZKB 4RD0A 4ZRMA 4UULA 1S01A 5AM4A 2JGFA 1YQQA 3IESA 1TO2E 2C2YA 3UICA 3GEEA 4P3KA 1C4KA 3QFCA 4K46A 2KN4A 3GDGA 1URPA 2FMTA 3G1WA 1SC3A 1P74A 4H6WA 1JIVA 3I73A 1L5ZA 2GRUA 1GL3A 1UJMA 4MEBA 3HVZA 4MJXA 2ZBVA 3QUQA 1UBOS 4E09A 4REQB 2GJ4A 1QP4A 2HDHA 2GBNA 3U40A 2EW1A 4NQLB 1SIJA 3SX0A 3Q4GA 3N1YC 2F9MA 1TLFA 5LQNA 3UNXA 3HA3A 1OHHD 1KMCA 1KVTA 4IM3A 2ACWA 3RG2A 2EV9A 1OI4A 4E21A 4XWKA 3AYZB 4KZ0A 3A1NA 4W9CA 2W42A 2VVTA 2YWXA 1DRUA 3HR7A 2JLUA 3TVYA 4XYCA 2OYSA 1MFPA 3B12A 4YBZA 2P4UA 3EMDA 3M9LA 5MN6A 2XITA 1L0YB 3HY4A 2GM9A 1T0HB 3EZNA 1XUOA 3G6WA 5E9JA 2NUPB 3ELDA 4AMBA 3MJSA 1I94B 2JVJA 5EJ9A 5D3ZA 1JMYA 2P8JA 4UAVA 2XMGA 1T9DA 4MA4A 1U3TA 2GILA 3WLEA 4LPKA 4P58A 3C87A 4C3ZA 1MGPA 4CM4B 4RJJA 4XB2A 4DMMA 2XADA 3RK0A 4KVFA 4TVBA 2VPIA 3EVCA 3AIKA 4L3WA 1N8SA 4Z6KA 2JIPA 2G67A 2AQ2B 3EXHB 2Y3AA 4E11A 4F0JA 2W90A 3MJ5A 1E8NA 3CS3A 5GMOA 1I4LD 3CLVA 1V1PA 4CM3A 2NP6A 2W11A 1VIMA 5K9ZA 3FCAA 2ZRKA 1XJQA 4N0PA 5BVHA 3LCVB 1P2FA 1FJGB 3K9CA 2BEUA 3NS7A 1OH8A 3JQBC 2JVIA 3O4HA 5F76A 1TC1A 4AUNA 3E2PA 1EFKA 4LSZA 3ZUPA 1GILA 4DCUA 4FFLA 4V2UA 3ZDDA 5AVWA 2UDPA 1PK9A 4C7VA 5BNIA 2R6HA 4TOIA 1S96A 4CV2A 4KDRA 4D8WA 1Z63A 3FNBA 4H31A 1Z15A 2W4IA 3T3DA 3INRA 4F92B 3QLUC 4YRLA 1FM0D 4H0CA 1JYEA 2OPHA 4JL9A 3IBTA 1DBWA 1XO1A 1E7YA 3JZIA 2ZE6A 3WRXA 3U49A 2XRMA 3FPFA 4E5KA 3AEQA 4YUXA 3ZW8A 2LCFA 4IPTA 3ZCXA 1XK6A 1P29A 3G88A 3V1NA 3HKBA 1F8XA 4WJQA 4FU0A 3UXYA 4MRMB 1F48A 3DBHB 4JVLA 2OV1A 2YHBA 5GONA 4QKQA 2GKOA 2XIQA 4BFSA 3B2FA 5D94A 2ID8A 1E7RA 3AKCA 1KH3A 1QJCA 2G9HD 4FGUA 4KMSA 2A5FA 2QUHA 1R8SA 4LBWA 1GGKA 3H4MA 1DUSA 2WIJA 2YVLA 2Z6QA 2DEUA 4OREX 2O3UA 2QUKA 3N30A 5CX3A 2MINB 2LUMA 1LSJA 2R4UA 2I4NA 4ETIA 2RIRA 2XKJE 4JEUA 1JHDA 2NU6B 3PC6A 4O2LA 3T12A 1VZ3A 2YCLA 3H1UA 1FQKA 3U9LA 3NT5A 3BQNB 3WHLA 4UCFA 1F7VA 4CEIB 1USWA 1J07A 4G0XA 2XDQA 4NCAA 3VGPA 3SC2B 3AP3A 2ZRJA 1TDJA 5KX5A 5DWVA 2Z9DA 4ZVTA 1GTJ1 3TNDA 1RKXA 2YY7A 4B2YA 1XIVA 3VI3B 5JJBA 4GPD1 3VC7A 5L53A 1SKMA 4FC7A 4WINA 5JAHA 4KMMA 3N75A 4C7OA 2YZKA 2V5VA 2OXFA 2H1LA 3N07A 2ODPA 2V3SA 4L73A 4ZCSA 1QCDA 2PVCA 5LQSA 5C4GB 3GJTA 4CEJB 3KJNA 4UDXX 4GDFA 1UBLS 4GLSC 5TIIA 3I8XA 3TIGA 3ZNHB 5J4LA 4JYZA 3C3CA 3KR0A 4C2TA 1GSAA 1NV9A 2K87A 4JLVA 3AHJA 2JGEA 3VPAA 5SYMA 1U7WA 4M38A 3IR7A 5L8VA 2V1UA 1KI6B 3AJAA 1GGJA 4TYNA 2PDAA 5F52A 4HJRA 3FY4A 5CAEB 2VDWA 3UY4A 2QMHA 1V8DA 1F0KA 2AZ4A 2C5SA 4PBSA 2CXRA 3H65A 3DJYA 3OT1A 2OGSA 3QVOA 3WSTA 3V9AA 1SBTA 4G09A 5GJBA 1U5CA 1N2SA 4PZPA 2IFTA 3DE4X 4B6SA 4CFZA 2KQ7A 1TFUA 2WWXA 4GF5A 2C5EA 3RG8A 4U02A 3FRIA 3EK2A 4PAGA 3TD2A 1D8TA 4XWYA 2MBBB 3Q9LA 1LV7A 5L7YA 2B5OA 4IJWA 4LC1A 4WBNA 1J1UA 4XGAB 2AUNA 1E3TA 5KQMA 3NCHA 5JTTA 1TRKA 4ZHQA 1W73A 3AFGA 1X6VA 3QELB 3ZYCA 1YQDA 4UMEA 1GKIA 4FZ3A 1NG9A 3EIXA 4HATA 1MVOA 1N0HA 4R1QA 3HDQA 2I65A 2GBLC 3WWDA 1EVQA 1HNXB 4JAVC 1BD3A 4TZTA 1ZD8A 1DIGA 2AWNA 3OTGA 4S04A 4PR3A 3CPEA 2GS9A 2F9FA 4OVUA 2J3IA 4FK8A 2BYFA 4NC9A 1XLWA 2QI9F 3NAMA 1W1IA 3R8XA 2WQZA 3ZS9A 4CJXA 2X5KO 3K05A 4CDMA 3DDOA 1JQ3A 1J7BA 1JKJB 2EDAA 1YQ4B 1Z75A 3MTJA 1SEVA 4Z7JA 1NIPA 4Q02A 5J1TB 4GX1A 3CWCA 4BE4A 3QFFA 3K0AA 1YNSA 3SS7X 4BWYA 4EQZA 4E5NA 2MBQA 4B09A 2W00A 3K9NA 4Q4DA 3NRBA 1NVXQ 5IK2D 1UWXA 1PVDA 4LY0A 3K1AA 1D4ZA 1O77A 3S0JA 3USES 3V7YA 1VRCA 4HS9A 3HJGA 4FS3A 1VHWA 3OUZA 4JI0B 1OAKA 3PHXB 3IB3A 5CB0A 5SY6A 1PSWA 2SEBD 3EHEA 2CVFA 1CFZA 4TMFA 4Q6BA 4HQ6A 5FPTA 3G8YA 2F67A 3JQGB 2BKXA 3D1LA 4JOSA 1Q84A 2FLWA 5KOYA 4D8YA 3W2TA 3NPMA 4HEHA 1C3VA 1C9DB 2L00B 4XVRA 3OPMA 3AY0A 2BLLA 2ZS8A 4UU1A 5LNK6 4MSUA 4M1WA 4TKZA 2KBFA 2HRQA 3AMVA 1LS1A 3AETB 2NU9B 2BZ1A 4FZJA 2M1ZA 4KQGA 3DVQX 1ATZA 4CKWA 2POCA 2C54A 3ZI4A 3WYAA 2JW5A 2WWHA 3GW8A 4WAFA 3JR7A 4AJNA 4Z53A 3T8MA 2QVGA 4K3VA 2G9VA 3HCDA 4GI7A 1KYTA 4MVCA 4WCVA 5KTTA 3RSQA 3JQ8B 2ZPNA 2LEKA 8AT1A 4PXYA 2V3WA 1X39A 5I48A 4HKQA 3GLIE 4UMDA 1U3FA 1UF9A 4ZOHC 5LJIA 1WXWA 2AQ8A 1FFAA 1M73E 4PLHA 3G2MA 1XALA 4MHTA 1V16B 4X44A 1U0RA 3VTVA 1LUAA 1SXHA 2ZB3A 1HDCA 3A9VA 4H35A 4JQZA 4S1VA 1H42A 5ERGB 3DEKA 1OU4A 3TZKA 1AA9A 3AEKB 3QUTA 1NQWA 1CF9A 2VDMB 1XTRA 2DTXA 5H3HA 5IVKA 4MQEB 5LXIB 2IPKD 2PFGA 2VPXA 4PHFA 4A8XC 3Q3JB 5B64A 2VSQA 2HO4A 3KUDA 4B44A 3OU2A 1Z0IA 5E2AA 4ISCA 2NM0A 4GVLA 2Z6UA 1EXNA 4B6RA 4IIJA 5GGYA 2VTVA 2ZJ1A 1GGNA 3UC9A 2KDIA 3DT9A 4JJAA 2N46A 2JFGA 2VH2A 3M1AA 4V0LA 1PYOA 5KDLA 4BV8A 4DV5B 5JWOA 4I9HA 4YFVA 4JVOA 2XZOA 1OQQA 1VKNA 3GGCA 5KIAA 4FCWA 4DJDC 5ED0A 3KQQA 2DKOA 2VJNA 4L0CA 4J94A 2NVWA 3V9PA 2PL9A 2WIAA 3N2EA 5MF6A 3ZCVA 4NCHA 2TRSB 3B9JA 1E4EA 4Z4GA 2D2FA 5CM2Z 1WF3A 4KR6A 4N03A 1HDOA 5JJKA 3QE0A 1XG5A 3UTCA 3EXIB 2OQIA 3I12A 1EFVB 4U6NA 2HFKA 1Z7BA 9LDBA 2FPOA 2PD6A 4XGQA 1QIKA 1TIPA 2WIGA 1GEEA 2IU6A 1FIUA 4G65A 4TVKA 4A8HA 4CV1A 4IWYA 2PV7A 4JCCA 3PIDA 4E22A 2AMYA 2G3QB 2I2YA 4G37A 1Z28A 2FA9A 1R4NB 2MX2A 2AW5A 4RHUA 3VH2A 4MMXB 2R751 1ZS9A 4DZTA 1OT5A 4AECA 2JWUA 4IG4A 5J4HA 2CFTA 4AJKA 1QP0A 3MWJA 3FNIA 4ZRQA 4EG3A 3MMPA 2XUGA 2W83A 3HDGA 3WKCA 3VSBA 2W8BB 3BAZA 2I8CA 5LNK1 2DULA 2CHFA 4GR5A 4KQKA 2GYVA 1Z9BA 3JPWA 4ZAVA 4DVGA 1DKNA 1E2JA 2ZT6A 5EZ6B 2HI0A 3B3FA 1W4RA 1KK2A 2BFMA 4FFBA 3SZ3A 2JLAA 3DVRX 4JY7A 2QW8A 3PHCA 2VTEA 3HWRA 3NBXX 3BSYA 3WP1B 3NKFA 1DQYA 3KB2A 3WGLA 4DCCA 1T2AA 5KWSA 4BAXA 1OXSC 1Z4PX 4HDOA 2R6AA 4TSFD 2OZLA 1TKYA 3MSCA 3M6XA 3REQB 3A1FA 1NQUA 3LB8C 5ARBA 5JCZA 5EJ7A 3PJDA 4ND3A 2XMZA 4OL0A 4HP8A 3G68A 1EVZA 5C8ZA 4CU2A 4EW2A 2I6XA 1OXVA 2JGIA 2ZROA 5HF8A 2P5TB 2FDCA 1N7GA 1QVRA 4J0IA 1NRWA 4CCSA 2B4AA 4RGBA 2CGEA 5DN6D 5IJXA 3DBRI 1NM5C 3SF8B 1PZFA 2DTDA 3VR4H 2PH3A 4IIEA 2GHIA 3C6BA 4FGSA 2QA5A 3GRCA 3A9UA 3K30A 1ORHA 4DYVA 4OAOA 4ZAZA 3OQIA 4QQKA 3TRIA 3QVKA 2YVUA 4YV1A 3T52A 4BVAA 2MJDA 1I2DA 4KNYA 1ZU5A 4RVSA 5JCOC 4O8ZA 4AZ0B 3TQCA 4ITUA 2D6FA 3M89A 3R5FA 1SCBA 3ZR4B 3AXCA 3GLVA 4P4LA 5BSWA 1ZMTA 4DHZE 2X76A 4DK5A 1SEPA 2FY8A 4P3YA 1QMGA 2DFDA 2QNBA 2XUFA 4MJ7A 4EX7A 2WA2A 4PX9A 1NOKA 1J8DA 2ZJ5A 3JY6A 1DRVA 1R4MA 1RYNA 2HB6A 3H1PA 4A6DA 2PCLA 3ZPXA 3C3BA 3P9YA 3MT0A 1QYDA 2G4SA 2IYYA 2UVQA 2MH7A 4ME6A 4BLVA 1HTTA 3DYIA 2KMAA 1GPJA 1EFUA 2WDRB 2Z8LA 4OQXA 5CFZA 1BIFA 1GUAA 1M2NA 3LDHA 4M54A 1M5TA 2Q0QA 1ENPA 4J6EA 2X15A 3P9QA 2YV2A 1MIOB 1AMUA 1Q1AA 3KB1A 4OHKA 3ANTA 4M87A 4C0KA 3IV6A 5K3OA 3E53A 4WNIA 2JFOA 4Q1AA 4UMVA 4IMPA 1RWQA 5IKCM 2VK8A 3W2DA 1GSHA 3IUBA 1XD9A 3Q8AA 2KDEB 2JI8A 2WXFA 1E99A 1G55A 1A7JA 2NAPA 2EU8A 3UHAA 3RSFA 2AHRA 3BJZA 4DPKA 1JROA 2EAUA 3NTVA 4MWCA 4EGAA 221PA 3UYLA 5CVTA 4OATA 1A8HA 2ZJBA 5C3UA 4MROA 3JD1A 1HZ6A 1AQ6A 1YC5A 3WLMA 4RNDB 4GRAA 2WLBA 4G0WA 1F4VA 3HA7A 3REOA 4CEHA 2ZSIA 4B47A 5L3ZA 4MP6A 4F3KA 1U8EA 1P60A 1ECGA 1QGDA 1RDFA 1B6TA 1OBCA 4ESOA 5ALDA 2BKEA 3KJGA 3PRPB 2VXOA 1CUCA 3E9SA 5C1OA 1L4KA 4ND6A 3ZK7A 1IN6A 2OEDA 3AJRA 4DY4A 3P1MA 3RC3A 1EK1A 3EBOA 2UZ1B 1PDOA 3B60A 1X8LA 4DR3B 4HJXA 2B34A 5CX1A 2YY6A 3KSAC 4FXCA 4P80A 4RSMA 5HJEA 2ZJZA 3R5TA 1CY4A 1NFFA 2AWTA 2VLBA 1IHYA 4HUQA 1HEUA 3NR2A 5GIPE 1NTOA 2JSVX 4A8PA 4KXLA 5JSZB 2WVHA 1U9YA 4F2HA 2BMFA 3T54A 5LD2C 1OYYA 3T7KA 4FEEA 1J39A 1T6BY 1I13A 2NYRA 4MP8A 2DFLA 1XTZA 2DFTA 4HSGA 2FPRA 2AK2A 3G9XA 3F0TA 3GA5A 1PJ2A 1Q57A 3LIPA 1XDGA 2FW0A 1NVEA 4N39A 5ECYA 3BIJA 4PIMA 1I6WA 3D8NA 2P3QA 4W9HA 2AQ3B 3ML9A 4X6XA 2XYPA 1HA5A 3H2YA 2HGSA 3L6DA 2AXPA 4A2QA 4HB2A 2NU8B 3H9UA 4OW0A 2FFJA 4PG6A 3NZSA 2JIDA 2OG1A 3P9SA 3P97A 1FU8A 4FYYA 3BFVA 2F1HA 1GGHA 4OD0A 3DDSA 1T3LA 4MVYA 4M9SA 5GOZA 3RT3B 1N4AA 5JAPA 2VCHA 2PRZA 3CRW1 1FSZA 5FUXA 1NW8A 5EA2A 4WECA 4IXTA 3FNQA 4JUCA 1V4VA 4L1BA 2I4LA 1E6UA 1VLHA 3IPYA 2GI9A 3ZV5A 1ZD1A 3LBYA 3BGVA 4J43A 2JAXA 1GC7A 5LFAA 5LR6A 3OQHA 1AUVA 4ROTA 1A77A 5ARDA 3RT1A 2IWRA 4QDZA 2O54A 1Y1RA 2E85A 4F60A 3H6NA 4ID3A 3KOMA 2CCGA 4XVHA 3RIEA 1NP7A 1NTRA 4LDJA 2QVLA 4QNMA 4IHAA 2EVWX 2GPNA 1DT5A 4HGPA 2J3LA 4TTQA 3DZJA 1ZXXA 3R4VA 2YCBA 1MVKA 4YR7A 1XTIA 1UXOA 5LU8A 1DDIA 1X1TA 4FZVA 2ES4A 5I4BA 2QT0A 3K92A 2WWVD 1SWVA 2FUCA 4BJ6A 5K0ZA 2PE6B 2A8YA 4S1TA 2IU3A 3I5MA 2ONQA 4GGPA 3WL4A 1LRJA 4UBIA 4KR9A 5INTA 1E0DA 4YR9A 1J97A 3CR7A 4MRMA 3QBEA 1TZBA 4UTRA 3DBHA 3ZY6A 2X8JB 1VJ5A 4E2WA 2YV5A 4YO8A 2CDAA 3TSWA 5BVHB 2Z8YM 3G85A 1CIJA 3B48A 2QTBA 2QE7D 4ZT4A 1RRBA 4XDYA 2BEUB 2EZ4A 4BGUA 1Q3TA 4JSRA 3PUYA 2ZSDA 4R69A 1GV0A 3UT5B 3ER9A 2KWUB 3BYYB 4KWHA 4MRNA 2OB1A 3CRRA 2XB9A 4D43A 1FEHA 4AQYB 1E79A 3LF1A 1CWUA 3BMOA 1QGYA 1PG0A 3PUXA 1I5EA 1SUBA 1USIA 5E7JA 4NBWA 2MINA 3WJ1A 2B35A 4EITA 5FWAA 2OUKA 1JWMD 2NSLA 4BWFB 4MRAA 5HVNA 1HYQA 4LGVA 2VF5X 2D06A 2RMMA 1GY8A 4ZD6A 1T8RA 1AG9A 3U4CA 5K0FA 5AH0A 3OLCX 1HYBA 2PNJA 3K09C 3FIJA 3SC2A 3R7QA 2QM7A 1SGWA 3AR6A 1QE5A 2H7VA 3H8HA 1I7QB 3PFFA 2QSDA 1YD8U 1GDHA 2IPAB 4G0OA 2RGDA 1S8FA 2H7XA 5CA0F 3GIDA 5KYWB 4TWBA 3AEQB 3OQMA 1K27A 2PS1A 1MRZA 2VJBA 3BXPA 2YZMA 2LRUA 3QLTA 3HKBB 3W4IA 2PUJA 5ICCA 3LOPA 4KOEC 2C2XA 5CA0B 3RSZA 2QG4A 2GH1A 1YQWA 4HPMB 3M5DA 4CEJA 2TMDA 4YJGA 2HF9A 5EP2A 2P9QA 3L8EA 1OTHA 2YV1A 1TK2A 3WV4A 3TTYA 5G02A 2PMEA 3U5ZB 1V86A 3CPSA 4V1CI 1EVIA 1R15A 1E89A 3BRWD 5CAEA 5TV2A 4TWZA 5T7BA 3SAJA 5FTNA 2NV0A 1TJ5A 2A0FA 4IKEA 5JDIC 1K92A 1GTL1 4WWMA 4COOA 1U7TA 1ZM2A 4ZRKA 4CKEA 5EPUA 4PS0A 2XDQB 2O1SA 3MP9A 3CH5A 2A1UA 3ZQKA 3DFFA 3SFEB 3PFKA 4G5HA 4C0LA 2JLCA 3O8LA 4RX1A 1V4NA 3SZGA 2R1UA 1V47A 4FXPA 5HHTA 4OLAA 4TRJA 1KJTA 4GL4A 3BXZA 4IBOA 1U8FO 1E5XA 4JLWA 3HGTA 4RD6A 3TEWA 1LFAA 1EFRD 4C7OB 4JQYA 2O6VB 4IXMA 4LOAA 4KREA 1JZSA 2V03A 4HYTA 3WL5A 1RZUA 4DMGA 2J0QA 1L7AA 4PN3A 2GN8A 1BXTA 1QZ3A 1MU0A 3CWIA 1Q20A 1PJSA 2BVNA 2QW0X 4JS0A 3AL0C 1FE8A 3BD9A 1VBFA 3VPHA 2R2QA 2YVCA 3RHTA 2A0UA 2PMKA 4R5MA 4ZODA 3BAFA 1EHYA 4TL7A 3PKZA 5IMSA 5DP1A 3OQ1A 3NT4A 4H1WA 2WNSA 2NXNA 2E6UX 1L7NA 4RIEA 1PTJA 4HL6A 4UNQA 2G9NA 4P93A 3I2FA 3AP2A 1PUXA 4QFDA 4IOIE 2C61A 2YW2A 4JK3A 3K9BA 3MGCA 3A1WA 3CINA 3D8BA 1NJ6A 5I7OA 3VNSA 1U8YA 4GVPA 1EQAA 4ZOCA 1ELOA 1Z16A 4C03A 2PL1A 3C4VA 2PPHA 4RVGA 4LDQA 1U2DA 4ZC8A 3DLPX 1WZ0A 1AQJA 4WBNB 2Z4SA 1O95C 1PZNA 4Z9AA 5DWQA 1XZPA 2RC5A 1L4YA 3NGLA 3ZBTA 2X4IA 3JQGA 3OIYA 4Q9HA 2NX2A 3FETA 3M62B 3GVCA 5FLEX 2GMWA 3EUB2 3TKLA 1NKVA 4NU6A 4IUYA 2R7NA 4DR4B 1PL6A 1JHQA 4M1ZA 4CMEA 1DBRA 2YHSA 3PE4A 4M0FA 4LUCA 3C7KA 1NW5A 5ICEA 4YAJA 4D45A 3IPCA 1JHZA 4QHSA 4F4UA 2IH2A 2ZRQA 5LB2A 3NDJA 1UJ6A 3T9CA 4CDNA 5J5VA 3TR6A 1E4VA 4RQTA 3K8QA 1XXGA 2LMCA 4D80A 2ZK7A 3AETA 2NU9A 2AJBA 4RGYA 4OQNA 3RYFA 1HC7A 4AY3A 2P30A 3NWEA 2WXQA 1GQ2A 2CY0A 4IFIA 2QX9A 3NZ3A 2C2ZA 3K0AB 1EGVB 4MUKA 1GDTA 2IPXA 1Z0KA 2EFYA 1I9GA 1EEHA 2Q07A 3LPAA 4PQYA 3K1AB 3K9HA 1UEXC 3TSSA 4I66A 4N76A 4NXMB 4OF4A 1O6CA 1MUUA 1N2OA 3FGZA 5JBQA 3UA3A 4DV3B 2WD7B 2R86A 2E1RA 1W87A 1V5IA 1YDFA 5BURA 1XXLA 4KLRA 3ZZTA 2M0XA 1NYQA 2Z8YA 4E33A 3Q8EA 1YN3A 1Q15A 4BN4A 1MAAA 4GXBA 1HEIA 1I4GA 4OH7A 4DHZB 4MQEA 3E3MA 2O5RA 3Q3JA 2Z2XA 3FTDA 1P2GA 4RM2A 2X3UA 4WIAA 2NUBA 3UOWA 2GF2A 2WJ4A 3AE5B 2WJAA 2Q99A 2WYHA 4TKUA 2TYSB 3E0QA 4H7DA 2DY1A 1HZZA 5ITWA 1XSEA 2QR2A 3NLLA 5DLEA 4HN9A 2HQOA 3D32A 3ILYA 3ORYA 5EQFA 1T2EA 3CH7A 3OZIA 4CKWB 3JVVA 3CF2A 1EGQA 4TZKA 2NG1A 1NAHA 5M3BA 3A6HA 3ZLVA 4HAVA 4GSLA 4GI2A 3R6GA 3N6VA 3UT6A 2YIVX 2IZVB 2IBIB 1G0OA 4XYLA 2FUEA 5DBGA 4JLKA 4U9HS 3EFOA 4U63A 1NXOA 3U4MA 5KNDH 2PS0A 3WZMA 4FMBB 4HDMB 3KAJA 1UMKA 3L79A 4W1RA 1WO8A 2ZJ0A 4C06A 4RF5A 4URUR 4D4JA 3VX4A 1EFVA 2HJWA 3O4GA 4TL6A 4M1KA 5D2MB 3QBTA 1P4RA 3OZXA 3EOBI 1E3QA 2RH4A 1H2FA 3GRVA 2PU7A 1FRDA 3ZE7A 4ITRC 1UPTA 2DHDA 3KUDB 5CVUA 3NG1A 3U7GA 2OC4A 1ZAYA 5E8RA 3QZUA 1W25A 4IIJB 2GDJA 2WIBA 1JMKC 5DXFA 4K8OA 2ZYRA 5DMXA 2Z3ZA 5JQWA 1BQ4A 2NNWB 4DIDA 3A0UA 4HBGA 1FK8A 3NRJA 1T8TA 1SCUA 1RT9A 5JSHA 2QRMA 1VR9A 2P9CA 2ERXA 4WCFA 1DCTA 4MW6A 1EFHA 1YWGO 3CR8A 2E4YA 2H4YA 2JAPA 1WIWA 1Y4ZA 2B1GA 4LV6A 3QJ5A 3PSHA 4CL0A 3D2AA 3KT8A 1Z7EA 2ZUFA 3WIMA 3OJLA 1ZN9A 5AKKA 4RQBA 4R8RA 4C7YA 2PUWA 1Q6ZA 2AKAB 3RADC 3ZXXA 4DR5B 2XQFA 4Q3BA 3U3KA 1LZLA 2UU9B 2ONZA 4BO6A 4ER0A 3KP1A 1IC6A 3M4NA 1P18A 4DDID 3ITKA 1OQRA 2Q6OA 3OOEA 4NPHA 3REQA 3W04A 3ZWBA 2P78A 3DMTC 4F04A 4LXHA 1KYIA 4NH4A 3LW7A 4E3CA 2ZUCA 1G3UA 4YRSA 4IWPA 3VO2A 2B5VA 4MV4A 1YZFA 2OD9A 4AQDA 4DV4B 3KOYA 1AKEA 2W82A 2HXGA 2FMKA 3SF8A 3OZSA 2XUAA 2LUOA 1OXKB 4GKAA 1JIUA 4OYYA 2VBGA 1Z47A 2IYPA 3IO5A 5I8ZA 3GQVA 4B48A 2VKQA 3GE8C 3RARA 3BGDA 5DGIA 3PGEA 3LLVA 3SBEA 3IUEA 1GG3A 4FFBB 1E8YA 1D6SA 2ODTX 2YRWA 4XD2A 3IJRA 4FMDF 4R9UC 4RANA 3ADKA 4G2TA 5T3UA 3E22B 7GPBA 1W581 1HT0A 1C9KA 5AUKA 4XQ0A 2WB2A 4AY2A 2A33A 2GR9A 3L92A 2HN9A 1RWPA 2OZLB 2QZPA 2JJ2D 4NZZA 2N9XA 5L4NA 3IT2A 4YV7A 2ZRBA 1JJIA 3KEOA 3ETEA 1WOMA 4FR2A 3VRHA 1LDYA 2NO9A 4HWTA 3H9EO 1FFUA 1W4ZA 1UBJS 3IAHA 1TZKA 4UVIA 4QPCA 4AK9A 1SZJG 2VF8A 4Z9YA 5IF9A 2M6RA 2HLNA 3RIHA 4NNPA 3P9PA 1CDOA 4H17A 3KLSX 1CUJA 1BGXT 5KSOA 2F2TA 2XGMA 4XJXA 3L7NA 4GKVA 4N01A 2OXTA 4JR2A 4CLEA 1OFUX 2QN3A 3RKUA 3KBBA 5HKKA 4G5RA 5I9IA 1WCV1 3PT5A 5C8VA 1BW9A 2FNAA 5EXDA 4P81A 1K7YA 4MW0A 5AOAA 4RNAA 2I87A 2H3HA 4S2EA 3PLUA 2NZUG 5EESA 2GBKA 2F59A 3JQAD 4QICA 4R0VA 3MYYA 4RJ2A 1P4JA 4GFDA 1MEEA 5L45A 3LC1O 5JW6A 4QUIA 4UD2A 3RTEA 3AVVA 3QPAA 3BF7A 1GRQA 4QZVA 4KYVA 3EA5A 3MLBA 4IDOA 1R4MB 3MMNA 2PH7A 4ACAA 1E8ZA 5JZOA 1EP1B 4NE2A 3LUKA 2FWNA 2P2LA 4NDNE 3RVBA 1YMHE 2PZFA 3PHIA 3EXEA 3DLTA 4JASB 3KSRA 3OCCA 4E0BA 3D02A 5CDGA 3OOJA 4W8HA 5ALTA 5FTKA 2BDTA 4FBJB 1A97A 2R8YA 1NAIA 3Q8FA 2DERA 6LDHA 3OEEA 1CR6A 3E3OA 1ZM9A 1DWPA 3V6LA 4S1NA 1K06A 4ATNA 1ZK1A 1DXQA 2BMWA 2FF5A 4NZLB 3FPSA 4LISA 1ODSA 1SU4A 2HJ1A 1Y8RB 2X8AA 1TJ3A 1E3JA 2WXGA 2X7HA 4KO2S 2Z9CA 2O5CA 1W47A 2PRIA 4AZTA 3D6NB 1D5XC 3EUEA 3L7JA 5COQA 3T7RA 4PYOA 3E5MA 1DRJA 5TR5A 3FIUA 3NBAA 2W98A 1X7YA 2IUTA 4DV2B 1KMMA 5BUCA 1H9BA 1NLZA 4C01A 4HNSA 2JJ1A 2R60A 4B1FA 2VAVA 3BJIC 1DAIA 1P6XA 2LGXA 3OC6A 1CQPA 3S5UA 5BYAA 4LDTD 3T1YB 4YJKA 3PQ4A 3SD7A 1OBHA 2GVDC 3G0HA 3FI0A 4XX1A 3L1JA 3KYDB 1YASA 2J52A 3OZGA 2VDKB 3U1BA 3HR8A 2AOWA 4A8TA 2OFPA 3UFXA 1ZY2A 3GDOA 3QXXA 4ANUA 5CX1B 1TKGA 1BCRB 2F1IA 1RAHA 3FSRA 4CTOA 4D02A 3D0QA 2IY0B 3UKDA 2KS6A 1DADA 2AWOA 3VPGA 5KOIA 1N2IA 4HUQB 1QONA 3RC2A 1ZGZA 3A2MA 1FPYA 3WHIA 1SQGA 4XEUA 2R97A 3UPDA 3WMRA 5HUQA 4EKIA 1ML3A 4CM7A 3EDOA 1U1IA 3KQVA 3K9QO 2WR8A 2WAAA 3FPEA 3R66C 2XZLA 1OPXA 1WXMA 1U9IC 3BB4A 3HPRA 5BQ3A 4Y7CA 1PZHA 3FPGA 3ZN2A 1PYDA 2OORA 1CJSA 4D2IA 1FNSA 2O23A 2Q7DA 4XUDA 3L0DA 3R3ZA 4FHJA 1E3DA 2QMQA 5C9ZA 4RD2A 4H4CA 4AUMA 3M70A 4ECAA 3B7GA 3O90A 3A31A 2ZIAA 3BB3A 3WAMA 1QRDA 1NUHA 4HDRB 3BKWA 1VP9A 3B7PA 1JFVA 3WGTA 1ZH2A 3EQ2A 1Q17A 1UKVY 4JJZA 2FIDA 2PRSA 1HYGA 2FSSA 4X5OA 4R8KA 1WB6A 2ZRMA 5E95A 2NVUI 5D87A 1HL7A 4M49A 2Z30A 2P6PA 2ZWOA 2CXSA 5A05A 2ZB2A 3LJKA 1TTHA 1R12A 3S40A 1XELA 2ZYGA 5T8KA 1H0HA 2X8JA 3M4YA 4AURA 3Q3IA 3C8ZA 5CYOA 5GJCA 3RZWC 2YQ5A 1DVRA 1U7UA 3O8OB 3DE7X 4Q3AA 1X14A 1H23A 1VE3A 4MGZE 2XEDA 2GBIA 3UT5A 1VLJA 5IANA 3FWPA 4UNSA 2AFIA 2Y4NA 3BUSA 2WDTB 2Z2KA 2Q62A 4WXEA 1QRRA 1KVSA 2D2VA 2H4WA 4E7PA 2YH2A 1BO6A 3AEUB 2D3CA 5HM6A 3TLCA 4YRTA 5ECGC 3W5IA 2Z43A 2K8HA 3RS2A 1U9ZA 5TPZA 3HIZA 2HEGA 4QOIA 3ED5A 1QLBB 2BISA 4EFDA 1HOTA 3MERA 5C3MA 3ZHTA 1FIQA 3ND5A 1GNLA 4O33A 2X42A 1D1PA 1RXSA 1VBNA 5HFJA 2V6GA 3AG5A 3DTVA 5KYWA 1WGGA 1VYTA 1JA0A 2YVKA 4OK6A 3H83A 5TMPA 4FYIA 3NC1C 1CUAA 3PDIA 2D0PB 4CI9A 2AF4C 2LE0A 3QVTA 5CA0A 4QDKA 5EXXA 3A58B 4FJ1A 3CVYA 1YD7A 4XQEA 1W49A 3Q88A 1LO5D 3RM3A 2G9QA 2B61A 3GNSA 1YHZA 3P9CA 2JBAA 4A5OA 4HGYA 3U6BA 1YGYA 2CCKA 3PHHA 3B85A 5TQJA 1PVVA 3SLKA 2G63A 5AVKA 4US0R 1T4CA 3BMOB 5F1OA 2WYWA 2FWIA 2JIRA 1Q21A 5FOWA 4N12A 5DCLA 1YGPA 4PR0A 1IRXA 1ZN2A 4ROSA 1VMDA 4MB6A 3FHTA 3W8DA 1KVQA 2UXDB 3BG5A 3OJ4B 2W2XA 1U4AA 1QYIA 3MC8A 2A4ZA 5IT4A 3UXEA 3DC2A 2LFIA 2XBUA 4DUYB 4E6PA 3PHGA 3GMIA 3NBQA 4LFBB 5T4EA 5DBHX 3TE6A 5E6SB 4OJQA 1FMAD 3GGDA 3P2IA 2AQKA 5FA8A 4ZOBA 1WWKA 5EIBC 3CISA 1XZGA 3ABZA 2VL7A 1GSOA 4W63A 4N6NA 2V8OA 3FAHA 5FKJA 1P4SA 5GMVA 2JIOA 4P1BC 4JC5A 5JCJD 2O6VA 4G1EB 4XUEA 4UE3S 4OYHA 1OQYA 3CNNA 5A6VA 4R5HA 1XD3B 4I8IA 2PE5A 4ZCQA 4YAFA 3S29A 2QTFA 2EKEC 1TM7E 4YJGB 1PDVA 4IDEA 1DJMA 3AH8A 4R8LA 4E03A 4GDLB 3OOWA 4E2XA 3OOHA 2ZUUA 5KNCA 2YS7A 1UFQA 5AXAA 2JHAA 3BWVA 3NHZA 5BOSB 1GPLA 1SRRA 2E6KA 5DI9A 4KDIC 3DAGA 3GAMA 2D3AA 2VDLB 1GR1A 4PM4A 4UD6A 3PQ3A 3WLKX 4GLLA 2JU6X 2AXQA 2EQ5A 1DI0A 4CM1A 4FSDA 4CKEB 1ULAA 2A1UB 3IYLW 1L4ZB 4U1RA 1OWMA 3KVYA 4QLOA 2QRVA 2A1TS 1AUXA 4RF2A 4LFAB 1V5WA 5IXSA 4BQPA 2KTFA 5L95C 3AY3A 2IYRA 4AUEA 3QFRA 5LZ2A 4H7PA 1T0QC 4M1SA 1LBIA 2PLWA 5EWLB 1K51A 1UQTA 5FV4A 3WMWA 3NALA 4DCPA 2OCYC 5T6MA 2WQYB 1R3DA 1XN1A 1KPGA 1NATA 5D7GA 2I22A 3RYHA 1CPYA 3E0XA 3A10A 5CM9C 2YZNA 1E6EA 1LC0A 1VJKA 3L7AA 1I01A 3BVPA 3TMAA 3M4JA 2Z6AA 1R8YA 2HV8A 4WNYA 4IUDS 4W5NA 3SBOA 2J4DA 1AARA 3L7BA 5LUAA 1LDBA 3DBIA 3D7LA 2NPOA 3WRYA 3DUFB 1EI9A 3WFJA 3HFJA 4J7CA 3EZGA 3LXMA 1O94A 1CYEA 4Z0PA 1DKUA 1MQSA 5E9WA 5E3HA 1RBMA 1E6LA 1L1FA 3D8UA 3FTFA 3CRZA 1T8WA 5K1ZA 4BQNA 2FQYA 1W5BA 5HRAA 4U2BA 2XB6A 3OESA 2YMMA 2P2GA 3IDAA 2BM8A 5DM0A 2COEA 3CNHA 3G59A 2WC1A 1IJBA 5BQFA 1GQRA 3FOAA 4US8A 2PR2A 2Y1FA 5EJGA 1KJ8A 3D54D 3Q3GE 2WV9A 2WD7A 2W2LD 5BYBA 4UBKA 5HQTA 2VFAA 3KPJA 1JA1A 1XFAA 1PR5A 1PT5A 1D1QA 1UAAA 1VPEA 3NBZC 4E5YA 1F4PA 1EP3B 2QPLA 1FFBA 4BGEA 1WP9A 2AFIE 3DL7A 1GA1A 1BVUA 1LQ2A 3BMQA 1VSUA 3NNSA 5HRUA 3FFXA 3I3SR 4JHXA 3P2YA 1FYWA 2I2FA 3PVZA 4YRMA 4WEOA 4HQOA 1E6WA 2G07A 1E7SA 1JQBA 1T0UA 1TQHA 2FSIA 1TYCA 4C89A 4FYHA 2C9MA 2IE8A 1OWOA 4CR8A 3RMKC 3N7AA 3AK4A 3U31A 4OGWA 2OMKA 2K6DB 4GWGA 3RYFB 5E1OA 1V39A 3CW9A 1QR6A 3B20A 5EL0A 1U94A 1IBCA 4MQMA 4DA4A 3PCXA 5FBRB 1N57A 2HBRA 3S6JA 2VHCA 1QO0A 2HCJB 1DP4A 1DLJA 4G2NA 5LP6F 2HYDA 5JDCC 2Z2ZA 3N2ZB 4HKZE 4E70A 2OAP1 2X8LA 3SC4A 1N5MA 3DM5A 2EERA 1FSGA 2HF7A 4P0TA 3DE0X 2I1LA 3RR2A 1EG2A 3P2BA 1FS5A 5LP6B 4HDMA 4KRYA 3PP8A 2OHIA 2C2HA 2FB9A 3FC4A 3OO1A 1EWCA 3OT4A 3GUCA 3WV5A 5BMGA 4D0GA 1G6HA 5C23A 2OV8A 5ILOA 3DEIA 4IWXA 1A70A 1DG3A 5IVDA 1TL7C 1X1AA 5DHSA 4US9A 3PC8C 2JRIB 3LXFA 2ZYWX 3TMPB 1DEXA 3FA2A 4MLCA 1JQLB 1RC0A 2V6BA 1E3MA 2H57A 1JDTA 1Z08A 4V2IA 4TKUB 4Q93A 1RFKA 2LGDA 1G8FA 2KMCA 3LZCA 4B31A 3NFRA 1UXKA 1L7PA 5B7PA 4JZYA 2WLTA 2VHYA 3T35A 1HT1E 3L3BA 5I4DA 4W8GA 4DGQA 5TF0A 2IXDA 2C8JA 2IXFA 1LJLA 4H60A 3F9IA 1N2GA 2GX6A 3FDIA 4DLXA 3I0ZA 2JIMA 2VDPB 4FCTA 1F0NA 1AHHA 2GN0A 4XIJA 1Q1GA 1YN5A 1RSZA 4DMFA 4OM7A 3L17A 1RAIA 4C4SA 5IEJA 3EPJA 3KJXA 1H6BA 5I9LA 3EFOB 1Y1KE 1SXPA 3E03A 1BZYA 1SBNE 1SQFA 2V97A 1A2OA 5A2GA 3RVMA 1N63A 4RMHA 1KI7A 3P9IA 4GQBA 3RBVA 5HJ5A 3C6KA 4B3XA 2B30A 5B58C 2IHJA 3BH0A 4GZLA 4X63A 2PVPA 1U98A 3ZD7A 2FEXA 2WICA 3SMQA 1COWA 1JIIA 5BOVA 3SS9X 3BYZA 3VU1A 1HMPA 1T1IA 4HLUA 3CRQA 1Y4DE 4NAHA 4NCNA 5CUQA 1GPUA 5DX8A 3NXSA 1UXGA 1NLYA 4IWNA 3LHDA 3PO0A 3QW2A 4KMRA 4I50F 4I3FA 4Z1MA 5FUQA 1RLMA 1UUFA 1SCUB 4QAYA 5IASA 1M8GA 5HSGA 1RXEA 3PQ8A 4WCFB 1JL3A 1VSVA 1JJVA 4I50B 1L5QA 4ZVSA 3TQRA 1V9JA 1KEKA 2PSFA 3A1SA 4BFXA 4YMHA 2ODNA 2IDMA 3TQIA 4IZIA 4A23A 1E1QD 2J3QA 5I4KA 4J29A 3R7RA 3HN6A 3LXXA 2Q5IA 1T2NA 4UM5A 4H18A 3E22A 4W9GA 4YTNB 2WIDA 2KWDA 1OI2A 5JXGA 5CHFA 2C00A 5A02A 1WM3A 5JO9A 3KZXA 1H4SA 4G24A 3UXMA 1T3SA 3W2HA 4DILA 1RAGA 5E1DA 3A36A 4JJGA 3DFZA 4GD3Q 3AVUA 2FK7A 2F55A 3A6JA 3L4KA 4ZAYA 2GK3A 2UZ4A 1KLGD 4HK2A 4WZ6A 4AJEA 5FAKA 2CL6X 2VYVA 1EDBA 2Q46A 3JQ9C 5TGTA 3GLHB 4UARA 4CCYA 2DETA 2NYVA 1WXGA 3CVWA 2CL5A 5FTWA 3GEDA 3TF5A 2F8TA 4FUTA 4EDFA 4GWKA 5DGHA 4XAQA 2JFXA 5JS2A 4D44A 1N34B 4ZEMA 3JWPA 1TM2A 1H4RA 5FK9C 4URVR 1ZUD2 2Q3LA 1CETA 4GGMX 2VHTA 1SPBS 1DC3A 2QRKA 4QU8A 2O06A 5HBRA 3NIBA 1R88A 3GD5A 1GGFA 4LXUA 4PYMA 1NNSA 1OX6A 5BSGA 2ZPUA 2AN9A 4E46A 3BRCA 4IJKA 1N2JA 1U80A 3OCJA 1H4QA 3WYBA 2NZ2A 4W9NC 1SQ0A 4ZKEA 2INGX 2C5HA 3ONDA 2Q5QA 1KI4A 2QU7A 3PR1A 1Y80A 2F3PA 4DJ5X 1X1MA 2XUOA 1ML4A 3G5AA 4PYUA 5E6OA 4ZK2A 4QXQA 2GCEA 1QV9A 4KODA 1AD2A 1SVOA 1SUPA 2G9UA 3AO0B 2R8OA 3H1EA 4K7SA 1GZ5A 1QS0B 1UODA 3BFXA 3CUSA 1YXMA 3KEFA 4RZQA 5D3IB 4PXAA 2JXTA 4RLHA 3I9LA 4TTIA 5F2OA 2X13A 4Q18A 2RJNA 1U28A 4NEGA 2GPYA 3E9EA 3A3YA 2ODQA 1CP2A 4BO0A 1CS0A 2AD5A 2CYBA 5JHHB 5GVSA 4F97A 1UMCA 4OO3A 3P5BA 4XVQA 3D6JA 3GRFA 2WA1A 2JFFA 1EF5A 1JR3A 3A4IA 1IVSA 4DIFA 5CD9A 4RTJA 2QVCA 3LUCA 2GYWA 1BW9B 2EW2A 4D81A 3S28A 1NUAA 1EIWA 4LHZA 1VM6A 3TAUA 1Y8RA 2J3MA 4IIFA 4Z54A 3E7XA 4F2DA 3RC1A 1XZLA 4Z0TA 4ZPJA 5KTNA 4BIMA 4ZDIA 5M34A 4YCAA 4CLHA 2INCC 4G26A 1CVLA 1Z74A 4FZ5A 3IHPC 2AXEA 1K8XB 4M8SA 4RMAA 3UUWA 2M1MA 1AK9A 2VSFA 4FFOA 4N40A 3IUNA 1SEBD 4L4UA 3KZMA 1YZTA 5JJCA 1WA5A 3A9RA 2HRRA 4HUTA 2VH5R 1V3UA 2QVYX 3TLXA 2KX0A 4GB9A 3T3MB 3G0CA 1I7LA 2CNBA 1UP7A 3QLVA 3KYDA 2BM0A 1KZHA 4QUDA 2C94A 3M33A 1GRRA 3CZCA 10MHA 2XYRA 3Q72A 4FEGA 3GRPA 4I5EA 3EXEB 4R9RA 2ZUBA 5I7UA 1VE6A 1JEQA 4ZOQI 3NDRA 1ESMA 4TTTS 1S8OA 1BCRA 1CUGA 4UTZA 1KJ9A 1XLUA 2DWCA 1KL7A 2ZRFA 3EDYA 4NY0A 1QTQA 2XUJA 1ENFA 1C9NA 3WC4A 4MTLA 3H2BA 1RRVA 4KN6A 3PENA 1GNPA 3NUQA 4CR7A 1N25A 4YRBA 2O0HA 5F7JA 3ZX5A 1FBTA 1GU7A 4G0UA 1X7YB 3V48A 5TQ0B 1L7EA 4P4SB 1GARA 1XYVA 4P22A 4YDQA 1P91A 2EBHX 4GXNA 4GNRA 1JR4A 1G98A 4S1PA 1XT6A 3QWFA 2QLLA 2GM3A 3RTDA 3ONWA 1UFRA 3BL6A 4B4KA 2CE7A 3NUZA 1ESNA 2ACZB 1ZJ6A 4CIYA 4JLUA 4HDRA 3PDWA 3KUKA 2DC1A 4K0KB 3UFXB 2O50A 3S44A 1D8AA 3GJSA 2FUG6 2OD2A 3R7FA 1JN0A 2L82A 3ZE1B 4BKUA 1L6RA 2XUHA 2O8BA 3LYAA 2R6FA 3AU4A 4XCVA 3ZDXB 2B7LA 3MCVA 3JAMA 1SUDA 2EX1A 4C4VB 4NSNA 3AUFA 3KHUA 3QY0A 2L3ZA 2DBRA 1JLSA 3KUXA 1H1TA 2RGRA 3OTQA 3O8OA 3AHGA 2YOFA 3AN1A 3NG0A 4QECA 4DRZA 1P0FA 2FNJB 4WJPA 1J42A 5CXXA 3ZWNA 5FNZA 4P4UA 1KXZA 1N7IA 2ZJ3A 4CHGA 1HDIA 1XEFA 3DUWA 3INGA 3TXXA 4C0AC 1JDUA 3CUUA 4L0QA 4L22A 1XXHB 2BSXA 4KSBA 5B2FA 2OCIA 4MVJD 1N60A 3PIRA 5KSZA 4JIMA 5GZ6A 4PX2A 2GM5A 1NONA 1MVLA 3FYUC 2I6QA 1FQOA 1EZ1A 3QPCA 3AEUA 1I24A 1KDVA 2PBLA 3M63B 2H1SA 4DGSA 5LQKA 4LJSA 4X00A 4UFNA 3CUKA 4TRRA 1KOTA 3AGPA 1A88A 2WX0A 3CEHA 1K5PA 1DDOA 4E07A 2JI7A 2OY0A 4COKA 3C6YA 4RNCA 5KSYA 2PUCA 1A98A 3S2UA 2ZLBA 2IYNA 2VJOA 4HCPB 3DDZX 1R0WA 3EG5A 1MOQA 1ISIA 4MB0A 2C9YA 4PYLA 4IMRA 3VBEA 2M19A 4OZAA 5ESWA 1ZUWA 1QHGA 3QBVA 4ZVOA 3AHEA 3OX3A 2FF7A 4TMXA 3M6AA 3MGBA 4MIYA 1EK5A 4RKWA 1P6QA 3IT3A 5CNIA 2FBWB 3RASA 3F3MA 1XNRB 4XRRA 2IUFA 4M22A 1DC6A 2AFIB 4C0WA 1GGEA 3EULA 4WWOA 3A33B 3BL5A 5FD8A 2RGNC 5I7RA 2RGYA 4WUVA 4HRXA 5EXTA 3W8EA 1Z2EA 4UU0A 5KOHA 2Q21A 3H9QA 1CRQA 1WVGA 4BJ3A 1AKMA 1C50A 1JR3E 4QVGA 3KRTA 4W9FA 2EFDB 5E6SA 5E6RB 1Y37A 3T15A 5C8DA 3SDSA 4EA8A 3DTVB 3ZDYB 1U7PA 3RWOA 1N2EA 1P7PA 2VPWA 3H97A 4AROA 2CSUA 3PDIB 3BWUD 4HLQB 4LK3A 2AL6A 5AOBA 2ZIWB 4M0LA 3G9UA 1NNI1 2Z4TA 2ILVA 3V8MA 5FOQA 4QSMA 1ZEJA 2IZ6A 4YT0B 4KVGA 4UUMA 2O7QA 3SQDA 2YBDA 4EY3A 1FFWA 1C3OB 2JBAB 3OEHA 5ES4B 3PI7A 3EN0A 5KQPA 4W9EA 2KK8A 2YNMA 4GDLA 4FD2A 1I36A 5THQA 4EKYA 2DPLA 3FOWA 1T4CB 1SVUA 3OE1A 5BOSA 2FGKA 3V62A 4XYGA 1K8RB 3Q3MC 1K4KA 1F9JA 3KVFB 1I4RA 3EOAI 3OFND 2P0EA 4Z7OB 3IKTA 2FOIA 1OA0A 3DJFA 4PSKA 3NRCA 2OO5A 3O38A 2QTVA 3DBRA 5DHTA 2ZVJA 4FWBA 5J58A 3UAYA 4KQFA 1WBBA 4AS2A 4RIIA 3C6ZA 1JALA 2AF3C 4WH0A 3BQ9A 2W6OA 3DL2A 2A9PA 4QARA 3I28A 1UZMA 2YWGA 1BS2A 1Q0SA 1YS7A 4R68A 3GIWA 2Q2WA 4I6GA 2RCNA 3U7RA 1QHIA 1NRJB 2QP4A 3MJHA 4NEHB 1WW2A 2WUFA 1N92A 1TIBA 3CC8A 5EWLA 1AO0A 3FNRA 4G4SP 3EASA 1PR3A 4I81A 3RTGA 3D6TB 1C7EA 3ZBUA 3D4NA 4DRYA 2PT6A 1RPZA 4J3OD 4QA9A 1HFWA 2XLCA 1W96A 4NZMA 3NHKA 2G3YA 1PJ8A 1HPLA 1JZQA 1K3TA 1SUFA 1TKRA 3VX3A 5AKGA 1VZ6A 1DT3A 2QENA 3KB8A 4PF1A 3QVVA 3H5WA 3NM4A 5IH3A 1U0GA 4BE7B 1Y7LA 4FJZA 4EGSA 5DOZA 4DLNA 4WUTA 3DUFA 3NI2A 3FKJA 3G8AA 1W0JD 1GNRA 1E2BA 4NVRA 2IQIA 4F56A 1FDTA 3WE7A 1PGXA 1PV4A 2FOLA 4E3ZA 4GN1A 4PQGA 4PZEA 1DV2A 5KJCA 1XYYA 3F6RA 5BV1A 5I6DA 3QNUA 4ALLA 4J03A 1MJDA 3U3MA 4B4OA 2PMVA 3KV1A 4JJFA 4QTUB 4WZAA 5JAUA 4QPPA 2BBOA 1MG0A 2LD9A 2HCBA 1SKYE 3SR4A 2QRVB 1DBSA 1H2XA 1K68A 3ZDFA 3V32A 3GJ6A 4N7RA 2CMFA 3NHYA 2WHYA 3LUJA 5LSAA 4F4CA 4W5QA 2PLPA 3CKKA 1U7ZA 3DZHA 4L50A 1T0JB 4JC4A 4L27A 4X61A 3VH4A 4LDPA 2PYDA 3VPXA 5JH5C 4MUIA 4BO4A 3RYHB 2VUSA 3ZY4A 1E6EB 4JA2A 4PICA 1ZHFA 2Q6IA 3H04A 4P54A 4F3CA 3NKVA 3Q2AC 5K05A 2FWJA 4BVFA 4CM5A 2A0KA 1Z7YA 2PZLA 4BP8A 2CJXA 5D7BA 2DH5A 1KKLA 4KXNA 4EYKA 1DX6A 4PC6A 3VR0A 2G80A 4B7UA 1QLWA 5DM70 1TU3A 2WT8A 1GPH1 3G2HA 4AG6A 3OWXA 2A5YB 4Y9DA 4MEMA 3BWDD 2FSHA 2RGCA 4KXWA 4Z8XA 2XWSA 1B16A 3MC0B 5DT2A 1XC7A 3O8CA 3K94A 1A95A 3CURA 3FTEA 4WWNA 1B26A 5IAJA 2GN9A 5HDBB 3PRYA 4HAZA 1EE9A 2X1MA 4NJMA 4OKIA 2RD0A 3TRJA 3OQVA 4J0JA 5AVRA 4DEVA 4BMPB 2VHWA 3EGVA 4W7SA 5D5HA 5LP6A 1OH7A 1FOEB 2FSVA 4BO1A 1GZ7A 2QW1A 3T0GA 1UZLA 2HLDD 3HXTA 4BNJA 3C15C 4C4XA 2K7FA 4HGZA 5AI4A 4EI7A 4ZGBA 1NVUQ 4XJTA