2VH2A

Crystal structure of cell divison protein ftsq from yersinia enterecolitica
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
202
structure length
201
Chain Sequence
PLSKLVVTGERHYTTNDDIRQAILSLGAPGTFMTQDVNIIQQQIERLPWIQQASVRKQWPDELKIHLVEYVPFARWNDLHMVDEQGRSFSVPSERVGKQKLPLLYGPEGSEQDVLEGYRAINKVLAANKYQLKMVAMSARHSWQLALDNDVRLELGRDDRMGRLQRFIELYPMLQQPDKRVSYVDLRYETGAAIGWAPVFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN FTSQ
publication title Structural and Mutational Analysis of Cell Division Protein Ftsq
pubmed doi rcsb
source organism Yersinia enterocolitica
molecule tags Cell cycle
total genus 30
structure length 201
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03799 FtsQ Cell division protein FtsQ
A PF08478 POTRA_1 POTRA domain, FtsQ-type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2vh2A01
3.40.50.11690 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vh2A02
4K3BA 2X8XX 2VH2A 4C00A 3OG5A 3Q6BA 3EFCA 4K3CA 2MHJA 2QDFA 3MC9A 3NJTA 4PK1A 4QAYA 3MC8A 4BZAA 2QCZA 2V9HA 2VH1A 4C4VB 4XGAB 4C4VA
chains in the Genus database with same CATH superfamily
2QW8A 1HTWA 2BLNA 2ON6A 1BC5A 1H2YA 4P35A 1DTSA 2YWEA 2AJDA 2OGSA 3E58A 1CJUC 4PS3A 2A8YA 1TS4A 1PYWD 5ALIA 3KQHA 3B2EA 2QAJA 3G13A 1Z08A 3ZUGA 5J47A 4PAWA 5ELXA 4K81B 1E61A 1D2MA 5HF9A 4NQKE 3D8NA 2GWHA 5I4BA 2OC4A 3ZKJC 4LJ9A 2ZFUA 4BCBA 1Q0RA 3FCSB 4ICUA 3ZRFA 4DCNA 3A9CA 4IDEA 4DA4A 3A04A 2F4VB 1XXGA 2A33A 2CL6X 1GZ6A 3ZHRA 3UIEA 2B9EA 1WF9A 4QU5A 5AM0A 1T3HA 3V2GA 3EFEA 2C58A 3VVLA 1N3BA 2O05A 5HE8A 5EUMA 1CHNA 2JFHA 3KLPX 3LWZA 1FMTA 4QAQA 1KDYA 4N0DA 4HDSB 3AR9A 4I4TB 1ZZGA 1WPGA 3HM9A 1E1NA 4V02A 2NP7A 3CW2A 4I5FA 3CUKA 4MQEA 2BHNA 4UQPA 3K0FB 3A32A 2VNIA 1JECA 3R40A 1NC3A 1QCCA 1BOFA 2W6QA 4NAWB 1M2OB 3Q7TA 3CHYA 3DAOA 2QGNA 1YJ1A 2YCLA 2XUOA 4HG2A 4AF6A 3C4QA 1N9ZA 4LPSA 1P0IA 3QXHA 5JAQA 1EBUA 1ABBA 3LY5A 4GOMD 3WWZA 5JSFA 4PANA 3L8YA 4TMFA 1DOXA 2H18A 3DA8A 3ADCA 4TM8A 5KYUA 1JIXA 1NQWA 3D6VA 1HLPA 1CR0A 2ZYAA 5A2QA 4DDKA 4R31A 1T5HX 4WK6A 3U3JA 3V4SA 3W78A 2B7CA 1ZKMA 1IZ7A 3DMRA 4R2LA 3K9FC 1TQ2A 4U3JA 1RKQA 2P62A 2XODA 1QBKC 3QKSA 4H77A 4WBSA 3RKSA 3V4FA 4N01A 4DQKA 3VU1A 4CM9D 1RU3A 5L7YA 5IDWA 1LRJA 4I55F 1KJYA 4X1IB 4X71A 1PNTA 3IJRA 3C3MA 3OFND 4ZCPA 2C0CA 5ENVA 1OAAA 2FWAA 5FBHA 4E21A 4HTAA 1T1JA 1U28A 2FN3A 3G2MA 5FULA 2BKLA 1QFMA 4PGFA 2LIPA 4XSHA 2W98A 1TUBB 2VKTA 4L85A 4E5SA 1TAHA 1EGVB 1MOQA 1UZMA 3S1LA 4DV0B 3U2SC 1K92A 3V9AA 2HHLA 4HRYA 4MP8A 3HNOA 4D2IA 4WKGA 3KSDO 4OG2A 3HGMA 4KCGA 2PUHA 2VQEB 4OJQA 1NLMA 2NTNA 1WMHA 3L8MA 3SJUA 1PD1A 3PFFA 4RHXA 4OB8A 3L79A 1HZZA 3HP4A 2EX4A 2DR0A 2GPTA 3QWIA 4QXOA 2IHVA 4MGYR 2CNWD 1N7HA 3X1KA 1SD5A 4IDCA 4AYTA 4MJLA 4I3FA 3WK5A 3QWBA 3KQYA 1HY3A 4N9QA 5DVZA 4C08A 5IN4A 5FPYA 1H6DA 2WTAA 3D8TA 2XCIA 1WH3A 2Q41A 3QVSA 3G8CA 5DK4A 1S89A 2ZUEA 3DDOA 3PNPA 1AM4D 1AXRA 4GOOD 5JISA 2BWFA 3DZBA 3P2KA 3Q1KA 4C7VA 4URWR 1NXOA 5I48A 1US8B 1QK5A 3D1JA 3CIFA 4UPDA 5A9RA 1E2DA 3KWJA 3IVXA 4R9UC 2Q6VA 2I22A 2YQ4A 3K5WA 4AZ3B 2OHHA 1I33A 5DOVA 5A06A 3WJ7A 1UT6A 4NABA 1ESCA 1SH7A 3A6DA 4HWSA 1YFLA 1KJNA 1QHEA 3OM1A 1PJZA 4PLZA 1HTTA 4OOFA 1P0MA 3EA4A 4GSWA 2O6VA 1IBLB 3RIGA 2FZKA 1AU9A 4HUTA 3F5DA 1ZJWA 1RWWA 3SF8A 5BMVB 4MYHA 4MVYA 1JLHA 1YJAA 3B6EA 1P4GA 1Q6YA 5DH9A 4F2GA 3LC7O 4IQ8A 1EFCA 3IIMA 3RF7A 2V7VA 1F1BA 2ZI5A 4Z0TA 2Y92A 2AGVA 2AEEA 4TROA 2I2WA 3A10A 3SGLA 4ZT2A 2BIFA 2G6BA 2VAWA 1MG4A 4LGMA 5AI5A 3OIDA 4WAUA 2CD7A 2Z2JA 3TXYA 5FBQB 3ZBQA 2QU8A 2FMKA 1Z0JA 4ZQCB 3CWIA 2YQ5A 4YMUA 1JDUA 1SIBE 5ANRB 1FRVA 1KI8A 3MWKA 4OHOA 4P0PB 2C2GA 5CBKA 2HU5A 3W2FA 1VJRA 3VOSA 5AI8A 2QNRA 2BBCA 1VIYA 4GBJA 1YHNA 1NPDA 4YRMA 3RYFB 1TZKA 1WV1A 1ZIOA 2D54A 5ALKA 2X22A 1PZGA 4ZP1A 3B20A 2MWSB 2E7ZA 1Z6QA 2XDAA 2AOXA 5CDSA 1BJRE 3W6NA 2DHCA 1RHKA 3JQ6A 1GGHA 1FK8A 3WAOA 3KHSA 1WHTB 1VRCA 2GJKA 4O59O 3IMEA 1Z0AA 1EU3A 3WL7A 2E9SA 3PSHA 1D4BA 1XVLA 3G8YA 4ZALA 4RKQA 3ZCSA 4JEUA 1Y82A 4P58A 4R3WA 2QVCA 3OQNA 2IDZA 1FE8A 2HZBA 3B36A 5FWYB 1U9IC 2JC3A 4JEMA 3IXMA 4Z54A 4MUXA 5C37A 2XITA 4C4XA 2YWHA 1JN0A 1C2TA 3IEIA 2P78A 2KHZA 3PRHA 3NEJA 3BVZA 1MB9A 2CYBA 2ZPTX 2P3SA 3COYA 1IWPB 1VXOA 4E1VA 3P0EA 2QL6A 1EFHA 2JVIA 5GAJA 3HGQA 3FCXA 5IZCA 4QGBA 1N4AA 2YCBA 1R0RE 1TVKB 4O3FA 4KKVA 5H68A 3G79A 5CCDA 2ZWVA 1DC3A 4JI3B 2CJNA 3G1TA 4I66A 3QVLA 4V2UA 4DY4A 3CLVA 5M04A 1FPMA 3DXZA 3WQSB 4QICA 2FQYA 2GMWA 3ENKA 3A6KA 5HDQA 2LFIA 4OATA 3VXKA 4LJ6A 3DEHA 3K9HA 4KPGA 2W8BB 4Q4JB 2C4WA 3SFTA 4QJ5A 3GL9A 1R12A 3QY9A 2ALJA 2IHBA 4C7ZA 3ILXA 4DMHA 3O65B 1EAMA 3BYYB 1YQGA 2WU8A 4WLUA 3UF8A 3UUEA 4KSYA 1ESEA 1YZLA 1KLUD 3EDRA 5TQJA 1EX9A 4YV1A 2VDLB 1XMQB 1KQGA 4BMSA 1P6XA 3BAFA 1KZ9A 1E0SA 3ZNPA 4D8YA 1QHSA 4M1ZA 4DC0A 1NI5A 2UZ4A 1QF6A 5D3QA 3PNOA 4URKA 2XCLA 1ZOYB 2IBIB 2KT7A 1SZCA 4X94A 2OOKA 4A2CA 1N77A 1GZHB 5CHYA 4FOSA 2JVKA 2Y0CA 3VYVA 4WESA 1FXUA 1TJYA 4X6YA 4DHZE 2XX3A 5ESRA 3TRDA 2DH5A 1GPUA 1HQCA 2O7VA 1NJ8A 2C7PA 3MG9A 1PRYA 3GRZA 2CUKA 2KZRA 2IUYA 4QUKA 2V6MA 4GXBA 4GKKB 4YIKA 4KACA 3A9UA 4YWHA 2ZKLA 5BW8A 4HR7A 4R0VA 3EDCA 3C4VA 3ZHYA 4QU9A 3M4XA 2P65A 3A58B 1GPKA 5JO9A 5JNVA 1ZAYA 1SFRA 2G4LA 1UKBA 3UAZA 1YUBA 1FNBA 3OIFA 4OCZA 2ZI3A 3SC4A 1LBEA 4PSKA 1VLJA 4DABA 2AL3A 1DT5A 4LZWA 3C1UA 3QYJA 2R1VB 2QZ4A 4DMRA 1JA1A 2NO9A 1GG5A 2UV8A 1LPBB 1JFVA 3GRPA 2G88A 2RG1A 1KSGA 5E8RA 3CURA 3AHGA 3L10B 2YICA 1K7FB 3VR6H 4EI7A 3DOOA 4LQ4A 2B0JA 5GV7A 1L5YA 1IZ8A 1E5TA 3H8SA 1Q3HA 4LI0A 5J2UF 1X1TA 4XGAB 5CIWA 4WAFA 3EDYA 5LYJF 4WZBA 3I2GA 4QBFA 1X1AA 4DS3A 3FI0A 5EG5A 4CGZA 4IGFA 1WYWB 4ON9A 2O07A 3KKEA 1T2NA 3C6QA 1GYQA 3V34A 3AR2A 1FFEA 2RBKA 5T4EA 3K6SA 1WQ3A 4BLRA 3IKJA 4KAAA 3LXMA 1UINA 1I13A 3TQOA 4NESA 4MZDA 2N9KA 5B58T 3K7EA 1YZQA 3VNBA 4WA7A 1L3CA 1DBSA 3B7WA 4DUZB 1TK9A 4EAQA 4HEA1 3KQQA 2OFPA 3EPRA 4OP1A 4I14A 1FRNA 3T0IA 3L54A 1N2CE 3TUOA 3OBIA 4HXYA 4NE9A 3QEJA 3EBPA 4DNFA 1F5NA 2HK8A 4DIKA 4RWEA 1M0TA 2XMSA 1S7GA 3CJRA 2R00C 4XWTA 3ZYCA 3HJNA 3I9KA 4J0IA 2AQ2B 3KLMX 4BEWA 2ZE5A 2DPHA 1W4RA 3HR8A 3FROA 3KHUA 2EIXA 4AO7A 1U3TA 1G18A 2KLGA 4DLSA 2J3QA 1EU4A 1V39A 4LMPA 2WTNA 6LDHA 1EPUA 3GCDA 2QM3A 3CF2A 5B1IA 2E85A 5KVQA 2ZS9A 1FXTB 1V5GA 3IA7A 4KQ1A 1KIAA 2DWCA 2G9ZA 3JQ8A 4D99A 4JI1B 3DLCA 1GCIA 2NUTA 2FFQA 4IW0A 1DS6A 4U1RA 4RDXA 1V7CA 3AEDB 3P4PB 1N5IA 2YY7A 1NRJB 1GTMA 5K6AA 3R4VA 5B1HA 4C20A 1TM3E 1Y1KE 2WVGA 3PXBA 4IEFB 4X7PA 5G0SA 2MSNA 1QHXA 3EVTA 3FSGD 4R8SA 2I4MA 3FPKA 4LCBA 4QXRA 3W5HA 4BLUA 1KFJB 3CX4A 4MHSA 5DNUA 2JRHA 1UZXB 5K8CA 1AD2A 5TB5A 1VSTA 5KOIA 4N5HX 3GUUA 3HE3A 4GKBA 5TPWB 1TYGB 4G26A 4H7DA 3EC1A 2A0YA 4PQYA 1H5NA 2X41A 3R2JA 5J9FA 1SQGA 1IOZA 1DKPA 1BCRB 3R0VA 5A9SA 1L6VA 3IV9A 2NMVA 3I92A 4YMTA 2YVCA 3ROEA 4MRMB 2Z3VA 3MJ4A 2I7XA 3Q72A 1E3DA 4QREA 4XE5A 2EHJA 2M6SA 1Y3CE 4W9RA 2QSUA 4PYKA 1DRJA 3W9YA 1Z6GA 2XH8A 2R1ZA 2J7QB 3TQIA 1NLUA 2ODPA 4HAUA 5C3UA 1S3SA 3HNPA 4LXHA 3MIIA 2PXCA 2HREA 1EDZA 5BW5A 3BMOA 3BIJA 4R2XA 2H57A 4LAFA 5F2OA 1UP7A 4V38A 16PKA 3HWRA 4NU5A 4ZVVA 2PGDA 4U7GA 4HLEA 4MNTA 2ZUSA 1H2WA 1HR0B 2ZQ5A 4X9XA 4ZOEA 2BBTA 3B3FA 3TKLA 4IIXA 1KDPA 3D81A 4QDUA 1WXWA 2WF9A 3WIUA 5EZQA 2YWGA 4D4HA 4QPZA 5BRNA 3QLUC 1Z63A 4JI8B 3A9KA 3IODA 3HJUA 1FCLA 4YP0A 4ACAA 3SLGA 5CX4A 4LTUA 3NAZA 2WSYB 4QTUB 2QYTA 3PQDA 1FFXB 2O9JA 1EFAA 2D4HA 4KFSA 4V0QA 1WB6A 4QQKA 4G5SA 2D0OB 4WIPA 3ZD6A 1Q0HA 2EXXA 4H18A 1D04A 3HG7A 4TLDA 3A9SA 2RD0A 5L6MB 4OM8A 5THKA 3DXFA 4RTKA 3K09A 4PN3A 3WICA 1JG1A 2M6RA 4V1CI 3BH7A 4YRNA 3BJZA 1KPHA 1KI4A 4R1MA 4B75A 4EHAA 3I5YA 2IGBA 3D4IA 1FXAA 1C2YA 3QPVA 3DH0A 3ID6C 5L6LB 2IDMA 2X6TA 4P4UA 4ZGGA 1UC8A 4M9RA 3M5CA 2M19A 2MX2A 1YB4A 5IMSA 4N49A 1XB2A 3TYXA 1IH8A 1D8AA 2ZVPX 4LCEA 3N9YC 3G8DA 4BHTA 4WJPA 4KWHA 4RF5A 2RHDA 1YACA 1KAGA 4CFSA 5BSVA 4IHJA 3ZY2A 4FUQA 2HLDA 2ZUWA 5ED4A 1ZN2A 1OBVA 1NUPA 1FMJA 3OX1A 2E87A 5ESXA 1HUQA 3IV7A 1CLUA 3CZ9A 3GZNI 4BL5A 1Z25A 3PF9A 1BQ3A 3R7NA 3I6MA 3PU6A 1ESZA 3FD8A 4WFJA 5BW6B 2OCGA 1JEOA 2QUHA 5TGTA 3RUHA 2OMKA 3H1PA 1KOFA 2C57A 4PCLA 2WFLB 3R2IA 1RI4A 3L4BA 4E2XA 2XTJA 4TS9A 5DWQA 5GVSA 5IARA 2YVQA 2H2WA 5D1HA 1T9ZA 1N61A 2FWRA 3Q3JB 5DLQC 3F6YA 2XXBA 4TXJA 1IN5A 1L4KA 4LJLA 5BN3B 1PDOA 4RDCA 1KEUA 5JR3A 2JLRA 3SHQA 2UVQA 1U7WA 3PXUA 4LXTA 4OVVA 1X14A 3I61A 4N18A 3WAGA 1UEJA 1NHGA 1O5TA 1Y3IA 4UEWA 5JAIA 3ZGYA 5KUTA 2W6OA 1QZUA 1WM1A 1KDOA 3FF4A 4F92B 2JIBA 4S0ZA 3T35A 3LYYA 2ZTLA 4LFCB 4B43A 1U0NA 2CKDA 3CF4A 3PDIB 3B9RA 5C8YA 4GL2A 1RZRD 4MGKR 4BBAA 4X1KB 5FWDA 5KIAA 2PLRA 1SXGA 1NEKB 3TJPA 3OZUA 2RGDA 4AXBA 1EIWA 3D2AA 4PFSA 4LBVA 3CLRD 2BDEA 5CU7A 3CTPA 1EUCB 3C85A 5LMNB 3AQIA 1J8QA 2H4XA 1MJDA 2GYVA 4FK8A 2AXNA 4TZKA 2CW5A 1TYCA 5DZSA 3IA2A 5IVHA 1A2OA 3DOFA 3JQAD 1YR3A 4Q3LA 4WECA 2OD7A 5EP3A 5F52A 1TU4A 3K0AA 1K97A 1KPIA 1Y4UA 1OBFO 5COBA 3KOUA 3NDJA 2H9YA 3PRZA 1YBVA 4GP9A 2IU0A 1VGQA 3R3HA 3NRCA 1JG3A 4M87A 4P1BC 5L4SA 4XGIA 1XKLA 5FUQA 1EUDB 3PI6A 2DG2A 5BNIA 2D1TA 4BNXA 3FOFC 2MHCA 2G7MC 2P4QA 4ALLA 4JJEA 3C8MA 3EARA 5KCZA 3TOZA 4C6TB 1J4AA 4UXJA 2R3SA 4OFBA 5DM70 4Z49A 2EKDA 2FMIA 1YU6A 4BWVA 2XB2A 4TLLB 4FX2A 1T9GS 2BGFA 1A3CA 1TFUA 4BNHA 3L1UA 3R0JA 3CWZA 2QL7A 2JLUA 5DM1A 4F91B 2GLSA 4CETA 3M70A 1J19A 4DCOA 3P2MA 4I6LB 4HDAA 3UJNA 1QIJA 3CYFA 3HBFA 2JBWA 3RSSA 4ZKDA 2DQZA 4Q9HA 2AQ1B 5HIMA 3IDAA 4A16A 1ORWA 4PZAA 1R0WA 4UHKA 3AB7A 1L4LA 2HI0A 4UHJA 1VE5A 2AFHB 5EQTA 3SR0A 2NSHA 1QIFA 3SYTA 2R8EA 5CDGA 2FZ4A 4JL6A 5EZSA 1FP7A 1WVMA 3NG1A 1Z7YA 4XYEA 1L5NA 3RKUA 2XN9C 5EYPA 1X3SA 1DV1A 1YL6A 2FK7A 1RM3A 2CVHA 3OZSA 5FKAC 2HSWA 3GY0A 5IJ0B 5DHQA 1L5ZA 4OM7A 1LVHA 3RYIA 2X23A 2DWOA 2IF2A 2DCMA 4BXOB 3DMHA 3G0HA 2NLOA 1YVDA 2QRQA 3VH1A 1ZW1A 3GFVA 1KF0A 4ZI2A 5EJIA 4LY6A 4Y9RA 1GUAA 2PQ2A 1IZYA 1ZA1A 4KN9S 4NARA 3QE4A 3RG2A 3DNFA 4WWMA 2P11A 4LK2A 4TT8A 1P77A 3OZTA 4BNLA 2UXBB 5EJFA 5BUCA 2N9EB 4DYDA 3LYLA 1G3UA 4FW9A 1E4EA 1DC7A 3ISVA 2J09A 3BZDB 4EY8A 1ZDXA 1Q0QA 2XUFA 2O0JA 1KEVA 3PCRB 1MB3A 2IFTA 3N5KA 3WRWA 3MQ2A 3ZLTA 5BUQA 2KANA 1P5RA 3N8DA 4B33A 2ZT5A 2X8WA 1OSNA 2OZEA 4QM6A 4X92A 1WXQA 5DGCA 2I1WA 4F5YA 2IXFA 2F1RA 1WZEA 1Y5MA 5I7AA 3FUCA 2HSEA 3CX6A 4FFLA 1I8TA 5CA1F 4I19A 1ZD1A 2DUJA 2FTKE 4HNHA 1I7SB 1KFCB 3EGOA 3ER9A 3DD1A 3Q8BA 1U98A 3FBGA 4Q4DA 4J0QA 4OI0A 3L4KA 4LVNA 1URPA 2E4WA 3WGUA 2PX0A 4WK4B 3HVDA 1ZSVA 3IBEA 1T6NA 1L5MA 3LUHA 5BW4A 4L1KA 1CUIA 3WNCA 4KOAA 1KETA 2XKJE 3BSYA 1JQBA 4TXLA 3KD3A 3D3JA 2VYVA 5FR6A 2SKDA 5AJTA 1JL3A 1ZVMA 5EHQA 2J5XA 2IL1A 4INZA 3EVFA 4OXNA 3W5AA 3FOEC 1LD3A 3G9QA 2CXOA 2R8YA 3EFBA 3N8IA 3TAHA 1NJ5A 3TQSA 4MYRA 1AK1A 4OHVA 3D3NA 2WE7A 1CB0A 3KAPA 4QLBA 5G2NA 4NNJA 4JE3B 5DGHA 3NDBB 2XUZA 3TG8A 2Y77A 2E0IA 2C2MA 5GPBA 3RROA 3WV4A 3Q2KA 1GV1A 2GXUA 1HQKA 1QFJA 3I04A 2KE5A 3KM0A 5KYKA 3IT3A 1HDGO 3PSEB 1Z0IA 4KDEA 1LLDA 4J3FA 2ZITA 3LUAA 4F93B 1QOFA 4TVKA 4J7CA 4UTOA 3ZUNA 3SSOA 3KVYA 3I2IA 5FWXB 4RNAA 4YJHA 4II7A 4FSXA 4B4UA 5HRUA 3A1SA 1U2GA 2H4FA 4PS1A 3H0EA 1SIWA 1NVXQ 2REQB 3ET5A 1Z5UA 3NUHB 4F86A 4C3OB 5HHDG 5J63A 1MV5A 2NZUG 3SY8A 1SXJA 4P16A 4KO8A 3ZK9A 5D8DA 4ZVMA 3ZHVA 2Z0DB 1ZYUA 1B1AA 2L0XA 4LCJA 4Q19A 4QEZA 5CPBA 3GPBA 2K8CA 4HFJA 1HDIA 3U19A 4C4AA 1B2RA 1XA0A 1XV5A 3OMLA 1JFLA 1NBEA 4E5KA 3NMUF 2ZR0A 1AS3A 2Q2NA 2F43B 3F2IA 2FPGB 1VOTA 1NU6A 3HCRA 2ZS7A 2O2DA 3IPAA 4BMCA 3HL0A 4FYMA 1OROA 3USZA 1GAQB 3EWAA 3NYWA 3C0RB 1S3GA 2Q8QA 3QLEA 4ZPXA 1YB5A 2C7BA 3O0DA 4MM3B 4WZAA 1BWRA 1YVRA 2GYUA 4M0FA 4CF5A 2H63A 2V9PA 3RGWS 2PKXA 2KS6A 1XPOA 3ZQ6A 4M0WA 3RUAA 2X2OA 4REMA 3GJYA 1EM7A 3MXTA 4YAUA 2QMZA 3I52A 2OKGA 1W34A 4ZI3A 3AGPA 3F2VA 4QLAA 5LC1A 3EGIA 3DCJA 2V65A 5KOYA 4QE3A 3WLOA 3ILYA 2Z9CA 3JYHA 4RZ2A 4CL3A 3SDLC 1E2IA 2AZTA 5HUHA 3F96A 3K9NA 4DIFA 3DOUA 1XD8A 1QIIA 5G41A 2VDVE 4MKZA 2Z95A 4ZVRA 3KUZA 2W3RA 2O3RA 5LMUB 1RSZA 2VDPB 5CM2Z 5A05A 2QROA 2AQ3B 2O2HA 3ZU3A 2O8EB 4CEIB 5YASA 4FHGA 1P7VA 4N65A 3HA7A 3RS3A 2B4RO 1Z8NA 3APFA 2OEDA 1NW6A 2PS1A 1I2CA 1B93A 2V6FA 3KAKA 4ZRDA 4ZI7F 1XJ0A 2QGFA 1DI0A 1WXVA 2KFJA 5A7GA 3ND8A 1R6BX 2KDFB 1CR4A 4OXXA 4V0OA 1K51A 2GASA 3K35A 3HYLA 4TKUA 3EYAA 2BMVA 4W9HA 2JJYA 1EVZA 3OZCA 3OAWA 1NBFC 3EH2A 3GJSA 4IDOA 3F0TA 3QXCA 1MHXA 3BZUA 1V3QE 1CFJA 2N46A 1CEYA 2L00B 3LOPA 5HF5A 2VP9A 5J17A 5F78A 3EGXB 3WRXA 1H9BA 1BN7A 3WZMA 3PPIA 4BWGA 2JFWA 1PSWA 2ZJ8A 4DHWA 3DULA 2EV9A 2CFSA 3A1EA 4W9JA 3UKDA 5E7JA 2WJZB 5EMHA 3WP0A 5DX8A 5HCNA 4TKNA 2AOUB 1CZLA 1DOIA 1BKDR 4C4OA 1Z6YA 1G20A 1SR8A 3L1IA 4Q82A 3QHTA 2HSZA 1H2HA 2X77A 4YCBA 4BLWA 2ZDQA 1EDEA 4L9SA 2QX9A 4QXMA 4E1AA 4PHTA 5CCEA 2I65A 3Q5EA 3BL6A 2EP7A 4P3PA 3JVEA 4ZVNA 3A4IA 4TL6A 4X7BA 4U9IS 2VTBB 5DPTA 2VPXA 4RQBA 4JD5A 4OBBA 2WJJA 4CWAA 4HK2A 4K2AA 3QTLA 4WNAB 3H9BA 3VR2A 3WA6A 3KUKA 4C3UA 4HQLA 4KFRA 1A50B 4F6RA 1XN4A 5EE1A 3ZGXA 2QTBA 2VPWA 2I38A 3BVMA 2GHRA 3P26A 3OTHA 4V1CA 2H07A 1PEYA 4BU1A 4J76A 4MWTA 2I9PA 2PZEA 1RWBA 4YDSA 4F5WA 2ZYGA 4HLUA 2AWOA 2GEBA 3PIIA 4IJVA 3HB4X 2YEPF 4FU0A 1TJPB 2LKCA 3BGVA 3V6EB 2IS4A 3CF6R 2WQYB 1FRQA 4EY4A 4J0KA 3RNOA 1VIVA 2WDZA 2ODAA 5L3QB 4REOA 2ZI4A 4NJCA 2GSWA 2WJHA 4K6OA 3PICA 4CGYA 2GCIA 5A4IS 1YB7A 4X20A 3UJHA 1G3QA 3THXA 3VGPA 1VBMA 2FPWA 3OZWA 4FJ1A 1W0JD 2J0VA 2QLTA 5FPPA 4QDOA 3O4JA 4RNCA 1ZDVA 4EYQA 3EC8A 4E2ZA 1E60A 2D2FA 5H5JA 3RRZA 3CF0A 2GJSA 2JFPA 2Z4TA 2KXJA 4R1UA 5A3JA 3MTAA 2XGGA 3OCXA 3ANXA 4U7PB 3NB0A 3H7SA 4W5HA 1WL8A 4H4DA 2BZSA 1UPBA 2HBQA 2XMDA 5FWAA 1TADA 2O7RA 3JZAA 5FK9C 3HI6A 4OMFG 1VL0A 3UHFA 2K6GA 3NHFA 3GJZA 3R3YA 1JQDA 3ZV7A 2LHEA 3HBNA 1JWUD 4Z7JA 2W58A 1QYVA 2OGUA 1BW9B 1IFXA 1KK3A 3Q2OA 4HAXA 3DPIA 3NVMB 4ZU6X 4C07A 1NSTA 4YV0A 2W37A 5TEWA 5KOJA 2ENUA 3GFFA 1CBUA 3DEAA 1YS7A 4H0NA 3X1WA 3A1QB 4Q1EA 4YRQA 3T9AA 2AR7A 3F1LA 1ZJ5A 4BLOA 1CJEA 1QHHA 4U2CA 5CAEB 3H4MA 5IK2D 3NTUA 1U4SA 2ADOA 1K0FA 3PXXA 4OHCA 4KRGA 1PGOA 2VDJA 2XIJA 3U9SA 1DRUA 2ANCA 3DAHA 1HNXB 5KTKA 5B4TA 1GGMA 1HPLA 4PRKA 4O29A 4BZZA 4EP1A 1HA5A 1AXGA 4JHLA 2PXXA 4D0NA 3PEYA 3G7UA 3QRWA 5FOVA 3SQNA 1E5VA 1ODSA 4Q1CA 4JSYA 2H11A 3V8QA 3FYHA 2Q7OE 3HSSA 5IJ9B 4EL5A 5KNBH 2C0QA 3PLUA 4AF8A 2YFQA 2ZWMA 3OQIB 3O2SB 1NG1A 3AB3A 4W7SA 4BFLA 2W6MA 3EXIB 5HA5A 2ZI7A 4CF6A 4DDHA 4PYLA 3CUUA 4UVGA 4RQAA 3P5SA 1L4FA 2CHXA 4KH1A 3IB3A 1Q16A 2PU5A 2XEDA 1Z12A 3ZJVA 1AQJA 3STYA 4EDFA 4RTMA 1KI2A 3PNMA 1AT1A 3CH5A 3TECE 3AEBB 1JMKC 3L7OA 1D7AA 4NZMA 3RYTC 1SKYB 3U7IA 3GRVA 5K0GA 4KITB 5K3OA 1NX9A 1U1GA 3N53A 2XMGA 4ARSA 3UXMA 5JCZA 2WJVA 4UVEA 5H82A 3MMSA 2C7GA 3AEQB 3H2SA 1D2AA 5L95A 1TAGA 2EW2A 2VK2A 4JYMA 2FRXA 3RE1A 3TWOA 4S12A 4ARZA 4Y30A 4PC1A 3OKAA 5K3BA 3CUTA 5HM8A 4DDID 1STOA 3H17A 2V4LA 4J2TA 4EDHA 3VO9A 2MQJA 4XUGB 4NQLB 2ETXA 1PZHA 2PMKA 1VSQA 3M33A 2J3JA 2ADMA 3UWSA 1UWMA 3QJYA 1GGFA 1Q21A 4C7KA 1PSZA 4O1MA 3L0OA 1KK2A 4K1LA 3IR7A 1UT5A 5LYJA 4MIEA 3NYRA 3WDSA 3P0IA 1SELA 4P9NA 1MJGM 5GVRA 3JS5A 4XOIA 5AK5A 1UXIA 1E7UA 2FWMX 4BC0A 3UJAA 5K8VA 1YQQA 2XWQA 1VMIA 1RZ3A 3NFRA 2KYRA 3LVRE 2QUKA 2F1OA 3IVCA 2BYFA 2NU6A 2QAGC 3KB1A 1G8YA 4AU1A 1Z4MA 1GRVA 1JSXA 1OFVA 1SQ0A 4XQ0A 1JQEA 4GAEA 1NI4A 2JFFA 4KR0A 3M6MD 3L6OO 3OPYI 2H1CA 5TJHA 3UAOA 2TSSA 3U0BA 5IU6A 1BU5A 4NCHA 3ZQ4A 1FNSA 2ASEA 3GYGA 3U7QA 1G4HA 2WE8A 2IZ6A 3TSCA 4LNKA 2G0AA 1TW2A 3COZA 1QOAA 3BSFA 1I3LA 4P2BA 2IKQA 1A5BB 4Z2AA 2W4IA 3PNBA 3DMTC 3U4IA 2FHPA 3MMPA 4LGCA 1XQ9A 3AG5A 3DG9A 4BO3A 2C7OA 4Z8XA 2BRUA 2UZ1B 4FGJA 3OHSX 4KTVE 4FT4A 2OXCA 3OQPA 5BQOA 1I2AA 2HYDA 2W9NA 5KVVA 4K2HA 2WTEA 4EFKA 4ZC8A 3IUMA 1K0UA 3N0XA 1QRUA 2QZ9A 2QAGB 3QYAA 1N3YA 3UKOA 3IAM1 5F35A 4CU2A 1V47A 2QSZA 1YZUA 1CW2B 1ZC3A 3EQ2A 4HRSA 1P91A 1T9HA 3PFCA 2WVJA 4X41A 1VKZA 1XHLA 3LOUA 3PTAA 5MPOA 1H8CA 2MWMA 1SQ6A 1VLVA 3EXG2 4R05A 3D3KA 3ABZA 5LQJA 4AMGA 1T26A 1GKUB 5CB0A 4IXMA 2XQVA 4MRRA 5A7HA 5C51B 4KVFA 1M2VA 4IWQA 4NQZA 1NNSA 3LRTA 1A9XA 2B4KA 4KN5A 3ZI4A 1QGUB 2HPAA 2DPXA 5EFZA 3QXXA 4H7KA 2FEPA 4U0JA 4MQUA 1B26A 5AW0A 1MBZA 3J80A 4E4YA 3DJYA 4QQFA 5K0FA 1RPNA 1LFAA 1GSAA 3Q12A 2WNIA 3HB9A 3RT3B 2GRAA 3T4XA 3A4LA 2MINB 4RVDA 3N05A 2WA2A 1KU6A 4BKOA 4BJ6A 4QBIA 1E20A 2ODNA 2YH2A 3AOEA 5GZ1A 2MBQA 4KPYA 1QGED 2ERXA 3HXPA 1M34E 3P20A 2XOKA 1FPYA 1Z29A 1KQPA 2GERA 3PPVA 2OSVA 1AXEA 4NCIA 3MTJA 3FDIA 3PFKA 2CXHA 5KU7A 4EEZA 1DQZA 4ZHQF 1WA5A 4IM2A 1DCTA 5LDDC 3W5VA 1GV0A 2HMAA 4PC2A 5CDFA 3DP7A 2I3DA 5KYGA 1C9EA 2CHVA 5M7EA 1PSDA 2MSLA 4L2IB 2SECE 2OBXA 3EA5A 1YJ5A 2D1RA 4MDEA 4NMLA 1DUIA 4UM9B 1Z8HA 2GZRA 3QF4B 2W6PA 2JPDA 2EL9A 4AYXA 4WXPA 1KAEA 4HUQB 5JCXA 1Q0LA 1JHOA 3G6WA 4W5RA 5A62A 1UJ4A 4ZV4A 1TZJA 4Y1EA 4Q1DA 3VNVA 5KHAA 3RYHB 4DA0A 2BPOA 5EFOA 2H5LA 3GGGA 2QC8A 3KYDD 3ESBA 4AJPA 2UU7A 2OG2A 4JJIA 3QKIA 2Z4RA 4ZGBA 4UNRA 3HBJA 1ZMTA 2BKXA 5FLEX 3VQIA 1J39A 2AN1A 2ZZNA 4AZ0A 3VH4B 2NZWA 1FD6A 4Q4AB 3U7HB 1FVXA 3ZK7A 2G07A 5F4ZA 2D3TA 5H70A 5A3VA 1I2ZA 3LV8A 5ICCA 3ESDA 3E27A 1SVIA 1L7RA 4XDCA 3PX2A 5CMLA 1ECCA 4GPIB 3FHTA 1W0KA 2J3LA 4YJ2A 1STEA 2NZ8A 5B1SA 4ZXFA 4DNPA 4BNJA 1LU9A 2CE7A 3AR3A 1TGZB 3N1XC 1FU4A 4EVQA 4OLHA 4B09A 4DUPA 3GLRA 3W2DA 4B2LA 3CE9A 4BX8A 4XYMA 3RRYA 3RREA 4Z9FA 1NZDA 5AH0A 1Y3FE 3AI7A 1Z5GA 3LMKA 5I7EA 3STWA 1TJ5A 4ENTA 2VF4X 3FY4A 3HCOA 2PGJA 4MI6A 2PE5A 4D3SA 1HEYA 2IPLA 3AR7A 1V35A 2AT1A 2QN1A 5AJZA 4YRIA 3C98A 5AM2A 4R83A 2HPZA 6CHYA 2H1OA 2C9WB 2ZAMA 1GQ2A 3Q7RA 3AP3A 4EY5A 5AIAA 1M1YE 2ZBVA 5LQAA 5GMVA 3T1QA 3B89A 1PTJA 3WO0A 5I7HA 2YYSA 4ISBA 2WD7A 1SA0A 3QOWA 2QGZA 5EJ7A 1MO2A 3AP2A 2PH5A 1CIPA 2IS6A 1OLSA 1UIMA 4MDYA 1GQQA 4K6KA 4X1YA 2J0UA 3LYAA 2ZXUA 3PF8A 1F06A 1XLTC 2A59A 3H87A 4D0GA 1WD5A 1TZ1A 4UBJA 4PHHA 1C7ZA 1WY5A 1R5NA 2JA2A 5LQUA 3EFHA 2Q8PA 1S2GA 4L5YA 2Q1XA 3U7FB 3MZ0A 5CVCA 3NEYA 2P9GA 5CT5A 2V3WA 2PGIA 3INTA 4Z4HA 1GZ3A 4G4JA 3UENA 2WG2A 1JFTA 2F64A 2P0EA 3BILA 2ODBA 4L4UA 3HCAA 4D3XA 3GJQA 2VJAA 5LZ9A 2G7ZA 4AJNA 1NOIA 3PX7A 1KXZA 2RGXA 1FUUA 1QNLA 3A1FA 4YRZA 2GM9A 5KJEA 2JT4B 3IPLA 5H7XA 1EA5A 4FEEA 1JLMA 3CT4A 4HWTA 2JLXA 2XZLA 4C3VA 2CHUA 5DBFA 1UT8A 4ND8B 1ZR2A 3BERA 1DBRA 1ZXHA 1XTVA 2AOVA 2HV9A 2AYOB 2CHZA 5AZHA 2ZIVB 1VC2A 3O8BA 1H2AS 3MCVA 4MGEA 3UZUA 2VZ8A 3AE1B 1BHQ1 4OP3A 2NOAA 4ASWC 4HGOA 2VS1A 4RIFA 2CVPA 1E98A 3U09A 4TN1A 1ZUD1 3FZQA 4L0MA 4L08A 3Q5DA 1VPDA 4ZA2A 2B92A 1A27A 4K9QA 2EZ4A 2FUNB 2IYTA 4XDGA 2A0UA 4PX2A 1EM8B 1FTGA 3JWGA 1YRAA 2WB2A 3ZBUA 3F73A 1JKJA 3RI3A 1IM2A 4ZCSA 1CIVA 5DYWA 2WUGA 2DFDA 1B0PA 2HJSA 1CUBA 3FFTA 1U3GA 3TLGA 4NPCA 1GADO 3LUDA 1KKUA 4OIMA 1TD1A 4U7FA 3BL5A 2AL7A 2CVFA 5FH9A 1RAXA 3TW8A 1WW8A 3JAWA 4Z0NA 3KWFA 2V0CA 4AOFA 1RHUA 4G0ZA 2EAUA 2DERA 3V8MA 4PW0A 3IAAA 3U31A 5F76A 3SDBA 3FWHA 1JTVA 1HI9A 4N6NA 2OFXA 1U9YA 1ZBQA 3TLCA 2G72A 4G5OA 3BBLA 4MJXA 5D86A 1GZVA 2XMCA 1OYVA 1OH7A 3GLHA 2ZIXA 2CV1A 1H93A 3LDUA 5CEFA 2YFKA 2FFHA 3U7EB 1R0KA 1LBTA 2FN9A 4QEKA 4FFBA 2C82A 1Y6QA 5KHLB 4TKVB 3QE0A 1YL5A 2VUTA 2L0TA 1KI1A 1DG3A 3SHFA 3STUA 3MTGA 1IHUA 2FPRA 4DG5A 3E56A 4RPIA 1T1IA 2J53A 4AKSA 4KKIA 1YF3A 4TL9A 2CNBA 3UT5A 4UXIA 2J4FA 4QLOA 4YMLA 1FEHA 5E38A 4IOIE 5AOAA 3R9XB 4RTLA 1KZYC 5K01A 1VG8A 1VA4A 4YBRA 3EAFA 5JJIA 1ATZA 4TQ1A 1BMFD 1AKNA 2I62A 4O0MA 3IPCA 4QYIA 4RE6A 1UOPA 4CG0A 1KE2A 4JNKA 4OU4A 1KBOA 4J1NA 4G9EA 2QORA 1W4LA 1JDPA 4UHHA 4PZUA 4NJOA 1UMBB 1NBHA 2AHOA 3ETLA 2VDRB 3RSGA 3AEKB 3L8CA 3BWCA 1D0IA 3PC6A 1E7QA 5HKLA 3OLVA 4AJLA 4UOZA 1XZIA 3SU8X 3WHIA 1JP7A 3DE0X 4JHXA 1BEEA 2EU8A 4MCIA 2QN9A 1CQJB 3RNGC 1CNMA 2NO0A 1N0WA 3IQGX 1DOZA 1NT4A 1Z07A 1Y42X 4CTOA 4HNTA 2YKGA 3AV0B 4OBXA 1E6EA 1JWAD 4CTMA 1RWKA 2I33A 2P2GA 1WX9A 1NXXA 1Q84A 4D96A 4IZ6A 2K5UA 4EUHA 2M1XA 5AUOB 2BFMA 3L43A 1A76A 1MFZA 4FVTA 3HBMA 5JH5C 3SFDB 2V5VA 4TT3A 3VRHA 4PZCA 3EPKA 4BQSA 3AU4A 2C00A 2W4QA 1PS9A 4EB6A 3IEPA 1XELA 4OF4A 3OX2A 3W1YA 4URUR 2QRHA 4KQEA 1GITA 1R3UA 4KWTA 2RB5A 1Z4NA 1GL6A 2DFPA 3SE7A 3ZDAA 1RLFA 3KXLA 1I0IA 2AJCA 4AY6A 5AOVA 1ZL2A 5KMGB 3UICA 2BFAA 4HK4A 1F77A 1KL7A 2Y3AA 4CLDA 4ZQBA 2WPDA 2QMQA 3AJRA 2RHCA 5B7GA 4J3JA 3WJAA 4C4VA 3V4VB 3O2NA 4Y7DA 2RDGA 4I8XA 4LEIA 1ZMBA 5LNK6 4CKCA 2RJ3A 3O74A 4L28A 4R40A 1V3TA 4CKXA 2IU3A 3P1MA 3B2FA 3R7SA 1E2EA 3CLSC 3UHAA 5ECGC 4RQTA 3DTNA 2E5FA 1EF1A 4L7QA 4KPFC 4B48A 1QX3A 4PPGA 3V55A 1X7YB 4XB1A 5KI6A 4PLPA 3KH0A 2IDYA 1XDGA 3T7JA 3RAFC 4BVLA 4K88A 3LB8C 3RVMA 2GUGA 3BL8A 2KJRA 1RQLA 1A4XA 2C2OA 2HD5B 3OPYA 2PKOA 4QKQA 3RAPR 2PVSA 5G0UA 1V3UA 2VRNA 1R8SA 1KDTA 1QIDA 1CZHA 4JEHA 2JLAA 5ICMA 3VMMA 1I6LA 4GLBA 4QYTA 5KSWB 4FFDA 5SZJA 1T6BX 2HQBA 3A4TA 3WB2A 2WM3A 4IEIA 1ISIA 1P1IA 1E6MA 4J6EA 1NW7A 3P2BA 3NJ4A 1I7NA 5HILA 4RXMA 4JIOU 1OXTA 4YCAA 4O4JB 1P5HA 3GH3A 3QBVA 4GPEA 3V7FA 4BKQA 5AI0A 1SBCA 1P1JA 1C7EA 1KIMA 4FBLA 4LUCA 4ZVTA 2DZJA 1CJMA 2X38A 2HA2A 1V8FA 5C8DA 5K2OA 1SZJG 4CR8A 5JZ9A 2ZIZA 1U0BB 1DC5A 3LKVA 3K4QA 2EKLA 3BE8A 4PVCA 3CIRB 3CTMA 5BSFA 2AKEA 3Q0IA 1WKVA 3VAWA 1DEHA 2GETA 2EW1A 3B1ZA 3PDWA 4NONA 3KCQA 3KE9A 3FILA 1OZAA 4NMHA 4M1MA 1N5MA 4FINA 1VDMA 3DEZA 4NNPA 1YGYA 3LPDA 5FOTA 1B00A 3FUUA 2ZUBA 1LNSA 3KS9A 2R1TB 2IO3B 4L16A 5IUKC 3VR5A 1MEJA 3DC2A 5EZ5A 5FBKA 2IE0A 4GHWA 4M86A 1UBHS 2OO3A 4GNKA 2GHQA 1MPXA 4WBNF 4TKZA 1KFBB 2VKQA 3ZWDA 4COKA 2ONCA 2VRCA 2CXSA 4WKBA 1YAHA 4NU6A 1IN8A 4AJYB 2BR3A 5I9SA 1JG7A 3HRHA 1SHTX 1Z62A 1PR3A 1FYFA 2X0FA 2D1QA 4YI3A 1LTKA 1XTTA 4BTLA 3BXFA 1EHIA 3HZOA 2B82A 3W8FA 5ARCA 3LLUA 4V3CA 2QRZA 3ZIUA 1ZGBA 5KBYA 1I24A 3LZ6A 2WAYA 1S1CA 3BULA 3GFQA 3HK0A 1KMHB 3IESA 2XZDA 4QJIA 4QDXA 4IJWA 4IJ6A 3RASA 2COEA 2WWVD 1KMQA 3F8SA 4HT3B 1DHRA 3A4VA 4IIJF 1XF5L 1WXEA 3TLMA 2V0GA 3FWYA 4TUYA 4DTIA 1N63A 1JPUA 1KMCA 4MS1B 4C7XA 2HPVA 1KHHA 4B6GA 3I5MA 5BV0A 1TC1A 3HVHA 5JSZB 3ZZ0A 3G02A 5DEOA 4BQRA 3PS9A 5L4LA 1Z13A 3ETCA 2P75A 3I6QA 1ISNA 4OGLA 3J81A 4WXYB 4YAKA 4NAHA 3E15A 4AKHA 4G5QA 3W04A 5I4CA 2RGGA 1KJZA 1ORIA 1J8YF 4MUNA 2D5GA 4LK0M 3T3PB 4P3NA 3ROTA 3PL1A 3LRXA 1IXZA 2DF8A 3OPXA 1FFDA 5A4DA 4URVR 2I66A 4L4SA 3ES9A 4J1SA 2REXB 5G4KB 4YONB 1GLNA 5A6SA 1TKEA 4JT4A 4HDMB 1W2HA 4H1WA 1C0KA 4ACBA 3CLUC 1W49A 5BQ3A 2ID4A 2Q62A 3WA7A 1L0YB 4DKXA 3C5EA 4J6FA 2P6OA 2KX3A 3N7UA 3MWGA 1PF7E 1GZDA 4B3FX 2RI0A 3M4JA 2NU8A 4I3GA 1JHUA 5ALMA 2WEKA 3TL5A 1C81A 2CLSA 2L18A 1GO2A 2MCNB 2R2GA 2FQWA 1D0VA 1YC5A 3KQSA 1QC5B 3TIXB 1V5IA 1GNTA 2GH1A 2GARA 4MQFB 1FDIA 4D9EA 4QPDA 3KXKA 3CQ9A 4OXRA 3HU2A 4GZ6A 3JSAA 4DV5B 3FFXA 4AIRA 1JR6A 1RXSA 1RT9A 2OPHA 1TTQB 3CNOA 1UJCA 4URFA 5ECWA 4OXKA 5JD5A 1QR6A 1MC5A 4DANA 3Q3VA 3IAS6 4B8WA 4ND4A 1GPBA 3TZKA 4QT0A 2QZPA 4UPVA 1FSPA 1DKRA 1Q1NA 3KV3O 2VSQA 1LV7A 5TQ0A 4N48A 2V6BA 1TCVA 2PVGC 2HKIA 2ZJFA 2KDMA 1AO0A 3GVXA 2F67A 5LLSA 4W5QA 2ZBPA 1A72A 2X4GA 5TLSA 1PWYE 1NMYA 2FPSA 3U8ZA 4UVIA 1HKUA 2OD2A 2D7CA 2XUKA 2MCFA 4EEKA 5GONB 2CZQA 4OQLA 4DEVA 1BX0A 3ZX5A 2XGSA 1VPWA 1P9NA 5DM2A 1VSBA 5J18A 2BUAA 4MSUA 2QPOA 2JGDA 3FW1A 5JDCA 3HJCA 2BWES 4HQ0A 4CKBB 4A3OA 4G4SO 2I4LA 1CY0A 4O2RA 2C84A 1C1YA 3M6WA 4IM7A 1X87A 1NBMA 3N74A 3DBRI 2PS9A 3T3HA 2HTME 1R1DA 1KVQA 4J4HA 1NP3A 1XZ8A 1G17A 1CYDA 1VD2A 3EFOA 4O2BF 2GZMA 2WU3A 1W36D 1MVLA 4GYKA 5EUBA 5HUJA 1MAVA 3OOWA 3WQQA 2P67A 4NG4A 4DAEA 4KE7A 3KE8A 3ECIA 2IHNA 1I6WA 2IH4A 4LDAA 3JAKA 3TTYA 4FFPA 2XIQA 1HX7A 8OHMA 1ZXLA 1O58A 2ET6A 5FNZA 2X8LA 3T1VA 3RI7C 1J9GA 2OJWA 2WP0A 4GOCA 1NMZA 2VO1A 3E61A 5KTMA 4HCPB 3CH7A 2FKNA 5K3FA 4GLFA 1LBHA 5AKHA 2PMVA 1TLLA 4RGVA 3ZBTA 4FKMA 2QZJA 4GZMA 1J8FA 1RYHA 3EZFA 4XE0A 4BKRA 2GF0A 2KFKA 2HU8A 3QTTA 2G76A 3AE7B 5AYVA 1NR1A 3SI7A 4QWWA 4XDYA 4KWCA 3VPAA 1YRLA 2DR2A 3VR3D 3JQ9A 3H2KA 1Q1OA 2WWHA 4FNMA 1XWWA 4PQEA 4A0FA 3PKJA 4M8NE 3BFPA 4OJTA 2ZRQA 4X6LA 3DCGA 3KDSE 1CJCA 4BNIA 2X8AA 1OGWA 2VT7A 4WL0A 2EG5A 1R4AA 5GP1A 3S8YA 3ODGA 1WZNA 3CNLA 2PAAA 1YJJA 3H8VA 3EE6A 5ICSA 4HX9A 4JQYA 2Q7DA 3H04A 4GX5A 4RLSA 3N86A 3C2QA 3WRYA 2L52A 3C48A 2PRSA 1DIOB 3JARA 3HKEA 1TTNA 1WXDA 1TUEA 5AK4A 5IC4A 2G3YA 3PIDA 1G38A 3WLIA 1YZNA 5ALVA 4JBXA 2KTFA 5ALFA 3KL2A 4ZQIA 7ADHA 2WTBA 1GARA 1K66A 3PWSA 2QMEA 1EZ4A 4UAGA 5C0OE 2J52A 3M1YA 2G4SA 4KQGA 5IXYA 3OC0A 1T3ZA 2PBRA 1XZHA 3ESCA 2KB0A 3WS7A 1TL7C 1XKQA 4FFNA 5IPFA 2LD4A 3DZCA 2O7QA 3EZGA 5DSXA 3C7AA 2C54A 1W5FA 1PP4A 1J22A 5EGSA 4EFNA 3VZBA 2ZRCA 1NVTA 2FMXA 3W2EA 2O0MA 1J0GA 1WUTA 3WYAA 2COKA 5FNVB 1DB3A 2ZRKA 4PO9A 5IFKA 1LVGA 2ZE6A 4I6NB 3USCS 1TJ4A 3FKYA 2R44A 3E3AA 5FUBA 3ZIAD 2MR5A 2KMLA 4R3NA 2WMOB 2R60A 5K7SA 3KWLA 1WXMA 3EEYA 4QYMA 3B9PA 4DUGD 3BK1A 2JEOA 3NOXA 2JS7A 4CM8A 5EHNA 2C9ZA 4UHEA 2QILA 4YRFA 3H1TA 4B7CA 3RJ5A 1Q2UA 4Y1RA 4ZO8A 4X7RA 2JGNA 3A9JB 4ZRKA 3NH6A 4G63A 2Z43A 3WR5A 3UNXA 1BXKA 4G4IA 1J5EB 3R5TA 2BFEA 3AJ9A 2INCC 1XC7A 1D2CA 5CVTA 2IEGA 4RS4A 4GNRA 1PGNA 1UPUA 5E2BA 4DARA 3I23A 3ESQA 3AWDA 4P34A 3RVKA 2WHQA 4F6LA 1U2EA 3G2PA 4OEHA 5F1YA 2VJMB 5IS2A 1DFIA 5C1IA 5CJ2A 3KQWA 1VJ1A 2O2ZA 3FHJA 4DQUA 4CUKA 4ARCA 2EKEC 1V95A 3H5VA 1QQRA 1XCBA 2WABA 2VPIA 1Y9ZA 1DFGA 1EJ2A 1E2QA 3W1WA 4JSTA 4X24A 1G8SA 3QARA 1PR4A 4MJSA 2YXPX 1KHTA 4I55A 2C4VA 5DTIA 1F48A 4FDUA 4JYPA 1WOMA 2N47A 1Z5OA 1O9BA 2CXTA 2XF2A 3E7PA 4R2IA 3NTXA 2PZMA 1Y7TA 5BSGA 1ET6A 5DW3A 3EIEA 5A4MS 4IG4A 4N40A 3ALBA 2A86A 3HUIA 4YAIA 4FCVA 4UU7A 4GECA 1W6RA 3CSDA 3K2BA 3T9FA 5KJCA 3VTWA 2ASQA 4WQMA 1SPBS 3RSQA 4AQDA 3ZXIA 2C1ZA 1EX1A 1Z4QA 2Z3WA 2UUOA 3NYIA 2PUDA 1GKIA 2R4TA 1ONSA 3G9ZA 2J32A 2DHQA 4OW0A 3GVCA 4G1EB 2OD9A 4B84A 1XD3B 5G0VA 3BXEA 4LRTB 4HF7A 1TIBA 4KYTA 3TLYA 4IJ5A 1YNSA 2VDQB 5LKRA 1Z34A 1UP4A 4RPGA 3OY2A 3PWKA 2J0KA 2HZ7A 3KUCA 1W30A 3LBAA 1G42A 1XRLA 3AWIA 2KBEA 4L3OA 3EOZA 4EJSA 4UUOA 4DLAA 2LWPA 2X2FA 5E7MA 3JQFC 3K1TA 1MJ5A 3TRFA 4MV0A 2Z0EB 3SKVA 4RFSA 1UJNA 2GTPA 3EGRA 2R11A 4DM3A 1PJ8A 1ORTA 3HDQA 3O82A 3GRCA 4JWTA 1Q7GA 3AU5A 3IHLA 1UXHA 1O2DA 4G0VA 1AF4A 3D7KA 5F33A 3WLJA 2B34A 4ZDKA 1USVA 3MA0A 5EZYF 3SP1A 2W2LD 1RVDA 3MBIA 3MD9A 3IDFA 4QRDA 2HX1A 5CB8A 1BN6A 4C0LA 1TS3A 1WAMA 1SRRA 4MT5A 3X1MA 4F56A 3QLVA 3O91A 3PVSA 1SBZA 1DJQA 3CW8X 3NHJA 1DEKA 5J1SB 4XWYA 3RSFA 3DDWA 1E3JA 1A0OA 3SIRA 4DIUA 1J2UA 1JT2A 2UUAB 3OLCX 4DCCA 2QVLA 4FXCA 1USIA 3PO0A 3O03A 3ERCA 3W5SA 3OHPA 2WHXA 5C8VA 1RXWA 4HLNA 1DAIA 2AR9A 3IIIA 4BNFA 1K1EA 1JEDA 1AS0A 2BV3A 3P9PA 4JB2A 1ABEA 1AO3A 3ITKA 5AVQA 3EVCA 2O23A 3DWGC 1Z75A 4AUEA 4TQ0A 1QPGA 1XXLA 3VPGA 3BMXA 4Q18A 3PHLA 1TCAA 3AKEA 2FRDC 3U0VA 2WIGA 1GYRA 3D59A 4N9F4 1IPFA 5TE9A 1TTTA 1FY2A 2OBFA 1XXHA 4DJ5X 4C88A 1YB1A 1THZA 4Y18A 4JKOA 4U8HA 4JBHA 3AVVA 4P4GA 5C8XA 2DVMA 5IXSA 2H29A 3WL3A 3WB1A 2PWYA 1PW7A 4GMFA 2UAGA 2O2VB 1L5SA 4EW1A 4MJ3A 1T8PA 1RHMA 5P8WA 3AK4A 4F2WA 1R50A 5FHRA 3TTSA 5H59A 1TO6A 2I4TA 5KNCA 1CQZA 3GB9A 3R7QA 4FHEA 3V8NA 1TY0A 1R3DA 2WA1A 2LHDA 2KC2A 2FW9A 4UUQA 3V1MA 2BUBA 2VP4A 4B3XA 1U8TA 5HTOA 3SJ7A 1P1FA 2PIDA 1UZAA 1MX3A 1B8NA 4AF7A 2ZS8A 5TPZD 2DPYA 4BKSA 1VLLA 2XVXA 2PTLA 1W87A 4PFJA 1IP9A 3A70A 1E66A 3C3KA 3KWMA 5LWQA 3JASA 5T8KC 1UKVY 3AHDA 3GZNA 3WK4A 1W9HA 2ONYA 2F8TA 1NJGA 4M0DA 5EPOA 4ZTUB 2P8JA 1RADA 2QX7A 5ESDA 5HQ3A 3GFRA 4Q00A 2CLLB 2QXTA 3LBHA 4NJMA 2VF5X 1SJED 5B3JA 1ZSYA 5CVDA 3IVFA 2P69A 4YAWA 3N1YC 3G0IA 3I2FA 3A33B 3O2QB 3VGJA 2BSAA 1YFZA 1IJEA 5CH8A 3TTTA 3V7NA 1YS1X 4LJPB 4MDFA 2BUCA 4D74A 2WWYA 4OQXA 3VH3A 1BKSB 3C4JA 2Z59B 2UXCB 2QN2A 3QKWA 4NBVA 2HMSA 4HAVA 2OBNA 3ORFA 1AHIA 3E5MA 2MMCA 1HYEA 3RWBA 2INDC 4Q7KA 1ZU4A 2DPGA 1WWTA 4B3JA 3A1NA 4YTNB 3AILA 2FWNA 4RK0A 3EQZA 1HSZA 3AU8A 4WXHA 1C4OA 3MT0A 1BA3A 2ADFA 3C3BA 1U6KA 4ZFNA 1L1EA 5C35A 2Q3JA 2YWXA 1JTFA 3HKDA 1TKRA 3ZJTA 1XLVA 2J33A 3DBIA 4KGXA 5EOVA 2DYMA 2WS3B 3AKCA 4PIMA 4NATA 1WJNA 2ICIA 5E6NA 3H2BA 2AMLA 5T5QA 5I47A 4XWOA 2C5LC 3WGIA 3LDZE 4CDMA 5IW8A 4WCFC 4AT1A 3O8CA 1H4RA 1XTRA 2GAIA 3A06A 1ZG3A 5F21A 4O25A 1QILA 1MENA 2BSXA 2JIZD 2YHIB 4ESHA 4PYQA 3KETA 2FZVA 4CKWA 3FH0A 1U1DA 3CZ5A 2Q1SA 2GRUA 1XALA 5BVHB 3FG9A 3NTOA 1QQ7A 2AEMA 3ZJYA 2BGJA 1SIFA 5LOVB 4TMYA 1W2GA 5C7LO 3S2EA 4GWLA 4ZRJA 2GVDC 2L0FA 4JK3A 3LHSA 4PFKA 1LS6A 2FSHA 1PT9A 5HMMA 3DBRA 1GNRA 1O94C 4MS4A 4RKRA 2ZCJA 1DKMA 2HMYB 2AN3A 2PR2A 1FCCC 3FWKA 2XYRA 4AROA 2Q46A 1PL0A 4OJMX 1CZNA 1SCIA 2RBGA 3KB6A 4XUEA 1VPLA 5KX5F 3MUOA 3BA1A 4PCUA 1IJBA 2CMGA 1AMNA 2XA1A 1P19A 5KSYA 3RNLA 1ZVKA 2Z2XA 4WCFB 5E1MA 3IAUA 2GPWA 4JI4B 3QVXA 4PE5B 5J2UA 3DO5A 1J0BA 2C83A 3FRJA 5F51A 4LYAA 4OHUA 2WXRA 5I7RA 4OHZA 3RGGA 1RYNA 2AC4A 2JUOA 1DDGA 1GAWA 4HRVA 4M1QA 5JS7A 1OREA 2ZWAA 3QVWA 3MRXA 2VUHB 4YQZA 4JDUA 3EUB2 4HEA6 1M75A 3KELA 2JKZA 3E9DA 3OEEA 3GAMA 4EHDA 2V9CA 3WSTA 4LJ4A 3NHRA 5FBLB 4Q9LA 2BSQA 1NP6A 1YMUA 2BGKA 4DILA 1QHGA 4YJGB 5L3SB 2ZDHA 1KS2A 2P41A 1IUEA 2YWFA 2QVYX 1Z0KA 1AGYA 4MARA 1JXAA 3RS2A 4FMCB 4CIAA 3O83A 3NIBA 2UUBB 3V05A 5JHGB 2IYFA 1KWGA 4C0JA 1E2PA 4BCDA 3WLPA 1ZQ1A 1JEYB 3BCHA 2V6JA 5FUMA 3V1YA 3UYLA 1V6EA 2OHOA 2L05A 3V7UA 4RPKA 5TARA 1LDGA 2OO5C 2Z2YA 1KVTA 2CK3D 3QX8A 4KBFA 4BGEA 4PCAA 2VDUE 3OOHA 2W2PA 1YDMA 4LDRA 2F00A 1Y3BE 1M8PA 3JVIA 3HDYA 1XCTL 3CJQA 1IMJA 5E6RB 1ZK3A 3RVRA 4AMYA 4CHGA 2GEVA 1M54A 2GA8A 4Y9DA 4JS0A 1J8MF 3DVQX 4KQJA 2IE8A 2W6CX 4OHMA 1R37A 4PQFA 1YOVB 5KTPA 1OU0A 4QIHA 4EQ6A 3GLFB 2YN0A 3KUUA 7ABPA 4UHDA 5EXEA 2ZWOA 1AQIA 3HP1A 3JR7A 3OU6A 1Y6RA 1FX0B 4QG7A 4CCYB 2EFCB 1G55A 3LZCA 3L6EA 1Y7IA 2H0QA 3IEUA 5KYYA 5CITA 3RYCA 3ASYA 3S2FA 1M2NA 1N6RA 2IO0B 4ES6A 5JH7B 2ZRMA 3VJMA 2J9FA 2DUUA 2WSIA 4PZEA 1CULC 3K72B 2BKUA 4M6WA 2NSDA 3U48A 2X5KO 4J0EA 1YZFA 1JFFB 1KH3A 1L3BA 3C5WP 1TUGA 4QYSA 1C7FA 5CFMA 1V11B 3DTVB 3FFWA 3TW6A 1M6VA 1D6SA 2MJ3A 1MORA 1Z8DA 3SVLA 3EXFB 2VH1A 4RY8A 1JAZA 3ZX4A 3SXPA 3GQBA 4F8YA 2BF4A 3BM5A 2Q0SA 1ZGZA 4BEVA 5F9FA 4JR2A 3GUCA 4QSMA 1UPCA 3H9DA 3B85A 2GN1A 3TBHA 4HGZA 1ZEJA 2QG9A 5CFOA 5SYAA 2Z2IA 1MVKA 4PZPA 5CVUA 4QOEA 2PT7A 2AUNA 3WL4A 1GL3A 2W93A 4CMIB 3VU9B 2CFRA 2A7XA 1EINA 1M5RA 3LLSA 1ONBA 2N7JA 3HO8A 1IRXA 5LJLA 4IIVA 1IPGA 3QELB 2ZSKA 2XTAA 2YWDA 2F62A 4ZV7A 3PFHA 1NQ5A 1J90A 1JILA 4LRYA 1DRVA 2HQOA 1UGMA 5AZGA 3E9CA 2BGGA 3UWDA 3N2KB 1YZYA 1HOTA 2X4LA 1YS4A 1RABA 4CKEA 3LA8A 1SN7A 1C1DB 3BRWA 4NZ9A 4AZVA 1GUYA 2VG8A 5HF6A 4HSGA 3MILA 2TS1A 3K8OE 2QN7A 3PTLA 1YA6A 5HIAA 1NXWA 1GTJ1 4LOAA 2AG1A 4UUAA 2H17A 5SICE 2X40A 4MLPA 4GX0A 1SO8A 1G4AE 4XFJA 4IWXA 3CPSA 4BCCA 4I36A 1SZDA 4NCXA 1NYLA 3IC5A 4X45A 1QIMA 3QU4A 3Q6NA 3S81A 1FXWF 3SHOA 4KVZA 4XA8A 1FNNA 3WNQA 3X0DA 2OVBA 3O3OB 1HRDA 3IDZA 3HFJA 4QDZA 3X1XA 1PWXA 3NS1A 1U02A 1EI9A 1ZUNB 8GPBA 4R7TA 1XEWX 3A28A 2QM7A 4DDUA 1V48A 5EJ5A 1ZY2A 4X57B 2CVZA 3A27A 3IGFA 4KMOA 1O6ZA 3E70C 3M9LA 1W46A 4E3ZA 2J5KA 4XWAA 2XSZA 4C5CA 1IONA 5B1YA 1UF9A 3RQSA 3MIZA 4K05A 4RNDB 1II8A 3DQZA 4OAOA 5KDOA 4EKEA 1KI6B 2NW6A 3K70C 3BK7A 4CDRA 4KR9A 3VZPA 1PFUA 3SIXA 1QFYA 5JAZA 4U6NA 1T2UA 3U81A 3S5UA 1O96B 3KSMA 4ZZ0A 3EZLA 4WERA 4NXMB 3IB6A 2HQ1A 4PF1A 3P5BA 4ND7A 5KTRA 3U7JA 2LASA 1OX4A 3GGPA 1VRVA 4DSAA 4CQLA 2ONZA 2X2PA 4UUBA 3NTQA 3KV1A 3VTZA 2ZG6A 2PSSA 3PQCA 1XFAA 1ZWLA 3RVBA 3IAFA 1EWYC 3QU7A 4TWAA 1BXRA 4PAGA 3F98A 1WUYA 4WOJA 5KVSA 4KGSA 2ODTX 1G7TA 5KJFA 3ZN2A 2BE9A 1VZ7A 3MWLA 3VI4B 2VQ6A 3DMFA 4KPUB 1OFGA 3HYNA 3UFXA 1AJEA 2X14A 4XRRA 2HQSA 3K32A 3ZDFA 1ZK1A 2EGHA 4D0RA 4RKWA 4IGIA 3W3AD 4P36A 3RUIA 2BFCB 1B1ZA 1F1JA 1BG6A 2ISQA 3K70B 1SCBA 1O87A 2LRUA 2NTYC 2IGHA 1WCYA 3NZUA 1C9JA 4MV6A 3A25A 2YV2A 1OGIA 1GG3A 3L0CA 3HY3A 5G1NA 3ZO5B 3L1JA 2IU6A 3GA0A 1YQBA 3BTSA 4KNWA 2BEJA 2QENA 5LZ7A 3CN9A 5ALHA 5J5AA 2BFDA 1G1AA 3BMQA 3CLTC 2RC6A 5A4JA 3WK8A 4DMCA 1DQSA 3G5MA 3KEQA 1NY5A 2W2OA 3SC6A 2Q5WD 3BB3A 2FRVA 1Y8CA 3EW9A 1YQWA 4DJTA 4EF5A 4ND3A 4HXDA 1J8VA 3HKBB 3PC8C 5LZ2A 3ZNHB 1XK7A 2WYQA 4TVBA 2B0CA 4R5HA 5LA6B 5PGMA 5TX7A 1D1PA 4A0QA 4K9DA 2J5BA 4YMGA 1ZD2P 3IHWA 2BC9A 3TOCA 2B4TO 3FCEA 1IXSB 1FP6A 2G77B 3P0RA 2JZCA 3LP8A 4AIIA 3TMAA 2GJ9A 3NTRA 4RW0A 4AP5A 4LECA 1NP7A 1NYTA 3KYCA 3MSXA 3H9JA 3P27A 5B12A 3TD2A 2PO7A 4ITRC 1JW9B 3TZ6A 1BE1A 2VUUA 2FF5A 1QG4A 2DZMA 2FOIA 4Q0MA 4RE5A 1GD1O 3LS2A 1R6DA 5FBWB 1GU1A 2UVPB 1F7VA 3I6BA 5IUNC 1G9SA 1C0EA 3IUSA 1ODFA 2W2NA 1XWFA 3E8XA 1D6JA 1DTWB 2H00A 4US9A 2IS1A 1Y8QA 3WL5A 3TB4A 1AQLA 3ZV6A 4AG6A 1PVDA 1SKAA 4CT4B 4GDKA 3G2JA 1ZU5A 1IK4A 1PT8A 2FNAA 2H1RA 1A7UA 1PWZA 4I50B 5FUXA 1VMKA 4QPJC 2D1FA 1BO6A 1CHDA 2J87A 1XZLA 1JGTA 3P9SA 4EW2A 5AVKA 1NSYA 1VKHA 3EEFA 5EUCA 1NVKA 1GPMA 2JFBA 5CVEA 5C3JB 6GPBA 3BIWA 2IOHA 3NRJA 4RJKA 4DA6A 1TYEB 2P9BA 4LDTB 4FSHA 1VYHA 2L3ZA 2WRZA 4PONA 4KHPB 3BWUD 3ZHBA 3K9LA 2QY6A 2H52A 1DMRA 3HO6A 3RG8A 4E5MA 5M29A 1EB8A 4BNKA 1QO7A 1NW4A 5UKDA 5TC4A 2OORA 2QTLA 4BB0A 4LF8B 1WXSA 1OQYA 1WR8A 3RC3A 2JHPA 4HEJA 5H9WA 2BZGA 3HLYA 4LNUA 4J7UA 2ICAA 5D2CA 2IK8A 4XLZA 1UD7A 1CUEA 1N9GA 1Q11A 4BYMA 3K0CC 3PWTA 1JUDA 3KXPA 3LY7A 1NU8A 1ZUIA 2QJWA 1U31A 3NV9A 3NHMA 2W2TA 4K03A 2QRVB 2K4MA 4CLRB 3RVSA 2EOAA 2ZUDA 1ATIA 4G1CA 2Y67A 3KD2A 3RIEA 4MCHA 1NXSA 1QHFA 4XX0A 4RORA 1K6EA 4FHFA 2P40A 4OQMA 4G3XA 2P2ZA 2JFOA 2IJGX 4DT1B 1MZPA 1R6UA 1C14A 2R6ZA 2XR1A 1FW8A 3RCBA 1QO0D 4YP6A 1AUPA 1VIDA 3ZLZA 1N6NA 1GNSA 1QRSA 4ARUA 2NPTB 1VR9A 2J59A 1BCSB 4YMIA 4UVDA 4CV1A 3T8YA 1WX7A 5CA1A 2H1IA 2YXNA 2QQ0A 3GVHA 5K0NA 3KQKA 2VWHA 3CJTA 4A90A 4D5GA 4EJFA 4G1UC 1RE1A 3GMTA 4CE6A 3VTUA 3T61A 2H0AA 2XMPA 2H16A 5F7XA 3TQTA 3W9CB 1RYYA 1I0ZA 3IUQA 1JAIA 3HCPA 3N75A 1VTKA 1RQXA 4FULA 3FOAA 4AJWA 3RJ9A 2HDNB 4QXQA 4ZK2A 3SF0A 4FM9A 1YNOA 4AKTA 1SHUX 4HH1A 4P86A 4YV2A 1OVMA 1C3LA 4F71A 2DP4E 3TGPA 4H6VA 1O95A 2V3CC 2N0SB 2Q4TA 1JPJA 4PR0A 1B6TA 3ZV5A 4CMJA 4ZWNA 1UEXC 1E94E 3KLNA 1RM0A 2EMTA 1L3IA 4KXXA 3I1FA 4IV0A 5H83A 5E4FA 4EB8A 2FFRA 5GY7A 1R16A 5KYWA 3A1DA 3UAVA 4RGOS 1THGA 2OPBA 1YZ3A 1I1HA 2QM8A 2H59A 5IX8A 1M1NA 3B70A 2ZB4A 1HOXA 4WFKA 1F2UB 1DCFA 5HKBA 1NV9A 1NVDA 4J4BA 5KYVA 1DMSA 1BTOA 2VNSA 1K50A 1E2BA 4FW8A 1IEVA 3DMYA 4IV5A 2FPLA 1YJBA 1GA6A 4JIMA 3KT0A 5HW0A 1CQIA 2QIPA 4A7PA 5BV8A 3N9IA 1KU0A 4MGZE 1VB5A 4HXEB 2DLNA 4OVUA 3N2IA 1E6UA 3DT8A 4DQOC 4Q9NA 4RD0A 3AF1A 2ZANA 4OHKA 2PCJA 1A82A 1DOAA 1I9GA 4US2R 4N5MA 2KYWA 3QEKA 3L6BA 4CDGA 3DEJA 2AFHE 2F9FA 3GDFA 4MKHA 4KSKC 1PL8A 3GZTB 1RPTA 3G7NA 1EFTA 2E6KA 2NUBA 3B2NA 4CHKA 2OFFA 5EIBC 2I2AA 2FSUA 4BP8A 5B7QA 2Q5EA 4ZDIA 5TRTA 2FW1A 3FTEA 3MT8A 2WICA 3WGKA 4KV2A 1IQRA 5CFNA 2AOTA 1FC0A 1V1RA 2LRWA 1K8ZB 4C78A 3W06A 4ISCA 1FDTA 1P73A 3IT6B 4WUTA 2VZ9A 4Q02A 2A5DA 1WZ2A 1G6KA 1YKGA 1VZ6A 4TTRA 3LWBA 4EPYA 3FI9A 4NY1A 2C04A 4ZCTA 1MOSA 3B51X 4CM6A 5KYNA 4BBPA 4UTVA 1Y0BA 1P1HA 2BP7A 2R1UA 1ZCJA 3JW0X 3KQPA 5DFAA 1NWHA 4MQEB 1KTVA 1KYQA 5AW7A 1KR5A 3EXHA 5REQA 2ZSDA 1ML4A 3SYNA 4ETNA 1TQDA 3OJFA 4Y2QA 3KKLA 1GOZA 2ROQA 4FJVB 3G9TA 3DLPX 3M9XA 5BN4A 1QMPA 1PGJA 4G5FA 2ZZKA 4Q9DA 2FJUA 5SYNA 1GRNA 3T7EA 1KE1A 5GZ3A 1UBLS 2ZR7A 4ZVQA 4W5OA 1OX5A 5ALGA 1CF2O 3Q7SA 3SVZA 2PMBA 4YP1A 2C3OA 1GPLA 3E3LA 1WMFA 3DQPA 4XVUA 3IT4B 1U7ZA 3H6HA 4E2FA 3LXFA 2LUOA 3PQ2A 3LCMA 3ZKWA 4FQ8A 3KAJA 3TEXA 4AZWA 3WFJA 2VHYA 5EZYA 4TSKA 4S0XA 4ZI7A 4P4NA 3HM6X 3PNLA 4C7JA 1B8UA 2IGTA 2Y3IA 1ZJ6A 4GFDA 4GSYA 5CBPA 2NYRA 2I2YA 4PZDA 2BJVA 1DEOA 2FJ0A 4Q3OA 1QLWA 1N5LA 3MYYA 4U3JB 4AURA 4P92A 4FLEA 1TC2A 3ML8A 5CYOA 3QKSB 3L7DA 4H3VA 1HZZC 4KMSA 3KT8A 1G5PA 1Q20A 4CM7A 2BF8B 4YCJA 4M7RA 4G67A 1NI3A 5KZMB 1NASA 4GR9A 3VDZA 4MSMB 3U4EG 3TGWA 5ILOA 4TQUS 1I10A 1N6IA 4EABA 4JLOA 2PGXA 3EDMA 3N2ZB 4L51A 3O4IA 4KLAA 4BIIA 4C4SA 1Z38A 4BMVA 3GLTA 3Q87B 1BEUB 2OMEA 4IDBA 2MIIA 4MEJA 3KKKA 2NNLD 1ZOLA 2XJ4A 4GXRA 2CV2A 2FG5A 2I55A 3VDNB 3NR2A 2P9ZA 1FTQA 3CH6A 3T0GA 4E30A 1NTOA 5SV2A 4U2BA 1Z2OX 2RGRA 2ZJYA 1JROA 1WMHB 1TGYA 2IPXA 3AOGA 4EKDA 4JGGA 1Y8ZA 4C14A 2ENWA 5ITZA 4JJ4A 3D0QA 3LQQA 2YZKA 4RA6A 1SVOA 1KVUA 5JMOA 1VKNA 1YB2A 2IEBA 1R0BA 1LRKA 4P3OA 1Q95A 1SU4A 4U00A 3VOAA 2FLKA 3NHYA 3FWPA 3RAGA 3R9WA 4P0QB 3DKIA 4XH9B 1TM4E 4EA9A 2RH9B 1M6YA 2ZAGA 3SR6A 2I1LA 2XCUA 5JZVA 2CEKA 3JYLA 4OQDA 4D0SA 5HIJA 4OYLA 1JMYA 3WDMA 2HC9A 3I9NA 1Z4IA 3CVYA 5EJGA 2B1RA 1SVWA 2HA0A 1R0CA 2ZRHA 2PAFA 4FFOA 3D32A 821PA 2I1QA 1ZW7A 5CM9C 2RAFA 3O21A 3FDFA 5FQNA 3RR2A 1DKUA 2EJVA 1DDOA 5JG7A 3RVNA 1UMDA 4FXOA 3HZRA 4PN7A 1Z39A 2J4DA 2FPIA 2J8ZA 3PV0A 1RBMA 5CDYA 4TN5A 3PXEA 2FGJA 2O6VB 2QI9F 1DL5A 5ERXA 4HXGA 2D1SA 2HT1A 2C2YA 3K92A 4HTFA 2RH4A 3H1BA 4P7FA 3SF8B 3LUGA 3QFTA 2A9FA 4B31A 3ZLJA 1W88A 2WXKA 3DR5A 4QO7A 4IP0A 4FYKA 4XD7D 4PV7A 2J0SA 1OI7A 4PG6A 4KGDA 4WZ6A 2J5QA 1C77A 2Q5FA 1Y8RA 2WUDA 1WGRA 4CIXA 3KEGA 4ZDVA 3IVAA 3M1AA 4EHLA 1C7QA 1HYHA 2IOFK 1ZIXA 1BD4A 1O6CA 1VHWA 4QWMA 1Y1SA 2VHEA 1P2BA 4WGGA 1USWA 5AO9A 1W96A 1EUYA 2C2HA 3O73A 5T67A 3OF2A 1NNUA 3OJWA 3BKWA 5LJIA 4RO0A 2C3MA 2Q07A 3RC9A 2NSYA 4MQBA 2H7CA 3BDIA 1EGAA 4XPZA 4K9MA 2WB4A 1Y5IA 2NR2A 2YLMA 4I9GA 2B36A 3UIPB 1PJAA 3IIKA 1RC1A 3DKPA 4RTOA 4E46A 1RWVA 2FOXA 1T5DX 3LUPA 2AFIA 2LIVA 2IH2A 4FNOA 2IX9A 1FUYB 1OFFA 4TPKA 4W5TA 1MX5A 2QSDA 4J91A 2J07A 4QDJA 1MO6A 1TZBA 4JX9A 1AN8A 5HMLA 5DXAA 3RTCA 4EGAA 4BP1A 4OHYA 4WLFA 5ECDA 4GKVA 2G3QB 1NGSA 1NSFA 4D45A 3IOEA 1GLGA 2CVQA 3DOWA 1CJVC 4J4TA 3OEHA 1PO7A 4B87A 4G50A 1IK6A 5FBRB 1MU0A 3HM3A 1DPFA 2Z3ZA 1FSSA 3FVVA 3OJOA 3EUAA 2OBYA 3NX4A 4HYEA 4XM1A 4BUCA 1T2CA 4O1HA 1XAHA 4U0KA 1YR8A 5IC5A 4BX2A 3DE3X 1PT7A 2BWJA 4K40A 1I4HA 1FFSA 3HUEA 2WXFA 2R5WA 1A8QA 2XZPA 3IAEA 4YLEA 4OLBA 4Y98A 3ACCA 2OYSA 7YASA 1N25A 2MLBA 2WF5A 3VVWB 2AFVA 2E5WA 2ZIGA 3QU5A 5AIBA 3CGGA 5C4MA 3N30A 3V80A 3SBOA 3C87A 1YT5A 3QC8B 3NZSA 4MVWA 3CVUA 4C4ZA 3RTAA 3C3XA 2J42A 3ZS8A 5FOUA 4B7XA 1NLFA 3DVAA 1Q3TA 1HKHA 4HJKA 3IERA 1RYFA 5CW2A 3W2GA 1WZUA 4I9NA 4XR9A 3MEQA 1TEXA 4Z1OA 2JANA 4CYMA 2V7QA 2CKHB 3GLKA 7AT1A 2JZOA 5E6SA 3D2BA 2YJ4A 3L7CA 4GB9A 4M9SA 1PU2A 2F8LA 2V1UA 4UFNA 5AW5A 3L7NA 2MTBA 5FPKA 2NX2A 4D9NA 2Q3CA 1EBBA 4WESB 2FX5A 2VP5A 4B6FA 1I6MA 3M1IA 4K9RA 1OQAA 4BMPB 4KC0A 5JWOA 1ZR4A 3TPFA 2QV0A 3IL2A 3W2IA 3UQBA 3EVDA 3DDSA 3U4CA 2OUIA 5AICA 5TEVA 4YP7A 3THWA 1EE1A 4B9AA 1DO2A 2H1VA 2BEUA 4O63O 3V1UA 2C1EA 1Z6AA 3S44A 5IKOA 2BH2A 5IT0A 2FLWA 2Z57A 3SX0A 2FSFA 2XGOA 3TLAA 2JVCA 2RMMA 5FOWA 1MIOA 4GMGA 3ZVRA 4DV3B 4N0PA 2I71A 4IHQA 1NUAA 3A31A 2Q27A 3GD7A 3KKPA 2LVQA 3L16A 4MGIR 3MINA 1SURA 1WO8A 3MCWA 2W4MA 3T5MA 3ICCA 2PUEA 4TS1A 3VHLB 4UAUA 2PVPA 2WYOA 1ZQ9A 1C7JA 2WYUA 3WBBA 2VR1A 3ESAA 2BZ1A 1Z6ZA 2ORWA 3FNRA 3WWEA 1R9MA 2HSDA 3V9PA 5KNDA 2PEZA 5CT8A 3TUJC 1JMVA 1YJCA 5CK5A 2EDAA 4EMSA 3A7DA 4WZBB 4ZCMA 2O0LA 3MFQA 4DIMA 1GCOA 1RI2A 3ZTYA 1ULUA 1BS1A 1D1SA 4MV8A 1Q5PA 3IMCA 1YVUA 3MP9A 3LPAA 2PSDA 1XPRA 5JXIA 3DFMA 3K6SB 3B5JA 2JB9A 3N28A 1O0SA 3SSAA 4CF4A 3G17A 3PPXA 4G5XA 1SCDA 5JCJA 4JB8A 2IELA 3WFIA 4I6GA 3L08A 2MYUA 4Z9AA 1PTKA 2QG6A 3SX2A 3FNIA 3MTEA 4BB5A 3W7BA 4BBNC 2C9BA 2IBTA 4NCJA 4XYBA 2C7HA 3KFLA 2ZVJA 3N7AA 3W1EA 1TRKA 5TNXA 1XROA 4KQMA 2UWQA 1G8FA 4W99A 3C41J 3NRZA 4ER6A 1U7HA 1FRRA 1SKYE 5K6AC 4ZHQA 3CZ4A 2FEKA 2G80A 1UBOS 1M5UA 1HH4A 1SPXA 1NATA 4B4DA 1KJ9A 1QCZA 2CD9A 5DGDA 1OH6A 4D79A 3ZH2A 5IFLA 1W5EA 1OASA 1ZKHA 3QX7A 3IQIX 3KPJA 3QEMA 4DV1B 4D9FA 1WCIA 3GW8A 1F3OA 3FKSD 1D2NA 3DGFC 5IP4D 4PYZA 5CB4F 3KL4A 3O75A 3QG1A 4CN8A 1CC1S 4BQIA 2C8LA 3ZNZB 2ACVA 2RGCA 3LW7A 5BV7A 2WVAA 1IZ0A 1ZJJA 3RS7A 1N5RA 1NNLA 2A9QA 2AXQA 4FD2A 4J7AA 4C05A 4LJ5A 3WYGA 3HRKA 4XARA 4IO1A 5IF3A 1Y6FA 1VJCA 4OK5A 3T0FA 3JQ8B 4WJOA 3K1AA 1V97A 3M6XA 1WGHA 1FA9A 1Z68A 1RAHA 2GCOB 4NV1A 2X15A 1XR3A 2JHCA 4OPMA 5K0LA 4UBMA 4W9GA 1TM1E 1R8YA 3NBQA 4M89A 1N7IA 1PNVA 4L72A 2PLPA 5JVDF 3H18A 2YNMC 2ZWIA 4ASUA 4G01B 4LISA 1T5IA 1V6CA 4MWEA 1E3QA 2W82A 3E9EA 3SNHA 1H05A 1UOOA 5C5IA 4BMXA 3RFVA 2RH8A 2DBQA 4KO2S 1Z88A 4MKRA 3UJ8A 1ZGCA 4RVCA 3WAMA 4FYWA 4WJQA 1FF9A 3DDNA 5E8JA 1NXTA 4RCOA 4LC9A 1WM3A 5A9SB 2UU9B 3DWIA 5EQDA 4EGQA 3VAAA 4J16A 3QKUA 1V43A 1X77A 1QCDA 1DIRA 4O4LF 2FVXA 3V61A 3O9VA 1MDFA 3LXUX 2GAJA 1L5GB 4NPAA 2EARA 2HJGA 1SHJA 2QRUA 1NVUQ 2OHXA 3M0EA 2ZJ3A 4KX5A 3BMOB 4QFMA 1WB5A 2FXIA 5H81A 1U0HC 5LZ8A 1RD4A 1XLQA 3A6ZA 5AUQA 4MAAA 1Z5SB 2GPNA 2AFRA 5DU2A 1I7LA 5IVPA 3O93A 3BYTB 5FR1A 3LU1A 3A7EA 1XL1A 4OUDA 3HV0A 4B17A 4LJ8A 3WKEA 2PRJA 2PW9A 1CZRA 4WKOA 2A1TS 2QWXA 4R1TA 4EG3A 1TMKA 4FN4A 3A9KB 2W70A 4HGYA 1MRSA 4L75A 3ZTCA 3QPCA 2Z8YM 4G0WA 5D6OA 5JNTA 4ZAFA 3FHLA 2NNWB 3PP8A 4UCWA 5JI2E 2WG0A 1NWCA 1RAGA 3IPXA 2DAJA 3AHJA 1OLXA 3M3JA 3QBJA 4F4FA 3Q3GE 3TKAA 4CZ2A 1E1CA 2ZUFA 2ORVA 2NBUA 3ZV3A 4WDQA 3O1JC 4JB3A 3WB9A 1MLDA 2C9CA 2YFHA 3LKDA 4CT0A 2UUPA 3JYNA 5EMLA 4JUIA 1Y8AA 1ZCAA 4EG1A 4HYYA 5HKOA 3DB1A 3KSZO 4WEQA 5DK6A 5JLJA 4HAIA 2WNSA 3JQBA 3I9MA 4ZOLF 3Q1LA 4GGMX 5IXJA 3DDHA 1OWOA 1QHNA 5PNTA 1P7YA 4Y2HA 4F7ZA 3MVEA 2B37A 3WGJA 9LDTA 2W22A 3E23A 4IHJB 3OU7A 5U9CA 1K9VF 5TT1A 1OW3B 3HDTA 1ZH4A 4PTYA 5AOBA 2Q3EA 1VE9A 1OFIA 5BYQA 4JV5B 2H2IA 4JMPA 2FUG1 3RRJA 3DMNA 4RZIA 4JP3A 4JQZA 3T9DA 3MWDB 1YGPA 1W94A 1OLUA 3N2EA 1SF0A 4ITUA 1L4DB 1FSZA 1ZJYA 1WW3A 2HL6A 2OB2A 2C95A 3E9NA 1QP0A 1VHTA 3QQPA 4MUYA 2ONKA 3G0GA 4FMDB 5TMDA 1DEAA 1RLJA 3ADOA 1PE0A 4C0WA 2KWCA 4C4PA 1PFYA 3NIFB 3RFCA 4C0HA 1DRWA 3TQCA 2XKAA 2HLNA 3R7LA 4Q9IA 4FIZA 1KDZA 3KVVA 3IKMB 3BN3A 3ETRA 4MIKA 4V0RA 5E3IA 3IBTA 4INPA 2FQXA 4K7WA 2IXGA 4ZT3A 3TL3A 5I9LA 1CUGA 1YWGO 4AG5A 4LRQA 4CRWB 1QWOA 2LP4Y 3D64A 2C8VA 2JLYA 5ESWA 2VSXA 3WZLA 1EJ0A 3SC2A 2WT8A 4MVJF 4WD3A 1UWCA 5F1KA 5ADHA 1R10A 1T0HB 2OHFA 3OLWA 3AHCA 1KY4A 2XQJA 1DQRA 4JC8A 1D2RA 5IEBA 4WQOB 2Q49A 2WKQA 3K8YA 3HA3A 4XX5A 2D5AA 1JWBB 2X1MA 3HJBA 2NS5A 3HYSA 5BR8B 3WOVA 4D42A 6ABPA 2AQHA 2ARKA 1NVID 3KFVA 4QQ8A 3DL2A 2GO7A 3O3CA 3ETEA 4FDLA 2R4QA 4OJNA 3MHZA 3AB8A 2Z8ZA 3DOEA 2ZW1A 4TYMA 3OJXA 2WAOA 2XNAC 2I2DA 4OHFA 3AUUA 5AVUA 2WC1A 1I4XA