4RMAA

Crystal structure of the ferm domain of human ezrin
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
295
structure length
295
Chain Sequence
PKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding protein
molecule keywords Ezrin
publication title Structural characterization suggests models for monomeric and dimeric forms of full-length ezrin.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4rmaA01
2BYVE 2M17A 4ANVA 1E7VA 2I1KA 2MA9B 4ICUA 4FADA 3WANA 1TGZB 2GMIC 2K8BA 3QA8A 3VVWB 4II2B 4EOYA 2C60A 2DYBA 3DBHI 1XT9B 2M1MA 2LWPA 3CF6E 4AWJA 4DXAB 3TL5A 2BWES 3A9KA 3ZTCA 3A4SC 5AZFA 1GC6A 5KHOA 3RT3B 3WAOA 1E8YA 4EEWA 2I1JA 3HK0A 2KFJA 4FJVB 3ONSA 3R3MA 4ZRKA 2AWTA 5JHAA 2R2OA 3M63B 1E7UA 2YVCA 4CYEA 4XZ4A 4NJ6A 5JH5C 3VFKA 2LGXA 2MX2A 3JW0X 1KJTA 1WR1A 2FNJB 2FAZA 2JT4B 1UGMA 3A1QB 4MGYE 2MP2A 2LVOA 4FHKA 4IWOA 5LXHA 4F7ZA 4K1RB 2KK8A 3WAPA 4X57B 1WR6E 3APCA 5CHWA 4YL8A 2IY1B 2CHXA 4J6IA 4GDKA 3NOBA 2K8HA 2WYQA 3ZO5B 2GBKA 4KZCA 4W9GA 4CO7A 1WZ0A 3ALBA 3ZLZA 2KWVB 2GBJA 4WWOA 3I3TB 3R7RA 2REXA 1QZEA 2N9XA 1F9JA 2IBIB 1V5TA 4HLEA 2LZ6A 3T8MA 4ASWC 1CMXB 2KD0A 2KVRA 3A9KB 2KJHB 4KDLB 5D94A 1J8CA 4K7WA 2KDIA 5CX3A 5J18A 4IG7B 1P98A 2NPTA 2PPHA 1D3ZA 4W9FA 3UGBB 3K9OB 4W9DA 2HE7A 2GOWA 4IM0A 3ML8A 5IAAC 3U8ZA 1WM2A 4AP4C 3DBRI 2ZNVC 4GOCA 3D32A 3B08A 4KZ0A 4HDQA 4OVVA 2KJ6A 2PE6B 2ZCCA 2NCNA 2DENB 3LDZE 3NY5A 1E8XA 4AUQC 4BKGA 2DZJA 2MP2B 2R2QA 1WFYA 2CU1A 5E6NA 4DWFA 4GMVA 3H6NA 3VUYA 2BKRB 4N9F4 1WM3A 3W1SC 2QHOA 4HVBA 1G6JA 4GDLA 4ZRJA 2NBUA 2L00B 1WE6A 4LDTD 3L10B 3C0RB 4GDKB 2JF5A 1OTRB 2Y5BB 4LJPB 4AOFA 3DBLI 4B95A 5DPWA 1WYWB 2KWUB 2JPHA 1WH3A 2LXAA 4GSWA 4II3B 4KSLC 2NVUI 3U30A 3V61A 3L54A 4WJOA 2KN5A 1YX5B 1IYFA 2ZPYA 3RD2A 2GBRA 4FHJA 3ML9A 5E6OA 3VAWA 4M8NA 1E90A 1OEYA 1UH6A 1OGWA 2KTFA 2RR9A 2LRUA 1WI0A 1WGYA 1Y8RC 2NPTB 1V6EA 2NBVB 3VTUA 2KTRA 2KQ7A 2N7EA 4GB9A 4M8MA 2IY0B 4G0NB 2K39A 2MBOA 4IW0A 1UBQA 2JXXA 2M8SA 4A20A 2AYOB 2BKFA 2C7MB 1KOTA 3RYTA 1TBEA 2IO3B 3KUDB 4G3XB 3PRMB 3A33B 4ICVA 4W9EA 2OJRA 4W9JA 3ZNGC 4KDIC 3NHEB 4MELA 5CHVC 3DVGX 3QHTA 3ZW3A 3OJ3A 4GDLB 1WF9A 4TV3A 2FIDA 5AZHA 3RUIB 1WE7A 2L76A 1EF1A 4BVUC 1WXVA 2GBNA 4NQKE 1YQBA 1WGDA 1SGHA 1UBIA 4MSQB 3ZKJC 4BKSD 1OEYJ 2DYOA 4AJWA 3EECA 3WIMA 4MJSA 1J0GA 3PTFC 1LXDA 2KKCA 2ZNVB 5G2NA 3MTNB 4MGIE 3QQ8B 4A3OA 3RULA 4JGHB 4MM3A 3VUXA 4EZLA 1EUVB 3WA0A 2FUHB 2KLGA 3PT2B 3PGEA 1K8RB 2BYFA 4NNJB 3IG3A 2LD9A 3HHMA 4ANUA 5L83A 2K8CA 2UYZB 2BPSA 2KQSA 2RPQA 3KVFB 2KTRB 3DCGA 4GXBA 2CHZA 2ZCBA 1WXAA 3M62B 3QAQA 4IM3A 4FJZA 2ZPNA 3ZNZB 2KO3A 3VQIA 3CSTA 4K7SA 4NPNA 3PHWB 3NZSA 1VD2A 1GUAB 2AEHA 2CS4A 3B0AA 3DOWA 2KX0A 4GN1A 4WWNA 1H8CA 4DDGD 1L7YA 2MBHA 1UZXB 3AI5A 4URKA 3HM3A 3ZUNA 4NY0A 1KLVA 3KH0A 1X1MA 1ISNA 4NJ7A 4E71A 1NI2A 3V60A 3HIZA 4FULA 4KSKC 2N7DA 4AJYB 5C23A 3JYUA 1P1AA 2WX0A 2Z0EB 1A5RA 1S1QB 1IP9A 4IM2A 1IPGA 1V5OA 4PYZA 4MJSB 3WAMA 1C3TA 2DAJA 1Z2MA 3M3JA 3UQBA 1YX6B 1KM7A 2BWFA 2WWZA 3HM6X 4MGZE 3UF8A 3KW5B 4RM9A 4WJNA 4FN2A 4TKNA 2HD5B 3A4RA 2MWSB 1S3SG 5LXIB 4WWPA 2MQJA 1E8WA 1T0YA 4IWQA 4BOSC 4MDKE 3EC8A 3H7SA 3UINB 2RSUA 3APFA 4W9CA 4G50A 4KV2A 4E74A 3QCAA 4W9LA 4IWPA 2KNBA 4E3CA 1HE8A 4NQLB 2NS5A 3KYDD 3ZRCA 5TR5A 3ZVVA 4RMAA 3ZDMC 3TBLD 2LUEA 3EHVA 1EO6A 3IVFA 1Q1OA 2V3SA 4ZRIA 3PLVA 1NDDA 4NAWA 3RZWC 1YJ1A 1AARA 2IO0B 3CSFA 1E8ZA 3RZFA 3N32A 1V80A 4I6PA 4LDTB 1YD8U 3PREA 3VHTC 3JSVA 4PS3A 3N3KB 1E5WA 3PS6A 3X23A 1WGRA 4WAAA 3H1UA 3Q3FA 4BKSA 3ZRFA 4A3PA 4WJQA 4JLCA 4CHKA 1WJNA 2C7NB 3VTWA 1EF5A 1TZ1A 2J0JA 2KFKA 1LFDA 3KYCD 2L0TA 1JRUA 3P2BA 1H4RA 2KMCA 4ZYNA 1P3QU 2AL3A 3APDA 3DDCB 4BKTA 2FCSA 4DK5A 2G45B 2RGFA 3ZTDA 2ZJDA 2MBQA 5D6JB 2JZZA 2J0MA 5D7GA 5GMVA 2JRIB 1XD3B 1YIWA 2N1WA 4DHJD 3QIJA 4XC2A 1WJUA 3S2AA 3GZNI 2C5LC 3OJ4B 3W1SA 1WY8A 3W1YA 3TCAA 2O6VD 1ZKHA 3Q3JA 3MHSD 2D11A 2PEAA 1V2YA 2BGFA 3QARA 2DHZA 4ANWA 3SDLC 2LGDA 4HJKA 3ZIMA 5EDSA 5BO4B 2KX3A 2JWZA 2O2VB 4DDID 1J19A 4GGQA 2JY6A 3L16A 2HTHA 3PSEB 5CHFA 5G55A 2G4SA 2Z0DB 2D2QA 4GIVA 4NAWB 5DPRA 5J2RA 2J7QB 3L08A 2IO2B 4HCNB 4GU2A 1WJ6A 1I42A 2JRHA 3UQAA 2L0FA 3JSVB 2KMAA 3H7PA 3PRZA 1WZ3A 2RD0A 3DQVA 4I6NB 4PS7A 2MBEA 2BYEA 2KC1A 3DBSA 3PHXB 2KWCA 2KZRA 2FCNA 3PVLA 2V4LA 5D2MB 1FXTB 1GNUA 2KFKB 4ZDVA 5LLIA 2N9PC 3IBEA 2FCMA 1PQSA 5J17A 3NS8A 1Z5SB 3QC8B 2WX1A 5IA7A 2WDTB 3WALA 3B1LX 4EKUA 1WX8A 2KHWB 4IUMB 2IYDB 2ZVOA 2D3GA 2MLBA 2KLCA 4DHZE 1VCBA 3AXCA 3LJ3A 1P9DU 5DPTA 3DVNU 4TUUA 3VXWA 1RLFA 3VH3B 2LASA 3SU8X 1WJ4A 4LJOB 2AL6A 2N9EB 1SE9A 4FA6A 3ZDTA 3PLUA 1WGGA 2JVCA 2KC2A 2W9NA 1BT0A 3QK0A 5L95C 2B3AA 1Q5WB 3EFUA 2D10A 3AULA 3QJZA 1V81A 2ASQA 2OOBB 4JL9A 1WX7A 2MW5A 3H7PB 5CTRC 4HDOA 5KHQA 1GG3A 1V86A 2VRRB 1GC7A 4OVUA 2LJ5A 4WJPA 2D07B 2KANA 5AZGA 1R4MI 2L05A 4TQ1A 4LCDE 3RCZA 2L8JA 3X0WA 3ECIA 2NBWB 2ZVNA 1RAXA 1V49A 3PPAA 4BFRA 4FBJB 2ZZPB 4MEMA 2M4NA 3BY4B 3A9JA 2IZVB 5E6PA 2O6VA 3L17A 4ANXA 2LRWA 3NZUA 3VDZA 5DPSA 4RM8A 1UD7A 2A5UA 2V1YA 4EFOA 4K81A 2C9WB 2JZ3B 3V62A 2EMTA 2L3ZA 1WXMA 3N30A 3ZNHB 1RRBA 2IO1B 2MBBB 4KIKA 2O2VA 2DX5B 3PRPB 1LQBA 3OAWA 2KDFB 4HK2A 1V9JA 3TIXA 3U7DA 2XK5A 1WGHA 2PE9A 1GJZA 3TJPA 2LI5A 2BF8B 3VH4B 2DZMA 2C7HA 2FIFA 2DZKA 3JVZX 1WRDB 2A4ZA 4G11A 2J0KA 4HWIB 2MRPA 2XEWA 3H9DA 4IC7B 3IFWB 4MGKE 5DCNA 4BBNC 2DYMA 2JUOA 1ZW7A 3QWZB 2KDBA 5JZEB 3V6EB 2UWQA 2K25A 2YLMA 3UIPB 2KDEB 3DVNV 2NR2A 2K1FA 1TTNA 1WXSA 1M94A 4DHJB 4FLHA 3AU5A 3IHPC 2KOXA 3CMMB 1I35A 1Q0WB 3A9JB 3V6CB 1WMHA 2CHWA 2O6VB 3L13A 3O65B 4B9KA 4M0WB 1UELA 4W9KA 3R66C 1SIFA 3K9PB 2FCQA 3TMPB 4EZKA 1C1YB 2LGYA 3L0WB 3UIOB 5HKHA 2XBBC 1L2NA 1MG8A 4FJYA 4KIKB 2LVPA 2K6DB 3AU4A 2K6QA 2DAFA 4PS8A 4MH0E 2N4FA 2GBMA 3KUCB 1RFAA 4MSMB 4BOZB 1R4NI 2G4DB 2XK5B 2EMSA 4HXDA 1LM8B 2MCNB 3T9LA 4F8CB 1WIAA 1XQQA 3KUZA 4HPLB 4K7UA 4BBNF 2HJ8A 5C1ZA 1ZGUB 2N1VA 3DPDA 1P0RA 2KXJA 4TQ0A 2ZEQA 2M0XA 4DBGA 4HPMB 3PV1A 4XX5A 4EUTA 3VTVA 1WX9A 3SHQA 4W9IA 3DVGY 4W9HA 3R7QA 3PZDA 4DHZB 4KVGB 4EZJA 2G3QB 4WQOB 1OQYA 2CR5A 2LXCA 3QX1A 4JIOU 3SD5A 5AEKB 4PYUA 2PJHA 2DZIA 3M95A 4P7IA 5JHBA 2L7RA 2LVQA 4HCPB 4I6LB 3VUWA 3A1QA 2KJRA 3ENEA 3GOEA 3MJWA 1WMHB 2Z59B 1NBFC 3OLMD 3ZNID 1U4AA 4F1SA 3BINA 2EKEC 4JQWC 2CKHB 5FR6A 2MSED 4B6WA
chains in the Genus database with same CATH superfamily
2I1KA 2GMIC 2D5GA 3KLSX 4II2B 1XT9B 2M1MA 2WU2B 3TL5A 2INNE 2J52A 4YT0B 3A4SC 3ZTCA 3RNBC 4EEWA 1T6BX 2I1JA 4OZAA 3GE3C 3TEXA 3ONSA 3NVVA 4TMAB 1E9MA 2PVGC 1ZE3D 3Q8BA 1HZ5A 1WSPA 2K3UA 1WR1A 2JT4B 1UGMA 3A1QB 1F52A 2INDC 2IJ0A 1WR6E 1ZXHA 1FNVA 4XWWA 4GDKA 2KN4A 4KZCA 1RFKA 3ALBA 3ABVB 2IBIB 3GS2A 1V5TA 3AE3B 2PIAA 2KDMA 1TS5A 1P98A 1LO5D 3ZJTA 4W9DA 4UDUC 3ML8A 1WM2A 3EA6A 1CJEA 2BYTA 1C4PA 4OVVA 2PE6B 2NCNA 3AE6B 2RPVA 2MP2B 1WFYA 4GMVA 5HI1A 3AEGB 2WDRB 3W1SC 4HVBA 1UNSA 4YSYB 1R4NB 4ZRJA 2L00B 1DGJA 3DBLI 4ITKA 2KWUB 1KLUD 2H89B 3IAM1 4II3B 3V61A 1XEEA 3L54A 1IYFA 2ZPYA 1DOIA 4M8NA 1E90A 1OEYA 5G5HA 2KTFA 2LRUA 1E6EB 2NBVB 5BMIA 3CIRB 2BT6A 2KTRA 4M8MA 1FEHA 2XN9C 1N61A 1IBXB 2JXXA 2M8SA 2K9XA 3E9SA 2IO3B 4JWSC 4WQMA 4ICVA 1QOBA 1NI3A 1J7AA 2J4XA 2WXFA 1ET9A 4PT5A 5AZHA 3EFCA 1WE7A 2TSSA 1EF1A 1OEYJ 2DYOA 1P7EA 3C8YA 3EECA 3PTFC 4YTMB 3QQ8B 4A3OA 1YN3A 3P1MA 4AQ7A 2KLGA 3PGEA 2IPKD 2GLSA 2BYFA 2LD9A 4ANUA 4LNNA 1PGAA 2KQSA 3KVFB 1GB1A 2HJ1A 3EGRA 2ZPNA 3AEEB 3T3OA 4K7SA 3MC8A 2KVZA 3B0AA 2KX0A 4WWNA 3FILB 1XLNA 2MBHA 4NJ7A 4E71A 1NI2A 2QSDA 2RDHA 2G1EA 5C23A 2JYTA 1C3TA 4PYZA 2DAJA 1Z2MA 3KW5B 2BS2B 1FO4A 3A4RA 2LFIA 1QQRA 4IWQA 3DBRB 3RMKC 3UINB 3APFA 4W9CA 1C78A 2MHJA 4IWPA 3IT4B 5TR5A 3ZVVA 1IBXA 2JZPA 1FMAD 4ZRIA 4NAWA 1YJ1A 4US9A 3CSFA 3V3XA 2B76B 1V80A 4I6PA 3CWIA 4LDTB 3VHTC 3N3KB 3X23A 3H1UA 3R2IA 4A3PA 3RNAC 4JLCA 1WJNA 2J0JA 3KYCD 2L0TA 3AE1B 4ZYNA 2AL3A 3FKYA 4DK5A 2RGFA 1TYGB 3V05A 5D6JB 2JRIB 1TY0A 1XD3B 2HDEA 2N1WA 4S0RA 1WJUA 3GZNI 3Q8CA 3OJ4B 1WY8A 1HTQA 3TCAA 2O6VD 3Q3JA 3MHSD 4LTUA 3P42A 3SDLC 1WWTA 1TKEA 2DLBA 4GLSC 2JWZA 2W3RA 3PSEB 2G4SA 2SEBD 5J2RA 5IP4D 4GU2A 1WJ6A 3UQAA 1FXAA 3JSVB 3BVMA 1FNWA 2RD0A 3DQVA 4I6NB 4JPSA 2MBEA 3PHXB 1YQ4B 5D2MB 4YSZB 5HFYA 1SF0A 2N9PC 1PQSA 2LGIA 1YJIA 4ZRPA 2WDTB 3B1LX 2X38A 3W5UB 2ZVOA 1VCBA 1P9DU 4TUUA 5I4DA 3VH3B 3SFDB 3PLUA 2WP9B 4RNAA 4MACA 3U7ZA 2B3AA 1JWSD 3QJZA 4L23A 5D3DA 1T5XD 4D2KA 4HKQA 1WX7A 2MW5A 1FD6A 1UWXA 1F2RI 1SE3A 1TKYA 1K53A 2E3TA 1V86A 1GC7A 5D3IB 4OVUA 4TQ1A 4B0EA 5BMHA 4B0MA 2ZVNA 1V49A 1SXTA 2WXPA 2IZVB 4ANXA 2LRWA 2CJNA 2V1YA 1AWDA 2JZ3B 1C77A 3ZNHB 2KWDA 2WXLA 4KIKA 2JXTA 3J9CA 2V4IB 4LNIA 2KAJA 1V9JA 3TIXA 1QOFA 3TJPA 3VH4B 2DZKA 2A4ZA 2MJ3A 4KX6B 1Y56A 2Q5WD 3QWZB 1WXQA 2UWQA 2K25A 3UIPB 1E0ZA 2KDEB 5C2TB 3DVNV 1TTNA 4DXGA 1K51A 4FLHA 2BBCA 4REZA 1I35A 1YN5A 4K3CA 3V6CB 3RNCC 4B9KA 4W9KA 2FCQA 1D6EC 4IOIE 4JWUC 4FJYA 2K0PA 3AU4A 2ON8A 4PS8A 4WWMA 3HRDD 4MSMB 2PTLA 2XK5B 3Q14C 1LM8B 4F8CB 1FM0D 3KUZA 1SE4A 2AQ1B 5C1ZA 4A55A 1ZGUB 3DPDA 2KXJA 4TQ0A 4XX5A 3SHQA 4W9IA 1F0ZA 4W9HA 3AM9A 4DHZB 3R8BA 4WQOB 2CR5A 3M95A 5JHBA 2LVQA 2BS4B 4HCPB 2WXOA 2Z59B 2PMVA 1U4AA 2MEKA 2QC8A 2EKEC 4JQWC 2JWUA 4RGTA 5FR6A 2MSED 2IGGA 3WANA 1TGZB 2OHFA 2BVCA 3NZ3A 4A6QA 4DXAB 3A9KA 5KHOA 3RT3B 2LHEA 3URYA 2NTTA 2Z8LA 3OWEB 3HK0A 2KFJA 4FJVB 2AWTA 3M63B 1V1PB 4CYEA 5JH5C 3SR6A 3JW0X 4F7ZA 4K1RB 1NVID 4ZHPA 2KK8A 5CHWA 3APCA 2IY1B 2CHXA 3AB5A 1TKGA 4W9GA 4CO7A 3Q3MC 1WZ0A 2KWVB 3R7RA 1A70A 2N9XA 1CMXB 2LMCA 1I4HA 4C56C 4TSSA 5D94A 1TY2A 2OEDA 1J8CA 4K7WA 3IAS1 1UWMA 2L1AA 2NPTA 4W9FA 3U8ZA 5IAAC 4AP4C 4LNKA 3HUIA 3U52E 3D32A 4HDQA 3NY5A 2DENB 3L4PA 4L1BA 2WXMA 2CJOA 2DZJA 3DBLB 2CU1A 1C79A 1JWBD 3VUYA 2BKRB 4N9F4 1Q10A 1WM3A 2FUG1 5HG2A 4LDTD 4GDKB 4LJPB 2JF5A 3N1ZC 5DPWA 1D5XC 1C4AA 2LXAA 4GSWA 2NVUI 4P6VF 1YX5B 2GBRA 1RYJA 2M56B 1FXIA 1OGWA 1QOGA 1WI0A 1Y8RC 2EELA 1YMHE 3VTUA 2N7EA 2KQ7A 4G0NB 2MBOA 1UBQA 4A20A 3ZJUA 1KOTA 5TSSA 3PRMB 1NENB 2OJRA 4W9JA 3QHTA 1XO3A 3MC9A 2GI9A 4NQKE 1YQBA 1WGDA 4MSQB 4AJWA 4MJSA 1J0GA 1LXDA 2KKCA 2ZNVB 4OHJA 5G2NA 3MTNB 2Y3AA 3VUXA 3WA0A 4USAA 1KRHA 1SBBB 2RDBC 3HHMA 1PFDA 5L83A 2K8CA 2KTRB 3DCGA 1SE2A 4IM3A 4OVZA 1SIJA 2QMTA 1IGDA 4NPNA 4N59A 1L5PA 2L32A 1ZDVA 1H8CA 1L6UA 3HM3A 3ZUNA 3KH0A 4FULA 1HZ6A 1QOAA 2N7DA 3FC4A 3JYUA 1S1QB 1IP9A 4ZOHC 3UF8A 2WWZA 3HM6X 4WJNA 4TKNA 2MWSB 1STEA 3FAHA 5LXIB 4WWPA 4BOSC 3Q8EA 3C19A 3I9V1 4KV2A 2D3CA 1HE8A 2NS5A 4RMAA 3ZDMC 3TBLD 2LUEA 3RNGC 4KGRA 3GE8C 2IO0B 1E8ZA 1ESFA 3RZFA 1GAQB 4IKGA 3PS6A 4WAAA 3Q3FA 4BKSA 4CHKA 3NRZA 3VTWA 1EF5A 1TZ1A 4GIVA 1LFDA 3P2BA 3GZNB 5EE1A 3APDA 3DDCB 4BKTA 2ZJDA 2MBQA 2PW9A 1D4BA 2JZZA 5GMVA 1YIWA 2WXQA 1AW7A 5H92C 2QDFA 5AUKA 3NUHB 2DHZA 4JX1C 4HJKA 3ZIMA 2AQ2B 5EDSA 2O2VB 4GGQA 2Z0DB 4NAWB 1TS3A 3L08A 1XLQA 4HCNB 2E6XA 3PRZA 1QF6A 3PVLA 2V4LA 1ZUD2 1NEKB 3N1YC 1QT9A 1BXTA 3IBEA 2FCMA 5J17A 1Z5SB 1EM7A 3QC8B 3Q3NC 4EKUA 3MFGA 1WX8A 4NZLB 2IYDB 3AV8A 2MLBA 1KTKA 3VXWA 3RNFC 2LASA 3SU8X 4LJOB 2N9EB 1SE9A 3ZDTA 3KQ4A 2KC2A 3QK0A 1TIFA 2M0AA 2G9HD 3EFUA 3RI7C 2BB5A 2K22A 3AULA 1V81A 2OOBB 1YQ3B 2DNFA 1VZ7A 3TSSA 4HDOA 5KHQA 1GG3A 1B1ZA 3ZJVA 1ZXIA 2LJ5A 2KANA 3DWGC 1LGRA 5AZGA 1R4MI 1M4VA 2L05A 3Q2AC 4RF0A 2PVOD 2XNAC 1D5ZC 3RCZA 3VR9B 4BFRA 2GB1A 3NVZA 3IXSA 3BY4B 3A9JA 5E6PA 3VR8B 3NZUA 4NJCA 2A5UA 2ZW0A 1OFFA 2IO1B 2MBBB 2O2VA 2WDQB 5BMGA 1LQBA 2J42A 2KDFB 1UF0A 2W3SA 1FNUA 1N6ZA 4HWIB 2MRPA 5HHDG 5DCNA 3ZXVA 1MHHE 1ZW7A 2WXJA 2RMMA 3V6EB 2YLMA 1BUIC 2NR2A 1PGXA 4YTNB 1L4ZB 4DHJB 2VZKB 2AX5A 3PO0A 1Q0WB 3AE4B 4ZYSA 2WXHA 3I57A 1WMHA 3O65B 1XCTL 1SIFA 3TMPB 3L0WB 1OQRA 1L2NA 4KIKB 2K6DB 4HKZE 1FCLA 2K6QA 2DAFA 1R4NI 1MG4A 1WIAA 4K7UA 2HJ8A 2IGDA 1KLGD 4EUTA 3R7QA 3PZDA 4KVGB 2G3QB 2LXCA 3QX1A 3SD5A 3MC0B 3NVYA 1CZPA 4XWTA 4I6LB 3MJWA 3ENEA 3PZ8A 1NBFC 2I38A 1GPXA 4F1SA 4KKJA 4RF1A 2BYVE 2MH7A 1E7VA 2MA9B 4ICUA 2D3BA 4EE2A 4RGMA 4S17A 4EOYA 3IT6B 2DYBA 3DBHI 4M00A 1L0XB 2LWPA 4AWJA 5AZFA 1GC6A 5IN7A 4LLGM 4FXCA 1DYQA 3R3MA 5JHAA 2R2OA 1RM6C 2V3PA 4XZ4A 3N9YC 1KJTA 2FNJB 1JW9D 3Q8AA 4MGYE 4IWOA 2INCC 4YL8A 3ZXRA 3NOBA 2WYQA 3ZO5B 2GBKA 1KFYB 1L4DB 5C3JB 2LUMA 5G5GA 3ZLZA 4WWOA 2N7JA 2QJLA 1QZEA 4HLEA 2LZ6A 2INPE 4ASWC 2KD0A 2MJDA 4J3OD 3A9KB 2MJEA 4KDLB 3GP7A 1CQVA 2QIEB 3BVZA 1D3ZA 1FCCC 5EE9A 3UGBB 3K9OB 3SFEB 2GOWA 5AUIA 1GB4A 2J53A 3DBRI 2ZNVC 4GOCA 3BIID 2KT7A 2WDVB 3B08A 4BKGA 2R2QA 5E6NA 4DWFA 3H6NA 4RGNA 2QHOA 1G6JA 4GDLA 3C0RB 3P4RB 3T3NA 4KSLC 3U30A 3VRAB 2KN5A 3RD2A 4FHJA 1F77A 3ML9A 5E6OA 2WXGA 4YWGG 2RR9A 1WGYA 2NPTB 3RPFC 1JWUD 3EUB2 3DHGC 2K39A 4XE0A 1K52A 2BKFA 2C7MB 3BK2A 4IDIA 1TBEA 4G3XB 3BZDB 3ZNGC 4KDIC 3NHEB 1XLOA 4MELA 3DVGX 1N5XA 4RCOA 2K5PA 3OJ3A 4TV3A 1WF9A 3RUIB 2FIDA 2L76A 4RFBA 4BVUC 2GBNA 4RH6A 1WGKA 1SGHA 1UBIA 1AN8A 2LHDA 3ZKJC 3TEZA 4JGHB 1EUVB 1JQ4A 2FUHB 3PT2B 4NNJB 3IG3A 2LGSA 1EU4A 2UYZB 4AS1A 4GXBA 3M62B 1WXAA 1NYQA 3VQIA 3PHWB 1VD2A 1GUAB 2AEHA 2CS4A 3DOWA 5IKCM 2BB6A 1ACCA 2W82A 1N60A 4C00A 1L7YA 1UZXB 3AI5A 3AEBB 3ETRA 4NY0A 1KLVA 1X1MA 1SJHD 3AEFB 4KSKC 4C4VA 2DBYA 1P1AA 4C7ZA 2Z0EB 1T0SC 4MJSB 4DQOC 2M19A 1KM7A 2BWFA 4MGZE 2BW2A 4FN2A 2HD5B 1S3SG 3BVGA 4MDKE 3EC8A 2RSUA 4E74A 2KNBA 4NQLB 1XLPA 3KYDD 1TJEA 1JMLA 1MHXA 4US8A 1EO6A 1SJED 2IGHA 5FK9C 2V3SA 1NDDA 5FR3A 3N32A 2DWQA 4M02A 2N9LA 1T0RC 5IOIA 4WURA 3H8HA 2V0GA 1C9FA 1I4GA 4O1NA 4JE3B 2KFKA 1H4RA 1F2RC 2KMCA 1P3QU 3W2DA 4CQNA 2FCSA 2G45B 3ZTDA 2J0MA 2R61A 5D7GA 4DHJD 5T8IA 1L6VA 3QIJA 2VZKD 4XC2A 5BYRA 4ACFA 4WIPA 1VJKA 2D11A 2PEAA 1V2YA 2BGFA 4ARIA 2KX3A 4DDID 1J19A 2JY6A 1I4XA 5CHFA 1VZ6A 5G55A 4YXDB 5BYQA 2D2QA 1FPYA 4LNFA 1I42A 4LNOA 2PLPA 2L0FA 3W9CB 3B9JA 2ACZB 2KMAA 3H7PA 3AE2B 1VZ8A 2WQYB 3B2FA 3OG5A 2BTEA 2KWCA 2KZRA 1ZOYB 2FCNA 1FXTB 1GNUA 1TS2A 2QILA 3B2GA 3I5JC 1N62A 1PUTA 1TT5B 1KH0A 1MFWA 1P7FA 1YOVB 5LLIA 3NS8A 2VH1A 1E7PB 2KHWB 4IUMB 2KQ4X 4DHZE 3AXCA 5DPTA 3DVNU 1I4PA 1WJ4A 2AL6A 4FA6A 3P4SB 5L95C 2JVCA 2W9NA 1ET6A 4ARCA 4KKIA 1Q5WB 4OW0A 1MVKA 3AECB 1R4MB 2ASQA 4K3BA 3LYYA 2X8XX 5CTRC 1R7SA 1NYRA 3RFZB 2BQQA 4WJPA 2D07B 1HEZE 2PKOA 4LCDE 1XXGA 3ECIA 2NBWB 1RAXA 2FBWB 4FBJB 2ZZPB 4MEMA 3Q6BA 4A9AA 1GOZA 2O6VA 3AE5B 4M0WA 4EFOA 1UD7A 4XYCA 2C9WB 1E10A 3V62A 4XDCA 2L3ZA 1IUEA 1WXMA 3N30A 3AE8B 3HVZA 1D5MC 3I63C 2DX5B 3U7DA 1YNTE 2PE9A 2BF8B 2DZMA 3N1XC 2C7HA 3JVZX 2J0KA 2FE8A 4WAFA 2XEWA 3H9DA 2ONQA 3IFWB 4MGKE 2JUOA 1V1OA 2K1FA 3AU5A 3IHPC 2KOXA 1K50A 1N63A 1T0QC 3A9JB 3L13A 2NMQA 3R66C 2XBBC 2NTSA 3NG0A 1MG8A 2JU6X 4N6EB 4MH8A 5FKAC 4DXFA 2IDYA 3KUCB 1RFAA 4BOZB 2G4DB 2EMSA 3BYTB 1JRPA 3NJTA 2MCNB 2AQ3B 4HPLB 4BBNF 1P0RA 2L52A 2ZEQA 2KYWA 4DBGA 4HPMB 3PV1A 3ZGZA 2QEJC 2WXNA 3VRBB 4P1CC 3LXFA 2DZIA 4P7IA 2L7RA 3VUWA 3A1QA 2KJRA 3GOEA 1WMHB 4RGOS 3ZNID 3BINA 2CKHB 4QAYA 2EKIA 4B6WA 3DBHB 2M17A 1QLBB 4ANVA 4FADA 3UI3A 2I2YA 2KACA 2K8BA 3QA8A 3VVWB 4LK0M 2C60A 3CF6E 1SB3C 1EU3A 5EE3A 2BWES 3WAOA 1E8YA 1HA5A 3Q8FA 4WH4A 4ZRKA 1N5WA 1E7UA 2YVCA 2W55A 4NJ6A 3DHHC 3VFKA 1ZPSA 2LGXA 2MX2A 3LB8C 3WCQA 3P4PB 2FAZA 3AE7B 2MP2A 2LVOA 2WXKA 4FHKA 5LXHA 1EWYC 1JROA 3WAPA 4X57B 4R3DA 4J6IA 2K8HA 2JX5A 5JXVA 2GBJA 3I3TB 2REXA 1F9JA 4MM3B 3T8MA 2KVRA 1FFUA 3BYYB 4HEA1 2KJHB 2RDGA 2KDIA 5CX3A 3AE9B 4IG7B 5J18A 3U2SC 2PPHA 2N9KA 2WLBA 4BAXA 2HE7A 4IM0A 3R2TA 1JWMD 1ENFA 4KZ0A 4C7YA 2KJ6A 2ZCCA 3LDZE 1VR9A 1V97A 1E8XA 4AUQC 2V3NA 1YJJA 1DOYA 2NBUA 1V8CA 1WE6A 2VH2A 3L10B 4B95A 2Y5BB 1OTRB 4AOFA 3AMZA 1WYWB 3BK1A 2BS3B 2JPHA 1WH3A 2JQRB 4ZHOA 4WJOA 1FRDA 4H2AA 3VAWA 1UH6A 3SEBA 4HROA 4PK1A 1V6EA 4GB9A 1PGBA 5BYSA 2IY0B 2ZW1A 5H8YE 4IW0A 2AYOB 4YSXB 3RYTA 3KUDB 3O13A 3A33B 4W9EA 3P63A 1XF5L 3AH7A 3FILA 5CHVC 3ZW3A 4GDLB 4HPPA 1VRAB 1QKZA 1WXVA 4BKSD 3WIMA 3U4EG 4MGIE 2WHIA 3RULA 1DOXA 4MM3A 4EZLA 3MJ5A 1K8RB 3TUOA 1T3QA 1BMLC 5E6JA 2BPSA 2RPQA 2CHZA 2ZCBA 3QAQA 2SAKA 2W54A 4FJZA 1JCKB 3ZNZB 2KO3A 3CSTA 3NZSA 3MHZA 2WGSA 2D3AA 2UU7A 4GN1A 4DDGD 4HRSA 3AEDB 4URKA 1WYGA 1ISNA 3RN9C 3V60A 1TS4A 3HIZA 4AJYB 2WX0A 1A5RA 4IM2A 1IPGA 1V5OA 2LJIA 1EWCA 3WAMA 1MPEA 3M3JA 2LEKA 3UQBA 1YX6B 1I7HA 4RM9A 1C76A 1J7BA 3DHIC 4MT5A 4KGSA 4XDDA 1B9RA 1I4QA 1MI0A 2MQJA 1E8WA 1T0YA 3H7SA 4G50A 2WNMA 3QCAA 2H88B 4W9LA 4E3CA 3ZQ4A 3ZRCA 3Q3OC 3GB1A 3EHVA 3HVDA 3P4QB 3IVFA 2WXIA 1Q1OA 3PLVA 3RZWC 1AARA 1YD8U 3PREA 4A8XC 2Y5CA 3JSVA 4PS3A 4N58A 1E5WA 1WGRA 4C4VB 3ZRFA 4WJQA 2C7NB 1JRUA 2CU3A 5GXGB 2YEPF 3S2AA 3MP9A 2C5LC 3W1SA 3RNEC 3W1YA 1ZKHA 3QARA 1ZP0B 4ANWA 1HXYD 2LGDA 5BO4B 3L16A 2HTHA 1FFVA 5DPRA 2J7QB 3NS1A 5EE0A 2IO2B 2WU5B 2JRHA 4XGAB 2YEPB 1WZ3A 4PS7A 2BYEA 2KC1A 3DBSA 1I4RA 1ROEA 2KFKB 2WXRA 2JSVX 4ZDVA 3TEYA 1PDXA 2WX1A 5IA7A 4C80A 3WALA 1VLBA 2JYEA 1UGJA 2D3GA 2WS3B 2KLCA 2OJWA 3LJ3A 1SEBD 2GRIA 1RLFA 4BZAA 1WGGA 1BT0A 1F1HA 4OZCA 1XCQL 1L0YB 1PYWD 2D10A 4L2YA 4JL9A 2ICIA 2HTME 3H7PB 1MJDA 1JWAD 4HJGE 2VRRB 2QCZA 4P16A 5MPOA 4A90A 3Q69A 1FRRA 2L8JA 1HTOA 3X0WA 4NAMA 3PPAA 1RWSA 4YTPB 4OZBA 2M4NA 1YN4A 1JALA 2V9HA 3L17A 3BWUD 3VDZA 2L83A 5DPSA 4RM8A 1QILA 1C4CA 4K81A 3N20C 1SSNA 1WRIA 2EMTA 3PZ7A 2Y5PA 3ZYYX 1RRBA 3W5VB 1CK1A 4HK2A 3PRPB 4ZRQA 3OAWA 3KWVA 2XK5A 1WGHA 3AEAB 1GJZA 2LI5A 2FIFA 1WRDB 1TZOA 4G11A 1KF6B 4IC7B 4BBNC 2DYMA 5JZEB 3E56A 2KDBA 1WXSA 1M94A 3AN1A 2N0SB 3TEWA 5LNK1 3CMMB 1L0VB 1VDVA 2CHWA 2O6VB 3DWMA 4M0WB 1UELA 1IGCA 3K9PB 4EZKA 1ZDXA 1C1YB 2LGYA 3UIOB 5HKHA 1FIQA 2LVPA 4M01A 1HQRD 2N4FA 2GBMA 4MH0E 4HXDA 3KWLA 3T9LA 1UUPA 1XQQA 4P1BC 2N1VA 2M0XA 2KMMA 3VTVA 1WX9A 4Q2JA 3DVGY 1AYFA 4EZJA 1OQYA 4JIOU 1V1PA 5AEKB 1OQQA 4PYUA 2PJHA 3NVWA 3OLMD 1J7CA 5IO9A 4KGTA
chains in the Genus database with same CATH topology
2BYVE 2M17A 4ANVA 1E7VA 2I1KA 2MA9B 4ICUA 4FADA 3WANA 1TGZB 2GMIC 2K8BA 3QA8A 3VVWB 4II2B 4EOYA 2C60A 2DYBA 3DBHI 1XT9B 2M1MA 2LWPA 3CF6E 4AWJA 4DXAB 3TL5A 2BWES 3A9KA 3ZTCA 3A4SC 5AZFA 1GC6A 5KHOA 3RT3B 3WAOA 1E8YA 4EEWA 2I1JA 3HK0A 2KFJA 4FJVB 3ONSA 3R3MA 4ZRKA 2AWTA 5JHAA 2R2OA 3M63B 1E7UA 2YVCA 4CYEA 4XZ4A 4NJ6A 5JH5C 3VFKA 2LGXA 2MX2A 3JW0X 1KJTA 1WR1A 2FNJB 2FAZA 2JT4B 1UGMA 3A1QB 4MGYE 2MP2A 2LVOA 4FHKA 4IWOA 5LXHA 4F7ZA 4K1RB 2KK8A 3WAPA 4X57B 1WR6E 3APCA 5CHWA 4YL8A 2IY1B 2CHXA 4J6IA 4GDKA 3NOBA 2K8HA 2WYQA 3ZO5B 2GBKA 4KZCA 4W9GA 4CO7A 1WZ0A 3ALBA 3ZLZA 2KWVB 2GBJA 4WWOA 3I3TB 3R7RA 2REXA 1QZEA 2N9XA 1F9JA 2IBIB 1V5TA 4HLEA 2LZ6A 3T8MA 4ASWC 1CMXB 2KD0A 2KVRA 3A9KB 2KJHB 4KDLB 5D94A 1J8CA 4K7WA 2KDIA 5CX3A 5J18A 4IG7B 1P98A 2NPTA 2PPHA 1D3ZA 4W9FA 3UGBB 3K9OB 4W9DA 2HE7A 2GOWA 4IM0A 3ML8A 5IAAC 3U8ZA 1WM2A 4AP4C 3DBRI 2ZNVC 4GOCA 3D32A 3B08A 4KZ0A 4HDQA 4OVVA 2KJ6A 2PE6B 2ZCCA 2NCNA 2DENB 3LDZE 3NY5A 1E8XA 4AUQC 4BKGA 2DZJA 2MP2B 2R2QA 1WFYA 2CU1A 5E6NA 4DWFA 4GMVA 3H6NA 3VUYA 2BKRB 4N9F4 1WM3A 3W1SC 2QHOA 4HVBA 1G6JA 4GDLA 4ZRJA 2NBUA 2L00B 1WE6A 4LDTD 3L10B 3C0RB 4GDKB 2JF5A 1OTRB 2Y5BB 4LJPB 4AOFA 3DBLI 4B95A 5DPWA 1WYWB 2KWUB 2JPHA 1WH3A 2LXAA 4GSWA 4II3B 4KSLC 2NVUI 3U30A 3V61A 3L54A 4WJOA 2KN5A 1YX5B 1IYFA 2ZPYA 3RD2A 2GBRA 4FHJA 3ML9A 5E6OA 3VAWA 4M8NA 1E90A 1OEYA 1UH6A 1OGWA 2KTFA 2RR9A 2LRUA 1WI0A 1WGYA 1Y8RC 2NPTB 1V6EA 2NBVB 3VTUA 2KTRA 2KQ7A 2N7EA 4GB9A 4M8MA 2IY0B 4G0NB 2K39A 2MBOA 4IW0A 1UBQA 2JXXA 2M8SA 4A20A 2AYOB 2BKFA 2C7MB 1KOTA 3RYTA 1TBEA 2IO3B 3KUDB 4G3XB 3PRMB 3A33B 4ICVA 4W9EA 2OJRA 4W9JA 3ZNGC 4KDIC 3NHEB 4MELA 5CHVC 3DVGX 3QHTA 3ZW3A 3OJ3A 4GDLB 1WF9A 4TV3A 2FIDA 5AZHA 3RUIB 1WE7A 2L76A 1EF1A 4BVUC 1WXVA 2GBNA 4NQKE 1YQBA 1WGDA 1SGHA 1UBIA 4MSQB 3ZKJC 4BKSD 1OEYJ 2DYOA 4AJWA 3EECA 3WIMA 4MJSA 1J0GA 3PTFC 1LXDA 2KKCA 2ZNVB 5G2NA 3MTNB 4MGIE 3QQ8B 4A3OA 3RULA 4JGHB 4MM3A 3VUXA 4EZLA 1EUVB 3WA0A 2FUHB 2KLGA 3PT2B 3PGEA 1K8RB 2BYFA 4NNJB 3IG3A 2LD9A 3HHMA 4ANUA 5L83A 2K8CA 2UYZB 2BPSA 2KQSA 2RPQA 3KVFB 2KTRB 3DCGA 4GXBA 2CHZA 2ZCBA 1WXAA 3M62B 3QAQA 4IM3A 4FJZA 2ZPNA 3ZNZB 2KO3A 3VQIA 3CSTA 4K7SA 4NPNA 3PHWB 3NZSA 1VD2A 1GUAB 2AEHA 2CS4A 3B0AA 3DOWA 2KX0A 4GN1A 4WWNA 1H8CA 4DDGD 1L7YA 2MBHA 1UZXB 3AI5A 4URKA 3HM3A 3ZUNA 4NY0A 1KLVA 3KH0A 1X1MA 1ISNA 4NJ7A 4E71A 1NI2A 3V60A 3HIZA 4FULA 4KSKC 2N7DA 4AJYB 5C23A 3JYUA 1P1AA 2WX0A 2Z0EB 1A5RA 1S1QB 1IP9A 4IM2A 1IPGA 1V5OA 4PYZA 4MJSB 3WAMA 1C3TA 2DAJA 1Z2MA 3M3JA 3UQBA 1YX6B 1KM7A 2BWFA 2WWZA 3HM6X 4MGZE 3UF8A 3KW5B 4RM9A 4WJNA 4FN2A 4TKNA 2HD5B 3A4RA 2MWSB 1S3SG 5LXIB 4WWPA 2MQJA 1E8WA 1T0YA 4IWQA 4BOSC 4MDKE 3EC8A 3H7SA 3UINB 2RSUA 3APFA 4W9CA 4G50A 4KV2A 4E74A 3QCAA 4W9LA 4IWPA 2KNBA 4E3CA 1HE8A 4NQLB 2NS5A 3KYDD 3ZRCA 5TR5A 3ZVVA 4RMAA 3ZDMC 3TBLD 2LUEA 3EHVA 1EO6A 3IVFA 1Q1OA 2V3SA 4ZRIA 3PLVA 1NDDA 4NAWA 3RZWC 1YJ1A 1AARA 2IO0B 3CSFA 1E8ZA 3RZFA 3N32A 1V80A 4I6PA 4LDTB 1YD8U 3PREA 3VHTC 3JSVA 4PS3A 3N3KB 1E5WA 3PS6A 3X23A 1WGRA 4WAAA 3H1UA 3Q3FA 4BKSA 3ZRFA 4A3PA 4WJQA 4JLCA 4CHKA 1WJNA 2C7NB 3VTWA 1EF5A 1TZ1A 2J0JA 2KFKA 1LFDA 3KYCD 2L0TA 1JRUA 3P2BA 1H4RA 2KMCA 4ZYNA 1P3QU 2AL3A 3APDA 3DDCB 4BKTA 2FCSA 4DK5A 2G45B 2RGFA 3ZTDA 2ZJDA 2MBQA 5D6JB 2JZZA 2J0MA 5D7GA 5GMVA 2JRIB 1XD3B 1YIWA 2N1WA 4DHJD 3QIJA 4XC2A 1WJUA 3S2AA 3GZNI 2C5LC 3OJ4B 3W1SA 1WY8A 3W1YA 3TCAA 2O6VD 1ZKHA 3Q3JA 3MHSD 2D11A 2PEAA 1V2YA 2BGFA 3QARA 2DHZA 4ANWA 3SDLC 2LGDA 4HJKA 3ZIMA 5EDSA 5BO4B 2KX3A 2JWZA 2O2VB 4DDID 1J19A 4GGQA 2JY6A 3L16A 2HTHA 3PSEB 5CHFA 5G55A 2G4SA 2Z0DB 2D2QA 4GIVA 4NAWB 5DPRA 5J2RA 2J7QB 3L08A 2IO2B 4HCNB 4GU2A 1WJ6A 1I42A 2JRHA 3UQAA 2L0FA 3JSVB 2KMAA 3H7PA 3PRZA 1WZ3A 2RD0A 3DQVA 4I6NB 4PS7A 2MBEA 2BYEA 2KC1A 3DBSA 3PHXB 2KWCA 2KZRA 2FCNA 3PVLA 2V4LA 5D2MB 1FXTB 1GNUA 2KFKB 4ZDVA 5LLIA 2N9PC 3IBEA 2FCMA 1PQSA 5J17A 3NS8A 1Z5SB 3QC8B 2WX1A 5IA7A 2WDTB 3WALA 3B1LX 4EKUA 1WX8A 2KHWB 4IUMB 2IYDB 2ZVOA 2D3GA 2MLBA 2KLCA 4DHZE 1VCBA 3AXCA 3LJ3A 1P9DU 5DPTA 3DVNU 4TUUA 3VXWA 1RLFA 3VH3B 2LASA 3SU8X 1WJ4A 4LJOB 2AL6A 2N9EB 1SE9A 4FA6A 3ZDTA 3PLUA 1WGGA 2JVCA 2KC2A 2W9NA 1BT0A 3QK0A 5L95C 2B3AA 1Q5WB 3EFUA 2D10A 3AULA 3QJZA 1V81A 2ASQA 2OOBB 4JL9A 1WX7A 2MW5A 3H7PB 5CTRC 4HDOA 5KHQA 1GG3A 1V86A 2VRRB 1GC7A 4OVUA 2LJ5A 4WJPA 2D07B 2KANA 5AZGA 1R4MI 2L05A 4TQ1A 4LCDE 3RCZA 2L8JA 3X0WA 3ECIA 2NBWB 2ZVNA 1RAXA 1V49A 3PPAA 4BFRA 4FBJB 2ZZPB 4MEMA 2M4NA 3BY4B 3A9JA 2IZVB 5E6PA 2O6VA 3L17A 4ANXA 2LRWA 3NZUA 3VDZA 5DPSA 4RM8A 1UD7A 2A5UA 2V1YA 4EFOA 4K81A 2C9WB 2JZ3B 3V62A 2EMTA 2L3ZA 1WXMA 3N30A 3ZNHB 1RRBA 2IO1B 2MBBB 4KIKA 2O2VA 2DX5B 3PRPB 1LQBA 3OAWA 2KDFB 4HK2A 1V9JA 3TIXA 3U7DA 2XK5A 1WGHA 2PE9A 1GJZA 3TJPA 2LI5A 2BF8B 3VH4B 2DZMA 2C7HA 2FIFA 2DZKA 3JVZX 1WRDB 2A4ZA 4G11A 2J0KA 4HWIB 2MRPA 2XEWA 3H9DA 4IC7B 3IFWB 4MGKE 5DCNA 4BBNC 2DYMA 2JUOA 1ZW7A 3QWZB 2KDBA 5JZEB 3V6EB 2UWQA 2K25A 2YLMA 3UIPB 2KDEB 3DVNV 2NR2A 2K1FA 1TTNA 1WXSA 1M94A 4DHJB 4FLHA 3AU5A 3IHPC 2KOXA 3CMMB 1I35A 1Q0WB 3A9JB 3V6CB 1WMHA 2CHWA 2O6VB 3L13A 3O65B 4B9KA 4M0WB 1UELA 4W9KA 3R66C 1SIFA 3K9PB 2FCQA 3TMPB 4EZKA 1C1YB 2LGYA 3L0WB 3UIOB 5HKHA 2XBBC 1L2NA 1MG8A 4FJYA 4KIKB 2LVPA 2K6DB 3AU4A 2K6QA 2DAFA 4PS8A 4MH0E 2N4FA 2GBMA 3KUCB 1RFAA 4MSMB 4BOZB 1R4NI 2G4DB 2XK5B 2EMSA 4HXDA 1LM8B 2MCNB 3T9LA 4F8CB 1WIAA 1XQQA 3KUZA 4HPLB 4K7UA 4BBNF 2HJ8A 5C1ZA 1ZGUB 2N1VA 3DPDA 1P0RA 2KXJA 4TQ0A 2ZEQA 2M0XA 4DBGA 4HPMB 3PV1A 4XX5A 4EUTA 3VTVA 1WX9A 3SHQA 4W9IA 3DVGY 4W9HA 3R7QA 3PZDA 4DHZB 4KVGB 4EZJA 2G3QB 4WQOB 1OQYA 2CR5A 2LXCA 3QX1A 4JIOU 3SD5A 5AEKB 4PYUA 2PJHA 2DZIA 3M95A 4P7IA 5JHBA 2L7RA 2LVQA 4HCPB 4I6LB 3VUWA 3A1QA 2KJRA 3ENEA 3GOEA 3MJWA 1WMHB 2Z59B 1NBFC 3OLMD 3ZNID 1U4AA 4F1SA 3BINA 2EKEC 4JQWC 2CKHB 5FR6A 2MSED 4B6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYV E;  2M17 A;  4ANV A;  1E7V A;  2I1K A;  2MA9 B;  4ICU A;  4FAD A;  3WAN A;  1TGZ B;  2GMI C;  2K8B A;  3QA8 A;  3VVW B;  4II2 B;  4EOY A;  2C60 A;  2DYB A;  3DBH I;  1XT9 B;  2M1M A;  2LWP A;  3CF6 E;  4AWJ A;  4DXA B;  3TL5 A;  2BWE S;  3A9K A;  3ZTC A;  3A4S C;  5AZF A;  1GC6 A;  5KHO A;  3RT3 B;  3WAO A;  1E8Y A;  4EEW A;  2I1J A;  3HK0 A;  2KFJ A;  4FJV B;  3ONS A;  3R3M A;  4ZRK A;  2AWT A;  5JHA A;  2R2O A;  3M63 B;  1E7U A;  2YVC A;  4CYE A;  4XZ4 A;  4NJ6 A;  5JH5 C;  3VFK A;  2LGX A;  2MX2 A;  3JW0 X;  1KJT A;  1WR1 A;  2FNJ B;  2FAZ A;  2JT4 B;  1UGM A;  3A1Q B;  4MGY E;  2MP2 A;  2LVO A;  4FHK A;  4IWO A;  5LXH A;  4F7Z A;  4K1R B;  2KK8 A;  3WAP A;  4X57 B;  1WR6 E;  3APC A;  5CHW A;  4YL8 A;  2IY1 B;  2CHX A;  4J6I A;  4GDK A;  3NOB A;  2K8H A;  2WYQ A;  3ZO5 B;  2GBK A;  4KZC A;  4W9G A;  4CO7 A;  1WZ0 A;  3ALB A;  3ZLZ A;  2KWV B;  2GBJ A;  4WWO A;  3I3T B;  3R7R A;  2REX A;  1QZE A;  2N9X A;  1F9J A;  2IBI B;  1V5T A;  4HLE A;  2LZ6 A;  3T8M A;  4ASW C;  1CMX B;  2KD0 A;  2KVR A;  3A9K B;  2KJH B;  4KDL B;  5D94 A;  1J8C A;  4K7W A;  2KDI A;  5CX3 A;  5J18 A;  4IG7 B;  1P98 A;  2NPT A;  2PPH A;  1D3Z A;  4W9F A;  3UGB B;  3K9O B;  4W9D A;  2HE7 A;  2GOW A;  4IM0 A;  3ML8 A;  5IAA C;  3U8Z A;  1WM2 A;  4AP4 C;  3DBR I;  2ZNV C;  4GOC A;  3D32 A;  3B08 A;  4KZ0 A;  4HDQ A;  4OVV A;  2KJ6 A;  2PE6 B;  2ZCC A;  2NCN A;  2DEN B;  3LDZ E;  3NY5 A;  1E8X A;  4AUQ C;  4BKG A;  2DZJ A;  2MP2 B;  2R2Q A;  1WFY A;  2CU1 A;  5E6N A;  4DWF A;  4GMV A;  3H6N A;  3VUY A;  2BKR B;  4N9F 4;  1WM3 A;  3W1S C;  2QHO A;  4HVB A;  1G6J A;  4GDL A;  4ZRJ A;  2NBU A;  2L00 B;  1WE6 A;  4LDT D;  3L10 B;  3C0R B;  4GDK B;  2JF5 A;  1OTR B;  2Y5B B;  4LJP B;  4AOF A;  3DBL I;  4B95 A;  5DPW A;  1WYW B;  2KWU B;  2JPH A;  1WH3 A;  2LXA A;  4GSW A;  4II3 B;  4KSL C;  2NVU I;  3U30 A;  3V61 A;  3L54 A;  4WJO A;  2KN5 A;  1YX5 B;  1IYF A;  2ZPY A;  3RD2 A;  2GBR A;  4FHJ A;  3ML9 A;  5E6O A;  3VAW A;  4M8N A;  1E90 A;  1OEY A;  1UH6 A;  1OGW A;  2KTF A;  2RR9 A;  2LRU A;  1WI0 A;  1WGY A;  1Y8R C;  2NPT B;  1V6E A;  2NBV B;  3VTU A;  2KTR A;  2KQ7 A;  2N7E A;  4GB9 A;  4M8M A;  2IY0 B;  4G0N B;  2K39 A;  2MBO A;  4IW0 A;  1UBQ A;  2JXX A;  2M8S A;  4A20 A;  2AYO B;  2BKF A;  2C7M B;  1KOT A;  3RYT A;  1TBE A;  2IO3 B;  3KUD B;  4G3X B;  3PRM B;  3A33 B;  4ICV A;  4W9E A;  2OJR A;  4W9J A;  3ZNG C;  4KDI C;  3NHE B;  4MEL A;  5CHV C;  3DVG X;  3QHT A;  3ZW3 A;  3OJ3 A;  4GDL B;  1WF9 A;  4TV3 A;  2FID A;  5AZH A;  3RUI B;  1WE7 A;  2L76 A;  1EF1 A;  4BVU C;  1WXV A;  2GBN A;  4NQK E;  1YQB A;  1WGD A;  1SGH A;  1UBI A;  4MSQ B;  3ZKJ C;  4BKS D;  1OEY J;  2DYO A;  4AJW A;  3EEC A;  3WIM A;  4MJS A;  1J0G A;  3PTF C;  1LXD A;  2KKC A;  2ZNV B;  5G2N A;  3MTN B;  4MGI E;  3QQ8 B;  4A3O A;  3RUL A;  4JGH B;  4MM3 A;  3VUX A;  4EZL A;  1EUV B;  3WA0 A;  2FUH B;  2KLG A;  3PT2 B;  3PGE A;  1K8R B;  2BYF A;  4NNJ B;  3IG3 A;  2LD9 A;  3HHM A;  4ANU A;  5L83 A;  2K8C A;  2UYZ B;  2BPS A;  2KQS A;  2RPQ A;  3KVF B;  2KTR B;  3DCG A;  4GXB A;  2CHZ A;  2ZCB A;  1WXA A;  3M62 B;  3QAQ A;  4IM3 A;  4FJZ A;  2ZPN A;  3ZNZ B;  2KO3 A;  3VQI A;  3CST A;  4K7S A;  4NPN A;  3PHW B;  3NZS A;  1VD2 A;  1GUA B;  2AEH A;  2CS4 A;  3B0A A;  3DOW A;  2KX0 A;  4GN1 A;  4WWN A;  1H8C A;  4DDG D;  1L7Y A;  2MBH A;  1UZX B;  3AI5 A;  4URK A;  3HM3 A;  3ZUN A;  4NY0 A;  1KLV A;  3KH0 A;  1X1M A;  1ISN A;  4NJ7 A;  4E71 A;  1NI2 A;  3V60 A;  3HIZ A;  4FUL A;  4KSK C;  2N7D A;  4AJY B;  5C23 A;  3JYU A;  1P1A A;  2WX0 A;  2Z0E B;  1A5R A;  1S1Q B;  1IP9 A;  4IM2 A;  1IPG A;  1V5O A;  4PYZ A;  4MJS B;  3WAM A;  1C3T A;  2DAJ A;  1Z2M A;  3M3J A;  3UQB A;  1YX6 B;  1KM7 A;  2BWF A;  2WWZ A;  3HM6 X;  4MGZ E;  3UF8 A;  3KW5 B;  4RM9 A;  4WJN A;  4FN2 A;  4TKN A;  2HD5 B;  3A4R A;  2MWS B;  1S3S G;  5LXI B;  4WWP A;  2MQJ A;  1E8W A;  1T0Y A;  4IWQ A;  4BOS C;  4MDK E;  3EC8 A;  3H7S A;  3UIN B;  2RSU A;  3APF A;  4W9C A;  4G50 A;  4KV2 A;  4E74 A;  3QCA A;  4W9L A;  4IWP A;  2KNB A;  4E3C A;  1HE8 A;  4NQL B;  2NS5 A;  3KYD D;  3ZRC A;  5TR5 A;  3ZVV A;  4RMA A;  3ZDM C;  3TBL D;  2LUE A;  3EHV A;  1EO6 A;  3IVF A;  1Q1O A;  2V3S A;  4ZRI A;  3PLV A;  1NDD A;  4NAW A;  3RZW C;  1YJ1 A;  1AAR A;  2IO0 B;  3CSF A;  1E8Z A;  3RZF A;  3N32 A;  1V80 A;  4I6P A;  4LDT B;  1YD8 U;  3PRE A;  3VHT C;  3JSV A;  4PS3 A;  3N3K B;  1E5W A;  3PS6 A;  3X23 A;  1WGR A;  4WAA A;  3H1U A;  3Q3F A;  4BKS A;  3ZRF A;  4A3P A;  4WJQ A;  4JLC A;  4CHK A;  1WJN A;  2C7N B;  3VTW A;  1EF5 A;  1TZ1 A;  2J0J A;  2KFK A;  1LFD A;  3KYC D;  2L0T A;  1JRU A;  3P2B A;  1H4R A;  2KMC A;  4ZYN A;  1P3Q U;  2AL3 A;  3APD A;  3DDC B;  4BKT A;  2FCS A;  4DK5 A;  2G45 B;  2RGF A;  3ZTD A;  2ZJD A;  2MBQ A;  5D6J B;  2JZZ A;  2J0M A;  5D7G A;  5GMV A;  2JRI B;  1XD3 B;  1YIW A;  2N1W A;  4DHJ D;  3QIJ A;  4XC2 A;  1WJU A;  3S2A A;  3GZN I;  2C5L C;  3OJ4 B;  3W1S A;  1WY8 A;  3W1Y A;  3TCA A;  2O6V D;  1ZKH A;  3Q3J A;  3MHS D;  2D11 A;  2PEA A;  1V2Y A;  2BGF A;  3QAR A;  2DHZ A;  4ANW A;  3SDL C;  2LGD A;  4HJK A;  3ZIM A;  5EDS A;  5BO4 B;  2KX3 A;  2JWZ A;  2O2V B;  4DDI D;  1J19 A;  4GGQ A;  2JY6 A;  3L16 A;  2HTH A;  3PSE B;  5CHF A;  5G55 A;  2G4S A;  2Z0D B;  2D2Q A;  4GIV A;  4NAW B;  5DPR A;  5J2R A;  2J7Q B;  3L08 A;  2IO2 B;  4HCN B;  4GU2 A;  1WJ6 A;  1I42 A;  2JRH A;  3UQA A;  2L0F A;  3JSV B;  2KMA A;  3H7P A;  3PRZ A;  1WZ3 A;  2RD0 A;  3DQV A;  4I6N B;  4PS7 A;  2MBE A;  2BYE A;  2KC1 A;  3DBS A;  3PHX B;  2KWC A;  2KZR A;  2FCN A;  3PVL A;  2V4L A;  5D2M B;  1FXT B;  1GNU A;  2KFK B;  4ZDV A;  5LLI A;  2N9P C;  3IBE A;  2FCM A;  1PQS A;  5J17 A;  3NS8 A;  1Z5S B;  3QC8 B;  2WX1 A;  5IA7 A;  2WDT B;  3WAL A;  3B1L X;  4EKU A;  1WX8 A;  2KHW B;  4IUM B;  2IYD B;  2ZVO A;  2D3G A;  2MLB A;  2KLC A;  4DHZ E;  1VCB A;  3AXC A;  3LJ3 A;  1P9D U;  5DPT A;  3DVN U;  4TUU A;  3VXW A;  1RLF A;  3VH3 B;  2LAS A;  3SU8 X;  1WJ4 A;  4LJO B;  2AL6 A;  2N9E B;  1SE9 A;  4FA6 A;  3ZDT A;  3PLU A;  1WGG A;  2JVC A;  2KC2 A;  2W9N A;  1BT0 A;  3QK0 A;  5L95 C;  2B3A A;  1Q5W B;  3EFU A;  2D10 A;  3AUL A;  3QJZ A;  1V81 A;  2ASQ A;  2OOB B;  4JL9 A;  1WX7 A;  2MW5 A;  3H7P B;  5CTR C;  4HDO A;  5KHQ A;  1GG3 A;  1V86 A;  2VRR B;  1GC7 A;  4OVU A;  2LJ5 A;  4WJP A;  2D07 B;  2KAN A;  5AZG A;  1R4M I;  2L05 A;  4TQ1 A;  4LCD E;  3RCZ A;  2L8J A;  3X0W A;  3ECI A;  2NBW B;  2ZVN A;  1RAX A;  1V49 A;  3PPA A;  4BFR A;  4FBJ B;  2ZZP B;  4MEM A;  2M4N A;  3BY4 B;  3A9J A;  2IZV B;  5E6P A;  2O6V A;  3L17 A;  4ANX A;  2LRW A;  3NZU A;  3VDZ A;  5DPS A;  4RM8 A;  1UD7 A;  2A5U A;  2V1Y A;  4EFO A;  4K81 A;  2C9W B;  2JZ3 B;  3V62 A;  2EMT A;  2L3Z A;  1WXM A;  3N30 A;  3ZNH B;  1RRB A;  2IO1 B;  2MBB B;  4KIK A;  2O2V A;  2DX5 B;  3PRP B;  1LQB A;  3OAW A;  2KDF B;  4HK2 A;  1V9J A;  3TIX A;  3U7D A;  2XK5 A;  1WGH A;  2PE9 A;  1GJZ A;  3TJP A;  2LI5 A;  2BF8 B;  3VH4 B;  2DZM A;  2C7H A;  2FIF A;  2DZK A;  3JVZ X;  1WRD B;  2A4Z A;  4G11 A;  2J0K A;  4HWI B;  2MRP A;  2XEW A;  3H9D A;  4IC7 B;  3IFW B;  4MGK E;  5DCN A;  4BBN C;  2DYM A;  2JUO A;  1ZW7 A;  3QWZ B;  2KDB A;  5JZE B;  3V6E B;  2UWQ A;  2K25 A;  2YLM A;  3UIP B;  2KDE B;  3DVN V;  2NR2 A;  2K1F A;  1TTN A;  1WXS A;  1M94 A;  4DHJ B;  4FLH A;  3AU5 A;  3IHP C;  2KOX A;  3CMM B;  1I35 A;  1Q0W B;  3A9J B;  3V6C B;  1WMH A;  2CHW A;  2O6V B;  3L13 A;  3O65 B;  4B9K A;  4M0W B;  1UEL A;  4W9K A;  3R66 C;  1SIF A;  3K9P B;  2FCQ A;  3TMP B;  4EZK A;  1C1Y B;  2LGY A;  3L0W B;  3UIO B;  5HKH A;  2XBB C;  1L2N A;  1MG8 A;  4FJY A;  4KIK B;  2LVP A;  2K6D B;  3AU4 A;  2K6Q A;  2DAF A;  4PS8 A;  4MH0 E;  2N4F A;  2GBM A;  3KUC B;  1RFA A;  4MSM B;  4BOZ B;  1R4N I;  2G4D B;  2XK5 B;  2EMS A;  4HXD A;  1LM8 B;  2MCN B;  3T9L A;  4F8C B;  1WIA A;  1XQQ A;  3KUZ A;  4HPL B;  4K7U A;  4BBN F;  2HJ8 A;  5C1Z A;  1ZGU B;  2N1V A;  3DPD A;  1P0R A;  2KXJ A;  4TQ0 A;  2ZEQ A;  2M0X A;  4DBG A;  4HPM B;  3PV1 A;  4XX5 A;  4EUT A;  3VTV A;  1WX9 A;  3SHQ A;  4W9I A;  3DVG Y;  4W9H A;  3R7Q A;  3PZD A;  4DHZ B;  4KVG B;  4EZJ A;  2G3Q B;  4WQO B;  1OQY A;  2CR5 A;  2LXC A;  3QX1 A;  4JIO U;  3SD5 A;  5AEK B;  4PYU A;  2PJH A;  2DZI A;  3M95 A;  4P7I A;  5JHB A;  2L7R A;  2LVQ A;  4HCP B;  4I6L B;  3VUW A;  3A1Q A;  2KJR A;  3ENE A;  3GOE A;  3MJW A;  1WMH B;  2Z59 B;  1NBF C;  3OLM D;  3ZNI D;  1U4A A;  4F1S A;  3BIN A;  2EKE C;  4JQW C;  2CKH B;  5FR6 A;  2MSE D;  4B6W A; 
#chains in the Genus database with same CATH topology
 2I1K A;  2GMI C;  2D5G A;  3KLS X;  4II2 B;  1XT9 B;  2M1M A;  2WU2 B;  3TL5 A;  2INN E;  2J52 A;  4YT0 B;  3A4S C;  3ZTC A;  3RNB C;  4EEW A;  1T6B X;  2I1J A;  4OZA A;  3GE3 C;  3TEX A;  3ONS A;  3NVV A;  4TMA B;  1E9M A;  2PVG C;  1ZE3 D;  3Q8B A;  1HZ5 A;  1WSP A;  2K3U A;  1WR1 A;  2JT4 B;  1UGM A;  3A1Q B;  1F52 A;  2IND C;  2IJ0 A;  1WR6 E;  1ZXH A;  1FNV A;  4XWW A;  4GDK A;  2KN4 A;  4KZC A;  1RFK A;  3ALB A;  3ABV B;  2IBI B;  3GS2 A;  1V5T A;  3AE3 B;  2PIA A;  2KDM A;  1TS5 A;  1P98 A;  1LO5 D;  3ZJT A;  4W9D A;  4UDU C;  3ML8 A;  1WM2 A;  3EA6 A;  1CJE A;  2BYT A;  1C4P A;  4OVV A;  2PE6 B;  2NCN A;  3AE6 B;  2RPV A;  2MP2 B;  1WFY A;  4GMV A;  5HI1 A;  3AEG B;  2WDR B;  3W1S C;  4HVB A;  1UNS A;  4YSY B;  1R4N B;  4ZRJ A;  2L00 B;  1DGJ A;  3DBL I;  4ITK A;  2KWU B;  1KLU D;  2H89 B;  3IAM 1;  4II3 B;  3V61 A;  1XEE A;  3L54 A;  1IYF A;  2ZPY A;  1DOI A;  4M8N A;  1E90 A;  1OEY A;  5G5H A;  2KTF A;  2LRU A;  1E6E B;  2NBV B;  5BMI A;  3CIR B;  2BT6 A;  2KTR A;  4M8M A;  1FEH A;  2XN9 C;  1N61 A;  1IBX B;  2JXX A;  2M8S A;  2K9X A;  3E9S A;  2IO3 B;  4JWS C;  4WQM A;  4ICV A;  1QOB A;  1NI3 A;  1J7A A;  2J4X A;  2WXF A;  1ET9 A;  4PT5 A;  5AZH A;  3EFC A;  1WE7 A;  2TSS A;  1EF1 A;  1OEY J;  2DYO A;  1P7E A;  3C8Y A;  3EEC A;  3PTF C;  4YTM B;  3QQ8 B;  4A3O A;  1YN3 A;  3P1M A;  4AQ7 A;  2KLG A;  3PGE A;  2IPK D;  2GLS A;  2BYF A;  2LD9 A;  4ANU A;  4LNN A;  1PGA A;  2KQS A;  3KVF B;  1GB1 A;  2HJ1 A;  3EGR A;  2ZPN A;  3AEE B;  3T3O A;  4K7S A;  3MC8 A;  2KVZ A;  3B0A A;  2KX0 A;  4WWN A;  3FIL B;  1XLN A;  2MBH A;  4NJ7 A;  4E71 A;  1NI2 A;  2QSD A;  2RDH A;  2G1E A;  5C23 A;  2JYT A;  1C3T A;  4PYZ A;  2DAJ A;  1Z2M A;  3KW5 B;  2BS2 B;  1FO4 A;  3A4R A;  2LFI A;  1QQR A;  4IWQ A;  3DBR B;  3RMK C;  3UIN B;  3APF A;  4W9C A;  1C78 A;  2MHJ A;  4IWP A;  3IT4 B;  5TR5 A;  3ZVV A;  1IBX A;  2JZP A;  1FMA D;  4ZRI A;  4NAW A;  1YJ1 A;  4US9 A;  3CSF A;  3V3X A;  2B76 B;  1V80 A;  4I6P A;  3CWI A;  4LDT B;  3VHT C;  3N3K B;  3X23 A;  3H1U A;  3R2I A;  4A3P A;  3RNA C;  4JLC A;  1WJN A;  2J0J A;  3KYC D;  2L0T A;  3AE1 B;  4ZYN A;  2AL3 A;  3FKY A;  4DK5 A;  2RGF A;  1TYG B;  3V05 A;  5D6J B;  2JRI B;  1TY0 A;  1XD3 B;  2HDE A;  2N1W A;  4S0R A;  1WJU A;  3GZN I;  3Q8C A;  3OJ4 B;  1WY8 A;  1HTQ A;  3TCA A;  2O6V D;  3Q3J A;  3MHS D;  4LTU A;  3P42 A;  3SDL C;  1WWT A;  1TKE A;  2DLB A;  4GLS C;  2JWZ A;  2W3R A;  3PSE B;  2G4S A;  2SEB D;  5J2R A;  5IP4 D;  4GU2 A;  1WJ6 A;  3UQA A;  1FXA A;  3JSV B;  3BVM A;  1FNW A;  2RD0 A;  3DQV A;  4I6N B;  4JPS A;  2MBE A;  3PHX B;  1YQ4 B;  5D2M B;  4YSZ B;  5HFY A;  1SF0 A;  2N9P C;  1PQS A;  2LGI A;  1YJI A;  4ZRP A;  2WDT B;  3B1L X;  2X38 A;  3W5U B;  2ZVO A;  1VCB A;  1P9D U;  4TUU A;  5I4D A;  3VH3 B;  3SFD B;  3PLU A;  2WP9 B;  4RNA A;  4MAC A;  3U7Z A;  2B3A A;  1JWS D;  3QJZ A;  4L23 A;  5D3D A;  1T5X D;  4D2K A;  4HKQ A;  1WX7 A;  2MW5 A;  1FD6 A;  1UWX A;  1F2R I;  1SE3 A;  1TKY A;  1K53 A;  2E3T A;  1V86 A;  1GC7 A;  5D3I B;  4OVU A;  4TQ1 A;  4B0E A;  5BMH A;  4B0M A;  2ZVN A;  1V49 A;  1SXT A;  2WXP A;  2IZV B;  4ANX A;  2LRW A;  2CJN A;  2V1Y A;  1AWD A;  2JZ3 B;  1C77 A;  3ZNH B;  2KWD A;  2WXL A;  4KIK A;  2JXT A;  3J9C A;  2V4I B;  4LNI A;  2KAJ A;  1V9J A;  3TIX A;  1QOF A;  3TJP A;  3VH4 B;  2DZK A;  2A4Z A;  2MJ3 A;  4KX6 B;  1Y56 A;  2Q5W D;  3QWZ B;  1WXQ A;  2UWQ A;  2K25 A;  3UIP B;  1E0Z A;  2KDE B;  5C2T B;  3DVN V;  1TTN A;  4DXG A;  1K51 A;  4FLH A;  2BBC A;  4REZ A;  1I35 A;  1YN5 A;  4K3C A;  3V6C B;  3RNC C;  4B9K A;  4W9K A;  2FCQ A;  1D6E C;  4IOI E;  4JWU C;  4FJY A;  2K0P A;  3AU4 A;  2ON8 A;  4PS8 A;  4WWM A;  3HRD D;  4MSM B;  2PTL A;  2XK5 B;  3Q14 C;  1LM8 B;  4F8C B;  1FM0 D;  3KUZ A;  1SE4 A;  2AQ1 B;  5C1Z A;  4A55 A;  1ZGU B;  3DPD A;  2KXJ A;  4TQ0 A;  4XX5 A;  3SHQ A;  4W9I A;  1F0Z A;  4W9H A;  3AM9 A;  4DHZ B;  3R8B A;  4WQO B;  2CR5 A;  3M95 A;  5JHB A;  2LVQ A;  2BS4 B;  4HCP B;  2WXO A;  2Z59 B;  2PMV A;  1U4A A;  2MEK A;  2QC8 A;  2EKE C;  4JQW C;  2JWU A;  4RGT A;  5FR6 A;  2MSE D;  2IGG A;  3WAN A;  1TGZ B;  2OHF A;  2BVC A;  3NZ3 A;  4A6Q A;  4DXA B;  3A9K A;  5KHO A;  3RT3 B;  2LHE A;  3URY A;  2NTT A;  2Z8L A;  3OWE B;  3HK0 A;  2KFJ A;  4FJV B;  2AWT A;  3M63 B;  1V1P B;  4CYE A;  5JH5 C;  3SR6 A;  3JW0 X;  4F7Z A;  4K1R B;  1NVI D;  4ZHP A;  2KK8 A;  5CHW A;  3APC A;  2IY1 B;  2CHX A;  3AB5 A;  1TKG A;  4W9G A;  4CO7 A;  3Q3M C;  1WZ0 A;  2KWV B;  3R7R A;  1A70 A;  2N9X A;  1CMX B;  2LMC A;  1I4H A;  4C56 C;  4TSS A;  5D94 A;  1TY2 A;  2OED A;  1J8C A;  4K7W A;  3IAS 1;  1UWM A;  2L1A A;  2NPT A;  4W9F A;  3U8Z A;  5IAA C;  4AP4 C;  4LNK A;  3HUI A;  3U52 E;  3D32 A;  4HDQ A;  3NY5 A;  2DEN B;  3L4P A;  4L1B A;  2WXM A;  2CJO A;  2DZJ A;  3DBL B;  2CU1 A;  1C79 A;  1JWB D;  3VUY A;  2BKR B;  4N9F 4;  1Q10 A;  1WM3 A;  2FUG 1;  5HG2 A;  4LDT D;  4GDK B;  4LJP B;  2JF5 A;  3N1Z C;  5DPW A;  1D5X C;  1C4A A;  2LXA A;  4GSW A;  2NVU I;  4P6V F;  1YX5 B;  2GBR A;  1RYJ A;  2M56 B;  1FXI A;  1OGW A;  1QOG A;  1WI0 A;  1Y8R C;  2EEL A;  1YMH E;  3VTU A;  2N7E A;  2KQ7 A;  4G0N B;  2MBO A;  1UBQ A;  4A20 A;  3ZJU A;  1KOT A;  5TSS A;  3PRM B;  1NEN B;  2OJR A;  4W9J A;  3QHT A;  1XO3 A;  3MC9 A;  2GI9 A;  4NQK E;  1YQB A;  1WGD A;  4MSQ B;  4AJW A;  4MJS A;  1J0G A;  1LXD A;  2KKC A;  2ZNV B;  4OHJ A;  5G2N A;  3MTN B;  2Y3A A;  3VUX A;  3WA0 A;  4USA A;  1KRH A;  1SBB B;  2RDB C;  3HHM A;  1PFD A;  5L83 A;  2K8C A;  2KTR B;  3DCG A;  1SE2 A;  4IM3 A;  4OVZ A;  1SIJ A;  2QMT A;  1IGD A;  4NPN A;  4N59 A;  1L5P A;  2L32 A;  1ZDV A;  1H8C A;  1L6U A;  3HM3 A;  3ZUN A;  3KH0 A;  4FUL A;  1HZ6 A;  1QOA A;  2N7D A;  3FC4 A;  3JYU A;  1S1Q B;  1IP9 A;  4ZOH C;  3UF8 A;  2WWZ A;  3HM6 X;  4WJN A;  4TKN A;  2MWS B;  1STE A;  3FAH A;  5LXI B;  4WWP A;  4BOS C;  3Q8E A;  3C19 A;  3I9V 1;  4KV2 A;  2D3C A;  1HE8 A;  2NS5 A;  4RMA A;  3ZDM C;  3TBL D;  2LUE A;  3RNG C;  4KGR A;  3GE8 C;  2IO0 B;  1E8Z A;  1ESF A;  3RZF A;  1GAQ B;  4IKG A;  3PS6 A;  4WAA A;  3Q3F A;  4BKS A;  4CHK A;  3NRZ A;  3VTW A;  1EF5 A;  1TZ1 A;  4GIV A;  1LFD A;  3P2B A;  3GZN B;  5EE1 A;  3APD A;  3DDC B;  4BKT A;  2ZJD A;  2MBQ A;  2PW9 A;  1D4B A;  2JZZ A;  5GMV A;  1YIW A;  2WXQ A;  1AW7 A;  5H92 C;  2QDF A;  5AUK A;  3NUH B;  2DHZ A;  4JX1 C;  4HJK A;  3ZIM A;  2AQ2 B;  5EDS A;  2O2V B;  4GGQ A;  2Z0D B;  4NAW B;  1TS3 A;  3L08 A;  1XLQ A;  4HCN B;  2E6X A;  3PRZ A;  1QF6 A;  3PVL A;  2V4L A;  1ZUD 2;  1NEK B;  3N1Y C;  1QT9 A;  1BXT A;  3IBE A;  2FCM A;  5J17 A;  1Z5S B;  1EM7 A;  3QC8 B;  3Q3N C;  4EKU A;  3MFG A;  1WX8 A;  4NZL B;  2IYD B;  3AV8 A;  2MLB A;  1KTK A;  3VXW A;  3RNF C;  2LAS A;  3SU8 X;  4LJO B;  2N9E B;  1SE9 A;  3ZDT A;  3KQ4 A;  2KC2 A;  3QK0 A;  1TIF A;  2M0A A;  2G9H D;  3EFU A;  3RI7 C;  2BB5 A;  2K22 A;  3AUL A;  1V81 A;  2OOB B;  1YQ3 B;  2DNF A;  1VZ7 A;  3TSS A;  4HDO A;  5KHQ A;  1GG3 A;  1B1Z A;  3ZJV A;  1ZXI A;  2LJ5 A;  2KAN A;  3DWG C;  1LGR A;  5AZG A;  1R4M I;  1M4V A;  2L05 A;  3Q2A C;  4RF0 A;  2PVO D;  2XNA C;  1D5Z C;  3RCZ A;  3VR9 B;  4BFR A;  2GB1 A;  3NVZ A;  3IXS A;  3BY4 B;  3A9J A;  5E6P A;  3VR8 B;  3NZU A;  4NJC A;  2A5U A;  2ZW0 A;  1OFF A;  2IO1 B;  2MBB B;  2O2V A;  2WDQ B;  5BMG A;  1LQB A;  2J42 A;  2KDF B;  1UF0 A;  2W3S A;  1FNU A;  1N6Z A;  4HWI B;  2MRP A;  5HHD G;  5DCN A;  3ZXV A;  1MHH E;  1ZW7 A;  2WXJ A;  2RMM A;  3V6E B;  2YLM A;  1BUI C;  2NR2 A;  1PGX A;  4YTN B;  1L4Z B;  4DHJ B;  2VZK B;  2AX5 A;  3PO0 A;  1Q0W B;  3AE4 B;  4ZYS A;  2WXH A;  3I57 A;  1WMH A;  3O65 B;  1XCT L;  1SIF A;  3TMP B;  3L0W B;  1OQR A;  1L2N A;  4KIK B;  2K6D B;  4HKZ E;  1FCL A;  2K6Q A;  2DAF A;  1R4N I;  1MG4 A;  1WIA A;  4K7U A;  2HJ8 A;  2IGD A;  1KLG D;  4EUT A;  3R7Q A;  3PZD A;  4KVG B;  2G3Q B;  2LXC A;  3QX1 A;  3SD5 A;  3MC0 B;  3NVY A;  1CZP A;  4XWT A;  4I6L B;  3MJW A;  3ENE A;  3PZ8 A;  1NBF C;  2I38 A;  1GPX A;  4F1S A;  4KKJ A;  4RF1 A;  2BYV E;  2MH7 A;  1E7V A;  2MA9 B;  4ICU A;  2D3B A;  4EE2 A;  4RGM A;  4S17 A;  4EOY A;  3IT6 B;  2DYB A;  3DBH I;  4M00 A;  1L0X B;  2LWP A;  4AWJ A;  5AZF A;  1GC6 A;  5IN7 A;  4LLG M;  4FXC A;  1DYQ A;  3R3M A;  5JHA A;  2R2O A;  1RM6 C;  2V3P A;  4XZ4 A;  3N9Y C;  1KJT A;  2FNJ B;  1JW9 D;  3Q8A A;  4MGY E;  4IWO A;  2INC C;  4YL8 A;  3ZXR A;  3NOB A;  2WYQ A;  3ZO5 B;  2GBK A;  1KFY B;  1L4D B;  5C3J B;  2LUM A;  5G5G A;  3ZLZ A;  4WWO A;  2N7J A;  2QJL A;  1QZE A;  4HLE A;  2LZ6 A;  2INP E;  4ASW C;  2KD0 A;  2MJD A;  4J3O D;  3A9K B;  2MJE A;  4KDL B;  3GP7 A;  1CQV A;  2QIE B;  3BVZ A;  1D3Z A;  1FCC C;  5EE9 A;  3UGB B;  3K9O B;  3SFE B;  2GOW A;  5AUI A;  1GB4 A;  2J53 A;  3DBR I;  2ZNV C;  4GOC A;  3BII D;  2KT7 A;  2WDV B;  3B08 A;  4BKG A;  2R2Q A;  5E6N A;  4DWF A;  3H6N A;  4RGN A;  2QHO A;  1G6J A;  4GDL A;  3C0R B;  3P4R B;  3T3N A;  4KSL C;  3U30 A;  3VRA B;  2KN5 A;  3RD2 A;  4FHJ A;  1F77 A;  3ML9 A;  5E6O A;  2WXG A;  4YWG G;  2RR9 A;  1WGY A;  2NPT B;  3RPF C;  1JWU D;  3EUB 2;  3DHG C;  2K39 A;  4XE0 A;  1K52 A;  2BKF A;  2C7M B;  3BK2 A;  4IDI A;  1TBE A;  4G3X B;  3BZD B;  3ZNG C;  4KDI C;  3NHE B;  1XLO A;  4MEL A;  3DVG X;  1N5X A;  4RCO A;  2K5P A;  3OJ3 A;  4TV3 A;  1WF9 A;  3RUI B;  2FID A;  2L76 A;  4RFB A;  4BVU C;  2GBN A;  4RH6 A;  1WGK A;  1SGH A;  1UBI A;  1AN8 A;  2LHD A;  3ZKJ C;  3TEZ A;  4JGH B;  1EUV B;  1JQ4 A;  2FUH B;  3PT2 B;  4NNJ B;  3IG3 A;  2LGS A;  1EU4 A;  2UYZ B;  4AS1 A;  4GXB A;  3M62 B;  1WXA A;  1NYQ A;  3VQI A;  3PHW B;  1VD2 A;  1GUA B;  2AEH A;  2CS4 A;  3DOW A;  5IKC M;  2BB6 A;  1ACC A;  2W82 A;  1N60 A;  4C00 A;  1L7Y A;  1UZX B;  3AI5 A;  3AEB B;  3ETR A;  4NY0 A;  1KLV A;  1X1M A;  1SJH D;  3AEF B;  4KSK C;  4C4V A;  2DBY A;  1P1A A;  4C7Z A;  2Z0E B;  1T0S C;  4MJS B;  4DQO C;  2M19 A;  1KM7 A;  2BWF A;  4MGZ E;  2BW2 A;  4FN2 A;  2HD5 B;  1S3S G;  3BVG A;  4MDK E;  3EC8 A;  2RSU A;  4E74 A;  2KNB A;  4NQL B;  1XLP A;  3KYD D;  1TJE A;  1JML A;  1MHX A;  4US8 A;  1EO6 A;  1SJE D;  2IGH A;  5FK9 C;  2V3S A;  1NDD A;  5FR3 A;  3N32 A;  2DWQ A;  4M02 A;  2N9L A;  1T0R C;  5IOI A;  4WUR A;  3H8H A;  2V0G A;  1C9F A;  1I4G A;  4O1N A;  4JE3 B;  2KFK A;  1H4R A;  1F2R C;  2KMC A;  1P3Q U;  3W2D A;  4CQN A;  2FCS A;  2G45 B;  3ZTD A;  2J0M A;  2R61 A;  5D7G A;  4DHJ D;  5T8I A;  1L6V A;  3QIJ A;  2VZK D;  4XC2 A;  5BYR A;  4ACF A;  4WIP A;  1VJK A;  2D11 A;  2PEA A;  1V2Y A;  2BGF A;  4ARI A;  2KX3 A;  4DDI D;  1J19 A;  2JY6 A;  1I4X A;  5CHF A;  1VZ6 A;  5G55 A;  4YXD B;  5BYQ A;  2D2Q A;  1FPY A;  4LNF A;  1I42 A;  4LNO A;  2PLP A;  2L0F A;  3W9C B;  3B9J A;  2ACZ B;  2KMA A;  3H7P A;  3AE2 B;  1VZ8 A;  2WQY B;  3B2F A;  3OG5 A;  2BTE A;  2KWC A;  2KZR A;  1ZOY B;  2FCN A;  1FXT B;  1GNU A;  1TS2 A;  2QIL A;  3B2G A;  3I5J C;  1N62 A;  1PUT A;  1TT5 B;  1KH0 A;  1MFW A;  1P7F A;  1YOV B;  5LLI A;  3NS8 A;  2VH1 A;  1E7P B;  2KHW B;  4IUM B;  2KQ4 X;  4DHZ E;  3AXC A;  5DPT A;  3DVN U;  1I4P A;  1WJ4 A;  2AL6 A;  4FA6 A;  3P4S B;  5L95 C;  2JVC A;  2W9N A;  1ET6 A;  4ARC A;  4KKI A;  1Q5W B;  4OW0 A;  1MVK A;  3AEC B;  1R4M B;  2ASQ A;  4K3B A;  3LYY A;  2X8X X;  5CTR C;  1R7S A;  1NYR A;  3RFZ B;  2BQQ A;  4WJP A;  2D07 B;  1HEZ E;  2PKO A;  4LCD E;  1XXG A;  3ECI A;  2NBW B;  1RAX A;  2FBW B;  4FBJ B;  2ZZP B;  4MEM A;  3Q6B A;  4A9A A;  1GOZ A;  2O6V A;  3AE5 B;  4M0W A;  4EFO A;  1UD7 A;  4XYC A;  2C9W B;  1E10 A;  3V62 A;  4XDC A;  2L3Z A;  1IUE A;  1WXM A;  3N30 A;  3AE8 B;  3HVZ A;  1D5M C;  3I63 C;  2DX5 B;  3U7D A;  1YNT E;  2PE9 A;  2BF8 B;  2DZM A;  3N1X C;  2C7H A;  3JVZ X;  2J0K A;  2FE8 A;  4WAF A;  2XEW A;  3H9D A;  2ONQ A;  3IFW B;  4MGK E;  2JUO A;  1V1O A;  2K1F A;  3AU5 A;  3IHP C;  2KOX A;  1K50 A;  1N63 A;  1T0Q C;  3A9J B;  3L13 A;  2NMQ A;  3R66 C;  2XBB C;  2NTS A;  3NG0 A;  1MG8 A;  2JU6 X;  4N6E B;  4MH8 A;  5FKA C;  4DXF A;  2IDY A;  3KUC B;  1RFA A;  4BOZ B;  2G4D B;  2EMS A;  3BYT B;  1JRP A;  3NJT A;  2MCN B;  2AQ3 B;  4HPL B;  4BBN F;  1P0R A;  2L52 A;  2ZEQ A;  2KYW A;  4DBG A;  4HPM B;  3PV1 A;  3ZGZ A;  2QEJ C;  2WXN A;  3VRB B;  4P1C C;  3LXF A;  2DZI A;  4P7I A;  2L7R A;  3VUW A;  3A1Q A;  2KJR A;  3GOE A;  1WMH B;  4RGO S;  3ZNI D;  3BIN A;  2CKH B;  4QAY A;  2EKI A;  4B6W A;  3DBH B;  2M17 A;  1QLB B;  4ANV A;  4FAD A;  3UI3 A;  2I2Y A;  2KAC A;  2K8B A;  3QA8 A;  3VVW B;  4LK0 M;  2C60 A;  3CF6 E;  1SB3 C;  1EU3 A;  5EE3 A;  2BWE S;  3WAO A;  1E8Y A;  1HA5 A;  3Q8F A;  4WH4 A;  4ZRK A;  1N5W A;  1E7U A;  2YVC A;  2W55 A;  4NJ6 A;  3DHH C;  3VFK A;  1ZPS A;  2LGX A;  2MX2 A;  3LB8 C;  3WCQ A;  3P4P B;  2FAZ A;  3AE7 B;  2MP2 A;  2LVO A;  2WXK A;  4FHK A;  5LXH A;  1EWY C;  1JRO A;  3WAP A;  4X57 B;  4R3D A;  4J6I A;  2K8H A;  2JX5 A;  5JXV A;  2GBJ A;  3I3T B;  2REX A;  1F9J A;  4MM3 B;  3T8M A;  2KVR A;  1FFU A;  3BYY B;  4HEA 1;  2KJH B;  2RDG A;  2KDI A;  5CX3 A;  3AE9 B;  4IG7 B;  5J18 A;  3U2S C;  2PPH A;  2N9K A;  2WLB A;  4BAX A;  2HE7 A;  4IM0 A;  3R2T A;  1JWM D;  1ENF A;  4KZ0 A;  4C7Y A;  2KJ6 A;  2ZCC A;  3LDZ E;  1VR9 A;  1V97 A;  1E8X A;  4AUQ C;  2V3N A;  1YJJ A;  1DOY A;  2NBU A;  1V8C A;  1WE6 A;  2VH2 A;  3L10 B;  4B95 A;  2Y5B B;  1OTR B;  4AOF A;  3AMZ A;  1WYW B;  3BK1 A;  2BS3 B;  2JPH A;  1WH3 A;  2JQR B;  4ZHO A;  4WJO A;  1FRD A;  4H2A A;  3VAW A;  1UH6 A;  3SEB A;  4HRO A;  4PK1 A;  1V6E A;  4GB9 A;  1PGB A;  5BYS A;  2IY0 B;  2ZW1 A;  5H8Y E;  4IW0 A;  2AYO B;  4YSX B;  3RYT A;  3KUD B;  3O13 A;  3A33 B;  4W9E A;  3P63 A;  1XF5 L;  3AH7 A;  3FIL A;  5CHV C;  3ZW3 A;  4GDL B;  4HPP A;  1VRA B;  1QKZ A;  1WXV A;  4BKS D;  3WIM A;  3U4E G;  4MGI E;  2WHI A;  3RUL A;  1DOX A;  4MM3 A;  4EZL A;  3MJ5 A;  1K8R B;  3TUO A;  1T3Q A;  1BML C;  5E6J A;  2BPS A;  2RPQ A;  2CHZ A;  2ZCB A;  3QAQ A;  2SAK A;  2W54 A;  4FJZ A;  1JCK B;  3ZNZ B;  2KO3 A;  3CST A;  3NZS A;  3MHZ A;  2WGS A;  2D3A A;  2UU7 A;  4GN1 A;  4DDG D;  4HRS A;  3AED B;  4URK A;  1WYG A;  1ISN A;  3RN9 C;  3V60 A;  1TS4 A;  3HIZ A;  4AJY B;  2WX0 A;  1A5R A;  4IM2 A;  1IPG A;  1V5O A;  2LJI A;  1EWC A;  3WAM A;  1MPE A;  3M3J A;  2LEK A;  3UQB A;  1YX6 B;  1I7H A;  4RM9 A;  1C76 A;  1J7B A;  3DHI C;  4MT5 A;  4KGS A;  4XDD A;  1B9R A;  1I4Q A;  1MI0 A;  2MQJ A;  1E8W A;  1T0Y A;  3H7S A;  4G50 A;  2WNM A;  3QCA A;  2H88 B;  4W9L A;  4E3C A;  3ZQ4 A;  3ZRC A;  3Q3O C;  3GB1 A;  3EHV A;  3HVD A;  3P4Q B;  3IVF A;  2WXI A;  1Q1O A;  3PLV A;  3RZW C;  1AAR A;  1YD8 U;  3PRE A;  4A8X C;  2Y5C A;  3JSV A;  4PS3 A;  4N58 A;  1E5W A;  1WGR A;  4C4V B;  3ZRF A;  4WJQ A;  2C7N B;  1JRU A;  2CU3 A;  5GXG B;  2YEP F;  3S2A A;  3MP9 A;  2C5L C;  3W1S A;  3RNE C;  3W1Y A;  1ZKH A;  3QAR A;  1ZP0 B;  4ANW A;  1HXY D;  2LGD A;  5BO4 B;  3L16 A;  2HTH A;  1FFV A;  5DPR A;  2J7Q B;  3NS1 A;  5EE0 A;  2IO2 B;  2WU5 B;  2JRH A;  4XGA B;  2YEP B;  1WZ3 A;  4PS7 A;  2BYE A;  2KC1 A;  3DBS A;  1I4R A;  1ROE A;  2KFK B;  2WXR A;  2JSV X;  4ZDV A;  3TEY A;  1PDX A;  2WX1 A;  5IA7 A;  4C80 A;  3WAL A;  1VLB A;  2JYE A;  1UGJ A;  2D3G A;  2WS3 B;  2KLC A;  2OJW A;  3LJ3 A;  1SEB D;  2GRI A;  1RLF A;  4BZA A;  1WGG A;  1BT0 A;  1F1H A;  4OZC A;  1XCQ L;  1L0Y B;  1PYW D;  2D10 A;  4L2Y A;  4JL9 A;  2ICI A;  2HTM E;  3H7P B;  1MJD A;  1JWA D;  4HJG E;  2VRR B;  2QCZ A;  4P16 A;  5MPO A;  4A90 A;  3Q69 A;  1FRR A;  2L8J A;  1HTO A;  3X0W A;  4NAM A;  3PPA A;  1RWS A;  4YTP B;  4OZB A;  2M4N A;  1YN4 A;  1JAL A;  2V9H A;  3L17 A;  3BWU D;  3VDZ A;  2L83 A;  5DPS A;  4RM8 A;  1QIL A;  1C4C A;  4K81 A;  3N20 C;  1SSN A;  1WRI A;  2EMT A;  3PZ7 A;  2Y5P A;  3ZYY X;  1RRB A;  3W5V B;  1CK1 A;  4HK2 A;  3PRP B;  4ZRQ A;  3OAW A;  3KWV A;  2XK5 A;  1WGH A;  3AEA B;  1GJZ A;  2LI5 A;  2FIF A;  1WRD B;  1TZO A;  4G11 A;  1KF6 B;  4IC7 B;  4BBN C;  2DYM A;  5JZE B;  3E56 A;  2KDB A;  1WXS A;  1M94 A;  3AN1 A;  2N0S B;  3TEW A;  5LNK 1;  3CMM B;  1L0V B;  1VDV A;  2CHW A;  2O6V B;  3DWM A;  4M0W B;  1UEL A;  1IGC A;  3K9P B;  4EZK A;  1ZDX A;  1C1Y B;  2LGY A;  3UIO B;  5HKH A;  1FIQ A;  2LVP A;  4M01 A;  1HQR D;  2N4F A;  2GBM A;  4MH0 E;  4HXD A;  3KWL A;  3T9L A;  1UUP A;  1XQQ A;  4P1B C;  2N1V A;  2M0X A;  2KMM A;  3VTV A;  1WX9 A;  4Q2J A;  3DVG Y;  1AYF A;  4EZJ A;  1OQY A;  4JIO U;  1V1P A;  5AEK B;  1OQQ A;  4PYU A;  2PJH A;  3NVW A;  3OLM D;  1J7C A;  5IO9 A;  4KGT A; 
#chains in the Genus database with same CATH homology
 2BYV E;  2M17 A;  4ANV A;  1E7V A;  2I1K A;  2MA9 B;  4ICU A;  4FAD A;  3WAN A;  1TGZ B;  2GMI C;  2K8B A;  3QA8 A;  3VVW B;  4II2 B;  4EOY A;  2C60 A;  2DYB A;  3DBH I;  1XT9 B;  2M1M A;  2LWP A;  3CF6 E;  4AWJ A;  4DXA B;  3TL5 A;  2BWE S;  3A9K A;  3ZTC A;  3A4S C;  5AZF A;  1GC6 A;  5KHO A;  3RT3 B;  3WAO A;  1E8Y A;  4EEW A;  2I1J A;  3HK0 A;  2KFJ A;  4FJV B;  3ONS A;  3R3M A;  4ZRK A;  2AWT A;  5JHA A;  2R2O A;  3M63 B;  1E7U A;  2YVC A;  4CYE A;  4XZ4 A;  4NJ6 A;  5JH5 C;  3VFK A;  2LGX A;  2MX2 A;  3JW0 X;  1KJT A;  1WR1 A;  2FNJ B;  2FAZ A;  2JT4 B;  1UGM A;  3A1Q B;  4MGY E;  2MP2 A;  2LVO A;  4FHK A;  4IWO A;  5LXH A;  4F7Z A;  4K1R B;  2KK8 A;  3WAP A;  4X57 B;  1WR6 E;  3APC A;  5CHW A;  4YL8 A;  2IY1 B;  2CHX A;  4J6I A;  4GDK A;  3NOB A;  2K8H A;  2WYQ A;  3ZO5 B;  2GBK A;  4KZC A;  4W9G A;  4CO7 A;  1WZ0 A;  3ALB A;  3ZLZ A;  2KWV B;  2GBJ A;  4WWO A;  3I3T B;  3R7R A;  2REX A;  1QZE A;  2N9X A;  1F9J A;  2IBI B;  1V5T A;  4HLE A;  2LZ6 A;  3T8M A;  4ASW C;  1CMX B;  2KD0 A;  2KVR A;  3A9K B;  2KJH B;  4KDL B;  5D94 A;  1J8C A;  4K7W A;  2KDI A;  5CX3 A;  5J18 A;  4IG7 B;  1P98 A;  2NPT A;  2PPH A;  1D3Z A;  4W9F A;  3UGB B;  3K9O B;  4W9D A;  2HE7 A;  2GOW A;  4IM0 A;  3ML8 A;  5IAA C;  3U8Z A;  1WM2 A;  4AP4 C;  3DBR I;  2ZNV C;  4GOC A;  3D32 A;  3B08 A;  4KZ0 A;  4HDQ A;  4OVV A;  2KJ6 A;  2PE6 B;  2ZCC A;  2NCN A;  2DEN B;  3LDZ E;  3NY5 A;  1E8X A;  4AUQ C;  4BKG A;  2DZJ A;  2MP2 B;  2R2Q A;  1WFY A;  2CU1 A;  5E6N A;  4DWF A;  4GMV A;  3H6N A;  3VUY A;  2BKR B;  4N9F 4;  1WM3 A;  3W1S C;  2QHO A;  4HVB A;  1G6J A;  4GDL A;  4ZRJ A;  2NBU A;  2L00 B;  1WE6 A;  4LDT D;  3L10 B;  3C0R B;  4GDK B;  2JF5 A;  1OTR B;  2Y5B B;  4LJP B;  4AOF A;  3DBL I;  4B95 A;  5DPW A;  1WYW B;  2KWU B;  2JPH A;  1WH3 A;  2LXA A;  4GSW A;  4II3 B;  4KSL C;  2NVU I;  3U30 A;  3V61 A;  3L54 A;  4WJO A;  2KN5 A;  1YX5 B;  1IYF A;  2ZPY A;  3RD2 A;  2GBR A;  4FHJ A;  3ML9 A;  5E6O A;  3VAW A;  4M8N A;  1E90 A;  1OEY A;  1UH6 A;  1OGW A;  2KTF A;  2RR9 A;  2LRU A;  1WI0 A;  1WGY A;  1Y8R C;  2NPT B;  1V6E A;  2NBV B;  3VTU A;  2KTR A;  2KQ7 A;  2N7E A;  4GB9 A;  4M8M A;  2IY0 B;  4G0N B;  2K39 A;  2MBO A;  4IW0 A;  1UBQ A;  2JXX A;  2M8S A;  4A20 A;  2AYO B;  2BKF A;  2C7M B;  1KOT A;  3RYT A;  1TBE A;  2IO3 B;  3KUD B;  4G3X B;  3PRM B;  3A33 B;  4ICV A;  4W9E A;  2OJR A;  4W9J A;  3ZNG C;  4KDI C;  3NHE B;  4MEL A;  5CHV C;  3DVG X;  3QHT A;  3ZW3 A;  3OJ3 A;  4GDL B;  1WF9 A;  4TV3 A;  2FID A;  5AZH A;  3RUI B;  1WE7 A;  2L76 A;  1EF1 A;  4BVU C;  1WXV A;  2GBN A;  4NQK E;  1YQB A;  1WGD A;  1SGH A;  1UBI A;  4MSQ B;  3ZKJ C;  4BKS D;  1OEY J;  2DYO A;  4AJW A;  3EEC A;  3WIM A;  4MJS A;  1J0G A;  3PTF C;  1LXD A;  2KKC A;  2ZNV B;  5G2N A;  3MTN B;  4MGI E;  3QQ8 B;  4A3O A;  3RUL A;  4JGH B;  4MM3 A;  3VUX A;  4EZL A;  1EUV B;  3WA0 A;  2FUH B;  2KLG A;  3PT2 B;  3PGE A;  1K8R B;  2BYF A;  4NNJ B;  3IG3 A;  2LD9 A;  3HHM A;  4ANU A;  5L83 A;  2K8C A;  2UYZ B;  2BPS A;  2KQS A;  2RPQ A;  3KVF B;  2KTR B;  3DCG A;  4GXB A;  2CHZ A;  2ZCB A;  1WXA A;  3M62 B;  3QAQ A;  4IM3 A;  4FJZ A;  2ZPN A;  3ZNZ B;  2KO3 A;  3VQI A;  3CST A;  4K7S A;  4NPN A;  3PHW B;  3NZS A;  1VD2 A;  1GUA B;  2AEH A;  2CS4 A;  3B0A A;  3DOW A;  2KX0 A;  4GN1 A;  4WWN A;  1H8C A;  4DDG D;  1L7Y A;  2MBH A;  1UZX B;  3AI5 A;  4URK A;  3HM3 A;  3ZUN A;  4NY0 A;  1KLV A;  3KH0 A;  1X1M A;  1ISN A;  4NJ7 A;  4E71 A;  1NI2 A;  3V60 A;  3HIZ A;  4FUL A;  4KSK C;  2N7D A;  4AJY B;  5C23 A;  3JYU A;  1P1A A;  2WX0 A;  2Z0E B;  1A5R A;  1S1Q B;  1IP9 A;  4IM2 A;  1IPG A;  1V5O A;  4PYZ A;  4MJS B;  3WAM A;  1C3T A;  2DAJ A;  1Z2M A;  3M3J A;  3UQB A;  1YX6 B;  1KM7 A;  2BWF A;  2WWZ A;  3HM6 X;  4MGZ E;  3UF8 A;  3KW5 B;  4RM9 A;  4WJN A;  4FN2 A;  4TKN A;  2HD5 B;  3A4R A;  2MWS B;  1S3S G;  5LXI B;  4WWP A;  2MQJ A;  1E8W A;  1T0Y A;  4IWQ A;  4BOS C;  4MDK E;  3EC8 A;  3H7S A;  3UIN B;  2RSU A;  3APF A;  4W9C A;  4G50 A;  4KV2 A;  4E74 A;  3QCA A;  4W9L A;  4IWP A;  2KNB A;  4E3C A;  1HE8 A;  4NQL B;  2NS5 A;  3KYD D;  3ZRC A;  5TR5 A;  3ZVV A;  4RMA A;  3ZDM C;  3TBL D;  2LUE A;  3EHV A;  1EO6 A;  3IVF A;  1Q1O A;  2V3S A;  4ZRI A;  3PLV A;  1NDD A;  4NAW A;  3RZW C;  1YJ1 A;  1AAR A;  2IO0 B;  3CSF A;  1E8Z A;  3RZF A;  3N32 A;  1V80 A;  4I6P A;  4LDT B;  1YD8 U;  3PRE A;  3VHT C;  3JSV A;  4PS3 A;  3N3K B;  1E5W A;  3PS6 A;  3X23 A;  1WGR A;  4WAA A;  3H1U A;  3Q3F A;  4BKS A;  3ZRF A;  4A3P A;  4WJQ A;  4JLC A;  4CHK A;  1WJN A;  2C7N B;  3VTW A;  1EF5 A;  1TZ1 A;  2J0J A;  2KFK A;  1LFD A;  3KYC D;  2L0T A;  1JRU A;  3P2B A;  1H4R A;  2KMC A;  4ZYN A;  1P3Q U;  2AL3 A;  3APD A;  3DDC B;  4BKT A;  2FCS A;  4DK5 A;  2G45 B;  2RGF A;  3ZTD A;  2ZJD A;  2MBQ A;  5D6J B;  2JZZ A;  2J0M A;  5D7G A;  5GMV A;  2JRI B;  1XD3 B;  1YIW A;  2N1W A;  4DHJ D;  3QIJ A;  4XC2 A;  1WJU A;  3S2A A;  3GZN I;  2C5L C;  3OJ4 B;  3W1S A;  1WY8 A;  3W1Y A;  3TCA A;  2O6V D;  1ZKH A;  3Q3J A;  3MHS D;  2D11 A;  2PEA A;  1V2Y A;  2BGF A;  3QAR A;  2DHZ A;  4ANW A;  3SDL C;  2LGD A;  4HJK A;  3ZIM A;  5EDS A;  5BO4 B;  2KX3 A;  2JWZ A;  2O2V B;  4DDI D;  1J19 A;  4GGQ A;  2JY6 A;  3L16 A;  2HTH A;  3PSE B;  5CHF A;  5G55 A;  2G4S A;  2Z0D B;  2D2Q A;  4GIV A;  4NAW B;  5DPR A;  5J2R A;  2J7Q B;  3L08 A;  2IO2 B;  4HCN B;  4GU2 A;  1WJ6 A;  1I42 A;  2JRH A;  3UQA A;  2L0F A;  3JSV B;  2KMA A;  3H7P A;  3PRZ A;  1WZ3 A;  2RD0 A;  3DQV A;  4I6N B;  4PS7 A;  2MBE A;  2BYE A;  2KC1 A;  3DBS A;  3PHX B;  2KWC A;  2KZR A;  2FCN A;  3PVL A;  2V4L A;  5D2M B;  1FXT B;  1GNU A;  2KFK B;  4ZDV A;  5LLI A;  2N9P C;  3IBE A;  2FCM A;  1PQS A;  5J17 A;  3NS8 A;  1Z5S B;  3QC8 B;  2WX1 A;  5IA7 A;  2WDT B;  3WAL A;  3B1L X;  4EKU A;  1WX8 A;  2KHW B;  4IUM B;  2IYD B;  2ZVO A;  2D3G A;  2MLB A;  2KLC A;  4DHZ E;  1VCB A;  3AXC A;  3LJ3 A;  1P9D U;  5DPT A;  3DVN U;  4TUU A;  3VXW A;  1RLF A;  3VH3 B;  2LAS A;  3SU8 X;  1WJ4 A;  4LJO B;  2AL6 A;  2N9E B;  1SE9 A;  4FA6 A;  3ZDT A;  3PLU A;  1WGG A;  2JVC A;  2KC2 A;  2W9N A;  1BT0 A;  3QK0 A;  5L95 C;  2B3A A;  1Q5W B;  3EFU A;  2D10 A;  3AUL A;  3QJZ A;  1V81 A;  2ASQ A;  2OOB B;  4JL9 A;  1WX7 A;  2MW5 A;  3H7P B;  5CTR C;  4HDO A;  5KHQ A;  1GG3 A;  1V86 A;  2VRR B;  1GC7 A;  4OVU A;  2LJ5 A;  4WJP A;  2D07 B;  2KAN A;  5AZG A;  1R4M I;  2L05 A;  4TQ1 A;  4LCD E;  3RCZ A;  2L8J A;  3X0W A;  3ECI A;  2NBW B;  2ZVN A;  1RAX A;  1V49 A;  3PPA A;  4BFR A;  4FBJ B;  2ZZP B;  4MEM A;  2M4N A;  3BY4 B;  3A9J A;  2IZV B;  5E6P A;  2O6V A;  3L17 A;  4ANX A;  2LRW A;  3NZU A;  3VDZ A;  5DPS A;  4RM8 A;  1UD7 A;  2A5U A;  2V1Y A;  4EFO A;  4K81 A;  2C9W B;  2JZ3 B;  3V62 A;  2EMT A;  2L3Z A;  1WXM A;  3N30 A;  3ZNH B;  1RRB A;  2IO1 B;  2MBB B;  4KIK A;  2O2V A;  2DX5 B;  3PRP B;  1LQB A;  3OAW A;  2KDF B;  4HK2 A;  1V9J A;  3TIX A;  3U7D A;  2XK5 A;  1WGH A;  2PE9 A;  1GJZ A;  3TJP A;  2LI5 A;  2BF8 B;  3VH4 B;  2DZM A;  2C7H A;  2FIF A;  2DZK A;  3JVZ X;  1WRD B;  2A4Z A;  4G11 A;  2J0K A;  4HWI B;  2MRP A;  2XEW A;  3H9D A;  4IC7 B;  3IFW B;  4MGK E;  5DCN A;  4BBN C;  2DYM A;  2JUO A;  1ZW7 A;  3QWZ B;  2KDB A;  5JZE B;  3V6E B;  2UWQ A;  2K25 A;  2YLM A;  3UIP B;  2KDE B;  3DVN V;  2NR2 A;  2K1F A;  1TTN A;  1WXS A;  1M94 A;  4DHJ B;  4FLH A;  3AU5 A;  3IHP C;  2KOX A;  3CMM B;  1I35 A;  1Q0W B;  3A9J B;  3V6C B;  1WMH A;  2CHW A;  2O6V B;  3L13 A;  3O65 B;  4B9K A;  4M0W B;  1UEL A;  4W9K A;  3R66 C;  1SIF A;  3K9P B;  2FCQ A;  3TMP B;  4EZK A;  1C1Y B;  2LGY A;  3L0W B;  3UIO B;  5HKH A;  2XBB C;  1L2N A;  1MG8 A;  4FJY A;  4KIK B;  2LVP A;  2K6D B;  3AU4 A;  2K6Q A;  2DAF A;  4PS8 A;  4MH0 E;  2N4F A;  2GBM A;  3KUC B;  1RFA A;  4MSM B;  4BOZ B;  1R4N I;  2G4D B;  2XK5 B;  2EMS A;  4HXD A;  1LM8 B;  2MCN B;  3T9L A;  4F8C B;  1WIA A;  1XQQ A;  3KUZ A;  4HPL B;  4K7U A;  4BBN F;  2HJ8 A;  5C1Z A;  1ZGU B;  2N1V A;  3DPD A;  1P0R A;  2KXJ A;  4TQ0 A;  2ZEQ A;  2M0X A;  4DBG A;  4HPM B;  3PV1 A;  4XX5 A;  4EUT A;  3VTV A;  1WX9 A;  3SHQ A;  4W9I A;  3DVG Y;  4W9H A;  3R7Q A;  3PZD A;  4DHZ B;  4KVG B;  4EZJ A;  2G3Q B;  4WQO B;  1OQY A;  2CR5 A;  2LXC A;  3QX1 A;  4JIO U;  3SD5 A;  5AEK B;  4PYU A;  2PJH A;  2DZI A;  3M95 A;  4P7I A;  5JHB A;  2L7R A;  2LVQ A;  4HCP B;  4I6L B;  3VUW A;  3A1Q A;  2KJR A;  3ENE A;  3GOE A;  3MJW A;  1WMH B;  2Z59 B;  1NBF C;  3OLM D;  3ZNI D;  1U4A A;  4F1S A;  3BIN A;  2EKE C;  4JQW C;  2CKH B;  5FR6 A;  2MSE D;  4B6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...