4RMAA

Crystal structure of the ferm domain of human ezrin
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
295
structure length
295
Chain Sequence
PKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ezrin
publication title Structural characterization suggests models for monomeric and dimeric forms of full-length ezrin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 90
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4rmaA01
2YLMA 5CTRC 4WWNA 2N4FA 2AL6A 2JWZA 4XZ4A 2KMCA 3ZTCA 4DWFA 3MHSD 4MM3A 1WXAA 3AULA 4NPNA 2KC2A 2LGDA 3WALA 4B6WA 4DXAB 1KOTA 4OVVA 4WJNA 2K1FA 2IBIB 3VUYA 4HVBA 2AWTA 2KX0A 2LRWA 3L10B 2KZRA 4MGYE 1WGHA 2KO3A 3DVNU 4WWPA 1QZEA 2LVPA 4W9JA 4NAWA 1RFAA 1P9DU 2M4NA 2GOWA 3R7RA 4KZCA 3PTFC 4GMVA 3WAMA 4X57B 1S1QB 2XK5A 2O2VB 1WXVA 3KH0A 3OLMD 3QCAA 2O6VA 3U30A 2PEAA 4K7UA 4DDID 3WAPA 1EUVB 3RT3B 1P3QU 3WANA 3TBLD 3H7SA 2DHZA 3HIZA 2CHWA 4W9DA 2ZVNA 3KVFB 4IM2A 4TQ0A 1WZ0A 3A33B 5DPTA 1GG3A 4MJSB 2D07B 4K7SA 2K8CA 1J0GA 4BOZB 4G3XB 3PHXB 2ZVOA 3LJ3A 3ZNID 2L7RA 2M8SA 3JW0X 3L0WB 4B95A 4ZDVA 3X0WA 2JT4B 4IM3A 2FCNA 3OJ4B 2OOBB 3A4RA 3UIPB 3X23A 1Z5SB 4EZJA 2PPHA 4HDQA 3DPDA 3MJWA 3UQAA 5G2NA 4B9KA 4URKA 1LQBA 4CYEA 2LRUA 1Q5WB 1YX6B 2WX1A 2IO3B 2VRRB 3PGEA 3QJZA 2KWVB 2D2QA 2KTRA 4M0WB 3ONSA 4NAWB 1IYFA 1WFYA 2KJHB 4PS3A 3NY5A 2I1KA 4DHJB 4PS7A 3QQ8B 2K8BA 3APDA 1YQBA 1HE8A 4FN2A 4W9EA 1VD2A 2O6VB 4KV2A 5CHVC 1WJNA 2DYOA 2FCSA 1I42A 3ZRFA 5IAAC 4MSQB 3TCAA 3UGBB 2DYBA 4WJPA 3L54A 2KQSA 3K9PB 2CHXA 1OEYA 1WI0A 1YD8U 2BYEA 5CHWA 1RRBA 2KLGA 2L0FA 2IY0B 2MP2A 3KYCD 2N1WA 3ML8A 5E6NA 1R4NI 3MTNB 3SD5A 2J0KA 2WDTB 1GJZA 1ZKHA 3HM6X 4LJPB 1LFDA 4PYUA 5AZFA 2KHWB 4NJ7A 1WXMA 2Z0DB 3N30A 3BINA 3PV1A 3KUCB 3M63B 3T8MA 2ZEQA 2IO2B 3L13A 3VTUA 3Q3FA 2EMTA 2LXCA 1J8CA 2R2QA 4GIVA 2W9NA 2KXJA 2MBEA 2REXA 1UGMA 2M17A 4MDKE 2KTRB 2BYVE 2BKRB 5DPRA 3PVLA 4AWJA 5DCNA 2GBNA 3ZVVA 2D3GA 4OVUA 3A9JB 5D2MB 1E90A 3ZO5B 3CF6E 1E8YA 2L76A 2G45B 4PYZA 1F9JA 1LM8B 3H6NA 2N7EA 1T0YA 2JXXA 2K6DB 1KM7A 4FADA 5JHBA 3DDCB 4JLCA 3PHWB 2KD0A 2WWZA 4DDGD 4LDTB 1WGDA 2LWPA 2LVQA 2FIDA 3CSFA 2Y5BB 3VHTC 3PSEB 2EKEC 1OTRB 1WR6E 4FLHA 1E8XA 4BKGA 2NVUI 3Q3JA 1EF5A 2MP2B 2LXAA 3IHPC 3NHEB 5KHOA 3WIMA 3JVZX 2KJ6A 4F8CB 2L00B 2PJHA 3ZLZA 3LDZE 1TZ1A 1WH3A 2MSED 2JZZA 2YVCA 2ZNVC 4II3B 3VH4B 2ZCCA 3W1SC 2A5UA 1ZGUB 4GN1A 1V6EA 2J7QB 3DVNV 4E74A 3SDLC 3IBEA 1YIWA 2NS5A 4GSWA 2UYZB 2NBWB 5CX3A 1WX7A 1WGGA 1OQYA 1P98A 3ENEA 3O65B 4GU2A 3PRPB 4HLEA 1WYWB 3K9OB 4W9KA 1D3ZA 2UWQA 3QK0A 2C5LC 2BWES 2NR2A 3ZDTA 4IWQA 2XBBC 4XC2A 2LD9A 4GDLA 4HXDA 2MBBB 3QA8A 5D6JB 2G4DB 4MSMB 1NI2A 2AYOB 4HPLB 2HJ8A 3A4SC 4JQWC 2LUEA 3JSVA 1UBQA 3L17A 4AJYB 3B0AA 3DVGY 3PS6A 4W9FA 3RZFA 3PLVA 1UD7A 2C7MB 4W9CA 1UBIA 4I6PA 2DAFA 1U4AA 1X1MA 4KSKC 4K1RB 4EZKA 5L83A 4JGHB 3IVFA 3TMPB 4G11A 3KUZA 2K25A 3P2BA 1YJ1A 2Z0EB 1SGHA 3RZWC 3ECIA 1MG8A 1KJTA 4IW0A 4A20A 4BBNF 4KDLB 1FXTB 5AZGA 3QWZB 2C60A 4AJWA 1JRUA 4FHJA 5HKHA 3T9LA 4FJVB 4I6LB 1WJUA 1CMXB 2KOXA 2N7DA 2KFKA 3DBLI 3U7DA 5JHAA 2KJRA 2LGYA 3UINB 3RCZA 2RD0A 1GNUA 4FHKA 1SE9A 2K8HA 4MGIE 1XD3B 2FUHB 2HTHA 2KWUB 1EF1A 3NZSA 3A9KA 2KKCA 3VFKA 2IYDB 4HK2A 3HM3A 5IA7A 1WM2A 2LI5A 2V4LA 1LXDA 1WX9A 3DBRI 2K39A 3N32A 4GDLB 1WRDB 2IY1B 4W9LA 5AZHA 1ISNA 2NBVB 2RSUA 2WX0A 5BO4B 3DBHI 4EOYA 3L08A 4HCNB 2XK5B 3VVWB 2FIFA 2WYQA 3BY4B 3DBSA 3JSVB 3M3JA 4RM8A 5E6OA 3SU8X 2KDIA 2LJ5A 3EFUA 4FA6A 2RPQA 1WM3A 3QIJA 3W1SA 1KLVA 3DOWA 3CMMB 3PPAA 1TBEA 4MGKE 4HJKA 2IZVB 1IP9A 3KYDD 3PREA 1TTNA 3TJPA 2G3QB 2G4SA 2CR5A 4GDKA 3EC8A 2IO1B 3U8ZA 4A3OA 3ZW3A 2GBKA 3H7PA 3S2AA 4ICVA 4LCDE 5DPWA 4W9GA 4DHJD 2PE6B 4RMAA 2J0JA 2KTFA 1WIAA 2O6VD 2DX5B 1I35A 2RGFA 3ZNHB 4CO7A 3N3KB 3JYUA 1WZ3A 1E8ZA 1BT0A 1WMHA 1L2NA 4TV3A 2MX2A 3QX1A 1XT9B 4GXBA 3R3MA 4P7IA 3V6EB 2AL3A 2MWSB 2QHOA 3M62B 3ZTDA 4YL8A 5DPSA 2KWCA 2RR9A 3QC8B 3SHQA 3ZNGC 3OJ3A 3L16A 4GOCA 5LLIA 2FAZA 4W9HA 1L7YA 4BKSD 2BF8B 2KN5A 2ZNVB 3PT2B 3VUXA 4TQ1A 2M0XA 4ASWC 1XQQA 2ZPYA 4NQKE 3A1QA 3D32A 3WAOA 2L05A 2N9EB 2R2OA 2KLCA 2KDBA 4KIKA 2DZIA 2JPHA 2KDFB 3V6CB 2LZ6A 4GDKB 5L95C 5EDSA 1V49A 4CHKA 1AARA 2FCQA 3PLUA 2O2VA 2CU1A 2JZ3B 3H7PB 1YX5B 1UELA 3V61A 2MBQA 2C7NB 2KANA 3H1UA 4ANVA 4FULA 2KNBA 5LXIB 3NZUA 2KC1A 1WGYA 2BGFA 2JRHA 3QHTA 2KFJA 3GOEA 4LJOB 4WWOA 3M95A 4NJ6A 2LASA 1WMHB 5FR6A 4LDTD 3VQIA 4AOFA 2LVOA 2JY6A 2JUOA 1SIFA 5JH5C 4IC7B 4IUMB 4K7WA 1H8CA 4DHZB 1P0RA 1NBFC 4KZ0A 1J19A 1WY8A 2CKHB 2DZJA 3CSTA 4WQOB 2DZKA 3PZDA 4BBNC 4II2B 2L8JA 4WJOA 3R7QA 4ZYNA 1C3TA 2ZCBA 3VTVA 4J6IA 1NDDA 1Z2MA 4RM9A 1V5OA 3QARA 4GB9A 3ZKJC 3ZUNA 3C0RB 2ASQA 3VAWA 2MBOA 3A1QB 5J18A 4NY0A 2MRPA 4KIKB 2N9XA 2I1JA 1GC7A 1WE7A 3TL5A 2BPSA 5D7GA 3RYTA 1G6JA 2D10A 4HDOA 3RD2A 3ALBA 2FCMA 2JRIB 4FJZA 4FJYA 3ZIMA 2MQJA 2DENB 2N9PC 4XX5A 3AXCA 4HPMB 2CS4A 1R4MI 4MGZE 4ZRIA 4EZLA 3IFWB 3AU4A 4E3CA 3ZRCA 3UQBA 3AU5A 4JIOU 1V80A 3B08A 3ZNZB 1Q1OA 4TKNA 1OGWA 1Y8RC 3B1LX 5E6PA 1V86A 5AEKB 4ANXA 4PS8A 5C1ZA 1V81A 2GMIC 4GGQA 2MBHA 3VTWA 3APFA 2DZMA 1P1AA 1E5WA 4BKSA 2D11A 4WJQA 2V3SA 2XEWA 2JF5A 3HHMA 3KW5B 3R66C 4NNJB 4EFOA 2NPTA 2KQ7A 3AI5A 4MEMA 2LGXA 2MW5A 1M94A 4BKTA 1E7VA 3RULA 4AUQC 4MELA 3VXWA 2B3AA 4K81A 3OAWA 2NCNA 4WAAA 1IPGA 4M8MA 4DBGA 2L0TA 4IG7B 4BVUC 4KDIC 3A9JA 1WE6A 4IWPA 2MA9B 5C23A 3EECA 2GBMA 1TGZB 4NQLB 2L3ZA 2CHZA 2BYFA 2JVCA 4KSLC 4E71A 2DYMA 1RAXA 2KFKB 4DHZE 2EMSA 1E7UA 1WXSA 2IO0B 1UZXB 2DAJA 2ZPNA 3HK0A 4EKUA 1A5RA 1C1YB 2KDEB 1V9JA 3EHVA 4ANUA 4BFRA 2J0MA 5J2RA 4EEWA 4ANWA 1VCBA 4IM0A 3A9KB 4M8NA 4ICUA 4KVGB 1H4RA 3QAQA 1V5TA 1RLFA 1OEYJ 1PQSA 3ML9A 3PRZA 4ZRJA 4DK5A 4EUTA 3PRMB 3KUDB 1WR1A 2Z59B 5KHQA 3H9DA 2MLBA 2N1VA 5GMVA 2HD5B 2BKFA 1GUAB 2NPTB 2A4ZA 2M1MA 4HCPB 1WX8A 3APCA 2GBRA 1V2YA 1WJ6A 1ZW7A 2K6QA 3I3TB 5TR5A 2HE7A 3TIXA 3VUWA 5J17A 3W1YA 2PE9A 2BWFA 3V62A 1EO6A 2KMAA 4HWIB 3DVGX 3V60A 5G55A 2AEHA 2KVRA 2C7HA 3RUIB 2MCNB 1WJ4A 5CHFA 4IWOA 4W9IA 4F7ZA 1K8RB 4MH0E 4BOSC 4FBJB 3ZDMC 5LXHA 4ZRKA 2C9WB 2ZJDA 2ZZPB 1E8WA 1Q0WB 1UH6A 3GZNI 5D94A 4AP4C 3DCGA 5JZEB 2V1YA 3IG3A 1S3SG 2FNJB 4G0NB 3VH3B 3NOBA 3VDZA 1WF9A 4MJSA 4A3PA 1GC6A 2OJRA 3UF8A 1WGRA 2GBJA 3NS8A 2KX3A 4JL9A 4I6NB 4TUUA 3UIOB 3DQVA 4G50A 3WA0A 2KK8A 4N9F4 2NBUA 4F1SA
chains in the Genus database with same CATH superfamily
1I4GA 5CTRC 4C4VB 4XZ4A 4MM3A 1WXAA 4NPNA 4B6WA 4DXAB 3BK1A 2YEPB 2JXTA 4WJNA 1J7AA 4HVBA 4YSXB 2LRWA 3L10B 5BMHA 1HEZE 1SXTA 1RFAA 3R7RA 1S1QB 2XK5A 1PGXA 4USAA 1EUVB 1P3QU 3TBLD 3C19A 4IM2A 3A33B 1MHXA 5G5HA 3OWEB 2ZVOA 1SJED 2PW9A 2M8SA 3RNGC 3JW0X 3DHIC 3X0WA 2K3UA 2IGGA 1RYJA 2ZW0A 3MP9A 3BVZA 3IT6B 4MM3B 3MJWA 4B9KA 4URKA 1F0ZA 1B1ZA 4HKQA 1Q5WB 1YX6B 3PGEA 1FMAD 2D2QA 4PS3A 5G5GA 4DHJB 2K8BA 2JYTA 1VD2A 1WJNA 2FCSA 1I42A 3ZRFA 3TCAA 3UGBB 1MI0A 2M19A 3K9PB 1E0ZA 1FXAA 2CHXA 2J4XA 2Y5PA 5CHWA 1XEEA 3BYTB 1R4NI 2X8XX 5MPOA 2WDTB 1ZKHA 2KHWB 2Z0DB 3ZXVA 2D5GA 3ZQ4A 1NYRA 3KUCB 1J8CA 3Q3FA 4LNOA 2IGDA 4KKIA 4XDCA 1KFYB 2REXA 1UGMA 4A9AA 2BKRB 3L4PA 5DPRA 4AWJA 5DCNA 3A9JB 5D2MB 2HJ1A 1E90A 1L5PA 1R7SA 3MC9A 1D5XC 1LM8B 2K6DB 5JHBA 1KM7A 3DDCB 5BYSA 3TEWA 2LWPA 2LVQA 3CSFA 2LMCA 3VHTC 4KX6B 1FRRA 1PFDA 2NVUI 1EF5A 3NHEB 3WIMA 1GAQB 1YQ3B 2I38A 3ZLZA 3LDZE 2ICIA 1V97A 2ZNVC 2YVCA 3W1SC 3VH4B 2L52A 3R8BA 1ZGUB 4E74A 3SDLC 1C76A 2NS5A 3MFGA 1OQYA 1P98A 1D3ZA 3KLSX 4JWUC 3C8YA 3SFEB 4HPLB 1D5ZC 3JSVA 3L17A 1YNTE 3B0AA 3PS6A 4W9FA 3PLVA 4W9CA 1GOZA 5L83A 2Z0EB 2INCC 3ECIA 1MG8A 1XLQA 2WXIA 5AZGA 3QWZB 5EE1A 2KJRA 3UINB 1GNUA 1SIJA 4MGIE 5HI1A 2VH1A 3PZ8A 4BAXA 1Q10A 3B2FA 1XCTL 2JX5A 4WWMA 3HM3A 2V4LA 1ZPSA 5IP4D 3DWGC 2WX0A 3P1MA 2RSUA 3DBHI 3L08A 3I63C 3BY4B 3DBSA 3JSVB 3M3JA 3FC4A 5E6OA 3SU8X 1ET6A 2KVZA 3DOWA 2KN4A 4MGKE 4HJKA 2IZVB 1IP9A 3KYDD 4RF0A 4JE3B 2WNMA 3ZW3A 2IO1B 4A3OA 4L1BA 3H7PA 4L2YA 2N7JA 2KTFA 1WIAA 1SE4A 2QDFA 3DHHC 2GB1A 3QX1A 1JWAD 1XT9B 5LLIA 4W9HA 1OQRA 2KN5A 5H92C 3PT2B 4YTMB 3D32A 1A70A 2L05A 4KIKA 3RPFC 5EDSA 1V49A 2J53A 2FCQA 3PLUA 2JZ3B 3H7PB 3V61A 2WXJA 1L0XB 4ANVA 2KNBA 2KC1A 1UGJA 2KFJA 2CJOA 4ZRPA 3ZGZA 3M95A 3VQIA 4AOFA 2WXFA 2LVOA 1SIFA 4K7WA 2L32A 1D6EC 1J19A 1HTQA 4NZLB 3PZDA 4WJOA 2WXKA 3R7QA 1C3TA 2ZCBA 4J6IA 1ZUD2 3R2IA 1V5OA 3ZKJC 2ASQA 2MBOA 2WDRB 5J18A 4NY0A 4KIKB 3MC8A 3TL5A 2Q5WD 3ALBA 4P1BC 2JRIB 4PK1A 2MQJA 1V1PA 1FNWA 3IFWB 3ZJUA 3AU4A 3UQBA 3AU5A 4JIOU 4KGRA 3B08A 3ZNZB 1OGWA 1Y8RC 5E6PA 3VRBB 1V86A 3E9SA 5AEKB 1V81A 2GMIC 3AE4B 5BMIA 2DZMA 3HHMA 2EKIA 2M0AA 2J52A 3ZJTA 4LNFA 3AI5A 2BB5A 1M94A 1J7CA 3BK2A 1UWMA 1F2RC 2BS4B 1TJEA 1QF6A 4A55A 1VLBA 2L0TA 1WE6A 2MA9B 5C23A 4E71A 4LNIA 1RAXA 4RNAA 4DHZE 2ZPNA 1V1PB 1V9JA 3KWVA 2INNE 2J0MA 1H4RA 2PTLA 3MHZA 4DK5A 3PRMB 1JQ4A 2WDVB 5KHQA 1TS4A 2HD5B 4PT5A 2A4ZA 1WX8A 3APCA 1V2YA 1WJ6A 1FIQA 1YMHE 1ZW7A 2K6QA 5HHDG 2AX5A 3TEYA 1QILA 1YJJA 2K22A 5J17A 3V62A 1B9RA 5FR3A 2C7HA 1HTOA 3AE6B 4F7ZA 3IT4B 4YTNB 1JCKB 2ZZPB 3GZNI 5D94A 1S3SG 2FNJB 2PMVA 3VH3B 3NOBA 4A3PA 1WF9A 4MJSA 1GC6A 1VZ7A 1AYFA 2WGSA 3UIOB 1TKEA 3U52E 3WA0A 4HEA1 1C4AA 1K50A 4WWNA 2N4FA 2G9HD 2JWZA 3VRAB 3TUOA 3ZTCA 4DWFA 1FCCC 4YWGG 2KC2A 1KOTA 4OVVA 2IBIB 3VUYA 2KX0A 3AE9B 1KTKA 1QZEA 4NAWA 2GOWA 3DBHB 4GMVA 4X57B 2O2VB 1ZP0B 2QCZA 3U4EG 4RF1A 3RT3B 1J7BA 2RDHA 3ZYYX 3H7SA 1LGRA 2DHZA 3HIZA 4XYCA 1KLUD 3RNAC 3NVYA 2ZVNA 2W3SA 1GG3A 4MJSB 2FUG1 2D07B 4K7SA 1T0QC 1J0GA 3AEGB 3L0WB 1TKGA 4B95A 2JT4B 3N1XC 2PPHA 3DPDA 1JWUD 2IO3B 2VRRB 2KWVB 3NG0A 2LGSA 4NAWB 2I1KA 3APDA 1HE8A 3N9YC 1TIFA 5CHVC 1FEHA 2MJ3A 5IAAC 4MSQB 1XXGA 2QC8A 2KQSA 3RNBC 1OEYA 1ZXIA 2K0PA 2IY0B 4OVZA 2W3RA 5BYQA 2N1WA 3ML8A 3BVGA 3SD5A 1GJZA 5AZFA 2WXMA 1OFFA 3BINA 4XDDA 3M63B 3Q8FA 2ZEQA 3EGRA 2R2QA 4GIVA 4MT5A 2MBEA 2M17A 2GI9A 3PZ7A 4MDKE 2BYVE 1E7PB 4OVUA 3W2DA 2NTSA 3Q3NC 3CF6E 1E8YA 3EFCA 2L76A 3AB5A 2N7EA 4JLCA 3PHWB 2KD0A 4LDTB 2WXRA 2FIDA 2Y5BB 2INDC 2EKEC 1GB1A 1D5MC 1JWSD 1FM0D 1C79A 2PVOD 3RNEC 3Q3JA 2LXAA 3IHPC 1IBXA 2IJ0A 2MSED 3NVWA 4H2AA 4OHJA 4GN1A 2CU3A 1V6EA 4K3BA 3ENEA 2R61A 3PRPB 3K9OB 2MHJA 3QK0A 2BWES 4IWQA 4XC2A 1IGCA 4GDLA 4HXDA 2QSDA 4J3OD 1AWDA 3EA6A 1NI2A 1IUEA 2AYOB 3A4SC 1TY2A 1UBQA 3DVGY 1LO5D 2DAFA 4K1RB 4YSYB 4G11A 4LTUA 1SGHA 4A20A 4KKJA 4BBNF 2JU6X 2SAKA 4KDLB 3RI7C 2C60A 4AJWA 1JRUA 1IBXB 2OHFA 2QJLA 2QEJC 2L83A 1CMXB 2N7DA 5JHAA 3DBLI 2IPKD 2LGYA 2RD0A 2G1EA 4JX1C 2WXHA 2K8HA 2QIEB 2HTHA 2KWUB 1EF1A 1DYQA 1DOIA 1QOBA 3VFKA 2IYDB 2LFIA 4OZBA 2WQYB 1ACCA 1DOYA 2YEPF 1TT5B 2K39A 3NRZA 4P16A 3N32A 4GDLB 1XF5L 4W9LA 4XWTA 2VH2A 1MFWA 4HCNB 2XK5B 1TS2A 1ENFA 3VVWB 1RM6C 2K9XA 4RM8A 3AEAB 1C78A 3EFUA 1WM3A 3W1SA 1E10A 1ESFA 2Y3AA 3PPAA 1NENB 3PREA 1TTNA 3Q8AA 4ZOHC 4TMAB 2G4SA 4GDKA 2BS2B 1JRPA 3EC8A 3U8ZA 1N6ZA 1F2RI 4OW0A 2GBKA 1MJDA 1L0VB 1FO4A 4LCDE 1CZPA 3GB1A 5E6JA 3GZNB 1VDVA 2O6VD 1I35A 4EE2A 3N3KB 1WZ3A 1F1HA 3FILA 1BT0A 2DWQA 1L2NA 1NI3A 5IN7A 3V6EB 4YXDB 2AL3A 2QHOA 3SHQA 4ARIA 3ZNGC 4GOCA 4WQMA 5AUIA 3BIID 2ZNVB 3Q8CA 3VUXA 4TQ1A 2ZPYA 3A1QA 2N9EB 2KLCA 2JPHA 4GDKB 2JSVX 1UELA 2C7NB 3H1UA 4FULA 1SBBB 2ACZB 3NZUA 1FFUA 3GOEA 4WWOA 1GPXA 2WHIA 2J42A 3IAM1 4N59A 4IC7B 1H8CA 4DHZB 4ITKA 4KZ0A 2CKHB 4WQOB 2DZKA 1SB3C 1ZE3D 4ZYNA 3VTVA 4IOIE 5FKAC 4ACFA 2WU2B 3A1QB 2I1JA 3IXSA 3RYTA 2FCMA 4WAFA 1HZ6A 4AS1A 3AXCA 2CS4A 4NAMA 1Q1OA 4TKNA 2KQ4X 3H8HA 4ZHPA 2BS3B 3VTWA 1E5WA 2D11A 4WJQA 2JF5A 4JPSA 3SFDB 1E7VA 2AQ1B 4K81A 4GLSC 4M8MA 3ZJVA 4KDIC 4DXFA 3EECA 3BWUD 4NQLB 4HROA 2CHZA 3FAHA 2DYMA 2EMSA 1E7UA 2IO0B 4EKUA 4BFRA 5J2RA 1C4CA 2LEKA 4EEWA 3P4SB 4ICUA 1V5TA 1PQSA 3PRZA 1YQ4B 2QILA 1WR1A 2Z59B 3H9DA 2MLBA 2N1VA 1E9MA 4HCPB 3ABVB 3TIXA 1FNVA 1YN3A 3GP7A 2KVRA 3AECB 3E56A 1WJ4A 5CHFA 3VR8B 4W9IA 1K8RB 4MH0E 4BOSC 2BTEA 3ZDMC 5JZEB 1Q0WB 3IG3A 1TZOA 1IGDA 3U2SC 4G0NB 2OJRA 3HRDD 3P42A 2E6XA 2N9LA 2KX3A 4JL9A 1WR6E 3KH0A 1I4HA 3TEXA 3DBLB 2GLSA 2YLMA 1K53A 1QKZA 2WS3B 2KMCA 3AULA 2Z8LA 2LGDA 1L4DB 4AQ7A 1JW9D 1V8CA 1WSPA 4A8XC 3Q6BA 4MGYE 1WGHA 3DVNU 3NS1A 4WWPA 2VZKD 1DOXA 3SEBA 2M4NA 5I4DA 3PTFC 2JWUA 1EM7A 3QCAA 4O1NA 3U30A 2PEAA 4DDID 4A6QA 1GB4A 3GS2A 4D2KA 1KRHA 3NUHB 1SEBD 4XGAB 4TQ0A 3Q3OC 2BYTA 1C4PA 1I7HA 3AE8B 2K8CA 4BOZB 4G3XB 1ZOYB 3LJ3A 3ZNID 3P4QB 2OEDA 3RFZB 4C56C 5IKCM 3OJ4B 2OOBB 3A4RA 3X23A 3N1YC 1QOFA 4HDQA 3NJTA 1LQBA 2WX1A 5GXGB 2V4IB 4C7YA 2BB6A 1IYFA 1WFYA 2KJHB 3NY5A 4PS7A 2N9KA 1SE3A 4W9EA 1FXIA 2DYBA 4WJPA 3L54A 3AE5B 1WI0A 1YD8U 3AE2B 1RRBA 2KLGA 2L0FA 2JYEA 2MP2A 3KYCD 2J0KA 3HM6X 4LJPB 4PYUA 4NJ7A 1WXMA 2MJDA 3N30A 4MH8A 4DXGA 2OJWA 3T8MA 2IO2B 3L13A 4C80A 2W9NA 5TSSA 4ZYSA 1YOVB 1PGBA 3ZVVA 3GE8C 5JXVA 3WCQA 1TKYA 1MPEA 3ETRA 2G45B 4RFBA 4PYZA 4FADA 4BZAA 1SF0A 2WWZA 3EUB2 4HJGE 1ZXHA 3PSEB 4FLHA 4BKGA 2XN9C 1MG4A 1VZ8A 2MP2B 3JVZX 2KJ6A 2ONQA 4F8CB 2L00B 2PJHA 2H89B 2INPE 3NVZA 2A5UA 2NTTA 4M02A 2J7QB 3DVNV 3IAS1 3IBEA 1FRDA 3W9CB 2UYZB 2NBWB 5CX3A 1E6EB 1WGGA 4M00A 4W9KA 3RNFC 2UWQA 5BMGA 2C5LC 2NR2A 2XBBC 5T8IA 2MBBB 3QA8A 2G4DB 2HJ8A 2LUEA 3KQ4A 4AJYB 3N20C 3BZDB 3RZFA 2C7MB 1UBIA 4I6PA 4KSKC 3IVFA 4OZCA 5EE0A 3P2BA 1YJ1A 1SSNA 4RGOS 1EWYC 4IW0A 1KJTA 2WLBA 5BYRA 4FHJA 2K5PA 4HRSA 3T9LA 4FJVB 1UF0A 4I6LB 2M56B 2KOXA 1EU4A 1AN8A 2KFKA 3U7DA 3RCZA 3AEDB 1P7FA 4YTPB 1D4BA 3CWIA 3O13A 2FUHB 3NZSA 3A9KA 4HK2A 1WM2A 4NJCA 2PVGC 1LXDA 1WX9A 3DBRI 4QAYA 1JMLA 2IY1B 1ISNA 1VR9A 2NBVB 5HG2A 1YJIA 2KDIA 1OQQA 2LJ5A 3P63A 3CMMB 5IO9A 3AN1A 1TBEA 3N1ZC 3TJPA 2G3QB 4R3DA 4LLGM 1QOGA 4DHJD 4HPPA 4RMAA 2J0JA 1N60A 2DX5B 4CO7A 1CQVA 1E8ZA 4N6EB 4TV3A 1L6VA 4YL8A 5DPSA 3HVZA 2KWCA 2RR9A 3AEBB 1WXQA 5IOIA 3BYYB 1ROEA 2RDGA 4BKSD 1XLOA 3DHGC 1JWBD 1QT9A 1KH0A 2M0XA 2V3PA 4NQKE 2R2OA 2IGHA 2KDBA 4ARCA 1WYGA 2LZ6A 1XLPA 5L95C 1AARA 3AMZA 2CU1A 3P4RB 1TS5A 2MBQA 2WXNA 1N5WA 1UUPA 2JRHA 3QHTA 3V05A 3PO0A 1VRAB 3AE7B 4LJOB 4NJ6A 2LASA 3BVMA 5FR6A 2JY6A 2JUOA 4IUMB 2KAJA 1PUTA 1P0RA 5EE3A 1WY8A 2DZJA 4BBNC 3CSTA 3I5JC 2BW2A 2L8JA 1V1OA 3AV8A 4N58A 4US8A 2V9HA 2WP9B 1NDDA 1Z2MA 3QARA 3B2GA 3C0RB 5C3JB 1XLNA 2MRPA 1WE7A 2BPSA 3Q69A 2D10A 3I9V1 4HDOA 4KGSA 3RD2A 4FJZA 3ZIMA 3HVDA 2N9PC 1WGKA 2WXGA 3KWLA 1BUIC 3LB8C 1R4MI 4MGZE 4EZLA 4E3CA 3ZRCA 2B76B 2NMQA 4YT0B 1K52A 1TS3A 4ANXA 4PS8A 5C1ZA 3APFA 1L6UA 2AQ2B 4BKSA 1N5XA 2D3BA 2XEWA 3KW5B 3R66C 2GRIA 2NPTA 2JQRB 2LGXA 1RWSA 3RULA 3VXWA 5EE9A 3OAWA 2NCNA 4WAAA 1IPGA 1T6BX 4DBGA 4IG7B 1HZ5A 3A9JA 2L3ZA 3B9JA 3OG5A 2D3CA 2DAJA 1STEA 3HK0A 1A5RA 1C1YB 1C9FA 2PKOA 1UNSA 1JWMD 4S17A 2UU7A 4ZRJA 2KYWA 3GE3C 4YSZB 5GMVA 2BKFA 1GUAB 2NPTB 4FXCA 5TR5A 4A90A 3ZXRA 1JALA 3Q3MC 1MHHE 3VUWA 2PE9A 1EO6A 4HWIB 3DVGX 3V60A 5G55A 2RMMA 4IWOA 4M01A 2W55A 4FBJB 5HFYA 2C9WB 2ZJDA 5D3DA 1UH6A 4AP4C 1Y56A 3DCGA 1HA5A 4JWSC 3VDZA 3FILB 1WGRA 4I6NB 4TUUA 2NBUA 1I4PA 1RFKA 1EWCA 3Q8BA 2AL6A 3MHSD 2AQ3B 3WALA 1ET9A 1VJKA 3FKYA 2K1FA 4Q2JA 2AWTA 2HDEA 2KZRA 3DBRB 1T0RC 2KO3A 4M0WA 2LVPA 4W9JA 1P9DU 3NVVA 4KZCA 2ON8A 3WAMA 2HTME 3OLMD 1WXVA 2O6VA 1K51A 1UWXA 3AEEB 4C00A 4K7UA 3WAPA 4OZAA 4B0MA 2MH7A 2ZW1A 3WANA 2CHWA 1QQRA 4W9DA 3KVFB 1JROA 1WZ0A 1F52A 1EU3A 5DPTA 1FCLA 3PHXB 5LNK1 2L7RA 4ZDVA 4IM3A 2FCNA 3UIPB 1Z5SB 4EZJA 3T3NA 3I57A 1ZDVA 3UQAA 5G2NA 4RGNA 4CYEA 2LRUA 3UI3A 3HUIA 1KF6B 3QJZA 2KTRA 3P4PB 1FPYA 4M0WB 3ONSA 1HXYD 2LJIA 1T5XD 1PYWD 3QQ8B 1YQBA 4FN2A 2O6VB 4KV2A 2DYOA 3CIRB 3R2TA 1XO3A 1ZDXA 3VR9B 1QOAA 2BYEA 3Q2AC 1FD6A 2LUMA 5E6NA 3MTNB 3AE3B 2IDYA 1LFDA 4XWWA 3PV1A 2WXLA 3VTUA 2EMTA 2LXCA 2PIAA 2KXJA 2KTRB 3PVLA 2E3TA 2GBNA 2D3GA 1P7EA 1FNUA 3ZO5B 2TSSA 4CQNA 1F9JA 3H6NA 1T0YA 2JXXA 4S0RA 1CK1A 1CJEA 4DDGD 1XCQL 2V3NA 1WGDA 3Q8EA 4P1CC 1OTRB 2DLBA 1L0YB 1E8XA 1M4VA 5KHOA 3U7ZA 2N0SB 2CJNA 1TZ1A 1WH3A 4II3B 2JZZA 2ZCCA 1YIWA 4GSWA 1R4MB 1WX7A 3O65B 2KACA 4GU2A 4HLEA 1T3QA 4MACA 1WYWB 4WIPA 3ZDTA 2LD9A 2MEKA 5D6JB 1TYGB 2H88B 4MSMB 4JQWC 4KGTA 1UD7A 2WDQB 1U4AA 1X1MA 4EZKA 4JGHB 4TSSA 3TMPB 2L1AA 3KUZA 2K25A 3RZWC 2PLPA 3AEFB 2BBCA 1FXTB 5HKHA 2BT6A 1WJUA 1VZ6A 1SJHD 1YN5A 3MC0B 4FHKA 1N63A 1SE9A 3W5VB 3SR6A 1XD3B 2KKCA 2KWDA 3J9CA 5IA7A 2LI5A 2RDBC 1WRDB 3MJ5A 1BXTA 5AZHA 5BO4B 1R4NB 4EOYA 3DWMA 3AE1B 2FIFA 2WYQA 5FK9C 2DBYA 4FA6A 2RPQA 3QIJA 1KLVA 1BMLC 1HQRD 2CR5A 3URYA 1NEKB 3S2AA 2LHDA 4ICVA 5DPWA 4W9GA 2PE6B 3V3XA 2RGFA 3ZNHB 3JYUA 1WMHA 3LXFA 2MX2A 4GXBA 3R3MA 4P7IA 2MWSB 3M62B 3ZTDA 3QC8B 3OJ3A 3L16A 2FAZA 1L7YA 2BF8B 5H8YE 4US9A 2BQQA 4ASWC 1F77A 2SEBD 1XQQA 3WAOA 1I4XA 3V6CB 2DZIA 2KDFB 1MVKA 2FE8A 3W5UB 4LK0M 4CHKA 4K3CA 2O2VA 1DGJA 1YX5B 4IDIA 2KANA 5LXIB 2VZKB 1WGYA 2BGFA 4WURA 2LHEA 3NZ3A 5C2TB 1WMHB 4LDTD 4RCOA 5JH5C 1N61A 2WU5B 1NBFC 1C77A 2V0GA 3AM9A 4WH4A 4II2B 2FBWB 4RM9A 4GB9A 3ZUNA 3VAWA 3TEZA 1YN4A 2N9XA 2JZPA 1GC7A 1G6JA 2WXQA 5D7GA 4DQOC 1N62A 4FJYA 2RPVA 1KLGD 2DENB 4XX5A 4HPMB 4HKZE 1PDXA 4ZRIA 1L4ZB 2EELA 1QLBB 1V80A 3B1LX 2QMTA 4C7ZA 1WWTA 3LYYA 5D3IB 4GGQA 2MBHA 2KDMA 1P1AA 2V3SA 1NYQA 2X38A 2W82A 4NNJB 4EFOA 2KQ7A 4MEMA 2MW5A 4BKTA 1TY0A 4AUQC 4MELA 2B3AA 1I4RA 2BVCA 4BVUC 4IWPA 1WRIA 4REZA 4RGTA 3RN9C 2GBMA 1TGZB 4IKGA 2BYFA 2JVCA 4KSLC 2KMMA 1AW7A 1T0SC 2KFKB 1WXSA 1UZXB 2KDEB 3EHVA 4ANUA 4P6VF 4ANWA 1VCBA 4IM0A 3A9KB 4M8NA 4KVGB 3QAQA 1RLFA 4LNNA 1OEYJ 3ML9A 4EUTA 2XNAC 1FFVA 4ZRQA 3KUDB 2WXOA 5AUKA 1SE2A 4RH6A 4RGMA 2M1MA 4ZHOA 4C4VA 2GBRA 2D3AA 3I3TB 4LNKA 2HE7A 3TSSA 2Y5CA 3W1YA 2BWFA 3RMKC 2KMAA 2KT7A 4XE0A 2AEHA 3AH7A 2W54A 3RUIB 3RNCC 4B0EA 2MCNB 1PGAA 2MJEA 2DNFA 2I2YA 4UDUC 5LXHA 4ZRKA 1E8WA 2WXPA 2V1YA 3Q14C 1NVID 3UF8A 4L23A 2LGIA 3T3OA 2GBJA 3NS8A 3DQVA 4G50A 2KK8A 4N9F4 1I4QA 4F1SA
chains in the Genus database with same CATH topology
2YLMA 5CTRC 4WWNA 2N4FA 2AL6A 2JWZA 4XZ4A 2KMCA 3ZTCA 4DWFA 3MHSD 4MM3A 1WXAA 3AULA 4NPNA 2KC2A 2LGDA 3WALA 4B6WA 4DXAB 1KOTA 4OVVA 4WJNA 2K1FA 2IBIB 3VUYA 4HVBA 2AWTA 2KX0A 2LRWA 3L10B 2KZRA 4MGYE 1WGHA 2KO3A 3DVNU 4WWPA 1QZEA 2LVPA 4W9JA 4NAWA 1RFAA 1P9DU 2M4NA 2GOWA 3R7RA 4KZCA 3PTFC 4GMVA 3WAMA 4X57B 1S1QB 2XK5A 2O2VB 1WXVA 3KH0A 3OLMD 3QCAA 2O6VA 3U30A 2PEAA 4K7UA 4DDID 3WAPA 1EUVB 3RT3B 1P3QU 3WANA 3TBLD 3H7SA 2DHZA 3HIZA 2CHWA 4W9DA 2ZVNA 3KVFB 4IM2A 4TQ0A 1WZ0A 3A33B 5DPTA 1GG3A 4MJSB 2D07B 4K7SA 2K8CA 1J0GA 4BOZB 4G3XB 3PHXB 2ZVOA 3LJ3A 3ZNID 2L7RA 2M8SA 3JW0X 3L0WB 4B95A 4ZDVA 3X0WA 2JT4B 4IM3A 2FCNA 3OJ4B 2OOBB 3A4RA 3UIPB 3X23A 1Z5SB 4EZJA 2PPHA 4HDQA 3DPDA 3MJWA 3UQAA 5G2NA 4B9KA 4URKA 1LQBA 4CYEA 2LRUA 1Q5WB 1YX6B 2WX1A 2IO3B 2VRRB 3PGEA 3QJZA 2KWVB 2D2QA 2KTRA 4M0WB 3ONSA 4NAWB 1IYFA 1WFYA 2KJHB 4PS3A 3NY5A 2I1KA 4DHJB 4PS7A 3QQ8B 2K8BA 3APDA 1YQBA 1HE8A 4FN2A 4W9EA 1VD2A 2O6VB 4KV2A 5CHVC 1WJNA 2DYOA 2FCSA 1I42A 3ZRFA 5IAAC 4MSQB 3TCAA 3UGBB 2DYBA 4WJPA 3L54A 2KQSA 3K9PB 2CHXA 1OEYA 1WI0A 1YD8U 2BYEA 5CHWA 1RRBA 2KLGA 2L0FA 2IY0B 2MP2A 3KYCD 2N1WA 3ML8A 5E6NA 1R4NI 3MTNB 3SD5A 2J0KA 2WDTB 1GJZA 1ZKHA 3HM6X 4LJPB 1LFDA 4PYUA 5AZFA 2KHWB 4NJ7A 1WXMA 2Z0DB 3N30A 3BINA 3PV1A 3KUCB 3M63B 3T8MA 2ZEQA 2IO2B 3L13A 3VTUA 3Q3FA 2EMTA 2LXCA 1J8CA 2R2QA 4GIVA 2W9NA 2KXJA 2MBEA 2REXA 1UGMA 2M17A 4MDKE 2KTRB 2BYVE 2BKRB 5DPRA 3PVLA 4AWJA 5DCNA 2GBNA 3ZVVA 2D3GA 4OVUA 3A9JB 5D2MB 1E90A 3ZO5B 3CF6E 1E8YA 2L76A 2G45B 4PYZA 1F9JA 1LM8B 3H6NA 2N7EA 1T0YA 2JXXA 2K6DB 1KM7A 4FADA 5JHBA 3DDCB 4JLCA 3PHWB 2KD0A 2WWZA 4DDGD 4LDTB 1WGDA 2LWPA 2LVQA 2FIDA 3CSFA 2Y5BB 3VHTC 3PSEB 2EKEC 1OTRB 1WR6E 4FLHA 1E8XA 4BKGA 2NVUI 3Q3JA 1EF5A 2MP2B 2LXAA 3IHPC 3NHEB 5KHOA 3WIMA 3JVZX 2KJ6A 4F8CB 2L00B 2PJHA 3ZLZA 3LDZE 1TZ1A 1WH3A 2MSED 2JZZA 2YVCA 2ZNVC 4II3B 3VH4B 2ZCCA 3W1SC 2A5UA 1ZGUB 4GN1A 1V6EA 2J7QB 3DVNV 4E74A 3SDLC 3IBEA 1YIWA 2NS5A 4GSWA 2UYZB 2NBWB 5CX3A 1WX7A 1WGGA 1OQYA 1P98A 3ENEA 3O65B 4GU2A 3PRPB 4HLEA 1WYWB 3K9OB 4W9KA 1D3ZA 2UWQA 3QK0A 2C5LC 2BWES 2NR2A 3ZDTA 4IWQA 2XBBC 4XC2A 2LD9A 4GDLA 4HXDA 2MBBB 3QA8A 5D6JB 2G4DB 4MSMB 1NI2A 2AYOB 4HPLB 2HJ8A 3A4SC 4JQWC 2LUEA 3JSVA 1UBQA 3L17A 4AJYB 3B0AA 3DVGY 3PS6A 4W9FA 3RZFA 3PLVA 1UD7A 2C7MB 4W9CA 1UBIA 4I6PA 2DAFA 1U4AA 1X1MA 4KSKC 4K1RB 4EZKA 5L83A 4JGHB 3IVFA 3TMPB 4G11A 3KUZA 2K25A 3P2BA 1YJ1A 2Z0EB 1SGHA 3RZWC 3ECIA 1MG8A 1KJTA 4IW0A 4A20A 4BBNF 4KDLB 1FXTB 5AZGA 3QWZB 2C60A 4AJWA 1JRUA 4FHJA 5HKHA 3T9LA 4FJVB 4I6LB 1WJUA 1CMXB 2KOXA 2N7DA 2KFKA 3DBLI 3U7DA 5JHAA 2KJRA 2LGYA 3UINB 3RCZA 2RD0A 1GNUA 4FHKA 1SE9A 2K8HA 4MGIE 1XD3B 2FUHB 2HTHA 2KWUB 1EF1A 3NZSA 3A9KA 2KKCA 3VFKA 2IYDB 4HK2A 3HM3A 5IA7A 1WM2A 2LI5A 2V4LA 1LXDA 1WX9A 3DBRI 2K39A 3N32A 4GDLB 1WRDB 2IY1B 4W9LA 5AZHA 1ISNA 2NBVB 2RSUA 2WX0A 5BO4B 3DBHI 4EOYA 3L08A 4HCNB 2XK5B 3VVWB 2FIFA 2WYQA 3BY4B 3DBSA 3JSVB 3M3JA 4RM8A 5E6OA 3SU8X 2KDIA 2LJ5A 3EFUA 4FA6A 2RPQA 1WM3A 3QIJA 3W1SA 1KLVA 3DOWA 3CMMB 3PPAA 1TBEA 4MGKE 4HJKA 2IZVB 1IP9A 3KYDD 3PREA 1TTNA 3TJPA 2G3QB 2G4SA 2CR5A 4GDKA 3EC8A 2IO1B 3U8ZA 4A3OA 3ZW3A 2GBKA 3H7PA 3S2AA 4ICVA 4LCDE 5DPWA 4W9GA 4DHJD 2PE6B 4RMAA 2J0JA 2KTFA 1WIAA 2O6VD 2DX5B 1I35A 2RGFA 3ZNHB 4CO7A 3N3KB 3JYUA 1WZ3A 1E8ZA 1BT0A 1WMHA 1L2NA 4TV3A 2MX2A 3QX1A 1XT9B 4GXBA 3R3MA 4P7IA 3V6EB 2AL3A 2MWSB 2QHOA 3M62B 3ZTDA 4YL8A 5DPSA 2KWCA 2RR9A 3QC8B 3SHQA 3ZNGC 3OJ3A 3L16A 4GOCA 5LLIA 2FAZA 4W9HA 1L7YA 4BKSD 2BF8B 2KN5A 2ZNVB 3PT2B 3VUXA 4TQ1A 2M0XA 4ASWC 1XQQA 2ZPYA 4NQKE 3A1QA 3D32A 3WAOA 2L05A 2N9EB 2R2OA 2KLCA 2KDBA 4KIKA 2DZIA 2JPHA 2KDFB 3V6CB 2LZ6A 4GDKB 5L95C 5EDSA 1V49A 4CHKA 1AARA 2FCQA 3PLUA 2O2VA 2CU1A 2JZ3B 3H7PB 1YX5B 1UELA 3V61A 2MBQA 2C7NB 2KANA 3H1UA 4ANVA 4FULA 2KNBA 5LXIB 3NZUA 2KC1A 1WGYA 2BGFA 2JRHA 3QHTA 2KFJA 3GOEA 4LJOB 4WWOA 3M95A 4NJ6A 2LASA 1WMHB 5FR6A 4LDTD 3VQIA 4AOFA 2LVOA 2JY6A 2JUOA 1SIFA 5JH5C 4IC7B 4IUMB 4K7WA 1H8CA 4DHZB 1P0RA 1NBFC 4KZ0A 1J19A 1WY8A 2CKHB 2DZJA 3CSTA 4WQOB 2DZKA 3PZDA 4BBNC 4II2B 2L8JA 4WJOA 3R7QA 4ZYNA 1C3TA 2ZCBA 3VTVA 4J6IA 1NDDA 1Z2MA 4RM9A 1V5OA 3QARA 4GB9A 3ZKJC 3ZUNA 3C0RB 2ASQA 3VAWA 2MBOA 3A1QB 5J18A 4NY0A 2MRPA 4KIKB 2N9XA 2I1JA 1GC7A 1WE7A 3TL5A 2BPSA 5D7GA 3RYTA 1G6JA 2D10A 4HDOA 3RD2A 3ALBA 2FCMA 2JRIB 4FJZA 4FJYA 3ZIMA 2MQJA 2DENB 2N9PC 4XX5A 3AXCA 4HPMB 2CS4A 1R4MI 4MGZE 4ZRIA 4EZLA 3IFWB 3AU4A 4E3CA 3ZRCA 3UQBA 3AU5A 4JIOU 1V80A 3B08A 3ZNZB 1Q1OA 4TKNA 1OGWA 1Y8RC 3B1LX 5E6PA 1V86A 5AEKB 4ANXA 4PS8A 5C1ZA 1V81A 2GMIC 4GGQA 2MBHA 3VTWA 3APFA 2DZMA 1P1AA 1E5WA 4BKSA 2D11A 4WJQA 2V3SA 2XEWA 2JF5A 3HHMA 3KW5B 3R66C 4NNJB 4EFOA 2NPTA 2KQ7A 3AI5A 4MEMA 2LGXA 2MW5A 1M94A 4BKTA 1E7VA 3RULA 4AUQC 4MELA 3VXWA 2B3AA 4K81A 3OAWA 2NCNA 4WAAA 1IPGA 4M8MA 4DBGA 2L0TA 4IG7B 4BVUC 4KDIC 3A9JA 1WE6A 4IWPA 2MA9B 5C23A 3EECA 2GBMA 1TGZB 4NQLB 2L3ZA 2CHZA 2BYFA 2JVCA 4KSLC 4E71A 2DYMA 1RAXA 2KFKB 4DHZE 2EMSA 1E7UA 1WXSA 2IO0B 1UZXB 2DAJA 2ZPNA 3HK0A 4EKUA 1A5RA 1C1YB 2KDEB 1V9JA 3EHVA 4ANUA 4BFRA 2J0MA 5J2RA 4EEWA 4ANWA 1VCBA 4IM0A 3A9KB 4M8NA 4ICUA 4KVGB 1H4RA 3QAQA 1V5TA 1RLFA 1OEYJ 1PQSA 3ML9A 3PRZA 4ZRJA 4DK5A 4EUTA 3PRMB 3KUDB 1WR1A 2Z59B 5KHQA 3H9DA 2MLBA 2N1VA 5GMVA 2HD5B 2BKFA 1GUAB 2NPTB 2A4ZA 2M1MA 4HCPB 1WX8A 3APCA 2GBRA 1V2YA 1WJ6A 1ZW7A 2K6QA 3I3TB 5TR5A 2HE7A 3TIXA 3VUWA 5J17A 3W1YA 2PE9A 2BWFA 3V62A 1EO6A 2KMAA 4HWIB 3DVGX 3V60A 5G55A 2AEHA 2KVRA 2C7HA 3RUIB 2MCNB 1WJ4A 5CHFA 4IWOA 4W9IA 4F7ZA 1K8RB 4MH0E 4BOSC 4FBJB 3ZDMC 5LXHA 4ZRKA 2C9WB 2ZJDA 2ZZPB 1E8WA 1Q0WB 1UH6A 3GZNI 5D94A 4AP4C 3DCGA 5JZEB 2V1YA 3IG3A 1S3SG 2FNJB 4G0NB 3VH3B 3NOBA 3VDZA 1WF9A 4MJSA 4A3PA 1GC6A 2OJRA 3UF8A 1WGRA 2GBJA 3NS8A 2KX3A 4JL9A 4I6NB 4TUUA 3UIOB 3DQVA 4G50A 3WA0A 2KK8A 4N9F4 2NBUA 4F1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YLM A;  5CTR C;  4WWN A;  2N4F A;  2AL6 A;  2JWZ A;  4XZ4 A;  2KMC A;  3ZTC A;  4DWF A;  3MHS D;  4MM3 A;  1WXA A;  3AUL A;  4NPN A;  2KC2 A;  2LGD A;  3WAL A;  4B6W A;  4DXA B;  1KOT A;  4OVV A;  4WJN A;  2K1F A;  2IBI B;  3VUY A;  4HVB A;  2AWT A;  2KX0 A;  2LRW A;  3L10 B;  2KZR A;  4MGY E;  1WGH A;  2KO3 A;  3DVN U;  4WWP A;  1QZE A;  2LVP A;  4W9J A;  4NAW A;  1RFA A;  1P9D U;  2M4N A;  2GOW A;  3R7R A;  4KZC A;  3PTF C;  4GMV A;  3WAM A;  4X57 B;  1S1Q B;  2XK5 A;  2O2V B;  1WXV A;  3KH0 A;  3OLM D;  3QCA A;  2O6V A;  3U30 A;  2PEA A;  4K7U A;  4DDI D;  3WAP A;  1EUV B;  3RT3 B;  1P3Q U;  3WAN A;  3TBL D;  3H7S A;  2DHZ A;  3HIZ A;  2CHW A;  4W9D A;  2ZVN A;  3KVF B;  4IM2 A;  4TQ0 A;  1WZ0 A;  3A33 B;  5DPT A;  1GG3 A;  4MJS B;  2D07 B;  4K7S A;  2K8C A;  1J0G A;  4BOZ B;  4G3X B;  3PHX B;  2ZVO A;  3LJ3 A;  3ZNI D;  2L7R A;  2M8S A;  3JW0 X;  3L0W B;  4B95 A;  4ZDV A;  3X0W A;  2JT4 B;  4IM3 A;  2FCN A;  3OJ4 B;  2OOB B;  3A4R A;  3UIP B;  3X23 A;  1Z5S B;  4EZJ A;  2PPH A;  4HDQ A;  3DPD A;  3MJW A;  3UQA A;  5G2N A;  4B9K A;  4URK A;  1LQB A;  4CYE A;  2LRU A;  1Q5W B;  1YX6 B;  2WX1 A;  2IO3 B;  2VRR B;  3PGE A;  3QJZ A;  2KWV B;  2D2Q A;  2KTR A;  4M0W B;  3ONS A;  4NAW B;  1IYF A;  1WFY A;  2KJH B;  4PS3 A;  3NY5 A;  2I1K A;  4DHJ B;  4PS7 A;  3QQ8 B;  2K8B A;  3APD A;  1YQB A;  1HE8 A;  4FN2 A;  4W9E A;  1VD2 A;  2O6V B;  4KV2 A;  5CHV C;  1WJN A;  2DYO A;  2FCS A;  1I42 A;  3ZRF A;  5IAA C;  4MSQ B;  3TCA A;  3UGB B;  2DYB A;  4WJP A;  3L54 A;  2KQS A;  3K9P B;  2CHX A;  1OEY A;  1WI0 A;  1YD8 U;  2BYE A;  5CHW A;  1RRB A;  2KLG A;  2L0F A;  2IY0 B;  2MP2 A;  3KYC D;  2N1W A;  3ML8 A;  5E6N A;  1R4N I;  3MTN B;  3SD5 A;  2J0K A;  2WDT B;  1GJZ A;  1ZKH A;  3HM6 X;  4LJP B;  1LFD A;  4PYU A;  5AZF A;  2KHW B;  4NJ7 A;  1WXM A;  2Z0D B;  3N30 A;  3BIN A;  3PV1 A;  3KUC B;  3M63 B;  3T8M A;  2ZEQ A;  2IO2 B;  3L13 A;  3VTU A;  3Q3F A;  2EMT A;  2LXC A;  1J8C A;  2R2Q A;  4GIV A;  2W9N A;  2KXJ A;  2MBE A;  2REX A;  1UGM A;  2M17 A;  4MDK E;  2KTR B;  2BYV E;  2BKR B;  5DPR A;  3PVL A;  4AWJ A;  5DCN A;  2GBN A;  3ZVV A;  2D3G A;  4OVU A;  3A9J B;  5D2M B;  1E90 A;  3ZO5 B;  3CF6 E;  1E8Y A;  2L76 A;  2G45 B;  4PYZ A;  1F9J A;  1LM8 B;  3H6N A;  2N7E A;  1T0Y A;  2JXX A;  2K6D B;  1KM7 A;  4FAD A;  5JHB A;  3DDC B;  4JLC A;  3PHW B;  2KD0 A;  2WWZ A;  4DDG D;  4LDT B;  1WGD A;  2LWP A;  2LVQ A;  2FID A;  3CSF A;  2Y5B B;  3VHT C;  3PSE B;  2EKE C;  1OTR B;  1WR6 E;  4FLH A;  1E8X A;  4BKG A;  2NVU I;  3Q3J A;  1EF5 A;  2MP2 B;  2LXA A;  3IHP C;  3NHE B;  5KHO A;  3WIM A;  3JVZ X;  2KJ6 A;  4F8C B;  2L00 B;  2PJH A;  3ZLZ A;  3LDZ E;  1TZ1 A;  1WH3 A;  2MSE D;  2JZZ A;  2YVC A;  2ZNV C;  4II3 B;  3VH4 B;  2ZCC A;  3W1S C;  2A5U A;  1ZGU B;  4GN1 A;  1V6E A;  2J7Q B;  3DVN V;  4E74 A;  3SDL C;  3IBE A;  1YIW A;  2NS5 A;  4GSW A;  2UYZ B;  2NBW B;  5CX3 A;  1WX7 A;  1WGG A;  1OQY A;  1P98 A;  3ENE A;  3O65 B;  4GU2 A;  3PRP B;  4HLE A;  1WYW B;  3K9O B;  4W9K A;  1D3Z A;  2UWQ A;  3QK0 A;  2C5L C;  2BWE S;  2NR2 A;  3ZDT A;  4IWQ A;  2XBB C;  4XC2 A;  2LD9 A;  4GDL A;  4HXD A;  2MBB B;  3QA8 A;  5D6J B;  2G4D B;  4MSM B;  1NI2 A;  2AYO B;  4HPL B;  2HJ8 A;  3A4S C;  4JQW C;  2LUE A;  3JSV A;  1UBQ A;  3L17 A;  4AJY B;  3B0A A;  3DVG Y;  3PS6 A;  4W9F A;  3RZF A;  3PLV A;  1UD7 A;  2C7M B;  4W9C A;  1UBI A;  4I6P A;  2DAF A;  1U4A A;  1X1M A;  4KSK C;  4K1R B;  4EZK A;  5L83 A;  4JGH B;  3IVF A;  3TMP B;  4G11 A;  3KUZ A;  2K25 A;  3P2B A;  1YJ1 A;  2Z0E B;  1SGH A;  3RZW C;  3ECI A;  1MG8 A;  1KJT A;  4IW0 A;  4A20 A;  4BBN F;  4KDL B;  1FXT B;  5AZG A;  3QWZ B;  2C60 A;  4AJW A;  1JRU A;  4FHJ A;  5HKH A;  3T9L A;  4FJV B;  4I6L B;  1WJU A;  1CMX B;  2KOX A;  2N7D A;  2KFK A;  3DBL I;  3U7D A;  5JHA A;  2KJR A;  2LGY A;  3UIN B;  3RCZ A;  2RD0 A;  1GNU A;  4FHK A;  1SE9 A;  2K8H A;  4MGI E;  1XD3 B;  2FUH B;  2HTH A;  2KWU B;  1EF1 A;  3NZS A;  3A9K A;  2KKC A;  3VFK A;  2IYD B;  4HK2 A;  3HM3 A;  5IA7 A;  1WM2 A;  2LI5 A;  2V4L A;  1LXD A;  1WX9 A;  3DBR I;  2K39 A;  3N32 A;  4GDL B;  1WRD B;  2IY1 B;  4W9L A;  5AZH A;  1ISN A;  2NBV B;  2RSU A;  2WX0 A;  5BO4 B;  3DBH I;  4EOY A;  3L08 A;  4HCN B;  2XK5 B;  3VVW B;  2FIF A;  2WYQ A;  3BY4 B;  3DBS A;  3JSV B;  3M3J A;  4RM8 A;  5E6O A;  3SU8 X;  2KDI A;  2LJ5 A;  3EFU A;  4FA6 A;  2RPQ A;  1WM3 A;  3QIJ A;  3W1S A;  1KLV A;  3DOW A;  3CMM B;  3PPA A;  1TBE A;  4MGK E;  4HJK A;  2IZV B;  1IP9 A;  3KYD D;  3PRE A;  1TTN A;  3TJP A;  2G3Q B;  2G4S A;  2CR5 A;  4GDK A;  3EC8 A;  2IO1 B;  3U8Z A;  4A3O A;  3ZW3 A;  2GBK A;  3H7P A;  3S2A A;  4ICV A;  4LCD E;  5DPW A;  4W9G A;  4DHJ D;  2PE6 B;  4RMA A;  2J0J A;  2KTF A;  1WIA A;  2O6V D;  2DX5 B;  1I35 A;  2RGF A;  3ZNH B;  4CO7 A;  3N3K B;  3JYU A;  1WZ3 A;  1E8Z A;  1BT0 A;  1WMH A;  1L2N A;  4TV3 A;  2MX2 A;  3QX1 A;  1XT9 B;  4GXB A;  3R3M A;  4P7I A;  3V6E B;  2AL3 A;  2MWS B;  2QHO A;  3M62 B;  3ZTD A;  4YL8 A;  5DPS A;  2KWC A;  2RR9 A;  3QC8 B;  3SHQ A;  3ZNG C;  3OJ3 A;  3L16 A;  4GOC A;  5LLI A;  2FAZ A;  4W9H A;  1L7Y A;  4BKS D;  2BF8 B;  2KN5 A;  2ZNV B;  3PT2 B;  3VUX A;  4TQ1 A;  2M0X A;  4ASW C;  1XQQ A;  2ZPY A;  4NQK E;  3A1Q A;  3D32 A;  3WAO A;  2L05 A;  2N9E B;  2R2O A;  2KLC A;  2KDB A;  4KIK A;  2DZI A;  2JPH A;  2KDF B;  3V6C B;  2LZ6 A;  4GDK B;  5L95 C;  5EDS A;  1V49 A;  4CHK A;  1AAR A;  2FCQ A;  3PLU A;  2O2V A;  2CU1 A;  2JZ3 B;  3H7P B;  1YX5 B;  1UEL A;  3V61 A;  2MBQ A;  2C7N B;  2KAN A;  3H1U A;  4ANV A;  4FUL A;  2KNB A;  5LXI B;  3NZU A;  2KC1 A;  1WGY A;  2BGF A;  2JRH A;  3QHT A;  2KFJ A;  3GOE A;  4LJO B;  4WWO A;  3M95 A;  4NJ6 A;  2LAS A;  1WMH B;  5FR6 A;  4LDT D;  3VQI A;  4AOF A;  2LVO A;  2JY6 A;  2JUO A;  1SIF A;  5JH5 C;  4IC7 B;  4IUM B;  4K7W A;  1H8C A;  4DHZ B;  1P0R A;  1NBF C;  4KZ0 A;  1J19 A;  1WY8 A;  2CKH B;  2DZJ A;  3CST A;  4WQO B;  2DZK A;  3PZD A;  4BBN C;  4II2 B;  2L8J A;  4WJO A;  3R7Q A;  4ZYN A;  1C3T A;  2ZCB A;  3VTV A;  4J6I A;  1NDD A;  1Z2M A;  4RM9 A;  1V5O A;  3QAR A;  4GB9 A;  3ZKJ C;  3ZUN A;  3C0R B;  2ASQ A;  3VAW A;  2MBO A;  3A1Q B;  5J18 A;  4NY0 A;  2MRP A;  4KIK B;  2N9X A;  2I1J A;  1GC7 A;  1WE7 A;  3TL5 A;  2BPS A;  5D7G A;  3RYT A;  1G6J A;  2D10 A;  4HDO A;  3RD2 A;  3ALB A;  2FCM A;  2JRI B;  4FJZ A;  4FJY A;  3ZIM A;  2MQJ A;  2DEN B;  2N9P C;  4XX5 A;  3AXC A;  4HPM B;  2CS4 A;  1R4M I;  4MGZ E;  4ZRI A;  4EZL A;  3IFW B;  3AU4 A;  4E3C A;  3ZRC A;  3UQB A;  3AU5 A;  4JIO U;  1V80 A;  3B08 A;  3ZNZ B;  1Q1O A;  4TKN A;  1OGW A;  1Y8R C;  3B1L X;  5E6P A;  1V86 A;  5AEK B;  4ANX A;  4PS8 A;  5C1Z A;  1V81 A;  2GMI C;  4GGQ A;  2MBH A;  3VTW A;  3APF A;  2DZM A;  1P1A A;  1E5W A;  4BKS A;  2D11 A;  4WJQ A;  2V3S A;  2XEW A;  2JF5 A;  3HHM A;  3KW5 B;  3R66 C;  4NNJ B;  4EFO A;  2NPT A;  2KQ7 A;  3AI5 A;  4MEM A;  2LGX A;  2MW5 A;  1M94 A;  4BKT A;  1E7V A;  3RUL A;  4AUQ C;  4MEL A;  3VXW A;  2B3A A;  4K81 A;  3OAW A;  2NCN A;  4WAA A;  1IPG A;  4M8M A;  4DBG A;  2L0T A;  4IG7 B;  4BVU C;  4KDI C;  3A9J A;  1WE6 A;  4IWP A;  2MA9 B;  5C23 A;  3EEC A;  2GBM A;  1TGZ B;  4NQL B;  2L3Z A;  2CHZ A;  2BYF A;  2JVC A;  4KSL C;  4E71 A;  2DYM A;  1RAX A;  2KFK B;  4DHZ E;  2EMS A;  1E7U A;  1WXS A;  2IO0 B;  1UZX B;  2DAJ A;  2ZPN A;  3HK0 A;  4EKU A;  1A5R A;  1C1Y B;  2KDE B;  1V9J A;  3EHV A;  4ANU A;  4BFR A;  2J0M A;  5J2R A;  4EEW A;  4ANW A;  1VCB A;  4IM0 A;  3A9K B;  4M8N A;  4ICU A;  4KVG B;  1H4R A;  3QAQ A;  1V5T A;  1RLF A;  1OEY J;  1PQS A;  3ML9 A;  3PRZ A;  4ZRJ A;  4DK5 A;  4EUT A;  3PRM B;  3KUD B;  1WR1 A;  2Z59 B;  5KHQ A;  3H9D A;  2MLB A;  2N1V A;  5GMV A;  2HD5 B;  2BKF A;  1GUA B;  2NPT B;  2A4Z A;  2M1M A;  4HCP B;  1WX8 A;  3APC A;  2GBR A;  1V2Y A;  1WJ6 A;  1ZW7 A;  2K6Q A;  3I3T B;  5TR5 A;  2HE7 A;  3TIX A;  3VUW A;  5J17 A;  3W1Y A;  2PE9 A;  2BWF A;  3V62 A;  1EO6 A;  2KMA A;  4HWI B;  3DVG X;  3V60 A;  5G55 A;  2AEH A;  2KVR A;  2C7H A;  3RUI B;  2MCN B;  1WJ4 A;  5CHF A;  4IWO A;  4W9I A;  4F7Z A;  1K8R B;  4MH0 E;  4BOS C;  4FBJ B;  3ZDM C;  5LXH A;  4ZRK A;  2C9W B;  2ZJD A;  2ZZP B;  1E8W A;  1Q0W B;  1UH6 A;  3GZN I;  5D94 A;  4AP4 C;  3DCG A;  5JZE B;  2V1Y A;  3IG3 A;  1S3S G;  2FNJ B;  4G0N B;  3VH3 B;  3NOB A;  3VDZ A;  1WF9 A;  4MJS A;  4A3P A;  1GC6 A;  2OJR A;  3UF8 A;  1WGR A;  2GBJ A;  3NS8 A;  2KX3 A;  4JL9 A;  4I6N B;  4TUU A;  3UIO B;  3DQV A;  4G50 A;  3WA0 A;  2KK8 A;  4N9F 4;  2NBU A;  4F1S A; 
#chains in the Genus database with same CATH topology
 1I4G A;  5CTR C;  4C4V B;  4XZ4 A;  4MM3 A;  1WXA A;  4NPN A;  4B6W A;  4DXA B;  3BK1 A;  2YEP B;  2JXT A;  4WJN A;  1J7A A;  4HVB A;  4YSX B;  2LRW A;  3L10 B;  5BMH A;  1HEZ E;  1SXT A;  1RFA A;  3R7R A;  1S1Q B;  2XK5 A;  1PGX A;  4USA A;  1EUV B;  1P3Q U;  3TBL D;  3C19 A;  4IM2 A;  3A33 B;  1MHX A;  5G5H A;  3OWE B;  2ZVO A;  1SJE D;  2PW9 A;  2M8S A;  3RNG C;  3JW0 X;  3DHI C;  3X0W A;  2K3U A;  2IGG A;  1RYJ A;  2ZW0 A;  3MP9 A;  3BVZ A;  3IT6 B;  4MM3 B;  3MJW A;  4B9K A;  4URK A;  1F0Z A;  1B1Z A;  4HKQ A;  1Q5W B;  1YX6 B;  3PGE A;  1FMA D;  2D2Q A;  4PS3 A;  5G5G A;  4DHJ B;  2K8B A;  2JYT A;  1VD2 A;  1WJN A;  2FCS A;  1I42 A;  3ZRF A;  3TCA A;  3UGB B;  1MI0 A;  2M19 A;  3K9P B;  1E0Z A;  1FXA A;  2CHX A;  2J4X A;  2Y5P A;  5CHW A;  1XEE A;  3BYT B;  1R4N I;  2X8X X;  5MPO A;  2WDT B;  1ZKH A;  2KHW B;  2Z0D B;  3ZXV A;  2D5G A;  3ZQ4 A;  1NYR A;  3KUC B;  1J8C A;  3Q3F A;  4LNO A;  2IGD A;  4KKI A;  4XDC A;  1KFY B;  2REX A;  1UGM A;  4A9A A;  2BKR B;  3L4P A;  5DPR A;  4AWJ A;  5DCN A;  3A9J B;  5D2M B;  2HJ1 A;  1E90 A;  1L5P A;  1R7S A;  3MC9 A;  1D5X C;  1LM8 B;  2K6D B;  5JHB A;  1KM7 A;  3DDC B;  5BYS A;  3TEW A;  2LWP A;  2LVQ A;  3CSF A;  2LMC A;  3VHT C;  4KX6 B;  1FRR A;  1PFD A;  2NVU I;  1EF5 A;  3NHE B;  3WIM A;  1GAQ B;  1YQ3 B;  2I38 A;  3ZLZ A;  3LDZ E;  2ICI A;  1V97 A;  2ZNV C;  2YVC A;  3W1S C;  3VH4 B;  2L52 A;  3R8B A;  1ZGU B;  4E74 A;  3SDL C;  1C76 A;  2NS5 A;  3MFG A;  1OQY A;  1P98 A;  1D3Z A;  3KLS X;  4JWU C;  3C8Y A;  3SFE B;  4HPL B;  1D5Z C;  3JSV A;  3L17 A;  1YNT E;  3B0A A;  3PS6 A;  4W9F A;  3PLV A;  4W9C A;  1GOZ A;  5L83 A;  2Z0E B;  2INC C;  3ECI A;  1MG8 A;  1XLQ A;  2WXI A;  5AZG A;  3QWZ B;  5EE1 A;  2KJR A;  3UIN B;  1GNU A;  1SIJ A;  4MGI E;  5HI1 A;  2VH1 A;  3PZ8 A;  4BAX A;  1Q10 A;  3B2F A;  1XCT L;  2JX5 A;  4WWM A;  3HM3 A;  2V4L A;  1ZPS A;  5IP4 D;  3DWG C;  2WX0 A;  3P1M A;  2RSU A;  3DBH I;  3L08 A;  3I63 C;  3BY4 B;  3DBS A;  3JSV B;  3M3J A;  3FC4 A;  5E6O A;  3SU8 X;  1ET6 A;  2KVZ A;  3DOW A;  2KN4 A;  4MGK E;  4HJK A;  2IZV B;  1IP9 A;  3KYD D;  4RF0 A;  4JE3 B;  2WNM A;  3ZW3 A;  2IO1 B;  4A3O A;  4L1B A;  3H7P A;  4L2Y A;  2N7J A;  2KTF A;  1WIA A;  1SE4 A;  2QDF A;  3DHH C;  2GB1 A;  3QX1 A;  1JWA D;  1XT9 B;  5LLI A;  4W9H A;  1OQR A;  2KN5 A;  5H92 C;  3PT2 B;  4YTM B;  3D32 A;  1A70 A;  2L05 A;  4KIK A;  3RPF C;  5EDS A;  1V49 A;  2J53 A;  2FCQ A;  3PLU A;  2JZ3 B;  3H7P B;  3V61 A;  2WXJ A;  1L0X B;  4ANV A;  2KNB A;  2KC1 A;  1UGJ A;  2KFJ A;  2CJO A;  4ZRP A;  3ZGZ A;  3M95 A;  3VQI A;  4AOF A;  2WXF A;  2LVO A;  1SIF A;  4K7W A;  2L32 A;  1D6E C;  1J19 A;  1HTQ A;  4NZL B;  3PZD A;  4WJO A;  2WXK A;  3R7Q A;  1C3T A;  2ZCB A;  4J6I A;  1ZUD 2;  3R2I A;  1V5O A;  3ZKJ C;  2ASQ A;  2MBO A;  2WDR B;  5J18 A;  4NY0 A;  4KIK B;  3MC8 A;  3TL5 A;  2Q5W D;  3ALB A;  4P1B C;  2JRI B;  4PK1 A;  2MQJ A;  1V1P A;  1FNW A;  3IFW B;  3ZJU A;  3AU4 A;  3UQB A;  3AU5 A;  4JIO U;  4KGR A;  3B08 A;  3ZNZ B;  1OGW A;  1Y8R C;  5E6P A;  3VRB B;  1V86 A;  3E9S A;  5AEK B;  1V81 A;  2GMI C;  3AE4 B;  5BMI A;  2DZM A;  3HHM A;  2EKI A;  2M0A A;  2J52 A;  3ZJT A;  4LNF A;  3AI5 A;  2BB5 A;  1M94 A;  1J7C A;  3BK2 A;  1UWM A;  1F2R C;  2BS4 B;  1TJE A;  1QF6 A;  4A55 A;  1VLB A;  2L0T A;  1WE6 A;  2MA9 B;  5C23 A;  4E71 A;  4LNI A;  1RAX A;  4RNA A;  4DHZ E;  2ZPN A;  1V1P B;  1V9J A;  3KWV A;  2INN E;  2J0M A;  1H4R A;  2PTL A;  3MHZ A;  4DK5 A;  3PRM B;  1JQ4 A;  2WDV B;  5KHQ A;  1TS4 A;  2HD5 B;  4PT5 A;  2A4Z A;  1WX8 A;  3APC A;  1V2Y A;  1WJ6 A;  1FIQ A;  1YMH E;  1ZW7 A;  2K6Q A;  5HHD G;  2AX5 A;  3TEY A;  1QIL A;  1YJJ A;  2K22 A;  5J17 A;  3V62 A;  1B9R A;  5FR3 A;  2C7H A;  1HTO A;  3AE6 B;  4F7Z A;  3IT4 B;  4YTN B;  1JCK B;  2ZZP B;  3GZN I;  5D94 A;  1S3S G;  2FNJ B;  2PMV A;  3VH3 B;  3NOB A;  4A3P A;  1WF9 A;  4MJS A;  1GC6 A;  1VZ7 A;  1AYF A;  2WGS A;  3UIO B;  1TKE A;  3U52 E;  3WA0 A;  4HEA 1;  1C4A A;  1K50 A;  4WWN A;  2N4F A;  2G9H D;  2JWZ A;  3VRA B;  3TUO A;  3ZTC A;  4DWF A;  1FCC C;  4YWG G;  2KC2 A;  1KOT A;  4OVV A;  2IBI B;  3VUY A;  2KX0 A;  3AE9 B;  1KTK A;  1QZE A;  4NAW A;  2GOW A;  3DBH B;  4GMV A;  4X57 B;  2O2V B;  1ZP0 B;  2QCZ A;  3U4E G;  4RF1 A;  3RT3 B;  1J7B A;  2RDH A;  3ZYY X;  3H7S A;  1LGR A;  2DHZ A;  3HIZ A;  4XYC A;  1KLU D;  3RNA C;  3NVY A;  2ZVN A;  2W3S A;  1GG3 A;  4MJS B;  2FUG 1;  2D07 B;  4K7S A;  1T0Q C;  1J0G A;  3AEG B;  3L0W B;  1TKG A;  4B95 A;  2JT4 B;  3N1X C;  2PPH A;  3DPD A;  1JWU D;  2IO3 B;  2VRR B;  2KWV B;  3NG0 A;  2LGS A;  4NAW B;  2I1K A;  3APD A;  1HE8 A;  3N9Y C;  1TIF A;  5CHV C;  1FEH A;  2MJ3 A;  5IAA C;  4MSQ B;  1XXG A;  2QC8 A;  2KQS A;  3RNB C;  1OEY A;  1ZXI A;  2K0P A;  2IY0 B;  4OVZ A;  2W3R A;  5BYQ A;  2N1W A;  3ML8 A;  3BVG A;  3SD5 A;  1GJZ A;  5AZF A;  2WXM A;  1OFF A;  3BIN A;  4XDD A;  3M63 B;  3Q8F A;  2ZEQ A;  3EGR A;  2R2Q A;  4GIV A;  4MT5 A;  2MBE A;  2M17 A;  2GI9 A;  3PZ7 A;  4MDK E;  2BYV E;  1E7P B;  4OVU A;  3W2D A;  2NTS A;  3Q3N C;  3CF6 E;  1E8Y A;  3EFC A;  2L76 A;  3AB5 A;  2N7E A;  4JLC A;  3PHW B;  2KD0 A;  4LDT B;  2WXR A;  2FID A;  2Y5B B;  2IND C;  2EKE C;  1GB1 A;  1D5M C;  1JWS D;  1FM0 D;  1C79 A;  2PVO D;  3RNE C;  3Q3J A;  2LXA A;  3IHP C;  1IBX A;  2IJ0 A;  2MSE D;  3NVW A;  4H2A A;  4OHJ A;  4GN1 A;  2CU3 A;  1V6E A;  4K3B A;  3ENE A;  2R61 A;  3PRP B;  3K9O B;  2MHJ A;  3QK0 A;  2BWE S;  4IWQ A;  4XC2 A;  1IGC A;  4GDL A;  4HXD A;  2QSD A;  4J3O D;  1AWD A;  3EA6 A;  1NI2 A;  1IUE A;  2AYO B;  3A4S C;  1TY2 A;  1UBQ A;  3DVG Y;  1LO5 D;  2DAF A;  4K1R B;  4YSY B;  4G11 A;  4LTU A;  1SGH A;  4A20 A;  4KKJ A;  4BBN F;  2JU6 X;  2SAK A;  4KDL B;  3RI7 C;  2C60 A;  4AJW A;  1JRU A;  1IBX B;  2OHF A;  2QJL A;  2QEJ C;  2L83 A;  1CMX B;  2N7D A;  5JHA A;  3DBL I;  2IPK D;  2LGY A;  2RD0 A;  2G1E A;  4JX1 C;  2WXH A;  2K8H A;  2QIE B;  2HTH A;  2KWU B;  1EF1 A;  1DYQ A;  1DOI A;  1QOB A;  3VFK A;  2IYD B;  2LFI A;  4OZB A;  2WQY B;  1ACC A;  1DOY A;  2YEP F;  1TT5 B;  2K39 A;  3NRZ A;  4P16 A;  3N32 A;  4GDL B;  1XF5 L;  4W9L A;  4XWT A;  2VH2 A;  1MFW A;  4HCN B;  2XK5 B;  1TS2 A;  1ENF A;  3VVW B;  1RM6 C;  2K9X A;  4RM8 A;  3AEA B;  1C78 A;  3EFU A;  1WM3 A;  3W1S A;  1E10 A;  1ESF A;  2Y3A A;  3PPA A;  1NEN B;  3PRE A;  1TTN A;  3Q8A A;  4ZOH C;  4TMA B;  2G4S A;  4GDK A;  2BS2 B;  1JRP A;  3EC8 A;  3U8Z A;  1N6Z A;  1F2R I;  4OW0 A;  2GBK A;  1MJD A;  1L0V B;  1FO4 A;  4LCD E;  1CZP A;  3GB1 A;  5E6J A;  3GZN B;  1VDV A;  2O6V D;  1I35 A;  4EE2 A;  3N3K B;  1WZ3 A;  1F1H A;  3FIL A;  1BT0 A;  2DWQ A;  1L2N A;  1NI3 A;  5IN7 A;  3V6E B;  4YXD B;  2AL3 A;  2QHO A;  3SHQ A;  4ARI A;  3ZNG C;  4GOC A;  4WQM A;  5AUI A;  3BII D;  2ZNV B;  3Q8C A;  3VUX A;  4TQ1 A;  2ZPY A;  3A1Q A;  2N9E B;  2KLC A;  2JPH A;  4GDK B;  2JSV X;  1UEL A;  2C7N B;  3H1U A;  4FUL A;  1SBB B;  2ACZ B;  3NZU A;  1FFU A;  3GOE A;  4WWO A;  1GPX A;  2WHI A;  2J42 A;  3IAM 1;  4N59 A;  4IC7 B;  1H8C A;  4DHZ B;  4ITK A;  4KZ0 A;  2CKH B;  4WQO B;  2DZK A;  1SB3 C;  1ZE3 D;  4ZYN A;  3VTV A;  4IOI E;  5FKA C;  4ACF A;  2WU2 B;  3A1Q B;  2I1J A;  3IXS A;  3RYT A;  2FCM A;  4WAF A;  1HZ6 A;  4AS1 A;  3AXC A;  2CS4 A;  4NAM A;  1Q1O A;  4TKN A;  2KQ4 X;  3H8H A;  4ZHP A;  2BS3 B;  3VTW A;  1E5W A;  2D11 A;  4WJQ A;  2JF5 A;  4JPS A;  3SFD B;  1E7V A;  2AQ1 B;  4K81 A;  4GLS C;  4M8M A;  3ZJV A;  4KDI C;  4DXF A;  3EEC A;  3BWU D;  4NQL B;  4HRO A;  2CHZ A;  3FAH A;  2DYM A;  2EMS A;  1E7U A;  2IO0 B;  4EKU A;  4BFR A;  5J2R A;  1C4C A;  2LEK A;  4EEW A;  3P4S B;  4ICU A;  1V5T A;  1PQS A;  3PRZ A;  1YQ4 B;  2QIL A;  1WR1 A;  2Z59 B;  3H9D A;  2MLB A;  2N1V A;  1E9M A;  4HCP B;  3ABV B;  3TIX A;  1FNV A;  1YN3 A;  3GP7 A;  2KVR A;  3AEC B;  3E56 A;  1WJ4 A;  5CHF A;  3VR8 B;  4W9I A;  1K8R B;  4MH0 E;  4BOS C;  2BTE A;  3ZDM C;  5JZE B;  1Q0W B;  3IG3 A;  1TZO A;  1IGD A;  3U2S C;  4G0N B;  2OJR A;  3HRD D;  3P42 A;  2E6X A;  2N9L A;  2KX3 A;  4JL9 A;  1WR6 E;  3KH0 A;  1I4H A;  3TEX A;  3DBL B;  2GLS A;  2YLM A;  1K53 A;  1QKZ A;  2WS3 B;  2KMC A;  3AUL A;  2Z8L A;  2LGD A;  1L4D B;  4AQ7 A;  1JW9 D;  1V8C A;  1WSP A;  4A8X C;  3Q6B A;  4MGY E;  1WGH A;  3DVN U;  3NS1 A;  4WWP A;  2VZK D;  1DOX A;  3SEB A;  2M4N A;  5I4D A;  3PTF C;  2JWU A;  1EM7 A;  3QCA A;  4O1N A;  3U30 A;  2PEA A;  4DDI D;  4A6Q A;  1GB4 A;  3GS2 A;  4D2K A;  1KRH A;  3NUH B;  1SEB D;  4XGA B;  4TQ0 A;  3Q3O C;  2BYT A;  1C4P A;  1I7H A;  3AE8 B;  2K8C A;  4BOZ B;  4G3X B;  1ZOY B;  3LJ3 A;  3ZNI D;  3P4Q B;  2OED A;  3RFZ B;  4C56 C;  5IKC M;  3OJ4 B;  2OOB B;  3A4R A;  3X23 A;  3N1Y C;  1QOF A;  4HDQ A;  3NJT A;  1LQB A;  2WX1 A;  5GXG B;  2V4I B;  4C7Y A;  2BB6 A;  1IYF A;  1WFY A;  2KJH B;  3NY5 A;  4PS7 A;  2N9K A;  1SE3 A;  4W9E A;  1FXI A;  2DYB A;  4WJP A;  3L54 A;  3AE5 B;  1WI0 A;  1YD8 U;  3AE2 B;  1RRB A;  2KLG A;  2L0F A;  2JYE A;  2MP2 A;  3KYC D;  2J0K A;  3HM6 X;  4LJP B;  4PYU A;  4NJ7 A;  1WXM A;  2MJD A;  3N30 A;  4MH8 A;  4DXG A;  2OJW A;  3T8M A;  2IO2 B;  3L13 A;  4C80 A;  2W9N A;  5TSS A;  4ZYS A;  1YOV B;  1PGB A;  3ZVV A;  3GE8 C;  5JXV A;  3WCQ A;  1TKY A;  1MPE A;  3ETR A;  2G45 B;  4RFB A;  4PYZ A;  4FAD A;  4BZA A;  1SF0 A;  2WWZ A;  3EUB 2;  4HJG E;  1ZXH A;  3PSE B;  4FLH A;  4BKG A;  2XN9 C;  1MG4 A;  1VZ8 A;  2MP2 B;  3JVZ X;  2KJ6 A;  2ONQ A;  4F8C B;  2L00 B;  2PJH A;  2H89 B;  2INP E;  3NVZ A;  2A5U A;  2NTT A;  4M02 A;  2J7Q B;  3DVN V;  3IAS 1;  3IBE A;  1FRD A;  3W9C B;  2UYZ B;  2NBW B;  5CX3 A;  1E6E B;  1WGG A;  4M00 A;  4W9K A;  3RNF C;  2UWQ A;  5BMG A;  2C5L C;  2NR2 A;  2XBB C;  5T8I A;  2MBB B;  3QA8 A;  2G4D B;  2HJ8 A;  2LUE A;  3KQ4 A;  4AJY B;  3N20 C;  3BZD B;  3RZF A;  2C7M B;  1UBI A;  4I6P A;  4KSK C;  3IVF A;  4OZC A;  5EE0 A;  3P2B A;  1YJ1 A;  1SSN A;  4RGO S;  1EWY C;  4IW0 A;  1KJT A;  2WLB A;  5BYR A;  4FHJ A;  2K5P A;  4HRS A;  3T9L A;  4FJV B;  1UF0 A;  4I6L B;  2M56 B;  2KOX A;  1EU4 A;  1AN8 A;  2KFK A;  3U7D A;  3RCZ A;  3AED B;  1P7F A;  4YTP B;  1D4B A;  3CWI A;  3O13 A;  2FUH B;  3NZS A;  3A9K A;  4HK2 A;  1WM2 A;  4NJC A;  2PVG C;  1LXD A;  1WX9 A;  3DBR I;  4QAY A;  1JML A;  2IY1 B;  1ISN A;  1VR9 A;  2NBV B;  5HG2 A;  1YJI A;  2KDI A;  1OQQ A;  2LJ5 A;  3P63 A;  3CMM B;  5IO9 A;  3AN1 A;  1TBE A;  3N1Z C;  3TJP A;  2G3Q B;  4R3D A;  4LLG M;  1QOG A;  4DHJ D;  4HPP A;  4RMA A;  2J0J A;  1N60 A;  2DX5 B;  4CO7 A;  1CQV A;  1E8Z A;  4N6E B;  4TV3 A;  1L6V A;  4YL8 A;  5DPS A;  3HVZ A;  2KWC A;  2RR9 A;  3AEB B;  1WXQ A;  5IOI A;  3BYY B;  1ROE A;  2RDG A;  4BKS D;  1XLO A;  3DHG C;  1JWB D;  1QT9 A;  1KH0 A;  2M0X A;  2V3P A;  4NQK E;  2R2O A;  2IGH A;  2KDB A;  4ARC A;  1WYG A;  2LZ6 A;  1XLP A;  5L95 C;  1AAR A;  3AMZ A;  2CU1 A;  3P4R B;  1TS5 A;  2MBQ A;  2WXN A;  1N5W A;  1UUP A;  2JRH A;  3QHT A;  3V05 A;  3PO0 A;  1VRA B;  3AE7 B;  4LJO B;  4NJ6 A;  2LAS A;  3BVM A;  5FR6 A;  2JY6 A;  2JUO A;  4IUM B;  2KAJ A;  1PUT A;  1P0R A;  5EE3 A;  1WY8 A;  2DZJ A;  4BBN C;  3CST A;  3I5J C;  2BW2 A;  2L8J A;  1V1O A;  3AV8 A;  4N58 A;  4US8 A;  2V9H A;  2WP9 B;  1NDD A;  1Z2M A;  3QAR A;  3B2G A;  3C0R B;  5C3J B;  1XLN A;  2MRP A;  1WE7 A;  2BPS A;  3Q69 A;  2D10 A;  3I9V 1;  4HDO A;  4KGS A;  3RD2 A;  4FJZ A;  3ZIM A;  3HVD A;  2N9P C;  1WGK A;  2WXG A;  3KWL A;  1BUI C;  3LB8 C;  1R4M I;  4MGZ E;  4EZL A;  4E3C A;  3ZRC A;  2B76 B;  2NMQ A;  4YT0 B;  1K52 A;  1TS3 A;  4ANX A;  4PS8 A;  5C1Z A;  3APF A;  1L6U A;  2AQ2 B;  4BKS A;  1N5X A;  2D3B A;  2XEW A;  3KW5 B;  3R66 C;  2GRI A;  2NPT A;  2JQR B;  2LGX A;  1RWS A;  3RUL A;  3VXW A;  5EE9 A;  3OAW A;  2NCN A;  4WAA A;  1IPG A;  1T6B X;  4DBG A;  4IG7 B;  1HZ5 A;  3A9J A;  2L3Z A;  3B9J A;  3OG5 A;  2D3C A;  2DAJ A;  1STE A;  3HK0 A;  1A5R A;  1C1Y B;  1C9F A;  2PKO A;  1UNS A;  1JWM D;  4S17 A;  2UU7 A;  4ZRJ A;  2KYW A;  3GE3 C;  4YSZ B;  5GMV A;  2BKF A;  1GUA B;  2NPT B;  4FXC A;  5TR5 A;  4A90 A;  3ZXR A;  1JAL A;  3Q3M C;  1MHH E;  3VUW A;  2PE9 A;  1EO6 A;  4HWI B;  3DVG X;  3V60 A;  5G55 A;  2RMM A;  4IWO A;  4M01 A;  2W55 A;  4FBJ B;  5HFY A;  2C9W B;  2ZJD A;  5D3D A;  1UH6 A;  4AP4 C;  1Y56 A;  3DCG A;  1HA5 A;  4JWS C;  3VDZ A;  3FIL B;  1WGR A;  4I6N B;  4TUU A;  2NBU A;  1I4P A;  1RFK A;  1EWC A;  3Q8B A;  2AL6 A;  3MHS D;  2AQ3 B;  3WAL A;  1ET9 A;  1VJK A;  3FKY A;  2K1F A;  4Q2J A;  2AWT A;  2HDE A;  2KZR A;  3DBR B;  1T0R C;  2KO3 A;  4M0W A;  2LVP A;  4W9J A;  1P9D U;  3NVV A;  4KZC A;  2ON8 A;  3WAM A;  2HTM E;  3OLM D;  1WXV A;  2O6V A;  1K51 A;  1UWX A;  3AEE B;  4C00 A;  4K7U A;  3WAP A;  4OZA A;  4B0M A;  2MH7 A;  2ZW1 A;  3WAN A;  2CHW A;  1QQR A;  4W9D A;  3KVF B;  1JRO A;  1WZ0 A;  1F52 A;  1EU3 A;  5DPT A;  1FCL A;  3PHX B;  5LNK 1;  2L7R A;  4ZDV A;  4IM3 A;  2FCN A;  3UIP B;  1Z5S B;  4EZJ A;  3T3N A;  3I57 A;  1ZDV A;  3UQA A;  5G2N A;  4RGN A;  4CYE A;  2LRU A;  3UI3 A;  3HUI A;  1KF6 B;  3QJZ A;  2KTR A;  3P4P B;  1FPY A;  4M0W B;  3ONS A;  1HXY D;  2LJI A;  1T5X D;  1PYW D;  3QQ8 B;  1YQB A;  4FN2 A;  2O6V B;  4KV2 A;  2DYO A;  3CIR B;  3R2T A;  1XO3 A;  1ZDX A;  3VR9 B;  1QOA A;  2BYE A;  3Q2A C;  1FD6 A;  2LUM A;  5E6N A;  3MTN B;  3AE3 B;  2IDY A;  1LFD A;  4XWW A;  3PV1 A;  2WXL A;  3VTU A;  2EMT A;  2LXC A;  2PIA A;  2KXJ A;  2KTR B;  3PVL A;  2E3T A;  2GBN A;  2D3G A;  1P7E A;  1FNU A;  3ZO5 B;  2TSS A;  4CQN A;  1F9J A;  3H6N A;  1T0Y A;  2JXX A;  4S0R A;  1CK1 A;  1CJE A;  4DDG D;  1XCQ L;  2V3N A;  1WGD A;  3Q8E A;  4P1C C;  1OTR B;  2DLB A;  1L0Y B;  1E8X A;  1M4V A;  5KHO A;  3U7Z A;  2N0S B;  2CJN A;  1TZ1 A;  1WH3 A;  4II3 B;  2JZZ A;  2ZCC A;  1YIW A;  4GSW A;  1R4M B;  1WX7 A;  3O65 B;  2KAC A;  4GU2 A;  4HLE A;  1T3Q A;  4MAC A;  1WYW B;  4WIP A;  3ZDT A;  2LD9 A;  2MEK A;  5D6J B;  1TYG B;  2H88 B;  4MSM B;  4JQW C;  4KGT A;  1UD7 A;  2WDQ B;  1U4A A;  1X1M A;  4EZK A;  4JGH B;  4TSS A;  3TMP B;  2L1A A;  3KUZ A;  2K25 A;  3RZW C;  2PLP A;  3AEF B;  2BBC A;  1FXT B;  5HKH A;  2BT6 A;  1WJU A;  1VZ6 A;  1SJH D;  1YN5 A;  3MC0 B;  4FHK A;  1N63 A;  1SE9 A;  3W5V B;  3SR6 A;  1XD3 B;  2KKC A;  2KWD A;  3J9C A;  5IA7 A;  2LI5 A;  2RDB C;  1WRD B;  3MJ5 A;  1BXT A;  5AZH A;  5BO4 B;  1R4N B;  4EOY A;  3DWM A;  3AE1 B;  2FIF A;  2WYQ A;  5FK9 C;  2DBY A;  4FA6 A;  2RPQ A;  3QIJ A;  1KLV A;  1BML C;  1HQR D;  2CR5 A;  3URY A;  1NEK B;  3S2A A;  2LHD A;  4ICV A;  5DPW A;  4W9G A;  2PE6 B;  3V3X A;  2RGF A;  3ZNH B;  3JYU A;  1WMH A;  3LXF A;  2MX2 A;  4GXB A;  3R3M A;  4P7I A;  2MWS B;  3M62 B;  3ZTD A;  3QC8 B;  3OJ3 A;  3L16 A;  2FAZ A;  1L7Y A;  2BF8 B;  5H8Y E;  4US9 A;  2BQQ A;  4ASW C;  1F77 A;  2SEB D;  1XQQ A;  3WAO A;  1I4X A;  3V6C B;  2DZI A;  2KDF B;  1MVK A;  2FE8 A;  3W5U B;  4LK0 M;  4CHK A;  4K3C A;  2O2V A;  1DGJ A;  1YX5 B;  4IDI A;  2KAN A;  5LXI B;  2VZK B;  1WGY A;  2BGF A;  4WUR A;  2LHE A;  3NZ3 A;  5C2T B;  1WMH B;  4LDT D;  4RCO A;  5JH5 C;  1N61 A;  2WU5 B;  1NBF C;  1C77 A;  2V0G A;  3AM9 A;  4WH4 A;  4II2 B;  2FBW B;  4RM9 A;  4GB9 A;  3ZUN A;  3VAW A;  3TEZ A;  1YN4 A;  2N9X A;  2JZP A;  1GC7 A;  1G6J A;  2WXQ A;  5D7G A;  4DQO C;  1N62 A;  4FJY A;  2RPV A;  1KLG D;  2DEN B;  4XX5 A;  4HPM B;  4HKZ E;  1PDX A;  4ZRI A;  1L4Z B;  2EEL A;  1QLB B;  1V80 A;  3B1L X;  2QMT A;  4C7Z A;  1WWT A;  3LYY A;  5D3I B;  4GGQ A;  2MBH A;  2KDM A;  1P1A A;  2V3S A;  1NYQ A;  2X38 A;  2W82 A;  4NNJ B;  4EFO A;  2KQ7 A;  4MEM A;  2MW5 A;  4BKT A;  1TY0 A;  4AUQ C;  4MEL A;  2B3A A;  1I4R A;  2BVC A;  4BVU C;  4IWP A;  1WRI A;  4REZ A;  4RGT A;  3RN9 C;  2GBM A;  1TGZ B;  4IKG A;  2BYF A;  2JVC A;  4KSL C;  2KMM A;  1AW7 A;  1T0S C;  2KFK B;  1WXS A;  1UZX B;  2KDE B;  3EHV A;  4ANU A;  4P6V F;  4ANW A;  1VCB A;  4IM0 A;  3A9K B;  4M8N A;  4KVG B;  3QAQ A;  1RLF A;  4LNN A;  1OEY J;  3ML9 A;  4EUT A;  2XNA C;  1FFV A;  4ZRQ A;  3KUD B;  2WXO A;  5AUK A;  1SE2 A;  4RH6 A;  4RGM A;  2M1M A;  4ZHO A;  4C4V A;  2GBR A;  2D3A A;  3I3T B;  4LNK A;  2HE7 A;  3TSS A;  2Y5C A;  3W1Y A;  2BWF A;  3RMK C;  2KMA A;  2KT7 A;  4XE0 A;  2AEH A;  3AH7 A;  2W54 A;  3RUI B;  3RNC C;  4B0E A;  2MCN B;  1PGA A;  2MJE A;  2DNF A;  2I2Y A;  4UDU C;  5LXH A;  4ZRK A;  1E8W A;  2WXP A;  2V1Y A;  3Q14 C;  1NVI D;  3UF8 A;  4L23 A;  2LGI A;  3T3O A;  2GBJ A;  3NS8 A;  3DQV A;  4G50 A;  2KK8 A;  4N9F 4;  1I4Q A;  4F1S A; 
#chains in the Genus database with same CATH homology
 2YLM A;  5CTR C;  4WWN A;  2N4F A;  2AL6 A;  2JWZ A;  4XZ4 A;  2KMC A;  3ZTC A;  4DWF A;  3MHS D;  4MM3 A;  1WXA A;  3AUL A;  4NPN A;  2KC2 A;  2LGD A;  3WAL A;  4B6W A;  4DXA B;  1KOT A;  4OVV A;  4WJN A;  2K1F A;  2IBI B;  3VUY A;  4HVB A;  2AWT A;  2KX0 A;  2LRW A;  3L10 B;  2KZR A;  4MGY E;  1WGH A;  2KO3 A;  3DVN U;  4WWP A;  1QZE A;  2LVP A;  4W9J A;  4NAW A;  1RFA A;  1P9D U;  2M4N A;  2GOW A;  3R7R A;  4KZC A;  3PTF C;  4GMV A;  3WAM A;  4X57 B;  1S1Q B;  2XK5 A;  2O2V B;  1WXV A;  3KH0 A;  3OLM D;  3QCA A;  2O6V A;  3U30 A;  2PEA A;  4K7U A;  4DDI D;  3WAP A;  1EUV B;  3RT3 B;  1P3Q U;  3WAN A;  3TBL D;  3H7S A;  2DHZ A;  3HIZ A;  2CHW A;  4W9D A;  2ZVN A;  3KVF B;  4IM2 A;  4TQ0 A;  1WZ0 A;  3A33 B;  5DPT A;  1GG3 A;  4MJS B;  2D07 B;  4K7S A;  2K8C A;  1J0G A;  4BOZ B;  4G3X B;  3PHX B;  2ZVO A;  3LJ3 A;  3ZNI D;  2L7R A;  2M8S A;  3JW0 X;  3L0W B;  4B95 A;  4ZDV A;  3X0W A;  2JT4 B;  4IM3 A;  2FCN A;  3OJ4 B;  2OOB B;  3A4R A;  3UIP B;  3X23 A;  1Z5S B;  4EZJ A;  2PPH A;  4HDQ A;  3DPD A;  3MJW A;  3UQA A;  5G2N A;  4B9K A;  4URK A;  1LQB A;  4CYE A;  2LRU A;  1Q5W B;  1YX6 B;  2WX1 A;  2IO3 B;  2VRR B;  3PGE A;  3QJZ A;  2KWV B;  2D2Q A;  2KTR A;  4M0W B;  3ONS A;  4NAW B;  1IYF A;  1WFY A;  2KJH B;  4PS3 A;  3NY5 A;  2I1K A;  4DHJ B;  4PS7 A;  3QQ8 B;  2K8B A;  3APD A;  1YQB A;  1HE8 A;  4FN2 A;  4W9E A;  1VD2 A;  2O6V B;  4KV2 A;  5CHV C;  1WJN A;  2DYO A;  2FCS A;  1I42 A;  3ZRF A;  5IAA C;  4MSQ B;  3TCA A;  3UGB B;  2DYB A;  4WJP A;  3L54 A;  2KQS A;  3K9P B;  2CHX A;  1OEY A;  1WI0 A;  1YD8 U;  2BYE A;  5CHW A;  1RRB A;  2KLG A;  2L0F A;  2IY0 B;  2MP2 A;  3KYC D;  2N1W A;  3ML8 A;  5E6N A;  1R4N I;  3MTN B;  3SD5 A;  2J0K A;  2WDT B;  1GJZ A;  1ZKH A;  3HM6 X;  4LJP B;  1LFD A;  4PYU A;  5AZF A;  2KHW B;  4NJ7 A;  1WXM A;  2Z0D B;  3N30 A;  3BIN A;  3PV1 A;  3KUC B;  3M63 B;  3T8M A;  2ZEQ A;  2IO2 B;  3L13 A;  3VTU A;  3Q3F A;  2EMT A;  2LXC A;  1J8C A;  2R2Q A;  4GIV A;  2W9N A;  2KXJ A;  2MBE A;  2REX A;  1UGM A;  2M17 A;  4MDK E;  2KTR B;  2BYV E;  2BKR B;  5DPR A;  3PVL A;  4AWJ A;  5DCN A;  2GBN A;  3ZVV A;  2D3G A;  4OVU A;  3A9J B;  5D2M B;  1E90 A;  3ZO5 B;  3CF6 E;  1E8Y A;  2L76 A;  2G45 B;  4PYZ A;  1F9J A;  1LM8 B;  3H6N A;  2N7E A;  1T0Y A;  2JXX A;  2K6D B;  1KM7 A;  4FAD A;  5JHB A;  3DDC B;  4JLC A;  3PHW B;  2KD0 A;  2WWZ A;  4DDG D;  4LDT B;  1WGD A;  2LWP A;  2LVQ A;  2FID A;  3CSF A;  2Y5B B;  3VHT C;  3PSE B;  2EKE C;  1OTR B;  1WR6 E;  4FLH A;  1E8X A;  4BKG A;  2NVU I;  3Q3J A;  1EF5 A;  2MP2 B;  2LXA A;  3IHP C;  3NHE B;  5KHO A;  3WIM A;  3JVZ X;  2KJ6 A;  4F8C B;  2L00 B;  2PJH A;  3ZLZ A;  3LDZ E;  1TZ1 A;  1WH3 A;  2MSE D;  2JZZ A;  2YVC A;  2ZNV C;  4II3 B;  3VH4 B;  2ZCC A;  3W1S C;  2A5U A;  1ZGU B;  4GN1 A;  1V6E A;  2J7Q B;  3DVN V;  4E74 A;  3SDL C;  3IBE A;  1YIW A;  2NS5 A;  4GSW A;  2UYZ B;  2NBW B;  5CX3 A;  1WX7 A;  1WGG A;  1OQY A;  1P98 A;  3ENE A;  3O65 B;  4GU2 A;  3PRP B;  4HLE A;  1WYW B;  3K9O B;  4W9K A;  1D3Z A;  2UWQ A;  3QK0 A;  2C5L C;  2BWE S;  2NR2 A;  3ZDT A;  4IWQ A;  2XBB C;  4XC2 A;  2LD9 A;  4GDL A;  4HXD A;  2MBB B;  3QA8 A;  5D6J B;  2G4D B;  4MSM B;  1NI2 A;  2AYO B;  4HPL B;  2HJ8 A;  3A4S C;  4JQW C;  2LUE A;  3JSV A;  1UBQ A;  3L17 A;  4AJY B;  3B0A A;  3DVG Y;  3PS6 A;  4W9F A;  3RZF A;  3PLV A;  1UD7 A;  2C7M B;  4W9C A;  1UBI A;  4I6P A;  2DAF A;  1U4A A;  1X1M A;  4KSK C;  4K1R B;  4EZK A;  5L83 A;  4JGH B;  3IVF A;  3TMP B;  4G11 A;  3KUZ A;  2K25 A;  3P2B A;  1YJ1 A;  2Z0E B;  1SGH A;  3RZW C;  3ECI A;  1MG8 A;  1KJT A;  4IW0 A;  4A20 A;  4BBN F;  4KDL B;  1FXT B;  5AZG A;  3QWZ B;  2C60 A;  4AJW A;  1JRU A;  4FHJ A;  5HKH A;  3T9L A;  4FJV B;  4I6L B;  1WJU A;  1CMX B;  2KOX A;  2N7D A;  2KFK A;  3DBL I;  3U7D A;  5JHA A;  2KJR A;  2LGY A;  3UIN B;  3RCZ A;  2RD0 A;  1GNU A;  4FHK A;  1SE9 A;  2K8H A;  4MGI E;  1XD3 B;  2FUH B;  2HTH A;  2KWU B;  1EF1 A;  3NZS A;  3A9K A;  2KKC A;  3VFK A;  2IYD B;  4HK2 A;  3HM3 A;  5IA7 A;  1WM2 A;  2LI5 A;  2V4L A;  1LXD A;  1WX9 A;  3DBR I;  2K39 A;  3N32 A;  4GDL B;  1WRD B;  2IY1 B;  4W9L A;  5AZH A;  1ISN A;  2NBV B;  2RSU A;  2WX0 A;  5BO4 B;  3DBH I;  4EOY A;  3L08 A;  4HCN B;  2XK5 B;  3VVW B;  2FIF A;  2WYQ A;  3BY4 B;  3DBS A;  3JSV B;  3M3J A;  4RM8 A;  5E6O A;  3SU8 X;  2KDI A;  2LJ5 A;  3EFU A;  4FA6 A;  2RPQ A;  1WM3 A;  3QIJ A;  3W1S A;  1KLV A;  3DOW A;  3CMM B;  3PPA A;  1TBE A;  4MGK E;  4HJK A;  2IZV B;  1IP9 A;  3KYD D;  3PRE A;  1TTN A;  3TJP A;  2G3Q B;  2G4S A;  2CR5 A;  4GDK A;  3EC8 A;  2IO1 B;  3U8Z A;  4A3O A;  3ZW3 A;  2GBK A;  3H7P A;  3S2A A;  4ICV A;  4LCD E;  5DPW A;  4W9G A;  4DHJ D;  2PE6 B;  4RMA A;  2J0J A;  2KTF A;  1WIA A;  2O6V D;  2DX5 B;  1I35 A;  2RGF A;  3ZNH B;  4CO7 A;  3N3K B;  3JYU A;  1WZ3 A;  1E8Z A;  1BT0 A;  1WMH A;  1L2N A;  4TV3 A;  2MX2 A;  3QX1 A;  1XT9 B;  4GXB A;  3R3M A;  4P7I A;  3V6E B;  2AL3 A;  2MWS B;  2QHO A;  3M62 B;  3ZTD A;  4YL8 A;  5DPS A;  2KWC A;  2RR9 A;  3QC8 B;  3SHQ A;  3ZNG C;  3OJ3 A;  3L16 A;  4GOC A;  5LLI A;  2FAZ A;  4W9H A;  1L7Y A;  4BKS D;  2BF8 B;  2KN5 A;  2ZNV B;  3PT2 B;  3VUX A;  4TQ1 A;  2M0X A;  4ASW C;  1XQQ A;  2ZPY A;  4NQK E;  3A1Q A;  3D32 A;  3WAO A;  2L05 A;  2N9E B;  2R2O A;  2KLC A;  2KDB A;  4KIK A;  2DZI A;  2JPH A;  2KDF B;  3V6C B;  2LZ6 A;  4GDK B;  5L95 C;  5EDS A;  1V49 A;  4CHK A;  1AAR A;  2FCQ A;  3PLU A;  2O2V A;  2CU1 A;  2JZ3 B;  3H7P B;  1YX5 B;  1UEL A;  3V61 A;  2MBQ A;  2C7N B;  2KAN A;  3H1U A;  4ANV A;  4FUL A;  2KNB A;  5LXI B;  3NZU A;  2KC1 A;  1WGY A;  2BGF A;  2JRH A;  3QHT A;  2KFJ A;  3GOE A;  4LJO B;  4WWO A;  3M95 A;  4NJ6 A;  2LAS A;  1WMH B;  5FR6 A;  4LDT D;  3VQI A;  4AOF A;  2LVO A;  2JY6 A;  2JUO A;  1SIF A;  5JH5 C;  4IC7 B;  4IUM B;  4K7W A;  1H8C A;  4DHZ B;  1P0R A;  1NBF C;  4KZ0 A;  1J19 A;  1WY8 A;  2CKH B;  2DZJ A;  3CST A;  4WQO B;  2DZK A;  3PZD A;  4BBN C;  4II2 B;  2L8J A;  4WJO A;  3R7Q A;  4ZYN A;  1C3T A;  2ZCB A;  3VTV A;  4J6I A;  1NDD A;  1Z2M A;  4RM9 A;  1V5O A;  3QAR A;  4GB9 A;  3ZKJ C;  3ZUN A;  3C0R B;  2ASQ A;  3VAW A;  2MBO A;  3A1Q B;  5J18 A;  4NY0 A;  2MRP A;  4KIK B;  2N9X A;  2I1J A;  1GC7 A;  1WE7 A;  3TL5 A;  2BPS A;  5D7G A;  3RYT A;  1G6J A;  2D10 A;  4HDO A;  3RD2 A;  3ALB A;  2FCM A;  2JRI B;  4FJZ A;  4FJY A;  3ZIM A;  2MQJ A;  2DEN B;  2N9P C;  4XX5 A;  3AXC A;  4HPM B;  2CS4 A;  1R4M I;  4MGZ E;  4ZRI A;  4EZL A;  3IFW B;  3AU4 A;  4E3C A;  3ZRC A;  3UQB A;  3AU5 A;  4JIO U;  1V80 A;  3B08 A;  3ZNZ B;  1Q1O A;  4TKN A;  1OGW A;  1Y8R C;  3B1L X;  5E6P A;  1V86 A;  5AEK B;  4ANX A;  4PS8 A;  5C1Z A;  1V81 A;  2GMI C;  4GGQ A;  2MBH A;  3VTW A;  3APF A;  2DZM A;  1P1A A;  1E5W A;  4BKS A;  2D11 A;  4WJQ A;  2V3S A;  2XEW A;  2JF5 A;  3HHM A;  3KW5 B;  3R66 C;  4NNJ B;  4EFO A;  2NPT A;  2KQ7 A;  3AI5 A;  4MEM A;  2LGX A;  2MW5 A;  1M94 A;  4BKT A;  1E7V A;  3RUL A;  4AUQ C;  4MEL A;  3VXW A;  2B3A A;  4K81 A;  3OAW A;  2NCN A;  4WAA A;  1IPG A;  4M8M A;  4DBG A;  2L0T A;  4IG7 B;  4BVU C;  4KDI C;  3A9J A;  1WE6 A;  4IWP A;  2MA9 B;  5C23 A;  3EEC A;  2GBM A;  1TGZ B;  4NQL B;  2L3Z A;  2CHZ A;  2BYF A;  2JVC A;  4KSL C;  4E71 A;  2DYM A;  1RAX A;  2KFK B;  4DHZ E;  2EMS A;  1E7U A;  1WXS A;  2IO0 B;  1UZX B;  2DAJ A;  2ZPN A;  3HK0 A;  4EKU A;  1A5R A;  1C1Y B;  2KDE B;  1V9J A;  3EHV A;  4ANU A;  4BFR A;  2J0M A;  5J2R A;  4EEW A;  4ANW A;  1VCB A;  4IM0 A;  3A9K B;  4M8N A;  4ICU A;  4KVG B;  1H4R A;  3QAQ A;  1V5T A;  1RLF A;  1OEY J;  1PQS A;  3ML9 A;  3PRZ A;  4ZRJ A;  4DK5 A;  4EUT A;  3PRM B;  3KUD B;  1WR1 A;  2Z59 B;  5KHQ A;  3H9D A;  2MLB A;  2N1V A;  5GMV A;  2HD5 B;  2BKF A;  1GUA B;  2NPT B;  2A4Z A;  2M1M A;  4HCP B;  1WX8 A;  3APC A;  2GBR A;  1V2Y A;  1WJ6 A;  1ZW7 A;  2K6Q A;  3I3T B;  5TR5 A;  2HE7 A;  3TIX A;  3VUW A;  5J17 A;  3W1Y A;  2PE9 A;  2BWF A;  3V62 A;  1EO6 A;  2KMA A;  4HWI B;  3DVG X;  3V60 A;  5G55 A;  2AEH A;  2KVR A;  2C7H A;  3RUI B;  2MCN B;  1WJ4 A;  5CHF A;  4IWO A;  4W9I A;  4F7Z A;  1K8R B;  4MH0 E;  4BOS C;  4FBJ B;  3ZDM C;  5LXH A;  4ZRK A;  2C9W B;  2ZJD A;  2ZZP B;  1E8W A;  1Q0W B;  1UH6 A;  3GZN I;  5D94 A;  4AP4 C;  3DCG A;  5JZE B;  2V1Y A;  3IG3 A;  1S3S G;  2FNJ B;  4G0N B;  3VH3 B;  3NOB A;  3VDZ A;  1WF9 A;  4MJS A;  4A3P A;  1GC6 A;  2OJR A;  3UF8 A;  1WGR A;  2GBJ A;  3NS8 A;  2KX3 A;  4JL9 A;  4I6N B;  4TUU A;  3UIO B;  3DQV A;  4G50 A;  3WA0 A;  2KK8 A;  4N9F 4;  2NBU A;  4F1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...