4KV2A

Ubiquitin-like domain of the mycobacterium tuberculosis type vii secretion system protein eccd1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
90
structure length
90
Chain Sequence
MATTRVTILTGRRMTDLVLPAAVPMETYIDDTVAVLSEVLEDTPADVLGGFDFTAQGVWAFARPGSPPLKLDQSLDDAGVVDGSLLTLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of EccB1 and EccD1 from the core complex of the mycobacterial ESX-1 type VII secretion system.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Protein transport
molecule keywords ESX-1 secretion system protein eccD1
total genus 16
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4kv2A00
4GDLB 3ZTCA 3ZNHB 2NCNA 4GDKB 4MSQB 1K8RB 1NBFC 4HVBA 4G3XB 4XX5A 5TR5A 2G4DB 1PQSA 5CHWA 1WGYA 1HE8A 4WJNA 4BKTA 2MX2A 1KLVA 2BKFA 3WALA 1UBQA 4G50A 3RD2A 2O2VB 5E6PA 3VQIA 1J19A 1NI2A 2CS4A 4KVGB 1F9JA 3PLUA 2BPSA 4NY0A 4MJSB 3RYTA 3VTVA 3ZIMA 4DK5A 1ISNA 4KV2A 1WMHA 3DQVA 3PSEB 3ZVVA 1SE9A 2FCMA 1WJ6A 3HK0A 3T9LA 2KVRA 1YX6B 2LI5A 2KTRB 3UQBA 3H1UA 4NQLB 4F1SA 2ZZPB 3QC8B 2XK5A 2LXAA 1J8CA 2O6VA 1BT0A 4BOSC 4CHKA 1S1QB 4ZRIA 4W9JA 3A9JB 4IWOA 3B08A 2KANA 5JZEB 2KJRA 2DYOA 1UGMA 1RAXA 1MG8A 2KKCA 1OEYA 1V49A 4TKNA 3U8ZA 1WRDB 2ZEQA 1Q1OA 5LLIA 2D11A 2M17A 3ZRCA 4HDOA 3KYCD 4F8CB 2K8BA 4BKSA 2BWFA 4BKSD 4I6PA 1OTRB 4KIKA 3PHWB 1RRBA 2N1WA 4ZYNA 3PVLA 1LM8B 1WH3A 3D32A 3EFUA 2C9WB 5BO4B 3ZLZA 2GMIC 1E8ZA 5E6NA 2BYFA 2V1YA 2KMAA 4GSWA 4PS8A 1EF5A 3KVFB 4ANWA 2ZVOA 1WF9A 2RPQA 4AWJA 3W1SA 4II2B 2KDIA 2L00B 4A20A 3ML8A 5AZGA 4IUMB 2KOXA 2YLMA 1H8CA 3QHTA 4DWFA 1UD7A 3SHQA 2MBQA 4PS7A 2UWQA 4E3CA 3X0WA 2DZJA 2N4FA 1WGHA 3PV1A 3NOBA 4KSLC 1GNUA 3ZKJC 3V60A 4RMAA 4CYEA 2L0TA 1I42A 3C0RB 3L0WB 3UF8A 1KJTA 2BKRB 3A9KA 3V61A 3VVWB 2HTHA 3QA8A 2J7QB 2C7MB 2MSED 3M63B 3R3MA 3RCZA 5L95C 1E8XA 2KLCA 2GBKA 3L16A 4FHKA 3TMPB 1VD2A 3TBLD 4AJWA 4K1RB 3QX1A 4OVUA 2MLBA 4DBGA 4BOZB 3KUZA 2PE6B 3B1LX 4J6IA 3QAQA 3TCAA 4LJOB 3IVFA 1WM3A 3A1QB 5IA7A 4ZRKA 3WAOA 1GC7A 4EEWA 2N9PC 4ZRJA 2KZRA 2JRIB 2V4LA 5AEKB 2M8SA 3JVZX 3EHVA 4WQOB 1YJ1A 3IHPC 2L7RA 2ZCCA 5FR6A 2GBNA 1P3QU 4FBJB 2JZZA 1V5OA 3A4SC 4GXBA 2JY6A 2LGXA 1TGZB 1OEYJ 3Q3FA 3V62A 2LVPA 2GBMA 4WAAA 1OGWA 3IFWB 1Z5SB 2DZIA 2G3QB 3APCA 5CHFA 4AUQC 2KJHB 3PLVA 5J18A 4DHJD 4IW0A 2RD0A 5KHQA 2GBJA 2ZNVC 2KNBA 3DBSA 2Z0EB 1YIWA 3SDLC 4KZCA 2KXJA 1TTNA 4AP4C 3WIMA 1R4NI 3A9JA 5D6JB 2WDTB 5EDSA 2KDFB 2ZCBA 3O65B 4HCPB 4WWNA 1V9JA 2AEHA 1P1AA 2AYOB 2WX1A 3QQ8B 4HPMB 2JZ3B 4IM2A 4TQ1A 3W1YA 2CHZA 2D10A 4EZKA 2Z59B 3OAWA 5CHVC 3ZTDA 2K6QA 2K6DB 4ICVA 1ZGUB 3N30A 3KYDD 2WX0A 2MA9B 2A4ZA 3RULA 3QJZA 4E74A 2I1JA 2NPTB 4DHZB 1H4RA 2J0JA 3WA0A 5J17A 4XC2A 2D3GA 2L8JA 4FHJA 3ZDTA 5IAAC 2DHZA 2K25A 4NNJB 2CKHB 2C7HA 1ZW7A 2DAFA 2KX0A 1RFAA 2R2QA 4GU2A 4NQKE 4PYUA 4ANUA 1D3ZA 4XZ4A 3QCAA 1WGRA 2GOWA 4FA6A 4AOFA 1M94A 2L0FA 3VH3B 4FULA 3K9PB 2IO2B 3H7SA 4II3B 4HCNB 2LD9A 2PEAA 3RZFA 2XEWA 1L2NA 2KFKA 3A4RA 2JPHA 1I35A 2LZ6A 2KDEB 1Z2MA 4GMVA 4BBNF 3UQAA 2K1FA 1TBEA 2ZPNA 4HXDA 4N9F4 2FCQA 3RT3B 1YX5B 4IM3A 2IO0B 3HM6X 2NVUI 3R66C 3UIOB 2D2QA 2BGFA 1YD8U 3VTWA 4BFRA 2MQJA 1E8WA 3RUIB 2B3AA 3VAWA 4I6LB 1P98A 3LDZE 3M62B 2AL6A 4GDKA 3UGBB 3AXCA 2BWES 3HHMA 2MP2B 2C7NB 3KUCB 1IP9A 3V6CB 4EZLA 4A3PA 2G45B 4HPLB 2PPHA 2M0XA 3DPDA 4MH0E 3DBRI 1WYWB 3QWZB 3T8MA 2KD0A 2VRRB 4JIOU 4HJKA 3AU4A 4M8NA 2HD5B 2KQSA 2LGDA 3OJ3A 1TZ1A 4KZ0A 5AZHA 3L13A 3ZNZB 3S2AA 3VH4B 1G6JA 2JF5A 1P0RA 2MW5A 2BYEA 2JUOA 1WJUA 4HK2A 3JW0X 3SU8X 2KMCA 2ZPYA 4GDLA 1WJ4A 2IO1B 1GG3A 1KM7A 4W9HA 3WAPA 3M95A 1JRUA 2J0KA 4NJ7A 5AZFA 2C60A 1AARA 2N7DA 2O6VD 2LWPA 2L3ZA 2R2OA 3N32A 4W9CA 4AJYB 1SGHA 1UELA 1CMXB 2IYDB 3JSVA 4NJ6A 2O6VB 3A9KB 2KTFA 3TL5A 4M0WB 4IG7B 1J0GA 4MM3A 1R4MI 2AWTA 3IBEA 4EKUA 1E5WA 1WGDA 4I6NB 4EOYA 4MDKE 2K39A 4P7IA 3VXWA 2ASQA 3SD5A 1T0YA 2AL3A 2OJRA 3DVGY 4A3OA 3M3JA 2LASA 1WE7A 1WGGA 2KJ6A 4MGZE 3R7QA 4LDTB 3MHSD 3VUXA 3IG3A 3NHEB 4IWQA 3TIXA 2FNJB 2MWSB 3DVGX 5HKHA 4K7WA 2DZMA 5JHBA 1WY8A 5D7GA 2XBBC 4GB9A 1E7VA 3K9OB 4IWPA 2KTRA 1Y8RC 4E71A 2KX3A 4OVVA 4IM0A 2KQ7A 1WR1A 1WXAA 4TV3A 2IBIB 3DBHI 3I3TB 4GOCA 3ZNID 3APFA 5DPWA 1UH6A 1GC6A 2KDBA 2KWVB 5JH5C 1VCBA 3KH0A 4JL9A 1WX9A 4GGQA 2Z0DB 2N1VA 1V81A 1NDDA 1V80A 2HE7A 3QK0A 5C23A 4FJVB 1WR6E 4W9KA 5G2NA 2CHWA 3UINB 2NPTA 2NR2A 1S3SG 1SIFA 2LXCA 2MBOA 2PJHA 4W9EA 3ZRFA 4W9IA 4CO7A 1V6EA 2JRHA 3CF6E 4PS3A 4MJSA 1A5RA 2MCNB 2LGYA 3MTNB 2IY1B 4KDIC 4W9GA 4G0NB 4EUTA 2KHWB 1X1MA 2BF8B 3DVNV 3QARA 4PYZA 3DBLI 4RM8A 1XD3B 3PRZA 3VUYA 3CMMB 2MBEA 1V2YA 3ECIA 3HM3A 3AULA 4K81A 3R7RA 3U7DA 4BVUC 2FIDA 2KN5A 4HDQA 3EC8A 3TJPA 4F7ZA 5GMVA 4JGHB 4MGIE 2LUEA 4HWIB 3N3KB 3OLMD 3APDA 2I1KA 2WYQA 1WMHB 4FN2A 2LVQA 5G55A 1E8YA 1WFYA 2NBUA 3L10B 4GN1A 2HJ8A 2N9XA 4W9DA 3AI5A 4BBNC 2CHXA 3CSFA 4KSKC 2C5LC 2MRPA 4W9LA 4M8MA 3HIZA 3PTFC 1WZ3A 3ZDMC 2XK5B 2DZKA 3H6NA 2KC2A 3WANA 1KOTA 1WXMA 2CU1A 4TUUA 3PRPB 2QHOA 5L83A 2D07B 2RR9A 4LDTD 2ZJDA 3VFKA 1L7YA 1WE6A 3H7PA 1LXDA 4NAWA 2MBBB 1EUVB 2FCSA 1WZ0A 3ML9A 3V6EB 3X23A 1V86A 4ASWC 1WXVA 2W9NA 3JYUA 3VTUA 1IYFA 3PHXB 4MGYE 4DHJB 3GZNI 2K8CA 2M4NA 3A1QA 2REXA 4EFOA 3BINA 4MELA 4MGKE 4KDLB 5LXIB 2KWUB 1LFDA 2L05A 3UIPB 4URKA 1P9DU 2FCNA 4FADA 1OQYA 3PZDA 4MEMA 1Q0WB 3ENEA 2WWZA 3DOWA 4WWOA 2JWZA 4DXAB 3QIJA 4RM9A 3L54A 1E90A 4JQWC 5LXHA 4YL8A 4ANVA 4HLEA 3ALBA 3P2BA 4JLCA 4TQ0A 2PE9A 4DDGD 5KHOA 2FUHB 2J0MA 2DAJA 3WAMA 3A33B 3MJWA 4LJPB 3VHTC 2RGFA 3KUDB 4ANXA 1WXSA 3DVNU 4MSMB 1WI0A 5DPSA 1Q5WB 2EMSA 4K7SA 2KC1A 3NS8A 3H9DA 2RSUA 4ZDVA 3VDZA 3L17A 4IC7B 2DX5B 3GOEA 2LJ5A 1FXTB 5DPTA 3U30A 4DHZE 2KFJA 2EKEC 2OOBB 4ICUA 5DPRA 2KO3A 2LRUA 3ZUNA 4B6WA 4FJYA 3ZNGC 5E6OA 3ZO5B 5JHAA 2JVCA 3PGEA 2ZNVB 1QZEA 3Q3JA 2KFKB 2DYMA 3PPAA 4B9KA 2MBHA 2K8HA 5DCNA 1C1YB 3ONSA 3NZUA 2O2VA 5CX3A 4DDID 1V5TA 2G4SA 2ZVNA 3RZWC 1U4AA 2IZVB 3W1SC 4KIKB 2KLGA 2LVOA 4WJQA 3BY4B 1WIAA 3OJ4B 2UYZB 2DENB 2BYVE 2A5UA 2IO3B 1YQBA 1LQBA 5CTRC 1WM2A 4EZJA 3H7PB 4NAWB 4NPNA 3NZSA 2JT4B 1GUAB 2MP2A 1XQQA 3ZW3A 2N7EA 1XT9B 2NS5A 4B95A 3DCGA 1UBIA 2DYBA 2EMTA 3PRMB 5D94A 2N9EB 4BKGA 1EF1A 2FIFA 3NY5A 4W9FA 1UZXB 2NBVB 1WX8A 4WJOA 1IPGA 5D2MB 1RLFA 4GIVA 3L08A 4LCDE 2NBWB 3PT2B 5C1ZA 3CSTA 3DDCB 2Y5BB 4FJZA 2FAZA 5J2RA 3VUWA 1ZKHA 3B0AA 1E7UA 3PREA 3PS6A 3EECA 2LRWA 3LJ3A 2CR5A 2V3SA 4G11A 4K7UA 1WJNA 2JXXA 4X57B 1C3TA 2YVCA 4FLHA 4WJPA 1WX7A 2KK8A 2KWCA 3KW5B 2L76A 1GJZA 1EO6A 4WWPA 2IY0B 2M1MA 2GBRA 3JSVB 3AU5A
chains in the Genus database with same CATH superfamily
3ZTCA 3I5JC 3N20C 2NCNA 1VZ7A 3EGRA 1NBFC 4G3XB 4XX5A 3DHHC 1HTOA 2IGHA 1HE8A 4BKTA 4LNFA 3DHIC 1NI2A 2CS4A 4HEA1 4KVGB 1F9JA 1VR9A 3VTVA 1WMHA 4NAMA 4EE2A 3DQVA 3PSEB 2FCMA 1YX6B 1I4HA 4YWGG 4NQLB 4CHKA 4C4VA 1MG8A 2YEPF 1IUEA 3FILB 1WRDB 2M17A 4IKGA 4YSZB 1DOXA 4BKSA 3PHWB 2N1WA 3PVLA 1WH3A 1V97A 2BB6A 4JPSA 4XDDA 2BYFA 2V1YA 4PS8A 1EF5A 2WXJA 5GXGB 3W1SA 3N9YC 1SSNA 2KDIA 2L00B 3ZJTA 3VR9B 1TT5B 1DYQA 4YTNB 1AN8A 2LEKA 2YLMA 4JX1C 1C79A 2UWQA 1XLNA 2N4FA 1WGHA 4BAXA 1K53A 3NOBA 3ZXVA 2L0TA 4ACFA 3B2GA 3FKYA 2D5GA 1VD2A 1MVKA 3QX1A 2N7JA 3B1LX 2WXQA 4J6IA 5IA7A 3PZ7A 3WAOA 1GC7A 2N9PC 2KZRA 3CWIA 4WQOB 4P1BC 3V05A 1YJ1A 2L7RA 5FR6A 1FD6A 4FBJB 2TSSA 3DBLB 2PLPA 3Q3FA 4RFBA 2LVPA 1OGWA 3IFWB 2G3QB 4AUQC 2KJHB 3PLVA 2WXNA 1KTKA 2RD0A 3DBSA 2OEDA 1JCKB 1JWMD 2KXJA 1L0VB 1R4NI 1TKEA 3A9JA 5EDSA 4WWNA 4XGAB 2JXTA 1P1AA 2WX1A 3QQ8B 1I4PA 4IM2A 2JZ3B 3TEXA 2JYTA 4PK1A 1PGAA 2K6QA 2KT7A 2K6DB 2WX0A 3RULA 4E74A 2I1JA 1XCQL 4JWUC 1B1ZA 2K25A 1TYGB 2R2QA 4GU2A 1RFAA 4NQKE 2LFIA 2L52A 1D3ZA 4XZ4A 2AX5A 4AOFA 3OG5A 2XN9C 4RGNA 4HCNB 1FCLA 2XEWA 1I35A 2LZ6A 4LNNA 4GMVA 3Q69A 4MACA 2IO0B 2NVUI 3Q14C 2IGDA 1V8CA 3P1MA 3URYA 4BFRA 1V1OA 3VAWA 1SJED 1P98A 3M62B 1STEA 2BWES 2J53A 3MJ5A 3NRZA 2C7NB 1IP9A 3V6CB 4HPLB 2PPHA 5IO9A 3DBRI 3AE1B 3T8MA 2VRRB 2QILA 4M8NA 1ROEA 2HD5B 5AZHA 4TMAB 1KH0A 3L13A 3S2AA 3RPFC 2G1EA 1G6JA 2JUOA 1SJHD 2IO1B 1KM7A 4W9HA 3M95A 1JRUA 1F2RC 5C3JB 2LWPA 1E10A 4AJYB 4W9CA 2IYDB 2O6VB 4M0WB 1T3QA 1N62A 2AWTA 1EU3A 2K39A 3R2IA 2OJRA 1WE7A 4MGZE 3MHSD 3IG3A 2W82A 2FNJB 2MWSB 5FK9C 3DVGX 3MHZA 1L6UA 2VH1A 1PYWD 3Q3OC 4DXGA 4GB9A 3AEFB 1E7VA 3BWUD 4IWPA 2BS2B 2KTRA 1Y8RC 2N9KA 3AE5B 1GB4A 1GB1A 4TV3A 1WXAA 1WR1A 1UNSA 3DBHI 1GC6A 2KDBA 3HVDA 1VCBA 1ZE3D 3KH0A 1WX9A 4WIPA 5E6JA 1V80A 4W9KA 2RDGA 2K0PA 1SIFA 2LXCA 4NZLB 4W9IA 2JRHA 4PS3A 1MG4A 4MJSA 2V9HA 4KDIC 4W9GA 1X1MA 3QARA 3CMMB 2PMVA 1ENFA 3ECIA 3AULA 1ZPSA 2LGSA 2KN5A 3SFDB 3AEDB 4JGHB 5D3IB 2DLBA 3N3KB 3APDA 1PGBA 2WYQA 1WMHB 2X8XX 4GN1A 3IT6B 4BBNC 4N6EB 2MRPA 4M8MA 3ZDMC 2XK5B 2KC2A 1KOTA 3P4SB 4LDTD 3TSSA 2ZJDA 3W5UB 1FIQA 1HEZE 1LXDA 3KWVA 1V86A 1P7FA 2QSDA 4ASWC 1R4MB 2K9XA 3GB1A 1IYFA 4MGYE 3MP9A 3A1QA 1L5PA 3BINA 4MELA 4MGKE 2HTME 2GB1A 1OQYA 2J4XA 1Q0WB 3ENEA 2WWZA 2JWZA 3QIJA 4RM9A 3L54A 1E90A 4JQWC 5HFYA 4HLEA 4C4VB 1WWTA 3ALBA 4JLCA 2PE9A 1FPYA 2J0MA 2PKOA 4LJPB 3VHTC 2RGFA 3KUDB 4ANXA 3KWLA 1R4NB 3NVYA 2EMSA 4NJCA 3NS8A 1OQRA 2RSUA 2VH2A 4B0EA 2IPKD 5T8IA 2RPVA 3L17A 1QQRA 2LJ5A 2Y5PA 2WU2B 3ZO5B 1FRDA 2DYMA 2MBHA 5DCNA 1QT9A 1C1YB 1I7HA 4DDID 1NYRA 2G4SA 2ZVNA 3RZWC 1U4AA 4LTUA 3ZYYX 2YEPB 1K51A 2KLGA 4WJQA 2QCZA 1NENB 1WRIA 1FFVA 4OW0A 1XQQA 2NS5A 3AE2B 1UBIA 1UF0A 2DYBA 3AEEB 5D94A 3NY5A 5D2MB 2FUG1 1RLFA 4AS1A 3DDCB 1K52A 2HJ1A 2Y5BB 4RF0A 3LJ3A 3W2DA 1GJZA 1EO6A 2JSVX 4BZAA 1FXIA 5TSSA 1SF0A 4D2KA 1WGYA 1NVID 2WNMA 3KQ4A 2BKFA 2O2VB 3J9CA 1EWCA 3PLUA 2BPSA 2WXKA 4MJSB 1TKGA 2WXGA 3T9LA 1RFKA 4DXFA 1K50A 4F1SA 1QKZA 2ZZPB 4DQOC 2MJDA 1FMAD 4A9AA 1YN4A 1SE4A 3AEBB 3BK1A 1OFFA 1S1QB 4W9JA 3B08A 2DYOA 2KKCA 1OEYA 4TKNA 2AQ2B 1Q1OA 2PIAA 4HKZE 2BWFA 3Q3MC 4BKSD 4KIKA 3C19A 3NG0A 3D32A 3EFCA 3ZLZA 1F1HA 2ZVOA 3H8HA 2VZKB 5JXVA 4A20A 3Q8EA 4J3OD 4ZHPA 2MBQA 2WHIA 2X38A 3P4QB 4KKJA 1J7BA 1FM0D 3NJTA 1ZDXA 4KSLC 2QC8A 2KQ4X 4CYEA 3L0WB 3UF8A 3GS2A 4GLSC 3VVWB 1YQ3B 3BYYB 5BMGA 2GBKA 3L16A 4KKIA 4BOZB 2PE6B 1FNWA 4LJOB 3IVFA 4C7YA 1WM3A 2W54A 2N9LA 4EEWA 2WXPA 4OZBA 3EHVA 1VRAB 2BBCA 3IHPC 2ZCCA 2GBNA 1P3QU 1WSPA 2JZZA 1V5OA 3I9V1 1TS2A 2JY6A 1TGZB 3V62A 2NMQA 1Z5SB 5CHFA 2MH7A 2BTEA 2ZNVC 1F77A 2Z0EB 1FNUA 3SDLC 4KZCA 1TTNA 3WIMA 1TY2A 1PFDA 2AEHA 4HPMB 1SE3A 3W1YA 2CHZA 2D10A 2Z59B 4TSSA 2J42A 1CQVA 1XXGA 3KYDD 2MA9B 4A8XC 3QJZA 1BXTA 4XC2A 2D3GA 2L8JA 3WCQA 5IAAC 2DHZA 2INPE 4NNJB 2DAFA 2KX0A 4ANUA 2WXMA 1HZ6A 1N6ZA 2H89B 4C7ZA 3VH3B 3K9PB 2INCC 1N61A 2IO2B 2QIEB 1MJDA 1C78A 4II3B 4P1CC 2LD9A 1L2NA 4KGRA 3A4RA 1D5MC 4YT0B 4YTMB 1GPXA 1TBEA 1V1PA 3HM6X 3EA6A 3Q2AC 2MQJA 5H92C 3RUIB 3UGBB 3LDZE 2GLSA 2E3TA 4EZLA 2G45B 3TEZA 2M0XA 4MH0E 3RNEC 2Y5CA 3QWZB 1YN3A 2KD0A 4JIOU 3P4PB 2JZPA 3ZNZB 2KWDA 4WWMA 3W5VB 2JF5A 1IGDA 3BK2A 1GG3A 1FFUA 1L0XB 1JWAD 2N7DA 3N32A 3BIID 3RNBC 3JSVA 3A9KB 3TL5A 1J0GA 4MM3A 1C77A 1DOIA 1R4MI 1E5WA 1AW7A 2V3PA 4EOYA 4MDKE 4P7IA 4AQ7A 4A3OA 5AUIA 2KJ6A 4LDTB 3NHEB 4IWQA 3TIXA 5JHBA 1L4DB 1WY8A 3AECB 3AEGB 1TS4A 4IOIE 4OVVA 4IM0A 2KQ7A 3ZNID 4GOCA 4R3DA 1ZOYB 3LXFA 5JH5C 2Z0DB 1WR6E 4HKQA 2NPTA 1Y56A 2L83A 4W9EA 1S3SG 2NR2A 2SAKA 3NVVA 4CO7A 1V6EA 3CF6E 3N1YC 2V4IB 5HHDG 2BF8B 3DVNV 3DBLI 3U7DA 4HDQA 1ZUD2 3TJPA 5GMVA 2LUEA 1L4ZB 2LVQA 5G55A 1E8YA 1WFYA 3L10B 4W9DA 1N5XA 2K5PA 1MFWA 1ET9A 2CHXA 4KSKC 2BS4B 2C5LC 4W9LA 2CJNA 3HIZA 2DBYA 2CU1A 4PT5A 3PRPB 2QHOA 3VRBB 1L7YA 1T6BX 4C00A 2J52A 5BYRA 2MBBB 1EUVB 1SIJA 4XYCA 3ML9A 2QEJC 3X23A 3ZJUA 1YN5A 2W9NA 3JYUA 1QOAA 3VTUA 2QDFA 2REXA 2ICIA 4EFOA 1CJEA 2KWUB 2L05A 2FCNA 3PZDA 4WWOA 4DXAB 5LXHA 2LHDA 1T0RC 4TQ0A 1RYJA 2DAJA 4A55A 4LNOA 1WXSA 1WI0A 3H9DA 3RMKC 3W9CB 2DX5B 2OOBB 1R7SA 2LRUA 4H2AA 2AQ3B 5E6OA 1F2RI 1QZEA 3GE8C 1Q10A 3PPAA 3NZUA 1KLGD 5CX3A 1V5TA 3W1SC 2MHJA 3OJ4B 2UYZB 3SEBA 5CTRC 3BVMA 1XCTL 4NPNA 3NZSA 1GUAB 2MP2A 1MPEA 1HZ5A 3DWGC 2VZKD 2EMTA 3PRMB 1EF1A 3T3OA 3AMZA 1UZXB 2ONQA 1JALA 1J7AA 3L08A 4LCDE 2NBWB 3PT2B 2FAZA 3RNCC 3VUWA 4N59A 1E7UA 4FXCA 4G11A 1M4VA 2V3SA 1UUPA 2JXXA 2NTSA 3TUOA 1N60A 1VZ6A 4WWPA 2IY0B 2GBRA 3AU5A 3ZQ4A 4GDLB 3ZNHB 4OHJA 5FKAC 1AYFA 3Q3NC 4HVBA 4ITKA 2WXIA 5TR5A 2G4DB 1PQSA 2EELA 2MX2A 3DHGC 4B0MA 3V3XA 2H88B 3WALA 1YOVB 4G50A 3RD2A 1J19A 1FNVA 2PVGC 1L6VA 4DK5A 3RYTA 3ZIMA 4KV2A 3HUIA 3BYTB 2EKIA 3HK0A 5BMHA 2KTRB 2XK5A 1T5XD 3Q6BA 1J8CA 1BT0A 1C4PA 3IXSA 4BOSC 1E6EB 4ZRIA 3A9JB 1XLPA 1I4GA 2KJRA 1JQ4A 1RAXA 2PW9A 2SEBD 4HPPA 1IBXB 2ZEQA 3GZNB 5LLIA 2D11A 4UDUC 3ZRCA 4HDOA 3KYCD 4F8CB 4I6PA 3LYYA 1KRHA 1OTRB 1T0QC 2BQQA 3MC0B 1LM8B 2AQ1B 2C9WB 5H8YE 4YSXB 1E8ZA 1SB3C 3HRDD 2KMAA 4GSWA 3KVFB 4ANWA 1WF9A 2RPQA 3FILA 5IN7A 4QAYA 2WXOA 3ML8A 5AZGA 4O1NA 4YSYB 1PUTA 4DWFA 4C56C 2BW2A 3SHQA 1L0YB 2K3UA 2DZJA 2WDQB 3PV1A 1QLBB 4RMAA 1I42A 4XWWA 2KYWA 1KJTA 2BKRB 4KGTA 3A9KA 3V61A 2JX5A 2HTHA 3QA8A 4A90A 2C7MB 2MSED 2B76B 2KLCA 4FHKA 2W3RA 4K1RB 2MLBA 4DBGA 1EU4A 3QAQA 2M56B 1SBBB 3TCAA 1E7PB 2M0AA 3A1QB 4ZRKA 1FXAA 4ZRJA 3OWEB 4WQMA 3UI3A 5D3DA 2M19A 3NVWA 3Q8AA 4YXDB 1VLBA 3A4SC 4GXBA 1KLUD 1V1PB 1OEYJ 2DZIA 5J18A 3E9SA 4M0WA 1ACCA 2LMCA 5KHQA 1YIWA 2BYTA 4XE0A 3RNFC 2Q5WD 2L32A 4LLGM 2UU7A 2ZCBA 1V9JA 2AYOB 3O13A 4N58A 1JWSD 4EZKA 3OAWA 5CHVC 4ICVA 1FO4A 5IP4D 5EE0A 2A4ZA 2NPTB 1FEHA 3AE8B 3WA0A 1SE2A 2CJOA 5J17A 4FHJA 4JWSC 3AE3B 3Q8FA 5I4DA 1UWMA 2CKHB 2C7HA 1ZW7A 3N1XC 1WGRA 2GOWA 4FA6A 1M94A 2L0FA 4FULA 3H7SA 3DBRB 4IDIA 2BS3B 2I38A 2KFKA 1IGCA 2JPHA 2KDEB 4L23A 4BBNF 2K1FA 2ZPNA 2ACZB 4IM3A 1P7EA 3R66C 3UIOB 4ARCA 1E8WA 1UWXA 2B3AA 4I6LB 2K22A 4GDKA 3HHMA 2MP2B 3GE3C 3PZ8A 3MC8A 1ZP0B 2WGSA 4KZ0A 4XDCA 2GRIA 3VH4B 4LNKA 2WXFA 1P0RA 3AV8A 4HK2A 2KMCA 4GDLA 2J0KA 4NJ7A 4ZYSA 2C60A 1QOGA 4HROA 2O6VD 2R2OA 1UELA 1CMXB 1HA5A 4NJ6A 3IBEA 2IDYA 4EKUA 1WGDA 4I6NB 2MJ3A 2R61A 3VXWA 3SD5A 2KACA 1T0YA 3DVGY 2LASA 3R7QA 4RNAA 1GOZA 2JQRB 3K9OB 2PTLA 2WLBA 2KX3A 2IBIB 4US8A 4GGQA 1V81A 1NDDA 5JHAA 2ON8A 5C23A 4FJVB 3U52E 1E9MA 2MBOA 3SFEB 1IBXA 4MT5A 1TIFA 1VZ8A 1I4RA 2DNFA 2LGYA 2MCNB 2KHWB 2WQYB 4RM8A 4PYZA 3VUYA 1XD3B 3PRZA 1EWYC 4RGOS 2OJWA 1A70A 3R7RA 4YTPB 5BYSA 2FIDA 4Q2JA 4F7ZA 3NS1A 4MGIE 1JROA 5EE3A 1WGKA 3OLMD 2I1KA 2HJ8A 2N9XA 3AI5A 3Q8CA 3SR6A 3PTFC 1WZ3A 2DZKA 3WANA 3KLSX 4TUUA 5L83A 2RR9A 3N1ZC 3NVZA 4L1BA 1WZ0A 1TZOA 4K3BA 2M4NA 4URKA 2KDMA 4MEMA 3P4RB 1ESFA 3DOWA 2MJEA 3E56A 4ANVA 3L4PA 3MC9A 4DDGD 5KHOA 2FUHB 3A33B 3MJWA 1QOFA 5DPSA 3BZDB 3AE9B 5C2TB 4IC7B 4ARIA 2EKEC 1TKYA 1YQ4B 4ICUA 3ZUNA 4KX6B 4B6WA 5HG2A 3T3NA 3PGEA 4B9KA 2K8HA 3U4EG 1LO5D 3AE6B 3ONSA 4ZRPA 4M01A 2IZVB 4KIKB 3BY4B 2CU3A 1TY0A 2BYVE 2A5UA 2BT6A 2IO3B 1D5ZC 1LQBA 4M00A 1WM2A 4EZJA 3H7PB 4NAWB 2JT4B 1HQRD 3I63C 1XT9B 4B95A 3DCGA 1JWBD 2FIFA 2NBVB 1WX8A 5LNK1 1I4QA 4WJOA 1XO3A 3U2SC 1VDVA 5C1ZA 3CSTA 3MFGA 4RF1A 1ZKHA 3B0AA 2INDC 2WXLA 3PS6A 3EECA 2LRWA 1E0ZA 2CR5A 4K7UA 1WJNA 1ZXIA 5IKCM 4M02A 2YVCA 1WX7A 3KW5B 1ZXHA 3JSVB 3PO0A 2BB5A 4GDKB 4MSQB 1K8RB 5CHWA 1C4AA 2HDEA 4WJNA 1B9RA 1KLVA 2WDRB 3FC4A 1UBQA 1JRPA 5E6PA 3VQIA 2WXHA 1SEBD 4NY0A 1ISNA 3ZVVA 1SE9A 1WJ6A 2KVRA 2LI5A 3UQBA 3H1UA 3BVGA 3QC8B 1RM6C 1XEEA 2LXAA 1N63A 2O6VA 5BYQA 3RI7C 1BUIC 3R8BA 4IWOA 2KANA 5JZEB 1UGMA 4OVZA 4RH6A 1V49A 3U8ZA 4HJGE 3NZ3A 2K8BA 1HXYD 1KF6B 3ABVB 1D4BA 3TEWA 1RRBA 4ZYNA 2MEKA 3VRAB 3EFUA 5BO4B 2GMIC 3GP7A 5E6NA 4ZHOA 1RWSA 1LGRA 4AWJA 3EUB2 5IOIA 4II2B 2RDBC 4MH8A 4IUMB 2KOXA 1H8CA 3QHTA 1UD7A 2JWUA 4PS7A 4E3CA 3X0WA 2KVZA 3LB8C 1YJJA 3AE7B 3ZKJC 1GNUA 3V60A 3Q8BA 2JYEA 3C0RB 2D3BA 1OQQA 3R3MA 2J7QB 3M63B 3RCZA 5L95C 1E8XA 3TMPB 4AJWA 4OVUA 4RCOA 3KUZA 4USAA 2W55A 4OZAA 3B9JA 4RGTA 2JRIB 2V4LA 5AEKB 2M8SA 4CQNA 3JVZX 3U7ZA 1F0ZA 2QMTA 1EM7A 2LGXA 2JU6X 2GBMA 4WAAA 2I2YA 3AE4B 3APCA 1YMHE 4DHJD 4IW0A 1F52A 2GBJA 2KNBA 4ZRQA 4AP4C 5D6JB 3TEYA 1PDXA 2WDTB 2KDFB 3O65B 4HCPB 3TBLD 2LHEA 4TQ1A 3BVZA 3ZTDA 1ZGUB 3N30A 1MI0A 4DHZB 1H4RA 2J0JA 3NUHB 2WU5B 4REZA 3ZDTA 5AUKA 4PYUA 2Z8LA 3P42A 1JWUD 3QCAA 3RNGC 4JE3B 3FAHA 2RMMA 2PEAA 3RZFA 1QOBA 3UQAA 1Z2MA 1NEKB 4HXDA 4HRSA 4N9F4 2FCQA 3RT3B 1YX5B 1QILA 2D2QA 2BGFA 1YD8U 3VTWA 2WS3B 1ET6A 2AL6A 3IAS1 3AXCA 3AB5A 1XLOA 2IJ0A 3KUCB 4A3PA 3DPDA 2OHFA 2ZW1A 1N5WA 1WYWB 4P16A 2FBWB 4HJKA 3B2FA 3AU4A 2KQSA 2LGDA 3OJ3A 1TZ1A 4LNIA 4A6QA 4RGMA 1VJKA 2MW5A 2BYEA 3SU8X 1WJUA 3JW0X 5BMIA 2ZPYA 3WAPA 1WJ4A 3DBHB 5AZFA 1AARA 2L1AA 3IAM1 2L3ZA 2E6XA 1SGHA 2KTFA 2LGIA 1MHXA 4IG7B 2XNAC 2KN4A 2V3NA 2NTTA 3R2TA 1FCCC 2ASQA 2AL3A 3M3JA 2KAJA 1WGGA 3VUXA 3AEAB 1J7CA 5HKHA 4K7WA 1KFYB 2DZMA 5D7GA 4MM3B 2XBBC 1DOYA 1YNTE 1BMLC 1NYQA 4E71A 1C76A 1T0SC 1YJIA 1FRRA 1TJEA 3I3TB 5DPWA 3APFA 1UH6A 1HTQA 2KWVB 4WURA 1XF5L 3AH7A 4JL9A 2PVOD 2HE7A 2N1VA 3QK0A 5G2NA 3UINB 2CHWA 2PJHA 3ZRFA 1WYGA 3ZGZA 3RN9C 1A5RA 3MTNB 2IY1B 4KGSA 4G0NB 4EUTA 1TS3A 2MBEA 1V2YA 3HM3A 4K81A 4BVUC 2WP9B 3EC8A 1CZPA 4HWIB 3AM9A 2LUMA 4FN2A 1D5XC 2NBUA 1XLQA 2Y3AA 3DWMA 4OZCA 3CSFA 5G5HA 2D3CA 3H6NA 1SXTA 1WXMA 2FE8A 4L2YA 4WH4A 2D07B 3VFKA 2DWQA 1WE6A 3HVZA 3H7PA 4NAWA 2FCSA 3RNAC 3V6EB 1PGXA 4ZOHC 1NI3A 1WXQA 1WXVA 3PHXB 4DHJB 1GAQB 3GZNI 2K8CA 1C4CA 4LK0M 3I57A 5LXIB 1JW9D 4KDLB 3UIPB 1LFDA 1P9DU 4FADA 1C9FA 3VR8B 4C80A 4S0RA 1ZDVA 2V0GA 4YL8A 3P2BA 3WAMA 3ZXRA 3CIRB 3DVNU 1CK1A 4MSMB 1Q5WB 4K7SA 2QJLA 2KC1A 2W3SA 1DGJA 3IT4B 3ETRA 4ZDVA 3VDZA 2D3AA 3GOEA 5DPTA 1FXTB 1QF6A 3U30A 4DHZE 3ZJVA 2KFJA 5DPRA 2KO3A 4FJYA 3ZNGC 2JVCA 3Q3JA 2ZNVB 2KFKB 2ZW0A 4S17A 2N0SB 5HI1A 2WXRA 2O2VA 2LVOA 1WIAA 3P63A 2DENB 3C8YA 4WAFA 1YQBA 2WDVB 1JMLA 3ZW3A 5FR3A 1AWDA 2N7EA 2IGGA 4BKGA 2KMMA 2N9EB 4W9FA 5MPOA 1IPGA 5G5GA 1I4XA 2INNE 4XWTA 4GIVA 3RFZB 4K3CA 2GI9A 4FJZA 5J2RA 3AN1A 2BVCA 3PREA 5EE9A 1TS5A 4X57B 2G9HD 4US9A 1C3TA 4WJPA 4FLHA 1UGJA 2KK8A 1MHHE 2KWCA 2L76A 2RDHA 2LJIA 1D6EC 4P6VF 2M1MA 5EE1A
chains in the Genus database with same CATH topology
4GDLB 3ZTCA 3ZNHB 2NCNA 4GDKB 4MSQB 1K8RB 1NBFC 4HVBA 4G3XB 4XX5A 5TR5A 2G4DB 1PQSA 5CHWA 1WGYA 1HE8A 4WJNA 4BKTA 2MX2A 1KLVA 2BKFA 3WALA 1UBQA 4G50A 3RD2A 2O2VB 5E6PA 3VQIA 1J19A 1NI2A 2CS4A 4KVGB 1F9JA 3PLUA 2BPSA 4NY0A 4MJSB 3RYTA 3VTVA 3ZIMA 4DK5A 1ISNA 4KV2A 1WMHA 3DQVA 3PSEB 3ZVVA 1SE9A 2FCMA 1WJ6A 3HK0A 3T9LA 2KVRA 1YX6B 2LI5A 2KTRB 3UQBA 3H1UA 4NQLB 4F1SA 2ZZPB 3QC8B 2XK5A 2LXAA 1J8CA 2O6VA 1BT0A 4BOSC 4CHKA 1S1QB 4ZRIA 4W9JA 3A9JB 4IWOA 3B08A 2KANA 5JZEB 2KJRA 2DYOA 1UGMA 1RAXA 1MG8A 2KKCA 1OEYA 1V49A 4TKNA 3U8ZA 1WRDB 2ZEQA 1Q1OA 5LLIA 2D11A 2M17A 3ZRCA 4HDOA 3KYCD 4F8CB 2K8BA 4BKSA 2BWFA 4BKSD 4I6PA 1OTRB 4KIKA 3PHWB 1RRBA 2N1WA 4ZYNA 3PVLA 1LM8B 1WH3A 3D32A 3EFUA 2C9WB 5BO4B 3ZLZA 2GMIC 1E8ZA 5E6NA 2BYFA 2V1YA 2KMAA 4GSWA 4PS8A 1EF5A 3KVFB 4ANWA 2ZVOA 1WF9A 2RPQA 4AWJA 3W1SA 4II2B 2KDIA 2L00B 4A20A 3ML8A 5AZGA 4IUMB 2KOXA 2YLMA 1H8CA 3QHTA 4DWFA 1UD7A 3SHQA 2MBQA 4PS7A 2UWQA 4E3CA 3X0WA 2DZJA 2N4FA 1WGHA 3PV1A 3NOBA 4KSLC 1GNUA 3ZKJC 3V60A 4RMAA 4CYEA 2L0TA 1I42A 3C0RB 3L0WB 3UF8A 1KJTA 2BKRB 3A9KA 3V61A 3VVWB 2HTHA 3QA8A 2J7QB 2C7MB 2MSED 3M63B 3R3MA 3RCZA 5L95C 1E8XA 2KLCA 2GBKA 3L16A 4FHKA 3TMPB 1VD2A 3TBLD 4AJWA 4K1RB 3QX1A 4OVUA 2MLBA 4DBGA 4BOZB 3KUZA 2PE6B 3B1LX 4J6IA 3QAQA 3TCAA 4LJOB 3IVFA 1WM3A 3A1QB 5IA7A 4ZRKA 3WAOA 1GC7A 4EEWA 2N9PC 4ZRJA 2KZRA 2JRIB 2V4LA 5AEKB 2M8SA 3JVZX 3EHVA 4WQOB 1YJ1A 3IHPC 2L7RA 2ZCCA 5FR6A 2GBNA 1P3QU 4FBJB 2JZZA 1V5OA 3A4SC 4GXBA 2JY6A 2LGXA 1TGZB 1OEYJ 3Q3FA 3V62A 2LVPA 2GBMA 4WAAA 1OGWA 3IFWB 1Z5SB 2DZIA 2G3QB 3APCA 5CHFA 4AUQC 2KJHB 3PLVA 5J18A 4DHJD 4IW0A 2RD0A 5KHQA 2GBJA 2ZNVC 2KNBA 3DBSA 2Z0EB 1YIWA 3SDLC 4KZCA 2KXJA 1TTNA 4AP4C 3WIMA 1R4NI 3A9JA 5D6JB 2WDTB 5EDSA 2KDFB 2ZCBA 3O65B 4HCPB 4WWNA 1V9JA 2AEHA 1P1AA 2AYOB 2WX1A 3QQ8B 4HPMB 2JZ3B 4IM2A 4TQ1A 3W1YA 2CHZA 2D10A 4EZKA 2Z59B 3OAWA 5CHVC 3ZTDA 2K6QA 2K6DB 4ICVA 1ZGUB 3N30A 3KYDD 2WX0A 2MA9B 2A4ZA 3RULA 3QJZA 4E74A 2I1JA 2NPTB 4DHZB 1H4RA 2J0JA 3WA0A 5J17A 4XC2A 2D3GA 2L8JA 4FHJA 3ZDTA 5IAAC 2DHZA 2K25A 4NNJB 2CKHB 2C7HA 1ZW7A 2DAFA 2KX0A 1RFAA 2R2QA 4GU2A 4NQKE 4PYUA 4ANUA 1D3ZA 4XZ4A 3QCAA 1WGRA 2GOWA 4FA6A 4AOFA 1M94A 2L0FA 3VH3B 4FULA 3K9PB 2IO2B 3H7SA 4II3B 4HCNB 2LD9A 2PEAA 3RZFA 2XEWA 1L2NA 2KFKA 3A4RA 2JPHA 1I35A 2LZ6A 2KDEB 1Z2MA 4GMVA 4BBNF 3UQAA 2K1FA 1TBEA 2ZPNA 4HXDA 4N9F4 2FCQA 3RT3B 1YX5B 4IM3A 2IO0B 3HM6X 2NVUI 3R66C 3UIOB 2D2QA 2BGFA 1YD8U 3VTWA 4BFRA 2MQJA 1E8WA 3RUIB 2B3AA 3VAWA 4I6LB 1P98A 3LDZE 3M62B 2AL6A 4GDKA 3UGBB 3AXCA 2BWES 3HHMA 2MP2B 2C7NB 3KUCB 1IP9A 3V6CB 4EZLA 4A3PA 2G45B 4HPLB 2PPHA 2M0XA 3DPDA 4MH0E 3DBRI 1WYWB 3QWZB 3T8MA 2KD0A 2VRRB 4JIOU 4HJKA 3AU4A 4M8NA 2HD5B 2KQSA 2LGDA 3OJ3A 1TZ1A 4KZ0A 5AZHA 3L13A 3ZNZB 3S2AA 3VH4B 1G6JA 2JF5A 1P0RA 2MW5A 2BYEA 2JUOA 1WJUA 4HK2A 3JW0X 3SU8X 2KMCA 2ZPYA 4GDLA 1WJ4A 2IO1B 1GG3A 1KM7A 4W9HA 3WAPA 3M95A 1JRUA 2J0KA 4NJ7A 5AZFA 2C60A 1AARA 2N7DA 2O6VD 2LWPA 2L3ZA 2R2OA 3N32A 4W9CA 4AJYB 1SGHA 1UELA 1CMXB 2IYDB 3JSVA 4NJ6A 2O6VB 3A9KB 2KTFA 3TL5A 4M0WB 4IG7B 1J0GA 4MM3A 1R4MI 2AWTA 3IBEA 4EKUA 1E5WA 1WGDA 4I6NB 4EOYA 4MDKE 2K39A 4P7IA 3VXWA 2ASQA 3SD5A 1T0YA 2AL3A 2OJRA 3DVGY 4A3OA 3M3JA 2LASA 1WE7A 1WGGA 2KJ6A 4MGZE 3R7QA 4LDTB 3MHSD 3VUXA 3IG3A 3NHEB 4IWQA 3TIXA 2FNJB 2MWSB 3DVGX 5HKHA 4K7WA 2DZMA 5JHBA 1WY8A 5D7GA 2XBBC 4GB9A 1E7VA 3K9OB 4IWPA 2KTRA 1Y8RC 4E71A 2KX3A 4OVVA 4IM0A 2KQ7A 1WR1A 1WXAA 4TV3A 2IBIB 3DBHI 3I3TB 4GOCA 3ZNID 3APFA 5DPWA 1UH6A 1GC6A 2KDBA 2KWVB 5JH5C 1VCBA 3KH0A 4JL9A 1WX9A 4GGQA 2Z0DB 2N1VA 1V81A 1NDDA 1V80A 2HE7A 3QK0A 5C23A 4FJVB 1WR6E 4W9KA 5G2NA 2CHWA 3UINB 2NPTA 2NR2A 1S3SG 1SIFA 2LXCA 2MBOA 2PJHA 4W9EA 3ZRFA 4W9IA 4CO7A 1V6EA 2JRHA 3CF6E 4PS3A 4MJSA 1A5RA 2MCNB 2LGYA 3MTNB 2IY1B 4KDIC 4W9GA 4G0NB 4EUTA 2KHWB 1X1MA 2BF8B 3DVNV 3QARA 4PYZA 3DBLI 4RM8A 1XD3B 3PRZA 3VUYA 3CMMB 2MBEA 1V2YA 3ECIA 3HM3A 3AULA 4K81A 3R7RA 3U7DA 4BVUC 2FIDA 2KN5A 4HDQA 3EC8A 3TJPA 4F7ZA 5GMVA 4JGHB 4MGIE 2LUEA 4HWIB 3N3KB 3OLMD 3APDA 2I1KA 2WYQA 1WMHB 4FN2A 2LVQA 5G55A 1E8YA 1WFYA 2NBUA 3L10B 4GN1A 2HJ8A 2N9XA 4W9DA 3AI5A 4BBNC 2CHXA 3CSFA 4KSKC 2C5LC 2MRPA 4W9LA 4M8MA 3HIZA 3PTFC 1WZ3A 3ZDMC 2XK5B 2DZKA 3H6NA 2KC2A 3WANA 1KOTA 1WXMA 2CU1A 4TUUA 3PRPB 2QHOA 5L83A 2D07B 2RR9A 4LDTD 2ZJDA 3VFKA 1L7YA 1WE6A 3H7PA 1LXDA 4NAWA 2MBBB 1EUVB 2FCSA 1WZ0A 3ML9A 3V6EB 3X23A 1V86A 4ASWC 1WXVA 2W9NA 3JYUA 3VTUA 1IYFA 3PHXB 4MGYE 4DHJB 3GZNI 2K8CA 2M4NA 3A1QA 2REXA 4EFOA 3BINA 4MELA 4MGKE 4KDLB 5LXIB 2KWUB 1LFDA 2L05A 3UIPB 4URKA 1P9DU 2FCNA 4FADA 1OQYA 3PZDA 4MEMA 1Q0WB 3ENEA 2WWZA 3DOWA 4WWOA 2JWZA 4DXAB 3QIJA 4RM9A 3L54A 1E90A 4JQWC 5LXHA 4YL8A 4ANVA 4HLEA 3ALBA 3P2BA 4JLCA 4TQ0A 2PE9A 4DDGD 5KHOA 2FUHB 2J0MA 2DAJA 3WAMA 3A33B 3MJWA 4LJPB 3VHTC 2RGFA 3KUDB 4ANXA 1WXSA 3DVNU 4MSMB 1WI0A 5DPSA 1Q5WB 2EMSA 4K7SA 2KC1A 3NS8A 3H9DA 2RSUA 4ZDVA 3VDZA 3L17A 4IC7B 2DX5B 3GOEA 2LJ5A 1FXTB 5DPTA 3U30A 4DHZE 2KFJA 2EKEC 2OOBB 4ICUA 5DPRA 2KO3A 2LRUA 3ZUNA 4B6WA 4FJYA 3ZNGC 5E6OA 3ZO5B 5JHAA 2JVCA 3PGEA 2ZNVB 1QZEA 3Q3JA 2KFKB 2DYMA 3PPAA 4B9KA 2MBHA 2K8HA 5DCNA 1C1YB 3ONSA 3NZUA 2O2VA 5CX3A 4DDID 1V5TA 2G4SA 2ZVNA 3RZWC 1U4AA 2IZVB 3W1SC 4KIKB 2KLGA 2LVOA 4WJQA 3BY4B 1WIAA 3OJ4B 2UYZB 2DENB 2BYVE 2A5UA 2IO3B 1YQBA 1LQBA 5CTRC 1WM2A 4EZJA 3H7PB 4NAWB 4NPNA 3NZSA 2JT4B 1GUAB 2MP2A 1XQQA 3ZW3A 2N7EA 1XT9B 2NS5A 4B95A 3DCGA 1UBIA 2DYBA 2EMTA 3PRMB 5D94A 2N9EB 4BKGA 1EF1A 2FIFA 3NY5A 4W9FA 1UZXB 2NBVB 1WX8A 4WJOA 1IPGA 5D2MB 1RLFA 4GIVA 3L08A 4LCDE 2NBWB 3PT2B 5C1ZA 3CSTA 3DDCB 2Y5BB 4FJZA 2FAZA 5J2RA 3VUWA 1ZKHA 3B0AA 1E7UA 3PREA 3PS6A 3EECA 2LRWA 3LJ3A 2CR5A 2V3SA 4G11A 4K7UA 1WJNA 2JXXA 4X57B 1C3TA 2YVCA 4FLHA 4WJPA 1WX7A 2KK8A 2KWCA 3KW5B 2L76A 1GJZA 1EO6A 4WWPA 2IY0B 2M1MA 2GBRA 3JSVB 3AU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GDL B;  3ZTC A;  3ZNH B;  2NCN A;  4GDK B;  4MSQ B;  1K8R B;  1NBF C;  4HVB A;  4G3X B;  4XX5 A;  5TR5 A;  2G4D B;  1PQS A;  5CHW A;  1WGY A;  1HE8 A;  4WJN A;  4BKT A;  2MX2 A;  1KLV A;  2BKF A;  3WAL A;  1UBQ A;  4G50 A;  3RD2 A;  2O2V B;  5E6P A;  3VQI A;  1J19 A;  1NI2 A;  2CS4 A;  4KVG B;  1F9J A;  3PLU A;  2BPS A;  4NY0 A;  4MJS B;  3RYT A;  3VTV A;  3ZIM A;  4DK5 A;  1ISN A;  4KV2 A;  1WMH A;  3DQV A;  3PSE B;  3ZVV A;  1SE9 A;  2FCM A;  1WJ6 A;  3HK0 A;  3T9L A;  2KVR A;  1YX6 B;  2LI5 A;  2KTR B;  3UQB A;  3H1U A;  4NQL B;  4F1S A;  2ZZP B;  3QC8 B;  2XK5 A;  2LXA A;  1J8C A;  2O6V A;  1BT0 A;  4BOS C;  4CHK A;  1S1Q B;  4ZRI A;  4W9J A;  3A9J B;  4IWO A;  3B08 A;  2KAN A;  5JZE B;  2KJR A;  2DYO A;  1UGM A;  1RAX A;  1MG8 A;  2KKC A;  1OEY A;  1V49 A;  4TKN A;  3U8Z A;  1WRD B;  2ZEQ A;  1Q1O A;  5LLI A;  2D11 A;  2M17 A;  3ZRC A;  4HDO A;  3KYC D;  4F8C B;  2K8B A;  4BKS A;  2BWF A;  4BKS D;  4I6P A;  1OTR B;  4KIK A;  3PHW B;  1RRB A;  2N1W A;  4ZYN A;  3PVL A;  1LM8 B;  1WH3 A;  3D32 A;  3EFU A;  2C9W B;  5BO4 B;  3ZLZ A;  2GMI C;  1E8Z A;  5E6N A;  2BYF A;  2V1Y A;  2KMA A;  4GSW A;  4PS8 A;  1EF5 A;  3KVF B;  4ANW A;  2ZVO A;  1WF9 A;  2RPQ A;  4AWJ A;  3W1S A;  4II2 B;  2KDI A;  2L00 B;  4A20 A;  3ML8 A;  5AZG A;  4IUM B;  2KOX A;  2YLM A;  1H8C A;  3QHT A;  4DWF A;  1UD7 A;  3SHQ A;  2MBQ A;  4PS7 A;  2UWQ A;  4E3C A;  3X0W A;  2DZJ A;  2N4F A;  1WGH A;  3PV1 A;  3NOB A;  4KSL C;  1GNU A;  3ZKJ C;  3V60 A;  4RMA A;  4CYE A;  2L0T A;  1I42 A;  3C0R B;  3L0W B;  3UF8 A;  1KJT A;  2BKR B;  3A9K A;  3V61 A;  3VVW B;  2HTH A;  3QA8 A;  2J7Q B;  2C7M B;  2MSE D;  3M63 B;  3R3M A;  3RCZ A;  5L95 C;  1E8X A;  2KLC A;  2GBK A;  3L16 A;  4FHK A;  3TMP B;  1VD2 A;  3TBL D;  4AJW A;  4K1R B;  3QX1 A;  4OVU A;  2MLB A;  4DBG A;  4BOZ B;  3KUZ A;  2PE6 B;  3B1L X;  4J6I A;  3QAQ A;  3TCA A;  4LJO B;  3IVF A;  1WM3 A;  3A1Q B;  5IA7 A;  4ZRK A;  3WAO A;  1GC7 A;  4EEW A;  2N9P C;  4ZRJ A;  2KZR A;  2JRI B;  2V4L A;  5AEK B;  2M8S A;  3JVZ X;  3EHV A;  4WQO B;  1YJ1 A;  3IHP C;  2L7R A;  2ZCC A;  5FR6 A;  2GBN A;  1P3Q U;  4FBJ B;  2JZZ A;  1V5O A;  3A4S C;  4GXB A;  2JY6 A;  2LGX A;  1TGZ B;  1OEY J;  3Q3F A;  3V62 A;  2LVP A;  2GBM A;  4WAA A;  1OGW A;  3IFW B;  1Z5S B;  2DZI A;  2G3Q B;  3APC A;  5CHF A;  4AUQ C;  2KJH B;  3PLV A;  5J18 A;  4DHJ D;  4IW0 A;  2RD0 A;  5KHQ A;  2GBJ A;  2ZNV C;  2KNB A;  3DBS A;  2Z0E B;  1YIW A;  3SDL C;  4KZC A;  2KXJ A;  1TTN A;  4AP4 C;  3WIM A;  1R4N I;  3A9J A;  5D6J B;  2WDT B;  5EDS A;  2KDF B;  2ZCB A;  3O65 B;  4HCP B;  4WWN A;  1V9J A;  2AEH A;  1P1A A;  2AYO B;  2WX1 A;  3QQ8 B;  4HPM B;  2JZ3 B;  4IM2 A;  4TQ1 A;  3W1Y A;  2CHZ A;  2D10 A;  4EZK A;  2Z59 B;  3OAW A;  5CHV C;  3ZTD A;  2K6Q A;  2K6D B;  4ICV A;  1ZGU B;  3N30 A;  3KYD D;  2WX0 A;  2MA9 B;  2A4Z A;  3RUL A;  3QJZ A;  4E74 A;  2I1J A;  2NPT B;  4DHZ B;  1H4R A;  2J0J A;  3WA0 A;  5J17 A;  4XC2 A;  2D3G A;  2L8J A;  4FHJ A;  3ZDT A;  5IAA C;  2DHZ A;  2K25 A;  4NNJ B;  2CKH B;  2C7H A;  1ZW7 A;  2DAF A;  2KX0 A;  1RFA A;  2R2Q A;  4GU2 A;  4NQK E;  4PYU A;  4ANU A;  1D3Z A;  4XZ4 A;  3QCA A;  1WGR A;  2GOW A;  4FA6 A;  4AOF A;  1M94 A;  2L0F A;  3VH3 B;  4FUL A;  3K9P B;  2IO2 B;  3H7S A;  4II3 B;  4HCN B;  2LD9 A;  2PEA A;  3RZF A;  2XEW A;  1L2N A;  2KFK A;  3A4R A;  2JPH A;  1I35 A;  2LZ6 A;  2KDE B;  1Z2M A;  4GMV A;  4BBN F;  3UQA A;  2K1F A;  1TBE A;  2ZPN A;  4HXD A;  4N9F 4;  2FCQ A;  3RT3 B;  1YX5 B;  4IM3 A;  2IO0 B;  3HM6 X;  2NVU I;  3R66 C;  3UIO B;  2D2Q A;  2BGF A;  1YD8 U;  3VTW A;  4BFR A;  2MQJ A;  1E8W A;  3RUI B;  2B3A A;  3VAW A;  4I6L B;  1P98 A;  3LDZ E;  3M62 B;  2AL6 A;  4GDK A;  3UGB B;  3AXC A;  2BWE S;  3HHM A;  2MP2 B;  2C7N B;  3KUC B;  1IP9 A;  3V6C B;  4EZL A;  4A3P A;  2G45 B;  4HPL B;  2PPH A;  2M0X A;  3DPD A;  4MH0 E;  3DBR I;  1WYW B;  3QWZ B;  3T8M A;  2KD0 A;  2VRR B;  4JIO U;  4HJK A;  3AU4 A;  4M8N A;  2HD5 B;  2KQS A;  2LGD A;  3OJ3 A;  1TZ1 A;  4KZ0 A;  5AZH A;  3L13 A;  3ZNZ B;  3S2A A;  3VH4 B;  1G6J A;  2JF5 A;  1P0R A;  2MW5 A;  2BYE A;  2JUO A;  1WJU A;  4HK2 A;  3JW0 X;  3SU8 X;  2KMC A;  2ZPY A;  4GDL A;  1WJ4 A;  2IO1 B;  1GG3 A;  1KM7 A;  4W9H A;  3WAP A;  3M95 A;  1JRU A;  2J0K A;  4NJ7 A;  5AZF A;  2C60 A;  1AAR A;  2N7D A;  2O6V D;  2LWP A;  2L3Z A;  2R2O A;  3N32 A;  4W9C A;  4AJY B;  1SGH A;  1UEL A;  1CMX B;  2IYD B;  3JSV A;  4NJ6 A;  2O6V B;  3A9K B;  2KTF A;  3TL5 A;  4M0W B;  4IG7 B;  1J0G A;  4MM3 A;  1R4M I;  2AWT A;  3IBE A;  4EKU A;  1E5W A;  1WGD A;  4I6N B;  4EOY A;  4MDK E;  2K39 A;  4P7I A;  3VXW A;  2ASQ A;  3SD5 A;  1T0Y A;  2AL3 A;  2OJR A;  3DVG Y;  4A3O A;  3M3J A;  2LAS A;  1WE7 A;  1WGG A;  2KJ6 A;  4MGZ E;  3R7Q A;  4LDT B;  3MHS D;  3VUX A;  3IG3 A;  3NHE B;  4IWQ A;  3TIX A;  2FNJ B;  2MWS B;  3DVG X;  5HKH A;  4K7W A;  2DZM A;  5JHB A;  1WY8 A;  5D7G A;  2XBB C;  4GB9 A;  1E7V A;  3K9O B;  4IWP A;  2KTR A;  1Y8R C;  4E71 A;  2KX3 A;  4OVV A;  4IM0 A;  2KQ7 A;  1WR1 A;  1WXA A;  4TV3 A;  2IBI B;  3DBH I;  3I3T B;  4GOC A;  3ZNI D;  3APF A;  5DPW A;  1UH6 A;  1GC6 A;  2KDB A;  2KWV B;  5JH5 C;  1VCB A;  3KH0 A;  4JL9 A;  1WX9 A;  4GGQ A;  2Z0D B;  2N1V A;  1V81 A;  1NDD A;  1V80 A;  2HE7 A;  3QK0 A;  5C23 A;  4FJV B;  1WR6 E;  4W9K A;  5G2N A;  2CHW A;  3UIN B;  2NPT A;  2NR2 A;  1S3S G;  1SIF A;  2LXC A;  2MBO A;  2PJH A;  4W9E A;  3ZRF A;  4W9I A;  4CO7 A;  1V6E A;  2JRH A;  3CF6 E;  4PS3 A;  4MJS A;  1A5R A;  2MCN B;  2LGY A;  3MTN B;  2IY1 B;  4KDI C;  4W9G A;  4G0N B;  4EUT A;  2KHW B;  1X1M A;  2BF8 B;  3DVN V;  3QAR A;  4PYZ A;  3DBL I;  4RM8 A;  1XD3 B;  3PRZ A;  3VUY A;  3CMM B;  2MBE A;  1V2Y A;  3ECI A;  3HM3 A;  3AUL A;  4K81 A;  3R7R A;  3U7D A;  4BVU C;  2FID A;  2KN5 A;  4HDQ A;  3EC8 A;  3TJP A;  4F7Z A;  5GMV A;  4JGH B;  4MGI E;  2LUE A;  4HWI B;  3N3K B;  3OLM D;  3APD A;  2I1K A;  2WYQ A;  1WMH B;  4FN2 A;  2LVQ A;  5G55 A;  1E8Y A;  1WFY A;  2NBU A;  3L10 B;  4GN1 A;  2HJ8 A;  2N9X A;  4W9D A;  3AI5 A;  4BBN C;  2CHX A;  3CSF A;  4KSK C;  2C5L C;  2MRP A;  4W9L A;  4M8M A;  3HIZ A;  3PTF C;  1WZ3 A;  3ZDM C;  2XK5 B;  2DZK A;  3H6N A;  2KC2 A;  3WAN A;  1KOT A;  1WXM A;  2CU1 A;  4TUU A;  3PRP B;  2QHO A;  5L83 A;  2D07 B;  2RR9 A;  4LDT D;  2ZJD A;  3VFK A;  1L7Y A;  1WE6 A;  3H7P A;  1LXD A;  4NAW A;  2MBB B;  1EUV B;  2FCS A;  1WZ0 A;  3ML9 A;  3V6E B;  3X23 A;  1V86 A;  4ASW C;  1WXV A;  2W9N A;  3JYU A;  3VTU A;  1IYF A;  3PHX B;  4MGY E;  4DHJ B;  3GZN I;  2K8C A;  2M4N A;  3A1Q A;  2REX A;  4EFO A;  3BIN A;  4MEL A;  4MGK E;  4KDL B;  5LXI B;  2KWU B;  1LFD A;  2L05 A;  3UIP B;  4URK A;  1P9D U;  2FCN A;  4FAD A;  1OQY A;  3PZD A;  4MEM A;  1Q0W B;  3ENE A;  2WWZ A;  3DOW A;  4WWO A;  2JWZ A;  4DXA B;  3QIJ A;  4RM9 A;  3L54 A;  1E90 A;  4JQW C;  5LXH A;  4YL8 A;  4ANV A;  4HLE A;  3ALB A;  3P2B A;  4JLC A;  4TQ0 A;  2PE9 A;  4DDG D;  5KHO A;  2FUH B;  2J0M A;  2DAJ A;  3WAM A;  3A33 B;  3MJW A;  4LJP B;  3VHT C;  2RGF A;  3KUD B;  4ANX A;  1WXS A;  3DVN U;  4MSM B;  1WI0 A;  5DPS A;  1Q5W B;  2EMS A;  4K7S A;  2KC1 A;  3NS8 A;  3H9D A;  2RSU A;  4ZDV A;  3VDZ A;  3L17 A;  4IC7 B;  2DX5 B;  3GOE A;  2LJ5 A;  1FXT B;  5DPT A;  3U30 A;  4DHZ E;  2KFJ A;  2EKE C;  2OOB B;  4ICU A;  5DPR A;  2KO3 A;  2LRU A;  3ZUN A;  4B6W A;  4FJY A;  3ZNG C;  5E6O A;  3ZO5 B;  5JHA A;  2JVC A;  3PGE A;  2ZNV B;  1QZE A;  3Q3J A;  2KFK B;  2DYM A;  3PPA A;  4B9K A;  2MBH A;  2K8H A;  5DCN A;  1C1Y B;  3ONS A;  3NZU A;  2O2V A;  5CX3 A;  4DDI D;  1V5T A;  2G4S A;  2ZVN A;  3RZW C;  1U4A A;  2IZV B;  3W1S C;  4KIK B;  2KLG A;  2LVO A;  4WJQ A;  3BY4 B;  1WIA A;  3OJ4 B;  2UYZ B;  2DEN B;  2BYV E;  2A5U A;  2IO3 B;  1YQB A;  1LQB A;  5CTR C;  1WM2 A;  4EZJ A;  3H7P B;  4NAW B;  4NPN A;  3NZS A;  2JT4 B;  1GUA B;  2MP2 A;  1XQQ A;  3ZW3 A;  2N7E A;  1XT9 B;  2NS5 A;  4B95 A;  3DCG A;  1UBI A;  2DYB A;  2EMT A;  3PRM B;  5D94 A;  2N9E B;  4BKG A;  1EF1 A;  2FIF A;  3NY5 A;  4W9F A;  1UZX B;  2NBV B;  1WX8 A;  4WJO A;  1IPG A;  5D2M B;  1RLF A;  4GIV A;  3L08 A;  4LCD E;  2NBW B;  3PT2 B;  5C1Z A;  3CST A;  3DDC B;  2Y5B B;  4FJZ A;  2FAZ A;  5J2R A;  3VUW A;  1ZKH A;  3B0A A;  1E7U A;  3PRE A;  3PS6 A;  3EEC A;  2LRW A;  3LJ3 A;  2CR5 A;  2V3S A;  4G11 A;  4K7U A;  1WJN A;  2JXX A;  4X57 B;  1C3T A;  2YVC A;  4FLH A;  4WJP A;  1WX7 A;  2KK8 A;  2KWC A;  3KW5 B;  2L76 A;  1GJZ A;  1EO6 A;  4WWP A;  2IY0 B;  2M1M A;  2GBR A;  3JSV B;  3AU5 A; 
#chains in the Genus database with same CATH topology
 3ZTC A;  3I5J C;  3N20 C;  2NCN A;  1VZ7 A;  3EGR A;  1NBF C;  4G3X B;  4XX5 A;  3DHH C;  1HTO A;  2IGH A;  1HE8 A;  4BKT A;  4LNF A;  3DHI C;  1NI2 A;  2CS4 A;  4HEA 1;  4KVG B;  1F9J A;  1VR9 A;  3VTV A;  1WMH A;  4NAM A;  4EE2 A;  3DQV A;  3PSE B;  2FCM A;  1YX6 B;  1I4H A;  4YWG G;  4NQL B;  4CHK A;  4C4V A;  1MG8 A;  2YEP F;  1IUE A;  3FIL B;  1WRD B;  2M17 A;  4IKG A;  4YSZ B;  1DOX A;  4BKS A;  3PHW B;  2N1W A;  3PVL A;  1WH3 A;  1V97 A;  2BB6 A;  4JPS A;  4XDD A;  2BYF A;  2V1Y A;  4PS8 A;  1EF5 A;  2WXJ A;  5GXG B;  3W1S A;  3N9Y C;  1SSN A;  2KDI A;  2L00 B;  3ZJT A;  3VR9 B;  1TT5 B;  1DYQ A;  4YTN B;  1AN8 A;  2LEK A;  2YLM A;  4JX1 C;  1C79 A;  2UWQ A;  1XLN A;  2N4F A;  1WGH A;  4BAX A;  1K53 A;  3NOB A;  3ZXV A;  2L0T A;  4ACF A;  3B2G A;  3FKY A;  2D5G A;  1VD2 A;  1MVK A;  3QX1 A;  2N7J A;  3B1L X;  2WXQ A;  4J6I A;  5IA7 A;  3PZ7 A;  3WAO A;  1GC7 A;  2N9P C;  2KZR A;  3CWI A;  4WQO B;  4P1B C;  3V05 A;  1YJ1 A;  2L7R A;  5FR6 A;  1FD6 A;  4FBJ B;  2TSS A;  3DBL B;  2PLP A;  3Q3F A;  4RFB A;  2LVP A;  1OGW A;  3IFW B;  2G3Q B;  4AUQ C;  2KJH B;  3PLV A;  2WXN A;  1KTK A;  2RD0 A;  3DBS A;  2OED A;  1JCK B;  1JWM D;  2KXJ A;  1L0V B;  1R4N I;  1TKE A;  3A9J A;  5EDS A;  4WWN A;  4XGA B;  2JXT A;  1P1A A;  2WX1 A;  3QQ8 B;  1I4P A;  4IM2 A;  2JZ3 B;  3TEX A;  2JYT A;  4PK1 A;  1PGA A;  2K6Q A;  2KT7 A;  2K6D B;  2WX0 A;  3RUL A;  4E74 A;  2I1J A;  1XCQ L;  4JWU C;  1B1Z A;  2K25 A;  1TYG B;  2R2Q A;  4GU2 A;  1RFA A;  4NQK E;  2LFI A;  2L52 A;  1D3Z A;  4XZ4 A;  2AX5 A;  4AOF A;  3OG5 A;  2XN9 C;  4RGN A;  4HCN B;  1FCL A;  2XEW A;  1I35 A;  2LZ6 A;  4LNN A;  4GMV A;  3Q69 A;  4MAC A;  2IO0 B;  2NVU I;  3Q14 C;  2IGD A;  1V8C A;  3P1M A;  3URY A;  4BFR A;  1V1O A;  3VAW A;  1SJE D;  1P98 A;  3M62 B;  1STE A;  2BWE S;  2J53 A;  3MJ5 A;  3NRZ A;  2C7N B;  1IP9 A;  3V6C B;  4HPL B;  2PPH A;  5IO9 A;  3DBR I;  3AE1 B;  3T8M A;  2VRR B;  2QIL A;  4M8N A;  1ROE A;  2HD5 B;  5AZH A;  4TMA B;  1KH0 A;  3L13 A;  3S2A A;  3RPF C;  2G1E A;  1G6J A;  2JUO A;  1SJH D;  2IO1 B;  1KM7 A;  4W9H A;  3M95 A;  1JRU A;  1F2R C;  5C3J B;  2LWP A;  1E10 A;  4AJY B;  4W9C A;  2IYD B;  2O6V B;  4M0W B;  1T3Q A;  1N62 A;  2AWT A;  1EU3 A;  2K39 A;  3R2I A;  2OJR A;  1WE7 A;  4MGZ E;  3MHS D;  3IG3 A;  2W82 A;  2FNJ B;  2MWS B;  5FK9 C;  3DVG X;  3MHZ A;  1L6U A;  2VH1 A;  1PYW D;  3Q3O C;  4DXG A;  4GB9 A;  3AEF B;  1E7V A;  3BWU D;  4IWP A;  2BS2 B;  2KTR A;  1Y8R C;  2N9K A;  3AE5 B;  1GB4 A;  1GB1 A;  4TV3 A;  1WXA A;  1WR1 A;  1UNS A;  3DBH I;  1GC6 A;  2KDB A;  3HVD A;  1VCB A;  1ZE3 D;  3KH0 A;  1WX9 A;  4WIP A;  5E6J A;  1V80 A;  4W9K A;  2RDG A;  2K0P A;  1SIF A;  2LXC A;  4NZL B;  4W9I A;  2JRH A;  4PS3 A;  1MG4 A;  4MJS A;  2V9H A;  4KDI C;  4W9G A;  1X1M A;  3QAR A;  3CMM B;  2PMV A;  1ENF A;  3ECI A;  3AUL A;  1ZPS A;  2LGS A;  2KN5 A;  3SFD B;  3AED B;  4JGH B;  5D3I B;  2DLB A;  3N3K B;  3APD A;  1PGB A;  2WYQ A;  1WMH B;  2X8X X;  4GN1 A;  3IT6 B;  4BBN C;  4N6E B;  2MRP A;  4M8M A;  3ZDM C;  2XK5 B;  2KC2 A;  1KOT A;  3P4S B;  4LDT D;  3TSS A;  2ZJD A;  3W5U B;  1FIQ A;  1HEZ E;  1LXD A;  3KWV A;  1V86 A;  1P7F A;  2QSD A;  4ASW C;  1R4M B;  2K9X A;  3GB1 A;  1IYF A;  4MGY E;  3MP9 A;  3A1Q A;  1L5P A;  3BIN A;  4MEL A;  4MGK E;  2HTM E;  2GB1 A;  1OQY A;  2J4X A;  1Q0W B;  3ENE A;  2WWZ A;  2JWZ A;  3QIJ A;  4RM9 A;  3L54 A;  1E90 A;  4JQW C;  5HFY A;  4HLE A;  4C4V B;  1WWT A;  3ALB A;  4JLC A;  2PE9 A;  1FPY A;  2J0M A;  2PKO A;  4LJP B;  3VHT C;  2RGF A;  3KUD B;  4ANX A;  3KWL A;  1R4N B;  3NVY A;  2EMS A;  4NJC A;  3NS8 A;  1OQR A;  2RSU A;  2VH2 A;  4B0E A;  2IPK D;  5T8I A;  2RPV A;  3L17 A;  1QQR A;  2LJ5 A;  2Y5P A;  2WU2 B;  3ZO5 B;  1FRD A;  2DYM A;  2MBH A;  5DCN A;  1QT9 A;  1C1Y B;  1I7H A;  4DDI D;  1NYR A;  2G4S A;  2ZVN A;  3RZW C;  1U4A A;  4LTU A;  3ZYY X;  2YEP B;  1K51 A;  2KLG A;  4WJQ A;  2QCZ A;  1NEN B;  1WRI A;  1FFV A;  4OW0 A;  1XQQ A;  2NS5 A;  3AE2 B;  1UBI A;  1UF0 A;  2DYB A;  3AEE B;  5D94 A;  3NY5 A;  5D2M B;  2FUG 1;  1RLF A;  4AS1 A;  3DDC B;  1K52 A;  2HJ1 A;  2Y5B B;  4RF0 A;  3LJ3 A;  3W2D A;  1GJZ A;  1EO6 A;  2JSV X;  4BZA A;  1FXI A;  5TSS A;  1SF0 A;  4D2K A;  1WGY A;  1NVI D;  2WNM A;  3KQ4 A;  2BKF A;  2O2V B;  3J9C A;  1EWC A;  3PLU A;  2BPS A;  2WXK A;  4MJS B;  1TKG A;  2WXG A;  3T9L A;  1RFK A;  4DXF A;  1K50 A;  4F1S A;  1QKZ A;  2ZZP B;  4DQO C;  2MJD A;  1FMA D;  4A9A A;  1YN4 A;  1SE4 A;  3AEB B;  3BK1 A;  1OFF A;  1S1Q B;  4W9J A;  3B08 A;  2DYO A;  2KKC A;  1OEY A;  4TKN A;  2AQ2 B;  1Q1O A;  2PIA A;  4HKZ E;  2BWF A;  3Q3M C;  4BKS D;  4KIK A;  3C19 A;  3NG0 A;  3D32 A;  3EFC A;  3ZLZ A;  1F1H A;  2ZVO A;  3H8H A;  2VZK B;  5JXV A;  4A20 A;  3Q8E A;  4J3O D;  4ZHP A;  2MBQ A;  2WHI A;  2X38 A;  3P4Q B;  4KKJ A;  1J7B A;  1FM0 D;  3NJT A;  1ZDX A;  4KSL C;  2QC8 A;  2KQ4 X;  4CYE A;  3L0W B;  3UF8 A;  3GS2 A;  4GLS C;  3VVW B;  1YQ3 B;  3BYY B;  5BMG A;  2GBK A;  3L16 A;  4KKI A;  4BOZ B;  2PE6 B;  1FNW A;  4LJO B;  3IVF A;  4C7Y A;  1WM3 A;  2W54 A;  2N9L A;  4EEW A;  2WXP A;  4OZB A;  3EHV A;  1VRA B;  2BBC A;  3IHP C;  2ZCC A;  2GBN A;  1P3Q U;  1WSP A;  2JZZ A;  1V5O A;  3I9V 1;  1TS2 A;  2JY6 A;  1TGZ B;  3V62 A;  2NMQ A;  1Z5S B;  5CHF A;  2MH7 A;  2BTE A;  2ZNV C;  1F77 A;  2Z0E B;  1FNU A;  3SDL C;  4KZC A;  1TTN A;  3WIM A;  1TY2 A;  1PFD A;  2AEH A;  4HPM B;  1SE3 A;  3W1Y A;  2CHZ A;  2D10 A;  2Z59 B;  4TSS A;  2J42 A;  1CQV A;  1XXG A;  3KYD D;  2MA9 B;  4A8X C;  3QJZ A;  1BXT A;  4XC2 A;  2D3G A;  2L8J A;  3WCQ A;  5IAA C;  2DHZ A;  2INP E;  4NNJ B;  2DAF A;  2KX0 A;  4ANU A;  2WXM A;  1HZ6 A;  1N6Z A;  2H89 B;  4C7Z A;  3VH3 B;  3K9P B;  2INC C;  1N61 A;  2IO2 B;  2QIE B;  1MJD A;  1C78 A;  4II3 B;  4P1C C;  2LD9 A;  1L2N A;  4KGR A;  3A4R A;  1D5M C;  4YT0 B;  4YTM B;  1GPX A;  1TBE A;  1V1P A;  3HM6 X;  3EA6 A;  3Q2A C;  2MQJ A;  5H92 C;  3RUI B;  3UGB B;  3LDZ E;  2GLS A;  2E3T A;  4EZL A;  2G45 B;  3TEZ A;  2M0X A;  4MH0 E;  3RNE C;  2Y5C A;  3QWZ B;  1YN3 A;  2KD0 A;  4JIO U;  3P4P B;  2JZP A;  3ZNZ B;  2KWD A;  4WWM A;  3W5V B;  2JF5 A;  1IGD A;  3BK2 A;  1GG3 A;  1FFU A;  1L0X B;  1JWA D;  2N7D A;  3N32 A;  3BII D;  3RNB C;  3JSV A;  3A9K B;  3TL5 A;  1J0G A;  4MM3 A;  1C77 A;  1DOI A;  1R4M I;  1E5W A;  1AW7 A;  2V3P A;  4EOY A;  4MDK E;  4P7I A;  4AQ7 A;  4A3O A;  5AUI A;  2KJ6 A;  4LDT B;  3NHE B;  4IWQ A;  3TIX A;  5JHB A;  1L4D B;  1WY8 A;  3AEC B;  3AEG B;  1TS4 A;  4IOI E;  4OVV A;  4IM0 A;  2KQ7 A;  3ZNI D;  4GOC A;  4R3D A;  1ZOY B;  3LXF A;  5JH5 C;  2Z0D B;  1WR6 E;  4HKQ A;  2NPT A;  1Y56 A;  2L83 A;  4W9E A;  1S3S G;  2NR2 A;  2SAK A;  3NVV A;  4CO7 A;  1V6E A;  3CF6 E;  3N1Y C;  2V4I B;  5HHD G;  2BF8 B;  3DVN V;  3DBL I;  3U7D A;  4HDQ A;  1ZUD 2;  3TJP A;  5GMV A;  2LUE A;  1L4Z B;  2LVQ A;  5G55 A;  1E8Y A;  1WFY A;  3L10 B;  4W9D A;  1N5X A;  2K5P A;  1MFW A;  1ET9 A;  2CHX A;  4KSK C;  2BS4 B;  2C5L C;  4W9L A;  2CJN A;  3HIZ A;  2DBY A;  2CU1 A;  4PT5 A;  3PRP B;  2QHO A;  3VRB B;  1L7Y A;  1T6B X;  4C00 A;  2J52 A;  5BYR A;  2MBB B;  1EUV B;  1SIJ A;  4XYC A;  3ML9 A;  2QEJ C;  3X23 A;  3ZJU A;  1YN5 A;  2W9N A;  3JYU A;  1QOA A;  3VTU A;  2QDF A;  2REX A;  2ICI A;  4EFO A;  1CJE A;  2KWU B;  2L05 A;  2FCN A;  3PZD A;  4WWO A;  4DXA B;  5LXH A;  2LHD A;  1T0R C;  4TQ0 A;  1RYJ A;  2DAJ A;  4A55 A;  4LNO A;  1WXS A;  1WI0 A;  3H9D A;  3RMK C;  3W9C B;  2DX5 B;  2OOB B;  1R7S A;  2LRU A;  4H2A A;  2AQ3 B;  5E6O A;  1F2R I;  1QZE A;  3GE8 C;  1Q10 A;  3PPA A;  3NZU A;  1KLG D;  5CX3 A;  1V5T A;  3W1S C;  2MHJ A;  3OJ4 B;  2UYZ B;  3SEB A;  5CTR C;  3BVM A;  1XCT L;  4NPN A;  3NZS A;  1GUA B;  2MP2 A;  1MPE A;  1HZ5 A;  3DWG C;  2VZK D;  2EMT A;  3PRM B;  1EF1 A;  3T3O A;  3AMZ A;  1UZX B;  2ONQ A;  1JAL A;  1J7A A;  3L08 A;  4LCD E;  2NBW B;  3PT2 B;  2FAZ A;  3RNC C;  3VUW A;  4N59 A;  1E7U A;  4FXC A;  4G11 A;  1M4V A;  2V3S A;  1UUP A;  2JXX A;  2NTS A;  3TUO A;  1N60 A;  1VZ6 A;  4WWP A;  2IY0 B;  2GBR A;  3AU5 A;  3ZQ4 A;  4GDL B;  3ZNH B;  4OHJ A;  5FKA C;  1AYF A;  3Q3N C;  4HVB A;  4ITK A;  2WXI A;  5TR5 A;  2G4D B;  1PQS A;  2EEL A;  2MX2 A;  3DHG C;  4B0M A;  3V3X A;  2H88 B;  3WAL A;  1YOV B;  4G50 A;  3RD2 A;  1J19 A;  1FNV A;  2PVG C;  1L6V A;  4DK5 A;  3RYT A;  3ZIM A;  4KV2 A;  3HUI A;  3BYT B;  2EKI A;  3HK0 A;  5BMH A;  2KTR B;  2XK5 A;  1T5X D;  3Q6B A;  1J8C A;  1BT0 A;  1C4P A;  3IXS A;  4BOS C;  1E6E B;  4ZRI A;  3A9J B;  1XLP A;  1I4G A;  2KJR A;  1JQ4 A;  1RAX A;  2PW9 A;  2SEB D;  4HPP A;  1IBX B;  2ZEQ A;  3GZN B;  5LLI A;  2D11 A;  4UDU C;  3ZRC A;  4HDO A;  3KYC D;  4F8C B;  4I6P A;  3LYY A;  1KRH A;  1OTR B;  1T0Q C;  2BQQ A;  3MC0 B;  1LM8 B;  2AQ1 B;  2C9W B;  5H8Y E;  4YSX B;  1E8Z A;  1SB3 C;  3HRD D;  2KMA A;  4GSW A;  3KVF B;  4ANW A;  1WF9 A;  2RPQ A;  3FIL A;  5IN7 A;  4QAY A;  2WXO A;  3ML8 A;  5AZG A;  4O1N A;  4YSY B;  1PUT A;  4DWF A;  4C56 C;  2BW2 A;  3SHQ A;  1L0Y B;  2K3U A;  2DZJ A;  2WDQ B;  3PV1 A;  1QLB B;  4RMA A;  1I42 A;  4XWW A;  2KYW A;  1KJT A;  2BKR B;  4KGT A;  3A9K A;  3V61 A;  2JX5 A;  2HTH A;  3QA8 A;  4A90 A;  2C7M B;  2MSE D;  2B76 B;  2KLC A;  4FHK A;  2W3R A;  4K1R B;  2MLB A;  4DBG A;  1EU4 A;  3QAQ A;  2M56 B;  1SBB B;  3TCA A;  1E7P B;  2M0A A;  3A1Q B;  4ZRK A;  1FXA A;  4ZRJ A;  3OWE B;  4WQM A;  3UI3 A;  5D3D A;  2M19 A;  3NVW A;  3Q8A A;  4YXD B;  1VLB A;  3A4S C;  4GXB A;  1KLU D;  1V1P B;  1OEY J;  2DZI A;  5J18 A;  3E9S A;  4M0W A;  1ACC A;  2LMC A;  5KHQ A;  1YIW A;  2BYT A;  4XE0 A;  3RNF C;  2Q5W D;  2L32 A;  4LLG M;  2UU7 A;  2ZCB A;  1V9J A;  2AYO B;  3O13 A;  4N58 A;  1JWS D;  4EZK A;  3OAW A;  5CHV C;  4ICV A;  1FO4 A;  5IP4 D;  5EE0 A;  2A4Z A;  2NPT B;  1FEH A;  3AE8 B;  3WA0 A;  1SE2 A;  2CJO A;  5J17 A;  4FHJ A;  4JWS C;  3AE3 B;  3Q8F A;  5I4D A;  1UWM A;  2CKH B;  2C7H A;  1ZW7 A;  3N1X C;  1WGR A;  2GOW A;  4FA6 A;  1M94 A;  2L0F A;  4FUL A;  3H7S A;  3DBR B;  4IDI A;  2BS3 B;  2I38 A;  2KFK A;  1IGC A;  2JPH A;  2KDE B;  4L23 A;  4BBN F;  2K1F A;  2ZPN A;  2ACZ B;  4IM3 A;  1P7E A;  3R66 C;  3UIO B;  4ARC A;  1E8W A;  1UWX A;  2B3A A;  4I6L B;  2K22 A;  4GDK A;  3HHM A;  2MP2 B;  3GE3 C;  3PZ8 A;  3MC8 A;  1ZP0 B;  2WGS A;  4KZ0 A;  4XDC A;  2GRI A;  3VH4 B;  4LNK A;  2WXF A;  1P0R A;  3AV8 A;  4HK2 A;  2KMC A;  4GDL A;  2J0K A;  4NJ7 A;  4ZYS A;  2C60 A;  1QOG A;  4HRO A;  2O6V D;  2R2O A;  1UEL A;  1CMX B;  1HA5 A;  4NJ6 A;  3IBE A;  2IDY A;  4EKU A;  1WGD A;  4I6N B;  2MJ3 A;  2R61 A;  3VXW A;  3SD5 A;  2KAC A;  1T0Y A;  3DVG Y;  2LAS A;  3R7Q A;  4RNA A;  1GOZ A;  2JQR B;  3K9O B;  2PTL A;  2WLB A;  2KX3 A;  2IBI B;  4US8 A;  4GGQ A;  1V81 A;  1NDD A;  5JHA A;  2ON8 A;  5C23 A;  4FJV B;  3U52 E;  1E9M A;  2MBO A;  3SFE B;  1IBX A;  4MT5 A;  1TIF A;  1VZ8 A;  1I4R A;  2DNF A;  2LGY A;  2MCN B;  2KHW B;  2WQY B;  4RM8 A;  4PYZ A;  3VUY A;  1XD3 B;  3PRZ A;  1EWY C;  4RGO S;  2OJW A;  1A70 A;  3R7R A;  4YTP B;  5BYS A;  2FID A;  4Q2J A;  4F7Z A;  3NS1 A;  4MGI E;  1JRO A;  5EE3 A;  1WGK A;  3OLM D;  2I1K A;  2HJ8 A;  2N9X A;  3AI5 A;  3Q8C A;  3SR6 A;  3PTF C;  1WZ3 A;  2DZK A;  3WAN A;  3KLS X;  4TUU A;  5L83 A;  2RR9 A;  3N1Z C;  3NVZ A;  4L1B A;  1WZ0 A;  1TZO A;  4K3B A;  2M4N A;  4URK A;  2KDM A;  4MEM A;  3P4R B;  1ESF A;  3DOW A;  2MJE A;  3E56 A;  4ANV A;  3L4P A;  3MC9 A;  4DDG D;  5KHO A;  2FUH B;  3A33 B;  3MJW A;  1QOF A;  5DPS A;  3BZD B;  3AE9 B;  5C2T B;  4IC7 B;  4ARI A;  2EKE C;  1TKY A;  1YQ4 B;  4ICU A;  3ZUN A;  4KX6 B;  4B6W A;  5HG2 A;  3T3N A;  3PGE A;  4B9K A;  2K8H A;  3U4E G;  1LO5 D;  3AE6 B;  3ONS A;  4ZRP A;  4M01 A;  2IZV B;  4KIK B;  3BY4 B;  2CU3 A;  1TY0 A;  2BYV E;  2A5U A;  2BT6 A;  2IO3 B;  1D5Z C;  1LQB A;  4M00 A;  1WM2 A;  4EZJ A;  3H7P B;  4NAW B;  2JT4 B;  1HQR D;  3I63 C;  1XT9 B;  4B95 A;  3DCG A;  1JWB D;  2FIF A;  2NBV B;  1WX8 A;  5LNK 1;  1I4Q A;  4WJO A;  1XO3 A;  3U2S C;  1VDV A;  5C1Z A;  3CST A;  3MFG A;  4RF1 A;  1ZKH A;  3B0A A;  2IND C;  2WXL A;  3PS6 A;  3EEC A;  2LRW A;  1E0Z A;  2CR5 A;  4K7U A;  1WJN A;  1ZXI A;  5IKC M;  4M02 A;  2YVC A;  1WX7 A;  3KW5 B;  1ZXH A;  3JSV B;  3PO0 A;  2BB5 A;  4GDK B;  4MSQ B;  1K8R B;  5CHW A;  1C4A A;  2HDE A;  4WJN A;  1B9R A;  1KLV A;  2WDR B;  3FC4 A;  1UBQ A;  1JRP A;  5E6P A;  3VQI A;  2WXH A;  1SEB D;  4NY0 A;  1ISN A;  3ZVV A;  1SE9 A;  1WJ6 A;  2KVR A;  2LI5 A;  3UQB A;  3H1U A;  3BVG A;  3QC8 B;  1RM6 C;  1XEE A;  2LXA A;  1N63 A;  2O6V A;  5BYQ A;  3RI7 C;  1BUI C;  3R8B A;  4IWO A;  2KAN A;  5JZE B;  1UGM A;  4OVZ A;  4RH6 A;  1V49 A;  3U8Z A;  4HJG E;  3NZ3 A;  2K8B A;  1HXY D;  1KF6 B;  3ABV B;  1D4B A;  3TEW A;  1RRB A;  4ZYN A;  2MEK A;  3VRA B;  3EFU A;  5BO4 B;  2GMI C;  3GP7 A;  5E6N A;  4ZHO A;  1RWS A;  1LGR A;  4AWJ A;  3EUB 2;  5IOI A;  4II2 B;  2RDB C;  4MH8 A;  4IUM B;  2KOX A;  1H8C A;  3QHT A;  1UD7 A;  2JWU A;  4PS7 A;  4E3C A;  3X0W A;  2KVZ A;  3LB8 C;  1YJJ A;  3AE7 B;  3ZKJ C;  1GNU A;  3V60 A;  3Q8B A;  2JYE A;  3C0R B;  2D3B A;  1OQQ A;  3R3M A;  2J7Q B;  3M63 B;  3RCZ A;  5L95 C;  1E8X A;  3TMP B;  4AJW A;  4OVU A;  4RCO A;  3KUZ A;  4USA A;  2W55 A;  4OZA A;  3B9J A;  4RGT A;  2JRI B;  2V4L A;  5AEK B;  2M8S A;  4CQN A;  3JVZ X;  3U7Z A;  1F0Z A;  2QMT A;  1EM7 A;  2LGX A;  2JU6 X;  2GBM A;  4WAA A;  2I2Y A;  3AE4 B;  3APC A;  1YMH E;  4DHJ D;  4IW0 A;  1F52 A;  2GBJ A;  2KNB A;  4ZRQ A;  4AP4 C;  5D6J B;  3TEY A;  1PDX A;  2WDT B;  2KDF B;  3O65 B;  4HCP B;  3TBL D;  2LHE A;  4TQ1 A;  3BVZ A;  3ZTD A;  1ZGU B;  3N30 A;  1MI0 A;  4DHZ B;  1H4R A;  2J0J A;  3NUH B;  2WU5 B;  4REZ A;  3ZDT A;  5AUK A;  4PYU A;  2Z8L A;  3P42 A;  1JWU D;  3QCA A;  3RNG C;  4JE3 B;  3FAH A;  2RMM A;  2PEA A;  3RZF A;  1QOB A;  3UQA A;  1Z2M A;  1NEK B;  4HXD A;  4HRS A;  4N9F 4;  2FCQ A;  3RT3 B;  1YX5 B;  1QIL A;  2D2Q A;  2BGF A;  1YD8 U;  3VTW A;  2WS3 B;  1ET6 A;  2AL6 A;  3IAS 1;  3AXC A;  3AB5 A;  1XLO A;  2IJ0 A;  3KUC B;  4A3P A;  3DPD A;  2OHF A;  2ZW1 A;  1N5W A;  1WYW B;  4P16 A;  2FBW B;  4HJK A;  3B2F A;  3AU4 A;  2KQS A;  2LGD A;  3OJ3 A;  1TZ1 A;  4LNI A;  4A6Q A;  4RGM A;  1VJK A;  2MW5 A;  2BYE A;  3SU8 X;  1WJU A;  3JW0 X;  5BMI A;  2ZPY A;  3WAP A;  1WJ4 A;  3DBH B;  5AZF A;  1AAR A;  2L1A A;  3IAM 1;  2L3Z A;  2E6X A;  1SGH A;  2KTF A;  2LGI A;  1MHX A;  4IG7 B;  2XNA C;  2KN4 A;  2V3N A;  2NTT A;  3R2T A;  1FCC C;  2ASQ A;  2AL3 A;  3M3J A;  2KAJ A;  1WGG A;  3VUX A;  3AEA B;  1J7C A;  5HKH A;  4K7W A;  1KFY B;  2DZM A;  5D7G A;  4MM3 B;  2XBB C;  1DOY A;  1YNT E;  1BML C;  1NYQ A;  4E71 A;  1C76 A;  1T0S C;  1YJI A;  1FRR A;  1TJE A;  3I3T B;  5DPW A;  3APF A;  1UH6 A;  1HTQ A;  2KWV B;  4WUR A;  1XF5 L;  3AH7 A;  4JL9 A;  2PVO D;  2HE7 A;  2N1V A;  3QK0 A;  5G2N A;  3UIN B;  2CHW A;  2PJH A;  3ZRF A;  1WYG A;  3ZGZ A;  3RN9 C;  1A5R A;  3MTN B;  2IY1 B;  4KGS A;  4G0N B;  4EUT A;  1TS3 A;  2MBE A;  1V2Y A;  3HM3 A;  4K81 A;  4BVU C;  2WP9 B;  3EC8 A;  1CZP A;  4HWI B;  3AM9 A;  2LUM A;  4FN2 A;  1D5X C;  2NBU A;  1XLQ A;  2Y3A A;  3DWM A;  4OZC A;  3CSF A;  5G5H A;  2D3C A;  3H6N A;  1SXT A;  1WXM A;  2FE8 A;  4L2Y A;  4WH4 A;  2D07 B;  3VFK A;  2DWQ A;  1WE6 A;  3HVZ A;  3H7P A;  4NAW A;  2FCS A;  3RNA C;  3V6E B;  1PGX A;  4ZOH C;  1NI3 A;  1WXQ A;  1WXV A;  3PHX B;  4DHJ B;  1GAQ B;  3GZN I;  2K8C A;  1C4C A;  4LK0 M;  3I57 A;  5LXI B;  1JW9 D;  4KDL B;  3UIP B;  1LFD A;  1P9D U;  4FAD A;  1C9F A;  3VR8 B;  4C80 A;  4S0R A;  1ZDV A;  2V0G A;  4YL8 A;  3P2B A;  3WAM A;  3ZXR A;  3CIR B;  3DVN U;  1CK1 A;  4MSM B;  1Q5W B;  4K7S A;  2QJL A;  2KC1 A;  2W3S A;  1DGJ A;  3IT4 B;  3ETR A;  4ZDV A;  3VDZ A;  2D3A A;  3GOE A;  5DPT A;  1FXT B;  1QF6 A;  3U30 A;  4DHZ E;  3ZJV A;  2KFJ A;  5DPR A;  2KO3 A;  4FJY A;  3ZNG C;  2JVC A;  3Q3J A;  2ZNV B;  2KFK B;  2ZW0 A;  4S17 A;  2N0S B;  5HI1 A;  2WXR A;  2O2V A;  2LVO A;  1WIA A;  3P63 A;  2DEN B;  3C8Y A;  4WAF A;  1YQB A;  2WDV B;  1JML A;  3ZW3 A;  5FR3 A;  1AWD A;  2N7E A;  2IGG A;  4BKG A;  2KMM A;  2N9E B;  4W9F A;  5MPO A;  1IPG A;  5G5G A;  1I4X A;  2INN E;  4XWT A;  4GIV A;  3RFZ B;  4K3C A;  2GI9 A;  4FJZ A;  5J2R A;  3AN1 A;  2BVC A;  3PRE A;  5EE9 A;  1TS5 A;  4X57 B;  2G9H D;  4US9 A;  1C3T A;  4WJP A;  4FLH A;  1UGJ A;  2KK8 A;  1MHH E;  2KWC A;  2L76 A;  2RDH A;  2LJI A;  1D6E C;  4P6V F;  2M1M A;  5EE1 A; 
#chains in the Genus database with same CATH homology
 4GDL B;  3ZTC A;  3ZNH B;  2NCN A;  4GDK B;  4MSQ B;  1K8R B;  1NBF C;  4HVB A;  4G3X B;  4XX5 A;  5TR5 A;  2G4D B;  1PQS A;  5CHW A;  1WGY A;  1HE8 A;  4WJN A;  4BKT A;  2MX2 A;  1KLV A;  2BKF A;  3WAL A;  1UBQ A;  4G50 A;  3RD2 A;  2O2V B;  5E6P A;  3VQI A;  1J19 A;  1NI2 A;  2CS4 A;  4KVG B;  1F9J A;  3PLU A;  2BPS A;  4NY0 A;  4MJS B;  3RYT A;  3VTV A;  3ZIM A;  4DK5 A;  1ISN A;  4KV2 A;  1WMH A;  3DQV A;  3PSE B;  3ZVV A;  1SE9 A;  2FCM A;  1WJ6 A;  3HK0 A;  3T9L A;  2KVR A;  1YX6 B;  2LI5 A;  2KTR B;  3UQB A;  3H1U A;  4NQL B;  4F1S A;  2ZZP B;  3QC8 B;  2XK5 A;  2LXA A;  1J8C A;  2O6V A;  1BT0 A;  4BOS C;  4CHK A;  1S1Q B;  4ZRI A;  4W9J A;  3A9J B;  4IWO A;  3B08 A;  2KAN A;  5JZE B;  2KJR A;  2DYO A;  1UGM A;  1RAX A;  1MG8 A;  2KKC A;  1OEY A;  1V49 A;  4TKN A;  3U8Z A;  1WRD B;  2ZEQ A;  1Q1O A;  5LLI A;  2D11 A;  2M17 A;  3ZRC A;  4HDO A;  3KYC D;  4F8C B;  2K8B A;  4BKS A;  2BWF A;  4BKS D;  4I6P A;  1OTR B;  4KIK A;  3PHW B;  1RRB A;  2N1W A;  4ZYN A;  3PVL A;  1LM8 B;  1WH3 A;  3D32 A;  3EFU A;  2C9W B;  5BO4 B;  3ZLZ A;  2GMI C;  1E8Z A;  5E6N A;  2BYF A;  2V1Y A;  2KMA A;  4GSW A;  4PS8 A;  1EF5 A;  3KVF B;  4ANW A;  2ZVO A;  1WF9 A;  2RPQ A;  4AWJ A;  3W1S A;  4II2 B;  2KDI A;  2L00 B;  4A20 A;  3ML8 A;  5AZG A;  4IUM B;  2KOX A;  2YLM A;  1H8C A;  3QHT A;  4DWF A;  1UD7 A;  3SHQ A;  2MBQ A;  4PS7 A;  2UWQ A;  4E3C A;  3X0W A;  2DZJ A;  2N4F A;  1WGH A;  3PV1 A;  3NOB A;  4KSL C;  1GNU A;  3ZKJ C;  3V60 A;  4RMA A;  4CYE A;  2L0T A;  1I42 A;  3C0R B;  3L0W B;  3UF8 A;  1KJT A;  2BKR B;  3A9K A;  3V61 A;  3VVW B;  2HTH A;  3QA8 A;  2J7Q B;  2C7M B;  2MSE D;  3M63 B;  3R3M A;  3RCZ A;  5L95 C;  1E8X A;  2KLC A;  2GBK A;  3L16 A;  4FHK A;  3TMP B;  1VD2 A;  3TBL D;  4AJW A;  4K1R B;  3QX1 A;  4OVU A;  2MLB A;  4DBG A;  4BOZ B;  3KUZ A;  2PE6 B;  3B1L X;  4J6I A;  3QAQ A;  3TCA A;  4LJO B;  3IVF A;  1WM3 A;  3A1Q B;  5IA7 A;  4ZRK A;  3WAO A;  1GC7 A;  4EEW A;  2N9P C;  4ZRJ A;  2KZR A;  2JRI B;  2V4L A;  5AEK B;  2M8S A;  3JVZ X;  3EHV A;  4WQO B;  1YJ1 A;  3IHP C;  2L7R A;  2ZCC A;  5FR6 A;  2GBN A;  1P3Q U;  4FBJ B;  2JZZ A;  1V5O A;  3A4S C;  4GXB A;  2JY6 A;  2LGX A;  1TGZ B;  1OEY J;  3Q3F A;  3V62 A;  2LVP A;  2GBM A;  4WAA A;  1OGW A;  3IFW B;  1Z5S B;  2DZI A;  2G3Q B;  3APC A;  5CHF A;  4AUQ C;  2KJH B;  3PLV A;  5J18 A;  4DHJ D;  4IW0 A;  2RD0 A;  5KHQ A;  2GBJ A;  2ZNV C;  2KNB A;  3DBS A;  2Z0E B;  1YIW A;  3SDL C;  4KZC A;  2KXJ A;  1TTN A;  4AP4 C;  3WIM A;  1R4N I;  3A9J A;  5D6J B;  2WDT B;  5EDS A;  2KDF B;  2ZCB A;  3O65 B;  4HCP B;  4WWN A;  1V9J A;  2AEH A;  1P1A A;  2AYO B;  2WX1 A;  3QQ8 B;  4HPM B;  2JZ3 B;  4IM2 A;  4TQ1 A;  3W1Y A;  2CHZ A;  2D10 A;  4EZK A;  2Z59 B;  3OAW A;  5CHV C;  3ZTD A;  2K6Q A;  2K6D B;  4ICV A;  1ZGU B;  3N30 A;  3KYD D;  2WX0 A;  2MA9 B;  2A4Z A;  3RUL A;  3QJZ A;  4E74 A;  2I1J A;  2NPT B;  4DHZ B;  1H4R A;  2J0J A;  3WA0 A;  5J17 A;  4XC2 A;  2D3G A;  2L8J A;  4FHJ A;  3ZDT A;  5IAA C;  2DHZ A;  2K25 A;  4NNJ B;  2CKH B;  2C7H A;  1ZW7 A;  2DAF A;  2KX0 A;  1RFA A;  2R2Q A;  4GU2 A;  4NQK E;  4PYU A;  4ANU A;  1D3Z A;  4XZ4 A;  3QCA A;  1WGR A;  2GOW A;  4FA6 A;  4AOF A;  1M94 A;  2L0F A;  3VH3 B;  4FUL A;  3K9P B;  2IO2 B;  3H7S A;  4II3 B;  4HCN B;  2LD9 A;  2PEA A;  3RZF A;  2XEW A;  1L2N A;  2KFK A;  3A4R A;  2JPH A;  1I35 A;  2LZ6 A;  2KDE B;  1Z2M A;  4GMV A;  4BBN F;  3UQA A;  2K1F A;  1TBE A;  2ZPN A;  4HXD A;  4N9F 4;  2FCQ A;  3RT3 B;  1YX5 B;  4IM3 A;  2IO0 B;  3HM6 X;  2NVU I;  3R66 C;  3UIO B;  2D2Q A;  2BGF A;  1YD8 U;  3VTW A;  4BFR A;  2MQJ A;  1E8W A;  3RUI B;  2B3A A;  3VAW A;  4I6L B;  1P98 A;  3LDZ E;  3M62 B;  2AL6 A;  4GDK A;  3UGB B;  3AXC A;  2BWE S;  3HHM A;  2MP2 B;  2C7N B;  3KUC B;  1IP9 A;  3V6C B;  4EZL A;  4A3P A;  2G45 B;  4HPL B;  2PPH A;  2M0X A;  3DPD A;  4MH0 E;  3DBR I;  1WYW B;  3QWZ B;  3T8M A;  2KD0 A;  2VRR B;  4JIO U;  4HJK A;  3AU4 A;  4M8N A;  2HD5 B;  2KQS A;  2LGD A;  3OJ3 A;  1TZ1 A;  4KZ0 A;  5AZH A;  3L13 A;  3ZNZ B;  3S2A A;  3VH4 B;  1G6J A;  2JF5 A;  1P0R A;  2MW5 A;  2BYE A;  2JUO A;  1WJU A;  4HK2 A;  3JW0 X;  3SU8 X;  2KMC A;  2ZPY A;  4GDL A;  1WJ4 A;  2IO1 B;  1GG3 A;  1KM7 A;  4W9H A;  3WAP A;  3M95 A;  1JRU A;  2J0K A;  4NJ7 A;  5AZF A;  2C60 A;  1AAR A;  2N7D A;  2O6V D;  2LWP A;  2L3Z A;  2R2O A;  3N32 A;  4W9C A;  4AJY B;  1SGH A;  1UEL A;  1CMX B;  2IYD B;  3JSV A;  4NJ6 A;  2O6V B;  3A9K B;  2KTF A;  3TL5 A;  4M0W B;  4IG7 B;  1J0G A;  4MM3 A;  1R4M I;  2AWT A;  3IBE A;  4EKU A;  1E5W A;  1WGD A;  4I6N B;  4EOY A;  4MDK E;  2K39 A;  4P7I A;  3VXW A;  2ASQ A;  3SD5 A;  1T0Y A;  2AL3 A;  2OJR A;  3DVG Y;  4A3O A;  3M3J A;  2LAS A;  1WE7 A;  1WGG A;  2KJ6 A;  4MGZ E;  3R7Q A;  4LDT B;  3MHS D;  3VUX A;  3IG3 A;  3NHE B;  4IWQ A;  3TIX A;  2FNJ B;  2MWS B;  3DVG X;  5HKH A;  4K7W A;  2DZM A;  5JHB A;  1WY8 A;  5D7G A;  2XBB C;  4GB9 A;  1E7V A;  3K9O B;  4IWP A;  2KTR A;  1Y8R C;  4E71 A;  2KX3 A;  4OVV A;  4IM0 A;  2KQ7 A;  1WR1 A;  1WXA A;  4TV3 A;  2IBI B;  3DBH I;  3I3T B;  4GOC A;  3ZNI D;  3APF A;  5DPW A;  1UH6 A;  1GC6 A;  2KDB A;  2KWV B;  5JH5 C;  1VCB A;  3KH0 A;  4JL9 A;  1WX9 A;  4GGQ A;  2Z0D B;  2N1V A;  1V81 A;  1NDD A;  1V80 A;  2HE7 A;  3QK0 A;  5C23 A;  4FJV B;  1WR6 E;  4W9K A;  5G2N A;  2CHW A;  3UIN B;  2NPT A;  2NR2 A;  1S3S G;  1SIF A;  2LXC A;  2MBO A;  2PJH A;  4W9E A;  3ZRF A;  4W9I A;  4CO7 A;  1V6E A;  2JRH A;  3CF6 E;  4PS3 A;  4MJS A;  1A5R A;  2MCN B;  2LGY A;  3MTN B;  2IY1 B;  4KDI C;  4W9G A;  4G0N B;  4EUT A;  2KHW B;  1X1M A;  2BF8 B;  3DVN V;  3QAR A;  4PYZ A;  3DBL I;  4RM8 A;  1XD3 B;  3PRZ A;  3VUY A;  3CMM B;  2MBE A;  1V2Y A;  3ECI A;  3HM3 A;  3AUL A;  4K81 A;  3R7R A;  3U7D A;  4BVU C;  2FID A;  2KN5 A;  4HDQ A;  3EC8 A;  3TJP A;  4F7Z A;  5GMV A;  4JGH B;  4MGI E;  2LUE A;  4HWI B;  3N3K B;  3OLM D;  3APD A;  2I1K A;  2WYQ A;  1WMH B;  4FN2 A;  2LVQ A;  5G55 A;  1E8Y A;  1WFY A;  2NBU A;  3L10 B;  4GN1 A;  2HJ8 A;  2N9X A;  4W9D A;  3AI5 A;  4BBN C;  2CHX A;  3CSF A;  4KSK C;  2C5L C;  2MRP A;  4W9L A;  4M8M A;  3HIZ A;  3PTF C;  1WZ3 A;  3ZDM C;  2XK5 B;  2DZK A;  3H6N A;  2KC2 A;  3WAN A;  1KOT A;  1WXM A;  2CU1 A;  4TUU A;  3PRP B;  2QHO A;  5L83 A;  2D07 B;  2RR9 A;  4LDT D;  2ZJD A;  3VFK A;  1L7Y A;  1WE6 A;  3H7P A;  1LXD A;  4NAW A;  2MBB B;  1EUV B;  2FCS A;  1WZ0 A;  3ML9 A;  3V6E B;  3X23 A;  1V86 A;  4ASW C;  1WXV A;  2W9N A;  3JYU A;  3VTU A;  1IYF A;  3PHX B;  4MGY E;  4DHJ B;  3GZN I;  2K8C A;  2M4N A;  3A1Q A;  2REX A;  4EFO A;  3BIN A;  4MEL A;  4MGK E;  4KDL B;  5LXI B;  2KWU B;  1LFD A;  2L05 A;  3UIP B;  4URK A;  1P9D U;  2FCN A;  4FAD A;  1OQY A;  3PZD A;  4MEM A;  1Q0W B;  3ENE A;  2WWZ A;  3DOW A;  4WWO A;  2JWZ A;  4DXA B;  3QIJ A;  4RM9 A;  3L54 A;  1E90 A;  4JQW C;  5LXH A;  4YL8 A;  4ANV A;  4HLE A;  3ALB A;  3P2B A;  4JLC A;  4TQ0 A;  2PE9 A;  4DDG D;  5KHO A;  2FUH B;  2J0M A;  2DAJ A;  3WAM A;  3A33 B;  3MJW A;  4LJP B;  3VHT C;  2RGF A;  3KUD B;  4ANX A;  1WXS A;  3DVN U;  4MSM B;  1WI0 A;  5DPS A;  1Q5W B;  2EMS A;  4K7S A;  2KC1 A;  3NS8 A;  3H9D A;  2RSU A;  4ZDV A;  3VDZ A;  3L17 A;  4IC7 B;  2DX5 B;  3GOE A;  2LJ5 A;  1FXT B;  5DPT A;  3U30 A;  4DHZ E;  2KFJ A;  2EKE C;  2OOB B;  4ICU A;  5DPR A;  2KO3 A;  2LRU A;  3ZUN A;  4B6W A;  4FJY A;  3ZNG C;  5E6O A;  3ZO5 B;  5JHA A;  2JVC A;  3PGE A;  2ZNV B;  1QZE A;  3Q3J A;  2KFK B;  2DYM A;  3PPA A;  4B9K A;  2MBH A;  2K8H A;  5DCN A;  1C1Y B;  3ONS A;  3NZU A;  2O2V A;  5CX3 A;  4DDI D;  1V5T A;  2G4S A;  2ZVN A;  3RZW C;  1U4A A;  2IZV B;  3W1S C;  4KIK B;  2KLG A;  2LVO A;  4WJQ A;  3BY4 B;  1WIA A;  3OJ4 B;  2UYZ B;  2DEN B;  2BYV E;  2A5U A;  2IO3 B;  1YQB A;  1LQB A;  5CTR C;  1WM2 A;  4EZJ A;  3H7P B;  4NAW B;  4NPN A;  3NZS A;  2JT4 B;  1GUA B;  2MP2 A;  1XQQ A;  3ZW3 A;  2N7E A;  1XT9 B;  2NS5 A;  4B95 A;  3DCG A;  1UBI A;  2DYB A;  2EMT A;  3PRM B;  5D94 A;  2N9E B;  4BKG A;  1EF1 A;  2FIF A;  3NY5 A;  4W9F A;  1UZX B;  2NBV B;  1WX8 A;  4WJO A;  1IPG A;  5D2M B;  1RLF A;  4GIV A;  3L08 A;  4LCD E;  2NBW B;  3PT2 B;  5C1Z A;  3CST A;  3DDC B;  2Y5B B;  4FJZ A;  2FAZ A;  5J2R A;  3VUW A;  1ZKH A;  3B0A A;  1E7U A;  3PRE A;  3PS6 A;  3EEC A;  2LRW A;  3LJ3 A;  2CR5 A;  2V3S A;  4G11 A;  4K7U A;  1WJN A;  2JXX A;  4X57 B;  1C3T A;  2YVC A;  4FLH A;  4WJP A;  1WX7 A;  2KK8 A;  2KWC A;  3KW5 B;  2L76 A;  1GJZ A;  1EO6 A;  4WWP A;  2IY0 B;  2M1M A;  2GBR A;  3JSV B;  3AU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...