4KV2A

Ubiquitin-like domain of the mycobacterium tuberculosis type vii secretion system protein eccd1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
90
structure length
90
Chain Sequence
MATTRVTILTGRRMTDLVLPAAVPMETYIDDTVAVLSEVLEDTPADVLGGFDFTAQGVWAFARPGSPPLKLDQSLDDAGVVDGSLLTLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords ESX-1 secretion system protein eccD1
publication title Structures of EccB1 and EccD1 from the core complex of the mycobacterial ESX-1 type VII secretion system.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 16
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4kv2A00
1WGDA 3TMPB 2FCMA 3QJZA 2KZRA 3A9KA 2A5UA 2GBJA 3ZNGC 4MSMB 2LJ5A 4GDLB 2ZZPB 3CMMB 3H7SA 3ZIMA 1WX9A 3WANA 3KVFB 1S1QB 3WAOA 3PS6A 4GU2A 4B9KA 2C7MB 4TV3A 1E8ZA 4LDTB 4GDKA 3VUWA 2CS4A 4JIOU 5J2RA 2MBBB 3A1QB 4FULA 2AL3A 4GXBA 2FCQA 2JPHA 4DHJB 2DZJA 2LZ6A 3DQVA 1WYWB 3A33B 2LWPA 3JSVA 2LD9A 3U7DA 5GMVA 4MJSB 3VTUA 5IA7A 2MBEA 2N4FA 2A4ZA 2WYQA 1TZ1A 4MSQB 2K6DB 1P1AA 2GBNA 4NQLB 5AZFA 2KJRA 2DENB 2MBHA 2REXA 3EHVA 3H7PB 4BFRA 5KHQA 3IHPC 3AULA 4OVUA 3ZRCA 1A5RA 2RD0A 4HXDA 3ZKJC 3JVZX 2W9NA 3BY4B 3TBLD 2KFKA 4JQWC 2GOWA 1WFYA 2C7NB 2KNBA 2ZJDA 3UQBA 2EMSA 2LVOA 2YLMA 2KWVB 5E6NA 1WGRA 1R4MI 4FJZA 1WGYA 3UIPB 4G11A 3UGBB 4PS3A 3B1LX 3GOEA 1J8CA 1LFDA 2AL6A 2FIDA 2AYOB 2KTFA 1V86A 4ZYNA 4MEMA 4LCDE 2QHOA 3IVFA 4GN1A 2DAFA 3S2AA 4IUMB 1WY8A 4BKGA 2IO1B 1TGZB 4IW0A 4ANVA 2K8BA 1H8CA 1WRDB 2PPHA 3A4SC 2KQSA 4NQKE 2JUOA 5CX3A 2J0JA 2OJRA 2NPTB 3ZDMC 2HD5B 1YIWA 3APCA 4WWNA 3H6NA 1YJ1A 1F9JA 3W1SC 4EEWA 4DDGD 1XT9B 2KN5A 3PLVA 4ZRKA 4NPNA 4MH0E 4WJOA 1WX7A 3EFUA 3TL5A 1E8XA 2K39A 4GIVA 5LXIB 1TBEA 3UINB 4BBNC 1I35A 1E90A 3IG3A 4K81A 2JZZA 2KDFB 2J0KA 4XX5A 3RYTA 5JHBA 1KOTA 4OVVA 1EUVB 4MDKE 3PSEB 5AEKB 4I6PA 2HJ8A 3ML9A 3PVLA 3SDLC 3OLMD 2FUHB 2IY0B 4NAWA 3R7QA 2WDTB 1E7VA 1H4RA 1UD7A 3WIMA 2OOBB 3NHEB 3RULA 3AXCA 1NBFC 2UWQA 3DDCB 4AOFA 2JRHA 1XD3B 2N1WA 2ZVOA 1KJTA 3DVGY 3PPAA 2IY1B 3PHXB 4F1SA 2IO3B 3MJWA 4E71A 2C7HA 3VQIA 2C9WB 2FNJB 1WXMA 4BKSD 1WR6E 1FXTB 4B95A 2JVCA 3CF6E 3W1SA 4W9HA 1D3ZA 1V49A 3DBHI 2WX0A 4W9EA 2V3SA 4W9GA 1YQBA 2LGXA 2EKEC 1NI2A 2J0MA 2ZPNA 1WXAA 1UZXB 2KDIA 2D3GA 4MELA 1OGWA 4HLEA 2Z0EB 1T0YA 1V81A 2IO0B 2KC2A 3IFWB 1WM2A 3VDZA 2ZNVC 1J0GA 4E74A 3B08A 3P2BA 1UELA 3IBEA 3HK0A 3PLUA 3PREA 4K1RB 3DBSA 1WMHA 4CYEA 2FCNA 2IZVB 4F8CB 3M62B 1SE9A 2KO3A 2DAJA 3U8ZA 4W9LA 2KX0A 2KWUB 4GDKB 4WJNA 3R3MA 4DHJD 4IWPA 4DK5A 3VTVA 4B6WA 1VD2A 2M8SA 4DXAB 1SIFA 4URKA 3MTNB 5G55A 2Z59B 4AJYB 2KVRA 2LXAA 2BPSA 3T8MA 2NCNA 5CTRC 2KXJA 4N9F4 1UBQA 1ISNA 3ZTCA 4A3PA 3L17A 5E6PA 1M94A 3GZNI 4ZDVA 3QAQA 1MG8A 2KQ7A 4DDID 4XZ4A 4DHZE 4PS8A 3T9LA 4W9DA 1E8WA 2MW5A 3QC8B 4CO7A 2DZMA 3VUXA 3QX1A 1WE6A 2KTRB 4WJQA 1WF9A 1OTRB 4GGQA 2C5LC 1WM3A 2D2QA 2K1FA 2K25A 2LVPA 3DBLI 4ASWC 3UF8A 4BKSA 3X0WA 2XK5B 2HTHA 4JGHB 1V9JA 5G2NA 2MX2A 1Q5WB 3C0RB 5KHOA 3V61A 1WJNA 5D2MB 1V6EA 3O65B 3SU8X 3V62A 3LDZE 3W1YA 1WZ0A 2MP2A 2DHZA 2GBKA 2RGFA 4M0WB 4W9KA 1C3TA 1JRUA 5D7GA 5AZHA 4AP4C 2LASA 1WZ3A 1GC6A 2JF5A 2KMAA 3ENEA 3K9OB 3QK0A 3VUYA 3VXWA 1YX5B 2CHXA 3PTFC 1Z2MA 2N7EA 4KZCA 3ZO5B 1EF1A 4FADA 1P9DU 3RCZA 1WXSA 1Q1OA 2KX3A 3Q3JA 2DZIA 1Y8RC 5J17A 4TQ0A 2JZ3B 2N9XA 5CHWA 4KSKC 1I42A 4MJSA 1GUAB 3QQ8B 5DPTA 2KD0A 3NOBA 1UBIA 3WALA 4ANUA 3QHTA 4BOSC 2ASQA 1L7YA 1U4AA 3H7PA 4WWPA 4IWQA 3DVNV 2KMCA 3NZSA 4IWOA 1OEYJ 2NVUI 3OJ3A 3Q3FA 3M63B 5CHVC 3DVNU 3L08A 2FCSA 2KFJA 4FN2A 1AARA 2JY6A 2G4DB 3KUZA 2MQJA 2ZCCA 3PRPB 4I6LB 2MRPA 1P3QU 4G3XB 3TJPA 2N7DA 1KM7A 1UH6A 2BKRB 2BGFA 3KW5B 4KVGB 2NS5A 4EKUA 2ZCBA 3DCGA 4MGIE 1C1YB 3RZFA 3I3TB 3H1UA 3NS8A 2MA9B 2IYDB 2R2QA 4P7IA 1OEYA 2JXXA 4RM8A 4X57B 1GJZA 3TIXA 2LGYA 1V5OA 1X1MA 3L16A 2M17A 4KIKA 5DPWA 2O2VA 4KSLC 4BBNF 3AU5A 3APDA 3ZLZA 2NPTA 2BF8B 4FHJA 5D6JB 2MLBA 4G50A 1TTNA 2DYOA 3QA8A 1GNUA 1WJUA 1EO6A 2G3QB 2V1YA 4MGYE 2IBIB 2O6VD 2GBRA 2PJHA 2RSUA 3A9JB 2UYZB 4RM9A 2L3ZA 2BYVE 3MHSD 4EOYA 1BT0A 2AEHA 2DYMA 4WWOA 4EUTA 1Q0WB 1WXVA 3KYDD 1RAXA 5JH5C 1K8RB 1XQQA 3ZNID 4DWFA 4HPLB 2WWZA 3VHTC 3ZUNA 2L05A 3V6EB 3A9KB 1Z5SB 4ANWA 2C60A 2KLGA 3ECIA 2EMTA 4KDLB 4NJ7A 4LDTD 4XC2A 1E5WA 3DVGX 5AZGA 4FJVB 4MGKE 3SHQA 1RFAA 1WR1A 2LRWA 2NBVB 2KJ6A 1RLFA 1WX8A 4HDQA 3L54A 3DPDA 5C23A 4NJ6A 2RPQA 3BINA 2MSED 2MBOA 2LRUA 4WQOB 1L2NA 2IO2B 3NZUA 4TKNA 2L7RA 2ZVNA 3ZVVA 3L13A 5L95C 2M4NA 1G6JA 1GC7A 2N9PC 4M8NA 1PQSA 3PT2B 4HPMB 1OQYA 3KUCB 4AUQC 3HIZA 3JSVB 3JW0X 3VTWA 4EZKA 3AU4A 4W9FA 4K7SA 3RUIB 3PGEA 3L10B 1E7UA 2CKHB 4EFOA 2CR5A 2MBQA 3L0WB 5D94A 3OJ4B 5CHFA 1LQBA 1WH3A 2M0XA 4HK2A 2BYEA 4ANXA 1RRBA 1ZW7A 2LI5A 3LJ3A 4II2B 2KFKB 4GOCA 2KANA 4FA6A 4ICVA 4A20A 2MP2B 1WIAA 2GBMA 2JRIB 4MM3A 1LM8B 4FJYA 2O6VA 4HVBA 4IM0A 2KLCA 2PEAA 2PE6B 3QIJA 2L8JA 3HHMA 1WI0A 3R66C 2LVQA 4FBJB 4PYUA 2L0TA 3AI5A 5JHAA 2YVCA 1V80A 2DYBA 2NBWB 2ZEQA 2KC1A 3CSFA 4GDLA 4A3OA 4IM3A 3V6CB 4G0NB 3ML8A 4IG7B 4J6IA 5FR6A 1ZGUB 1WGGA 2Z0DB 4CHKA 5L83A 5HKHA 1SGHA 2KJHB 4NNJB 3DOWA 4FLHA 3VH3B 3A1QA 4WJPA 5C1ZA 3PV1A 2K6QA 4YL8A 1LXDA 4W9IA 2CHZA 3VVWB 1GG3A 2BKFA 3PZDA 4ZRJA 3EECA 4KV2A 3RZWC 5EDSA 2KTRA 2L00B 4KZ0A 5BO4B 3ZNZB 1IPGA 2JT4B 2FAZA 2XK5A 2R2OA 2KOXA 2KKCA 1WJ6A 3B0AA 3QARA 2KHWB 3X23A 3ONSA 3H9DA 1P0RA 4K7UA 1QZEA 3WAMA 4DHZB 4DBGA 2LUEA 3JYUA 5J18A 1KLVA 1HE8A 3OAWA 2K8HA 1IYFA 2NR2A 4BOZB 4HCPB 3ZNHB 4KDIC 4NY0A 3RT3B 2CHWA 4M8MA 2G45B 3KH0A 3V60A 2V4LA 2G4SA 3M95A 4NAWB 4AWJA 2GMIC 2DX5B 3PRMB 4W9CA 4KIKB 1WGHA 1ZKHA 4RMAA 2O2VB 4LJOB 4TUUA 2D11A 2JWZA 2XEWA 4W9JA 3VFKA 2MCNB 1WJ4A 2FIFA 2VRRB 5DCNA 2KDBA 1NDDA 5DPRA 3ZRFA 4TQ1A 4WAAA 4HJKA 4MGZE 2J7QB 4IC7B 2BWES 3UQAA 2LGDA 4JL9A 1YD8U 4LJPB 1J19A 3K9PB 4II3B 3ZDTA 3U30A 3N30A 4F7ZA 4HWIB 3TCAA 3N3KB 5JZEB 4ZRIA 5IAAC 2K8CA 4ICUA 1R4NI 4AJWA 2HE7A 3QWZB 2Y5BB 4FHKA 3APFA 1EF5A 4HDOA 3M3JA 1UGMA 4IM2A 3VH4B 2WX1A 3R7RA 3ZW3A 4PS7A 2NBUA 1WMHB 4K7WA 5LLIA 1V5TA 2D07B 2CU1A 1YX6B 4HCNB 3KUDB 3DBRI 3ALBA 1E8YA 2I1KA 2MWSB 4EZJA 2L0FA 3HM6X 3QCAA 3HM3A 3EC8A 5LXHA 3CSTA 1V2YA 4GSWA 2DZKA 4PYZA 3WA0A 2BYFA 2AWTA 2KDEB 4EZLA 2XBBC 1P98A 1S3SG 2L76A 3NY5A 4I6NB 3ZTDA 4BVUC 2LXCA 3N32A 5DPSA 3SD5A 2KK8A 5TR5A 1WE7A 4JLCA 3D32A 5E6OA 1VCBA 2I1JA 3VAWA 4E3CA 2D10A 2BWFA 2ZPYA 2M1MA 3A4RA 4GB9A 3PRZA 3KYCD 3WAPA 3A9JA 2N9EB 3PHWB 3UIOB 3RD2A 2PE9A 4GMVA 2B3AA 2O6VB 2ZNVB 2RR9A 1IP9A 2KWCA 4BKTA 1CMXB 2N1VA
chains in the Genus database with same CATH superfamily
3QJZA 3T3NA 2GBJA 3KWLA 1MI0A 3ZIMA 1S1QB 3U2SC 3WAOA 4CQNA 4TV3A 2MBBB 2ZW0A 1T0SC 4FULA 2FCQA 4DHJB 2DZJA 2LZ6A 3A33B 2BVCA 2WXRA 4MJSB 3VTUA 1HTQA 2N4FA 2WYQA 1M4VA 5AZFA 2REXA 4BFRA 5IP4D 3AULA 2INPE 3ZRCA 4KGRA 1HQRD 3N1XC 2KFKA 1JQ4A 1N5WA 3UQBA 2LGIA 5E6NA 4FJZA 3RNAC 3ZJUA 1DGJA 1LFDA 2AYOB 2KTFA 4MEMA 3RI7C 2DAFA 4IUMB 3E56A 4BKGA 4ANVA 1XLQA 1H8CA 2OJRA 4XWTA 3ZDMC 4MACA 2IDYA 4H2AA 3N1ZC 3PLVA 4NPNA 3EFUA 5D3DA 1NVID 2EELA 3IG3A 2KDFB 4KX6B 1KOTA 2MEKA 1EUVB 1VR9A 3PSEB 1GB4A 3PVLA 3OLMD 2IY0B 3R7QA 1E7VA 1H4RA 1D5MC 4C80A 2L83A 1R4NB 2OOBB 4A8XC 4C4VA 3AV8A 1P7EA 4RGOS 1XD3B 1KJTA 3GB1A 4JWUC 1TS2A 4E71A 2C7HA 2C9WB 4BKSD 3R2TA 1FXTB 1AN8A 1YOVB 1NYQA 2Y5CA 1IGCA 3DBHI 2WX0A 2V3NA 2V3SA 1I4GA 1NI2A 3Q14C 2WXHA 2CJNA 4HLEA 3BZDB 2BB5A 3B08A 4MM3B 3TEZA 1OQQA 3M62B 1OFFA 1SE9A 3B2FA 1V1PA 1TJEA 2QILA 3AE3B 4GDKB 4IWPA 3VTVA 1SIFA 5G55A 2Z59B 3T8MA 2NCNA 4YSZB 3ZTCA 3FILB 5EE9A 4A3PA 5E6PA 4ZDVA 5EE0A 4DDID 4XZ4A 2L1AA 2UU7A 1KRHA 2DZMA 3QX1A 1WE6A 4TMAB 3LB8C 4ASWC 3DBLI 2N9LA 3SR6A 1SB3C 3GE3C 2MX2A 1PFDA 1FRDA 3V61A 3FKYA 4RFBA 3O65B 5T8IA 2KVZA 1C3TA 2N0SB 3U52E 2JF5A 3ZYYX 1Z2MA 2N7EA 4WWMA 4YSYB 2DLBA 3LXFA 1R4MB 2KX3A 1Y8RC 1I42A 1GUAB 3AE7B 1WSPA 3QHTA 4YTMB 2K5PA 4WWPA 3AM9A 1I4PA 2KMCA 3M63B 4WQMA 3SEBA 2FCSA 2KFJA 2FE8A 1D5ZC 2ZCCA 3WCQA 1KM7A 2M56B 4M00A 2BKRB 3KW5B 4KVGB 3DCGA 1C1YB 3H1UA 1V1OA 1GJZA 1OEYA 4HKZE 3L16A 2M17A 5DPWA 4KSLC 3APDA 4HPPA 2NPTA 4FHJA 4G50A 1TTNA 2OHFA 1C4AA 1EM7A 1EO6A 2G3QB 2V1YA 2HDEA 4A6QA 2O6VD 4Q2JA 4RM9A 1XF5L 2DYMA 4TSSA 1K8RB 4DWFA 2WWZA 4KKIA 1F2RC 1Z5SB 3Q8CA 2KQ4X 2IGGA 5TSSA 2C60A 3ECIA 2EMTA 2RDGA 4FJVB 2LRWA 4BAXA 1RLFA 1FEHA 1WX8A 1EU3A 1L2NA 2TSSA 3AE9B 3NZUA 4TKNA 2ZVNA 1GC7A 1F0ZA 3KUCB 4AUQC 3HIZA 3JSVB 4EZKA 2CKHB 2CR5A 5CHFA 1LQBA 1WH3A 2M0XA 2BYEA 3U4EG 2HJ1A 1QKZA 3LJ3A 1UWXA 1QF6A 4HVBA 2KLCA 2PEAA 2PE6B 2L32A 2L8JA 3HHMA 2IGHA 2ZEQA 3NVZA 2KC1A 4JWSC 4A3OA 1IBXA 1P7FA 1ZDXA 2SEBD 2Z0DB 4CHKA 2KJHB 3NVVA 4YL8A 5EE1A 2CHZA 2VH2A 1KLUD 5C2TB 2BKFA 4ZRJA 1B9RA 2KTRA 3ZNZB 1ROEA 1RYJA 2LGSA 2FAZA 3ONSA 3BYYB 3ABVB 5J18A 1LO5D 1YN4A 4KDIC 4NY0A 4M0WA 1ENFA 3RT3B 3KH0A 2JQRB 2V4LA 4NAWB 1I7HA 4KIKB 2O2VB 2D11A 2JWZA 4W9JA 5BYRA 2KACA 1NDDA 3ZRFA 3P42A 1E10A 2J7QB 3I63C 4IC7B 1PGBA 1BXTA 3ZDTA 1TZOA 4GLSC 3TCAA 4ZRIA 4S0RA 4AJWA 2HE7A 3QWZB 3MJ5A 2WX1A 3R7RA 3ZW3A 2NBUA 1QOAA 1WMHB 1QLBB 4K7WA 1TY2A 4K3BA 3KUDB 4EZJA 3BVMA 3EC8A 3HRDD 2AWTA 4BVUC 3NJTA 3N32A 1JWSD 3SD5A 1PUTA 1F2RI 1SIJA 3OWEB 1ZE3D 3D32A 2ZPYA 2M1MA 3A4RA 3P63A 2V9HA 1WRIA 3WAPA 3AEDB 2WHIA 2PE9A 2RR9A 1IP9A 2KWCA 2D5GA 1CMXB 1B1ZA 1WGDA 3TMPB 3A9KA 1SSNA 3DHIC 4GDLB 2INNE 1N61A 1WX9A 3PS6A 4GU2A 2OEDA 3A1QB 1KF6B 2WXKA 5BMIA 5HFYA 1WYWB 1YJIA 5FR3A 2LWPA 3BVZA 5GMVA 5GXGB 2X8XX 3Q8AA 5IA7A 2MBEA 2LFIA 1P1AA 2MBHA 3H7PB 3EHVA 4O1NA 3IHPC 4OVUA 2WNMA 1YNTE 3HVDA 3ZKJC 3BY4B 2GOWA 1WFYA 2KNBA 3AH7A 2LVOA 3AE1B 1WGYA 4XDCA 2BQQA 3B1LX 1J8CA 3AE5B 1V86A 4LCDE 3IVFA 3S2AA 1WY8A 2DWQA 4IW0A 2K8BA 1TKYA 1WRDB 3A4SC 2KQSA 4NQKE 2AQ1B 1CJEA 1YIWA 3APCA 4WWNA 2LUMA 1YJ1A 3W1SC 3DHHC 3CIRB 1FNUA 1ZOYB 4MH0E 2LHEA 1E8XA 1QILA 4GIVA 4ZRQA 3ZXVA 3UINB 1I35A 2CU3A 2WDRB 3Q3NC 4PK1A 3VR9B 4K81A 3RYTA 4OVVA 3BWUD 1ZXIA 3SDLC 1D4BA 1FIQA 1FXAA 1J7BA 2J53A 4ARIA 3RULA 3AXCA 1NBFC 3TEXA 4AOFA 2N1WA 4IOIE 2IO3B 1OQRA 2KWDA 1WXMA 2JVCA 3W1SA 2ON8A 1YQBA 2J0MA 2ZPNA 1UZXB 2D3GA 5IOIA 1RFKA 2R61A 1T0YA 1V81A 2IO0B 4XWWA 1J0GA 2ZNVC 4E74A 3P2BA 4K1RB 3DBSA 4CYEA 1ZDVA 5BMHA 3W5VB 2QSDA 4WJNA 3B2GA 1VD2A 1ZPSA 4IDIA 1XLPA 1N60A 4YTNB 1UBQA 3L17A 2WXGA 3QAQA 1MG8A 2BTEA 4DHZE 4W9DA 1E8WA 2MW5A 3QC8B 4CO7A 3VUXA 3AEFB 2FBWB 4GGQA 1OTRB 2E3TA 1WM3A 2G9HD 2K25A 2VH1A 2WXOA 4JGHB 1V9JA 3Q6BA 3C0RB 2GI9A 5KHOA 3H8HA 1KFYB 5D2MB 4DXFA 1XLNA 3LDZE 2MP2A 2D3BA 1E0ZA 3ENEA 4KGSA 3K9OB 3QK0A 1T3QA 2K9XA 3RNFC 1YMHE 1P9DU 1WXQA 3AN1A 3Q3JA 2DZIA 5J17A 2N9XA 4MJSA 2KD0A 3WALA 3GS2A 4ARCA 4S17A 1L7YA 1C78A 2B76B 3DVNU 3L08A 1HEZE 4YT0B 4RGTA 2G4DB 4P1BC 1UGJA 2MQJA 3PRPB 3PO0A 1P3QU 4G3XB 2BGFA 4EKUA 4MGIE 2AQ3B 3I3TB 2IYDB 4X57B 4P7IA 1F77A 3BIID 2YEPF 3W5UB 1L6VA 1X1MA 1TY0A 3AU5A 4HRSA 1BUIC 3RFZB 2MJEA 5D6JB 3P4QB 3AMZA 5IKCM 1WJUA 1E9MA 4K3CA 2W3RA 3P4RB 2GBRA 2BYVE 2AEHA 1TKEA 1Q0WB 2W55A 1XQQA 3VHTC 3ZUNA 3V6EB 2G1EA 2PKOA 2KLGA 4F1SA 4XC2A 4NJ7A 1E5WA 3DVGX 1C4PA 5G5HA 3SHQA 1RFAA 1MG4A 2PVGC 2NBVB 2MHJA 3L54A 3DPDA 2EKIA 5C23A 4NJ6A 2MBOA 4MT5A 3ZVVA 1JWBD 3I9V1 2PW9A 3JW0X 3VTWA 1RM6C 2MBQA 1XXGA 1XO3A 3AEAB 3DHGC 1T0RC 2LI5A 4XGAB 4II2B 3GZNB 1L0YB 4MM3A 1LM8B 4IM0A 2V3PA 1WI0A 1QOFA 1CZPA 3MC0B 5JHAA 3CSFA 4IG7B 5HKHA 1SGHA 4NNJB 4FLHA 3VH3B 4NJCA 4WJPA 1TS4A 5C1ZA 1K52A 3IAS1 4W9IA 2INCC 4KGTA 3PZDA 4P1CC 1YQ4B 3EECA 4KV2A 3RNBC 5EDSA 2L00B 4KZ0A 1IPGA 2JT4B 5E6JA 3AE6B 2ZW1A 2QJLA 1JROA 3NG0A 1N62A 1IYFA 4XYCA 1DOYA 2G45B 2GMIC 2DX5B 3PRMB 3URYA 1ZP0B 4TUUA 1MPEA 2XEWA 2MCNB 1I4RA 2KDBA 2IPKD 4HJKA 3SFEB 2SAKA 3UQAA 4JL9A 2JYEA 1I4HA 4LJPB 3U30A 4F7ZA 1KLGD 4HWIB 5D3IB 3N3KB 3I57A 1R4NI 1IUEA 1YQ3B 2RMMA 4YWGG 1UGMA 4IM2A 3VH4B 4PS7A 1SE4A 2KDMA 5LLIA 4HCNB 4LK0M 4USAA 2WXIA 1E8YA 2I1KA 1C9FA 3HM3A 1V2YA 4JE3B 1TKGA 2JYTA 2KDEB 2XBBC 4ZRPA 1S3SG 4I6NB 2L76A 3NY5A 2LXCA 3TEYA 3EGRA 5DPSA 5TR5A 1VCBA 2I1JA 4HKQA 3TUOA 3KYCD 1TYGB 2N9EB 3MP9A 5HI1A 2B3AA 2NTSA 2WXQA 2GRIA 1N6ZA 2N1VA 2KZRA 4OHJA 3PZ7A 1PGAA 2VZKD 2CJOA 3ZNGC 3H7SA 3WANA 1ZUD2 1FNWA 3KVFB 1DOXA 1ET9A 4UDUC 2C7MB 3VUWA 2CS4A 2WXNA 1MHXA 2ACZB 4GXBA 3DQVA 3JSVA 3DWGC 4OZCA 1Y56A 3AEBB 2A4ZA 1TZ1A 4MSQB 4NQLB 3BK2A 1A5RA 2J42A 2RD0A 4HXDA 1C4CA 4JQWC 1IGDA 2LMCA 3Q8FA 1R4MI 4PS3A 3GOEA 4ZYNA 2QHOA 4GN1A 1L0XB 2PPHA 1EWCA 2KN4A 2JUOA 2QCZA 5CX3A 4ZHOA 2J0JA 4LNFA 2PLPA 2Y5PA 1QOBA 2QMTA 1WX7A 5LXIB 2K39A 1TBEA 4A9AA 2JZZA 4LTUA 4XX5A 2WXJA 3PZ8A 3P1MA 4I6PA 2HJ8A 4NAWA 3WIMA 2WDVB 2UWQA 2ZVOA 3PPAA 3VRBB 3PHXB 3MJWA 3VQIA 1WR6E 4B95A 3CF6E 4WURA 2D3CA 1C76A 1D3ZA 3DBRB 4W9GA 2EKEC 1WXAA 2KDIA 4N6EB 4P16A 1OGWA 3KLSX 3R8BA 3IFWB 1WM2A 1JRPA 1UELA 3IBEA 3HK0A 1MFWA 1WMHA 2IZVB 3BK1A 3IAM1 4F8CB 1T0QC 2DAJA 3U8ZA 4A55A 4YTPB 2KWUB 1JW9D 3R3MA 3ETRA 4DK5A 1K50A 4DXAB 4URKA 1L0VB 2LXAA 3MFGA 1ISNA 3NVYA 4ZOHC 4PS8A 1NI3A 4B0MA 2WLBA 2RDBC 4WJQA 2C5LC 2D2QA 2K1FA 2LVPA 4BKSA 4L1BA 3X0WA 2XK5B 2HTHA 5G2NA 1Q5WB 2GLSA 5AUIA 3BVGA 1WJNA 2NMQA 1LGRA 3V62A 3EFCA 1WZ0A 2GBKA 5AZHA 1F52A 1AWDA 4AP4C 1WZ3A 1GC6A 4R3DA 2ICIA 2KMAA 2BYTA 3VUYA 3VXWA 1YX5B 2CHXA 4C00A 3PTFC 5G5GA 2D3AA 4QAYA 3RNGC 1EF1A 2JX5A 3Q8EA 4ITKA 4US8A 1E7PB 4TQ0A 1FM0D 3QQ8B 4ACFA 4ANUA 1UF0A 2ASQA 2H88B 2JWUA 3H7PA 3NZSA 2WP9B 4IWOA 1FRRA 2NVUI 3Q3FA 2QEJC 5LNK1 5CHVC 2JSVX 2Z8LA 1AARA 2N7JA 2JY6A 1C77A 3KUZA 2MRPA 4XE0A 1UH6A 2NS5A 2ZCBA 3U7ZA 3RZFA 2R2QA 3TIXA 4WH4A 1JWAD 1V5OA 3AE8B 4M02A 3ZLZA 2I38A 3QA8A 2Q5WD 1GNUA 4JPSA 1DYQA 1ACCA 4MGYE 1FCCC 3A9JB 3C8YA 4EE2A 4EOYA 2L3ZA 1BT0A 4WWOA 2W54A 2OJWA 3ZNID 4NAMA 2L05A 1VZ6A 1A70A 4ANWA 3DBHB 1HA5A 4KDLB 4MGKE 2BS4B 2KJ6A 4HDQA 3BINA 2MSED 3TSSA 2LRUA 4WQOB 2AX5A 2L7RA 3C19A 1G6JA 2M4NA 2N9PC 4M8NA 1PQSA 3PT2B 4HPMB 1OQYA 4N58A 2AQ2B 1MHHE 3AU4A 4W9FA 3RUIB 3PGEA 1E7UA 4EFOA 2RPVA 4RCOA 4US9A 3L0WB 3DWMA 2KYWA 4ANXA 1RRBA 2KFKB 4GOCA 4ICVA 4A20A 2MP2B 1WIAA 2GBMA 2JRIB 4FJYA 2O6VA 2QIEB 5BMGA 3ZJTA 4PYUA 4PT5A 2K0PA 2NBWB 3DBLB 4IM3A 2WU2B 4J6IA 2VZKB 5FR6A 1FPYA 1ZGUB 3DOWA 3RMKC 3MHZA 1LXDA 1TT5B 3EA6A 2BW2A 1L4ZB 1GG3A 3RZWC 2LJIA 1UUPA 1WWTA 5BO4B 3W2DA 4LNKA 2R2OA 2KOXA 2KKCA 1WJ6A 3B0AA 3X23A 1P0RA 2NTTA 1PGXA 3WAMA 4DHZB 2LUEA 1KLVA 3OAWA 2K8HA 2NR2A 3VRAB 4HCPB 3ZNHB 4M8MA 1J7CA 2G4SA 4AWJA 4BZAA 1WGHA 1SEBD 2LHDA 4LJOB 4C4VB 3NVWA 1QOGA 1FCLA 1WJ4A 2FIFA 2VRRB 3N1YC 5DCNA 5DPRA 3ZXRA 1FMAD 4TQ1A 3RN9C 4WAAA 2KAJA 3K9PB 5MPOA 4II3B 2J52A 1I4XA 5JZEB 2DNFA 5IAAC 4RH6A 4HDOA 2Y5BB 3APFA 3M3JA 1VZ7A 2WQYB 1JMLA 2D07B 2CU1A 2WU5B 4C7ZA 1SJED 1V1PB 3CWIA 3ALBA 3AE2B 2BB6A 4J3OD 5LXHA 3CSTA 4GSWA 1SE3A 3WA0A 2FUG1 2BYFA 2K3UA 4EZLA 1P98A 1WE7A 5E6OA 4E3CA 2D10A 2BWFA 1SXTA 1TS3A 4GB9A 3AEEB 4RF0A 3KQ4A 3PHWB 5BYSA 4GMVA 1T6BX 3MC8A 4BKTA 2BT6A 2FCMA 1D6EC 3N20C 2A5UA 2XNAC 4MSMB 2LJ5A 2ZZPB 3CMMB 1C79A 1D5XC 3E9SA 4B9KA 1E8ZA 4LDTB 4GDKA 3KWVA 1STEA 4JIOU 5J2RA 1DOIA 4LNIA 1VZ8A 4B0EA 2AL3A 1MJDA 2JPHA 1FD6A 4IKGA 2X38A 1JWMD 2LD9A 3FILA 1SBBB 3U7DA 2IJ0A 2K6DB 2GBNA 2KJRA 1SF0A 2DENB 5IO9A 4LNOA 5KHQA 1V97A 3JVZX 2W9NA 3TBLD 3P4SB 3Q3OC 2C7NB 3V05A 2ZJDA 3RPFC 3UI3A 2EMSA 2YLMA 2KWVB 5EE3A 1WGRA 3UIPB 3IXSA 4G11A 3UGBB 1WYGA 5IN7A 1V8CA 2AL6A 2FIDA 4D2KA 3NUHB 1GB1A 1K51A 1AW7A 2QDFA 1NYRA 2IO1B 1TGZB 4OW0A 2KMMA 2NPTB 2HD5B 1TIFA 3H6NA 5FKAC 1F9JA 4EEWA 1Q10A 4DDGD 1XT9B 2RDHA 2KN5A 1AYFA 2PMVA 4ZRKA 4REZA 3MC9A 3W9CB 4WJOA 3TL5A 3J9CA 4BBNC 2K22A 1E90A 5AUKA 1GOZA 1L6UA 4HROA 1T5XD 2J0KA 5JHBA 4MDKE 1N5XA 1YN3A 5AEKB 3ML9A 3GE8C 2FUHB 2WDTB 1UD7A 3NHEB 2LEKA 4DXGA 2HTME 1F1HA 3DDCB 2JRHA 3N9YC 3DVGY 2IY1B 3AE4B 2J4XA 2FNJB 2INDC 4AS1A 4W9HA 1V49A 1L4DB 4W9EA 4L2YA 1VLBA 2LGXA 3O13A 4MELA 3IT4B 2Z0EB 4MH8A 2KC2A 3VDZA 3LYYA 3PLUA 3PREA 2FCNA 2KO3A 1RWSA 4W9LA 2KX0A 2V4IB 4DHJD 2JXTA 4B6WA 2M8SA 3GP7A 3MTNB 1IBXB 4AJYB 2KVRA 2BPSA 5CTRC 2KXJA 4OZBA 4N9F4 1M94A 3GZNI 5HHDG 2KQ7A 4JX1C 4RNAA 3AEGB 3T9LA 3FAHA 2KTRB 1WF9A 2N9KA 4HEA1 3UF8A 2PIAA 3RNEC 3NZ3A 1R7SA 1V6EA 2JU6X 3IT6B 3SU8X 3W1YA 2DHZA 2RGFA 4W9KA 4M0WB 1JRUA 5D7GA 3NRZA 2WXPA 1FXIA 2DBYA 2LASA 2PVOD 3T3OA 2KT7A 1SJHD 2W3SA 4KZCA 3ZO5B 4FADA 3RCZA 1WXSA 1FFUA 1Q1OA 2M19A 4HJGE 2W82A 4XDDA 2JZ3B 5CHWA 4KSKC 2BS3B 1KH0A 5DPTA 3NOBA 1UBIA 2BS2B 4BOSC 1CQVA 1U4AA 3AB5A 4IWQA 4WIPA 3DVNV 1OEYJ 3OJ3A 2WGSA 3HVZA 3BYTB 1FFVA 4FN2A 2I2YA 1UWMA 4I6LB 1JCKB 1NEKB 2N7DA 3TJPA 2M0AA 3HUIA 3ZQ4A 3P4PB 4AQ7A 1GPXA 3NS8A 2MA9B 4RM8A 2JXXA 2LGYA 1EWYC 1I4QA 4KIKA 1KTKA 2O2VA 5HG2A 4BBNF 1ET6A 2WXLA 3B9JA 2BF8B 2MLBA 3ZGZA 2DYOA 2MJDA 1EU4A 4WAFA 2IBIB 1NENB 2PJHA 2RSUA 1QQRA 2UYZB 3MHSD 4EUTA 1HTOA 1WXVA 3KYDD 1RAXA 5JH5C 2GB1A 1VRAB 3Q8BA 4P6VF 4HPLB 5I4DA 1QT9A 2QC8A 3A9KB 1ZXHA 1HZ6A 4LNNA 1VDVA 4LDTD 5AZGA 1WR1A 3EUB2 2JZPA 2RPQA 3OG5A 2IO2B 3FC4A 4N59A 4YSXB 4RGMA 5L95C 3L13A 3V3XA 1XCTL 2WDQB 4K7SA 3VR8B 3L10B 5H8YE 5D94A 3OJ4B 4HK2A 3RNCC 5FK9C 1ZW7A 4FA6A 2KANA 1XEEA 5C3JB 3QIJA 1GAQB 2XN9C 3R66C 2LVQA 4FBJB 4OZAA 1YN5A 2L0TA 3AI5A 2YVCA 1V80A 2DYBA 1J7AA 4GDLA 3V6CB 2PTLA 4G0NB 3ML8A 1VJKA 1PYWD 3R2IA 1HZ5A 1WGGA 5L83A 3A1QA 3PV1A 2K6QA 1SE2A 3VVWB 5JXVA 4KKJA 3AECB 4RF1A 2XK5A 3L4PA 4DQOC 1BMLC 1XLOA 1ESFA 1FNVA 3QARA 2KHWB 4RGNA 2E6XA 3H9DA 1JWUD 4K7UA 1QZEA 4FXCA 4DBGA 3JYUA 3ZJVA 1HE8A 4BOZB 4A90A 2V0GA 2CHWA 1JALA 3V60A 3M95A 2ONQA 4W9CA 1FO4A 1L5PA 1ZKHA 1E6EB 4RMAA 3NS1A 1TS5A 3VFKA 3Q2AC 4ZYSA 1HXYD 2WS3B 4YXDB 4MGZE 2BWES 2LGDA 1YD8U 1MVKA 1J19A 4OVZA 2YEPB 3N30A 1UNSA 4C7YA 2BBCA 2H89B 5BYQA 2K8CA 4ICUA 4C56C 2WXFA 4FHKA 1N63A 1EF5A 2MJ3A 1CK1A 2WXMA 2Y3AA 1V5TA 1XCQL 1PDXA 3Q3MC 1YX6B 3DBRI 4L23A 2IGDA 4ZHPA 2MWSB 2L0FA 3HM6X 3QCAA 3Q69A 4LLGM 4NZLB 4M01A 2DZKA 4PYZA 3SFDB 1K53A 3TEWA 3ZTDA 1YJJA 5H92C 3I5JC 2KK8A 4JLCA 3VAWA 3PRZA 1WGKA 2L52A 3A9JA 3UIOB 3RD2A 2O6VB 2ZNVB 2MH7A
chains in the Genus database with same CATH topology
1WGDA 3TMPB 2FCMA 3QJZA 2KZRA 3A9KA 2A5UA 2GBJA 3ZNGC 4MSMB 2LJ5A 4GDLB 2ZZPB 3CMMB 3H7SA 3ZIMA 1WX9A 3WANA 3KVFB 1S1QB 3WAOA 3PS6A 4GU2A 4B9KA 2C7MB 4TV3A 1E8ZA 4LDTB 4GDKA 3VUWA 2CS4A 4JIOU 5J2RA 2MBBB 3A1QB 4FULA 2AL3A 4GXBA 2FCQA 2JPHA 4DHJB 2DZJA 2LZ6A 3DQVA 1WYWB 3A33B 2LWPA 3JSVA 2LD9A 3U7DA 5GMVA 4MJSB 3VTUA 5IA7A 2MBEA 2N4FA 2A4ZA 2WYQA 1TZ1A 4MSQB 2K6DB 1P1AA 2GBNA 4NQLB 5AZFA 2KJRA 2DENB 2MBHA 2REXA 3EHVA 3H7PB 4BFRA 5KHQA 3IHPC 3AULA 4OVUA 3ZRCA 1A5RA 2RD0A 4HXDA 3ZKJC 3JVZX 2W9NA 3BY4B 3TBLD 2KFKA 4JQWC 2GOWA 1WFYA 2C7NB 2KNBA 2ZJDA 3UQBA 2EMSA 2LVOA 2YLMA 2KWVB 5E6NA 1WGRA 1R4MI 4FJZA 1WGYA 3UIPB 4G11A 3UGBB 4PS3A 3B1LX 3GOEA 1J8CA 1LFDA 2AL6A 2FIDA 2AYOB 2KTFA 1V86A 4ZYNA 4MEMA 4LCDE 2QHOA 3IVFA 4GN1A 2DAFA 3S2AA 4IUMB 1WY8A 4BKGA 2IO1B 1TGZB 4IW0A 4ANVA 2K8BA 1H8CA 1WRDB 2PPHA 3A4SC 2KQSA 4NQKE 2JUOA 5CX3A 2J0JA 2OJRA 2NPTB 3ZDMC 2HD5B 1YIWA 3APCA 4WWNA 3H6NA 1YJ1A 1F9JA 3W1SC 4EEWA 4DDGD 1XT9B 2KN5A 3PLVA 4ZRKA 4NPNA 4MH0E 4WJOA 1WX7A 3EFUA 3TL5A 1E8XA 2K39A 4GIVA 5LXIB 1TBEA 3UINB 4BBNC 1I35A 1E90A 3IG3A 4K81A 2JZZA 2KDFB 2J0KA 4XX5A 3RYTA 5JHBA 1KOTA 4OVVA 1EUVB 4MDKE 3PSEB 5AEKB 4I6PA 2HJ8A 3ML9A 3PVLA 3SDLC 3OLMD 2FUHB 2IY0B 4NAWA 3R7QA 2WDTB 1E7VA 1H4RA 1UD7A 3WIMA 2OOBB 3NHEB 3RULA 3AXCA 1NBFC 2UWQA 3DDCB 4AOFA 2JRHA 1XD3B 2N1WA 2ZVOA 1KJTA 3DVGY 3PPAA 2IY1B 3PHXB 4F1SA 2IO3B 3MJWA 4E71A 2C7HA 3VQIA 2C9WB 2FNJB 1WXMA 4BKSD 1WR6E 1FXTB 4B95A 2JVCA 3CF6E 3W1SA 4W9HA 1D3ZA 1V49A 3DBHI 2WX0A 4W9EA 2V3SA 4W9GA 1YQBA 2LGXA 2EKEC 1NI2A 2J0MA 2ZPNA 1WXAA 1UZXB 2KDIA 2D3GA 4MELA 1OGWA 4HLEA 2Z0EB 1T0YA 1V81A 2IO0B 2KC2A 3IFWB 1WM2A 3VDZA 2ZNVC 1J0GA 4E74A 3B08A 3P2BA 1UELA 3IBEA 3HK0A 3PLUA 3PREA 4K1RB 3DBSA 1WMHA 4CYEA 2FCNA 2IZVB 4F8CB 3M62B 1SE9A 2KO3A 2DAJA 3U8ZA 4W9LA 2KX0A 2KWUB 4GDKB 4WJNA 3R3MA 4DHJD 4IWPA 4DK5A 3VTVA 4B6WA 1VD2A 2M8SA 4DXAB 1SIFA 4URKA 3MTNB 5G55A 2Z59B 4AJYB 2KVRA 2LXAA 2BPSA 3T8MA 2NCNA 5CTRC 2KXJA 4N9F4 1UBQA 1ISNA 3ZTCA 4A3PA 3L17A 5E6PA 1M94A 3GZNI 4ZDVA 3QAQA 1MG8A 2KQ7A 4DDID 4XZ4A 4DHZE 4PS8A 3T9LA 4W9DA 1E8WA 2MW5A 3QC8B 4CO7A 2DZMA 3VUXA 3QX1A 1WE6A 2KTRB 4WJQA 1WF9A 1OTRB 4GGQA 2C5LC 1WM3A 2D2QA 2K1FA 2K25A 2LVPA 3DBLI 4ASWC 3UF8A 4BKSA 3X0WA 2XK5B 2HTHA 4JGHB 1V9JA 5G2NA 2MX2A 1Q5WB 3C0RB 5KHOA 3V61A 1WJNA 5D2MB 1V6EA 3O65B 3SU8X 3V62A 3LDZE 3W1YA 1WZ0A 2MP2A 2DHZA 2GBKA 2RGFA 4M0WB 4W9KA 1C3TA 1JRUA 5D7GA 5AZHA 4AP4C 2LASA 1WZ3A 1GC6A 2JF5A 2KMAA 3ENEA 3K9OB 3QK0A 3VUYA 3VXWA 1YX5B 2CHXA 3PTFC 1Z2MA 2N7EA 4KZCA 3ZO5B 1EF1A 4FADA 1P9DU 3RCZA 1WXSA 1Q1OA 2KX3A 3Q3JA 2DZIA 1Y8RC 5J17A 4TQ0A 2JZ3B 2N9XA 5CHWA 4KSKC 1I42A 4MJSA 1GUAB 3QQ8B 5DPTA 2KD0A 3NOBA 1UBIA 3WALA 4ANUA 3QHTA 4BOSC 2ASQA 1L7YA 1U4AA 3H7PA 4WWPA 4IWQA 3DVNV 2KMCA 3NZSA 4IWOA 1OEYJ 2NVUI 3OJ3A 3Q3FA 3M63B 5CHVC 3DVNU 3L08A 2FCSA 2KFJA 4FN2A 1AARA 2JY6A 2G4DB 3KUZA 2MQJA 2ZCCA 3PRPB 4I6LB 2MRPA 1P3QU 4G3XB 3TJPA 2N7DA 1KM7A 1UH6A 2BKRB 2BGFA 3KW5B 4KVGB 2NS5A 4EKUA 2ZCBA 3DCGA 4MGIE 1C1YB 3RZFA 3I3TB 3H1UA 3NS8A 2MA9B 2IYDB 2R2QA 4P7IA 1OEYA 2JXXA 4RM8A 4X57B 1GJZA 3TIXA 2LGYA 1V5OA 1X1MA 3L16A 2M17A 4KIKA 5DPWA 2O2VA 4KSLC 4BBNF 3AU5A 3APDA 3ZLZA 2NPTA 2BF8B 4FHJA 5D6JB 2MLBA 4G50A 1TTNA 2DYOA 3QA8A 1GNUA 1WJUA 1EO6A 2G3QB 2V1YA 4MGYE 2IBIB 2O6VD 2GBRA 2PJHA 2RSUA 3A9JB 2UYZB 4RM9A 2L3ZA 2BYVE 3MHSD 4EOYA 1BT0A 2AEHA 2DYMA 4WWOA 4EUTA 1Q0WB 1WXVA 3KYDD 1RAXA 5JH5C 1K8RB 1XQQA 3ZNID 4DWFA 4HPLB 2WWZA 3VHTC 3ZUNA 2L05A 3V6EB 3A9KB 1Z5SB 4ANWA 2C60A 2KLGA 3ECIA 2EMTA 4KDLB 4NJ7A 4LDTD 4XC2A 1E5WA 3DVGX 5AZGA 4FJVB 4MGKE 3SHQA 1RFAA 1WR1A 2LRWA 2NBVB 2KJ6A 1RLFA 1WX8A 4HDQA 3L54A 3DPDA 5C23A 4NJ6A 2RPQA 3BINA 2MSED 2MBOA 2LRUA 4WQOB 1L2NA 2IO2B 3NZUA 4TKNA 2L7RA 2ZVNA 3ZVVA 3L13A 5L95C 2M4NA 1G6JA 1GC7A 2N9PC 4M8NA 1PQSA 3PT2B 4HPMB 1OQYA 3KUCB 4AUQC 3HIZA 3JSVB 3JW0X 3VTWA 4EZKA 3AU4A 4W9FA 4K7SA 3RUIB 3PGEA 3L10B 1E7UA 2CKHB 4EFOA 2CR5A 2MBQA 3L0WB 5D94A 3OJ4B 5CHFA 1LQBA 1WH3A 2M0XA 4HK2A 2BYEA 4ANXA 1RRBA 1ZW7A 2LI5A 3LJ3A 4II2B 2KFKB 4GOCA 2KANA 4FA6A 4ICVA 4A20A 2MP2B 1WIAA 2GBMA 2JRIB 4MM3A 1LM8B 4FJYA 2O6VA 4HVBA 4IM0A 2KLCA 2PEAA 2PE6B 3QIJA 2L8JA 3HHMA 1WI0A 3R66C 2LVQA 4FBJB 4PYUA 2L0TA 3AI5A 5JHAA 2YVCA 1V80A 2DYBA 2NBWB 2ZEQA 2KC1A 3CSFA 4GDLA 4A3OA 4IM3A 3V6CB 4G0NB 3ML8A 4IG7B 4J6IA 5FR6A 1ZGUB 1WGGA 2Z0DB 4CHKA 5L83A 5HKHA 1SGHA 2KJHB 4NNJB 3DOWA 4FLHA 3VH3B 3A1QA 4WJPA 5C1ZA 3PV1A 2K6QA 4YL8A 1LXDA 4W9IA 2CHZA 3VVWB 1GG3A 2BKFA 3PZDA 4ZRJA 3EECA 4KV2A 3RZWC 5EDSA 2KTRA 2L00B 4KZ0A 5BO4B 3ZNZB 1IPGA 2JT4B 2FAZA 2XK5A 2R2OA 2KOXA 2KKCA 1WJ6A 3B0AA 3QARA 2KHWB 3X23A 3ONSA 3H9DA 1P0RA 4K7UA 1QZEA 3WAMA 4DHZB 4DBGA 2LUEA 3JYUA 5J18A 1KLVA 1HE8A 3OAWA 2K8HA 1IYFA 2NR2A 4BOZB 4HCPB 3ZNHB 4KDIC 4NY0A 3RT3B 2CHWA 4M8MA 2G45B 3KH0A 3V60A 2V4LA 2G4SA 3M95A 4NAWB 4AWJA 2GMIC 2DX5B 3PRMB 4W9CA 4KIKB 1WGHA 1ZKHA 4RMAA 2O2VB 4LJOB 4TUUA 2D11A 2JWZA 2XEWA 4W9JA 3VFKA 2MCNB 1WJ4A 2FIFA 2VRRB 5DCNA 2KDBA 1NDDA 5DPRA 3ZRFA 4TQ1A 4WAAA 4HJKA 4MGZE 2J7QB 4IC7B 2BWES 3UQAA 2LGDA 4JL9A 1YD8U 4LJPB 1J19A 3K9PB 4II3B 3ZDTA 3U30A 3N30A 4F7ZA 4HWIB 3TCAA 3N3KB 5JZEB 4ZRIA 5IAAC 2K8CA 4ICUA 1R4NI 4AJWA 2HE7A 3QWZB 2Y5BB 4FHKA 3APFA 1EF5A 4HDOA 3M3JA 1UGMA 4IM2A 3VH4B 2WX1A 3R7RA 3ZW3A 4PS7A 2NBUA 1WMHB 4K7WA 5LLIA 1V5TA 2D07B 2CU1A 1YX6B 4HCNB 3KUDB 3DBRI 3ALBA 1E8YA 2I1KA 2MWSB 4EZJA 2L0FA 3HM6X 3QCAA 3HM3A 3EC8A 5LXHA 3CSTA 1V2YA 4GSWA 2DZKA 4PYZA 3WA0A 2BYFA 2AWTA 2KDEB 4EZLA 2XBBC 1P98A 1S3SG 2L76A 3NY5A 4I6NB 3ZTDA 4BVUC 2LXCA 3N32A 5DPSA 3SD5A 2KK8A 5TR5A 1WE7A 4JLCA 3D32A 5E6OA 1VCBA 2I1JA 3VAWA 4E3CA 2D10A 2BWFA 2ZPYA 2M1MA 3A4RA 4GB9A 3PRZA 3KYCD 3WAPA 3A9JA 2N9EB 3PHWB 3UIOB 3RD2A 2PE9A 4GMVA 2B3AA 2O6VB 2ZNVB 2RR9A 1IP9A 2KWCA 4BKTA 1CMXB 2N1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGD A;  3TMP B;  2FCM A;  3QJZ A;  2KZR A;  3A9K A;  2A5U A;  2GBJ A;  3ZNG C;  4MSM B;  2LJ5 A;  4GDL B;  2ZZP B;  3CMM B;  3H7S A;  3ZIM A;  1WX9 A;  3WAN A;  3KVF B;  1S1Q B;  3WAO A;  3PS6 A;  4GU2 A;  4B9K A;  2C7M B;  4TV3 A;  1E8Z A;  4LDT B;  4GDK A;  3VUW A;  2CS4 A;  4JIO U;  5J2R A;  2MBB B;  3A1Q B;  4FUL A;  2AL3 A;  4GXB A;  2FCQ A;  2JPH A;  4DHJ B;  2DZJ A;  2LZ6 A;  3DQV A;  1WYW B;  3A33 B;  2LWP A;  3JSV A;  2LD9 A;  3U7D A;  5GMV A;  4MJS B;  3VTU A;  5IA7 A;  2MBE A;  2N4F A;  2A4Z A;  2WYQ A;  1TZ1 A;  4MSQ B;  2K6D B;  1P1A A;  2GBN A;  4NQL B;  5AZF A;  2KJR A;  2DEN B;  2MBH A;  2REX A;  3EHV A;  3H7P B;  4BFR A;  5KHQ A;  3IHP C;  3AUL A;  4OVU A;  3ZRC A;  1A5R A;  2RD0 A;  4HXD A;  3ZKJ C;  3JVZ X;  2W9N A;  3BY4 B;  3TBL D;  2KFK A;  4JQW C;  2GOW A;  1WFY A;  2C7N B;  2KNB A;  2ZJD A;  3UQB A;  2EMS A;  2LVO A;  2YLM A;  2KWV B;  5E6N A;  1WGR A;  1R4M I;  4FJZ A;  1WGY A;  3UIP B;  4G11 A;  3UGB B;  4PS3 A;  3B1L X;  3GOE A;  1J8C A;  1LFD A;  2AL6 A;  2FID A;  2AYO B;  2KTF A;  1V86 A;  4ZYN A;  4MEM A;  4LCD E;  2QHO A;  3IVF A;  4GN1 A;  2DAF A;  3S2A A;  4IUM B;  1WY8 A;  4BKG A;  2IO1 B;  1TGZ B;  4IW0 A;  4ANV A;  2K8B A;  1H8C A;  1WRD B;  2PPH A;  3A4S C;  2KQS A;  4NQK E;  2JUO A;  5CX3 A;  2J0J A;  2OJR A;  2NPT B;  3ZDM C;  2HD5 B;  1YIW A;  3APC A;  4WWN A;  3H6N A;  1YJ1 A;  1F9J A;  3W1S C;  4EEW A;  4DDG D;  1XT9 B;  2KN5 A;  3PLV A;  4ZRK A;  4NPN A;  4MH0 E;  4WJO A;  1WX7 A;  3EFU A;  3TL5 A;  1E8X A;  2K39 A;  4GIV A;  5LXI B;  1TBE A;  3UIN B;  4BBN C;  1I35 A;  1E90 A;  3IG3 A;  4K81 A;  2JZZ A;  2KDF B;  2J0K A;  4XX5 A;  3RYT A;  5JHB A;  1KOT A;  4OVV A;  1EUV B;  4MDK E;  3PSE B;  5AEK B;  4I6P A;  2HJ8 A;  3ML9 A;  3PVL A;  3SDL C;  3OLM D;  2FUH B;  2IY0 B;  4NAW A;  3R7Q A;  2WDT B;  1E7V A;  1H4R A;  1UD7 A;  3WIM A;  2OOB B;  3NHE B;  3RUL A;  3AXC A;  1NBF C;  2UWQ A;  3DDC B;  4AOF A;  2JRH A;  1XD3 B;  2N1W A;  2ZVO A;  1KJT A;  3DVG Y;  3PPA A;  2IY1 B;  3PHX B;  4F1S A;  2IO3 B;  3MJW A;  4E71 A;  2C7H A;  3VQI A;  2C9W B;  2FNJ B;  1WXM A;  4BKS D;  1WR6 E;  1FXT B;  4B95 A;  2JVC A;  3CF6 E;  3W1S A;  4W9H A;  1D3Z A;  1V49 A;  3DBH I;  2WX0 A;  4W9E A;  2V3S A;  4W9G A;  1YQB A;  2LGX A;  2EKE C;  1NI2 A;  2J0M A;  2ZPN A;  1WXA A;  1UZX B;  2KDI A;  2D3G A;  4MEL A;  1OGW A;  4HLE A;  2Z0E B;  1T0Y A;  1V81 A;  2IO0 B;  2KC2 A;  3IFW B;  1WM2 A;  3VDZ A;  2ZNV C;  1J0G A;  4E74 A;  3B08 A;  3P2B A;  1UEL A;  3IBE A;  3HK0 A;  3PLU A;  3PRE A;  4K1R B;  3DBS A;  1WMH A;  4CYE A;  2FCN A;  2IZV B;  4F8C B;  3M62 B;  1SE9 A;  2KO3 A;  2DAJ A;  3U8Z A;  4W9L A;  2KX0 A;  2KWU B;  4GDK B;  4WJN A;  3R3M A;  4DHJ D;  4IWP A;  4DK5 A;  3VTV A;  4B6W A;  1VD2 A;  2M8S A;  4DXA B;  1SIF A;  4URK A;  3MTN B;  5G55 A;  2Z59 B;  4AJY B;  2KVR A;  2LXA A;  2BPS A;  3T8M A;  2NCN A;  5CTR C;  2KXJ A;  4N9F 4;  1UBQ A;  1ISN A;  3ZTC A;  4A3P A;  3L17 A;  5E6P A;  1M94 A;  3GZN I;  4ZDV A;  3QAQ A;  1MG8 A;  2KQ7 A;  4DDI D;  4XZ4 A;  4DHZ E;  4PS8 A;  3T9L A;  4W9D A;  1E8W A;  2MW5 A;  3QC8 B;  4CO7 A;  2DZM A;  3VUX A;  3QX1 A;  1WE6 A;  2KTR B;  4WJQ A;  1WF9 A;  1OTR B;  4GGQ A;  2C5L C;  1WM3 A;  2D2Q A;  2K1F A;  2K25 A;  2LVP A;  3DBL I;  4ASW C;  3UF8 A;  4BKS A;  3X0W A;  2XK5 B;  2HTH A;  4JGH B;  1V9J A;  5G2N A;  2MX2 A;  1Q5W B;  3C0R B;  5KHO A;  3V61 A;  1WJN A;  5D2M B;  1V6E A;  3O65 B;  3SU8 X;  3V62 A;  3LDZ E;  3W1Y A;  1WZ0 A;  2MP2 A;  2DHZ A;  2GBK A;  2RGF A;  4M0W B;  4W9K A;  1C3T A;  1JRU A;  5D7G A;  5AZH A;  4AP4 C;  2LAS A;  1WZ3 A;  1GC6 A;  2JF5 A;  2KMA A;  3ENE A;  3K9O B;  3QK0 A;  3VUY A;  3VXW A;  1YX5 B;  2CHX A;  3PTF C;  1Z2M A;  2N7E A;  4KZC A;  3ZO5 B;  1EF1 A;  4FAD A;  1P9D U;  3RCZ A;  1WXS A;  1Q1O A;  2KX3 A;  3Q3J A;  2DZI A;  1Y8R C;  5J17 A;  4TQ0 A;  2JZ3 B;  2N9X A;  5CHW A;  4KSK C;  1I42 A;  4MJS A;  1GUA B;  3QQ8 B;  5DPT A;  2KD0 A;  3NOB A;  1UBI A;  3WAL A;  4ANU A;  3QHT A;  4BOS C;  2ASQ A;  1L7Y A;  1U4A A;  3H7P A;  4WWP A;  4IWQ A;  3DVN V;  2KMC A;  3NZS A;  4IWO A;  1OEY J;  2NVU I;  3OJ3 A;  3Q3F A;  3M63 B;  5CHV C;  3DVN U;  3L08 A;  2FCS A;  2KFJ A;  4FN2 A;  1AAR A;  2JY6 A;  2G4D B;  3KUZ A;  2MQJ A;  2ZCC A;  3PRP B;  4I6L B;  2MRP A;  1P3Q U;  4G3X B;  3TJP A;  2N7D A;  1KM7 A;  1UH6 A;  2BKR B;  2BGF A;  3KW5 B;  4KVG B;  2NS5 A;  4EKU A;  2ZCB A;  3DCG A;  4MGI E;  1C1Y B;  3RZF A;  3I3T B;  3H1U A;  3NS8 A;  2MA9 B;  2IYD B;  2R2Q A;  4P7I A;  1OEY A;  2JXX A;  4RM8 A;  4X57 B;  1GJZ A;  3TIX A;  2LGY A;  1V5O A;  1X1M A;  3L16 A;  2M17 A;  4KIK A;  5DPW A;  2O2V A;  4KSL C;  4BBN F;  3AU5 A;  3APD A;  3ZLZ A;  2NPT A;  2BF8 B;  4FHJ A;  5D6J B;  2MLB A;  4G50 A;  1TTN A;  2DYO A;  3QA8 A;  1GNU A;  1WJU A;  1EO6 A;  2G3Q B;  2V1Y A;  4MGY E;  2IBI B;  2O6V D;  2GBR A;  2PJH A;  2RSU A;  3A9J B;  2UYZ B;  4RM9 A;  2L3Z A;  2BYV E;  3MHS D;  4EOY A;  1BT0 A;  2AEH A;  2DYM A;  4WWO A;  4EUT A;  1Q0W B;  1WXV A;  3KYD D;  1RAX A;  5JH5 C;  1K8R B;  1XQQ A;  3ZNI D;  4DWF A;  4HPL B;  2WWZ A;  3VHT C;  3ZUN A;  2L05 A;  3V6E B;  3A9K B;  1Z5S B;  4ANW A;  2C60 A;  2KLG A;  3ECI A;  2EMT A;  4KDL B;  4NJ7 A;  4LDT D;  4XC2 A;  1E5W A;  3DVG X;  5AZG A;  4FJV B;  4MGK E;  3SHQ A;  1RFA A;  1WR1 A;  2LRW A;  2NBV B;  2KJ6 A;  1RLF A;  1WX8 A;  4HDQ A;  3L54 A;  3DPD A;  5C23 A;  4NJ6 A;  2RPQ A;  3BIN A;  2MSE D;  2MBO A;  2LRU A;  4WQO B;  1L2N A;  2IO2 B;  3NZU A;  4TKN A;  2L7R A;  2ZVN A;  3ZVV A;  3L13 A;  5L95 C;  2M4N A;  1G6J A;  1GC7 A;  2N9P C;  4M8N A;  1PQS A;  3PT2 B;  4HPM B;  1OQY A;  3KUC B;  4AUQ C;  3HIZ A;  3JSV B;  3JW0 X;  3VTW A;  4EZK A;  3AU4 A;  4W9F A;  4K7S A;  3RUI B;  3PGE A;  3L10 B;  1E7U A;  2CKH B;  4EFO A;  2CR5 A;  2MBQ A;  3L0W B;  5D94 A;  3OJ4 B;  5CHF A;  1LQB A;  1WH3 A;  2M0X A;  4HK2 A;  2BYE A;  4ANX A;  1RRB A;  1ZW7 A;  2LI5 A;  3LJ3 A;  4II2 B;  2KFK B;  4GOC A;  2KAN A;  4FA6 A;  4ICV A;  4A20 A;  2MP2 B;  1WIA A;  2GBM A;  2JRI B;  4MM3 A;  1LM8 B;  4FJY A;  2O6V A;  4HVB A;  4IM0 A;  2KLC A;  2PEA A;  2PE6 B;  3QIJ A;  2L8J A;  3HHM A;  1WI0 A;  3R66 C;  2LVQ A;  4FBJ B;  4PYU A;  2L0T A;  3AI5 A;  5JHA A;  2YVC A;  1V80 A;  2DYB A;  2NBW B;  2ZEQ A;  2KC1 A;  3CSF A;  4GDL A;  4A3O A;  4IM3 A;  3V6C B;  4G0N B;  3ML8 A;  4IG7 B;  4J6I A;  5FR6 A;  1ZGU B;  1WGG A;  2Z0D B;  4CHK A;  5L83 A;  5HKH A;  1SGH A;  2KJH B;  4NNJ B;  3DOW A;  4FLH A;  3VH3 B;  3A1Q A;  4WJP A;  5C1Z A;  3PV1 A;  2K6Q A;  4YL8 A;  1LXD A;  4W9I A;  2CHZ A;  3VVW B;  1GG3 A;  2BKF A;  3PZD A;  4ZRJ A;  3EEC A;  4KV2 A;  3RZW C;  5EDS A;  2KTR A;  2L00 B;  4KZ0 A;  5BO4 B;  3ZNZ B;  1IPG A;  2JT4 B;  2FAZ A;  2XK5 A;  2R2O A;  2KOX A;  2KKC A;  1WJ6 A;  3B0A A;  3QAR A;  2KHW B;  3X23 A;  3ONS A;  3H9D A;  1P0R A;  4K7U A;  1QZE A;  3WAM A;  4DHZ B;  4DBG A;  2LUE A;  3JYU A;  5J18 A;  1KLV A;  1HE8 A;  3OAW A;  2K8H A;  1IYF A;  2NR2 A;  4BOZ B;  4HCP B;  3ZNH B;  4KDI C;  4NY0 A;  3RT3 B;  2CHW A;  4M8M A;  2G45 B;  3KH0 A;  3V60 A;  2V4L A;  2G4S A;  3M95 A;  4NAW B;  4AWJ A;  2GMI C;  2DX5 B;  3PRM B;  4W9C A;  4KIK B;  1WGH A;  1ZKH A;  4RMA A;  2O2V B;  4LJO B;  4TUU A;  2D11 A;  2JWZ A;  2XEW A;  4W9J A;  3VFK A;  2MCN B;  1WJ4 A;  2FIF A;  2VRR B;  5DCN A;  2KDB A;  1NDD A;  5DPR A;  3ZRF A;  4TQ1 A;  4WAA A;  4HJK A;  4MGZ E;  2J7Q B;  4IC7 B;  2BWE S;  3UQA A;  2LGD A;  4JL9 A;  1YD8 U;  4LJP B;  1J19 A;  3K9P B;  4II3 B;  3ZDT A;  3U30 A;  3N30 A;  4F7Z A;  4HWI B;  3TCA A;  3N3K B;  5JZE B;  4ZRI A;  5IAA C;  2K8C A;  4ICU A;  1R4N I;  4AJW A;  2HE7 A;  3QWZ B;  2Y5B B;  4FHK A;  3APF A;  1EF5 A;  4HDO A;  3M3J A;  1UGM A;  4IM2 A;  3VH4 B;  2WX1 A;  3R7R A;  3ZW3 A;  4PS7 A;  2NBU A;  1WMH B;  4K7W A;  5LLI A;  1V5T A;  2D07 B;  2CU1 A;  1YX6 B;  4HCN B;  3KUD B;  3DBR I;  3ALB A;  1E8Y A;  2I1K A;  2MWS B;  4EZJ A;  2L0F A;  3HM6 X;  3QCA A;  3HM3 A;  3EC8 A;  5LXH A;  3CST A;  1V2Y A;  4GSW A;  2DZK A;  4PYZ A;  3WA0 A;  2BYF A;  2AWT A;  2KDE B;  4EZL A;  2XBB C;  1P98 A;  1S3S G;  2L76 A;  3NY5 A;  4I6N B;  3ZTD A;  4BVU C;  2LXC A;  3N32 A;  5DPS A;  3SD5 A;  2KK8 A;  5TR5 A;  1WE7 A;  4JLC A;  3D32 A;  5E6O A;  1VCB A;  2I1J A;  3VAW A;  4E3C A;  2D10 A;  2BWF A;  2ZPY A;  2M1M A;  3A4R A;  4GB9 A;  3PRZ A;  3KYC D;  3WAP A;  3A9J A;  2N9E B;  3PHW B;  3UIO B;  3RD2 A;  2PE9 A;  4GMV A;  2B3A A;  2O6V B;  2ZNV B;  2RR9 A;  1IP9 A;  2KWC A;  4BKT A;  1CMX B;  2N1V A; 
#chains in the Genus database with same CATH topology
 3QJZ A;  3T3N A;  2GBJ A;  3KWL A;  1MI0 A;  3ZIM A;  1S1Q B;  3U2S C;  3WAO A;  4CQN A;  4TV3 A;  2MBB B;  2ZW0 A;  1T0S C;  4FUL A;  2FCQ A;  4DHJ B;  2DZJ A;  2LZ6 A;  3A33 B;  2BVC A;  2WXR A;  4MJS B;  3VTU A;  1HTQ A;  2N4F A;  2WYQ A;  1M4V A;  5AZF A;  2REX A;  4BFR A;  5IP4 D;  3AUL A;  2INP E;  3ZRC A;  4KGR A;  1HQR D;  3N1X C;  2KFK A;  1JQ4 A;  1N5W A;  3UQB A;  2LGI A;  5E6N A;  4FJZ A;  3RNA C;  3ZJU A;  1DGJ A;  1LFD A;  2AYO B;  2KTF A;  4MEM A;  3RI7 C;  2DAF A;  4IUM B;  3E56 A;  4BKG A;  4ANV A;  1XLQ A;  1H8C A;  2OJR A;  4XWT A;  3ZDM C;  4MAC A;  2IDY A;  4H2A A;  3N1Z C;  3PLV A;  4NPN A;  3EFU A;  5D3D A;  1NVI D;  2EEL A;  3IG3 A;  2KDF B;  4KX6 B;  1KOT A;  2MEK A;  1EUV B;  1VR9 A;  3PSE B;  1GB4 A;  3PVL A;  3OLM D;  2IY0 B;  3R7Q A;  1E7V A;  1H4R A;  1D5M C;  4C80 A;  2L83 A;  1R4N B;  2OOB B;  4A8X C;  4C4V A;  3AV8 A;  1P7E A;  4RGO S;  1XD3 B;  1KJT A;  3GB1 A;  4JWU C;  1TS2 A;  4E71 A;  2C7H A;  2C9W B;  4BKS D;  3R2T A;  1FXT B;  1AN8 A;  1YOV B;  1NYQ A;  2Y5C A;  1IGC A;  3DBH I;  2WX0 A;  2V3N A;  2V3S A;  1I4G A;  1NI2 A;  3Q14 C;  2WXH A;  2CJN A;  4HLE A;  3BZD B;  2BB5 A;  3B08 A;  4MM3 B;  3TEZ A;  1OQQ A;  3M62 B;  1OFF A;  1SE9 A;  3B2F A;  1V1P A;  1TJE A;  2QIL A;  3AE3 B;  4GDK B;  4IWP A;  3VTV A;  1SIF A;  5G55 A;  2Z59 B;  3T8M A;  2NCN A;  4YSZ B;  3ZTC A;  3FIL B;  5EE9 A;  4A3P A;  5E6P A;  4ZDV A;  5EE0 A;  4DDI D;  4XZ4 A;  2L1A A;  2UU7 A;  1KRH A;  2DZM A;  3QX1 A;  1WE6 A;  4TMA B;  3LB8 C;  4ASW C;  3DBL I;  2N9L A;  3SR6 A;  1SB3 C;  3GE3 C;  2MX2 A;  1PFD A;  1FRD A;  3V61 A;  3FKY A;  4RFB A;  3O65 B;  5T8I A;  2KVZ A;  1C3T A;  2N0S B;  3U52 E;  2JF5 A;  3ZYY X;  1Z2M A;  2N7E A;  4WWM A;  4YSY B;  2DLB A;  3LXF A;  1R4M B;  2KX3 A;  1Y8R C;  1I42 A;  1GUA B;  3AE7 B;  1WSP A;  3QHT A;  4YTM B;  2K5P A;  4WWP A;  3AM9 A;  1I4P A;  2KMC A;  3M63 B;  4WQM A;  3SEB A;  2FCS A;  2KFJ A;  2FE8 A;  1D5Z C;  2ZCC A;  3WCQ A;  1KM7 A;  2M56 B;  4M00 A;  2BKR B;  3KW5 B;  4KVG B;  3DCG A;  1C1Y B;  3H1U A;  1V1O A;  1GJZ A;  1OEY A;  4HKZ E;  3L16 A;  2M17 A;  5DPW A;  4KSL C;  3APD A;  4HPP A;  2NPT A;  4FHJ A;  4G50 A;  1TTN A;  2OHF A;  1C4A A;  1EM7 A;  1EO6 A;  2G3Q B;  2V1Y A;  2HDE A;  4A6Q A;  2O6V D;  4Q2J A;  4RM9 A;  1XF5 L;  2DYM A;  4TSS A;  1K8R B;  4DWF A;  2WWZ A;  4KKI A;  1F2R C;  1Z5S B;  3Q8C A;  2KQ4 X;  2IGG A;  5TSS A;  2C60 A;  3ECI A;  2EMT A;  2RDG A;  4FJV B;  2LRW A;  4BAX A;  1RLF A;  1FEH A;  1WX8 A;  1EU3 A;  1L2N A;  2TSS A;  3AE9 B;  3NZU A;  4TKN A;  2ZVN A;  1GC7 A;  1F0Z A;  3KUC B;  4AUQ C;  3HIZ A;  3JSV B;  4EZK A;  2CKH B;  2CR5 A;  5CHF A;  1LQB A;  1WH3 A;  2M0X A;  2BYE A;  3U4E G;  2HJ1 A;  1QKZ A;  3LJ3 A;  1UWX A;  1QF6 A;  4HVB A;  2KLC A;  2PEA A;  2PE6 B;  2L32 A;  2L8J A;  3HHM A;  2IGH A;  2ZEQ A;  3NVZ A;  2KC1 A;  4JWS C;  4A3O A;  1IBX A;  1P7F A;  1ZDX A;  2SEB D;  2Z0D B;  4CHK A;  2KJH B;  3NVV A;  4YL8 A;  5EE1 A;  2CHZ A;  2VH2 A;  1KLU D;  5C2T B;  2BKF A;  4ZRJ A;  1B9R A;  2KTR A;  3ZNZ B;  1ROE A;  1RYJ A;  2LGS A;  2FAZ A;  3ONS A;  3BYY B;  3ABV B;  5J18 A;  1LO5 D;  1YN4 A;  4KDI C;  4NY0 A;  4M0W A;  1ENF A;  3RT3 B;  3KH0 A;  2JQR B;  2V4L A;  4NAW B;  1I7H A;  4KIK B;  2O2V B;  2D11 A;  2JWZ A;  4W9J A;  5BYR A;  2KAC A;  1NDD A;  3ZRF A;  3P42 A;  1E10 A;  2J7Q B;  3I63 C;  4IC7 B;  1PGB A;  1BXT A;  3ZDT A;  1TZO A;  4GLS C;  3TCA A;  4ZRI A;  4S0R A;  4AJW A;  2HE7 A;  3QWZ B;  3MJ5 A;  2WX1 A;  3R7R A;  3ZW3 A;  2NBU A;  1QOA A;  1WMH B;  1QLB B;  4K7W A;  1TY2 A;  4K3B A;  3KUD B;  4EZJ A;  3BVM A;  3EC8 A;  3HRD D;  2AWT A;  4BVU C;  3NJT A;  3N32 A;  1JWS D;  3SD5 A;  1PUT A;  1F2R I;  1SIJ A;  3OWE B;  1ZE3 D;  3D32 A;  2ZPY A;  2M1M A;  3A4R A;  3P63 A;  2V9H A;  1WRI A;  3WAP A;  3AED B;  2WHI A;  2PE9 A;  2RR9 A;  1IP9 A;  2KWC A;  2D5G A;  1CMX B;  1B1Z A;  1WGD A;  3TMP B;  3A9K A;  1SSN A;  3DHI C;  4GDL B;  2INN E;  1N61 A;  1WX9 A;  3PS6 A;  4GU2 A;  2OED A;  3A1Q B;  1KF6 B;  2WXK A;  5BMI A;  5HFY A;  1WYW B;  1YJI A;  5FR3 A;  2LWP A;  3BVZ A;  5GMV A;  5GXG B;  2X8X X;  3Q8A A;  5IA7 A;  2MBE A;  2LFI A;  1P1A A;  2MBH A;  3H7P B;  3EHV A;  4O1N A;  3IHP C;  4OVU A;  2WNM A;  1YNT E;  3HVD A;  3ZKJ C;  3BY4 B;  2GOW A;  1WFY A;  2KNB A;  3AH7 A;  2LVO A;  3AE1 B;  1WGY A;  4XDC A;  2BQQ A;  3B1L X;  1J8C A;  3AE5 B;  1V86 A;  4LCD E;  3IVF A;  3S2A A;  1WY8 A;  2DWQ A;  4IW0 A;  2K8B A;  1TKY A;  1WRD B;  3A4S C;  2KQS A;  4NQK E;  2AQ1 B;  1CJE A;  1YIW A;  3APC A;  4WWN A;  2LUM A;  1YJ1 A;  3W1S C;  3DHH C;  3CIR B;  1FNU A;  1ZOY B;  4MH0 E;  2LHE A;  1E8X A;  1QIL A;  4GIV A;  4ZRQ A;  3ZXV A;  3UIN B;  1I35 A;  2CU3 A;  2WDR B;  3Q3N C;  4PK1 A;  3VR9 B;  4K81 A;  3RYT A;  4OVV A;  3BWU D;  1ZXI A;  3SDL C;  1D4B A;  1FIQ A;  1FXA A;  1J7B A;  2J53 A;  4ARI A;  3RUL A;  3AXC A;  1NBF C;  3TEX A;  4AOF A;  2N1W A;  4IOI E;  2IO3 B;  1OQR A;  2KWD A;  1WXM A;  2JVC A;  3W1S A;  2ON8 A;  1YQB A;  2J0M A;  2ZPN A;  1UZX B;  2D3G A;  5IOI A;  1RFK A;  2R61 A;  1T0Y A;  1V81 A;  2IO0 B;  4XWW A;  1J0G A;  2ZNV C;  4E74 A;  3P2B A;  4K1R B;  3DBS A;  4CYE A;  1ZDV A;  5BMH A;  3W5V B;  2QSD A;  4WJN A;  3B2G A;  1VD2 A;  1ZPS A;  4IDI A;  1XLP A;  1N60 A;  4YTN B;  1UBQ A;  3L17 A;  2WXG A;  3QAQ A;  1MG8 A;  2BTE A;  4DHZ E;  4W9D A;  1E8W A;  2MW5 A;  3QC8 B;  4CO7 A;  3VUX A;  3AEF B;  2FBW B;  4GGQ A;  1OTR B;  2E3T A;  1WM3 A;  2G9H D;  2K25 A;  2VH1 A;  2WXO A;  4JGH B;  1V9J A;  3Q6B A;  3C0R B;  2GI9 A;  5KHO A;  3H8H A;  1KFY B;  5D2M B;  4DXF A;  1XLN A;  3LDZ E;  2MP2 A;  2D3B A;  1E0Z A;  3ENE A;  4KGS A;  3K9O B;  3QK0 A;  1T3Q A;  2K9X A;  3RNF C;  1YMH E;  1P9D U;  1WXQ A;  3AN1 A;  3Q3J A;  2DZI A;  5J17 A;  2N9X A;  4MJS A;  2KD0 A;  3WAL A;  3GS2 A;  4ARC A;  4S17 A;  1L7Y A;  1C78 A;  2B76 B;  3DVN U;  3L08 A;  1HEZ E;  4YT0 B;  4RGT A;  2G4D B;  4P1B C;  1UGJ A;  2MQJ A;  3PRP B;  3PO0 A;  1P3Q U;  4G3X B;  2BGF A;  4EKU A;  4MGI E;  2AQ3 B;  3I3T B;  2IYD B;  4X57 B;  4P7I A;  1F77 A;  3BII D;  2YEP F;  3W5U B;  1L6V A;  1X1M A;  1TY0 A;  3AU5 A;  4HRS A;  1BUI C;  3RFZ B;  2MJE A;  5D6J B;  3P4Q B;  3AMZ A;  5IKC M;  1WJU A;  1E9M A;  4K3C A;  2W3R A;  3P4R B;  2GBR A;  2BYV E;  2AEH A;  1TKE A;  1Q0W B;  2W55 A;  1XQQ A;  3VHT C;  3ZUN A;  3V6E B;  2G1E A;  2PKO A;  2KLG A;  4F1S A;  4XC2 A;  4NJ7 A;  1E5W A;  3DVG X;  1C4P A;  5G5H A;  3SHQ A;  1RFA A;  1MG4 A;  2PVG C;  2NBV B;  2MHJ A;  3L54 A;  3DPD A;  2EKI A;  5C23 A;  4NJ6 A;  2MBO A;  4MT5 A;  3ZVV A;  1JWB D;  3I9V 1;  2PW9 A;  3JW0 X;  3VTW A;  1RM6 C;  2MBQ A;  1XXG A;  1XO3 A;  3AEA B;  3DHG C;  1T0R C;  2LI5 A;  4XGA B;  4II2 B;  3GZN B;  1L0Y B;  4MM3 A;  1LM8 B;  4IM0 A;  2V3P A;  1WI0 A;  1QOF A;  1CZP A;  3MC0 B;  5JHA A;  3CSF A;  4IG7 B;  5HKH A;  1SGH A;  4NNJ B;  4FLH A;  3VH3 B;  4NJC A;  4WJP A;  1TS4 A;  5C1Z A;  1K52 A;  3IAS 1;  4W9I A;  2INC C;  4KGT A;  3PZD A;  4P1C C;  1YQ4 B;  3EEC A;  4KV2 A;  3RNB C;  5EDS A;  2L00 B;  4KZ0 A;  1IPG A;  2JT4 B;  5E6J A;  3AE6 B;  2ZW1 A;  2QJL A;  1JRO A;  3NG0 A;  1N62 A;  1IYF A;  4XYC A;  1DOY A;  2G45 B;  2GMI C;  2DX5 B;  3PRM B;  3URY A;  1ZP0 B;  4TUU A;  1MPE A;  2XEW A;  2MCN B;  1I4R A;  2KDB A;  2IPK D;  4HJK A;  3SFE B;  2SAK A;  3UQA A;  4JL9 A;  2JYE A;  1I4H A;  4LJP B;  3U30 A;  4F7Z A;  1KLG D;  4HWI B;  5D3I B;  3N3K B;  3I57 A;  1R4N I;  1IUE A;  1YQ3 B;  2RMM A;  4YWG G;  1UGM A;  4IM2 A;  3VH4 B;  4PS7 A;  1SE4 A;  2KDM A;  5LLI A;  4HCN B;  4LK0 M;  4USA A;  2WXI A;  1E8Y A;  2I1K A;  1C9F A;  3HM3 A;  1V2Y A;  4JE3 B;  1TKG A;  2JYT A;  2KDE B;  2XBB C;  4ZRP A;  1S3S G;  4I6N B;  2L76 A;  3NY5 A;  2LXC A;  3TEY A;  3EGR A;  5DPS A;  5TR5 A;  1VCB A;  2I1J A;  4HKQ A;  3TUO A;  3KYC D;  1TYG B;  2N9E B;  3MP9 A;  5HI1 A;  2B3A A;  2NTS A;  2WXQ A;  2GRI A;  1N6Z A;  2N1V A;  2KZR A;  4OHJ A;  3PZ7 A;  1PGA A;  2VZK D;  2CJO A;  3ZNG C;  3H7S A;  3WAN A;  1ZUD 2;  1FNW A;  3KVF B;  1DOX A;  1ET9 A;  4UDU C;  2C7M B;  3VUW A;  2CS4 A;  2WXN A;  1MHX A;  2ACZ B;  4GXB A;  3DQV A;  3JSV A;  3DWG C;  4OZC A;  1Y56 A;  3AEB B;  2A4Z A;  1TZ1 A;  4MSQ B;  4NQL B;  3BK2 A;  1A5R A;  2J42 A;  2RD0 A;  4HXD A;  1C4C A;  4JQW C;  1IGD A;  2LMC A;  3Q8F A;  1R4M I;  4PS3 A;  3GOE A;  4ZYN A;  2QHO A;  4GN1 A;  1L0X B;  2PPH A;  1EWC A;  2KN4 A;  2JUO A;  2QCZ A;  5CX3 A;  4ZHO A;  2J0J A;  4LNF A;  2PLP A;  2Y5P A;  1QOB A;  2QMT A;  1WX7 A;  5LXI B;  2K39 A;  1TBE A;  4A9A A;  2JZZ A;  4LTU A;  4XX5 A;  2WXJ A;  3PZ8 A;  3P1M A;  4I6P A;  2HJ8 A;  4NAW A;  3WIM A;  2WDV B;  2UWQ A;  2ZVO A;  3PPA A;  3VRB B;  3PHX B;  3MJW A;  3VQI A;  1WR6 E;  4B95 A;  3CF6 E;  4WUR A;  2D3C A;  1C76 A;  1D3Z A;  3DBR B;  4W9G A;  2EKE C;  1WXA A;  2KDI A;  4N6E B;  4P16 A;  1OGW A;  3KLS X;  3R8B A;  3IFW B;  1WM2 A;  1JRP A;  1UEL A;  3IBE A;  3HK0 A;  1MFW A;  1WMH A;  2IZV B;  3BK1 A;  3IAM 1;  4F8C B;  1T0Q C;  2DAJ A;  3U8Z A;  4A55 A;  4YTP B;  2KWU B;  1JW9 D;  3R3M A;  3ETR A;  4DK5 A;  1K50 A;  4DXA B;  4URK A;  1L0V B;  2LXA A;  3MFG A;  1ISN A;  3NVY A;  4ZOH C;  4PS8 A;  1NI3 A;  4B0M A;  2WLB A;  2RDB C;  4WJQ A;  2C5L C;  2D2Q A;  2K1F A;  2LVP A;  4BKS A;  4L1B A;  3X0W A;  2XK5 B;  2HTH A;  5G2N A;  1Q5W B;  2GLS A;  5AUI A;  3BVG A;  1WJN A;  2NMQ A;  1LGR A;  3V62 A;  3EFC A;  1WZ0 A;  2GBK A;  5AZH A;  1F52 A;  1AWD A;  4AP4 C;  1WZ3 A;  1GC6 A;  4R3D A;  2ICI A;  2KMA A;  2BYT A;  3VUY A;  3VXW A;  1YX5 B;  2CHX A;  4C00 A;  3PTF C;  5G5G A;  2D3A A;  4QAY A;  3RNG C;  1EF1 A;  2JX5 A;  3Q8E A;  4ITK A;  4US8 A;  1E7P B;  4TQ0 A;  1FM0 D;  3QQ8 B;  4ACF A;  4ANU A;  1UF0 A;  2ASQ A;  2H88 B;  2JWU A;  3H7P A;  3NZS A;  2WP9 B;  4IWO A;  1FRR A;  2NVU I;  3Q3F A;  2QEJ C;  5LNK 1;  5CHV C;  2JSV X;  2Z8L A;  1AAR A;  2N7J A;  2JY6 A;  1C77 A;  3KUZ A;  2MRP A;  4XE0 A;  1UH6 A;  2NS5 A;  2ZCB A;  3U7Z A;  3RZF A;  2R2Q A;  3TIX A;  4WH4 A;  1JWA D;  1V5O A;  3AE8 B;  4M02 A;  3ZLZ A;  2I38 A;  3QA8 A;  2Q5W D;  1GNU A;  4JPS A;  1DYQ A;  1ACC A;  4MGY E;  1FCC C;  3A9J B;  3C8Y A;  4EE2 A;  4EOY A;  2L3Z A;  1BT0 A;  4WWO A;  2W54 A;  2OJW A;  3ZNI D;  4NAM A;  2L05 A;  1VZ6 A;  1A70 A;  4ANW A;  3DBH B;  1HA5 A;  4KDL B;  4MGK E;  2BS4 B;  2KJ6 A;  4HDQ A;  3BIN A;  2MSE D;  3TSS A;  2LRU A;  4WQO B;  2AX5 A;  2L7R A;  3C19 A;  1G6J A;  2M4N A;  2N9P C;  4M8N A;  1PQS A;  3PT2 B;  4HPM B;  1OQY A;  4N58 A;  2AQ2 B;  1MHH E;  3AU4 A;  4W9F A;  3RUI B;  3PGE A;  1E7U A;  4EFO A;  2RPV A;  4RCO A;  4US9 A;  3L0W B;  3DWM A;  2KYW A;  4ANX A;  1RRB A;  2KFK B;  4GOC A;  4ICV A;  4A20 A;  2MP2 B;  1WIA A;  2GBM A;  2JRI B;  4FJY A;  2O6V A;  2QIE B;  5BMG A;  3ZJT A;  4PYU A;  4PT5 A;  2K0P A;  2NBW B;  3DBL B;  4IM3 A;  2WU2 B;  4J6I A;  2VZK B;  5FR6 A;  1FPY A;  1ZGU B;  3DOW A;  3RMK C;  3MHZ A;  1LXD A;  1TT5 B;  3EA6 A;  2BW2 A;  1L4Z B;  1GG3 A;  3RZW C;  2LJI A;  1UUP A;  1WWT A;  5BO4 B;  3W2D A;  4LNK A;  2R2O A;  2KOX A;  2KKC A;  1WJ6 A;  3B0A A;  3X23 A;  1P0R A;  2NTT A;  1PGX A;  3WAM A;  4DHZ B;  2LUE A;  1KLV A;  3OAW A;  2K8H A;  2NR2 A;  3VRA B;  4HCP B;  3ZNH B;  4M8M A;  1J7C A;  2G4S A;  4AWJ A;  4BZA A;  1WGH A;  1SEB D;  2LHD A;  4LJO B;  4C4V B;  3NVW A;  1QOG A;  1FCL A;  1WJ4 A;  2FIF A;  2VRR B;  3N1Y C;  5DCN A;  5DPR A;  3ZXR A;  1FMA D;  4TQ1 A;  3RN9 C;  4WAA A;  2KAJ A;  3K9P B;  5MPO A;  4II3 B;  2J52 A;  1I4X A;  5JZE B;  2DNF A;  5IAA C;  4RH6 A;  4HDO A;  2Y5B B;  3APF A;  3M3J A;  1VZ7 A;  2WQY B;  1JML A;  2D07 B;  2CU1 A;  2WU5 B;  4C7Z A;  1SJE D;  1V1P B;  3CWI A;  3ALB A;  3AE2 B;  2BB6 A;  4J3O D;  5LXH A;  3CST A;  4GSW A;  1SE3 A;  3WA0 A;  2FUG 1;  2BYF A;  2K3U A;  4EZL A;  1P98 A;  1WE7 A;  5E6O A;  4E3C A;  2D10 A;  2BWF A;  1SXT A;  1TS3 A;  4GB9 A;  3AEE B;  4RF0 A;  3KQ4 A;  3PHW B;  5BYS A;  4GMV A;  1T6B X;  3MC8 A;  4BKT A;  2BT6 A;  2FCM A;  1D6E C;  3N20 C;  2A5U A;  2XNA C;  4MSM B;  2LJ5 A;  2ZZP B;  3CMM B;  1C79 A;  1D5X C;  3E9S A;  4B9K A;  1E8Z A;  4LDT B;  4GDK A;  3KWV A;  1STE A;  4JIO U;  5J2R A;  1DOI A;  4LNI A;  1VZ8 A;  4B0E A;  2AL3 A;  1MJD A;  2JPH A;  1FD6 A;  4IKG A;  2X38 A;  1JWM D;  2LD9 A;  3FIL A;  1SBB B;  3U7D A;  2IJ0 A;  2K6D B;  2GBN A;  2KJR A;  1SF0 A;  2DEN B;  5IO9 A;  4LNO A;  5KHQ A;  1V97 A;  3JVZ X;  2W9N A;  3TBL D;  3P4S B;  3Q3O C;  2C7N B;  3V05 A;  2ZJD A;  3RPF C;  3UI3 A;  2EMS A;  2YLM A;  2KWV B;  5EE3 A;  1WGR A;  3UIP B;  3IXS A;  4G11 A;  3UGB B;  1WYG A;  5IN7 A;  1V8C A;  2AL6 A;  2FID A;  4D2K A;  3NUH B;  1GB1 A;  1K51 A;  1AW7 A;  2QDF A;  1NYR A;  2IO1 B;  1TGZ B;  4OW0 A;  2KMM A;  2NPT B;  2HD5 B;  1TIF A;  3H6N A;  5FKA C;  1F9J A;  4EEW A;  1Q10 A;  4DDG D;  1XT9 B;  2RDH A;  2KN5 A;  1AYF A;  2PMV A;  4ZRK A;  4REZ A;  3MC9 A;  3W9C B;  4WJO A;  3TL5 A;  3J9C A;  4BBN C;  2K22 A;  1E90 A;  5AUK A;  1GOZ A;  1L6U A;  4HRO A;  1T5X D;  2J0K A;  5JHB A;  4MDK E;  1N5X A;  1YN3 A;  5AEK B;  3ML9 A;  3GE8 C;  2FUH B;  2WDT B;  1UD7 A;  3NHE B;  2LEK A;  4DXG A;  2HTM E;  1F1H A;  3DDC B;  2JRH A;  3N9Y C;  3DVG Y;  2IY1 B;  3AE4 B;  2J4X A;  2FNJ B;  2IND C;  4AS1 A;  4W9H A;  1V49 A;  1L4D B;  4W9E A;  4L2Y A;  1VLB A;  2LGX A;  3O13 A;  4MEL A;  3IT4 B;  2Z0E B;  4MH8 A;  2KC2 A;  3VDZ A;  3LYY A;  3PLU A;  3PRE A;  2FCN A;  2KO3 A;  1RWS A;  4W9L A;  2KX0 A;  2V4I B;  4DHJ D;  2JXT A;  4B6W A;  2M8S A;  3GP7 A;  3MTN B;  1IBX B;  4AJY B;  2KVR A;  2BPS A;  5CTR C;  2KXJ A;  4OZB A;  4N9F 4;  1M94 A;  3GZN I;  5HHD G;  2KQ7 A;  4JX1 C;  4RNA A;  3AEG B;  3T9L A;  3FAH A;  2KTR B;  1WF9 A;  2N9K A;  4HEA 1;  3UF8 A;  2PIA A;  3RNE C;  3NZ3 A;  1R7S A;  1V6E A;  2JU6 X;  3IT6 B;  3SU8 X;  3W1Y A;  2DHZ A;  2RGF A;  4W9K A;  4M0W B;  1JRU A;  5D7G A;  3NRZ A;  2WXP A;  1FXI A;  2DBY A;  2LAS A;  2PVO D;  3T3O A;  2KT7 A;  1SJH D;  2W3S A;  4KZC A;  3ZO5 B;  4FAD A;  3RCZ A;  1WXS A;  1FFU A;  1Q1O A;  2M19 A;  4HJG E;  2W82 A;  4XDD A;  2JZ3 B;  5CHW A;  4KSK C;  2BS3 B;  1KH0 A;  5DPT A;  3NOB A;  1UBI A;  2BS2 B;  4BOS C;  1CQV A;  1U4A A;  3AB5 A;  4IWQ A;  4WIP A;  3DVN V;  1OEY J;  3OJ3 A;  2WGS A;  3HVZ A;  3BYT B;  1FFV A;  4FN2 A;  2I2Y A;  1UWM A;  4I6L B;  1JCK B;  1NEK B;  2N7D A;  3TJP A;  2M0A A;  3HUI A;  3ZQ4 A;  3P4P B;  4AQ7 A;  1GPX A;  3NS8 A;  2MA9 B;  4RM8 A;  2JXX A;  2LGY A;  1EWY C;  1I4Q A;  4KIK A;  1KTK A;  2O2V A;  5HG2 A;  4BBN F;  1ET6 A;  2WXL A;  3B9J A;  2BF8 B;  2MLB A;  3ZGZ A;  2DYO A;  2MJD A;  1EU4 A;  4WAF A;  2IBI B;  1NEN B;  2PJH A;  2RSU A;  1QQR A;  2UYZ B;  3MHS D;  4EUT A;  1HTO A;  1WXV A;  3KYD D;  1RAX A;  5JH5 C;  2GB1 A;  1VRA B;  3Q8B A;  4P6V F;  4HPL B;  5I4D A;  1QT9 A;  2QC8 A;  3A9K B;  1ZXH A;  1HZ6 A;  4LNN A;  1VDV A;  4LDT D;  5AZG A;  1WR1 A;  3EUB 2;  2JZP A;  2RPQ A;  3OG5 A;  2IO2 B;  3FC4 A;  4N59 A;  4YSX B;  4RGM A;  5L95 C;  3L13 A;  3V3X A;  1XCT L;  2WDQ B;  4K7S A;  3VR8 B;  3L10 B;  5H8Y E;  5D94 A;  3OJ4 B;  4HK2 A;  3RNC C;  5FK9 C;  1ZW7 A;  4FA6 A;  2KAN A;  1XEE A;  5C3J B;  3QIJ A;  1GAQ B;  2XN9 C;  3R66 C;  2LVQ A;  4FBJ B;  4OZA A;  1YN5 A;  2L0T A;  3AI5 A;  2YVC A;  1V80 A;  2DYB A;  1J7A A;  4GDL A;  3V6C B;  2PTL A;  4G0N B;  3ML8 A;  1VJK A;  1PYW D;  3R2I A;  1HZ5 A;  1WGG A;  5L83 A;  3A1Q A;  3PV1 A;  2K6Q A;  1SE2 A;  3VVW B;  5JXV A;  4KKJ A;  3AEC B;  4RF1 A;  2XK5 A;  3L4P A;  4DQO C;  1BML C;  1XLO A;  1ESF A;  1FNV A;  3QAR A;  2KHW B;  4RGN A;  2E6X A;  3H9D A;  1JWU D;  4K7U A;  1QZE A;  4FXC A;  4DBG A;  3JYU A;  3ZJV A;  1HE8 A;  4BOZ B;  4A90 A;  2V0G A;  2CHW A;  1JAL A;  3V60 A;  3M95 A;  2ONQ A;  4W9C A;  1FO4 A;  1L5P A;  1ZKH A;  1E6E B;  4RMA A;  3NS1 A;  1TS5 A;  3VFK A;  3Q2A C;  4ZYS A;  1HXY D;  2WS3 B;  4YXD B;  4MGZ E;  2BWE S;  2LGD A;  1YD8 U;  1MVK A;  1J19 A;  4OVZ A;  2YEP B;  3N30 A;  1UNS A;  4C7Y A;  2BBC A;  2H89 B;  5BYQ A;  2K8C A;  4ICU A;  4C56 C;  2WXF A;  4FHK A;  1N63 A;  1EF5 A;  2MJ3 A;  1CK1 A;  2WXM A;  2Y3A A;  1V5T A;  1XCQ L;  1PDX A;  3Q3M C;  1YX6 B;  3DBR I;  4L23 A;  2IGD A;  4ZHP A;  2MWS B;  2L0F A;  3HM6 X;  3QCA A;  3Q69 A;  4LLG M;  4NZL B;  4M01 A;  2DZK A;  4PYZ A;  3SFD B;  1K53 A;  3TEW A;  3ZTD A;  1YJJ A;  5H92 C;  3I5J C;  2KK8 A;  4JLC A;  3VAW A;  3PRZ A;  1WGK A;  2L52 A;  3A9J A;  3UIO B;  3RD2 A;  2O6V B;  2ZNV B;  2MH7 A; 
#chains in the Genus database with same CATH homology
 1WGD A;  3TMP B;  2FCM A;  3QJZ A;  2KZR A;  3A9K A;  2A5U A;  2GBJ A;  3ZNG C;  4MSM B;  2LJ5 A;  4GDL B;  2ZZP B;  3CMM B;  3H7S A;  3ZIM A;  1WX9 A;  3WAN A;  3KVF B;  1S1Q B;  3WAO A;  3PS6 A;  4GU2 A;  4B9K A;  2C7M B;  4TV3 A;  1E8Z A;  4LDT B;  4GDK A;  3VUW A;  2CS4 A;  4JIO U;  5J2R A;  2MBB B;  3A1Q B;  4FUL A;  2AL3 A;  4GXB A;  2FCQ A;  2JPH A;  4DHJ B;  2DZJ A;  2LZ6 A;  3DQV A;  1WYW B;  3A33 B;  2LWP A;  3JSV A;  2LD9 A;  3U7D A;  5GMV A;  4MJS B;  3VTU A;  5IA7 A;  2MBE A;  2N4F A;  2A4Z A;  2WYQ A;  1TZ1 A;  4MSQ B;  2K6D B;  1P1A A;  2GBN A;  4NQL B;  5AZF A;  2KJR A;  2DEN B;  2MBH A;  2REX A;  3EHV A;  3H7P B;  4BFR A;  5KHQ A;  3IHP C;  3AUL A;  4OVU A;  3ZRC A;  1A5R A;  2RD0 A;  4HXD A;  3ZKJ C;  3JVZ X;  2W9N A;  3BY4 B;  3TBL D;  2KFK A;  4JQW C;  2GOW A;  1WFY A;  2C7N B;  2KNB A;  2ZJD A;  3UQB A;  2EMS A;  2LVO A;  2YLM A;  2KWV B;  5E6N A;  1WGR A;  1R4M I;  4FJZ A;  1WGY A;  3UIP B;  4G11 A;  3UGB B;  4PS3 A;  3B1L X;  3GOE A;  1J8C A;  1LFD A;  2AL6 A;  2FID A;  2AYO B;  2KTF A;  1V86 A;  4ZYN A;  4MEM A;  4LCD E;  2QHO A;  3IVF A;  4GN1 A;  2DAF A;  3S2A A;  4IUM B;  1WY8 A;  4BKG A;  2IO1 B;  1TGZ B;  4IW0 A;  4ANV A;  2K8B A;  1H8C A;  1WRD B;  2PPH A;  3A4S C;  2KQS A;  4NQK E;  2JUO A;  5CX3 A;  2J0J A;  2OJR A;  2NPT B;  3ZDM C;  2HD5 B;  1YIW A;  3APC A;  4WWN A;  3H6N A;  1YJ1 A;  1F9J A;  3W1S C;  4EEW A;  4DDG D;  1XT9 B;  2KN5 A;  3PLV A;  4ZRK A;  4NPN A;  4MH0 E;  4WJO A;  1WX7 A;  3EFU A;  3TL5 A;  1E8X A;  2K39 A;  4GIV A;  5LXI B;  1TBE A;  3UIN B;  4BBN C;  1I35 A;  1E90 A;  3IG3 A;  4K81 A;  2JZZ A;  2KDF B;  2J0K A;  4XX5 A;  3RYT A;  5JHB A;  1KOT A;  4OVV A;  1EUV B;  4MDK E;  3PSE B;  5AEK B;  4I6P A;  2HJ8 A;  3ML9 A;  3PVL A;  3SDL C;  3OLM D;  2FUH B;  2IY0 B;  4NAW A;  3R7Q A;  2WDT B;  1E7V A;  1H4R A;  1UD7 A;  3WIM A;  2OOB B;  3NHE B;  3RUL A;  3AXC A;  1NBF C;  2UWQ A;  3DDC B;  4AOF A;  2JRH A;  1XD3 B;  2N1W A;  2ZVO A;  1KJT A;  3DVG Y;  3PPA A;  2IY1 B;  3PHX B;  4F1S A;  2IO3 B;  3MJW A;  4E71 A;  2C7H A;  3VQI A;  2C9W B;  2FNJ B;  1WXM A;  4BKS D;  1WR6 E;  1FXT B;  4B95 A;  2JVC A;  3CF6 E;  3W1S A;  4W9H A;  1D3Z A;  1V49 A;  3DBH I;  2WX0 A;  4W9E A;  2V3S A;  4W9G A;  1YQB A;  2LGX A;  2EKE C;  1NI2 A;  2J0M A;  2ZPN A;  1WXA A;  1UZX B;  2KDI A;  2D3G A;  4MEL A;  1OGW A;  4HLE A;  2Z0E B;  1T0Y A;  1V81 A;  2IO0 B;  2KC2 A;  3IFW B;  1WM2 A;  3VDZ A;  2ZNV C;  1J0G A;  4E74 A;  3B08 A;  3P2B A;  1UEL A;  3IBE A;  3HK0 A;  3PLU A;  3PRE A;  4K1R B;  3DBS A;  1WMH A;  4CYE A;  2FCN A;  2IZV B;  4F8C B;  3M62 B;  1SE9 A;  2KO3 A;  2DAJ A;  3U8Z A;  4W9L A;  2KX0 A;  2KWU B;  4GDK B;  4WJN A;  3R3M A;  4DHJ D;  4IWP A;  4DK5 A;  3VTV A;  4B6W A;  1VD2 A;  2M8S A;  4DXA B;  1SIF A;  4URK A;  3MTN B;  5G55 A;  2Z59 B;  4AJY B;  2KVR A;  2LXA A;  2BPS A;  3T8M A;  2NCN A;  5CTR C;  2KXJ A;  4N9F 4;  1UBQ A;  1ISN A;  3ZTC A;  4A3P A;  3L17 A;  5E6P A;  1M94 A;  3GZN I;  4ZDV A;  3QAQ A;  1MG8 A;  2KQ7 A;  4DDI D;  4XZ4 A;  4DHZ E;  4PS8 A;  3T9L A;  4W9D A;  1E8W A;  2MW5 A;  3QC8 B;  4CO7 A;  2DZM A;  3VUX A;  3QX1 A;  1WE6 A;  2KTR B;  4WJQ A;  1WF9 A;  1OTR B;  4GGQ A;  2C5L C;  1WM3 A;  2D2Q A;  2K1F A;  2K25 A;  2LVP A;  3DBL I;  4ASW C;  3UF8 A;  4BKS A;  3X0W A;  2XK5 B;  2HTH A;  4JGH B;  1V9J A;  5G2N A;  2MX2 A;  1Q5W B;  3C0R B;  5KHO A;  3V61 A;  1WJN A;  5D2M B;  1V6E A;  3O65 B;  3SU8 X;  3V62 A;  3LDZ E;  3W1Y A;  1WZ0 A;  2MP2 A;  2DHZ A;  2GBK A;  2RGF A;  4M0W B;  4W9K A;  1C3T A;  1JRU A;  5D7G A;  5AZH A;  4AP4 C;  2LAS A;  1WZ3 A;  1GC6 A;  2JF5 A;  2KMA A;  3ENE A;  3K9O B;  3QK0 A;  3VUY A;  3VXW A;  1YX5 B;  2CHX A;  3PTF C;  1Z2M A;  2N7E A;  4KZC A;  3ZO5 B;  1EF1 A;  4FAD A;  1P9D U;  3RCZ A;  1WXS A;  1Q1O A;  2KX3 A;  3Q3J A;  2DZI A;  1Y8R C;  5J17 A;  4TQ0 A;  2JZ3 B;  2N9X A;  5CHW A;  4KSK C;  1I42 A;  4MJS A;  1GUA B;  3QQ8 B;  5DPT A;  2KD0 A;  3NOB A;  1UBI A;  3WAL A;  4ANU A;  3QHT A;  4BOS C;  2ASQ A;  1L7Y A;  1U4A A;  3H7P A;  4WWP A;  4IWQ A;  3DVN V;  2KMC A;  3NZS A;  4IWO A;  1OEY J;  2NVU I;  3OJ3 A;  3Q3F A;  3M63 B;  5CHV C;  3DVN U;  3L08 A;  2FCS A;  2KFJ A;  4FN2 A;  1AAR A;  2JY6 A;  2G4D B;  3KUZ A;  2MQJ A;  2ZCC A;  3PRP B;  4I6L B;  2MRP A;  1P3Q U;  4G3X B;  3TJP A;  2N7D A;  1KM7 A;  1UH6 A;  2BKR B;  2BGF A;  3KW5 B;  4KVG B;  2NS5 A;  4EKU A;  2ZCB A;  3DCG A;  4MGI E;  1C1Y B;  3RZF A;  3I3T B;  3H1U A;  3NS8 A;  2MA9 B;  2IYD B;  2R2Q A;  4P7I A;  1OEY A;  2JXX A;  4RM8 A;  4X57 B;  1GJZ A;  3TIX A;  2LGY A;  1V5O A;  1X1M A;  3L16 A;  2M17 A;  4KIK A;  5DPW A;  2O2V A;  4KSL C;  4BBN F;  3AU5 A;  3APD A;  3ZLZ A;  2NPT A;  2BF8 B;  4FHJ A;  5D6J B;  2MLB A;  4G50 A;  1TTN A;  2DYO A;  3QA8 A;  1GNU A;  1WJU A;  1EO6 A;  2G3Q B;  2V1Y A;  4MGY E;  2IBI B;  2O6V D;  2GBR A;  2PJH A;  2RSU A;  3A9J B;  2UYZ B;  4RM9 A;  2L3Z A;  2BYV E;  3MHS D;  4EOY A;  1BT0 A;  2AEH A;  2DYM A;  4WWO A;  4EUT A;  1Q0W B;  1WXV A;  3KYD D;  1RAX A;  5JH5 C;  1K8R B;  1XQQ A;  3ZNI D;  4DWF A;  4HPL B;  2WWZ A;  3VHT C;  3ZUN A;  2L05 A;  3V6E B;  3A9K B;  1Z5S B;  4ANW A;  2C60 A;  2KLG A;  3ECI A;  2EMT A;  4KDL B;  4NJ7 A;  4LDT D;  4XC2 A;  1E5W A;  3DVG X;  5AZG A;  4FJV B;  4MGK E;  3SHQ A;  1RFA A;  1WR1 A;  2LRW A;  2NBV B;  2KJ6 A;  1RLF A;  1WX8 A;  4HDQ A;  3L54 A;  3DPD A;  5C23 A;  4NJ6 A;  2RPQ A;  3BIN A;  2MSE D;  2MBO A;  2LRU A;  4WQO B;  1L2N A;  2IO2 B;  3NZU A;  4TKN A;  2L7R A;  2ZVN A;  3ZVV A;  3L13 A;  5L95 C;  2M4N A;  1G6J A;  1GC7 A;  2N9P C;  4M8N A;  1PQS A;  3PT2 B;  4HPM B;  1OQY A;  3KUC B;  4AUQ C;  3HIZ A;  3JSV B;  3JW0 X;  3VTW A;  4EZK A;  3AU4 A;  4W9F A;  4K7S A;  3RUI B;  3PGE A;  3L10 B;  1E7U A;  2CKH B;  4EFO A;  2CR5 A;  2MBQ A;  3L0W B;  5D94 A;  3OJ4 B;  5CHF A;  1LQB A;  1WH3 A;  2M0X A;  4HK2 A;  2BYE A;  4ANX A;  1RRB A;  1ZW7 A;  2LI5 A;  3LJ3 A;  4II2 B;  2KFK B;  4GOC A;  2KAN A;  4FA6 A;  4ICV A;  4A20 A;  2MP2 B;  1WIA A;  2GBM A;  2JRI B;  4MM3 A;  1LM8 B;  4FJY A;  2O6V A;  4HVB A;  4IM0 A;  2KLC A;  2PEA A;  2PE6 B;  3QIJ A;  2L8J A;  3HHM A;  1WI0 A;  3R66 C;  2LVQ A;  4FBJ B;  4PYU A;  2L0T A;  3AI5 A;  5JHA A;  2YVC A;  1V80 A;  2DYB A;  2NBW B;  2ZEQ A;  2KC1 A;  3CSF A;  4GDL A;  4A3O A;  4IM3 A;  3V6C B;  4G0N B;  3ML8 A;  4IG7 B;  4J6I A;  5FR6 A;  1ZGU B;  1WGG A;  2Z0D B;  4CHK A;  5L83 A;  5HKH A;  1SGH A;  2KJH B;  4NNJ B;  3DOW A;  4FLH A;  3VH3 B;  3A1Q A;  4WJP A;  5C1Z A;  3PV1 A;  2K6Q A;  4YL8 A;  1LXD A;  4W9I A;  2CHZ A;  3VVW B;  1GG3 A;  2BKF A;  3PZD A;  4ZRJ A;  3EEC A;  4KV2 A;  3RZW C;  5EDS A;  2KTR A;  2L00 B;  4KZ0 A;  5BO4 B;  3ZNZ B;  1IPG A;  2JT4 B;  2FAZ A;  2XK5 A;  2R2O A;  2KOX A;  2KKC A;  1WJ6 A;  3B0A A;  3QAR A;  2KHW B;  3X23 A;  3ONS A;  3H9D A;  1P0R A;  4K7U A;  1QZE A;  3WAM A;  4DHZ B;  4DBG A;  2LUE A;  3JYU A;  5J18 A;  1KLV A;  1HE8 A;  3OAW A;  2K8H A;  1IYF A;  2NR2 A;  4BOZ B;  4HCP B;  3ZNH B;  4KDI C;  4NY0 A;  3RT3 B;  2CHW A;  4M8M A;  2G45 B;  3KH0 A;  3V60 A;  2V4L A;  2G4S A;  3M95 A;  4NAW B;  4AWJ A;  2GMI C;  2DX5 B;  3PRM B;  4W9C A;  4KIK B;  1WGH A;  1ZKH A;  4RMA A;  2O2V B;  4LJO B;  4TUU A;  2D11 A;  2JWZ A;  2XEW A;  4W9J A;  3VFK A;  2MCN B;  1WJ4 A;  2FIF A;  2VRR B;  5DCN A;  2KDB A;  1NDD A;  5DPR A;  3ZRF A;  4TQ1 A;  4WAA A;  4HJK A;  4MGZ E;  2J7Q B;  4IC7 B;  2BWE S;  3UQA A;  2LGD A;  4JL9 A;  1YD8 U;  4LJP B;  1J19 A;  3K9P B;  4II3 B;  3ZDT A;  3U30 A;  3N30 A;  4F7Z A;  4HWI B;  3TCA A;  3N3K B;  5JZE B;  4ZRI A;  5IAA C;  2K8C A;  4ICU A;  1R4N I;  4AJW A;  2HE7 A;  3QWZ B;  2Y5B B;  4FHK A;  3APF A;  1EF5 A;  4HDO A;  3M3J A;  1UGM A;  4IM2 A;  3VH4 B;  2WX1 A;  3R7R A;  3ZW3 A;  4PS7 A;  2NBU A;  1WMH B;  4K7W A;  5LLI A;  1V5T A;  2D07 B;  2CU1 A;  1YX6 B;  4HCN B;  3KUD B;  3DBR I;  3ALB A;  1E8Y A;  2I1K A;  2MWS B;  4EZJ A;  2L0F A;  3HM6 X;  3QCA A;  3HM3 A;  3EC8 A;  5LXH A;  3CST A;  1V2Y A;  4GSW A;  2DZK A;  4PYZ A;  3WA0 A;  2BYF A;  2AWT A;  2KDE B;  4EZL A;  2XBB C;  1P98 A;  1S3S G;  2L76 A;  3NY5 A;  4I6N B;  3ZTD A;  4BVU C;  2LXC A;  3N32 A;  5DPS A;  3SD5 A;  2KK8 A;  5TR5 A;  1WE7 A;  4JLC A;  3D32 A;  5E6O A;  1VCB A;  2I1J A;  3VAW A;  4E3C A;  2D10 A;  2BWF A;  2ZPY A;  2M1M A;  3A4R A;  4GB9 A;  3PRZ A;  3KYC D;  3WAP A;  3A9J A;  2N9E B;  3PHW B;  3UIO B;  3RD2 A;  2PE9 A;  4GMV A;  2B3A A;  2O6V B;  2ZNV B;  2RR9 A;  1IP9 A;  2KWC A;  4BKT A;  1CMX B;  2N1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...