4B6WA

Architecture of trypanosoma brucei tubulin-binding cofactor b
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
86
structure length
86
Chain Sequence
SVVKVSLTHSASRMRVPEKRYGLAQTIESIKENVFTHFATPPEYMQLQLIDDRGITIEKNMANDKQLGYYQCRDEFVIHVVDLQPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUBULIN-SPECIFIC CHAPERONE
publication title The Architecture of Trypanosoma Brucei Tubulin-Binding Cofactor B and Implications for Function.
pubmed doi rcsb
source organism Trypanosoma brucei brucei strain 927/4 gutat10.1
molecule tags Chaperone
total genus 21
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2012-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4b6wA00
3WANA 4LDTD 4JQWC 1XT9B 1OGWA 1E8YA 3PHXB 4IM2A 1LM8B 1TGZB 2C7HA 4MGYE 1SGHA 4PS3A 4BKGA 4ANWA 5LLIA 1WGGA 4OVUA 4HDQA 2XK5A 4XX5A 5E6OA 1NDDA 1V49A 3IHPC 3AU4A 2L0FA 2ZPYA 2DZKA 4K7UA 4FULA 3K9PB 4MELA 2BKFA 2DX5B 4DHJB 1VCBA 1WM2A 3RZWC 2CHZA 3IBEA 2KFKA 3DBHI 1WR1A 2FCQA 3K9OB 3WIMA 3PZDA 4JIOU 2VRRB 4KSKC 5AZFA 2WWZA 4BFRA 2AYOB 2J0MA 3A9KA 2DYMA 1P3QU 1GC7A 2Y5BB 4FHJA 3ECIA 2KDIA 1IP9A 4LCDE 2MCNB 5IAAC 3NZUA 1WGRA 3W1SC 5HKHA 3H1UA 3PRZA 3TIXA 3ZTDA 1KOTA 2AWTA 3M95A 1ZW7A 3RUIB 1L7YA 3KUCB 3A33B 4FJYA 1C3TA 1UZXB 2KJRA 2MBEA 2LI5A 3ML8A 4EKUA 4P7IA 5JH5C 1RFAA 2LWPA 5BO4B 1J0GA 2KTRA 1OQYA 3A9JA 3ZKJC 1RAXA 2IO0B 2ZPNA 2DYOA 2GOWA 3L54A 3R7QA 4AWJA 4F7ZA 2CKHB 4FLHA 1YD8U 2MW5A 4DWFA 1Q0WB 1YJ1A 1GNUA 2RSUA 3CF6E 4MGZE 2WX0A 4CHKA 2HTHA 2BF8B 2KHWB 4EZKA 2N4FA 3B08A 3V60A 5LXHA 3QIJA 3QWZB 1R4MI 2KFKB 3QQ8B 2RPQA 4ANXA 2FNJB 2DZMA 2M1MA 4B6WA 2NBVB 4IWQA 3ZLZA 3BINA 2FIFA 4TQ1A 2IY1B 3DVGY 1XD3B 4WAAA 4ZRKA 3QHTA 1UD7A 4BKTA 3ZRFA 1CMXB 1TZ1A 2CHXA 4PYZA 4DDID 2A5UA 2OOBB 1P9DU 3M63B 3A9KB 1WX7A 4W9EA 4MJSA 3ZUNA 3N3KB 4BOZB 2L76A 4TQ0A 2C7NB 3NY5A 4HJKA 3MTNB 3R3MA 5D2MB 2KXJA 3H6NA 2N9EB 3HM3A 4FJVB 4DDGD 4KVGB 3QA8A 3APDA 3DOWA 3QARA 4IW0A 4RM9A 2D10A 2K25A 3VTWA 5JHAA 2DHZA 4G0NB 3DBSA 2R2OA 1A5RA 2NCNA 4URKA 3LDZE 1L2NA 3VDZA 4EOYA 3RT3B 3ZDTA 3UQAA 3H7SA 3C0RB 3DDCB 3GZNI 3OAWA 4ZDVA 4W9GA 2KLCA 5CHVC 3QAQA 3SU8X 2J7QB 2DYBA 1J8CA 1E8XA 2RGFA 5EDSA 2ASQA 1WE7A 2JUOA 3HK0A 3JSVA 4W9CA 3V62A 1ZGUB 1GG3A 2MWSB 3PLVA 4HXDA 5TR5A 4ZYNA 4E74A 4MEMA 3V6CB 2JRIB 1V80A 1V5OA 2IZVB 2L3ZA 3PREA 1V2YA 2KTFA 2BGFA 2PPHA 4MM3A 4BKSA 5GMVA 3A1QA 2N7EA 3VH4B 3U7DA 2MP2A 1T0YA 2KJHB 3UQBA 2L0TA 2RR9A 1WH3A 4PS8A 1TBEA 4AOFA 2BYVE 4G3XB 2BWES 2LD9A 1UBQA 3B1LX 4MJSB 2NBUA 4TUUA 1M94A 1X1MA 3TCAA 4AP4C 2N1VA 4KZ0A 5LXIB 5CHFA 1WXSA 1WY8A 2M17A 4GB9A 1H4RA 1PQSA 5KHQA 3LJ3A 1K8RB 3H7PA 3R66C 3L0WB 2KQSA 1Q5WB 2R2QA 2L8JA 3HM6X 4AUQC 1WM3A 4OVVA 2LGXA 1WRDB 1WJ4A 3CSTA 1J19A 3QK0A 4M8NA 4PS7A 2FUHB 3I3TB 4II3B 3PSEB 1C1YB 4EZLA 3KVFB 3DBLI 1WR6E 2LRWA 2KZRA 3APCA 2MBBB 1WE6A 4JLCA 3RCZA 2ZNVB 4ANUA 1D3ZA 2IO2B 2GMIC 4HWIB 4GXBA 2IY0B 2O6VB 3DVGX 1LXDA 2DZIA 2KDEB 2ZVOA 3PTFC 3DQVA 4HDOA 4BBNC 1WXMA 1EF5A 1GUAB 3JSVB 1WXAA 2G3QB 3ALBA 4GOCA 2JWZA 4AJYB 3ENEA 4W9HA 3V61A 2FAZA 2KKCA 2PE6B 5G55A 3ZNHB 3WA0A 4HPMB 4I6NB 4NPNA 5AZGA 3W1SA 3RULA 3T9LA 4TKNA 2FCNA 5IA7A 1E90A 5CHWA 1TTNA 1WX8A 1IPGA 4YL8A 5C1ZA 1V5TA 3A1QB 2N7DA 3TBLD 1WGYA 4I6PA 4DBGA 1WX9A 4KIKA 4N9F4 2MP2B 2Z0EB 2QHOA 4X57B 5DPTA 1XQQA 4GDLA 4ANVA 4EUTA 4F1SA 4W9IA 1V81A 4E71A 3DVNV 2LGYA 5DCNA 3PS6A 3L17A 3CMMB 3EECA 4NNJB 5AZHA 3HIZA 2V1YA 3VFKA 2Z0DB 3HHMA 1SE9A 4DXAB 1P98A 3PLUA 4LDTB 5J2RA 2C7MB 1WI0A 2LRUA 2XK5B 3KUZA 4A20A 1WYWB 1F9JA 1WFYA 4WJQA 3L16A 4HK2A 2PJHA 3UGBB 2I1KA 2LXCA 4HLEA 3D32A 2EMSA 3VVWB 2WYQA 4BOSC 1KM7A 4FHKA 1YX6B 4J6IA 4WJPA 2L7RA 2DAJA 3L08A 4M8MA 4WJOA 2GBJA 1WGDA 4WJNA 3ZTCA 5D94A 4AJWA 4DK5A 2D3GA 4XZ4A 1E8ZA 1Q1OA 4LJOB 2KANA 3N30A 2JRHA 2KQ7A 3ZIMA 3ZO5B 2BWFA 3JYUA 4FA6A 4GU2A 4IUMB 1V9JA 4W9KA 2OJRA 3IG3A 4IM0A 1UBIA 4KIKB 3ZVVA 5FR6A 2KD0A 4MGKE 2WX1A 3VHTC 2JF5A 3TL5A 4I6LB 1WGHA 2FCSA 1OEYA 2IO3B 4G50A 3ZNZB 2JT4B 2JZZA 4FBJB 1YX5B 2LZ6A 1EO6A 4WWNA 4A3PA 3T8MA 2LGDA 3MJWA 2KMCA 1OTRB 2KTRB 3A9JB 2BPSA 2KOXA 2K8CA 4W9JA 4BVUC 3VTUA 3JVZX 5J17A 4TV3A 3VUWA 5J18A 1UH6A 3TJPA 3ZW3A 2DAFA 5KHOA 4DHJD 1JRUA 1FXTB 1Y8RC 2LJ5A 3VAWA 2G4DB 2NPTA 2KLGA 4GMVA 4KDLB 3M62B 2DENB 2KNBA 2MLBA 2KVRA 2LXAA 2K6QA 4GN1A 2B3AA 4G11A 4KV2A 3PT2B 4ZRIA 3RYTA 4ASWC 4GDKA 2BYFA 2G4SA 3A4SC 2KDFB 3WALA 2MBHA 3PHWB 4II2B 2K8HA 3ONSA 4K81A 4B95A 3Q3JA 3QJZA 2ZNVC 3L10B 3JW0X 2M8SA 4ICVA 5DPWA 4E3CA 3H9DA 4RM8A 3UIOB 2BKRB 3UIPB 3AULA 1GJZA 4DHZB 4F8CB 2KK8A 2M4NA 3S2AA 2JY6A 5L95C 5JZEB 3UF8A 2GBKA 2IBIB 2LVPA 2IYDB 3R7RA 4FADA 3NS8A 1P1AA 2Z59B 3KH0A 4EZJA 3UINB 1EF1A 3BY4B 3VH3B 1E7VA 2KC2A 1SIFA 3PVLA 1S3SG 4W9FA 2GBRA 3ZNGC 4NY0A 2NVUI 3KYDD 4HPLB 2AL3A 1E7UA 2L00B 1WJUA 3VTVA 4DHZE 1NBFC 2A4ZA 3O65B 4KZCA 4IG7B 2K1FA 2KJ6A 2REXA 2GBNA 3VQIA 3ZNID 4GIVA 1E8WA 2K6DB 1RLFA 2MX2A 2N1WA 2ZEQA 4MDKE 3RZFA 3KYCD 3NOBA 2NPTB 4WQOB 1OEYJ 3EFUA 5C23A 1MG8A 1UGMA 2KMAA 2N9PC 2N9XA 3OLMD 2HE7A 4IM3A 3TMPB 4GDKB 1RRBA 1H8CA 4JL9A 2ZVNA 3PGEA 2KC1A 1WF9A 1V6EA 1WJ6A 1G6JA 4GSWA 1WIAA 2IO1B 4BBNF 3MHSD 4HCNB 2UYZB 3OJ4B 3KW5B 2AL6A 2PE9A 4FJZA 5DPRA 4NAWA 1YIWA 3EHVA 3QCAA 2KWUB 4MGIE 1R4NI 2LVOA 3ML9A 4KSLC 3WAMA 2HJ8A 1WMHA 4CO7A 3GOEA 3SDLC 2W9NA 3H7PB 3U30A 4NJ7A 2KWVB 2M0XA 3KUDB 4LJPB 2CS4A 4KDIC 3WAOA 1LFDA 3B0AA 4CYEA 5DPSA 1I35A 3PRPB 2D07B 3SD5A 3ZRCA 2CU1A 3EC8A 2D2QA 2MRPA 2NBWB 3N32A 1Z2MA 4FN2A 2JPHA 2J0KA 5CTRC 1P0RA 3ZDMC 1YQBA 4ICUA 4ZRJA 4EEWA 2D11A 4JGHB 3VUYA 2K8BA 5E6NA 2XBBC 4K7SA 3M3JA 2L05A 4MSMB 1KJTA 2MQJA 1HE8A 3AXCA 3OJ3A 3A4RA 2KFJA 2LUEA 2MBQA 2UWQA 1S1QB 2MA9B 5AEKB 2FIDA 3RD2A 2I1JA 1KLVA 4GGQA 3APFA 2EKEC 3U8ZA 1LQBA 2NR2A 2KO3A 2C9WB 2YLMA 1BT0A 2EMTA 4MH0E 1ISNA 4PYUA 1V86A 4XC2A 4M0WB 2O2VA 4HVBA 2V4LA 1I42A 3PPAA 4GDLB 3VXWA 2CHWA 1NI2A 3QC8B 4NAWB 2AEHA 2ZJDA 5D6JB 3W1YA 1WZ3A 4NJ6A 2G45B 1WMHB 2V3SA 5E6PA 2XEWA 2BYEA 4WWPA 2NS5A 4HCPB 2RD0A 4W9LA 1EUVB 4A3OA 1IYFA 3DPDA 2YVCA 2K39A 2MSED 5CX3A 4K1RB 2GBMA 2J0JA 2DZJA 1E5WA 3AI5A 2KX0A 4IWOA 5JHBA 4MSQB 2CR5A 3V6EB 2LVQA 1WXVA 3VUXA 1QZEA 2FCMA 3CSFA 2O6VD 4WWOA 4RMAA 1VD2A 3X0WA 3IFWB 3PRMB 2MBOA 2HD5B 1ZKHA 3SHQA 1WZ0A 2O6VA 2ZZPB 3NZSA 2C5LC 3Q3FA 4W9DA 1UELA 4IC7B 2KX3A 2PEAA 2ZCCA 2WDTB 4NQLB 4K7WA 2JZ3B 2KN5A 4BKSD 3P2BA 3AU5A 3L13A 2ZCBA 2JVCA 4NQKE 2O2VB 3DCGA 3IVFA 1Z5SB 1U4AA 3DVNU 3QX1A 5D7GA 4EFOA 3NHEB 3WAPA 2KDBA 3X23A 4B9KA 2C60A 2JXXA 1AARA 5L83A 2KWCA 1WJNA 1GC6A 3PV1A 4IWPA 2LASA 3DBRI 5G2NA
chains in the Genus database with same CATH superfamily
3WANA 2MJEA 3PHXB 4ANWA 1SGHA 3AU4A 4K7UA 3K9PB 1STEA 3H8HA 3UI3A 1D6EC 2QCZA 1I4RA 1HTOA 3ECIA 1KFYB 5IAAC 1KH0A 1EU4A 1TY2A 3EUB2 1PFDA 4P6VF 3A33B 3EFCA 5BYQA 1B9RA 2WDQB 4LNKA 1HZ6A 1JROA 3ZXRA 5IN7A 4EKUA 1RFAA 1J0GA 2KTRA 2W54A 2IO0B 2CKHB 4FLHA 3BYTB 1YD8U 2WX0A 4M02A 2NTTA 5LXHA 1QF6A 3QQ8B 2RPQA 4ANXA 2NBVB 1L6UA 3BINA 4TQ1A 3DVGY 1XD3B 1I4QA 1UD7A 1TZ1A 3AE5B 2CHXA 2OOBB 3M63B 1WX7A 1UNSA 3AN1A 4BOZB 2L76A 2ZW1A 2M19A 1KF6B 1YN4A 1QOBA 5D2MB 3HM3A 2ONQA 2KACA 2MHJA 1D5XC 1FRRA 4KVGB 3APDA 4RM9A 5H92C 3VTWA 1OFFA 2XN9C 3TSSA 2CJOA 3DDCB 1RYJA 3QAQA 2J7QB 1J8CA 2ASQA 2JUOA 3JSVA 3HK0A 3V62A 1C79A 1XO3A 1R7SA 4ZYNA 4MEMA 1V5OA 3AEBB 4P1CC 1XLPA 3P4SB 1IBXA 2BGFA 3SFEB 4BKSA 2N7EA 1TS4A 4PS8A 1TYGB 2BWES 2LD9A 1D4BA 2OEDA 5LXIB 3I5JC 3T3OA 1HZ5A 3BVGA 5KHQA 2QSDA 1Q5WB 1WRDB 1WJ4A 3CSTA 2L1AA 4PS7A 1ZOYB 3I3TB 4EZLA 3DBLI 2LRWA 2CU3A 2KZRA 3U2SC 4JLCA 2GMIC 4HDOA 3PTFC 2DZIA 3DQVA 1WXMA 3JSVB 2JWZA 4AJYB 2QILA 3NG0A 1L6VA 1MHXA 3N9YC 2PE6B 2W3SA 3RNFC 1NYRA 4I6NB 3GP7A 3W1SA 2WXRA 1E90A 1IBXB 1SE4A 3OG5A 1WRIA 5DPTA 4ZYSA 1V81A 3NVYA 4K3BA 1YN5A 3HIZA 5AZHA 3VFKA 2Z0DB 1TJEA 4ARIA 3PLUA 1AW7A 1XEEA 2LRUA 3AEDB 3AV8A 4A20A 4RGNA 2IDYA 4HK2A 3UGBB 1T5XD 2K0PA 2G1EA 1FPYA 4N58A 2DWQA 4FHKA 1K51A 1JWUD 1XF5L 1V8CA 2AQ2B 1WGDA 4RGTA 4WJNA 1K53A 4DK5A 2D3GA 1E8ZA 4LJOB 2BYTA 2UU7A 1XCQL 2JYEA 3ZO5B 2BWFA 3JYUA 5EE3A 2BW2A 4W9KA 1OQQA 2OJRA 3IG3A 4MGKE 3AE6B 2K9XA 1PYWD 2ICIA 2JT4B 3U7ZA 1MG4A 2INPE 1EO6A 1I7HA 2LGDA 1FNUA 2BB5A 2KMCA 4A8XC 3I57A 2QIEB 2KOXA 1F0ZA 4JX1C 2TSSA 3JVZX 2W82A 5EE9A 4C56C 4ZHOA 5KHOA 1FXTB 1Y8RC 2KLGA 4KDLB 2DENB 2KNBA 2LXAA 1OQRA 5IO9A 4GDKA 4DXGA 2K8HA 3Q3JA 2ZNVC 2H89B 4M00A 1SXTA 2BKRB 3UIPB 2M4NA 5L95C 2GBKA 2IBIB 2Y5PA 2I2YA 3NS8A 2Z8LA 4EZJA 2DLBA 3UINB 1E7VA 1SIFA 2WP9B 3ZNGC 2MEKA 2L00B 3VTVA 1YMHE 1NBFC 4MT5A 1D5MC 2REXA 1N62A 2N1WA 3R8BA 2ZEQA 3RZFA 3KYCD 3EFUA 5C23A 1E10A 3OLMD 4IM3A 1NYQA 3TMPB 4GDKB 3LYYA 3N20C 1WF9A 1G6JA 1WJ6A 4GSWA 2LUMA 3MHSD 2WGSA 3KW5B 3WAMA 4CO7A 1WMHA 2WU5B 3GE3C 2BVCA 3NVWA 1NVID 1EM7A 2WXIA 4LJPB 1LFDA 4CYEA 5DPSA 5BYSA 4REZA 4L1BA 2NBWB 1Z2MA 2JPHA 5IP4D 5CTRC 1P0RA 2KQ4X 3RFZB 1C4AA 2XBBC 1V97A 1YNTE 2L05A 2GLSA 4YTPB 1TT5B 4J3OD 1I4PA 2EKEC 2WXJA 5JHAA 4XWWA 4BOSC 1BT0A 1I4GA 2O2VA 1I42A 4GDLB 1F77A 2V9HA 1ROEA 2ZJDA 1WZ3A 1WMHB 3ZJUA 4YTMB 4WWPA 5T8IA 2D3CA 3DPDA 2MSED 4K1RB 2D3AA 2DZJA 1A70A 2KX0A 4LTUA 3V6EB 4NAMA 3VUXA 2FCMA 3CSFA 4RMAA 1MJDA 3KQ4A 4ZHPA 3IT6B 3SHQA 1M4VA 2WS3B 2O6VA 1ENFA 3Q3FA 2LMCA 4IC7B 4IKGA 2WXGA 1YQ4B 4K7WA 4BKSD 3P2BA 3J9CA 2KWDA 2JSVX 4NQKE 2O2VB 3DCGA 1FNVA 3IVFA 2AX5A 1F2RC 3QX1A 5D7GA 4B9KA 3X23A 2JYTA 2C60A 2JXXA 2OHFA 1GC6A 1GPXA 3DBRI 3DBRB 1TGZB 4MGYE 5E6OA 3IHPC 2ZPYA 1FFUA 3Q8BA 5AUKA 4FULA 1F2RI 4MELA 2CHZA 2KFKA 4PK1A 3ZQ4A 1RWSA 4RCOA 4JIOU 1C78A 4KSKC 5AZFA 4BFRA 2J0MA 1P3QU 4US9A 4KKJA 2WLBA 3ZGZA 1IP9A 4MACA 1RFKA 3PRZA 3ZTDA 1KOTA 2AWTA 3RUIB 2AQ1B 3V05A 3KUCB 3Q8CA 4FJYA 2QMTA 2EKIA 1UZXB 2KJRA 2MBEA 3DWGC 4KGSA 4P7IA 5JH5C 2LWPA 3MC8A 3A9JA 3ZKJC 1I4HA 2H88B 2DYOA 4F7ZA 2G9HD 5BYRA 4DWFA 1Q0WB 3RNGC 1YJ1A 1GNUA 2KHWB 2BF8B 2FBWB 3QIJA 1R4MI 2KFKB 3ZLZA 4IWQA 5BMIA 3P4QB 3BVMA 1FXAA 1SSNA 3QHTA 3ZRFA 1CMXB 1WYGA 4MJSA 3ZUNA 1DOIA 4TQ0A 3MTNB 2QJLA 3BZDB 2KXJA 3O13A 2WNMA 2V4IB 3DOWA 4IW0A 4HROA 4G0NB 1A5RA 3LDZE 3B2GA 1UWMA 3VDZA 3ZDTA 4EOYA 5C3JB 1I4XA 1QILA 2WDVB 3NUHB 1XLNA 2KLCA 3PZ7A 1WE7A 3PLVA 4E74A 1MHHE 2JRIB 2L3ZA 5E6JA 4ZOHC 3PREA 2KTFA 1CK1A 3Q3NC 1YJJA 3Q69A 2N9KA 2MP2A 1T0YA 2KJHB 2L0TA 3URYA 4EE2A 1TBEA 4MJSB 2NBUA 2N1VA 1N5WA 5CHFA 4JWUC 1WXSA 1WY8A 2M17A 1JWSD 1PQSA 1K8RB 3H7PA 3L0WB 2KQSA 1ZXIA 4AUQC 1WM3A 4OVVA 1FM0D 1J19A 5GXGB 3DHIC 5EE1A 3PSEB 3KVFB 1VJKA 2M56B 4GXBA 1ZDXA 1EF5A 1GUAB 1SE2A 1ZPSA 5BMGA 1WXAA 2G3QB 4GOCA 4YT0B 3RNBC 3ENEA 3V61A 2FAZA 4HPMB 4NPNA 2J53A 3AE9B 3AEGB 3IT4B 4ITKA 4TKNA 3RULA 2LGIA 2FCNA 4A6QA 1TTNA 1IPGA 4YL8A 3RPFC 2MP2B 2Z0EB 4X57B 1WGKA 4NZLB 3HVDA 4F1SA 3GS2A 4E71A 3DVNV 2JU6X 1R4NB 3EECA 4NNJB 1VR9A 4LDTB 2C7MB 2VH1A 4RF0A 1WFYA 2CJNA 4WJQA 5I4DA 2OJWA 1N61A 2I1KA 4HLEA 3D32A 1KM7A 1TS2A 4J6IA 3L08A 1T3QA 4M8MA 4WJOA 2GBJA 4H2AA 1Q1OA 4HEA1 2WXLA 3N30A 1MI0A 4GU2A 1TKGA 4YSXB 1QLBB 2LHEA 5FR6A 3TL5A 1HEZE 2FCSA 2IO3B 1YX5B 4WWNA 2KTRB 2BPSA 4RF1A 3TJPA 1AN8A 5G5GA 2MLBA 2KVRA 2K6QA 4KV2A 2B3AA 4G11A 1HQRD 2BYFA 2G4SA 2B76B 3A4SC 2KDFB 2MBHA 4BAXA 1UGJA 3QJZA 3JW0X 2M8SA 1SF0A 4ICVA 5DPWA 3UIOB 3AULA 4DHZB 4F8CB 2LVPA 4QAYA 4JE3B 1P1AA 1EF1A 3BY4B 3NJTA 3Q8EA 1Y56A 4NY0A 3TUOA 2NVUI 2AL3A 1E7UA 4ZRPA 4DHZE 3O65B 4IG7B 2KJ6A 2Y3AA 1ESFA 2WXOA 3ZNID 1RLFA 1RM6C 3FILA 1ZUD2 4WQOB 3BK1A 2KMAA 2HE7A 3DWMA 2KT7A 3DBHB 2IO1B 4A55A 4HCNB 3OJ4B 2AL6A 2PE9A 5FKAC 2KWUB 4PT5A 1KRHA 4KSLC 2HJ8A 5MPOA 3U30A 2KWVB 2M0XA 2CS4A 4KDIC 3V3XA 2KYWA 2IPKD 2KAJA 1I35A 3MJ5A 3SD5A 3ZRCA 2CU1A 3ZDMC 4JGHB 3FILB 2JXTA 4MSMB 2MQJA 1HE8A 1YJIA 1SBBB 2MJ3A 2UWQA 5AEKB 3AEFB 2RMMA 2WDRB 3N1ZC 2C9WB 3CIRB 2JZPA 1V86A 4HVBA 5JXVA 3VXWA 2PMVA 1JQ4A 3QC8B 3W9CB 1UUPA 3KLSX 1K50A 2SEBD 2X38A 2BYEA 2WXPA 2NS5A 4HCPB 1IGCA 2RD0A 3MHZA 2INNE 2QC8A 2WXNA 2YEPB 2YVCA 5CX3A 1SJHD 3U52E 2GBMA 4D2KA 3AE8B 3AI5A 3FC4A 4IWOA 4XDCA 4MSQB 1WXVA 3IXSA 1QZEA 3TEYA 4WWOA 1VD2A 3X0WA 2HD5B 2WXFA 1WZ0A 1ZE3D 3B9JA 1IGDA 3SEBA 1UELA 2KX3A 2GRIA 4NQLB 2WDTB 3VR8B 1D5ZC 1KLUD 3W5UB 5FK9C 1VLBA 1Z5SB 2AQ3B 3WAPA 2KDBA 2R61A 3ZJVA 4AQ7A 4IWPA 2LASA 2INDC 5G2NA 1JWMD 4LDTD 1OGWA 1T0QC 1E8YA 5HHDG 4BKGA 5LLIA 4HDQA 2XK5A 4XX5A 2L0FA 2BKFA 2DX5B 3RNAC 4LNFA 1MFWA 2LJIA 2PW9A 1WM2A 3RZWC 3OWEB 1AYFA 3MP9A 2FCQA 3PZDA 1N5XA 2VRRB 2WWZA 3A9KA 2V3NA 1NI3A 2DYMA 3GE8C 4FHJA 2KDIA 1ZDVA 4LCDE 3NZUA 2EELA 4RNAA 1ZW7A 1L7YA 4NJCA 2VH2A 1JMLA 4B0EA 1C3TA 3ML8A 2PTLA 1PUTA 5BO4B 1OQYA 4HKQA 1RAXA 4ACFA 2GOWA 2IGDA 4RFBA 2MW5A 3DHGC 2RSUA 3CF6E 4CHKA 4EZKA 3MC0B 1WWTA 3QWZB 2L52A 2DZMA 2M1MA 4GLSC 4C7YA 2BQQA 2IY1B 4WAAA 1XCTL 4BKTA 1P9DU 3A9KB 4W9EA 1FO4A 2C7NB 3R3MA 1TS3A 3H6NA 4M01A 2N9EB 1UWXA 4WH4A 4DDGD 1ET9A 3QA8A 3C8YA 3QARA 2K25A 2DHZA 1L0VB 3B2FA 3DBSA 3MC9A 1NEKB 2JWUA 2NCNA 4URKA 1L2NA 2E3TA 3RT3B 3C0RB 4LNNA 3OAWA 4ZDVA 3SU8X 1FRDA 4ARCA 1E8XA 2RGFA 5EDSA 2WXHA 1GG3A 1TZOA 1V80A 2IZVB 1QKZA 2PPHA 5GMVA 2J42A 3U7DA 4S0RA 3NS1A 4BVUC 1WH3A 4AOFA 2BYVE 4G3XB 4TUUA 3RI7C 1M94A 1X1MA 3KWVA 3TCAA 4AP4C 4KZ0A 4GB9A 4A9AA 4JWSC 3R66C 4JPSA 1MVKA 3BYYB 4N6EB 2FUHB 4II3B 4XGAB 1C1YB 1J7BA 1WR6E 4UDUC 3APCA 4P1BC 2MBBB 1WE6A 3RCZA 2QDFA 1D3ZA 2IO2B 3ZJTA 3P63A 2IY0B 2O6VB 3ZNZB 1LXDA 2KDEB 2ZVOA 1BUIC 4KGRA 1QT9A 4HKZE 1CQVA 3WA0A 3T9LA 1XLOA 5CHWA 4C4VA 1V5TA 1LGRA 2N7DA 3TBLD 5C2TB 2ZW0A 1WX9A 4N9F4 5G5HA 1XQQA 4EUTA 1C4PA 1GAQB 3FAHA 2IJ0A 5DCNA 3L17A 3CMMB 3HHMA 4DXAB 1T0SC 1YOVB 1XXGA 4C80A 1C77A 1WYWB 2BS3B 4YWGG 4TSSA 1IUEA 1HXYD 2PJHA 3AM9A 3VVWB 2WYQA 4OHJA 4WJPA 2BS2B 2DAJA 4YSZB 3W2DA 2MH7A 4HPPA 4LNIA 1Q10A 1FFVA 2WU2B 3Q3OC 4XZ4A 1V1PA 2KANA 2I38A 2JRHA 4C4VB 3ZIMA 4IUMB 2WXMA 4IM0A 3ZVVA 1QQRA 2KD0A 1FNWA 3VHTC 1QOGA 2LZ6A 3R2TA 3NZ3A 2N0SB 3NVVA 1C4CA 1OTRB 3A9JB 4RGOS 2BS4B 4W9JA 2HTME 3VTUA 5J17A 3VUWA 1UH6A 1ZXHA 3ZW3A 1JRUA 3VAWA 2LJ5A 4RH6A 3RYTA 4GN1A 4ZRIA 3EA6A 1DYQA 3PT2B 1YN3A 4ASWC 3RMKC 2WHIA 3WALA 4B95A 3Q14C 2X8XX 1FIQA 4P16A 1V1PB 4E3CA 1FD6A 4YTNB 3S2AA 5FR3A 5JZEB 3UF8A 4WQMA 2K3UA 2IYDB 4N59A 4FADA 3P42A 3KH0A 1TY0A 1S3SG 4W9FA 2GBRA 2DBYA 4HPLB 3IAM1 1WJUA 2A4ZA 1EWCA 4KZCA 2V0GA 2K1FA 3VQIA 2GBNA 4MH8A 1DGJA 2RPVA 3C19A 4GIVA 1E8WA 4KKIA 2K6DB 2MX2A 2PIAA 4MDKE 3E56A 1UGMA 1V1OA 2N9PC 2N9XA 2LHDA 4XDDA 1RRBA 1N6ZA 2KDMA 1H8CA 1LO5D 2ZVNA 5HFYA 1VRAB 1V6EA 3AH7A 2KN4A 2UYZB 2Y5CA 3N1XC 4FJZA 3Q2AC 1YIWA 4NAWA 3QCAA 1R4NI 4US8A 3GB1A 1VDVA 2W9NA 3H7PB 3SDLC 2LEKA 4NJ7A 3WAOA 1MPEA 1QOAA 3Q3MC 2D07B 2D2QA 1UF0A 3N32A 1YQBA 4ZRJA 4EEWA 2D11A 3VUYA 2K8BA 2L32A 2N7JA 4K7SA 1KJTA 2GI9A 1VZ7A 3A4RA 2LUEA 2FIDA 2I1JA 1LQBA 2YLMA 2NR2A 2KO3A 3BWUD 3BVZA 4XC2A 5IKCM 3IAS1 2V4LA 4L2YA 4XE0A 3PPAA 1SIJA 2CHWA 1ZP0B 4NAWB 5D6JB 3W1YA 4NJ6A 2G45B 3TEZA 2V3SA 5E6PA 2XEWA 1J7CA 4FXCA 1EUVB 1IYFA 2K39A 1F1HA 2JX5A 2LVQA 1AWDA 2O6VD 1WXQA 1JCKB 2SAKA 3PRMB 1ZKHA 4W9DA 1KLGD 2PEAA 2ZCCA 3AU5A 2K22A 1U4AA 3ABVB 4OZCA 5L83A 3PV1A 3HRDD 4JQWC 1XT9B 4S17A 4B0MA 4IM2A 1LM8B 4PS3A 2C7HA 3TEXA 1CZPA 1WGGA 2V3PA 2QEJC 1YQ3B 3ETRA 4OVUA 1NDDA 1V49A 2DZKA 4DHJB 1EWYC 1VCBA 2MJDA 3DBLB 4XWTA 4YSYB 1PGBA 3IBEA 3DBHI 3U4EG 4Q2JA 1WR1A 3K9OB 3WIMA 3PO0A 2AYOB 1GC7A 2Y5BB 4USAA 4ZRQA 4OZAA 2YEPF 1E9MA 2PKOA 2MCNB 4YXDB 1CJEA 1QOFA 1JWAD 1WGRA 3W1SC 3H1UA 5HKHA 1L4ZB 3TIXA 2PLPA 2LGSA 3TEWA 3AE2B 2HJ1A 3M95A 3I9V1 2N9LA 2J4XA 1KTKA 1DOXA 2L83A 1E6EB 2LI5A 3AE4B 4IDIA 3DHHC 2ZPNA 3L54A 3HUIA 3R7QA 2INCC 4AWJA 4C7ZA 4TMAB 3BK2A 4MGZE 2HTHA 2N4FA 3B08A 3V60A 1BXTA 2FNJB 4B6WA 3L4PA 3P4PB 2FIFA 4ZRKA 2VZKB 3VRBB 4PYZA 4DDID 2A5UA 5HG2A 3N3KB 4WURA 3NY5A 4HJKA 4WWMA 1WSPA 2W55A 4LNOA 3MFGA 4FJVB 1VZ8A 2M0AA 2W3RA 2WXKA 2D10A 4DQOC 5HI1A 2R2OA 3UQAA 3H7SA 3GZNI 3GZNB 4W9GA 2KMMA 5CHVC 2DYBA 2HDEA 4W9CA 1B1ZA 1ZGUB 2MWSB 4HXDA 1GB4A 2FUG1 5TR5A 3R2IA 4BZAA 4XYCA 3V6CB 3CWIA 1V2YA 2NTSA 2RDGA 4MM3A 3A1QA 2D5GA 3VH4B 1FCCC 3NVZA 3UQBA 2RR9A 4BBNF 1UBQA 3B1LX 3RNCC 1ACCA 1H4RA 2ACZB 1FCLA 3FKYA 3LJ3A 2R2QA 2L8JA 3HM6X 3SFDB 2BTEA 2LGXA 1SEBD 2IGHA 3QK0A 4RGMA 4M8NA 3ZYYX 2ON8A 4ANUA 2ZNVB 4HWIB 1GB1A 3DVGX 4BBNC 1TKEA 2D3BA 3ALBA 3N1YC 4W9HA 4L23A 2KKCA 1JRPA 5G55A 1J7AA 3ZNHB 2NMQA 5AZGA 2K5PA 5IA7A 1L5PA 1WX8A 5C1ZA 4MM3B 3A1QB 1WGYA 3HVZA 4I6PA 4DBGA 1BMLC 2XNAC 4KIKA 3PZ8A 2J52A 1L4DB 2QHOA 4KX6B 4ANVA 4GDLA 3P1MA 4W9IA 4CQNA 2LGYA 4OVZA 3AECB 1SB3C 3PS6A 1HA5A 2V1YA 1SE9A 1P98A 5J2RA 1WI0A 2XK5B 3KUZA 2RDBC 1T0RC 3P4RB 1F9JA 2LFIA 4R3DA 5EE0A 3L16A 2LXCA 4C00A 2EMSA 3AEAB 1YX6B 3LB8C 2L7RA 2E6XA 3BIID 3SR6A 3ZTCA 5D94A 2GB1A 4AJWA 1DOYA 1GOZA 2KQ7A 4FA6A 1V9JA 1UBIA 4KIKB 3Q6BA 2WX1A 2JF5A 4I6LB 1WGHA 1OEYA 4G50A 2JZZA 4FBJB 4LK0M 1JWBD 4A3PA 3T8MA 5TSSA 3MJWA 1FEHA 2K8CA 4TV3A 5J18A 3W5VB 1NENB 1TS5A 4OZBA 2DAFA 4DHJD 2G4DB 2NPTA 4GMVA 3M62B 4AS1A 2WQYB 3AB5A 5H8YE 3LXFA 3PHWB 3ONSA 4II2B 4K81A 4HRSA 1T6BX 3ZXVA 3L10B 3H9DA 4RM8A 1GJZA 2KK8A 2JY6A 3R7RA 2Z59B 3VH3B 2KC2A 3PVLA 2KVZA 3NRZA 3KYDD 1P7EA 3Q8AA 1L0XB 1E0ZA 3AE7B 1K52A 4DXFA 2IGGA 4HJGE 5IOIA 3NOBA 4LLGM 1PDXA 2NPTB 1OEYJ 1MG8A 3I63C 5AUIA 2JQRB 3EGRA 2BB6A 4JL9A 3PGEA 2KC1A 3KWLA 1WIAA 2FE8A 2VZKD 1C9FA 4M0WA 1SJED 1HTQA 5DPRA 4KGTA 3AE1B 3EHVA 4MGIE 2LVOA 3ML9A 3RNEC 1JALA 1F52A 3GOEA 2BBCA 3KUDB 3B0AA 3PRPB 2BT6A 3EC8A 2MRPA 4FN2A 2J0KA 3AEEB 4ICUA 2WXQA 5E6NA 3M3JA 1C76A 1P7FA 3AMZA 1ET6A 3AXCA 3OJ3A 2KFJA 2MBQA 1S1QB 1JW9D 2MA9B 3RN9C 1KLVA 3RD2A 1VZ6A 4GGQA 3Q8FA 1XLQA 1FXIA 3APFA 3U8ZA 3T3NA 1PGXA 1EU3A 1R4MB 2EMTA 4MH0E 4PYUA 1ISNA 4M0WB 3AE3B 4K3CA 2DNFA 4OW0A 1NI2A 2AEHA 1PGAA 1TKYA 3VR9B 4W9LA 4A3OA 2PVOD 2J0JA 1E5WA 1SE3A 3WCQA 5JHBA 1N60A 5LNK1 1FMAD 2CR5A 2PVGC 2Q5WD 4WIPA 3IFWB 2MBOA 2RDHA 1TIFA 2ZZPB 3NZSA 2C5LC 1E7PB 2JZ3B 2KN5A 3L13A 4O1NA 4WAFA 2ZCBA 2JVCA 5D3IB 3DVNU 3E9SA 1L0YB 3NHEB 4EFOA 4IOIE 1N63A 1AARA 2KWCA 3VRAB 1WJNA 5BMHA 5D3DA 4A90A
chains in the Genus database with same CATH topology
3WANA 4LDTD 4JQWC 1XT9B 1OGWA 1E8YA 3PHXB 4IM2A 1LM8B 1TGZB 2C7HA 4MGYE 1SGHA 4PS3A 4BKGA 4ANWA 5LLIA 1WGGA 4OVUA 4HDQA 2XK5A 4XX5A 5E6OA 1NDDA 1V49A 3IHPC 3AU4A 2L0FA 2ZPYA 2DZKA 4K7UA 4FULA 3K9PB 4MELA 2BKFA 2DX5B 4DHJB 1VCBA 1WM2A 3RZWC 2CHZA 3IBEA 2KFKA 3DBHI 1WR1A 2FCQA 3K9OB 3WIMA 3PZDA 4JIOU 2VRRB 4KSKC 5AZFA 2WWZA 4BFRA 2AYOB 2J0MA 3A9KA 2DYMA 1P3QU 1GC7A 2Y5BB 4FHJA 3ECIA 2KDIA 1IP9A 4LCDE 2MCNB 5IAAC 3NZUA 1WGRA 3W1SC 5HKHA 3H1UA 3PRZA 3TIXA 3ZTDA 1KOTA 2AWTA 3M95A 1ZW7A 3RUIB 1L7YA 3KUCB 3A33B 4FJYA 1C3TA 1UZXB 2KJRA 2MBEA 2LI5A 3ML8A 4EKUA 4P7IA 5JH5C 1RFAA 2LWPA 5BO4B 1J0GA 2KTRA 1OQYA 3A9JA 3ZKJC 1RAXA 2IO0B 2ZPNA 2DYOA 2GOWA 3L54A 3R7QA 4AWJA 4F7ZA 2CKHB 4FLHA 1YD8U 2MW5A 4DWFA 1Q0WB 1YJ1A 1GNUA 2RSUA 3CF6E 4MGZE 2WX0A 4CHKA 2HTHA 2BF8B 2KHWB 4EZKA 2N4FA 3B08A 3V60A 5LXHA 3QIJA 3QWZB 1R4MI 2KFKB 3QQ8B 2RPQA 4ANXA 2FNJB 2DZMA 2M1MA 4B6WA 2NBVB 4IWQA 3ZLZA 3BINA 2FIFA 4TQ1A 2IY1B 3DVGY 1XD3B 4WAAA 4ZRKA 3QHTA 1UD7A 4BKTA 3ZRFA 1CMXB 1TZ1A 2CHXA 4PYZA 4DDID 2A5UA 2OOBB 1P9DU 3M63B 3A9KB 1WX7A 4W9EA 4MJSA 3ZUNA 3N3KB 4BOZB 2L76A 4TQ0A 2C7NB 3NY5A 4HJKA 3MTNB 3R3MA 5D2MB 2KXJA 3H6NA 2N9EB 3HM3A 4FJVB 4DDGD 4KVGB 3QA8A 3APDA 3DOWA 3QARA 4IW0A 4RM9A 2D10A 2K25A 3VTWA 5JHAA 2DHZA 4G0NB 3DBSA 2R2OA 1A5RA 2NCNA 4URKA 3LDZE 1L2NA 3VDZA 4EOYA 3RT3B 3ZDTA 3UQAA 3H7SA 3C0RB 3DDCB 3GZNI 3OAWA 4ZDVA 4W9GA 2KLCA 5CHVC 3QAQA 3SU8X 2J7QB 2DYBA 1J8CA 1E8XA 2RGFA 5EDSA 2ASQA 1WE7A 2JUOA 3HK0A 3JSVA 4W9CA 3V62A 1ZGUB 1GG3A 2MWSB 3PLVA 4HXDA 5TR5A 4ZYNA 4E74A 4MEMA 3V6CB 2JRIB 1V80A 1V5OA 2IZVB 2L3ZA 3PREA 1V2YA 2KTFA 2BGFA 2PPHA 4MM3A 4BKSA 5GMVA 3A1QA 2N7EA 3VH4B 3U7DA 2MP2A 1T0YA 2KJHB 3UQBA 2L0TA 2RR9A 1WH3A 4PS8A 1TBEA 4AOFA 2BYVE 4G3XB 2BWES 2LD9A 1UBQA 3B1LX 4MJSB 2NBUA 4TUUA 1M94A 1X1MA 3TCAA 4AP4C 2N1VA 4KZ0A 5LXIB 5CHFA 1WXSA 1WY8A 2M17A 4GB9A 1H4RA 1PQSA 5KHQA 3LJ3A 1K8RB 3H7PA 3R66C 3L0WB 2KQSA 1Q5WB 2R2QA 2L8JA 3HM6X 4AUQC 1WM3A 4OVVA 2LGXA 1WRDB 1WJ4A 3CSTA 1J19A 3QK0A 4M8NA 4PS7A 2FUHB 3I3TB 4II3B 3PSEB 1C1YB 4EZLA 3KVFB 3DBLI 1WR6E 2LRWA 2KZRA 3APCA 2MBBB 1WE6A 4JLCA 3RCZA 2ZNVB 4ANUA 1D3ZA 2IO2B 2GMIC 4HWIB 4GXBA 2IY0B 2O6VB 3DVGX 1LXDA 2DZIA 2KDEB 2ZVOA 3PTFC 3DQVA 4HDOA 4BBNC 1WXMA 1EF5A 1GUAB 3JSVB 1WXAA 2G3QB 3ALBA 4GOCA 2JWZA 4AJYB 3ENEA 4W9HA 3V61A 2FAZA 2KKCA 2PE6B 5G55A 3ZNHB 3WA0A 4HPMB 4I6NB 4NPNA 5AZGA 3W1SA 3RULA 3T9LA 4TKNA 2FCNA 5IA7A 1E90A 5CHWA 1TTNA 1WX8A 1IPGA 4YL8A 5C1ZA 1V5TA 3A1QB 2N7DA 3TBLD 1WGYA 4I6PA 4DBGA 1WX9A 4KIKA 4N9F4 2MP2B 2Z0EB 2QHOA 4X57B 5DPTA 1XQQA 4GDLA 4ANVA 4EUTA 4F1SA 4W9IA 1V81A 4E71A 3DVNV 2LGYA 5DCNA 3PS6A 3L17A 3CMMB 3EECA 4NNJB 5AZHA 3HIZA 2V1YA 3VFKA 2Z0DB 3HHMA 1SE9A 4DXAB 1P98A 3PLUA 4LDTB 5J2RA 2C7MB 1WI0A 2LRUA 2XK5B 3KUZA 4A20A 1WYWB 1F9JA 1WFYA 4WJQA 3L16A 4HK2A 2PJHA 3UGBB 2I1KA 2LXCA 4HLEA 3D32A 2EMSA 3VVWB 2WYQA 4BOSC 1KM7A 4FHKA 1YX6B 4J6IA 4WJPA 2L7RA 2DAJA 3L08A 4M8MA 4WJOA 2GBJA 1WGDA 4WJNA 3ZTCA 5D94A 4AJWA 4DK5A 2D3GA 4XZ4A 1E8ZA 1Q1OA 4LJOB 2KANA 3N30A 2JRHA 2KQ7A 3ZIMA 3ZO5B 2BWFA 3JYUA 4FA6A 4GU2A 4IUMB 1V9JA 4W9KA 2OJRA 3IG3A 4IM0A 1UBIA 4KIKB 3ZVVA 5FR6A 2KD0A 4MGKE 2WX1A 3VHTC 2JF5A 3TL5A 4I6LB 1WGHA 2FCSA 1OEYA 2IO3B 4G50A 3ZNZB 2JT4B 2JZZA 4FBJB 1YX5B 2LZ6A 1EO6A 4WWNA 4A3PA 3T8MA 2LGDA 3MJWA 2KMCA 1OTRB 2KTRB 3A9JB 2BPSA 2KOXA 2K8CA 4W9JA 4BVUC 3VTUA 3JVZX 5J17A 4TV3A 3VUWA 5J18A 1UH6A 3TJPA 3ZW3A 2DAFA 5KHOA 4DHJD 1JRUA 1FXTB 1Y8RC 2LJ5A 3VAWA 2G4DB 2NPTA 2KLGA 4GMVA 4KDLB 3M62B 2DENB 2KNBA 2MLBA 2KVRA 2LXAA 2K6QA 4GN1A 2B3AA 4G11A 4KV2A 3PT2B 4ZRIA 3RYTA 4ASWC 4GDKA 2BYFA 2G4SA 3A4SC 2KDFB 3WALA 2MBHA 3PHWB 4II2B 2K8HA 3ONSA 4K81A 4B95A 3Q3JA 3QJZA 2ZNVC 3L10B 3JW0X 2M8SA 4ICVA 5DPWA 4E3CA 3H9DA 4RM8A 3UIOB 2BKRB 3UIPB 3AULA 1GJZA 4DHZB 4F8CB 2KK8A 2M4NA 3S2AA 2JY6A 5L95C 5JZEB 3UF8A 2GBKA 2IBIB 2LVPA 2IYDB 3R7RA 4FADA 3NS8A 1P1AA 2Z59B 3KH0A 4EZJA 3UINB 1EF1A 3BY4B 3VH3B 1E7VA 2KC2A 1SIFA 3PVLA 1S3SG 4W9FA 2GBRA 3ZNGC 4NY0A 2NVUI 3KYDD 4HPLB 2AL3A 1E7UA 2L00B 1WJUA 3VTVA 4DHZE 1NBFC 2A4ZA 3O65B 4KZCA 4IG7B 2K1FA 2KJ6A 2REXA 2GBNA 3VQIA 3ZNID 4GIVA 1E8WA 2K6DB 1RLFA 2MX2A 2N1WA 2ZEQA 4MDKE 3RZFA 3KYCD 3NOBA 2NPTB 4WQOB 1OEYJ 3EFUA 5C23A 1MG8A 1UGMA 2KMAA 2N9PC 2N9XA 3OLMD 2HE7A 4IM3A 3TMPB 4GDKB 1RRBA 1H8CA 4JL9A 2ZVNA 3PGEA 2KC1A 1WF9A 1V6EA 1WJ6A 1G6JA 4GSWA 1WIAA 2IO1B 4BBNF 3MHSD 4HCNB 2UYZB 3OJ4B 3KW5B 2AL6A 2PE9A 4FJZA 5DPRA 4NAWA 1YIWA 3EHVA 3QCAA 2KWUB 4MGIE 1R4NI 2LVOA 3ML9A 4KSLC 3WAMA 2HJ8A 1WMHA 4CO7A 3GOEA 3SDLC 2W9NA 3H7PB 3U30A 4NJ7A 2KWVB 2M0XA 3KUDB 4LJPB 2CS4A 4KDIC 3WAOA 1LFDA 3B0AA 4CYEA 5DPSA 1I35A 3PRPB 2D07B 3SD5A 3ZRCA 2CU1A 3EC8A 2D2QA 2MRPA 2NBWB 3N32A 1Z2MA 4FN2A 2JPHA 2J0KA 5CTRC 1P0RA 3ZDMC 1YQBA 4ICUA 4ZRJA 4EEWA 2D11A 4JGHB 3VUYA 2K8BA 5E6NA 2XBBC 4K7SA 3M3JA 2L05A 4MSMB 1KJTA 2MQJA 1HE8A 3AXCA 3OJ3A 3A4RA 2KFJA 2LUEA 2MBQA 2UWQA 1S1QB 2MA9B 5AEKB 2FIDA 3RD2A 2I1JA 1KLVA 4GGQA 3APFA 2EKEC 3U8ZA 1LQBA 2NR2A 2KO3A 2C9WB 2YLMA 1BT0A 2EMTA 4MH0E 1ISNA 4PYUA 1V86A 4XC2A 4M0WB 2O2VA 4HVBA 2V4LA 1I42A 3PPAA 4GDLB 3VXWA 2CHWA 1NI2A 3QC8B 4NAWB 2AEHA 2ZJDA 5D6JB 3W1YA 1WZ3A 4NJ6A 2G45B 1WMHB 2V3SA 5E6PA 2XEWA 2BYEA 4WWPA 2NS5A 4HCPB 2RD0A 4W9LA 1EUVB 4A3OA 1IYFA 3DPDA 2YVCA 2K39A 2MSED 5CX3A 4K1RB 2GBMA 2J0JA 2DZJA 1E5WA 3AI5A 2KX0A 4IWOA 5JHBA 4MSQB 2CR5A 3V6EB 2LVQA 1WXVA 3VUXA 1QZEA 2FCMA 3CSFA 2O6VD 4WWOA 4RMAA 1VD2A 3X0WA 3IFWB 3PRMB 2MBOA 2HD5B 1ZKHA 3SHQA 1WZ0A 2O6VA 2ZZPB 3NZSA 2C5LC 3Q3FA 4W9DA 1UELA 4IC7B 2KX3A 2PEAA 2ZCCA 2WDTB 4NQLB 4K7WA 2JZ3B 2KN5A 4BKSD 3P2BA 3AU5A 3L13A 2ZCBA 2JVCA 4NQKE 2O2VB 3DCGA 3IVFA 1Z5SB 1U4AA 3DVNU 3QX1A 5D7GA 4EFOA 3NHEB 3WAPA 2KDBA 3X23A 4B9KA 2C60A 2JXXA 1AARA 5L83A 2KWCA 1WJNA 1GC6A 3PV1A 4IWPA 2LASA 3DBRI 5G2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WAN A;  4LDT D;  4JQW C;  1XT9 B;  1OGW A;  1E8Y A;  3PHX B;  4IM2 A;  1LM8 B;  1TGZ B;  2C7H A;  4MGY E;  1SGH A;  4PS3 A;  4BKG A;  4ANW A;  5LLI A;  1WGG A;  4OVU A;  4HDQ A;  2XK5 A;  4XX5 A;  5E6O A;  1NDD A;  1V49 A;  3IHP C;  3AU4 A;  2L0F A;  2ZPY A;  2DZK A;  4K7U A;  4FUL A;  3K9P B;  4MEL A;  2BKF A;  2DX5 B;  4DHJ B;  1VCB A;  1WM2 A;  3RZW C;  2CHZ A;  3IBE A;  2KFK A;  3DBH I;  1WR1 A;  2FCQ A;  3K9O B;  3WIM A;  3PZD A;  4JIO U;  2VRR B;  4KSK C;  5AZF A;  2WWZ A;  4BFR A;  2AYO B;  2J0M A;  3A9K A;  2DYM A;  1P3Q U;  1GC7 A;  2Y5B B;  4FHJ A;  3ECI A;  2KDI A;  1IP9 A;  4LCD E;  2MCN B;  5IAA C;  3NZU A;  1WGR A;  3W1S C;  5HKH A;  3H1U A;  3PRZ A;  3TIX A;  3ZTD A;  1KOT A;  2AWT A;  3M95 A;  1ZW7 A;  3RUI B;  1L7Y A;  3KUC B;  3A33 B;  4FJY A;  1C3T A;  1UZX B;  2KJR A;  2MBE A;  2LI5 A;  3ML8 A;  4EKU A;  4P7I A;  5JH5 C;  1RFA A;  2LWP A;  5BO4 B;  1J0G A;  2KTR A;  1OQY A;  3A9J A;  3ZKJ C;  1RAX A;  2IO0 B;  2ZPN A;  2DYO A;  2GOW A;  3L54 A;  3R7Q A;  4AWJ A;  4F7Z A;  2CKH B;  4FLH A;  1YD8 U;  2MW5 A;  4DWF A;  1Q0W B;  1YJ1 A;  1GNU A;  2RSU A;  3CF6 E;  4MGZ E;  2WX0 A;  4CHK A;  2HTH A;  2BF8 B;  2KHW B;  4EZK A;  2N4F A;  3B08 A;  3V60 A;  5LXH A;  3QIJ A;  3QWZ B;  1R4M I;  2KFK B;  3QQ8 B;  2RPQ A;  4ANX A;  2FNJ B;  2DZM A;  2M1M A;  4B6W A;  2NBV B;  4IWQ A;  3ZLZ A;  3BIN A;  2FIF A;  4TQ1 A;  2IY1 B;  3DVG Y;  1XD3 B;  4WAA A;  4ZRK A;  3QHT A;  1UD7 A;  4BKT A;  3ZRF A;  1CMX B;  1TZ1 A;  2CHX A;  4PYZ A;  4DDI D;  2A5U A;  2OOB B;  1P9D U;  3M63 B;  3A9K B;  1WX7 A;  4W9E A;  4MJS A;  3ZUN A;  3N3K B;  4BOZ B;  2L76 A;  4TQ0 A;  2C7N B;  3NY5 A;  4HJK A;  3MTN B;  3R3M A;  5D2M B;  2KXJ A;  3H6N A;  2N9E B;  3HM3 A;  4FJV B;  4DDG D;  4KVG B;  3QA8 A;  3APD A;  3DOW A;  3QAR A;  4IW0 A;  4RM9 A;  2D10 A;  2K25 A;  3VTW A;  5JHA A;  2DHZ A;  4G0N B;  3DBS A;  2R2O A;  1A5R A;  2NCN A;  4URK A;  3LDZ E;  1L2N A;  3VDZ A;  4EOY A;  3RT3 B;  3ZDT A;  3UQA A;  3H7S A;  3C0R B;  3DDC B;  3GZN I;  3OAW A;  4ZDV A;  4W9G A;  2KLC A;  5CHV C;  3QAQ A;  3SU8 X;  2J7Q B;  2DYB A;  1J8C A;  1E8X A;  2RGF A;  5EDS A;  2ASQ A;  1WE7 A;  2JUO A;  3HK0 A;  3JSV A;  4W9C A;  3V62 A;  1ZGU B;  1GG3 A;  2MWS B;  3PLV A;  4HXD A;  5TR5 A;  4ZYN A;  4E74 A;  4MEM A;  3V6C B;  2JRI B;  1V80 A;  1V5O A;  2IZV B;  2L3Z A;  3PRE A;  1V2Y A;  2KTF A;  2BGF A;  2PPH A;  4MM3 A;  4BKS A;  5GMV A;  3A1Q A;  2N7E A;  3VH4 B;  3U7D A;  2MP2 A;  1T0Y A;  2KJH B;  3UQB A;  2L0T A;  2RR9 A;  1WH3 A;  4PS8 A;  1TBE A;  4AOF A;  2BYV E;  4G3X B;  2BWE S;  2LD9 A;  1UBQ A;  3B1L X;  4MJS B;  2NBU A;  4TUU A;  1M94 A;  1X1M A;  3TCA A;  4AP4 C;  2N1V A;  4KZ0 A;  5LXI B;  5CHF A;  1WXS A;  1WY8 A;  2M17 A;  4GB9 A;  1H4R A;  1PQS A;  5KHQ A;  3LJ3 A;  1K8R B;  3H7P A;  3R66 C;  3L0W B;  2KQS A;  1Q5W B;  2R2Q A;  2L8J A;  3HM6 X;  4AUQ C;  1WM3 A;  4OVV A;  2LGX A;  1WRD B;  1WJ4 A;  3CST A;  1J19 A;  3QK0 A;  4M8N A;  4PS7 A;  2FUH B;  3I3T B;  4II3 B;  3PSE B;  1C1Y B;  4EZL A;  3KVF B;  3DBL I;  1WR6 E;  2LRW A;  2KZR A;  3APC A;  2MBB B;  1WE6 A;  4JLC A;  3RCZ A;  2ZNV B;  4ANU A;  1D3Z A;  2IO2 B;  2GMI C;  4HWI B;  4GXB A;  2IY0 B;  2O6V B;  3DVG X;  1LXD A;  2DZI A;  2KDE B;  2ZVO A;  3PTF C;  3DQV A;  4HDO A;  4BBN C;  1WXM A;  1EF5 A;  1GUA B;  3JSV B;  1WXA A;  2G3Q B;  3ALB A;  4GOC A;  2JWZ A;  4AJY B;  3ENE A;  4W9H A;  3V61 A;  2FAZ A;  2KKC A;  2PE6 B;  5G55 A;  3ZNH B;  3WA0 A;  4HPM B;  4I6N B;  4NPN A;  5AZG A;  3W1S A;  3RUL A;  3T9L A;  4TKN A;  2FCN A;  5IA7 A;  1E90 A;  5CHW A;  1TTN A;  1WX8 A;  1IPG A;  4YL8 A;  5C1Z A;  1V5T A;  3A1Q B;  2N7D A;  3TBL D;  1WGY A;  4I6P A;  4DBG A;  1WX9 A;  4KIK A;  4N9F 4;  2MP2 B;  2Z0E B;  2QHO A;  4X57 B;  5DPT A;  1XQQ A;  4GDL A;  4ANV A;  4EUT A;  4F1S A;  4W9I A;  1V81 A;  4E71 A;  3DVN V;  2LGY A;  5DCN A;  3PS6 A;  3L17 A;  3CMM B;  3EEC A;  4NNJ B;  5AZH A;  3HIZ A;  2V1Y A;  3VFK A;  2Z0D B;  3HHM A;  1SE9 A;  4DXA B;  1P98 A;  3PLU A;  4LDT B;  5J2R A;  2C7M B;  1WI0 A;  2LRU A;  2XK5 B;  3KUZ A;  4A20 A;  1WYW B;  1F9J A;  1WFY A;  4WJQ A;  3L16 A;  4HK2 A;  2PJH A;  3UGB B;  2I1K A;  2LXC A;  4HLE A;  3D32 A;  2EMS A;  3VVW B;  2WYQ A;  4BOS C;  1KM7 A;  4FHK A;  1YX6 B;  4J6I A;  4WJP A;  2L7R A;  2DAJ A;  3L08 A;  4M8M A;  4WJO A;  2GBJ A;  1WGD A;  4WJN A;  3ZTC A;  5D94 A;  4AJW A;  4DK5 A;  2D3G A;  4XZ4 A;  1E8Z A;  1Q1O A;  4LJO B;  2KAN A;  3N30 A;  2JRH A;  2KQ7 A;  3ZIM A;  3ZO5 B;  2BWF A;  3JYU A;  4FA6 A;  4GU2 A;  4IUM B;  1V9J A;  4W9K A;  2OJR A;  3IG3 A;  4IM0 A;  1UBI A;  4KIK B;  3ZVV A;  5FR6 A;  2KD0 A;  4MGK E;  2WX1 A;  3VHT C;  2JF5 A;  3TL5 A;  4I6L B;  1WGH A;  2FCS A;  1OEY A;  2IO3 B;  4G50 A;  3ZNZ B;  2JT4 B;  2JZZ A;  4FBJ B;  1YX5 B;  2LZ6 A;  1EO6 A;  4WWN A;  4A3P A;  3T8M A;  2LGD A;  3MJW A;  2KMC A;  1OTR B;  2KTR B;  3A9J B;  2BPS A;  2KOX A;  2K8C A;  4W9J A;  4BVU C;  3VTU A;  3JVZ X;  5J17 A;  4TV3 A;  3VUW A;  5J18 A;  1UH6 A;  3TJP A;  3ZW3 A;  2DAF A;  5KHO A;  4DHJ D;  1JRU A;  1FXT B;  1Y8R C;  2LJ5 A;  3VAW A;  2G4D B;  2NPT A;  2KLG A;  4GMV A;  4KDL B;  3M62 B;  2DEN B;  2KNB A;  2MLB A;  2KVR A;  2LXA A;  2K6Q A;  4GN1 A;  2B3A A;  4G11 A;  4KV2 A;  3PT2 B;  4ZRI A;  3RYT A;  4ASW C;  4GDK A;  2BYF A;  2G4S A;  3A4S C;  2KDF B;  3WAL A;  2MBH A;  3PHW B;  4II2 B;  2K8H A;  3ONS A;  4K81 A;  4B95 A;  3Q3J A;  3QJZ A;  2ZNV C;  3L10 B;  3JW0 X;  2M8S A;  4ICV A;  5DPW A;  4E3C A;  3H9D A;  4RM8 A;  3UIO B;  2BKR B;  3UIP B;  3AUL A;  1GJZ A;  4DHZ B;  4F8C B;  2KK8 A;  2M4N A;  3S2A A;  2JY6 A;  5L95 C;  5JZE B;  3UF8 A;  2GBK A;  2IBI B;  2LVP A;  2IYD B;  3R7R A;  4FAD A;  3NS8 A;  1P1A A;  2Z59 B;  3KH0 A;  4EZJ A;  3UIN B;  1EF1 A;  3BY4 B;  3VH3 B;  1E7V A;  2KC2 A;  1SIF A;  3PVL A;  1S3S G;  4W9F A;  2GBR A;  3ZNG C;  4NY0 A;  2NVU I;  3KYD D;  4HPL B;  2AL3 A;  1E7U A;  2L00 B;  1WJU A;  3VTV A;  4DHZ E;  1NBF C;  2A4Z A;  3O65 B;  4KZC A;  4IG7 B;  2K1F A;  2KJ6 A;  2REX A;  2GBN A;  3VQI A;  3ZNI D;  4GIV A;  1E8W A;  2K6D B;  1RLF A;  2MX2 A;  2N1W A;  2ZEQ A;  4MDK E;  3RZF A;  3KYC D;  3NOB A;  2NPT B;  4WQO B;  1OEY J;  3EFU A;  5C23 A;  1MG8 A;  1UGM A;  2KMA A;  2N9P C;  2N9X A;  3OLM D;  2HE7 A;  4IM3 A;  3TMP B;  4GDK B;  1RRB A;  1H8C A;  4JL9 A;  2ZVN A;  3PGE A;  2KC1 A;  1WF9 A;  1V6E A;  1WJ6 A;  1G6J A;  4GSW A;  1WIA A;  2IO1 B;  4BBN F;  3MHS D;  4HCN B;  2UYZ B;  3OJ4 B;  3KW5 B;  2AL6 A;  2PE9 A;  4FJZ A;  5DPR A;  4NAW A;  1YIW A;  3EHV A;  3QCA A;  2KWU B;  4MGI E;  1R4N I;  2LVO A;  3ML9 A;  4KSL C;  3WAM A;  2HJ8 A;  1WMH A;  4CO7 A;  3GOE A;  3SDL C;  2W9N A;  3H7P B;  3U30 A;  4NJ7 A;  2KWV B;  2M0X A;  3KUD B;  4LJP B;  2CS4 A;  4KDI C;  3WAO A;  1LFD A;  3B0A A;  4CYE A;  5DPS A;  1I35 A;  3PRP B;  2D07 B;  3SD5 A;  3ZRC A;  2CU1 A;  3EC8 A;  2D2Q A;  2MRP A;  2NBW B;  3N32 A;  1Z2M A;  4FN2 A;  2JPH A;  2J0K A;  5CTR C;  1P0R A;  3ZDM C;  1YQB A;  4ICU A;  4ZRJ A;  4EEW A;  2D11 A;  4JGH B;  3VUY A;  2K8B A;  5E6N A;  2XBB C;  4K7S A;  3M3J A;  2L05 A;  4MSM B;  1KJT A;  2MQJ A;  1HE8 A;  3AXC A;  3OJ3 A;  3A4R A;  2KFJ A;  2LUE A;  2MBQ A;  2UWQ A;  1S1Q B;  2MA9 B;  5AEK B;  2FID A;  3RD2 A;  2I1J A;  1KLV A;  4GGQ A;  3APF A;  2EKE C;  3U8Z A;  1LQB A;  2NR2 A;  2KO3 A;  2C9W B;  2YLM A;  1BT0 A;  2EMT A;  4MH0 E;  1ISN A;  4PYU A;  1V86 A;  4XC2 A;  4M0W B;  2O2V A;  4HVB A;  2V4L A;  1I42 A;  3PPA A;  4GDL B;  3VXW A;  2CHW A;  1NI2 A;  3QC8 B;  4NAW B;  2AEH A;  2ZJD A;  5D6J B;  3W1Y A;  1WZ3 A;  4NJ6 A;  2G45 B;  1WMH B;  2V3S A;  5E6P A;  2XEW A;  2BYE A;  4WWP A;  2NS5 A;  4HCP B;  2RD0 A;  4W9L A;  1EUV B;  4A3O A;  1IYF A;  3DPD A;  2YVC A;  2K39 A;  2MSE D;  5CX3 A;  4K1R B;  2GBM A;  2J0J A;  2DZJ A;  1E5W A;  3AI5 A;  2KX0 A;  4IWO A;  5JHB A;  4MSQ B;  2CR5 A;  3V6E B;  2LVQ A;  1WXV A;  3VUX A;  1QZE A;  2FCM A;  3CSF A;  2O6V D;  4WWO A;  4RMA A;  1VD2 A;  3X0W A;  3IFW B;  3PRM B;  2MBO A;  2HD5 B;  1ZKH A;  3SHQ A;  1WZ0 A;  2O6V A;  2ZZP B;  3NZS A;  2C5L C;  3Q3F A;  4W9D A;  1UEL A;  4IC7 B;  2KX3 A;  2PEA A;  2ZCC A;  2WDT B;  4NQL B;  4K7W A;  2JZ3 B;  2KN5 A;  4BKS D;  3P2B A;  3AU5 A;  3L13 A;  2ZCB A;  2JVC A;  4NQK E;  2O2V B;  3DCG A;  3IVF A;  1Z5S B;  1U4A A;  3DVN U;  3QX1 A;  5D7G A;  4EFO A;  3NHE B;  3WAP A;  2KDB A;  3X23 A;  4B9K A;  2C60 A;  2JXX A;  1AAR A;  5L83 A;  2KWC A;  1WJN A;  1GC6 A;  3PV1 A;  4IWP A;  2LAS A;  3DBR I;  5G2N A; 
#chains in the Genus database with same CATH topology
 3WAN A;  2MJE A;  3PHX B;  4ANW A;  1SGH A;  3AU4 A;  4K7U A;  3K9P B;  1STE A;  3H8H A;  3UI3 A;  1D6E C;  2QCZ A;  1I4R A;  1HTO A;  3ECI A;  1KFY B;  5IAA C;  1KH0 A;  1EU4 A;  1TY2 A;  3EUB 2;  1PFD A;  4P6V F;  3A33 B;  3EFC A;  5BYQ A;  1B9R A;  2WDQ B;  4LNK A;  1HZ6 A;  1JRO A;  3ZXR A;  5IN7 A;  4EKU A;  1RFA A;  1J0G A;  2KTR A;  2W54 A;  2IO0 B;  2CKH B;  4FLH A;  3BYT B;  1YD8 U;  2WX0 A;  4M02 A;  2NTT A;  5LXH A;  1QF6 A;  3QQ8 B;  2RPQ A;  4ANX A;  2NBV B;  1L6U A;  3BIN A;  4TQ1 A;  3DVG Y;  1XD3 B;  1I4Q A;  1UD7 A;  1TZ1 A;  3AE5 B;  2CHX A;  2OOB B;  3M63 B;  1WX7 A;  1UNS A;  3AN1 A;  4BOZ B;  2L76 A;  2ZW1 A;  2M19 A;  1KF6 B;  1YN4 A;  1QOB A;  5D2M B;  3HM3 A;  2ONQ A;  2KAC A;  2MHJ A;  1D5X C;  1FRR A;  4KVG B;  3APD A;  4RM9 A;  5H92 C;  3VTW A;  1OFF A;  2XN9 C;  3TSS A;  2CJO A;  3DDC B;  1RYJ A;  3QAQ A;  2J7Q B;  1J8C A;  2ASQ A;  2JUO A;  3JSV A;  3HK0 A;  3V62 A;  1C79 A;  1XO3 A;  1R7S A;  4ZYN A;  4MEM A;  1V5O A;  3AEB B;  4P1C C;  1XLP A;  3P4S B;  1IBX A;  2BGF A;  3SFE B;  4BKS A;  2N7E A;  1TS4 A;  4PS8 A;  1TYG B;  2BWE S;  2LD9 A;  1D4B A;  2OED A;  5LXI B;  3I5J C;  3T3O A;  1HZ5 A;  3BVG A;  5KHQ A;  2QSD A;  1Q5W B;  1WRD B;  1WJ4 A;  3CST A;  2L1A A;  4PS7 A;  1ZOY B;  3I3T B;  4EZL A;  3DBL I;  2LRW A;  2CU3 A;  2KZR A;  3U2S C;  4JLC A;  2GMI C;  4HDO A;  3PTF C;  2DZI A;  3DQV A;  1WXM A;  3JSV B;  2JWZ A;  4AJY B;  2QIL A;  3NG0 A;  1L6V A;  1MHX A;  3N9Y C;  2PE6 B;  2W3S A;  3RNF C;  1NYR A;  4I6N B;  3GP7 A;  3W1S A;  2WXR A;  1E90 A;  1IBX B;  1SE4 A;  3OG5 A;  1WRI A;  5DPT A;  4ZYS A;  1V81 A;  3NVY A;  4K3B A;  1YN5 A;  3HIZ A;  5AZH A;  3VFK A;  2Z0D B;  1TJE A;  4ARI A;  3PLU A;  1AW7 A;  1XEE A;  2LRU A;  3AED B;  3AV8 A;  4A20 A;  4RGN A;  2IDY A;  4HK2 A;  3UGB B;  1T5X D;  2K0P A;  2G1E A;  1FPY A;  4N58 A;  2DWQ A;  4FHK A;  1K51 A;  1JWU D;  1XF5 L;  1V8C A;  2AQ2 B;  1WGD A;  4RGT A;  4WJN A;  1K53 A;  4DK5 A;  2D3G A;  1E8Z A;  4LJO B;  2BYT A;  2UU7 A;  1XCQ L;  2JYE A;  3ZO5 B;  2BWF A;  3JYU A;  5EE3 A;  2BW2 A;  4W9K A;  1OQQ A;  2OJR A;  3IG3 A;  4MGK E;  3AE6 B;  2K9X A;  1PYW D;  2ICI A;  2JT4 B;  3U7Z A;  1MG4 A;  2INP E;  1EO6 A;  1I7H A;  2LGD A;  1FNU A;  2BB5 A;  2KMC A;  4A8X C;  3I57 A;  2QIE B;  2KOX A;  1F0Z A;  4JX1 C;  2TSS A;  3JVZ X;  2W82 A;  5EE9 A;  4C56 C;  4ZHO A;  5KHO A;  1FXT B;  1Y8R C;  2KLG A;  4KDL B;  2DEN B;  2KNB A;  2LXA A;  1OQR A;  5IO9 A;  4GDK A;  4DXG A;  2K8H A;  3Q3J A;  2ZNV C;  2H89 B;  4M00 A;  1SXT A;  2BKR B;  3UIP B;  2M4N A;  5L95 C;  2GBK A;  2IBI B;  2Y5P A;  2I2Y A;  3NS8 A;  2Z8L A;  4EZJ A;  2DLB A;  3UIN B;  1E7V A;  1SIF A;  2WP9 B;  3ZNG C;  2MEK A;  2L00 B;  3VTV A;  1YMH E;  1NBF C;  4MT5 A;  1D5M C;  2REX A;  1N62 A;  2N1W A;  3R8B A;  2ZEQ A;  3RZF A;  3KYC D;  3EFU A;  5C23 A;  1E10 A;  3OLM D;  4IM3 A;  1NYQ A;  3TMP B;  4GDK B;  3LYY A;  3N20 C;  1WF9 A;  1G6J A;  1WJ6 A;  4GSW A;  2LUM A;  3MHS D;  2WGS A;  3KW5 B;  3WAM A;  4CO7 A;  1WMH A;  2WU5 B;  3GE3 C;  2BVC A;  3NVW A;  1NVI D;  1EM7 A;  2WXI A;  4LJP B;  1LFD A;  4CYE A;  5DPS A;  5BYS A;  4REZ A;  4L1B A;  2NBW B;  1Z2M A;  2JPH A;  5IP4 D;  5CTR C;  1P0R A;  2KQ4 X;  3RFZ B;  1C4A A;  2XBB C;  1V97 A;  1YNT E;  2L05 A;  2GLS A;  4YTP B;  1TT5 B;  4J3O D;  1I4P A;  2EKE C;  2WXJ A;  5JHA A;  4XWW A;  4BOS C;  1BT0 A;  1I4G A;  2O2V A;  1I42 A;  4GDL B;  1F77 A;  2V9H A;  1ROE A;  2ZJD A;  1WZ3 A;  1WMH B;  3ZJU A;  4YTM B;  4WWP A;  5T8I A;  2D3C A;  3DPD A;  2MSE D;  4K1R B;  2D3A A;  2DZJ A;  1A70 A;  2KX0 A;  4LTU A;  3V6E B;  4NAM A;  3VUX A;  2FCM A;  3CSF A;  4RMA A;  1MJD A;  3KQ4 A;  4ZHP A;  3IT6 B;  3SHQ A;  1M4V A;  2WS3 B;  2O6V A;  1ENF A;  3Q3F A;  2LMC A;  4IC7 B;  4IKG A;  2WXG A;  1YQ4 B;  4K7W A;  4BKS D;  3P2B A;  3J9C A;  2KWD A;  2JSV X;  4NQK E;  2O2V B;  3DCG A;  1FNV A;  3IVF A;  2AX5 A;  1F2R C;  3QX1 A;  5D7G A;  4B9K A;  3X23 A;  2JYT A;  2C60 A;  2JXX A;  2OHF A;  1GC6 A;  1GPX A;  3DBR I;  3DBR B;  1TGZ B;  4MGY E;  5E6O A;  3IHP C;  2ZPY A;  1FFU A;  3Q8B A;  5AUK A;  4FUL A;  1F2R I;  4MEL A;  2CHZ A;  2KFK A;  4PK1 A;  3ZQ4 A;  1RWS A;  4RCO A;  4JIO U;  1C78 A;  4KSK C;  5AZF A;  4BFR A;  2J0M A;  1P3Q U;  4US9 A;  4KKJ A;  2WLB A;  3ZGZ A;  1IP9 A;  4MAC A;  1RFK A;  3PRZ A;  3ZTD A;  1KOT A;  2AWT A;  3RUI B;  2AQ1 B;  3V05 A;  3KUC B;  3Q8C A;  4FJY A;  2QMT A;  2EKI A;  1UZX B;  2KJR A;  2MBE A;  3DWG C;  4KGS A;  4P7I A;  5JH5 C;  2LWP A;  3MC8 A;  3A9J A;  3ZKJ C;  1I4H A;  2H88 B;  2DYO A;  4F7Z A;  2G9H D;  5BYR A;  4DWF A;  1Q0W B;  3RNG C;  1YJ1 A;  1GNU A;  2KHW B;  2BF8 B;  2FBW B;  3QIJ A;  1R4M I;  2KFK B;  3ZLZ A;  4IWQ A;  5BMI A;  3P4Q B;  3BVM A;  1FXA A;  1SSN A;  3QHT A;  3ZRF A;  1CMX B;  1WYG A;  4MJS A;  3ZUN A;  1DOI A;  4TQ0 A;  3MTN B;  2QJL A;  3BZD B;  2KXJ A;  3O13 A;  2WNM A;  2V4I B;  3DOW A;  4IW0 A;  4HRO A;  4G0N B;  1A5R A;  3LDZ E;  3B2G A;  1UWM A;  3VDZ A;  3ZDT A;  4EOY A;  5C3J B;  1I4X A;  1QIL A;  2WDV B;  3NUH B;  1XLN A;  2KLC A;  3PZ7 A;  1WE7 A;  3PLV A;  4E74 A;  1MHH E;  2JRI B;  2L3Z A;  5E6J A;  4ZOH C;  3PRE A;  2KTF A;  1CK1 A;  3Q3N C;  1YJJ A;  3Q69 A;  2N9K A;  2MP2 A;  1T0Y A;  2KJH B;  2L0T A;  3URY A;  4EE2 A;  1TBE A;  4MJS B;  2NBU A;  2N1V A;  1N5W A;  5CHF A;  4JWU C;  1WXS A;  1WY8 A;  2M17 A;  1JWS D;  1PQS A;  1K8R B;  3H7P A;  3L0W B;  2KQS A;  1ZXI A;  4AUQ C;  1WM3 A;  4OVV A;  1FM0 D;  1J19 A;  5GXG B;  3DHI C;  5EE1 A;  3PSE B;  3KVF B;  1VJK A;  2M56 B;  4GXB A;  1ZDX A;  1EF5 A;  1GUA B;  1SE2 A;  1ZPS A;  5BMG A;  1WXA A;  2G3Q B;  4GOC A;  4YT0 B;  3RNB C;  3ENE A;  3V61 A;  2FAZ A;  4HPM B;  4NPN A;  2J53 A;  3AE9 B;  3AEG B;  3IT4 B;  4ITK A;  4TKN A;  3RUL A;  2LGI A;  2FCN A;  4A6Q A;  1TTN A;  1IPG A;  4YL8 A;  3RPF C;  2MP2 B;  2Z0E B;  4X57 B;  1WGK A;  4NZL B;  3HVD A;  4F1S A;  3GS2 A;  4E71 A;  3DVN V;  2JU6 X;  1R4N B;  3EEC A;  4NNJ B;  1VR9 A;  4LDT B;  2C7M B;  2VH1 A;  4RF0 A;  1WFY A;  2CJN A;  4WJQ A;  5I4D A;  2OJW A;  1N61 A;  2I1K A;  4HLE A;  3D32 A;  1KM7 A;  1TS2 A;  4J6I A;  3L08 A;  1T3Q A;  4M8M A;  4WJO A;  2GBJ A;  4H2A A;  1Q1O A;  4HEA 1;  2WXL A;  3N30 A;  1MI0 A;  4GU2 A;  1TKG A;  4YSX B;  1QLB B;  2LHE A;  5FR6 A;  3TL5 A;  1HEZ E;  2FCS A;  2IO3 B;  1YX5 B;  4WWN A;  2KTR B;  2BPS A;  4RF1 A;  3TJP A;  1AN8 A;  5G5G A;  2MLB A;  2KVR A;  2K6Q A;  4KV2 A;  2B3A A;  4G11 A;  1HQR D;  2BYF A;  2G4S A;  2B76 B;  3A4S C;  2KDF B;  2MBH A;  4BAX A;  1UGJ A;  3QJZ A;  3JW0 X;  2M8S A;  1SF0 A;  4ICV A;  5DPW A;  3UIO B;  3AUL A;  4DHZ B;  4F8C B;  2LVP A;  4QAY A;  4JE3 B;  1P1A A;  1EF1 A;  3BY4 B;  3NJT A;  3Q8E A;  1Y56 A;  4NY0 A;  3TUO A;  2NVU I;  2AL3 A;  1E7U A;  4ZRP A;  4DHZ E;  3O65 B;  4IG7 B;  2KJ6 A;  2Y3A A;  1ESF A;  2WXO A;  3ZNI D;  1RLF A;  1RM6 C;  3FIL A;  1ZUD 2;  4WQO B;  3BK1 A;  2KMA A;  2HE7 A;  3DWM A;  2KT7 A;  3DBH B;  2IO1 B;  4A55 A;  4HCN B;  3OJ4 B;  2AL6 A;  2PE9 A;  5FKA C;  2KWU B;  4PT5 A;  1KRH A;  4KSL C;  2HJ8 A;  5MPO A;  3U30 A;  2KWV B;  2M0X A;  2CS4 A;  4KDI C;  3V3X A;  2KYW A;  2IPK D;  2KAJ A;  1I35 A;  3MJ5 A;  3SD5 A;  3ZRC A;  2CU1 A;  3ZDM C;  4JGH B;  3FIL B;  2JXT A;  4MSM B;  2MQJ A;  1HE8 A;  1YJI A;  1SBB B;  2MJ3 A;  2UWQ A;  5AEK B;  3AEF B;  2RMM A;  2WDR B;  3N1Z C;  2C9W B;  3CIR B;  2JZP A;  1V86 A;  4HVB A;  5JXV A;  3VXW A;  2PMV A;  1JQ4 A;  3QC8 B;  3W9C B;  1UUP A;  3KLS X;  1K50 A;  2SEB D;  2X38 A;  2BYE A;  2WXP A;  2NS5 A;  4HCP B;  1IGC A;  2RD0 A;  3MHZ A;  2INN E;  2QC8 A;  2WXN A;  2YEP B;  2YVC A;  5CX3 A;  1SJH D;  3U52 E;  2GBM A;  4D2K A;  3AE8 B;  3AI5 A;  3FC4 A;  4IWO A;  4XDC A;  4MSQ B;  1WXV A;  3IXS A;  1QZE A;  3TEY A;  4WWO A;  1VD2 A;  3X0W A;  2HD5 B;  2WXF A;  1WZ0 A;  1ZE3 D;  3B9J A;  1IGD A;  3SEB A;  1UEL A;  2KX3 A;  2GRI A;  4NQL B;  2WDT B;  3VR8 B;  1D5Z C;  1KLU D;  3W5U B;  5FK9 C;  1VLB A;  1Z5S B;  2AQ3 B;  3WAP A;  2KDB A;  2R61 A;  3ZJV A;  4AQ7 A;  4IWP A;  2LAS A;  2IND C;  5G2N A;  1JWM D;  4LDT D;  1OGW A;  1T0Q C;  1E8Y A;  5HHD G;  4BKG A;  5LLI A;  4HDQ A;  2XK5 A;  4XX5 A;  2L0F A;  2BKF A;  2DX5 B;  3RNA C;  4LNF A;  1MFW A;  2LJI A;  2PW9 A;  1WM2 A;  3RZW C;  3OWE B;  1AYF A;  3MP9 A;  2FCQ A;  3PZD A;  1N5X A;  2VRR B;  2WWZ A;  3A9K A;  2V3N A;  1NI3 A;  2DYM A;  3GE8 C;  4FHJ A;  2KDI A;  1ZDV A;  4LCD E;  3NZU A;  2EEL A;  4RNA A;  1ZW7 A;  1L7Y A;  4NJC A;  2VH2 A;  1JML A;  4B0E A;  1C3T A;  3ML8 A;  2PTL A;  1PUT A;  5BO4 B;  1OQY A;  4HKQ A;  1RAX A;  4ACF A;  2GOW A;  2IGD A;  4RFB A;  2MW5 A;  3DHG C;  2RSU A;  3CF6 E;  4CHK A;  4EZK A;  3MC0 B;  1WWT A;  3QWZ B;  2L52 A;  2DZM A;  2M1M A;  4GLS C;  4C7Y A;  2BQQ A;  2IY1 B;  4WAA A;  1XCT L;  4BKT A;  1P9D U;  3A9K B;  4W9E A;  1FO4 A;  2C7N B;  3R3M A;  1TS3 A;  3H6N A;  4M01 A;  2N9E B;  1UWX A;  4WH4 A;  4DDG D;  1ET9 A;  3QA8 A;  3C8Y A;  3QAR A;  2K25 A;  2DHZ A;  1L0V B;  3B2F A;  3DBS A;  3MC9 A;  1NEK B;  2JWU A;  2NCN A;  4URK A;  1L2N A;  2E3T A;  3RT3 B;  3C0R B;  4LNN A;  3OAW A;  4ZDV A;  3SU8 X;  1FRD A;  4ARC A;  1E8X A;  2RGF A;  5EDS A;  2WXH A;  1GG3 A;  1TZO A;  1V80 A;  2IZV B;  1QKZ A;  2PPH A;  5GMV A;  2J42 A;  3U7D A;  4S0R A;  3NS1 A;  4BVU C;  1WH3 A;  4AOF A;  2BYV E;  4G3X B;  4TUU A;  3RI7 C;  1M94 A;  1X1M A;  3KWV A;  3TCA A;  4AP4 C;  4KZ0 A;  4GB9 A;  4A9A A;  4JWS C;  3R66 C;  4JPS A;  1MVK A;  3BYY B;  4N6E B;  2FUH B;  4II3 B;  4XGA B;  1C1Y B;  1J7B A;  1WR6 E;  4UDU C;  3APC A;  4P1B C;  2MBB B;  1WE6 A;  3RCZ A;  2QDF A;  1D3Z A;  2IO2 B;  3ZJT A;  3P63 A;  2IY0 B;  2O6V B;  3ZNZ B;  1LXD A;  2KDE B;  2ZVO A;  1BUI C;  4KGR A;  1QT9 A;  4HKZ E;  1CQV A;  3WA0 A;  3T9L A;  1XLO A;  5CHW A;  4C4V A;  1V5T A;  1LGR A;  2N7D A;  3TBL D;  5C2T B;  2ZW0 A;  1WX9 A;  4N9F 4;  5G5H A;  1XQQ A;  4EUT A;  1C4P A;  1GAQ B;  3FAH A;  2IJ0 A;  5DCN A;  3L17 A;  3CMM B;  3HHM A;  4DXA B;  1T0S C;  1YOV B;  1XXG A;  4C80 A;  1C77 A;  1WYW B;  2BS3 B;  4YWG G;  4TSS A;  1IUE A;  1HXY D;  2PJH A;  3AM9 A;  3VVW B;  2WYQ A;  4OHJ A;  4WJP A;  2BS2 B;  2DAJ A;  4YSZ B;  3W2D A;  2MH7 A;  4HPP A;  4LNI A;  1Q10 A;  1FFV A;  2WU2 B;  3Q3O C;  4XZ4 A;  1V1P A;  2KAN A;  2I38 A;  2JRH A;  4C4V B;  3ZIM A;  4IUM B;  2WXM A;  4IM0 A;  3ZVV A;  1QQR A;  2KD0 A;  1FNW A;  3VHT C;  1QOG A;  2LZ6 A;  3R2T A;  3NZ3 A;  2N0S B;  3NVV A;  1C4C A;  1OTR B;  3A9J B;  4RGO S;  2BS4 B;  4W9J A;  2HTM E;  3VTU A;  5J17 A;  3VUW A;  1UH6 A;  1ZXH A;  3ZW3 A;  1JRU A;  3VAW A;  2LJ5 A;  4RH6 A;  3RYT A;  4GN1 A;  4ZRI A;  3EA6 A;  1DYQ A;  3PT2 B;  1YN3 A;  4ASW C;  3RMK C;  2WHI A;  3WAL A;  4B95 A;  3Q14 C;  2X8X X;  1FIQ A;  4P16 A;  1V1P B;  4E3C A;  1FD6 A;  4YTN B;  3S2A A;  5FR3 A;  5JZE B;  3UF8 A;  4WQM A;  2K3U A;  2IYD B;  4N59 A;  4FAD A;  3P42 A;  3KH0 A;  1TY0 A;  1S3S G;  4W9F A;  2GBR A;  2DBY A;  4HPL B;  3IAM 1;  1WJU A;  2A4Z A;  1EWC A;  4KZC A;  2V0G A;  2K1F A;  3VQI A;  2GBN A;  4MH8 A;  1DGJ A;  2RPV A;  3C19 A;  4GIV A;  1E8W A;  4KKI A;  2K6D B;  2MX2 A;  2PIA A;  4MDK E;  3E56 A;  1UGM A;  1V1O A;  2N9P C;  2N9X A;  2LHD A;  4XDD A;  1RRB A;  1N6Z A;  2KDM A;  1H8C A;  1LO5 D;  2ZVN A;  5HFY A;  1VRA B;  1V6E A;  3AH7 A;  2KN4 A;  2UYZ B;  2Y5C A;  3N1X C;  4FJZ A;  3Q2A C;  1YIW A;  4NAW A;  3QCA A;  1R4N I;  4US8 A;  3GB1 A;  1VDV A;  2W9N A;  3H7P B;  3SDL C;  2LEK A;  4NJ7 A;  3WAO A;  1MPE A;  1QOA A;  3Q3M C;  2D07 B;  2D2Q A;  1UF0 A;  3N32 A;  1YQB A;  4ZRJ A;  4EEW A;  2D11 A;  3VUY A;  2K8B A;  2L32 A;  2N7J A;  4K7S A;  1KJT A;  2GI9 A;  1VZ7 A;  3A4R A;  2LUE A;  2FID A;  2I1J A;  1LQB A;  2YLM A;  2NR2 A;  2KO3 A;  3BWU D;  3BVZ A;  4XC2 A;  5IKC M;  3IAS 1;  2V4L A;  4L2Y A;  4XE0 A;  3PPA A;  1SIJ A;  2CHW A;  1ZP0 B;  4NAW B;  5D6J B;  3W1Y A;  4NJ6 A;  2G45 B;  3TEZ A;  2V3S A;  5E6P A;  2XEW A;  1J7C A;  4FXC A;  1EUV B;  1IYF A;  2K39 A;  1F1H A;  2JX5 A;  2LVQ A;  1AWD A;  2O6V D;  1WXQ A;  1JCK B;  2SAK A;  3PRM B;  1ZKH A;  4W9D A;  1KLG D;  2PEA A;  2ZCC A;  3AU5 A;  2K22 A;  1U4A A;  3ABV B;  4OZC A;  5L83 A;  3PV1 A;  3HRD D;  4JQW C;  1XT9 B;  4S17 A;  4B0M A;  4IM2 A;  1LM8 B;  4PS3 A;  2C7H A;  3TEX A;  1CZP A;  1WGG A;  2V3P A;  2QEJ C;  1YQ3 B;  3ETR A;  4OVU A;  1NDD A;  1V49 A;  2DZK A;  4DHJ B;  1EWY C;  1VCB A;  2MJD A;  3DBL B;  4XWT A;  4YSY B;  1PGB A;  3IBE A;  3DBH I;  3U4E G;  4Q2J A;  1WR1 A;  3K9O B;  3WIM A;  3PO0 A;  2AYO B;  1GC7 A;  2Y5B B;  4USA A;  4ZRQ A;  4OZA A;  2YEP F;  1E9M A;  2PKO A;  2MCN B;  4YXD B;  1CJE A;  1QOF A;  1JWA D;  1WGR A;  3W1S C;  3H1U A;  5HKH A;  1L4Z B;  3TIX A;  2PLP A;  2LGS A;  3TEW A;  3AE2 B;  2HJ1 A;  3M95 A;  3I9V 1;  2N9L A;  2J4X A;  1KTK A;  1DOX A;  2L83 A;  1E6E B;  2LI5 A;  3AE4 B;  4IDI A;  3DHH C;  2ZPN A;  3L54 A;  3HUI A;  3R7Q A;  2INC C;  4AWJ A;  4C7Z A;  4TMA B;  3BK2 A;  4MGZ E;  2HTH A;  2N4F A;  3B08 A;  3V60 A;  1BXT A;  2FNJ B;  4B6W A;  3L4P A;  3P4P B;  2FIF A;  4ZRK A;  2VZK B;  3VRB B;  4PYZ A;  4DDI D;  2A5U A;  5HG2 A;  3N3K B;  4WUR A;  3NY5 A;  4HJK A;  4WWM A;  1WSP A;  2W55 A;  4LNO A;  3MFG A;  4FJV B;  1VZ8 A;  2M0A A;  2W3R A;  2WXK A;  2D10 A;  4DQO C;  5HI1 A;  2R2O A;  3UQA A;  3H7S A;  3GZN I;  3GZN B;  4W9G A;  2KMM A;  5CHV C;  2DYB A;  2HDE A;  4W9C A;  1B1Z A;  1ZGU B;  2MWS B;  4HXD A;  1GB4 A;  2FUG 1;  5TR5 A;  3R2I A;  4BZA A;  4XYC A;  3V6C B;  3CWI A;  1V2Y A;  2NTS A;  2RDG A;  4MM3 A;  3A1Q A;  2D5G A;  3VH4 B;  1FCC C;  3NVZ A;  3UQB A;  2RR9 A;  4BBN F;  1UBQ A;  3B1L X;  3RNC C;  1ACC A;  1H4R A;  2ACZ B;  1FCL A;  3FKY A;  3LJ3 A;  2R2Q A;  2L8J A;  3HM6 X;  3SFD B;  2BTE A;  2LGX A;  1SEB D;  2IGH A;  3QK0 A;  4RGM A;  4M8N A;  3ZYY X;  2ON8 A;  4ANU A;  2ZNV B;  4HWI B;  1GB1 A;  3DVG X;  4BBN C;  1TKE A;  2D3B A;  3ALB A;  3N1Y C;  4W9H A;  4L23 A;  2KKC A;  1JRP A;  5G55 A;  1J7A A;  3ZNH B;  2NMQ A;  5AZG A;  2K5P A;  5IA7 A;  1L5P A;  1WX8 A;  5C1Z A;  4MM3 B;  3A1Q B;  1WGY A;  3HVZ A;  4I6P A;  4DBG A;  1BML C;  2XNA C;  4KIK A;  3PZ8 A;  2J52 A;  1L4D B;  2QHO A;  4KX6 B;  4ANV A;  4GDL A;  3P1M A;  4W9I A;  4CQN A;  2LGY A;  4OVZ A;  3AEC B;  1SB3 C;  3PS6 A;  1HA5 A;  2V1Y A;  1SE9 A;  1P98 A;  5J2R A;  1WI0 A;  2XK5 B;  3KUZ A;  2RDB C;  1T0R C;  3P4R B;  1F9J A;  2LFI A;  4R3D A;  5EE0 A;  3L16 A;  2LXC A;  4C00 A;  2EMS A;  3AEA B;  1YX6 B;  3LB8 C;  2L7R A;  2E6X A;  3BII D;  3SR6 A;  3ZTC A;  5D94 A;  2GB1 A;  4AJW A;  1DOY A;  1GOZ A;  2KQ7 A;  4FA6 A;  1V9J A;  1UBI A;  4KIK B;  3Q6B A;  2WX1 A;  2JF5 A;  4I6L B;  1WGH A;  1OEY A;  4G50 A;  2JZZ A;  4FBJ B;  4LK0 M;  1JWB D;  4A3P A;  3T8M A;  5TSS A;  3MJW A;  1FEH A;  2K8C A;  4TV3 A;  5J18 A;  3W5V B;  1NEN B;  1TS5 A;  4OZB A;  2DAF A;  4DHJ D;  2G4D B;  2NPT A;  4GMV A;  3M62 B;  4AS1 A;  2WQY B;  3AB5 A;  5H8Y E;  3LXF A;  3PHW B;  3ONS A;  4II2 B;  4K81 A;  4HRS A;  1T6B X;  3ZXV A;  3L10 B;  3H9D A;  4RM8 A;  1GJZ A;  2KK8 A;  2JY6 A;  3R7R A;  2Z59 B;  3VH3 B;  2KC2 A;  3PVL A;  2KVZ A;  3NRZ A;  3KYD D;  1P7E A;  3Q8A A;  1L0X B;  1E0Z A;  3AE7 B;  1K52 A;  4DXF A;  2IGG A;  4HJG E;  5IOI A;  3NOB A;  4LLG M;  1PDX A;  2NPT B;  1OEY J;  1MG8 A;  3I63 C;  5AUI A;  2JQR B;  3EGR A;  2BB6 A;  4JL9 A;  3PGE A;  2KC1 A;  3KWL A;  1WIA A;  2FE8 A;  2VZK D;  1C9F A;  4M0W A;  1SJE D;  1HTQ A;  5DPR A;  4KGT A;  3AE1 B;  3EHV A;  4MGI E;  2LVO A;  3ML9 A;  3RNE C;  1JAL A;  1F52 A;  3GOE A;  2BBC A;  3KUD B;  3B0A A;  3PRP B;  2BT6 A;  3EC8 A;  2MRP A;  4FN2 A;  2J0K A;  3AEE B;  4ICU A;  2WXQ A;  5E6N A;  3M3J A;  1C76 A;  1P7F A;  3AMZ A;  1ET6 A;  3AXC A;  3OJ3 A;  2KFJ A;  2MBQ A;  1S1Q B;  1JW9 D;  2MA9 B;  3RN9 C;  1KLV A;  3RD2 A;  1VZ6 A;  4GGQ A;  3Q8F A;  1XLQ A;  1FXI A;  3APF A;  3U8Z A;  3T3N A;  1PGX A;  1EU3 A;  1R4M B;  2EMT A;  4MH0 E;  4PYU A;  1ISN A;  4M0W B;  3AE3 B;  4K3C A;  2DNF A;  4OW0 A;  1NI2 A;  2AEH A;  1PGA A;  1TKY A;  3VR9 B;  4W9L A;  4A3O A;  2PVO D;  2J0J A;  1E5W A;  1SE3 A;  3WCQ A;  5JHB A;  1N60 A;  5LNK 1;  1FMA D;  2CR5 A;  2PVG C;  2Q5W D;  4WIP A;  3IFW B;  2MBO A;  2RDH A;  1TIF A;  2ZZP B;  3NZS A;  2C5L C;  1E7P B;  2JZ3 B;  2KN5 A;  3L13 A;  4O1N A;  4WAF A;  2ZCB A;  2JVC A;  5D3I B;  3DVN U;  3E9S A;  1L0Y B;  3NHE B;  4EFO A;  4IOI E;  1N63 A;  1AAR A;  2KWC A;  3VRA B;  1WJN A;  5BMH A;  5D3D A;  4A90 A; 
#chains in the Genus database with same CATH homology
 3WAN A;  4LDT D;  4JQW C;  1XT9 B;  1OGW A;  1E8Y A;  3PHX B;  4IM2 A;  1LM8 B;  1TGZ B;  2C7H A;  4MGY E;  1SGH A;  4PS3 A;  4BKG A;  4ANW A;  5LLI A;  1WGG A;  4OVU A;  4HDQ A;  2XK5 A;  4XX5 A;  5E6O A;  1NDD A;  1V49 A;  3IHP C;  3AU4 A;  2L0F A;  2ZPY A;  2DZK A;  4K7U A;  4FUL A;  3K9P B;  4MEL A;  2BKF A;  2DX5 B;  4DHJ B;  1VCB A;  1WM2 A;  3RZW C;  2CHZ A;  3IBE A;  2KFK A;  3DBH I;  1WR1 A;  2FCQ A;  3K9O B;  3WIM A;  3PZD A;  4JIO U;  2VRR B;  4KSK C;  5AZF A;  2WWZ A;  4BFR A;  2AYO B;  2J0M A;  3A9K A;  2DYM A;  1P3Q U;  1GC7 A;  2Y5B B;  4FHJ A;  3ECI A;  2KDI A;  1IP9 A;  4LCD E;  2MCN B;  5IAA C;  3NZU A;  1WGR A;  3W1S C;  5HKH A;  3H1U A;  3PRZ A;  3TIX A;  3ZTD A;  1KOT A;  2AWT A;  3M95 A;  1ZW7 A;  3RUI B;  1L7Y A;  3KUC B;  3A33 B;  4FJY A;  1C3T A;  1UZX B;  2KJR A;  2MBE A;  2LI5 A;  3ML8 A;  4EKU A;  4P7I A;  5JH5 C;  1RFA A;  2LWP A;  5BO4 B;  1J0G A;  2KTR A;  1OQY A;  3A9J A;  3ZKJ C;  1RAX A;  2IO0 B;  2ZPN A;  2DYO A;  2GOW A;  3L54 A;  3R7Q A;  4AWJ A;  4F7Z A;  2CKH B;  4FLH A;  1YD8 U;  2MW5 A;  4DWF A;  1Q0W B;  1YJ1 A;  1GNU A;  2RSU A;  3CF6 E;  4MGZ E;  2WX0 A;  4CHK A;  2HTH A;  2BF8 B;  2KHW B;  4EZK A;  2N4F A;  3B08 A;  3V60 A;  5LXH A;  3QIJ A;  3QWZ B;  1R4M I;  2KFK B;  3QQ8 B;  2RPQ A;  4ANX A;  2FNJ B;  2DZM A;  2M1M A;  4B6W A;  2NBV B;  4IWQ A;  3ZLZ A;  3BIN A;  2FIF A;  4TQ1 A;  2IY1 B;  3DVG Y;  1XD3 B;  4WAA A;  4ZRK A;  3QHT A;  1UD7 A;  4BKT A;  3ZRF A;  1CMX B;  1TZ1 A;  2CHX A;  4PYZ A;  4DDI D;  2A5U A;  2OOB B;  1P9D U;  3M63 B;  3A9K B;  1WX7 A;  4W9E A;  4MJS A;  3ZUN A;  3N3K B;  4BOZ B;  2L76 A;  4TQ0 A;  2C7N B;  3NY5 A;  4HJK A;  3MTN B;  3R3M A;  5D2M B;  2KXJ A;  3H6N A;  2N9E B;  3HM3 A;  4FJV B;  4DDG D;  4KVG B;  3QA8 A;  3APD A;  3DOW A;  3QAR A;  4IW0 A;  4RM9 A;  2D10 A;  2K25 A;  3VTW A;  5JHA A;  2DHZ A;  4G0N B;  3DBS A;  2R2O A;  1A5R A;  2NCN A;  4URK A;  3LDZ E;  1L2N A;  3VDZ A;  4EOY A;  3RT3 B;  3ZDT A;  3UQA A;  3H7S A;  3C0R B;  3DDC B;  3GZN I;  3OAW A;  4ZDV A;  4W9G A;  2KLC A;  5CHV C;  3QAQ A;  3SU8 X;  2J7Q B;  2DYB A;  1J8C A;  1E8X A;  2RGF A;  5EDS A;  2ASQ A;  1WE7 A;  2JUO A;  3HK0 A;  3JSV A;  4W9C A;  3V62 A;  1ZGU B;  1GG3 A;  2MWS B;  3PLV A;  4HXD A;  5TR5 A;  4ZYN A;  4E74 A;  4MEM A;  3V6C B;  2JRI B;  1V80 A;  1V5O A;  2IZV B;  2L3Z A;  3PRE A;  1V2Y A;  2KTF A;  2BGF A;  2PPH A;  4MM3 A;  4BKS A;  5GMV A;  3A1Q A;  2N7E A;  3VH4 B;  3U7D A;  2MP2 A;  1T0Y A;  2KJH B;  3UQB A;  2L0T A;  2RR9 A;  1WH3 A;  4PS8 A;  1TBE A;  4AOF A;  2BYV E;  4G3X B;  2BWE S;  2LD9 A;  1UBQ A;  3B1L X;  4MJS B;  2NBU A;  4TUU A;  1M94 A;  1X1M A;  3TCA A;  4AP4 C;  2N1V A;  4KZ0 A;  5LXI B;  5CHF A;  1WXS A;  1WY8 A;  2M17 A;  4GB9 A;  1H4R A;  1PQS A;  5KHQ A;  3LJ3 A;  1K8R B;  3H7P A;  3R66 C;  3L0W B;  2KQS A;  1Q5W B;  2R2Q A;  2L8J A;  3HM6 X;  4AUQ C;  1WM3 A;  4OVV A;  2LGX A;  1WRD B;  1WJ4 A;  3CST A;  1J19 A;  3QK0 A;  4M8N A;  4PS7 A;  2FUH B;  3I3T B;  4II3 B;  3PSE B;  1C1Y B;  4EZL A;  3KVF B;  3DBL I;  1WR6 E;  2LRW A;  2KZR A;  3APC A;  2MBB B;  1WE6 A;  4JLC A;  3RCZ A;  2ZNV B;  4ANU A;  1D3Z A;  2IO2 B;  2GMI C;  4HWI B;  4GXB A;  2IY0 B;  2O6V B;  3DVG X;  1LXD A;  2DZI A;  2KDE B;  2ZVO A;  3PTF C;  3DQV A;  4HDO A;  4BBN C;  1WXM A;  1EF5 A;  1GUA B;  3JSV B;  1WXA A;  2G3Q B;  3ALB A;  4GOC A;  2JWZ A;  4AJY B;  3ENE A;  4W9H A;  3V61 A;  2FAZ A;  2KKC A;  2PE6 B;  5G55 A;  3ZNH B;  3WA0 A;  4HPM B;  4I6N B;  4NPN A;  5AZG A;  3W1S A;  3RUL A;  3T9L A;  4TKN A;  2FCN A;  5IA7 A;  1E90 A;  5CHW A;  1TTN A;  1WX8 A;  1IPG A;  4YL8 A;  5C1Z A;  1V5T A;  3A1Q B;  2N7D A;  3TBL D;  1WGY A;  4I6P A;  4DBG A;  1WX9 A;  4KIK A;  4N9F 4;  2MP2 B;  2Z0E B;  2QHO A;  4X57 B;  5DPT A;  1XQQ A;  4GDL A;  4ANV A;  4EUT A;  4F1S A;  4W9I A;  1V81 A;  4E71 A;  3DVN V;  2LGY A;  5DCN A;  3PS6 A;  3L17 A;  3CMM B;  3EEC A;  4NNJ B;  5AZH A;  3HIZ A;  2V1Y A;  3VFK A;  2Z0D B;  3HHM A;  1SE9 A;  4DXA B;  1P98 A;  3PLU A;  4LDT B;  5J2R A;  2C7M B;  1WI0 A;  2LRU A;  2XK5 B;  3KUZ A;  4A20 A;  1WYW B;  1F9J A;  1WFY A;  4WJQ A;  3L16 A;  4HK2 A;  2PJH A;  3UGB B;  2I1K A;  2LXC A;  4HLE A;  3D32 A;  2EMS A;  3VVW B;  2WYQ A;  4BOS C;  1KM7 A;  4FHK A;  1YX6 B;  4J6I A;  4WJP A;  2L7R A;  2DAJ A;  3L08 A;  4M8M A;  4WJO A;  2GBJ A;  1WGD A;  4WJN A;  3ZTC A;  5D94 A;  4AJW A;  4DK5 A;  2D3G A;  4XZ4 A;  1E8Z A;  1Q1O A;  4LJO B;  2KAN A;  3N30 A;  2JRH A;  2KQ7 A;  3ZIM A;  3ZO5 B;  2BWF A;  3JYU A;  4FA6 A;  4GU2 A;  4IUM B;  1V9J A;  4W9K A;  2OJR A;  3IG3 A;  4IM0 A;  1UBI A;  4KIK B;  3ZVV A;  5FR6 A;  2KD0 A;  4MGK E;  2WX1 A;  3VHT C;  2JF5 A;  3TL5 A;  4I6L B;  1WGH A;  2FCS A;  1OEY A;  2IO3 B;  4G50 A;  3ZNZ B;  2JT4 B;  2JZZ A;  4FBJ B;  1YX5 B;  2LZ6 A;  1EO6 A;  4WWN A;  4A3P A;  3T8M A;  2LGD A;  3MJW A;  2KMC A;  1OTR B;  2KTR B;  3A9J B;  2BPS A;  2KOX A;  2K8C A;  4W9J A;  4BVU C;  3VTU A;  3JVZ X;  5J17 A;  4TV3 A;  3VUW A;  5J18 A;  1UH6 A;  3TJP A;  3ZW3 A;  2DAF A;  5KHO A;  4DHJ D;  1JRU A;  1FXT B;  1Y8R C;  2LJ5 A;  3VAW A;  2G4D B;  2NPT A;  2KLG A;  4GMV A;  4KDL B;  3M62 B;  2DEN B;  2KNB A;  2MLB A;  2KVR A;  2LXA A;  2K6Q A;  4GN1 A;  2B3A A;  4G11 A;  4KV2 A;  3PT2 B;  4ZRI A;  3RYT A;  4ASW C;  4GDK A;  2BYF A;  2G4S A;  3A4S C;  2KDF B;  3WAL A;  2MBH A;  3PHW B;  4II2 B;  2K8H A;  3ONS A;  4K81 A;  4B95 A;  3Q3J A;  3QJZ A;  2ZNV C;  3L10 B;  3JW0 X;  2M8S A;  4ICV A;  5DPW A;  4E3C A;  3H9D A;  4RM8 A;  3UIO B;  2BKR B;  3UIP B;  3AUL A;  1GJZ A;  4DHZ B;  4F8C B;  2KK8 A;  2M4N A;  3S2A A;  2JY6 A;  5L95 C;  5JZE B;  3UF8 A;  2GBK A;  2IBI B;  2LVP A;  2IYD B;  3R7R A;  4FAD A;  3NS8 A;  1P1A A;  2Z59 B;  3KH0 A;  4EZJ A;  3UIN B;  1EF1 A;  3BY4 B;  3VH3 B;  1E7V A;  2KC2 A;  1SIF A;  3PVL A;  1S3S G;  4W9F A;  2GBR A;  3ZNG C;  4NY0 A;  2NVU I;  3KYD D;  4HPL B;  2AL3 A;  1E7U A;  2L00 B;  1WJU A;  3VTV A;  4DHZ E;  1NBF C;  2A4Z A;  3O65 B;  4KZC A;  4IG7 B;  2K1F A;  2KJ6 A;  2REX A;  2GBN A;  3VQI A;  3ZNI D;  4GIV A;  1E8W A;  2K6D B;  1RLF A;  2MX2 A;  2N1W A;  2ZEQ A;  4MDK E;  3RZF A;  3KYC D;  3NOB A;  2NPT B;  4WQO B;  1OEY J;  3EFU A;  5C23 A;  1MG8 A;  1UGM A;  2KMA A;  2N9P C;  2N9X A;  3OLM D;  2HE7 A;  4IM3 A;  3TMP B;  4GDK B;  1RRB A;  1H8C A;  4JL9 A;  2ZVN A;  3PGE A;  2KC1 A;  1WF9 A;  1V6E A;  1WJ6 A;  1G6J A;  4GSW A;  1WIA A;  2IO1 B;  4BBN F;  3MHS D;  4HCN B;  2UYZ B;  3OJ4 B;  3KW5 B;  2AL6 A;  2PE9 A;  4FJZ A;  5DPR A;  4NAW A;  1YIW A;  3EHV A;  3QCA A;  2KWU B;  4MGI E;  1R4N I;  2LVO A;  3ML9 A;  4KSL C;  3WAM A;  2HJ8 A;  1WMH A;  4CO7 A;  3GOE A;  3SDL C;  2W9N A;  3H7P B;  3U30 A;  4NJ7 A;  2KWV B;  2M0X A;  3KUD B;  4LJP B;  2CS4 A;  4KDI C;  3WAO A;  1LFD A;  3B0A A;  4CYE A;  5DPS A;  1I35 A;  3PRP B;  2D07 B;  3SD5 A;  3ZRC A;  2CU1 A;  3EC8 A;  2D2Q A;  2MRP A;  2NBW B;  3N32 A;  1Z2M A;  4FN2 A;  2JPH A;  2J0K A;  5CTR C;  1P0R A;  3ZDM C;  1YQB A;  4ICU A;  4ZRJ A;  4EEW A;  2D11 A;  4JGH B;  3VUY A;  2K8B A;  5E6N A;  2XBB C;  4K7S A;  3M3J A;  2L05 A;  4MSM B;  1KJT A;  2MQJ A;  1HE8 A;  3AXC A;  3OJ3 A;  3A4R A;  2KFJ A;  2LUE A;  2MBQ A;  2UWQ A;  1S1Q B;  2MA9 B;  5AEK B;  2FID A;  3RD2 A;  2I1J A;  1KLV A;  4GGQ A;  3APF A;  2EKE C;  3U8Z A;  1LQB A;  2NR2 A;  2KO3 A;  2C9W B;  2YLM A;  1BT0 A;  2EMT A;  4MH0 E;  1ISN A;  4PYU A;  1V86 A;  4XC2 A;  4M0W B;  2O2V A;  4HVB A;  2V4L A;  1I42 A;  3PPA A;  4GDL B;  3VXW A;  2CHW A;  1NI2 A;  3QC8 B;  4NAW B;  2AEH A;  2ZJD A;  5D6J B;  3W1Y A;  1WZ3 A;  4NJ6 A;  2G45 B;  1WMH B;  2V3S A;  5E6P A;  2XEW A;  2BYE A;  4WWP A;  2NS5 A;  4HCP B;  2RD0 A;  4W9L A;  1EUV B;  4A3O A;  1IYF A;  3DPD A;  2YVC A;  2K39 A;  2MSE D;  5CX3 A;  4K1R B;  2GBM A;  2J0J A;  2DZJ A;  1E5W A;  3AI5 A;  2KX0 A;  4IWO A;  5JHB A;  4MSQ B;  2CR5 A;  3V6E B;  2LVQ A;  1WXV A;  3VUX A;  1QZE A;  2FCM A;  3CSF A;  2O6V D;  4WWO A;  4RMA A;  1VD2 A;  3X0W A;  3IFW B;  3PRM B;  2MBO A;  2HD5 B;  1ZKH A;  3SHQ A;  1WZ0 A;  2O6V A;  2ZZP B;  3NZS A;  2C5L C;  3Q3F A;  4W9D A;  1UEL A;  4IC7 B;  2KX3 A;  2PEA A;  2ZCC A;  2WDT B;  4NQL B;  4K7W A;  2JZ3 B;  2KN5 A;  4BKS D;  3P2B A;  3AU5 A;  3L13 A;  2ZCB A;  2JVC A;  4NQK E;  2O2V B;  3DCG A;  3IVF A;  1Z5S B;  1U4A A;  3DVN U;  3QX1 A;  5D7G A;  4EFO A;  3NHE B;  3WAP A;  2KDB A;  3X23 A;  4B9K A;  2C60 A;  2JXX A;  1AAR A;  5L83 A;  2KWC A;  1WJN A;  1GC6 A;  3PV1 A;  4IWP A;  2LAS A;  3DBR I;  5G2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...