4B6WA

Architecture of trypanosoma brucei tubulin-binding cofactor b
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
86
structure length
86
Chain Sequence
SVVKVSLTHSASRMRVPEKRYGLAQTIESIKENVFTHFATPPEYMQLQLIDDRGITIEKNMANDKQLGYYQCRDEFVIHVVDLQPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords TUBULIN-SPECIFIC CHAPERONE
publication title The Architecture of Trypanosoma Brucei Tubulin-Binding Cofactor B and Implications for Function.
pubmed doi rcsb
source organism Trypanosoma brucei brucei strain 927/4 gutat10.1
total genus 21
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2012-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4b6wA00
1BT0A 1RLFA 4IG7B 4W9JA 1P1AA 4BKSD 3VUYA 4HDOA 2K8HA 2HD5B 3PRPB 3ZNID 2AWTA 2L00B 3M62B 4GXBA 4IWOA 3PZDA 2NBWB 1UH6A 3L0WB 4ZDVA 2LGYA 2G4SA 5DPRA 1MG8A 2C5LC 2LVQA 3TMPB 3IFWB 2O2VA 3N30A 1WXMA 2K25A 4NQKE 4KZCA 1V5OA 1WFYA 2ZEQA 2IYDB 4EFOA 2C7MB 1ZW7A 2C9WB 2DZIA 2GBNA 2JZZA 2KDIA 2LD9A 2O6VD 4ASWC 4B6WA 5KHQA 1QZEA 4EEWA 4ANUA 1ZGUB 3VH3B 2XEWA 2BKRB 2MBHA 3DBRI 4MJSA 3ZVVA 3PTFC 4M8NA 3NHEB 1NBFC 4CO7A 4IM0A 1S3SG 2HJ8A 3QQ8B 1VD2A 1WX8A 1Z5SB 2LXAA 3GZNI 4A3OA 4F7ZA 3LJ3A 1LQBA 2N1WA 1SGHA 3ZKJC 5IA7A 2EKEC 2MP2A 2NCNA 3R66C 5J2RA 2RSUA 4HK2A 2KDFB 2C7NB 3HHMA 2Z0DB 2JXXA 3L08A 2K6QA 4GDKB 4W9EA 2MBEA 4FN2A 3DBHI 4PS3A 1GUAB 2KVRA 3UIOB 3DQVA 3P2BA 1YX6B 3R7RA 4EZLA 3APDA 4W9HA 2M17A 4I6NB 4GSWA 3IG3A 2IO3B 2FCSA 4FBJB 1JRUA 2IBIB 4RMAA 2RD0A 3T8MA 2MW5A 2KQ7A 4ANWA 3KYCD 4NJ7A 3RD2A 3UINB 5EDSA 4LDTB 3SU8X 3A33B 2MA9B 2N7EA 2WDTB 3WIMA 3A1QB 2B3AA 4NY0A 1LXDA 2I1JA 3R7QA 3ML8A 5AEKB 2KC1A 4AP4C 1ZKHA 1HE8A 4HCPB 3QCAA 1D3ZA 3UIPB 2JPHA 3SDLC 3ZW3A 4MH0E 3Q3FA 4LJOB 2FCNA 2D10A 4ZYNA 3DBSA 3CSTA 4K1RB 2JT4B 4PYZA 3VAWA 1T0YA 4W9GA 3ZDMC 2BF8B 4EOYA 4BVUC 2KFKA 3QWZB 2O6VB 2UWQA 2J0KA 5AZFA 3VH4B 1OQYA 3KUZA 4GDLB 4JQWC 4LCDE 2DZMA 1UBQA 3DCGA 3QHTA 3RCZA 2KDEB 1WYWB 2N9PC 3APCA 4URKA 4K7UA 3L54A 3PRMB 4MM3A 3VVWB 1SE9A 3OJ3A 1WI0A 4IUMB 2XK5B 4AJWA 1WXAA 4NPNA 3TCAA 3ZDTA 3CMMB 4EZKA 3MHSD 1WM3A 4ANXA 2M1MA 2BYVE 3ZTDA 2LGXA 1YJ1A 3APFA 1U4AA 3MJWA 1V9JA 1WGDA 3MTNB 3ZO5B 4FHJA 4NJ6A 4G11A 2FAZA 3L16A 4JGHB 2WWZA 4IWQA 1WJ4A 2LWPA 2ZCBA 5LLIA 3S2AA 1XT9B 3HM3A 4KVGB 4N9F4 2DZKA 2ZJDA 2CHWA 4NAWA 5AZHA 4BKSA 4BOSC 2XBBC 3DPDA 2LRWA 4DWFA 3A1QA 1GC6A 3R3MA 2PE9A 5D7GA 1WIAA 2J7QB 4KSKC 2KX3A 3LDZE 4HPMB 4EZJA 1E8ZA 1S1QB 2MSED 2PEAA 3DVGY 3VUXA 4DHJB 3N32A 2KWUB 2M0XA 4PS8A 2DZJA 5TR5A 1IP9A 1IPGA 4B9KA 5CHFA 4W9DA 2HE7A 3V6EB 3QX1A 3A9JB 3ZTCA 4LDTD 4GGQA 5DPTA 3PLUA 4HVBA 5CHVC 3QIJA 2O6VA 2DYOA 5L83A 1M94A 3KUDB 1RFAA 3H7PB 1SIFA 3B08A 4MDKE 4MGZE 2KMAA 2NR2A 5G2NA 3EHVA 3PLVA 2KNBA 2GMIC 4W9IA 4F1SA 3TIXA 4II2B 3WAMA 2LI5A 2MLBA 1WMHA 2XK5A 1G6JA 4FADA 2JY6A 1AARA 1UGMA 4K7SA 5AZGA 2CHZA 1I35A 3VTWA 1KM7A 1XD3B 2UYZB 1P0RA 1WJ6A 2MBBB 3TJPA 2LRUA 4PS7A 3DDCB 3PS6A 2KKCA 2LXCA 3KH0A 1XQQA 5IAAC 3A9KB 1LFDA 5CHWA 3QC8B 4MELA 1P3QU 4WWPA 3IBEA 2IY1B 1WXSA 3M95A 3B1LX 3WAPA 2NPTB 3EC8A 3PHXB 2KFJA 1KJTA 3H1UA 2KHWB 4TUUA 4AJYB 4XX5A 2KTRA 1E7UA 1R4NI 4XZ4A 3L17A 2WX1A 3HK0A 4W9FA 2DAJA 2AEHA 2C7HA 2AYOB 4FULA 3L10B 1E90A 1WJNA 3PPAA 3QAQA 3V60A 3M3JA 2CKHB 2Z59B 1GC7A 1WH3A 2D11A 3A9JA 2IO1B 1Q5WB 2V4LA 2IY0B 2KJHB 2K6DB 3CSFA 3IVFA 1V6EA 3PVLA 2JRHA 3GOEA 2BPSA 4MGIE 4W9CA 4BOZB 3DVNU 1NDDA 3PRZA 2L3ZA 3PREA 4KDIC 1KOTA 3A4RA 2FIDA 2LVPA 3AXCA 4DHJD 3BINA 4IM3A 4KSLC 1C1YB 2BYEA 2KC2A 2JZ3B 1EF1A 4HCNB 4BBNF 3ZNZB 3ZNGC 3CF6E 2MRPA 2LVOA 1V81A 5JHAA 3VDZA 2A4ZA 4P7IA 1A5RA 1VCBA 2VRRB 3M63B 3U8ZA 2IZVB 4X57B 3AULA 4ICVA 1ISNA 2NVUI 3VHTC 4FJZA 3A9KA 4OVUA 3HIZA 2L0FA 2ZNVB 1H8CA 4AOFA 2KK8A 1NI2A 4A20A 1GNUA 3TL5A 3UQBA 4W9KA 1F9JA 1EUVB 3QARA 1GJZA 2M4NA 2N4FA 3QA8A 2CR5A 4ICUA 1WX7A 1E8XA 2KN5A 3H9DA 4JIOU 1V80A 3W1YA 1WY8A 5FR6A 4TQ1A 4E71A 2CU1A 4MSQB 3ZUNA 3IHPC 4GDKA 4LJPB 2D3GA 5D6JB 5D94A 2BWFA 4TV3A 3H7SA 4DXAB 2DYBA 4M8MA 4JL9A 2BKFA 5G55A 4ZRKA 2W9NA 1I42A 2V3SA 5E6NA 4WJQA 1OTRB 2KDBA 2OOBB 1WXVA 1J19A 4AWJA 5LXHA 3ENEA 3NS8A 3OAWA 2K39A 4DHZB 2ASQA 5DCNA 2I1KA 3QJZA 3RZFA 2MBOA 3ZRFA 4ANVA 4CHKA 3B0AA 3JSVB 3ZIMA 3DBLI 2AL3A 2O2VB 3OJ4B 4DK5A 1WF9A 2K8BA 3A4SC 4BBNC 2BWES 1C3TA 3X0WA 1TGZB 2ZPYA 2ZVNA 3WALA 1WR1A 1V86A 3VXWA 2KD0A 4GMVA 3NOBA 4NQLB 5KHOA 3V62A 4BFRA 2ZCCA 2L7RA 1UD7A 2V1YA 3DVNV 4MJSB 3PGEA 2KLGA 2DAFA 3RUIB 2IO0B 4RM8A 2KJ6A 3HM6X 2DX5B 4MGYE 2GBRA 4GDLA 1CMXB 4WWOA 4XC2A 4E3CA 4IWPA 2FIFA 1WGYA 4DDGD 2G45B 2R2OA 3EFUA 2JWZA 4G50A 4M0WB 5E6PA 4OVVA 1WR6E 2FNJB 3AU5A 4W9LA 1KLVA 2L8JA 1WJUA 4IM2A 2OJRA 4KIKB 2AL6A 3W1SA 4EKUA 3OLMD 2D2QA 4I6PA 1V2YA 4HPLB 2QHOA 1K8RB 2KX0A 5E6OA 3RULA 2DENB 2JF5A 3K9OB 3QK0A 4HJKA 3ECIA 4K81A 3BY4B 4EUTA 5C1ZA 4MEMA 1WZ3A 2L05A 1WX9A 3VTVA 4HLEA 2R2QA 3X23A 2GBMA 3KUCB 3T9LA 5J18A 2BYFA 3JSVA 3VFKA 3WA0A 2GBJA 4GB9A 4DBGA 2NBUA 2ZZPB 3PSEB 3PV1A 5DPSA 5J17A 2RPQA 1L2NA 3SHQA 3JYUA 3U30A 2LJ5A 1WZ0A 2JUOA 3O65B 5CTRC 3ALBA 3V61A 3ZLZA 4BKGA 2D07B 1OEYJ 2RR9A 3RYTA 1TTNA 3RZWC 2KXJA 4IW0A 4WJPA 4AUQC 1WGRA 3DVGX 3VTUA 3ZRCA 4FJYA 3PT2B 1E5WA 2KFKB 3KW5B 5JH5C 1TBEA 3UGBB 5CX3A 3DOWA 1R4MI 4GOCA 2K1FA 1Q0WB 3H7PA 4GIVA 4II3B 3SD5A 1IYFA 1Z2MA 2KANA 2KTFA 4G0NB 4J6IA 4DHZE 2N9EB 2N1VA 4WJOA 1J8CA 2PJHA 2KWVB 4WWNA 2FCMA 2L0TA 3TBLD 2MQJA 2KOXA 4E74A 4FA6A 1V5TA 2MBQA 4KIKA 4A3PA 2EMTA 2PPHA 2LUEA 1RRBA 4MSMB 3ML9A 4RM9A 4F8CB 5GMVA 4FHKA 3RT3B 2ZNVC 2KLCA 1GG3A 1OEYA 4B95A 2YLMA 3L13A 1WM2A 2KWCA 3UQAA 2IO2B 1EF5A 1X1MA 2G4DB 2L76A 1YIWA 3KYDD 2KQSA 4NAWB 2NPTA 4HWIB 2JRIB 2KJRA 3AI5A 4MGKE 4KZ0A 4NNJB 1PQSA 4YL8A 1Y8RC 4WAAA 5JHBA 2LGDA 2GBKA 1OGWA 2A5UA 3KVFB 3NZUA 1H4RA 2NBVB 2CS4A 3W1SC 4I6LB 3WANA 1UBIA 5JZEB 2Z0EB 1RAXA 4KV2A 2LASA 4PYUA 1L7YA 2JVCA 4WQOB 2ZPNA 3K9PB 5DPWA 3JVZX 4K7WA 3ONSA 4HDQA 2GOWA 5LXIB 1WGGA 3V6CB 4TQ0A 1YX5B 2M8SA 1LM8B 3UF8A 2MWSB 1E8YA 2WYQA 4GU2A 1UZXB 5C23A 3VQIA 4DDID 4FJVB 1WGHA 3AU4A 2CHXA 4CYEA 5HKHA 4ZRIA 1YQBA 3C0RB 4ZRJA 1FXTB 3ZNHB 2ZVOA 5L95C 1WE6A 2KZRA 2YVCA 2NS5A 4G3XB 1WMHB 2FCQA 2KO3A 1EO6A 2N7DA 3Q3JA 2BGFA 1P98A 3D32A 2G3QB 3VUWA 2N9XA 2MX2A 5D2MB 2K8CA 2DYMA 4IC7B 2WX0A 1P9DU 4KDLB 3WAOA 1WRDB 3EECA 2RGFA 2J0MA 1UELA 4JLCA 4BKTA 1WE7A 3NY5A 2C60A 1Q1OA 2FUHB 3NZSA 4FLHA 2KTRB 4GN1A 1E7VA 2LZ6A 1TZ1A 2EMSA 2HTHA 1V49A 2MP2B 2J0JA 4HXDA 3H6NA 2KMCA 2REXA 3N3KB 2PE6B 3I3TB 1J0GA 3JW0X 2Y5BB 5BO4B 3U7DA 1E8WA 2DHZA 4WJNA 4TKNA 2MCNB 3PHWB 1YD8U
chains in the Genus database with same CATH superfamily
1FCLA 3VUYA 2K8HA 3PRPB 1JCKB 4IWOA 2NBWB 2IPKD 2PVGC 2LGYA 4XE0A 1MG8A 2C5LC 4EE2A 3TMPB 2WXFA 2K25A 4KZCA 1WFYA 2C7MB 1L4DB 5KHQA 1ZGUB 4MJSA 3PTFC 3NHEB 1NBFC 3QQ8B 1E6EB 1VD2A 3VRAB 2LXAA 2N1WA 1SGHA 3Q8FA 2EKEC 2NCNA 3R66C 4L2YA 2D5GA 3HHMA 3W2DA 2MBEA 2KVRA 2LJIA 3N9YC 3PZ7A 4W9HA 4I6NB 2BTEA 4RMAA 4LK0M 4ANWA 3RD2A 4ARIA 4KKIA 4S0RA 2B3AA 4NY0A 1LXDA 1XLOA 1MHXA 4AP4C 1HE8A 3P4RB 3R8BA 4HCPB 3HUIA 3UIPB 2X38A 3SDLC 1YMHE 4MH0E 4ZYNA 3MP9A 3VAWA 1T0YA 2LHDA 4EOYA 2UWQA 3KUZA 2VZKD 2DZMA 4OZBA 3PRMB 4MM3A 4P6VF 4IUMB 1YJIA 3CMMB 2QIEB 2M1MA 2RDGA 1JW9D 1V9JA 3MTNB 4KX6B 3ZO5B 1J7AA 1FRDA 1P7FA 1JALA 2LWPA 1E0ZA 3P4QB 2CHWA 4BKSA 3TEXA 1ZXHA 3DPDA 2WHIA 3KWLA 4M00A 3A1QA 1GC6A 2PE9A 1PYWD 5D7GA 2V3NA 4A6QA 2L83A 4EZJA 3DVGY 3VUXA 4DHJB 2M0XA 2DZJA 2MJEA 1PGAA 1IP9A 2INCC 3MFGA 3V6EB 3A9JB 3ZTCA 2W54A 2DNFA 4WIPA 1FRRA 2PLPA 2DYOA 3BK1A 3H7PB 1SIFA 3EHVA 3DBLB 3PLVA 4XGAB 3TIXA 2MLBA 2VZKB 1G6JA 1UGMA 1FPYA 1I35A 3V05A 3PS6A 2KKCA 5IAAC 1T6BX 3QC8B 4MELA 5H8YE 3AE5B 4USAA 1WXSA 2NPTB 1XCQL 4DXGA 4TUUA 4AJYB 2KTRA 1R4NI 3URYA 1AW7A 3NZ3A 4WQMA 3U52E 3KLSX 2JU6X 2WXOA 1WJNA 3PPAA 3QAQA 3M3JA 5EE3A 1GC7A 1WH3A 1Q5WB 3RFZB 1WGKA 2ICIA 4W9CA 3I63C 3DVNU 1NDDA 4HRSA 1KOTA 2HDEA 2LVPA 3BINA 1IBXB 4KSLC 4BBNF 1DOYA 1KFYB 1V81A 4HPPA 1FD6A 3BIID 4P7IA 1A5RA 3M63B 2IZVB 1F2RC 4ICVA 3VHTC 1GB4A 4A55A 1FNWA 2DWQA 1NI2A 3SFEB 3TL5A 3UQBA 4W9KA 1GJZA 2N4FA 3C19A 2CR5A 2LGSA 3H9DA 3W1YA 5FR6A 2WU5B 3Q8AA 3ZUNA 3IHPC 4LNKA 4RGTA 4M8MA 2JSVX 4JL9A 3DHHC 2V3SA 5E6NA 2H88B 1WXVA 1ROEA 4AWJA 3NS8A 3OAWA 2KDMA 5AUKA 4CHKA 3AM9A 1SEBD 3JSVB 3ZIMA 2KN4A 3AB5A 1QQRA 2JZPA 4DK5A 1WF9A 2K8BA 2FBWB 1D5XC 3B9JA 3X0WA 1I7HA 1K51A 3IAS1 3AE7B 2JYEA 3VR9B 4GMVA 2L7RA 4MJSB 3DVNV 1TS3A 3W5UB 1TKEA 4RM8A 2KJ6A 1I4QA 2XN9C 3IT4B 1CMXB 4XC2A 3P63A 1MFWA 1EU3A 4DDGD 1RWSA 1HA5A 2G45B 3EFUA 4M0WB 5E6PA 4OVVA 1WR6E 4IM2A 1PGBA 3W1SA 4YT0B 3OLMD 2D2QA 2QHOA 1NENB 3O13A 2DENB 2J53A 4WAFA 2JF5A 3QK0A 3NRZA 4EUTA 5C1ZA 2KYWA 5IP4D 2IGGA 2RDHA 2R2QA 3T9LA 3AEGB 4RH6A 1WYGA 2G1EA 4DBGA 2L32A 3PSEB 4ZRPA 3PV1A 3T3OA 1IGDA 2ZW0A 2QDFA 2E6XA 3ALBA 4BKGA 1OEYJ 2RR9A 4BZAA 2KXJA 3FAHA 2FE8A 4BAXA 1E5WA 3KW5B 4ACFA 1R4MI 4GOCA 2BQQA 2LEKA 4GIVA 1XLNA 4R3DA 1Z2MA 3SD5A 2K9XA 4JWSC 2N1VA 3ZJUA 2MQJA 2PPHA 1RRBA 2H89B 3RT3B 3I57A 1RFKA 2LMCA 4YSZB 3TEZA 3E56A 1EF5A 1YIWA 2KQSA 4HWIB 2JRIB 4NNJB 4WAAA 2A5UA 3KVFB 3NZUA 2CS4A 1RAXA 3K9PB 1C9FA 3OWEB 3V6CB 2N7JA 1YX5B 2OHFA 1LM8B 2MWSB 2B76B 1LGRA 1QOAA 5C23A 4FJVB 1NYRA 3H8HA 1WGHA 3AU4A 4CYEA 1YQBA 3P4SB 2KZRA 2V3PA 1F1HA 4ZHOA 2IDYA 1Y56A 4G3XB 3Q3JA 2BGFA 1P98A 2IGHA 3VUWA 1N61A 2N9KA 2K8CA 2RGFA 4CQNA 3MHZA 3RNFC 2FUHB 1VZ7A 2KTRB 4GN1A 1E7VA 1V49A 2J0JA 3AEAB 3N3KB 3NUHB 4FXCA 5BO4B 2MCNB 1I4XA 2GRIA 3ZJTA 3PHWB 1STEA 1CK1A 4IG7B 1P1AA 2W3SA 4HDOA 2AWTA 3PZDA 1UH6A 4N59A 2KQ4X 1C4CA 4ZDVA 1JROA 1E10A 2LVQA 4XWTA 2WXNA 3IFWB 2O2VA 3N30A 1V5OA 2ZEQA 4C00A 4OHJA 2C9WB 2DZIA 2GBNA 2JZZA 2KDIA 2O6VD 2SEBD 4ASWC 4PK1A 4AS1A 1QZEA 4EEWA 3DBRI 3ZVVA 1DOIA 3B2GA 4M8NA 4CO7A 1N63A 1TKYA 4A3OA 3GZNI 4F7ZA 3LJ3A 3ABVB 3RNAC 3ZKJC 2MP2A 2GI9A 4HK2A 2WXQA 2C7NB 2Z0DB 1GUAB 2BS4B 3P2BA 2Q5WD 4NAMA 3APDA 3NVYA 2IO3B 4FBJB 3T8MA 3Q8EA 1V1OA 3KYCD 2AQ1B 5EDSA 2N7EA 5I4DA 3WIMA 1FEHA 1FNUA 5AEKB 1FO4A 1ZKHA 2JYTA 2JX5A 3ZW3A 3CSTA 3R2IA 2JT4B 2RPVA 1T0QC 3ZDMC 2KFKA 2O6VB 3VH4B 2IGDA 3AEDB 2V0GA 1ZE3D 1WYWB 3APCA 4URKA 1L6VA 4K7UA 4IOIE 1M4VA 1SSNA 1WI0A 2GB1A 4EZKA 1WM3A 1YJ1A 1XF5L 1GOZA 1WGDA 4FHJA 4G11A 1WJ4A 5LLIA 2DZKA 5HFYA 2XBBC 2LRWA 4DWFA 3HVZA 4KSKC 3TUOA 2WNMA 3E9SA 1E9MA 3FKYA 3LDZE 4HPMB 1S1QB 2PIAA 3IAM1 3N32A 4PS8A 3ZXRA 3Q2AC 4LNIA 5TR5A 4N6EB 3QX1A 4GGQA 3PLUA 1UGJA 4AQ7A 3QIJA 1IUEA 4P1CC 5L83A 1M94A 3KUDB 4ARCA 1ACCA 1RYJA 1PDXA 3BVGA 5G2NA 5BYQA 3NVZA 4UDUC 2BVCA 3WAMA 2LI5A 1WMHA 2XK5A 1AARA 1WSPA 4K7SA 5GXGB 1EWYC 2PTLA 3VTWA 1KM7A 1XD3B 2UYZB 3TJPA 2PKOA 3A9KB 1T3QA 4WWPA 4MH8A 2KFJA 3H1UA 4XX5A 3L17A 2WX1A 3HK0A 1TS2A 2C7HA 1E90A 4N58A 1PUTA 1JRPA 2IO1B 2V4LA 1JWUD 1A70A 1C76A 2IY0B 3ETRA 2K6DB 3GOEA 2BPSA 3PREA 2L3ZA 4WURA 5IN7A 4A9AA 3AXCA 4DHJD 3ZNZB 1TJEA 3CF6E 1FIQA 5JHAA 3VDZA 2A4ZA 3DBRB 1VCBA 2VRRB 3U8ZA 3AULA 2NVUI 2Y5PA 4FJZA 4OVUA 4D2KA 2ZNVB 1H8CA 1FM0D 1F9JA 1N5XA 3WCQA 2M4NA 3N1ZC 3SEBA 1T5XD 3BYTB 4MSQB 3R2TA 4GDKA 2D3GA 5D6JB 3P1MA 1YN3A 4TV3A 2DYBA 1TZOA 4OVZA 3BZDB 1OTRB 2KDBA 3BK2A 1Q10A 2SAKA 2ASQA 3HRDD 4LTUA 3RZFA 4ZRQA 2WXMA 4ANVA 4TMAB 3B0AA 3RNBC 2O2VB 3A4SC 1C3TA 1TGZB 3WALA 1V86A 2ACZB 4ZYSA 2DBYA 2KD0A 2K0PA 1UD7A 3PGEA 1KLGD 1XEEA 4DQOC 3HM6X 2GBRA 4IDIA 4GDLA 5IO9A 4E3CA 1HEZE 3AE2B 1KF6B 2BB6A 2R2OA 1WJUA 2I2YA 3RNEC 2OJRA 4KIKB 5T8IA 2MJ3A 2K3UA 4EKUA 3GS2A 4HPLB 3KWVA 2QSDA 1JQ4A 4HROA 4US8A 2EELA 2GBMA 5J18A 1UF0A 2BYFA 3WA0A 4RGNA 1TYGB 2GBJA 3RN9C 2ZZPB 1HZ5A 5FR3A 1L2NA 3SHQA 3JYUA 3U30A 2LJ5A 2OJWA 2JUOA 1V1PA 2NMQA 1TTNA 4AUQC 3DVGX 4WWMA 1SF0A 3HVDA 3PT2B 2KFKB 3TEWA 2WXJA 1Q0WB 4II3B 2KTFA 4DHZE 2N9EB 4WJOA 2KWVB 3VR8B 3TBLD 2INPE 2OEDA 5D3DA 2MBQA 1FNVA 1UNSA 3MC0B 3N20C 3ML9A 4FHKA 2ZNVC 1GG3A 1VDVA 4B95A 2X8XX 1WM2A 2KWCA 1X1MA 2INDC 3MJ5A 3AI5A 4MGKE 4YL8A 1PQSA 3TSSA 1Y8RC 2LGDA 2WXRA 1H4RA 2NBVB 4I6LB 1UBIA 2Z0EB 2JVCA 4WQOB 5DPWA 4K7WA 1MHHE 4C4VA 1MPEA 2GOWA 3LYYA 1YN5A 2LGIA 4S17A 2M8SA 1DYQA 1MJDA 1NVID 1VR9A 2WYQA 1UZXB 1AWDA 3VQIA 2MEKA 5HKHA 4ZRIA 2KWDA 3C0RB 3ZNHB 2ZVOA 5L95C 1SB3C 1JWMD 2YVCA 2NS5A 1WMHB 2KO3A 2DLBA 4P1BC 2N7DA 2BB5A 1SE4A 2MX2A 1L0YB 4IC7B 2QEJC 2WX0A 4GLSC 4KDLB 3EECA 4JLCA 1L5PA 4BKTA 1WE7A 3NY5A 2C60A 4RFBA 3RNCC 1TZ1A 2HTHA 2REXA 2PE6B 1J0GA 1VZ6A 3U7DA 2CU3A 1KTKA 4A90A 1BT0A 1RLFA 4BKSD 2R61A 2HD5B 4GXBA 2L00B 2K22A 2BS3B 3L0WB 2L1AA 4RNAA 3N1YC 5DPRA 3RNGC 3BVZA 3EA6A 4NQKE 1OQQA 2IYDB 4EFOA 1ZW7A 4ANUA 2NTSA 1MVKA 2JQRB 2BKRB 2MBHA 2CJOA 4OZCA 1TKGA 3P4PB 1S3SG 2AQ2B 1FMAD 3GP7A 1SE3A 1WX8A 3BVMA 1V97A 2RSUA 5E6JA 4MM3B 1OFFA 3MC9A 4HJGE 4JPSA 2JXXA 4GDKB 1ESFA 1K50A 3DBHI 4PS3A 3U4EG 3UIOB 3AE8B 3DQVA 3R7RA 4EZLA 2M17A 4GSWA 3IG3A 4JE3B 2FCSA 3RMKC 2IBIB 2IJ0A 2RD0A 2YEPF 2MW5A 3UINB 1R4NB 4LDTB 3A33B 2N0SB 2WDTB 3A1QB 2I1JA 3R7QA 2ON8A 1B9RA 3ML8A 1SXTA 2KC1A 1QILA 4KGSA 1FXIA 2PW9A 4LJOB 1CJEA 3NJTA 4K1RB 4PYZA 3ZXVA 2BF8B 4BVUC 5AZFA 2WXPA 1OQYA 4GDLB 4JQWC 3DCGA 1C4PA 4B0MA 3QHTA 3RCZA 4PT5A 1N5WA 3L54A 3GE8C 3VVWB 2M19A 4AJWA 3TCAA 3ZDTA 3MHSD 4ANXA 3U7ZA 3ZTDA 3VRBB 3MJWA 1U4AA 4US9A 2FAZA 3L16A 4JGHB 2WWZA 1V8CA 1VLBA 4IWQA 2ZCBA 3S2AA 2QMTA 1XT9B 3HM3A 4N9F4 2ZJDA 2BS2B 2RDBC 1TS4A 2J7QB 1HZ6A 4C7ZA 2KWUB 2AX5A 4MACA 1IPGA 1V1PB 3MC8A 4HKZE 2KACA 5DPTA 4HVBA 5CHVC 1I4GA 4M01A 5HHDG 1RFAA 4MDKE 3B08A 4MGZE 1JWAD 2KNBA 2GMIC 4W9IA 1AYFA 4II2B 1TT5B 1SE2A 2HTME 2JY6A 3FC4A 5AZGA 2CHZA 1C4AA 3DDCB 4K3CA 2LXCA 3V3XA 3KH0A 3OG5A 2Y5CA 1LFDA 5CHWA 3AE3B 3ZQ4A 2IY1B 2M56B 4ZOHC 3B1LX 3EC8A 3PHXB 1KJTA 2KHWB 3AE9B 3NG0A 1YJJA 4W9FA 2DAJA 5EE0A 2MJDA 2AYOB 4FULA 5H92C 3L10B 2LUMA 2CKHB 2Z59B 1BUIC 2D11A 4C4VB 3A9JA 2LFIA 3CSFA 3IVFA 4KGTA 2JRHA 4MGIE 4BOZB 4YSXB 1F2RI 4KDIC 2E3TA 2FIDA 1QT9A 2D3CA 3I9V1 4IM3A 1PGXA 2AQ3B 1NI3A 3Q8BA 3ZNGC 2MRPA 1ISNA 3AH7A 3HIZA 1CQVA 1I4RA 2L0FA 3SR6A 2QILA 1EU4A 2BT6A 1R4MB 3ZGZA 3CWIA 3QA8A 1XCTL 4ICUA 4ITKA 4REZA 1WX7A 2KN5A 2WS3B 1GPXA 1V80A 4E71A 4TQ1A 2CU1A 3LXFA 2EKIA 3I5JC 5D94A 2BWFA 3H7SA 3NVWA 4RCOA 2BKFA 1I42A 1LO5D 4WJQA 1J7CA 3ENEA 4B0EA 4DHZB 4YTNB 1QF6A 5DCNA 1IBXA 2I1KA 5BYSA 1NEKB 2MBOA 3DBLI 3OJ4B 4BBNC 1FCCC 2WP9B 1WR1A 3VXWA 4OZAA 3NOBA 4BFRA 2V1YA 2KVZA 1F0ZA 2KLGA 2DAFA 3RUIB 2BBCA 2DX5B 4MGYE 1N6ZA 3UI3A 4ZHPA 1HQRD 3AU5A 4W9LA 3J9CA 4LLGM 3AE4B 4I6PA 3RULA 5BMHA 4YTPB 1I4HA 1ENFA 4K81A 3BY4B 3ZJVA 4XDDA 1WZ3A 4HLEA 3KUCB 3JSVA 4XDCA 1ZDVA 2NTTA 1SBBB 5EE9A 2MH7A 5DPSA 2RPQA 2WXKA 1HTQA 4LNOA 1ZDXA 3O65B 5CTRC 1ZOYB 2D07B 3Q3OC 2QC8A 3RYTA 3RZWC 4IW0A 4WJPA 1ZUD2 3VTUA 3UGBB 5CX3A 3PO0A 4J6IA 4M0WA 5FKAC 1WXQA 4WWNA 2FCMA 2L0TA 4FA6A 4E74A 1L6UA 4A3PA 2LUEA 4C56C 2BYTA 2YLMA 3UQAA 3L4PA 2MHJA 2IO2B 3EGRA 1SJED 3KYDD 3GZNB 2W55A 4L1BA 1VRAB 2GBKA 1OGWA 3BWUD 3Q69A 3W1SC 3WANA 5JZEB 2Y3AA 4KV2A 1L7YA 3IT6B 4MT5A 4HDQA 1WGGA 4TQ0A 4JWUC 4RGMA 1YQ4B 1BXTA 5C3JB 4GU2A 3T3NA 2BW2A 1ET9A 4ZRJA 1QOFA 5C2TB 1WE6A 4YTMB 1MG4A 4A8XC 1TY2A 2G3QB 2N9XA 5AUIA 2WU2B 2DYMA 4XYCA 3WAOA 3U2SC 4HEA1 4HKQA 1P7EA 4H2AA 1SIJA 2EMSA 2MP2B 4HXDA 3H6NA 2KMCA 1C78A 3JW0X 2Y5BB 1FFUA 2DHZA 4WJNA 1YD8U 4W9JA 3EFCA 2WLBA 3ZNID 1OQRA 2L52A 3M62B 2W82A 2LHEA 2G4SA 1D4BA 1UUPA 5HI1A 3RPFC 1T0SC 1WXMA 5IOIA 2J4XA 2LD9A 4B6WA 3AV8A 3VH3B 2XEWA 2V9HA 1DOXA 1WWTA 4TSSA 4IM0A 5BYRA 2HJ8A 1TY0A 3FILA 3AEEB 4C7YA 1L4ZB 1Z5SB 1ZPSA 1LQBA 4P16A 2M0AA 2WDVB 5IA7A 3DHGC 5J2RA 2KDFB 5EE1A 3L08A 1ZXIA 2K6QA 4W9EA 1HTOA 4FN2A 1YX6B 1L0VB 2UU7A 3AN1A 2WGSA 3DWGC 1JRUA 1FFVA 2KQ7A 1RM6C 4JX1C 4NJ7A 3AEBB 1GAQB 1XLQA 3AMZA 3P42A 3SU8X 2MA9B 5LNK1 4WH4A 1C79A 2PVOD 3QCAA 1D3ZA 1KH0A 2JPHA 3Q3FA 2FCNA 2D10A 3DBSA 4W9GA 1N62A 3DHIC 3QWZB 2J0KA 4YWGG 2FUG1 3LB8C 4LCDE 1UBQA 1F77A 2KDEB 2N9PC 1N60A 1EM7A 1SE9A 3OJ3A 2XK5B 1WXAA 4NPNA 2HJ1A 2KMMA 2BYVE 2LGXA 3APFA 4NJ6A 4KVGB 5AZHA 4NAWA 4BOSC 1ET6A 3R3MA 2QCZA 2J52A 1WIAA 2KX3A 2GLSA 1J7BA 4QAYA 4XWWA 3TEYA 3AEFB 1E8ZA 2MSED 2PEAA 2RMMA 5CHFA 4B9KA 4W9DA 2HE7A 4LDTD 5BMIA 2O6VA 4LNNA 3ZYYX 1YNTE 2KMAA 2NR2A 1D5MC 4F1SA 1JWBD 4FADA 1JWSD 1P0RA 1WJ6A 2MBBB 5FK9C 2LRUA 5JXVA 4PS7A 1I4PA 1XQQA 2WDQB 1P3QU 2WXGA 3IBEA 3M95A 2QJLA 3WAPA 1E7UA 2D3AA 4XZ4A 2AEHA 1PFDA 2G9HD 2XNAC 3V60A 1YN4A 3PZ8A 3AECB 1VJKA 2KJHB 1GB1A 1V6EA 3PVLA 1XLPA 4RF1A 4RF0A 4O1NA 3PRZA 3A4RA 4J3OD 1C1YB 2BYEA 2KC2A 1ZP0B 2JZ3B 1EF1A 4HCNB 3Q3NC 1YQ3B 2N9LA 4Q2JA 2LVOA 4X57B 3A9KA 3SFDB 1CZPA 3Q14C 4AOFA 2KK8A 4A20A 1GNUA 1SJHD 1EUVB 3QARA 5D3IB 3C8YA 4YXDB 1E8XA 4JIOU 1WY8A 2KAJA 3B2FA 1UWMA 4LJPB 4C80A 1QOGA 2D3BA 4DXAB 1C77A 4IKGA 2WDRB 5G55A 4ZRKA 2W9NA 2OOBB 1J19A 2ONQA 5LXHA 2K39A 1QLBB 3QJZA 1WRIA 3ZRFA 2AL3A 1VZ8A 1E7PB 2BWES 2ZPYA 2K5PA 2ZVNA 5TSSA 2W3RA 5G5HA 1AN8A 4NQLB 5KHOA 3V62A 2INNE 2ZCCA 4OW0A 2IO0B 3FILB 4YSYB 2JXTA 1TIFA 4WWOA 4IWPA 2FIFA 1WGYA 1KRHA 2CJNA 2JWZA 4G50A 1FXAA 2FNJB 1KLVA 1QKZA 2L8JA 3NVVA 2AL6A 3Q3MC 1V2YA 1K8RB 2KX0A 5E6OA 1D6EC 2WXLA 3K9OB 2I38A 3ECIA 4HJKA 1L0XB 4MEMA 2L05A 1WX9A 3VTVA 3X23A 2JWUA 4RGOS 3VFKA 2WXIA 1UWXA 4M02A 4GB9A 2NBUA 5J17A 1TS5A 1R7SA 1WZ0A 5IKCM 1IGCA 3V61A 3ZLZA 4DXFA 1WGRA 3ZRCA 4FJYA 3GB1A 5JH5C 1TBEA 3DOWA 4LNFA 4L23A 2K1FA 3H7PA 1IYFA 2KANA 4K3BA 4G0NB 1J8CA 2PJHA 2KOXA 1T0RC 1V5TA 3AE6B 4KIKA 2EMTA 1JMLA 3Q6BA 4MSMB 4RM9A 4F8CB 5GMVA 2KLCA 1OEYA 1HXYD 3L13A 2KT7A 3BYYB 2Z8LA 2G4DB 2L76A 4NAWB 1XXGA 2NPTA 2KJRA 3KQ4A 4KZ0A 5MPOA 5JHBA 1B1ZA 2PMVA 1F52A 3DBHB 5HG2A 2LASA 4PYUA 5BMGA 1BMLC 4NZLB 2ZPNA 3EUB2 3AE1B 3JVZX 3ONSA 3DWMA 5LXIB 3IXSA 3UF8A 1K53A 1E8YA 2VH1A 3NS1A 4DDID 1K52A 1QOBA 1DGJA 3GE3C 2CHXA 1EWCA 1FXTB 1NYQA 4NJCA 2WXHA 3N1XC 2TSSA 2FCQA 1EO6A 2ZW1A 3D32A 3W5VB 4KGRA 5D2MB 3RI7C 1P9DU 5G5GA 2VH2A 1WRDB 1MI0A 2J0MA 1UELA 4KKJA 2V4IB 1D5ZC 3CIRB 1Q1OA 3NZSA 2J42A 4FLHA 2LZ6A 3Q8CA 3W9CB 2YEPB 2WQYB 1YOVB 1KLUD 3I3TB 1E8WA 4TKNA 1XO3A
chains in the Genus database with same CATH topology
1BT0A 1RLFA 4IG7B 4W9JA 1P1AA 4BKSD 3VUYA 4HDOA 2K8HA 2HD5B 3PRPB 3ZNID 2AWTA 2L00B 3M62B 4GXBA 4IWOA 3PZDA 2NBWB 1UH6A 3L0WB 4ZDVA 2LGYA 2G4SA 5DPRA 1MG8A 2C5LC 2LVQA 3TMPB 3IFWB 2O2VA 3N30A 1WXMA 2K25A 4NQKE 4KZCA 1V5OA 1WFYA 2ZEQA 2IYDB 4EFOA 2C7MB 1ZW7A 2C9WB 2DZIA 2GBNA 2JZZA 2KDIA 2LD9A 2O6VD 4ASWC 4B6WA 5KHQA 1QZEA 4EEWA 4ANUA 1ZGUB 3VH3B 2XEWA 2BKRB 2MBHA 3DBRI 4MJSA 3ZVVA 3PTFC 4M8NA 3NHEB 1NBFC 4CO7A 4IM0A 1S3SG 2HJ8A 3QQ8B 1VD2A 1WX8A 1Z5SB 2LXAA 3GZNI 4A3OA 4F7ZA 3LJ3A 1LQBA 2N1WA 1SGHA 3ZKJC 5IA7A 2EKEC 2MP2A 2NCNA 3R66C 5J2RA 2RSUA 4HK2A 2KDFB 2C7NB 3HHMA 2Z0DB 2JXXA 3L08A 2K6QA 4GDKB 4W9EA 2MBEA 4FN2A 3DBHI 4PS3A 1GUAB 2KVRA 3UIOB 3DQVA 3P2BA 1YX6B 3R7RA 4EZLA 3APDA 4W9HA 2M17A 4I6NB 4GSWA 3IG3A 2IO3B 2FCSA 4FBJB 1JRUA 2IBIB 4RMAA 2RD0A 3T8MA 2MW5A 2KQ7A 4ANWA 3KYCD 4NJ7A 3RD2A 3UINB 5EDSA 4LDTB 3SU8X 3A33B 2MA9B 2N7EA 2WDTB 3WIMA 3A1QB 2B3AA 4NY0A 1LXDA 2I1JA 3R7QA 3ML8A 5AEKB 2KC1A 4AP4C 1ZKHA 1HE8A 4HCPB 3QCAA 1D3ZA 3UIPB 2JPHA 3SDLC 3ZW3A 4MH0E 3Q3FA 4LJOB 2FCNA 2D10A 4ZYNA 3DBSA 3CSTA 4K1RB 2JT4B 4PYZA 3VAWA 1T0YA 4W9GA 3ZDMC 2BF8B 4EOYA 4BVUC 2KFKA 3QWZB 2O6VB 2UWQA 2J0KA 5AZFA 3VH4B 1OQYA 3KUZA 4GDLB 4JQWC 4LCDE 2DZMA 1UBQA 3DCGA 3QHTA 3RCZA 2KDEB 1WYWB 2N9PC 3APCA 4URKA 4K7UA 3L54A 3PRMB 4MM3A 3VVWB 1SE9A 3OJ3A 1WI0A 4IUMB 2XK5B 4AJWA 1WXAA 4NPNA 3TCAA 3ZDTA 3CMMB 4EZKA 3MHSD 1WM3A 4ANXA 2M1MA 2BYVE 3ZTDA 2LGXA 1YJ1A 3APFA 1U4AA 3MJWA 1V9JA 1WGDA 3MTNB 3ZO5B 4FHJA 4NJ6A 4G11A 2FAZA 3L16A 4JGHB 2WWZA 4IWQA 1WJ4A 2LWPA 2ZCBA 5LLIA 3S2AA 1XT9B 3HM3A 4KVGB 4N9F4 2DZKA 2ZJDA 2CHWA 4NAWA 5AZHA 4BKSA 4BOSC 2XBBC 3DPDA 2LRWA 4DWFA 3A1QA 1GC6A 3R3MA 2PE9A 5D7GA 1WIAA 2J7QB 4KSKC 2KX3A 3LDZE 4HPMB 4EZJA 1E8ZA 1S1QB 2MSED 2PEAA 3DVGY 3VUXA 4DHJB 3N32A 2KWUB 2M0XA 4PS8A 2DZJA 5TR5A 1IP9A 1IPGA 4B9KA 5CHFA 4W9DA 2HE7A 3V6EB 3QX1A 3A9JB 3ZTCA 4LDTD 4GGQA 5DPTA 3PLUA 4HVBA 5CHVC 3QIJA 2O6VA 2DYOA 5L83A 1M94A 3KUDB 1RFAA 3H7PB 1SIFA 3B08A 4MDKE 4MGZE 2KMAA 2NR2A 5G2NA 3EHVA 3PLVA 2KNBA 2GMIC 4W9IA 4F1SA 3TIXA 4II2B 3WAMA 2LI5A 2MLBA 1WMHA 2XK5A 1G6JA 4FADA 2JY6A 1AARA 1UGMA 4K7SA 5AZGA 2CHZA 1I35A 3VTWA 1KM7A 1XD3B 2UYZB 1P0RA 1WJ6A 2MBBB 3TJPA 2LRUA 4PS7A 3DDCB 3PS6A 2KKCA 2LXCA 3KH0A 1XQQA 5IAAC 3A9KB 1LFDA 5CHWA 3QC8B 4MELA 1P3QU 4WWPA 3IBEA 2IY1B 1WXSA 3M95A 3B1LX 3WAPA 2NPTB 3EC8A 3PHXB 2KFJA 1KJTA 3H1UA 2KHWB 4TUUA 4AJYB 4XX5A 2KTRA 1E7UA 1R4NI 4XZ4A 3L17A 2WX1A 3HK0A 4W9FA 2DAJA 2AEHA 2C7HA 2AYOB 4FULA 3L10B 1E90A 1WJNA 3PPAA 3QAQA 3V60A 3M3JA 2CKHB 2Z59B 1GC7A 1WH3A 2D11A 3A9JA 2IO1B 1Q5WB 2V4LA 2IY0B 2KJHB 2K6DB 3CSFA 3IVFA 1V6EA 3PVLA 2JRHA 3GOEA 2BPSA 4MGIE 4W9CA 4BOZB 3DVNU 1NDDA 3PRZA 2L3ZA 3PREA 4KDIC 1KOTA 3A4RA 2FIDA 2LVPA 3AXCA 4DHJD 3BINA 4IM3A 4KSLC 1C1YB 2BYEA 2KC2A 2JZ3B 1EF1A 4HCNB 4BBNF 3ZNZB 3ZNGC 3CF6E 2MRPA 2LVOA 1V81A 5JHAA 3VDZA 2A4ZA 4P7IA 1A5RA 1VCBA 2VRRB 3M63B 3U8ZA 2IZVB 4X57B 3AULA 4ICVA 1ISNA 2NVUI 3VHTC 4FJZA 3A9KA 4OVUA 3HIZA 2L0FA 2ZNVB 1H8CA 4AOFA 2KK8A 1NI2A 4A20A 1GNUA 3TL5A 3UQBA 4W9KA 1F9JA 1EUVB 3QARA 1GJZA 2M4NA 2N4FA 3QA8A 2CR5A 4ICUA 1WX7A 1E8XA 2KN5A 3H9DA 4JIOU 1V80A 3W1YA 1WY8A 5FR6A 4TQ1A 4E71A 2CU1A 4MSQB 3ZUNA 3IHPC 4GDKA 4LJPB 2D3GA 5D6JB 5D94A 2BWFA 4TV3A 3H7SA 4DXAB 2DYBA 4M8MA 4JL9A 2BKFA 5G55A 4ZRKA 2W9NA 1I42A 2V3SA 5E6NA 4WJQA 1OTRB 2KDBA 2OOBB 1WXVA 1J19A 4AWJA 5LXHA 3ENEA 3NS8A 3OAWA 2K39A 4DHZB 2ASQA 5DCNA 2I1KA 3QJZA 3RZFA 2MBOA 3ZRFA 4ANVA 4CHKA 3B0AA 3JSVB 3ZIMA 3DBLI 2AL3A 2O2VB 3OJ4B 4DK5A 1WF9A 2K8BA 3A4SC 4BBNC 2BWES 1C3TA 3X0WA 1TGZB 2ZPYA 2ZVNA 3WALA 1WR1A 1V86A 3VXWA 2KD0A 4GMVA 3NOBA 4NQLB 5KHOA 3V62A 4BFRA 2ZCCA 2L7RA 1UD7A 2V1YA 3DVNV 4MJSB 3PGEA 2KLGA 2DAFA 3RUIB 2IO0B 4RM8A 2KJ6A 3HM6X 2DX5B 4MGYE 2GBRA 4GDLA 1CMXB 4WWOA 4XC2A 4E3CA 4IWPA 2FIFA 1WGYA 4DDGD 2G45B 2R2OA 3EFUA 2JWZA 4G50A 4M0WB 5E6PA 4OVVA 1WR6E 2FNJB 3AU5A 4W9LA 1KLVA 2L8JA 1WJUA 4IM2A 2OJRA 4KIKB 2AL6A 3W1SA 4EKUA 3OLMD 2D2QA 4I6PA 1V2YA 4HPLB 2QHOA 1K8RB 2KX0A 5E6OA 3RULA 2DENB 2JF5A 3K9OB 3QK0A 4HJKA 3ECIA 4K81A 3BY4B 4EUTA 5C1ZA 4MEMA 1WZ3A 2L05A 1WX9A 3VTVA 4HLEA 2R2QA 3X23A 2GBMA 3KUCB 3T9LA 5J18A 2BYFA 3JSVA 3VFKA 3WA0A 2GBJA 4GB9A 4DBGA 2NBUA 2ZZPB 3PSEB 3PV1A 5DPSA 5J17A 2RPQA 1L2NA 3SHQA 3JYUA 3U30A 2LJ5A 1WZ0A 2JUOA 3O65B 5CTRC 3ALBA 3V61A 3ZLZA 4BKGA 2D07B 1OEYJ 2RR9A 3RYTA 1TTNA 3RZWC 2KXJA 4IW0A 4WJPA 4AUQC 1WGRA 3DVGX 3VTUA 3ZRCA 4FJYA 3PT2B 1E5WA 2KFKB 3KW5B 5JH5C 1TBEA 3UGBB 5CX3A 3DOWA 1R4MI 4GOCA 2K1FA 1Q0WB 3H7PA 4GIVA 4II3B 3SD5A 1IYFA 1Z2MA 2KANA 2KTFA 4G0NB 4J6IA 4DHZE 2N9EB 2N1VA 4WJOA 1J8CA 2PJHA 2KWVB 4WWNA 2FCMA 2L0TA 3TBLD 2MQJA 2KOXA 4E74A 4FA6A 1V5TA 2MBQA 4KIKA 4A3PA 2EMTA 2PPHA 2LUEA 1RRBA 4MSMB 3ML9A 4RM9A 4F8CB 5GMVA 4FHKA 3RT3B 2ZNVC 2KLCA 1GG3A 1OEYA 4B95A 2YLMA 3L13A 1WM2A 2KWCA 3UQAA 2IO2B 1EF5A 1X1MA 2G4DB 2L76A 1YIWA 3KYDD 2KQSA 4NAWB 2NPTA 4HWIB 2JRIB 2KJRA 3AI5A 4MGKE 4KZ0A 4NNJB 1PQSA 4YL8A 1Y8RC 4WAAA 5JHBA 2LGDA 2GBKA 1OGWA 2A5UA 3KVFB 3NZUA 1H4RA 2NBVB 2CS4A 3W1SC 4I6LB 3WANA 1UBIA 5JZEB 2Z0EB 1RAXA 4KV2A 2LASA 4PYUA 1L7YA 2JVCA 4WQOB 2ZPNA 3K9PB 5DPWA 3JVZX 4K7WA 3ONSA 4HDQA 2GOWA 5LXIB 1WGGA 3V6CB 4TQ0A 1YX5B 2M8SA 1LM8B 3UF8A 2MWSB 1E8YA 2WYQA 4GU2A 1UZXB 5C23A 3VQIA 4DDID 4FJVB 1WGHA 3AU4A 2CHXA 4CYEA 5HKHA 4ZRIA 1YQBA 3C0RB 4ZRJA 1FXTB 3ZNHB 2ZVOA 5L95C 1WE6A 2KZRA 2YVCA 2NS5A 4G3XB 1WMHB 2FCQA 2KO3A 1EO6A 2N7DA 3Q3JA 2BGFA 1P98A 3D32A 2G3QB 3VUWA 2N9XA 2MX2A 5D2MB 2K8CA 2DYMA 4IC7B 2WX0A 1P9DU 4KDLB 3WAOA 1WRDB 3EECA 2RGFA 2J0MA 1UELA 4JLCA 4BKTA 1WE7A 3NY5A 2C60A 1Q1OA 2FUHB 3NZSA 4FLHA 2KTRB 4GN1A 1E7VA 2LZ6A 1TZ1A 2EMSA 2HTHA 1V49A 2MP2B 2J0JA 4HXDA 3H6NA 2KMCA 2REXA 3N3KB 2PE6B 3I3TB 1J0GA 3JW0X 2Y5BB 5BO4B 3U7DA 1E8WA 2DHZA 4WJNA 4TKNA 2MCNB 3PHWB 1YD8U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BT0 A;  1RLF A;  4IG7 B;  4W9J A;  1P1A A;  4BKS D;  3VUY A;  4HDO A;  2K8H A;  2HD5 B;  3PRP B;  3ZNI D;  2AWT A;  2L00 B;  3M62 B;  4GXB A;  4IWO A;  3PZD A;  2NBW B;  1UH6 A;  3L0W B;  4ZDV A;  2LGY A;  2G4S A;  5DPR A;  1MG8 A;  2C5L C;  2LVQ A;  3TMP B;  3IFW B;  2O2V A;  3N30 A;  1WXM A;  2K25 A;  4NQK E;  4KZC A;  1V5O A;  1WFY A;  2ZEQ A;  2IYD B;  4EFO A;  2C7M B;  1ZW7 A;  2C9W B;  2DZI A;  2GBN A;  2JZZ A;  2KDI A;  2LD9 A;  2O6V D;  4ASW C;  4B6W A;  5KHQ A;  1QZE A;  4EEW A;  4ANU A;  1ZGU B;  3VH3 B;  2XEW A;  2BKR B;  2MBH A;  3DBR I;  4MJS A;  3ZVV A;  3PTF C;  4M8N A;  3NHE B;  1NBF C;  4CO7 A;  4IM0 A;  1S3S G;  2HJ8 A;  3QQ8 B;  1VD2 A;  1WX8 A;  1Z5S B;  2LXA A;  3GZN I;  4A3O A;  4F7Z A;  3LJ3 A;  1LQB A;  2N1W A;  1SGH A;  3ZKJ C;  5IA7 A;  2EKE C;  2MP2 A;  2NCN A;  3R66 C;  5J2R A;  2RSU A;  4HK2 A;  2KDF B;  2C7N B;  3HHM A;  2Z0D B;  2JXX A;  3L08 A;  2K6Q A;  4GDK B;  4W9E A;  2MBE A;  4FN2 A;  3DBH I;  4PS3 A;  1GUA B;  2KVR A;  3UIO B;  3DQV A;  3P2B A;  1YX6 B;  3R7R A;  4EZL A;  3APD A;  4W9H A;  2M17 A;  4I6N B;  4GSW A;  3IG3 A;  2IO3 B;  2FCS A;  4FBJ B;  1JRU A;  2IBI B;  4RMA A;  2RD0 A;  3T8M A;  2MW5 A;  2KQ7 A;  4ANW A;  3KYC D;  4NJ7 A;  3RD2 A;  3UIN B;  5EDS A;  4LDT B;  3SU8 X;  3A33 B;  2MA9 B;  2N7E A;  2WDT B;  3WIM A;  3A1Q B;  2B3A A;  4NY0 A;  1LXD A;  2I1J A;  3R7Q A;  3ML8 A;  5AEK B;  2KC1 A;  4AP4 C;  1ZKH A;  1HE8 A;  4HCP B;  3QCA A;  1D3Z A;  3UIP B;  2JPH A;  3SDL C;  3ZW3 A;  4MH0 E;  3Q3F A;  4LJO B;  2FCN A;  2D10 A;  4ZYN A;  3DBS A;  3CST A;  4K1R B;  2JT4 B;  4PYZ A;  3VAW A;  1T0Y A;  4W9G A;  3ZDM C;  2BF8 B;  4EOY A;  4BVU C;  2KFK A;  3QWZ B;  2O6V B;  2UWQ A;  2J0K A;  5AZF A;  3VH4 B;  1OQY A;  3KUZ A;  4GDL B;  4JQW C;  4LCD E;  2DZM A;  1UBQ A;  3DCG A;  3QHT A;  3RCZ A;  2KDE B;  1WYW B;  2N9P C;  3APC A;  4URK A;  4K7U A;  3L54 A;  3PRM B;  4MM3 A;  3VVW B;  1SE9 A;  3OJ3 A;  1WI0 A;  4IUM B;  2XK5 B;  4AJW A;  1WXA A;  4NPN A;  3TCA A;  3ZDT A;  3CMM B;  4EZK A;  3MHS D;  1WM3 A;  4ANX A;  2M1M A;  2BYV E;  3ZTD A;  2LGX A;  1YJ1 A;  3APF A;  1U4A A;  3MJW A;  1V9J A;  1WGD A;  3MTN B;  3ZO5 B;  4FHJ A;  4NJ6 A;  4G11 A;  2FAZ A;  3L16 A;  4JGH B;  2WWZ A;  4IWQ A;  1WJ4 A;  2LWP A;  2ZCB A;  5LLI A;  3S2A A;  1XT9 B;  3HM3 A;  4KVG B;  4N9F 4;  2DZK A;  2ZJD A;  2CHW A;  4NAW A;  5AZH A;  4BKS A;  4BOS C;  2XBB C;  3DPD A;  2LRW A;  4DWF A;  3A1Q A;  1GC6 A;  3R3M A;  2PE9 A;  5D7G A;  1WIA A;  2J7Q B;  4KSK C;  2KX3 A;  3LDZ E;  4HPM B;  4EZJ A;  1E8Z A;  1S1Q B;  2MSE D;  2PEA A;  3DVG Y;  3VUX A;  4DHJ B;  3N32 A;  2KWU B;  2M0X A;  4PS8 A;  2DZJ A;  5TR5 A;  1IP9 A;  1IPG A;  4B9K A;  5CHF A;  4W9D A;  2HE7 A;  3V6E B;  3QX1 A;  3A9J B;  3ZTC A;  4LDT D;  4GGQ A;  5DPT A;  3PLU A;  4HVB A;  5CHV C;  3QIJ A;  2O6V A;  2DYO A;  5L83 A;  1M94 A;  3KUD B;  1RFA A;  3H7P B;  1SIF A;  3B08 A;  4MDK E;  4MGZ E;  2KMA A;  2NR2 A;  5G2N A;  3EHV A;  3PLV A;  2KNB A;  2GMI C;  4W9I A;  4F1S A;  3TIX A;  4II2 B;  3WAM A;  2LI5 A;  2MLB A;  1WMH A;  2XK5 A;  1G6J A;  4FAD A;  2JY6 A;  1AAR A;  1UGM A;  4K7S A;  5AZG A;  2CHZ A;  1I35 A;  3VTW A;  1KM7 A;  1XD3 B;  2UYZ B;  1P0R A;  1WJ6 A;  2MBB B;  3TJP A;  2LRU A;  4PS7 A;  3DDC B;  3PS6 A;  2KKC A;  2LXC A;  3KH0 A;  1XQQ A;  5IAA C;  3A9K B;  1LFD A;  5CHW A;  3QC8 B;  4MEL A;  1P3Q U;  4WWP A;  3IBE A;  2IY1 B;  1WXS A;  3M95 A;  3B1L X;  3WAP A;  2NPT B;  3EC8 A;  3PHX B;  2KFJ A;  1KJT A;  3H1U A;  2KHW B;  4TUU A;  4AJY B;  4XX5 A;  2KTR A;  1E7U A;  1R4N I;  4XZ4 A;  3L17 A;  2WX1 A;  3HK0 A;  4W9F A;  2DAJ A;  2AEH A;  2C7H A;  2AYO B;  4FUL A;  3L10 B;  1E90 A;  1WJN A;  3PPA A;  3QAQ A;  3V60 A;  3M3J A;  2CKH B;  2Z59 B;  1GC7 A;  1WH3 A;  2D11 A;  3A9J A;  2IO1 B;  1Q5W B;  2V4L A;  2IY0 B;  2KJH B;  2K6D B;  3CSF A;  3IVF A;  1V6E A;  3PVL A;  2JRH A;  3GOE A;  2BPS A;  4MGI E;  4W9C A;  4BOZ B;  3DVN U;  1NDD A;  3PRZ A;  2L3Z A;  3PRE A;  4KDI C;  1KOT A;  3A4R A;  2FID A;  2LVP A;  3AXC A;  4DHJ D;  3BIN A;  4IM3 A;  4KSL C;  1C1Y B;  2BYE A;  2KC2 A;  2JZ3 B;  1EF1 A;  4HCN B;  4BBN F;  3ZNZ B;  3ZNG C;  3CF6 E;  2MRP A;  2LVO A;  1V81 A;  5JHA A;  3VDZ A;  2A4Z A;  4P7I A;  1A5R A;  1VCB A;  2VRR B;  3M63 B;  3U8Z A;  2IZV B;  4X57 B;  3AUL A;  4ICV A;  1ISN A;  2NVU I;  3VHT C;  4FJZ A;  3A9K A;  4OVU A;  3HIZ A;  2L0F A;  2ZNV B;  1H8C A;  4AOF A;  2KK8 A;  1NI2 A;  4A20 A;  1GNU A;  3TL5 A;  3UQB A;  4W9K A;  1F9J A;  1EUV B;  3QAR A;  1GJZ A;  2M4N A;  2N4F A;  3QA8 A;  2CR5 A;  4ICU A;  1WX7 A;  1E8X A;  2KN5 A;  3H9D A;  4JIO U;  1V80 A;  3W1Y A;  1WY8 A;  5FR6 A;  4TQ1 A;  4E71 A;  2CU1 A;  4MSQ B;  3ZUN A;  3IHP C;  4GDK A;  4LJP B;  2D3G A;  5D6J B;  5D94 A;  2BWF A;  4TV3 A;  3H7S A;  4DXA B;  2DYB A;  4M8M A;  4JL9 A;  2BKF A;  5G55 A;  4ZRK A;  2W9N A;  1I42 A;  2V3S A;  5E6N A;  4WJQ A;  1OTR B;  2KDB A;  2OOB B;  1WXV A;  1J19 A;  4AWJ A;  5LXH A;  3ENE A;  3NS8 A;  3OAW A;  2K39 A;  4DHZ B;  2ASQ A;  5DCN A;  2I1K A;  3QJZ A;  3RZF A;  2MBO A;  3ZRF A;  4ANV A;  4CHK A;  3B0A A;  3JSV B;  3ZIM A;  3DBL I;  2AL3 A;  2O2V B;  3OJ4 B;  4DK5 A;  1WF9 A;  2K8B A;  3A4S C;  4BBN C;  2BWE S;  1C3T A;  3X0W A;  1TGZ B;  2ZPY A;  2ZVN A;  3WAL A;  1WR1 A;  1V86 A;  3VXW A;  2KD0 A;  4GMV A;  3NOB A;  4NQL B;  5KHO A;  3V62 A;  4BFR A;  2ZCC A;  2L7R A;  1UD7 A;  2V1Y A;  3DVN V;  4MJS B;  3PGE A;  2KLG A;  2DAF A;  3RUI B;  2IO0 B;  4RM8 A;  2KJ6 A;  3HM6 X;  2DX5 B;  4MGY E;  2GBR A;  4GDL A;  1CMX B;  4WWO A;  4XC2 A;  4E3C A;  4IWP A;  2FIF A;  1WGY A;  4DDG D;  2G45 B;  2R2O A;  3EFU A;  2JWZ A;  4G50 A;  4M0W B;  5E6P A;  4OVV A;  1WR6 E;  2FNJ B;  3AU5 A;  4W9L A;  1KLV A;  2L8J A;  1WJU A;  4IM2 A;  2OJR A;  4KIK B;  2AL6 A;  3W1S A;  4EKU A;  3OLM D;  2D2Q A;  4I6P A;  1V2Y A;  4HPL B;  2QHO A;  1K8R B;  2KX0 A;  5E6O A;  3RUL A;  2DEN B;  2JF5 A;  3K9O B;  3QK0 A;  4HJK A;  3ECI A;  4K81 A;  3BY4 B;  4EUT A;  5C1Z A;  4MEM A;  1WZ3 A;  2L05 A;  1WX9 A;  3VTV A;  4HLE A;  2R2Q A;  3X23 A;  2GBM A;  3KUC B;  3T9L A;  5J18 A;  2BYF A;  3JSV A;  3VFK A;  3WA0 A;  2GBJ A;  4GB9 A;  4DBG A;  2NBU A;  2ZZP B;  3PSE B;  3PV1 A;  5DPS A;  5J17 A;  2RPQ A;  1L2N A;  3SHQ A;  3JYU A;  3U30 A;  2LJ5 A;  1WZ0 A;  2JUO A;  3O65 B;  5CTR C;  3ALB A;  3V61 A;  3ZLZ A;  4BKG A;  2D07 B;  1OEY J;  2RR9 A;  3RYT A;  1TTN A;  3RZW C;  2KXJ A;  4IW0 A;  4WJP A;  4AUQ C;  1WGR A;  3DVG X;  3VTU A;  3ZRC A;  4FJY A;  3PT2 B;  1E5W A;  2KFK B;  3KW5 B;  5JH5 C;  1TBE A;  3UGB B;  5CX3 A;  3DOW A;  1R4M I;  4GOC A;  2K1F A;  1Q0W B;  3H7P A;  4GIV A;  4II3 B;  3SD5 A;  1IYF A;  1Z2M A;  2KAN A;  2KTF A;  4G0N B;  4J6I A;  4DHZ E;  2N9E B;  2N1V A;  4WJO A;  1J8C A;  2PJH A;  2KWV B;  4WWN A;  2FCM A;  2L0T A;  3TBL D;  2MQJ A;  2KOX A;  4E74 A;  4FA6 A;  1V5T A;  2MBQ A;  4KIK A;  4A3P A;  2EMT A;  2PPH A;  2LUE A;  1RRB A;  4MSM B;  3ML9 A;  4RM9 A;  4F8C B;  5GMV A;  4FHK A;  3RT3 B;  2ZNV C;  2KLC A;  1GG3 A;  1OEY A;  4B95 A;  2YLM A;  3L13 A;  1WM2 A;  2KWC A;  3UQA A;  2IO2 B;  1EF5 A;  1X1M A;  2G4D B;  2L76 A;  1YIW A;  3KYD D;  2KQS A;  4NAW B;  2NPT A;  4HWI B;  2JRI B;  2KJR A;  3AI5 A;  4MGK E;  4KZ0 A;  4NNJ B;  1PQS A;  4YL8 A;  1Y8R C;  4WAA A;  5JHB A;  2LGD A;  2GBK A;  1OGW A;  2A5U A;  3KVF B;  3NZU A;  1H4R A;  2NBV B;  2CS4 A;  3W1S C;  4I6L B;  3WAN A;  1UBI A;  5JZE B;  2Z0E B;  1RAX A;  4KV2 A;  2LAS A;  4PYU A;  1L7Y A;  2JVC A;  4WQO B;  2ZPN A;  3K9P B;  5DPW A;  3JVZ X;  4K7W A;  3ONS A;  4HDQ A;  2GOW A;  5LXI B;  1WGG A;  3V6C B;  4TQ0 A;  1YX5 B;  2M8S A;  1LM8 B;  3UF8 A;  2MWS B;  1E8Y A;  2WYQ A;  4GU2 A;  1UZX B;  5C23 A;  3VQI A;  4DDI D;  4FJV B;  1WGH A;  3AU4 A;  2CHX A;  4CYE A;  5HKH A;  4ZRI A;  1YQB A;  3C0R B;  4ZRJ A;  1FXT B;  3ZNH B;  2ZVO A;  5L95 C;  1WE6 A;  2KZR A;  2YVC A;  2NS5 A;  4G3X B;  1WMH B;  2FCQ A;  2KO3 A;  1EO6 A;  2N7D A;  3Q3J A;  2BGF A;  1P98 A;  3D32 A;  2G3Q B;  3VUW A;  2N9X A;  2MX2 A;  5D2M B;  2K8C A;  2DYM A;  4IC7 B;  2WX0 A;  1P9D U;  4KDL B;  3WAO A;  1WRD B;  3EEC A;  2RGF A;  2J0M A;  1UEL A;  4JLC A;  4BKT A;  1WE7 A;  3NY5 A;  2C60 A;  1Q1O A;  2FUH B;  3NZS A;  4FLH A;  2KTR B;  4GN1 A;  1E7V A;  2LZ6 A;  1TZ1 A;  2EMS A;  2HTH A;  1V49 A;  2MP2 B;  2J0J A;  4HXD A;  3H6N A;  2KMC A;  2REX A;  3N3K B;  2PE6 B;  3I3T B;  1J0G A;  3JW0 X;  2Y5B B;  5BO4 B;  3U7D A;  1E8W A;  2DHZ A;  4WJN A;  4TKN A;  2MCN B;  3PHW B;  1YD8 U; 
#chains in the Genus database with same CATH topology
 1FCL A;  3VUY A;  2K8H A;  3PRP B;  1JCK B;  4IWO A;  2NBW B;  2IPK D;  2PVG C;  2LGY A;  4XE0 A;  1MG8 A;  2C5L C;  4EE2 A;  3TMP B;  2WXF A;  2K25 A;  4KZC A;  1WFY A;  2C7M B;  1L4D B;  5KHQ A;  1ZGU B;  4MJS A;  3PTF C;  3NHE B;  1NBF C;  3QQ8 B;  1E6E B;  1VD2 A;  3VRA B;  2LXA A;  2N1W A;  1SGH A;  3Q8F A;  2EKE C;  2NCN A;  3R66 C;  4L2Y A;  2D5G A;  3HHM A;  3W2D A;  2MBE A;  2KVR A;  2LJI A;  3N9Y C;  3PZ7 A;  4W9H A;  4I6N B;  2BTE A;  4RMA A;  4LK0 M;  4ANW A;  3RD2 A;  4ARI A;  4KKI A;  4S0R A;  2B3A A;  4NY0 A;  1LXD A;  1XLO A;  1MHX A;  4AP4 C;  1HE8 A;  3P4R B;  3R8B A;  4HCP B;  3HUI A;  3UIP B;  2X38 A;  3SDL C;  1YMH E;  4MH0 E;  4ZYN A;  3MP9 A;  3VAW A;  1T0Y A;  2LHD A;  4EOY A;  2UWQ A;  3KUZ A;  2VZK D;  2DZM A;  4OZB A;  3PRM B;  4MM3 A;  4P6V F;  4IUM B;  1YJI A;  3CMM B;  2QIE B;  2M1M A;  2RDG A;  1JW9 D;  1V9J A;  3MTN B;  4KX6 B;  3ZO5 B;  1J7A A;  1FRD A;  1P7F A;  1JAL A;  2LWP A;  1E0Z A;  3P4Q B;  2CHW A;  4BKS A;  3TEX A;  1ZXH A;  3DPD A;  2WHI A;  3KWL A;  4M00 A;  3A1Q A;  1GC6 A;  2PE9 A;  1PYW D;  5D7G A;  2V3N A;  4A6Q A;  2L83 A;  4EZJ A;  3DVG Y;  3VUX A;  4DHJ B;  2M0X A;  2DZJ A;  2MJE A;  1PGA A;  1IP9 A;  2INC C;  3MFG A;  3V6E B;  3A9J B;  3ZTC A;  2W54 A;  2DNF A;  4WIP A;  1FRR A;  2PLP A;  2DYO A;  3BK1 A;  3H7P B;  1SIF A;  3EHV A;  3DBL B;  3PLV A;  4XGA B;  3TIX A;  2MLB A;  2VZK B;  1G6J A;  1UGM A;  1FPY A;  1I35 A;  3V05 A;  3PS6 A;  2KKC A;  5IAA C;  1T6B X;  3QC8 B;  4MEL A;  5H8Y E;  3AE5 B;  4USA A;  1WXS A;  2NPT B;  1XCQ L;  4DXG A;  4TUU A;  4AJY B;  2KTR A;  1R4N I;  3URY A;  1AW7 A;  3NZ3 A;  4WQM A;  3U52 E;  3KLS X;  2JU6 X;  2WXO A;  1WJN A;  3PPA A;  3QAQ A;  3M3J A;  5EE3 A;  1GC7 A;  1WH3 A;  1Q5W B;  3RFZ B;  1WGK A;  2ICI A;  4W9C A;  3I63 C;  3DVN U;  1NDD A;  4HRS A;  1KOT A;  2HDE A;  2LVP A;  3BIN A;  1IBX B;  4KSL C;  4BBN F;  1DOY A;  1KFY B;  1V81 A;  4HPP A;  1FD6 A;  3BII D;  4P7I A;  1A5R A;  3M63 B;  2IZV B;  1F2R C;  4ICV A;  3VHT C;  1GB4 A;  4A55 A;  1FNW A;  2DWQ A;  1NI2 A;  3SFE B;  3TL5 A;  3UQB A;  4W9K A;  1GJZ A;  2N4F A;  3C19 A;  2CR5 A;  2LGS A;  3H9D A;  3W1Y A;  5FR6 A;  2WU5 B;  3Q8A A;  3ZUN A;  3IHP C;  4LNK A;  4RGT A;  4M8M A;  2JSV X;  4JL9 A;  3DHH C;  2V3S A;  5E6N A;  2H88 B;  1WXV A;  1ROE A;  4AWJ A;  3NS8 A;  3OAW A;  2KDM A;  5AUK A;  4CHK A;  3AM9 A;  1SEB D;  3JSV B;  3ZIM A;  2KN4 A;  3AB5 A;  1QQR A;  2JZP A;  4DK5 A;  1WF9 A;  2K8B A;  2FBW B;  1D5X C;  3B9J A;  3X0W A;  1I7H A;  1K51 A;  3IAS 1;  3AE7 B;  2JYE A;  3VR9 B;  4GMV A;  2L7R A;  4MJS B;  3DVN V;  1TS3 A;  3W5U B;  1TKE A;  4RM8 A;  2KJ6 A;  1I4Q A;  2XN9 C;  3IT4 B;  1CMX B;  4XC2 A;  3P63 A;  1MFW A;  1EU3 A;  4DDG D;  1RWS A;  1HA5 A;  2G45 B;  3EFU A;  4M0W B;  5E6P A;  4OVV A;  1WR6 E;  4IM2 A;  1PGB A;  3W1S A;  4YT0 B;  3OLM D;  2D2Q A;  2QHO A;  1NEN B;  3O13 A;  2DEN B;  2J53 A;  4WAF A;  2JF5 A;  3QK0 A;  3NRZ A;  4EUT A;  5C1Z A;  2KYW A;  5IP4 D;  2IGG A;  2RDH A;  2R2Q A;  3T9L A;  3AEG B;  4RH6 A;  1WYG A;  2G1E A;  4DBG A;  2L32 A;  3PSE B;  4ZRP A;  3PV1 A;  3T3O A;  1IGD A;  2ZW0 A;  2QDF A;  2E6X A;  3ALB A;  4BKG A;  1OEY J;  2RR9 A;  4BZA A;  2KXJ A;  3FAH A;  2FE8 A;  4BAX A;  1E5W A;  3KW5 B;  4ACF A;  1R4M I;  4GOC A;  2BQQ A;  2LEK A;  4GIV A;  1XLN A;  4R3D A;  1Z2M A;  3SD5 A;  2K9X A;  4JWS C;  2N1V A;  3ZJU A;  2MQJ A;  2PPH A;  1RRB A;  2H89 B;  3RT3 B;  3I57 A;  1RFK A;  2LMC A;  4YSZ B;  3TEZ A;  3E56 A;  1EF5 A;  1YIW A;  2KQS A;  4HWI B;  2JRI B;  4NNJ B;  4WAA A;  2A5U A;  3KVF B;  3NZU A;  2CS4 A;  1RAX A;  3K9P B;  1C9F A;  3OWE B;  3V6C B;  2N7J A;  1YX5 B;  2OHF A;  1LM8 B;  2MWS B;  2B76 B;  1LGR A;  1QOA A;  5C23 A;  4FJV B;  1NYR A;  3H8H A;  1WGH A;  3AU4 A;  4CYE A;  1YQB A;  3P4S B;  2KZR A;  2V3P A;  1F1H A;  4ZHO A;  2IDY A;  1Y56 A;  4G3X B;  3Q3J A;  2BGF A;  1P98 A;  2IGH A;  3VUW A;  1N61 A;  2N9K A;  2K8C A;  2RGF A;  4CQN A;  3MHZ A;  3RNF C;  2FUH B;  1VZ7 A;  2KTR B;  4GN1 A;  1E7V A;  1V49 A;  2J0J A;  3AEA B;  3N3K B;  3NUH B;  4FXC A;  5BO4 B;  2MCN B;  1I4X A;  2GRI A;  3ZJT A;  3PHW B;  1STE A;  1CK1 A;  4IG7 B;  1P1A A;  2W3S A;  4HDO A;  2AWT A;  3PZD A;  1UH6 A;  4N59 A;  2KQ4 X;  1C4C A;  4ZDV A;  1JRO A;  1E10 A;  2LVQ A;  4XWT A;  2WXN A;  3IFW B;  2O2V A;  3N30 A;  1V5O A;  2ZEQ A;  4C00 A;  4OHJ A;  2C9W B;  2DZI A;  2GBN A;  2JZZ A;  2KDI A;  2O6V D;  2SEB D;  4ASW C;  4PK1 A;  4AS1 A;  1QZE A;  4EEW A;  3DBR I;  3ZVV A;  1DOI A;  3B2G A;  4M8N A;  4CO7 A;  1N63 A;  1TKY A;  4A3O A;  3GZN I;  4F7Z A;  3LJ3 A;  3ABV B;  3RNA C;  3ZKJ C;  2MP2 A;  2GI9 A;  4HK2 A;  2WXQ A;  2C7N B;  2Z0D B;  1GUA B;  2BS4 B;  3P2B A;  2Q5W D;  4NAM A;  3APD A;  3NVY A;  2IO3 B;  4FBJ B;  3T8M A;  3Q8E A;  1V1O A;  3KYC D;  2AQ1 B;  5EDS A;  2N7E A;  5I4D A;  3WIM A;  1FEH A;  1FNU A;  5AEK B;  1FO4 A;  1ZKH A;  2JYT A;  2JX5 A;  3ZW3 A;  3CST A;  3R2I A;  2JT4 B;  2RPV A;  1T0Q C;  3ZDM C;  2KFK A;  2O6V B;  3VH4 B;  2IGD A;  3AED B;  2V0G A;  1ZE3 D;  1WYW B;  3APC A;  4URK A;  1L6V A;  4K7U A;  4IOI E;  1M4V A;  1SSN A;  1WI0 A;  2GB1 A;  4EZK A;  1WM3 A;  1YJ1 A;  1XF5 L;  1GOZ A;  1WGD A;  4FHJ A;  4G11 A;  1WJ4 A;  5LLI A;  2DZK A;  5HFY A;  2XBB C;  2LRW A;  4DWF A;  3HVZ A;  4KSK C;  3TUO A;  2WNM A;  3E9S A;  1E9M A;  3FKY A;  3LDZ E;  4HPM B;  1S1Q B;  2PIA A;  3IAM 1;  3N32 A;  4PS8 A;  3ZXR A;  3Q2A C;  4LNI A;  5TR5 A;  4N6E B;  3QX1 A;  4GGQ A;  3PLU A;  1UGJ A;  4AQ7 A;  3QIJ A;  1IUE A;  4P1C C;  5L83 A;  1M94 A;  3KUD B;  4ARC A;  1ACC A;  1RYJ A;  1PDX A;  3BVG A;  5G2N A;  5BYQ A;  3NVZ A;  4UDU C;  2BVC A;  3WAM A;  2LI5 A;  1WMH A;  2XK5 A;  1AAR A;  1WSP A;  4K7S A;  5GXG B;  1EWY C;  2PTL A;  3VTW A;  1KM7 A;  1XD3 B;  2UYZ B;  3TJP A;  2PKO A;  3A9K B;  1T3Q A;  4WWP A;  4MH8 A;  2KFJ A;  3H1U A;  4XX5 A;  3L17 A;  2WX1 A;  3HK0 A;  1TS2 A;  2C7H A;  1E90 A;  4N58 A;  1PUT A;  1JRP A;  2IO1 B;  2V4L A;  1JWU D;  1A70 A;  1C76 A;  2IY0 B;  3ETR A;  2K6D B;  3GOE A;  2BPS A;  3PRE A;  2L3Z A;  4WUR A;  5IN7 A;  4A9A A;  3AXC A;  4DHJ D;  3ZNZ B;  1TJE A;  3CF6 E;  1FIQ A;  5JHA A;  3VDZ A;  2A4Z A;  3DBR B;  1VCB A;  2VRR B;  3U8Z A;  3AUL A;  2NVU I;  2Y5P A;  4FJZ A;  4OVU A;  4D2K A;  2ZNV B;  1H8C A;  1FM0 D;  1F9J A;  1N5X A;  3WCQ A;  2M4N A;  3N1Z C;  3SEB A;  1T5X D;  3BYT B;  4MSQ B;  3R2T A;  4GDK A;  2D3G A;  5D6J B;  3P1M A;  1YN3 A;  4TV3 A;  2DYB A;  1TZO A;  4OVZ A;  3BZD B;  1OTR B;  2KDB A;  3BK2 A;  1Q10 A;  2SAK A;  2ASQ A;  3HRD D;  4LTU A;  3RZF A;  4ZRQ A;  2WXM A;  4ANV A;  4TMA B;  3B0A A;  3RNB C;  2O2V B;  3A4S C;  1C3T A;  1TGZ B;  3WAL A;  1V86 A;  2ACZ B;  4ZYS A;  2DBY A;  2KD0 A;  2K0P A;  1UD7 A;  3PGE A;  1KLG D;  1XEE A;  4DQO C;  3HM6 X;  2GBR A;  4IDI A;  4GDL A;  5IO9 A;  4E3C A;  1HEZ E;  3AE2 B;  1KF6 B;  2BB6 A;  2R2O A;  1WJU A;  2I2Y A;  3RNE C;  2OJR A;  4KIK B;  5T8I A;  2MJ3 A;  2K3U A;  4EKU A;  3GS2 A;  4HPL B;  3KWV A;  2QSD A;  1JQ4 A;  4HRO A;  4US8 A;  2EEL A;  2GBM A;  5J18 A;  1UF0 A;  2BYF A;  3WA0 A;  4RGN A;  1TYG B;  2GBJ A;  3RN9 C;  2ZZP B;  1HZ5 A;  5FR3 A;  1L2N A;  3SHQ A;  3JYU A;  3U30 A;  2LJ5 A;  2OJW A;  2JUO A;  1V1P A;  2NMQ A;  1TTN A;  4AUQ C;  3DVG X;  4WWM A;  1SF0 A;  3HVD A;  3PT2 B;  2KFK B;  3TEW A;  2WXJ A;  1Q0W B;  4II3 B;  2KTF A;  4DHZ E;  2N9E B;  4WJO A;  2KWV B;  3VR8 B;  3TBL D;  2INP E;  2OED A;  5D3D A;  2MBQ A;  1FNV A;  1UNS A;  3MC0 B;  3N20 C;  3ML9 A;  4FHK A;  2ZNV C;  1GG3 A;  1VDV A;  4B95 A;  2X8X X;  1WM2 A;  2KWC A;  1X1M A;  2IND C;  3MJ5 A;  3AI5 A;  4MGK E;  4YL8 A;  1PQS A;  3TSS A;  1Y8R C;  2LGD A;  2WXR A;  1H4R A;  2NBV B;  4I6L B;  1UBI A;  2Z0E B;  2JVC A;  4WQO B;  5DPW A;  4K7W A;  1MHH E;  4C4V A;  1MPE A;  2GOW A;  3LYY A;  1YN5 A;  2LGI A;  4S17 A;  2M8S A;  1DYQ A;  1MJD A;  1NVI D;  1VR9 A;  2WYQ A;  1UZX B;  1AWD A;  3VQI A;  2MEK A;  5HKH A;  4ZRI A;  2KWD A;  3C0R B;  3ZNH B;  2ZVO A;  5L95 C;  1SB3 C;  1JWM D;  2YVC A;  2NS5 A;  1WMH B;  2KO3 A;  2DLB A;  4P1B C;  2N7D A;  2BB5 A;  1SE4 A;  2MX2 A;  1L0Y B;  4IC7 B;  2QEJ C;  2WX0 A;  4GLS C;  4KDL B;  3EEC A;  4JLC A;  1L5P A;  4BKT A;  1WE7 A;  3NY5 A;  2C60 A;  4RFB A;  3RNC C;  1TZ1 A;  2HTH A;  2REX A;  2PE6 B;  1J0G A;  1VZ6 A;  3U7D A;  2CU3 A;  1KTK A;  4A90 A;  1BT0 A;  1RLF A;  4BKS D;  2R61 A;  2HD5 B;  4GXB A;  2L00 B;  2K22 A;  2BS3 B;  3L0W B;  2L1A A;  4RNA A;  3N1Y C;  5DPR A;  3RNG C;  3BVZ A;  3EA6 A;  4NQK E;  1OQQ A;  2IYD B;  4EFO A;  1ZW7 A;  4ANU A;  2NTS A;  1MVK A;  2JQR B;  2BKR B;  2MBH A;  2CJO A;  4OZC A;  1TKG A;  3P4P B;  1S3S G;  2AQ2 B;  1FMA D;  3GP7 A;  1SE3 A;  1WX8 A;  3BVM A;  1V97 A;  2RSU A;  5E6J A;  4MM3 B;  1OFF A;  3MC9 A;  4HJG E;  4JPS A;  2JXX A;  4GDK B;  1ESF A;  1K50 A;  3DBH I;  4PS3 A;  3U4E G;  3UIO B;  3AE8 B;  3DQV A;  3R7R A;  4EZL A;  2M17 A;  4GSW A;  3IG3 A;  4JE3 B;  2FCS A;  3RMK C;  2IBI B;  2IJ0 A;  2RD0 A;  2YEP F;  2MW5 A;  3UIN B;  1R4N B;  4LDT B;  3A33 B;  2N0S B;  2WDT B;  3A1Q B;  2I1J A;  3R7Q A;  2ON8 A;  1B9R A;  3ML8 A;  1SXT A;  2KC1 A;  1QIL A;  4KGS A;  1FXI A;  2PW9 A;  4LJO B;  1CJE A;  3NJT A;  4K1R B;  4PYZ A;  3ZXV A;  2BF8 B;  4BVU C;  5AZF A;  2WXP A;  1OQY A;  4GDL B;  4JQW C;  3DCG A;  1C4P A;  4B0M A;  3QHT A;  3RCZ A;  4PT5 A;  1N5W A;  3L54 A;  3GE8 C;  3VVW B;  2M19 A;  4AJW A;  3TCA A;  3ZDT A;  3MHS D;  4ANX A;  3U7Z A;  3ZTD A;  3VRB B;  3MJW A;  1U4A A;  4US9 A;  2FAZ A;  3L16 A;  4JGH B;  2WWZ A;  1V8C A;  1VLB A;  4IWQ A;  2ZCB A;  3S2A A;  2QMT A;  1XT9 B;  3HM3 A;  4N9F 4;  2ZJD A;  2BS2 B;  2RDB C;  1TS4 A;  2J7Q B;  1HZ6 A;  4C7Z A;  2KWU B;  2AX5 A;  4MAC A;  1IPG A;  1V1P B;  3MC8 A;  4HKZ E;  2KAC A;  5DPT A;  4HVB A;  5CHV C;  1I4G A;  4M01 A;  5HHD G;  1RFA A;  4MDK E;  3B08 A;  4MGZ E;  1JWA D;  2KNB A;  2GMI C;  4W9I A;  1AYF A;  4II2 B;  1TT5 B;  1SE2 A;  2HTM E;  2JY6 A;  3FC4 A;  5AZG A;  2CHZ A;  1C4A A;  3DDC B;  4K3C A;  2LXC A;  3V3X A;  3KH0 A;  3OG5 A;  2Y5C A;  1LFD A;  5CHW A;  3AE3 B;  3ZQ4 A;  2IY1 B;  2M56 B;  4ZOH C;  3B1L X;  3EC8 A;  3PHX B;  1KJT A;  2KHW B;  3AE9 B;  3NG0 A;  1YJJ A;  4W9F A;  2DAJ A;  5EE0 A;  2MJD A;  2AYO B;  4FUL A;  5H92 C;  3L10 B;  2LUM A;  2CKH B;  2Z59 B;  1BUI C;  2D11 A;  4C4V B;  3A9J A;  2LFI A;  3CSF A;  3IVF A;  4KGT A;  2JRH A;  4MGI E;  4BOZ B;  4YSX B;  1F2R I;  4KDI C;  2E3T A;  2FID A;  1QT9 A;  2D3C A;  3I9V 1;  4IM3 A;  1PGX A;  2AQ3 B;  1NI3 A;  3Q8B A;  3ZNG C;  2MRP A;  1ISN A;  3AH7 A;  3HIZ A;  1CQV A;  1I4R A;  2L0F A;  3SR6 A;  2QIL A;  1EU4 A;  2BT6 A;  1R4M B;  3ZGZ A;  3CWI A;  3QA8 A;  1XCT L;  4ICU A;  4ITK A;  4REZ A;  1WX7 A;  2KN5 A;  2WS3 B;  1GPX A;  1V80 A;  4E71 A;  4TQ1 A;  2CU1 A;  3LXF A;  2EKI A;  3I5J C;  5D94 A;  2BWF A;  3H7S A;  3NVW A;  4RCO A;  2BKF A;  1I42 A;  1LO5 D;  4WJQ A;  1J7C A;  3ENE A;  4B0E A;  4DHZ B;  4YTN B;  1QF6 A;  5DCN A;  1IBX A;  2I1K A;  5BYS A;  1NEK B;  2MBO A;  3DBL I;  3OJ4 B;  4BBN C;  1FCC C;  2WP9 B;  1WR1 A;  3VXW A;  4OZA A;  3NOB A;  4BFR A;  2V1Y A;  2KVZ A;  1F0Z A;  2KLG A;  2DAF A;  3RUI B;  2BBC A;  2DX5 B;  4MGY E;  1N6Z A;  3UI3 A;  4ZHP A;  1HQR D;  3AU5 A;  4W9L A;  3J9C A;  4LLG M;  3AE4 B;  4I6P A;  3RUL A;  5BMH A;  4YTP B;  1I4H A;  1ENF A;  4K81 A;  3BY4 B;  3ZJV A;  4XDD A;  1WZ3 A;  4HLE A;  3KUC B;  3JSV A;  4XDC A;  1ZDV A;  2NTT A;  1SBB B;  5EE9 A;  2MH7 A;  5DPS A;  2RPQ A;  2WXK A;  1HTQ A;  4LNO A;  1ZDX A;  3O65 B;  5CTR C;  1ZOY B;  2D07 B;  3Q3O C;  2QC8 A;  3RYT A;  3RZW C;  4IW0 A;  4WJP A;  1ZUD 2;  3VTU A;  3UGB B;  5CX3 A;  3PO0 A;  4J6I A;  4M0W A;  5FKA C;  1WXQ A;  4WWN A;  2FCM A;  2L0T A;  4FA6 A;  4E74 A;  1L6U A;  4A3P A;  2LUE A;  4C56 C;  2BYT A;  2YLM A;  3UQA A;  3L4P A;  2MHJ A;  2IO2 B;  3EGR A;  1SJE D;  3KYD D;  3GZN B;  2W55 A;  4L1B A;  1VRA B;  2GBK A;  1OGW A;  3BWU D;  3Q69 A;  3W1S C;  3WAN A;  5JZE B;  2Y3A A;  4KV2 A;  1L7Y A;  3IT6 B;  4MT5 A;  4HDQ A;  1WGG A;  4TQ0 A;  4JWU C;  4RGM A;  1YQ4 B;  1BXT A;  5C3J B;  4GU2 A;  3T3N A;  2BW2 A;  1ET9 A;  4ZRJ A;  1QOF A;  5C2T B;  1WE6 A;  4YTM B;  1MG4 A;  4A8X C;  1TY2 A;  2G3Q B;  2N9X A;  5AUI A;  2WU2 B;  2DYM A;  4XYC A;  3WAO A;  3U2S C;  4HEA 1;  4HKQ A;  1P7E A;  4H2A A;  1SIJ A;  2EMS A;  2MP2 B;  4HXD A;  3H6N A;  2KMC A;  1C78 A;  3JW0 X;  2Y5B B;  1FFU A;  2DHZ A;  4WJN A;  1YD8 U;  4W9J A;  3EFC A;  2WLB A;  3ZNI D;  1OQR A;  2L52 A;  3M62 B;  2W82 A;  2LHE A;  2G4S A;  1D4B A;  1UUP A;  5HI1 A;  3RPF C;  1T0S C;  1WXM A;  5IOI A;  2J4X A;  2LD9 A;  4B6W A;  3AV8 A;  3VH3 B;  2XEW A;  2V9H A;  1DOX A;  1WWT A;  4TSS A;  4IM0 A;  5BYR A;  2HJ8 A;  1TY0 A;  3FIL A;  3AEE B;  4C7Y A;  1L4Z B;  1Z5S B;  1ZPS A;  1LQB A;  4P16 A;  2M0A A;  2WDV B;  5IA7 A;  3DHG C;  5J2R A;  2KDF B;  5EE1 A;  3L08 A;  1ZXI A;  2K6Q A;  4W9E A;  1HTO A;  4FN2 A;  1YX6 B;  1L0V B;  2UU7 A;  3AN1 A;  2WGS A;  3DWG C;  1JRU A;  1FFV A;  2KQ7 A;  1RM6 C;  4JX1 C;  4NJ7 A;  3AEB B;  1GAQ B;  1XLQ A;  3AMZ A;  3P42 A;  3SU8 X;  2MA9 B;  5LNK 1;  4WH4 A;  1C79 A;  2PVO D;  3QCA A;  1D3Z A;  1KH0 A;  2JPH A;  3Q3F A;  2FCN A;  2D10 A;  3DBS A;  4W9G A;  1N62 A;  3DHI C;  3QWZ B;  2J0K A;  4YWG G;  2FUG 1;  3LB8 C;  4LCD E;  1UBQ A;  1F77 A;  2KDE B;  2N9P C;  1N60 A;  1EM7 A;  1SE9 A;  3OJ3 A;  2XK5 B;  1WXA A;  4NPN A;  2HJ1 A;  2KMM A;  2BYV E;  2LGX A;  3APF A;  4NJ6 A;  4KVG B;  5AZH A;  4NAW A;  4BOS C;  1ET6 A;  3R3M A;  2QCZ A;  2J52 A;  1WIA A;  2KX3 A;  2GLS A;  1J7B A;  4QAY A;  4XWW A;  3TEY A;  3AEF B;  1E8Z A;  2MSE D;  2PEA A;  2RMM A;  5CHF A;  4B9K A;  4W9D A;  2HE7 A;  4LDT D;  5BMI A;  2O6V A;  4LNN A;  3ZYY X;  1YNT E;  2KMA A;  2NR2 A;  1D5M C;  4F1S A;  1JWB D;  4FAD A;  1JWS D;  1P0R A;  1WJ6 A;  2MBB B;  5FK9 C;  2LRU A;  5JXV A;  4PS7 A;  1I4P A;  1XQQ A;  2WDQ B;  1P3Q U;  2WXG A;  3IBE A;  3M95 A;  2QJL A;  3WAP A;  1E7U A;  2D3A A;  4XZ4 A;  2AEH A;  1PFD A;  2G9H D;  2XNA C;  3V60 A;  1YN4 A;  3PZ8 A;  3AEC B;  1VJK A;  2KJH B;  1GB1 A;  1V6E A;  3PVL A;  1XLP A;  4RF1 A;  4RF0 A;  4O1N A;  3PRZ A;  3A4R A;  4J3O D;  1C1Y B;  2BYE A;  2KC2 A;  1ZP0 B;  2JZ3 B;  1EF1 A;  4HCN B;  3Q3N C;  1YQ3 B;  2N9L A;  4Q2J A;  2LVO A;  4X57 B;  3A9K A;  3SFD B;  1CZP A;  3Q14 C;  4AOF A;  2KK8 A;  4A20 A;  1GNU A;  1SJH D;  1EUV B;  3QAR A;  5D3I B;  3C8Y A;  4YXD B;  1E8X A;  4JIO U;  1WY8 A;  2KAJ A;  3B2F A;  1UWM A;  4LJP B;  4C80 A;  1QOG A;  2D3B A;  4DXA B;  1C77 A;  4IKG A;  2WDR B;  5G55 A;  4ZRK A;  2W9N A;  2OOB B;  1J19 A;  2ONQ A;  5LXH A;  2K39 A;  1QLB B;  3QJZ A;  1WRI A;  3ZRF A;  2AL3 A;  1VZ8 A;  1E7P B;  2BWE S;  2ZPY A;  2K5P A;  2ZVN A;  5TSS A;  2W3R A;  5G5H A;  1AN8 A;  4NQL B;  5KHO A;  3V62 A;  2INN E;  2ZCC A;  4OW0 A;  2IO0 B;  3FIL B;  4YSY B;  2JXT A;  1TIF A;  4WWO A;  4IWP A;  2FIF A;  1WGY A;  1KRH A;  2CJN A;  2JWZ A;  4G50 A;  1FXA A;  2FNJ B;  1KLV A;  1QKZ A;  2L8J A;  3NVV A;  2AL6 A;  3Q3M C;  1V2Y A;  1K8R B;  2KX0 A;  5E6O A;  1D6E C;  2WXL A;  3K9O B;  2I38 A;  3ECI A;  4HJK A;  1L0X B;  4MEM A;  2L05 A;  1WX9 A;  3VTV A;  3X23 A;  2JWU A;  4RGO S;  3VFK A;  2WXI A;  1UWX A;  4M02 A;  4GB9 A;  2NBU A;  5J17 A;  1TS5 A;  1R7S A;  1WZ0 A;  5IKC M;  1IGC A;  3V61 A;  3ZLZ A;  4DXF A;  1WGR A;  3ZRC A;  4FJY A;  3GB1 A;  5JH5 C;  1TBE A;  3DOW A;  4LNF A;  4L23 A;  2K1F A;  3H7P A;  1IYF A;  2KAN A;  4K3B A;  4G0N B;  1J8C A;  2PJH A;  2KOX A;  1T0R C;  1V5T A;  3AE6 B;  4KIK A;  2EMT A;  1JML A;  3Q6B A;  4MSM B;  4RM9 A;  4F8C B;  5GMV A;  2KLC A;  1OEY A;  1HXY D;  3L13 A;  2KT7 A;  3BYY B;  2Z8L A;  2G4D B;  2L76 A;  4NAW B;  1XXG A;  2NPT A;  2KJR A;  3KQ4 A;  4KZ0 A;  5MPO A;  5JHB A;  1B1Z A;  2PMV A;  1F52 A;  3DBH B;  5HG2 A;  2LAS A;  4PYU A;  5BMG A;  1BML C;  4NZL B;  2ZPN A;  3EUB 2;  3AE1 B;  3JVZ X;  3ONS A;  3DWM A;  5LXI B;  3IXS A;  3UF8 A;  1K53 A;  1E8Y A;  2VH1 A;  3NS1 A;  4DDI D;  1K52 A;  1QOB A;  1DGJ A;  3GE3 C;  2CHX A;  1EWC A;  1FXT B;  1NYQ A;  4NJC A;  2WXH A;  3N1X C;  2TSS A;  2FCQ A;  1EO6 A;  2ZW1 A;  3D32 A;  3W5V B;  4KGR A;  5D2M B;  3RI7 C;  1P9D U;  5G5G A;  2VH2 A;  1WRD B;  1MI0 A;  2J0M A;  1UEL A;  4KKJ A;  2V4I B;  1D5Z C;  3CIR B;  1Q1O A;  3NZS A;  2J42 A;  4FLH A;  2LZ6 A;  3Q8C A;  3W9C B;  2YEP B;  2WQY B;  1YOV B;  1KLU D;  3I3T B;  1E8W A;  4TKN A;  1XO3 A; 
#chains in the Genus database with same CATH homology
 1BT0 A;  1RLF A;  4IG7 B;  4W9J A;  1P1A A;  4BKS D;  3VUY A;  4HDO A;  2K8H A;  2HD5 B;  3PRP B;  3ZNI D;  2AWT A;  2L00 B;  3M62 B;  4GXB A;  4IWO A;  3PZD A;  2NBW B;  1UH6 A;  3L0W B;  4ZDV A;  2LGY A;  2G4S A;  5DPR A;  1MG8 A;  2C5L C;  2LVQ A;  3TMP B;  3IFW B;  2O2V A;  3N30 A;  1WXM A;  2K25 A;  4NQK E;  4KZC A;  1V5O A;  1WFY A;  2ZEQ A;  2IYD B;  4EFO A;  2C7M B;  1ZW7 A;  2C9W B;  2DZI A;  2GBN A;  2JZZ A;  2KDI A;  2LD9 A;  2O6V D;  4ASW C;  4B6W A;  5KHQ A;  1QZE A;  4EEW A;  4ANU A;  1ZGU B;  3VH3 B;  2XEW A;  2BKR B;  2MBH A;  3DBR I;  4MJS A;  3ZVV A;  3PTF C;  4M8N A;  3NHE B;  1NBF C;  4CO7 A;  4IM0 A;  1S3S G;  2HJ8 A;  3QQ8 B;  1VD2 A;  1WX8 A;  1Z5S B;  2LXA A;  3GZN I;  4A3O A;  4F7Z A;  3LJ3 A;  1LQB A;  2N1W A;  1SGH A;  3ZKJ C;  5IA7 A;  2EKE C;  2MP2 A;  2NCN A;  3R66 C;  5J2R A;  2RSU A;  4HK2 A;  2KDF B;  2C7N B;  3HHM A;  2Z0D B;  2JXX A;  3L08 A;  2K6Q A;  4GDK B;  4W9E A;  2MBE A;  4FN2 A;  3DBH I;  4PS3 A;  1GUA B;  2KVR A;  3UIO B;  3DQV A;  3P2B A;  1YX6 B;  3R7R A;  4EZL A;  3APD A;  4W9H A;  2M17 A;  4I6N B;  4GSW A;  3IG3 A;  2IO3 B;  2FCS A;  4FBJ B;  1JRU A;  2IBI B;  4RMA A;  2RD0 A;  3T8M A;  2MW5 A;  2KQ7 A;  4ANW A;  3KYC D;  4NJ7 A;  3RD2 A;  3UIN B;  5EDS A;  4LDT B;  3SU8 X;  3A33 B;  2MA9 B;  2N7E A;  2WDT B;  3WIM A;  3A1Q B;  2B3A A;  4NY0 A;  1LXD A;  2I1J A;  3R7Q A;  3ML8 A;  5AEK B;  2KC1 A;  4AP4 C;  1ZKH A;  1HE8 A;  4HCP B;  3QCA A;  1D3Z A;  3UIP B;  2JPH A;  3SDL C;  3ZW3 A;  4MH0 E;  3Q3F A;  4LJO B;  2FCN A;  2D10 A;  4ZYN A;  3DBS A;  3CST A;  4K1R B;  2JT4 B;  4PYZ A;  3VAW A;  1T0Y A;  4W9G A;  3ZDM C;  2BF8 B;  4EOY A;  4BVU C;  2KFK A;  3QWZ B;  2O6V B;  2UWQ A;  2J0K A;  5AZF A;  3VH4 B;  1OQY A;  3KUZ A;  4GDL B;  4JQW C;  4LCD E;  2DZM A;  1UBQ A;  3DCG A;  3QHT A;  3RCZ A;  2KDE B;  1WYW B;  2N9P C;  3APC A;  4URK A;  4K7U A;  3L54 A;  3PRM B;  4MM3 A;  3VVW B;  1SE9 A;  3OJ3 A;  1WI0 A;  4IUM B;  2XK5 B;  4AJW A;  1WXA A;  4NPN A;  3TCA A;  3ZDT A;  3CMM B;  4EZK A;  3MHS D;  1WM3 A;  4ANX A;  2M1M A;  2BYV E;  3ZTD A;  2LGX A;  1YJ1 A;  3APF A;  1U4A A;  3MJW A;  1V9J A;  1WGD A;  3MTN B;  3ZO5 B;  4FHJ A;  4NJ6 A;  4G11 A;  2FAZ A;  3L16 A;  4JGH B;  2WWZ A;  4IWQ A;  1WJ4 A;  2LWP A;  2ZCB A;  5LLI A;  3S2A A;  1XT9 B;  3HM3 A;  4KVG B;  4N9F 4;  2DZK A;  2ZJD A;  2CHW A;  4NAW A;  5AZH A;  4BKS A;  4BOS C;  2XBB C;  3DPD A;  2LRW A;  4DWF A;  3A1Q A;  1GC6 A;  3R3M A;  2PE9 A;  5D7G A;  1WIA A;  2J7Q B;  4KSK C;  2KX3 A;  3LDZ E;  4HPM B;  4EZJ A;  1E8Z A;  1S1Q B;  2MSE D;  2PEA A;  3DVG Y;  3VUX A;  4DHJ B;  3N32 A;  2KWU B;  2M0X A;  4PS8 A;  2DZJ A;  5TR5 A;  1IP9 A;  1IPG A;  4B9K A;  5CHF A;  4W9D A;  2HE7 A;  3V6E B;  3QX1 A;  3A9J B;  3ZTC A;  4LDT D;  4GGQ A;  5DPT A;  3PLU A;  4HVB A;  5CHV C;  3QIJ A;  2O6V A;  2DYO A;  5L83 A;  1M94 A;  3KUD B;  1RFA A;  3H7P B;  1SIF A;  3B08 A;  4MDK E;  4MGZ E;  2KMA A;  2NR2 A;  5G2N A;  3EHV A;  3PLV A;  2KNB A;  2GMI C;  4W9I A;  4F1S A;  3TIX A;  4II2 B;  3WAM A;  2LI5 A;  2MLB A;  1WMH A;  2XK5 A;  1G6J A;  4FAD A;  2JY6 A;  1AAR A;  1UGM A;  4K7S A;  5AZG A;  2CHZ A;  1I35 A;  3VTW A;  1KM7 A;  1XD3 B;  2UYZ B;  1P0R A;  1WJ6 A;  2MBB B;  3TJP A;  2LRU A;  4PS7 A;  3DDC B;  3PS6 A;  2KKC A;  2LXC A;  3KH0 A;  1XQQ A;  5IAA C;  3A9K B;  1LFD A;  5CHW A;  3QC8 B;  4MEL A;  1P3Q U;  4WWP A;  3IBE A;  2IY1 B;  1WXS A;  3M95 A;  3B1L X;  3WAP A;  2NPT B;  3EC8 A;  3PHX B;  2KFJ A;  1KJT A;  3H1U A;  2KHW B;  4TUU A;  4AJY B;  4XX5 A;  2KTR A;  1E7U A;  1R4N I;  4XZ4 A;  3L17 A;  2WX1 A;  3HK0 A;  4W9F A;  2DAJ A;  2AEH A;  2C7H A;  2AYO B;  4FUL A;  3L10 B;  1E90 A;  1WJN A;  3PPA A;  3QAQ A;  3V60 A;  3M3J A;  2CKH B;  2Z59 B;  1GC7 A;  1WH3 A;  2D11 A;  3A9J A;  2IO1 B;  1Q5W B;  2V4L A;  2IY0 B;  2KJH B;  2K6D B;  3CSF A;  3IVF A;  1V6E A;  3PVL A;  2JRH A;  3GOE A;  2BPS A;  4MGI E;  4W9C A;  4BOZ B;  3DVN U;  1NDD A;  3PRZ A;  2L3Z A;  3PRE A;  4KDI C;  1KOT A;  3A4R A;  2FID A;  2LVP A;  3AXC A;  4DHJ D;  3BIN A;  4IM3 A;  4KSL C;  1C1Y B;  2BYE A;  2KC2 A;  2JZ3 B;  1EF1 A;  4HCN B;  4BBN F;  3ZNZ B;  3ZNG C;  3CF6 E;  2MRP A;  2LVO A;  1V81 A;  5JHA A;  3VDZ A;  2A4Z A;  4P7I A;  1A5R A;  1VCB A;  2VRR B;  3M63 B;  3U8Z A;  2IZV B;  4X57 B;  3AUL A;  4ICV A;  1ISN A;  2NVU I;  3VHT C;  4FJZ A;  3A9K A;  4OVU A;  3HIZ A;  2L0F A;  2ZNV B;  1H8C A;  4AOF A;  2KK8 A;  1NI2 A;  4A20 A;  1GNU A;  3TL5 A;  3UQB A;  4W9K A;  1F9J A;  1EUV B;  3QAR A;  1GJZ A;  2M4N A;  2N4F A;  3QA8 A;  2CR5 A;  4ICU A;  1WX7 A;  1E8X A;  2KN5 A;  3H9D A;  4JIO U;  1V80 A;  3W1Y A;  1WY8 A;  5FR6 A;  4TQ1 A;  4E71 A;  2CU1 A;  4MSQ B;  3ZUN A;  3IHP C;  4GDK A;  4LJP B;  2D3G A;  5D6J B;  5D94 A;  2BWF A;  4TV3 A;  3H7S A;  4DXA B;  2DYB A;  4M8M A;  4JL9 A;  2BKF A;  5G55 A;  4ZRK A;  2W9N A;  1I42 A;  2V3S A;  5E6N A;  4WJQ A;  1OTR B;  2KDB A;  2OOB B;  1WXV A;  1J19 A;  4AWJ A;  5LXH A;  3ENE A;  3NS8 A;  3OAW A;  2K39 A;  4DHZ B;  2ASQ A;  5DCN A;  2I1K A;  3QJZ A;  3RZF A;  2MBO A;  3ZRF A;  4ANV A;  4CHK A;  3B0A A;  3JSV B;  3ZIM A;  3DBL I;  2AL3 A;  2O2V B;  3OJ4 B;  4DK5 A;  1WF9 A;  2K8B A;  3A4S C;  4BBN C;  2BWE S;  1C3T A;  3X0W A;  1TGZ B;  2ZPY A;  2ZVN A;  3WAL A;  1WR1 A;  1V86 A;  3VXW A;  2KD0 A;  4GMV A;  3NOB A;  4NQL B;  5KHO A;  3V62 A;  4BFR A;  2ZCC A;  2L7R A;  1UD7 A;  2V1Y A;  3DVN V;  4MJS B;  3PGE A;  2KLG A;  2DAF A;  3RUI B;  2IO0 B;  4RM8 A;  2KJ6 A;  3HM6 X;  2DX5 B;  4MGY E;  2GBR A;  4GDL A;  1CMX B;  4WWO A;  4XC2 A;  4E3C A;  4IWP A;  2FIF A;  1WGY A;  4DDG D;  2G45 B;  2R2O A;  3EFU A;  2JWZ A;  4G50 A;  4M0W B;  5E6P A;  4OVV A;  1WR6 E;  2FNJ B;  3AU5 A;  4W9L A;  1KLV A;  2L8J A;  1WJU A;  4IM2 A;  2OJR A;  4KIK B;  2AL6 A;  3W1S A;  4EKU A;  3OLM D;  2D2Q A;  4I6P A;  1V2Y A;  4HPL B;  2QHO A;  1K8R B;  2KX0 A;  5E6O A;  3RUL A;  2DEN B;  2JF5 A;  3K9O B;  3QK0 A;  4HJK A;  3ECI A;  4K81 A;  3BY4 B;  4EUT A;  5C1Z A;  4MEM A;  1WZ3 A;  2L05 A;  1WX9 A;  3VTV A;  4HLE A;  2R2Q A;  3X23 A;  2GBM A;  3KUC B;  3T9L A;  5J18 A;  2BYF A;  3JSV A;  3VFK A;  3WA0 A;  2GBJ A;  4GB9 A;  4DBG A;  2NBU A;  2ZZP B;  3PSE B;  3PV1 A;  5DPS A;  5J17 A;  2RPQ A;  1L2N A;  3SHQ A;  3JYU A;  3U30 A;  2LJ5 A;  1WZ0 A;  2JUO A;  3O65 B;  5CTR C;  3ALB A;  3V61 A;  3ZLZ A;  4BKG A;  2D07 B;  1OEY J;  2RR9 A;  3RYT A;  1TTN A;  3RZW C;  2KXJ A;  4IW0 A;  4WJP A;  4AUQ C;  1WGR A;  3DVG X;  3VTU A;  3ZRC A;  4FJY A;  3PT2 B;  1E5W A;  2KFK B;  3KW5 B;  5JH5 C;  1TBE A;  3UGB B;  5CX3 A;  3DOW A;  1R4M I;  4GOC A;  2K1F A;  1Q0W B;  3H7P A;  4GIV A;  4II3 B;  3SD5 A;  1IYF A;  1Z2M A;  2KAN A;  2KTF A;  4G0N B;  4J6I A;  4DHZ E;  2N9E B;  2N1V A;  4WJO A;  1J8C A;  2PJH A;  2KWV B;  4WWN A;  2FCM A;  2L0T A;  3TBL D;  2MQJ A;  2KOX A;  4E74 A;  4FA6 A;  1V5T A;  2MBQ A;  4KIK A;  4A3P A;  2EMT A;  2PPH A;  2LUE A;  1RRB A;  4MSM B;  3ML9 A;  4RM9 A;  4F8C B;  5GMV A;  4FHK A;  3RT3 B;  2ZNV C;  2KLC A;  1GG3 A;  1OEY A;  4B95 A;  2YLM A;  3L13 A;  1WM2 A;  2KWC A;  3UQA A;  2IO2 B;  1EF5 A;  1X1M A;  2G4D B;  2L76 A;  1YIW A;  3KYD D;  2KQS A;  4NAW B;  2NPT A;  4HWI B;  2JRI B;  2KJR A;  3AI5 A;  4MGK E;  4KZ0 A;  4NNJ B;  1PQS A;  4YL8 A;  1Y8R C;  4WAA A;  5JHB A;  2LGD A;  2GBK A;  1OGW A;  2A5U A;  3KVF B;  3NZU A;  1H4R A;  2NBV B;  2CS4 A;  3W1S C;  4I6L B;  3WAN A;  1UBI A;  5JZE B;  2Z0E B;  1RAX A;  4KV2 A;  2LAS A;  4PYU A;  1L7Y A;  2JVC A;  4WQO B;  2ZPN A;  3K9P B;  5DPW A;  3JVZ X;  4K7W A;  3ONS A;  4HDQ A;  2GOW A;  5LXI B;  1WGG A;  3V6C B;  4TQ0 A;  1YX5 B;  2M8S A;  1LM8 B;  3UF8 A;  2MWS B;  1E8Y A;  2WYQ A;  4GU2 A;  1UZX B;  5C23 A;  3VQI A;  4DDI D;  4FJV B;  1WGH A;  3AU4 A;  2CHX A;  4CYE A;  5HKH A;  4ZRI A;  1YQB A;  3C0R B;  4ZRJ A;  1FXT B;  3ZNH B;  2ZVO A;  5L95 C;  1WE6 A;  2KZR A;  2YVC A;  2NS5 A;  4G3X B;  1WMH B;  2FCQ A;  2KO3 A;  1EO6 A;  2N7D A;  3Q3J A;  2BGF A;  1P98 A;  3D32 A;  2G3Q B;  3VUW A;  2N9X A;  2MX2 A;  5D2M B;  2K8C A;  2DYM A;  4IC7 B;  2WX0 A;  1P9D U;  4KDL B;  3WAO A;  1WRD B;  3EEC A;  2RGF A;  2J0M A;  1UEL A;  4JLC A;  4BKT A;  1WE7 A;  3NY5 A;  2C60 A;  1Q1O A;  2FUH B;  3NZS A;  4FLH A;  2KTR B;  4GN1 A;  1E7V A;  2LZ6 A;  1TZ1 A;  2EMS A;  2HTH A;  1V49 A;  2MP2 B;  2J0J A;  4HXD A;  3H6N A;  2KMC A;  2REX A;  3N3K B;  2PE6 B;  3I3T B;  1J0G A;  3JW0 X;  2Y5B B;  5BO4 B;  3U7D A;  1E8W A;  2DHZ A;  4WJN A;  4TKN A;  2MCN B;  3PHW B;  1YD8 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...