4B6WA

Architecture of trypanosoma brucei tubulin-binding cofactor b
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
86
structure length
86
Chain Sequence
SVVKVSLTHSASRMRVPEKRYGLAQTIESIKENVFTHFATPPEYMQLQLIDDRGITIEKNMANDKQLGYYQCRDEFVIHVVDLQPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Architecture of Trypanosoma Brucei Tubulin-Binding Cofactor B and Implications for Function.
pubmed doi rcsb
source organism Trypanosoma brucei brucei strain 927/4 gutat10.1
molecule tags Chaperone
molecule keywords TUBULIN-SPECIFIC CHAPERONE
total genus 21
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2012-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4b6wA00
2KJRA 1UBQA 3QIJA 4XX5A 2EKEC 2M17A 1WE6A 3L0WB 3OJ3A 3QJZA 5CHFA 2G45B 4KV2A 2KMCA 2KVRA 3PRPB 3H7PB 2DZKA 2JRIB 3TBLD 1GC7A 3ZIMA 4HVBA 3V61A 3Q3FA 4DDID 1WXMA 2M1MA 2BYVE 3RD2A 2IO2B 4WWOA 1J19A 2I1KA 4GDLA 1M94A 3OAWA 4WJOA 4LJOB 2D10A 2R2OA 2KFJA 4IM0A 3WALA 4DBGA 4FULA 1E8XA 2K6QA 2PE9A 2O2VA 5J17A 2LRUA 2DZMA 2G4DB 5LXIB 1OEYA 3KVFB 3RYTA 5IA7A 5JHAA 1H8CA 2G3QB 2J0KA 3KUDB 3UF8A 1KM7A 1E8YA 1XQQA 4TQ1A 3HIZA 5D7GA 5BO4B 3T8MA 2V3SA 4AP4C 2CU1A 3PREA 4GOCA 3V60A 2DENB 3DDCB 4EFOA 4LDTD 1V9JA 3RCZA 4RM8A 3ZLZA 4E74A 1ISNA 4PS7A 3RT3B 4GMVA 1WM3A 2L0TA 3A4RA 4GSWA 1GG3A 2CHWA 2DX5B 4F8CB 3ML9A 2UYZB 1GUAB 2KQ7A 1IP9A 4ICVA 4HWIB 4PS8A 2N7DA 1WR6E 2GBKA 2BYFA 2GMIC 2IO0B 2BGFA 2XEWA 2FCMA 2BKRB 3KUCB 3MJWA 4WJQA 3KUZA 4YL8A 3VTVA 2KTRA 1Y8RC 1I35A 2K39A 2NCNA 3ONSA 4J6IA 1WM2A 2W9NA 4NPNA 3VUYA 2FIDA 3ZUNA 3M63B 3L10B 4BBNF 3VQIA 4KIKA 2RSUA 1EO6A 1MG8A 2LVPA 1UZXB 5DPWA 3VUXA 4PYZA 1WGGA 2JVCA 1G6JA 2DAFA 3TJPA 3KW5B 3PV1A 4CYEA 4DHZB 4W9HA 2ZVOA 4G3XB 5E6OA 1C1YB 2KHWB 2NR2A 3DPDA 4ICUA 4W9EA 3X0WA 2FCSA 2D2QA 2QHOA 3GOEA 3UINB 3NS8A 4K7SA 2KDBA 3PTFC 3MHSD 3PRMB 3ZNID 3V6CB 3RULA 3L13A 2GOWA 4AOFA 2KMAA 5IAAC 2K8CA 4A20A 1I42A 2JY6A 3BINA 4DWFA 1WXVA 2JT4B 3EHVA 2JWZA 2N7EA 2LASA 4HPMB 1WJ4A 3H1UA 5KHOA 4DHJB 2ZNVB 3R3MA 4MSQB 4HPLB 3L54A 4W9DA 2ZVNA 1E90A 1ZGUB 3V62A 4FJZA 3ZNHB 1WGYA 2L0FA 2NPTB 4MGIE 4BOZB 2RR9A 2WYQA 1GJZA 3JVZX 2IYDB 2AWTA 2KK8A 3NOBA 2A5UA 2J7QB 5TR5A 3BY4B 4GN1A 2G4SA 3APCA 1WXAA 1WMHB 3WA0A 2LUEA 2LRWA 2LVQA 3QK0A 4JL9A 4LJPB 1WE7A 1VCBA 2UWQA 2XK5A 4PYUA 1RRBA 3QARA 4MGZE 4W9KA 5CTRC 2BF8B 3TL5A 1OGWA 2HTHA 1WZ0A 3T9LA 4DHJD 2JXXA 2IY1B 3A33B 4ZRJA 5G55A 1E5WA 4GB9A 2LXCA 5JHBA 3SHQA 2REXA 1GNUA 1P0RA 4GDKA 4EZJA 3DVGX 4JLCA 1FXTB 3JSVB 4MGKE 2M0XA 3PRZA 4AWJA 2KLGA 4OVUA 4W9GA 4X57B 1L7YA 2C7HA 3ZDMC 3ZNZB 4KSLC 3A4SC 3W1SC 1LM8B 3NY5A 4FBJB 2RD0A 4EZKA 3A9JA 2KC2A 4FHKA 2AL6A 1WR1A 3QHTA 4NAWB 2DHZA 3EC8A 3PPAA 3VH3B 3VDZA 3ZRFA 4HLEA 1SIFA 1YX6B 3NZUA 1SGHA 3WAMA 5G2NA 2OOBB 1E7VA 4IM2A 3CSTA 2FNJB 2MQJA 4KSKC 4TQ0A 5CHVC 4ANXA 2BWFA 3OLMD 3ENEA 4WAAA 2Y5BB 4CO7A 5EDSA 3ZNGC 1V6EA 1K8RB 3KH0A 3AULA 1OQYA 2FAZA 1WJ6A 1UELA 1VD2A 2KD0A 4FADA 2DZJA 1SE9A 3SDLC 4TV3A 5J18A 2WDTB 4AUQC 1V80A 4KDLB 3PHWB 1Q5WB 1P9DU 2FUHB 4RM9A 1KJTA 4MEMA 3HK0A 2EMTA 2MBEA 3DVNV 3I3TB 4MELA 1X1MA 4URKA 2NPTA 2JUOA 3EECA 1EF1A 1YD8U 3N32A 3N30A 3TCAA 4CHKA 4K7UA 3EFUA 2DYOA 3PLVA 4MH0E 1WGDA 4FJYA 3U8ZA 4HCNB 3HM3A 2MBBB 3M3JA 4FA6A 2YVCA 3UIOB 2L8JA 4F1SA 1NDDA 4F7ZA 4G50A 1CMXB 4EOYA 1WFYA 3DBRI 4NNJB 4AJWA 3QWZB 1A5RA 2C7NB 2KZRA 2HE7A 3KYDD 4G0NB 2N9EB 3PS6A 4M8MA 4GU2A 1UBIA 1V5TA 3IHPC 2ASQA 2MRPA 1WMHA 2AEHA 2JZZA 1S1QB 1WYWB 2PJHA 3Q3JA 1YIWA 2BWES 2CHZA 5DPSA 3H7PA 3X23A 4IW0A 5KHQA 4AJYB 3ZDTA 2K6DB 1RAXA 3AU4A 4NQLB 3L16A 3KYCD 3WAOA 5FR6A 3DBSA 4JIOU 2ZEQA 4HXDA 3CMMB 2KX0A 2L7RA 2LVOA 5C23A 3QQ8B 2V4LA 3QC8B 2WX0A 3P2BA 2NVUI 3HHMA 1LQBA 1WX9A 2HD5B 2IO1B 4M0WB 1RLFA 2J0MA 3ZW3A 3SU8X 2KDEB 5E6PA 1Q0WB 1AARA 2DYMA 5GMVA 1U4AA 5HKHA 2AYOB 2O6VA 5DPTA 5D94A 5AZHA 3VUWA 3C0RB 2KNBA 1Z2MA 2GBJA 4IUMB 3APDA 3H6NA 4JGHB 4XZ4A 2IBIB 3H9DA 4MM3A 4WWNA 1PQSA 2RGFA 4KIKB 3GZNI 5JH5C 4ASWC 2MBHA 4GDLB 2O6VD 2MP2B 2KC1A 2WX1A 3A9KB 3B1LX 2M8SA 4IC7B 3TIXA 2KFKA 2ZZPB 2KDFB 3A1QB 3WANA 3ECIA 1J8CA 1BT0A 2D3GA 4JQWC 1RFAA 3S2AA 4KDIC 2JPHA 2BKFA 2ZCCA 2KN5A 2NBVB 3DBLI 2MX2A 2N9XA 4ZRKA 2KXJA 4II2B 3B08A 2BYEA 1C3TA 2JF5A 2K8HA 3VVWB 4BBNC 1HE8A 3IBEA 4K81A 3RZWC 2LJ5A 3ML8A 2KDIA 3NZSA 2KANA 1WGRA 2O2VB 2L76A 3NHEB 1P3QU 4KVGB 2KTFA 3UQBA 4MGYE 1V2YA 1Q1OA 1KOTA 2GBMA 2XK5B 1D3ZA 1WY8A 3N3KB 1OTRB 2KOXA 2OJRA 2Z0DB 3QX1A 4ANVA 1V86A 5L95C 4K1RB 3ZTCA 5J2RA 4I6LB 1T0YA 1WIAA 4W9JA 4M8NA 4E3CA 4GXBA 1YX5B 2KJHB 1QZEA 2K1FA 2LD9A 2FCNA 3AU5A 2K25A 2ZJDA 1NI2A 4WJNA 3W1SA 1H4RA 1EF5A 5C1ZA 4B9KA 1NBFC 3R7QA 4EEWA 2MSED 5DPRA 2O6VB 4BOSC 2N4FA 4MJSB 2KFKB 2KWCA 4WQOB 2C60A 4B95A 2RPQA 4DXAB 2I1JA 1ZKHA 3M62B 5JZEB 3DOWA 4HCPB 2IZVB 5LLIA 3IFWB 1TGZB 4DK5A 3DCGA 3WIMA 1UD7A 2C9WB 2C7MB 3K9PB 3LJ3A 4WWPA 4ZDVA 4NJ7A 4IWPA 4HDQA 2CHXA 2KTRB 2KKCA 4RMAA 4XC2A 3U7DA 2PE6B 4NJ6A 2GBNA 2FIFA 2ZNVC 2ZPNA 2ZPYA 3ZKJC 4IM3A 3WAPA 2ZCBA 2VRRB 1R4NI 3CSFA 4BKSA 4LDTB 3DVGY 3JSVA 2NBUA 3R7RA 4MDKE 2PEAA 1LXDA 1P1AA 3VHTC 1IYFA 4I6NB 2HJ8A 2LZ6A 2LXAA 4G11A 5DCNA 4DDGD 2PPHA 4GIVA 2C5LC 4W9CA 4ZYNA 1LFDA 3OJ4B 4NAWA 3UIPB 3ZVVA 5CHWA 3W1YA 4BKSD 2L00B 4NQKE 1V5OA 2N1VA 3ZO5B 3DBHI 2IO3B 1OEYJ 4EUTA 2D07B 2DYBA 4PS3A 2R2QA 2MLBA 1KLVA 2DZIA 4HDOA 1WGHA 3AXCA 2FCQA 2D11A 3D32A 4GGQA 4IG7B 1XD3B 5AZGA 1ZW7A 2KLCA 4W9LA 1WZ3A 4A3PA 2KJ6A 3JYUA 1WF9A 3DVNU 2LWPA 3H7SA 1YQBA 3QCAA 3M95A 1F9JA 3L08A 4FHJA 2KO3A 1E8WA 5LXHA 3APFA 4ANWA 3PHXB 2LGXA 5AZFA 2MBOA 2K8BA 4IWOA 3HM6X 5E6NA 3VAWA 3VH4B 1WRDB 2CS4A 2LGYA 2YLMA 3VTUA 3O65B 3R66C 4BKTA 3LDZE 2Z0EB 5L83A 4LCDE 2MBQA 3PZDA 4FJVB 1XT9B 1E8ZA 2LI5A 3UGBB 3ALBA 4OVVA 4IWQA 3VFKA 3VXWA 4BVUC 4DHZE 3IG3A 4GDKB 2JZ3B 3PT2B 2CKHB 4NY0A 3UQAA 2BPSA 4A3OA 1L2NA 1V81A 5D2MB 2KWVB 3A9KA 1JRUA 4MSMB 2LGDA 2V1YA 4E71A 4I6PA 4KZCA 2NBWB 3JW0X 3CF6E 2XBBC 1GC6A 2B3AA 4WJPA 2DAJA 4EZLA 3ZRCA 4MJSA 3PVLA 1TTNA 4W9IA 2KWUB 5CX3A 2MW5A 1R4MI 2N9PC 3QAQA 4HK2A 1P98A 1Z5SB 2NS5A 3L17A 4W9FA 3MTNB 3U30A 4ANUA 1TBEA 3PGEA 1EUVB 2L05A 2GBRA 3K9OB 1WJNA 3TMPB 3QA8A 2EMSA 1V49A 3VTWA 3IVFA 4BFRA 3B0AA 1WJUA 2MA9B 2L3ZA 5AEKB 4B6WA 4ZRIA 2A4ZA 2M4NA 2WWZA 3RZFA 2KQSA 4II3B 1YJ1A 4FN2A 1TZ1A 4KZ0A 3ZTDA 1IPGA 2N1WA 1WX8A 2AL3A 1WX7A 2MP2A 2IY0B 2J0JA 4K7WA 1WI0A 2MWSB 3PSEB 4HJKA 3SD5A 3DQVA 2KX3A 3A9JB 4EKUA 3AI5A 4BKGA 4P7IA 2CR5A 5D6JB 1E7UA 4TKNA 1WXSA 1UH6A 1UGMA 1J0GA 4TUUA 3V6EB 3PLUA 3RUIB 1WH3A 4N9F4 2MCNB 3A1QA 1S3SG 2Z59B 4FLHA 2JRHA
chains in the Genus database with same CATH superfamily
1J7BA 2VH1A 1NENB 2EKEC 5AUKA 1WE6A 5CHFA 3DHHC 4XWTA 1QQRA 3PRPB 4HVBA 3Q3FA 2BYVE 1XLNA 1UWXA 2I1KA 4GDLA 4LJOB 3Q2AC 4DBGA 4IM0A 4MM3B 2PE9A 1F77A 1KFYB 4L1BA 2HDEA 5LXIB 3KVFB 1H8CA 5JHAA 2J0KA 1ZDXA 5G5HA 1AN8A 2D3BA 2V3SA 4AP4C 2CU1A 4P1BC 1I4PA 1JQ4A 1SSNA 4EFOA 1V9JA 4XYCA 4RM8A 3Q8FA 3SFDB 4GMVA 1GG3A 3RPFC 2UYZB 1GUAB 4ICVA 4HWIB 3U7DA 1F1HA 3VTVA 2XEWA 2FCMA 2BKRB 4DHZE 2NCNA 1VDVA 4KKIA 1TKYA 1RYJA 4DXFA 1EO6A 2QCZA 3IT6B 1WGGA 1G6JA 2DAFA 4IOIE 3KW5B 2YEPF 4CYEA 1JWUD 2ZVOA 2BS3B 3P4RB 1HEZE 2NR2A 1MJDA 3NS8A 1TYGB 3PRMB 1QOBA 2GOWA 2KMAA 2ZW1A 2K8CA 3H1UA 4MSQB 3RNBC 1WGYA 5HI1A 2WXRA 2A5UA 2J7QB 2KMMA 2ONQA 3NG0A 2LVQA 1ET9A 4LJPB 2UWQA 1C79A 3TL5A 1OGWA 1WZ0A 3T9LA 2RDBC 2TSSA 4NJCA 4XDCA 5C2TB 2REXA 2SAKA 1N61A 4EZJA 3DVGX 4MGKE 1T0RC 2CJNA 1LM8B 4FBJB 3AE3B 1XEEA 3HVDA 1QT9A 4PK1A 1YX6B 1SGHA 3WAMA 5G2NA 3DWGC 3VRBB 3VR8B 2WXPA 3GE8C 3ZNGC 3C8YA 1V6EA 1C4CA 2KWDA 1PGBA 1SE9A 3SDLC 2W82A 5J18A 4P6VF 1P9DU 2FUHB 4MEMA 4EE2A 4WQMA 2NPTA 2JUOA 3EECA 4CHKA 1PFDA 1SBBB 2DYOA 3FAHA 3M3JA 3UIOB 2PVOD 4F1SA 2WXQA 1NDDA 1CMXB 4M8MA 4GU2A 1UBIA 2WDVB 2ASQA 2JZZA 2PJHA 1WYWB 3Q3JA 3U2SC 2MJEA 5DPSA 4ARIA 2WDRB 3ZDTA 5JXVA 1FXIA 1YMHE 3AU4A 2W55A 4HXDA 2KX0A 3Q8BA 3Q8EA 3P42A 3HHMA 3IT4B 2E6XA 5GMVA 3NVVA 2LEKA 4LNFA 2Y5CA 2BW2A 3C0RB 2KNBA 1T5XD 3HRDD 2GBJA 4IUMB 3LB8C 2IBIB 3H9DA 4WWNA 4GDLB 2MP2B 2KC1A 2M8SA 2ZZPB 4MT5A 3S2AA 2JPHA 2ZCCA 2KN5A 3P4SB 1WYGA 2MX2A 4OZBA 3U4EG 4II2B 3B08A 3TEYA 1UUPA 3ETRA 3ML8A 2KDIA 2KANA 1WGRA 1P3QU 3UQBA 2INDC 2IPKD 3N3KB 1SE4A 4ACFA 3QX1A 3W5VB 3ZTCA 5J2RA 4I6LB 1ZPSA 4M8NA 3Q3NC 1QZEA 3J9CA 5H92C 2FE8A 3EUB2 2LHDA 3R7QA 1D6EC 1Y56A 5DPRA 2LUMA 2IZVB 2RDHA 4YWGG 1UD7A 2C7MB 4ZDVA 4NJ7A 1M4VA 2WXKA 4NJ6A 2N9LA 2ZNVC 3ZKJC 4IM3A 5FKAC 1SXTA 4WURA 1R4NI 3CSFA 1TS3A 3ZJUA 2HTME 5EE0A 1FNUA 2R61A 2PEAA 2KQ4X 2SEBD 4I6NB 5MPOA 4G11A 5DCNA 4GIVA 4ZYNA 4A55A 4UDUC 4L2YA 3URYA 5IP4D 3FILA 2D07B 4HEA1 4LNNA 2L83A 1D5ZC 2MLBA 4JPSA 1WGHA 2N0SB 1ZW7A 1YN5A 1XLQA 2ICIA 4KGSA 1F9JA 5EE3A 4KGTA 5AZFA 2MBOA 2K8BA 2NMQA 3HM6X 4IWOA 4LNOA 2BYTA 1L6VA 3P63A 5AUIA 1VJKA 3PZDA 4OVVA 1JCKB 5IO9A 2M0AA 4J3OD 4NY0A 2BPSA 1L2NA 4MSMB 2K3UA 1YN4A 3SR6A 3DWMA 2INCC 4ZRQA 2XBBC 1GC6A 4WJPA 2GB1A 4MJSA 4W9IA 2WXIA 2KWUB 3DHGC 3L17A 1YJIA 1BUIC 4M02A 3K9OB 2W54A 3R2IA 1V1OA 4HROA 1FIQA 5AEKB 4B6WA 3Q8AA 2A4ZA 2WWZA 4KZ0A 1IPGA 1CZPA 5IN7A 2MP2A 2IY0B 1MVKA 3BWUD 1WI0A 3AE5B 3PSEB 4HJKA 3A9JB 4EKUA 3V05A 1FD6A 4BKGA 1SJED 2CR5A 4YSZB 2OHFA 4TUUA 4N9F4 2UU7A 1XLPA 1YQ3B 4XX5A 2M17A 2BB5A 3OJ3A 3QJZA 4JX1C 2WDQB 3WCQA 4YSXB 1FPYA 2KACA 1EWCA 4YTMB 1JW9D 3V61A 3RN9C 4NZLB 1MI0A 1WSPA 3O13A 1M94A 3OAWA 1EU3A 3Q3OC 1SF0A 1E8XA 2K6QA 2O2VA 2LRUA 1GB4A 2G4DB 1QILA 1OEYA 4RCOA 3AE8B 2H88B 3RYTA 5IA7A 2G3QB 3UF8A 1XQQA 2PLPA 3HIZA 4C00A 3N1ZC 5BO4B 4GOCA 3PREA 3I9V1 3V60A 2DENB 3DDCB 4LDTD 4E74A 1FRDA 2BBCA 2Y3AA 4GSWA 1TY0A 4F8CB 5BYRA 4N59A 5H8YE 1WR6E 2GMIC 3AE9B 1I35A 3KUZA 1DOXA 3KLSX 3VUYA 1WM2A 2W9NA 4NPNA 2FIDA 4ZRPA 3L10B 2RSUA 1MG8A 3GB1A 4PYZA 1EM7A 2DWQA 3TUOA 4KGRA 3TJPA 1B1ZA 5HG2A 2FCSA 2QHOA 3GOEA 4DXGA 2KDBA 3ZNID 3L13A 2I2YA 5IAAC 3RNAC 2VH2A 4DQOC 4A20A 1I42A 4MH8A 2G9HD 2JT4B 4WH4A 4HPMB 1WJ4A 5T8IA 1R7SA 4W9DA 2N7JA 1E90A 1T0QC 1AW7A 4FJZA 3ZNHB 4BOZB 2WYQA 2IYDB 4TSSA 2KK8A 3BY4B 4GN1A 1WXAA 2LUEA 1FO4A 2WXOA 4RGNA 4MGZE 2HTHA 4DHJD 2PKOA 2J4XA 3B2GA 4GB9A 4D2KA 4GLSC 1E6EB 3SHQA 1I4HA 3RI7C 2QIEB 3TEXA 1L4ZB 4LTUA 3JSVB 2M0XA 3PRZA 1RWSA 3RNFC 4X57B 1SJHD 1L7YA 2C7HA 1DYQA 4KSLC 3W1SC 1T6BX 3A9JA 2KC2A 4NAWB 3FKYA 1SIFA 3BYYB 1FXAA 3AE6B 2WNMA 4KSKC 4TQ0A 3Q8CA 1KLGD 4ANXA 5LNK1 3MJ5A 2BQQA 3ENEA 5EDSA 3P4PB 1UELA 1NEKB 2RPVA 2KD0A 4FADA 2WDTB 4AUQC 1V80A 2INPE 3MP9A 4RM9A 5BMIA 2WS3B 1N5WA 2QC8A 1OQQA 3N32A 2DNFA 2FBWB 4HCNB 2L8JA 4F7ZA 4G50A 1XCTL 4NNJB 1A5RA 2KZRA 2J53A 4G0NB 2LGSA 4RNAA 3IHPC 1WMHA 3NVWA 2CHZA 1QOGA 3PZ8A 3X23A 4IW0A 4A90A 3WAOA 3L16A 3KYCD 4ZHPA 3DBSA 4AQ7A 2ZEQA 2L7RA 3QQ8B 3QC8B 3RFZB 2NVUI 2MJDA 2IO1B 4M0WB 2JZPA 1RLFA 3ZW3A 5E6PA 1Q0WB 1U4AA 2O6VA 5DPTA 1ZDVA 1Z2MA 3H6NA 1VZ8A 3MC0B 3TEWA 4ZHOA 4ASWC 1MHHE 2O6VD 3B1LX 4IC7B 4RGOS 1J8CA 4P1CC 1JROA 2D3GA 4JQWC 4JWUC 1EU4A 2BKFA 3MC9A 1WXQA 4RH6A 2BYEA 1C3TA 3VVWB 4BBNC 2LJ5A 1TIFA 2QEJC 3NHEB 1MG4A 3AB5A 4KVGB 1NYRA 2BVCA 1KOTA 2GBMA 2KOXA 3OG5A 4C80A 1I4QA 2Z0DB 3VRAB 1XCQL 2DLBA 5FK9C 4W9JA 1WIAA 4GXBA 2KJHB 1ET6A 3AU5A 2JXTA 2K25A 1NI2A 4WWMA 5C1ZA 4B9KA 2V0GA 3PO0A 2L52A 4LNKA 1FCCC 2D3AA 4BOSC 1NYQA 4MJSB 2KWCA 1XXGA 5LLIA 1E9MA 5BMGA 2C9WB 4K3BA 1K50A 1KRHA 4HDQA 4RGMA 1OFFA 4XC2A 2KTRB 2KKCA 1LGRA 2XN9C 2ZPYA 2V3PA 2KYWA 2ZCBA 4OHJA 2WLBA 2NBUA 3R7RA 2AQ1B 4MDKE 1UWMA 1J7CA 3N9YC 2JSVX 1FNWA 1HXYD 2K5PA 3MFGA 1L5PA 2PPHA 4DDGD 3OJ4B 3UIPB 4LNIA 3W1YA 3NJTA 2L00B 2IDYA 4O1NA 2IO3B 1OEYJ 4EUTA 4PS3A 2R2QA 2DZIA 2D11A 4IG7B 1HZ6A 4W9LA 1HZ5A 4LLGM 1WF9A 3H7SA 1YQBA 1QKZA 3QCAA 3M95A 3NVYA 4YSYB 3DHIC 1AYFA 3VAWA 3VH4B 2BB6A 2LGYA 2YLMA 1PYWD 1KLUD 5L83A 4LCDE 3Q3MC 1E0ZA 3AE1B 1XT9B 2LI5A 4S17A 3NUHB 3VFKA 3VXWA 3IG3A 4GDKB 2JZ3B 2CKHB 3ABVB 5EE9A 1SE3A 3A9KA 3KQ4A 2LGDA 3LYYA 2V1YA 1DOYA 2DAJA 1VRAB 4N58A 1TTNA 2MW5A 4K3CA 2VZKD 2QMTA 3HVZA 2L05A 3RNGC 1WJNA 3V3XA 2V4IB 2KQSA 1YJ1A 4FN2A 4LK0M 3ZTDA 1WX7A 3RNCC 1KH0A 2MWSB 1YJJA 1UF0A 5FR3A 3DQVA 4TKNA 2MEKA 1UGMA 4JE3B 3RUIB 3VR9B 2MCNB 3VQIA 1XLOA 1S3SG 5C3JB 2JRHA 3C19A 3SEBA 1TKEA 2KJRA 3ZJTA 3QIJA 2D3CA 3L0WB 4KV2A 3H7PB 2JRIB 3ZIMA 4DDID 2M1MA 1SB3C 2KAJA 3RD2A 5EE1A 4WWOA 1J19A 5GXGB 1FFUA 2R2OA 4OZCA 4ZYSA 1JALA 5J17A 2BTEA 2K9XA 2DZMA 2N9KA 3KUDB 1KM7A 1NI3A 5I4DA 5HHDG 3PZ7A 2LHEA 2LFIA 2Q5WD 4ZOHC 1GB1A 3AEAB 2XNAC 4PS7A 4RF0A 2L0TA 3ZGZA 3AEDB 3ML9A 3IAM1 1IP9A 2KQ7A 2WXJA 2AX5A 1F2RC 2IO0B 2BYFA 4YL8A 3MJWA 3BVZA 1RM6C 3M63B 4BBNF 4KIKA 1D4BA 2LVPA 4ARCA 2JVCA 4Q2JA 4W9HA 4G3XB 5E6OA 3ZXVA 2KHWB 4W9EA 2D2QA 2AQ2B 4K7SA 3V6CB 4AOFA 2W3RA 3P1MA 3BINA 3FILB 4DWFA 1WXVA 2JWZA 2N7EA 2DBYA 5KHOA 4DHJB 1MFWA 2ZNVB 1ZUD2 2RDGA 2ZVNA 1DOIA 3AV8A 2EKIA 4MGIE 3NOBA 4AS1A 3APCA 3WA0A 2WXHA 2QDFA 2LRWA 3BYTB 4C4VB 3QK0A 4JL9A 1RRBA 3QARA 5CTRC 2BF8B 2IY1B 4ZRJA 1IBXA 1GNUA 4JLCA 1FXTB 1L4DB 5HFYA 4OVUA 4W9GA 2JQRB 3A4SC 3BK2A 1E10A 3BK1A 4EZKA 3N1YC 2DHZA 3IAS1 3PPAA 3VDZA 3ZRFA 2M19A 1YOVB 1C4PA 2OOBB 1E7VA 2ON8A 3CSTA 1V8CA 3AN1A 2I38A 5CHVC 2BWFA 4HKQA 4WAAA 1F0ZA 2Y5BB 1AWDA 1VR9A 1D5XC 1OQYA 3AULA 4RFBA 1JWMD 1ZXHA 2FAZA 1WJ6A 1VD2A 2IGHA 2IGGA 3NRZA 1PDXA 4KDLB 3PHWB 2QJLA 2EMTA 4YTPB 4R3DA 4MELA 3TSSA 1X1MA 3MHZA 1YD8U 4K7UA 4MH0E 1D5MC 1WGDA 4FJYA 4RF1A 4PT5A 3U8ZA 4FA6A 2YVCA 2J42A 1WFYA 3DBRI 4NAMA 3QWZB 2C7NB 3KYDD 2N9EB 3ZQ4A 1V5TA 2MRPA 2AEHA 2MHJA 3AE4B 4AJYB 1GOZA 1RAXA 1F2RI 3BVGA 2LVOA 5C23A 2V4LA 3P2BA 3KWLA 1WX9A 4N6EB 3CWIA 2KDEB 2W3SA 5HKHA 2AYOB 1WRIA 2E3TA 2PTLA 5D94A 1FMAD 3SFEB 3APDA 4JGHB 4XZ4A 4A9AA 4MM3A 1I7HA 2RGFA 2BT6A 4KIKB 5JH5C 2WX1A 3A9KB 3UI3A 1JWBD 2KFKA 2Z8LA 3A1QB 3ECIA 2KT7A 1BT0A 1RFAA 3EFCA 2WXLA 1FEHA 1KTKA 3BIID 2NBVB 1ZP0B 2B76B 3DBLI 4ZRKA 3FC4A 1P7EA 2KXJA 2JF5A 3IBEA 1MHXA 3NZSA 3U7ZA 2O2VB 2ACZB 1WWTA 1QOFA 2WGSA 1D3ZA 2X38A 3I63C 1OTRB 2WXGA 2OJRA 3NZ3A 1V86A 4K1RB 2NTSA 1T0YA 4E3CA 4XDDA 1HTQA 3AEBB 1YX5B 2G1EA 2K1FA 1QLBB 1YNTE 2ZJDA 1TS5A 4WJNA 3W1SA 2MSED 2BS2B 1I4GA 3LXFA 3IXSA 1P7FA 4WQOB 4XGAB 4C7YA 2RPQA 1SEBD 1ZKHA 2IJ0A 3M62B 3AE7B 3IFWB 4B0MA 1TGZB 3DCGA 1ACCA 3WIMA 3K9PB 4WWPA 4IWPA 2CHXA 3ZXRA 2PE6B 1GPXA 2GBNA 2FIFA 2PVGC 2ZPNA 2L1AA 3WAPA 2VRRB 4BKSA 3DBRB 1P1AA 2MH7A 3VHTC 4H2AA 2HJ8A 2LZ6A 2LXAA 2V3NA 2C5LC 4W9CA 4OW0A 1LFDA 2LMCA 4NAWA 3ZVVA 2NTTA 3AEFB 2QILA 4BKSD 4NQKE 1V5OA 4A6QA 3OWEB 1BMLC 3W2DA 3ZO5B 2KN4A 3D32A 1MPEA 2FCQA 4GGQA 4M0WA 5AZGA 2KLCA 1WZ3A 3JYUA 2YEPB 2LWPA 1PGAA 1FFVA 4FHJA 2KO3A 3E56A 5TSSA 1I4XA 3GP7A 3VTUA 4BKTA 4YTNB 4FJVB 1CK1A 4ITKA 1EWYC 2HJ1A 3UQAA 4A3OA 1V81A 5D2MB 2KWVB 1JRUA 3BZDB 3EA6A 1TT5B 3GE3C 2OEDA 4I6PA 2WXNA 4KZCA 2NBWB 3JW0X 2B3AA 2VZKB 4EZLA 1L0XB 4YT0B 3Q6BA 2WXFA 5CX3A 2N9PC 4HK2A 1P98A 1Z5SB 2NS5A 4W9FA 3PGEA 4FXCA 3VTWA 4BFRA 1T0SC 1N63A 2MA9B 1K52A 2JWUA 2M4NA 3RZFA 1TZ1A 2N1WA 1WX8A 2AL3A 3DBHB 4M01A 1FNVA 4K7WA 4A8XC 3SD5A 2KX3A 1N5XA 4P7IA 5D6JB 2GLSA 1WXSA 3V6EB 3PLUA 4RGTA 3RULA 4FLHA 1UBQA 2G45B 2WQYB 2KMCA 2KVRA 2DZKA 3BVMA 3TBLD 1GC7A 3RMKC 3CIRB 1WXMA 2IO2B 5BYQA 4WJOA 1HA5A 2D10A 3WALA 2KFJA 4FULA 3NS1A 1L0VB 4S0RA 1TJEA 1E8YA 2J52A 4TQ1A 5D7GA 3T8MA 4QAYA 2D5GA 3HUIA 2WU2B 4BZAA 4OVZA 2MJ3A 1V1PB 3RCZA 3ZLZA 1UNSA 1ISNA 3RT3B 1WM3A 2WHIA 3A4RA 2CHWA 2DX5B 1HQRD 1TS4A 4PS8A 2N7DA 2GBKA 2CU3A 3KUCB 3VH3B 2BGFA 4WJQA 2KTRA 1Y8RC 2K39A 4REZA 3ONSA 4J6IA 3ZUNA 2BS4B 1QF6A 2JX5A 1N6ZA 1UZXB 5DPWA 3VUXA 3T3NA 4HKZE 3PV1A 4DHZB 1TKGA 1C1YB 4ICUA 3DPDA 3X0WA 3UINB 3PTFC 3MHSD 3AEEB 4WAFA 1GAQB 2Y5PA 2JY6A 3N20C 3EHVA 2LASA 3B2FA 2PW9A 3R3MA 4YXDB 4HPLB 3L54A 3ZYYX 1STEA 1ZGUB 3V62A 1DGJA 2L0FA 3AM9A 2NPTB 1GJZA 2RR9A 3JVZX 2AWTA 1SE2A 1N60A 5TR5A 1C9FA 2G4SA 1L0YB 1WMHB 1WE7A 1I4RA 1VCBA 2XK5A 4PYUA 4W9KA 1BXTA 2JXXA 3A33B 5G55A 1E5WA 2LXCA 5JHBA 1CQVA 5IKCM 1P0RA 4GDKA 4AWJA 1K51A 2KLGA 1TY2A 3N1XC 1ENFA 3Q69A 3ZDMC 3ZNZB 3NY5A 2RD0A 4USAA 1K53A 4FHKA 2AL6A 1WR1A 2PMVA 3QHTA 3EC8A 4HLEA 4HRSA 3NZUA 5E6JA 3H8HA 4IM2A 2FNJB 2MQJA 3AEGB 3OLMD 2LGIA 2H89B 3E9SA 4CO7A 1K8RB 3KH0A 2EELA 1IGCA 1KF6B 2DZJA 4TV3A 1Q5WB 1KJTA 3HK0A 2MBEA 1YN3A 3DVNV 3I3TB 2JYEA 4URKA 2QSDA 1FRRA 2L32A 1EF1A 3N30A 3TCAA 3AECB 4C7ZA 3EFUA 3PLVA 3HM3A 2MBBB 3DBLB 4TMAB 4US9A 1PUTA 4EOYA 4XWWA 4AJWA 1FCLA 4L23A 2HE7A 3PS6A 3AH7A 1S1QB 5IOIA 1VZ7A 1YIWA 2BWES 2GRIA 3H7PA 2V9HA 5KHQA 2LJIA 2K6DB 4NQLB 5FR6A 1PGXA 4JIOU 3CMMB 2WX0A 1LQBA 2HD5B 2J0MA 3SU8X 1AARA 2DYMA 3I57A 2OJWA 5AZHA 1C77A 3VUWA 2K0PA 4HJGE 1L6UA 2IGDA 2KVZA 1JMLA 1PQSA 1Q10A 1NVID 1ZXIA 3GZNI 1JWAD 2MBHA 3TIXA 2KDFB 3WANA 3GS2A 4KDIC 2JYTA 3R2TA 4WIPA 1XF5L 2N9XA 1C78A 2K8HA 3NVZA 1HE8A 1VZ6A 4K81A 3RZWC 2L76A 2X8XX 2KTFA 4MGYE 1V2YA 1Q1OA 2XK5B 1WY8A 1JRPA 4C56C 1ZE3D 3W9CB 2WXMA 4MACA 4KX6B 4ANVA 1WGKA 5L95C 5D3IB 3AMZA 4CQNA 2LD9A 2FCNA 3R8BA 1H4RA 1EF5A 4C4VA 1NBFC 1IGDA 4EEWA 4JWSC 1RFKA 2JU6X 1F52A 2O6VB 2N4FA 1LO5D 1T3QA 2KFKB 3L4PA 2C60A 4B95A 4DXAB 2I1JA 5JZEB 3DOWA 4HCPB 1C76A 4DK5A 4US8A 4OZAA 2FUG1 3LJ3A 5G5GA 4RMAA 3KWVA 2CJOA 4B0EA 1IUEA 1C4AA 5D3DA 4BAXA 4LDTB 3DVGY 3JSVA 2RMMA 1LXDA 1IYFA 1ZOYB 1CJEA 3EGRA 1SIJA 3I5JC 5CHWA 3U52E 1FM0D 1V1PA 2N1VA 1UGJA 3T3OA 3DBHI 2DYBA 2INNE 2PIAA 1KLVA 4HDOA 3AXCA 4A3PA 1XD3B 1E7PB 2AQ3B 2KJ6A 3DVNU 3AE2B 3B9JA 3L08A 4M00A 1E8WA 5LXHA 3P4QB 3APFA 4ANWA 3PHXB 2LGXA 1YQ4B 5E6NA 1WRDB 2CS4A 1TZOA 1B9RA 3O65B 4IKGA 3R66C 3LDZE 2Z0EB 2MBQA 4IDIA 1TS2A 1E8ZA 3UGBB 1IBXB 3ALBA 4IWQA 3RNEC 4KKJA 4BVUC 3TEZA 2K22A 3PT2B 3W5UB 1V97A 4E71A 1ESFA 3CF6E 3ZRCA 3PVLA 1R4NB 1R4MI 4HPPA 3QAQA 3MTNB 2KDMA 3U30A 4ANUA 1TBEA 1EUVB 3TMPB 2GBRA 5BYSA 1VLBA 3MC8A 3QA8A 2EMSA 1V49A 3IVFA 3B0AA 2ZW0A 1WJUA 1J7AA 2L3ZA 4ZRIA 1OQRA 4II3B 1XO3A 2WP9B 4P16A 2M56B 1A70A 2J0JA 1ROEA 4XE0A 2WU5B 5BMHA 1JWSD 1N62A 3AI5A 1HTOA 1E7UA 3ZJVA 1R4MB 1UH6A 1J0GA 1QOAA 1WH3A 2GI9A 3A1QA 2Z59B 3GZNB 3Q14C
chains in the Genus database with same CATH topology
2KJRA 1UBQA 3QIJA 4XX5A 2EKEC 2M17A 1WE6A 3L0WB 3OJ3A 3QJZA 5CHFA 2G45B 4KV2A 2KMCA 2KVRA 3PRPB 3H7PB 2DZKA 2JRIB 3TBLD 1GC7A 3ZIMA 4HVBA 3V61A 3Q3FA 4DDID 1WXMA 2M1MA 2BYVE 3RD2A 2IO2B 4WWOA 1J19A 2I1KA 4GDLA 1M94A 3OAWA 4WJOA 4LJOB 2D10A 2R2OA 2KFJA 4IM0A 3WALA 4DBGA 4FULA 1E8XA 2K6QA 2PE9A 2O2VA 5J17A 2LRUA 2DZMA 2G4DB 5LXIB 1OEYA 3KVFB 3RYTA 5IA7A 5JHAA 1H8CA 2G3QB 2J0KA 3KUDB 3UF8A 1KM7A 1E8YA 1XQQA 4TQ1A 3HIZA 5D7GA 5BO4B 3T8MA 2V3SA 4AP4C 2CU1A 3PREA 4GOCA 3V60A 2DENB 3DDCB 4EFOA 4LDTD 1V9JA 3RCZA 4RM8A 3ZLZA 4E74A 1ISNA 4PS7A 3RT3B 4GMVA 1WM3A 2L0TA 3A4RA 4GSWA 1GG3A 2CHWA 2DX5B 4F8CB 3ML9A 2UYZB 1GUAB 2KQ7A 1IP9A 4ICVA 4HWIB 4PS8A 2N7DA 1WR6E 2GBKA 2BYFA 2GMIC 2IO0B 2BGFA 2XEWA 2FCMA 2BKRB 3KUCB 3MJWA 4WJQA 3KUZA 4YL8A 3VTVA 2KTRA 1Y8RC 1I35A 2K39A 2NCNA 3ONSA 4J6IA 1WM2A 2W9NA 4NPNA 3VUYA 2FIDA 3ZUNA 3M63B 3L10B 4BBNF 3VQIA 4KIKA 2RSUA 1EO6A 1MG8A 2LVPA 1UZXB 5DPWA 3VUXA 4PYZA 1WGGA 2JVCA 1G6JA 2DAFA 3TJPA 3KW5B 3PV1A 4CYEA 4DHZB 4W9HA 2ZVOA 4G3XB 5E6OA 1C1YB 2KHWB 2NR2A 3DPDA 4ICUA 4W9EA 3X0WA 2FCSA 2D2QA 2QHOA 3GOEA 3UINB 3NS8A 4K7SA 2KDBA 3PTFC 3MHSD 3PRMB 3ZNID 3V6CB 3RULA 3L13A 2GOWA 4AOFA 2KMAA 5IAAC 2K8CA 4A20A 1I42A 2JY6A 3BINA 4DWFA 1WXVA 2JT4B 3EHVA 2JWZA 2N7EA 2LASA 4HPMB 1WJ4A 3H1UA 5KHOA 4DHJB 2ZNVB 3R3MA 4MSQB 4HPLB 3L54A 4W9DA 2ZVNA 1E90A 1ZGUB 3V62A 4FJZA 3ZNHB 1WGYA 2L0FA 2NPTB 4MGIE 4BOZB 2RR9A 2WYQA 1GJZA 3JVZX 2IYDB 2AWTA 2KK8A 3NOBA 2A5UA 2J7QB 5TR5A 3BY4B 4GN1A 2G4SA 3APCA 1WXAA 1WMHB 3WA0A 2LUEA 2LRWA 2LVQA 3QK0A 4JL9A 4LJPB 1WE7A 1VCBA 2UWQA 2XK5A 4PYUA 1RRBA 3QARA 4MGZE 4W9KA 5CTRC 2BF8B 3TL5A 1OGWA 2HTHA 1WZ0A 3T9LA 4DHJD 2JXXA 2IY1B 3A33B 4ZRJA 5G55A 1E5WA 4GB9A 2LXCA 5JHBA 3SHQA 2REXA 1GNUA 1P0RA 4GDKA 4EZJA 3DVGX 4JLCA 1FXTB 3JSVB 4MGKE 2M0XA 3PRZA 4AWJA 2KLGA 4OVUA 4W9GA 4X57B 1L7YA 2C7HA 3ZDMC 3ZNZB 4KSLC 3A4SC 3W1SC 1LM8B 3NY5A 4FBJB 2RD0A 4EZKA 3A9JA 2KC2A 4FHKA 2AL6A 1WR1A 3QHTA 4NAWB 2DHZA 3EC8A 3PPAA 3VH3B 3VDZA 3ZRFA 4HLEA 1SIFA 1YX6B 3NZUA 1SGHA 3WAMA 5G2NA 2OOBB 1E7VA 4IM2A 3CSTA 2FNJB 2MQJA 4KSKC 4TQ0A 5CHVC 4ANXA 2BWFA 3OLMD 3ENEA 4WAAA 2Y5BB 4CO7A 5EDSA 3ZNGC 1V6EA 1K8RB 3KH0A 3AULA 1OQYA 2FAZA 1WJ6A 1UELA 1VD2A 2KD0A 4FADA 2DZJA 1SE9A 3SDLC 4TV3A 5J18A 2WDTB 4AUQC 1V80A 4KDLB 3PHWB 1Q5WB 1P9DU 2FUHB 4RM9A 1KJTA 4MEMA 3HK0A 2EMTA 2MBEA 3DVNV 3I3TB 4MELA 1X1MA 4URKA 2NPTA 2JUOA 3EECA 1EF1A 1YD8U 3N32A 3N30A 3TCAA 4CHKA 4K7UA 3EFUA 2DYOA 3PLVA 4MH0E 1WGDA 4FJYA 3U8ZA 4HCNB 3HM3A 2MBBB 3M3JA 4FA6A 2YVCA 3UIOB 2L8JA 4F1SA 1NDDA 4F7ZA 4G50A 1CMXB 4EOYA 1WFYA 3DBRI 4NNJB 4AJWA 3QWZB 1A5RA 2C7NB 2KZRA 2HE7A 3KYDD 4G0NB 2N9EB 3PS6A 4M8MA 4GU2A 1UBIA 1V5TA 3IHPC 2ASQA 2MRPA 1WMHA 2AEHA 2JZZA 1S1QB 1WYWB 2PJHA 3Q3JA 1YIWA 2BWES 2CHZA 5DPSA 3H7PA 3X23A 4IW0A 5KHQA 4AJYB 3ZDTA 2K6DB 1RAXA 3AU4A 4NQLB 3L16A 3KYCD 3WAOA 5FR6A 3DBSA 4JIOU 2ZEQA 4HXDA 3CMMB 2KX0A 2L7RA 2LVOA 5C23A 3QQ8B 2V4LA 3QC8B 2WX0A 3P2BA 2NVUI 3HHMA 1LQBA 1WX9A 2HD5B 2IO1B 4M0WB 1RLFA 2J0MA 3ZW3A 3SU8X 2KDEB 5E6PA 1Q0WB 1AARA 2DYMA 5GMVA 1U4AA 5HKHA 2AYOB 2O6VA 5DPTA 5D94A 5AZHA 3VUWA 3C0RB 2KNBA 1Z2MA 2GBJA 4IUMB 3APDA 3H6NA 4JGHB 4XZ4A 2IBIB 3H9DA 4MM3A 4WWNA 1PQSA 2RGFA 4KIKB 3GZNI 5JH5C 4ASWC 2MBHA 4GDLB 2O6VD 2MP2B 2KC1A 2WX1A 3A9KB 3B1LX 2M8SA 4IC7B 3TIXA 2KFKA 2ZZPB 2KDFB 3A1QB 3WANA 3ECIA 1J8CA 1BT0A 2D3GA 4JQWC 1RFAA 3S2AA 4KDIC 2JPHA 2BKFA 2ZCCA 2KN5A 2NBVB 3DBLI 2MX2A 2N9XA 4ZRKA 2KXJA 4II2B 3B08A 2BYEA 1C3TA 2JF5A 2K8HA 3VVWB 4BBNC 1HE8A 3IBEA 4K81A 3RZWC 2LJ5A 3ML8A 2KDIA 3NZSA 2KANA 1WGRA 2O2VB 2L76A 3NHEB 1P3QU 4KVGB 2KTFA 3UQBA 4MGYE 1V2YA 1Q1OA 1KOTA 2GBMA 2XK5B 1D3ZA 1WY8A 3N3KB 1OTRB 2KOXA 2OJRA 2Z0DB 3QX1A 4ANVA 1V86A 5L95C 4K1RB 3ZTCA 5J2RA 4I6LB 1T0YA 1WIAA 4W9JA 4M8NA 4E3CA 4GXBA 1YX5B 2KJHB 1QZEA 2K1FA 2LD9A 2FCNA 3AU5A 2K25A 2ZJDA 1NI2A 4WJNA 3W1SA 1H4RA 1EF5A 5C1ZA 4B9KA 1NBFC 3R7QA 4EEWA 2MSED 5DPRA 2O6VB 4BOSC 2N4FA 4MJSB 2KFKB 2KWCA 4WQOB 2C60A 4B95A 2RPQA 4DXAB 2I1JA 1ZKHA 3M62B 5JZEB 3DOWA 4HCPB 2IZVB 5LLIA 3IFWB 1TGZB 4DK5A 3DCGA 3WIMA 1UD7A 2C9WB 2C7MB 3K9PB 3LJ3A 4WWPA 4ZDVA 4NJ7A 4IWPA 4HDQA 2CHXA 2KTRB 2KKCA 4RMAA 4XC2A 3U7DA 2PE6B 4NJ6A 2GBNA 2FIFA 2ZNVC 2ZPNA 2ZPYA 3ZKJC 4IM3A 3WAPA 2ZCBA 2VRRB 1R4NI 3CSFA 4BKSA 4LDTB 3DVGY 3JSVA 2NBUA 3R7RA 4MDKE 2PEAA 1LXDA 1P1AA 3VHTC 1IYFA 4I6NB 2HJ8A 2LZ6A 2LXAA 4G11A 5DCNA 4DDGD 2PPHA 4GIVA 2C5LC 4W9CA 4ZYNA 1LFDA 3OJ4B 4NAWA 3UIPB 3ZVVA 5CHWA 3W1YA 4BKSD 2L00B 4NQKE 1V5OA 2N1VA 3ZO5B 3DBHI 2IO3B 1OEYJ 4EUTA 2D07B 2DYBA 4PS3A 2R2QA 2MLBA 1KLVA 2DZIA 4HDOA 1WGHA 3AXCA 2FCQA 2D11A 3D32A 4GGQA 4IG7B 1XD3B 5AZGA 1ZW7A 2KLCA 4W9LA 1WZ3A 4A3PA 2KJ6A 3JYUA 1WF9A 3DVNU 2LWPA 3H7SA 1YQBA 3QCAA 3M95A 1F9JA 3L08A 4FHJA 2KO3A 1E8WA 5LXHA 3APFA 4ANWA 3PHXB 2LGXA 5AZFA 2MBOA 2K8BA 4IWOA 3HM6X 5E6NA 3VAWA 3VH4B 1WRDB 2CS4A 2LGYA 2YLMA 3VTUA 3O65B 3R66C 4BKTA 3LDZE 2Z0EB 5L83A 4LCDE 2MBQA 3PZDA 4FJVB 1XT9B 1E8ZA 2LI5A 3UGBB 3ALBA 4OVVA 4IWQA 3VFKA 3VXWA 4BVUC 4DHZE 3IG3A 4GDKB 2JZ3B 3PT2B 2CKHB 4NY0A 3UQAA 2BPSA 4A3OA 1L2NA 1V81A 5D2MB 2KWVB 3A9KA 1JRUA 4MSMB 2LGDA 2V1YA 4E71A 4I6PA 4KZCA 2NBWB 3JW0X 3CF6E 2XBBC 1GC6A 2B3AA 4WJPA 2DAJA 4EZLA 3ZRCA 4MJSA 3PVLA 1TTNA 4W9IA 2KWUB 5CX3A 2MW5A 1R4MI 2N9PC 3QAQA 4HK2A 1P98A 1Z5SB 2NS5A 3L17A 4W9FA 3MTNB 3U30A 4ANUA 1TBEA 3PGEA 1EUVB 2L05A 2GBRA 3K9OB 1WJNA 3TMPB 3QA8A 2EMSA 1V49A 3VTWA 3IVFA 4BFRA 3B0AA 1WJUA 2MA9B 2L3ZA 5AEKB 4B6WA 4ZRIA 2A4ZA 2M4NA 2WWZA 3RZFA 2KQSA 4II3B 1YJ1A 4FN2A 1TZ1A 4KZ0A 3ZTDA 1IPGA 2N1WA 1WX8A 2AL3A 1WX7A 2MP2A 2IY0B 2J0JA 4K7WA 1WI0A 2MWSB 3PSEB 4HJKA 3SD5A 3DQVA 2KX3A 3A9JB 4EKUA 3AI5A 4BKGA 4P7IA 2CR5A 5D6JB 1E7UA 4TKNA 1WXSA 1UH6A 1UGMA 1J0GA 4TUUA 3V6EB 3PLUA 3RUIB 1WH3A 4N9F4 2MCNB 3A1QA 1S3SG 2Z59B 4FLHA 2JRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KJR A;  1UBQ A;  3QIJ A;  4XX5 A;  2EKE C;  2M17 A;  1WE6 A;  3L0W B;  3OJ3 A;  3QJZ A;  5CHF A;  2G45 B;  4KV2 A;  2KMC A;  2KVR A;  3PRP B;  3H7P B;  2DZK A;  2JRI B;  3TBL D;  1GC7 A;  3ZIM A;  4HVB A;  3V61 A;  3Q3F A;  4DDI D;  1WXM A;  2M1M A;  2BYV E;  3RD2 A;  2IO2 B;  4WWO A;  1J19 A;  2I1K A;  4GDL A;  1M94 A;  3OAW A;  4WJO A;  4LJO B;  2D10 A;  2R2O A;  2KFJ A;  4IM0 A;  3WAL A;  4DBG A;  4FUL A;  1E8X A;  2K6Q A;  2PE9 A;  2O2V A;  5J17 A;  2LRU A;  2DZM A;  2G4D B;  5LXI B;  1OEY A;  3KVF B;  3RYT A;  5IA7 A;  5JHA A;  1H8C A;  2G3Q B;  2J0K A;  3KUD B;  3UF8 A;  1KM7 A;  1E8Y A;  1XQQ A;  4TQ1 A;  3HIZ A;  5D7G A;  5BO4 B;  3T8M A;  2V3S A;  4AP4 C;  2CU1 A;  3PRE A;  4GOC A;  3V60 A;  2DEN B;  3DDC B;  4EFO A;  4LDT D;  1V9J A;  3RCZ A;  4RM8 A;  3ZLZ A;  4E74 A;  1ISN A;  4PS7 A;  3RT3 B;  4GMV A;  1WM3 A;  2L0T A;  3A4R A;  4GSW A;  1GG3 A;  2CHW A;  2DX5 B;  4F8C B;  3ML9 A;  2UYZ B;  1GUA B;  2KQ7 A;  1IP9 A;  4ICV A;  4HWI B;  4PS8 A;  2N7D A;  1WR6 E;  2GBK A;  2BYF A;  2GMI C;  2IO0 B;  2BGF A;  2XEW A;  2FCM A;  2BKR B;  3KUC B;  3MJW A;  4WJQ A;  3KUZ A;  4YL8 A;  3VTV A;  2KTR A;  1Y8R C;  1I35 A;  2K39 A;  2NCN A;  3ONS A;  4J6I A;  1WM2 A;  2W9N A;  4NPN A;  3VUY A;  2FID A;  3ZUN A;  3M63 B;  3L10 B;  4BBN F;  3VQI A;  4KIK A;  2RSU A;  1EO6 A;  1MG8 A;  2LVP A;  1UZX B;  5DPW A;  3VUX A;  4PYZ A;  1WGG A;  2JVC A;  1G6J A;  2DAF A;  3TJP A;  3KW5 B;  3PV1 A;  4CYE A;  4DHZ B;  4W9H A;  2ZVO A;  4G3X B;  5E6O A;  1C1Y B;  2KHW B;  2NR2 A;  3DPD A;  4ICU A;  4W9E A;  3X0W A;  2FCS A;  2D2Q A;  2QHO A;  3GOE A;  3UIN B;  3NS8 A;  4K7S A;  2KDB A;  3PTF C;  3MHS D;  3PRM B;  3ZNI D;  3V6C B;  3RUL A;  3L13 A;  2GOW A;  4AOF A;  2KMA A;  5IAA C;  2K8C A;  4A20 A;  1I42 A;  2JY6 A;  3BIN A;  4DWF A;  1WXV A;  2JT4 B;  3EHV A;  2JWZ A;  2N7E A;  2LAS A;  4HPM B;  1WJ4 A;  3H1U A;  5KHO A;  4DHJ B;  2ZNV B;  3R3M A;  4MSQ B;  4HPL B;  3L54 A;  4W9D A;  2ZVN A;  1E90 A;  1ZGU B;  3V62 A;  4FJZ A;  3ZNH B;  1WGY A;  2L0F A;  2NPT B;  4MGI E;  4BOZ B;  2RR9 A;  2WYQ A;  1GJZ A;  3JVZ X;  2IYD B;  2AWT A;  2KK8 A;  3NOB A;  2A5U A;  2J7Q B;  5TR5 A;  3BY4 B;  4GN1 A;  2G4S A;  3APC A;  1WXA A;  1WMH B;  3WA0 A;  2LUE A;  2LRW A;  2LVQ A;  3QK0 A;  4JL9 A;  4LJP B;  1WE7 A;  1VCB A;  2UWQ A;  2XK5 A;  4PYU A;  1RRB A;  3QAR A;  4MGZ E;  4W9K A;  5CTR C;  2BF8 B;  3TL5 A;  1OGW A;  2HTH A;  1WZ0 A;  3T9L A;  4DHJ D;  2JXX A;  2IY1 B;  3A33 B;  4ZRJ A;  5G55 A;  1E5W A;  4GB9 A;  2LXC A;  5JHB A;  3SHQ A;  2REX A;  1GNU A;  1P0R A;  4GDK A;  4EZJ A;  3DVG X;  4JLC A;  1FXT B;  3JSV B;  4MGK E;  2M0X A;  3PRZ A;  4AWJ A;  2KLG A;  4OVU A;  4W9G A;  4X57 B;  1L7Y A;  2C7H A;  3ZDM C;  3ZNZ B;  4KSL C;  3A4S C;  3W1S C;  1LM8 B;  3NY5 A;  4FBJ B;  2RD0 A;  4EZK A;  3A9J A;  2KC2 A;  4FHK A;  2AL6 A;  1WR1 A;  3QHT A;  4NAW B;  2DHZ A;  3EC8 A;  3PPA A;  3VH3 B;  3VDZ A;  3ZRF A;  4HLE A;  1SIF A;  1YX6 B;  3NZU A;  1SGH A;  3WAM A;  5G2N A;  2OOB B;  1E7V A;  4IM2 A;  3CST A;  2FNJ B;  2MQJ A;  4KSK C;  4TQ0 A;  5CHV C;  4ANX A;  2BWF A;  3OLM D;  3ENE A;  4WAA A;  2Y5B B;  4CO7 A;  5EDS A;  3ZNG C;  1V6E A;  1K8R B;  3KH0 A;  3AUL A;  1OQY A;  2FAZ A;  1WJ6 A;  1UEL A;  1VD2 A;  2KD0 A;  4FAD A;  2DZJ A;  1SE9 A;  3SDL C;  4TV3 A;  5J18 A;  2WDT B;  4AUQ C;  1V80 A;  4KDL B;  3PHW B;  1Q5W B;  1P9D U;  2FUH B;  4RM9 A;  1KJT A;  4MEM A;  3HK0 A;  2EMT A;  2MBE A;  3DVN V;  3I3T B;  4MEL A;  1X1M A;  4URK A;  2NPT A;  2JUO A;  3EEC A;  1EF1 A;  1YD8 U;  3N32 A;  3N30 A;  3TCA A;  4CHK A;  4K7U A;  3EFU A;  2DYO A;  3PLV A;  4MH0 E;  1WGD A;  4FJY A;  3U8Z A;  4HCN B;  3HM3 A;  2MBB B;  3M3J A;  4FA6 A;  2YVC A;  3UIO B;  2L8J A;  4F1S A;  1NDD A;  4F7Z A;  4G50 A;  1CMX B;  4EOY A;  1WFY A;  3DBR I;  4NNJ B;  4AJW A;  3QWZ B;  1A5R A;  2C7N B;  2KZR A;  2HE7 A;  3KYD D;  4G0N B;  2N9E B;  3PS6 A;  4M8M A;  4GU2 A;  1UBI A;  1V5T A;  3IHP C;  2ASQ A;  2MRP A;  1WMH A;  2AEH A;  2JZZ A;  1S1Q B;  1WYW B;  2PJH A;  3Q3J A;  1YIW A;  2BWE S;  2CHZ A;  5DPS A;  3H7P A;  3X23 A;  4IW0 A;  5KHQ A;  4AJY B;  3ZDT A;  2K6D B;  1RAX A;  3AU4 A;  4NQL B;  3L16 A;  3KYC D;  3WAO A;  5FR6 A;  3DBS A;  4JIO U;  2ZEQ A;  4HXD A;  3CMM B;  2KX0 A;  2L7R A;  2LVO A;  5C23 A;  3QQ8 B;  2V4L A;  3QC8 B;  2WX0 A;  3P2B A;  2NVU I;  3HHM A;  1LQB A;  1WX9 A;  2HD5 B;  2IO1 B;  4M0W B;  1RLF A;  2J0M A;  3ZW3 A;  3SU8 X;  2KDE B;  5E6P A;  1Q0W B;  1AAR A;  2DYM A;  5GMV A;  1U4A A;  5HKH A;  2AYO B;  2O6V A;  5DPT A;  5D94 A;  5AZH A;  3VUW A;  3C0R B;  2KNB A;  1Z2M A;  2GBJ A;  4IUM B;  3APD A;  3H6N A;  4JGH B;  4XZ4 A;  2IBI B;  3H9D A;  4MM3 A;  4WWN A;  1PQS A;  2RGF A;  4KIK B;  3GZN I;  5JH5 C;  4ASW C;  2MBH A;  4GDL B;  2O6V D;  2MP2 B;  2KC1 A;  2WX1 A;  3A9K B;  3B1L X;  2M8S A;  4IC7 B;  3TIX A;  2KFK A;  2ZZP B;  2KDF B;  3A1Q B;  3WAN A;  3ECI A;  1J8C A;  1BT0 A;  2D3G A;  4JQW C;  1RFA A;  3S2A A;  4KDI C;  2JPH A;  2BKF A;  2ZCC A;  2KN5 A;  2NBV B;  3DBL I;  2MX2 A;  2N9X A;  4ZRK A;  2KXJ A;  4II2 B;  3B08 A;  2BYE A;  1C3T A;  2JF5 A;  2K8H A;  3VVW B;  4BBN C;  1HE8 A;  3IBE A;  4K81 A;  3RZW C;  2LJ5 A;  3ML8 A;  2KDI A;  3NZS A;  2KAN A;  1WGR A;  2O2V B;  2L76 A;  3NHE B;  1P3Q U;  4KVG B;  2KTF A;  3UQB A;  4MGY E;  1V2Y A;  1Q1O A;  1KOT A;  2GBM A;  2XK5 B;  1D3Z A;  1WY8 A;  3N3K B;  1OTR B;  2KOX A;  2OJR A;  2Z0D B;  3QX1 A;  4ANV A;  1V86 A;  5L95 C;  4K1R B;  3ZTC A;  5J2R A;  4I6L B;  1T0Y A;  1WIA A;  4W9J A;  4M8N A;  4E3C A;  4GXB A;  1YX5 B;  2KJH B;  1QZE A;  2K1F A;  2LD9 A;  2FCN A;  3AU5 A;  2K25 A;  2ZJD A;  1NI2 A;  4WJN A;  3W1S A;  1H4R A;  1EF5 A;  5C1Z A;  4B9K A;  1NBF C;  3R7Q A;  4EEW A;  2MSE D;  5DPR A;  2O6V B;  4BOS C;  2N4F A;  4MJS B;  2KFK B;  2KWC A;  4WQO B;  2C60 A;  4B95 A;  2RPQ A;  4DXA B;  2I1J A;  1ZKH A;  3M62 B;  5JZE B;  3DOW A;  4HCP B;  2IZV B;  5LLI A;  3IFW B;  1TGZ B;  4DK5 A;  3DCG A;  3WIM A;  1UD7 A;  2C9W B;  2C7M B;  3K9P B;  3LJ3 A;  4WWP A;  4ZDV A;  4NJ7 A;  4IWP A;  4HDQ A;  2CHX A;  2KTR B;  2KKC A;  4RMA A;  4XC2 A;  3U7D A;  2PE6 B;  4NJ6 A;  2GBN A;  2FIF A;  2ZNV C;  2ZPN A;  2ZPY A;  3ZKJ C;  4IM3 A;  3WAP A;  2ZCB A;  2VRR B;  1R4N I;  3CSF A;  4BKS A;  4LDT B;  3DVG Y;  3JSV A;  2NBU A;  3R7R A;  4MDK E;  2PEA A;  1LXD A;  1P1A A;  3VHT C;  1IYF A;  4I6N B;  2HJ8 A;  2LZ6 A;  2LXA A;  4G11 A;  5DCN A;  4DDG D;  2PPH A;  4GIV A;  2C5L C;  4W9C A;  4ZYN A;  1LFD A;  3OJ4 B;  4NAW A;  3UIP B;  3ZVV A;  5CHW A;  3W1Y A;  4BKS D;  2L00 B;  4NQK E;  1V5O A;  2N1V A;  3ZO5 B;  3DBH I;  2IO3 B;  1OEY J;  4EUT A;  2D07 B;  2DYB A;  4PS3 A;  2R2Q A;  2MLB A;  1KLV A;  2DZI A;  4HDO A;  1WGH A;  3AXC A;  2FCQ A;  2D11 A;  3D32 A;  4GGQ A;  4IG7 B;  1XD3 B;  5AZG A;  1ZW7 A;  2KLC A;  4W9L A;  1WZ3 A;  4A3P A;  2KJ6 A;  3JYU A;  1WF9 A;  3DVN U;  2LWP A;  3H7S A;  1YQB A;  3QCA A;  3M95 A;  1F9J A;  3L08 A;  4FHJ A;  2KO3 A;  1E8W A;  5LXH A;  3APF A;  4ANW A;  3PHX B;  2LGX A;  5AZF A;  2MBO A;  2K8B A;  4IWO A;  3HM6 X;  5E6N A;  3VAW A;  3VH4 B;  1WRD B;  2CS4 A;  2LGY A;  2YLM A;  3VTU A;  3O65 B;  3R66 C;  4BKT A;  3LDZ E;  2Z0E B;  5L83 A;  4LCD E;  2MBQ A;  3PZD A;  4FJV B;  1XT9 B;  1E8Z A;  2LI5 A;  3UGB B;  3ALB A;  4OVV A;  4IWQ A;  3VFK A;  3VXW A;  4BVU C;  4DHZ E;  3IG3 A;  4GDK B;  2JZ3 B;  3PT2 B;  2CKH B;  4NY0 A;  3UQA A;  2BPS A;  4A3O A;  1L2N A;  1V81 A;  5D2M B;  2KWV B;  3A9K A;  1JRU A;  4MSM B;  2LGD A;  2V1Y A;  4E71 A;  4I6P A;  4KZC A;  2NBW B;  3JW0 X;  3CF6 E;  2XBB C;  1GC6 A;  2B3A A;  4WJP A;  2DAJ A;  4EZL A;  3ZRC A;  4MJS A;  3PVL A;  1TTN A;  4W9I A;  2KWU B;  5CX3 A;  2MW5 A;  1R4M I;  2N9P C;  3QAQ A;  4HK2 A;  1P98 A;  1Z5S B;  2NS5 A;  3L17 A;  4W9F A;  3MTN B;  3U30 A;  4ANU A;  1TBE A;  3PGE A;  1EUV B;  2L05 A;  2GBR A;  3K9O B;  1WJN A;  3TMP B;  3QA8 A;  2EMS A;  1V49 A;  3VTW A;  3IVF A;  4BFR A;  3B0A A;  1WJU A;  2MA9 B;  2L3Z A;  5AEK B;  4B6W A;  4ZRI A;  2A4Z A;  2M4N A;  2WWZ A;  3RZF A;  2KQS A;  4II3 B;  1YJ1 A;  4FN2 A;  1TZ1 A;  4KZ0 A;  3ZTD A;  1IPG A;  2N1W A;  1WX8 A;  2AL3 A;  1WX7 A;  2MP2 A;  2IY0 B;  2J0J A;  4K7W A;  1WI0 A;  2MWS B;  3PSE B;  4HJK A;  3SD5 A;  3DQV A;  2KX3 A;  3A9J B;  4EKU A;  3AI5 A;  4BKG A;  4P7I A;  2CR5 A;  5D6J B;  1E7U A;  4TKN A;  1WXS A;  1UH6 A;  1UGM A;  1J0G A;  4TUU A;  3V6E B;  3PLU A;  3RUI B;  1WH3 A;  4N9F 4;  2MCN B;  3A1Q A;  1S3S G;  2Z59 B;  4FLH A;  2JRH A; 
#chains in the Genus database with same CATH topology
 1J7B A;  2VH1 A;  1NEN B;  2EKE C;  5AUK A;  1WE6 A;  5CHF A;  3DHH C;  4XWT A;  1QQR A;  3PRP B;  4HVB A;  3Q3F A;  2BYV E;  1XLN A;  1UWX A;  2I1K A;  4GDL A;  4LJO B;  3Q2A C;  4DBG A;  4IM0 A;  4MM3 B;  2PE9 A;  1F77 A;  1KFY B;  4L1B A;  2HDE A;  5LXI B;  3KVF B;  1H8C A;  5JHA A;  2J0K A;  1ZDX A;  5G5H A;  1AN8 A;  2D3B A;  2V3S A;  4AP4 C;  2CU1 A;  4P1B C;  1I4P A;  1JQ4 A;  1SSN A;  4EFO A;  1V9J A;  4XYC A;  4RM8 A;  3Q8F A;  3SFD B;  4GMV A;  1GG3 A;  3RPF C;  2UYZ B;  1GUA B;  4ICV A;  4HWI B;  3U7D A;  1F1H A;  3VTV A;  2XEW A;  2FCM A;  2BKR B;  4DHZ E;  2NCN A;  1VDV A;  4KKI A;  1TKY A;  1RYJ A;  4DXF A;  1EO6 A;  2QCZ A;  3IT6 B;  1WGG A;  1G6J A;  2DAF A;  4IOI E;  3KW5 B;  2YEP F;  4CYE A;  1JWU D;  2ZVO A;  2BS3 B;  3P4R B;  1HEZ E;  2NR2 A;  1MJD A;  3NS8 A;  1TYG B;  3PRM B;  1QOB A;  2GOW A;  2KMA A;  2ZW1 A;  2K8C A;  3H1U A;  4MSQ B;  3RNB C;  1WGY A;  5HI1 A;  2WXR A;  2A5U A;  2J7Q B;  2KMM A;  2ONQ A;  3NG0 A;  2LVQ A;  1ET9 A;  4LJP B;  2UWQ A;  1C79 A;  3TL5 A;  1OGW A;  1WZ0 A;  3T9L A;  2RDB C;  2TSS A;  4NJC A;  4XDC A;  5C2T B;  2REX A;  2SAK A;  1N61 A;  4EZJ A;  3DVG X;  4MGK E;  1T0R C;  2CJN A;  1LM8 B;  4FBJ B;  3AE3 B;  1XEE A;  3HVD A;  1QT9 A;  4PK1 A;  1YX6 B;  1SGH A;  3WAM A;  5G2N A;  3DWG C;  3VRB B;  3VR8 B;  2WXP A;  3GE8 C;  3ZNG C;  3C8Y A;  1V6E A;  1C4C A;  2KWD A;  1PGB A;  1SE9 A;  3SDL C;  2W82 A;  5J18 A;  4P6V F;  1P9D U;  2FUH B;  4MEM A;  4EE2 A;  4WQM A;  2NPT A;  2JUO A;  3EEC A;  4CHK A;  1PFD A;  1SBB B;  2DYO A;  3FAH A;  3M3J A;  3UIO B;  2PVO D;  4F1S A;  2WXQ A;  1NDD A;  1CMX B;  4M8M A;  4GU2 A;  1UBI A;  2WDV B;  2ASQ A;  2JZZ A;  2PJH A;  1WYW B;  3Q3J A;  3U2S C;  2MJE A;  5DPS A;  4ARI A;  2WDR B;  3ZDT A;  5JXV A;  1FXI A;  1YMH E;  3AU4 A;  2W55 A;  4HXD A;  2KX0 A;  3Q8B A;  3Q8E A;  3P42 A;  3HHM A;  3IT4 B;  2E6X A;  5GMV A;  3NVV A;  2LEK A;  4LNF A;  2Y5C A;  2BW2 A;  3C0R B;  2KNB A;  1T5X D;  3HRD D;  2GBJ A;  4IUM B;  3LB8 C;  2IBI B;  3H9D A;  4WWN A;  4GDL B;  2MP2 B;  2KC1 A;  2M8S A;  2ZZP B;  4MT5 A;  3S2A A;  2JPH A;  2ZCC A;  2KN5 A;  3P4S B;  1WYG A;  2MX2 A;  4OZB A;  3U4E G;  4II2 B;  3B08 A;  3TEY A;  1UUP A;  3ETR A;  3ML8 A;  2KDI A;  2KAN A;  1WGR A;  1P3Q U;  3UQB A;  2IND C;  2IPK D;  3N3K B;  1SE4 A;  4ACF A;  3QX1 A;  3W5V B;  3ZTC A;  5J2R A;  4I6L B;  1ZPS A;  4M8N A;  3Q3N C;  1QZE A;  3J9C A;  5H92 C;  2FE8 A;  3EUB 2;  2LHD A;  3R7Q A;  1D6E C;  1Y56 A;  5DPR A;  2LUM A;  2IZV B;  2RDH A;  4YWG G;  1UD7 A;  2C7M B;  4ZDV A;  4NJ7 A;  1M4V A;  2WXK A;  4NJ6 A;  2N9L A;  2ZNV C;  3ZKJ C;  4IM3 A;  5FKA C;  1SXT A;  4WUR A;  1R4N I;  3CSF A;  1TS3 A;  3ZJU A;  2HTM E;  5EE0 A;  1FNU A;  2R61 A;  2PEA A;  2KQ4 X;  2SEB D;  4I6N B;  5MPO A;  4G11 A;  5DCN A;  4GIV A;  4ZYN A;  4A55 A;  4UDU C;  4L2Y A;  3URY A;  5IP4 D;  3FIL A;  2D07 B;  4HEA 1;  4LNN A;  2L83 A;  1D5Z C;  2MLB A;  4JPS A;  1WGH A;  2N0S B;  1ZW7 A;  1YN5 A;  1XLQ A;  2ICI A;  4KGS A;  1F9J A;  5EE3 A;  4KGT A;  5AZF A;  2MBO A;  2K8B A;  2NMQ A;  3HM6 X;  4IWO A;  4LNO A;  2BYT A;  1L6V A;  3P63 A;  5AUI A;  1VJK A;  3PZD A;  4OVV A;  1JCK B;  5IO9 A;  2M0A A;  4J3O D;  4NY0 A;  2BPS A;  1L2N A;  4MSM B;  2K3U A;  1YN4 A;  3SR6 A;  3DWM A;  2INC C;  4ZRQ A;  2XBB C;  1GC6 A;  4WJP A;  2GB1 A;  4MJS A;  4W9I A;  2WXI A;  2KWU B;  3DHG C;  3L17 A;  1YJI A;  1BUI C;  4M02 A;  3K9O B;  2W54 A;  3R2I A;  1V1O A;  4HRO A;  1FIQ A;  5AEK B;  4B6W A;  3Q8A A;  2A4Z A;  2WWZ A;  4KZ0 A;  1IPG A;  1CZP A;  5IN7 A;  2MP2 A;  2IY0 B;  1MVK A;  3BWU D;  1WI0 A;  3AE5 B;  3PSE B;  4HJK A;  3A9J B;  4EKU A;  3V05 A;  1FD6 A;  4BKG A;  1SJE D;  2CR5 A;  4YSZ B;  2OHF A;  4TUU A;  4N9F 4;  2UU7 A;  1XLP A;  1YQ3 B;  4XX5 A;  2M17 A;  2BB5 A;  3OJ3 A;  3QJZ A;  4JX1 C;  2WDQ B;  3WCQ A;  4YSX B;  1FPY A;  2KAC A;  1EWC A;  4YTM B;  1JW9 D;  3V61 A;  3RN9 C;  4NZL B;  1MI0 A;  1WSP A;  3O13 A;  1M94 A;  3OAW A;  1EU3 A;  3Q3O C;  1SF0 A;  1E8X A;  2K6Q A;  2O2V A;  2LRU A;  1GB4 A;  2G4D B;  1QIL A;  1OEY A;  4RCO A;  3AE8 B;  2H88 B;  3RYT A;  5IA7 A;  2G3Q B;  3UF8 A;  1XQQ A;  2PLP A;  3HIZ A;  4C00 A;  3N1Z C;  5BO4 B;  4GOC A;  3PRE A;  3I9V 1;  3V60 A;  2DEN B;  3DDC B;  4LDT D;  4E74 A;  1FRD A;  2BBC A;  2Y3A A;  4GSW A;  1TY0 A;  4F8C B;  5BYR A;  4N59 A;  5H8Y E;  1WR6 E;  2GMI C;  3AE9 B;  1I35 A;  3KUZ A;  1DOX A;  3KLS X;  3VUY A;  1WM2 A;  2W9N A;  4NPN A;  2FID A;  4ZRP A;  3L10 B;  2RSU A;  1MG8 A;  3GB1 A;  4PYZ A;  1EM7 A;  2DWQ A;  3TUO A;  4KGR A;  3TJP A;  1B1Z A;  5HG2 A;  2FCS A;  2QHO A;  3GOE A;  4DXG A;  2KDB A;  3ZNI D;  3L13 A;  2I2Y A;  5IAA C;  3RNA C;  2VH2 A;  4DQO C;  4A20 A;  1I42 A;  4MH8 A;  2G9H D;  2JT4 B;  4WH4 A;  4HPM B;  1WJ4 A;  5T8I A;  1R7S A;  4W9D A;  2N7J A;  1E90 A;  1T0Q C;  1AW7 A;  4FJZ A;  3ZNH B;  4BOZ B;  2WYQ A;  2IYD B;  4TSS A;  2KK8 A;  3BY4 B;  4GN1 A;  1WXA A;  2LUE A;  1FO4 A;  2WXO A;  4RGN A;  4MGZ E;  2HTH A;  4DHJ D;  2PKO A;  2J4X A;  3B2G A;  4GB9 A;  4D2K A;  4GLS C;  1E6E B;  3SHQ A;  1I4H A;  3RI7 C;  2QIE B;  3TEX A;  1L4Z B;  4LTU A;  3JSV B;  2M0X A;  3PRZ A;  1RWS A;  3RNF C;  4X57 B;  1SJH D;  1L7Y A;  2C7H A;  1DYQ A;  4KSL C;  3W1S C;  1T6B X;  3A9J A;  2KC2 A;  4NAW B;  3FKY A;  1SIF A;  3BYY B;  1FXA A;  3AE6 B;  2WNM A;  4KSK C;  4TQ0 A;  3Q8C A;  1KLG D;  4ANX A;  5LNK 1;  3MJ5 A;  2BQQ A;  3ENE A;  5EDS A;  3P4P B;  1UEL A;  1NEK B;  2RPV A;  2KD0 A;  4FAD A;  2WDT B;  4AUQ C;  1V80 A;  2INP E;  3MP9 A;  4RM9 A;  5BMI A;  2WS3 B;  1N5W A;  2QC8 A;  1OQQ A;  3N32 A;  2DNF A;  2FBW B;  4HCN B;  2L8J A;  4F7Z A;  4G50 A;  1XCT L;  4NNJ B;  1A5R A;  2KZR A;  2J53 A;  4G0N B;  2LGS A;  4RNA A;  3IHP C;  1WMH A;  3NVW A;  2CHZ A;  1QOG A;  3PZ8 A;  3X23 A;  4IW0 A;  4A90 A;  3WAO A;  3L16 A;  3KYC D;  4ZHP A;  3DBS A;  4AQ7 A;  2ZEQ A;  2L7R A;  3QQ8 B;  3QC8 B;  3RFZ B;  2NVU I;  2MJD A;  2IO1 B;  4M0W B;  2JZP A;  1RLF A;  3ZW3 A;  5E6P A;  1Q0W B;  1U4A A;  2O6V A;  5DPT A;  1ZDV A;  1Z2M A;  3H6N A;  1VZ8 A;  3MC0 B;  3TEW A;  4ZHO A;  4ASW C;  1MHH E;  2O6V D;  3B1L X;  4IC7 B;  4RGO S;  1J8C A;  4P1C C;  1JRO A;  2D3G A;  4JQW C;  4JWU C;  1EU4 A;  2BKF A;  3MC9 A;  1WXQ A;  4RH6 A;  2BYE A;  1C3T A;  3VVW B;  4BBN C;  2LJ5 A;  1TIF A;  2QEJ C;  3NHE B;  1MG4 A;  3AB5 A;  4KVG B;  1NYR A;  2BVC A;  1KOT A;  2GBM A;  2KOX A;  3OG5 A;  4C80 A;  1I4Q A;  2Z0D B;  3VRA B;  1XCQ L;  2DLB A;  5FK9 C;  4W9J A;  1WIA A;  4GXB A;  2KJH B;  1ET6 A;  3AU5 A;  2JXT A;  2K25 A;  1NI2 A;  4WWM A;  5C1Z A;  4B9K A;  2V0G A;  3PO0 A;  2L52 A;  4LNK A;  1FCC C;  2D3A A;  4BOS C;  1NYQ A;  4MJS B;  2KWC A;  1XXG A;  5LLI A;  1E9M A;  5BMG A;  2C9W B;  4K3B A;  1K50 A;  1KRH A;  4HDQ A;  4RGM A;  1OFF A;  4XC2 A;  2KTR B;  2KKC A;  1LGR A;  2XN9 C;  2ZPY A;  2V3P A;  2KYW A;  2ZCB A;  4OHJ A;  2WLB A;  2NBU A;  3R7R A;  2AQ1 B;  4MDK E;  1UWM A;  1J7C A;  3N9Y C;  2JSV X;  1FNW A;  1HXY D;  2K5P A;  3MFG A;  1L5P A;  2PPH A;  4DDG D;  3OJ4 B;  3UIP B;  4LNI A;  3W1Y A;  3NJT A;  2L00 B;  2IDY A;  4O1N A;  2IO3 B;  1OEY J;  4EUT A;  4PS3 A;  2R2Q A;  2DZI A;  2D11 A;  4IG7 B;  1HZ6 A;  4W9L A;  1HZ5 A;  4LLG M;  1WF9 A;  3H7S A;  1YQB A;  1QKZ A;  3QCA A;  3M95 A;  3NVY A;  4YSY B;  3DHI C;  1AYF A;  3VAW A;  3VH4 B;  2BB6 A;  2LGY A;  2YLM A;  1PYW D;  1KLU D;  5L83 A;  4LCD E;  3Q3M C;  1E0Z A;  3AE1 B;  1XT9 B;  2LI5 A;  4S17 A;  3NUH B;  3VFK A;  3VXW A;  3IG3 A;  4GDK B;  2JZ3 B;  2CKH B;  3ABV B;  5EE9 A;  1SE3 A;  3A9K A;  3KQ4 A;  2LGD A;  3LYY A;  2V1Y A;  1DOY A;  2DAJ A;  1VRA B;  4N58 A;  1TTN A;  2MW5 A;  4K3C A;  2VZK D;  2QMT A;  3HVZ A;  2L05 A;  3RNG C;  1WJN A;  3V3X A;  2V4I B;  2KQS A;  1YJ1 A;  4FN2 A;  4LK0 M;  3ZTD A;  1WX7 A;  3RNC C;  1KH0 A;  2MWS B;  1YJJ A;  1UF0 A;  5FR3 A;  3DQV A;  4TKN A;  2MEK A;  1UGM A;  4JE3 B;  3RUI B;  3VR9 B;  2MCN B;  3VQI A;  1XLO A;  1S3S G;  5C3J B;  2JRH A;  3C19 A;  3SEB A;  1TKE A;  2KJR A;  3ZJT A;  3QIJ A;  2D3C A;  3L0W B;  4KV2 A;  3H7P B;  2JRI B;  3ZIM A;  4DDI D;  2M1M A;  1SB3 C;  2KAJ A;  3RD2 A;  5EE1 A;  4WWO A;  1J19 A;  5GXG B;  1FFU A;  2R2O A;  4OZC A;  4ZYS A;  1JAL A;  5J17 A;  2BTE A;  2K9X A;  2DZM A;  2N9K A;  3KUD B;  1KM7 A;  1NI3 A;  5I4D A;  5HHD G;  3PZ7 A;  2LHE A;  2LFI A;  2Q5W D;  4ZOH C;  1GB1 A;  3AEA B;  2XNA C;  4PS7 A;  4RF0 A;  2L0T A;  3ZGZ A;  3AED B;  3ML9 A;  3IAM 1;  1IP9 A;  2KQ7 A;  2WXJ A;  2AX5 A;  1F2R C;  2IO0 B;  2BYF A;  4YL8 A;  3MJW A;  3BVZ A;  1RM6 C;  3M63 B;  4BBN F;  4KIK A;  1D4B A;  2LVP A;  4ARC A;  2JVC A;  4Q2J A;  4W9H A;  4G3X B;  5E6O A;  3ZXV A;  2KHW B;  4W9E A;  2D2Q A;  2AQ2 B;  4K7S A;  3V6C B;  4AOF A;  2W3R A;  3P1M A;  3BIN A;  3FIL B;  4DWF A;  1WXV A;  2JWZ A;  2N7E A;  2DBY A;  5KHO A;  4DHJ B;  1MFW A;  2ZNV B;  1ZUD 2;  2RDG A;  2ZVN A;  1DOI A;  3AV8 A;  2EKI A;  4MGI E;  3NOB A;  4AS1 A;  3APC A;  3WA0 A;  2WXH A;  2QDF A;  2LRW A;  3BYT B;  4C4V B;  3QK0 A;  4JL9 A;  1RRB A;  3QAR A;  5CTR C;  2BF8 B;  2IY1 B;  4ZRJ A;  1IBX A;  1GNU A;  4JLC A;  1FXT B;  1L4D B;  5HFY A;  4OVU A;  4W9G A;  2JQR B;  3A4S C;  3BK2 A;  1E10 A;  3BK1 A;  4EZK A;  3N1Y C;  2DHZ A;  3IAS 1;  3PPA A;  3VDZ A;  3ZRF A;  2M19 A;  1YOV B;  1C4P A;  2OOB B;  1E7V A;  2ON8 A;  3CST A;  1V8C A;  3AN1 A;  2I38 A;  5CHV C;  2BWF A;  4HKQ A;  4WAA A;  1F0Z A;  2Y5B B;  1AWD A;  1VR9 A;  1D5X C;  1OQY A;  3AUL A;  4RFB A;  1JWM D;  1ZXH A;  2FAZ A;  1WJ6 A;  1VD2 A;  2IGH A;  2IGG A;  3NRZ A;  1PDX A;  4KDL B;  3PHW B;  2QJL A;  2EMT A;  4YTP B;  4R3D A;  4MEL A;  3TSS A;  1X1M A;  3MHZ A;  1YD8 U;  4K7U A;  4MH0 E;  1D5M C;  1WGD A;  4FJY A;  4RF1 A;  4PT5 A;  3U8Z A;  4FA6 A;  2YVC A;  2J42 A;  1WFY A;  3DBR I;  4NAM A;  3QWZ B;  2C7N B;  3KYD D;  2N9E B;  3ZQ4 A;  1V5T A;  2MRP A;  2AEH A;  2MHJ A;  3AE4 B;  4AJY B;  1GOZ A;  1RAX A;  1F2R I;  3BVG A;  2LVO A;  5C23 A;  2V4L A;  3P2B A;  3KWL A;  1WX9 A;  4N6E B;  3CWI A;  2KDE B;  2W3S A;  5HKH A;  2AYO B;  1WRI A;  2E3T A;  2PTL A;  5D94 A;  1FMA D;  3SFE B;  3APD A;  4JGH B;  4XZ4 A;  4A9A A;  4MM3 A;  1I7H A;  2RGF A;  2BT6 A;  4KIK B;  5JH5 C;  2WX1 A;  3A9K B;  3UI3 A;  1JWB D;  2KFK A;  2Z8L A;  3A1Q B;  3ECI A;  2KT7 A;  1BT0 A;  1RFA A;  3EFC A;  2WXL A;  1FEH A;  1KTK A;  3BII D;  2NBV B;  1ZP0 B;  2B76 B;  3DBL I;  4ZRK A;  3FC4 A;  1P7E A;  2KXJ A;  2JF5 A;  3IBE A;  1MHX A;  3NZS A;  3U7Z A;  2O2V B;  2ACZ B;  1WWT A;  1QOF A;  2WGS A;  1D3Z A;  2X38 A;  3I63 C;  1OTR B;  2WXG A;  2OJR A;  3NZ3 A;  1V86 A;  4K1R B;  2NTS A;  1T0Y A;  4E3C A;  4XDD A;  1HTQ A;  3AEB B;  1YX5 B;  2G1E A;  2K1F A;  1QLB B;  1YNT E;  2ZJD A;  1TS5 A;  4WJN A;  3W1S A;  2MSE D;  2BS2 B;  1I4G A;  3LXF A;  3IXS A;  1P7F A;  4WQO B;  4XGA B;  4C7Y A;  2RPQ A;  1SEB D;  1ZKH A;  2IJ0 A;  3M62 B;  3AE7 B;  3IFW B;  4B0M A;  1TGZ B;  3DCG A;  1ACC A;  3WIM A;  3K9P B;  4WWP A;  4IWP A;  2CHX A;  3ZXR A;  2PE6 B;  1GPX A;  2GBN A;  2FIF A;  2PVG C;  2ZPN A;  2L1A A;  3WAP A;  2VRR B;  4BKS A;  3DBR B;  1P1A A;  2MH7 A;  3VHT C;  4H2A A;  2HJ8 A;  2LZ6 A;  2LXA A;  2V3N A;  2C5L C;  4W9C A;  4OW0 A;  1LFD A;  2LMC A;  4NAW A;  3ZVV A;  2NTT A;  3AEF B;  2QIL A;  4BKS D;  4NQK E;  1V5O A;  4A6Q A;  3OWE B;  1BML C;  3W2D A;  3ZO5 B;  2KN4 A;  3D32 A;  1MPE A;  2FCQ A;  4GGQ A;  4M0W A;  5AZG A;  2KLC A;  1WZ3 A;  3JYU A;  2YEP B;  2LWP A;  1PGA A;  1FFV A;  4FHJ A;  2KO3 A;  3E56 A;  5TSS A;  1I4X A;  3GP7 A;  3VTU A;  4BKT A;  4YTN B;  4FJV B;  1CK1 A;  4ITK A;  1EWY C;  2HJ1 A;  3UQA A;  4A3O A;  1V81 A;  5D2M B;  2KWV B;  1JRU A;  3BZD B;  3EA6 A;  1TT5 B;  3GE3 C;  2OED A;  4I6P A;  2WXN A;  4KZC A;  2NBW B;  3JW0 X;  2B3A A;  2VZK B;  4EZL A;  1L0X B;  4YT0 B;  3Q6B A;  2WXF A;  5CX3 A;  2N9P C;  4HK2 A;  1P98 A;  1Z5S B;  2NS5 A;  4W9F A;  3PGE A;  4FXC A;  3VTW A;  4BFR A;  1T0S C;  1N63 A;  2MA9 B;  1K52 A;  2JWU A;  2M4N A;  3RZF A;  1TZ1 A;  2N1W A;  1WX8 A;  2AL3 A;  3DBH B;  4M01 A;  1FNV A;  4K7W A;  4A8X C;  3SD5 A;  2KX3 A;  1N5X A;  4P7I A;  5D6J B;  2GLS A;  1WXS A;  3V6E B;  3PLU A;  4RGT A;  3RUL A;  4FLH A;  1UBQ A;  2G45 B;  2WQY B;  2KMC A;  2KVR A;  2DZK A;  3BVM A;  3TBL D;  1GC7 A;  3RMK C;  3CIR B;  1WXM A;  2IO2 B;  5BYQ A;  4WJO A;  1HA5 A;  2D10 A;  3WAL A;  2KFJ A;  4FUL A;  3NS1 A;  1L0V B;  4S0R A;  1TJE A;  1E8Y A;  2J52 A;  4TQ1 A;  5D7G A;  3T8M A;  4QAY A;  2D5G A;  3HUI A;  2WU2 B;  4BZA A;  4OVZ A;  2MJ3 A;  1V1P B;  3RCZ A;  3ZLZ A;  1UNS A;  1ISN A;  3RT3 B;  1WM3 A;  2WHI A;  3A4R A;  2CHW A;  2DX5 B;  1HQR D;  1TS4 A;  4PS8 A;  2N7D A;  2GBK A;  2CU3 A;  3KUC B;  3VH3 B;  2BGF A;  4WJQ A;  2KTR A;  1Y8R C;  2K39 A;  4REZ A;  3ONS A;  4J6I A;  3ZUN A;  2BS4 B;  1QF6 A;  2JX5 A;  1N6Z A;  1UZX B;  5DPW A;  3VUX A;  3T3N A;  4HKZ E;  3PV1 A;  4DHZ B;  1TKG A;  1C1Y B;  4ICU A;  3DPD A;  3X0W A;  3UIN B;  3PTF C;  3MHS D;  3AEE B;  4WAF A;  1GAQ B;  2Y5P A;  2JY6 A;  3N20 C;  3EHV A;  2LAS A;  3B2F A;  2PW9 A;  3R3M A;  4YXD B;  4HPL B;  3L54 A;  3ZYY X;  1STE A;  1ZGU B;  3V62 A;  1DGJ A;  2L0F A;  3AM9 A;  2NPT B;  1GJZ A;  2RR9 A;  3JVZ X;  2AWT A;  1SE2 A;  1N60 A;  5TR5 A;  1C9F A;  2G4S A;  1L0Y B;  1WMH B;  1WE7 A;  1I4R A;  1VCB A;  2XK5 A;  4PYU A;  4W9K A;  1BXT A;  2JXX A;  3A33 B;  5G55 A;  1E5W A;  2LXC A;  5JHB A;  1CQV A;  5IKC M;  1P0R A;  4GDK A;  4AWJ A;  1K51 A;  2KLG A;  1TY2 A;  3N1X C;  1ENF A;  3Q69 A;  3ZDM C;  3ZNZ B;  3NY5 A;  2RD0 A;  4USA A;  1K53 A;  4FHK A;  2AL6 A;  1WR1 A;  2PMV A;  3QHT A;  3EC8 A;  4HLE A;  4HRS A;  3NZU A;  5E6J A;  3H8H A;  4IM2 A;  2FNJ B;  2MQJ A;  3AEG B;  3OLM D;  2LGI A;  2H89 B;  3E9S A;  4CO7 A;  1K8R B;  3KH0 A;  2EEL A;  1IGC A;  1KF6 B;  2DZJ A;  4TV3 A;  1Q5W B;  1KJT A;  3HK0 A;  2MBE A;  1YN3 A;  3DVN V;  3I3T B;  2JYE A;  4URK A;  2QSD A;  1FRR A;  2L32 A;  1EF1 A;  3N30 A;  3TCA A;  3AEC B;  4C7Z A;  3EFU A;  3PLV A;  3HM3 A;  2MBB B;  3DBL B;  4TMA B;  4US9 A;  1PUT A;  4EOY A;  4XWW A;  4AJW A;  1FCL A;  4L23 A;  2HE7 A;  3PS6 A;  3AH7 A;  1S1Q B;  5IOI A;  1VZ7 A;  1YIW A;  2BWE S;  2GRI A;  3H7P A;  2V9H A;  5KHQ A;  2LJI A;  2K6D B;  4NQL B;  5FR6 A;  1PGX A;  4JIO U;  3CMM B;  2WX0 A;  1LQB A;  2HD5 B;  2J0M A;  3SU8 X;  1AAR A;  2DYM A;  3I57 A;  2OJW A;  5AZH A;  1C77 A;  3VUW A;  2K0P A;  4HJG E;  1L6U A;  2IGD A;  2KVZ A;  1JML A;  1PQS A;  1Q10 A;  1NVI D;  1ZXI A;  3GZN I;  1JWA D;  2MBH A;  3TIX A;  2KDF B;  3WAN A;  3GS2 A;  4KDI C;  2JYT A;  3R2T A;  4WIP A;  1XF5 L;  2N9X A;  1C78 A;  2K8H A;  3NVZ A;  1HE8 A;  1VZ6 A;  4K81 A;  3RZW C;  2L76 A;  2X8X X;  2KTF A;  4MGY E;  1V2Y A;  1Q1O A;  2XK5 B;  1WY8 A;  1JRP A;  4C56 C;  1ZE3 D;  3W9C B;  2WXM A;  4MAC A;  4KX6 B;  4ANV A;  1WGK A;  5L95 C;  5D3I B;  3AMZ A;  4CQN A;  2LD9 A;  2FCN A;  3R8B A;  1H4R A;  1EF5 A;  4C4V A;  1NBF C;  1IGD A;  4EEW A;  4JWS C;  1RFK A;  2JU6 X;  1F52 A;  2O6V B;  2N4F A;  1LO5 D;  1T3Q A;  2KFK B;  3L4P A;  2C60 A;  4B95 A;  4DXA B;  2I1J A;  5JZE B;  3DOW A;  4HCP B;  1C76 A;  4DK5 A;  4US8 A;  4OZA A;  2FUG 1;  3LJ3 A;  5G5G A;  4RMA A;  3KWV A;  2CJO A;  4B0E A;  1IUE A;  1C4A A;  5D3D A;  4BAX A;  4LDT B;  3DVG Y;  3JSV A;  2RMM A;  1LXD A;  1IYF A;  1ZOY B;  1CJE A;  3EGR A;  1SIJ A;  3I5J C;  5CHW A;  3U52 E;  1FM0 D;  1V1P A;  2N1V A;  1UGJ A;  3T3O A;  3DBH I;  2DYB A;  2INN E;  2PIA A;  1KLV A;  4HDO A;  3AXC A;  4A3P A;  1XD3 B;  1E7P B;  2AQ3 B;  2KJ6 A;  3DVN U;  3AE2 B;  3B9J A;  3L08 A;  4M00 A;  1E8W A;  5LXH A;  3P4Q B;  3APF A;  4ANW A;  3PHX B;  2LGX A;  1YQ4 B;  5E6N A;  1WRD B;  2CS4 A;  1TZO A;  1B9R A;  3O65 B;  4IKG A;  3R66 C;  3LDZ E;  2Z0E B;  2MBQ A;  4IDI A;  1TS2 A;  1E8Z A;  3UGB B;  1IBX B;  3ALB A;  4IWQ A;  3RNE C;  4KKJ A;  4BVU C;  3TEZ A;  2K22 A;  3PT2 B;  3W5U B;  1V97 A;  4E71 A;  1ESF A;  3CF6 E;  3ZRC A;  3PVL A;  1R4N B;  1R4M I;  4HPP A;  3QAQ A;  3MTN B;  2KDM A;  3U30 A;  4ANU A;  1TBE A;  1EUV B;  3TMP B;  2GBR A;  5BYS A;  1VLB A;  3MC8 A;  3QA8 A;  2EMS A;  1V49 A;  3IVF A;  3B0A A;  2ZW0 A;  1WJU A;  1J7A A;  2L3Z A;  4ZRI A;  1OQR A;  4II3 B;  1XO3 A;  2WP9 B;  4P16 A;  2M56 B;  1A70 A;  2J0J A;  1ROE A;  4XE0 A;  2WU5 B;  5BMH A;  1JWS D;  1N62 A;  3AI5 A;  1HTO A;  1E7U A;  3ZJV A;  1R4M B;  1UH6 A;  1J0G A;  1QOA A;  1WH3 A;  2GI9 A;  3A1Q A;  2Z59 B;  3GZN B;  3Q14 C; 
#chains in the Genus database with same CATH homology
 2KJR A;  1UBQ A;  3QIJ A;  4XX5 A;  2EKE C;  2M17 A;  1WE6 A;  3L0W B;  3OJ3 A;  3QJZ A;  5CHF A;  2G45 B;  4KV2 A;  2KMC A;  2KVR A;  3PRP B;  3H7P B;  2DZK A;  2JRI B;  3TBL D;  1GC7 A;  3ZIM A;  4HVB A;  3V61 A;  3Q3F A;  4DDI D;  1WXM A;  2M1M A;  2BYV E;  3RD2 A;  2IO2 B;  4WWO A;  1J19 A;  2I1K A;  4GDL A;  1M94 A;  3OAW A;  4WJO A;  4LJO B;  2D10 A;  2R2O A;  2KFJ A;  4IM0 A;  3WAL A;  4DBG A;  4FUL A;  1E8X A;  2K6Q A;  2PE9 A;  2O2V A;  5J17 A;  2LRU A;  2DZM A;  2G4D B;  5LXI B;  1OEY A;  3KVF B;  3RYT A;  5IA7 A;  5JHA A;  1H8C A;  2G3Q B;  2J0K A;  3KUD B;  3UF8 A;  1KM7 A;  1E8Y A;  1XQQ A;  4TQ1 A;  3HIZ A;  5D7G A;  5BO4 B;  3T8M A;  2V3S A;  4AP4 C;  2CU1 A;  3PRE A;  4GOC A;  3V60 A;  2DEN B;  3DDC B;  4EFO A;  4LDT D;  1V9J A;  3RCZ A;  4RM8 A;  3ZLZ A;  4E74 A;  1ISN A;  4PS7 A;  3RT3 B;  4GMV A;  1WM3 A;  2L0T A;  3A4R A;  4GSW A;  1GG3 A;  2CHW A;  2DX5 B;  4F8C B;  3ML9 A;  2UYZ B;  1GUA B;  2KQ7 A;  1IP9 A;  4ICV A;  4HWI B;  4PS8 A;  2N7D A;  1WR6 E;  2GBK A;  2BYF A;  2GMI C;  2IO0 B;  2BGF A;  2XEW A;  2FCM A;  2BKR B;  3KUC B;  3MJW A;  4WJQ A;  3KUZ A;  4YL8 A;  3VTV A;  2KTR A;  1Y8R C;  1I35 A;  2K39 A;  2NCN A;  3ONS A;  4J6I A;  1WM2 A;  2W9N A;  4NPN A;  3VUY A;  2FID A;  3ZUN A;  3M63 B;  3L10 B;  4BBN F;  3VQI A;  4KIK A;  2RSU A;  1EO6 A;  1MG8 A;  2LVP A;  1UZX B;  5DPW A;  3VUX A;  4PYZ A;  1WGG A;  2JVC A;  1G6J A;  2DAF A;  3TJP A;  3KW5 B;  3PV1 A;  4CYE A;  4DHZ B;  4W9H A;  2ZVO A;  4G3X B;  5E6O A;  1C1Y B;  2KHW B;  2NR2 A;  3DPD A;  4ICU A;  4W9E A;  3X0W A;  2FCS A;  2D2Q A;  2QHO A;  3GOE A;  3UIN B;  3NS8 A;  4K7S A;  2KDB A;  3PTF C;  3MHS D;  3PRM B;  3ZNI D;  3V6C B;  3RUL A;  3L13 A;  2GOW A;  4AOF A;  2KMA A;  5IAA C;  2K8C A;  4A20 A;  1I42 A;  2JY6 A;  3BIN A;  4DWF A;  1WXV A;  2JT4 B;  3EHV A;  2JWZ A;  2N7E A;  2LAS A;  4HPM B;  1WJ4 A;  3H1U A;  5KHO A;  4DHJ B;  2ZNV B;  3R3M A;  4MSQ B;  4HPL B;  3L54 A;  4W9D A;  2ZVN A;  1E90 A;  1ZGU B;  3V62 A;  4FJZ A;  3ZNH B;  1WGY A;  2L0F A;  2NPT B;  4MGI E;  4BOZ B;  2RR9 A;  2WYQ A;  1GJZ A;  3JVZ X;  2IYD B;  2AWT A;  2KK8 A;  3NOB A;  2A5U A;  2J7Q B;  5TR5 A;  3BY4 B;  4GN1 A;  2G4S A;  3APC A;  1WXA A;  1WMH B;  3WA0 A;  2LUE A;  2LRW A;  2LVQ A;  3QK0 A;  4JL9 A;  4LJP B;  1WE7 A;  1VCB A;  2UWQ A;  2XK5 A;  4PYU A;  1RRB A;  3QAR A;  4MGZ E;  4W9K A;  5CTR C;  2BF8 B;  3TL5 A;  1OGW A;  2HTH A;  1WZ0 A;  3T9L A;  4DHJ D;  2JXX A;  2IY1 B;  3A33 B;  4ZRJ A;  5G55 A;  1E5W A;  4GB9 A;  2LXC A;  5JHB A;  3SHQ A;  2REX A;  1GNU A;  1P0R A;  4GDK A;  4EZJ A;  3DVG X;  4JLC A;  1FXT B;  3JSV B;  4MGK E;  2M0X A;  3PRZ A;  4AWJ A;  2KLG A;  4OVU A;  4W9G A;  4X57 B;  1L7Y A;  2C7H A;  3ZDM C;  3ZNZ B;  4KSL C;  3A4S C;  3W1S C;  1LM8 B;  3NY5 A;  4FBJ B;  2RD0 A;  4EZK A;  3A9J A;  2KC2 A;  4FHK A;  2AL6 A;  1WR1 A;  3QHT A;  4NAW B;  2DHZ A;  3EC8 A;  3PPA A;  3VH3 B;  3VDZ A;  3ZRF A;  4HLE A;  1SIF A;  1YX6 B;  3NZU A;  1SGH A;  3WAM A;  5G2N A;  2OOB B;  1E7V A;  4IM2 A;  3CST A;  2FNJ B;  2MQJ A;  4KSK C;  4TQ0 A;  5CHV C;  4ANX A;  2BWF A;  3OLM D;  3ENE A;  4WAA A;  2Y5B B;  4CO7 A;  5EDS A;  3ZNG C;  1V6E A;  1K8R B;  3KH0 A;  3AUL A;  1OQY A;  2FAZ A;  1WJ6 A;  1UEL A;  1VD2 A;  2KD0 A;  4FAD A;  2DZJ A;  1SE9 A;  3SDL C;  4TV3 A;  5J18 A;  2WDT B;  4AUQ C;  1V80 A;  4KDL B;  3PHW B;  1Q5W B;  1P9D U;  2FUH B;  4RM9 A;  1KJT A;  4MEM A;  3HK0 A;  2EMT A;  2MBE A;  3DVN V;  3I3T B;  4MEL A;  1X1M A;  4URK A;  2NPT A;  2JUO A;  3EEC A;  1EF1 A;  1YD8 U;  3N32 A;  3N30 A;  3TCA A;  4CHK A;  4K7U A;  3EFU A;  2DYO A;  3PLV A;  4MH0 E;  1WGD A;  4FJY A;  3U8Z A;  4HCN B;  3HM3 A;  2MBB B;  3M3J A;  4FA6 A;  2YVC A;  3UIO B;  2L8J A;  4F1S A;  1NDD A;  4F7Z A;  4G50 A;  1CMX B;  4EOY A;  1WFY A;  3DBR I;  4NNJ B;  4AJW A;  3QWZ B;  1A5R A;  2C7N B;  2KZR A;  2HE7 A;  3KYD D;  4G0N B;  2N9E B;  3PS6 A;  4M8M A;  4GU2 A;  1UBI A;  1V5T A;  3IHP C;  2ASQ A;  2MRP A;  1WMH A;  2AEH A;  2JZZ A;  1S1Q B;  1WYW B;  2PJH A;  3Q3J A;  1YIW A;  2BWE S;  2CHZ A;  5DPS A;  3H7P A;  3X23 A;  4IW0 A;  5KHQ A;  4AJY B;  3ZDT A;  2K6D B;  1RAX A;  3AU4 A;  4NQL B;  3L16 A;  3KYC D;  3WAO A;  5FR6 A;  3DBS A;  4JIO U;  2ZEQ A;  4HXD A;  3CMM B;  2KX0 A;  2L7R A;  2LVO A;  5C23 A;  3QQ8 B;  2V4L A;  3QC8 B;  2WX0 A;  3P2B A;  2NVU I;  3HHM A;  1LQB A;  1WX9 A;  2HD5 B;  2IO1 B;  4M0W B;  1RLF A;  2J0M A;  3ZW3 A;  3SU8 X;  2KDE B;  5E6P A;  1Q0W B;  1AAR A;  2DYM A;  5GMV A;  1U4A A;  5HKH A;  2AYO B;  2O6V A;  5DPT A;  5D94 A;  5AZH A;  3VUW A;  3C0R B;  2KNB A;  1Z2M A;  2GBJ A;  4IUM B;  3APD A;  3H6N A;  4JGH B;  4XZ4 A;  2IBI B;  3H9D A;  4MM3 A;  4WWN A;  1PQS A;  2RGF A;  4KIK B;  3GZN I;  5JH5 C;  4ASW C;  2MBH A;  4GDL B;  2O6V D;  2MP2 B;  2KC1 A;  2WX1 A;  3A9K B;  3B1L X;  2M8S A;  4IC7 B;  3TIX A;  2KFK A;  2ZZP B;  2KDF B;  3A1Q B;  3WAN A;  3ECI A;  1J8C A;  1BT0 A;  2D3G A;  4JQW C;  1RFA A;  3S2A A;  4KDI C;  2JPH A;  2BKF A;  2ZCC A;  2KN5 A;  2NBV B;  3DBL I;  2MX2 A;  2N9X A;  4ZRK A;  2KXJ A;  4II2 B;  3B08 A;  2BYE A;  1C3T A;  2JF5 A;  2K8H A;  3VVW B;  4BBN C;  1HE8 A;  3IBE A;  4K81 A;  3RZW C;  2LJ5 A;  3ML8 A;  2KDI A;  3NZS A;  2KAN A;  1WGR A;  2O2V B;  2L76 A;  3NHE B;  1P3Q U;  4KVG B;  2KTF A;  3UQB A;  4MGY E;  1V2Y A;  1Q1O A;  1KOT A;  2GBM A;  2XK5 B;  1D3Z A;  1WY8 A;  3N3K B;  1OTR B;  2KOX A;  2OJR A;  2Z0D B;  3QX1 A;  4ANV A;  1V86 A;  5L95 C;  4K1R B;  3ZTC A;  5J2R A;  4I6L B;  1T0Y A;  1WIA A;  4W9J A;  4M8N A;  4E3C A;  4GXB A;  1YX5 B;  2KJH B;  1QZE A;  2K1F A;  2LD9 A;  2FCN A;  3AU5 A;  2K25 A;  2ZJD A;  1NI2 A;  4WJN A;  3W1S A;  1H4R A;  1EF5 A;  5C1Z A;  4B9K A;  1NBF C;  3R7Q A;  4EEW A;  2MSE D;  5DPR A;  2O6V B;  4BOS C;  2N4F A;  4MJS B;  2KFK B;  2KWC A;  4WQO B;  2C60 A;  4B95 A;  2RPQ A;  4DXA B;  2I1J A;  1ZKH A;  3M62 B;  5JZE B;  3DOW A;  4HCP B;  2IZV B;  5LLI A;  3IFW B;  1TGZ B;  4DK5 A;  3DCG A;  3WIM A;  1UD7 A;  2C9W B;  2C7M B;  3K9P B;  3LJ3 A;  4WWP A;  4ZDV A;  4NJ7 A;  4IWP A;  4HDQ A;  2CHX A;  2KTR B;  2KKC A;  4RMA A;  4XC2 A;  3U7D A;  2PE6 B;  4NJ6 A;  2GBN A;  2FIF A;  2ZNV C;  2ZPN A;  2ZPY A;  3ZKJ C;  4IM3 A;  3WAP A;  2ZCB A;  2VRR B;  1R4N I;  3CSF A;  4BKS A;  4LDT B;  3DVG Y;  3JSV A;  2NBU A;  3R7R A;  4MDK E;  2PEA A;  1LXD A;  1P1A A;  3VHT C;  1IYF A;  4I6N B;  2HJ8 A;  2LZ6 A;  2LXA A;  4G11 A;  5DCN A;  4DDG D;  2PPH A;  4GIV A;  2C5L C;  4W9C A;  4ZYN A;  1LFD A;  3OJ4 B;  4NAW A;  3UIP B;  3ZVV A;  5CHW A;  3W1Y A;  4BKS D;  2L00 B;  4NQK E;  1V5O A;  2N1V A;  3ZO5 B;  3DBH I;  2IO3 B;  1OEY J;  4EUT A;  2D07 B;  2DYB A;  4PS3 A;  2R2Q A;  2MLB A;  1KLV A;  2DZI A;  4HDO A;  1WGH A;  3AXC A;  2FCQ A;  2D11 A;  3D32 A;  4GGQ A;  4IG7 B;  1XD3 B;  5AZG A;  1ZW7 A;  2KLC A;  4W9L A;  1WZ3 A;  4A3P A;  2KJ6 A;  3JYU A;  1WF9 A;  3DVN U;  2LWP A;  3H7S A;  1YQB A;  3QCA A;  3M95 A;  1F9J A;  3L08 A;  4FHJ A;  2KO3 A;  1E8W A;  5LXH A;  3APF A;  4ANW A;  3PHX B;  2LGX A;  5AZF A;  2MBO A;  2K8B A;  4IWO A;  3HM6 X;  5E6N A;  3VAW A;  3VH4 B;  1WRD B;  2CS4 A;  2LGY A;  2YLM A;  3VTU A;  3O65 B;  3R66 C;  4BKT A;  3LDZ E;  2Z0E B;  5L83 A;  4LCD E;  2MBQ A;  3PZD A;  4FJV B;  1XT9 B;  1E8Z A;  2LI5 A;  3UGB B;  3ALB A;  4OVV A;  4IWQ A;  3VFK A;  3VXW A;  4BVU C;  4DHZ E;  3IG3 A;  4GDK B;  2JZ3 B;  3PT2 B;  2CKH B;  4NY0 A;  3UQA A;  2BPS A;  4A3O A;  1L2N A;  1V81 A;  5D2M B;  2KWV B;  3A9K A;  1JRU A;  4MSM B;  2LGD A;  2V1Y A;  4E71 A;  4I6P A;  4KZC A;  2NBW B;  3JW0 X;  3CF6 E;  2XBB C;  1GC6 A;  2B3A A;  4WJP A;  2DAJ A;  4EZL A;  3ZRC A;  4MJS A;  3PVL A;  1TTN A;  4W9I A;  2KWU B;  5CX3 A;  2MW5 A;  1R4M I;  2N9P C;  3QAQ A;  4HK2 A;  1P98 A;  1Z5S B;  2NS5 A;  3L17 A;  4W9F A;  3MTN B;  3U30 A;  4ANU A;  1TBE A;  3PGE A;  1EUV B;  2L05 A;  2GBR A;  3K9O B;  1WJN A;  3TMP B;  3QA8 A;  2EMS A;  1V49 A;  3VTW A;  3IVF A;  4BFR A;  3B0A A;  1WJU A;  2MA9 B;  2L3Z A;  5AEK B;  4B6W A;  4ZRI A;  2A4Z A;  2M4N A;  2WWZ A;  3RZF A;  2KQS A;  4II3 B;  1YJ1 A;  4FN2 A;  1TZ1 A;  4KZ0 A;  3ZTD A;  1IPG A;  2N1W A;  1WX8 A;  2AL3 A;  1WX7 A;  2MP2 A;  2IY0 B;  2J0J A;  4K7W A;  1WI0 A;  2MWS B;  3PSE B;  4HJK A;  3SD5 A;  3DQV A;  2KX3 A;  3A9J B;  4EKU A;  3AI5 A;  4BKG A;  4P7I A;  2CR5 A;  5D6J B;  1E7U A;  4TKN A;  1WXS A;  1UH6 A;  1UGM A;  1J0G A;  4TUU A;  3V6E B;  3PLU A;  3RUI B;  1WH3 A;  4N9F 4;  2MCN B;  3A1Q A;  1S3S G;  2Z59 B;  4FLH A;  2JRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...