1FNUA

Structure of streptococcal pyrogenic exotoxin a
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
221
structure length
221
Chain Sequence
QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYTIDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDNKTSQIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords EXOTOXIN TYPE A PRECURSOR (ALLELE 1)
publication title Structure of streptococcal pyrogenic exotoxin A reveals a novel metal cluster.
pubmed rcsb
total genus 59
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fnuA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fnuA02
1QILA 3CHBD 1G8ZD 3GP7A 3MFGA 3R2TA 4RGTA 3BYTB 4RHRA 1EFID 1V1OA 3BVGA 4RGNA 5ELBA 1KLUD 1LT3D 1LTTD 1XXGA 2ICIA 2RDGA 1TS2A 1EEID 1DJRD 2AQ2B 1PTOF 4L63B 3SEBA 2RDHA 1I4QA 1BCPF 1I4PA 1LTBD 1D6EC 2IJ0A 3OWEB 1LT6D 1JQYD 4UDUC 2CHBD 5I4DA 1PZID 3BVMA 5D3IB 1S5DD 1FNUA 1TY2A 4RGMA 4K6LA 3DWAA 1KTKA 1SJED 1S5FD 1ET9A 1ESFA 2O2LD 1SE4A 1B1ZA 1LLRD 2XRSD 1PYWD 1V1PB 1S5ED 1LTID 1PTOB 1B44D 5D3DA 1CQVA 2QILA 1JWUD 3BYYB 4DXGA 1KLGD 1BCPB 1I4XA 3BVZA 5FK9C 3EA6A 2AQ3B 3EFXD 1CK1A 2WV6D 2R61A 1RF2D 1T5XD 1PTOC 4BWGB 5ELEA 2IPKD 1TY0A 1BCPC 1HQRD 1RDPD 1EU4A 4ZYSA 2G9HD 1FGBD 4RHSA 1PZKD 1BCPD 2SEBD 3KLSX 1RD9D 1FD7D 1UUPA 2QEJC 4RFBA 4O1NA 5ELFA 1STEA 1LTAD 1SE3A 3TSSA 1HTLD 1CT1D 1PRTF 3R2IA 4TSSA 1I4RA 1SXTA 4RGOS 1HXYD 2J4XA 1JWSD 1V1PA 3BZDB 5TSSA 1L0XB 1I4HA 1F77A 1TS3A 2AQ1B 2XN9C 1FNVA 1JWMD 3DWQA 1LTSD 1JCKB 1FNWA 1S5CD 2TSSA 1CHPD 1EEFD 1ET6A 1LTRD 4NZLB 2NTSA 4C56C 1PTOD 1PZJD 1S5BD 1M4VA 1D5XC 1XTCD 1RCVD 5ELDA 1I4GA 1PTOH 1TS5A 1HA5A 1PRTB 4RH6A 4DXFA 1LO5D 1CHQD 1BXTA 1ENFA 3DWPA 1LTGD 1YN5A 1L0YB 3W2DA 1UNSA 2Z8LA 3V05A 1SBBB 1EWCA 1JR0D 1SEBD 1SJHD 5ELCA 1LT5D 1D5ZC 1LT4D 1SE2A 4L6TB 3R8BA 3URYA 1YN4A 4RCOA 1PRTC 1YN3A 2NTTA 1EU3A 5FKAC 1AW7A 3MC0B 1GOZA 1DYQA 1PRTD 4OHJA 1TS4A 1D5MC 3O13A 4Z9CB 2XRQD 1MD2D 1AN8A 2XNAC
chains in the Genus database with same CATH superfamily
3KW5B 2A1AA 4W9HA 2JA7G 3H7PB 1PFNA 3PPAA 2KEDA 4N9PA 3I4NB 3BYTB 2EYLA 1N61A 2BDOA 1YJNA 1SR3A 1S3SG 1I94Q 3U4VA 1L6VA 1AYFA 4DK0A 4LTUA 1IBLL 3BK1A 4L63B 3TN2A 3FDTA 4IUUA 4ZKBB 4DV4L 3AI5A 2NVYH 4CKBA 2ASBA 4V190 2L12A 2MUYA 3RR5A 1N34L 1Y1VG 2FBWB 2GVBA 1SROA 1H9JA 4FYDA 3ONAB 2AL6A 4POGA 2LVOA 3P42A 1KTKA 2E2IH 3PUWA 2LVQA 3DVNV 5FLXL 1B8AA 3JAME 3NJTA 1OGWA 1NI2A 1PTOB 3IHPC 1B44D 2QILA 1S40A 1XCTL 4DF7A 2WFWA 4XX5A 4KTAA 4X3SA 5AZGA 2ZTEA 3GTKB 2PMZE 1PFDA 2R2OA 1U4PA 4K7SA 2MPMA 5FLMH 4AP4C 2DZKA 3VR8B 2IGDA 4PNYA 4LF5L 1SN8A 1WI5A 2R61A 5CYUA 4MGYE 2JJQA 3PO3H 2HT1A 2UU7A 4BWGB 2F0EA 4A76A 1QNKA 4KN4C 2BVCA 1C9OA 4A8XC 1Q1BA 2IWHA 1N36L 4NNJB 2V1CC 5M5XH 1L0VB 2LI5A 4YL8A 1GXDC 1YJ1A 2JSVX 3M3YB 1XJVA 1XLPA 2KJHB 3HOWG 1C4QA 1O7ZA 4RAUC 5JHBA 2RSUA 2DZJA 4TSSA 3AMUA 2WXQA 1Y8RC 4RA8A 1EF1A 1GJXA 1TJEA 2MLBA 4JOIC 2K50A 1NR2A 4ARCA 4WRDA 1WXSA 4LNOA 2F0SA 2L5TA 4IJLA 3K57A 2X38A 2ZVNA 5HHDG 2AQ1B 3A74A 4JI5L 4CJ0B 3LX0A 1IBMQ 2MBHA 2PIAA 4HSVA 2ZW0A 1OEYJ 1Y56A 3DBHI 4DDGD 1X3EA 4C56C 3LGJA 2WDQB 3JVZX 4XGAB 3C46A 4QCLA 1F9JA 1Q1OA 3K5MA 2MBQA 1CSQA 4CGYB 1WJ4A 3F8TA 3HZXA 3CC2A 3NZUA 3T16A 2E74C 4I6LB 3PSEB 3M4OH 3PO3G 1PHJA 3S1QH 4XQNA 3SGIA 2NVXB 1JJGA 1WFYA 1YZ6A 1WIAA 2GLSA 3FVQA 1XQQA 3FHWA 4LW1A 2PLPA 3GTGH 2XBBC 3I3CA 4QIWB 3VDZA 1E0ZA 1IW7C 4HEDA 4Y7NB 2NBFA 1NMFA 1EU3A 1WXMA 4A6QA 1IW7D 1W6KA 2NVYB 5BR8L 2M2LA 2RCNA 2F0IA 1QOFA 1ZP0B 1HE8A 2Z0EB 4PYUA 1GO3E 3MXNB 1IYVA 3AEBB 4KKTA 3S1NH 2F0KA 1JRPA 4X62L 4O42A 5TR5A 3LXFA 1D7QA 3ICEA 1E2WA 1YHBA 4B3ML 4RM8A 3MFGA 2ZJQA 1JOOA 2K5QA 4RHRA 2E2IB 1EL0A 2WKCA 1NI3A 5EPJA 1WGGA 3A9JB 4ANWA 1GPXA 2MSED 3BS1A 5ELBA 1YMHE 1BT0A 4HKZE 1U4MA 4PMCA 1DD2A 1TS2A 4MEMA 2AQ2B 2IX1A 2L3ZA 3DBSA 3Q6SA 3SEBA 4DXAB 1EYGA 4DV1Q 1QZEA 1BCPF 4JX1C 5I9PA 2PTLA 2CR5A 3J80E 2PW9A 2W3RA 2I5LX 2AMCB 1Q7YC 2B63H 3AE8B 4RKLA 2Q2IA 4C2MB 1C78A 4B9KA 5EBCA 1C77A 2DZMA 2EY1A 1YVCA 2VZKD 4TV3A 2I2YA 1WE6A 2CKZB 1TBEA 2HIXA 5G55A 1N33Q 1Q5WB 1SNMA 1WJJA 1Q0WB 3O65B 1PYWD 2AHOB 5M5XB 4QJFA 1XX8A 1U4LA 3U2SC 4OW0A 4DR6L 2I1KA 5CBEE 1K8GA 1JT8A 3KDFB 4ME5A 1RWSA 4GGQA 5C3EH 3VUYA 5EPKA 3VH4B 3KF6B 2PZUA 3CMMB 5HY6A 4N9F4 3FC4A 3NEMA 3V6CB 4DR2Q 3J81E 2Q5WD 3DWMA 3UIOB 4IPCA 1YHQA 5C0XI 3DVNU 3KYDD 1SNOA 1IGCA 2PE6B 5T8IA 3EJIA 4RHSA 5M5YH 3PUZA 3VRBB 1PZKD 3K0XA 2X8XX 2W54A 2HCCA 4GN3B 3BIID 1STEA 4WH4A 1JE5A 1ICFB 2BYVE 2JA8G 2PO4A 2PQAA 1HTLD 1PH7A 1I4RA 2DJFC 2FCSA 2QJLA 2XWBB 4P16A 2KVZA 2H4OA 5L95C 1V1PA 3B0AA 3M4OB 1SFOB 4LFAQ 1UZXB 1VQEA 2KHWB 1BNZA 4KKSA 4LF9L 3A9KA 1FNVA 1SDFA 3B2FA 3T9LA 3LDZE 3AYHB 1U4RA 2YVCA 3RNAC 3W1SC 1CHPD 1IXRA 4IFDH 3RUIB 3APFA 1Y8NB 4US9A 4A3GH 1K50A 1IBKQ 2HTME 1RKNA 4R4TA 5C3EG 1DOYA 5EKKA 2KLGA 2KLCA 3S1NB 2ID0A 4APVA 4BVUC 1KAWA 3T51B 2N9PC 1UNSA 5MPOA 1SBBB 1VQJA 3CQZH 3RLOA 4A4IA 1PQSA 4OVZA 3HHMA 4IOCA 2QDFA 4LAAA 1F2RC 3KUDB 2IGGA 3AU5A 2LGYA 1L2NA 2AL3A 3DUZA 2KHIA 4WWPA 1Y8OB 4USAA 3MC0B 3N6RA 2E2JH 5CORA 1OQYA 4HPLB 2MJ3A 1TWFH 3ML8A 3N3KB 3QWNA 2B63B 3K7AB 4JV5Q 4KHPL 1XT9B 1TTNA 2PMVA 2B2YA 4EQ5A 4UP8A 1R4MI 1EF5A 4IPDA 2DZIA 3LWEA 2LXCA 2FXQA 3AECB 3PO2H 4CDCC 4C4VB 2L55A 2KDIA 2RHSB 2KC1A 4BAXA 3PIOA 4GOPB 1B53A 4NXMQ 4AOFA 1K0RA 2RSOA 4MIUA 1R4NI 4A3GG 4CHKA 1IUEA 3HUIA 5EQ0A 2QSDA 2PI2E 1PZID 1E2ZA 5JPNC 2K5NA 3WIMA 4DV3L 2G4DB 1FNUA 2WWZA 3L3OC 3OIQA 2R7ZG 1S5FD 4CKCA 4HIOA 4OVUA 1OQRA 5CX3A 2NBUA 1B1ZA 1KC8C 3HM3A 1K28A 4PG3A 5CV9A 4XTCS 3GZNB 4NQLB 1CSPA 1GUNA 4IUTA 3T53B 5M5YB 4YTNB 5LXIB 4M0WA 3T8MA 4QUCA 2E3TA 3NZ3A 3I57A 5AJ3L 3H6NA 2GN5A 1TWGH 4KD3A 3NE5B 5K36H 4DXGA 3MTNB 2G5DA 2BS2B 1XLNA 2AEHA 3RLNA 5KNCA 4X65L 2WDTB 1UE7A 5FR6A 3G4SA 4A3KB 1UWMA 1OXSC 1X1MA 4A20A 4XYQA 3J7AV 1ZXHA 2OF1A 2Y3AA 2VQEQ 4RF0A 3T13A 2L32A 3NK9A 3PO2G 4A3OA 1VDVA 4HKQA 4NPNA 3PZDA 4OX9L 3RYTA 1H8CA 2ZVOA 1CZWA 4KZCA 4PZ6A 3K59A 4NXNL 3L2PA 4IPGA 3H94A 1ML0D 1WYGA 1C76A 1B50A 4DNIA 5ELFA 4KY6A 4F87A 1DZ1A 2A68C 3DDCB 3L17A 1HZ9A 1PLFA 3U4EG 2GA4B 5JVH3 4QQBX 3NXWA 5E1FA 3RN9C 3T3OA 2A68D 1KQSA 2E76C 2KTRB 4HJ8A 2RCFA 3CQZB 4ICVA 4JI1L 4JVZA 1QG7A 5M9OA 1PH5A 3W1BA 4IPHA 1HPCA 2A6EC 2XEWA 1HNWQ 1HZ6A 1SYEA 3HVZA 2WP9B 2M4NA 4DHJD 2A6ED 5M3MH 5LMUL 3EGRA 4EE2A 2E2JB 2K1FA 2VH2A 4PMWA 3MHZA 3Q3FA 1TWFB 1XPOA 3CMAA 4N8X1 3ZW3A 2KBNA 2INDC 3N1ZC 3DBLB 1EY7A 2N4FA 5JEAJ 4YY3L 2PVGC 2D5GA 3KQ4A 2LRUA 4LNKA 4QY7A 1PH9A 1SEBD 3PO2B 2QEXA 2CQOA 2QDLA 4DR5Q 5EAYA 1JMCA 2G45B 1WRDB 5E7NA 3EFCA 5JEAH 3BWUD 3RT3B 4BXXH 1E24A 2IBIB 1VLBA 4NKLA 2Q2UA 1GUAB 4UAIA 1YJIA 2PE9A 3E9IA 1W2BA 3QA8A 4KV2A 2KQ7A 2KWDA 5C23A 2PQAB 4Z9CB 2NPTA 3AE7B 3ZNHB 3JSVA 1AN8A 4OO1I 2KFKA 1FXAA 2RVLA 5DM63 4KN7C 3CHBD 3R2TA 3ZGZA 1Y14B 1K83H 2O6VB 2CH4A 1HZCA 2HDMA 2Z1CA 2L52A 4G7ZC 4JPBW 4LFBQ 1XXGA 3C0RB 4LK1C 4ARIA 3M62B 3P4SB 1EEID 3WAOA 1Q10A 3DHQA 4LF7Q 1GHJA 3AE4B 1DCZA 3A1QA 3N20C 1XCQL 3U8ZA 2IHEA 1STHA 1TWGB 2R93G 2KMAA 1LTBD 3QARA 1S3OA 1T0SC 2Z6KA 2K1BA 5FO8B 5IO9A 2F3VA 3KJPA 2M17A 1YD8U 1XMOL 2R92H 1M1KC 4EQPA 2K32A 4F8MA 2SAKA 2OEDA 4W9CA 1UWVA 2KECA 4BS9A 2JRHA 1PDQA 5H1SE 3C3LA 2MQHA 1TIFA 1SE4A 3TP6A 1KRTA 1KDAA 4A3FB 2MJDA 3OJ4B 2LRWA 5G5GA 3J80L 2JK8A 1WCMH 3DBHB 1KDBA 5JEAG 2K6QA 3NVYA 3OIPA 2F0QA 3QX1A 4XT3B 1JOQA 4DGZA 2Q2TA 4IUVA 2J42A 4ANXA 3DQVA 2Z0SA 1QZGA 3CCSA 5AUKA 1AE3A 2WV6D 2WDRB 1QLBB 4A3MH 1TGZB 4W9LA 2QF7A 2JWUA 2RQXA 4GU2A 4JI8Q 3TIXA 1EU4A 2Q2HA 3T3NA 4J6HA 4MH0E 3A8IE 3TZDA 1V86A 3A8JE 5HG2A 1ZW7A 2MQJA 4IALA 3UIPB 3Q3NC 4KVGB 5M3MB 4AWJA 1BDOA 3J81L 3MJ5A 1SE9A 1T0RC 5KHQA 3S2HH 1SIJA 1L1OB 3D6CA 4DAYA 1MPEA 4K5VA 2KC2A 3S16B 2QIEB 2O5IC 2XGTA 2FUHB 4BBRG 3Q3JA 3RN2A 2R2QA 5D94A 1LTSD 1HUNA 1J19A 3EBEA 3KF8A 1CUKA 2X6LA 2D5DA 4FF2A 3S17H 3NVWA 2LY7A 4KMUC 2F4VQ 4K1RB 2HD5B 1D5XC 4DK5A 1JB7A 1XTCD 3VQIA 4DU9A 3DCGA 1X56A 2K5HA 1YBYA 5M3FH 2F0UA 3ZRFA 2KDBA 3T1HL 1SSNA 1WYWB 1L0YB 1K83B 1BUIC 3IXSA 4YSYB 1BUVT 1EWCA 4UPAA 3QJZA 3U30A 1WWTA 1SJHD 4DK1A 1FJGL 1XPRA 3Q8DA 1RYJA 4CYEA 1WVLA 4C00A 1X32A 4EEWA 1LT4D 1HEZE 1YQBA 3DHHC 3HOVH 4RCOA 1R4PB 4RCNA 1Z7TA 5J3BA 3RZWC 1E0BA 2PQEA 4P74A 1F9SA 1SRUA 2R3ZA 3KJOA 3EROA 3CCEA 4R4OA 3PRMB 3GTOH 3E3XA 1IBLQ 3NTKA 4O2DA 3I72A 2JU6X 1FXTB 1VQ9A 2R92B 3WDNA 5LNK1 4DV4Q 4C3HH 4TQ1A 3DBRI 2B2WA 4JI4L 1DM0B 1N34Q 3QIJA 4KZ0A 3OWFA 1WCMB 4LNIA 3UDFA 1UGJA 2LZ6A 2ZZPB 4N6EB 3W1GA 2UU9Q 2RDHA 3F2DA 3GD7A 3CXCA 3AULA 4P7IA 3A8KE 2HDLA 2Y5CA 2K28A 2WXMA 2KWCA 1EQRA 3IBEA 5CMDA 3NS8A 1LT6D 2PCFB 1XLQA 2WXIA 4PS7A 1B9NA 2CHBD 5I4DA 3HOXH 3CIRB 3SVMA 3Q8FA 4QF4A 1MFWA 2WP8J 4A3MB 4A93H 4E74A 2L0TA 4BKSA 4HJGE 2HQLA 3AE3B 1GB4A 4YIJA 1WJUA 2HQEA 4LF5Q 5DPSA 2A5HA 5EDSA 3DMUA 2MNAA 3HG9A 4J6IA 4DR4L 5ELOA 3TL5A 1BR9A 3KWVA 2KDFB 4H7BA 2UXCL 4ZDVA 3AE9B 3V61A 1UEBA 3OOCA 3S14H 4W9FA 1HR0W 1OO9B 3OAWA 3S2HB 3IL8A 5BMHA 2MW5A 3NELA 1N36Q 4IUMB 4Q2JA 4H02A 1E7ZA 3Q8BA 3S2DH 2KFKB 4GLVB 2EJFC 1LACA 4KGRA 2C60A 2ZTCA 3X23A 2ACZB 2ICEC 3E6ZX 2R7DA 2YTXA 5A2QE 1KLVA 3G48A 4TUUA 1VQOA 1VCIA 4WJNA 3QWZB 1QUQB 4AQYL 4DUYL 4MSQB 1A3TA 2KCNA 5LMNL 2PEAA 3S17B 1II3A 5LXHA 1FL0A 3A1QB 2MHVA 1VQGA 4GNXB 3T1YL 2RHQB 3VDYA 4JI5Q 3MFYA 2V3NA 5IA7A 5J2RA 3RULA 3V62A 1WGYA 1A15A 4IWQA 4WJOA 5M3FB 3TS0A 1C9FA 2WXNA 5E6PA 3U58A 4A93G 2DWQA 3ALBA 2CHWA 4JE3B 1TYGB 3VUWA 3HOYB 1DOLA 4C1NI 5DAUA 1IBXA 1CZPA 2WIIB 2FAZA 3DWQA 1KF6B 5CTRC 1CKNB 1KIXA 3HOVB 1EEFD 4AJYB 3EECA 1JC7A 1GUOA 5M5WB 1MJEA 3I4MH 2VRRB 1WRIA 3KWLA 2IDYA 5EE0A 1I5FA 1R4QB 2INNE 5LHY1 4XWWA 3HM6X 2YYZA 2KEEA 4YCUA 1PTOH 4JWSC 2JYOA 2J53A 2OJWA 4MDKE 1PRTB 1P98A 1CHQD 3DVGY 1Y8PB 2B2VC 3N52A 5FLXc 4C3HB 2JP1A 5BR8Q 3GTKH 3CCQA 1SE8A 1R9TH 1JRUA 3GDEA 1LQBA 1YQ3B 1KHIA 2KVRA 5BYRA 2E8GA 3K5OA 4TRDA 4FNFA 4X66L 4X62Q 3UQBA 1VF5C 3W3AA 4B3MQ 1TXYA 3MXPA 4LUZA 4YWGG 3ZIMA 4MHEA 1KABA 1IKLA 3QR8A 4HAEA 4JI3L 1F9PA 1BMLC 1WE7A 3EUB2 5IN7A 1WSPA 3HOXB 1FCCC 4GS3A 4K2KA 3AN1A 4DAYB 4P2CB 1C8CA 3AFQA 2JA5H 2FIFA 2E2DC 4RGTA 1G8ZD 2NN6I 2INPE 2EYMA 1X3QA 4A93B 4G57A 2IX0A 2A4ZA 2IT1A 1SYCA 4BA1I 1JMLA 2LXJA 4XQJA 2ICIA 4C3IH 1FRDA 3L13A 2UUCL 3U9SA 4DKAC 3BU2A 1OXXK 4P73A 3I4MG 3NP8A 1SNCA 1PV4A 2B3GA 1ASZA 2YTYA 3A4RA 2GBKA 2C5CA 2K4KA 2A8VA 1V97A 3S14B 2K8HA 4WJPA 1NSNS 4DA2A 1H9SA 4P6VF 2JSOA 1S5DD 1YI2A 4XDXA 1M90C 3S2DB 2J0MA 3ZNGC 1TY2A 4DR6Q 1GUTA 3TEZA 4ZK9B 4PT5A 1PA6A 3NRZA 3RLFA 1GB1A 5KRUA 2CJNA 3TRZA 4YWLA 3U4ZA 2EY2A 2D3GA 1PXUA 3L54A 1OFFA 1A5RA 3KH0A 2Q8TA 1S5ED 5J1ZA 4POFA 2LUMA 1SMXA 2NVXH 3EFUA 4M01A 5IOIA 2BWFA 2ZPYA 3BYYB 1G91A 1V5OA 1UE5A 2J0JA 5IE8A 1I4XA 4AQ7A 1WF9A 4Y7NH 3EC8A 1K73C 1CQFA 1YNNC 4URKA 2ATWA 3C19A 4A3CG 4DAPA 1X9NA 1PH4A 2JA5G 3P4QB 3H0GH 5ISRA 4ID6A 3TJPA 3I2ZA 5C4XH 1YNND 2V3PA 1L1OC 1YNXA 5BN4A 2QGQA 3PSIA 2KYWA 2MO0A 3NOBA 3PZ8A 4C3IG 2KN4A 1MI0A 2DUDA 4IO9A 2UU9L 1FPYA 2D0PA 2B2TC 2QKIC 2QEJC 1UUPA 2BH8A 3I4MB 3PTFC 1PMRA 3TSSA 4LF9Q 2NS5A 4RWSC 3JYUA 3K5NA 2BGFA 1NCVA 1FO4A 4IURA 2HJ1A 1SXTA 2D2CC 3VR4A 3HOUH 4P71A 2MP1A 3R7RA 5JH5C 1O7YA 2GBRA 2KFJA 2G9DA 1L0WA 3PQIA 2AUJD 4AUQC 2Q8RE 2LHEA 3CCUA 4E71A 3V6EB 1UF0A 1PUTA 1R9TB 3NVVA 4IUNA 2DLBA 3BDLA 1G51A 1Y1WH 4C2MH 3U50C 3WOFA 3J7A5 2OWOA 3CD6A 3CAMA 2MJ8A 5C3JB 2BYEA 4BOZB 1FNWA 4K5WA 1S5CD 1V9PA 1N8RC 1YIWA 3AEDB 4NZLB 1VQLA 2NR2A 1OXTA 3CWIA 3IT4B 2EELA 1WGRA 2JN4A 2I5HA 4H44C 4HROA 3A0JA 3P20A 2YEPB 1JORA 2JYTA 3RNBC 4C80A 3X3MA 2QW7A 1YOVB 4HDQA 2M00A 4A3JH 2JA5B 1V49A 3H0GG 5C4XG 3ULJA 2JZPA 1J8CA 4EZLA 3MEHA 1BQQT 3CKIB 3CRLC 1SF0A 4C3IB 2SNMA 4DR1L 1ZOYB 4KHPQ 2DAFA 2UUAL 3A33B 1N62A 4I6PA 2ONQA 2NZHA 4JI2L 3AEGB 3I55A 3EIVA 2LGSA 1VQ8A 2ZW1A 1G6PA 4TMAB 2CH4W 1EM7A 1PGAA 4OHJA 2WXGA 2WX1A 1VF7A 3JW0X 4DHZB 2BBCA 4TKOB 3CRKC 4FJYA 4K81A 3TS2A 2NBWB 1EIFA 1ZPSA 5FLMG 5A35A 1Y1WG 4A3DB 1UAPA 3QAQA 4RGNA 2FINB 5CV8A 1AZPA 4QAYA 3UF8A 1ZDXA 4US8A 4DV3Q 1FIQA 1BOSA 3FKIB 1SFOH 1VJKA 5JJZA 3AM9A 2D3AA 3IAYA 3IFDA 3OTOL 1PH6A 1ACCA 4AYBB 1F52A 2V4IB 2DJGC 5E6NA 4BY7H 3PGZA 4QIWE 1D8LA 2F0FA 4N58A 5CHWA 1JALA 2AX5A 1V1QA 5AJ3Q 1CJEA 2KKCA 3H0GB 2O2VB 5C4XB 2GOWA 3R7QA 1U5KA 1MHXA 1WX7A 5G2NA 3S9WA 2UUBL 1ZXIA 1XWEA 1TWHH 1Z6HA 4X65Q 1UE1A 2OXPA 3CF6E 3FILA 3SDLC 4HEA1 1Z9FA 3G6EA 3ERQA 4RMAA 1Z2MA 1I42A 3A54A 5KNDA 1WX8A 3H9DA 2A5UA 3KFUA 4OX9Q 3VR5A 4XE0A 1JOKA 4TKNA 2N9KA 3GB1A 5FK9C 2VB2X 4NXNQ 3HOUB 2I1JA 2Y0SB 4I6NB 2MRPA 4GNXC 2ZPNA 3D32A 5H92C 1RAXA 3U7ZA 5C1ZA 4GDLA 1Y1WB 1TY0A 1VMPA 3K7AH 1SYFA 3B6YA 2PKOA 4FJVB 1RDPD 2L0FA 5IT9E 3AH7A 4YSZB 5LLIA 1FGBD 2X69A 2H1EA 1ENAA 2JEBI 2OQKA 4E6IA 1UELA 2L00B 2Q8IB 4JI6L 5BO4B 1L7YA 1RODA 3VR2A 1MJCA 4JI1Q 2JEAI 2IX3A 1KD1C 2NVTB 4RM9A 2K5VA 2Z4HA 2JPHA 5A2QL 1H9SB 3UI3A 1OTCA 1STGA 2M0AA 4A3JB 3DBRB 3BZKA 3RNEC 5LMUQ 3IFWB 2WHIA 1CZGA 1I6HH 3F2UA 4U68A 3KUZA 4YY3Q 1SNPA 2TSSA 1K3BC 4L23A 4FADA 5EBDA 2LVPA 2CFMA 3VYTA 3AFPA 1EZ8A 2VW9A 4JGHB 2B2UC 1Q1EA 2CW0C 3VR6A 4YWKA 4K8IA 4PQXA 4A75A 3RZDH 4KGSA 1BXTA 3WALA 2CU1A 3W2DA 2JQRB 4EX5A 1ZUD2 3CF5A 2B63G 2N9EB 5ELCA 4A3KH 2DBYA 2Z59B 4DV6L 4IFDJ 1LT5D 4JYAL 2EKIA 2QMTA 3NS1A 4PS8A 1RLFA 2DY7A 1YN4A 1K9MC 2RGFA 3VVWB 1YN3A 1VQ4A 1YNJC 1VQMA 1C7YA 1H9RA 3LB8C 2G3QB 4YXDB 1V2YA 1CI3M 2F0JA 2KCCA 3PUVA 3Q6BA 4KIKA 5D2MB 4MTNA 2WX0A 3H7SA 1TS4A 4BY7B 3I4OA 4QMGA 1QZHA 2AWOA 2XRQD 3RNGC 4B3SL 5BMIA 5IGCA 4UP9A 2F0WA 1BVSA 3AEEB 3P7JA 1HH2P 1TKEA 3QIAA 3M4QA 1GKHA 1TWHB 5I6WA 1WTPA 2XIWA 3SR1A 3QHTA 5E6JA 1XMOQ 1A62A 1DJRD 2OTJA 1NENB 2N7DA 1A3UA 1I4QA 2BF8B 4DR3L 3ERSX 4L1BA 3IG3A 5C6AA 1XPUA 4JBWA 1XLOA 3BVMA 2R7FA 4HSPA 3CC7A 4IUQA 2KUMA 3MJWA 2L1AA 4DK3C 2FUG1 4F1SA 1WTXA 3RMHA 2HD3A 4LDTB 4WURA 4P1CC 4A3KG 1SYDA 2EXZA 4I65A 4LCDE 2D3CA 1GUSA 4YWMA 3T56B 2WXHA 3MVVA 2MEKA 4N59A 4EUTA 1LTID 3A7AB 1WM2A 3RD2A 3DVGX 1N32L 1YITA 3ZO5B 3PMFA 4CDFC 3K8AA 4BBSH 3BVZA 4IFDG 2B3AA 3PZ7A 3WA0A 1IYFA 3H3VC 1WM3A 2Y5PA 2NBVB 2W3SA 1ILQA 5E4XA 4KDIC 1RF2D 2MO1A 1PTOC 1Q81C 2NZOA 2JQOA 4A3IH 2WNMA 1I6HB 4K0KL 5JVG3 1SYGA 1STBA 3HKZG 3NWSA 4ZYSA 1EY6A 5DPWA 2BWES 2PZTA 1EYDA 1U4AA 2WS3B 3PIO3 5IGBA 3MP9A 4O1NA 5GADC 3GTQH 1SE3A 1KDCA 3DXJC 5C4ZA 3R93A 2QA4A 4JL9A 4XWTA 1SLJA 2XSCA 2K05A 4J8QA 2L7RA 3ZTCA 1E10A 3ZYYX 3K5LA 3RZDB 3IKJA 2C7HA 2P5ZX 1MJDA 2OQ0A 3QQ8B 1GHKA 1O7IA 4BBNC 3K80C 3F1ZA 1LTLA 1XTDA 2K5DA 2ZXPA 3JAML 2C7NB 3N1XC 2WACA 3FEWX 4HPPA 4YHHL 1N6ZA 1NYQA 3T1HQ 4WJWA 3QC8B 3ZDMC 2ZJDA 4FXKC 3KLWA 2LKVA 4A3FH 2C9OA 3NY5A 1E8XA 1NEKB 3BJUA 1FJGQ 4ZRPA 1ROEA 2WXRA 3RMKC 1A2TA 4B08A 3ONSA 4JBKA 1CMXB 4BBSG 1YHAA 2XK5A 4X57B 3ZDTA 4JI0L 1XNRL 4RH6A 2EYHA 1VQNA 1B7YB 1STYA 5CV5A 1FM0D 3P63A 4C7ZA 2K8CA 3V05A 2BYTA 3K0YA 1O7LA 3J80c 2NMQA 4L8JA 1EWIA 2ZNVB 3BINA 4B3RL 1DOXA 4BZAA 1HFGA 3HKZB 4OELB 2NVQB 4W9GA 4D2KA 2CKHB 3HKZE 3LWUA 1YEZA 3Q14C 1WGHA 2N88A 3PF5A 1G6JA 4JI4Q 5CV6A 3AE1B 1GOZA 3A7LA 1DYQA 3CCMA 4IM0A 1MSHA 4W9DA 4J15A 1T0QC 2F0OA 2IY5B 1J7CA 5K36G 2KCTA 2E6XA 2M56B 4S17A 5GROA 3DHIC 2PPHA 2A69C 1L2FA 3P1HA 4OZCA 3QJYA 4KHVA 1DOIA 1D3ZA 3VUXA 1V1OA 4DNRB 3IRBA 2A69D 3L08A 4KHZA 4JOIA 4GMVA 4LNNA 3S16H 1TIID 1A6XA 1VMCA 3GO5A 1JWBD 1KFYB 1OQQA 4A3FG 3H8HA 5D6JB 1O80A 4DN4M 2UXDL 4DDID 4L5RC 1EUVB 1JE4A 1KNEA 4R9WA 4BBSB 2KQ4X 2EJGC 4R4IA 1EO6A 3P1MA 1WH3A 4IUPA 2K5PA 1F2RI 1SMYC 3ER0A 2ZCBA 3X3NA 4DR4Q 3PV1A 1QKZA 2K7VA 2UXCQ 1KAAA 2I0QA 2V4DA 2XVSA 4A3IB 1DXMA 3SHLA 3U7DA 1AZQA 4HJKA 3I7FA 2GBNA 4XC2A 2K33A 2L11A 5JOBA 1V1PB 2EPBA 3A5UA 2WLBA 4N9TA 4OIKA 3DEPA 4HJ7A 3ZJYC 1CQVA 3ABVB 3GTQB 3A9KB 3X0WA 5L83A 4BY1H 1BCPB 5IGDA 4ZOHC 1NVID 3CP0A 3EA6A 3ZKJC 4AQYQ 5J17A 4DUYQ 2CVRA 2F0VA 5LMNQ 5M3MG 5C0XJ 2J0KA 1T5XD 4KDLB 4WAFA 3T1YQ 3GTLH 1J7BA 2ZEQA 3ZNZB 4NJCA 2DNFA 3TEWA 1J6QA 5G3LD 1W6JA 1IYUA 1HQRD 4X3KA 2ZM6L 2G9HD 5KYIA 3NSWA 2EOTA 2PNHA 1HTOA 1QOBA 5C0XH 1CKMA 3SDZA 4X64L 4Y52H 3Q8CA 3I3TB 2IO3B 4M02A 2QC8A 3TQYA 4B3TL 3HP3A 2EKEC 3OLMD 3ZXVA 2ZCCA 1C3TA 1CT1D 2A6HC 1D1IA 3R2IA 3CCRA 2EZVA 3H15A 4Q5VA 4BXXG 1L4DB 1TKWB 3DM3A 1RFKA 3BY4B 1CFMA 5IT9L 3SHQA 1KNAA 2VY3A 2F0TA 2A6HD 1GC6A 5TSSA 4AJWA 2BCOA 2K22A 2Z6BA 1A63A 1MVKA 3GQBA 2IGHA 5IWAL 1UE6A 5IKCM 1D1KA 3M63B 1EWYC 2N1WA 2KENA 2B8FA 2N9LA 5FJ8H 3MC8A 1LTRD 2NTSA 3UDXA 4FDBA 3K6OA 1K8RB 2L1BA 3C2PA 4ZRZA 4GXBA 1M4VA 1WD1A 1P0RA 2MX2A 2RDBC 2G4SA 4YSXB 1JWAD 1QOHA 4X66Q 4F7ZA 1EYCA 1X3PA 2NWGA 2IY0B 2BYFA 1A0IA 4K5XA 2F03A 1EIYB 3PLVA 4JI3Q 1G2TA 4A55A 1SB3C 1FYCA 2NVUI 4MM3A 1NYRA 5DCNA 2Z9HA 1IL2A 4HWIB 4CDDC 3MWYW 5GXGB 5FLXE 2R92G 4FA6A 2GI9A 5JHAA 4L6TB 5IIFA 2N78A 3UDGA 1HFNA 1I7HA 5C0XG 2KJRA 3Q23A 5J39A 2IO2B 2YLMA 1WCMG 2BE5C 4NB3A 5CBAE 1X3FA 3ZJUA 1GUGA 2UUCQ 2KMMA 4M0WB 4IWOA 2IW3A 5FO7B 4WWMA 1LXDA 1VQBA 4KSKC 2D0OA 1BO0A 2BE5D 2H5XA 1ZE3D 3I5JC 3PV0A 3MXUA 2JT4B 3E9SA 1KH0A 1VQCA 1N63A 4NY0A 2LXKA 1PH3A 4DV0L 2K25A 1J9OA 3AE5B 4EZJA 4C7YA 3FKYA 5IGEA 2B8GA 1PTOF 4A3MG 5BMGA 3S1MB 3NTIA 3HOYH 3RPFC 1I4PA 4C3JB 1HZ5A 4NJ7A 5BN3A 3S24A 4RG1A 5C5LA 3SK4A 4BY1B 1QVFA 3NBIA 1TQOA 4KD4A 4GDKA 4UDUC 4ZRKA 3TBLD 3PHWB 3W1SA 3HKSA 3WAPA 5M5WH 1P1AA 3RCZA 2MA9B 4EOYA 4HIDA 1STNA 4GOPC 3E5SA 1HNXL 3AB5A 4CO7A 4AS1A 1ZEQX 3GTLB 2CHXA 2L05A 2O2LD 1N60A 2KXJA 2YU9B 1LLRD 1B3AA 1QNUA 2DN8A 1EQTA 3I91A 3I73A 4FXDA 1Q3LA 1E7VA 2RR9A 3IAM1 5GMVA 1Z5SB 4BBNF 3IVFA 4R3DA 2MGSA 1AEXA 2JA6H 3VA5A 1LGRA 1RRBA 3H7PA 1EQVA 1T9HA 5LL6X 2N7EA 1HRJA 1WTQA 3NQTA 4P75A 3Q8AA 5E6OA 4YTMB 1E3PA 3CW2C 2F0PA 4IN3A 1MSGA 1L6UA 4HLEA 1YNTE 1HCZA 4KJOA 3GV3A 5M3FG 1A2UA 5IYBH 4DUZL 1TWAH 3LJ3A 2F0HA 2CJOA 3DOWA 4JC0A 2H88B 4REZA 3HOYG 1QF6A 2V3SA 1F2ZA 1M8AA 4R4CA 4C1NK 2UXBL 3STBC 3HOVG 2L15A 1BBWA 4X6AH 2ASQA 4KX6B 2DGYA 3TP7A 5EGTA 3MA2B 2E2HH 3STBD 2K6AA 3DM1A 2VB3X 3FPUB 1FMAD 2HIVA 1BBXC 3CSTA 3NQIA 2OHFA 2NPTB 3SK8A 2XN9C 3JSVB 1ZDVA 1UBQA 2B76B 2FE8A 3KVFB 4C3HG 1PFMA 3QK0A 2K9XA 2FIDA 4XDDA 4GKKL 5DPTA 3AU4A 2DNCA 1WR1A 1IZ6A 5C44H 1VZ8A 3WAMA 2MP2A 2JA6G 2N55A 4HIKA 1WI0A 2L83A 3AE6B 4DR1Q 2MBEA 3Q2AC 2UUAQ 2PZWA 4PV1C 4JI2Q 1UWXA 1HA5A 3NPPA 3F2BA 2L8JA 2LGIA 4L5TA 5JXVA 2EMTA 1BBUA 1FFUA 1YN5A 1FRRA 1K3RA 3UE1A 1QB5D 1VQ6A 3NUHB 3K7UC 1SSOA 5NUCA 3HOXG 2IHFA 1R4MB 1HHVA 4OWTB 2KACA 3HOZH 2FCNA 2XTIA 2DENB 3S2AA 3J7ZC 2AWNA 1V6EA 3MEFA 3ZJVA 1J5EL 2RSNA 1K8OA 4K6DA 4DV5L 2M9VA 4LMQD 2O5JC 3I90A 4XT1B 1K8MA 1R4NB 1QVCA 2RF4A 5CV4A 3NHEB 1VQHA 5AZFA 2WXOA 2K75A 2VS1A 3OTOQ 5C3XA 1K52A 4OO1H 1RTNA 3L10B 1X6OA 4K3BA 4PS3A 4IG7B 4LJPB 3ETRA 2VZKB 5G3LF 3L7ZC 2HHHQ 4DWFA 5CC4A 2EDGA 2KWUB 1E22A 3MHBA 5C44G 4HK2A 2UUBQ 2JA6B 1LFDA 1D6EC 4A3EH 1DOKA 5HURA 4LNFA 3OMCA 1CKOA 4A3BH 4KK7A 2D11A 1CTMA 4RF1A 5BYQA 2KMCA 1T3QA 2GBMA 1E8WA 4NW2A 3P75A 1HNZL 3CC4A 2O6VD 1D4BA 5D65A 2KNBA 1JB3A 3I4LA 3DWAA 1P16A 3FPPA 4K6LA 4RKBA 3RUZA 4DAVA 4HJ5A 5AFWA 2L76A 4OXPA 1MHWC 1CA5A 2H89B 1XNQL 1TWAB 1ZXTA 1V5TA 3MXNA 5IP7H 1VQ7A 4EQOA 1HR0L 1SIFA 4K3CA 2WB1B 1NAPA 3OG5A 3MXGA 1GAQB 2BKRB 1I35A 1JWUD 3K9OB 4TVAB 3MAQA 1XYIA 3A9JA 3C1FA 1EFWA 3SR6A 2L0CA 1BF4A 3KF8B 4JI6Q 3M9BA 2E2HB 1CK1A 1C79A 3K58A 5AUIA 3RNUA 1VQDA 2KHJA 2CS4A 4IOIE 4DQOC 1AWDA 4AIMA 4OZAA 3VFKA 1GC7A 4H13C 1TKGA 1VZ7A 2KT7A 4A3DH 1FD7D 5C44B 3AQQA 1Y1VH 1Q82C 4MT5A 3VH3B 2B2YC 1LTAD 2LS01 2NZ1D 1E7PB 2VQFL 2N7JA 1B70B 2XWJB 2BB5A 3FKIH 4A3BG 4DR7L 4KI0A 1I6VC 5E4WC 5GAHC 4DV2L 1C4PA 4GKJL 3KK7A 2KWVB 4E3CA 1L0XB 2QDBA 1ASYA 5JJKA 2LJIA 4ICUA 1EY5A 2EYPA 3EHVA 3PIPA 4WQOB 4ANUA 1B9RA 2A73B 3QO2A 3HOZB 3UE0A 4EFOA 4ABNA 1ESRA 1WOCA 4P72A 5IP7G 5C4JH 3ZJTA 3KF6A 4R8IA 3VYSA 1K8AC 1WGKA 4KGTA 1MBYA 2C5LC 3MZ5A 1WTOA 2EE1A 3RNCC 4DV6Q 4JYAQ 4PYZA 3EQLC 2WKDA 1HZAA 4OONA 3PIP3 3M4YA 1WY8A 3OSOA 4ZRIA 1M94A 3AE2B 1A8VA 1EOVA 1F2LA 4NPSA 1LM8B 4RMFA 1SNDA 4DV7L 2KVMA 3SK5A 2YV5A 4B3SQ 3HOWH 1SE2A 4B9XA 3CCLA 4MH8A 1NR4A 4XXEA 4A3DG 1OEYA 2W82A 4MELA 4ZRJA 2EY5A 4ZLTF 1MI2A 3ZUNA 3MTSA 3DBLI 4A3EB 4ILWA 4MJSA 5DEHA 3FKIG 3M85A 4A3BB 2OOBB 4LF8L 3HK0A 4FHJA 2ZJPA 1XO3A 4WJ3M 3QCAA 2L9HA 4AYBG 1RHPA 4V0BA 3AV8A 3SFEB 1QT9A 1I3QB 2K04A 3GP7A 5IOCA 1EY8A 4CJ1B 4DR3Q 2NVTH 2V0GA 3M3JA 3ZLZA 2UYZB 3PGEA 5JAVA 4HCPB 4MGKE 2PMZB 4L5QA 2RDGA 1BKBA 1WR6E 4RNAA 1QJOA 2RPVA 5T1GA 4KJNA 1L5PA 1Y69U 3VYUA 2VNUD 1V8QA 3D4WA 3DEOA 3DPDA 4W9IA 3UINB 1E8YA 2JA7B 2IJ0A 2MP2B 5I2XA 2K0PA 1C4CA 4LJZC 4ZRQA 2E5LL 3WWVA 1YX6B 3APDA 3VTVA 5D3IB 4YTPB 3SU8X 1A70A 2JF5A 1N32Q 2WXLA 4MTKA 2N8NA 2VH1A 2F0GA 3HOUG 2Y0SG 1P3QU 2L4NA 2N49A 4MGZE 2KD0A 2K39A 2RD0A 3H1UA 1V80A 1VQIA 5HGQA 4FF3A 3WCQA 2HJ8A 4DHZE 1H4RA 2EMSA 3PT2B 5D3DA 1Y1VB 1OTRB 1VQFA 4G7HC 2WXFA 3ML9A 1IBXB 4QUFA 4GB9A 1KLGD 3B9JA 1B3QA 4C4VA 4L5SA 4LF4L 2FCQA 4NP5A 4QGUA 3TCAA 4ALPA 1WTHA 2NB0A 3VR9B 4NAWA 5AEKB 4GOPA 4B95A 4OWXB 3CSFA 4AYBE 5KIXA 5JZEB 4K14A 2FJ2A 1EUJA 2ALYB 2D3BA 3JAMi 2HHHL 4WJ4A 4A3JG 2PI2A 4MGIE 3ENEA 3OPOA 2UWQA 1EIGA 4FVMA 4JW0A 5C4JB 3OW2A 4EQNA 4JQWC 4JI7L 3PO0A 2F3IA 4IOAA 2FHTA 4II3B 1MGSA 4ITKA 3J7AF 1S4ZA 4HCEA 4YHHQ 2KOLA 2IYDB 3PLUA 4DHJB 5CHVC 4MZ9A 1JROA 2VUMH 1JWSD 4FP5D 4OGQC 1VD2A 4BOSC 1WX9A 1G6ZA 1F77A 3SE0A 3MC9A 1D2BA 3ZVVA 1TS3A 3NBHA 4JI0Q 4IW0A 3OW7A 1XNRQ 3HOWB 2Y0SE 5HGTA 3ULLA 2Z6KC 2LMCA 4LLGM 3OMGA 5GAEC 1XMQL 2BS4B 4WORA 4FULA 2KDEB 3V3XA 5JJIA 2EY6A 5EKIA 4B3RQ 1E5WA 4XQQA 2C35B 4LFCL 1YIJA 2RA4A 4F88A 3AEVA 3AEAB 1RTOA 3IFTA 1F1HA 2N3SA 1J7AA 3QB3A 5E3FA 1NBWA 1TS5A 2EQSA 3D4RA 2LEKA 5IP4D 1PGBA 1TZ1A 4FJZA 4BFRA 2ENBA 4BY7G 1T0YA 4JPSA 1FFVA 2CCZA 2Z4IA 2A19A 1S1QB 3M95A 1YJWA 4GN5A 1OXVA 3H91A 4R8NA 4UP7A 3NUCA 1VDZA 2JA8H 1FD6A 4B9WA 4LF6L 1WTVA 1PRTC 1KM7A 3KLRA 3C1EA 4KY5A 3B08A 5FKAC 2W9NA 1V81A 3NHHA 2KTRA 1NDDA 4XZ4A 4PMBA 1PRTD 2JUOA 4P1BC 3PO3B 1TKYA 2ZXRA 2KOXA 1EY4A 2VZAA 1VZ6A 2VUMG 1JJ2A 1Q8IA 4DFAA 2PVOD 2UXDQ 3VYRA 3NVZA 4ASWC 3OJ3A 4CQNA 1EFID 4J1MA 1TU2B 2JZ3B 1AE2A 4WFN3 3BVGA 2NN6H 1UGMA 1LT3D 2N0SB 2BH2A 1IL8A 4HR7B 3TP5A 2C9WB 3HRDD 2CW0D 1L4ZB 1SGHA 2Y5BB 1VQAA 2NUCA 4Q0FA 4ZUJA 3BK2A 3BDOA 5KEEA 2X6GA 3OWEB 4A3PA 2KO3A 5COYA 3D6WA 2K14A 3PCOB 3PUYA 1I94L 1P9DU 3U52E 3WANA 1PFBA 1PFSA 2BDNA 4S0RA 2OCEA 3JAMc 1YNJD 2FCMA 3PREA 1J0GA 3KUPA 2MHJA 1ET9A 3QOJA 2KAJA 2F52A 1I50H 2SOBA 1KRHA 3RN5A 3R66C 3J81j 3NTHA 2B2VA 3U9OA 1X3GA 4W9KA 4EZKA 2VXWA 5GQOA 1Q90A 2LXAA 3HGBA 2IZVB 4IQZA 1T5EA 5G5HA 1EOTA 3IAS1 3DLLA 4KKUA 2ZM6Q 2WINB 2F0MA 3J80i 2NVQH 1T6BX 4JCVE 1QWYA 2O6VA 4MJSB 4K2LA 2PW7A 3EFXD 3S1QB 4X64Q 1PGXA 2F0LA 2VUMB 3KLSA 3GTGB 2M19A 5IYDH 4B3TQ 1SNQA 1CM9A 2NYZD 1DGJA 1IHZA 1PYBA 5H8YE 2KCMA 2IPKD 1VQ5A 4OWWB 3W5OA 3GTPH 2NN6G 2LSSA 1HTPA 5IODA 3GS2A 5DM73 4GLXA 4W9JA 1F9RA 1KJTA 3SK6A 4RFBA 4IZ8A 3EVQA 1NE3A 4ZAIA 5IWAQ 1Q86C 2MBBB 1FR3A 2RMMA 1SYBA 4HDOA 2WU2B 4XDCA 5KHOA 2B2WC 4UY8C 2R7ZH 1YX5B 2F0NA 4TQUS 2AYOB 5CHFA 4RGOS 5EE3A 3E0JA 4U673 2J4XA 1EIHA 2D2QA 2RDFA 2INCC 1I4HA 3J81i 2WQYB 2V1YA 1JWMD 2BKFA 5EJWA 4IKGA 4ODGA 2JA8B 1E8ZA 1JCKB 1ZYRC 3E9HA 1H9MA 3I8ZA 2WDVB 3RFZB 1B9MA 1STAA 4F8CB 3W5VB 1PTOD 1PZJD 1S5BD 2OJRA 3ECIA 1ZYRD 3DHGC 2ZTDA 1K0SA 4KKJA 5ELDA 2B39A 1I4GA 1B4OA 1IBML 1FXIA 3UQAA 4BKSD 4GIVA 1PH2A 2SDFA 5IYDG 2Z8LA 1E9MA 4R4QA 4NAWB 1E1TA 4G50A 1OXUA 4HMJA 2PW5A 1WTWA 4B0MA 4KLKA 3TP8A 2WU5B 2KANA 4HPMB 1EY9A 3I9V1 1L1OA 5C3EB 4A3LH 3W5UB 4NJ6A 3NWTA 2NTTA 2BW2A 1Z47A 4DV0Q 3Q3OC 3LNNA 4G4KA 2BOSA 4BKGA 3FILB 1D5MC 4IJHA 3Q22A 4LNQA 2B2TA 3FMCA 2K01A 1GG3A 2EYFA 2DYMA 3VA7A 1P7EA 4HTHA 2IO0B 2FMMA 3VAWA 3RZOH 2LGDA 2WXJA 3S1RH 1HTQA 1MKHA 2JVCA 2CQAA 1I50B 4YCVA 1XF5L 3L0WB 2YTVA 3I70A 3D31A 1E2VA 3A5ZB 3NBHB 2KJ6A 1WZ3A 2LMCB 4I7ZC 1HNXQ 4JG2A 4A3IG 4M8NA 3ZRCA 3FP9A 1Q46A 4GDLB 2JXXA 2LFIA 4PZ7A 3VRAB 4TQ0A 4KKIA 5I2YA 5IT9c 3HFZB 1XEEA 3A4SC 3QG1A 4CHTB 2NCNA 1ZGUB 3APCA 5KNBA 4L2YA 3G6JB 5D14A 3GTMH 2OT2A 4XYOA 2KN5A 2N9XA 2PJHA 3MHSD 3NG0A 3CCVA 4BA2I 4RGMA 2JX5A 3L4PA 1RIPA 1SJED 3E56A 4QL5A 4DV1L 3Q69A 3GTPB 3J7YW 2F1MA 4B0EA 4F7XA 5T1IA 4A3GB 2K8BA 4UHVA 3P4PB 4A3LG 2FFKB 1E7UA 4LJOB 1LV9A 5HKHA 4XIGS 1NJIC 1PVOA 2ZXOA 4DUZQ 2R7ZB 4ZUIA 4WWNA 2HTHA 1N33L 3AB9A 3J81c 1EZ6A 4GOCA 3V2TA 1O78A 4M8AA 3KBXA 5J22A 2UXBQ 5HFYA 2GVAA 1N5WA 4X3UA 4CDEC 3F2CA 4JBMA 2WXKA 3AXCA 3Q3MC 2R93H 5JJLA 2I5MX 5IGFA 2BA1A 1SMYD 2SEBD 1LUZA 3OHXC 2W55A 5IY0A 4CJ2C 2J52A 3BZCA 4IDIA 4DR2L 1UD7A 2JXTA 1PRTF 3S1MH 1MIUA 4GKKQ 2IY1B 4C3JH 1KRSA 1HXYD 1EY0A 3CU7A 4KIKB 3NENA 2F3WA 3BZDB 4M1UB 1EQQA 2K6DB 2KQSA 3UDIA 3TMEA 3RI7C 2JY6A 5K5PA 1GM5A 4HXDA 4OL7A 3G71A 3GV6A 3T4AC 1UEAB 4G11A 3NZSA 3HEJA 5DPRA 1TT5B 3H3VI 4H2AA 1ET6A 1K51A 4FXCA 2YU9H 4A9AA 1A3VA 1G2SA 3HIZA 4NDXA 2BA0A 2KK8A 4LFAL 1WXQA 5D7GA 3ZTDA 4DK6C 4ULLA 4ANVA 2JWZA 4FF4A 3P4RB 4NMZA 1RCVD 3H09A 3K81C 4DXFA 4B6WA 3TZUA 3W1YA 1LTGD 1J5EQ 1QUQA 3L16A 2E75C 3PS6A 3RZOB 4DV5Q 3S1RB 1QOGA 4YT0B 2RKSA 1NNXA 2VL6A 1E6EB 3RZFA 1JR0D 3SXHA 2BQQA 4GNXA 1IBKL 3WOEA 3A56A 1D5ZC 3R8BA 4A90A 1CA6A 3HVDA 1IP9A 4KY7A 3GE3C 1WZ0A 3PUXA 3N30A 2JRIB 1FVIA 2K3UA 2I38A 2MBOA 4FLHA 2EXDA 4O0AA 3O13A 3SFDB 2KA7A 4K8JA 2KX3A 2JE6I 2AQ3B 4BBRH 2CWPA 2K03A 3GTMB 4C3JG 1GNUA 1CKNA 4BY1G 3AEFB 3N9YC 1NBFC 2WXPA 1HZBA 1X65A 3C8YA 4JWUC 1WGDA 1GVPA 5EE1A 1LTTD 1WFQA 2IL8A 2J0TD 1HNZQ 3VHTC 3SD5A 1WMHA 1UH6A 1MG8A 3KUCB 4G3XB 4K0KQ 4JV5L 2F0DA 2QCPX 1RM6C 5BYSA 4EVOA 3OYYA 4HCNB 3GOEA 1ZKOA 4R1JA 4LUOA 1DOMA 2DX5B 2DY8A 1XNQQ 1V8CA 3Q24A 1N9WA 2BTEA 1Q12A 4HCSA 1JICA 1HR0Q 1WXVA 2JXMB 3D3RA 1DONA 1NTGA 3KOJA 4NXML 4JK1C 3KYCD 5C5MA 1P8LA 2B2UA 2WGSA 1TWCH 3N32A 2K52A 2ES2A 4W9EA 4BKTA 2ON8A 2R93B 1C1YB 2F4IA 2XRSD 5GAGC 1N5XA 1ZKHA 2FMCA 1UBIA 1WD0A 2KDMA 1MG4A 4OVVA 1SAPA 1QE6A 4HJ9A 2OEOA 4G0NB 2HE7A 4M00A 5J18A 2Z0DB 3R3OA 4MACA 2KHSA 4N8FA 1HA6A 4HRSA 1EWHA 3BDCA 3TEHB 5FJ8G 3N1YC 5CGKA 3B2GA 3K9PB 4EKUA 3CPFA 3A55A 5F2DA 3V96A 3D4DA 4LDTD 5IAAC 2EYJA 4WWOA 1FGUA 2VQFQ 1B2TA 4G7OC 5C2TB 2BPSA 2XK5B 5L37A 3D8GA 4DR7Q 2BB6A 4DV2Q 2C7MB 2TMPA 4GKJQ 1U0LA 3CCJA 3Q8EA 5C3WA 1FCLA 1G291 2AKWB 1QCBD 3ULPA 4DBGA 4IWPA 2MCNB 2YEPF 2VQEL 2KX0A 2M8SA 3PVLA 4IM3A 1HUMA 1FEHA 2O4XA 1C0AA 1F0ZA 5LMNW 4HJAA 1PDXA 3GTJH 4GN4B 1TVXA 2GB1A 3TREA 5IP9H 1YQ4B 4WAAA 2G1EA 4JBJA 3PHXB 1JQ4A 3ND8A 1ONLA 3UI2A 5DNFA 2M1MA 2GMIC 3VTUA 3CMEA 2LGXA 4LK0M 4GN1A 4S3SA 2AWTA 5C4HA 1E1OA 1QQRA 4DV7Q 4JLCA 2DYBA 2IO1B 4MNOA 1ISNA 3HS0C 4CBVA 4BBRB 2LJ5A 3TUOA 3W9CB 2KZRA 3KYHC 1J8IA 3DWPA 4HN7A 1HNWL 2D62A 1ILPA 2RPQA 3I56A 1AFPA 4LF8Q 4IM2A 1AH9A 2J7ZA 4KV6A 1TT2A 5BN5A 2A74C 4CKEA 4HMIA 1WJ6A 2D07B 4XYCA 3RNFC 3URYA 4ZQ3A 4KSLC 5IYCH 4M8MA 3J9CA 3PF4A 3ITPA 3R3MA 3KBGA 3PRPB 2V9HA 1AW7A 5AZHA 2N1VA 1WXAA 2CHZA 3P2BA 3PRZA 4ZCKA 3VR3A 2ZNVC 2DYOA 4J3OD 4ACFA 4QB4A 4YCWA 3ZNID 4DR5L 3AMZA 4H0LC 1MD2D 5FR3A 4GZYC 1QILA 5EE9A 5IP9G 3M4PA 2HUGA 4K7UA 1X54A 2B29A 1TWCB 3AU7A 3TDQA 4PK1A 1IYJB 2E5LQ 1F2YA 1KLUD 3LYYA 2EIFA 1KL9A 3IT6B 3M7GA 4WQMA 1EYAA 4ME3A 2OTLA 1P7FA 2FNJB 1JW9D 1LYLA 4K7WA 1H9KA 1NMGA 1YJJA 4FF1A 4NQKE 3S15H 3HRZC 5IYBG 1ENCA 3H6MA 2JYEA 2MJEA 3VXWA 2GBJA 1KOTA 1JQYD 3UGBB 1AP0A 4I7AA 1VR9A 2WB1G 5JPMC 3L9AX 4LFBL 3BG3A 1WJNA 5ELNA 4NAMA 5FOBB 1RJTA 3L0OA 2EVBA 4LF7L 2BS3B 1PH1A 3TBIB 3I4NH 2KQ3A 1K53A 4DAMA 4II2B 1ESFA 3D0FA 2AUKA 1WTRA 2R6GA 2EJMA 2I07B 1MHHE 3V60A 5DLQE 1NUCA 4LF4Q 5CV7A 2V4LA 1RL2A 1RFAA 3I63C 5IYCG 2M0XA 1PH8A 5KYLA 2QHOA 5KGUA 1VQKA 3TEYA 3ND9A 2HCIA 4FN2A 1DGSA 1R7SA 2WAQG 3E0EA 1GJZA 2J7QB 2LASA 1NY4A 1GD7A 2CWAA 5EPLA 3CPWA 4FO2A 3GTJB 4JI7Q 1PYSB 2MH7A 3M7NA 4HVBA 2HDEA 1IPGA 1C4AA 4X3TA 3JC66 5ELEA 4FXGC 4FBJB 1V9JA 1KXLA 3VTWA 1YJ9A 1BCPC 2LHDA 3ZXRA 3H3VH 1I3QH 3GTOB 2ZT9C 3FRPB 1WMHB 1BCPD 3KLSX 4FHKA 4MM3B 1RD9D 4ZHPA 4PZ8A 3HOZG 3DWGC 1QVGA 2O2VA 4ZYNA 2K5WA 5I9OA 1JJCB 1TZOA 5CR3A 1XMQQ 4HIMA 4JI8L 2I46A 2LWPA 2D10A 4IC7B 1HJPA 1U9RA 5I6YA 1TR5A 2WB1E 5FO9B 2JA7H 4GLAC 3ZQ4A 4MSMB 3I4NG 5EKLA 4LFCQ 1GUWA 3GE8C 4WIPA 1VS0A 3FAHA 4OIJA 3TEXA 1X55A 1XD3B 4MN3A 5LL6S 4AH6A 2KJXA 2DNEA 4LUVA 4EGVA 4OO1G 5IGGA 2CU3A 3GZNI 3Q0AA 1F9QA 2RBMA 1VQPA 3B1LX 4OZBA 3M3YH 4A3CH 1LABA 1S72A 2PNRC 2ZJRA 1H95A 4GSWA 2JZZA 1HQMC 2WAQB 2D9UA 4LF6Q 2QCZA 4JIOU 2DHZA 1LM0A 1LO5D 2WAQE 1ENFA 1ICWA 4OEMB 1VRAB 2KTFA 4A3EG 1Q8KA 4ZKCB 2WYQA 1W3SA 1F2MA 2LFNA 2EYOA 2GRIA 4GDKB 1C48A 4ZHOA 2F4VL 2PPBC 1AARA 2JA9A 2MWSB 4GLSC 5HI1A 1IKMA 3QOLA 2MFIA 1E90A 3TMPB 2BT6A 1V43A 2REXA 2DAJA 4DNTB 1WYDA 3EN2A 3S15B 4IFDI 4WJQA 1VCBA 2LD9A 4DPGA 3RD4A 3KDFA 1IGDA 4LWCA 2LUEA 2PYKA 1QOAA 3G7LA 2SNSA 2XNAC
chains in the Genus database with same CATH topology
1PFNA 2KEDA 4N9PA 3I4NB 3BYTB 2EYLA 1N61A 2BDOA 1L6VA 1AYFA 4DK0A 4LTUA 3BK1A 4L63B 3TN2A 3FDTA 4IUUA 4ZKBB 4CKBA 4V190 2L12A 2MUYA 2FBWB 1H9JA 4FYDA 3ONAB 3P42A 1KTKA 3PUWA 5FLXL 3JAME 1PTOB 1B44D 2QILA 1XCTL 4DF7A 4KTAA 4X3SA 3GTKB 1PFDA 1U4PA 2MPMA 3VR8B 2IGDA 4PNYA 2R61A 5CYUA 4BWGB 2F0EA 1QNKA 4KN4C 1Q1BA 2IWHA 1L0VB 1GXDC 2JSVX 3M3YB 1XLPA 1C4QA 1O7ZA 4RAUC 4TSSA 3AMUA 2WXQA 4RA8A 1GJXA 1TJEA 1NR2A 4ARCA 4WRDA 2F0SA 2L5TA 3K57A 2X38A 5HHDG 2AQ1B 4CJ0B 2PIAA 3LX0A 4HSVA 2ZW0A 1Y56A 4C56C 2WDQB 3C46A 4QCLA 3K5MA 4CGYB 3HZXA 3T16A 2E74C 4XQNA 2NVXB 3FVQA 2PLPA 3I3CA 4QIWB 1E0ZA 1IW7C 4HEDA 4Y7NB 2NBFA 1EU3A 1IW7D 1W6KA 2NVYB 2M2LA 2F0IA 1QOFA 1ZP0B 1IYVA 3AEBB 4KKTA 1JRPA 2F0KA 4O42A 3LXFA 1E2WA 3MFGA 1JOOA 2K5QA 4RHRA 2E2IB 1EL0A 2WKCA 1NI3A 5EPJA 1GPXA 3BS1A 5ELBA 1YMHE 4HKZE 1U4MA 4PMCA 1DD2A 1TS2A 2AQ2B 2IX1A 3Q6SA 3SEBA 4JX1C 1BCPF 5I9PA 2PTLA 3J80E 2PW9A 2W3RA 3AE8B 4RKLA 4C2MB 1C78A 5EBCA 1C77A 2EY1A 2VZKD 2I2YA 1SNMA 1PYWD 5M5XB 1XX8A 1U4LA 3U2SC 4OW0A 5CBEE 1RWSA 4ME5A 5EPKA 2PZUA 3FC4A 2Q5WD 3J81E 3DWMA 5C0XI 1SNOA 1IGCA 5T8IA 3EJIA 4RHSA 3PUZA 3VRBB 1PZKD 2W54A 2HCCA 3BIID 4WH4A 1STEA 2PO4A 1HTLD 1I4RA 2QJLA 4P16A 2XWBB 2H4OA 1V1PA 3M4OB 1SFOB 1BNZA 4KKSA 1FNVA 1SDFA 3B2FA 1U4RA 1CHPD 4IFDH 1Y8NB 4US9A 1K50A 2HTME 1RKNA 1DOYA 5EKKA 3S1NB 2ID0A 3T51B 1UNSA 5MPOA 1SBBB 4OVZA 4LAAA 1F2RC 2IGGA 3DUZA 1Y8OB 4USAA 3MC0B 3N6RA 5CORA 2MJ3A 3QWNA 2B63B 3K7AB 2PMVA 2B2YA 3LWEA 3AECB 2L55A 1B53A 2RSOA 4MIUA 1IUEA 3HUIA 5EQ0A 2QSDA 1PZID 1E2ZA 5JPNC 1FNUA 3L3OC 3OIQA 1S5FD 4CKCA 1OQRA 1B1ZA 5CV9A 4XTCS 1GUNA 4IUTA 3T53B 5M5YB 4YTNB 4M0WA 4QUCA 2E3TA 3NZ3A 3I57A 4KD3A 5K36H 3NE5B 4DXGA 2BS2B 1XLNA 5KNCA 4A3KB 1UWMA 1OXSC 4XYQA 3J7AV 1ZXHA 2OF1A 2Y3AA 4RF0A 3T13A 2L32A 3NK9A 1VDVA 4HKQA 1CZWA 3K59A 3H94A 1ML0D 1WYGA 1C76A 1B50A 5ELFA 4KY6A 4F87A 1DZ1A 2A68C 1PLFA 3U4EG 2GA4B 5JVH3 3T3OA 3NXWA 5E1FA 2A68D 2E76C 3CQZB 5M9OA 1QG7A 1HPCA 2A6EC 3HVZA 1HZ6A 1SYEA 2WP9B 2A6ED 3EGRA 4EE2A 2E2JB 4PMWA 3MHZA 1TWFB 1EY7A 5JEAJ 2PVGC 2D5GA 3KQ4A 3PO2B 1SEBD 5JEAH 3BWUD 1VLBA 4NKLA 4UAIA 1YJIA 2KWDA 4Z9CB 3AE7B 1AN8A 4OO1I 1FXAA 2RVLA 5DM63 4KN7C 3CHBD 3R2TA 3ZGZA 2Z1CA 2HDMA 2L52A 4G7ZC 1XXGA 4LK1C 4ARIA 3P4SB 1EEID 1Q10A 3DHQA 1GHJA 3AE4B 1DCZA 1XCQL 1STHA 1TWGB 1LTBD 2K1BA 5FO8B 2F3VA 4EQPA 2K32A 4F8MA 2SAKA 2OEDA 4BS9A 2KECA 1PDQA 3C3LA 1SE4A 3TP6A 1KDAA 4A3FB 2MJDA 5G5GA 3J80L 1KDBA 5JEAG 3NVYA 3OIPA 2F0QA 4XT3B 1JOQA 4DGZA 4IUVA 2J42A 5AUKA 2WV6D 2WDRB 1QLBB 2QF7A 2JWUA 2RQXA 3T3NA 1EU4A 4J6HA 3A8IE 3TZDA 5HG2A 3A8JE 4IALA 5M3MB 1BDOA 3J81L 3MJ5A 1SIJA 3D6CA 4DAYA 1MPEA 4K5VA 3S16B 2QIEB 2O5IC 1LTSD 1HUNA 3KF8A 4FF2A 2X6LA 2D5DA 3NVWA 2LY7A 4KMUC 1D5XC 3VQIA 1XTCD 4DU9A 2F0UA 1SSNA 1L0YB 1K83B 1BUIC 3IXSA 4YSYB 1BUVT 1EWCA 1WWTA 1SJHD 4DK1A 1RYJA 1WVLA 1X32A 1LT4D 1HEZE 4RCOA 1R4PB 4RCNA 1Z7TA 1E0BA 2PQEA 1F9SA 2R3ZA 3EROA 3NTKA 3I72A 2JU6X 2R92B 3WDNA 5LNK1 4TQ1A 2B2WA 1DM0B 3OWFA 1WCMB 1UGJA 4N6EB 2RDHA 3GD7A 3TEYA 3A8KE 2HDLA 2Y5CA 2K28A 2WXMA 5CMDA 1LT6D 2PCFB 1XLQA 2WXIA 1B9NA 2CHBD 5I4DA 3CIRB 3Q8FA 3SVMA 4QF4A 2WP8J 4A3MB 4HJGE 3AE3B 1GB4A 4YIJA 2HQEA 2A5HA 3DMUA 3HG9A 1BR9A 3KWVA 4H7BA 3AE9B 3OOCA 1OO9B 5BMHA 3S2HB 3IL8A 4Q2JA 3Q8BA 2EJFC 1LACA 4KGRA 2ACZB 2ICEC 3E6ZX 5A2QE 1VCIA 1A3TA 2KCNA 3S17B 1II3A 2MHVA 2V3NA 3MFYA 1A15A 5M3FB 1C9FA 2WXNA 2DWQA 4JE3B 1TYGB 3HOYB 1DOLA 4C1NI 5DAUA 1IBXA 1CZPA 2WIIB 3DWQA 1KF6B 3HOVB 1EEFD 1JC7A 1GUOA 5M5WB 3KWLA 1WRIA 5EE0A 2IDYA 1R4QB 2INNE 5LHY1 4XWWA 2YYZA 2KEEA 1PTOH 4JWSC 2JYOA 2J53A 1PRTB 1CHQD 1Y8PB 2B2VC 3N52A 4C3HB 2JP1A 5BYRA 1YQ3B 3K5OA 4TRDA 4FNFA 1VF5C 3W3AA 3MXPA 4YWGG 4MHEA 1KABA 1IKLA 4HAEA 1F9PA 1BMLC 3EUB2 1WSPA 3HOXB 1FCCC 4K2KA 3AN1A 4P2CB 1C8CA 2E2DC 4RGTA 1G8ZD 2NN6I 2INPE 2EYMA 1X3QA 4A93B 4G57A 2IX0A 2IT1A 1SYCA 4BA1I 1JMLA 4XQJA 2ICIA 1FRDA 3U9SA 1OXXK 3NP8A 1SNCA 2C5CA 1V97A 3S14B 1NSNS 4DA2A 1H9SA 4P6VF 2JSOA 1S5DD 4XDXA 3S2DB 1TY2A 1GUTA 3TEZA 4ZK9B 4PT5A 3NRZA 3RLFA 1GB1A 5KRUA 2CJNA 2EY2A 1PXUA 1OFFA 2Q8TA 1S5ED 5J1ZA 2LUMA 3BYYB 1G91A 1I4XA 4AQ7A 1CQFA 1YNNC 4DAPA 3P4QB 5ISRA 4ID6A 2V3PA 1YNND 5BN4A 3PZ8A 4C3IG 2KN4A 1MI0A 2B2TC 2QKIC 2QEJC 1UUPA 3I4MB 1PMRA 3TSSA 4RWSC 1FO4A 3K5NA 1NCVA 4IURA 1SXTA 2D2CC 3VR4A 2MP1A 1O7YA 2G9DA 2AUJD 2Q8RE 2LHEA 1PUTA 1R9TB 3NVVA 4IUNA 2DLBA 3BDLA 3WOFA 5C3JB 2MJ8A 1FNWA 4K5WA 1S5CD 3AEDB 4NZLB 1OXTA 3CWIA 3IT4B 2EELA 4H44C 4HROA 3P20A 2YEPB 1JORA 2JYTA 4C80A 3X3MA 2M00A 2JA5B 2JZPA 3MEHA 1BQQT 3CKIB 3CRLC 1SF0A 4C3IB 2SNMA 1ZOYB 1N62A 2ONQA 3AEGB 2ZW1A 4TMAB 1EM7A 1PGAA 4OHJA 2WXGA 1VF7A 2BBCA 4TKOB 3CRKC 1ZPSA 5A35A 4A3DB 1UAPA 4RGNA 2FINB 5CV8A 1AZPA 1ZDXA 4US8A 1FIQA 1BOSA 3FKIB 1VJKA 5JJZA 3AM9A 3IAYA 3IFDA 1ACCA 4AYBB 2V4IB 2F0FA 4N58A 1JALA 2AX5A 1CJEA 3H0GB 5C4XB 1MHXA 3S9WA 1ZXIA 1XWEA 1Z6HA 2OXPA 3FILA 4HEA1 3ERQA 3A54A 5KNDA 3VR5A 4XE0A 1JOKA 2N9KA 3GB1A 5FK9C 2VB2X 3HOUB 2Y0SB 5H92C 3U7ZA 1Y1WB 1TY0A 1VMPA 1SYFA 2PKOA 1RDPD 5IT9E 3AH7A 4YSZB 1FGBD 2X69A 2H1EA 1ENAA 2JEBI 4E6IA 2Q8IB 1RODA 3VR2A 2JEAI 2IX3A 2NVTB 2Z4HA 5A2QL 1H9SB 3UI3A 1STGA 2M0AA 4A3JB 1CZGA 3F2UA 4U68A 1SNPA 2TSSA 4L23A 5EBDA 3VYTA 1EZ8A 2B2UC 1Q1EA 2CW0C 3VR6A 4K8IA 4PQXA 4KGSA 1BXTA 3W2DA 2JQRB 1ZUD2 5ELCA 2DBYA 4IFDJ 1LT5D 2EKIA 2QMTA 3NS1A 2DY7A 1YN4A 1YN3A 1YNJC 1H9RA 3LB8C 4YXDB 1CI3M 2F0JA 2KCCA 3PUVA 1TS4A 4BY7B 4QMGA 2AWOA 2XRQD 5BMIA 5IGCA 2F0WA 3AEEB 3P7JA 1TKEA 3QIAA 1TWHB 5I6WA 1WTPA 2XIWA 3SR1A 5E6JA 1DJRD 1NENB 1A3UA 1I4QA 4L1BA 5C6AA 1XLOA 4JBWA 3BVMA 4HSPA 4IUQA 2KUMA 2L1AA 2FUG1 1WTXA 3RMHA 4WURA 1SYDA 2EXZA 4I65A 1GUSA 3T56B 2WXHA 3MVVA 2MEKA 4N59A 1LTID 3A7AB 3PMFA 3BVZA 4IFDG 3PZ7A 3H3VC 2Y5PA 2W3SA 1ILQA 5E4XA 1RF2D 1PTOC 2WNMA 1I6HB 5JVG3 1SYGA 1STBA 3NWSA 4ZYSA 1EY6A 2PZTA 1EYDA 2WS3B 3PIO3 5IGBA 3MP9A 4O1NA 1SE3A 1KDCA 3DXJC 5C4ZA 3R93A 4XWTA 2XSCA 2K05A 4J8QA 1E10A 3ZYYX 3K5LA 3RZDB 3IKJA 1GHKA 2ZXPA 2K5DA 3JAML 2WACA 3FEWX 1NYQA 4WJWA 4FXKC 2LKVA 2C9OA 4ZRPA 1NEKB 1ROEA 2WXRA 1A2TA 4B08A 4RH6A 2EYHA 1STYA 1FM0D 5CV5A 3P63A 4C7ZA 3V05A 2BYTA 3K0YA 1O7LA 2NMQA 4L8JA 1DOXA 1HFGA 3HKZB 2NVQB 4D2KA 3LWUA 2N88A 3AE1B 5CV6A 1GOZA 3A7LA 1DYQA 1MSHA 2F0OA 1J7CA 5K36G 2E6XA 2M56B 2A69C 3P1HA 4OZCA 3QJYA 4KHVA 1DOIA 1V1OA 4DNRB 2A69D 4KHZA 1TIID 1A6XA 1VMCA 3GO5A 1JWBD 1KFYB 1OQQA 3H8HA 1O80A 4DN4M 1JE4A 1KNEA 4R9WA 4BBSB 2KQ4X 2EJGC 3P1MA 4IUPA 2K5PA 1F2RI 1SMYC 3X3NA 1QKZA 2K7VA 1KAAA 2V4DA 2XVSA 4A3IB 1DXMA 3SHLA 1AZQA 2K33A 2L11A 5JOBA 1V1PB 2EPBA 2WLBA 4N9TA 4OIKA 3DEPA 1CQVA 3ABVB 3GTQB 1BCPB 5IGDA 4ZOHC 1NVID 3EA6A 2CVRA 2F0VA 5C0XJ 1T5XD 4WAFA 1J7BA 4NJCA 3TEWA 5G3LD 1W6JA 1IYUA 1HQRD 4X3KA 2G9HD 5KYIA 3NSWA 2EOTA 1QOBA 5C0XH 3SDZA 3Q8CA 3HP3A 1CT1D 2A6HC 1D1IA 3R2IA 2EZVA 1RFKA 4Q5VA 1L4DB 1TKWB 1CFMA 5IT9L 1KNAA 2F0TA 2A6HD 5TSSA 2BCOA 2K22A 1MVKA 3GQBA 2IGHA 1D1KA 1EWYC 2B8FA 2N9LA 1LTRD 2NTSA 3K6OA 2L1BA 3C2PA 4ZRZA 1M4VA 1WD1A 4YSXB 1JWAD 1QOHA 1EYCA 1X3PA 2NWGA 4K5XA 2F03A 1G2TA 4A55A 1SB3C 1FYCA 1NYRA 3MWYW 5GXGB 5FLXE 2GI9A 4L6TB 5IIFA 1I7HA 1HFNA 5C0XG 3Q23A 5J39A 2BE5C 3ZJUA 5CBAE 1GUGA 2KMMA 2IW3A 5FO7B 4WWMA 1BO0A 2BE5D 1ZE3D 3PV0A 3MXUA 3E9SA 1KH0A 1N63A 1J9OA 3AE5B 4C7YA 5IGEA 2B8GA 1PTOF 5BMGA 3S1MB 3NTIA 3RPFC 1I4PA 4C3JB 1HZ5A 5BN3A 5C5LA 3SK4A 4BY1B 3NBIA 1TQOA 4KD4A 4UDUC 3W1SA 1STNA 3E5SA 4AS1A 3AB5A 1ZEQX 3GTLB 2O2LD 1N60A 2YU9B 1LLRD 1B3AA 1QNUA 2DN8A 1EQTA 3I91A 3I73A 4FXDA 1Q3LA 3IAM1 4R3DA 2MGSA 1AEXA 3VA5A 1EQVA 5LL6X 1HRJA 1WTQA 3NQTA 3Q8AA 4YTMB 2F0PA 4IN3A 1MSGA 1L6UA 1YNTE 1HCZA 4KJOA 3GV3A 1A2UA 2F0HA 2CJOA 2H88B 4REZA 1QF6A 1F2ZA 1M8AA 4C1NK 4KX6B 3TP7A 5EGTA 3MA2B 2K6AA 3DM1A 2VB3X 3FPUB 1FMAD 1BBXC 3NQIA 2OHFA 3SK8A 2XN9C 1ZDVA 2B76B 2FE8A 4C3HG 1PFMA 2K9XA 4XDDA 2DNCA 1VZ8A 2N55A 2L83A 3AE6B 2PZWA 4PV1C 1UWXA 1HA5A 3NPPA 2LGIA 5JXVA 1FFUA 1YN5A 1FRRA 3NUHB 1QB5D 1SSOA 5NUCA 1HHVA 2KACA 2AWNA 3ZJVA 1K8OA 2RSNA 4K6DA 2M9VA 4LMQD 2O5JC 3I90A 4XT1B 1K8MA 5CV4A 2WXOA 5C3XA 1K52A 4OO1H 1RTNA 3ETRA 2VZKB 5G3LF 3L7ZC 5CC4A 2EDGA 3MHBA 2JA6B 1D6EC 1DOKA 5HURA 3OMCA 4KK7A 1CTMA 4RF1A 5BYQA 1T3QA 4NW2A 3P75A 1D4BA 5D65A 1JB3A 3I4LA 3DWAA 4K6LA 3FPPA 3RUZA 4RKBA 4DAVA 5AFWA 1CA5A 2H89B 1TWAB 1ZXTA 3MXNA 4EQOA 2WB1B 1NAPA 3MXGA 1GAQB 1JWUD 3MAQA 1XYIA 3C1FA 3SR6A 2L0CA 1BF4A 2E2HB 1C79A 1CK1A 3K58A 5AUIA 4IOIE 4DQOC 1AWDA 4OZAA 4H13C 1TKGA 1VZ7A 4MT5A 1FD7D 5C44B 2B2YC 1LTAD 2LS01 2NZ1D 1E7PB 2N7JA 2XWJB 2BB5A 4KI0A 1I6VC 5E4WC 1C4PA 3KK7A 1L0XB 2QDBA 2LJIA 1B9RA 1EY5A 2EYPA 2A73B 3QO2A 3HOZB 4ABNA 1ESRA 3ZJTA 4R8IA 3VYSA 4KGTA 1WGKA 1MBYA 3MZ5A 1WTOA 2EE1A 3EQLC 2WKDA 3PIP3 3M4YA 3OSOA 3AE2B 1F2LA 1SNDA 2KVMA 3SK5A 1SE2A 4B9XA 4MH8A 1NR4A 4XXEA 2W82A 2EY5A 4ZLTF 1MI2A 3MTSA 4A3EB 4ILWA 5DEHA 3M85A 4A3BB 1XO3A 2L9HA 1RHPA 4V0BA 3AV8A 3SFEB 1QT9A 1I3QB 2K04A 3GP7A 5IOCA 1EY8A 4CJ1B 2V0GA 5JAVA 2PMZB 2RDGA 4RNAA 1QJOA 2RPVA 5T1GA 4KJNA 1L5PA 1Y69U 3VYUA 2VNUD 1V8QA 3D4WA 3DEOA 2JA7B 2IJ0A 5I2XA 2K0PA 1C4CA 4LJZC 4ZRQA 5D3IB 4YTPB 1A70A 2WXLA 2F0GA 2L4NA 3WCQA 4FF3A 5D3DA 1Y1VB 4G7HC 2WXFA 1IBXB 4QUFA 1KLGD 3B9JA 4NP5A 3VR9B 2NB0A 5KIXA 4K14A 2FJ2A 3OPOA 1EIGA 4FVMA 5C4JB 4EQNA 3PO0A 2FHTA 1MGSA 4ITKA 3J7AF 1S4ZA 4HCEA 2KOLA 1JROA 1JWSD 4FP5D 4OGQC 1G6ZA 1F77A 3SE0A 1D2BA 1TS3A 3NBHA 3OW7A 3HOWB 5HGTA 2LMCA 4LLGM 3OMGA 2BS4B 4WORA 3V3XA 2EY6A 5EKIA 4XQQA 2RA4A 4F88A 3AEAB 1RTOA 3IFTA 1J7AA 3QB3A 5E3FA 3D4RA 1TS5A 2LEKA 1PGBA 2ENBA 4JPSA 1FFVA 2Z4IA 1OXVA 3H91A 4R8NA 3NUCA 1VDZA 1FD6A 4B9WA 1WTVA 1PRTC 3KLRA 3C1EA 4KY5A 5FKAC 3NHHA 4PMBA 1PRTD 3PO3B 1TKYA 2ZXRA 1EY4A 1VZ6A 1Q8IA 4DFAA 2PVOD 3VYRA 3NVZA 4CQNA 1EFID 4J1MA 1TU2B 4WFN3 3BVGA 2NN6H 1LT3D 2N0SB 1IL8A 4HR7B 3TP5A 3HRDD 2CW0D 1L4ZB 2NUCA 4Q0FA 4ZUJA 3BK2A 3BDOA 5KEEA 2X6GA 3OWEB 5COYA 3D6WA 3PUYA 3U52E 1PFBA 2BDNA 1YNJD 3KUPA 1ET9A 3QOJA 2KAJA 2SOBA 1KRHA 3NTHA 2B2VA 3U9OA 2VXWA 1Q90A 3HGBA 4IQZA 1T5EA 5G5HA 1EOTA 3IAS1 4KKUA 2WINB 2F0MA 1T6BX 1QWYA 4K2LA 2PW7A 3EFXD 3S1QB 1PGXA 2F0LA 2VUMB 3KLSA 3GTGB 2M19A 1SNQA 1CM9A 2NYZD 1DGJA 1IHZA 5H8YE 2IPKD 2NN6G 1HTPA 5IODA 3GS2A 5DM73 1F9RA 3SK6A 4RFBA 4IZ8A 3EVQA 4ZAIA 2RMMA 1FR3A 1SYBA 2WU2B 4XDCA 2B2WC 2F0NA 4TQUS 4RGOS 5EE3A 3E0JA 4U673 2J4XA 1EIHA 2RDFA 1I4HA 2WQYB 1JWMD 5EJWA 4IKGA 4ODGA 2JA8B 1JCKB 1ZYRC 3I8ZA 1H9MA 2WDVB 3RFZB 1B9MA 1STAA 3W5VB 1PTOD 1PZJD 1S5BD 1ZYRD 4KKJA 5ELDA 2B39A 1I4GA 1B4OA 1FXIA 2SDFA 2Z8LA 1E9MA 4NAWB 1OXUA 4HMJA 2PW5A 1WTWA 4B0MA 3TP8A 2WU5B 1EY9A 3I9V1 3W5UB 5C3EB 3NWTA 2NTTA 2BW2A 1Z47A 3LNNA 4G4KA 2BOSA 3FILB 1D5MC 3Q22A 2B2TA 3FMCA 2K01A 2EYFA 2DYMA 3VA7A 1P7EA 4HTHA 2FMMA 2WXJA 2CQAA 1I50B 1XF5L 3I70A 3D31A 1E2VA 2LMCB 4I7ZC 4GDLB 2LFIA 3VRAB 4TQ0A 4KKIA 5I2YA 1XEEA 3QG1A 4CHTB 5KNBA 4L2YA 3G6JB 5D14A 2OT2A 4XYOA 4BA2I 4RGMA 2JX5A 3L4PA 1SJED 3E56A 3Q69A 3GTPB 3J7YW 2F1MA 4B0EA 4F7XA 5T1IA 4A3GB 3P4PB 2FFKB 1LV9A 4XIGS 2ZXOA 2R7ZB 4ZUIA 3AB9A 1EZ6A 3V2TA 1O78A 4M8AA 3KBXA 5J22A 5HFYA 1N5WA 4X3UA 2WXKA 5IGFA 2BA1A 1SMYD 2SEBD 3OHXC 2W55A 4CJ2C 2J52A 4IDIA 2JXTA 1PRTF 1HXYD 1EY0A 3CU7A 4A8XC 2F3WA 3BZDB 4M1UB 3TMEA 5K5PA 4OL7A 3GV6A 3T4AC 1UEAB 3HEJA 4H2AA 1ET6A 1K51A 4FXCA 4A9AA 1A3VA 1G2SA 4NDXA 2BA0A 5D7GA 1WXQA 4ULLA 4FF4A 3P4RB 4NMZA 1RCVD 3H09A 4DXFA 3TZUA 1LTGD 2E75C 3RZOB 3S1RB 1QOGA 4YT0B 2RKSA 1E6EB 1JR0D 3SXHA 3WOEA 3A56A 1D5ZC 3R8BA 4A90A 1CA6A 3HVDA 4KY7A 3PUXA 2K3UA 2I38A 3O13A 3SFDB 2KA7A 4K8JA 2JE6I 2AQ3B 2K03A 3GTMB 4C3JG 3AEFB 3N9YC 2WXPA 3C8YA 4JWUC 5EE1A 1LTTD 2IL8A 2J0TD 2F0DA 2QCPX 1RM6C 5BYSA 4EVOA 1ZKOA 1DOMA 2BTEA 2DY8A 1V8CA 3Q24A 1Q12A 4HCSA 1JICA 2JXMB 3D3RA 1DONA 4JK1C 5C5MA 2B2UA 2ON8A 2R93B 2F4IA 2XRSD 1N5XA 2FMCA 1WD0A 2KDMA 1SAPA 1QE6A 2OEOA 3R3OA 4MACA 2KHSA 1HA6A 4HRSA 1EWHA 3BDCA 5CGKA 3B2GA 3A55A 5F2DA 3V96A 3D4DA 2EYJA 1B2TA 4G7OC 5C2TB 3D8GA 2BB6A 2TMPA 3Q8EA 5C3WA 1FCLA 1G291 1QCBD 2YEPF 1HUMA 1FEHA 2O4XA 1F0ZA 1PDXA 1TVXA 2GB1A 1YQ4B 2G1EA 1JQ4A 3ND8A 1ONLA 3UI2A 5DNFA 4LK0M 4S3SA 5C4HA 1QQRA 3HS0C 4CBVA 4BBRB 3TUOA 3W9CB 1J8IA 3DWPA 4HN7A 2D62A 1ILPA 1AFPA 2J7ZA 4KV6A 1TT2A 5BN5A 2A74C 4CKEA 4HMIA 3URYA 4ZQ3A 3J9CA 3ITPA 3KBGA 1AW7A 3VR3A 2DYOA 4J3OD 4QB4A 3AMZA 4H0LC 1MD2D 5FR3A 4GZYC 1QILA 5EE9A 2HUGA 3AU7A 1TWCB 3TDQA 1F2YA 1KLUD 3LYYA 3IT6B 3M7GA 4WQMA 1EYAA 1P7FA 1JW9D 1H9KA 1YJJA 4FF1A 3HRZC 1ENCA 3H6MA 2JYEA 2MJEA 1JQYD 1AP0A 1VR9A 5JPMC 3L9AX 3BG3A 4NAMA 5FOBB 1RJTA 2EVBA 2BS3B 3TBIB 2KQ3A 1K53A 1ESFA 2AUKA 1WTRA 2R6GA 2EJMA 2I07B 1MHHE 1NUCA 5CV7A 5KYLA 5KGUA 3ND9A 2HCIA 1R7SA 4A6QA 5EPLA 2MH7A 3GTJB 4FO2A 3M7NA 2HDEA 1C4AA 4X3TA 5ELEA 4FXGC 1BCPC 2LHDA 3GTOB 2ZT9C 3FRPB 1BCPD