1FNUA

Structure of streptococcal pyrogenic exotoxin a
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
221
structure length
221
Chain Sequence
QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYTIDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDNKTSQIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of streptococcal pyrogenic exotoxin A reveals a novel metal cluster.
pubmed rcsb
molecule tags Toxin
molecule keywords EXOTOXIN TYPE A PRECURSOR (ALLELE 1)
total genus 59
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fnuA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fnuA02
4RGMA 1GOZA 2G9HD 4C56C 1KLGD 1JR0D 2XRQD 1HXYD 2QEJC 1I4RA 1JQYD 5TSSA 3V05A 1PZJD 1PTOH 1RD9D 1V1PA 1PRTD 1ENFA 3R2TA 3DWAA 1AW7A 5ELCA 1LTAD 3OWEB 1HTLD 4RHRA 1YN4A 1ET6A 1KTKA 1JWSD 1BCPC 1UNSA 2AQ3B 2IJ0A 2QILA 3BZDB 1BXTA 4RGOS 1STEA 1CK1A 1HQRD 1CHPD 3BYYB 1T5XD 2TSSA 1S5CD 4RFBA 1S5FD 4RGTA 1JWMD 3DWQA 3MFGA 1JWUD 1PRTC 1SBBB 1B1ZA 1XTCD 2NTSA 1LT4D 1I4QA 1SE3A 1SE4A 1I4GA 1RCVD 1BCPD 1CQVA 1B44D 3BVZA 1D5ZC 1SJED 5D3IB 4RH6A 1PRTB 1SEBD 1JCKB 1D6EC 2R61A 1LTID 1RDPD 1PYWD 1XXGA 2RDGA 1S5BD 3EFXD 4UDUC 1ESFA 1HA5A 4BWGB 1EU3A 5FK9C 1AN8A 1BCPB 1V1PB 4L63B 1LT5D 2NTTA 1L0YB 1MD2D 1G8ZD 1PTOB 4RHSA 1SJHD 4OHJA 4NZLB 1PTOD 1UUPA 5ELBA 1SXTA 2RDHA 2Z8LA 3GP7A 2XRSD 5D3DA 2XNAC 2AQ2B 1FNUA 1LT6D 1PTOC 1YN3A 2IPKD 3CHBD 4TSSA 1DJRD 2SEBD 1PZID 1LLRD 1ET9A 3W2DA 2O2LD 3O13A 1QILA 3SEBA 1LTSD 1I4HA 1CHQD 1EEFD 1F77A 4O1NA 1KLUD 1TY2A 1YN5A 4ZYSA 3BVMA 1PZKD 1EWCA 1LTGD 1CT1D 1FGBD 5I4DA 1TS5A 3R2IA 1TS2A 2XN9C 1LT3D 4DXFA 1S5DD 1TS3A 4Z9CB 1SE2A 1EEID 1FD7D 2AQ1B 4RCOA 3URYA 1L0XB 1EFID 1FNWA 2CHBD 1EU4A 3EA6A 1LO5D 1PRTF 1RF2D 4DXGA 1DYQA 3BVGA 2J4XA 3R8BA 1D5MC 2ICIA 2WV6D 1I4XA 3MC0B 1M4VA 1I4PA 1TY0A 3KLSX 5FKAC 3DWPA 5ELDA 1LTTD 1V1OA 1D5XC 4L6TB 1LTRD 1BCPF 3BYTB 1FNVA 1TS4A 1PTOF 4RGNA 5ELFA 3TSSA 4K6LA 5ELEA 1S5ED 1LTBD
chains in the Genus database with same CATH superfamily
4IM0A 2INCC 4JIOU 2MX2A 4NAWA 3I4NB 1L6UA 3AE4B 3DBSA 2A74C 1FFVA 3A9JB 4GNXC 1PDQA 1I4RA 1YBYA 4M01A 5FLMG 4XDDA 3VXWA 4YCUA 4NB3A 4ZQ3A 4WWPA 2JA6B 3SFDB 3I55A 1Q1EA 4DK1A 4BFRA 3TEYA 4DR4L 2BDNA 4MSQB 4EZJA 5AJ3L 1VDVA 3OTOL 3Q6BA 1JWSD 2IJ0A 2MNAA 2WXIA 4X57B 2R6GA 3KUPA 5C3EG 1YJIA 1CHPD 1YIJA 4C3HH 4A3FG 3I4NH 1B9NA 4RFBA 2KCTA 2L9HA 3DBLI 3BS1A 1SE3A 2PZUA 4LFAL 2R92G 2A4ZA 3N9YC 1WJNA 4AQYQ 3MXGA 2K9XA 1SROA 4YL8A 5E6JA 1YIWA 3HM3A 4DV7L 1FXAA 1Q90A 3HOUH 2ZW0A 3PIPA 2PEAA 1CM9A 4AJWA 3ZW3A 3QJZA 1W6KA 2MBOA 2GI9A 3D6WA 1EIFA 2KVMA 5J2RA 3LXFA 4OWXB 1SYDA 4KV6A 1SYBA 5M5XH 3TMEA 1ILQA 4JE3B 2ZW1A 3KF6A 3UE0A 1PGXA 4BBRB 3MAQA 2KWCA 3AB9A 3OW7A 4KIKA 2GOWA 3LX0A 4P75A 1IL2A 1I3QB 1EZ6A 2F0UA 4FF1A 3AV8A 2KHWB 2MA9B 3D8GA 2E2JH 2AYOB 3ZYYX 4A3MB 1SXTA 2BH8A 2M0AA 3PSIA 1J7AA 1PTOC 2X6LA 5IP9G 3EN2A 4O2DA 2PI2E 1C0AA 2WXNA 3A33B 4DK6C 3PO3G 3SD5A 1HH2P 1CFMA 2VXWA 5ELOA 2VL6A 3HOZG 2FUG1 1R9TB 3JVZX 2XWJB 4EEWA 2BPSA 3CCRA 2N1VA 4JI1L 1E3PA 4GMVA 1EY5A 5CGKA 5GAHC 5NUCA 1WGHA 1LTSD 4HMIA 3L4PA 1ILPA 2PYKA 3DM3A 1EEFD 5KGUA 5AJ3Q 5MPOA 3Q2AC 1KLUD 4A3EB 4GKKL 3CD6A 1PDXA 4TVAB 1P9DU 2CH4A 4XXEA 1Q86C 5BR8L 2D3CA 4Q0FA 1CKNB 4NXNQ 3GTMH 4HSPA 1WTWA 3R2IA 2KTRB 1WMHA 2OHFA 3SHLA 3G48A 1S5DD 2LUMA 3A55A 3HKZG 3NPPA 4N58A 4JI5Q 1SRUA 3VTWA 1WGGA 5FO9B 3KUCB 4AQ7A 5C3EH 3NVYA 4IURA 1QZEA 4N59A 5IA7A 1LGRA 2ON8A 4GLAC 3EA6A 3RNEC 5D7GA 3BVGA 5IP9H 3T1HL 1PH5A 4GS3A 1DOIA 1RAXA 3P1MA 1SN8A 1ESRA 2F0JA 3DLLA 3A1QB 2F0SA 3ALBA 3BJUA 3AU4A 3EBEA 3J7ZC 3CC2A 2CW0C 3MHBA 5JPNC 4FF3A 3KWLA 3CAMA 4X3TA 2JA5H 3NTKA 2WXQA 1IBMQ 1SE9A 4AUQC 3SK4A 5BYSA 2ZJRA 3ECIA 5ELDA 2V4IB 3A8KE 2FFKB 3BYTB 1BCPF 3Q3NC 2F3IA 2D9UA 4LJZC 2BT6A 4WJ4A 2BW2A 2MJDA 4AP4C 2F0WA 1GOZA 2F0PA 3E0EA 1L0WA 1A2UA 4S0RA 3TL5A 4PZ7A 2E6XA 4HLEA 1G6JA 3U4VA 1QNKA 2FBWB 2IGDA 4KY7A 3KLSA 1EIGA 4POFA 4RMFA 5JEAJ 4C3IH 3G6JB 1EY6A 1SNMA 2K7VA 3AFQA 1K8OA 1LTAD 1ZKHA 4L5RC 2GMIC 2LUEA 1HTLD 1O7LA 1YN4A 4JBMA 5CX3A 4WJWA 2KZRA 5G5GA 3V96A 2B2YA 4WAFA 2L12A 4NQLB 4POGA 5H8YE 5C3JB 1CK1A 5DAUA 2M19A 1L4DB 2K04A 2KNBA 4RGTA 4NXMQ 2JA7G 3ZKJC 3FC4A 2CU1A 1WYGA 2WP9B 3S14B 1XT9B 1Z7TA 2C5CA 1FCCC 1EUVB 2QKIC 1PGBA 3MXPA 2INNE 2K8HA 4G0NB 4B95A 1STBA 1WTPA 4G50A 3Q8FA 4OO1G 3BVZA 3ZNHB 4KTAA 2LGIA 4PQXA 2CQAA 1KHIA 1QKZA 4IUQA 1PH7A 1ENAA 3IKJA 2NVXH 2PIAA 2V3PA 4OO1I 1RYJA 2F0TA 2JYEA 3HS0C 3PSEB 4A20A 1VQ5A 2WLBA 1A5RA 2CHZA 2KFKB 1V80A 2Z4IA 1QZGA 1WCMG 3TP5A 1YEZA 4PV1C 3K5MA 1V5TA 2FIDA 1GKHA 2KVRA 4PMCA 2LS01 3MA2B 2A5HA 2YU9B 4ID6A 5LL6S 1A63A 3W9CB 1NDDA 1HUMA 1Y69U 1HZ5A 2HCIA 1TWFB 3VFKA 4I7ZC 3NVWA 4ZAIA 4GDLB 1PHJA 1I42A 4ZRPA 2LJIA 1FJGL 5JOBA 1FNUA 1CZPA 1YN3A 2C60A 4WJNA 3D4DA 2CFMA 3GTOB 3NUCA 4P1CC 2OEDA 1YJWA 2MH7A 5BO4B 1XLPA 1C8CA 5JJIA 2XBBC 4LUZA 1XMQL 4A3LH 5EKLA 2K8CA 4C3HG 4A3FH 3RI7C 4KVGB 2CWPA 2J52A 1I4HA 3R3OA 1JMLA 2F0MA 2UXBQ 3S15H 1UH6A 3QWNA 4V0BA 5IIFA 3TJPA 1VQOA 4G3XB 1T0SC 3KOJA 1L7YA 1XF5L 3FEWX 2EY2A 4LFBL 2KFJA 2SOBA 2JA8B 3GTPH 3I4NG 1TS5A 2ASQA 1VZ6A 4JX1C 2BDOA 1OFFA 4IFDH 2AUJD 4H0LC 1EQVA 3BZKA 1GD7A 1FPYA 1TR5A 2PKOA 4R1JA 1VZ7A 1PA6A 1WXMA 4A3LG 2B2VA 1WXQA 4NMZA 4G7HC 1VCBA 2MBEA 2WXRA 1KIXA 2VQFQ 2JQOA 4HMJA 1BMLC 2MCNB 2N9LA 2MP2B 4ZK9B 1UAPA 5IT9E 2Z6KC 3CC4A 1PFMA 2ONQA 5KRUA 4BA2I 4A3GG 4QIWE 2KLGA 4L6TB 4HJ8A 2R92B 5C6AA 2LZ6A 4CJ2C 4HCSA 5KNDA 4DV1Q 4RGNA 3A9JA 3BY4B 4IUNA 1ZXHA 1NR4A 4C7ZA 4RGMA 2K5HA 4K2KA 3UDGA 3ICEA 3WDNA 1JB7A 1YVCA 4LUVA 3A54A 3FAHA 1WFYA 2XIWA 3ONSA 1MKHA 4K6DA 4MM3B 1U0LA 1K0SA 3AXCA 1R4PB 2SNMA 3R2TA 3PRZA 3AYHB 5ELCA 4RKBA 2H89B 1VQ4A 4GIVA 3OMGA 1C77A 2LEKA 2OWOA 2NVTB 4CQNA 2D07B 3CRKC 3PGEA 4FHKA 1PFNA 4KLKA 5C23A 2N0SB 3DEPA 1YX5B 2E2JB 3ZXVA 5C0XJ 3STBC 3UDFA 4ME3A 3RN9C 3L2PA 2PVGC 1STHA 4FXKC 1JWUD 2FUHB 2NTSA 4DA2A 1YITA 4K0KQ 4APVA 4GLXA 1DONA 4DR3L 2JN4A 1T0RC 4HWIB 2Q2IA 4XYOA 1B44D 3DXJC 5E6NA 3VVWB 4R4QA 4U68A 1AE3A 5GAEC 2V3SA 5D3IB 1KH0A 2PNHA 3RLFA 2NVTH 3DBRI 3P42A 4F1SA 4LDTB 3OJ4B 4BY1H 2KX0A 3HOWG 2VQEL 1PQSA 1RDPD 1NI3A 2RDGA 2BYEA 3DBLB 1D3ZA 4UDUC 2A6HD 3E9IA 1WI5A 3C1FA 1RODA 4OX9L 1V8CA 2G5DA 1J8CA 2D5GA 1GM5A 3VUXA 1LT5D 1KABA 3FKIH 2KKCA 4KGTA 2JRHA 4A90A 4ULLA 3IT4B 1LUZA 4NZLB 3NSWA 2LASA 2H1EA 4JI2Q 5M3MG 4EGVA 2X8XX 3RNAC 4K7SA 2OEOA 2XRSD 4OWTB 1UE7A 2AQ2B 3VH4B 5IYDH 2WDVB 1HFGA 5M5WB 1EYGA 1A8VA 4B3MQ 2LVQA 3TP7A 3PLVA 3ZDTA 5IKCM 5D6JB 5M3MH 1YZ6A 2AUKA 4MIUA 3GOEA 1Q81C 4IFDG 1C48A 2GB1A 3BK1A 2I5HA 1QILA 3ND9A 1KAAA 1EFWA 4QQBX 2DJFC 1GG3A 4AOFA 4YSXB 2O6VD 1RWSA 4IW0A 1WY8A 3WCQA 1TY2A 4W9JA 4EKUA 1CT1D 4XZ4A 4NJ6A 3D31A 4DXFA 3H6MA 2QHOA 2WXPA 3W3AA 3VRAB 4C3IB 3MWYW 3PO2B 3AU7A 1YX6B 1ZOYB 4X3UA 2K28A 4KKUA 5BN4A 5KNBA 2WINB 3PCOB 4LF6L 2KTRA 5JHAA 1WR6E 1LO5D 4G4KA 4GB9A 2B3GA 1NY4A 2L5TA 4DR1L 3NVVA 4DQOC 3S17B 4GOPA 4FVMA 1EY0A 2K4KA 2YEPB 3S1NB 2KLCA 1EUJA 2JZ3B 1DCZA 4E6IA 4HDOA 1STAA 3AM9A 4B3RL 5IYCH 3N3KB 4BBSH 3OAWA 3L08A 1SYGA 4DUYQ 3BK2A 3CCMA 4GLVB 2RSOA 2E2IH 1X54A 2RHSB 3H3VC 4HJ9A 1JR0D 1HXYD 4C2MH 2ID0A 5KEEA 4WORA 2DLBA 2KTFA 1G291 1S4ZA 2PMVA 3VRBB 4JI3Q 5DPSA 5K36H 3S1RH 3LJ3A 1E22A 2WNMA 4LF8L 3J81i 4N8X1 3K59A 4A3MG 2UXDQ 3MTNB 5GADC 3ML9A 2LHEA 4XC2A 1S5FD 2QCZA 2KQ7A 1LT4D 2EOTA 2A6HC 3GO5A 2F0KA 2R92H 1R4MB 2Z0EB 3T3NA 4DAYB 3J7AV 1OXSC 3HGBA 1GPXA 1MIUA 2RA4A 3ZDMC 1JICA 2I2YA 4S3SA 1TZOA 1IPGA 2MW5A 4US8A 2R61A 2EMSA 3WAPA 3QAQA 3V2TA 2KMCA 4DV0L 5CV5A 1E2VA 4YHHL 2JA8G 2WQYB 2HDLA 1PFBA 2R2QA 3NEMA 1BO0A 4BKGA 5IYDG 4JI5L 1B53A 2LXJA 4ILWA 4IG7B 4MH0E 1VQLA 2DN8A 1NMGA 1VQMA 4K5VA 3G6EA 3EC8A 1G8ZD 4BOSC 1L5PA 2ZVNA 2PI2A 3LDZE 3C46A 3B08A 2F0QA 4KKJA 3TEZA 4AQYL 1F2YA 3VYRA 5C4XB 3RPFC 3C2PA 5DM73 3R7RA 2CS4A 3D4RA 3KDFA 4TSSA 3I73A 4BKSD 2MSED 1IGCA 2PE9A 4LAAA 5DPRA 4HR7B 4FYDA 1PGAA 5CTRC 4YWLA 2LGDA 4LJOB 5KHOA 2PZWA 2WX0A 4ZYNA 2A6EC 1K0RA 2AEHA 1XLNA 2R7FA 2UWQA 1EY8A 3OTOQ 1P3QU 3BVMA 1N36L 1D1IA 3RNBC 3T13A 4EQNA 1K51A 1TS3A 3UGBB 5M3FH 4X65Q 4WQOB 1EEID 2FMCA 4LFAQ 4A3BH 3I3TB 3FHWA 1S3SG 3U52E 3VDYA 2ZXRA 3GD7A 4M1UB 2KWUB 2WB1B 1PRTF 3GTKB 4LTUA 4GKJQ 2MQHA 3DWGC 2ZT9C 3CXCA 4LF4Q 3B6YA 1GVPA 3C1EA 4KSKC 2F0LA 3GTMB 2B2TA 1KF6B 2EY6A 1Q82C 4ACFA 4NXML 3DDCB 5CHWA 1XEEA 4HN7A 3IG3A 1S3OA 3J81E 4K6LA 1C3TA 3R93A 2OOBB 3KBXA 1CMXB 3U50C 3R3MA 5IT9L 2Z0SA 2GVAA 3M4QA 1CTMA 4K3BA 1L2FA 4C3JH 4A3CG 4ZRJA 2XEWA 2OJRA 4KJNA 1RTNA 4DAMA 4G7OC 3V05A 3HOVB 3BWUD 3WOFA 4BY1G 2ENBA 4KV2A 2MO1A 3GE3C 2VUMH 1V1PA 4DR2Q 2UUAL 1TWGH 3ZNGC 3I2ZA 1YNXA 2CHXA 5GQOA 1V5OA 3LYYA 3GTQH 3PHXB 3PT2B 4LFCL 3TZDA 4DAPA 4NNJB 1ASZA 1J7CA 2LKVA 3U9OA 2RQXA 4JI4Q 3M7NA 4QY7A 3I4LA 4YCVA 3U4ZA 4ZRZA 4RMAA 3NXWA 1WTXA 2E2HB 4NXNL 3MFGA 4P74A 4GXBA 4LF7Q 1D1KA 3Q14C 5HKHA 4IPCA 2O5IC 2BVCA 1IHZA 1VMCA 3U9SA 1WGYA 2BCOA 3HHMA 2KCNA 4IFDI 1QLBB 2K14A 3W1YA 2A1AA 3U7ZA 3Q8DA 2DYBA 4REZA 3K6OA 1HJPA 1HNXQ 1LTID 4LWCA 3IBEA 1W2BA 1YJJA 2NUCA 1WE7A 4XT3B 3KJOA 4FULA 1I7HA 4JI2L 3KW5B 2UUBL 1N61A 1IBKL 2L00B 2L76A 4FJZA 1AZPA 2L1BA 2FCMA 1XNQL 2R7ZG 1C4QA 4G57A 4HAEA 3DM1A 2KJ6A 1IP9A 2DYOA 3CQZH 4YIJA 1UUPA 4QB4A 2A6ED 4PZ8A 1EF1A 2W55A 2HT1A 4RNAA 1DOYA 2LMCB 1VDZA 2GVBA 2KMMA 4M8MA 2F0NA 1L6VA 3CHBD 1XTDA 1T9HA 3PQIA 2Y0SE 1WJ6A 3NJTA 4W9LA 2SEBD 1X3FA 2W3SA 3M3YH 1JOOA 2Q5WD 4GN4B 5HURA 2UU9L 1HEZE 4W9HA 4K8JA 3WIMA 4JK1C 3K81C 5C44H 2PO4A 4QJFA 4LK1C 3BIID 2K8BA 3Q69A 4BY7H 2X69A 3DBHB 2B2VC 4FNFA 1DOMA 3GZNI 1H9SA 4PS7A 4CHTB 4F88A 2B63B 1LTGD 5FLXL 4IUTA 1FGBD 2OCEA 4HJ5A 3GV3A 3ULLA 3GTOH 4DK0A 5A35A 3M4YA 1UWXA 2VB2X 2GA4B 1ZXIA 2D3GA 5F2DA 2ZXPA 1YHAA 2MBQA 3DHIC 3I9V1 3I4MH 2V9HA 4UPAA 4QL5A 1X1MA 1U9RA 4LCDE 1ZXTA 3HVZA 2BYVE 4XTCS 1GHKA 3Q3JA 3B2GA 1TVXA 1R4NI 3EJIA 5C0XI 3OYYA 1BKBA 1ZDXA 3GTLH 3ZJVA 2WV6D 4FJVB 1ZEQX 4PS8A 1R9TH 1P98A 2I5LX 1GHJA 1K50A 2KT7A 3WOEA 1UF0A 4K3CA 2IHFA 1ISNA 4MSMB 4KIKB 4LF4L 1HE8A 2K0PA 2N9KA 2N9XA 1EYCA 4R4IA 2IT1A 3RLNA 3KLWA 2MO0A 4P72A 3S1NH 3VYSA 3ZNID 4XQNA 1S5ED 4A93B 1RJTA 2Y0SB 3KYHC 3OIQA 1VQ6A 4AYBE 4EX5A 2XK5A 3AFPA 4A4IA 4LF5L 4OGQC 2WU2B 2J0TD 2J7ZA 2DYMA 4FXDA 5TSSA 3HKSA 2FNJB 2EQSA 5C0XG 4PYUA 3KF6B 1IXRA 2VUMG 4CO7A 1TU2B 1E90A 4A3BB 3DHGC 4NPNA 1F52A 3H94A 4RHRA 3ENEA 2D10A 4II3B 2W82A 2A19A 2A69C 2XWBB 2E8GA 5JAVA 1BBWA 1T5XD 1YI2A 4CDEC 3H0GH 1A0IA 3CCJA 5C5LA 2W54A 3U8ZA 2B29A 2KDBA 3HOYH 1MJDA 2H88B 4DV2Q 1WGKA 2ZCCA 3IAS1 2JYTA 3TQYA 4RF1A 1MSGA 3JAMc 3I5JC 1SJED 1OXXK 1TQOA 2HIXA 3KK7A 1P16A 3NHEB 3H0GG 4IPGA 2K33A 2E5LL 2BKFA 2KOLA 1DOKA 1HTQA 1VQKA 1UZXB 1EYDA 5AFWA 1YQ4B 3EIVA 2VZAA 4QUCA 4FN2A 2KQ3A 1L0VB 2M56B 4HEA1 4JW0A 4A3MH 3JYUA 3EHVA 4DGZA 1V81A 3DUZA 4ZUJA 5FO8B 2C9WB 1J0GA 5CYUA 3I70A 1FYCA 1STGA 4KGSA 1R4NB 1Y56A 3ITPA 1CI3M 1JT8A 1SYFA 4XX5A 3QB3A 3AMZA 1TGZB 3BINA 2GBRA 5HFYA 1VQJA 4GNXB 1WR1A 1WD1A 4OIKA 2CU3A 2DZIA 2KDEB 2WXHA 2WAQE 5LXIB 2JZZA 1PMRA 4YY3L 2NMQA 2WDQB 4ZDVA 3NWSA 1WJJA 3CPFA 3VR6A 5HHDG 1TZ1A 2PMZB 3AE1B 5FLXE 2AL3A 3PHWB 1K28A 1DGJA 4L5QA 2INPE 1ICFB 4DUYL 1WE6A 1J7BA 3A8JE 3Q8CA 2BYTA 4X3KA 2BF8B 2JYOA 3AE7B 1W6JA 3ZRCA 4ANXA 1EO6A 1F9RA 1TYGB 1Y1WB 4ASWC 3P20A 5D14A 3ERQA 2MUYA 1HR0Q 3KVFB 4ABNA 2J0JA 1IBXB 2D2CC 3APFA 2OQ0A 1WM3A 1ML0D 3TS2A 2K1FA 3K8AA 3FVQA 1KD1C 1FNWA 2KQSA 3DVNU 2F3WA 2LFIA 2VZKB 1EZ8A 2L3ZA 2NN6G 2K75A 3I56A 1OEYJ 1Q12A 4DU9A 1I4XA 2EYOA 5C3EB 2XSCA 3TRZA 5G55A 3QOJA 2GRIA 4LNNA 2PQAA 3CSTA 1E8XA 2O2VB 3A5UA 1TKGA 2N88A 4ZKCB 1YNJC 4JOIA 1NI2A 2DWQA 2NBUA 3F1ZA 3B9JA 2KN5A 2AKWB 4XYCA 2IDYA 1TWCH 2Z4HA 3HKZE 1HR0L 3PO2H 5M3FG 2A8VA 3W1SC 5BYQA 3DHQA 3HM6X 2B8GA 2HJ1A 5IGCA 1SFOH 2B63H 1TKWB 5IT9c 3A8IE 5K36G 2MJ3A 1WH3A 1E7VA 4I6PA 4KY5A 1JQYD 1KRSA 5EKKA 2G45B 4CDFC 4DV1L 2INDC 1X3GA 1GUNA 3RZFA 3J81L 2UU7A 5IYBG 3TCAA 3PUYA 3K5LA 2QDLA 5EPLA 3ABVB 1BUIC 3TIXA 1SNDA 2KAJA 2N7EA 2Y5CA 1KTKA 3BZDB 1UNSA 2AQ3B 3P75A 4K81A 5LLIA 1PH2A 2NWGA 3S14H 2JE6I 5IN7A 4KMUC 3VDZA 1VQ7A 3KF8A 1N33L 5JEAG 3B0AA 1V9JA 3DBHI 3TUOA 2V0GA 4MTNA 4KZCA 2EYHA 4GZYC 2EXDA 1XYIA 3FPPA 2N3SA 3Q6SA 4M8AA 2JXXA 1XTCD 2AWNA 4AIMA 2BOSA 3PUVA 4S17A 4A8XC 3FDTA 2PTLA 4O42A 3HOZB 3L10B 1Q3LA 3I72A 4JG2A 1FXIA 1V97A 1KDAA 5HGQA 5G3LF 2JA9A 4GGQA 2X38A 3PMFA 2BTEA 1WOCA 4FO2A 2MHVA 5DEHA 3F2BA 1A3TA 1N34Q 4A55A 1PRTB 4JI0L 1BNZA 2KVZA 1SEBD 5CBEE 3CMMB 4K7WA 1V86A 4X66L 1JOQA 1AARA 2JPHA 1KAWA 5DLQE 2WXFA 4DK3C 2ZPNA 4FA6A 4ZKBB 4FXGC 3VTVA 3EFXD 3ML8A 4XDCA 4H2AA 4IUUA 3S1MB 1IW7D 1HCZA 3ULPA 1C4CA 3PREA 1RFAA 2VQEQ 2YTXA 4XQQA 1BCPB 1QVCA 4H7BA 3A0JA 4P71A 2PMZE 2K03A 1U5KA 4L63B 1ZP0B 4HKZE 3T9LA 3AU5A 4P73A 1OTRB 4TRDA 4XWWA 1SGHA 5C4JH 1II3A 4A3DG 3FRPB 3MC8A 2B8FA 4OHJA 1NEKB 4LNQA 3V60A 1NNXA 3MTSA 4A3FB 5IGFA 1GC7A 1K8RB 1PXUA 1JALA 4MDKE 2Z1CA 3PIO3 1LT6D 4XYQA 2Y5PA 4RKLA 1LM0A 3E5SA 2L11A 2RF4A 2X6GA 4RWSC 3S15B 2ZM6L 1TIFA 1XLQA 2M8SA 1QB5D 1WX9A 1U4AA 5E3FA 1SAPA 2N8NA 3SEBA 2WAQG 2IO3B 1NJIC 2KO3A 3ZIMA 1F9PA 2AX5A 2ASBA 4LW1A 3HOXB 2ZNVC 1I6VC 1NBFC 5E1FA 3K57A 1WD0A 3NRZA 5IO9A 4PNYA 1EWCA 5KNCA 1KM7A 3U30A 4MELA 3BU2A 4TQ1A 5C4XH 1BT0A 1SE2A 4K5XA 1NR2A 3T53B 3AE9B 4RCOA 5I6WA 1L0XB 1LM8B 4A3BG 2XGTA 5IYCG 3S2DH 2JJQA 1MFWA 4OL7A 1LACA 1QNUA 3NS1A 4M02A 3ZXRA 3NTHA 3VYTA 3IXSA 1IKLA 1QCBD 2NVYB 2K5VA 1XPUA 2MWSB 1B3AA 5CR3A 5FR3A 2ICIA 1C79A 1QQRA 4C80A 4MN3A 3M85A 3PO3B 1N32L 2ZVOA 4HCNB 3T4AC 5M9OA 3H3VH 5KYIA 1LTTD 1A3UA 3GTQB 2ZEQA 2P5ZX 1QVGA 4W9GA 1PTOF 5ELFA 2FAZA 3MVVA 2DBYA 1Y1WG 2A73B 3CIRB 3D0FA 2Q8TA 4OZAA 4B9WA 1E8YA 2KJHB 4R3DA 2CR5A 1E6EB 2DNCA 4BBRH 2VY3A 2L52A 1PZJD 1Y14B 1CKMA 1M94A 1R7SA 4R4CA 1RD9D 1FCLA 1A3VA 3MC9A 4Y7NH 1D8LA 1LTLA 1R4QB 4YTPB 4IO9A 3BZCA 3E0JA 4KKIA 4OVUA 1BCPC 3OMCA 5T1IA 3PRPB 2IGGA 2MRPA 3R7QA 3S17H 3K0XA 1ONLA 1SB3C 1UD7A 2M0XA 3H7PA 4J6HA 2F3VA 2JQRB 3A7AB 3NELA 4YT0B 1SSNA 2R2OA 2B39A 4F7XA 1NYQA 4A3GB 3VR3A 4ZLTF 3MHZA 2IX3A 3Q8AA 2HTME 2YVCA 2H4OA 2MP1A 5C0XH 4DR7Q 4HKQA 4HJAA 4JWUC 2KC2A 1CSPA 5IGDA 1BF4A 4QF4A 2IO1B 5C4ZA 4A9AA 1UBIA 4C00A 2NB0A 3ZLZA 4OWWB 1N63A 1SYCA 3HOWH 2K22A 1PYWD 2BS3B 3DOWA 4DAYA 2D0PA 1QT9A 1Q0WB 4WH4A 1F0ZA 1KDBA 4B3SQ 2FCSA 4WURA 2FCNA 1QOBA 2JVCA 2I07B 2YTYA 4OELB 3GZNB 5HGTA 4MZ9A 2AL6A 2HDEA 2MQJA 1O80A 4JBKA 3DWMA 4UP7A 3A9KB 1PTOB 4RHSA 2JXMB 5J1ZA 1UGMA 1LFDA 4F87A 3MP9A 4DV5Q 3GP7A 4DXAB 3RLOA 2K6AA 1V1QA 2R93H 3JAME 2A68C 3QCAA 4IOCA 3RFZB 2JK8A 2KUMA 5LMNW 1EWYC 4ZRQA 2DENB 2O6VA 3NZ3A 4C4VB 3GDEA 1H9JA 2K3UA 3K9OB 2PQAB 4KDIC 4A6QA 3TREA 4R8IA 1EIYB 1X6OA 4NQKE 2QIEB 4US9A 3A4RA 3KDFB 3NQTA 4OZBA 5IP7G 2F0OA 2WB1E 4GN3B 5LMUL 1WTOA 2E2IB 1BVSA 3IHPC 3NBHA 2DNFA 4HIMA 2KOXA 1PZKD 2NVQH 5C1ZA 1IL8A 3RD2A 2QA4A 4UHVA 3CW2C 1XNQQ 4W9IA 2HQLA 4IFDJ 2K5QA 3UE1A 5IY0A 4M0WA 3MEFA 1W3SA 1KRTA 4WJ3M 4CBVA 2LJ5A 3UINB 5AZHA 1E5WA 2IY1B 1WYDA 1EFID 3RNCC 5H1SE 2ZPYA 4UAIA 4II2B 2E76C 3R8BA 1QF6A 2EJFC 2NCNA 4UY8C 2GBKA 4X3SA 3DCGA 4K5WA 4EQPA 2K52A 3PF4A 2FXQA 1B70B 2LXKA 4FP5D 1HUNA 1E0ZA 4MH8A 1TTNA 2CW0D 5KYLA 2ZTEA 1RIPA 5CHFA 3I4MG 2VH2A 2BKRB 3D32A 1LTRD 1YQ3B 3M62B 3CWIA 2JXTA 1IZ6A 3NWTA 1N62A 3L0WB 3VUYA 2EXZA 3PF5A 4HSVA 2MBBB 1QUQA 4IOAA 4NJ7A 2XRQD 3NE5B 3TBLD 3IVFA 4MEMA 3SU8X 2JP1A 1SLJA 3Q3MC 3ZQ4A 4JV5L 2SNSA 5T1GA 1WZ0A 2UXDL 2J0KA 4C3IG 4LDTD 1L1OA 1PRTD 5GAGC 3MFYA 2JSVX 3U2SC 1AW7A 4ICVA 3OWEB 4C3JG 4MGIE 2PW5A 5E6PA 1CZWA 3NBHB 3KFUA 1WJUA 4OZCA 4I6NB 3QIJA 1HQRD 1GJXA 4JBWA 5CV6A 3HG9A 4JCVE 2FE8A 1HZAA 2TSSA 1K9MC 1WI0A 1LABA 1ZYRC 3DWQA 1WXVA 4YCWA 2Q8RE 4EZLA 1YD8U 4W9KA 2HQEA 1ENCA 4HROA 4J3OD 4DHZE 3A74A 2UXCQ 2Y5BB 1I4GA 1RCVD 4ARIA 3SR6A 3A56A 4J1MA 1HA6A 3W5VB 1JQ4A 2HIVA 4C3HB 3I3CA 4NPSA 5D94A 4A3OA 4YTMB 2PLPA 4A3CH 2BH2A 2KD0A 2MGSA 4DV3Q 1F2LA 3NHHA 3RR5A 4MHEA 5IAAC 4HPLB 1E24A 1I3QH 1UGJA 1MG4A 1J8IA 2BS4B 3TEWA 4I65A 5FK9C 4LFCQ 4OO1H 1JB3A 3VA7A 1OO9B 4RCNA 2QMTA 2AHOB 1CA5A 2JY6A 4GSWA 5L95C 1WGRA 3ETRA 4FHJA 5E6OA 1SIFA 3EQLC 4IWOA 1MD2D 2EPBA 2EY5A 5KHQA 1VQBA 1DGSA 1K53A 1K83H 2PCFB 4F8MA 4HPMB 1F2ZA 5C3WA 2FJ2A 1SNQA 1HNZQ 2XNAC 3N30A 1WTVA 3I63C 3QG1A 5A2QE 3W5OA 3W1BA 5J39A 3IAYA 1XCTL 2WXGA 3GE8C 1NVID 2BQQA 4F7ZA 2RVLA 2WXMA 2PNRC 4DV3L 2PW9A 5C2TB 2K1BA 3M4PA 1RLFA 1RRBA 3HUIA 1G6ZA 3C19A 1YMHE 1UELA 1WXSA 4WQMA 1BUVT 4AJYB 2KJRA 2K6DB 2E2DC 2RCNA 1RKNA 3FP9A 1KOTA 2KENA 3CCEA 5LXHA 2ZM6Q 4IWQA 1V9PA 5I4DA 5JJZA 1TIID 2KBNA 2YYZA 2KWVB 1CSQA 1AWDA 3TEHB 2TMPA 4JPBW 3J7YW 1PH1A 1WSPA 3PZ7A 4EZKA 3MXUA 1TWGB 1HNZL 3EUB2 4D2KA 3OWFA 2N9EB 3J7AF 1KC8C 4HVBA 1SNCA 1PH6A 1VJKA 3J7A5 1RF2D 2PQEA 4DXGA 2WXKA 5LL6X 2J4XA 1E7PB 1I35A 2K5WA 1EY4A 1C9OA 4LF8Q 3SXHA 2IW3A 5FOBB 2ATWA 1IYVA 2DZJA 1OXUA 3AE3B 1DM0B 4N9TA 4RAUC 2WGSA 2I5MX 4KN7C 2WDRB 1I4PA 3L3OC 1HZ6A 3L7ZC 4GU2A 1EYAA 2EIFA 4MNOA 1XCQL 3S9WA 1GAQB 2KK8A 1V2YA 4WRDA 1G6PA 3IFDA 1XNRL 2PPHA 3RCZA 4ANVA 4GKJL 2AWOA 3PV0A 2NN6H 3WA0A 1MJEA 1FR3A 1XD3B 3J80i 1DD2A 1ZGUB 1OQQA 4MJSB 3M63B 1WMHB 4YSZB 4DHJD 2WDTB 2LVOA 3CU7A 1ZDVA 5IOIA 1X32A 3V6EB 4KGRA 3WAMA 4IM2A 2QEJC 3QARA 3CPWA 2ZZPB 4MACA 3VR4A 1ZYRD 3J80L 2B2WA 5I2XA 2EYPA 4YWGG 1UWMA 2K25A 1VF7A 3CSFA 3UI3A 3Q3OC 1OEYA 4JI4L 2WB1G 3K5OA 3P4SB 3AN1A 1WCMH 4ODGA 3HFZB 5IOCA 4DHJB 4TKNA 2QGQA 5IGEA 3KYCD 4A3DB 1K3BC 3GTLB 5BMGA 1OXVA 3N32A 4GDKA 3RMKC 1KNEA 1WIAA 2L83A 2OTJA 2A69D 1C9FA 3CCSA 3LGJA 3STBD 2WFWA 4ITKA 1Y1WH 3S1QB 1WTHA 4J8QA 2RR9A 2PPBC 3HRZC 1BCPD 3H15A 3P4QB 2NZOA 3NUHB 4HRSA 2O6VB 3G7LA 2OTLA 3PGZA 4P16A 4RH6A 3DEOA 1VQCA 3P1HA 3S1RB 2EZVA 1D6EC 4BS9A 4YWMA 1WXAA 4LLGM 5AUKA 3RYTA 1B3QA 1C7YA 5M5YH 4LF9Q 3PIP3 3L0OA 4XQJA 4WWMA 1C4PA 1N60A 2E3TA 3VR9B 2N49A 4V190 1Q1OA 4A3JH 4R4TA 1IYUA 4C2MB 1M1KC 2LRWA 1E1OA 3JC66 1UWVA 4C1NK 1K52A 4OW0A 2KDFB 2CCZA 1GUGA 1Y8NB 1XNRQ 2V1YA 3BDLA 2DAFA 2L8JA 3OOCA 4L2YA 1BBXC 2L32A 1JJCB 4B3SL 1KXLA 4P6VF 3X23A 1O78A 3NG0A 1Q7YC 1X3PA 2OJWA 5CV4A 4DR4Q 3MJ5A 1PZID 1LLRD 4KJOA 3TZUA 3T51B 1RM6C 1SYEA 1I94L 4C7YA 1S1QB 4P7IA 3UI2A 2WWZA 3VQIA 3QX1A 2NVYH 5T8IA 2V1CC 4HDQA 1X3QA 4A93H 1A70A 1DOLA 1MHXA 2NBFA 2MBHA 5COYA 1KQSA 4IN3A 4OXPA 1YN5A 2BWFA 2FINB 1HQMC 2A68D 2HHHQ 4A3IB 1X56A 1TBEA 2CJNA 2DZKA 4IUMB 5BN5A 1P7EA 1MPEA 1MSHA 1NE3A 3DPDA 2L0FA 1XQQA 1XO3A 5I9OA 3URYA 5EGTA 5HG2A 2IBIB 4FLHA 4EE2A 5CV8A 2KHIA 2LWPA 2AMCB 2R93G 4B3TL 4FADA 3TS0A 3QJYA 4JI0Q 4XDXA 1JWBD 4FF2A 2JA5G 1SNOA 2WACA 3B2FA 1HZ9A 4YHHQ 3PPAA 1EY9A 2MHJA 3J9CA 1K8AC 4KHZA 1FNVA 3CCQA 1YJ1A 2HHHL 1HPCA 1GUSA 4BA1I 1CUKA 4B9XA 5D65A 1TT5B 1E2WA 4IPDA 5IGBA 3V6CB 4DV5L 3OLMD 3MHSD 1KRHA 4JWSC 3WANA 4N6EB 3S24A 2HDMA 2M4NA 2N78A 3G4SA 3X3MA 4A3JB 1R4MI 3OG5A 5AEKB 2H5XA 4X64L 3HRDD 1P7FA 1D4BA 2RDBC 4HIKA 2FHTA 4PK1A 1EQQA 1HNXL 4W9CA 4OVVA 2KECA 1B7YB 4Q2JA 1VF5C 2ZJPA 1QOAA 1FFUA 1UEBA 3PZDA 1LYLA 1NTGA 4DV0Q 4LF6Q 4DR3Q 3S2AA 2Z6KA 4JI6L 2R7ZB 3AULA 3NENA 1X3EA 3ZTDA 2A5UA 1KL9A 4WAAA 2ZCBA 2G4SA 4MM3A 2UUCL 1RTOA 2F0HA 3BYYB 2J7QB 1S5CD 5IGGA 1GO3E 4KHVA 1WWTA 3J81c 1PRTC 5IWAL 5C4XG 3AI5A 1OTCA 2N9PC 5ISRA 5CORA 4R8NA 3QIAA 2L1AA 4YSYB 4IKGA 3AEBB 3K9PB 1T0YA 4A93G 1D5ZC 2MEKA 2Z6BA 1OGWA 4X62Q 3A5ZB 2BB5A 4DR2L 2UUAQ 2M9VA 2YEPF 3AE2B 3ZJUA 1SE8A 3LWEA 5I6YA 2UXBL 1IBML 1ROEA 5LMUQ 1IBLQ 4DV2L 4WWOA 1E10A 2G9DA 3UDIA 4JC0A 2JA6G 2RBMA 3S2DB 4HJGE 5LNK1 1G51A 3Q8BA 4A3GH 2QC8A 4NJCA 1L4ZB 1AYFA 2DX5B 5J18A 2L55A 1IKMA 1ACCA 2E5LQ 4UP9A 2JWZA 1Y1VB 2LXCA 2JF5A 3TMPB 2K32A 4CYEA 5ELBA 1U4LA 3D4WA 1U4MA 5J3BA 2NN6I 2GLSA 2XTIA 4O0AA 2VQFL 2JA7B 1CQFA 3M9BA 3HP3A 4DF7A 3TDQA 2B2UC 1U4PA 4IUVA 3RUZA 4XIGS 3W2DA 4A3KG 2EJMA 1VQEA 1N34L 3UDXA 4CDCC 3H8HA 2VW9A 1HTOA 1HZBA 1V6EA 1FM0D 2EYMA 1NUCA 2N7DA 4DFAA 5FO7B 4O1NA 1WTQA 2GN5A 2Q2TA 3T8MA 2EKIA 2IY5B 3JSVA 1EOVA 4GN1A 3WALA 1IGDA 2WXJA 1E7ZA 4HPPA 4Y52H 4L23A 3HOVG 4FF4A 1BQQT 1Z5SB 4UP8A 1GB4A 5JZEB 4B3RQ 5C4JB 5JEAH 2NR2A 2O5JC 3S2HB 2M2LA 4DN4M 4GN5A 5LMNL 4DV6L 4EUTA 2DUDA 2Q2HA 2E2HH 3MEHA 3VR8B 1X9NA 3AEEB 1F1HA 2HE7A 4GOCA 3KYDD 3KBGA 1TWHH 4IM3A 2ZJDA 2I1KA 1SNPA 1IBKQ 4AH6A 2QW7A 4I7AA 5EAYA 3RT3B 1VQIA 4MJSA 3DWPA 4JOIC 2PVOD 1D5XC 4B3TQ 1VQHA 2REXA 1MBYA 2I0QA 4GLSC 4MGZE 1CZGA 1JE5A 1TS4A 5FLXc 4DK5A 2NZHA 3GQBA 4U673 1Q1BA 4ARCA 3MZ5A 2F03A 1JOKA 4GOPC 1LTBD 4PYZA 3Q3FA 3GS2A 4DNTB 1MI0A 1KLVA 3H9DA 2WYQA 3V61A 1B9RA 4IUPA 1F9JA 2YU9H 3ULJA 2UU9Q 4LK0M 4BKSA 1VQNA 3VTUA 1X65A 1PTOH 2EJGC 2B2UA 3K7UC 3S1MH 1TJEA 4PZ6A 4B0MA 3RN5A 2XVSA 4X64Q 4CHKA 3SE0A 4B0EA 5CBAE 2JA7H 2R93B 2QILA 2Q8IB 2LGYA 4F8CB 3MXNA 1BXTA 3I91A 4L8JA 4YWKA 1E1TA 5BYRA 2KHSA 1A6XA 1CKNA 3W5UB 3VH3B 5JXVA 1TKYA 1GUWA 4XGAB 3F8TA 1SIJA 1JWMD 2PJHA 1JORA 3IT6B 3N1XC 2EE1A 1YNND 1MJCA 1EWIA 3H1UA 4WJPA 2EYJA 5IWAQ 3K5NA 5C4HA 2IY0B 3A1QA 3Q8EA 1PYBA 2MJ8A 4JL9A 4A75A 3V62A 1Q46A 4DNRB 1DOXA 3IAM1 3P2BA 4DV7Q 1QOGA 1Q8KA 1XXGA 2B63G 1XMOQ 3JAMi 3S16H 1VR9A 3B1LX 5BMHA 1XWEA 1L2NA 5AUIA 3VHTC 4RM8A 2NPTB 3U4EG 4XWTA 2HD3A 1Y8PB 2RSUA 1TWHB 3CKIB 4JI7L 1HNWL 2K5DA 1SMXA 2QDFA 4WJQA 2C7MB 3H7PB 3QA8A 1VQDA 1F2MA 2DY8A 1WZ3A 4TUUA 1B2TA 1A15A 2WKDA 2WS3B 2BBCA 3PUXA 3BDOA 4LF9L 2K5NA 4PMBA 1JE4A 4AYBG 3S16B 4IALA 3L16A 1WM2A 4LF7L 2VS1A 2I1JA 1B9MA 2BYFA 4WIPA 2L15A 4DR5Q 1NCVA 2NZ1D 1FRDA 3NQIA 1E9MA 2O2LD 2M1MA 3VA5A 2CKZB 2VB3X 3D3RA 1Z47A 4KI0A 3H0GB 4DKAC 1N6ZA 2WX1A 5M3FB 3TP6A 1J5EL 1JRPA 1NBWA 1V8QA 2KWDA 3H6NA 3P4RB 2PE6B 4JGHB 3KH0A 5E4XA 2EYLA 2EELA 2J0MA 3L54A 1K73C 3A9KA 3EFCA 4LF5Q 3AB5A 1T3QA 2JA6H 2UXCL 1SMYC 3BDCA 2RGFA 3X0WA 2B2TC 5E7NA 2DHZA 1E8ZA 3Q0AA 3C0RB 4HCEA 2QSDA 4M00A 2F4VL 3U7DA 2BA1A 2F0IA 4OEMB 1N5WA 2Z0DB 3AEFB 4JPSA 3IRBA 2WIIB 2JZPA 3ER0A 1WGDA 2NPTA 1XPRA 4J15A 5AZFA 3EFUA 4I6LB 1TY0A 3PS6A 4A76A 4A3KB 1QWYA 3L9AX 4KHPL 2BWES 3NTIA 2GBNA 5G5HA 3FILA 1V43A 3T1HQ 3RZOH 2M00A 3C8YA 4JVZA 3HOXG 1FO4A 2IL8A 4LFBQ 1J5EQ 1BDOA 4QAYA 4KZ0A 2OF1A 3LNNA 1PH3A 1QJOA 3DVGY 3NZSA 2G9HD 1QOFA 5EE9A 1FD6A 2NYZD 3I7FA 4HIOA 4L1BA 3HOWB 2GBJA 1X55A 3T16A 2I46A 3ZJTA 1HHVA 3OHXC 1KNAA 4DNIA 2Y3AA 3SK6A 1GNUA 1K83B 1ZE3D 4QMGA 3DWAA 5EJWA 2QEXA 3I90A 4JV5Q 4LJPB 4YTNB 2HJ8A 3E56A 4OVZA 1ET6A 3M95A 3UF8A 2MP2A 2DY7A 4GDLA 5HI1A 3PVLA 2I38A 1E2ZA 5M3MB 4Y7NB 2DZMA 3VUWA 5C5MA 4KY6A 4JBJA 1NSNS 4NP5A 4JI8L 3X3NA 1SSOA 3NOBA 3GTJB 3M4OH 4J6IA 3H09A 4KHPQ 3TP8A 3RZDH 1BOSA 2BGFA 1VS0A 5FLMH 1FL0A 1PV4A 3SR1A 3APCA 4MGKE 3ZRFA 3KWVA 1O7YA 2DJGC 2OT2A 5AZGA 1OQYA 5FJ8H 1ZPSA 5C44G 4K2LA 1JCKB 1U4RA 4DAVA 2ES2A 2RPQA 3PLUA 3TEXA 4OIJA 1F9SA 2KA7A 1H9SB 2D5DA 3FKYA 4RG1A 1ESFA 1HA5A 3M7GA 3N1ZC 3NS8A 1BBUA 3K58A 1EF5A 1XMOL 1NYRA 3N20C 4W9FA 2VZKD 1F9QA 1G2SA 2NTTA 1D7QA 1QE6A 1GUAB 1EQTA 1QVFA 5K5PA 1PTOD 3CMAA 4PG3A 1IBLL 4IDIA 4IC7B 1QG7A 4QIWB 3RZOB 4JI1Q 2KJXA 3WAOA 1NENB 2IPKD 4BY7B 5EPJA 4ZRIA 2EKEC 3VR2A 4BOZB 5EE1A 1O7ZA 3JSVB 2NS5A 1EOTA 4ANWA 3Q23A 3RN2A 1I50H 4GKKQ 3O13A 3DQVA 2L7RA 3UQAA 4X65L 3QHTA 3E3XA 4DUZL 4JI3L 3MXNB 1M8AA 4NY0A 1TT2A 2N1WA 3F2UA 1V49A 4TKOB 1WX8A 5L37A 2G1EA 1TS2A 4BAXA 1IYJB 3NVZA 3LWUA 4KX6B 3E9SA 5J22A 2SDFA 3ZUNA 1L1OB 3CF5A 4NDXA 5JVH3 2L05A 2K50A 1Y1VG 1UE5A 2CHBD 1EU4A 2WKCA 2ICEC 4KKTA 1JC7A 3A4SC 1TWFH 4KSLC 1XLOA 2J53A 4MGYE 4YXDB 1BR9A 3KUZA 5EQ0A 3GTGH 4AYBB 1O7IA 1YHBA 2DNEA 5I2YA 2IO0B 3W1GA 2LI5A 3S2HH 1WTRA 2E74C 3RMHA 1C1YB 3KLSX 1GXDC 3AE8B 3HOUG 2M17A 1H9KA 2KFKA 3N52A 2LHDA 1Q8IA 4IWPA 4EVOA 2CJOA 1LV9A 3WWVA 2WAQB 3T1YQ 2JU6X 2N7JA 5G2NA 1UE6A 2K39A 5CMDA 4AS1A 5ELEA 2DAJA 1HZCA 1WVLA 5DCNA 1PYSB 2PZTA 4KD3A 4C56C 1KLGD 2YLMA 2KHJA 4ZHOA 3RNUA 2AWTA 3HEJA 4QGUA 3DHHC 5CHVC 3UIPB 2HD5B 2OQKA 1JROA 4M0WB 2C7HA 4XT1B 1HTPA 4N9PA 3DBRB 3HIZA 1TWAH 4KKSA 4ANUA 1AH9A 1Q10A 1MG8A 1VQ9A 2UUBQ 4NKLA 4P1BC 3SDZA 2MFIA 2CQOA 2WU5B 1SR3A 3QC8B 1RL2A 4RGOS 4K14A 4MTKA 3HOYB 1PVOA 2J42A 4KDLB 4TQ0A 4DR1Q 2BA0A 4HEDA 1EL0A 1JWAD 1PFDA 3M3JA 2IGHA 4E3CA 2QCPX 3GB1A 1N9WA 2EVBA 1YHQA 3Q22A 1N36Q 2RHQB 5LHY1 4BZAA 3PRMB 1ASYA 2HUGA 2XK5B 4KK7A 5JH5C 1P1AA 4DDID 5CC4A 4B08A 2F0GA 4JI8Q 1XMQQ 2Q2UA 4EFOA 3A7LA 2BE5D 3J81j 2G3QB 4JI7Q 1HNWQ 1G2TA 1WRDB 1I6HH 1KFYB 5EKIA 3DVNV 5L83A 1H9RA 1S5BD 2IZVB 2D0OA 2KYWA 3GTKH 1YNNC 3AEDB 4L5SA 4WJOA 1S40A 3D6CA 1WX7A 2NBVB 2JUOA 4H02A 1XX8A 2IWHA 3IFTA 3T56B 3PIOA 4EQOA 4C3JB 3GTGB 4X6AH 1AEXA 4X66Q 1JJ2A 1C76A 3TBIB 3PO2G 1E8WA 3AEGB 4W9DA 1N33Q 3RZWC 3CMEA 4EOYA 1VQFA 3EROA 3FILB 4K1RB 4A3DH 1JMCA 1H9MA 4BBNF 3PTFC 2E75C 3AEAB 2F0FA 2Z8LA 1SDFA 5D3DA 5GMVA 1H4RA 2KCCA 1YQBA 2JT4B 1M90C 1CA6A 1L1OC 4AWJA 4ICUA 1CJEA 4HTHA 1P8LA 1YOVB 2B3AA 5BMIA 2K05A 1I5FA 5DNFA 3SVMA 4N9F4 1FIQA 4FJYA 5J17A 3HVDA 2V4LA 3RULA 1IBXA 1JW9D 1IUEA 3NK9A 2LVPA 1YNTE 2IHEA 3I57A 4BKTA 5M5WH 4K8IA 3ZJYC 4LUOA 4ZYSA 1TWAB 2NBWB 1NMFA 1N8RC 1H8CA 3LB8C 4DR6Q 1ICWA 3N6RA 2IO2B 2XN9C 4TV3A 1HRJA 1WRIA 3AH7A 2K6QA 2FIFA 1GJZA 4Z9CB 1TKEA 1EIHA 3PZ8A 3FKIB 5H92C 5DPWA 1VZ8A 1HR0W 3CC7A 1MHWC 2UYZB 3O65B 4GNXA 3HK0A 4FDBA 3SK8A 1EWHA 1PH9A 2FMMA 3J80c 3L13A 3CCUA 1PH4A 3H3VI 2C35B 3E9HA 4A3EH 4LNOA 3W1SA 5IYBH 3HOVH 1UEAB 3I4OA 2LMCA 4PT5A 4CKEA 2JWUA 2ZNVB 3QQ8B 3DVGX 2HTHA 1SMYD 2QDBA 4URKA 3PUWA 1B8AA 4IOIE 1I50B 3K7AB 1FVIA 1I6HB 3P4PB 2CH4W 3KJPA 2YV5A 2LSSA 3PUZA 1B50A 4RM9A 2O2VA 3ZTCA 3AE6B 1LQBA 4A3KH 3EGRA 4M8NA 4LMQD 5C44B 2RSNA 2LFNA 1EQRA 4BBSG 2WP8J 1B4OA 3HKZB 1Z2MA 2KCMA 3Q24A 1J19A 2MJEA 4ZCKA 5EE0A 1A62A 5GROA 1SFOB 1ENFA 4E74A 1MHHE 3ZVVA 3KUDB 2DGYA 4OX9Q 4RF0A 2RCFA 3KLRA 3ERSX 1NAPA 3V3XA 1Y8RC 5EDSA 2LXAA 1AE2A 4QCLA 3T3OA 3FMCA 4CJ1B 5EPKA 2BS2B 4KN4C 3F2DA 3AE5B 3UQBA 1SBBB 1Z9FA 4MT5A 4USAA 2ZTDA 3CCLA 2ZTCA 1OQRA 2NVUI 4JI6Q 1SE4A 1ZKOA 4YY3Q 5IP4D 3KF8B 1UE1A 2V4DA 3P63A 2R7DA 2C5LC 1EM7A 2BB6A 2QJLA 3QWZB 4ME5A 2F52A 3RD4A 4NAWB 4HJKA 3QR8A 3BG3A 4R4OA 3VR5A 3C3LA 5JPMC 3CP0A 3HOZH 4DV6Q 1GC6A 2YTVA 3SK5A 1ZUD2 1STYA 2N55A 4A3IH 2RPVA 1K3RA 5CV7A 4DR7L 1PUTA 2CHWA 5IE8A 4C1NI 1EU3A 1AN8A 2F4IA 1F2RI 5GXGB 5A2QL 4JLCA 3AMUA 1DXMA 3OJ3A 3NZUA 1J9OA 2PW7A 4P2CB 5EBCA 1L0YB 2F1MA 3IFWB 3QOLA 2IX1A 1PLFA 5EBDA 2MPMA 3OIPA 2KX3A 3I8ZA 2IX0A 1PFSA 1VQGA 3VYUA 3K7AH 4DV4L 2JA8H 1MGSA 3RNFC 2ZJQA 3KQ4A 2ALYB 3ZGZA 4PMWA 1Z6HA 2B2WC 5BR8Q 3HOXH 2JRIB 3ND8A 3APDA 4GOPB 3QK0A 4N8FA 2Z59B 1WJ4A 1ET9A 3SFEB 4DDGD 3F2CA 3I4MB 3HOUB 2KXJA 2ZXOA 1PH8A 4G11A 2IYDB 1F77A 3JAML 5EE3A 2KACA 2ACZB 4JQWC 1G91A 4DWFA 3PO0A 2KEDA 4K0KL 2KQ4X 1FGUA 3EECA 3P7JA 2EY1A 4XE0A 2RDFA 3TN2A 5C3XA 2W3RA 3VAWA 1VMPA 4HIDA 4BY1B 1FD7D 5DPTA 4B9KA 4DV4Q 4IZ8A 3PO3H 4BBNC 4ZUIA 4LNKA 2L4NA 1IYFA 4Q5VA 4ALPA 1AFPA 1XJVA 4EQ5A 1DYQA 1WF9A 2N4FA 1C78A 2V3NA 2VRRB 2WXOA 1VQPA 4DR5L 2VH1A 1AP0A 1RHPA 4DHZB 2B76B 1C4AA 2CVRA 3CF6E 4BVUC 1YNJD 4BY7G 2D2QA 3MC0B 2KDIA 5LMNQ 3GTPB 2F0DA 2GBMA 3AECB 1GUOA 1RFKA 1A2TA 1V1OA 1K8MA 5IODA 5FR6A 4B6WA 4A3PA 3NBIA 2WXLA 3ZNZB 3J80E 2RKSA 1VCIA 4HXDA 4ZRKA 2JX5A 1FEHA 3IL8A 2MLBA 2OXPA 3PV1A 4ZHPA 3OSOA 4CJ0B 1H95A 3GTJH 1TXYA 1MI2A 3AQQA 2R7ZH 3M4OB 3SDLC 1SF0A 1UBQA 1VQ8A 4WFN3 2F4VQ 2SAKA 3GV6A 4DPGA 1LXDA 1VLBA 4IJLA 1XPOA 5E4WC 4QUFA 3NY5A 4BBRG 1KDCA 5G3LD 2C7NB 3L17A 1CKOA 3ONAB 1QZHA 5JJKA 1STEA 1YJNA 3K0YA 2KN4A 3SGIA 2R3ZA 2K01A 4X62L 2JA5B 1YJ9A 4KD4A 5BN3A 1JRUA 2VNUD 1EY7A 1B1ZA 3UIOB 2JEBI 3CRLC 4K7UA 1I4QA 3SHQA 4LNFA 2RD0A 2NVXB 4R9WA 2KDMA 2F0VA 1F2RC 1T6BX 1CQVA 4OONA 4JYAQ 1VD2A 2KANA 2C9OA 1VRAB 3JW0X 5D2MB 1I94Q 1ZW7A 5HY6A 2KMAA 4G7ZC 3RNGC 2CWAA 2RMMA 1AZQA 5JHBA 1IW7C 5KIXA 4DUZQ 2LY7A 4A3EG 2LD9A 2LGSA 2WHIA 1Y1VH 5ELNA 4A3IG 3K80C 3U58A 1FJGQ 4BWGB 4CGYB 1KJTA 2HCCA 3R66C 4DBGA 1V1PB 1JJGA 4IQZA 1P0RA 1Q5WB 4NAMA 5TR5A 3T1YL 4BXXG 3FKIG 2BE5C 5JJLA 2LRUA 1HFNA 1SJHD 5CV9A 1Y8OB 5I9PA 1WFQA 3M3YB 2RDHA 4H13C 1TWCB 2D11A 4W9EA 1N32Q 2FCQA 2LGXA 3QO2A 3H7SA 1DJRD 2O4XA 4CKCA 3CQZB 3AEVA 4TMAB 4DR6L 4CDDC 3CCVA 5JVG3 4JYAL 2D62A 2L0TA 3DMUA 4HK2A 2JSOA 1CHQD 1E7UA 4FXCA 2KEEA 1WYWB 3E6ZX 1GUTA 5DM63 4L5TA 1T0QC 2Y0SG 4PS3A 2G4DB 4C4VA 2B2YC 4H44C 2JEAI 2CKHB 2D3BA 3EVQA 4A3JG 4BXXH 2EYFA 1J6QA 1LT3D 1VQAA 1WCMB 2QF7A 4BBSB 1T5EA 4IPHA 4WWNA 4LNIA 3RUIB 2AQ1B 2VUMB 3H91A 4CKBA 1QOHA 3OPOA 2W9NA 2Z9HA 2NVQB 4ZOHC 3ZO5B 4HJ7A 1DZ1A 1E0BA 2EDGA 5M5YB 2L0CA 1D2BA 5M5XB 4FBJB 5FJ8G 3MJWA 4HCPB 1N5XA 1FRRA 1STNA 3HOYG 4RA8A 4TQUS 3RZDB 3S1QH 4B3ML 2KC1A 1D5MC 2UUCQ 2K5PA 4GDKB 3N1YC 3G71A 1K8GA 1M4VA 5IP7H 1MVKA 3NP8A 5FKAC 3OW2A 2F0EA 1FXTB 1QUQB 1GB1A 3FPUB 2EMTA 4NW2A 1FMAD 2D3AA 4E71A 3HZXA 3TSSA 1S72A 1OXTA 4IJHA
chains in the Genus database with same CATH topology
3I4NB 1L6UA 3AE4B 2A74C 1FFVA 1PDQA 1I4RA 4XDDA 4ZQ3A 2JA6B 3SFDB 3TEYA 1Q1EA 4DK1A 2BDNA 1VDVA 1JWSD 2IJ0A 2WXIA 2R6GA 3KUPA 1YJIA 1CHPD 1B9NA 4RFBA 2L9HA 3BS1A 1SE3A 2PZUA 3N9YC 3MXGA 2K9XA 5E6JA 1FXAA 1Q90A 2ZW0A 1CM9A 1W6KA 2GI9A 3D6WA 2KVMA 3LXFA 1SYDA 4KV6A 1SYBA 4JE3B 3TMEA 1ILQA 2ZW1A 1PGXA 4BBRB 3MAQA 3AB9A 3OW7A 3LX0A 1I3QB 1EZ6A 2F0UA 4FF1A 3AV8A 3D8GA 3ZYYX 4A3MB 1SXTA 2M0AA 1J7AA 1PTOC 2X6LA 2WXNA 1CFMA 2VXWA 2FUG1 1R9TB 2XWJB 1EY5A 5CGKA 5NUCA 1LTSD 4HMIA 3L4PA 1ILPA 2PYKA 1EEFD 5KGUA 5MPOA 1KLUD 4A3EB 1PDXA 4XXEA 4Q0FA 4HSPA 1WTWA 3R2IA 2OHFA 3SHLA 1S5DD 2LUMA 3A55A 3NPPA 4N58A 5FO9B 4AQ7A 3NVYA 4IURA 4N59A 2ON8A 3EA6A 5D7GA 3BVGA 3P1MA 1DOIA 1ESRA 2F0JA 2F0SA 4YTMB 4FF3A 2CW0C 3MHBA 5JPNC 3KWLA 4X3TA 3NTKA 2WXQA 3SK4A 5BYSA 5ELDA 2V4IB 3A8KE 2FFKB 3BYTB 1BCPF 2D9UA 4LJZC 2BT6A 2BW2A 2MJDA 2F0WA 1GOZA 2F0PA 1A2UA 2E6XA 2FBWB 1QNKA 2IGDA 4KY7A 3KLSA 1EIGA 5JEAJ 3G6JB 1EY6A 1SNMA 2K7VA 1K8OA 1LTAD 1HTLD 1O7LA 1YN4A 4WJWA 5G5GA 3V96A 2B2YA 4WAFA 2L12A 5H8YE 5C3JB 1CK1A 5DAUA 2M19A 1L4DB 2K04A 4RGTA 3FC4A 1WYGA 2WP9B 3S14B 1Z7TA 2C5CA 1FCCC 1PGBA 2QKIC 2INNE 3MXPA 1STBA 1WTPA 3Q8FA 4OO1G 3BVZA 4KTAA 2LGIA 4PQXA 2CQAA 1QKZA 4IUQA 1ENAA 3IKJA 2PIAA 2V3PA 4OO1I 1RYJA 2F0TA 2JYEA 3HS0C 2WLBA 2Z4IA 3TP5A 4PV1C 3K5MA 4PMCA 2LS01 3MA2B 2A5HA 2YU9B 4ID6A 5LL6S 3W9CB 1HUMA 1Y69U 1HZ5A 2HCIA 1TWFB 4I7ZC 3NVWA 4ZAIA 4GDLB 4ZRPA 2LJIA 5JOBA 1FNUA 1CZPA 1YN3A 3D4DA 3GTOB 3NUCA 2OEDA 2MH7A 1XLPA 1C8CA 5EKLA 4C3HG 2J52A 1I4HA 3R3OA 1JMLA 2F0MA 3QWNA 4V0BA 5IIFA 1XF5L 3FEWX 2EY2A 2SOBA 2JA8B 1TS5A 1VZ6A 4JX1C 2BDOA 1OFFA 4IFDH 2AUJD 4H0LC 1EQVA 1TR5A 2PKOA 1VZ7A 2B2VA 1WXQA 4NMZA 4G7HC 2WXRA 1BMLC 4HMJA 2N9LA 4ZK9B 1UAPA 5IT9E 2ONQA 1PFMA 5KRUA 4BA2I 4L6TB 2R92B 5C6AA 4CJ2C 4HCSA 5KNDA 4RGNA 4IUNA 1ZXHA 1NR4A 4C7ZA 4RGMA 4K2KA 3WDNA 3A54A 3FAHA 2XIWA 4K6DA 4MM3B 1R4PB 2SNMA 3R2TA 5ELCA 4RKBA 2H89B 3OMGA 1C77A 2LEKA 2NVTB 4CQNA 3CRKC 1PFNA 2N0SB 3DEPA 2E2JB 5C0XJ 2PVGC 1STHA 1JWUD 4FXKC 2NTSA 4DA2A 1DONA 4XYOA 1B44D 3DXJC 4U68A 5D3IB 1KH0A 3RLFA 3P42A 1RDPD 1NI3A 2RDGA 4UDUC 2A6HD 3C1FA 1RODA 1V8CA 2D5GA 1LT5D 1KABA 4KGTA 4A90A 4ULLA 3IT4B 4NZLB 3NSWA 2H1EA 4EGVA 2OEOA 2XRSD 2AQ2B 2WDVB 1HFGA 5M5WB 3TP7A 2AUKA 4MIUA 4IFDG 1C48A 2GB1A 3BK1A 3ND9A 1QILA 1KAAA 4YSXB 1RWSA 3WCQA 1TY2A 1CT1D 3D31A 4DXFA 3H6MA 2WXPA 3W3AA 3VRAB 4C3IB 3MWYW 3PO2B 3AU7A 1ZOYB 4X3UA 2K28A 4KKUA 5BN4A 5KNBA 2WINB 1LO5D 4G4KA 2L5TA 3NVVA 4DQOC 3S17B 4FVMA 1EY0A 2YEPB 3S1NB 1DCZA 4E6IA 1STAA 3AM9A 1SYGA 3BK2A 2RSOA 3H3VC 1JR0D 1HXYD 2ID0A 5KEEA 4WORA 2DLBA 1G291 1S4ZA 2PMVA 3VRBB 5K36H 2WNMA 3K59A 2LHEA 1S5FD 1LT4D 2EOTA 2A6HC 3GO5A 2F0KA 3T3NA 3J7AV 1OXSC 3HGBA 1GPXA 2RA4A 1JICA 2I2YA 4S3SA 1TZOA 4US8A 2R61A 3V2TA 5CV5A 1E2VA 2WQYB 2HDLA 1PFBA 1BO0A 1B53A 4ILWA 2DN8A 4K5VA 1G8ZD 1L5PA 3C46A 2F0QA 4KKJA 3TEZA 1F2YA 3VYRA 5C4XB 3RPFC 3C2PA 5DM73 3D4RA 4TSSA 3I73A 1IGCA 4LAAA 4HR7B 4FYDA 1PGAA 2PZWA 2A6EC 1XLNA 1EY8A 3BVMA 1D1IA 3T13A 4EQNA 1K51A 1TS3A 1EEID 2FMCA 3U52E 2ZXRA 3GD7A 4M1UB 2WB1B 1PRTF 3GTKB 4LTUA 3DWGC 2ZT9C 3C1EA 2F0LA 3GTMB 2B2TA 1KF6B 2EY6A 1XEEA 4HN7A 3J81E 4K6LA 3R93A 3KBXA 5IT9L 1CTMA 4KJNA 1RTNA 4G7OC 3V05A 3HOVB 3BWUD 3WOFA 2ENBA 1V1PA 3LYYA 3TZDA 4DAPA 1J7CA 2LKVA 3U9OA 2RQXA 3M7NA 3I4LA 4ZRZA 3NXWA 1WTXA 2E2HB 3MFGA 1D1KA 2O5IC 1IHZA 1VMCA 3U9SA 2BCOA 2KCNA 4IFDI 1QLBB 3U7ZA 4REZA 3K6OA 1LTID 1YJJA 2NUCA 4XT3B 1I7HA 1N61A 1AZPA 2L1BA 1C4QA 4G57A 4HAEA 3DM1A 2DYOA 4YIJA 1UUPA 4QB4A 2A6ED 2W55A 4RNAA 1DOYA 2LMCB 1VDZA 2KMMA 2F0NA 1L6VA 3CHBD 2SEBD 2W3SA 1JOOA 2Q5WD 1HEZE 5HURA 4K8JA 4JK1C 2PO4A 4LK1C 3BIID 3Q69A 2X69A 2B2VC 4FNFA 1DOMA 1H9SA 4CHTB 4F88A 2B63B 1LTGD 5FLXL 4IUTA 1FGBD 3GV3A 4DK0A 5A35A 3M4YA 1UWXA 2VB2X 2GA4B 1ZXIA 3I9V1 5F2DA 2ZXPA 1U9RA 1ZXTA 3HVZA 4XTCS 1GHKA 3B2GA 1TVXA 3EJIA 5C0XI 1ZDXA 3ZJVA 2WV6D 1ZEQX 1K50A 1GHJA 3WOEA 2K0PA 2N9KA 1EYCA 2IT1A 3VYSA 4XQNA 1S5ED 4A93B 1RJTA 2Y0SB 3OIQA 4OGQC 2WU2B 2J0TD 2J7ZA 2DYMA 4FXDA 5TSSA 5C0XG 1TU2B 4A3BB 3H94A 4RHRA 2W82A 2A69C 2XWBB 5JAVA 1T5XD 5C5LA 2W54A 2H88B 1WGKA 3IAS1 2JYTA 4RF1A 1MSGA 1SJED 1OXXK 1TQOA 3KK7A 2K33A 2KOLA 1DOKA 1EYDA 5AFWA 1YQ4B 4QUCA 2KQ3A 1L0VB 2M56B 4HEA1 4DGZA 3DUZA 5FO8B 4ZUJA 5CYUA 3I70A 1FYCA 1STGA 4KGSA 1Y56A 3ITPA 1CI3M 1SYFA 3QB3A 3AMZA 5HFYA 1WD1A 4OIKA 2CU3A 2WXHA 1PMRA 2NMQA 2WDQB 3NWSA 3VR6A 5HHDG 2PMZB 3AE1B 5FLXE 1DGJA 2INPE 1J7BA 3A8JE 3Q8CA 2BYTA 4X3KA 2JYOA 3AE7B 1W6JA 1F9RA 1TYGB 1Y1WB 3P20A 5D14A 3ERQA 2MUYA 4ABNA 1IBXB 2D2CC 1ML0D 3FVQA 1FNWA 2F3WA 2LFIA 2VZKB 1EZ8A 2NN6G 1Q12A 4DU9A 1I4XA 2EYOA 5C3EB 2XSCA 3QOJA 2GRIA 1TKGA 2N88A 4ZKCB 1YNJC 2DWQA 3B9JA 2IDYA 2Z4HA 5BYQA 3DHQA 2B8GA 5IGCA 1TKWB 5K36G 3A8IE 2MJ3A 4KY5A 1JQYD 5EKKA 1GUNA 3J81L 3PUYA 3K5LA 5EPLA 3ABVB 1BUIC 1SNDA 2KAJA 2Y5CA 1KTKA 3BZDB 1UNSA 2AQ3B 3P75A 2NWGA 2JE6I 4KMUC 3KF8A 3TUOA 5JEAG 2V0GA 2EYHA 4GZYC 1XYIA 3FPPA 3Q6SA 4M8AA 1XTCD 2AWNA 2BOSA 3PUVA 4A8XC 3FDTA 2PTLA 4O42A 3HOZB 1Q3LA 3I72A 1FXIA 1V97A 1KDAA 5G3LF 2X38A 3PMFA 2BTEA 4FO2A 5DEHA 2MHVA 1A3TA 4A55A 1PRTB 1BNZA 1SEBD 5CBEE 2WXFA 1JOQA 4ZKBB 4FXGC 3EFXD 4XDCA 4H2AA 4IUUA 3S1MB 1IW7D 1HCZA 1C4CA 4XQQA 1BCPB 4H7BA 1ZP0B 2K03A 4L63B 4HKZE 4TRDA 4XWWA 1II3A 3FRPB 2B8FA 4OHJA 1NEKB 3MTSA 4A3FB 5IGFA 1PXUA 1JALA 2Z1CA 3PIO3 1LT6D 4XYQA 2Y5PA 4RKLA 3E5SA 2L11A 2X6GA 4RWSC 3S15B 1XLQA 1QB5D 5E3FA 1SAPA 3SEBA 1F9PA 2AX5A 3HOXB 1I6VC 3NRZA 5E1FA 3K57A 1WD0A 4PNYA 1EWCA 5KNCA 4TQ1A 1SE2A 4K5XA 1NR2A 3T53B 3AE9B 4RCOA 5I6WA 1L0XB 4OL7A 1LACA 1QNUA 3NS1A 3NTHA 3VYTA 3IXSA 1IKLA 1QCBD 2NVYB 1B3AA 5CR3A 5FR3A 2ICIA 1C79A 1QQRA 4C80A 4MN3A 3M85A 3PO3B 3T4AC 5M9OA 5KYIA 1LTTD 1A3UA 3GTQB 1PTOF 5ELFA 3CIRB 3MVVA 2DBYA 2A73B 2Q8TA 4OZAA 4B9WA 4R3DA 1E6EB 2DNCA 2L52A 1PZJD 1R7SA 1RD9D 1FCLA 1A3VA 1R4QB 4YTPB 4KKIA 3E0JA 1BCPC 3OMCA 5T1IA 2IGGA 1ONLA 1SB3C 4J6HA 2F3VA 2JQRB 3A7AB 4YT0B 1SSNA 2B39A 4F7XA 1NYQA 4A3GB 3VR3A 4ZLTF 3MHZA 2IX3A 3Q8AA 2HTME 2H4OA 2MP1A 5C0XH 4HKQA 4JWUC 5IGDA 1BF4A 4QF4A 5C4ZA 4A9AA 2NB0A 1N63A 1SYCA 2K22A 1PYWD 2BS3B 4DAYA 1QT9A 4WH4A 1F0ZA 1KDBA 4WURA 1QOBA 2I07B 5HGTA 2HDEA 1O80A 3DWMA 1PTOB 4RHSA 2JXMB 5J1ZA 4F87A 3MP9A 3GP7A 2K6AA 3JAME 2A68C 3RFZB 2KUMA 4ZRQA 1EWYC 3NZ3A 1H9JA 2K3UA 4A6QA 4R8IA 2QIEB 4US9A 3NQTA 4OZBA 2F0OA 2E2IB 1WTOA 3NBHA 1PZKD 1IL8A 4IFDJ 2K5QA 4M0WA 4CBVA 1EFID 4UAIA 2E76C 3R8BA 1QF6A 2EJFC 4X3SA 4K5WA 4EQPA 1HUNA 1E0ZA 4FP5D 4MH8A 2CW0D 5KYLA 1LTRD 1YQ3B 3CWIA 2JXTA 3NWTA 1N62A 2EXZA 4HSVA 2XRQD 3NE5B 2JP1A 3ZQ4A 2SNSA 5T1GA 4C3IG 1PRTD 3MFYA 2JSVX 3U2SC 1AW7A 3OWEB 4C3JG 2PW5A 1CZWA 4OZCA 1HQRD 1GJXA 4JBWA 5CV6A 3HG9A 2FE8A 2TSSA 1LABA 1ZYRC 3DWQA 2Q8RE 2HQEA 1ENCA 4HROA 4J3OD 1I4GA 1RCVD 4ARIA 3SR6A 3A56A 4J1MA 1HA6A 3W5VB 1JQ4A 4C3HB 3I3CA 2PLPA 2MGSA 1F2LA 3NHHA 4MHEA 1UGJA 1J8IA 2BS4B 3TEWA 4I65A 5FK9C 4OO1H 1JB3A 3VA7A 1OO9B 4RCNA 2QMTA 1CA5A 3ETRA 3EQLC 1MD2D 2EPBA 2EY5A 1K53A 4F8MA 2PCFB 1F2ZA 5C3WA 2FJ2A 1SNQA 2XNAC 1WTVA 3QG1A 5A2QE 5J39A 3IAYA 1XCTL 2WXGA 1NVID 2RVLA 2WXMA 2PNRC 2PW9A 5C2TB 2K1BA 3HUIA 1G6ZA 1YMHE 4WQMA 1BUVT 2E2DC 1RKNA 5I4DA 5JJZA 1TIID 2YYZA 1AWDA 2TMPA 3J7YW 3PZ7A 1WSPA 3MXUA 1TWGB 3EUB2 4D2KA 3OWFA 3J7AF 1SNCA 1VJKA 1RF2D 2PQEA 4DXGA 2WXKA 5LL6X 2J4XA 1E7PB 2K5WA 1EY4A 3SXHA 2IW3A 5FOBB 1IYVA 3AE3B 1OXUA 1DM0B 4N9TA 4RAUC 4KN7C 2WDRB 1I4PA 3L3OC 1HZ6A 3L7ZC 1EYAA 1XCQL 3S9WA 1GAQB 4WRDA 3IFDA 2AWOA 3PV0A 2NN6H 1FR3A 1DD2A 1OQQA 4YSZB 3CU7A 1ZDVA 1X32A 4KGRA 2QEJC 4MACA 3VR4A 1ZYRD 3J80L 2B2WA 5I2XA 2EYPA 4YWGG 1UWMA 1VF7A 3UI3A 3K5OA 3P4SB 3AN1A 4ODGA 5IOCA 5IGEA 4A3DB 3GTLB 5BMGA 1OXVA 1KNEA 2L83A 1C9FA 2A69D 4ITKA 3S1QB 4J8QA 2PPBC 3HRZC 1BCPD 3P4QB 3NUHB 4HRSA 3G7LA 4P16A 4RH6A 3DEOA 3P1HA 3S1RB 2EZVA 1D6EC 4BS9A 4LLGM 5AUKA 3PIP3 4XQJA 3VR9B 4WWMA 1C4PA 1N60A 2E3TA 4V190 1IYUA 4C2MB 1K52A 4C1NK 4OW0A 1GUGA 1Y8NB 3BDLA 3OOCA 4L2YA 1BBXC 2L32A 4P6VF 1O78A 1X3PA 5CV4A 3MJ5A 1PZID 1LLRD 4KJOA 3TZUA 3T51B 1RM6C 1SYEA 4C7YA 3UI2A 3VQIA 5T8IA 1X3QA 1A70A 1DOLA 1MHXA 2NBFA 5COYA 1YN5A 4IN3A 2FINB 1HQMC 2A68D 4A3IB 2CJNA 5BN5A 1P7EA 1MPEA 1MSHA 1XO3A 5I9OA 3URYA 5EGTA 5HG2A 4EE2A 5CV8A 3QJYA 4XDXA 1JWBD 4FF2A 1SNOA 2WACA 3B2FA 1EY9A 3J9CA 4KHZA 1FNVA 1HPCA 1GUSA 4BA1I 4B9XA 5D65A 1E2WA 5IGBA 4JWSC 1KRHA 4N6EB 2HDMA 3X3MA 4A3JB 3HRDD 1P7FA 1D4BA 2FHTA 2KECA 4Q2JA 1VF5C 1QOAA 1FFUA 2R7ZB 1RTOA 2F0HA 3BYYB 1S5CD 5IGGA 4KHVA 1WWTA 1PRTC 5ISRA 5CORA 4R8NA 3QIAA 2L1AA 4YSYB 4IKGA 3AEBB 1D5ZC 2MEKA 2BB5A 2M9VA 2YEPF 3AE2B 3ZJUA 3LWEA 5I6YA 1ROEA 1E10A 2G9DA 3S2DB 2RBMA 4HJGE 5LNK1 3Q8BA 4NJCA 1L4ZB 1AYFA 2L55A 1IKMA 1ACCA 1Y1VB 2K32A 5ELBA 1U4LA 3D4WA 1U4MA 2NN6I 2JA7B 1CQFA 3HP3A 4DF7A 3TDQA 2B2UC 1U4PA 4IUVA 3RUZA 4XIGS 3W2DA 2EJMA 3H8HA 1FM0D 2EYMA 1NUCA 4DFAA 5FO7B 4O1NA 1WTQA 2EKIA 1IGDA 2WXJA 4L23A 4FF4A 1BQQT 1GB4A 5C4JB 5JEAH 2O5JC 3S2HB 2M2LA 4DN4M 3MEHA 3VR8B 3AEEB 3KBGA 1SNPA 3DWPA 2PVOD 1D5XC 1MBYA 4GLSC 1CZGA 1TS4A 3GQBA 4U673 1Q1BA 4ARCA 3MZ5A 2F03A 1JOKA 1LTBD 3GS2A 4DNTB 1MI0A 1B9RA 4IUPA 4LK0M 1PTOH 2EJGC 2B2UA 1TJEA 4B0MA 2XVSA 3SE0A 4B0EA 5CBAE 2R93B 2QILA 2Q8IB 3MXNA 1BXTA 3I91A 4L8JA 5BYRA 2KHSA 1A6XA 3W5UB 5JXVA 1TKYA 1GUWA 1SIJA 1JWMD 1JORA 3IT6B 2EE1A 1YNND 2EYJA 3K5NA 5C4HA 3Q8EA 2MJ8A 4DNRB 1DOXA 3IAM1 1QOGA 1XXGA 5BMHA 1VR9A 1XWEA 5AUIA 3U4EG 4XWTA 1Y8PB 1TWHB 3CKIB 2K5DA 1F2MA 2DY8A 1B2TA 1A15A 2WKDA 2WS3B 2BBCA 3PUXA 3BDOA 4PMBA 1JE4A 3S16B 4IALA 1B9MA 4WIPA 1NCVA 2NZ1D 1FRDA 3NQIA 1E9MA 2O2LD 3VA5A 2VB3X 3D3RA 3H0GB 1Z47A 4KI0A 5M3FB 3TP6A 1JRPA 1V8QA 2KWDA 3P4RB 5E4XA 2EYLA 2EELA 3AB5A 1T3QA 1SMYC 3BDCA 2B2TC 3Q0AA 4HCEA 2QSDA 2BA1A 2F0IA 1N5WA 4JPSA 3AEFB 2WIIB 2JZPA 1TY0A 4A3KB 1QWYA 3L9AX 3NTIA 5G5HA 3FILA 1V43A 3C8YA 2M00A 1FO4A 2IL8A 1BDOA 2OF1A 3LNNA 1QJOA 1FD6A 2G9HD 1QOFA 5EE9A 2NYZD 4L1BA 3HOWB 3ZJTA 3T16A 2I46A 1HHVA 3OHXC 1KNAA 2Y3AA 3SK6A 1K83B 1ZE3D 4QMGA 3DWAA 5EJWA 3I90A 4YTNB 3E56A 4OVZA 1ET6A 2DY7A 5HI1A 2I38A 1E2ZA 5M3MB 4Y7NB 5C5MA 4KY6A 4NP5A 1NSNS 3X3NA 1SSOA 3GTJB 3H09A 3TP8A 1BOSA 3SR1A 3KWVA 1O7YA 2OT2A 1ZPSA 4K2LA 1JCKB 1U4RA 4DAVA 3TEXA 4OIJA 1F9SA 2KA7A 1H9SB 2D5DA 1ESFA 1HA5A 3M7GA 3K58A 1NYRA 2VZKD 1F9QA 1G2SA 2NTTA 1QE6A 1EQTA 5K5PA 1PTOD 4IDIA 1QG7A 4QIWB 3RZOB 2KJXA 1NENB 2IPKD 4BY7B 5EPJA 3VR2A 5EE1A 1O7ZA 1EOTA 3Q23A 3O13A 1M8AA 1TT2A 3F2UA 4TKOB 2G1EA 1TS2A 3NVZA 3LWUA 4KX6B 3E9SA 5J22A 2SDFA 5JVH3 4NDXA 2CHBD 1EU4A 2WKCA 2ICEC 4KKTA 1JC7A 1XLOA 2J53A 4YXDB 1BR9A 5EQ0A 4AYBB 5I2YA 2DNEA 1WTRA 2E74C 3RMHA 3KLSX 1GXDC 3AE8B 1H9KA 3N52A 2LHDA 1Q8IA 4EVOA 2CJOA 1LV9A 2JU6X 2WAQB 2N7JA 5CMDA 4AS1A 5ELEA 1WVLA 2PZTA 4KD3A 4C56C 1KLGD 4ZHOA 3HEJA 1JROA 4XT1B 1HTPA 4N9PA 4KKSA 1Q10A 4NKLA 3SDZA 2WU5B 4RGOS 4K14A 3HOYB 4TQ0A 2J42A 2BA0A 4HEDA 1EL0A 1JWAD 1PFDA 2IGHA 2QCPX 3GB1A 2EVBA 3Q22A 5LHY1 2HUGA 4KK7A 5CC4A 4B08A 2F0GA 3A7LA 2BE5D 1G2TA 1KFYB 5EKIA 1H9RA 1S5BD 1YNNC 3AEDB 3D6CA 2IWHA 3GTGB 1XX8A 3IFTA 3T56B 1C76A 4EQOA 4C3JB 1AEXA 3TBIB 3AEGB 3EROA 3FILB 1H9MA 2E75C 3AEAB 2F0FA 2Z8LA 1SDFA 5D3DA 2KCCA 1CA6A 1CJEA 4HTHA 5BMIA 2K05A 5DNFA 3SVMA 1FIQA 3HVDA 1IBXA 1JW9D 1IUEA 3NK9A 1YNTE 3I57A 4K8IA 4ZYSA 1TWAB 3LB8C 1ICWA 3N6RA 2XN9C 1HRJA 1WRIA 3AH7A 4Z9CB 1TKEA 1EIHA 3PZ8A 3FKIB 5H92C 1VZ8A 3SK8A 1EWHA 2FMMA 3W1SA 2LMCA 1UEAB 4PT5A 4CKEA 2JWUA 1SMYD 2QDBA 3PUWA 4IOIE 1I50B 3K7AB 1I6HB 3P4PB 3PUZA 1B50A 3AE6B 3EGRA 4LMQD 5C44B 2RSNA 2LFNA 2WP8J 1B4OA 3HKZB 3Q24A 2MJEA 5EE0A 1SFOB 1ENFA 1MHHE 4RF0A 3KLRA 1NAPA 3V3XA 3T3OA 4QCLA 3FMCA 4CJ1B 5EPKA 2BS2B 4KN4C 3AE5B 1SBBB 4MT5A 4USAA 1OQRA 1SE4A 1ZKOA 2V4DA 3P63A 2QJLA 1EM7A 2BB6A 4ME5A 3RD4A 4NAWB 3BG3A 3VR5A 3C3LA 5JPMC 3SK5A 1ZUD2 1STYA 2N55A 2RPVA 5CV7A 1PUTA 4C1NI 1EU3A 1AN8A 2F4IA 1F2RI 5GXGB 5A2QL 3AMUA 1DXMA 1J9OA 2PW7A 4P2CB 5EBCA 1L0YB 2F1MA 3QOLA 2IX1A 1PLFA 5EBDA 2MPMA 3OIPA 2IX0A 3I8ZA 3VYUA 1MGSA 3KQ4A 3ZGZA 4PMWA 1Z6HA 2B2WC 3ND8A 1ET9A 3SFEB 3I4MB 3HOUB 2ZXOA 1F77A 3JAML 5EE3A 2KACA 2ACZB 1G91A 3PO0A 2KEDA 2KQ4X 3P7JA 2EY1A 4XE0A 2RDFA 3TN2A 5C3XA 2W3RA 1VMPA 4BY1B 1FD7D 4IZ8A 4ZUIA 2L4NA 4Q5VA 1AFPA 2WXOA 1DYQA 2V3NA 1C78A 1AP0A 1RHPA 2B76B 1C4AA 2CVRA 1YNJD 3MC0B 3GTPB 2F0DA 3AECB 1GUOA 1RFKA 1A2TA 1V1OA 1K8MA 5IODA 3NBIA 2WXLA 3J80E 2RKSA 1VCIA 2JX5A 1FEHA 3IL8A 2OXPA 4ZHPA 3OSOA 4CJ0B 3M4OB 1MI2A 1SF0A 4WFN3 2SAKA 3GV6A 1VLBA 5E4WC 4QUFA 1KDCA 5G3LD 3ONAB 1STEA 3K0YA 2KN4A 2R3ZA 2K01A 2JA5B 4KD4A 5BN3A 2VNUD 1EY7A 1B1ZA 2JEBI 3CRLC 1I4QA 2NVXB 4R9WA 2KDMA 2F0VA 1F2RC 1T6BX 1CQVA 2C9OA 1VRAB 4G7ZC 2RMMA 1AZQA 1IW7C 5KIXA 2LY7A 4BWGB 4CGYB 2HCCA 1V1PB 4IQZA 4NAMA 2BE5C 1HFNA 1SJHD 5CV9A 1Y8OB 5I9PA