1FNUA

Structure of streptococcal pyrogenic exotoxin a
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
221
structure length
221
Chain Sequence
QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYTIDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDNKTSQIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of streptococcal pyrogenic exotoxin A reveals a novel metal cluster.
pubmed rcsb
molecule tags Toxin
molecule keywords EXOTOXIN TYPE A PRECURSOR (ALLELE 1)
total genus 59
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fnuA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fnuA02
3GP7A 2TSSA 1SE4A 1S5CD 1D5XC 3W2DA 4BWGB 1S5DD 1SJHD 3OWEB 5ELCA 1CHPD 1PTOD 4OHJA 1LTRD 1PTOH 1HTLD 1HQRD 1JWMD 4C56C 1I4XA 1HXYD 1V1PA 2XRSD 1UUPA 1PTOF 3DWQA 1CQVA 1QILA 4RGOS 3SEBA 1PRTB 1JWSD 1FGBD 1TS2A 2ICIA 1ET6A 1LT4D 1T5XD 5D3DA 1RF2D 1EEFD 1B1ZA 1PRTD 1AW7A 1LTSD 1AN8A 1LT6D 2NTTA 3EFXD 1BXTA 1BCPC 1FNUA 4L6TB 4RHSA 4UDUC 3BVGA 1PRTF 1TS5A 2QILA 5I4DA 1XXGA 4K6LA 1EWCA 1LTAD 1ENFA 1PZID 1SXTA 1I4PA 3R2TA 1BCPF 4DXFA 1YN5A 3DWPA 5ELEA 2CHBD 1PRTC 1XTCD 1D5MC 3BYYB 5D3IB 1HA5A 1PZJD 3O13A 2WV6D 3TSSA 1CK1A 1I4HA 3DWAA 5ELFA 1S5ED 1YN3A 1FNWA 1I4GA 1S5FD 1BCPD 5FKAC 1LTGD 2AQ3B 3CHBD 1V1OA 3R8BA 5ELBA 4RGNA 1LTID 2XRQD 1TY0A 1KLUD 1DYQA 1F77A 1RD9D 1V1PB 3BVMA 1SJED 1G8ZD 3BZDB 2AQ1B 3EA6A 1PYWD 1B44D 1D5ZC 4L63B 4Z9CB 1CHQD 1RDPD 1FD7D 1EU3A 1LLRD 3MFGA 2AQ2B 1ET9A 3KLSX 1BCPB 5ELDA 1FNVA 1MD2D 4RGMA 1JWUD 1PTOC 3V05A 1JR0D 1L0YB 1LO5D 2IPKD 2XN9C 5TSSA 1GOZA 4RGTA 2G9HD 2O2LD 3URYA 1TS4A 1D6EC 1EEID 1PZKD 1JCKB 1STEA 1SEBD 2R61A 4RHRA 2XNAC 1PTOB 4RH6A 2SEBD 2QEJC 2RDHA 4ZYSA 2RDGA 1LT5D 1LTTD 2NTSA 1UNSA 4RFBA 1TS3A 1YN4A 3R2IA 1LT3D 4RCOA 1CT1D 5FK9C 4DXGA 2Z8LA 1SE2A 4TSSA 4NZLB 1L0XB 1JQYD 1S5BD 1KTKA 3BYTB 1KLGD 2J4XA 1ESFA 1I4RA 2IJ0A 1EU4A 3BVZA 1I4QA 1SBBB 1SE3A 1EFID 1RCVD 3MC0B 1M4VA 1LTBD 4O1NA 1TY2A 1DJRD
chains in the Genus database with same CATH superfamily
4H7BA 5JPNC 1E90A 2K22A 4HMJA 4DR5Q 4BWGB 4CJ1B 3CCSA 2E75C 4P71A 1I6HB 1XO3A 2LRWA 2B8GA 2BPSA 2LVQA 3PHXB 2K8HA 4XYCA 1NJIC 2CCZA 3RCZA 1XLPA 4AOFA 2B2UC 3WAOA 2KNBA 3NSWA 2PVOD 2BYEA 1PTOF 3D31A 5JAVA 2O5IC 1CQVA 3A5ZB 1XLNA 4WJOA 1X6OA 4EEWA 5C3JB 3AFQA 1LACA 1LUZA 1SRUA 2MQHA 3W1BA 5IYCG 2J0TD 5G5HA 1T5XD 1GB4A 4CDEC 1E2ZA 1NTGA 2KJRA 2M19A 1EQVA 1ROEA 2K6DB 4IFDI 3D6CA 2DAJA 1IKLA 3UQBA 5H1SE 1UBQA 2KMMA 3ENEA 1UAPA 2WB1E 4F87A 3ZXVA 4IM3A 1IYUA 3DBLI 2YTXA 2RQXA 1P7EA 4HCPB 2N9PC 4OEMB 3DVGX 3IVFA 4M0WB 1G6JA 3HOZH 3VTWA 1UE1A 4OXPA 3LGJA 3T13A 1D2BA 1QOBA 1T0QC 3NOBA 4ZRQA 4KIKA 3W1YA 1YD8U 1XTCD 2EYFA 1E2WA 4LF9Q 2F1MA 3O13A 3A33B 3HK0A 4LNOA 3DBLB 4BKTA 2VL6A 5A2QL 3ZJTA 1O7LA 3H94A 2MSED 4KHPL 2K5WA 2KDMA 4LW1A 4K1RB 3L3OC 2LHDA 3RNFC 1GUNA 4YTPB 3J81c 1WH3A 2K52A 3HOVB 2E3TA 4IFDH 3IFWB 3BVMA 2EY1A 3P4SB 3V3XA 4XDDA 5T1GA 4IOCA 2N1WA 4XT3B 1TR5A 2F0EA 2AQ1B 1QT9A 4LNKA 2B2VA 4A3BH 2D11A 4NY0A 4DR4L 4WWOA 3SR6A 4A90A 4G57A 1S72A 1C1YB 1V9JA 4JPSA 3R3OA 1N36L 3H9DA 5JEAG 1YX5B 4UP8A 1MFWA 3PIO3 2MBEA 1VZ6A 2I5MX 2NPTA 2PW5A 3K6OA 3C8YA 3J7A5 2K50A 5JVG3 1N5WA 2D10A 1JOKA 2CFMA 3PSIA 1WRIA 1M1KC 1YX6B 1TWHH 5C6AA 3DHGC 2PZWA 3G6JB 2XTIA 1TT2A 3Q3NC 2JA6B 4G11A 4M0WA 3VYUA 1GJZA 1C48A 2BQQA 3HFZB 2SEBD 2WXRA 3KUDB 2AHOB 1KABA 2OHFA 2RDGA 5FLXL 3FAHA 1VQHA 3AB9A 1BKBA 2ZTEA 1K53A 2B76B 3CMAA 1FJGQ 5I6YA 4GOCA 2KCNA 5JJIA 1GUOA 4B9XA 2PPBC 3SK6A 4EZLA 1KDAA 3NUHB 3K0XA 4N9TA 2K32A 3RZDB 2VRRB 4W9LA 2XIWA 2BDNA 2LUEA 3QQ8B 4DBGA 5JHBA 5HI1A 3ML8A 2B2UA 3OMGA 1K0SA 2WXKA 1PFBA 4JI2L 3CF6E 1HNWL 2M0XA 1TY2A 2BCOA 2WXQA 3GP7A 4JOIA 1EF5A 2A68D 3P1MA 3NWTA 5I2XA 3T4AC 2JA5B 2DWQA 4JIOU 2HD5B 1ONLA 2HUGA 3ND9A 4RF1A 5E3FA 1PTOD 1WXAA 5E6OA 3VH3B 4II2B 1HE8A 1TKYA 4DV0L 1P8LA 4A3FB 2X6GA 3KLWA 2SDFA 2UXBL 4H02A 1HTOA 3TEHB 4KKSA 1VQ6A 2KENA 3H3VI 1H95A 2R7ZB 5D3DA 4A3JH 2DZIA 5CORA 4KK7A 4HPPA 1F2RI 4L6TB 2BE5D 4OGQC 2BH2A 2D3CA 1A3VA 2XWJB 3KUZA 1TBEA 3QOJA 1X3PA 3S1RB 3NVYA 2BDOA 2K5VA 3NBHB 1IBXA 2DBYA 4HMIA 1W3SA 2HQLA 4DXFA 1EQRA 2XGTA 5C44H 4GNXC 3KYCD 2ZNVC 4LCDE 4B95A 1OXUA 2PKOA 1AE2A 1VQ8A 1DZ1A 2CU3A 3M85A 1WFQA 2A5HA 2E5LQ 3ZNZB 1VQBA 3A9JA 1YIWA 2HTME 2W54A 2EXZA 4EQ5A 3GTQB 2QCPX 1WX8A 5ELFA 1RL2A 1S5ED 3U52E 5IODA 5GXGB 3F2UA 3S24A 1QE6A 1C7YA 2PMVA 2HE7A 1Q10A 1TXYA 4C3HH 3D4RA 2R2OA 4TQ0A 3LYYA 2TMPA 1GJXA 4EFOA 1I3QH 4A3JG 4DK0A 5FLMG 3NEMA 4DV4L 2HCCA 1NBWA 1KLUD 4QIWB 3EIVA 2AX5A 3SDLC 3R93A 2F0JA 3BY4B 4RMAA 3P63A 2KC2A 4K5WA 3KYHC 2PCFB 5EDSA 3IAYA 2K01A 1A62A 1RODA 4U68A 3H15A 3CW2C 2PE9A 1YNJD 1Y1VG 1Y1VB 2BKRB 2RVLA 1VMPA 2RHSB 3NS8A 3ZIMA 2KEDA 2KUMA 2PI2A 2O2VB 3A8KE 3VDZA 1C4PA 4JI3Q 3OJ3A 4ODGA 3S1RH 3HOXG 3S1QB 1MHWC 3HP3A 4MM3B 3SE0A 2KMCA 2ZXPA 1GHKA 3W1SC 4X65L 1WM2A 2KJ6A 1V5TA 4C4VB 4JK1C 3RN5A 3M4OB 1QWYA 3L10B 1K28A 1S3OA 4DDID 3A9KB 1ZDVA 4JG2A 2KFKA 4WJPA 1ML0D 4ANVA 4DDGD 5C3EB 4J6IA 1D7QA 3UIPB 1YEZA 1F9RA 1WGGA 2VZKB 2Z4HA 4B3ML 1UBIA 5E6JA 3RNCC 4TRDA 1LM0A 2KYWA 3UQAA 4FO2A 4YL8A 3ZLZA 1IGCA 3NJTA 3E0EA 1X32A 1CT1D 3TDQA 2LGSA 2B63G 2IO3B 3DBSA 3M63B 5FJ8H 2WXFA 1SE2A 3H6MA 2CWAA 2UU9L 1EL0A 3IT4B 3PZ8A 2NVQB 3SFEB 4HPMB 1I4RA 2KO3A 4ANXA 1ZDXA 4IJHA 1B50A 5I9OA 1M4VA 1SE9A 4YCUA 2CVRA 2AUJD 1DJRD 5IGFA 1JMCA 3BZKA 1LQBA 1LYLA 4JL9A 3PO2H 4LFCQ 2B2VC 3HOVH 3MXGA 4V0BA 1ILPA 2IO2B 1SJHD 4IPHA 1WGKA 1DOIA 2F0PA 2F0FA 5ELCA 2R2QA 2WX0A 4KDIC 4PS7A 1EQQA 1JWMD 3BS1A 4LJPB 1V1PA 3K57A 4OVUA 3GTMB 3I4NH 2W82A 1YNTE 2DUDA 3KUPA 1K8MA 2KX3A 4B3SQ 5GMVA 2LHEA 4K8JA 3J80E 2Q2TA 1JWSD 4HJ5A 1VS0A 1VR9A 3CMMB 1KOTA 1G6PA 2SAKA 1JWAD 3W9CB 2NR2A 1PRTD 2JN4A 1LT6D 3EFXD 1BXTA 1VQJA 2BYFA 5M5WB 2C7MB 3I90A 4GXBA 3P4PB 5KHOA 1F9SA 5M5YH 1WOCA 5KIXA 2RSOA 4LF5Q 4OO1G 1JB3A 3HOUH 2L83A 1VQIA 2A69D 3G71A 1F9JA 2QA4A 2YTYA 3GTOH 2Y5CA 1JW9D 5C3XA 3Q8EA 4HJKA 3ZRFA 1E6EB 4ZAIA 3JVZX 4YTMB 4IJLA 1FXAA 3A0JA 5J22A 1NE3A 3I4NG 4A3GB 5LL6X 3Q8DA 3MVVA 1U4RA 2D9UA 4R4OA 5IT9L 2WINB 3CHBD 1C0AA 4MH0E 5C2TB 2IX1A 1ILQA 3ZQ4A 1R7SA 4JI0Q 4XQQA 3TN2A 4BBRB 2NB0A 2VQFL 4HDQA 2W9NA 3SXHA 4LDTB 5CBAE 4TUUA 5IGBA 4BY7H 3FKIH 1FCCC 2WDTB 1BBXC 2QMTA 3U58A 2R92H 3HM6X 3K59A 1X1MA 1D5ZC 3VYTA 1QOGA 5C0XJ 4CGYB 3P20A 3PUZA 5DAUA 3J80i 4OWWB 4ANUA 4Z9CB 4X62Q 4DUZL 2N7EA 1DONA 2NBWB 3PSEB 3K7UC 3MFGA 3P75A 4YTNB 5G55A 3NHEB 1FNVA 1PFNA 2JY6A 3AM9A 3V05A 4XX5A 1F0ZA 3GS2A 2J7QB 2EYHA 4EKUA 3RNEC 2KWUB 4JBMA 2JQOA 1NNXA 1L0YB 2ATWA 2N78A 3IFTA 1BBWA 2JYTA 2WXMA 1KHIA 3ERSX 5TSSA 1YJWA 3J7AF 4BBNC 4XGAB 2C35B 2O2LD 1G2SA 1MGSA 1PZKD 1JCKB 4CKBA 4ALPA 4ABNA 1DOXA 2YEPF 2R61A 2JRHA 3EFUA 4FDBA 1K8AC 1O78A 4DK6C 2RDHA 2Z6BA 2INPE 2R92G 2Y0SE 1I6HH 1LT5D 1PFDA 4B3RL 4B0MA 3M9BA 3RN2A 4IO9A 2KVRA 5AZFA 3ZDMC 2L1BA 1WTHA 2GMIC 4GDLA 3CPFA 2PIAA 2WP8J 3CAMA 2R93B 1ZEQX 2ZW1A 5H8YE 3M4PA 1QVGA 2FIFA 1UELA 4KY6A 4DAYA 3CCMA 5IT9E 3WOEA 2MBBB 1EY7A 1Q46A 3PIOA 1I4QA 1SBBB 1KD1C 3KWLA 1UE5A 2R93H 3E9SA 4PYZA 1LTBD 1J5EQ 3T51B 4OZAA 5H92C 5K5PA 2TSSA 2WXHA 3QARA 3JSVB 4IW0A 3W2DA 2A73B 3OWEB 4DR2Q 1VQMA 2X6LA 2NVTB 2GA4B 5HG2A 1JORA 1PUTA 3TBIB 4BA2I 3JAMi 2MGSA 1E24A 5IWAQ 3AE4B 1STAA 3MC8A 3T9LA 4XDCA 3KYDD 1OQYA 3WANA 1LT4D 2YYZA 3RUIB 3GE8C 1ZYRD 4WURA 5KNCA 2N3SA 3B08A 3JAMc 2BWES 3BVGA 3UE0A 5EJWA 3N20C 3TEYA 4GKKQ 4XT1B 2Y5PA 3B2GA 2E5LL 3A5UA 4EZJA 3EC8A 4R4CA 2R93G 4CDFC 4R9WA 1IP9A 3T3OA 2UUBQ 3I56A 1WTRA 5D3IB 1D5MC 1H8CA 1Y8NB 3MXNA 3J81L 2UXDQ 2R92B 5KNDA 1M94A 2KTFA 2WWZA 5BMHA 4A55A 1UF0A 2YU9B 2HHHL 1MG4A 2Y5BB 3K5OA 2O2VA 2F3WA 4ILWA 4K8IA 1WFYA 2R6GA 5J39A 2AUKA 2F03A 1UEBA 1MIUA 3NBIA 1SNQA 2L0TA 3C2PA 1ZOYB 3IFDA 3WDNA 1TY0A 4BBSH 2R7ZG 4WJ4A 1U5KA 1PLFA 2WKDA 2HQEA 4QB4A 1CZWA 4NXNL 3BZDB 4A3DB 1OEYJ 1MSHA 1QVCA 1WGHA 4ASWC 4FXCA 3ZXRA 2Q8TA 4A3FG 3N9YC 2K6AA 4DA2A 3PO3H 2GB1A 4X62L 4DUZQ 4HCNB 1NAPA 2I5HA 4R4QA 1QUQB 2KOLA 4GN3B 4DR2L 3BDLA 1VMCA 2YEPB 1UZXB 2WFWA 2KDIA 3AEDB 1HZAA 1NR2A 2JA5G 1ZPSA 2RSUA 1HJPA 1GXDC 1HNXQ 4FN2A 1OXSC 1VF7A 1WRDB 1CUKA 2YV5A 3ZKJC 1JR0D 2LRUA 3A8JE 3SVMA 4XQNA 1Y8RC 4RGTA 2N9LA 4GMVA 4JI1L 3OTOQ 4IUTA 1WI5A 3FP9A 4LJOB 4JI4L 4A8XC 2N9KA 2F0GA 4G0NB 4E74A 1STEA 4R8NA 4DR3L 4DF7A 1WGRA 1WX9A 5EE0A 4B3MQ 3X3MA 2K03A 1IBKL 1NMFA 1U4PA 3I4NB 4CBVA 3KVFB 1PTOB 1XT9B 1ZXIA 2IYDB 5M3FG 1BNZA 2UU7A 2V3NA 3FILA 5C5LA 1C79A 4Y52H 2WACA 4EQOA 5BYSA 3QC8B 4IWQA 1PFSA 2V4LA 5C0XG 1LT3D 2N4FA 2JZZA 5KNBA 1MI2A 2QDBA 2VZAA 4O2DA 3T8MA 4H0LC 1U0LA 2KN5A 3PUWA 5T8IA 1E2VA 2ENBA 3HKSA 2J4XA 3Q14C 3AULA 1CI3M 1V97A 4HN7A 5BMGA 4R8IA 1J5EL 5IP7H 2MBHA 3Q2AC 4G50A 4EVOA 3ZNGC 2OXPA 1V6EA 2J0KA 3P42A 3AECB 4DHZE 4LF7L 1JE5A 4QAYA 2KQ4X 5CYUA 3R7QA 2EJGC 2VXWA 2RKSA 5CHFA 1L7YA 1CHPD 1UGMA 4DV2Q 1HTLD 2AKWB 4E71A 5A35A 4MEMA 3TL5A 1XMQL 3W1SA 1S3SG 3SEBA 3DBHB 2F0KA 1FO4A 1CKMA 1J8IA 1T0SC 3EUB2 2FFKB 1ET6A 3N6RA 3MTNB 2I07B 4PV1C 3H6NA 1AW7A 3DEPA 2EIFA 3Q8CA 2MLBA 1FPYA 5C4JB 2LVOA 4N9PA 3U8ZA 5JXVA 4PMWA 2KWVB 4GN5A 4HLEA 2QILA 4XYQA 1KC8C 1PQSA 2I5LX 1LTAD 2I0QA 4DR7L 3R2TA 2B2TC 5L37A 3C3LA 2GRIA 3HOYG 1TJEA 3U50C 2MP2B 1HRJA 3VR9B 4JGHB 3NHHA 4DV7Q 5A2QE 5C3EG 4M1UB 1I94Q 3MJ5A 5TR5A 2EJMA 5G5GA 1EOVA 4KJNA 1S5FD 4HROA 1WCMB 4PMBA 4ZUIA 3MAQA 1HNWQ 1LGRA 1DOMA 1V1OA 2NVYH 2E2IH 2WHIA 1Q8KA 1NSNS 2EY6A 2INDC 2WS3B 2XBBC 3CC7A 2Z0EB 3BZCA 3L16A 2XRQD 4C3HB 1Q1EA 3Q8BA 4P6VF 4USAA 3E6ZX 4WJ3M 2JVCA 5I2YA 4N59A 3I4MH 1A3UA 2AWTA 3NZ3A 5G3LD 3S2AA 3NTIA 3V62A 2DNFA 4YXDB 2DY7A 2DY8A 2AEHA 4LUOA 5FLXc 4MACA 3AH7A 4IUQA 2KK8A 2KHJA 1K9MC 3CCEA 1GUWA 2PZTA 3LWEA 3K5MA 2F0SA 4HJ9A 5D14A 4RG1A 4A76A 2NMQA 1NMGA 5EKLA 5IAAC 1Y1WH 2BKFA 3DBRI 1B70B 4YWMA 2AYOB 4A93H 4GN1A 5M5XH 2DNEA 1IKMA 1VCIA 4A3EG 1SSNA 3LXFA 4HJGE 5G3LF 4GNXB 3PGZA 4OIKA 4KY5A 4XIGS 2L0FA 3M3JA 3RNBC 2B8FA 2BE5C 4A3LH 4LNQA 5E1FA 1P3QU 3LB8C 4GLXA 1DOKA 1UWMA 2EOTA 2IPKD 4A3JB 1QKZA 2PYKA 3CWIA 2KECA 1SMYC 3HOWB 1VQ9A 2EYPA 3S16H 1NDDA 1T0RC 1SMXA 2N55A 1PH2A 3JC66 4A3FH 3OIPA 2JA7B 2I1KA 2KANA 1HZBA 2WB1G 4JCVE 1C9OA 4R4IA 3TP8A 1PH6A 1SFOB 2MA9B 3L7ZC 4WIPA 2F0VA 5IGCA 1WE6A 3FVQA 2OWOA 3Q22A 1ASYA 3N52A 4OX9Q 5CBEE 4HIDA 4DV5L 2C9OA 2RSNA 4YIJA 3QX1A 1M8AA 2HHHQ 3ZRCA 1Q5WB 2P5ZX 4C4VA 3GTKH 3H3VC 1XLOA 1PH1A 2ON8A 3HKZB 3U4EG 3B0AA 3NUCA 4C7YA 3TZDA 4KN7C 1A15A 2KACA 2OJWA 2JA8G 1RFAA 1JQYD 2ASBA 2IT1A 4BZAA 4C2MH 3AQQA 3G7LA 1LFDA 1JWBD 1TWGB 3JW0X 4NAWA 3E5SA 2E6XA 3Q3MC 3FKIB 3K5NA 1RJTA 1TIID 4C3IB 3ITPA 1L0WA 4A3KH 1JRPA 2GBNA 5AUIA 4BBRH 4IC7B 1FYCA 4AIMA 3ZJVA 4MGYE 4TQUS 1RLFA 3PUXA 3TP5A 1EYDA 2XEWA 5MPOA 1T9HA 1RIPA 5I9PA 4IOAA 1HZ9A 2L5TA 3HKZE 4IUUA 3T1YQ 1WTXA 2Z6KC 5KGUA 4DAVA 1AWDA 1IZ6A 3VA5A 2MRPA 3NVWA 5AUKA 3I55A 2R7DA 2J53A 4XWWA 2KDFB 1CTMA 1HFNA 1E1TA 4CHTB 1BO0A 3EGRA 2DYOA 1CSPA 2HIVA 3CSFA 4C3JG 4NB3A 3APFA 4A3IG 1FNUA 3HRDD 4L5SA 3G6EA 3NK9A 3HOUB 2F0IA 3U30A 2ONQA 1XXGA 4I65A 2OQKA 1YNNC 4I6LB 4URKA 3H0GH 4X3KA 2ID0A 2AMCB 2X8XX 3UI2A 2C9WB 4AYBB 4IALA 3VA7A 1F2YA 1S4ZA 4PK1A 1OTCA 4FNFA 5GAEC 4F8MA 1XWEA 2KDEB 5IP9G 4FVMA 2WV6D 4L5QA 2CKHB 1H9JA 4JVZA 2KXJA 4C1NK 3CC4A 1YN3A 3V6CB 2DNCA 4IQZA 3PGEA 1EQTA 2JA6G 1ZKHA 4PZ7A 3BWUD 5M3MH 1T0YA 1FCLA 4D2KA 3E9IA 2JXTA 3H3VH 4RKLA 4HXDA 3QA8A 4DAPA 4IPCA 2WX1A 2MBOA 4ZHPA 1Q8IA 5FLXE 2UUAL 1F2RC 5ELNA 4EGVA 4FF2A 5LLIA 4ZLTF 4IKGA 3UDXA 5AEKB 1Q0WB 2L12A 4QUFA 4G7OC 2CQOA 1G8ZD 3EA6A 2INCC 3CQZH 3D0FA 4DV4Q 3FPUB 1IXRA 4C2MB 1HUNA 1P1AA 2DJGC 2DYMA 3ABVB 3BDOA 1QOHA 3X3NA 4DAMA 1KFYB 1PDQA 2G4DB 1OXXK 4MHEA 1WJUA 2G1EA 4GN4B 4JE3B 4LAAA 4UPAA 3H0GB 3H91A 4DR6Q 1EU3A 2IGHA 3H7SA 4GLSC 3KLSX 2SNSA 3GTKB 4HDOA 4DK5A 1MD2D 4IUMB 4ZQ3A 1WXMA 3A9KA 1E10A 2F0QA 4E3CA 1E7UA 3HOVG 2F0DA 4H44C 5DEHA 1JOOA 3QWNA 5CC4A 1GOZA 2K05A 3I4MG 2KN4A 3ZW3A 5FR6A 5IGEA 2MX2A 4RMFA 1E7PB 3S16B 2B3AA 2LGXA 3AE2B 2E2JH 4WQOB 2ZT9C 3GB1A 4MJSB 4IURA 2NZHA 1QOAA 1HNZQ 1C4QA 1YJNA 1P98A 4DV7L 4FHKA 5FO7B 2JSOA 2LS01 4AJYB 2KOXA 3I4LA 1WY8A 1JOQA 3PZDA 3E3XA 4DN4M 3KF6B 1UNSA 1A6XA 1Y8PB 4ZK9B 3R2IA 5M5XB 4A93B 2UUBL 3ZTDA 4PG3A 2HDLA 2JA9A 1YBYA 1SGHA 2MJDA 1NCVA 2O6VB 3NQTA 1HZ6A 1WXSA 3PHWB 3I9V1 5AZGA 2K28A 3CCLA 5D2MB 1HQMC 1PDXA 4MSMB 4O1NA 2KBNA 3RMHA 3PIPA 1WD1A 2NN6I 2X69A 4IZ8A 4A3CH 3H7PB 4I6PA 4OZCA 1IUEA 3TMEA 3A7AB 1ZXHA 4WJQA 4B3SL 3U2SC 2NN6G 1FRRA 5FR3A 3KWVA 2MP2A 1W6JA 3KF6A 1I35A 3IL8A 4RCNA 3TMPB 2LMCB 3CCQA 4KKUA 3HOWH 1VQGA 3PRPB 4DR1L 1UEAB 3TS0A 1B1ZA 1TQOA 3DM1A 2PPHA 2FIDA 4I6NB 3QB3A 1N34Q 2ZW0A 1E8WA 3OW7A 4K14A 2L52A 4QL5A 3TP6A 2VH1A 5J2RA 1MPEA 4R4TA 1B4OA 4DV3L 2DLBA 3TIXA 3U4ZA 1EWCA 1XTDA 4HKQA 1I4PA 1OTRB 2PNRC 5ELEA 2RCFA 1FMAD 1JT8A 2MBQA 4W9HA 4OO1I 1YJ9A 2Z59B 5E6NA 2KC1A 2EJFC 1WGDA 4I7ZC 4P1CC 3I2ZA 4HCSA 5IIFA 1X3FA 5IYBH 3GTLB 2W55A 1ZUD2 5JH5C 3NXWA 2ZPNA 3VR6A 3S1MB 4NMZA 2A6HC 3VR4A 2KWDA 2LUMA 2QDFA 5ISRA 1E8YA 3R8BA 2NBUA 4RA8A 3DVGY 1Z2MA 2L55A 1ACCA 2M56B 1U9RA 2EY5A 1WCMH 1K83B 3IAS1 2HT1A 4NXNQ 1X55A 2LD9A 4KHVA 4A9AA 2KAJA 3K7AH 2KA7A 4KX6B 3F2BA 3GTJB 3S14H 1TYGB 4JV5Q 3BK2A 4DQOC 2DENB 4WWPA 3GDEA 4FYDA 4F7XA 1PYBA 1BBUA 1YITA 1E3PA 1KNEA 2A1AA 4DR6L 1NBFC 1CHQD 4BY1G 2FXQA 4LMQD 1HCZA 1YQBA 3QHTA 4AQYL 2ZXRA 4KN4C 4RGMA 1G6ZA 2EKEC 5C4JH 2CU1A 4G4KA 5BMIA 4WJWA 1PA6A 1B7YB 1LO5D 5IGDA 1QNUA 2F3IA 4O42A 3ONSA 3DXJC 1AZQA 2IBIB 4LLGM 1Z47A 1Y1WG 3R66C 2L15A 1HNZL 4M00A 1JALA 4HRSA 5KYIA 2Z1CA 2D3AA 4EQPA 1B9NA 1EY8A 2NTSA 1QB5D 4P72A 4M8AA 2FE8A 3A4SC 1BUIC 4GS3A 1NENB 2WYQA 3NZSA 4KSKC 4NJCA 4HPLB 3I73A 1E9MA 4K7UA 1MHHE 1TVXA 4FADA 3JSVA 4K81A 4ZKBB 3M3YH 5BO4B 4NXMQ 2UXCQ 1YMHE 1WR6E 2ZJDA 3HS0C 3NTKA 2VB3X 1WYGA 1PH5A 3BK1A 1L0VB 2JYEA 4RNAA 4ZUJA 1ZXTA 2HDEA 1WTPA 4GSWA 2VUMB 2L05A 1SE4A 1SSOA 3DLLA 3QWZB 1N8RC 1XLQA 1KM7A 4NJ7A 2NWGA 1T5EA 4C1NI 3I70A 3PIP3 1C8CA 1CFMA 2AWNA 2MPMA 1GAQB 2ZPYA 1SYCA 4NW2A 1I4XA 2K39A 3R7RA 3PREA 3MC9A 1UUPA 4DFAA 5C4HA 1K52A 1S1QB 3K9OB 4ZKCB 3AV8A 4AQYQ 2I2YA 2K75A 1XNQQ 1X65A 2Y0SB 4GKJL 3Q6SA 1AN8A 1XCTL 2KCMA 1FD6A 3KLSA 3HOZB 1PRTF 1W6KA 2D3BA 3OW2A 2JEAI 1FFVA 1QVFA 4YY3L 4DV6L 2VQEL 2ZZPB 1MJEA 1EFWA 1VD2A 3NQIA 3ETRA 4JPBW 1PRTC 2EVBA 3FPPA 4IPDA 1J6QA 4QF4A 3SU8X 4K2LA 3CP0A 1QJOA 3A8IE 3K7AB 3H8HA 4A3DH 3DWAA 3UIOB 4A3IH 2FMMA 3JAML 1PH8A 1HUMA 1I4GA 1EF1A 2ALYB 2PW7A 3SK4A 4K6DA 4BBSB 1STNA 5J17A 1VDZA 5CTRC 2AQ3B 3S2DH 1F1HA 2N49A 3CPWA 3ALBA 1EY4A 4GDKB 5CV4A 3M7NA 1L6VA 2A6HD 4JX1C 4X3TA 1JJ2A 1D8LA 1J19A 4EZKA 1ZP0B 3M4QA 1GC7A 4HTHA 2L76A 1V1PB 1P16A 1IBXB 3KW5B 1T3QA 2J7ZA 2JF5A 4X64Q 1L1OA 2YU9H 4P7IA 2HJ8A 4OELB 1CJEA 1RFKA 2KKCA 3Q8FA 2XSCA 1FR3A 3KF8A 3AMUA 4KZ0A 1BUVT 1NUCA 2FCNA 1HNXL 3AI5A 3ERQA 1C77A 3K81C 4B6WA 1OGWA 5M3MG 3J7YW 3K5LA 1OXVA 2V4IB 1FD7D 4RF0A 2MCNB 4WH4A 3V6EB 4DR1Q 1G291 2E74C 1K0RA 1TZOA 4GLAC 3T1YL 4F8CB 3A56A 3M7GA 2IWHA 1N33L 3TZUA 1EIFA 1ICWA 2D0PA 2LXCA 3GTPB 1D6EC 1V49A 1YZ6A 1EWIA 3L0WB 5C23A 4B3TQ 4Q5VA 4RHRA 2RR9A 3NVVA 4US8A 3RFZB 1CZPA 2MFIA 3M62B 3AYHB 4BAXA 4IFDJ 2GOWA 5DPSA 5ELOA 3GTGB 1ISNA 2K9XA 4FA6A 2D5DA 4PZ6A 4DR3Q 4XWTA 4ICVA 3PO2G 2JXMB 1WYDA 1YNND 1KRSA 2V0GA 1FL0A 3EECA 2L0CA 1NY4A 1WZ3A 3ER0A 1AARA 1IYJB 4S3SA 2QDLA 3ICEA 2NUCA 1I50H 3FILB 3DVNV 1D3ZA 2G4SA 3BYTB 4WWMA 2DN8A 2A69C 2CR5A 4DNRB 4NPNA 5EE1A 4KY7A 4PMCA 4QY7A 1SE3A 4BY7B 1SE8A 1WTWA 1PHJA 1IBLQ 1FVIA 1Q81C 2F4VQ 4A6QA 1IGDA 3EROA 5CMDA 3AN1A 4OHJA 1SNDA 2EPBA 4PT5A 3S9WA 2JU6X 1J7AA 4DU9A 4WFN3 4EOYA 4XYOA 4NAMA 2WU2B 3A74A 1EEFD 1PV4A 1V8QA 1HFGA 3AU5A 4IM0A 4BKSA 1J8CA 5NUCA 4FF3A 1TS5A 2PVGC 5C4XG 1X3QA 4L5RC 3B1LX 3K9PB 3LJ3A 2J0JA 2ZTDA 4CO7A 3VFKA 1B2TA 4A3BG 3HVDA 4ZRKA 3ZGZA 4GDLB 1EWHA 2V9HA 1ENFA 5GADC 5JVH3 1MHXA 1XMOL 2H89B 2K5PA 3DWPA 1O7YA 3MHBA 4DUYQ 2M00A 3AU7A 2EMSA 2R7FA 1F9QA 1VCBA 4A3MB 2CH4A 3L9AX 4IUNA 3BYYB 4KDLB 4FXKC 4LF5L 5COYA 4YSZB 3RYTA 3MFYA 4ULLA 2N7DA 4XDXA 1SAPA 1WMHA 3CU7A 3GTMH 1XJVA 1WIAA 3VUWA 4FBJB 1EO6A 4HIKA 3S17B 1U4MA 2WAQB 4N8X1 2E2DC 5CV6A 5IYCH 1YOVB 4C00A 3WIMA 2VB2X 1A2TA 2UUAQ 3S2HB 1WM3A 2N1VA 4X6AH 2V4DA 1F77A 1LTLA 4A3GH 2WXOA 2MO1A 1Q82C 3CCUA 3A55A 2F0LA 4L8JA 3ND8A 4UHVA 1EIHA 1YNXA 4CKEA 3AE7B 2LGDA 2LWPA 2KWCA 3T1HQ 1WD0A 1EY5A 4W9IA 5L95C 4TQ1A 5D94A 3EVQA 3BDCA 1SROA 1S40A 2UUCQ 1OO9B 2JA8H 4BY1B 4HKZE 4JWSC 2LASA 2MJEA 1LLRD 1WZ0A 5J3BA 1QZEA 3AE3B 1MG8A 1BCPB 2C5CA 4PQXA 1YVCA 4QJFA 2I1JA 4NNJB 4K0KQ 2LJIA 1GUTA 4LUVA 3P7JA 5C3EH 1TTNA 5HHDG 3CXCA 1XMQQ 1SR3A 1KQSA 3CCJA 4J3OD 4L23A 4W9EA 4X3UA 1JROA 3TCAA 2XN9C 3I72A 1LABA 1E8ZA 3CMEA 3Q3FA 1PFMA 3WCQA 2W3SA 1TS4A 4YWLA 1W2BA 1A8VA 4X66Q 4HJ8A 3Q3OC 3SK5A 4GGQA 1HR0L 1SDFA 2Y3AA 2E2HH 3ML9A 3I7FA 1PXUA 1GUAB 2KZRA 4ME5A 4L2YA 5IN7A 4MZ9A 1EY0A 2F3VA 1NYRA 2BA0A 2PW9A 1ENAA 4NDXA 2EMTA 1WMHB 1GUGA 4A3KB 4ICUA 2IO1B 1I7HA 1ASZA 5JJLA 4HSPA 2V3PA 1E7VA 1P9DU 4B3RQ 2WXPA 1N5XA 5KHQA 4W9GA 4TSSA 3C0RB 4CQNA 1UH6A 2RA4A 1KAWA 2OJRA 5IOIA 1KDBA 1D1IA 3D4DA 1ESFA 2SNMA 2VY3A 1QUQA 3A7LA 3RR5A 1YHQA 2A5UA 3NBHA 2A19A 3E56A 2E8GA 4A3LG 1FGUA 2NVXB 1LV9A 4ZDVA 4ME3A 4POGA 3NTHA 1HTQA 1NI2A 2BW2A 1Q1BA 5EPKA 3WALA 1I3QB 1E7ZA 4OO1H 2VNUD 5GAGC 2CJNA 4DR4Q 1WJ6A 3K0YA 2B3GA 1TU2B 4LNIA 3HEJA 1ZE3D 1GHJA 3QO2A 4DV2L 5JPMC 1SYBA 5JZEB 1SMYD 4RGOS 3TRZA 1AFPA 1AEXA 3GTLH 2D5GA 4II3B 2QF7A 3FEWX 3I4OA 3SGIA 4EX5A 1B53A 1JB7A 1DGSA 2FUHB 3VVWB 4IN3A 2GVBA 3FDTA 3TEWA 5C44B 3NENA 3G48A 2LGYA 3M4YA 1WYWB 2RHQB 4JI5L 4DV1L 5M9OA 3AXCA 4LFAL 4RM9A 2EYLA 1Y1VH 2QC8A 4BBSG 1Y56A 4KIKB 2R7ZH 1WE7A 3J7ZC 1YQ3B 2I38A 4JI7Q 3Q6BA 3QR8A 3TREA 3KH0A 1FJGL 2ZEQA 5E6PA 1HPCA 4OX9L 3ULLA 3C46A 2CS4A 2ZVNA 4S17A 3PF4A 3RPFC 4Y7NB 1AYFA 1EWYC 2E2IB 3NWSA 4X64L 4Y7NH 1A3TA 3L2PA 4ITKA 1N9WA 1SLJA 4BOSC 4EQNA 2EYJA 4NXML 3GTQH 1RHPA 1SJED 3EFCA 4ARIA 1H4RA 2RGFA 4UP9A 1L1OC 4KKJA 1B8AA 1C9FA 3KDFB 4M02A 5D7GA 1SN8A 1KAAA 3HUIA 1DCZA 1GVPA 1WTOA 3QIJA 3AE6B 2IHEA 3PMFA 3F2DA 1CKNB 4IWPA 3VQIA 3WAMA 5FJ8G 1AP0A 2WXIA 2K14A 1TWCH 2WIIB 3DVNU 1MKHA 5CV9A 4I7AA 1BQQT 2E2HB 2K5NA 4AWJA 2LJ5A 3DBHI 4LTUA 2KQSA 1GD7A 2QCZA 3Q0AA 2E2JB 5DPTA 1Q86C 2JA6H 4GKJQ 1HR0Q 3I3CA 2B2TA 2WXNA 5L83A 2CW0D 1KRHA 3GO5A 1TWHB 3HVZA 3PLUA 3ZNHB 2CHZA 1V1QA 1V43A 1PGXA 1XNRL 2REXA 3TUOA 2JK8A 4NAWB 3BINA 4MTNA 2N88A 3IHPC 3J80c 2LXJA 2FJ2A 4DHJD 4KMUC 2MEKA 4DNTB 5IYDG 4LF6L 1HA6A 5CGKA 1I42A 4AYBG 2LEKA 3Q23A 5EPJA 1IBLL 3GE3C 5IP4D 5JHAA 3HOXH 3U7ZA 1I6VC 3CQZB 5EKIA 4A3BB 2WP9B 1X56A 1Q7YC 4PNYA 2CKZB 4LFBQ 1WSPA 4ZHOA 5BR8Q 5IYBG 3AE5B 3SD5A 2LMCA 3ULPA 1XX8A 3S2HH 4BA1I 1GM5A 1ZW7A 3S17H 2XK5B 1LTRD 3DEOA 2PQEA 2JWUA 3C1EA 1L5PA 1DGJA 3FKYA 1O7IA 4H13C 1MBYA 3H7PA 2MP1A 4TKNA 1OQRA 5EBDA 5HFYA 4JI3L 2RBMA 4A3MH 3PTFC 1K73C 2BGFA 5E4WC 2K5DA 2G45B 2NTTA 2BA1A 2BF8B 1C4CA 3SK8A 3RZOH 2K25A 3F1ZA 4X66L 2QSDA 1CKOA 4YWKA 4ACFA 4AJWA 2YVCA 2M2LA 1BT0A 3SHQA 4C80A 2EQSA 2OEDA 1JICA 4IUVA 3QIAA 1H9KA 4OL7A 5HGQA 2NBFA 4QMGA 5EGTA 2XK5A 1RRBA 1K8RB 3U4VA 5T1IA 1NEKB 1R4MI 1L2NA 1PH7A 4HEA1 2Z4IA 3VHTC 3QJZA 5IKCM 4MNOA 1I94L 5HKHA 1J7BA 1MSGA 2G9DA 4CKCA 1VZ7A 1K50A 1IHZA 3HOZG 5ELBA 1EM7A 4FJYA 2LXAA 2JE6I 4IDIA 2BB6A 1DYQA 4AUQC 3J80L 4YCWA 5C44G 4C3IH 1A2UA 1N32Q 2DGYA 4MELA 4B9KA 4OWTB 4L5TA 2VS1A 4ARCA 4MN3A 4LFCL 1RM6C 1I50B 3J81j 4LNNA 1KIXA 2KT7A 3KJOA 2GBRA 3K58A 5LMNQ 2BVCA 2SOBA 4DR5L 3L54A 3P4RB 1F52A 3HIZA 2AQ2B 2BOSA 3OMCA 3S1NH 1XD3B 2LFIA 3APCA 4IFDG 1IW7C 2N0SB 4LK0M 1JE4A 3MTSA 5C0XH 1EYGA 2IY1B 3RI7C 4TMAB 2ES2A 5FLMH 1EIYB 5C0XI 1F2MA 1SFOH 4GKKL 1YHAA 1SYGA 1VQEA 4B0EA 1TKEA 2G9HD 4CJ0B 3Q69A 4CHKA 4A3OA 4MSQB 2WAQG 3V2TA 3RLOA 2JUOA 3ZDTA 5DNFA 1E8XA 4H2AA 2UYZB 2H88B 3P1HA 5AJ3L 2M17A 3H1UA 3HRZC 3R3MA 4RH6A 5CV7A 2BYVE 2KFKB 2MQJA 3DWGC 3J9CA 2IDYA 3M95A 2NVTH 3Q8AA 4M8NA 1DOLA 3VYSA 1B9MA 2V3SA 3KQ4A 4Q2JA 1NI3A 3RD2A 1A5RA 1UE7A 3MXNB 3WOFA 1WGYA 3B9JA 1L4DB 2IX0A 5LXHA 3K80C 2FHTA 1RAXA 4RCOA 2GBMA 1QZGA 2K1FA 4DXGA 3JAME 3E0JA 5FO8B 2JZPA 3W5UB 4Q0FA 3N1ZC 1GB1A 5IOCA 1EU4A 4HJAA 3OSOA 3ONAB 4ZRZA 2F0MA 2F4VL 3I4MB 1QF6A 3T53B 4TV3A 2PNHA 3W3AA 5HGTA 3P2BA 2PI2E 4LDTD 5E7NA 1N32L 1S5DD 4APVA 1K8OA 2PMZB 4BOZB 3PO0A 3S2DB 3OAWA 1GO3E 2WXJA 5BN4A 3D8GA 1Q3LA 1MJDA 1X3GA 5EE3A 2XRSD 3H0GG 2OT2A 1C4AA 1F2ZA 4P2CB 2ACZB 2M4NA 4HWIB 4BKSD 1QILA 3PV0A 3CD6A 3GTPH 3DUZA 4ID6A 3VTVA 1L4ZB 2CH4W 2L11A 2ASQA 5IT9c 1RYJA 5ELDA 1SIFA 1EIGA 1RF2D 2G3QB 3VR2A 4JI5Q 3OWFA 1BCPC 3DHHC 1J9OA 4K7WA 4BFRA 1RTOA 1N34L 4REZA 4EUTA 3DDCB 4F1SA 3S1NB 2JSVX 3DHQA 3F2CA 4JWUC 3MP9A 4K6LA 4DKAC 1UWXA 2KX0A 4NP5A 1YN5A 2ZCCA 4MIUA 1BCPF 1TWAB 2K4KA 2Q5WD 2CHBD 4N9F4 4AQ7A 4RWSC 2Q2IA 1YHBA 4XQJA 3LWUA 2VQEQ 3U9SA 4GOPB 4LF4L 4K3BA 3PVLA 4GZYC 4HIMA 2GN5A 2FCSA 3MHZA 4KV2A 4A3MG 1E5WA 3S15H 2J42A 4IPGA 2JT4B 4YHHQ 4A3EH 1VQOA 4LWCA 1BCPD 5FKAC 2Q2HA 2FINB 2RCNA 3J81i 3BIID 3OLMD 1WF9A 2VQFQ 3FRPB 2Q2UA 2L8JA 4JI8L 1NYQA 4AYBE 3KBXA 2M8SA 3DOWA 1H9SA 1RD9D 2RD0A 3QK0A 4MTKA 4A3IB 1MVKA 1PMRA 2LZ6A 3D32A 1B9RA 2ZTCA 4KKTA 5BN5A 1PYWD 1R4QB 5LL6S 2GBKA 3SDZA 5J18A 4JBWA 4C7ZA 3M3YB 5BN3A 5LMNL 3VRAB 3KJPA 3AFPA 1VQ5A 2IO0B 3X23A 1ICFB 5EE9A 5JOBA 1SIJA 2PQAA 3VTUA 1MI0A 2KDBA 1ET9A 3WWVA 3A54A 4FP5D 1JWUD 2DZMA 4HIOA 1R9TB 4DV0Q 1ENCA 2KD0A 4JW0A 2BTEA 1V8CA 4AH6A 4C3IG 5HURA 3DCGA 2IY5B 5IGGA 1XNRQ 2LVPA 5CR3A 2IGDA 3G4SA 3ZVVA 1EEID 1SB3C 4OVZA 3DHIC 4FHJA 2ZM6L 3DWMA 2N9EB 4HEDA 4LF8L 4MGIE 4GOPA 1G91A 1QNKA 2MW5A 1SYDA 1DD2A 3PO2B 1PGBA 3U7DA 2VZKD 4PS3A 3X0WA 3ZJYC 2ZJRA 2B2WA 1KLVA 2NN6H 2KTRB 3Q3JA 2K04A 4TVAB 3RD4A 4JI6Q 2RMMA 2Z8LA 3MJWA 2WB1B 4JI0L 1KTKA 1V2YA 3GTJH 3S14B 2ZXOA 1V86A 4IUPA 3IXSA 2KQ7A 4U673 2K5HA 3QJYA 2O6VD 4N6EB 4YSXB 1SYEA 4JV5L 1RCVD 4JI8Q 2N9XA 3TEXA 4DHZB 3CC2A 4MJSA 4A4IA 3LX0A 2IZVB 3AEEB 1CSQA 3PUYA 1WX7A 3NZUA 1HH2P 4FLHA 3NG0A 1R4PB 4IOIE 2PLPA 2LY7A 3W5OA 2OTJA 4DHJB 4KZCA 2A6EC 3KOJA 3LDZE 4A3EB 3S15B 3PS6A 4CDDC 1KF6B 3GD7A 1JRUA 1EYAA 4BKGA 3KK7A 4LNFA 3WAPA 5IP9H 4WRDA 1STBA 1WR1A 4G7ZC 1XCQL 1EOTA 4RAUC 1TIFA 2BB5A 1H9RA 4W9KA 1L2FA 2ICIA 2JEBI 4BS9A 2DJFC 2IGGA 2WAQE 2Z0SA 4P16A 5KEEA 1TWAH 1CA5A 3AEGB 1TWCB 5J1ZA 3I57A 1CA6A 1VF5C 3EHVA 3PRZA 3SHLA 3AEAB 2EYMA 2RPQA 2W3RA 4LFAQ 2HIXA 1XEEA 2WDQB 1N33Q 3L17A 3GQBA 4W9DA 3AMZA 5DLQE 4NJ6A 1WCMG 2X38A 1C76A 2QKIC 3HG9A 2H1EA 4JLCA 3MHSD 1RKNA 4BXXH 1HA5A 4KHPQ 2GLSA 4UP7A 3PV1A 1VDVA 2VW9A 2V1YA 3IT6B 1V80A 1K83H 4YT0B 2BT6A 2GVAA 3GZNI 2Q8IB 4FJZA 1FRDA 5BYQA 2IHFA 3QOLA 1G2TA 1LTID 3NS1A 4N8FA 3B6YA 1ZGUB 4J1MA 3RN9C 1TWFH 3J81E 2KEEA 2JJQA 1KJTA 2KLCA 3VDYA 4N58A 2NVUI 3GOEA 2QHOA 1B44D 1UWVA 4K5XA 5C4XH 5EBCA 2BS2B 2KVZA 1RTNA 2L4NA 4P74A 3VRBB 2MO0A 4CJ2C 2WQYB 4KLKA 2JP1A 2MH7A 3HM3A 2M0AA 1XF5L 4KKIA 1TKGA 3H09A 3L08A 4A3PA 1SNOA 2IW3A 4OONA 2VUMG 4DV6Q 4OW0A 4W9JA 1WTQA 5KYLA 1EZ6A 2D2CC 4A20A 2KHSA 1NVID 1LXDA 2JWZA 2D3GA 2UWQA 4K0KL 3OPOA 2NYZD 1PH9A 5HY6A 2C60A 4TKOB 2BWFA 2NPTB 3N30A 5IO9A 1CKNA 1K3BC 2K5QA 4LF8Q 1T6BX 3PRMB 3D6WA 3AU4A 3LNNA 4P73A 5C5MA 1F2LA 4A3CG 1K8GA 1PYSB 1CMXB 3AE1B 3BG3A 4A3GG 2F0UA 3QG1A 4WAAA 2KCTA 2MNAA 3RUZA 3KLRA 2JA5H 2DHZA 1R4MB 5JEAJ 2CHXA 1E0ZA 1TGZB 1HZ5A 4RFBA 1E1OA 1TS3A 2EZVA 5GAHC 5LXIB 4JI6L 1K51A 5JJKA 2FNJB 5M3FB 1VQPA 1L1OB 3UDIA 4W9FA 3CKIB 3HOWG 1AH9A 5JEAH 1L0XB 2XVSA 2D07B 1JMLA 1VQAA 3RZWC 3BVZA 1BR9A 2IJ0A 2EYOA 1XYIA 1EFID 5LHY1 3MC0B 2CW0C 1VQNA 4B08A 5BR8L 2M9VA 2RDBC 5AFWA 1D5XC 4F7ZA 1WVLA 1JJGA 4NQKE 3RLFA 5M3MB 1X9NA 2LKVA 1QQRA 3CIRB 1N63A 1YJJA 5DM73 3AEBB 1VQFA 1PVOA 1EYCA 3PQIA 4NQLB 1SNPA 4QIWE 3SFDB 5LMNW 4KTAA 1YJ1A 1FM0D 1F9PA 4FJVB 4J15A 1LTSD 4UDUC 3GTOB 3UDGA 2K6QA 3A9JB 2LI5A 1XNQL 2ZCBA 3PT2B 5M5YB 2ZM6Q 1HR0W 2BBCA 2ZNVB 3TEZA 1L6UA 2N8NA 3JYUA 4PS8A 3SR1A 1B3AA 1V9PA 4LJZC 3TP7A 5M5WH 2JA8B 3RZOB 2CJOA 2IY0B 2B2YA 4A3KG 2RDFA 2OOBB 1U4AA 2WDRB 3I8ZA 4DK3C 2PEAA 5G2NA 5C3WA 2F4IA 1QCBD 2ZVOA 2B39A 3ZUNA 4XXEA 3U9OA 3HGBA 2L00B 1EY6A 2CQAA 2C7NB 2WU5B 3PLVA 2J52A 4YSYB 3ZTCA 1IYFA 2A6ED 3BU2A 2EE1A 4P75A 1GG3A 2NBVB 1MJCA 1A63A 3UDFA 4POFA 1VLBA 3B2FA 4CYEA 2JA7G 1PH4A 3WA0A 5K36G 2MUYA 2JRIB 4RGNA 5F2DA 4QGUA 2UXCL 4ZRIA 4OIJA 1BOSA 2EKIA 3VR8B 4FF1A 4R1JA 4QQBX 2K8CA 3AE8B 3ZNID 3CRKC 4WAFA 2JX5A 2NVQH 1TZ1A 1VQDA 1VQCA 2JYOA 2K7VA 4JOIC 1IBMQ 3HOXB 1P7FA 1QOFA 3L4PA 1Z7TA 3PUVA 3MXUA 4HCEA 3FHWA 1IW7D 2MHVA 3NP8A 4JYAQ 4X57B 2L7RA 1UD7A 1YJIA 4BBNF 2I46A 2V1CC 5CHWA 2AWOA 3F8TA 1VQ4A 2O6VA 3VH4B 4JI4Q 3KDFA 2L3ZA 5EKKA 2QEXA 2DX5B 2Z6KA 1GNUA 3N3KB 5DM63 5IWAL 3TBLD 2UXBQ 4A75A 4M8MA 3D3RA 3RT3B 2HDMA 2JA7H 2AL6A 4DUYL 2F0HA 3URYA 1HHVA 3RMKC 3M4OH 1BMLC 3CCRA 1SEBD 2KHWB 4JBKA 3I63C 2D0OA 1VQLA 3GZNB 4A93G 1ZKOA 2CWPA 3S1QH 3CCVA 4B3TL 4XE0A 1J7CA 2FMCA 4KV6A 2K0PA 3NELA 2UU9Q 1STGA 1OXTA 1WXVA 2OEOA 2KJHB 1HZCA 1Y1WB 4R3DA 3APDA 2INNE 1TWGH 2B2WC 1JC7A 1KXLA 4NZLB 2FCQA 1S5BD 5C4XB 2WXLA 3HOUG 5BYRA 2JQRB 1KLGD 4KGSA 4S0RA 4DWFA 1RWSA 2ICEC 5LMUQ 2HJ1A 3VXWA 4EE2A 5M3FH 3T1HL 1J0GA 2K8BA 2PTLA 4DNIA 1TWFB 2B2YC 2UUCL 1S5CD 2K1BA 2ZJQA 2MJ3A 2PE6B 2EELA 4LK1C 1HTPA 1EUVB 3N1YC 4CDCC 4J8QA 3NE5B 4KGRA 4ZCKA 3O65B 3OYYA 1U4LA 5GQOA 5CX3A 3RULA 3RLNA 4C56C 1CZGA 1H9SB 1Z5SB 5C1ZA 3IG3A 5EPLA 2C5LC 1FFUA 5FOBB 1FXIA 3DWQA 1II3A 4RKBA 4F88A 2A8VA 4FXDA 5FO9B 4A3DG 1A0IA 3NRZA 1FGBD 4ZYNA 3STBC 4XZ4A 2BYTA 1TS2A 2PMZE 2KHIA 1XQQA 4BY7G 1CQFA 3FKIG 2MWSB 1X3EA 2KFJA 3UF8A 3I5JC 4RHSA 3RNUA 4KSLC 1K3RA 3ZJUA 2JXXA 4DPGA 5DCNA 1H9MA 3DPDA 2E76C 2OQ0A 2A4ZA 2NZ1D 2WLBA 2DZJA 3UINB 2HTHA 3TJPA 3L0OA 1DXMA 3DQVA 1DOYA 4YY3Q 4MH8A 2ZJPA 5IE8A 4K5VA 1N6ZA 1TKWB 4DGZA 1WJ4A 1B3QA 3KUCB 4YWGG 4DK1A 1FIQA 5EAYA 1D4BA 1EY9A 4GIVA 1PZJD 3MEHA 2NZOA 1SNMA 3CF5A 1CK1A 1I4HA 1HEZE 3D4WA 3KBGA 4YHHL 4JI7L 2FAZA 1SNCA 2K33A 2YLMA 2O5JC 3QCAA 4C3JH 1Q90A 3A4RA 4KI0A 5D65A 3C19A 5IA7A 1LTGD 2HD3A 1IPGA 2G5DA 5C4ZA 1V5OA 2LFNA 2NVYB 3EJIA 1C78A 3AB5A 1QLBB 3HOYH 3STBD 2OTLA 2NVXH 4YCVA 4BXXG 1BVSA 3MA2B 4MM3A 4WJNA 1KDCA 1WJJA 3ULJA 4GU2A 5EQ0A 1KL9A 2DZKA 2RPVA 3I3TB 2NCNA 4BVUC 1EUJA 2F0WA 2KQ3A 2QJLA 3T3NA 2K3UA 3A1QB 1IL2A 4LFBL 4HAEA 4OZBA 3RZDH 3I91A 3Q24A 3VUYA 4JYAL 1STYA 2Q8RE 1N60A 3DBRB 3MXPA 4ANWA 2D2QA 3DM3A 2L1AA 2MJ8A 5K36H 3IRBA 4LUZA 3OHXC 1BDOA 2KJXA 4DV1Q 2BH8A 1PGAA 1WWTA 4X65Q 4HK2A 4GLVB 4MGKE 1O80A 1Y8OB 2PQAB 2VH2A 3UGBB 3MWYW 4DV5Q 4DV3Q 1KH0A 1EZ8A 4WWNA 4FF4A 2F0NA 2F52A 2O4XA 1KNAA 2XNAC 4KHZA 2BS3B 2Z9HA 4M01A 2QEJC 2XWBB 5CV8A 4G7HC 4K3CA 4IM2A 2DYBA 2KMAA 4DXAB 1LTTD 3A1QA 4E6IA 2NS5A 1GC6A 2CHWA 1XPOA 3MEFA 1CM9A 1YI2A 4ZOHC 5AJ3Q 3OOCA 3TS2A 2FBWB 2KLGA 2VUMH 2QW7A 4LF9L 2MHJA 3VR3A 4OVVA 4AP4C 1SYFA 4KGTA 3PCOB 3VYRA 4BY1H 2EY2A 1P0RA 2LGIA 3HHMA 2OCEA 4QUCA 3V96A 4LF6Q 4MDKE 1PH3A 3C1FA 4JC0A 3EQLC 5JJZA 3T56B 4JBJA 3OG5A 1QZHA 2Y0SG 4KD3A 2H5XA 3KFUA 1IYVA 3HZXA 1M90C 2PJHA 1E22A 4IG7B 1STHA 1IBML 2C7HA 1YIJA 3QAQA 2KTRA 1JQ4A 3N1XC 1I5FA 4X3SA 2IX3A 3KF8B 4NKLA 4HVBA 2PZUA 1PTOH 3OJ4B 1HQRD 1KRTA 1HXYD 3AEVA 3V60A 2JZ3B 4FULA 3ECIA 2KVMA 2QGQA 3RNGC 2F0TA 1E0BA 3FMCA 4ZRPA 1PRTB 3IAM1 1YNJC 2OF1A 3MZ5A 4US9A 5D6JB 2J0MA 2L32A 1UE6A 5KRUA 4BBRG 2HCIA 1R9TH 2KCCA 1IBKQ 3J7AV 4G3XB 2BS4B 2D62A 4L1BA 5LNK1 3PPAA 1IL8A 2RF4A 3NPPA 2B29A 2WKCA 4C3HG 5I4DA 1WI0A 3DMUA 3GV6A 2GI9A 1ESRA 3AEFB 4IWOA 3TQYA 4WQMA 5CHVC 1PZID 1SXTA 3EN2A 5DPRA 4AS1A 3PZ7A 3ZO5B 1D1KA 4W9CA 1N61A 1XMOQ 4K7SA 4KD4A 2R3ZA 3ZYYX 3PO3B 2DAFA 3TSSA 3EBEA 1R4NB 1DM0B 5GROA 3GV3A 1AZPA 1WJNA 4PYUA 4J6HA 1FNWA 4MT5A 1GKHA 1LM8B 3K8AA 3HOYB 1VJKA 2UXDL 1VQ7A 4LF4Q 1N62A 3BJUA 4LF7Q 4FXGC 5LMUL 1Z9FA 1SF0A 3S1MH 2FUG1 2WGSA 2PO4A 4C3JB 1Y69U 4GOPC 2Z0DB 3IBEA 5DPWA 4PZ8A 3FC4A 4MGZE 3UE1A 1Y14B 1JJCB 3N32A 2H4OA 4RM8A 3AE9B 4XC2A 2M1MA 2EXDA 4KVGB 4HSVA 1YQ4B 3OIQA 4L63B 1FEHA 2GBJA 1GPXA 4DAYB 5E4XA 1RDPD 1N36Q 4P1BC 2AL3A 2A74C 3NVZA 1X54A 5IP7G 1BF4A 1XPUA 2YTVA 1XPRA 1PTOC 4JI1Q 3OTOL 3V61A 1OEYA 1GUSA 5AZHA 3GTGH 4HJ7A 2WDVB 4V190 1VRAB 4GDKA 4DR7Q 4KJOA 2WXGA 5IY0A 4OWXB 5IYDH 3E9HA 1UGJA 2F0OA 3P4QB 3W5VB 2FCMA 2B63H 1WTVA 3PF5A 3RNAC 2IL8A 2B63B 3RZFA 2EDGA 4NPSA 3VR5A 4O0AA 3HKZG 4GNXA 1VZ8A 3L13A 2QIEB 1AE3A 1R4NI 3VUXA 4ZRJA 4B9WA 2LSSA 4ZYSA 4WORA 1VQKA 2N7JA 4JQWC 4K2KA 2JPHA 1OQQA 3CSTA 1QG7A 3W1GA 2LXKA 1YN4A 1NR4A 3NY5A 4GB9A 1Q12A 3PO3G 1A70A 5CV5A 5I6WA 1FXTB 5FK9C 4UAIA 1V81A 3UI3A 4QCLA 3VAWA 4UY8C 1WXQA 2WNMA 1C3TA 3CRLC 1O7ZA 1Q1OA 1ZYRC 1Z6HA 4XTCS 3T16A 1OFFA 2L9HA 1G51A 3IKJA 2A68C 4JI2Q 1TT5B 4HR7B
chains in the Genus database with same CATH topology
4H7BA 5JPNC 2K22A 4HMJA 4BWGB 4CJ1B 2E75C 1I6HB 1XO3A 2B8GA 1XLPA 2B2UC 3NSWA 2PVOD 1PTOF 3D31A 5JAVA 2O5IC 1CQVA 1XLNA 5C3JB 1LACA 2J0TD 5G5HA 1T5XD 1GB4A 1E2ZA 2M19A 1EQVA 1ROEA 4IFDI 3D6CA 1IKLA 2KMMA 1UAPA 4F87A 1IYUA 2RQXA 1P7EA 1QOBA 3T13A 1D2BA 4ZRQA 1XTCD 2EYFA 1E2WA 2F1MA 3O13A 5A2QL 3ZJTA 1O7LA 3H94A 2K5WA 2KDMA 3L3OC 2LHDA 1GUNA 4YTPB 3HOVB 2E3TA 4IFDH 3BVMA 2EY1A 3P4SB 3V3XA 4XDDA 5T1GA 4XT3B 1TR5A 2F0EA 2AQ1B 1QT9A 2B2VA 3SR6A 4A90A 4G57A 4JPSA 3R3OA 5JEAG 3PIO3 1VZ6A 2PW5A 3K6OA 3C8YA 5JVG3 1N5WA 1JOKA 1WRIA 5C6AA 2PZWA 3G6JB 1TT2A 2JA6B 4M0WA 3VYUA 1C48A 2SEBD 2WXRA 1KABA 2OHFA 2RDGA 5FLXL 3FAHA 3AB9A 1K53A 2B76B 5I6YA 2KCNA 1GUOA 4B9XA 2PPBC 3SK6A 1KDAA 3NUHB 4N9TA 2K32A 3RZDB 2XIWA 2BDNA 5HI1A 2B2UA 3OMGA 2WXKA 1PFBA 1TY2A 2BCOA 2WXQA 3GP7A 2A68D 3P1MA 3NWTA 5I2XA 3T4AC 2JA5B 2DWQA 1ONLA 2HUGA 3ND9A 4RF1A 5E3FA 1PTOD 1TKYA 4A3FB 2X6GA 2SDFA 4KKSA 1E0ZA 2R7ZB 5D3DA 5CORA 4KK7A 1F2RI 4L6TB 2BE5D 4OGQC 1A3VA 2XWJB 3QOJA 1X3PA 3S1RB 3NVYA 2BDOA 1IBXA 2DBYA 4HMIA 4DXFA 1OXUA 2PKOA 2CU3A 1DZ1A 3M85A 2A5HA 2HTME 2W54A 2EXZA 3GTQB 2QCPX 5ELFA 1S5ED 3U52E 5IODA 5GXGB 3F2UA 1QE6A 2PMVA 1Q10A 4TQ0A 3D4RA 3LYYA 2TMPA 1GJXA 4DK0A 2HCCA 1KLUD 4QIWB 2AX5A 3R93A 2F0JA 3P63A 4K5WA 2PCFB 3IAYA 2K01A 1RODA 4U68A 1YNJD 1Y1VB 2RVLA 1VMPA 2KEDA 2KUMA 3A8KE 1C4PA 4ODGA 4MM3B 3S1QB 3HP3A 3SE0A 2ZXPA 1GHKA 4JK1C 3M4OB 1QWYA 1ZDVA 1ML0D 5C3EB 1F9RA 2VZKB 2Z4HA 5E6JA 4TRDA 4FO2A 1IGCA 1X32A 1CT1D 3TDQA 2WXFA 1SE2A 3H6MA 1EL0A 3IT4B 3PZ8A 2NVQB 3SFEB 1I4RA 1ZDXA 1B50A 5I9OA 1M4VA 2CVRA 2AUJD 1DJRD 5IGFA 2B2VC 3MXGA 4V0BA 1ILPA 1SJHD 1WGKA 1DOIA 2F0PA 2F0FA 5ELCA 1JWMD 3BS1A 1V1PA 3K57A 3GTMB 2W82A 1YNTE 3KUPA 1K8MA 2LHEA 4K8JA 3J80E 1JWSD 1VR9A 2SAKA 1JWAD 3W9CB 1PRTD 1LT6D 3EFXD 1BXTA 5M5WB 3I90A 3P4PB 1F9SA 5KIXA 2RSOA 4OO1G 1JB3A 2L83A 2A69D 2Y5CA 1JW9D 5C3XA 3Q8EA 1E6EB 4ZAIA 4YTMB 1FXAA 5J22A 4A3GB 5LL6X 3MVVA 1U4RA 2D9UA 5IT9L 2WINB 3CHBD 5C2TB 2IX1A 1ILQA 3ZQ4A 1R7SA 4XQQA 3TN2A 4BBRB 2NB0A 3SXHA 5CBAE 5IGBA 1FCCC 1BBXC 2QMTA 3K59A 1D5ZC 3VYTA 1QOGA 5C0XJ 4CGYB 3P20A 3PUZA 5DAUA 4Z9CB 1DONA 3MFGA 3P75A 4YTNB 1FNVA 1PFNA 3AM9A 3V05A 1F0ZA 3GS2A 2EYHA 2JYTA 1L0YB 2WXMA 3AN1A 3IFTA 5TSSA 3J7AF 2O2LD 1G2SA 1MGSA 1PZKD 1JCKB 4CKBA 4ABNA 1DOXA 2YEPF 2R61A 1O78A 2RDHA 2INPE 1LT5D 1PFDA 4B0MA 2L1BA 2PIAA 2WP8J 2R93B 1ZEQX 2ZW1A 5H8YE 4KY6A 4DAYA 5IT9E 3WOEA 3KWLA 1EY7A 1I4QA 1SBBB 3E9SA 1LTBD 3T51B 4OZAA 5H92C 5K5PA 2TSSA 2WXHA 3W2DA 2A73B 3OWEB 2X6LA 2NVTB 2GA4B 5HG2A 1JORA 1PUTA 3TBIB 4BA2I 2MGSA 3AE4B 1STAA 4XDCA 1LT4D 2YYZA 1ZYRD 4WURA 5KNCA 3BVGA 5EJWA 3TEYA 4XT1B 2Y5PA 3B2GA 4R9WA 3T3OA 1WTRA 5D3IB 1D5MC 1Y8NB 3MXNA 3J81L 2R92B 5KNDA 5BMHA 4A55A 2YU9B 3K5OA 2F3WA 4ILWA 4K8IA 2R6GA 5J39A 2AUKA 2F03A 3NBIA 1SNQA 3C2PA 1ZOYB 3IFDA 3WDNA 1TY0A 1PLFA 2WKDA 2HQEA 4QB4A 1CZWA 3BZDB 4A3DB 1MSHA 4FXCA 2Q8TA 3N9YC 2K6AA 4DA2A 2GB1A 1NAPA 2KOLA 3BDLA 1VMCA 2YEPB 3AEDB 1NR2A 1ZPSA 1GXDC 1OXSC 1VF7A 1JR0D 3A8JE 3SVMA 4XQNA 4RGTA 2N9LA 4A8XC 4IUTA 2N9KA 2F0GA 1STEA 4R8NA 4DF7A 5EE0A 3X3MA 2K03A 3I4NB 1U4PA 4CBVA 1PTOB 1ZXIA 1BNZA 2V3NA 3FILA 5C5LA 1C79A 2WACA 4EQOA 5BYSA 5C0XG 1LT3D 5KNBA 1MI2A 2QDBA 4H0LC 3PUWA 5T8IA 1E2VA 2ENBA 2J4XA 1CI3M 1V97A 4HN7A 5BMGA 4R8IA 4EVOA 2OXPA 3P42A 3AECB 2KQ4X 5CYUA 2EJGC 2VXWA 2RKSA 1CHPD 1HTLD 5A35A 3W1SA 3SEBA 2F0KA 1FO4A 1J8IA 3EUB2 2FFKB 1ET6A 3N6RA 2I07B 4PV1C 1AW7A 3DEPA 3Q8CA 5C4JB 4N9PA 5JXVA 4PMWA 2QILA 4XYQA 1LTAD 3R2TA 2B2TC 3C3LA 2GRIA 1TJEA 3VR9B 1HRJA 3NHHA 5A2QE 3MJ5A 4M1UB 2EJMA 5G5GA 4KJNA 1S5FD 4HROA 1WCMB 4PMBA 4ZUIA 3MAQA 1DOMA 1V1OA 2WS3B 2EY6A 1NSNS 2XRQD 4C3HB 1Q1EA 3Q8BA 4P6VF 4USAA 3E6ZX 5I2YA 4N59A 1A3UA 4YXDB 3NZ3A 5G3LD 3NTIA 2DY7A 2DY8A 4MACA 3AH7A 4IUQA 1GUWA 2PZTA 3LWEA 3K5MA 2F0SA 2NMQA 5D14A 5EKLA 4HJGE 2DNEA 1IKMA 1VCIA 1SSNA 3LXFA 5G3LF 4OIKA 4KY5A 4XIGS 2B8FA 2BE5C 3LB8C 5E1FA 1DOKA 1UWMA 2EOTA 2IPKD 4A3JB 1QKZA 2PYKA 3CWIA 2KECA 1SMYC 3HOWB 2EYPA 2N55A 3OIPA 2JA7B 3TP8A 1SFOB 3L7ZC 4WIPA 2F0VA 5IGCA 3FVQA 3Q22A 3N52A 5CBEE 2C9OA 2RSNA 4YIJA 1M8AA 3H3VC 1XLOA 2ON8A 3U4EG 3HKZB 3NUCA 4C7YA 3TZDA 4KN7C 1A15A 2KACA 1JQYD 2IT1A 3G7LA 1JWBD 1TWGB 3E5SA 2E6XA 3FKIB 3K5NA 1RJTA 1TIID 4C3IB 3ITPA 5AUIA 1JRPA 1FYCA 3ZJVA 4TQUS 3PUXA 3TP5A 1EYDA 5MPOA 5I9PA 2L5TA 4IUUA 1WTXA 5KGUA 4DAVA 1AWDA 3NVWA 3VA5A 5AUKA 2J53A 4XWWA 1CTMA 1HFNA 4CHTB 3EGRA 1BO0A 2DYOA 4C3JG 3HRDD 1FNUA 3NK9A 3HOUB 2F0IA 2ONQA 1XXGA 4I65A 1YNNC 4X3KA 2ID0A 3UI2A 4AYBB 4IALA 3VA7A 1F2YA 1S4ZA 4FNFA 4F8MA 1XWEA 4FVMA 2WV6D 1H9JA 4C1NK 1YN3A 2DNCA 4IQZA 1EQTA 3BWUD 1FCLA 4D2KA 2JXTA 4RKLA 4DAPA 4ZHPA 1Q8IA 5FLXE 1F2RC 4EGVA 4FF2A 4ZLTF 4IKGA 2L12A 4QUFA 4G7OC 1G8ZD 3EA6A 1HUNA 3ABVB 3FPUB 4C2MB 2DYMA 3BDOA 1QOHA 3X3NA 1KFYB 1PDQA 1OXXK 4MHEA 2G1EA 4JE3B 4LAAA 3H0GB 3H91A 2IGHA 1EU3A 4GLSC 3KLSX 2SNSA 3GTKB 1MD2D 4ZQ3A 1E10A 2F0QA 2F0DA 4H44C 5DEHA 1JOOA 3QWNA 5CC4A 1GOZA 2K05A 2KN4A 5IGEA 1E7PB 3S16B 3AE2B 2ZT9C 3GB1A 4IURA 1QOAA 1C4QA 5FO7B 2JSOA 2LS01 3I4LA 1JOQA 4DN4M 1UNSA 1A6XA 1Y8PB 4ZK9B 3R2IA 5M5XB 4A93B 2HDLA 2MJDA 1NCVA 3NQTA 1HZ6A 3I9V1 2K28A 1HQMC 1PDXA 4O1NA 3RMHA 4OZCA 1WD1A 2NN6I 2X69A 4IZ8A 1IUEA 3TMEA 3A7AB 1ZXHA 3U2SC 2NN6G 1FRRA 5FR3A 1W6JA 3IL8A 4RCNA 2LMCB 4KKUA 1UEAB 1TQOA 1B1ZA 3DM1A 3QB3A 2ZW0A 3OW7A 4K14A 2L52A 3TP6A 1MPEA 1B4OA 2DLBA 1EWCA 4HKQA 1I4PA 2PNRC 5ELEA 1FMAD 4OO1I 2EJFC 4I7ZC 4HCSA 5IIFA 3GTLB 2W55A 1ZUD2 3NXWA 3VR6A 3S1MB 2A6HC 3VR4A 4NMZA 2KWDA 2LUMA 5ISRA 3R8BA 4RA8A 2M56B 2L55A 1ACCA 1U9RA 2EY5A 1K83B 3IAS1 4KHVA 4A9AA 2KAJA 2KA7A 4KX6B 3GTJB 1TYGB 4DQOC 3BK2A 4FYDA 4F7XA 1KNEA 1CHQD 4LMQD 1HCZA 2ZXRA 4KN4C 4RGMA 1G6ZA 4G4KA 5BMIA 4WJWA 1LO5D 5IGDA 1QNUA 4O42A 3DXJC 1AZQA 4LLGM 1Z47A 1JALA 4HRSA 5KYIA 2Z1CA 4EQPA 1B9NA 1EY8A 2NTSA 1QB5D 4M8AA 2FE8A 1BUIC 1NENB 4NJCA 3I73A 1E9MA 1MHHE 1TVXA 4ZKBB 1YMHE 3HS0C 3NTKA 2VB3X 1WYGA 3BK1A 1L0VB 2JYEA 4RNAA 4ZUJA 1ZXTA 2HDEA 1WTPA 2VUMB 1SE4A 1SSOA 1XLQA 2NWGA 1T5EA 4C1NI 1C8CA 3PIP3 3I70A 1CFMA 2AWNA 2MPMA 1GAQB 3KWVA 1SYCA 4NW2A 1I4XA 1UUPA 4DFAA 5C4HA 1K52A 4ZKCB 3AV8A 2I2YA 2Y0SB 1XCTL 3Q6SA 1AN8A 1FD6A 3KLSA 3HOZB 1PRTF 1W6KA 2JEAI 1FFVA 3ETRA 3NQIA 1PRTC 2EVBA 3FPPA 4QF4A 4K2LA 1QJOA 3A8IE 3K7AB 3H8HA 3DWAA 2FMMA 3JAML 1HUMA 1I4GA 2PW7A 3SK4A 4K6DA 4BBSB 1STNA 1VDZA 2AQ3B 4GDKB 4JX1C 1EY4A 5CV4A 3M7NA 1L6VA 2A6HD 4X3TA 1ZP0B 4HTHA 1V1PB 1IBXB 1T3QA 2J7ZA 1CJEA 1RFKA 3Q8FA 2XSCA 1FR3A 3KF8A 3AMUA 1BUVT 1NUCA 3ERQA 1C77A 3J7YW 3K5LA 1OXVA 2V4IB 1FD7D 4RF0A 4WH4A 1G291 2E74C 1TZOA 3A56A 3M7GA 2IWHA 3TZUA 1ICWA 3GTPB 1D6EC 4US8A 4Q5VA 4RHRA 3NVVA 3RFZB 1CZPA 4IFDJ 3GTGB 2K9XA 2D5DA 4XWTA 2JXMB 1YNND 2V0GA 2L0CA 4S3SA 3FILB 2NUCA 3BYTB 4WWMA 2DN8A 2A69C 4DNRB 5EE1A 4KY7A 4PMCA 1SE3A 4BY7B 1WTWA 4A6QA 1IGDA 3EROA 5CMDA 4OHJA 1SNDA 2EPBA 4PT5A 3S9WA 2JU6X 1J7AA 4DU9A 4WFN3 4XYOA 4NAMA 2WU2B 1EEFD 1V8QA 1HFGA 5NUCA 4FF3A 1TS5A 2PVGC 1X3QA 3ZGZA 1B2TA 3HVDA 4GDLB 1EWHA 1ENFA 5JVH3 1MHXA 2H89B 2K5PA 3DWPA 1O7YA 3MHBA 2M00A 3AU7A 1F9QA 4A3MB 4YSZB 3L9AX 4IUNA 3BYYB 4FXKC 5COYA 3MFYA 4ULLA 4XDXA 1SAPA 3CU7A 3S17B 1U4MA 2WAQB 2E2DC 5CV6A 2VB2X 1A2TA 3S2HB 2V4DA 1F77A 2WXOA 3A55A 2F0LA 4L8JA 3ND8A 1EIHA 3AE7B 4CKEA 1WD0A 1EY5A 4TQ1A 3EVQA 3BDCA 1OO9B 4JWSC 4BY1B 4HKZE 2MJEA 1LLRD 3AE3B 1BCPB 2C5CA 4PQXA 2LJIA 1GUTA 3P7JA 5HHDG 4L23A 4J3OD 4X3UA 1JROA 2XN9C 3I72A 1LABA 1PFMA 3WCQA 2W3SA 1TS4A 3SK5A 1SDFA 2Y3AA 1PXUA 4ME5A 4L2YA 1EY0A 2F3VA 1NYRA 2BA0A 2PW9A 1ENAA 4NDXA 1GUGA 4A3KB 1I7HA 4HSPA 2V3PA 2WXPA 1N5XA 4TSSA 4CQNA 2RA4A 1KDBA 1D1IA 3D4DA 1ESFA 2SNMA 3A7LA 3NBHA 3E56A 2NVXB 1LV9A 3NTHA 2BW2A 1Q1BA 5EPKA 1I3QB 4OO1H 2VNUD 2CJNA 3K0YA 1TU2B 3HEJA 1ZE3D 1GHJA 3QO2A 5JPMC 1SYBA 1SMYD 4RGOS 1AFPA 1AEXA 2D5GA 2QF7A 3FEWX 1B53A 4IN3A 3TEWA 3FDTA 5C44B 3M4YA 5M9OA 2EYLA 1Y56A 1YQ3B 2I38A 1HPCA 3C46A 3RPFC 4Y7NB 1AYFA 1EWYC 2E2IB 3NWSA 1A3TA 4ITKA 4EQNA 2EYJA 1RHPA 1SJED 4ARIA 4KKJA 1C9FA 5D7GA 1KAAA 3HUIA 1DCZA 1WTOA 3AE6B 3PMFA 3VQIA 1AP0A 2WXIA 2WIIB 5CV9A 1BQQT 2E2HB 3Q0AA 2E2JB 3I3CA 2B2TA 2WXNA 2CW0D 1KRHA 3GO5A 1TWHB 3HVZA 1V43A 1PGXA 3TUOA 4NAWB 2N88A 2FJ2A 4KMUC 2MEKA 4DNTB 1HA6A 5CGKA 2LEKA 3Q23A 5EPJA 3U7ZA 1I6VC 3CQZB 5EKIA 4A3BB 2WP9B 4PNYA 1WSPA 4ZHOA 3AE5B 2LMCA 1XX8A 4BA1I 1LTRD 3DEOA 2PQEA 2JWUA 3C1EA 1L5PA 1DGJA 4H13C 1MBYA 2MP1A 1OQRA 5EBDA 5HFYA 2RBMA 5E4WC 2K5DA 2NTTA 2BA1A 1C4CA 3SK8A 2QSDA 2M2LA 4C80A 2OEDA 1JICA 4IUVA 3QIAA 1H9KA 4OL7A 2NBFA 4QMGA 5EGTA 5T1IA 1NEKB 4HEA1 2Z4IA 1J7BA 1MSGA 2G9DA 4CKCA 1VZ7A 1K50A 1IHZA 5ELBA 1EM7A 2JE6I 4IDIA 2BB6A 1DYQA 3J80L 1A2UA 4ARCA 4MN3A 1RM6C 1I50B 3K58A 2SOBA 3P4RB 2AQ2B 2BOSA 3OMCA 2LFIA 4IFDG 1IW7C 2N0SB 4LK0M 1JE4A 3MTSA 5C0XH 4TMAB 5C0XI 1F2MA 4B0EA 1SYGA 1TKEA 2G9HD 4CJ0B 3Q69A 3V2TA 5DNFA 4H2AA 2H88B 3P1HA 3HRZC 4RH6A 5CV7A 3J9CA 3DWGC 2IDYA 3Q8AA 1DOLA 3VYSA 1B9MA 3KQ4A 4Q2JA 1NI3A 3WOFA 3B9JA 1L4DB 2IX0A 2FHTA 4RCOA 4DXGA 3JAME 3E0JA 5FO8B 2JZPA 3W5UB 4Q0FA 1GB1A 5IOCA 1EU4A 3OSOA 3ONAB 4ZRZA 2F0MA 3I4MB 1QF6A 3T53B 3W3AA 5HGTA 1S5DD 1K8OA 2PMZB 3PO0A 3S2DB 2WXJA 5BN4A 3D8GA 1Q3LA 5EE3A 2XRSD 1C4AA 2OT2A 2ACZB 1F2ZA 4P2CB 1QILA 3PV0A 3DUZA 4ID6A 1L4ZB 2L11A 1RYJA 5ELDA 1EIGA 1RF2D 3VR2A 3OWFA 1BCPC 1J9OA 1RTOA 4REZA 3S1NB 2JSVX 3DHQA 4JWUC 3MP9A 4K6LA 1UWXA 4NP5A 1YN5A 4MIUA 1BCPF 1TWAB 2Q5WD 2CHBD 4AQ7A 4RWSC 4XQJA 3LWUA 3U9SA 4GZYC 3MHZA 2J42A 1BCPD 5FKAC 2FINB 3BIID 3FRPB 1NYQA 3KBXA 1H9SA 1RD9D 4A3IB 1MVKA 1PMRA 1B9RA 4KKTA 5BN5A 1PYWD 1R4QB 5LL6S 3SDZA 4JBWA 4C7ZA 3M3YB 5BN3A 3VRAB 5EE9A 5JOBA 1SIJA 1MI0A 1ET9A 3A54A 4FP5D 1JWUD 1R9TB 1ENCA 2BTEA 1V8CA 4C3IG 5HURA 5IGGA 5CR3A 2IGDA 1EEID 1SB3C 4OVZA 3DWMA 4HEDA 1G91A 1QNKA 1SYDA 1DD2A 3PO2B 1PGBA 2VZKD 2B2WA 2NN6H 2K04A 3RD4A 2RMMA 2Z8LA 2WB1B 1KTKA 3IXSA 3S14B 2ZXOA 4IUPA 4U673 3QJYA 4N6EB 4YSXB 1SYEA 1RCVD 3TEXA 3LX0A 3AEEB 3PUYA 1R4PB 4IOIE 2PLPA 2LY7A 2A6EC 4A3EB 3S15B 1KF6B 3GD7A 1EYAA 3KK7A 4WRDA 1STBA 4G7ZC 1XCQL 1EOTA 4RAUC 2BB5A 1H9RA 2ICIA 2JEBI 4BS9A 2IGGA 4P16A 5KEEA 1CA5A 3AEGB 1TWCB 5J1ZA 3I57A 1CA6A 1VF5C 3SHLA 3AEAB 2EYMA 2W3RA 1XEEA 2WDQB 3GQBA 3AMZA 2X38A 1C76A 2QKIC 3HG9A 2H1EA 1RKNA 1HA5A 1VDVA 3IT6B 4YT0B 2BT6A 2Q8IB 1FRDA 5BYQA 3QOLA 1G2TA 1LTID 3NS1A 4J1MA 3J81E 2KEEA 4N58A 1B44D 4K5XA 5EBCA 2BS2B 1RTNA 2L4NA 3VRBB 4CJ2C 2WQYB 2JP1A 2MH7A 2M0AA 1XF5L 4KKIA 1TKGA 3H09A 1SNOA 2IW3A 4OW0A 1WTQA 5KYLA 1EZ6A 2D2CC 2KHSA 1NVID 3OPOA 2NYZD 4TKOB 2K5QA 1T6BX 3D6WA 3LNNA 5C5MA 1F2LA 3AE1B 3BG3A 2F0UA 3QG1A 3RUZA 3KLRA 5JEAJ 1HZ5A 4RFBA 1TS3A 2EZVA 1K51A 5M3FB 3CKIB 5JEAH 1L0XB 2XVSA 1JMLA 1BR9A 2IJ0A 3BVZA 2EYOA 1XYIA 1EFID 5LHY1 3MC0B 2CW0C 4B08A 2M9VA 5AFWA 1D5XC 1WVLA 3RLFA 5M3MB 1QQRA 2LKVA 3CIRB 1N63A 1YJJA 5DM73 3AEBB 1EYCA 1SNPA 3SFDB 4KTAA 1FM0D 1F9PA 1LTSD 4UDUC 3GTOB 5M5YB 2BBCA 3TEZA 1L6UA 3SR1A 1B3AA 4LJZC 3TP7A 2JA8B 3RZOB 2CJOA 2WDRB 2B2YA 2RDFA 3I8ZA 5C3WA 2F4IA 1QCBD 2B39A 4XXEA 3U9OA 3HGBA 1EY6A 2CQAA 4YSYB 2WU5B 2J52A 2A6ED 2EE1A 1VLBA 3B2FA 5K36G 2MUYA 4RGNA 5F2DA 4OIJA 1BOSA 2EKIA 3VR8B 4FF1A 3AE8B 3CRKC 4WAFA 2JX5A 2JYOA 2K7VA 3L4PA 3HOXB 1QOFA 1P7FA 1Z7TA 3PUVA 3MXUA 4HCEA 1IW7D 2MHVA 3NP8A 1YJIA 2I46A 2AWOA 5EKKA 5DM63 3D3RA 2HDMA 2F0HA 3URYA 1HHVA 1BMLC 1SEBD 1ZKOA 4XE0A 1J7CA 2FMCA 4KV6A 2K0PA 1STGA 1OXTA 2OEOA 1Y1WB 4R3DA 2INNE 2B2WC 1JC7A 4NZLB 1S5BD 5C4XB 2WXLA 5BYRA 2JQRB 1KLGD 4KGSA 1RWSA 2ICEC 4EE2A 2PTLA 1TWFB 2B2YC 1S5CD 2K1BA 2MJ3A 2EELA 4LK1C 1HTPA 4J8QA 3NE5B 4KGRA 1U4LA 4C56C 1CZGA 1H9SB 5EPLA 1FFUA 5FOBB 1FXIA 3DWQA 1II3A 4RKBA 4F88A 4FXDA 5FO9B 3NRZA 1FGBD 2BYTA 1TS2A 1CQFA 4RHSA 3ZJUA 1H9MA 2E76C 2NZ1D 2WLBA 1DOYA 1DXMA 4MH8A 4K5VA 1TKWB 4DGZA 4YWGG 4DK1A 1FIQA 1D4BA 1EY9A 1PZJD 3MEHA 1SNMA 1CK1A 1I4HA 1HEZE 3D4WA 3KBGA 1SNCA 2K33A 2O5JC 1Q90A 4KI0A 5D65A 1LTGD 5C4ZA 2LFNA 2NVYB 3EJIA 1C78A 3AB5A 1QLBB 3MA2B 1KDCA 5EQ0A 2RPVA 2F0WA 2KQ3A 2QJLA 3T3NA 2K3UA 4HAEA 4OZBA 3I91A 3Q24A 1STYA 2Q8RE 1N60A 3MXPA 2L1AA 2MJ8A 5K36H 1BDOA 3OHXC 2KJXA 1PGAA 1WWTA 1O80A 1Y8OB 3MWYW 1KH0A 1EZ8A 4FF4A 2F0NA 2O4XA 2XNAC 1KNAA 2BS3B 4KHZA 2QEJC 2XWBB 5CV8A 4G7HC 1LTTD 4E6IA 4ZOHC 1CM9A 2FBWB 3OOCA 4LTUA 3VR3A 1SYFA 4KGTA 3VYRA 2EY2A 2LGIA 4QUCA 3V96A 3C1FA 3EQLC 5JJZA 3T56B 4KD3A 1IYVA 3HZXA 1STHA 1JQ4A 4X3SA 2IX3A 4NKLA 2PZUA 1PTOH 1HQRD 1HXYD 2KVMA 2F0TA 1E0BA 3FMCA 4ZRPA 1PRTB 3IAM1 1YNJC 2OF1A 3MZ5A 4US9A 2L32A 5KRUA 2HCIA 2KCCA 3J7AV 2BS4B 2D62A 4L1BA 5LNK1 1IL8A 3NPPA 5I4DA 2WKCA 4C3HG 2GI9A 3AEFB 3DMUA 3GV6A 4WQMA 1ESRA 1PZID 1SXTA 4AS1A 3PZ7A 1D1KA 1N61A 4KD4A 2R3ZA 3ZYYX 3PO3B 3TSSA 1DM0B 1AZPA 3GV3A 1FNWA 4J6HA 4MT5A 3HOYB 1VJKA 1N62A 4FXGC 1SF0A