1FNUA

Structure of streptococcal pyrogenic exotoxin a
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
221
structure length
221
Chain Sequence
b'QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYTIDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDNKTSQIEVYLTTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOTOXIN TYPE A PRECURSOR (ALLELE 1)
publication title Structure of streptococcal pyrogenic exotoxin A reveals a novel metal cluster.
pubmed rcsb
molecule tags Toxin
total genus 59
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fnuA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fnuA02
3BVGA 1PTOF 1LTRD 4C56C 4TSSA 4L63B 2XRSD 3BYYB 1FNUA 5D3DA 1YN4A 4RGMA 4O1NA 3MFGA 2WV6D 1JCKB 1PRTC 1B44D 1RCVD 1S5CD 2RDGA 1STEA 3URYA 1UUPA 4RGOS 1LO5D 1TY2A 4RGTA 1FNWA 1T5XD 3W2DA 1EWCA 1CHPD 1HXYD 2NTSA 1TS3A 4RCOA 1I4XA 1EU4A 4RGNA 1HA5A 1SXTA 1CQVA 3OWEB 1FD7D 1LTID 5FK9C 1FNVA 4BWGB 1TS4A 1D6EC 2IPKD 1SJHD 1L0YB 4DXGA 1SE3A 1F77A 1TY0A 2CHBD 1DYQA 2O2LD 3DWAA 4RFBA 4RHRA 1TS5A 3GP7A 1V1OA 2TSSA 3CHBD 1EFID 2XN9C 1PRTF 1I4RA 1V1PB 1KTKA 1LLRD 1LTAD 1S5DD 2QILA 1AN8A 1EEID 3EFXD 1LTGD 1I4QA 1PYWD 1D5XC 1ENFA 1LTTD 3BYTB 5ELCA 1S5ED 3R8BA 2AQ1B 2AQ2B 1LTBD 1PZJD 1QILA 1V1PA 1TS2A 1YN3A 1JR0D 1EEFD 5TSSA 3V05A 5FKAC 3O13A 4DXFA 2XNAC 4Z9CB 1BCPD 4UDUC 1LT6D 1BXTA 2XRQD 3TSSA 4NZLB 1MD2D 4OHJA 1KLGD 5ELBA 4RHSA 1PTOB 1PTOH 1JWMD 3BVMA 1PTOD 1LT3D 4K6LA 1JWUD 1PZID 1CHQD 1JQYD 1I4PA 3BZDB 3R2TA 5I4DA 1BCPC 1LTSD 3MC0B 1HQRD 1ET6A 4L6TB 1CT1D 1B1ZA 1XXGA 1SBBB 3DWQA 3EA6A 1XTCD 1PTOC 2NTTA 1RDPD 1YN5A 1D5MC 2R61A 1SJED 1RF2D 1RD9D 2RDHA 5ELEA 1HTLD 5ELFA 3SEBA 1D5ZC 1ESFA 1LT4D 5ELDA 1SE4A 2SEBD 1DJRD 1FGBD 1BCPB 1JWSD 4RH6A 1LT5D 2Z8LA 1G8ZD 1S5FD 2QEJC 3R2IA 1L0XB 1SE2A 3DWPA 1S5BD 2ICIA 2J4XA 1KLUD 2IJ0A 3BVZA 1GOZA 4ZYSA 1SEBD 2G9HD 1AW7A 2AQ3B 1M4VA 3KLSX 1UNSA 1EU3A 1PZKD 1I4GA 1PRTB 1BCPF 1I4HA 1PRTD 5D3IB 1CK1A 1ET9A
chains in the Genus database with same CATH superfamily
1TIFA 4NAWA 4N6EB 2R7ZG 1VQDA 4CQNA 2F0TA 1WI0A 3J81j 3QOJA 3S17B 3NBHB 2EJMA 1DGSA 2KDIA 4A3GH 4A90A 4DV6L 3ZJTA 3G6EA 5I6WA 3ZNHB 3A54A 4KKUA 3DBLB 2QW7A 4BBRB 2K8CA 4I65A 5D14A 1O7LA 1J7AA 2KT7A 1A3UA 3NTKA 3OWFA 3VR5A 1HNZQ 1QVGA 4J3OD 1TWAH 3MVVA 3RULA 2PCFB 2E75C 2YEPF 3OW2A 3HM3A 4NPSA 2F52A 2KVZA 1V43A 4BY1B 2N7EA 3S15B 2WLBA 1C7YA 4QUCA 4KV2A 3VH4B 4IJHA 3CCRA 1U5KA 3OWEB 1HZ5A 4W9EA 1PDXA 3ZDTA 2W54A 4PYUA 3NZSA 5H92C 1P0RA 2CS4A 4ALPA 3CQZH 4NXNL 4DXGA 3GTJH 3Q8CA 3JAMi 2BA1A 5D7GA 2VB3X 1OXVA 3WIMA 2F4IA 3NG0A 1GM5A 4BBSH 4ZKBB 1KDAA 2OWOA 2QA4A 2O6VD 4DUZL 3KLWA 1YOVB 4LF4Q 2VUMB 3UDFA 5C0XI 1YNXA 3A8JE 4DV0Q 1N32L 3VR3A 2VZKD 1HNWL 5JHAA 4ZRQA 3E0JA 2KUMA 1Q1OA 3A5ZB 2KANA 3H7PB 2LS01 4GS3A 3D6WA 1E1OA 5FJ8H 3RFZB 1NR4A 2R92B 3AEAB 1PYBA 3A0JA 1QWYA 4XYOA 1K8MA 2JQOA 1WX8A 4K5XA 4C3IH 2OXPA 4L5QA 1I4QA 2R93G 4DR2Q 5IP4D 4LFBQ 3BYTB 3J7ZC 1EUVB 5HG2A 5BR8L 2AQ1B 4KI0A 3TP8A 1M8AA 2MLBA 5EKKA 3ZNID 1XMOQ 1A6XA 3I2ZA 1FEHA 1DD2A 2C7NB 5JJLA 1STYA 1EIHA 4IUNA 1HZCA 3H0GH 4ARIA 3OOCA 3HKZB 1SIJA 2RSUA 3PHWB 1RRBA 2ZXPA 1JOKA 4DV5Q 4ZHPA 2CJNA 4W9HA 1A62A 3G48A 4J8QA 4RKBA 4C1NI 5I4DA 4B3ML 1YQBA 2AWTA 2JYEA 1TQOA 2HQEA 1QZEA 4IWQA 2N7JA 1C4PA 2LGYA 4DV4Q 3P2BA 2HTME 3SU8X 3U7ZA 1SBBB 4ABNA 2PZUA 2NBWB 1C4CA 1P1AA 3UIPB 4K2KA 3UQBA 3K0XA 4JWUC 2W82A 2KYWA 2I1JA 4B08A 2GBRA 3RLNA 3IG3A 4JIOU 4L2YA 3RI7C 2DZMA 1ICFB 4NAWB 1Q3LA 1X6OA 1B7YB 1NCVA 3H94A 3MA2B 2KQSA 5CV8A 2XK5B 1QF6A 4BY7G 4WWNA 2I5HA 2NVTH 3KUDB 2NZOA 1SNCA 4IALA 4N8X1 1GPXA 4HJ7A 2EE1A 3DVNU 4IUMB 4Q0FA 1EU3A 1YNND 1B9MA 3C1FA 3KLSA 5E1FA 3A74A 4X3UA 3S24A 1SB3C 2B3AA 2INNE 3BWUD 4LNQA 3NWSA 5C4XH 4QMGA 1W6JA 4OVVA 2I5MX 2NBFA 1L4ZB 4IM3A 3FP9A 2WIIB 2K9XA 1KL9A 2EY6A 1VQ6A 4ZRIA 3WDNA 5DLQE 1NUCA 3F2CA 1SDFA 4HEDA 4B9WA 4RGMA 1IBMQ 1YIWA 2JA5G 3M85A 1B44D 4GZYC 2WYQA 4KK7A 3PTFC 5IKCM 1C1YB 2N3SA 1I7HA 3BZKA 2B63G 1V5OA 2MJDA 3HOXB 1T0YA 1XCTL 3RMHA 1WTXA 4R8IA 4A3JH 2K1FA 1VQEA 4C3IG 3CCQA 4RGNA 4DR4L 1YX5B 1SXTA 3L13A 4GGQA 3HVZA 5BMIA 1CQVA 3F8TA 4IC7B 2OCEA 4JOIC 4URKA 3SVMA 2VNUD 3M4QA 1XPUA 1SE3A 1RIPA 4DDGD 1HH2P 3K7AB 2NN6G 2B76B 1JICA 1H9KA 3K59A 3L10B 4V0BA 4FJYA 1TU2B 2EVBA 1LUZA 1IW7C 1K8GA 3L16A 1WXSA 5CBEE 4LLGM 3P75A 2K5QA 1A63A 2L1AA 2BYTA 1V2YA 4IFDI 4O42A 2Q2UA 5FLXc 3M62B 3QJYA 2Y0SB 5A2QL 4PT5A 2GBKA 4YSXB 1JB3A 3QWZB 1XPOA 2ICEC 2NVUI 4DAYA 4C3HH 1YI2A 2GBMA 1RLFA 2J7ZA 3NUHB 3VUWA 3NJTA 1PZJD 4DUYQ 4V190 3LGJA 4YWKA 4A3EH 3I56A 1SAPA 1EEFD 4QIWB 4IURA 1VQIA 1XNQL 3O13A 3ITPA 1JOOA 4KHPQ 1PQSA 3ZQ4A 4XXEA 1Q7YC 1LT6D 1BXTA 3BZCA 4A3KH 4YSZB 1VQNA 1SR3A 3HRZC 2IX1A 2LJ5A 3IHPC 3IXSA 4XX5A 1G6PA 1QT9A 2QCPX 4IWPA 2MJ8A 3ND9A 1YJ9A 2FMMA 1R4MB 4WJNA 5C3WA 4YIJA 2AX5A 1GC6A 4JI4Q 3AU5A 3CPFA 4C7YA 1DOXA 1WE7A 1VQJA 1O7ZA 4PZ7A 4HJKA 2EELA 3DMUA 5C4XG 3KLRA 2BWFA 2JA7B 1XTCD 1PGXA 2KTRA 2N9PC 5LXIB 4NXML 1JOQA 1SJED 3H15A 4F8CB 4KN4C 3A7LA 4B0MA 1EYCA 2X8XX 3NY5A 2K6DB 2RHQB 1KQSA 2LRUA 4IO9A 2EKEC 1CZWA 1QNUA 2QDBA 4H44C 3CP0A 2CCZA 2KC2A 1N61A 3KK7A 3F1ZA 2M00A 4C1NK 4KJOA 3HOWG 2KX0A 2ICIA 3GTOB 1Q12A 1WJNA 3Q8EA 1GOZA 2DYBA 5C23A 1NMGA 2G9HD 3AN1A 2K5PA 3STBC 2IY5B 3HOUH 4JYAL 1EIFA 2FJ2A 5KRUA 4DNRB 3BIID 1EFWA 4LF6L 1P3QU 3OJ4B 3P7JA 2K50A 1HHVA 4LMQD 1TT2A 2MUYA 4A3LH 4L1BA 3K57A 1IHZA 4JI8Q 1WGRA 2V4IB 4A3OA 2QDLA 4DV2L 3GS2A 4B3SQ 1MG8A 1TWGB 4C56C 3DWMA 2Q5WD 4JPSA 3ULLA 1SYFA 3S17H 2JU6X 2L8JA 3IFDA 4REZA 1QZHA 3NBIA 3G71A 4M00A 1TZOA 3F2BA 1HR0L 4ME5A 4BBRH 1AZPA 2WXKA 1KAWA 4HPLB 2D5GA 1EY6A 1AEXA 4K6DA 2DWQA 3ZJVA 3HOVG 1HEZE 4DA2A 2JK8A 4CDEC 1FNWA 3CXCA 2OOBB 1HXYD 2B2WC 2OQKA 4BY1H 3S15H 4RCOA 3N32A 3VRBB 1V9JA 2MEKA 1IL2A 4GN5A 5JJIA 2ZPNA 2A6HD 2OQ0A 2ZJQA 4L5RC 4LNOA 4XDCA 1HZ6A 4OONA 2EYHA 4S17A 3DBHB 1D1KA 5BYSA 3PQIA 4D2KA 1O7YA 1HUMA 1C48A 1AE2A 4JI3L 1EYGA 4DAYB 1H9RA 1XTDA 4RHRA 2I38A 2WU2B 4LNIA 3U2SC 1NTGA 5IYBH 2AMCB 4JWSC 1STHA 3K0YA 1I4RA 4A3FB 1QZGA 1EWHA 3G7LA 2I46A 2KK8A 3D8GA 4IDIA 3HUIA 3DCGA 2WWZA 1CQFA 4X64Q 4ANVA 3QG1A 4XQNA 4DAPA 3AMZA 4H7BA 2LXCA 2LWPA 4L5SA 1PFMA 2B2WA 1GUOA 3SFDB 4FVMA 4EGVA 2LXJA 3AFQA 4KMUC 2CR5A 2LMCA 4CDCC 3ZVVA 1PHJA 4HK2A 2LFIA 3UDIA 4I7AA 3L0OA 4J6HA 1JR0D 2R7ZB 3C0RB 1OXXK 2VRRB 4X62Q 1Z7TA 4M01A 4BBNC 3IRBA 4Z9CB 4R4CA 1NEKB 4ZAIA 2KTRB 1SN8A 2K8BA 3LNNA 2L52A 3NENA 2JEBI 2LRWA 1STGA 4FHJA 4B3RQ 4LK1C 2EY2A 3OYYA 4HLEA 3T56B 1JWMD 4QY7A 1V80A 2L00B 2CVRA 3GTKB 3CCUA 2CKZB 4I6LB 1Q1BA 2BE5C 3HOUG 4BFRA 1NMFA 2C5CA 3SHQA 1LTSD 1I94Q 1WE6A 4EQNA 1ML0D 2RPQA 3KVFB 1B1ZA 1CUKA 2G3QB 2NTTA 5A2QE 2M4NA 2R61A 1WTRA 5CC4A 4LF5L 3PRZA 5EBCA 3V61A 1RF2D 1SE8A 3NVWA 3RNFC 2CHWA 4CJ2C 2BW2A 1D5ZC 2FE8A 1GKHA 4JK1C 2K1BA 1DJRD 1XT9B 1Q1EA 3B08A 2BVCA 4ANXA 1S5FD 5GMVA 3VUYA 1PGAA 1I42A 2N8NA 3CAMA 2VQFQ 2ZM6Q 1SEBD 3SD5A 1OO9B 1AW7A 2DNCA 4JI7Q 1Q5WB 3CIRB 3RT3B 4CHKA 1KC8C 2PJHA 1UNSA 3ZW3A 3NRZA 5K36H 3R7RA 1A15A 3ZTCA 1YVCA 2UUBL 3I72A 4K8JA 3ZRFA 3H6NA 4AQYL 4GN4B 4K7WA 3L3OC 4XQJA 2K39A 4PNYA 4JV5Q 1CJEA 4MH8A 4MSMB 3W5VB 1JMLA 4KKSA 3MFGA 2Q2IA 2WXPA 1EIGA 3TBIB 2LI5A 1LQBA 3CMEA 3K9OB 1MJCA 5AUIA 1WIAA 2IBIB 3HOXH 1K8RB 2J52A 4FO2A 2HDLA 2K6AA 2LKVA 4KY5A 2MGSA 4R4QA 3W1GA 2NTSA 4DR6Q 2PNHA 3CMMB 2PQAA 2Z6KC 3PPAA 4IQZA 3ZGZA 1QKZA 2K33A 2ZTDA 3UDXA 1NVID 1SYEA 3N6RA 2B29A 3ZKJC 1G6ZA 3NP8A 1OXUA 5J39A 2V9HA 2WXIA 4XC2A 2O2LD 4GKJL 1JC7A 2SNSA 3K7UC 2PPBC 1LTLA 1E7VA 3OG5A 2LMCB 1CZPA 4RWSC 2QSDA 3JAMc 3KBGA 4JI2Q 2DENB 3ABVB 3AV8A 4PS8A 3HKZG 3H9DA 1IBKL 1SE9A 1VLBA 4BY7B 4B9XA 4X65L 2EYOA 2PMZB 1LTAD 5CV6A 5FOBB 1DZ1A 1TZ1A 3VTWA 3IBEA 3TREA 1WYWB 2KDFB 2JPHA 2FIDA 1ZXHA 2Z6KA 3JVZX 3PMFA 3TEZA 3HM6X 1WTHA 1BNZA 3CQZB 3GTJB 2IDYA 3VA7A 1V1PA 1F1HA 2VY3A 4KD3A 3UDGA 3S1MB 1FRDA 3MXUA 3RN9C 5FKAC 1J8CA 2UXDQ 2GVBA 2GA4B 4YWMA 4K7UA 1BO0A 3HZXA 4UDUC 2KCMA 5DPWA 3Q3MC 3TSSA 5C4HA 2GBJA 2AWOA 2JA5B 1K0SA 2E76C 3PSIA 2JY6A 2ONQA 2BF8B 1FD6A 5C3XA 1VS0A 4ZKCB 2B63B 3Q8DA 4JE3B 3OHXC 1SYGA 3N20C 1BCPC 2D2QA 2N9KA 5GAEC 4A3MH 4I6NB 3QA8A 4LF7L 4LFAQ 3SK4A 3PUWA 1WF9A 1F9SA 4BKGA 2JA7H 3WAMA 2KCCA 1D5MC 3V6CB 5JVH3 2YYZA 4R4OA 1Z9FA 1S40A 2Y5CA 4UY8C 1CKMA 4XIGS 3S14B 1VRAB 3A4RA 4LF4L 2SEBD 2IHFA 2XSCA 5FR3A 4A4IA 4OO1H 4F1SA 5JJKA 1D4BA 1LT5D 1NI3A 3CF5A 3K8AA 2MP2A 5IT9L 1S3OA 1S5BD 3Q23A 4B6WA 3GTOH 4M8AA 3Q3JA 4FF1A 3HOXG 3K81C 1WXMA 2KACA 4P1BC 1EQVA 2A73B 3M9BA 1P9DU 3P20A 1M4VA 4DR2L 2KWUB 3J80L 4GB9A 4NKLA 5IE8A 2ZT9C 1BVSA 3SK5A 1DOKA 2R6GA 1BMLC 1XMQQ 3H09A 3CC7A 5HHDG 1F2RC 2I0QA 2XWJB 2PQAB 3ULJA 2ASQA 2J0JA 1XPRA 1UGJA 2PTLA 5IYCG 1FNUA 2BT6A 4DBGA 3OW7A 3ZRCA 2X6LA 4DV3Q 4ZOHC 1FFUA 3OMCA 1U4AA 3LWUA 1CKOA 1I6VC 3I70A 3T9LA 1T5EA 2NVYB 1UUPA 3SGIA 1E90A 1UE1A 2PW9A 3TEYA 3VYUA 3W2DA 3J7AF 1TTNA 5LL6X 3X23A 5GXGB 2G45B 1HR0W 1SLJA 1IKLA 1FD7D 2D3CA 1KABA 3HG9A 4XDXA 1FO4A 5JEAG 1WD0A 3L9AX 5C4XB 1EF1A 4CJ1B 2CHBD 4US9A 2E5LQ 1WZ0A 3ENEA 2BGFA 1T9HA 4DQOC 1TKWB 3KF6A 4RFBA 3U30A 2IHEA 4HPMB 4EFOA 1EY7A 1QQRA 1SMYD 2IYDB 3TJPA 2NBVB 1WYDA 3HOYG 2G1EA 4ZYNA 5E4WC 5D6JB 1V1PB 3E6ZX 4A3FH 4KZ0A 1VQPA 2BBCA 2M17A 3EIVA 1X3QA 3HOWB 4NJ6A 2IO3B 1K28A 3QIAA 1GJXA 1F52A 3KWVA 4LWCA 4A3MG 4YHHL 1EEID 4R3DA 4X57B 1K9MC 1PYWD 1X65A 3CCMA 1FIQA 4FHKA 4BZAA 3RZWC 1IPGA 5ELCA 1HTPA 1S5ED 4LUZA 3ERSX 4RKLA 2JA7G 1VQOA 4G7HC 1F2YA 2XBBC 4GDKA 2K6QA 1E8XA 4Q5VA 5A35A 1CZGA 3PV0A 1QG7A 1IBML 2R7ZH 3P63A 4M8MA 5HY6A 3V05A 2G9DA 1Q86C 2LVOA 4OO1G 2QDFA 2WXGA 4POFA 4DR5L 4II3B 1RHPA 1TKEA 2HT1A 2F0SA 2FCSA 4G50A 3OIPA 3FAHA 5EE9A 4ZCKA 5MPOA 5C44G 1XYIA 3UGBB 1CHQD 4XQQA 3QARA 4GDLA 3EFCA 2KEDA 3HOVB 1D7QA 1WJUA 2HDEA 3RPFC 3TZUA 4UP9A 4W9KA 4LFCQ 2MP2B 1R9TH 2C9WB 3WOFA 2O6VA 4OELB 1XXGA 3Q2AC 1NENB 3ZUNA 1HNXL 1DCZA 4JC0A 1G2SA 2XEWA 2L83A 2AL3A 1CSPA 4G7OC 1J7CA 4ICUA 5KHQA 1LT4D 4IFDG 3QC8B 5IYDG 1FGBD 5T1GA 1BCPB 1DXMA 4HJAA 1C4AA 1CA5A 3R3MA 2HCCA 3R2IA 1TGZB 2Y5BB 2NZHA 1JJCB 3DEPA 1BQQT 2WACA 1EY4A 3BY4B 2JXTA 1QE6A 2UXCL 1YJ1A 1LFDA 3NQIA 3I3CA 2F0IA 4WRDA 5M3FG 3C1EA 3BDCA 3PS6A 2DX5B 1TYGB 4LUOA 3KUCB 2C35B 1OEYA 4JBMA 1YZ6A 1SSOA 1YNTE 1PH5A 4RM8A 2KQ7A 5E3FA 1QOBA 2WX0A 2ZVNA 1Q46A 2K03A 2D9UA 3H91A 3BVGA 2AHOB 2F3IA 2PW7A 4LJPB 2XVSA 1D2BA 3S2DH 1UELA 2BWES 1L1OC 1YNNC 3CCJA 1WR6E 2HTHA 2JA9A 3QIJA 1S5CD 4RM9A 5AJ3L 5LMNQ 1KF6B 1MSHA 3AULA 2RDGA 3VR4A 3Q24A 4J15A 3EC8A 2UU9Q 4JI4L 5C4JB 1Y1WB 4HCNB 4HWIB 2PIAA 4GLSC 5D94A 2V3PA 3QB3A 2AL6A 5CYUA 5IT9E 4MGKE 3HOUB 1JORA 1HZBA 5J2RA 5AZHA 2XTIA 3TBLD 2R7FA 1P7FA 4OW0A 3H3VI 1K3BC 3AI5A 3J80E 3FDTA 1Y8PB 2ZJPA 2A4ZA 1P8LA 3DHGC 4S0RA 2VQEL 2UXBL 2HCIA 1CKNB 3ONAB 2XK5A 3I57A 3HS0C 3I90A 5CMDA 3ICEA 3M95A 2F0PA 4KVGB 2A8VA 2HUGA 2K28A 2KHIA 2TSSA 5KNCA 1L1OA 4GDKB 4GU2A 1JMCA 3NUCA 4KSKC 1RWSA 3KJPA 4GKKL 4FN2A 1NNXA 2D2CC 5IWAQ 5AZFA 2FFKB 4BY7H 3UI3A 4HIKA 4DR1Q 1ILPA 2KMCA 1KAAA 2IX3A 4DGZA 4A3DG 4C4VA 2EDGA 1GO3E 3Q3NC 2K22A 1AE3A 2LJIA 2D62A 1R4NB 2ZNVB 4GDLB 3JW0X 1ZEQX 4IN3A 4HVBA 2L76A 2UUCQ 3VYSA 4QL5A 1ZPSA 2N1WA 3S1MH 3KF8A 5TSSA 3BK1A 5JZEB 2MH7A 4LNKA 3A55A 3AE5B 3HEJA 2MWSB 2O6VB 2ZCBA 1J5EQ 4MGIE 4MTNA 3LDZE 5CV5A 2JA5H 1P7EA 4RHSA 2O2VA 2VZKB 2OF1A 4H13C 4RA8A 1N36Q 1VR9A 1Y56A 1JQYD 2LUEA 2B63H 3GOEA 3WAOA 2IO2B 5T8IA 3I63C 1E8YA 1JWBD 3I9V1 4OZAA 4K0KQ 3QCAA 4AQ7A 4NQLB 3RNGC 3GTQB 1OXSC 4L6TB 1CT1D 1WM2A 4G7ZC 4OIKA 3DHIC 4YTNB 4UP8A 2F0MA 2IT1A 3K5MA 3Q8FA 1TIID 3VFKA 3EBEA 3X3MA 3S14H 5C3JB 2L7RA 2CWPA 1FVIA 2NN6H 1PVOA 3A1QA 3OIQA 1A8VA 2DN8A 2QEXA 4BBNF 3A56A 1RTOA 2FCNA 4FLHA 4BS9A 4X64L 2CQOA 4IPGA 2KMMA 3BVZA 1KLUD 5K5PA 5M3MG 1S1QB 5JPNC 2EYMA 4XTCS 4LJOB 1ZYRD 2JEAI 3CPWA 2IW3A 3KLSX 4E71A 4DPGA 1VZ6A 1XCQL 2NWGA 4K3CA 1WTOA 2WDQB 4FP5D 1VQ9A 1OTRB 3A4SC 4BKSD 1I4HA 5IGFA 5IY0A 2Z0DB 1QVCA 4MH0E 4K14A 1YHBA 5JH5C 2AUKA 2A69D 2L15A 1N6ZA 4OVUA 3P42A 1V6EA 2CW0C 4TSSA 4A3IG 2LGSA 2PPHA 5CHFA 3BYYB 4X3TA 1WVLA 1RTNA 2WAQE 3C2PA 1GJZA 2JRHA 1RM6C 2GVAA 2HHHQ 3CCVA 1YX6B 2NVYH 1IYFA 3M3JA 1E10A 4RGTA 4WJPA 1VMCA 3HHMA 1CHPD 4KKJA 1MJEA 4FDBA 1NYQA 5J18A 3J80i 2H4OA 2WP9B 1L1OB 5EKLA 2B2VC 4HXDA 1PUTA 3T1YQ 1WXAA 4WIPA 3IL8A 1HTOA 4N9F4 3NZUA 3M7NA 4EQOA 3TEHB 3ML9A 1WJJA 1Y69U 3VR6A 4DR3Q 4C4VB 3PLVA 3WAPA 2A74C 4NDXA 3TS0A 2QCZA 3DWAA 1VZ8A 2RSOA 3VHTC 2LFNA 1M94A 2K3UA 3VDZA 1MPEA 2O5JC 3NXWA 2NVQB 4JI7L 1VQFA 3KF8B 3HOWH 1H9MA 4NMZA 4W9CA 1RL2A 2DUDA 2D0OA 3U4VA 1KJTA 3AM9A 3T3OA 4ZUIA 1R4MI 2BS4B 2O2VB 4O0AA 1YHAA 2PZWA 3VR8B 2C7HA 1JWAD 3R93A 2B2VA 3GE8C 4JV5L 2WXJA 1STNA 4JI5L 4HJ8A 4XE0A 1C9FA 1WXQA 2XNAC 1Z47A 1Y8RC 2K7VA 1UD7A 2EYPA 4QQBX 1WRDB 3W3AA 5EE1A 1J19A 2MW5A 5ELBA 3M4PA 1WGKA 4DR6L 1SROA 5AZGA 2EXDA 1EF5A 4K6LA 1WM3A 3A1QB 4KY7A 2R3ZA 4DK3C 2BYVE 3HOVH 1ZE3D 1UWXA 4ZK9B 5BMGA 3U50C 4A3PA 4BVUC 2Z1CA 1PMRA 1IGDA 4K3BA 4JI6L 2Q2TA 1RDPD 1YN5A 2KBNA 4MJSA 4MNOA 2JA8G 3HFZB 1Q10A 1HTLD 5L37A 3ETRA 3GTMH 3OTOQ 2DZKA 2IGDA 1VQ8A 5D2MB 3NPPA 3J81L 3AE8B 4JI2L 1TT5B 4NJ7A 4H02A 3K5OA 1EM7A 3HVDA 1B3QA 2MCNB 3HOYB 2YVCA 2UUAL 5LHY1 2OTJA 3Q3OC 2F0GA 2K75A 4FYDA 2C5LC 1R4QB 3RN5A 3BJUA 3FRPB 2QJLA 1C79A 1IXRA 2N55A 1ASZA 2AQ3B 4J6IA 4XWTA 5BN4A 3MTNB 4HCPB 4K81A 1E0BA 1E8ZA 4KGSA 4A3MB 2MNAA 1BCPF 4DAMA 3VRAB 4CKEA 5L95C 1GVPA 4DN4M 2LGDA 1UWMA 3QHTA 2EY5A 1N5XA 3D0FA 3E3XA 1WSPA 4HDQA 1UBQA 4FULA 4K5WA 1VQAA 1IBLQ 3GTLH 3DBHI 2LGIA 4R8NA 4QGUA 4O1NA 4HKZE 1O7IA 1FCCC 3HRDD 3AEFB 3GTGB 3S1RH 3R7QA 3DVGY 2RKSA 2YTXA 3QAQA 2OT2A 5I9OA 1MJDA 5C4JH 4PG3A 1LO5D 5C44B 1Y1WH 2JUOA 5E7NA 3B0AA 4TQ0A 4KJNA 5FLMG 2WDVB 2F0OA 1E2ZA 3T4AC 5DM63 4DDID 1EU4A 2XGTA 1RODA 3VYTA 4Q2JA 2NYZD 4CBVA 4JI0L 1AARA 5FK9C 1FNVA 1TXYA 4DR7Q 1KRSA 4A3BB 1N63A 2RMMA 2EY1A 3L17A 3ZNGC 4A6QA 4TMAB 2I1KA 3BDOA 2KD0A 1GB1A 5LMUL 3PF5A 2INDC 2V1YA 1Q8KA 5E4XA 1YIJA 5JXVA 4HIDA 4KN7C 5CGKA 2M0AA 1B50A 3DOWA 1B8AA 3J7A5 2D11A 3PRPB 1BUVT 5C5LA 2ATWA 4YY3L 2WINB 1KXLA 4KIKA 2EIFA 3MHZA 4APVA 4EUTA 4LCDE 3PZ7A 1X3GA 4A93G 3X0WA 5M3FB 3TRZA 1WJ6A 1IZ6A 2JN4A 3ER0A 5IGCA 1U0LA 3HK0A 2VB2X 1XLOA 2KFKA 5FR6A 5IN7A 2F0WA 4YCUA 3FILA 4K7SA 2WP8J 4R4IA 3FKYA 1TS2A 4NXNQ 1QUQA 2QMTA 3PSEB 3VR9B 2KOXA 2KAJA 2GN5A 3KH0A 3CCSA 4JW0A 2BS2B 1ZKHA 1R7SA 4DUZQ 2PI2E 1WGYA 1J6QA 1NAPA 3I91A 3AE9B 3RR5A 4MJSB 3ZXRA 1PTOB 4HSVA 2MHJA 5E6NA 1HQMC 1PTOD 2M56B 4DHJD 1N32Q 4TUUA 3ZJYC 1QVFA 1I4PA 2INCC 5ELNA 3WCQA 1VQBA 1F0ZA 2MA9B 1L7YA 4HR7B 1HUNA 1MHWC 3RNAC 1YHQA 2AEHA 3GTQH 1KNAA 3P1MA 3OPOA 4ZLTF 2E3TA 2YLMA 2N0SB 2DY8A 4J1MA 1PH9A 5BR8Q 2Z4HA 1VQKA 3AEVA 2ZZPB 1OXTA 4EEWA 1L0VB 1Q82C 1ESFA 5ELDA 1SE4A 4PQXA 3P4RB 4DAVA 5M5WB 3C46A 4WFN3 4B3TQ 1UEAB 4A20A 4EZJA 4UAIA 1JT8A 2W9NA 4A76A 4KX6B 1ACCA 1Y1WG 2LVPA 4C00A 4JGHB 3TUOA 3PLUA 1ICWA 5EPKA 3T51B 2KNBA 4B3MQ 1IW7D 4A3DB 3RUIB 1PRTB 4IKGA 4LF8L 3Q0AA 1R9TB 1PRTD 1UE5A 1VDZA 4OL7A 3M4OB 3PIPA 1NJIC 1D1IA 1FJGQ 4CHTB 4LNNA 1PFBA 2MRPA 3M63B 4WJ3M 4UHVA 5JOBA 4G4KA 2XRSD 4C3JB 3NZ3A 3E9HA 5G5GA 2VH2A 2WV6D 4OEMB 1P98A 1WMHB 5J17A 2KFJA 2F03A 1WFYA 3URYA 1WOCA 4YTMB 2HDMA 3J81E 5KYIA 3VXWA 3D31A 3PO2G 4R1JA 4DHZE 2F3WA 2JZPA 1T5XD 3RUZA 2DYMA 2RGFA 3KYDD 4IJLA 1VQ5A 2D3AA 2FUHB 2BDOA 5CORA 1HE8A 4ITKA 3EFUA 3MP9A 2D10A 4KIKB 5KGUA 2CH4W 1E3PA 1N9WA 1C9OA 4TRDA 2GLSA 4M0WA 2KOLA 1WX7A 2DYOA 5C0XH 4IWOA 4KLKA 3S2DB 1K51A 3E9IA 4GMVA 2KFKB 1WH3A 3GP7A 5G3LD 3ZIMA 1B4OA 1AZQA 3FILB 2L9HA 3CHBD 2P5ZX 1FFVA 3V6EB 2A6EC 4OWWB 5FO7B 2NVQH 2EQSA 3SDLC 1QUQB 2GB1A 4DV7Q 3TL5A 4P16A 4XYCA 4AYBE 5M3MB 4G0NB 4GIVA 5IOCA 1OQQA 1EY9A 1SYDA 3VTUA 3AXCA 1GNUA 2K5WA 3MXGA 1YNJD 1B70B 3W1SC 1VCIA 4DU9A 4N9TA 1ZDVA 1UE7A 1PFNA 3S9WA 1V8CA 5C3EG 2OJWA 2J0KA 2KLGA 3STBD 2KVMA 2ZEQA 2CHZA 3T16A 4DXFA 2A68C 4A3IB 2KJRA 2EPBA 4OZBA 5IYCH 3H8HA 5J22A 2EYLA 2N88A 5KNBA 2VW9A 4HJ9A 1KLGD 2UU9L 2O5IC 5L83A 3ZJUA 2K01A 4PV1C 2B2TC 2C7MB 4MTKA 3T1HL 1Z5SB 2BPSA 3QOLA 1J0GA 3T13A 1N34L 4ACFA 4YSYB 1XD3B 3MC0B 3KYCD 5F2DA 2W3RA 5CTRC 1HQRD 2H1EA 1KHIA 2ZJDA 4G57A 2V3SA 4QUFA 3ONSA 1PFSA 2YEPB 4YWGG 3MHBA 1O80A 2JSOA 5JEAH 4PZ6A 4MT5A 1MBYA 2XIWA 4JBWA 4MHEA 3W1SA 2F0FA 1Y8OB 2E2HB 1XNQQ 1ZP0B 2K8HA 1JWSD 1V5TA 4KSLC 4QJFA 3FPPA 3BDLA 2QEJC 3QO2A 1HNZL 3DVGX 2SAKA 3Q69A 2RPVA 4FXKC 1MSGA 1YQ4B 3DHQA 3T53B 4BOZB 3HOYH 2WXOA 2FAZA 5CHWA 2CFMA 1LGRA 3V60A 2J4XA 5D65A 2IJ0A 4K5VA 3D4RA 1NBWA 4R4TA 2FMCA 3I4MH 1VZ7A 2KEEA 3SDZA 1EZ6A 2B2TA 4LJZC 1XEEA 1PV4A 2V4LA 2L0CA 4HMJA 1I4GA 1OFFA 2H88B 4YTPB 4NJCA 4LW1A 5GAHC 3MJ5A 1S4ZA 4DK6C 4RCNA 3EQLC 2EJGC 4HIMA 1E0ZA 4YCVA 3U9OA 2F0KA 5C0XG 3A7AB 2WKCA 3UINB 3FVQA 3J81i 3RZDB 3ULPA 4XT3B 5EJWA 3JSVB 2F0UA 4DV0L 2YU9B 4CJ0B 2J53A 3VVWB 3VA5A 3FPUB 3GTGH 3ALBA 4M0WB 4CO7A 5J1ZA 2CU1A 3R66C 1SYBA 3E56A 3Q3FA 3ZO5B 3KDFB 4EKUA 5C44H 3QR8A 4K0KL 2EKIA 2KN5A 4W9LA 2L5TA 1EQTA 2DGYA 2O4XA 3UE0A 5JPMC 2F0NA 3UE1A 2G4DB 3AH7A 3LB8C 1HA5A 2K05A 4YWLA 4LFBL 5TR5A 4LDTD 2V0GA 2RF4A 1LTID 3B9JA 1SJHD 4F7ZA 1L0YB 3FEWX 1BF4A 4A3BH 5IA7A 3J80c 3PO0A 1I3QB 1UWVA 1GUSA 2N9XA 4HSPA 5DEHA 2I5LX 5LL6S 1XMOL 1KNEA 2BE5D 2JA8B 2DNFA 2E6XA 3L0WB 2VXWA 2X38A 2OTLA 2JZ3B 4MM3A 1TS5A 4IFDH 2WB1E 2E2JH 5IYDH 3TDQA 1SNMA 4I6PA 2SNMA 1A2TA 1HR0Q 5DPTA 1EFID 1EWYC 3OJ3A 2KN4A 1F9QA 2BYEA 4DV5L 2X69A 4WWOA 2PNRC 3N1ZC 3N30A 3TS2A 1S5DD 3A33B 1B9NA 1JROA 4NNJB 1YBYA 5M3FH 1VQMA 2PVGC 4AJWA 1LTGD 4DV4L 2PE6B 1ENFA 3Q22A 2B8FA 2ZW1A 3NE5B 4OWXB 4DNIA 3TEWA 4NPNA 2YV5A 1E1TA 4XYQA 2OEOA 2E2IB 2JWZA 2PE9A 1QOFA 3C8YA 1QILA 3L4PA 1YN3A 3M3YH 2QIEB 3P1HA 1E7ZA 5FO8B 4Y7NB 1HFNA 1PLFA 1PYSB 4HPPA 2KDEB 4WJOA 2A5UA 3DM1A 1FXIA 2WXNA 4JI3Q 5KYLA 4NZLB 4JCVE 4FF2A 1A3VA 2AWNA 1KRTA 2RHSB 2ZNVC 2E74C 1PTOH 3I73A 4P7IA 2WKDA 4AS1A 3I4MG 2KCTA 2DZIA 1MI2A 4NAMA 2ASBA 4BXXG 1X9NA 1FXTB 1OQYA 4P74A 4CKCA 1OGWA 1QOHA 1N5WA 4DXAB 2W55A 4IPDA 1ENAA 2N9LA 1WR1A 4BKTA 1CKNA 2FXQA 1ET6A 3L7ZC 5IGEA 1TKGA 4L23A 4WJ4A 2DJGC 5BYRA 3SK8A 1I6HB 1KDCA 1P16A 3CW2C 5IOIA 2I2YA 2IGHA 2L11A 2NZ1D 1WGDA 3MAQA 4OVZA 2ALYB 2KENA 2L0TA 2DHZA 1TWHB 2Z9HA 1H4RA 3D32A 5M5WH 4PS3A 2L32A 2C9OA 4RH6A 1CA6A 1B2TA 4MEMA 5E6JA 1Z2MA 4TQUS 3PRMB 1K52A 5CV7A 1OEYJ 2RDBC 3PIP3 4RG1A 5C1ZA 2WNMA 1DM0B 1QCBD 4MN3A 3H7SA 5BN3A 2IZVB 2HJ1A 1F2RI 5M5YH 2M0XA 4N9PA 3UI2A 2LHEA 1BKBA 1EZ8A 4A3DH 4A93B 1I50B 2FBWB 1WJ4A 1V81A 4YXDB 2HJ8A 3M4OH 2JVCA 4A3BG 3S2HB 2D3BA 4FXGC 2V3NA 4F7XA 3CCEA 4QAYA 1C3TA 2PQEA 1FPYA 4X66Q 1EIYB 2WAQG 3GTMB 3WALA 2ENBA 4C3JH 2EZVA 1GUNA 1UGMA 3WANA 3DEOA 4GOPB 1CMXB 4U673 2Q2HA 1JCKB 5EKIA 3JAME 5J3BA 3DWGC 1ILQA 4B0EA 2KWVB 4FBJB 2WDTB 3K80C 1STEA 1Y14B 4M1UB 3DBLI 4ZRPA 1SFOH 1YQ3B 1CSQA 4OWTB 4XZ4A 4MM3B 2MHVA 1EWCA 1EO6A 4W9GA 4AP4C 4AIMA 3VDYA 2BYFA 3W1BA 2KO3A 3CSFA 4RMFA 4MSQB 2RA4A 2RQXA 4DUYL 4OX9Q 2N9EB 3CWIA 4YL8A 3QX1A 2UUBQ 1STBA 1C77A 1Q0WB 1DOIA 2WDRB 4AQYQ 5EQ0A 4LNFA 2MQJA 4IPHA 4KHPL 1FYCA 3MTSA 4NB3A 3GTLB 4A75A 3CCLA 3CC2A 1A70A 1UH6A 4AJYB 4XWWA 1OTCA 2F0QA 3BK2A 1SRUA 1WTPA 3HOZG 2AUJD 3K9PB 2LVQA 5C0XJ 3J7AV 4BKSA 1VQLA 4EX5A 3S1RB 3S16B 3EJIA 3MXPA 3I4NG 2BS3B 2DAFA 3IT4B 4LK0M 4EOYA 4MDKE 2FIFA 4M8NA 5M3MH 1ZKOA 5EBDA 2M8SA 3P4SB 3PF4A 3LXFA 2A1AA 5GADC 3KFUA 4W9FA 3PUVA 3EHVA 2YTVA 3GZNB 1KIXA 2JXMB 2KVRA 5C4ZA 2R2OA 1ZDXA 3TMPB 1XF5L 1X32A 1CM9A 1Y1VB 2KECA 2FCQA 2D07B 4USAA 1HFGA 4EZLA 1HCZA 1MHXA 2MQHA 3CRLC 2ZCCA 1S72A 4WAAA 1K0RA 1V9PA 3NSWA 4A3IH 1H9SB 3DHHC 2HD3A 4CKBA 1E7PB 5C6AA 3GV6A 3WA0A 3ZNZB 1QJOA 4X6AH 2MX2A 2N49A 4G11A 3SR6A 3NHEB 1IL8A 2V1CC 3AE6B 2J0TD 4TVAB 3TZDA 3HP3A 3QK0A 3T8MA 3BZDB 1IBKQ 3PO3H 3PO2B 1ONLA 2F0DA 1AFPA 2LGXA 4RNAA 5IP9G 1BUIC 5LMNW 3MWYW 1DOMA 2ZPYA 4MACA 4DR7L 1ZW7A 4HROA 2LZ6A 2N4FA 1B3AA 4JI8L 5IGBA 2G5DA 4LF9Q 1H95A 2KZRA 2Y5PA 2KQ3A 5NUCA 5IIFA 3MHSD 4B3SL 4KZCA 2ZTEA 4IUVA 4PZ8A 1RD9D 3FHWA 1GHJA 1TWCH 2DZJA 4IUTA 4C3JG 4IM0A 2M9VA 3CRKC 3A8KE 2E2HH 1ZUD2 3PREA 3PIOA 4GXBA 3AFPA 2K04A 3UQAA 2Z8LA 3D4DA 5JEAJ 2CJOA 3B6YA 4EZKA 4US8A 3DBRB 3KQ4A 1EY0A 2E8GA 2JYOA 2QGQA 5BMHA 1WCMG 2F1MA 4P75A 1JB7A 3S1NH 2LASA 4ZYSA 2MP1A 1L6VA 2KHSA 2PMVA 4WH4A 1QB5D 2Y0SE 4JI1Q 1XLNA 3GQBA 4DV1Q 4S3SA 3PV1A 3M7GA 2DLBA 4ULLA 1HA6A 4BA2I 1G91A 3IFWB 4LF7Q 1X3EA 1A0IA 2Q8TA 2NS5A 4WQMA 1FR3A 2DJFC 3CD6A 2OJRA 1H9JA 4QIWE 2BTEA 4KHZA 5C3EB 3OLMD 3IAS1 3RZDH 2EXZA 4HCSA 4HKQA 1RFKA 5LXHA 2YU9H 5ISRA 2WXHA 1VF7A 1DONA 4GLVB 3CKIB 3BU2A 1L6UA 1TVXA 3MFYA 1SGHA 3EUB2 3NVZA 1YEZA 4CGYB 3D4WA 1E9MA 3VAWA 3NWTA 1I4XA 1PH3A 1NYRA 2MBOA 4ZDVA 2FCMA 1G291 1PA6A 2GOWA 4LUVA 2KJ6A 3ECIA 1ESRA 4DNTB 1XX8A 3DXJC 1I3QH 2VL6A 1CFMA 1F9RA 4X62L 4GN1A 1KDBA 4KDIC 1LM8B 4B3TL 4W9IA 2JA8H 4ZRJA 1C4QA 4E74A 4UP7A 5AFWA 2L4NA 5M5XB 1I5FA 3AYHB 2BQQA 3ZXVA 1EQRA 4B3RL 1DOYA 3TN2A 2XN9C 2F0LA 4AWJA 5I6YA 5G5HA 2PYKA 2VH1A 3RNEC 4ASWC 1PH1A 2JA6G 1MG4A 4IFDJ 4II2B 2KHWB 5LLIA 4HTHA 3PO3G 1IUEA 3OMGA 4JL9A 1I94L 1DGJA 3HKSA 2BKRB 2EMSA 1G51A 1FJGL 1F9PA 4H2AA 3R8BA 5GAGC 4PS7A 4HCEA 1EQQA 1MHHE 2UWQA 1XNRQ 4TKNA 2E2IH 4KD4A 2L3ZA 4PMCA 4DKAC 1VJKA 3VH3B 2BA0A 3DVNV 2A5HA 4Y7NH 4A3GG 1FXAA 3I4OA 3B2FA 3GDEA 1JJGA 2INPE 1GB4A 2A6HC 3RLFA 4ICVA 4OHJA 1SNOA 1N33Q 2FINB 2VQFL 5ELOA 1SNQA 2QC8A 2D0PA 3KOJA 2ZM6L 3RNUA 1JWUD 1Q81C 2K5NA 1C0AA 1PGBA 1TJEA 1NY4A 2WQYB 2GI9A 2UYZB 1X54A 3R2TA 1C8CA 2ZXOA 1ZOYB 1FRRA 5FLMH 3AEBB 2BH8A 2J7QB 4YHHQ 3PGEA 4NP5A 3EA6A 4DK5A 3DWQA 2GRIA 1I6HH 5KIXA 1PTOC 3AECB 1WFQA 3GTPB 5CR3A 3WOEA 2RDHA 2KA7A 3I4LA 1NBFC 4BBSG 1HJPA 1BBWA 1TWHH 1L0WA 3U58A 3V3XA 4QB4A 1S3SG 1V1QA 4DR5Q 2PO4A 1BBXC 3G4SA 3RD2A 1L0XB 2RR9A 4OO1I 1SE2A 4DV7L 3BG3A 3RLOA 3QJZA 3VTVA 5JHBA 4QCLA 3PZ8A 5E6OA 3W9CB 3I55A 5FJ8G 3VUXA 2JP1A 2JSVX 1L4DB 2CHXA 1PZKD 2KKCA 4B9KA 1U4LA 4A93H 4JG2A 1I50H 3N9YC 3AQQA 3IKJA 1CK1A 2K5HA 4XT1B 1WI5A 4KTAA 2DNEA 5IODA 4ID6A 3S2HH 1F9JA 4GNXC 5DPSA 1HNXQ 1AWDA 3W5UB 2ON8A 4FNFA 4PMBA 2ZW0A 1IYUA 2JF5A 5CV9A 1YN4A 5FLXL 3F2DA 3Q6BA 4DF7A 2JYTA 1KLVA 2N1VA 3H0GG 2MFIA 1XQQA 3NVVA 1PRTC 3Q8AA 1W3SA 4Y52H 2R2QA 4RF1A 1JE5A 3SK6A 4WQOB 4GSWA 3J81c 1NDDA 5CHVC 2WFWA 3I4MB 3WWVA 2MO1A 2UXCQ 1F2MA 1IBXA 5KHOA 1TS3A 2Z59B 1X3FA 1K8OA 2EMTA 3AE2B 1WD1A 1L2FA 2NVXB 3TMEA 1BOSA 4JOIA 1I35A 1TY0A 2IGGA 1YJNA 2F4VQ 1E7UA 4ZRKA 2UXDL 3U8ZA 1C76A 2CKHB 4GNXA 2BDNA 3IFTA 4TV3A 5FO9B 3VQIA 1ZXIA 1E6EB 3A8IE 4JBJA 4IUQA 5AJ3Q 1KTKA 3S16H 1M1KC 4N59A 3RMKC 3RYTA 4JLCA 4AYBG 4ODGA 1LLRD 1SNDA 2KJHB 1AH9A 1G6JA 4MIUA 5DM73 3RZOH 2IY1B 1YJJA 3GE3C 2B8GA 4A8XC 3KBXA 3EFXD 3T3NA 3SE0A 4LFAL 1MIUA 2H5XA 3E5SA 4PMWA 5LNK1 4U68A 1D5XC 4JVZA 4WJWA 1YJWA 4HJGE 5HFYA 1B9RA 2AQ2B 1K83B 1X1MA 1VDVA 1A3TA 1WMHA 3AEEB 1EOTA 1Y1VH 1MI0A 4IPCA 3NS1A 4AUQC 2V4DA 2VQEQ 3FKIB 3S1QB 2UXBQ 3P4PB 1PH2A 1IP9A 2WAQB 1NR2A 2GMIC 2E2JB 1YNJC 4MZ9A 3ZYYX 4DV6Q 2WS3B 4W9DA 2IY0B 2WX1A 1XLQA 4K1RB 1PZID 4A3JG 2RCFA 4P72A 3DLLA 2CW0D 4GKKQ 1NI2A 1KD1C 3PO2H 3IAM1 1SSNA 1T0RC 3MZ5A 5EGTA 3DUZA 3ND8A 1J7BA 3D6CA 1MGSA 2WXQA 1VQ7A 4IG7B 2FNJB 3PIO3 3W5OA 1XMQL 4EE2A 3M4YA 3KUZA 1HTQA 2ZTCA 1EY8A 3PHXB 3M3YB 1EWIA 4WJQA 1NSNS 4CDFC 3ZLZA 4CYEA 4TKOB 4DV3L 1DOLA 1GXDC 2JT4B 5C2TB 2LUMA 3ERQA 3G6JB 3Q8BA 3HOZB 2TMPA 3N52A 1YITA 1G2TA 2RDFA 4KKTA 4DHJB 1RFAA 5HKHA 3I4NB 2K14A 3FC4A 3ZDMC 1QLBB 1VQCA 2RSNA 2PMZE 1E24A 1HNWQ 1JRPA 4LAAA 4IUPA 4RAUC 2NUCA 3LWEA 4C3HG 2B2YC 4OXPA 5EPJA 1IYJB 4FXCA 5HI1A 1BDOA 3AB9A 3I7FA 1UZXB 5GQOA 1M90C 2ACZB 2K5DA 1E5WA 2CQAA 3KWLA 4A3EG 2E5LL 1IBXB 4IUUA 1LTRD 4OIJA 5CX3A 2WXRA 1K53A 1GUWA 5C3EH 3NELA 2NPTA 2KDBA 3AE4B 4A3KG 2VUMH 1WTQA 2KJXA 2NMQA 2QKIC 2CH4A 3U52E 1L5PA 3I5JC 2MBQA 2BKFA 1V86A 2EOTA 1TBEA 3APFA 1UE6A 2I07B 4RGOS 1ROEA 3H6MA 4GNXB 4A9AA 2MJEA 2R92H 1XJVA 4F88A 2REXA 3TIXA 5M5YB 2J0MA 3MC8A 3H3VH 5BN5A 5M9OA 4RF0A 1PH4A 4HJ5A 1TKYA 4PYZA 3NS8A 3HGBA 2PI2A 4R9WA 2B2YA 3C3LA 3PT2B 1Y1VG 5I2YA 2MJ3A 4NY0A 5C5MA 3B1LX 2IO0B 2WB1G 2LD9A 3NQTA 4GN3B 2ES2A 1GAQB 4YT0B 1N8RC 5M5XH 2M1MA 3JYUA 3TP5A 4XGAB 5KNDA 3TCAA 2F0HA 3MEFA 2KLCA 4N8FA 1JW9D 5KEEA 2WXFA 5FLXE 1WCMB 2BOSA 3NTHA 3Q6SA 1SFOB 4ZHOA 2SOBA 2SDFA 4IOAA 1T0QC 1VQGA 1XWEA 2QILA 4LFCL 1WTVA 4KY6A 2WHIA 5CBAE 4A3LG 1PH8A 2KWDA 2PLPA 4DK0A 3DDCB 1LV9A 2CWAA 3LJ3A 3IVFA 1VF5C 4X66L 3JSVA 4MELA 1EOVA 2D3GA 2F0VA 3PUZA 2KWCA 1RKNA 2Q8IB 1MKHA 2DY7A 3KDFA 3J7YW 4BBRG 1QOGA 2AYOB 4MGZE 1K3RA 3HIZA 2WGSA 3KYHC 4DK1A 2PVOD 4IOIE 5HURA 2VS1A 1K8AC 3Q14C 3FMCA 1YD8U 1SF0A 2K5VA 2LXKA 2QHOA 4BY1G 4BA1I 3BS1A 5CV4A 5E6PA 3E0EA 4A55A 4HEA1 1F2ZA 4QF4A 2KTFA 1D3ZA 3NHHA 5H1SE 2KC1A 3VYRA 3TP7A 2R93B 2ZVOA 1SMYC 4LTUA 4L8JA 3TEXA 1Q90A 3QWNA 4OX9L 4DR4Q 1K50A 3MXNA 3K5NA 3GB1A 2X6GA 2Q8RE 1RJTA 3SR1A 3GTPH 2KXJA 1FMAD 1B53A 4A3CH 5ELFA 2PZTA 2JQRB 1BT0A 1TWFB 4JI5Q 4ANWA 4C80A 1KFYB 2PW5A 3K6OA 2VUMG 5IYBG 1ENCA 4E3CA 2KCNA 1GUGA 3D3RA 5LMNL 3AEDB 4WORA 2HE7A 2NN6I 2K0PA 4C2MB 1KM7A 2HD5B 3KW5B 2H89B 3MC9A 5GROA 4AH6A 2LHDA 2R92G 1U4RA 1PDQA 2JA6B 2JZZA 2NPTB 4KGTA 4C7ZA 3PO3B 3EN2A 1GC7A 4WURA 1YMHE 1OQRA 2W3SA 2UU7A 5DNFA 4FXDA 3CSTA 4WWMA 4KKIA 4ANUA 4FJZA 2HQLA 4JPBW 1ET9A 2KQ4X 4FADA 4JI6Q 1MVKA 2EYFA 1UAPA 3GO5A 3K7AH 3JAML 1A5RA 5BO4B 3A9KA 4H0LC 4ZRZA 1X55A 3SHLA 1T0SC 1TWCB 3V96A 5JVG3 1WTWA 2HIVA 2WXLA 4A3GB 3A9JA 1MFWA 1JALA 3KUPA 2DBYA 1RCVD 3NTIA 1R4PB 1TWAB 5IWAL 2Z4IA 4ME3A 3N1YC 3SXHA 4DR1L 1ASYA 3AMUA 2UUAQ 3S1NB 4HDOA 2J42A 4N58A 1JQ4A 4HIOA 1UBIA 4BXXH 1WGHA 2BCOA 3PCOB 3N1XC 4OZCA 3V62A 1JRUA 4GOPC 4LF9L 2NVXH 1QOAA 1D6EC 2ID0A 2IPKD 4KV6A 2WU5B 2UUCL 1O78A 3F2UA 1TR5A 3APCA 4JX1C 1E22A 2DAJA 1DYQA 1HZAA 4NXMQ 4M02A 2RCNA 3U9SA 4BBSB 1GHKA 1J5EL 5AUKA 5COYA 4JBKA 1F2LA 1AYFA 1V1OA 1SNPA 2JRIB 1RYJA 4PK1A 2IL8A 3DPDA 1N60A 1PH6A 1N36L 2C60A 2Z0EB 4DWFA 3H1UA 3L08A 1KRHA 3QQ8B 4JI1L 1BR9A 2OHFA 1XO3A 2NB0A 3OSOA 4DV1L 3AE7B 4FJVB 2N78A 1A2UA 2KMAA 5H8YE 3NEMA 3VR2A 5K36G 2WXMA 4CDDC 1WRIA 4C3IB 1LYLA 3RNBC 5IT9c 4FF3A 3K5LA 4JYAQ 5EAYA 2Z6BA 2OEDA 4EQ5A 3AU7A 2B39A 4JI0Q 1XLPA 2BB5A 4IOCA 4LDTB 4LF6Q 4NW2A 4GOPA 1ZGUB 2L12A 1K83H 5HGTA 4GOCA 1LTBD 3GV3A 4A3CG 2K25A 2AKWB 4E6IA 4DV2Q 4W9JA 2IX0A 3S1QH 3FKIH 1ISNA 2E2DC 4IM2A 3J9CA 3ML8A 3MXNB 5LMUQ 1V49A 3EECA 1L2NA 1Q8IA 2XRQD 3H0GB 1WWTA 2JWUA 3RCZA 5HGQA 1LT3D 4DHZB 3DBSA 4FA6A 2FUG1 3UF8A 1W2BA 2L1BA 1LABA 4YY3Q 4G3XB 5IAAC 2PKOA 1JE4A 1GUTA 3E9SA 1HRJA 3KJOA 2KDMA 2LY7A 1CI3M 2YTYA 3PUYA 4O2DA 4L5TA 5I9PA 3AE3B 3O65B 3W1YA 3UIOB 1TWGH 5ELEA 1NE3A 3SEBA 1V8QA 2FHTA 4X3KA 1WX9A 1QNKA 2RD0A 5IP7H 3N3KB 1Z6HA 2L55A 1LACA 3PUXA 3L54A 3OAWA 4EVOA 3L2PA 1IGCA 2HHHL 1T3QA 4B95A 3MEHA 5G2NA 1VCBA 2LXAA 3BINA 2B2UC 1VMPA 3DWPA 1VQ4A 3HOZH 1IYVA 3A9KB 1STAA 4HRSA 4DFAA 1EL0A 3LYYA 2F0JA 2Y0SG 3I4NH 2Y3AA 2NVTB 1IKMA 4AYBB 3A9JB 2NBUA 4NQKE 1U4PA 4F8MA 3U4ZA 2N7DA 1WXVA 3T1YL 5AEKB 1II3A 1BBUA 1N62A 1XNRL 1YJIA 3SFEB 5IO9A 5EPLA 4BOSC 2MBEA 4YCWA 1C78A 2A6ED 1H9SA 4DR3L 4IW0A 5DPRA 1PTOF 4F87A 1X56A 4L63B 5D3DA 1U4MA 5G55A 4I7ZC 2R7DA 1N33L 3TP6A 1UEBA 2QF7A 3MJWA 1W6KA 2LEKA 2ZJRA 1EUJA 1HPCA 3AU4A 3GD7A 2B3GA 2F3VA 4K8IA 2RVLA 4HN7A 1TY2A 2B2UA 5I2XA 2LSSA 3LX0A 4A3JB 3DQVA 3K58A 2A68D 1WYGA 1RAXA 4FF4A 1SIFA 3NBHA 2L0FA 5IP9H 2MBBB 3S2AA 1EYAA 3TQYA 3IT6B 4BWGB 2G4SA 2ZXRA 4LF8Q 1TS4A 1GG3A 5DCNA 4BAXA 3RD4A 4WWPA 4WAFA 3GZNI 5EDSA 5JJZA 1E2VA 1F77A 3DM3A 4P71A 1ZYRC 4LF5Q 1GD7A 3FKIG 5T1IA 1WGGA 5DAUA 2Z0SA 1PXUA 2MBHA 3RNCC 3H3VC 1FL0A 3NK9A 4KGRA 2F0EA 3CU7A 5JAVA 1UF0A 1PRTF 2IWHA 4K2LA 3GTKH 2A69C 3AB5A 2M2LA 4GLAC 4ARCA 1WCMH 3HKZE 4P73A 1SYCA 1VD2A 1VQHA 3EVQA 3V2TA 1D8LA 4XDDA 1H8CA 3PZDA 1CTMA 1JJ2A 1AN8A 3I8ZA 2EJFC 3NOBA 4EQPA 1PFDA 1LM0A 1LTTD 4C3HB 1AP0A 2A19A 5IGGA 1X3PA 2HIXA 4MGYE 3U7DA 4KHVA 3OTOL 2JXXA 1R4NI 4A3EB 3JC66 2BB6A 1EY5A 5IP7G 4ZQ3A 2JE6I 3H7PA 1FCLA 1BCPD 4P2CB 1WZ3A 1E8WA 3ZTDA 4A3KB 1MD2D 2K52A 1V97A 4P1CC 3PVLA 1LXDA 4HAEA 3A5UA 4X3SA 3EROA 3BVMA 3X3NA 5IGDA 3DBRI 3APDA 1KOTA 3CF6E 3RZOB 1PH7A 2MSED 2M19A 3AEGB 3P4QB 2R93H 1Y8NB 1K73C 1U9RA 5G3LF 4JQWC 1FGUA 4POGA 2F4VL 2CU3A 1FM0D 3EGRA 4TQ1A 2JX5A 4KDLB 4GLXA 4ZUJA 1IBLL 3I3TB 3CMAA 1TWFH 1ZXTA 1HZ9A 3RN2A 4GKJQ 1KH0A 4OGQC 2WB1B 1J9OA 4HMIA 2MO0A 3R3OA 1G8ZD 4UPAA 1EYDA 2NR2A 3C19A 2JJQA 4A3FG 2K4KA 4ILWA 4C2MH 2MPMA 1J8IA 2XWBB 3KF6B 2K32A 5EE3A 2JA6H 2L05A 3T1HQ 3CC4A 3RZFA 2VZAA 4P6VF 1GUAB 3PGZA 1N34Q 4X65Q 4RMAA 5EE0A 2PEAA 2NCNA 1SMXA 2BH2A 2D5DA 2GBNA 2KHJA 2KX3A 3NVYA 5D3IB 2IO1B 1E2WA 4AOFA 4IZ8A 2RBMA 2EYJA 3IAYA 1T6BX 5BYQA 3U4EG 1WY8A 3AE1B 3B2GA
chains in the Genus database with same CATH topology
4N6EB 4CQNA 2F0TA 3QOJA 3S17B 2EJMA 4A90A 3ZJTA 5I6WA 3A54A 4KKUA 4BBRB 4I65A 5D14A 1O7LA 1J7AA 1A3UA 3NTKA 3OWFA 3VR5A 4J3OD 3MVVA 2PCFB 2E75C 2YEPF 1V43A 4BY1B 3S15B 2WLBA 4QUCA 3OWEB 1HZ5A 1PDXA 2W54A 5H92C 4DXGA 3Q8CA 2BA1A 5D7GA 2VB3X 1OXVA 2F4IA 4ZKBB 1KDAA 2VUMB 5C0XI 3A8JE 3VR3A 2VZKD 4ZRQA 3E0JA 2KUMA 2LS01 3D6WA 3RFZB 1NR4A 2R92B 3AEAB 1QWYA 4XYOA 1K8MA 4K5XA 2OXPA 1I4QA 3BYTB 5HG2A 2AQ1B 4KI0A 3TP8A 1M8AA 5EKKA 1A6XA 1FEHA 1DD2A 1STYA 1EIHA 4IUNA 4ARIA 3OOCA 3HKZB 1SIJA 2ZXPA 1JOKA 4ZHPA 2CJNA 4J8QA 4RKBA 4C1NI 5I4DA 2JYEA 1TQOA 2HQEA 2N7JA 1C4PA 3U7ZA 2HTME 1SBBB 4ABNA 2PZUA 1C4CA 4K2KA 4JWUC 2W82A 4B08A 4L2YA 4NAWB 1Q3LA 1NCVA 3H94A 3MA2B 5CV8A 1QF6A 1SNCA 4IALA 1GPXA 2EE1A 4Q0FA 1EU3A 1YNND 1B9MA 3C1FA 3KLSA 5E1FA 1SB3C 4X3UA 2INNE 3BWUD 3NWSA 4QMGA 1W6JA 2NBFA 1L4ZB 2WIIB 2K9XA 2EY6A 3WDNA 1NUCA 1SDFA 4HEDA 4B9WA 4RGMA 4GZYC 3M85A 1B44D 4KK7A 1I7HA 2MJDA 3HOXB 1XCTL 3RMHA 1WTXA 4R8IA 4C3IG 4RGNA 5BMIA 1SXTA 3HVZA 1CQVA 3SVMA 2VNUD 1SE3A 2B76B 3K7AB 2NN6G 1JICA 1H9KA 3K59A 4V0BA 1TU2B 2EVBA 1IW7C 5CBEE 4LLGM 3P75A 2K5QA 2L1AA 2BYTA 4IFDI 4O42A 3QJYA 2Y0SB 5A2QL 4PT5A 4YSXB 1JB3A 2ICEC 4DAYA 2J7ZA 3NUHB 1PZJD 4V190 1SAPA 1EEFD 4QIWB 4IURA 3O13A 3ITPA 1JOOA 3ZQ4A 4XXEA 1LT6D 1BXTA 4YSZB 3HRZC 2IX1A 3IXSA 1QT9A 2QCPX 2MJ8A 3ND9A 2FMMA 5C3WA 4YIJA 2AX5A 4C7YA 1DOXA 1O7ZA 2EELA 3DMUA 1JQ4A 3KLRA 2JA7B 1XTCD 1PGXA 1JOQA 1SJED 4KN4C 3A7LA 4B0MA 1EYCA 1CZWA 1QNUA 2QDBA 4H44C 1N61A 3KK7A 2M00A 4C1NK 4KJOA 2ICIA 3GTOB 1Q12A 3Q8EA 1GOZA 2G9HD 3AN1A 2K5PA 2FJ2A 5KRUA 4DNRB 3BIID 3P7JA 1HHVA 4LMQD 1TT2A 2MUYA 4L1BA 3K57A 1IHZA 2V4IB 3GS2A 1TWGB 4C56C 3DWMA 2Q5WD 4JPSA 1SYFA 2JU6X 3IFDA 4REZA 3NBIA 1TZOA 4ME5A 1AZPA 2WXKA 2D5GA 1EY6A 1AEXA 4K6DA 2DWQA 3ZJVA 1HEZE 4DA2A 1FNWA 1HXYD 2B2WC 4RCOA 3VRBB 2MEKA 2A6HD 4XDCA 1HZ6A 2EYHA 1D1KA 5BYSA 4D2KA 1O7YA 1HUMA 1C48A 2I38A 2WU2B 1H9RA 4RHRA 3U2SC 4JWSC 1STHA 3K0YA 1I4RA 4A3FB 1EWHA 3G7LA 2I46A 3D8GA 4IDIA 3HUIA 1CQFA 3QG1A 4XQNA 4DAPA 3AMZA 4H7BA 1PFMA 2B2WA 1GUOA 3SFDB 4FVMA 4EGVA 4KMUC 2LMCA 2LFIA 4J6HA 1JR0D 2R7ZB 1OXXK 1Z7TA 4Z9CB 2L52A 1NEKB 4ZAIA 3LNNA 2JEBI 1STGA 4LK1C 2EY2A 3T56B 1JWMD 2CVRA 3GTKB 1Q1BA 2BE5C 2C5CA 1LTSD 4EQNA 1ML0D 1B1ZA 2NTTA 5A2QE 2R61A 1WTRA 5CC4A 5EBCA 1RF2D 3NVWA 4CJ2C 2BW2A 1D5ZC 2FE8A 4JK1C 2K1BA 1DJRD 1Q1EA 1S5FD 1PGAA 1SEBD 1OO9B 1AW7A 2DNCA 3CIRB 1UNSA 3NRZA 5K36H 1A15A 3I72A 4K8JA 3L3OC 4XQJA 4PNYA 1CJEA 4MH8A 3W5VB 1JMLA 4KKSA 3MFGA 2WXPA 1EIGA 3TBIB 5AUIA 2J52A 4FO2A 2HDLA 2K6AA 2LKVA 4KY5A 2MGSA 2NTSA 4IQZA 3ZGZA 1QKZA 2K33A 1NVID 1SYEA 3N6RA 1G6ZA 3NP8A 1OXUA 5J39A 2WXIA 2O2LD 1JC7A 2SNSA 2PPBC 2LMCB 1CZPA 4RWSC 2QSDA 3KBGA 3AV8A 3ABVB 1VLBA 4BY7B 4B9XA 2EYOA 2PMZB 1LTAD 5CV6A 5FOBB 1DZ1A 1ZXHA 3PMFA 3TEZA 1BNZA 3CQZB 3GTJB 2IDYA 3VA7A 1V1PA 3S1MB 4KD3A 1FRDA 3MXUA 5FKAC 2GA4B 1BO0A 3HZXA 4UDUC 3TSSA 5C4HA 2AWOA 2JA5B 2E76C 2ONQA 1FD6A 5C3XA 4ZKCB 2B63B 4JE3B 3OHXC 1SYGA 1BCPC 2N9KA 3SK4A 3PUWA 1F9SA 2KCCA 1D5MC 5JVH3 2YYZA 2Y5CA 4XIGS 3S14B 1VRAB 2SEBD 2XSCA 5FR3A 4OO1H 1D4BA 1LT5D 1NI3A 5IT9L 1S5BD 3Q23A 4M8AA 4FF1A 2KACA 1EQVA 2A73B 3P20A 1M4VA 3J80L 4NKLA 2ZT9C 3SK5A 1DOKA 2R6GA 1BMLC 3H09A 5HHDG 1F2RC 2XWJB 1UGJA 2PTLA 1FNUA 2BT6A 3OW7A 2X6LA 4ZOHC 1FFUA 3OMCA 3LWUA 1I6VC 3I70A 1T5EA 2NVYB 1UUPA 2PW9A 3TEYA 3VYUA 3W2DA 3J7AF 5LL6X 5GXGB 1IKLA 1FD7D 1KABA 3HG9A 4XDXA 1FO4A 5JEAG 1WD0A 3L9AX 5C4XB 4CJ1B 2CHBD 4US9A 1TKWB 4RFBA 1EY7A 1QQRA 1SMYD 2G1EA 5E4WC 1V1PB 3E6ZX 2BBCA 1X3QA 3HOWB 1GJXA 3QIAA 3KWVA 1EEID 4R3DA 1PYWD 1FIQA 5ELCA 1HTPA 1S5ED 4RKLA 4G7HC 1F2YA 4Q5VA 5A35A 1CZGA 3PV0A 1QG7A 3P63A 4DQOC 3V05A 2WXGA 2G9DA 4OO1G 1RHPA 1TKEA 2F0SA 3OIPA 3FAHA 5EE9A 5MPOA 1XYIA 1CHQD 4XQQA 2KEDA 3HOVB 2HDEA 3RPFC 3TZUA 3WOFA 1XXGA 1NENB 1DCZA 1G2SA 2L83A 4G7OC 1J7CA 1LT4D 4IFDG 1FGBD 5T1GA 1BCPB 1DXMA 1C4AA 1CA5A 2HCCA 3R2IA 3DEPA 1BQQT 2WACA 1EY4A 2JXTA 1QE6A 3NQIA 3I3CA 2F0IA 4WRDA 3C1EA 3BDCA 1TYGB 1SSOA 1YNTE 5E3FA 1QOBA 2K03A 3H91A 2D9UA 3BVGA 2PW7A 2XVSA 1D2BA 1YNNC 1S5CD 1KF6B 1MSHA 2RDGA 3VR4A 3Q24A 5C4JB 1Y1WB 2PIAA 4GLSC 2V3PA 3QB3A 5CYUA 5IT9E 3HOUB 1JORA 1P7FA 4OW0A 3J80E 3FDTA 1Y8PB 2HCIA 3ONAB 3I57A 3HS0C 3I90A 5CMDA 2F0PA 2HUGA 2K28A 2TSSA 5KNCA 4GDKB 3NUCA 1RWSA 2D2CC 3UI3A 2FFKB 1ILPA 1KAAA 2IX3A 4DGZA 2EDGA 2K22A 2LJIA 2D62A 4GDLB 1ZEQX 4IN3A 3VYSA 1ZPSA 3KF8A 5TSSA 3BK1A 2MH7A 3A55A 3AE5B 3HEJA 5CV5A 1P7EA 4RHSA 2VZKB 2OF1A 4H13C 4RA8A 1VR9A 1Y56A 1JQYD 5T8IA 1JWBD 3I9V1 4OZAA 4AQ7A 3GTQB 1OXSC 4L6TB 1CT1D 4G7ZC 4OIKA 4YTNB 2F0MA 2IT1A 3K5MA 3Q8FA 1TIID 3X3MA 5C3JB 2NN6H 3OIQA 2DN8A 3A56A 1RTOA 4BS9A 2KMMA 3BVZA 1KLUD 5K5PA 5JPNC 2EYMA 4XTCS 1ZYRD 2JEAI 2IW3A 3KLSX 1VZ6A 1XCQL 2NWGA 1WTOA 2WDQB 4FP5D 1I4HA 5IGFA 4K14A 2AUKA 2A69D 3P42A 2CW0C 4TSSA 3BYYB 4X3TA 1WVLA 1RTNA 3C2PA 1RM6C 1E10A 4RGTA 1VMCA 4KKJA 1CHPD 1NYQA 2H4OA 2WP9B 5EKLA 2B2VC 1PUTA 4WIPA 3IL8A 3M7NA 4EQOA 1Y69U 3VR6A 2A74C 4NDXA 3DWAA 1VZ8A 2RSOA 2LFNA 2K3UA 1MPEA 2O5JC 3NXWA 2NVQB 1H9MA 4NMZA 3AM9A 3T3OA 4ZUIA 2BS4B 2PZWA 3VR8B 1JWAD 3R93A 2B2VA 2WXJA 1STNA 4XE0A 1C9FA 1WXQA 2XNAC 1Z47A 2K7VA 2EYPA 3W3AA 5EE1A 5ELBA 1WGKA 4K6LA 4KY7A 2R3ZA 1ZE3D 1UWXA 4ZK9B 5BMGA 2Z1CA 1PMRA 1IGDA 1RDPD 1YN5A 1Q10A 1HTLD 3ETRA 2IGDA 3NPPA 3J81L 3AE8B 3K5OA 1EM7A 3HVDA 3HOYB 5LHY1 2F0GA 4FYDA 1R4QB 3FRPB 2QJLA 1C79A 2N55A 2AQ3B 4XWTA 5BN4A 1E0BA 4KGSA 4A3MB 1BCPF 3VRAB 4CKEA 4DN4M 1UWMA 2EY5A 1N5XA 1WSPA 4K5WA 2LGIA 4R8NA 4O1NA 4HKZE 1FCCC 3HRDD 3AEFB 3GTGB 2RKSA 2OT2A 5I9OA 1LO5D 5C44B 4TQ0A 4KJNA 2WDVB 2F0OA 1E2ZA 3T4AC 5DM63 1EU4A 1RODA 3VYTA 4Q2JA 2NYZD 4CBVA 5FK9C 1FNVA 4A3BB 1N63A 2RMMA 2EY1A 4A6QA 4TMAB 3BDOA 1GB1A 5E4XA 5JXVA 4KN7C 5CGKA 2M0AA 1B50A 1BUVT 5C5LA 2WINB 3MHZA 3PZ7A 5M3FB 5IGCA 2VB2X 1XLOA 2F0WA 3FILA 2WP8J 1TS2A 2QMTA 3VR9B 2KAJA 2BS2B 1R7SA 1NAPA 3I91A 3AE9B 1PTOB 4HSVA 1HQMC 1PTOD 2M56B 1I4PA 3WCQA 1F0ZA 4HR7B 1HUNA 1KNAA 3P1MA 3OPOA 4ZLTF 2E3TA 2N0SB 2DY8A 4J1MA 2Z4HA 1OXTA 1L0VB 1ESFA 5ELDA 1SE4A 4PQXA 3P4RB 4DAVA 5M5WB 3C46A 4WFN3 1UEAB 4UAIA 4KX6B 1ACCA 3TUOA 1ICWA 5EPKA 3T51B 4A3DB 1IW7D 1PRTB 4IKGA 3Q0AA 1R9TB 1PRTD 1VDZA 4OL7A 3M4OB 1D1IA 4CHTB 1PFBA 5JOBA 4G4KA 2XRSD 4C3JB 3NZ3A 5G5GA 2WV6D 2F03A 3URYA 4YTMB 2HDMA 3J81E 5KYIA 3D31A 2F3WA 2JZPA 1T5XD 3RUZA 2DYMA 4ITKA 2BDOA 5CORA 3MP9A 5KGUA 4TRDA 4M0WA 2KOLA 2DYOA 5C0XH 3S2DB 1K51A 3GP7A 5G3LD 1B4OA 1AZQA 3FILB 2L9HA 3CHBD 1FFVA 2A6EC 5FO7B 2GB1A 4P16A 5M3MB 5IOCA 1OQQA 1EY9A 1SYDA 2K5WA 3MXGA 1YNJD 1VCIA 4DU9A 4N9TA 1ZDVA 1PFNA 3S9WA 1V8CA 2KVMA 3T16A 4DXFA 2A68C 4A3IB 2EPBA 4OZBA 3H8HA 5J22A 2EYLA 2N88A 5KNBA 1KLGD 2O5IC 3ZJUA 2K01A 4PV1C 2B2TC 3QOLA 3T13A 4YSYB 3MC0B 5F2DA 2W3RA 1HQRD 2H1EA 4G57A 4QUFA 4YWGG 2YEPB 3MHBA 1O80A 2JSOA 5JEAH 4MT5A 1MBYA 2XIWA 4JBWA 4MHEA 3W1SA 2F0FA 1Y8OB 2E2HB 1ZP0B 1JWSD 3FPPA 3BDLA 2QEJC 3QO2A 3Q69A 2SAKA 2RPVA 4FXKC 1MSGA 1YQ4B 3DHQA 3T53B 2WXOA 2J4XA 5D65A 2IJ0A 4K5VA 3D4RA 2FMCA 1VZ7A 2KEEA 3SDZA 1EZ6A 2B2TA 4LJZC 1XEEA 2L0CA 4HMJA 1I4GA 1OFFA 2H88B 4YTPB 4NJCA 3MJ5A 1S4ZA 4RCNA 3EQLC 2EJGC 1E0ZA 3U9OA 2F0KA 5C0XG 3A7AB 2WKCA 3FVQA 3RZDB 4XT3B 5EJWA 2F0UA 2YU9B 4CJ0B 2J53A 3VA5A 3FPUB 5J1ZA 1SYBA 3E56A 2EKIA 2L5TA 1EQTA 5JPMC 2O4XA 3LB8C 3AH7A 2F0NA 1HA5A 2K05A 2V0GA 1LTID 3B9JA 1SJHD 1L0YB 3FEWX 1BF4A 3PO0A 1I3QB 1GUSA 4HSPA 5DEHA 5LL6S 1KNEA 2BE5D 2JA8B 2E6XA 2VXWA 2X38A 1TS5A 4IFDH 3TDQA 1SNMA 2SNMA 1A2TA 1EFID 1EWYC 2KN4A 1F9QA 2X69A 2PNRC 1S5DD 1B9NA 1JROA 2PVGC 1LTGD 1ENFA 3Q22A 2B8FA 2ZW1A 3NE5B 3TEWA 4XYQA 2E2IB 2OEOA 3C8YA 1QOFA 1QILA 3L4PA 1YN3A 2QIEB 3P1HA 5FO8B 4Y7NB 1HFNA 1PLFA 3DM1A 1FXIA 2WXNA 5KYLA 4NZLB 4FF2A 1A3VA 2AWNA 2E74C 1PTOH 3I73A 2WKDA 4AS1A 1MI2A 4NAMA 4CKCA 1QOHA 1N5WA 2W55A 1ENAA 2N9LA 5IGEA 3L7ZC 1ET6A 4L23A 1TKGA 5BYRA 3SK8A 1I6HB 1KDCA 2I2YA 2IGHA 2L11A 2NZ1D 3MAQA 4OVZA 1TWHB 2L32A 2C9OA 4RH6A 1CA6A 1B2TA 5E6JA 4TQUS 1K52A 5CV7A 3PIP3 2WNMA 1DM0B 1QCBD 4MN3A 5BN3A 1F2RI 4N9PA 3UI2A 2LHEA 1EZ8A 4A93B 1I50B 2FBWB 4YXDB 3S2HB 4FXGC 2V3NA 4F7XA 2PQEA 3GTMB 2ENBA 2EZVA 1GUNA 3DEOA 4U673 5EKIA 1JCKB 3JAME 3DWGC 4B0EA 1ILQA 1STEA 4M1UB 4ZRPA 1YQ3B 4MM3B 2MHVA 1EWCA 2RA4A 2RQXA 3CWIA 1STBA 1C77A 1DOIA 2WDRB 5EQ0A 1FYCA 3MTSA 3GTLB 1A70A 4XWWA 2F0QA 3BK2A 1WTPA 2AUJD 5C0XJ 3J7AV 3S16B 3S1RB 3EJIA 3MXPA 2BS3B 3IT4B 4LK0M 1ZKOA 5EBDA 3P4SB 3LXFA 3PUVA 2JXMB 5C4ZA 1ZDXA 1XF5L 1X32A 1CM9A 1Y1VB 2KECA 4USAA 1HFGA 1HCZA 1MHXA 3CRLC 3NSWA 1H9SB 4CKBA 1E7PB 5C6AA 3GV6A 1QJOA 3SR6A 1IL8A 3AE6B 2J0TD 3TZDA 3HP3A 3BZDB 3PO2B 4RNAA 1ONLA 2F0DA 1AFPA 1BUIC 3MWYW 1DOMA 4MACA 4HROA 1B3AA 5IGBA 2Y5PA 2KQ3A 5NUCA 5IIFA 4IUVA 1RD9D 1GHJA 4IUTA 4C3JG 2M9VA 3CRKC 3A8KE 1ZUD2 2K04A 2Z8LA 3D4DA 5JEAJ 2CJOA 4US8A 3KQ4A 1EY0A 5BMHA 2JYOA 2F1MA 4ZYSA 2MP1A 1L6VA 2KHSA 2PMVA 4WH4A 1QB5D 1XLNA 3GQBA 4S3SA 3M7GA 2DLBA 4ULLA 1HA6A 4BA2I 1G91A 2Q8TA 4WQMA 1FR3A 1H9JA 2BTEA 4KHZA 5C3EB 3IAS1 2EXZA 4HCSA 4HKQA 1RFKA 5ISRA 2WXHA 1VF7A 1DONA 3CKIB 1L6UA 1TVXA 3MFYA 3EUB2 3NVZA 4CGYB 3D4WA 1E9MA 3NWTA 1I4XA 1NYRA 1G291 1ESRA 4DNTB 1XX8A 3DXJC 1CFMA 1F9RA 1KDBA 1C4QA 5AFWA 2L4NA 5M5XB 1DOYA 3TN2A 2XN9C 2F0LA 5I6YA 5G5HA 2PYKA 4IFDJ 4HTHA 1IUEA 3OMGA 1DGJA 1F9PA 4H2AA 3R8BA 4HCEA 1MHHE 4KD4A 4PMCA 1VJKA 2BA0A 2A5HA 1FXAA 3B2FA 2INPE 1GB4A 2A6HC 3RLFA 4OHJA 1SNOA 2FINB 1SNQA 1JWUD 1PGBA 1TJEA 2WQYB 2GI9A 3R2TA 1C8CA 2ZXOA 1ZOYB 1FRRA 3AEBB 4NP5A 3EA6A 3DWQA 2GRIA 5KIXA 1PTOC 3AECB 3GTPB 5CR3A 3WOEA 2RDHA 2KA7A 3I4LA 3V3XA 4QB4A 2PO4A 1BBXC 1L0XB 4OO1I 1SE2A 3BG3A 4QCLA 3PZ8A 3W9CB 2JP1A 2JSVX 1L4DB 1PZKD 1U4LA 3N9YC 3IKJA 1CK1A 4XT1B 4KTAA 5IODA 2DNEA 4ID6A 1AWDA 3W5UB 2ON8A 4FNFA 4PMBA 2ZW0A 1IYUA 5CV9A 1YN4A 5FLXL 4DF7A 2JYTA 3NVVA 3Q8AA 1PRTC 4RF1A 3SK6A 3I4MB 1F2MA 1IBXA 1TS3A 1K8OA 3AE2B 1WD1A 2NVXB 3TMEA 1BOSA 1TY0A 2IGGA 1C76A 2BDNA 3IFTA 5FO9B 3VQIA 1ZXIA 1E6EB 3A8IE 4IUQA 1KTKA 4N59A 4ODGA 1LLRD 1SNDA 4MIUA 5DM73 1YJJA 2B8GA 4A8XC 3KBXA 3EFXD 3T3NA 3SE0A 3E5SA 4PMWA 5LNK1 4U68A 1D5XC 4WJWA 4HJGE 5HFYA 1B9RA 2AQ2B 1K83B 1VDVA 1A3TA 3AEEB 1EOTA 1MI0A 3NS1A 2V4DA 3S1QB 3FKIB 3P4PB 2WAQB 1NR2A 2E2JB 1YNJC 3ZYYX 2WS3B 1XLQA 1PZID 3IAM1 2CW0D 1SSNA 3MZ5A 5EGTA 3DUZA 3ND8A 1J7BA 3D6CA 1MGSA 2WXQA 3PIO3 4EE2A 3M4YA 1EY8A 3M3YB 1NSNS 4TKOB 1DOLA 1GXDC 5C2TB 2LUMA 3ERQA 3G6JB 3Q8BA 3HOZB 2TMPA 3N52A 1G2TA 2RDFA 4KKTA 3I4NB 3FC4A 1QLBB 2RSNA 1JRPA 4LAAA 4IUPA 4RAUC 2NUCA 3LWEA 4C3HG 2B2YC 5EPJA 4FXCA 5HI1A 1BDOA 3AB9A 2ACZB 2K5DA 2CQAA 3KWLA 1IBXB 4IUUA 1LTRD 4OIJA 2WXRA 1K53A 1GUWA 3AE4B 1WTQA 2KJXA 2NMQA 2QKIC 3U52E 1L5PA 2EOTA 2I07B 4RGOS 1ROEA 3H6MA 4A9AA 2MJEA 4F88A 5M5YB 5BN5A 5M9OA 4RF0A 1TKYA 3HGBA 4R9WA 2B2YA 3C3LA 5I2YA 2MJ3A 5C5MA 3NQTA 1GAQB 4YT0B 3TP5A 5KNDA 2F0HA 1JW9D 5KEEA 2WXFA 5FLXE 1WCMB 2BOSA 3NTHA 3Q6SA 1SFOB 4ZHOA 2SOBA 2SDFA 1XWEA 2QILA 1WTVA 4KY6A 5CBAE 2PLPA 2KWDA 4DK0A 1LV9A 1VF5C 2F0VA 3PUZA 1RKNA 2Q8IB 2DY7A 3J7YW 1QOGA 4DK1A 2PVOD 4IOIE 5HURA 3FMCA 1SF0A 4BA1I 3BS1A 5CV4A 4A55A 4HEA1 1F2ZA 4QF4A 3NHHA 3VYRA 3TP7A 2R93B 4LTUA 1SMYC 3TEXA 4L8JA 1Q90A 3QWNA 1K50A 3MXNA 3K5NA 3GB1A 2X6GA 2Q8RE 1RJTA 3SR1A 1FMAD 1B53A 5ELFA 2PZTA 2JQRB 1TWFB 4C80A 1KFYB 2PW5A 3K6OA 1ENCA 2KCNA 1GUGA 3D3RA 3AEDB 4WORA 2NN6I 2K0PA 4C2MB 2H89B 2LHDA 1U4RA 1PDQA 2JA6B 4KGTA 4C7ZA 3PO3B 4WURA 1YMHE 1OQRA 2W3SA 5DNFA 4FXDA 4WWMA 4KKIA 1ET9A 2KQ4X 1MVKA 2EYFA 1UAPA 3GO5A 3JAML 4H0LC 4ZRZA 3SHLA 1TWCB 3V96A 5JVG3 1WTWA 2WXLA 4A3GB 1JALA 3KUPA 2DBYA 1RCVD 3NTIA 1R4PB 1TWAB 2Z4IA 3SXHA 3AMUA 3S1NB 2J42A 4N58A 2BCOA 4OZCA 1QOAA 1D6EC 2ID0A 2IPKD 4KV6A 2WU5B 1O78A 3F2UA 1TR5A 4JX1C 1DYQA 3U9SA 4BBSB 1GHKA 5AUKA 5COYA 1F2LA 1AYFA 1V1OA 1SNPA 1RYJA 2IL8A 1N60A 1KRHA 1BR9A 2OHFA 1XO3A 2NB0A 3OSOA 3AE7B 5H8YE 1A2UA 3VR2A 5K36G 2WXMA 1WRIA 4C3IB 4FF3A 3K5LA 2OEDA 1XLPA 3AU7A 2B39A 2BB5A 4NW2A 2L12A 5HGTA 1LTBD 3GV3A 4E6IA 2IX0A 2E2DC 3J9CA 1Q8IA 2XRQD 3H0GB 1WWTA 2JWUA 1LT3D 2FUG1 2L1BA 1LABA 2PKOA 1JE4A 1GUTA 3E9SA 1HRJA 2KDMA 2LY7A 1CI3M 5I9PA 3PUYA 3AE3B 5ELEA 3SEBA 1V8QA 2FHTA 4X3KA 1QNKA 1Z6HA 2L55A 1LACA 3PUXA 4EVOA 1IGCA 1T3QA 3MEHA 2B2UC 1VMPA 3DWPA 1IYVA 4HRSA 1STAA 4DFAA 1EL0A 3LYYA 2F0JA 2Y3AA 2NVTB 1IKMA 4AYBB 1U4PA 4F8MA 1II3A 1N62A 1YJIA 3SFEB 5EPLA 1C78A 2A6ED 1H9SA 1PTOF 4F87A 4L63B 5D3DA 1U4MA 4I7ZC 3TP6A 2QF7A 1W6KA 2LEKA 1HPCA 3GD7A 2F3VA 4K8IA 2RVLA 4HN7A 1TY2A 2B2UA 5I2XA 3LX0A 4A3JB 3K58A 2A68D 1WYGA 4FF4A 3NBHA 1EYAA 3IT6B 4BWGB 2ZXRA 1TS4A 3RD4A 4WAFA 5JJZA 1E2VA 1F77A 1ZYRC 5T1IA 5DAUA 1PXUA 3H3VC 4KGRA 3NK9A 2F0EA 3CU7A 5JAVA 1PRTF 2IWHA 4K2LA 4ARCA 2A69C 3AB5A 2M2LA 4XDDA 1SYCA 3EVQA 3V2TA 1CTMA 1AN8A 3I8ZA 2EJFC 4EQPA 1PFD