1FNUA

Structure of streptococcal pyrogenic exotoxin a
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
221
structure length
221
Chain Sequence
QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYTIDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDNKTSQIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOTOXIN TYPE A PRECURSOR (ALLELE 1)
publication title Structure of streptococcal pyrogenic exotoxin A reveals a novel metal cluster.
pubmed rcsb
molecule tags Toxin
total genus 59
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fnuA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fnuA02
1JQYD 1LTAD 3BVZA 1CQVA 1EEID 1JWUD 1SE2A 4K6LA 1S5ED 1F77A 3O13A 5D3IB 1QILA 1UUPA 5ELCA 1FNWA 1HXYD 1EEFD 4BWGB 1SE4A 1PRTF 1LT4D 1I4HA 1SXTA 1TS4A 3KLSX 2R61A 1BCPC 1PTOD 3BVMA 2SEBD 5I4DA 1JWMD 2XRSD 1B1ZA 2QILA 2XRQD 5ELBA 2QEJC 1V1PA 1S5BD 1G8ZD 1YN4A 1S5CD 1XTCD 3BYYB 1SJED 1SEBD 4RGOS 2RDGA 4RHRA 1PZJD 1DJRD 1PRTC 1V1PB 1TY2A 1FD7D 1XXGA 4OHJA 1ET9A 2RDHA 3R2IA 4RFBA 3SEBA 1PTOF 1FGBD 5ELEA 1T5XD 4UDUC 3MFGA 2G9HD 1CHPD 2AQ2B 4L63B 4TSSA 1TS2A 1B44D 4RH6A 1HQRD 4RGMA 5TSSA 3CHBD 5ELFA 1CHQD 1EU4A 5FKAC 1LTSD 3BYTB 2NTTA 1ET6A 1I4RA 1JCKB 2IJ0A 2CHBD 3GP7A 1LT5D 1PYWD 1SJHD 4DXFA 1BCPB 2XNAC 1TS5A 3DWQA 1EFID 1PTOC 1AN8A 1CK1A 1KLGD 1RDPD 3EFXD 3URYA 1RF2D 1EWCA 1D5XC 1LTBD 1M4VA 1SE3A 1JR0D 1LTTD 3R8BA 1I4PA 2NTSA 3BVGA 1YN5A 4Z9CB 1YN3A 2Z8LA 3MC0B 1PRTB 1TY0A 1ENFA 1ESFA 1D5MC 4L6TB 1KTKA 1S5FD 1PZID 4O1NA 4RHSA 1AW7A 3W2DA 1DYQA 2O2LD 2WV6D 1JWSD 3V05A 1HTLD 3DWPA 5D3DA 1LO5D 1LTGD 1D5ZC 1HA5A 4RGTA 1PZKD 3R2TA 3BZDB 5FK9C 1BXTA 1D6EC 1L0XB 1RD9D 4C56C 1PTOB 2TSSA 3OWEB 3DWAA 3EA6A 2XN9C 1CT1D 1GOZA 1LT6D 1BCPD 1V1OA 1LT3D 1STEA 4RGNA 2J4XA 2IPKD 4ZYSA 2ICIA 4NZLB 1I4QA 4DXGA 5ELDA 1MD2D 1S5DD 1LTRD 2AQ3B 1I4GA 1L0YB 1PRTD 1TS3A 1FNVA 1I4XA 1BCPF 1LLRD 1PTOH 1RCVD 1UNSA 1KLUD 3TSSA 1FNUA 1SBBB 4RCOA 2AQ1B 1EU3A 1LTID
chains in the Genus database with same CATH superfamily
1E22A 4A3JB 4KGSA 3U8ZA 3ZTCA 2ZM6Q 3ERSX 4JI2Q 3MC8A 2NVTB 1QKZA 4QIWB 4B3ML 2RSNA 2K0PA 4EZJA 4ZAIA 1V2YA 5T1GA 4OWXB 1V43A 2R61A 4JI5Q 2JA6G 2F3WA 1SNMA 4JVZA 4A3GH 2SEBD 2D5DA 1VQJA 1VDZA 4AIMA 1FCCC 1E7UA 2VQEL 2E5LL 2C7HA 2KX0A 2L0FA 5CHVC 1S5BD 4R4TA 5CV9A 5JPNC 2RHQB 1DD2A 2NN6I 4P73A 3QIAA 2ASQA 2K1FA 1JWAD 2VH1A 3DUZA 1NCVA 3EVQA 2FIDA 1XF5L 2ON8A 3HVDA 5C44B 2AKWB 4QF4A 2INNE 3QO2A 3H7PB 2B8FA 3H3VI 3NBIA 4IDIA 4AYBB 4I6NB 3FKIB 1W6KA 1UEBA 4RNAA 4B95A 1YJIA 1HCZA 2MP1A 3CHBD 3MAQA 3AEBB 5A35A 1YX6B 4JGHB 3HGBA 2PMZE 2EJMA 4ZCKA 5LL6X 3BYTB 1LM8B 4FXKC 4RKLA 1Z6HA 3FMCA 3HM6X 5GAHC 2Z59B 1XNRQ 2MBEA 4MM3B 4ARCA 5JJZA 3SXHA 1WJUA 3QWNA 1B70B 1WWTA 4BZAA 4W9LA 3PF5A 1ICFB 1S72A 4P7IA 1X3EA 4B9WA 1U9RA 5D7GA 1XQQA 1GUAB 3RUIB 2Q5WD 1I4PA 4DR1L 4Z9CB 2VY3A 4ASWC 2XWJB 1UBQA 3NJTA 4KKJA 4BKSA 3UI2A 4G7ZC 4AP4C 3CF5A 4WWNA 1BQQT 4TMAB 1UE5A 1JE5A 4IPCA 3W1GA 3UQAA 4DBGA 5KRUA 2VUMH 1EOTA 4REZA 5CV5A 1XO3A 1ZW7A 1E24A 3D4RA 3EQLC 2KC2A 3L4PA 4BY7G 5M5YH 3AE2B 4GB9A 3R2TA 3ALBA 2K52A 4WQMA 3U9SA 1I50H 1YD8U 4OWTB 1G6ZA 3RN9C 4QB4A 5E3FA 3MXNA 5D14A 3W3AA 4OW0A 1OFFA 2F0TA 1SYFA 1FXIA 2DAFA 2K4KA 4MIUA 3CP0A 3HG9A 3C3LA 1EO6A 2DYMA 3MXPA 5M3FG 1HNZQ 2CU3A 2K6QA 2A19A 4OVUA 4RG1A 4KY6A 5I9PA 3Q8FA 1ZDXA 2SNSA 4GKJQ 3NELA 1IKMA 4LLGM 2FCSA 4XTCS 1R4PB 4WORA 4IPDA 3PIPA 2UUAQ 4BBRH 1NAPA 1EYDA 2J4XA 4HR7B 4P75A 3STBC 1XMQQ 2JQRB 1TWHH 2E75C 3I7FA 1PH4A 4LF4L 3PRMB 2EPBA 1MD2D 3KF6A 3DHHC 1S3SG 4A8XC 1WI5A 1EY4A 1G6PA 1ASZA 4II3B 4KHPL 4NXML 1XCQL 3U9OA 1LLRD 3S2HH 3J9CA 1UNSA 4KV6A 3ZYYX 1MHWC 1WXSA 2A4ZA 3ONSA 3QK0A 1RM6C 3AE5B 4LJOB 1X56A 5IYBH 2HQEA 3BS1A 3OTOL 2Z6BA 1EU3A 4JI1L 3I4NG 5CHWA 3TP8A 2LXAA 1Y1VH 2V4DA 4PV1C 1ROEA 2KVZA 3A56A 1R9TH 3AEDB 3O13A 2V3NA 3AE8B 3P4QB 2OJWA 3DVNV 4AS1A 1CFMA 1WYGA 3H0GG 1H95A 1SIJA 2WLBA 4BWGB 2DENB 4LNFA 5IGBA 1N5XA 1SYDA 1TZ1A 2LXCA 2A68C 3EGRA 1HNWL 4JC0A 2K5WA 2QDLA 3RLFA 3VR2A 5IWAQ 5G5HA 3QG1A 2IBIB 3A55A 3D8GA 3LYYA 4NJ7A 2JY6A 4OZBA 2WXLA 3HOVB 1V1PA 2LY7A 4GDKB 1P9DU 4BOZB 2KD0A 1XPUA 1G291 2MEKA 5IN7A 1WCMG 3BYYB 4DHJD 1HNXQ 4GN5A 4PYUA 1IYFA 4OONA 3ZDTA 3B6YA 4JWSC 4C7ZA 5ELEA 5CORA 1K53A 1H4RA 3S1RB 3MXUA 2RHSB 4RH6A 3RUZA 2EZVA 2RA4A 2MUYA 2L5TA 4MGIE 4BAXA 1JJGA 4JL9A 3RNEC 4HCEA 1JCKB 2BB6A 4DXFA 3DQVA 3S1NB 5E4XA 2VZKB 3TEYA 3ENEA 1TWAB 4DU9A 3DWGC 1HTOA 4A3BB 1E10A 1N33L 4IJLA 4HJGE 2FAZA 3PO2H 1ZKHA 3QOJA 1L7YA 4DDID 4YL8A 1Y8NB 3X3MA 5C23A 1JOKA 4FJVB 1A63A 2V9HA 2CQAA 3IFTA 4A3GG 4FYDA 3S17B 1X3QA 5D6JB 4IM0A 4QUFA 5M5WH 4A6QA 1C0AA 1RL2A 2F4IA 2LJIA 3IFWB 3HS0C 3SK8A 1VQ5A 3APCA 3RNCC 4JI2L 4YSZB 1Y8OB 3CIRB 5GROA 3GTMB 4LFBL 1UWXA 1HA5A 2G5DA 3NWSA 4RGTA 3S14B 4FXCA 2F3IA 1P0RA 2QJLA 2X8XX 1CA5A 2M0AA 5KNBA 1WM2A 4JV5Q 2IO2B 3TBLD 4L5QA 3U4EG 2K05A 3KK7A 4KN4C 1SYGA 2JA9A 2PW9A 4BBSB 1XNQQ 4CYEA 2RPVA 2RR9A 2J0MA 4M8NA 2LASA 4DK5A 3HIZA 4DV0Q 3W5VB 3OYYA 1K8RB 3I57A 2JWZA 2A6EC 2R2QA 1XLOA 2AYOB 3FC4A 2NBFA 3DEOA 5LMUQ 2OT2A 1C4PA 3U58A 4OO1H 2IO3B 2KNBA 4RWSC 2KJ6A 4M00A 3RNGC 2EXZA 3LGJA 4HJAA 2GLSA 3IRBA 1TWFB 5JOBA 3ZRCA 3K80C 3D32A 3KUDB 4TKNA 4QAYA 4B0MA 3U52E 3BU2A 2KJRA 2NVYB 2KDFB 4JBMA 4MACA 5EDSA 1XNRL 3JC66 3ZJUA 3V61A 3D31A 2WDVB 4YCVA 3G7LA 2WAQE 3HP3A 2REXA 1CZPA 4XYCA 3ETRA 2VUMG 4KKIA 3RZOB 4PK1A 1Q8IA 1LTAD 2LGXA 1O7YA 2JA7B 3VR6A 1TKGA 3ZJYC 3ZUNA 5FLMH 1E1TA 1EEFD 2PNHA 4JBKA 4LF5Q 3DDCB 3KQ4A 3PT2B 1LT4D 4ZLTF 1RODA 1TS4A 2L12A 4QL5A 3MEFA 3PUWA 2G1EA 1FL0A 2E76C 1RKNA 3JAML 4KX6B 2DJGC 2OQ0A 5D2MB 2I5MX 1WTPA 4GDLA 5FLXE 2SOBA 1JWBD 5ELBA 4V0BA 1P98A 1LABA 2DHZA 1PGBA 2KLCA 1NBFC 1WGHA 1NJIC 1C8CA 3GTKH 4KI0A 2GVAA 4RHRA 4BA2I 4BBRG 3CWIA 1F2MA 1ET9A 2RDHA 2K50A 2IW3A 2XWBB 2A6HC 2PO4A 4GLVB 4JBWA 2WDRB 3K57A 4UP9A 2MH7A 1STHA 3HOWH 2J7ZA 4KHVA 2UUCQ 3KOJA 3PGEA 1R4NB 3QR8A 2HDEA 2MP2B 4GMVA 1CHQD 3CU7A 3JVZX 2UUAL 3ULJA 3APFA 1A8VA 4FDBA 4OZCA 1N36L 5AUIA 2B2UA 5DM63 4AOFA 3MEHA 2N7DA 4JI0Q 2GI9A 4HMJA 4ZKCB 2K5VA 3K0YA 5M5XH 4P1CC 5IYBG 3CSTA 2A69C 2C5LC 3OWFA 2L1BA 1EYCA 2LJ5A 4FJZA 1IYVA 3VFKA 4M02A 1Y1VG 4JW0A 1LTBD 1SSOA 2BE5C 4H7BA 3TN2A 3QX1A 1JR0D 3GV6A 3P4PB 4IM2A 1TWGH 1GHKA 1E7PB 1GO3E 1I5FA 4J6HA 3RULA 2CQOA 3SK4A 1G2SA 3HOXB 2DUDA 3VDYA 1Z7TA 2PI2E 1CTMA 1V5OA 3QC8B 3H94A 2PQAB 1KTKA 2WX0A 1DYQA 1YI2A 5IA7A 3RNBC 3J81L 3M4PA 1LUZA 3EFUA 4GNXC 4H2AA 5HGQA 2KJHB 4A93B 1WFQA 3GDEA 2Z6KC 2KCTA 4MHEA 3EFCA 4LUVA 4B0EA 4TKOB 2JQOA 3A9KB 4ZHPA 4K5XA 3A4SC 1HUNA 3OMGA 2C60A 3FHWA 1VRAB 5BN4A 1SMYD 3TZDA 3Q3JA 2KFJA 4A3DH 4C56C 4M1UB 1TQOA 5EGTA 2FUHB 2NWGA 1TKEA 4NB3A 1LACA 1NBWA 3RLOA 3D4WA 1HNXL 5C3XA 2Z4IA 3VR3A 3ZDMC 2I5LX 3F1ZA 4C2MH 1X3FA 1VZ7A 1R4QB 1RHPA 2ASBA 4NAWA 3H6MA 1QOHA 4DUZL 3IAYA 4CDEC 1I7HA 3I5JC 1GUNA 2RF4A 1I42A 2D5GA 4IPHA 5I2XA 2PYKA 2KA7A 1GNUA 3GZNB 3HOYB 3L0WB 4APVA 2WIIB 2EY6A 2KYWA 2KQSA 3PO2G 2BYVE 1MSHA 2O2VA 2LFIA 3E56A 3TEXA 3V96A 3PVLA 2HCCA 1BCPF 3DHQA 3J80i 3R7QA 4XQQA 2OF1A 2AL6A 5NUCA 2QIEB 3AYHB 2Y0SE 4TV3A 3RZWC 3K5LA 1TXYA 1SB3C 1K83H 1YBYA 4PS8A 1DGSA 3NQTA 3HOZB 3NRZA 2PZTA 3C1FA 2ATWA 3A4RA 2ZEQA 3GTGB 3D6CA 5A2QE 2WHIA 1TU2B 1CSPA 2IWHA 3Q22A 1O7ZA 5BYQA 4ME3A 4CKBA 4HEDA 1TVXA 2F4VL 3ZKJC 1DONA 4NW2A 1YJWA 2DX5B 1I94Q 2JA6B 4ME5A 5K36H 1D1IA 3NVWA 4X66Q 2AMCB 1YN4A 2NBVB 4MJSA 3TMPB 3MJ5A 3PSIA 4E3CA 4J6IA 4DNRB 4RGOS 1UE1A 3BDCA 1WX9A 1NYRA 2KQ4X 1RJTA 4U68A 1V6EA 4HKQA 1TY2A 1XXGA 4JV5L 1JRUA 1JMCA 5G5GA 1VQPA 3P75A 2ZTCA 1SR3A 4OX9Q 4OO1G 4NY0A 1XNQL 1U4LA 1TS2A 3VDZA 2JA8B 4NNJB 4JI4L 4YY3Q 4JI6Q 1A3UA 2VNUD 1DZ1A 4HN7A 2JZZA 4KZCA 4FVMA 3MZ5A 4K3BA 1GUSA 4CKCA 1WGRA 2DNCA 2O6VD 1I4RA 4YWLA 4S17A 3GP7A 5DNFA 5LMUL 1CKMA 2K03A 2VH2A 3BK2A 3ZXRA 1UGJA 1YNJD 3T1HL 2HCIA 3WCQA 3KLSA 2OEDA 3T3OA 4DV3L 2GBJA 4LCDE 1STBA 1VQ4A 3GTPH 4KSLC 1JRPA 2UYZB 4DFAA 3HKZG 3NZ3A 2WKCA 1E8YA 3A33B 5EAYA 5FLMG 1IYJB 1YN5A 2J7QB 4X3TA 2MGSA 4C80A 2KMMA 2WP9B 2L9HA 2VB3X 3E0EA 1AW7A 4ZRJA 1OEYA 1C9FA 2YTYA 2JA5G 1Y8PB 4A3MH 4DV7Q 1KNEA 4EGVA 4LF8Q 2INCC 1PH6A 2EY5A 1OGWA 5D3DA 1L4ZB 2ZPNA 1FEHA 2K75A 1VF5C 4ZRIA 4LF5L 4ANXA 3N3KB 3FPPA 3L9AX 4MNOA 4KSKC 5BMGA 1SYBA 3BZDB 1BUVT 4PZ6A 4BY7B 3DBRI 1STYA 2BDNA 3BJUA 3MC9A 4Y7NH 1QNKA 2W55A 2C5CA 2ONQA 3VH3B 4JLCA 5JVG3 3HOWG 3WAMA 1ZDVA 2B2WA 4XX5A 1HUMA 2W82A 3K5MA 4KY5A 4YCWA 3GTQB 2RDBC 4IW0A 2WXKA 4A55A 1HFGA 1GB1A 1CT1D 4DV2L 4WURA 3UIPB 1WSPA 1BCPD 4NP5A 1XPRA 2ZJRA 2B2YA 5M3FB 3ML9A 4ZRPA 4ZK9B 1A3VA 1R4MB 4JK1C 4NZLB 3X23A 1K8GA 3S16H 1F9JA 3DM3A 5EBDA 2FMMA 3V2TA 4DK0A 1Q5WB 1J9OA 1L0YB 1F52A 3KBGA 2NPTB 3R7RA 1EWHA 2KQ3A 3PS6A 3UINB 1TS3A 5C4XH 3KFUA 5JH5C 2R93H 2WQYB 2V0GA 1QJOA 1M1KC 2MBBB 2AQ1B 2EYLA 2F0PA 2Z4HA 2KKCA 2F03A 1PGAA 4JPSA 4A90A 2GBRA 4POGA 2BYEA 4EUTA 1X54A 3UI3A 2K22A 3I4NB 3IG3A 2EDGA 3I55A 2Z0EB 1OXSC 1SE4A 1K73C 4OO1I 4B3SQ 1MJCA 2DYBA 3A8KE 5JHBA 3CQZB 4G11A 1DGJA 2NBUA 1U4RA 2RSOA 1J0GA 4A3DG 2AL3A 3AE7B 2NUCA 1VCBA 4CO7A 4FA6A 4IFDJ 2M2LA 3FP9A 1VQAA 2X6GA 4H02A 1I6HH 3WALA 3UE0A 4OVZA 3IHPC 1ZXTA 4DV6Q 4IALA 4FADA 2RDGA 3QCAA 4NQLB 4LJPB 4OHJA 2X6LA 1WCMB 1L6UA 4PT5A 3CXCA 5CV8A 1CKNB 4OL7A 3KYHC 4KD3A 1BF4A 2INDC 1K8AC 4BOSC 2CHBD 5J1ZA 4KN7C 1XJVA 1XD3B 2JE6I 1EY6A 1TWCH 4X3SA 5IGCA 5EE3A 5C3EH 1IL2A 5LMNW 3J7ZC 2K14A 1MBYA 1NYQA 1P16A 1JALA 1H9SB 3TEHB 3AEGB 2HDLA 3IT4B 1D5XC 2F0LA 2FFKB 3KBXA 4A3KH 1JOQA 2WB1B 4GKKL 4K2KA 3VR8B 1JB3A 4M0WA 1OO9B 3NENA 2ZTEA 5CMDA 4LF7Q 1DOMA 1MFWA 1MSGA 4ZRZA 2LKVA 3IKJA 3LDZE 2A68D 3PO3H 5L95C 3Q23A 3M3YH 1KD1C 1E8XA 2Z1CA 2N9LA 3N20C 3TCAA 5C4JB 3T53B 5K36G 4EQOA 4A3GB 2JRIB 1B3QA 1JE4A 2OEOA 3CRLC 3AU4A 3RMKC 1ZKOA 2E2JB 3J7YW 2PIAA 1QOBA 4B6WA 3HRZC 1STGA 2M1MA 5IGGA 4FHKA 3K81C 1N32Q 2V4LA 5IP9H 1U4AA 3UDFA 4HSVA 3L10B 3R66C 4HIDA 3J7AF 4LW1A 3E9SA 3VTWA 4HIOA 1I94L 1K50A 5EKKA 2RCNA 1NSNS 3SR1A 2B2VC 4X66L 4LF6Q 3ZJTA 3O65B 1JJCB 2BT6A 5KHOA 2WU5B 2CJNA 4L2YA 4JOIA 1K28A 2JP1A 4WAAA 2PTLA 1X6OA 5COYA 4RGNA 4HCPB 4QUCA 4OX9L 2EKEC 2CR5A 4DXGA 5IGFA 4HPLB 1FXTB 4JI6L 2O6VA 4DN4M 2PE9A 4GGQA 3B1LX 3DVGY 1UH6A 4HLEA 2MHVA 1EQTA 3KF8B 1IBKQ 3E5SA 2L32A 1VQ7A 1T0YA 2WYQA 3VUXA 2BCOA 4GDLB 1HZAA 1B2TA 1UZXB 4K5VA 2XSCA 3K7AB 4LNIA 1QOFA 2ZVOA 2DY7A 1N34L 3I4MH 1YIWA 4ZQ3A 2W54A 4A3MG 2DWQA 1KABA 1Q82C 3LXFA 1WYDA 2B29A 1CQVA 4W9KA 2BH8A 2F0VA 4FHJA 4FXGC 3SHLA 2CU1A 4K7SA 2F0MA 1ISNA 3ZTDA 4L8JA 4YCUA 3KJOA 2K8CA 5G2NA 3Q14C 4X62Q 4I7ZC 3VR5A 1J5EQ 1B9NA 2CWPA 4LF8L 1SIFA 1YNTE 3MP9A 2KTRA 5J22A 5H1SE 1N5WA 1JORA 2M8SA 3NVVA 3RZDH 1E0ZA 2TMPA 2MJ3A 3UDGA 5EE9A 3BDOA 1UEAB 3NTIA 3NS8A 4C3HH 3RN5A 4HJ8A 3KH0A 2A6ED 3HHMA 4GZYC 1E8WA 1PRTC 1PFBA 3HOUG 4X3UA 2E6XA 4RMAA 1SE9A 2VRRB 1OQYA 3H09A 1HTPA 4LNOA 3PCOB 3TL5A 1N9WA 4BBRB 5TSSA 4RGMA 4DR3Q 4I65A 1M94A 3ABVB 5IAAC 2IX0A 2K04A 1TWHB 1Y1WH 3NTHA 5EPLA 4ZYNA 1C79A 1E9MA 2N49A 4KDLB 5C4XG 1QZHA 3WOEA 3HK0A 2R93G 4ULLA 4PS3A 4J15A 4DHZB 1ZUD2 2EYPA 1TIID 1PTOC 3PF4A 2CKZB 3S2HB 4P74A 5M3MH 1DM0B 4ALPA 4J1MA 1MVKA 1SE3A 5T8IA 3H3VC 1QG7A 3VUYA 3RNAC 1NVID 1R9TB 4WJPA 5IE8A 4IOAA 1O78A 2CW0C 3DWPA 5TR5A 4LFAQ 4POFA 3PV0A 4XDXA 1EWIA 1GM5A 3BIID 2UU7A 5BYRA 2F0WA 1A6XA 1AE2A 4B3SL 4US8A 1F2LA 4ZUJA 1IYUA 3ZLZA 3AMZA 3RPFC 3TMEA 2Q8IB 1A62A 1NUCA 3OW2A 3KUZA 2A6HD 4WJQA 4A4IA 3L13A 4JI3L 3W1SC 3FILA 3DBHB 1B3AA 2A1AA 1NR2A 2N9XA 2LFNA 4AQ7A 3RD4A 2Z0DB 1TGZB 4WJ3M 2N4FA 3PTFC 1ILQA 5FO7B 2VQFL 2MX2A 3VYSA 3K9OB 2ZXRA 1WR6E 2L76A 4QY7A 2NZHA 3RMHA 1Q90A 4IOCA 3AU7A 3GE8C 3A7LA 1KIXA 1WYWB 2N88A 2D2QA 2KDMA 4K3CA 3RYTA 4C4VA 2C35B 4KY7A 5C3EG 3A8IE 4WFN3 1DCZA 4A3OA 2UUBL 4USAA 1BO0A 4LUOA 2KUMA 2WXPA 1V1QA 4OWWB 2BE5D 4A3KG 2N55A 1WRIA 3QWZB 3E3XA 3SK5A 5CGKA 5EKIA 3CCMA 4A3LH 2KACA 3PO3G 3PO2B 1RFAA 1Q81C 1EL0A 2VZAA 3HM3A 1QCBD 1WMHB 1B1ZA 2G4DB 4IWPA 2KN4A 1VJKA 2CHXA 4C3JH 1JWUD 2E2HH 2OOBB 1X65A 4BA1I 4RAUC 3KUPA 2ZZPB 3GTOH 4TQUS 4CGYB 4KIKA 1FJGQ 4IJHA 1SXTA 1KC8C 2JEAI 2K01A 2LD9A 5IP9G 3GD7A 3NG0A 1QOAA 4XWWA 2MHJA 3M4OB 1RLFA 4HWIB 1ZEQX 1CI3M 1F2ZA 2MO0A 1NDDA 1WGYA 3VTVA 1C1YB 4OXPA 1MHXA 1VQ8A 4HJKA 2LUMA 2RKSA 4DGZA 2I2YA 5KNDA 4LF9Q 3S2DH 3NBHA 4RKBA 1Q1OA 1TYGB 3TDQA 4QQBX 1N32L 1ZXIA 2MFIA 1WXMA 1BDOA 2BS4B 2D3CA 2ES2A 4MSMB 1WOCA 3VR9B 2NR2A 2JZPA 3CPWA 4A3JH 4DQOC 4NXNL 5JEAJ 4JYAQ 3JAME 4HRSA 4IM3A 1Q8KA 5I9OA 2NVTH 2PCFB 2DNFA 3QQ8B 3ZJVA 3SE0A 1Y8RC 5HGTA 1STAA 3H8HA 2E2DC 2IJ0A 3VYTA 4DK3C 1V81A 3U7ZA 3CAMA 3TEZA 3J80c 1S3OA 3NOBA 3PLUA 4C3IH 2W9NA 3I4MG 1EY7A 2LS01 4LNNA 3AE4B 1RF2D 2EYFA 2NZ1D 1M4VA 5C44H 5H8YE 4NKLA 2AUJD 2PW5A 1HJPA 1NY4A 4O42A 2K8HA 3T3NA 3MC0B 3CCVA 3FKIH 3TZUA 2QSDA 3NP8A 3HKZB 3AQQA 1HZ9A 4DUYL 2BS3B 4EQPA 2BYTA 2JN4A 3K6OA 4Q5VA 2O5JC 2V1YA 2WXFA 1CSQA 1KDBA 1KL9A 1QUQA 1FFVA 3S24A 2J52A 2ZW1A 2JA5B 1IBLL 3JYUA 5KYLA 4DAVA 1W3SA 2FXQA 2K8BA 1NE3A 4L23A 4M8AA 1VQKA 3NHEB 4A20A 1LV9A 3AFPA 4X62L 3EBEA 4PMCA 1J5EL 1YQ3B 3WA0A 1IPGA 2OWOA 4LDTB 3RZFA 1PH8A 2RQXA 5BR8L 3U30A 3JSVA 2J53A 3LWUA 3LX0A 3J81E 4FNFA 4MH8A 3H6NA 1YOVB 3U7DA 4MSQB 1IL8A 4A3EH 3HOWB 1YX5B 2ACZB 2GRIA 4EEWA 2WAQG 2M56B 3OLMD 4N9PA 2D0OA 3KLWA 3G71A 1WF9A 4ANWA 1K3BC 2Q8TA 1D7QA 4DR3L 3NWTA 5DPWA 2ZM6L 4IUPA 4QJFA 5M3MG 4HTHA 2N3SA 1GUWA 3K8AA 1UBIA 4ANVA 3KYCD 3QJYA 3V60A 4JI5L 5JHAA 1D8LA 2D62A 2I0QA 3VVWB 3TJPA 1MHHE 3Q0AA 3CCJA 1WZ3A 2EYJA 1EYAA 1JMLA 2BDOA 4KGTA 1DOXA 5IP7H 3I72A 4FO2A 3A9JA 2NVXB 1W6JA 3AE6B 2W3RA 3VYUA 3PIOA 2L7RA 1KQSA 3KVFB 1R4MI 4HDQA 3TP5A 5HKHA 2J0KA 2GBNA 2L0CA 1SNOA 4DNTB 4WWOA 4JWUC 4R8NA 3DVGX 4IWQA 5J2RA 2L52A 3KLSX 3P63A 3HUIA 4B9KA 1E7VA 3PHWB 4BXXH 1AYFA 3MTNB 3KWLA 1V9PA 2LSSA 1FM0D 5BN3A 1EFWA 4LFAL 1PFDA 3GTJH 2F0EA 1XTCD 1WTHA 5DEHA 5EJWA 2L11A 4QMGA 4PZ7A 2QHOA 1RTOA 1DJRD 3WOFA 2KXJA 1FGBD 1T5XD 2I38A 1D3ZA 1PUTA 2C7NB 1JT8A 4KDIC 1OXVA 1XPOA 2UXBQ 2DN8A 1YMHE 1E2ZA 3A7AB 2IY5B 1XLQA 3Q69A 4UPAA 2WB1E 3K59A 1F2RI 4CQNA 1K0RA 3NQIA 4ZUIA 5KHQA 1NI3A 4K0KQ 3NSWA 4A3LG 2PMVA 2JX5A 1RRBA 2AX5A 3HOVH 2KAJA 4BY1H 4XT3B 3AE3B 1EFID 3TP6A 1AN8A 2WP8J 3NE5B 4NJ6A 4C3JG 1SMXA 3CF6E 2DZJA 1PLFA 3SFDB 2BVCA 4M8MA 1IW7D 2F0NA 3BVGA 1D1KA 1K83B 3CSFA 1NMGA 1YN3A 1PRTB 2V3PA 1IGCA 4FJYA 2F3VA 5CV4A 2KTFA 3S1RH 3VA5A 1ZYRC 2WDQB 3VAWA 4RHSA 3S15H 5JJKA 3AEAB 4HVBA 1KOTA 2KK8A 3SHQA 1JWSD 5IY0A 1HNZL 4BBNC 2LI5A 1HPCA 1HTLD 2D3BA 2JF5A 2PI2A 1AE3A 4DV5Q 3KDFB 4GKJL 2BKFA 1LO5D 3N1YC 4CJ1B 2N9KA 3R3MA 2FCMA 1F2YA 1FJGL 1XMQL 4TUUA 4P6VF 5IGEA 2PKOA 1D6EC 1TWAH 3ZNID 4K14A 3EC8A 2EYOA 4K5WA 4MGZE 1IP9A 2FBWB 4A3JG 1PTOB 2KFKA 1TZOA 1MJDA 4YHHQ 1EY0A 1L6VA 1WD1A 3VYRA 2F0UA 4H13C 1JW9D 4YTPB 4DDGD 4LF9L 3K58A 2Q2UA 2W3SA 2R7ZH 1T0SC 2N7JA 4HIKA 3S17H 2Y0SG 1BNZA 1CQFA 3LNNA 1LT3D 4TQ1A 1H8CA 3DMUA 2VZKD 2K5NA 4A9AA 1L1OA 4C3IG 4DAYA 4HIMA 2RBMA 2J0TD 3MVVA 1FGUA 2ZXOA 4HAEA 4HSPA 1GHJA 1S5DD 4OIJA 5EPKA 1C3TA 3GTMH 3HEJA 5DLQE 2EMSA 2F0HA 5IKCM 4OVVA 3S14H 3ZNGC 5C44G 4P71A 1AZPA 3W1BA 2PZUA 2WFWA 3ND8A 1ENCA 2EIFA 5IWAL 3FKIG 2LGDA 3PPAA 1HFNA 1QVGA 2MA9B 2KTRB 4BBSH 4F7XA 1P8LA 1FFUA 4G0NB 3S1QH 1J6QA 4DR4Q 5JJLA 2E2IB 4OGQC 2KHSA 1AFPA 3P42A 5BN5A 2DZKA 2IO1B 2J0JA 2HT1A 3WAOA 1QILA 2ZXPA 2KMAA 2XEWA 1ZOYB 1B8AA 1FNWA 1HXYD 3RR5A 4EVOA 4K7UA 2JYEA 2LRUA 2OCEA 1L2FA 2B39A 2N0SB 3NVYA 1TWFH 2BOSA 4HXDA 2G3QB 2AHOB 3PUZA 3PHXB 2KOXA 1ASYA 1YZ6A 1FYCA 3G6EA 1XYIA 2B2UC 2HJ8A 4QIWE 4A3EG 1Q1EA 3Q8EA 3T9LA 2CFMA 1DXMA 1F9SA 4C1NI 3L08A 3K5OA 5J3BA 1KH0A 1SFOB 4P16A 2DLBA 2B3AA 2N8NA 2JA7H 2KWCA 4L63B 3IFDA 4CHKA 3FKYA 3HOUB 3HKSA 3EROA 4HK2A 2CS4A 3CCQA 5IYDH 1LQBA 2DYOA 1V8QA 4MM3A 1V49A 4WIPA 3S16B 3T51B 1ILPA 3NY5A 2NTTA 1RYJA 3UF8A 1EM7A 1IUEA 2B63H 3PV1A 4IC7B 3F8TA 1IHZA 4AYBE 2L8JA 1JICA 3NZSA 2K32A 2WXOA 3CRKC 1WY8A 1XCTL 3NXWA 4X6AH 5T1IA 4XYOA 4G7OC 4FLHA 4Q2JA 3Q8CA 2HIVA 4JI8Q 3VUWA 4GU2A 1L0VB 5IP7G 1T9HA 3G48A 2R7DA 1WH3A 4JCVE 5IOIA 3MFYA 1ZXHA 1S4ZA 3IXSA 3KUCB 2IZVB 3H15A 5E7NA 2F52A 4F88A 4HPMB 5LXHA 2WXMA 1Z5SB 4FF2A 3FILB 1II3A 4BXXG 3QOLA 3FEWX 2WV6D 2EY1A 5AFWA 3CPFA 4G50A 4A3IH 3UQBA 2QGQA 2ENBA 4DV0L 3DOWA 1EZ6A 1E8ZA 3CCLA 1QB5D 1QOGA 2FCNA 2MBQA 3ND9A 3F2CA 1KJTA 2HHHQ 2ZTDA 2KDBA 4C4VB 1I3QH 1YNND 5J39A 1HR0W 3HRDD 5IT9L 3PQIA 4AWJA 3ICEA 1C76A 5LLIA 1H9MA 4E71A 1FMAD 2ZVNA 5MPOA 2K28A 3HOXH 1BBUA 2LRWA 1ZPSA 3AE9B 3L54A 3VRBB 3MXNB 1V1OA 3T13A 1J7AA 3HOVG 5E6OA 4BY1G 1AH9A 3L2PA 5KIXA 5L83A 4A93H 1G6JA 1GUOA 1CUKA 2UXBL 1JROA 4PYZA 2KEDA 4OEMB 1KDCA 4B3TQ 4KIKB 3HFZB 2R6GA 2I1KA 5C3EB 2JJQA 2K6AA 2FJ2A 3KF6B 1EY8A 1FIQA 5GXGB 5C0XJ 1F9PA 4GN1A 4A75A 1EF5A 1V86A 3UDXA 2VW9A 5C5LA 3QA8A 4IURA 3B2GA 5C3JB 4JI7Q 2KJXA 5J17A 3LB8C 1WIAA 3VRAB 3J80L 2LWPA 1VS0A 5FOBB 1JQYD 2N78A 2M9VA 4WJOA 1EEID 1SE2A 2Q2IA 4IPGA 3M3YB 3CMEA 1P7FA 4FXDA 1UUPA 3CKIB 3GO5A 5I6YA 2X38A 4H0LC 3BDLA 1VQHA 2BGFA 4BFRA 2IT1A 1OXTA 3KW5B 5HHDG 2DZIA 1TKYA 2L0TA 3R93A 2UUCL 3HOYH 1VQNA 4F1SA 4I7AA 2QILA 3S1MB 1Q46A 1PVOA 2MW5A 3RFZB 2EYHA 2M0XA 3NUHB 3M4QA 4ODGA 1BR9A 2I5HA 1WJJA 2JEBI 4K8JA 2CHZA 3A5UA 2R7ZG 3W9CB 5FO9B 4JI0L 1N62A 3E6ZX 1YJ9A 5CV7A 3B08A 3TS2A 3NHHA 1A2UA 1V1PB 1YHAA 2R7FA 4G57A 4X3KA 3CCSA 3R2IA 1MPEA 4B3MQ 3F2UA 2WXNA 4GOPA 4RF0A 2BKRB 1KAWA 1KRTA 4YHHL 3P4SB 2AQ2B 3HOZH 2Q2TA 2MSED 4PQXA 1HQRD 4CBVA 5JJIA 1P1AA 2IGGA 4DKAC 3GTGH 1XLNA 1PH1A 1LTSD 2K39A 3PUXA 2M17A 3W1YA 1OXUA 3PZ8A 3CCEA 1X9NA 3H0GB 4CDFC 1EOVA 4EQ5A 4XZ4A 5AUKA 4BBSG 1QUQB 3N32A 3W5OA 1B53A 2IHFA 2F0IA 4EX5A 1SNDA 2QF7A 2KDEB 1VQBA 1YQ4B 5H92C 2Q8RE 5HI1A 2HQLA 3QARA 1UELA 5FJ8H 3T1YQ 3RNUA 3STBD 1TY0A 3M85A 2B2WC 3GS2A 2SNMA 2JA8H 3MHZA 2DJFC 4QCLA 5C2TB 1UE6A 3ITPA 3JSVB 5ELOA 1RAXA 2YEPB 1QZEA 5FO8B 3SU8X 1QNUA 2PEAA 4MN3A 4DAMA 3ZO5B 2HJ1A 2A74C 2B2YC 1LTGD 2UXCQ 2WXRA 5GADC 4LNQA 4F8MA 2RD0A 1PZKD 4DK1A 3RZDB 3M62B 1O80A 3PIO3 4C7YA 1PH2A 3I56A 2R92H 3HVZA 3AV8A 2F0SA 2JA7G 3GV3A 1UGMA 3OMCA 1XWEA 4IUTA 5CTRC 3NTKA 3P7JA 1UWVA 2A73B 1SGHA 3ZXVA 2EVBA 2B63G 2KX3A 3ZNZB 1SNQA 4R4OA 1WTRA 2IL8A 2NVQH 1A15A 2KVRA 1EWYC 2NB0A 1B4OA 1U4PA 1I4QA 2V1CC 4UAIA 4ABNA 1ESRA 1H9KA 2I1JA 1E1OA 4HMIA 2FNJB 2N7EA 1T6BX 4GLAC 4BS9A 2AQ3B 2EQSA 4JIOU 5E6JA 1WTWA 1M90C 1F9QA 2MQJA 1QWYA 2Y3AA 2CKHB 1GXDC 3B0AA 3U2SC 2UWQA 4F7ZA 1IBXA 2LXJA 4RCOA 2Y5PA 2KVMA 3D3RA 4A3FH 1WTVA 3AXCA 4KLKA 1SMYC 5CYUA 3A0JA 3OSOA 4OELB 5ISRA 4A3IG 3M95A 1GVPA 1Y14B 3BVZA 4LF4Q 3FVQA 2C9OA 3BZKA 1HZ5A 1TKWB 2QEXA 2WWZA 1Y56A 1NEKB 3M9BA 4MTNA 3Q3NC 1CZWA 2PW7A 3I91A 3X3NA 2JXTA 4NXMQ 4W9HA 5EBCA 1B9MA 1TBEA 4YY3L 1GC6A 4EKUA 2O4XA 3TQYA 2HE7A 3WDNA 3S2AA 2XRQD 5BMHA 3OIPA 2F0GA 3AB9A 4BVUC 1Q3LA 2QA4A 4JI1Q 4RF1A 3HOXG 3GE3C 1YHBA 4K7WA 4GOCA 1GKHA 3NZUA 2UU9Q 5EE1A 5FR3A 1VQMA 1V9JA 4I6PA 1FD7D 2F0QA 2MP2A 1KRSA 4J8QA 1PYSB 3ULLA 1U0LA 3ZIMA 2KCCA 1MIUA 2FCQA 3QIJA 3C8YA 5ELFA 2KBNA 2VUMB 3X0WA 1HEZE 3DVNU 2RVLA 1EU4A 2KWDA 2LHEA 3HZXA 5M5YB 3PSEB 2K5QA 5FR6A 4F87A 4WJWA 5G3LF 4DV7L 3DWQA 1OEYJ 1I50B 5DPRA 3P2BA 4XXEA 1PQSA 4R9WA 1VCIA 3AULA 3URYA 4HPPA 4FF3A 1Q86C 2PQAA 3Q3MC 1H9JA 4A3CH 3R8BA 1WCMH 2BW2A 3N30A 4DXAB 4C3JB 3DXJC 1ENFA 3L3OC 2E2HB 2KFKB 1ESFA 4IUMB 3HOYG 2EY2A 3GTOB 3A9KA 2YU9H 1SYEA 3IAM1 4GLSC 4JOIC 5CHFA 1EIFA 4FP5D 3ML8A 3LJ3A 5IODA 2A5UA 4WQOB 1JOOA 1JJ2A 4DR2Q 4DA2A 3AB5A 1PMRA 1PHJA 3FRPB 2FHTA 1N33Q 2H88B 3TBIB 4DAYB 5HURA 3SGIA 4YWGG 2VXWA 4N59A 2BWFA 4NDXA 3EJIA 2IY1B 3HOZG 3NK9A 1N63A 1YNJC 2LEKA 1YJ1A 2LMCA 3N9YC 4A3PA 3DWAA 4V190 1CA6A 1GUGA 2KEEA 3L7ZC 1WJ4A 1ZE3D 1S1QB 3S9WA 3VHTC 1OXXK 2QCZA 1Y1VB 4KD4A 3RNFC 4DHJB 1R4NI 5KNCA 4LFBQ 4DAPA 5C4JH 1BT0A 2IGDA 1SAPA 1WE7A 4DF7A 2P5ZX 3GTLH 3DBLB 3Q8BA 2Y0SB 1WTOA 2CH4A 2E2JH 3KLRA 1LGRA 3DEPA 3T8MA 1SLJA 1O7LA 3H1UA 4C3IB 4NAWB 3OOCA 3PUVA 4AQYQ 3NEMA 2ZT9C 5FJ8G 4KKUA 3OW7A 3OG5A 3L16A 3ZNHB 1I6VC 4AH6A 2WGSA 3I70A 2JPHA 3TSSA 3QB3A 2JA8G 1ZYRD 2WNMA 4P2CB 2DBYA 2GN5A 1J7CA 2O2VB 3VTUA 4MELA 4DV6L 4HJ5A 3WIMA 3UIOB 2KWUB 4K6LA 1TTNA 1WTXA 2KHIA 5EQ0A 4LTUA 3T1YL 3IVFA 4CJ0B 1R7SA 1XLPA 2BF8B 2XK5A 2YYZA 1HHVA 2KMCA 1B9RA 4DV1Q 3IL8A 4KJNA 3EN2A 1BCPC 1NMFA 1BMLC 1EQRA 2A69D 1E7ZA 2IHEA 2R92G 5I4DA 5EKLA 1UE7A 4WH4A 1OQRA 1JWMD 1QE6A 1XMOQ 4RM9A 5HFYA 3KYDD 5C0XH 2QEJC 2UXCL 4MGYE 3DBRB 1S5CD 2L05A 3DHGC 1BBWA 1SEBD 3CMAA 4WRDA 1WRDB 3A1QA 2QCPX 3AU5A 3K7AH 5C5MA 3ZGZA 1VMPA 3AMUA 2K3UA 4US9A 4EQNA 2HDMA 1EF1A 4MH0E 4MJSB 5G3LD 4LFCQ 4XC2A 4A3EB 2KCNA 2KOLA 3MFGA 2X69A 3L0OA 1MG4A 4CDDC 5KEEA 3P1MA 1TT5B 2E3TA 5M5WB 3MHSD 4LF7L 4L5RC 3GZNI 1NI2A 1YEZA 5IT9c 1QVCA 2YVCA 1ET6A 4EOYA 3OJ4B 5FLXc 4C1NK 2K25A 4FN2A 5JPMC 1SJHD 1LTLA 3TREA 4DWFA 3ZQ4A 2WXQA 1U5KA 5JVH3 1WE6A 1SNCA 3I3CA 5M9OA 4A3FG 1Q10A 3DBSA 1MI2A 2CWAA 2D9UA 3Q3FA 3CD6A 4FF4A 1EZ8A 1MJEA 3T56B 1QVFA 3A74A 3T16A 4XYQA 4W9CA 2MWSB 4N58A 1LTTD 1WX7A 1SSNA 4IUVA 2H5XA 2Z8LA 1JQ4A 1YIJA 4CHTB 3F2DA 1X1MA 4LF6L 3P20A 5DM73 3RCZA 4L6TB 1S5FD 3U4VA 1N36Q 4I6LB 3M7NA 5IO9A 4S3SA 1AP0A 2H4OA 1NENB 4BKTA 2CCZA 4P1BC 3I4LA 4IFDH 4KTAA 1WXVA 1D5ZC 1GC7A 5I6WA 3WANA 2ZNVB 3NPPA 4KKSA 1GD7A 4ZKBB 1BXTA 1K9MC 1EUVB 1P3QU 4NPSA 3GTJB 1PGXA 2JXMB 2OQKA 2GMIC 1A5RA 1E2WA 1W2BA 1IBKL 2HTHA 1CZGA 2H89B 3OWEB 2RPQA 1Q0WB 4NPNA 1PH7A 1WGGA 2NMQA 4W9IA 4XWTA 1XT9B 1C9OA 3A8JE 2KHWB 2UU9L 1DOLA 2YLMA 1B50A 1SN8A 3I4OA 4KV2A 1FD6A 2L4NA 5JAVA 4B3RQ 1IGDA 2NPTA 1SYCA 1WXAA 1PDQA 2HIXA 3PZ7A 1E3PA 1SDFA 2DNEA 2JZ3B 5GQOA 1L0WA 3J81j 1LXDA 2K33A 2D07B 2F0OA 1YQBA 5ELNA 1I4GA 1FO4A 4BY1B 3FDTA 4C3HG 4AUQC 1CKOA 2DGYA 2EXDA 2XIWA 4A3CG 2PJHA 3QHTA 2Q2HA 4IUUA 1F9RA 3F2BA 5DPSA 1I4XA 2BA0A 2IYDB 4ZDVA 2XVSA 2C9WB 1XEEA 2KT7A 3GTKB 3N1ZC 1G2TA 4HROA 5F2DA 1V8CA 2RMMA 2L00B 1D2BA 3U4ZA 2JK8A 4IZ8A 2FUG1 4DUZQ 1RWSA 2HTME 4D2KA 2BBCA 1Y1WG 3I63C 2GVBA 3S15B 4MZ9A 1VQGA 2IX1A 2MBOA 3JAMi 4KK7A 4GOPB 2WXIA 1A70A 2KN5A 3Q6SA 4YTNB 1FCLA 4PMWA 1Z47A 4CKEA 1WFYA 3BVMA 1TR5A 3OJ3A 1TT2A 1HR0Q 4UY8C 3PZDA 4YT0B 2MCNB 4IQZA 1GB4A 5CBAE 2B3GA 2WB1G 5M5XB 3J7AV 4DR2L 1M8AA 3EUB2 5C4HA 5E6NA 5E4WC 5L37A 2MBHA 1STNA 1V97A 4XT1B 5GAEC 2G45B 3U50C 4N8X1 4O0AA 1QT9A 4LWCA 5AZFA 1JB7A 1CKNA 1A0IA 1K3RA 1TWGB 3DLLA 4RFBA 2SDFA 1N8RC 3TRZA 2R7ZB 2GBMA 3CW2C 5LXIB 2G9HD 2HD5B 1B7YB 2ALYB 3OPOA 4GSWA 3K7UC 1MGSA 1B44D 4N8FA 3OAWA 2F4VQ 3JW0X 3AFQA 3M4YA 2OTLA 2LGIA 4DNIA 1ONLA 2N1WA 3Q8AA 3M4OH 1H9SA 3DHIC 2QKIC 4L5SA 1T0RC 3V6CB 1FRRA 4LUZA 1E6EB 2F0KA 3ZRFA 1KNAA 4JBJA 4DR6Q 3PRZA 3C0RB 2K5HA 1VDVA 1KLGD 2ZPYA 1K52A 4K2LA 4A3DB 2HUGA 4AQYL 1EWCA 3G6JB 4M01A 4WAFA 1DOKA 4JI4Q 3S1QB 2NTSA 2QMTA 5IIFA 1BOSA 3VH4B 1HRJA 1PYBA 1KF6B 3J7A5 3J81i 3Q3OC 1NTGA 3TUOA 1I35A 4C2MB 1VLBA 4GXBA 1EUJA 4IN3A 1PZID 2EELA 2KQ7A 4JG2A 4HJ7A 4M0WB 2K7VA 1BKBA 1J8IA 3ZW3A 2FE8A 1VD2A 5C0XG 3T1HQ 1F2RC 3ER0A 1QZGA 1RFKA 2CJOA 4AJYB 1F0ZA 4MDKE 4DV3Q 3WAPA 1N6ZA 4HJ9A 2CH4W 4DV1L 1VQIA 1GG3A 1UD7A 4XIGS 5FK9C 1L0XB 1L2NA 1DOIA 1IZ6A 1XMOL 1XTDA 4R3DA 2JT4B 1SRUA 2E8GA 3B9JA 2VB2X 3MWYW 3EA6A 4N9TA 1WM3A 1Z2MA 4F8CB 2M00A 3NS1A 2JUOA 2MJEA 2DAJA 2GB1A 3NUCA 3GB1A 1WX8A 2G4SA 4K81A 4NQKE 1OTRB 1VQDA 2ID0A 1WD0A 3C1EA 4GNXA 1AWDA 4ID6A 1STEA 1ML0D 3KF8A 2Z6KA 3MTSA 4LFCL 3VQIA 2IPKD 4ZYSA 4ACFA 2B63B 3V62A 3UGBB 3N1XC 2ICEC 5IT9E 1K0SA 2JA5H 4K8IA 4RCNA 2LVOA 4LAAA 1OTCA 4DR5Q 3S1NH 5E1FA 2EKIA 1ACCA 2O6VB 1X32A 2YTVA 1RCVD 4A3BH 3EHVA 1KLUD 2DY8A 1HA6A 1PA6A 4EZLA 3CCUA 4DV2Q 1WR1A 5BO4B 1ZP0B 1EY9A 2MJDA 5CBEE 4XDCA 1LTID 1PXUA 5EPJA 5IYCH 2WS3B 1FPYA 2IX3A 1KHIA 1E0BA 4IFDG 1EIHA 3AECB 3VR4A 4GIVA 2D3GA 4X57B 4A3IB 2KHJA 1PRTF 2PVOD 1A3TA 2LGSA 2WACA 4O2DA 4JYAL 1J19A 1BVSA 3C2PA 4KVGB 1GAQB 2BB5A 5LMNQ 4LDTD 1VF7A 2WXGA 1KXLA 2N9EB 3LWEA 3KJPA 4YTMB 2C7MB 3J80E 2WX1A 1IBXB 1I3QB 1BUIC 1T3QA 1E5WA 1Z9FA 3I8ZA 4AYBG 1FRDA 3GTPB 2MQHA 1C77A 1E90A 3FPUB 1U4MA 4UP7A 4P72A 2NVXH 4W9JA 4FF1A 2QW7A 4RM8A 4UHVA 1PTOF 1V5TA 3EECA 1CHPD 4S0RA 3I2ZA 3M3JA 1CMXB 4XE0A 1HQMC 4IUQA 2PE6B 4A3MB 4EZKA 1VQ9A 2KECA 2JSOA 1LYLA 1Q7YC 4HCNB 2ZJQA 3SFEB 1J8CA 4JPBW 2LZ6A 4B3RL 1LT5D 1PYWD 4YWKA 2JU6X 4W9DA 1BCPB 2CVRA 1KLVA 1HZBA 5C0XI 3TEWA 1VMCA 1ICWA 2GBKA 1XX8A 4ITKA 1TS5A 3P4RB 4KKTA 3CC4A 3MA2B 3P1HA 1T0QC 4Y7NB 2JXXA 3H7PA 1RDPD 1MI0A 2K5DA 2NVYH 4R1JA 1O7IA 3OIQA 3QJZA 3RD2A 1UAPA 3TIXA 5E6PA 4C00A 2PMZB 1PV4A 1VR9A 3D4DA 2KC1A 2SAKA 4X65Q 2D0PA 1WI0A 3RZOH 1WGKA 4DHZE 4N6EB 2LMCB 2WXHA 1PH3A 1L5PA 1Q1BA 1YITA 1D5MC 4XDDA 3C19A 2DZMA 2O2LD 3BY4B 2UXDQ 2L15A 4X64Q 4MEMA 4N9F4 5DPTA 3E0JA 3BINA 2MO1A 3RT3B 4LK1C 4XQNA 2ZJDA 3M63B 1ZGUB 1PFMA 3PRPB 1UWMA 5D65A 2L3ZA 3G4SA 2BYFA 1L1OC 4H44C 2AWTA 1NR4A 3IT6B 4ICUA 3L17A 4GKKQ 4WJ4A 4DV4Q 3RI7C 3CC7A 1HR0L 2B2TA 2AWNA 1GJZA 5C4XB 3FAHA 1E2VA 2R93B 2AUKA 2TSSA 1C78A 4WWMA 3RN2A 1GPXA 4PZ8A 3E9IA 5BYSA 2XN9C 5JEAH 2B76B 2YTXA 1YHQA 3K9PB 3SDZA 4EE2A 2RDFA 4FULA 3A5ZB 5C3WA 4HDOA 5CX3A 2BTEA 1LT6D 2AWOA 1KFYB 1EYGA 1NNXA 2F1MA 1YJNA 1VZ8A 3SDLC 2CHWA 4IFDI 5I2YA 4QGUA 1X3PA 4DR7Q 1G91A 2JWUA 2L83A 2PVGC 2XK5B 4KMUC 5CR3A 4E6IA 1WTQA 2A8VA 4G3XB 3I90A 3K0XA 2GA4B 1I6HB 1WMHA 1PRTD 1HE8A 2EYMA 1PFSA 1VQOA 1ENAA 1PTOH 4WWPA 4GLXA 2NN6H 1VZ6A 1SF0A 4JX1C 1FNUA 3CCRA 3AE1B 2PLPA 4DR6L 2PQEA 1JC7A 5FLXL 4GN3B 4K6DA 1WVLA 4IOIE 4UP8A 2EOTA 3I9V1 3H3VH 3NVZA 4LK0M 4HEA1 2K1BA 3M7GA 3A1QB 3A54A 1F77A 5IP4D 3GQBA 2QDFA 5ELCA 2JYTA 3DBLI 1WXQA 1DOYA 1PH5A 1I4HA 1HZ6A 3QAQA 1GUTA 4Y52H 1IBMQ 1D4BA 1PTOD 2Y5CA 2F0JA 1IKLA 2PPBC 1TWCB 2XTIA 2Z9HA 3ZVVA 4HKZE 4KGRA 1Y69U 3PIP3 1G8ZD 1N34Q 1VQEA 2B8GA 2R92B 2BQQA 1C4QA 4K0KL 3APDA 5AJ3Q 1SJED 3DBHI 4FBJB 2B2TC 4A3KB 1PZJD 1MG8A 4GN4B 1LFDA 2H1EA 3N52A 3SEBA 4U673 2E2IH 2LGYA 2WKDA 2A5HA 3NBHB 4TSSA 2CW0D 3PO3B 4G4KA 1VQ6A 2JSVX 2JYOA 1QQRA 2NVQB 2K9XA 4MTKA 4IG7B 2I07B 2KCMA 2V4IB 5JXVA 3AN1A 3GOEA 5FKAC 3D0FA 4GDKA 4NMZA 1H9RA 4A3BG 4JQWC 1UF0A 2N9PC 4R4IA 1S40A 2XNAC 2NS5A 4K1RB 5JZEB 2OTJA 2AEHA 5BMIA 4DV5L 3AEVA 3MJWA 5J18A 1AZQA 5IYCG 4URKA 4DR5L 1J7BA 1VQCA 1FR3A 2L55A 2IDYA 4A3FB 4OIKA 3BWUD 4PS7A 2GOWA 1SROA 1SFOH 3DPDA 2LHDA 3PUYA 2D10A 2BS2B 2HD3A 4GS3A 5AZGA 4R4CA 3HOUH 3W2DA 3UDIA 3ERQA 3BZCA 1C7YA 2WDTB 2JRHA 3V05A 1HTQA 2VQEQ 2E5LQ 2D3AA 2E74C 1WGDA 1IXRA 2QDBA 2N1VA 2ZNVC 1YVCA 4CJ2C 4YXDB 4W9EA 2F0DA 1Q12A 2YV5A 3HKZE 2ZJPA 3PMFA 1PH9A 2LVQA 3TP7A 2NZOA 2JA6H 3Q2AC 5LMNL 1EIGA 2WU2B 2LXKA 3VXWA 2G9DA 2LVPA 1C4CA 2OHFA 1AARA 3I3TB 4W9GA 5HY6A 4DK6C 3I4MB 2K6DB 2M4NA 2NVUI 4JE3B 4PG3A 1KAAA 4AJWA 3DWMA 4YWMA 1LM0A 4B08A 1IW7C 3IAS1 2NBWB 3BK1A 4DR4L 2NYZD 2WXJA 3ECIA 4KZ0A 1KM7A 3N6RA 2LUEA 1YNXA 2KANA 3T4AC 4IO9A 1A2TA 1K51A 4W9FA 4JI3Q 2L1AA 3AI5A 3PO0A 5C1ZA 5A2QL 4ANUA 4ICVA 2B2VA 1V80A 2K5PA 4DR1Q 1FNVA 4B9XA 2XBBC 1K8MA 2EE1A 3H7SA 2VQFQ 3KWVA 3PREA 1SBBB 4C3HB 1SE8A 4Q0FA 2BWES 2V3SA 4R8IA 1FVIA 4NAMA 5K5PA 3MXGA 1VQLA 4CDCC 5IYDG 2BA1A 4BKSD 4EFOA 1HH2P 5D3IB 1TIFA 1S5ED 2I46A 1N61A 3B2FA 4XQJA 5GMVA 4RA8A 2YU9B 2PPHA 4X65L 5KGUA 4GOPC 2UUBQ 3A9JB 1Y1WB 2FIFA 3DCGA 2EMTA 1EIYB 1L4DB 2UXDL 2WAQB 4X64L 3K5NA 2YEPF 2XRSD 5IGDA 5LL6S 2JVCA 5CC4A 1F1HA 4TRDA 1TJEA 4BY7H 5DAUA 1FXAA 5JEAG 4KJOA 2MPMA 2RCFA 1QLBB 4RMFA 4PMBA 3AM9A 1N60A 5M3MB 4L1BA 3BG3A 4DV4L 4JI8L 5G55A 2QC8A 5LHY1 3GTQH 5C6AA 4PNYA 4UDUC 2MNAA 1CM9A 3ULPA 1WJNA 3PLVA 3SR6A 4TQ0A 4IUNA 1G51A 4YSXB 1X3GA 3CMMB 2PZWA 4LMQD 5M3FH 2O5IC 1GJXA 4NJCA 2BPSA 1PDXA 1EQVA 3GTLB 4BKGA 1C48A 3V3XA 2KWVB 4KHPQ 2R2OA 1EQQA 4TVAB 4E74A 2NN6G 1P7EA 2INPE 3S1MH 5C4ZA 3Q24A 2MLBA 3V6EB 4BBNF 2F0FA 4DR7L 2IGHA 4YIJA 2KO3A 5LNK1 1CK1A 3EFXD 2RGFA 3OTOQ 2R3ZA 4R4QA 4ARIA 4NXNQ 2MJ8A 1K8OA 2FINB 2ZCCA 2OXPA 3VA7A 3PGZA 3RLNA 2HHHL 1CJEA 3IBEA 5DCNA 4XGAB 4LNKA 5IOCA 4II2B 4L5TA 3JAMc 2Y5BB 4IKGA 3TS0A 4MT5A 2FMCA 1WZ0A 3KDFA 2EJFC 3DM1A 2XGTA 4A93G 1HZCA 2M19A 4O1NA 2Z0SA 2KLGA 1HNWQ 3EIVA 2D11A 1PFNA 1BBXC 3I4NH 2KZRA 4KHZA 1EY5A 2WINB 4GNXB 3CQZH 2NCNA 1WJ6A 1SNPA 3H0GH 5CV6A 2VL6A 5HG2A 1IBML 3I73A 3UE1A 4ZOHC 1RD9D 4B3TL 2BH2A 2RSUA 1KDAA 3ONAB 4DUYQ 1KRHA 4A76A 4ZRKA 5AEKB 2OJRA 2ZW0A 1C4AA 3AEFB 1X55A 4DPGA 5AJ3L 4J3OD 3SK6A 3MHBA 3CC2A 3AH7A 3R3OA 2EJGC 1MKHA 4ILWA 2KENA 1GOZA 5AZHA 4JI7L 3SVMA 1IBLQ 4YSYB 4HCSA 1AEXA 2ICIA 1YJJA 4IWOA 3OHXC 5ELDA 5EE0A 1T5EA 4G7HC 3Q6BA 4WJNA 5D94A 3H9DA 3D6WA 3W5UB 1LTRD 3WWVA 5GAGC 5KYIA 1OQQA 2IO0B 1VQFA 1QF6A 1RIPA 4MGKE 3H91A 1L1OB 5BR8Q 2KDIA 3W1SA 4ZRQA 4LJZC 2IY0B 2MRPA 2J42A 3C46A 3S2DB 2PNRC 3E9HA 2ZCBA 2D2CC 3J81c 4ZHOA 3SD5A 3AEEB 3Q8DA 1YNNC 2VS1A 1RTNA 4OZAA
chains in the Genus database with same CATH topology
4A3JB 4KGSA 2NVTB 1QKZA 4QIWB 2RSNA 2K0PA 4ZAIA 5T1GA 1V43A 2R61A 2F3WA 1SNMA 2SEBD 2D5DA 1VDZA 1FCCC 1S5BD 5CV9A 5JPNC 1DD2A 2NN6I 3QIAA 1JWAD 3DUZA 1NCVA 3EVQA 1XF5L 2ON8A 3HVDA 5C44B 4QF4A 2INNE 3QO2A 2B8FA 3NBIA 4IDIA 4AYBB 3FKIB 1W6KA 4RNAA 1YJIA 1HCZA 2MP1A 3CHBD 3MAQA 3AEBB 5A35A 3HGBA 2EJMA 5LL6X 3BYTB 4FXKC 4RKLA 1Z6HA 3FMCA 4MM3B 4ARCA 5JJZA 3SXHA 3QWNA 1WWTA 4B9WA 1U9RA 5D7GA 2Q5WD 1I4PA 4Z9CB 2XWJB 4KKJA 3UI2A 4G7ZC 1BQQT 4TMAB 5KRUA 1EOTA 4REZA 5CV5A 1XO3A 3D4RA 3L4PA 3EQLC 3AE2B 3R2TA 4WQMA 3U9SA 1G6ZA 4QB4A 5E3FA 3MXNA 5D14A 3W3AA 4OW0A 1OFFA 2F0TA 1SYFA 1FXIA 4MIUA 3HG9A 2DYMA 3C3LA 3MXPA 2CU3A 5I9PA 4KY6A 3Q8FA 1ZDXA 2SNSA 1IKMA 4LLGM 4XTCS 1R4PB 4WORA 2JQRB 1NAPA 1EYDA 2J4XA 4HR7B 2E75C 2EPBA 1MD2D 4A8XC 1EY4A 1XCQL 3U9OA 1LLRD 3J9CA 1UNSA 4KV6A 3ZYYX 1RM6C 3AE5B 3BS1A 2HQEA 1EU3A 3TP8A 2V4DA 4PV1C 1ROEA 3AEDB 3P4QB 3A56A 3O13A 2V3NA 3AE8B 4AS1A 1CFMA 1WYGA 2WLBA 1SIJA 4BWGB 5IGBA 1N5XA 1SYDA 2A68C 3EGRA 2K5WA 3RLFA 3VR2A 5G5HA 3QG1A 3A55A 3D8GA 3LYYA 4OZBA 2WXLA 3HOVB 1V1PA 2LY7A 4GDKB 1G291 2MEKA 3BYYB 4JWSC 4C7ZA 5ELEA 5CORA 1K53A 3S1RB 3MXUA 4RH6A 3RUZA 2EZVA 2RA4A 2MUYA 2L5TA 4HCEA 1JCKB 2BB6A 4DXFA 3S1NB 5E4XA 2VZKB 3TEYA 1TWAB 4DU9A 3DWGC 4A3BB 1E10A 4HJGE 3QOJA 1Y8NB 3X3MA 1JOKA 2CQAA 3IFTA 4FYDA 3S17B 1X3QA 4QUFA 4A6QA 2LJIA 2F4IA 3HS0C 3SK8A 4YSZB 1Y8OB 3CIRB 3GTMB 1UWXA 1HA5A 4RGTA 3NWSA 4FXCA 3S14B 2QJLA 1CA5A 2M0AA 5KNBA 3U4EG 2K05A 3KK7A 4KN4C 1SYGA 2PW9A 4BBSB 2RPVA 3W5VB 3I57A 2A6EC 1XLOA 3FC4A 2NBFA 3DEOA 2OT2A 1C4PA 4OO1H 4RWSC 2EXZA 1TWFB 5JOBA 4B0MA 3U52E 2NVYB 4MACA 3ZJUA 3D31A 2WDVB 3G7LA 3HP3A 1CZPA 3ETRA 4KKIA 3RZOB 1Q8IA 1LTAD 1O7YA 2JA7B 3VR6A 1TKGA 1EEFD 3KQ4A 4ZLTF 1LT4D 1RODA 1TS4A 2L12A 3PUWA 2G1EA 2E76C 1RKNA 3JAML 4KX6B 1WTPA 5FLXE 2SOBA 1JWBD 5ELBA 4V0BA 1LABA 1PGBA 1C8CA 4KI0A 4RHRA 4BA2I 3CWIA 1F2MA 1ET9A 2RDHA 2IW3A 2XWBB 2A6HC 2PO4A 4JBWA 2WDRB 3K57A 2MH7A 1STHA 2J7ZA 4KHVA 2HDEA 1CHQD 3CU7A 4OZCA 5AUIA 2B2UA 5DM63 3MEHA 2GI9A 4HMJA 4ZKCB 3K0YA 2A69C 3OWFA 2L1BA 1EYCA 1IYVA 1LTBD 1SSOA 2BE5C 4H7BA 3TN2A 1JR0D 3GV6A 3P4PB 1GHKA 1E7PB 4J6HA 3SK4A 1G2SA 3HOXB 1Z7TA 1CTMA 3H94A 1KTKA 1DYQA 3J81L 4H2AA 4A93B 4ZHPA 4MHEA 4B0EA 4TKOB 4K5XA 1HUNA 3OMGA 1VRAB 5BN4A 1SMYD 3TZDA 4C56C 4M1UB 1TQOA 5EGTA 2NWGA 1TKEA 1LACA 3D4WA 5C3XA 2Z4IA 3VR3A 1VZ7A 1R4QB 1RHPA 3H6MA 1QOHA 3IAYA 1I7HA 1GUNA 2D5GA 5I2XA 2PYKA 2KA7A 3HOYB 2WIIB 2EY6A 1MSHA 2LFIA 3E56A 3TEXA 3V96A 2HCCA 1BCPF 3DHQA 4XQQA 2OF1A 2QIEB 5NUCA 3K5LA 1SB3C 3NQTA 3HOZB 3NRZA 2PZTA 3C1FA 3GTGB 3D6CA 5A2QE 1TU2B 3Q22A 2IWHA 1O7ZA 5BYQA 4CKBA 4HEDA 1TVXA 1DONA 4NW2A 2JA6B 5K36H 4ME5A 1D1IA 3NVWA 1YN4A 3MJ5A 4DNRB 4RGOS 3BDCA 2KQ4X 1NYRA 1RJTA 4U68A 4HKQA 1TY2A 1XXGA 5G5GA 3P75A 4OO1G 1U4LA 1TS2A 2JA8B 2VNUD 1A3UA 1DZ1A 4HN7A 4FVMA 3MZ5A 1GUSA 4CKCA 2DNCA 1I4RA 3GP7A 5DNFA 2K03A 3BK2A 1UGJA 1YNJD 2HCIA 3WCQA 3KLSA 2OEDA 3T3OA 1STBA 1JRPA 4DFAA 3NZ3A 2WKCA 1YN5A 4X3TA 2MGSA 4C80A 2KMMA 2WP9B 2L9HA 2VB3X 1C9FA 1AW7A 1Y8PB 1KNEA 4EGVA 2EY5A 5D3DA 1L4ZB 1FEHA 1VF5C 3FPPA 3L9AX 5BMGA 1SYBA 3BZDB 1BUVT 4BY7B 1STYA 2BDNA 1QNKA 2W55A 2C5CA 2ONQA 5JVG3 1ZDVA 2B2WA 1HUMA 2W82A 3K5MA 4KY5A 3GTQB 1GB1A 2WXKA 4A55A 1HFGA 1CT1D 4WURA 1WSPA 1BCPD 4NP5A 2B2YA 5M3FB 4ZRPA 4ZK9B 1A3VA 4JK1C 4NZLB 5EBDA 2FMMA 3V2TA 4DK0A 1J9OA 1L0YB 3KBGA 1EWHA 2KQ3A 1TS3A 2WQYB 2V0GA 1QJOA 2AQ1B 2EYLA 2F0PA 2Z4HA 2F03A 1PGAA 4JPSA 4A90A 3UI3A 2K22A 3I4NB 2EDGA 1OXSC 1SE4A 4OO1I 3A8KE 3CQZB 1DGJA 1U4RA 2RSOA 3AE7B 2NUCA 4IFDJ 2M2LA 2X6GA 4OVZA 1ZXTA 4IALA 2RDGA 4OHJA 2X6LA 1WCMB 1L6UA 4PT5A 5CV8A 4OL7A 1BF4A 4KD3A 2CHBD 5J1ZA 4KN7C 2JE6I 1EY6A 5IGCA 4X3SA 5EE3A 1MBYA 1NYQA 1JALA 1H9SB 3AEGB 2HDLA 3IT4B 1D5XC 2F0LA 2FFKB 3KBXA 1JOQA 2WB1B 4K2KA 3VR8B 1JB3A 4M0WA 1OO9B 5CMDA 1DOMA 1MSGA 4ZRZA 2LKVA 3IKJA 2A68D 3Q23A 2Z1CA 2N9LA 5C4JB 3T53B 5K36G 4EQOA 4A3GB 1JE4A 2OEOA 3CRLC 1ZKOA 2E2JB 3J7YW 2PIAA 1QOBA 3HRZC 1STGA 5IGGA 4HSVA 3J7AF 3E9SA 1K50A 5EKKA 1NSNS 3SR1A 2B2VC 3ZJTA 2BT6A 2WU5B 2CJNA 4L2YA 2JP1A 2PTLA 5COYA 4RGNA 4QUCA 4DXGA 5IGFA 4DN4M 2MHVA 1EQTA 3E5SA 2L32A 2BCOA 4GDLB 1B2TA 4K5VA 2XSCA 3K7AB 1QOFA 2DY7A 4ZQ3A 2W54A 2DWQA 1KABA 3LXFA 1CQVA 2F0VA 4FXGC 3SHLA 2F0MA 4L8JA 4I7ZC 3VR5A 1B9NA 1YNTE 3MP9A 5J22A 1N5WA 1JORA 3NVVA 1E0ZA 2TMPA 2MJ3A 5EE9A 3BDOA 1UEAB 3NTIA 2A6ED 4GZYC 1PRTC 1PFBA 4X3UA 2E6XA 3H09A 1HTPA 4BBRB 5TSSA 4RGMA 4I65A 3ABVB 2IX0A 2K04A 1TWHB 3NTHA 5EPLA 1C79A 1E9MA 3WOEA 4ULLA 1ZUD2 2EYPA 1TIID 1PTOC 3S2HB 1DM0B 1MVKA 4J1MA 1SE3A 5T8IA 3H3VC 1QG7A 1NVID 1R9TB 1O78A 2CW0C 3DWPA 3PV0A 4XDXA 3BIID 5BYRA 2F0WA 1A6XA 4US8A 1F2LA 4ZUJA 1IYUA 3AMZA 3RPFC 3TMEA 2Q8IB 1NUCA 2A6HD 3FILA 1B3AA 1NR2A 2LFNA 4AQ7A 3RD4A 1ILQA 5FO7B 3VYSA 2ZXRA 3RMHA 1Q90A 3AU7A 3A7LA 2N88A 2KDMA 4KY7A 3A8IE 4WFN3 1DCZA 4USAA 1BO0A 2KUMA 2WXPA 1WRIA 2BE5D 2N55A 3SK5A 5CGKA 5EKIA 2KACA 3PO2B 1EL0A 1QCBD 1B1ZA 2KN4A 1VJKA 1JWUD 4BA1I 4RAUC 3KUPA 4TQUS 4CGYB 1SXTA 2JEAI 2K01A 4XWWA 3GD7A 1QOAA 3M4OB 1ZEQX 1CI3M 1F2ZA 1MHXA 2LUMA 2RKSA 4DGZA 2I2YA 5KNDA 3NBHA 4RKBA 1TYGB 3TDQA 1ZXIA 3VR9B 1BDOA 2BS4B 4DQOC 2JZPA 5JEAJ 3JAME 4HRSA 5I9OA 2PCFB 3ZJVA 3SE0A 5HGTA 1STAA 3H8HA 2E2DC 2IJ0A 3VYTA 3U7ZA 3TEZA 1EY7A 2LS01 3AE4B 1RF2D 2EYFA 2NZ1D 1M4VA 5H8YE 4NKLA 2AUJD 2PW5A 4O42A 3T3NA 3MC0B 3TZUA 2QSDA 3HKZB 3NP8A 2BS3B 4EQPA 2BYTA 3K6OA 4Q5VA 2O5JC 2WXFA 1FFVA 1KDBA 2J52A 2ZW1A 2JA5B 5KYLA 4DAVA 4L23A 4M8AA 1LV9A 4PMCA 1YQ3B 2RQXA 2J53A 3LWUA 3LX0A 3J81E 4FNFA 4MH8A 1IL8A 3HOWB 2ACZB 2GRIA 2M56B 4N9PA 2Q8TA 3NWTA 4IUPA 4HTHA 1GUWA 3QJYA 2D62A 1MHHE 3Q0AA 2EYJA 1EYAA 1JMLA 2BDOA 4KGTA 1DOXA 3I72A 4FO2A 2NVXB 1W6JA 3AE6B 2W3RA 3VYUA 3TP5A 2L0CA 1SNOA 4DNTB 4JWUC 4R8NA 2L52A 3KLSX 3P63A 3HUIA 1AYFA 3KWLA 1FM0D 5BN3A 1PFDA 2F0EA 1XTCD 5DEHA 5EJWA 2L11A 4QMGA 1RTOA 1DJRD 3WOFA 1FGBD 1T5XD 2I38A 1PUTA 1OXVA 2DN8A 1YMHE 1E2ZA 3A7AB 1XLQA 3Q69A 3K59A 1F2RI 4CQNA 4ZUIA 3NQIA 1NI3A 3NSWA 2PMVA 2JX5A 2KAJA 2AX5A 4XT3B 3AE3B 1EFID 3TP6A 1AN8A 2WP8J 3NE5B 4C3JG 1PLFA 3SFDB 1IW7D 2F0NA 3BVGA 1D1KA 1K83B 1YN3A 1PRTB 2V3PA 1IGCA 2F3VA 5CV4A 3VA5A 1ZYRC 2WDQB 4RHSA 3AEAB 1JWSD 1HPCA 1HTLD 1LO5D 4CJ1B 2N9KA 1F2YA 4P6VF 5IGEA 2PKOA 1D6EC 4K14A 2EYOA 4K5WA 2FBWB 1PTOB 1TZOA 1EY0A 1L6VA 1WD1A 3VYRA 2F0UA 4H13C 1JW9D 4YTPB 3K58A 2W3SA 2N7JA 1BNZA 1CQFA 3LNNA 1LT3D 4TQ1A 3DMUA 2VZKD 4A9AA 4C3IG 4DAYA 2RBMA 2J0TD 3MVVA 4HSPA 2ZXOA 4HAEA 1GHJA 5EPKA 1S5DD 4OIJA 3HEJA 2F0HA 1AZPA 2PZUA 3ND8A 1ENCA 1HFNA 4F7XA 1FFUA 2E2IB 4OGQC 2KHSA 1AFPA 3P42A 5BN5A 1QILA 2ZXPA 1ZOYB 1FNWA 1HXYD 4EVOA 2JYEA 2B39A 2N0SB 3NVYA 2BOSA 3PUZA 1FYCA 1XYIA 2B2UC 1Q1EA 3Q8EA 1DXMA 1F9SA 4C1NI 3K5OA 1KH0A 1SFOB 4P16A 2DLBA 4L63B 3IFDA 3HOUB 3EROA 4WIPA 2DYOA 1V8QA 3S16B 3T51B 1ILPA 2NTTA 1RYJA 1EM7A 1IUEA 1IHZA 1JICA 2K32A 2WXOA 3CRKC 1XCTL 4YT0B 3NXWA 4Q2JA 5T1IA 4XYOA 4G7OC 3Q8CA 1L0VB 3MFYA 1ZXHA 1S4ZA 3IXSA 4F88A 2WXMA 4FF2A 3FILB 1II3A 3QOLA 3FEWX 2WV6D 2EY1A 5AFWA 2ENBA 1EZ6A 1QB5D 1QOGA 3ND9A 1YNND 5J39A 3HRDD 5IT9L 1C76A 1H9MA 1FMAD 5MPOA 2K28A 3AE9B 1ZPSA 3VRBB 1V1OA 3T13A 1J7AA 5KIXA 1GUOA 1JROA 2KEDA 1KDCA 2R6GA 5C3EB 2K6AA 2FJ2A 1EY8A 1FIQA 5GXGB 5C0XJ 1F9PA 5C5LA 4IURA 3B2GA 5C3JB 2KJXA 3LB8C 3VRAB 3J80L 5FOBB 1JQYD 2M9VA 1EEID 1SE2A 3M3YB 1P7FA 4FXDA 1UUPA 3CKIB 3GO5A 5I6YA 2X38A 4H0LC 3BDLA 2IT1A 1OXTA 5HHDG 1TKYA 3R93A 2QILA 3S1MB 3RFZB 2EYHA 3NUHB 4ODGA 1BR9A 2JEBI 4K8JA 3W9CB 5FO9B 1N62A 3E6ZX 5CV7A 3NHHA 1A2UA 1V1PB 4G57A 4X3KA 1MPEA 3R2IA 3F2UA 2WXNA 4RF0A 3P4SB 2AQ2B 4PQXA 1HQRD 4CBVA 2IGGA 1XLNA 1LTSD 3PUXA 1OXUA 3PZ8A 3H0GB 5AUKA 1B53A 2F0IA 1SNDA 2QF7A 1YQ4B 5H92C 2Q8RE 5HI1A 1TY0A 3M85A 2B2WC 3GS2A 2SNMA 3MHZA 4QCLA 5C2TB 3ITPA 2YEPB 5FO8B 1QNUA 4MN3A 2A74C 2B2YC 1LTGD 2WXRA 4F8MA 1PZKD 4DK1A 3RZDB 1O80A 3PIO3 4C7YA 3HVZA 3AV8A 2F0SA 3GV3A 3OMCA 1XWEA 4IUTA 3NTKA 3P7JA 2A73B 2EVBA 1SNQA 1WTRA 2IL8A 1A15A 1EWYC 2NB0A 1B4OA 1U4PA 1I4QA 4UAIA 4ABNA 1ESRA 1H9KA 4HMIA 1T6BX 4BS9A 2AQ3B 5E6JA 1WTWA 1F9QA 1QWYA 2Y3AA 1GXDC 3U2SC 1IBXA 2Y5PA 4RCOA 2KVMA 3D3RA 1WTVA 5CYUA 1SMYC 3OSOA 5ISRA 3BVZA 3FVQA 2C9OA 1HZ5A 1TKWB 1Y56A 1NEKB 1CZWA 2PW7A 3I91A 3X3NA 2JXTA 5EBCA 1B9MA 2O4XA 3WDNA 2XRQD 5BMHA 3OIPA 2F0GA 3AB9A 1Q3LA 4RF1A 5EE1A 5FR3A 1FD7D 2F0QA 4J8QA 2KCCA 3C8YA 5ELFA 2VUMB 1HEZE 2RVLA 1EU4A 2KWDA 2LHEA 3HZXA 5M5YB 2K5QA 4F87A 4WJWA 5G3LF 3DWQA 1I50B 4XXEA 4R9WA 1VCIA 3URYA 4FF3A 1H9JA 3R8BA 2BW2A 4C3JB 3DXJC 1ENFA 3L3OC 2E2HB 1ESFA 2EY2A 3GTOB 4GLSC 1SYEA 3IAM1 4FP5D 5IODA 1JOOA 4DA2A 3AB5A 1PMRA 3FRPB 2FHTA 2H88B 3TBIB 5HURA 4YWGG 2VXWA 4N59A 4NDXA 3EJIA 3NK9A 1N63A 1YNJC 2LEKA 2LMCA 3N9YC 3DWAA 4V190 1CA6A 1GUGA 2KEEA 3L7ZC 1ZE3D 3S9WA 1OXXK 1Y1VB 4KD4A 5KNCA 4DAPA 2IGDA 1SAPA 4DF7A 3Q8BA 2Y0SB 1WTOA 3KLRA 3DEPA 1O7LA 4C3IB 4NAWB 3OOCA 3PUVA 2ZT9C 4KKUA 3OW7A 1I6VC 3I70A 3TSSA 3QB3A 1ZYRD 2WNMA 4P2CB 2DBYA 1J7CA 4K6LA 1WTXA 5EQ0A 4LTUA 4CJ0B 1R7SA 1XLPA 2YYZA 1HHVA 1B9RA 3IL8A 4KJNA 1BMLC 1BCPC 2A69D 5I4DA 5EKLA 4WH4A 1OQRA 1JWMD 1QE6A 5HFYA 5C0XH 2QEJC 1S5CD 1SEBD 4WRDA 2QCPX 5C5MA 3ZGZA 1VMPA 3AMUA 2K3UA 4US9A 4EQNA 2HDMA 5G3LD 4A3EB 2KCNA 2KOLA 3MFGA 2X69A 5KEEA 3P1MA 2E3TA 5M5WB 1ET6A 4C1NK 5JPMC 1SJHD 3ZQ4A 2WXQA 5JVH3 1SNCA 3I3CA 5M9OA 1Q10A 1MI2A 2D9UA 4FF4A 1EZ8A 3T56B 3T16A 4XYQA 4N58A 1LTTD 1SSNA 4IUVA 2Z8LA 1JQ4A 4CHTB 3P20A 5DM73 4L6TB 1S5FD 3M7NA 4S3SA 1AP0A 2H4OA 1NENB 3I4LA 4IFDH 4KTAA 1D5ZC 5I6WA 3NPPA 4KKSA 4ZKBB 1BXTA 1PGXA 3GTJB 2JXMB 1E2WA 1CZGA 2H89B 3OWEB 2NMQA 4XWTA 3A8JE 1DOLA 1B50A 1FD6A 2L4NA 5JAVA 1IGDA 1SYCA 1PDQA 3PZ7A 1SDFA 2DNEA 2K33A 2F0OA 1I4GA 1FO4A 4BY1B 3FDTA 4C3HG 2XIWA 4IUUA 1F9RA 1I4XA 2BA0A 2XVSA 1XEEA 3GTKB 4HROA 1G2TA 5F2DA 1V8CA 2RMMA 1D2BA 4IZ8A 2HTME 2FUG1 1RWSA 4D2KA 2BBCA 3S15B 2IX1A 4KK7A 2WXIA 1A70A 3Q6SA 4YTNB 1FCLA 4PMWA 1Z47A 4CKEA 3BVMA 1TR5A 1TT2A 1GB4A 4IQZA 5CBAE 5M5XB 3J7AV 1M8AA 3EUB2 5C4HA 5E4WC 1STNA 1V97A 4XT1B 1QT9A 1TWGB 4RFBA 2SDFA 2R7ZB 2G9HD 3OPOA 1MGSA 1B44D 3M4YA 2LGIA 3Q8AA 1ONLA 1H9SA 2QKIC 1FRRA 1E6EB 2F0KA 1KNAA 1VDVA 1KLGD 1K52A 4K2LA 4A3DB 2HUGA 1EWCA 3G6JB 4WAFA 1DOKA 3S1QB 2NTSA 2QMTA 5IIFA 1BOSA 1HRJA 1KF6B 3TUOA 4C2MB 1VLBA 4IN3A 1PZID 2EELA 2K7VA 1J8IA 2FE8A 5C0XG 1F2RC 1RFKA 2CJOA 1F0ZA 4XIGS 5FK9C 1L0XB 1DOIA 4R3DA 3B9JA 2VB2X 3MWYW 3EA6A 4N9TA 2M00A 3NS1A 2MJEA 3GB1A 2GB1A 3NUCA 1IBXB 1WD0A 2ID0A 3C1EA 1AWDA 4ID6A 1STEA 1ML0D 3KF8A 3MTSA 3VQIA 2IPKD 4ZYSA 2B63B 2ICEC 5IT9E 4K8IA 4RCNA 4LAAA 5E1FA 2EKIA 1ACCA 1X32A 1RCVD 1KLUD 2DY8A 1HA6A 1ZP0B 1EY9A 2MJDA 5CBEE 4XDCA 1LTID 1PXUA 5EPJA 2WS3B 2IX3A 1E0BA 4IFDG 1EIHA 3AECB 3VR4A 4A3IB 1PRTF 2PVOD 1A3TA 2WACA 3C2PA 1GAQB 2BB5A 1VF7A 2WXGA 3LWEA 4YTMB 3J80E 1I3QB 1BUIC 1T3QA 3I8ZA 1FRDA 3GTPB 1C77A 3FPUB 1U4MA 4FF1A 1PTOF 1CHPD 4XE0A 1HQMC 4IUQA 4A3MB 2KECA 2JSOA 3SFEB 1LT5D 1PYWD 2JU6X 1BCPB 2CVRA 5C0XI 3TEWA 1VMCA 1ICWA 1XX8A 4ITKA 1TS5A 3P4RB 4KKTA 3MA2B 3P1HA 4Y7NB 1RDPD 1MI0A 2K5DA 3OIQA 1UAPA 2PMZB 1VR9A 3D4DA 2SAKA 1WGKA 4N6EB 2LMCB 2WXHA 4XDDA 1L5PA 1Q1BA 1D5MC 2O2LD 3E0JA 4LK1C 4XQNA 1PFMA 1UWMA 5D65A 4H44C 1NR4A 3IT6B 2B2TA 2AWNA 5C4XB 3FAHA 1E2VA 2R93B 2AUKA 2TSSA 1C78A 4WWMA 1GPXA 5BYSA 2XN9C 5JEAH 2B76B 3SDZA 4EE2A 2RDFA 5C3WA 2BTEA 1LT6D 2AWOA 1KFYB 2F1MA 1VZ8A 4IFDI 5I2YA 1X3PA 1G91A 2JWUA 2L83A 2PVGC 4KMUC 5CR3A 4E6IA 1WTQA 3I90A 2GA4B 1I6HB 1PRTD 2EYMA 1ENAA 1PTOH 2NN6H 1VZ6A 1SF0A 4JX1C 1FNUA 3AE1B 2PLPA 2PQEA 1JC7A 5FLXL 4K6DA 1WVLA 4IOIE 2EOTA 3I9V1 3NVZA 4LK0M 4HEA1 2K1BA 3M7GA 3A54A 1F77A 3GQBA 5ELCA 2JYTA 1WXQA 1DOYA 1I4HA 1HZ6A 1GUTA 1D4BA 1PTOD 2Y5CA 2F0JA 1IKLA 2PPBC 1TWCB 4HKZE 4KGRA 1Y69U 3PIP3 1G8ZD 2B8GA 2R92B 1C4QA 1SJED 2B2TC 4A3KB 1PZJD 2H1EA 3N52A 3SEBA 4U673 2WKDA 2A5HA 4TSSA 2CW0D 3PO3B 4G4KA 2JSVX 2JYOA 1QQRA 2NVQB 2K9XA 2I07B 2V4IB 5JXVA 3AN1A 5FKAC 4NMZA 1H9RA 2XNAC 5BMIA 1AZQA 1J7BA 1FR3A 2L55A 2IDYA 4A3FB 4OIKA 3BWUD 2LHDA 3PUYA 2BS2B 3W2DA 3ERQA 3V05A 2E74C 2QDBA 4CJ2C 4YXDB 2F0DA 1Q12A 3PMFA 3TP7A 1EIGA 2WU2B 2G9DA 1C4CA 2OHFA 3I4MB 4JE3B 1KAAA 3DWMA 4B08A 1IW7C 3IAS1 3BK1A 2NYZD 2WXJA 3N6RA 3T4AC 1K51A 1A2TA 2L1AA 3PO0A 5A2QL 2B2VA 2K5PA 1FNVA 4B9XA 1K8MA 2EE1A 3KWVA 1SBBB 4C3HB 4Q0FA 4R8IA 4NAMA 5K5PA 3MXGA 2BA1A 5D3IB 1S5ED 2I46A 1N61A 3B2FA 4XQJA 4RA8A 2YU9B 5KGUA 1Y1WB 1L4DB 2WAQB 3K5NA 2YEPF 2XRSD 5IGDA 5LL6S 5CC4A 4TRDA 1TJEA 5DAUA 1FXAA 5JEAG 4KJOA 2MPMA 1QLBB 4PMBA 3AM9A 1N60A 5M3MB 4L1BA 3BG3A 5LHY1 5C6AA 4PNYA 4UDUC 1CM9A 3SR6A 4TQ0A 4IUNA 4YSXB 2PZWA 4LMQD 2O5IC 4NJCA 1GJXA 1PDXA 1EQVA 3GTLB 1C48A 3V3XA 2NN6G 1P7EA 2INPE 5C4ZA 3Q24A 2F0FA 2IGHA 4YIJA 5LNK1 1CK1A 3EFXD 2R3ZA 4ARIA 1K8OA 2MJ8A 2FINB 2OXPA