1FNUA

Structure of streptococcal pyrogenic exotoxin a
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
221
structure length
221
Chain Sequence
b'QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYTIDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDNKTSQIEVYLTTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOTOXIN TYPE A PRECURSOR (ALLELE 1)
molecule tags Toxin
publication title Structure of streptococcal pyrogenic exotoxin A reveals a novel metal cluster.
pubmed rcsb
total genus 59
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fnuA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fnuA02
1RCVD 1PRTB 1EWCA 3R2TA 1EEFD 1I4GA 1LTGD 5D3DA 2QEJC 3R8BA 3R2IA 1KLUD 2NTTA 3KLSX 2QILA 5FKAC 4RFBA 1B1ZA 1LTAD 4Z9CB 1LTID 1D5ZC 1T5XD 1STEA 5ELBA 1BCPC 1HXYD 1PTOC 4UDUC 1JWSD 5I4DA 3EA6A 1RD9D 1AW7A 1PTOB 5ELEA 5ELDA 4OHJA 4C56C 4RHSA 1SE2A 1SXTA 1LT6D 1JWUD 1PTOF 3TSSA 2XRQD 1LLRD 4DXGA 1SEBD 1TY2A 5ELFA 1SE3A 1FNVA 1LT4D 1RDPD 1XXGA 1FNUA 1SJHD 1HA5A 3DWQA 4RGNA 2IPKD 1JR0D 1S5FD 1PZID 1JWMD 1I4HA 1JQYD 2RDGA 1PZJD 1TY0A 4L63B 1I4XA 1EU4A 2NTSA 1LT3D 3EFXD 1M4VA 2WV6D 3DWPA 4O1NA 1YN5A 2AQ2B 1ET9A 4L6TB 1FNWA 1CT1D 4RCOA 1AN8A 3BVGA 1SBBB 1BCPD 1HTLD 2RDHA 1V1PA 2ICIA 2TSSA 3BYTB 1PTOD 1MD2D 2R61A 2Z8LA 1YN4A 1TS4A 1EEID 1LTRD 1CHPD 1LTSD 1KLGD 3BYYB 5D3IB 1BXTA 1S5ED 4RH6A 1S5CD 1L0YB 1LTBD 3BZDB 1PRTD 5FK9C 3MC0B 2CHBD 5ELCA 1UUPA 2G9HD 1F77A 1G8ZD 1ET6A 1CK1A 3GP7A 1XTCD 3BVMA 1S5BD 1LT5D 1S5DD 1CQVA 3V05A 4K6LA 1QILA 4RGOS 1GOZA 1BCPB 1FD7D 4BWGB 5TSSA 1FGBD 4ZYSA 1KTKA 1TS3A 3URYA 1I4PA 1PTOH 4RGTA 1CHQD 1DYQA 1V1PB 1EFID 4RGMA 1BCPF 1LO5D 1TS2A 1HQRD 2AQ1B 1ESFA 3DWAA 1PZKD 4DXFA 3SEBA 1D5XC 4NZLB 1D5MC 1RF2D 2XN9C 1EU3A 2SEBD 1PYWD 1L0XB 4TSSA 1SJED 1LTTD 1TS5A 1UNSA 2AQ3B 2IJ0A 4RHRA 1V1OA 2XNAC 3OWEB 1PRTF 2O2LD 1YN3A 2XRSD 3MFGA 3O13A 1SE4A 1ENFA 3CHBD 1B44D 1D6EC 1DJRD 3BVZA 3W2DA 1I4QA 2J4XA 1JCKB 1PRTC 1I4RA
chains in the Genus database with same CATH superfamily
1V6EA 4CGYB 4HIOA 3EN2A 3TEYA 2LI5A 1LTGD 3HFZB 1C76A 1GJXA 1HNWL 2Q5WD 4IJLA 3P63A 1WXMA 2JYEA 1T9HA 1UWMA 3QIJA 4URKA 2K0PA 1PGBA 1N60A 4NQKE 3ZJVA 3FP9A 2MSED 5C44B 4DV4Q 3S17B 4L23A 2VNUD 3PUVA 3U4ZA 2CR5A 5E4XA 4DR5Q 3EGRA 3AMZA 2E2JB 1B7YB 3KUPA 1G91A 1PTOB 2KLCA 5EE3A 2WXOA 3CCVA 1X3FA 2MP1A 2WP9B 4FO2A 1A2TA 4BAXA 3WAPA 1UEAB 2XBBC 1ICFB 4BBRB 1J5EL 3HIZA 3FKIG 4APVA 1HZBA 1TY2A 1YEZA 3J7A5 1AFPA 4EQPA 3CF5A 1RDPD 2LXJA 4C3HG 3TP8A 3E9HA 3OWFA 4KD3A 1VQOA 1TKYA 4GS3A 4DAYA 2BQQA 5IOCA 2EMTA 2ALYB 4X6AH 3DWQA 1AZPA 2MGSA 4K7SA 4MGZE 4DHZB 4X64Q 1UE6A 3BDCA 1BR9A 2FIFA 1XJVA 1TY0A 4A93H 2LXKA 1G51A 4L63B 3WDNA 1E7VA 4ODGA 3A1QA 4LNOA 1RHPA 4B3TQ 1LT3D 1PXUA 2EYJA 2OCEA 3KLWA 2BW2A 3IT4B 4FN2A 1G6ZA 3U4VA 4IZ8A 1WMHB 3CCQA 4H44C 3OOCA 4GDKB 3VUYA 3MHBA 4IOAA 4WQOB 4IPGA 3JSVA 4X65L 4KTAA 1YI2A 1J7BA 1LV9A 1MD2D 3VH3B 3GS2A 1MSGA 1EF1A 2IO3B 2ASQA 2B8FA 1U0LA 2MJ3A 2PVGC 1F9RA 4LF7L 4HPMB 2ES2A 3CF6E 5J18A 2MWSB 3GTJB 2C7MB 1VCIA 4PG3A 4RH6A 4ZKBB 1VQHA 4LDTD 1Y8OB 1EIFA 1KDBA 1F1HA 4JI2L 1DXMA 4R3DA 3K8AA 4IWQA 1ET6A 2NVYB 2WX1A 1CK1A 3PO0A 1DOYA 1KXLA 4KHPL 4BA1I 3ICEA 3GZNI 3TUOA 1KH0A 1HHVA 2L5TA 4ZK9B 3PO3H 1L6VA 4KVGB 4A3FB 1JOKA 5C4XH 4JI6Q 1TWHB 1Q90A 5TSSA 2BE5D 4GOPB 1KTKA 4LWCA 1NJIC 2G1EA 3HM6X 1PTOH 1XF5L 4ZLTF 2A19A 1HR0W 1EL0A 3S1NB 1Y8PB 1WI0A 5EKIA 3QJYA 4JI3Q 3NJTA 3U2SC 5C44H 1UE5A 3ZJTA 1L7YA 4DR6L 2J0KA 1TVXA 1DCZA 3QR8A 4HTHA 4N6EB 4MTKA 4JI8L 3DHIC 2JYTA 1MG4A 5I9PA 4HIMA 1M8AA 4B3ML 5F2DA 4AQYQ 3AEAB 1TIID 4DU9A 4DR7Q 3WOFA 4DXAB 4LF5Q 2KVMA 1FRDA 2KD0A 2I07B 3WIMA 3W2DA 3OSOA 1I4QA 5IP4D 4PYUA 3QC8B 2N9EB 2KT7A 1Q1OA 3AE9B 3GTQB 1WRDB 1EWHA 3MHZA 3PZ7A 1FMAD 1EEFD 2PYKA 1SYCA 5IYBG 2QEJC 1KC8C 1YJ9A 3AEGB 5E6JA 3SHQA 2LVPA 1S4ZA 3I4OA 2PZWA 1K8AC 1FPYA 2N1VA 2Q2UA 4A3JG 4U68A 1JOOA 3A5ZB 1N5WA 1B1ZA 3M3YH 2V3NA 1TBEA 3VR2A 3VYTA 2JZ3B 4HRSA 5FJ8H 1GJZA 3GDEA 4LF8L 3HVZA 1LXDA 2Z1CA 5IP9G 3HEJA 4G4KA 4P72A 2L52A 5BO4B 2WXKA 4DV5Q 2CHXA 4R8NA 1DOLA 2ZPNA 1JWSD 3UE0A 3H7PA 4PS3A 2OEOA 1PFMA 1STGA 3WWVA 1F52A 3ONSA 2PO4A 4DV0Q 4DK3C 2B2YA 4A3CH 1CA5A 1JMCA 1VQNA 3CQZB 1SXTA 1LT6D 3OHXC 5GADC 4HEA1 1BUVT 4N9TA 1QB5D 2UU9Q 1LLRD 3KUZA 2LHDA 1TWCH 4HK2A 1Z9FA 2RSOA 4ANXA 4FXGC 5IWAQ 4WAAA 5E1FA 4UAIA 3Q8FA 1FNUA 4DR7L 1QE6A 3ERQA 1T0SC 2WHIA 1E8YA 5EPLA 3SK5A 4YY3L 2LASA 4A3DG 2JEAI 1WJUA 4EE2A 2QKIC 5C4ZA 3ITPA 5I2XA 2KDFB 4P16A 3M63B 2KFKA 3F2DA 1MJDA 1WD1A 2WV6D 2OWOA 1UEBA 4PS8A 2INDC 2J7QB 4I6PA 3W1YA 4IFDI 1JOQA 4D2KA 1EZ8A 2O6VB 1NR4A 5DAUA 4PMWA 3CPFA 4LMQD 5FOBB 4WJPA 5IAAC 3I7FA 1SBBB 1ZXTA 4R1JA 1WTVA 5HGQA 4OO1I 3PPAA 4I6LB 2J7ZA 2UU7A 3OIQA 5BYSA 2NVXH 4H02A 3I90A 5KYLA 2RCNA 5GAHC 5M5WB 2I5MX 1EEID 1NI2A 4K0KQ 3HG9A 4GLVB 4A3IG 2JJQA 3T3NA 1O78A 1K52A 1Q8IA 1MSHA 1U5KA 3A74A 4BY7B 2WDRB 3V2TA 1BDOA 3DBLB 4JVZA 3KUDB 5DPSA 1CKOA 2WYQA 3RZWC 3NVWA 5K36H 2WKCA 2DY7A 1NEKB 1ML0D 4QIWE 3BVMA 5LNK1 4DK6C 4IM2A 3KYCD 2GB1A 4MTNA 3CCSA 4K6LA 2WAQE 3S2HH 3I4NH 2M1MA 4MNOA 1I6VC 4OIKA 2F3WA 2N4FA 3P1MA 4C3JH 2EKEC 3AFQA 2K6QA 4XT3B 3NE5B 3MXUA 2CW0D 2DJFC 4IUNA 2OQKA 3DMUA 4RGTA 3U58A 1BNZA 1V1PB 2UUBL 2OXPA 1EFID 4BY1G 1UGMA 1YX5B 4MDKE 1GB1A 5C0XI 5M3FH 4AJWA 5J22A 3WA0A 2UU9L 2GN5A 1C79A 4HAEA 1PLFA 4OWWB 2K9XA 3X0WA 1FD6A 1EIHA 4DK1A 4BXXH 1E5WA 3HZXA 1SMYC 4QQBX 4QUCA 1SYBA 2MPMA 3P7JA 2Q8RE 1GM5A 2V3SA 3N32A 2NVQH 4IPDA 2MH7A 4WWMA 3PMFA 1XPRA 1PGXA 2ZM6Q 2CWAA 1Q12A 2O2LD 2K8BA 1YN3A 5GMVA 1ENFA 2NCNA 1C1YB 3HKZB 3IAS1 4M0WA 4MH8A 4B08A 2JA7B 1N36L 1H9SA 4A3BB 3L08A 4C7YA 4N8FA 3M4PA 1GKHA 2GVBA 3HOVH 2E76C 1A15A 3FHWA 3SE0A 4K7UA 1P16A 3G48A 1WJ4A 4CDCC 1TKWB 3RZDH 3M9BA 3RI7C 3QG1A 4FXDA 4FF3A 2OHFA 2NUCA 2B3GA 2DLBA 3S14H 1T5XD 2C35B 2A6HD 1Q1EA 1WJJA 5ISRA 3MAQA 3CCJA 1LGRA 3RZOB 4OGQC 2ZNVB 4LFCL 3TP5A 5JJZA 4UDUC 4DR1L 4B3MQ 1SRUA 1KAWA 3BU2A 4O2DA 4ABNA 4A3MG 1WD0A 1E7PB 1P0RA 1V49A 1CKNB 2LVQA 3B2GA 4FJZA 1J9OA 1G291 1TKEA 2PLPA 2F4IA 1I5FA 4CKEA 4DR6Q 4KGTA 1B9RA 4OX9L 3CKIB 3I4MG 2FMCA 1UZXB 2KWUB 2LRWA 4JW0A 1B50A 4FVMA 3J80c 2UUCL 2Q2HA 2HIVA 5BMIA 2KN4A 2EXZA 3P20A 4GLAC 3HOYG 1WX8A 2ZCCA 3ENEA 3PS6A 4OONA 2DYBA 4F87A 2IPKD 1ZUD2 2AX5A 2Z59B 4HN7A 5JJKA 2NZ1D 2BT6A 4L2YA 1I4HA 1L1OA 1A3TA 2UUBQ 1VQCA 3X23A 5JPMC 3ZTDA 1EYCA 4LNKA 3DWPA 1WXAA 3TN2A 1LABA 1T6BX 4KDIC 3HM3A 4DHJD 2MW5A 1K8GA 3S14B 5BN4A 1ZYRC 3NUHB 3PHWB 4IKGA 5EBCA 1C78A 1DGJA 1GHJA 2LKVA 1V5OA 2AEHA 1I50H 5JVH3 1I3QH 1B3QA 4M1UB 4KN7C 3BYTB 1NDDA 2KWVB 2XWJB 1P3QU 3J81j 2D2QA 1JW9D 5M5XH 2MP2B 3PRPB 4A3GH 2CHZA 3I3TB 2MBHA 3WAOA 3KLSA 4F8CB 4JL9A 1XLOA 1LM0A 4I7ZC 1GUOA 2N7EA 4DUYL 3S24A 4HIDA 1NI3A 4DR2Q 2WB1E 4RKLA 5FK9C 2CHBD 5ELCA 4DWFA 2K5PA 4E71A 5GAGC 3J81E 2K5VA 2Y3AA 4JI5L 2PQEA 3SFEB 4KDLB 1Z6HA 3TBLD 5DM73 1FL0A 1K9MC 1FD7D 3V62A 1K83H 5C44G 3A7AB 3I2ZA 4BWGB 4HJ8A 1V86A 2VW9A 3AYHB 2B2VA 5LLIA 4KK7A 5H1SE 1UAPA 2NPTB 5I2YA 4PYZA 2WS3B 1YNJC 3RR5A 2HIXA 2WXFA 3R3OA 3AXCA 3N1XC 2R2QA 1VF7A 2K05A 3CPWA 2NVXB 2HDEA 3MJ5A 5C3JB 3HRZC 5I9OA 2F4VQ 3QWZB 1ICWA 4JI7Q 4QJFA 4LF4Q 4PV1C 2IJ0A 4W9DA 1X65A 2B63H 4P6VF 5G55A 5CHFA 2B63B 1XO3A 2JXTA 2KX0A 2B3AA 3J7ZC 2WXIA 1Q82C 1VJKA 4JBKA 2R61A 1EWIA 5GXGB 3LXFA 4E74A 1VR9A 3IRBA 3EFUA 3RNUA 3AQQA 4JPSA 4TKNA 1H8CA 4MM3A 3AE3B 3NHEB 2SNSA 1HZ5A 3A4SC 4RF0A 5HI1A 1RODA 3VYRA 2OJRA 1HNWQ 4YIJA 1WF9A 2WU2B 3DLLA 1DM0B 1F9JA 4JBJA 5DM63 1GUAB 1WFYA 4NNJB 1R4PB 4ICVA 3PRMB 4IUPA 3BG3A 1HUNA 3STBC 1E7UA 3I56A 4YWMA 3GTOH 1B9MA 3I4NG 1B3AA 1YHQA 2LSSA 3LB8C 1ZYRD 2PI2E 3DHHC 2JX5A 1ACCA 4DHJB 3ECIA 3VAWA 4WORA 4BBNC 1UWVA 2JRHA 3I3CA 1SMYD 1YOVB 3RUIB 3Q2AC 3PIO3 1WYDA 2NN6G 2FE8A 1SE2A 4PQXA 1VLBA 4HKQA 3E9IA 4WWNA 3TSSA 4JWUC 1PH2A 4DXGA 5C1ZA 3KK7A 1K0SA 2JN4A 2CH4A 2MFIA 3IL8A 1GD7A 2KJHB 3CW2C 1OQRA 5CBAE 2K39A 3J81L 1SFOH 4JI4Q 3DVGX 1JR0D 1S72A 1NMGA 1JWMD 3GTLB 4IOIE 2RDGA 2LGYA 2KUMA 2YTYA 2ZXOA 2MO0A 1A63A 3GTMH 1KJTA 2L0TA 1NE3A 3T1YQ 1R4NI 1X3QA 2B2WC 3K0XA 2NTSA 1J8IA 4KSLC 3NVZA 5FR3A 1WGKA 1AE3A 4NJ7A 1XMQL 1M4VA 1PFSA 3ZNID 4KKTA 2JK8A 1SIJA 3AE4B 2EELA 3QQ8B 4A3EG 2F0NA 1U9RA 1EY9A 2H1EA 3M7GA 1EQTA 3AE2B 4AS1A 4P73A 2LGXA 4DUYQ 1RAXA 3KDFB 4WJQA 1VQJA 2BH2A 4BA2I 2NVTB 3TIXA 4DHZE 1T3QA 1XPOA 2F0DA 1OTCA 2TSSA 3JAML 2WXPA 4G7ZC 1PFDA 3TEXA 2LMCA 3VA7A 3T1HQ 3L13A 4KGRA 2D62A 1WGYA 1FCLA 2K25A 2KN5A 1VMPA 1VD2A 5IE8A 1MHXA 1D2BA 4JYAQ 2KLGA 2V1YA 5L37A 2R92B 4F7XA 2M2LA 2NWGA 2WACA 1S1QB 4A4IA 2JA7H 2WXGA 2NBFA 1G8ZD 1CQFA 2RQXA 2EIFA 4RA8A 2WP8J 4W9JA 2KDMA 5JEAG 1JICA 2HJ8A 3AU5A 3CRLC 3L4PA 4ZHOA 2N9PC 4G11A 1B2TA 1FXAA 5FR6A 1IBXB 2ENBA 3GTMB 3VRBB 3TRZA 2A68D 4UY8C 3GTGH 1WOCA 3Q22A 1NY4A 1YMHE 3KLRA 2LHEA 2PQAB 3VR9B 2F0GA 5M3FB 1QKZA 2BPSA 3KWVA 1BQQT 3SK8A 4M8AA 1Q3LA 1C4AA 4YT0B 1V2YA 2L83A 3OW2A 3HOZH 2CKZB 1D5MC 3NQIA 2YU9B 3KJPA 1PUTA 2GBMA 2KWCA 2HHHQ 5NUCA 2M4NA 4DFAA 4BBSG 4YWKA 1YQ3B 2A69C 3SVMA 3AEDB 4IDIA 4XX5A 4HJ5A 3HKZE 1Q86C 3TS0A 2V0GA 4DR1Q 3DVNU 1O80A 2IYDB 2VH1A 4G3XB 2VUMG 2Y0SE 3H0GG 1QQRA 2IO1B 5CV8A 1UELA 1WR6E 2Y5BB 2INCC 1Y1VB 2RR9A 4C80A 2D5GA 4F7ZA 4DV4L 3VUXA 2I5HA 3OIPA 2Q2TA 2QC8A 3PF4A 1FFUA 1E10A 1W2BA 2L32A 4FF1A 3CSTA 3Q6BA 1MVKA 1EM7A 4KV2A 2N8NA 3QJZA 1F9SA 4A9AA 4JI1L 3PGEA 2QCZA 3D0FA 4OIJA 1HTQA 1RJTA 2R93H 2KZRA 5AZFA 4HR7B 3ZRFA 3HGBA 1A70A 2EPBA 3TJPA 5AZGA 1E6EB 5I4DA 3KDFA 1BT0A 3MC9A 1WI5A 1N5XA 4WWPA 1JJGA 3RPFC 4OEMB 3T8MA 4DV0L 4FHJA 2L12A 5HY6A 1JWUD 1GUWA 1R7SA 3NY5A 4M8MA 4A3LG 4JI7L 3FDTA 4OZCA 3TCAA 3VYUA 3P4PB 1C4PA 4YCWA 2RVLA 3BDOA 1VQPA 1GHKA 2L3ZA 1JE5A 4K3CA 1SYDA 2DX5B 4K5WA 1Y1WG 3KQ4A 3UE1A 3BJUA 4DUZL 4DV6L 1UBQA 1WJNA 4LCDE 1K3BC 1I4XA 3PUYA 4BBRG 2N9LA 2PMVA 3B6YA 2DYMA 3EFXD 4LW1A 2WXNA 4YTMB 4C1NK 2YVCA 4C3HB 1YN5A 2F0HA 2X69A 1VQ8A 4JI5Q 1UH6A 2JWUA 3B9JA 4KN4C 3OAWA 4LTUA 2C7NB 5IA7A 1SAPA 2HQEA 1CT1D 2ZT9C 3NZUA 2YYZA 4BZAA 3M4OH 2HJ1A 2EXDA 5IGCA 2NN6I 1V81A 5FLXL 4DR2L 2ICIA 1W6JA 2F0OA 3H3VI 1BUIC 2BYEA 1QZHA 2HT1A 2IW3A 2E2IH 4R4OA 2WXJA 4DDGD 2JA6G 1PTOD 3U9OA 1YJIA 3JW0X 4HJKA 2VY3A 4A3KH 3BS1A 3C0RB 4JQWC 4MGIE 2N7JA 3GTKB 2RDBC 2FCQA 2G45B 2YTXA 1KLGD 3HOXH 3CCEA 3PIP3 1NTGA 2Z4HA 1IBLQ 1TWCB 4OL7A 1MJCA 3KBGA 4PZ6A 3NVYA 5IN7A 4P74A 2IDYA 5KEEA 1XNQL 1PV4A 2O6VA 2N55A 4ZRPA 1SNMA 3S16H 2WXRA 4IUUA 3KUCB 4IM3A 2L1AA 1LT5D 4OO1H 4KKJA 2H88B 3A8JE 2EY2A 2JA5G 1VQDA 3ALBA 1ZEQX 3EHVA 2UXCL 5E6PA 1WCMB 2C5CA 4XTCS 4BXXG 3A7LA 3UINB 4L5RC 2YEPB 5JEAH 1KDCA 5IWAL 1BCPF 1LO5D 1JALA 2IHFA 4HVBA 3NRZA 1N8RC 3SXHA 3LWEA 2RA4A 1GUNA 1A6XA 5IP7H 3P1HA 2D07B 3AECB 2K22A 3IXSA 1HRJA 4UPAA 1EYDA 1XNRQ 1WJ6A 3DVGY 3E0EA 4DV5L 3I57A 1V1OA 4WH4A 1EQQA 1DZ1A 2EYMA 4ZOHC 3UDGA 3A5UA 1HFNA 3HK0A 4ANUA 2DNCA 2QDFA 1V8CA 4LUZA 3CWIA 3DQVA 1NNXA 5I6YA 1HE8A 2ZTCA 1E8ZA 1GC6A 1CZGA 1OQYA 4QB4A 2C9OA 2I1JA 1SYEA 1IZ6A 1EYAA 4B3TL 1WR1A 2KMMA 1XX8A 2RBMA 2WIIB 1SNCA 2Z6KC 4HEDA 1NBFC 1PH4A 4GLSC 1VQ6A 1SYFA 4PNYA 5EAYA 3T51B 2F4VL 5ELBA 3S15H 1WTXA 1WX9A 2MJEA 1XCTL 5CV6A 3JVZX 3UQAA 4JE3B 5IT9c 4KKIA 2PJHA 5E4WC 1S3OA 4DPGA 5KYIA 2MNAA 1WGDA 1CTMA 1HZCA 1CJEA 1E9MA 1EYGA 4N8X1 1TTNA 3D6CA 3KH0A 4GNXC 4A3JB 5L95C 2DHZA 1Q1BA 1U4MA 2XRQD 2N9XA 3GTJH 3Q3NC 4UP9A 5ELFA 2NN6H 5C3WA 1C0AA 1V9PA 1UE1A 3A54A 4DR5L 4MSMB 4REZA 1XXGA 4K14A 5M3MB 1SJHD 2MBBB 4G50A 2F0VA 1QLBB 2LGIA 4JI6L 4EFOA 2BB6A 2E6XA 3M85A 1YIWA 1SNQA 2V4DA 1YNNC 1EU4A 1V5TA 2QF7A 3BK1A 2GMIC 1MKHA 3TEWA 2M8SA 4YSYB 5IYDH 4H13C 2NZOA 5LMNL 2ID0A 2XVSA 2FUG1 3U52E 2BS4B 1HNZQ 2JP1A 3GTGB 3ML9A 4GNXA 4HCEA 4A3DB 2AL6A 3D3RA 1N33L 1QUQB 5M5YB 1H4RA 5BMHA 3JC66 3S17H 1NVID 1J19A 5CTRC 2Z8LA 3HOWG 1IKLA 1NCVA 1VQ5A 2A8VA 3ZVVA 1BMLC 3Q69A 2ZEQA 3A9JA 2B63G 1TXYA 3G7LA 5GAEC 1JB7A 3A8IE 4K0KL 3G4SA 1KD1C 4QUFA 3W1SA 3HOUH 2L8JA 2WGSA 2N3SA 1UUPA 3DEPA 1CM9A 4P71A 5D94A 4KMUC 5FLXc 2QGQA 1XTCD 5IYCG 4A3IB 1ENCA 3Q23A 4IFDG 1I94L 2UUAL 3DBHB 5CX3A 1LM8B 1B8AA 2A5UA 2MX2A 2WDQB 1JRPA 1WCMH 2KTRB 1WGHA 2XGTA 3DWAA 1N34L 2RSNA 1TJEA 1PYBA 2A4ZA 1E3PA 1EUJA 3QOJA 5GQOA 1U4LA 2EY1A 3SEBA 2CQOA 2R6GA 5CHWA 4HKZE 1OTRB 4TSSA 5EJWA 1SJED 3PZ8A 1TS5A 5JJLA 3T4AC 5KNCA 3RT3B 2B2YC 3VVWB 2LY7A 3D4WA 4XYCA 3U7ZA 3DBLI 1PRTC 1STYA 2K1FA 1I4RA 1UD7A 2E8GA 2K1BA 2Q2IA 3R2TA 4XC2A 4JOIC 3W1SC 3FRPB 5LL6S 4J6HA 3CC2A 1VQLA 1K50A 3D32A 1R9TB 3MFYA 4PZ7A 3GD7A 4GB9A 2KQ3A 4MGKE 3VR5A 5FO9B 3WOEA 4QY7A 4X3UA 5T1GA 4A3BG 1ZW7A 2JZZA 2D11A 1KRHA 5EPJA 1BF4A 3EA6A 5EBDA 3AB5A 1EQVA 1DOXA 3DWGC 3H3VH 4OX9Q 4LF5L 4QAYA 2O4XA 3HOYH 1RYJA 3K9OB 4BVUC 3QX1A 5IKCM 4L5QA 3RNBC 3KBXA 4B6WA 1HA6A 2M0AA 1IBKQ 1WWTA 1SEBD 1YHBA 1LFDA 2KBNA 2R92G 1IXRA 2VZKB 3I4MH 3K9PB 1F9QA 2AMCB 5C0XG 2RPQA 1EY8A 3K6OA 2CW0C 5AJ3Q 1OFFA 3ZJUA 3B08A 3UDFA 2G9DA 3TDQA 3TQYA 1K8RB 1PH1A 3X3MA 4MT5A 2FHTA 4A3IH 3I70A 4YXDB 1D4BA 3W1BA 3QHTA 3RNAC 2UXBQ 3APCA 3J81c 1XCQL 4DAVA 3HOUB 1L4DB 1QOGA 2QDBA 3NXWA 1VZ7A 3PT2B 1P7FA 3AI5A 2WNMA 5IOIA 2IGHA 2F0QA 2CH4W 3H7PB 2UXBL 1S40A 2QSDA 1CMXB 4KLKA 5C2TB 2CHWA 4BBSB 2HE7A 2KC2A 3N1ZC 1EWYC 4RG1A 4IC7B 3I72A 1J0GA 4ZUJA 1HH2P 2K14A 3TMPB 5KHOA 2CWPA 1AYFA 4OW0A 2BCOA 2VUMB 1R4MI 2ZJDA 4G7OC 2INPE 5DPWA 2PEAA 1TWFB 3GTPH 4P2CB 4B9KA 1L0YB 4KJNA 2QHOA 3PRZA 4FLHA 4XE0A 1RFAA 3RFZB 3IAM1 1CSPA 2KKCA 4AYBB 2ZVOA 2HQLA 4LFAQ 2Y5PA 1C8CA 5IO9A 4BY1H 3ZIMA 1KF6B 1PVOA 1OEYA 3VTVA 2XTIA 1HPCA 4C2MB 2Z6BA 4ZKCB 3PV1A 1UGJA 3F2BA 2AWNA 1AE2A 4A93B 2EQSA 1N32L 3NBIA 3R93A 1VQGA 4K6DA 4OWXB 1IBMQ 1QVCA 4W9EA 1Y8NB 2JA5H 2AQ1B 3FEWX 3ZDMC 1PZKD 4HJ7A 4EZLA 2HTME 4E6IA 1D5XC 2KANA 4NZLB 2IT1A 3EROA 4C7ZA 1IUEA 2R2OA 1PYWD 2MUYA 4R4QA 3SK6A 1H9JA 1L0XB 1RM6C 1V9JA 2JXMB 2AQ3B 4JC0A 4GN5A 4DK0A 3J80E 4NKLA 3S15B 2XNAC 2D0OA 1H9MA 1L5PA 2DZIA 2GLSA 2M19A 3MP9A 3K7AB 3NTKA 1AWDA 4RCNA 3PIPA 4FA6A 4ULLA 3CD6A 1Q5WB 1YNXA 3CU7A 1BBWA 1PH5A 4JLCA 1PRTB 4YCVA 1PGAA 1M90C 1BBUA 3R2IA 2QIEB 2DNEA 5BN3A 4IG7B 3KLSX 5LMUQ 1ILPA 2FCSA 3ULLA 3PTFC 2B76B 3ZNHB 2BA0A 2KFKB 4FADA 1B53A 3RULA 3AULA 2P5ZX 5KNDA 4JWSC 2W55A 2XIWA 4IFDH 3STBD 4RF1A 3RZOH 1IPGA 3AE8B 3KVFB 3S2DH 4BFRA 4MJSA 5HG2A 1OEYJ 4DR4Q 2JA6B 1CI3M 4CJ0B 1I94Q 2UUAQ 4NXNQ 3VTWA 2PKOA 3I91A 3M62B 4FJYA 4HDQA 1TKGA 3NQTA 4R4IA 1HFGA 2RDFA 2DZJA 5J3BA 2RD0A 1PQSA 1NENB 1FVIA 4M0WB 3MXNA 2PNHA 1BO0A 2XK5B 2NVTH 3K0YA 3A9JB 3VRAB 2KHWB 3NOBA 2EVBA 1WE6A 4NJ6A 4W9KA 4NAMA 3PZDA 1PYSB 3VHTC 5T1IA 3EC8A 2BBCA 4ME5A 4W9IA 3U30A 2NBVB 5CR3A 2H4OA 2UYZB 1U4RA 3QO2A 1G6PA 1YNJD 2K01A 4PMCA 3N1YC 3J7YW 1JWBD 2KYWA 3J7AF 2LUMA 3CAMA 4ANVA 1KIXA 3I5JC 4RKBA 5HHDG 3VDYA 1BCPD 2LGSA 2F0FA 2RDHA 3PHXB 1PA6A 1DOIA 2F0SA 4IURA 5E7NA 3KJOA 1BOSA 4AQYL 1HR0Q 1STNA 3A4RA 3JAME 4S17A 1FXTB 3L54A 2JSOA 5JZEB 2WX0A 4JI8Q 3EQLC 3S2HB 1HZAA 1LTRD 2I5LX 4A3EB 3P2BA 3MXNB 2KJRA 3V96A 4FNFA 1GUGA 2VZAA 2BH8A 4A3MH 1VCBA 2JXXA 2PE6B 4TUUA 1YZ6A 3PGZA 2KOLA 1S5ED 2J42A 3IG3A 2VZKD 4IWOA 3H91A 4C3HH 3BZDB 1IHZA 4Y7NB 1QZEA 2FCNA 2NBWB 2PE9A 2F0IA 3H1UA 1BBXC 3KOJA 4OVUA 2CFMA 3APFA 2VXWA 3TS2A 1EOTA 1S5BD 3D31A 2DUDA 1VDZA 3U50C 4RGOS 2ZJRA 5CV7A 1C77A 3OW7A 2OF1A 1BCPB 3DCGA 2ZTDA 2LJ5A 4JI2Q 1X56A 2DZMA 3D4RA 3VR4A 4GNXB 3NG0A 3JAMc 2SAKA 4DQOC 2RMMA 3FPPA 1IKMA 2PPHA 1MBYA 2HUGA 4LK0M 1O7LA 4LF7Q 3NBHB 3Q0AA 3OPOA 4DXFA 1PH9A 2D2CC 3Q6SA 2XN9C 3FPUB 4DV1L 2I46A 1IYJB 3LGJA 4DR3Q 2VQEQ 3SR1A 3JAMi 1WM2A 1TWGB 5AUKA 2EYFA 1PDXA 4ZYNA 2R93B 2L4NA 5M3MG 1IGCA 3L7ZC 1VQIA 1D1IA 3G71A 2JA8B 3DDCB 5M3FG 1C4QA 4A3GB 2VQEL 5M5XB 5IYDG 2PPBC 4C00A 3T3OA 1K83B 3K5OA 1F2MA 2NTTA 2NB0A 2RHQB 3CMEA 2UUCQ 1WYGA 1FR3A 1C9FA 2JQOA 4RFBA 1L0WA 4DR4L 1XT9B 3N20C 4II3B 1E2VA 1LTAD 3TL5A 4GXBA 3S1RB 1R9TH 2JU6X 4AWJA 3NHHA 3VR6A 4OO1G 1GAQB 1ZXIA 1WTHA 2IHEA 4WRDA 4US9A 2LGDA 2WDVB 2MJDA 1HZ9A 1PTOC 4Q5VA 3ND9A 1VS0A 4HCSA 4HJ9A 1G2TA 4K5XA 1K53A 2C5LC 2JZPA 2K3UA 2ZZPB 3H8HA 2ZXPA 5ELDA 3V61A 1ZPSA 4NPSA 1JROA 4NXMQ 1KNEA 2KCTA 4EKUA 4XGAB 4CJ1B 2PMZE 2DAFA 3C2PA 1KRTA 2BF8B 5D7GA 1FNVA 1LT4D 4A55A 1G2SA 1WY8A 4BKSD 1Y8RC 4X66L 3APDA 5C3EB 1MHHE 3M3JA 4B9WA 3I63C 3VUWA 4ME3A 2LVOA 4E3CA 5CYUA 3J80i 4A76A 2FNJB 1C3TA 3DEOA 2X6GA 3UDXA 1VQMA 5A2QE 3C19A 1DD2A 5FLMG 4DN4M 2FUHB 2E3TA 3RYTA 1WZ3A 2ZM6L 3FVQA 1YVCA 1N63A 3AEEB 2JA9A 2R92H 2F0KA 1QF6A 2J0MA 4YTNB 4DK5A 5IY0A 5ELOA 1AN8A 1Y1WB 2E2DC 4HJAA 4P7IA 3ZW3A 2C9WB 3EUB2 4IW0A 4LF6L 1E1TA 1IYFA 4KZCA 1OXTA 4ZDVA 4NB3A 4EZKA 2MBEA 4GIVA 3PO3B 1TS4A 1WE7A 2WKDA 4K8IA 2AL3A 3IFWB 1ISNA 3T56B 4S3SA 2MLBA 4LF9L 4IN3A 3H09A 3NELA 1PH7A 2D0PA 3W1GA 2XEWA 1JE4A 2PI2A 1D8LA 2BKFA 4YWLA 1OXXK 5C3EH 1C7YA 4PS7A 2ON8A 3A1QB 1MPEA 3Q8AA 1FRRA 1K8OA 2KWDA 4FXCA 1H9SB 4NXNL 2EDGA 4EQ5A 4X3TA 1CQVA 1LTLA 2R7FA 1XMOL 1IBLL 3U7DA 4L1BA 2QDLA 2JT4B 2AUKA 1LUZA 2EOTA 1FGBD 3WALA 4DGZA 2CU1A 2M0XA 3Q8BA 3FILB 5FLXE 1WTOA 3T16A 3P4SB 2A69D 4A3OA 2KJ6A 1VQBA 4WURA 2ZJPA 1L1OC 5M9OA 2CU3A 3A8KE 2UXDL 5AUIA 2JA5B 2NVQB 1NMFA 3KF8A 2VUMH 1UF0A 2V3PA 3VR8B 1U4PA 3CCMA 1O7YA 1WCMG 3ABVB 1EY5A 1CKNA 2Z0SA 1PDQA 4B0MA 4BBSH 3R66C 4DF7A 3NTHA 4PZ8A 2FAZA 1F2LA 4XDCA 1JC7A 1K73C 1RTNA 1Z5SB 1C48A 2J4XA 3W3AA 1JCKB 3V05A 5IGEA 2K7VA 2JY6A 2JA8H 3UI2A 3CXCA 4C3JB 3RZFA 2GI9A 1YIJA 1IBXA 1KLUD 4EQOA 1K3RA 3S1QB 2KCCA 3HOUG 2BWFA 2WU5B 3JYUA 1QCBD 4GGQA 2MA9B 3AU4A 4EQNA 3CCLA 3MC8A 2F52A 4NMZA 2Z6KA 2E2JH 4WIPA 1E8WA 4CDEC 4U673 5JHBA 1I42A 4RMFA 1IL8A 3OMCA 4A3LH 1MIUA 1ZKHA 4JBMA 4OZAA 1IYUA 3H94A 3MTSA 1AW7A 4OZBA 1IGDA 4JI0Q 3H7SA 2ZXRA 4LF8Q 5DPTA 4FP5D 3E56A 1KNAA 1YX6B 4DV7L 3DM1A 2K04A 1QOFA 3RNCC 1NAPA 1SE3A 1FYCA 3D4DA 5JAVA 2L7RA 3H6NA 3J81i 1JB3A 4J8QA 4USAA 4BBNF 4YL8A 4AYBG 3P4RB 1HA5A 2DAJA 1EIGA 4J15A 2RGFA 4X62Q 4EGVA 4OELB 4QF4A 2DN8A 4F8MA 3J9CA 2WXHA 3PUZA 3PQIA 1DONA 4I6NB 3ZNZB 4MELA 4A93G 1H95A 1TZ1A 2A5HA 3ZXRA 3EFCA 3HS0C 4L6TB 4RCOA 1HJPA 5IGGA 1P1AA 4KY6A 4N58A 2C7HA 1Q0WB 3Q8CA 5JXVA 3NZSA 1XMQQ 2IX1A 3HOVG 3S16B 4FYDA 1ZOYB 4YHHL 4K81A 4KKUA 5CV5A 4H0LC 3BZKA 1RWSA 3ZXVA 2KA7A 2B39A 1H9RA 1ZDXA 1XNQQ 3A0JA 4WFN3 2QMTA 1ENAA 3KWLA 2EZVA 2RKSA 3DBRI 2J53A 4A8XC 1Y69U 3HP3A 2EYLA 5EGTA 2K75A 4WJOA 1QVGA 1Y14B 3QOLA 2Q8TA 4N9F4 4WJ4A 2G3QB 4AH6A 1MJEA 3SGIA 3BINA 4FHKA 4LNIA 4HPLB 1HCZA 1ESRA 1SSNA 2RCFA 5J39A 3AN1A 3HOWB 5KHQA 3AE7B 3PUWA 2VQFQ 1EUVB 1C4CA 2K5QA 2KEDA 3TMEA 4DKAC 1X3EA 3DHGC 2PCFB 2R7DA 3D6WA 1VRAB 3S1NH 4JV5L 2F0LA 4ZYSA 2NBUA 1TS3A 3URYA 1HZ6A 1FJGQ 2LUEA 4KI0A 3L0OA 1ROEA 2G4DB 2OOBB 1TWHH 4XQJA 3UIOB 1QOBA 1WGRA 4LNNA 2BWES 3L3OC 2W54A 2K33A 4J3OD 4XWTA 4RAUC 4DV7Q 3WCQA 4LUVA 1KRSA 5E6OA 1EU3A 2SEBD 2KNBA 1JJ2A 4WQMA 2HD3A 5BMGA 3SDLC 1K51A 1TIFA 1HTPA 2XWBB 4B0EA 2WB1B 2L0CA 5FLMH 2N7DA 1PRTF 1J6QA 4X66Q 4JCVE 2IY5B 2B8GA 3Q3FA 3EIVA 3ND8A 3V60A 1L4ZB 1RCVD 2DJGC 4C2MH 1V97A 1IP9A 1SR3A 5DPRA 3R8BA 5C4XB 2EYHA 1SF0A 4Y52H 4AP4C 4F88A 1E7ZA 3ZGZA 4XQQA 1YBYA 3P4QB 1KM7A 4GKKL 4Z9CB 2NVYH 4BKTA 1LTID 1WM3A 2CKHB 1EFWA 2K28A 3BDLA 4KY7A 1F2YA 1EQRA 3N9YC 3S1RH 3I9V1 2L55A 3M95A 2MJ8A 1OQQA 1HUMA 2PZTA 3MVVA 4IALA 3MXGA 5EKLA 1X55A 1EY0A 1WTQA 1IYVA 5E3FA 3ONAB 1CUKA 3QA8A 3SFDB 1ZDVA 4TV3A 3PO2B 3QIAA 3DBHI 2PNRC 2KECA 3PLUA 4HSVA 4L5SA 1T0YA 1UE7A 1U4AA 3WANA 4KHPQ 2LD9A 4KD4A 2BYFA 2YU9H 4DNTB 2KDBA 1QUQA 2HCCA 3TREA 2NS5A 4JBWA 1TWGH 5JOBA 4N9PA 1TWFH 1WTRA 2MBOA 2N1WA 5ELNA 4DV1Q 3G6EA 2WXLA 2DNFA 5BYRA 3V6CB 2J0JA 2V1CC 3TP6A 2O5IC 2WWZA 4EOYA 4YTPB 1RIPA 2AQ2B 3DXJC 3T13A 4O42A 2BOSA 1SYGA 4PMBA 5GROA 2K8CA 2AWOA 2ATWA 1AEXA 5BR8Q 3R7RA 2BYTA 1HNXQ 4XZ4A 3BVGA 4A3JH 4LFAL 3PIOA 1HTLD 2AWTA 2PTLA 1FM0D 3GQBA 1I35A 1EOVA 3N6RA 5M5WH 2ASBA 2K5HA 4NPNA 3UGBB 5G5HA 5C4JB 3MEHA 2F3IA 1PFNA 3K5NA 4P1BC 2CJNA 5C23A 2R93G 3F1ZA 3P42A 1LTSD 3HHMA 3K5LA 2JA8G 1KL9A 4Y7NH 3HKSA 3S9WA 1NUCA 4ZUIA 4Q0FA 1DOKA 3SK4A 4KIKB 1IL2A 3RNEC 2B29A 2FCMA 5DLQE 1E24A 3C46A 4PK1A 1VF5C 3KYDD 4TKOB 1A3VA 4TVAB 3AH7A 2GA4B 2O5JC 2L76A 4US8A 2J52A 4AIMA 2VB2X 1B9NA 2KVZA 4DNRB 2Y0SG 4HMIA 3PSIA 1ZP0B 5EE9A 4RGMA 3MEFA 2IBIB 1X32A 1A62A 2IX0A 2YV5A 1KAAA 2MQJA 5KIXA 1E2ZA 1ONLA 4HROA 1YD8U 3I4LA 2KDEB 4DUZQ 4DV6Q 3U4EG 1CFMA 3HOWH 3M4YA 1ZKOA 1N36Q 2QJLA 5G5GA 1MHWC 1SROA 1QZGA 4HLEA 4L8JA 3J80L 1TWAB 4DV2L 1J7AA 2E2IB 4HDOA 4X3KA 5EE0A 1E90A 4LLGM 5C3EG 1X54A 3MFGA 3O13A 4KIKA 2HDLA 4ITKA 3ULPA 1D6EC 2K5WA 2PW5A 2KX3A 2KEEA 2JSVX 3NUCA 2F03A 1JT8A 3M4QA 2KMCA 3I73A 1B70B 4NDXA 2DGYA 3VFKA 1HTOA 2WXMA 2MCNB 2JYOA 4EUTA 5LXHA 2QILA 5FKAC 4EX5A 4LFBQ 1E2WA 2OTJA 1UBIA 3FILA 1SLJA 4GU2A 1YITA 1D5ZC 2LS01 5C4JH 1KOTA 3G6JB 3HUIA 2G4SA 4RWSC 3H3VC 1XLPA 3L10B 2UXCQ 4NAWA 1HXYD 3KF6B 3QARA 5H8YE 3T53B 1YJWA 2IO0B 3U9SA 2K8HA 3H15A 4GOCA 4C56C 1YQ4B 1TYGB 1F0ZA 4HIKA 3RLOA 5EKKA 5D65A 5IGBA 1WZ0A 4C3IG 1OXVA 4G57A 4IUVA 3K7AH 1IW7C 4GDKA 4X3SA 1VZ6A 2XSCA 4QIWB 1KHIA 2KAJA 3S1QH 2PW9A 3SR6A 5AEKB 3AEFB 4NQLB 3VA5A 3QB3A 4XYOA 4XQNA 1PZID 2RHSB 3RN5A 4GKKQ 2EMSA 4KSKC 1JQYD 4HPPA 1GUSA 4C3IH 5FO8B 2F3VA 2L11A 2OQ0A 4MIUA 4CO7A 1O7IA 2WINB 2PW7A 5COYA 1XYIA 4IM0A 2B2VC 1ILQA 2F0WA 1E1OA 3Q8DA 3PO2H 4NP5A 3MZ5A 1VQ7A 1SE8A 1GG3A 3B0AA 2A6ED 4KHZA 2D5DA 1WXSA 1IBML 3CSFA 5CBEE 3DOWA 1TQOA 1D3ZA 4UP8A 3JSVB 4C4VA 5D14A 4HCNB 1UWXA 3AFPA 4M00A 1ASYA 1C9OA 4RM9A 3VQIA 2K6AA 4ZRJA 1NSNS 3C8YA 3PVLA 3C1FA 4YY3Q 2GRIA 2HTHA 5CV4A 2EKIA 2JPHA 1MGSA 1YJNA 3KF8B 3HRDD 3E9SA 1YJ1A 2KTRA 5EQ0A 3QWNA 1AP0A 4WWOA 1S5CD 5JHAA 5D2MB 2EY5A 4ARIA 4JYAL 2WAQG 3OTOQ 5JEAJ 4GSWA 3VXWA 3Q24A 4C3JG 1KFYB 4IO9A 2IZVB 2NVUI 1Y1VH 4MGYE 4JV5Q 4QMGA 2ZVNA 1I50B 1X9NA 1YJJA 3GP7A 5KRUA 3RD2A 1ZXHA 2PMZB 2N9KA 1WTWA 4KJOA 2O6VD 4KX6B 5FJ8G 2BS3B 3ZO5B 1S5DD 4CKBA 2F0TA 3AB9A 1ZE3D 3P75A 1N62A 1J7CA 4XWWA 4NW2A 2HD5B 4CHKA 1LACA 1I4PA 3L9AX 2FINB 1HEZE 2D3AA 3UQBA 3TP7A 2HCIA 3W5OA 4RNAA 2G5DA 2EYPA 3HOZB 2D10A 4ZAIA 4XIGS 1XD3B 4W9LA 1VMCA 1A8VA 4A3KG 2FMMA 4DV3Q 3ULJA 1L2NA 4JI4L 2KDIA 3BY4B 2GBRA 4BKGA 1RKNA 4KZ0A 4RHRA 2BS2B 3OWEB 3S2DB 4M8NA 3CHBD 2OTLA 3KW5B 4RMAA 4Q2JA 2E5LQ 3F8TA 1E0BA 1DGSA 4K8JA 3A9KA 1GB4A 4JX1C 1IBKL 1EWCA 2DWQA 2HHHL 1V80A 1FO4A 3AEVA 2HDMA 1F2RC 3BK2A 1FIQA 4IUQA 4JI3L 1Q10A 2F0JA 3DPDA 1QVFA 2FBWB 2TMPA 1EO6A 4OXPA 3OLMD 4IUMB 3FKIB 1B4OA 4JOIA 4A3GG 1Y1WH 1OXUA 1QG7A 1STEA 1N6ZA 2IX3A 2KO3A 3OJ3A 4MN3A 2ACZB 2JWZA 2Q8IB 4DBGA 4A3BH 1SGHA 4ZHPA 3NP8A 4II2B 1WGGA 1II3A 2MO1A 2JRIB 3R7QA 4MM3B 1WRIA 2E75C 2CQAA 2CCZA 1VQFA 3ERSX 1LYLA 1W3SA 3CRKC 1XNRL 1A3UA 3M7NA 2BTEA 1BKBA 3T9LA 1EY4A 1VZ8A 1NBWA 1FJGL 2R7ZB 5JH5C 1P7EA 3I55A 4RGNA 3V3XA 1XPUA 1S3SG 4ACFA 1CKMA 1SFOB 2SDFA 2LJIA 3ML8A 3MHSD 5E6NA 4CQNA 2KHSA 1Z7TA 3F2CA 2L05A 2VS1A 3GTKH 4G0NB 2KJXA 2AYOB 1P8LA 4TQ1A 5EE1A 5A35A 1WYWB 2V9HA 4OWTB 1JJCB 5L83A 4HMJA 1ET9A 2L0FA 2WDTB 3QK0A 3MTNB 1XLQA 2W82A 2M56B 1FNWA 2AHOB 3NWTA 2E5LL 2MBQA 3ER0A 3LX0A 3DBRB 5DCNA 1WX7A 4O0AA 5K5PA 5LL6X 2IGGA 1RLFA 3ZJYC 1RL2A 1CZPA 1E0ZA 3C1EA 4M01A 3T1YL 1QNUA 1K28A 3Q3OC 3K80C 1DOMA 3SHLA 2WB1G 1CHPD 2XK5A 3NTIA 1V8QA 5T8IA 2KENA 2F0PA 3CCRA 1AZQA 5CMDA 4A3FG 3BYYB 4FULA 3RLFA 4A3PA 4JG2A 3A33B 1GPXA 3LNNA 2K03A 1PRTD 3BZCA 3LJ3A 1QT9A 5C4XG 1NR2A 1AARA 1HNXL 3PO3G 1TGZB 1L2FA 4EEWA 2GBJA 2D3GA 3EBEA 2CS4A 4GDLB 2N0SB 5M5YH 1QILA 2KQSA 3NS8A 3QCAA 4K7WA 5TR5A 1WXVA 1N9WA 4GN4B 3FMCA 3GV6A 4A3DH 5BYQA 3ZUNA 3OTOL 3LDZE 1IW7D 4W9CA 1Y56A 2KXJA 4HJGE 4TRDA 1SE9A 2DENB 2V4IB 5HKHA 2OT2A 4LF9Q 3H6MA 2H89B 4M02A 1TZOA 1MG8A 1KDAA 2MP2A 3NEMA 2F0MA 3PREA 3LWUA 3GOEA 4A3CG 2X8XX 4MACA 4MHEA 1LTTD 3N3KB 2B2UA 5D6JB 1GC7A 2FXQA 3DM3A 3F2UA 2D3CA 1X3GA 1SE4A 2I38A 2WQYB 1B44D 3BVZA 3RCZA 1I6HH 4GZYC 2W9NA 3B2FA 4X64L 4LF4L 3H9DA 5JJIA 1SMXA 3IKJA 3WAMA 2NPTA 1I4GA 4MZ9A 2JUOA 2IWHA 4LNQA 4DAMA 5IIFA 3OG5A 1Z2MA 2VRRB 3UF8A 5K36G 5H92C 1L1OB 1T0QC 4POGA 2I2YA 2NZHA 3CCUA 5IGDA 4CDDC 4JI1Q 1MI0A 5LMUL 4FBJB 3IAYA 1J5EQ 1QOHA 3NPPA 4GMVA 2NYZD 4GKJQ 2K6DB 1KLVA 2A1AA 3HOXG 4XT1B 1AH9A 2LRUA 2EJGC 3B1LX 2D9UA 3FKIH 4JIOU 3U8ZA 3L0WB 5ELEA 1Q46A 3RLNA 2FFKB 2JA6H 3RN9C 2KMAA 3CMMB 4CKCA 1KQSA 2B2UC 4OHJA 1FCCC 4HSPA 5CHVC 2UXDQ 1WMHA 1STHA 3PLVA 4R4TA 1PTOF 2K5DA 3GB1A 4N59A 4IJHA 2EJFC 3DHQA 4XXEA 2K50A 3IHPC 3K7UC 2ZNVC 2MEKA 3Q8EA 3ZRCA 2Y5CA 1YNND 1WH3A 1R4MB 3O65B 2BDNA 1S5FD 3CMAA 4NJCA 4WAFA 2LMCB 2DYOA 2D3BA 2EY6A 2M9VA 4QL5A 2MHVA 3GTLH 4A20A 2Y0SB 4FF4A 3EECA 1Z47A 5KGUA 2ZPYA 5IT9L 4O1NA 4V0BA 5IP7G 3IT6B 1XWEA 5C4HA 2RPVA 2KTFA 4MEMA 2N88A 2VQFL 5C6AA 2RSUA 2LEKA 1W6KA 1VQAA 3IFDA 4C4VB 1Q8KA 5LHY1 2E74C 4LNFA 4UP7A 1RFKA 4DV2Q 3VH4B 4B3SQ 2ZJQA 2YLMA 3AE5B 2F0EA 4DR3L 5G3LF 2O2VA 1MI2A 1YN4A 5IP9H 1QWYA 3FAHA 4A6QA 4FDBA 1I6HB 4IPHA 1N33Q 1XQQA 4DDID 2Z4IA 4LF6Q 1SNDA 3DVNV 4P75A 5AFWA 1PMRA 3NENA 3HOVB 4YHHQ 2EJMA 2IY1B 2KK8A 1EF5A 4LJZC 4BY1B 4R9WA 5CV9A 2G9HD 5LMNQ 5IYBH 1TR5A 4C1NI 2B2TA 5KNBA 2IGDA 5IODA 2QEXA 3RNGC 3SD5A 2V4LA 1A5RA 1R4QB 3TEHB 5JVG3 3RMKC 3RMHA 1SB3C 4QGUA 2L00B 3RNFC 2SOBA 1CHQD 3I8ZA 3TZUA 2A74C 1TS2A 4P1CC 3TZDA 3W9CB 3HKZG 5J1ZA 3Q14C 2N78A 4EZJA 3RN2A 3VDZA 4L5TA 1K0RA 5HURA 4NXML 3RD4A 4BY7H 4GKJL 1F9PA 2KC1A 3KFUA 1PH3A 3D8GA 5IYCH 4XDDA 1UNSA 4K5VA 1HR0L 4GDLA 2I1KA 4K2KA 4IQZA 4QCLA 1K8MA 3S2AA 2DBYA 3DBSA 3ZDTA 4JI0L 1WTPA 1GUTA 4BOZB 1STBA 4W9FA 3A55A 2B2TC 1NYQA 2JF5A 2KQ7A 2Z0DB 1O7ZA 2C60A 2ICEC 3C3LA 3N52A 2JQRB 2BKRB 5D3DA 2K52A 1A2UA 4LUOA 4HWIB 4WJ3M 2SNMA 2BA1A 5IT9E 1Q81C 2KVRA 2IY0B 4S0RA 1X6OA 4DA2A 1PH6A 3IBEA 2KHIA 3I4MB 2INNE 1D7QA 3PCOB 1OO9B 2A6HC 2F1MA 1M1KC 1P98A 3Q3MC 1BCPC 2J0TD 4YCUA 2QCPX 3MXPA 3UIPB 3HOYB 4AUQC 4ILWA 1D1KA 1HQMC 2YTVA 4DAPA 3PSEB 5LMNW 3GZNB 1JQ4A 1VDVA 1XEEA 3AU7A 2K32A 4RHSA 1I3QB 5IGFA 4YSZB 5G2NA 1L0VB 3L16A 4ARCA 3K57A 3E6ZX 1F2ZA 4IWPA 3SU8X 2EE1A 4TQUS 1EY6A 4ID6A 5C5LA 3GO5A 2NR2A 1SSOA 3ZKJC 2DY8A 2K5NA 1CSQA 1TWAH 1R4NB 5CC4A 3PO2G 1CA6A 3E0JA 3OMGA 3CP0A 3AEBB 1FFVA 4JPBW 1RRBA 4ALPA 4DV3L 3K81C 1GO3E 1Q7YC 2MHJA 4J1MA 4CHTB 3HOZG 2H5XA 3E3XA 4CDFC 2ZW0A 2PVOD 4YSXB 1CZWA 1FGUA 2KHJA 1T5EA 2KCNA 2JEBI 2RF4A 4UHVA 4LK1C 3Q3JA 4B95A 1V43A 1EZ6A 3EVQA 4ZRZA 4A3KB 3NZ3A 3OYYA 3GE8C 3NK9A 1VQ9A 1TU2B 4I65A 5C0XH 4PT5A 1YNTE 4W9HA 1X3PA 4GN3B 2Z9HA 1BXTA 1YHAA 2KCMA 2CVRA 2N49A 3KYHC 4KV6A 3MA2B 2VL6A 4I7AA 4OVZA 1BVSA 2WFWA 2AKWB 4B9XA 4TMAB 3NBHA 3NSWA 1N32Q 5EPKA 3MC0B 4K3BA 2LFIA 1F77A 5LXIB 3CIRB 1V1QA 4GOPC 4V190 4JK1C 3T1HL 3ZLZA 1HNZL 3K59A 4POFA 2ZTEA 2LXAA 2KQ4X 2EYOA 4X65Q 3AMUA 4ZRQA 2LXCA 4BOSC 4F1SA 2W3RA 2FJ2A 4ZCKA 1STAA 3RUZA 4IFDJ 4ICUA 4TQ0A 1M94A 1DYQA 3ZYYX 3CC7A 2NMQA 4J6IA 3SDZA 3S1MH 2E2HB 4AQ7A 1HQRD 1ESFA 5CGKA 1VQ4A 5DNFA 4IOCA 3J7AV 3CC4A 2BGFA 4R8IA 1SIFA 3OJ4B 1EY7A 4HXDA 1QOAA 5J2RA 3RZDB 2A68C 2L9HA 1NYRA 2M17A 1E8XA 3R3MA 5MPOA 1SDFA 4A3FH 4H7BA 3PF5A 2R7ZG 2JE6I 3FKYA 4BY7G 4GOPA 2KOXA 1G6JA 2AUJD 3GV3A 4B3RL 2REXA 3W5VB 4LDTB 3QAQA 3IFTA 3GE3C 4CBVA 4X57B 5I6WA 5AZHA 3I4NB 4DAYB 4HCPB 1FXIA 4LFCQ 1MFWA 1H9KA 3LYYA 3ZNGC 3GTPB 1F2RI 2MRPA 2PIAA 1WVLA 3NWSA 1OGWA 2ZW1A 3NVVA 2ONQA 3IVFA 4AJYB 2A73B 2R3ZA 1RTOA 4IPCA 4X62L 1JWAD 2GOWA 1I7HA 2GVAA 3GTOB 3AV8A 1QJOA 1JORA 5JPNC 3FC4A 1VQEA 1SNPA 1YQBA 4R4CA 1ASZA 1KABA 5BN5A 2X38A 3N30A 4XDXA 1RD9D 2CJOA 2IO2B 2W3SA 5CORA 4B3RQ 4BBRH 3K58A 2K4KA 2KFJA 3A56A 1P9DU 1TT2A 1WFQA 2B2WA 3EJIA 4EVOA 2X6LA 1XMOQ 3W5UB 4DNIA 2KACA 3V6EB 1GVPA 5M3MH 2BB5A 3UI3A 4IUTA 1E22A 3PV0A 3NS1A 2JVCA 3X3NA 3MWYW 5EDSA 3VR3A 3DWMA 1ZGUB 2LZ6A 1A0IA 3UDIA 3E5SA 1GXDC 2JA7G 1PZJD 4BKSA 2E2HH 3S1MB 4ASWC 4B3SL 2WLBA 3BIID 4K2LA 4G7HC 3PUXA 3TBIB 2LFNA 4C3IB 2UWQA 4BS9A 2OJWA 3MJWA 2OEDA 5C3XA 3ZQ4A 3L17A 4MJSB 4WJNA 4LJPB 3KF6A 1JRUA 1X1MA 4CJ2C 4XYQA 5A2QL 1T0RC 4ZRKA 2BE5C 4A90A 1V1PA 2GBNA 2F0UA 3CQZH 2QA4A 5J17A 1XTDA 1OXSC 1SNOA 3AM9A 4OVVA 3DUZA 2IL8A 1GNUA 2FIDA 5C5MA 4A3MB 3VTUA 1FEHA 1JMLA 1L6UA 4K1RB 2GBKA 1N61A 1PHJA 4A3EH 1QNKA 2ZCBA 4A75A 5D3IB 2MQHA 1N34Q 3HVDA 4KGSA 2PQAA 3H0GH 1LTBD 5DEHA 1EIYB 4H2AA 2QW7A 2A6EC 4FXKC 2BDOA 1VQKA 4JGHB 2DZKA 4ANWA 3K5MA 4NY0A 4AOFA 3L2PA 5C0XJ 4FF2A 5FO7B 3A9KB 3ETRA 2BVCA 3AE6B 4MH0E 2M00A 4GLXA 1PH8A 1GOZA 2O2VB 2YEPF 4KKSA 3AE1B 4GN1A 2R7ZH 4MSQB 2I0QA 1XLNA 1TT5B 1WIAA 3HOXB 2WAQB 5AJ3L 4LAAA 5HFYA 4YWGG 2Z0EB 1WXQA 4W9GA 4KY5A 2L15A 5G3LD 4AYBE 2L1BA 3H0GB 4KHVA 4FJVB 4LJOB 3ZTCA 3BWUD 1RF2D 1Y1VG 5BR8L 3M3YB 1PFBA 1WSPA 2VH2A 3M4OB 2WXQA 3VYSA 4RM8A 5HGTA 2LWPA 1SN8A 2PZUA 4LFBL 4CYEA 3TEZA 2VB3X 2XRSD 4NAWB 1J8CA 4WJWA 3GTQH 1DJRD 1LQBA 4ZRIA 4ZQ3A 2BYVE
chains in the Genus database with same CATH topology
4CGYB 3TEYA 1LTGD 1C76A 1GJXA 2Q5WD 3P63A 2JYEA 1UWMA 2K0PA 1PGBA 1N60A 3ZJVA 5C44B 3S17B 4L23A 2VNUD 3PUVA 3EGRA 5E4XA 3AMZA 2E2JB 3KUPA 1G91A 1PTOB 5EE3A 2WXOA 2MP1A 2WP9B 4FO2A 1A2TA 1UEAB 4BBRB 1TY2A 1AFPA 4EQPA 1RDPD 4C3HG 1TKYA 3TP8A 4KD3A 3OWFA 4DAYA 5IOCA 3DWQA 1AZPA 2MGSA 3BDCA 1BR9A 1TY0A 4L63B 3WDNA 4ODGA 1RHPA 1LT3D 1PXUA 2EYJA 2BW2A 3IT4B 1G6ZA 4IZ8A 4H44C 3OOCA 4GDKB 3MHBA 4KTAA 1J7BA 1LV9A 1MD2D 3GS2A 1MSGA 2B8FA 2MJ3A 2PVGC 1F9RA 3GTJB 1VCIA 4RH6A 4ZKBB 1Y8OB 1KDBA 1DXMA 4R3DA 1ET6A 2NVYB 3PO0A 1CK1A 1DOYA 4BA1I 3TUOA 1KH0A 1HHVA 2L5TA 4ZK9B 1L6VA 4A3FB 1JOKA 4USAA 3ZJUA 1TWHB 1Q90A 5TSSA 2BE5D 1KTKA 2G1EA 1PTOH 1XF5L 4ZLTF 1EL0A 3S1NB 1Y8PB 5EKIA 3QJYA 3U2SC 3ZJTA 1TVXA 1DCZA 4HTHA 4N6EB 2JYTA 5I9PA 1M8AA 5F2DA 3AEAB 1TIID 4DU9A 3WOFA 2KVMA 1FRDA 2I07B 3W2DA 3OSOA 1I4QA 3AE9B 3GTQB 3MHZA 1EWHA 3PZ7A 1FMAD 1EEFD 2PYKA 1SYCA 3AEGB 2QEJC 1S4ZA 2PZWA 4U68A 1JOOA 1N5WA 1B1ZA 2V3NA 3VR2A 3VYTA 4HRSA 3HVZA 2Z1CA 3HEJA 4G4KA 2L52A 2WXKA 4R8NA 1DOLA 1JWSD 2OEOA 1PFMA 1STGA 2PO4A 2B2YA 1CA5A 3CQZB 1SXTA 1LT6D 3OHXC 4HEA1 1BUVT 4N9TA 1QB5D 1LLRD 2LHDA 2RSOA 4FXGC 5E1FA 4UAIA 3Q8FA 1FNUA 1QE6A 3ERQA 5EPLA 3SK5A 2JEAI 4EE2A 2QKIC 5C4ZA 3ITPA 5I2XA 4P16A 1WD1A 2WV6D 4IFDI 1JOQA 4D2KA 1EZ8A 1NR4A 5DAUA 4PMWA 4LMQD 5FOBB 1SBBB 1ZXTA 4OO1I 1WTVA 2J7ZA 5BYSA 3OIQA 3I90A 5KYLA 5M5WB 1EEID 3HG9A 3T3NA 1O78A 1K52A 1Q8IA 1MSHA 4BY7B 2WDRB 3V2TA 1BDOA 3NVWA 5K36H 2WKCA 2DY7A 1NEKB 1ML0D 3BVMA 5LNK1 2GB1A 4K6LA 1I6VC 4OIKA 2F3WA 3P1MA 4XT3B 3NE5B 3MXUA 2CW0D 4RGTA 3DMUA 4IUNA 4AS1A 1BNZA 5E6JA 1V1PB 2OXPA 1EFID 1GB1A 5C0XI 5J22A 1C79A 4HAEA 1PLFA 2K9XA 1FD6A 1EIHA 4DK1A 3HZXA 1SMYC 4QUCA 1SYBA 2MPMA 3P7JA 2Q8RE 2MH7A 4WWMA 3PMFA 1PGXA 1Q12A 2O2LD 1YN3A 1ENFA 3HKZB 3IAS1 4M0WA 4MH8A 4B08A 2JA7B 4C7YA 1H9SA 4A3BB 2E76C 1A15A 3SE0A 1TKWB 3QG1A 4FXDA 4FF3A 2OHFA 2NUCA 2DLBA 1T5XD 2A6HD 3MAQA 1Q1EA 5ISRA 3RZOB 4OGQC 3TP5A 5JJZA 4UDUC 4ABNA 1WD0A 1E7PB 3B2GA 1J9OA 1G291 1TKEA 2PLPA 2F4IA 4CKEA 1B9RA 4KGTA 3CKIB 2FMCA 1B50A 4FVMA 5BMIA 2KN4A 2EXZA 3P20A 4F87A 2IPKD 1ZUD2 2AX5A 4HN7A 2NZ1D 2BT6A 4L2YA 1I4HA 1A3TA 5JPMC 1EYCA 3DWPA 3TN2A 1LABA 1T6BX 3S14B 5BN4A 1ZYRC 3NUHB 4IKGA 5EBCA 1C78A 1DGJA 1GHJA 2LKVA 5JVH3 4M1UB 4KN7C 3BYTB 2XWJB 1JW9D 3KLSA 1XLOA 4I7ZC 1GUOA 1NI3A 5FK9C 4RKLA 2CHBD 5ELCA 2K5PA 3J81E 2Y3AA 2PQEA 1Z6HA 5DM73 1FD7D 3A7AB 4BWGB 2B2VA 4KK7A 1UAPA 5I2YA 2WS3B 1YNJC 2WXFA 3R3OA 5C3JB 1VF7A 2K05A 2NVXB 2HDEA 3MJ5A 3HRZC 5I9OA 1ICWA 4PV1C 2IJ0A 4P6VF 2B63B 1XO3A 2JXTA 2WXIA 1VJKA 2R61A 5GXGB 3LXFA 1VR9A 4JPSA 3AE3B 2SNSA 1HZ5A 4RF0A 5HI1A 1RODA 3VYRA 4YIJA 2WU2B 1DM0B 5DM63 1R4PB 4IUPA 3BG3A 1HUNA 1B9MA 1B3AA 3LB8C 1ZYRD 2JX5A 1ACCA 4WORA 3I3CA 1SMYD 3PIO3 2NN6G 2FE8A 1SE2A 4PQXA 1VLBA 3TSSA 4JWUC 4DXGA 3KK7A 3IL8A 1OQRA 5CBAE 3J81L 1JR0D 1JWMD 3GTLB 4IOIE 2RDGA 2KUMA 2ZXOA 5FR3A 1X3QA 2B2WC 1J8IA 2NTSA 3NVZA 1WGKA 1M4VA 4KKTA 1SIJA 3AE4B 2EELA 2F0NA 1U9RA 1EY9A 2H1EA 3M7GA 1EQTA 3AE2B 4BA2I 2NVTB 1T3QA 2F0DA 2TSSA 3JAML 2WXPA 4G7ZC 1PFDA 3TEXA 2LMCA 3VA7A 4KGRA 2D62A 1FCLA 1VMPA 1MHXA 1D2BA 2R92B 4F7XA 2M2LA 2NWGA 2WACA 2WXGA 2NBFA 1G8ZD 1CQFA 2RQXA 4RA8A 2WP8J 2KDMA 5JEAG 1JICA 3CRLC 3L4PA 4ZHOA 1B2TA 1FXAA 1IBXB 2ENBA 3GTMB 3VRBB 2A68D 3Q22A 1YMHE 2LHEA 3KLRA 3VR9B 2F0GA 5M3FB 1QKZA 3KWVA 1BQQT 3SK8A 4M8AA 1Q3LA 1C4AA 4YT0B 2L83A 3NQIA 1D5MC 2YU9B 1PUTA 5NUCA 3AEDB 4DFAA 4IDIA 1YQ3B 2A69C 3SVMA 2V0GA 1O80A 1QQRA 5CV8A 1Y1VB 4C80A 2D5GA 3OIPA 1FFUA 1E10A 2L32A 4FF1A 1MVKA 1EM7A 1F9SA 4A9AA 4OIJA 1RJTA 4HR7B 3HGBA 1A70A 2EPBA 1E6EB 5I4DA 1N5XA 3RPFC 2L12A 1JWUD 1GUWA 1R7SA 4OZCA 3FDTA 3VYUA 3P4PB 1C4PA 2RVLA 3BDOA 1GHKA 1SYDA 4K5WA 3KQ4A 1I4XA 3PUYA 2N9LA 2PMVA 2DYMA 3EFXD 2WXNA 4YTMB 4C1NK 4C3HB 1YN5A 2F0HA 2X69A 2JWUA 3B9JA 4LTUA 4KN4C 1SAPA 2HQEA 1CT1D 2ZT9C 2YYZA 5IGCA 2NN6I 5FLXL 2ICIA 1W6JA 2F0OA 1BUIC 3SFEB 2WXJA 2IW3A 1PTOD 3U9OA 1YJIA 3BS1A 2N7JA 3GTKB 1KLGD 3PIP3 2Z4HA 1TWCB 4OL7A 3NVYA 3KBGA 2IDYA 5KEEA 2N55A 4ZRPA 1SNMA 2WXRA 4IUUA 2L1AA 1LT5D 4OO1H 4KKJA 2H88B 3A8JE 2EY2A 1ZEQX 1WCMB 2C5CA 4XTCS 3A7LA 2YEPB 5JEAH 1KDCA 1BCPF 1LO5D 1JALA 3NRZA 3SXHA 3LWEA 2RA4A 1GUNA 1A6XA 3P1HA 3AECB 3IXSA 2K22A 1HRJA 1EYDA 3I57A 1V1OA 4WH4A 4ZOHC 1DZ1A 2EYMA 1HFNA 2DNCA 1V8CA 3CWIA 5I6YA 1CZGA 4QB4A 2C9OA 1SYEA 1EYAA 2KMMA 1XX8A 2RBMA 2WIIB 1SNCA 4HEDA 4GLSC 1SYFA 4PNYA 3T51B 5ELBA 2MJEA 1WTXA 1XCTL 5CV6A 4JE3B 4KKIA 5E4WC 5KYIA 1CTMA 1CJEA 1E9MA 3D6CA 4A3JB 1Q1BA 1U4MA 2XRQD 5ELFA 2NN6H 5C3WA 4REZA 3A54A 1XXGA 4K14A 5M3MB 1SJHD 2F0VA 1QLBB 2LGIA 2BB6A 2E6XA 3M85A 1SNQA 2V4DA 1YNNC 1EU4A 2QF7A 3BK1A 3TEWA 4YSYB 4H13C 2ID0A 2XVSA 2FUG1 3U52E 2BS4B 2JP1A 3GTGB 4HCEA 4A3DB 3D3RA 5M5YB 5BMHA 1NVID 2Z8LA 1IKLA 1NCVA 1BMLC 3Q69A 3G7LA 3A8IE 4QUFA 3W1SA 1UUPA 3DEPA 1CM9A 4KMUC 1XTCD 4A3IB 1ENCA 3Q23A 4IFDG 2WDQB 1JRPA 3DWAA 1TJEA 2RSNA 3QOJA 1U4LA 2EY1A 3SEBA 2R6GA 4HKZE 4TSSA 5EJWA 1SJED 3PZ8A 1TS5A 3T4AC 5KNCA 2B2YC 2LY7A 3D4WA 3U7ZA 1STYA 1PRTC 1I4RA 2K1BA 3R2TA 3FRPB 5LL6S 4J6HA 1K50A 1R9TB 3MFYA 3GD7A 2KQ3A 3VR5A 5FO9B 3WOEA 4X3UA 5T1GA 1KRHA 5EPJA 1BF4A 3EA6A 5EBDA 3AB5A 1EQVA 1DOXA 3DWGC 2O4XA 1RYJA 3KBXA 1HA6A 2M0AA 1WWTA 1SEBD 2VZKB 1F9QA 5C0XG 1EY8A 3K6OA 2CW0C 1OFFA 2G9DA 3TDQA 3X3MA 4MT5A 2FHTA 3I70A 4YXDB 1D4BA 1XCQL 4DAVA 3HOUB 1L4DB 1QOGA 2QDBA 3NXWA 1VZ7A 1P7FA 2WNMA 2IGHA 2F0QA 2QSDA 5C2TB 4BBSB 1EWYC 3I72A 4ZUJA 1AYFA 4OW0A 2BCOA 2VUMB 4G7OC 2INPE 1TWFB 4P2CB 1L0YB 4KJNA 4XE0A 3RFZB 3IAM1 4AYBB 2Y5PA 1C8CA 1KF6B 1HPCA 4C2MB 4ZKCB 1UGJA 2AWNA 4A93B 3NBIA 3R93A 4K6DA 1Y8NB 2AQ1B 3FEWX 1PZKD 2HTME 4E6IA 1D5XC 4NZLB 2IT1A 3EROA 4C7ZA 1IUEA 1PYWD 2MUYA 3SK6A 1H9JA 1L0XB 1RM6C 2JXMB 2AQ3B 4DK0A 3J80E 4NKLA 3S15B 2XNAC 1L5PA 1H9MA 2M19A 3MP9A 3K7AB 3NTKA 1AWDA 4RCNA 4ULLA 3CU7A 1PRTB 1PGAA 3R2IA 2QIEB 2DNEA 5BN3A 3KLSX 1ILPA 2BA0A 1B53A 5KNDA 4JWSC 2W55A 2XIWA 4IFDH 4RF1A 3AE8B 5HG2A 2JA6B 1CI3M 4CJ0B 2PKOA 3I91A 1TKGA 3NQTA 1HFGA 2RDFA 1NENB 3MXNA 1BO0A 3VRAB 3K0YA 2EVBA 4NAMA 5T1IA 2BBCA 4ME5A 5CR3A 2H4OA 1U4RA 3QO2A 1YNJD 2K01A 4PMCA 3J7YW 1JWBD 3J7AF 2LUMA 4RKBA 5HHDG 1BCPD 2F0FA 2RDHA 4HKQA 1DOIA 2F0SA 4IURA 1BOSA 1STNA 3JAME 2JSOA 3EQLC 3S2HB 1LTRD 4A3EB 3V96A 4FNFA 1GUGA 2KOLA 1S5ED 2J42A 2VZKD 3H91A 4Y7NB 3BZDB 1IHZA 2F0IA 1BBXC 2VXWA 1EOTA 1S5BD 3D31A 1VDZA 4RGOS 5CV7A 1C77A 3OW7A 2OF1A 1BCPB 3D4RA 3VR4A 2SAKA 4DQOC 2RMMA 3FPPA 1IKMA 1MBYA 2HUGA 4LK0M 1O7LA 3Q0AA 3OPOA 4DXFA 2D2CC 3Q6SA 2XN9C 3FPUB 2I46A 3SR1A 1TWGB 5AUKA 2EYFA 1PDXA 2R93B 2L4NA 1IGCA 3L7ZC 1D1IA 2JA8B 1C4QA 4A3GB 5M5XB 2PPBC 3T3OA 1K83B 3K5OA 1F2MA 2NTTA 2NB0A 1WYGA 1FR3A 1C9FA 4RFBA 1E2VA 1LTAD 3S1RB 2JU6X 3NHHA 3VR6A 4OO1G 1GAQB 1ZXIA 4WRDA 4US9A 2WDVB 2MJDA 1PTOC 4Q5VA 1G2TA 3ND9A 4HCSA 2B76B 2JZPA 2K3UA 4K5XA 1K53A 3H8HA 2ZXPA 5ELDA 1ZPSA 1JROA 1KNEA 4CJ1B 3C2PA 5D7GA 1FNVA 1LT4D 4A55A 1G2SA 5C3EB 1MHHE 4B9WA 5CYUA 3DEOA 2X6GA 5A2QE 1DD2A 4DN4M 2E3TA 1N63A 3FVQA 3AEEB 2F0KA 1QF6A 4YTNB 1Y1WB 1AN8A 2E2DC 1OXTA 3PO3B 1TS4A 2WKDA 4K8IA 3T56B 4S3SA 4IN3A 3H09A 1JE4A 1OXXK 2ON8A 1MPEA 3Q8AA 1FRRA 1K8OA 2KWDA 4FXCA 1H9SB 2EDGA 4X3TA 1CQVA 4L1BA 2AUKA 2EOTA 1FGBD 4DGZA 3Q8BA 3FILB 5FLXE 1WTOA 3T16A 3P4SB 2A69D 4WURA 5M9OA 2CU3A 3A8KE 5AUIA 2JA5B 2NVQB 3KF8A 2V3PA 3VR8B 1U4PA 1O7YA 3ABVB 1EY5A 1PDQA 4B0MA 4DF7A 3NTHA 4XDCA 1F2LA 1JC7A 1RTNA 1C48A 2J4XA 3W3AA 1JCKB 3V05A 5IGEA 2K7VA 3UI2A 4C3JB 2GI9A 1IBXA 1KLUD 4EQOA 3S1QB 2KCCA 2WU5B 1QCBD 4EQNA 4NMZA 4WIPA 4U673 1IL8A 3OMCA 4OZAA 1IYUA 3H94A 3MTSA 1AW7A 4OZBA 1IGDA 2ZXRA 4FP5D 3E56A 1KNAA 3DM1A 2K04A 1QOFA 5JAVA 1NAPA 1SE3A 1FYCA 3D4DA 1JB3A 4J8QA 3P4RB 1HA5A 1EIGA 4EGVA 4QF4A 2DN8A 4F8MA 3J9CA 2WXHA 3PUZA 1DONA 2A5HA 3HS0C 4L6TB 4RCOA 5IGGA 4N58A 4KY6A 3Q8CA 5JXVA 2IX1A 3S16B 4FYDA 1ZOYB 4KKUA 5CV5A 4H0LC 1RWSA 2KA7A 2B39A 1H9RA 1ZDXA 4WFN3 2QMTA 1ENAA 3KWLA 2EZVA 2RKSA 2J53A 4A8XC 1Y69U 3HP3A 2EYLA 5EGTA 3QOLA 2Q8TA 1HCZA 1ESRA 1SSNA 5J39A 3AN1A 3HOWB 3AE7B 3PUWA 1C4CA 2K5QA 2KEDA 3TMEA 2PCFB 3D6WA 1VRAB 2F0LA 4ZYSA 1TS3A 3URYA 1HZ6A 4KI0A 1ROEA 4XQJA 1QOBA 3L3OC 2W54A 2K33A 4J3OD 4XWTA 4RAUC 3WCQA 1EU3A 2SEBD 4WQMA 5BMGA 1K51A 1HTPA 2XWBB 4B0EA 2WB1B 2L0CA 1PRTF 2B8GA 3ND8A 1L4ZB 1RCVD 1V97A 3R8BA 5C4XB 2EYHA 1SF0A 4F88A 3ZGZA 4XQQA 3P4QB 4Z9CB 1LTID 2K28A 3BDLA 4KY7A 1F2YA 3N9YC 3I9V1 2L55A 2MJ8A 1OQQA 1HUMA 2PZTA 3MVVA 4IALA 3MXGA 5EKLA 1EY0A 1WTQA 1IYVA 5E3FA 3ONAB 3SFDB 1ZDVA 3PO2B 3QIAA 2PNRC 2KECA 4HSVA 4KD4A 4DNTB 2HCCA 4JBWA 5JOBA 4N9PA 1WTRA 2WXLA 5BYRA 3TP6A 2O5IC 4YTPB 2AQ2B 3T13A 3DXJC 4O42A 2BOSA 1SYGA 4PMBA 2BYTA 2AWOA 1AEXA 3BVGA 1HTLD 2PTLA 1FM0D 3GQBA 3N6RA 5G5HA 5C4JB 3MEHA 3K5NA 1PFNA 2CJNA 3P42A 1LTSD 3K5LA 3S9WA 1NUCA 4ZUIA 4Q0FA 1DOKA 3SK4A 3C46A 1VF5C 4TKOB 1A3VA 3AH7A 4US8A 2GA4B 2O5JC 2J52A 2VB2X 1B9NA 4DNRB 4HMIA 1ZP0B 5EE9A 4RGMA 1X32A 2IX0A 1KAAA 5KIXA 1E2ZA 1ONLA 4HROA 3I4LA 3U4EG 1CFMA 3M4YA 1ZKOA 2QJLA 5G5GA 4L8JA 3J80L 1TWAB 1J7AA 2E2IB 5EE0A 4X3KA 4LLGM 3MFGA 3O13A 2HDLA 4ITKA 1D6EC 2K5WA 2PW5A 2KEEA 2JSVX 3NUCA 2F03A 3I73A 4NDXA 2WXMA 2JYOA 2QILA 5FKAC 1E2WA 3FILA 1D5ZC 2LS01 3G6JB 3HUIA 4RWSC 3H3VC 1XLPA 1HXYD 5H8YE 3T53B 3U9SA 4C56C 1YQ4B 1TYGB 1F0ZA 5IGBA 5D65A 5EKKA 4C3IG 1OXVA 4G57A 4IUVA 1IW7C 4X3SA 1VZ6A 2XSCA 4QIWB 2KAJA 2PW9A 3SR6A 3AEFB 3VA5A 3QB3A 4XYOA 4XQNA 1PZID 1JQYD 1GUSA 5FO8B 2F3VA 2L11A 4MIUA 2WINB 5COYA 2PW7A 1XYIA 2B2VC 1ILQA 2F0WA 4NP5A 3MZ5A 2A6ED 4KHZA 2D5DA 5CBEE 1TQOA 5D14A 1UWXA 3VQIA 2K6AA 1NSNS 3C8YA 3C1FA 2GRIA 5CV4A 2EKIA 1MGSA 3HRDD 3E9SA 5EQ0A 3QWNA 1AP0A 1S5CD 4ARIA 2EY5A 5JEAJ 3Q24A 4C3JG 1KFYB 4QMGA 1I50B 1YJJA 3GP7A 5KRUA 1ZXHA 2PMZB 2N9KA 1WTWA 4KJOA 4KX6B 2BS3B 1S5DD 4CKBA 2F0TA 3AB9A 1ZE3D 3P75A 1N62A 1J7CA 4XWWA 4NW2A 1LACA 1I4PA 3L9AX 2FINB 1HEZE 3TP7A 2HCIA 4RNAA 2EYPA 3HOZB 4ZAIA 4XIGS 1VMCA 2FMMA 1RKNA 4RHRA 2BS2B 3OWEB 3S2DB 3CHBD 4Q2JA 1E0BA 4K8JA 1GB4A 4JX1C 1EWCA 2DWQA 1FO4A 2HDMA 1F2RC 3BK2A 1FIQA 4IUQA 1Q10A 2F0JA 2FBWB 2TMPA 3FKIB 1B4OA 1OXUA 1QG7A 1STEA 2IX3A 4MN3A 2ACZB 2Q8IB 4ZHPA 3NP8A 1II3A 4MM3B 1WRIA 2E75C 2CQAA 3CRKC 1A3UA 3M7NA 2BTEA 1EY4A 1VZ8A 2R7ZB 1P7EA 3V3XA 4RGNA 1SFOB 2SDFA 2LJIA 4CQNA 2KHSA 1Z7TA 2KJXA 4TQ1A 5EE1A 5A35A 4HMJA 1ET9A 1XLQA 2W82A 2M56B 1FNWA 3NWTA 3LX0A 5K5PA 5LL6X 2IGGA 1CZPA 1E0ZA 3C1EA 1QNUA 1DOMA 3SHLA 1CHPD 3NTIA 1V8QA 5T8IA 2F0PA 1AZQA 5CMDA 3BYYB 3RLFA 1GPXA 3LNNA 2K03A 1PRTD 1QT9A 1NR2A 4GDLB 2N0SB 1QILA 3FMCA 3GV6A 5BYQA 1IW7D 1Y56A 4HJGE 4TRDA 2V4IB 2OT2A 3H6MA 2H89B 1TZOA 1KDAA 2F0MA 3LWUA 4MACA 4MHEA 1LTTD 2B2UA 2WQYB 3F2UA 2I38A 1SE4A 1B44D 3BVZA 4GZYC 3B2FA 3IKJA 1I4GA 2IWHA 5IIFA 5K36G 5H92C 2I2YA 5IGDA 1MI0A 3IAYA 1QOHA 3NPPA 2NYZD 4XT1B 2EJGC 2D9UA 5ELEA 2FFKB 4CKCA 2B2UC 4OHJA 1FCCC 4HSPA 1STHA 1PTOF 2K5DA 3GB1A 4N59A 2EJFC 4XXEA 3DHQA 2MEKA 3Q8EA 2Y5CA 1YNND 2BDNA 1S5FD 4NJCA 4WAFA 2LMCB 2DYOA 2EY6A 2M9VA 2MHVA 2Y0SB 4FF4A 1Z47A 5KGUA 5IT9L 4O1NA 4V0BA 3IT6B 1XWEA 5C4HA 2RPVA 2N88A 5C6AA 2LEKA 1W6KA 3IFDA 5LHY1 2E74C 1RFKA 3AE5B 2F0EA 5G3LF 1MI2A 1YN4A 1QWYA 3FAHA 4A6QA 1I6HB 2Z4IA 1SNDA 5AFWA 1PMRA 3HOVB 2EJMA 4LJZC 4BY1B 4R9WA 5CV9A 2G9HD 2IGDA 1TR5A 4C1NI 2B2TA 5KNBA 5IODA 1R4QB 5JVG3 3RMHA 1SB3C 2SOBA 1CHQD 3I8ZA 3TZUA 2A74C 1TS2A 3W9CB 3TZDA 5J1ZA 5HURA 3RD4A 1F9PA 3D8GA 4XDDA 1UNSA 4K5VA 4K2KA 4IQZA 4QCLA 1K8MA 2DBYA 1WTPA 1GUTA 1STBA 3A55A 2B2TC 1NYQA 1O7ZA 2ICEC 3C3LA 3N52A 2JQRB 5D3DA 1A2UA 2SNMA 2BA1A 5IT9E 4DA2A 3I4MB 2INNE 1OO9B 2A6HC 2F1MA 1BCPC 2J0TD 2QCPX 3MXPA 3HOYB 4ILWA 1D1KA 1HQMC 4DAPA 1JQ4A 1VDVA 1XEEA 3AU7A 2K32A 4RHSA 1I3QB 5IGFA 4YSZB 1L0VB 4ARCA 3K57A 3E6ZX 1F2ZA 2EE1A 4TQUS 1EY6A 4ID6A 5C5LA 3GO5A 1SSOA 2DY8A 5CC4A 1CA6A 3E0JA 3OMGA 3AEBB 1FFVA 4J1MA 4CHTB 2ZW0A 2PVOD 4YSXB 1CZWA 1T5EA 2KCNA 2JEBI 4LK1C 1V43A 1EZ6A 3EVQA 4ZRZA 4A3KB 3NZ3A 3NK9A 1TU2B 4I65A 5C0XH 4PT5A 1YNTE 1X3PA 3EUB2 1BXTA 2CVRA 3MA2B 4KV6A 4OVZA 4B9XA 4TMAB 3NBHA 3NSWA 5EPKA 3MC0B 2LFIA 1F77A 3CIRB 4V190 4JK1C 3K59A 2KQ4X 2EYOA 3AMUA 4ZRQA 2W3RA 2FJ2A 1STAA 3RUZA 4IFDJ 4TQ0A 1DYQA 3ZYYX 2NMQA 3SDZA 2E2HB 4AQ7A 1HQRD 1ESFA 5CGKA 5DNFA 3J7AV 4R8IA 1EY7A 1QOAA 3RZDB 2A68C 2L9HA 1NYRA 5MPOA 1SDFA 4H7BA 2JE6I 2AUJD 3GV3A 3W5VB 3IFTA 4CBVA 5I6WA 3I4NB 1FXIA 1H9KA 3LYYA 3GTPB 1F2RI 2PIAA 1WVLA 3NWSA 2ZW1A 3NVVA 2ONQA 2A73B 2R3ZA 1RTOA 1JWAD 1I7HA 3GTOB 3AV8A 1QJOA 1JORA 5JPNC 3FC4A 1SNPA 1KABA 5BN5A 2X38A 4XDXA 1RD9D 2CJOA 2W3SA 5CORA 3K58A 3A56A 1TT2A 2B2WA 3W5UB 4EVOA 3EJIA 2X6LA 2KACA 2BB5A 3UI3A 4IUTA 3PV0A 3NS1A 3X3NA 3MWYW 3VR3A 3DWMA 3E5SA 1GXDC 1PZJD 3S1MB 2WLBA 3BIID 4K2LA 4G7HC 3PUXA 4C3IB 3TBIB 2LFNA 4BS9A 2OEDA 5C3XA 3ZQ4A 4CJ2C 4XYQ