4HROA

Crystal structure of h. volcanii small archaeal modifier protein 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
87
structure length
87
Chain Sequence
GAHMEWKLFADLAEVAGSRTVRVDVDGDATVGDALDALVGAHPALESRVFGDDGELYDHINVLRNGEAAALGEATAAGDELALFPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Small archaeal modifier protein 1
publication title Crystal structure of H. volcanii small archaeal modifier protein 1
rcsb
source organism Haloferax volcanii ds2
total genus 24
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4hroA00
3AMZA 2WU5B 3P1MA 3KWLA 3AEGB 3WCQA 4A9AA 1JWAD 3AE7B 1QOBA 2K22A 1WRIA 1KF6B 1ROEA 5H8YE 1RWSA 1VDVA 1OFFA 3AV8A 3HVZA 2CJNA 2CU3A 1DOYA 2WQYB 4US9A 1OQRA 3NS1A 3P4QB 2JQRB 4JWUC 1FFUA 1FIQA 1TKGA 1YJIA 4N6EB 1TKYA 2AX5A 2BS2B 2M56B 3HUIA 4YSXB 1XO3A 4KX6B 3VR8B 1SF0A 5G5GA 4JWSC 1PUTA 3PO0A 2Q5WD 2K5PA 4C80A 1F0ZA 1FXIA 4HRSA 2PIAA 1PDXA 3LB8C 3SR6A 2WDVB 5C3JB 3FAHA 1CJEA 3AEDB 4C7YA 1NYRA 1E9MA 3AEEB 4IDIA 1JQ4A 1QT9A 4HROA 1FRRA 3AE9B 5H92C 1J7BA 3AB5A 4YTMB 1JWBD 5EE9A 2W54A 2MH7A 1WGKA 3NRZA 2PKOA 1IUEA 3LXFA 3NVYA 3AEFB 1QOFA 1N61A 1XLOA 3AE8B 1B9RA 1T3QA 2KMMA 1CZPA 4LTUA 1FRDA 4USAA 3FC4A 4ITKA 4YSYB 3VR9B 1E0ZA 3AECB 5G5HA 3B9JA 1VJKA 1RYJA 1QOAA 3P4RB 3P63A 3RPFC 1L0VB 2W55A 1GPXA 3AN1A 2BT6A 1WWTA 3SFDB 1L6UA 2G1EA 4C7ZA 2PVOD 1PFDA 1SB3C 2FBWB 1TKEA 4YSZB 1UWMA 4WWMA 1NVID 5EE1A 2B76B 2BS3B 3AEAB 1JW9D 2WDRB 2WDQB 3AE5B 2QIEB 3ZYYX 1N60A 2LEKA 4JX1C 5AUIA 1L5PA 2BS4B 1A70A 1FM0D 1DOIA 1N63A 1NYQA 2L52A 2E3TA 3B2GA 1FO4A 1QF6A 2ACZB 1ZP0B 3P4SB 1JRPA 1VLBA 1FXAA 3EUB2 1RFKA 1RM6C 1XLPA 3L4PA 1ZUD2 1KRHA 2K9XA 2QJLA 4US8A 5GXGB 1DOXA 1KFYB 2DWQA 2M19A 1YQ4B 1EWYC 2W3SA 1J7CA 2MJ3A 1GAQB 2N0SB 3AE6B 1J7AA 2WP9B 3CWIA 3AE1B 3DWMA 1XLQA 4WQMA 1NI3A 4ZOHC 1WXQA 1N62A 2JX5A 4YXDB 2CJOA 4FXCA 5EE3A 2HTME 3NVVA 1FMAD 3SFEB 1E6EB 1ZXIA 1WYGA 5C2TB 1I7HA 1FFVA 4N59A 2WU2B 3DWGC 1NEKB 1N5WA 2L83A 1NENB 2H89B 1JROA 3AE2B 3W9CB 4YTNB 2PVGC 3AE4B 3W5VB 1AYFA 1L6VA 1N5XA 2OHFA 1V97A 1YJJA 2EKIA 3CIRB 1V8CA 3AM9A 1R7SA 2W3RA 3NVWA 1DGJA 2Y5CA 2WLBA 1SIJA 1JALA 3ETRA 5EE0A 4ZHPA 1AWDA 3HRDD 3P4PB 4YTPB 4N58A 1XLNA 4ZHOA 2WS3B 5AUKA 3VRBB 3NVZA 3AE3B 1E10A 4P6VF 1YQ3B 3ABVB 1QLBB 3VRAB 2DBYA 1TJEA 3W5UB 1ZOYB 3BIID 5MPOA 2MJDA 3AH7A 2H88B 3AEBB 4YT0B 1E7PB 3B2FA 1TYGB 2KAJA 1QOGA 1OQQA 2MJEA
chains in the Genus database with same CATH superfamily
3M3JA 4K3BA 1KF6B 1SXTA 2WGSA 4CO7A 2DAJA 2JZZA 3QAQA 1OQRA 2CKHB 4JQWC 2AX5A 1T0RC 2R61A 3ECIA 2KDFB 4PS3A 1YX5B 4P1BC 2VZKD 2BF8B 4JGHB 2LVQA 2LWPA 5JH5C 2V4IB 1NYRA 3EGRA 3JSVB 2L00B 2WNMA 2ICIA 1E8WA 2XN9C 5EE9A 5BYSA 1D5XC 3FILB 3ZVVA 3AE8B 2MBQA 1TZOA 2LRUA 1E0ZA 4IM0A 3Q14C 1RYJA 1N6ZA 2FBWB 1SE4A 1L4DB 3U7DA 5AUIA 1MG8A 1N63A 3NZUA 1FO4A 2X8XX 3ZO5B 4DHZE 3ML8A 3RZFA 2M19A 1NI2A 1UNSA 2INNE 2WP9B 1A5RA 2KFKB 1TS4A 2IGGA 4NAWA 4FXCA 2XK5A 1Q0WB 1LGRA 3HHMA 4WIPA 3DWGC 1CK1A 2K39A 1NENB 1UZXB 2PVGC 4M0WA 2JZ3B 1OEYA 4G0NB 2OHFA 4IWOA 3WAMA 1SIFA 3APCA 1XD3B 1WYWB 3N1XC 4RH6A 4KGRA 1L7YA 1SGHA 3T3NA 4FN2A 4K3CA 2W9NA 5D7GA 2DZIA 4AUQC 1HTOA 4K81A 4YT0B 3P2BA 1TYGB 2EELA 2HE7A 2G9HD 3SHQA 5T8IA 1VZ6A 3VFKA 2ZW1A 3HVZA 2ASQA 3VAWA 4ACFA 2JQRB 4GDLB 2YLMA 2B3AA 2QDFA 4OZCA 4C80A 2CU1A 3BVGA 3L16A 3AE9B 4YTMB 1KLUD 1M94A 1XQQA 3HK0A 4KDIC 1YQBA 4NY0A 4MM3B 5D2MB 4P16A 4P1CC 3JSVA 1WR6E 3FILA 1UWMA 2NPTB 2KLCA 2N4FA 2RSUA 1GUAB 3TUOA 3ENEA 1IYFA 2N9KA 2L1AA 1SBBB 3AE6B 3RNGC 1ET6A 3PT2B 3CMMB 4KSKC 1KOTA 3OLMD 3WALA 1FMAD 1I7HA 4KGTA 1BT0A 1SE2A 2AQ1B 4E74A 1TS5A 3VHTC 1L6VA 2KC1A 3DBLI 4IG7B 2WLBA 1P1AA 3VUYA 2JXXA 3DBRB 3ZNHB 3I9V1 2J53A 3RCZA 1FNWA 4EZKA 5AUKA 4KGSA 1E10A 4FADA 1RAXA 1E8XA 1VCBA 1TJEA 1HEZE 1UWXA 2MBOA 2LHDA 4G50A 3AULA 1WRIA 2RPQA 2GBRA 2HJ1A 1F2RC 3H8HA 3WAOA 2BGFA 2ZZPB 2KN4A 2PJHA 4DHJD 3PO0A 2Q5WD 2BVCA 1D5ZC 1YN4A 3LB8C 1T0QC 4N9F4 4OVVA 2IDYA 3PPAA 3EECA 4GDLA 3KUCB 3KWVA 5FR3A 2REXA 2RGFA 1SEBD 2J0MA 3LJ3A 1MJDA 2N1WA 1YX6B 3UIPB 4TQ0A 1C4CA 1KLVA 3P4RB 3DVNU 3PTFC 2MBEA 2LVOA 2BT6A 2G1EA 3U7ZA 1I4PA 2FIDA 3TEYA 3ZNGC 4LNNA 3AE5B 4K7SA 4AJWA 4JX1C 3CSTA 4WJPA 3SD5A 3MHSD 3IFWB 4MM3A 1VLBA 1XLPA 1LFDA 2LRWA 5GXGB 2V4LA 4WWOA 3BVZA 2L8JA 2LGIA 2NPTA 4RGTA 4YXDB 2BTEA 1TS3A 3OAWA 2DZMA 1LQBA 1J19A 2JU6X 2K25A 3CIRB 4BKSD 4GMVA 2AL3A 3U8ZA 5EE0A 3ETRA 2I1JA 4NJ7A 2KANA 5DPRA 3L17A 3ZTDA 2JSVX 2CR5A 4RM9A 4RGOS 4W9FA 2MJDA 2H88B 3ZTCA 3B2FA 4UDUC 1OEYJ 3KWLA 3AMZA 3P1MA 3O13A 2KTRB 2FUG1 2JY6A 4IKGA 4O1NA 1GB1A 3QWZB 3B0AA 2M0AA 3ZRCA 5BYQA 4FA6A 3AU4A 1TY2A 5D6JB 1HZ6A 2WXRA 2WXPA 4IWPA 4G11A 4HJKA 4DDGD 3RMKC 2Z0DB 1XT9B 3IXSA 1HXYD 3VXWA 1PDXA 3PHWB 4HDOA 4TKNA 1J7BA 1MFWA 2D3AA 1QKZA 3OG5A 3LXFA 4DK5A 1QOFA 2KMMA 4USAA 3LYYA 2IPKD 2YEPB 3B9JA 3RYTA 3BYTB 4XWWA 1WWTA 4C7ZA 2W82A 2BQQA 3VUWA 5EDSA 4WWMA 1P9DU 2WDRB 1VZ8A 2IO2B 1ZDXA 1N60A 2LEKA 2NS5A 2GBJA 1NYQA 3ZDMC 3P4SB 4DQOC 3ZUNA 2XEWA 4ANVA 2XNAC 3M62B 5AZHA 3V62A 3M63B 4L23A 1N62A 3UI3A 1JWSD 3PZDA 3QA8A 3W1YA 2WU2B 5AEKB 1G6JA 2JWZA 2H89B 2WXNA 4R3DA 3AE2B 2M4NA 3AE4B 4KVGB 4AQ7A 2IZVB 3AU5A 3TJPA 3HRDD 4B9KA 2N9XA 5LNK1 2EMSA 3HM3A 4DHJB 1F52A 1ZE3D 1YQ3B 1L2NA 5E6OA 2PTLA 3EHVA 2ACZB 4OHJA 1OQQA 5DPTA 1SE9A 2WXJA 4MSMB 2OEDA 2MBBB 2DYOA 3N32A 1Q1OA 1AARA 3ZJTA 1LM8B 3MTNB 2M56B 4YL8A 2AEHA 4YSXB 4NJ6A 4W9LA 2INDC 1C4PA 2KJHB 4HLEA 4PYZA 1UH6A 3WIMA 1EM7A 1MVKA 1WGRA 2CS4A 2MSED 2V3NA 2KMCA 2RPVA 3WANA 2LGSA 2RR9A 2EKEC 4ZRIA 2WXLA 2A5UA 3L13A 2LGDA 1XCQL 1KTKA 3Q2AC 1L0VB 5CHFA 3TIXA 1C3TA 2BWFA 1TKEA 2NBWB 3RZWC 1JW9D 4GGQA 2KOXA 1L5PA 1T6BX 1DOIA 1FCLA 3FKYA 2WX0A 1EWYC 1WXQA 3MP9A 3DBHB 3KUZA 3ML9A 3PRZA 2XK5B 3KW5B 1V97A 1V81A 2IGDA 4XC2A 1V8CA 3NVWA 1SIJA 3TEXA 1AWDA 4M0WB 2DENB 2Y3AA 3AE3B 4FJZA 4P6VF 2ZNVB 3VRAB 3W5UB 4NNJB 2E6XA 1WF9A 1FNUA 2G3QB 3A4SC 3ZDTA 3ZW3A 5IA7A 2ZPNA 1FEHA 3DHGC 3PLUA 2NVUI 2LUMA 1DOYA 2L3ZA 1YJIA 3L10B 3N3KB 5D3IB 1FXTB 1WZ3A 3GZNI 1F0ZA 2IY0B 2GRIA 3X0WA 2L05A 1OTRB 3PS6A 3Q3OC 3AB5A 2GMIC 2WXIA 3MC8A 1X1MA 1WIAA 4ASWC 3W1SA 5JHAA 2PKOA 1IUEA 1WXAA 2KZRA 4X57B 2FAZA 3VR9B 4YSYB 1FCCC 4BKGA 3R2IA 1WX8A 3NS8A 3NZSA 1GC7A 1HQRD 1GPXA 3TSSA 5LXIB 1WJ6A 4MACA 5TR5A 3ZKJC 3T3OA 1L0XB 4IWQA 3UGBB 3R7RA 4FHJA 1V2YA 4JL9A 1FD6A 1DOXA 2W3SA 4BOZB 1GAQB 3MJWA 2GB1A 1WSPA 1C4AA 3RNEC 1WGGA 2J0JA 2K8BA 4BKSA 3KUDB 5JHBA 2V1YA 4REZA 4ZRJA 3DBLB 4B0MA 1E7UA 2O6VD 2C7HA 2W3RA 4DWFA 3SEBA 4RM8A 2KWVB 2IO0B 1J0GA 2JRHA 2KWCA 2BWES 3V3XA 3AH7A 4LNKA 1V1PA 2KAJA 2N7DA 4JWUC 3WCQA 3DBHI 4ARCA 2R2QA 4WWPA 2AL6A 4ZYNA 1JWMD 2CHZA 4XYCA 4XE0A 4A8XC 2CU3A 1T0SC 1YNTE 3KLSX 2D10A 1FPYA 2KQSA 2DHZA 4PYUA 1EO6A 4EZLA 3ZJVA 2INPE 1XO3A 1E8ZA 4B95A 2OJRA 3VR8B 4C4VA 1E90A 1WM2A 2D3BA 4DXFA 3DVGY 3KH0A 1ZKHA 2C7NB 1YMHE 2WXOA 1ACCA 2IBIB 2W54A 4GOCA 2ZVNA 1B9RA 1CZPA 4GIVA 4LTUA 2FNJB 2L32A 1P98A 4WJNA 3IT4B 5BMHA 2M17A 3NY5A 1CMXB 4MT5A 3BK1A 3Q3MC 3KQ4A 4BAXA 5G55A 4FJVB 3KVFB 4HCPB 2MCNB 4MH8A 1WJNA 1V9JA 4MJSB 3ALBA 4US8A 3S2AA 3E9SA 3CWIA 4P7IA 4WJOA 1TZ1A 1XCTL 5IP4D 1HZ5A 5C2TB 2KWDA 2KDMA 2NTSA 1WFYA 2D3CA 3I5JC 4IC7B 4ICUA 3W5VB 1AYFA 1WX7A 2KD0A 3Q8BA 4S17A 2HD5B 4K7WA 1ESFA 1QILA 4N58A 2BYEA 2WS3B 2IYDB 3J9CA 2SEBD 3QC8B 2Y5PA 1RRBA 1QLBB 2KHWB 1GNUA 3ZXVA 3BIID 1JRUA 2V9HA 1E7PB 2WXHA 5D3DA 2K3UA 2NCNA 1YN5A 3A9KA 3OJ4B 2KX0A 1AN8A 3Q3NC 2GBMA 4PK1A 1WRDB 4ICVA 1GJZA 2QCZA 3I57A 2GLSA 4J3OD 2BS2B 3HUIA 2INCC 3PREA 1LXDA 4KV2A 2VZKB 2PIAA 3FAHA 1C78A 2HJ8A 3PZ7A 2MLBA 1JWBD 3NHEB 5D94A 4F8CB 4W9KA 4PT5A 2MBHA 3AEFB 1T3QA 2J4XA 3NUHB 3VH4B 1Z2MA 2LFIA 4BBNF 3V6CB 4II2B 2AQ3B 1WR1A 1UF0A 1PGAA 3UF8A 2O6VB 4ZDVA 4WAAA 1L0YB 2E3TA 1WZ0A 3NJTA 2KLGA 2QJLA 2WHIA 2DWQA 2FCMA 5E6JA 2WXMA 5G2NA 3APDA 4IW0A 2LGXA 4HCNB 4DXGA 4MJSA 3PZ8A 3AM9A 1DGJA 1HA5A 2C5LC 4ZHPA 1D5MC 1XLNA 4EEWA 1C76A 4CQNA 3ZLZA 3VRBB 2Z0EB 5HI1A 4ZRPA 2N9EB 2RDBC 3MJ5A 2BKFA 3AEBB 4NQLB 3C8YA 4GDKA 4HEA1 4MH0E 1WJ4A 2LJ5A 3RD2A 4AWJA 2VH1A 2IY1B 2Y5BB 4OW0A 1F9JA 4HPMB 1I42A 1PQSA 1HTQA 2C7MB 3M95A 3QQ8B 3R2TA 5G5GA 3U30A 3N30A 1SJHD 1RFAA 4II3B 4MSQB 2JF5A 4NZLB 4IDIA 4EKUA 5IO9A 1V1OA 2MWSB 4S0RA 1I35A 2MH7A 3NRZA 1K50A 3ZGZA 3BINA 2KO3A 2LXAA 2HTHA 5G5HA 2KDIA 4OZAA 2LGYA 4KZCA 3OJ3A 4FJYA 2PVOD 5DCNA 4HJGE 2DYMA 1EF5A 4I6LB 5CTRC 2QIEB 5LLIA 1SSNA 1EU3A 2BS4B 2LI5A 3C19A 2KT7A 1JRPA 1F2RI 1BMLC 1YQ4B 1XEEA 1TIFA 4NQKE 5EE3A 3H7PA 1T0YA 3KYDD 3VDZA 1TTNA 3V60A 2MP2A 2O6VA 1WE6A 3R8BA 1TBEA 3VUXA 4LNFA 4A55A 2AWTA 4F7ZA 2EKIA 2LJIA 4KSLC 4KDLB 1VD2A 1Q10A 4HVBA 1NBFC 2Y5CA 1GC6A 2BYTA 2JUOA 4FHKA 3KYCD 1ZGUB 5HKHA 3P4PB 3ZJUA 4PS8A 2WDTB 4EFOA 2LASA 3U52E 2CHWA 4LNOA 2KMAA 3K9PB 2JWUA 3N1ZC 1BXTA 2L83A 3ZQ4A 2YVCA 2QHOA 2K0PA 3EFUA 2ZJDA 3ZIMA 5IOIA 1JWAD 1WM3A 4LNIA 1EF1A 3QIJA 3VTWA 4TMAB 4LLGM 1R4NI 4I6NB 2QC8A 1C79A 3GZNB 3R3MA 4M8MA 1I4XA 1V49A 2BW2A 2YEPF 5DPSA 2NMQA 3AEDB 2D11A 4RF0A 1MHXA 3ZRFA 4RFBA 3PHXB 2IO1B 1VR9A 1EU4A 4ZRKA 1ZDVA 1N61A 3I63C 1ET9A 2NR2A 2KNBA 1WXMA 1PYWD 3AECB 2K6DB 4J6IA 2N7JA 3DBSA 3RPFC 1P0RA 3AN1A 1I4GA 1I4HA 1C1YB 1H8CA 2KWUB 2ONQA 2N9LA 2MRPA 1XF5L 3TL5A 1CQVA 1STEA 4IOIE 2OOBB 1F1HA 1YOVB 5BO4B 4JPSA 2KXJA 2LHEA 4GSWA 1KRHA 2N0SB 4WQMA 3I3TB 3IAM1 1XLQA 1JCKB 2HTME 2LD9A 1RLFA 1ZXIA 4N59A 3IVFA 4GXBA 3D32A 4MEMA 3O65B 2Z59B 1K51A 2BYFA 1N5XA 1V86A 3VVWB 4BZAA 3LDZE 3WA0A 3R66C 1VZ7A 2ON8A 3TCAA 5IAAC 4TSSA 2QSDA 1WXVA 3UINB 2DLBA 3QK0A 4D2KA 3NVZA 5CX3A 3QCAA 2LXCA 4TUUA 2KX3A 1KM7A 3UQBA 1QOBA 3JYUA 3AV8A 4HPLB 1V1PB 1B1ZA 3GOEA 4L2YA 4CYEA 2L0TA 1WGHA 3MC0B 4N6EB 1TKGA 4GN1A 3RNFC 5KHQA 2KN5A 3ZNID 3RUIB 2RMMA 2KQ4X 2K1FA 1GG3A 4C4VB 1E9MA 2KTFA 2N7EA 1Q5WB 1IBXA 1WGKA 3NVYA 1AW7A 2LUEA 4FBJB 3MC9A 1C77A 4GU2A 4AJYB 2J0KA 1V6EA 1UGMA 3IT6B 2V3PA 3HVDA 2B76B 2V3SA 2NBVB 3Q3FA 3B2GA 4HKQA 3NG0A 3Q8CA 4OZBA 5GMVA 4FULA 3ZNZB 4C56C 1RFKA 3L4PA 2XBBC 2BB5A 1KFYB 2ZVOA 3L08A 4LK0M 1C9FA 1T5XD 2K8CA 4ANXA 1WJUA 2IO3B 1WYGA 4DHZB 5L83A 1FFVA 3OWEB 1NEKB 3UIOB 3TEWA 3BVMA 3PV1A 2WXQA 4LJPB 5J18A 1R7SA 1JALA 3P42A 2BBCA 2DX5B 2JYEA 4AOFA 4K1RB 2I1KA 4WJQA 4FLHA 1HE8A 2DBYA 1ZOYB 2IGHA 4JIOU 5I4DA 4W9DA 4ARIA 3DHHC 3MFGA 1MG4A 3DQVA 2DAFA 3Q8FA 4W9GA 2FCQA 4W9HA 4XGAB 2QILA 1VDVA 2WX1A 2MEKA 4XDCA 3NS1A 4M02A 2JVCA 3A9KB 2I2YA 1LO5D 2ZW0A 4WH4A 4JWSC 4W9EA 4A20A 4ZYSA 2PE9A 4A6QA 1E5WA 5FKAC 2WDVB 5C3JB 3QJZA 3GE8C 4C7YA 3PSEB 1QT9A 4HROA 1FRRA 1EUVB 3X23A 1TT5B 1K52A 1FRDA 3Q69A 4HK2A 4ITKA 4MGZE 4KZ0A 3RFZB 2WWZA 2W55A 1P3QU 2NTTA 3PRMB 1PFDA 2VRRB 5E6PA 4IUMB 1UELA 2BS3B 2VH2A 2PE6B 2BPSA 3Q6BA 4WQOB 3VTVA 1V80A 2FIFA 4DDID 4I6PA 3GP7A 3K9OB 5DPWA 1Y8RC 3DWMA 3EC8A 5KHOA 1TY0A 3APFA 3NVVA 3DCGA 4W9CA 1L4ZB 4BOSC 3W9CB 3TMPB 5LXHA 1YJJA 3T9LA 3JW0X 2Z8LA 2MW5A 2I38A 3N20C 4ZHOA 1D4BA 1K8RB 3Q8AA 3BWUD 4B6WA 1E8YA 3ABVB 3VQIA 1JWUD 3TBLD 4H2AA 2PW9A 5C23A 2MJEA 2PMVA 1F77A 3AEGB 4LDTD 4A9AA 2LZ6A 2PLPA 2J42A 5IKCM 1JMLA 5H8YE 1RWSA 2JZPA 4GDKB 3P4QB 4MGIE 1YJ1A 4WAFA 2ZEQA 3V61A 4QAYA 1PUTA 5AZFA 3E56A 1D3ZA 3SR6A 3A1QB 1CJEA 3DVGX 4F1SA 1J8CA 5JZEB 2LVPA 4EUTA 2BYVE 3VTUA 1XLOA 3SU8X 4BBNC 2WYQA 4BKTA 5J17A 2QEJC 2HDEA 3HM6X 3SFDB 1M4VA 1NVID 5EE1A 4JLCA 3AEAB 5CHVC 4A3PA 4MGKE 5JXVA 3ZYYX 4Q2JA 1FM0D 3PRPB 2KFKA 4CHKA 3RT3B 2K9XA 5J2RA 1UD7A 1J7CA 2MJ3A 3DPDA 4URKA 4M01A 3RN9C 5CHWA 1NI3A 2TSSA 1Y56A 2N9PC 2RDGA 2KJRA 5E6NA 4TQ1A 3Q8EA 1GB4A 1N5WA 1ZPSA 2KJ6A 1WE7A 1JROA 3DOWA 1WMHB 4GB9A 1S3SG 2GI9A 1U4AA 4YWGG 3H7PB 1SJED 2MP2B 3N1YC 3B1LX 4WWNA 1S1QB 1KJTA 3DHIC 2NBUA 4A3OA 3H6NA 4DXAB 3L0WB 1GOZA 1KH0A 1PGBA 1DYQA 3RNAC 4HKZE 5MPOA 2KKCA 2X38A 3GB1A 2O2VB 4EOYA 4JE3B 2WU5B 4XWTA 3B08A 3A9JB 3AE7B 3H9DA 1ROEA 2MHJA 3NOBA 5IN7A 1OFFA 2IJ0A 1R4NB 3IBEA 2CJNA 3C0RB 2KC2A 5BMIA 3SDLC 4L1BA 2MQJA 1FIQA 1NDDA 1TKYA 2QMTA 3H1UA 2V0GA 1UBIA 2J7QB 2BB6A 2WXKA 1IPGA 1KLGD 3AI5A 5L95C 5C1ZA 3CF6E 1EWCA 1JQ4A 1K53A 1IGDA 4LJOB 2OJWA 3W2DA 1XXGA 3Q3JA 2KDBA 3FC4A 1QQRA 1VRAB 2GBKA 3A1QA 1QOAA 2L76A 1L6UA 3R7QA 2KK8A 4YSZB 3BZDB 2KACA 1A70A 1UGJA 3AXCA 1QF6A 2C60A 4M8NA 4A90A 3PVLA 3EUB2 3URYA 1IGCA 3AE1B 2M8SA 2A4ZA 5FK9C 1WXSA 2MA9B 4G3XB 4XZ4A 3QHTA 1MI0A 1IP9A 2KYWA 3SFEB 2ZCCA 1E6EB 4XDDA 4ANUA 4GLSC 4KIKB 4W9IA 2C9WB 4YTNB 2JPHA 2G45B 1YN3A 2J52A 2KVZA 4LDTB 1TGZB 2PEAA 2KFJA 2DYBA 1SE3A 3EFCA 3WAPA 1WX9A 3DBRI 2M0XA 4IM3A 1WGYA 5BYRA 3UQAA 2PPHA 1YIWA 3RULA 1Z5SB 1WMHA 3DVNV 3L54A 3IHPC 3V05A 4RNAA 4E71A 2WXGA 2DZKA 3BY4B 3H7SA 3RI7C 3EA6A 3PLVA 2CHXA 4RF1A 2GOWA 1FNVA 2G4SA 4W9JA 2JXTA 1FFUA 2JRIB 2N1VA 1I4RA 1R4MB 2DNFA 1WY8A 4KKJA 2O2VA 4KX6B 4TV3A 1SF0A 1ISNA 3RNCC 3JVZX 4HXDA 2JYTA 1ZW7A 3A9JA 3CSFA 1FXIA 5HHDG 4C00A 3AEEB 2MX2A 3ZXRA 3A33B 2UWQA 2KVRA 2FE8A 3DDCB 1UUPA 2L7RA 1IBXB 4NAMA 1TS2A 3P63A 1I4QA 2K6QA 4EE2A 1D6EC 4RGMA 3ONSA 4MELA 5BMGA 2WDQB 4NJCA 2RDHA 1QZEA 2L52A 3N9YC 1E7VA 1OGWA 3MHZA 4KKIA 1FXAA 2KQ7A 3GE3C 1RM6C 1ZUD2 1V5OA 3RNBC 4XX5A 2EMTA 1MHHE 4ZOHC 2D5GA 1PGXA 2UYZB 4RGNA 4WURA 4YTPB 4PS7A 4MDKE 2D07B 1WH3A 2D2QA 1WGDA 4KIKA 4E3CA 2KTRA 4OVUA 4ZRQA 3W1SC 3GS2A 3HIZA 4IM2A 1VJKA 3NZ3A 1BUIC 3A4RA 3BYYB 1UBQA 2K22A 2WQYB 4US9A 2JT4B 4ANWA 2ZCBA 3PGEA 3BK2A 2L0FA 2K5PA 3U4EG 2AYOB 4HRSA 3VH3B 4DBGA 2UU7A 5HFYA 5H92C 2SAKA 2D3GA 4BVUC 2ZPYA 2LMCA 1ENFA 4HDQA 2AQ2B 4BFRA 1R4MI 1YD8U 1P7EA 2KDEB 4EZJA 2FCNA 2FUHB 1ZXHA 2G4DB 1SB3C 4NPNA 4NAWB 4AP4C 2K8HA 3QX1A 2DZJA 3IG3A 1P7FA 4HWIB 1ZP0B 4M00A 2R2OA 4RCOA 1H4RA 1J7AA 4AS1A 2FCSA 2JX5A 5TSSA 3V6EB 2CJOA 3T8MA 3QARA 1OQYA 2ZNVC 3IAS1 1WI0A 4OVZA 4K7UA 3U2SC 5AZGA 4MGYE 1MPEA 2BKRB 2WXFA 1V5TA 4HPPA 5FR6A 2RD0A 4RMAA 4B0EA 2GBNA 2M1MA 3TEZA 4LCDE 1QOGA 5HG2A
chains in the Genus database with same CATH topology
2PMVA 1F77A 2WXJA 3AEGB 4A9AA 2PLPA 2J42A 1JMLA 2OEDA 1KF6B 1SXTA 5H8YE 1RWSA 2JZPA 4OW0A 4GDKB 2DYOA 1OQRA 3P4QB 3ZJTA 2AX5A 2M56B 4WAFA 4YSXB 3R2TA 2R61A 5G5GA 1C4PA 1PUTA 2VZKD 1EM7A 1MVKA 1SJHD 3E56A 3SR6A 1CJEA 2V3NA 2V4IB 2RPVA 1NYRA 3EGRA 4NZLB 4IDIA 2WNMA 2ICIA 2XN9C 5EE9A 1V1OA 5BYSA 1D5XC 3FILB 2WXLA 2MH7A 3NRZA 1K50A 3ZGZA 1XCQL 1XLOA 3AE8B 1KTKA 1TZOA 1E0ZA 5G5HA 1RYJA 2QEJC 4OZAA 1L0VB 5HG2A 2HDEA 3SFDB 2PVOD 2FBWB 1M4VA 1TKEA 1NVID 4HJGE 5EE1A 3AEAB 1JW9D 2DYMA 5JXVA 1SE4A 3ZYYX 2QIEB 1L4DB 4Q2JA 1SSNA 1EU3A 5AUIA 2BS4B 1L5PA 1FM0D 1DOIA 1N63A 1T6BX 1FO4A 1FCLA 1JRPA 1F2RI 1BMLC 2K9XA 2M19A 1YQ4B 1EWYC 1J7CA 1UNSA 1XEEA 2MJ3A 2INNE 2WP9B 1NI3A 2TSSA 1WXQA 1Y56A 1TS4A 2IGGA 4FXCA 5EE3A 2RDGA 4WIPA 3MP9A 4TQ1A 3Q8EA 1GB4A 3DWGC 1N5WA 1CK1A 1ZPSA 3R8BA 1NENB 1JROA 2GI9A 2PVGC 4YWGG 4M0WA 4A55A 2OHFA 1V97A 2EKIA 2IGDA 2LJIA 1SJED 1Q10A 1V8CA 3NVWA 2Y5CA 1SIJA 2BYTA 3TEXA 4RH6A 1AWDA 4KGRA 3P4PB 3T3NA 3ZJUA 2Y3AA 5D7GA 3AE3B 1GOZA 1KH0A 1PGBA 4P6VF 1DYQA 4HKZE 3VRAB 3U52E 3W5UB 1QOGA 2E6XA 2JWUA 5MPOA 1FNUA 4YT0B 1BXTA 2X38A 3GB1A 1TYGB 2EELA 2L83A 2G9HD 3ZQ4A 4JE3B 2WU5B 2K0PA 4XWTA 1FEHA 1JWAD 3AE7B 5T8IA 1VZ6A 1ROEA 2ZW1A 3HVZA 1OFFA 2IJ0A 2LUMA 2CJNA 1DOYA 4TMAB 4LLGM 2JQRB 5BMIA 4L1BA 4GDLB 1FIQA 1YJIA 1C79A 1TKYA 2QMTA 2V0GA 5D3IB 2BB6A 2WXKA 1KLGD 4OZCA 4C80A 1F0ZA 1I4XA 2GRIA 2BW2A 2YEPF 1EWCA 2NMQA 3AEDB 4RF0A 1JQ4A 3BVGA 1K53A 1MHXA 3AE9B 3AB5A 4YTMB 2WXIA 1KLUD 4RFBA 1IGDA 1VR9A 1EU4A 3W1SA 2PKOA 1IUEA 1ZDVA 1N61A 1ET9A 3W2DA 1XXGA 3FC4A 4YSYB 1FCCC 3VR9B 3AECB 1PYWD 1QQRA 1VRAB 3R2IA 4MM3B 2N7JA 1QOAA 4P16A 3RPFC 1HQRD 1GPXA 3AN1A 3TSSA 1I4GA 1L6UA 4MACA 1I4HA 3FILA 4YSZB 1UWMA 3T3OA 2ONQA 1L0XB 3BZDB 3TUOA 2N9LA 2KACA 1XF5L 1CQVA 1STEA 1A70A 4IOIE 1UGJA 1QF6A 4A90A 2N9KA 3EUB2 4JPSA 3URYA 2LHEA 2L1AA 1KRHA 1FD6A 1DOXA 2W3SA 1SBBB 1GAQB 2N0SB 3AE6B 1ET6A 1IGCA 3AE1B 3IAM1 1XLQA 2GB1A 1WSPA 4WQMA 5FK9C 1C4AA 1JCKB 2HTME 1MI0A 3SFEB 1FMAD 1E6EB 1ZXIA 1I7HA 4KGTA 1SE2A 4N59A 4XDDA 4REZA 2AQ1B 1TS5A 4GLSC 4YTNB 1K51A 4B0MA 1N5XA 1L6VA 1YN3A 2J52A 2W3RA 2WLBA 3SEBA 1SE3A 1VZ7A 2ON8A 3I9V1 2J53A 4TSSA 2QSDA 1FNWA 5AUKA 2DLBA 5BYRA 4KGSA 4D2KA 3NVZA 1E10A 1TJEA 3V3XA 1HEZE 1UWXA 3AH7A 3V05A 2LHDA 1V1PA 2KAJA 4JWUC 4RNAA 2WXGA 3WCQA 4ARCA 1QOBA 1WRIA 3EA6A 1JWMD 3AV8A 4RF1A 4XE0A 1V1PB 4A8XC 2CU3A 1FNVA 1F2RC 1B1ZA 3H8HA 4L2YA 1YNTE 3KLSX 2JXTA 1FFUA 3MC0B 1I4RA 1TKGA 4N6EB 3ZJVA 2INPE 1XO3A 2KN4A 4KKJA 4KX6B 3VR8B 1SF0A 3PO0A 2Q5WD 4DXFA 2JYTA 1FXIA 2RMMA 5HHDG 1D5ZC 1YN4A 3LB8C 2KQ4X 2IDYA 1E9MA 3AEEB 1YMHE 2WXOA 1ACCA 2W54A 1IBXA 1WGKA 3KWVA 3NVYA 5FR3A 1AW7A 2FE8A 1C77A 1SEBD 1B9RA 1CZPA 4LTUA 1UUPA 2L32A 4TQ0A 1C4CA 1IBXB 4NAMA 3P4RB 1TS2A 3P63A 1I4QA 4EE2A 3IT6B 3IT4B 2BT6A 5BMHA 1D6EC 2G1EA 2V3PA 4RGMA 4MT5A 3BK1A 3U7ZA 3KQ4A 1I4PA 3HVDA 2B76B 3TEYA 5BMGA 2WDQB 4NJCA 2RDHA 3AE5B 4JX1C 2L52A 3B2GA 3N9YC 4MH8A 4HKQA 3Q8CA 4OZBA 3MHZA 4C56C 1VLBA 4KKIA 1FXAA 1RFKA 1RM6C 1XLPA 3L4PA 1ZUD2 4US8A 5GXGB 2BB5A 1KFYB 4LK0M 1C9FA 3BVZA 3E9SA 1T5XD 3CWIA 1MHHE 4ZOHC 1XCTL 2D5GA 2LGIA 4YXDB 4RGTA 2BTEA 1HZ5A 1WYGA 5C2TB 2KWDA 2KDMA 2NTSA 1FFVA 3OWEB 1NEKB 1TS3A 3TEWA 1PGXA 3BVMA 3W5VB 2JU6X 1AYFA 3CIRB 2WXQA 3Q8BA 1R7SA 5EE0A 3ETRA 1JALA 3P42A 2BBCA 1ESFA 1QILA 4RGNA 2JYEA 4WURA 4N58A 4YTPB 2WS3B 2JSVX 3J9CA 2SEBD 2Y5PA 1QLBB 2DBYA 4RGOS 4ZRQA 1ZOYB 3BIID 2MJDA 3GS2A 2H88B 2IGHA 1E7PB 3B2FA 4UDUC 5I4DA 3KWLA 1VJKA 3NZ3A 1BUIC 2WXHA 4ARIA 3AMZA 2K3UA 3P1MA 3MFGA 5D3DA 1YN5A 3O13A 2FUG1 3BYYB 1AN8A 3Q8FA 4IKGA 2K22A 2QILA 4O1NA 1VDVA 1GB1A 2MEKA 4OHJA 2M0AA 2WQYB 4US9A 4XDCA 3NS1A 5BYQA 1TY2A 1HZ6A 3I57A 2WXRA 2WXPA 4J3OD 2BS2B 3HUIA 2I2YA 1LO5D 3BK2A 2ZW0A 4WH4A 4JWSC 2K5PA 3U4EG 4ZYSA 4A6QA 3IXSA 1HXYD 2VZKB 4HRSA 5FKAC 2PIAA 1PDXA 2WDVB 5C3JB 3FAHA 1C78A 4C7YA 5HFYA 1QT9A 4HROA 1FRRA 3PZ7A 2SAKA 1J7BA 5H92C 1JWBD 1QKZA 2LMCA 3LXFA 1ENFA 4PT5A 1K52A 1QOFA 3AEFB 1T3QA 2J4XA 2KMMA 3NUHB 2AQ2B 4USAA 1FRDA 3Q69A 4ITKA 3LYYA 2IPKD 3RFZB 2LFIA 2YEPB 3B9JA 3BYTB 2W55A 4XWWA 2AQ3B 1P7EA 2NTTA 1WWTA 4C7ZA 2W82A 1ZXHA 1PFDA 1SB3C 1PGAA 4NAWB 4WWMA 2BS3B 2WDRB 1VZ8A 1P7FA 1ZDXA 1N60A 2LEKA 1L0YB 1NYQA 2E3TA 1ZP0B 3P4SB 4DQOC 2QJLA 2XNAC 2DWQA 4RCOA 3GP7A 3DWMA 1J7AA 4AS1A 5E6JA 2WXMA 4L23A 1TY0A 1N62A 2JX5A 5TSSA 2CJOA 3UI3A 3NVVA 1JWSD 2WU2B 3IAS1 2H89B 2WXNA 4OVZA 4R3DA 1L4ZB 3AE2B 4DXGA 3W9CB 3U2SC 3AE4B 3PZ8A 1MPEA 1YJJA 3AM9A 2WXFA 2Z8LA 1DGJA 1HA5A 4AQ7A 4ZHPA 4B0EA 3HRDD 2I38A 1D5MC 1XLNA 4ZHOA 1D4BA 1C76A 4CQNA 3Q8AA 3BWUD 5LNK1 3VRBB 5HI1A 4ZRPA 1ZE3D 1YQ3B 3TEZA 3ABVB 3VQIA 1JWUD 3MJ5A 2PTLA 3AEBB 3C8YA 4H2AA 2PW9A 2ACZB 4HEA1 1OQQA 2MJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AMZ A;  2WU5 B;  3P1M A;  3KWL A;  3AEG B;  3WCQ A;  4A9A A;  1JWA D;  3AE7 B;  1QOB A;  2K22 A;  1WRI A;  1KF6 B;  1ROE A;  5H8Y E;  1RWS A;  1VDV A;  1OFF A;  3AV8 A;  3HVZ A;  2CJN A;  2CU3 A;  1DOY A;  2WQY B;  4US9 A;  1OQR A;  3NS1 A;  3P4Q B;  2JQR B;  4JWU C;  1FFU A;  1FIQ A;  1TKG A;  1YJI A;  4N6E B;  1TKY A;  2AX5 A;  2BS2 B;  2M56 B;  3HUI A;  4YSX B;  1XO3 A;  4KX6 B;  3VR8 B;  1SF0 A;  5G5G A;  4JWS C;  1PUT A;  3PO0 A;  2Q5W D;  2K5P A;  4C80 A;  1F0Z A;  1FXI A;  4HRS A;  2PIA A;  1PDX A;  3LB8 C;  3SR6 A;  2WDV B;  5C3J B;  3FAH A;  1CJE A;  3AED B;  4C7Y A;  1NYR A;  1E9M A;  3AEE B;  4IDI A;  1JQ4 A;  1QT9 A;  4HRO A;  1FRR A;  3AE9 B;  5H92 C;  1J7B A;  3AB5 A;  4YTM B;  1JWB D;  5EE9 A;  2W54 A;  2MH7 A;  1WGK A;  3NRZ A;  2PKO A;  1IUE A;  3LXF A;  3NVY A;  3AEF B;  1QOF A;  1N61 A;  1XLO A;  3AE8 B;  1B9R A;  1T3Q A;  2KMM A;  1CZP A;  4LTU A;  1FRD A;  4USA A;  3FC4 A;  4ITK A;  4YSY B;  3VR9 B;  1E0Z A;  3AEC B;  5G5H A;  3B9J A;  1VJK A;  1RYJ A;  1QOA A;  3P4R B;  3P63 A;  3RPF C;  1L0V B;  2W55 A;  1GPX A;  3AN1 A;  2BT6 A;  1WWT A;  3SFD B;  1L6U A;  2G1E A;  4C7Z A;  2PVO D;  1PFD A;  1SB3 C;  2FBW B;  1TKE A;  4YSZ B;  1UWM A;  4WWM A;  1NVI D;  5EE1 A;  2B76 B;  2BS3 B;  3AEA B;  1JW9 D;  2WDR B;  2WDQ B;  3AE5 B;  2QIE B;  3ZYY X;  1N60 A;  2LEK A;  4JX1 C;  5AUI A;  1L5P A;  2BS4 B;  1A70 A;  1FM0 D;  1DOI A;  1N63 A;  1NYQ A;  2L52 A;  2E3T A;  3B2G A;  1FO4 A;  1QF6 A;  2ACZ B;  1ZP0 B;  3P4S B;  1JRP A;  1VLB A;  1FXA A;  3EUB 2;  1RFK A;  1RM6 C;  1XLP A;  3L4P A;  1ZUD 2;  1KRH A;  2K9X A;  2QJL A;  4US8 A;  5GXG B;  1DOX A;  1KFY B;  2DWQ A;  2M19 A;  1YQ4 B;  1EWY C;  2W3S A;  1J7C A;  2MJ3 A;  1GAQ B;  2N0S B;  3AE6 B;  1J7A A;  2WP9 B;  3CWI A;  3AE1 B;  3DWM A;  1XLQ A;  4WQM A;  1NI3 A;  4ZOH C;  1WXQ A;  1N62 A;  2JX5 A;  4YXD B;  2CJO A;  4FXC A;  5EE3 A;  2HTM E;  3NVV A;  1FMA D;  3SFE B;  1E6E B;  1ZXI A;  1WYG A;  5C2T B;  1I7H A;  1FFV A;  4N59 A;  2WU2 B;  3DWG C;  1NEK B;  1N5W A;  2L83 A;  1NEN B;  2H89 B;  1JRO A;  3AE2 B;  3W9C B;  4YTN B;  2PVG C;  3AE4 B;  3W5V B;  1AYF A;  1L6V A;  1N5X A;  2OHF A;  1V97 A;  1YJJ A;  2EKI A;  3CIR B;  1V8C A;  3AM9 A;  1R7S A;  2W3R A;  3NVW A;  1DGJ A;  2Y5C A;  2WLB A;  1SIJ A;  1JAL A;  3ETR A;  5EE0 A;  4ZHP A;  1AWD A;  3HRD D;  3P4P B;  4YTP B;  4N58 A;  1XLN A;  4ZHO A;  2WS3 B;  5AUK A;  3VRB B;  3NVZ A;  3AE3 B;  1E10 A;  4P6V F;  1YQ3 B;  3ABV B;  1QLB B;  3VRA B;  2DBY A;  1TJE A;  3W5U B;  1ZOY B;  3BII D;  5MPO A;  2MJD A;  3AH7 A;  2H88 B;  3AEB B;  4YT0 B;  1E7P B;  3B2F A;  1TYG B;  2KAJ A;  1QOG A;  1OQQ A;  2MJE A; 
#chains in the Genus database with same CATH topology
 3M3J A;  4K3B A;  1KF6 B;  1SXT A;  2WGS A;  4CO7 A;  2DAJ A;  2JZZ A;  3QAQ A;  1OQR A;  2CKH B;  4JQW C;  2AX5 A;  1T0R C;  2R61 A;  3ECI A;  2KDF B;  4PS3 A;  1YX5 B;  4P1B C;  2VZK D;  2BF8 B;  4JGH B;  2LVQ A;  2LWP A;  5JH5 C;  2V4I B;  1NYR A;  3EGR A;  3JSV B;  2L00 B;  2WNM A;  2ICI A;  1E8W A;  2XN9 C;  5EE9 A;  5BYS A;  1D5X C;  3FIL B;  3ZVV A;  3AE8 B;  2MBQ A;  1TZO A;  2LRU A;  1E0Z A;  4IM0 A;  3Q14 C;  1RYJ A;  1N6Z A;  2FBW B;  1SE4 A;  1L4D B;  3U7D A;  5AUI A;  1MG8 A;  1N63 A;  3NZU A;  1FO4 A;  2X8X X;  3ZO5 B;  4DHZ E;  3ML8 A;  3RZF A;  2M19 A;  1NI2 A;  1UNS A;  2INN E;  2WP9 B;  1A5R A;  2KFK B;  1TS4 A;  2IGG A;  4NAW A;  4FXC A;  2XK5 A;  1Q0W B;  1LGR A;  3HHM A;  4WIP A;  3DWG C;  1CK1 A;  2K39 A;  1NEN B;  1UZX B;  2PVG C;  4M0W A;  2JZ3 B;  1OEY A;  4G0N B;  2OHF A;  4IWO A;  3WAM A;  1SIF A;  3APC A;  1XD3 B;  1WYW B;  3N1X C;  4RH6 A;  4KGR A;  1L7Y A;  1SGH A;  3T3N A;  4FN2 A;  4K3C A;  2W9N A;  5D7G A;  2DZI A;  4AUQ C;  1HTO A;  4K81 A;  4YT0 B;  3P2B A;  1TYG B;  2EEL A;  2HE7 A;  2G9H D;  3SHQ A;  5T8I A;  1VZ6 A;  3VFK A;  2ZW1 A;  3HVZ A;  2ASQ A;  3VAW A;  4ACF A;  2JQR B;  4GDL B;  2YLM A;  2B3A A;  2QDF A;  4OZC A;  4C80 A;  2CU1 A;  3BVG A;  3L16 A;  3AE9 B;  4YTM B;  1KLU D;  1M94 A;  1XQQ A;  3HK0 A;  4KDI C;  1YQB A;  4NY0 A;  4MM3 B;  5D2M B;  4P16 A;  4P1C C;  3JSV A;  1WR6 E;  3FIL A;  1UWM A;  2NPT B;  2KLC A;  2N4F A;  2RSU A;  1GUA B;  3TUO A;  3ENE A;  1IYF A;  2N9K A;  2L1A A;  1SBB B;  3AE6 B;  3RNG C;  1ET6 A;  3PT2 B;  3CMM B;  4KSK C;  1KOT A;  3OLM D;  3WAL A;  1FMA D;  1I7H A;  4KGT A;  1BT0 A;  1SE2 A;  2AQ1 B;  4E74 A;  1TS5 A;  3VHT C;  1L6V A;  2KC1 A;  3DBL I;  4IG7 B;  2WLB A;  1P1A A;  3VUY A;  2JXX A;  3DBR B;  3ZNH B;  3I9V 1;  2J53 A;  3RCZ A;  1FNW A;  4EZK A;  5AUK A;  4KGS A;  1E10 A;  4FAD A;  1RAX A;  1E8X A;  1VCB A;  1TJE A;  1HEZ E;  1UWX A;  2MBO A;  2LHD A;  4G50 A;  3AUL A;  1WRI A;  2RPQ A;  2GBR A;  2HJ1 A;  1F2R C;  3H8H A;  3WAO A;  2BGF A;  2ZZP B;  2KN4 A;  2PJH A;  4DHJ D;  3PO0 A;  2Q5W D;  2BVC A;  1D5Z C;  1YN4 A;  3LB8 C;  1T0Q C;  4N9F 4;  4OVV A;  2IDY A;  3PPA A;  3EEC A;  4GDL A;  3KUC B;  3KWV A;  5FR3 A;  2REX A;  2RGF A;  1SEB D;  2J0M A;  3LJ3 A;  1MJD A;  2N1W A;  1YX6 B;  3UIP B;  4TQ0 A;  1C4C A;  1KLV A;  3P4R B;  3DVN U;  3PTF C;  2MBE A;  2LVO A;  2BT6 A;  2G1E A;  3U7Z A;  1I4P A;  2FID A;  3TEY A;  3ZNG C;  4LNN A;  3AE5 B;  4K7S A;  4AJW A;  4JX1 C;  3CST A;  4WJP A;  3SD5 A;  3MHS D;  3IFW B;  4MM3 A;  1VLB A;  1XLP A;  1LFD A;  2LRW A;  5GXG B;  2V4L A;  4WWO A;  3BVZ A;  2L8J A;  2LGI A;  2NPT A;  4RGT A;  4YXD B;  2BTE A;  1TS3 A;  3OAW A;  2DZM A;  1LQB A;  1J19 A;  2JU6 X;  2K25 A;  3CIR B;  4BKS D;  4GMV A;  2AL3 A;  3U8Z A;  5EE0 A;  3ETR A;  2I1J A;  4NJ7 A;  2KAN A;  5DPR A;  3L17 A;  3ZTD A;  2JSV X;  2CR5 A;  4RM9 A;  4RGO S;  4W9F A;  2MJD A;  2H88 B;  3ZTC A;  3B2F A;  4UDU C;  1OEY J;  3KWL A;  3AMZ A;  3P1M A;  3O13 A;  2KTR B;  2FUG 1;  2JY6 A;  4IKG A;  4O1N A;  1GB1 A;  3QWZ B;  3B0A A;  2M0A A;  3ZRC A;  5BYQ A;  4FA6 A;  3AU4 A;  1TY2 A;  5D6J B;  1HZ6 A;  2WXR A;  2WXP A;  4IWP A;  4G11 A;  4HJK A;  4DDG D;  3RMK C;  2Z0D B;  1XT9 B;  3IXS A;  1HXY D;  3VXW A;  1PDX A;  3PHW B;  4HDO A;  4TKN A;  1J7B A;  1MFW A;  2D3A A;  1QKZ A;  3OG5 A;  3LXF A;  4DK5 A;  1QOF A;  2KMM A;  4USA A;  3LYY A;  2IPK D;  2YEP B;  3B9J A;  3RYT A;  3BYT B;  4XWW A;  1WWT A;  4C7Z A;  2W82 A;  2BQQ A;  3VUW A;  5EDS A;  4WWM A;  1P9D U;  2WDR B;  1VZ8 A;  2IO2 B;  1ZDX A;  1N60 A;  2LEK A;  2NS5 A;  2GBJ A;  1NYQ A;  3ZDM C;  3P4S B;  4DQO C;  3ZUN A;  2XEW A;  4ANV A;  2XNA C;  3M62 B;  5AZH A;  3V62 A;  3M63 B;  4L23 A;  1N62 A;  3UI3 A;  1JWS D;  3PZD A;  3QA8 A;  3W1Y A;  2WU2 B;  5AEK B;  1G6J A;  2JWZ A;  2H89 B;  2WXN A;  4R3D A;  3AE2 B;  2M4N A;  3AE4 B;  4KVG B;  4AQ7 A;  2IZV B;  3AU5 A;  3TJP A;  3HRD D;  4B9K A;  2N9X A;  5LNK 1;  2EMS A;  3HM3 A;  4DHJ B;  1F52 A;  1ZE3 D;  1YQ3 B;  1L2N A;  5E6O A;  2PTL A;  3EHV A;  2ACZ B;  4OHJ A;  1OQQ A;  5DPT A;  1SE9 A;  2WXJ A;  4MSM B;  2OED A;  2MBB B;  2DYO A;  3N32 A;  1Q1O A;  1AAR A;  3ZJT A;  1LM8 B;  3MTN B;  2M56 B;  4YL8 A;  2AEH A;  4YSX B;  4NJ6 A;  4W9L A;  2IND C;  1C4P A;  2KJH B;  4HLE A;  4PYZ A;  1UH6 A;  3WIM A;  1EM7 A;  1MVK A;  1WGR A;  2CS4 A;  2MSE D;  2V3N A;  2KMC A;  2RPV A;  3WAN A;  2LGS A;  2RR9 A;  2EKE C;  4ZRI A;  2WXL A;  2A5U A;  3L13 A;  2LGD A;  1XCQ L;  1KTK A;  3Q2A C;  1L0V B;  5CHF A;  3TIX A;  1C3T A;  2BWF A;  1TKE A;  2NBW B;  3RZW C;  1JW9 D;  4GGQ A;  2KOX A;  1L5P A;  1T6B X;  1DOI A;  1FCL A;  3FKY A;  2WX0 A;  1EWY C;  1WXQ A;  3MP9 A;  3DBH B;  3KUZ A;  3ML9 A;  3PRZ A;  2XK5 B;  3KW5 B;  1V97 A;  1V81 A;  2IGD A;  4XC2 A;  1V8C A;  3NVW A;  1SIJ A;  3TEX A;  1AWD A;  4M0W B;  2DEN B;  2Y3A A;  3AE3 B;  4FJZ A;  4P6V F;  2ZNV B;  3VRA B;  3W5U B;  4NNJ B;  2E6X A;  1WF9 A;  1FNU A;  2G3Q B;  3A4S C;  3ZDT A;  3ZW3 A;  5IA7 A;  2ZPN A;  1FEH A;  3DHG C;  3PLU A;  2NVU I;  2LUM A;  1DOY A;  2L3Z A;  1YJI A;  3L10 B;  3N3K B;  5D3I B;  1FXT B;  1WZ3 A;  3GZN I;  1F0Z A;  2IY0 B;  2GRI A;  3X0W A;  2L05 A;  1OTR B;  3PS6 A;  3Q3O C;  3AB5 A;  2GMI C;  2WXI A;  3MC8 A;  1X1M A;  1WIA A;  4ASW C;  3W1S A;  5JHA A;  2PKO A;  1IUE A;  1WXA A;  2KZR A;  4X57 B;  2FAZ A;  3VR9 B;  4YSY B;  1FCC C;  4BKG A;  3R2I A;  1WX8 A;  3NS8 A;  3NZS A;  1GC7 A;  1HQR D;  1GPX A;  3TSS A;  5LXI B;  1WJ6 A;  4MAC A;  5TR5 A;  3ZKJ C;  3T3O A;  1L0X B;  4IWQ A;  3UGB B;  3R7R A;  4FHJ A;  1V2Y A;  4JL9 A;  1FD6 A;  1DOX A;  2W3S A;  4BOZ B;  1GAQ B;  3MJW A;  2GB1 A;  1WSP A;  1C4A A;  3RNE C;  1WGG A;  2J0J A;  2K8B A;  4BKS A;  3KUD B;  5JHB A;  2V1Y A;  4REZ A;  4ZRJ A;  3DBL B;  4B0M A;  1E7U A;  2O6V D;  2C7H A;  2W3R A;  4DWF A;  3SEB A;  4RM8 A;  2KWV B;  2IO0 B;  1J0G A;  2JRH A;  2KWC A;  2BWE S;  3V3X A;  3AH7 A;  4LNK A;  1V1P A;  2KAJ A;  2N7D A;  4JWU C;  3WCQ A;  3DBH I;  4ARC A;  2R2Q A;  4WWP A;  2AL6 A;  4ZYN A;  1JWM D;  2CHZ A;  4XYC A;  4XE0 A;  4A8X C;  2CU3 A;  1T0S C;  1YNT E;  3KLS X;  2D10 A;  1FPY A;  2KQS A;  2DHZ A;  4PYU A;  1EO6 A;  4EZL A;  3ZJV A;  2INP E;  1XO3 A;  1E8Z A;  4B95 A;  2OJR A;  3VR8 B;  4C4V A;  1E90 A;  1WM2 A;  2D3B A;  4DXF A;  3DVG Y;  3KH0 A;  1ZKH A;  2C7N B;  1YMH E;  2WXO A;  1ACC A;  2IBI B;  2W54 A;  4GOC A;  2ZVN A;  1B9R A;  1CZP A;  4GIV A;  4LTU A;  2FNJ B;  2L32 A;  1P98 A;  4WJN A;  3IT4 B;  5BMH A;  2M17 A;  3NY5 A;  1CMX B;  4MT5 A;  3BK1 A;  3Q3M C;  3KQ4 A;  4BAX A;  5G55 A;  4FJV B;  3KVF B;  4HCP B;  2MCN B;  4MH8 A;  1WJN A;  1V9J A;  4MJS B;  3ALB A;  4US8 A;  3S2A A;  3E9S A;  3CWI A;  4P7I A;  4WJO A;  1TZ1 A;  1XCT L;  5IP4 D;  1HZ5 A;  5C2T B;  2KWD A;  2KDM A;  2NTS A;  1WFY A;  2D3C A;  3I5J C;  4IC7 B;  4ICU A;  3W5V B;  1AYF A;  1WX7 A;  2KD0 A;  3Q8B A;  4S17 A;  2HD5 B;  4K7W A;  1ESF A;  1QIL A;  4N58 A;  2BYE A;  2WS3 B;  2IYD B;  3J9C A;  2SEB D;  3QC8 B;  2Y5P A;  1RRB A;  1QLB B;  2KHW B;  1GNU A;  3ZXV A;  3BII D;  1JRU A;  2V9H A;  1E7P B;  2WXH A;  5D3D A;  2K3U A;  2NCN A;  1YN5 A;  3A9K A;  3OJ4 B;  2KX0 A;  1AN8 A;  3Q3N C;  2GBM A;  4PK1 A;  1WRD B;  4ICV A;  1GJZ A;  2QCZ A;  3I57 A;  2GLS A;  4J3O D;  2BS2 B;  3HUI A;  2INC C;  3PRE A;  1LXD A;  4KV2 A;  2VZK B;  2PIA A;  3FAH A;  1C78 A;  2HJ8 A;  3PZ7 A;  2MLB A;  1JWB D;  3NHE B;  5D94 A;  4F8C B;  4W9K A;  4PT5 A;  2MBH A;  3AEF B;  1T3Q A;  2J4X A;  3NUH B;  3VH4 B;  1Z2M A;  2LFI A;  4BBN F;  3V6C B;  4II2 B;  2AQ3 B;  1WR1 A;  1UF0 A;  1PGA A;  3UF8 A;  2O6V B;  4ZDV A;  4WAA A;  1L0Y B;  2E3T A;  1WZ0 A;  3NJT A;  2KLG A;  2QJL A;  2WHI A;  2DWQ A;  2FCM A;  5E6J A;  2WXM A;  5G2N A;  3APD A;  4IW0 A;  2LGX A;  4HCN B;  4DXG A;  4MJS A;  3PZ8 A;  3AM9 A;  1DGJ A;  1HA5 A;  2C5L C;  4ZHP A;  1D5M C;  1XLN A;  4EEW A;  1C76 A;  4CQN A;  3ZLZ A;  3VRB B;  2Z0E B;  5HI1 A;  4ZRP A;  2N9E B;  2RDB C;  3MJ5 A;  2BKF A;  3AEB B;  4NQL B;  3C8Y A;  4GDK A;  4HEA 1;  4MH0 E;  1WJ4 A;  2LJ5 A;  3RD2 A;  4AWJ A;  2VH1 A;  2IY1 B;  2Y5B B;  4OW0 A;  1F9J A;  4HPM B;  1I42 A;  1PQS A;  1HTQ A;  2C7M B;  3M95 A;  3QQ8 B;  3R2T A;  5G5G A;  3U30 A;  3N30 A;  1SJH D;  1RFA A;  4II3 B;  4MSQ B;  2JF5 A;  4NZL B;  4IDI A;  4EKU A;  5IO9 A;  1V1O A;  2MWS B;  4S0R A;  1I35 A;  2MH7 A;  3NRZ A;  1K50 A;  3ZGZ A;  3BIN A;  2KO3 A;  2LXA A;  2HTH A;  5G5H A;  2KDI A;  4OZA A;  2LGY A;  4KZC A;  3OJ3 A;  4FJY A;  2PVO D;  5DCN A;  4HJG E;  2DYM A;  1EF5 A;  4I6L B;  5CTR C;  2QIE B;  5LLI A;  1SSN A;  1EU3 A;  2BS4 B;  2LI5 A;  3C19 A;  2KT7 A;  1JRP A;  1F2R I;  1BML C;  1YQ4 B;  1XEE A;  1TIF A;  4NQK E;  5EE3 A;  3H7P A;  1T0Y A;  3KYD D;  3VDZ A;  1TTN A;  3V60 A;  2MP2 A;  2O6V A;  1WE6 A;  3R8B A;  1TBE A;  3VUX A;  4LNF A;  4A55 A;  2AWT A;  4F7Z A;  2EKI A;  2LJI A;  4KSL C;  4KDL B;  1VD2 A;  1Q10 A;  4HVB A;  1NBF C;  2Y5C A;  1GC6 A;  2BYT A;  2JUO A;  4FHK A;  3KYC D;  1ZGU B;  5HKH A;  3P4P B;  3ZJU A;  4PS8 A;  2WDT B;  4EFO A;  2LAS A;  3U52 E;  2CHW A;  4LNO A;  2KMA A;  3K9P B;  2JWU A;  3N1Z C;  1BXT A;  2L83 A;  3ZQ4 A;  2YVC A;  2QHO A;  2K0P A;  3EFU A;  2ZJD A;  3ZIM A;  5IOI A;  1JWA D;  1WM3 A;  4LNI A;  1EF1 A;  3QIJ A;  3VTW A;  4TMA B;  4LLG M;  1R4N I;  4I6N B;  2QC8 A;  1C79 A;  3GZN B;  3R3M A;  4M8M A;  1I4X A;  1V49 A;  2BW2 A;  2YEP F;  5DPS A;  2NMQ A;  3AED B;  2D11 A;  4RF0 A;  1MHX A;  3ZRF A;  4RFB A;  3PHX B;  2IO1 B;  1VR9 A;  1EU4 A;  4ZRK A;  1ZDV A;  1N61 A;  3I63 C;  1ET9 A;  2NR2 A;  2KNB A;  1WXM A;  1PYW D;  3AEC B;  2K6D B;  4J6I A;  2N7J A;  3DBS A;  3RPF C;  1P0R A;  3AN1 A;  1I4G A;  1I4H A;  1C1Y B;  1H8C A;  2KWU B;  2ONQ A;  2N9L A;  2MRP A;  1XF5 L;  3TL5 A;  1CQV A;  1STE A;  4IOI E;  2OOB B;  1F1H A;  1YOV B;  5BO4 B;  4JPS A;  2KXJ A;  2LHE A;  4GSW A;  1KRH A;  2N0S B;  4WQM A;  3I3T B;  3IAM 1;  1XLQ A;  1JCK B;  2HTM E;  2LD9 A;  1RLF A;  1ZXI A;  4N59 A;  3IVF A;  4GXB A;  3D32 A;  4MEM A;  3O65 B;  2Z59 B;  1K51 A;  2BYF A;  1N5X A;  1V86 A;  3VVW B;  4BZA A;  3LDZ E;  3WA0 A;  3R66 C;  1VZ7 A;  2ON8 A;  3TCA A;  5IAA C;  4TSS A;  2QSD A;  1WXV A;  3UIN B;  2DLB A;  3QK0 A;  4D2K A;  3NVZ A;  5CX3 A;  3QCA A;  2LXC A;  4TUU A;  2KX3 A;  1KM7 A;  3UQB A;  1QOB A;  3JYU A;  3AV8 A;  4HPL B;  1V1P B;  1B1Z A;  3GOE A;  4L2Y A;  4CYE A;  2L0T A;  1WGH A;  3MC0 B;  4N6E B;  1TKG A;  4GN1 A;  3RNF C;  5KHQ A;  2KN5 A;  3ZNI D;  3RUI B;  2RMM A;  2KQ4 X;  2K1F A;  1GG3 A;  4C4V B;  1E9M A;  2KTF A;  2N7E A;  1Q5W B;  1IBX A;  1WGK A;  3NVY A;  1AW7 A;  2LUE A;  4FBJ B;  3MC9 A;  1C77 A;  4GU2 A;  4AJY B;  2J0K A;  1V6E A;  1UGM A;  3IT6 B;  2V3P A;  3HVD A;  2B76 B;  2V3S A;  2NBV B;  3Q3F A;  3B2G A;  4HKQ A;  3NG0 A;  3Q8C A;  4OZB A;  5GMV A;  4FUL A;  3ZNZ B;  4C56 C;  1RFK A;  3L4P A;  2XBB C;  2BB5 A;  1KFY B;  2ZVO A;  3L08 A;  4LK0 M;  1C9F A;  1T5X D;  2K8C A;  4ANX A;  1WJU A;  2IO3 B;  1WYG A;  4DHZ B;  5L83 A;  1FFV A;  3OWE B;  1NEK B;  3UIO B;  3TEW A;  3BVM A;  3PV1 A;  2WXQ A;  4LJP B;  5J18 A;  1R7S A;  1JAL A;  3P42 A;  2BBC A;  2DX5 B;  2JYE A;  4AOF A;  4K1R B;  2I1K A;  4WJQ A;  4FLH A;  1HE8 A;  2DBY A;  1ZOY B;  2IGH A;  4JIO U;  5I4D A;  4W9D A;  4ARI A;  3DHH C;  3MFG A;  1MG4 A;  3DQV A;  2DAF A;  3Q8F A;  4W9G A;  2FCQ A;  4W9H A;  4XGA B;  2QIL A;  1VDV A;  2WX1 A;  2MEK A;  4XDC A;  3NS1 A;  4M02 A;  2JVC A;  3A9K B;  2I2Y A;  1LO5 D;  2ZW0 A;  4WH4 A;  4JWS C;  4W9E A;  4A20 A;  4ZYS A;  2PE9 A;  4A6Q A;  1E5W A;  5FKA C;  2WDV B;  5C3J B;  3QJZ A;  3GE8 C;  4C7Y A;  3PSE B;  1QT9 A;  4HRO A;  1FRR A;  1EUV B;  3X23 A;  1TT5 B;  1K52 A;  1FRD A;  3Q69 A;  4HK2 A;  4ITK A;  4MGZ E;  4KZ0 A;  3RFZ B;  2WWZ A;  2W55 A;  1P3Q U;  2NTT A;  3PRM B;  1PFD A;  2VRR B;  5E6P A;  4IUM B;  1UEL A;  2BS3 B;  2VH2 A;  2PE6 B;  2BPS A;  3Q6B A;  4WQO B;  3VTV A;  1V80 A;  2FIF A;  4DDI D;  4I6P A;  3GP7 A;  3K9O B;  5DPW A;  1Y8R C;  3DWM A;  3EC8 A;  5KHO A;  1TY0 A;  3APF A;  3NVV A;  3DCG A;  4W9C A;  1L4Z B;  4BOS C;  3W9C B;  3TMP B;  5LXH A;  1YJJ A;  3T9L A;  3JW0 X;  2Z8L A;  2MW5 A;  2I38 A;  3N20 C;  4ZHO A;  1D4B A;  1K8R B;  3Q8A A;  3BWU D;  4B6W A;  1E8Y A;  3ABV B;  3VQI A;  1JWU D;  3TBL D;  4H2A A;  2PW9 A;  5C23 A;  2MJE A;  2PMV A;  1F77 A;  3AEG B;  4LDT D;  4A9A A;  2LZ6 A;  2PLP A;  2J42 A;  5IKC M;  1JML A;  5H8Y E;  1RWS A;  2JZP A;  4GDK B;  3P4Q B;  4MGI E;  1YJ1 A;  4WAF A;  2ZEQ A;  3V61 A;  4QAY A;  1PUT A;  5AZF A;  3E56 A;  1D3Z A;  3SR6 A;  3A1Q B;  1CJE A;  3DVG X;  4F1S A;  1J8C A;  5JZE B;  2LVP A;  4EUT A;  2BYV E;  3VTU A;  1XLO A;  3SU8 X;  4BBN C;  2WYQ A;  4BKT A;  5J17 A;  2QEJ C;  2HDE A;  3HM6 X;  3SFD B;  1M4V A;  1NVI D;  5EE1 A;  4JLC A;  3AEA B;  5CHV C;  4A3P A;  4MGK E;  5JXV A;  3ZYY X;  4Q2J A;  1FM0 D;  3PRP B;  2KFK A;  4CHK A;  3RT3 B;  2K9X A;  5J2R A;  1UD7 A;  1J7C A;  2MJ3 A;  3DPD A;  4URK A;  4M01 A;  3RN9 C;  5CHW A;  1NI3 A;  2TSS A;  1Y56 A;  2N9P C;  2RDG A;  2KJR A;  5E6N A;  4TQ1 A;  3Q8E A;  1GB4 A;  1N5W A;  1ZPS A;  2KJ6 A;  1WE7 A;  1JRO A;  3DOW A;  1WMH B;  4GB9 A;  1S3S G;  2GI9 A;  1U4A A;  4YWG G;  3H7P B;  1SJE D;  2MP2 B;  3N1Y C;  3B1L X;  4WWN A;  1S1Q B;  1KJT A;  3DHI C;  2NBU A;  4A3O A;  3H6N A;  4DXA B;  3L0W B;  1GOZ A;  1KH0 A;  1PGB A;  1DYQ A;  3RNA C;  4HKZ E;  5MPO A;  2KKC A;  2X38 A;  3GB1 A;  2O2V B;  4EOY A;  4JE3 B;  2WU5 B;  4XWT A;  3B08 A;  3A9J B;  3AE7 B;  3H9D A;  1ROE A;  2MHJ A;  3NOB A;  5IN7 A;  1OFF A;  2IJ0 A;  1R4N B;  3IBE A;  2CJN A;  3C0R B;  2KC2 A;  5BMI A;  3SDL C;  4L1B A;  2MQJ A;  1FIQ A;  1NDD A;  1TKY A;  2QMT A;  3H1U A;  2V0G A;  1UBI A;  2J7Q B;  2BB6 A;  2WXK A;  1IPG A;  1KLG D;  3AI5 A;  5L95 C;  5C1Z A;  3CF6 E;  1EWC A;  1JQ4 A;  1K53 A;  1IGD A;  4LJO B;  2OJW A;  3W2D A;  1XXG A;  3Q3J A;  2KDB A;  3FC4 A;  1QQR A;  1VRA B;  2GBK A;  3A1Q A;  1QOA A;  2L76 A;  1L6U A;  3R7Q A;  2KK8 A;  4YSZ B;  3BZD B;  2KAC A;  1A70 A;  1UGJ A;  3AXC A;  1QF6 A;  2C60 A;  4M8N A;  4A90 A;  3PVL A;  3EUB 2;  3URY A;  1IGC A;  3AE1 B;  2M8S A;  2A4Z A;  5FK9 C;  1WXS A;  2MA9 B;  4G3X B;  4XZ4 A;  3QHT A;  1MI0 A;  1IP9 A;  2KYW A;  3SFE B;  2ZCC A;  1E6E B;  4XDD A;  4ANU A;  4GLS C;  4KIK B;  4W9I A;  2C9W B;  4YTN B;  2JPH A;  2G45 B;  1YN3 A;  2J52 A;  2KVZ A;  4LDT B;  1TGZ B;  2PEA A;  2KFJ A;  2DYB A;  1SE3 A;  3EFC A;  3WAP A;  1WX9 A;  3DBR I;  2M0X A;  4IM3 A;  1WGY A;  5BYR A;  3UQA A;  2PPH A;  1YIW A;  3RUL A;  1Z5S B;  1WMH A;  3DVN V;  3L54 A;  3IHP C;  3V05 A;  4RNA A;  4E71 A;  2WXG A;  2DZK A;  3BY4 B;  3H7S A;  3RI7 C;  3EA6 A;  3PLV A;  2CHX A;  4RF1 A;  2GOW A;  1FNV A;  2G4S A;  4W9J A;  2JXT A;  1FFU A;  2JRI B;  2N1V A;  1I4R A;  1R4M B;  2DNF A;  1WY8 A;  4KKJ A;  2O2V A;  4KX6 B;  4TV3 A;  1SF0 A;  1ISN A;  3RNC C;  3JVZ X;  4HXD A;  2JYT A;  1ZW7 A;  3A9J A;  3CSF A;  1FXI A;  5HHD G;  4C00 A;  3AEE B;  2MX2 A;  3ZXR A;  3A33 B;  2UWQ A;  2KVR A;  2FE8 A;  3DDC B;  1UUP A;  2L7R A;  1IBX B;  4NAM A;  1TS2 A;  3P63 A;  1I4Q A;  2K6Q A;  4EE2 A;  1D6E C;  4RGM A;  3ONS A;  4MEL A;  5BMG A;  2WDQ B;  4NJC A;  2RDH A;  1QZE A;  2L52 A;  3N9Y C;  1E7V A;  1OGW A;  3MHZ A;  4KKI A;  1FXA A;  2KQ7 A;  3GE3 C;  1RM6 C;  1ZUD 2;  1V5O A;  3RNB C;  4XX5 A;  2EMT A;  1MHH E;  4ZOH C;  2D5G A;  1PGX A;  2UYZ B;  4RGN A;  4WUR A;  4YTP B;  4PS7 A;  4MDK E;  2D07 B;  1WH3 A;  2D2Q A;  1WGD A;  4KIK A;  4E3C A;  2KTR A;  4OVU A;  4ZRQ A;  3W1S C;  3GS2 A;  3HIZ A;  4IM2 A;  1VJK A;  3NZ3 A;  1BUI C;  3A4R A;  3BYY B;  1UBQ A;  2K22 A;  2WQY B;  4US9 A;  2JT4 B;  4ANW A;  2ZCB A;  3PGE A;  3BK2 A;  2L0F A;  2K5P A;  3U4E G;  2AYO B;  4HRS A;  3VH3 B;  4DBG A;  2UU7 A;  5HFY A;  5H92 C;  2SAK A;  2D3G A;  4BVU C;  2ZPY A;  2LMC A;  1ENF A;  4HDQ A;  2AQ2 B;  4BFR A;  1R4M I;  1YD8 U;  1P7E A;  2KDE B;  4EZJ A;  2FCN A;  2FUH B;  1ZXH A;  2G4D B;  1SB3 C;  4NPN A;  4NAW B;  4AP4 C;  2K8H A;  3QX1 A;  2DZJ A;  3IG3 A;  1P7F A;  4HWI B;  1ZP0 B;  4M00 A;  2R2O A;  4RCO A;  1H4R A;  1J7A A;  4AS1 A;  2FCS A;  2JX5 A;  5TSS A;  3V6E B;  2CJO A;  3T8M A;  3QAR A;  1OQY A;  2ZNV C;  3IAS 1;  1WI0 A;  4OVZ A;  4K7U A;  3U2S C;  5AZG A;  4MGY E;  1MPE A;  2BKR B;  2WXF A;  1V5T A;  4HPP A;  5FR6 A;  2RD0 A;  4RMA A;  4B0E A;  2GBN A;  2M1M A;  3TEZ A;  4LCD E;  1QOG A;  5HG2 A; 
#chains in the Genus database with same CATH homology
 2PMV A;  1F77 A;  2WXJ A;  3AEG B;  4A9A A;  2PLP A;  2J42 A;  1JML A;  2OED A;  1KF6 B;  1SXT A;  5H8Y E;  1RWS A;  2JZP A;  4OW0 A;  4GDK B;  2DYO A;  1OQR A;  3P4Q B;  3ZJT A;  2AX5 A;  2M56 B;  4WAF A;  4YSX B;  3R2T A;  2R61 A;  5G5G A;  1C4P A;  1PUT A;  2VZK D;  1EM7 A;  1MVK A;  1SJH D;  3E56 A;  3SR6 A;  1CJE A;  2V3N A;  2V4I B;  2RPV A;  1NYR A;  3EGR A;  4NZL B;  4IDI A;  2WNM A;  2ICI A;  2XN9 C;  5EE9 A;  1V1O A;  5BYS A;  1D5X C;  3FIL B;  2WXL A;  2MH7 A;  3NRZ A;  1K50 A;  3ZGZ A;  1XCQ L;  1XLO A;  3AE8 B;  1KTK A;  1TZO A;  1E0Z A;  5G5H A;  1RYJ A;  2QEJ C;  4OZA A;  1L0V B;  5HG2 A;  2HDE A;  3SFD B;  2PVO D;  2FBW B;  1M4V A;  1TKE A;  1NVI D;  4HJG E;  5EE1 A;  3AEA B;  1JW9 D;  2DYM A;  5JXV A;  1SE4 A;  3ZYY X;  2QIE B;  1L4D B;  4Q2J A;  1SSN A;  1EU3 A;  5AUI A;  2BS4 B;  1L5P A;  1FM0 D;  1DOI A;  1N63 A;  1T6B X;  1FO4 A;  1FCL A;  1JRP A;  1F2R I;  1BML C;  2K9X A;  2M19 A;  1YQ4 B;  1EWY C;  1J7C A;  1UNS A;  1XEE A;  2MJ3 A;  2INN E;  2WP9 B;  1NI3 A;  2TSS A;  1WXQ A;  1Y56 A;  1TS4 A;  2IGG A;  4FXC A;  5EE3 A;  2RDG A;  4WIP A;  3MP9 A;  4TQ1 A;  3Q8E A;  1GB4 A;  3DWG C;  1N5W A;  1CK1 A;  1ZPS A;  3R8B A;  1NEN B;  1JRO A;  2GI9 A;  2PVG C;  4YWG G;  4M0W A;  4A55 A;  2OHF A;  1V97 A;  2EKI A;  2IGD A;  2LJI A;  1SJE D;  1Q10 A;  1V8C A;  3NVW A;  2Y5C A;  1SIJ A;  2BYT A;  3TEX A;  4RH6 A;  1AWD A;  4KGR A;  3P4P B;  3T3N A;  3ZJU A;  2Y3A A;  5D7G A;  3AE3 B;  1GOZ A;  1KH0 A;  1PGB A;  4P6V F;  1DYQ A;  4HKZ E;  3VRA B;  3U52 E;  3W5U B;  1QOG A;  2E6X A;  2JWU A;  5MPO A;  1FNU A;  4YT0 B;  1BXT A;  2X38 A;  3GB1 A;  1TYG B;  2EEL A;  2L83 A;  2G9H D;  3ZQ4 A;  4JE3 B;  2WU5 B;  2K0P A;  4XWT A;  1FEH A;  1JWA D;  3AE7 B;  5T8I A;  1VZ6 A;  1ROE A;  2ZW1 A;  3HVZ A;  1OFF A;  2IJ0 A;  2LUM A;  2CJN A;  1DOY A;  4TMA B;  4LLG M;  2JQR B;  5BMI A;  4L1B A;  4GDL B;  1FIQ A;  1YJI A;  1C79 A;  1TKY A;  2QMT A;  2V0G A;  5D3I B;  2BB6 A;  2WXK A;  1KLG D;  4OZC A;  4C80 A;  1F0Z A;  1I4X A;  2GRI A;  2BW2 A;  2YEP F;  1EWC A;  2NMQ A;  3AED B;  4RF0 A;  1JQ4 A;  3BVG A;  1K53 A;  1MHX A;  3AE9 B;  3AB5 A;  4YTM B;  2WXI A;  1KLU D;  4RFB A;  1IGD A;  1VR9 A;  1EU4 A;  3W1S A;  2PKO A;  1IUE A;  1ZDV A;  1N61 A;  1ET9 A;  3W2D A;  1XXG A;  3FC4 A;  4YSY B;  1FCC C;  3VR9 B;  3AEC B;  1PYW D;  1QQR A;  1VRA B;  3R2I A;  4MM3 B;  2N7J A;  1QOA A;  4P16 A;  3RPF C;  1HQR D;  1GPX A;  3AN1 A;  3TSS A;  1I4G A;  1L6U A;  4MAC A;  1I4H A;  3FIL A;  4YSZ B;  1UWM A;  3T3O A;  2ONQ A;  1L0X B;  3BZD B;  3TUO A;  2N9L A;  2KAC A;  1XF5 L;  1CQV A;  1STE A;  1A70 A;  4IOI E;  1UGJ A;  1QF6 A;  4A90 A;  2N9K A;  3EUB 2;  4JPS A;  3URY A;  2LHE A;  2L1A A;  1KRH A;  1FD6 A;  1DOX A;  2W3S A;  1SBB B;  1GAQ B;  2N0S B;  3AE6 B;  1ET6 A;  1IGC A;  3AE1 B;  3IAM 1;  1XLQ A;  2GB1 A;  1WSP A;  4WQM A;  5FK9 C;  1C4A A;  1JCK B;  2HTM E;  1MI0 A;  3SFE B;  1FMA D;  1E6E B;  1ZXI A;  1I7H A;  4KGT A;  1SE2 A;  4N59 A;  4XDD A;  4REZ A;  2AQ1 B;  1TS5 A;  4GLS C;  4YTN B;  1K51 A;  4B0M A;  1N5X A;  1L6V A;  1YN3 A;  2J52 A;  2W3R A;  2WLB A;  3SEB A;  1SE3 A;  1VZ7 A;  2ON8 A;  3I9V 1;  2J53 A;  4TSS A;  2QSD A;  1FNW A;  5AUK A;  2DLB A;  5BYR A;  4KGS A;  4D2K A;  3NVZ A;  1E10 A;  1TJE A;  3V3X A;  1HEZ E;  1UWX A;  3AH7 A;  3V05 A;  2LHD A;  1V1P A;  2KAJ A;  4JWU C;  4RNA A;  2WXG A;  3WCQ A;  4ARC A;  1QOB A;  1WRI A;  3EA6 A;  1JWM D;  3AV8 A;  4RF1 A;  4XE0 A;  1V1P B;  4A8X C;  2CU3 A;  1FNV A;  1F2R C;  1B1Z A;  3H8H A;  4L2Y A;  1YNT E;  3KLS X;  2JXT A;  1FFU A;  3MC0 B;  1I4R A;  1TKG A;  4N6E B;  3ZJV A;  2INP E;  1XO3 A;  2KN4 A;  4KKJ A;  4KX6 B;  3VR8 B;  1SF0 A;  3PO0 A;  2Q5W D;  4DXF A;  2JYT A;  1FXI A;  2RMM A;  5HHD G;  1D5Z C;  1YN4 A;  3LB8 C;  2KQ4 X;  2IDY A;  1E9M A;  3AEE B;  1YMH E;  2WXO A;  1ACC A;  2W54 A;  1IBX A;  1WGK A;  3KWV A;  3NVY A;  5FR3 A;  1AW7 A;  2FE8 A;  1C77 A;  1SEB D;  1B9R A;  1CZP A;  4LTU A;  1UUP A;  2L32 A;  4TQ0 A;  1C4C A;  1IBX B;  4NAM A;  3P4R B;  1TS2 A;  3P63 A;  1I4Q A;  4EE2 A;  3IT6 B;  3IT4 B;  2BT6 A;  5BMH A;  1D6E C;  2G1E A;  2V3P A;  4RGM A;  4MT5 A;  3BK1 A;  3U7Z A;  3KQ4 A;  1I4P A;  3HVD A;  2B76 B;  3TEY A;  5BMG A;  2WDQ B;  4NJC A;  2RDH A;  3AE5 B;  4JX1 C;  2L52 A;  3B2G A;  3N9Y C;  4MH8 A;  4HKQ A;  3Q8C A;  4OZB A;  3MHZ A;  4C56 C;  1VLB A;  4KKI A;  1FXA A;  1RFK A;  1RM6 C;  1XLP A;  3L4P A;  1ZUD 2;  4US8 A;  5GXG B;  2BB5 A;  1KFY B;  4LK0 M;  1C9F A;  3BVZ A;  3E9S A;  1T5X D;  3CWI A;  1MHH E;  4ZOH C;  1XCT L;  2D5G A;  2LGI A;  4YXD B;  4RGT A;  2BTE A;  1HZ5 A;  1WYG A;  5C2T B;  2KWD A;  2KDM A;  2NTS A;  1FFV A;  3OWE B;  1NEK B;  1TS3 A;  3TEW A;  1PGX A;  3BVM A;  3W5V B;  2JU6 X;  1AYF A;  3CIR B;  2WXQ A;  3Q8B A;  1R7S A;  5EE0 A;  3ETR A;  1JAL A;  3P42 A;  2BBC A;  1ESF A;  1QIL A;  4RGN A;  2JYE A;  4WUR A;  4N58 A;  4YTP B;  2WS3 B;  2JSV X;  3J9C A;  2SEB D;  2Y5P A;  1QLB B;  2DBY A;  4RGO S;  4ZRQ A;  1ZOY B;  3BII D;  2MJD A;  3GS2 A;  2H88 B;  2IGH A;  1E7P B;  3B2F A;  4UDU C;  5I4D A;  3KWL A;  1VJK A;  3NZ3 A;  1BUI C;  2WXH A;  4ARI A;  3AMZ A;  2K3U A;  3P1M A;  3MFG A;  5D3D A;  1YN5 A;  3O13 A;  2FUG 1;  3BYY B;  1AN8 A;  3Q8F A;  4IKG A;  2K22 A;  2QIL A;  4O1N A;  1VDV A;  1GB1 A;  2MEK A;  4OHJ A;  2M0A A;  2WQY B;  4US9 A;  4XDC A;  3NS1 A;  5BYQ A;  1TY2 A;  1HZ6 A;  3I57 A;  2WXR A;  2WXP A;  4J3O D;  2BS2 B;  3HUI A;  2I2Y A;  1LO5 D;  3BK2 A;  2ZW0 A;  4WH4 A;  4JWS C;  2K5P A;  3U4E G;  4ZYS A;  4A6Q A;  3IXS A;  1HXY D;  2VZK B;  4HRS A;  5FKA C;  2PIA A;  1PDX A;  2WDV B;  5C3J B;  3FAH A;  1C78 A;  4C7Y A;  5HFY A;  1QT9 A;  4HRO A;  1FRR A;  3PZ7 A;  2SAK A;  1J7B A;  5H92 C;  1JWB D;  1QKZ A;  2LMC A;  3LXF A;  1ENF A;  4PT5 A;  1K52 A;  1QOF A;  3AEF B;  1T3Q A;  2J4X A;  2KMM A;  3NUH B;  2AQ2 B;  4USA A;  1FRD A;  3Q69 A;  4ITK A;  3LYY A;  2IPK D;  3RFZ B;  2LFI A;  2YEP B;  3B9J A;  3BYT B;  2W55 A;  4XWW A;  2AQ3 B;  1P7E A;  2NTT A;  1WWT A;  4C7Z A;  2W82 A;  1ZXH A;  1PFD A;  1SB3 C;  1PGA A;  4NAW B;  4WWM A;  2BS3 B;  2WDR B;  1VZ8 A;  1P7F A;  1ZDX A;  1N60 A;  2LEK A;  1L0Y B;  1NYQ A;  2E3T A;  1ZP0 B;  3P4S B;  4DQO C;  2QJL A;  2XNA C;  2DWQ A;  4RCO A;  3GP7 A;  3DWM A;  1J7A A;  4AS1 A;  5E6J A;  2WXM A;  4L23 A;  1TY0 A;  1N62 A;  2JX5 A;  5TSS A;  2CJO A;  3UI3 A;  3NVV A;  1JWS D;  2WU2 B;  3IAS 1;  2H89 B;  2WXN A;  4OVZ A;  4R3D A;  1L4Z B;  3AE2 B;  4DXG A;  3W9C B;  3U2S C;  3AE4 B;  3PZ8 A;  1MPE A;  1YJJ A;  3AM9 A;  2WXF A;  2Z8L A;  1DGJ A;  1HA5 A;  4AQ7 A;  4ZHP A;  4B0E A;  3HRD D;  2I38 A;  1D5M C;  1XLN A;  4ZHO A;  1D4B A;  1C76 A;  4CQN A;  3Q8A A;  3BWU D;  5LNK 1;  3VRB B;  5HI1 A;  4ZRP A;  1ZE3 D;  1YQ3 B;  3TEZ A;  3ABV B;  3VQI A;  1JWU D;  3MJ5 A;  2PTL A;  3AEB B;  3C8Y A;  4H2A A;  2PW9 A;  2ACZ B;  4HEA 1;  1OQQ A;  2MJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...