4HROA

Crystal structure of h. volcanii small archaeal modifier protein 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
87
structure length
87
Chain Sequence
GAHMEWKLFADLAEVAGSRTVRVDVDGDATVGDALDALVGAHPALESRVFGDDGELYDHINVLRNGEAAALGEATAAGDELALFPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of H. volcanii small archaeal modifier protein 1
rcsb
source organism Haloferax volcanii ds2
molecule tags Protein binding
molecule keywords Small archaeal modifier protein 1
total genus 24
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4hroA00
3ZYYX 4C7YA 1NVID 2MH7A 3AM9A 2LEKA 1V97A 2MJDA 3VRAB 1T3QA 2WDVB 2L83A 4WQMA 4YTMB 4JWSC 4LTUA 4P6VF 4HRSA 3NRZA 2KAJA 1FXIA 1WWTA 2WS3B 2OHFA 1L0VB 2PKOA 3SFEB 1N60A 3AE6B 3NS1A 3CIRB 2FBWB 3KWLA 1TJEA 1YQ3B 3P4SB 1QLBB 1PUTA 1N5XA 3AEEB 1FFVA 1QOFA 1XLQA 2MJEA 3LXFA 4HROA 3VRBB 4A9AA 3NVVA 1I7HA 3AB5A 5C3JB 4JX1C 4IDIA 1WXQA 3AE9B 4ITKA 3L4PA 4FXCA 2PVGC 2M56B 5H8YE 4US9A 1J7CA 3AE5B 1RM6C 1FM0D 2H89B 2Q5WD 2WU5B 3AEBB 4N59A 4YSYB 1N63A 1SF0A 1CZPA 2CU3A 1QOBA 2H88B 1TKYA 4YXDB 3AE1B 4US8A 1FRRA 1FRDA 1NENB 2W3SA 2EKIA 3DWGC 2WDRB 3P4PB 1QOGA 2BS4B 3B2FA 4N58A 4WWMA 1E10A 4JWUC 1OQRA 2B76B 3HRDD 3NVWA 3SR6A 5AUIA 1RYJA 1ZP0B 1ZOYB 2K5PA 1WRIA 4YTPB 1NYRA 3AECB 5G5HA 1TKGA 1YJIA 1J7BA 2CJOA 1AWDA 1SIJA 2BS3B 2JX5A 2Y5CA 4YTNB 1FXAA 1NI3A 1QOAA 2QJLA 2WP9B 5EE9A 1PDXA 3FC4A 3P1MA 2K22A 4ZHOA 2WU2B 2WQYB 2JQRB 3AV8A 4C7ZA 1SB3C 3VR8B 1EWYC 3SFDB 4YSXB 5MPOA 4N6EB 3NVYA 2DBYA 1KF6B 1WGKA 1DOXA 3EUB2 1ROEA 1DGJA 1L6UA 2W55A 1JWBD 2ACZB 2N0SB 2MJ3A 3AE7B 2WLBA 1XLOA 1DOYA 1UWMA 2AX5A 5G5GA 2K9XA 2KMMA 2BS2B 2DWQA 2M19A 3AE8B 3LB8C 1PFDA 3AE4B 1E6EB 1NYQA 1YQ4B 1ZUD2 3RPFC 1JWAD 3ABVB 4USAA 5EE1A 1AYFA 1TYGB 3P4RB 4ZOHC 3AEFB 1OQQA 1QT9A 3P63A 1QF6A 2WDQB 3WCQA 3AEAB 1RFKA 4YT0B 1XLPA 1N62A 1V8CA 3CWIA 1YJJA 3AE3B 3HVZA 1GAQB 1OFFA 1FO4A 5AUKA 2G1EA 5GXGB 1ZXIA 1JQ4A 2E3TA 2BT6A 1KRHA 1KFYB 1VJKA 1NEKB 3B9JA 1JROA 3BIID 3HUIA 3ETRA 1IUEA 3NVZA 4ZHPA 1VLBA 3PO0A 2PIAA 1VDVA 1JALA 2QIEB 3W9CB 1JRPA 1XO3A 1TKEA 1WYGA 5EE0A 3W5UB 1DOIA 2W54A 3AN1A 1CJEA 3FAHA 5EE3A 1JW9D 3P4QB 1FMAD 3AEDB 1L6VA 1B9RA 1GPXA 1RWSA 3VR9B 3DWMA 1N61A 1A70A 1FFUA 3B2GA 1L5PA 1XLNA 3W5VB 4KX6B 2W3RA 3AH7A 1J7AA 2PVOD 3AEGB 5H92C 3AMZA 4C80A 2CJNA 1E9MA 2L52A 1E0ZA 1F0ZA 1R7SA 3AE2B 5C2TB 2HTME 1E7PB 1N5WA 1FIQA 4YSZB
chains in the Genus database with same CATH superfamily
3ZYYX 3FILB 2DZKA 4K7SA 2QCZA 2LVQA 3DBLB 1Z5SB 1RRBA 4HROA 4C4VA 3BVMA 5H8YE 3N20C 3PPAA 3MJWA 1QOBA 1TKYA 2G4SA 3DWGC 1E5WA 2OJRA 3CMMB 1UGMA 4ICVA 2K0PA 3Q69A 1HZ6A 1J7BA 2JX5A 3QK0A 2K6DB 3DDCB 3H7PA 4ZHOA 3FC4A 4MH8A 4DDID 2FCMA 4C7ZA 4HCNB 3SFDB 2LHEA 1YIWA 1LGRA 4MJSA 3I63C 3W2DA 1L4ZB 2M8SA 1BUIC 1E6EB 2D3GA 3P4RB 3IVFA 3QIJA 4BVUC 1WX8A 1TS4A 1GOZA 1S1QB 4BAXA 4HK2A 2WXPA 1SJED 3PRMB 1BT0A 2I1JA 1J19A 3V6EB 4FLHA 1JALA 2JZPA 3L17A 3T9LA 5LLIA 2IO2B 1C3TA 4RM8A 3GB1A 2BKFA 4H2AA 3PZ7A 5C23A 2N9XA 1P0RA 3TUOA 1L5PA 4C56C 3CF6E 4WJNA 4NY0A 5H92C 3ZNID 2N4FA 2BWFA 3ZXRA 4HKQA 1B1ZA 1L7YA 1PYWD 2HDEA 4KDIC 2M0AA 2HTME 4DDGD 3TJPA 4LTUA 1ET6A 1T5XD 2D5GA 3K9PB 1WWTA 4EE2A 3SFEB 5AEKB 2R2OA 3VRBB 4WQOB 4ICUA 1JMLA 2LRUA 1WF9A 4JGHB 4KSLC 4NZLB 3DPDA 4ANWA 4LCDE 4IWPA 2WWZA 3U7ZA 3ZIMA 1ZOYB 1UBQA 3QQ8B 4YTPB 3U4EG 3GS2A 2L32A 2IGHA 2FAZA 3DOWA 4RNAA 1SB3C 4OW0A 4B9KA 3TL5A 2BYTA 1P7FA 3A1QB 3H9DA 3NZSA 2KTRB 4FN2A 2K9XA 3N1ZC 1V6EA 2N1WA 1YQ4B 1JCKB 1GC7A 2KDEB 4WJPA 1EWCA 3ZNGC 3WCQA 2O2VA 2KMCA 1WZ3A 1UGJA 4WJQA 2V3NA 4A8XC 3BIID 4BBNF 2K8BA 1UWXA 4GLSC 3K9OB 3BWUD 3Q8EA 2V4IB 4LNFA 4MDKE 4KIKA 2LZ6A 2MBOA 1ESFA 4EZJA 3ZUNA 3H8HA 3R2TA 3WAMA 4WWPA 1J7AA 2PVOD 4N9F4 1F0ZA 1UBIA 1Q1OA 3N3KB 2EMSA 3ALBA 3QA8A 4FJZA 4G11A 1V97A 4A3OA 2BB5A 4HRSA 2KAJA 5BYQA 4XC2A 1I4PA 3AE6B 3RULA 3CIRB 2M4NA 2L00B 1QLBB 4IC7B 4QAYA 4IM0A 4BBNC 3TEXA 2INNE 2KDBA 4RGTA 1D6EC 1XD3B 2WDRB 4A20A 2JVCA 2BS4B 2GMIC 2IGDA 1E10A 1V86A 1FD6A 4DXGA 1PGBA 2JY6A 2IJ0A 2NTSA 1NYRA 4J6IA 2BPSA 1SIJA 2AL3A 2BYVE 2JPHA 4NAWB 1Z2MA 2VRRB 4O1NA 1K52A 3RT3B 2WXIA 2LI5A 4II3B 2WGSA 2KK8A 2GB1A 4B6WA 1XLOA 1Y56A 3Q3MC 1EF1A 3BK2A 1PFDA 2CKHB 5D3IB 2KWDA 3FKYA 1WRDB 2PLPA 3A9JB 5DPSA 3CWIA 1LFDA 3RMKC 1GAQB 3RUIB 4NJ6A 2KC1A 2NR2A 1JROA 3HUIA 4AQ7A 4NAMA 1YQBA 1TS2A 2LGSA 4JL9A 2L3ZA 3Q8BA 2LJIA 2MX2A 1D5MC 1MVKA 3UIOB 1N61A 3M3JA 1FFUA 1T0QC 3AMZA 2WXKA 3NUHB 1E0ZA 1JWMD 4W9HA 3UF8A 2J42A 2J0JA 4HPPA 2LEKA 4AJWA 3RNEC 2B3AA 1K8RB 4PK1A 4PS3A 4YTMB 1Q10A 2RPQA 3KWLA 1WJ4A 2KLGA 2WX1A 4W9DA 3P42A 3L4PA 5J18A 4BOZB 1J7CA 3NY5A 2WXOA 1SE9A 1UD7A 1N63A 2V9HA 4YXDB 1FNVA 1I4QA 4G3XB 3APDA 4MSMB 2DAFA 3U8ZA 1RYJA 1SE2A 3QCAA 1ET9A 3FILA 4BKSA 3OAWA 4LJPB 4IW0A 5AZGA 1E8XA 1YX5B 2RPVA 2ZVOA 3VR8B 3V60A 1PGAA 3DBRI 2V0GA 4W9KA 2ZPNA 2YEPB 2V3SA 2KMMA 2MP2A 1KLGD 3C19A 4W9IA 1SBBB 1V5OA 3HHMA 1QF6A 1WMHA 2ZVNA 3AEAB 2RDGA 4MACA 1FO4A 2G1EA 4GDLB 1WJNA 4ZHPA 4KIKB 2KFKA 5FR6A 3PVLA 1C1YB 1JWUD 2O6VB 4AWJA 3DVGX 3B2GA 4KV2A 4M0WA 3W5VB 3MC0B 3AU4A 1TT5B 4YWGG 2KLCA 2LXCA 4ASWC 1ZKHA 3BVZA 4IG7B 2BB6A 3AULA 4EUTA 2M1MA 3M62B 4LNNA 4WJOA 3ML9A 2QEJC 1KLVA 1T6BX 2C9WB 2FCNA 1L4DB 1WM2A 3SU8X 1V80A 1LM8B 1V81A 2LXAA 2Q5WD 4A55A 2FIFA 4W9FA 2E6XA 1WXVA 1OGWA 2W3SA 4DBGA 2NS5A 2ZZPB 2JZ3B 1VZ8A 3I5JC 3BYYB 2Y5CA 4AOFA 3N1XC 1STEA 1AN8A 2IYDB 1GB1A 3ZVVA 3KUDB 3RNBC 4GU2A 5LXIB 3T8MA 4OVVA 4RF0A 1C76A 2ACZB 1IPGA 5G5GA 3GE8C 1TZ1A 3IT4B 4DHJD 2LWPA 4ZRKA 1YMHE 2REXA 4GB9A 2I1KA 3M63B 2D3AA 3Q3JA 4USAA 1TYGB 1V5TA 2SEBD 4ZYNA 1OQQA 1WFYA 1P1AA 4YT0B 4GOCA 1DYQA 4HVBA 4Q2JA 1ZXIA 2QDFA 1UELA 2Y5BB 3WAOA 3Q6BA 5DCNA 1XO3A 5IOIA 1GNUA 1ZW7A 2W54A 2FCQA 1E90A 1U4AA 1UF0A 4K7WA 4EZKA 2IZVB 4XDCA 5HFYA 1HTQA 2JXTA 1BXTA 2D2QA 1EF5A 4ZDVA 2KFJA 2L52A 1YOVB 2KWVB 4HCPB 3TCAA 2V1YA 3NOBA 3Q8CA 1WJ6A 2JRHA 5DPWA 4HDQA 2DYOA 2Y5PA 3NRZA 3HVDA 4KKJA 2PKOA 4NNJB 2BWES 3L10B 2JXXA 2QSDA 2N9PC 2KC2A 2V3PA 3EGRA 2KDMA 1RFAA 4JX1C 4LDTB 1HQRD 1KOTA 1YD8U 2H89B 1FM0D 3KW5B 3I3TB 3H7SA 1NENB 2EKIA 3ZGZA 5D2MB 2B76B 2GBKA 1ZP0B 3MTNB 3LDZE 1SE3A 2K5PA 2IO1B 4WIPA 3ZRCA 2BS3B 3U30A 2L05A 3P1MA 2MEKA 1YN5A 5DPTA 4C00A 4XE0A 3QWZB 3V05A 4FHJA 1WE7A 3VTUA 3NVYA 2IDYA 2D10A 2N0SB 4P1CC 2L0TA 4GMVA 4ZRPA 3OJ3A 3MHZA 3AI5A 2V4LA 4NQKE 3C0RB 4KKIA 2FE8A 3B0AA 1NBFC 4HWIB 4MT5A 2J53A 3UINB 1ZDVA 2LGYA 2MP2B 3QJZA 2UYZB 4NJCA 1WGRA 3EECA 1IUEA 3TSSA 3WA0A 2J7QB 4K7UA 5HI1A 4BKSD 1WMHB 1IP9A 1CJEA 2JT4B 3O13A 4M8NA 3IFWB 5FR3A 2LFIA 3V3XA 3MP9A 2KD0A 3A33B 1XLNA 3VXWA 2C7NB 1WH3A 1QKZA 3KUCB 1SJHD 2QMTA 4YSZB 1NVID 2LGIA 1SXTA 5FKAC 2FIDA 1IGCA 4OVZA 4ANUA 2WHIA 2ZW0A 1L0VB 2IGGA 3N1YC 2VZKD 3PRZA 2KTRA 3SDLC 1WXQA 4EOYA 1D5XC 4BFRA 1RM6C 4YSYB 5CTRC 4F8CB 2H88B 3R2IA 3RI7C 3GE3C 3U52E 2UWQA 3P4PB 4WAAA 1F2RC 1XF5L 2PJHA 2KT7A 1N6ZA 5G5HA 4KSKC 4TKNA 2EELA 3RNAC 3OWEB 3A1QA 4AS1A 1QOAA 4K1RB 1AARA 2GBRA 2KMAA 4FA6A 1Q5WB 2LVOA 4XDDA 1KF6B 3X23A 4YL8A 5TSSA 1WM3A 2XK5A 3VHTC 4JPSA 1GG3A 1XCQL 2A5UA 3ZKJC 3EFCA 5D3DA 2K8CA 4ZOHC 1RAXA 2ONQA 4G50A 1QT9A 3P63A 2L76A 4B95A 3CSTA 3P2BA 1N62A 3AE3B 3KVFB 3PLUA 2DX5B 1C4AA 2LGXA 3NS8A 4E3CA 2BBCA 2BYEA 1VLBA 4RGNA 5BYRA 4FULA 3HIZA 1S3SG 1TKEA 1VZ7A 2BW2A 1KM7A 1L0YB 3FAHA 2M0XA 1V2YA 1F9JA 1KH0A 4X57B 2KVRA 2AYOB 3AEDB 2JRIB 1GPXA 3RD2A 3VR9B 1A70A 1Y8RC 4KX6B 1LO5D 3QHTA 4IUMB 3V61A 4MELA 5LNK1 1WI0A 4JIOU 3HM6X 4RCOA 2IO0B 4F7ZA 4EZLA 4NAWA 3RNGC 2C7HA 4JWSC 4P6VF 1GUAB 1FXIA 4RMAA 1E8WA 3JSVA 2C5LC 2WXGA 3DHGC 2J4XA 1D5ZC 4FJVB 3AB5A 4IDIA 4W9CA 3RN9C 1FNUA 2PVGC 1VCBA 1YJ1A 2BGFA 3L54A 3U7DA 4D2KA 4N59A 1WGHA 1T0RC 2INPE 2WXFA 4WWOA 2ZW1A 4FJYA 1TZOA 2BF8B 3EFUA 2L0FA 2Z0EB 2WXJA 4JLCA 3MC8A 2JUOA 1WRIA 2D3CA 3AECB 1C9FA 1TKGA 1YJIA 2CJOA 4OZAA 2UU7A 3W1SC 5IAAC 2JQRB 3AU5A 1P98A 4DWFA 2KJRA 3APFA 2O6VD 1F2RI 4RM9A 3QC8B 3BVGA 4CQNA 1JWAD 5EE1A 1K51A 3LYYA 3ZXVA 1EM7A 2WDQB 2KNBA 3E9SA 1C78A 4XX5A 3JSVB 2FUHB 3PRPB 4JE3B 2W9NA 3H7PB 4E71A 2QIEB 3O65B 3V62A 2MLBA 1JRPA 1I4XA 2KQSA 1OEYA 4MJSB 2NPTA 3R66C 2Z8LA 4TSSA 3PTFC 3ZQ4A 2L7RA 3ECIA 1A5RA 3IXSA 4CO7A 5LXHA 4JQWC 4MEMA 2MQJA 3ZJUA 5C2TB 2KJHB 1MPEA 3DQVA 1V1OA 4TQ0A 2NVUI 5BO4B 2N9LA 2C7MB 3A4RA 2NTTA 3R7RA 5IKCM 3BZDB 1FFVA 3HM3A 5C3JB 1C77A 3ZDTA 3VTWA 4US9A 2MW5A 3ZNHB 4L23A 1EUVB 2GOWA 1LXDA 4A6QA 1CZPA 3PZ8A 3N30A 2LHDA 4ZRIA 2HE7A 2KOXA 4GDLA 5IP4D 3BY4B 5AUIA 4LNKA 3EA6A 2XBBC 1T0SC 2JWZA 4HDOA 5E6NA 2KQ4X 4XZ4A 2J0MA 4AUQC 1JWSD 2DZIA 4YSXB 3PGEA 5MPOA 2WXQA 1WX7A 1OQYA 4LLGM 2KHWB 3D32A 4PS8A 2LASA 3AE4B 3GP7A 3UQAA 1FCCC 5I4DA 2Y3AA 1J0GA 1TTNA 2PE6B 2K25A 1RFKA 2KJ6A 2MRPA 1P3QU 2QC8A 4M8MA 5AUKA 1MJDA 2AQ1B 4XWWA 1FXTB 5GMVA 3KYCD 4AJYB 4OVUA 4KGRA 2NPTB 1R4MI 3W5UB 2D11A 4WWNA 4URKA 4REZA 1IBXB 1I4HA 4NJ7A 1B9RA 1L6VA 1RWSA 3Q8FA 3PLVA 1R4MB 1HXYD 4W9GA 3DBHB 2MBBB 3AEGB 2BTEA 2NBUA 1MHHE 3E56A 1EU3A 2RSUA 3N32A 2WXMA 2NBWB 3PREA 4MGKE 2CR5A 1WXAA 3NJTA 2L83A 1L2NA 3L0WB 3R3MA 2RD0A 3RFZB 2KTFA 1I42A 3Q3OC 3LXFA 1QOFA 4A9AA 1J8CA 4DXFA 2DZMA 3KLSX 2WDTB 2HTHA 3QAQA 3DHHC 2RGFA 2KX3A 1IGDA 2R61A 4W9EA 2KDIA 2KDFB 3IAS1 3VUWA 2N9KA 5E6JA 2WX0A 3HRDD 4PT5A 4KVGB 2CHXA 1I4GA 1M94A 3LJ3A 1FXAA 3NHEB 2CU1A 2KO3A 4ARCA 2DYMA 2K22A 2J52A 2QILA 2IY1B 4WURA 1DGJA 1KTKA 4HLEA 2W55A 1JWBD 2MJ3A 3AE7B 1YNTE 4FHKA 3RYTA 4I6PA 5G2NA 2INDC 3RPFC 2RMMA 4ZYSA 4NPNA 2KWCA 3SEBA 1WR6E 1MHXA 1F52A 1XLPA 3U2SC 2MHJA 2MSED 1OFFA 2DAJA 2WYQA 2BT6A 1VJKA 1KRHA 2LD9A 5JHAA 1V1PA 3CSFA 4FBJB 1WYGA 3KWVA 5EE0A 1DOIA 5IO9A 1FMAD 3GOEA 2XK5B 1YX6B 2AQ2B 1WGDA 2W3RA 1SGHA 1XQQA 5KHQA 2JWUA 2ICIA 2OJWA 3B08A 1E7UA 3W1YA 4HJGE 2MH7A 3VRAB 2BVCA 3VQIA 2BYFA 2WDVB 5TR5A 4M02A 4BKGA 1H4RA 2OEDA 3NS1A 1XLQA 2Z0DB 1R4NB 4ITKA 4TMAB 3AE5B 3AEBB 2WU5B 5BYSA 1ZXHA 4GDKA 1FRRA 1ZGUB 2O2VB 2TSSA 2GRIA 2NMQA 3EC8A 1HE8A 4HEA1 5AZHA 2M17A 3PV1A 2C60A 4B0MA 2OOBB 2BKRB 3OLMD 3BK1A 4TQ1A 2I38A 1WGGA 2YEPF 1BMLC 3NZ3A 3QARA 2KN4A 4M01A 4MGYE 4OZCA 1NYQA 1CK1A 2KXJA 3WALA 3ABVB 3KUZA 1AYFA 2DLBA 3AEFB 4GN1A 3MHSD 3DBRB 5CHFA 3R8BA 2GLSA 4RGMA 1V49A 1JQ4A 1GC6A 5BMIA 3B9JA 4M00A 1VDVA 3PZDA 3H1UA 2EKEC 2N7JA 5EE3A 1I35A 4WAFA 1PQSA 1UNSA 4ANXA 3M95A 1RLFA 3AH7A 2KX0A 1UZXB 4GGQA 5JXVA 2NBVB 1E7PB 1N5WA 3ML8A 2DHZA 2CHZA 2JF5A 2A4ZA 1OTRB 1WE6A 2KANA 3L08A 4BKTA 4HKZE 2X8XX 5FK9C 3DVNV 2DNFA 2ZCCA 3BYTB 4DHZB 2M56B 3AXCA 3Q3NC 4RGOS 2JSVX 4E74A 3TMPB 2RDHA 2O6VA 4KZCA 2PPHA 2PMVA 2G45B 3NVWA 4PYZA 2IY0B 3T3NA 2VH2A 4HJKA 1VD2A 5JZEB 2AWTA 2WU2B 4A90A 1EWYC 3VH3B 3WANA 1R4NI 1WGKA 2KWUB 3EUB2 2IBIB 2HJ8A 3ZTDA 1UWMA 3A9KA 1K50A 2BS2B 2MBQA 3ZJVA 2LJ5A 2BQQA 3NZUA 2HJ1A 4K3CA 3IBEA 1XXGA 1GB4A 2N7EA 3A4SC 5GXGB 2XNAC 2AEHA 1LQBA 1NEKB 3ETRA 1K53A 3RCZA 5CHWA 4IKGA 2X38A 4OZBA 3OG5A 2GBNA 3P4QB 3UI3A 2DENB 2NCNA 1X1MA 3TEZA 2D3BA 2LRWA 4GIVA 1PGXA 3WAPA 3AM9A 4KGSA 4LK0M 2CHWA 2I2YA 3TEYA 2OHFA 5J17A 2JYEA 2L1AA 2FBWB 3NVVA 1KLUD 3GZNI 1SIFA 4FXCA 2YVCA 4DQOC 3ZDMC 4DK5A 1DOYA 2CU3A 2ZEQA 1FRDA 1QILA 4P1BC 5E6OA 1JRUA 2JYTA 4K3BA 4IM3A 4N58A 4BZAA 1OQRA 1MG8A 3MJ5A 2VZKB 2W82A 1D4BA 4YTNB 2KVZA 1L0XB 1PDXA 3DBHI 3A9KB 1XCTL 1WJUA 2DBYA 1TY0A 1ROEA 4EEWA 4HXDA 2DZJA 2ON8A 3DBSA 4DHZE 4KGTA 3UGBB 4G0NB 2DWQA 3AE8B 1MG4A 1UH6A 3UIPB 2R2QA 3MFGA 4MGZE 2LGDA 4J3OD 2WXNA 1YN3A 3R7QA 3VAWA 2IO3B 3UQBA 3WIMA 3ZRFA 1QQRA 1P9DU 2K39A 2KFKB 1TBEA 1H8CA 4C4VB 3NVZA 1P7EA 3ZO5B 2L8JA 3BINA 5CHVC 3W9CB 3ENEA 4LJOB 3DVGY 2K6QA 3URYA 1GJZA 1EO6A 3I9V1 3PSEB 1MI0A 2PEAA 5HG2A 5DPRA 3SHQA 5HHDG 2KQ7A 1WSPA 1G6JA 1WXMA 1R7SA 2GI9A 4L1BA 2XEWA 3IT6B 1T3QA 4ACFA 3S2AA 3X0WA 5IA7A 2LVPA 1E8YA 2WS3B 1NDDA 5G55A 2PTLA 3AEEB 3DVNU 2MJEA 1SSNA 5JH5C 3PHWB 1I7HA 3I57A 2N1VA 2ZJDA 3DHIC 4FADA 2G9HD 1FCLA 2MBEA 2RR9A 4L2YA 3TEWA 4II2B 4US8A 3TIXA 2IPKD 4TUUA 1HZ5A 3VUXA 1QOGA 1ZE3D 3SR6A 3EHVA 3RZFA 1AWDA 1WXSA 4DXAB 2ZNVB 3DCGA 3ZTCA 2WXHA 3PS6A 2CS4A 3L13A 3VFKA 3ZNZB 4GXBA 4K81A 4LDTD 1DOXA 1L6UA 2RDBC 4GSWA 4LNOA 2GBMA 2MCNB 2J0KA 2N7DA 2Z59B 4LNIA 2ZNVC 3GZNB 1ZUD2 4KDLB 2MA9B 5D7GA 4XGAB 2INCC 4ARIA 1YJJA 2VH1A 5C1ZA 3Q8AA 1ISNA 1F1HA 2PW9A 2LMCA 4MH0E 2WXRA 1YN4A 2LUMA 4P7IA 3VVWB 4TV3A 3T3OA 4RF1A 3W1SA 1TY2A 3N9YC 1MFWA 5AZFA 1F77A 4R3DA 3SD5A 1D3ZA 3HK0A 4MM3A 1XT9B 5BMGA 1V9JA 2CJNA 3AE2B 3TBLD 3DWMA 4S17A 4C7YA 2MJDA 2ZPYA 4A3PA 3Q14C 4WQMA 4M0WB 3B1LX 4BOSC 3ONSA 3IHPC 2FCSA 1TJEA 5KHOA 5L83A 1N5XA 3KH0A 4UDUC 3QX1A 2KYWA 1C4CA 1IYFA 2G3QB 1SF0A 1ZPSA 3RNCC 5EDSA 3B2FA 4IWQA 4WWMA 3ZLZA 4F1SA 4DHJB 4OHJA 2AQ3B 2FUG1 2JZZA 3NG0A 1NI3A 3C8YA 1V1PB 2WP9B 1WYWB 1FNWA 1I4RA 2XN9C 3IG3A 1E8ZA 1TGZB 2WLBA 2AX5A 3KQ4A 4WH4A 1WX9A 2D07B 2K1FA 2GBJA 3L16A 1OEYJ 1ENFA 1HTOA 3J9CA 2KKCA 4PYUA 1V8CA 1C4PA 3VTVA 2MBHA 1AW7A 1FEHA 3PHXB 3RNFC 4B0EA 4AP4C 3JVZX 4I6NB 2QHOA 4S0RA 3DBLI 4RFBA 4MM3B 1JW9D 3IAM1 1WIAA 4KZ0A 1SEBD 4GDKB 3JYUA 2JU6X 3MC9A 2KZRA 3H6NA 2N9EB 1XEEA 1EU4A 3Q3FA 1VZ6A 4CYEA 4P16A 2K3UA 5CX3A 3KYDD 2LUEA 1WR1A 3VUYA 1NI2A 4EFOA 2MWSB 1N60A 4IOIE 1YQ3B 3P4SB 4EKUA 2DYBA 1PUTA 2FNJB 1T0YA 1VRAB 3AE9B 3ZJTA 2KN5A 4W9JA 3Q2AC 1CMXB 1M4VA 4MSQB 5IN7A 1C79A 4NQLB 3AE1B 4HPLB 1QZEA 3A9JA 4JWUC 3V6CB 4I6LB 1Q0WB 2YLMA 4HPMB 2QJLA 5EE9A 1SE4A 5J2RA 3JW0X 2WQYB 3AV8A 1ACCA 2G4DB 1UUPA 1KJTA 4N6EB 1E7VA 2AL6A 2WXLA 5D94A 3PT2B 1CQVA 5BMHA 3LB8C 2M19A 5T8IA 2KACA 1ZDXA 4IWOA 2EMTA 4ZRQA 3ZW3A 5JHBA 1TS3A 2WNMA 2ASQA 3OJ4B 1HA5A 3HVZA 4CHKA 2E3TA 5D6JB 1KFYB 4XWTA 4XYCA 2HD5B 1WY8A 3RZWC 1WZ0A 3PO0A 2PIAA 3VH4B 4ZRJA 3APCA 4IM2A 1FPYA 2ZCBA 3AN1A 5E6PA 2SAKA 2PE9A 4MGIE 1WGYA 4ANVA 4RH6A 4PS7A 1VR9A 3VDZA 5HKHA 1TIFA 4W9LA 1HEZE 5L95C 1IBXA 4C80A 1E9MA 1TS5A 2K8HA 1FIQA
chains in the Genus database with same CATH topology
3ZYYX 1MPEA 3AM9A 4TQ0A 1V1OA 3FILB 4KGSA 2QEJC 4LK0M 1T6BX 2I2YA 3TEYA 2N9LA 1L4DB 2NTTA 2OHFA 2JYEA 2L1AA 2FBWB 3BZDB 4HROA 1FFVA 3NVVA 5C3JB 1KLUD 1C77A 3BVMA 4FXCA 5H8YE 4US9A 2Q5WD 4L23A 4A55A 4DQOC 4A6QA 1DOYA 1CZPA 3PZ8A 2CU3A 1QOBA 1TKYA 2E6XA 2LHDA 1FRDA 1QILA 2W3SA 3DWGC 2JYTA 4N58A 1OQRA 1VZ8A 3MJ5A 5AUIA 3BYYB 2VZKB 2K0PA 3EA6A 3Q69A 2W82A 1HZ6A 1J7BA 2JX5A 1D4BA 2Y5CA 4YTNB 1STEA 1AN8A 2KQ4X 1L0XB 1GB1A 1PDXA 3FC4A 4ZHOA 4MH8A 1JWSD 4C7ZA 3SFDB 1XCTL 2LHEA 4YSXB 5MPOA 2DBYA 1TY0A 2WXQA 1ROEA 4LLGM 4RF0A 1C76A 2ACZB 2ON8A 4KGTA 3W2DA 1L4ZB 5G5GA 3IT4B 1YMHE 1BUIC 2DWQA 3AE8B 3AE4B 1E6EB 3GP7A 1FCCC 5I4DA 2Y3AA 4USAA 3MFGA 1TYGB 2SEBD 3P4RB 4J3OD 2WXNA 1YN3A 1OQQA 1RFKA 1TS4A 1GOZA 4YT0B 1QQRA 2WXPA 1DYQA 1SJED 5AUKA 4Q2JA 1ZXIA 2AQ1B 4XWWA 3NVZA 1P7EA 1JALA 3W9CB 2JZPA 4KGRA 1XO3A 3W5UB 2W54A 3GB1A 3URYA 4REZA 4H2AA 3I9V1 3PZ7A 1IBXB 1I4HA 1B9RA 1L6VA 4XDCA 5HFYA 1RWSA 3Q8FA 2JXTA 3TUOA 1BXTA 1L5PA 1MI0A 1HXYD 5HG2A 4C56C 3AEGB 5H92C 2BTEA 1MHHE 3E56A 5HHDG 2L52A 1EU3A 4HKQA 1WSPA 1B1ZA 1PYWD 1R7SA 2GI9A 2HDEA 2M0AA 2WXMA 4L1BA 3Q8CA 2HTME 3IT6B 1T3QA 2L83A 2DYOA 2Y5PA 1ET6A 1T5XD 2D5GA 4LTUA 3NRZA 2WS3B 1WWTA 3RFZB 3HVDA 4KKJA 2PKOA 3SFEB 4EE2A 2PTLA 2QSDA 3AEEB 1QOFA 3LXFA 2MJEA 4A9AA 3VRBB 2V3PA 1SSNA 3EGRA 2KDMA 4DXFA 1I7HA 3I57A 4JX1C 3KLSX 1HQRD 2G9HD 1FCLA 1JMLA 2H89B 1FM0D 1IGDA 2R61A 4L2YA 3TEWA 4US8A 4NZLB 2IPKD 1HZ5A 1NENB 3IAS1 2EKIA 2N9KA 5E6JA 3ZGZA 1QOGA 1ZE3D 3U7ZA 2B76B 3HRDD 4PT5A 3SR6A 1ZOYB 1I4GA 1ZP0B 1SE3A 2K5PA 4WIPA 4YTPB 3U4EG 1AWDA 2BS3B 3GS2A 2L32A 1FXAA 4ARCA 2DYMA 2WXHA 2IGHA 3P1MA 2K22A 2MEKA 1YN5A 4RNAA 4XE0A 1SB3C 4OW0A 2J52A 3V05A 2QILA 3NVYA 4WURA 2IDYA 2BYTA 1P7FA 1DOXA 1DGJA 1KTKA 1L6UA 2W55A 1JWBD 2N0SB 2MJ3A 3AE7B 2K9XA 1YNTE 4ZRPA 1YQ4B 1ZUD2 3RPFC 2RMMA 1JCKB 3MHZA 4ZYSA 5D7GA 4KKIA 2FE8A 1EWCA 3SEBA 3WCQA 1MHXA 4MT5A 1XLPA 2J53A 4ARIA 3U2SC 1YJJA 1UGJA 1OFFA 3Q8AA 1ZDVA 2V3NA 4A8XC 2BT6A 1KRHA 1VJKA 2PW9A 3BIID 2LMCA 4NJCA 1IUEA 2WXRA 1UWXA 3TSSA 1V1PA 4GLSC 1YN4A 2LUMA 5HI1A 3T3OA 3BWUD 4RF1A 1WYGA 3KWVA 5EE0A 1DOIA 1CJEA 3Q8EA 3O13A 3W1SA 2V4IB 5FR3A 1TY2A 2LFIA 3N9YC 1FMAD 3V3XA 3MP9A 1F77A 4R3DA 1ESFA 2AQ2B 1XLNA 3H8HA 3R2TA 2W3RA 5BMGA 1J7AA 2PVOD 1QKZA 2CJNA 1F0ZA 2JWUA 2ICIA 3AE2B 3DWMA 4YSZB 1SJHD 2QMTA 4HJGE 4C7YA 1NVID 2MH7A 2MJDA 1V97A 2LGIA 1SXTA 3VQIA 3VRAB 2WDVB 5FKAC 4WQMA 2BB5A 1IGCA 4OVZA 4HRSA 2KAJA 2ZW0A 5BYQA 1L0VB 2IGGA 1I4PA 2OEDA 3AE6B 3NS1A 3CIRB 2VZKD 1TJEA 1QLBB 1N5XA 1XLQA 4UDUC 1WXQA 4ITKA 1D5XC 4TMAB 3AE5B 1RM6C 3AEBB 1C4CA 2WU5B 5BYSA 4YSYB 1ZXHA 1SF0A 3TEXA 2H88B 1ZPSA 3R2IA 2INNE 1FRRA 4RGTA 1D6EC 3U52E 2WDRB 3P4PB 2BS4B 3B2FA 4WWMA 2IGDA 1E10A 2TSSA 1FD6A 4DXGA 1PGBA 2GRIA 1F2RC 2NMQA 1XF5L 4HEA1 2IJ0A 2NTSA 1NYRA 4OHJA 2AQ3B 5G5HA 2FUG1 1SIJA 2EELA 3OWEB 4AS1A 1NI3A 3C8YA 1QOAA 1V1PB 4B0MA 4NAWB 2WP9B 4O1NA 1K52A 1FNWA 2WXIA 1I4RA 3BK1A 2I38A 2XN9C 4TQ1A 4XDDA 1KF6B 2YEPF 1BMLC 3NZ3A 2GB1A 2WLBA 1XLOA 5TSSA 2AX5A 3KQ4A 1Y56A 4JPSA 3BK2A 1PFDA 1XCQL 2KN4A 4OZCA 1NYQA 1CK1A 4WH4A 3ABVB 1AYFA 5D3DA 5D3IB 2DLBA 2KWDA 4ZOHC 2ONQA 3AEFB 1QT9A 3P63A 1ENFA 2PLPA 3J9CA 3R8BA 1N62A 1C4PA 1V8CA 3CWIA 3AE3B 4RGMA 1GAQB 1C4AA 1JQ4A 1AW7A 5BMIA 1FEHA 3B9JA 1JROA 2BBCA 3HUIA 4AQ7A 1VLBA 4B0EA 4RGNA 1VDVA 4NAMA 5BYRA 1TS2A 1TKEA 1VZ7A 2BW2A 4RFBA 2N7JA 1L0YB 3FAHA 4MM3B 3Q8BA 5EE3A 1JW9D 3IAM1 2LJIA 4WAFA 1KH0A 1D5MC 3AEDB 1GPXA 1MVKA 1UNSA 1SEBD 3VR9B 4GDKB 1N61A 1A70A 2JU6X 1FFUA 4KX6B 1LO5D 3AH7A 3AMZA 1XEEA 1EU4A 2WXKA 3NUHB 1VZ6A 1E0ZA 5LNK1 4P16A 1JWMD 5JXVA 1E7PB 2K3UA 1N5WA 2J42A 4RCOA 2LEKA 4YTMB 4JWSC 4P6VF 1FXIA 1Q10A 4HKZE 1N60A 2WXGA 3KWLA 4IOIE 1YQ3B 3P4SB 1PUTA 5FK9C 2J4XA 1D5ZC 3AB5A 4IDIA 1VRAB 3P42A 3AE9B 1FNUA 3L4PA 3BYTB 2PVGC 2M56B 3ZJTA 1J7CA 2WXOA 4D2KA 4RGOS 2JSVX 1M4VA 4N59A 1N63A 2INPE 2WXFA 1C79A 4YXDB 3AE1B 1FNVA 1I4QA 2RDHA 2ZW1A 1TZOA 4JWUC 2PMVA 2WXJA 3NVWA 1RYJA 1SE2A 1WRIA 3AECB 1C9FA 1TKGA 1YJIA 3T3NA 2CJOA 4OZAA 1ET9A 3FILA 2QJLA 5EE9A 1SE4A 2WU2B 2WQYB 1ACCA 2JQRB 2RPVA 3AV8A 4A90A 3VR8B 1EWYC 1PGAA 1UUPA 2V0GA 4N6EB 1WGKA 2YEPB 3EUB2 2WXLA 1UWMA 1F2RI 1K50A 1CQVA 2KMMA 1KLGD 2BS2B 3BVGA 2M19A 3LB8C 5BMHA 3ZJVA 4CQNA 5T8IA 1SBBB 1JWAD 5EE1A 2KACA 1ZDXA 1K51A 3LYYA 1EM7A 4ZRQA 1QF6A 1XXGA 2WDQB 1TS3A 2WNMA 3AEAB 3E9SA 1C78A 1HA5A 2RDGA 3HVZA 4MACA 1GB4A 1FO4A 2G1EA 5GXGB 2XNAC 2E3TA 4GDLB 1KFYB 1NEKB 4XWTA 4JE3B 3ETRA 1K53A 4ZHPA 3PO0A 2PIAA 2QIEB 4IKGA 2X38A 1JRPA 4OZBA 1I4XA 3AN1A 1JWUD 2SAKA 4RH6A 3P4QB 3UI3A 1VR9A 2Z8LA 4TSSA 3B2GA 4M0WA 3ZQ4A 3TEZA 3W5VB 3MC0B 3IXSA 1HEZE 1IBXA 4C80A 4YWGG 1E9MA 1PGXA 1TS5A 3ZJUA 3BVZA 5C2TB 2BB6A 1FIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYY X;  4C7Y A;  1NVI D;  2MH7 A;  3AM9 A;  2LEK A;  1V97 A;  2MJD A;  3VRA B;  1T3Q A;  2WDV B;  2L83 A;  4WQM A;  4YTM B;  4JWS C;  4LTU A;  4P6V F;  4HRS A;  3NRZ A;  2KAJ A;  1FXI A;  1WWT A;  2WS3 B;  2OHF A;  1L0V B;  2PKO A;  3SFE B;  1N60 A;  3AE6 B;  3NS1 A;  3CIR B;  2FBW B;  3KWL A;  1TJE A;  1YQ3 B;  3P4S B;  1QLB B;  1PUT A;  1N5X A;  3AEE B;  1FFV A;  1QOF A;  1XLQ A;  2MJE A;  3LXF A;  4HRO A;  3VRB B;  4A9A A;  3NVV A;  1I7H A;  3AB5 A;  5C3J B;  4JX1 C;  4IDI A;  1WXQ A;  3AE9 B;  4ITK A;  3L4P A;  4FXC A;  2PVG C;  2M56 B;  5H8Y E;  4US9 A;  1J7C A;  3AE5 B;  1RM6 C;  1FM0 D;  2H89 B;  2Q5W D;  2WU5 B;  3AEB B;  4N59 A;  4YSY B;  1N63 A;  1SF0 A;  1CZP A;  2CU3 A;  1QOB A;  2H88 B;  1TKY A;  4YXD B;  3AE1 B;  4US8 A;  1FRR A;  1FRD A;  1NEN B;  2W3S A;  2EKI A;  3DWG C;  2WDR B;  3P4P B;  1QOG A;  2BS4 B;  3B2F A;  4N58 A;  4WWM A;  1E10 A;  4JWU C;  1OQR A;  2B76 B;  3HRD D;  3NVW A;  3SR6 A;  5AUI A;  1RYJ A;  1ZP0 B;  1ZOY B;  2K5P A;  1WRI A;  4YTP B;  1NYR A;  3AEC B;  5G5H A;  1TKG A;  1YJI A;  1J7B A;  2CJO A;  1AWD A;  1SIJ A;  2BS3 B;  2JX5 A;  2Y5C A;  4YTN B;  1FXA A;  1NI3 A;  1QOA A;  2QJL A;  2WP9 B;  5EE9 A;  1PDX A;  3FC4 A;  3P1M A;  2K22 A;  4ZHO A;  2WU2 B;  2WQY B;  2JQR B;  3AV8 A;  4C7Z A;  1SB3 C;  3VR8 B;  1EWY C;  3SFD B;  4YSX B;  5MPO A;  4N6E B;  3NVY A;  2DBY A;  1KF6 B;  1WGK A;  1DOX A;  3EUB 2;  1ROE A;  1DGJ A;  1L6U A;  2W55 A;  1JWB D;  2ACZ B;  2N0S B;  2MJ3 A;  3AE7 B;  2WLB A;  1XLO A;  1DOY A;  1UWM A;  2AX5 A;  5G5G A;  2K9X A;  2KMM A;  2BS2 B;  2DWQ A;  2M19 A;  3AE8 B;  3LB8 C;  1PFD A;  3AE4 B;  1E6E B;  1NYQ A;  1YQ4 B;  1ZUD 2;  3RPF C;  1JWA D;  3ABV B;  4USA A;  5EE1 A;  1AYF A;  1TYG B;  3P4R B;  4ZOH C;  3AEF B;  1OQQ A;  1QT9 A;  3P63 A;  1QF6 A;  2WDQ B;  3WCQ A;  3AEA B;  1RFK A;  4YT0 B;  1XLP A;  1N62 A;  1V8C A;  3CWI A;  1YJJ A;  3AE3 B;  3HVZ A;  1GAQ B;  1OFF A;  1FO4 A;  5AUK A;  2G1E A;  5GXG B;  1ZXI A;  1JQ4 A;  2E3T A;  2BT6 A;  1KRH A;  1KFY B;  1VJK A;  1NEK B;  3B9J A;  1JRO A;  3BII D;  3HUI A;  3ETR A;  1IUE A;  3NVZ A;  4ZHP A;  1VLB A;  3PO0 A;  2PIA A;  1VDV A;  1JAL A;  2QIE B;  3W9C B;  1JRP A;  1XO3 A;  1TKE A;  1WYG A;  5EE0 A;  3W5U B;  1DOI A;  2W54 A;  3AN1 A;  1CJE A;  3FAH A;  5EE3 A;  1JW9 D;  3P4Q B;  1FMA D;  3AED B;  1L6V A;  1B9R A;  1GPX A;  1RWS A;  3VR9 B;  3DWM A;  1N61 A;  1A70 A;  1FFU A;  3B2G A;  1L5P A;  1XLN A;  3W5V B;  4KX6 B;  2W3R A;  3AH7 A;  1J7A A;  2PVO D;  3AEG B;  5H92 C;  3AMZ A;  4C80 A;  2CJN A;  1E9M A;  2L52 A;  1E0Z A;  1F0Z A;  1R7S A;  3AE2 B;  5C2T B;  2HTM E;  1E7P B;  1N5W A;  1FIQ A;  4YSZ B; 
#chains in the Genus database with same CATH topology
 3ZYY X;  3FIL B;  2DZK A;  4K7S A;  2QCZ A;  2LVQ A;  3DBL B;  1Z5S B;  1RRB A;  4HRO A;  4C4V A;  3BVM A;  5H8Y E;  3N20 C;  3PPA A;  3MJW A;  1QOB A;  1TKY A;  2G4S A;  3DWG C;  1E5W A;  2OJR A;  3CMM B;  1UGM A;  4ICV A;  2K0P A;  3Q69 A;  1HZ6 A;  1J7B A;  2JX5 A;  3QK0 A;  2K6D B;  3DDC B;  3H7P A;  4ZHO A;  3FC4 A;  4MH8 A;  4DDI D;  2FCM A;  4C7Z A;  4HCN B;  3SFD B;  2LHE A;  1YIW A;  1LGR A;  4MJS A;  3I63 C;  3W2D A;  1L4Z B;  2M8S A;  1BUI C;  1E6E B;  2D3G A;  3P4R B;  3IVF A;  3QIJ A;  4BVU C;  1WX8 A;  1TS4 A;  1GOZ A;  1S1Q B;  4BAX A;  4HK2 A;  2WXP A;  1SJE D;  3PRM B;  1BT0 A;  2I1J A;  1J19 A;  3V6E B;  4FLH A;  1JAL A;  2JZP A;  3L17 A;  3T9L A;  5LLI A;  2IO2 B;  1C3T A;  4RM8 A;  3GB1 A;  2BKF A;  4H2A A;  3PZ7 A;  5C23 A;  2N9X A;  1P0R A;  3TUO A;  1L5P A;  4C56 C;  3CF6 E;  4WJN A;  4NY0 A;  5H92 C;  3ZNI D;  2N4F A;  2BWF A;  3ZXR A;  4HKQ A;  1B1Z A;  1L7Y A;  1PYW D;  2HDE A;  4KDI C;  2M0A A;  2HTM E;  4DDG D;  3TJP A;  4LTU A;  1ET6 A;  1T5X D;  2D5G A;  3K9P B;  1WWT A;  4EE2 A;  3SFE B;  5AEK B;  2R2O A;  3VRB B;  4WQO B;  4ICU A;  1JML A;  2LRU A;  1WF9 A;  4JGH B;  4KSL C;  4NZL B;  3DPD A;  4ANW A;  4LCD E;  4IWP A;  2WWZ A;  3U7Z A;  3ZIM A;  1ZOY B;  1UBQ A;  3QQ8 B;  4YTP B;  3U4E G;  3GS2 A;  2L32 A;  2IGH A;  2FAZ A;  3DOW A;  4RNA A;  1SB3 C;  4OW0 A;  4B9K A;  3TL5 A;  2BYT A;  1P7F A;  3A1Q B;  3H9D A;  3NZS A;  2KTR B;  4FN2 A;  2K9X A;  3N1Z C;  1V6E A;  2N1W A;  1YQ4 B;  1JCK B;  1GC7 A;  2KDE B;  4WJP A;  1EWC A;  3ZNG C;  3WCQ A;  2O2V A;  2KMC A;  1WZ3 A;  1UGJ A;  4WJQ A;  2V3N A;  4A8X C;  3BII D;  4BBN F;  2K8B A;  1UWX A;  4GLS C;  3K9O B;  3BWU D;  3Q8E A;  2V4I B;  4LNF A;  4MDK E;  4KIK A;  2LZ6 A;  2MBO A;  1ESF A;  4EZJ A;  3ZUN A;  3H8H A;  3R2T A;  3WAM A;  4WWP A;  1J7A A;  2PVO D;  4N9F 4;  1F0Z A;  1UBI A;  1Q1O A;  3N3K B;  2EMS A;  3ALB A;  3QA8 A;  4FJZ A;  4G11 A;  1V97 A;  4A3O A;  2BB5 A;  4HRS A;  2KAJ A;  5BYQ A;  4XC2 A;  1I4P A;  3AE6 B;  3RUL A;  3CIR B;  2M4N A;  2L00 B;  1QLB B;  4IC7 B;  4QAY A;  4IM0 A;  4BBN C;  3TEX A;  2INN E;  2KDB A;  4RGT A;  1D6E C;  1XD3 B;  2WDR B;  4A20 A;  2JVC A;  2BS4 B;  2GMI C;  2IGD A;  1E10 A;  1V86 A;  1FD6 A;  4DXG A;  1PGB A;  2JY6 A;  2IJ0 A;  2NTS A;  1NYR A;  4J6I A;  2BPS A;  1SIJ A;  2AL3 A;  2BYV E;  2JPH A;  4NAW B;  1Z2M A;  2VRR B;  4O1N A;  1K52 A;  3RT3 B;  2WXI A;  2LI5 A;  4II3 B;  2WGS A;  2KK8 A;  2GB1 A;  4B6W A;  1XLO A;  1Y56 A;  3Q3M C;  1EF1 A;  3BK2 A;  1PFD A;  2CKH B;  5D3I B;  2KWD A;  3FKY A;  1WRD B;  2PLP A;  3A9J B;  5DPS A;  3CWI A;  1LFD A;  3RMK C;  1GAQ B;  3RUI B;  4NJ6 A;  2KC1 A;  2NR2 A;  1JRO A;  3HUI A;  4AQ7 A;  4NAM A;  1YQB A;  1TS2 A;  2LGS A;  4JL9 A;  2L3Z A;  3Q8B A;  2LJI A;  2MX2 A;  1D5M C;  1MVK A;  3UIO B;  1N61 A;  3M3J A;  1FFU A;  1T0Q C;  3AMZ A;  2WXK A;  3NUH B;  1E0Z A;  1JWM D;  4W9H A;  3UF8 A;  2J42 A;  2J0J A;  4HPP A;  2LEK A;  4AJW A;  3RNE C;  2B3A A;  1K8R B;  4PK1 A;  4PS3 A;  4YTM B;  1Q10 A;  2RPQ A;  3KWL A;  1WJ4 A;  2KLG A;  2WX1 A;  4W9D A;  3P42 A;  3L4P A;  5J18 A;  4BOZ B;  1J7C A;  3NY5 A;  2WXO A;  1SE9 A;  1UD7 A;  1N63 A;  2V9H A;  4YXD B;  1FNV A;  1I4Q A;  4G3X B;  3APD A;  4MSM B;  2DAF A;  3U8Z A;  1RYJ A;  1SE2 A;  3QCA A;  1ET9 A;  3FIL A;  4BKS A;  3OAW A;  4LJP B;  4IW0 A;  5AZG A;  1E8X A;  1YX5 B;  2RPV A;  2ZVO A;  3VR8 B;  3V60 A;  1PGA A;  3DBR I;  2V0G A;  4W9K A;  2ZPN A;  2YEP B;  2V3S A;  2KMM A;  2MP2 A;  1KLG D;  3C19 A;  4W9I A;  1SBB B;  1V5O A;  3HHM A;  1QF6 A;  1WMH A;  2ZVN A;  3AEA B;  2RDG A;  4MAC A;  1FO4 A;  2G1E A;  4GDL B;  1WJN A;  4ZHP A;  4KIK B;  2KFK A;  5FR6 A;  3PVL A;  1C1Y B;  1JWU D;  2O6V B;  4AWJ A;  3DVG X;  3B2G A;  4KV2 A;  4M0W A;  3W5V B;  3MC0 B;  3AU4 A;  1TT5 B;  4YWG G;  2KLC A;  2LXC A;  4ASW C;  1ZKH A;  3BVZ A;  4IG7 B;  2BB6 A;  3AUL A;  4EUT A;  2M1M A;  3M62 B;  4LNN A;  4WJO A;  3ML9 A;  2QEJ C;  1KLV A;  1T6B X;  2C9W B;  2FCN A;  1L4D B;  1WM2 A;  3SU8 X;  1V80 A;  1LM8 B;  1V81 A;  2LXA A;  2Q5W D;  4A55 A;  2FIF A;  4W9F A;  2E6X A;  1WXV A;  1OGW A;  2W3S A;  4DBG A;  2NS5 A;  2ZZP B;  2JZ3 B;  1VZ8 A;  3I5J C;  3BYY B;  2Y5C A;  4AOF A;  3N1X C;  1STE A;  1AN8 A;  2IYD B;  1GB1 A;  3ZVV A;  3KUD B;  3RNB C;  4GU2 A;  5LXI B;  3T8M A;  4OVV A;  4RF0 A;  1C76 A;  2ACZ B;  1IPG A;  5G5G A;  3GE8 C;  1TZ1 A;  3IT4 B;  4DHJ D;  2LWP A;  4ZRK A;  1YMH E;  2REX A;  4GB9 A;  2I1K A;  3M63 B;  2D3A A;  3Q3J A;  4USA A;  1TYG B;  1V5T A;  2SEB D;  4ZYN A;  1OQQ A;  1WFY A;  1P1A A;  4YT0 B;  4GOC A;  1DYQ A;  4HVB A;  4Q2J A;  1ZXI A;  2QDF A;  1UEL A;  2Y5B B;  3WAO A;  3Q6B A;  5DCN A;  1XO3 A;  5IOI A;  1GNU A;  1ZW7 A;  2W54 A;  2FCQ A;  1E90 A;  1U4A A;  1UF0 A;  4K7W A;  4EZK A;  2IZV B;  4XDC A;  5HFY A;  1HTQ A;  2JXT A;  1BXT A;  2D2Q A;  1EF5 A;  4ZDV A;  2KFJ A;  2L52 A;  1YOV B;  2KWV B;  4HCP B;  3TCA A;  2V1Y A;  3NOB A;  3Q8C A;  1WJ6 A;  2JRH A;  5DPW A;  4HDQ A;  2DYO A;  2Y5P A;  3NRZ A;  3HVD A;  4KKJ A;  2PKO A;  4NNJ B;  2BWE S;  3L10 B;  2JXX A;  2QSD A;  2N9P C;  2KC2 A;  2V3P A;  3EGR A;  2KDM A;  1RFA A;  4JX1 C;  4LDT B;  1HQR D;  1KOT A;  1YD8 U;  2H89 B;  1FM0 D;  3KW5 B;  3I3T B;  3H7S A;  1NEN B;  2EKI A;  3ZGZ A;  5D2M B;  2B76 B;  2GBK A;  1ZP0 B;  3MTN B;  3LDZ E;  1SE3 A;  2K5P A;  2IO1 B;  4WIP A;  3ZRC A;  2BS3 B;  3U30 A;  2L05 A;  3P1M A;  2MEK A;  1YN5 A;  5DPT A;  4C00 A;  4XE0 A;  3QWZ B;  3V05 A;  4FHJ A;  1WE7 A;  3VTU A;  3NVY A;  2IDY A;  2D10 A;  2N0S B;  4P1C C;  2L0T A;  4GMV A;  4ZRP A;  3OJ3 A;  3MHZ A;  3AI5 A;  2V4L A;  4NQK E;  3C0R B;  4KKI A;  2FE8 A;  3B0A A;  1NBF C;  4HWI B;  4MT5 A;  2J53 A;  3UIN B;  1ZDV A;  2LGY A;  2MP2 B;  3QJZ A;  2UYZ B;  4NJC A;  1WGR A;  3EEC A;  1IUE A;  3TSS A;  3WA0 A;  2J7Q B;  4K7U A;  5HI1 A;  4BKS D;  1WMH B;  1IP9 A;  1CJE A;  2JT4 B;  3O13 A;  4M8N A;  3IFW B;  5FR3 A;  2LFI A;  3V3X A;  3MP9 A;  2KD0 A;  3A33 B;  1XLN A;  3VXW A;  2C7N B;  1WH3 A;  1QKZ A;  3KUC B;  1SJH D;  2QMT A;  4YSZ B;  1NVI D;  2LGI A;  1SXT A;  5FKA C;  2FID A;  1IGC A;  4OVZ A;  4ANU A;  2WHI A;  2ZW0 A;  1L0V B;  2IGG A;  3N1Y C;  2VZK D;  3PRZ A;  2KTR A;  3SDL C;  1WXQ A;  4EOY A;  1D5X C;  4BFR A;  1RM6 C;  4YSY B;  5CTR C;  4F8C B;  2H88 B;  3R2I A;  3RI7 C;  3GE3 C;  3U52 E;  2UWQ A;  3P4P B;  4WAA A;  1F2R C;  1XF5 L;  2PJH A;  2KT7 A;  1N6Z A;  5G5H A;  4KSK C;  4TKN A;  2EEL A;  3RNA C;  3OWE B;  3A1Q A;  4AS1 A;  1QOA A;  4K1R B;  1AAR A;  2GBR A;  2KMA A;  4FA6 A;  1Q5W B;  2LVO A;  4XDD A;  1KF6 B;  3X23 A;  4YL8 A;  5TSS A;  1WM3 A;  2XK5 A;  3VHT C;  4JPS A;  1GG3 A;  1XCQ L;  2A5U A;  3ZKJ C;  3EFC A;  5D3D A;  2K8C A;  4ZOH C;  1RAX A;  2ONQ A;  4G50 A;  1QT9 A;  3P63 A;  2L76 A;  4B95 A;  3CST A;  3P2B A;  1N62 A;  3AE3 B;  3KVF B;  3PLU A;  2DX5 B;  1C4A A;  2LGX A;  3NS8 A;  4E3C A;  2BBC A;  2BYE A;  1VLB A;  4RGN A;  5BYR A;  4FUL A;  3HIZ A;  1S3S G;  1TKE A;  1VZ7 A;  2BW2 A;  1KM7 A;  1L0Y B;  3FAH A;  2M0X A;  1V2Y A;  1F9J A;  1KH0 A;  4X57 B;  2KVR A;  2AYO B;  3AED B;  2JRI B;  1GPX A;  3RD2 A;  3VR9 B;  1A70 A;  1Y8R C;  4KX6 B;  1LO5 D;  3QHT A;  4IUM B;  3V61 A;  4MEL A;  5LNK 1;  1WI0 A;  4JIO U;  3HM6 X;  4RCO A;  2IO0 B;  4F7Z A;  4EZL A;  4NAW A;  3RNG C;  2C7H A;  4JWS C;  4P6V F;  1GUA B;  1FXI A;  4RMA A;  1E8W A;  3JSV A;  2C5L C;  2WXG A;  3DHG C;  2J4X A;  1D5Z C;  4FJV B;  3AB5 A;  4IDI A;  4W9C A;  3RN9 C;  1FNU A;  2PVG C;  1VCB A;  1YJ1 A;  2BGF A;  3L54 A;  3U7D A;  4D2K A;  4N59 A;  1WGH A;  1T0R C;  2INP E;  2WXF A;  4WWO A;  2ZW1 A;  4FJY A;  1TZO A;  2BF8 B;  3EFU A;  2L0F A;  2Z0E B;  2WXJ A;  4JLC A;  3MC8 A;  2JUO A;  1WRI A;  2D3C A;  3AEC B;  1C9F A;  1TKG A;  1YJI A;  2CJO A;  4OZA A;  2UU7 A;  3W1S C;  5IAA C;  2JQR B;  3AU5 A;  1P98 A;  4DWF A;  2KJR A;  3APF A;  2O6V D;  1F2R I;  4RM9 A;  3QC8 B;  3BVG A;  4CQN A;  1JWA D;  5EE1 A;  1K51 A;  3LYY A;  3ZXV A;  1EM7 A;  2WDQ B;  2KNB A;  3E9S A;  1C78 A;  4XX5 A;  3JSV B;  2FUH B;  3PRP B;  4JE3 B;  2W9N A;  3H7P B;  4E71 A;  2QIE B;  3O65 B;  3V62 A;  2MLB A;  1JRP A;  1I4X A;  2KQS A;  1OEY A;  4MJS B;  2NPT A;  3R66 C;  2Z8L A;  4TSS A;  3PTF C;  3ZQ4 A;  2L7R A;  3ECI A;  1A5R A;  3IXS A;  4CO7 A;  5LXH A;  4JQW C;  4MEM A;  2MQJ A;  3ZJU A;  5C2T B;  2KJH B;  1MPE A;  3DQV A;  1V1O A;  4TQ0 A;  2NVU I;  5BO4 B;  2N9L A;  2C7M B;  3A4R A;  2NTT A;  3R7R A;  5IKC M;  3BZD B;  1FFV A;  3HM3 A;  5C3J B;  1C77 A;  3ZDT A;  3VTW A;  4US9 A;  2MW5 A;  3ZNH B;  4L23 A;  1EUV B;  2GOW A;  1LXD A;  4A6Q A;  1CZP A;  3PZ8 A;  3N30 A;  2LHD A;  4ZRI A;  2HE7 A;  2KOX A;  4GDL A;  5IP4 D;  3BY4 B;  5AUI A;  4LNK A;  3EA6 A;  2XBB C;  1T0S C;  2JWZ A;  4HDO A;  5E6N A;  2KQ4 X;  4XZ4 A;  2J0M A;  4AUQ C;  1JWS D;  2DZI A;  4YSX B;  3PGE A;  5MPO A;  2WXQ A;  1WX7 A;  1OQY A;  4LLG M;  2KHW B;  3D32 A;  4PS8 A;  2LAS A;  3AE4 B;  3GP7 A;  3UQA A;  1FCC C;  5I4D A;  2Y3A A;  1J0G A;  1TTN A;  2PE6 B;  2K25 A;  1RFK A;  2KJ6 A;  2MRP A;  1P3Q U;  2QC8 A;  4M8M A;  5AUK A;  1MJD A;  2AQ1 B;  4XWW A;  1FXT B;  5GMV A;  3KYC D;  4AJY B;  4OVU A;  4KGR A;  2NPT B;  1R4M I;  3W5U B;  2D11 A;  4WWN A;  4URK A;  4REZ A;  1IBX B;  1I4H A;  4NJ7 A;  1B9R A;  1L6V A;  1RWS A;  3Q8F A;  3PLV A;  1R4M B;  1HXY D;  4W9G A;  3DBH B;  2MBB B;  3AEG B;  2BTE A;  2NBU A;  1MHH E;  3E56 A;  1EU3 A;  2RSU A;  3N32 A;  2WXM A;  2NBW B;  3PRE A;  4MGK E;  2CR5 A;  1WXA A;  3NJT A;  2L83 A;  1L2N A;  3L0W B;  3R3M A;  2RD0 A;  3RFZ B;  2KTF A;  1I42 A;  3Q3O C;  3LXF A;  1QOF A;  4A9A A;  1J8C A;  4DXF A;  2DZM A;  3KLS X;  2WDT B;  2HTH A;  3QAQ A;  3DHH C;  2RGF A;  2KX3 A;  1IGD A;  2R61 A;  4W9E A;  2KDI A;  2KDF B;  3IAS 1;  3VUW A;  2N9K A;  5E6J A;  2WX0 A;  3HRD D;  4PT5 A;  4KVG B;  2CHX A;  1I4G A;  1M94 A;  3LJ3 A;  1FXA A;  3NHE B;  2CU1 A;  2KO3 A;  4ARC A;  2DYM A;  2K22 A;  2J52 A;  2QIL A;  2IY1 B;  4WUR A;  1DGJ A;  1KTK A;  4HLE A;  2W55 A;  1JWB D;  2MJ3 A;  3AE7 B;  1YNT E;  4FHK A;  3RYT A;  4I6P A;  5G2N A;  2IND C;  3RPF C;  2RMM A;  4ZYS A;  4NPN A;  2KWC A;  3SEB A;  1WR6 E;  1MHX A;  1F52 A;  1XLP A;  3U2S C;  2MHJ A;  2MSE D;  1OFF A;  2DAJ A;  2WYQ A;  2BT6 A;  1VJK A;  1KRH A;  2LD9 A;  5JHA A;  1V1P A;  3CSF A;  4FBJ B;  1WYG A;  3KWV A;  5EE0 A;  1DOI A;  5IO9 A;  1FMA D;  3GOE A;  2XK5 B;  1YX6 B;  2AQ2 B;  1WGD A;  2W3R A;  1SGH A;  1XQQ A;  5KHQ A;  2JWU A;  2ICI A;  2OJW A;  3B08 A;  1E7U A;  3W1Y A;  4HJG E;  2MH7 A;  3VRA B;  2BVC A;  3VQI A;  2BYF A;  2WDV B;  5TR5 A;  4M02 A;  4BKG A;  1H4R A;  2OED A;  3NS1 A;  1XLQ A;  2Z0D B;  1R4N B;  4ITK A;  4TMA B;  3AE5 B;  3AEB B;  2WU5 B;  5BYS A;  1ZXH A;  4GDK A;  1FRR A;  1ZGU B;  2O2V B;  2TSS A;  2GRI A;  2NMQ A;  3EC8 A;  1HE8 A;  4HEA 1;  5AZH A;  2M17 A;  3PV1 A;  2C60 A;  4B0M A;  2OOB B;  2BKR B;  3OLM D;  3BK1 A;  4TQ1 A;  2I38 A;  1WGG A;  2YEP F;  1BML C;  3NZ3 A;  3QAR A;  2KN4 A;  4M01 A;  4MGY E;  4OZC A;  1NYQ A;  1CK1 A;  2KXJ A;  3WAL A;  3ABV B;  3KUZ A;  1AYF A;  2DLB A;  3AEF B;  4GN1 A;  3MHS D;  3DBR B;  5CHF A;  3R8B A;  2GLS A;  4RGM A;  1V49 A;  1JQ4 A;  1GC6 A;  5BMI A;  3B9J A;  4M00 A;  1VDV A;  3PZD A;  3H1U A;  2EKE C;  2N7J A;  5EE3 A;  1I35 A;  4WAF A;  1PQS A;  1UNS A;  4ANX A;  3M95 A;  1RLF A;  3AH7 A;  2KX0 A;  1UZX B;  4GGQ A;  5JXV A;  2NBV B;  1E7P B;  1N5W A;  3ML8 A;  2DHZ A;  2CHZ A;  2JF5 A;  2A4Z A;  1OTR B;  1WE6 A;  2KAN A;  3L08 A;  4BKT A;  4HKZ E;  2X8X X;  5FK9 C;  3DVN V;  2DNF A;  2ZCC A;  3BYT B;  4DHZ B;  2M56 B;  3AXC A;  3Q3N C;  4RGO S;  2JSV X;  4E74 A;  3TMP B;  2RDH A;  2O6V A;  4KZC A;  2PPH A;  2PMV A;  2G45 B;  3NVW A;  4PYZ A;  2IY0 B;  3T3N A;  2VH2 A;  4HJK A;  1VD2 A;  5JZE B;  2AWT A;  2WU2 B;  4A90 A;  1EWY C;  3VH3 B;  3WAN A;  1R4N I;  1WGK A;  2KWU B;  3EUB 2;  2IBI B;  2HJ8 A;  3ZTD A;  1UWM A;  3A9K A;  1K50 A;  2BS2 B;  2MBQ A;  3ZJV A;  2LJ5 A;  2BQQ A;  3NZU A;  2HJ1 A;  4K3C A;  3IBE A;  1XXG A;  1GB4 A;  2N7E A;  3A4S C;  5GXG B;  2XNA C;  2AEH A;  1LQB A;  1NEK B;  3ETR A;  1K53 A;  3RCZ A;  5CHW A;  4IKG A;  2X38 A;  4OZB A;  3OG5 A;  2GBN A;  3P4Q B;  3UI3 A;  2DEN B;  2NCN A;  1X1M A;  3TEZ A;  2D3B A;  2LRW A;  4GIV A;  1PGX A;  3WAP A;  3AM9 A;  4KGS A;  4LK0 M;  2CHW A;  2I2Y A;  3TEY A;  2OHF A;  5J17 A;  2JYE A;  2L1A A;  2FBW B;  3NVV A;  1KLU D;  3GZN I;  1SIF A;  4FXC A;  2YVC A;  4DQO C;  3ZDM C;  4DK5 A;  1DOY A;  2CU3 A;  2ZEQ A;  1FRD A;  1QIL A;  4P1B C;  5E6O A;  1JRU A;  2JYT A;  4K3B A;  4IM3 A;  4N58 A;  4BZA A;  1OQR A;  1MG8 A;  3MJ5 A;  2VZK B;  2W82 A;  1D4B A;  4YTN B;  2KVZ A;  1L0X B;  1PDX A;  3DBH I;  3A9K B;  1XCT L;  1WJU A;  2DBY A;  1TY0 A;  1ROE A;  4EEW A;  4HXD A;  2DZJ A;  2ON8 A;  3DBS A;  4DHZ E;  4KGT A;  3UGB B;  4G0N B;  2DWQ A;  3AE8 B;  1MG4 A;  1UH6 A;  3UIP B;  2R2Q A;  3MFG A;  4MGZ E;  2LGD A;  4J3O D;  2WXN A;  1YN3 A;  3R7Q A;  3VAW A;  2IO3 B;  3UQB A;  3WIM A;  3ZRF A;  1QQR A;  1P9D U;  2K39 A;  2KFK B;  1TBE A;  1H8C A;  4C4V B;  3NVZ A;  1P7E A;  3ZO5 B;  2L8J A;  3BIN A;  5CHV C;  3W9C B;  3ENE A;  4LJO B;  3DVG Y;  2K6Q A;  3URY A;  1GJZ A;  1EO6 A;  3I9V 1;  3PSE B;  1MI0 A;  2PEA A;  5HG2 A;  5DPR A;  3SHQ A;  5HHD G;  2KQ7 A;  1WSP A;  1G6J A;  1WXM A;  1R7S A;  2GI9 A;  4L1B A;  2XEW A;  3IT6 B;  1T3Q A;  4ACF A;  3S2A A;  3X0W A;  5IA7 A;  2LVP A;  1E8Y A;  2WS3 B;  1NDD A;  5G55 A;  2PTL A;  3AEE B;  3DVN U;  2MJE A;  1SSN A;  5JH5 C;  3PHW B;  1I7H A;  3I57 A;  2N1V A;  2ZJD A;  3DHI C;  4FAD A;  2G9H D;  1FCL A;  2MBE A;  2RR9 A;  4L2Y A;  3TEW A;  4II2 B;  4US8 A;  3TIX A;  2IPK D;  4TUU A;  1HZ5 A;  3VUX A;  1QOG A;  1ZE3 D;  3SR6 A;  3EHV A;  3RZF A;  1AWD A;  1WXS A;  4DXA B;  2ZNV B;  3DCG A;  3ZTC A;  2WXH A;  3PS6 A;  2CS4 A;  3L13 A;  3VFK A;  3ZNZ B;  4GXB A;  4K81 A;  4LDT D;  1DOX A;  1L6U A;  2RDB C;  4GSW A;  4LNO A;  2GBM A;  2MCN B;  2J0K A;  2N7D A;  2Z59 B;  4LNI A;  2ZNV C;  3GZN B;  1ZUD 2;  4KDL B;  2MA9 B;  5D7G A;  4XGA B;  2INC C;  4ARI A;  1YJJ A;  2VH1 A;  5C1Z A;  3Q8A A;  1ISN A;  1F1H A;  2PW9 A;  2LMC A;  4MH0 E;  2WXR A;  1YN4 A;  2LUM A;  4P7I A;  3VVW B;  4TV3 A;  3T3O A;  4RF1 A;  3W1S A;  1TY2 A;  3N9Y C;  1MFW A;  5AZF A;  1F77 A;  4R3D A;  3SD5 A;  1D3Z A;  3HK0 A;  4MM3 A;  1XT9 B;  5BMG A;  1V9J A;  2CJN A;  3AE2 B;  3TBL D;  3DWM A;  4S17 A;  4C7Y A;  2MJD A;  2ZPY A;  4A3P A;  3Q14 C;  4WQM A;  4M0W B;  3B1L X;  4BOS C;  3ONS A;  3IHP C;  2FCS A;  1TJE A;  5KHO A;  5L83 A;  1N5X A;  3KH0 A;  4UDU C;  3QX1 A;  2KYW A;  1C4C A;  1IYF A;  2G3Q B;  1SF0 A;  1ZPS A;  3RNC C;  5EDS A;  3B2F A;  4IWQ A;  4WWM A;  3ZLZ A;  4F1S A;  4DHJ B;  4OHJ A;  2AQ3 B;  2FUG 1;  2JZZ A;  3NG0 A;  1NI3 A;  3C8Y A;  1V1P B;  2WP9 B;  1WYW B;  1FNW A;  1I4R A;  2XN9 C;  3IG3 A;  1E8Z A;  1TGZ B;  2WLB A;  2AX5 A;  3KQ4 A;  4WH4 A;  1WX9 A;  2D07 B;  2K1F A;  2GBJ A;  3L16 A;  1OEY J;  1ENF A;  1HTO A;  3J9C A;  2KKC A;  4PYU A;  1V8C A;  1C4P A;  3VTV A;  2MBH A;  1AW7 A;  1FEH A;  3PHX B;  3RNF C;  4B0E A;  4AP4 C;  3JVZ X;  4I6N B;  2QHO A;  4S0R A;  3DBL I;  4RFB A;  4MM3 B;  1JW9 D;  3IAM 1;  1WIA A;  4KZ0 A;  1SEB D;  4GDK B;  3JYU A;  2JU6 X;  3MC9 A;  2KZR A;  3H6N A;  2N9E B;  1XEE A;  1EU4 A;  3Q3F A;  1VZ6 A;  4CYE A;  4P16 A;  2K3U A;  5CX3 A;  3KYD D;  2LUE A;  1WR1 A;  3VUY A;  1NI2 A;  4EFO A;  2MWS B;  1N60 A;  4IOI E;  1YQ3 B;  3P4S B;  4EKU A;  2DYB A;  1PUT A;  2FNJ B;  1T0Y A;  1VRA B;  3AE9 B;  3ZJT A;  2KN5 A;  4W9J A;  3Q2A C;  1CMX B;  1M4V A;  4MSQ B;  5IN7 A;  1C79 A;  4NQL B;  3AE1 B;  4HPL B;  1QZE A;  3A9J A;  4JWU C;  3V6C B;  4I6L B;  1Q0W B;  2YLM A;  4HPM B;  2QJL A;  5EE9 A;  1SE4 A;  5J2R A;  3JW0 X;  2WQY B;  3AV8 A;  1ACC A;  2G4D B;  1UUP A;  1KJT A;  4N6E B;  1E7V A;  2AL6 A;  2WXL A;  5D94 A;  3PT2 B;  1CQV A;  5BMH A;  3LB8 C;  2M19 A;  5T8I A;  2KAC A;  1ZDX A;  4IWO A;  2EMT A;  4ZRQ A;  3ZW3 A;  5JHB A;  1TS3 A;  2WNM A;  2ASQ A;  3OJ4 B;  1HA5 A;  3HVZ A;  4CHK A;  2E3T A;  5D6J B;  1KFY B;  4XWT A;  4XYC A;  2HD5 B;  1WY8 A;  3RZW C;  1WZ0 A;  3PO0 A;  2PIA A;  3VH4 B;  4ZRJ A;  3APC A;  4IM2 A;  1FPY A;  2ZCB A;  3AN1 A;  5E6P A;  2SAK A;  2PE9 A;  4MGI E;  1WGY A;  4ANV A;  4RH6 A;  4PS7 A;  1VR9 A;  3VDZ A;  5HKH A;  1TIF A;  4W9L A;  1HEZ E;  5L95 C;  1IBX A;  4C80 A;  1E9M A;  1TS5 A;  2K8H A;  1FIQ A; 
#chains in the Genus database with same CATH homology
 3ZYY X;  1MPE A;  3AM9 A;  4TQ0 A;  1V1O A;  3FIL B;  4KGS A;  2QEJ C;  4LK0 M;  1T6B X;  2I2Y A;  3TEY A;  2N9L A;  1L4D B;  2NTT A;  2OHF A;  2JYE A;  2L1A A;  2FBW B;  3BZD B;  4HRO A;  1FFV A;  3NVV A;  5C3J B;  1KLU D;  1C77 A;  3BVM A;  4FXC A;  5H8Y E;  4US9 A;  2Q5W D;  4L23 A;  4A55 A;  4DQO C;  4A6Q A;  1DOY A;  1CZP A;  3PZ8 A;  2CU3 A;  1QOB A;  1TKY A;  2E6X A;  2LHD A;  1FRD A;  1QIL A;  2W3S A;  3DWG C;  2JYT A;  4N58 A;  1OQR A;  1VZ8 A;  3MJ5 A;  5AUI A;  3BYY B;  2VZK B;  2K0P A;  3EA6 A;  3Q69 A;  2W82 A;  1HZ6 A;  1J7B A;  2JX5 A;  1D4B A;  2Y5C A;  4YTN B;  1STE A;  1AN8 A;  2KQ4 X;  1L0X B;  1GB1 A;  1PDX A;  3FC4 A;  4ZHO A;  4MH8 A;  1JWS D;  4C7Z A;  3SFD B;  1XCT L;  2LHE A;  4YSX B;  5MPO A;  2DBY A;  1TY0 A;  2WXQ A;  1ROE A;  4LLG M;  4RF0 A;  1C76 A;  2ACZ B;  2ON8 A;  4KGT A;  3W2D A;  1L4Z B;  5G5G A;  3IT4 B;  1YMH E;  1BUI C;  2DWQ A;  3AE8 B;  3AE4 B;  1E6E B;  3GP7 A;  1FCC C;  5I4D A;  2Y3A A;  4USA A;  3MFG A;  1TYG B;  2SEB D;  3P4R B;  4J3O D;  2WXN A;  1YN3 A;  1OQQ A;  1RFK A;  1TS4 A;  1GOZ A;  4YT0 B;  1QQR A;  2WXP A;  1DYQ A;  1SJE D;  5AUK A;  4Q2J A;  1ZXI A;  2AQ1 B;  4XWW A;  3NVZ A;  1P7E A;  1JAL A;  3W9C B;  2JZP A;  4KGR A;  1XO3 A;  3W5U B;  2W54 A;  3GB1 A;  3URY A;  4REZ A;  4H2A A;  3I9V 1;  3PZ7 A;  1IBX B;  1I4H A;  1B9R A;  1L6V A;  4XDC A;  5HFY A;  1RWS A;  3Q8F A;  2JXT A;  3TUO A;  1BXT A;  1L5P A;  1MI0 A;  1HXY D;  5HG2 A;  4C56 C;  3AEG B;  5H92 C;  2BTE A;  1MHH E;  3E56 A;  5HHD G;  2L52 A;  1EU3 A;  4HKQ A;  1WSP A;  1B1Z A;  1PYW D;  1R7S A;  2GI9 A;  2HDE A;  2M0A A;  2WXM A;  4L1B A;  3Q8C A;  2HTM E;  3IT6 B;  1T3Q A;  2L83 A;  2DYO A;  2Y5P A;  1ET6 A;  1T5X D;  2D5G A;  4LTU A;  3NRZ A;  2WS3 B;  1WWT A;  3RFZ B;  3HVD A;  4KKJ A;  2PKO A;  3SFE B;  4EE2 A;  2PTL A;  2QSD A;  3AEE B;  1QOF A;  3LXF A;  2MJE A;  4A9A A;  3VRB B;  2V3P A;  1SSN A;  3EGR A;  2KDM A;  4DXF A;  1I7H A;  3I57 A;  4JX1 C;  3KLS X;  1HQR D;  2G9H D;  1FCL A;  1JML A;  2H89 B;  1FM0 D;  1IGD A;  2R61 A;  4L2Y A;  3TEW A;  4US8 A;  4NZL B;  2IPK D;  1HZ5 A;  1NEN B;  3IAS 1;  2EKI A;  2N9K A;  5E6J A;  3ZGZ A;  1QOG A;  1ZE3 D;  3U7Z A;  2B76 B;  3HRD D;  4PT5 A;  3SR6 A;  1ZOY B;  1I4G A;  1ZP0 B;  1SE3 A;  2K5P A;  4WIP A;  4YTP B;  3U4E G;  1AWD A;  2BS3 B;  3GS2 A;  2L32 A;  1FXA A;  4ARC A;  2DYM A;  2WXH A;  2IGH A;  3P1M A;  2K22 A;  2MEK A;  1YN5 A;  4RNA A;  4XE0 A;  1SB3 C;  4OW0 A;  2J52 A;  3V05 A;  2QIL A;  3NVY A;  4WUR A;  2IDY A;  2BYT A;  1P7F A;  1DOX A;  1DGJ A;  1KTK A;  1L6U A;  2W55 A;  1JWB D;  2N0S B;  2MJ3 A;  3AE7 B;  2K9X A;  1YNT E;  4ZRP A;  1YQ4 B;  1ZUD 2;  3RPF C;  2RMM A;  1JCK B;  3MHZ A;  4ZYS A;  5D7G A;  4KKI A;  2FE8 A;  1EWC A;  3SEB A;  3WCQ A;  1MHX A;  4MT5 A;  1XLP A;  2J53 A;  4ARI A;  3U2S C;  1YJJ A;  1UGJ A;  1OFF A;  3Q8A A;  1ZDV A;  2V3N A;  4A8X C;  2BT6 A;  1KRH A;  1VJK A;  2PW9 A;  3BII D;  2LMC A;  4NJC A;  1IUE A;  2WXR A;  1UWX A;  3TSS A;  1V1P A;  4GLS C;  1YN4 A;  2LUM A;  5HI1 A;  3T3O A;  3BWU D;  4RF1 A;  1WYG A;  3KWV A;  5EE0 A;  1DOI A;  1CJE A;  3Q8E A;  3O13 A;  3W1S A;  2V4I B;  5FR3 A;  1TY2 A;  2LFI A;  3N9Y C;  1FMA D;  3V3X A;  3MP9 A;  1F77 A;  4R3D A;  1ESF A;  2AQ2 B;  1XLN A;  3H8H A;  3R2T A;  2W3R A;  5BMG A;  1J7A A;  2PVO D;  1QKZ A;  2CJN A;  1F0Z A;  2JWU A;  2ICI A;  3AE2 B;  3DWM A;  4YSZ B;  1SJH D;  2QMT A;  4HJG E;  4C7Y A;  1NVI D;  2MH7 A;  2MJD A;  1V97 A;  2LGI A;  1SXT A;  3VQI A;  3VRA B;  2WDV B;  5FKA C;  4WQM A;  2BB5 A;  1IGC A;  4OVZ A;  4HRS A;  2KAJ A;  2ZW0 A;  5BYQ A;  1L0V B;  2IGG A;  1I4P A;  2OED A;  3AE6 B;  3NS1 A;  3CIR B;  2VZK D;  1TJE A;  1QLB B;  1N5X A;  1XLQ A;  4UDU C;  1WXQ A;  4ITK A;  1D5X C;  4TMA B;  3AE5 B;  1RM6 C;  3AEB B;  1C4C A;  2WU5 B;  5BYS A;  4YSY B;  1ZXH A;  1SF0 A;  3TEX A;  2H88 B;  1ZPS A;  3R2I A;  2INN E;  1FRR A;  4RGT A;  1D6E C;  3U52 E;  2WDR B;  3P4P B;  2BS4 B;  3B2F A;  4WWM A;  2IGD A;  1E10 A;  2TSS A;  1FD6 A;  4DXG A;  1PGB A;  2GRI A;  1F2R C;  2NMQ A;  1XF5 L;  4HEA 1;  2IJ0 A;  2NTS A;  1NYR A;  4OHJ A;  2AQ3 B;  5G5H A;  2FUG 1;  1SIJ A;  2EEL A;  3OWE B;  4AS1 A;  1NI3 A;  3C8Y A;  1QOA A;  1V1P B;  4B0M A;  4NAW B;  2WP9 B;  4O1N A;  1K52 A;  1FNW A;  2WXI A;  1I4R A;  3BK1 A;  2I38 A;  2XN9 C;  4TQ1 A;  4XDD A;  1KF6 B;  2YEP F;  1BML C;  3NZ3 A;  2GB1 A;  2WLB A;  1XLO A;  5TSS A;  2AX5 A;  3KQ4 A;  1Y56 A;  4JPS A;  3BK2 A;  1PFD A;  1XCQ L;  2KN4 A;  4OZC A;  1NYQ A;  1CK1 A;  4WH4 A;  3ABV B;  1AYF A;  5D3D A;  5D3I B;  2DLB A;  2KWD A;  4ZOH C;  2ONQ A;  3AEF B;  1QT9 A;  3P63 A;  1ENF A;  2PLP A;  3J9C A;  3R8B A;  1N62 A;  1C4P A;  1V8C A;  3CWI A;  3AE3 B;  4RGM A;  1GAQ B;  1C4A A;  1JQ4 A;  1AW7 A;  5BMI A;  1FEH A;  3B9J A;  1JRO A;  2BBC A;  3HUI A;  4AQ7 A;  1VLB A;  4B0E A;  4RGN A;  1VDV A;  4NAM A;  5BYR A;  1TS2 A;  1TKE A;  1VZ7 A;  2BW2 A;  4RFB A;  2N7J A;  1L0Y B;  3FAH A;  4MM3 B;  3Q8B A;  5EE3 A;  1JW9 D;  3IAM 1;  2LJI A;  4WAF A;  1KH0 A;  1D5M C;  3AED B;  1GPX A;  1MVK A;  1UNS A;  1SEB D;  3VR9 B;  4GDK B;  1N61 A;  1A70 A;  2JU6 X;  1FFU A;  4KX6 B;  1LO5 D;  3AH7 A;  3AMZ A;  1XEE A;  1EU4 A;  2WXK A;  3NUH B;  1VZ6 A;  1E0Z A;  5LNK 1;  4P16 A;  1JWM D;  5JXV A;  1E7P B;  2K3U A;  1N5W A;  2J42 A;  4RCO A;  2LEK A;  4YTM B;  4JWS C;  4P6V F;  1FXI A;  1Q10 A;  4HKZ E;  1N60 A;  2WXG A;  3KWL A;  4IOI E;  1YQ3 B;  3P4S B;  1PUT A;  5FK9 C;  2J4X A;  1D5Z C;  3AB5 A;  4IDI A;  1VRA B;  3P42 A;  3AE9 B;  1FNU A;  3L4P A;  3BYT B;  2PVG C;  2M56 B;  3ZJT A;  1J7C A;  2WXO A;  4D2K A;  4RGO S;  2JSV X;  1M4V A;  4N59 A;  1N63 A;  2INP E;  2WXF A;  1C79 A;  4YXD B;  3AE1 B;  1FNV A;  1I4Q A;  2RDH A;  2ZW1 A;  1TZO A;  4JWU C;  2PMV A;  2WXJ A;  3NVW A;  1RYJ A;  1SE2 A;  1WRI A;  3AEC B;  1C9F A;  1TKG A;  1YJI A;  3T3N A;  2CJO A;  4OZA A;  1ET9 A;  3FIL A;  2QJL A;  5EE9 A;  1SE4 A;  2WU2 B;  2WQY B;  1ACC A;  2JQR B;  2RPV A;  3AV8 A;  4A90 A;  3VR8 B;  1EWY C;  1PGA A;  1UUP A;  2V0G A;  4N6E B;  1WGK A;  2YEP B;  3EUB 2;  2WXL A;  1UWM A;  1F2R I;  1K50 A;  1CQV A;  2KMM A;  1KLG D;  2BS2 B;  3BVG A;  2M19 A;  3LB8 C;  5BMH A;  3ZJV A;  4CQN A;  5T8I A;  1SBB B;  1JWA D;  5EE1 A;  2KAC A;  1ZDX A;  1K51 A;  3LYY A;  1EM7 A;  4ZRQ A;  1QF6 A;  1XXG A;  2WDQ B;  1TS3 A;  2WNM A;  3AEA B;  3E9S A;  1C78 A;  1HA5 A;  2RDG A;  3HVZ A;  4MAC A;  1GB4 A;  1FO4 A;  2G1E A;  5GXG B;  2XNA C;  2E3T A;  4GDL B;  1KFY B;  1NEK B;  4XWT A;  4JE3 B;  3ETR A;  1K53 A;  4ZHP A;  3PO0 A;  2PIA A;  2QIE B;  4IKG A;  2X38 A;  1JRP A;  4OZB A;  1I4X A;  3AN1 A;  1JWU D;  2SAK A;  4RH6 A;  3P4Q B;  3UI3 A;  1VR9 A;  2Z8L A;  4TSS A;  3B2G A;  4M0W A;  3ZQ4 A;  3TEZ A;  3W5V B;  3MC0 B;  3IXS A;  1HEZ E;  1IBX A;  4C80 A;  4YWG G;  1E9M A;  1PGX A;  1TS5 A;  3ZJU A;  3BVZ A;  5C2T B;  2BB6 A;  1FIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...