4HROA

Crystal structure of h. volcanii small archaeal modifier protein 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
87
structure length
87
Chain Sequence
b'GAHMEWKLFADLAEVAGSRTVRVDVDGDATVGDALDALVGAHPALESRVFGDDGELYDHINVLRNGEAAALGEATAAGDELALFPPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small archaeal modifier protein 1
publication title Crystal structure of H. volcanii small archaeal modifier protein 1
rcsb
source organism Haloferax volcanii ds2
molecule tags Protein binding
total genus 24
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4hroA00
1L6VA 2M56B 1DGJA 1XO3A 1N61A 4N59A 1N5WA 2ACZB 3SFDB 4YT0B 1F0ZA 3AEFB 2BT6A 1FXAA 1N63A 1QOGA 1N60A 2FBWB 2WLBA 3FC4A 1I7HA 3BIID 5H92C 2WDVB 3AE6B 1ZXIA 3VRBB 3DWGC 4IDIA 2DBYA 4WWMA 1OQRA 2K9XA 2QIEB 4A9AA 3HVZA 1N5XA 1ROEA 1TYGB 1RM6C 1WYGA 3DWMA 3AB5A 1L0VB 3W9CB 2PVGC 3NVZA 4HRSA 5EE0A 1J7BA 1ZP0B 3ETRA 1DOIA 2G1EA 2WDRB 2WS3B 3SR6A 1FRDA 4JWUC 1TKYA 1QLBB 1JQ4A 3AE5B 2PKOA 3CIRB 1CZPA 1NVID 4YXDB 1FRRA 2WP9B 1E6EB 2Q5WD 1A70A 1JW9D 2K22A 4USAA 3P4SB 4ZOHC 5AUKA 3VR9B 3AE8B 1J7AA 1PFDA 2L52A 5G5GA 2LEKA 4FXCA 2W54A 2KMMA 3LXFA 5EE9A 2CJNA 1V8CA 1FXIA 1FM0D 2H89B 4P6VF 5G5HA 3NVVA 3AEAB 3AEGB 4N6EB 1CJEA 1JROA 3AE2B 3NRZA 5H8YE 2E3TA 1RYJA 4ZHPA 1DOYA 2W55A 1JWBD 3AE3B 3B2GA 2N0SB 3FAHA 1EWYC 2HTME 3B9JA 1IUEA 1B9RA 5EE3A 2WU5B 3AN1A 2BS3B 1VJKA 2H88B 1R7SA 3RPFC 1YJIA 2W3RA 2QJLA 3AEBB 3P4PB 1VDVA 3AMZA 1YQ3B 2AX5A 3NS1A 4N58A 2MJEA 1UWMA 1AWDA 4YTNB 1WGKA 3NVWA 3EUB2 3SFEB 3AEDB 3AV8A 3NVYA 4JX1C 1E0ZA 2OHFA 2WDQB 3L4PA 1FO4A 1KFYB 1N62A 1ZOYB 2M19A 1QT9A 1FFVA 3PO0A 4YTMB 3AE1B 3B2FA 4C7ZA 3VRAB 1FFUA 1GAQB 4WQMA 1DOXA 1E9MA 3P63A 4YSXB 2WQYB 1T3QA 1RWSA 4KX6B 5AUIA 1OQQA 1KRHA 1SIJA 1V97A 2L83A 3VR8B 3W5VB 3LB8C 3P1MA 1PDXA 1NYRA 2JQRB 5EE1A 2CU3A 2W3SA 1TKGA 4HROA 4JWSC 1TJEA 4YTPB 1NYQA 1J7CA 1XLPA 2Y5CA 3KWLA 1AYFA 1PUTA 1QF6A 2K5PA 3P4QB 4US9A 2PVOD 1OFFA 1QOBA 1YJJA 1JALA 2CJOA 3HRDD 3AECB 1E10A 1L6UA 1YQ4B 1WWTA 4C80A 1ZUD2 2BS2B 1NENB 3AEEB 3CWIA 1FIQA 1JRPA 3AM9A 3AE9B 3HUIA 1SF0A 2DWQA 2MJ3A 4YSYB 3AE4B 1TKEA 2BS4B 3W5UB 1XLOA 1FMAD 3ABVB 1XLNA 1WXQA 3ZYYX 1E7PB 3WCQA 5C2TB 1NI3A 1QOFA 5GXGB 5C3JB 5MPOA 4ZHOA 1QOAA 4LTUA 1GPXA 2WU2B 3P4RB 4ITKA 4C7YA 3AE7B 4US8A 2EKIA 2MJDA 4YSZB 1RFKA 2MH7A 1JWAD 1SB3C 1L5PA 1XLQA 3AH7A 1WRIA 2B76B 2KAJA 2JX5A 2PIAA 1VLBA 1NEKB 1KF6B
chains in the Genus database with same CATH superfamily
4W9DA 4WJQA 2KDMA 2HE7A 1FXAA 4LJPB 5C1ZA 2BB5A 2N1VA 3BIID 3UQBA 3DVNV 4DXFA 5HHDG 3MC9A 4HDOA 5IN7A 3AB5A 3PHWB 2KO3A 3T8MA 4TKNA 4IUMB 1DOIA 2W9NA 5CHWA 3QARA 3Q3NC 3UIPB 1KLGD 5E6OA 4F1SA 4WWNA 2E6XA 2Z0DB 4RMAA 3R7RA 4LK0M 1JWUD 1M94A 5E6JA 3AE2B 1C3TA 1H8CA 4MGZE 2FE8A 1EWYC 1ENFA 3JW0X 4O1NA 2KYWA 3E56A 1P7FA 2SEBD 4KGSA 3A4RA 5JH5C 1FFVA 1YIWA 2PPHA 1E9MA 3P63A 3ECIA 2TSSA 3O13A 3UI3A 1SIJA 3P1MA 3C19A 1GC7A 4WQOB 3W1YA 2K5PA 4HLEA 2IBIB 3B0AA 1QOBA 1Q1OA 2OJWA 1WWTA 3A9JB 1OEYJ 4B95A 2CHWA 3WANA 1YMHE 1YQBA 2WXGA 1VD2A 4DHJB 1UBIA 4RM8A 3WCQA 4GDLB 4BFRA 2ICIA 4LDTB 2D2QA 3ZRFA 1D5MC 3MFGA 1L5PA 3AH7A 4NAWA 1GB4A 4EE2A 5G2NA 1L6VA 2CS4A 2J0KA 3PTFC 2L1AA 3ZIMA 2N9LA 3AU4A 3X23A 2R2OA 2FBWB 3GOEA 5H92C 4WJNA 1KLVA 2FNJB 5BO4B 1TZOA 2DBYA 4IDIA 1EM7A 3K9OB 3TUOA 2GBNA 1V6EA 2IO3B 1FNUA 4LCDE 4TV3A 5EE0A 4MM3A 2JRIB 1ZP0B 3VXWA 2PE6B 1S3SG 1WJ4A 1I4HA 4MJSB 3MJ5A 1WXSA 2CHZA 1VZ6A 1TS3A 4KKIA 4W9HA 3IFWB 1FM0D 3ML8A 3BK1A 3HIZA 1V81A 2LJ5A 2EKEC 3R3MA 2HTME 3EA6A 2MBQA 1R7SA 3RPFC 4C4VA 2RSUA 2O6VA 1SJHD 1VDVA 2LD9A 3K9PB 2QEJC 4N58A 1SE4A 4JX1C 1PGAA 4RNAA 2CR5A 1HEZE 5BMIA 3RZWC 2BF8B 2WHIA 4AUQC 2L83A 4GDKA 1IBXA 2C60A 3DBRI 3AXCA 1TS5A 4OVUA 1PUTA 1QF6A 4PYZA 1PGBA 3AECB 4II3B 4BOZB 3AM9A 4KGRA 5JXVA 4RGMA 2KLCA 4FBJB 1WX9A 2KWUB 2D5GA 2NTSA 2AL6A 1E7PB 3TSSA 1T0YA 1I4QA 1V1PA 4C7YA 3TIXA 3KVFB 2V4IB 2MJDA 2LVPA 4EZLA 3IBEA 1DYQA 2WWZA 2ZPYA 4WJOA 4K1RB 4EFOA 1P0RA 3KH0A 3SFDB 4NY0A 3JSVB 2WDTB 2IGHA 4AP4C 1L2NA 4JE3B 3C0RB 1GOZA 1MVKA 4TQ1A 3SD5A 1KM7A 4HRSA 3ZJUA 1JQ4A 1QLBB 2INPE 1GNUA 2JYTA 4USAA 2J0JA 2K22A 1UZXB 2MWSB 1QKZA 1TGZB 3AE8B 2JWZA 2KHWB 1E8YA 4GSWA 4XDCA 4DBGA 3ZXVA 2ZVNA 1WR6E 5CHVC 3QC8B 4KSKC 4FJZA 3ZDMC 2DZKA 3ZNGC 5BYRA 2X8XX 1JWBD 2KWVB 3BINA 3ZDTA 3VFKA 4FJVB 3NS8A 3Q6BA 2V0GA 1X1MA 4IWQA 3NVWA 3SFEB 1PYWD 3GP7A 4YTMB 3B1LX 1FXTB 3GB1A 5J2RA 4OVVA 2GBMA 2I1KA 4NQLB 4LNNA 5J17A 2W3SA 4F8CB 2M0XA 2MBHA 5LLIA 1C9FA 3DBLI 3ZXRA 1JRPA 2BBCA 2MW5A 2ZNVC 2BS4B 1YNTE 3KUDB 2ZEQA 3ZUNA 3NUHB 2IO2B 1VR9A 1H4RA 3QCAA 2J42A 2FIFA 2LGIA 2QC8A 2PIAA 4OHJA 4EKUA 3M63B 1YD8U 3QJZA 3PV1A 5D7GA 1F2RI 4YT0B 3GE8C 2O2VB 4NJCA 3AE6B 1FCLA 3ML9A 3TJPA 2DZMA 4KDIC 1XEEA 1EO6A 1WYGA 2QMTA 2I2YA 1J7BA 2KLGA 1TKYA 2AQ3B 2GOWA 1OQYA 1Q10A 2JPHA 2Q5WD 4QAYA 2IO1B 4GXBA 2KN4A 1R4MI 3TCAA 1IYFA 2VH2A 3VAWA 3BYTB 1V8CA 2GMIC 4IM0A 5FK9C 3OG5A 1J19A 2RDBC 1RYJA 2J4XA 1VLBA 2DZJA 5IO9A 3ZGZA 3AE3B 3ENEA 3VH3B 2BS3B 2C5LC 5LXIB 1MG4A 4L23A 2AX5A 1UWMA 2K25A 2WX1A 2J7QB 3FILB 3PO0A 2L3ZA 3L0WB 3ZNHB 2RPVA 1UGJA 3VRAB 1HZ5A 3LDZE 1OEYA 3VHTC 2ZVOA 2K6QA 3IT6B 1WM2A 2M17A 3N1ZC 1JALA 2WXPA 3M3JA 4XWWA 1YQ4B 4A55A 2DWQA 2YEPF 3AULA 2GLSA 4JLCA 2QILA 1PGXA 1P98A 3ZYYX 4W9EA 1QOAA 4KDLB 3TBLD 2WXNA 4HPPA 4KKJA 1KTKA 3QIJA 1XLQA 4MGIE 2LMCA 2WXJA 4P16A 1C1YB 1KF6B 4IM3A 1CMXB 3ZTCA 4HK2A 4KIKA 2AWTA 4ZYSA 3VUWA 2WDVB 2LVQA 3APCA 2BB6A 1EF1A 2PLPA 3R2TA 3BZDB 1WXVA 3W9CB 1R4NB 2EELA 3PPAA 3HHMA 2L00B 2WDRB 2MHJA 2BPSA 2N7EA 1FO4A 2KJRA 2LEKA 2C7HA 3J9CA 2DYBA 4K7UA 4K3CA 3OWEB 4BBNC 1ET6A 4UDUC 2JSVX 3MC0B 3Q8AA 1T0QC 5TR5A 1B9RA 2ASQA 2RR9A 1YQ3B 3H8HA 2HJ8A 3QK0A 3IG3A 2K39A 1KFYB 2WXIA 4HDQA 3AE1B 5DPSA 4C7ZA 2DYMA 5FKAC 1I4PA 3QX1A 2WQYB 4PS3A 2DLBA 3UF8A 2NPTA 5IAAC 2Y5CA 3N30A 4H2AA 2RGFA 3D32A 2Z59B 1MI0A 2K8CA 1IGCA 3QAQA 4W9IA 3L16A 2YVCA 4KGTA 1WXQA 5MPOA 2MA9B 1FPYA 3RNAC 4E74A 2J52A 4YSZB 3W1SC 1C4AA 4BKSD 5D2MB 3TEYA 2PJHA 1G6JA 3MHZA 3NY5A 3QWZB 5AZFA 5GMVA 4WURA 1FEHA 4MGYE 4FJYA 1T5XD 4B9KA 2L0TA 1E7VA 1FD6A 4IM2A 1K8RB 3ZJVA 1CZPA 4OW0A 3DBRB 1TS4A 1A70A 1EUVB 4LNKA 3VR9B 1WY8A 5G5GA 2IJ0A 2GBJA 2DENB 4GIVA 2C7MB 2CJNA 2FCSA 3AEAB 2JXTA 2D07B 2AEHA 5EE3A 3ZO5B 4F7ZA 1YJIA 1PQSA 5JHAA 2WXQA 1XCTL 1WRDB 4ZRIA 4ANUA 1TY0A 3N20C 1FFUA 1TZ1A 1RWSA 5AUIA 1UF0A 5HFYA 3VR8B 3LB8C 1PDXA 1AARA 1WFYA 2JWUA 3VH4B 3MHSD 1TY2A 4DQOC 1J7CA 4US9A 3HRDD 2KFKA 5BMGA 1NDDA 4NAWB 4LJOB 3X0WA 3PLVA 4P1CC 2ONQA 3W5UB 3SDLC 1R4NI 2LGXA 4REZA 1MHXA 4LTUA 2KMCA 2FAZA 3VTWA 2MQJA 2MRPA 4G3XB 2KK8A 2KDBA 3SHQA 4MM3B 4AJYB 1D4BA 1QOGA 3BK2A 2RMMA 2Y5PA 3W1SA 3IAS1 1FCCC 3FC4A 3MP9A 1L4ZB 4B0MA 1YN5A 2NR2A 2G9HD 1OQRA 2I38A 4RH6A 4C56C 4RF0A 3DWMA 3ALBA 1D6EC 2BVCA 1ZE3D 2FCQA 2NBUA 4ZRQA 2AQ1B 5L95C 4HEA1 4DWFA 2PKOA 2WXMA 2KT7A 1E8XA 2N9EB 3GE3C 3PRZA 4C4VB 4AQ7A 2O6VB 1KJTA 1PFDA 1GG3A 4GMVA 4IC7B 3DBLB 3HK0A 5G5HA 5AZGA 3KUCB 2C9WB 1ZKHA 2N0SB 1SE3A 4GDKB 2KDEB 1IBXB 1FNWA 3P4PB 4KVGB 3RNEC 4DHZB 3NS1A 2KX3A 3ZRCA 2IZVB 4DDID 3BVGA 4HJKA 1BXTA 2OEDA 4MGKE 4S17A 2WNMA 4KSLC 4G50A 1EU3A 2L05A 4YSXB 4MH8A 1JCKB 2JF5A 4DHJD 2MCNB 5EE1A 3A9JA 1V1PB 1TJEA 4LDTD 1AYFA 4IW0A 1HTQA 1NENB 4W9FA 3HVDA 1WYWB 4L1BA 4RGTA 1XLOA 2LHDA 3H6NA 1WGHA 2IYDB 1XLNA 4HWIB 3A1QA 1WZ0A 2N4FA 4ZHOA 3RI7C 4A3OA 1R4MB 4K7WA 2PEAA 4L2YA 2GI9A 1QILA 1C76A 2Y3AA 4RGOS 3V60A 5D3IB 5LNK1 3AEFB 1N63A 2QSDA 1YN3A 4GGQA 3VRBB 2EMSA 1V2YA 2KQ7A 1UWXA 2D3CA 1JWSD 4I6PA 2KKCA 1RM6C 4ICVA 5FR6A 3PZDA 1BT0A 2K6DB 4MJSA 3SR6A 3R2IA 3VTVA 1Z2MA 1ZDXA 2BYVE 1J7AA 2XNAC 2G4DB 5T8IA 4FXCA 2G3QB 3QA8A 3ZKJC 2RD0A 5AEKB 2N1WA 4JGHB 2Z8LA 1WJUA 2WYQA 4NNJB 4ASWC 4IWOA 2IGDA 2VRRB 2WXFA 1EU4A 1UUPA 1C4CA 2IY0B 4K7SA 3WAMA 3L4PA 3PRMB 3WAPA 3V3XA 1C77A 2K1FA 3BWUD 4WQMA 3JVZX 1T3QA 4KX6B 5HI1A 1OQQA 3BVMA 1SE2A 2CU3A 3E9SA 1WX7A 1C79A 1NYQA 1WR1A 1GJZA 4XGAB 4MEMA 4ZRKA 2JUOA 2CKHB 3UIOB 3RNBC 3AE4B 4MELA 2RPQA 1UBQA 2MP2B 2Z0EB 1HTOA 1WM3A 1E90A 3VUYA 1GPXA 4ITKA 1C4PA 1WF9A 2XBBC 2D10A 3AI5A 2DNFA 1SGHA 2JX5A 3I3TB 3CF6E 3U7DA 4J6IA 4TMAB 5IP4D 3L10B 3IXSA 4MACA 1K50A 4A8XC 2L32A 1TS2A 4DHZE 1V5OA 3RCZA 1L4DB 3HVZA 1WGGA 3NZSA 4MSMB 3M95A 4W9KA 3NG0A 1UNSA 4HJGE 2IO0B 1I4XA 1XCQL 4XE0A 5BYQA 2G4SA 4EUTA 2WS3B 1NBFC 2KC1A 1NVID 4ZOHC 1M4VA 5E6PA 1E8ZA 2KXJA 2JY6A 2MLBA 1V5TA 1BMLC 2XN9C 4A20A 3PHXB 4KZCA 1VZ7A 2HJ1A 1FXIA 2K0PA 3AU5A 3KWVA 2K8HA 2RDHA 4FLHA 2MSED 1LQBA 4K3BA 3OJ4B 1NI2A 3TEWA 5TSSA 4YTNB 2NS5A 3AEDB 4JPSA 4LNIA 1N62A 2BKRB 3EHVA 4I6NB 2WXHA 1V9JA 2M0AA 3ZLZA 3SU8X 2NMQA 2BW2A 2M8SA 5JHBA 1A5RA 3JYUA 3PVLA 1OFFA 2ZNVB 2NVUI 2CJOA 1E10A 3U52E 5DCNA 1GB1A 1MHHE 3ONSA 1XT9B 3AE9B 2ZJDA 1L0XB 1V80A 2FUHB 1N6ZA 4M0WA 5DPRA 1SJED 3L54A 4MDKE 4LNOA 1P9DU 2WU2B 4N9F4 3LJ3A 3H1UA 3PS6A 4BAXA 4XYCA 3Q3MC 1Q5WB 3RMKC 1AN8A 1ZUD2 1S1QB 5KHQA 2FUG1 2KANA 1N61A 4XC2A 2KTRA 3GZNB 4EOYA 2INCC 1SSNA 3EC8A 1SEBD 5EDSA 4EEWA 4CYEA 1HA5A 3VDZA 1ET9A 2GBKA 2V1YA 3MJWA 4MSQB 3PREA 4YXDB 3DOWA 2WXKA 1P1AA 3RD2A 1WGYA 3H7PB 3LXFA 4CQNA 3QQ8B 2UYZB 2J0MA 1K52A 3MTNB 3AEGB 2D3AA 4XDDA 3DBSA 5CHFA 1UH6A 3VVWB 4FHJA 1UD7A 2LVOA 4A3PA 2LUEA 3OAWA 1BUIC 5IOIA 2KWCA 4JIOU 2UWQA 2W3RA 3AEBB 2NPTB 3KYDD 4BOSC 4NPNA 3AV8A 2GRIA 3RFZB 1E0ZA 2M19A 3CMMB 3RYTA 2BYEA 2BYFA 3DCGA 3N1XC 1KRHA 2AYOB 3RN9C 4PK1A 4HKQA 4FADA 4JQWC 1RAXA 2HDEA 2LXCA 1LGRA 3AEEB 3BYYB 1Y56A 1SF0A 2BYTA 3IT4B 4EZJA 2NTTA 1WGRA 5C3JB 1IPGA 4ZYNA 4ZDVA 2KDIA 4US8A 3ZNID 4ANVA 4DXGA 1SB3C 3L13A 1WRIA 2LGDA 4TQ0A 5CTRC 2V3NA 2G45B 2MBEA 1EWCA 1E6EB 2JYEA 4R3DA 4A90A 1WX8A 3DDCB 3U4EG 4BVUC 2MBBB 5G55A 4GN1A 3APFA 4FA6A 1N5XA 4ZRJA 1F9JA 2LRUA 4G11A 3RNFC 3ETRA 3Q8BA 4HXDA 3Q3JA 1ACCA 5AUKA 4NJ6A 1JW9D 1LM8B 4TUUA 1WI0A 4WAFA 1LO5D 1XQQA 1RRBA 2FCMA 5EE9A 4P6VF 4GLSC 4BKSA 1XF5L 3RUIB 4WH4A 4HVBA 2IDYA 3M62B 3AN1A 4M8NA 2XEWA 2L7RA 3EECA 3NVYA 4K81A 2OHFA 5IA7A 2KFKB 1T6BX 1ZOYB 1E5WA 4FN2A 2DZIA 4PYUA 1XXGA 3DHHC 4X57B 3W5VB 3ZVVA 1NYRA 1WMHA 2GBRA 2JZ3B 3GZNI 2Y5BB 2BTEA 3I57A 1GC6A 4OVZA 2BS2B 3CWIA 4ANXA 3PLUA 4XZ4A 1SBBB 2BQQA 2ZCBA 4HCNB 4GU2A 4IWPA 2ZCCA 3A9KA 1ZXHA 1D5XC 2DHZA 1RFKA 3S2AA 2N7JA 1HE8A 3ZJTA 2QDFA 2JRHA 3I9V1 2M56B 1XO3A 1KLUD 4WWOA 2ACZB 3DVGY 4AS1A 2LJIA 4FHKA 3L08A 2N9KA 1MFWA 1ROEA 1TYGB 1ZGUB 2XK5A 3VQIA 4W9JA 2LHEA 4IG7B 3CSTA 1I35A 5C23A 2LASA 1I4GA 4DK5A 3IAM1 3P4SB 4W9CA 1OGWA 2L52A 2LZ6A 2H89B 5KHOA 1F2RC 3N9YC 1EF5A 1DOYA 1WXAA 2JU6X 1SXTA 5DPTA 3TEXA 3AMZA 4RF1A 2PTLA 1ZDVA 5I4DA 3WA0A 4MH0E 4BKTA 1B1ZA 1HZ6A 3RT3B 2KJHB 4NAMA 1D3ZA 1UELA 3A1QB 3FKYA 2DAJA 1XLPA 3NHEB 3Q3FA 3KWLA 4JL9A 4KZ0A 3U30A 2PVOD 4C80A 1U4AA 1YJ1A 2V3SA 2WXLA 4YSYB 3RZFA 3RNGC 1TIFA 3V62A 2KDFB 3ABVB 1YX5B 4P7IA 3PZ7A 4C00A 1QOFA 5GXGB 3VTUA 2KVZA 3BY4B 2V3PA 3AE7B 2EKIA 3ZTDA 2L8JA 5AZHA 3I63C 2N7DA 1NEKB 1DGJA 2BGFA 2LGSA 2JXXA 3C8YA 4GDLA 2WLBA 2NBWB 2KOXA 4XX5A 2O6VD 4HPLB 4E71A 2K9XA 5LXHA 1TTNA 2V4LA 2KVRA 1YX6B 3DBHB 2UU7A 2R61A 1FRDA 3KQ4A 4ACFA 3HM3A 1LFDA 3CIRB 4YL8A 1D5ZC 3B08A 1XD3B 3HM6X 3MC8A 2RDGA 5L83A 2W54A 3KW5B 2KMMA 5HKHA 1E8WA 4OZBA 3V61A 4M01A 4S0RA 1CJEA 4ZHPA 3NRZA 2LFIA 2REXA 5IKCM 3B2GA 3T3OA 1L7YA 1VJKA 3UGBB 5J18A 4BKGA 3KLSX 4LLGM 4DXAB 2V9HA 2D3BA 1WGKA 4TSSA 2WDQB 3ZNZB 3Q8FA 5BMHA 1DOXA 3NOBA 2K3UA 1T0RC 2KN5A 1V97A 2JVCA 1L0YB 1Z5SB 1YN4A 2OJRA 3Q2AC 4D2KA 4DDGD 2MJ3A 1Q0WB 3EGRA 3OJ3A 1FMAD 1SIFA 1JWMD 4PS7A 1ISNA 1VRAB 1VZ8A 3R8BA 1FNVA 3DHIC 3CSFA 1RLFA 4E3CA 2QHOA 3H7SA 3VUXA 4IKGA 2I1JA 1ESFA 1F0ZA 4OZAA 3Q14C 1ZXIA 2DAFA 3Q8CA 1IP9A 5HG2A 2L0FA 1F77A 2IPKD 2WXRA 3V6CB 4PT5A 4ZRPA 4NZLB 1F52A 4GB9A 2ZW0A 3PZ8A 2X38A 3JSVA 3Q69A 1FRRA 2WP9B 2AL3A 4ANWA 4Q2JA 2N9PC 3KUZA 4AWJA 4W9GA 1I4RA 2OOBB 1ZPSA 3A33B 4WIPA 3WIMA 1JROA 5CX3A 1CK1A 2E3TA 1IUEA 3V6EB 2A5UA 2WU5B 4AJWA 3WALA 1QZEA 2MJEA 3W2DA 3O65B 1SE9A 3PT2B 1GAQB 2DYOA 1JMLA 1WGDA 2PW9A 4M0WB 2ZZPB 2WGSA 3URYA 1WJ6A 4HROA 5JZEB 3LYYA 3DVGX 3Q3OC 1YJJA 3DVNU 4RGNA 2MP2A 1WIAA 2LGYA 1FIQA 2KQ4X 3H9DA 3DBHI 3TMPB 2CHXA 4LNFA 2JZPA 1IGDA 2KTRB 2NCNA 2C7NB 4WAAA 5C2TB 2M1MA 5FR3A 2FCNA 2BKFA 5D6JB 3P4RB 2BWFA 3EFUA 3GS2A 1J8CA 2QCZA 3DHGC 5BYSA 1WZ3A 1JWAD 2HTHA 2YLMA 4AOFA 2BWES 2B76B 3R66C 1J0GA 3P42A 1MPEA 4CO7A 3NZUA 4ICUA 4N59A 1N5WA 2WX0A 1N60A 1F1HA 1I7HA 3DPDA 2GB1A 2HD5B 5DPWA 3PGEA 3U8ZA 4I6LB 4EZKA 4A9AA 4KIKB 2LUMA 1L0VB 2NBVB 2ZW1A 3N1YC 3P2BA 5D94A 4B6WA 2G1EA 2JZZA 1MJDA 3UINB 2KZRA 2O2VA 3AE5B 3UQAA 4ARIA 4BZAA 1TT5B 4A6QA 1YOVB 3KYCD 3OLMD 1LXDA 2ZPNA 3RNCC 2LI5A 2N9XA 3NVVA 2SAKA 5H8YE 1WE7A 2VH1A 3SEBA 4URKA 2MBOA 3FAHA 3B9JA 2KMAA 2R2QA 1V49A 3DQVA 2FIDA 4HPMB 1AWDA 1WE6A 1QT9A 3B2FA 1E7UA 2MEKA 2KNBA 1Y8RC 1QQRA 2EMTA 4BBNF 1WJNA 2KTFA 2KC2A 4YTPB 4B0EA 4JWSC 2INDC 4M8MA 3P4QB 4RCOA 1VCBA 1I42A 1L6UA 3FILA 4ARCA 3HUIA 4P1BC 3TEZA 1V86A 3L17A 3APDA 4RFBA 2M4NA 4M00A 1JRUA 1NI3A 4FULA 1P7EA 2L76A 4IOIE 4WJPA 4G0NB 5D3DA 3N3KB 3U2SC 1STEA 4OZCA 2K8BA 3A4SC 2KWDA 3PSEB 2LXAA 4MT5A 1WH3A 2BT6A 1GUAB 3V05A 2KX0A 1V1OA 3ZQ4A 1HXYD 3DWGC 4WWMA 2QIEB 4GOCA 2KJ6A 1UGMA 4M02A 2KACA 2PVGC 3NVZA 1KH0A 1TBEA 1CQVA 2LRWA 2IGGA 4JWUC 4NQKE 1C78A 3T9LA 1WSPA 2DX5B 3H7PA 2VZKB 3R7QA 3Q8EA 2KFJA 5E6NA 4WWPA 3I5JC 4II2B 4N6EB 3ZW3A 3BVZA 2CU1A 3IHPC 1K53A 2PMVA 1T0SC 3WAOA 3PRPB 3T3NA 2H88B 2J53A 2QJLA 1WMHB 2YEPB 2B3AA 3QHTA 2D11A 3IVFA 3EUB2 4XWTA 4YWGG 1RFAA 2IY1B 2KQSA 4KV2A 1HQRD 4HCPB 3NJTA 1OTRB 1K51A 4CHKA 2INNE 1WXMA 2A4ZA 2JQRB 2D3GA 1TKGA 3A9KB 1P3QU 3EFCA 3U7ZA 2AQ2B 2WXOA 2KD0A 4RM9A 2W82A 3TL5A 1TKEA 2LWPA 3RULA 2MX2A 2VZKD 4PS8A 1ZW7A 4W9LA 1AW7A 3N32A 2PE9A 4HKZE 1KOTA 4J3OD 2MH7A 2ON8A 1MG8A 2KAJA 2XK5B 2JT4B 3NZ3A 2W55A 4NJ7A
chains in the Genus database with same CATH topology
1DGJA 3IXSA 4MACA 2KDMA 1K50A 1FXAA 4A8XC 2L32A 2BB5A 4ZYSA 1TS2A 3C8YA 2WLBA 3BIID 2WDVB 4DXFA 2K9XA 2BB6A 5HHDG 2PLPA 1L4DB 3R2TA 3HVZA 3BZDB 1UNSA 3AB5A 4HJGE 2R61A 3W9CB 1I4XA 1XCQL 2EELA 4XE0A 5BYQA 1DOIA 2WDRB 2WS3B 1FRDA 3KQ4A 3CIRB 1NVID 1KLGD 1D5ZC 4ZOHC 1FO4A 1M4VA 2E6XA 2RDGA 1BMLC 2LEKA 2XN9C 2W54A 3J9CA 1VZ7A 2KMMA 4LK0M 1JWUD 1FXIA 4OZBA 3OWEB 2K0PA 5E6JA 1CJEA 1ET6A 3AE2B 3KWVA 3NRZA 4UDUC 4ZHPA 2JSVX 2LFIA 3MC0B 3Q8AA 2FE8A 3B2GA 2RDHA 1EWYC 1B9RA 3T3OA 1VJKA 1ENFA 4O1NA 1YQ3B 3TEWA 5TSSA 3H8HA 3KLSX 4LLGM 3E56A 4YTNB 1WGKA 4TSSA 1P7FA 3AEDB 2SEBD 4KGSA 2WDQB 4JPSA 1KFYB 1N62A 1FFVA 2WXIA 3AE1B 4C7ZA 2DYMA 3Q8FA 2WXHA 5BMHA 1DOXA 5FKAC 1I4PA 1E9MA 3P63A 2M0AA 2K3UA 2WQYB 2TSSA 2DLBA 3O13A 3UI3A 1SIJA 1V97A 2NMQA 2BW2A 3P1MA 2Y5CA 4H2AA 1L0YB 2K5PA 1OFFA 1QOBA 1MI0A 2CJOA 1E10A 3U52E 1IGCA 1GB1A 1MHHE 1WWTA 1YN4A 4D2KA 3AE9B 2MJ3A 3EGRA 1YMHE 1L0XB 2WXGA 4KGTA 1FMAD 1JWMD 1WXQA 4M0WA 3WCQA 5MPOA 1SJED 1VRAB 4GDLB 1VZ8A 2ICIA 2WU2B 2J52A 3R8BA 4YSZB 1FNVA 1D5MC 3MFGA 1L5PA 3AH7A 1C4AA 1GB4A 1AN8A 4EE2A 1ZUD2 4IKGA 1L6VA 2FUG1 1N61A 3TEYA 1ESFA 2L1AA 1F0ZA 2N9LA 3MHZA 2FBWB 4OZAA 5H92C 1SSNA 1ZXIA 4WURA 1TZOA 2DBYA 1FEHA 3Q8CA 4IDIA 5HG2A 1SEBD 1F77A 1EM7A 3TUOA 2IPKD 2WXRA 1T5XD 4PT5A 1HA5A 1FNUA 4ZRPA 4NZLB 5EE0A 1ET9A 1ZP0B 1FD6A 2ZW0A 3PZ8A 3ZJVA 2X38A 1CZPA 4OW0A 4YXDB 1TS4A 3Q69A 1FRRA 2WP9B 1I4HA 1A70A 3VR9B 3MJ5A 2WXKA 4Q2JA 5G5GA 1VZ6A 1TS3A 2IJ0A 4KKIA 3LXFA 4CQNA 2CJNA 1FM0D 1I4RA 1K52A 1ZPSA 2JXTA 3AEAB 3AEGB 3BK1A 4WIPA 1JROA 4XDDA 1CK1A 2E3TA 2HTME 1IUEA 3EA6A 5EE3A 1BUIC 2WU5B 1R7SA 3RPFC 1YJIA 2W3RA 1SJHD 3AEBB 1VDVA 4N58A 2MJEA 2QEJC 3AV8A 2GRIA 1SE4A 4JX1C 3W2DA 3RFZB 1E0ZA 1PGAA 4RNAA 2M19A 1XCTL 2WXQA 1HEZE 5BMIA 1TY0A 1FFUA 1GAQB 2DYOA 1RWSA 5AUIA 1JMLA 1KRHA 2PW9A 2L83A 5HFYA 3VR8B 3LB8C 1IBXA 1PDXA 2JWUA 4HKQA 3URYA 1TY2A 4DQOC 4HROA 1TS5A 3LYYA 1J7CA 1PUTA 1QF6A 2HDEA 4US9A 1YJJA 3HRDD 1PGBA 3AECB 5BMGA 4NAWB 4RGNA 3AEEB 1FIQA 2KQ4X 3BYYB 1Y56A 3AM9A 4KGRA 1SF0A 2BYTA 5JXVA 3IT4B 4RGMA 2ONQA 3W5UB 2JZPA 1IGDA 2D5GA 2NTSA 2NTTA 1E7PB 3TSSA 4REZA 5C2TB 1MHXA 5C3JB 5FR3A 1I4QA 4LTUA 1V1PA 4C7YA 3P4RB 4US8A 2V4IB 2MJDA 3GS2A 4DXGA 5BYSA 1JWAD 1SB3C 1WRIA 4TQ0A 2V3NA 2B76B 1DYQA 3P42A 2JYEA 1EWCA 1E6EB 1MPEA 4R3DA 4MM3B 4A90A 4N59A 1N5WA 3SFDB 1D4BA 3U4EG 1QOGA 1N60A 2RMMA 3BK2A 2Y5PA 3W1SA 3IAS1 1FCCC 3FC4A 1I7HA 3MP9A 1L4ZB 2GB1A 2IGHA 4B0MA 1YN5A 2G9HD 1OQRA 2I38A 4RH6A 4A9AA 4JE3B 4C56C 1N5XA 1GOZA 2LUMA 3DWMA 4RF0A 1MVKA 4TQ1A 1L0VB 1D6EC 1ZE3D 2ZW1A 4HRSA 3ZJUA 3ETRA 2G1EA 4ZRQA 2AQ1B 3Q8BA 1JQ4A 1QLBB 4HEA1 2INPE 3AE5B 2PKOA 2WXMA 1ACCA 5AUKA 2JYTA 1JW9D 2K22A 4USAA 4ARIA 1QKZA 3AE8B 4AQ7A 4A6QA 1PFDA 4XDCA 4WAFA 1LO5D 5EE9A 4P6VF 4GLSC 5G5HA 1XF5L 3NVVA 2SAKA 5H8YE 5BYRA 4WH4A 2W55A 3SEBA 2IDYA 1JWBD 3FAHA 2N0SB 1SE3A 3B9JA 3AN1A 4GDKB 1IBXB 1FNWA 3P4PB 3NS1A 2V0GA 1AWDA 3NVWA 3SFEB 1PYWD 3NVYA 3BVGA 1BXTA 2OEDA 2OHFA 3GP7A 1T6BX 1ZOYB 1QT9A 4YTMB 2WNMA 3B2FA 1EU3A 2MEKA 1XXGA 4YSXB 4MH8A 1JCKB 1QQRA 3GB1A 3W5VB 1NYRA 5EE1A 4B0EA 2W3SA 4YTPB 1V1PB 4JWSC 1TJEA 1AYFA 3P4QB 2BTEA 4RCOA 3I57A 1L6UA 3FILA 4OVZA 2BS2B 1C9FA 1NENB 4ARCA 3CWIA 1JRPA 2BBCA 3HUIA 3TEZA 3HVDA 2BS4B 1SBBB 4L1BA 4RGTA 1YNTE 1XLOA 2LHDA 4RFBA 1XLNA 3NUHB 1NI3A 4ZHOA 1P7EA 4IOIE 1VR9A 1ZXHA 5D3DA 1D5XC 2J42A 4L2YA 1RFKA 3U2SC 2GI9A 1STEA 1QILA 2N7JA 1C76A 2LGIA 4OZCA 3ZJTA 2PIAA 2KWDA 4OHJA 3I9V1 2Y3AA 4RGOS 2M56B 1XO3A 4MT5A 1KLUD 5D3IB 1F2RI 2ACZB 5D7GA 4YT0B 5LNK1 3AEFB 2BT6A 1N63A 4AS1A 3V05A 2LJIA 2QSDA 4NJCA 1YN3A 1V1OA 3AE6B 3ZQ4A 3VRBB 1HXYD 3DWGC 4WWMA 1FCLA 2QIEB 2N9KA 1UWXA 1XEEA 1JWSD 1ROEA 1TYGB 1RM6C 1WYGA 2KACA 3VQIA 2PVGC 2QMTA 3NVZA 1KH0A 2I2YA 1J7BA 2LHEA 1CQVA 3SR6A 3R2IA 2IGGA 4JWUC 1TKYA 2AQ3B 1C78A 1Q10A 1WSPA 1I4GA 2Q5WD 1ZDXA 3IAM1 3P4SB 2VZKB 3Q8EA 1J7AA 2XNAC 2KN4A 2L52A 5T8IA 4FXCA 3BYTB 1V8CA 2H89B 4N6EB 5FK9C 1F2RC 3BVZA 1RYJA 3N9YC 2Z8LA 1DOYA 1K53A 2J4XA 2PMVA 3ZGZA 2JU6X 3AE3B 1SXTA 3T3NA 2BS3B 2H88B 2IGDA 2J53A 4L23A 3TEXA 2WXFA 2QJLA 1EU4A 3AMZA 1UUPA 2AX5A 2YEPB 2PTLA 4RF1A 1UWMA 1C4CA 1ZDVA 3EUB2 4XWTA 4YWGG 5I4DA 3L4PA 3FILB 3PO0A 1HQRD 2RPVA 1UGJA 3V3XA 3VRAB 1C77A 1B1ZA 1HZ6A 3BWUD 4WQMA 1HZ5A 1T3QA 4KX6B 5HI1A 1K51A 4NAMA 1OQQA 2INNE 3BVMA 2JQRB 1SE2A 2CU3A 1TKGA 3E9SA 3IT6B 1C79A 1NYQA 1XLPA 3KWLA 2PVOD 1JALA 2WXPA 4XWWA 1YQ4B 4C80A 3U7ZA 2AQ2B 2WXOA 2WXLA 4YSYB 4A55A 2DWQA 2W82A 2YEPF 3AE4B 1TKEA 2QILA 1PGXA 2VZKD 3ABVB 3ZYYX 3PZ7A 1QOFA 5GXGB 1QOAA 1AW7A 1GPXA 4HKZE 4ITKA 2V3PA 3AE7B 2EKIA 2WXNA 4J3OD 1C4PA 2MH7A 4KKJA 2ON8A 1KTKA 1XLQA 2LMCA 2WXJA 4P16A 2KAJA 2JX5A 3NZ3A 1VLBA 4TMAB 1NEKB 1KF6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L6V A;  2M56 B;  1DGJ A;  1XO3 A;  1N61 A;  4N59 A;  1N5W A;  2ACZ B;  3SFD B;  4YT0 B;  1F0Z A;  3AEF B;  2BT6 A;  1FXA A;  1N63 A;  1QOG A;  1N60 A;  2FBW B;  2WLB A;  3FC4 A;  1I7H A;  3BII D;  5H92 C;  2WDV B;  3AE6 B;  1ZXI A;  3VRB B;  3DWG C;  4IDI A;  2DBY A;  4WWM A;  1OQR A;  2K9X A;  2QIE B;  4A9A A;  3HVZ A;  1N5X A;  1ROE A;  1TYG B;  1RM6 C;  1WYG A;  3DWM A;  3AB5 A;  1L0V B;  3W9C B;  2PVG C;  3NVZ A;  4HRS A;  5EE0 A;  1J7B A;  1ZP0 B;  3ETR A;  1DOI A;  2G1E A;  2WDR B;  2WS3 B;  3SR6 A;  1FRD A;  4JWU C;  1TKY A;  1QLB B;  1JQ4 A;  3AE5 B;  2PKO A;  3CIR B;  1CZP A;  1NVI D;  4YXD B;  1FRR A;  2WP9 B;  1E6E B;  2Q5W D;  1A70 A;  1JW9 D;  2K22 A;  4USA A;  3P4S B;  4ZOH C;  5AUK A;  3VR9 B;  3AE8 B;  1J7A A;  1PFD A;  2L52 A;  5G5G A;  2LEK A;  4FXC A;  2W54 A;  2KMM A;  3LXF A;  5EE9 A;  2CJN A;  1V8C A;  1FXI A;  1FM0 D;  2H89 B;  4P6V F;  5G5H A;  3NVV A;  3AEA B;  3AEG B;  4N6E B;  1CJE A;  1JRO A;  3AE2 B;  3NRZ A;  5H8Y E;  2E3T A;  1RYJ A;  4ZHP A;  1DOY A;  2W55 A;  1JWB D;  3AE3 B;  3B2G A;  2N0S B;  3FAH A;  1EWY C;  2HTM E;  3B9J A;  1IUE A;  1B9R A;  5EE3 A;  2WU5 B;  3AN1 A;  2BS3 B;  1VJK A;  2H88 B;  1R7S A;  3RPF C;  1YJI A;  2W3R A;  2QJL A;  3AEB B;  3P4P B;  1VDV A;  3AMZ A;  1YQ3 B;  2AX5 A;  3NS1 A;  4N58 A;  2MJE A;  1UWM A;  1AWD A;  4YTN B;  1WGK A;  3NVW A;  3EUB 2;  3SFE B;  3AED B;  3AV8 A;  3NVY A;  4JX1 C;  1E0Z A;  2OHF A;  2WDQ B;  3L4P A;  1FO4 A;  1KFY B;  1N62 A;  1ZOY B;  2M19 A;  1QT9 A;  1FFV A;  3PO0 A;  4YTM B;  3AE1 B;  3B2F A;  4C7Z A;  3VRA B;  1FFU A;  1GAQ B;  4WQM A;  1DOX A;  1E9M A;  3P63 A;  4YSX B;  2WQY B;  1T3Q A;  1RWS A;  4KX6 B;  5AUI A;  1OQQ A;  1KRH A;  1SIJ A;  1V97 A;  2L83 A;  3VR8 B;  3W5V B;  3LB8 C;  3P1M A;  1PDX A;  1NYR A;  2JQR B;  5EE1 A;  2CU3 A;  2W3S A;  1TKG A;  4HRO A;  4JWS C;  1TJE A;  4YTP B;  1NYQ A;  1J7C A;  1XLP A;  2Y5C A;  3KWL A;  1AYF A;  1PUT A;  1QF6 A;  2K5P A;  3P4Q B;  4US9 A;  2PVO D;  1OFF A;  1QOB A;  1YJJ A;  1JAL A;  2CJO A;  3HRD D;  3AEC B;  1E10 A;  1L6U A;  1YQ4 B;  1WWT A;  4C80 A;  1ZUD 2;  2BS2 B;  1NEN B;  3AEE B;  3CWI A;  1FIQ A;  1JRP A;  3AM9 A;  3AE9 B;  3HUI A;  1SF0 A;  2DWQ A;  2MJ3 A;  4YSY B;  3AE4 B;  1TKE A;  2BS4 B;  3W5U B;  1XLO A;  1FMA D;  3ABV B;  1XLN A;  1WXQ A;  3ZYY X;  1E7P B;  3WCQ A;  5C2T B;  1NI3 A;  1QOF A;  5GXG B;  5C3J B;  5MPO A;  4ZHO A;  1QOA A;  4LTU A;  1GPX A;  2WU2 B;  3P4R B;  4ITK A;  4C7Y A;  3AE7 B;  4US8 A;  2EKI A;  2MJD A;  4YSZ B;  1RFK A;  2MH7 A;  1JWA D;  1SB3 C;  1L5P A;  1XLQ A;  3AH7 A;  1WRI A;  2B76 B;  2KAJ A;  2JX5 A;  2PIA A;  1VLB A;  1NEK B;  1KF6 B; 
#chains in the Genus database with same CATH topology
 4W9D A;  4WJQ A;  2KDM A;  2HE7 A;  1FXA A;  4LJP B;  5C1Z A;  2BB5 A;  2N1V A;  3BII D;  3UQB A;  3DVN V;  4DXF A;  5HHD G;  3MC9 A;  4HDO A;  5IN7 A;  3AB5 A;  3PHW B;  2KO3 A;  3T8M A;  4TKN A;  4IUM B;  1DOI A;  2W9N A;  5CHW A;  3QAR A;  3Q3N C;  3UIP B;  1KLG D;  5E6O A;  4F1S A;  4WWN A;  2E6X A;  2Z0D B;  4RMA A;  3R7R A;  4LK0 M;  1JWU D;  1M94 A;  5E6J A;  3AE2 B;  1C3T A;  1H8C A;  4MGZ E;  2FE8 A;  1EWY C;  1ENF A;  3JW0 X;  4O1N A;  2KYW A;  3E56 A;  1P7F A;  2SEB D;  4KGS A;  3A4R A;  5JH5 C;  1FFV A;  1YIW A;  2PPH A;  1E9M A;  3P63 A;  3ECI A;  2TSS A;  3O13 A;  3UI3 A;  1SIJ A;  3P1M A;  3C19 A;  1GC7 A;  4WQO B;  3W1Y A;  2K5P A;  4HLE A;  2IBI B;  3B0A A;  1QOB A;  1Q1O A;  2OJW A;  1WWT A;  3A9J B;  1OEY J;  4B95 A;  2CHW A;  3WAN A;  1YMH E;  1YQB A;  2WXG A;  1VD2 A;  4DHJ B;  1UBI A;  4RM8 A;  3WCQ A;  4GDL B;  4BFR A;  2ICI A;  4LDT B;  2D2Q A;  3ZRF A;  1D5M C;  3MFG A;  1L5P A;  3AH7 A;  4NAW A;  1GB4 A;  4EE2 A;  5G2N A;  1L6V A;  2CS4 A;  2J0K A;  3PTF C;  2L1A A;  3ZIM A;  2N9L A;  3AU4 A;  3X23 A;  2R2O A;  2FBW B;  3GOE A;  5H92 C;  4WJN A;  1KLV A;  2FNJ B;  5BO4 B;  1TZO A;  2DBY A;  4IDI A;  1EM7 A;  3K9O B;  3TUO A;  2GBN A;  1V6E A;  2IO3 B;  1FNU A;  4LCD E;  4TV3 A;  5EE0 A;  4MM3 A;  2JRI B;  1ZP0 B;  3VXW A;  2PE6 B;  1S3S G;  1WJ4 A;  1I4H A;  4MJS B;  3MJ5 A;  1WXS A;  2CHZ A;  1VZ6 A;  1TS3 A;  4KKI A;  4W9H A;  3IFW B;  1FM0 D;  3ML8 A;  3BK1 A;  3HIZ A;  1V81 A;  2LJ5 A;  2EKE C;  3R3M A;  2HTM E;  3EA6 A;  2MBQ A;  1R7S A;  3RPF C;  4C4V A;  2RSU A;  2O6V A;  1SJH D;  1VDV A;  2LD9 A;  3K9P B;  2QEJ C;  4N58 A;  1SE4 A;  4JX1 C;  1PGA A;  4RNA A;  2CR5 A;  1HEZ E;  5BMI A;  3RZW C;  2BF8 B;  2WHI A;  4AUQ C;  2L83 A;  4GDK A;  1IBX A;  2C60 A;  3DBR I;  3AXC A;  1TS5 A;  4OVU A;  1PUT A;  1QF6 A;  4PYZ A;  1PGB A;  3AEC B;  4II3 B;  4BOZ B;  3AM9 A;  4KGR A;  5JXV A;  4RGM A;  2KLC A;  4FBJ B;  1WX9 A;  2KWU B;  2D5G A;  2NTS A;  2AL6 A;  1E7P B;  3TSS A;  1T0Y A;  1I4Q A;  1V1P A;  4C7Y A;  3TIX A;  3KVF B;  2V4I B;  2MJD A;  2LVP A;  4EZL A;  3IBE A;  1DYQ A;  2WWZ A;  2ZPY A;  4WJO A;  4K1R B;  4EFO A;  1P0R A;  3KH0 A;  3SFD B;  4NY0 A;  3JSV B;  2WDT B;  2IGH A;  4AP4 C;  1L2N A;  4JE3 B;  3C0R B;  1GOZ A;  1MVK A;  4TQ1 A;  3SD5 A;  1KM7 A;  4HRS A;  3ZJU A;  1JQ4 A;  1QLB B;  2INP E;  1GNU A;  2JYT A;  4USA A;  2J0J A;  2K22 A;  1UZX B;  2MWS B;  1QKZ A;  1TGZ B;  3AE8 B;  2JWZ A;  2KHW B;  1E8Y A;  4GSW A;  4XDC A;  4DBG A;  3ZXV A;  2ZVN A;  1WR6 E;  5CHV C;  3QC8 B;  4KSK C;  4FJZ A;  3ZDM C;  2DZK A;  3ZNG C;  5BYR A;  2X8X X;  1JWB D;  2KWV B;  3BIN A;  3ZDT A;  3VFK A;  4FJV B;  3NS8 A;  3Q6B A;  2V0G A;  1X1M A;  4IWQ A;  3NVW A;  3SFE B;  1PYW D;  3GP7 A;  4YTM B;  3B1L X;  1FXT B;  3GB1 A;  5J2R A;  4OVV A;  2GBM A;  2I1K A;  4NQL B;  4LNN A;  5J17 A;  2W3S A;  4F8C B;  2M0X A;  2MBH A;  5LLI A;  1C9F A;  3DBL I;  3ZXR A;  1JRP A;  2BBC A;  2MW5 A;  2ZNV C;  2BS4 B;  1YNT E;  3KUD B;  2ZEQ A;  3ZUN A;  3NUH B;  2IO2 B;  1VR9 A;  1H4R A;  3QCA A;  2J42 A;  2FIF A;  2LGI A;  2QC8 A;  2PIA A;  4OHJ A;  4EKU A;  3M63 B;  1YD8 U;  3QJZ A;  3PV1 A;  5D7G A;  1F2R I;  4YT0 B;  3GE8 C;  2O2V B;  4NJC A;  3AE6 B;  1FCL A;  3ML9 A;  3TJP A;  2DZM A;  4KDI C;  1XEE A;  1EO6 A;  1WYG A;  2QMT A;  2I2Y A;  1J7B A;  2KLG A;  1TKY A;  2AQ3 B;  2GOW A;  1OQY A;  1Q10 A;  2JPH A;  2Q5W D;  4QAY A;  2IO1 B;  4GXB A;  2KN4 A;  1R4M I;  3TCA A;  1IYF A;  2VH2 A;  3VAW A;  3BYT B;  1V8C A;  2GMI C;  4IM0 A;  5FK9 C;  3OG5 A;  1J19 A;  2RDB C;  1RYJ A;  2J4X A;  1VLB A;  2DZJ A;  5IO9 A;  3ZGZ A;  3AE3 B;  3ENE A;  3VH3 B;  2BS3 B;  2C5L C;  5LXI B;  1MG4 A;  4L23 A;  2AX5 A;  1UWM A;  2K25 A;  2WX1 A;  2J7Q B;  3FIL B;  3PO0 A;  2L3Z A;  3L0W B;  3ZNH B;  2RPV A;  1UGJ A;  3VRA B;  1HZ5 A;  3LDZ E;  1OEY A;  3VHT C;  2ZVO A;  2K6Q A;  3IT6 B;  1WM2 A;  2M17 A;  3N1Z C;  1JAL A;  2WXP A;  3M3J A;  4XWW A;  1YQ4 B;  4A55 A;  2DWQ A;  2YEP F;  3AUL A;  2GLS A;  4JLC A;  2QIL A;  1PGX A;  1P98 A;  3ZYY X;  4W9E A;  1QOA A;  4KDL B;  3TBL D;  2WXN A;  4HPP A;  4KKJ A;  1KTK A;  3QIJ A;  1XLQ A;  4MGI E;  2LMC A;  2WXJ A;  4P16 A;  1C1Y B;  1KF6 B;  4IM3 A;  1CMX B;  3ZTC A;  4HK2 A;  4KIK A;  2AWT A;  4ZYS A;  3VUW A;  2WDV B;  2LVQ A;  3APC A;  2BB6 A;  1EF1 A;  2PLP A;  3R2T A;  3BZD B;  1WXV A;  3W9C B;  1R4N B;  2EEL A;  3PPA A;  3HHM A;  2L00 B;  2WDR B;  2MHJ A;  2BPS A;  2N7E A;  1FO4 A;  2KJR A;  2LEK A;  2C7H A;  3J9C A;  2DYB A;  4K7U A;  4K3C A;  3OWE B;  4BBN C;  1ET6 A;  4UDU C;  2JSV X;  3MC0 B;  3Q8A A;  1T0Q C;  5TR5 A;  1B9R A;  2ASQ A;  2RR9 A;  1YQ3 B;  3H8H A;  2HJ8 A;  3QK0 A;  3IG3 A;  2K39 A;  1KFY B;  2WXI A;  4HDQ A;  3AE1 B;  5DPS A;  4C7Z A;  2DYM A;  5FKA C;  1I4P A;  3QX1 A;  2WQY B;  4PS3 A;  2DLB A;  3UF8 A;  2NPT A;  5IAA C;  2Y5C A;  3N30 A;  4H2A A;  2RGF A;  3D32 A;  2Z59 B;  1MI0 A;  2K8C A;  1IGC A;  3QAQ A;  4W9I A;  3L16 A;  2YVC A;  4KGT A;  1WXQ A;  5MPO A;  2MA9 B;  1FPY A;  3RNA C;  4E74 A;  2J52 A;  4YSZ B;  3W1S C;  1C4A A;  4BKS D;  5D2M B;  3TEY A;  2PJH A;  1G6J A;  3MHZ A;  3NY5 A;  3QWZ B;  5AZF A;  5GMV A;  4WUR A;  1FEH A;  4MGY E;  4FJY A;  1T5X D;  4B9K A;  2L0T A;  1E7V A;  1FD6 A;  4IM2 A;  1K8R B;  3ZJV A;  1CZP A;  4OW0 A;  3DBR B;  1TS4 A;  1A70 A;  1EUV B;  4LNK A;  3VR9 B;  1WY8 A;  5G5G A;  2IJ0 A;  2GBJ A;  2DEN B;  4GIV A;  2C7M B;  2CJN A;  2FCS A;  3AEA B;  2JXT A;  2D07 B;  2AEH A;  5EE3 A;  3ZO5 B;  4F7Z A;  1YJI A;  1PQS A;  5JHA A;  2WXQ A;  1XCT L;  1WRD B;  4ZRI A;  4ANU A;  1TY0 A;  3N20 C;  1FFU A;  1TZ1 A;  1RWS A;  5AUI A;  1UF0 A;  5HFY A;  3VR8 B;  3LB8 C;  1PDX A;  1AAR A;  1WFY A;  2JWU A;  3VH4 B;  3MHS D;  1TY2 A;  4DQO C;  1J7C A;  4US9 A;  3HRD D;  2KFK A;  5BMG A;  1NDD A;  4NAW B;  4LJO B;  3X0W A;  3PLV A;  4P1C C;  2ONQ A;  3W5U B;  3SDL C;  1R4N I;  2LGX A;  4REZ A;  1MHX A;  4LTU A;  2KMC A;  2FAZ A;  3VTW A;  2MQJ A;  2MRP A;  4G3X B;  2KK8 A;  2KDB A;  3SHQ A;  4MM3 B;  4AJY B;  1D4B A;  1QOG A;  3BK2 A;  2RMM A;  2Y5P A;  3W1S A;  3IAS 1;  1FCC C;  3FC4 A;  3MP9 A;  1L4Z B;  4B0M A;  1YN5 A;  2NR2 A;  2G9H D;  1OQR A;  2I38 A;  4RH6 A;  4C56 C;  4RF0 A;  3DWM A;  3ALB A;  1D6E C;  2BVC A;  1ZE3 D;  2FCQ A;  2NBU A;  4ZRQ A;  2AQ1 B;  5L95 C;  4HEA 1;  4DWF A;  2PKO A;  2WXM A;  2KT7 A;  1E8X A;  2N9E B;  3GE3 C;  3PRZ A;  4C4V B;  4AQ7 A;  2O6V B;  1KJT A;  1PFD A;  1GG3 A;  4GMV A;  4IC7 B;  3DBL B;  3HK0 A;  5G5H A;  5AZG A;  3KUC B;  2C9W B;  1ZKH A;  2N0S B;  1SE3 A;  4GDK B;  2KDE B;  1IBX B;  1FNW A;  3P4P B;  4KVG B;  3RNE C;  4DHZ B;  3NS1 A;  2KX3 A;  3ZRC A;  2IZV B;  4DDI D;  3BVG A;  4HJK A;  1BXT A;  2OED A;  4MGK E;  4S17 A;  2WNM A;  4KSL C;  4G50 A;  1EU3 A;  2L05 A;  4YSX B;  4MH8 A;  1JCK B;  2JF5 A;  4DHJ D;  2MCN B;  5EE1 A;  3A9J A;  1V1P B;  1TJE A;  4LDT D;  1AYF A;  4IW0 A;  1HTQ A;  1NEN B;  4W9F A;  3HVD A;  1WYW B;  4L1B A;  4RGT A;  1XLO A;  2LHD A;  3H6N A;  1WGH A;  2IYD B;  1XLN A;  4HWI B;  3A1Q A;  1WZ0 A;  2N4F A;  4ZHO A;  3RI7 C;  4A3O A;  1R4M B;  4K7W A;  2PEA A;  4L2Y A;  2GI9 A;  1QIL A;  1C76 A;  2Y3A A;  4RGO S;  3V60 A;  5D3I B;  5LNK 1;  3AEF B;  1N63 A;  2QSD A;  1YN3 A;  4GGQ A;  3VRB B;  2EMS A;  1V2Y A;  2KQ7 A;  1UWX A;  2D3C A;  1JWS D;  4I6P A;  2KKC A;  1RM6 C;  4ICV A;  5FR6 A;  3PZD A;  1BT0 A;  2K6D B;  4MJS A;  3SR6 A;  3R2I A;  3VTV A;  1Z2M A;  1ZDX A;  2BYV E;  1J7A A;  2XNA C;  2G4D B;  5T8I A;  4FXC A;  2G3Q B;  3QA8 A;  3ZKJ C;  2RD0 A;  5AEK B;  2N1W A;  4JGH B;  2Z8L A;  1WJU A;  2WYQ A;  4NNJ B;  4ASW C;  4IWO A;  2IGD A;  2VRR B;  2WXF A;  1EU4 A;  1UUP A;  1C4C A;  2IY0 B;  4K7S A;  3WAM A;  3L4P A;  3PRM B;  3WAP A;  3V3X A;  1C77 A;  2K1F A;  3BWU D;  4WQM A;  3JVZ X;  1T3Q A;  4KX6 B;  5HI1 A;  1OQQ A;  3BVM A;  1SE2 A;  2CU3 A;  3E9S A;  1WX7 A;  1C79 A;  1NYQ A;  1WR1 A;  1GJZ A;  4XGA B;  4MEM A;  4ZRK A;  2JUO A;  2CKH B;  3UIO B;  3RNB C;  3AE4 B;  4MEL A;  2RPQ A;  1UBQ A;  2MP2 B;  2Z0E B;  1HTO A;  1WM3 A;  1E90 A;  3VUY A;  1GPX A;  4ITK A;  1C4P A;  1WF9 A;  2XBB C;  2D10 A;  3AI5 A;  2DNF A;  1SGH A;  2JX5 A;  3I3T B;  3CF6 E;  3U7D A;  4J6I A;  4TMA B;  5IP4 D;  3L10 B;  3IXS A;  4MAC A;  1K50 A;  4A8X C;  2L32 A;  1TS2 A;  4DHZ E;  1V5O A;  3RCZ A;  1L4D B;  3HVZ A;  1WGG A;  3NZS A;  4MSM B;  3M95 A;  4W9K A;  3NG0 A;  1UNS A;  4HJG E;  2IO0 B;  1I4X A;  1XCQ L;  4XE0 A;  5BYQ A;  2G4S A;  4EUT A;  2WS3 B;  1NBF C;  2KC1 A;  1NVI D;  4ZOH C;  1M4V A;  5E6P A;  1E8Z A;  2KXJ A;  2JY6 A;  2MLB A;  1V5T A;  1BML C;  2XN9 C;  4A20 A;  3PHX B;  4KZC A;  1VZ7 A;  2HJ1 A;  1FXI A;  2K0P A;  3AU5 A;  3KWV A;  2K8H A;  2RDH A;  4FLH A;  2MSE D;  1LQB A;  4K3B A;  3OJ4 B;  1NI2 A;  3TEW A;  5TSS A;  4YTN B;  2NS5 A;  3AED B;  4JPS A;  4LNI A;  1N62 A;  2BKR B;  3EHV A;  4I6N B;  2WXH A;  1V9J A;  2M0A A;  3ZLZ A;  3SU8 X;  2NMQ A;  2BW2 A;  2M8S A;  5JHB A;  1A5R A;  3JYU A;  3PVL A;  1OFF A;  2ZNV B;  2NVU I;  2CJO A;  1E10 A;  3U52 E;  5DCN A;  1GB1 A;  1MHH E;  3ONS A;  1XT9 B;  3AE9 B;  2ZJD A;  1L0X B;  1V80 A;  2FUH B;  1N6Z A;  4M0W A;  5DPR A;  1SJE D;  3L54 A;  4MDK E;  4LNO A;  1P9D U;  2WU2 B;  4N9F 4;  3LJ3 A;  3H1U A;  3PS6 A;  4BAX A;  4XYC A;  3Q3M C;  1Q5W B;  3RMK C;  1AN8 A;  1ZUD 2;  1S1Q B;  5KHQ A;  2FUG 1;  2KAN A;  1N61 A;  4XC2 A;  2KTR A;  3GZN B;  4EOY A;  2INC C;  1SSN A;  3EC8 A;  1SEB D;  5EDS A;  4EEW A;  4CYE A;  1HA5 A;  3VDZ A;  1ET9 A;  2GBK A;  2V1Y A;  3MJW A;  4MSQ B;  3PRE A;  4YXD B;  3DOW A;  2WXK A;  1P1A A;  3RD2 A;  1WGY A;  3H7P B;  3LXF A;  4CQN A;  3QQ8 B;  2UYZ B;  2J0M A;  1K52 A;  3MTN B;  3AEG B;  2D3A A;  4XDD A;  3DBS A;  5CHF A;  1UH6 A;  3VVW B;  4FHJ A;  1UD7 A;  2LVO A;  4A3P A;  2LUE A;  3OAW A;  1BUI C;  5IOI A;  2KWC A;  4JIO U;  2UWQ A;  2W3R A;  3AEB B;  2NPT B;  3KYD D;  4BOS C;  4NPN A;  3AV8 A;  2GRI A;  3RFZ B;  1E0Z A;  2M19 A;  3CMM B;  3RYT A;  2BYE A;  2BYF A;  3DCG A;  3N1X C;  1KRH A;  2AYO B;  3RN9 C;  4PK1 A;  4HKQ A;  4FAD A;  4JQW C;  1RAX A;  2HDE A;  2LXC A;  1LGR A;  3AEE B;  3BYY B;  1Y56 A;  1SF0 A;  2BYT A;  3IT4 B;  4EZJ A;  2NTT A;  1WGR A;  5C3J B;  1IPG A;  4ZYN A;  4ZDV A;  2KDI A;  4US8 A;  3ZNI D;  4ANV A;  4DXG A;  1SB3 C;  3L13 A;  1WRI A;  2LGD A;  4TQ0 A;  5CTR C;  2V3N A;  2G45 B;  2MBE A;  1EWC A;  1E6E B;  2JYE A;  4R3D A;  4A90 A;  1WX8 A;  3DDC B;  3U4E G;  4BVU C;  2MBB B;  5G55 A;  4GN1 A;  3APF A;  4FA6 A;  1N5X A;  4ZRJ A;  1F9J A;  2LRU A;  4G11 A;  3RNF C;  3ETR A;  3Q8B A;  4HXD A;  3Q3J A;  1ACC A;  5AUK A;  4NJ6 A;  1JW9 D;  1LM8 B;  4TUU A;  1WI0 A;  4WAF A;  1LO5 D;  1XQQ A;  1RRB A;  2FCM A;  5EE9 A;  4P6V F;  4GLS C;  4BKS A;  1XF5 L;  3RUI B;  4WH4 A;  4HVB A;  2IDY A;  3M62 B;  3AN1 A;  4M8N A;  2XEW A;  2L7R A;  3EEC A;  3NVY A;  4K81 A;  2OHF A;  5IA7 A;  2KFK B;  1T6B X;  1ZOY B;  1E5W A;  4FN2 A;  2DZI A;  4PYU A;  1XXG A;  3DHH C;  4X57 B;  3W5V B;  3ZVV A;  1NYR A;  1WMH A;  2GBR A;  2JZ3 B;  3GZN I;  2Y5B B;  2BTE A;  3I57 A;  1GC6 A;  4OVZ A;  2BS2 B;  3CWI A;  4ANX A;  3PLU A;  4XZ4 A;  1SBB B;  2BQQ A;  2ZCB A;  4HCN B;  4GU2 A;  4IWP A;  2ZCC A;  3A9K A;  1ZXH A;  1D5X C;  2DHZ A;  1RFK A;  3S2A A;  2N7J A;  1HE8 A;  3ZJT A;  2QDF A;  2JRH A;  3I9V 1;  2M56 B;  1XO3 A;  1KLU D;  4WWO A;  2ACZ B;  3DVG Y;  4AS1 A;  2LJI A;  4FHK A;  3L08 A;  2N9K A;  1MFW A;  1ROE A;  1TYG B;  1ZGU B;  2XK5 A;  3VQI A;  4W9J A;  2LHE A;  4IG7 B;  3CST A;  1I35 A;  5C23 A;  2LAS A;  1I4G A;  4DK5 A;  3IAM 1;  3P4S B;  4W9C A;  1OGW A;  2L52 A;  2LZ6 A;  2H89 B;  5KHO A;  1F2R C;  3N9Y C;  1EF5 A;  1DOY A;  1WXA A;  2JU6 X;  1SXT A;  5DPT A;  3TEX A;  3AMZ A;  4RF1 A;  2PTL A;  1ZDV A;  5I4D A;  3WA0 A;  4MH0 E;  4BKT A;  1B1Z A;  1HZ6 A;  3RT3 B;  2KJH B;  4NAM A;  1D3Z A;  1UEL A;  3A1Q B;  3FKY A;  2DAJ A;  1XLP A;  3NHE B;  3Q3F A;  3KWL A;  4JL9 A;  4KZ0 A;  3U30 A;  2PVO D;  4C80 A;  1U4A A;  1YJ1 A;  2V3S A;  2WXL A;  4YSY B;  3RZF A;  3RNG C;  1TIF A;  3V62 A;  2KDF B;  3ABV B;  1YX5 B;  4P7I A;  3PZ7 A;  4C00 A;  1QOF A;  5GXG B;  3VTU A;  2KVZ A;  3BY4 B;  2V3P A;  3AE7 B;  2EKI A;  3ZTD A;  2L8J A;  5AZH A;  3I63 C;  2N7D A;  1NEK B;  1DGJ A;  2BGF A;  2LGS A;  2JXX A;  3C8Y A;  4GDL A;  2WLB A;  2NBW B;  2KOX A;  4XX5 A;  2O6V D;  4HPL B;  4E71 A;  2K9X A;  5LXH A;  1TTN A;  2V4L A;  2KVR A;  1YX6 B;  3DBH B;  2UU7 A;  2R61 A;  1FRD A;  3KQ4 A;  4ACF A;  3HM3 A;  1LFD A;  3CIR B;  4YL8 A;  1D5Z C;  3B08 A;  1XD3 B;  3HM6 X;  3MC8 A;  2RDG A;  5L83 A;  2W54 A;  3KW5 B;  2KMM A;  5HKH A;  1E8W A;  4OZB A;  3V61 A;  4M01 A;  4S0R A;  1CJE A;  4ZHP A;  3NRZ A;  2LFI A;  2REX A;  5IKC M;  3B2G A;  3T3O A;  1L7Y A;  1VJK A;  3UGB B;  5J18 A;  4BKG A;  3KLS X;  4LLG M;  4DXA B;  2V9H A;  2D3B A;  1WGK A;  4TSS A;  2WDQ B;  3ZNZ B;  3Q8F A;  5BMH A;  1DOX A;  3NOB A;  2K3U A;  1T0R C;  2KN5 A;  1V97 A;  2JVC A;  1L0Y B;  1Z5S B;  1YN4 A;  2OJR A;  3Q2A C;  4D2K A;  4DDG D;  2MJ3 A;  1Q0W B;  3EGR A;  3OJ3 A;  1FMA D;  1SIF A;  1JWM D;  4PS7 A;  1ISN A;  1VRA B;  1VZ8 A;  3R8B A;  1FNV A;  3DHI C;  3CSF A;  1RLF A;  4E3C A;  2QHO A;  3H7S A;  3VUX A;  4IKG A;  2I1J A;  1ESF A;  1F0Z A;  4OZA A;  3Q14 C;  1ZXI A;  2DAF A;  3Q8C A;  1IP9 A;  5HG2 A;  2L0F A;  1F77 A;  2IPK D;  2WXR A;  3V6C B;  4PT5 A;  4ZRP A;  4NZL B;  1F52 A;  4GB9 A;  2ZW0 A;  3PZ8 A;  2X38 A;  3JSV A;  3Q69 A;  1FRR A;  2WP9 B;  2AL3 A;  4ANW A;  4Q2J A;  2N9P C;  3KUZ A;  4AWJ A;  4W9G A;  1I4R A;  2OOB B;  1ZPS A;  3A33 B;  4WIP A;  3WIM A;  1JRO A;  5CX3 A;  1CK1 A;  2E3T A;  1IUE A;  3V6E B;  2A5U A;  2WU5 B;  4AJW A;  3WAL A;  1QZE A;  2MJE A;  3W2D A;  3O65 B;  1SE9 A;  3PT2 B;  1GAQ B;  2DYO A;  1JML A;  1WGD A;  2PW9 A;  4M0W B;  2ZZP B;  2WGS A;  3URY A;  1WJ6 A;  4HRO A;  5JZE B;  3LYY A;  3DVG X;  3Q3O C;  1YJJ A;  3DVN U;  4RGN A;  2MP2 A;  1WIA A;  2LGY A;  1FIQ A;  2KQ4 X;  3H9D A;  3DBH I;  3TMP B;  2CHX A;  4LNF A;  2JZP A;  1IGD A;  2KTR B;  2NCN A;  2C7N B;  4WAA A;  5C2T B;  2M1M A;  5FR3 A;  2FCN A;  2BKF A;  5D6J B;  3P4R B;  2BWF A;  3EFU A;  3GS2 A;  1J8C A;  2QCZ A;  3DHG C;  5BYS A;  1WZ3 A;  1JWA D;  2HTH A;  2YLM A;  4AOF A;  2BWE S;  2B76 B;  3R66 C;  1J0G A;  3P42 A;  1MPE A;  4CO7 A;  3NZU A;  4ICU A;  4N59 A;  1N5W A;  2WX0 A;  1N60 A;  1F1H A;  1I7H A;  3DPD A;  2GB1 A;  2HD5 B;  5DPW A;  3PGE A;  3U8Z A;  4I6L B;  4EZK A;  4A9A A;  4KIK B;  2LUM A;  1L0V B;  2NBV B;  2ZW1 A;  3N1Y C;  3P2B A;  5D94 A;  4B6W A;  2G1E A;  2JZZ A;  1MJD A;  3UIN B;  2KZR A;  2O2V A;  3AE5 B;  3UQA A;  4ARI A;  4BZA A;  1TT5 B;  4A6Q A;  1YOV B;  3KYC D;  3OLM D;  1LXD A;  2ZPN A;  3RNC C;  2LI5 A;  2N9X A;  3NVV A;  2SAK A;  5H8Y E;  1WE7 A;  2VH1 A;  3SEB A;  4URK A;  2MBO A;  3FAH A;  3B9J A;  2KMA A;  2R2Q A;  1V49 A;  3DQV A;  2FID A;  4HPM B;  1AWD A;  1WE6 A;  1QT9 A;  3B2F A;  1E7U A;  2MEK A;  2KNB A;  1Y8R C;  1QQR A;  2EMT A;  4BBN F;  1WJN A;  2KTF A;  2KC2 A;  4YTP B;  4B0E A;  4JWS C;  2IND C;  4M8M A;  3P4Q B;  4RCO A;  1VCB A;  1I42 A;  1L6U A;  3FIL A;  4ARC A;  3HUI A;  4P1B C;  3TEZ A;  1V86 A;  3L17 A;  3APD A;  4RFB A;  2M4N A;  4M00 A;  1JRU A;  1NI3 A;  4FUL A;  1P7E A;  2L76 A;  4IOI E;  4WJP A;  4G0N B;  5D3D A;  3N3K B;  3U2S C;  1STE A;  4OZC A;  2K8B A;  3A4S C;  2KWD A;  3PSE B;  2LXA A;  4MT5 A;  1WH3 A;  2BT6 A;  1GUA B;  3V05 A;  2KX0 A;  1V1O A;  3ZQ4 A;  1HXY D;  3DWG C;  4WWM A;  2QIE B;  4GOC A;  2KJ6 A;  1UGM A;  4M02 A;  2KAC A;  2PVG C;  3NVZ A;  1KH0 A;  1TBE A;  1CQV A;  2LRW A;  2IGG A;  4JWU C;  4NQK E;  1C78 A;  3T9L A;  1WSP A;  2DX5 B;  3H7P A;  2VZK B;  3R7Q A;  3Q8E A;  2KFJ A;  5E6N A;  4WWP A;  3I5J C;  4II2 B;  4N6E B;  3ZW3 A;  3BVZ A;  2CU1 A;  3IHP C;  1K53 A;  2PMV A;  1T0S C;  3WAO A;  3PRP B;  3T3N A;  2H88 B;  2J53 A;  2QJL A;  1WMH B;  2YEP B;  2B3A A;  3QHT A;  2D11 A;  3IVF A;  3EUB 2;  4XWT A;  4YWG G;  1RFA A;  2IY1 B;  2KQS A;  4KV2 A;  1HQR D;  4HCP B;  3NJT A;  1OTR B;  1K51 A;  4CHK A;  2INN E;  1WXM A;  2A4Z A;  2JQR B;  2D3G A;  1TKG A;  3A9K B;  1P3Q U;  3EFC A;  3U7Z A;  2AQ2 B;  2WXO A;  2KD0 A;  4RM9 A;  2W82 A;  3TL5 A;  1TKE A;  2LWP A;  3RUL A;  2MX2 A;  2VZK D;  4PS8 A;  1ZW7 A;  4W9L A;  1AW7 A;  3N32 A;  2PE9 A;  4HKZ E;  1KOT A;  4J3O D;  2MH7 A;  2ON8 A;  1MG8 A;  2KAJ A;  2XK5 B;  2JT4 B;  3NZ3 A;  2W55 A;  4NJ7 A; 
#chains in the Genus database with same CATH homology
 1DGJ A;  3IXS A;  4MAC A;  2KDM A;  1K50 A;  1FXA A;  4A8X C;  2L32 A;  2BB5 A;  4ZYS A;  1TS2 A;  3C8Y A;  2WLB A;  3BII D;  2WDV B;  4DXF A;  2K9X A;  2BB6 A;  5HHD G;  2PLP A;  1L4D B;  3R2T A;  3HVZ A;  3BZD B;  1UNS A;  3AB5 A;  4HJG E;  2R61 A;  3W9C B;  1I4X A;  1XCQ L;  2EEL A;  4XE0 A;  5BYQ A;  1DOI A;  2WDR B;  2WS3 B;  1FRD A;  3KQ4 A;  3CIR B;  1NVI D;  1KLG D;  1D5Z C;  4ZOH C;  1FO4 A;  1M4V A;  2E6X A;  2RDG A;  1BML C;  2LEK A;  2XN9 C;  2W54 A;  3J9C A;  1VZ7 A;  2KMM A;  4LK0 M;  1JWU D;  1FXI A;  4OZB A;  3OWE B;  2K0P A;  5E6J A;  1CJE A;  1ET6 A;  3AE2 B;  3KWV A;  3NRZ A;  4UDU C;  4ZHP A;  2JSV X;  2LFI A;  3MC0 B;  3Q8A A;  2FE8 A;  3B2G A;  2RDH A;  1EWY C;  1B9R A;  3T3O A;  1VJK A;  1ENF A;  4O1N A;  1YQ3 B;  3TEW A;  5TSS A;  3H8H A;  3KLS X;  4LLG M;  3E56 A;  4YTN B;  1WGK A;  4TSS A;  1P7F A;  3AED B;  2SEB D;  4KGS A;  2WDQ B;  4JPS A;  1KFY B;  1N62 A;  1FFV A;  2WXI A;  3AE1 B;  4C7Z A;  2DYM A;  3Q8F A;  2WXH A;  5BMH A;  1DOX A;  5FKA C;  1I4P A;  1E9M A;  3P63 A;  2M0A A;  2K3U A;  2WQY B;  2TSS A;  2DLB A;  3O13 A;  3UI3 A;  1SIJ A;  1V97 A;  2NMQ A;  2BW2 A;  3P1M A;  2Y5C A;  4H2A A;  1L0Y B;  2K5P A;  1OFF A;  1QOB A;  1MI0 A;  2CJO A;  1E10 A;  3U52 E;  1IGC A;  1GB1 A;  1MHH E;  1WWT A;  1YN4 A;  4D2K A;  3AE9 B;  2MJ3 A;  3EGR A;  1YMH E;  1L0X B;  2WXG A;  4KGT A;  1FMA D;  1JWM D;  1WXQ A;  4M0W A;  3WCQ A;  5MPO A;  1SJE D;  1VRA B;  4GDL B;  1VZ8 A;  2ICI A;  2WU2 B;  2J52 A;  3R8B A;  4YSZ B;  1FNV A;  1D5M C;  3MFG A;  1L5P A;  3AH7 A;  1C4A A;  1GB4 A;  1AN8 A;  4EE2 A;  1ZUD 2;  4IKG A;  1L6V A;  2FUG 1;  1N61 A;  3TEY A;  1ESF A;  2L1A A;  1F0Z A;  2N9L A;  3MHZ A;  2FBW B;  4OZA A;  5H92 C;  1SSN A;  1ZXI A;  4WUR A;  1TZO A;  2DBY A;  1FEH A;  3Q8C A;  4IDI A;  5HG2 A;  1SEB D;  1F77 A;  1EM7 A;  3TUO A;  2IPK D;  2WXR A;  1T5X D;  4PT5 A;  1HA5 A;  1FNU A;  4ZRP A;  4NZL B;  5EE0 A;  1ET9 A;  1ZP0 B;  1FD6 A;  2ZW0 A;  3PZ8 A;  3ZJV A;  2X38 A;  1CZP A;  4OW0 A;  4YXD B;  1TS4 A;  3Q69 A;  1FRR A;  2WP9 B;  1I4H A;  1A70 A;  3VR9 B;  3MJ5 A;  2WXK A;  4Q2J A;  5G5G A;  1VZ6 A;  1TS3 A;  2IJ0 A;  4KKI A;  3LXF A;  4CQN A;  2CJN A;  1FM0 D;  1I4R A;  1K52 A;  1ZPS A;  2JXT A;  3AEA B;  3AEG B;  3BK1 A;  4WIP A;  1JRO A;  4XDD A;  1CK1 A;  2E3T A;  2HTM E;  1IUE A;  3EA6 A;  5EE3 A;  1BUI C;  2WU5 B;  1R7S A;  3RPF C;  1YJI A;  2W3R A;  1SJH D;  3AEB B;  1VDV A;  4N58 A;  2MJE A;  2QEJ C;  3AV8 A;  2GRI A;  1SE4 A;  4JX1 C;  3W2D A;  3RFZ B;  1E0Z A;  1PGA A;  4RNA A;  2M19 A;  1XCT L;  2WXQ A;  1HEZ E;  5BMI A;  1TY0 A;  1FFU A;  1GAQ B;  2DYO A;  1RWS A;  5AUI A;  1JML A;  1KRH A;  2PW9 A;  2L83 A;  5HFY A;  3VR8 B;  3LB8 C;  1IBX A;  1PDX A;  2JWU A;  4HKQ A;  3URY A;  1TY2 A;  4DQO C;  4HRO A;  1TS5 A;  3LYY A;  1J7C A;  1PUT A;  1QF6 A;  2HDE A;  4US9 A;  1YJJ A;  3HRD D;  1PGB A;  3AEC B;  5BMG A;  4NAW B;  4RGN A;  3AEE B;  1FIQ A;  2KQ4 X;  3BYY B;  1Y56 A;  3AM9 A;  4KGR A;  1SF0 A;  2BYT A;  5JXV A;  3IT4 B;  4RGM A;  2ONQ A;  3W5U B;  2JZP A;  1IGD A;  2D5G A;  2NTS A;  2NTT A;  1E7P B;  3TSS A;  4REZ A;  5C2T B;  1MHX A;  5C3J B;  5FR3 A;  1I4Q A;  4LTU A;  1V1P A;  4C7Y A;  3P4R B;  4US8 A;  2V4I B;  2MJD A;  3GS2 A;  4DXG A;  5BYS A;  1JWA D;  1SB3 C;  1WRI A;  4TQ0 A;  2V3N A;  2B76 B;  1DYQ A;  3P42 A;  2JYE A;  1EWC A;  1E6E B;  1MPE A;  4R3D A;  4MM3 B;  4A90 A;  4N59 A;  1N5W A;  3SFD B;  1D4B A;  3U4E G;  1QOG A;  1N60 A;  2RMM A;  3BK2 A;  2Y5P A;  3W1S A;  3IAS 1;  1FCC C;  3FC4 A;  1I7H A;  3MP9 A;  1L4Z B;  2GB1 A;  2IGH A;  4B0M A;  1YN5 A;  2G9H D;  1OQR A;  2I38 A;  4RH6 A;  4A9A A;  4JE3 B;  4C56 C;  1N5X A;  1GOZ A;  2LUM A;  3DWM A;  4RF0 A;  1MVK A;  4TQ1 A;  1L0V B;  1D6E C;  1ZE3 D;  2ZW1 A;  4HRS A;  3ZJU A;  3ETR A;  2G1E A;  4ZRQ A;  2AQ1 B;  3Q8B A;  1JQ4 A;  1QLB B;  4HEA 1;  2INP E;  3AE5 B;  2PKO A;  2WXM A;  1ACC A;  5AUK A;  2JYT A;  1JW9 D;  2K22 A;  4USA A;  4ARI A;  1QKZ A;  3AE8 B;  4AQ7 A;  4A6Q A;  1PFD A;  4XDC A;  4WAF A;  1LO5 D;  5EE9 A;  4P6V F;  4GLS C;  5G5H A;  1XF5 L;  3NVV A;  2SAK A;  5H8Y E;  5BYR A;  4WH4 A;  2W55 A;  3SEB A;  2IDY A;  1JWB D;  3FAH A;  2N0S B;  1SE3 A;  3B9J A;  3AN1 A;  4GDK B;  1IBX B;  1FNW A;  3P4P B;  3NS1 A;  2V0G A;  1AWD A;  3NVW A;  3SFE B;  1PYW D;  3NVY A;  3BVG A;  1BXT A;  2OED A;  2OHF A;  3GP7 A;  1T6B X;  1ZOY B;  1QT9 A;  4YTM B;  2WNM A;  3B2F A;  1EU3 A;  2MEK A;  1XXG A;  4YSX B;  4MH8 A;  1JCK B;  1QQR A;  3GB1 A;  3W5V B;  1NYR A;  5EE1 A;  4B0E A;  2W3S A;  4YTP B;  1V1P B;  4JWS C;  1TJE A;  1AYF A;  3P4Q B;  2BTE A;  4RCO A;  3I57 A;  1L6U A;  3FIL A;  4OVZ A;  2BS2 B;  1C9F A;  1NEN B;  4ARC A;  3CWI A;  1JRP A;  2BBC A;  3HUI A;  3TEZ A;  3HVD A;  2BS4 B;  1SBB B;  4L1B A;  4RGT A;  1YNT E;  1XLO A;  2LHD A;  4RFB A;  1XLN A;  3NUH B;  1NI3 A;  4ZHO A;  1P7E A;  4IOI E;  1VR9 A;  1ZXH A;  5D3D A;  1D5X C;  2J42 A;  4L2Y A;  1RFK A;  3U2S C;  2GI9 A;  1STE A;  1QIL A;  2N7J A;  1C76 A;  2LGI A;  4OZC A;  3ZJT A;  2PIA A;  2KWD A;  4OHJ A;  3I9V 1;  2Y3A A;  4RGO S;  2M56 B;  1XO3 A;  4MT5 A;  1KLU D;  5D3I B;  1F2R I;  2ACZ B;  5D7G A;  4YT0 B;  5LNK 1;  3AEF B;  2BT6 A;  1N63 A;  4AS1 A;  3V05 A;  2LJI A;  2QSD A;  4NJC A;  1YN3 A;  1V1O A;  3AE6 B;  3ZQ4 A;  3VRB B;  1HXY D;  3DWG C;  4WWM A;  1FCL A;  2QIE B;  2N9K A;  1UWX A;  1XEE A;  1JWS D;  1ROE A;  1TYG B;  1RM6 C;  1WYG A;  2KAC A;  3VQI A;  2PVG C;  2QMT A;  3NVZ A;  1KH0 A;  2I2Y A;  1J7B A;  2LHE A;  1CQV A;  3SR6 A;  3R2I A;  2IGG A;  4JWU C;  1TKY A;  2AQ3 B;  1C78 A;  1Q10 A;  1WSP A;  1I4G A;  2Q5W D;  1ZDX A;  3IAM 1;  3P4S B;  2VZK B;  3Q8E A;  1J7A A;  2XNA C;  2KN4 A;  2L52 A;  5T8I A;  4FXC A;  3BYT B;  1V8C A;  2H89 B;  4N6E B;  5FK9 C;  1F2R C;  3BVZ A;  1RYJ A;  3N9Y C;  2Z8L A;  1DOY A;  1K53 A;  2J4X A;  2PMV A;  3ZGZ A;  2JU6 X;  3AE3 B;  1SXT A;  3T3N A;  2BS3 B;  2H88 B;  2IGD A;  2J53 A;  4L23 A;  3TEX A;  2WXF A;  2QJL A;  1EU4 A;  3AMZ A;  1UUP A;  2AX5 A;  2YEP B;  2PTL A;  4RF1 A;  1UWM A;  1C4C A;  1ZDV A;  3EUB 2;  4XWT A;  4YWG G;  5I4D A;  3L4P A;  3FIL B;  3PO0 A;  1HQR D;  2RPV A;  1UGJ A;  3V3X A;  3VRA B;  1C77 A;  1B1Z A;  1HZ6 A;  3BWU D;  4WQM A;  1HZ5 A;  1T3Q A;  4KX6 B;  5HI1 A;  1K51 A;  4NAM A;  1OQQ A;  2INN E;  3BVM A;  2JQR B;  1SE2 A;  2CU3 A;  1TKG A;  3E9S A;  3IT6 B;  1C79 A;  1NYQ A;  1XLP A;  3KWL A;  2PVO D;  1JAL A;  2WXP A;  4XWW A;  1YQ4 B;  4C80 A;  3U7Z A;  2AQ2 B;  2WXO A;  2WXL A;  4YSY B;  4A55 A;  2DWQ A;  2W82 A;  2YEP F;  3AE4 B;  1TKE A;  2QIL A;  1PGX A;  2VZK D;  3ABV B;  3ZYY X;  3PZ7 A;  1QOF A;  5GXG B;  1QOA A;  1AW7 A;  1GPX A;  4HKZ E;  4ITK A;  2V3P A;  3AE7 B;  2EKI A;  2WXN A;  4J3O D;  1C4P A;  2MH7 A;  4KKJ A;  2ON8 A;  1KTK A;  1XLQ A;  2LMC A;  2WXJ A;  4P16 A;  2KAJ A;  2JX5 A;  3NZ3 A;  1VLB A;  4TMA B;  1NEK B;  1KF6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...