4HROA

Crystal structure of h. volcanii small archaeal modifier protein 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
87
structure length
87
Chain Sequence
GAHMEWKLFADLAEVAGSRTVRVDVDGDATVGDALDALVGAHPALESRVFGDDGELYDHINVLRNGEAAALGEATAAGDELALFPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small archaeal modifier protein 1
publication title Crystal structure of H. volcanii small archaeal modifier protein 1
rcsb
source organism Haloferax volcanii ds2
molecule tags Protein binding
total genus 24
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4hroA00
1AYFA 3SFDB 1R7SA 1KRHA 3AE8B 4US9A 1WWTA 4YSZB 4P6VF 3VRAB 1WRIA 3SFEB 4JWSC 2L52A 1E6EB 1V97A 1L6VA 2QIEB 4JX1C 3P63A 4C7ZA 1N62A 1OQRA 1TKYA 1FXAA 1QOBA 3AE1B 1CZPA 3L4PA 1ZOYB 2JX5A 2M56B 5EE1A 5G5HA 1E7PB 4WQMA 3P1MA 1YJIA 3AB5A 3LXFA 3P4PB 1WXQA 1GPXA 3B9JA 1NVID 1ROEA 1WGKA 1ZUD2 1NENB 5EE9A 3RPFC 1YQ3B 1VDVA 1J7AA 3AH7A 2MJEA 3HRDD 3W9CB 1SB3C 4N59A 1E10A 3AMZA 1QT9A 4YTPB 5AUIA 4USAA 1TKEA 4YTMB 1WYGA 3AE2B 1JW9D 1FRDA 4YSXB 2G1EA 2OHFA 1TYGB 1VLBA 2H88B 3AEGB 1JRPA 1N61A 4YTNB 2WLBA 3AV8A 1FIQA 1JALA 3PO0A 5EE0A 4YT0B 1XLOA 3W5UB 2WU5B 3BIID 3AM9A 4ZOHC 4YSYB 3AE4B 1QF6A 2PIAA 1YQ4B 2E3TA 3DWGC 3CWIA 2W3RA 4HROA 4ZHOA 2KAJA 3VR8B 1FFUA 4YXDB 1RFKA 5GXGB 1XO3A 3EUB2 1JROA 2QJLA 1AWDA 3AN1A 4US8A 3ABVB 4KX6B 5MPOA 1FO4A 1ZP0B 1ZXIA 3NVYA 1NYQA 1V8CA 3AECB 1FXIA 5H8YE 1XLQA 1SIJA 3AE7B 1I7HA 1B9RA 2WS3B 3B2FA 5C3JB 1N63A 1FM0D 1QOGA 3AE6B 5G5GA 1NI3A 2FBWB 2WDQB 2CJOA 1FMAD 2K9XA 5EE3A 2ACZB 4A9AA 2MH7A 1RWSA 5H92C 2WP9B 1NEKB 3LB8C 2AX5A 3B2GA 2W3SA 1XLPA 4JWUC 1N5WA 1XLNA 3P4SB 3P4QB 1DGJA 2BS4B 2Q5WD 2WDVB 3AEBB 3ETRA 1PUTA 2KMMA 5C2TB 1T3QA 3ZYYX 2DBYA 5AUKA 1EWYC 2LEKA 1FFVA 1OFFA 3AEAB 2HTME 2CU3A 1PFDA 3AEDB 2PKOA 1DOYA 1L5PA 1L6UA 2W54A 3AE3B 3NS1A 2MJDA 2M19A 1RM6C 1TKGA 1DOIA 3VR9B 3NVVA 2DWQA 3FC4A 3KWLA 1QOAA 2BS2B 2H89B 2K22A 2K5PA 3FAHA 1L0VB 3AEFB 3AEEB 1PDXA 1N5XA 2CJNA 4WWMA 1E0ZA 3NRZA 4N6EB 2MJ3A 4C7YA 1OQQA 1QOFA 1YJJA 3VRBB 1E9MA 4HRSA 1KFYB 3DWMA 4LTUA 1TJEA 1J7CA 1UWMA 1IUEA 3HUIA 3CIRB 3NVWA 1VJKA 4FXCA 4N58A 2JQRB 3SR6A 1JQ4A 1N60A 1GAQB 2W55A 1CJEA 1KF6B 1RYJA 2PVGC 4ZHPA 3WCQA 1QLBB 3HVZA 2Y5CA 3P4RB 2B76B 1NYRA 4C80A 2WDRB 2EKIA 1F0ZA 3NVZA 1SF0A 2PVOD 1FRRA 3W5VB 2BT6A 2BS3B 2WQYB 2WU2B 2L83A 3AE5B 3AE9B 1JWAD 1JWBD 4IDIA 1DOXA 4ITKA 1J7BA 2N0SB 1A70A
chains in the Genus database with same CATH superfamily
2R61A 3BY4B 3SHQA 1CMXB 1AW7A 3QQ8B 1MVKA 4EFOA 2MSED 1FNUA 1T0YA 3BK1A 4EOYA 2BQQA 3WANA 3M62B 2BW2A 2MP2B 2SEBD 2ZVOA 2WXMA 1YJIA 1A5RA 1WXQA 2GB1A 4P1CC 3N1XC 3RYTA 3OJ4B 2MJEA 3W9CB 4LNIA 3UQBA 3ZJVA 3Q3FA 4BKTA 4RH6A 3PSEB 3MJ5A 2L7RA 3VTUA 3DWGC 2KAJA 1EF5A 4WIPA 5GXGB 1JROA 4G0NB 3L10B 5E6NA 2MBEA 1KJTA 1UGJA 3DHHC 1YMHE 2KACA 4GDLA 5H8YE 3RN9C 3RI7C 3B2FA 5G5GA 1QOGA 2KWUB 1JWUD 1WE7A 4WAFA 4K7SA 1XLPA 4HCNB 2DAJA 2OOBB 3ZYYX 5C2TB 2LXAA 2GBKA 3GB1A 3L54A 1FNVA 2IO0B 3PRMB 2EMTA 2R2OA 4PS3A 4EUTA 2MRPA 1ZDXA 5FR3A 2MLBA 4MELA 4C7YA 4M00A 4K3CA 1WY8A 1E9MA 1KFYB 4WJPA 2JSVX 4MEMA 4KZ0A 5IN7A 1E8ZA 1PGXA 2KTRA 4PS7A 1N60A 5D94A 1RYJA 2O6VD 2DYMA 1H8CA 3P4RB 1LQBA 4HEA1 3DVGY 4TQ0A 1DOXA 3B0AA 4LCDE 1KRHA 4US9A 4YSZB 2RDHA 3ECIA 2RPQA 1OQRA 2C7NB 1DYQA 4IWQA 1IYFA 3LXFA 3Q8CA 1NDDA 2IGHA 4WAAA 4RGNA 2IY1B 4YTMB 1L0XB 4NAWA 2MX2A 3K9OB 3PO0A 1IPGA 3PLUA 1ET9A 4DBGA 3O13A 1JMLA 2DNFA 3H7PA 1FFUA 2KN4A 1K50A 2O6VA 2QJLA 3ONSA 2FNJB 3ABVB 1NYQA 4W9CA 1FXIA 2WDTB 3PTFC 4RM8A 5IP4D 2WP9B 2MCNB 4KKJA 2IO1B 4KKIA 3N1ZC 3T3OA 2KWDA 2DENB 5TR5A 2DAFA 1IGCA 2D3GA 5E6PA 1HQRD 1Z5SB 2MA9B 2N9EB 1GC7A 3M95A 3ALBA 2JWUA 2K22A 2KYWA 2KFJA 4KIKB 5D2MB 4AWJA 2J53A 3GZNB 4JIOU 4LTUA 1TJEA 4FXCA 2K1FA 5L83A 1WYWB 3ZXRA 1KF6B 1C3TA 1YOVB 3SDLC 2L83A 3T8MA 1UELA 1WSPA 2NVUI 3EA6A 4M8NA 4B6WA 1T6BX 3PREA 4P6VF 4ANUA 1RLFA 1IGDA 1P98A 3ZNHB 5BYSA 3UQAA 2QCZA 1E7PB 2FUHB 2QSDA 3P1MA 1ACCA 2PMVA 1HZ6A 1J19A 4LNKA 1MHXA 3DBRB 4XDCA 3RMKC 1V86A 3QAQA 3RD2A 1WIAA 2HJ1A 3AV8A 1V6EA 5AEKB 3W5UB 3NG0A 2N9LA 4NJCA 5D3IB 1F2RC 4YWGG 2XEWA 4LNOA 3CMMB 2JU6X 4BAXA 4LK0M 1FO4A 4AJYB 3PZDA 2JZZA 1TZ1A 2D3BA 1LFDA 2JT4B 3H7SA 4GU2A 2WDQB 1D5ZC 1NBFC 1E7UA 4JQWC 4TV3A 3W1SC 1PGBA 1XLNA 4DHJD 1TS2A 5AZGA 2K8BA 3AU5A 1HEZE 3A1QA 3MHZA 1OFFA 2GOWA 3ZIMA 3HHMA 3UIOB 1ZPSA 2MJDA 3URYA 2ZPYA 3FC4A 2K5PA 2N7DA 1PDXA 2CJNA 2Y5BB 3CIRB 2INCC 4LNFA 4BZAA 3K9PB 3J9CA 2B76B 4C4VA 4RNAA 2IZVB 2MQJA 1PQSA 4CQNA 2NPTA 3AE8B 3MJWA 2KLCA 2LGDA 1SE9A 2K8CA 4JWSC 1S3SG 4C7ZA 5BMHA 2NBUA 1WXVA 3L4PA 2WYQA 3E9SA 4WQMA 2N1VA 5JHBA 3IG3A 5E6JA 3A9KA 2KFKA 1GOZA 2N9KA 1V5TA 2NBVB 4WWNA 3ZO5B 3TJPA 2G3QB 2BPSA 4MSQB 1WGRA 1JWMD 1IBXA 3BIID 2BYEA 2LZ6A 3UIPB 1QF6A 3CWIA 4KGRA 2K0PA 3NHEB 2D3CA 4JE3B 2REXA 4B95A 1LO5D 3AN1A 4BBNC 2PW9A 1UWXA 4NZLB 3BINA 3L16A 3EFUA 2KLGA 1NI3A 2BB6A 2CJOA 4DWFA 3BVMA 1ZW7A 3VTVA 2Q5WD 3B08A 3H6NA 4LDTB 1WRDB 5LXIB 1C78A 1YNTE 2N9XA 2NS5A 3QARA 2LGYA 1CK1A 1V49A 2DZIA 2ICIA 2KDFB 3VFKA 3A9JA 4OW0A 4K81A 3DWMA 4GDLB 3HUIA 2JQRB 2WXQA 5I4DA 3KYCD 2FCQA 4F7ZA 3R7QA 2GBMA 4H2AA 3KUZA 4NJ6A 1NYRA 2EKIA 2C5LC 2WXLA 4K1RB 4HKZE 3I3TB 1J7BA 2N0SB 1WMHA 1TS3A 2HE7A 3RFZB 2Z8LA 2M8SA 5FKAC 2IPKD 4NPNA 1N62A 4WJNA 3QWZB 4K7UA 2UYZB 2NTTA 1XF5L 1ZOYB 2LMCA 4DXGA 2LD9A 5CX3A 1XT9B 1XD3B 5G55A 3RNBC 3R3MA 2INPE 1WGKA 4REZA 3WAOA 1YQ3B 3AMZA 5AUIA 3KQ4A 4USAA 1QQRA 1KOTA 1JW9D 1UF0A 3EHVA 3EECA 4M8MA 1I4QA 2L8JA 1PYWD 2QDFA 3RUIB 1STEA 2KO3A 3V3XA 3APFA 1BMLC 1XO3A 2JRIB 4DK5A 1WJUA 2M17A 3PRPB 2BTEA 2KX0A 1ZXIA 2V3NA 4F8CB 5KHQA 3AE7B 1PGAA 5EE3A 1M94A 1V1PB 3KH0A 1UUPA 4JL9A 2LUMA 5IA7A 4AS1A 1FD6A 3N9YC 1I35A 4NAWB 1T3QA 3U4EG 2WX1A 1Q0WB 1JCKB 4HPPA 2V1YA 2KZRA 4WWOA 2KDIA 2RDGA 3MC0B 1E5WA 3V6EB 3VR9B 5HI1A 3V61A 3L0WB 1G6JA 1FXTB 4XWWA 1HZ5A 2D07B 2O6VB 1J7CA 4MSMB 2YLMA 1VZ6A 2W55A 2GMIC 1UH6A 2YEPB 3Q8EA 1F1HA 2VZKD 3Q2AC 5D3DA 4NJ7A 4ITKA 4NQLB 2BYTA 3A33B 1SE2A 3KW5B 2KOXA 1S1QB 4GGQA 4ASWC 3WALA 5BO4B 2Y5PA 1E8XA 1EF1A 1XCTL 2KD0A 1J8CA 1ROEA 1H4RA 1GG3A 1QKZA 5BMGA 2L76A 3QHTA 1FNWA 3AEGB 1F52A 3T9LA 2WLBA 3R66C 1AARA 2QHOA 3X23A 2RPVA 1WJ6A 1FCCC 2KDEB 4W9LA 2J4XA 4W9FA 2INDC 2BB5A 3HIZA 3U7ZA 5J17A 5JH5C 4HDOA 1TGZB 2AQ1B 3UGBB 1KLUD 1UD7A 2KDBA 1TIFA 2FBWB 3X0WA 3Q69A 3IT6B 1YQBA 3SEBA 2LGIA 3EGRA 4JPSA 3T3NA 1BXTA 4MJSB 2TSSA 3FILB 2IYDB 3DVGX 1L4ZB 1N6ZA 1RRBA 5CTRC 2CU3A 2KN5A 3PZ8A 2YVCA 3OG5A 2WWZA 4BKSD 1EO6A 4N6EB 1C4CA 4HRSA 3PZ7A 2MBHA 3QC8B 4AP4C 1WM2A 1UZXB 3N20C 2ZJDA 3U7DA 3C8YA 4TUUA 3HM3A 2PJHA 2BS3B 3AE5B 4HKQA 2RMMA 4W9DA 4HLEA 3N32A 4W9IA 3IVFA 1WRIA 3A1QB 4A6QA 2N7JA 3TIXA 1L6VA 1MI0A 2IBIB 2ZW0A 3MTNB 4JGHB 2V4IB 3RNCC 4A3PA 4EZJA 1HXYD 2M0XA 2O2VA 3VUYA 4IM0A 3BVZA 4OHJA 2WHIA 4URKA 2WXOA 4ANXA 1K53A 3C0RB 4FJYA 1TYGB 4BKSA 3UF8A 2KC1A 5J18A 4E74A 3RZWC 1WGHA 2JZPA 2LJ5A 4L2YA 4OVVA 3H9DA 2KQSA 3HK0A 4YXDB 2WXHA 4RMAA 1AWDA 2AQ2B 4KX6B 4B9KA 4OZAA 4XX5A 4RGTA 2DZJA 2KNBA 2BF8B 4DXAB 3ZQ4A 4DHJB 2WXPA 2DZMA 4L1BA 2KFKB 1E90A 3U8ZA 3B2GA 4CHKA 3ZRFA 4IWPA 2C7HA 4ANVA 5AUKA 3BVGA 1X1MA 1HTQA 4GSWA 3U52E 1IBXB 1L6UA 3ML9A 5IOIA 2KANA 3AEEB 4WWMA 3RNFC 4ZRQA 3VUWA 3NVWA 1IP9A 2AEHA 3IAM1 4BBNF 2CS4A 1EM7A 3VAWA 4ICUA 3AXCA 2BT6A 2WU2B 3FKYA 1FCLA 4IUMB 1YN5A 1AYFA 5HFYA 1ZGUB 3U2SC 4NY0A 2K6DB 4E71A 1WFYA 3ZNID 1V5OA 4TSSA 1SGHA 2K8HA 4MGIE 1TY0A 1UNSA 4ICVA 4TMAB 3VXWA 3N1YC 3A9JB 1NVID 1TY2A 5DPSA 3AH7A 3HRDD 3R7RA 2LFIA 2WXGA 3Q8FA 1I4GA 1ZDVA 3CF6E 2OHFA 4RGOS 1N61A 1C1YB 5BMIA 2K6QA 3H8HA 1R4MI 4HVBA 2KJHB 3AE4B 2E3TA 1XCQL 2IY0B 4ZHOA 1WMHB 2K39A 3BYTB 2PPHA 1TZOA 3MC9A 5DCNA 4CO7A 1WI0A 2KDMA 3ZW3A 2V4LA 1C4AA 2OJWA 1VZ7A 4A8XC 3BK2A 4IW0A 4XC2A 1N63A 1D5XC 1FM0D 1OQYA 4S0RA 3NUHB 4HK2A 2KXJA 1C4PA 2GBNA 1SE4A 1SEBD 1TTNA 1BT0A 1WH3A 2ON8A 4PS8A 3P4QB 2WX0A 1M4VA 3N3KB 2KK8A 2LEKA 2J0MA 1MHHE 5IAAC 1MG4A 3AEAB 1WGYA 2PKOA 3QX1A 4BFRA 1B1ZA 2C60A 3KWLA 4GXBA 4GB9A 3FAHA 4BKGA 1P9DU 4HPLB 1FPYA 3W1YA 3NRZA 3PPAA 3TL5A 1QOFA 2MW5A 1YIWA 4D2KA 3RZFA 2JXTA 3WCQA 1SJED 2KC2A 2WDRB 3NVZA 2E6XA 4EKUA 4G3XB 2MHJA 4FJZA 4RF0A 3GS2A 1T0QC 1FXAA 1I4XA 4NNJB 1CZPA 4ZYSA 4ARCA 1I4HA 1TBEA 3DHGC 1WGDA 1JWSD 1WXSA 2PTLA 3DBHI 1QT9A 5E6OA 2L0TA 5C1ZA 2UU7A 4MGZE 1VLBA 2H88B 3I57A 1JRPA 3KLSX 1XLOA 2LWPA 2I1KA 3B1LX 2BBCA 1VRAB 2LRWA 2KWCA 4FBJB 3GP7A 1P1AA 2BVCA 1KM7A 1V9JA 2FIFA 3DPDA 3WAPA 5LNK1 2M1MA 4W9HA 2PEAA 4US8A 2PE6B 3UI3A 3ZTCA 4LLGM 1XLQA 4RCOA 4KSLC 1B9RA 2LGSA 2HTHA 3JW0X 1CQVA 3Q3MC 4A9AA 4PK1A 3QK0A 1WR6E 5HHDG 3SD5A 2J52A 2C9WB 1N5WA 5C23A 4C4VB 2ZEQA 2LVPA 3V05A 2JYEA 2OEDA 2RGFA 1MG8A 1KTKA 3AEDB 1OEYA 2FUG1 4KDLB 2M19A 2DWQA 3PHXB 4HWIB 1XEEA 1ZE3D 1N5XA 3Q3JA 4FN2A 5AZFA 2L1AA 2D2QA 5JZEB 2VRRB 2VZKB 1L2NA 2B3AA 4GDKA 3DOWA 1ZKHA 1WXAA 2LVQA 3HVZA 4MH0E 4M0WA 3I5JC 1JWBD 1LM8B 3RNEC 1V1OA 4HXDA 4L23A 2KQ7A 4BOZB 3ZNGC 2KMAA 2PE9A 4MDKE 2J42A 2FAZA 2GBRA 1Y56A 1D6EC 3VUXA 2IO2B 3P4PB 1KLVA 3B9JA 5J2RA 1J7AA 2LRUA 4S17A 4B0MA 1Q10A 4P16A 3AE2B 3H1UA 4OZBA 4KVGB 2WXKA 1LGRA 3MFGA 4ZOHC 3JYUA 4A3OA 4ANWA 2BKRB 3ZJUA 3JVZX 3W1SA 1YX5B 1WX8A 2FCMA 1C77A 3V6CB 2KTRB 1SIJA 4LJOB 3ZUNA 4OVZA 4MACA 3ENEA 3AE6B 2K9XA 2ACZB 2JF5A 2JUOA 3ZKJC 5D6JB 2O2VB 4YL8A 2N7EA 5CHWA 4K7WA 3RULA 3ETRA 2KMMA 2DBYA 2K25A 4XZ4A 4PYUA 2V3PA 2DZKA 2I38A 2HTME 3R8BA 2L3ZA 5BYQA 4FADA 2DX5B 5CHFA 3AULA 3V62A 4P1BC 3L08A 1U4AA 2N4FA 2NTSA 2G45B 1P0RA 2JVCA 2L00B 1AN8A 4DDGD 2HJ8A 1GAQB 2A5UA 3PRZA 1MJDA 3M3JA 1D5MC 4PT5A 2WQYB 2CHZA 2JYTA 1Q1OA 1RFAA 3KWVA 1R7SA 3H7PB 3SFEB 4MM3A 4KZCA 2LUEA 4JX1C 2LXCA 2MBOA 2EKEC 1YD8U 2MWSB 2N1WA 4C56C 1SBBB 1GPXA 1NENB 2FCNA 1I42A 5DPWA 2LHDA 4CYEA 3GE3C 2DHZA 3TEZA 4NAMA 2V0GA 2PLPA 4AJWA 5FK9C 3VTWA 4FA6A 1QILA 3ZDTA 4ZRIA 2ZZPB 4XE0A 3HVDA 4FHJA 1T0SC 2RD0A 3C19A 5AZHA 2JZ3B 2G4DB 1RWSA 4IWOA 3P4SB 2WDVB 4MGYE 1D4BA 2QILA 4II2B 1EWYC 1Y8RC 3TBLD 1FFVA 3DVNV 1KLGD 3AU4A 2GI9A 1XXGA 3WA0A 1OTRB 3NVVA 1QOAA 2KJ6A 2BS2B 2H89B 4JLCA 1D3ZA 1L0VB 3AEFB 3NZ3A 1OQQA 3Q3NC 3ZNZB 2L05A 3Q3OC 4HPMB 4LJPB 4KV2A 3IFWB 1SJHD 5BYRA 2Y5CA 4AOFA 4C80A 1F0ZA 2WGSA 1F9JA 4J3OD 4W9KA 3P42A 1C76A 3VRAB 3WIMA 4NQKE 4A90A 3DBLI 4R3DA 4EEWA 2D10A 3PVLA 1QOBA 2M56B 2WXFA 5EE1A 3QCAA 1QZEA 1VZ8A 4KGSA 3A4SC 5EE9A 1SSNA 2CR5A 3Q14C 1E10A 1TKEA 3ZXVA 4WJQA 5D7GA 1FRDA 3OLMD 4UDUC 2G1EA 4IG7B 1JALA 4G50A 1SXTA 4XDDA 1YQ4B 2W3RA 4XGAB 2DYBA 1Z2MA 3GOEA 3IHPC 2UWQA 3VH4B 4BOSC 2IGGA 3S2AA 5JHAA 3P2BA 1R4MB 1E8WA 1R4NI 3M63B 3U30A 3PHWB 3PT2B 2W9NA 3I9V1 3Q6BA 2AX5A 3JSVA 1ENFA 1YX6B 1E8YA 4JWUC 1DGJA 3ML8A 2NMQA 3IXSA 2NPTB 3DVNU 4RM9A 3W2DA 1DOYA 3PGEA 4QAYA 3DHIC 4PYZA 1WZ0A 2MJ3A 2CKHB 3A9KB 3NY5A 2GLSA 4N58A 3Q8BA 1EUVB 4DQOC 2J0JA 5TSSA 2D11A 4EZKA 4WJOA 4GOCA 1V1PA 3ZDMC 2EELA 2XNAC 1HA5A 4HCPB 1V81A 1WZ3A 2D3AA 2CU1A 2FIDA 2M0AA 1V80A 2AYOB 2WXJA 4FJVB 2XK5A 4DDID 3IT4B 2MEKA 1WF9A 4ZRKA 2LASA 1VDVA 3L13A 1J0GA 4TKNA 1UBQA 3OWEB 3KUDB 1TT5B 4GDKB 4YSXB 3QJZA 2LI5A 2AWTA 4HDQA 4M0WB 3AM9A 1WX9A 2KT7A 1WR1A 3DBHB 2GRIA 2Y3AA 4HROA 4HJKA 3QA8A 3VR8B 1ZXHA 2BYFA 3EUB2 3BWUD 3EFCA 5DPRA 4DHZB 3MHSD 4W9GA 1T0RC 2KVRA 3N30A 2BS4B 1WJ4A 3IAS1 2ZCCA 2Z0DB 1XQQA 2XBBC 3ZRCA 4K3BA 1TS5A 4BVUC 2N9PC 1Q5WB 1LXDA 2W54A 4DHZE 2MP2A 4ARIA 3NS1A 3NJTA 4FHKA 2I2YA 4GLSC 4FULA 5L95C 2KQ4X 4X57B 2ZNVB 2LJIA 1E0ZA 3VH3B 3VRBB 3PV1A 4GIVA 2KVZA 5G5HA 4M02A 2EMSA 4I6NB 1JQ4A 5JXVA 1GNUA 5G2NA 2NR2A 4AQ7A 1UGMA 2PVGC 4W9EA 3SU8X 1RAXA 3ZLZA 4MT5A 2JPHA 2PVOD 2VH2A 2W82A 3APDA 4LNNA 4MJSA 1CJEA 3FILA 4WQOB 2JY6A 1WWTA 1MFWA 2KX3A 2JXXA 2WNMA 1E6EB 1OGWA 1TKYA 1VCBA 4GN1A 2BWFA 1ET6A 1L7YA 2J0KA 2K3UA 4M01A 2KJRA 4II3B 2ASQA 1WYGA 2V9HA 5FR6A 1C9FA 3LJ3A 1K8RB 5KHOA 2AQ3B 4YTNB 1FIQA 3E56A 2DYOA 2JWZA 2X8XX 1P3QU 2QC8A 2ZNVC 3Q8AA 4XYCA 1K51A 4B0EA 1L4DB 3UINB 4MM3B 2LGXA 2WXNA 2NBWB 3RNGC 3OAWA 2LVOA 3TSSA 2AL3A 2ZPNA 5C3JB 2QEJC 3DCGA 3D32A 2KTFA 4F1SA 3LB8C 4I6PA 2MBQA 3AEBB 5T8IA 3VHTC 2KHWB 3VDZA 4KSKC 2V3SA 4KDIC 1F2RI 1PFDA 3GZNI 1L5PA 2BGFA 2IJ0A 4WH4A 2J7QB 1TKGA 1F77A 4OVUA 5LLIA 2INNE 4G11A 3LYYA 1VR9A 1I4RA 4Q2JA 3SR6A 3NZSA 3VVWB 3BZDB 4ZDVA 3V60A 4TQ1A 3TEWA 2GBJA 3TEYA 1SF0A 3KVFB 4IDIA 1JWAD 1IUEA 5HG2A 2RDBC 3TCAA 4AUQC 4MH8A 3DBRI 2KKCA 1WGGA 1V97A 2QIEB 1V2YA 4ZYNA 2BKFA 3PS6A 1GJZA 4IM2A 2JX5A 4N9F4 5IO9A 1HTOA 3ZJTA 2YEPF 4HJGE 3R2IA 3IBEA 4I6LB 1SB3C 2Z0EB 4N59A 3ZTDA 2I1JA 1JRUA 3GE8C 5IKCM 4YT0B 1WXMA 1UBIA 2WU5B 3KUCB 2D5GA 4YSYB 3WAMA 2M4NA 4IKGA 1L0YB 1RFKA 4KIKA 1ISNA 1K52A 2HD5B 5HKHA 2LHEA 2BYVE 5MPOA 1ZP0B 2WXIA 1V8CA 3AECB 2R2QA 1FMAD 4GMVA 2L0FA 2MH7A 1I4PA 5H92C 1SIFA 1NEKB 2RR9A 2W3SA 4EE2A 4E3CA 1FEHA 3L17A 2XN9C 2RSUA 3NZUA 4C00A 4W9JA 2DLBA 2SAKA 4P7IA 3AE3B 5CHVC 2G9HD 2OJRA 3TUOA 1P7FA 1WM3A 1YJJA 2G4SA 3DDCB 1OEYJ 1UWMA 2X38A 1MPEA 1GB4A 4ZHPA 3HM6X 1QLBB 1T5XD 4RGMA 3ZGZA 3RT3B 1WJNA 3QIJA 1BUIC 1FRRA 3PLVA 3AE9B 3JSVB 3W5VB 3I63C 2VH1A 1NI2A 1E7VA 2IGDA 3RNAC 3SFDB 1EU3A 3O65B 4DXFA 2L52A 3RCZA 2ZW1A 3P63A 1SE3A 3BYYB 3AE1B 1WX7A 2AL6A 4WWPA 3DQVA 2C7MB 3CSFA 2IDYA 4ACFA 4XWTA 3AB5A 4RFBA 3ZVVA 2FE8A 1ZUD2 4IC7B 3DBLB 3RPFC 1EU4A 2QMTA 3NS8A 4YTPB 2NCNA 1VD2A 3MC8A 2CHXA 5EE0A 2A4ZA 4KGTA 2KMCA 2PIAA 1YJ1A 3AI5A 3CSTA 5LXHA 3TMPB 4A20A 1WE6A 1GC6A 4FLHA 5EDSA 4IOIE 2XK5B 3LDZE 3TEXA 3MP9A 2IO3B 1HE8A 1I7HA 2WS3B 3DBSA 2KWVB 3NOBA 4WURA 2ZVNA 1P7EA 1KH0A 1YN3A 2L32A 2JRHA 4ZRPA 4A55A 2FCSA 2WXRA 3OJ3A 1R4NB 2ONQA 1TS4A 4J6IA 4ZRJA 1PUTA 3APCA 1EWCA 4EZLA 1ESFA 3A4RA 4LDTD 3KYDD 2BWES 1DOIA 1RM6C 3VQIA 1GUAB 5GMVA 4OZCA 1VJKA 4RF1A 4MGKE 5DPTA 2Z59B 2HDEA 4IM3A 1YN4A 2ZCBA 3EC8A 2CHWA 1GB1A 4O1NA 1C79A 2MBBB 3R2TA 3NVYA 1A70A
chains in the Genus database with same CATH topology
2R61A 1AW7A 1TS3A 1MVKA 3RFZB 1FNUA 2Z8LA 3BK1A 2M0AA 4RF0A 5FKAC 2IPKD 2WXJA 2BW2A 1N62A 3GS2A 1FXAA 1I4XA 2NTTA 1CZPA 1XF5L 1ZOYB 2SEBD 2LMCA 4DXGA 3IT4B 4ZYSA 2WXMA 1I4HA 1YJIA 2MEKA 4ARCA 1WXQA 2GB1A 1WGKA 2INPE 4REZA 1YQ3B 1VDVA 1JWSD 2MJEA 3W9CB 2PTLA 3AMZA 1QT9A 3KQ4A 5AUIA 3ZJVA 3OWEB 4USAA 1QQRA 1JW9D 4GDKB 4YSXB 1VLBA 2H88B 3I57A 1JRPA 3KLSX 4RH6A 1I4QA 1PYWD 1XLOA 3AM9A 3MJ5A 2BBCA 1VRAB 3DWGC 2GRIA 2Y3AA 3GP7A 4HROA 2KAJA 1STEA 3VR8B 4WIPA 1ZXHA 3V3XA 1BMLC 5GXGB 1XO3A 3EUB2 5LNK1 1JROA 3BWUD 4US8A 3UI3A 1UGJA 2BTEA 1YMHE 2KACA 1ZXIA 3NVYA 2V3NA 4LLGM 5H8YE 1XLQA 3AE7B 4RCOA 1B9RA 3B2FA 5G5GA 1QOGA 1CQVA 1PGAA 5EE3A 4A9AA 1V1PB 1UUPA 4AS1A 2LUMA 1FD6A 5HHDG 1JWUD 3N9YC 4WAFA 1XLPA 2J52A 1N5WA 2BS4B 3ZYYX 3IAS1 5C2TB 4NAWB 1T3QA 3U4EG 3V05A 2JYEA 2OEDA 1TS5A 1JCKB 3GB1A 1FNVA 1KTKA 3AEDB 2RDGA 2FUG1 2W54A 4ARIA 3MC0B 3NS1A 2M19A 3VR9B 2I2YA 5HI1A 4GLSC 2DWQA 1ZDXA 5FR3A 2KQ4X 1XEEA 1ZE3D 4XWWA 1HZ5A 1N5XA 2LJIA 1E0ZA 4C7YA 3VRBB 2L1AA 1E9MA 1KFYB 2JSVX 1J7CA 5G5HA 1PGXA 1JQ4A 2VZKB 5JXVA 1N60A 1VZ6A 2W55A 4AQ7A 1RYJA 2YEPB 2PVGC 3Q8EA 2DYMA 3HVZA 3P4RB 2VZKD 4M0WA 2PVOD 4HEA1 4MT5A 5D3DA 2W82A 4TQ0A 1DOXA 1JWBD 4ITKA 1CJEA 3FILA 2BYTA 1KRHA 4US9A 4YSZB 1WWTA 2RDHA 1V1OA 4L23A 1SE2A 2WNMA 1E6EB 1OQRA 1TKYA 1DYQA 2J42A 2Y5PA 1Y56A 1ET6A 1D6EC 3LXFA 1XCTL 3P4PB 2K3UA 3B9JA 3Q8CA 1ROEA 2IGHA 1J7AA 4RGNA 4B0MA 5BMGA 1Q10A 1QKZA 4P16A 4YTMB 1L0XB 1WYGA 3AE2B 1C9FA 1FNWA 3AEGB 2AQ3B 4OZBA 4YTNB 2WXKA 2WLBA 3PO0A 1FIQA 3E56A 2DYOA 3MFGA 1ET9A 4ZOHC 2RPVA 3Q8AA 3O13A 1FCCC 1JMLA 1K51A 4B0EA 2J4XA 1L4DB 3ZJUA 1FFUA 2KN4A 2BB5A 3U7ZA 3W1SA 4MM3B 1K50A 2WXNA 2QJLA 1C77A 2AQ1B 3ABVB 1NYQA 1KLUD 1FXIA 1SIJA 4OVZA 3TSSA 5C3JB 4MACA 3AE6B 2FBWB 2QEJC 2K9XA 2ACZB 3Q69A 3IT6B 2WP9B 3LB8C 3SEBA 4KKJA 2LGIA 3EGRA 4JPSA 3T3NA 1BXTA 2TSSA 4KKIA 3AEBB 3ETRA 2KMMA 3FILB 5T8IA 3T3OA 2DBYA 2KWDA 1IGCA 2V3PA 1L4ZB 2I38A 2HTME 1F2RI 1PFDA 2CU3A 3R8BA 1HQRD 1L5PA 3PZ8A 2IJ0A 4WH4A 5BYQA 1TKGA 2JWUA 1F77A 2K22A 2INNE 3LYYA 4N6EB 2J53A 1C4CA 2NTSA 4HRSA 4LTUA 1TJEA 1VR9A 1I4RA 4FXCA 4Q2JA 3PZ7A 3SR6A 1AN8A 1GAQB 3BZDB 1KF6B 4TQ1A 3C8YA 3TEWA 1D5MC 4PT5A 1SF0A 3TEYA 2WQYB 2BS3B 3AE5B 2JYTA 2L83A 4IDIA 1JWAD 1IUEA 5HG2A 1WSPA 4HKQA 2RMMA 3EA6A 3KWVA 1R7SA 4MH8A 1T6BX 4P6VF 1WRIA 3SFEB 4A6QA 2N7JA 1V97A 1IGDA 1L6VA 1MI0A 2QIEB 2ZW0A 4JX1C 5BYSA 2V4IB 2JX5A 4C56C 1E7PB 1HXYD 2QSDA 3P1MA 1ACCA 2PMVA 1SBBB 3ZJTA 1HZ6A 2YEPF 4HJGE 1MHXA 3R2IA 1GPXA 1NENB 4XDCA 3BVZA 4OHJA 1SB3C 4N59A 2LHDA 3TEZA 2WXOA 1K53A 4NAMA 1TYGB 2V0GA 2PLPA 3AV8A 4YT0B 5FK9C 1QILA 2WU5B 3W5UB 2D5GA 2JZPA 2N9LA 4YSYB 4NJCA 4L2YA 5D3IB 1F2RC 4IKGA 4YWGG 1L0YB 4YXDB 4XE0A 1RFKA 2WXHA 1K52A 3HVDA 1AWDA 2JU6X 2AQ2B 2LHEA 4LK0M 4KX6B 4OZAA 5MPOA 1FO4A 1ZP0B 2WXIA 1V8CA 3AECB 4RGTA 3ZQ4A 2WDQB 1D5ZC 1FMAD 2WXPA 4L1BA 2MH7A 1RWSA 1I4PA 5H92C 1NEKB 3B2GA 1PGBA 2W3SA 1XLNA 3P4SB 1TS2A 2WDVB 4EE2A 1D4BA 2QILA 1FEHA 1HEZE 5AUKA 1EWYC 3BVGA 1FFVA 2XN9C 3MHZA 1OFFA 1KLGD 2GI9A 1XXGA 3U52E 1IBXB 2DLBA 1L6UA 2SAKA 3AE3B 1ZPSA 2G9HD 2MJDA 3URYA 3NVVA 3FC4A 1QOAA 3TUOA 2BS2B 2H89B 2K5PA 1P7FA 1L0VB 3AEFB 3AEEB 1PDXA 2CJNA 4WWMA 3NZ3A 4ZRQA 1OQQA 1YJJA 1UWMA 3CIRB 3NVWA 2X38A 3IAM1 1MPEA 1EM7A 1SJHD 1GB4A 4ZHPA 1QLBB 1T5XD 3J9CA 4RGMA 2Y5CA 5BYRA 2B76B 4C80A 3ZGZA 1F0ZA 4RNAA 1BUIC 1FRRA 3W5VB 2BT6A 3AE9B 2WU2B 1FCLA 2IGDA 4J3OD 1YN5A 1AYFA 3SFDB 4CQNA 1EU3A 3AE8B 3P42A 5HFYA 1C76A 3VRAB 3U2SC 4DXFA 4JWSC 4TSSA 2L52A 4A90A 2ZW1A 3P63A 1SE3A 3BYYB 4R3DA 4C7ZA 5BMHA 3AE1B 1QOBA 3L4PA 2M56B 2WXFA 5EE1A 1TY0A 1UNSA 3E9SA 4WQMA 2IDYA 4XWTA 3AB5A 4TMAB 4RFBA 1VZ8A 1NVID 1ZUD2 2FE8A 4KGSA 5E6JA 5EE9A 1SSNA 1TY2A 1EU4A 3RPFC 3AH7A 3HRDD 1GOZA 2LFIA 2N9KA 2QMTA 1E10A 4YTPB 2WXGA 1TKEA 3Q8FA 1I4GA 5D7GA 1FRDA 1ZDVA 4UDUC 2G1EA 2OHFA 4RGOS 1N61A 5BMIA 1JALA 5EE0A 1JWMD 3H8HA 1IBXA 1SXTA 3BIID 4KGTA 3AE4B 4XDDA 1QF6A 2PIAA 1YQ4B 2E3TA 3CWIA 1XCQL 2W3RA 4KGRA 2K0PA 4ZHOA 3BYTB 4JE3B 1LO5D 1TZOA 3AN1A 2IGGA 2PW9A 1UWXA 4IOIE 2KDMA 4NZLB 3TEXA 1C4AA 3MP9A 1VZ7A 4A8XC 3BK2A 1I7HA 2WS3B 1N63A 1D5XC 1FM0D 3I9V1 3NUHB 1NI3A 2BB6A 2CJOA 1C4PA 4WURA 1P7EA 1KH0A 1YN3A 2L32A 1SE4A 4ZRPA 4A55A 2AX5A 1ENFA 2WXRA 1SEBD 3BVMA 4JWUC 2ONQA 1TS4A 2ON8A 3P4QB 1DGJA 2Q5WD 2NMQA 3IXSA 1M4VA 1PUTA 1EWCA 2LEKA 1MHHE 1C78A 1ESFA 3AEAB 1YNTE 3W2DA 2PKOA 1DOYA 1B1ZA 1DOIA 1RM6C 1CK1A 3KWLA 3VQIA 2ICIA 3FAHA 4OW0A 3NRZA 4OZCA 2MJ3A 1QOFA 3DWMA 4GDLB 3HUIA 4N58A 1VJKA 3Q8BA 2JQRB 2WXQA 4RF1A 5I4DA 4DQOC 4D2KA 5TSSA 2JXTA 2HDEA 4H2AA 3WCQA 1YN4A 1V1PA 1GB1A 1SJED 1NYRA 2EELA 2WDRB 2EKIA 2XNAC 4O1NA 3NVZA 2WXLA 1C79A 4HKZE 1HA5A 2E6XA 3R2TA 1J7BA 2N0SB 1A70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AYF A;  3SFD B;  1R7S A;  1KRH A;  3AE8 B;  4US9 A;  1WWT A;  4YSZ B;  4P6V F;  3VRA B;  1WRI A;  3SFE B;  4JWS C;  2L52 A;  1E6E B;  1V97 A;  1L6V A;  2QIE B;  4JX1 C;  3P63 A;  4C7Z A;  1N62 A;  1OQR A;  1TKY A;  1FXA A;  1QOB A;  3AE1 B;  1CZP A;  3L4P A;  1ZOY B;  2JX5 A;  2M56 B;  5EE1 A;  5G5H A;  1E7P B;  4WQM A;  3P1M A;  1YJI A;  3AB5 A;  3LXF A;  3P4P B;  1WXQ A;  1GPX A;  3B9J A;  1NVI D;  1ROE A;  1WGK A;  1ZUD 2;  1NEN B;  5EE9 A;  3RPF C;  1YQ3 B;  1VDV A;  1J7A A;  3AH7 A;  2MJE A;  3HRD D;  3W9C B;  1SB3 C;  4N59 A;  1E10 A;  3AMZ A;  1QT9 A;  4YTP B;  5AUI A;  4USA A;  1TKE A;  4YTM B;  1WYG A;  3AE2 B;  1JW9 D;  1FRD A;  4YSX B;  2G1E A;  2OHF A;  1TYG B;  1VLB A;  2H88 B;  3AEG B;  1JRP A;  1N61 A;  4YTN B;  2WLB A;  3AV8 A;  1FIQ A;  1JAL A;  3PO0 A;  5EE0 A;  4YT0 B;  1XLO A;  3W5U B;  2WU5 B;  3BII D;  3AM9 A;  4ZOH C;  4YSY B;  3AE4 B;  1QF6 A;  2PIA A;  1YQ4 B;  2E3T A;  3DWG C;  3CWI A;  2W3R A;  4HRO A;  4ZHO A;  2KAJ A;  3VR8 B;  1FFU A;  4YXD B;  1RFK A;  5GXG B;  1XO3 A;  3EUB 2;  1JRO A;  2QJL A;  1AWD A;  3AN1 A;  4US8 A;  3ABV B;  4KX6 B;  5MPO A;  1FO4 A;  1ZP0 B;  1ZXI A;  3NVY A;  1NYQ A;  1V8C A;  3AEC B;  1FXI A;  5H8Y E;  1XLQ A;  1SIJ A;  3AE7 B;  1I7H A;  1B9R A;  2WS3 B;  3B2F A;  5C3J B;  1N63 A;  1FM0 D;  1QOG A;  3AE6 B;  5G5G A;  1NI3 A;  2FBW B;  2WDQ B;  2CJO A;  1FMA D;  2K9X A;  5EE3 A;  2ACZ B;  4A9A A;  2MH7 A;  1RWS A;  5H92 C;  2WP9 B;  1NEK B;  3LB8 C;  2AX5 A;  3B2G A;  2W3S A;  1XLP A;  4JWU C;  1N5W A;  1XLN A;  3P4S B;  3P4Q B;  1DGJ A;  2BS4 B;  2Q5W D;  2WDV B;  3AEB B;  3ETR A;  1PUT A;  2KMM A;  5C2T B;  1T3Q A;  3ZYY X;  2DBY A;  5AUK A;  1EWY C;  2LEK A;  1FFV A;  1OFF A;  3AEA B;  2HTM E;  2CU3 A;  1PFD A;  3AED B;  2PKO A;  1DOY A;  1L5P A;  1L6U A;  2W54 A;  3AE3 B;  3NS1 A;  2MJD A;  2M19 A;  1RM6 C;  1TKG A;  1DOI A;  3VR9 B;  3NVV A;  2DWQ A;  3FC4 A;  3KWL A;  1QOA A;  2BS2 B;  2H89 B;  2K22 A;  2K5P A;  3FAH A;  1L0V B;  3AEF B;  3AEE B;  1PDX A;  1N5X A;  2CJN A;  4WWM A;  1E0Z A;  3NRZ A;  4N6E B;  2MJ3 A;  4C7Y A;  1OQQ A;  1QOF A;  1YJJ A;  3VRB B;  1E9M A;  4HRS A;  1KFY B;  3DWM A;  4LTU A;  1TJE A;  1J7C A;  1UWM A;  1IUE A;  3HUI A;  3CIR B;  3NVW A;  1VJK A;  4FXC A;  4N58 A;  2JQR B;  3SR6 A;  1JQ4 A;  1N60 A;  1GAQ B;  2W55 A;  1CJE A;  1KF6 B;  1RYJ A;  2PVG C;  4ZHP A;  3WCQ A;  1QLB B;  3HVZ A;  2Y5C A;  3P4R B;  2B76 B;  1NYR A;  4C80 A;  2WDR B;  2EKI A;  1F0Z A;  3NVZ A;  1SF0 A;  2PVO D;  1FRR A;  3W5V B;  2BT6 A;  2BS3 B;  2WQY B;  2WU2 B;  2L83 A;  3AE5 B;  3AE9 B;  1JWA D;  1JWB D;  4IDI A;  1DOX A;  4ITK A;  1J7B A;  2N0S B;  1A70 A; 
#chains in the Genus database with same CATH topology
 2R61 A;  3BY4 B;  3SHQ A;  1CMX B;  1AW7 A;  3QQ8 B;  1MVK A;  4EFO A;  2MSE D;  1FNU A;  1T0Y A;  3BK1 A;  4EOY A;  2BQQ A;  3WAN A;  3M62 B;  2BW2 A;  2MP2 B;  2SEB D;  2ZVO A;  2WXM A;  1YJI A;  1A5R A;  1WXQ A;  2GB1 A;  4P1C C;  3N1X C;  3RYT A;  3OJ4 B;  2MJE A;  3W9C B;  4LNI A;  3UQB A;  3ZJV A;  3Q3F A;  4BKT A;  4RH6 A;  3PSE B;  3MJ5 A;  2L7R A;  3VTU A;  3DWG C;  2KAJ A;  1EF5 A;  4WIP A;  5GXG B;  1JRO A;  4G0N B;  3L10 B;  5E6N A;  2MBE A;  1KJT A;  1UGJ A;  3DHH C;  1YMH E;  2KAC A;  4GDL A;  5H8Y E;  3RN9 C;  3RI7 C;  3B2F A;  5G5G A;  1QOG A;  2KWU B;  1JWU D;  1WE7 A;  4WAF A;  4K7S A;  1XLP A;  4HCN B;  2DAJ A;  2OOB B;  3ZYY X;  5C2T B;  2LXA A;  2GBK A;  3GB1 A;  3L54 A;  1FNV A;  2IO0 B;  3PRM B;  2EMT A;  2R2O A;  4PS3 A;  4EUT A;  2MRP A;  1ZDX A;  5FR3 A;  2MLB A;  4MEL A;  4C7Y A;  4M00 A;  4K3C A;  1WY8 A;  1E9M A;  1KFY B;  4WJP A;  2JSV X;  4MEM A;  4KZ0 A;  5IN7 A;  1E8Z A;  1PGX A;  2KTR A;  4PS7 A;  1N60 A;  5D94 A;  1RYJ A;  2O6V D;  2DYM A;  1H8C A;  3P4R B;  1LQB A;  4HEA 1;  3DVG Y;  4TQ0 A;  1DOX A;  3B0A A;  4LCD E;  1KRH A;  4US9 A;  4YSZ B;  2RDH A;  3ECI A;  2RPQ A;  1OQR A;  2C7N B;  1DYQ A;  4IWQ A;  1IYF A;  3LXF A;  3Q8C A;  1NDD A;  2IGH A;  4WAA A;  4RGN A;  2IY1 B;  4YTM B;  1L0X B;  4NAW A;  2MX2 A;  3K9O B;  3PO0 A;  1IPG A;  3PLU A;  1ET9 A;  4DBG A;  3O13 A;  1JML A;  2DNF A;  3H7P A;  1FFU A;  2KN4 A;  1K50 A;  2O6V A;  2QJL A;  3ONS A;  2FNJ B;  3ABV B;  1NYQ A;  4W9C A;  1FXI A;  2WDT B;  3PTF C;  4RM8 A;  5IP4 D;  2WP9 B;  2MCN B;  4KKJ A;  2IO1 B;  4KKI A;  3N1Z C;  3T3O A;  2KWD A;  2DEN B;  5TR5 A;  2DAF A;  1IGC A;  2D3G A;  5E6P A;  1HQR D;  1Z5S B;  2MA9 B;  2N9E B;  1GC7 A;  3M95 A;  3ALB A;  2JWU A;  2K22 A;  2KYW A;  2KFJ A;  4KIK B;  5D2M B;  4AWJ A;  2J53 A;  3GZN B;  4JIO U;  4LTU A;  1TJE A;  4FXC A;  2K1F A;  5L83 A;  1WYW B;  3ZXR A;  1KF6 B;  1C3T A;  1YOV B;  3SDL C;  2L83 A;  3T8M A;  1UEL A;  1WSP A;  2NVU I;  3EA6 A;  4M8N A;  4B6W A;  1T6B X;  3PRE A;  4P6V F;  4ANU A;  1RLF A;  1IGD A;  1P98 A;  3ZNH B;  5BYS A;  3UQA A;  2QCZ A;  1E7P B;  2FUH B;  2QSD A;  3P1M A;  1ACC A;  2PMV A;  1HZ6 A;  1J19 A;  4LNK A;  1MHX A;  3DBR B;  4XDC A;  3RMK C;  1V86 A;  3QAQ A;  3RD2 A;  1WIA A;  2HJ1 A;  3AV8 A;  1V6E A;  5AEK B;  3W5U B;  3NG0 A;  2N9L A;  4NJC A;  5D3I B;  1F2R C;  4YWG G;  2XEW A;  4LNO A;  3CMM B;  2JU6 X;  4BAX A;  4LK0 M;  1FO4 A;  4AJY B;  3PZD A;  2JZZ A;  1TZ1 A;  2D3B A;  1LFD A;  2JT4 B;  3H7S A;  4GU2 A;  2WDQ B;  1D5Z C;  1NBF C;  1E7U A;  4JQW C;  4TV3 A;  3W1S C;  1PGB A;  1XLN A;  4DHJ D;  1TS2 A;  5AZG A;  2K8B A;  3AU5 A;  1HEZ E;  3A1Q A;  3MHZ A;  1OFF A;  2GOW A;  3ZIM A;  3HHM A;  3UIO B;  1ZPS A;  2MJD A;  3URY A;  2ZPY A;  3FC4 A;  2K5P A;  2N7D A;  1PDX A;  2CJN A;  2Y5B B;  3CIR B;  2INC C;  4LNF A;  4BZA A;  3K9P B;  3J9C A;  2B76 B;  4C4V A;  4RNA A;  2IZV B;  2MQJ A;  1PQS A;  4CQN A;  2NPT A;  3AE8 B;  3MJW A;  2KLC A;  2LGD A;  1SE9 A;  2K8C A;  4JWS C;  1S3S G;  4C7Z A;  5BMH A;  2NBU A;  1WXV A;  3L4P A;  2WYQ A;  3E9S A;  4WQM A;  2N1V A;  5JHB A;  3IG3 A;  5E6J A;  3A9K A;  2KFK A;  1GOZ A;  2N9K A;  1V5T A;  2NBV B;  4WWN A;  3ZO5 B;  3TJP A;  2G3Q B;  2BPS A;  4MSQ B;  1WGR A;  1JWM D;  1IBX A;  3BII D;  2BYE A;  2LZ6 A;  3UIP B;  1QF6 A;  3CWI A;  4KGR A;  2K0P A;  3NHE B;  2D3C A;  4JE3 B;  2REX A;  4B95 A;  1LO5 D;  3AN1 A;  4BBN C;  2PW9 A;  1UWX A;  4NZL B;  3BIN A;  3L16 A;  3EFU A;  2KLG A;  1NI3 A;  2BB6 A;  2CJO A;  4DWF A;  3BVM A;  1ZW7 A;  3VTV A;  2Q5W D;  3B08 A;  3H6N A;  4LDT B;  1WRD B;  5LXI B;  1C78 A;  1YNT E;  2N9X A;  2NS5 A;  3QAR A;  2LGY A;  1CK1 A;  1V49 A;  2DZI A;  2ICI A;  2KDF B;  3VFK A;  3A9J A;  4OW0 A;  4K81 A;  3DWM A;  4GDL B;  3HUI A;  2JQR B;  2WXQ A;  5I4D A;  3KYC D;  2FCQ A;  4F7Z A;  3R7Q A;  2GBM A;  4H2A A;  3KUZ A;  4NJ6 A;  1NYR A;  2EKI A;  2C5L C;  2WXL A;  4K1R B;  4HKZ E;  3I3T B;  1J7B A;  2N0S B;  1WMH A;  1TS3 A;  2HE7 A;  3RFZ B;  2Z8L A;  2M8S A;  5FKA C;  2IPK D;  4NPN A;  1N62 A;  4WJN A;  3QWZ B;  4K7U A;  2UYZ B;  2NTT A;  1XF5 L;  1ZOY B;  2LMC A;  4DXG A;  2LD9 A;  5CX3 A;  1XT9 B;  1XD3 B;  5G55 A;  3RNB C;  3R3M A;  2INP E;  1WGK A;  4REZ A;  3WAO A;  1YQ3 B;  3AMZ A;  5AUI A;  3KQ4 A;  4USA A;  1QQR A;  1KOT A;  1JW9 D;  1UF0 A;  3EHV A;  3EEC A;  4M8M A;  1I4Q A;  2L8J A;  1PYW D;  2QDF A;  3RUI B;  1STE A;  2KO3 A;  3V3X A;  3APF A;  1BML C;  1XO3 A;  2JRI B;  4DK5 A;  1WJU A;  2M17 A;  3PRP B;  2BTE A;  2KX0 A;  1ZXI A;  2V3N A;  4F8C B;  5KHQ A;  3AE7 B;  1PGA A;  5EE3 A;  1M94 A;  1V1P B;  3KH0 A;  1UUP A;  4JL9 A;  2LUM A;  5IA7 A;  4AS1 A;  1FD6 A;  3N9Y C;  1I35 A;  4NAW B;  1T3Q A;  3U4E G;  2WX1 A;  1Q0W B;  1JCK B;  4HPP A;  2V1Y A;  2KZR A;  4WWO A;  2KDI A;  2RDG A;  3MC0 B;  1E5W A;  3V6E B;  3VR9 B;  5HI1 A;  3V61 A;  3L0W B;  1G6J A;  1FXT B;  4XWW A;  1HZ5 A;  2D07 B;  2O6V B;  1J7C A;  4MSM B;  2YLM A;  1VZ6 A;  2W55 A;  2GMI C;  1UH6 A;  2YEP B;  3Q8E A;  1F1H A;  2VZK D;  3Q2A C;  5D3D A;  4NJ7 A;  4ITK A;  4NQL B;  2BYT A;  3A33 B;  1SE2 A;  3KW5 B;  2KOX A;  1S1Q B;  4GGQ A;  4ASW C;  3WAL A;  5BO4 B;  2Y5P A;  1E8X A;  1EF1 A;  1XCT L;  2KD0 A;  1J8C A;  1ROE A;  1H4R A;  1GG3 A;  1QKZ A;  5BMG A;  2L76 A;  3QHT A;  1FNW A;  3AEG B;  1F52 A;  3T9L A;  2WLB A;  3R66 C;  1AAR A;  2QHO A;  3X23 A;  2RPV A;  1WJ6 A;  1FCC C;  2KDE B;  4W9L A;  2J4X A;  4W9F A;  2IND C;  2BB5 A;  3HIZ A;  3U7Z A;  5J17 A;  5JH5 C;  4HDO A;  1TGZ B;  2AQ1 B;  3UGB B;  1KLU D;  1UD7 A;  2KDB A;  1TIF A;  2FBW B;  3X0W A;  3Q69 A;  3IT6 B;  1YQB A;  3SEB A;  2LGI A;  3EGR A;  4JPS A;  3T3N A;  1BXT A;  4MJS B;  2TSS A;  3FIL B;  2IYD B;  3DVG X;  1L4Z B;  1N6Z A;  1RRB A;  5CTR C;  2CU3 A;  2KN5 A;  3PZ8 A;  2YVC A;  3OG5 A;  2WWZ A;  4BKS D;  1EO6 A;  4N6E B;  1C4C A;  4HRS A;  3PZ7 A;  2MBH A;  3QC8 B;  4AP4 C;  1WM2 A;  1UZX B;  3N20 C;  2ZJD A;  3U7D A;  3C8Y A;  4TUU A;  3HM3 A;  2PJH A;  2BS3 B;  3AE5 B;  4HKQ A;  2RMM A;  4W9D A;  4HLE A;  3N32 A;  4W9I A;  3IVF A;  1WRI A;  3A1Q B;  4A6Q A;  2N7J A;  3TIX A;  1L6V A;  1MI0 A;  2IBI B;  2ZW0 A;  3MTN B;  4JGH B;  2V4I B;  3RNC C;  4A3P A;  4EZJ A;  1HXY D;  2M0X A;  2O2V A;  3VUY A;  4IM0 A;  3BVZ A;  4OHJ A;  2WHI A;  4URK A;  2WXO A;  4ANX A;  1K53 A;  3C0R B;  4FJY A;  1TYG B;  4BKS A;  3UF8 A;  2KC1 A;  5J18 A;  4E74 A;  3RZW C;  1WGH A;  2JZP A;  2LJ5 A;  4L2Y A;  4OVV A;  3H9D A;  2KQS A;  3HK0 A;  4YXD B;  2WXH A;  4RMA A;  1AWD A;  2AQ2 B;  4KX6 B;  4B9K A;  4OZA A;  4XX5 A;  4RGT A;  2DZJ A;  2KNB A;  2BF8 B;  4DXA B;  3ZQ4 A;  4DHJ B;  2WXP A;  2DZM A;  4L1B A;  2KFK B;  1E90 A;  3U8Z A;  3B2G A;  4CHK A;  3ZRF A;  4IWP A;  2C7H A;  4ANV A;  5AUK A;  3BVG A;  1X1M A;  1HTQ A;  4GSW A;  3U52 E;  1IBX B;  1L6U A;  3ML9 A;  5IOI A;  2KAN A;  3AEE B;  4WWM A;  3RNF C;  4ZRQ A;  3VUW A;  3NVW A;  1IP9 A;  2AEH A;  3IAM 1;  4BBN F;  2CS4 A;  1EM7 A;  3VAW A;  4ICU A;  3AXC A;  2BT6 A;  2WU2 B;  3FKY A;  1FCL A;  4IUM B;  1YN5 A;  1AYF A;  5HFY A;  1ZGU B;  3U2S C;  4NY0 A;  2K6D B;  4E71 A;  1WFY A;  3ZNI D;  1V5O A;  4TSS A;  1SGH A;  2K8H A;  4MGI E;  1TY0 A;  1UNS A;  4ICV A;  4TMA B;  3VXW A;  3N1Y C;  3A9J B;  1NVI D;  1TY2 A;  5DPS A;  3AH7 A;  3HRD D;  3R7R A;  2LFI A;  2WXG A;  3Q8F A;  1I4G A;  1ZDV A;  3CF6 E;  2OHF A;  4RGO S;  1N61 A;  1C1Y B;  5BMI A;  2K6Q A;  3H8H A;  1R4M I;  4HVB A;  2KJH B;  3AE4 B;  2E3T A;  1XCQ L;  2IY0 B;  4ZHO A;  1WMH B;  2K39 A;  3BYT B;  2PPH A;  1TZO A;  3MC9 A;  5DCN A;  4CO7 A;  1WI0 A;  2KDM A;  3ZW3 A;  2V4L A;  1C4A A;  2OJW A;  1VZ7 A;  4A8X C;  3BK2 A;  4IW0 A;  4XC2 A;  1N63 A;  1D5X C;  1FM0 D;  1OQY A;  4S0R A;  3NUH B;  4HK2 A;  2KXJ A;  1C4P A;  2GBN A;  1SE4 A;  1SEB D;  1TTN A;  1BT0 A;  1WH3 A;  2ON8 A;  4PS8 A;  3P4Q B;  2WX0 A;  1M4V A;  3N3K B;  2KK8 A;  2LEK A;  2J0M A;  1MHH E;  5IAA C;  1MG4 A;  3AEA B;  1WGY A;  2PKO A;  3QX1 A;  4BFR A;  1B1Z A;  2C60 A;  3KWL A;  4GXB A;  4GB9 A;  3FAH A;  4BKG A;  1P9D U;  4HPL B;  1FPY A;  3W1Y A;  3NRZ A;  3PPA A;  3TL5 A;  1QOF A;  2MW5 A;  1YIW A;  4D2K A;  3RZF A;  2JXT A;  3WCQ A;  1SJE D;  2KC2 A;  2WDR B;  3NVZ A;  2E6X A;  4EKU A;  4G3X B;  2MHJ A;  4FJZ A;  4RF0 A;  3GS2 A;  1T0Q C;  1FXA A;  1I4X A;  4NNJ B;  1CZP A;  4ZYS A;  4ARC A;  1I4H A;  1TBE A;  3DHG C;  1WGD A;  1JWS D;  1WXS A;  2PTL A;  3DBH I;  1QT9 A;  5E6O A;  2L0T A;  5C1Z A;  2UU7 A;  4MGZ E;  1VLB A;  2H88 B;  3I57 A;  1JRP A;  3KLS X;  1XLO A;  2LWP A;  2I1K A;  3B1L X;  2BBC A;  1VRA B;  2LRW A;  2KWC A;  4FBJ B;  3GP7 A;  1P1A A;  2BVC A;  1KM7 A;  1V9J A;  2FIF A;  3DPD A;  3WAP A;  5LNK 1;  2M1M A;  4W9H A;  2PEA A;  4US8 A;  2PE6 B;  3UI3 A;  3ZTC A;  4LLG M;  1XLQ A;  4RCO A;  4KSL C;  1B9R A;  2LGS A;  2HTH A;  3JW0 X;  1CQV A;  3Q3M C;  4A9A A;  4PK1 A;  3QK0 A;  1WR6 E;  5HHD G;  3SD5 A;  2J52 A;  2C9W B;  1N5W A;  5C23 A;  4C4V B;  2ZEQ A;  2LVP A;  3V05 A;  2JYE A;  2OED A;  2RGF A;  1MG8 A;  1KTK A;  3AED B;  1OEY A;  2FUG 1;  4KDL B;  2M19 A;  2DWQ A;  3PHX B;  4HWI B;  1XEE A;  1ZE3 D;  1N5X A;  3Q3J A;  4FN2 A;  5AZF A;  2L1A A;  2D2Q A;  5JZE B;  2VRR B;  2VZK B;  1L2N A;  2B3A A;  4GDK A;  3DOW A;  1ZKH A;  1WXA A;  2LVQ A;  3HVZ A;  4MH0 E;  4M0W A;  3I5J C;  1JWB D;  1LM8 B;  3RNE C;  1V1O A;  4HXD A;  4L23 A;  2KQ7 A;  4BOZ B;  3ZNG C;  2KMA A;  2PE9 A;  4MDK E;  2J42 A;  2FAZ A;  2GBR A;  1Y56 A;  1D6E C;  3VUX A;  2IO2 B;  3P4P B;  1KLV A;  3B9J A;  5J2R A;  1J7A A;  2LRU A;  4S17 A;  4B0M A;  1Q10 A;  4P16 A;  3AE2 B;  3H1U A;  4OZB A;  4KVG B;  2WXK A;  1LGR A;  3MFG A;  4ZOH C;  3JYU A;  4A3O A;  4ANW A;  2BKR B;  3ZJU A;  3JVZ X;  3W1S A;  1YX5 B;  1WX8 A;  2FCM A;  1C77 A;  3V6C B;  2KTR B;  1SIJ A;  4LJO B;  3ZUN A;  4OVZ A;  4MAC A;  3ENE A;  3AE6 B;  2K9X A;  2ACZ B;  2JF5 A;  2JUO A;  3ZKJ C;  5D6J B;  2O2V B;  4YL8 A;  2N7E A;  5CHW A;  4K7W A;  3RUL A;  3ETR A;  2KMM A;  2DBY A;  2K25 A;  4XZ4 A;  4PYU A;  2V3P A;  2DZK A;  2I38 A;  2HTM E;  3R8B A;  2L3Z A;  5BYQ A;  4FAD A;  2DX5 B;  5CHF A;  3AUL A;  3V62 A;  4P1B C;  3L08 A;  1U4A A;  2N4F A;  2NTS A;  2G45 B;  1P0R A;  2JVC A;  2L00 B;  1AN8 A;  4DDG D;  2HJ8 A;  1GAQ B;  2A5U A;  3PRZ A;  1MJD A;  3M3J A;  1D5M C;  4PT5 A;  2WQY B;  2CHZ A;  2JYT A;  1Q1O A;  1RFA A;  3KWV A;  1R7S A;  3H7P B;  3SFE B;  4MM3 A;  4KZC A;  2LUE A;  4JX1 C;  2LXC A;  2MBO A;  2EKE C;  1YD8 U;  2MWS B;  2N1W A;  4C56 C;  1SBB B;  1GPX A;  1NEN B;  2FCN A;  1I42 A;  5DPW A;  2LHD A;  4CYE A;  3GE3 C;  2DHZ A;  3TEZ A;  4NAM A;  2V0G A;  2PLP A;  4AJW A;  5FK9 C;  3VTW A;  4FA6 A;  1QIL A;  3ZDT A;  4ZRI A;  2ZZP B;  4XE0 A;  3HVD A;  4FHJ A;  1T0S C;  2RD0 A;  3C19 A;  5AZH A;  2JZ3 B;  2G4D B;  1RWS A;  4IWO A;  3P4S B;  2WDV B;  4MGY E;  1D4B A;  2QIL A;  4II2 B;  1EWY C;  1Y8R C;  3TBL D;  1FFV A;  3DVN V;  1KLG D;  3AU4 A;  2GI9 A;  1XXG A;  3WA0 A;  1OTR B;  3NVV A;  1QOA A;  2KJ6 A;  2BS2 B;  2H89 B;  4JLC A;  1D3Z A;  1L0V B;  3AEF B;  3NZ3 A;  1OQQ A;  3Q3N C;  3ZNZ B;  2L05 A;  3Q3O C;  4HPM B;  4LJP B;  4KV2 A;  3IFW B;  1SJH D;  5BYR A;  2Y5C A;  4AOF A;  4C80 A;  1F0Z A;  2WGS A;  1F9J A;  4J3O D;  4W9K A;  3P42 A;  1C76 A;  3VRA B;  3WIM A;  4NQK E;  4A90 A;  3DBL I;  4R3D A;  4EEW A;  2D10 A;  3PVL A;  1QOB A;  2M56 B;  2WXF A;  5EE1 A;  3QCA A;  1QZE A;  1VZ8 A;  4KGS A;  3A4S C;  5EE9 A;  1SSN A;  2CR5 A;  3Q14 C;  1E10 A;  1TKE A;  3ZXV A;  4WJQ A;  5D7G A;  1FRD A;  3OLM D;  4UDU C;  2G1E A;  4IG7 B;  1JAL A;  4G50 A;  1SXT A;  4XDD A;  1YQ4 B;  2W3R A;  4XGA B;  2DYB A;  1Z2M A;  3GOE A;  3IHP C;  2UWQ A;  3VH4 B;  4BOS C;  2IGG A;  3S2A A;  5JHA A;  3P2B A;  1R4M B;  1E8W A;  1R4N I;  3M63 B;  3U30 A;  3PHW B;  3PT2 B;  2W9N A;  3I9V 1;  3Q6B A;  2AX5 A;  3JSV A;  1ENF A;  1YX6 B;  1E8Y A;  4JWU C;  1DGJ A;  3ML8 A;  2NMQ A;  3IXS A;  2NPT B;  3DVN U;  4RM9 A;  3W2D A;  1DOY A;  3PGE A;  4QAY A;  3DHI C;  4PYZ A;  1WZ0 A;  2MJ3 A;  2CKH B;  3A9K B;  3NY5 A;  2GLS A;  4N58 A;  3Q8B A;  1EUV B;  4DQO C;  2J0J A;  5TSS A;  2D11 A;  4EZK A;  4WJO A;  4GOC A;  1V1P A;  3ZDM C;  2EEL A;  2XNA C;  1HA5 A;  4HCP B;  1V81 A;  1WZ3 A;  2D3A A;  2CU1 A;  2FID A;  2M0A A;  1V80 A;  2AYO B;  2WXJ A;  4FJV B;  2XK5 A;  4DDI D;  3IT4 B;  2MEK A;  1WF9 A;  4ZRK A;  2LAS A;  1VDV A;  3L13 A;  1J0G A;  4TKN A;  1UBQ A;  3OWE B;  3KUD B;  1TT5 B;  4GDK B;  4YSX B;  3QJZ A;  2LI5 A;  2AWT A;  4HDQ A;  4M0W B;  3AM9 A;  1WX9 A;  2KT7 A;  1WR1 A;  3DBH B;  2GRI A;  2Y3A A;  4HRO A;  4HJK A;  3QA8 A;  3VR8 B;  1ZXH A;  2BYF A;  3EUB 2;  3BWU D;  3EFC A;  5DPR A;  4DHZ B;  3MHS D;  4W9G A;  1T0R C;  2KVR A;  3N30 A;  2BS4 B;  1WJ4 A;  3IAS 1;  2ZCC A;  2Z0D B;  1XQQ A;  2XBB C;  3ZRC A;  4K3B A;  1TS5 A;  4BVU C;  2N9P C;  1Q5W B;  1LXD A;  2W54 A;  4DHZ E;  2MP2 A;  4ARI A;  3NS1 A;  3NJT A;  4FHK A;  2I2Y A;  4GLS C;  4FUL A;  5L95 C;  2KQ4 X;  4X57 B;  2ZNV B;  2LJI A;  1E0Z A;  3VH3 B;  3VRB B;  3PV1 A;  4GIV A;  2KVZ A;  5G5H A;  4M02 A;  2EMS A;  4I6N B;  1JQ4 A;  5JXV A;  1GNU A;  5G2N A;  2NR2 A;  4AQ7 A;  1UGM A;  2PVG C;  4W9E A;  3SU8 X;  1RAX A;  3ZLZ A;  4MT5 A;  2JPH A;  2PVO D;  2VH2 A;  2W82 A;  3APD A;  4LNN A;  4MJS A;  1CJE A;  3FIL A;  4WQO B;  2JY6 A;  1WWT A;  1MFW A;  2KX3 A;  2JXX A;  2WNM A;  1E6E B;  1OGW A;  1TKY A;  1VCB A;  4GN1 A;  2BWF A;  1ET6 A;  1L7Y A;  2J0K A;  2K3U A;  4M01 A;  2KJR A;  4II3 B;  2ASQ A;  1WYG A;  2V9H A;  5FR6 A;  1C9F A;  3LJ3 A;  1K8R B;  5KHO A;  2AQ3 B;  4YTN B;  1FIQ A;  3E56 A;  2DYO A;  2JWZ A;  2X8X X;  1P3Q U;  2QC8 A;  2ZNV C;  3Q8A A;  4XYC A;  1K51 A;  4B0E A;  1L4D B;  3UIN B;  4MM3 B;  2LGX A;  2WXN A;  2NBW B;  3RNG C;  3OAW A;  2LVO A;  3TSS A;  2AL3 A;  2ZPN A;  5C3J B;  2QEJ C;  3DCG A;  3D32 A;  2KTF A;  4F1S A;  3LB8 C;  4I6P A;  2MBQ A;  3AEB B;  5T8I A;  3VHT C;  2KHW B;  3VDZ A;  4KSK C;  2V3S A;  4KDI C;  1F2R I;  1PFD A;  3GZN I;  1L5P A;  2BGF A;  2IJ0 A;  4WH4 A;  2J7Q B;  1TKG A;  1F77 A;  4OVU A;  5LLI A;  2INN E;  4G11 A;  3LYY A;  1VR9 A;  1I4R A;  4Q2J A;  3SR6 A;  3NZS A;  3VVW B;  3BZD B;  4ZDV A;  3V60 A;  4TQ1 A;  3TEW A;  2GBJ A;  3TEY A;  1SF0 A;  3KVF B;  4IDI A;  1JWA D;  1IUE A;  5HG2 A;  2RDB C;  3TCA A;  4AUQ C;  4MH8 A;  3DBR I;  2KKC A;  1WGG A;  1V97 A;  2QIE B;  1V2Y A;  4ZYN A;  2BKF A;  3PS6 A;  1GJZ A;  4IM2 A;  2JX5 A;  4N9F 4;  5IO9 A;  1HTO A;  3ZJT A;  2YEP F;  4HJG E;  3R2I A;  3IBE A;  4I6L B;  1SB3 C;  2Z0E B;  4N59 A;  3ZTD A;  2I1J A;  1JRU A;  3GE8 C;  5IKC M;  4YT0 B;  1WXM A;  1UBI A;  2WU5 B;  3KUC B;  2D5G A;  4YSY B;  3WAM A;  2M4N A;  4IKG A;  1L0Y B;  1RFK A;  4KIK A;  1ISN A;  1K52 A;  2HD5 B;  5HKH A;  2LHE A;  2BYV E;  5MPO A;  1ZP0 B;  2WXI A;  1V8C A;  3AEC B;  2R2Q A;  1FMA D;  4GMV A;  2L0F A;  2MH7 A;  1I4P A;  5H92 C;  1SIF A;  1NEK B;  2RR9 A;  2W3S A;  4EE2 A;  4E3C A;  1FEH A;  3L17 A;  2XN9 C;  2RSU A;  3NZU A;  4C00 A;  4W9J A;  2DLB A;  2SAK A;  4P7I A;  3AE3 B;  5CHV C;  2G9H D;  2OJR A;  3TUO A;  1P7F A;  1WM3 A;  1YJJ A;  2G4S A;  3DDC B;  1OEY J;  1UWM A;  2X38 A;  1MPE A;  1GB4 A;  4ZHP A;  3HM6 X;  1QLB B;  1T5X D;  4RGM A;  3ZGZ A;  3RT3 B;  1WJN A;  3QIJ A;  1BUI C;  1FRR A;  3PLV A;  3AE9 B;  3JSV B;  3W5V B;  3I63 C;  2VH1 A;  1NI2 A;  1E7V A;  2IGD A;  3RNA C;  3SFD B;  1EU3 A;  3O65 B;  4DXF A;  2L52 A;  3RCZ A;  2ZW1 A;  3P63 A;  1SE3 A;  3BYY B;  3AE1 B;  1WX7 A;  2AL6 A;  4WWP A;  3DQV A;  2C7M B;  3CSF A;  2IDY A;  4ACF A;  4XWT A;  3AB5 A;  4RFB A;  3ZVV A;  2FE8 A;  1ZUD 2;  4IC7 B;  3DBL B;  3RPF C;  1EU4 A;  2QMT A;  3NS8 A;  4YTP B;  2NCN A;  1VD2 A;  3MC8 A;  2CHX A;  5EE0 A;  2A4Z A;  4KGT A;  2KMC A;  2PIA A;  1YJ1 A;  3AI5 A;  3CST A;  5LXH A;  3TMP B;  4A20 A;  1WE6 A;  1GC6 A;  4FLH A;  5EDS A;  4IOI E;  2XK5 B;  3LDZ E;  3TEX A;  3MP9 A;  2IO3 B;  1HE8 A;  1I7H A;  2WS3 B;  3DBS A;  2KWV B;  3NOB A;  4WUR A;  2ZVN A;  1P7E A;  1KH0 A;  1YN3 A;  2L32 A;  2JRH A;  4ZRP A;  4A55 A;  2FCS A;  2WXR A;  3OJ3 A;  1R4N B;  2ONQ A;  1TS4 A;  4J6I A;  4ZRJ A;  1PUT A;  3APC A;  1EWC A;  4EZL A;  1ESF A;  3A4R A;  4LDT D;  3KYD D;  2BWE S;  1DOI A;  1RM6 C;  3VQI A;  1GUA B;  5GMV A;  4OZC A;  1VJK A;  4RF1 A;  4MGK E;  5DPT A;  2Z59 B;  2HDE A;  4IM3 A;  1YN4 A;  2ZCB A;  3EC8 A;  2CHW A;  1GB1 A;  4O1N A;  1C79 A;  2MBB B;  3R2T A;  3NVY A;  1A70 A; 
#chains in the Genus database with same CATH homology
 2R61 A;  1AW7 A;  1TS3 A;  1MVK A;  3RFZ B;  1FNU A;  2Z8L A;  3BK1 A;  2M0A A;  4RF0 A;  5FKA C;  2IPK D;  2WXJ A;  2BW2 A;  1N62 A;  3GS2 A;  1FXA A;  1I4X A;  2NTT A;  1CZP A;  1XF5 L;  1ZOY B;  2SEB D;  2LMC A;  4DXG A;  3IT4 B;  4ZYS A;  2WXM A;  1I4H A;  1YJI A;  2MEK A;  4ARC A;  1WXQ A;  2GB1 A;  1WGK A;  2INP E;  4REZ A;  1YQ3 B;  1VDV A;  1JWS D;  2MJE A;  3W9C B;  2PTL A;  3AMZ A;  1QT9 A;  3KQ4 A;  5AUI A;  3ZJV A;  3OWE B;  4USA A;  1QQR A;  1JW9 D;  4GDK B;  4YSX B;  1VLB A;  2H88 B;  3I57 A;  1JRP A;  3KLS X;  4RH6 A;  1I4Q A;  1PYW D;  1XLO A;  3AM9 A;  3MJ5 A;  2BBC A;  1VRA B;  3DWG C;  2GRI A;  2Y3A A;  3GP7 A;  4HRO A;  2KAJ A;  1STE A;  3VR8 B;  4WIP A;  1ZXH A;  3V3X A;  1BML C;  5GXG B;  1XO3 A;  3EUB 2;  5LNK 1;  1JRO A;  3BWU D;  4US8 A;  3UI3 A;  1UGJ A;  2BTE A;  1YMH E;  2KAC A;  1ZXI A;  3NVY A;  2V3N A;  4LLG M;  5H8Y E;  1XLQ A;  3AE7 B;  4RCO A;  1B9R A;  3B2F A;  5G5G A;  1QOG A;  1CQV A;  1PGA A;  5EE3 A;  4A9A A;  1V1P B;  1UUP A;  4AS1 A;  2LUM A;  1FD6 A;  5HHD G;  1JWU D;  3N9Y C;  4WAF A;  1XLP A;  2J52 A;  1N5W A;  2BS4 B;  3ZYY X;  3IAS 1;  5C2T B;  4NAW B;  1T3Q A;  3U4E G;  3V05 A;  2JYE A;  2OED A;  1TS5 A;  1JCK B;  3GB1 A;  1FNV A;  1KTK A;  3AED B;  2RDG A;  2FUG 1;  2W54 A;  4ARI A;  3MC0 B;  3NS1 A;  2M19 A;  3VR9 B;  2I2Y A;  5HI1 A;  4GLS C;  2DWQ A;  1ZDX A;  5FR3 A;  2KQ4 X;  1XEE A;  1ZE3 D;  4XWW A;  1HZ5 A;  1N5X A;  2LJI A;  1E0Z A;  4C7Y A;  3VRB B;  2L1A A;  1E9M A;  1KFY B;  2JSV X;  1J7C A;  5G5H A;  1PGX A;  1JQ4 A;  2VZK B;  5JXV A;  1N60 A;  1VZ6 A;  2W55 A;  4AQ7 A;  1RYJ A;  2YEP B;  2PVG C;  3Q8E A;  2DYM A;  3HVZ A;  3P4R B;  2VZK D;  4M0W A;  2PVO D;  4HEA 1;  4MT5 A;  5D3D A;  2W82 A;  4TQ0 A;  1DOX A;  1JWB D;  4ITK A;  1CJE A;  3FIL A;  2BYT A;  1KRH A;  4US9 A;  4YSZ B;  1WWT A;  2RDH A;  1V1O A;  4L23 A;  1SE2 A;  2WNM A;  1E6E B;  1OQR A;  1TKY A;  1DYQ A;  2J42 A;  2Y5P A;  1Y56 A;  1ET6 A;  1D6E C;  3LXF A;  1XCT L;  3P4P B;  2K3U A;  3B9J A;  3Q8C A;  1ROE A;  2IGH A;  1J7A A;  4RGN A;  4B0M A;  5BMG A;  1Q10 A;  1QKZ A;  4P16 A;  4YTM B;  1L0X B;  1WYG A;  3AE2 B;  1C9F A;  1FNW A;  3AEG B;  2AQ3 B;  4OZB A;  4YTN B;  2WXK A;  2WLB A;  3PO0 A;  1FIQ A;  3E56 A;  2DYO A;  3MFG A;  1ET9 A;  4ZOH C;  2RPV A;  3Q8A A;  3O13 A;  1FCC C;  1JML A;  1K51 A;  4B0E A;  2J4X A;  1L4D B;  3ZJU A;  1FFU A;  2KN4 A;  2BB5 A;  3U7Z A;  3W1S A;  4MM3 B;  1K50 A;  2WXN A;  2QJL A;  1C77 A;  2AQ1 B;  3ABV B;  1NYQ A;  1KLU D;  1FXI A;  1SIJ A;  4OVZ A;  3TSS A;  5C3J B;  4MAC A;  3AE6 B;  2FBW B;  2QEJ C;  2K9X A;  2ACZ B;  3Q69 A;  3IT6 B;  2WP9 B;  3LB8 C;  3SEB A;  4KKJ A;  2LGI A;  3EGR A;  4JPS A;  3T3N A;  1BXT A;  2TSS A;  4KKI A;  3AEB B;  3ETR A;  2KMM A;  3FIL B;  5T8I A;  3T3O A;  2DBY A;  2KWD A;  1IGC A;  2V3P A;  1L4Z B;  2I38 A;  2HTM E;  1F2R I;  1PFD A;  2CU3 A;  3R8B A;  1HQR D;  1L5P A;  3PZ8 A;  2IJ0 A;  4WH4 A;  5BYQ A;  1TKG A;  2JWU A;  1F77 A;  2K22 A;  2INN E;  3LYY A;  4N6E B;  2J53 A;  1C4C A;  2NTS A;  4HRS A;  4LTU A;  1TJE A;  1VR9 A;  1I4R A;  4FXC A;  4Q2J A;  3PZ7 A;  3SR6 A;  1AN8 A;  1GAQ B;  3BZD B;  1KF6 B;  4TQ1 A;  3C8Y A;  3TEW A;  1D5M C;  4PT5 A;  1SF0 A;  3TEY A;  2WQY B;  2BS3 B;  3AE5 B;  2JYT A;  2L83 A;  4IDI A;  1JWA D;  1IUE A;  5HG2 A;  1WSP A;  4HKQ A;  2RMM A;  3EA6 A;  3KWV A;  1R7S A;  4MH8 A;  1T6B X;  4P6V F;  1WRI A;  3SFE B;  4A6Q A;  2N7J A;  1V97 A;  1IGD A;  1L6V A;  1MI0 A;  2QIE B;  2ZW0 A;  4JX1 C;  5BYS A;  2V4I B;  2JX5 A;  4C56 C;  1E7P B;  1HXY D;  2QSD A;  3P1M A;  1ACC A;  2PMV A;  1SBB B;  3ZJT A;  1HZ6 A;  2YEP F;  4HJG E;  1MHX A;  3R2I A;  1GPX A;  1NEN B;  4XDC A;  3BVZ A;  4OHJ A;  1SB3 C;  4N59 A;  2LHD A;  3TEZ A;  2WXO A;  1K53 A;  4NAM A;  1TYG B;  2V0G A;  2PLP A;  3AV8 A;  4YT0 B;  5FK9 C;  1QIL A;  2WU5 B;  3W5U B;  2D5G A;  2JZP A;  2N9L A;  4YSY B;  4NJC A;  4L2Y A;  5D3I B;  1F2R C;  4IKG A;  4YWG G;  1L0Y B;  4YXD B;  4XE0 A;  1RFK A;  2WXH A;  1K52 A;  3HVD A;  1AWD A;  2JU6 X;  2AQ2 B;  2LHE A;  4LK0 M;  4KX6 B;  4OZA A;  5MPO A;  1FO4 A;  1ZP0 B;  2WXI A;  1V8C A;  3AEC B;  4RGT A;  3ZQ4 A;  2WDQ B;  1D5Z C;  1FMA D;  2WXP A;  4L1B A;  2MH7 A;  1RWS A;  1I4P A;  5H92 C;  1NEK B;  3B2G A;  1PGB A;  2W3S A;  1XLN A;  3P4S B;  1TS2 A;  2WDV B;  4EE2 A;  1D4B A;  2QIL A;  1FEH A;  1HEZ E;  5AUK A;  1EWY C;  3BVG A;  1FFV A;  2XN9 C;  3MHZ A;  1OFF A;  1KLG D;  2GI9 A;  1XXG A;  3U52 E;  1IBX B;  2DLB A;  1L6U A;  2SAK A;  3AE3 B;  1ZPS A;  2G9H D;  2MJD A;  3URY A;  3NVV A;  3FC4 A;  1QOA A;  3TUO A;  2BS2 B;  2H89 B;  2K5P A;  1P7F A;  1L0V B;  3AEF B;  3AEE B;  1PDX A;  2CJN A;  4WWM A;  3NZ3 A;  4ZRQ A;  1OQQ A;  1YJJ A;  1UWM A;  3CIR B;  3NVW A;  2X38 A;  3IAM 1;  1MPE A;  1EM7 A;  1SJH D;  1GB4 A;  4ZHP A;  1QLB B;  1T5X D;  3J9C A;  4RGM A;  2Y5C A;  5BYR A;  2B76 B;  4C80 A;  3ZGZ A;  1F0Z A;  4RNA A;  1BUI C;  1FRR A;  3W5V B;  2BT6 A;  3AE9 B;  2WU2 B;  1FCL A;  2IGD A;  4J3O D;  1YN5 A;  1AYF A;  3SFD B;  4CQN A;  1EU3 A;  3AE8 B;  3P42 A;  5HFY A;  1C76 A;  3VRA B;  3U2S C;  4DXF A;  4JWS C;  4TSS A;  2L52 A;  4A90 A;  2ZW1 A;  3P63 A;  1SE3 A;  3BYY B;  4R3D A;  4C7Z A;  5BMH A;  3AE1 B;  1QOB A;  3L4P A;  2M56 B;  2WXF A;  5EE1 A;  1TY0 A;  1UNS A;  3E9S A;  4WQM A;  2IDY A;  4XWT A;  3AB5 A;  4TMA B;  4RFB A;  1VZ8 A;  1NVI D;  1ZUD 2;  2FE8 A;  4KGS A;  5E6J A;  5EE9 A;  1SSN A;  1TY2 A;  1EU4 A;  3RPF C;  3AH7 A;  3HRD D;  1GOZ A;  2LFI A;  2N9K A;  2QMT A;  1E10 A;  4YTP B;  2WXG A;  1TKE A;  3Q8F A;  1I4G A;  5D7G A;  1FRD A;  1ZDV A;  4UDU C;  2G1E A;  2OHF A;  4RGO S;  1N61 A;  5BMI A;  1JAL A;  5EE0 A;  1JWM D;  3H8H A;  1IBX A;  1SXT A;  3BII D;  4KGT A;  3AE4 B;  4XDD A;  1QF6 A;  2PIA A;  1YQ4 B;  2E3T A;  3CWI A;  1XCQ L;  2W3R A;  4KGR A;  2K0P A;  4ZHO A;  3BYT B;  4JE3 B;  1LO5 D;  1TZO A;  3AN1 A;  2IGG A;  2PW9 A;  1UWX A;  4IOI E;  2KDM A;  4NZL B;  3TEX A;  1C4A A;  3MP9 A;  1VZ7 A;  4A8X C;  3BK2 A;  1I7H A;  2WS3 B;  1N63 A;  1D5X C;  1FM0 D;  3I9V 1;  3NUH B;  1NI3 A;  2BB6 A;  2CJO A;  1C4P A;  4WUR A;  1P7E A;  1KH0 A;  1YN3 A;  2L32 A;  1SE4 A;  4ZRP A;  4A55 A;  2AX5 A;  1ENF A;  2WXR A;  1SEB D;  3BVM A;  4JWU C;  2ONQ A;  1TS4 A;  2ON8 A;  3P4Q B;  1DGJ A;  2Q5W D;  2NMQ A;  3IXS A;  1M4V A;  1PUT A;  1EWC A;  2LEK A;  1MHH E;  1C78 A;  1ESF A;  3AEA B;  1YNT E;  3W2D A;  2PKO A;  1DOY A;  1B1Z A;  1DOI A;  1RM6 C;  1CK1 A;  3KWL A;  3VQI A;  2ICI A;  3FAH A;  4OW0 A;  3NRZ A;  4OZC A;  2MJ3 A;  1QOF A;  3DWM A;  4GDL B;  3HUI A;  4N58 A;  1VJK A;  3Q8B A;  2JQR B;  2WXQ A;  4RF1 A;  5I4D A;  4DQO C;  4D2K A;  5TSS A;  2JXT A;  2HDE A;  4H2A A;  3WCQ A;  1YN4 A;  1V1P A;  1GB1 A;  1SJE D;  1NYR A;  2EEL A;  2WDR B;  2EKI A;  2XNA C;  4O1N A;  3NVZ A;  2WXL A;  1C79 A;  4HKZ E;  1HA5 A;  2E6X A;  3R2T A;  1J7B A;  2N0S B;  1A70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...