2LASA

Molecular determinants of paralogue-specific sumo-sim recognition
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
78
structure length
78
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small ubiquitin-related modifier 1
publication title Insights into High Affinity Small Ubiquitin-like Modifier (SUMO) Recognition by SUMO-interacting Motifs (SIMs) Revealed by a Combination of NMR and Peptide Array Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 9
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2011-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lasA00
2DYBA 2IYDB 2KOXA 2KMAA 3ML8A 1UH6A 1GG3A 4W9GA 3T8MA 3QQ8B 4DDGD 2EMTA 2HTHA 2J0KA 4HPMB 2KJHB 2Z0EB 2LXAA 3A4RA 3PLVA 4YL8A 2EKEC 1K8RB 2D10A 2KKCA 3ZRFA 4ANXA 3PV1A 2BWES 4FHKA 2WX1A 3PLUA 3P2BA 3TIXA 1GC7A 3M62B 5C23A 2B3AA 3PREA 1I35A 3IHPC 4NY0A 4E74A 3SDLC 1OQYA 1VCBA 3RT3B 3M3JA 2LGDA 4NJ6A 5D6JB 2OOBB 2CR5A 1LFDA 4IG7B 2LGYA 2WWZA 4AJWA 4TKNA 3H7PB 1IYFA 1WZ0A 5E6OA 4WWOA 3VUYA 5J17A 2L76A 3QA8A 3RZWC 2N7DA 3A1QA 2JXXA 4MGKE 2ZCCA 3N3KB 2O2VA 4BFRA 3AXCA 1NDDA 2YVCA 2Z0DB 3ML9A 3UINB 3H7SA 4ASWC 1GUAB 3PZDA 2BKFA 2L00B 1RAXA 4MGZE 5E6PA 2PEAA 1WGRA 3WAMA 3WAPA 2FIFA 3A1QB 2K8HA 1SE9A 5D2MB 4DHZB 5DPRA 1P0RA 3W1SC 3W1YA 4M0WB 5AZGA 2KNBA 1RLFA 3W1SA 3K9OB 2KDBA 3QCAA 2RSUA 1U4AA 3DCGA 2KO3A 4WJOA 2M4NA 1E7UA 2N1WA 3L17A 5CTRC 2LXCA 4WAAA 2KC1A 4PS8A 2JZ3B 1S1QB 1WM2A 3OJ3A 1V5OA 3RZFA 3DPDA 4MSQB 2GOWA 3H6NA 3VTUA 4II3B 2MBBB 2LVPA 2LJ5A 2MA9B 3HIZA 2HE7A 1SIFA 2NS5A 4JGHB 4W9FA 4TQ0A 1YIWA 2I1KA 2MBQA 2L8JA 2BKRB 4A3OA 1L7YA 1I42A 3QIJA 2JZZA 1GJZA 3QJZA 4AOFA 1E8WA 1WXSA 3PHWB 4M8MA 4GMVA 4DK5A 2G3QB 5CHFA 4KZCA 4KSKC 4B6WA 1WR6E 4GOCA 2NBWB 1CMXB 4IM3A 4MDKE 2K6QA 4ZYNA 1WGYA 3NZUA 4BBNC 4WJPA 2MSED 4BKGA 1YQBA 3R7QA 2FCMA 2FNJB 5LXHA 4TUUA 3VHTC 1G6JA 2K8BA 4K7SA 4EUTA 2JRIB 1V49A 3VQIA 4RM9A 1C3TA 3HHMA 1EUVB 3PS6A 2LI5A 1WIAA 2AWTA 2OJRA 2XK5B 3PRPB 4N9F4 5KHQA 1WJ4A 4JIOU 1H8CA 3O65B 2IZVB 2I1JA 4B9KA 1UGMA 2ZPYA 2L3ZA 2G45B 4HK2A 3ZDTA 2O6VA 3TL5A 2KJRA 2LGXA 3PGEA 4W9JA 5L83A 4XX5A 3PTFC 3KW5B 3X0WA 2BYVE 3WA0A 4AP4C 3ZW3A 2GBNA 2AEHA 4EEWA 4FA6A 3HK0A 4G3XB 2LUEA 4GIVA 2KFKA 4G50A 4KDIC 4KSLC 3ZNZB 5DPWA 2K39A 5CX3A 2UWQA 2D2QA 2O6VB 3LJ3A 4W9KA 2LVQA 1NBFC 1PQSA 2MX2A 3M95A 4IC7B 4MJSA 3SHQA 1J8CA 3L54A 2DZIA 5DPTA 3ZTDA 2L7RA 3H9DA 2DZMA 4GGQA 1Q0WB 2FUHB 3DBLI 4HWIB 2MCNB 4BOSC 1TBEA 4DHJB 1WI0A 1E8YA 2JVCA 4FULA 3DVNU 4GDLA 1Z5SB 4FJVB 2KX0A 3ZNHB 1M94A 4MJSB 3ZKJC 2VRRB 4A3PA 1E5WA 3KH0A 2MBEA 4PYUA 1P1AA 4AUQC 4GDKA 1V80A 4ANWA 2KANA 1LQBA 2JT4B 2LVOA 4G0NB 2IO2B 4IUMB 1TZ1A 2KC2A 4GDLB 4II2B 3T9LA 3SD5A 2KDFB 2V1YA 3NHEB 2CKHB 2ZVOA 3DDCB 3AI5A 3MHSD 4IW0A 4KV2A 3RULA 3QWZB 1V81A 4MGIE 3KVFB 2FAZA 1WX8A 1Y8RC 3L10B 3PVLA 1LM8B 3CSFA 3QARA 5AZHA 4ANVA 2FCSA 4RM8A 1XQQA 4MH0E 1V9JA 2DAJA 4OVUA 3DBHI 3NZSA 2LZ6A 2WDTB 1WXAA 2DYOA 3WAOA 3ZO5B 2C60A 3RD2A 4GXBA 1KM7A 2A5UA 3ZUNA 3GZNI 5L95C 1WF9A 2J7QB 4BVUC 4NQLB 3ZIMA 1D3ZA 2GBKA 4E71A 5D94A 3BY4B 1LXDA 2V3SA 2V4LA 2G4SA 3NS8A 1UD7A 1WX7A 4J6IA 4TQ1A 3VVWB 4URKA 4LJPB 4EFOA 3IBEA 2KZRA 2O2VB 3EHVA 2GBMA 2C7HA 2ZEQA 1IPGA 2DX5B 3L13A 1R4MI 1XT9B 2C5LC 2PE9A 4KZ0A 3EECA 2DYMA 2N4FA 2M17A 1V5TA 2HJ8A 2LD9A 5CHWA 4FHJA 3CF6E 3VDZA 4E3CA 3PSEB 3NOBA 4F1SA 3N30A 1J19A 1YX6B 4KIKA 4HCNB 3WANA 3JYUA 1A5RA 3MTNB 3L08A 1WXVA 3C0RB 5HKHA 3B08A 1ISNA 3ZLZA 4GB9A 1WMHA 2ASQA 3BINA 4FLHA 2KK8A 1E8XA 1E7VA 4ZRIA 3Q3FA 3ZNGC 3VUXA 4AWJA 4KIKB 2D3GA 2O6VD 5LXIB 2L0TA 2KWUB 2MWSB 2KXJA 3JW0X 4IWQA 5EDSA 2NVUI 4PS7A 2DZKA 3DBSA 2LWPA 2PJHA 1WMHB 3VAWA 2EMSA 1YD8U 5JHBA 4KDLB 2Z59B 1YX5B 1NI2A 4DHJD 3UIOB 3PRMB 4NJ7A 3TCAA 1VD2A 3RYTA 1KLVA 5D7GA 3VTVA 4HDOA 1WZ3A 2J0MA 4NAWA 5G55A 3V60A 3ZTCA 2C7NB 2KHWB 2LRWA 2N9PC 2PPHA 4MGYE 4BKSA 2CHWA 2RR9A 3QAQA 4K7WA 1XD3B 2NBVB 4TV3A 1T0YA 4IWOA 4XC2A 3UF8A 2KQ7A 1AARA 3ZRCA 4JL9A 4NAWB 3B0AA 1R4NI 2MP2A 3ALBA 1WJNA 3U30A 1WH3A 3M63B 3DBRI 3APCA 3R3MA 3CSTA 4K1RB 3TMPB 1J0GA 2BPSA 4LDTD 5GMVA 1MG8A 2LASA 4W9CA 3SU8X 2M0XA 3VH4B 2W9NA 4FBJB 4EZJA 2PE6B 3LDZE 2N1VA 5C1ZA 2JWZA 3QC8B 3OLMD 2R2QA 4JQWC 4P7IA 1KOTA 3V6CB 3TBLD 3B1LX 4MSMB 5DCNA 3A9JA 2WX0A 3QX1A 1OEYJ 4HJKA 1EF5A 1JRUA 3UGBB 2KFKB 1E8ZA 2KFJA 1GNUA 4EZLA 1WR1A 4FJYA 3RUIB 4NPNA 4WJNA 1WY8A 3KUZA 4GN1A 1OEYA 2MLBA 2N9EB 2AL6A 2JY6A 3A9JB 2DENB 4GSWA 1WGDA 1ZW7A 3PRZA 3KUDB 4XZ4A 4W9EA 2KDEB 1WE6A 2KLCA 3KUCB 3NY5A 3A9KA 5JHAA 4ICVA 1WGGA 4MEMA 1E90A 1WRDB 2IY0B 1RFAA 4CYEA 4DHZE 2J0JA 3DVGY 4GDKB 1P98A 2QHOA 3KYCD 4LDTB 4ZRKA 2IY1B 4F7ZA 1Z2MA 2RPQA 3IFWB 4G11A 3X23A 3AU5A 3ENEA 3A9KB 2NPTA 4K81A 4GU2A 2D11A 3H7PA 2K6DB 2BGFA 3OAWA 4ANUA 3R66C 1WFYA 1UBIA 2KWCA 3JVZX 4KVGB 2LRUA 1Q5WB 4W9DA 2FIDA 2JRHA 4IM2A 3ECIA 3IVFA 1WXMA 2D07B 2NPTB 1OTRB 1UZXB 2K8CA 1WM3A 4EZKA 4HVBA 3EC8A 2KQSA 4WWNA 3V61A 5CHVC 1WYWB 2AYOB 1V86A 2ZPNA 4WWPA 2A4ZA 4A20A 5IA7A 3VUWA 3ZVVA 2ZNVC 3RCZA 1WX9A 4IWPA 2BYEA 1IP9A 5DPSA 3Q3JA 3ONSA 4HCPB 2XBBC 2K1FA 4MM3A 2REXA 5AZFA 3U7DA 4RMAA 1KJTA 3HM3A 4DDID 4W9IA 4HPLB 5BO4B 3H1UA 2ZZPB 2L0FA 2CHZA 3U8ZA 3UQBA 2ZCBA 2KTFA 1WJUA 2KN5A 2DAFA 4EOYA 3V6EB 3WALA 2KWVB 1HE8A 4PS3A 4EKUA 3QHTA 4BKSD 5E6NA 2ZNVB 3CMMB 2MRPA 2KMCA 1EF1A 3A4SC 3D32A 5J2RA 1SGHA 1S3SG 3DVNV 3VFKA 3VXWA 1V2YA 2NCNA 1BT0A 2N7EA 4HXDA 4B95A 4BBNF 4X57B 3V62A 4DXAB 1P9DU 1TTNA 2MBHA 3L0WB 2XEWA 2CHXA 3PT2B 5IAAC 4BOZB 2M1MA 4ZDVA 3JSVA 3DOWA 3N32A 1RRBA 1UELA 2GMIC 1OGWA 2KLGA 5LLIA 3AULA 4DWFA 2UYZB 1TGZB 1YJ1A 5J18A 2CU1A 2JPHA 4IM0A 3ZDMC 5JH5C 2DHZA 2RGFA 4W9HA 3APFA 1Q1OA 2IO1B 2Y5BB 5TR5A 5AEKB 2WYQA 2ZJDA 4OVVA 3S2AA 4WJQA 4I6NB 3ZNID 4WQOB 2FCNA 3PPAA 5G2NA 3JSVB 1WJ6A 3PHXB 3OJ4B 4I6PA 1X1MA 4NQKE 4W9LA 4AJYB 2XK5A 2BYFA 3I3TB 2K25A 2YLMA 1V6EA 1WGHA 1H4RA 4JLCA 3R7RA 3VTWA 3KYDD 2ZVNA 2C9WB 3L16A 4HLEA 4CHKA 2R2OA 2G4DB 2FCQA 2L05A 3GOEA 1ZKHA 2KTRA 2N9XA 3MJWA 3EFUA 2GBJA 3APDA 3UQAA 4LCDE 4LJOB 4ICUA 5KHOA 4F8CB 1F9JA 2JUOA 2RD0A 3TJPA 4FADA 2NBUA 2MP2B 4K7UA 4FJZA 3K9PB 1ZGUB 1GC6A 2BF8B 4PYZA 2KTRB 2KX3A 2C7MB 3AU4A 4I6LB 2JF5A 2GBRA 4MELA 4HDQA 2IO0B 1QZEA 4M8NA 2BWFA 2CS4A 1P3QU 1WE7A 2KJ6A 3QK0A 3IG3A 4ZRJA 2MW5A 4CO7A 2NR2A 4NNJB 1C1YB 5FR6A 2M8SA 3UIPB 2IO3B 3A33B 2DZJA 2KDIA 2KD0A 3VH3B 2MQJA 3HM6X 2HD5B 5JZEB 1FXTB 4FN2A 1L2NA 3DVGX 2MBOA 3WIMA 1UBQA 3DQVA 4BKTA 2AL3A 2KVRA 2IBIB 1EO6A 4DBGA
chains in the Genus database with same CATH superfamily
1B1ZA 1GG3A 1TS5A 4W9GA 1QT9A 2KJHB 3PLVA 3A4RA 2BWES 1YNTE 2WX1A 1YQ3B 3P2BA 2BB6A 3TIXA 2R61A 4XWTA 4E74A 1OQYA 1VCBA 3M3JA 4NJ6A 2OOBB 4IG7B 5EE3A 4TKNA 1TT5B 2HJ1A 1EWCA 1WZ0A 2N9LA 4B0MA 3A1QA 2JXXA 4WWMA 1I4GA 3W9CB 2L00B 1I7HA 2OHFA 2PEAA 2FIFA 1SE9A 1SIJA 3TEXA 5DPRA 1RLFA 3QCAA 2INPE 4WJOA 1HZ6A 2M4NA 2QJLA 2QEJC 2JZ3B 1S1QB 3OJ3A 4MSQB 3BIID 4II3B 2LVPA 2MA9B 3HIZA 3GB1A 4A3OA 1L7YA 4AOFA 1WXSA 2IPKD 3PHWB 4M8MA 2M19A 3DHHC 2NTSA 3NUHB 4IM3A 2MJEA 4MDKE 4ZYNA 3NZUA 1GB4A 1F0ZA 3AB5A 2XNAC 2K8BA 4N6EB 1V49A 4US9A 2LI5A 3IT6B 3PRPB 4N9F4 1KLUD 3O65B 1H8CA 2I1JA 4B9KA 2AQ1B 4HK2A 3TL5A 3PGEA 2INDC 4XX5A 2JYTA 3X0WA 2GBNA 5MPOA 2AX5A 3P4RB 3T3OA 3ZNZB 3W5UB 2UWQA 2D2QA 1QKZA 4IC7B 1K50A 1TJEA 2DZIA 5DPTA 1TZOA 3ZTDA 2L7RA 1Q10A 3H9DA 1Q0WB 2FUHB 3DBLI 2MCNB 4BOSC 2JVCA 4A6QA 4N59A 2WXPA 4MJSB 3AEAB 3KH0A 2MBEA 1P1AA 4ANWA 3IAM1 1LQBA 2OEDA 2LVOA 2PIAA 2KC2A 2KDFB 1I4HA 1XLNA 2CKHB 2PVGC 3MHSD 4IW0A 4KV2A 4YTMB 3L10B 3BZDB 1K53A 4ANVA 3E9SA 3I9V1 4MH0E 4OVUA 3NZSA 4JWUC 3SEBA 2LZ6A 2X8XX 1WXAA 2DYOA 3WAOA 1TKYA 4GXBA 1KM7A 3GZNI 4IDIA 2WXHA 1FD6A 4E71A 1LXDA 2V3SA 2V4LA 2G4SA 1WX7A 3VVWB 2DLBA 4URKA 3EA6A 4XYCA 1FEHA 2KZRA 3LB8C 2FE8A 3HVDA 2HJ8A 3VDZA 2LD9A 4WIPA 3PSEB 3V3XA 4F1SA 3N30A 4MH8A 4KIKA 3WANA 1A5RA 1FRDA 3MTNB 1WXVA 4NAMA 3AE4B 1MFWA 1YMHE 4OZBA 2K9XA 1E8XA 3Q3FA 5LXIB 2KWUB 2VZKB 3RPFC 3DBSA 2PJHA 1YD8U 4KDLB 4NJ7A 1XLQA 2C7NB 2GRIA 2KHWB 2QDFA 4KGSA 4MGYE 2RR9A 3QAQA 4TV3A 1JWUD 3RNAC 4ARIA 1DOYA 1AARA 4JL9A 1NYRA 3U30A 3R3MA 1J0GA 1L0VB 2BPSA 5GMVA 3VRAB 2W9NA 2D3BA 4LNNA 4EZJA 2PE6B 2WLBA 1V1OA 4P7IA 5HI1A 5E6JA 3TBLD 3B1LX 5DCNA 3Q8BA 2WX0A 1OEYJ 3DBHB 2W54A 2KFJA 1PGAA 4XE0A 3RUIB 2WU2B 3Q8CA 2CU3A 4IKGA 3KUZA 1DOIA 3KLSX 3PRZA 2GI9A 3KUDB 2WXRA 2KDEB 1T3QA 4DHZE 2X38A 3FAHA 2QHOA 4LDTB 2N0SB 4F7ZA 1YJJA 1FNVA 1Z2MA 2BBCA 2GB1A 2ON8A 1WSPA 2WDRB 3OAWA 4ANUA 1SE3A 3JVZX 1JMLA 4A8XC 1KH0A 1FPYA 3R2TA 2NMQA 3ECIA 2NPTB 5EE9A 4WWNA 3L4PA 4N58A 2AYOB 4USAA 1TY0A 3RCZA 1WX9A 1KTKA 4H2AA 1AWDA 1EWYC 5DPSA 2RPVA 4MM3A 5HHDG 1KJTA 4W9IA 2L0FA 2CHZA 3U8ZA 3UQBA 4EOYA 4ITKA 4EKUA 4D2KA 2ZW1A 5E6NA 3A4SC 1EF1A 3D32A 3DVNV 1R4NB 2NCNA 4B95A 2PVOD 4X57B 1TTNA 2LJIA 5HFYA 1YN5A 3JSVA 3DOWA 1C4AA 1RRBA 2GMIC 2KLGA 5LLIA 3AULA 5J18A 1TGZB 1F52A 2CU1A 4W9HA 2Y5BB 1I4PA 5G2NA 4S0RA 1KFYB 1KRHA 3PHXB 4LNFA 4JPSA 3OJ4B 2KAJA 2L52A 1QOBA 1B9RA 3R7RA 1SBBB 4CHKA 2FCQA 1JROA 1YQ4B 1L6UA 2J4XA 3APDA 1IGCA 2Q5WD 4LJOB 4EE2A 3MP9A 1TS2A 3TJPA 1J7CA 4FADA 1TIFA 2NBUA 4CQNA 4K7UA 2KYWA 3K9PB 1GC6A 2BF8B 4WAFA 2JF5A 4MELA 4M8NA 2CS4A 4RGTA 1YN4A 2I2YA 2IO3B 1IBXA 1WWTA 3VH3B 4RCOA 4YWGG 3U2SC 1FXTB 2TSSA 1SB3C 3ZYYX 2M0AA 3WIMA 1UBQA 4HKQA 1T6BX 4BKTA 1DYQA 2KVRA 1LGRA 2IYDB 2KOXA 2KMAA 2W3RA 4WURA 1AN8A 4L23A 4RNAA 4RF0A 3O13A 4YL8A 2EKEC 4A55A 2KKCA 3PV1A 5EE0A 4FHKA 3URYA 3PLUA 1M4VA 4OZCA 3PREA 2DBYA 3SDLC 3RT3B 2LGDA 5D6JB 2CR5A 2V0GA 4AJWA 1IYFA 2QILA 3MFGA 2J53A 3QA8A 2N7DA 3RNGC 4MGKE 3ABVB 4BFRA 2O2VA 1E6EB 1ZXIA 2YVCA 3OWEB 1ET9A 5BYSA 3PZDA 2BKFA 1RAXA 1WGRA 3W1YA 5BMHA 1UWXA 2RSUA 3BK1A 1U4AA 3DCGA 5D3DA 2H88B 4L1BA 4ACFA 2E6XA 1C79A 2N1WA 5CTRC 4WAAA 1QOGA 3H8HA 2GOWA 3VTUA 1VDVA 2MBBB 2BKRB 5IKCM 2JZZA 1N5WA 2BS2B 4GMVA 2BYTA 1VJKA 3N1ZC 4KZCA 2NBWB 1CMXB 2K6QA 4WJPA 3ZXRA 2ICIA 4A90A 4HKZE 5LXHA 4TUUA 4K7SA 1C78A 4RM9A 1OQQA 3PS6A 3SFEB 1AW7A 2JU6X 1F2RC 3U4EG 1QOFA 2ZPYA 2G45B 2L3ZA 3ZDTA 2LGXA 1RWSA 4W9JA 3ZQ4A 3PTFC 2BYVE 3WA0A 3ZW3A 2UU7A 4FA6A 3HK0A 1XXGA 2LUEA 4KDIC 2K39A 1ET6A 2O6VB 4W9KA 1NBFC 2MX2A 4MJSA 2DZMA 4Q2JA 1SF0A 1WI0A 2J42A 3DVNU 2WXLA 1Z5SB 4FJVB 3ZNHB 3E56A 3TSSA 1XEEA 1E5WA 2ACZB 1V80A 2BS4B 4G0NB 1TZ1A 2CJOA 2IJ0A 3T9LA 2V1YA 3NHEB 4HRSA 3DDCB 3RULA 1V81A 5IO9A 5C3JB 1FRRA 1FM0D 3CSFA 2FCSA 1CZPA 2DAJA 3DBHI 2WDTB 2WS3B 3NZ3A 3ZUNA 3P1MA 5L95C 1PYWD 1D3ZA 2VZKD 5D94A 3BY4B 1F77A 3NS8A 4TQ1A 2DNFA 2O2VB 1IPGA 1XT9B 2C5LC 2PE9A 3EECA 2DYMA 3NVVA 2MEKA 3DHIC 1N63A 5CHWA 4FHJA 3AE7B 3NOBA 1WGKA 2BS3B 2EELA 3Q8FA 1YX6B 3L08A 3ZXVA 1ROEA 1J7AA 1QQRA 5HKHA 3B08A 3ZLZA 2ASQA 2WDVB 3AEBB 2L0TA 2MWSB 2KXJA 3LYYA 1WMHB 2WDQB 2Z59B 1Y56A 4DHJD 3AE8B 1VD2A 4LTUA 3VTVA 3V60A 2AQ3B 2LRWA 2N9PC 2PPHA 1KLGD 2CHWA 1V8CA 1T0YA 4US8A 3UF8A 1D6EC 2KQ7A 2BT6A 2M56B 3NVZA 3ZRCA 4NAWB 1CJEA 4RGOS 1JALA 1E9MA 1R4NI 2I38A 3V05A 1IUEA 2V3PA 3APCA 3TMPB 1VZ8A 4LDTD 1RFKA 2LASA 1DGJA 4W9CA 1QF6A 5IN7A 4YSXB 4FBJB 3FILA 1BXTA 3TEWA 3RI7C 3OLMD 2W3SA 3NJTA 4HJKA 1EF5A 3UGBB 4EZLA 3AE3B 2WXQA 4NPNA 3R2IA 4WJNA 5H8YE 3Q3NC 1OEYA 2K0PA 2MLBA 2N9EB 2JY6A 4GSWA 2DENB 1WGDA 1FCCC 1ZW7A 3I57A 4W9EA 3NY5A 1C9FA 4JWSC 4MACA 4ARCA 1E90A 4CYEA 1R4MB 4P16A 3N9YC 2WP9B 1TS4A 2IY1B 2W55A 1N5XA 2WXMA 3A9KB 2NPTA 1JWSD 3AEFB 4GU2A 4JX1C 3WCQA 1WFYA 1UBIA 2RDBC 4KVGB 3NG0A 4W9DA 1XO3A 1EM7A 2JRHA 4IM2A 2D07B 2PLPA 1WM3A 4EZKA 4HVBA 1WYGA 4OHJA 3RMKC 2JXTA 2ZPNA 4WWPA 2A4ZA 4A20A 3Q69A 3ETRA 3ZVVA 2ZNVC 4ZHOA 1IP9A 3Q3JA 4OVZA 2KQ4X 4M02A 5AZFA 4DDID 4HPLB 5BO4B 3H1UA 4RF1A 2B76B 4PS3A 2K3UA 3QHTA 2ZNVB 3CMMB 1XCTL 2LGIA 1SGHA 2GLSA 1VRAB 3VXWA 1V2YA 2N7EA 2L83A 2W82A 4XDDA 4BBNF 1N60A 2Y5PA 5IAAC 3N32A 4DWFA 2JPHA 4IM0A 2RGFA 3APFA 2IO1B 3NRZA 2WYQA 2ZJDA 1C4PA 3NVWA 4OVVA 4WJQA 3ZNID 3AEEB 3BWUD 2HDEA 2EKIA 5BMIA 2WXOA 4NQKE 2BYFA 3I3TB 1TKGA 1WGHA 2WNMA 4IOIE 4C4VA 5G5HA 2G4DB 1ZPSA 2G1EA 3I5JC 2GBJA 3AM9A 4RH6A 4ICUA 5IP4D 2JUOA 4XDCA 2N9KA 2C7MB 4I6LB 4HJGE 2GBRA 3FILB 1P3QU 2KJ6A 3Q2AC 3IG3A 2MW5A 3A33B 5FKAC 1STEA 3HM6X 5BMGA 3AE5B 3BVMA 3MJ5A 1NYQA 2AL3A 1EO6A 4KGTA 5TSSA 1UH6A 3T8MA 4DDGD 2EMTA 2J0KA 1K8RB 1NVID 2LUMA 1V97A 1F2RI 4AQ7A 3M62B 4K3CA 3AH7A 1XLPA 3IHPC 1MJDA 2LGYA 2WWZA 2FUG1 4WWOA 5E6OA 3VUYA 3RZWC 4QAYA 2KWDA 2WXGA 2ZCCA 2Z0DB 1JCKB 3BVZA 4MGZE 4C00A 3WAPA 4RFBA 5D2MB 3W1SC 4M0WB 3K9OB 2KDBA 3BVGA 1L5PA 2J52A 3NS1A 2KO3A 1E7UA 2LXCA 4PS8A 2IDYA 4OZAA 1WRIA 3Q3OC 1AYFA 1JWAD 1V5OA 3B9JA 2LEKA 3DPDA 3H6NA 2LJ5A 2HE7A 1SIFA 2NS5A 4W9FA 2MBQA 3AN1A 3QIJA 3QJZA 4R3DA 1PGBA 1NI3A 3AEDB 3N20C 4ZYSA 3MHZA 3B2FA 4KSKC 4GOCA 1CQVA 2MSED 3R7QA 3CWIA 3VHTC 5GXGB 3VQIA 1C3TA 1EUVB 1XCQL 1WIAA 2AWTA 2OJRA 5KHQA 1WJ4A 4JIOU 1GAQB 2IZVB 4C4VB 2KVZA 2WU5B 1UGMA 3SFDB 2O6VA 2D3CA 2KJRA 3KW5B 3Q8EA 5LNK1 2AEHA 5DPWA 4KSLC 2KFKA 4G50A 5CX3A 4YTNB 1GPXA 3LJ3A 3MC0B 2LVQA 1SE2A 3L54A 3NVYA 1QLBB 2SAKA 2PKOA 1TBEA 3Q6BA 1E8YA 4J3OD 2KX0A 1RM6C 2VRRB 1TS3A 3HVZA 2D5GA 4PYUA 2JT4B 2IO2B 2QMTA 4GDLB 4II2B 3SD5A 3AI5A 3QWZB 4MGIE 3KVFB 2FAZA 3PVLA 4RGMA 1LM8B 5AZHA 4YXDB 5I4DA 1JRPA 2MHJA 1JWMD 1T0RC 4BAXA 4BVUC 3PZ7A 4J6IA 1UD7A 4EFOA 4FXCA 2GBMA 2C7HA 2E3TA 2DX5B 3L13A 1R4MI 4K3BA 4KZ0A 2WXNA 2M17A 3CF6E 4KX6B 1J19A 3JYUA 1VR9A 2BVCA 2KN4A 1ISNA 1SE4A 1WMHA 1RYJA 3VR9B 3RFZB 3AE9B 3MC9A 4ZRIA 1FCLA 3ZNGC 1FNUA 3JW0X 4IWQA 3BK2A 2QSDA 3AE6B 2DZKA 5JHBA 1YX5B 3UIOB 2KDMA 2ONQA 3RYTA 1HQRD 4HDOA 1WZ3A 2J0MA 3AE2B 4NAWA 3ZTCA 1GOZA 1SXTA 3HUIA 4BKSA 3DWMA 1XD3B 4XC2A 3SR6A 2H89B 5D3IB 3R8BA 1IGDA 1MHXA 3B0AA 3ALBA 1WJNA 1WH3A 4AS1A 4K1RB 2VH2A 1DOXA 1MG8A 3VH4B 1BUIC 2N7JA 1C4CA 2MJ3A 1VLBA 5C1ZA 2JWZA 1KOTA 3IT4B 4YSYB 4MSMB 5H92C 2KFKB 1E8ZA 5HG2A 1FNWA 1WY8A 4P1CC 3CIRB 1HTQA 2LHDA 5IOIA 2OJWA 5BYRA 4S17A 1JWBD 4KGRA 3A9JB 1TYGB 4XZ4A 1WE6A 4YTPB 3GS2A 2KLCA 3KUCB 3N1YC 3A9KA 5JHAA 1WGGA 4MEMA 2KT7A 2YEPF 1WRDB 2IY0B 1RFAA 2J0JA 2Y3AA 3DVGY 1P98A 3ZJUA 2RPQA 1HZ5A 4G11A 4P6VF 3X23A 3GE3C 1D5XC 3ENEA 3W5VB 2AQ2B 1PDXA 1N6ZA 3H7PA 2VH1A 2KWCA 1Q5WB 2FIDA 1YN3A 3OG5A 1JQ4A 4C7ZA 3EC8A 3V61A 5CHVC 1WYWB 1V86A 4TMAB 5IA7A 2WGSA 3VUWA 1MHHE 1WXQA 2BYEA 5G5GA 3ONSA 3P42A 2K1FA 2IGHA 3HM3A 2YEPB 2KTFA 4B0EA 2KN5A 1T0QC 3W2DA 3V6EB 1P7EA 1F1HA 2PW9A 2KMCA 2RDHA 3VFKA 1TKEA 1UF0A 1BT0A 4HXDA 2WXFA 3DBRB 4WQMA 2D3AA 4DXAB 1P9DU 3PT2B 2MBHA 2XEWA 3VRBB 2NTTA 4HPPA 1UELA 2WXIA 1MVKA 1L0YB 1R7SA 3PZ8A 2UYZB 3ZDMC 5JH5C 5AEKB 5TR5A 3UI3A 5AUIA 3S2AA 2WHIA 3KWVA 4KKIA 3ZJTA 4WQOB 3PPAA 2WXKA 1VZ7A 1L0XB 3EFCA 1ZE3D 4I6PA 2XK5A 2K25A 2YLMA 1H4RA 3VTWA 3KYDD 2ZVNA 2C9WB 3L16A 4HLEA 1N61A 2R2OA 3P63A 2JZPA 2L05A 3GOEA 1ZKHA 1SJHD 1GB1A 2N9XA 3UQAA 4LCDE 1D5ZC 1F9JA 3IAS1 2KTRB 1FFVA 3AU4A 2V3NA 4HDQA 2BWFA 3BYTB 4RGNA 3QK0A 4ZRJA 1C76A 2NR2A 1C1YB 3EUB2 5FR6A 3TEYA 2DZJA 2KDIA 2KD0A 1PUTA 2MQJA 2HD5B 4FN2A 1L2NA 3DVGX 2MBOA 3DQVA 2IBIB 2DYBA 3ML8A 1MPEA 3QQ8B 4M00A 2HTHA 2JSVX 4HPMB 2Z0EB 2LXAA 2D10A 3ZRFA 4ANXA 3AEGB 1MG4A 1E0ZA 4YSZB 2JX5A 1T0SC 1GC7A 5C23A 1I35A 2B3AA 1UNSA 4NY0A 3VR8B 2WXJA 3AE1B 1LFDA 3H7PB 5J17A 2L76A 2LMCA 4M0WA 3N3KB 3AXCA 1NDDA 3ML9A 1EU3A 5AUKA 3H7SA 3UINB 4ASWC 1GUAB 3RNFC 5E6PA 1BMLC 2LFIA 4GLSC 1D5MC 2INCC 3A1QB 3WAMA 3Q8AA 1YOVB 2K8HA 4DHZB 1P0RA 5AZGA 2KNBA 1JW9D 3Q14C 3W1SA 3L17A 4A9AA 2KC1A 1L6VA 1WM2A 3RZFA 1E7PB 2MJDA 4XGAB 4JGHB 4TQ0A 2JYEA 1YIWA 2I1KA 2L8JA 4NZLB 1L4DB 1I42A 1GJZA 1E8WA 3C19A 2G9HD 4DK5A 2G3QB 5CHFA 4B6WA 3ZGZA 1WR6E 4LNIA 1ZDXA 4WH4A 1WGYA 4BBNC 4BKGA 1YQBA 1T5XD 2FCMA 2FNJB 4TSSA 2QCZA 1G6JA 4EUTA 2JRIB 3HHMA 2XK5B 1V1PA 3ZJVA 2KMMA 3TEZA 1FMAD 5L83A 4AP4C 1NEKB 4EEWA 4G3XB 1E10A 4GIVA 4L2YA 1PQSA 3M95A 2V9HA 4DXFA 3SHQA 1J8CA 3RNCC 3AECB 3T3NA 4GGQA 4HWIB 4DHJB 3P4QB 4OW0A 4FULA 4GDLA 1L4ZB 1M94A 3ZKJC 4C7YA 4M01A 4A3PA 4AUQC 1KF6B 4GDKA 1HEZE 2KANA 1ZDVA 3PO0A 4IUMB 1PGXA 2ZVOA 1WX8A 1Y8RC 2K5PA 3QARA 3P4SB 4RM8A 1UUPA 1XQQA 1V9JA 1C77A 1HXYD 1VZ6A 2QC8A 3ZO5B 4XWWA 2C60A 3RD2A 2A5UA 5BYQA 1WF9A 2J7QB 2V4IB 1PFDA 4NQLB 3ZIMA 2PMVA 2IGDA 4O1NA 1QILA 2GBKA 4ZRPA 3FKYA 4LJPB 1I4RA 3IBEA 3P4PB 3HRDD 3EHVA 2ZEQA 4ZHPA 2N4FA 1V5TA 1UGJA 4E3CA 5JXVA 2K22A 3TUOA 1SJED 5T8IA 3U7ZA 4HCNB 3FC4A 3GP7A 5FR3A 2DWQA 2Z8LA 4BZAA 2L32A 3C0RB 1A70A 4GB9A 1ESFA 1FIQA 3BINA 4FLHA 2KK8A 1E7VA 1TY2A 1CK1A 4C56C 3VUXA 4AWJA 4KIKB 2IGGA 2D3GA 2O6VD 4ZOHC 5EDSA 1UWMA 2NVUI 4PS7A 2LWPA 3BYYB 3VAWA 2EMSA 2QIEB 1NI2A 3GE8C 2ZW0A 3PRMB 1K51A 4KKJA 3TCAA 1KLVA 5D7GA 5G55A 1MI0A 3DBLB 3C8YA 1D4BA 2BW2A 4K7WA 1ZXHA 2NBVB 4IWOA 2HTME 5FK9C 1EU4A 2MP2A 1FO4A 4UDUC 5C2TB 3M63B 3DBRI 4LNOA 3CSTA 1V1PB 1FXAA 1FXIA 3SU8X 2M0XA 1ZUD2 3LDZE 2N1VA 3QC8B 4JQWC 2R2QA 3V6CB 3A9JA 3QX1A 1JRUA 2INNE 1J7BA 1GNUA 1WR1A 4FJYA 2LHEA 3GZNB 2Y5CA 4GN1A 2BTEA 3AMZA 2AL6A 3U52E 1YJIA 4LNKA 1XF5L 4ICVA 1SSNA 2BQQA 4PK1A 3RNEC 4GDKB 3DWGC 3KYCD 4ZRKA 3IFWB 1N62A 3AU5A 1HTOA 4K81A 1P7FA 2D11A 2K6DB 2BGFA 4HEA1 3R66C 1FFUA 2LRUA 3MC8A 3IVFA 1WXMA 4NJCA 1OTRB 1UZXB 2K8CA 2KQSA 4PT5A 5EE1A 2RDGA 2LGSA 4LLGM 3DHGC 4IWPA 3RN9C 4HCPB 1I4XA 2XBBC 2REXA 3U7DA 1ZP0B 2BB5A 4RMAA 2ZZPB 1NENB 1K52A 2ZCBA 4DQOC 3AV8A 1WJUA 3J9CA 2DAFA 1SEBD 3WALA 2KWVB 1HE8A 4BKSD 2KACA 4HROA 2MRPA 5J2RA 4MM3B 4JE3B 1ENFA 1S3SG 4YT0B 3IXSA 3LXFA 3V62A 1ACCA 1LO5D 1XLOA 3L0WB 4BOZB 4ZDVA 2CHXA 2M1MA 2XN9C 1OGWA 1I4QA 1YJ1A 3KQ4A 2DHZA 1Q1OA 4I6NB 2FCNA 4C80A 3JSVB 1WJ6A 3RNBC 1X1MA 4W9LA 4AJYB 1V6EA 1OQRA 4JLCA 4REZA 3B2GA 4LK0M 2KTRA 3MJWA 1HA5A 3EFUA 4ZRQA 5KHOA 4F8CB 2RD0A 2MH7A 2MP2B 2WQYB 3Q3MC 2RMMA 4FJZA 1ZGUB 3I63C 4PYZA 2CJNA 2KX3A 1ZOYB 2JWUA 2IO0B 1QZEA 2FBWB 2SEBD 1QOAA 1WE7A 2JQRB 4P1BC 2L1AA 4CO7A 4NNJB 3UIPB 2M8SA 3EGRA 3KWLA 4MT5A 5JZEB 2PTLA 3N1XC 4DXGA 1IBXB 1OFFA 4DBGA
chains in the Genus database with same CATH topology
2DYBA 2IYDB 2KOXA 2KMAA 3ML8A 1UH6A 1GG3A 4W9GA 3T8MA 3QQ8B 4DDGD 2EMTA 2HTHA 2J0KA 4HPMB 2KJHB 2Z0EB 2LXAA 3A4RA 3PLVA 4YL8A 2EKEC 1K8RB 2D10A 2KKCA 3ZRFA 4ANXA 3PV1A 2BWES 4FHKA 2WX1A 3PLUA 3P2BA 3TIXA 1GC7A 3M62B 5C23A 2B3AA 3PREA 1I35A 3IHPC 4NY0A 4E74A 3SDLC 1OQYA 1VCBA 3RT3B 3M3JA 2LGDA 4NJ6A 5D6JB 2OOBB 2CR5A 1LFDA 4IG7B 2LGYA 2WWZA 4AJWA 4TKNA 3H7PB 1IYFA 1WZ0A 5E6OA 4WWOA 3VUYA 5J17A 2L76A 3QA8A 3RZWC 2N7DA 3A1QA 2JXXA 4MGKE 2ZCCA 3N3KB 2O2VA 4BFRA 3AXCA 1NDDA 2YVCA 2Z0DB 3ML9A 3UINB 3H7SA 4ASWC 1GUAB 3PZDA 2BKFA 2L00B 1RAXA 4MGZE 5E6PA 2PEAA 1WGRA 3WAMA 3WAPA 2FIFA 3A1QB 2K8HA 1SE9A 5D2MB 4DHZB 5DPRA 1P0RA 3W1SC 3W1YA 4M0WB 5AZGA 2KNBA 1RLFA 3W1SA 3K9OB 2KDBA 3QCAA 2RSUA 1U4AA 3DCGA 2KO3A 4WJOA 2M4NA 1E7UA 2N1WA 3L17A 5CTRC 2LXCA 4WAAA 2KC1A 4PS8A 2JZ3B 1S1QB 1WM2A 3OJ3A 1V5OA 3RZFA 3DPDA 4MSQB 2GOWA 3H6NA 3VTUA 4II3B 2MBBB 2LVPA 2LJ5A 2MA9B 3HIZA 2HE7A 1SIFA 2NS5A 4JGHB 4W9FA 4TQ0A 1YIWA 2I1KA 2MBQA 2L8JA 2BKRB 4A3OA 1L7YA 1I42A 3QIJA 2JZZA 1GJZA 3QJZA 4AOFA 1E8WA 1WXSA 3PHWB 4M8MA 4GMVA 4DK5A 2G3QB 5CHFA 4KZCA 4KSKC 4B6WA 1WR6E 4GOCA 2NBWB 1CMXB 4IM3A 4MDKE 2K6QA 4ZYNA 1WGYA 3NZUA 4BBNC 4WJPA 2MSED 4BKGA 1YQBA 3R7QA 2FCMA 2FNJB 5LXHA 4TUUA 3VHTC 1G6JA 2K8BA 4K7SA 4EUTA 2JRIB 1V49A 3VQIA 4RM9A 1C3TA 3HHMA 1EUVB 3PS6A 2LI5A 1WIAA 2AWTA 2OJRA 2XK5B 3PRPB 4N9F4 5KHQA 1WJ4A 4JIOU 1H8CA 3O65B 2IZVB 2I1JA 4B9KA 1UGMA 2ZPYA 2L3ZA 2G45B 4HK2A 3ZDTA 2O6VA 3TL5A 2KJRA 2LGXA 3PGEA 4W9JA 5L83A 4XX5A 3PTFC 3KW5B 3X0WA 2BYVE 3WA0A 4AP4C 3ZW3A 2GBNA 2AEHA 4EEWA 4FA6A 3HK0A 4G3XB 2LUEA 4GIVA 2KFKA 4G50A 4KDIC 4KSLC 3ZNZB 5DPWA 2K39A 5CX3A 2UWQA 2D2QA 2O6VB 3LJ3A 4W9KA 2LVQA 1NBFC 1PQSA 2MX2A 3M95A 4IC7B 4MJSA 3SHQA 1J8CA 3L54A 2DZIA 5DPTA 3ZTDA 2L7RA 3H9DA 2DZMA 4GGQA 1Q0WB 2FUHB 3DBLI 4HWIB 2MCNB 4BOSC 1TBEA 4DHJB 1WI0A 1E8YA 2JVCA 4FULA 3DVNU 4GDLA 1Z5SB 4FJVB 2KX0A 3ZNHB 1M94A 4MJSB 3ZKJC 2VRRB 4A3PA 1E5WA 3KH0A 2MBEA 4PYUA 1P1AA 4AUQC 4GDKA 1V80A 4ANWA 2KANA 1LQBA 2JT4B 2LVOA 4G0NB 2IO2B 4IUMB 1TZ1A 2KC2A 4GDLB 4II2B 3T9LA 3SD5A 2KDFB 2V1YA 3NHEB 2CKHB 2ZVOA 3DDCB 3AI5A 3MHSD 4IW0A 4KV2A 3RULA 3QWZB 1V81A 4MGIE 3KVFB 2FAZA 1WX8A 1Y8RC 3L10B 3PVLA 1LM8B 3CSFA 3QARA 5AZHA 4ANVA 2FCSA 4RM8A 1XQQA 4MH0E 1V9JA 2DAJA 4OVUA 3DBHI 3NZSA 2LZ6A 2WDTB 1WXAA 2DYOA 3WAOA 3ZO5B 2C60A 3RD2A 4GXBA 1KM7A 2A5UA 3ZUNA 3GZNI 5L95C 1WF9A 2J7QB 4BVUC 4NQLB 3ZIMA 1D3ZA 2GBKA 4E71A 5D94A 3BY4B 1LXDA 2V3SA 2V4LA 2G4SA 3NS8A 1UD7A 1WX7A 4J6IA 4TQ1A 3VVWB 4URKA 4LJPB 4EFOA 3IBEA 2KZRA 2O2VB 3EHVA 2GBMA 2C7HA 2ZEQA 1IPGA 2DX5B 3L13A 1R4MI 1XT9B 2C5LC 2PE9A 4KZ0A 3EECA 2DYMA 2N4FA 2M17A 1V5TA 2HJ8A 2LD9A 5CHWA 4FHJA 3CF6E 3VDZA 4E3CA 3PSEB 3NOBA 4F1SA 3N30A 1J19A 1YX6B 4KIKA 4HCNB 3WANA 3JYUA 1A5RA 3MTNB 3L08A 1WXVA 3C0RB 5HKHA 3B08A 1ISNA 3ZLZA 4GB9A 1WMHA 2ASQA 3BINA 4FLHA 2KK8A 1E8XA 1E7VA 4ZRIA 3Q3FA 3ZNGC 3VUXA 4AWJA 4KIKB 2D3GA 2O6VD 5LXIB 2L0TA 2KWUB 2MWSB 2KXJA 3JW0X 4IWQA 5EDSA 2NVUI 4PS7A 2DZKA 3DBSA 2LWPA 2PJHA 1WMHB 3VAWA 2EMSA 1YD8U 5JHBA 4KDLB 2Z59B 1YX5B 1NI2A 4DHJD 3UIOB 3PRMB 4NJ7A 3TCAA 1VD2A 3RYTA 1KLVA 5D7GA 3VTVA 4HDOA 1WZ3A 2J0MA 4NAWA 5G55A 3V60A 3ZTCA 2C7NB 2KHWB 2LRWA 2N9PC 2PPHA 4MGYE 4BKSA 2CHWA 2RR9A 3QAQA 4K7WA 1XD3B 2NBVB 4TV3A 1T0YA 4IWOA 4XC2A 3UF8A 2KQ7A 1AARA 3ZRCA 4JL9A 4NAWB 3B0AA 1R4NI 2MP2A 3ALBA 1WJNA 3U30A 1WH3A 3M63B 3DBRI 3APCA 3R3MA 3CSTA 4K1RB 3TMPB 1J0GA 2BPSA 4LDTD 5GMVA 1MG8A 2LASA 4W9CA 3SU8X 2M0XA 3VH4B 2W9NA 4FBJB 4EZJA 2PE6B 3LDZE 2N1VA 5C1ZA 2JWZA 3QC8B 3OLMD 2R2QA 4JQWC 4P7IA 1KOTA 3V6CB 3TBLD 3B1LX 4MSMB 5DCNA 3A9JA 2WX0A 3QX1A 1OEYJ 4HJKA 1EF5A 1JRUA 3UGBB 2KFKB 1E8ZA 2KFJA 1GNUA 4EZLA 1WR1A 4FJYA 3RUIB 4NPNA 4WJNA 1WY8A 3KUZA 4GN1A 1OEYA 2MLBA 2N9EB 2AL6A 2JY6A 3A9JB 2DENB 4GSWA 1WGDA 1ZW7A 3PRZA 3KUDB 4XZ4A 4W9EA 2KDEB 1WE6A 2KLCA 3KUCB 3NY5A 3A9KA 5JHAA 4ICVA 1WGGA 4MEMA 1E90A 1WRDB 2IY0B 1RFAA 4CYEA 4DHZE 2J0JA 3DVGY 4GDKB 1P98A 2QHOA 3KYCD 4LDTB 4ZRKA 2IY1B 4F7ZA 1Z2MA 2RPQA 3IFWB 4G11A 3X23A 3AU5A 3ENEA 3A9KB 2NPTA 4K81A 4GU2A 2D11A 3H7PA 2K6DB 2BGFA 3OAWA 4ANUA 3R66C 1WFYA 1UBIA 2KWCA 3JVZX 4KVGB 2LRUA 1Q5WB 4W9DA 2FIDA 2JRHA 4IM2A 3ECIA 3IVFA 1WXMA 2D07B 2NPTB 1OTRB 1UZXB 2K8CA 1WM3A 4EZKA 4HVBA 3EC8A 2KQSA 4WWNA 3V61A 5CHVC 1WYWB 2AYOB 1V86A 2ZPNA 4WWPA 2A4ZA 4A20A 5IA7A 3VUWA 3ZVVA 2ZNVC 3RCZA 1WX9A 4IWPA 2BYEA 1IP9A 5DPSA 3Q3JA 3ONSA 4HCPB 2XBBC 2K1FA 4MM3A 2REXA 5AZFA 3U7DA 4RMAA 1KJTA 3HM3A 4DDID 4W9IA 4HPLB 5BO4B 3H1UA 2ZZPB 2L0FA 2CHZA 3U8ZA 3UQBA 2ZCBA 2KTFA 1WJUA 2KN5A 2DAFA 4EOYA 3V6EB 3WALA 2KWVB 1HE8A 4PS3A 4EKUA 3QHTA 4BKSD 5E6NA 2ZNVB 3CMMB 2MRPA 2KMCA 1EF1A 3A4SC 3D32A 5J2RA 1SGHA 1S3SG 3DVNV 3VFKA 3VXWA 1V2YA 2NCNA 1BT0A 2N7EA 4HXDA 4B95A 4BBNF 4X57B 3V62A 4DXAB 1P9DU 1TTNA 2MBHA 3L0WB 2XEWA 2CHXA 3PT2B 5IAAC 4BOZB 2M1MA 4ZDVA 3JSVA 3DOWA 3N32A 1RRBA 1UELA 2GMIC 1OGWA 2KLGA 5LLIA 3AULA 4DWFA 2UYZB 1TGZB 1YJ1A 5J18A 2CU1A 2JPHA 4IM0A 3ZDMC 5JH5C 2DHZA 2RGFA 4W9HA 3APFA 1Q1OA 2IO1B 2Y5BB 5TR5A 5AEKB 2WYQA 2ZJDA 4OVVA 3S2AA 4WJQA 4I6NB 3ZNID 4WQOB 2FCNA 3PPAA 5G2NA 3JSVB 1WJ6A 3PHXB 3OJ4B 4I6PA 1X1MA 4NQKE 4W9LA 4AJYB 2XK5A 2BYFA 3I3TB 2K25A 2YLMA 1V6EA 1WGHA 1H4RA 4JLCA 3R7RA 3VTWA 3KYDD 2ZVNA 2C9WB 3L16A 4HLEA 4CHKA 2R2OA 2G4DB 2FCQA 2L05A 3GOEA 1ZKHA 2KTRA 2N9XA 3MJWA 3EFUA 2GBJA 3APDA 3UQAA 4LCDE 4LJOB 4ICUA 5KHOA 4F8CB 1F9JA 2JUOA 2RD0A 3TJPA 4FADA 2NBUA 2MP2B 4K7UA 4FJZA 3K9PB 1ZGUB 1GC6A 2BF8B 4PYZA 2KTRB 2KX3A 2C7MB 3AU4A 4I6LB 2JF5A 2GBRA 4MELA 4HDQA 2IO0B 1QZEA 4M8NA 2BWFA 2CS4A 1P3QU 1WE7A 2KJ6A 3QK0A 3IG3A 4ZRJA 2MW5A 4CO7A 2NR2A 4NNJB 1C1YB 5FR6A 2M8SA 3UIPB 2IO3B 3A33B 2DZJA 2KDIA 2KD0A 3VH3B 2MQJA 3HM6X 2HD5B 5JZEB 1FXTB 4FN2A 1L2NA 3DVGX 2MBOA 3WIMA 1UBQA 3DQVA 4BKTA 2AL3A 2KVRA 2IBIB 1EO6A 4DBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYB A;  2IYD B;  2KOX A;  2KMA A;  3ML8 A;  1UH6 A;  1GG3 A;  4W9G A;  3T8M A;  3QQ8 B;  4DDG D;  2EMT A;  2HTH A;  2J0K A;  4HPM B;  2KJH B;  2Z0E B;  2LXA A;  3A4R A;  3PLV A;  4YL8 A;  2EKE C;  1K8R B;  2D10 A;  2KKC A;  3ZRF A;  4ANX A;  3PV1 A;  2BWE S;  4FHK A;  2WX1 A;  3PLU A;  3P2B A;  3TIX A;  1GC7 A;  3M62 B;  5C23 A;  2B3A A;  3PRE A;  1I35 A;  3IHP C;  4NY0 A;  4E74 A;  3SDL C;  1OQY A;  1VCB A;  3RT3 B;  3M3J A;  2LGD A;  4NJ6 A;  5D6J B;  2OOB B;  2CR5 A;  1LFD A;  4IG7 B;  2LGY A;  2WWZ A;  4AJW A;  4TKN A;  3H7P B;  1IYF A;  1WZ0 A;  5E6O A;  4WWO A;  3VUY A;  5J17 A;  2L76 A;  3QA8 A;  3RZW C;  2N7D A;  3A1Q A;  2JXX A;  4MGK E;  2ZCC A;  3N3K B;  2O2V A;  4BFR A;  3AXC A;  1NDD A;  2YVC A;  2Z0D B;  3ML9 A;  3UIN B;  3H7S A;  4ASW C;  1GUA B;  3PZD A;  2BKF A;  2L00 B;  1RAX A;  4MGZ E;  5E6P A;  2PEA A;  1WGR A;  3WAM A;  3WAP A;  2FIF A;  3A1Q B;  2K8H A;  1SE9 A;  5D2M B;  4DHZ B;  5DPR A;  1P0R A;  3W1S C;  3W1Y A;  4M0W B;  5AZG A;  2KNB A;  1RLF A;  3W1S A;  3K9O B;  2KDB A;  3QCA A;  2RSU A;  1U4A A;  3DCG A;  2KO3 A;  4WJO A;  2M4N A;  1E7U A;  2N1W A;  3L17 A;  5CTR C;  2LXC A;  4WAA A;  2KC1 A;  4PS8 A;  2JZ3 B;  1S1Q B;  1WM2 A;  3OJ3 A;  1V5O A;  3RZF A;  3DPD A;  4MSQ B;  2GOW A;  3H6N A;  3VTU A;  4II3 B;  2MBB B;  2LVP A;  2LJ5 A;  2MA9 B;  3HIZ A;  2HE7 A;  1SIF A;  2NS5 A;  4JGH B;  4W9F A;  4TQ0 A;  1YIW A;  2I1K A;  2MBQ A;  2L8J A;  2BKR B;  4A3O A;  1L7Y A;  1I42 A;  3QIJ A;  2JZZ A;  1GJZ A;  3QJZ A;  4AOF A;  1E8W A;  1WXS A;  3PHW B;  4M8M A;  4GMV A;  4DK5 A;  2G3Q B;  5CHF A;  4KZC A;  4KSK C;  4B6W A;  1WR6 E;  4GOC A;  2NBW B;  1CMX B;  4IM3 A;  4MDK E;  2K6Q A;  4ZYN A;  1WGY A;  3NZU A;  4BBN C;  4WJP A;  2MSE D;  4BKG A;  1YQB A;  3R7Q A;  2FCM A;  2FNJ B;  5LXH A;  4TUU A;  3VHT C;  1G6J A;  2K8B A;  4K7S A;  4EUT A;  2JRI B;  1V49 A;  3VQI A;  4RM9 A;  1C3T A;  3HHM A;  1EUV B;  3PS6 A;  2LI5 A;  1WIA A;  2AWT A;  2OJR A;  2XK5 B;  3PRP B;  4N9F 4;  5KHQ A;  1WJ4 A;  4JIO U;  1H8C A;  3O65 B;  2IZV B;  2I1J A;  4B9K A;  1UGM A;  2ZPY A;  2L3Z A;  2G45 B;  4HK2 A;  3ZDT A;  2O6V A;  3TL5 A;  2KJR A;  2LGX A;  3PGE A;  4W9J A;  5L83 A;  4XX5 A;  3PTF C;  3KW5 B;  3X0W A;  2BYV E;  3WA0 A;  4AP4 C;  3ZW3 A;  2GBN A;  2AEH A;  4EEW A;  4FA6 A;  3HK0 A;  4G3X B;  2LUE A;  4GIV A;  2KFK A;  4G50 A;  4KDI C;  4KSL C;  3ZNZ B;  5DPW A;  2K39 A;  5CX3 A;  2UWQ A;  2D2Q A;  2O6V B;  3LJ3 A;  4W9K A;  2LVQ A;  1NBF C;  1PQS A;  2MX2 A;  3M95 A;  4IC7 B;  4MJS A;  3SHQ A;  1J8C A;  3L54 A;  2DZI A;  5DPT A;  3ZTD A;  2L7R A;  3H9D A;  2DZM A;  4GGQ A;  1Q0W B;  2FUH B;  3DBL I;  4HWI B;  2MCN B;  4BOS C;  1TBE A;  4DHJ B;  1WI0 A;  1E8Y A;  2JVC A;  4FUL A;  3DVN U;  4GDL A;  1Z5S B;  4FJV B;  2KX0 A;  3ZNH B;  1M94 A;  4MJS B;  3ZKJ C;  2VRR B;  4A3P A;  1E5W A;  3KH0 A;  2MBE A;  4PYU A;  1P1A A;  4AUQ C;  4GDK A;  1V80 A;  4ANW A;  2KAN A;  1LQB A;  2JT4 B;  2LVO A;  4G0N B;  2IO2 B;  4IUM B;  1TZ1 A;  2KC2 A;  4GDL B;  4II2 B;  3T9L A;  3SD5 A;  2KDF B;  2V1Y A;  3NHE B;  2CKH B;  2ZVO A;  3DDC B;  3AI5 A;  3MHS D;  4IW0 A;  4KV2 A;  3RUL A;  3QWZ B;  1V81 A;  4MGI E;  3KVF B;  2FAZ A;  1WX8 A;  1Y8R C;  3L10 B;  3PVL A;  1LM8 B;  3CSF A;  3QAR A;  5AZH A;  4ANV A;  2FCS A;  4RM8 A;  1XQQ A;  4MH0 E;  1V9J A;  2DAJ A;  4OVU A;  3DBH I;  3NZS A;  2LZ6 A;  2WDT B;  1WXA A;  2DYO A;  3WAO A;  3ZO5 B;  2C60 A;  3RD2 A;  4GXB A;  1KM7 A;  2A5U A;  3ZUN A;  3GZN I;  5L95 C;  1WF9 A;  2J7Q B;  4BVU C;  4NQL B;  3ZIM A;  1D3Z A;  2GBK A;  4E71 A;  5D94 A;  3BY4 B;  1LXD A;  2V3S A;  2V4L A;  2G4S A;  3NS8 A;  1UD7 A;  1WX7 A;  4J6I A;  4TQ1 A;  3VVW B;  4URK A;  4LJP B;  4EFO A;  3IBE A;  2KZR A;  2O2V B;  3EHV A;  2GBM A;  2C7H A;  2ZEQ A;  1IPG A;  2DX5 B;  3L13 A;  1R4M I;  1XT9 B;  2C5L C;  2PE9 A;  4KZ0 A;  3EEC A;  2DYM A;  2N4F A;  2M17 A;  1V5T A;  2HJ8 A;  2LD9 A;  5CHW A;  4FHJ A;  3CF6 E;  3VDZ A;  4E3C A;  3PSE B;  3NOB A;  4F1S A;  3N30 A;  1J19 A;  1YX6 B;  4KIK A;  4HCN B;  3WAN A;  3JYU A;  1A5R A;  3MTN B;  3L08 A;  1WXV A;  3C0R B;  5HKH A;  3B08 A;  1ISN A;  3ZLZ A;  4GB9 A;  1WMH A;  2ASQ A;  3BIN A;  4FLH A;  2KK8 A;  1E8X A;  1E7V A;  4ZRI A;  3Q3F A;  3ZNG C;  3VUX A;  4AWJ A;  4KIK B;  2D3G A;  2O6V D;  5LXI B;  2L0T A;  2KWU B;  2MWS B;  2KXJ A;  3JW0 X;  4IWQ A;  5EDS A;  2NVU I;  4PS7 A;  2DZK A;  3DBS A;  2LWP A;  2PJH A;  1WMH B;  3VAW A;  2EMS A;  1YD8 U;  5JHB A;  4KDL B;  2Z59 B;  1YX5 B;  1NI2 A;  4DHJ D;  3UIO B;  3PRM B;  4NJ7 A;  3TCA A;  1VD2 A;  3RYT A;  1KLV A;  5D7G A;  3VTV A;  4HDO A;  1WZ3 A;  2J0M A;  4NAW A;  5G55 A;  3V60 A;  3ZTC A;  2C7N B;  2KHW B;  2LRW A;  2N9P C;  2PPH A;  4MGY E;  4BKS A;  2CHW A;  2RR9 A;  3QAQ A;  4K7W A;  1XD3 B;  2NBV B;  4TV3 A;  1T0Y A;  4IWO A;  4XC2 A;  3UF8 A;  2KQ7 A;  1AAR A;  3ZRC A;  4JL9 A;  4NAW B;  3B0A A;  1R4N I;  2MP2 A;  3ALB A;  1WJN A;  3U30 A;  1WH3 A;  3M63 B;  3DBR I;  3APC A;  3R3M A;  3CST A;  4K1R B;  3TMP B;  1J0G A;  2BPS A;  4LDT D;  5GMV A;  1MG8 A;  2LAS A;  4W9C A;  3SU8 X;  2M0X A;  3VH4 B;  2W9N A;  4FBJ B;  4EZJ A;  2PE6 B;  3LDZ E;  2N1V A;  5C1Z A;  2JWZ A;  3QC8 B;  3OLM D;  2R2Q A;  4JQW C;  4P7I A;  1KOT A;  3V6C B;  3TBL D;  3B1L X;  4MSM B;  5DCN A;  3A9J A;  2WX0 A;  3QX1 A;  1OEY J;  4HJK A;  1EF5 A;  1JRU A;  3UGB B;  2KFK B;  1E8Z A;  2KFJ A;  1GNU A;  4EZL A;  1WR1 A;  4FJY A;  3RUI B;  4NPN A;  4WJN A;  1WY8 A;  3KUZ A;  4GN1 A;  1OEY A;  2MLB A;  2N9E B;  2AL6 A;  2JY6 A;  3A9J B;  2DEN B;  4GSW A;  1WGD A;  1ZW7 A;  3PRZ A;  3KUD B;  4XZ4 A;  4W9E A;  2KDE B;  1WE6 A;  2KLC A;  3KUC B;  3NY5 A;  3A9K A;  5JHA A;  4ICV A;  1WGG A;  4MEM A;  1E90 A;  1WRD B;  2IY0 B;  1RFA A;  4CYE A;  4DHZ E;  2J0J A;  3DVG Y;  4GDK B;  1P98 A;  2QHO A;  3KYC D;  4LDT B;  4ZRK A;  2IY1 B;  4F7Z A;  1Z2M A;  2RPQ A;  3IFW B;  4G11 A;  3X23 A;  3AU5 A;  3ENE A;  3A9K B;  2NPT A;  4K81 A;  4GU2 A;  2D11 A;  3H7P A;  2K6D B;  2BGF A;  3OAW A;  4ANU A;  3R66 C;  1WFY A;  1UBI A;  2KWC A;  3JVZ X;  4KVG B;  2LRU A;  1Q5W B;  4W9D A;  2FID A;  2JRH A;  4IM2 A;  3ECI A;  3IVF A;  1WXM A;  2D07 B;  2NPT B;  1OTR B;  1UZX B;  2K8C A;  1WM3 A;  4EZK A;  4HVB A;  3EC8 A;  2KQS A;  4WWN A;  3V61 A;  5CHV C;  1WYW B;  2AYO B;  1V86 A;  2ZPN A;  4WWP A;  2A4Z A;  4A20 A;  5IA7 A;  3VUW A;  3ZVV A;  2ZNV C;  3RCZ A;  1WX9 A;  4IWP A;  2BYE A;  1IP9 A;  5DPS A;  3Q3J A;  3ONS A;  4HCP B;  2XBB C;  2K1F A;  4MM3 A;  2REX A;  5AZF A;  3U7D A;  4RMA A;  1KJT A;  3HM3 A;  4DDI D;  4W9I A;  4HPL B;  5BO4 B;  3H1U A;  2ZZP B;  2L0F A;  2CHZ A;  3U8Z A;  3UQB A;  2ZCB A;  2KTF A;  1WJU A;  2KN5 A;  2DAF A;  4EOY A;  3V6E B;  3WAL A;  2KWV B;  1HE8 A;  4PS3 A;  4EKU A;  3QHT A;  4BKS D;  5E6N A;  2ZNV B;  3CMM B;  2MRP A;  2KMC A;  1EF1 A;  3A4S C;  3D32 A;  5J2R A;  1SGH A;  1S3S G;  3DVN V;  3VFK A;  3VXW A;  1V2Y A;  2NCN A;  1BT0 A;  2N7E A;  4HXD A;  4B95 A;  4BBN F;  4X57 B;  3V62 A;  4DXA B;  1P9D U;  1TTN A;  2MBH A;  3L0W B;  2XEW A;  2CHX A;  3PT2 B;  5IAA C;  4BOZ B;  2M1M A;  4ZDV A;  3JSV A;  3DOW A;  3N32 A;  1RRB A;  1UEL A;  2GMI C;  1OGW A;  2KLG A;  5LLI A;  3AUL A;  4DWF A;  2UYZ B;  1TGZ B;  1YJ1 A;  5J18 A;  2CU1 A;  2JPH A;  4IM0 A;  3ZDM C;  5JH5 C;  2DHZ A;  2RGF A;  4W9H A;  3APF A;  1Q1O A;  2IO1 B;  2Y5B B;  5TR5 A;  5AEK B;  2WYQ A;  2ZJD A;  4OVV A;  3S2A A;  4WJQ A;  4I6N B;  3ZNI D;  4WQO B;  2FCN A;  3PPA A;  5G2N A;  3JSV B;  1WJ6 A;  3PHX B;  3OJ4 B;  4I6P A;  1X1M A;  4NQK E;  4W9L A;  4AJY B;  2XK5 A;  2BYF A;  3I3T B;  2K25 A;  2YLM A;  1V6E A;  1WGH A;  1H4R A;  4JLC A;  3R7R A;  3VTW A;  3KYD D;  2ZVN A;  2C9W B;  3L16 A;  4HLE A;  4CHK A;  2R2O A;  2G4D B;  2FCQ A;  2L05 A;  3GOE A;  1ZKH A;  2KTR A;  2N9X A;  3MJW A;  3EFU A;  2GBJ A;  3APD A;  3UQA A;  4LCD E;  4LJO B;  4ICU A;  5KHO A;  4F8C B;  1F9J A;  2JUO A;  2RD0 A;  3TJP A;  4FAD A;  2NBU A;  2MP2 B;  4K7U A;  4FJZ A;  3K9P B;  1ZGU B;  1GC6 A;  2BF8 B;  4PYZ A;  2KTR B;  2KX3 A;  2C7M B;  3AU4 A;  4I6L B;  2JF5 A;  2GBR A;  4MEL A;  4HDQ A;  2IO0 B;  1QZE A;  4M8N A;  2BWF A;  2CS4 A;  1P3Q U;  1WE7 A;  2KJ6 A;  3QK0 A;  3IG3 A;  4ZRJ A;  2MW5 A;  4CO7 A;  2NR2 A;  4NNJ B;  1C1Y B;  5FR6 A;  2M8S A;  3UIP B;  2IO3 B;  3A33 B;  2DZJ A;  2KDI A;  2KD0 A;  3VH3 B;  2MQJ A;  3HM6 X;  2HD5 B;  5JZE B;  1FXT B;  4FN2 A;  1L2N A;  3DVG X;  2MBO A;  3WIM A;  1UBQ A;  3DQV A;  4BKT A;  2AL3 A;  2KVR A;  2IBI B;  1EO6 A;  4DBG A; 
#chains in the Genus database with same CATH topology
 1B1Z A;  1GG3 A;  1TS5 A;  4W9G A;  1QT9 A;  2KJH B;  3PLV A;  3A4R A;  2BWE S;  1YNT E;  2WX1 A;  1YQ3 B;  3P2B A;  2BB6 A;  3TIX A;  2R61 A;  4XWT A;  4E74 A;  1OQY A;  1VCB A;  3M3J A;  4NJ6 A;  2OOB B;  4IG7 B;  5EE3 A;  4TKN A;  1TT5 B;  2HJ1 A;  1EWC A;  1WZ0 A;  2N9L A;  4B0M A;  3A1Q A;  2JXX A;  4WWM A;  1I4G A;  3W9C B;  2L00 B;  1I7H A;  2OHF A;  2PEA A;  2FIF A;  1SE9 A;  1SIJ A;  3TEX A;  5DPR A;  1RLF A;  3QCA A;  2INP E;  4WJO A;  1HZ6 A;  2M4N A;  2QJL A;  2QEJ C;  2JZ3 B;  1S1Q B;  3OJ3 A;  4MSQ B;  3BII D;  4II3 B;  2LVP A;  2MA9 B;  3HIZ A;  3GB1 A;  4A3O A;  1L7Y A;  4AOF A;  1WXS A;  2IPK D;  3PHW B;  4M8M A;  2M19 A;  3DHH C;  2NTS A;  3NUH B;  4IM3 A;  2MJE A;  4MDK E;  4ZYN A;  3NZU A;  1GB4 A;  1F0Z A;  3AB5 A;  2XNA C;  2K8B A;  4N6E B;  1V49 A;  4US9 A;  2LI5 A;  3IT6 B;  3PRP B;  4N9F 4;  1KLU D;  3O65 B;  1H8C A;  2I1J A;  4B9K A;  2AQ1 B;  4HK2 A;  3TL5 A;  3PGE A;  2IND C;  4XX5 A;  2JYT A;  3X0W A;  2GBN A;  5MPO A;  2AX5 A;  3P4R B;  3T3O A;  3ZNZ B;  3W5U B;  2UWQ A;  2D2Q A;  1QKZ A;  4IC7 B;  1K50 A;  1TJE A;  2DZI A;  5DPT A;  1TZO A;  3ZTD A;  2L7R A;  1Q10 A;  3H9D A;  1Q0W B;  2FUH B;  3DBL I;  2MCN B;  4BOS C;  2JVC A;  4A6Q A;  4N59 A;  2WXP A;  4MJS B;  3AEA B;  3KH0 A;  2MBE A;  1P1A A;  4ANW A;  3IAM 1;  1LQB A;  2OED A;  2LVO A;  2PIA A;  2KC2 A;  2KDF B;  1I4H A;  1XLN A;  2CKH B;  2PVG C;  3MHS D;  4IW0 A;  4KV2 A;  4YTM B;  3L10 B;  3BZD B;  1K53 A;  4ANV A;  3E9S A;  3I9V 1;  4MH0 E;  4OVU A;  3NZS A;  4JWU C;  3SEB A;  2LZ6 A;  2X8X X;  1WXA A;  2DYO A;  3WAO A;  1TKY A;  4GXB A;  1KM7 A;  3GZN I;  4IDI A;  2WXH A;  1FD6 A;  4E71 A;  1LXD A;  2V3S A;  2V4L A;  2G4S A;  1WX7 A;  3VVW B;  2DLB A;  4URK A;  3EA6 A;  4XYC A;  1FEH A;  2KZR A;  3LB8 C;  2FE8 A;  3HVD A;  2HJ8 A;  3VDZ A;  2LD9 A;  4WIP A;  3PSE B;  3V3X A;  4F1S A;  3N30 A;  4MH8 A;  4KIK A;  3WAN A;  1A5R A;  1FRD A;  3MTN B;  1WXV A;  4NAM A;  3AE4 B;  1MFW A;  1YMH E;  4OZB A;  2K9X A;  1E8X A;  3Q3F A;  5LXI B;  2KWU B;  2VZK B;  3RPF C;  3DBS A;  2PJH A;  1YD8 U;  4KDL B;  4NJ7 A;  1XLQ A;  2C7N B;  2GRI A;  2KHW B;  2QDF A;  4KGS A;  4MGY E;  2RR9 A;  3QAQ A;  4TV3 A;  1JWU D;  3RNA C;  4ARI A;  1DOY A;  1AAR A;  4JL9 A;  1NYR A;  3U30 A;  3R3M A;  1J0G A;  1L0V B;  2BPS A;  5GMV A;  3VRA B;  2W9N A;  2D3B A;  4LNN A;  4EZJ A;  2PE6 B;  2WLB A;  1V1O A;  4P7I A;  5HI1 A;  5E6J A;  3TBL D;  3B1L X;  5DCN A;  3Q8B A;  2WX0 A;  1OEY J;  3DBH B;  2W54 A;  2KFJ A;  1PGA A;  4XE0 A;  3RUI B;  2WU2 B;  3Q8C A;  2CU3 A;  4IKG A;  3KUZ A;  1DOI A;  3KLS X;  3PRZ A;  2GI9 A;  3KUD B;  2WXR A;  2KDE B;  1T3Q A;  4DHZ E;  2X38 A;  3FAH A;  2QHO A;  4LDT B;  2N0S B;  4F7Z A;  1YJJ A;  1FNV A;  1Z2M A;  2BBC A;  2GB1 A;  2ON8 A;  1WSP A;  2WDR B;  3OAW A;  4ANU A;  1SE3 A;  3JVZ X;  1JML A;  4A8X C;  1KH0 A;  1FPY A;  3R2T A;  2NMQ A;  3ECI A;  2NPT B;  5EE9 A;  4WWN A;  3L4P A;  4N58 A;  2AYO B;  4USA A;  1TY0 A;  3RCZ A;  1WX9 A;  1KTK A;  4H2A A;  1AWD A;  1EWY C;  5DPS A;  2RPV A;  4MM3 A;  5HHD G;  1KJT A;  4W9I A;  2L0F A;  2CHZ A;  3U8Z A;  3UQB A;  4EOY A;  4ITK A;  4EKU A;  4D2K A;  2ZW1 A;  5E6N A;  3A4S C;  1EF1 A;  3D32 A;  3DVN V;  1R4N B;  2NCN A;  4B95 A;  2PVO D;  4X57 B;  1TTN A;  2LJI A;  5HFY A;  1YN5 A;  3JSV A;  3DOW A;  1C4A A;  1RRB A;  2GMI C;  2KLG A;  5LLI A;  3AUL A;  5J18 A;  1TGZ B;  1F52 A;  2CU1 A;  4W9H A;  2Y5B B;  1I4P A;  5G2N A;  4S0R A;  1KFY B;  1KRH A;  3PHX B;  4LNF A;  4JPS A;  3OJ4 B;  2KAJ A;  2L52 A;  1QOB A;  1B9R A;  3R7R A;  1SBB B;  4CHK A;  2FCQ A;  1JRO A;  1YQ4 B;  1L6U A;  2J4X A;  3APD A;  1IGC A;  2Q5W D;  4LJO B;  4EE2 A;  3MP9 A;  1TS2 A;  3TJP A;  1J7C A;  4FAD A;  1TIF A;  2NBU A;  4CQN A;  4K7U A;  2KYW A;  3K9P B;  1GC6 A;  2BF8 B;  4WAF A;  2JF5 A;  4MEL A;  4M8N A;  2CS4 A;  4RGT A;  1YN4 A;  2I2Y A;  2IO3 B;  1IBX A;  1WWT A;  3VH3 B;  4RCO A;  4YWG G;  3U2S C;  1FXT B;  2TSS A;  1SB3 C;  3ZYY X;  2M0A A;  3WIM A;  1UBQ A;  4HKQ A;  1T6B X;  4BKT A;  1DYQ A;  2KVR A;  1LGR A;  2IYD B;  2KOX A;  2KMA A;  2W3R A;  4WUR A;  1AN8 A;  4L23 A;  4RNA A;  4RF0 A;  3O13 A;  4YL8 A;  2EKE C;  4A55 A;  2KKC A;  3PV1 A;  5EE0 A;  4FHK A;  3URY A;  3PLU A;  1M4V A;  4OZC A;  3PRE A;  2DBY A;  3SDL C;  3RT3 B;  2LGD A;  5D6J B;  2CR5 A;  2V0G A;  4AJW A;  1IYF A;  2QIL A;  3MFG A;  2J53 A;  3QA8 A;  2N7D A;  3RNG C;  4MGK E;  3ABV B;  4BFR A;  2O2V A;  1E6E B;  1ZXI A;  2YVC A;  3OWE B;  1ET9 A;  5BYS A;  3PZD A;  2BKF A;  1RAX A;  1WGR A;  3W1Y A;  5BMH A;  1UWX A;  2RSU A;  3BK1 A;  1U4A A;  3DCG A;  5D3D A;  2H88 B;  4L1B A;  4ACF A;  2E6X A;  1C79 A;  2N1W A;  5CTR C;  4WAA A;  1QOG A;  3H8H A;  2GOW A;  3VTU A;  1VDV A;  2MBB B;  2BKR B;  5IKC M;  2JZZ A;  1N5W A;  2BS2 B;  4GMV A;  2BYT A;  1VJK A;  3N1Z C;  4KZC A;  2NBW B;  1CMX B;  2K6Q A;  4WJP A;  3ZXR A;  2ICI A;  4A90 A;  4HKZ E;  5LXH A;  4TUU A;  4K7S A;  1C78 A;  4RM9 A;  1OQQ A;  3PS6 A;  3SFE B;  1AW7 A;  2JU6 X;  1F2R C;  3U4E G;  1QOF A;  2ZPY A;  2G45 B;  2L3Z A;  3ZDT A;  2LGX A;  1RWS A;  4W9J A;  3ZQ4 A;  3PTF C;  2BYV E;  3WA0 A;  3ZW3 A;  2UU7 A;  4FA6 A;  3HK0 A;  1XXG A;  2LUE A;  4KDI C;  2K39 A;  1ET6 A;  2O6V B;  4W9K A;  1NBF C;  2MX2 A;  4MJS A;  2DZM A;  4Q2J A;  1SF0 A;  1WI0 A;  2J42 A;  3DVN U;  2WXL A;  1Z5S B;  4FJV B;  3ZNH B;  3E56 A;  3TSS A;  1XEE A;  1E5W A;  2ACZ B;  1V80 A;  2BS4 B;  4G0N B;  1TZ1 A;  2CJO A;  2IJ0 A;  3T9L A;  2V1Y A;  3NHE B;  4HRS A;  3DDC B;  3RUL A;  1V81 A;  5IO9 A;  5C3J B;  1FRR A;  1FM0 D;  3CSF A;  2FCS A;  1CZP A;  2DAJ A;  3DBH I;  2WDT B;  2WS3 B;  3NZ3 A;  3ZUN A;  3P1M A;  5L95 C;  1PYW D;  1D3Z A;  2VZK D;  5D94 A;  3BY4 B;  1F77 A;  3NS8 A;  4TQ1 A;  2DNF A;  2O2V B;  1IPG A;  1XT9 B;  2C5L C;  2PE9 A;  3EEC A;  2DYM A;  3NVV A;  2MEK A;  3DHI C;  1N63 A;  5CHW A;  4FHJ A;  3AE7 B;  3NOB A;  1WGK A;  2BS3 B;  2EEL A;  3Q8F A;  1YX6 B;  3L08 A;  3ZXV A;  1ROE A;  1J7A A;  1QQR A;  5HKH A;  3B08 A;  3ZLZ A;  2ASQ A;  2WDV B;  3AEB B;  2L0T A;  2MWS B;  2KXJ A;  3LYY A;  1WMH B;  2WDQ B;  2Z59 B;  1Y56 A;  4DHJ D;  3AE8 B;  1VD2 A;  4LTU A;  3VTV A;  3V60 A;  2AQ3 B;  2LRW A;  2N9P C;  2PPH A;  1KLG D;  2CHW A;  1V8C A;  1T0Y A;  4US8 A;  3UF8 A;  1D6E C;  2KQ7 A;  2BT6 A;  2M56 B;  3NVZ A;  3ZRC A;  4NAW B;  1CJE A;  4RGO S;  1JAL A;  1E9M A;  1R4N I;  2I38 A;  3V05 A;  1IUE A;  2V3P A;  3APC A;  3TMP B;  1VZ8 A;  4LDT D;  1RFK A;  2LAS A;  1DGJ A;  4W9C A;  1QF6 A;  5IN7 A;  4YSX B;  4FBJ B;  3FIL A;  1BXT A;  3TEW A;  3RI7 C;  3OLM D;  2W3S A;  3NJT A;  4HJK A;  1EF5 A;  3UGB B;  4EZL A;  3AE3 B;  2WXQ A;  4NPN A;  3R2I A;  4WJN A;  5H8Y E;  3Q3N C;  1OEY A;  2K0P A;  2MLB A;  2N9E B;  2JY6 A;  4GSW A;  2DEN B;  1WGD A;  1FCC C;  1ZW7 A;  3I57 A;  4W9E A;  3NY5 A;  1C9F A;  4JWS C;  4MAC A;  4ARC A;  1E90 A;  4CYE A;  1R4M B;  4P16 A;  3N9Y C;  2WP9 B;  1TS4 A;  2IY1 B;  2W55 A;  1N5X A;  2WXM A;  3A9K B;  2NPT A;  1JWS D;  3AEF B;  4GU2 A;  4JX1 C;  3WCQ A;  1WFY A;  1UBI A;  2RDB C;  4KVG B;  3NG0 A;  4W9D A;  1XO3 A;  1EM7 A;  2JRH A;  4IM2 A;  2D07 B;  2PLP A;  1WM3 A;  4EZK A;  4HVB A;  1WYG A;  4OHJ A;  3RMK C;  2JXT A;  2ZPN A;  4WWP A;  2A4Z A;  4A20 A;  3Q69 A;  3ETR A;  3ZVV A;  2ZNV C;  4ZHO A;  1IP9 A;  3Q3J A;  4OVZ A;  2KQ4 X;  4M02 A;  5AZF A;  4DDI D;  4HPL B;  5BO4 B;  3H1U A;  4RF1 A;  2B76 B;  4PS3 A;  2K3U A;  3QHT A;  2ZNV B;  3CMM B;  1XCT L;  2LGI A;  1SGH A;  2GLS A;  1VRA B;  3VXW A;  1V2Y A;  2N7E A;  2L83 A;  2W82 A;  4XDD A;  4BBN F;  1N60 A;  2Y5P A;  5IAA C;  3N32 A;  4DWF A;  2JPH A;  4IM0 A;  2RGF A;  3APF A;  2IO1 B;  3NRZ A;  2WYQ A;  2ZJD A;  1C4P A;  3NVW A;  4OVV A;  4WJQ A;  3ZNI D;  3AEE B;  3BWU D;  2HDE A;  2EKI A;  5BMI A;  2WXO A;  4NQK E;  2BYF A;  3I3T B;  1TKG A;  1WGH A;  2WNM A;  4IOI E;  4C4V A;  5G5H A;  2G4D B;  1ZPS A;  2G1E A;  3I5J C;  2GBJ A;  3AM9 A;  4RH6 A;  4ICU A;  5IP4 D;  2JUO A;  4XDC A;  2N9K A;  2C7M B;  4I6L B;  4HJG E;  2GBR A;  3FIL B;  1P3Q U;  2KJ6 A;  3Q2A C;  3IG3 A;  2MW5 A;  3A33 B;  5FKA C;  1STE A;  3HM6 X;  5BMG A;  3AE5 B;  3BVM A;  3MJ5 A;  1NYQ A;  2AL3 A;  1EO6 A;  4KGT A;  5TSS A;  1UH6 A;  3T8M A;  4DDG D;  2EMT A;  2J0K A;  1K8R B;  1NVI D;  2LUM A;  1V97 A;  1F2R I;  4AQ7 A;  3M62 B;  4K3C A;  3AH7 A;  1XLP A;  3IHP C;  1MJD A;  2LGY A;  2WWZ A;  2FUG 1;  4WWO A;  5E6O A;  3VUY A;  3RZW C;  4QAY A;  2KWD A;  2WXG A;  2ZCC A;  2Z0D B;  1JCK B;  3BVZ A;  4MGZ E;  4C00 A;  3WAP A;  4RFB A;  5D2M B;  3W1S C;  4M0W B;  3K9O B;  2KDB A;  3BVG A;  1L5P A;  2J52 A;  3NS1 A;  2KO3 A;  1E7U A;  2LXC A;  4PS8 A;  2IDY A;  4OZA A;  1WRI A;  3Q3O C;  1AYF A;  1JWA D;  1V5O A;  3B9J A;  2LEK A;  3DPD A;  3H6N A;  2LJ5 A;  2HE7 A;  1SIF A;  2NS5 A;  4W9F A;  2MBQ A;  3AN1 A;  3QIJ A;  3QJZ A;  4R3D A;  1PGB A;  1NI3 A;  3AED B;  3N20 C;  4ZYS A;  3MHZ A;  3B2F A;  4KSK C;  4GOC A;  1CQV A;  2MSE D;  3R7Q A;  3CWI A;  3VHT C;  5GXG B;  3VQI A;  1C3T A;  1EUV B;  1XCQ L;  1WIA A;  2AWT A;  2OJR A;  5KHQ A;  1WJ4 A;  4JIO U;  1GAQ B;  2IZV B;  4C4V B;  2KVZ A;  2WU5 B;  1UGM A;  3SFD B;  2O6V A;  2D3C A;  2KJR A;  3KW5 B;  3Q8E A;  5LNK 1;  2AEH A;  5DPW A;  4KSL C;  2KFK A;  4G50 A;  5CX3 A;  4YTN B;  1GPX A;  3LJ3 A;  3MC0 B;  2LVQ A;  1SE2 A;  3L54 A;  3NVY A;  1QLB B;  2SAK A;  2PKO A;  1TBE A;  3Q6B A;  1E8Y A;  4J3O D;  2KX0 A;  1RM6 C;  2VRR B;  1TS3 A;  3HVZ A;  2D5G A;  4PYU A;  2JT4 B;  2IO2 B;  2QMT A;  4GDL B;  4II2 B;  3SD5 A;  3AI5 A;  3QWZ B;  4MGI E;  3KVF B;  2FAZ A;  3PVL A;  4RGM A;  1LM8 B;  5AZH A;  4YXD B;  5I4D A;  1JRP A;  2MHJ A;  1JWM D;  1T0R C;  4BAX A;  4BVU C;  3PZ7 A;  4J6I A;  1UD7 A;  4EFO A;  4FXC A;  2GBM A;  2C7H A;  2E3T A;  2DX5 B;  3L13 A;  1R4M I;  4K3B A;  4KZ0 A;  2WXN A;  2M17 A;  3CF6 E;  4KX6 B;  1J19 A;  3JYU A;  1VR9 A;  2BVC A;  2KN4 A;  1ISN A;  1SE4 A;  1WMH A;  1RYJ A;  3VR9 B;  3RFZ B;  3AE9 B;  3MC9 A;  4ZRI A;  1FCL A;  3ZNG C;  1FNU A;  3JW0 X;  4IWQ A;  3BK2 A;  2QSD A;  3AE6 B;  2DZK A;  5JHB A;  1YX5 B;  3UIO B;  2KDM A;  2ONQ A;  3RYT A;  1HQR D;  4HDO A;  1WZ3 A;  2J0M A;  3AE2 B;  4NAW A;  3ZTC A;  1GOZ A;  1SXT A;  3HUI A;  4BKS A;  3DWM A;  1XD3 B;  4XC2 A;  3SR6 A;  2H89 B;  5D3I B;  3R8B A;  1IGD A;  1MHX A;  3B0A A;  3ALB A;  1WJN A;  1WH3 A;  4AS1 A;  4K1R B;  2VH2 A;  1DOX A;  1MG8 A;  3VH4 B;  1BUI C;  2N7J A;  1C4C A;  2MJ3 A;  1VLB A;  5C1Z A;  2JWZ A;  1KOT A;  3IT4 B;  4YSY B;  4MSM B;  5H92 C;  2KFK B;  1E8Z A;  5HG2 A;  1FNW A;  1WY8 A;  4P1C C;  3CIR B;  1HTQ A;  2LHD A;  5IOI A;  2OJW A;  5BYR A;  4S17 A;  1JWB D;  4KGR A;  3A9J B;  1TYG B;  4XZ4 A;  1WE6 A;  4YTP B;  3GS2 A;  2KLC A;  3KUC B;  3N1Y C;  3A9K A;  5JHA A;  1WGG A;  4MEM A;  2KT7 A;  2YEP F;  1WRD B;  2IY0 B;  1RFA A;  2J0J A;  2Y3A A;  3DVG Y;  1P98 A;  3ZJU A;  2RPQ A;  1HZ5 A;  4G11 A;  4P6V F;  3X23 A;  3GE3 C;  1D5X C;  3ENE A;  3W5V B;  2AQ2 B;  1PDX A;  1N6Z A;  3H7P A;  2VH1 A;  2KWC A;  1Q5W B;  2FID A;  1YN3 A;  3OG5 A;  1JQ4 A;  4C7Z A;  3EC8 A;  3V61 A;  5CHV C;  1WYW B;  1V86 A;  4TMA B;  5IA7 A;  2WGS A;  3VUW A;  1MHH E;  1WXQ A;  2BYE A;  5G5G A;  3ONS A;  3P42 A;  2K1F A;  2IGH A;  3HM3 A;  2YEP B;  2KTF A;  4B0E A;  2KN5 A;  1T0Q C;  3W2D A;  3V6E B;  1P7E A;  1F1H A;  2PW9 A;  2KMC A;  2RDH A;  3VFK A;  1TKE A;  1UF0 A;  1BT0 A;  4HXD A;  2WXF A;  3DBR B;  4WQM A;  2D3A A;  4DXA B;  1P9D U;  3PT2 B;  2MBH A;  2XEW A;  3VRB B;  2NTT A;  4HPP A;  1UEL A;  2WXI A;  1MVK A;  1L0Y B;  1R7S A;  3PZ8 A;  2UYZ B;  3ZDM C;  5JH5 C;  5AEK B;  5TR5 A;  3UI3 A;  5AUI A;  3S2A A;  2WHI A;  3KWV A;  4KKI A;  3ZJT A;  4WQO B;  3PPA A;  2WXK A;  1VZ7 A;  1L0X B;  3EFC A;  1ZE3 D;  4I6P A;  2XK5 A;  2K25 A;  2YLM A;  1H4R A;  3VTW A;  3KYD D;  2ZVN A;  2C9W B;  3L16 A;  4HLE A;  1N61 A;  2R2O A;  3P63 A;  2JZP A;  2L05 A;  3GOE A;  1ZKH A;  1SJH D;  1GB1 A;  2N9X A;  3UQA A;  4LCD E;  1D5Z C;  1F9J A;  3IAS 1;  2KTR B;  1FFV A;  3AU4 A;  2V3N A;  4HDQ A;  2BWF A;  3BYT B;  4RGN A;  3QK0 A;  4ZRJ A;  1C76 A;  2NR2 A;  1C1Y B;  3EUB 2;  5FR6 A;  3TEY A;  2DZJ A;  2KDI A;  2KD0 A;  1PUT A;  2MQJ A;  2HD5 B;  4FN2 A;  1L2N A;  3DVG X;  2MBO A;  3DQV A;  2IBI B;  2DYB A;  3ML8 A;  1MPE A;  3QQ8 B;  4M00 A;  2HTH A;  2JSV X;  4HPM B;  2Z0E B;  2LXA A;  2D10 A;  3ZRF A;  4ANX A;  3AEG B;  1MG4 A;  1E0Z A;  4YSZ B;  2JX5 A;  1T0S C;  1GC7 A;  5C23 A;  1I35 A;  2B3A A;  1UNS A;  4NY0 A;  3VR8 B;  2WXJ A;  3AE1 B;  1LFD A;  3H7P B;  5J17 A;  2L76 A;  2LMC A;  4M0W A;  3N3K B;  3AXC A;  1NDD A;  3ML9 A;  1EU3 A;  5AUK A;  3H7S A;  3UIN B;  4ASW C;  1GUA B;  3RNF C;  5E6P A;  1BML C;  2LFI A;  4GLS C;  1D5M C;  2INC C;  3A1Q B;  3WAM A;  3Q8A A;  1YOV B;  2K8H A;  4DHZ B;  1P0R A;  5AZG A;  2KNB A;  1JW9 D;  3Q14 C;  3W1S A;  3L17 A;  4A9A A;  2KC1 A;  1L6V A;  1WM2 A;  3RZF A;  1E7P B;  2MJD A;  4XGA B;  4JGH B;  4TQ0 A;  2JYE A;  1YIW A;  2I1K A;  2L8J A;  4NZL B;  1L4D B;  1I42 A;  1GJZ A;  1E8W A;  3C19 A;  2G9H D;  4DK5 A;  2G3Q B;  5CHF A;  4B6W A;  3ZGZ A;  1WR6 E;  4LNI A;  1ZDX A;  4WH4 A;  1WGY A;  4BBN C;  4BKG A;  1YQB A;  1T5X D;  2FCM A;  2FNJ B;  4TSS A;  2QCZ A;  1G6J A;  4EUT A;  2JRI B;  3HHM A;  2XK5 B;  1V1P A;  3ZJV A;  2KMM A;  3TEZ A;  1FMA D;  5L83 A;  4AP4 C;  1NEK B;  4EEW A;  4G3X B;  1E10 A;  4GIV A;  4L2Y A;  1PQS A;  3M95 A;  2V9H A;  4DXF A;  3SHQ A;  1J8C A;  3RNC C;  3AEC B;  3T3N A;  4GGQ A;  4HWI B;  4DHJ B;  3P4Q B;  4OW0 A;  4FUL A;  4GDL A;  1L4Z B;  1M94 A;  3ZKJ C;  4C7Y A;  4M01 A;  4A3P A;  4AUQ C;  1KF6 B;  4GDK A;  1HEZ E;  2KAN A;  1ZDV A;  3PO0 A;  4IUM B;  1PGX A;  2ZVO A;  1WX8 A;  1Y8R C;  2K5P A;  3QAR A;  3P4S B;  4RM8 A;  1UUP A;  1XQQ A;  1V9J A;  1C77 A;  1HXY D;  1VZ6 A;  2QC8 A;  3ZO5 B;  4XWW A;  2C60 A;  3RD2 A;  2A5U A;  5BYQ A;  1WF9 A;  2J7Q B;  2V4I B;  1PFD A;  4NQL B;  3ZIM A;  2PMV A;  2IGD A;  4O1N A;  1QIL A;  2GBK A;  4ZRP A;  3FKY A;  4LJP B;  1I4R A;  3IBE A;  3P4P B;  3HRD D;  3EHV A;  2ZEQ A;  4ZHP A;  2N4F A;  1V5T A;  1UGJ A;  4E3C A;  5JXV A;  2K22 A;  3TUO A;  1SJE D;  5T8I A;  3U7Z A;  4HCN B;  3FC4 A;  3GP7 A;  5FR3 A;  2DWQ A;  2Z8L A;  4BZA A;  2L32 A;  3C0R B;  1A70 A;  4GB9 A;  1ESF A;  1FIQ A;  3BIN A;  4FLH A;  2KK8 A;  1E7V A;  1TY2 A;  1CK1 A;  4C56 C;  3VUX A;  4AWJ A;  4KIK B;  2IGG A;  2D3G A;  2O6V D;  4ZOH C;  5EDS A;  1UWM A;  2NVU I;  4PS7 A;  2LWP A;  3BYY B;  3VAW A;  2EMS A;  2QIE B;  1NI2 A;  3GE8 C;  2ZW0 A;  3PRM B;  1K51 A;  4KKJ A;  3TCA A;  1KLV A;  5D7G A;  5G55 A;  1MI0 A;  3DBL B;  3C8Y A;  1D4B A;  2BW2 A;  4K7W A;  1ZXH A;  2NBV B;  4IWO A;  2HTM E;  5FK9 C;  1EU4 A;  2MP2 A;  1FO4 A;  4UDU C;  5C2T B;  3M63 B;  3DBR I;  4LNO A;  3CST A;  1V1P B;  1FXA A;  1FXI A;  3SU8 X;  2M0X A;  1ZUD 2;  3LDZ E;  2N1V A;  3QC8 B;  4JQW C;  2R2Q A;  3V6C B;  3A9J A;  3QX1 A;  1JRU A;  2INN E;  1J7B A;  1GNU A;  1WR1 A;  4FJY A;  2LHE A;  3GZN B;  2Y5C A;  4GN1 A;  2BTE A;  3AMZ A;  2AL6 A;  3U52 E;  1YJI A;  4LNK A;  1XF5 L;  4ICV A;  1SSN A;  2BQQ A;  4PK1 A;  3RNE C;  4GDK B;  3DWG C;  3KYC D;  4ZRK A;  3IFW B;  1N62 A;  3AU5 A;  1HTO A;  4K81 A;  1P7F A;  2D11 A;  2K6D B;  2BGF A;  4HEA 1;  3R66 C;  1FFU A;  2LRU A;  3MC8 A;  3IVF A;  1WXM A;  4NJC A;  1OTR B;  1UZX B;  2K8C A;  2KQS A;  4PT5 A;  5EE1 A;  2RDG A;  2LGS A;  4LLG M;  3DHG C;  4IWP A;  3RN9 C;  4HCP B;  1I4X A;  2XBB C;  2REX A;  3U7D A;  1ZP0 B;  2BB5 A;  4RMA A;  2ZZP B;  1NEN B;  1K52 A;  2ZCB A;  4DQO C;  3AV8 A;  1WJU A;  3J9C A;  2DAF A;  1SEB D;  3WAL A;  2KWV B;  1HE8 A;  4BKS D;  2KAC A;  4HRO A;  2MRP A;  5J2R A;  4MM3 B;  4JE3 B;  1ENF A;  1S3S G;  4YT0 B;  3IXS A;  3LXF A;  3V62 A;  1ACC A;  1LO5 D;  1XLO A;  3L0W B;  4BOZ B;  4ZDV A;  2CHX A;  2M1M A;  2XN9 C;  1OGW A;  1I4Q A;  1YJ1 A;  3KQ4 A;  2DHZ A;  1Q1O A;  4I6N B;  2FCN A;  4C80 A;  3JSV B;  1WJ6 A;  3RNB C;  1X1M A;  4W9L A;  4AJY B;  1V6E A;  1OQR A;  4JLC A;  4REZ A;  3B2G A;  4LK0 M;  2KTR A;  3MJW A;  1HA5 A;  3EFU A;  4ZRQ A;  5KHO A;  4F8C B;  2RD0 A;  2MH7 A;  2MP2 B;  2WQY B;  3Q3M C;  2RMM A;  4FJZ A;  1ZGU B;  3I63 C;  4PYZ A;  2CJN A;  2KX3 A;  1ZOY B;  2JWU A;  2IO0 B;  1QZE A;  2FBW B;  2SEB D;  1QOA A;  1WE7 A;  2JQR B;  4P1B C;  2L1A A;  4CO7 A;  4NNJ B;  3UIP B;  2M8S A;  3EGR A;  3KWL A;  4MT5 A;  5JZE B;  2PTL A;  3N1X C;  4DXG A;  1IBX B;  1OFF A;  4DBG A; 
#chains in the Genus database with same CATH homology
 2DYB A;  2IYD B;  2KOX A;  2KMA A;  3ML8 A;  1UH6 A;  1GG3 A;  4W9G A;  3T8M A;  3QQ8 B;  4DDG D;  2EMT A;  2HTH A;  2J0K A;  4HPM B;  2KJH B;  2Z0E B;  2LXA A;  3A4R A;  3PLV A;  4YL8 A;  2EKE C;  1K8R B;  2D10 A;  2KKC A;  3ZRF A;  4ANX A;  3PV1 A;  2BWE S;  4FHK A;  2WX1 A;  3PLU A;  3P2B A;  3TIX A;  1GC7 A;  3M62 B;  5C23 A;  2B3A A;  3PRE A;  1I35 A;  3IHP C;  4NY0 A;  4E74 A;  3SDL C;  1OQY A;  1VCB A;  3RT3 B;  3M3J A;  2LGD A;  4NJ6 A;  5D6J B;  2OOB B;  2CR5 A;  1LFD A;  4IG7 B;  2LGY A;  2WWZ A;  4AJW A;  4TKN A;  3H7P B;  1IYF A;  1WZ0 A;  5E6O A;  4WWO A;  3VUY A;  5J17 A;  2L76 A;  3QA8 A;  3RZW C;  2N7D A;  3A1Q A;  2JXX A;  4MGK E;  2ZCC A;  3N3K B;  2O2V A;  4BFR A;  3AXC A;  1NDD A;  2YVC A;  2Z0D B;  3ML9 A;  3UIN B;  3H7S A;  4ASW C;  1GUA B;  3PZD A;  2BKF A;  2L00 B;  1RAX A;  4MGZ E;  5E6P A;  2PEA A;  1WGR A;  3WAM A;  3WAP A;  2FIF A;  3A1Q B;  2K8H A;  1SE9 A;  5D2M B;  4DHZ B;  5DPR A;  1P0R A;  3W1S C;  3W1Y A;  4M0W B;  5AZG A;  2KNB A;  1RLF A;  3W1S A;  3K9O B;  2KDB A;  3QCA A;  2RSU A;  1U4A A;  3DCG A;  2KO3 A;  4WJO A;  2M4N A;  1E7U A;  2N1W A;  3L17 A;  5CTR C;  2LXC A;  4WAA A;  2KC1 A;  4PS8 A;  2JZ3 B;  1S1Q B;  1WM2 A;  3OJ3 A;  1V5O A;  3RZF A;  3DPD A;  4MSQ B;  2GOW A;  3H6N A;  3VTU A;  4II3 B;  2MBB B;  2LVP A;  2LJ5 A;  2MA9 B;  3HIZ A;  2HE7 A;  1SIF A;  2NS5 A;  4JGH B;  4W9F A;  4TQ0 A;  1YIW A;  2I1K A;  2MBQ A;  2L8J A;  2BKR B;  4A3O A;  1L7Y A;  1I42 A;  3QIJ A;  2JZZ A;  1GJZ A;  3QJZ A;  4AOF A;  1E8W A;  1WXS A;  3PHW B;  4M8M A;  4GMV A;  4DK5 A;  2G3Q B;  5CHF A;  4KZC A;  4KSK C;  4B6W A;  1WR6 E;  4GOC A;  2NBW B;  1CMX B;  4IM3 A;  4MDK E;  2K6Q A;  4ZYN A;  1WGY A;  3NZU A;  4BBN C;  4WJP A;  2MSE D;  4BKG A;  1YQB A;  3R7Q A;  2FCM A;  2FNJ B;  5LXH A;  4TUU A;  3VHT C;  1G6J A;  2K8B A;  4K7S A;  4EUT A;  2JRI B;  1V49 A;  3VQI A;  4RM9 A;  1C3T A;  3HHM A;  1EUV B;  3PS6 A;  2LI5 A;  1WIA A;  2AWT A;  2OJR A;  2XK5 B;  3PRP B;  4N9F 4;  5KHQ A;  1WJ4 A;  4JIO U;  1H8C A;  3O65 B;  2IZV B;  2I1J A;  4B9K A;  1UGM A;  2ZPY A;  2L3Z A;  2G45 B;  4HK2 A;  3ZDT A;  2O6V A;  3TL5 A;  2KJR A;  2LGX A;  3PGE A;  4W9J A;  5L83 A;  4XX5 A;  3PTF C;  3KW5 B;  3X0W A;  2BYV E;  3WA0 A;  4AP4 C;  3ZW3 A;  2GBN A;  2AEH A;  4EEW A;  4FA6 A;  3HK0 A;  4G3X B;  2LUE A;  4GIV A;  2KFK A;  4G50 A;  4KDI C;  4KSL C;  3ZNZ B;  5DPW A;  2K39 A;  5CX3 A;  2UWQ A;  2D2Q A;  2O6V B;  3LJ3 A;  4W9K A;  2LVQ A;  1NBF C;  1PQS A;  2MX2 A;  3M95 A;  4IC7 B;  4MJS A;  3SHQ A;  1J8C A;  3L54 A;  2DZI A;  5DPT A;  3ZTD A;  2L7R A;  3H9D A;  2DZM A;  4GGQ A;  1Q0W B;  2FUH B;  3DBL I;  4HWI B;  2MCN B;  4BOS C;  1TBE A;  4DHJ B;  1WI0 A;  1E8Y A;  2JVC A;  4FUL A;  3DVN U;  4GDL A;  1Z5S B;  4FJV B;  2KX0 A;  3ZNH B;  1M94 A;  4MJS B;  3ZKJ C;  2VRR B;  4A3P A;  1E5W A;  3KH0 A;  2MBE A;  4PYU A;  1P1A A;  4AUQ C;  4GDK A;  1V80 A;  4ANW A;  2KAN A;  1LQB A;  2JT4 B;  2LVO A;  4G0N B;  2IO2 B;  4IUM B;  1TZ1 A;  2KC2 A;  4GDL B;  4II2 B;  3T9L A;  3SD5 A;  2KDF B;  2V1Y A;  3NHE B;  2CKH B;  2ZVO A;  3DDC B;  3AI5 A;  3MHS D;  4IW0 A;  4KV2 A;  3RUL A;  3QWZ B;  1V81 A;  4MGI E;  3KVF B;  2FAZ A;  1WX8 A;  1Y8R C;  3L10 B;  3PVL A;  1LM8 B;  3CSF A;  3QAR A;  5AZH A;  4ANV A;  2FCS A;  4RM8 A;  1XQQ A;  4MH0 E;  1V9J A;  2DAJ A;  4OVU A;  3DBH I;  3NZS A;  2LZ6 A;  2WDT B;  1WXA A;  2DYO A;  3WAO A;  3ZO5 B;  2C60 A;  3RD2 A;  4GXB A;  1KM7 A;  2A5U A;  3ZUN A;  3GZN I;  5L95 C;  1WF9 A;  2J7Q B;  4BVU C;  4NQL B;  3ZIM A;  1D3Z A;  2GBK A;  4E71 A;  5D94 A;  3BY4 B;  1LXD A;  2V3S A;  2V4L A;  2G4S A;  3NS8 A;  1UD7 A;  1WX7 A;  4J6I A;  4TQ1 A;  3VVW B;  4URK A;  4LJP B;  4EFO A;  3IBE A;  2KZR A;  2O2V B;  3EHV A;  2GBM A;  2C7H A;  2ZEQ A;  1IPG A;  2DX5 B;  3L13 A;  1R4M I;  1XT9 B;  2C5L C;  2PE9 A;  4KZ0 A;  3EEC A;  2DYM A;  2N4F A;  2M17 A;  1V5T A;  2HJ8 A;  2LD9 A;  5CHW A;  4FHJ A;  3CF6 E;  3VDZ A;  4E3C A;  3PSE B;  3NOB A;  4F1S A;  3N30 A;  1J19 A;  1YX6 B;  4KIK A;  4HCN B;  3WAN A;  3JYU A;  1A5R A;  3MTN B;  3L08 A;  1WXV A;  3C0R B;  5HKH A;  3B08 A;  1ISN A;  3ZLZ A;  4GB9 A;  1WMH A;  2ASQ A;  3BIN A;  4FLH A;  2KK8 A;  1E8X A;  1E7V A;  4ZRI A;  3Q3F A;  3ZNG C;  3VUX A;  4AWJ A;  4KIK B;  2D3G A;  2O6V D;  5LXI B;  2L0T A;  2KWU B;  2MWS B;  2KXJ A;  3JW0 X;  4IWQ A;  5EDS A;  2NVU I;  4PS7 A;  2DZK A;  3DBS A;  2LWP A;  2PJH A;  1WMH B;  3VAW A;  2EMS A;  1YD8 U;  5JHB A;  4KDL B;  2Z59 B;  1YX5 B;  1NI2 A;  4DHJ D;  3UIO B;  3PRM B;  4NJ7 A;  3TCA A;  1VD2 A;  3RYT A;  1KLV A;  5D7G A;  3VTV A;  4HDO A;  1WZ3 A;  2J0M A;  4NAW A;  5G55 A;  3V60 A;  3ZTC A;  2C7N B;  2KHW B;  2LRW A;  2N9P C;  2PPH A;  4MGY E;  4BKS A;  2CHW A;  2RR9 A;  3QAQ A;  4K7W A;  1XD3 B;  2NBV B;  4TV3 A;  1T0Y A;  4IWO A;  4XC2 A;  3UF8 A;  2KQ7 A;  1AAR A;  3ZRC A;  4JL9 A;  4NAW B;  3B0A A;  1R4N I;  2MP2 A;  3ALB A;  1WJN A;  3U30 A;  1WH3 A;  3M63 B;  3DBR I;  3APC A;  3R3M A;  3CST A;  4K1R B;  3TMP B;  1J0G A;  2BPS A;  4LDT D;  5GMV A;  1MG8 A;  2LAS A;  4W9C A;  3SU8 X;  2M0X A;  3VH4 B;  2W9N A;  4FBJ B;  4EZJ A;  2PE6 B;  3LDZ E;  2N1V A;  5C1Z A;  2JWZ A;  3QC8 B;  3OLM D;  2R2Q A;  4JQW C;  4P7I A;  1KOT A;  3V6C B;  3TBL D;  3B1L X;  4MSM B;  5DCN A;  3A9J A;  2WX0 A;  3QX1 A;  1OEY J;  4HJK A;  1EF5 A;  1JRU A;  3UGB B;  2KFK B;  1E8Z A;  2KFJ A;  1GNU A;  4EZL A;  1WR1 A;  4FJY A;  3RUI B;  4NPN A;  4WJN A;  1WY8 A;  3KUZ A;  4GN1 A;  1OEY A;  2MLB A;  2N9E B;  2AL6 A;  2JY6 A;  3A9J B;  2DEN B;  4GSW A;  1WGD A;  1ZW7 A;  3PRZ A;  3KUD B;  4XZ4 A;  4W9E A;  2KDE B;  1WE6 A;  2KLC A;  3KUC B;  3NY5 A;  3A9K A;  5JHA A;  4ICV A;  1WGG A;  4MEM A;  1E90 A;  1WRD B;  2IY0 B;  1RFA A;  4CYE A;  4DHZ E;  2J0J A;  3DVG Y;  4GDK B;  1P98 A;  2QHO A;  3KYC D;  4LDT B;  4ZRK A;  2IY1 B;  4F7Z A;  1Z2M A;  2RPQ A;  3IFW B;  4G11 A;  3X23 A;  3AU5 A;  3ENE A;  3A9K B;  2NPT A;  4K81 A;  4GU2 A;  2D11 A;  3H7P A;  2K6D B;  2BGF A;  3OAW A;  4ANU A;  3R66 C;  1WFY A;  1UBI A;  2KWC A;  3JVZ X;  4KVG B;  2LRU A;  1Q5W B;  4W9D A;  2FID A;  2JRH A;  4IM2 A;  3ECI A;  3IVF A;  1WXM A;  2D07 B;  2NPT B;  1OTR B;  1UZX B;  2K8C A;  1WM3 A;  4EZK A;  4HVB A;  3EC8 A;  2KQS A;  4WWN A;  3V61 A;  5CHV C;  1WYW B;  2AYO B;  1V86 A;  2ZPN A;  4WWP A;  2A4Z A;  4A20 A;  5IA7 A;  3VUW A;  3ZVV A;  2ZNV C;  3RCZ A;  1WX9 A;  4IWP A;  2BYE A;  1IP9 A;  5DPS A;  3Q3J A;  3ONS A;  4HCP B;  2XBB C;  2K1F A;  4MM3 A;  2REX A;  5AZF A;  3U7D A;  4RMA A;  1KJT A;  3HM3 A;  4DDI D;  4W9I A;  4HPL B;  5BO4 B;  3H1U A;  2ZZP B;  2L0F A;  2CHZ A;  3U8Z A;  3UQB A;  2ZCB A;  2KTF A;  1WJU A;  2KN5 A;  2DAF A;  4EOY A;  3V6E B;  3WAL A;  2KWV B;  1HE8 A;  4PS3 A;  4EKU A;  3QHT A;  4BKS D;  5E6N A;  2ZNV B;  3CMM B;  2MRP A;  2KMC A;  1EF1 A;  3A4S C;  3D32 A;  5J2R A;  1SGH A;  1S3S G;  3DVN V;  3VFK A;  3VXW A;  1V2Y A;  2NCN A;  1BT0 A;  2N7E A;  4HXD A;  4B95 A;  4BBN F;  4X57 B;  3V62 A;  4DXA B;  1P9D U;  1TTN A;  2MBH A;  3L0W B;  2XEW A;  2CHX A;  3PT2 B;  5IAA C;  4BOZ B;  2M1M A;  4ZDV A;  3JSV A;  3DOW A;  3N32 A;  1RRB A;  1UEL A;  2GMI C;  1OGW A;  2KLG A;  5LLI A;  3AUL A;  4DWF A;  2UYZ B;  1TGZ B;  1YJ1 A;  5J18 A;  2CU1 A;  2JPH A;  4IM0 A;  3ZDM C;  5JH5 C;  2DHZ A;  2RGF A;  4W9H A;  3APF A;  1Q1O A;  2IO1 B;  2Y5B B;  5TR5 A;  5AEK B;  2WYQ A;  2ZJD A;  4OVV A;  3S2A A;  4WJQ A;  4I6N B;  3ZNI D;  4WQO B;  2FCN A;  3PPA A;  5G2N A;  3JSV B;  1WJ6 A;  3PHX B;  3OJ4 B;  4I6P A;  1X1M A;  4NQK E;  4W9L A;  4AJY B;  2XK5 A;  2BYF A;  3I3T B;  2K25 A;  2YLM A;  1V6E A;  1WGH A;  1H4R A;  4JLC A;  3R7R A;  3VTW A;  3KYD D;  2ZVN A;  2C9W B;  3L16 A;  4HLE A;  4CHK A;  2R2O A;  2G4D B;  2FCQ A;  2L05 A;  3GOE A;  1ZKH A;  2KTR A;  2N9X A;  3MJW A;  3EFU A;  2GBJ A;  3APD A;  3UQA A;  4LCD E;  4LJO B;  4ICU A;  5KHO A;  4F8C B;  1F9J A;  2JUO A;  2RD0 A;  3TJP A;  4FAD A;  2NBU A;  2MP2 B;  4K7U A;  4FJZ A;  3K9P B;  1ZGU B;  1GC6 A;  2BF8 B;  4PYZ A;  2KTR B;  2KX3 A;  2C7M B;  3AU4 A;  4I6L B;  2JF5 A;  2GBR A;  4MEL A;  4HDQ A;  2IO0 B;  1QZE A;  4M8N A;  2BWF A;  2CS4 A;  1P3Q U;  1WE7 A;  2KJ6 A;  3QK0 A;  3IG3 A;  4ZRJ A;  2MW5 A;  4CO7 A;  2NR2 A;  4NNJ B;  1C1Y B;  5FR6 A;  2M8S A;  3UIP B;  2IO3 B;  3A33 B;  2DZJ A;  2KDI A;  2KD0 A;  3VH3 B;  2MQJ A;  3HM6 X;  2HD5 B;  5JZE B;  1FXT B;  4FN2 A;  1L2N A;  3DVG X;  2MBO A;  3WIM A;  1UBQ A;  3DQV A;  4BKT A;  2AL3 A;  2KVR A;  2IBI B;  1EO6 A;  4DBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...