2LASA

Molecular determinants of paralogue-specific sumo-sim recognition
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
78
structure length
78
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Small ubiquitin-related modifier 1
publication title Insights into High Affinity Small Ubiquitin-like Modifier (SUMO) Recognition by SUMO-interacting Motifs (SIMs) Revealed by a Combination of NMR and Peptide Array Analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2011-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lasA00
1R4NI 1RFAA 2ZZPB 3JYUA 4IM0A 1PQSA 4FADA 1Q5WB 2LUEA 2KC2A 2JWZA 1D3ZA 4XC2A 5G2NA 1Z2MA 2UWQA 3PHXB 4MSQB 4NY0A 1J8CA 2WWZA 1WE7A 3EC8A 4GU2A 1KLVA 2KX0A 2KN5A 4NJ6A 2KMAA 5DPRA 2R2OA 3R3MA 4IC7B 4M8MA 2DHZA 1E5WA 2CHZA 2JUOA 1WXAA 5D94A 3L0WB 4CO7A 2M17A 3DCGA 4B9KA 4RM9A 3PLVA 2FCSA 4WAAA 1ZGUB 2REXA 5CX3A 3L16A 3PS6A 2BF8B 4KV2A 4FBJB 3ZNZB 3VFKA 4K7WA 4XZ4A 2LGDA 3ZLZA 3VHTC 3IG3A 3JSVB 3KYCD 1OEYA 3A4SC 3WAMA 4W9CA 3RZFA 2ZEQA 3H6NA 2AL6A 2LGYA 1VCBA 3RT3B 1U4AA 4EOYA 4TUUA 5AZFA 2DAJA 2LI5A 3NS8A 2JPHA 3NZUA 5AZHA 3UGBB 3A9KB 1CMXB 1GJZA 2NBVB 2KDEB 3PREA 1RAXA 4WQOB 2DZKA 4MGZE 2HD5B 1OQYA 2KO3A 4E3CA 3V6EB 2FCQA 3ZNHB 1ZW7A 4G11A 1WGDA 4F7ZA 2K6DB 4MEMA 1WZ3A 3UINB 3T8MA 2XK5B 1E8WA 3ML8A 3JVZX 3Q3FA 2MQJA 4EFOA 2OOBB 4DHZE 2EKEC 5JH5C 2KNBA 3IFWB 2GBMA 2JY6A 2M8SA 4IM3A 4W9KA 1L2NA 2KJHB 4BKTA 2KDFB 2KVRA 3VUWA 4K7UA 3W1YA 4ANXA 3CMMB 2RR9A 1OTRB 2KANA 3A9JB 2LJ5A 4DWFA 4BOSC 3D32A 4DHJD 1E7UA 3K9OB 2VRRB 1YD8U 4KSKC 3R7RA 2JXXA 3W1SA 3X0WA 2MSED 2QHOA 2L8JA 1P9DU 3VH4B 1VD2A 3KUCB 3ML9A 4FJVB 1LM8B 4WJOA 3DVNV 3U30A 3V62A 2HTHA 2JT4B 1UZXB 3ZRFA 5EDSA 3TL5A 2PEAA 3A1QA 4GN1A 2O6VD 1L7YA 4JGHB 4CHKA 3WALA 5D6JB 1P1AA 3DVGY 2KKCA 1NBFC 2NBUA 1Q1OA 4W9LA 3UIPB 2MBOA 4HPMB 4WJNA 2W9NA 5LXIB 2J0JA 1V86A 1YX6B 4KSLC 4TQ1A 5DPSA 4GOCA 4GB9A 1V5TA 4A3PA 1UGMA 3U7DA 2DX5B 5JHAA 1WMHA 1P98A 3DDCB 2B3AA 4GXBA 4TKNA 3OJ4B 2MBBB 3PV1A 2MWSB 4WWOA 3PZDA 2WDTB 3WAOA 2AWTA 2D2QA 2KDBA 1WJ4A 3H7SA 4PS3A 5KHOA 4XX5A 5J18A 1HE8A 2A5UA 2AYOB 2N9XA 2G4SA 4E74A 2LRUA 2LXCA 2O2VB 4GMVA 2JRIB 4FA6A 4MJSA 4MGIE 4NAWA 3DPDA 4MH0E 1WM2A 2KDIA 3DQVA 4W9DA 2DENB 1WX7A 3APDA 2LVPA 4LJOB 3VH3B 2K6QA 4KIKA 1V5OA 5CTRC 5IA7A 1WF9A 2ZJDA 4DXAB 1WXVA 2NPTA 1TTNA 1JRUA 1V80A 3ZDTA 1P0RA 2FAZA 4BVUC 4PS7A 2KJRA 4W9GA 3NOBA 4B95A 4URKA 3RZWC 4HDQA 2AL3A 4WJPA 5E6NA 4DBGA 3B0AA 3L10B 5BO4B 3S2AA 1GC6A 2N9PC 3QARA 3UIOB 3Q3JA 4I6PA 5FR6A 3M62B 3AXCA 2I1JA 1WGGA 4FJYA 2EMTA 1P3QU 2KFKA 3QQ8B 3V61A 2IY0B 5L95C 3WA0A 5TR5A 2O6VA 5CHVC 3QWZB 4MSMB 3OLMD 1SGHA 3QA8A 2GBRA 1V2YA 1MG8A 2O2VA 4ZRIA 3DVGX 3VUXA 4ANWA 1YX5B 3PVLA 4J6IA 1R4MI 2JF5A 3N3KB 2MP2B 2DZIA 4KZCA 4HWIB 2K39A 3VTUA 2UYZB 2NVUI 2ZPYA 4ZRKA 1GNUA 4E71A 1WFYA 3TJPA 2XBBC 4FULA 4IWOA 4FN2A 3SU8X 2DYOA 1WJ6A 2M4NA 1E8ZA 2ZVNA 2K1FA 4TV3A 3HK0A 3HHMA 1WXSA 2ZCBA 1C3TA 2KTRA 1E8YA 2C5LC 1ISNA 3B08A 4EEWA 2YLMA 2GBNA 3QIJA 1BT0A 1WGYA 2WYQA 4HLEA 2MCNB 1LQBA 2IZVB 1WE6A 1AARA 1M94A 2KWCA 4NQKE 5CHFA 5J2RA 4FHJA 4II3B 2L7RA 4JQWC 1WY8A 2MA9B 3ZIMA 3ZVVA 2KHWB 4EUTA 4DHZB 4EKUA 2BYEA 2LZ6A 2WX0A 4MM3A 2N7EA 3I3TB 1TGZB 4AJWA 2FNJB 2MP2A 4FLHA 2L0TA 3VVWB 2IO3B 1C1YB 1YJ1A 1H8CA 1NI2A 1XD3B 3JSVA 2KWVB 3GOEA 4FHKA 1G6JA 2DAFA 2N1VA 4CYEA 2KZRA 2R2QA 2FUHB 1WX8A 3ZW3A 4GDKB 1K8RB 2WX1A 3M63B 3ONSA 3AI5A 3RUIB 2IO0B 3A9KA 3QJZA 3O65B 4W9FA 4ZYNA 2PE6B 4I6NB 3TBLD 3H7PB 2L3ZA 2C7HA 1FXTB 2FIDA 3L54A 2ZPNA 2L0FA 2FCMA 2K25A 5E6OA 2KJ6A 3MTNB 4BBNF 3SHQA 3KYDD 1LFDA 1TBEA 2ZNVC 1WJNA 1F9JA 2G4DB 2XK5A 3DBRI 3VUYA 3CF6E 2BKRB 5LXHA 1I42A 3NHEB 3L13A 1WGRA 2DZJA 3B1LX 3KUDB 4K7SA 4MGKE 3ZRCA 1UD7A 2DYMA 2Y5BB 4MELA 3RCZA 2L05A 3W1SC 5AZGA 4A20A 4F1SA 4GIVA 3A9JA 4M0WB 3TCAA 3H1UA 1T0YA 1WYWB 4K81A 5G55A 2ZVOA 3U8ZA 2IBIB 3QX1A 4HK2A 2C60A 4WJQA 2RSUA 4BBNC 3ZDMC 3IVFA 2K8CA 3R7QA 1V49A 2K8BA 2N4FA 2Z0EB 3QC8B 1WX9A 3CSTA 3V60A 2C7MB 3ZTCA 4GDKA 4AJYB 3VXWA 3ZKJC 3HM6X 3X23A 2BPSA 4GSWA 3OAWA 3DBHI 3EECA 1EF5A 1Q0WB 1KOTA 4PS8A 2M1MA 2NR2A 5J17A 2CS4A 2KC1A 3SDLC 3MJWA 4GDLB 1EUVB 3ECIA 3VTWA 1WH3A 2KOXA 3BY4B 2J0KA 3HM3A 1OGWA 1UBQA 4LDTB 3UQAA 4B6WA 3KUZA 2RGFA 3SD5A 4BFRA 3WANA 2KTFA 4W9HA 3TIXA 4WWNA 1UH6A 2ZCCA 3ALBA 1EF1A 1IPGA 2PPHA 1ZKHA 4IW0A 1Z5SB 2BWES 3UQBA 1E8XA 4ICUA 2ASQA 3APFA 1NDDA 3EFUA 4NPNA 3BINA 3PRPB 5DPTA 1GC7A 3AU5A 4G50A 4ANVA 3PLUA 2GMIC 1KM7A 2IYDB 1WZ0A 4KVGB 4X57B 3UF8A 4BKSA 4EZJA 1UELA 2CR5A 3NY5A 1YQBA 5KHQA 3RULA 2K8HA 3L08A 2JZ3B 3K9PB 4HDOA 2D07B 3PSEB 4AWJA 2KXJA 2ZNVB 3M95A 2PE9A 4W9EA 3ZNID 1V9JA 1A5RA 2Z0DB 2JVCA 2C7NB 3VDZA 2GOWA 4IWPA 2KLCA 2D3GA 2JZZA 3AU4A 4IUMB 2IO2B 2MBEA 4LJPB 2MLBA 4OVUA 2V3SA 4LCDE 1H4RA 4G3XB 4GDLA 2BGFA 2A4ZA 2MX2A 1KJTA 3A4RA 2KWUB 1GG3A 4HXDA 3VQIA 4ZRJA 4JL9A 4ANUA 3ZNGC 2PJHA 3KVFB 3HIZA 1Y8RC 4EZLA 5AEKB 5JZEB 5DPWA 2J7QB 2LVQA 3PHWB 1EO6A 4ZDVA 2D10A 3A1QB 4NJ7A 2LGXA 3LDZE 4RM8A 5JHBA 2BKFA 4TQ0A 2KD0A 2KQSA 2I1KA 4BOZB 4G0NB 2HE7A 1SIFA 1E90A 1OEYJ 2Z59B 3PPAA 2IY1B 3N30A 2GBJA 1WMHB 1J0GA 3ZTDA 3ZUNA 2CU1A 2BYVE 5D7GA 4EZKA 2LXAA 5CHWA 3IBEA 4MGYE 2N1WA 3PRZA 4JIOU 2L00B 3A33B 4WWPA 2DYBA 2IO1B 2LD9A 5L83A 1XT9B 2FIFA 1RLFA 3PGEA 3EHVA 4HPLB 4I6LB 4N9F4 1WR1A 2MW5A 5C23A 3QAQA 4ICVA 3V6CB 2MBQA 3M3JA 2N9EB 4MJSB 3DBLI 4NAWB 4NQLB 5D2MB 2DZMA 3N32A 4BKGA 3APCA 2LASA 1J19A 2D11A 2OJRA 1I35A 2NBWB 2JRHA 4FJZA 2YVCA 4IG7B 3MHSD 3QCAA 2L76A 4JLCA 4KIKB 2BWFA 1RRBA 4KDLB 4AP4C 2C9WB 2KLGA 2KQ7A 3KW5B 4DDGD 1SE9A 2NPTB 2NS5A 4YL8A 4M8NA 1V81A 4HVBA 5LLIA 3CSFA 1GUAB 1S3SG 1WRDB 2KMCA 2GBKA 2LWPA 4KZ0A 3PRMB 2FCNA 5GMVA 3RD2A 4DHJB 3PT2B 1WGHA 3KH0A 4IM2A 2CKHB 3H9DA 4W9JA 4BKSD 3NZSA 1LXDA 2KX3A 2V4LA 3R66C 2LVOA 3PTFC 3T9LA 3LJ3A 3ZO5B 4AUQC 2BYFA 2G45B 3P2BA 1IYFA 1X1MA 5E6PA 3JW0X 3WIMA 4F8CB 2KFKB 3OJ3A 1XQQA 1WJUA 3RYTA 4A3OA 2MRPA 4MDKE 2O6VB 4IWQA 3AULA 4PYUA 3C0RB 4GGQA 3DBSA 1WIAA 2EMSA 2G3QB 1QZEA 4RMAA 3DOWA 4HCNB 3TMPB 4K1RB 2NCNA 1S1QB 1IP9A 4ASWC 3IHPC 4LDTD 2HJ8A 5IAAC 2AEHA 1WR6E 2M0XA 3ENEA 3H7PA 2RD0A 2XEWA 4HCPB 2RPQA 4II2B 2MBHA 3L17A 3QHTA 4DK5A 2V1YA 1E7VA 5DCNA 4PYZA 3VTVA 4AOFA 2N7DA 2LRWA 2CHWA 2KK8A 4P7IA 2CHXA 1WM3A 1WI0A 3GZNI 4OVVA 1TZ1A 1WXMA 4HJKA 4NNJB 1YIWA 3VAWA 1V6EA 4DDID 2KFJA 5HKHA 3DVNU 1UBIA 3QK0A 4W9IA 5C1ZA 2KTRB 4KDIC 2J0MA 3WAPA
chains in the Genus database with same CATH superfamily
4M0WA 2WGSA 2ZZPB 3Q14C 4FADA 3VRAB 1I7HA 1ET6A 1Z2MA 4NY0A 2EKIA 2Z8LA 2FBWB 2KN5A 2ZW0A 1YNTE 2KMAA 3R3MA 2JUOA 3L0WB 3DCGA 3PLVA 2FCSA 2D3BA 4MM3B 4WAAA 2K5PA 1SJED 2QMTA 3AE5B 4FBJB 3I5JC 3ZNZB 3VFKA 2LGDA 3ZLZA 3VHTC 1DOIA 2OEDA 2ZEQA 3H6NA 1FFVA 3GE3C 4EOYA 2WXPA 2DAJA 3NZUA 1CMXB 2NBVB 2KDEB 4A6QA 1OQYA 1PYWD 1MHHE 2L52A 1I4HA 1JRPA 1WXQA 3ML8A 1IGDA 2MQJA 3IFWB 2GBMA 2M8SA 2WLBA 4IM3A 1L2NA 4BKTA 2KVRA 3NVYA 3CMMB 2RR9A 4DHJD 2VRRB 3R7RA 2MSED 3DHIC 1VD2A 4WJOA 3DVNV 1SE3A 3A1QA 4GN1A 2LFIA 2KKCA 4W9LA 4HPMB 5LXIB 4O1NA 4A3PA 1UGMA 3DDCB 4WURA 2J52A 1SBBB 2MWSB 2D2QA 4HRSA 5KHOA 1T0QC 2O2VB 4GMVA 2JRIB 4NAWA 3ABVB 3DQVA 4A90A 2LVPA 1TY0A 4KIKA 1B9RA 1F1HA 2ZJDA 4DXAB 2NPTA 1TTNA 1V80A 3RFZB 4PS7A 4YSYB 4XGAB 4WJPA 3B0AA 3QARA 3UIOB 3Q3JA 1NYRA 2EMTA 4ACFA 1JW9D 2INPE 2IY0B 2ACZB 1QOAA 3WA0A 5CHVC 3HVDA 1HA5A 3PZ7A 3FILA 2O2VA 3AEDB 4J6IA 1R4MI 3N3KB 2DZIA 4KZCA 1MI0A 4HKQA 1XXGA 5GXGB 4RNAA 2XBBC 4IWOA 2DYOA 4C4VB 1N6ZA 3B2FA 4YTMB 4EEWA 1T0RC 1ISNA 2C5LC 3B08A 2YLMA 2GBNA 3QIJA 1BT0A 1VJKA 2MCNB 1LQBA 2IZVB 3VRBB 1M94A 4C00A 3AE1B 1N62A 3TEXA 5J2RA 4FHJA 4JQWC 2VZKB 4S17A 1WY8A 1LGRA 4DHZB 5D3DA 5C2TB 1AW7A 3J9CA 1TGZB 3Q2AC 2FNJB 4N58A 1V1PA 2IO3B 1C1YB 3SR6A 2KDMA 2KWVB 2I2YA 4HKZE 2R2QA 2FUHB 2HTME 4GDKB 1K8RB 2WX1A 3M63B 5EE1A 3RUIB 2IO0B 3QJZA 4W9FA 3O65B 5E6JA 2AQ1B 2PE6B 3TBLD 1FRRA 2FIDA 3L54A 1WRIA 2K25A 3MHZA 5E6OA 1BXTA 3SHQA 1TBEA 3TEYA 2G4DB 3AECB 2XK5A 3BZDB 2MH7A 4C56C 3B1LX 4REZA 4ARCA 3RCZA 1HEZE 3W1SC 3A9JA 1T0YA 2V4IB 1SJHD 3ZDMC 3R7QA 2K8BA 2Z0EB 1WX9A 3CSTA 3V60A 4GDKA 4AJYB 2YEPB 3VXWA 2KACA 3AH7A 3IAM1 3HM6X 3DBHI 3RNEC 1T6BX 3N1XC 2OHFA 5BYRA 3SDLC 2K3UA 4D2KA 2KOXA 3BY4B 3HM3A 4W9HA 2G1EA 2WDQB 1C9FA 1IPGA 2N7JA 1ZKHA 4IW0A 1Z5SB 1E8XA 3AB5A 2DBYA 4RH6A 4RGNA 3BINA 1MG4A 5DPTA 4ZYSA 3AU5A 1HTOA 2QSDA 2H89B 4BKSA 4EZJA 3NY5A 1Y56A 3RULA 4RFBA 2E6XA 3PSEB 4AWJA 2JVCA 3TSSA 2GOWA 4IWPA 3V05A 3Q8AA 2MLBA 4LCDE 4G3XB 4KX6B 2BYTA 3AEFB 3VQIA 4HXDA 4ZRJA 1GPXA 3KLSX 2PJHA 3KVFB 1Y8RC 5AEKB 4KGSA 2J7QB 3PHWB 5FKAC 1XEEA 2D10A 3Q8CA 4TQ0A 4RCOA 2HE7A 1KFYB 2WP9B 3PPAA 2IY1B 1WMHB 3ZUNA 5EE9A 4L2YA 1JMLA 2LXAA 2NTTA 4MGYE 4WWPA 3A33B 1XT9B 4I6LB 3EHVA 2WXJA 1WR1A 4N9F4 5C23A 4BKGA 2LASA 1J19A 2OJRA 1C78A 2L76A 3IXSA 1RRBA 1NYQA 4AP4C 4YTNB 4DDGD 3FAHA 5LLIA 1GUAB 4PK1A 4YXDB 3PRMB 1I4RA 3L4PA 2CKHB 3Q6BA 3NZSA 1LXDA 3R66C 2V4LA 3P4SB 3UI3A 2LVOA 3W5UB 3T9LA 1FO4A 2LEKA 1L6VA 1GAQB 2KFKB 1XQQA 3NVZA 2MRPA 3C0RB 4JX1C 4TSSA 3BIID 4HCNB 3TMPB 4LDTD 4HCPB 1NI3A 4KKJA 2RPQA 4LK0M 4PYZA 4A8XC 3U2SC 2CHXA 2BB6A 3VAWA 4DDID 3P1MA 1UBIA 2KTRB 1J7AA 3P4QB 1MJDA 5HG2A 3T3OA 3AEAB 1PQSA 1V97A 1ESFA 1D3ZA 2MHJA 3C8YA 1KLUD 3PHXB 5G2NA 1J8CA 4GU2A 3EC8A 2R2OA 3Q69A 2CHZA 4CO7A 4OZAA 2BW2A 5CX3A 3PS6A 2BF8B 3EA6A 1IBXB 4K7WA 3JSVB 1OEYA 3A4SC 1E0ZA 3SFEB 4TUUA 2LI5A 4S0RA 2JPHA 3UGBB 3A9KB 1GJZA 3PREA 4WQOB 1TKGA 1QOBA 3V6EB 4G11A 1WGDA 2K6DB 3V3XA 1FXIA 1WZ3A 3UINB 1QOGA 3T8MA 1E8WA 2OOBB 4DHZE 3N1YC 5JH5C 2KNBA 3NJTA 2WXOA 1QF6A 1T3QA 2KDFB 2LGSA 3W1YA 2LJ5A 4Q2JA 1JCKB 3D32A 1YD8U 2JXXA 3AV8A 1WYGA 2VH2A 2VH1A 1P9DU 4FJVB 3V62A 2JT4B 4IKGA 4LNNA 4CHKA 3WALA 5D6JB 3DVGY 1EU3A 2NBUA 3UIPB 2BS4B 4WJNA 1YX6B 1FCCC 4GOCA 4AQ7A 2WQYB 1P98A 1F52A 2B3AA 4TKNA 3OJ4B 3TEZA 3WAOA 3H7SA 2W3RA 1HE8A 2A5UA 2AYOB 4KKIA 2N9XA 2G4SA 1PUTA 4FA6A 4MH0E 3AE6B 3NS1A 3MFGA 1WX7A 2BQQA 4LJOB 1V5OA 5IA7A 1WF9A 3CWIA 1WXVA 2GI9A 4HPPA 1JRUA 2SEBD 1P0RA 3RI7C 2V3PA 1VRAB 4W9GA 3NOBA 4C80A 1VZ6A 2AL3A 5E6NA 1K51A 3L10B 5BO4B 2BS3B 2N9PC 4JWUC 5FR6A 3AXCA 3W5VB 1VZ7A 1ACCA 1WGGA 3N9YC 4RGMA 1ZXHA 2PKOA 1NVID 1YJJA 3QQ8B 5L95C 5TR5A 1JWBD 3PO0A 1I4PA 1SGHA 2D5GA 4WQMA 2GBRA 1SF0A 2JU6X 3VUXA 3PVLA 2JF5A 4HWIB 2EELA 3VTUA 2ON8A 1JROA 1R4NB 3AE9B 2NVUI 1XO3A 4E71A 5AUKA 2I38A 1DYQA 3BK2A 2M4NA 1E8ZA 2JX5A 2MJEA 4TV3A 3VR9B 2RMMA 1WXSA 4WIPA 2ZCBA 1C3TA 1E8YA 2PVGC 3NVVA 4MACA 2DWQA 2KWCA 3LXFA 3GP7A 4B0MA 2KHWB 1XCQL 4LNFA 2WX0A 1EWYC 4MM3A 4AJWA 3VVWB 1N63A 1NI2A 1XD3B 3Q3NC 4PT5A 3ZQ4A 3GOEA 2W54A 4FHKA 1G6JA 2DAFA 4OHJA 4P1CC 1C79A 1FMAD 4ZYNA 4I6NB 2L3ZA 2KJ6A 3MTNB 4BBNF 3B9JA 1KTKA 2CJNA 3DBRI 1I4GA 3VUYA 1ZXIA 1TZOA 3AEGB 2DZJA 1SB3C 2DYMA 2XN9C 5AZGA 3RN9C 4M02A 4P1BC 1UWXA 4K81A 2Y5PA 5G55A 3U8ZA 1P7EA 1KF6B 2C60A 2RSUA 1YOVB 4WJQA 4BBNC 1V49A 2N4FA 4HJGE 1JWAD 1ZOYB 1MVKA 4TMAB 1AWDA 3WCQA 3E56A 1QKZA 1L0XB 1Q0WB 4PS8A 4DQOC 2WXRA 2NR2A 4CQNA 5J17A 1VZ8A 4LNKA 2KC1A 2N9KA 4L23A 4GDLB 3VTWA 2W55A 2ZW1A 4B6WA 3KUZA 3SD5A 5D3IB 2KTFA 1UH6A 2ZCCA 2SAKA 4US9A 2BWES 4QAYA 3UQBA 4ICUA 3ETRA 3APFA 3EFUA 4GLSC 3PLUA 3ZJVA 3UF8A 5HI1A 2WHIA 1UELA 2CR5A 1YQBA 3L08A 1FIQA 2PE9A 2D3CA 5BMHA 3AU4A 2XNAC 2VZKD 3MC9A 4LJPB 4OVUA 2V3SA 5FK9C 2UU7A 3NVWA 4GDLA 2A4ZA 2BGFA 1GG3A 2K0PA 1F2RI 4JL9A 5G5GA 4EZLA 5JZEB 4USAA 2PTLA 1EO6A 3Q3MC 4ZDVA 4OVZA 1QLBB 1BUIC 4RGTA 2BKFA 2KQSA 1RFKA 1TY2A 4YTPB 1YN3A 1SIFA 3EGRA 2GBJA 1J0GA 3ZTDA 3LYYA 2BYVE 4EZKA 3IBEA 2N1WA 2RDBC 3PRZA 2LD9A 4C7YA 2FIFA 4C4VA 1RLFA 3PGEA 4HPLB 1XLNA 4ICVA 2MBQA 3M3JA 4MJSB 3DBLI 2MJ3A 3KQ4A 3KWVA 2PMVA 1E7PB 2KYWA 1ENFA 3KW5B 2C9WB 1D5XC 4M8NA 1WRDB 1S3SG 2KMCA 5C3JB 5GMVA 3NRZA 3PT2B 1WGHA 4BKSD 1UUPA 2KX3A 3LJ3A 1NENB 3ZO5B 2BYFA 1X1MA 3JW0X 4IOIE 3RYTA 3TUOA 4MDKE 2O6VB 4IWQA 1LO5D 2AX5A 3ZJTA 4EE2A 3KWLA 4XWTA 2NCNA 1S1QB 3AE7B 4ASWC 1P7FA 3Q3OC 2M0XA 2WXHA 2KWDA 4II2B 2MBHA 2JYTA 1E7VA 5DCNA 3VTVA 2LHEA 4AOFA 2N7DA 1EM7A 3ZXVA 5AUIA 4P7IA 4ZOHC 4UDUC 2LJIA 2INCC 1N5XA 3QK0A 4W9IA 4BZAA 1R4NI 2K22A 4IM0A 1Q5WB 2IGDA 2UWQA 4MSQB 1UGJA 1HQRD 3GB1A 1KLVA 1ROEA 3GZNB 1D5ZC 1FRDA 4R3DA 1WXAA 3U52E 2M17A 4RGOS 4ZRPA 4B9KA 4RM9A 1ZGUB 2Y5CA 1PDXA 3L16A 4KV2A 4XZ4A 3IG3A 1FPYA 3KYCD 3VR8B 3WAMA 4W9CA 2N0SB 3RZFA 2LGYA 1MFWA 5AZHA 2RDHA 2IJ0A 2LUMA 2QC8A 1RAXA 1D6EC 2DZKA 4MGZE 3DWGC 1C77A 1VR9A 2FCQA 4F7ZA 4MEMA 1QQRA 3JVZX 3Q3FA 4EFOA 1TKEA 4JE3B 1FCLA 1FD6A 1XLOA 4W9KA 1ET9A 3VUWA 4ANXA 4OZCA 2X8XX 1OTRB 2KANA 2WNMA 4DWFA 4BOSC 1ZDXA 4WAFA 5I4DA 1JALA 1L6UA 2L8JA 3VH4B 4FXCA 3ML9A 1LM8B 1MHXA 2HTHA 5EDSA 2WXNA 3TL5A 2QIEB 1F0ZA 4HROA 1NBFC 1Q1OA 1WWTA 2MBOA 1V86A 5JHAA 2QCZA 3U7DA 2DX5B 1WMHA 2MBBB 2WXQA 4WWOA 3ZJUA 2WDTB 2AWTA 2INNE 4XX5A 5J18A 2BS2B 4ARIA 2M19A 3NG0A 1YJIA 5H92C 4E74A 4XWWA 2LXCA 1ZP0B 2KDIA 4W9DA 4XE0A 2DENB 3U7ZA 3APDA 2DNFA 1YQ3B 3VH3B 4MH8A 2J4XA 3BVZA 1FFUA 2JWUA 4LNOA 2FAZA 3HUIA 4J3OD 4BVUC 3N20C 3S2AA 2WXIA 3M62B 4P16A 3TEWA 2PW9A 1P3QU 2KFKA 4XDCA 4MSMB 3OLMD 2X38A 1V2YA 1TKYA 1MG8A 4ZRIA 3DVGX 4ANWA 1YX5B 1T5XD 3B2GA 2GLSA 2MP2B 3AE4B 2K39A 5JXVA 2UYZB 2ZPYA 4ZRKA 1GNUA 1WFYA 1QILA 2DLBA 4FN2A 1WJ6A 3RNFC 4RF0A 2ZVNA 1RWSA 3HK0A 2BB5A 2KTRA 2QILA 2WYQA 1ZDVA 3C19A 4HLEA 3RNGC 1C4PA 5H8YE 1AARA 2BTEA 1CQVA 3DWMA 2MA9B 3ZVVA 4EUTA 4K3CA 3MP9A 1CZPA 2BYEA 2KVZA 1OQQA 3I3TB 2MP2A 3MJ5A 1JWUD 1IBXA 1FXAA 1YJ1A 3ZGZA 3JSVA 4CYEA 2KZRA 2JZPA 1SXTA 3ZW3A 1B1ZA 3ONSA 3AI5A 3A9KA 1I4XA 3H7PB 2C7HA 5IKCM 5IO9A 5T8IA 2ZPNA 2L0FA 1I4QA 2FCMA 1WGKA 2V9HA 4WWMA 2ZNVC 1WJNA 1F9JA 4LLGM 4OW0A 4P6VF 5LXHA 1I42A 3NHEB 1WGRA 3KUDB 3O13A 4K7SA 4MGKE 1KH0A 1XF5L 1UD7A 4A9AA 4DXFA 4M0WB 1N60A 3TCAA 1WYWB 2INDC 2IBIB 4HK2A 2K8CA 5HFYA 3QC8B 2RDGA 3ZTCA 4GSWA 3EECA 1EF5A 1C76A 1F2RC 4B0EA 3P4PB 1AYFA 2ONQA 3MJWA 3AEEB 3ECIA 3BYTB 1CK1A 4NAMA 3I63C 3TIXA 4WWNA 3BYYB 2PPHA 1ZE3D 1D5MC 1NDDA 3DBHB 1SEBD 4G50A 4ANVA 2QDFA 4KVGB 4X57B 1K50A 1HZ6A 2J42A 4HDOA 2JZ3B 3K9PB 4MT5A 1XLPA 4W9EA 3GS2A 2KLCA 2D3GA 4IUMB 5G5HA 2H88B 2IO2B 3PZ8A 3R2IA 1KJTA 3A4RA 1GB4A 1WSPA 2L83A 2WXLA 5DPWA 3HIZA 3T3NA 2LVQA 1DOYA 3BK1A 3A1QB 4NJ7A 4RM8A 3U4EG 4HEA1 1E9MA 2I1KA 1TS5A 3GE8C 4ZHPA 4BOZB 5IP4D 4G0NB 2N9LA 1E90A 1OEYJ 2Z59B 4BAXA 2HJ1A 2CU1A 2LMCA 5D7GA 2WU5B 5CHWA 4JIOU 2DYBA 1OFFA 2MW5A 3QAQA 4NZLB 2W3SA 4NQLB 4NAWB 2DZMA 2V3NA 3N32A 2D11A 1I35A 2NBWB 2JRHA 4FJZA 2YVCA 3MHSD 2M56B 4JLCA 3QCAA 4KIKB 1FNWA 4KDLB 3MC8A 2KLGA 2KQ7A 3EUB2 1ZUD2 1SE9A 2NPTB 2NS5A 4HVBA 3CSFA 1RYJA 1UF0A 2FCNA 4N6EB 3RD2A 4DHJB 3AM9A 4IM2A 1L0YB 3RNCC 4W9JA 5TSSA 4JWSC 2E3TA 2G45B 1A70A 1IYFA 3WIMA 1EU4A 4GGQA 1SE2A 3DBSA 2EMSA 1E6EB 2G3QB 2NTSA 1QZEA 4YSXB 3FILB 1TS4A 3SFDB 3N1ZC 1WR6E 3ENEA 2XEWA 2CJOA 3Q8FA 3AEBB 1BMLC 2V1YA 1HTQA 2KK8A 1YMHE 1WM3A 2RPVA 1YIWA 2OJWA 5IOIA 5C1ZA 2J0MA 3AMZA 2R61A 4ZHOA 3WAPA 1JWSD 1RFAA 3JYUA 2LUEA 2KC2A 2JSVX 2JWZA 4XC2A 4DXGA 2WWZA 1WE7A 2PIAA 1J7BA 2KX0A 4NJ6A 5DPRA 4IC7B 4M8MA 2DHZA 1E5WA 3BWUD 5D94A 2WDRB 2AQ2B 3MC0B 2REXA 1FM0D 1V1PB 2BVCA 1DOXA 2B76B 3AE8B 1TIFA 2AL6A 3NZ3A 1VCBA 3RT3B 1U4AA 5AZFA 3NS8A 1UNSA 3HVZA 1FNUA 2HD5B 1XLQA 2KAJA 2KO3A 4E3CA 2Y3AA 3ZNHB 1ZW7A 2JYEA 2K9XA 1TJEA 2L1AA 2XK5B 3CIRB 2PLPA 2QEJC 2EKEC 4RF1A 2JY6A 1IUEA 2KJHB 4K7UA 3W9CB 3I9V1 1C4CA 3DHHC 3A9JB 2KN4A 1E7UA 3K9OB 4KGRA 4KSKC 1PGBA 2WXGA 1YQ4B 3W1SA 3X0WA 2QHOA 2JXTA 3FKYA 3AE2B 3U30A 3KUCB 2BBCA 1UZXB 3ZRFA 4LTUA 2PEAA 3E9SA 2O6VD 1L7YA 4JGHB 1P1AA 2J53A 3Q8BA 5LNK1 1KRHA 2W9NA 1JQ4A 2J0JA 2WS3B 3Q8EA 4KSLC 4TQ1A 4L1BA 5DPSA 4GB9A 1V5TA 1SE4A 4GXBA 3PV1A 3PZDA 2KDBA 1WJ4A 4PS3A 3URYA 5MPOA 4YWGG 2LRUA 4MJSA 4MGIE 3DPDA 1WM2A 4M00A 3ZXRA 2K6QA 5CTRC 1KLGD 3ZDTA 2WDVB 2KJRA 1HZ5A 4B95A 4URKA 3RZWC 4HDQA 4DBGA 1GC6A 1E10A 3OG5A 4I6PA 2I1JA 3H8HA 1UWMA 4H2AA 4FJYA 1TS2A 3V61A 2O6VA 3QWZB 1EWCA 3BVMA 3QA8A 4AS1A 2WXKA 1L5PA 2CU3A 4C7ZA 1RM6C 2YEPF 2V0GA 2IGGA 2IDYA 3TJPA 4FULA 3SU8X 4A55A 2FUG1 1V8CA 1GB1A 3P42A 5FR3A 1L4ZB 2NMQA 2K1FA 4N59A 3HHMA 3RNAC 1L0VB 1WGYA 4K3BA 2G9HD 3R8BA 4KGTA 1WE6A 3IT6B 4NQKE 5CHFA 2MEKA 3EFCA 4II3B 2LGIA 2L7RA 3ZIMA 1PGXA 4EKUA 3HRDD 2LZ6A 3W2DA 2N7EA 1TYGB 4FLHA 2L0TA 1YN5A 1H8CA 4ITKA 2GRIA 2N1VA 2PVOD 1WX8A 2KT7A 5IN7A 1FXTB 1YN4A 4WH4A 2JQRB 3KYDD 1LFDA 1CJEA 1HXYD 1D4BA 3I57A 1PFDA 3LB8C 4XYCA 3CF6E 2BKRB 3L13A 3ZRCA 2Y5BB 4MELA 1FEHA 1NEKB 2L05A 2WXMA 4US8A 4F1SA 4A20A 4GIVA 1PGAA 3H1UA 3P63A 1VDVA 2ZVOA 3OWEB 3QX1A 5BYSA 3IVFA 3IAS1 3DBRB 1C4AA 2C7MB 1JWMD 3ZKJC 2GB1A 1QOFA 3X23A 1VLBA 2BPSA 3OAWA 1KOTA 2M1MA 1XCTL 2CS4A 1QT9A 1T0SC 5EE3A 1EUVB 1WH3A 2J0KA 1OGWA 1UBQA 4LDTB 3UQAA 1IGCA 1M4VA 2RGFA 4BFRA 3WANA 2D3AA 3ALBA 1EF1A 4LNIA 3SEBA 2ASQA 2Q5WD 4NPNA 3NUHB 3PRPB 1GC7A 1N5WA 2GMIC 1KM7A 2IYDB 1WZ0A 2LHDA 1SSNA 3IT4B 5KHQA 5BMGA 2K8HA 2D07B 2KXJA 5HHDG 2ZNVB 3M95A 3ZNID 2IPKD 1A5RA 1V9JA 2Z0DB 2C7NB 3VDZA 4NJCA 2JZZA 1K52A 2MBEA 2FE8A 1R4MB 2AQ3B 1H4RA 2L32A 4OZBA 2MX2A 3FC4A 2KWUB 2KMMA 4ANUA 1Q10A 3ZYYX 3ZNGC 5BYQA 4JPSA 2IGHA 2LGXA 3LDZE 5JHBA 3RMKC 2KD0A 1OQRA 1N61A 4YSZB 3N30A 1MPEA 1ZPSA 3P4RB 2HDEA 4M01A 3RNBC 2BT6A 2L00B 2IO1B 5L83A 3AN1A 1J7CA 3V6CB 2N9EB 5D2MB 3RPFC 3APCA 4IG7B 2WXFA 2BWFA 1V1OA 2M0AA 1FNVA 4ZRQA 2ICIA 4YL8A 1V81A 1DGJA 2GBKA 2LWPA 4KZ0A 3DHGC 3KH0A 3H9DA 1TT5B 3PTFC 4AUQC 3DBLB 2KQ4X 2MJDA 3P2BA 5E6PA 5EE0A 4F8CB 1AN8A 2WU2B 3OJ3A 1WJUA 4YT0B 4A3OA 3AULA 4PYUA 1SIJA 1WIAA 3AE3B 4IDIA 4RMAA 3DOWA 3R2TA 4K1RB 1IP9A 1K53A 2TSSA 1STEA 3IHPC 2HJ8A 5IAAC 2AEHA 3H7PA 2RD0A 2W82A 3L17A 3QHTA 1GOZA 4DK5A 5BMIA 1TS3A 2LRWA 2CHWA 1F77A 1WI0A 3GZNI 4XDDA 4OVVA 1TZ1A 1WXMA 4HJKA 4NNJB 1R7SA 1V6EA 3BVGA 2KFJA 5HKHA 3DVNU 2QJLA 4KDIC 1L4DB
chains in the Genus database with same CATH topology
1R4NI 1RFAA 2ZZPB 3JYUA 4IM0A 1PQSA 4FADA 1Q5WB 2LUEA 2KC2A 2JWZA 1D3ZA 4XC2A 5G2NA 1Z2MA 2UWQA 3PHXB 4MSQB 4NY0A 1J8CA 2WWZA 1WE7A 3EC8A 4GU2A 1KLVA 2KX0A 2KN5A 4NJ6A 2KMAA 5DPRA 2R2OA 3R3MA 4IC7B 4M8MA 2DHZA 1E5WA 2CHZA 2JUOA 1WXAA 5D94A 3L0WB 4CO7A 2M17A 3DCGA 4B9KA 4RM9A 3PLVA 2FCSA 4WAAA 1ZGUB 2REXA 5CX3A 3L16A 3PS6A 2BF8B 4KV2A 4FBJB 3ZNZB 3VFKA 4K7WA 4XZ4A 2LGDA 3ZLZA 3VHTC 3IG3A 3JSVB 3KYCD 1OEYA 3A4SC 3WAMA 4W9CA 3RZFA 2ZEQA 3H6NA 2AL6A 2LGYA 1VCBA 3RT3B 1U4AA 4EOYA 4TUUA 5AZFA 2DAJA 2LI5A 3NS8A 2JPHA 3NZUA 5AZHA 3UGBB 3A9KB 1CMXB 1GJZA 2NBVB 2KDEB 3PREA 1RAXA 4WQOB 2DZKA 4MGZE 2HD5B 1OQYA 2KO3A 4E3CA 3V6EB 2FCQA 3ZNHB 1ZW7A 4G11A 1WGDA 4F7ZA 2K6DB 4MEMA 1WZ3A 3UINB 3T8MA 2XK5B 1E8WA 3ML8A 3JVZX 3Q3FA 2MQJA 4EFOA 2OOBB 4DHZE 2EKEC 5JH5C 2KNBA 3IFWB 2GBMA 2JY6A 2M8SA 4IM3A 4W9KA 1L2NA 2KJHB 4BKTA 2KDFB 2KVRA 3VUWA 4K7UA 3W1YA 4ANXA 3CMMB 2RR9A 1OTRB 2KANA 3A9JB 2LJ5A 4DWFA 4BOSC 3D32A 4DHJD 1E7UA 3K9OB 2VRRB 1YD8U 4KSKC 3R7RA 2JXXA 3W1SA 3X0WA 2MSED 2QHOA 2L8JA 1P9DU 3VH4B 1VD2A 3KUCB 3ML9A 4FJVB 1LM8B 4WJOA 3DVNV 3U30A 3V62A 2HTHA 2JT4B 1UZXB 3ZRFA 5EDSA 3TL5A 2PEAA 3A1QA 4GN1A 2O6VD 1L7YA 4JGHB 4CHKA 3WALA 5D6JB 1P1AA 3DVGY 2KKCA 1NBFC 2NBUA 1Q1OA 4W9LA 3UIPB 2MBOA 4HPMB 4WJNA 2W9NA 5LXIB 2J0JA 1V86A 1YX6B 4KSLC 4TQ1A 5DPSA 4GOCA 4GB9A 1V5TA 4A3PA 1UGMA 3U7DA 2DX5B 5JHAA 1WMHA 1P98A 3DDCB 2B3AA 4GXBA 4TKNA 3OJ4B 2MBBB 3PV1A 2MWSB 4WWOA 3PZDA 2WDTB 3WAOA 2AWTA 2D2QA 2KDBA 1WJ4A 3H7SA 4PS3A 5KHOA 4XX5A 5J18A 1HE8A 2A5UA 2AYOB 2N9XA 2G4SA 4E74A 2LRUA 2LXCA 2O2VB 4GMVA 2JRIB 4FA6A 4MJSA 4MGIE 4NAWA 3DPDA 4MH0E 1WM2A 2KDIA 3DQVA 4W9DA 2DENB 1WX7A 3APDA 2LVPA 4LJOB 3VH3B 2K6QA 4KIKA 1V5OA 5CTRC 5IA7A 1WF9A 2ZJDA 4DXAB 1WXVA 2NPTA 1TTNA 1JRUA 1V80A 3ZDTA 1P0RA 2FAZA 4BVUC 4PS7A 2KJRA 4W9GA 3NOBA 4B95A 4URKA 3RZWC 4HDQA 2AL3A 4WJPA 5E6NA 4DBGA 3B0AA 3L10B 5BO4B 3S2AA 1GC6A 2N9PC 3QARA 3UIOB 3Q3JA 4I6PA 5FR6A 3M62B 3AXCA 2I1JA 1WGGA 4FJYA 2EMTA 1P3QU 2KFKA 3QQ8B 3V61A 2IY0B 5L95C 3WA0A 5TR5A 2O6VA 5CHVC 3QWZB 4MSMB 3OLMD 1SGHA 3QA8A 2GBRA 1V2YA 1MG8A 2O2VA 4ZRIA 3DVGX 3VUXA 4ANWA 1YX5B 3PVLA 4J6IA 1R4MI 2JF5A 3N3KB 2MP2B 2DZIA 4KZCA 4HWIB 2K39A 3VTUA 2UYZB 2NVUI 2ZPYA 4ZRKA 1GNUA 4E71A 1WFYA 3TJPA 2XBBC 4FULA 4IWOA 4FN2A 3SU8X 2DYOA 1WJ6A 2M4NA 1E8ZA 2ZVNA 2K1FA 4TV3A 3HK0A 3HHMA 1WXSA 2ZCBA 1C3TA 2KTRA 1E8YA 2C5LC 1ISNA 3B08A 4EEWA 2YLMA 2GBNA 3QIJA 1BT0A 1WGYA 2WYQA 4HLEA 2MCNB 1LQBA 2IZVB 1WE6A 1AARA 1M94A 2KWCA 4NQKE 5CHFA 5J2RA 4FHJA 4II3B 2L7RA 4JQWC 1WY8A 2MA9B 3ZIMA 3ZVVA 2KHWB 4EUTA 4DHZB 4EKUA 2BYEA 2LZ6A 2WX0A 4MM3A 2N7EA 3I3TB 1TGZB 4AJWA 2FNJB 2MP2A 4FLHA 2L0TA 3VVWB 2IO3B 1C1YB 1YJ1A 1H8CA 1NI2A 1XD3B 3JSVA 2KWVB 3GOEA 4FHKA 1G6JA 2DAFA 2N1VA 4CYEA 2KZRA 2R2QA 2FUHB 1WX8A 3ZW3A 4GDKB 1K8RB 2WX1A 3M63B 3ONSA 3AI5A 3RUIB 2IO0B 3A9KA 3QJZA 3O65B 4W9FA 4ZYNA 2PE6B 4I6NB 3TBLD 3H7PB 2L3ZA 2C7HA 1FXTB 2FIDA 3L54A 2ZPNA 2L0FA 2FCMA 2K25A 5E6OA 2KJ6A 3MTNB 4BBNF 3SHQA 3KYDD 1LFDA 1TBEA 2ZNVC 1WJNA 1F9JA 2G4DB 2XK5A 3DBRI 3VUYA 3CF6E 2BKRB 5LXHA 1I42A 3NHEB 3L13A 1WGRA 2DZJA 3B1LX 3KUDB 4K7SA 4MGKE 3ZRCA 1UD7A 2DYMA 2Y5BB 4MELA 3RCZA 2L05A 3W1SC 5AZGA 4A20A 4F1SA 4GIVA 3A9JA 4M0WB 3TCAA 3H1UA 1T0YA 1WYWB 4K81A 5G55A 2ZVOA 3U8ZA 2IBIB 3QX1A 4HK2A 2C60A 4WJQA 2RSUA 4BBNC 3ZDMC 3IVFA 2K8CA 3R7QA 1V49A 2K8BA 2N4FA 2Z0EB 3QC8B 1WX9A 3CSTA 3V60A 2C7MB 3ZTCA 4GDKA 4AJYB 3VXWA 3ZKJC 3HM6X 3X23A 2BPSA 4GSWA 3OAWA 3DBHI 3EECA 1EF5A 1Q0WB 1KOTA 4PS8A 2M1MA 2NR2A 5J17A 2CS4A 2KC1A 3SDLC 3MJWA 4GDLB 1EUVB 3ECIA 3VTWA 1WH3A 2KOXA 3BY4B 2J0KA 3HM3A 1OGWA 1UBQA 4LDTB 3UQAA 4B6WA 3KUZA 2RGFA 3SD5A 4BFRA 3WANA 2KTFA 4W9HA 3TIXA 4WWNA 1UH6A 2ZCCA 3ALBA 1EF1A 1IPGA 2PPHA 1ZKHA 4IW0A 1Z5SB 2BWES 3UQBA 1E8XA 4ICUA 2ASQA 3APFA 1NDDA 3EFUA 4NPNA 3BINA 3PRPB 5DPTA 1GC7A 3AU5A 4G50A 4ANVA 3PLUA 2GMIC 1KM7A 2IYDB 1WZ0A 4KVGB 4X57B 3UF8A 4BKSA 4EZJA 1UELA 2CR5A 3NY5A 1YQBA 5KHQA 3RULA 2K8HA 3L08A 2JZ3B 3K9PB 4HDOA 2D07B 3PSEB 4AWJA 2KXJA 2ZNVB 3M95A 2PE9A 4W9EA 3ZNID 1V9JA 1A5RA 2Z0DB 2JVCA 2C7NB 3VDZA 2GOWA 4IWPA 2KLCA 2D3GA 2JZZA 3AU4A 4IUMB 2IO2B 2MBEA 4LJPB 2MLBA 4OVUA 2V3SA 4LCDE 1H4RA 4G3XB 4GDLA 2BGFA 2A4ZA 2MX2A 1KJTA 3A4RA 2KWUB 1GG3A 4HXDA 3VQIA 4ZRJA 4JL9A 4ANUA 3ZNGC 2PJHA 3KVFB 3HIZA 1Y8RC 4EZLA 5AEKB 5JZEB 5DPWA 2J7QB 2LVQA 3PHWB 1EO6A 4ZDVA 2D10A 3A1QB 4NJ7A 2LGXA 3LDZE 4RM8A 5JHBA 2BKFA 4TQ0A 2KD0A 2KQSA 2I1KA 4BOZB 4G0NB 2HE7A 1SIFA 1E90A 1OEYJ 2Z59B 3PPAA 2IY1B 3N30A 2GBJA 1WMHB 1J0GA 3ZTDA 3ZUNA 2CU1A 2BYVE 5D7GA 4EZKA 2LXAA 5CHWA 3IBEA 4MGYE 2N1WA 3PRZA 4JIOU 2L00B 3A33B 4WWPA 2DYBA 2IO1B 2LD9A 5L83A 1XT9B 2FIFA 1RLFA 3PGEA 3EHVA 4HPLB 4I6LB 4N9F4 1WR1A 2MW5A 5C23A 3QAQA 4ICVA 3V6CB 2MBQA 3M3JA 2N9EB 4MJSB 3DBLI 4NAWB 4NQLB 5D2MB 2DZMA 3N32A 4BKGA 3APCA 2LASA 1J19A 2D11A 2OJRA 1I35A 2NBWB 2JRHA 4FJZA 2YVCA 4IG7B 3MHSD 3QCAA 2L76A 4JLCA 4KIKB 2BWFA 1RRBA 4KDLB 4AP4C 2C9WB 2KLGA 2KQ7A 3KW5B 4DDGD 1SE9A 2NPTB 2NS5A 4YL8A 4M8NA 1V81A 4HVBA 5LLIA 3CSFA 1GUAB 1S3SG 1WRDB 2KMCA 2GBKA 2LWPA 4KZ0A 3PRMB 2FCNA 5GMVA 3RD2A 4DHJB 3PT2B 1WGHA 3KH0A 4IM2A 2CKHB 3H9DA 4W9JA 4BKSD 3NZSA 1LXDA 2KX3A 2V4LA 3R66C 2LVOA 3PTFC 3T9LA 3LJ3A 3ZO5B 4AUQC 2BYFA 2G45B 3P2BA 1IYFA 1X1MA 5E6PA 3JW0X 3WIMA 4F8CB 2KFKB 3OJ3A 1XQQA 1WJUA 3RYTA 4A3OA 2MRPA 4MDKE 2O6VB 4IWQA 3AULA 4PYUA 3C0RB 4GGQA 3DBSA 1WIAA 2EMSA 2G3QB 1QZEA 4RMAA 3DOWA 4HCNB 3TMPB 4K1RB 2NCNA 1S1QB 1IP9A 4ASWC 3IHPC 4LDTD 2HJ8A 5IAAC 2AEHA 1WR6E 2M0XA 3ENEA 3H7PA 2RD0A 2XEWA 4HCPB 2RPQA 4II2B 2MBHA 3L17A 3QHTA 4DK5A 2V1YA 1E7VA 5DCNA 4PYZA 3VTVA 4AOFA 2N7DA 2LRWA 2CHWA 2KK8A 4P7IA 2CHXA 1WM3A 1WI0A 3GZNI 4OVVA 1TZ1A 1WXMA 4HJKA 4NNJB 1YIWA 3VAWA 1V6EA 4DDID 2KFJA 5HKHA 3DVNU 1UBIA 3QK0A 4W9IA 5C1ZA 2KTRB 4KDIC 2J0MA 3WAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4N I;  1RFA A;  2ZZP B;  3JYU A;  4IM0 A;  1PQS A;  4FAD A;  1Q5W B;  2LUE A;  2KC2 A;  2JWZ A;  1D3Z A;  4XC2 A;  5G2N A;  1Z2M A;  2UWQ A;  3PHX B;  4MSQ B;  4NY0 A;  1J8C A;  2WWZ A;  1WE7 A;  3EC8 A;  4GU2 A;  1KLV A;  2KX0 A;  2KN5 A;  4NJ6 A;  2KMA A;  5DPR A;  2R2O A;  3R3M A;  4IC7 B;  4M8M A;  2DHZ A;  1E5W A;  2CHZ A;  2JUO A;  1WXA A;  5D94 A;  3L0W B;  4CO7 A;  2M17 A;  3DCG A;  4B9K A;  4RM9 A;  3PLV A;  2FCS A;  4WAA A;  1ZGU B;  2REX A;  5CX3 A;  3L16 A;  3PS6 A;  2BF8 B;  4KV2 A;  4FBJ B;  3ZNZ B;  3VFK A;  4K7W A;  4XZ4 A;  2LGD A;  3ZLZ A;  3VHT C;  3IG3 A;  3JSV B;  3KYC D;  1OEY A;  3A4S C;  3WAM A;  4W9C A;  3RZF A;  2ZEQ A;  3H6N A;  2AL6 A;  2LGY A;  1VCB A;  3RT3 B;  1U4A A;  4EOY A;  4TUU A;  5AZF A;  2DAJ A;  2LI5 A;  3NS8 A;  2JPH A;  3NZU A;  5AZH A;  3UGB B;  3A9K B;  1CMX B;  1GJZ A;  2NBV B;  2KDE B;  3PRE A;  1RAX A;  4WQO B;  2DZK A;  4MGZ E;  2HD5 B;  1OQY A;  2KO3 A;  4E3C A;  3V6E B;  2FCQ A;  3ZNH B;  1ZW7 A;  4G11 A;  1WGD A;  4F7Z A;  2K6D B;  4MEM A;  1WZ3 A;  3UIN B;  3T8M A;  2XK5 B;  1E8W A;  3ML8 A;  3JVZ X;  3Q3F A;  2MQJ A;  4EFO A;  2OOB B;  4DHZ E;  2EKE C;  5JH5 C;  2KNB A;  3IFW B;  2GBM A;  2JY6 A;  2M8S A;  4IM3 A;  4W9K A;  1L2N A;  2KJH B;  4BKT A;  2KDF B;  2KVR A;  3VUW A;  4K7U A;  3W1Y A;  4ANX A;  3CMM B;  2RR9 A;  1OTR B;  2KAN A;  3A9J B;  2LJ5 A;  4DWF A;  4BOS C;  3D32 A;  4DHJ D;  1E7U A;  3K9O B;  2VRR B;  1YD8 U;  4KSK C;  3R7R A;  2JXX A;  3W1S A;  3X0W A;  2MSE D;  2QHO A;  2L8J A;  1P9D U;  3VH4 B;  1VD2 A;  3KUC B;  3ML9 A;  4FJV B;  1LM8 B;  4WJO A;  3DVN V;  3U30 A;  3V62 A;  2HTH A;  2JT4 B;  1UZX B;  3ZRF A;  5EDS A;  3TL5 A;  2PEA A;  3A1Q A;  4GN1 A;  2O6V D;  1L7Y A;  4JGH B;  4CHK A;  3WAL A;  5D6J B;  1P1A A;  3DVG Y;  2KKC A;  1NBF C;  2NBU A;  1Q1O A;  4W9L A;  3UIP B;  2MBO A;  4HPM B;  4WJN A;  2W9N A;  5LXI B;  2J0J A;  1V86 A;  1YX6 B;  4KSL C;  4TQ1 A;  5DPS A;  4GOC A;  4GB9 A;  1V5T A;  4A3P A;  1UGM A;  3U7D A;  2DX5 B;  5JHA A;  1WMH A;  1P98 A;  3DDC B;  2B3A A;  4GXB A;  4TKN A;  3OJ4 B;  2MBB B;  3PV1 A;  2MWS B;  4WWO A;  3PZD A;  2WDT B;  3WAO A;  2AWT A;  2D2Q A;  2KDB A;  1WJ4 A;  3H7S A;  4PS3 A;  5KHO A;  4XX5 A;  5J18 A;  1HE8 A;  2A5U A;  2AYO B;  2N9X A;  2G4S A;  4E74 A;  2LRU A;  2LXC A;  2O2V B;  4GMV A;  2JRI B;  4FA6 A;  4MJS A;  4MGI E;  4NAW A;  3DPD A;  4MH0 E;  1WM2 A;  2KDI A;  3DQV A;  4W9D A;  2DEN B;  1WX7 A;  3APD A;  2LVP A;  4LJO B;  3VH3 B;  2K6Q A;  4KIK A;  1V5O A;  5CTR C;  5IA7 A;  1WF9 A;  2ZJD A;  4DXA B;  1WXV A;  2NPT A;  1TTN A;  1JRU A;  1V80 A;  3ZDT A;  1P0R A;  2FAZ A;  4BVU C;  4PS7 A;  2KJR A;  4W9G A;  3NOB A;  4B95 A;  4URK A;  3RZW C;  4HDQ A;  2AL3 A;  4WJP A;  5E6N A;  4DBG A;  3B0A A;  3L10 B;  5BO4 B;  3S2A A;  1GC6 A;  2N9P C;  3QAR A;  3UIO B;  3Q3J A;  4I6P A;  5FR6 A;  3M62 B;  3AXC A;  2I1J A;  1WGG A;  4FJY A;  2EMT A;  1P3Q U;  2KFK A;  3QQ8 B;  3V61 A;  2IY0 B;  5L95 C;  3WA0 A;  5TR5 A;  2O6V A;  5CHV C;  3QWZ B;  4MSM B;  3OLM D;  1SGH A;  3QA8 A;  2GBR A;  1V2Y A;  1MG8 A;  2O2V A;  4ZRI A;  3DVG X;  3VUX A;  4ANW A;  1YX5 B;  3PVL A;  4J6I A;  1R4M I;  2JF5 A;  3N3K B;  2MP2 B;  2DZI A;  4KZC A;  4HWI B;  2K39 A;  3VTU A;  2UYZ B;  2NVU I;  2ZPY A;  4ZRK A;  1GNU A;  4E71 A;  1WFY A;  3TJP A;  2XBB C;  4FUL A;  4IWO A;  4FN2 A;  3SU8 X;  2DYO A;  1WJ6 A;  2M4N A;  1E8Z A;  2ZVN A;  2K1F A;  4TV3 A;  3HK0 A;  3HHM A;  1WXS A;  2ZCB A;  1C3T A;  2KTR A;  1E8Y A;  2C5L C;  1ISN A;  3B08 A;  4EEW A;  2YLM A;  2GBN A;  3QIJ A;  1BT0 A;  1WGY A;  2WYQ A;  4HLE A;  2MCN B;  1LQB A;  2IZV B;  1WE6 A;  1AAR A;  1M94 A;  2KWC A;  4NQK E;  5CHF A;  5J2R A;  4FHJ A;  4II3 B;  2L7R A;  4JQW C;  1WY8 A;  2MA9 B;  3ZIM A;  3ZVV A;  2KHW B;  4EUT A;  4DHZ B;  4EKU A;  2BYE A;  2LZ6 A;  2WX0 A;  4MM3 A;  2N7E A;  3I3T B;  1TGZ B;  4AJW A;  2FNJ B;  2MP2 A;  4FLH A;  2L0T A;  3VVW B;  2IO3 B;  1C1Y B;  1YJ1 A;  1H8C A;  1NI2 A;  1XD3 B;  3JSV A;  2KWV B;  3GOE A;  4FHK A;  1G6J A;  2DAF A;  2N1V A;  4CYE A;  2KZR A;  2R2Q A;  2FUH B;  1WX8 A;  3ZW3 A;  4GDK B;  1K8R B;  2WX1 A;  3M63 B;  3ONS A;  3AI5 A;  3RUI B;  2IO0 B;  3A9K A;  3QJZ A;  3O65 B;  4W9F A;  4ZYN A;  2PE6 B;  4I6N B;  3TBL D;  3H7P B;  2L3Z A;  2C7H A;  1FXT B;  2FID A;  3L54 A;  2ZPN A;  2L0F A;  2FCM A;  2K25 A;  5E6O A;  2KJ6 A;  3MTN B;  4BBN F;  3SHQ A;  3KYD D;  1LFD A;  1TBE A;  2ZNV C;  1WJN A;  1F9J A;  2G4D B;  2XK5 A;  3DBR I;  3VUY A;  3CF6 E;  2BKR B;  5LXH A;  1I42 A;  3NHE B;  3L13 A;  1WGR A;  2DZJ A;  3B1L X;  3KUD B;  4K7S A;  4MGK E;  3ZRC A;  1UD7 A;  2DYM A;  2Y5B B;  4MEL A;  3RCZ A;  2L05 A;  3W1S C;  5AZG A;  4A20 A;  4F1S A;  4GIV A;  3A9J A;  4M0W B;  3TCA A;  3H1U A;  1T0Y A;  1WYW B;  4K81 A;  5G55 A;  2ZVO A;  3U8Z A;  2IBI B;  3QX1 A;  4HK2 A;  2C60 A;  4WJQ A;  2RSU A;  4BBN C;  3ZDM C;  3IVF A;  2K8C A;  3R7Q A;  1V49 A;  2K8B A;  2N4F A;  2Z0E B;  3QC8 B;  1WX9 A;  3CST A;  3V60 A;  2C7M B;  3ZTC A;  4GDK A;  4AJY B;  3VXW A;  3ZKJ C;  3HM6 X;  3X23 A;  2BPS A;  4GSW A;  3OAW A;  3DBH I;  3EEC A;  1EF5 A;  1Q0W B;  1KOT A;  4PS8 A;  2M1M A;  2NR2 A;  5J17 A;  2CS4 A;  2KC1 A;  3SDL C;  3MJW A;  4GDL B;  1EUV B;  3ECI A;  3VTW A;  1WH3 A;  2KOX A;  3BY4 B;  2J0K A;  3HM3 A;  1OGW A;  1UBQ A;  4LDT B;  3UQA A;  4B6W A;  3KUZ A;  2RGF A;  3SD5 A;  4BFR A;  3WAN A;  2KTF A;  4W9H A;  3TIX A;  4WWN A;  1UH6 A;  2ZCC A;  3ALB A;  1EF1 A;  1IPG A;  2PPH A;  1ZKH A;  4IW0 A;  1Z5S B;  2BWE S;  3UQB A;  1E8X A;  4ICU A;  2ASQ A;  3APF A;  1NDD A;  3EFU A;  4NPN A;  3BIN A;  3PRP B;  5DPT A;  1GC7 A;  3AU5 A;  4G50 A;  4ANV A;  3PLU A;  2GMI C;  1KM7 A;  2IYD B;  1WZ0 A;  4KVG B;  4X57 B;  3UF8 A;  4BKS A;  4EZJ A;  1UEL A;  2CR5 A;  3NY5 A;  1YQB A;  5KHQ A;  3RUL A;  2K8H A;  3L08 A;  2JZ3 B;  3K9P B;  4HDO A;  2D07 B;  3PSE B;  4AWJ A;  2KXJ A;  2ZNV B;  3M95 A;  2PE9 A;  4W9E A;  3ZNI D;  1V9J A;  1A5R A;  2Z0D B;  2JVC A;  2C7N B;  3VDZ A;  2GOW A;  4IWP A;  2KLC A;  2D3G A;  2JZZ A;  3AU4 A;  4IUM B;  2IO2 B;  2MBE A;  4LJP B;  2MLB A;  4OVU A;  2V3S A;  4LCD E;  1H4R A;  4G3X B;  4GDL A;  2BGF A;  2A4Z A;  2MX2 A;  1KJT A;  3A4R A;  2KWU B;  1GG3 A;  4HXD A;  3VQI A;  4ZRJ A;  4JL9 A;  4ANU A;  3ZNG C;  2PJH A;  3KVF B;  3HIZ A;  1Y8R C;  4EZL A;  5AEK B;  5JZE B;  5DPW A;  2J7Q B;  2LVQ A;  3PHW B;  1EO6 A;  4ZDV A;  2D10 A;  3A1Q B;  4NJ7 A;  2LGX A;  3LDZ E;  4RM8 A;  5JHB A;  2BKF A;  4TQ0 A;  2KD0 A;  2KQS A;  2I1K A;  4BOZ B;  4G0N B;  2HE7 A;  1SIF A;  1E90 A;  1OEY J;  2Z59 B;  3PPA A;  2IY1 B;  3N30 A;  2GBJ A;  1WMH B;  1J0G A;  3ZTD A;  3ZUN A;  2CU1 A;  2BYV E;  5D7G A;  4EZK A;  2LXA A;  5CHW A;  3IBE A;  4MGY E;  2N1W A;  3PRZ A;  4JIO U;  2L00 B;  3A33 B;  4WWP A;  2DYB A;  2IO1 B;  2LD9 A;  5L83 A;  1XT9 B;  2FIF A;  1RLF A;  3PGE A;  3EHV A;  4HPL B;  4I6L B;  4N9F 4;  1WR1 A;  2MW5 A;  5C23 A;  3QAQ A;  4ICV A;  3V6C B;  2MBQ A;  3M3J A;  2N9E B;  4MJS B;  3DBL I;  4NAW B;  4NQL B;  5D2M B;  2DZM A;  3N32 A;  4BKG A;  3APC A;  2LAS A;  1J19 A;  2D11 A;  2OJR A;  1I35 A;  2NBW B;  2JRH A;  4FJZ A;  2YVC A;  4IG7 B;  3MHS D;  3QCA A;  2L76 A;  4JLC A;  4KIK B;  2BWF A;  1RRB A;  4KDL B;  4AP4 C;  2C9W B;  2KLG A;  2KQ7 A;  3KW5 B;  4DDG D;  1SE9 A;  2NPT B;  2NS5 A;  4YL8 A;  4M8N A;  1V81 A;  4HVB A;  5LLI A;  3CSF A;  1GUA B;  1S3S G;  1WRD B;  2KMC A;  2GBK A;  2LWP A;  4KZ0 A;  3PRM B;  2FCN A;  5GMV A;  3RD2 A;  4DHJ B;  3PT2 B;  1WGH A;  3KH0 A;  4IM2 A;  2CKH B;  3H9D A;  4W9J A;  4BKS D;  3NZS A;  1LXD A;  2KX3 A;  2V4L A;  3R66 C;  2LVO A;  3PTF C;  3T9L A;  3LJ3 A;  3ZO5 B;  4AUQ C;  2BYF A;  2G45 B;  3P2B A;  1IYF A;  1X1M A;  5E6P A;  3JW0 X;  3WIM A;  4F8C B;  2KFK B;  3OJ3 A;  1XQQ A;  1WJU A;  3RYT A;  4A3O A;  2MRP A;  4MDK E;  2O6V B;  4IWQ A;  3AUL A;  4PYU A;  3C0R B;  4GGQ A;  3DBS A;  1WIA A;  2EMS A;  2G3Q B;  1QZE A;  4RMA A;  3DOW A;  4HCN B;  3TMP B;  4K1R B;  2NCN A;  1S1Q B;  1IP9 A;  4ASW C;  3IHP C;  4LDT D;  2HJ8 A;  5IAA C;  2AEH A;  1WR6 E;  2M0X A;  3ENE A;  3H7P A;  2RD0 A;  2XEW A;  4HCP B;  2RPQ A;  4II2 B;  2MBH A;  3L17 A;  3QHT A;  4DK5 A;  2V1Y A;  1E7V A;  5DCN A;  4PYZ A;  3VTV A;  4AOF A;  2N7D A;  2LRW A;  2CHW A;  2KK8 A;  4P7I A;  2CHX A;  1WM3 A;  1WI0 A;  3GZN I;  4OVV A;  1TZ1 A;  1WXM A;  4HJK A;  4NNJ B;  1YIW A;  3VAW A;  1V6E A;  4DDI D;  2KFJ A;  5HKH A;  3DVN U;  1UBI A;  3QK0 A;  4W9I A;  5C1Z A;  2KTR B;  4KDI C;  2J0M A;  3WAP A; 
#chains in the Genus database with same CATH topology
 4M0W A;  2WGS A;  2ZZP B;  3Q14 C;  4FAD A;  3VRA B;  1I7H A;  1ET6 A;  1Z2M A;  4NY0 A;  2EKI A;  2Z8L A;  2FBW B;  2KN5 A;  2ZW0 A;  1YNT E;  2KMA A;  3R3M A;  2JUO A;  3L0W B;  3DCG A;  3PLV A;  2FCS A;  2D3B A;  4MM3 B;  4WAA A;  2K5P A;  1SJE D;  2QMT A;  3AE5 B;  4FBJ B;  3I5J C;  3ZNZ B;  3VFK A;  2LGD A;  3ZLZ A;  3VHT C;  1DOI A;  2OED A;  2ZEQ A;  3H6N A;  1FFV A;  3GE3 C;  4EOY A;  2WXP A;  2DAJ A;  3NZU A;  1CMX B;  2NBV B;  2KDE B;  4A6Q A;  1OQY A;  1PYW D;  1MHH E;  2L52 A;  1I4H A;  1JRP A;  1WXQ A;  3ML8 A;  1IGD A;  2MQJ A;  3IFW B;  2GBM A;  2M8S A;  2WLB A;  4IM3 A;  1L2N A;  4BKT A;  2KVR A;  3NVY A;  3CMM B;  2RR9 A;  4DHJ D;  2VRR B;  3R7R A;  2MSE D;  3DHI C;  1VD2 A;  4WJO A;  3DVN V;  1SE3 A;  3A1Q A;  4GN1 A;  2LFI A;  2KKC A;  4W9L A;  4HPM B;  5LXI B;  4O1N A;  4A3P A;  1UGM A;  3DDC B;  4WUR A;  2J52 A;  1SBB B;  2MWS B;  2D2Q A;  4HRS A;  5KHO A;  1T0Q C;  2O2V B;  4GMV A;  2JRI B;  4NAW A;  3ABV B;  3DQV A;  4A90 A;  2LVP A;  1TY0 A;  4KIK A;  1B9R A;  1F1H A;  2ZJD A;  4DXA B;  2NPT A;  1TTN A;  1V80 A;  3RFZ B;  4PS7 A;  4YSY B;  4XGA B;  4WJP A;  3B0A A;  3QAR A;  3UIO B;  3Q3J A;  1NYR A;  2EMT A;  4ACF A;  1JW9 D;  2INP E;  2IY0 B;  2ACZ B;  1QOA A;  3WA0 A;  5CHV C;  3HVD A;  1HA5 A;  3PZ7 A;  3FIL A;  2O2V A;  3AED B;  4J6I A;  1R4M I;  3N3K B;  2DZI A;  4KZC A;  1MI0 A;  4HKQ A;  1XXG A;  5GXG B;  4RNA A;  2XBB C;  4IWO A;  2DYO A;  4C4V B;  1N6Z A;  3B2F A;  4YTM B;  4EEW A;  1T0R C;  1ISN A;  2C5L C;  3B08 A;  2YLM A;  2GBN A;  3QIJ A;  1BT0 A;  1VJK A;  2MCN B;  1LQB A;  2IZV B;  3VRB B;  1M94 A;  4C00 A;  3AE1 B;  1N62 A;  3TEX A;  5J2R A;  4FHJ A;  4JQW C;  2VZK B;  4S17 A;  1WY8 A;  1LGR A;  4DHZ B;  5D3D A;  5C2T B;  1AW7 A;  3J9C A;  1TGZ B;  3Q2A C;  2FNJ B;  4N58 A;  1V1P A;  2IO3 B;  1C1Y B;  3SR6 A;  2KDM A;  2KWV B;  2I2Y A;  4HKZ E;  2R2Q A;  2FUH B;  2HTM E;  4GDK B;  1K8R B;  2WX1 A;  3M63 B;  5EE1 A;  3RUI B;  2IO0 B;  3QJZ A;  4W9F A;  3O65 B;  5E6J A;  2AQ1 B;  2PE6 B;  3TBL D;  1FRR A;  2FID A;  3L54 A;  1WRI A;  2K25 A;  3MHZ A;  5E6O A;  1BXT A;  3SHQ A;  1TBE A;  3TEY A;  2G4D B;  3AEC B;  2XK5 A;  3BZD B;  2MH7 A;  4C56 C;  3B1L X;  4REZ A;  4ARC A;  3RCZ A;  1HEZ E;  3W1S C;  3A9J A;  1T0Y A;  2V4I B;  1SJH D;  3ZDM C;  3R7Q A;  2K8B A;  2Z0E B;  1WX9 A;  3CST A;  3V60 A;  4GDK A;  4AJY B;  2YEP B;  3VXW A;  2KAC A;  3AH7 A;  3IAM 1;  3HM6 X;  3DBH I;  3RNE C;  1T6B X;  3N1X C;  2OHF A;  5BYR A;  3SDL C;  2K3U A;  4D2K A;  2KOX A;  3BY4 B;  3HM3 A;  4W9H A;  2G1E A;  2WDQ B;  1C9F A;  1IPG A;  2N7J A;  1ZKH A;  4IW0 A;  1Z5S B;  1E8X A;  3AB5 A;  2DBY A;  4RH6 A;  4RGN A;  3BIN A;  1MG4 A;  5DPT A;  4ZYS A;  3AU5 A;  1HTO A;  2QSD A;  2H89 B;  4BKS A;  4EZJ A;  3NY5 A;  1Y56 A;  3RUL A;  4RFB A;  2E6X A;  3PSE B;  4AWJ A;  2JVC A;  3TSS A;  2GOW A;  4IWP A;  3V05 A;  3Q8A A;  2MLB A;  4LCD E;  4G3X B;  4KX6 B;  2BYT A;  3AEF B;  3VQI A;  4HXD A;  4ZRJ A;  1GPX A;  3KLS X;  2PJH A;  3KVF B;  1Y8R C;  5AEK B;  4KGS A;  2J7Q B;  3PHW B;  5FKA C;  1XEE A;  2D10 A;  3Q8C A;  4TQ0 A;  4RCO A;  2HE7 A;  1KFY B;  2WP9 B;  3PPA A;  2IY1 B;  1WMH B;  3ZUN A;  5EE9 A;  4L2Y A;  1JML A;  2LXA A;  2NTT A;  4MGY E;  4WWP A;  3A33 B;  1XT9 B;  4I6L B;  3EHV A;  2WXJ A;  1WR1 A;  4N9F 4;  5C23 A;  4BKG A;  2LAS A;  1J19 A;  2OJR A;  1C78 A;  2L76 A;  3IXS A;  1RRB A;  1NYQ A;  4AP4 C;  4YTN B;  4DDG D;  3FAH A;  5LLI A;  1GUA B;  4PK1 A;  4YXD B;  3PRM B;  1I4R A;  3L4P A;  2CKH B;  3Q6B A;  3NZS A;  1LXD A;  3R66 C;  2V4L A;  3P4S B;  3UI3 A;  2LVO A;  3W5U B;  3T9L A;  1FO4 A;  2LEK A;  1L6V A;  1GAQ B;  2KFK B;  1XQQ A;  3NVZ A;  2MRP A;  3C0R B;  4JX1 C;  4TSS A;  3BII D;  4HCN B;  3TMP B;  4LDT D;  4HCP B;  1NI3 A;  4KKJ A;  2RPQ A;  4LK0 M;  4PYZ A;  4A8X C;  3U2S C;  2CHX A;  2BB6 A;  3VAW A;  4DDI D;  3P1M A;  1UBI A;  2KTR B;  1J7A A;  3P4Q B;  1MJD A;  5HG2 A;  3T3O A;  3AEA B;  1PQS A;  1V97 A;  1ESF A;  1D3Z A;  2MHJ A;  3C8Y A;  1KLU D;  3PHX B;  5G2N A;  1J8C A;  4GU2 A;  3EC8 A;  2R2O A;  3Q69 A;  2CHZ A;  4CO7 A;  4OZA A;  2BW2 A;  5CX3 A;  3PS6 A;  2BF8 B;  3EA6 A;  1IBX B;  4K7W A;  3JSV B;  1OEY A;  3A4S C;  1E0Z A;  3SFE B;  4TUU A;  2LI5 A;  4S0R A;  2JPH A;  3UGB B;  3A9K B;  1GJZ A;  3PRE A;  4WQO B;  1TKG A;  1QOB A;  3V6E B;  4G11 A;  1WGD A;  2K6D B;  3V3X A;  1FXI A;  1WZ3 A;  3UIN B;  1QOG A;  3T8M A;  1E8W A;  2OOB B;  4DHZ E;  3N1Y C;  5JH5 C;  2KNB A;  3NJT A;  2WXO A;  1QF6 A;  1T3Q A;  2KDF B;  2LGS A;  3W1Y A;  2LJ5 A;  4Q2J A;  1JCK B;  3D32 A;  1YD8 U;  2JXX A;  3AV8 A;  1WYG A;  2VH2 A;  2VH1 A;  1P9D U;  4FJV B;  3V62 A;  2JT4 B;  4IKG A;  4LNN A;  4CHK A;  3WAL A;  5D6J B;  3DVG Y;  1EU3 A;  2NBU A;  3UIP B;  2BS4 B;  4WJN A;  1YX6 B;  1FCC C;  4GOC A;  4AQ7 A;  2WQY B;  1P98 A;  1F52 A;  2B3A A;  4TKN A;  3OJ4 B;  3TEZ A;  3WAO A;  3H7S A;  2W3R A;  1HE8 A;  2A5U A;  2AYO B;  4KKI A;  2N9X A;  2G4S A;  1PUT A;  4FA6 A;  4MH0 E;  3AE6 B;  3NS1 A;  3MFG A;  1WX7 A;  2BQQ A;  4LJO B;  1V5O A;  5IA7 A;  1WF9 A;  3CWI A;  1WXV A;  2GI9 A;  4HPP A;  1JRU A;  2SEB D;  1P0R A;  3RI7 C;  2V3P A;  1VRA B;  4W9G A;  3NOB A;  4C80 A;  1VZ6 A;  2AL3 A;  5E6N A;  1K51 A;  3L10 B;  5BO4 B;  2BS3 B;  2N9P C;  4JWU C;  5FR6 A;  3AXC A;  3W5V B;  1VZ7 A;  1ACC A;  1WGG A;  3N9Y C;  4RGM A;  1ZXH A;  2PKO A;  1NVI D;  1YJJ A;  3QQ8 B;  5L95 C;  5TR5 A;  1JWB D;  3PO0 A;  1I4P A;  1SGH A;  2D5G A;  4WQM A;  2GBR A;  1SF0 A;  2JU6 X;  3VUX A;  3PVL A;  2JF5 A;  4HWI B;  2EEL A;  3VTU A;  2ON8 A;  1JRO A;  1R4N B;  3AE9 B;  2NVU I;  1XO3 A;  4E71 A;  5AUK A;  2I38 A;  1DYQ A;  3BK2 A;  2M4N A;  1E8Z A;  2JX5 A;  2MJE A;  4TV3 A;  3VR9 B;  2RMM A;  1WXS A;  4WIP A;  2ZCB A;  1C3T A;  1E8Y A;  2PVG C;  3NVV A;  4MAC A;  2DWQ A;  2KWC A;  3LXF A;  3GP7 A;  4B0M A;  2KHW B;  1XCQ L;  4LNF A;  2WX0 A;  1EWY C;  4MM3 A;  4AJW A;  3VVW B;  1N63 A;  1NI2 A;  1XD3 B;  3Q3N C;  4PT5 A;  3ZQ4 A;  3GOE A;  2W54 A;  4FHK A;  1G6J A;  2DAF A;  4OHJ A;  4P1C C;  1C79 A;  1FMA D;  4ZYN A;  4I6N B;  2L3Z A;  2KJ6 A;  3MTN B;  4BBN F;  3B9J A;  1KTK A;  2CJN A;  3DBR I;  1I4G A;  3VUY A;  1ZXI A;  1TZO A;  3AEG B;  2DZJ A;  1SB3 C;  2DYM A;  2XN9 C;  5AZG A;  3RN9 C;  4M02 A;  4P1B C;  1UWX A;  4K81 A;  2Y5P A;  5G55 A;  3U8Z A;  1P7E A;  1KF6 B;  2C60 A;  2RSU A;  1YOV B;  4WJQ A;  4BBN C;  1V49 A;  2N4F A;  4HJG E;  1JWA D;  1ZOY B;  1MVK A;  4TMA B;  1AWD A;  3WCQ A;  3E56 A;  1QKZ A;  1L0X B;  1Q0W B;  4PS8 A;  4DQO C;  2WXR A;  2NR2 A;  4CQN A;  5J17 A;  1VZ8 A;  4LNK A;  2KC1 A;  2N9K A;  4L23 A;  4GDL B;  3VTW A;  2W55 A;  2ZW1 A;  4B6W A;  3KUZ A;  3SD5 A;  5D3I B;  2KTF A;  1UH6 A;  2ZCC A;  2SAK A;  4US9 A;  2BWE S;  4QAY A;  3UQB A;  4ICU A;  3ETR A;  3APF A;  3EFU A;  4GLS C;  3PLU A;  3ZJV A;  3UF8 A;  5HI1 A;  2WHI A;  1UEL A;  2CR5 A;  1YQB A;  3L08 A;  1FIQ A;  2PE9 A;  2D3C A;  5BMH A;  3AU4 A;  2XNA C;  2VZK D;  3MC9 A;  4LJP B;  4OVU A;  2V3S A;  5FK9 C;  2UU7 A;  3NVW A;  4GDL A;  2A4Z A;  2BGF A;  1GG3 A;  2K0P A;  1F2R I;  4JL9 A;  5G5G A;  4EZL A;  5JZE B;  4USA A;  2PTL A;  1EO6 A;  3Q3M C;  4ZDV A;  4OVZ A;  1QLB B;  1BUI C;  4RGT A;  2BKF A;  2KQS A;  1RFK A;  1TY2 A;  4YTP B;  1YN3 A;  1SIF A;  3EGR A;  2GBJ A;  1J0G A;  3ZTD A;  3LYY A;  2BYV E;  4EZK A;  3IBE A;  2N1W A;  2RDB C;  3PRZ A;  2LD9 A;  4C7Y A;  2FIF A;  4C4V A;  1RLF A;  3PGE A;  4HPL B;  1XLN A;  4ICV A;  2MBQ A;  3M3J A;  4MJS B;  3DBL I;  2MJ3 A;  3KQ4 A;  3KWV A;  2PMV A;  1E7P B;  2KYW A;  1ENF A;  3KW5 B;  2C9W B;  1D5X C;  4M8N A;  1WRD B;  1S3S G;  2KMC A;  5C3J B;  5GMV A;  3NRZ A;  3PT2 B;  1WGH A;  4BKS D;  1UUP A;  2KX3 A;  3LJ3 A;  1NEN B;  3ZO5 B;  2BYF A;  1X1M A;  3JW0 X;  4IOI E;  3RYT A;  3TUO A;  4MDK E;  2O6V B;  4IWQ A;  1LO5 D;  2AX5 A;  3ZJT A;  4EE2 A;  3KWL A;  4XWT A;  2NCN A;  1S1Q B;  3AE7 B;  4ASW C;  1P7F A;  3Q3O C;  2M0X A;  2WXH A;  2KWD A;  4II2 B;  2MBH A;  2JYT A;  1E7V A;  5DCN A;  3VTV A;  2LHE A;  4AOF A;  2N7D A;  1EM7 A;  3ZXV A;  5AUI A;  4P7I A;  4ZOH C;  4UDU C;  2LJI A;  2INC C;  1N5X A;  3QK0 A;  4W9I A;  4BZA A;  1R4N I;  2K22 A;  4IM0 A;  1Q5W B;  2IGD A;  2UWQ A;  4MSQ B;  1UGJ A;  1HQR D;  3GB1 A;  1KLV A;  1ROE A;  3GZN B;  1D5Z C;  1FRD A;  4R3D A;  1WXA A;  3U52 E;  2M17 A;  4RGO S;  4ZRP A;  4B9K A;  4RM9 A;  1ZGU B;  2Y5C A;  1PDX A;  3L16 A;  4KV2 A;  4XZ4 A;  3IG3 A;  1FPY A;  3KYC D;  3VR8 B;  3WAM A;  4W9C A;  2N0S B;  3RZF A;  2LGY A;  1MFW A;  5AZH A;  2RDH A;  2IJ0 A;  2LUM A;  2QC8 A;  1RAX A;  1D6E C;  2DZK A;  4MGZ E;  3DWG C;  1C77 A;  1VR9 A;  2FCQ A;  4F7Z A;  4MEM A;  1QQR A;  3JVZ X;  3Q3F A;  4EFO A;  1TKE A;  4JE3 B;  1FCL A;  1FD6 A;  1XLO A;  4W9K A;  1ET9 A;  3VUW A;  4ANX A;  4OZC A;  2X8X X;  1OTR B;  2KAN A;  2WNM A;  4DWF A;  4BOS C;  1ZDX A;  4WAF A;  5I4D A;  1JAL A;  1L6U A;  2L8J A;  3VH4 B;  4FXC A;  3ML9 A;  1LM8 B;  1MHX A;  2HTH A;  5EDS A;  2WXN A;  3TL5 A;  2QIE B;  1F0Z A;  4HRO A;  1NBF C;  1Q1O A;  1WWT A;  2MBO A;  1V86 A;  5JHA A;  2QCZ A;  3U7D A;  2DX5 B;  1WMH A;  2MBB B;  2WXQ A;  4WWO A;  3ZJU A;  2WDT B;  2AWT A;  2INN E;  4XX5 A;  5J18 A;  2BS2 B;  4ARI A;  2M19 A;  3NG0 A;  1YJI A;  5H92 C;  4E74 A;  4XWW A;  2LXC A;  1ZP0 B;  2KDI A;  4W9D A;  4XE0 A;  2DEN B;  3U7Z A;  3APD A;  2DNF A;  1YQ3 B;  3VH3 B;  4MH8 A;  2J4X A;  3BVZ A;  1FFU A;  2JWU A;  4LNO A;  2FAZ A;  3HUI A;  4J3O D;  4BVU C;  3N20 C;  3S2A A;  2WXI A;  3M62 B;  4P16 A;  3TEW A;  2PW9 A;  1P3Q U;  2KFK A;  4XDC A;  4MSM B;  3OLM D;  2X38 A;  1V2Y A;  1TKY A;  1MG8 A;  4ZRI A;  3DVG X;  4ANW A;  1YX5 B;  1T5X D;  3B2G A;  2GLS A;  2MP2 B;  3AE4 B;  2K39 A;  5JXV A;  2UYZ B;  2ZPY A;  4ZRK A;  1GNU A;  1WFY A;  1QIL A;  2DLB A;  4FN2 A;  1WJ6 A;  3RNF C;  4RF0 A;  2ZVN A;  1RWS A;  3HK0 A;  2BB5 A;  2KTR A;  2QIL A;  2WYQ A;  1ZDV A;  3C19 A;  4HLE A;  3RNG C;  1C4P A;  5H8Y E;  1AAR A;  2BTE A;  1CQV A;  3DWM A;  2MA9 B;  3ZVV A;  4EUT A;  4K3C A;  3MP9 A;  1CZP A;  2BYE A;  2KVZ A;  1OQQ A;  3I3T B;  2MP2 A;  3MJ5 A;  1JWU D;  1IBX A;  1FXA A;  1YJ1 A;  3ZGZ A;  3JSV A;  4CYE A;  2KZR A;  2JZP A;  1SXT A;  3ZW3 A;  1B1Z A;  3ONS A;  3AI5 A;  3A9K A;  1I4X A;  3H7P B;  2C7H A;  5IKC M;  5IO9 A;  5T8I A;  2ZPN A;  2L0F A;  1I4Q A;  2FCM A;  1WGK A;  2V9H A;  4WWM A;  2ZNV C;  1WJN A;  1F9J A;  4LLG M;  4OW0 A;  4P6V F;  5LXH A;  1I42 A;  3NHE B;  1WGR A;  3KUD B;  3O13 A;  4K7S A;  4MGK E;  1KH0 A;  1XF5 L;  1UD7 A;  4A9A A;  4DXF A;  4M0W B;  1N60 A;  3TCA A;  1WYW B;  2IND C;  2IBI B;  4HK2 A;  2K8C A;  5HFY A;  3QC8 B;  2RDG A;  3ZTC A;  4GSW A;  3EEC A;  1EF5 A;  1C76 A;  1F2R C;  4B0E A;  3P4P B;  1AYF A;  2ONQ A;  3MJW A;  3AEE B;  3ECI A;  3BYT B;  1CK1 A;  4NAM A;  3I63 C;  3TIX A;  4WWN A;  3BYY B;  2PPH A;  1ZE3 D;  1D5M C;  1NDD A;  3DBH B;  1SEB D;  4G50 A;  4ANV A;  2QDF A;  4KVG B;  4X57 B;  1K50 A;  1HZ6 A;  2J42 A;  4HDO A;  2JZ3 B;  3K9P B;  4MT5 A;  1XLP A;  4W9E A;  3GS2 A;  2KLC A;  2D3G A;  4IUM B;  5G5H A;  2H88 B;  2IO2 B;  3PZ8 A;  3R2I A;  1KJT A;  3A4R A;  1GB4 A;  1WSP A;  2L83 A;  2WXL A;  5DPW A;  3HIZ A;  3T3N A;  2LVQ A;  1DOY A;  3BK1 A;  3A1Q B;  4NJ7 A;  4RM8 A;  3U4E G;  4HEA 1;  1E9M A;  2I1K A;  1TS5 A;  3GE8 C;  4ZHP A;  4BOZ B;  5IP4 D;  4G0N B;  2N9L A;  1E90 A;  1OEY J;  2Z59 B;  4BAX A;  2HJ1 A;  2CU1 A;  2LMC A;  5D7G A;  2WU5 B;  5CHW A;  4JIO U;  2DYB A;  1OFF A;  2MW5 A;  3QAQ A;  4NZL B;  2W3S A;  4NQL B;  4NAW B;  2DZM A;  2V3N A;  3N32 A;  2D11 A;  1I35 A;  2NBW B;  2JRH A;  4FJZ A;  2YVC A;  3MHS D;  2M56 B;  4JLC A;  3QCA A;  4KIK B;  1FNW A;  4KDL B;  3MC8 A;  2KLG A;  2KQ7 A;  3EUB 2;  1ZUD 2;  1SE9 A;  2NPT B;  2NS5 A;  4HVB A;  3CSF A;  1RYJ A;  1UF0 A;  2FCN A;  4N6E B;  3RD2 A;  4DHJ B;  3AM9 A;  4IM2 A;  1L0Y B;  3RNC C;  4W9J A;  5TSS A;  4JWS C;  2E3T A;  2G45 B;  1A70 A;  1IYF A;  3WIM A;  1EU4 A;  4GGQ A;  1SE2 A;  3DBS A;  2EMS A;  1E6E B;  2G3Q B;  2NTS A;  1QZE A;  4YSX B;  3FIL B;  1TS4 A;  3SFD B;  3N1Z C;  1WR6 E;  3ENE A;  2XEW A;  2CJO A;  3Q8F A;  3AEB B;  1BML C;  2V1Y A;  1HTQ A;  2KK8 A;  1YMH E;  1WM3 A;  2RPV A;  1YIW A;  2OJW A;  5IOI A;  5C1Z A;  2J0M A;  3AMZ A;  2R61 A;  4ZHO A;  3WAP A;  1JWS D;  1RFA A;  3JYU A;  2LUE A;  2KC2 A;  2JSV X;  2JWZ A;  4XC2 A;  4DXG A;  2WWZ A;  1WE7 A;  2PIA A;  1J7B A;  2KX0 A;  4NJ6 A;  5DPR A;  4IC7 B;  4M8M A;  2DHZ A;  1E5W A;  3BWU D;  5D94 A;  2WDR B;  2AQ2 B;  3MC0 B;  2REX A;  1FM0 D;  1V1P B;  2BVC A;  1DOX A;  2B76 B;  3AE8 B;  1TIF A;  2AL6 A;  3NZ3 A;  1VCB A;  3RT3 B;  1U4A A;  5AZF A;  3NS8 A;  1UNS A;  3HVZ A;  1FNU A;  2HD5 B;  1XLQ A;  2KAJ A;  2KO3 A;  4E3C A;  2Y3A A;  3ZNH B;  1ZW7 A;  2JYE A;  2K9X A;  1TJE A;  2L1A A;  2XK5 B;  3CIR B;  2PLP A;  2QEJ C;  2EKE C;  4RF1 A;  2JY6 A;  1IUE A;  2KJH B;  4K7U A;  3W9C B;  3I9V 1;  1C4C A;  3DHH C;  3A9J B;  2KN4 A;  1E7U A;  3K9O B;  4KGR A;  4KSK C;  1PGB A;  2WXG A;  1YQ4 B;  3W1S A;  3X0W A;  2QHO A;  2JXT A;  3FKY A;  3AE2 B;  3U30 A;  3KUC B;  2BBC A;  1UZX B;  3ZRF A;  4LTU A;  2PEA A;  3E9S A;  2O6V D;  1L7Y A;  4JGH B;  1P1A A;  2J53 A;  3Q8B A;  5LNK 1;  1KRH A;  2W9N A;  1JQ4 A;  2J0J A;  2WS3 B;  3Q8E A;  4KSL C;  4TQ1 A;  4L1B A;  5DPS A;  4GB9 A;  1V5T A;  1SE4 A;  4GXB A;  3PV1 A;  3PZD A;  2KDB A;  1WJ4 A;  4PS3 A;  3URY A;  5MPO A;  4YWG G;  2LRU A;  4MJS A;  4MGI E;  3DPD A;  1WM2 A;  4M00 A;  3ZXR A;  2K6Q A;  5CTR C;  1KLG D;  3ZDT A;  2WDV B;  2KJR A;  1HZ5 A;  4B95 A;  4URK A;  3RZW C;  4HDQ A;  4DBG A;  1GC6 A;  1E10 A;  3OG5 A;  4I6P A;  2I1J A;  3H8H A;  1UWM A;  4H2A A;  4FJY A;  1TS2 A;  3V61 A;  2O6V A;  3QWZ B;  1EWC A;  3BVM A;  3QA8 A;  4AS1 A;  2WXK A;  1L5P A;  2CU3 A;  4C7Z A;  1RM6 C;  2YEP F;  2V0G A;  2IGG A;  2IDY A;  3TJP A;  4FUL A;  3SU8 X;  4A55 A;  2FUG 1;  1V8C A;  1GB1 A;  3P42 A;  5FR3 A;  1L4Z B;  2NMQ A;  2K1F A;  4N59 A;  3HHM A;  3RNA C;  1L0V B;  1WGY A;  4K3B A;  2G9H D;  3R8B A;  4KGT A;  1WE6 A;  3IT6 B;  4NQK E;  5CHF A;  2MEK A;  3EFC A;  4II3 B;  2LGI A;  2L7R A;  3ZIM A;  1PGX A;  4EKU A;  3HRD D;  2LZ6 A;  3W2D A;  2N7E A;  1TYG B;  4FLH A;  2L0T A;  1YN5 A;  1H8C A;  4ITK A;  2GRI A;  2N1V A;  2PVO D;  1WX8 A;  2KT7 A;  5IN7 A;  1FXT B;  1YN4 A;  4WH4 A;  2JQR B;  3KYD D;  1LFD A;  1CJE A;  1HXY D;  1D4B A;  3I57 A;  1PFD A;  3LB8 C;  4XYC A;  3CF6 E;  2BKR B;  3L13 A;  3ZRC A;  2Y5B B;  4MEL A;  1FEH A;  1NEK B;  2L05 A;  2WXM A;  4US8 A;  4F1S A;  4A20 A;  4GIV A;  1PGA A;  3H1U A;  3P63 A;  1VDV A;  2ZVO A;  3OWE B;  3QX1 A;  5BYS A;  3IVF A;  3IAS 1;  3DBR B;  1C4A A;  2C7M B;  1JWM D;  3ZKJ C;  2GB1 A;  1QOF A;  3X23 A;  1VLB A;  2BPS A;  3OAW A;  1KOT A;  2M1M A;  1XCT L;  2CS4 A;  1QT9 A;  1T0S C;  5EE3 A;  1EUV B;  1WH3 A;  2J0K A;  1OGW A;  1UBQ A;  4LDT B;  3UQA A;  1IGC A;  1M4V A;  2RGF A;  4BFR A;  3WAN A;  2D3A A;  3ALB A;  1EF1 A;  4LNI A;  3SEB A;  2ASQ A;  2Q5W D;  4NPN A;  3NUH B;  3PRP B;  1GC7 A;  1N5W A;  2GMI C;  1KM7 A;  2IYD B;  1WZ0 A;  2LHD A;  1SSN A;  3IT4 B;  5KHQ A;  5BMG A;  2K8H A;  2D07 B;  2KXJ A;  5HHD G;  2ZNV B;  3M95 A;  3ZNI D;  2IPK D;  1A5R A;  1V9J A;  2Z0D B;  2C7N B;  3VDZ A;  4NJC A;  2JZZ A;  1K52 A;  2MBE A;  2FE8 A;  1R4M B;  2AQ3 B;  1H4R A;  2L32 A;  4OZB A;  2MX2 A;  3FC4 A;  2KWU B;  2KMM A;  4ANU A;  1Q10 A;  3ZYY X;  3ZNG C;  5BYQ A;  4JPS A;  2IGH A;  2LGX A;  3LDZ E;  5JHB A;  3RMK C;  2KD0 A;  1OQR A;  1N61 A;  4YSZ B;  3N30 A;  1MPE A;  1ZPS A;  3P4R B;  2HDE A;  4M01 A;  3RNB C;  2BT6 A;  2L00 B;  2IO1 B;  5L83 A;  3AN1 A;  1J7C A;  3V6C B;  2N9E B;  5D2M B;  3RPF C;  3APC A;  4IG7 B;  2WXF A;  2BWF A;  1V1O A;  2M0A A;  1FNV A;  4ZRQ A;  2ICI A;  4YL8 A;  1V81 A;  1DGJ A;  2GBK A;  2LWP A;  4KZ0 A;  3DHG C;  3KH0 A;  3H9D A;  1TT5 B;  3PTF C;  4AUQ C;  3DBL B;  2KQ4 X;  2MJD A;  3P2B A;  5E6P A;  5EE0 A;  4F8C B;  1AN8 A;  2WU2 B;  3OJ3 A;  1WJU A;  4YT0 B;  4A3O A;  3AUL A;  4PYU A;  1SIJ A;  1WIA A;  3AE3 B;  4IDI A;  4RMA A;  3DOW A;  3R2T A;  4K1R B;  1IP9 A;  1K53 A;  2TSS A;  1STE A;  3IHP C;  2HJ8 A;  5IAA C;  2AEH A;  3H7P A;  2RD0 A;  2W82 A;  3L17 A;  3QHT A;  1GOZ A;  4DK5 A;  5BMI A;  1TS3 A;  2LRW A;  2CHW A;  1F77 A;  1WI0 A;  3GZN I;  4XDD A;  4OVV A;  1TZ1 A;  1WXM A;  4HJK A;  4NNJ B;  1R7S A;  1V6E A;  3BVG A;  2KFJ A;  5HKH A;  3DVN U;  2QJL A;  4KDI C;  1L4D B; 
#chains in the Genus database with same CATH homology
 1R4N I;  1RFA A;  2ZZP B;  3JYU A;  4IM0 A;  1PQS A;  4FAD A;  1Q5W B;  2LUE A;  2KC2 A;  2JWZ A;  1D3Z A;  4XC2 A;  5G2N A;  1Z2M A;  2UWQ A;  3PHX B;  4MSQ B;  4NY0 A;  1J8C A;  2WWZ A;  1WE7 A;  3EC8 A;  4GU2 A;  1KLV A;  2KX0 A;  2KN5 A;  4NJ6 A;  2KMA A;  5DPR A;  2R2O A;  3R3M A;  4IC7 B;  4M8M A;  2DHZ A;  1E5W A;  2CHZ A;  2JUO A;  1WXA A;  5D94 A;  3L0W B;  4CO7 A;  2M17 A;  3DCG A;  4B9K A;  4RM9 A;  3PLV A;  2FCS A;  4WAA A;  1ZGU B;  2REX A;  5CX3 A;  3L16 A;  3PS6 A;  2BF8 B;  4KV2 A;  4FBJ B;  3ZNZ B;  3VFK A;  4K7W A;  4XZ4 A;  2LGD A;  3ZLZ A;  3VHT C;  3IG3 A;  3JSV B;  3KYC D;  1OEY A;  3A4S C;  3WAM A;  4W9C A;  3RZF A;  2ZEQ A;  3H6N A;  2AL6 A;  2LGY A;  1VCB A;  3RT3 B;  1U4A A;  4EOY A;  4TUU A;  5AZF A;  2DAJ A;  2LI5 A;  3NS8 A;  2JPH A;  3NZU A;  5AZH A;  3UGB B;  3A9K B;  1CMX B;  1GJZ A;  2NBV B;  2KDE B;  3PRE A;  1RAX A;  4WQO B;  2DZK A;  4MGZ E;  2HD5 B;  1OQY A;  2KO3 A;  4E3C A;  3V6E B;  2FCQ A;  3ZNH B;  1ZW7 A;  4G11 A;  1WGD A;  4F7Z A;  2K6D B;  4MEM A;  1WZ3 A;  3UIN B;  3T8M A;  2XK5 B;  1E8W A;  3ML8 A;  3JVZ X;  3Q3F A;  2MQJ A;  4EFO A;  2OOB B;  4DHZ E;  2EKE C;  5JH5 C;  2KNB A;  3IFW B;  2GBM A;  2JY6 A;  2M8S A;  4IM3 A;  4W9K A;  1L2N A;  2KJH B;  4BKT A;  2KDF B;  2KVR A;  3VUW A;  4K7U A;  3W1Y A;  4ANX A;  3CMM B;  2RR9 A;  1OTR B;  2KAN A;  3A9J B;  2LJ5 A;  4DWF A;  4BOS C;  3D32 A;  4DHJ D;  1E7U A;  3K9O B;  2VRR B;  1YD8 U;  4KSK C;  3R7R A;  2JXX A;  3W1S A;  3X0W A;  2MSE D;  2QHO A;  2L8J A;  1P9D U;  3VH4 B;  1VD2 A;  3KUC B;  3ML9 A;  4FJV B;  1LM8 B;  4WJO A;  3DVN V;  3U30 A;  3V62 A;  2HTH A;  2JT4 B;  1UZX B;  3ZRF A;  5EDS A;  3TL5 A;  2PEA A;  3A1Q A;  4GN1 A;  2O6V D;  1L7Y A;  4JGH B;  4CHK A;  3WAL A;  5D6J B;  1P1A A;  3DVG Y;  2KKC A;  1NBF C;  2NBU A;  1Q1O A;  4W9L A;  3UIP B;  2MBO A;  4HPM B;  4WJN A;  2W9N A;  5LXI B;  2J0J A;  1V86 A;  1YX6 B;  4KSL C;  4TQ1 A;  5DPS A;  4GOC A;  4GB9 A;  1V5T A;  4A3P A;  1UGM A;  3U7D A;  2DX5 B;  5JHA A;  1WMH A;  1P98 A;  3DDC B;  2B3A A;  4GXB A;  4TKN A;  3OJ4 B;  2MBB B;  3PV1 A;  2MWS B;  4WWO A;  3PZD A;  2WDT B;  3WAO A;  2AWT A;  2D2Q A;  2KDB A;  1WJ4 A;  3H7S A;  4PS3 A;  5KHO A;  4XX5 A;  5J18 A;  1HE8 A;  2A5U A;  2AYO B;  2N9X A;  2G4S A;  4E74 A;  2LRU A;  2LXC A;  2O2V B;  4GMV A;  2JRI B;  4FA6 A;  4MJS A;  4MGI E;  4NAW A;  3DPD A;  4MH0 E;  1WM2 A;  2KDI A;  3DQV A;  4W9D A;  2DEN B;  1WX7 A;  3APD A;  2LVP A;  4LJO B;  3VH3 B;  2K6Q A;  4KIK A;  1V5O A;  5CTR C;  5IA7 A;  1WF9 A;  2ZJD A;  4DXA B;  1WXV A;  2NPT A;  1TTN A;  1JRU A;  1V80 A;  3ZDT A;  1P0R A;  2FAZ A;  4BVU C;  4PS7 A;  2KJR A;  4W9G A;  3NOB A;  4B95 A;  4URK A;  3RZW C;  4HDQ A;  2AL3 A;  4WJP A;  5E6N A;  4DBG A;  3B0A A;  3L10 B;  5BO4 B;  3S2A A;  1GC6 A;  2N9P C;  3QAR A;  3UIO B;  3Q3J A;  4I6P A;  5FR6 A;  3M62 B;  3AXC A;  2I1J A;  1WGG A;  4FJY A;  2EMT A;  1P3Q U;  2KFK A;  3QQ8 B;  3V61 A;  2IY0 B;  5L95 C;  3WA0 A;  5TR5 A;  2O6V A;  5CHV C;  3QWZ B;  4MSM B;  3OLM D;  1SGH A;  3QA8 A;  2GBR A;  1V2Y A;  1MG8 A;  2O2V A;  4ZRI A;  3DVG X;  3VUX A;  4ANW A;  1YX5 B;  3PVL A;  4J6I A;  1R4M I;  2JF5 A;  3N3K B;  2MP2 B;  2DZI A;  4KZC A;  4HWI B;  2K39 A;  3VTU A;  2UYZ B;  2NVU I;  2ZPY A;  4ZRK A;  1GNU A;  4E71 A;  1WFY A;  3TJP A;  2XBB C;  4FUL A;  4IWO A;  4FN2 A;  3SU8 X;  2DYO A;  1WJ6 A;  2M4N A;  1E8Z A;  2ZVN A;  2K1F A;  4TV3 A;  3HK0 A;  3HHM A;  1WXS A;  2ZCB A;  1C3T A;  2KTR A;  1E8Y A;  2C5L C;  1ISN A;  3B08 A;  4EEW A;  2YLM A;  2GBN A;  3QIJ A;  1BT0 A;  1WGY A;  2WYQ A;  4HLE A;  2MCN B;  1LQB A;  2IZV B;  1WE6 A;  1AAR A;  1M94 A;  2KWC A;  4NQK E;  5CHF A;  5J2R A;  4FHJ A;  4II3 B;  2L7R A;  4JQW C;  1WY8 A;  2MA9 B;  3ZIM A;  3ZVV A;  2KHW B;  4EUT A;  4DHZ B;  4EKU A;  2BYE A;  2LZ6 A;  2WX0 A;  4MM3 A;  2N7E A;  3I3T B;  1TGZ B;  4AJW A;  2FNJ B;  2MP2 A;  4FLH A;  2L0T A;  3VVW B;  2IO3 B;  1C1Y B;  1YJ1 A;  1H8C A;  1NI2 A;  1XD3 B;  3JSV A;  2KWV B;  3GOE A;  4FHK A;  1G6J A;  2DAF A;  2N1V A;  4CYE A;  2KZR A;  2R2Q A;  2FUH B;  1WX8 A;  3ZW3 A;  4GDK B;  1K8R B;  2WX1 A;  3M63 B;  3ONS A;  3AI5 A;  3RUI B;  2IO0 B;  3A9K A;  3QJZ A;  3O65 B;  4W9F A;  4ZYN A;  2PE6 B;  4I6N B;  3TBL D;  3H7P B;  2L3Z A;  2C7H A;  1FXT B;  2FID A;  3L54 A;  2ZPN A;  2L0F A;  2FCM A;  2K25 A;  5E6O A;  2KJ6 A;  3MTN B;  4BBN F;  3SHQ A;  3KYD D;  1LFD A;  1TBE A;  2ZNV C;  1WJN A;  1F9J A;  2G4D B;  2XK5 A;  3DBR I;  3VUY A;  3CF6 E;  2BKR B;  5LXH A;  1I42 A;  3NHE B;  3L13 A;  1WGR A;  2DZJ A;  3B1L X;  3KUD B;  4K7S A;  4MGK E;  3ZRC A;  1UD7 A;  2DYM A;  2Y5B B;  4MEL A;  3RCZ A;  2L05 A;  3W1S C;  5AZG A;  4A20 A;  4F1S A;  4GIV A;  3A9J A;  4M0W B;  3TCA A;  3H1U A;  1T0Y A;  1WYW B;  4K81 A;  5G55 A;  2ZVO A;  3U8Z A;  2IBI B;  3QX1 A;  4HK2 A;  2C60 A;  4WJQ A;  2RSU A;  4BBN C;  3ZDM C;  3IVF A;  2K8C A;  3R7Q A;  1V49 A;  2K8B A;  2N4F A;  2Z0E B;  3QC8 B;  1WX9 A;  3CST A;  3V60 A;  2C7M B;  3ZTC A;  4GDK A;  4AJY B;  3VXW A;  3ZKJ C;  3HM6 X;  3X23 A;  2BPS A;  4GSW A;  3OAW A;  3DBH I;  3EEC A;  1EF5 A;  1Q0W B;  1KOT A;  4PS8 A;  2M1M A;  2NR2 A;  5J17 A;  2CS4 A;  2KC1 A;  3SDL C;  3MJW A;  4GDL B;  1EUV B;  3ECI A;  3VTW A;  1WH3 A;  2KOX A;  3BY4 B;  2J0K A;  3HM3 A;  1OGW A;  1UBQ A;  4LDT B;  3UQA A;  4B6W A;  3KUZ A;  2RGF A;  3SD5 A;  4BFR A;  3WAN A;  2KTF A;  4W9H A;  3TIX A;  4WWN A;  1UH6 A;  2ZCC A;  3ALB A;  1EF1 A;  1IPG A;  2PPH A;  1ZKH A;  4IW0 A;  1Z5S B;  2BWE S;  3UQB A;  1E8X A;  4ICU A;  2ASQ A;  3APF A;  1NDD A;  3EFU A;  4NPN A;  3BIN A;  3PRP B;  5DPT A;  1GC7 A;  3AU5 A;  4G50 A;  4ANV A;  3PLU A;  2GMI C;  1KM7 A;  2IYD B;  1WZ0 A;  4KVG B;  4X57 B;  3UF8 A;  4BKS A;  4EZJ A;  1UEL A;  2CR5 A;  3NY5 A;  1YQB A;  5KHQ A;  3RUL A;  2K8H A;  3L08 A;  2JZ3 B;  3K9P B;  4HDO A;  2D07 B;  3PSE B;  4AWJ A;  2KXJ A;  2ZNV B;  3M95 A;  2PE9 A;  4W9E A;  3ZNI D;  1V9J A;  1A5R A;  2Z0D B;  2JVC A;  2C7N B;  3VDZ A;  2GOW A;  4IWP A;  2KLC A;  2D3G A;  2JZZ A;  3AU4 A;  4IUM B;  2IO2 B;  2MBE A;  4LJP B;  2MLB A;  4OVU A;  2V3S A;  4LCD E;  1H4R A;  4G3X B;  4GDL A;  2BGF A;  2A4Z A;  2MX2 A;  1KJT A;  3A4R A;  2KWU B;  1GG3 A;  4HXD A;  3VQI A;  4ZRJ A;  4JL9 A;  4ANU A;  3ZNG C;  2PJH A;  3KVF B;  3HIZ A;  1Y8R C;  4EZL A;  5AEK B;  5JZE B;  5DPW A;  2J7Q B;  2LVQ A;  3PHW B;  1EO6 A;  4ZDV A;  2D10 A;  3A1Q B;  4NJ7 A;  2LGX A;  3LDZ E;  4RM8 A;  5JHB A;  2BKF A;  4TQ0 A;  2KD0 A;  2KQS A;  2I1K A;  4BOZ B;  4G0N B;  2HE7 A;  1SIF A;  1E90 A;  1OEY J;  2Z59 B;  3PPA A;  2IY1 B;  3N30 A;  2GBJ A;  1WMH B;  1J0G A;  3ZTD A;  3ZUN A;  2CU1 A;  2BYV E;  5D7G A;  4EZK A;  2LXA A;  5CHW A;  3IBE A;  4MGY E;  2N1W A;  3PRZ A;  4JIO U;  2L00 B;  3A33 B;  4WWP A;  2DYB A;  2IO1 B;  2LD9 A;  5L83 A;  1XT9 B;  2FIF A;  1RLF A;  3PGE A;  3EHV A;  4HPL B;  4I6L B;  4N9F 4;  1WR1 A;  2MW5 A;  5C23 A;  3QAQ A;  4ICV A;  3V6C B;  2MBQ A;  3M3J A;  2N9E B;  4MJS B;  3DBL I;  4NAW B;  4NQL B;  5D2M B;  2DZM A;  3N32 A;  4BKG A;  3APC A;  2LAS A;  1J19 A;  2D11 A;  2OJR A;  1I35 A;  2NBW B;  2JRH A;  4FJZ A;  2YVC A;  4IG7 B;  3MHS D;  3QCA A;  2L76 A;  4JLC A;  4KIK B;  2BWF A;  1RRB A;  4KDL B;  4AP4 C;  2C9W B;  2KLG A;  2KQ7 A;  3KW5 B;  4DDG D;  1SE9 A;  2NPT B;  2NS5 A;  4YL8 A;  4M8N A;  1V81 A;  4HVB A;  5LLI A;  3CSF A;  1GUA B;  1S3S G;  1WRD B;  2KMC A;  2GBK A;  2LWP A;  4KZ0 A;  3PRM B;  2FCN A;  5GMV A;  3RD2 A;  4DHJ B;  3PT2 B;  1WGH A;  3KH0 A;  4IM2 A;  2CKH B;  3H9D A;  4W9J A;  4BKS D;  3NZS A;  1LXD A;  2KX3 A;  2V4L A;  3R66 C;  2LVO A;  3PTF C;  3T9L A;  3LJ3 A;  3ZO5 B;  4AUQ C;  2BYF A;  2G45 B;  3P2B A;  1IYF A;  1X1M A;  5E6P A;  3JW0 X;  3WIM A;  4F8C B;  2KFK B;  3OJ3 A;  1XQQ A;  1WJU A;  3RYT A;  4A3O A;  2MRP A;  4MDK E;  2O6V B;  4IWQ A;  3AUL A;  4PYU A;  3C0R B;  4GGQ A;  3DBS A;  1WIA A;  2EMS A;  2G3Q B;  1QZE A;  4RMA A;  3DOW A;  4HCN B;  3TMP B;  4K1R B;  2NCN A;  1S1Q B;  1IP9 A;  4ASW C;  3IHP C;  4LDT D;  2HJ8 A;  5IAA C;  2AEH A;  1WR6 E;  2M0X A;  3ENE A;  3H7P A;  2RD0 A;  2XEW A;  4HCP B;  2RPQ A;  4II2 B;  2MBH A;  3L17 A;  3QHT A;  4DK5 A;  2V1Y A;  1E7V A;  5DCN A;  4PYZ A;  3VTV A;  4AOF A;  2N7D A;  2LRW A;  2CHW A;  2KK8 A;  4P7I A;  2CHX A;  1WM3 A;  1WI0 A;  3GZN I;  4OVV A;  1TZ1 A;  1WXM A;  4HJK A;  4NNJ B;  1YIW A;  3VAW A;  1V6E A;  4DDI D;  2KFJ A;  5HKH A;  3DVN U;  1UBI A;  3QK0 A;  4W9I A;  5C1Z A;  2KTR B;  4KDI C;  2J0M A;  3WAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...