2LASA

Molecular determinants of paralogue-specific sumo-sim recognition
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
78
structure length
78
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small ubiquitin-related modifier 1
publication title Insights into High Affinity Small Ubiquitin-like Modifier (SUMO) Recognition by SUMO-interacting Motifs (SIMs) Revealed by a Combination of NMR and Peptide Array Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 9
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2011-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lasA00
2KO3A 1WZ0A 4FJZA 4URKA 1K8RB 1UH6A 1WJ4A 2KDBA 2KWUB 5JZEB 2CKHB 2MBOA 1WXVA 3ZDTA 1WF9A 3SU8X 3B1LX 1WGDA 2DAFA 3KW5B 2KDFB 2KNBA 2VRRB 3PLVA 4K7WA 3TIXA 2DZKA 2EMSA 4HCNB 3N32A 2JRIB 1WMHA 3NOBA 4FULA 2J7QB 3PHXB 1E7VA 2KANA 4RM8A 4BBNF 1YX6B 3N30A 4IWOA 1NI2A 5G55A 2WYQA 3ZTCA 3O65B 2PE9A 4BOZB 2D3GA 1L2NA 4TKNA 2LRUA 2ZCCA 4NNJB 1YIWA 2O2VA 3DPDA 1GUAB 4ANVA 1E7UA 1V86A 2I1KA 2N9XA 2PJHA 1E8WA 1EF1A 4NQKE 3SDLC 3VQIA 2JWZA 2ZEQA 3L08A 4FJYA 3OJ3A 2KC2A 3TBLD 1A5RA 3UGBB 4DHJB 3W1YA 2J0KA 2IY0B 2C5LC 5AZFA 3ML9A 5LLIA 4MGZE 2BPSA 2KKCA 2NR2A 2KK8A 4ZYNA 2PEAA 2KDEB 4EFOA 4GDKB 3QQ8B 3NZSA 2KX3A 2KFKB 2GBKA 1E8XA 2D07B 3M3JA 1OQYA 2MX2A 4ZRKA 3PRPB 4KSLC 2IO1B 3PREA 4IM3A 4WJPA 2HD5B 2XK5A 2OOBB 4TQ0A 2N4FA 2A5UA 4BKSD 3U30A 2K8BA 2HE7A 4XX5A 2IO2B 2L00B 2MBEA 2QHOA 2GBNA 2N9PC 3JYUA 4W9DA 2JF5A 1JRUA 1OGWA 1Z2MA 3H9DA 2DYMA 4ICUA 3UIPB 2CU1A 3UIOB 3PHWB 3VDZA 3PTFC 2KN5A 4MELA 2KFKA 4I6PA 4MH0E 2FCSA 3PT2B 2M17A 3V62A 3PV1A 1V2YA 1L7YA 1T0YA 3ZNZB 5CTRC 4BKSA 5HKHA 4ICVA 2IZVB 3JVZX 3T9LA 1V6EA 4JQWC 1LFDA 3V60A 3R7QA 2KMCA 4GIVA 3VH4B 1YD8U 4GN1A 1RLFA 2K6DB 4IWPA 2LVQA 4WJOA 3RT3B 3VUYA 2WDTB 2O6VB 1UZXB 2V4LA 2M0XA 3ZNHB 4AP4C 2G3QB 4IUMB 1S3SG 2BYEA 2V3SA 1P98A 3A4SC 4GDLB 3PRZA 2ZPYA 1ZW7A 2BKRB 1V81A 4G11A 1S1QB 3IFWB 1TGZB 3AU4A 4WJNA 2V1YA 5DPWA 1RFAA 1WJ6A 3PRMB 2JZZA 3MTNB 3R3MA 4II2B 1RAXA 2KWCA 1P3QU 2LGDA 1XD3B 2D10A 2C7HA 2Y5BB 2OJRA 4KIKA 3WAPA 5D6JB 4ZRJA 4IWQA 1MG8A 4MSMB 1E5WA 2KTRB 2MCNB 2IO3B 5DPTA 4B95A 2JPHA 3DDCB 2CR5A 2LVPA 3QIJA 1YJ1A 1IPGA 3A1QB 2MA9B 4GOCA 1WXSA 2N1WA 4LJPB 4JIOU 5CHVC 2JRHA 3L0WB 4KSKC 3K9PB 2K39A 2GBRA 4ASWC 3PSEB 4EUTA 2Z0DB 1U4AA 2AYOB 4MM3A 1PQSA 2C60A 4OVVA 3WA0A 2L8JA 1D3ZA 5LXHA 1M94A 5E6OA 2N9EB 3QA8A 4K1RB 3LJ3A 3U7DA 3VH3B 3ZLZA 2BWFA 4DWFA 2LUEA 4TQ1A 2DX5B 4M8NA 2G4SA 5JH5C 2JY6A 2K1FA 4IM0A 3VTUA 5JHBA 2KMAA 3TL5A 1E8ZA 3TMPB 3A9KB 3M63B 4NY0A 2LWPA 1WX9A 2N7EA 3DVNV 3ML8A 2M4NA 5CHFA 1XT9B 4E74A 2DZMA 2XBBC 3CSTA 3VHTC 3VUWA 4ANWA 4BFRA 2EKEC 4EZJA 5CX3A 3CMMB 4I6NB 3ZVVA 1J19A 1WR6E 3SHQA 4BVUC 1IP9A 1Z5SB 4EEWA 3M62B 3ZIMA 3KUDB 3EC8A 2ZZPB 3A9KA 4YL8A 1WIAA 2JZ3B 2KC1A 2MBQA 4HCPB 1WY8A 1TBEA 2K8CA 3N3KB 3OAWA 1QZEA 2IO0B 2JT4B 3DVGY 1WGRA 3WANA 2MLBA 1C1YB 2UWQA 2LGYA 4E3CA 3DBSA 1KM7A 1X1MA 2R2OA 3C0RB 4DK5A 2GOWA 3H7PB 3QHTA 2K8HA 3IG3A 2NPTB 3UQAA 1V5TA 4BOSC 3KVFB 2KZRA 3ONSA 4M0WB 2C7MB 1FXTB 4PS8A 3VAWA 5E6PA 1E90A 4DHJD 4XC2A 4DXAB 3TJPA 2ZNVB 2JUOA 3IVFA 4GSWA 5D7GA 2RPQA 5BO4B 4HDQA 1EO6A 2D11A 5LXIB 1OTRB 3NZUA 3HM3A 3UQBA 4GU2A 1I35A 2D2QA 1ZGUB 3ENEA 4ZDVA 3A4RA 2KJHB 1LXDA 3GOEA 3NHEB 1UBQA 1Q1OA 2ASQA 4LDTB 2DENB 2FAZA 5DCNA 2ZPNA 3V6EB 2L05A 2KXJA 1E8YA 2BYFA 4AOFA 3VFKA 1UGMA 1G6JA 5DPSA 2NBVB 2IYDB 1V9JA 3VUXA 1SIFA 5AZGA 4W9HA 4GDKA 2MP2B 2NS5A 1RRBA 3L13A 1V80A 4G50A 4TV3A 3RULA 2FUHB 2N1VA 4J6IA 5C1ZA 5IA7A 3QARA 2RD0A 2ZVNA 3BINA 2MBHA 3RZFA 2N7DA 2KJRA 2REXA 4AUQC 4DHZB 5E6NA 2KX0A 3B08A 3EFUA 3ECIA 4HWIB 4MGIE 2IY1B 1LM8B 1R4MI 2WX1A 1WGHA 2A4ZA 1TTNA 1C3TA 1WI0A 1GC6A 4FADA 4ZRIA 1GJZA 1V5OA 3DBLI 4B6WA 4JGHB 2GBJA 3PZDA 3QCAA 2O6VD 2MP2A 2HJ8A 3RD2A 2UYZB 3AXCA 3KUCB 3PGEA 4K7UA 4F1SA 2NBUA 4HDOA 3HHMA 1Q0WB 4KV2A 4W9EA 2FNJB 4W9JA 5D2MB 5J17A 3KH0A 2J0MA 1KLVA 4IG7B 3DBRI 2EMTA 3JSVB 3OLMD 2KFJA 3KYCD 2O6VA 3R66C 2KQSA 4GGQA 3D32A 3ZRCA 3APDA 3DOWA 3IHPC 4BBNC 1BT0A 2MW5A 4GDLA 2CHZA 3VXWA 4MJSB 1Y8RC 4XZ4A 1EUVB 2LVOA 3VVWB 1WX8A 3RZWC 4F7ZA 3ZO5B 3T8MA 3I3TB 4GXBA 1WE7A 2BGFA 2KDIA 1WJUA 4MSQB 2K6QA 1WJNA 3PVLA 3HK0A 4AJYB 4A20A 2ZJDA 4WWNA 2KOXA 2BF8B 2RR9A 2KD0A 3ZKJC 2LRWA 2WX0A 2KTRA 4EKUA 4HVBA 1OEYA 5G2NA 4MJSA 1R4NI 4AWJA 3A1QA 1WR1A 4K7SA 4W9FA 4LCDE 4A3PA 3DVGX 4DBGA 3H7SA 1J8CA 3VTVA 4E71A 1YQBA 2J0JA 3LDZE 4JLCA 3V61A 3QJZA 1ISNA 4GMVA 1WH3A 1HE8A 2CHXA 3L16A 4DHZE 2KJ6A 4K81A 4WJQA 1WGGA 5L83A 1WE6A 4PYUA 4IC7B 1WXAA 4FA6A 1VCBA 4B9KA 4MEMA 3QK0A 4NAWB 2LXAA 4FJVB 4BKGA 3QAQA 4IW0A 2CHWA 1EF5A 4HK2A 1GNUA 1SGHA 1WMHB 3AI5A 3ZNGC 2DAJA 4RM9A 3Q3JA 3GZNI 2XEWA 3ZNID 4BKTA 1F9JA 4TUUA 4MDKE 2K25A 1NBFC 2B3AA 4WAAA 3ZDMC 2O2VB 1WRDB 4NPNA 2YLMA 2AEHA 2ZVOA 1Q5WB 4JL9A 4NAWA 3ZTDA 2AL6A 3MHSD 3RYTA 1WZ3A 3WALA 2LI5A 4ANXA 1P1AA 3M95A 4LJOB 5DPRA 3WAOA 2KTFA 4F8CB 3UINB 1P0RA 2DZJA 3S2AA 2KLGA 3QC8B 4AJWA 5EDSA 2JVCA 3APCA 3L17A 4WWOA 3EHVA 3A9JB 1V49A 3RUIB 1VD2A 1WX7A 2LZ6A 3HM6X 2FCNA 5GMVA 4HXDA 4FBJB 5J18A 1UBIA 3H7PA 4HPMB 2NPTA 2WWZA 4KZCA 1CMXB 3ZUNA 4EZLA 2Z59B 5KHQA 5KHOA 2LASA 2FIDA 1WM2A 5AEKB 1WXMA 4NJ7A 4DDID 4HJKA 1TZ1A 4DDGD 3APFA 3DBHI 3W1SC 2XK5B 3K9OB 4LDTD 2GMIC 2NCNA 2PPHA 3A9JA 2LXCA 2G45B 3UF8A 1H8CA 3WIMA 3X0WA 1GC7A 2L3ZA 4M8MA 3PS6A 4N9F4 3AULA 5FR6A 2IBIB 2L0TA 4A3OA 1LQBA 2MWSB 1P9DU 5TR5A 5JHAA 2AWTA 3JW0X 4W9CA 2DYBA 4MGKE 3AU5A 1ZKHA 4EZKA 3DQVA 1AARA 2LJ5A 4W9IA 4KVGB 2KVRA 1KJTA 4FLHA 3PLUA 3CF6E 3ZW3A 5AZHA 4CYEA 2C9WB 4W9KA 3L10B 2M1MA 2I1JA 3X23A 2DZIA 2MBBB 2KHWB 4HLEA 4W9LA 4G0NB 2YVCA 2NBWB 2C7NB 3QWZB 4P7IA 3TCAA 4CO7A 2BYVE 2MSED 1NDDA 1UELA 3VTWA 3BY4B 4HPLB 3HIZA 3SD5A 5C23A 3DCGA 4KDLB 3B0AA 5CHWA 2RSUA 4PS7A 4KIKB 1IYFA 4G3XB 2ZNVC 4MGYE 2BWES 3NY5A 4NQLB 1I42A 4X57B 2MQJA 1UD7A 2L0FA 3A33B 3KUZA 2FCQA 3DVNU 3QX1A 5L95C 4NJ6A 2BKFA 2HTHA 2ZCBA 4GB9A 2Z0EB 2RGFA 3CSFA 3JSVA 3MJWA 3WAMA 1SE9A 2L7RA 3L54A 1XQQA 2NVUI 4FN2A 4WQOB 1GG3A 2G4DB 3PPAA 4PS3A 4FHJA 3RCZA 2M8SA 3KYDD 1H4RA 4FHKA 3V6CB 1WYWB 3Q3FA 2GBMA 2W9NA 4KZ0A 2DHZA 3NS8A 2KWVB 4W9GA 1OEYJ 4WWPA 3R7RA 2R2QA 3U8ZA 4ANUA 1YX5B 2CS4A 2MRPA 4I6LB 5D94A 3EECA 3ZRFA 4II3B 4IM2A 5J2RA 1WFYA 3H1UA 3IBEA 5IAAC 2LD9A 2AL3A 4RMAA 3W1SA 3P2BA 4KDIC 1WGYA 2KQ7A 1J0GA 2DYOA 1KOTA 4EOYA 2FIFA 2FCMA 2LGXA 4OVUA 2PE6B 3H6NA 2JXXA 2KLCA 3OJ4B 1WM3A 4CHKA 3ALBA 4PYZA 2L76A
chains in the Genus database with same CATH superfamily
4URKA 1L6UA 1UH6A 5JZEB 1HZ6A 2PVGC 3AV8A 2MBOA 1WGDA 2KDFB 2KNBA 3E56A 1YX6B 2LUMA 3O65B 4BOZB 1L2NA 1HQRD 3TUOA 2MJDA 2LRUA 3AEDB 3BVGA 4M01A 1IGDA 1E7UA 2N9XA 3VQIA 3OJ3A 1P7EA 2LEKA 3EGRA 1TKYA 3UGBB 2IY0B 2LMCA 3GS2A 2KYWA 4C4VA 2PEAA 2KDEB 5BYQA 3P42A 1YN3A 1PGXA 2CJOA 2HDEA 3PRPB 4KSLC 2HD5B 2EELA 4A90A 2MBEA 4W9DA 4PK1A 2JF5A 1OGWA 1Z2MA 3H9DA 2DYMA 3UIOB 3VDZA 3PTFC 2KFKA 1TZOA 3PT2B 1I4PA 1STEA 3DBHB 5IO9A 4JQWC 4L2YA 3R7QA 3U2SC 1UNSA 4IWPA 4WJOA 1ZDVA 4JWUC 1J7AA 4MT5A 2V4LA 1ZOYB 4IUMB 1J7CA 1P98A 1ZW7A 1E9MA 4G11A 4P1CC 1S1QB 3IFWB 3AU4A 2IGDA 2OHFA 5EE1A 3BIID 1WJ6A 3PRMB 4REZA 2VZKB 2LGDA 2C7HA 2Y5BB 1UWXA 3BK2A 2OJRA 2W54A 1ESFA 3GE8C 4AQ7A 1XCQL 5DPTA 1MG4A 3DDCB 4GLSC 4YTNB 2LVPA 3QIJA 2LJIA 1D5MC 1TKGA 2MEKA 4GOCA 1FRDA 3Q8EA 4LJPB 4JIOU 5CHVC 2L52A 3PSEB 4EUTA 2AYOB 2QMTA 4OVVA 3WA0A 1D3ZA 1M94A 5E6OA 2V9HA 3VH3B 2BWFA 1C4AA 1V1OA 4OW0A 2G4SA 3AE5B 2K1FA 4IM0A 2KWDA 2KMAA 3TL5A 1E8ZA 5JHBA 4WWMA 3DVNV 4RH6A 3ML8A 1C76A 2DZMA 3VHTC 4BFRA 4I6NB 3NVWA 1KFYB 1WR6E 4S17A 4ACFA 3MC8A 1IP9A 1EWYC 1XLNA 3KUDB 2BS3B 1C78A 2K8CA 4DXFA 1QZEA 2IO0B 3DVGY 3WANA 3DBSA 2R2OA 1X1MA 2NPTB 1L4DB 4M0WB 5C2TB 3VAWA 3KWLA 3Q3MC 3RNEC 2M56B 5HG2A 2ZNVB 2JUOA 4HDQA 1EO6A 2D11A 3ZJTA 2D2QA 3ENEA 1WRIA 2KJHB 3NHEB 2IDYA 3Q69A 1Q1OA 1UBQA 3IXSA 3BZDB 1OFFA 2MP2B 2NS5A 1RRBA 1V80A 2FUHB 5IA7A 2ZVNA 3BINA 3RZFA 1J7BA 2KJRA 2WXNA 3ECIA 4HWIB 1I4GA 5BMGA 1LM8B 3SEBA 3I63C 2H88B 2BS2B 1YN4A 4B6WA 3QCAA 5I4DA 2JQRB 2UYZB 3WCQA 4K7UA 4F1SA 2JYTA 2XNAC 3AE4B 4IG7B 2D3CA 3DBRI 2EMTA 1F1HA 4YTMB 3FKYA 2VZKD 3RPFC 1VR9A 4JWSC 1L0YB 1VZ7A 3DOWA 4BBNC 2MW5A 2INPE 3VVWB 1WE7A 2HTME 2KDIA 1WJNA 1TT5B 4WWNA 2KOXA 2BF8B 3ZKJC 3ZYYX 1TS3A 4EKUA 1SE4A 1OEYA 2OJWA 4AWJA 3DVGX 1J8CA 3H7SA 3VTVA 1JW9D 2J0JA 3NS1A 2J53A 1JWAD 3C19A 2WS3B 3DBRB 5IOIA 4K81A 1WGGA 4PYUA 1VLBA 1WXAA 2SAKA 1GOZA 3QK0A 4OZAA 2ONQA 3ZJVA 3Q8AA 3IAM1 4IW0A 4KX6B 3VR8B 3B9JA 3HRDD 1ZP0B 5BMHA 2BB6A 1JWUD 2K5PA 1F0ZA 2DAJA 4A9AA 4XDDA 1VDVA 3Q3JA 3ZNID 2K25A 1NBFC 4P16A 1KH0A 2O2VB 5HI1A 4NPNA 2AEHA 3T3NA 3Q3NC 2ZVOA 1Q5WB 4JL9A 3ZTDA 3WALA 3M95A 4LJOB 4YSZB 2KTFA 1TS5A 4F8CB 4AJWA 2DZJA 3S2AA 5EDSA 5IP4D 2FUG1 2TSSA 4WWOA 1VD2A 4FBJB 2NPTA 2WWZA 5KHQA 1DOYA 2LASA 1D6EC 1WXMA 4NJ7A 1MHXA 4M0WA 3VRAB 3W1SC 1XLPA 3MHZA 2GMIC 2NCNA 3AEGB 1DOIA 2PPHA 1GC7A 1SBBB 1NI3A 3AULA 4FXCA 5FR6A 3Q2AC 5TR5A 1K50A 4HROA 1D4BA 3TEYA 1AARA 2LJ5A 4W9IA 4FLHA 5E6JA 5AZHA 2LFIA 2C9WB 2K9XA 2I1JA 2MBBB 2YVCA 2NBWB 3NVVA 2BYVE 2MSED 1NDDA 2V4IB 3HIZA 3SD5A 3DHGC 1I4QA 1V1PA 4KIKB 4MGYE 1I42A 4X57B 2MQJA 2L0FA 3NZ3A 2DWQA 2B76B 3TEWA 2BKFA 5LNK1 2Y5CA 2L7RA 1XQQA 3DBLB 4DXGA 4C56C 1FRRA 4WQOB 2DLBA 3RCZA 2KWVB 3AEEB 1OEYJ 3NVYA 4ZRQA 3U8ZA 1FO4A 4M00A 1FNWA 1YX5B 2E6XA 1JWMD 2K0PA 2WDVB 3RNFC 4IM2A 5IAAC 3P2BA 2IJ0A 4KDIC 1WGYA 2KQ7A 2FIFA 2BYTA 2LGXA 4OVUA 2PE6B 4WQMA 1HA5A 3R8BA 1WM3A 4CHKA 2L76A 1XCTL 2KO3A 1WJ4A 2KDBA 2KWUB 4B0EA 2PVOD 5H92C 3AMZA 2DAFA 3PLVA 2WGSA 2WXFA 4HCNB 4KGSA 2J7QB 1YJJA 3PHXB 2KANA 4IWOA 2Y3AA 2PE9A 2K22A 3W5UB 1A70A 4TKNA 2D3BA 4C4VB 4NNJB 1YIWA 2O2VA 1F2RI 2PJHA 4N58A 3P63A 2DBYA 3TBLD 1A5RA 2L1AA 2KQ4X 3GB1A 3W1YA 2J0KA 1V8CA 3ML9A 2KACA 4ZYNA 1GB4A 4R3DA 4KGRA 3NZSA 2KFKB 1JWSD 4ZRKA 1OQRA 2IO1B 4WJPA 1Q10A 2OOBB 3R2IA 2N4FA 2J42A 4LNOA 2A5UA 4BKSD 4IOIE 3U30A 2K8BA 4XX5A 2QHOA 1C4PA 1D5XC 2GBNA 2N9PC 1QF6A 4ICUA 2BT6A 1UWMA 4I6PA 3OG5A 4BAXA 2M17A 3PV1A 1L7YA 3ZNZB 5CTRC 4BKSA 3T9LA 1LFDA 3SFDB 4GIVA 4KKJA 1YD8U 1RLFA 1NYRA 2O6VB 4AP4C 1MHHE 2V3SA 3A4SC 4GDLB 4HJGE 2ZPYA 3PRZA 4WAFA 1V81A 4RGOS 3AE8B 1EU4A 2JU6X 1F52A 1RFAA 3R3MA 1RAXA 4RGMA 2QILA 4KIKA 4IWQA 4B95A 1L0VB 4J3OD 1PYWD 1YJ1A 1IPGA 3PO0A 1WSPA 4KSKC 1SE3A 3P4SB 5LXHA 2Q5WD 2MH7A 3AM9A 4DWFA 1N62A 5G5GA 2JY6A 1EWCA 3N20C 3VTUA 4C7YA 1NYQA 3TMPB 4NY0A 2LWPA 2RPVA 1XT9B 4E74A 2XBBC 3AEFB 3CWIA 4OVZA 1YQ4B 5CX3A 3ZVVA 1WYGA 3SHQA 2QDFA 1XLOA 3EC8A 1FFUA 2ZZPB 1YJIA 4YL8A 2JZ3B 4HCPB 3VR9B 2NTTA 3N3KB 3OAWA 1WGRA 5EE0A 2UWQA 1C77A 2WXLA 3H7PB 3QHTA 2KVZA 3IG3A 3UQAA 4BOSC 4K3BA 3ONSA 1ET9A 1K51A 4XC2A 4DXAB 2WP9B 4GSWA 1N5WA 3HM3A 3UQBA 4P1BC 1ZGUB 4ZDVA 4B0MA 3GOEA 1QQRA 2ASQA 2HJ1A 2FAZA 2PMVA 2AQ2B 2L05A 1GPXA 2KXJA 2BYFA 1SEBD 1G6JA 2NBVB 1V9JA 4W9HA 3Q14C 3RULA 2J52A 1N5XA 4J6IA 1FPYA 4DHZB 2MBHA 3RNGC 3EFUA 4H2AA 4MGIE 2IY1B 1R4MI 3BYTB 3I9V1 1AW7A 4ZRIA 4JGHB 4C00A 3T3OA 2WLBA 2O6VD 3NVZA 3V3XA 4XWWA 4L23A 2I2YA 3RD2A 3PGEA 4MACA 1Q0WB 4W9EA 5J17A 1KLVA 4ZHPA 3JSVB 2O6VA 3IHPC 4XYCA 4GDLA 2PLPA 4XZ4A 1EUVB 3ZO5B 3I3TB 4GXBA 3W2DA 4HRSA 1FXAA 2V3PA 4MSQB 4AJYB 1ZDXA 1NEKB 2ZJDA 2ICIA 2WX0A 4JE3B 1YMHE 3EUB2 4MJSA 4K7SA 4W9FA 4LCDE 3V61A 2PKOA 1ISNA 2X38A 3MC0B 1TYGB 4RF1A 3L16A 1QT9A 5L83A 1ZXHA 2J4XA 1XLQA 2Y5PA 4FA6A 2LXAA 2CHWA 1EF5A 3Q6BA 4HK2A 4EE2A 2GB1A 3ZNGC 1FNVA 4LNKA 3KWVA 1HTOA 3TEZA 2Z8LA 2B3AA 3URYA 2YLMA 4ANXA 2LI5A 5DPRA 3IT6B 3BWUD 2ON8A 5C3JB 3B2FA 4RFBA 2JVCA 1F77A 3BVZA 1SE2A 3L17A 3EHVA 1T3QA 1L0XB 1V49A 2LZ6A 3HM6X 3BYYB 2FCNA 5GMVA 1IUEA 4HXDA 5J18A 1UBIA 3H7PA 2JX5A 4NJCA 4A55A 5AEKB 1RFKA 1TZ1A 3W5VB 3APFA 2RDGA 4YWGG 3TEXA 3K9OB 4C7ZA 3A9JA 3X0WA 3CIRB 3PS6A 3EA6A 1Y56A 4ARIA 2MWSB 4HKZE 2N9KA 2CJNA 2VH2A 3AU5A 1N60A 3DQVA 1V1PB 1KJTA 3SR6A 3PLUA 4PT5A 5GXGB 1FCCC 1T0RC 5EE3A 3QWZB 4P7IA 5C23A 4KDLB 2RSUA 3RNAC 1IYFA 1SJED 4YSXB 1E10A 3DHIC 4LNNA 4NQLB 4RF0A 3A33B 3KUZA 1WGKA 1QOBA 2HTHA 2ZCBA 2Z0EB 5FKAC 3JSVA 4MM3B 1K52A 2MHJA 3WAMA 1SE9A 1JROA 1E0ZA 2NVUI 4FN2A 2G4DB 4ZHOA 4FHJA 4KKIA 3C8YA 1WYWB 4KZ0A 1B9RA 4W9GA 2ACZB 1ZPSA 2KN4A 4ANUA 4XDCA 2CS4A 4I6LB 1MJDA 1QOAA 2WXPA 4KGTA 5J2RA 1WFYA 4MH8A 2QJLA 4HPPA 1KOTA 4EOYA 1D5ZC 1SF0A 1QOGA 2KLCA 2FBWB 4JX1C 4FJZA 1WZ0A 2CKHB 3AE9B 1MPEA 4N6EB 3FAHA 1WF9A 3KW5B 3TIXA 2VRRB 4K7WA 2DZKA 2EMSA 1HEZE 3NOBA 1E7VA 4RM8A 4BBNF 5G55A 1NI2A 2M19A 2D3GA 2ZCCA 3DPDA 1GUAB 1V86A 2I1KA 2K3UA 5HFYA 2JWZA 3AE7B 2KC2A 2BB5A 4DHJB 4K3CA 3I5JC 1FM0D 2BPSA 2KKCA 3BVMA 1QLBB 1C79A 4GDKB 2GBKA 1E8XA 2D07B 2MX2A 2WXJA 2L83A 4CQNA 4IM3A 3UI3A 3EFCA 2HE7A 1PGAA 2L00B 2IPKD 1QOFA 1LGRA 3U52E 1WXQA 2GRIA 3UIPB 2CU1A 2H89B 3PHWB 2KN5A 4MELA 4MH0E 2KT7A 2XN9C 2FCSA 1V2YA 4RNAA 3AE1B 5HKHA 4ICVA 2IZVB 1UUPA 1V6EA 2W55A 3V60A 3VH4B 4GN1A 2K6DB 3RT3B 2WDTB 1UZXB 2QC8A 1S3SG 2BYEA 3MC9A 1I4RA 2BKRB 4ITKA 1C9FA 3LB8C 4A8XC 5T8IA 2JZZA 3MTNB 1SB3C 1P3QU 3WAPA 5D6JB 1MG8A 2KTRB 2MCNB 2IO3B 2JPHA 3PZ8A 3A1QB 2MA9B 1WXSA 2RDBC 4BZAA 1N6ZA 2K39A 3RNBC 3DHHC 4MM3A 2C60A 2KMMA 3N1XC 4K1RB 3U7DA 1SXTA 2JSVX 3ZLZA 2DX5B 4M8NA 3N1YC 4ZYSA 2M4NA 2WQYB 2EKEC 5AUIA 3CMMB 1FEHA 3ZXRA 1RWSA 4BVUC 1L6VA 1Z5SB 3ZIMA 2G1EA 3A9KA 2MBQA 4ZRPA 1TBEA 1NENB 4L1BA 2I38A 1C1YB 1KM7A 3P1MA 2GOWA 1E6EB 1IBXB 2WXHA 3KVFB 5BMIA 1EM7A 2KZRA 2C7MB 2MJEA 1JMLA 1FMAD 5E6PA 1E90A 4DHJD 2INNE 3IVFA 1XO3A 5D7GA 2RPQA 5BO4B 5LXIB 2QIEB 4GU2A 1I35A 3P4RB 2N9LA 3A4RA 5G5HA 2V0GA 3FILB 1LXDA 3VRBB 2GI9A 1CQVA 3L4PA 4LDTB 1DYQA 3V6EB 2RDHA 4AOFA 3VFKA 3NRZA 1N61A 4N59A 5DPSA 2IYDB 2GLSA 5AZGA 4GDKA 1TY2A 3J9CA 4G50A 3RNCC 2WU5B 3QARA 2RD0A 2REXA 1VRAB 4AUQC 1TJEA 2LGIA 3NJTA 2WX1A 2G9HD 2WNMA 4NAMA 1GJZA 4D2KA 3U7ZA 3PZDA 2HJ8A 3AXCA 3V05A 3KUCB 2NBUA 1T0QC 4KV2A 4W9JA 5D2MB 1XEEA 2J0MA 1I4XA 3MFGA 4S0RA 3TSSA 1ACCA 3D32A 4LTUA 3B2GA 1BT0A 1QKZA 2CHZA 3VXWA 3GE3C 4MJSB 1WX8A 3MJ5A 3T8MA 4P6VF 2BGFA 2K6QA 1SSNA 3PVLA 2R61A 2RR9A 2KD0A 2LRWA 2KTRA 5G2NA 1R4NI 3A1QA 1WR1A 3NG0A 4E71A 4AS1A 1NVID 1YQBA 3LDZE 3AB5A 4JLCA 4WH4A 1WH3A 1HE8A 2CHXA 3OWEB 4DHZE 2KJ6A 1FNUA 3ZJUA 4WJQA 1QILA 1WE6A 1BMLC 4IC7B 4WIPA 2BBCA 3DWMA 4MEMA 1CZPA 4BKGA 3QAQA 4HKQA 1WMHB 1SGHA 5FR3A 1UF0A 1ROEA 2NMQA 3GZNI 1I4HA 4BKTA 4TUUA 3ZDMC 4HEA1 4NAWA 1R4NB 3RYTA 3Q8BA 1WZ3A 5FK9C 1P1AA 3WAOA 2WXKA 4US8A 2WHIA 1GB1A 1P0RA 2WXOA 2KLGA 1LO5D 5BYSA 3N1ZC 3A9JB 5D3DA 1ET6A 2D3AA 4YT0B 4HPMB 1IBXA 3MP9A 3ZUNA 4EZLA 3ZQ4A 4DDID 4DDGD 3DBHI 2XK5B 1FCLA 3ETRA 4LDTD 1KRHA 3GZNB 2LXCA 1AN8A 3ZGZA 2L0TA 4A3OA 1P9DU 3FILA 4LNFA 5JHAA 2AWTA 2BW2A 3JW0X 4W9CA 2DYBA 2E3TA 4EZKA 1PFDA 1SIJA 1R7SA 3U4EG 3CF6E 4CYEA 4W9KA 3L10B 3X23A 2DZIA 4HLEA 4G0NB 1T5XD 4RCOA 1UELA 3VTWA 3BY4B 3I57A 3N9YC 1E7PB 3B0AA 5CHWA 1HXYD 1WWTA 4G3XB 1L5PA 2ZNVC 1TIFA 1VJKA 3AE3B 3NUHB 4YSYB 1R4MB 3RI7C 3CSFA 3RN9C 3MJWA 3L54A 2WDRB 1KF6B 3PPAA 1JCKB 4PS3A 1ZE3D 1H4RA 4FHKA 4ZOHC 2GBMA 2W9NA 2DHZA 3NS8A 4WWPA 3AEAB 2DNFA 2MRPA 3ZRFA 4II3B 2LGSA 2LD9A 4RMAA 4LLGM 5IKCM 2DYOA 3P4QB 2FCMA 2OEDA 1V97A 4NZLB 2KHWB 1K8RB 1KTKA 1WXVA 2INDC 1ENFA 3SU8X 3ZDTA 3B1LX 3N32A 2PTLA 2JRIB 1WMHA 1KLGD 4FULA 1UGJA 4JPSA 3AECB 3N30A 4US9A 2WYQA 4OHJA 3ZTCA 1I7HA 1BUIC 1HTQA 4ANVA 3IAS1 4LNIA 3Q8CA 1E8WA 1EF1A 4NQKE 3SDLC 3L08A 2ZEQA 4FJYA 1DGJA 3DWGC 1MVKA 2C5LC 2WXRA 5AZFA 1EU3A 5LLIA 4MGZE 5IN7A 2NR2A 3RMKC 2KK8A 1B1ZA 4EFOA 5EE9A 3QQ8B 2KX3A 3M3JA 3Q3OC 1OQYA 3PREA 2XK5A 2WXIA 4TQ0A 4XWTA 2INCC 2IO2B 2N7JA 3JYUA 1JRUA 2YEPF 2FE8A 1JALA 2W3SA 3V62A 1T0YA 1TS2A 3JVZX 3Q8FA 2KMCA 2QEJC 5TSSA 3LYYA 2LVQA 3VUYA 2BTEA 3HUIA 2M0XA 3ZNHB 2IGGA 2G3QB 1MI0A 4YXDB 4ARCA 2YEPB 3HVZA 4WJNA 1TGZB 5DPWA 2V1YA 1ZUD2 1JQ4A 4II2B 2KWCA 1XD3B 2D10A 4TMAB 5BYRA 2W3RA 4A6QA 4ZRJA 4MSMB 1E5WA 1GAQB 2WXMA 2CR5A 2N1WA 4M02A 2JRHA 3L0WB 3K9PB 3AE2B 2GBRA 4ASWC 2PW9A 2Z0DB 1U4AA 1PQSA 2L8JA 2VH1A 2N9EB 3QA8A 3LJ3A 4YTPB 2LUEA 4TQ1A 5JH5C 2BS4B 2N0SB 3A9KB 3M63B 1WX9A 2N7EA 5CHFA 4OZCA 4C80A 3CSTA 4ANWA 3VUWA 1JRPA 4EZJA 3AE6B 1J19A 2ZW1A 1PDXA 2X8XX 3BK1A 1FXIA 4EEWA 3M62B 3LXFA 1MFWA 1WIAA 2KC1A 1WY8A 2AX5A 4XE0A 2JT4B 1VZ6A 2MLBA 2LGYA 4E3CA 1M4VA 2M0AA 2AQ3B 3C0RB 4DK5A 2K8HA 1V5TA 3IT4B 4XGAB 2JZPA 1FXTB 4PS8A 2NTSA 5AUKA 3TJPA 2MJ3A 1OTRB 3NZUA 1T0SC 2JYEA 2CU3A 3P4PB 1OQQA 2DENB 5DCNA 2ZPNA 4DQOC 1E8YA 1FD6A 2BVCA 1UGMA 1FFVA 1AWDA 4LK0M 2JWUA 3VUXA 1SIFA 3L13A 3FC4A 4TV3A 2N1VA 5C1ZA 3R2TA 2N7DA 1K53A 2KX0A 3B08A 5E6NA 2LHEA 1WGHA 2A4ZA 1TTNA 1C3TA 1WI0A 1GC6A 4FADA 1V5OA 3DBLI 2GBJA 3O13A 2MP2A 4QAYA 1PUTA 1TY0A 4HDOA 2UU7A 3HHMA 2FNJB 1CK1A 3KH0A 1BXTA 3OLMD 2KFJA 2LHDA 3KYCD 3R66C 2KQSA 4GGQA 1FIQA 3APDA 3ZRCA 1AYFA 1Y8RC 2LVOA 3RZWC 4F7ZA 1DOXA 1WJUA 4USAA 3HK0A 3KQ4A 4A20A 3AH7A 2L32A 1T6BX 4O1NA 4HVBA 1YQ3B 2QCZA 4DBGA 4A3PA 1F2RC 1N63A 1VZ8A 5H8YE 3QJZA 4GMVA 1HZ5A 1XF5L 4UDUC 1VCBA 4B9KA 4NAWB 4FJVB 1JWBD 1RYJA 1XXGA 4WURA 1GNUA 3AI5A 5D3IB 4RM9A 2XEWA 1F9JA 4MDKE 2WXQA 4WAAA 1WRDB 1PGBA 2AL6A 3MHSD 1RM6C 3UINB 3QC8B 3APCA 1TKEA 3RUIB 1WX7A 1C4CA 1L4ZB 3W9CB 4IKGA 3SFEB 4KZCA 1CMXB 4RGTA 4TSSA 2Z59B 5KHOA 2FIDA 1WM2A 2JXTA 3GP7A 4HJKA 1YNTE 3E9SA 2W82A 1TS4A 1YOVB 1IGCA 2V3NA 2G45B 3UF8A 1H8CA 3WIMA 2L3ZA 4M8MA 4N9F4 2AQ1B 2IBIB 2WXGA 1LQBA 3H8HA 1SJHD 4RGNA 4MGKE 1ZKHA 2WU2B 3AEBB 4KVGB 2KVRA 3ZW3A 2PIAA 2M1MA 1P7FA 5JXVA 4W9LA 2C7NB 2EKIA 3TCAA 4CO7A 3RFZB 4Q2JA 4IDIA 1CJEA 4HPLB 3DCGA 5HHDG 4PS7A 4OZBA 3KLSX 2BWES 3NY5A 1UD7A 1ZXIA 2FCQA 3DVNU 3QX1A 5L95C 4NJ6A 3HVDA 2ZW0A 1KLUD 4GB9A 2RGFA 2WDQB 3AN1A 2KDMA 1GG3A 2QSDA 2RMMA 5MPOA 2M8SA 3KYDD 3V6CB 3Q3FA 3PZ7A 3R7RA 2R2QA 5D94A 3EECA 1YN5A 3H1UA 3IBEA 3ABVB 2AL3A 3W1SA 2D5GA 2BQQA 2IGHA 1J0GA 2SEBD 3H6NA 3ZXVA 2JXXA 3OJ4B 2KAJA 3ALBA 4PYZA
chains in the Genus database with same CATH topology
2KO3A 1WZ0A 4FJZA 4URKA 1K8RB 1UH6A 1WJ4A 2KDBA 2KWUB 5JZEB 2CKHB 2MBOA 1WXVA 3ZDTA 1WF9A 3SU8X 3B1LX 1WGDA 2DAFA 3KW5B 2KDFB 2KNBA 2VRRB 3PLVA 4K7WA 3TIXA 2DZKA 2EMSA 4HCNB 3N32A 2JRIB 1WMHA 3NOBA 4FULA 2J7QB 3PHXB 1E7VA 2KANA 4RM8A 4BBNF 1YX6B 3N30A 4IWOA 1NI2A 5G55A 2WYQA 3ZTCA 3O65B 2PE9A 4BOZB 2D3GA 1L2NA 4TKNA 2LRUA 2ZCCA 4NNJB 1YIWA 2O2VA 3DPDA 1GUAB 4ANVA 1E7UA 1V86A 2I1KA 2N9XA 2PJHA 1E8WA 1EF1A 4NQKE 3SDLC 3VQIA 2JWZA 2ZEQA 3L08A 4FJYA 3OJ3A 2KC2A 3TBLD 1A5RA 3UGBB 4DHJB 3W1YA 2J0KA 2IY0B 2C5LC 5AZFA 3ML9A 5LLIA 4MGZE 2BPSA 2KKCA 2NR2A 2KK8A 4ZYNA 2PEAA 2KDEB 4EFOA 4GDKB 3QQ8B 3NZSA 2KX3A 2KFKB 2GBKA 1E8XA 2D07B 3M3JA 1OQYA 2MX2A 4ZRKA 3PRPB 4KSLC 2IO1B 3PREA 4IM3A 4WJPA 2HD5B 2XK5A 2OOBB 4TQ0A 2N4FA 2A5UA 4BKSD 3U30A 2K8BA 2HE7A 4XX5A 2IO2B 2L00B 2MBEA 2QHOA 2GBNA 2N9PC 3JYUA 4W9DA 2JF5A 1JRUA 1OGWA 1Z2MA 3H9DA 2DYMA 4ICUA 3UIPB 2CU1A 3UIOB 3PHWB 3VDZA 3PTFC 2KN5A 4MELA 2KFKA 4I6PA 4MH0E 2FCSA 3PT2B 2M17A 3V62A 3PV1A 1V2YA 1L7YA 1T0YA 3ZNZB 5CTRC 4BKSA 5HKHA 4ICVA 2IZVB 3JVZX 3T9LA 1V6EA 4JQWC 1LFDA 3V60A 3R7QA 2KMCA 4GIVA 3VH4B 1YD8U 4GN1A 1RLFA 2K6DB 4IWPA 2LVQA 4WJOA 3RT3B 3VUYA 2WDTB 2O6VB 1UZXB 2V4LA 2M0XA 3ZNHB 4AP4C 2G3QB 4IUMB 1S3SG 2BYEA 2V3SA 1P98A 3A4SC 4GDLB 3PRZA 2ZPYA 1ZW7A 2BKRB 1V81A 4G11A 1S1QB 3IFWB 1TGZB 3AU4A 4WJNA 2V1YA 5DPWA 1RFAA 1WJ6A 3PRMB 2JZZA 3MTNB 3R3MA 4II2B 1RAXA 2KWCA 1P3QU 2LGDA 1XD3B 2D10A 2C7HA 2Y5BB 2OJRA 4KIKA 3WAPA 5D6JB 4ZRJA 4IWQA 1MG8A 4MSMB 1E5WA 2KTRB 2MCNB 2IO3B 5DPTA 4B95A 2JPHA 3DDCB 2CR5A 2LVPA 3QIJA 1YJ1A 1IPGA 3A1QB 2MA9B 4GOCA 1WXSA 2N1WA 4LJPB 4JIOU 5CHVC 2JRHA 3L0WB 4KSKC 3K9PB 2K39A 2GBRA 4ASWC 3PSEB 4EUTA 2Z0DB 1U4AA 2AYOB 4MM3A 1PQSA 2C60A 4OVVA 3WA0A 2L8JA 1D3ZA 5LXHA 1M94A 5E6OA 2N9EB 3QA8A 4K1RB 3LJ3A 3U7DA 3VH3B 3ZLZA 2BWFA 4DWFA 2LUEA 4TQ1A 2DX5B 4M8NA 2G4SA 5JH5C 2JY6A 2K1FA 4IM0A 3VTUA 5JHBA 2KMAA 3TL5A 1E8ZA 3TMPB 3A9KB 3M63B 4NY0A 2LWPA 1WX9A 2N7EA 3DVNV 3ML8A 2M4NA 5CHFA 1XT9B 4E74A 2DZMA 2XBBC 3CSTA 3VHTC 3VUWA 4ANWA 4BFRA 2EKEC 4EZJA 5CX3A 3CMMB 4I6NB 3ZVVA 1J19A 1WR6E 3SHQA 4BVUC 1IP9A 1Z5SB 4EEWA 3M62B 3ZIMA 3KUDB 3EC8A 2ZZPB 3A9KA 4YL8A 1WIAA 2JZ3B 2KC1A 2MBQA 4HCPB 1WY8A 1TBEA 2K8CA 3N3KB 3OAWA 1QZEA 2IO0B 2JT4B 3DVGY 1WGRA 3WANA 2MLBA 1C1YB 2UWQA 2LGYA 4E3CA 3DBSA 1KM7A 1X1MA 2R2OA 3C0RB 4DK5A 2GOWA 3H7PB 3QHTA 2K8HA 3IG3A 2NPTB 3UQAA 1V5TA 4BOSC 3KVFB 2KZRA 3ONSA 4M0WB 2C7MB 1FXTB 4PS8A 3VAWA 5E6PA 1E90A 4DHJD 4XC2A 4DXAB 3TJPA 2ZNVB 2JUOA 3IVFA 4GSWA 5D7GA 2RPQA 5BO4B 4HDQA 1EO6A 2D11A 5LXIB 1OTRB 3NZUA 3HM3A 3UQBA 4GU2A 1I35A 2D2QA 1ZGUB 3ENEA 4ZDVA 3A4RA 2KJHB 1LXDA 3GOEA 3NHEB 1UBQA 1Q1OA 2ASQA 4LDTB 2DENB 2FAZA 5DCNA 2ZPNA 3V6EB 2L05A 2KXJA 1E8YA 2BYFA 4AOFA 3VFKA 1UGMA 1G6JA 5DPSA 2NBVB 2IYDB 1V9JA 3VUXA 1SIFA 5AZGA 4W9HA 4GDKA 2MP2B 2NS5A 1RRBA 3L13A 1V80A 4G50A 4TV3A 3RULA 2FUHB 2N1VA 4J6IA 5C1ZA 5IA7A 3QARA 2RD0A 2ZVNA 3BINA 2MBHA 3RZFA 2N7DA 2KJRA 2REXA 4AUQC 4DHZB 5E6NA 2KX0A 3B08A 3EFUA 3ECIA 4HWIB 4MGIE 2IY1B 1LM8B 1R4MI 2WX1A 1WGHA 2A4ZA 1TTNA 1C3TA 1WI0A 1GC6A 4FADA 4ZRIA 1GJZA 1V5OA 3DBLI 4B6WA 4JGHB 2GBJA 3PZDA 3QCAA 2O6VD 2MP2A 2HJ8A 3RD2A 2UYZB 3AXCA 3KUCB 3PGEA 4K7UA 4F1SA 2NBUA 4HDOA 3HHMA 1Q0WB 4KV2A 4W9EA 2FNJB 4W9JA 5D2MB 5J17A 3KH0A 2J0MA 1KLVA 4IG7B 3DBRI 2EMTA 3JSVB 3OLMD 2KFJA 3KYCD 2O6VA 3R66C 2KQSA 4GGQA 3D32A 3ZRCA 3APDA 3DOWA 3IHPC 4BBNC 1BT0A 2MW5A 4GDLA 2CHZA 3VXWA 4MJSB 1Y8RC 4XZ4A 1EUVB 2LVOA 3VVWB 1WX8A 3RZWC 4F7ZA 3ZO5B 3T8MA 3I3TB 4GXBA 1WE7A 2BGFA 2KDIA 1WJUA 4MSQB 2K6QA 1WJNA 3PVLA 3HK0A 4AJYB 4A20A 2ZJDA 4WWNA 2KOXA 2BF8B 2RR9A 2KD0A 3ZKJC 2LRWA 2WX0A 2KTRA 4EKUA 4HVBA 1OEYA 5G2NA 4MJSA 1R4NI 4AWJA 3A1QA 1WR1A 4K7SA 4W9FA 4LCDE 4A3PA 3DVGX 4DBGA 3H7SA 1J8CA 3VTVA 4E71A 1YQBA 2J0JA 3LDZE 4JLCA 3V61A 3QJZA 1ISNA 4GMVA 1WH3A 1HE8A 2CHXA 3L16A 4DHZE 2KJ6A 4K81A 4WJQA 1WGGA 5L83A 1WE6A 4PYUA 4IC7B 1WXAA 4FA6A 1VCBA 4B9KA 4MEMA 3QK0A 4NAWB 2LXAA 4FJVB 4BKGA 3QAQA 4IW0A 2CHWA 1EF5A 4HK2A 1GNUA 1SGHA 1WMHB 3AI5A 3ZNGC 2DAJA 4RM9A 3Q3JA 3GZNI 2XEWA 3ZNID 4BKTA 1F9JA 4TUUA 4MDKE 2K25A 1NBFC 2B3AA 4WAAA 3ZDMC 2O2VB 1WRDB 4NPNA 2YLMA 2AEHA 2ZVOA 1Q5WB 4JL9A 4NAWA 3ZTDA 2AL6A 3MHSD 3RYTA 1WZ3A 3WALA 2LI5A 4ANXA 1P1AA 3M95A 4LJOB 5DPRA 3WAOA 2KTFA 4F8CB 3UINB 1P0RA 2DZJA 3S2AA 2KLGA 3QC8B 4AJWA 5EDSA 2JVCA 3APCA 3L17A 4WWOA 3EHVA 3A9JB 1V49A 3RUIB 1VD2A 1WX7A 2LZ6A 3HM6X 2FCNA 5GMVA 4HXDA 4FBJB 5J18A 1UBIA 3H7PA 4HPMB 2NPTA 2WWZA 4KZCA 1CMXB 3ZUNA 4EZLA 2Z59B 5KHQA 5KHOA 2LASA 2FIDA 1WM2A 5AEKB 1WXMA 4NJ7A 4DDID 4HJKA 1TZ1A 4DDGD 3APFA 3DBHI 3W1SC 2XK5B 3K9OB 4LDTD 2GMIC 2NCNA 2PPHA 3A9JA 2LXCA 2G45B 3UF8A 1H8CA 3WIMA 3X0WA 1GC7A 2L3ZA 4M8MA 3PS6A 4N9F4 3AULA 5FR6A 2IBIB 2L0TA 4A3OA 1LQBA 2MWSB 1P9DU 5TR5A 5JHAA 2AWTA 3JW0X 4W9CA 2DYBA 4MGKE 3AU5A 1ZKHA 4EZKA 3DQVA 1AARA 2LJ5A 4W9IA 4KVGB 2KVRA 1KJTA 4FLHA 3PLUA 3CF6E 3ZW3A 5AZHA 4CYEA 2C9WB 4W9KA 3L10B 2M1MA 2I1JA 3X23A 2DZIA 2MBBB 2KHWB 4HLEA 4W9LA 4G0NB 2YVCA 2NBWB 2C7NB 3QWZB 4P7IA 3TCAA 4CO7A 2BYVE 2MSED 1NDDA 1UELA 3VTWA 3BY4B 4HPLB 3HIZA 3SD5A 5C23A 3DCGA 4KDLB 3B0AA 5CHWA 2RSUA 4PS7A 4KIKB 1IYFA 4G3XB 2ZNVC 4MGYE 2BWES 3NY5A 4NQLB 1I42A 4X57B 2MQJA 1UD7A 2L0FA 3A33B 3KUZA 2FCQA 3DVNU 3QX1A 5L95C 4NJ6A 2BKFA 2HTHA 2ZCBA 4GB9A 2Z0EB 2RGFA 3CSFA 3JSVA 3MJWA 3WAMA 1SE9A 2L7RA 3L54A 1XQQA 2NVUI 4FN2A 4WQOB 1GG3A 2G4DB 3PPAA 4PS3A 4FHJA 3RCZA 2M8SA 3KYDD 1H4RA 4FHKA 3V6CB 1WYWB 3Q3FA 2GBMA 2W9NA 4KZ0A 2DHZA 3NS8A 2KWVB 4W9GA 1OEYJ 4WWPA 3R7RA 2R2QA 3U8ZA 4ANUA 1YX5B 2CS4A 2MRPA 4I6LB 5D94A 3EECA 3ZRFA 4II3B 4IM2A 5J2RA 1WFYA 3H1UA 3IBEA 5IAAC 2LD9A 2AL3A 4RMAA 3W1SA 3P2BA 4KDIC 1WGYA 2KQ7A 1J0GA 2DYOA 1KOTA 4EOYA 2FIFA 2FCMA 2LGXA 4OVUA 2PE6B 3H6NA 2JXXA 2KLCA 3OJ4B 1WM3A 4CHKA 3ALBA 4PYZA 2L76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KO3 A;  1WZ0 A;  4FJZ A;  4URK A;  1K8R B;  1UH6 A;  1WJ4 A;  2KDB A;  2KWU B;  5JZE B;  2CKH B;  2MBO A;  1WXV A;  3ZDT A;  1WF9 A;  3SU8 X;  3B1L X;  1WGD A;  2DAF A;  3KW5 B;  2KDF B;  2KNB A;  2VRR B;  3PLV A;  4K7W A;  3TIX A;  2DZK A;  2EMS A;  4HCN B;  3N32 A;  2JRI B;  1WMH A;  3NOB A;  4FUL A;  2J7Q B;  3PHX B;  1E7V A;  2KAN A;  4RM8 A;  4BBN F;  1YX6 B;  3N30 A;  4IWO A;  1NI2 A;  5G55 A;  2WYQ A;  3ZTC A;  3O65 B;  2PE9 A;  4BOZ B;  2D3G A;  1L2N A;  4TKN A;  2LRU A;  2ZCC A;  4NNJ B;  1YIW A;  2O2V A;  3DPD A;  1GUA B;  4ANV A;  1E7U A;  1V86 A;  2I1K A;  2N9X A;  2PJH A;  1E8W A;  1EF1 A;  4NQK E;  3SDL C;  3VQI A;  2JWZ A;  2ZEQ A;  3L08 A;  4FJY A;  3OJ3 A;  2KC2 A;  3TBL D;  1A5R A;  3UGB B;  4DHJ B;  3W1Y A;  2J0K A;  2IY0 B;  2C5L C;  5AZF A;  3ML9 A;  5LLI A;  4MGZ E;  2BPS A;  2KKC A;  2NR2 A;  2KK8 A;  4ZYN A;  2PEA A;  2KDE B;  4EFO A;  4GDK B;  3QQ8 B;  3NZS A;  2KX3 A;  2KFK B;  2GBK A;  1E8X A;  2D07 B;  3M3J A;  1OQY A;  2MX2 A;  4ZRK A;  3PRP B;  4KSL C;  2IO1 B;  3PRE A;  4IM3 A;  4WJP A;  2HD5 B;  2XK5 A;  2OOB B;  4TQ0 A;  2N4F A;  2A5U A;  4BKS D;  3U30 A;  2K8B A;  2HE7 A;  4XX5 A;  2IO2 B;  2L00 B;  2MBE A;  2QHO A;  2GBN A;  2N9P C;  3JYU A;  4W9D A;  2JF5 A;  1JRU A;  1OGW A;  1Z2M A;  3H9D A;  2DYM A;  4ICU A;  3UIP B;  2CU1 A;  3UIO B;  3PHW B;  3VDZ A;  3PTF C;  2KN5 A;  4MEL A;  2KFK A;  4I6P A;  4MH0 E;  2FCS A;  3PT2 B;  2M17 A;  3V62 A;  3PV1 A;  1V2Y A;  1L7Y A;  1T0Y A;  3ZNZ B;  5CTR C;  4BKS A;  5HKH A;  4ICV A;  2IZV B;  3JVZ X;  3T9L A;  1V6E A;  4JQW C;  1LFD A;  3V60 A;  3R7Q A;  2KMC A;  4GIV A;  3VH4 B;  1YD8 U;  4GN1 A;  1RLF A;  2K6D B;  4IWP A;  2LVQ A;  4WJO A;  3RT3 B;  3VUY A;  2WDT B;  2O6V B;  1UZX B;  2V4L A;  2M0X A;  3ZNH B;  4AP4 C;  2G3Q B;  4IUM B;  1S3S G;  2BYE A;  2V3S A;  1P98 A;  3A4S C;  4GDL B;  3PRZ A;  2ZPY A;  1ZW7 A;  2BKR B;  1V81 A;  4G11 A;  1S1Q B;  3IFW B;  1TGZ B;  3AU4 A;  4WJN A;  2V1Y A;  5DPW A;  1RFA A;  1WJ6 A;  3PRM B;  2JZZ A;  3MTN B;  3R3M A;  4II2 B;  1RAX A;  2KWC A;  1P3Q U;  2LGD A;  1XD3 B;  2D10 A;  2C7H A;  2Y5B B;  2OJR A;  4KIK A;  3WAP A;  5D6J B;  4ZRJ A;  4IWQ A;  1MG8 A;  4MSM B;  1E5W A;  2KTR B;  2MCN B;  2IO3 B;  5DPT A;  4B95 A;  2JPH A;  3DDC B;  2CR5 A;  2LVP A;  3QIJ A;  1YJ1 A;  1IPG A;  3A1Q B;  2MA9 B;  4GOC A;  1WXS A;  2N1W A;  4LJP B;  4JIO U;  5CHV C;  2JRH A;  3L0W B;  4KSK C;  3K9P B;  2K39 A;  2GBR A;  4ASW C;  3PSE B;  4EUT A;  2Z0D B;  1U4A A;  2AYO B;  4MM3 A;  1PQS A;  2C60 A;  4OVV A;  3WA0 A;  2L8J A;  1D3Z A;  5LXH A;  1M94 A;  5E6O A;  2N9E B;  3QA8 A;  4K1R B;  3LJ3 A;  3U7D A;  3VH3 B;  3ZLZ A;  2BWF A;  4DWF A;  2LUE A;  4TQ1 A;  2DX5 B;  4M8N A;  2G4S A;  5JH5 C;  2JY6 A;  2K1F A;  4IM0 A;  3VTU A;  5JHB A;  2KMA A;  3TL5 A;  1E8Z A;  3TMP B;  3A9K B;  3M63 B;  4NY0 A;  2LWP A;  1WX9 A;  2N7E A;  3DVN V;  3ML8 A;  2M4N A;  5CHF A;  1XT9 B;  4E74 A;  2DZM A;  2XBB C;  3CST A;  3VHT C;  3VUW A;  4ANW A;  4BFR A;  2EKE C;  4EZJ A;  5CX3 A;  3CMM B;  4I6N B;  3ZVV A;  1J19 A;  1WR6 E;  3SHQ A;  4BVU C;  1IP9 A;  1Z5S B;  4EEW A;  3M62 B;  3ZIM A;  3KUD B;  3EC8 A;  2ZZP B;  3A9K A;  4YL8 A;  1WIA A;  2JZ3 B;  2KC1 A;  2MBQ A;  4HCP B;  1WY8 A;  1TBE A;  2K8C A;  3N3K B;  3OAW A;  1QZE A;  2IO0 B;  2JT4 B;  3DVG Y;  1WGR A;  3WAN A;  2MLB A;  1C1Y B;  2UWQ A;  2LGY A;  4E3C A;  3DBS A;  1KM7 A;  1X1M A;  2R2O A;  3C0R B;  4DK5 A;  2GOW A;  3H7P B;  3QHT A;  2K8H A;  3IG3 A;  2NPT B;  3UQA A;  1V5T A;  4BOS C;  3KVF B;  2KZR A;  3ONS A;  4M0W B;  2C7M B;  1FXT B;  4PS8 A;  3VAW A;  5E6P A;  1E90 A;  4DHJ D;  4XC2 A;  4DXA B;  3TJP A;  2ZNV B;  2JUO A;  3IVF A;  4GSW A;  5D7G A;  2RPQ A;  5BO4 B;  4HDQ A;  1EO6 A;  2D11 A;  5LXI B;  1OTR B;  3NZU A;  3HM3 A;  3UQB A;  4GU2 A;  1I35 A;  2D2Q A;  1ZGU B;  3ENE A;  4ZDV A;  3A4R A;  2KJH B;  1LXD A;  3GOE A;  3NHE B;  1UBQ A;  1Q1O A;  2ASQ A;  4LDT B;  2DEN B;  2FAZ A;  5DCN A;  2ZPN A;  3V6E B;  2L05 A;  2KXJ A;  1E8Y A;  2BYF A;  4AOF A;  3VFK A;  1UGM A;  1G6J A;  5DPS A;  2NBV B;  2IYD B;  1V9J A;  3VUX A;  1SIF A;  5AZG A;  4W9H A;  4GDK A;  2MP2 B;  2NS5 A;  1RRB A;  3L13 A;  1V80 A;  4G50 A;  4TV3 A;  3RUL A;  2FUH B;  2N1V A;  4J6I A;  5C1Z A;  5IA7 A;  3QAR A;  2RD0 A;  2ZVN A;  3BIN A;  2MBH A;  3RZF A;  2N7D A;  2KJR A;  2REX A;  4AUQ C;  4DHZ B;  5E6N A;  2KX0 A;  3B08 A;  3EFU A;  3ECI A;  4HWI B;  4MGI E;  2IY1 B;  1LM8 B;  1R4M I;  2WX1 A;  1WGH A;  2A4Z A;  1TTN A;  1C3T A;  1WI0 A;  1GC6 A;  4FAD A;  4ZRI A;  1GJZ A;  1V5O A;  3DBL I;  4B6W A;  4JGH B;  2GBJ A;  3PZD A;  3QCA A;  2O6V D;  2MP2 A;  2HJ8 A;  3RD2 A;  2UYZ B;  3AXC A;  3KUC B;  3PGE A;  4K7U A;  4F1S A;  2NBU A;  4HDO A;  3HHM A;  1Q0W B;  4KV2 A;  4W9E A;  2FNJ B;  4W9J A;  5D2M B;  5J17 A;  3KH0 A;  2J0M A;  1KLV A;  4IG7 B;  3DBR I;  2EMT A;  3JSV B;  3OLM D;  2KFJ A;  3KYC D;  2O6V A;  3R66 C;  2KQS A;  4GGQ A;  3D32 A;  3ZRC A;  3APD A;  3DOW A;  3IHP C;  4BBN C;  1BT0 A;  2MW5 A;  4GDL A;  2CHZ A;  3VXW A;  4MJS B;  1Y8R C;  4XZ4 A;  1EUV B;  2LVO A;  3VVW B;  1WX8 A;  3RZW C;  4F7Z A;  3ZO5 B;  3T8M A;  3I3T B;  4GXB A;  1WE7 A;  2BGF A;  2KDI A;  1WJU A;  4MSQ B;  2K6Q A;  1WJN A;  3PVL A;  3HK0 A;  4AJY B;  4A20 A;  2ZJD A;  4WWN A;  2KOX A;  2BF8 B;  2RR9 A;  2KD0 A;  3ZKJ C;  2LRW A;  2WX0 A;  2KTR A;  4EKU A;  4HVB A;  1OEY A;  5G2N A;  4MJS A;  1R4N I;  4AWJ A;  3A1Q A;  1WR1 A;  4K7S A;  4W9F A;  4LCD E;  4A3P A;  3DVG X;  4DBG A;  3H7S A;  1J8C A;  3VTV A;  4E71 A;  1YQB A;  2J0J A;  3LDZ E;  4JLC A;  3V61 A;  3QJZ A;  1ISN A;  4GMV A;  1WH3 A;  1HE8 A;  2CHX A;  3L16 A;  4DHZ E;  2KJ6 A;  4K81 A;  4WJQ A;  1WGG A;  5L83 A;  1WE6 A;  4PYU A;  4IC7 B;  1WXA A;  4FA6 A;  1VCB A;  4B9K A;  4MEM A;  3QK0 A;  4NAW B;  2LXA A;  4FJV B;  4BKG A;  3QAQ A;  4IW0 A;  2CHW A;  1EF5 A;  4HK2 A;  1GNU A;  1SGH A;  1WMH B;  3AI5 A;  3ZNG C;  2DAJ A;  4RM9 A;  3Q3J A;  3GZN I;  2XEW A;  3ZNI D;  4BKT A;  1F9J A;  4TUU A;  4MDK E;  2K25 A;  1NBF C;  2B3A A;  4WAA A;  3ZDM C;  2O2V B;  1WRD B;  4NPN A;  2YLM A;  2AEH A;  2ZVO A;  1Q5W B;  4JL9 A;  4NAW A;  3ZTD A;  2AL6 A;  3MHS D;  3RYT A;  1WZ3 A;  3WAL A;  2LI5 A;  4ANX A;  1P1A A;  3M95 A;  4LJO B;  5DPR A;  3WAO A;  2KTF A;  4F8C B;  3UIN B;  1P0R A;  2DZJ A;  3S2A A;  2KLG A;  3QC8 B;  4AJW A;  5EDS A;  2JVC A;  3APC A;  3L17 A;  4WWO A;  3EHV A;  3A9J B;  1V49 A;  3RUI B;  1VD2 A;  1WX7 A;  2LZ6 A;  3HM6 X;  2FCN A;  5GMV A;  4HXD A;  4FBJ B;  5J18 A;  1UBI A;  3H7P A;  4HPM B;  2NPT A;  2WWZ A;  4KZC A;  1CMX B;  3ZUN A;  4EZL A;  2Z59 B;  5KHQ A;  5KHO A;  2LAS A;  2FID A;  1WM2 A;  5AEK B;  1WXM A;  4NJ7 A;  4DDI D;  4HJK A;  1TZ1 A;  4DDG D;  3APF A;  3DBH I;  3W1S C;  2XK5 B;  3K9O B;  4LDT D;  2GMI C;  2NCN A;  2PPH A;  3A9J A;  2LXC A;  2G45 B;  3UF8 A;  1H8C A;  3WIM A;  3X0W A;  1GC7 A;  2L3Z A;  4M8M A;  3PS6 A;  4N9F 4;  3AUL A;  5FR6 A;  2IBI B;  2L0T A;  4A3O A;  1LQB A;  2MWS B;  1P9D U;  5TR5 A;  5JHA A;  2AWT A;  3JW0 X;  4W9C A;  2DYB A;  4MGK E;  3AU5 A;  1ZKH A;  4EZK A;  3DQV A;  1AAR A;  2LJ5 A;  4W9I A;  4KVG B;  2KVR A;  1KJT A;  4FLH A;  3PLU A;  3CF6 E;  3ZW3 A;  5AZH A;  4CYE A;  2C9W B;  4W9K A;  3L10 B;  2M1M A;  2I1J A;  3X23 A;  2DZI A;  2MBB B;  2KHW B;  4HLE A;  4W9L A;  4G0N B;  2YVC A;  2NBW B;  2C7N B;  3QWZ B;  4P7I A;  3TCA A;  4CO7 A;  2BYV E;  2MSE D;  1NDD A;  1UEL A;  3VTW A;  3BY4 B;  4HPL B;  3HIZ A;  3SD5 A;  5C23 A;  3DCG A;  4KDL B;  3B0A A;  5CHW A;  2RSU A;  4PS7 A;  4KIK B;  1IYF A;  4G3X B;  2ZNV C;  4MGY E;  2BWE S;  3NY5 A;  4NQL B;  1I42 A;  4X57 B;  2MQJ A;  1UD7 A;  2L0F A;  3A33 B;  3KUZ A;  2FCQ A;  3DVN U;  3QX1 A;  5L95 C;  4NJ6 A;  2BKF A;  2HTH A;  2ZCB A;  4GB9 A;  2Z0E B;  2RGF A;  3CSF A;  3JSV A;  3MJW A;  3WAM A;  1SE9 A;  2L7R A;  3L54 A;  1XQQ A;  2NVU I;  4FN2 A;  4WQO B;  1GG3 A;  2G4D B;  3PPA A;  4PS3 A;  4FHJ A;  3RCZ A;  2M8S A;  3KYD D;  1H4R A;  4FHK A;  3V6C B;  1WYW B;  3Q3F A;  2GBM A;  2W9N A;  4KZ0 A;  2DHZ A;  3NS8 A;  2KWV B;  4W9G A;  1OEY J;  4WWP A;  3R7R A;  2R2Q A;  3U8Z A;  4ANU A;  1YX5 B;  2CS4 A;  2MRP A;  4I6L B;  5D94 A;  3EEC A;  3ZRF A;  4II3 B;  4IM2 A;  5J2R A;  1WFY A;  3H1U A;  3IBE A;  5IAA C;  2LD9 A;  2AL3 A;  4RMA A;  3W1S A;  3P2B A;  4KDI C;  1WGY A;  2KQ7 A;  1J0G A;  2DYO A;  1KOT A;  4EOY A;  2FIF A;  2FCM A;  2LGX A;  4OVU A;  2PE6 B;  3H6N A;  2JXX A;  2KLC A;  3OJ4 B;  1WM3 A;  4CHK A;  3ALB A;  4PYZ A;  2L76 A; 
#chains in the Genus database with same CATH topology
 4URK A;  1L6U A;  1UH6 A;  5JZE B;  1HZ6 A;  2PVG C;  3AV8 A;  2MBO A;  1WGD A;  2KDF B;  2KNB A;  3E56 A;  1YX6 B;  2LUM A;  3O65 B;  4BOZ B;  1L2N A;  1HQR D;  3TUO A;  2MJD A;  2LRU A;  3AED B;  3BVG A;  4M01 A;  1IGD A;  1E7U A;  2N9X A;  3VQI A;  3OJ3 A;  1P7E A;  2LEK A;  3EGR A;  1TKY A;  3UGB B;  2IY0 B;  2LMC A;  3GS2 A;  2KYW A;  4C4V A;  2PEA A;  2KDE B;  5BYQ A;  3P42 A;  1YN3 A;  1PGX A;  2CJO A;  2HDE A;  3PRP B;  4KSL C;  2HD5 B;  2EEL A;  4A90 A;  2MBE A;  4W9D A;  4PK1 A;  2JF5 A;  1OGW A;  1Z2M A;  3H9D A;  2DYM A;  3UIO B;  3VDZ A;  3PTF C;  2KFK A;  1TZO A;  3PT2 B;  1I4P A;  1STE A;  3DBH B;  5IO9 A;  4JQW C;  4L2Y A;  3R7Q A;  3U2S C;  1UNS A;  4IWP A;  4WJO A;  1ZDV A;  4JWU C;  1J7A A;  4MT5 A;  2V4L A;  1ZOY B;  4IUM B;  1J7C A;  1P98 A;  1ZW7 A;  1E9M A;  4G11 A;  4P1C C;  1S1Q B;  3IFW B;  3AU4 A;  2IGD A;  2OHF A;  5EE1 A;  3BII D;  1WJ6 A;  3PRM B;  4REZ A;  2VZK B;  2LGD A;  2C7H A;  2Y5B B;  1UWX A;  3BK2 A;  2OJR A;  2W54 A;  1ESF A;  3GE8 C;  4AQ7 A;  1XCQ L;  5DPT A;  1MG4 A;  3DDC B;  4GLS C;  4YTN B;  2LVP A;  3QIJ A;  2LJI A;  1D5M C;  1TKG A;  2MEK A;  4GOC A;  1FRD A;  3Q8E A;  4LJP B;  4JIO U;  5CHV C;  2L52 A;  3PSE B;  4EUT A;  2AYO B;  2QMT A;  4OVV A;  3WA0 A;  1D3Z A;  1M94 A;  5E6O A;  2V9H A;  3VH3 B;  2BWF A;  1C4A A;  1V1O A;  4OW0 A;  2G4S A;  3AE5 B;  2K1F A;  4IM0 A;  2KWD A;  2KMA A;  3TL5 A;  1E8Z A;  5JHB A;  4WWM A;  3DVN V;  4RH6 A;  3ML8 A;  1C76 A;  2DZM A;  3VHT C;  4BFR A;  4I6N B;  3NVW A;  1KFY B;  1WR6 E;  4S17 A;  4ACF A;  3MC8 A;  1IP9 A;  1EWY C;  1XLN A;  3KUD B;  2BS3 B;  1C78 A;  2K8C A;  4DXF A;  1QZE A;  2IO0 B;  3DVG Y;  3WAN A;  3DBS A;  2R2O A;  1X1M A;  2NPT B;  1L4D B;  4M0W B;  5C2T B;  3VAW A;  3KWL A;  3Q3M C;  3RNE C;  2M56 B;  5HG2 A;  2ZNV B;  2JUO A;  4HDQ A;  1EO6 A;  2D11 A;  3ZJT A;  2D2Q A;  3ENE A;  1WRI A;  2KJH B;  3NHE B;  2IDY A;  3Q69 A;  1Q1O A;  1UBQ A;  3IXS A;  3BZD B;  1OFF A;  2MP2 B;  2NS5 A;  1RRB A;  1V80 A;  2FUH B;  5IA7 A;  2ZVN A;  3BIN A;  3RZF A;  1J7B A;  2KJR A;  2WXN A;  3ECI A;  4HWI B;  1I4G A;  5BMG A;  1LM8 B;  3SEB A;  3I63 C;  2H88 B;  2BS2 B;  1YN4 A;  4B6W A;  3QCA A;  5I4D A;  2JQR B;  2UYZ B;  3WCQ A;  4K7U A;  4F1S A;  2JYT A;  2XNA C;  3AE4 B;  4IG7 B;  2D3C A;  3DBR I;  2EMT A;  1F1H A;  4YTM B;  3FKY A;  2VZK D;  3RPF C;  1VR9 A;  4JWS C;  1L0Y B;  1VZ7 A;  3DOW A;  4BBN C;  2MW5 A;  2INP E;  3VVW B;  1WE7 A;  2HTM E;  2KDI A;  1WJN A;  1TT5 B;  4WWN A;  2KOX A;  2BF8 B;  3ZKJ C;  3ZYY X;  1TS3 A;  4EKU A;  1SE4 A;  1OEY A;  2OJW A;  4AWJ A;  3DVG X;  1J8C A;  3H7S A;  3VTV A;  1JW9 D;  2J0J A;  3NS1 A;  2J53 A;  1JWA D;  3C19 A;  2WS3 B;  3DBR B;  5IOI A;  4K81 A;  1WGG A;  4PYU A;  1VLB A;  1WXA A;  2SAK A;  1GOZ A;  3QK0 A;  4OZA A;  2ONQ A;  3ZJV A;  3Q8A A;  3IAM 1;  4IW0 A;  4KX6 B;  3VR8 B;  3B9J A;  3HRD D;  1ZP0 B;  5BMH A;  2BB6 A;  1JWU D;  2K5P A;  1F0Z A;  2DAJ A;  4A9A A;  4XDD A;  1VDV A;  3Q3J A;  3ZNI D;  2K25 A;  1NBF C;  4P16 A;  1KH0 A;  2O2V B;  5HI1 A;  4NPN A;  2AEH A;  3T3N A;  3Q3N C;  2ZVO A;  1Q5W B;  4JL9 A;  3ZTD A;  3WAL A;  3M95 A;  4LJO B;  4YSZ B;  2KTF A;  1TS5 A;  4F8C B;  4AJW A;  2DZJ A;  3S2A A;  5EDS A;  5IP4 D;  2FUG 1;  2TSS A;  4WWO A;  1VD2 A;  4FBJ B;  2NPT A;  2WWZ A;  5KHQ A;  1DOY A;  2LAS A;  1D6E C;  1WXM A;  4NJ7 A;  1MHX A;  4M0W A;  3VRA B;  3W1S C;  1XLP A;  3MHZ A;  2GMI C;  2NCN A;  3AEG B;  1DOI A;  2PPH A;  1GC7 A;  1SBB B;  1NI3 A;  3AUL A;  4FXC A;  5FR6 A;  3Q2A C;  5TR5 A;  1K50 A;  4HRO A;  1D4B A;  3TEY A;  1AAR A;  2LJ5 A;  4W9I A;  4FLH A;  5E6J A;  5AZH A;  2LFI A;  2C9W B;  2K9X A;  2I1J A;  2MBB B;  2YVC A;  2NBW B;  3NVV A;  2BYV E;  2MSE D;  1NDD A;  2V4I B;  3HIZ A;  3SD5 A;  3DHG C;  1I4Q A;  1V1P A;  4KIK B;  4MGY E;  1I42 A;  4X57 B;  2MQJ A;  2L0F A;  3NZ3 A;  2DWQ A;  2B76 B;  3TEW A;  2BKF A;  5LNK 1;  2Y5C A;  2L7R A;  1XQQ A;  3DBL B;  4DXG A;  4C56 C;  1FRR A;  4WQO B;  2DLB A;  3RCZ A;  2KWV B;  3AEE B;  1OEY J;  3NVY A;  4ZRQ A;  3U8Z A;  1FO4 A;  4M00 A;  1FNW A;  1YX5 B;  2E6X A;  1JWM D;  2K0P A;  2WDV B;  3RNF C;  4IM2 A;  5IAA C;  3P2B A;  2IJ0 A;  4KDI C;  1WGY A;  2KQ7 A;  2FIF A;  2BYT A;  2LGX A;  4OVU A;  2PE6 B;  4WQM A;  1HA5 A;  3R8B A;  1WM3 A;  4CHK A;  2L76 A;  1XCT L;  2KO3 A;  1WJ4 A;  2KDB A;  2KWU B;  4B0E A;  2PVO D;  5H92 C;  3AMZ A;  2DAF A;  3PLV A;  2WGS A;  2WXF A;  4HCN B;  4KGS A;  2J7Q B;  1YJJ A;  3PHX B;  2KAN A;  4IWO A;  2Y3A A;  2PE9 A;  2K22 A;  3W5U B;  1A70 A;  4TKN A;  2D3B A;  4C4V B;  4NNJ B;  1YIW A;  2O2V A;  1F2R I;  2PJH A;  4N58 A;  3P63 A;  2DBY A;  3TBL D;  1A5R A;  2L1A A;  2KQ4 X;  3GB1 A;  3W1Y A;  2J0K A;  1V8C A;  3ML9 A;  2KAC A;  4ZYN A;  1GB4 A;  4R3D A;  4KGR A;  3NZS A;  2KFK B;  1JWS D;  4ZRK A;  1OQR A;  2IO1 B;  4WJP A;  1Q10 A;  2OOB B;  3R2I A;  2N4F A;  2J42 A;  4LNO A;  2A5U A;  4BKS D;  4IOI E;  3U30 A;  2K8B A;  4XX5 A;  2QHO A;  1C4P A;  1D5X C;  2GBN A;  2N9P C;  1QF6 A;  4ICU A;  2BT6 A;  1UWM A;  4I6P A;  3OG5 A;  4BAX A;  2M17 A;  3PV1 A;  1L7Y A;  3ZNZ B;  5CTR C;  4BKS A;  3T9L A;  1LFD A;  3SFD B;  4GIV A;  4KKJ A;  1YD8 U;  1RLF A;  1NYR A;  2O6V B;  4AP4 C;  1MHH E;  2V3S A;  3A4S C;  4GDL B;  4HJG E;  2ZPY A;  3PRZ A;  4WAF A;  1V81 A;  4RGO S;  3AE8 B;  1EU4 A;  2JU6 X;  1F52 A;  1RFA A;  3R3M A;  1RAX A;  4RGM A;  2QIL A;  4KIK A;  4IWQ A;  4B95 A;  1L0V B;  4J3O D;  1PYW D;  1YJ1 A;  1IPG A;  3PO0 A;  1WSP A;  4KSK C;  1SE3 A;  3P4S B;  5LXH A;  2Q5W D;  2MH7 A;  3AM9 A;  4DWF A;  1N62 A;  5G5G A;  2JY6 A;  1EWC A;  3N20 C;  3VTU A;  4C7Y A;  1NYQ A;  3TMP B;  4NY0 A;  2LWP A;  2RPV A;  1XT9 B;  4E74 A;  2XBB C;  3AEF B;  3CWI A;  4OVZ A;  1YQ4 B;  5CX3 A;  3ZVV A;  1WYG A;  3SHQ A;  2QDF A;  1XLO A;  3EC8 A;  1FFU A;  2ZZP B;  1YJI A;  4YL8 A;  2JZ3 B;  4HCP B;  3VR9 B;  2NTT A;  3N3K B;  3OAW A;  1WGR A;  5EE0 A;  2UWQ A;  1C77 A;  2WXL A;  3H7P B;  3QHT A;  2KVZ A;  3IG3 A;  3UQA A;  4BOS C;  4K3B A;  3ONS A;  1ET9 A;  1K51 A;  4XC2 A;  4DXA B;  2WP9 B;  4GSW A;  1N5W A;  3HM3 A;  3UQB A;  4P1B C;  1ZGU B;  4ZDV A;  4B0M A;  3GOE A;  1QQR A;  2ASQ A;  2HJ1 A;  2FAZ A;  2PMV A;  2AQ2 B;  2L05 A;  1GPX A;  2KXJ A;  2BYF A;  1SEB D;  1G6J A;  2NBV B;  1V9J A;  4W9H A;  3Q14 C;  3RUL A;  2J52 A;  1N5X A;  4J6I A;  1FPY A;  4DHZ B;  2MBH A;  3RNG C;  3EFU A;  4H2A A;  4MGI E;  2IY1 B;  1R4M I;  3BYT B;  3I9V 1;  1AW7 A;  4ZRI A;  4JGH B;  4C00 A;  3T3O A;  2WLB A;  2O6V D;  3NVZ A;  3V3X A;  4XWW A;  4L23 A;  2I2Y A;  3RD2 A;  3PGE A;  4MAC A;  1Q0W B;  4W9E A;  5J17 A;  1KLV A;  4ZHP A;  3JSV B;  2O6V A;  3IHP C;  4XYC A;  4GDL A;  2PLP A;  4XZ4 A;  1EUV B;  3ZO5 B;  3I3T B;  4GXB A;  3W2D A;  4HRS A;  1FXA A;  2V3P A;  4MSQ B;  4AJY B;  1ZDX A;  1NEK B;  2ZJD A;  2ICI A;  2WX0 A;  4JE3 B;  1YMH E;  3EUB 2;  4MJS A;  4K7S A;  4W9F A;  4LCD E;  3V61 A;  2PKO A;  1ISN A;  2X38 A;  3MC0 B;  1TYG B;  4RF1 A;  3L16 A;  1QT9 A;  5L83 A;  1ZXH A;  2J4X A;  1XLQ A;  2Y5P A;  4FA6 A;  2LXA A;  2CHW A;  1EF5 A;  3Q6B A;  4HK2 A;  4EE2 A;  2GB1 A;  3ZNG C;  1FNV A;  4LNK A;  3KWV A;  1HTO A;  3TEZ A;  2Z8L A;  2B3A A;  3URY A;  2YLM A;  4ANX A;  2LI5 A;  5DPR A;  3IT6 B;  3BWU D;  2ON8 A;  5C3J B;  3B2F A;  4RFB A;  2JVC A;  1F77 A;  3BVZ A;  1SE2 A;  3L17 A;  3EHV A;  1T3Q A;  1L0X B;  1V49 A;  2LZ6 A;  3HM6 X;  3BYY B;  2FCN A;  5GMV A;  1IUE A;  4HXD A;  5J18 A;  1UBI A;  3H7P A;  2JX5 A;  4NJC A;  4A55 A;  5AEK B;  1RFK A;  1TZ1 A;  3W5V B;  3APF A;  2RDG A;  4YWG G;  3TEX A;  3K9O B;  4C7Z A;  3A9J A;  3X0W A;  3CIR B;  3PS6 A;  3EA6 A;  1Y56 A;  4ARI A;  2MWS B;  4HKZ E;  2N9K A;  2CJN A;  2VH2 A;  3AU5 A;  1N60 A;  3DQV A;  1V1P B;  1KJT A;  3SR6 A;  3PLU A;  4PT5 A;  5GXG B;  1FCC C;  1T0R C;  5EE3 A;  3QWZ B;  4P7I A;  5C23 A;  4KDL B;  2RSU A;  3RNA C;  1IYF A;  1SJE D;  4YSX B;  1E10 A;  3DHI C;  4LNN A;  4NQL B;  4RF0 A;  3A33 B;  3KUZ A;  1WGK A;  1QOB A;  2HTH A;  2ZCB A;  2Z0E B;  5FKA C;  3JSV A;  4MM3 B;  1K52 A;  2MHJ A;  3WAM A;  1SE9 A;  1JRO A;  1E0Z A;  2NVU I;  4FN2 A;  2G4D B;  4ZHO A;  4FHJ A;  4KKI A;  3C8Y A;  1WYW B;  4KZ0 A;  1B9R A;  4W9G A;  2ACZ B;  1ZPS A;  2KN4 A;  4ANU A;  4XDC A;  2CS4 A;  4I6L B;  1MJD A;  1QOA A;  2WXP A;  4KGT A;  5J2R A;  1WFY A;  4MH8 A;  2QJL A;  4HPP A;  1KOT A;  4EOY A;  1D5Z C;  1SF0 A;  1QOG A;  2KLC A;  2FBW B;  4JX1 C;  4FJZ A;  1WZ0 A;  2CKH B;  3AE9 B;  1MPE A;  4N6E B;  3FAH A;  1WF9 A;  3KW5 B;  3TIX A;  2VRR B;  4K7W A;  2DZK A;  2EMS A;  1HEZ E;  3NOB A;  1E7V A;  4RM8 A;  4BBN F;  5G55 A;  1NI2 A;  2M19 A;  2D3G A;  2ZCC A;  3DPD A;  1GUA B;  1V86 A;  2I1K A;  2K3U A;  5HFY A;  2JWZ A;  3AE7 B;  2KC2 A;  2BB5 A;  4DHJ B;  4K3C A;  3I5J C;  1FM0 D;  2BPS A;  2KKC A;  3BVM A;  1QLB B;  1C79 A;  4GDK B;  2GBK A;  1E8X A;  2D07 B;  2MX2 A;  2WXJ A;  2L83 A;  4CQN A;  4IM3 A;  3UI3 A;  3EFC A;  2HE7 A;  1PGA A;  2L00 B;  2IPK D;  1QOF A;  1LGR A;  3U52 E;  1WXQ A;  2GRI A;  3UIP B;  2CU1 A;  2H89 B;  3PHW B;  2KN5 A;  4MEL A;  4MH0 E;  2KT7 A;  2XN9 C;  2FCS A;  1V2Y A;  4RNA A;  3AE1 B;  5HKH A;  4ICV A;  2IZV B;  1UUP A;  1V6E A;  2W55 A;  3V60 A;  3VH4 B;  4GN1 A;  2K6D B;  3RT3 B;  2WDT B;  1UZX B;  2QC8 A;  1S3S G;  2BYE A;  3MC9 A;  1I4R A;  2BKR B;  4ITK A;  1C9F A;  3LB8 C;  4A8X C;  5T8I A;  2JZZ A;  3MTN B;  1SB3 C;  1P3Q U;  3WAP A;  5D6J B;  1MG8 A;  2KTR B;  2MCN B;  2IO3 B;  2JPH A;  3PZ8 A;  3A1Q B;  2MA9 B;  1WXS A;  2RDB C;  4BZA A;  1N6Z A;  2K39 A;  3RNB C;  3DHH C;  4MM3 A;  2C60 A;  2KMM A;  3N1X C;  4K1R B;  3U7D A;  1SXT A;  2JSV X;  3ZLZ A;  2DX5 B;  4M8N A;  3N1Y C;  4ZYS A;  2M4N A;  2WQY B;  2EKE C;  5AUI A;  3CMM B;  1FEH A;  3ZXR A;  1RWS A;  4BVU C;  1L6V A;  1Z5S B;  3ZIM A;  2G1E A;  3A9K A;  2MBQ A;  4ZRP A;  1TBE A;  1NEN B;  4L1B A;  2I38 A;  1C1Y B;  1KM7 A;  3P1M A;  2GOW A;  1E6E B;  1IBX B;  2WXH A;  3KVF B;  5BMI A;  1EM7 A;  2KZR A;  2C7M B;  2MJE A;  1JML A;  1FMA D;  5E6P A;  1E90 A;  4DHJ D;  2INN E;  3IVF A;  1XO3 A;  5D7G A;  2RPQ A;  5BO4 B;  5LXI B;  2QIE B;  4GU2 A;  1I35 A;  3P4R B;  2N9L A;  3A4R A;  5G5H A;  2V0G A;  3FIL B;  1LXD A;  3VRB B;  2GI9 A;  1CQV A;  3L4P A;  4LDT B;  1DYQ A;  3V6E B;  2RDH A;  4AOF A;  3VFK A;  3NRZ A;  1N61 A;  4N59 A;  5DPS A;  2IYD B;  2GLS A;  5AZG A;  4GDK A;  1TY2 A;  3J9C A;  4G50 A;  3RNC C;  2WU5 B;  3QAR A;  2RD0 A;  2REX A;  1VRA B;  4AUQ C;  1TJE A;  2LGI A;  3NJT A;  2WX1 A;  2G9H D;  2WNM A;  4NAM A;  1GJZ A;  4D2K A;  3U7Z A;  3PZD A;  2HJ8 A;  3AXC A;  3V05 A;  3KUC B;  2NBU A;  1T0Q C;  4KV2 A;  4W9J A;  5D2M B;  1XEE A;  2J0M A;  1I4X A;  3MFG A;  4S0R A;  3TSS A;  1ACC A;  3D32 A;  4LTU A;  3B2G A;  1BT0 A;  1QKZ A;  2CHZ A;  3VXW A;  3GE3 C;  4MJS B;  1WX8 A;  3MJ5 A;  3T8M A;  4P6V F;  2BGF A;  2K6Q A;  1SSN A;  3PVL A;  2R61 A;  2RR9 A;  2KD0 A;  2LRW A;  2KTR A;  5G2N A;  1R4N I;  3A1Q A;  1WR1 A;  3NG0 A;  4E71 A;  4AS1 A;  1NVI D;  1YQB A;  3LDZ E;  3AB5 A;  4JLC A;  4WH4 A;  1WH3 A;  1HE8 A;  2CHX A;  3OWE B;  4DHZ E;  2KJ6 A;  1FNU A;  3ZJU A;  4WJQ A;  1QIL A;  1WE6 A;  1BML C;  4IC7 B;  4WIP A;  2BBC A;  3DWM A;  4MEM A;  1CZP A;  4BKG A;  3QAQ A;  4HKQ A;  1WMH B;  1SGH A;  5FR3 A;  1UF0 A;  1ROE A;  2NMQ A;  3GZN I;  1I4H A;  4BKT A;  4TUU A;  3ZDM C;  4HEA 1;  4NAW A;  1R4N B;  3RYT A;  3Q8B A;  1WZ3 A;  5FK9 C;  1P1A A;  3WAO A;  2WXK A;  4US8 A;  2WHI A;  1GB1 A;  1P0R A;  2WXO A;  2KLG A;  1LO5 D;  5BYS A;  3N1Z C;  3A9J B;  5D3D A;  1ET6 A;  2D3A A;  4YT0 B;  4HPM B;  1IBX A;  3MP9 A;  3ZUN A;  4EZL A;  3ZQ4 A;  4DDI D;  4DDG D;  3DBH I;  2XK5 B;  1FCL A;  3ETR A;  4LDT D;  1KRH A;  3GZN B;  2LXC A;  1AN8 A;  3ZGZ A;  2L0T A;  4A3O A;  1P9D U;  3FIL A;  4LNF A;  5JHA A;  2AWT A;  2BW2 A;  3JW0 X;  4W9C A;  2DYB A;  2E3T A;  4EZK A;  1PFD A;  1SIJ A;  1R7S A;  3U4E G;  3CF6 E;  4CYE A;  4W9K A;  3L10 B;  3X23 A;  2DZI A;  4HLE A;  4G0N B;  1T5X D;  4RCO A;  1UEL A;  3VTW A;  3BY4 B;  3I57 A;  3N9Y C;  1E7P B;  3B0A A;  5CHW A;  1HXY D;  1WWT A;  4G3X B;  1L5P A;  2ZNV C;  1TIF A;  1VJK A;  3AE3 B;  3NUH B;  4YSY B;  1R4M B;  3RI7 C;  3CSF A;  3RN9 C;  3MJW A;  3L54 A;  2WDR B;  1KF6 B;  3PPA A;  1JCK B;  4PS3 A;  1ZE3 D;  1H4R A;  4FHK A;  4ZOH C;  2GBM A;  2W9N A;  2DHZ A;  3NS8 A;  4WWP A;  3AEA B;  2DNF A;  2MRP A;  3ZRF A;  4II3 B;  2LGS A;  2LD9 A;  4RMA A;  4LLG M;  5IKC M;  2DYO A;  3P4Q B;  2FCM A;  2OED A;  1V97 A;  4NZL B;  2KHW B;  1K8R B;  1KTK A;  1WXV A;  2IND C;  1ENF A;  3SU8 X;  3ZDT A;  3B1L X;  3N32 A;  2PTL A;  2JRI B;  1WMH A;  1KLG D;  4FUL A;  1UGJ A;  4JPS A;  3AEC B;  3N30 A;  4US9 A;  2WYQ A;  4OHJ A;  3ZTC A;  1I7H A;  1BUI C;  1HTQ A;  4ANV A;  3IAS 1;  4LNI A;  3Q8C A;  1E8W A;  1EF1 A;  4NQK E;  3SDL C;  3L08 A;  2ZEQ A;  4FJY A;  1DGJ A;  3DWG C;  1MVK A;  2C5L C;  2WXR A;  5AZF A;  1EU3 A;  5LLI A;  4MGZ E;  5IN7 A;  2NR2 A;  3RMK C;  2KK8 A;  1B1Z A;  4EFO A;  5EE9 A;  3QQ8 B;  2KX3 A;  3M3J A;  3Q3O C;  1OQY A;  3PRE A;  2XK5 A;  2WXI A;  4TQ0 A;  4XWT A;  2INC C;  2IO2 B;  2N7J A;  3JYU A;  1JRU A;  2YEP F;  2FE8 A;  1JAL A;  2W3S A;  3V62 A;  1T0Y A;  1TS2 A;  3JVZ X;  3Q8F A;  2KMC A;  2QEJ C;  5TSS A;  3LYY A;  2LVQ A;  3VUY A;  2BTE A;  3HUI A;  2M0X A;  3ZNH B;  2IGG A;  2G3Q B;  1MI0 A;  4YXD B;  4ARC A;  2YEP B;  3HVZ A;  4WJN A;  1TGZ B;  5DPW A;  2V1Y A;  1ZUD 2;  1JQ4 A;  4II2 B;  2KWC A;  1XD3 B;  2D10 A;  4TMA B;  5BYR A;  2W3R A;  4A6Q A;  4ZRJ A;  4MSM B;  1E5W A;  1GAQ B;  2WXM A;  2CR5 A;  2N1W A;  4M02 A;  2JRH A;  3L0W B;  3K9P B;  3AE2 B;  2GBR A;  4ASW C;  2PW9 A;  2Z0D B;  1U4A A;  1PQS A;  2L8J A;  2VH1 A;  2N9E B;  3QA8 A;  3LJ3 A;  4YTP B;  2LUE A;  4TQ1 A;  5JH5 C;  2BS4 B;  2N0S B;  3A9K B;  3M63 B;  1WX9 A;  2N7E A;  5CHF A;  4OZC A;  4C80 A;  3CST A;  4ANW A;  3VUW A;  1JRP A;  4EZJ A;  3AE6 B;  1J19 A;  2ZW1 A;  1PDX A;  2X8X X;  3BK1 A;  1FXI A;  4EEW A;  3M62 B;  3LXF A;  1MFW A;  1WIA A;  2KC1 A;  1WY8 A;  2AX5 A;  4XE0 A;  2JT4 B;  1VZ6 A;  2MLB A;  2LGY A;  4E3C A;  1M4V A;  2M0A A;  2AQ3 B;  3C0R B;  4DK5 A;  2K8H A;  1V5T A;  3IT4 B;  4XGA B;  2JZP A;  1FXT B;  4PS8 A;  2NTS A;  5AUK A;  3TJP A;  2MJ3 A;  1OTR B;  3NZU A;  1T0S C;  2JYE A;  2CU3 A;  3P4P B;  1OQQ A;  2DEN B;  5DCN A;  2ZPN A;  4DQO C;  1E8Y A;  1FD6 A;  2BVC A;  1UGM A;  1FFV A;  1AWD A;  4LK0 M;  2JWU A;  3VUX A;  1SIF A;  3L13 A;  3FC4 A;  4TV3 A;  2N1V A;  5C1Z A;  3R2T A;  2N7D A;  1K53 A;  2KX0 A;  3B08 A;  5E6N A;  2LHE A;  1WGH A;  2A4Z A;  1TTN A;  1C3T A;  1WI0 A;  1GC6 A;  4FAD A;  1V5O A;  3DBL I;  2GBJ A;  3O13 A;  2MP2 A;  4QAY A;  1PUT A;  1TY0 A;  4HDO A;  2UU7 A;  3HHM A;  2FNJ B;  1CK1 A;  3KH0 A;  1BXT A;  3OLM D;  2KFJ A;  2LHD A;  3KYC D;  3R66 C;  2KQS A;  4GGQ A;  1FIQ A;  3APD A;  3ZRC A;  1AYF A;  1Y8R C;  2LVO A;  3RZW C;  4F7Z A;  1DOX A;  1WJU A;  4USA A;  3HK0 A;  3KQ4 A;  4A20 A;  3AH7 A;  2L32 A;  1T6B X;  4O1N A;  4HVB A;  1YQ3 B;  2QCZ A;  4DBG A;  4A3P A;  1F2R C;  1N63 A;  1VZ8 A;  5H8Y E;  3QJZ A;  4GMV A;  1HZ5 A;  1XF5 L;  4UDU C;  1VCB A;  4B9K A;  4NAW B;  4FJV B;  1JWB D;  1RYJ A;  1XXG A;  4WUR A;  1GNU A;  3AI5 A;  5D3I B;  4RM9 A;  2XEW A;  1F9J A;  4MDK E;  2WXQ A;  4WAA A;  1WRD B;  1PGB A;  2AL6 A;  3MHS D;  1RM6 C;  3UIN B;  3QC8 B;  3APC A;  1TKE A;  3RUI B;  1WX7 A;  1C4C A;  1L4Z B;  3W9C B;  4IKG A;  3SFE B;  4KZC A;  1CMX B;  4RGT A;  4TSS A;  2Z59 B;  5KHO A;  2FID A;  1WM2 A;  2JXT A;  3GP7 A;  4HJK A;  1YNT E;  3E9S A;  2W82 A;  1TS4 A;  1YOV B;  1IGC A;  2V3N A;  2G45 B;  3UF8 A;  1H8C A;  3WIM A;  2L3Z A;  4M8M A;  4N9F 4;  2AQ1 B;  2IBI B;  2WXG A;  1LQB A;  3H8H A;  1SJH D;  4RGN A;  4MGK E;  1ZKH A;  2WU2 B;  3AEB B;  4KVG B;  2KVR A;  3ZW3 A;  2PIA A;  2M1M A;  1P7F A;  5JXV A;  4W9L A;  2C7N B;  2EKI A;  3TCA A;  4CO7 A;  3RFZ B;  4Q2J A;  4IDI A;  1CJE A;  4HPL B;  3DCG A;  5HHD G;  4PS7 A;  4OZB A;  3KLS X;  2BWE S;  3NY5 A;  1UD7 A;  1ZXI A;  2FCQ A;  3DVN U;  3QX1 A;  5L95 C;  4NJ6 A;  3HVD A;  2ZW0 A;  1KLU D;  4GB9 A;  2RGF A;  2WDQ B;  3AN1 A;  2KDM A;  1GG3 A;  2QSD A;  2RMM A;  5MPO A;  2M8S A;  3KYD D;  3V6C B;  3Q3F A;  3PZ7 A;  3R7R A;  2R2Q A;  5D94 A;  3EEC A;  1YN5 A;  3H1U A;  3IBE A;  3ABV B;  2AL3 A;  3W1S A;  2D5G A;  2BQQ A;  2IGH A;  1J0G A;  2SEB D;  3H6N A;  3ZXV A;  2JXX A;  3OJ4 B;  2KAJ A;  3ALB A;  4PYZ A; 
#chains in the Genus database with same CATH homology
 2KO3 A;  1WZ0 A;  4FJZ A;  4URK A;  1K8R B;  1UH6 A;  1WJ4 A;  2KDB A;  2KWU B;  5JZE B;  2CKH B;  2MBO A;  1WXV A;  3ZDT A;  1WF9 A;  3SU8 X;  3B1L X;  1WGD A;  2DAF A;  3KW5 B;  2KDF B;  2KNB A;  2VRR B;  3PLV A;  4K7W A;  3TIX A;  2DZK A;  2EMS A;  4HCN B;  3N32 A;  2JRI B;  1WMH A;  3NOB A;  4FUL A;  2J7Q B;  3PHX B;  1E7V A;  2KAN A;  4RM8 A;  4BBN F;  1YX6 B;  3N30 A;  4IWO A;  1NI2 A;  5G55 A;  2WYQ A;  3ZTC A;  3O65 B;  2PE9 A;  4BOZ B;  2D3G A;  1L2N A;  4TKN A;  2LRU A;  2ZCC A;  4NNJ B;  1YIW A;  2O2V A;  3DPD A;  1GUA B;  4ANV A;  1E7U A;  1V86 A;  2I1K A;  2N9X A;  2PJH A;  1E8W A;  1EF1 A;  4NQK E;  3SDL C;  3VQI A;  2JWZ A;  2ZEQ A;  3L08 A;  4FJY A;  3OJ3 A;  2KC2 A;  3TBL D;  1A5R A;  3UGB B;  4DHJ B;  3W1Y A;  2J0K A;  2IY0 B;  2C5L C;  5AZF A;  3ML9 A;  5LLI A;  4MGZ E;  2BPS A;  2KKC A;  2NR2 A;  2KK8 A;  4ZYN A;  2PEA A;  2KDE B;  4EFO A;  4GDK B;  3QQ8 B;  3NZS A;  2KX3 A;  2KFK B;  2GBK A;  1E8X A;  2D07 B;  3M3J A;  1OQY A;  2MX2 A;  4ZRK A;  3PRP B;  4KSL C;  2IO1 B;  3PRE A;  4IM3 A;  4WJP A;  2HD5 B;  2XK5 A;  2OOB B;  4TQ0 A;  2N4F A;  2A5U A;  4BKS D;  3U30 A;  2K8B A;  2HE7 A;  4XX5 A;  2IO2 B;  2L00 B;  2MBE A;  2QHO A;  2GBN A;  2N9P C;  3JYU A;  4W9D A;  2JF5 A;  1JRU A;  1OGW A;  1Z2M A;  3H9D A;  2DYM A;  4ICU A;  3UIP B;  2CU1 A;  3UIO B;  3PHW B;  3VDZ A;  3PTF C;  2KN5 A;  4MEL A;  2KFK A;  4I6P A;  4MH0 E;  2FCS A;  3PT2 B;  2M17 A;  3V62 A;  3PV1 A;  1V2Y A;  1L7Y A;  1T0Y A;  3ZNZ B;  5CTR C;  4BKS A;  5HKH A;  4ICV A;  2IZV B;  3JVZ X;  3T9L A;  1V6E A;  4JQW C;  1LFD A;  3V60 A;  3R7Q A;  2KMC A;  4GIV A;  3VH4 B;  1YD8 U;  4GN1 A;  1RLF A;  2K6D B;  4IWP A;  2LVQ A;  4WJO A;  3RT3 B;  3VUY A;  2WDT B;  2O6V B;  1UZX B;  2V4L A;  2M0X A;  3ZNH B;  4AP4 C;  2G3Q B;  4IUM B;  1S3S G;  2BYE A;  2V3S A;  1P98 A;  3A4S C;  4GDL B;  3PRZ A;  2ZPY A;  1ZW7 A;  2BKR B;  1V81 A;  4G11 A;  1S1Q B;  3IFW B;  1TGZ B;  3AU4 A;  4WJN A;  2V1Y A;  5DPW A;  1RFA A;  1WJ6 A;  3PRM B;  2JZZ A;  3MTN B;  3R3M A;  4II2 B;  1RAX A;  2KWC A;  1P3Q U;  2LGD A;  1XD3 B;  2D10 A;  2C7H A;  2Y5B B;  2OJR A;  4KIK A;  3WAP A;  5D6J B;  4ZRJ A;  4IWQ A;  1MG8 A;  4MSM B;  1E5W A;  2KTR B;  2MCN B;  2IO3 B;  5DPT A;  4B95 A;  2JPH A;  3DDC B;  2CR5 A;  2LVP A;  3QIJ A;  1YJ1 A;  1IPG A;  3A1Q B;  2MA9 B;  4GOC A;  1WXS A;  2N1W A;  4LJP B;  4JIO U;  5CHV C;  2JRH A;  3L0W B;  4KSK C;  3K9P B;  2K39 A;  2GBR A;  4ASW C;  3PSE B;  4EUT A;  2Z0D B;  1U4A A;  2AYO B;  4MM3 A;  1PQS A;  2C60 A;  4OVV A;  3WA0 A;  2L8J A;  1D3Z A;  5LXH A;  1M94 A;  5E6O A;  2N9E B;  3QA8 A;  4K1R B;  3LJ3 A;  3U7D A;  3VH3 B;  3ZLZ A;  2BWF A;  4DWF A;  2LUE A;  4TQ1 A;  2DX5 B;  4M8N A;  2G4S A;  5JH5 C;  2JY6 A;  2K1F A;  4IM0 A;  3VTU A;  5JHB A;  2KMA A;  3TL5 A;  1E8Z A;  3TMP B;  3A9K B;  3M63 B;  4NY0 A;  2LWP A;  1WX9 A;  2N7E A;  3DVN V;  3ML8 A;  2M4N A;  5CHF A;  1XT9 B;  4E74 A;  2DZM A;  2XBB C;  3CST A;  3VHT C;  3VUW A;  4ANW A;  4BFR A;  2EKE C;  4EZJ A;  5CX3 A;  3CMM B;  4I6N B;  3ZVV A;  1J19 A;  1WR6 E;  3SHQ A;  4BVU C;  1IP9 A;  1Z5S B;  4EEW A;  3M62 B;  3ZIM A;  3KUD B;  3EC8 A;  2ZZP B;  3A9K A;  4YL8 A;  1WIA A;  2JZ3 B;  2KC1 A;  2MBQ A;  4HCP B;  1WY8 A;  1TBE A;  2K8C A;  3N3K B;  3OAW A;  1QZE A;  2IO0 B;  2JT4 B;  3DVG Y;  1WGR A;  3WAN A;  2MLB A;  1C1Y B;  2UWQ A;  2LGY A;  4E3C A;  3DBS A;  1KM7 A;  1X1M A;  2R2O A;  3C0R B;  4DK5 A;  2GOW A;  3H7P B;  3QHT A;  2K8H A;  3IG3 A;  2NPT B;  3UQA A;  1V5T A;  4BOS C;  3KVF B;  2KZR A;  3ONS A;  4M0W B;  2C7M B;  1FXT B;  4PS8 A;  3VAW A;  5E6P A;  1E90 A;  4DHJ D;  4XC2 A;  4DXA B;  3TJP A;  2ZNV B;  2JUO A;  3IVF A;  4GSW A;  5D7G A;  2RPQ A;  5BO4 B;  4HDQ A;  1EO6 A;  2D11 A;  5LXI B;  1OTR B;  3NZU A;  3HM3 A;  3UQB A;  4GU2 A;  1I35 A;  2D2Q A;  1ZGU B;  3ENE A;  4ZDV A;  3A4R A;  2KJH B;  1LXD A;  3GOE A;  3NHE B;  1UBQ A;  1Q1O A;  2ASQ A;  4LDT B;  2DEN B;  2FAZ A;  5DCN A;  2ZPN A;  3V6E B;  2L05 A;  2KXJ A;  1E8Y A;  2BYF A;  4AOF A;  3VFK A;  1UGM A;  1G6J A;  5DPS A;  2NBV B;  2IYD B;  1V9J A;  3VUX A;  1SIF A;  5AZG A;  4W9H A;  4GDK A;  2MP2 B;  2NS5 A;  1RRB A;  3L13 A;  1V80 A;  4G50 A;  4TV3 A;  3RUL A;  2FUH B;  2N1V A;  4J6I A;  5C1Z A;  5IA7 A;  3QAR A;  2RD0 A;  2ZVN A;  3BIN A;  2MBH A;  3RZF A;  2N7D A;  2KJR A;  2REX A;  4AUQ C;  4DHZ B;  5E6N A;  2KX0 A;  3B08 A;  3EFU A;  3ECI A;  4HWI B;  4MGI E;  2IY1 B;  1LM8 B;  1R4M I;  2WX1 A;  1WGH A;  2A4Z A;  1TTN A;  1C3T A;  1WI0 A;  1GC6 A;  4FAD A;  4ZRI A;  1GJZ A;  1V5O A;  3DBL I;  4B6W A;  4JGH B;  2GBJ A;  3PZD A;  3QCA A;  2O6V D;  2MP2 A;  2HJ8 A;  3RD2 A;  2UYZ B;  3AXC A;  3KUC B;  3PGE A;  4K7U A;  4F1S A;  2NBU A;  4HDO A;  3HHM A;  1Q0W B;  4KV2 A;  4W9E A;  2FNJ B;  4W9J A;  5D2M B;  5J17 A;  3KH0 A;  2J0M A;  1KLV A;  4IG7 B;  3DBR I;  2EMT A;  3JSV B;  3OLM D;  2KFJ A;  3KYC D;  2O6V A;  3R66 C;  2KQS A;  4GGQ A;  3D32 A;  3ZRC A;  3APD A;  3DOW A;  3IHP C;  4BBN C;  1BT0 A;  2MW5 A;  4GDL A;  2CHZ A;  3VXW A;  4MJS B;  1Y8R C;  4XZ4 A;  1EUV B;  2LVO A;  3VVW B;  1WX8 A;  3RZW C;  4F7Z A;  3ZO5 B;  3T8M A;  3I3T B;  4GXB A;  1WE7 A;  2BGF A;  2KDI A;  1WJU A;  4MSQ B;  2K6Q A;  1WJN A;  3PVL A;  3HK0 A;  4AJY B;  4A20 A;  2ZJD A;  4WWN A;  2KOX A;  2BF8 B;  2RR9 A;  2KD0 A;  3ZKJ C;  2LRW A;  2WX0 A;  2KTR A;  4EKU A;  4HVB A;  1OEY A;  5G2N A;  4MJS A;  1R4N I;  4AWJ A;  3A1Q A;  1WR1 A;  4K7S A;  4W9F A;  4LCD E;  4A3P A;  3DVG X;  4DBG A;  3H7S A;  1J8C A;  3VTV A;  4E71 A;  1YQB A;  2J0J A;  3LDZ E;  4JLC A;  3V61 A;  3QJZ A;  1ISN A;  4GMV A;  1WH3 A;  1HE8 A;  2CHX A;  3L16 A;  4DHZ E;  2KJ6 A;  4K81 A;  4WJQ A;  1WGG A;  5L83 A;  1WE6 A;  4PYU A;  4IC7 B;  1WXA A;  4FA6 A;  1VCB A;  4B9K A;  4MEM A;  3QK0 A;  4NAW B;  2LXA A;  4FJV B;  4BKG A;  3QAQ A;  4IW0 A;  2CHW A;  1EF5 A;  4HK2 A;  1GNU A;  1SGH A;  1WMH B;  3AI5 A;  3ZNG C;  2DAJ A;  4RM9 A;  3Q3J A;  3GZN I;  2XEW A;  3ZNI D;  4BKT A;  1F9J A;  4TUU A;  4MDK E;  2K25 A;  1NBF C;  2B3A A;  4WAA A;  3ZDM C;  2O2V B;  1WRD B;  4NPN A;  2YLM A;  2AEH A;  2ZVO A;  1Q5W B;  4JL9 A;  4NAW A;  3ZTD A;  2AL6 A;  3MHS D;  3RYT A;  1WZ3 A;  3WAL A;  2LI5 A;  4ANX A;  1P1A A;  3M95 A;  4LJO B;  5DPR A;  3WAO A;  2KTF A;  4F8C B;  3UIN B;  1P0R A;  2DZJ A;  3S2A A;  2KLG A;  3QC8 B;  4AJW A;  5EDS A;  2JVC A;  3APC A;  3L17 A;  4WWO A;  3EHV A;  3A9J B;  1V49 A;  3RUI B;  1VD2 A;  1WX7 A;  2LZ6 A;  3HM6 X;  2FCN A;  5GMV A;  4HXD A;  4FBJ B;  5J18 A;  1UBI A;  3H7P A;  4HPM B;  2NPT A;  2WWZ A;  4KZC A;  1CMX B;  3ZUN A;  4EZL A;  2Z59 B;  5KHQ A;  5KHO A;  2LAS A;  2FID A;  1WM2 A;  5AEK B;  1WXM A;  4NJ7 A;  4DDI D;  4HJK A;  1TZ1 A;  4DDG D;  3APF A;  3DBH I;  3W1S C;  2XK5 B;  3K9O B;  4LDT D;  2GMI C;  2NCN A;  2PPH A;  3A9J A;  2LXC A;  2G45 B;  3UF8 A;  1H8C A;  3WIM A;  3X0W A;  1GC7 A;  2L3Z A;  4M8M A;  3PS6 A;  4N9F 4;  3AUL A;  5FR6 A;  2IBI B;  2L0T A;  4A3O A;  1LQB A;  2MWS B;  1P9D U;  5TR5 A;  5JHA A;  2AWT A;  3JW0 X;  4W9C A;  2DYB A;  4MGK E;  3AU5 A;  1ZKH A;  4EZK A;  3DQV A;  1AAR A;  2LJ5 A;  4W9I A;  4KVG B;  2KVR A;  1KJT A;  4FLH A;  3PLU A;  3CF6 E;  3ZW3 A;  5AZH A;  4CYE A;  2C9W B;  4W9K A;  3L10 B;  2M1M A;  2I1J A;  3X23 A;  2DZI A;  2MBB B;  2KHW B;  4HLE A;  4W9L A;  4G0N B;  2YVC A;  2NBW B;  2C7N B;  3QWZ B;  4P7I A;  3TCA A;  4CO7 A;  2BYV E;  2MSE D;  1NDD A;  1UEL A;  3VTW A;  3BY4 B;  4HPL B;  3HIZ A;  3SD5 A;  5C23 A;  3DCG A;  4KDL B;  3B0A A;  5CHW A;  2RSU A;  4PS7 A;  4KIK B;  1IYF A;  4G3X B;  2ZNV C;  4MGY E;  2BWE S;  3NY5 A;  4NQL B;  1I42 A;  4X57 B;  2MQJ A;  1UD7 A;  2L0F A;  3A33 B;  3KUZ A;  2FCQ A;  3DVN U;  3QX1 A;  5L95 C;  4NJ6 A;  2BKF A;  2HTH A;  2ZCB A;  4GB9 A;  2Z0E B;  2RGF A;  3CSF A;  3JSV A;  3MJW A;  3WAM A;  1SE9 A;  2L7R A;  3L54 A;  1XQQ A;  2NVU I;  4FN2 A;  4WQO B;  1GG3 A;  2G4D B;  3PPA A;  4PS3 A;  4FHJ A;  3RCZ A;  2M8S A;  3KYD D;  1H4R A;  4FHK A;  3V6C B;  1WYW B;  3Q3F A;  2GBM A;  2W9N A;  4KZ0 A;  2DHZ A;  3NS8 A;  2KWV B;  4W9G A;  1OEY J;  4WWP A;  3R7R A;  2R2Q A;  3U8Z A;  4ANU A;  1YX5 B;  2CS4 A;  2MRP A;  4I6L B;  5D94 A;  3EEC A;  3ZRF A;  4II3 B;  4IM2 A;  5J2R A;  1WFY A;  3H1U A;  3IBE A;  5IAA C;  2LD9 A;  2AL3 A;  4RMA A;  3W1S A;  3P2B A;  4KDI C;  1WGY A;  2KQ7 A;  1J0G A;  2DYO A;  1KOT A;  4EOY A;  2FIF A;  2FCM A;  2LGX A;  4OVU A;  2PE6 B;  3H6N A;  2JXX A;  2KLC A;  3OJ4 B;  1WM3 A;  4CHK A;  3ALB A;  4PYZ A;  2L76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...