1CZPA

Anabaena pcc7119 [2fe-2s] ferredoxin in the reduced and oxixized state at 1.17 a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined X-ray structures of the oxidized, at 1.3 A, and reduced, at 1.17 A, [2Fe-2S] ferredoxin from the cyanobacterium Anabaena PCC7119 show redox-linked conformational changes.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords FERREDOXIN I
total genus 25
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1czpA00
5C2TB 1TKGA 4C7YA 1XO3A 1RM6C 2K5PA 5EE3A 5H8YE 1PUTA 3SFEB 2MJDA 2LEKA 1RWSA 3DWGC 3SFDB 1I7HA 1WWTA 1JWBD 1L6VA 1NVID 1TKYA 2PKOA 1XLPA 3AMZA 4WWMA 1GPXA 4P6VF 4IDIA 5AUIA 5GXGB 1J7AA 4YSZB 2MJ3A 1ZOYB 2QJLA 5EE1A 3NS1A 3WCQA 1UWMA 3W5UB 2B76B 3AE8B 3P4SB 3SR6A 1L0VB 3P4QB 2PVGC 1TKEA 1EWYC 1OQRA 1ZXIA 4YSXB 3AE5B 2JX5A 2BS4B 3FAHA 2PVOD 3AE1B 3KWLA 3EUB2 5EE9A 4JWUC 1QOAA 3NVVA 1V8CA 1AYFA 4YTNB 1SB3C 2WS3B 3NVWA 4HRSA 3AM9A 1FIQA 2MJEA 2WDRB 1N60A 1XLOA 2WDQB 3AE2B 3AE9B 1N61A 2KMMA 2DWQA 3W5VB 1PDXA 1QF6A 3P4RB 1ROEA 3W9CB 1JW9D 4N59A 4WQMA 2MH7A 3AE4B 3FC4A 1CJEA 4N58A 4US8A 1QLBB 2G1EA 1DGJA 1QOBA 3B2GA 3B9JA 4A9AA 2WQYB 1N63A 1WYGA 4ZHOA 5MPOA 3NRZA 1FMAD 2L83A 2FBWB 1ZP0B 1J7BA 2WU5B 4US9A 2W3RA 1NEKB 1WRIA 1L6UA 3ABVB 1FRRA 1RFKA 2PIAA 4YT0B 3CWIA 1QT9A 1E0ZA 1R7SA 1RYJA 4YTPB 1N5XA 2Q5WD 2H89B 4JWSC 4C80A 2L52A 3LXFA 5AUKA 1FFVA 4C7ZA 2ACZB 1VLBA 1KF6B 1OFFA 3P63A 1N5WA 1NYQA 3ETRA 1YQ4B 1SF0A 2W3SA 3AEGB 1VDVA 2M19A 3P1MA 2E3TA 1TYGB 4N6EB 3RPFC 1NENB 4FXCA 2K22A 1E9MA 1NI3A 1WXQA 1TJEA 3AH7A 4LTUA 2OHFA 1JALA 3NVYA 3AE7B 2CJOA 3AN1A 3B2FA 1DOXA 3AEFB 3CIRB 4ZOHC 4ZHPA 1ZUD2 3AEDB 1J7CA 1FXIA 1XLNA 3AEAB 1YJJA 2WLBA 3AECB 3AE3B 1FXAA 3L4PA 1FRDA 3P4PB 5EE0A 3HRDD 4JX1C 2JQRB 4YXDB 3AB5A 2WP9B 2N0SB 2KAJA 4YSYB 1WGKA 3VRAB 5G5HA 2M56B 1PFDA 2EKIA 2DBYA 2W55A 1A70A 1FM0D 5H92C 3VRBB 4YTMB 1VJKA 3PO0A 4KX6B 5G5GA 1T3QA 1XLQA 2BT6A 4HROA 1FO4A 1F0ZA 1V97A 1FFUA 2W54A 1SIJA 2K9XA 2WDVB 1DOYA 2Y5CA 4USAA 2BS3B 3AV8A 1B9RA 1YJIA 2HTME 1AWDA 3HVZA 3AEEB 1DOIA 1L5PA 3BIID 4ITKA 3VR8B 1JWAD 1YQ3B 2QIEB 1KFYB 3NVZA 3DWMA 1CZPA 1KRHA 1JQ4A 1E10A 3AEBB 1OQQA 1GAQB 1QOFA 1JROA 1N62A 1QOGA 3VR9B 1E7PB 1IUEA 3LB8C 3ZYYX 5C3JB 2CJNA 2AX5A 3AE6B 1E6EB 3HUIA 1NYRA 2H88B 2WU2B 2CU3A 1JRPA 2BS2B
chains in the Genus database with same CATH superfamily
1XO3A 3GZNB 2MW5A 3QWZB 4KKIA 3ZJVA 3ML9A 2FUHB 5GXGB 2LGXA 2XK5A 1HXYD 1R4MB 3N1YC 2OJWA 1SJHD 1WM3A 2O6VA 1AYFA 2BB6A 1XLOA 3DBLI 2K25A 3W5VB 2KZRA 4OVUA 3OAWA 3VUYA 3AE4B 3TL5A 3JW0X 2GB1A 1YN4A 2MSED 4C56C 1J7BA 2ZCCA 2L7RA 3U7DA 2JSVX 5IOIA 3GB1A 4KKJA 4OVZA 2Z0EB 4MGIE 3A1QB 3WCQA 1V86A 3ZVVA 4P1BC 1QKZA 3PT2B 2FCMA 2V9HA 2LHEA 1WRDB 2CJOA 3TUOA 4B0EA 3A9KA 5DPTA 4F1SA 3UINB 2IO3B 3KWVA 1IGDA 3PLUA 4YSYB 2WP9B 3RNAC 1F2RI 3NZ3A 4GOCA 1TS4A 2KTFA 1L2NA 1T3QA 2K8HA 2IZVB 2KD0A 4FADA 4ICUA 3JVZX 1FEHA 1JWAD 4II2B 5J18A 3ZGZA 3NVZA 5E6PA 3H7SA 3W1SA 5JXVA 4NAWB 1YNTE 3ZQ4A 4OZAA 2PW9A 5AZHA 2G45B 5EE3A 3MHZA 2C7HA 2IYDB 3P2BA 2MX2A 3SFDB 1E8ZA 2N9LA 3A9JA 2WXRA 2FAZA 2QJLA 3ZJTA 4WQOB 3HM6X 1IPGA 4CO7A 4A3OA 4M8NA 1L0YB 4A90A 3NVVA 2WS3B 3IFWB 1SSNA 1ET6A 1F52A 4ZRJA 3DHHC 3HIZA 2I2YA 2LASA 2Z59B 3C8YA 1QOBA 4A9AA 2LZ6A 3AULA 4MM3A 4MSQB 2FBWB 1ZW7A 2K8CA 2PIAA 3OLMD 3QIJA 2KKCA 4BKSD 3LYYA 3LXFA 2LRUA 4RGMA 4REZA 2WX0A 5DPSA 4IWPA 4LJPB 4OW0A 3N30A 3ZW3A 2KFKB 3KVFB 2J4XA 3CIRB 4XC2A 4J6IA 3U2SC 1SGHA 2O6VB 4JPSA 3VRAB 5J17A 4X57B 1GUAB 1P98A 1YD8U 2JWZA 1WX7A 1VRAB 5IO9A 3TMPB 2KHWB 1P7FA 4IC7B 1MVKA 1WGYA 4GMVA 2KTRB 1GNUA 1YMHE 2D3BA 2GRIA 4W9JA 3KUZA 4KDLB 4KZCA 3X0WA 4TQ0A 2N9EB 3U52E 3QA8A 2M17A 3AU5A 2LEKA 2EMSA 3RN9C 2INDC 4IUMB 2G3QB 2WGSA 3AMZA 2BQQA 5AZGA 4MH8A 3PREA 4MGYE 1J7AA 1ZOYB 4MM3B 2ZZPB 1FCCC 2LJIA 2R61A 3QCAA 4WJQA 4ZRPA 1LFDA 1N6ZA 4YSXB 4MELA 1Q10A 1WX9A 3EC8A 1XCTL 3BYTB 2I1KA 4PT5A 3SD5A 1VZ8A 2WDRB 2N1VA 2MLBA 1V1PB 4WURA 2BWFA 4FHJA 5JHAA 1MG8A 2IJ0A 3CMMB 1D5ZC 1BMLC 1WYGA 3M63B 2N7EA 2VRRB 2K0PA 3DOWA 1WYWB 1P9DU 1LGRA 3PRMB 1JWSD 2H89B 2NVUI 3QX1A 1M4VA 1WF9A 2WXKA 1FFVA 2MRPA 2L76A 5FK9C 3P1MA 3PHXB 1WXQA 3ZTCA 4TKNA 5J2RA 2EELA 2MEKA 4HCNB 5BYRA 2BBCA 2ICIA 3DBLB 1FNUA 3L4PA 4KDIC 2ONQA 1RRBA 2DNFA 4HK2A 4FJYA 1YN3A 2ZNVC 3I63C 5BMGA 1HA5A 1SJED 2JZPA 4DQOC 1FFUA 2J0JA 4KGTA 1DOYA 5C1ZA 3PZ8A 2BS3B 2DZKA 4USAA 4CYEA 1D5MC 2MBBB 2ZW0A 2KYWA 5D3IB 1YQ3B 4RGOS 1ZKHA 1JROA 3VR9B 1EUVB 1E7PB 1IUEA 2PPHA 5C3JB 1PYWD 2O2VB 2L3ZA 4BFRA 4C7YA 2RD0A 3W2DA 3ZNZB 4LJOB 3N3KB 3B08A 3W5UB 3PGEA 1SE4A 1OQRA 3PTFC 3EGRA 4ANVA 2NBUA 1E8WA 1P7EA 1N60A 4NAMA 2BW2A 1WXSA 1PDXA 3DCGA 4WQMA 4IW0A 2WXIA 1V81A 1DGJA 3B2GA 3VTVA 4DHZB 5HG2A 2OOBB 2KVZA 2DAFA 4PS3A 2LHDA 1JWUD 2JY6A 2D2QA 1N5XA 2JXXA 4LDTD 4LLGM 1OFFA 3P63A 1TS5A 1KOTA 2W3SA 5G55A 4GXBA 4TMAB 3R7RA 1VD2A 1M94A 2K6QA 3AECB 5CHVC 2ZCBA 2RSUA 4G3XB 3NZSA 1V1PA 2XEWA 4WWOA 2KACA 4W9FA 2JYEA 5BYQA 1SIJA 3QARA 1Q1OA 2M0AA 2RGFA 3NHEB 3RZFA 1AWDA 3MJWA 1STEA 4K3CA 2MBQA 1D4BA 3L0WB 4GLSC 4OHJA 4E3CA 3VUXA 4EZLA 2KLCA 1WFYA 2UU7A 2YEPB 3ZNID 1LXDA 2C5LC 1XCQL 2LWPA 4P6VF 1YX6B 2LVPA 2MJ3A 3EA6A 4URKA 2BYFA 1L0XB 4MEMA 3MHSD 2GBRA 2O6VD 3IXSA 3KWLA 5EE9A 4XGAB 3DDCB 4ZDVA 2L8JA 2VZKD 4ASWC 3UI3A 2AEHA 1WXVA 2BKFA 3AE9B 1MHHE 1N61A 1VCBA 3A9JB 3WAOA 1WE6A 1XD3B 1GJZA 1ZE3D 1FPYA 4HJGE 3BZDB 2W3RA 1NEKB 1XEEA 1FRRA 2KFKA 2PEAA 1LM8B 3W1YA 1ENFA 1N5WA 3AEGB 1EM7A 2EMTA 2E3TA 1TYGB 3R8BA 2BKRB 2W9NA 1GB1A 2MP2B 4D2KA 2LI5A 3WAMA 2AQ3B 1ZUD2 3AE3B 3HRDD 3RZWC 4BBNF 4HKQA 4B95A 1WGKA 2LGIA 3IAS1 2EKIA 1J19A 1UWXA 1WI0A 1V97A 3Q3NC 2W54A 1WJ6A 2J0KA 2HTME 4FN2A 1AW7A 1L5PA 2QIEB 3V61A 5D94A 2PE6B 1WIAA 4HWIB 2FCNA 3QHTA 1WE7A 3DQVA 2G4SA 2O2VA 2K5PA 4DHJB 1PUTA 1ZXHA 4GB9A 3DWGC 2WX1A 2I38A 1I4RA 3H7PB 1GPXA 4N9F4 1D6EC 4WJNA 3NS1A 4FA6A 1MG4A 1E8YA 2JWUA 3UQBA 1CQVA 2G9HD 1OEYA 4OZCA 2KX0A 2N7JA 4NNJB 1XF5L 2ZEQA 3AM9A 4BOSC 3AE2B 4EE2A 3KYDD 5LNK1 1HTOA 2DWQA 1V5TA 1I42A 3W9CB 3BK2A 4JIOU 2WQYB 2KVRA 5IA7A 3BWUD 3PHWB 3NG0A 2IPKD 1UBIA 4YT0B 3DVNV 2N9KA 3MFGA 2WXQA 1T0YA 3GE3C 1C4PA 4PYZA 4PS8A 4C7ZA 1ZDVA 1EO6A 4GDLB 3UIOB 2INNE 4B9KA 4FXCA 3MC8A 1NI3A 3Q8BA 2WXNA 5I4DA 1S3SG 1HZ6A 3AE7B 2KDFB 2KN4A 4NJCA 4II3B 4HDOA 4WAFA 1KLUD 3BVZA 2WXHA 1RFAA 4IM2A 1UGMA 1Q0WB 4NPNA 2WXMA 2G4DB 3AB5A 2N0SB 2D3CA 2WWZA 3VUWA 4MDKE 3DHGC 2BGFA 4BAXA 2DZIA 2JYTA 2CKHB 3K9PB 5CTRC 2WNMA 3RNFC 2LFIA 1L7YA 3UIPB 1C78A 2JPHA 4IOIE 3H6NA 3NUHB 5E6NA 3ZJUA 2TSSA 1DOIA 2X38A 4UDUC 3GS2A 2KNBA 4G11A 4W9IA 2QSDA 3L54A 1QZEA 3LB8C 3ZYYX 1E6EB 2WU2B 3JSVB 3TEXA 4OZBA 1E7VA 2RPQA 4A8XC 2JZ3B 4PS7A 2A4ZA 5EE1A 1GC7A 4HPPA 2B76B 2REXA 3A4RA 3RFZB 3QAQA 3RCZA 3FILB 1WGHA 2K6DB 2WDTB 2KOXA 4LNNA 1V8CA 3TEZA 3SDLC 3HVDA 3Q69A 1MPEA 2DZMA 2EKEC 3DBHI 2FIDA 2BYEA 3GP7A 4RF0A 1OTRB 2DHZA 2IY1B 1V49A 2UWQA 3L17A 1BUIC 4MJSB 3Q3FA 1G6JA 4ZHOA 3NRZA 4US9A 3R66C 3M3JA 1A5RA 1ZPSA 4E74A 1UNSA 1YN5A 2R2QA 2NPTA 2KFJA 3NVYA 4PK1A 2VZKB 3VH4B 4ZHPA 3E56A 3A9KB 4BVUC 2L0TA 1MFWA 5G5HA 2WYQA 2FNJB 1A70A 4R3DA 2RDHA 4KX6B 1TT5B 4C4VA 1NDDA 4XZ4A 2KXJA 2PJHA 2K9XA 4WWPA 4RMAA 3ZNGC 3PS6A 1UUPA 2FIFA 1GB4A 4M01A 2KJRA 5E6JA 2GLSA 5E6OA 1KFYB 3UF8A 2J52A 3I5JC 3RNBC 1WGRA 1BT0A 4DWFA 1ISNA 4I6NB 3E9SA 2IBIB 1I7HA 1NVID 4I6LB 4GDKB 2IGGA 3VFKA 1P1AA 2NTTA 4RCOA 1TKEA 2IY0B 3EHVA 2L1AA 2NCNA 2WXGA 4IKGA 4TSSA 3RMKC 1IBXB 3FILA 3FAHA 2FCSA 4JWUC 2KDBA 2KK8A 1V5OA 1SB3C 4E71A 2J42A 3T3OA 1MI0A 2BF8B 4ZYSA 4RM8A 4WWNA 2NTSA 3N1ZC 2WXOA 1QLBB 3ZLZA 2QEJC 3B9JA 5TSSA 4XWWA 4DXFA 3ML8A 1MJDA 4DDID 3RNGC 3ZIMA 2ZVNA 1FCLA 2JT4B 2UYZB 2WXLA 3WALA 2YEPF 2Q5WD 5LXHA 4NJ6A 4NJ7A 3T8MA 1QILA 1YX5B 2INCC 2YLMA 2NPTB 4DBGA 2K39A 3R2TA 3C19A 3VH3B 4Q2JA 1FXIA 1YJJA 4EOYA 1FXAA 2OEDA 1E5WA 2KWCA 5D6JB 1I4PA 2PLPA 3GE8C 4H2AA 2LVOA 2DBYA 2FUG1 1EU4A 5DPRA 5G5GA 4M00A 4HROA 5T8IA 3GZNI 4DXAB 1K51A 2R2OA 3BK1A 3VTUA 3ZUNA 2V3PA 1E10A 3IT6B 1N62A 2QDFA 4A55A 3HK0A 2JU6X 4WIPA 5H8YE 2L32A 2Z0DB 1AN8A 4HXDA 1WH3A 2D5GA 4EUTA 1SE3A 1XLPA 4LCDE 2ZVOA 4W9HA 2DZJA 2LGYA 3O65B 3DVGY 1OEYJ 3R3MA 3CSFA 3DBRB 1K50A 2M4NA 1H4RA 1IYFA 4DXGA 3NZUA 3OJ4B 3VAWA 1FXTB 2KDMA 4FULA 4AS1A 2LVQA 4YWGG 2XNAC 3V6CB 1ROEA 4PYUA 1TIFA 4N58A 1GOZA 1MHXA 1XT9B 4IG7B 2WXJA 2L83A 3CF6E 3VQIA 3TCAA 1EF1A 2K3UA 1YJ1A 1QT9A 3C0RB 3PVLA 4RGNA 3RD2A 4TUUA 4JWSC 2L52A 3TEYA 1KF6B 4KZ0A 2KJ6A 4GDKA 3DBHB 3U4EG 1D3ZA 2HDEA 3ZNHB 3BY4B 2V1YA 1TTNA 4IM3A 3EFUA 2C60A 2QILA 3PRPB 1XLNA 3AEAB 2N7DA 2WLBA 5EE0A 5LXIB 2JRHA 1VR9A 2C9WB 2L00B 3MC0B 2CU1A 1F77A 4C00A 1PFDA 3IHPC 3BINA 5L95C 2W82A 4MSMB 1Y8RC 5L83A 1IGCA 2ZPNA 3A33B 4FHKA 2V4LA 3V60A 4ITKA 4IWQA 1WZ3A 1I4GA 2MQJA 3M95A 1QOGA 1NYRA 3A1QA 3NY5A 2KWVB 3ENEA 4ANWA 2MJDA 1T6BX 3Q3JA 1JWBD 2PKOA 4YL8A 2B3AA 1I35A 3SR6A 4BZAA 2GBNA 2RDBC 3TBLD 4CQNA 3AE1B 2DLBA 4YTNB 3EECA 4P16A 3NVWA 4MJSA 2J53A 1FNWA 4S17A 4W9KA 2KMAA 2VH2A 1T0RC 2WXPA 4N59A 2KN5A 4FLHA 3FC4A 1UF0A 4DDGD 2IO1B 2NBVB 2BWES 5HKHA 2DENB 1C1YB 2BPSA 3RULA 4MACA 1RYJA 4K81A 4B0MA 2CHWA 2MWSB 4HKZE 5KHQA 3T9LA 2D3AA 5D7GA 1VDVA 1Q5WB 1B1ZA 1I4HA 2OHFA 4ZRQA 3RNCC 4P7IA 1DOXA 2D11A 1LQBA 1WXMA 1V2YA 2J0MA 1J8CA 4JX1C 2E6XA 2AL3A 2IGHA 5LLIA 2HTHA 1JWMD 4KGRA 3VXWA 4XDCA 5H92C 2NBWB 1R4MI 3Q2AC 3Q14C 1NBFC 2BT6A 1ZDXA 3MP9A 4LK0M 1FNVA 2KT7A 2V4IB 3OJ3A 3AEEB 4M0WB 4DHZE 2D3GA 1K53A 3GOEA 1KRHA 2VH1A 2SAKA 3Q3MC 2H88B 4K7UA 3Q3OC 4ANXA 1RM6C 1KH0A 1WR6E 4NZLB 1WZ0A 1K8RB 1QQRA 1TKYA 4IDIA 1KM7A 3ALBA 3URYA 3U8ZA 2ON8A 1UWMA 2KC1A 3T3NA 5DPWA 1TS2A 3L08A 3WAPA 1GC6A 2LD9A 5IN7A 3VVWB 2PVOD 1JMLA 3RYTA 3HHMA 3BVGA 2V3NA 3P42A 3V62A 2OJRA 4FJVB 3UGBB 1PGBA 4FBJB 2KANA 3Q8FA 3DHIC 2WU5B 2RPVA 2BYVE 2JRIB 1L6UA 3TIXA 1E0ZA 2AWTA 4GSWA 3DVNU 3JYUA 4CHKA 2KJHB 4ACFA 1NYQA 4HCPB 3AH7A 1JALA 2HE7A 3AN1A 3B2FA 4GGQA 1J7CA 1C3TA 4NQKE 2KAJA 2LUMA 4MH0E 1WXAA 4AJWA 3ZDTA 3ZRCA 1I4QA 2WXFA 3APCA 4AQ7A 5GMVA 3AV8A 2KLGA 4L2YA 1VZ6A 2Y3AA 3TSSA 2INPE 1ESFA 3AEBB 1GAQB 2HJ1A 1P0RA 5FR6A 4WJOA 2AX5A 3HUIA 1WY8A 1JRUA 2MCNB 3H8HA 2NR2A 2RR9A 3N32A 1RWSA 3ZO5B 1WWTA 5HHDG 2D07B 1VZ7A 1L6VA 4EEWA 1IBXA 2M1MA 4WWMA 5EDSA 3MJ5A 2ZJDA 4J3OD 3KUCB 1L0VB 2Z8LA 2IO2B 4BOZB 1ZXIA 3ONSA 2LUEA 1UELA 4KVGB 1HEZE 3CSTA 1FIQA 2MJEA 1WMHA 2KMMA 1QF6A 1UH6A 2FE8A 2GBJA 4GU2A 2KX3A 3DPDA 1UBQA 3DBRI 1Z2MA 4LNKA 1N63A 4W9GA 4XX5A 4JL9A 1TY2A 4RGTA 2M0XA 1YQ4B 4KIKA 4A6QA 1WJ4A 4ZRIA 1OQYA 2ASQA 1RAXA 2LRWA 4GN1A 1FRDA 2M56B 1SBBB 4W9DA 4LDTB 2LGDA 2KO3A 1FM0D 4AUQC 4RM9A 2N4FA 4HVBA 1GG3A 3L10B 3PV1A 4ZYNA 3NJTA 2BB5A 4AOFA 2RDGA 5D3DA 2C7MB 1K52A 3HVZA 1BXTA 3RT3B 1F1HA 3KH0A 4MGZE 2LXAA 3L13A 2MBHA 1OQQA 4MT5A 1E7UA 1PGXA 3IG3A 2CU3A 3IVFA 1I4XA 5IAAC 4DHJD 4M8MA 1SE2A 3IAM1 3V05A 2DX5B 2LGSA 1HZ5A 4XDDA 4AP4C 1V9JA 1KJTA 2KQ4X 1E90A 1Y56A 3O13A 1R4NI 4AJYB 4M0WA 3J9CA 3AE5B 2JZZA 1AARA 3BVMA 4C4VB 2CHXA 2Y5BB 2KMCA 3U30A 4MGKE 3NOBA 1R4NB 4A3PA 2FCQA 4KSKC 2G1EA 4K1RB 5MPOA 2KQ7A 3QJZA 5AZFA 4DK5A 2KWDA 1WM2A 3CWIA 2PMVA 2AL6A 4YTPB 1SIFA 2KC2A 1SXTA 2N9PC 1SF0A 2M19A 5IP4D 2C7NB 1E9MA 2PTLA 1XXGA 2CR5A 3ZXRA 4WJPA 3WA0A 3JSVA 4K3BA 4ZOHC 3H9DA 1PGAA 2GOWA 3ZTDA 3P4PB 1HTQA 1WJNA 2WHIA 1UZXB 4HLEA 1WMHB 1SEBD 3AXCA 1CMXB 1VJKA 3PO0A 1T0QC 2QCZA 4NQLB 2IGDA 4WAAA 2X8XX 2Y5PA 3X23A 2DAJA 3RNEC 3QK0A 2BTEA 3BIID 1CK1A 1Z5SB 4OVVA 3LDZE 1T0SC 3DWMA 3S2AA 2QMTA 2SEBD 4ANUA 1YIWA 2XN9C 2ZPYA 2N1WA 3AE6B 2HD5B 1JRPA 2KWUB 2BS2B 1ACCA 1KTKA 2KQSA 1ZGUB 2JVCA 1UGJA 1H8CA 4YSZB 1HQRD 2D10A 1J0GA 3VTWA 2XK5B 2YVCA 4AWJA 3P4QB 2PVGC 1EWYC 4M02A 4NAWA 2DYMA 2JX5A 4KV2A 4RH6A 2MBEA 4KIKB 2QC8A 1KLGD 2WDQB 4TV3A 4I6PA 3ZXVA 4WH4A 3P4RB 1JW9D 2MH7A 4L23A 5FR3A 2DYBA 4LNFA 1EWCA 4P1CC 3ZDMC 3APFA 3R2IA 2JXTA 3ABVB 2PE9A 3B0AA 2MBOA 4K7SA 3MTNB 4C80A 5AUKA 3N9YC 4EZJA 3RPFC 4N6EB 3KUDB 2K22A 1TBEA 3B1LX 3KW5B 2LMCA 2AQ1B 4L1BA 5IKCM 1SE9A 2XBBC 2LJ5A 3PSEB 4EKUA 4EZKA 4YXDB 3V3XA 1F9JA 2W55A 3VRBB 3I3TB 1XLQA 4F7ZA 3APDA 4KGSA 1YJIA 2HJ8A 1F2RC 3L16A 3NS8A 3ZRFA 4KSLC 1JQ4A 4HDQA 4GIVA 1C4AA 1QOFA 4IM0A 4O1NA 2GBKA 2MA9B 1OGWA 2V3SA 4G50A 1TZ1A 4GDLA 5HI1A 4A20A 4JQWC 3SFEB 1C76A 1V1OA 2KTRA 3VHTC 4XWTA 2KDIA 5AUIA 3R7QA 4HPLB 3P4SB 2NMQA 1WGDA 5FKAC 3I9V1 2BS4B 4RF1A 1LO5D 3AU4A 3N20C 3MC9A 1E8XA 4HRSA 2DYOA 1C4CA 4FJZA 1KLVA 3EFCA 4ICVA 1V80A 3H1UA 4HPMB 4US8A 3RUIB 3K9OB 3FKYA 1FMAD 3PRZA 1ZP0B 1DYQA 3KLSX 1TGZB 1WJUA 1S1QB 3ECIA 5D2MB 5AEKB 4IWOA 5JHBA 1RFKA 3OWEB 1R7SA 2K8BA 3PZDA 2ACZB 1VLBA 1RLFA 3ETRA 2K1FA 3IBEA 4S0RA 1NENB 2MP2A 4G0NB 4BKTA 4LTUA 1C79A 3Q6BA 5HFYA 3UQAA 3W1SC 3AEFB 4LNOA 2CHZA 5DCNA 4XYCA 4LNIA 1PQSA 1TY0A 1EF5A 1C77A 5G2NA 4K7WA 2M8SA 3A4SC 3WIMA 4YTMB 1X1MA 3Q8CA 5CHFA 1F0ZA 4RNAA 4JLCA 2WDVB 2V0GA 4ARIA 2BVCA 1V6EA 4NY0A 4F8CB 2QHOA 4ZRKA 5CX3A 3VR8B 4XE0A 2IO0B 3DVGX 3SEBA 5JH5C 1XQQA 5BO4B 5C2TB 1TKGA 3AI5A 1ET9A 3M62B 4W9CA 1WGGA 2AYOB 3TJPA 4RFBA 2I1JA 3Q8EA 2GBMA 3AE8B 3QC8B 2A5UA 1NI2A 3Q8AA 4JE3B 2JF5A 1P3QU 5BMIA 4HEA1 1IP9A 3EUB2 5KHOA 5BYSA 1QOAA 1YOVB 2KDEB 4BKSA 4W9EA 3VDZA 2N9XA 1EU3A 3I57A 1WSPA 1WR1A 3HM3A 1TZOA 2BYTA 1CJEA 4ARCA 1U4AA 2GI9A 2ZNVB 2NS5A 2J7QB 3H7PA 1WRIA 3KYCD 1D5XC 2JUOA 3PLVA 4B6WA 1UD7A 3LJ3A 3QQ8B 3WANA 1T5XD 3ZKJC 3IT4B 4QAYA 1FD6A 3RI7C 5BMHA 1WX8A 3SU8X 1TJEA 5CHWA 3N1XC 3KQ4A 3PZ7A 3AEDB 2GMIC 1JCKB 2IDYA 5C23A 2JQRB 5TR5A 2MHJA 4W9LA 1L4DB 4BKGA 2RMMA 4HJKA 2LXCA 3TEWA 4EFOA 2ZW1A 1FO4A 2AQ2B 2CS4A 3DBSA 3D32A 2Y5CA 1YQBA 3PPAA 1B9RA 4JGHB 1L4ZB 1TS3A 2L0FA 5JZEB 1C9FA 3U7ZA 1CZPA 4TQ1A 1HE8A 3BYYB 3V6EB 2L05A 3SHQA 4BBNC 3OG5A 2CJNA
chains in the Genus database with same CATH topology
1I4XA 1SE2A 3IAM1 1XO3A 4WIPA 5H8YE 2YEPB 3V05A 2L32A 4KKIA 3ZJVA 1AN8A 1XCQL 2D5GA 1SE3A 1XLPA 4XDDA 1HZ5A 4P6VF 5GXGB 3EA6A 2MJ3A 2KQ4X 1Y56A 3O13A 1HXYD 1L0XB 4M0WA 3J9CA 3AE5B 1SJHD 3IXSA 3KWLA 1K50A 5EE9A 3BVMA 1AYFA 2VZKD 4DXGA 3UI3A 2BB6A 1XLOA 2KDMA 1MHHE 1N61A 3AE9B 4AS1A 3W5VB 4YWGG 2XNAC 1ROEA 3AE4B 4N58A 1GOZA 1ZE3D 2G1EA 2GB1A 1MHXA 1YN4A 5MPOA 2WXJA 2L83A 4C56C 1J7BA 4HJGE 3BZDB 3VQIA 2W3RA 1NEKB 2K3UA 1XEEA 2JSVX 2KWDA 3GB1A 1FRRA 3CWIA 2PMVA 1QT9A 4RGNA 4KKJA 4YTPB 4JWSC 2L52A 4OVZA 1ENFA 3TEYA 1KF6B 1SXTA 1N5WA 3AEGB 1SF0A 3WCQA 1EM7A 2M19A 2E3TA 1TYGB 3U4EG 2HDEA 1QKZA 3R8BA 1E9MA 2PTLA 1GB1A 1XXGA 2LHEA 4D2KA 2CJOA 3TUOA 4B0EA 4ZOHC 2AQ3B 1ZUD2 1PGAA 2QILA 1XLNA 3AEAB 3P4PB 2WLBA 5EE0A 3AE3B 1VR9A 3KWVA 3HRDD 1IGDA 3MC0B 4HKQA 4YSYB 2WP9B 1F77A 1WGKA 2LGIA 3IAS1 1PFDA 2EKIA 1F2RI 3NZ3A 1SEBD 1TS4A 1UWXA 1VJKA 3PO0A 2W82A 1T3QA 1V97A 2W54A 1IGCA 2IGDA 2Y5PA 2HTME 1AW7A 2BTEA 1L5PA 3BIID 1CK1A 1FEHA 4ITKA 1JWAD 2QIEB 1I4GA 3ZGZA 3NVZA 3DWMA 2QMTA 2SEBD 1QOGA 3W1SA 2XN9C 5JXVA 4NAWB 1YNTE 3ZQ4A 3AE6B 1NYRA 1JRPA 2PW9A 4OZAA 2BS2B 1ACCA 2K5PA 5EE3A 1KTKA 1PUTA 3MHZA 2MJDA 1ZXHA 1T6BX 3DWGC 3SFDB 2I38A 1I4RA 1JWBD 2PKOA 1UGJA 2N9LA 1GPXA 2WXRA 4YSZB 1D6EC 1HQRD 2QJLA 3NS1A 3ZJTA 3SR6A 2JWUA 3P4QB 2PVGC 1EWYC 1CQVA 2DYMA 2G9HD 4CQNA 2JX5A 4RH6A 3AE1B 1L0YB 4OZCA 4A90A 2N7JA 3NVVA 1XF5L 2DLBA 4YTNB 2WS3B 4P16A 3NVWA 1SSNA 2J53A 1ET6A 3AM9A 1KLGD 2WDQB 3AE2B 4EE2A 1FNWA 4WH4A 5LNK1 2DWQA 3P4RB 3W9CB 1JW9D 2WXPA 4N59A 3BK2A 2MH7A 2I2YA 3FC4A 3C8YA 4L23A 1QOBA 4A9AA 2WQYB 5FR3A 2FBWB 1EWCA 3BWUD 3R2IA 2JXTA 3ABVB 2IPKD 4YT0B 2PIAA 2N9KA 3MFGA 4MACA 1RYJA 2WXQA 3LYYA 4B0MA 4C80A 3LXFA 1C4PA 5AUKA 4RGMA 4C7ZA 4HKZE 1ZDVA 3N9YC 4GDLB 4REZA 5D7GA 1VDVA 3RPFC 2INNE 4N6EB 4FXCA 2K22A 4OW0A 1B1ZA 1NI3A 3Q8BA 1I4HA 2J4XA 2OHFA 2WXNA 5I4DA 4ZRQA 1HZ6A 3AE7B 2KN4A 4NJCA 2LMCA 2AQ1B 3CIRB 1DOXA 4L1BA 4WAFA 3U2SC 1KLUD 3BVZA 2WXHA 4JX1C 2E6XA 4YXDB 2WXMA 3AB5A 4JPSA 2N0SB 3V3XA 3VRAB 2IGHA 1JWMD 4KGRA 4XDCA 2JYTA 2W55A 5H92C 3VRBB 2BT6A 1XLQA 1ZDXA 2WNMA 2LFIA 3MP9A 1VRAB 4LK0M 1FNVA 1C78A 2V4IB 1YJIA 4KGSA 4IOIE 1F2RC 3NUHB 3ZJUA 3AEEB 2TSSA 1DOIA 1P7FA 1K53A 2X38A 4UDUC 3GS2A 1KRHA 1MVKA 1JQ4A 2SAKA 1C4AA 1QOFA 1YMHE 2GRIA 2QSDA 4O1NA 3LB8C 3ZYYX 1E6EB 4TQ0A 2H88B 2WU2B 5HI1A 3TEXA 4OZBA 1RM6C 3U52E 1KH0A 3SFEB 2LEKA 4NZLB 1C76A 1V1OA 1QQRA 4A8XC 1TKYA 3AMZA 4IDIA 4MH8A 3URYA 4XWTA 5AUIA 1J7AA 1ZOYB 5EE1A 2ON8A 4MM3B 1UWMA 2B76B 3P4SB 3T3NA 3RFZB 1FCCC 2LJIA 2R61A 1TS2A 4ZRPA 2NMQA 3FILB 5FKAC 4YSXB 1Q10A 3I9V1 2BS4B 4RF1A 1LO5D 2PVOD 1JMLA 1XCTL 3BYTB 1V8CA 4PT5A 3TEZA 3BVGA 3HVDA 4HRSA 3Q69A 1VZ8A 2DYOA 1C4CA 2WDRB 1MPEA 1V1PB 2V3NA 4WURA 3P42A 3GP7A 4RF0A 2IJ0A 4US8A 1PGBA 1BUIC 1D5ZC 1BMLC 4ZHOA 1WYGA 3NRZA 1FMAD 3Q8FA 4US9A 1ZP0B 2WU5B 2RPVA 1DYQA 3KLSX 2K0PA 1L6UA 1RFKA 1JWSD 1ZPSA 3OWEB 1E0ZA 1R7SA 2H89B 1M4VA 1UNSA 2WXKA 1YN5A 1FFVA 2ACZB 1VLBA 1NYQA 3ETRA 5FK9C 3P1MA 1NENB 1WXQA 4LTUA 3AH7A 1C79A 2EELA 1JALA 3NVYA 2MEKA 5BYRA 3AN1A 5HFYA 3B2FA 2VZKB 3AEFB 4ZHPA 3E56A 2BBCA 2ICIA 1J7CA 1FNUA 3L4PA 2ONQA 1TY0A 2KAJA 2LUMA 1C77A 5G5HA 1I4QA 1A70A 1YN3A 2WXFA 4YTMB 4R3DA 2RDHA 4KX6B 5BMGA 3Q8CA 1F0ZA 1HA5A 1SJED 2JZPA 4DQOC 4AQ7A 1FFUA 4RNAA 4KGTA 2K9XA 2WDVB 2V0GA 1DOYA 3PZ8A 2BS3B 4USAA 3AV8A 4L2YA 4ARIA 1D5MC 1UUPA 2ZW0A 1GB4A 1VZ6A 2Y3AA 5D3IB 5E6JA 3VR8B 1YQ3B 3TSSA 4RGOS 1KFYB 2J52A 2INPE 1ESFA 4XE0A 3AEBB 1GAQB 1JROA 3VR9B 3SEBA 1E7PB 1IUEA 5C3JB 2AX5A 3HUIA 1PYWD 5C2TB 1TKGA 4C7YA 3H8HA 3E9SA 3W2DA 1RWSA 1ET9A 1I7HA 1WWTA 5HHDG 1VZ7A 1L6VA 1NVID 1IBXA 4WWMA 4GDKB 2IGGA 4RFBA 3MJ5A 4J3OD 3Q8EA 3W5UB 3AE8B 2NTTA 1L0VB 2Z8LA 1SE4A 4RCOA 1TKEA 1OQRA 3Q8AA 4JE3B 2L1AA 2WXGA 1ZXIA 4IKGA 4TSSA 3EGRA 5BMIA 4HEA1 3FILA 1IBXB 3FAHA 3EUB2 5BYSA 4JWUC 1QOAA 1HEZE 1SB3C 1P7EA 2J42A 1FIQA 2MJEA 1N60A 4NAMA 2BW2A 3T3OA 1MI0A 2KMMA 1PDXA 1QF6A 4ZYSA 1EU3A 3I57A 1WSPA 2FE8A 4WQMA 1TZOA 2BYTA 1CJEA 2NTSA 2WXIA 4ARCA 2WXOA 1QLBB 1DGJA 2QEJC 3B2GA 3B9JA 5TSSA 4XWWA 4DXFA 1N63A 2GI9A 5HG2A 1FCLA 1WRIA 1D5XC 1TY2A 4RGTA 2LHDA 2WXLA 2YEPF 1JWUD 1N5XA 2Q5WD 4LLGM 1T5XD 3IT4B 1OFFA 3P63A 1TS5A 1YQ4B 2W3SA 1FD6A 4A6QA 1QILA 5BMHA 1TJEA 4TMAB 3KQ4A 3R2TA 3PZ7A 4Q2JA 3AEDB 1FXIA 1JCKB 1YJJA 3AECB 1FXAA 2IDYA 1FRDA 2OEDA 1I4PA 2JQRB 2PLPA 1L4DB 2M56B 1V1PA 1SBBB 4H2AA 2DBYA 2FUG1 2RMMA 1FM0D 1EU4A 3TEWA 5G5GA 2ZW1A 2KACA 4HROA 2JYEA 5BYQA 5T8IA 2AQ2B 1FO4A 1SIJA 1K51A 2BB5A 2Y5CA 2RDGA 2M0AA 3BK1A 5D3DA 1B9RA 1K52A 1AWDA 1L4ZB 1TS3A 3HVZA 1BXTA 1C9FA 2V3PA 1STEA 3U7ZA 1CZPA 4TQ1A 1E10A 3BYYB 3IT6B 1OQQA 1D4BA 1N62A 4GLSC 4OHJA 4A55A 2CJNA 4MT5A 1PGXA 2CU3A 2JU6X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C2T B;  1TKG A;  4C7Y A;  1XO3 A;  1RM6 C;  2K5P A;  5EE3 A;  5H8Y E;  1PUT A;  3SFE B;  2MJD A;  2LEK A;  1RWS A;  3DWG C;  3SFD B;  1I7H A;  1WWT A;  1JWB D;  1L6V A;  1NVI D;  1TKY A;  2PKO A;  1XLP A;  3AMZ A;  4WWM A;  1GPX A;  4P6V F;  4IDI A;  5AUI A;  5GXG B;  1J7A A;  4YSZ B;  2MJ3 A;  1ZOY B;  2QJL A;  5EE1 A;  3NS1 A;  3WCQ A;  1UWM A;  3W5U B;  2B76 B;  3AE8 B;  3P4S B;  3SR6 A;  1L0V B;  3P4Q B;  2PVG C;  1TKE A;  1EWY C;  1OQR A;  1ZXI A;  4YSX B;  3AE5 B;  2JX5 A;  2BS4 B;  3FAH A;  2PVO D;  3AE1 B;  3KWL A;  3EUB 2;  5EE9 A;  4JWU C;  1QOA A;  3NVV A;  1V8C A;  1AYF A;  4YTN B;  1SB3 C;  2WS3 B;  3NVW A;  4HRS A;  3AM9 A;  1FIQ A;  2MJE A;  2WDR B;  1N60 A;  1XLO A;  2WDQ B;  3AE2 B;  3AE9 B;  1N61 A;  2KMM A;  2DWQ A;  3W5V B;  1PDX A;  1QF6 A;  3P4R B;  1ROE A;  3W9C B;  1JW9 D;  4N59 A;  4WQM A;  2MH7 A;  3AE4 B;  3FC4 A;  1CJE A;  4N58 A;  4US8 A;  1QLB B;  2G1E A;  1DGJ A;  1QOB A;  3B2G A;  3B9J A;  4A9A A;  2WQY B;  1N63 A;  1WYG A;  4ZHO A;  5MPO A;  3NRZ A;  1FMA D;  2L83 A;  2FBW B;  1ZP0 B;  1J7B A;  2WU5 B;  4US9 A;  2W3R A;  1NEK B;  1WRI A;  1L6U A;  3ABV B;  1FRR A;  1RFK A;  2PIA A;  4YT0 B;  3CWI A;  1QT9 A;  1E0Z A;  1R7S A;  1RYJ A;  4YTP B;  1N5X A;  2Q5W D;  2H89 B;  4JWS C;  4C80 A;  2L52 A;  3LXF A;  5AUK A;  1FFV A;  4C7Z A;  2ACZ B;  1VLB A;  1KF6 B;  1OFF A;  3P63 A;  1N5W A;  1NYQ A;  3ETR A;  1YQ4 B;  1SF0 A;  2W3S A;  3AEG B;  1VDV A;  2M19 A;  3P1M A;  2E3T A;  1TYG B;  4N6E B;  3RPF C;  1NEN B;  4FXC A;  2K22 A;  1E9M A;  1NI3 A;  1WXQ A;  1TJE A;  3AH7 A;  4LTU A;  2OHF A;  1JAL A;  3NVY A;  3AE7 B;  2CJO A;  3AN1 A;  3B2F A;  1DOX A;  3AEF B;  3CIR B;  4ZOH C;  4ZHP A;  1ZUD 2;  3AED B;  1J7C A;  1FXI A;  1XLN A;  3AEA B;  1YJJ A;  2WLB A;  3AEC B;  3AE3 B;  1FXA A;  3L4P A;  1FRD A;  3P4P B;  5EE0 A;  3HRD D;  4JX1 C;  2JQR B;  4YXD B;  3AB5 A;  2WP9 B;  2N0S B;  2KAJ A;  4YSY B;  1WGK A;  3VRA B;  5G5H A;  2M56 B;  1PFD A;  2EKI A;  2DBY A;  2W55 A;  1A70 A;  1FM0 D;  5H92 C;  3VRB B;  4YTM B;  1VJK A;  3PO0 A;  4KX6 B;  5G5G A;  1T3Q A;  1XLQ A;  2BT6 A;  4HRO A;  1FO4 A;  1F0Z A;  1V97 A;  1FFU A;  2W54 A;  1SIJ A;  2K9X A;  2WDV B;  1DOY A;  2Y5C A;  4USA A;  2BS3 B;  3AV8 A;  1B9R A;  1YJI A;  2HTM E;  1AWD A;  3HVZ A;  3AEE B;  1DOI A;  1L5P A;  3BII D;  4ITK A;  3VR8 B;  1JWA D;  1YQ3 B;  2QIE B;  1KFY B;  3NVZ A;  3DWM A;  1CZP A;  1KRH A;  1JQ4 A;  1E10 A;  3AEB B;  1OQQ A;  1GAQ B;  1QOF A;  1JRO A;  1N62 A;  1QOG A;  3VR9 B;  1E7P B;  1IUE A;  3LB8 C;  3ZYY X;  5C3J B;  2CJN A;  2AX5 A;  3AE6 B;  1E6E B;  3HUI A;  1NYR A;  2H88 B;  2WU2 B;  2CU3 A;  1JRP A;  2BS2 B; 
#chains in the Genus database with same CATH topology
 1XO3 A;  3GZN B;  2MW5 A;  3QWZ B;  4KKI A;  3ZJV A;  3ML9 A;  2FUH B;  5GXG B;  2LGX A;  2XK5 A;  1HXY D;  1R4M B;  3N1Y C;  2OJW A;  1SJH D;  1WM3 A;  2O6V A;  1AYF A;  2BB6 A;  1XLO A;  3DBL I;  2K25 A;  3W5V B;  2KZR A;  4OVU A;  3OAW A;  3VUY A;  3AE4 B;  3TL5 A;  3JW0 X;  2GB1 A;  1YN4 A;  2MSE D;  4C56 C;  1J7B A;  2ZCC A;  2L7R A;  3U7D A;  2JSV X;  5IOI A;  3GB1 A;  4KKJ A;  4OVZ A;  2Z0E B;  4MGI E;  3A1Q B;  3WCQ A;  1V86 A;  3ZVV A;  4P1B C;  1QKZ A;  3PT2 B;  2FCM A;  2V9H A;  2LHE A;  1WRD B;  2CJO A;  3TUO A;  4B0E A;  3A9K A;  5DPT A;  4F1S A;  3UIN B;  2IO3 B;  3KWV A;  1IGD A;  3PLU A;  4YSY B;  2WP9 B;  3RNA C;  1F2R I;  3NZ3 A;  4GOC A;  1TS4 A;  2KTF A;  1L2N A;  1T3Q A;  2K8H A;  2IZV B;  2KD0 A;  4FAD A;  4ICU A;  3JVZ X;  1FEH A;  1JWA D;  4II2 B;  5J18 A;  3ZGZ A;  3NVZ A;  5E6P A;  3H7S A;  3W1S A;  5JXV A;  4NAW B;  1YNT E;  3ZQ4 A;  4OZA A;  2PW9 A;  5AZH A;  2G45 B;  5EE3 A;  3MHZ A;  2C7H A;  2IYD B;  3P2B A;  2MX2 A;  3SFD B;  1E8Z A;  2N9L A;  3A9J A;  2WXR A;  2FAZ A;  2QJL A;  3ZJT A;  4WQO B;  3HM6 X;  1IPG A;  4CO7 A;  4A3O A;  4M8N A;  1L0Y B;  4A90 A;  3NVV A;  2WS3 B;  3IFW B;  1SSN A;  1ET6 A;  1F52 A;  4ZRJ A;  3DHH C;  3HIZ A;  2I2Y A;  2LAS A;  2Z59 B;  3C8Y A;  1QOB A;  4A9A A;  2LZ6 A;  3AUL A;  4MM3 A;  4MSQ B;  2FBW B;  1ZW7 A;  2K8C A;  2PIA A;  3OLM D;  3QIJ A;  2KKC A;  4BKS D;  3LYY A;  3LXF A;  2LRU A;  4RGM A;  4REZ A;  2WX0 A;  5DPS A;  4IWP A;  4LJP B;  4OW0 A;  3N30 A;  3ZW3 A;  2KFK B;  3KVF B;  2J4X A;  3CIR B;  4XC2 A;  4J6I A;  3U2S C;  1SGH A;  2O6V B;  4JPS A;  3VRA B;  5J17 A;  4X57 B;  1GUA B;  1P98 A;  1YD8 U;  2JWZ A;  1WX7 A;  1VRA B;  5IO9 A;  3TMP B;  2KHW B;  1P7F A;  4IC7 B;  1MVK A;  1WGY A;  4GMV A;  2KTR B;  1GNU A;  1YMH E;  2D3B A;  2GRI A;  4W9J A;  3KUZ A;  4KDL B;  4KZC A;  3X0W A;  4TQ0 A;  2N9E B;  3U52 E;  3QA8 A;  2M17 A;  3AU5 A;  2LEK A;  2EMS A;  3RN9 C;  2IND C;  4IUM B;  2G3Q B;  2WGS A;  3AMZ A;  2BQQ A;  5AZG A;  4MH8 A;  3PRE A;  4MGY E;  1J7A A;  1ZOY B;  4MM3 B;  2ZZP B;  1FCC C;  2LJI A;  2R61 A;  3QCA A;  4WJQ A;  4ZRP A;  1LFD A;  1N6Z A;  4YSX B;  4MEL A;  1Q10 A;  1WX9 A;  3EC8 A;  1XCT L;  3BYT B;  2I1K A;  4PT5 A;  3SD5 A;  1VZ8 A;  2WDR B;  2N1V A;  2MLB A;  1V1P B;  4WUR A;  2BWF A;  4FHJ A;  5JHA A;  1MG8 A;  2IJ0 A;  3CMM B;  1D5Z C;  1BML C;  1WYG A;  3M63 B;  2N7E A;  2VRR B;  2K0P A;  3DOW A;  1WYW B;  1P9D U;  1LGR A;  3PRM B;  1JWS D;  2H89 B;  2NVU I;  3QX1 A;  1M4V A;  1WF9 A;  2WXK A;  1FFV A;  2MRP A;  2L76 A;  5FK9 C;  3P1M A;  3PHX B;  1WXQ A;  3ZTC A;  4TKN A;  5J2R A;  2EEL A;  2MEK A;  4HCN B;  5BYR A;  2BBC A;  2ICI A;  3DBL B;  1FNU A;  3L4P A;  4KDI C;  2ONQ A;  1RRB A;  2DNF A;  4HK2 A;  4FJY A;  1YN3 A;  2ZNV C;  3I63 C;  5BMG A;  1HA5 A;  1SJE D;  2JZP A;  4DQO C;  1FFU A;  2J0J A;  4KGT A;  1DOY A;  5C1Z A;  3PZ8 A;  2BS3 B;  2DZK A;  4USA A;  4CYE A;  1D5M C;  2MBB B;  2ZW0 A;  2KYW A;  5D3I B;  1YQ3 B;  4RGO S;  1ZKH A;  1JRO A;  3VR9 B;  1EUV B;  1E7P B;  1IUE A;  2PPH A;  5C3J B;  1PYW D;  2O2V B;  2L3Z A;  4BFR A;  4C7Y A;  2RD0 A;  3W2D A;  3ZNZ B;  4LJO B;  3N3K B;  3B08 A;  3W5U B;  3PGE A;  1SE4 A;  1OQR A;  3PTF C;  3EGR A;  4ANV A;  2NBU A;  1E8W A;  1P7E A;  1N60 A;  4NAM A;  2BW2 A;  1WXS A;  1PDX A;  3DCG A;  4WQM A;  4IW0 A;  2WXI A;  1V81 A;  1DGJ A;  3B2G A;  3VTV A;  4DHZ B;  5HG2 A;  2OOB B;  2KVZ A;  2DAF A;  4PS3 A;  2LHD A;  1JWU D;  2JY6 A;  2D2Q A;  1N5X A;  2JXX A;  4LDT D;  4LLG M;  1OFF A;  3P63 A;  1TS5 A;  1KOT A;  2W3S A;  5G55 A;  4GXB A;  4TMA B;  3R7R A;  1VD2 A;  1M94 A;  2K6Q A;  3AEC B;  5CHV C;  2ZCB A;  2RSU A;  4G3X B;  3NZS A;  1V1P A;  2XEW A;  4WWO A;  2KAC A;  4W9F A;  2JYE A;  5BYQ A;  1SIJ A;  3QAR A;  1Q1O A;  2M0A A;  2RGF A;  3NHE B;  3RZF A;  1AWD A;  3MJW A;  1STE A;  4K3C A;  2MBQ A;  1D4B A;  3L0W B;  4GLS C;  4OHJ A;  4E3C A;  3VUX A;  4EZL A;  2KLC A;  1WFY A;  2UU7 A;  2YEP B;  3ZNI D;  1LXD A;  2C5L C;  1XCQ L;  2LWP A;  4P6V F;  1YX6 B;  2LVP A;  2MJ3 A;  3EA6 A;  4URK A;  2BYF A;  1L0X B;  4MEM A;  3MHS D;  2GBR A;  2O6V D;  3IXS A;  3KWL A;  5EE9 A;  4XGA B;  3DDC B;  4ZDV A;  2L8J A;  2VZK D;  4ASW C;  3UI3 A;  2AEH A;  1WXV A;  2BKF A;  3AE9 B;  1MHH E;  1N61 A;  1VCB A;  3A9J B;  3WAO A;  1WE6 A;  1XD3 B;  1GJZ A;  1ZE3 D;  1FPY A;  4HJG E;  3BZD B;  2W3R A;  1NEK B;  1XEE A;  1FRR A;  2KFK A;  2PEA A;  1LM8 B;  3W1Y A;  1ENF A;  1N5W A;  3AEG B;  1EM7 A;  2EMT A;  2E3T A;  1TYG B;  3R8B A;  2BKR B;  2W9N A;  1GB1 A;  2MP2 B;  4D2K A;  2LI5 A;  3WAM A;  2AQ3 B;  1ZUD 2;  3AE3 B;  3HRD D;  3RZW C;  4BBN F;  4HKQ A;  4B95 A;  1WGK A;  2LGI A;  3IAS 1;  2EKI A;  1J19 A;  1UWX A;  1WI0 A;  1V97 A;  3Q3N C;  2W54 A;  1WJ6 A;  2J0K A;  2HTM E;  4FN2 A;  1AW7 A;  1L5P A;  2QIE B;  3V61 A;  5D94 A;  2PE6 B;  1WIA A;  4HWI B;  2FCN A;  3QHT A;  1WE7 A;  3DQV A;  2G4S A;  2O2V A;  2K5P A;  4DHJ B;  1PUT A;  1ZXH A;  4GB9 A;  3DWG C;  2WX1 A;  2I38 A;  1I4R A;  3H7P B;  1GPX A;  4N9F 4;  1D6E C;  4WJN A;  3NS1 A;  4FA6 A;  1MG4 A;  1E8Y A;  2JWU A;  3UQB A;  1CQV A;  2G9H D;  1OEY A;  4OZC A;  2KX0 A;  2N7J A;  4NNJ B;  1XF5 L;  2ZEQ A;  3AM9 A;  4BOS C;  3AE2 B;  4EE2 A;  3KYD D;  5LNK 1;  1HTO A;  2DWQ A;  1V5T A;  1I42 A;  3W9C B;  3BK2 A;  4JIO U;  2WQY B;  2KVR A;  5IA7 A;  3BWU D;  3PHW B;  3NG0 A;  2IPK D;  1UBI A;  4YT0 B;  3DVN V;  2N9K A;  3MFG A;  2WXQ A;  1T0Y A;  3GE3 C;  1C4P A;  4PYZ A;  4PS8 A;  4C7Z A;  1ZDV A;  1EO6 A;  4GDL B;  3UIO B;  2INN E;  4B9K A;  4FXC A;  3MC8 A;  1NI3 A;  3Q8B A;  2WXN A;  5I4D A;  1S3S G;  1HZ6 A;  3AE7 B;  2KDF B;  2KN4 A;  4NJC A;  4II3 B;  4HDO A;  4WAF A;  1KLU D;  3BVZ A;  2WXH A;  1RFA A;  4IM2 A;  1UGM A;  1Q0W B;  4NPN A;  2WXM A;  2G4D B;  3AB5 A;  2N0S B;  2D3C A;  2WWZ A;  3VUW A;  4MDK E;  3DHG C;  2BGF A;  4BAX A;  2DZI A;  2JYT A;  2CKH B;  3K9P B;  5CTR C;  2WNM A;  3RNF C;  2LFI A;  1L7Y A;  3UIP B;  1C78 A;  2JPH A;  4IOI E;  3H6N A;  3NUH B;  5E6N A;  3ZJU A;  2TSS A;  1DOI A;  2X38 A;  4UDU C;  3GS2 A;  2KNB A;  4G11 A;  4W9I A;  2QSD A;  3L54 A;  1QZE A;  3LB8 C;  3ZYY X;  1E6E B;  2WU2 B;  3JSV B;  3TEX A;  4OZB A;  1E7V A;  2RPQ A;  4A8X C;  2JZ3 B;  4PS7 A;  2A4Z A;  5EE1 A;  1GC7 A;  4HPP A;  2B76 B;  2REX A;  3A4R A;  3RFZ B;  3QAQ A;  3RCZ A;  3FIL B;  1WGH A;  2K6D B;  2WDT B;  2KOX A;  4LNN A;  1V8C A;  3TEZ A;  3SDL C;  3HVD A;  3Q69 A;  1MPE A;  2DZM A;  2EKE C;  3DBH I;  2FID A;  2BYE A;  3GP7 A;  4RF0 A;  1OTR B;  2DHZ A;  2IY1 B;  1V49 A;  2UWQ A;  3L17 A;  1BUI C;  4MJS B;  3Q3F A;  1G6J A;  4ZHO A;  3NRZ A;  4US9 A;  3R66 C;  3M3J A;  1A5R A;  1ZPS A;  4E74 A;  1UNS A;  1YN5 A;  2R2Q A;  2NPT A;  2KFJ A;  3NVY A;  4PK1 A;  2VZK B;  3VH4 B;  4ZHP A;  3E56 A;  3A9K B;  4BVU C;  2L0T A;  1MFW A;  5G5H A;  2WYQ A;  2FNJ B;  1A70 A;  4R3D A;  2RDH A;  4KX6 B;  1TT5 B;  4C4V A;  1NDD A;  4XZ4 A;  2KXJ A;  2PJH A;  2K9X A;  4WWP A;  4RMA A;  3ZNG C;  3PS6 A;  1UUP A;  2FIF A;  1GB4 A;  4M01 A;  2KJR A;  5E6J A;  2GLS A;  5E6O A;  1KFY B;  3UF8 A;  2J52 A;  3I5J C;  3RNB C;  1WGR A;  1BT0 A;  4DWF A;  1ISN A;  4I6N B;  3E9S A;  2IBI B;  1I7H A;  1NVI D;  4I6L B;  4GDK B;  2IGG A;  3VFK A;  1P1A A;  2NTT A;  4RCO A;  1TKE A;  2IY0 B;  3EHV A;  2L1A A;  2NCN A;  2WXG A;  4IKG A;  4TSS A;  3RMK C;  1IBX B;  3FIL A;  3FAH A;  2FCS A;  4JWU C;  2KDB A;  2KK8 A;  1V5O A;  1SB3 C;  4E71 A;  2J42 A;  3T3O A;  1MI0 A;  2BF8 B;  4ZYS A;  4RM8 A;  4WWN A;  2NTS A;  3N1Z C;  2WXO A;  1QLB B;  3ZLZ A;  2QEJ C;  3B9J A;  5TSS A;  4XWW A;  4DXF A;  3ML8 A;  1MJD A;  4DDI D;  3RNG C;  3ZIM A;  2ZVN A;  1FCL A;  2JT4 B;  2UYZ B;  2WXL A;  3WAL A;  2YEP F;  2Q5W D;  5LXH A;  4NJ6 A;  4NJ7 A;  3T8M A;  1QIL A;  1YX5 B;  2INC C;  2YLM A;  2NPT B;  4DBG A;  2K39 A;  3R2T A;  3C19 A;  3VH3 B;  4Q2J A;  1FXI A;  1YJJ A;  4EOY A;  1FXA A;  2OED A;  1E5W A;  2KWC A;  5D6J B;  1I4P A;  2PLP A;  3GE8 C;  4H2A A;  2LVO A;  2DBY A;  2FUG 1;  1EU4 A;  5DPR A;  5G5G A;  4M00 A;  4HRO A;  5T8I A;  3GZN I;  4DXA B;  1K51 A;  2R2O A;  3BK1 A;  3VTU A;  3ZUN A;  2V3P A;  1E10 A;  3IT6 B;  1N62 A;  2QDF A;  4A55 A;  3HK0 A;  2JU6 X;  4WIP A;  5H8Y E;  2L32 A;  2Z0D B;  1AN8 A;  4HXD A;  1WH3 A;  2D5G A;  4EUT A;  1SE3 A;  1XLP A;  4LCD E;  2ZVO A;  4W9H A;  2DZJ A;  2LGY A;  3O65 B;  3DVG Y;  1OEY J;  3R3M A;  3CSF A;  3DBR B;  1K50 A;  2M4N A;  1H4R A;  1IYF A;  4DXG A;  3NZU A;  3OJ4 B;  3VAW A;  1FXT B;  2KDM A;  4FUL A;  4AS1 A;  2LVQ A;  4YWG G;  2XNA C;  3V6C B;  1ROE A;  4PYU A;  1TIF A;  4N58 A;  1GOZ A;  1MHX A;  1XT9 B;  4IG7 B;  2WXJ A;  2L83 A;  3CF6 E;  3VQI A;  3TCA A;  1EF1 A;  2K3U A;  1YJ1 A;  1QT9 A;  3C0R B;  3PVL A;  4RGN A;  3RD2 A;  4TUU A;  4JWS C;  2L52 A;  3TEY A;  1KF6 B;  4KZ0 A;  2KJ6 A;  4GDK A;  3DBH B;  3U4E G;  1D3Z A;  2HDE A;  3ZNH B;  3BY4 B;  2V1Y A;  1TTN A;  4IM3 A;  3EFU A;  2C60 A;  2QIL A;  3PRP B;  1XLN A;  3AEA B;  2N7D A;  2WLB A;  5EE0 A;  5LXI B;  2JRH A;  1VR9 A;  2C9W B;  2L00 B;  3MC0 B;  2CU1 A;  1F77 A;  4C00 A;  1PFD A;  3IHP C;  3BIN A;  5L95 C;  2W82 A;  4MSM B;  1Y8R C;  5L83 A;  1IGC A;  2ZPN A;  3A33 B;  4FHK A;  2V4L A;  3V60 A;  4ITK A;  4IWQ A;  1WZ3 A;  1I4G A;  2MQJ A;  3M95 A;  1QOG A;  1NYR A;  3A1Q A;  3NY5 A;  2KWV B;  3ENE A;  4ANW A;  2MJD A;  1T6B X;  3Q3J A;  1JWB D;  2PKO A;  4YL8 A;  2B3A A;  1I35 A;  3SR6 A;  4BZA A;  2GBN A;  2RDB C;  3TBL D;  4CQN A;  3AE1 B;  2DLB A;  4YTN B;  3EEC A;  4P16 A;  3NVW A;  4MJS A;  2J53 A;  1FNW A;  4S17 A;  4W9K A;  2KMA A;  2VH2 A;  1T0R C;  2WXP A;  4N59 A;  2KN5 A;  4FLH A;  3FC4 A;  1UF0 A;  4DDG D;  2IO1 B;  2NBV B;  2BWE S;  5HKH A;  2DEN B;  1C1Y B;  2BPS A;  3RUL A;  4MAC A;  1RYJ A;  4K81 A;  4B0M A;  2CHW A;  2MWS B;  4HKZ E;  5KHQ A;  3T9L A;  2D3A A;  5D7G A;  1VDV A;  1Q5W B;  1B1Z A;  1I4H A;  2OHF A;  4ZRQ A;  3RNC C;  4P7I A;  1DOX A;  2D11 A;  1LQB A;  1WXM A;  1V2Y A;  2J0M A;  1J8C A;  4JX1 C;  2E6X A;  2AL3 A;  2IGH A;  5LLI A;  2HTH A;  1JWM D;  4KGR A;  3VXW A;  4XDC A;  5H92 C;  2NBW B;  1R4M I;  3Q2A C;  3Q14 C;  1NBF C;  2BT6 A;  1ZDX A;  3MP9 A;  4LK0 M;  1FNV A;  2KT7 A;  2V4I B;  3OJ3 A;  3AEE B;  4M0W B;  4DHZ E;  2D3G A;  1K53 A;  3GOE A;  1KRH A;  2VH1 A;  2SAK A;  3Q3M C;  2H88 B;  4K7U A;  3Q3O C;  4ANX A;  1RM6 C;  1KH0 A;  1WR6 E;  4NZL B;  1WZ0 A;  1K8R B;  1QQR A;  1TKY A;  4IDI A;  1KM7 A;  3ALB A;  3URY A;  3U8Z A;  2ON8 A;  1UWM A;  2KC1 A;  3T3N A;  5DPW A;  1TS2 A;  3L08 A;  3WAP A;  1GC6 A;  2LD9 A;  5IN7 A;  3VVW B;  2PVO D;  1JML A;  3RYT A;  3HHM A;  3BVG A;  2V3N A;  3P42 A;  3V62 A;  2OJR A;  4FJV B;  3UGB B;  1PGB A;  4FBJ B;  2KAN A;  3Q8F A;  3DHI C;  2WU5 B;  2RPV A;  2BYV E;  2JRI B;  1L6U A;  3TIX A;  1E0Z A;  2AWT A;  4GSW A;  3DVN U;  3JYU A;  4CHK A;  2KJH B;  4ACF A;  1NYQ A;  4HCP B;  3AH7 A;  1JAL A;  2HE7 A;  3AN1 A;  3B2F A;  4GGQ A;  1J7C A;  1C3T A;  4NQK E;  2KAJ A;  2LUM A;  4MH0 E;  1WXA A;  4AJW A;  3ZDT A;  3ZRC A;  1I4Q A;  2WXF A;  3APC A;  4AQ7 A;  5GMV A;  3AV8 A;  2KLG A;  4L2Y A;  1VZ6 A;  2Y3A A;  3TSS A;  2INP E;  1ESF A;  3AEB B;  1GAQ B;  2HJ1 A;  1P0R A;  5FR6 A;  4WJO A;  2AX5 A;  3HUI A;  1WY8 A;  1JRU A;  2MCN B;  3H8H A;  2NR2 A;  2RR9 A;  3N32 A;  1RWS A;  3ZO5 B;  1WWT A;  5HHD G;  2D07 B;  1VZ7 A;  1L6V A;  4EEW A;  1IBX A;  2M1M A;  4WWM A;  5EDS A;  3MJ5 A;  2ZJD A;  4J3O D;  3KUC B;  1L0V B;  2Z8L A;  2IO2 B;  4BOZ B;  1ZXI A;  3ONS A;  2LUE A;  1UEL A;  4KVG B;  1HEZ E;  3CST A;  1FIQ A;  2MJE A;  1WMH A;  2KMM A;  1QF6 A;  1UH6 A;  2FE8 A;  2GBJ A;  4GU2 A;  2KX3 A;  3DPD A;  1UBQ A;  3DBR I;  1Z2M A;  4LNK A;  1N63 A;  4W9G A;  4XX5 A;  4JL9 A;  1TY2 A;  4RGT A;  2M0X A;  1YQ4 B;  4KIK A;  4A6Q A;  1WJ4 A;  4ZRI A;  1OQY A;  2ASQ A;  1RAX A;  2LRW A;  4GN1 A;  1FRD A;  2M56 B;  1SBB B;  4W9D A;  4LDT B;  2LGD A;  2KO3 A;  1FM0 D;  4AUQ C;  4RM9 A;  2N4F A;  4HVB A;  1GG3 A;  3L10 B;  3PV1 A;  4ZYN A;  3NJT A;  2BB5 A;  4AOF A;  2RDG A;  5D3D A;  2C7M B;  1K52 A;  3HVZ A;  1BXT A;  3RT3 B;  1F1H A;  3KH0 A;  4MGZ E;  2LXA A;  3L13 A;  2MBH A;  1OQQ A;  4MT5 A;  1E7U A;  1PGX A;  3IG3 A;  2CU3 A;  3IVF A;  1I4X A;  5IAA C;  4DHJ D;  4M8M A;  1SE2 A;  3IAM 1;  3V05 A;  2DX5 B;  2LGS A;  1HZ5 A;  4XDD A;  4AP4 C;  1V9J A;  1KJT A;  2KQ4 X;  1E90 A;  1Y56 A;  3O13 A;  1R4N I;  4AJY B;  4M0W A;  3J9C A;  3AE5 B;  2JZZ A;  1AAR A;  3BVM A;  4C4V B;  2CHX A;  2Y5B B;  2KMC A;  3U30 A;  4MGK E;  3NOB A;  1R4N B;  4A3P A;  2FCQ A;  4KSK C;  2G1E A;  4K1R B;  5MPO A;  2KQ7 A;  3QJZ A;  5AZF A;  4DK5 A;  2KWD A;  1WM2 A;  3CWI A;  2PMV A;  2AL6 A;  4YTP B;  1SIF A;  2KC2 A;  1SXT A;  2N9P C;  1SF0 A;  2M19 A;  5IP4 D;  2C7N B;  1E9M A;  2PTL A;  1XXG A;  2CR5 A;  3ZXR A;  4WJP A;  3WA0 A;  3JSV A;  4K3B A;  4ZOH C;  3H9D A;  1PGA A;  2GOW A;  3ZTD A;  3P4P B;  1HTQ A;  1WJN A;  2WHI A;  1UZX B;  4HLE A;  1WMH B;  1SEB D;  3AXC A;  1CMX B;  1VJK A;  3PO0 A;  1T0Q C;  2QCZ A;  4NQL B;  2IGD A;  4WAA A;  2X8X X;  2Y5P A;  3X23 A;  2DAJ A;  3RNE C;  3QK0 A;  2BTE A;  3BII D;  1CK1 A;  1Z5S B;  4OVV A;  3LDZ E;  1T0S C;  3DWM A;  3S2A A;  2QMT A;  2SEB D;  4ANU A;  1YIW A;  2XN9 C;  2ZPY A;  2N1W A;  3AE6 B;  2HD5 B;  1JRP A;  2KWU B;  2BS2 B;  1ACC A;  1KTK A;  2KQS A;  1ZGU B;  2JVC A;  1UGJ A;  1H8C A;  4YSZ B;  1HQR D;  2D10 A;  1J0G A;  3VTW A;  2XK5 B;  2YVC A;  4AWJ A;  3P4Q B;  2PVG C;  1EWY C;  4M02 A;  4NAW A;  2DYM A;  2JX5 A;  4KV2 A;  4RH6 A;  2MBE A;  4KIK B;  2QC8 A;  1KLG D;  2WDQ B;  4TV3 A;  4I6P A;  3ZXV A;  4WH4 A;  3P4R B;  1JW9 D;  2MH7 A;  4L23 A;  5FR3 A;  2DYB A;  4LNF A;  1EWC A;  4P1C C;  3ZDM C;  3APF A;  3R2I A;  2JXT A;  3ABV B;  2PE9 A;  3B0A A;  2MBO A;  4K7S A;  3MTN B;  4C80 A;  5AUK A;  3N9Y C;  4EZJ A;  3RPF C;  4N6E B;  3KUD B;  2K22 A;  1TBE A;  3B1L X;  3KW5 B;  2LMC A;  2AQ1 B;  4L1B A;  5IKC M;  1SE9 A;  2XBB C;  2LJ5 A;  3PSE B;  4EKU A;  4EZK A;  4YXD B;  3V3X A;  1F9J A;  2W55 A;  3VRB B;  3I3T B;  1XLQ A;  4F7Z A;  3APD A;  4KGS A;  1YJI A;  2HJ8 A;  1F2R C;  3L16 A;  3NS8 A;  3ZRF A;  4KSL C;  1JQ4 A;  4HDQ A;  4GIV A;  1C4A A;  1QOF A;  4IM0 A;  4O1N A;  2GBK A;  2MA9 B;  1OGW A;  2V3S A;  4G50 A;  1TZ1 A;  4GDL A;  5HI1 A;  4A20 A;  4JQW C;  3SFE B;  1C76 A;  1V1O A;  2KTR A;  3VHT C;  4XWT A;  2KDI A;  5AUI A;  3R7Q A;  4HPL B;  3P4S B;  2NMQ A;  1WGD A;  5FKA C;  3I9V 1;  2BS4 B;  4RF1 A;  1LO5 D;  3AU4 A;  3N20 C;  3MC9 A;  1E8X A;  4HRS A;  2DYO A;  1C4C A;  4FJZ A;  1KLV A;  3EFC A;  4ICV A;  1V80 A;  3H1U A;  4HPM B;  4US8 A;  3RUI B;  3K9O B;  3FKY A;  1FMA D;  3PRZ A;  1ZP0 B;  1DYQ A;  3KLS X;  1TGZ B;  1WJU A;  1S1Q B;  3ECI A;  5D2M B;  5AEK B;  4IWO A;  5JHB A;  1RFK A;  3OWE B;  1R7S A;  2K8B A;  3PZD A;  2ACZ B;  1VLB A;  1RLF A;  3ETR A;  2K1F A;  3IBE A;  4S0R A;  1NEN B;  2MP2 A;  4G0N B;  4BKT A;  4LTU A;  1C79 A;  3Q6B A;  5HFY A;  3UQA A;  3W1S C;  3AEF B;  4LNO A;  2CHZ A;  5DCN A;  4XYC A;  4LNI A;  1PQS A;  1TY0 A;  1EF5 A;  1C77 A;  5G2N A;  4K7W A;  2M8S A;  3A4S C;  3WIM A;  4YTM B;  1X1M A;  3Q8C A;  5CHF A;  1F0Z A;  4RNA A;  4JLC A;  2WDV B;  2V0G A;  4ARI A;  2BVC A;  1V6E A;  4NY0 A;  4F8C B;  2QHO A;  4ZRK A;  5CX3 A;  3VR8 B;  4XE0 A;  2IO0 B;  3DVG X;  3SEB A;  5JH5 C;  1XQQ A;  5BO4 B;  5C2T B;  1TKG A;  3AI5 A;  1ET9 A;  3M62 B;  4W9C A;  1WGG A;  2AYO B;  3TJP A;  4RFB A;  2I1J A;  3Q8E A;  2GBM A;  3AE8 B;  3QC8 B;  2A5U A;  1NI2 A;  3Q8A A;  4JE3 B;  2JF5 A;  1P3Q U;  5BMI A;  4HEA 1;  1IP9 A;  3EUB 2;  5KHO A;  5BYS A;  1QOA A;  1YOV B;  2KDE B;  4BKS A;  4W9E A;  3VDZ A;  2N9X A;  1EU3 A;  3I57 A;  1WSP A;  1WR1 A;  3HM3 A;  1TZO A;  2BYT A;  1CJE A;  4ARC A;  1U4A A;  2GI9 A;  2ZNV B;  2NS5 A;  2J7Q B;  3H7P A;  1WRI A;  3KYC D;  1D5X C;  2JUO A;  3PLV A;  4B6W A;  1UD7 A;  3LJ3 A;  3QQ8 B;  3WAN A;  1T5X D;  3ZKJ C;  3IT4 B;  4QAY A;  1FD6 A;  3RI7 C;  5BMH A;  1WX8 A;  3SU8 X;  1TJE A;  5CHW A;  3N1X C;  3KQ4 A;  3PZ7 A;  3AED B;  2GMI C;  1JCK B;  2IDY A;  5C23 A;  2JQR B;  5TR5 A;  2MHJ A;  4W9L A;  1L4D B;  4BKG A;  2RMM A;  4HJK A;  2LXC A;  3TEW A;  4EFO A;  2ZW1 A;  1FO4 A;  2AQ2 B;  2CS4 A;  3DBS A;  3D32 A;  2Y5C A;  1YQB A;  3PPA A;  1B9R A;  4JGH B;  1L4Z B;  1TS3 A;  2L0F A;  5JZE B;  1C9F A;  3U7Z A;  1CZP A;  4TQ1 A;  1HE8 A;  3BYY B;  3V6E B;  2L05 A;  3SHQ A;  4BBN C;  3OG5 A;  2CJN A; 
#chains in the Genus database with same CATH homology
 1I4X A;  1SE2 A;  3IAM 1;  1XO3 A;  4WIP A;  5H8Y E;  2YEP B;  3V05 A;  2L32 A;  4KKI A;  3ZJV A;  1AN8 A;  1XCQ L;  2D5G A;  1SE3 A;  1XLP A;  4XDD A;  1HZ5 A;  4P6V F;  5GXG B;  3EA6 A;  2MJ3 A;  2KQ4 X;  1Y56 A;  3O13 A;  1HXY D;  1L0X B;  4M0W A;  3J9C A;  3AE5 B;  1SJH D;  3IXS A;  3KWL A;  1K50 A;  5EE9 A;  3BVM A;  1AYF A;  2VZK D;  4DXG A;  3UI3 A;  2BB6 A;  1XLO A;  2KDM A;  1MHH E;  1N61 A;  3AE9 B;  4AS1 A;  3W5V B;  4YWG G;  2XNA C;  1ROE A;  3AE4 B;  4N58 A;  1GOZ A;  1ZE3 D;  2G1E A;  2GB1 A;  1MHX A;  1YN4 A;  5MPO A;  2WXJ A;  2L83 A;  4C56 C;  1J7B A;  4HJG E;  3BZD B;  3VQI A;  2W3R A;  1NEK B;  2K3U A;  1XEE A;  2JSV X;  2KWD A;  3GB1 A;  1FRR A;  3CWI A;  2PMV A;  1QT9 A;  4RGN A;  4KKJ A;  4YTP B;  4JWS C;  2L52 A;  4OVZ A;  1ENF A;  3TEY A;  1KF6 B;  1SXT A;  1N5W A;  3AEG B;  1SF0 A;  3WCQ A;  1EM7 A;  2M19 A;  2E3T A;  1TYG B;  3U4E G;  2HDE A;  1QKZ A;  3R8B A;  1E9M A;  2PTL A;  1GB1 A;  1XXG A;  2LHE A;  4D2K A;  2CJO A;  3TUO A;  4B0E A;  4ZOH C;  2AQ3 B;  1ZUD 2;  1PGA A;  2QIL A;  1XLN A;  3AEA B;  3P4P B;  2WLB A;  5EE0 A;  3AE3 B;  1VR9 A;  3KWV A;  3HRD D;  1IGD A;  3MC0 B;  4HKQ A;  4YSY B;  2WP9 B;  1F77 A;  1WGK A;  2LGI A;  3IAS 1;  1PFD A;  2EKI A;  1F2R I;  3NZ3 A;  1SEB D;  1TS4 A;  1UWX A;  1VJK A;  3PO0 A;  2W82 A;  1T3Q A;  1V97 A;  2W54 A;  1IGC A;  2IGD A;  2Y5P A;  2HTM E;  1AW7 A;  2BTE A;  1L5P A;  3BII D;  1CK1 A;  1FEH A;  4ITK A;  1JWA D;  2QIE B;  1I4G A;  3ZGZ A;  3NVZ A;  3DWM A;  2QMT A;  2SEB D;  1QOG A;  3W1S A;  2XN9 C;  5JXV A;  4NAW B;  1YNT E;  3ZQ4 A;  3AE6 B;  1NYR A;  1JRP A;  2PW9 A;  4OZA A;  2BS2 B;  1ACC A;  2K5P A;  5EE3 A;  1KTK A;  1PUT A;  3MHZ A;  2MJD A;  1ZXH A;  1T6B X;  3DWG C;  3SFD B;  2I38 A;  1I4R A;  1JWB D;  2PKO A;  1UGJ A;  2N9L A;  1GPX A;  2WXR A;  4YSZ B;  1D6E C;  1HQR D;  2QJL A;  3NS1 A;  3ZJT A;  3SR6 A;  2JWU A;  3P4Q B;  2PVG C;  1EWY C;  1CQV A;  2DYM A;  2G9H D;  4CQN A;  2JX5 A;  4RH6 A;  3AE1 B;  1L0Y B;  4OZC A;  4A90 A;  2N7J A;  3NVV A;  1XF5 L;  2DLB A;  4YTN B;  2WS3 B;  4P16 A;  3NVW A;  1SSN A;  2J53 A;  1ET6 A;  3AM9 A;  1KLG D;  2WDQ B;  3AE2 B;  4EE2 A;  1FNW A;  4WH4 A;  5LNK 1;  2DWQ A;  3P4R B;  3W9C B;  1JW9 D;  2WXP A;  4N59 A;  3BK2 A;  2MH7 A;  2I2Y A;  3FC4 A;  3C8Y A;  4L23 A;  1QOB A;  4A9A A;  2WQY B;  5FR3 A;  2FBW B;  1EWC A;  3BWU D;  3R2I A;  2JXT A;  3ABV B;  2IPK D;  4YT0 B;  2PIA A;  2N9K A;  3MFG A;  4MAC A;  1RYJ A;  2WXQ A;  3LYY A;  4B0M A;  4C80 A;  3LXF A;  1C4P A;  5AUK A;  4RGM A;  4C7Z A;  4HKZ E;  1ZDV A;  3N9Y C;  4GDL B;  4REZ A;  5D7G A;  1VDV A;  3RPF C;  2INN E;  4N6E B;  4FXC A;  2K22 A;  4OW0 A;  1B1Z A;  1NI3 A;  3Q8B A;  1I4H A;  2J4X A;  2OHF A;  2WXN A;  5I4D A;  4ZRQ A;  1HZ6 A;  3AE7 B;  2KN4 A;  4NJC A;  2LMC A;  2AQ1 B;  3CIR B;  1DOX A;  4L1B A;  4WAF A;  3U2S C;  1KLU D;  3BVZ A;  2WXH A;  4JX1 C;  2E6X A;  4YXD B;  2WXM A;  3AB5 A;  4JPS A;  2N0S B;  3V3X A;  3VRA B;  2IGH A;  1JWM D;  4KGR A;  4XDC A;  2JYT A;  2W55 A;  5H92 C;  3VRB B;  2BT6 A;  1XLQ A;  1ZDX A;  2WNM A;  2LFI A;  3MP9 A;  1VRA B;  4LK0 M;  1FNV A;  1C78 A;  2V4I B;  1YJI A;  4KGS A;  4IOI E;  1F2R C;  3NUH B;  3ZJU A;  3AEE B;  2TSS A;  1DOI A;  1P7F A;  1K53 A;  2X38 A;  4UDU C;  3GS2 A;  1KRH A;  1MVK A;  1JQ4 A;  2SAK A;  1C4A A;  1QOF A;  1YMH E;  2GRI A;  2QSD A;  4O1N A;  3LB8 C;  3ZYY X;  1E6E B;  4TQ0 A;  2H88 B;  2WU2 B;  5HI1 A;  3TEX A;  4OZB A;  1RM6 C;  3U52 E;  1KH0 A;  3SFE B;  2LEK A;  4NZL B;  1C76 A;  1V1O A;  1QQR A;  4A8X C;  1TKY A;  3AMZ A;  4IDI A;  4MH8 A;  3URY A;  4XWT A;  5AUI A;  1J7A A;  1ZOY B;  5EE1 A;  2ON8 A;  4MM3 B;  1UWM A;  2B76 B;  3P4S B;  3T3N A;  3RFZ B;  1FCC C;  2LJI A;  2R61 A;  1TS2 A;  4ZRP A;  2NMQ A;  3FIL B;  5FKA C;  4YSX B;  1Q10 A;  3I9V 1;  2BS4 B;  4RF1 A;  1LO5 D;  2PVO D;  1JML A;  1XCT L;  3BYT B;  1V8C A;  4PT5 A;  3TEZ A;  3BVG A;  3HVD A;  4HRS A;  3Q69 A;  1VZ8 A;  2DYO A;  1C4C A;  2WDR B;  1MPE A;  1V1P B;  2V3N A;  4WUR A;  3P42 A;  3GP7 A;  4RF0 A;  2IJ0 A;  4US8 A;  1PGB A;  1BUI C;  1D5Z C;  1BML C;  4ZHO A;  1WYG A;  3NRZ A;  1FMA D;  3Q8F A;  4US9 A;  1ZP0 B;  2WU5 B;  2RPV A;  1DYQ A;  3KLS X;  2K0P A;  1L6U A;  1RFK A;  1JWS D;  1ZPS A;  3OWE B;  1E0Z A;  1R7S A;  2H89 B;  1M4V A;  1UNS A;  2WXK A;  1YN5 A;  1FFV A;  2ACZ B;  1VLB A;  1NYQ A;  3ETR A;  5FK9 C;  3P1M A;  1NEN B;  1WXQ A;  4LTU A;  3AH7 A;  1C79 A;  2EEL A;  1JAL A;  3NVY A;  2MEK A;  5BYR A;  3AN1 A;  5HFY A;  3B2F A;  2VZK B;  3AEF B;  4ZHP A;  3E56 A;  2BBC A;  2ICI A;  1J7C A;  1FNU A;  3L4P A;  2ONQ A;  1TY0 A;  2KAJ A;  2LUM A;  1C77 A;  5G5H A;  1I4Q A;  1A70 A;  1YN3 A;  2WXF A;  4YTM B;  4R3D A;  2RDH A;  4KX6 B;  5BMG A;  3Q8C A;  1F0Z A;  1HA5 A;  1SJE D;  2JZP A;  4DQO C;  4AQ7 A;  1FFU A;  4RNA A;  4KGT A;  2K9X A;  2WDV B;  2V0G A;  1DOY A;  3PZ8 A;  2BS3 B;  4USA A;  3AV8 A;  4L2Y A;  4ARI A;  1D5M C;  1UUP A;  2ZW0 A;  1GB4 A;  1VZ6 A;  2Y3A A;  5D3I B;  5E6J A;  3VR8 B;  1YQ3 B;  3TSS A;  4RGO S;  1KFY B;  2J52 A;  2INP E;  1ESF A;  4XE0 A;  3AEB B;  1GAQ B;  1JRO A;  3VR9 B;  3SEB A;  1E7P B;  1IUE A;  5C3J B;  2AX5 A;  3HUI A;  1PYW D;  5C2T B;  1TKG A;  4C7Y A;  3H8H A;  3E9S A;  3W2D A;  1RWS A;  1ET9 A;  1I7H A;  1WWT A;  5HHD G;  1VZ7 A;  1L6V A;  1NVI D;  1IBX A;  4WWM A;  4GDK B;  2IGG A;  4RFB A;  3MJ5 A;  4J3O D;  3Q8E A;  3W5U B;  3AE8 B;  2NTT A;  1L0V B;  2Z8L A;  1SE4 A;  4RCO A;  1TKE A;  1OQR A;  3Q8A A;  4JE3 B;  2L1A A;  2WXG A;  1ZXI A;  4IKG A;  4TSS A;  3EGR A;  5BMI A;  4HEA 1;  3FIL A;  1IBX B;  3FAH A;  3EUB 2;  5BYS A;  4JWU C;  1QOA A;  1HEZ E;  1SB3 C;  1P7E A;  2J42 A;  1FIQ A;  2MJE A;  1N60 A;  4NAM A;  2BW2 A;  3T3O A;  1MI0 A;  2KMM A;  1PDX A;  1QF6 A;  4ZYS A;  1EU3 A;  3I57 A;  1WSP A;  2FE8 A;  4WQM A;  1TZO A;  2BYT A;  1CJE A;  2NTS A;  2WXI A;  4ARC A;  2WXO A;  1QLB B;  1DGJ A;  2QEJ C;  3B2G A;  3B9J A;  5TSS A;  4XWW A;  4DXF A;  1N63 A;  2GI9 A;  5HG2 A;  1FCL A;  1WRI A;  1D5X C;  1TY2 A;  4RGT A;  2LHD A;  2WXL A;  2YEP F;  1JWU D;  1N5X A;  2Q5W D;  4LLG M;  1T5X D;  3IT4 B;  1OFF A;  3P63 A;  1TS5 A;  1YQ4 B;  2W3S A;  1FD6 A;  4A6Q A;  1QIL A;  5BMH A;  1TJE A;  4TMA B;  3KQ4 A;  3R2T A;  3PZ7 A;  4Q2J A;  3AED B;  1FXI A;  1JCK B;  1YJJ A;  3AEC B;  1FXA A;  2IDY A;  1FRD A;  2OED A;  1I4P A;  2JQR B;  2PLP A;  1L4D B;  2M56 B;  1V1P A;  1SBB B;  4H2A A;  2DBY A;  2FUG 1;  2RMM A;  1FM0 D;  1EU4 A;  3TEW A;  5G5G A;  2ZW1 A;  2KAC A;  4HRO A;  2JYE A;  5BYQ A;  5T8I A;  2AQ2 B;  1FO4 A;  1SIJ A;  1K51 A;  2BB5 A;  2Y5C A;  2RDG A;  2M0A A;  3BK1 A;  5D3D A;  1B9R A;  1K52 A;  1AWD A;  1L4Z B;  1TS3 A;  3HVZ A;  1BXT A;  1C9F A;  2V3P A;  1STE A;  3U7Z A;  1CZP A;  4TQ1 A;  1E10 A;  3BYY B;  3IT6 B;  1OQQ A;  1D4B A;  1N62 A;  4GLS C;  4OHJ A;  4A55 A;  2CJN A;  4MT5 A;  1PGX A;  2CU3 A;  2JU6 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...