1CZPA

Anabaena pcc7119 [2fe-2s] ferredoxin in the reduced and oxixized state at 1.17 a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined X-ray structures of the oxidized, at 1.3 A, and reduced, at 1.17 A, [2Fe-2S] ferredoxin from the cyanobacterium Anabaena PCC7119 show redox-linked conformational changes.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords FERREDOXIN I
total genus 25
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1czpA00
3AMZA 1JW9D 4YTPB 1RWSA 1KF6B 3B2GA 1NYQA 3KWLA 1L6UA 1V8CA 3P63A 4YSYB 2WS3B 3P1MA 4A9AA 3AE5B 1WGKA 3FC4A 2WQYB 1QOFA 2PKOA 3L4PA 3SFDB 1N60A 1JROA 1ROEA 1N61A 1WWTA 4YT0B 1E0ZA 2W54A 1QOGA 1GAQB 5G5GA 2HTME 2BS3B 3NVWA 1QLBB 3AE1B 2CU3A 3B2FA 3BIID 1WYGA 2H89B 5G5HA 3AH7A 1E10A 3DWGC 2K5PA 1DOXA 3VR9B 2K22A 4YTNB 1FFVA 3AEBB 5AUIA 3P4RB 5H92C 1SF0A 3NRZA 4JWSC 2BT6A 2OHFA 5C3JB 1OFFA 4C80A 1XLOA 1YJJA 1AYFA 1FFUA 2MH7A 5MPOA 5AUKA 4WWMA 3AV8A 1A70A 1SIJA 1XLNA 2QIEB 1DOIA 2DWQA 3AE3B 1N5XA 2L52A 2KAJA 2L83A 3AE2B 2MJEA 1JRPA 1GPXA 2Y5CA 3ZYYX 2ACZB 2CJNA 1T3QA 3NVVA 4HROA 4C7ZA 1FM0D 1DOYA 1N5WA 2WDQB 1RFKA 2WU5B 4US8A 2QJLA 2LEKA 3PO0A 3VRAB 1JWAD 3NVYA 1TYGB 1XO3A 4ZHPA 4FXCA 2W55A 2CJOA 3HVZA 1L0VB 1DGJA 4IDIA 1NVID 3LXFA 5EE1A 1NENB 1B9RA 1JWBD 2KMMA 3FAHA 5H8YE 2WDRB 5EE3A 3AE4B 3ETRA 1NI3A 3HUIA 1YQ3B 4ITKA 1VJKA 1N62A 2H88B 3P4PB 1QOBA 3SFEB 1TKYA 3VR8B 4ZOHC 1V97A 1N63A 1FXAA 4JX1C 1JQ4A 1QF6A 4P6VF 2JX5A 3AE6B 3AE9B 1PUTA 1QOAA 1QT9A 1R7SA 3VRBB 1XLQA 3AEDB 1CJEA 3W5VB 2MJDA 1E9MA 4ZHOA 2WU2B 1IUEA 1WRIA 3CIRB 5GXGB 1FIQA 1SB3C 4YXDB 2WDVB 3HRDD 3AEGB 4WQMA 3AN1A 5C2TB 1FO4A 1PFDA 3AM9A 3AECB 1OQQA 2G1EA 2W3RA 3CWIA 3AE8B 3LB8C 1YJIA 1ZXIA 3RPFC 2Q5WD 4JWUC 3B9JA 1ZOYB 3DWMA 5EE9A 3W5UB 3AEAB 2AX5A 3AEEB 4HRSA 2BS4B 3ABVB 1TKEA 4C7YA 4N59A 2WLBA 2DBYA 1RM6C 2E3TA 2M56B 1I7HA 1E6EB 1J7CA 1NEKB 1PDXA 1WXQA 2B76B 2PIAA 1ZP0B 4USAA 1KFYB 1FXIA 4US9A 2M19A 2K9XA 1VLBA 1YQ4B 3NVZA 3NS1A 1ZUD2 1E7PB 1RYJA 2BS2B 2EKIA 3EUB2 1TKGA 2MJ3A 1OQRA 1FRDA 1FMAD 4YSZB 4LTUA 1UWMA 2N0SB 3P4SB 4N6EB 3SR6A 2FBWB 3AE7B 1NYRA 1J7AA 1L6VA 4KX6B 1FRRA 4YSXB 2PVGC 3W9CB 4YTMB 3P4QB 1VDVA 1KRHA 2PVOD 1JALA 1J7BA 3AEFB 1L5PA 1XLPA 1EWYC 2JQRB 2W3SA 4N58A 2WP9B 1F0ZA 3WCQA 5EE0A 3AB5A 1CZPA 1AWDA 1TJEA
chains in the Genus database with same CATH superfamily
3MFGA 4OHJA 2X38A 3ZJTA 1LO5D 3WAOA 4FULA 2RDHA 2RR9A 4DBGA 2N7DA 5G5GA 2KWVB 3E9SA 1T6BX 1V5OA 5IP4D 1FFVA 3TMPB 5AUIA 4GDLA 2JYTA 4C80A 3Q3FA 4A3PA 2KC1A 1A70A 2JVCA 4B6WA 3L08A 1FD6A 3NJTA 3ZRCA 1JRPA 1C4PA 2QMTA 4CO7A 2ZVNA 1P9DU 4DWFA 2GBNA 1WJUA 4WJPA 1V80A 2IJ0A 2QJLA 1X1MA 1JWAD 2QILA 1E5WA 1NVID 1JWBD 4NY0A 3N1ZC 4KSKC 3MJWA 2L76A 1V97A 3ECIA 1PUTA 1R7SA 2PLPA 4OW0A 1K53A 3RNEC 2C7NB 1TGZB 2N9PC 3AEGB 3ZO5B 3GP7A 2IGDA 2N7EA 4L2YA 4B0EA 3WA0A 2GBKA 3ABVB 2CS4A 1WF9A 4N59A 4NAMA 2C60A 3OG5A 1OGWA 4M01A 2V0GA 2NR2A 4LCDE 2FIDA 3NVZA 1F2RC 4EZKA 3IXSA 2PE9A 4RGTA 3ZNZB 3O65B 4M8MA 4ZRPA 2AEHA 3SDLC 3W9CB 4NAWA 4FJYA 1KRHA 2GLSA 2D3AA 2QC8A 4NNJB 4DK5A 5EE0A 1AWDA 1IBXB 1V8CA 2PJHA 3IG3A 3JYUA 3P1MA 1WGKA 3FC4A 2GB1A 2X8XX 1T0QC 4GXBA 1QLBB 3ZLZA 1G6JA 4XYCA 2M17A 1ZDVA 2N1WA 2JUOA 1TY0A 4IWPA 2MBQA 1C79A 3AU5A 2D5GA 5AZFA 4WJNA 2M0XA 1P0RA 3JSVA 3DOWA 3NS8A 1YD8U 4GSWA 4PT5A 2MBEA 4GDKA 2LMCA 3SD5A 2ZW0A 1C4AA 3PRZA 4AJYB 3ZDTA 1FM0D 3Q69A 4TUUA 3DBSA 1I42A 4US8A 3I63C 2INDC 3R3MA 4IM2A 4CHKA 4IM3A 1L0YB 1C1YB 1VZ7A 2BYEA 2G3QB 2AYOB 2BYVE 3Q2AC 1LM8B 4JX1C 1JQ4A 4W9GA 5DPTA 4S17A 4QAYA 3CSTA 3VRBB 3VH3B 2V3NA 2KDFB 2MJDA 2WU2B 5GXGB 2IBIB 2KD0A 3H7PA 3KUCB 4A55A 2RDGA 3N32A 3R8BA 1IYFA 5FR3A 4R3DA 5AZGA 2DBYA 2ZPYA 2MCNB 2B76B 1E6EB 4BBNF 1KFYB 1FXIA 1D5XC 3RYTA 4F7ZA 2M19A 3NS1A 3ML9A 3VXWA 1T0YA 1WGYA 4JE3B 1FMAD 2D10A 2OJWA 1ET9A 3BK2A 2KNBA 1JWSD 4OVZA 2N0SB 5D2MB 2WXGA 4BAXA 3B0AA 1L6VA 2L0TA 3DPDA 3KLSX 3HM6X 1Z2MA 1WMHA 5JH5C 3UI3A 1K50A 1TJEA 5CHFA 2LHDA 3OJ4B 4GGQA 1JMLA 3A4SC 3TSSA 1QOFA 5CHWA 3L13A 1KLUD 1ROEA 4TQ0A 1WWTA 2LRUA 3C19A 1GAQB 3Q8AA 5BMGA 1T5XD 1XCQL 2DZKA 2CU3A 2M8SA 4EZLA 3DQVA 2SAKA 2N9KA 1C78A 2WXFA 2ICIA 2OJRA 4NJ7A 2DNFA 5JHBA 3ZJVA 1KM7A 3AE3B 2IO1B 1OEYJ 3QHTA 3TEXA 3JW0X 4HROA 4GIVA 1WXSA 3I5JC 1MPEA 4LDTD 2IDYA 2GBJA 1E8XA 2KVZA 5GMVA 1YQ3B 2KMAA 2ZPNA 2JWUA 1VCBA 3ZUNA 3VQIA 2BTEA 3RFZB 2KANA 1N6ZA 4EKUA 1SB3C 3VVWB 3N9YC 1OEYA 4I6LB 4RNAA 2VZKB 2RDBC 3GOEA 3O13A 4KDIC 2IGHA 1SXTA 1NDDA 3NOBA 1T0RC 1YN3A 2M56B 4MGZE 2BWFA 4M0WB 1TZOA 3U52E 4RM8A 2YLMA 1YQ4B 2KFKA 1QZEA 2AQ3B 1I4QA 2KK8A 3AE7B 1ESFA 1NYRA 4A8XC 1UUPA 1ENFA 2KO3A 4KKJA 2LGXA 4DHZB 2O6VA 3VAWA 3DHIC 4W9EA 5TR5A 1L6UA 2K25A 3N20C 1V1OA 2PEAA 3SFDB 2ZCBA 1GNUA 1E0ZA 2KXJA 1CK1A 3BWUD 4C4VB 3AEBB 1UWXA 2ZNVC 1UELA 1YJJA 5C1ZA 3PHXB 1EF1A 1YN4A 4FN2A 1TS2A 1V81A 3BVMA 5IOIA 1T3QA 2D3BA 2KZRA 2NBUA 1WM2A 2EKEC 1H4RA 5H8YE 2WGSA 1VJKA 1WGHA 4ZRKA 2NMQA 1TKYA 4ZYSA 1WR1A 1FXAA 5IAAC 1UZXB 3RD2A 4P6VF 2V9HA 4W9DA 2WXNA 3DCGA 1BMLC 1K8RB 3MJ5A 3N3KB 4YXDB 3HRDD 2K39A 3DVGX 1C3TA 3BYYB 4RH6A 3B9JA 3MHZA 3MHSD 5D7GA 1F9JA 3NY5A 2Y5PA 1R4NI 1YJ1A 4PS3A 4X57B 4URKA 2FCSA 2BB5A 2MP2A 3OLMD 1KOTA 3ZDMC 3IAM1 3RNAC 2KJHB 2MJ3A 3VHTC 2KX3A 2V1YA 3T3OA 2OEDA 3QIJA 2KDBA 3IVFA 3C0RB 2L8JA 4N9F4 1VDVA 2MQJA 1P7FA 2K1FA 4BKSD 1XLPA 2WP9B 2HJ1A 4EFOA 1EUVB 3ZGZA 4YTPB 4W9HA 2O6VD 3ZTDA 1PGAA 5J18A 3P42A 3A9JA 2RSUA 3KW5B 2WXOA 4XWTA 1JRUA 2C5LC 3VTVA 3NRZA 4JWSC 5FR6A 2AQ2B 4HDQA 1JCKB 3DDCB 4RF1A 2LGDA 2Y5CA 4HJKA 2KTRA 4BZAA 4C7ZA 3V6CB 3V6EB 1RFKA 5IN7A 1L0VB 1DGJA 2ZVOA 1XT9B 2KQSA 4IM0A 1UBIA 2H88B 3VR8B 1Z5SB 4IKGA 2FCMA 1I4HA 3ZNGC 3L54A 2LGIA 4LJPB 4BFRA 5G2NA 1B1ZA 2J0MA 2WNMA 3PZ8A 3M62B 1D3ZA 1D5MC 3L10B 2WLBA 2WXKA 3GE8C 1J7CA 3L17A 2MRPA 3R66C 2J4XA 4NJCA 3TEWA 1NI2A 2FIFA 1LXDA 4XDCA 5KHOA 4NAWB 3ZQ4A 5LNK1 4XDDA 2FE8A 2WHIA 4KIKA 4AOFA 3IAS1 4N58A 2JY6A 2NBWB 2EMTA 4LLGM 2V3SA 1TZ1A 1D4BA 1VR9A 2ON8A 1IGDA 1KJTA 1J19A 2KWCA 4P1BC 1I35A 4M02A 3W1SC 1N61A 4DQOC 2O2VA 2Z0DB 2RPQA 3GS2A 2ZNVB 2H89B 1CMXB 1I4PA 3APDA 3P4RB 3VUWA 2J7QB 4DHJB 3PVLA 2DX5B 1HQRD 5E6PA 5AUKA 2QDFA 1XLNA 1WR6E 2CR5A 3RNCC 4OVVA 1ACCA 2L83A 1L4DB 2MJEA 4A90A 2KDMA 1WYWB 2Y3AA 1N5WA 1SSNA 2WDQB 3E56A 2WU5B 4HCNB 2LEKA 3RI7C 3V05A 3PREA 2K8HA 3SU8X 4K7SA 4GOCA 2C9WB 3ETRA 3A33B 3Q3OC 4B95A 3H6NA 4E71A 2GOWA 3PZDA 3T3NA 3Q8FA 1P3QU 1ZGUB 4LNOA 1VD2A 3AN1A 3OWEB 2G45B 1R4MB 3RT3B 4W9LA 2BS4B 2DAJA 1PDXA 2XBBC 1LGRA 1WSPA 1F1HA 2IYDB 3OAWA 2FBWB 4K7WA 5HI1A 2CU1A 4E74A 4OZCA 3A9KA 4GLSC 2IZVB 4TKNA 2V4LA 3QA8A 4NQKE 4KZ0A 2LVOA 2WS3B 3LDZE 2O2VB 3M63B 3L4PA 2M0AA 2PMVA 1JROA 3BYTB 2K6DB 3GE3C 3Q3MC 3AE1B 3AU4A 4TQ1A 1WGRA 5CTRC 4K1RB 1ZW7A 4A6QA 2KACA 3DWGC 2JYEA 3SHQA 5BMIA 1SIJA 1FPYA 2RD0A 4MSMB 1N5XA 2L52A 4HLEA 1C4CA 1P98A 2KJ6A 3NHEB 5HKHA 4B0MA 2IPKD 4BKGA 4RMAA 4JPSA 2JT4B 3D32A 2C7MB 2V4IB 3UGBB 2WDRB 1AARA 4KZCA 3T9LA 4GU2A 4K3BA 2KFJA 1UF0A 1KLGD 1WE6A 3EECA 1EU4A 3QJZA 1HA5A 3ALBA 2W3RA 4FADA 3AE8B 2ASQA 4JWUC 2KQ4X 1ISNA 3PRPB 2CHZA 2GBRA 4IOIE 4RGMA 3VTWA 4JGHB 2PE6B 4ANVA 4KGSA 4BVUC 2FCNA 2VH2A 2FUG1 1E7PB 3MC8A 4DXGA 1FEHA 4YSZB 4LTUA 5E6JA 1KH0A 4RF0A 1FNWA 2PVOD 1J7BA 3V62A 3KUZA 2MLBA 3UF8A 5DPWA 1HTQA 2K8CA 4EUTA 4I6NB 1KF6B 2D3GA 3AI5A 1HTOA 3A1QB 1Y56A 4RGNA 4AWJA 1N60A 4YT0B 4ARIA 2O6VB 2ZJDA 2KDEB 1YX5B 2K5PA 2KDIA 3TJPA 2JXTA 4OZAA 5LXIB 3GZNB 1SE9A 3EFCA 4EOYA 2KVRA 4G0NB 4JL9A 1PGXA 4CYEA 3PO0A 1C76A 2INCC 2WXJA 2J52A 3NVYA 2W55A 4ICUA 5EE1A 1B9RA 1Q10A 2I2YA 3HUIA 4KGRA 4MGKE 3GB1A 3QC8B 3FILB 1WJ4A 3S2AA 1WFYA 1TTNA 2XEWA 2IO3B 4A3OA 3T8MA 2KYWA 3EFUA 3ZW3A 3LB8C 4ICVA 2Q5WD 4W9CA 4A20A 3BY4B 2QCZA 1NEKB 4NPNA 4OZBA 3DVGY 1E8ZA 1ZUD2 2UYZB 2D11A 4PYZA 1MJDA 1WMHB 5IO9A 3P4SB 2MBBB 4KGTA 1WGGA 1IPGA 3QCAA 2DYMA 4DDGD 1RFAA 3IBEA 1CZPA 2LGYA 3DVNU 1JW9D 3A9JB 4L1BA 4G3XB 4GDLB 4P1CC 4YSYB 3L16A 4CQNA 4PK1A 3C8YA 1QKZA 3ZKJC 3ENEA 1VZ8A 1TIFA 2LUMA 2LJ5A 2BS3B 1STEA 1TY2A 1IBXA 5FK9C 1HEZE 2L1AA 2L00B 1WXMA 4EEWA 3A4RA 4FHJA 2G4DB 2N4FA 2BPSA 2IGGA 5H92C 1SF0A 2INPE 3VDZA 2BT6A 1OFFA 1XLOA 3PTFC 3LYYA 2XK5B 5BYSA 2MH7A 4KV2A 3PLUA 1TT5B 1DOIA 2LWPA 5EDSA 2IO0B 1U4AA 2C7HA 2CJNA 3HK0A 2A4ZA 2L32A 2WXRA 3VRAB 2WXQA 2JZZA 3U8ZA 3K9PB 1GC7A 5JZEB 1K52A 2UWQA 1N62A 2R2QA 3SFEB 1ZXHA 2JPHA 3IFWB 3VUYA 2XN9C 1YNTE 2G9HD 4K81A 1WXAA 2DZJA 1AN8A 4DXFA 1WRIA 3ZRFA 3HIZA 1PFDA 2WX0A 5JHAA 2G4SA 1WXVA 4HXDA 4MDKE 1SE4A 3AEAB 2BBCA 1V2YA 4M0WA 4PS8A 5DCNA 1SEBD 2BF8B 1EF5A 3QX1A 2HE7A 4USAA 1EU3A 3TIXA 1BXTA 3RULA 2DLBA 3URYA 2GRIA 2EKIA 1HE8A 1S1QB 1MG8A 2KLGA 1Q1OA 3SR6A 4N6EB 3B1LX 1V1PB 2MP2B 4KX6B 3TCAA 2KN4A 3R7QA 4HPPA 1L5PA 2JQRB 3PHWB 1QILA 5HHDG 3B08A 1FNUA 2YVCA 2A5UA 2MBHA 1E7UA 4XZ4A 4C4VA 2DYBA 4IG7B 2BGFA 4WQOB 3B2FA 5HG2A 2WXMA 1VRAB 1UH6A 4IW0A 3X0WA 2MW5A 1IGCA 2KWDA 2MA9B 3WIMA 5J2RA 2QIEB 2KT7A 2QHOA 3AE2B 3R2IA 5LLIA 5I4DA 5E6NA 4BKSA 4TSSA 1I4RA 2CJOA 4IDIA 3ZJUA 1NENB 2MHJA 3FAHA 5EE3A 1GB1A 4ZRQA 1UGJA 2KHWB 4HJGE 2PTLA 5BYQA 1YIWA 4L23A 1WE7A 2NVUI 3ZVVA 1CJEA 3ZNHB 1F77A 3VUXA 1IUEA 2RMMA 1FIQA 1V5TA 5C23A 1FO4A 1MI0A 3CWIA 1ZXIA 2JU6X 2K8BA 3Q8CA 2QSDA 1WJNA 1RRBA 1SE3A 5D3IB 3NUHB 2NPTB 2HJ8A 3H7PB 3KH0A 3UQAA 1FRRA 4GB9A 3OJ3A 3NZSA 2KOXA 2XNAC 4ZRIA 3ZNID 2DAFA 3WCQA 4HCPB 5LXHA 1YX6B 3UQBA 1UGMA 3L0WB 2WXIA 3B2GA 3KWLA 3BVGA 2J0KA 3U7DA 3JVZX 2IY0B 3RNGC 1F52A 4HKQA 4K3CA 2GMIC 4WH4A 5DPSA 4KDLB 4WJQA 4JIOU 2MEKA 4P7IA 3DBHI 2YEPB 2OHFA 2LVPA 3DBRI 2KTRB 4DHZE 5JXVA 3AV8A 1L2NA 4J6IA 3JSVB 4TV3A 2N9EB 4FBJB 3U30A 4RGOS 2D2QA 4JQWC 4TMAB 3NVVA 1DOYA 1WX8A 4YWGG 1YQBA 5G55A 3ML8A 1SJHD 2NTSA 3HVZA 3H7SA 2LD9A 3TL5A 2KMMA 1EO6A 2AL6A 4Q2JA 4I6PA 1GB4A 2BYFA 1QQRA 2LVQA 1SGHA 2ZW1A 1VZ6A 3RN9C 1UD7A 1XLQA 1OQYA 1XEEA 2EMSA 2M1MA 1E9MA 3KVFB 1WX9A 3ZXRA 1WY8A 5C2TB 3MTNB 4OVUA 2G1EA 3RZWC 2K6QA 4MACA 1H8CA 1RLFA 2D07B 4P16A 1R4NB 1TS3A 4GMVA 2EELA 2LHEA 3P2BA 4ANUA 4XWWA 1M94A 3N30A 5AZHA 1NBFC 1UBQA 4MELA 4AP4C 2E6XA 4YTMB 3PT2B 4GDKB 4WWNA 1XCTL 2J42A 1YOVB 4KSLC 5KHQA 1MHHE 5BMHA 1GJZA 2WQYB 1XD3B 3PGEA 2HTHA 2AL3A 1FCLA 1FNVA 3A1QA 1YN5A 2N9XA 3RZFA 2DZMA 3PV1A 1OTRB 2V3PA 4HWIB 2DYOA 5C3JB 3KYDD 1FFUA 1WZ0A 2N1VA 4ZYNA 1MVKA 2ZCCA 2K3UA 3VTUA 3BK1A 3DHHC 3CSFA 1JWMD 5D6JB 4HEA1 2NPTA 3R2TA 1ET6A 3P4PB 4ZOHC 1GG3A 1TBEA 4MT5A 3NZUA 3UIPB 1QF6A 3RMKC 2JX5A 2XK5A 3AE6B 1Y8RC 4EE2A 3QK0A 1RAXA 3DBLI 1HXYD 1SBBB 2BYTA 2KTFA 4ZHOA 3RNBC 4IUMB 5DPRA 3X23A 4D2KA 2FCQA 5EE9A 3DWMA 2Z0EB 2BWES 2R2OA 1BUIC 3HM3A 1V1PA 4RCOA 4DHJD 2PIAA 1WXQA 2WXHA 1I4XA 1ZP0B 1CQVA 2QEJC 2K9XA 2L0FA 3H8HA 2BS2B 3EUB2 2KC2A 2TSSA 3WALA 3N1YC 2KMCA 2ZEQA 4M00A 4F8CB 4BOSC 3TBLD 4PS7A 3AEFB 1D6EC 3V61A 1J0GA 3AMZA 3UINB 2KKCA 1HZ6A 2JZ3B 2BKFA 4J3OD 3SEBA 2JRHA 4UDUC 2W54A 2R61A 5IA7A 2WXPA 4W9JA 2VH1A 4WJOA 2JWZA 1V9JA 5G5HA 2DHZA 3VR9B 2K22A 2ZZPB 3FKYA 1AW7A 3HVDA 1WIAA 4ANXA 4M8NA 4FJVB 2LUEA 5TSSA 3ZYYX 2JSVX 4BKTA 1ZPSA 3DVNV 4MH0E 1XQQA 4AS1A 4ZRJA 1KTKA 5L95C 2LFIA 2AQ1B 1QOBA 3Q3NC 1N63A 5FKAC 4C56C 1E8YA 3AE9B 4BBNC 1MHXA 1MG4A 3KUDB 3AEDB 1WM3A 2HD5B 2WX1A 4WAFA 2KQ7A 4WQMA 4KIKB 3R7RA 2BVCA 3MC0B 2FNJB 3EA6A 3N1XC 1YJIA 3RPFC 1R4MI 2Z59B 3NZ3A 3AEEB 1E7VA 2LZ6A 4LNKA 5BO4B 3LJ3A 3CMMB 2E3TA 3J9CA 4IWQA 2M4NA 4DDID 1M4VA 1VLBA 2L7RA 4HPLB 1OQRA 1FRDA 4FHKA 3Q3JA 4FA6A 1F2RI 1ZDXA 1J7AA 2LI5A 2KJRA 4LNFA 4W9FA 3P4QB 3Q8BA 3W1SA 1FXTB 1WGDA 1I4GA 3EGRA 5CHVC 3ONSA 1ZE3D 1QOGA 4MJSB 1P1AA 3VFKA 3BIID 3M3JA 2PW9A 4IC7B 1E10A 4YTNB 1JWUD 1J8CA 1V49A 1WZ3A 3RUIB 1D5ZC 1ZKHA 1TS4A 1AYFA 2W82A 1XXGA 3EHVA 1WI0A 2LXCA 4WWOA 1GPXA 2ACZB 2RGFA 4YL8A 1GC6A 3KQ4A 1SJED 3NG0A 3MP9A 4ZHPA 3IT4B 4FXCA 1DYQA 3ZXVA 2NBVB 4ITKA 1EWCA 1FCCC 2SEBD 2I1JA 4MM3A 2L3ZA 1MFWA 3WANA 2DZIA 3QWZB 2YEPF 3PPAA 4HPMB 2NTTA 3Q6BA 1WJ6A 3CIRB 4WIPA 5T8IA 4AQ7A 1A5RA 2B3AA 3K9OB 3PSEB 3DHGC 3VH4B 2CHWA 5D3DA 1TKEA 2BKRB 1E8WA 3GZNI 4MGYE 4XC2A 5E6OA 3MC9A 4US9A 1L0XB 3A9KB 3IT6B 1V6EA 1EM7A 4MM3B 4REZA 3WAMA 4S0RA 2W9NA 3PRMB 1UWMA 2GI9A 1K51A 5HFYA 2VRRB 2PVGC 1JALA 2I1KA 2N7JA 3QQ8B 1Q0WB 4NJ6A 4IWOA 3AB5A 2NS5A 4W9KA 1RWSA 3PZ7A 4F1SA 1NYQA 1SE2A 1XF5L 2VZKD 3I9V1 4MJSA 2PKOA 2KX0A 2LJIA 1WH3A 3WAPA 1C77A 2L05A 4XE0A 2N9LA 2WDTB 3I3TB 1WYGA 2KLCA 3W1YA 3AH7A 4RFBA 1DOXA 4LK0M 4ASWC 2KWUB 4EZJA 4AUQC 1HZ5A 5D94A 3BVZA 3DBLB 1P7EA 4RM9A 1PQSA 4LDTB 4WWMA 2I38A 3DBHB 2DWQA 2BB6A 1WRDB 3TUOA 2LRWA 4HDOA 3H9DA 3H1UA 4JLCA 3Q8EA 1S3SG 2WYQA 3AE4B 3KYCD 4WURA 4ANWA 4YSXB 4AJWA 3V60A 3ZTCA 1LFDA 2Y5BB 4E3CA 4KVGB 2NCNA 1GUAB 1WX7A 4BOZB 2JXXA 1LQBA 4MGIE 1SIFA 3CF6E 3KWVA 2JZPA 5CX3A 2WDVB 2WWZA 4WAAA 5J17A 3FILA 1OQQA 3APCA 1ZOYB 2JRIB 3APFA 3TEYA 4PYUA 2LGSA 4ARCA 2REXA 1TS5A 3RNFC 1I7HA 4DXAB 4MH8A 4C00A 5L83A 4KKIA 1PGBA 1RYJA 1TKGA 2MSED 2KFKB 1UNSA 3PLVA 3HHMA 3DBRB 2HDEA 4ACFA 2W3SA 1F0ZA 2Z8LA 2INNE 1PYWD 2RPVA 3P63A 4A9AA 3AE5B 5IKCM 5AEKB 2AWTA 3AXCA 1KLVA 2UU7A 3W2DA 2FAZA 4LNIA 3ZIMA 4G50A 2HTME 3NVWA 3AULA 2DENB 2FUHB 2D3CA 4ZDVA 2CHXA 4GN1A 3I57A 5BYRA 1GOZA 3Q14C 2LXAA 4MSQB 4G11A 2CKHB 4II3B 3M95A 4XX5A 2J53A 1C9FA 2OOBB 5MPOA 1BT0A 2LASA 4XGAB 1V86A 2KAJA 2MBOA 3EC8A 2GBMA 2PPHA 3QAQA 1L7YA 1Q5WB 2K0PA 2BQQA 1IP9A 1TYGB 1XO3A 3RCZA 1L4ZB 3LXFA 4NQLB 1NI3A 4HKZE 3UIOB 2KN5A 1YMHE 4FJZA 4LJOB 2J0JA 4H2AA 1QOAA 1QT9A 4HK2A 4WWPA 3BZDB 2WXLA 3W5VB 4MEMA 4B9KA 3AM9A 2IO2B 3AECB 3QARA 3V3XA 4HVBA 1E90A 2IY1B 3W5UB 2ONQA 2AX5A 4HRSA 3U7ZA 4W9IA 4C7YA 4K7UA 4NZLB 1RM6C 1T0SC 2JF5A 3BINA 4II2B 3IHPC 2MX2A 2MWSB 3PS6A 3U4EG 4O1NA 4FLHA 3TEZA 1EWYC 3U2SC 4LNNA 2BW2A
chains in the Genus database with same CATH topology
3AMZA 3ZGZA 1HZ6A 1JW9D 3MFGA 4YTPB 4OHJA 4J3OD 2X38A 4L1BA 4GDLB 3ZJTA 4YSYB 1LO5D 1PGAA 4CQNA 3C8YA 1QKZA 3SEBA 2RDHA 4UDUC 1VZ8A 2R61A 2W54A 2WXPA 5G5GA 2LUMA 3E9SA 2BS3B 1STEA 1TY2A 3P42A 1IBXA 5FK9C 1HEZE 5G5HA 2L1AA 1T6BX 2WXOA 4XWTA 2K22A 3VR9B 1FFVA 1AW7A 2IGGA 5AUIA 5H92C 1SF0A 2INPE 3NRZA 2BT6A 2JYTA 3HVDA 1OFFA 4JWSC 1XLOA 4C80A 3LYYA 2AQ2B 5BYSA 2MH7A 1A70A 1JCKB 1DOIA 1FD6A 4RF1A 1JRPA 5TSSA 1C4PA 2QMTA 2Y5CA 3ZYYX 2CJNA 4C7ZA 2JSVX 2L32A 1RFKA 2IJ0A 2QJLA 1ZPSA 2WXRA 3VRAB 1JWAD 2WXQA 2QILA 1L0VB 1DGJA 4AS1A 1NVID 1KTKA 1JWBD 2LFIA 1K52A 2AQ1B 1N62A 2H88B 3SFEB 1QOBA 3VR8B 1ZXHA 1V97A 4IKGA 1N63A 2XN9C 5FKAC 4C56C 1YNTE 2G9HD 3AE9B 1PUTA 1I4HA 1R7SA 2PLPA 4OW0A 1AN8A 1K53A 1MHXA 4DXFA 3AEDB 1WRIA 2LGIA 4WAFA 3AEGB 4WQMA 1B1ZA 1PFDA 3GP7A 3MC0B 2IGDA 3EA6A 1YJIA 3RPFC 4L2YA 4B0EA 1SE4A 2WNMA 3PZ8A 3NZ3A 3AEAB 2BBCA 3AEEB 4M0WA 3ABVB 1D5MC 1SEBD 4N59A 2WLBA 4NAMA 2E3TA 2WXKA 3J9CA 2V0GA 1J7CA 4USAA 1EU3A 2J4XA 1BXTA 1M4VA 1VLBA 3NVZA 1F2RC 2DLBA 4NJCA 3IXSA 3URYA 2GRIA 2EKIA 4RGTA 3TEWA 1OQRA 1FRDA 4ZRPA 4XDCA 3SR6A 4N6EB 1F2RI 1ZDXA 4NAWB 1J7AA 1V1PB 4KX6B 2KN4A 3ZQ4A 3W9CB 5LNK1 4XDDA 2FE8A 3P4QB 1KRHA 3IAS1 3Q8BA 1L5PA 2JQRB 1QILA 4N58A 3W1SA 5HHDG 5EE0A 1FNUA 4LLGM 1AWDA 1D4BA 1I4GA 1IBXB 1VR9A 2ON8A 1IGDA 1V8CA 3P1MA 1WGKA 3FC4A 2GB1A 3EGRA 1N61A 1ZE3D 4DQOC 1QOGA 1QLBB 3GS2A 3B2FA 3BIID 2H89B 1ZDVA 5HG2A 2WXMA 1VRAB 2PW9A 1TY0A 1E10A 1I4PA 4YTNB 1C79A 1JWUD 2D5GA 1IGCA 3P4RB 1D5ZC 2KWDA 1HQRD 1TS4A 1AYFA 2W82A 1XXGA 5AUKA 2QIEB 1XLNA 4PT5A 2LMCA 1ACCA 2ZW0A 2L83A 1C4AA 1L4DB 2MJEA 3AE2B 1GPXA 3R2IA 4A90A 2KDMA 2ACZB 5I4DA 1FM0D 2Y3AA 1N5WA 1SSNA 2WDQB 3E56A 3Q69A 2WU5B 4US8A 3KQ4A 1SJED 2LEKA 4TSSA 3MP9A 4ZHPA 3IT4B 4FXCA 3V05A 1I4RA 2CJOA 4IDIA 1DYQA 3ZJUA 1NENB 1L0YB 3FAHA 1VZ7A 5EE3A 1GB1A 3ETRA 4ZRQA 4ITKA 1EWCA 1FCCC 1UGJA 2SEBD 4HJGE 2PTLA 5BYQA 4JX1C 1JQ4A 4L23A 3T3NA 3Q8FA 2YEPF 3VRBB 2V3NA 1CJEA 2NTTA 1F77A 2MJDA 2WU2B 1IUEA 3CIRB 2RMMA 1FIQA 4WIPA 5GXGB 5T8IA 4AQ7A 3AN1A 3OWEB 1FO4A 1MI0A 3CWIA 1ZXIA 4A55A 2RDGA 3R8BA 2JU6X 3Q8CA 4R3DA 5FR3A 2BS4B 5D3DA 1TKEA 2QSDA 2DBYA 2B76B 1E6EB 1PDXA 4US9A 1SE3A 1L0XB 5D3IB 1KFYB 1FXIA 1D5XC 1EM7A 3IT6B 3NUHB 4MM3B 2M19A 3NS1A 1WSPA 4REZA 4JE3B 1FMAD 1ET9A 3BK2A 1JWSD 4OVZA 1UWMA 2N0SB 2GI9A 2WXGA 1K51A 2FBWB 5HFYA 1L6VA 1FRRA 3KLSX 2PVGC 5HI1A 1JALA 2N7JA 2XNAC 4OZCA 3UI3A 3WCQA 1K50A 4GLSC 3AB5A 1TJEA 2LHDA 1RWSA 3PZ7A 1JMLA 2WXIA 1NYQA 3B2GA 3KWLA 3BVGA 3TSSA 1SE2A 1XF5L 2WS3B 2VZKD 3I9V1 1QOFA 2PKOA 3L4PA 2LJIA 2M0AA 2PMVA 1KLUD 1JROA 1ROEA 1WWTA 4TQ0A 1C77A 3BYTB 1GAQB 3Q8AA 4HKQA 5BMGA 1T5XD 2N9LA 1XCQL 4XE0A 3AE1B 4TQ1A 2CU3A 4WH4A 1WYGA 2MEKA 3AH7A 4RFBA 2KACA 2N9KA 2SAKA 3DWGC 4A6QA 1DOXA 4LK0M 1C78A 2JYEA 1HZ5A 2WXFA 2ICIA 2YEPB 2OHFA 3BVZA 5BMIA 1P7EA 5JXVA 3ZJVA 4WWMA 2I38A 3AV8A 1SIJA 2DWQA 3AE3B 2BB6A 1N5XA 2L52A 1C4CA 4RGOS 3TEXA 4TMAB 3NVVA 4HROA 1DOYA 4YWGG 4B0MA 3TUOA 2IPKD 1SJHD 4JPSA 2NTSA 2V4IB 1MPEA 3HVZA 2IDYA 2KMMA 2WDRB 3Q8EA 3AE4B 4WURA 4Q2JA 1YQ3B 4YSXB 1GB4A 2JWUA 1QQRA 2ZW1A 1VZ6A 3VQIA 1KLGD 2BTEA 1XLQA 3RFZB 1XEEA 1E9MA 1EU4A 2JZPA 3KWVA 1SB3C 2WDVB 3N9YC 1HA5A 5C2TB 4RNAA 2VZKB 3FILA 1OQQA 2G1EA 2W3RA 3AE8B 3O13A 4JWUC 4MACA 2IGHA 2KQ4X 1SXTA 1ZOYB 3TEYA 4ARCA 4IOIE 1TS5A 4P16A 1YN3A 4RGMA 2M56B 1I7HA 4MH8A 1TZOA 4KGSA 3U52E 4KKIA 1TS3A 1YQ4B 2EELA 2FUG1 1E7PB 2LHEA 1PGBA 1RYJA 2AQ3B 1TKGA 4DXGA 1I4QA 4XWWA 1FEHA 1UNSA 4YSZB 4LTUA 5E6JA 3AE7B 1ESFA 1KH0A 1NYRA 4RF0A 2E6XA 1FNWA 4YTMB 2PVOD 4A8XC 1J7BA 4GDKB 2HDEA 2W3SA 1UUPA 1ENFA 1F0ZA 1XCTL 4KKJA 2Z8LA 2J42A 1KF6B 2INNE 1L6UA 1PYWD 2RPVA 3P63A 4A9AA 1MHHE 5BMHA 3AE5B 1Y56A 2WQYB 1V1OA 4RGNA 3SFDB 1N60A 3W2DA 4YT0B 1E0ZA 1FCLA 1CK1A 2HTME 4ARIA 1FNVA 3NVWA 1YN5A 2K5PA 3I57A 5BYRA 3BWUD 1GOZA 3AEBB 2JXTA 1UWXA 4OZAA 2V3PA 2DYOA 5C3JB 1YJJA 2J53A 1C9FA 1FFUA 5MPOA 1YN4A 1TS2A 3BVMA 1MVKA 2KAJA 2K3UA 1T3QA 1PGXA 2K0PA 3BK1A 1C76A 2WXJA 3NVYA 2J52A 1TYGB 1XO3A 3PO0A 1JWMD 1L4ZB 2W55A 5EE1A 1B9RA 3LXFA 1Q10A 4HEA1 5H8YE 2I2YA 3R2TA 3HUIA 1NI3A 1VJKA 4KGRA 1ET6A 2NMQA 3P4PB 1TKYA 4ZYSA 4HKZE 4ZOHC 3GB1A 4MT5A 1FXAA 3FILB 1YMHE 1QF6A 4P6VF 2JX5A 3AE6B 4H2AA 4EE2A 1QOAA 1QT9A 2WXNA 3BZDB 2WXLA 1BMLC 1HXYD 1SBBB 2BYTA 3W5VB 4ZHOA 3MJ5A 4YXDB 3HRDD 3AM9A 4D2KA 3AECB 3LB8C 3BYYB 4RH6A 3V3XA 2Q5WD 3B9JA 3MHZA 3DWMA 5EE9A 2ONQA 5D7GA 3W5UB 2AX5A 2Y5PA 4HRSA 1BUIC 3U7ZA 1V1PA 4RCOA 4NZLB 4C7YA 1RM6C 1NEKB 2PIAA 1WXQA 2WXHA 1I4XA 1ZP0B 4OZBA 1CQVA 2BB5A 2QEJC 2K9XA 3H8HA 1ZUD2 3IAM1 2BS2B 3EUB2 2MJ3A 2TSSA 3P4SB 3T3OA 2OEDA 4KGTA 3U4EG 4O1NA 1VDVA 1P7FA 3AEFB 3TEZA 1D6EC 1EWYC 1XLPA 3U2SC 2DYMA 2WP9B 2BW2A 1CZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AMZ A;  1JW9 D;  4YTP B;  1RWS A;  1KF6 B;  3B2G A;  1NYQ A;  3KWL A;  1L6U A;  1V8C A;  3P63 A;  4YSY B;  2WS3 B;  3P1M A;  4A9A A;  3AE5 B;  1WGK A;  3FC4 A;  2WQY B;  1QOF A;  2PKO A;  3L4P A;  3SFD B;  1N60 A;  1JRO A;  1ROE A;  1N61 A;  1WWT A;  4YT0 B;  1E0Z A;  2W54 A;  1QOG A;  1GAQ B;  5G5G A;  2HTM E;  2BS3 B;  3NVW A;  1QLB B;  3AE1 B;  2CU3 A;  3B2F A;  3BII D;  1WYG A;  2H89 B;  5G5H A;  3AH7 A;  1E10 A;  3DWG C;  2K5P A;  1DOX A;  3VR9 B;  2K22 A;  4YTN B;  1FFV A;  3AEB B;  5AUI A;  3P4R B;  5H92 C;  1SF0 A;  3NRZ A;  4JWS C;  2BT6 A;  2OHF A;  5C3J B;  1OFF A;  4C80 A;  1XLO A;  1YJJ A;  1AYF A;  1FFU A;  2MH7 A;  5MPO A;  5AUK A;  4WWM A;  3AV8 A;  1A70 A;  1SIJ A;  1XLN A;  2QIE B;  1DOI A;  2DWQ A;  3AE3 B;  1N5X A;  2L52 A;  2KAJ A;  2L83 A;  3AE2 B;  2MJE A;  1JRP A;  1GPX A;  2Y5C A;  3ZYY X;  2ACZ B;  2CJN A;  1T3Q A;  3NVV A;  4HRO A;  4C7Z A;  1FM0 D;  1DOY A;  1N5W A;  2WDQ B;  1RFK A;  2WU5 B;  4US8 A;  2QJL A;  2LEK A;  3PO0 A;  3VRA B;  1JWA D;  3NVY A;  1TYG B;  1XO3 A;  4ZHP A;  4FXC A;  2W55 A;  2CJO A;  3HVZ A;  1L0V B;  1DGJ A;  4IDI A;  1NVI D;  3LXF A;  5EE1 A;  1NEN B;  1B9R A;  1JWB D;  2KMM A;  3FAH A;  5H8Y E;  2WDR B;  5EE3 A;  3AE4 B;  3ETR A;  1NI3 A;  3HUI A;  1YQ3 B;  4ITK A;  1VJK A;  1N62 A;  2H88 B;  3P4P B;  1QOB A;  3SFE B;  1TKY A;  3VR8 B;  4ZOH C;  1V97 A;  1N63 A;  1FXA A;  4JX1 C;  1JQ4 A;  1QF6 A;  4P6V F;  2JX5 A;  3AE6 B;  3AE9 B;  1PUT A;  1QOA A;  1QT9 A;  1R7S A;  3VRB B;  1XLQ A;  3AED B;  1CJE A;  3W5V B;  2MJD A;  1E9M A;  4ZHO A;  2WU2 B;  1IUE A;  1WRI A;  3CIR B;  5GXG B;  1FIQ A;  1SB3 C;  4YXD B;  2WDV B;  3HRD D;  3AEG B;  4WQM A;  3AN1 A;  5C2T B;  1FO4 A;  1PFD A;  3AM9 A;  3AEC B;  1OQQ A;  2G1E A;  2W3R A;  3CWI A;  3AE8 B;  3LB8 C;  1YJI A;  1ZXI A;  3RPF C;  2Q5W D;  4JWU C;  3B9J A;  1ZOY B;  3DWM A;  5EE9 A;  3W5U B;  3AEA B;  2AX5 A;  3AEE B;  4HRS A;  2BS4 B;  3ABV B;  1TKE A;  4C7Y A;  4N59 A;  2WLB A;  2DBY A;  1RM6 C;  2E3T A;  2M56 B;  1I7H A;  1E6E B;  1J7C A;  1NEK B;  1PDX A;  1WXQ A;  2B76 B;  2PIA A;  1ZP0 B;  4USA A;  1KFY B;  1FXI A;  4US9 A;  2M19 A;  2K9X A;  1VLB A;  1YQ4 B;  3NVZ A;  3NS1 A;  1ZUD 2;  1E7P B;  1RYJ A;  2BS2 B;  2EKI A;  3EUB 2;  1TKG A;  2MJ3 A;  1OQR A;  1FRD A;  1FMA D;  4YSZ B;  4LTU A;  1UWM A;  2N0S B;  3P4S B;  4N6E B;  3SR6 A;  2FBW B;  3AE7 B;  1NYR A;  1J7A A;  1L6V A;  4KX6 B;  1FRR A;  4YSX B;  2PVG C;  3W9C B;  4YTM B;  3P4Q B;  1VDV A;  1KRH A;  2PVO D;  1JAL A;  1J7B A;  3AEF B;  1L5P A;  1XLP A;  1EWY C;  2JQR B;  2W3S A;  4N58 A;  2WP9 B;  1F0Z A;  3WCQ A;  5EE0 A;  3AB5 A;  1CZP A;  1AWD A;  1TJE A; 
#chains in the Genus database with same CATH topology
 3MFG A;  4OHJ A;  2X38 A;  3ZJT A;  1LO5 D;  3WAO A;  4FUL A;  2RDH A;  2RR9 A;  4DBG A;  2N7D A;  5G5G A;  2KWV B;  3E9S A;  1T6B X;  1V5O A;  5IP4 D;  1FFV A;  3TMP B;  5AUI A;  4GDL A;  2JYT A;  4C80 A;  3Q3F A;  4A3P A;  2KC1 A;  1A70 A;  2JVC A;  4B6W A;  3L08 A;  1FD6 A;  3NJT A;  3ZRC A;  1JRP A;  1C4P A;  2QMT A;  4CO7 A;  2ZVN A;  1P9D U;  4DWF A;  2GBN A;  1WJU A;  4WJP A;  1V80 A;  2IJ0 A;  2QJL A;  1X1M A;  1JWA D;  2QIL A;  1E5W A;  1NVI D;  1JWB D;  4NY0 A;  3N1Z C;  4KSK C;  3MJW A;  2L76 A;  1V97 A;  3ECI A;  1PUT A;  1R7S A;  2PLP A;  4OW0 A;  1K53 A;  3RNE C;  2C7N B;  1TGZ B;  2N9P C;  3AEG B;  3ZO5 B;  3GP7 A;  2IGD A;  2N7E A;  4L2Y A;  4B0E A;  3WA0 A;  2GBK A;  3ABV B;  2CS4 A;  1WF9 A;  4N59 A;  4NAM A;  2C60 A;  3OG5 A;  1OGW A;  4M01 A;  2V0G A;  2NR2 A;  4LCD E;  2FID A;  3NVZ A;  1F2R C;  4EZK A;  3IXS A;  2PE9 A;  4RGT A;  3ZNZ B;  3O65 B;  4M8M A;  4ZRP A;  2AEH A;  3SDL C;  3W9C B;  4NAW A;  4FJY A;  1KRH A;  2GLS A;  2D3A A;  2QC8 A;  4NNJ B;  4DK5 A;  5EE0 A;  1AWD A;  1IBX B;  1V8C A;  2PJH A;  3IG3 A;  3JYU A;  3P1M A;  1WGK A;  3FC4 A;  2GB1 A;  2X8X X;  1T0Q C;  4GXB A;  1QLB B;  3ZLZ A;  1G6J A;  4XYC A;  2M17 A;  1ZDV A;  2N1W A;  2JUO A;  1TY0 A;  4IWP A;  2MBQ A;  1C79 A;  3AU5 A;  2D5G A;  5AZF A;  4WJN A;  2M0X A;  1P0R A;  3JSV A;  3DOW A;  3NS8 A;  1YD8 U;  4GSW A;  4PT5 A;  2MBE A;  4GDK A;  2LMC A;  3SD5 A;  2ZW0 A;  1C4A A;  3PRZ A;  4AJY B;  3ZDT A;  1FM0 D;  3Q69 A;  4TUU A;  3DBS A;  1I42 A;  4US8 A;  3I63 C;  2IND C;  3R3M A;  4IM2 A;  4CHK A;  4IM3 A;  1L0Y B;  1C1Y B;  1VZ7 A;  2BYE A;  2G3Q B;  2AYO B;  2BYV E;  3Q2A C;  1LM8 B;  4JX1 C;  1JQ4 A;  4W9G A;  5DPT A;  4S17 A;  4QAY A;  3CST A;  3VRB B;  3VH3 B;  2V3N A;  2KDF B;  2MJD A;  2WU2 B;  5GXG B;  2IBI B;  2KD0 A;  3H7P A;  3KUC B;  4A55 A;  2RDG A;  3N32 A;  3R8B A;  1IYF A;  5FR3 A;  4R3D A;  5AZG A;  2DBY A;  2ZPY A;  2MCN B;  2B76 B;  1E6E B;  4BBN F;  1KFY B;  1FXI A;  1D5X C;  3RYT A;  4F7Z A;  2M19 A;  3NS1 A;  3ML9 A;  3VXW A;  1T0Y A;  1WGY A;  4JE3 B;  1FMA D;  2D10 A;  2OJW A;  1ET9 A;  3BK2 A;  2KNB A;  1JWS D;  4OVZ A;  2N0S B;  5D2M B;  2WXG A;  4BAX A;  3B0A A;  1L6V A;  2L0T A;  3DPD A;  3KLS X;  3HM6 X;  1Z2M A;  1WMH A;  5JH5 C;  3UI3 A;  1K50 A;  1TJE A;  5CHF A;  2LHD A;  3OJ4 B;  4GGQ A;  1JML A;  3A4S C;  3TSS A;  1QOF A;  5CHW A;  3L13 A;  1KLU D;  1ROE A;  4TQ0 A;  1WWT A;  2LRU A;  3C19 A;  1GAQ B;  3Q8A A;  5BMG A;  1T5X D;  1XCQ L;  2DZK A;  2CU3 A;  2M8S A;  4EZL A;  3DQV A;  2SAK A;  2N9K A;  1C78 A;  2WXF A;  2ICI A;  2OJR A;  4NJ7 A;  2DNF A;  5JHB A;  3ZJV A;  1KM7 A;  3AE3 B;  2IO1 B;  1OEY J;  3QHT A;  3TEX A;  3JW0 X;  4HRO A;  4GIV A;  1WXS A;  3I5J C;  1MPE A;  4LDT D;  2IDY A;  2GBJ A;  1E8X A;  2KVZ A;  5GMV A;  1YQ3 B;  2KMA A;  2ZPN A;  2JWU A;  1VCB A;  3ZUN A;  3VQI A;  2BTE A;  3RFZ B;  2KAN A;  1N6Z A;  4EKU A;  1SB3 C;  3VVW B;  3N9Y C;  1OEY A;  4I6L B;  4RNA A;  2VZK B;  2RDB C;  3GOE A;  3O13 A;  4KDI C;  2IGH A;  1SXT A;  1NDD A;  3NOB A;  1T0R C;  1YN3 A;  2M56 B;  4MGZ E;  2BWF A;  4M0W B;  1TZO A;  3U52 E;  4RM8 A;  2YLM A;  1YQ4 B;  2KFK A;  1QZE A;  2AQ3 B;  1I4Q A;  2KK8 A;  3AE7 B;  1ESF A;  1NYR A;  4A8X C;  1UUP A;  1ENF A;  2KO3 A;  4KKJ A;  2LGX A;  4DHZ B;  2O6V A;  3VAW A;  3DHI C;  4W9E A;  5TR5 A;  1L6U A;  2K25 A;  3N20 C;  1V1O A;  2PEA A;  3SFD B;  2ZCB A;  1GNU A;  1E0Z A;  2KXJ A;  1CK1 A;  3BWU D;  4C4V B;  3AEB B;  1UWX A;  2ZNV C;  1UEL A;  1YJJ A;  5C1Z A;  3PHX B;  1EF1 A;  1YN4 A;  4FN2 A;  1TS2 A;  1V81 A;  3BVM A;  5IOI A;  1T3Q A;  2D3B A;  2KZR A;  2NBU A;  1WM2 A;  2EKE C;  1H4R A;  5H8Y E;  2WGS A;  1VJK A;  1WGH A;  4ZRK A;  2NMQ A;  1TKY A;  4ZYS A;  1WR1 A;  1FXA A;  5IAA C;  1UZX B;  3RD2 A;  4P6V F;  2V9H A;  4W9D A;  2WXN A;  3DCG A;  1BML C;  1K8R B;  3MJ5 A;  3N3K B;  4YXD B;  3HRD D;  2K39 A;  3DVG X;  1C3T A;  3BYY B;  4RH6 A;  3B9J A;  3MHZ A;  3MHS D;  5D7G A;  1F9J A;  3NY5 A;  2Y5P A;  1R4N I;  1YJ1 A;  4PS3 A;  4X57 B;  4URK A;  2FCS A;  2BB5 A;  2MP2 A;  3OLM D;  1KOT A;  3ZDM C;  3IAM 1;  3RNA C;  2KJH B;  2MJ3 A;  3VHT C;  2KX3 A;  2V1Y A;  3T3O A;  2OED A;  3QIJ A;  2KDB A;  3IVF A;  3C0R B;  2L8J A;  4N9F 4;  1VDV A;  2MQJ A;  1P7F A;  2K1F A;  4BKS D;  1XLP A;  2WP9 B;  2HJ1 A;  4EFO A;  1EUV B;  3ZGZ A;  4YTP B;  4W9H A;  2O6V D;  3ZTD A;  1PGA A;  5J18 A;  3P42 A;  3A9J A;  2RSU A;  3KW5 B;  2WXO A;  4XWT A;  1JRU A;  2C5L C;  3VTV A;  3NRZ A;  4JWS C;  5FR6 A;  2AQ2 B;  4HDQ A;  1JCK B;  3DDC B;  4RF1 A;  2LGD A;  2Y5C A;  4HJK A;  2KTR A;  4BZA A;  4C7Z A;  3V6C B;  3V6E B;  1RFK A;  5IN7 A;  1L0V B;  1DGJ A;  2ZVO A;  1XT9 B;  2KQS A;  4IM0 A;  1UBI A;  2H88 B;  3VR8 B;  1Z5S B;  4IKG A;  2FCM A;  1I4H A;  3ZNG C;  3L54 A;  2LGI A;  4LJP B;  4BFR A;  5G2N A;  1B1Z A;  2J0M A;  2WNM A;  3PZ8 A;  3M62 B;  1D3Z A;  1D5M C;  3L10 B;  2WLB A;  2WXK A;  3GE8 C;  1J7C A;  3L17 A;  2MRP A;  3R66 C;  2J4X A;  4NJC A;  3TEW A;  1NI2 A;  2FIF A;  1LXD A;  4XDC A;  5KHO A;  4NAW B;  3ZQ4 A;  5LNK 1;  4XDD A;  2FE8 A;  2WHI A;  4KIK A;  4AOF A;  3IAS 1;  4N58 A;  2JY6 A;  2NBW B;  2EMT A;  4LLG M;  2V3S A;  1TZ1 A;  1D4B A;  1VR9 A;  2ON8 A;  1IGD A;  1KJT A;  1J19 A;  2KWC A;  4P1B C;  1I35 A;  4M02 A;  3W1S C;  1N61 A;  4DQO C;  2O2V A;  2Z0D B;  2RPQ A;  3GS2 A;  2ZNV B;  2H89 B;  1CMX B;  1I4P A;  3APD A;  3P4R B;  3VUW A;  2J7Q B;  4DHJ B;  3PVL A;  2DX5 B;  1HQR D;  5E6P A;  5AUK A;  2QDF A;  1XLN A;  1WR6 E;  2CR5 A;  3RNC C;  4OVV A;  1ACC A;  2L83 A;  1L4D B;  2MJE A;  4A90 A;  2KDM A;  1WYW B;  2Y3A A;  1N5W A;  1SSN A;  2WDQ B;  3E56 A;  2WU5 B;  4HCN B;  2LEK A;  3RI7 C;  3V05 A;  3PRE A;  2K8H A;  3SU8 X;  4K7S A;  4GOC A;  2C9W B;  3ETR A;  3A33 B;  3Q3O C;  4B95 A;  3H6N A;  4E71 A;  2GOW A;  3PZD A;  3T3N A;  3Q8F A;  1P3Q U;  1ZGU B;  4LNO A;  1VD2 A;  3AN1 A;  3OWE B;  2G45 B;  1R4M B;  3RT3 B;  4W9L A;  2BS4 B;  2DAJ A;  1PDX A;  2XBB C;  1LGR A;  1WSP A;  1F1H A;  2IYD B;  3OAW A;  2FBW B;  4K7W A;  5HI1 A;  2CU1 A;  4E74 A;  4OZC A;  3A9K A;  4GLS C;  2IZV B;  4TKN A;  2V4L A;  3QA8 A;  4NQK E;  4KZ0 A;  2LVO A;  2WS3 B;  3LDZ E;  2O2V B;  3M63 B;  3L4P A;  2M0A A;  2PMV A;  1JRO A;  3BYT B;  2K6D B;  3GE3 C;  3Q3M C;  3AE1 B;  3AU4 A;  4TQ1 A;  1WGR A;  5CTR C;  4K1R B;  1ZW7 A;  4A6Q A;  2KAC A;  3DWG C;  2JYE A;  3SHQ A;  5BMI A;  1SIJ A;  1FPY A;  2RD0 A;  4MSM B;  1N5X A;  2L52 A;  4HLE A;  1C4C A;  1P98 A;  2KJ6 A;  3NHE B;  5HKH A;  4B0M A;  2IPK D;  4BKG A;  4RMA A;  4JPS A;  2JT4 B;  3D32 A;  2C7M B;  2V4I B;  3UGB B;  2WDR B;  1AAR A;  4KZC A;  3T9L A;  4GU2 A;  4K3B A;  2KFJ A;  1UF0 A;  1KLG D;  1WE6 A;  3EEC A;  1EU4 A;  3QJZ A;  1HA5 A;  3ALB A;  2W3R A;  4FAD A;  3AE8 B;  2ASQ A;  4JWU C;  2KQ4 X;  1ISN A;  3PRP B;  2CHZ A;  2GBR A;  4IOI E;  4RGM A;  3VTW A;  4JGH B;  2PE6 B;  4ANV A;  4KGS A;  4BVU C;  2FCN A;  2VH2 A;  2FUG 1;  1E7P B;  3MC8 A;  4DXG A;  1FEH A;  4YSZ B;  4LTU A;  5E6J A;  1KH0 A;  4RF0 A;  1FNW A;  2PVO D;  1J7B A;  3V62 A;  3KUZ A;  2MLB A;  3UF8 A;  5DPW A;  1HTQ A;  2K8C A;  4EUT A;  4I6N B;  1KF6 B;  2D3G A;  3AI5 A;  1HTO A;  3A1Q B;  1Y56 A;  4RGN A;  4AWJ A;  1N60 A;  4YT0 B;  4ARI A;  2O6V B;  2ZJD A;  2KDE B;  1YX5 B;  2K5P A;  2KDI A;  3TJP A;  2JXT A;  4OZA A;  5LXI B;  3GZN B;  1SE9 A;  3EFC A;  4EOY A;  2KVR A;  4G0N B;  4JL9 A;  1PGX A;  4CYE A;  3PO0 A;  1C76 A;  2INC C;  2WXJ A;  2J52 A;  3NVY A;  2W55 A;  4ICU A;  5EE1 A;  1B9R A;  1Q10 A;  2I2Y A;  3HUI A;  4KGR A;  4MGK E;  3GB1 A;  3QC8 B;  3FIL B;  1WJ4 A;  3S2A A;  1WFY A;  1TTN A;  2XEW A;  2IO3 B;  4A3O A;  3T8M A;  2KYW A;  3EFU A;  3ZW3 A;  3LB8 C;  4ICV A;  2Q5W D;  4W9C A;  4A20 A;  3BY4 B;  2QCZ A;  1NEK B;  4NPN A;  4OZB A;  3DVG Y;  1E8Z A;  1ZUD 2;  2UYZ B;  2D11 A;  4PYZ A;  1MJD A;  1WMH B;  5IO9 A;  3P4S B;  2MBB B;  4KGT A;  1WGG A;  1IPG A;  3QCA A;  2DYM A;  4DDG D;  1RFA A;  3IBE A;  1CZP A;  2LGY A;  3DVN U;  1JW9 D;  3A9J B;  4L1B A;  4G3X B;  4GDL B;  4P1C C;  4YSY B;  3L16 A;  4CQN A;  4PK1 A;  3C8Y A;  1QKZ A;  3ZKJ C;  3ENE A;  1VZ8 A;  1TIF A;  2LUM A;  2LJ5 A;  2BS3 B;  1STE A;  1TY2 A;  1IBX A;  5FK9 C;  1HEZ E;  2L1A A;  2L00 B;  1WXM A;  4EEW A;  3A4R A;  4FHJ A;  2G4D B;  2N4F A;  2BPS A;  2IGG A;  5H92 C;  1SF0 A;  2INP E;  3VDZ A;  2BT6 A;  1OFF A;  1XLO A;  3PTF C;  3LYY A;  2XK5 B;  5BYS A;  2MH7 A;  4KV2 A;  3PLU A;  1TT5 B;  1DOI A;  2LWP A;  5EDS A;  2IO0 B;  1U4A A;  2C7H A;  2CJN A;  3HK0 A;  2A4Z A;  2L32 A;  2WXR A;  3VRA B;  2WXQ A;  2JZZ A;  3U8Z A;  3K9P B;  1GC7 A;  5JZE B;  1K52 A;  2UWQ A;  1N62 A;  2R2Q A;  3SFE B;  1ZXH A;  2JPH A;  3IFW B;  3VUY A;  2XN9 C;  1YNT E;  2G9H D;  4K81 A;  1WXA A;  2DZJ A;  1AN8 A;  4DXF A;  1WRI A;  3ZRF A;  3HIZ A;  1PFD A;  2WX0 A;  5JHA A;  2G4S A;  1WXV A;  4HXD A;  4MDK E;  1SE4 A;  3AEA B;  2BBC A;  1V2Y A;  4M0W A;  4PS8 A;  5DCN A;  1SEB D;  2BF8 B;  1EF5 A;  3QX1 A;  2HE7 A;  4USA A;  1EU3 A;  3TIX A;  1BXT A;  3RUL A;  2DLB A;  3URY A;  2GRI A;  2EKI A;  1HE8 A;  1S1Q B;  1MG8 A;  2KLG A;  1Q1O A;  3SR6 A;  4N6E B;  3B1L X;  1V1P B;  2MP2 B;  4KX6 B;  3TCA A;  2KN4 A;  3R7Q A;  4HPP A;  1L5P A;  2JQR B;  3PHW B;  1QIL A;  5HHD G;  3B08 A;  1FNU A;  2YVC A;  2A5U A;  2MBH A;  1E7U A;  4XZ4 A;  4C4V A;  2DYB A;  4IG7 B;  2BGF A;  4WQO B;  3B2F A;  5HG2 A;  2WXM A;  1VRA B;  1UH6 A;  4IW0 A;  3X0W A;  2MW5 A;  1IGC A;  2KWD A;  2MA9 B;  3WIM A;  5J2R A;  2QIE B;  2KT7 A;  2QHO A;  3AE2 B;  3R2I A;  5LLI A;  5I4D A;  5E6N A;  4BKS A;  4TSS A;  1I4R A;  2CJO A;  4IDI A;  3ZJU A;  1NEN B;  2MHJ A;  3FAH A;  5EE3 A;  1GB1 A;  4ZRQ A;  1UGJ A;  2KHW B;  4HJG E;  2PTL A;  5BYQ A;  1YIW A;  4L23 A;  1WE7 A;  2NVU I;  3ZVV A;  1CJE A;  3ZNH B;  1F77 A;  3VUX A;  1IUE A;  2RMM A;  1FIQ A;  1V5T A;  5C23 A;  1FO4 A;  1MI0 A;  3CWI A;  1ZXI A;  2JU6 X;  2K8B A;  3Q8C A;  2QSD A;  1WJN A;  1RRB A;  1SE3 A;  5D3I B;  3NUH B;  2NPT B;  2HJ8 A;  3H7P B;  3KH0 A;  3UQA A;  1FRR A;  4GB9 A;  3OJ3 A;  3NZS A;  2KOX A;  2XNA C;  4ZRI A;  3ZNI D;  2DAF A;  3WCQ A;  4HCP B;  5LXH A;  1YX6 B;  3UQB A;  1UGM A;  3L0W B;  2WXI A;  3B2G A;  3KWL A;  3BVG A;  2J0K A;  3U7D A;  3JVZ X;  2IY0 B;  3RNG C;  1F52 A;  4HKQ A;  4K3C A;  2GMI C;  4WH4 A;  5DPS A;  4KDL B;  4WJQ A;  4JIO U;  2MEK A;  4P7I A;  3DBH I;  2YEP B;  2OHF A;  2LVP A;  3DBR I;  2KTR B;  4DHZ E;  5JXV A;  3AV8 A;  1L2N A;  4J6I A;  3JSV B;  4TV3 A;  2N9E B;  4FBJ B;  3U30 A;  4RGO S;  2D2Q A;  4JQW C;  4TMA B;  3NVV A;  1DOY A;  1WX8 A;  4YWG G;  1YQB A;  5G55 A;  3ML8 A;  1SJH D;  2NTS A;  3HVZ A;  3H7S A;  2LD9 A;  3TL5 A;  2KMM A;  1EO6 A;  2AL6 A;  4Q2J A;  4I6P A;  1GB4 A;  2BYF A;  1QQR A;  2LVQ A;  1SGH A;  2ZW1 A;  1VZ6 A;  3RN9 C;  1UD7 A;  1XLQ A;  1OQY A;  1XEE A;  2EMS A;  2M1M A;  1E9M A;  3KVF B;  1WX9 A;  3ZXR A;  1WY8 A;  5C2T B;  3MTN B;  4OVU A;  2G1E A;  3RZW C;  2K6Q A;  4MAC A;  1H8C A;  1RLF A;  2D07 B;  4P16 A;  1R4N B;  1TS3 A;  4GMV A;  2EEL A;  2LHE A;  3P2B A;  4ANU A;  4XWW A;  1M94 A;  3N30 A;  5AZH A;  1NBF C;  1UBQ A;  4MEL A;  4AP4 C;  2E6X A;  4YTM B;  3PT2 B;  4GDK B;  4WWN A;  1XCT L;  2J42 A;  1YOV B;  4KSL C;  5KHQ A;  1MHH E;  5BMH A;  1GJZ A;  2WQY B;  1XD3 B;  3PGE A;  2HTH A;  2AL3 A;  1FCL A;  1FNV A;  3A1Q A;  1YN5 A;  2N9X A;  3RZF A;  2DZM A;  3PV1 A;  1OTR B;  2V3P A;  4HWI B;  2DYO A;  5C3J B;  3KYD D;  1FFU A;  1WZ0 A;  2N1V A;  4ZYN A;  1MVK A;  2ZCC A;  2K3U A;  3VTU A;  3BK1 A;  3DHH C;  3CSF A;  1JWM D;  5D6J B;  4HEA 1;  2NPT A;  3R2T A;  1ET6 A;  3P4P B;  4ZOH C;  1GG3 A;  1TBE A;  4MT5 A;  3NZU A;  3UIP B;  1QF6 A;  3RMK C;  2JX5 A;  2XK5 A;  3AE6 B;  1Y8R C;  4EE2 A;  3QK0 A;  1RAX A;  3DBL I;  1HXY D;  1SBB B;  2BYT A;  2KTF A;  4ZHO A;  3RNB C;  4IUM B;  5DPR A;  3X23 A;  4D2K A;  2FCQ A;  5EE9 A;  3DWM A;  2Z0E B;  2BWE S;  2R2O A;  1BUI C;  3HM3 A;  1V1P A;  4RCO A;  4DHJ D;  2PIA A;  1WXQ A;  2WXH A;  1I4X A;  1ZP0 B;  1CQV A;  2QEJ C;  2K9X A;  2L0F A;  3H8H A;  2BS2 B;  3EUB 2;  2KC2 A;  2TSS A;  3WAL A;  3N1Y C;  2KMC A;  2ZEQ A;  4M00 A;  4F8C B;  4BOS C;  3TBL D;  4PS7 A;  3AEF B;  1D6E C;  3V61 A;  1J0G A;  3AMZ A;  3UIN B;  2KKC A;  1HZ6 A;  2JZ3 B;  2BKF A;  4J3O D;  3SEB A;  2JRH A;  4UDU C;  2W54 A;  2R61 A;  5IA7 A;  2WXP A;  4W9J A;  2VH1 A;  4WJO A;  2JWZ A;  1V9J A;  5G5H A;  2DHZ A;  3VR9 B;  2K22 A;  2ZZP B;  3FKY A;  1AW7 A;  3HVD A;  1WIA A;  4ANX A;  4M8N A;  4FJV B;  2LUE A;  5TSS A;  3ZYY X;  2JSV X;  4BKT A;  1ZPS A;  3DVN V;  4MH0 E;  1XQQ A;  4AS1 A;  4ZRJ A;  1KTK A;  5L95 C;  2LFI A;  2AQ1 B;  1QOB A;  3Q3N C;  1N63 A;  5FKA C;  4C56 C;  1E8Y A;  3AE9 B;  4BBN C;  1MHX A;  1MG4 A;  3KUD B;  3AED B;  1WM3 A;  2HD5 B;  2WX1 A;  4WAF A;  2KQ7 A;  4WQM A;  4KIK B;  3R7R A;  2BVC A;  3MC0 B;  2FNJ B;  3EA6 A;  3N1X C;  1YJI A;  3RPF C;  1R4M I;  2Z59 B;  3NZ3 A;  3AEE B;  1E7V A;  2LZ6 A;  4LNK A;  5BO4 B;  3LJ3 A;  3CMM B;  2E3T A;  3J9C A;  4IWQ A;  2M4N A;  4DDI D;  1M4V A;  1VLB A;  2L7R A;  4HPL B;  1OQR A;  1FRD A;  4FHK A;  3Q3J A;  4FA6 A;  1F2R I;  1ZDX A;  1J7A A;  2LI5 A;  2KJR A;  4LNF A;  4W9F A;  3P4Q B;  3Q8B A;  3W1S A;  1FXT B;  1WGD A;  1I4G A;  3EGR A;  5CHV C;  3ONS A;  1ZE3 D;  1QOG A;  4MJS B;  1P1A A;  3VFK A;  3BII D;  3M3J A;  2PW9 A;  4IC7 B;  1E10 A;  4YTN B;  1JWU D;  1J8C A;  1V49 A;  1WZ3 A;  3RUI B;  1D5Z C;  1ZKH A;  1TS4 A;  1AYF A;  2W82 A;  1XXG A;  3EHV A;  1WI0 A;  2LXC A;  4WWO A;  1GPX A;  2ACZ B;  2RGF A;  4YL8 A;  1GC6 A;  3KQ4 A;  1SJE D;  3NG0 A;  3MP9 A;  4ZHP A;  3IT4 B;  4FXC A;  1DYQ A;  3ZXV A;  2NBV B;  4ITK A;  1EWC A;  1FCC C;  2SEB D;  2I1J A;  4MM3 A;  2L3Z A;  1MFW A;  3WAN A;  2DZI A;  3QWZ B;  2YEP F;  3PPA A;  4HPM B;  2NTT A;  3Q6B A;  1WJ6 A;  3CIR B;  4WIP A;  5T8I A;  4AQ7 A;  1A5R A;  2B3A A;  3K9O B;  3PSE B;  3DHG C;  3VH4 B;  2CHW A;  5D3D A;  1TKE A;  2BKR B;  1E8W A;  3GZN I;  4MGY E;  4XC2 A;  5E6O A;  3MC9 A;  4US9 A;  1L0X B;  3A9K B;  3IT6 B;  1V6E A;  1EM7 A;  4MM3 B;  4REZ A;  3WAM A;  4S0R A;  2W9N A;  3PRM B;  1UWM A;  2GI9 A;  1K51 A;  5HFY A;  2VRR B;  2PVG C;  1JAL A;  2I1K A;  2N7J A;  3QQ8 B;  1Q0W B;  4NJ6 A;  4IWO A;  3AB5 A;  2NS5 A;  4W9K A;  1RWS A;  3PZ7 A;  4F1S A;  1NYQ A;  1SE2 A;  1XF5 L;  2VZK D;  3I9V 1;  4MJS A;  2PKO A;  2KX0 A;  2LJI A;  1WH3 A;  3WAP A;  1C77 A;  2L05 A;  4XE0 A;  2N9L A;  2WDT B;  3I3T B;  1WYG A;  2KLC A;  3W1Y A;  3AH7 A;  4RFB A;  1DOX A;  4LK0 M;  4ASW C;  2KWU B;  4EZJ A;  4AUQ C;  1HZ5 A;  5D94 A;  3BVZ A;  3DBL B;  1P7E A;  4RM9 A;  1PQS A;  4LDT B;  4WWM A;  2I38 A;  3DBH B;  2DWQ A;  2BB6 A;  1WRD B;  3TUO A;  2LRW A;  4HDO A;  3H9D A;  3H1U A;  4JLC A;  3Q8E A;  1S3S G;  2WYQ A;  3AE4 B;  3KYC D;  4WUR A;  4ANW A;  4YSX B;  4AJW A;  3V60 A;  3ZTC A;  1LFD A;  2Y5B B;  4E3C A;  4KVG B;  2NCN A;  1GUA B;  1WX7 A;  4BOZ B;  2JXX A;  1LQB A;  4MGI E;  1SIF A;  3CF6 E;  3KWV A;  2JZP A;  5CX3 A;  2WDV B;  2WWZ A;  4WAA A;  5J17 A;  3FIL A;  1OQQ A;  3APC A;  1ZOY B;  2JRI B;  3APF A;  3TEY A;  4PYU A;  2LGS A;  4ARC A;  2REX A;  1TS5 A;  3RNF C;  1I7H A;  4DXA B;  4MH8 A;  4C00 A;  5L83 A;  4KKI A;  1PGB A;  1RYJ A;  1TKG A;  2MSE D;  2KFK B;  1UNS A;  3PLV A;  3HHM A;  3DBR B;  2HDE A;  4ACF A;  2W3S A;  1F0Z A;  2Z8L A;  2INN E;  1PYW D;  2RPV A;  3P63 A;  4A9A A;  3AE5 B;  5IKC M;  5AEK B;  2AWT A;  3AXC A;  1KLV A;  2UU7 A;  3W2D A;  2FAZ A;  4LNI A;  3ZIM A;  4G50 A;  2HTM E;  3NVW A;  3AUL A;  2DEN B;  2FUH B;  2D3C A;  4ZDV A;  2CHX A;  4GN1 A;  3I57 A;  5BYR A;  1GOZ A;  3Q14 C;  2LXA A;  4MSQ B;  4G11 A;  2CKH B;  4II3 B;  3M95 A;  4XX5 A;  2J53 A;  1C9F A;  2OOB B;  5MPO A;  1BT0 A;  2LAS A;  4XGA B;  1V86 A;  2KAJ A;  2MBO A;  3EC8 A;  2GBM A;  2PPH A;  3QAQ A;  1L7Y A;  1Q5W B;  2K0P A;  2BQQ A;  1IP9 A;  1TYG B;  1XO3 A;  3RCZ A;  1L4Z B;  3LXF A;  4NQL B;  1NI3 A;  4HKZ E;  3UIO B;  2KN5 A;  1YMH E;  4FJZ A;  4LJO B;  2J0J A;  4H2A A;  1QOA A;  1QT9 A;  4HK2 A;  4WWP A;  3BZD B;  2WXL A;  3W5V B;  4MEM A;  4B9K A;  3AM9 A;  2IO2 B;  3AEC B;  3QAR A;  3V3X A;  4HVB A;  1E90 A;  2IY1 B;  3W5U B;  2ONQ A;  2AX5 A;  4HRS A;  3U7Z A;  4W9I A;  4C7Y A;  4K7U A;  4NZL B;  1RM6 C;  1T0S C;  2JF5 A;  3BIN A;  4II2 B;  3IHP C;  2MX2 A;  2MWS B;  3PS6 A;  3U4E G;  4O1N A;  4FLH A;  3TEZ A;  1EWY C;  3U2S C;  4LNN A;  2BW2 A; 
#chains in the Genus database with same CATH homology
 3AMZ A;  3ZGZ A;  1HZ6 A;  1JW9 D;  3MFG A;  4YTP B;  4OHJ A;  4J3O D;  2X38 A;  4L1B A;  4GDL B;  3ZJT A;  4YSY B;  1LO5 D;  1PGA A;  4CQN A;  3C8Y A;  1QKZ A;  3SEB A;  2RDH A;  4UDU C;  1VZ8 A;  2R61 A;  2W54 A;  2WXP A;  5G5G A;  2LUM A;  3E9S A;  2BS3 B;  1STE A;  1TY2 A;  3P42 A;  1IBX A;  5FK9 C;  1HEZ E;  5G5H A;  2L1A A;  1T6B X;  2WXO A;  4XWT A;  2K22 A;  3VR9 B;  1FFV A;  1AW7 A;  2IGG A;  5AUI A;  5H92 C;  1SF0 A;  2INP E;  3NRZ A;  2BT6 A;  2JYT A;  3HVD A;  1OFF A;  4JWS C;  1XLO A;  4C80 A;  3LYY A;  2AQ2 B;  5BYS A;  2MH7 A;  1A70 A;  1JCK B;  1DOI A;  1FD6 A;  4RF1 A;  1JRP A;  5TSS A;  1C4P A;  2QMT A;  2Y5C A;  3ZYY X;  2CJN A;  4C7Z A;  2JSV X;  2L32 A;  1RFK A;  2IJ0 A;  2QJL A;  1ZPS A;  2WXR A;  3VRA B;  1JWA D;  2WXQ A;  2QIL A;  1L0V B;  1DGJ A;  4AS1 A;  1NVI D;  1KTK A;  1JWB D;  2LFI A;  1K52 A;  2AQ1 B;  1N62 A;  2H88 B;  3SFE B;  1QOB A;  3VR8 B;  1ZXH A;  1V97 A;  4IKG A;  1N63 A;  2XN9 C;  5FKA C;  4C56 C;  1YNT E;  2G9H D;  3AE9 B;  1PUT A;  1I4H A;  1R7S A;  2PLP A;  4OW0 A;  1AN8 A;  1K53 A;  1MHX A;  4DXF A;  3AED B;  1WRI A;  2LGI A;  4WAF A;  3AEG B;  4WQM A;  1B1Z A;  1PFD A;  3GP7 A;  3MC0 B;  2IGD A;  3EA6 A;  1YJI A;  3RPF C;  4L2Y A;  4B0E A;  1SE4 A;  2WNM A;  3PZ8 A;  3NZ3 A;  3AEA B;  2BBC A;  3AEE B;  4M0W A;  3ABV B;  1D5M C;  1SEB D;  4N59 A;  2WLB A;  4NAM A;  2E3T A;  2WXK A;  3J9C A;  2V0G A;  1J7C A;  4USA A;  1EU3 A;  2J4X A;  1BXT A;  1M4V A;  1VLB A;  3NVZ A;  1F2R C;  2DLB A;  4NJC A;  3IXS A;  3URY A;  2GRI A;  2EKI A;  4RGT A;  3TEW A;  1OQR A;  1FRD A;  4ZRP A;  4XDC A;  3SR6 A;  4N6E B;  1F2R I;  1ZDX A;  4NAW B;  1J7A A;  1V1P B;  4KX6 B;  2KN4 A;  3ZQ4 A;  3W9C B;  5LNK 1;  4XDD A;  2FE8 A;  3P4Q B;  1KRH A;  3IAS 1;  3Q8B A;  1L5P A;  2JQR B;  1QIL A;  4N58 A;  3W1S A;  5HHD G;  5EE0 A;  1FNU A;  4LLG M;  1AWD A;  1D4B A;  1I4G A;  1IBX B;  1VR9 A;  2ON8 A;  1IGD A;  1V8C A;  3P1M A;  1WGK A;  3FC4 A;  2GB1 A;  3EGR A;  1N61 A;  1ZE3 D;  4DQO C;  1QOG A;  1QLB B;  3GS2 A;  3B2F A;  3BII D;  2H89 B;  1ZDV A;  5HG2 A;  2WXM A;  1VRA B;  2PW9 A;  1TY0 A;  1E10 A;  1I4P A;  4YTN B;  1C79 A;  1JWU D;  2D5G A;  1IGC A;  3P4R B;  1D5Z C;  2KWD A;  1HQR D;  1TS4 A;  1AYF A;  2W82 A;  1XXG A;  5AUK A;  2QIE B;  1XLN A;  4PT5 A;  2LMC A;  1ACC A;  2ZW0 A;  2L83 A;  1C4A A;  1L4D B;  2MJE A;  3AE2 B;  1GPX A;  3R2I A;  4A90 A;  2KDM A;  2ACZ B;  5I4D A;  1FM0 D;  2Y3A A;  1N5W A;  1SSN A;  2WDQ B;  3E56 A;  3Q69 A;  2WU5 B;  4US8 A;  3KQ4 A;  1SJE D;  2LEK A;  4TSS A;  3MP9 A;  4ZHP A;  3IT4 B;  4FXC A;  3V05 A;  1I4R A;  2CJO A;  4IDI A;  1DYQ A;  3ZJU A;  1NEN B;  1L0Y B;  3FAH A;  1VZ7 A;  5EE3 A;  1GB1 A;  3ETR A;  4ZRQ A;  4ITK A;  1EWC A;  1FCC C;  1UGJ A;  2SEB D;  4HJG E;  2PTL A;  5BYQ A;  4JX1 C;  1JQ4 A;  4L23 A;  3T3N A;  3Q8F A;  2YEP F;  3VRB B;  2V3N A;  1CJE A;  2NTT A;  1F77 A;  2MJD A;  2WU2 B;  1IUE A;  3CIR B;  2RMM A;  1FIQ A;  4WIP A;  5GXG B;  5T8I A;  4AQ7 A;  3AN1 A;  3OWE B;  1FO4 A;  1MI0 A;  3CWI A;  1ZXI A;  4A55 A;  2RDG A;  3R8B A;  2JU6 X;  3Q8C A;  4R3D A;  5FR3 A;  2BS4 B;  5D3D A;  1TKE A;  2QSD A;  2DBY A;  2B76 B;  1E6E B;  1PDX A;  4US9 A;  1SE3 A;  1L0X B;  5D3I B;  1KFY B;  1FXI A;  1D5X C;  1EM7 A;  3IT6 B;  3NUH B;  4MM3 B;  2M19 A;  3NS1 A;  1WSP A;  4REZ A;  4JE3 B;  1FMA D;  1ET9 A;  3BK2 A;  1JWS D;  4OVZ A;  1UWM A;  2N0S B;  2GI9 A;  2WXG A;  1K51 A;  2FBW B;  5HFY A;  1L6V A;  1FRR A;  3KLS X;  2PVG C;  5HI1 A;  1JAL A;  2N7J A;  2XNA C;  4OZC A;  3UI3 A;  3WCQ A;  1K50 A;  4GLS C;  3AB5 A;  1TJE A;  2LHD A;  1RWS A;  3PZ7 A;  1JML A;  2WXI A;  1NYQ A;  3B2G A;  3KWL A;  3BVG A;  3TSS A;  1SE2 A;  1XF5 L;  2WS3 B;  2VZK D;  3I9V 1;  1QOF A;  2PKO A;  3L4P A;  2LJI A;  2M0A A;  2PMV A;  1KLU D;  1JRO A;  1ROE A;  1WWT A;  4TQ0 A;  1C77 A;  3BYT B;  1GAQ B;  3Q8A A;  4HKQ A;  5BMG A;  1T5X D;  2N9L A;  1XCQ L;  4XE0 A;  3AE1 B;  4TQ1 A;  2CU3 A;  4WH4 A;  1WYG A;  2MEK A;  3AH7 A;  4RFB A;  2KAC A;  2N9K A;  2SAK A;  3DWG C;  4A6Q A;  1DOX A;  4LK0 M;  1C78 A;  2JYE A;  1HZ5 A;  2WXF A;  2ICI A;  2YEP B;  2OHF A;  3BVZ A;  5BMI A;  1P7E A;  5JXV A;  3ZJV A;  4WWM A;  2I38 A;  3AV8 A;  1SIJ A;  2DWQ A;  3AE3 B;  2BB6 A;  1N5X A;  2L52 A;  1C4C A;  4RGO S;  3TEX A;  4TMA B;  3NVV A;  4HRO A;  1DOY A;  4YWG G;  4B0M A;  3TUO A;  2IPK D;  1SJH D;  4JPS A;  2NTS A;  2V4I B;  1MPE A;  3HVZ A;  2IDY A;  2KMM A;  2WDR B;  3Q8E A;  3AE4 B;  4WUR A;  4Q2J A;  1YQ3 B;  4YSX B;  1GB4 A;  2JWU A;  1QQR A;  2ZW1 A;  1VZ6 A;  3VQI A;  1KLG D;  2BTE A;  1XLQ A;  3RFZ B;  1XEE A;  1E9M A;  1EU4 A;  2JZP A;  3KWV A;  1SB3 C;  2WDV B;  3N9Y C;  1HA5 A;  5C2T B;  4RNA A;  2VZK B;  3FIL A;  1OQQ A;  2G1E A;  2W3R A;  3AE8 B;  3O13 A;  4JWU C;  4MAC A;  2IGH A;  2KQ4 X;  1SXT A;  1ZOY B;  3TEY A;  4ARC A;  4IOI E;  1TS5 A;  4P16 A;  1YN3 A;  4RGM A;  2M56 B;  1I7H A;  4MH8 A;  1TZO A;  4KGS A;  3U52 E;  4KKI A;  1TS3 A;  1YQ4 B;  2EEL A;  2FUG 1;  1E7P B;  2LHE A;  1PGB A;  1RYJ A;  2AQ3 B;  1TKG A;  4DXG A;  1I4Q A;  4XWW A;  1FEH A;  1UNS A;  4YSZ B;  4LTU A;  5E6J A;  3AE7 B;  1ESF A;  1KH0 A;  1NYR A;  4RF0 A;  2E6X A;  1FNW A;  4YTM B;  2PVO D;  4A8X C;  1J7B A;  4GDK B;  2HDE A;  2W3S A;  1UUP A;  1ENF A;  1F0Z A;  1XCT L;  4KKJ A;  2Z8L A;  2J42 A;  1KF6 B;  2INN E;  1L6U A;  1PYW D;  2RPV A;  3P63 A;  4A9A A;  1MHH E;  5BMH A;  3AE5 B;  1Y56 A;  2WQY B;  1V1O A;  4RGN A;  3SFD B;  1N60 A;  3W2D A;  4YT0 B;  1E0Z A;  1FCL A;  1CK1 A;  2HTM E;  4ARI A;  1FNV A;  3NVW A;  1YN5 A;  2K5P A;  3I57 A;  5BYR A;  3BWU D;  1GOZ A;  3AEB B;  2JXT A;  1UWX A;  4OZA A;  2V3P A;  2DYO A;  5C3J B;  1YJJ A;  2J53 A;  1C9F A;  1FFU A;  5MPO A;  1YN4 A;  1TS2 A;  3BVM A;  1MVK A;  2KAJ A;  2K3U A;  1T3Q A;  1PGX A;  2K0P A;  3BK1 A;  1C76 A;  2WXJ A;  3NVY A;  2J52 A;  1TYG B;  1XO3 A;  3PO0 A;  1JWM D;  1L4Z B;  2W55 A;  5EE1 A;  1B9R A;  3LXF A;  1Q10 A;  4HEA 1;  5H8Y E;  2I2Y A;  3R2T A;  3HUI A;  1NI3 A;  1VJK A;  4KGR A;  1ET6 A;  2NMQ A;  3P4P B;  1TKY A;  4ZYS A;  4HKZ E;  4ZOH C;  3GB1 A;  4MT5 A;  1FXA A;  3FIL B;  1YMH E;  1QF6 A;  4P6V F;  2JX5 A;  3AE6 B;  4H2A A;  4EE2 A;  1QOA A;  1QT9 A;  2WXN A;  3BZD B;  2WXL A;  1BML C;  1HXY D;  1SBB B;  2BYT A;  3W5V B;  4ZHO A;  3MJ5 A;  4YXD B;  3HRD D;  3AM9 A;  4D2K A;  3AEC B;  3LB8 C;  3BYY B;  4RH6 A;  3V3X A;  2Q5W D;  3B9J A;  3MHZ A;  3DWM A;  5EE9 A;  2ONQ A;  5D7G A;  3W5U B;  2AX5 A;  2Y5P A;  4HRS A;  1BUI C;  3U7Z A;  1V1P A;  4RCO A;  4NZL B;  4C7Y A;  1RM6 C;  1NEK B;  2PIA A;  1WXQ A;  2WXH A;  1I4X A;  1ZP0 B;  4OZB A;  1CQV A;  2BB5 A;  2QEJ C;  2K9X A;  3H8H A;  1ZUD 2;  3IAM 1;  2BS2 B;  3EUB 2;  2MJ3 A;  2TSS A;  3P4S B;  3T3O A;  2OED A;  4KGT A;  3U4E G;  4O1N A;  1VDV A;  1P7F A;  3AEF B;  3TEZ A;  1D6E C;  1EWY C;  1XLP A;  3U2S C;  2DYM A;  2WP9 B;  2BW2 A;  1CZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...