1CZPA

Anabaena pcc7119 [2fe-2s] ferredoxin in the reduced and oxixized state at 1.17 a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
b'ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN I
publication title Refined X-ray structures of the oxidized, at 1.3 A, and reduced, at 1.17 A, [2Fe-2S] ferredoxin from the cyanobacterium Anabaena PCC7119 show redox-linked conformational changes.
pubmed doi rcsb
molecule tags Electron transport
total genus 25
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1czpA00
1ROEA 3AE4B 4WWMA 3CIRB 1DOIA 2CU3A 3VRBB 4YXDB 1QOAA 5H92C 5MPOA 3FC4A 3AEFB 2K9XA 2AX5A 2L83A 1L0VB 1NENB 4ZOHC 4HRSA 2PKOA 1JALA 3EUB2 1J7AA 1GAQB 5AUIA 1IUEA 3AEBB 2WS3B 4USAA 1JQ4A 2K5PA 4FXCA 1QOGA 1KFYB 2BT6A 2CJNA 3AE5B 3AN1A 2B76B 2DBYA 2WDRB 1YQ4B 1VJKA 1B9RA 1XLPA 1R7SA 1E10A 1DOXA 1N62A 3HUIA 1NYRA 3AECB 1XLOA 3AE2B 2LEKA 3AEGB 1WRIA 3AE6B 3NVZA 3B9JA 3P63A 3VR8B 1L6UA 3P4SB 1YJIA 2EKIA 2K22A 1ZXIA 2WLBA 3DWGC 2JQRB 1FIQA 1NYQA 1FRRA 2M56B 3HRDD 3LB8C 2OHFA 3AB5A 1N5WA 1PDXA 1OQRA 1XO3A 1YQ3B 2MJDA 3ABVB 1QOFA 3NVYA 1DOYA 1SIJA 3AE1B 1ZOYB 2H88B 1TJEA 1FM0D 3AEEB 2CJOA 3B2FA 2BS4B 2KAJA 3FAHA 1GPXA 1CZPA 1FXAA 1N61A 2WU2B 1QT9A 3AE7B 3P4RB 2PIAA 4C7ZA 1EWYC 1XLNA 1L6VA 4P6VF 3SFEB 1QLBB 1SF0A 2BS2B 3VR9B 3NRZA 3LXFA 2BS3B 1QF6A 1FFVA 1CJEA 2QIEB 1WYGA 3DWMA 4HROA 5EE1A 1TKYA 3KWLA 1XLQA 1N60A 2N0SB 1L5PA 1TKEA 2E3TA 3CWIA 4US9A 1PUTA 1RM6C 1OQQA 3P4PB 1V8CA 1E9MA 1T3QA 3NVWA 4N58A 1ZP0B 2W3SA 1V97A 4WQMA 3AM9A 5C2TB 1I7HA 5EE3A 1N5XA 1DGJA 2H89B 2MH7A 2WDVB 3NVVA 1RYJA 1AWDA 3ZYYX 3W5VB 1TYGB 2M19A 1JW9D 1FXIA 4LTUA 1NVID 3BIID 3W9CB 1NI3A 4JWUC 1JWAD 1AYFA 5AUKA 4ZHPA 1J7BA 1VDVA 5G5GA 1JRPA 1RWSA 3PO0A 3B2GA 1KF6B 1E6EB 1JWBD 2Q5WD 4N59A 2DWQA 3AEAB 4ZHOA 3NS1A 3RPFC 4JX1C 2ACZB 1FRDA 3AE3B 1WXQA 1QOBA 2KMMA 3AEDB 3AMZA 4KX6B 3VRAB 1NEKB 2PVGC 4YSZB 1E7PB 1SB3C 5G5HA 1J7CA 3L4PA 1UWMA 2WQYB 4N6EB 1JROA 3SR6A 5C3JB 1PFDA 3HVZA 1A70A 4C7YA 3WCQA 4JWSC 5H8YE 2G1EA 1F0ZA 2W3RA 2WP9B 3P1MA 4YTNB 3AV8A 4A9AA 1OFFA 1RFKA 1TKGA 1VLBA 2W54A 2W55A 3AE8B 2HTME 4YT0B 5GXGB 2MJEA 3SFDB 4C80A 2WDQB 4YTMB 1WGKA 1KRHA 1E0ZA 4US8A 3P4QB 2FBWB 2Y5CA 4ITKA 2PVOD 1FFUA 1YJJA 2JX5A 1N63A 3AH7A 2L52A 4IDIA 4YSXB 2QJLA 3ETRA 5EE9A 1WWTA 2MJ3A 1FMAD 2WU5B 4YSYB 4YTPB 3AE9B 5EE0A 1FO4A 1ZUD2 3W5UB
chains in the Genus database with same CATH superfamily
3IAM1 5H92C 5MPOA 3RNAC 4ANVA 2PKOA 1LXDA 4GGQA 1D4BA 3VXWA 2QHOA 3PREA 3ZTCA 1SJHD 2FIFA 1K51A 3KLSX 3NVZA 5DPSA 1YJIA 2K22A 2NBUA 3DVNU 2V0GA 1VD2A 2L3ZA 1XO3A 1TY2A 2RPVA 3AE1B 3PS6A 3ZNZB 3TEYA 4MEMA 3AEEB 4K7SA 3B2FA 2G3QB 1CZPA 4WQOB 2NCNA 1ISNA 4OZAA 1GOZA 1P98A 4NQKE 1V81A 4IC7B 2EMSA 1TKEA 3V61A 3PGEA 4IM2A 4J3OD 3RD2A 2RPQA 4HPPA 2JZPA 4M8MA 2GMIC 1VZ8A 3RMKC 3T9LA 3O13A 4WURA 4XZ4A 4ZRJA 3PZ7A 3U4EG 5AUKA 4B95A 3B2GA 2GI9A 4N59A 4RMAA 1VZ6A 2G4SA 3AMZA 3VUXA 3EC8A 5G5HA 4HK2A 4LCDE 1F2RC 1PYWD 3SR6A 2WXRA 3BYYB 4C7YA 3EA6A 2KHWB 4MELA 4X57B 2LMCA 2ICIA 4XDCA 5GXGB 2W9NA 2J0KA 4KIKB 2O6VB 1WJ4A 4GOCA 4F7ZA 2K1FA 2MBQA 2I2YA 1KLUD 1N63A 2KK8A 4C00A 4YTPB 4HEA1 2GBKA 4HCNB 1I4QA 1DOIA 1Q5WB 1QOAA 2L32A 4FBJB 1E7VA 1F9JA 4BBNF 1WJNA 2ZW0A 1R7SA 2KJRA 1E10A 2V3PA 2BKRB 2RDHA 3AE2B 5D7GA 2LEKA 4LK0M 1T0SC 2D5GA 3PRPB 1P0RA 3PLVA 5KHQA 2KFKA 3TEZA 1PDXA 2KDIA 3UIOB 4PK1A 2KYWA 2LFIA 3K9PB 4EZJA 2NTSA 3MJ5A 3QCAA 3BWUD 3VH3B 4B6WA 3S2AA 4A90A 2MP2B 3VR9B 2KVZA 2LUEA 4M0WB 1CJEA 1WGYA 2GRIA 1E90A 4W9GA 4URKA 4K1RB 4TMAB 4DHZB 3WAMA 4CYEA 1Y8RC 2PJHA 4ARIA 1D3ZA 1C4CA 1EU3A 1SEBD 5EE3A 2ASQA 4AP4C 1XD3B 2DYMA 2MA9B 2REXA 2D3CA 3APFA 1F77A 1FNUA 4YSZB 1GUAB 3P1MA 1J8CA 3AV8A 4A9AA 1GPXA 4C80A 4FULA 2L1AA 3APDA 2FUHB 3UINB 2XK5B 3A1QB 1GG3A 3W1SC 1DYQA 3E56A 3L08A 1GJZA 1KJTA 2KDBA 3KWVA 2BVCA 3BVZA 1JALA 3EUB2 3L13A 3A4RA 2WS3B 2IO0B 2LZ6A 2BT6A 3AN1A 4WIPA 3M3JA 3V6CB 4JLCA 1TS3A 3KVFB 2V3NA 3RYTA 2RD0A 4HJKA 3HUIA 1UF0A 1XLOA 2KO3A 3UQAA 4RF1A 3VR8B 2NPTA 2WLBA 4ANWA 3ZJVA 1TZOA 1EF1A 2V4LA 3JVZX 3IG3A 1IYFA 1FM0D 2FIDA 1PGBA 2BS4B 2KAJA 2WGSA 2CU1A 2WHIA 1YMHE 1KOTA 4C7ZA 1XLNA 3GP7A 3QC8B 1SF0A 1FFVA 2CKHB 3OAWA 1N60A 4US9A 1UBIA 2IPKD 4W9LA 1MG8A 5D94A 5J2RA 3A9KB 3GZNI 3R8BA 1EF5A 5DPTA 3WAPA 3BK1A 5C2TB 1WF9A 1V86A 2JY6A 4ZRIA 2QC8A 1KTKA 4LJOB 4LTUA 4M00A 1FXTB 3IT4B 5G5GA 1SE2A 3PO0A 2IZVB 2FCMA 2M0XA 4RCOA 1Z2MA 2WX0A 3AEDB 5TR5A 3J9CA 1NEKB 1XQQA 4BOZB 2IDYA 4IOIE 4DWFA 3BVMA 5D3DA 2M1MA 1OFFA 1RRBA 1L0XB 1S3SG 2IJ0A 2N9XA 2N7EA 1NI2A 1WWTA 4YSYB 1F52A 3RCZA 3Q3OC 2INDC 3V62A 1C4AA 1ROEA 1WXAA 3U8ZA 3ENEA 2M4NA 4YXDB 3MHZA 3N1XC 2JPHA 4ZRPA 4ZOHC 4HRSA 4I6LB 3NJTA 3RNGC 2JUOA 3HM3A 1JQ4A 2BBCA 1PGAA 2D11A 5I4DA 4ZYNA 4MDKE 3ECIA 1L6UA 5LLIA 3MJWA 3TEWA 1G6JA 1ZGUB 2BPSA 3NG0A 2JQRB 1NYQA 2M56B 3TSSA 1OQRA 2KTFA 4FN2A 2KLGA 4B9KA 4R3DA 3O65B 3CMMB 4B0EA 1I4RA 2IYDB 3K9OB 2PIAA 1WX7A 2K8CA 2ON8A 2AWTA 2BS3B 1QF6A 2DZJA 3DWMA 1VR9A 2FNJB 4KIKA 1OQQA 2O6VA 1MI0A 3ZTDA 2LXCA 2W3SA 3H7PB 2BB6A 3AM9A 3QWZB 1EU4A 3VVWB 4AQ7A 1RYJA 1AWDA 3TUOA 4BKSA 4GLSC 3NUHB 2V4IB 2LJ5A 2DWQA 4GIVA 1FCLA 1SBBB 2K0PA 1R4MB 2J4XA 3AE3B 1Y56A 1MPEA 1PQSA 2UWQA 1A70A 2GBJA 4W9HA 2ZVOA 2W54A 3R7QA 2C9WB 3P4QB 2EMTA 3AH7A 3L16A 2L52A 4MM3B 1YX5B 1C76A 2J52A 4C4VB 2LRUA 4OVVA 1EO6A 3HHMA 4CHKA 3VRBB 2MP2A 4M0WA 3N3KB 1NBFC 2BKFA 2KWDA 1TS5A 4RGMA 3AEBB 1KLGD 2WDRB 5E6JA 3IFWB 3AEGB 3AECB 1V5OA 4RGNA 3LB8C 2OHFA 1ZDVA 5BYQA 1N5WA 3ZJUA 2MJDA 4OVZA 1TIFA 4ICVA 1WGDA 3PHXB 4TQ0A 2I38A 1RLFA 4W9EA 5C23A 2EELA 4LNNA 4KZCA 3KWLA 3W1SA 1TS2A 1PUTA 1V8CA 2O6VD 3NVWA 4N58A 3DBLB 4FHJA 2KQ4X 2KDEB 4XE0A 2JT4B 3FKYA 1D5MC 2Z0DB 1K52A 2XK5A 3A1QA 2KTRA 3Q3NC 4OVUA 2LVOA 4BKSD 3VTVA 2NTTA 4ARCA 3W9CB 1H8CA 4A20A 3QJZA 2DZKA 2Q5WD 4ZHOA 3ONSA 4OZCA 1WXQA 2GB1A 4J6IA 2JYEA 1E7PB 2JYTA 1BT0A 2ZW1A 4N6EB 5IP4D 2EKEC 2MEKA 1QQRA 3ML8A 2LHEA 3L10B 1Q0WB 2C60A 2WXOA 4GU2A 3FILA 1V9JA 1IBXB 1YJJA 5EDSA 4JGHB 2L0FA 2YEPB 4FLHA 4YSXB 1V49A 3DVGY 3AE9B 2O2VA 3W5UB 2WXNA 2LGIA 2V3SA 2KN5A 4WJOA 4WWMA 4EFOA 3PZ8A 2D3BA 4NNJB 1LGRA 1ZPSA 2KX0A 3PRZA 1IUEA 5E6PA 1OEYJ 3A9KA 2KN4A 1DOXA 4DBGA 3W1YA 4RGOS 2CR5A 3UQBA 1YNTE 3ALBA 2LASA 2OOBB 3NHEB 2PMVA 3U30A 1KM7A 3T3OA 1YQ3B 1FEHA 1WYWB 3Q2AC 3FAHA 2BB5A 2KWCA 3QQ8B 4JIOU 1UGMA 2VZKB 1OGWA 3TJPA 5GMVA 3ZNID 5J18A 2ZVNA 3R66C 2WYQA 1HZ6A 4KZ0A 3CSFA 4GDKB 2MBEA 4MGYE 4E74A 1N5XA 4NJ7A 1WE7A 2WDVB 4WWPA 4K7UA 1JWMD 1FXIA 3DBRI 4GSWA 2PW9A 4F1SA 4JWUC 4DQOC 4A6QA 2J42A 2IBIB 1P9DU 2XBBC 3PSEB 5J17A 1L7YA 1LFDA 3DHIC 4TQ1A 4TKNA 2KJ6A 4BAXA 2KMMA 2JXTA 4LNFA 1SB3C 3SDLC 4IM3A 2KMAA 3HK0A 1IP9A 2PEAA 2G1EA 5FR3A 2FCNA 1ENFA 2PE9A 3KH0A 1GC6A 3HIZA 3L17A 3ZW3A 4US8A 2Z59B 3M63B 2PVOD 2I1KA 2A4ZA 3C0RB 4PYZA 4EZLA 4RFBA 3V05A 3Q8CA 1C3TA 4JPSA 3FC4A 2KACA 3AEFB 5L83A 2V9HA 1HQRD 1C1YB 1J7AA 5AEKB 5AUIA 2DHZA 1QOGA 1EWCA 1B9RA 5T8IA 3RZFA 3Q8FA 1XF5L 3H7PA 1WXSA 1D5XC 2KX3A 2CHWA 4XC2A 2L00B 1JWSD 5E6OA 2RDBC 5AZHA 2J7QB 1AARA 1SIJA 2WDTB 3EFUA 2FE8A 4E71A 2KXJA 2V1YA 4HDOA 3NZUA 3DDCB 3KUZA 4NQLB 1L6VA 5HFYA 1QLBB 3JYUA 3LJ3A 4PYUA 3B08A 1XLQA 2N0SB 1L5PA 3DHHC 3EHVA 1LM8B 3P4PB 1E9MA 1SIFA 3NZSA 1D6EC 1K50A 1YOVB 1TS4A 4MM3A 4C4VA 2H89B 2C5LC 5DPWA 1R4NI 1P7FA 2BQQA 4GMVA 4DXFA 2M19A 1EM7A 3MC0B 1WRDB 3BIID 5DCNA 1NI3A 1TT5B 1RWSA 3GS2A 3NS1A 1TTNA 1T6BX 1CMXB 3X23A 4XWWA 2G45B 3TL5A 2ZNVB 4GN1A 1FCCC 1VLBA 2WXGA 4WWNA 5CX3A 1TY0A 2JX5A 3BZDB 2WXMA 4KV2A 2QSDA 3MC8A 2ZNVC 1ZUD2 1KH0A 1C4PA 3GE3C 2KD0A 4P1CC 3MC9A 4I6PA 4TV3A 1T0YA 2MW5A 2CJNA 1BMLC 1QKZA 1XLPA 4TUUA 4HDQA 1NYRA 2TSSA 3P63A 2NR2A 2EKIA 1C78A 2ZJDA 1K8RB 1WZ0A 1WJ6A 1UELA 4LNIA 2I1JA 5BMGA 3N20C 1QILA 2C7MB 2QCZA 2IO2B 1ET9A 2CJOA 1XXGA 3Q3JA 3Q8BA 2LRWA 2M17A 2MHJA 2R2QA 2VRRB 3KYDD 2E3TA 3CWIA 3A33B 4I6NB 1RM6C 1UBQA 3CF6E 1Q1OA 4W9DA 2BTEA 2BGFA 1WZ3A 4WH4A 5G55A 1ZP0B 1IBXA 5KHOA 4KVGB 4W9IA 2XN9C 2MBOA 3TCAA 3JSVB 2IY1B 1SJED 2N7JA 4N9F4 3W5VB 2N9EB 5FKAC 1SGHA 2IO1B 1OQYA 4NPNA 3UF8A 1IGCA 3BK2A 3D32A 4JL9A 1NDDA 1K53A 3AEAB 4NAWB 4ACFA 3WAOA 1S1QB 3VRAB 1J7CA 2D3AA 4EUTA 1PFDA 3HVZA 1P1AA 2YEPF 4PT5A 3OLMD 4YTNB 2KJHB 5BYRA 3ZIMA 2JZ3B 1MJDA 3SD5A 3X0WA 3VUYA 4EOYA 4KSLC 4NZLB 2WU5B 3VH4B 1WMHB 2DX5B 4XGAB 5BO4B 4OW0A 3DOWA 1SXTA 2LHDA 2DAJA 1RAXA 2D10A 3ZRCA 2KOXA 4USAA 2INNE 4YWGG 4GDKA 3RN9C 3ZNHB 1VJKA 1HEZE 5BYSA 3DBHI 2LI5A 4GB9A 4NJCA 3H8HA 4RH6A 1WRIA 3V60A 2GLSA 3L0WB 2BWES 3NVYA 3Q3MC 4CQNA 2MBHA 4OHJA 2D2QA 3PRMB 4HPMB 4AUQC 4WAAA 4HROA 4RNAA 3ZGZA 5DPRA 3VTWA 2OEDA 2FCQA 1SE4A 2KLCA 1WM2A 4PS7A 2G9HD 4LJPB 2C7NB 4HKZE 1I7HA 1YX6B 5TSSA 2WXLA 4RGTA 4DK5A 1JWAD 1VDVA 3C8YA 3U2SC 2KC2A 1WX9A 4XWTA 3Q8AA 1IPGA 2L76A 2NVUI 1SSNA 3WCQA 1E5WA 1Q10A 4HPLB 3IVFA 2KFJA 2HTME 2JRHA 2X8XX 2FBWB 4PS8A 2GBNA 1R4NB 2QJLA 4HWIB 2MX2A 1TGZB 2L0TA 2NBVB 1T5XD 4P7IA 2VZKD 3PV1A 2K9XA 4LDTB 2AX5A 3WANA 3ZXRA 4A8XC 1F2RI 3VQIA 2C7HA 1P3QU 2NMQA 1RFAA 4REZA 3AE5B 3B0AA 2B76B 3H9DA 4M02A 3E9SA 4M01A 4II3B 5HKHA 2MQJA 3KUDB 1MFWA 3GE8C 2GOWA 2LGSA 1M4VA 4LNKA 4AJWA 2K39A 2FAZA 3TBLD 3AB5A 4KSKC 3N30A 4NAMA 3ABVB 4MT5A 4CO7A 1E8WA 4MSQB 4XX5A 1TJEA 2D3GA 4DDGD 4ZRQA 2RGFA 4KKJA 1WYGA 3KUCB 3MHSD 2N4FA 5AZGA 3BYTB 4G0NB 2CHXA 4RF0A 3T8MA 1X1MA 4DHJB 3M62B 3U7ZA 3QIJA 1DGJA 4K7WA 2JRIB 4BKTA 3L54A 2K8BA 2N9PC 3SU8X 4C56C 1ZW7A 4ANXA 4ZHPA 1AN8A 3QHTA 4O1NA 1KF6B 1E6EB 1JWBD 1L4DB 3WIMA 3EECA 3RI7C 1OEYA 4LLGM 2LVQA 4E3CA 4L2YA 5JZEB 1L4ZB 1P7EA 2J53A 4D2KA 2W55A 3SFDB 3AE8B 2BWFA 4YTMB 1KRHA 4WJPA 2Z8LA 1BXTA 4ITKA 2ONQA 3MP9A 1TZ1A 3ZXVA 4IDIA 1MVKA 1FPYA 5G2NA 1FO4A 3AE4B 3CIRB 4F8CB 1JWUD 1UNSA 3CSTA 4MGIE 4A3PA 1L0VB 1V6EA 4WJQA 3RNFC 3I3TB 1WXMA 1GAQB 2XEWA 1PGXA 3GZNB 3A4SC 1MHHE 4M8NA 2DBYA 3T3NA 1HE8A 4BFRA 4EE2A 3TIXA 5D2MB 3AXCA 3JSVA 4HLEA 2LJIA 1ZOYB 1LO5D 2H88B 5HHDG 1J0GA 3ZRFA 1C9FA 2SEBD 4NAWA 2LXAA 2J0JA 2RSUA 4XYCA 1L0YB 2YVCA 2N7DA 5BMHA 3N9YC 1V2YA 2QDFA 1XT9B 4S17A 1WFYA 3A9JB 1V80A 1WIAA 3ZYYX 2JSVX 5IA7A 2VH1A 4TSSA 1AYFA 4L23A 2J0MA 2GBRA 1QOBA 1D5ZC 2R2OA 2QILA 1STEA 3N1ZC 2K6DB 2VH2A 4HKQA 5FR6A 1RFKA 1YN3A 3GOEA 2AL6A 2MWSB 1E0ZA 5IN7A 2L7RA 3IT6B 2DENB 3RFZB 1FFUA 3APCA 4BVUC 4IUMB 3VUWA 3ZNGC 1C79A 4DXAB 4WWOA 1WI0A 2JZZA 1OTRB 3NS8A 2G4DB 2AL3A 2BW2A 2K5PA 1KFYB 1HZ5A 3NZ3A 3V6EB 3PHWB 1VCBA 2K6QA 1N62A 2JWUA 3B9JA 4L1BA 4ZDVA 1ZXIA 3DWGC 3PT2B 4ZRKA 3MTNB 1XCQL 4BZAA 1FRRA 4K3CA 2K25A 5IO9A 1UZXB 2BYFA 3OJ3A 4KKIA 1UD7A 3KYCD 4A3OA 4II2B 2SAKA 4FJYA 1A5RA 3LXFA 2QEJC 1M94A 1WH3A 1ZDXA 2MLBA 3WA0A 1ZXHA 3DQVA 1T3QA 4MH8A 4ASWC 2WX1A 4MACA 2N9LA 2WXHA 2N9KA 4WAFA 2JVCA 3DPDA 2IY0B 1TYGB 1JW9D 2HE7A 1NVID 2A5UA 2PTLA 2DZMA 2RDGA 5HG2A 2KVRA 1FRDA 4EZKA 3VHTC 4W9CA 2BYVE 4FJVB 5JHBA 1Z5SB 3H7SA 1F0ZA 2KQSA 1HTOA 2WDQB 2KWVB 3B1LX 1U4AA 1T0QC 3H6NA 2HJ1A 2HJ8A 2DYBA 4S0RA 2LVPA 1UGJA 3NOBA 2LWPA 3ZJTA 1V5TA 1CK1A 2ZPNA 4GDLB 3Q3FA 3TMPB 3ZDMC 1IGDA 1YQBA 2HD5B 3ZO5B 2AYOB 1R4MI 5AZFA 1E8XA 3QK0A 3Q6BA 4P16A 5L95C 2BYTA 1EUVB 5JH5C 2AQ1B 1ESFA 3ZDTA 4OZBA 5D6JB 3VFKA 1N6ZA 2CS4A 4IWQA 1QOFA 2LGYA 4MJSB 4NJ6A 1DOYA 4DHZE 1LQBA 1WXVA 1MG4A 3IXSA 3PTFC 1JMLA 3AU4A 1FXAA 1N61A 4KGSA 4HCPB 1YN5A 4B0MA 5EE1A 5HI1A 3PPAA 3W2DA 4PS3A 1TKYA 2OJRA 2K8HA 2Y3AA 3VTUA 2INCC 3KW5B 5FK9C 4BOSC 2UU7A 1WR1A 3BINA 2DLBA 3KQ4A 4IM0A 4RM8A 2MH7A 4EKUA 2RR9A 4IG7B 5C1ZA 1E7UA 4LDTD 1AW7A 1GC7A 4LNOA 1L2NA 1I4GA 2KTRB 4KDIC 3SHQA 4JX1C 3QA8A 4KDLB 4KX6B 3WALA 2KDMA 2MCNB 2PVGC 3L4PA 5C3JB 5JHAA 1VRAB 4W9KA 1HXYD 1GB4A 2WP9B 2DZIA 1TKGA 2L05A 1FNVA 4YT0B 2PE6B 1WGKA 2LD9A 2XNAC 1J19A 1V1PB 1YIWA 4FHKA 2ZEQA 3DBLI 4G3XB 2MJ3A 3RZWC 1YD8U 2FUG1 3QAQA 3R2IA 3FILB 4A55A 2CU3A 2ZPYA 2CHZA 4AOFA 3PLUA 3R3MA 3M95A 4WJNA 4DXGA 2B3AA 2O2VB 3RULA 4IWPA 3U52E 3AULA 4DHJD 3A9JA 1WJUA 3DBRB 3V3XA 3QX1A 2KZRA 2NBWB 4ZYSA 4H2AA 1ZE3D 2D07B 3IBEA 4KGRA 2KANA 1HA5A 5CHWA 5CHVC 1T0RC 1QT9A 2JWZA 2BS2B 2KKCA 1E8YA 3NRZA 4FADA 2JF5A 2QIEB 3I9V1 1XEEA 5LXHA 3PVLA 2IGGA 1V1OA 4GXBA 3LDZE 3URYA 2IGHA 2WXFA 1GNUA 4XDDA 3DCGA 2KT7A 1I4PA 4JQWC 1JRPA 2Y5PA 1HTQA 1F1HA 1WM3A 2QMTA 3ZKJC 5BMIA 3LYYA 4MGKE 3BY4B 1WE6A 1I4HA 2WQYB 2R61A 4BKGA 5H8YE 1XCTL 2MRPA 2FCSA 4MH0E 2OJWA 3ML9A 3Q14C 2MJEA 4JE3B 2M0AA 4HJGE 2KDFB 4W9JA 3Q8EA 3QARA 3DVGX 1FMAD 1UH6A 3TEXA 4DDID 2ZCBA 4AJYB 2HTHA 2HDEA 3H1UA 1KLVA 2KQ7A 1B1ZA 2L83A 2MSED 5JXVA 3UGBB 1YJ1A 1FNWA 3UIPB 3DVNV 2DAFA 3I63C 1QZEA 1UWXA 3AI5A 2DNFA 2YLMA 2WNMA 2UYZB 1WGHA 3P4SB 4P1BC 4AWJA 4W9FA 1FIQA 3RNCC 5D3IB 3HRDD 1SE3A 2AQ2B 4MGZE 1ET6A 4FA6A 5IOIA 4HXDA 4BBNC 4Q2JA 2LGXA 2K3UA 1EWYC 3SFEB 3IAS1 2DYOA 3PZDA 4MSMB 4UDUC 4NY0A 1MHXA 2L8JA 1V97A 3N32A 2INPE 4G50A 4WQMA 3ZQ4A 3IHPC 2BF8B 3P42A 1SE9A 3HVDA 3P2BA 3R7RA 3VDZA 2KFKB 2X38A 4HVBA 1WX8A 5LNK1 2Y5BB 4GDLA 2WXQA 3Q69A 3OG5A 4IW0A 5CHFA 4ANUA 2ACZB 2AEHA 4FJZA 3BVGA 1UWMA 3RT3B 4JWSC 3NY5A 1WGRA 3JW0X 3HM6X 1TBEA 3OWEB 2ZCCA 3DBSA 2KWUB 3MFGA 4MJSA 2KNBA 1WSPA 2WXKA 2JU6X 1H4RA 2IO3B 2E6XA 3OJ4B 1I4XA 5EE0A 4AS1A 1C77A 2N1VA 1VZ7A 1GB1A 2PPHA 1ACCA 1NENB 1JRUA 2M8SA 3EGRA 3R2TA 1YN4A 3ZVVA 4FXCA 4IWOA 1WGGA 1YQ4B 4ICUA 3ZLZA 2N1WA 4K3BA 1CQVA 3AE6B 3UI3A 3U7DA 3RNBC 2BYEA 2KC1A 3DHGC 4KGTA 2KMCA 2GBMA 5IKCM 3I5JC 2RMMA 2WU2B 3P4RB 3AE7B 1I42A 4P6VF 4RM9A 2PLPA 3RNEC 3SEBA 3C19A 3EFCA 2WXIA 1WR6E 1I35A 2MBBB 5CTRC 3I57A 4QAYA 3GB1A 1V1PA 3N1YC 2NPTB 1BUIC 4YL8A 3NVVA 2WWZA 2LUMA 1WY8A 1JCKB 1J7BA 2AQ3B 2WXJA 3RPFC 2W82A 2WXPA 2NS5A 5E6NA 3DBHB 3AU5A 4IKGA 4EEWA 3VAWA 1JROA 3RUIB 2W3RA 3ZUNA 2IGDA 2Z0EB 2JXXA 1WMHA 5IAAC 4G11A 1E8ZA 1FD6A 2Y5CA 1ZKHA 5LXIB 2ZZPB 3ETRA 1UUPA 5EE9A 2LGDA 4K81A
chains in the Genus database with same CATH topology
1UGJA 3IAM1 3ZJTA 3VRBB 5H92C 1CK1A 1SXTA 5MPOA 4M0WA 2LHDA 4GDLB 2KWDA 2PKOA 1TS5A 1D4BA 1IGDA 4RGMA 3AEBB 4USAA 1KLGD 2INNE 4YWGG 2WDRB 5E6JA 1VJKA 1HEZE 1SJHD 4P16A 5BYSA 1K51A 2BYTA 3KLSX 3AEGB 3AECB 4NJCA 3H8HA 4RH6A 1WRIA 3NVZA 1YJIA 2AQ1B 2K22A 1ESFA 4OZBA 4RGNA 2V0GA 3LB8C 2OHFA 1ZDVA 5BYQA 1N5WA 3ZJUA 1XO3A 2MJDA 4OVZA 1QOFA 1TY2A 2RPVA 3NVYA 1DOYA 3AE1B 3TEYA 3IXSA 3AEEB 4CQNA 3B2FA 4TQ0A 1CZPA 1JMLA 1FXAA 1N61A 2I38A 4KGSA 4OHJA 4OZAA 1YN5A 4B0MA 1GOZA 2EELA 4HROA 5EE1A 5HI1A 4RNAA 3W2DA 3ZGZA 1TKYA 3KWLA 2Y3AA 1TKEA 3W1SA 4J3OD 1TS2A 1PUTA 2OEDA 1SE4A 5FK9C 1V8CA 2JZPA 3NVWA 4N58A 2G9HD 2KQ4X 4XE0A 4HKZE 1VZ8A 2DLBA 3KQ4A 1I7HA 1D5MC 5TSSA 2WXLA 1K52A 3O13A 2MH7A 4WURA 4RGTA 3PZ7A 2NTTA 4ARCA 3W9CB 3U4EG 5AUKA 1JWAD 1VDVA 3C8YA 1AW7A 3B2GA 2GI9A 3U2SC 2Q5WD 4N59A 1I4GA 4ZHOA 4XWTA 4JX1C 1VZ6A 4OZCA 1WXQA 3AMZA 3Q8AA 4KX6B 2KDMA 2GB1A 2JYEA 2PVGC 1E7PB 5G5HA 2JYTA 3L4PA 2ZW1A 1F2RC 4N6EB 1PYWD 3SR6A 2WXRA 5C3JB 3BYYB 4C7YA 1VRAB 1SSNA 3WCQA 1HXYD 1GB4A 3EA6A 2MEKA 1QQRA 1Q10A 2WP9B 2LMCA 2ICIA 2LHEA 4XDCA 4YT0B 1TKGA 5GXGB 1FNVA 2WXOA 2HTME 1WGKA 3FILA 2XNAC 2FBWB 1V1PB 1YJJA 1IBXB 2I2YA 1KLUD 1N63A 2YEPB 4YSXB 2QJLA 2MJ3A 4YTPB 2FUG1 3AE9B 4HEA1 3W5UB 3R2IA 2WXNA 3FILB 2LGIA 4WWMA 1I4QA 4A55A 1DOIA 2CU3A 1T5XD 1QOAA 2L32A 2VZKD 3PZ8A 2K9XA 2AX5A 4A8XC 1F2RI 3VQIA 4DXGA 1ZPSA 1IUEA 2NMQA 4REZA 3AE5B 3U52E 2B76B 2ZW0A 1R7SA 1E10A 2KN4A 3E9SA 1DOXA 4RGOS 2V3PA 2RDHA 3AE2B 1YNTE 2LEKA 5D7GA 4LK0M 2D5GA 3V3XA 1M4VA 2PMVA 4ZYSA 3TEZA 3AB5A 1PDXA 4H2AA 3T3OA 4NAMA 1YQ3B 3ABVB 4MT5A 1FEHA 2LFIA 2NTSA 1TJEA 1ZE3D 4KGRA 3MJ5A 1HA5A 3BWUD 3FAHA 4A90A 2BB5A 4ZRQA 1QT9A 4KKJA 2VZKB 2BS2B 3VR9B 3NRZA 1CJEA 2QIEB 1WYGA 2GRIA 3I9V1 1XEEA 4TMAB 1HZ6A 3BYTB 4GDKB 4RF0A 4ARIA 2IGGA 1C4CA 1EU3A 1V1OA 3U7ZA 1SEBD 5EE3A 1N5XA 1DGJA 3URYA 2IGHA 2WDVB 1JWMD 1FXIA 2WXFA 4C56C 4XDDA 2DYMA 2PW9A 4JWUC 4ZHPA 1AN8A 1I4PA 4DQOC 4A6QA 1JRPA 4O1NA 2J42A 2Y5PA 1KF6B 1E6EB 1JWBD 1L4DB 4TQ1A 2QMTA 5BMIA 3LYYA 2KMMA 2JXTA 1F77A 1FNUA 4LLGM 4YSZB 1SB3C 1I4HA 2WQYB 2R61A 4L2YA 1L4ZB 1P7EA 2J53A 5H8YE 2G1EA 5FR3A 1XCTL 1ENFA 3P1MA 4D2KA 3AV8A 4A9AA 1GPXA 2W55A 3SFDB 3AE8B 4C80A 4YTMB 2MJEA 4JE3B 1KRHA 2M0AA 4US8A 2Z8LA 4HJGE 1BXTA 4ITKA 2PVOD 2ONQA 3MP9A 2L1AA 3Q8EA 4IDIA 1MVKA 4RFBA 1FMAD 3V05A 3TEXA 1FO4A 1DYQA 3E56A 3AE4B 3Q8CA 3CIRB 1JWUD 4JPSA 2HDEA 1UNSA 3FC4A 2KACA 3AEFB 3KWVA 1B1ZA 2L83A 1L0VB 3BVZA 1HQRD 1JALA 3EUB2 5JXVA 1J7AA 1GAQB 5AUIA 1FNWA 2WS3B 1PGXA 1QOGA 2BT6A 3AN1A 4WIPA 1MHHE 1EWCA 2DBYA 1B9RA 5T8IA 1UWXA 3T3NA 4EE2A 3Q8FA 1XF5L 1TS3A 2V3NA 1D5XC 3HUIA 1XLOA 1JWSD 2WNMA 4RF1A 3VR8B 3P4SB 2WLBA 1FIQA 5D3IB 3ZJVA 3HRDD 1SE3A 1TZOA 2LJIA 1SIJA 2AQ2B 1ET6A 1ZOYB 1LO5D 2H88B 5HHDG 1C9FA 2FE8A 2SEBD 1FM0D 1PGBA 2BS4B 2KAJA 4Q2JA 1YMHE 2K3UA 4C7ZA 1EWYC 1XLNA 1L6VA 3GP7A 3SFEB 1QLBB 1SF0A 2DYOA 3IAS1 5HFYA 1L0YB 4UDUC 1FFVA 5BMHA 1XLQA 1N60A 2N0SB 1L5PA 3N9YC 4US9A 1MHXA 2IPKD 3P4PB 1E9MA 1V97A 1D6EC 2INPE 1K50A 4WQMA 3R8BA 3ZQ4A 1TS4A 3BK1A 3P42A 5C2TB 2H89B 3HVDA 1P7FA 3ZYYX 1KTKA 2M19A 4DXFA 1EM7A 3MC0B 4LTUA 2X38A 2JSVX 3BIID 4TSSA 1NI3A 1AYFA 3IT4B 4L23A 1SE2A 1RWSA 3PO0A 5G5GA 5LNK1 2WXQA 3Q69A 3GS2A 3NS1A 2ACZB 4RCOA 3AEDB 1QOBA 3J9CA 1NEKB 1D5ZC 3BVGA 1T6BX 1UWMA 2IDYA 2QILA 1STEA 4IOIE 4JWSC 3BVMA 4HKQA 4XWWA 5D3DA 3OWEB 1FCCC 1OFFA 1RFKA 1VLBA 1YN3A 1L0XB 1E0ZA 2WXGA 3IT6B 1TY0A 3RFZB 1FFUA 2JX5A 3BZDB 3MFGA 2IJ0A 1WSPA 2WXMA 1WWTA 2WXKA 4YSYB 2JU6X 2E6XA 2QSDA 1I4XA 5EE0A 1ZUD2 4AS1A 1C4AA 1C77A 1C4PA 1KH0A 1ROEA 1VZ7A 1C79A 4YXDB 3MHZA 1GB1A 4ZRPA 1ACCA 1NENB 4ZOHC 4HRSA 3EGRA 2BW2A 3R2TA 1YN4A 1JQ4A 2K5PA 4FXCA 1KFYB 2BBCA 1HZ5A 1PGAA 2CJNA 3NZ3A 1BMLC 1QKZA 1YQ4B 1XLPA 1N62A 5I4DA 1NYRA 2TSSA 1CQVA 2JWUA 3AE6B 3P63A 3B9JA 3UI3A 4L1BA 1L6UA 3TEWA 2EKIA 1ZXIA 3DWGC 1C78A 2JQRB 1XCQL 1NYQA 1FRRA 2M56B 4KGTA 3TSSA 1OQRA 5BMGA 4KKIA 1QILA 4R3DA 1ET9A 4B0EA 2CJOA 1I4RA 2RMMA 2WU2B 3P4RB 3AE7B 2SAKA 1XXGA 2PIAA 4P6VF 2ON8A 2PLPA 3LXFA 2QEJC 2BS3B 3Q8BA 3SEBA 1QF6A 3DWMA 1ZDXA 2E3TA 1VR9A 2WXIA 3CWIA 1RM6C 1OQQA 3I57A 1MI0A 1ZXHA 4MH8A 1T3QA 2BTEA 4WH4A 4MACA 1ZP0B 2W3SA 3GB1A 1V1PA 1IBXA 2N9LA 2BB6A 3AM9A 2WXHA 1EU4A 2N9KA 4WAFA 2XN9C 1BUIC 3NVVA 4AQ7A 1RYJA 1SJED 2N7JA 1AWDA 3TUOA 3W5VB 1TYGB 1JW9D 2LUMA 4GLSC 5FKAC 1NVID 1JCKB 3NUHB 2V4IB 1IGCA 1J7BA 3BK2A 2PTLA 2RDGA 1K53A 5HG2A 2AQ3B 2DWQA 3AEAB 1SBBB 2K0PA 2WXJA 4NAWB 3RPFC 2J4XA 2W82A 1FCLA 1FRDA 2WXPA 3AE3B 1Y56A 3VRAB 4IKGA 1J7CA 1MPEA 1JROA 1PFDA 3HVZA 1A70A 2YEPF 1F0ZA 2W3RA 4PT5A 2IGDA 4YTNB 2W54A 5BYRA 2WDQB 1FD6A 3P4QB 2Y5CA 3AH7A 2L52A 4MM3B 3ETRA 1UUPA 4NZLB 2J52A 1C76A 2WU5B 5EE9A 4OW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROE A;  3AE4 B;  4WWM A;  3CIR B;  1DOI A;  2CU3 A;  3VRB B;  4YXD B;  1QOA A;  5H92 C;  5MPO A;  3FC4 A;  3AEF B;  2K9X A;  2AX5 A;  2L83 A;  1L0V B;  1NEN B;  4ZOH C;  4HRS A;  2PKO A;  1JAL A;  3EUB 2;  1J7A A;  1GAQ B;  5AUI A;  1IUE A;  3AEB B;  2WS3 B;  4USA A;  1JQ4 A;  2K5P A;  4FXC A;  1QOG A;  1KFY B;  2BT6 A;  2CJN A;  3AE5 B;  3AN1 A;  2B76 B;  2DBY A;  2WDR B;  1YQ4 B;  1VJK A;  1B9R A;  1XLP A;  1R7S A;  1E10 A;  1DOX A;  1N62 A;  3HUI A;  1NYR A;  3AEC B;  1XLO A;  3AE2 B;  2LEK A;  3AEG B;  1WRI A;  3AE6 B;  3NVZ A;  3B9J A;  3P63 A;  3VR8 B;  1L6U A;  3P4S B;  1YJI A;  2EKI A;  2K22 A;  1ZXI A;  2WLB A;  3DWG C;  2JQR B;  1FIQ A;  1NYQ A;  1FRR A;  2M56 B;  3HRD D;  3LB8 C;  2OHF A;  3AB5 A;  1N5W A;  1PDX A;  1OQR A;  1XO3 A;  1YQ3 B;  2MJD A;  3ABV B;  1QOF A;  3NVY A;  1DOY A;  1SIJ A;  3AE1 B;  1ZOY B;  2H88 B;  1TJE A;  1FM0 D;  3AEE B;  2CJO A;  3B2F A;  2BS4 B;  2KAJ A;  3FAH A;  1GPX A;  1CZP A;  1FXA A;  1N61 A;  2WU2 B;  1QT9 A;  3AE7 B;  3P4R B;  2PIA A;  4C7Z A;  1EWY C;  1XLN A;  1L6V A;  4P6V F;  3SFE B;  1QLB B;  1SF0 A;  2BS2 B;  3VR9 B;  3NRZ A;  3LXF A;  2BS3 B;  1QF6 A;  1FFV A;  1CJE A;  2QIE B;  1WYG A;  3DWM A;  4HRO A;  5EE1 A;  1TKY A;  3KWL A;  1XLQ A;  1N60 A;  2N0S B;  1L5P A;  1TKE A;  2E3T A;  3CWI A;  4US9 A;  1PUT A;  1RM6 C;  1OQQ A;  3P4P B;  1V8C A;  1E9M A;  1T3Q A;  3NVW A;  4N58 A;  1ZP0 B;  2W3S A;  1V97 A;  4WQM A;  3AM9 A;  5C2T B;  1I7H A;  5EE3 A;  1N5X A;  1DGJ A;  2H89 B;  2MH7 A;  2WDV B;  3NVV A;  1RYJ A;  1AWD A;  3ZYY X;  3W5V B;  1TYG B;  2M19 A;  1JW9 D;  1FXI A;  4LTU A;  1NVI D;  3BII D;  3W9C B;  1NI3 A;  4JWU C;  1JWA D;  1AYF A;  5AUK A;  4ZHP A;  1J7B A;  1VDV A;  5G5G A;  1JRP A;  1RWS A;  3PO0 A;  3B2G A;  1KF6 B;  1E6E B;  1JWB D;  2Q5W D;  4N59 A;  2DWQ A;  3AEA B;  4ZHO A;  3NS1 A;  3RPF C;  4JX1 C;  2ACZ B;  1FRD A;  3AE3 B;  1WXQ A;  1QOB A;  2KMM A;  3AED B;  3AMZ A;  4KX6 B;  3VRA B;  1NEK B;  2PVG C;  4YSZ B;  1E7P B;  1SB3 C;  5G5H A;  1J7C A;  3L4P A;  1UWM A;  2WQY B;  4N6E B;  1JRO A;  3SR6 A;  5C3J B;  1PFD A;  3HVZ A;  1A70 A;  4C7Y A;  3WCQ A;  4JWS C;  5H8Y E;  2G1E A;  1F0Z A;  2W3R A;  2WP9 B;  3P1M A;  4YTN B;  3AV8 A;  4A9A A;  1OFF A;  1RFK A;  1TKG A;  1VLB A;  2W54 A;  2W55 A;  3AE8 B;  2HTM E;  4YT0 B;  5GXG B;  2MJE A;  3SFD B;  4C80 A;  2WDQ B;  4YTM B;  1WGK A;  1KRH A;  1E0Z A;  4US8 A;  3P4Q B;  2FBW B;  2Y5C A;  4ITK A;  2PVO D;  1FFU A;  1YJJ A;  2JX5 A;  1N63 A;  3AH7 A;  2L52 A;  4IDI A;  4YSX B;  2QJL A;  3ETR A;  5EE9 A;  1WWT A;  2MJ3 A;  1FMA D;  2WU5 B;  4YSY B;  4YTP B;  3AE9 B;  5EE0 A;  1FO4 A;  1ZUD 2;  3W5U B; 
#chains in the Genus database with same CATH topology
 3IAM 1;  5H92 C;  5MPO A;  3RNA C;  4ANV A;  2PKO A;  1LXD A;  4GGQ A;  1D4B A;  3VXW A;  2QHO A;  3PRE A;  3ZTC A;  1SJH D;  2FIF A;  1K51 A;  3KLS X;  3NVZ A;  5DPS A;  1YJI A;  2K22 A;  2NBU A;  3DVN U;  2V0G A;  1VD2 A;  2L3Z A;  1XO3 A;  1TY2 A;  2RPV A;  3AE1 B;  3PS6 A;  3ZNZ B;  3TEY A;  4MEM A;  3AEE B;  4K7S A;  3B2F A;  2G3Q B;  1CZP A;  4WQO B;  2NCN A;  1ISN A;  4OZA A;  1GOZ A;  1P98 A;  4NQK E;  1V81 A;  4IC7 B;  2EMS A;  1TKE A;  3V61 A;  3PGE A;  4IM2 A;  4J3O D;  3RD2 A;  2RPQ A;  4HPP A;  2JZP A;  4M8M A;  2GMI C;  1VZ8 A;  3RMK C;  3T9L A;  3O13 A;  4WUR A;  4XZ4 A;  4ZRJ A;  3PZ7 A;  3U4E G;  5AUK A;  4B95 A;  3B2G A;  2GI9 A;  4N59 A;  4RMA A;  1VZ6 A;  2G4S A;  3AMZ A;  3VUX A;  3EC8 A;  5G5H A;  4HK2 A;  4LCD E;  1F2R C;  1PYW D;  3SR6 A;  2WXR A;  3BYY B;  4C7Y A;  3EA6 A;  2KHW B;  4MEL A;  4X57 B;  2LMC A;  2ICI A;  4XDC A;  5GXG B;  2W9N A;  2J0K A;  4KIK B;  2O6V B;  1WJ4 A;  4GOC A;  4F7Z A;  2K1F A;  2MBQ A;  2I2Y A;  1KLU D;  1N63 A;  2KK8 A;  4C00 A;  4YTP B;  4HEA 1;  2GBK A;  4HCN B;  1I4Q A;  1DOI A;  1Q5W B;  1QOA A;  2L32 A;  4FBJ B;  1E7V A;  1F9J A;  4BBN F;  1WJN A;  2ZW0 A;  1R7S A;  2KJR A;  1E10 A;  2V3P A;  2BKR B;  2RDH A;  3AE2 B;  5D7G A;  2LEK A;  4LK0 M;  1T0S C;  2D5G A;  3PRP B;  1P0R A;  3PLV A;  5KHQ A;  2KFK A;  3TEZ A;  1PDX A;  2KDI A;  3UIO B;  4PK1 A;  2KYW A;  2LFI A;  3K9P B;  4EZJ A;  2NTS A;  3MJ5 A;  3QCA A;  3BWU D;  3VH3 B;  4B6W A;  3S2A A;  4A90 A;  2MP2 B;  3VR9 B;  2KVZ A;  2LUE A;  4M0W B;  1CJE A;  1WGY A;  2GRI A;  1E90 A;  4W9G A;  4URK A;  4K1R B;  4TMA B;  4DHZ B;  3WAM A;  4CYE A;  1Y8R C;  2PJH A;  4ARI A;  1D3Z A;  1C4C A;  1EU3 A;  1SEB D;  5EE3 A;  2ASQ A;  4AP4 C;  1XD3 B;  2DYM A;  2MA9 B;  2REX A;  2D3C A;  3APF A;  1F77 A;  1FNU A;  4YSZ B;  1GUA B;  3P1M A;  1J8C A;  3AV8 A;  4A9A A;  1GPX A;  4C80 A;  4FUL A;  2L1A A;  3APD A;  2FUH B;  3UIN B;  2XK5 B;  3A1Q B;  1GG3 A;  3W1S C;  1DYQ A;  3E56 A;  3L08 A;  1GJZ A;  1KJT A;  2KDB A;  3KWV A;  2BVC A;  3BVZ A;  1JAL A;  3EUB 2;  3L13 A;  3A4R A;  2WS3 B;  2IO0 B;  2LZ6 A;  2BT6 A;  3AN1 A;  4WIP A;  3M3J A;  3V6C B;  4JLC A;  1TS3 A;  3KVF B;  2V3N A;  3RYT A;  2RD0 A;  4HJK A;  3HUI A;  1UF0 A;  1XLO A;  2KO3 A;  3UQA A;  4RF1 A;  3VR8 B;  2NPT A;  2WLB A;  4ANW A;  3ZJV A;  1TZO A;  1EF1 A;  2V4L A;  3JVZ X;  3IG3 A;  1IYF A;  1FM0 D;  2FID A;  1PGB A;  2BS4 B;  2KAJ A;  2WGS A;  2CU1 A;  2WHI A;  1YMH E;  1KOT A;  4C7Z A;  1XLN A;  3GP7 A;  3QC8 B;  1SF0 A;  1FFV A;  2CKH B;  3OAW A;  1N60 A;  4US9 A;  1UBI A;  2IPK D;  4W9L A;  1MG8 A;  5D94 A;  5J2R A;  3A9K B;  3GZN I;  3R8B A;  1EF5 A;  5DPT A;  3WAP A;  3BK1 A;  5C2T B;  1WF9 A;  1V86 A;  2JY6 A;  4ZRI A;  2QC8 A;  1KTK A;  4LJO B;  4LTU A;  4M00 A;  1FXT B;  3IT4 B;  5G5G A;  1SE2 A;  3PO0 A;  2IZV B;  2FCM A;  2M0X A;  4RCO A;  1Z2M A;  2WX0 A;  3AED B;  5TR5 A;  3J9C A;  1NEK B;  1XQQ A;  4BOZ B;  2IDY A;  4IOI E;  4DWF A;  3BVM A;  5D3D A;  2M1M A;  1OFF A;  1RRB A;  1L0X B;  1S3S G;  2IJ0 A;  2N9X A;  2N7E A;  1NI2 A;  1WWT A;  4YSY B;  1F52 A;  3RCZ A;  3Q3O C;  2IND C;  3V62 A;  1C4A A;  1ROE A;  1WXA A;  3U8Z A;  3ENE A;  2M4N A;  4YXD B;  3MHZ A;  3N1X C;  2JPH A;  4ZRP A;  4ZOH C;  4HRS A;  4I6L B;  3NJT A;  3RNG C;  2JUO A;  3HM3 A;  1JQ4 A;  2BBC A;  1PGA A;  2D11 A;  5I4D A;  4ZYN A;  4MDK E;  3ECI A;  1L6U A;  5LLI A;  3MJW A;  3TEW A;  1G6J A;  1ZGU B;  2BPS A;  3NG0 A;  2JQR B;  1NYQ A;  2M56 B;  3TSS A;  1OQR A;  2KTF A;  4FN2 A;  2KLG A;  4B9K A;  4R3D A;  3O65 B;  3CMM B;  4B0E A;  1I4R A;  2IYD B;  3K9O B;  2PIA A;  1WX7 A;  2K8C A;  2ON8 A;  2AWT A;  2BS3 B;  1QF6 A;  2DZJ A;  3DWM A;  1VR9 A;  2FNJ B;  4KIK A;  1OQQ A;  2O6V A;  1MI0 A;  3ZTD A;  2LXC A;  2W3S A;  3H7P B;  2BB6 A;  3AM9 A;  3QWZ B;  1EU4 A;  3VVW B;  4AQ7 A;  1RYJ A;  1AWD A;  3TUO A;  4BKS A;  4GLS C;  3NUH B;  2V4I B;  2LJ5 A;  2DWQ A;  4GIV A;  1FCL A;  1SBB B;  2K0P A;  1R4M B;  2J4X A;  3AE3 B;  1Y56 A;  1MPE A;  1PQS A;  2UWQ A;  1A70 A;  2GBJ A;  4W9H A;  2ZVO A;  2W54 A;  3R7Q A;  2C9W B;  3P4Q B;  2EMT A;  3AH7 A;  3L16 A;  2L52 A;  4MM3 B;  1YX5 B;  1C76 A;  2J52 A;  4C4V B;  2LRU A;  4OVV A;  1EO6 A;  3HHM A;  4CHK A;  3VRB B;  2MP2 A;  4M0W A;  3N3K B;  1NBF C;  2BKF A;  2KWD A;  1TS5 A;  4RGM A;  3AEB B;  1KLG D;  2WDR B;  5E6J A;  3IFW B;  3AEG B;  3AEC B;  1V5O A;  4RGN A;  3LB8 C;  2OHF A;  1ZDV A;  5BYQ A;  1N5W A;  3ZJU A;  2MJD A;  4OVZ A;  1TIF A;  4ICV A;  1WGD A;  3PHX B;  4TQ0 A;  2I38 A;  1RLF A;  4W9E A;  5C23 A;  2EEL A;  4LNN A;  4KZC A;  3KWL A;  3W1S A;  1TS2 A;  1PUT A;  1V8C A;  2O6V D;  3NVW A;  4N58 A;  3DBL B;  4FHJ A;  2KQ4 X;  2KDE B;  4XE0 A;  2JT4 B;  3FKY A;  1D5M C;  2Z0D B;  1K52 A;  2XK5 A;  3A1Q A;  2KTR A;  3Q3N C;  4OVU A;  2LVO A;  4BKS D;  3VTV A;  2NTT A;  4ARC A;  3W9C B;  1H8C A;  4A20 A;  3QJZ A;  2DZK A;  2Q5W D;  4ZHO A;  3ONS A;  4OZC A;  1WXQ A;  2GB1 A;  4J6I A;  2JYE A;  1E7P B;  2JYT A;  1BT0 A;  2ZW1 A;  4N6E B;  5IP4 D;  2EKE C;  2MEK A;  1QQR A;  3ML8 A;  2LHE A;  3L10 B;  1Q0W B;  2C60 A;  2WXO A;  4GU2 A;  3FIL A;  1V9J A;  1IBX B;  1YJJ A;  5EDS A;  4JGH B;  2L0F A;  2YEP B;  4FLH A;  4YSX B;  1V49 A;  3DVG Y;  3AE9 B;  2O2V A;  3W5U B;  2WXN A;  2LGI A;  2V3S A;  2KN5 A;  4WJO A;  4WWM A;  4EFO A;  3PZ8 A;  2D3B A;  4NNJ B;  1LGR A;  1ZPS A;  2KX0 A;  3PRZ A;  1IUE A;  5E6P A;  1OEY J;  3A9K A;  2KN4 A;  1DOX A;  4DBG A;  3W1Y A;  4RGO S;  2CR5 A;  3UQB A;  1YNT E;  3ALB A;  2LAS A;  2OOB B;  3NHE B;  2PMV A;  3U30 A;  1KM7 A;  3T3O A;  1YQ3 B;  1FEH A;  1WYW B;  3Q2A C;  3FAH A;  2BB5 A;  2KWC A;  3QQ8 B;  4JIO U;  1UGM A;  2VZK B;  1OGW A;  3TJP A;  5GMV A;  3ZNI D;  5J18 A;  2ZVN A;  3R66 C;  2WYQ A;  1HZ6 A;  4KZ0 A;  3CSF A;  4GDK B;  2MBE A;  4MGY E;  4E74 A;  1N5X A;  4NJ7 A;  1WE7 A;  2WDV B;  4WWP A;  4K7U A;  1JWM D;  1FXI A;  3DBR I;  4GSW A;  2PW9 A;  4F1S A;  4JWU C;  4DQO C;  4A6Q A;  2J42 A;  2IBI B;  1P9D U;  2XBB C;  3PSE B;  5J17 A;  1L7Y A;  1LFD A;  3DHI C;  4TQ1 A;  4TKN A;  2KJ6 A;  4BAX A;  2KMM A;  2JXT A;  4LNF A;  1SB3 C;  3SDL C;  4IM3 A;  2KMA A;  3HK0 A;  1IP9 A;  2PEA A;  2G1E A;  5FR3 A;  2FCN A;  1ENF A;  2PE9 A;  3KH0 A;  1GC6 A;  3HIZ A;  3L17 A;  3ZW3 A;  4US8 A;  2Z59 B;  3M63 B;  2PVO D;  2I1K A;  2A4Z A;  3C0R B;  4PYZ A;  4EZL A;  4RFB A;  3V05 A;  3Q8C A;  1C3T A;  4JPS A;  3FC4 A;  2KAC A;  3AEF B;  5L83 A;  2V9H A;  1HQR D;  1C1Y B;  1J7A A;  5AEK B;  5AUI A;  2DHZ A;  1QOG A;  1EWC A;  1B9R A;  5T8I A;  3RZF A;  3Q8F A;  1XF5 L;  3H7P A;  1WXS A;  1D5X C;  2KX3 A;  2CHW A;  4XC2 A;  2L00 B;  1JWS D;  5E6O A;  2RDB C;  5AZH A;  2J7Q B;  1AAR A;  1SIJ A;  2WDT B;  3EFU A;  2FE8 A;  4E71 A;  2KXJ A;  2V1Y A;  4HDO A;  3NZU A;  3DDC B;  3KUZ A;  4NQL B;  1L6V A;  5HFY A;  1QLB B;  3JYU A;  3LJ3 A;  4PYU A;  3B08 A;  1XLQ A;  2N0S B;  1L5P A;  3DHH C;  3EHV A;  1LM8 B;  3P4P B;  1E9M A;  1SIF A;  3NZS A;  1D6E C;  1K50 A;  1YOV B;  1TS4 A;  4MM3 A;  4C4V A;  2H89 B;  2C5L C;  5DPW A;  1R4N I;  1P7F A;  2BQQ A;  4GMV A;  4DXF A;  2M19 A;  1EM7 A;  3MC0 B;  1WRD B;  3BII D;  5DCN A;  1NI3 A;  1TT5 B;  1RWS A;  3GS2 A;  3NS1 A;  1TTN A;  1T6B X;  1CMX B;  3X23 A;  4XWW A;  2G45 B;  3TL5 A;  2ZNV B;  4GN1 A;  1FCC C;  1VLB A;  2WXG A;  4WWN A;  5CX3 A;  1TY0 A;  2JX5 A;  3BZD B;  2WXM A;  4KV2 A;  2QSD A;  3MC8 A;  2ZNV C;  1ZUD 2;  1KH0 A;  1C4P A;  3GE3 C;  2KD0 A;  4P1C C;  3MC9 A;  4I6P A;  4TV3 A;  1T0Y A;  2MW5 A;  2CJN A;  1BML C;  1QKZ A;  1XLP A;  4TUU A;  4HDQ A;  1NYR A;  2TSS A;  3P63 A;  2NR2 A;  2EKI A;  1C78 A;  2ZJD A;  1K8R B;  1WZ0 A;  1WJ6 A;  1UEL A;  4LNI A;  2I1J A;  5BMG A;  3N20 C;  1QIL A;  2C7M B;  2QCZ A;  2IO2 B;  1ET9 A;  2CJO A;  1XXG A;  3Q3J A;  3Q8B A;  2LRW A;  2M17 A;  2MHJ A;  2R2Q A;  2VRR B;  3KYD D;  2E3T A;  3CWI A;  3A33 B;  4I6N B;  1RM6 C;  1UBQ A;  3CF6 E;  1Q1O A;  4W9D A;  2BTE A;  2BGF A;  1WZ3 A;  4WH4 A;  5G55 A;  1ZP0 B;  1IBX A;  5KHO A;  4KVG B;  4W9I A;  2XN9 C;  2MBO A;  3TCA A;  3JSV B;  2IY1 B;  1SJE D;  2N7J A;  4N9F 4;  3W5V B;  2N9E B;  5FKA C;  1SGH A;  2IO1 B;  1OQY A;  4NPN A;  3UF8 A;  1IGC A;  3BK2 A;  3D32 A;  4JL9 A;  1NDD A;  1K53 A;  3AEA B;  4NAW B;  4ACF A;  3WAO A;  1S1Q B;  3VRA B;  1J7C A;  2D3A A;  4EUT A;  1PFD A;  3HVZ A;  1P1A A;  2YEP F;  4PT5 A;  3OLM D;  4YTN B;  2KJH B;  5BYR A;  3ZIM A;  2JZ3 B;  1MJD A;  3SD5 A;  3X0W A;  3VUY A;  4EOY A;  4KSL C;  4NZL B;  2WU5 B;  3VH4 B;  1WMH B;  2DX5 B;  4XGA B;  5BO4 B;  4OW0 A;  3DOW A;  1SXT A;  2LHD A;  2DAJ A;  1RAX A;  2D10 A;  3ZRC A;  2KOX A;  4USA A;  2INN E;  4YWG G;  4GDK A;  3RN9 C;  3ZNH B;  1VJK A;  1HEZ E;  5BYS A;  3DBH I;  2LI5 A;  4GB9 A;  4NJC A;  3H8H A;  4RH6 A;  1WRI A;  3V60 A;  2GLS A;  3L0W B;  2BWE S;  3NVY A;  3Q3M C;  4CQN A;  2MBH A;  4OHJ A;  2D2Q A;  3PRM B;  4HPM B;  4AUQ C;  4WAA A;  4HRO A;  4RNA A;  3ZGZ A;  5DPR A;  3VTW A;  2OED A;  2FCQ A;  1SE4 A;  2KLC A;  1WM2 A;  4PS7 A;  2G9H D;  4LJP B;  2C7N B;  4HKZ E;  1I7H A;  1YX6 B;  5TSS A;  2WXL A;  4RGT A;  4DK5 A;  1JWA D;  1VDV A;  3C8Y A;  3U2S C;  2KC2 A;  1WX9 A;  4XWT A;  3Q8A A;  1IPG A;  2L76 A;  2NVU I;  1SSN A;  3WCQ A;  1E5W A;  1Q10 A;  4HPL B;  3IVF A;  2KFJ A;  2HTM E;  2JRH A;  2X8X X;  2FBW B;  4PS8 A;  2GBN A;  1R4N B;  2QJL A;  4HWI B;  2MX2 A;  1TGZ B;  2L0T A;  2NBV B;  1T5X D;  4P7I A;  2VZK D;  3PV1 A;  2K9X A;  4LDT B;  2AX5 A;  3WAN A;  3ZXR A;  4A8X C;  1F2R I;  3VQI A;  2C7H A;  1P3Q U;  2NMQ A;  1RFA A;  4REZ A;  3AE5 B;  3B0A A;  2B76 B;  3H9D A;  4M02 A;  3E9S A;  4M01 A;  4II3 B;  5HKH A;  2MQJ A;  3KUD B;  1MFW A;  3GE8 C;  2GOW A;  2LGS A;  1M4V A;  4LNK A;  4AJW A;  2K39 A;  2FAZ A;  3TBL D;  3AB5 A;  4KSK C;  3N30 A;  4NAM A;  3ABV B;  4MT5 A;  4CO7 A;  1E8W A;  4MSQ B;  4XX5 A;  1TJE A;  2D3G A;  4DDG D;  4ZRQ A;  2RGF A;  4KKJ A;  1WYG A;  3KUC B;  3MHS D;  2N4F A;  5AZG A;  3BYT B;  4G0N B;  2CHX A;  4RF0 A;  3T8M A;  1X1M A;  4DHJ B;  3M62 B;  3U7Z A;  3QIJ A;  1DGJ A;  4K7W A;  2JRI B;  4BKT A;  3L54 A;  2K8B A;  2N9P C;  3SU8 X;  4C56 C;  1ZW7 A;  4ANX A;  4ZHP A;  1AN8 A;  3QHT A;  4O1N A;  1KF6 B;  1E6E B;  1JWB D;  1L4D B;  3WIM A;  3EEC A;  3RI7 C;  1OEY A;  4LLG M;  2LVQ A;  4E3C A;  4L2Y A;  5JZE B;  1L4Z B;  1P7E A;  2J53 A;  4D2K A;  2W55 A;  3SFD B;  3AE8 B;  2BWF A;  4YTM B;  1KRH A;  4WJP A;  2Z8L A;  1BXT A;  4ITK A;  2ONQ A;  3MP9 A;  1TZ1 A;  3ZXV A;  4IDI A;  1MVK A;  1FPY A;  5G2N A;  1FO4 A;  3AE4 B;  3CIR B;  4F8C B;  1JWU D;  1UNS A;  3CST A;  4MGI E;  4A3P A;  1L0V B;  1V6E A;  4WJQ A;  3RNF C;  3I3T B;  1WXM A;  1GAQ B;  2XEW A;  1PGX A;  3GZN B;  3A4S C;  1MHH E;  4M8N A;  2DBY A;  3T3N A;  1HE8 A;  4BFR A;  4EE2 A;  3TIX A;  5D2M B;  3AXC A;  3JSV A;  4HLE A;  2LJI A;  1ZOY B;  1LO5 D;  2H88 B;  5HHD G;  1J0G A;  3ZRF A;  1C9F A;  2SEB D;  4NAW A;  2LXA A;  2J0J A;  2RSU A;  4XYC A;  1L0Y B;  2YVC A;  2N7D A;  5BMH A;  3N9Y C;  1V2Y A;  2QDF A;  1XT9 B;  4S17 A;  1WFY A;  3A9J B;  1V80 A;  1WIA A;  3ZYY X;  2JSV X;  5IA7 A;  2VH1 A;  4TSS A;  1AYF A;  4L23 A;  2J0M A;  2GBR A;  1QOB A;  1D5Z C;  2R2O A;  2QIL A;  1STE A;  3N1Z C;  2K6D B;  2VH2 A;  4HKQ A;  5FR6 A;  1RFK A;  1YN3 A;  3GOE A;  2AL6 A;  2MWS B;  1E0Z A;  5IN7 A;  2L7R A;  3IT6 B;  2DEN B;  3RFZ B;  1FFU A;  3APC A;  4BVU C;  4IUM B;  3VUW A;  3ZNG C;  1C79 A;  4DXA B;  4WWO A;  1WI0 A;  2JZZ A;  1OTR B;  3NS8 A;  2G4D B;  2AL3 A;  2BW2 A;  2K5P A;  1KFY B;  1HZ5 A;  3NZ3 A;  3V6E B;  3PHW B;  1VCB A;  2K6Q A;  1N62 A;  2JWU A;  3B9J A;  4L1B A;  4ZDV A;  1ZXI A;  3DWG C;  3PT2 B;  4ZRK A;  3MTN B;  1XCQ L;  4BZA A;  1FRR A;  4K3C A;  2K25 A;  5IO9 A;  1UZX B;  2BYF A;  3OJ3 A;  4KKI A;  1UD7 A;  3KYC D;  4A3O A;  4II2 B;  2SAK A;  4FJY A;  1A5R A;  3LXF A;  2QEJ C;  1M94 A;  1WH3 A;  1ZDX A;  2MLB A;  3WA0 A;  1ZXH A;  3DQV A;  1T3Q A;  4MH8 A;  4ASW C;  2WX1 A;  4MAC A;  2N9L A;  2WXH A;  2N9K A;  4WAF A;  2JVC A;  3DPD A;  2IY0 B;  1TYG B;  1JW9 D;  2HE7 A;  1NVI D;  2A5U A;  2PTL A;  2DZM A;  2RDG A;  5HG2 A;  2KVR A;  1FRD A;  4EZK A;  3VHT C;  4W9C A;  2BYV E;  4FJV B;  5JHB A;  1Z5S B;  3H7S A;  1F0Z A;  2KQS A;  1HTO A;  2WDQ B;  2KWV B;  3B1L X;  1U4A A;  1T0Q C;  3H6N A;  2HJ1 A;  2HJ8 A;  2DYB A;  4S0R A;  2LVP A;  1UGJ A;  3NOB A;  2LWP A;  3ZJT A;  1V5T A;  1CK1 A;  2ZPN A;  4GDL B;  3Q3F A;  3TMP B;  3ZDM C;  1IGD A;  1YQB A;  2HD5 B;  3ZO5 B;  2AYO B;  1R4M I;  5AZF A;  1E8X A;  3QK0 A;  3Q6B A;  4P16 A;  5L95 C;  2BYT A;  1EUV B;  5JH5 C;  2AQ1 B;  1ESF A;  3ZDT A;  4OZB A;  5D6J B;  3VFK A;  1N6Z A;  2CS4 A;  4IWQ A;  1QOF A;  2LGY A;  4MJS B;  4NJ6 A;  1DOY A;  4DHZ E;  1LQB A;  1WXV A;  1MG4 A;  3IXS A;  3PTF C;  1JML A;  3AU4 A;  1FXA A;  1N61 A;  4KGS A;  4HCP B;  1YN5 A;  4B0M A;  5EE1 A;  5HI1 A;  3PPA A;  3W2D A;  4PS3 A;  1TKY A;  2OJR A;  2K8H A;  2Y3A A;  3VTU A;  2INC C;  3KW5 B;  5FK9 C;  4BOS C;  2UU7 A;  1WR1 A;  3BIN A;  2DLB A;  3KQ4 A;  4IM0 A;  4RM8 A;  2MH7 A;  4EKU A;  2RR9 A;  4IG7 B;  5C1Z A;  1E7U A;  4LDT D;  1AW7 A;  1GC7 A;  4LNO A;  1L2N A;  1I4G A;  2KTR B;  4KDI C;  3SHQ A;  4JX1 C;  3QA8 A;  4KDL B;  4KX6 B;  3WAL A;  2KDM A;  2MCN B;  2PVG C;  3L4P A;  5C3J B;  5JHA A;  1VRA B;  4W9K A;  1HXY D;  1GB4 A;  2WP9 B;  2DZI A;  1TKG A;  2L05 A;  1FNV A;  4YT0 B;  2PE6 B;  1WGK A;  2LD9 A;  2XNA C;  1J19 A;  1V1P B;  1YIW A;  4FHK A;  2ZEQ A;  3DBL I;  4G3X B;  2MJ3 A;  3RZW C;  1YD8 U;  2FUG 1;  3QAQ A;  3R2I A;  3FIL B;  4A55 A;  2CU3 A;  2ZPY A;  2CHZ A;  4AOF A;  3PLU A;  3R3M A;  3M95 A;  4WJN A;  4DXG A;  2B3A A;  2O2V B;  3RUL A;  4IWP A;  3U52 E;  3AUL A;  4DHJ D;  3A9J A;  1WJU A;  3DBR B;  3V3X A;  3QX1 A;  2KZR A;  2NBW B;  4ZYS A;  4H2A A;  1ZE3 D;  2D07 B;  3IBE A;  4KGR A;  2KAN A;  1HA5 A;  5CHW A;  5CHV C;  1T0R C;  1QT9 A;  2JWZ A;  2BS2 B;  2KKC A;  1E8Y A;  3NRZ A;  4FAD A;  2JF5 A;  2QIE B;  3I9V 1;  1XEE A;  5LXH A;  3PVL A;  2IGG A;  1V1O A;  4GXB A;  3LDZ E;  3URY A;  2IGH A;  2WXF A;  1GNU A;  4XDD A;  3DCG A;  2KT7 A;  1I4P A;  4JQW C;  1JRP A;  2Y5P A;  1HTQ A;  1F1H A;  1WM3 A;  2QMT A;  3ZKJ C;  5BMI A;  3LYY A;  4MGK E;  3BY4 B;  1WE6 A;  1I4H A;  2WQY B;  2R61 A;  4BKG A;  5H8Y E;  1XCT L;  2MRP A;  2FCS A;  4MH0 E;  2OJW A;  3ML9 A;  3Q14 C;  2MJE A;  4JE3 B;  2M0A A;  4HJG E;  2KDF B;  4W9J A;  3Q8E A;  3QAR A;  3DVG X;  1FMA D;  1UH6 A;  3TEX A;  4DDI D;  2ZCB A;  4AJY B;  2HTH A;  2HDE A;  3H1U A;  1KLV A;  2KQ7 A;  1B1Z A;  2L83 A;  2MSE D;  5JXV A;  3UGB B;  1YJ1 A;  1FNW A;  3UIP B;  3DVN V;  2DAF A;  3I63 C;  1QZE A;  1UWX A;  3AI5 A;  2DNF A;  2YLM A;  2WNM A;  2UYZ B;  1WGH A;  3P4S B;  4P1B C;  4AWJ A;  4W9F A;  1FIQ A;  3RNC C;  5D3I B;  3HRD D;  1SE3 A;  2AQ2 B;  4MGZ E;  1ET6 A;  4FA6 A;  5IOI A;  4HXD A;  4BBN C;  4Q2J A;  2LGX A;  2K3U A;  1EWY C;  3SFE B;  3IAS 1;  2DYO A;  3PZD A;  4MSM B;  4UDU C;  4NY0 A;  1MHX A;  2L8J A;  1V97 A;  3N32 A;  2INP E;  4G50 A;  4WQM A;  3ZQ4 A;  3IHP C;  2BF8 B;  3P42 A;  1SE9 A;  3HVD A;  3P2B A;  3R7R A;  3VDZ A;  2KFK B;  2X38 A;  4HVB A;  1WX8 A;  5LNK 1;  2Y5B B;  4GDL A;  2WXQ A;  3Q69 A;  3OG5 A;  4IW0 A;  5CHF A;  4ANU A;  2ACZ B;  2AEH A;  4FJZ A;  3BVG A;  1UWM A;  3RT3 B;  4JWS C;  3NY5 A;  1WGR A;  3JW0 X;  3HM6 X;  1TBE A;  3OWE B;  2ZCC A;  3DBS A;  2KWU B;  3MFG A;  4MJS A;  2KNB A;  1WSP A;  2WXK A;  2JU6 X;  1H4R A;  2IO3 B;  2E6X A;  3OJ4 B;  1I4X A;  5EE0 A;  4AS1 A;  1C77 A;  2N1V A;  1VZ7 A;  1GB1 A;  2PPH A;  1ACC A;  1NEN B;  1JRU A;  2M8S A;  3EGR A;  3R2T A;  1YN4 A;  3ZVV A;  4FXC A;  4IWO A;  1WGG A;  1YQ4 B;  4ICU A;  3ZLZ A;  2N1W A;  4K3B A;  1CQV A;  3AE6 B;  3UI3 A;  3U7D A;  3RNB C;  2BYE A;  2KC1 A;  3DHG C;  4KGT A;  2KMC A;  2GBM A;  5IKC M;  3I5J C;  2RMM A;  2WU2 B;  3P4R B;  3AE7 B;  1I42 A;  4P6V F;  4RM9 A;  2PLP A;  3RNE C;  3SEB A;  3C19 A;  3EFC A;  2WXI A;  1WR6 E;  1I35 A;  2MBB B;  5CTR C;  3I57 A;  4QAY A;  3GB1 A;  1V1P A;  3N1Y C;  2NPT B;  1BUI C;  4YL8 A;  3NVV A;  2WWZ A;  2LUM A;  1WY8 A;  1JCK B;  1J7B A;  2AQ3 B;  2WXJ A;  3RPF C;  2W82 A;  2WXP A;  2NS5 A;  5E6N A;  3DBH B;  3AU5 A;  4IKG A;  4EEW A;  3VAW A;  1JRO A;  3RUI B;  2W3R A;  3ZUN A;  2IGD A;  2Z0E B;  2JXX A;  1WMH A;  5IAA C;  4G11 A;  1E8Z A;  1FD6 A;  2Y5C A;  1ZKH A;  5LXI B;  2ZZP B;  3ETR A;  1UUP A;  5EE9 A;  2LGD A;  4K81 A; 
#chains in the Genus database with same CATH homology
 1UGJ A;  3IAM 1;  3ZJT A;  3VRB B;  5H92 C;  1CK1 A;  1SXT A;  5MPO A;  4M0W A;  2LHD A;  4GDL B;  2KWD A;  2PKO A;  1TS5 A;  1D4B A;  1IGD A;  4RGM A;  3AEB B;  4USA A;  1KLG D;  2INN E;  4YWG G;  2WDR B;  5E6J A;  1VJK A;  1HEZ E;  1SJH D;  4P16 A;  5BYS A;  1K51 A;  2BYT A;  3KLS X;  3AEG B;  3AEC B;  4NJC A;  3H8H A;  4RH6 A;  1WRI A;  3NVZ A;  1YJI A;  2AQ1 B;  2K22 A;  1ESF A;  4OZB A;  4RGN A;  2V0G A;  3LB8 C;  2OHF A;  1ZDV A;  5BYQ A;  1N5W A;  3ZJU A;  1XO3 A;  2MJD A;  4OVZ A;  1QOF A;  1TY2 A;  2RPV A;  3NVY A;  1DOY A;  3AE1 B;  3TEY A;  3IXS A;  3AEE B;  4CQN A;  3B2F A;  4TQ0 A;  1CZP A;  1JML A;  1FXA A;  1N61 A;  2I38 A;  4KGS A;  4OHJ A;  4OZA A;  1YN5 A;  4B0M A;  1GOZ A;  2EEL A;  4HRO A;  5EE1 A;  5HI1 A;  4RNA A;  3W2D A;  3ZGZ A;  1TKY A;  3KWL A;  2Y3A A;  1TKE A;  3W1S A;  4J3O D;  1TS2 A;  1PUT A;  2OED A;  1SE4 A;  5FK9 C;  1V8C A;  2JZP A;  3NVW A;  4N58 A;  2G9H D;  2KQ4 X;  4XE0 A;  4HKZ E;  1VZ8 A;  2DLB A;  3KQ4 A;  1I7H A;  1D5M C;  5TSS A;  2WXL A;  1K52 A;  3O13 A;  2MH7 A;  4WUR A;  4RGT A;  3PZ7 A;  2NTT A;  4ARC A;  3W9C B;  3U4E G;  5AUK A;  1JWA D;  1VDV A;  3C8Y A;  1AW7 A;  3B2G A;  2GI9 A;  3U2S C;  2Q5W D;  4N59 A;  1I4G A;  4ZHO A;  4XWT A;  4JX1 C;  1VZ6 A;  4OZC A;  1WXQ A;  3AMZ A;  3Q8A A;  4KX6 B;  2KDM A;  2GB1 A;  2JYE A;  2PVG C;  1E7P B;  5G5H A;  2JYT A;  3L4P A;  2ZW1 A;  1F2R C;  4N6E B;  1PYW D;  3SR6 A;  2WXR A;  5C3J B;  3BYY B;  4C7Y A;  1VRA B;  1SSN A;  3WCQ A;  1HXY D;  1GB4 A;  3EA6 A;  2MEK A;  1QQR A;  1Q10 A;  2WP9 B;  2LMC A;  2ICI A;  2LHE A;  4XDC A;  4YT0 B;  1TKG A;  5GXG B;  1FNV A;  2WXO A;  2HTM E;  1WGK A;  3FIL A;  2XNA C;  2FBW B;  1V1P B;  1YJJ A;  1IBX B;  2I2Y A;  1KLU D;  1N63 A;  2YEP B;  4YSX B;  2QJL A;  2MJ3 A;  4YTP B;  2FUG 1;  3AE9 B;  4HEA 1;  3W5U B;  3R2I A;  2WXN A;  3FIL B;  2LGI A;  4WWM A;  1I4Q A;  4A55 A;  1DOI A;  2CU3 A;  1T5X D;  1QOA A;  2L32 A;  2VZK D;  3PZ8 A;  2K9X A;  2AX5 A;  4A8X C;  1F2R I;  3VQI A;  4DXG A;  1ZPS A;  1IUE A;  2NMQ A;  4REZ A;  3AE5 B;  3U52 E;  2B76 B;  2ZW0 A;  1R7S A;  1E10 A;  2KN4 A;  3E9S A;  1DOX A;  4RGO S;  2V3P A;  2RDH A;  3AE2 B;  1YNT E;  2LEK A;  5D7G A;  4LK0 M;  2D5G A;  3V3X A;  1M4V A;  2PMV A;  4ZYS A;  3TEZ A;  3AB5 A;  1PDX A;  4H2A A;  3T3O A;  4NAM A;  1YQ3 B;  3ABV B;  4MT5 A;  1FEH A;  2LFI A;  2NTS A;  1TJE A;  1ZE3 D;  4KGR A;  3MJ5 A;  1HA5 A;  3BWU D;  3FAH A;  4A90 A;  2BB5 A;  4ZRQ A;  1QT9 A;  4KKJ A;  2VZK B;  2BS2 B;  3VR9 B;  3NRZ A;  1CJE A;  2QIE B;  1WYG A;  2GRI A;  3I9V 1;  1XEE A;  4TMA B;  1HZ6 A;  3BYT B;  4GDK B;  4RF0 A;  4ARI A;  2IGG A;  1C4C A;  1EU3 A;  1V1O A;  3U7Z A;  1SEB D;  5EE3 A;  1N5X A;  1DGJ A;  3URY A;  2IGH A;  2WDV B;  1JWM D;  1FXI A;  2WXF A;  4C56 C;  4XDD A;  2DYM A;  2PW9 A;  4JWU C;  4ZHP A;  1AN8 A;  1I4P A;  4DQO C;  4A6Q A;  1JRP A;  4O1N A;  2J42 A;  2Y5P A;  1KF6 B;  1E6E B;  1JWB D;  1L4D B;  4TQ1 A;  2QMT A;  5BMI A;  3LYY A;  2KMM A;  2JXT A;  1F77 A;  1FNU A;  4LLG M;  4YSZ B;  1SB3 C;  1I4H A;  2WQY B;  2R61 A;  4L2Y A;  1L4Z B;  1P7E A;  2J53 A;  5H8Y E;  2G1E A;  5FR3 A;  1XCT L;  1ENF A;  3P1M A;  4D2K A;  3AV8 A;  4A9A A;  1GPX A;  2W55 A;  3SFD B;  3AE8 B;  4C80 A;  4YTM B;  2MJE A;  4JE3 B;  1KRH A;  2M0A A;  4US8 A;  2Z8L A;  4HJG E;  1BXT A;  4ITK A;  2PVO D;  2ONQ A;  3MP9 A;  2L1A A;  3Q8E A;  4IDI A;  1MVK A;  4RFB A;  1FMA D;  3V05 A;  3TEX A;  1FO4 A;  1DYQ A;  3E56 A;  3AE4 B;  3Q8C A;  3CIR B;  1JWU D;  4JPS A;  2HDE A;  1UNS A;  3FC4 A;  2KAC A;  3AEF B;  3KWV A;  1B1Z A;  2L83 A;  1L0V B;  3BVZ A;  1HQR D;  1JAL A;  3EUB 2;  5JXV A;  1J7A A;  1GAQ B;  5AUI A;  1FNW A;  2WS3 B;  1PGX A;  1QOG A;  2BT6 A;  3AN1 A;  4WIP A;  1MHH E;  1EWC A;  2DBY A;  1B9R A;  5T8I A;  1UWX A;  3T3N A;  4EE2 A;  3Q8F A;  1XF5 L;  1TS3 A;  2V3N A;  1D5X C;  3HUI A;  1XLO A;  1JWS D;  2WNM A;  4RF1 A;  3VR8 B;  3P4S B;  2WLB A;  1FIQ A;  5D3I B;  3ZJV A;  3HRD D;  1SE3 A;  1TZO A;  2LJI A;  1SIJ A;  2AQ2 B;  1ET6 A;  1ZOY B;  1LO5 D;  2H88 B;  5HHD G;  1C9F A;  2FE8 A;  2SEB D;  1FM0 D;  1PGB A;  2BS4 B;  2KAJ A;  4Q2J A;  1YMH E;  2K3U A;  4C7Z A;  1EWY C;  1XLN A;  1L6V A;  3GP7 A;  3SFE B;  1QLB B;  1SF0 A;  2DYO A;  3IAS 1;  5HFY A;  1L0Y B;  4UDU C;  1FFV A;  5BMH A;  1XLQ A;  1N60 A;  2N0S B;  1L5P A;  3N9Y C;  4US9 A;  1MHX A;  2IPK D;  3P4P B;  1E9M A;  1V97 A;  1D6E C;  2INP E;  1K50 A;  4WQM A;  3R8B A;  3ZQ4 A;  1TS4 A;  3BK1 A;  3P42 A;  5C2T B;  2H89 B;  3HVD A;  1P7F A;  3ZYY X;  1KTK A;  2M19 A;  4DXF A;  1EM7 A;  3MC0 B;  4LTU A;  2X38 A;  2JSV X;  3BII D;  4TSS A;  1NI3 A;  1AYF A;  3IT4 B;  4L23 A;  1SE2 A;  1RWS A;  3PO0 A;  5G5G A;  5LNK 1;  2WXQ A;  3Q69 A;  3GS2 A;  3NS1 A;  2ACZ B;  4RCO A;  3AED B;  1QOB A;  3J9C A;  1NEK B;  1D5Z C;  3BVG A;  1T6B X;  1UWM A;  2IDY A;  2QIL A;  1STE A;  4IOI E;  4JWS C;  3BVM A;  4HKQ A;  4XWW A;  5D3D A;  3OWE B;  1FCC C;  1OFF A;  1RFK A;  1VLB A;  1YN3 A;  1L0X B;  1E0Z A;  2WXG A;  3IT6 B;  1TY0 A;  3RFZ B;  1FFU A;  2JX5 A;  3BZD B;  3MFG A;  2IJ0 A;  1WSP A;  2WXM A;  1WWT A;  2WXK A;  4YSY B;  2JU6 X;  2E6X A;  2QSD A;  1I4X A;  5EE0 A;  1ZUD 2;  4AS1 A;  1C4A A;  1C77 A;  1C4P A;  1KH0 A;  1ROE A;  1VZ7 A;  1C79 A;  4YXD B;  3MHZ A;  1GB1 A;  4ZRP A;  1ACC A;  1NEN B;  4ZOH C;  4HRS A;  3EGR A;  2BW2 A;  3R2T A;  1YN4 A;  1JQ4 A;  2K5P A;  4FXC A;  1KFY B;  2BBC A;  1HZ5 A;  1PGA A;  2CJN A;  3NZ3 A;  1BML C;  1QKZ A;  1YQ4 B;  1XLP A;  1N62 A;  5I4D A;  1NYR A;  2TSS A;  1CQV A;  2JWU A;  3AE6 B;  3P63 A;  3B9J A;  3UI3 A;  4L1B A;  1L6U A;  3TEW A;  2EKI A;  1ZXI A;  3DWG C;  1C78 A;  2JQR B;  1XCQ L;  1NYQ A;  1FRR A;  2M56 B;  4KGT A;  3TSS A;  1OQR A;  5BMG A;  4KKI A;  1QIL A;  4R3D A;  1ET9 A;  4B0E A;  2CJO A;  1I4R A;  2RMM A;  2WU2 B;  3P4R B;  3AE7 B;  2SAK A;  1XXG A;  2PIA A;  4P6V F;  2ON8 A;  2PLP A;  3LXF A;  2QEJ C;  2BS3 B;  3Q8B A;  3SEB A;  1QF6 A;  3DWM A;  1ZDX A;  2E3T A;  1VR9 A;  2WXI A;  3CWI A;  1RM6 C;  1OQQ A;  3I57 A;  1MI0 A;  1ZXH A;  4MH8 A;  1T3Q A;  2BTE A;  4WH4 A;  4MAC A;  1ZP0 B;  2W3S A;  3GB1 A;  1V1P A;  1IBX A;  2N9L A;  2BB6 A;  3AM9 A;  2WXH A;  1EU4 A;  2N9K A;  4WAF A;  2XN9 C;  1BUI C;  3NVV A;  4AQ7 A;  1RYJ A;  1SJE D;  2N7J A;  1AWD A;  3TUO A;  3W5V B;  1TYG B;  1JW9 D;  2LUM A;  4GLS C;  5FKA C;  1NVI D;  1JCK B;  3NUH B;  2V4I B;  1IGC A;  1J7B A;  3BK2 A;  2PTL A;  2RDG A;  1K53 A;  5HG2 A;  2AQ3 B;  2DWQ A;  3AEA B;  1SBB B;  2K0P A;  2WXJ A;  4NAW B;  3RPF C;  2J4X A;  2W82 A;  1FCL A;  1FRD A;  2WXP A;  3AE3 B;  1Y56 A;  3VRA B;  4IKG A;  1J7C A;  1MPE A;  1JRO A;  1PFD A;  3HVZ A;  1A70 A;  2YEP F;  1F0Z A;  2W3R A;  4PT5 A;  2IGD A;  4YTN B;  2W54 A;  5BYR A;  2WDQ B;  1FD6 A;  3P4Q B;  2Y5C A;  3AH7 A;  2L52 A;  4MM3 B;  3ETR A;  1UUP A;  4NZL B;  2J52 A;  1C76 A;  2WU5 B;  5EE9 A;  4OW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...