1CZPA

Anabaena pcc7119 [2fe-2s] ferredoxin in the reduced and oxixized state at 1.17 a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN I
publication title Refined X-ray structures of the oxidized, at 1.3 A, and reduced, at 1.17 A, [2Fe-2S] ferredoxin from the cyanobacterium Anabaena PCC7119 show redox-linked conformational changes.
pubmed doi rcsb
molecule tags Electron transport
total genus 25
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1czpA00
2LEKA 1FMAD 3FAHA 4USAA 5AUKA 1WGKA 2WDQB 4FXCA 1TYGB 2WQYB 2N0SB 4WWMA 4JWUC 4YTMB 2WS3B 1NENB 1N5XA 3ZYYX 5EE9A 1FRRA 1ZXIA 1ZOYB 3HRDD 1DGJA 1TKGA 1XLOA 2K5PA 2PVGC 1XLPA 2FBWB 3P4PB 5H8YE 1R7SA 1YQ3B 2K9XA 1NVID 2DBYA 3W9CB 1JWBD 1N63A 1NYRA 1VDVA 1NYQA 2Q5WD 3DWGC 3AE5B 3SFEB 4C7ZA 1E0ZA 1TKEA 3HUIA 4N6EB 1FM0D 3CWIA 4YTNB 4HROA 5H92C 1SB3C 2PKOA 3AE3B 1YJJA 1RFKA 2JX5A 2WP9B 1ZUD2 2BT6A 4WQMA 3W5UB 4YTPB 3P1MA 1T3QA 1FO4A 2WU5B 1JW9D 1E9MA 1EWYC 3AEEB 1V8CA 1FFUA 1KFYB 4ZHPA 1JRPA 4N58A 1E7PB 1QT9A 1UWMA 3PO0A 3AECB 1JROA 4ITKA 1YQ4B 1FXAA 1N5WA 2BS2B 2QJLA 3AEAB 1XLNA 4C80A 1JALA 2B76B 3AE6B 2WDRB 4KX6B 1TKYA 1FRDA 4LTUA 1XO3A 2CJNA 5G5HA 1DOIA 5GXGB 2ACZB 2MJDA 1CJEA 3AE2B 1OFFA 5C2TB 1L6VA 1QOGA 1WYGA 2W3SA 4JWSC 2BS3B 4N59A 3P4SB 4ZOHC 1NEKB 1QOAA 1L0VB 1VLBA 2QIEB 3AM9A 1OQQA 1RM6C 3AN1A 3NVVA 5G5GA 4P6VF 4A9AA 3P63A 1N62A 2MH7A 1WXQA 1L6UA 1RWSA 2M19A 4YT0B 3P4RB 2KAJA 3AE9B 5MPOA 2W55A 3NVZA 3AE1B 1L5PA 2M56B 5EE3A 1ZP0B 2L52A 5AUIA 3RPFC 3NVWA 1J7AA 2CJOA 2PVOD 3VRBB 1J7BA 1A70A 1GPXA 4YSZB 2G1EA 1AYFA 3AEBB 1PDXA 3KWLA 1DOXA 4JX1C 3B2GA 3AEFB 3AE7B 1PFDA 4ZHOA 1OQRA 2BS4B 2DWQA 2W3RA 2W54A 3AH7A 4YSXB 3NRZA 3AB5A 1AWDA 1KRHA 2Y5CA 3L4PA 4US9A 2EKIA 1YJIA 3AEDB 4HRSA 3P4QB 1KF6B 1PUTA 3HVZA 1GAQB 3B9JA 1XLQA 2WLBA 1FFVA 2JQRB 3WCQA 3ETRA 2L83A 2HTME 1VJKA 1SIJA 2MJ3A 1WRIA 1DOYA 1V97A 1QOBA 3NVYA 3SFDB 3VRAB 2CU3A 2OHFA 3CIRB 4US8A 5C3JB 3DWMA 1QF6A 1E6EB 1QLBB 3SR6A 1NI3A 1F0ZA 3NS1A 1WWTA 3FC4A 3AE4B 1J7CA 3LXFA 3W5VB 1FXIA 2PIAA 5EE0A 3EUB2 1E10A 1IUEA 3ABVB 1I7HA 1JQ4A 1ROEA 1N60A 3AMZA 2WU2B 4YXDB 1N61A 1RYJA 3B2FA 2KMMA 2MJEA 3BIID 3VR9B 3AEGB 2H88B 5EE1A 2H89B 2K22A 1B9RA 2AX5A 3AE8B 4YSYB 4C7YA 3VR8B 1QOFA 3LB8C 1TJEA 1CZPA 1FIQA 1JWAD 2E3TA 3AV8A 2WDVB 4IDIA 1SF0A
chains in the Genus database with same CATH superfamily
3FAHA 3TCAA 5CHWA 2MBHA 3TMPB 3HRDD 4KDIC 1SSNA 2VH2A 1D4BA 1WGGA 2PJHA 4MELA 1Q0WB 4S17A 1C1YB 2OJWA 1JWBD 1NYQA 5CTRC 2L1AA 2YLMA 2BWES 1ZUD2 2LVPA 2MP2B 4WURA 4DHZE 4WWNA 3AU5A 5DPTA 4A3OA 1V8CA 1FFUA 1V1PB 3MJWA 1HEZE 4OZCA 4NPNA 2B76B 1UNSA 5BYRA 1TKYA 2CJNA 4II2B 2MJDA 3AE2B 4NAWB 2W3SA 2JVCA 5JHAA 4LJPB 4XDDA 3SD5A 2KTRB 1T0QC 5KHOA 2M19A 1EU3A 3NJTA 2KXJA 1PGBA 2XBBC 4ANWA 1J7AA 2FE8A 2YEPB 2INDC 1WZ3A 4LNKA 3S2AA 4AUQC 1PDXA 3R2TA 3PPAA 3DVNV 1RRBA 2IDYA 2JU6X 2N1VA 1ZDXA 2LFIA 2KYWA 4HCNB 3NRZA 2KVZA 3MFGA 3PRMB 1KF6B 1PUTA 3MHSD 3RCZA 1V6EA 4CQNA 1VJKA 1OEYA 1WRIA 3NZUA 3ZXVA 2INPE 3VRAB 2KWDA 5FKAC 1WYWB 1L4ZB 1QQRA 4FN2A 3RNFC 3W5VB 4ICVA 3RD2A 3IAS1 1E7UA 1D5ZC 2WXNA 3UGBB 4YWGG 3LB8C 3TUOA 3VXWA 3ZNHB 2WDVB 3EGRA 3SEBA 4I6PA 2ZCCA 2L7RA 1WMHA 2K9XA 1N63A 3AE5B 1SB3C 5BMIA 4FHKA 2A4ZA 1KLUD 1MPEA 3I63C 4N58A 3WAMA 3URYA 1A5RA 2WDRB 2KK8A 4FBJB 4LTUA 3X23A 5BO4B 1QOGA 4EEWA 1TS4A 1KLVA 4MEMA 1KLGD 1NEKB 1FD6A 4DHJB 3ZJUA 3IHPC 1WH3A 2K8CA 3BWUD 4WWPA 4W9LA 2Z8LA 1YD8U 3JYUA 2FNJB 2G4SA 1AN8A 3L0WB 2DWQA 2NR2A 4ASWC 4F1SA 1HXYD 2PE6B 1WX9A 2WLBA 2N9XA 1YN3A 2WXGA 2JZPA 4PK1A 4PT5A 3IAM1 5LNK1 4HKZE 3VUWA 3TEYA 1OQYA 1C4AA 2WWZA 3NS1A 5IA7A 2NPTA 2KT7A 2CHWA 4K3CA 4ZYNA 4J3OD 2JXXA 3NHEB 1N61A 3VR9B 2D3GA 5E6OA 2AQ1B 3QJZA 2DZIA 1U4AA 4FXCA 4XWTA 1FCLA 1NENB 2LASA 3EC8A 1TKGA 3AI5A 2KO3A 4KDLB 1PGAA 2Q5WD 4C7ZA 1WXMA 1QKZA 3CWIA 3KVFB 2IYDB 1UZXB 1F1HA 2KHWB 1F77A 3ONSA 3VUXA 4HXDA 1E8XA 4BBNF 2KX0A 4X57B 4RM8A 5DPWA 1QT9A 4HEA1 1UWXA 1E5WA 4G0NB 5FR6A 3K9PB 3QQ8B 2JZZA 2N7EA 3RZWC 3BK1A 4PYZA 5GXGB 4MDKE 3DOWA 4JWSC 1KH0A 2QIEB 3VH3B 4JIOU 1OQQA 1WJUA 4P6VF 3V05A 2KAJA 4EOYA 2QMTA 2IO2B 4L2YA 3H7PB 4J6IA 2JT4B 3C19A 1I35A 3APDA 3IBEA 2GBJA 3K9OB 4MM3A 2G1EA 2PPHA 3V3XA 3PVLA 4ZHOA 1JWMD 3QA8A 1AWDA 1YJIA 2Z0EB 1WM2A 2JQRB 2DYBA 4BVUC 2ZNVC 3L08A 4RF1A 1WIAA 2X8XX 1YN4A 2BYVE 3PRZA 4LCDE 5HFYA 2J0JA 3X0WA 3LXFA 3O65B 1FXIA 5EE0A 1TGZB 3DBHI 3AMZA 2HE7A 2M17A 2K22A 1UBQA 4HDOA 3TEWA 2JXTA 2MX2A 2G4DB 3APCA 3L10B 1FIQA 3PZDA 2K8BA 3OWEB 4MT5A 3ECIA 1TYGB 2L76A 2O2VA 2WQYB 3WALA 1IGCA 1VCBA 1SE3A 3ZYYX 3RNCC 1NI2A 3ZKJC 4MJSA 3Q2AC 1FM0D 2WXFA 2R2OA 1XEEA 2QC8A 4K81A 1GC7A 3EECA 1D5MC 1V5TA 2BKFA 5IP4D 1EWYC 1HTQA 2FUG1 2C5LC 2KLGA 2IY1B 3C0RB 2AL3A 3ZXRA 1BT0A 4AWJA 4GDLB 4IWPA 2KC2A 2KJRA 1UUPA 1YMHE 4AQ7A 4ZYSA 2AL6A 4DWFA 2MBOA 1WXQA 3AE1B 1L5PA 2XK5B 2JRIB 2CJOA 1YIWA 3TJPA 2Z0DB 1HE8A 4LNIA 2D3BA 3IFWB 5FK9C 3AE7B 4K3BA 2K39A 1I4PA 2RPQA 5CHFA 4KZ0A 3VQIA 3B9JA 4HDQA 4TQ1A 1MVKA 2WXMA 2ZPNA 3DVNU 2JYEA 4EE2A 1I7HA 2L0TA 2V4IB 2WHIA 1TY2A 2KMMA 2CU1A 3E9SA 1L0XB 3PLVA 1YNTE 3BY4B 1FMAD 1WGKA 5IO9A 4RM9A 3PREA 1IPGA 1XLOA 3M3JA 1D5XC 2DX5B 4KSLC 2BW2A 2DBYA 3JSVB 4NJCA 1VDVA 3OAWA 4HROA 2L3ZA 2KQ4X 3QC8B 3V6EB 1WGRA 1WJNA 4MGIE 2ON8A 4KGTA 3VUYA 2EELA 1MFWA 1C78A 1R4NI 1JRPA 4RMAA 2V3PA 4ITKA 2B3AA 3AEAB 4LJOB 2JWUA 5HHDG 5G5HA 1L6VA 1SJHD 4W9GA 1I42A 2BGFA 5CX3A 3EHVA 2CHZA 2QSDA 2N1WA 2RDHA 1PGXA 4GMVA 2LI5A 3P4RB 3PRPB 3D32A 4IM0A 1MJDA 3B0AA 1T6BX 2V4LA 2KVRA 2V0GA 2ZCBA 4KSKC 2I1JA 2J42A 4JX1C 2PW9A 4QAYA 5G55A 2GRIA 2GBNA 2EMSA 3PV1A 3NZ3A 3RZFA 2RPVA 2MCNB 1XLQA 3KYDD 2KQ7A 3KLSX 2WYQA 2HTME 4A90A 1V97A 5AEKB 2WGSA 1ISNA 4FJZA 3H7SA 1I4HA 2AYOB 2WDTB 1RLFA 1LFDA 1TZOA 2IPKD 4WWOA 2PIAA 1M94A 4I6NB 4O1NA 2L8JA 3JVZX 1JQ4A 3LJ3A 2WU2B 3R3MA 3Q8BA 2DZJA 2DAFA 1V1PA 3RI7C 2WXKA 2AQ2B 4XE0A 2CS4A 3ZDMC 2PTLA 5AUKA 3PS6A 4DHZB 3WANA 3DBLI 2N0SB 1S1QB 1E8WA 2J0KA 2KZRA 1XLPA 4REZA 3P4PB 4D2KA 3U7ZA 4WJOA 1GB4A 4B9KA 1P1AA 1LO5D 2IGDA 3R8BA 3W5UB 1T3QA 3CSTA 3N1YC 1UWMA 1XCQL 4C80A 4BBNC 3A9KB 4W9DA 1WXSA 1K53A 2KMAA 4IWQA 3RYTA 3AM9A 1F9JA 1C77A 3VHTC 3QIJA 4W9IA 2W55A 4LDTD 1YOVB 5AUIA 2M8SA 4YSZB 5DPRA 3B2GA 4BOSC 4MH8A 2M1MA 3FKYA 2JF5A 2J0MA 2W3RA 2X38A 2GBRA 2E6XA 4AJYB 1V1OA 1I4XA 1WE6A 2R2QA 2QEJC 4BKTA 2MA9B 3PGEA 2CU3A 3CMMB 4US8A 1ENFA 1WGYA 3EA6A 4JLCA 1ZXHA 3UQBA 4KV2A 3N32A 1E10A 4JGHB 4XWWA 2PEAA 1N60A 4GLSC 4KIKB 5D3DA 3N3KB 3Q3OC 3GZNI 2LJ5A 2ZJDA 4XZ4A 1QOFA 2E3TA 3IG3A 3T3NA 4URKA 4USAA 4GXBA 1KM7A 1EWCA 4WWMA 2NTSA 4ZRPA 1FRRA 4NNJB 4W9JA 1LQBA 3NUHB 5DPSA 3ZTDA 4BKSD 1GB1A 1FPYA 3A9JA 1D6EC 2BT6A 2KDMA 3P1MA 2ZNVB 4W9EA 3OJ4B 4EUTA 1T0YA 4ZHPA 3VTVA 2RDGA 3A1QA 4MSMB 4WJPA 4EZKA 1G6JA 2ACZB 3ZNID 1YX5B 1OFFA 4IC7B 2AEHA 3RUIB 4RH6A 3P63A 2FCMA 5MPOA 3ZRCA 3AE9B 4GOCA 2KDFB 2K6DB 3OLMD 3W1SC 3O13A 1FNWA 3RPFC 1RAXA 5TR5A 4W9CA 1Z5SB 2WXLA 2UYZB 1PFDA 4FJYA 4FADA 2LWPA 5JH5C 5T8IA 4ANUA 3AEDB 1T5XD 3HVZA 2JWZA 5JHBA 2V3SA 3VTUA 2RR9A 4F7ZA 1DOYA 1N6ZA 2MJ3A 2K25A 1WY8A 4I6LB 4NY0A 2D07B 2LGXA 1V49A 1E90A 3VDZA 1V2YA 5C3JB 1QF6A 1E6EB 2UWQA 5BMGA 4HCPB 1K52A 2L00B 2NTTA 3ML8A 1Q10A 3ZVVA 4B0MA 4OW0A 5HKHA 1OEYJ 2RSUA 2MJEA 2W9NA 3BIID 1XQQA 5EE1A 3AE8B 1E8YA 5KHQA 1TJEA 1JWAD 1J8CA 4YTMB 5FR3A 3Q8AA 2HDEA 1XF5L 5H8YE 1ZE3D 1HTOA 1E0ZA 4HPPA 3AE3B 1WMHB 2C7NB 4EFOA 4KKJA 1BUIC 2LVQA 3KUCB 1JW9D 3ZJVA 3U7DA 1JROA 1FXAA 1SBBB 1N5WA 2GB1A 4G50A 2LGSA 3H6NA 3ZRFA 4ZRIA 1C76A 2NS5A 2NBVB 3PSEB 5IOIA 3MC9A 1WYGA 3I5JC 4KKIA 4ZOHC 1VLBA 3BK2A 1CK1A 2JUOA 3PHXB 4XX5A 5EE3A 2PVOD 4C4VA 1FXTB 1UBIA 2A5UA 2JZ3B 2KOXA 1P9DU 1DOXA 4TUUA 2R61A 1F52A 2W54A 3ZUNA 4E71A 5J2RA 3UIOB 1X1MA 4LNNA 4RGMA 4JQWC 1BXTA 5D6JB 4C56C 1GUAB 4XDCA 3BZDB 3DWMA 1F0ZA 1WSPA 4HJGE 3V62A 5E6NA 2GMIC 2D5GA 1ROEA 4JPSA 2WXHA 1UF0A 2GBMA 3M63B 2NPTB 2ASQA 1B9RA 1C9FA 4YSYB 4C7YA 3UF8A 3N9YC 4TKNA 3R7QA 4A55A 1EM7A 3L13A 1HZ6A 4NQLB 4MH0E 1WX8A 4MGZE 4RNAA 4GN1A 4W9HA 1R7SA 1OGWA 1ZGUB 2NVUI 2RGFA 3MJ5A 4WJNA 2AQ3B 5J18A 2DHZA 3GE8C 1YJJA 3TEXA 2HTHA 3ZDTA 1E9MA 3FILA 3DHIC 2V1YA 3NY5A 3EFUA 1JALA 3QWZB 2BBCA 4KX6B 1FRDA 1SEBD 1IYFA 4NJ7A 4YL8A 2KFKA 3HK0A 2BYTA 2MH7A 4YT0B 4ZRJA 2L52A 2ZVNA 1EU4A 3AEBB 3L17A 4ICUA 2JYTA 4GDKA 4RGTA 4MM3B 1V5OA 2KDIA 1SGHA 2BTEA 1XD3B 4HVBA 3U52E 3CF6E 4WJQA 4MGKE 4HWIB 2VZKD 2WNMA 3L4PA 4XC2A 2D11A 1B1ZA 3UQAA 4DK5A 3VAWA 2KTFA 3B1LX 3TIXA 1I4GA 2GBKA 1WR1A 2VH1A 1SXTA 1MG4A 1WWTA 4ZRQA 3V60A 4BKSA 2ZW1A 4H2AA 4RGOS 1YN5A 3DBSA 2ZZPB 2O6VA 4OVZA 5HI1A 3PTFC 2K8HA 3I9V1 4A6QA 1IBXA 2I1KA 1CZPA 4EZLA 1Z2MA 2KNBA 4KVGB 1Y8RC 4W9KA 1V9JA 2N9EB 4LDTB 4M0WA 2OOBB 1NDDA 4WAFA 1DGJA 2NMQA 2PVGC 3KYCD 3SDLC 2O2VB 4BFRA 2YVCA 2JRHA 3DWGC 3HUIA 1I4RA 2MLBA 2KJ6A 2JX5A 2KWVB 4MJSB 4CHKA 2CR5A 2KQSA 2JPHA 2WU5B 4II3B 3R7RA 4P7IA 1YQ4B 1DYQA 1C4PA 3KQ4A 4LNFA 1S3SG 3Q8CA 1HQRD 1TBEA 1J19A 1H4RA 2BVCA 2OJRA 4W9FA 4N59A 2REXA 1RM6C 3AN1A 3Q3MC 4A9AA 2M4NA 2KANA 3N1ZC 1TY0A 2UU7A 2XEWA 1KTKA 5C23A 3Q3JA 1R4MI 2IO3B 3NVWA 1CMXB 1K8RB 1M4VA 2FIFA 3KH0A 2QHOA 5L95C 1YX6B 1JRUA 3BVMA 1SE2A 4PYUA 1SJED 3IVFA 4ANVA 3RNGC 1C4CA 3AB5A 2HJ1A 4US9A 1L4DB 2EKIA 4HRSA 3DQVA 3PHWB 3IT4B 2BYEA 4CYEA 2FAZA 3DBHB 5BMHA 2K6QA 3CIRB 2Y3AA 3R66C 1QLBB 1V81A 2L0FA 3BYYB 2BKRB 1EF1A 1LGRA 1WJ4A 2BPSA 4K7UA 1EUVB 3GP7A 2DYMA 4NJ6A 3AEGB 2AX5A 2V3NA 2YEPF 2NCNA 2LGYA 1ZKHA 3AV8A 5E6PA 4JL9A 1QILA 5EE9A 2GI9A 5D3IB 4DXGA 2D10A 1V86A 4AJWA 3QHTA 3ZIMA 3UINB 2MP2A 3Q14C 1WGHA 1TZ1A 2N9PC 1P7EA 5AZGA 4P16A 3H1UA 1YJ1A 3QK0A 5LXIB 3RULA 4IUMB 3WAOA 4NAWA 2IGHA 4GSWA 2J4XA 3GB1A 3N20C 2KC1A 4HJKA 2QILA 3N30A 2GOWA 2KTRA 1QOAA 1L0VB 1J0GA 4IWOA 5G5GA 3ZLZA 2LHDA 2KWCA 1L6UA 1FCCC 4LLGM 4MSQB 3OJ3A 3UI3A 3DPDA 2LXCA 1ACCA 3TSSA 1AW7A 1GAQB 4XYCA 3WCQA 3ML9A 3EFCA 4RF0A 2OHFA 2IY0B 4B6WA 3FC4A 2LXAA 1ZW7A 1SE4A 1JCKB 3DHGC 3VVWB 2WX1A 4S0RA 5BYSA 4F8CB 4YXDB 1RYJA 2KN5A 3B2FA 4UDUC 1P0RA 1C79A 3P42A 3R2IA 2RMMA 2FUHB 5G2NA 3VR8B 4K7WA 1TIFA 4FHJA 1PYWD 4IDIA 4IG7B 2W82A 4ANXA 1WGDA 1ZOYB 4HK2A 1XT9B 1R4MB 2CHXA 4OZAA 1R4NB 1FNUA 3QX1A 3BVGA 4WH4A 2WP9B 4WQMA 3PT2B 4YTPB 3L16A 3MC8A 2J52A 3DBRI 5C1ZA 1JWSD 3TBLD 3AECB 4K1RB 4BOZB 3I57A 2QJLA 1XLNA 4DDID 4HLEA 1BMLC 1DOIA 2KFJA 5C2TB 4OVVA 4K7SA 2KDBA 3DVGY 3P4SB 2O6VD 3KW5B 4ARCA 2MW5A 4FLHA 1JWUD 1WXVA 2LGIA 2INCC 1L2NA 2MSED 3PZ8A 1J7BA 3C8YA 1GPXA 3HM6X 3A4SC 2DYOA 2XN9C 4KZCA 4M01A 1SIFA 4A3PA 1UGJA 2BWFA 2IZVB 1D3ZA 3QAQA 4L1BA 1MG8A 1TS2A 3T3OA 1L0YB 1H8CA 1ESFA 1T0SC 1VZ8A 4M8NA 3SFDB 4CO7A 2FCQA 1TS3A 3I3TB 2DLBA 3A4RA 2C7HA 2WXRA 4WQOB 2G45B 3Q3FA 3RNAC 4RCOA 1JMLA 3A33B 3KWVA 1J7CA 4IM2A 4OHJA 4BKGA 4FA6A 1E7VA 1VD2A 3DBLB 3H9DA 3ZTCA 4NQKE 3V61A 2H88B 4PS8A 3RMKC 3U4EG 2L05A 4IOIE 2LHEA 4AP4C 1FNVA 1F2RI 2LEKA 1SF0A 4JWUC 2G9HD 2MEKA 2RD0A 5IN7A 2GLSA 1HZ5A 4PS3A 3Q69A 1NYRA 3SFEB 3ZGZA 4N6EB 4P1BC 2PKOA 2I2YA 1RFKA 2VZKB 4HPMB 3A9JB 4B95A 1FO4A 2PE9A 1I4QA 1C3TA 3ALBA 4MGYE 1IGDA 3A1QB 1IP9A 2BQQA 3PLUA 2FCNA 4M8MA 3T8MA 3H7PA 3NVVA 2ZW0A 3MHZA 3RN9C 1N62A 4IW0A 4M00A 2KD0A 3VRBB 2MQJA 4B0EA 1Q1OA 4EZJA 2NBWB 2J7QB 2DENB 3KUDB 4E74A 2AWTA 2BF8B 2Y5CA 3SU8X 3RFZB 2XNAC 3U8ZA 2KDEB 1TT5B 3BINA 4AS1A 1SIJA 1QOBA 3BYTB 4DBGA 2LRUA 2FIDA 2QDFA 3WAPA 3Q8EA 3GZNB 3TEZA 4DDGD 3DBRB 3AE4B 3WIMA 3DCGA 3Q3NC 4DQOC 4Q2JA 1ZPSA 2C9WB 4ARIA 2WXIA 1T0RC 2G3QB 4JE3B 2ONQA 2ICIA 1XXGA 3NG0A 5IAAC 2DZMA 1ZXIA 3KUZA 4WIPA 4TV3A 2MBEA 1NVID 5D2MB 3T9LA 1WFYA 3AU4A 3IT6B 5H92C 2D3AA 4M02A 2MBBB 1UELA 3TL5A 2Y5BB 4R3DA 3LDZE 1KFYB 4GDLA 1E7PB 3PO0A 2J53A 2JSVX 3ZJTA 2LD9A 3APFA 2IJ0A 1PQSA 4L23A 2IO1B 4KGRA 1MI0A 3HVDA 3Q6BA 2L32A 2N9LA 4GGQA 1NBFC 2XK5A 1RFAA 3B08A 3IXSA 2BYFA 1RWSA 2DNFA 4FULA 5E6JA 4LK0M 1GJZA 1EO6A 1AYFA 3H8HA 1TS5A 3KWLA 4C4VB 2Z59B 3GOEA 2Y5PA 3ZO5B 1WZ0A 3NS8A 2I38A 3GS2A 4YSXB 1KRHA 1FEHA 2HJ8A 4XGAB 3OG5A 4E3CA 1VRAB 2L83A 1KOTA 3NVYA 1E8ZA 1GC6A 2M0XA 1AARA 2MWSB 4G11A 1NI3A 3SHQA 4LNOA 2QCZA 2WXOA 4N9F4 3PZ7A 4DHJD 2K3UA 2H89B 3HM3A 2IBIB 1MHHE 2ZEQA 2D3CA 1WR6E 3ZW3A 2TSSA 3JSVA 1N5XA 2MHJA 1WM3A 5TSSA 2K5PA 2LZ6A 2BB6A 3P2BA 3W9CB 3N1XC 4TMAB 5I4DA 2M0AA 2LUMA 1SE9A 3U30A 1KJTA 1LM8B 2EKEC 5BYQA 3W2DA 1TTNA 2WXQA 3AULA 2WXJA 1K51A 1K50A 4IKGA 2BS2B 2LUEA 2CKHB 2DZKA 3E56A 5EDSA 3FILB 1WE7A 3M95A 1MHXA 3QCAA 3U2SC 2JY6A 3M62B 1CJEA 2IO0B 1P7FA 3QARA 2N7JA 2IGGA 3CSFA 2KFKB 4OZBA 1ET9A 3NVZA 4GB9A 4RFBA 3VH4B 1VZ6A 1UGMA 3RNBC 2SAKA 3MTNB 1QZEA 4P1CC 1WI0A 2KMCA 1VR9A 1ET6A 1P98A 3LYYA 2SEBD 3W1SA 4BAXA 3AH7A 3VTWA 4GDKB 1P3QU 3ZNZB 5L83A 2ZPYA 3P4QB 5CHVC 1FFVA 5IKCM 3ETRA 3NOBA 2DAJA 3DHHC 3JW0X 5J17A 3AXCA 1HA5A 1YQBA 3UIPB 5JZEB 3SR6A 1L7YA 3L54A 4RGNA 1GNUA 1ZDVA 3EUB2 4TQ0A 3ABVB 2KX3A 2NBUA 1WJ6A 5LLIA 1GG3A 2N4FA 2KACA 3J9CA 1STEA 2KN4A 2O6VB 3W1YA 4ZRKA 1CQVA 4TSSA 1LXDA 3ZNGC 2WDQB 4NZLB 3BVZA 2WS3B 1IBXB 3MP9A 3WA0A 4FJVB 3VFKA 3ZQ4A 1WF9A 2N7DA 2FBWB 5D94A 1Y56A 1YQ3B 3DVGX 4M0WB 5D7GA 1TKEA 2K1FA 4YTNB 4AOFA 4BZAA 2MBQA 4GIVA 3NZSA 5JXVA 2KLCA 4KGSA 4A20A 4EKUA 2KWUB 5HG2A 4DXAB 4PS7A 5AZHA 2LMCA 2KKCA 4C00A 4NAMA 3AEEB 2RDBC 3A9KA 1EF5A 2EMTA 3ENEA 2PLPA 3MC0B 3AE6B 1XO3A 3GE3C 2LRWA 4WAAA 2WX0A 2V9HA 1F2RC 2BS3B 2C7MB 4HPLB 2FCSA 1OTRB 2M56B 2HD5B 5GMVA 3HHMA 1A70A 1WX7A 2LJIA 2INNE 4G3XB 1Q5WB 3AEFB 2BB5A 2WXPA 1OQRA 2BS4B 4A8XC 1UD7A 4GU2A 2D2QA 5AZFA 4ZDVA 1V80A 3V6CB 2ZVOA 1WRDB 3Q8FA 5LXHA 2KJHB 2PMVA 2K0PA 3RNEC 4OVUA 2VRRB 1XCTL 4KIKA 4HKQA 4ACFA 2OEDA 4DXFA 2MRPA 1IUEA 1WXAA 2N9KA 2LVOA 3DDCB 1UH6A 5DCNA 2C60A 3HIZA 3RT3B 1VZ7A 1GOZA 4IM3A 2LGDA 4MACA 1ZP0B
chains in the Genus database with same CATH topology
2LEKA 1FMAD 3FAHA 4A55A 1EM7A 1WGKA 1HZ6A 4JWUC 2G9HD 2MEKA 3HRDD 1SSNA 1HZ5A 1XLOA 4RNAA 1D4BA 3Q69A 1D5XC 1R7SA 4NJCA 2BW2A 2DBYA 1JWBD 1NYRA 1VDVA 1NYQA 3SFEB 3ZGZA 4N6EB 4HROA 2L1AA 3MJ5A 2PKOA 2KQ4X 2AQ3B 3TEXA 1YJJA 2I2YA 1RFKA 1ZUD2 2VZKB 4WURA 2ON8A 4KGTA 1FO4A 2EELA 1C78A 1E9MA 1I4QA 1V8CA 1FFUA 3FILA 1JRPA 1V1PB 2V3PA 4ITKA 1HEZE 3AEAB 4OZCA 4IOIE 1JALA 2B76B 1IGDA 2BBCA 1UNSA 2JWUA 4KX6B 1TKYA 5BYRA 1FRDA 1SEBD 2CJNA 5HHDG 5G5HA 2MJDA 3AE2B 4NAWB 1L6VA 1SJHD 2W3SA 4XDDA 3NVVA 2BYTA 2QSDA 2ZW0A 3MHZA 1N62A 2MH7A 4YT0B 2RDHA 1PGXA 1EU3A 2M19A 3P4RB 1T6BX 1ZP0B 2L52A 1PGBA 1J7AA 3VRBB 2V0GA 2FE8A 2YEPB 4B0EA 1EU4A 3AEBB 1PDXA 2JYTA 3R2TA 2J42A 4JX1C 4RGTA 2PW9A 2IDYA 4MM3B 2JU6X 2BTEA 2GRIA 1ZDXA 2LFIA 3U52E 2VZKD 3NRZA 2WNMA 2Y5CA 3L4PA 3NZ3A 3MFGA 2RPVA 1KF6B 1B1ZA 1PUTA 3RFZB 2XNAC 1XLQA 3KLSX 4CQNA 2HTME 4A90A 1VJKA 4AS1A 1SIJA 1WRIA 1V97A 1QOBA 3BYTB 2INPE 3VRAB 1I4GA 2KWDA 5FKAC 1I4HA 1L4ZB 1SXTA 1QQRA 3Q8EA 1WWTA 3TEZA 4ZRQA 3AE4B 1TZOA 2IPKD 2ZW1A 3W5VB 2PIAA 4O1NA 4H2AA 4RGOS 1YN5A 1JQ4A 4DQOC 4OVZA 3IAS1 2WU2B 4Q2JA 1ZPSA 5HI1A 3Q8BA 1D5ZC 2WXNA 1V1PA 3I9V1 4A6QA 2WXKA 4ARIA 2WXIA 2AQ2B 4YWGG 4XE0A 3LB8C 1IBXA 4JE3B 1CZPA 3TUOA 2WDVB 3EGRA 2ONQA 2PTLA 5AUKA 3SEBA 2ICIA 1XXGA 2N0SB 4M0WA 4WAFA 1ZXIA 1DGJA 2NMQA 2PVGC 4WIPA 4REZA 1XLPA 3P4PB 2K9XA 4D2KA 1NVID 3U7ZA 1GB4A 1N63A 3DWGC 3AE5B 3HUIA 1I4RA 3IT6B 1LO5D 5H92C 1SB3C 5BMIA 2IGDA 2JX5A 3R8BA 1KLUD 3W5UB 1T3QA 1MPEA 4R3DA 2WU5B 1KFYB 4N58A 1E7PB 1UWMA 3PO0A 1XCQL 2J53A 2JSVX 3ZJTA 1YQ4B 1DYQA 3URYA 4C80A 2IJ0A 4L23A 1C4PA 3KQ4A 2WDRB 4KGRA 1MI0A 3Q8CA 1HQRD 4LTUA 3HVDA 1K53A 2L32A 2N9LA 1QOGA 1TS4A 4N59A 1KLGD 1NEKB 1FD6A 3AM9A 1RM6C 3AN1A 4A9AA 1C77A 3IXSA 1RWSA 1TY0A 2W55A 3ZJUA 1KTKA 5E6JA 5AUIA 3NVWA 4LK0M 1M4VA 4YSZB 1AYFA 3H8HA 3BWUD 1TS5A 3KWLA 2Z8LA 3B2GA 2Y5PA 3BVMA 4MH8A 1SE2A 1AN8A 1SJED 2W3RA 2DWQA 2I38A 2X38A 1C4CA 3GS2A 4YSXB 2E6XA 3AB5A 1KRHA 1FEHA 4US9A 1L4DB 2EKIA 4HRSA 1V1OA 1HXYD 2WLBA 1VRAB 3IT4B 2L83A 1YN3A 1I4XA 3NVYA 2QEJC 2WXGA 2JZPA 4PT5A 3IAM1 2CU3A 5BMHA 5LNK1 3CIRB 4HKZE 4US8A 3TEYA 2Y3AA 1QLBB 1ENFA 1NI3A 3EA6A 1C4AA 3NS1A 3BYYB 1ZXHA 1E10A 2WXOA 4XWWA 4J3OD 3GP7A 1N60A 3PZ7A 1N61A 3VR9B 4GLSC 2K3UA 2DYMA 3AEGB 2H89B 5D3DA 2AX5A 2V3NA 2YEPF 2AQ1B 1QOFA 1MHHE 2E3TA 3AV8A 3T3NA 4USAA 1QILA 1EWCA 4FXCA 4XWTA 2TSSA 4WWMA 1FCLA 2NTSA 4ZRPA 1NENB 1N5XA 5EE9A 1FRRA 2GI9A 5TSSA 5D3IB 1TKGA 2K5PA 2BB6A 4DXGA 3NUHB 3W9CB 1PGAA 2Q5WD 4TMAB 4C7ZA 5I4DA 2M0AA 1GB1A 1QKZA 3CWIA 2LUMA 1P7EA 4P16A 5BYQA 1D6EC 2BT6A 2KDMA 1F77A 3W2DA 3P1MA 2WXQA 4ZHPA 2WXJA 1QT9A 4HEA1 1UWXA 2RDGA 1K51A 1K50A 4IKGA 2IGHA 2BS2B 2J4XA 3E56A 3FILB 1MHXA 3GB1A 3U2SC 3BK1A 5GXGB 2ACZB 2QILA 1CJEA 1OFFA 1P7FA 4JWSC 1KH0A 1QOAA 2QIEB 1L0VB 2N7JA 2IGGA 1OQQA 4RH6A 4P6VF 2LHDA 3P63A 5G5GA 3V05A 1L6UA 5MPOA 4OZBA 1FCCC 2KAJA 1ET9A 3AE9B 4LLGM 2QMTA 3NVZA 4L2YA 3O13A 4RFBA 1FNWA 3RPFC 1VZ6A 2SAKA 2G1EA 3UI3A 1VR9A 1ET6A 2WXLA 3V3XA 3LYYA 2SEBD 1PFDA 4ZHOA 1ACCA 1JWMD 3W1SA 3TSSA 3AH7A 4GDKB 5T8IA 1AWDA 1AW7A 1YJIA 3AEDB 3P4QB 1T5XD 3HVZA 1GAQB 1FFVA 2JQRB 3WCQA 3ETRA 4RF1A 1DOYA 2MJ3A 4RF0A 1HA5A 1YN4A 2OHFA 5C3JB 1QF6A 1E6EB 3SR6A 5BMGA 4RGNA 1K52A 5HFYA 2NTTA 1Q10A 3FC4A 1ZDVA 4B0MA 3LXFA 1SE4A 1JCKB 1FXIA 4OW0A 5EE0A 3EUB2 4TQ0A 3ABVB 5BYSA 3AMZA 4YXDB 1RYJA 3B2FA 2MJEA 3BIID 4UDUC 2KACA 3J9CA 1C79A 2K22A 5EE1A 3P42A 3TEWA 1STEA 3AE8B 2RMMA 2JXTA 2KN4A 3R2IA 3VR8B 4MACA 1TJEA 1CQVA 1FIQA 1JWAD 4TSSA 1PYWD 4IDIA 3OWEB 4MT5A 2W82A 2WDQB 4NZLB 1TYGB 2WQYB 4YTMB 5FR3A 3BVZA 2WS3B 1IGCA 1IBXB 1SE3A 3ZYYX 3Q8AA 3MP9A 1ZOYB 2HDEA 3ZQ4A 1XF5L 2FBWB 5H8YE 1Y56A 1YQ3B 1ZE3D 1E0ZA 5D7GA 1TKEA 4OZAA 1FM0D 1FNUA 2WXFA 4YTNB 1XEEA 3AE3B 3BVGA 4WH4A 5JXVA 2WP9B 4KGSA 4KKJA 1BUIC 4WQMA 5HG2A 4YTPB 1D5MC 2LMCA 2J52A 4NAMA 1JW9D 1JWSD 1EWYC 3AEEB 3ZJVA 3AECB 2FUG1 1JROA 3I57A 1FXAA 1SBBB 1N5WA 2QJLA 1XLNA 2PLPA 3MC0B 2GB1A 3AE6B 4GDLB 1BMLC 1XO3A 1C76A 1DOIA 1F2RI 5C2TB 1UUPA 1WYGA 1F2RC 1YMHE 2BS3B 4KKIA 3P4SB 4ZOHC 4AQ7A 1VLBA 4ZYSA 4ARCA 3BK2A 1CK1A 1JWUD 1WXQA 2LGIA 3AE1B 1L5PA 2M56B 5EE3A 3PZ8A 2CJOA 2PVOD 1J7BA 1A70A 3C8YA 1GPXA 2LJIA 2DYOA 2XN9C 2INNE 1DOXA 2R61A 5FK9C 3AEFB 2BB5A 3AE7B 2WXPA 1OQRA 1UGJA 2BS4B 4A8XC 2W54A 4L1BA 1I4PA 1TS2A 3VQIA 3T3OA 4RGMA 3B9JA 1L0YB 1ESFA 1BXTA 4TQ1A 1VZ8A 3SFDB 4C56C 1TS3A 2DLBA 1MVKA 3Q8FA 4XDCA 3BZDB 2WXRA 2WXMA 3DWMA 2PMVA 2K0PA 1F0ZA 1WSPA 4RCOA 1JMLA 1XCTL 4HKQA 3KWVA 1J7CA 2OEDA 2JYEA 4DXFA 4OHJA 4EE2A 4HJGE 1IUEA 1I7HA 2D5GA 1ROEA 4JPSA 2WXHA 2N9KA 2V4IB 1TY2A 2KMMA 1B9RA 2H88B 1C9FA 3E9SA 4YSYB 4C7YA 1L0XB 1YNTE 1VZ7A 3U4EG 1GOZA 2LHEA 1FNVA 3N9YC 1SF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LEK A;  1FMA D;  3FAH A;  4USA A;  5AUK A;  1WGK A;  2WDQ B;  4FXC A;  1TYG B;  2WQY B;  2N0S B;  4WWM A;  4JWU C;  4YTM B;  2WS3 B;  1NEN B;  1N5X A;  3ZYY X;  5EE9 A;  1FRR A;  1ZXI A;  1ZOY B;  3HRD D;  1DGJ A;  1TKG A;  1XLO A;  2K5P A;  2PVG C;  1XLP A;  2FBW B;  3P4P B;  5H8Y E;  1R7S A;  1YQ3 B;  2K9X A;  1NVI D;  2DBY A;  3W9C B;  1JWB D;  1N63 A;  1NYR A;  1VDV A;  1NYQ A;  2Q5W D;  3DWG C;  3AE5 B;  3SFE B;  4C7Z A;  1E0Z A;  1TKE A;  3HUI A;  4N6E B;  1FM0 D;  3CWI A;  4YTN B;  4HRO A;  5H92 C;  1SB3 C;  2PKO A;  3AE3 B;  1YJJ A;  1RFK A;  2JX5 A;  2WP9 B;  1ZUD 2;  2BT6 A;  4WQM A;  3W5U B;  4YTP B;  3P1M A;  1T3Q A;  1FO4 A;  2WU5 B;  1JW9 D;  1E9M A;  1EWY C;  3AEE B;  1V8C A;  1FFU A;  1KFY B;  4ZHP A;  1JRP A;  4N58 A;  1E7P B;  1QT9 A;  1UWM A;  3PO0 A;  3AEC B;  1JRO A;  4ITK A;  1YQ4 B;  1FXA A;  1N5W A;  2BS2 B;  2QJL A;  3AEA B;  1XLN A;  4C80 A;  1JAL A;  2B76 B;  3AE6 B;  2WDR B;  4KX6 B;  1TKY A;  1FRD A;  4LTU A;  1XO3 A;  2CJN A;  5G5H A;  1DOI A;  5GXG B;  2ACZ B;  2MJD A;  1CJE A;  3AE2 B;  1OFF A;  5C2T B;  1L6V A;  1QOG A;  1WYG A;  2W3S A;  4JWS C;  2BS3 B;  4N59 A;  3P4S B;  4ZOH C;  1NEK B;  1QOA A;  1L0V B;  1VLB A;  2QIE B;  3AM9 A;  1OQQ A;  1RM6 C;  3AN1 A;  3NVV A;  5G5G A;  4P6V F;  4A9A A;  3P63 A;  1N62 A;  2MH7 A;  1WXQ A;  1L6U A;  1RWS A;  2M19 A;  4YT0 B;  3P4R B;  2KAJ A;  3AE9 B;  5MPO A;  2W55 A;  3NVZ A;  3AE1 B;  1L5P A;  2M56 B;  5EE3 A;  1ZP0 B;  2L52 A;  5AUI A;  3RPF C;  3NVW A;  1J7A A;  2CJO A;  2PVO D;  3VRB B;  1J7B A;  1A70 A;  1GPX A;  4YSZ B;  2G1E A;  1AYF A;  3AEB B;  1PDX A;  3KWL A;  1DOX A;  4JX1 C;  3B2G A;  3AEF B;  3AE7 B;  1PFD A;  4ZHO A;  1OQR A;  2BS4 B;  2DWQ A;  2W3R A;  2W54 A;  3AH7 A;  4YSX B;  3NRZ A;  3AB5 A;  1AWD A;  1KRH A;  2Y5C A;  3L4P A;  4US9 A;  2EKI A;  1YJI A;  3AED B;  4HRS A;  3P4Q B;  1KF6 B;  1PUT A;  3HVZ A;  1GAQ B;  3B9J A;  1XLQ A;  2WLB A;  1FFV A;  2JQR B;  3WCQ A;  3ETR A;  2L83 A;  2HTM E;  1VJK A;  1SIJ A;  2MJ3 A;  1WRI A;  1DOY A;  1V97 A;  1QOB A;  3NVY A;  3SFD B;  3VRA B;  2CU3 A;  2OHF A;  3CIR B;  4US8 A;  5C3J B;  3DWM A;  1QF6 A;  1E6E B;  1QLB B;  3SR6 A;  1NI3 A;  1F0Z A;  3NS1 A;  1WWT A;  3FC4 A;  3AE4 B;  1J7C A;  3LXF A;  3W5V B;  1FXI A;  2PIA A;  5EE0 A;  3EUB 2;  1E10 A;  1IUE A;  3ABV B;  1I7H A;  1JQ4 A;  1ROE A;  1N60 A;  3AMZ A;  2WU2 B;  4YXD B;  1N61 A;  1RYJ A;  3B2F A;  2KMM A;  2MJE A;  3BII D;  3VR9 B;  3AEG B;  2H88 B;  5EE1 A;  2H89 B;  2K22 A;  1B9R A;  2AX5 A;  3AE8 B;  4YSY B;  4C7Y A;  3VR8 B;  1QOF A;  3LB8 C;  1TJE A;  1CZP A;  1FIQ A;  1JWA D;  2E3T A;  3AV8 A;  2WDV B;  4IDI A;  1SF0 A; 
#chains in the Genus database with same CATH topology
 3FAH A;  3TCA A;  5CHW A;  2MBH A;  3TMP B;  3HRD D;  4KDI C;  1SSN A;  2VH2 A;  1D4B A;  1WGG A;  2PJH A;  4MEL A;  1Q0W B;  4S17 A;  1C1Y B;  2OJW A;  1JWB D;  1NYQ A;  5CTR C;  2L1A A;  2YLM A;  2BWE S;  1ZUD 2;  2LVP A;  2MP2 B;  4WUR A;  4DHZ E;  4WWN A;  3AU5 A;  5DPT A;  4A3O A;  1V8C A;  1FFU A;  1V1P B;  3MJW A;  1HEZ E;  4OZC A;  4NPN A;  2B76 B;  1UNS A;  5BYR A;  1TKY A;  2CJN A;  4II2 B;  2MJD A;  3AE2 B;  4NAW B;  2W3S A;  2JVC A;  5JHA A;  4LJP B;  4XDD A;  3SD5 A;  2KTR B;  1T0Q C;  5KHO A;  2M19 A;  1EU3 A;  3NJT A;  2KXJ A;  1PGB A;  2XBB C;  4ANW A;  1J7A A;  2FE8 A;  2YEP B;  2IND C;  1WZ3 A;  4LNK A;  3S2A A;  4AUQ C;  1PDX A;  3R2T A;  3PPA A;  3DVN V;  1RRB A;  2IDY A;  2JU6 X;  2N1V A;  1ZDX A;  2LFI A;  2KYW A;  4HCN B;  3NRZ A;  2KVZ A;  3MFG A;  3PRM B;  1KF6 B;  1PUT A;  3MHS D;  3RCZ A;  1V6E A;  4CQN A;  1VJK A;  1OEY A;  1WRI A;  3NZU A;  3ZXV A;  2INP E;  3VRA B;  2KWD A;  5FKA C;  1WYW B;  1L4Z B;  1QQR A;  4FN2 A;  3RNF C;  3W5V B;  4ICV A;  3RD2 A;  3IAS 1;  1E7U A;  1D5Z C;  2WXN A;  3UGB B;  4YWG G;  3LB8 C;  3TUO A;  3VXW A;  3ZNH B;  2WDV B;  3EGR A;  3SEB A;  4I6P A;  2ZCC A;  2L7R A;  1WMH A;  2K9X A;  1N63 A;  3AE5 B;  1SB3 C;  5BMI A;  4FHK A;  2A4Z A;  1KLU D;  1MPE A;  3I63 C;  4N58 A;  3WAM A;  3URY A;  1A5R A;  2WDR B;  2KK8 A;  4FBJ B;  4LTU A;  3X23 A;  5BO4 B;  1QOG A;  4EEW A;  1TS4 A;  1KLV A;  4MEM A;  1KLG D;  1NEK B;  1FD6 A;  4DHJ B;  3ZJU A;  3IHP C;  1WH3 A;  2K8C A;  3BWU D;  4WWP A;  4W9L A;  2Z8L A;  1YD8 U;  3JYU A;  2FNJ B;  2G4S A;  1AN8 A;  3L0W B;  2DWQ A;  2NR2 A;  4ASW C;  4F1S A;  1HXY D;  2PE6 B;  1WX9 A;  2WLB A;  2N9X A;  1YN3 A;  2WXG A;  2JZP A;  4PK1 A;  4PT5 A;  3IAM 1;  5LNK 1;  4HKZ E;  3VUW A;  3TEY A;  1OQY A;  1C4A A;  2WWZ A;  3NS1 A;  5IA7 A;  2NPT A;  2KT7 A;  2CHW A;  4K3C A;  4ZYN A;  4J3O D;  2JXX A;  3NHE B;  1N61 A;  3VR9 B;  2D3G A;  5E6O A;  2AQ1 B;  3QJZ A;  2DZI A;  1U4A A;  4FXC A;  4XWT A;  1FCL A;  1NEN B;  2LAS A;  3EC8 A;  1TKG A;  3AI5 A;  2KO3 A;  4KDL B;  1PGA A;  2Q5W D;  4C7Z A;  1WXM A;  1QKZ A;  3CWI A;  3KVF B;  2IYD B;  1UZX B;  1F1H A;  2KHW B;  1F77 A;  3ONS A;  3VUX A;  4HXD A;  1E8X A;  4BBN F;  2KX0 A;  4X57 B;  4RM8 A;  5DPW A;  1QT9 A;  4HEA 1;  1UWX A;  1E5W A;  4G0N B;  5FR6 A;  3K9P B;  3QQ8 B;  2JZZ A;  2N7E A;  3RZW C;  3BK1 A;  4PYZ A;  5GXG B;  4MDK E;  3DOW A;  4JWS C;  1KH0 A;  2QIE B;  3VH3 B;  4JIO U;  1OQQ A;  1WJU A;  4P6V F;  3V05 A;  2KAJ A;  4EOY A;  2QMT A;  2IO2 B;  4L2Y A;  3H7P B;  4J6I A;  2JT4 B;  3C19 A;  1I35 A;  3APD A;  3IBE A;  2GBJ A;  3K9O B;  4MM3 A;  2G1E A;  2PPH A;  3V3X A;  3PVL A;  4ZHO A;  1JWM D;  3QA8 A;  1AWD A;  1YJI A;  2Z0E B;  1WM2 A;  2JQR B;  2DYB A;  4BVU C;  2ZNV C;  3L08 A;  4RF1 A;  1WIA A;  2X8X X;  1YN4 A;  2BYV E;  3PRZ A;  4LCD E;  5HFY A;  2J0J A;  3X0W A;  3LXF A;  3O65 B;  1FXI A;  5EE0 A;  1TGZ B;  3DBH I;  3AMZ A;  2HE7 A;  2M17 A;  2K22 A;  1UBQ A;  4HDO A;  3TEW A;  2JXT A;  2MX2 A;  2G4D B;  3APC A;  3L10 B;  1FIQ A;  3PZD A;  2K8B A;  3OWE B;  4MT5 A;  3ECI A;  1TYG B;  2L76 A;  2O2V A;  2WQY B;  3WAL A;  1IGC A;  1VCB A;  1SE3 A;  3ZYY X;  3RNC C;  1NI2 A;  3ZKJ C;  4MJS A;  3Q2A C;  1FM0 D;  2WXF A;  2R2O A;  1XEE A;  2QC8 A;  4K81 A;  1GC7 A;  3EEC A;  1D5M C;  1V5T A;  2BKF A;  5IP4 D;  1EWY C;  1HTQ A;  2FUG 1;  2C5L C;  2KLG A;  2IY1 B;  3C0R B;  2AL3 A;  3ZXR A;  1BT0 A;  4AWJ A;  4GDL B;  4IWP A;  2KC2 A;  2KJR A;  1UUP A;  1YMH E;  4AQ7 A;  4ZYS A;  2AL6 A;  4DWF A;  2MBO A;  1WXQ A;  3AE1 B;  1L5P A;  2XK5 B;  2JRI B;  2CJO A;  1YIW A;  3TJP A;  2Z0D B;  1HE8 A;  4LNI A;  2D3B A;  3IFW B;  5FK9 C;  3AE7 B;  4K3B A;  2K39 A;  1I4P A;  2RPQ A;  5CHF A;  4KZ0 A;  3VQI A;  3B9J A;  4HDQ A;  4TQ1 A;  1MVK A;  2WXM A;  2ZPN A;  3DVN U;  2JYE A;  4EE2 A;  1I7H A;  2L0T A;  2V4I B;  2WHI A;  1TY2 A;  2KMM A;  2CU1 A;  3E9S A;  1L0X B;  3PLV A;  1YNT E;  3BY4 B;  1FMA D;  1WGK A;  5IO9 A;  4RM9 A;  3PRE A;  1IPG A;  1XLO A;  3M3J A;  1D5X C;  2DX5 B;  4KSL C;  2BW2 A;  2DBY A;  3JSV B;  4NJC A;  1VDV A;  3OAW A;  4HRO A;  2L3Z A;  2KQ4 X;  3QC8 B;  3V6E B;  1WGR A;  1WJN A;  4MGI E;  2ON8 A;  4KGT A;  3VUY A;  2EEL A;  1MFW A;  1C78 A;  1R4N I;  1JRP A;  4RMA A;  2V3P A;  4ITK A;  2B3A A;  3AEA B;  4LJO B;  2JWU A;  5HHD G;  5G5H A;  1L6V A;  1SJH D;  4W9G A;  1I42 A;  2BGF A;  5CX3 A;  3EHV A;  2CHZ A;  2QSD A;  2N1W A;  2RDH A;  1PGX A;  4GMV A;  2LI5 A;  3P4R B;  3PRP B;  3D32 A;  4IM0 A;  1MJD A;  3B0A A;  1T6B X;  2V4L A;  2KVR A;  2V0G A;  2ZCB A;  4KSK C;  2I1J A;  2J42 A;  4JX1 C;  2PW9 A;  4QAY A;  5G55 A;  2GRI A;  2GBN A;  2EMS A;  3PV1 A;  3NZ3 A;  3RZF A;  2RPV A;  2MCN B;  1XLQ A;  3KYD D;  2KQ7 A;  3KLS X;  2WYQ A;  2HTM E;  4A90 A;  1V97 A;  5AEK B;  2WGS A;  1ISN A;  4FJZ A;  3H7S A;  1I4H A;  2AYO B;  2WDT B;  1RLF A;  1LFD A;  1TZO A;  2IPK D;  4WWO A;  2PIA A;  1M94 A;  4I6N B;  4O1N A;  2L8J A;  3JVZ X;  1JQ4 A;  3LJ3 A;  2WU2 B;  3R3M A;  3Q8B A;  2DZJ A;  2DAF A;  1V1P A;  3RI7 C;  2WXK A;  2AQ2 B;  4XE0 A;  2CS4 A;  3ZDM C;  2PTL A;  5AUK A;  3PS6 A;  4DHZ B;  3WAN A;  3DBL I;  2N0S B;  1S1Q B;  1E8W A;  2J0K A;  2KZR A;  1XLP A;  4REZ A;  3P4P B;  4D2K A;  3U7Z A;  4WJO A;  1GB4 A;  4B9K A;  1P1A A;  1LO5 D;  2IGD A;  3R8B A;  3W5U B;  1T3Q A;  3CST A;  3N1Y C;  1UWM A;  1XCQ L;  4C80 A;  4BBN C;  3A9K B;  4W9D A;  1WXS A;  1K53 A;  2KMA A;  4IWQ A;  3RYT A;  3AM9 A;  1F9J A;  1C77 A;  3VHT C;  3QIJ A;  4W9I A;  2W55 A;  4LDT D;  1YOV B;  5AUI A;  2M8S A;  4YSZ B;  5DPR A;  3B2G A;  4BOS C;  4MH8 A;  2M1M A;  3FKY A;  2JF5 A;  2J0M A;  2W3R A;  2X38 A;  2GBR A;  2E6X A;  4AJY B;  1V1O A;  1I4X A;  1WE6 A;  2R2Q A;  2QEJ C;  4BKT A;  2MA9 B;  3PGE A;  2CU3 A;  3CMM B;  4US8 A;  1ENF A;  1WGY A;  3EA6 A;  4JLC A;  1ZXH A;  3UQB A;  4KV2 A;  3N32 A;  1E10 A;  4JGH B;  4XWW A;  2PEA A;  1N60 A;  4GLS C;  4KIK B;  5D3D A;  3N3K B;  3Q3O C;  3GZN I;  2LJ5 A;  2ZJD A;  4XZ4 A;  1QOF A;  2E3T A;  3IG3 A;  3T3N A;  4URK A;  4USA A;  4GXB A;  1KM7 A;  1EWC A;  4WWM A;  2NTS A;  4ZRP A;  1FRR A;  4NNJ B;  4W9J A;  1LQB A;  3NUH B;  5DPS A;  3ZTD A;  4BKS D;  1GB1 A;  1FPY A;  3A9J A;  1D6E C;  2BT6 A;  2KDM A;  3P1M A;  2ZNV B;  4W9E A;  3OJ4 B;  4EUT A;  1T0Y A;  4ZHP A;  3VTV A;  2RDG A;  3A1Q A;  4MSM B;  4WJP A;  4EZK A;  1G6J A;  2ACZ B;  3ZNI D;  1YX5 B;  1OFF A;  4IC7 B;  2AEH A;  3RUI B;  4RH6 A;  3P63 A;  2FCM A;  5MPO A;  3ZRC A;  3AE9 B;  4GOC A;  2KDF B;  2K6D B;  3OLM D;  3W1S C;  3O13 A;  1FNW A;  3RPF C;  1RAX A;  5TR5 A;  4W9C A;  1Z5S B;  2WXL A;  2UYZ B;  1PFD A;  4FJY A;  4FAD A;  2LWP A;  5JH5 C;  5T8I A;  4ANU A;  3AED B;  1T5X D;  3HVZ A;  2JWZ A;  5JHB A;  2V3S A;  3VTU A;  2RR9 A;  4F7Z A;  1DOY A;  1N6Z A;  2MJ3 A;  2K25 A;  1WY8 A;  4I6L B;  4NY0 A;  2D07 B;  2LGX A;  1V49 A;  1E90 A;  3VDZ A;  1V2Y A;  5C3J B;  1QF6 A;  1E6E B;  2UWQ A;  5BMG A;  4HCP B;  1K52 A;  2L00 B;  2NTT A;  3ML8 A;  1Q10 A;  3ZVV A;  4B0M A;  4OW0 A;  5HKH A;  1OEY J;  2RSU A;  2MJE A;  2W9N A;  3BII D;  1XQQ A;  5EE1 A;  3AE8 B;  1E8Y A;  5KHQ A;  1TJE A;  1JWA D;  1J8C A;  4YTM B;  5FR3 A;  3Q8A A;  2HDE A;  1XF5 L;  5H8Y E;  1ZE3 D;  1HTO A;  1E0Z A;  4HPP A;  3AE3 B;  1WMH B;  2C7N B;  4EFO A;  4KKJ A;  1BUI C;  2LVQ A;  3KUC B;  1JW9 D;  3ZJV A;  3U7D A;  1JRO A;  1FXA A;  1SBB B;  1N5W A;  2GB1 A;  4G50 A;  2LGS A;  3H6N A;  3ZRF A;  4ZRI A;  1C76 A;  2NS5 A;  2NBV B;  3PSE B;  5IOI A;  3MC9 A;  1WYG A;  3I5J C;  4KKI A;  4ZOH C;  1VLB A;  3BK2 A;  1CK1 A;  2JUO A;  3PHX B;  4XX5 A;  5EE3 A;  2PVO D;  4C4V A;  1FXT B;  1UBI A;  2A5U A;  2JZ3 B;  2KOX A;  1P9D U;  1DOX A;  4TUU A;  2R61 A;  1F52 A;  2W54 A;  3ZUN A;  4E71 A;  5J2R A;  3UIO B;  1X1M A;  4LNN A;  4RGM A;  4JQW C;  1BXT A;  5D6J B;  4C56 C;  1GUA B;  4XDC A;  3BZD B;  3DWM A;  1F0Z A;  1WSP A;  4HJG E;  3V62 A;  5E6N A;  2GMI C;  2D5G A;  1ROE A;  4JPS A;  2WXH A;  1UF0 A;  2GBM A;  3M63 B;  2NPT B;  2ASQ A;  1B9R A;  1C9F A;  4YSY B;  4C7Y A;  3UF8 A;  3N9Y C;  4TKN A;  3R7Q A;  4A55 A;  1EM7 A;  3L13 A;  1HZ6 A;  4NQL B;  4MH0 E;  1WX8 A;  4MGZ E;  4RNA A;  4GN1 A;  4W9H A;  1R7S A;  1OGW A;  1ZGU B;  2NVU I;  2RGF A;  3MJ5 A;  4WJN A;  2AQ3 B;  5J18 A;  2DHZ A;  3GE8 C;  1YJJ A;  3TEX A;  2HTH A;  3ZDT A;  1E9M A;  3FIL A;  3DHI C;  2V1Y A;  3NY5 A;  3EFU A;  1JAL A;  3QWZ B;  2BBC A;  4KX6 B;  1FRD A;  1SEB D;  1IYF A;  4NJ7 A;  4YL8 A;  2KFK A;  3HK0 A;  2BYT A;  2MH7 A;  4YT0 B;  4ZRJ A;  2L52 A;  2ZVN A;  1EU4 A;  3AEB B;  3L17 A;  4ICU A;  2JYT A;  4GDK A;  4RGT A;  4MM3 B;  1V5O A;  2KDI A;  1SGH A;  2BTE A;  1XD3 B;  4HVB A;  3U52 E;  3CF6 E;  4WJQ A;  4MGK E;  4HWI B;  2VZK D;  2WNM A;  3L4P A;  4XC2 A;  2D11 A;  1B1Z A;  3UQA A;  4DK5 A;  3VAW A;  2KTF A;  3B1L X;  3TIX A;  1I4G A;  2GBK A;  1WR1 A;  2VH1 A;  1SXT A;  1MG4 A;  1WWT A;  4ZRQ A;  3V60 A;  4BKS A;  2ZW1 A;  4H2A A;  4RGO S;  1YN5 A;  3DBS A;  2ZZP B;  2O6V A;  4OVZ A;  5HI1 A;  3PTF C;  2K8H A;  3I9V 1;  4A6Q A;  1IBX A;  2I1K A;  1CZP A;  4EZL A;  1Z2M A;  2KNB A;  4KVG B;  1Y8R C;  4W9K A;  1V9J A;  2N9E B;  4LDT B;  4M0W A;  2OOB B;  1NDD A;  4WAF A;  1DGJ A;  2NMQ A;  2PVG C;  3KYC D;  3SDL C;  2O2V B;  4BFR A;  2YVC A;  2JRH A;  3DWG C;  3HUI A;  1I4R A;  2MLB A;  2KJ6 A;  2JX5 A;  2KWV B;  4MJS B;  4CHK A;  2CR5 A;  2KQS A;  2JPH A;  2WU5 B;  4II3 B;  3R7R A;  4P7I A;  1YQ4 B;  1DYQ A;  1C4P A;  3KQ4 A;  4LNF A;  1S3S G;  3Q8C A;  1HQR D;  1TBE A;  1J19 A;  1H4R A;  2BVC A;  2OJR A;  4W9F A;  4N59 A;  2REX A;  1RM6 C;  3AN1 A;  3Q3M C;  4A9A A;  2M4N A;  2KAN A;  3N1Z C;  1TY0 A;  2UU7 A;  2XEW A;  1KTK A;  5C23 A;  3Q3J A;  1R4M I;  2IO3 B;  3NVW A;  1CMX B;  1K8R B;  1M4V A;  2FIF A;  3KH0 A;  2QHO A;  5L95 C;  1YX6 B;  1JRU A;  3BVM A;  1SE2 A;  4PYU A;  1SJE D;  3IVF A;  4ANV A;  3RNG C;  1C4C A;  3AB5 A;  2HJ1 A;  4US9 A;  1L4D B;  2EKI A;  4HRS A;  3DQV A;  3PHW B;  3IT4 B;  2BYE A;  4CYE A;  2FAZ A;  3DBH B;  5BMH A;  2K6Q A;  3CIR B;  2Y3A A;  3R66 C;  1QLB B;  1V81 A;  2L0F A;  3BYY B;  2BKR B;  1EF1 A;  1LGR A;  1WJ4 A;  2BPS A;  4K7U A;  1EUV B;  3GP7 A;  2DYM A;  4NJ6 A;  3AEG B;  2AX5 A;  2V3N A;  2YEP F;  2NCN A;  2LGY A;  1ZKH A;  3AV8 A;  5E6P A;  4JL9 A;  1QIL A;  5EE9 A;  2GI9 A;  5D3I B;  4DXG A;  2D10 A;  1V86 A;  4AJW A;  3QHT A;  3ZIM A;  3UIN B;  2MP2 A;  3Q14 C;  1WGH A;  1TZ1 A;  2N9P C;  1P7E A;  5AZG A;  4P16 A;  3H1U A;  1YJ1 A;  3QK0 A;  5LXI B;  3RUL A;  4IUM B;  3WAO A;  4NAW A;  2IGH A;  4GSW A;  2J4X A;  3GB1 A;  3N20 C;  2KC1 A;  4HJK A;  2QIL A;  3N30 A;  2GOW A;  2KTR A;  1QOA A;  1L0V B;  1J0G A;  4IWO A;  5G5G A;  3ZLZ A;  2LHD A;  2KWC A;  1L6U A;  1FCC C;  4LLG M;  4MSQ B;  3OJ3 A;  3UI3 A;  3DPD A;  2LXC A;  1ACC A;  3TSS A;  1AW7 A;  1GAQ B;  4XYC A;  3WCQ A;  3ML9 A;  3EFC A;  4RF0 A;  2OHF A;  2IY0 B;  4B6W A;  3FC4 A;  2LXA A;  1ZW7 A;  1SE4 A;  1JCK B;  3DHG C;  3VVW B;  2WX1 A;  4S0R A;  5BYS A;  4F8C B;  4YXD B;  1RYJ A;  2KN5 A;  3B2F A;  4UDU C;  1P0R A;  1C79 A;  3P42 A;  3R2I A;  2RMM A;  2FUH B;  5G2N A;  3VR8 B;  4K7W A;  1TIF A;  4FHJ A;  1PYW D;  4IDI A;  4IG7 B;  2W82 A;  4ANX A;  1WGD A;  1ZOY B;  4HK2 A;  1XT9 B;  1R4M B;  2CHX A;  4OZA A;  1R4N B;  1FNU A;  3QX1 A;  3BVG A;  4WH4 A;  2WP9 B;  4WQM A;  3PT2 B;  4YTP B;  3L16 A;  3MC8 A;  2J52 A;  3DBR I;  5C1Z A;  1JWS D;  3TBL D;  3AEC B;  4K1R B;  4BOZ B;  3I57 A;  2QJL A;  1XLN A;  4DDI D;  4HLE A;  1BML C;  1DOI A;  2KFJ A;  5C2T B;  4OVV A;  4K7S A;  2KDB A;  3DVG Y;  3P4S B;  2O6V D;  3KW5 B;  4ARC A;  2MW5 A;  4FLH A;  1JWU D;  1WXV A;  2LGI A;  2INC C;  1L2N A;  2MSE D;  3PZ8 A;  1J7B A;  3C8Y A;  1GPX A;  3HM6 X;  3A4S C;  2DYO A;  2XN9 C;  4KZC A;  4M01 A;  1SIF A;  4A3P A;  1UGJ A;  2BWF A;  2IZV B;  1D3Z A;  3QAQ A;  4L1B A;  1MG8 A;  1TS2 A;  3T3O A;  1L0Y B;  1H8C A;  1ESF A;  1T0S C;  1VZ8 A;  4M8N A;  3SFD B;  4CO7 A;  2FCQ A;  1TS3 A;  3I3T B;  2DLB A;  3A4R A;  2C7H A;  2WXR A;  4WQO B;  2G45 B;  3Q3F A;  3RNA C;  4RCO A;  1JML A;  3A33 B;  3KWV A;  1J7C A;  4IM2 A;  4OHJ A;  4BKG A;  4FA6 A;  1E7V A;  1VD2 A;  3DBL B;  3H9D A;  3ZTC A;  4NQK E;  3V61 A;  2H88 B;  4PS8 A;  3RMK C;  3U4E G;  2L05 A;  4IOI E;  2LHE A;  4AP4 C;  1FNV A;  1F2R I;  2LEK A;  1SF0 A;  4JWU C;  2G9H D;  2MEK A;  2RD0 A;  5IN7 A;  2GLS A;  1HZ5 A;  4PS3 A;  3Q69 A;  1NYR A;  3SFE B;  3ZGZ A;  4N6E B;  4P1B C;  2PKO A;  2I2Y A;  1RFK A;  2VZK B;  4HPM B;  3A9J B;  4B95 A;  1FO4 A;  2PE9 A;  1I4Q A;  1C3T A;  3ALB A;  4MGY E;  1IGD A;  3A1Q B;  1IP9 A;  2BQQ A;  3PLU A;  2FCN A;  4M8M A;  3T8M A;  3H7P A;  3NVV A;  2ZW0 A;  3MHZ A;  3RN9 C;  1N62 A;  4IW0 A;  4M00 A;  2KD0 A;  3VRB B;  2MQJ A;  4B0E A;  1Q1O A;  4EZJ A;  2NBW B;  2J7Q B;  2DEN B;  3KUD B;  4E74 A;  2AWT A;  2BF8 B;  2Y5C A;  3SU8 X;  3RFZ B;  2XNA C;  3U8Z A;  2KDE B;  1TT5 B;  3BIN A;  4AS1 A;  1SIJ A;  1QOB A;  3BYT B;  4DBG A;  2LRU A;  2FID A;  2QDF A;  3WAP A;  3Q8E A;  3GZN B;  3TEZ A;  4DDG D;  3DBR B;  3AE4 B;  3WIM A;  3DCG A;  3Q3N C;  4DQO C;  4Q2J A;  1ZPS A;  2C9W B;  4ARI A;  2WXI A;  1T0R C;  2G3Q B;  4JE3 B;  2ONQ A;  2ICI A;  1XXG A;  3NG0 A;  5IAA C;  2DZM A;  1ZXI A;  3KUZ A;  4WIP A;  4TV3 A;  2MBE A;  1NVI D;  5D2M B;  3T9L A;  1WFY A;  3AU4 A;  3IT6 B;  5H92 C;  2D3A A;  4M02 A;  2MBB B;  1UEL A;  3TL5 A;  2Y5B B;  4R3D A;  3LDZ E;  1KFY B;  4GDL A;  1E7P B;  3PO0 A;  2J53 A;  2JSV X;  3ZJT A;  2LD9 A;  3APF A;  2IJ0 A;  1PQS A;  4L23 A;  2IO1 B;  4KGR A;  1MI0 A;  3HVD A;  3Q6B A;  2L32 A;  2N9L A;  4GGQ A;  1NBF C;  2XK5 A;  1RFA A;  3B08 A;  3IXS A;  2BYF A;  1RWS A;  2DNF A;  4FUL A;  5E6J A;  4LK0 M;  1GJZ A;  1EO6 A;  1AYF A;  3H8H A;  1TS5 A;  3KWL A;  4C4V B;  2Z59 B;  3GOE A;  2Y5P A;  3ZO5 B;  1WZ0 A;  3NS8 A;  2I38 A;  3GS2 A;  4YSX B;  1KRH A;  1FEH A;  2HJ8 A;  4XGA B;  3OG5 A;  4E3C A;  1VRA B;  2L83 A;  1KOT A;  3NVY A;  1E8Z A;  1GC6 A;  2M0X A;  1AAR A;  2MWS B;  4G11 A;  1NI3 A;  3SHQ A;  4LNO A;  2QCZ A;  2WXO A;  4N9F 4;  3PZ7 A;  4DHJ D;  2K3U A;  2H89 B;  3HM3 A;  2IBI B;  1MHH E;  2ZEQ A;  2D3C A;  1WR6 E;  3ZW3 A;  2TSS A;  3JSV A;  1N5X A;  2MHJ A;  1WM3 A;  5TSS A;  2K5P A;  2LZ6 A;  2BB6 A;  3P2B A;  3W9C B;  3N1X C;  4TMA B;  5I4D A;  2M0A A;  2LUM A;  1SE9 A;  3U30 A;  1KJT A;  1LM8 B;  2EKE C;  5BYQ A;  3W2D A;  1TTN A;  2WXQ A;  3AUL A;  2WXJ A;  1K51 A;  1K50 A;  4IKG A;  2BS2 B;  2LUE A;  2CKH B;  2DZK A;  3E56 A;  5EDS A;  3FIL B;  1WE7 A;  3M95 A;  1MHX A;  3QCA A;  3U2S C;  2JY6 A;  3M62 B;  1CJE A;  2IO0 B;  1P7F A;  3QAR A;  2N7J A;  2IGG A;  3CSF A;  2KFK B;  4OZB A;  1ET9 A;  3NVZ A;  4GB9 A;  4RFB A;  3VH4 B;  1VZ6 A;  1UGM A;  3RNB C;  2SAK A;  3MTN B;  1QZE A;  4P1C C;  1WI0 A;  2KMC A;  1VR9 A;  1ET6 A;  1P98 A;  3LYY A;  2SEB D;  3W1S A;  4BAX A;  3AH7 A;  3VTW A;  4GDK B;  1P3Q U;  3ZNZ B;  5L83 A;  2ZPY A;  3P4Q B;  5CHV C;  1FFV A;  5IKC M;  3ETR A;  3NOB A;  2DAJ A;  3DHH C;  3JW0 X;  5J17 A;  3AXC A;  1HA5 A;  1YQB A;  3UIP B;  5JZE B;  3SR6 A;  1L7Y A;  3L54 A;  4RGN A;  1GNU A;  1ZDV A;  3EUB 2;  4TQ0 A;  3ABV B;  2KX3 A;  2NBU A;  1WJ6 A;  5LLI A;  1GG3 A;  2N4F A;  2KAC A;  3J9C A;  1STE A;  2KN4 A;  2O6V B;  3W1Y A;  4ZRK A;  1CQV A;  4TSS A;  1LXD A;  3ZNG C;  2WDQ B;  4NZL B;  3BVZ A;  2WS3 B;  1IBX B;  3MP9 A;  3WA0 A;  4FJV B;  3VFK A;  3ZQ4 A;  1WF9 A;  2N7D A;  2FBW B;  5D94 A;  1Y56 A;  1YQ3 B;  3DVG X;  4M0W B;  5D7G A;  1TKE A;  2K1F A;  4YTN B;  4AOF A;  4BZA A;  2MBQ A;  4GIV A;  3NZS A;  5JXV A;  2KLC A;  4KGS A;  4A20 A;  4EKU A;  2KWU B;  5HG2 A;  4DXA B;  4PS7 A;  5AZH A;  2LMC A;  2KKC A;  4C00 A;  4NAM A;  3AEE B;  2RDB C;  3A9K A;  1EF5 A;  2EMT A;  3ENE A;  2PLP A;  3MC0 B;  3AE6 B;  1XO3 A;  3GE3 C;  2LRW A;  4WAA A;  2WX0 A;  2V9H A;  1F2R C;  2BS3 B;  2C7M B;  4HPL B;  2FCS A;  1OTR B;  2M56 B;  2HD5 B;  5GMV A;  3HHM A;  1A70 A;  1WX7 A;  2LJI A;  2INN E;  4G3X B;  1Q5W B;  3AEF B;  2BB5 A;  2WXP A;  1OQR A;  2BS4 B;  4A8X C;  1UD7 A;  4GU2 A;  2D2Q A;  5AZF A;  4ZDV A;  1V80 A;  3V6C B;  2ZVO A;  1WRD B;  3Q8F A;  5LXH A;  2KJH B;  2PMV A;  2K0P A;  3RNE C;  4OVU A;  2VRR B;  1XCT L;  4KIK A;  4HKQ A;  4ACF A;  2OED A;  4DXF A;  2MRP A;  1IUE A;  1WXA A;  2N9K A;  2LVO A;  3DDC B;  1UH6 A;  5DCN A;  2C60 A;  3HIZ A;  3RT3 B;  1VZ7 A;  1GOZ A;  4IM3 A;  2LGD A;  4MAC A;  1ZP0 B; 
#chains in the Genus database with same CATH homology
 2LEK A;  1FMA D;  3FAH A;  4A55 A;  1EM7 A;  1WGK A;  1HZ6 A;  4JWU C;  2G9H D;  2MEK A;  3HRD D;  1SSN A;  1HZ5 A;  1XLO A;  4RNA A;  1D4B A;  3Q69 A;  1D5X C;  1R7S A;  4NJC A;  2BW2 A;  2DBY A;  1JWB D;  1NYR A;  1VDV A;  1NYQ A;  3SFE B;  3ZGZ A;  4N6E B;  4HRO A;  2L1A A;  3MJ5 A;  2PKO A;  2KQ4 X;  2AQ3 B;  3TEX A;  1YJJ A;  2I2Y A;  1RFK A;  1ZUD 2;  2VZK B;  4WUR A;  2ON8 A;  4KGT A;  1FO4 A;  2EEL A;  1C78 A;  1E9M A;  1I4Q A;  1V8C A;  1FFU A;  3FIL A;  1JRP A;  1V1P B;  2V3P A;  4ITK A;  1HEZ E;  3AEA B;  4OZC A;  4IOI E;  1JAL A;  2B76 B;  1IGD A;  2BBC A;  1UNS A;  2JWU A;  4KX6 B;  1TKY A;  5BYR A;  1FRD A;  1SEB D;  2CJN A;  5HHD G;  5G5H A;  2MJD A;  3AE2 B;  4NAW B;  1L6V A;  1SJH D;  2W3S A;  4XDD A;  3NVV A;  2BYT A;  2QSD A;  2ZW0 A;  3MHZ A;  1N62 A;  2MH7 A;  4YT0 B;  2RDH A;  1PGX A;  1EU3 A;  2M19 A;  3P4R B;  1T6B X;  1ZP0 B;  2L52 A;  1PGB A;  1J7A A;  3VRB B;  2V0G A;  2FE8 A;  2YEP B;  4B0E A;  1EU4 A;  3AEB B;  1PDX A;  2JYT A;  3R2T A;  2J42 A;  4JX1 C;  4RGT A;  2PW9 A;  2IDY A;  4MM3 B;  2JU6 X;  2BTE A;  2GRI A;  1ZDX A;  2LFI A;  3U52 E;  2VZK D;  3NRZ A;  2WNM A;  2Y5C A;  3L4P A;  3NZ3 A;  3MFG A;  2RPV A;  1KF6 B;  1B1Z A;  1PUT A;  3RFZ B;  2XNA C;  1XLQ A;  3KLS X;  4CQN A;  2HTM E;  4A90 A;  1VJK A;  4AS1 A;  1SIJ A;  1WRI A;  1V97 A;  1QOB A;  3BYT B;  2INP E;  3VRA B;  1I4G A;  2KWD A;  5FKA C;  1I4H A;  1L4Z B;  1SXT A;  1QQR A;  3Q8E A;  1WWT A;  3TEZ A;  4ZRQ A;  3AE4 B;  1TZO A;  2IPK D;  2ZW1 A;  3W5V B;  2PIA A;  4O1N A;  4H2A A;  4RGO S;  1YN5 A;  1JQ4 A;  4DQO C;  4OVZ A;  3IAS 1;  2WU2 B;  4Q2J A;  1ZPS A;  5HI1 A;  3Q8B A;  1D5Z C;  2WXN A;  1V1P A;  3I9V 1;  4A6Q A;  2WXK A;  4ARI A;  2WXI A;  2AQ2 B;  4YWG G;  4XE0 A;  3LB8 C;  1IBX A;  4JE3 B;  1CZP A;  3TUO A;  2WDV B;  3EGR A;  2ONQ A;  2PTL A;  5AUK A;  3SEB A;  2ICI A;  1XXG A;  2N0S B;  4M0W A;  4WAF A;  1ZXI A;  1DGJ A;  2NMQ A;  2PVG C;  4WIP A;  4REZ A;  1XLP A;  3P4P B;  2K9X A;  4D2K A;  1NVI D;  3U7Z A;  1GB4 A;  1N63 A;  3DWG C;  3AE5 B;  3HUI A;  1I4R A;  3IT6 B;  1LO5 D;  5H92 C;  1SB3 C;  5BMI A;  2IGD A;  2JX5 A;  3R8B A;  1KLU D;  3W5U B;  1T3Q A;  1MPE A;  4R3D A;  2WU5 B;  1KFY B;  4N58 A;  1E7P B;  1UWM A;  3PO0 A;  1XCQ L;  2J53 A;  2JSV X;  3ZJT A;  1YQ4 B;  1DYQ A;  3URY A;  4C80 A;  2IJ0 A;  4L23 A;  1C4P A;  3KQ4 A;  2WDR B;  4KGR A;  1MI0 A;  3Q8C A;  1HQR D;  4LTU A;  3HVD A;  1K53 A;  2L32 A;  2N9L A;  1QOG A;  1TS4 A;  4N59 A;  1KLG D;  1NEK B;  1FD6 A;  3AM9 A;  1RM6 C;  3AN1 A;  4A9A A;  1C77 A;  3IXS A;  1RWS A;  1TY0 A;  2W55 A;  3ZJU A;  1KTK A;  5E6J A;  5AUI A;  3NVW A;  4LK0 M;  1M4V A;  4YSZ B;  1AYF A;  3H8H A;  3BWU D;  1TS5 A;  3KWL A;  2Z8L A;  3B2G A;  2Y5P A;  3BVM A;  4MH8 A;  1SE2 A;  1AN8 A;  1SJE D;  2W3R A;  2DWQ A;  2I38 A;  2X38 A;  1C4C A;  3GS2 A;  4YSX B;  2E6X A;  3AB5 A;  1KRH A;  1FEH A;  4US9 A;  1L4D B;  2EKI A;  4HRS A;  1V1O A;  1HXY D;  2WLB A;  1VRA B;  3IT4 B;  2L83 A;  1YN3 A;  1I4X A;  3NVY A;  2QEJ C;  2WXG A;  2JZP A;  4PT5 A;  3IAM 1;  2CU3 A;  5BMH A;  5LNK 1;  3CIR B;  4HKZ E;  4US8 A;  3TEY A;  2Y3A A;  1QLB B;  1ENF A;  1NI3 A;  3EA6 A;  1C4A A;  3NS1 A;  3BYY B;  1ZXH A;  1E10 A;  2WXO A;  4XWW A;  4J3O D;  3GP7 A;  1N60 A;  3PZ7 A;  1N61 A;  3VR9 B;  4GLS C;  2K3U A;  2DYM A;  3AEG B;  2H89 B;  5D3D A;  2AX5 A;  2V3N A;  2YEP F;  2AQ1 B;  1QOF A;  1MHH E;  2E3T A;  3AV8 A;  3T3N A;  4USA A;  1QIL A;  1EWC A;  4FXC A;  4XWT A;  2TSS A;  4WWM A;  1FCL A;  2NTS A;  4ZRP A;  1NEN B;  1N5X A;  5EE9 A;  1FRR A;  2GI9 A;  5TSS A;  5D3I B;  1TKG A;  2K5P A;  2BB6 A;  4DXG A;  3NUH B;  3W9C B;  1PGA A;  2Q5W D;  4TMA B;  4C7Z A;  5I4D A;  2M0A A;  1GB1 A;  1QKZ A;  3CWI A;  2LUM A;  1P7E A;  4P16 A;  5BYQ A;  1D6E C;  2BT6 A;  2KDM A;  1F77 A;  3W2D A;  3P1M A;  2WXQ A;  4ZHP A;  2WXJ A;  1QT9 A;  4HEA 1;  1UWX A;  2RDG A;  1K51 A;  1K50 A;  4IKG A;  2IGH A;  2BS2 B;  2J4X A;  3E56 A;  3FIL B;  1MHX A;  3GB1 A;  3U2S C;  3BK1 A;  5GXG B;  2ACZ B;  2QIL A;  1CJE A;  1OFF A;  1P7F A;  4JWS C;  1KH0 A;  1QOA A;  2QIE B;  1L0V B;  2N7J A;  2IGG A;  1OQQ A;  4RH6 A;  4P6V F;  2LHD A;  3P63 A;  5G5G A;  3V05 A;  1L6U A;  5MPO A;  4OZB A;  1FCC C;  2KAJ A;  1ET9 A;  3AE9 B;  4LLG M;  2QMT A;  3NVZ A;  4L2Y A;  3O13 A;  4RFB A;  1FNW A;  3RPF C;  1VZ6 A;  2SAK A;  2G1E A;  3UI3 A;  1VR9 A;  1ET6 A;  2WXL A;  3V3X A;  3LYY A;  2SEB D;  1PFD A;  4ZHO A;  1ACC A;  1JWM D;  3W1S A;  3TSS A;  3AH7 A;  4GDK B;  5T8I A;  1AWD A;  1AW7 A;  1YJI A;  3AED B;  3P4Q B;  1T5X D;  3HVZ A;  1GAQ B;  1FFV A;  2JQR B;  3WCQ A;  3ETR A;  4RF1 A;  1DOY A;  2MJ3 A;  4RF0 A;  1HA5 A;  1YN4 A;  2OHF A;  5C3J B;  1QF6 A;  1E6E B;  3SR6 A;  5BMG A;  4RGN A;  1K52 A;  5HFY A;  2NTT A;  1Q10 A;  3FC4 A;  1ZDV A;  4B0M A;  3LXF A;  1SE4 A;  1JCK B;  1FXI A;  4OW0 A;  5EE0 A;  3EUB 2;  4TQ0 A;  3ABV B;  5BYS A;  3AMZ A;  4YXD B;  1RYJ A;  3B2F A;  2MJE A;  3BII D;  4UDU C;  2KAC A;  3J9C A;  1C79 A;  2K22 A;  5EE1 A;  3P42 A;  3TEW A;  1STE A;  3AE8 B;  2RMM A;  2JXT A;  2KN4 A;  3R2I A;  3VR8 B;  4MAC A;  1TJE A;  1CQV A;  1FIQ A;  1JWA D;  4TSS A;  1PYW D;  4IDI A;  3OWE B;  4MT5 A;  2W82 A;  2WDQ B;  4NZL B;  1TYG B;  2WQY B;  4YTM B;  5FR3 A;  3BVZ A;  2WS3 B;  1IGC A;  1IBX B;  1SE3 A;  3ZYY X;  3Q8A A;  3MP9 A;  1ZOY B;  2HDE A;  3ZQ4 A;  1XF5 L;  2FBW B;  5H8Y E;  1Y56 A;  1YQ3 B;  1ZE3 D;  1E0Z A;  5D7G A;  1TKE A;  4OZA A;  1FM0 D;  1FNU A;  2WXF A;  4YTN B;  1XEE A;  3AE3 B;  3BVG A;  4WH4 A;  5JXV A;  2WP9 B;  4KGS A;  4KKJ A;  1BUI C;  4WQM A;  5HG2 A;  4YTP B;  1D5M C;  2LMC A;  2J52 A;  4NAM A;  1JW9 D;  1JWS D;  1EWY C;  3AEE B;  3ZJV A;  3AEC B;  2FUG 1;  1JRO A;  3I57 A;  1FXA A;  1SBB B;  1N5W A;  2QJL A;  1XLN A;  2PLP A;  3MC0 B;  2GB1 A;  3AE6 B;  4GDL B;  1BML C;  1XO3 A;  1C76 A;  1DOI A;  1F2R I;  5C2T B;  1UUP A;  1WYG A;  1F2R C;  1YMH E;  2BS3 B;  4KKI A;  3P4S B;  4ZOH C;  4AQ7 A;  1VLB A;  4ZYS A;  4ARC A;  3BK2 A;  1CK1 A;  1JWU D;  1WXQ A;  2LGI A;  3AE1 B;  1L5P A;  2M56 B;  5EE3 A;  3PZ8 A;  2CJO A;  2PVO D;  1J7B A;  1A70 A;  3C8Y A;  1GPX A;  2LJI A;  2DYO A;  2XN9 C;  2INN E;  1DOX A;  2R61 A;  5FK9 C;  3AEF B;  2BB5 A;  3AE7 B;  2WXP A;  1OQR A;  1UGJ A;  2BS4 B;  4A8X C;  2W54 A;  4L1B A;  1I4P A;  1TS2 A;  3VQI A;  3T3O A;  4RGM A;  3B9J A;  1L0Y B;  1ESF A;  1BXT A;  4TQ1 A;  1VZ8 A;  3SFD B;  4C56 C;  1TS3 A;  2DLB A;  1MVK A;  3Q8F A;  4XDC A;  3BZD B;  2WXR A;  2WXM A;  3DWM A;  2PMV A;  2K0P A;  1F0Z A;  1WSP A;  4RCO A;  1JML A;  1XCT L;  4HKQ A;  3KWV A;  1J7C A;  2OED A;  2JYE A;  4DXF A;  4OHJ A;  4EE2 A;  4HJG E;  1IUE A;  1I7H A;  2D5G A;  1ROE A;  4JPS A;  2WXH A;  2N9K A;  2V4I B;  1TY2 A;  2KMM A;  1B9R A;  2H88 B;  1C9F A;  3E9S A;  4YSY B;  4C7Y A;  1L0X B;  1YNT E;  1VZ7 A;  3U4E G;  1GOZ A;  2LHE A;  1FNV A;  3N9Y C;  1SF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...