1CZPA

Anabaena pcc7119 [2fe-2s] ferredoxin in the reduced and oxixized state at 1.17 a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN I
publication title Refined X-ray structures of the oxidized, at 1.3 A, and reduced, at 1.17 A, [2Fe-2S] ferredoxin from the cyanobacterium Anabaena PCC7119 show redox-linked conformational changes.
pubmed doi rcsb
total genus 25
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1czpA00
1RM6C 1ZOYB 1WYGA 2ACZB 2BT6A 2DWQA 1DGJA 2H88B 2MJ3A 2W54A 1KF6B 4HROA 1T3QA 3P4PB 4WWMA 1F0ZA 5EE1A 2K5PA 2Y5CA 1JWAD 1B9RA 2PIAA 1FFVA 5EE0A 4ZHPA 1J7AA 1CJEA 1QLBB 3FAHA 2W3SA 5G5HA 5C2TB 2PKOA 3AB5A 1N62A 1A70A 1YQ4B 1IUEA 4JX1C 1QOGA 3AECB 3ZYYX 4ITKA 2KMMA 1XLPA 1QF6A 1E7PB 1JWBD 2W55A 2K22A 3NRZA 4P6VF 1FO4A 1NVID 2H89B 4JWUC 3NVZA 3HUIA 1YQ3B 2MJDA 1GPXA 1TKGA 3AE4B 3LB8C 1L6UA 1YJJA 1L0VB 3EUB2 3P4SB 3AE8B 1ZXIA 2WQYB 4YXDB 1QOBA 4YSZB 2WDRB 3AEFB 4FXCA 1JRPA 4IDIA 3SR6A 1NYRA 3B9JA 4ZOHC 3W9CB 1E0ZA 1E6EB 2KAJA 2E3TA 4C80A 1FRRA 1TKYA 4WQMA 4YSXB 1N5XA 1QT9A 4US9A 1WWTA 1XLNA 2WU2B 5G5GA 2LEKA 2CJOA 2EKIA 3W5VB 2L83A 2PVOD 3AN1A 3AE6B 2WDQB 1EWYC 3NVYA 1RFKA 2WDVB 3NVVA 3AMZA 3HRDD 4YTPB 1UWMA 3P4QB 2JQRB 4A9AA 2JX5A 2CJNA 1WXQA 1I7HA 1FRDA 1FXAA 1L6VA 1N61A 1OQQA 1KRHA 1CZPA 1E9MA 2N0SB 3DWMA 3PO0A 1QOAA 2FBWB 1WRIA 3B2GA 1FXIA 3VRAB 3VR8B 3AE7B 5GXGB 1FFUA 3AE9B 3NS1A 3P1MA 1XLQA 3HVZA 4C7YA 1V97A 2MJEA 3P63A 1ZUD2 4HRSA 2BS2B 3AEGB 3AEAB 1E10A 3AE2B 3KWLA 5H92C 1R7SA 1TJEA 4YTNB 1YJIA 3VRBB 2OHFA 1AYFA 1RYJA 1VLBA 2WS3B 3CWIA 4YSYB 3AEBB 1TKEA 1JQ4A 5C3JB 1RWSA 1VJKA 3P4RB 1VDVA 4C7ZA 4YTMB 3AH7A 3AM9A 3SFEB 1N63A 1N60A 3ABVB 3L4PA 3NVWA 1FMAD 3LXFA 4LTUA 4ZHOA 1FIQA 1NENB 3FC4A 1TYGB 3AE5B 3VR9B 2DBYA 3AE1B 2W3RA 3BIID 1NI3A 4US8A 1SF0A 1JW9D 3AV8A 4JWSC 3WCQA 2B76B 1AWDA 1KFYB 1XO3A 3AEDB 1QOFA 2BS4B 1FM0D 4USAA 1JROA 4N6EB 1DOXA 1NYQA 2K9XA 2WU5B 4KX6B 1N5WA 1OFFA 1SIJA 1PUTA 3SFDB 3AEEB 1PFDA 1DOYA 1SB3C 2M56B 1L5PA 2PVGC 3W5UB 3ETRA 4N59A 1WGKA 5AUKA 5MPOA 5EE3A 1GAQB 1XLOA 2AX5A 2Q5WD 5H8YE 2G1EA 2HTME 1OQRA 1NEKB 4YT0B 2WLBA 2QJLA 2CU3A 2QIEB 3CIRB 1J7BA 1V8CA 1ROEA 2WP9B 5AUIA 1J7CA 2M19A 1ZP0B 1DOIA 3DWGC 2BS3B 1PDXA 2L52A 3AE3B 1JALA 3RPFC 3B2FA 4N58A 5EE9A 2MH7A
chains in the Genus database with same CATH superfamily
1F52A 4I6LB 2ACZB 4E3CA 1P1AA 2V0GA 2K6DB 3ZNGC 1J7AA 4M0WA 1GG3A 3Q3JA 4JE3B 2DYBA 1E8YA 4DXAB 1VD2A 4HKQA 4WWPA 4HLEA 3Q6BA 3AI5A 2ZZPB 2INNE 4F8CB 1RAXA 5C1ZA 2TSSA 3T3NA 4II2B 2VRRB 3GP7A 1SE9A 4IM3A 2D2QA 4NPNA 4B95A 1Q5WB 4OVZA 2OOBB 5IA7A 4NQLB 2KC2A 3B2GA 4HWIB 1XLQA 2ZNVC 1YX6B 3DQVA 2QMTA 1RYJA 3L08A 3VAWA 1ET6A 1VJKA 2GBKA 4KDLB 2ZVNA 2QILA 2N7JA 3AH7A 3GE3C 1B1ZA 1MVKA 2D3AA 3BIID 4BVUC 1ZDVA 3M63B 1YD8U 1FCLA 3ZTCA 1F2RI 3ECIA 1HZ5A 2I1KA 2AX5A 2G1EA 4KGSA 2WP9B 4W9KA 3HM3A 5HFYA 1DOIA 1PDXA 1MG4A 4WWNA 5JXVA 1OQYA 1YNTE 2LVQA 3VVWB 2IO0B 3JSVB 2MJ3A 1KF6B 1P7FA 3P4PB 5CHVC 4FJVB 1D4BA 2PIAA 1KJTA 4B9KA 1Y8RC 5C2TB 5IN7A 2INPE 4EZLA 1E7PB 2KLCA 2K22A 2L0TA 3RFZB 1F1HA 5C23A 2BB5A 4WJNA 3DPDA 4CQNA 3CSTA 2N1VA 1L0VB 3TEZA 2WQYB 2WDRB 3MFGA 2QC8A 3WAMA 2BKFA 4ZRJA 2KQ7A 2MBEA 1FEHA 2O2VA 3RUIB 1T0RC 1L0XB 2A4ZA 2K3UA 4HVBA 2L83A 2RSUA 3AE6B 1WXVA 1EWYC 1SEBD 3NVYA 3AMZA 2KWDA 1LXDA 3PLUA 4GU2A 5AZGA 1CMXB 3GZNI 3NS8A 3PZ8A 4MSMB 2GRIA 2WXOA 1GB4A 2L0FA 3KLSX 4GSWA 3QCAA 1WX9A 3N9YC 2ASQA 4OZAA 4HJKA 4MSQB 2AL6A 3QQ8B 3BK2A 1KLGD 2XN9C 3L4PA 1Q10A 1RRBA 2LD9A 5BMGA 5AEKB 1S1QB 5BYQA 1JWMD 1JW9D 3KYDD 4JWSC 5CX3A 4REZA 4C56C 4EZJA 3NHEB 2B3AA 3HK0A 4LCDE 3NJTA 1DOYA 3M95A 2AL3A 4M0WB 4MACA 3EGRA 5H8YE 1XQQA 4NAWA 4WJQA 2KANA 3IBEA 4WJPA 2KX3A 4G3XB 2KYWA 1QILA 2V3NA 3ZYYX 1CK1A 5E6JA 3RYTA 5EE0A 5FR6A 4BBNC 3UQBA 4LLGM 3ZRFA 4MGYE 3AB5A 1YQ4B 1WH3A 3AULA 4KZ0A 2FIDA 4AP4C 1H8CA 1SE2A 2N7DA 3RNFC 4EFOA 3ZKJC 1YX5B 1I35A 3SR6A 3T8MA 4YSXB 3JYUA 1QT9A 2WWZA 2MBHA 1VZ8A 1L7YA 2PE9A 2NR2A 2PVOD 1AW7A 2KDEB 4DHJB 2JVCA 2JQRB 3PRZA 2IO2B 1V49A 1LO5D 1XF5L 2Z0DB 1PGAA 4RF1A 4E74A 2UU7A 4HRSA 4KVGB 3KWLA 1XT9B 4BAXA 2IYDB 2VH1A 5C3JB 5LXIB 4IWPA 3RMKC 5AZHA 2OJWA 1LFDA 1K50A 1TYGB 4LDTD 2J4XA 2Z59B 3ZLZA 2NMQA 2BF8B 4NY0A 3AEEB 1IGDA 1L5PA 1WJ6A 5MPOA 4KKIA 1EUVB 2RGFA 1UF0A 3OLMD 1J7BA 1SSNA 2CHZA 4ZDVA 3AE3B 3VHTC 1EU3A 4LNNA 3ZNZB 3Q14C 4M8MA 2DAFA 1BT0A 5L95C 1FFVA 1K53A 2LVPA 2W3SA 4F7ZA 5G5HA 3O65B 2O2VB 3APFA 3ZNHB 1XXGA 5KHQA 4HCPB 4LNKA 2IGHA 4HDOA 5TR5A 3HUIA 2MX2A 3RD2A 1GPXA 1RFAA 2L32A 3VH4B 3L0WB 2BW2A 2L1AA 3VUXA 5DPSA 1EO6A 3VTVA 2LXAA 2WXNA 4WQMA 2D10A 2NBWB 3B08A 3OG5A 2KD0A 3UIPB 2JRHA 3QHTA 3W5VB 1VR9A 2LRUA 3ZIMA 2G4SA 1LGRA 2EMTA 2BYEA 1UWMA 3P4QB 2W9NA 2IY1B 3DWMA 4EEWA 2M4NA 5BMHA 2AQ2B 4BFRA 3N1ZC 1CQVA 2FCSA 2JYTA 2K39A 1P98A 4FBJB 2KFKA 2O6VD 2QDFA 1VDVA 2JUOA 2IGDA 4NAWB 1C3TA 1N63A 1N60A 4MH0E 4ZHOA 5JHAA 3Q8EA 4QAYA 2XNAC 1UWXA 4II3B 3CF6E 3R7QA 2IPKD 3LDZE 2HDEA 3H9DA 4KX6B 2KMAA 2LUMA 3MJWA 5FK9C 2LJ5A 4DK5A 4ACFA 4W9HA 2K8CA 3RNAC 5E6OA 1QZEA 1GC7A 1M4VA 3CIRB 4GOCA 3BYYB 2K1FA 3Q8BA 3KW5B 2J0MA 4YWGG 3V3XA 2YVCA 3BYTB 4L2YA 3UIOB 1C76A 5GMVA 3B0AA 3QIJA 4XX5A 1BUIC 2LHEA 3RNCC 1FNUA 2KK8A 1WM2A 1UGMA 1GC6A 4ITKA 2WDTB 2N1WA 1IBXA 1IYFA 3KYCD 1ZXIA 2LFIA 2FCQA 3NY5A 2BQQA 3Q2AC 3NG0A 4IWQA 1T6BX 1JRUA 2WXKA 3LJ3A 5G55A 3R2IA 3U30A 1X1MA 1K8RB 1HA5A 4DXGA 1OQQA 3V62A 1R4NB 1F77A 1Q0WB 1QOAA 1FXIA 2MWSB 4ZRPA 2RDBC 3TIXA 3MTNB 4TV3A 4DHZB 3ALBA 1GB1A 1TS5A 2VZKB 3Q3FA 2MW5A 2K25A 2Z0EB 3MP9A 5I4DA 4N9F4 2W82A 5J18A 3C8YA 1ZW7A 2REXA 1T0SC 1JROA 2BGFA 4BKTA 3IFWB 5IKCM 1WE6A 5IAAC 4CHKA 3L10B 5D7GA 3UI3A 4RGTA 1YN4A 4FA6A 1IP9A 5AZFA 2LHDA 2CHWA 1YN5A 2W54A 4KDIC 1TT5B 3N3KB 2K5PA 2Y5CA 1I4XA 3TMPB 5DCNA 3FAHA 5J2RA 4M01A 1TZOA 1H4RA 3DBLB 3GB1A 4KGTA 3CSFA 2H89B 1OGWA 3EC8A 2KLGA 2MJDA 3I5JC 2AWTA 1YJJA 3NOBA 2WHIA 3UQAA 3AE8B 3C19A 3H7SA 2WXHA 3W1SC 2GBJA 1WWTA 2KFKB 2KTRA 3C0RB 4RCOA 5BYRA 3ZRCA 2K8BA 1WXQA 2KACA 1I4RA 4BKSD 4J6IA 4KV2A 4RM9A 2ZCCA 3NS1A 1G6JA 1WGHA 1ET9A 2KQ4X 3URYA 2UWQA 4DHZE 3BK1A 4AWJA 3ZTDA 3CWIA 4KIKA 1YQBA 1TGZB 3DHGC 4E71A 1JWUD 4LTUA 1T0QC 2ZEQA 4WWOA 3AE1B 3NZ3A 4US8A 3SEBA 3TBLD 3W2DA 4P16A 2WX1A 1NYQA 2WU5B 3SFDB 3PTFC 1PFDA 2PVGC 3VQIA 2LXCA 2KJRA 1GAQB 3MHZA 1C4PA 4PS8A 1V1PA 1UBQA 3H1UA 2J42A 4URKA 4G0NB 3KUZA 1IBXB 3IT6B 1WXMA 3JW0X 4MM3A 3A1QA 3X0WA 2WX0A 3M3JA 1TTNA 2D3GA 4WURA 4PYZA 4WWMA 1J8CA 2R61A 5EE1A 1GNUA 3AU5A 4KKJA 3KUDB 3L13A 3V6CB 4FADA 2PTLA 2UYZB 2I1JA 3V60A 4DWFA 4TMAB 4CYEA 3VFKA 4IM2A 1F2RC 4JIOU 3Q3MC 4YSZB 4EOYA 2KWCA 1I42A 4C80A 1FRRA 2DHZA 3VUYA 1VCBA 2KDMA 1XLNA 3DBHB 4HEA1 2NS5A 1R4NI 1PYWD 3AXCA 4W9LA 1E8XA 1D5MC 1V80A 2WDQB 1MG8A 1WGYA 2LZ6A 4IG7B 4GDKA 2CJNA 2K6QA 2KN4A 2N9EB 4XWTA 3U7DA 3TJPA 2FBWB 4A3PA 3VRAB 3RNGC 3P1MA 3DVGX 1WI0A 2RD0A 2N9KA 5JHBA 3AE2B 1STEA 4YTNB 1TY0A 2J0KA 2LWPA 2EKEC 2IY0B 2ZVOA 4L1BA 3P4RB 2K8HA 3AM9A 2PPHA 3RZWC 1BXTA 3AE5B 2DBYA 2GBNA 3AEDB 1QOFA 2LJIA 2ZCBA 3L16A 2JT4B 1ESFA 4DDGD 1L0YB 2JYEA 1N5WA 2NTTA 3R7RA 1D5XC 1SIJA 3T3OA 3ETRA 2BWES 3QAQA 3B1LX 4UDUC 3U7ZA 1HXYD 3RULA 4MDKE 3PVLA 1C79A 3PS6A 4DQOC 2X8XX 1E7VA 2GI9A 2KVRA 3TUOA 1JALA 2I2YA 2G4DB 2SEBD 1DGJA 2L3ZA 3DBLI 2KKCA 2ZPYA 1KLVA 1I4PA 1JMLA 1TIFA 1WRDB 1WF9A 2E6XA 2KTRB 2NPTA 4O1NA 2JZPA 3NRZA 5IO9A 2YEPF 1TKGA 5D94A 3EUB2 3MC9A 3PRMB 4R3DA 1QOBA 1LM8B 2ONQA 2BTEA 4KGRA 4LK0M 3PZDA 2CKHB 1S3SG 4TUUA 4LJPB 4US9A 4RGNA 2LEKA 1HTOA 4KIKB 4KSLC 4W9EA 3AN1A 4RMAA 4ICUA 3HRDD 4RGOS 3QK0A 3PSEB 1SGHA 1WMHA 3ZGZA 2M0XA 2G9HD 4OZCA 1E10A 3MJ5A 2PLPA 1C78A 1WFYA 2OHFA 4LNFA 2JXXA 2C7HA 5HI1A 1V1PB 2C5LC 2D3BA 2PMVA 4NJ7A 2JZZA 4TQ1A 3UINB 4MM3B 1SF0A 1ZGUB 2J52A 3A1QB 2B76B 4W9DA 1KFYB 1MHHE 1FNVA 2DX5B 3I9V1 4XC2A 3WANA 1PUTA 1N6ZA 2QHOA 5EE3A 5LLIA 4XYCA 4B6WA 4DBGA 3DHHC 2O6VA 2CU3A 2DZKA 1ZP0B 2N9PC 4IC7B 2KC1A 3VR9B 4C4VA 4AUQC 4A8XC 3Q8AA 4HROA 4Q2JA 3A9JA 3R66C 5KHOA 4JPSA 3QC8B 3NUHB 4BKGA 4ANUA 1WGGA 3H7PA 3PPAA 4OVUA 3OJ4B 4OZBA 2K0PA 1IUEA 1QOGA 1BMLC 2IO3B 2W55A 1R4MB 3APCA 3TSSA 4GDKB 2VH2A 3L54A 5D3IB 3BWUD 3DBHI 2KXJA 1K51A 3HIZA 1JRPA 2QSDA 2C60A 2KWVB 3W9CB 2QCZA 1C4AA 5FKAC 4C00A 2V3PA 2NCNA 1WJ4A 1SBBB 3J9CA 2Z8LA 2LMCA 2WDVB 1UBIA 1YJ1A 2IGGA 2N0SB 1E9MA 4B0MA 3BY4B 3Q69A 2YLMA 2M17A 4ZRIA 5GXGB 2Y5BB 4FULA 1QKZA 3P63A 3EA6A 1UNSA 3AEAB 2IO1B 3KUCB 1VLBA 5BMIA 3I63C 3R3MA 3M62B 5FR3A 3LXFA 2X38A 2RPVA 3FC4A 3K9PB 1SIFA 2W3RA 3KH0A 1XO3A 2MSED 1MFWA 3DOWA 4EZKA 3KQ4A 5IOIA 1V2YA 1OFFA 4LDTB 5CTRC 3QX1A 1NDDA 3Q3OC 4GDLA 2MRPA 2NPTB 1J19A 1WZ0A 5E6NA 1NEKB 2LI5A 2OJRA 4XDCA 2FE8A 2M8SA 3NZSA 3PT2B 3U4EG 1ROEA 1WX7A 1UELA 2V4LA 5E6PA 2AQ1B 3RPFC 1FCCC 5BO4B 5EE9A 1RM6C 3LYYA 1HEZE 2AQ3B 4IKGA 2WGSA 1F0ZA 3FILA 1B9RA 1WR1A 4S17A 4GIVA 2N7EA 2J7QB 2MP2A 4P6VF 3P2BA 3ZO5B 2PEAA 1WMHB 4MJSA 1D6EC 3ZJUA 3I57A 3AEFB 4FXCA 2YEPB 3B9JA 2E3TA 3BINA 2V9HA 1RLFA 4HK2A 4EKUA 2ZNVB 4NAMA 3EFUA 1PGBA 3L17A 3IG3A 1IPGA 3N32A 4DDID 2DENB 1N61A 3BZDB 2LGDA 3BVZA 3ZVVA 1QQRA 2C9WB 3ZNID 3ML8A 2KT7A 1WGRA 2JSVX 1P7EA 2MJEA 1ZUD2 3SDLC 2RMMA 3AEGB 2RDHA 4IUMB 3H8HA 1XEEA 1WY8A 2INCC 2KQSA 4FN2A 2BWFA 1JQ4A 2IJ0A 3OJ3A 2O6VB 1OTRB 2KFJA 3ABVB 1FMAD 3U52E 4K7WA 4W9GA 5DPRA 3RI7C 1PQSA 4C4VB 1V6EA 2CS4A 4IM0A 4BKSA 4CO7A 3A9JB 1WM3A 3VTWA 3TEYA 2FCNA 3H7PB 3PGEA 3MC8A 3BVMA 3W5UB 2LRWA 5AUKA 3V05A 2LASA 2KVZA 4OHJA 2KMCA 3DVGY 2N4FA 1WZ3A 2BYVE 2DLBA 3DBSA 4HCNB 2QIEB 3VTUA 2HD5B 2JU6X 2L52A 1C1YB 4WJOA 3B2FA 1ZOYB 3APDA 1C9FA 1E8ZA 2DWQA 3QA8A 3RNEC 2XEWA 4MELA 4GB9A 3D32A 2J0JA 3ENEA 2N9XA 1T0YA 3K9OB 4IOIE 2G3QB 4IWOA 2RPQA 3E56A 2KJ6A 2KMMA 2ON8A 1YQ3B 3MHSD 4GGQA 1XCQL 2AEHA 5EDSA 4PYUA 1WR6E 5T8IA 4B0EA 4XGAB 1YMHE 4RF0A 3IT4B 4ZRKA 1LQBA 3RT3B 3PHXB 4A9AA 3KWVA 1FRDA 3Q3NC 5JH5C 4MGKE 5CHFA 3SU8X 4ICVA 1TBEA 2M0AA 1UGJA 1ZXHA 4GDLB 1AYFA 1RWSA 2L05A 1L4ZB 4XWWA 1EM7A 2DYOA 4GXBA 3IAS1 5D6JB 1TZ1A 1MPEA 1AWDA 3EHVA 3QARA 2K9XA 3FILB 3N30A 4A90A 4A55A 4HJGE 2M56B 2RDGA 2WLBA 2MP2B 2MHJA 1J7CA 3JVZX 3DWGC 2PJHA 1V86A 1KH0A 4MJSB 4RGMA 2JWZA 5D2MB 4FLHA 4NJCA 4A20A 1QLBB 2WXQA 4NZLB 4PS7A 4HXDA 1FPYA 4LNOA 1ZE3D 4W9JA 4PT5A 4X57B 1WXSA 1FO4A 2BBCA 1NVID 2ZPNA 2GBMA 3NVZA 3A4RA 1NI2A 3TCAA 2R2OA 2V4IB 3A33B 2KHWB 2NVUI 2WXPA 2KO3A 1Y56A 4MGZE 4ARCA 2ZW0A 4G11A 5DPTA 4MEMA 2WYQA 1NYRA 2KNBA 1WJNA 3I3TB 1HZ6A 4AS1A 4EUTA 3WAPA 2EKIA 3A4SC 3DBRB 4ASWC 4P1BC 3ONSA 3HVDA 3DVNV 4TSSA 2G45B 2AYOB 1FFUA 4GMVA 1WGDA 2HE7A 5H92C 1R7SA 1YJIA 4YSYB 2V3SA 4F1SA 3AEBB 1TKEA 3DCGA 4MH8A 4RM8A 3PLVA 3S2AA 2XK5A 4YTMB 3R8BA 1MJDA 1HQRD 4RFBA 1HTQA 1VZ6A 2FCMA 1NENB 4HPPA 4FJYA 3VXWA 3Q8CA 5LXHA 4RH6A 1I4QA 4USAA 3WIMA 2RR9A 3IAM1 2MCNB 4EE2A 1WJUA 1JCKB 2Q5WD 2KDIA 2R2QA 3ZDTA 3H6NA 4ANXA 3W1YA 2NTSA 2H88B 1KTKA 1UH6A 1Z5SB 1XD3B 3GS2A 1Q1OA 1WXAA 3IVFA 4ARIA 5G2NA 1MHXA 4P1CC 3AE4B 3LB8C 1L6UA 3VDZA 2INDC 2BKRB 4L23A 3TEWA 4ZOHC 2XBBC 1T5XD 1SJED 1EWCA 4GLSC 2BVCA 5G5GA 1V5TA 4DHJD 3W1SA 1D5ZC 2GB1A 1P0RA 3NZUA 3RN9C 4K7SA 1RFKA 1A5RA 2LGIA 1E5WA 1VZ7A 4PS3A 4TQ0A 2CR5A 2WNMA 1I7HA 1KLUD 3IHPC 4FHJA 3PO0A 2BPSA 4OVVA 1WRIA 3ZXRA 1E8WA 2Y3AA 3HVZA 1SJHD 4ANWA 4FHKA 4C7YA 3KVFB 4ZYSA 1V1OA 3ZDMC 3WAOA 4KSKC 2WXGA 2WXLA 1P3QU 1JWSD 1GJZA 1NI3A 3WALA 4G50A 2CU1A 1KM7A 1C77A 5D3DA 4D2KA 2L8JA 4XZ4A 1WGKA 1OEYA 3AU4A 5HHDG 4AQ7A 1OQRA 2KZRA 2LGYA 4HPMB 5HKHA 2IDYA 4WQOB 3CMMB 5TSSA 3PREA 4J3OD 4A3OA 4GN1A 2MLBA 4NQKE 1ACCA 5BYSA 2ZJDA 1T3QA 1V5OA 2JZ3B 2A5UA 2FUHB 1FNWA 2PKOA 1N62A 2PE6B 1EF5A 1ENFA 3QWZB 1TS4A 4ZYNA 4WH4A 3GE8C 2LGSA 4I6NB 1EU4A 1D3ZA 2MBBB 3P4SB 3A9KA 3VUWA 3P42A 3DBRI 3ZUNA 4HPLB 2KOXA 4IDIA 1TKYA 1N5XA 4IW0A 2WU2B 3U8ZA 3PRPB 4WAAA 5HG2A 4BZAA 2XK5B 3V6EB 1TS3A 3N20C 3DHIC 2JX5A 4JQWC 2QEJC 1L6VA 2GLSA 2I38A 3VR8B 3ZXVA 3TL5A 2BS2B 2MBQA 2CHXA 2JWUA 2JY6A 2DZJA 2L00B 2WXIA 3R2TA 4C7ZA 5L83A 1YOVB 2DAJA 3SFEB 1GUAB 2KDBA 4K1RB 1FIQA 3X23A 1WSPA 2LUEA 3AV8A 1MI0A 2JF5A 3UF8A 1V9JA 2ICIA 2GMIC 4N6EB 2J53A 1FD6A 1TY2A 4M8NA 2JPHA 4N59A 3U2SC 2DZIA 4MT5A 2D3CA 4HDQA 3SHQA 1I4HA 2QJLA 1YIWA 3FKYA 3HM6X 1Z2MA 4NNJB 2BS3B 1ZPSA 4JGHB 2Y5PA 2FNJB 2DYMA 2FAZA 2FUG1 4BBNF 5IP4D 3VH3B 4ZHPA 1CJEA 1ZKHA 1FXTB 2D07B 1L2NA 4JX1C 1JWBD 1WE7A 4K81A 4JWUC 3HHMA 4ZRQA 4ANVA 1AN8A 1SE3A 3N1XC 4YXDB 1J0GA 4XE0A 2V1YA 4W9IA 3ZJTA 1E0ZA 1E6EB 2KAJA 3O13A 2BB6A 2MEKA 1U4AA 2EMSA 1WX8A 2NBVB 1SXTA 4JL9A 4BOZB 3NVVA 4H2AA 4AJWA 1TS2A 4HKZE 1CZPA 4K3BA 1K52A 3AE9B 1I4GA 3MC0B 2EELA 4M00A 1V97A 2VZKD 3OAWA 3ZJVA 4FJZA 3UGBB 2IBIB 4K3CA 2MA9B 3RZFA 1V81A 1F9JA 2KN5A 4MGIE 5LNK1 3Q8FA 3SD5A 3OWEB 1ISNA 2NBUA 2BS4B 2MBOA 4KZCA 2N9LA 2WXJA 2PW9A 1SB3C 2DZMA 3PV1A 2C7MB 2JRIB 1E90A 4P7IA 1C4CA 1OEYJ 4M02A 5DPWA 1UZXB 1V8CA 3N1YC 2M19A 4YL8A 3T9LA 4N58A 4XDDA 1WYGA 3A9KB 2BT6A 1VRAB 4I6PA 3DVNU 2WXMA 1NBFC 3EFCA 1JWAD 1HE8A 3V61A 4AOFA 1A70A 2GOWA 2KJHB 3AECB 4W9FA 4LJOB 1XLPA 1SE4A 4RNAA 1QF6A 2OEDA 4PK1A 1UD7A 3E9SA 5J17A 4AJYB 1XCTL 2HJ1A 3JSVA 2HJ8A 4K7UA 1M94A 1R4MI 2KX0A 2SAKA 1PGXA 3QJZA 2CJOA 4LNIA 4DXFA 4TKNA 4YTPB 2FIFA 1YN3A 2JXTA 4NJ6A 1WIAA 2ZW1A 2GBRA 2L7RA 1FXAA 5JZEB 1KRHA 3EECA 3WA0A 3ZW3A 4BOSC 2D11A 4W9CA 3AE7B 2WXRA 1DYQA 2MQJA 4S0RA 3PHWB 2M1MA 1E7UA 1TJEA 1EF1A 3GZNB 1ZDXA 3PZ7A 3VRBB 2WS3B 1P9DU 3GOEA 2L76A 4WIPA 3ZQ4A 2WXFA 2BYFA 3NVWA 2KTFA 3RNBC 3TEXA 4WAFA 3WCQA 3ML9A 1KOTA 2KDFB 1GOZA 2LVOA 1FM0D 1DOXA 3DDCB 5CHWA 4JLCA 2C7NB 1XLOA 3IXSA 2KWUB 1IGCA 1L4DB 2HTME 2DNFA 4YT0B 4A6QA 3RCZA 1AARA 1UUPA 3BVGA 5AUIA 2LGXA 2BYTA 2HTHA 2IZVB 4OW0A 2D5GA 1WYWB 2MH7A
chains in the Genus database with same CATH topology
4YWGG 4A8XC 3V3XA 2ACZB 3BYTB 2NTSA 3Q8AA 2H88B 1C76A 4HROA 4L2YA 4Q2JA 1KTKA 2V0GA 4JPSA 1BUIC 2LHEA 3NUHB 1FNUA 3GS2A 1J7AA 4M0WA 4OZBA 2K0PA 4JE3B 1IUEA 1QOGA 1BMLC 4ITKA 4ARIA 2W55A 1MHXA 3TSSA 4GDKB 1IBXA 4HKQA 3AE4B 3LB8C 5D3IB 1L6UA 3BWUD 1ZXIA 1K51A 2INNE 2LFIA 4L23A 3TEWA 1JRPA 2TSSA 2QSDA 3T3NA 4ZOHC 3W9CB 1T5XD 3GP7A 1C4AA 1SJED 5FKAC 2V3PA 1EWCA 4GLSC 1T6BX 5G5GA 3W1SA 2WXKA 1D5ZC 2GB1A 3R2IA 1SBBB 3J9CA 2Z8LA 2LMCA 1RFKA 2WDVB 2LGIA 4OVZA 1VZ7A 4TQ0A 1HA5A 2WNMA 1I7HA 1KLUD 2IGGA 4DXGA 1OQQA 2N0SB 1E9MA 4B0MA 3PO0A 1F77A 3Q69A 1QOAA 1WRIA 3B2GA 1FXIA 5GXGB 2Y3AA 4ZRPA 1XLQA 1SJHD 3HVZA 4C7YA 1QKZA 3P63A 4ZYSA 1V1OA 3EA6A 1UNSA 3AEAB 2QMTA 1GB1A 1TS5A 2VZKB 1RYJA 1VLBA 2WXGA 1ET6A 1VJKA 2WXLA 2QILA 5BMIA 2N7JA 3AH7A 1B1ZA 5FR3A 1MVKA 1JWSD 3LXFA 2X38A 3MP9A 2RPVA 3FC4A 5I4DA 2W3RA 3BIID 1NI3A 1ZDVA 2W82A 3C8YA 1XO3A 1JROA 3KQ4A 1FCLA 1OFFA 1C77A 5D3DA 4D2KA 1F2RI 1HZ5A 1WGKA 2AX5A 5HHDG 4AQ7A 2G1EA 5D7GA 3UI3A 1OQRA 1NEKB 4RGTA 1YN4A 4XDCA 2FE8A 4KGSA 3U4EG 1ROEA 2WP9B 2IDYA 5TSSA 5HFYA 4J3OD 1DOIA 1PDXA 2AQ1B 3RPFC 2LHDA 1FCCC 5EE9A 5JXVA 1RM6C 3LYYA 1YNTE 1HEZE 1YN5A 2W54A 2MJ3A 1ACCA 2AQ3B 1KF6B 1P7FA 1T3QA 3P4PB 4IKGA 5BYSA 1F0ZA 2K5PA 2Y5CA 3FILA 1B9RA 1D4BA 2PIAA 1I4XA 3FAHA 1FNWA 5C2TB 2PKOA 1TZOA 1N62A 2INPE 1ENFA 3GB1A 1E7PB 4KGTA 1TS4A 4P6VF 2K22A 4WH4A 3RFZB 2BB5A 2H89B 1EU4A 4CQNA 2MJDA 1YJJA 1L0VB 3P4SB 3AE8B 3TEZA 2WQYB 1D6EC 3ZJUA 3I57A 2WDRB 3AEFB 3MFGA 4FXCA 3P42A 2YEPB 4IDIA 3B9JA 2WXHA 2E3TA 1TKYA 1N5XA 1FEHA 1WWTA 2WU2B 4NAMA 1L0XB 2K3UA 2L83A 1PGBA 3AE6B 4RCOA 5BYRA 5HG2A 1EWYC 1SEBD 3NVYA 1TS3A 3AMZA 2KWDA 2JX5A 1WXQA 2QEJC 2KACA 1I4RA 1L6VA 1N61A 3BZDB 3BVZA 1QQRA 2I38A 3VR8B 3PZ8A 3NS1A 2JSVX 2GRIA 2WXOA 1P7EA 2MJEA 1GB4A 1ZUD2 3KLSX 1ET9A 2BS2B 2KQ4X 2RMMA 3AEGB 2RDHA 2JWUA 1XEEA 3H8HA 3N9YC 4OZAA 3URYA 3BK1A 2WXIA 3CWIA 3R2TA 1JQ4A 2IJ0A 3BK2A 4C7ZA 1KLGD 2XN9C 3SFEB 3L4PA 3ABVB 1Q10A 1FMAD 3U52E 1JWUD 4LTUA 5BMGA 1FIQA 3AE1B 5BYQA 3NZ3A 4US8A 1JWMD 1WSPA 1JW9D 3AV8A 4JWSC 1MI0A 3SEBA 3W2DA 4REZA 4C56C 2ICIA 4P16A 4N6EB 1NYQA 2WU5B 2J53A 1FD6A 3TEYA 1TY2A 3SFDB 1DOYA 1PFDA 4MACA 2PVGC 3BVMA 3W5UB 4N59A 3U2SC 3VQIA 3EGRA 4MT5A 5AUKA 1GAQB 3MHZA 1C4PA 5H8YE 1V1PA 3V05A 4OHJA 2DLBA 2J42A 1I4HA 2QJLA 2QIEB 1IBXB 3IT6B 2JU6X 2BS3B 2L52A 1ZPSA 3B2FA 1QILA 2Y5PA 1ZOYB 2V3NA 1C9FA 2DWQA 4WURA 3ZYYX 4WWMA 1CK1A 5E6JA 2DYMA 2R61A 5EE1A 2FUG1 4KKJA 5EE0A 2PTLA 4ZHPA 1CJEA 4LLGM 4IOIE 3AB5A 4TMAB 1YQ4B 4JX1C 3E56A 2KMMA 1JWBD 1F2RC 1SE2A 4JWUC 2ON8A 1YQ3B 4ZRQA 1AN8A 1SE3A 1XCQL 4YXDB 4XE0A 4YSZB 3ZJTA 3SR6A 1E0ZA 1E6EB 2KAJA 3O13A 4C80A 2BB6A 1FRRA 4YSXB 5T8IA 4B0EA 1QT9A 2MEKA 1YMHE 2KDMA 1XLNA 1VZ8A 4RF0A 3IT4B 4HEA1 1PYWD 1SXTA 2PVOD 1AW7A 1D5MC 2WDQB 3NVVA 4H2AA 2JQRB 4A9AA 2CJNA 3KWVA 1TS2A 1FRDA 2KN4A 4HKZE 1CZPA 4XWTA 2FBWB 1LO5D 1K52A 3VRAB 1XF5L 3AE9B 1I4GA 3MC0B 2EELA 3P1MA 1PGAA 4RF1A 1V97A 2VZKD 4HRSA 3ZJVA 2M0AA 2N9KA 1UGJA 3AE2B 3KWLA 1STEA 4YTNB 1ZXHA 1TY0A 4GDLB 1AYFA 5C3JB 1RWSA 4L1BA 1L4ZB 3P4RB 4XWWA 5LNK1 3Q8FA 1EM7A 2DYOA 3AM9A 3IAS1 1BXTA 3OWEB 1K50A 1TYGB 3AE5B 2DBYA 1MPEA 1AWDA 2J4XA 3AEDB 1QOFA 2BS4B 2LJIA 1ESFA 1L0YB 2K9XA 2JYEA 3FILB 1N5WA 2NTTA 2NMQA 1D5XC 1SIJA 4A90A 2N9LA 4A55A 3AEEB 1IGDA 2WXJA 2PW9A 4HJGE 3T3OA 1SB3C 2M56B 1L5PA 3ETRA 5MPOA 1C4CA 4KKIA 2RDGA 4UDUC 1HXYD 3U7ZA 2WLBA 1C79A 4DQOC 1J7BA 1V8CA 2GI9A 1SSNA 1J7CA 2M19A 3TUOA 3DWGC 3AE3B 1JALA 2I2YA 1KH0A 4N58A 4XDDA 2SEBD 4RGMA 1WYGA 2BT6A 1VRAB 1DGJA 1EU3A 2WXMA 1JWAD 4NJCA 1FFVA 1K53A 1I4PA 1JMLA 1QLBB 2W3SA 2WXQA 5G5HA 4NZLB 1A70A 2E6XA 1XXGA 1ZE3D 3AECB 4PT5A 4O1NA 1XLPA 1SE4A 4RNAA 2JZPA 1QF6A 2OEDA 3NRZA 1FO4A 2BBCA 1NVID 3E9SA 2IGHA 3NVZA 3HUIA 2YEPF 1GPXA 1TKGA 2V4IB 3EUB2 2WXPA 1XCTL 2L32A 1Y56A 4R3DA 1QOBA 4ARCA 2ONQA 2BW2A 2ZW0A 2BTEA 2L1AA 4KGRA 1NYRA 4LK0M 2SAKA 1HZ6A 1PGXA 2WXNA 4WQMA 4AS1A 4US9A 4RGNA 2LEKA 2CJOA 2EKIA 3W5VB 1VR9A 3AN1A 4DXFA 4YTPB 1YN3A 2JXTA 3HRDD 1UWMA 3P4QB 4RGOS 2ZW1A 3HVDA 1FXAA 1KRHA 3DWMA 4TSSA 3ZGZA 3AE7B 1FFUA 2WXRA 1DYQA 2G9HD 5BMHA 2AQ2B 4OZCA 1E10A 1CQVA 1R7SA 1TJEA 2JYTA 3MJ5A 5H92C 1YJIA 1ZDXA 2PLPA 3PZ7A 1C78A 2OHFA 2WS3B 3VRBB 4YSYB 3AEBB 1TKEA 5HI1A 1V1PB 4MH8A 4WIPA 1VDVA 3ZQ4A 4YTMB 2IGDA 4NAWB 3R8BA 2WXFA 1N63A 1N60A 1HQRD 2PMVA 3NVWA 4RFBA 1VZ6A 4TQ1A 4ZHOA 1NENB 3TEXA 4MM3B 3Q8EA 4WAFA 1SF0A 2J52A 2XNAC 1UWXA 3WCQA 2B76B 1KFYB 2IPKD 3Q8CA 1MHHE 1FNVA 1GOZA 3I9V1 4RH6A 1FM0D 1I4QA 4USAA 1DOXA 2HDEA 4KX6B 2LUMA 5FK9C 3IAM1 1PUTA 4EE2A 1JCKB 5EE3A 1XLOA 2Q5WD 3IXSA 1IGCA 1L4DB 2HTME 4YT0B 4A6QA 1M4VA 2CU3A 3CIRB 1UUPA 3BVGA 3BYYB 5AUIA 1ZP0B 3Q8BA 2BYTA 4OW0A 2D5GA 3VR9B 2MH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RM6 C;  1ZOY B;  1WYG A;  2ACZ B;  2BT6 A;  2DWQ A;  1DGJ A;  2H88 B;  2MJ3 A;  2W54 A;  1KF6 B;  4HRO A;  1T3Q A;  3P4P B;  4WWM A;  1F0Z A;  5EE1 A;  2K5P A;  2Y5C A;  1JWA D;  1B9R A;  2PIA A;  1FFV A;  5EE0 A;  4ZHP A;  1J7A A;  1CJE A;  1QLB B;  3FAH A;  2W3S A;  5G5H A;  5C2T B;  2PKO A;  3AB5 A;  1N62 A;  1A70 A;  1YQ4 B;  1IUE A;  4JX1 C;  1QOG A;  3AEC B;  3ZYY X;  4ITK A;  2KMM A;  1XLP A;  1QF6 A;  1E7P B;  1JWB D;  2W55 A;  2K22 A;  3NRZ A;  4P6V F;  1FO4 A;  1NVI D;  2H89 B;  4JWU C;  3NVZ A;  3HUI A;  1YQ3 B;  2MJD A;  1GPX A;  1TKG A;  3AE4 B;  3LB8 C;  1L6U A;  1YJJ A;  1L0V B;  3EUB 2;  3P4S B;  3AE8 B;  1ZXI A;  2WQY B;  4YXD B;  1QOB A;  4YSZ B;  2WDR B;  3AEF B;  4FXC A;  1JRP A;  4IDI A;  3SR6 A;  1NYR A;  3B9J A;  4ZOH C;  3W9C B;  1E0Z A;  1E6E B;  2KAJ A;  2E3T A;  4C80 A;  1FRR A;  1TKY A;  4WQM A;  4YSX B;  1N5X A;  1QT9 A;  4US9 A;  1WWT A;  1XLN A;  2WU2 B;  5G5G A;  2LEK A;  2CJO A;  2EKI A;  3W5V B;  2L83 A;  2PVO D;  3AN1 A;  3AE6 B;  2WDQ B;  1EWY C;  3NVY A;  1RFK A;  2WDV B;  3NVV A;  3AMZ A;  3HRD D;  4YTP B;  1UWM A;  3P4Q B;  2JQR B;  4A9A A;  2JX5 A;  2CJN A;  1WXQ A;  1I7H A;  1FRD A;  1FXA A;  1L6V A;  1N61 A;  1OQQ A;  1KRH A;  1CZP A;  1E9M A;  2N0S B;  3DWM A;  3PO0 A;  1QOA A;  2FBW B;  1WRI A;  3B2G A;  1FXI A;  3VRA B;  3VR8 B;  3AE7 B;  5GXG B;  1FFU A;  3AE9 B;  3NS1 A;  3P1M A;  1XLQ A;  3HVZ A;  4C7Y A;  1V97 A;  2MJE A;  3P63 A;  1ZUD 2;  4HRS A;  2BS2 B;  3AEG B;  3AEA B;  1E10 A;  3AE2 B;  3KWL A;  5H92 C;  1R7S A;  1TJE A;  4YTN B;  1YJI A;  3VRB B;  2OHF A;  1AYF A;  1RYJ A;  1VLB A;  2WS3 B;  3CWI A;  4YSY B;  3AEB B;  1TKE A;  1JQ4 A;  5C3J B;  1RWS A;  1VJK A;  3P4R B;  1VDV A;  4C7Z A;  4YTM B;  3AH7 A;  3AM9 A;  3SFE B;  1N63 A;  1N60 A;  3ABV B;  3L4P A;  3NVW A;  1FMA D;  3LXF A;  4LTU A;  4ZHO A;  1FIQ A;  1NEN B;  3FC4 A;  1TYG B;  3AE5 B;  3VR9 B;  2DBY A;  3AE1 B;  2W3R A;  3BII D;  1NI3 A;  4US8 A;  1SF0 A;  1JW9 D;  3AV8 A;  4JWS C;  3WCQ A;  2B76 B;  1AWD A;  1KFY B;  1XO3 A;  3AED B;  1QOF A;  2BS4 B;  1FM0 D;  4USA A;  1JRO A;  4N6E B;  1DOX A;  1NYQ A;  2K9X A;  2WU5 B;  4KX6 B;  1N5W A;  1OFF A;  1SIJ A;  1PUT A;  3SFD B;  3AEE B;  1PFD A;  1DOY A;  1SB3 C;  2M56 B;  1L5P A;  2PVG C;  3W5U B;  3ETR A;  4N59 A;  1WGK A;  5AUK A;  5MPO A;  5EE3 A;  1GAQ B;  1XLO A;  2AX5 A;  2Q5W D;  5H8Y E;  2G1E A;  2HTM E;  1OQR A;  1NEK B;  4YT0 B;  2WLB A;  2QJL A;  2CU3 A;  2QIE B;  3CIR B;  1J7B A;  1V8C A;  1ROE A;  2WP9 B;  5AUI A;  1J7C A;  2M19 A;  1ZP0 B;  1DOI A;  3DWG C;  2BS3 B;  1PDX A;  2L52 A;  3AE3 B;  1JAL A;  3RPF C;  3B2F A;  4N58 A;  5EE9 A;  2MH7 A; 
#chains in the Genus database with same CATH topology
 1F52 A;  4I6L B;  2ACZ B;  4E3C A;  1P1A A;  2V0G A;  2K6D B;  3ZNG C;  1J7A A;  4M0W A;  1GG3 A;  3Q3J A;  4JE3 B;  2DYB A;  1E8Y A;  4DXA B;  1VD2 A;  4HKQ A;  4WWP A;  4HLE A;  3Q6B A;  3AI5 A;  2ZZP B;  2INN E;  4F8C B;  1RAX A;  5C1Z A;  2TSS A;  3T3N A;  4II2 B;  2VRR B;  3GP7 A;  1SE9 A;  4IM3 A;  2D2Q A;  4NPN A;  4B95 A;  1Q5W B;  4OVZ A;  2OOB B;  5IA7 A;  4NQL B;  2KC2 A;  3B2G A;  4HWI B;  1XLQ A;  2ZNV C;  1YX6 B;  3DQV A;  2QMT A;  1RYJ A;  3L08 A;  3VAW A;  1ET6 A;  1VJK A;  2GBK A;  4KDL B;  2ZVN A;  2QIL A;  2N7J A;  3AH7 A;  3GE3 C;  1B1Z A;  1MVK A;  2D3A A;  3BII D;  4BVU C;  1ZDV A;  3M63 B;  1YD8 U;  1FCL A;  3ZTC A;  1F2R I;  3ECI A;  1HZ5 A;  2I1K A;  2AX5 A;  2G1E A;  4KGS A;  2WP9 B;  4W9K A;  3HM3 A;  5HFY A;  1DOI A;  1PDX A;  1MG4 A;  4WWN A;  5JXV A;  1OQY A;  1YNT E;  2LVQ A;  3VVW B;  2IO0 B;  3JSV B;  2MJ3 A;  1KF6 B;  1P7F A;  3P4P B;  5CHV C;  4FJV B;  1D4B A;  2PIA A;  1KJT A;  4B9K A;  1Y8R C;  5C2T B;  5IN7 A;  2INP E;  4EZL A;  1E7P B;  2KLC A;  2K22 A;  2L0T A;  3RFZ B;  1F1H A;  5C23 A;  2BB5 A;  4WJN A;  3DPD A;  4CQN A;  3CST A;  2N1V A;  1L0V B;  3TEZ A;  2WQY B;  2WDR B;  3MFG A;  2QC8 A;  3WAM A;  2BKF A;  4ZRJ A;  2KQ7 A;  2MBE A;  1FEH A;  2O2V A;  3RUI B;  1T0R C;  1L0X B;  2A4Z A;  2K3U A;  4HVB A;  2L83 A;  2RSU A;  3AE6 B;  1WXV A;  1EWY C;  1SEB D;  3NVY A;  3AMZ A;  2KWD A;  1LXD A;  3PLU A;  4GU2 A;  5AZG A;  1CMX B;  3GZN I;  3NS8 A;  3PZ8 A;  4MSM B;  2GRI A;  2WXO A;  1GB4 A;  2L0F A;  3KLS X;  4GSW A;  3QCA A;  1WX9 A;  3N9Y C;  2ASQ A;  4OZA A;  4HJK A;  4MSQ B;  2AL6 A;  3QQ8 B;  3BK2 A;  1KLG D;  2XN9 C;  3L4P A;  1Q10 A;  1RRB A;  2LD9 A;  5BMG A;  5AEK B;  1S1Q B;  5BYQ A;  1JWM D;  1JW9 D;  3KYD D;  4JWS C;  5CX3 A;  4REZ A;  4C56 C;  4EZJ A;  3NHE B;  2B3A A;  3HK0 A;  4LCD E;  3NJT A;  1DOY A;  3M95 A;  2AL3 A;  4M0W B;  4MAC A;  3EGR A;  5H8Y E;  1XQQ A;  4NAW A;  4WJQ A;  2KAN A;  3IBE A;  4WJP A;  2KX3 A;  4G3X B;  2KYW A;  1QIL A;  2V3N A;  3ZYY X;  1CK1 A;  5E6J A;  3RYT A;  5EE0 A;  5FR6 A;  4BBN C;  3UQB A;  4LLG M;  3ZRF A;  4MGY E;  3AB5 A;  1YQ4 B;  1WH3 A;  3AUL A;  4KZ0 A;  2FID A;  4AP4 C;  1H8C A;  1SE2 A;  2N7D A;  3RNF C;  4EFO A;  3ZKJ C;  1YX5 B;  1I35 A;  3SR6 A;  3T8M A;  4YSX B;  3JYU A;  1QT9 A;  2WWZ A;  2MBH A;  1VZ8 A;  1L7Y A;  2PE9 A;  2NR2 A;  2PVO D;  1AW7 A;  2KDE B;  4DHJ B;  2JVC A;  2JQR B;  3PRZ A;  2IO2 B;  1V49 A;  1LO5 D;  1XF5 L;  2Z0D B;  1PGA A;  4RF1 A;  4E74 A;  2UU7 A;  4HRS A;  4KVG B;  3KWL A;  1XT9 B;  4BAX A;  2IYD B;  2VH1 A;  5C3J B;  5LXI B;  4IWP A;  3RMK C;  5AZH A;  2OJW A;  1LFD A;  1K50 A;  1TYG B;  4LDT D;  2J4X A;  2Z59 B;  3ZLZ A;  2NMQ A;  2BF8 B;  4NY0 A;  3AEE B;  1IGD A;  1L5P A;  1WJ6 A;  5MPO A;  4KKI A;  1EUV B;  2RGF A;  1UF0 A;  3OLM D;  1J7B A;  1SSN A;  2CHZ A;  4ZDV A;  3AE3 B;  3VHT C;  1EU3 A;  4LNN A;  3ZNZ B;  3Q14 C;  4M8M A;  2DAF A;  1BT0 A;  5L95 C;  1FFV A;  1K53 A;  2LVP A;  2W3S A;  4F7Z A;  5G5H A;  3O65 B;  2O2V B;  3APF A;  3ZNH B;  1XXG A;  5KHQ A;  4HCP B;  4LNK A;  2IGH A;  4HDO A;  5TR5 A;  3HUI A;  2MX2 A;  3RD2 A;  1GPX A;  1RFA A;  2L32 A;  3VH4 B;  3L0W B;  2BW2 A;  2L1A A;  3VUX A;  5DPS A;  1EO6 A;  3VTV A;  2LXA A;  2WXN A;  4WQM A;  2D10 A;  2NBW B;  3B08 A;  3OG5 A;  2KD0 A;  3UIP B;  2JRH A;  3QHT A;  3W5V B;  1VR9 A;  2LRU A;  3ZIM A;  2G4S A;  1LGR A;  2EMT A;  2BYE A;  1UWM A;  3P4Q B;  2W9N A;  2IY1 B;  3DWM A;  4EEW A;  2M4N A;  5BMH A;  2AQ2 B;  4BFR A;  3N1Z C;  1CQV A;  2FCS A;  2JYT A;  2K39 A;  1P98 A;  4FBJ B;  2KFK A;  2O6V D;  2QDF A;  1VDV A;  2JUO A;  2IGD A;  4NAW B;  1C3T A;  1N63 A;  1N60 A;  4MH0 E;  4ZHO A;  5JHA A;  3Q8E A;  4QAY A;  2XNA C;  1UWX A;  4II3 B;  3CF6 E;  3R7Q A;  2IPK D;  3LDZ E;  2HDE A;  3H9D A;  4KX6 B;  2KMA A;  2LUM A;  3MJW A;  5FK9 C;  2LJ5 A;  4DK5 A;  4ACF A;  4W9H A;  2K8C A;  3RNA C;  5E6O A;  1QZE A;  1GC7 A;  1M4V A;  3CIR B;  4GOC A;  3BYY B;  2K1F A;  3Q8B A;  3KW5 B;  2J0M A;  4YWG G;  3V3X A;  2YVC A;  3BYT B;  4L2Y A;  3UIO B;  1C76 A;  5GMV A;  3B0A A;  3QIJ A;  4XX5 A;  1BUI C;  2LHE A;  3RNC C;  1FNU A;  2KK8 A;  1WM2 A;  1UGM A;  1GC6 A;  4ITK A;  2WDT B;  2N1W A;  1IBX A;  1IYF A;  3KYC D;  1ZXI A;  2LFI A;  2FCQ A;  3NY5 A;  2BQQ A;  3Q2A C;  3NG0 A;  4IWQ A;  1T6B X;  1JRU A;  2WXK A;  3LJ3 A;  5G55 A;  3R2I A;  3U30 A;  1X1M A;  1K8R B;  1HA5 A;  4DXG A;  1OQQ A;  3V62 A;  1R4N B;  1F77 A;  1Q0W B;  1QOA A;  1FXI A;  2MWS B;  4ZRP A;  2RDB C;  3TIX A;  3MTN B;  4TV3 A;  4DHZ B;  3ALB A;  1GB1 A;  1TS5 A;  2VZK B;  3Q3F A;  2MW5 A;  2K25 A;  2Z0E B;  3MP9 A;  5I4D A;  4N9F 4;  2W82 A;  5J18 A;  3C8Y A;  1ZW7 A;  2REX A;  1T0S C;  1JRO A;  2BGF A;  4BKT A;  3IFW B;  5IKC M;  1WE6 A;  5IAA C;  4CHK A;  3L10 B;  5D7G A;  3UI3 A;  4RGT A;  1YN4 A;  4FA6 A;  1IP9 A;  5AZF A;  2LHD A;  2CHW A;  1YN5 A;  2W54 A;  4KDI C;  1TT5 B;  3N3K B;  2K5P A;  2Y5C A;  1I4X A;  3TMP B;  5DCN A;  3FAH A;  5J2R A;  4M01 A;  1TZO A;  1H4R A;  3DBL B;  3GB1 A;  4KGT A;  3CSF A;  2H89 B;  1OGW A;  3EC8 A;  2KLG A;  2MJD A;  3I5J C;  2AWT A;  1YJJ A;  3NOB A;  2WHI A;  3UQA A;  3AE8 B;  3C19 A;  3H7S A;  2WXH A;  3W1S C;  2GBJ A;  1WWT A;  2KFK B;  2KTR A;  3C0R B;  4RCO A;  5BYR A;  3ZRC A;  2K8B A;  1WXQ A;  2KAC A;  1I4R A;  4BKS D;  4J6I A;  4KV2 A;  4RM9 A;  2ZCC A;  3NS1 A;  1G6J A;  1WGH A;  1ET9 A;  2KQ4 X;  3URY A;  2UWQ A;  4DHZ E;  3BK1 A;  4AWJ A;  3ZTD A;  3CWI A;  4KIK A;  1YQB A;  1TGZ B;  3DHG C;  4E71 A;  1JWU D;  4LTU A;  1T0Q C;  2ZEQ A;  4WWO A;  3AE1 B;  3NZ3 A;  4US8 A;  3SEB A;  3TBL D;  3W2D A;  4P16 A;  2WX1 A;  1NYQ A;  2WU5 B;  3SFD B;  3PTF C;  1PFD A;  2PVG C;  3VQI A;  2LXC A;  2KJR A;  1GAQ B;  3MHZ A;  1C4P A;  4PS8 A;  1V1P A;  1UBQ A;  3H1U A;  2J42 A;  4URK A;  4G0N B;  3KUZ A;  1IBX B;  3IT6 B;  1WXM A;  3JW0 X;  4MM3 A;  3A1Q A;  3X0W A;  2WX0 A;  3M3J A;  1TTN A;  2D3G A;  4WUR A;  4PYZ A;  4WWM A;  1J8C A;  2R61 A;  5EE1 A;  1GNU A;  3AU5 A;  4KKJ A;  3KUD B;  3L13 A;  3V6C B;  4FAD A;  2PTL A;  2UYZ B;  2I1J A;  3V60 A;  4DWF A;  4TMA B;  4CYE A;  3VFK A;  4IM2 A;  1F2R C;  4JIO U;  3Q3M C;  4YSZ B;  4EOY A;  2KWC A;  1I42 A;  4C80 A;  1FRR A;  2DHZ A;  3VUY A;  1VCB A;  2KDM A;  1XLN A;  3DBH B;  4HEA 1;  2NS5 A;  1R4N I;  1PYW D;  3AXC A;  4W9L A;  1E8X A;  1D5M C;  1V80 A;  2WDQ B;  1MG8 A;  1WGY A;  2LZ6 A;  4IG7 B;  4GDK A;  2CJN A;  2K6Q A;  2KN4 A;  2N9E B;  4XWT A;  3U7D A;  3TJP A;  2FBW B;  4A3P A;  3VRA B;  3RNG C;  3P1M A;  3DVG X;  1WI0 A;  2RD0 A;  2N9K A;  5JHB A;  3AE2 B;  1STE A;  4YTN B;  1TY0 A;  2J0K A;  2LWP A;  2EKE C;  2IY0 B;  2ZVO A;  4L1B A;  3P4R B;  2K8H A;  3AM9 A;  2PPH A;  3RZW C;  1BXT A;  3AE5 B;  2DBY A;  2GBN A;  3AED B;  1QOF A;  2LJI A;  2ZCB A;  3L16 A;  2JT4 B;  1ESF A;  4DDG D;  1L0Y B;  2JYE A;  1N5W A;  2NTT A;  3R7R A;  1D5X C;  1SIJ A;  3T3O A;  3ETR A;  2BWE S;  3QAQ A;  3B1L X;  4UDU C;  3U7Z A;  1HXY D;  3RUL A;  4MDK E;  3PVL A;  1C79 A;  3PS6 A;  4DQO C;  2X8X X;  1E7V A;  2GI9 A;  2KVR A;  3TUO A;  1JAL A;  2I2Y A;  2G4D B;  2SEB D;  1DGJ A;  2L3Z A;  3DBL I;  2KKC A;  2ZPY A;  1KLV A;  1I4P A;  1JML A;  1TIF A;  1WRD B;  1WF9 A;  2E6X A;  2KTR B;  2NPT A;  4O1N A;  2JZP A;  3NRZ A;  5IO9 A;  2YEP F;  1TKG A;  5D94 A;  3EUB 2;  3MC9 A;  3PRM B;  4R3D A;  1QOB A;  1LM8 B;  2ONQ A;  2BTE A;  4KGR A;  4LK0 M;  3PZD A;  2CKH B;  1S3S G;  4TUU A;  4LJP B;  4US9 A;  4RGN A;  2LEK A;  1HTO A;  4KIK B;  4KSL C;  4W9E A;  3AN1 A;  4RMA A;  4ICU A;  3HRD D;  4RGO S;  3QK0 A;  3PSE B;  1SGH A;  1WMH A;  3ZGZ A;  2M0X A;  2G9H D;  4OZC A;  1E10 A;  3MJ5 A;  2PLP A;  1C78 A;  1WFY A;  2OHF A;  4LNF A;  2JXX A;  2C7H A;  5HI1 A;  1V1P B;  2C5L C;  2D3B A;  2PMV A;  4NJ7 A;  2JZZ A;  4TQ1 A;  3UIN B;  4MM3 B;  1SF0 A;  1ZGU B;  2J52 A;  3A1Q B;  2B76 B;  4W9D A;  1KFY B;  1MHH E;  1FNV A;  2DX5 B;  3I9V 1;  4XC2 A;  3WAN A;  1PUT A;  1N6Z A;  2QHO A;  5EE3 A;  5LLI A;  4XYC A;  4B6W A;  4DBG A;  3DHH C;  2O6V A;  2CU3 A;  2DZK A;  1ZP0 B;  2N9P C;  4IC7 B;  2KC1 A;  3VR9 B;  4C4V A;  4AUQ C;  4A8X C;  3Q8A A;  4HRO A;  4Q2J A;  3A9J A;  3R66 C;  5KHO A;  4JPS A;  3QC8 B;  3NUH B;  4BKG A;  4ANU A;  1WGG A;  3H7P A;  3PPA A;  4OVU A;  3OJ4 B;  4OZB A;  2K0P A;  1IUE A;  1QOG A;  1BML C;  2IO3 B;  2W55 A;  1R4M B;  3APC A;  3TSS A;  4GDK B;  2VH2 A;  3L54 A;  5D3I B;  3BWU D;  3DBH I;  2KXJ A;  1K51 A;  3HIZ A;  1JRP A;  2QSD A;  2C60 A;  2KWV B;  3W9C B;  2QCZ A;  1C4A A;  5FKA C;  4C00 A;  2V3P A;  2NCN A;  1WJ4 A;  1SBB B;  3J9C A;  2Z8L A;  2LMC A;  2WDV B;  1UBI A;  1YJ1 A;  2IGG A;  2N0S B;  1E9M A;  4B0M A;  3BY4 B;  3Q69 A;  2YLM A;  2M17 A;  4ZRI A;  5GXG B;  2Y5B B;  4FUL A;  1QKZ A;  3P63 A;  3EA6 A;  1UNS A;  3AEA B;  2IO1 B;  3KUC B;  1VLB A;  5BMI A;  3I63 C;  3R3M A;  3M62 B;  5FR3 A;  3LXF A;  2X38 A;  2RPV A;  3FC4 A;  3K9P B;  1SIF A;  2W3R A;  3KH0 A;  1XO3 A;  2MSE D;  1MFW A;  3DOW A;  4EZK A;  3KQ4 A;  5IOI A;  1V2Y A;  1OFF A;  4LDT B;  5CTR C;  3QX1 A;  1NDD A;  3Q3O C;  4GDL A;  2MRP A;  2NPT B;  1J19 A;  1WZ0 A;  5E6N A;  1NEK B;  2LI5 A;  2OJR A;  4XDC A;  2FE8 A;  2M8S A;  3NZS A;  3PT2 B;  3U4E G;  1ROE A;  1WX7 A;  1UEL A;  2V4L A;  5E6P A;  2AQ1 B;  3RPF C;  1FCC C;  5BO4 B;  5EE9 A;  1RM6 C;  3LYY A;  1HEZ E;  2AQ3 B;  4IKG A;  2WGS A;  1F0Z A;  3FIL A;  1B9R A;  1WR1 A;  4S17 A;  4GIV A;  2N7E A;  2J7Q B;  2MP2 A;  4P6V F;  3P2B A;  3ZO5 B;  2PEA A;  1WMH B;  4MJS A;  1D6E C;  3ZJU A;  3I57 A;  3AEF B;  4FXC A;  2YEP B;  3B9J A;  2E3T A;  3BIN A;  2V9H A;  1RLF A;  4HK2 A;  4EKU A;  2ZNV B;  4NAM A;  3EFU A;  1PGB A;  3L17 A;  3IG3 A;  1IPG A;  3N32 A;  4DDI D;  2DEN B;  1N61 A;  3BZD B;  2LGD A;  3BVZ A;  3ZVV A;  1QQR A;  2C9W B;  3ZNI D;  3ML8 A;  2KT7 A;  1WGR A;  2JSV X;  1P7E A;  2MJE A;  1ZUD 2;  3SDL C;  2RMM A;  3AEG B;  2RDH A;  4IUM B;  3H8H A;  1XEE A;  1WY8 A;  2INC C;  2KQS A;  4FN2 A;  2BWF A;  1JQ4 A;  2IJ0 A;  3OJ3 A;  2O6V B;  1OTR B;  2KFJ A;  3ABV B;  1FMA D;  3U52 E;  4K7W A;  4W9G A;  5DPR A;  3RI7 C;  1PQS A;  4C4V B;  1V6E A;  2CS4 A;  4IM0 A;  4BKS A;  4CO7 A;  3A9J B;  1WM3 A;  3VTW A;  3TEY A;  2FCN A;  3H7P B;  3PGE A;  3MC8 A;  3BVM A;  3W5U B;  2LRW A;  5AUK A;  3V05 A;  2LAS A;  2KVZ A;  4OHJ A;  2KMC A;  3DVG Y;  2N4F A;  1WZ3 A;  2BYV E;  2DLB A;  3DBS A;  4HCN B;  2QIE B;  3VTU A;  2HD5 B;  2JU6 X;  2L52 A;  1C1Y B;  4WJO A;  3B2F A;  1ZOY B;  3APD A;  1C9F A;  1E8Z A;  2DWQ A;  3QA8 A;  3RNE C;  2XEW A;  4MEL A;  4GB9 A;  3D32 A;  2J0J A;  3ENE A;  2N9X A;  1T0Y A;  3K9O B;  4IOI E;  2G3Q B;  4IWO A;  2RPQ A;  3E56 A;  2KJ6 A;  2KMM A;  2ON8 A;  1YQ3 B;  3MHS D;  4GGQ A;  1XCQ L;  2AEH A;  5EDS A;  4PYU A;  1WR6 E;  5T8I A;  4B0E A;  4XGA B;  1YMH E;  4RF0 A;  3IT4 B;  4ZRK A;  1LQB A;  3RT3 B;  3PHX B;  4A9A A;  3KWV A;  1FRD A;  3Q3N C;  5JH5 C;  4MGK E;  5CHF A;  3SU8 X;  4ICV A;  1TBE A;  2M0A A;  1UGJ A;  1ZXH A;  4GDL B;  1AYF A;  1RWS A;  2L05 A;  1L4Z B;  4XWW A;  1EM7 A;  2DYO A;  4GXB A;  3IAS 1;  5D6J B;  1TZ1 A;  1MPE A;  1AWD A;  3EHV A;  3QAR A;  2K9X A;  3FIL B;  3N30 A;  4A90 A;  4A55 A;  4HJG E;  2M56 B;  2RDG A;  2WLB A;  2MP2 B;  2MHJ A;  1J7C A;  3JVZ X;  3DWG C;  2PJH A;  1V86 A;  1KH0 A;  4MJS B;  4RGM A;  2JWZ A;  5D2M B;  4FLH A;  4NJC A;  4A20 A;  1QLB B;  2WXQ A;  4NZL B;  4PS7 A;  4HXD A;  1FPY A;  4LNO A;  1ZE3 D;  4W9J A;  4PT5 A;  4X57 B;  1WXS A;  1FO4 A;  2BBC A;  1NVI D;  2ZPN A;  2GBM A;  3NVZ A;  3A4R A;  1NI2 A;  3TCA A;  2R2O A;  2V4I B;  3A33 B;  2KHW B;  2NVU I;  2WXP A;  2KO3 A;  1Y56 A;  4MGZ E;  4ARC A;  2ZW0 A;  4G11 A;  5DPT A;  4MEM A;  2WYQ A;  1NYR A;  2KNB A;  1WJN A;  3I3T B;  1HZ6 A;  4AS1 A;  4EUT A;  3WAP A;  2EKI A;  3A4S C;  3DBR B;  4ASW C;  4P1B C;  3ONS A;  3HVD A;  3DVN V;  4TSS A;  2G45 B;  2AYO B;  1FFU A;  4GMV A;  1WGD A;  2HE7 A;  5H92 C;  1R7S A;  1YJI A;  4YSY B;  2V3S A;  4F1S A;  3AEB B;  1TKE A;  3DCG A;  4MH8 A;  4RM8 A;  3PLV A;  3S2A A;  2XK5 A;  4YTM B;  3R8B A;  1MJD A;  1HQR D;  4RFB A;  1HTQ A;  1VZ6 A;  2FCM A;  1NEN B;  4HPP A;  4FJY A;  3VXW A;  3Q8C A;  5LXH A;  4RH6 A;  1I4Q A;  4USA A;  3WIM A;  2RR9 A;  3IAM 1;  2MCN B;  4EE2 A;  1WJU A;  1JCK B;  2Q5W D;  2KDI A;  2R2Q A;  3ZDT A;  3H6N A;  4ANX A;  3W1Y A;  2NTS A;  2H88 B;  1KTK A;  1UH6 A;  1Z5S B;  1XD3 B;  3GS2 A;  1Q1O A;  1WXA A;  3IVF A;  4ARI A;  5G2N A;  1MHX A;  4P1C C;  3AE4 B;  3LB8 C;  1L6U A;  3VDZ A;  2IND C;  2BKR B;  4L23 A;  3TEW A;  4ZOH C;  2XBB C;  1T5X D;  1SJE D;  1EWC A;  4GLS C;  2BVC A;  5G5G A;  1V5T A;  4DHJ D;  3W1S A;  1D5Z C;  2GB1 A;  1P0R A;  3NZU A;  3RN9 C;  4K7S A;  1RFK A;  1A5R A;  2LGI A;  1E5W A;  1VZ7 A;  4PS3 A;  4TQ0 A;  2CR5 A;  2WNM A;  1I7H A;  1KLU D;  3IHP C;  4FHJ A;  3PO0 A;  2BPS A;  4OVV A;  1WRI A;  3ZXR A;  1E8W A;  2Y3A A;  3HVZ A;  1SJH D;  4ANW A;  4FHK A;  4C7Y A;  3KVF B;  4ZYS A;  1V1O A;  3ZDM C;  3WAO A;  4KSK C;  2WXG A;  2WXL A;  1P3Q U;  1JWS D;  1GJZ A;  1NI3 A;  3WAL A;  4G50 A;  2CU1 A;  1KM7 A;  1C77 A;  5D3D A;  4D2K A;  2L8J A;  4XZ4 A;  1WGK A;  1OEY A;  3AU4 A;  5HHD G;  4AQ7 A;  1OQR A;  2KZR A;  2LGY A;  4HPM B;  5HKH A;  2IDY A;  4WQO B;  3CMM B;  5TSS A;  3PRE A;  4J3O D;  4A3O A;  4GN1 A;  2MLB A;  4NQK E;  1ACC A;  5BYS A;  2ZJD A;  1T3Q A;  1V5O A;  2JZ3 B;  2A5U A;  2FUH B;  1FNW A;  2PKO A;  1N62 A;  2PE6 B;  1EF5 A;  1ENF A;  3QWZ B;  1TS4 A;  4ZYN A;  4WH4 A;  3GE8 C;  2LGS A;  4I6N B;  1EU4 A;  1D3Z A;  2MBB B;  3P4S B;  3A9K A;  3VUW A;  3P42 A;  3DBR I;  3ZUN A;  4HPL B;  2KOX A;  4IDI A;  1TKY A;  1N5X A;  4IW0 A;  2WU2 B;  3U8Z A;  3PRP B;  4WAA A;  5HG2 A;  4BZA A;  2XK5 B;  3V6E B;  1TS3 A;  3N20 C;  3DHI C;  2JX5 A;  4JQW C;  2QEJ C;  1L6V A;  2GLS A;  2I38 A;  3VR8 B;  3ZXV A;  3TL5 A;  2BS2 B;  2MBQ A;  2CHX A;  2JWU A;  2JY6 A;  2DZJ A;  2L00 B;  2WXI A;  3R2T A;  4C7Z A;  5L83 A;  1YOV B;  2DAJ A;  3SFE B;  1GUA B;  2KDB A;  4K1R B;  1FIQ A;  3X23 A;  1WSP A;  2LUE A;  3AV8 A;  1MI0 A;  2JF5 A;  3UF8 A;  1V9J A;  2ICI A;  2GMI C;  4N6E B;  2J53 A;  1FD6 A;  1TY2 A;  4M8N A;  2JPH A;  4N59 A;  3U2S C;  2DZI A;  4MT5 A;  2D3C A;  4HDQ A;  3SHQ A;  1I4H A;  2QJL A;  1YIW A;  3FKY A;  3HM6 X;  1Z2M A;  4NNJ B;  2BS3 B;  1ZPS A;  4JGH B;  2Y5P A;  2FNJ B;  2DYM A;  2FAZ A;  2FUG 1;  4BBN F;  5IP4 D;  3VH3 B;  4ZHP A;  1CJE A;  1ZKH A;  1FXT B;  2D07 B;  1L2N A;  4JX1 C;  1JWB D;  1WE7 A;  4K81 A;  4JWU C;  3HHM A;  4ZRQ A;  4ANV A;  1AN8 A;  1SE3 A;  3N1X C;  4YXD B;  1J0G A;  4XE0 A;  2V1Y A;  4W9I A;  3ZJT A;  1E0Z A;  1E6E B;  2KAJ A;  3O13 A;  2BB6 A;  2MEK A;  1U4A A;  2EMS A;  1WX8 A;  2NBV B;  1SXT A;  4JL9 A;  4BOZ B;  3NVV A;  4H2A A;  4AJW A;  1TS2 A;  4HKZ E;  1CZP A;  4K3B A;  1K52 A;  3AE9 B;  1I4G A;  3MC0 B;  2EEL A;  4M00 A;  1V97 A;  2VZK D;  3OAW A;  3ZJV A;  4FJZ A;  3UGB B;  2IBI B;  4K3C A;  2MA9 B;  3RZF A;  1V81 A;  1F9J A;  2KN5 A;  4MGI E;  5LNK 1;  3Q8F A;  3SD5 A;  3OWE B;  1ISN A;  2NBU A;  2BS4 B;  2MBO A;  4KZC A;  2N9L A;  2WXJ A;  2PW9 A;  1SB3 C;  2DZM A;  3PV1 A;  2C7M B;  2JRI B;  1E90 A;  4P7I A;  1C4C A;  1OEY J;  4M02 A;  5DPW A;  1UZX B;  1V8C A;  3N1Y C;  2M19 A;  4YL8 A;  3T9L A;  4N58 A;  4XDD A;  1WYG A;  3A9K B;  2BT6 A;  1VRA B;  4I6P A;  3DVN U;  2WXM A;  1NBF C;  3EFC A;  1JWA D;  1HE8 A;  3V61 A;  4AOF A;  1A70 A;  2GOW A;  2KJH B;  3AEC B;  4W9F A;  4LJO B;  1XLP A;  1SE4 A;  4RNA A;  1QF6 A;  2OED A;  4PK1 A;  1UD7 A;  3E9S A;  5J17 A;  4AJY B;  1XCT L;  2HJ1 A;  3JSV A;  2HJ8 A;  4K7U A;  1M94 A;  1R4M I;  2KX0 A;  2SAK A;  1PGX A;  3QJZ A;  2CJO A;  4LNI A;  4DXF A;  4TKN A;  4YTP B;  2FIF A;  1YN3 A;  2JXT A;  4NJ6 A;  1WIA A;  2ZW1 A;  2GBR A;  2L7R A;  1FXA A;  5JZE B;  1KRH A;  3EEC A;  3WA0 A;  3ZW3 A;  4BOS C;  2D11 A;  4W9C A;  3AE7 B;  2WXR A;  1DYQ A;  2MQJ A;  4S0R A;  3PHW B;  2M1M A;  1E7U A;  1TJE A;  1EF1 A;  3GZN B;  1ZDX A;  3PZ7 A;  3VRB B;  2WS3 B;  1P9D U;  3GOE A;  2L76 A;  4WIP A;  3ZQ4 A;  2WXF A;  2BYF A;  3NVW A;  2KTF A;  3RNB C;  3TEX A;  4WAF A;  3WCQ A;  3ML9 A;  1KOT A;  2KDF B;  1GOZ A;  2LVO A;  1FM0 D;  1DOX A;  3DDC B;  5CHW A;  4JLC A;  2C7N B;  1XLO A;  3IXS A;  2KWU B;  1IGC A;  1L4D B;  2HTM E;  2DNF A;  4YT0 B;  4A6Q A;  3RCZ A;  1AAR A;  1UUP A;  3BVG A;  5AUI A;  2LGX A;  2BYT A;  2HTH A;  2IZV B;  4OW0 A;  2D5G A;  1WYW B;  2MH7 A; 
#chains in the Genus database with same CATH homology
 4YWG G;  4A8X C;  3V3X A;  2ACZ B;  3BYT B;  2NTS A;  3Q8A A;  2H88 B;  1C76 A;  4HRO A;  4L2Y A;  4Q2J A;  1KTK A;  2V0G A;  4JPS A;  1BUI C;  2LHE A;  3NUH B;  1FNU A;  3GS2 A;  1J7A A;  4M0W A;  4OZB A;  2K0P A;  4JE3 B;  1IUE A;  1QOG A;  1BML C;  4ITK A;  4ARI A;  2W55 A;  1MHX A;  3TSS A;  4GDK B;  1IBX A;  4HKQ A;  3AE4 B;  3LB8 C;  5D3I B;  1L6U A;  3BWU D;  1ZXI A;  1K51 A;  2INN E;  2LFI A;  4L23 A;  3TEW A;  1JRP A;  2TSS A;  2QSD A;  3T3N A;  4ZOH C;  3W9C B;  1T5X D;  3GP7 A;  1C4A A;  1SJE D;  5FKA C;  2V3P A;  1EWC A;  4GLS C;  1T6B X;  5G5G A;  3W1S A;  2WXK A;  1D5Z C;  2GB1 A;  3R2I A;  1SBB B;  3J9C A;  2Z8L A;  2LMC A;  1RFK A;  2WDV B;  2LGI A;  4OVZ A;  1VZ7 A;  4TQ0 A;  1HA5 A;  2WNM A;  1I7H A;  1KLU D;  2IGG A;  4DXG A;  1OQQ A;  2N0S B;  1E9M A;  4B0M A;  3PO0 A;  1F77 A;  3Q69 A;  1QOA A;  1WRI A;  3B2G A;  1FXI A;  5GXG B;  2Y3A A;  4ZRP A;  1XLQ A;  1SJH D;  3HVZ A;  4C7Y A;  1QKZ A;  3P63 A;  4ZYS A;  1V1O A;  3EA6 A;  1UNS A;  3AEA B;  2QMT A;  1GB1 A;  1TS5 A;  2VZK B;  1RYJ A;  1VLB A;  2WXG A;  1ET6 A;  1VJK A;  2WXL A;  2QIL A;  5BMI A;  2N7J A;  3AH7 A;  1B1Z A;  5FR3 A;  1MVK A;  1JWS D;  3LXF A;  2X38 A;  3MP9 A;  2RPV A;  3FC4 A;  5I4D A;  2W3R A;  3BII D;  1NI3 A;  1ZDV A;  2W82 A;  3C8Y A;  1XO3 A;  1JRO A;  3KQ4 A;  1FCL A;  1OFF A;  1C77 A;  5D3D A;  4D2K A;  1F2R I;  1HZ5 A;  1WGK A;  2AX5 A;  5HHD G;  4AQ7 A;  2G1E A;  5D7G A;  3UI3 A;  1OQR A;  1NEK B;  4RGT A;  1YN4 A;  4XDC A;  2FE8 A;  4KGS A;  3U4E G;  1ROE A;  2WP9 B;  2IDY A;  5TSS A;  5HFY A;  4J3O D;  1DOI A;  1PDX A;  2AQ1 B;  3RPF C;  2LHD A;  1FCC C;  5EE9 A;  5JXV A;  1RM6 C;  3LYY A;  1YNT E;  1HEZ E;  1YN5 A;  2W54 A;  2MJ3 A;  1ACC A;  2AQ3 B;  1KF6 B;  1P7F A;  1T3Q A;  3P4P B;  4IKG A;  5BYS A;  1F0Z A;  2K5P A;  2Y5C A;  3FIL A;  1B9R A;  1D4B A;  2PIA A;  1I4X A;  3FAH A;  1FNW A;  5C2T B;  2PKO A;  1TZO A;  1N62 A;  2INP E;  1ENF A;  3GB1 A;  1E7P B;  4KGT A;  1TS4 A;  4P6V F;  2K22 A;  4WH4 A;  3RFZ B;  2BB5 A;  2H89 B;  1EU4 A;  4CQN A;  2MJD A;  1YJJ A;  1L0V B;  3P4S B;  3AE8 B;  3TEZ A;  2WQY B;  1D6E C;  3ZJU A;  3I57 A;  2WDR B;  3AEF B;  3MFG A;  4FXC A;  3P42 A;  2YEP B;  4IDI A;  3B9J A;  2WXH A;  2E3T A;  1TKY A;  1N5X A;  1FEH A;  1WWT A;  2WU2 B;  4NAM A;  1L0X B;  2K3U A;  2L83 A;  1PGB A;  3AE6 B;  4RCO A;  5BYR A;  5HG2 A;  1EWY C;  1SEB D;  3NVY A;  1TS3 A;  3AMZ A;  2KWD A;  2JX5 A;  1WXQ A;  2QEJ C;  2KAC A;  1I4R A;  1L6V A;  1N61 A;  3BZD B;  3BVZ A;  1QQR A;  2I38 A;  3VR8 B;  3PZ8 A;  3NS1 A;  2JSV X;  2GRI A;  2WXO A;  1P7E A;  2MJE A;  1GB4 A;  1ZUD 2;  3KLS X;  1ET9 A;  2BS2 B;  2KQ4 X;  2RMM A;  3AEG B;  2RDH A;  2JWU A;  1XEE A;  3H8H A;  3N9Y C;  4OZA A;  3URY A;  3BK1 A;  2WXI A;  3CWI A;  3R2T A;  1JQ4 A;  2IJ0 A;  3BK2 A;  4C7Z A;  1KLG D;  2XN9 C;  3SFE B;  3L4P A;  3ABV B;  1Q10 A;  1FMA D;  3U52 E;  1JWU D;  4LTU A;  5BMG A;  1FIQ A;  3AE1 B;  5BYQ A;  3NZ3 A;  4US8 A;  1JWM D;  1WSP A;  1JW9 D;  3AV8 A;  4JWS C;  1MI0 A;  3SEB A;  3W2D A;  4REZ A;  4C56 C;  2ICI A;  4P16 A;  4N6E B;  1NYQ A;  2WU5 B;  2J53 A;  1FD6 A;  3TEY A;  1TY2 A;  3SFD B;  1DOY A;  1PFD A;  4MAC A;  2PVG C;  3BVM A;  3W5U B;  4N59 A;  3U2S C;  3VQI A;  3EGR A;  4MT5 A;  5AUK A;  1GAQ B;  3MHZ A;  1C4P A;  5H8Y E;  1V1P A;  3V05 A;  4OHJ A;  2DLB A;  2J42 A;  1I4H A;  2QJL A;  2QIE B;  1IBX B;  3IT6 B;  2JU6 X;  2BS3 B;  2L52 A;  1ZPS A;  3B2F A;  1QIL A;  2Y5P A;  1ZOY B;  2V3N A;  1C9F A;  2DWQ A;  4WUR A;  3ZYY X;  4WWM A;  1CK1 A;  5E6J A;  2DYM A;  2R61 A;  5EE1 A;  2FUG 1;  4KKJ A;  5EE0 A;  2PTL A;  4ZHP A;  1CJE A;  4LLG M;  4IOI E;  3AB5 A;  4TMA B;  1YQ4 B;  4JX1 C;  3E56 A;  2KMM A;  1JWB D;  1F2R C;  1SE2 A;  4JWU C;  2ON8 A;  1YQ3 B;  4ZRQ A;  1AN8 A;  1SE3 A;  1XCQ L;  4YXD B;  4XE0 A;  4YSZ B;  3ZJT A;  3SR6 A;  1E0Z A;  1E6E B;  2KAJ A;  3O13 A;  4C80 A;  2BB6 A;  1FRR A;  4YSX B;  5T8I A;  4B0E A;  1QT9 A;  2MEK A;  1YMH E;  2KDM A;  1XLN A;  1VZ8 A;  4RF0 A;  3IT4 B;  4HEA 1;  1PYW D;  1SXT A;  2PVO D;  1AW7 A;  1D5M C;  2WDQ B;  3NVV A;  4H2A A;  2JQR B;  4A9A A;  2CJN A;  3KWV A;  1TS2 A;  1FRD A;  2KN4 A;  4HKZ E;  1CZP A;  4XWT A;  2FBW B;  1LO5 D;  1K52 A;  3VRA B;  1XF5 L;  3AE9 B;  1I4G A;  3MC0 B;  2EEL A;  3P1M A;  1PGA A;  4RF1 A;  1V97 A;  2VZK D;  4HRS A;  3ZJV A;  2M0A A;  2N9K A;  1UGJ A;  3AE2 B;  3KWL A;  1STE A;  4YTN B;  1ZXH A;  1TY0 A;  4GDL B;  1AYF A;  5C3J B;  1RWS A;  4L1B A;  1L4Z B;  3P4R B;  4XWW A;  5LNK 1;  3Q8F A;  1EM7 A;  2DYO A;  3AM9 A;  3IAS 1;  1BXT A;  3OWE B;  1K50 A;  1TYG B;  3AE5 B;  2DBY A;  1MPE A;  1AWD A;  2J4X A;  3AED B;  1QOF A;  2BS4 B;  2LJI A;  1ESF A;  1L0Y B;  2K9X A;  2JYE A;  3FIL B;  1N5W A;  2NTT A;  2NMQ A;  1D5X C;  1SIJ A;  4A90 A;  2N9L A;  4A55 A;  3AEE B;  1IGD A;  2WXJ A;  2PW9 A;  4HJG E;  3T3O A;  1SB3 C;  2M56 B;  1L5P A;  3ETR A;  5MPO A;  1C4C A;  4KKI A;  2RDG A;  4UDU C;  1HXY D;  3U7Z A;  2WLB A;  1C79 A;  4DQO C;  1J7B A;  1V8C A;  2GI9 A;  1SSN A;  1J7C A;  2M19 A;  3TUO A;  3DWG C;  3AE3 B;  1JAL A;  2I2Y A;  1KH0 A;  4N58 A;  4XDD A;  2SEB D;  4RGM A;  1WYG A;  2BT6 A;  1VRA B;  1DGJ A;  1EU3 A;  2WXM A;  1JWA D;  4NJC A;  1FFV A;  1K53 A;  1I4P A;  1JML A;  1QLB B;  2W3S A;  2WXQ A;  5G5H A;  4NZL B;  1A70 A;  2E6X A;  1XXG A;  1ZE3 D;  3AEC B;  4PT5 A;  4O1N A;  1XLP A;  1SE4 A;  4RNA A;  2JZP A;  1QF6 A;  2OED A;  3NRZ A;  1FO4 A;  2BBC A;  1NVI D;  3E9S A;  2IGH A;  3NVZ A;  3HUI A;  2YEP F;  1GPX A;  1TKG A;  2V4I B;  3EUB 2;  2WXP A;  1XCT L;  2L32 A;  1Y56 A;  4R3D A;  1QOB A;  4ARC A;  2ONQ A;  2BW2 A;  2ZW0 A;  2BTE A;  2L1A A;  4KGR A;  1NYR A;  4LK0 M;  2SAK A;  1HZ6 A;  1PGX A;  2WXN A;  4WQM A;  4AS1 A;  4US9 A;  4RGN A;  2LEK A;  2CJO A;  2EKI A;  3W5V B;  1VR9 A;  3AN1 A;  4DXF A;  4YTP B;  1YN3 A;  2JXT A;  3HRD D;  1UWM A;  3P4Q B;  4RGO S;  2ZW1 A;  3HVD A;  1FXA A;  1KRH A;  3DWM A;  4TSS A;  3ZGZ A;  3AE7 B;  1FFU A;  2WXR A;  1DYQ A;  2G9H D;  5BMH A;  2AQ2 B;  4OZC A;  1E10 A;  1CQV A;  1R7S A;  1TJE A;  2JYT A;  3MJ5 A;  5H92 C;  1YJI A;  1ZDX A;  2PLP A;  3PZ7 A;  1C78 A;  2OHF A;  2WS3 B;  3VRB B;  4YSY B;  3AEB B;  1TKE A;  5HI1 A;  1V1P B;  4MH8 A;  4WIP A;  1VDV A;  3ZQ4 A;  4YTM B;  2IGD A;  4NAW B;  3R8B A;  2WXF A;  1N63 A;  1N60 A;  1HQR D;  2PMV A;  3NVW A;  4RFB A;  1VZ6 A;  4TQ1 A;  4ZHO A;  1NEN B;  3TEX A;  4MM3 B;  3Q8E A;  4WAF A;  1SF0 A;  2J52 A;  2XNA C;  1UWX A;  3WCQ A;  2B76 B;  1KFY B;  2IPK D;  3Q8C A;  1MHH E;  1FNV A;  1GOZ A;  3I9V 1;  4RH6 A;  1FM0 D;  1I4Q A;  4USA A;  1DOX A;  2HDE A;  4KX6 B;  2LUM A;  5FK9 C;  3IAM 1;  1PUT A;  4EE2 A;  1JCK B;  5EE3 A;  1XLO A;  2Q5W D;  3IXS A;  1IGC A;  1L4D B;  2HTM E;  4YT0 B;  4A6Q A;  1M4V A;  2CU3 A;  3CIR B;  1UUP A;  3BVG A;  3BYY B;  5AUI A;  1ZP0 B;  3Q8B A;  2BYT A;  4OW0 A;  2D5G A;  3VR9 B;  2MH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...