4OZAA

Backbone modifications in the protein gb1 helix: beta-3-ala24, beta-3-lys28, beta-3-gln32, beta-3-asp36
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
52
Chain Sequence
b'DTYKLILNGKTLKGETTTEAVDATAEVFKYANNGVDGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Folding Thermodynamics of Protein-Like Oligomers with Heterogeneous Backbones.
pubmed doi rcsb
molecule keywords Streptococcal Protein GB1 Backbone Modified Variant: beta-3-
molecule tags De novo protein
total genus 12
structure length 52
sequence length 56
ec nomenclature
pdb deposition date 2014-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ozaA00
2J53A 1C9FA 1JMLA 2ZW1A 1IBXB 1K51A 4OZBA 3UI3A 3V3XA 1FCLA 2JZPA 4HJGE 4OZAA 2PLPA 1MVKA 1HZ6A 4D2KA 1GB4A 4HKZE 1QKZA 4KGSA 4IOIE 1Q10A 4GLSC 1IGDA 2LUMA 1PGAA 3FILB 2N9KA 2ZW0A 1XCQL 2JWUA 1P7FA 2KQ4X 1MI0A 4OZCA 1MHHE 2ON8A 2IGGA 2JXTA 2I2YA 3MP9A 2IGHA 1HZ5A 1PGBA 3GB1A 1PGXA 5BMGA 1D4BA 1P7EA 1MHXA 2NMQA 1K53A 1FD6A 2K0PA 2GI9A 2QMTA 1IBXA 1K52A 2EELA 5HG2A 1YNTE 2JU6X 1YMHE 1KH0A 2IGDA 2ONQA 1F2RC 2N9LA 2KN4A 2JSVX 2KACA 1HEZE 4MACA 2PW9A 1K50A 5HHDG 2LHEA 1FCCC 1UWXA 2LHDA 2KWDA 4KGRA 1GB1A 1IGCA 3FILA 2QSDA 4IKGA 4WH4A 1MPEA 5HFYA 2N7JA 4KGTA 1XCTL 2OEDA 1F2RI 5HI1A 1XF5L 1ZXHA 2PTLA 5BMHA 2KDMA 5JXVA 5BMIA 2LGIA 2I38A 1EM7A 2RPVA 2RMMA 2J52A 2GB1A
chains in the Genus database with same CATH superfamily
4TQ1A 3BYTB 3EUB2 2BVCA 2BGFA 1WFYA 3V3XA 3AU5A 1IYFA 2JZPA 3DHGC 3VHTC 3DDCB 5D2MB 1XQQA 3VR8B 3M95A 4C4VB 2KFJA 3TEXA 3AU4A 2K22A 4DXAB 2KYWA 2CHXA 1FFVA 5AZFA 2N9KA 3U2SC 3QARA 3BVZA 2QCZA 4CYEA 3PV1A 4K81A 2BTEA 1EWYC 3N1YC 3DWGC 5L95C 1WXQA 1WYWB 1UUPA 2WLBA 3ALBA 4XZ4A 3I57A 5J18A 2QMTA 2MJDA 3ZNGC 2C7HA 4JE3B 5G2NA 1SIJA 3TMPB 4NJCA 1T3QA 4OVVA 3V62A 2JRHA 2MRPA 3T8MA 1BT0A 1AWDA 3R7RA 1SBBB 1SF0A 4BAXA 1GPXA 1EO6A 2BYFA 2CU1A 1T0SC 4J3OD 2IO1B 2O2VB 4ANUA 4PYUA 3W1SA 5CHFA 3Q8CA 4GXBA 4DDID 4MGKE 1WR1A 1QOGA 1TS3A 2SAKA 4MH8A 2N7JA 4HCNB 3T3OA 3ETRA 2E6XA 2L1AA 1V49A 1WM2A 3M3JA 1WM3A 2RDGA 2E3TA 1T0QC 2N4FA 4IWPA 2CJNA 2AX5A 3AE3B 3SFDB 2ZW1A 1FCLA 4IM3A 1VLBA 1MG4A 2AYOB 3Q3JA 4HKQA 3KUZA 2MLBA 3VTVA 3PO0A 2AL3A 2CJOA 4FADA 1GB4A 3ZW3A 5KHOA 2JY6A 4KGSA 4N59A 3E56A 1RFKA 1D5ZC 2O6VA 2GBJA 2Z59B 4TV3A 1N62A 3L17A 2BWFA 5BYRA 1E8XA 5EDSA 1VD2A 4M00A 2K9XA 3C19A 4A3OA 2ACZB 1V97A 4JLCA 3BVMA 3NVWA 3TEZA 1AN8A 4NJ7A 2DX5B 1GNUA 1K52A 2AQ2B 4MT5A 3TBLD 3DPDA 1VRAB 4YSZB 1HA5A 2KD0A 4LNKA 1C76A 2N9LA 2KWUB 1N5XA 4DK5A 2MBBB 2L8JA 2WXKA 1GJZA 4C80A 4I6NB 2KANA 3MC9A 1EF5A 5C3JB 1R7SA 3ZXVA 2ZCCA 5AZGA 4GMVA 4L1BA 2KMMA 3ZJVA 3AE4B 1TGZB 5FR6A 1FRDA 4K7SA 2JUOA 1YJJA 4URKA 1FRRA 4GDKB 2D3BA 5HI1A 1ZXHA 4W9FA 3SR6A 3PHXB 4FLHA 3ZTDA 2ZZPB 1WSPA 2MBOA 4ZRPA 2LMCA 1TKYA 3X23A 3KUCB 4HCPB 2KC2A 4W9GA 1T6BX 2MEKA 4ICVA 2OJWA 3GE3C 2BPSA 3N1XC 3AB5A 3VRAB 4HJKA 4DHZE 2NPTB 2AWTA 4OVUA 2EMTA 4EEWA 4XGAB 3ZTCA 4XWWA 3BY4B 2BS2B 4L23A 4ZRKA 3FILB 1J7CA 3OLMD 2KQ4X 4K3CA 5G55A 2L05A 3CMMB 3LDZE 1WF9A 3KUDB 1RRBA 3IT4B 5CTRC 4K7WA 2DYOA 4HDOA 3Q3OC 3A9JA 1T0YA 1MHXA 2KN5A 3H1UA 2CU3A 3NVZA 4RMAA 2KK8A 4AJWA 2KDBA 1VZ7A 4II2B 5BYSA 2IO2B 3EC8A 5LLIA 1KH0A 4ZRQA 5AZHA 1IUEA 3RNGC 4BBNF 4ZHOA 3JYUA 4EFOA 1NBFC 3RNBC 2KVZA 3GP7A 2SEBD 4AP4C 4ZDVA 2LVOA 3W5VB 3VUWA 3WCQA 1JRUA 3RT3B 2ZPNA 1WJ4A 2MP2A 3SHQA 3UQBA 4E3CA 2NBWB 1XCTL 4M8MA 3HRDD 3L13A 1F2RI 3A9KA 4IM2A 1S3SG 1WGKA 1FXIA 2JWZA 3KH0A 4MGIE 1EU4A 1SE3A 1UGJA 2BS3B 2WXPA 1E8ZA 1DOXA 1SXTA 1JW9D 1OTRB 1STEA 1K8RB 1ZDVA 3ML8A 2G9HD 1P0RA 2HTME 4W9KA 3VAWA 3C8YA 1XLPA 1HZ6A 4EZKA 2DAFA 1RFAA 2C5LC 1SIFA 1F77A 4RGOS 4NQLB 4B0MA 4GDLA 4A55A 2BWES 3VUXA 1V81A 1SJED 5DPSA 2WXNA 1YQ4B 5IAAC 2BT6A 3KVFB 2I2YA 1L5PA 3DQVA 4KIKA 2DAJA 4A6QA 3K9PB 3NUHB 1CK1A 1JCKB 2LVQA 1P7EA 1OEYJ 2GLSA 4ANXA 5G5HA 3GZNB 1IP9A 3WAMA 3EECA 1XEEA 1ZDXA 2JT4B 1BXTA 1YN5A 1E90A 3ZDMC 4C4VA 3NRZA 2QJLA 3N32A 1N61A 4EZLA 2DZMA 1D6EC 3KWVA 2M17A 4W9DA 2A5UA 3HVDA 2LGDA 2N7DA 3RYTA 2W3SA 3UQAA 2N9PC 2V3NA 2YLMA 1VR9A 2GOWA 1AYFA 2MWSB 3PPAA 1ACCA 1WWTA 1KRHA 5GXGB 3AEEB 2LXCA 2WS3B 4JX1C 3ONSA 4XE0A 3A1QB 1MVKA 3KYDD 1V5TA 1OQYA 2RGFA 4JQWC 4DWFA 1WIAA 1XXGA 3L4PA 4IWOA 3AE7B 1WXVA 1TBEA 1XLNA 4MM3B 3KWLA 1NI2A 1ZPSA 5BO4B 2LRWA 2LUMA 2XBBC 2G3QB 5JZEB 3ML9A 4FA6A 2JWUA 3IVFA 2K3UA 1JWBD 2KZRA 4EZJA 3AM9A 5DCNA 3ZDTA 1NI3A 1JROA 3Q69A 3PZDA 4KZCA 2AQ1B 2MA9B 3URYA 1I4HA 3RMKC 1JWAD 1XLOA 3PLVA 3ZVVA 4OW0A 2Y5PA 2FAZA 1KFYB 3VQIA 1FXTB 4XC2A 3L16A 3TEYA 1D5XC 2FCMA 2KDIA 4RM9A 3RD2A 1OFFA 2IYDB 2DYBA 2C60A 1UWXA 1YIWA 3NZUA 4MH0E 1GB1A 4LNOA 1UGMA 1MFWA 1WI0A 3H8HA 3Q8BA 3R66C 3PRMB 3PHWB 2CR5A 3DBSA 1ZKHA 3A33B 3GOEA 2NBUA 1YJ1A 1WX7A 5JHAA 3HM6X 4HXDA 1M94A 2V4IB 1GAQB 2IY1B 3M62B 1TY0A 1E8WA 4H2AA 4MSQB 4B0EA 4IWQA 1UD7A 2RDHA 4X57B 1UELA 3WALA 4OZAA 5IO9A 1FXAA 1TS4A 3DOWA 5DPRA 1Y56A 4ICUA 2CS4A 1TZOA 3BZDB 1Q10A 4Q2JA 3IHPC 1E10A 1YJIA 1KJTA 3DVNV 4AWJA 4G3XB 3RNEC 3AE9B 4GGQA 1P7FA 4EUTA 1ENFA 2J7QB 4BBNC 1DOIA 2KX3A 2C7MB 4YXDB 5D3IB 4GDKA 3R7QA 2ON8A 1FNUA 2J0MA 1CMXB 1D4BA 2L0FA 4A8XC 4O1NA 1PUTA 3EFCA 4BOZB 3AEGB 3RZWC 2EELA 3H7SA 1A70A 4HPLB 1VDVA 2JZZA 2FUG1 3W2DA 1J19A 1EF1A 2NPTA 4NY0A 3APCA 5JH5C 4MACA 1C1YB 2N1WA 2KC1A 4RF0A 3SU8X 2V3PA 3L10B 1FCCC 3V61A 2K8CA 5BYQA 1V80A 4KGRA 2PPHA 4RNAA 2LASA 3FILA 1WMHB 3Q6BA 3NHEB 2L00B 5HFYA 1J0GA 2W3RA 4BKGA 3CF6E 3IAS1 3MTNB 1Q1OA 4DXFA 5CHVC 4E74A 3I3TB 3PRZA 1I42A 3LJ3A 3PZ8A 2DZIA 2W9NA 1IBXB 1E7PB 1WGGA 3GE8C 3IT6B 3AEBB 2PLPA 2BF8B 4LJPB 1CZPA 4USAA 2KOXA 4JGHB 3NY5A 2AL6A 1KF6B 3RN9C 3VFKA 3DHIC 1L6VA 1RLFA 4GLSC 1WX9A 2VH2A 1T0RC 3PLUA 3AE8B 1WY8A 1TYGB 4LNNA 4KSLC 4C7ZA 2G1EA 4WWPA 3MHSD 1WXMA 3NOBA 1MHHE 4FXCA 2WXRA 2B76B 1H8CA 4DHJD 3VTWA 2OOBB 2DWQA 1ISNA 3E9SA 1L0XB 1FD6A 3B08A 2KWVB 4YTMB 2DBYA 1M4VA 1WGYA 3OJ3A 3VVWB 4LCDE 1YMHE 1UBQA 3O13A 1I4GA 3QX1A 1UWMA 2D10A 1FM0D 1SB3C 4W9LA 3RPFC 4B9KA 2PE9A 4US9A 1MJDA 3U7ZA 2LHDA 4PS3A 4WQMA 1IGCA 4MDKE 4W9HA 4NAWB 2HTHA 3W5UB 4DBGA 4F1SA 4WH4A 2KJHB 3AMZA 5FKAC 2K8BA 2ASQA 2FNJB 4HPPA 2Y3AA 3TSSA 1ET6A 4ARIA 1V1PB 3DBRI 2N9XA 3AECB 4XDCA 2MBHA 3DBRB 2QHOA 1TZ1A 2KVRA 1WE6A 1TIFA 2KDEB 1V1OA 4GIVA 3R8BA 3LYYA 4HVBA 3PRPB 1FEHA 2M19A 2WXMA 1F0ZA 4A3PA 2N7EA 1I4PA 2A4ZA 4IC7B 2DENB 4IOIE 1JWUD 5LXIB 2NVUI 2BB6A 1PQSA 4DQOC 1IGDA 3EFUA 3VH4B 2D3CA 3WAPA 1XCQL 2K6DB 4ZRIA 3I5JC 1AW7A 2LGYA 4LDTB 4FHKA 4PYZA 1I35A 1TS2A 2IGGA 3IAM1 3TUOA 1JQ4A 2CHZA 2LGSA 5MPOA 1TT5B 1HE8A 2DLBA 1KLGD 4MELA 2EMSA 4M0WB 3A4RA 2GBRA 2KQSA 4JWSC 5FK9C 2WXOA 2WU2B 2M1MA 1UNSA 5HG2A 3QCAA 5E6JA 2DNFA 5AUKA 3FAHA 2LXAA 4M01A 3A1QA 2Y5CA 3H6NA 3MFGA 3TIXA 1VZ6A 4WJNA 2MJ3A 1QT9A 3K9OB 2R2OA 2WDRB 5HHDG 4WAFA 2KJ6A 4MM3A 1OGWA 2WHIA 4ZYSA 3WA0A 2CKHB 4LNFA 4WJQA 2PVOD 1WRIA 2IJ0A 1NYQA 5BMHA 5JXVA 1B1ZA 2FBWB 1EWCA 3R2IA 1N6ZA 3B9JA 4HWIB 1R4NI 1IPGA 1FPYA 4C56C 1R4NB 1Q5WB 1L0VB 2FUHB 1JMLA 2WYQA 4K1RB 1YD8U 2LZ6A 4NAMA 3JVZX 3ABVB 3RULA 5C2TB 4QAYA 2K5PA 4AOFA 2JVCA 5EE0A 1I4XA 4N6EB 5E6NA 2D3AA 2ZEQA 3MHZA 3DWMA 2JRIB 2JXXA 2NS5A 2CHWA 4FN2A 4BVUC 2BYEA 1YN4A 3NZSA 3DHHC 4KKJA 1C3TA 2DYMA 4M02A 3MP9A 3B1LX 1DYQA 3WANA 2IZVB 1PGXA 4FHJA 1SE9A 3QIJA 2OHFA 3ZQ4A 3WAOA 2JF5A 1GC7A 1Z5SB 3AULA 3NVVA 2LJIA 3IG3A 2JU6X 3CSTA 1V9JA 2L76A 2VRRB 2X8XX 2J4XA 4NZLB 1VCBA 4W9IA 2MQJA 5EE9A 4ZYNA 5D6JB 3ZO5B 1FNWA 4FJYA 4LJOB 3PGEA 2GMIC 2L83A 3UIPB 2XK5B 1D5MC 4EOYA 1P9DU 2BYTA 4KDLB 3BK2A 4KKIA 2NR2A 1J7AA 3TL5A 3BVGA 4RF1A 2QSDA 3KQ4A 4A20A 4WJPA 5IN7A 4DDGD 1ZOYB 3DVNU 4AS1A 4ZHPA 2I38A 3OWEB 2C7NB 5C1ZA 2RPVA 3ZGZA 1V86A 2KXJA 1GG3A 2K1FA 1NYRA 2FCQA 1XD3B 1C4AA 1NVID 2ZJDA 4RGTA 2J0KA 1WGHA 1J7BA 2C9WB 2AQ3B 3MJ5A 4OZBA 3ZRFA 2L52A 4DHJB 3Q2AC 3PS6A 1JRPA 3OAWA 1WZ3A 4PS7A 1UBIA 2Q5WD 1YOVB 2KTFA 2INPE 2WQYB 3IBEA 2N9EB 2WDVB 3VRBB 3QQ8B 4KV2A 4LK0M 3TCAA 4RGMA 2JPHA 1I7HA 1L6UA 5JHBA 1R4MI 4OVZA 4BKSD 1WMHA 4JWUC 1TY2A 3O65B 3AE6B 2HE7A 5J2RA 1WGDA 2YEPF 1OQQA 1SE2A 4P16A 3S2AA 3UF8A 4ACFA 3TEWA 2LUEA 2QC8A 1RWSA 1WJ6A 3FKYA 4TMAB 1P1AA 2XNAC 3QC8B 4WJOA 3PT2B 2L0TA 1K53A 3QAQA 2L32A 3P4PB 2HJ8A 3OG5A 1IBXA 2M8SA 2D2QA 4KX6B 1ZUD2 3ZKJC 2WX1A 3I63C 4R3DA 3P2BA 4HRSA 4K3BA 3M63B 2X38A 2M56B 3QHTA 2LFIA 3NZ3A 3VDZA 2FCSA 1QLBB 1H4RA 4HK2A 5EE3A 1KTKA 4S17A 2L7RA 1UZXB 3AN1A 4K7UA 1EU3A 4DHZB 1CQVA 2LRUA 4PT5A 1ZXIA 3PSEB 3UINB 3U52E 3IXSA 4P1BC 2KDFB 4G11A 4B95A 4F8CB 1ROEA 2LEKA 2LVPA 3P4QB 2DZJA 2BW2A 2INCC 2J42A 3W1SC 5TR5A 5I4DA 3MC0B 1WR6E 1JALA 3PTFC 2DHZA 2RR9A 4ANWA 4NQKE 3P63A 1U4AA 3N30A 1SJHD 4W9JA 1JWMD 4II3B 2KT7A 2PEAA 3U8ZA 2H88B 1ZP0B 2PIAA 3U30A 1JWSD 4KDIC 3MJWA 3KW5B 5J17A 5FR3A 5HKHA 2FE8A 5LXHA 1X1MA 4NAWA 3AE5B 1TKGA 1LXDA 1J8CA 3T3NA 1C4PA 4AJYB 2WU5B 1KM7A 1C4CA 2V4LA 4DXGA 1V1PA 1L2NA 1MG8A 2PJHA 2KKCA 2L3ZA 3X0WA 3N9YC 4RFBA 2K0PA 1OQRA 4ANVA 2M0AA 2ONQA 2UU7A 3DBHI 3C0RB 1QQRA 2JSVX 1C78A 2HJ1A 3DBHB 4HDQA 4N58A 3FC4A 1HEZE 1HQRD 1Y8RC 4TKNA 1LM8B 4G0NB 3AV8A 3H9DA 1TS5A 4REZA 4A90A 1V6EA 2QEJC 2Z0DB 2BKFA 1SEBD 4HLEA 2DZKA 1E0ZA 2VH1A 3L0WB 2JYEA 2IO0B 3V6CB 1L4DB 2K25A 4BZAA 2WGSA 2JQRB 3HHMA 2I1KA 1XF5L 3HVZA 4RGNA 2KDMA 2W55A 5D94A 5D3DA 2ZNVC 3LB8C 4M0WA 4TSSA 1V8CA 3AEFB 1E7UA 1WX8A 3ZUNA 4B6WA 2O6VD 3RNAC 1AARA 4A9AA 2KO3A 3RCZA 2MX2A 2BS4B 1WE7A 2G4SA 2W82A 3SDLC 4EE2A 3AEDB 3I9V1 2NBVB 4NJ6A 1PFDA 2V3SA 3RNFC 4CO7A 1KLVA 3APDA 2QDFA 1MI0A 2IPKD 3EA6A 4E71A 4MJSB 2JXTA 5G5GA 2KTRB 4WAAA 5IKCM 3GS2A 2FIFA 1LGRA 5BMGA 1D3ZA 3VUYA 4IDIA 2Z8LA 4XDDA 2KFKB 1XLQA 1FO4A 1V2YA 2KNBA 3T9LA 3ZNHB 2GRIA 3BINA 3BK1A 4FJVB 2W54A 4CQNA 2IBIB 1L4ZB 1GC6A 2PW9A 2V0GA 3CWIA 3N3KB 1WH3A 3BWUD 4KSKC 4XX5A 2MSED 2MHJA 2KWCA 2Z0EB 1QOAA 4GN1A 2ZVOA 4PS8A 2BYVE 1FFUA 2WNMA 1E6EB 1C79A 4LLGM 1SE4A 1TKEA 2Y5BB 1PYWD 4ITKA 3QJZA 2LD9A 3PZ7A 4US8A 1YX5B 2J53A 4I6PA 1C9FA 4G50A 2K39A 4W9CA 2PE6B 3ZXRA 3ZLZA 3H7PB 1LFDA 4F7ZA 3ECIA 3QWZB 2VZKD 1OEYA 2JX5A 3R2TA 3JSVB 4WWOA 1E5WA 1QOBA 1DOYA 1T5XD 3Q8FA 3Q3NC 3RI7C 4HPMB 4JL9A 1QKZA 2XK5A 4J6IA 4FBJB 3AEAB 4WQOB 2K6QA 4FULA 3ZYYX 1EUVB 1YQBA 4WIPA 1PGAA 3HUIA 4N9F4 3PREA 1XT9B 3D32A 5DPTA 1UH6A 4P6VF 4WWMA 4YSXB 1FMAD 2INDC 3VH3B 3KLSX 2G45B 3RZFA 4MSMB 2OJRA 3HIZA 1NENB 1N5WA 1RAXA 4LNIA 4BFRA 3WIMA 4P7IA 1FIQA 2M4NA 2BBCA 2R61A 4XYCA 1DGJA 1XO3A 2GBKA 1HTOA 2WP9B 4MGYE 1I4RA 3DVGY 1S1QB 4IKGA 3PVLA 3QA8A 1MPEA 2FCNA 1N60A 2IDYA 1RM6C 3L08A 2MBQA 3DCGA 3P42A 2QILA 2IO3B 1E7VA 1G6JA 2LGIA 3QK0A 2G4DB 4KZ0A 5TSSA 2ICIA 3HK0A 2GBNA 4MEMA 3CIRB 3KYCD 1P3QU 1Q0WB 2YVCA 1F52A 4RCOA 2JYTA 2J0JA 1WJUA 2XN9C 2GBMA 3Q14C 3TJPA 2EKIA 3AE2B 2I1JA 2KLGA 3U7DA 2B3AA 1SSNA 2NTSA 3W9CB 1RYJA 3W1YA 5IA7A 3AH7A 2XEWA 1FNVA 2WX0A 4C00A 2D3GA 1KLUD 2NTTA 3B2GA 2NCNA 2UYZB 2WDQB 4OZCA 3NS1A 2IGHA 2HD5B 1ESFA 1HZ5A 2D11A 2WXJA 2PVGC 3DBLI 2WXGA 1NEKB 2V9HA 1TTNA 2WWZA 2ZVNA 5D7GA 3DBLB 3IFWB 3ZNZB 3VR9B 3EHVA 2WXFA 3Q8AA 5C23A 5AEKB 3P4SB 3RFZB 1QZEA 1A5RA 5IOIA 2KHWB 4CHKA 3EGRA 2MCNB 5E6PA 1ET9A 3ZJTA 4YSYB 4MGZE 1TJEA 3ZNID 1GUAB 2O6VB 4NPNA 5T8IA 2D5GA 1HTQA 3DVGX 4ASWC 3B0AA 2N0SB 4L2YA 4HROA 1YX6B 2OEDA 5DPWA 2KJRA 3ZJUA 1UF0A 1LO5D 3J9CA 3MC8A 5LNK1 4KVGB 1P98A 2H89B 4RM8A 2WXHA 2KX0A 1VJKA 4UDUC 3UI3A 2ZPYA 2WXIA 3BIID 2EKEC 4D2KA 1ZGUB 2D07B 3JW0X 1QOFA 3N20C 4LTUA 4AQ7A 3APFA 4RH6A 1ZW7A 2MJEA 4BOSC 3GZNI 1WXSA 2LJ5A 2ZNVB 4PK1A 1WXAA 5H92C 4ZRJA 2UWQA 2BKRB 2BB5A 4NNJB 2ZW0A 3OJ4B 4M8NA 2LI5A 3SD5A 2FIDA 1WZ0A 1BMLC 1YQ3B 1WYGA 2R2QA 3V05A 4YWGG 4TQ0A 1NDDA 1PGBA 5EE1A 5IP4D 3P4RB 2NMQA 3V6EB 2GI9A 5CHWA 3N1ZC 3BYYB 1PDXA 2K8HA 3SEBA 2KLCA 3ZRCA 1YNTE 2AEHA 2IGDA 3NJTA 1N63A 2IY0B 4JIOU 1R4MB 5H8YE 3V60A 1F9JA 2BQQA 3VXWA 3UIOB 3UGBB 4YTNB 2LHEA 4WWNA 3AE1B 3RUIB 2VZKB 3ENEA 3Q3FA 1F1HA 2RSUA 1QF6A 2INNE 1WJNA 4GOCA 1I4QA 3P1MA 5AUIA 3NS8A 4IG7B 4KGTA 3B2FA 3SFEB 3HM3A 4MJSA 5L83A 2PTLA 2KTRA 4IW0A 1EM7A 2O2VA 3A9JB 3VTUA 1WGRA 1CJEA 4W9EA 3L54A 2RPQA 4YT0B 1K51A 3NVYA 2KFKA 1L7YA 2KMAA 4HJGE 1BUIC 4GB9A 4HKZE 4C7YA 4S0RA 4HEA1 1VZ8A 4BKTA 2MH7A 3A4SC 4YTPB 1YN3A 1L0YB 2REXA 4OHJA 2RDBC 2KAJA 2N1VA 2MP2B 2PMVA 4XWTA 2TSSA 3Q3MC 3A9KB 2YEPB 3NG0A 1LQBA 1QILA 2M0XA 3GB1A 2LWPA 4LDTD 3Q8EA 2KMCA 4WURA 4ZOHC 4BKSA 4ARCA 1V5OA 1E8YA 2MBEA 4IUMB 5GMVA 3U4EG 3ZIMA 3R3MA 3H7PA 1C77A 1KOTA 4FJZA 1ZE3D 2ZCBA 1F2RC 2WXLA 3CSFA 3JSVA 1WRDB 1Z2MA 2KN4A 4AUQC 3LXFA 2KACA 4JPSA 2QIEB 1K50A 1E9MA 2WXQA 2WDTB 2LGXA 3RNCC 4GDLB 4TUUA 2JZ3B 2MW5A 3AI5A 2KWDA 1B9RA 2PKOA 2RD0A 1GOZA 5E6OA 1SGHA 2V1YA 4I6LB 4P1CC 1HXYD 4GU2A 5KHQA 4KIKB 2HDEA 5BMIA 4GSWA 2RMMA 2KQ7A 4YL8A 5CX3A 4EKUA 4IM0A 2J52A 2GB1A 3AXCA
chains in the Genus database with same CATH topology
2J53A 4TQ1A 1C9FA 1L0VB 3BYTB 1JMLA 3EUB2 1ACCA 1WWTA 1KRHA 5GXGB 3AEEB 4NAMA 3V3XA 2VZKD 2WS3B 4JX1C 2JZPA 2JX5A 3ABVB 3R2TA 4XE0A 5C2TB 1MVKA 3VR8B 1QOBA 1DOYA 1T5XD 2K5PA 3Q8FA 5EE0A 3L4PA 1XXGA 3TEXA 1QKZA 1I4XA 3AE7B 4N6EB 1XLNA 3MHZA 2K22A 3AEAB 3DWMA 4MM3B 3KWLA 3ZYYX 1ZPSA 4WIPA 2LUMA 1PGAA 1FFVA 2N9KA 3HUIA 3U2SC 3BVZA 2JWUA 1YN4A 4KKJA 2K3UA 1JWBD 2DYMA 3MP9A 4P6VF 1DYQA 2BTEA 1EWYC 3AM9A 3DWGC 4WWMA 1WXQA 4YSXB 1FMAD 1NI3A 1JROA 3Q69A 1UUPA 1PGXA 2WLBA 2OHFA 2AQ1B 3ZQ4A 3KLSX 3I57A 2QMTA 3URYA 1I4HA 2MJDA 3NVVA 2LJIA 1NENB 1JWAD 4JE3B 2JU6X 1SIJA 1XLOA 1N5WA 4NJCA 1T3QA 2J4XA 4NZLB 4OW0A 2Y5PA 5EE9A 1FIQA 1AWDA 1KFYB 3VQIA 1FNWA 1SBBB 1SF0A 1GPXA 3TEYA 1D5XC 2BBCA 2R61A 2L83A 1DGJA 4J3OD 1D5MC 1XO3A 3W1SA 1OFFA 3Q8CA 2BYTA 1UWXA 2WP9B 3BK2A 1GB1A 1I4RA 4KKIA 1QOGA 1J7AA 1TS3A 3BVGA 4RF1A 4IKGA 2QSDA 2SAKA 3KQ4A 3H8HA 3Q8BA 4MH8A 1MPEA 2N7JA 3T3OA 1N60A 3ETRA 2E6XA 2IDYA 2L1AA 1RM6C 3P42A 1ZOYB 2QILA 4AS1A 4ZHPA 2RDGA 2LGIA 2I38A 2E3TA 3OWEB 2RPVA 5TSSA 3ZGZA 2ICIA 2CJNA 2V4IB 2AX5A 1GAQB 3CIRB 1NYRA 3AE3B 1C4AA 1NVID 1TY0A 4RGTA 4H2AA 4B0EA 3SFDB 2ZW1A 1J7BA 2AQ3B 3MJ5A 2RDHA 4OZBA 4RCOA 2JYTA 1FCLA 2L52A 1VLBA 4OZAA 1JRPA 2XN9C 1FXAA 1TS4A 4HKQA 2Q5WD 2EKIA 3AE2B 1Y56A 3PO0A 2CJOA 1GB4A 2WQYB 2INPE 1SSNA 4KGSA 1TZOA 3BZDB 2WDVB 4N59A 1Q10A 4Q2JA 3VRBB 2NTSA 3E56A 3W9CB 1RFKA 1D5ZC 1RYJA 4LK0M 3AH7A 1E10A 1YJIA 1FNVA 4RGMA 3AE9B 1I7HA 1L6UA 4OVZA 4JWUC 1TY2A 1P7FA 3AE6B 1ENFA 2YEPF 1OQQA 1SE2A 1KLUD 4P16A 2NTTA 1DOIA 3B2GA 2WDQB 1N62A 4OZCA 4YXDB 3NS1A 5D3IB 2ON8A 3TEWA 1FNUA 2IGHA 5BYRA 1ESFA 1HZ5A 2WXJA 1RWSA 2PVGC 2WXGA 4TMAB 2K9XA 2XNAC 1NEKB 1D4BA 2ACZB 4A8XC 4O1NA 5D7GA 1PUTA 1V97A 1K53A 3BVMA 2L32A 3NVWA 3VR9B 3TEZA 1AN8A 3P4PB 2WXFA 1IBXA 3AEGB 1K52A 2AQ2B 2EELA 3Q8AA 1A70A 4MT5A 1VDVA 1ZUD2 4KX6B 1VRAB 4YSZB 4R3DA 1HA5A 3P4SB 4HRSA 3RFZB 2FUG1 1C76A 2X38A 2N9LA 2M56B 3W2DA 2LFIA 1N5XA 3NZ3A 1QLBB 2WXKA 3EGRA 4C80A 4MACA 1ET9A 3ZJTA 4RF0A 4YSYB 1KTKA 5EE3A 2V3PA 3AN1A 1TJEA 1FCCC 5C3JB 1R7SA 5BYQA 1EU3A 4KGRA 5T8IA 1CQVA 4L1BA 2KMMA 4RNAA 3ZJVA 4PT5A 1ZXIA 2D5GA 3AE4B 3FILA 2N0SB 3U52E 3IXSA 1FRDA 4L2YA 5HFYA 4HROA 2W3RA 1YJJA 2OEDA 1ROEA 1FRRA 4GDKB 2LEKA 5HI1A 3P4QB 2BW2A 1ZXHA 2J42A 3SR6A 3ZJUA 3IAS1 5I4DA 3MC0B 4DXFA 1WSPA 1LO5D 3J9CA 4ZRPA 1JALA 2LMCA 1TKYA 5LNK1 3PZ8A 2H89B 1T6BX 2MEKA 1IBXB 1E7PB 2WXHA 1VJKA 3P63A 4UDUC 1SJHD 3UI3A 1JWMD 2WXIA 3IT6B 3AB5A 3BIID 3AEBB 2PLPA 3VRAB 2H88B 1ZP0B 2PIAA 4D2KA 1JWSD 1QOFA 1CZPA 4USAA 4LTUA 4AQ7A 4RH6A 4XWWA 2MJEA 1KF6B 5FR3A 2FE8A 1L6VA 2BS2B 5H92C 4GLSC 4L23A 3AE8B 2BB5A 3FILB 1J7CA 3AE5B 1TYGB 2ZW0A 1TKGA 4C7ZA 2G1EA 2KQ4X 3T3NA 1C4PA 1MHHE 1BMLC 1YQ3B 4FXCA 2WXRA 1WYGA 2WU5B 1C4CA 2B76B 3V05A 4YWGG 3IT4B 4TQ0A 4DXGA 1PGBA 1V1PA 5EE1A 2DYOA 2DWQA 3P4RB 1MHXA 3E9SA 2NMQA 3N9YC 1L0XB 4RFBA 1FD6A 2K0PA 4YTMB 1OQRA 2CU3A 2GI9A 2DBYA 3NVZA 1M4VA 3BYYB 1PDXA 3SEBA 1VZ7A 5BYSA 1YNTE 1YMHE 2M0AA 1KH0A 2IGDA 3O13A 1I4GA 4ZRQA 1UWMA 2ONQA 1IUEA 1N63A 4ZHOA 1QQRA 5H8YE 1FM0D 1SB3C 2JSVX 1C78A 4N58A 3FC4A 1HQRD 1HEZE 3RPFC 3GP7A 2SEBD 4YTNB 3AV8A 2LHEA 4US9A 3AE1B 1TS5A 2VZKB 4REZA 4A90A 3W5VB 3U7ZA 3WCQA 2LHDA 1QF6A 4WQMA 2QEJC 2INNE 1IGCA 1SEBD 4NAWB 3W5UB 1I4QA 3P1MA 5AUIA 1E0ZA 4WH4A 2JYEA 3AMZA 4KGTA 5FKAC 3B2FA 1L4DB 1XCTL 3HRDD 1F2RI 3SFEB 2JQRB 4RGNA 2Y3AA 1XF5L 3HVZA 3TSSA 2PTLA 2KDMA 1ET6A 2W55A 5D3DA 4ARIA 1EM7A 1WGKA 1FXIA 1V1PB 3AECB 4XDCA 3LB8C 1EU4A 1SE3A 1CJEA 4M0WA 1UGJA 2BS3B 4TSSA 1V8CA 4YT0B 1V1OA 3AEFB 2WXPA 1K51A 1DOXA 3NVYA 3R8BA 3LYYA 1SXTA 1JW9D 1STEA 1ZDVA 4HJGE 2G9HD 1FEHA 2HTME 2M19A 3C8YA 1XLPA 1HZ6A 4A9AA 1BUIC 1F77A 2BS4B 2WXMA 4RGOS 1F0ZA 2W82A 1I4PA 4HKZE 4C7YA 4HEA1 4IOIE 1JWUD 1VZ8A 4EE2A 2MH7A 4YTPB 4B0MA 3AEDB 2BB6A 3I9V1 1YN3A 1L0YB 4DQOC 1IGDA 4A55A 1PFDA 4OHJA 2KAJA 1SJED 1XCQL 2PMVA 4XWTA 2WXNA 2TSSA 1YQ4B 1MI0A 1AW7A 2IPKD 3EA6A 2BT6A 1TS2A 2IGGA 2JXTA 2YEPB 3IAM1 5G5GA 1L5PA 3TUOA 2I2YA 1JQ4A 4A6QA 1QILA 3GS2A 5MPOA 3NUHB 3GB1A 1CK1A 2DLBA 1KLGD 1JCKB 3Q8EA 5BMGA 1P7EA 4WURA 4ZOHC 4ARCA 4IDIA 3U4EG 5G5HA 2Z8LA 4JWSC 5FK9C 4XDDA 2WXOA 2WU2B 1UNSA 5HG2A 1C77A 1XEEA 1XLQA 1FO4A 1ZE3D 5E6JA 2GRIA 5AUKA 3FAHA 1ZDXA 1F2RC 2WXLA 3BK1A 2W54A 1BXTA 2Y5CA 4CQNA 1YN5A 3MFGA 2KN4A 3LXFA 1VZ6A 2KACA 1L4ZB 2MJ3A 1QT9A 2PW9A 2QIEB 1K50A 4JPSA 2V0GA 1E9MA 2WXQA 3CWIA 5HHDG 2WDRB 3BWUD 3NRZA 4GDLB 4WAFA 2QJLA 2KWDA 1N61A 2PKOA 1B9RA 1QOAA 1GOZA 4ZYSA 1D6EC 1FFUA 1HXYD 2WNMA 3KWVA 1E6EB 2PVOD 1C79A 3HVDA 4LLGM 1SE4A 1TKEA 1PYWD 1WRIA 2IJ0A 1NYQA 4ITKA 2W3SA 2HDEA 5BMHA 5JXVA 5BMIA 1B1ZA 2FBWB 1EWCA 2V3NA 3R2IA 3B9JA 2RMMA 3PZ7A 1VR9A 4US8A 1AYFA 4C56C 2J52A 2GB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J53 A;  1C9F A;  1JML A;  2ZW1 A;  1IBX B;  1K51 A;  4OZB A;  3UI3 A;  3V3X A;  1FCL A;  2JZP A;  4HJG E;  4OZA A;  2PLP A;  1MVK A;  1HZ6 A;  4D2K A;  1GB4 A;  4HKZ E;  1QKZ A;  4KGS A;  4IOI E;  1Q10 A;  4GLS C;  1IGD A;  2LUM A;  1PGA A;  3FIL B;  2N9K A;  2ZW0 A;  1XCQ L;  2JWU A;  1P7F A;  2KQ4 X;  1MI0 A;  4OZC A;  1MHH E;  2ON8 A;  2IGG A;  2JXT A;  2I2Y A;  3MP9 A;  2IGH A;  1HZ5 A;  1PGB A;  3GB1 A;  1PGX A;  5BMG A;  1D4B A;  1P7E A;  1MHX A;  2NMQ A;  1K53 A;  1FD6 A;  2K0P A;  2GI9 A;  2QMT A;  1IBX A;  1K52 A;  2EEL A;  5HG2 A;  1YNT E;  2JU6 X;  1YMH E;  1KH0 A;  2IGD A;  2ONQ A;  1F2R C;  2N9L A;  2KN4 A;  2JSV X;  2KAC A;  1HEZ E;  4MAC A;  2PW9 A;  1K50 A;  5HHD G;  2LHE A;  1FCC C;  1UWX A;  2LHD A;  2KWD A;  4KGR A;  1GB1 A;  1IGC A;  3FIL A;  2QSD A;  4IKG A;  4WH4 A;  1MPE A;  5HFY A;  2N7J A;  4KGT A;  1XCT L;  2OED A;  1F2R I;  5HI1 A;  1XF5 L;  1ZXH A;  2PTL A;  5BMH A;  2KDM A;  5JXV A;  5BMI A;  2LGI A;  2I38 A;  1EM7 A;  2RPV A;  2RMM A;  2J52 A;  2GB1 A; 
#chains in the Genus database with same CATH topology
 4TQ1 A;  3BYT B;  3EUB 2;  2BVC A;  2BGF A;  1WFY A;  3V3X A;  3AU5 A;  1IYF A;  2JZP A;  3DHG C;  3VHT C;  3DDC B;  5D2M B;  1XQQ A;  3VR8 B;  3M95 A;  4C4V B;  2KFJ A;  3TEX A;  3AU4 A;  2K22 A;  4DXA B;  2KYW A;  2CHX A;  1FFV A;  5AZF A;  2N9K A;  3U2S C;  3QAR A;  3BVZ A;  2QCZ A;  4CYE A;  3PV1 A;  4K81 A;  2BTE A;  1EWY C;  3N1Y C;  3DWG C;  5L95 C;  1WXQ A;  1WYW B;  1UUP A;  2WLB A;  3ALB A;  4XZ4 A;  3I57 A;  5J18 A;  2QMT A;  2MJD A;  3ZNG C;  2C7H A;  4JE3 B;  5G2N A;  1SIJ A;  3TMP B;  4NJC A;  1T3Q A;  4OVV A;  3V62 A;  2JRH A;  2MRP A;  3T8M A;  1BT0 A;  1AWD A;  3R7R A;  1SBB B;  1SF0 A;  4BAX A;  1GPX A;  1EO6 A;  2BYF A;  2CU1 A;  1T0S C;  4J3O D;  2IO1 B;  2O2V B;  4ANU A;  4PYU A;  3W1S A;  5CHF A;  3Q8C A;  4GXB A;  4DDI D;  4MGK E;  1WR1 A;  1QOG A;  1TS3 A;  2SAK A;  4MH8 A;  2N7J A;  4HCN B;  3T3O A;  3ETR A;  2E6X A;  2L1A A;  1V49 A;  1WM2 A;  3M3J A;  1WM3 A;  2RDG A;  2E3T A;  1T0Q C;  2N4F A;  4IWP A;  2CJN A;  2AX5 A;  3AE3 B;  3SFD B;  2ZW1 A;  1FCL A;  4IM3 A;  1VLB A;  1MG4 A;  2AYO B;  3Q3J A;  4HKQ A;  3KUZ A;  2MLB A;  3VTV A;  3PO0 A;  2AL3 A;  2CJO A;  4FAD A;  1GB4 A;  3ZW3 A;  5KHO A;  2JY6 A;  4KGS A;  4N59 A;  3E56 A;  1RFK A;  1D5Z C;  2O6V A;  2GBJ A;  2Z59 B;  4TV3 A;  1N62 A;  3L17 A;  2BWF A;  5BYR A;  1E8X A;  5EDS A;  1VD2 A;  4M00 A;  2K9X A;  3C19 A;  4A3O A;  2ACZ B;  1V97 A;  4JLC A;  3BVM A;  3NVW A;  3TEZ A;  1AN8 A;  4NJ7 A;  2DX5 B;  1GNU A;  1K52 A;  2AQ2 B;  4MT5 A;  3TBL D;  3DPD A;  1VRA B;  4YSZ B;  1HA5 A;  2KD0 A;  4LNK A;  1C76 A;  2N9L A;  2KWU B;  1N5X A;  4DK5 A;  2MBB B;  2L8J A;  2WXK A;  1GJZ A;  4C80 A;  4I6N B;  2KAN A;  3MC9 A;  1EF5 A;  5C3J B;  1R7S A;  3ZXV A;  2ZCC A;  5AZG A;  4GMV A;  4L1B A;  2KMM A;  3ZJV A;  3AE4 B;  1TGZ B;  5FR6 A;  1FRD A;  4K7S A;  2JUO A;  1YJJ A;  4URK A;  1FRR A;  4GDK B;  2D3B A;  5HI1 A;  1ZXH A;  4W9F A;  3SR6 A;  3PHX B;  4FLH A;  3ZTD A;  2ZZP B;  1WSP A;  2MBO A;  4ZRP A;  2LMC A;  1TKY A;  3X23 A;  3KUC B;  4HCP B;  2KC2 A;  4W9G A;  1T6B X;  2MEK A;  4ICV A;  2OJW A;  3GE3 C;  2BPS A;  3N1X C;  3AB5 A;  3VRA B;  4HJK A;  4DHZ E;  2NPT B;  2AWT A;  4OVU A;  2EMT A;  4EEW A;  4XGA B;  3ZTC A;  4XWW A;  3BY4 B;  2BS2 B;  4L23 A;  4ZRK A;  3FIL B;  1J7C A;  3OLM D;  2KQ4 X;  4K3C A;  5G55 A;  2L05 A;  3CMM B;  3LDZ E;  1WF9 A;  3KUD B;  1RRB A;  3IT4 B;  5CTR C;  4K7W A;  2DYO A;  4HDO A;  3Q3O C;  3A9J A;  1T0Y A;  1MHX A;  2KN5 A;  3H1U A;  2CU3 A;  3NVZ A;  4RMA A;  2KK8 A;  4AJW A;  2KDB A;  1VZ7 A;  4II2 B;  5BYS A;  2IO2 B;  3EC8 A;  5LLI A;  1KH0 A;  4ZRQ A;  5AZH A;  1IUE A;  3RNG C;  4BBN F;  4ZHO A;  3JYU A;  4EFO A;  1NBF C;  3RNB C;  2KVZ A;  3GP7 A;  2SEB D;  4AP4 C;  4ZDV A;  2LVO A;  3W5V B;  3VUW A;  3WCQ A;  1JRU A;  3RT3 B;  2ZPN A;  1WJ4 A;  2MP2 A;  3SHQ A;  3UQB A;  4E3C A;  2NBW B;  1XCT L;  4M8M A;  3HRD D;  3L13 A;  1F2R I;  3A9K A;  4IM2 A;  1S3S G;  1WGK A;  1FXI A;  2JWZ A;  3KH0 A;  4MGI E;  1EU4 A;  1SE3 A;  1UGJ A;  2BS3 B;  2WXP A;  1E8Z A;  1DOX A;  1SXT A;  1JW9 D;  1OTR B;  1STE A;  1K8R B;  1ZDV A;  3ML8 A;  2G9H D;  1P0R A;  2HTM E;  4W9K A;  3VAW A;  3C8Y A;  1XLP A;  1HZ6 A;  4EZK A;  2DAF A;  1RFA A;  2C5L C;  1SIF A;  1F77 A;  4RGO S;  4NQL B;  4B0M A;  4GDL A;  4A55 A;  2BWE S;  3VUX A;  1V81 A;  1SJE D;  5DPS A;  2WXN A;  1YQ4 B;  5IAA C;  2BT6 A;  3KVF B;  2I2Y A;  1L5P A;  3DQV A;  4KIK A;  2DAJ A;  4A6Q A;  3K9P B;  3NUH B;  1CK1 A;  1JCK B;  2LVQ A;  1P7E A;  1OEY J;  2GLS A;  4ANX A;  5G5H A;  3GZN B;  1IP9 A;  3WAM A;  3EEC A;  1XEE A;  1ZDX A;  2JT4 B;  1BXT A;  1YN5 A;  1E90 A;  3ZDM C;  4C4V A;  3NRZ A;  2QJL A;  3N32 A;  1N61 A;  4EZL A;  2DZM A;  1D6E C;  3KWV A;  2M17 A;  4W9D A;  2A5U A;  3HVD A;  2LGD A;  2N7D A;  3RYT A;  2W3S A;  3UQA A;  2N9P C;  2V3N A;  2YLM A;  1VR9 A;  2GOW A;  1AYF A;  2MWS B;  3PPA A;  1ACC A;  1WWT A;  1KRH A;  5GXG B;  3AEE B;  2LXC A;  2WS3 B;  4JX1 C;  3ONS A;  4XE0 A;  3A1Q B;  1MVK A;  3KYD D;  1V5T A;  1OQY A;  2RGF A;  4JQW C;  4DWF A;  1WIA A;  1XXG A;  3L4P A;  4IWO A;  3AE7 B;  1WXV A;  1TBE A;  1XLN A;  4MM3 B;  3KWL A;  1NI2 A;  1ZPS A;  5BO4 B;  2LRW A;  2LUM A;  2XBB C;  2G3Q B;  5JZE B;  3ML9 A;  4FA6 A;  2JWU A;  3IVF A;  2K3U A;  1JWB D;  2KZR A;  4EZJ A;  3AM9 A;  5DCN A;  3ZDT A;  1NI3 A;  1JRO A;  3Q69 A;  3PZD A;  4KZC A;  2AQ1 B;  2MA9 B;  3URY A;  1I4H A;  3RMK C;  1JWA D;  1XLO A;  3PLV A;  3ZVV A;  4OW0 A;  2Y5P A;  2FAZ A;  1KFY B;  3VQI A;  1FXT B;  4XC2 A;  3L16 A;  3TEY A;  1D5X C;  2FCM A;  2KDI A;  4RM9 A;  3RD2 A;  1OFF A;  2IYD B;  2DYB A;  2C60 A;  1UWX A;  1YIW A;  3NZU A;  4MH0 E;  1GB1 A;  4LNO A;  1UGM A;  1MFW A;  1WI0 A;  3H8H A;  3Q8B A;  3R66 C;  3PRM B;  3PHW B;  2CR5 A;  3DBS A;  1ZKH A;  3A33 B;  3GOE A;  2NBU A;  1YJ1 A;  1WX7 A;  5JHA A;  3HM6 X;  4HXD A;  1M94 A;  2V4I B;  1GAQ B;  2IY1 B;  3M62 B;  1TY0 A;  1E8W A;  4H2A A;  4MSQ B;  4B0E A;  4IWQ A;  1UD7 A;  2RDH A;  4X57 B;  1UEL A;  3WAL A;  4OZA A;  5IO9 A;  1FXA A;  1TS4 A;  3DOW A;  5DPR A;  1Y56 A;  4ICU A;  2CS4 A;  1TZO A;  3BZD B;  1Q10 A;  4Q2J A;  3IHP C;  1E10 A;  1YJI A;  1KJT A;  3DVN V;  4AWJ A;  4G3X B;  3RNE C;  3AE9 B;  4GGQ A;  1P7F A;  4EUT A;  1ENF A;  2J7Q B;  4BBN C;  1DOI A;  2KX3 A;  2C7M B;  4YXD B;  5D3I B;  4GDK A;  3R7Q A;  2ON8 A;  1FNU A;  2J0M A;  1CMX B;  1D4B A;  2L0F A;  4A8X C;  4O1N A;  1PUT A;  3EFC A;  4BOZ B;  3AEG B;  3RZW C;  2EEL A;  3H7S A;  1A70 A;  4HPL B;  1VDV A;  2JZZ A;  2FUG 1;  3W2D A;  1J19 A;  1EF1 A;  2NPT A;  4NY0 A;  3APC A;  5JH5 C;  4MAC A;  1C1Y B;  2N1W A;  2KC1 A;  4RF0 A;  3SU8 X;  2V3P A;  3L10 B;  1FCC C;  3V61 A;  2K8C A;  5BYQ A;  1V80 A;  4KGR A;  2PPH A;  4RNA A;  2LAS A;  3FIL A;  1WMH B;  3Q6B A;  3NHE B;  2L00 B;  5HFY A;  1J0G A;  2W3R A;  4BKG A;  3CF6 E;  3IAS 1;  3MTN B;  1Q1O A;  4DXF A;  5CHV C;  4E74 A;  3I3T B;  3PRZ A;  1I42 A;  3LJ3 A;  3PZ8 A;  2DZI A;  2W9N A;  1IBX B;  1E7P B;  1WGG A;  3GE8 C;  3IT6 B;  3AEB B;  2PLP A;  2BF8 B;  4LJP B;  1CZP A;  4USA A;  2KOX A;  4JGH B;  3NY5 A;  2AL6 A;  1KF6 B;  3RN9 C;  3VFK A;  3DHI C;  1L6V A;  1RLF A;  4GLS C;  1WX9 A;  2VH2 A;  1T0R C;  3PLU A;  3AE8 B;  1WY8 A;  1TYG B;  4LNN A;  4KSL C;  4C7Z A;  2G1E A;  4WWP A;  3MHS D;  1WXM A;  3NOB A;  1MHH E;  4FXC A;  2WXR A;  2B76 B;  1H8C A;  4DHJ D;  3VTW A;  2OOB B;  2DWQ A;  1ISN A;  3E9S A;  1L0X B;  1FD6 A;  3B08 A;  2KWV B;  4YTM B;  2DBY A;  1M4V A;  1WGY A;  3OJ3 A;  3VVW B;  4LCD E;  1YMH E;  1UBQ A;  3O13 A;  1I4G A;  3QX1 A;  1UWM A;  2D10 A;  1FM0 D;  1SB3 C;  4W9L A;  3RPF C;  4B9K A;  2PE9 A;  4US9 A;  1MJD A;  3U7Z A;  2LHD A;  4PS3 A;  4WQM A;  1IGC A;  4MDK E;  4W9H A;  4NAW B;  2HTH A;  3W5U B;  4DBG A;  4F1S A;  4WH4 A;  2KJH B;  3AMZ A;  5FKA C;  2K8B A;  2ASQ A;  2FNJ B;  4HPP A;  2Y3A A;  3TSS A;  1ET6 A;  4ARI A;  1V1P B;  3DBR I;  2N9X A;  3AEC B;  4XDC A;  2MBH A;  3DBR B;  2QHO A;  1TZ1 A;  2KVR A;  1WE6 A;  1TIF A;  2KDE B;  1V1O A;  4GIV A;  3R8B A;  3LYY A;  4HVB A;  3PRP B;  1FEH A;  2M19 A;  2WXM A;  1F0Z A;  4A3P A;  2N7E A;  1I4P A;  2A4Z A;  4IC7 B;  2DEN B;  4IOI E;  1JWU D;  5LXI B;  2NVU I;  2BB6 A;  1PQS A;  4DQO C;  1IGD A;  3EFU A;  3VH4 B;  2D3C A;  3WAP A;  1XCQ L;  2K6D B;  4ZRI A;  3I5J C;  1AW7 A;  2LGY A;  4LDT B;  4FHK A;  4PYZ A;  1I35 A;  1TS2 A;  2IGG A;  3IAM 1;  3TUO A;  1JQ4 A;  2CHZ A;  2LGS A;  5MPO A;  1TT5 B;  1HE8 A;  2DLB A;  1KLG D;  4MEL A;  2EMS A;  4M0W B;  3A4R A;  2GBR A;  2KQS A;  4JWS C;  5FK9 C;  2WXO A;  2WU2 B;  2M1M A;  1UNS A;  5HG2 A;  3QCA A;  5E6J A;  2DNF A;  5AUK A;  3FAH A;  2LXA A;  4M01 A;  3A1Q A;  2Y5C A;  3H6N A;  3MFG A;  3TIX A;  1VZ6 A;  4WJN A;  2MJ3 A;  1QT9 A;  3K9O B;  2R2O A;  2WDR B;  5HHD G;  4WAF A;  2KJ6 A;  4MM3 A;  1OGW A;  2WHI A;  4ZYS A;  3WA0 A;  2CKH B;  4LNF A;  4WJQ A;  2PVO D;  1WRI A;  2IJ0 A;  1NYQ A;  5BMH A;  5JXV A;  1B1Z A;  2FBW B;  1EWC A;  3R2I A;  1N6Z A;  3B9J A;  4HWI B;  1R4N I;  1IPG A;  1FPY A;  4C56 C;  1R4N B;  1Q5W B;  1L0V B;  2FUH B;  1JML A;  2WYQ A;  4K1R B;  1YD8 U;  2LZ6 A;  4NAM A;  3JVZ X;  3ABV B;  3RUL A;  5C2T B;  4QAY A;  2K5P A;  4AOF A;  2JVC A;  5EE0 A;  1I4X A;  4N6E B;  5E6N A;  2D3A A;  2ZEQ A;  3MHZ A;  3DWM A;  2JRI B;  2JXX A;  2NS5 A;  2CHW A;  4FN2 A;  4BVU C;  2BYE A;  1YN4 A;  3NZS A;  3DHH C;  4KKJ A;  1C3T A;  2DYM A;  4M02 A;  3MP9 A;  3B1L X;  1DYQ A;  3WAN A;  2IZV B;  1PGX A;  4FHJ A;  1SE9 A;  3QIJ A;  2OHF A;  3ZQ4 A;  3WAO A;  2JF5 A;  1GC7 A;  1Z5S B;  3AUL A;  3NVV A;  2LJI A;  3IG3 A;  2JU6 X;  3CST A;  1V9J A;  2L76 A;  2VRR B;  2X8X X;  2J4X A;  4NZL B;  1VCB A;  4W9I A;  2MQJ A;  5EE9 A;  4ZYN A;  5D6J B;  3ZO5 B;  1FNW A;  4FJY A;  4LJO B;  3PGE A;  2GMI C;  2L83 A;  3UIP B;  2XK5 B;  1D5M C;  4EOY A;  1P9D U;  2BYT A;  4KDL B;  3BK2 A;  4KKI A;  2NR2 A;  1J7A A;  3TL5 A;  3BVG A;  4RF1 A;  2QSD A;  3KQ4 A;  4A20 A;  4WJP A;  5IN7 A;  4DDG D;  1ZOY B;  3DVN U;  4AS1 A;  4ZHP A;  2I38 A;  3OWE B;  2C7N B;  5C1Z A;  2RPV A;  3ZGZ A;  1V86 A;  2KXJ A;  1GG3 A;  2K1F A;  1NYR A;  2FCQ A;  1XD3 B;  1C4A A;  1NVI D;  2ZJD A;  4RGT A;  2J0K A;  1WGH A;  1J7B A;  2C9W B;  2AQ3 B;  3MJ5 A;  4OZB A;  3ZRF A;  2L52 A;  4DHJ B;  3Q2A C;  3PS6 A;  1JRP A;  3OAW A;  1WZ3 A;  4PS7 A;  1UBI A;  2Q5W D;  1YOV B;  2KTF A;  2INP E;  2WQY B;  3IBE A;  2N9E B;  2WDV B;  3VRB B;  3QQ8 B;  4KV2 A;  4LK0 M;  3TCA A;  4RGM A;  2JPH A;  1I7H A;  1L6U A;  5JHB A;  1R4M I;  4OVZ A;  4BKS D;  1WMH A;  4JWU C;  1TY2 A;  3O65 B;  3AE6 B;  2HE7 A;  5J2R A;  1WGD A;  2YEP F;  1OQQ A;  1SE2 A;  4P16 A;  3S2A A;  3UF8 A;  4ACF A;  3TEW A;  2LUE A;  2QC8 A;  1RWS A;  1WJ6 A;  3FKY A;  4TMA B;  1P1A A;  2XNA C;  3QC8 B;  4WJO A;  3PT2 B;  2L0T A;  1K53 A;  3QAQ A;  2L32 A;  3P4P B;  2HJ8 A;  3OG5 A;  1IBX A;  2M8S A;  2D2Q A;  4KX6 B;  1ZUD 2;  3ZKJ C;  2WX1 A;  3I63 C;  4R3D A;  3P2B A;  4HRS A;  4K3B A;  3M63 B;  2X38 A;  2M56 B;  3QHT A;  2LFI A;  3NZ3 A;  3VDZ A;  2FCS A;  1QLB B;  1H4R A;  4HK2 A;  5EE3 A;  1KTK A;  4S17 A;  2L7R A;  1UZX B;  3AN1 A;  4K7U A;  1EU3 A;  4DHZ B;  1CQV A;  2LRU A;  4PT5 A;  1ZXI A;  3PSE B;  3UIN B;  3U52 E;  3IXS A;  4P1B C;  2KDF B;  4G11 A;  4B95 A;  4F8C B;  1ROE A;  2LEK A;  2LVP A;  3P4Q B;  2DZJ A;  2BW2 A;  2INC C;  2J42 A;  3W1S C;  5TR5 A;  5I4D A;  3MC0 B;  1WR6 E;  1JAL A;  3PTF C;  2DHZ A;  2RR9 A;  4ANW A;  4NQK E;  3P63 A;  1U4A A;  3N30 A;  1SJH D;  4W9J A;  1JWM D;  4II3 B;  2KT7 A;  2PEA A;  3U8Z A;  2H88 B;  1ZP0 B;  2PIA A;  3U30 A;  1JWS D;  4KDI C;  3MJW A;  3KW5 B;  5J17 A;  5FR3 A;  5HKH A;  2FE8 A;  5LXH A;  1X1M A;  4NAW A;  3AE5 B;  1TKG A;  1LXD A;  1J8C A;  3T3N A;  1C4P A;  4AJY B;  2WU5 B;  1KM7 A;  1C4C A;  2V4L A;  4DXG A;  1V1P A;  1L2N A;  1MG8 A;  2PJH A;  2KKC A;  2L3Z A;  3X0W A;  3N9Y C;  4RFB A;  2K0P A;  1OQR A;  4ANV A;  2M0A A;  2ONQ A;  2UU7 A;  3DBH I;  3C0R B;  1QQR A;  2JSV X;  1C78 A;  2HJ1 A;  3DBH B;  4HDQ A;  4N58 A;  3FC4 A;  1HEZ E;  1HQR D;  1Y8R C;  4TKN A;  1LM8 B;  4G0N B;  3AV8 A;  3H9D A;  1TS5 A;  4REZ A;  4A90 A;  1V6E A;  2QEJ C;  2Z0D B;  2BKF A;  1SEB D;  4HLE A;  2DZK A;  1E0Z A;  2VH1 A;  3L0W B;  2JYE A;  2IO0 B;  3V6C B;  1L4D B;  2K25 A;  4BZA A;  2WGS A;  2JQR B;  3HHM A;  2I1K A;  1XF5 L;  3HVZ A;  4RGN A;  2KDM A;  2W55 A;  5D94 A;  5D3D A;  2ZNV C;  3LB8 C;  4M0W A;  4TSS A;  1V8C A;  3AEF B;  1E7U A;  1WX8 A;  3ZUN A;  4B6W A;  2O6V D;  3RNA C;  1AAR A;  4A9A A;  2KO3 A;  3RCZ A;  2MX2 A;  2BS4 B;  1WE7 A;  2G4S A;  2W82 A;  3SDL C;  4EE2 A;  3AED B;  3I9V 1;  2NBV B;  4NJ6 A;  1PFD A;  2V3S A;  3RNF C;  4CO7 A;  1KLV A;  3APD A;  2QDF A;  1MI0 A;  2IPK D;  3EA6 A;  4E71 A;  4MJS B;  2JXT A;  5G5G A;  2KTR B;  4WAA A;  5IKC M;  3GS2 A;  2FIF A;  1LGR A;  5BMG A;  1D3Z A;  3VUY A;  4IDI A;  2Z8L A;  4XDD A;  2KFK B;  1XLQ A;  1FO4 A;  1V2Y A;  2KNB A;  3T9L A;  3ZNH B;  2GRI A;  3BIN A;  3BK1 A;  4FJV B;  2W54 A;  4CQN A;  2IBI B;  1L4Z B;  1GC6 A;  2PW9 A;  2V0G A;  3CWI A;  3N3K B;  1WH3 A;  3BWU D;  4KSK C;  4XX5 A;  2MSE D;  2MHJ A;  2KWC A;  2Z0E B;  1QOA A;  4GN1 A;  2ZVO A;  4PS8 A;  2BYV E;  1FFU A;  2WNM A;  1E6E B;  1C79 A;  4LLG M;  1SE4 A;  1TKE A;  2Y5B B;  1PYW D;  4ITK A;  3QJZ A;  2LD9 A;  3PZ7 A;  4US8 A;  1YX5 B;  2J53 A;  4I6P A;  1C9F A;  4G50 A;  2K39 A;  4W9C A;  2PE6 B;  3ZXR A;  3ZLZ A;  3H7P B;  1LFD A;  4F7Z A;  3ECI A;  3QWZ B;  2VZK D;  1OEY A;  2JX5 A;  3R2T A;  3JSV B;  4WWO A;  1E5W A;  1QOB A;  1DOY A;  1T5X D;  3Q8F A;  3Q3N C;  3RI7 C;  4HPM B;  4JL9 A;  1QKZ A;  2XK5 A;  4J6I A;  4FBJ B;  3AEA B;  4WQO B;  2K6Q A;  4FUL A;  3ZYY X;  1EUV B;  1YQB A;  4WIP A;  1PGA A;  3HUI A;  4N9F 4;  3PRE A;  1XT9 B;  3D32 A;  5DPT A;  1UH6 A;  4P6V F;  4WWM A;  4YSX B;  1FMA D;  2IND C;  3VH3 B;  3KLS X;  2G45 B;  3RZF A;  4MSM B;  2OJR A;  3HIZ A;  1NEN B;  1N5W A;  1RAX A;  4LNI A;  4BFR A;  3WIM A;  4P7I A;  1FIQ A;  2M4N A;  2BBC A;  2R61 A;  4XYC A;  1DGJ A;  1XO3 A;  2GBK A;  1HTO A;  2WP9 B;  4MGY E;  1I4R A;  3DVG Y;  1S1Q B;  4IKG A;  3PVL A;  3QA8 A;  1MPE A;  2FCN A;  1N60 A;  2IDY A;  1RM6 C;  3L08 A;  2MBQ A;  3DCG A;  3P42 A;  2QIL A;  2IO3 B;  1E7V A;  1G6J A;  2LGI A;  3QK0 A;  2G4D B;  4KZ0 A;  5TSS A;  2ICI A;  3HK0 A;  2GBN A;  4MEM A;  3CIR B;  3KYC D;  1P3Q U;  1Q0W B;  2YVC A;  1F52 A;  4RCO A;  2JYT A;  2J0J A;  1WJU A;  2XN9 C;  2GBM A;  3Q14 C;  3TJP A;  2EKI A;  3AE2 B;  2I1J A;  2KLG A;  3U7D A;  2B3A A;  1SSN A;  2NTS A;  3W9C B;  1RYJ A;  3W1Y A;  5IA7 A;  3AH7 A;  2XEW A;  1FNV A;  2WX0 A;  4C00 A;  2D3G A;  1KLU D;  2NTT A;  3B2G A;  2NCN A;  2UYZ B;  2WDQ B;  4OZC A;  3NS1 A;  2IGH A;  2HD5 B;  1ESF A;  1HZ5 A;  2D11 A;  2WXJ A;  2PVG C;  3DBL I;  2WXG A;  1NEK B;  2V9H A;  1TTN A;  2WWZ A;  2ZVN A;  5D7G A;  3DBL B;  3IFW B;  3ZNZ B;  3VR9 B;  3EHV A;  2WXF A;  3Q8A A;  5C23 A;  5AEK B;  3P4S B;  3RFZ B;  1QZE A;  1A5R A;  5IOI A;  2KHW B;  4CHK A;  3EGR A;  2MCN B;  5E6P A;  1ET9 A;  3ZJT A;  4YSY B;  4MGZ E;  1TJE A;  3ZNI D;  1GUA B;  2O6V B;  4NPN A;  5T8I A;  2D5G A;  1HTQ A;  3DVG X;  4ASW C;  3B0A A;  2N0S B;  4L2Y A;  4HRO A;  1YX6 B;  2OED A;  5DPW A;  2KJR A;  3ZJU A;  1UF0 A;  1LO5 D;  3J9C A;  3MC8 A;  5LNK 1;  4KVG B;  1P98 A;  2H89 B;  4RM8 A;  2WXH A;  2KX0 A;  1VJK A;  4UDU C;  3UI3 A;  2ZPY A;  2WXI A;  3BII D;  2EKE C;  4D2K A;  1ZGU B;  2D07 B;  3JW0 X;  1QOF A;  3N20 C;  4LTU A;  4AQ7 A;  3APF A;  4RH6 A;  1ZW7 A;  2MJE A;  4BOS C;  3GZN I;  1WXS A;  2LJ5 A;  2ZNV B;  4PK1 A;  1WXA A;  5H92 C;  4ZRJ A;  2UWQ A;  2BKR B;  2BB5 A;  4NNJ B;  2ZW0 A;  3OJ4 B;  4M8N A;  2LI5 A;  3SD5 A;  2FID A;  1WZ0 A;  1BML C;  1YQ3 B;  1WYG A;  2R2Q A;  3V05 A;  4YWG G;  4TQ0 A;  1NDD A;  1PGB A;  5EE1 A;  5IP4 D;  3P4R B;  2NMQ A;  3V6E B;  2GI9 A;  5CHW A;  3N1Z C;  3BYY B;  1PDX A;  2K8H A;  3SEB A;  2KLC A;  3ZRC A;  1YNT E;  2AEH A;  2IGD A;  3NJT A;  1N63 A;  2IY0 B;  4JIO U;  1R4M B;  5H8Y E;  3V60 A;  1F9J A;  2BQQ A;  3VXW A;  3UIO B;  3UGB B;  4YTN B;  2LHE A;  4WWN A;  3AE1 B;  3RUI B;  2VZK B;  3ENE A;  3Q3F A;  1F1H A;  2RSU A;  1QF6 A;  2INN E;  1WJN A;  4GOC A;  1I4Q A;  3P1M A;  5AUI A;  3NS8 A;  4IG7 B;  4KGT A;  3B2F A;  3SFE B;  3HM3 A;  4MJS A;  5L83 A;  2PTL A;  2KTR A;  4IW0 A;  1EM7 A;  2O2V A;  3A9J B;  3VTU A;  1WGR A;  1CJE A;  4W9E A;  3L54 A;  2RPQ A;  4YT0 B;  1K51 A;  3NVY A;  2KFK A;  1L7Y A;  2KMA A;  4HJG E;  1BUI C;  4GB9 A;  4HKZ E;  4C7Y A;  4S0R A;  4HEA 1;  1VZ8 A;  4BKT A;  2MH7 A;  3A4S C;  4YTP B;  1YN3 A;  1L0Y B;  2REX A;  4OHJ A;  2RDB C;  2KAJ A;  2N1V A;  2MP2 B;  2PMV A;  4XWT A;  2TSS A;  3Q3M C;  3A9K B;  2YEP B;  3NG0 A;  1LQB A;  1QIL A;  2M0X A;  3GB1 A;  2LWP A;  4LDT D;  3Q8E A;  2KMC A;  4WUR A;  4ZOH C;  4BKS A;  4ARC A;  1V5O A;  1E8Y A;  2MBE A;  4IUM B;  5GMV A;  3U4E G;  3ZIM A;  3R3M A;  3H7P A;  1C77 A;  1KOT A;  4FJZ A;  1ZE3 D;  2ZCB A;  1F2R C;  2WXL A;  3CSF A;  3JSV A;  1WRD B;  1Z2M A;  2KN4 A;  4AUQ C;  3LXF A;  2KAC A;  4JPS A;  2QIE B;  1K50 A;  1E9M A;  2WXQ A;  2WDT B;  2LGX A;  3RNC C;  4GDL B;  4TUU A;  2JZ3 B;  2MW5 A;  3AI5 A;  2KWD A;  1B9R A;  2PKO A;  2RD0 A;  1GOZ A;  5E6O A;  1SGH A;  2V1Y A;  4I6L B;  4P1C C;  1HXY D;  4GU2 A;  5KHQ A;  4KIK B;  2HDE A;  5BMI A;  4GSW A;  2RMM A;  2KQ7 A;  4YL8 A;  5CX3 A;  4EKU A;  4IM0 A;  2J52 A;  2GB1 A;  3AXC A; 
#chains in the Genus database with same CATH homology
 2J53 A;  4TQ1 A;  1C9F A;  1L0V B;  3BYT B;  1JML A;  3EUB 2;  1ACC A;  1WWT A;  1KRH A;  5GXG B;  3AEE B;  4NAM A;  3V3X A;  2VZK D;  2WS3 B;  4JX1 C;  2JZP A;  2JX5 A;  3ABV B;  3R2T A;  4XE0 A;  5C2T B;  1MVK A;  3VR8 B;  1QOB A;  1DOY A;  1T5X D;  2K5P A;  3Q8F A;  5EE0 A;  3L4P A;  1XXG A;  3TEX A;  1QKZ A;  1I4X A;  3AE7 B;  4N6E B;  1XLN A;  3MHZ A;  2K22 A;  3AEA B;  3DWM A;  4MM3 B;  3KWL A;  3ZYY X;  1ZPS A;  4WIP A;  2LUM A;  1PGA A;  1FFV A;  2N9K A;  3HUI A;  3U2S C;  3BVZ A;  2JWU A;  1YN4 A;  4KKJ A;  2K3U A;  1JWB D;  2DYM A;  3MP9 A;  4P6V F;  1DYQ A;  2BTE A;  1EWY C;  3AM9 A;  3DWG C;  4WWM A;  1WXQ A;  4YSX B;  1FMA D;  1NI3 A;  1JRO A;  3Q69 A;  1UUP A;  1PGX A;  2WLB A;  2OHF A;  2AQ1 B;  3ZQ4 A;  3KLS X;  3I57 A;  2QMT A;  3URY A;  1I4H A;  2MJD A;  3NVV A;  2LJI A;  1NEN B;  1JWA D;  4JE3 B;  2JU6 X;  1SIJ A;  1XLO A;  1N5W A;  4NJC A;  1T3Q A;  2J4X A;  4NZL B;  4OW0 A;  2Y5P A;  5EE9 A;  1FIQ A;  1AWD A;  1KFY B;  3VQI A;  1FNW A;  1SBB B;  1SF0 A;  1GPX A;  3TEY A;  1D5X C;  2BBC A;  2R61 A;  2L83 A;  1DGJ A;  4J3O D;  1D5M C;  1XO3 A;  3W1S A;  1OFF A;  3Q8C A;  2BYT A;  1UWX A;  2WP9 B;  3BK2 A;  1GB1 A;  1I4R A;  4KKI A;  1QOG A;  1J7A A;  1TS3 A;  3BVG A;  4RF1 A;  4IKG A;  2QSD A;  2SAK A;  3KQ4 A;  3H8H A;  3Q8B A;  4MH8 A;  1MPE A;  2N7J A;  3T3O A;  1N60 A;  3ETR A;  2E6X A;  2IDY A;  2L1A A;  1RM6 C;  3P42 A;  1ZOY B;  2QIL A;  4AS1 A;  4ZHP A;  2RDG A;  2LGI A;  2I38 A;  2E3T A;  3OWE B;  2RPV A;  5TSS A;  3ZGZ A;  2ICI A;  2CJN A;  2V4I B;  2AX5 A;  1GAQ B;  3CIR B;  1NYR A;  3AE3 B;  1C4A A;  1NVI D;  1TY0 A;  4RGT A;  4H2A A;  4B0E A;  3SFD B;  2ZW1 A;  1J7B A;  2AQ3 B;  3MJ5 A;  2RDH A;  4OZB A;  4RCO A;  2JYT A;  1FCL A;  2L52 A;  1VLB A;  4OZA A;  1JRP A;  2XN9 C;  1FXA A;  1TS4 A;  4HKQ A;  2Q5W D;  2EKI A;  3AE2 B;  1Y56 A;  3PO0 A;  2CJO A;  1GB4 A;  2WQY B;  2INP E;  1SSN A;  4KGS A;  1TZO A;  3BZD B;  2WDV B;  4N59 A;  1Q10 A;  4Q2J A;  3VRB B;  2NTS A;  3E56 A;  3W9C B;  1RFK A;  1D5Z C;  1RYJ A;  4LK0 M;  3AH7 A;  1E10 A;  1YJI A;  1FNV A;  4RGM A;  3AE9 B;  1I7H A;  1L6U A;  4OVZ A;  4JWU C;  1TY2 A;  1P7F A;  3AE6 B;  1ENF A;  2YEP F;  1OQQ A;  1SE2 A;  1KLU D;  4P16 A;  2NTT A;  1DOI A;  3B2G A;  2WDQ B;  1N62 A;  4OZC A;  4YXD B;  3NS1 A;  5D3I B;  2ON8 A;  3TEW A;  1FNU A;  2IGH A;  5BYR A;  1ESF A;  1HZ5 A;  2WXJ A;  1RWS A;  2PVG C;  2WXG A;  4TMA B;  2K9X A;  2XNA C;  1NEK B;  1D4B A;  2ACZ B;  4A8X C;  4O1N A;  5D7G A;  1PUT A;  1V97 A;  1K53 A;  3BVM A;  2L32 A;  3NVW A;  3VR9 B;  3TEZ A;  1AN8 A;  3P4P B;  2WXF A;  1IBX A;  3AEG B;  1K52 A;  2AQ2 B;  2EEL A;  3Q8A A;  1A70 A;  4MT5 A;  1VDV A;  1ZUD 2;  4KX6 B;  1VRA B;  4YSZ B;  4R3D A;  1HA5 A;  3P4S B;  4HRS A;  3RFZ B;  2FUG 1;  1C76 A;  2X38 A;  2N9L A;  2M56 B;  3W2D A;  2LFI A;  1N5X A;  3NZ3 A;  1QLB B;  2WXK A;  3EGR A;  4C80 A;  4MAC A;  1ET9 A;  3ZJT A;  4RF0 A;  4YSY B;  1KTK A;  5EE3 A;  2V3P A;  3AN1 A;  1TJE A;  1FCC C;  5C3J B;  1R7S A;  5BYQ A;  1EU3 A;  4KGR A;  5T8I A;  1CQV A;  4L1B A;  2KMM A;  4RNA A;  3ZJV A;  4PT5 A;  1ZXI A;  2D5G A;  3AE4 B;  3FIL A;  2N0S B;  3U52 E;  3IXS A;  1FRD A;  4L2Y A;  5HFY A;  4HRO A;  2W3R A;  1YJJ A;  2OED A;  1ROE A;  1FRR A;  4GDK B;  2LEK A;  5HI1 A;  3P4Q B;  2BW2 A;  1ZXH A;  2J42 A;  3SR6 A;  3ZJU A;  3IAS 1;  5I4D A;  3MC0 B;  4DXF A;  1WSP A;  1LO5 D;  3J9C A;  4ZRP A;  1JAL A;  2LMC A;  1TKY A;  5LNK 1;  3PZ8 A;  2H89 B;  1T6B X;  2MEK A;  1IBX B;  1E7P B;  2WXH A;  1VJK A;  3P63 A;  4UDU C;  1SJH D;  3UI3 A;  1JWM D;  2WXI A;  3IT6 B;  3AB5 A;  3BII D;  3AEB B;  2PLP A;  3VRA B;  2H88 B;  1ZP0 B;  2PIA A;  4D2K A;  1JWS D;  1QOF A;  1CZP A;  4USA A;  4LTU A;  4AQ7 A;  4RH6 A;  4XWW A;  2MJE A;  1KF6 B;  5FR3 A;  2FE8 A;  1L6V A;  2BS2 B;  5H92 C;  4GLS C;  4L23 A;  3AE8 B;  2BB5 A;  3FIL B;  1J7C A;  3AE5 B;  1TYG B;  2ZW0 A;  1TKG A;  4C7Z A;  2G1E A;  2KQ4 X;  3T3N A;  1C4P A;  1MHH E;  1BML C;  1YQ3 B;  4FXC A;  2WXR A;  1WYG A;  2WU5 B;  1C4C A;  2B76 B;  3V05 A;  4YWG G;  3IT4 B;  4TQ0 A;  4DXG A;  1PGB A;  1V1P A;  5EE1 A;  2DYO A;  2DWQ A;  3P4R B;  1MHX A;  3E9S A;  2NMQ A;  3N9Y C;  1L0X B;  4RFB A;  1FD6 A;  2K0P A;  4YTM B;  1OQR A;  2CU3 A;  2GI9 A;  2DBY A;  3NVZ A;  1M4V A;  3BYY B;  1PDX A;  3SEB A;  1VZ7 A;  5BYS A;  1YNT E;  1YMH E;  2M0A A;  1KH0 A;  2IGD A;  3O13 A;  1I4G A;  4ZRQ A;  1UWM A;  2ONQ A;  1IUE A;  1N63 A;  4ZHO A;  1QQR A;  5H8Y E;  1FM0 D;  1SB3 C;  2JSV X;  1C78 A;  4N58 A;  3FC4 A;  1HQR D;  1HEZ E;  3RPF C;  3GP7 A;  2SEB D;  4YTN B;  3AV8 A;  2LHE A;  4US9 A;  3AE1 B;  1TS5 A;  2VZK B;  4REZ A;  4A90 A;  3W5V B;  3U7Z A;  3WCQ A;  2LHD A;  1QF6 A;  4WQM A;  2QEJ C;  2INN E;  1IGC A;  1SEB D;  4NAW B;  3W5U B;  1I4Q A;  3P1M A;  5AUI A;  1E0Z A;  4WH4 A;  2JYE A;  3AMZ A;  4KGT A;  5FKA C;  3B2F A;  1L4D B;  1XCT L;  3HRD D;  1F2R I;  3SFE B;  2JQR B;  4RGN A;  2Y3A A;  1XF5 L;  3HVZ A;  3TSS A;  2PTL A;  2KDM A;  1ET6 A;  2W55 A;  5D3D A;  4ARI A;  1EM7 A;  1WGK A;  1FXI A;  1V1P B;  3AEC B;  4XDC A;  3LB8 C;  1EU4 A;  1SE3 A;  1CJE A;  4M0W A;  1UGJ A;  2BS3 B;  4TSS A;  1V8C A;  4YT0 B;  1V1O A;  3AEF B;  2WXP A;  1K51 A;  1DOX A;  3NVY A;  3R8B A;  3LYY A;  1SXT A;  1JW9 D;  1STE A;  1ZDV A;  4HJG E;  2G9H D;  1FEH A;  2HTM E;  2M19 A;  3C8Y A;  1XLP A;  1HZ6 A;  4A9A A;  1BUI C;  1F77 A;  2BS4 B;  2WXM A;  4RGO S;  1F0Z A;  2W82 A;  1I4P A;  4HKZ E;  4C7Y A;  4HEA 1;  4IOI E;  1JWU D;  1VZ8 A;  4EE2 A;  2MH7 A;  4YTP B;  4B0M A;  3AED B;  2BB6 A;  3I9V 1;  1YN3 A;  1L0Y B;  4DQO C;  1IGD A;  4A55 A;  1PFD A;  4OHJ A;  2KAJ A;  1SJE D;  1XCQ L;  2PMV A;  4XWT A;  2WXN A;  2TSS A;  1YQ4 B;  1MI0 A;  1AW7 A;  2IPK D;  3EA6 A;  2BT6 A;  1TS2 A;  2IGG A;  2JXT A;  2YEP B;  3IAM 1;  5G5G A;  1L5P A;  3TUO A;  2I2Y A;  1JQ4 A;  4A6Q A;  1QIL A;  3GS2 A;  5MPO A;  3NUH B;  3GB1 A;  1CK1 A;  2DLB A;  1KLG D;  1JCK B;  3Q8E A;  5BMG A;  1P7E A;  4WUR A;  4ZOH C;  4ARC A;  4IDI A;  3U4E G;  5G5H A;  2Z8L A;  4JWS C;  5FK9 C;  4XDD A;  2WXO A;  2WU2 B;  1UNS A;  5HG2 A;  1C77 A;  1XEE A;  1XLQ A;  1FO4 A;  1ZE3 D;  5E6J A;  2GRI A;  5AUK A;  3FAH A;  1ZDX A;  1F2R C;  2WXL A;  3BK1 A;  2W54 A;  1BXT A;  2Y5C A;  4CQN A;  1YN5 A;  3MFG A;  2KN4 A;  3LXF A;  1VZ6 A;  2KAC A;  1L4Z B;  2MJ3 A;  1QT9 A;  2PW9 A;  2QIE B;  1K50 A;  4JPS A;  2V0G A;  1E9M A;  2WXQ A;  3CWI A;  5HHD G;  2WDR B;  3BWU D;  3NRZ A;  4GDL B;  4WAF A;  2QJL A;  2KWD A;  1N61 A;  2PKO A;  1B9R A;  1QOA A;  1GOZ A;  4ZYS A;  1D6E C;  1FFU A;  1HXY D;  2WNM A;  3KWV A;  1E6E B;  2PVO D;  1C79 A;  3HVD A;  4LLG M;  1SE4 A;  1TKE A;  1PYW D;  1WRI A;  2IJ0 A;  1NYQ A;  4ITK A;  2W3S A;  2HDE A;  5BMH A;  5JXV A;  5BMI A;  1B1Z A;  2FBW B;  1EWC A;  2V3N A;  3R2I A;  3B9J A;  2RMM A;  3PZ7 A;  1VR9 A;  4US8 A;  1AYF A;  4C56 C;  2J52 A;  2GB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...