4OZAA

Backbone modifications in the protein gb1 helix: beta-3-ala24, beta-3-lys28, beta-3-gln32, beta-3-asp36
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
52
Chain Sequence
DTYKLILNGKTLKGETTTEAVDATAEVFKYANNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptococcal Protein GB1 Backbone Modified Variant: beta-3-
publication title Folding Thermodynamics of Protein-Like Oligomers with Heterogeneous Backbones.
pubmed doi rcsb
molecule tags De novo protein
total genus 12
structure length 52
sequence length 56
ec nomenclature
pdb deposition date 2014-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ozaA00
4HJGE 1YMHE 1MVKA 2QMTA 3FILB 2GI9A 4IOIE 2LHDA 3MP9A 2N7JA 1PGXA 2LUMA 2QSDA 1FCLA 1UWXA 1YNTE 1K52A 1P7EA 1EM7A 1XCQL 4HKZE 2IGDA 1D4BA 1QKZA 2JSVX 2KWDA 2ON8A 5HFYA 2NMQA 2ZW0A 1IBXB 2RPVA 2JXTA 4MACA 1GB1A 3GB1A 1K50A 1Q10A 4KGRA 1MPEA 4KGSA 1MI0A 2KQ4X 2J52A 1GB4A 4OZCA 5HI1A 2PLPA 4OZBA 3FILA 1IGDA 2N9KA 2EELA 1KH0A 2JU6X 2PTLA 3V3XA 1JMLA 1K51A 1PGAA 1F2RC 3UI3A 2K0PA 5HG2A 4D2KA 2GB1A 2RMMA 5HHDG 2IGGA 5BMGA 2IGHA 4WH4A 5BMIA 1IGCA 2LGIA 2LHEA 2JWUA 1FD6A 1K53A 1MHXA 1FCCC 1PGBA 2KN4A 1HEZE 1IBXA 2I38A 1P7FA 2J53A 1XF5L 1F2RI 2I2YA 1XCTL 5JXVA 1ZXHA 2N9LA 1HZ6A 4OZAA 2ZW1A 1MHHE 1HZ5A 2ONQA 4KGTA 2JZPA 5BMHA 1C9FA 4GLSC 2OEDA 2KDMA 4IKGA 2PW9A 2KACA
chains in the Genus database with same CATH superfamily
1ENFA 1WXAA 4GDKB 2J0KA 1LGRA 2KDBA 2KLCA 2JUOA 3IT6B 3ZJUA 2CU1A 4HDQA 3OLMD 4MJSA 1Z5SB 4C56C 4RNAA 2PVGC 2KVZA 1JWSD 1WE6A 2D3BA 4C4VB 1KM7A 2QSDA 2WLBA 2NTTA 3W2DA 4KDIC 4EFOA 4YTMB 1RFAA 2WDVB 3DBHB 3DBRI 1QOBA 3BVMA 1KOTA 3IAS1 2D3GA 3PS6A 1BUIC 3QA8A 3H9DA 4HRSA 2Z0EB 2K6QA 1C78A 2YEPF 3HRDD 4P1CC 4REZA 4J6IA 2NMQA 2NPTA 2ZZPB 1YOVB 4RGOS 4MACA 3A4SC 5BYQA 1TS4A 4GOCA 3PRZA 1K8RB 1Q10A 2LASA 3KWVA 3N20C 4MGZE 1Z2MA 4G3XB 3KVFB 4AP4C 2JZ3B 2PLPA 1J7AA 5C3JB 4FJVB 4KKJA 2EELA 2ZPNA 2WX0A 1E8WA 2BB5A 4YT0B 5HHDG 2L05A 2H88B 3VH4B 2E6XA 3RZWC 3V62A 2KVRA 5J18A 2KN5A 4NJCA 2KJ6A 3EC8A 3LJ3A 2PVOD 4JLCA 2AX5A 2VH1A 1ZKHA 3AV8A 3Q8CA 2KWUB 2GLSA 3NJTA 5IA7A 3M3JA 2IO1B 4IC7B 4MGIE 4YSXB 2V3PA 5BYSA 1DGJA 4IKGA 4AQ7A 1YMHE 3P1MA 4DHJB 2A4ZA 4XDCA 3C0RB 3U52E 1P1AA 4ZHOA 4W9HA 4MT5A 3HIZA 3DBSA 4JWUC 2DENB 2JVCA 5J2RA 3BVGA 3DWGC 2HDEA 3RNBC 2KO3A 2WXNA 2IGDA 2W55A 4A20A 4ANUA 2LI5A 1D4BA 4B95A 5LXIB 1KRHA 4ARCA 2Y5CA 3SFEB 1ZP0B 1PYWD 3GB1A 4DXAB 3BY4B 1SE2A 1I4PA 2BS2B 5C23A 1R4MB 4NAWB 3NZSA 3RYTA 2D2QA 5J17A 4GN1A 1QOGA 2BPSA 1RLFA 2LRWA 3KWLA 3AECB 1CMXB 3TMPB 4W9IA 5BO4B 2DHZA 2J0MA 3LB8C 4N9F4 1ESFA 2FIDA 1MG4A 3Q3NC 1WXSA 3OWEB 3L08A 3L54A 3W5UB 4KVGB 3ZXVA 2M4NA 2WP9B 1YQ3B 4I6LB 3JYUA 4HWIB 3H1UA 3P4PB 3NUHB 1D6EC 2JZZA 4LNNA 2JPHA 4XC2A 1ZXHA 2G4DB 2ZPYA 4LTUA 2QIEB 4NNJB 1E8ZA 3NS1A 3WAPA 2MBQA 2JYEA 2L0FA 2L0TA 3R8BA 3VH3B 1TJEA 2KACA 3A9JA 4JQWC 1VZ8A 1X1MA 1RAXA 1PFDA 1WJ6A 4E71A 4K7UA 3IT4B 1FEHA 3FILB 1XO3A 4WURA 3LYYA 3AN1A 1WXVA 1ZDVA 2L32A 2G3QB 2DZIA 4ASWC 4EOYA 2GRIA 4B0EA 1SE9A 5D94A 3ZUNA 1EU4A 2WXIA 3KUDB 4ICVA 4ZHPA 3ONSA 2KWDA 3ZYYX 4YTPB 1L0YB 2EMTA 1KTKA 1L6UA 1TKGA 4LJOB 5LLIA 1V1PA 4FADA 4NZLB 3PTFC 3VVWB 4TKNA 4K7SA 2B76B 1WR1A 2REXA 1C4CA 3PHXB 3DBLB 1WSPA 2MSED 1RYJA 1KH0A 1ZPSA 1J8CA 3QK0A 4X57B 1WFYA 1WMHB 4D2KA 2GB1A 3PZDA 1TIFA 1SSNA 5L95C 1L2NA 1HTQA 1N62A 4HDOA 4BKSD 3ZIMA 3ZNGC 1D3ZA 2DWQA 4E3CA 4BKSA 3U8ZA 1CK1A 3VQIA 2FCMA 2M8SA 1VCBA 4ACFA 1GC7A 4WWMA 3R3MA 3GZNB 5BYRA 2DZMA 1PQSA 2L83A 2D10A 2UU7A 4KV2A 4II2B 4WJPA 3B2FA 2EMSA 2QJLA 3APFA 3AEDB 3CWIA 3Q2AC 5CHWA 4IWPA 2GBNA 1MHHE 2L00B 4BKGA 1SIJA 2BYEA 5BMHA 2MWSB 2DBYA 4LDTB 3U2SC 1TKEA 2V0GA 1OQYA 5TSSA 1UNSA 1FNVA 3KLSX 2WXPA 1LO5D 1J0GA 3RMKC 3AE8B 3WAOA 2ZEQA 4G11A 4AUQC 2D11A 2Z59B 2KDEB 1AN8A 4RGNA 3URYA 5IO9A 4DQOC 1FRRA 2MRPA 4WWOA 3T3OA 1PUTA 1QOAA 2QCZA 3VFKA 1JWUD 2HE7A 2RPVA 2KK8A 3B9JA 3DQVA 3PPAA 1P98A 3RCZA 2SEBD 2WYQA 3ZRFA 1MI0A 1C4PA 1MFWA 4ARIA 1XLOA 1EU3A 2FUHB 3NVWA 3BYTB 2XBBC 1WF9A 3NHEB 2AL3A 3QAQA 2W9NA 2KFKA 2INPE 3AULA 2V4LA 1SF0A 1NBFC 2LGXA 2QILA 3DHGC 5H92C 2LMCA 4XYCA 1YN3A 2KANA 3DPDA 3SHQA 1I4RA 4ANVA 5FR3A 2IGHA 1QZEA 2BB6A 2N1VA 4B0MA 2JQRB 3RN9C 4F1SA 1LM8B 3Q8EA 3EHVA 3RPFC 1MHXA 3IBEA 1QF6A 2LRUA 1E9MA 1F2RI 1GC6A 3ZJTA 2DNFA 5CHFA 1D5XC 2FCNA 3AU4A 1H4RA 4IM0A 3PREA 1V81A 2NR2A 2WDQB 2M19A 3Q8BA 2KDMA 3TIXA 3UQBA 4CQNA 5KHQA 4ZDVA 4XX5A 2HD5B 1D5ZC 2KMAA 1VLBA 2LJ5A 1TZOA 4P6VF 4MEMA 1WH3A 3AE2B 3QCAA 2FE8A 2GBMA 3L13A 3MJWA 2N7EA 2KMMA 3VR8B 3TJPA 1YQBA 2FCQA 2QEJC 1NYQA 2NBVB 1V80A 1C1YB 3VTUA 3L17A 1WX7A 2KNBA 3ZO5B 1JWMD 3ZNID 3EFUA 4HPLB 4GDLA 1ISNA 2DLBA 1G6JA 2RPQA 4AJYB 4OZCA 4A90A 5G55A 2AQ2B 3HHMA 1C79A 2VH2A 1I35A 2W54A 4WJQA 2CR5A 1WJUA 2PEAA 3ZTDA 3RNGC 3T8MA 2D3AA 3PV1A 2R2QA 3TEYA 1WXMA 3EUB2 2D07B 2J53A 4FJYA 1E5WA 2NPTB 5E6PA 2O2VA 3DWMA 1L7YA 2PE6B 2KKCA 3P42A 4YXDB 2KQSA 4DDID 4IM2A 3QX1A 4YTNB 4HJGE 3AEFB 3B1LX 1SEBD 2KFJA 2MW5A 2KYWA 4KIKB 4ZRPA 1R7SA 2FCSA 3PVLA 3KW5B 2MP2B 2IO0B 1JRPA 4WIPA 2K9XA 2JT4B 1U4AA 3BK2A 1DOYA 3NOBA 3P4QB 3A1QA 1YNTE 2G45B 2CS4A 1T0RC 2J4XA 2KT7A 3N3KB 1N5WA 4BBNF 3TEXA 4DHZE 3VXWA 3WCQA 1EUVB 2PMVA 3NZUA 1LXDA 1I4QA 3B0AA 4XWTA 2JXTA 4EUTA 4MH0E 2XK5B 3CSTA 3AE7B 3W1SA 1MPEA 3GZNI 4GMVA 2ZVOA 2KQ4X 3ETRA 3RNAC 2W3RA 3GP7A 4NPNA 4US9A 1JWAD 4ANWA 4WJOA 2Y5BB 1UF0A 2FBWB 5IN7A 5JH5C 1V8CA 1JMLA 1SE4A 1HE8A 3Q8FA 1TKYA 3SU8X 3O65B 1WIAA 1UUPA 4BAXA 5DPTA 2ICIA 1I4GA 3UIOB 4C80A 3QQ8B 2KAJA 3Q3FA 3AE1B 4TUUA 5C1ZA 1J7BA 5I4DA 4S17A 4PS8A 1FCCC 4RGTA 2ZNVB 1UBQA 4DHZB 2V1YA 3R7RA 2YEPB 1IBXA 1XF5L 2JRIB 1EWYC 2CKHB 4ZRJA 3FC4A 3IHPC 1T6BX 4N58A 1WWTA 3KH0A 1ZW7A 1OQQA 2KOXA 3AE9B 2WXJA 4BOSC 1Q5WB 4NJ7A 1WGGA 3HK0A 1SJHD 2INDC 2DX5B 1WY8A 1GUAB 3V60A 3IXSA 1GG3A 3WA0A 1VRAB 1ZUD2 2BQQA 2MBOA 5DPSA 3L0WB 5TR5A 2WXHA 4OHJA 1HQRD 4JPSA 4OW0A 1L4DB 4H2AA 3ZJVA 2GOWA 2QHOA 4K7WA 4IWOA 2IBIB 3KYDD 4C7YA 3DCGA 3KUZA 2BWFA 1R4NB 5C2TB 3ZVVA 4PYUA 1ZGUB 3QARA 2K3UA 1E6EB 1ET9A 1WZ0A 2IO2B 2K8HA 4N59A 3NS8A 4C4VA 2A5UA 4LCDE 1F77A 5JHBA 1QOFA 1FM0D 2WXFA 4CO7A 1FFVA 4KGSA 2BS3B 2RDBC 4M8MA 3P63A 3P4SB 1TZ1A 3PZ8A 1GOZA 3GS2A 1GB4A 1WM3A 1WRDB 1V86A 3W9CB 1IGDA 4XZ4A 1B1ZA 3FAHA 3CIRB 2KQ7A 4DBGA 3E56A 1FPYA 1OQRA 3BZDB 1MG8A 1YD8U 3X0WA 1FFUA 3UF8A 3AB5A 2C7MB 2Z8LA 5BMIA 2EKEC 1WXQA 3ALBA 2WXGA 1V5OA 3BYYB 2JWUA 2D3CA 4B6WA 1FD6A 2R61A 4BVUC 3HVZA 4HXDA 1K53A 4FHKA 4K3CA 4TV3A 4AJWA 2M56B 3Q3OC 4NAMA 1ET6A 1WI0A 2V3NA 4FHJA 1HXYD 3BWUD 4PS3A 1YJIA 1TBEA 2PKOA 3ZLZA 3MC8A 1EWCA 3MP9A 4JIOU 3AE3B 5KHOA 4FJZA 1MVKA 4IUMB 2LVOA 2KJHB 2JWZA 1ZDXA 4HKQA 1NENB 4LJPB 2N0SB 3VTWA 3PLVA 1V2YA 3APCA 3JSVB 2N7JA 3S2AA 4MM3B 2C5LC 5DPRA 2M1MA 4DHJD 1E7UA 4MGKE 4A8XC 1WGRA 3Q14C 3ZNHB 2MQJA 3EFCA 1QLBB 4RCOA 1YX6B 1QT9A 2KTFA 2N4FA 5EE9A 1P3QU 2AYOB 1YQ4B 4J3OD 1LQBA 4RF1A 4AS1A 2CHZA 2YVCA 2DAJA 2KX0A 1MJDA 4MGYE 1AW7A 4TSSA 2BKFA 2C7HA 4M0WA 3TBLD 2MJ3A 5JZEB 4O1NA 1XLNA 5L83A 2CHXA 2DZJA 2N1WA 1OEYJ 1SGHA 2MH7A 4KSLC 3V6CB 2K0PA 4MSMB 2BVCA 1KFYB 2IPKD 2MCNB 3DHHC 2E3TA 2V3SA 4MSQB 4XWWA 1V5TA 1ROEA 3Q3MC 2X38A 2LGIA 2K1FA 5D2MB 1FRDA 2PPHA 1PGBA 4DXFA 2JYTA 2ACZB 4FULA 3AMZA 5G5HA 1F52A 2DYOA 3BIID 1HZ5A 2MA9B 1EO6A 2B3AA 2ONQA 1WYGA 2K25A 1UGMA 2LUMA 2OEDA 2Z0DB 3ECIA 4JX1C 2HJ8A 2KHWB 3RFZB 2QMTA 3Q69A 2Y5PA 2WU2B 3N9YC 3DBHI 1E7PB 1FO4A 4WAFA 4RMAA 4UDUC 4QAYA 3H7PA 3Q3JA 3E9SA 2ZVNA 4L23A 2HTHA 1E8YA 5FKAC 4FXCA 1XLQA 2BS4B 2GBKA 5E6JA 2NS5A 2BW2A 2JSVX 3DBRB 1V9JA 2AEHA 4KSKC 1WGYA 4M01A 3N32A 1FMAD 3I57A 3NVZA 1F9JA 1GB1A 3VRAB 2KX3A 1SIFA 3U30A 3VRBB 1XLPA 1FXIA 3SFDB 3DVGY 4HVBA 4OZBA 1FNWA 3HVDA 1NDDA 3MHZA 1I42A 2JU6X 4MELA 1UH6A 2N9PC 5HG2A 1N6ZA 4M02A 2K39A 4I6NB 4P16A 1TYGB 5AZFA 4HLEA 3NRZA 2MBEA 3ENEA 1OEYA 3NVYA 4RF0A 1E10A 4CYEA 2AL6A 4RGMA 2CHWA 1ACCA 2K5PA 5LXHA 2KN4A 1WMHA 3PSEB 1P7FA 2XNAC 3WANA 3N1YC 2G9HD 1XCTL 5JXVA 5D6JB 2KMCA 4IG7B 4HJKA 4G0NB 4WWPA 4JL9A 2KTRA 3Q6BA 1JRUA 1ZE3D 2KJRA 3IAM1 4W9DA 4W9FA 2K6DB 2GI9A 3A9KA 3PZ7A 3M63B 4EE2A 3R66C 4LDTD 5EE3A 1KLVA 4WJNA 2KLGA 2FAZA 1UWXA 3GE8C 1EM7A 2WS3B 4HKZE 4AWJA 3VDZA 1XXGA 2WGSA 5AZHA 4S0RA 4M00A 2O6VB 3W5VB 4BKTA 1JROA 2LWPA 4YWGG 1R4MI 3LDZE 5IKCM 1LFDA 2PJHA 3V61A 2WDRB 1WM2A 3I9V1 1M94A 2LXCA 2ZNVC 2OJRA 3N1ZC 2NTSA 4ANXA 2N9KA 3R2IA 2BT6A 2LGYA 1J19A 4NQLB 5HKHA 3V3XA 2RDHA 4FN2A 1BMLC 2BYVE 4YSYB 3PRMB 3OJ4B 2NCNA 5G5GA 3QWZB 1TT5B 3KQ4A 1DOIA 1IPGA 2MLBA 5AUKA 1EF5A 1JW9D 5CTRC 1HEZE 4K81A 2M0AA 1FXAA 3K9OB 1S3SG 4MJSB 1WYWB 4LNOA 1IP9A 2YLMA 2IY1B 2JX5A 3LXFA 1UD7A 3RZFA 2PW9A 4XE0A 1WX9A 2Y3AA 5JHAA 1BXTA 2MHJA 3PHWB 5AZGA 3ZW3A 4WAAA 1DOXA 3BK1A 5IAAC 4LNFA 3DVGX 3WIMA 1AARA 4PK1A 4HPPA 2DYMA 2RDGA 2BGFA 3PO0A 2FIFA 3SDLC 4HROA 3X23A 3VR9B 1TS2A 2LFIA 4HPMB 1GPXA 2FUG1 3WALA 4EKUA 1IBXB 3AEEB 1TS3A 3DBLI 4ZOHC 1Q1OA 2INNE 2X8XX 3GE3C 2KZRA 2WDTB 2INCC 4A55A 3ZTCA 2OHFA 3IVFA 2CJNA 4W9GA 3I5JC 1K51A 1BT0A 4C00A 2K8CA 3N1XC 3ZDMC 3TSSA 3RD2A 2XN9C 2LXAA 2I1JA 3TEZA 4TQ1A 4EZKA 2C60A 2IZVB 1UELA 4FBJB 2KC2A 2L1AA 2I2YA 1CQVA 3B2GA 1SE3A 3H7SA 1NVID 2K8BA 1C76A 3H8HA 1V6EA 4KGTA 2KDFB 2WX1A 4N6EB 5EE1A 1GAQB 2KWCA 3BINA 1IUEA 3WAMA 3RUIB 4IOIE 3NZ3A 3MFGA 3AEAB 3O13A 1S1QB 5DPWA 4LLGM 1N61A 1WGKA 5GXGB 5D3IB 3A4RA 4A3PA 2HTME 2R2OA 2PIAA 2LD9A 3AU5A 3AE5B 4KIKA 2QC8A 4PYZA 3R7QA 2NBWB 5HFYA 2J0JA 4EEWA 1TY0A 2MP2A 3HUIA 4IW0A 1KJTA 2IDYA 3ML8A 2I1KA 4II3B 5AUIA 5T8IA 1YN4A 2IJ0A 3AH7A 1WGDA 2WU5B 1Y8RC 2J52A 2LZ6A 5EDSA 3TUOA 4GDKA 4TQ0A 2H89B 5LNK1 1YJJA 4P1BC 1KLGD 3ZRCA 3AM9A 2LVPA 2XK5A 3DVNV 2W82A 4XGAB 5EE0A 3NVVA 3AI5A 3MTNB 2L3ZA 2EKIA 1SBBB 1YIWA 3R2TA 4W9LA 3KYCD 4ZYSA 1D5MC 1WR6E 4L1BA 3A9JB 1QQRA 3RNEC 1E8XA 2BTEA 2BKRB 4ICUA 1IYFA 1Y56A 1L4ZB 4JGHB 2IO3B 2Q5WD 2ZW1A 2MJEA 2BYFA 3TEWA 2AWTA 2WXRA 4IM3A 3I3TB 3MC9A 1VZ7A 2TSSA 4M0WB 2KXJA 1I4XA 4HK2A 3P2BA 1XEEA 4K3BA 3UINB 1WZ3A 2NBUA 3AE6B 4RFBA 1V1PB 4LK0M 1FXTB 2BBCA 4OVUA 1UGJA 2J7QB 4A9AA 1RFKA 3AXCA 4DWFA 4ZYNA 3ZNZB 4ZRKA 2UYZB 4KZ0A 2AQ1B 1PDXA 3J9CA 3M95A 4USAA 1RM6C 2AQ3B 4WQOB 3QC8B 3RI7C 4A6QA 4HCPB 4KGRA 3T3NA 2C9WB 2RSUA 2WXKA 1WGHA 3VAWA 3OG5A 4KKIA 4MDKE 3UQAA 1N63A 3EA6A 3MJ5A 2JRHA 4CHKA 1L6VA 1M4VA 3UI3A 1HTOA 1C4AA 1T0YA 5CX3A 1FIQA 3M62B 2IGGA 3QJZA 4FA6A 3H7PB 3C19A 4NJ6A 4GIVA 1NI2A 2N9EB 2UWQA 5D7GA 1XQQA 2WWZA 4NY0A 2D5GA 2HJ1A 2RR9A 2WXQA 4OVZA 1WX8A 2K22A 3U4EG 5FR6A 2N7DA 4WQMA 3RNCC 3PRPB 4NAWA 2ZCBA 4RM8A 1NYRA 1C9FA 4GLSC 1STEA 3DDCB 2L76A 1UWMA 4F8CB 3NY5A 4TMAB 1V49A 5IOIA 1TY2A 1L0XB 4K1RB 2KD0A 2NVUI 3ZDTA 1FCLA 1H8CA 1AWDA 1C77A 5AEKB 2CJOA 2PE9A 2XEWA 1P7EA 4JWSC 3IG3A 1XCQL 4MH8A 1T0SC 2KC1A 4LNIA 2BYTA 1JWBD 4JE3B 4GU2A 3QIJA 3AEBB 2KFKB 3H6NA 2OOBB 4IWQA 3JSVA 3APDA 2W3SA 1UBIA 3P4RB 3C8YA 4MM3A 4EZLA 4DK5A 5E6OA 4BZAA 3OJ3A 1GNUA 1K50A 1OFFA 5CHVC 3L4PA 4URKA 1V97A 2DZKA 2KTRB 2IY0B 1B9RA 4GGQA 2WXLA 2SAKA 4BOZB 3FILA 3UGBB 1JQ4A 2GBJA 4NQKE 3W1SC 3D32A 3A9KB 2MEKA 4KX6B 4P7IA 1HA5A 4Q2JA 4KDLB 2DAFA 2WXMA 3T9LA 1CJEA 1KLUD 4WH4A 1IGCA 2ZCCA 3IFWB 2BF8B 3PGEA 2LHEA 2N9XA 1WE7A 1XT9B 1GJZA 3EECA 2LGDA 1A70A 4RM9A 1VD2A 4A3OA 4OZAA 4DDGD 4US8A 1SB3C 3ZXRA 1E7VA 2KWVB 1UZXB 2V4IB 1Q0WB 3CSFA 2V9HA 2G4SA 3TCAA 1SJED 2LJIA 2L8JA 2RGFA 3NG0A 2LHDA 1VR9A 1OTRB 3JW0X 3W1YA 3SD5A 1JCKB 1F0ZA 4ZRIA 5E6NA 4EZJA 4RH6A 3HM3A 3VUWA 1R4NI 1ZOYB 2DYBA 3PLUA 4OVVA 4GDLB 1OGWA 1TTNA 1C3TA 2ON8A 1FNUA 3AEGB 4B9KA 5FK9C 2ZW0A 1KF6B 5H8YE 4F7ZA 3OAWA 1L0VB 1TS5A 4M8NA 4BBNC 4DXGA 3ZQ4A 3CMMB 1AYFA 1DYQA 2LVQA 5HI1A 3HM6X 1ZXIA 2L7RA 3JVZX 4ZRQA 1E0ZA 2PTLA 3DOWA 1PGAA 3FKYA 2ZJDA 1VJKA 2GMIC 2WXOA 1T3QA 2O2VB 3VHTC 5BMGA 5IP4D 2L52A 1I4HA 3RULA 3U7ZA 2KDIA 3SEBA 5GMVA 2WHIA 2LGSA 3B08A 3RNFC 1P9DU 3EGRA 3TL5A 4PS7A 3CF6E 2I38A 1RRBA 1YN5A 3UIPB 5G2NA 3GOEA 1QILA 1SXTA 1HZ6A 4L2YA 2VZKB 3VTVA 2BWES 1T5XD 2JZPA 3A1QB 4G50A 2CU3A 4GSWA 4YSZB 1YJ1A 2IYDB 1JALA 4XDDA 1TGZB 1I7HA 1L5PA 4LNKA 4W9KA 1WJNA 3A33B 3L10B 4C7ZA 3Q8AA 3QHTA 1NEKB 3MC0B 4HCNB 3ZGZA 4PT5A 2MBHA 1VDVA 2WNMA 4E74A 1PGXA 3K9PB 4BFRA 2OJWA 1VZ6A 1K52A 1T0QC 2LUEA 3I63C 1YX5B 1XD3B 4GXBA 2M0XA 3VUXA 1QKZA 2J42A 3ML9A 1P0RA 3V6EB 2JF5A 3MHSD 1RWSA 3N30A 2FNJB 4IDIA 1EF1A 5DCNA 1N5XA 3AE4B 2O6VD 4GB9A 1NI3A 2ASQA 1CZPA 3SR6A 4I6PA 1WRIA 2O6VA 2WQYB 2M17A 3ABVB 2RD0A 4FLHA 4KZCA 2C7NB 4ITKA 4W9CA 1F2RC 3BVZA 2QDFA 2RMMA 4HEA1 1E90A 2LEKA 2MBBB 5D3DA 1A5RA 3DVNU 3ZKJC 2JXXA 1WJ4A 3DHIC 1V1OA 2GBRA 2VZKD 2G1EA 3VUYA 1N60A 2VRRB 3PT2B 3V05A 3RT3B 4W9JA 2MX2A 3L16A 2N9LA 5MPOA 4W9EA 3KUCB 2JY6A 1F1HA 4AOFA 4WWNA 4YL8A 2MJDA 4R3DA 1J7CA 3U7DA
chains in the Genus database with same CATH topology
4JX1C 1ENFA 1I4XA 3RFZB 2QMTA 3Q69A 4GDKB 4CQNA 2Y5PA 2WU2B 3N9YC 1XEEA 3IT6B 3ZJUA 3AE6B 1D5ZC 1E7PB 1VLBA 4RFBA 4RNAA 4C56C 2PVGC 1FO4A 4WAFA 4UDUC 1V1PB 1JWSD 1TZOA 4LK0M 2LUMA 2BBCA 2QSDA 2WLBA 4P6VF 2NTTA 1UGJA 3AE2B 3E9SA 3W2DA 2FE8A 4YTMB 2WDVB 4L23A 4A9AA 1RFKA 5FKAC 1QOBA 4FXCA 3BVMA 1XLQA 2BS4B 3IAS1 1BUIC 5E6JA 4HRSA 2KMMA 3VR8B 2BW2A 2JSVX 2AQ1B 1C78A 2YEPF 1PDXA 3HRDD 3J9CA 4REZA 4USAA 2NMQA 1RM6C 2AQ3B 2QEJC 1NYQA 1FMAD 3I57A 4RGOS 3NVZA 4MACA 4A6QA 5BYQA 1GB1A 3VRAB 1TS4A 1JWMD 3VRBB 1Q10A 4KGRA 3T3NA 1XLPA 3KWVA 2WXKA 1FXIA 2DLBA 3SFDB 4KKIA 4OZCA 4A90A 2PLPA 4OZBA 1J7AA 5C3JB 1FNWA 3HVDA 4KKJA 2EELA 1N63A 3EA6A 3MJ5A 3MHZA 2JU6X 1L6VA 2AQ2B 2BB5A 1M4VA 4YT0B 1C79A 3UI3A 5HG2A 2W54A 1C4AA 5HHDG 1FIQA 4P16A 2IGGA 2H88B 1TYGB 2OEDA 2E6XA 3NRZA 3NVYA 4NJCA 5D7GA 4RF0A 1E10A 4RGMA 3TEYA 1ACCA 2K5PA 3EUB2 2KN4A 2PVOD 2AX5A 2D5GA 1P7FA 2J53A 2XNAC 2G9HD 1XCTL 5JXVA 2WXQA 3AV8A 4OVZA 3Q8CA 3DWMA 2K22A 3U4EG 4WQMA 3P42A 4YXDB 4YTNB 1NYRA 2V3PA 1DGJA 4GLSC 4YSXB 5BYSA 1C9FA 1STEA 4IKGA 1ZE3D 3IAM1 4AQ7A 4HJGE 3AEFB 1UWMA 1YMHE 1SEBD 4TMAB 3P1MA 2GI9A 1TY2A 1L0XB 3PZ7A 4ZRPA 1R7SA 4XDCA 4EE2A 3U52E 5EE3A 4ZHOA 4MT5A 1JRPA 4WIPA 2K9XA 4JWUC 3BK2A 1DOYA 1FCLA 3P4QB 1AWDA 1UWXA 1C77A 1YNTE 3BVGA 3DWGC 2HDEA 2CJOA 2J4XA 1P7EA 1EM7A 4JWSC 1XCQL 2WS3B 2WXNA 1N5WA 4HKZE 4MH8A 3TEXA 3WCQA 2IGDA 2W55A 2PMVA 1D4BA 1XXGA 1I4QA 2BYTA 1JWBD 4JE3B 3W5VB 3AEBB 1KRHA 1JROA 4YWGG 4XWTA 2W3SA 4ARCA 2Y5CA 2JXTA 3P4RB 3C8YA 3SFEB 2WDRB 1ZP0B 1PYWD 3AE7B 3W1SA 3I9V1 3GB1A 1K50A 1MPEA 1SE2A 1I4PA 1OFFA 2BS2B 3L4PA 1V97A 2KQ4X 3ETRA 2W3RA 3GP7A 4NAWB 4US9A 1B9RA 2WXLA 1JWAD 2SAKA 1QOGA 2FBWB 2NTSA 3FILA 2N9KA 3R2IA 2BT6A 1JQ4A 1V8CA 3KWLA 3AECB 3V3XA 1JMLA 1SE4A 2RDHA 2MEKA 4KX6B 1HA5A 1BMLC 3LB8C 3Q8FA 4Q2JA 4YSYB 1TKYA 1ESFA 1UUPA 5G5GA 2WXMA 3OWEB 1CJEA 2ICIA 3W5UB 1I4GA 1KLUD 4C80A 4WH4A 2KAJA 1IGCA 3KQ4A 2WP9B 1DOIA 1YQ3B 2LHEA 3AE1B 5AUKA 3P4PB 1JW9D 1J7BA 3NUHB 5I4DA 1D6EC 1FCCC 4RGTA 1HEZE 1IBXA 2YEPB 1XF5L 1A70A 2M0AA 1EWYC 1FXAA 1ZXHA 3FC4A 4LTUA 1T6BX 4N58A 2QIEB 1WWTA 4OZAA 4US8A 3NS1A 2JYEA 1OQQA 3AE9B 1SB3C 2WXJA 2V4IB 2JX5A 3LXFA 3R8BA 2PW9A 2KACA 1TJEA 1VZ8A 4XE0A 1PFDA 2Y3AA 1SJED 2LJIA 1SJHD 3IT4B 1FEHA 3FILB 1BXTA 1XO3A 2LHDA 3IXSA 1VR9A 4WURA 3LYYA 3AN1A 1VRAB 1ZDVA 2L32A 1ZUD2 1JCKB 1F0ZA 1DOXA 2WXHA 4OHJA 2GRIA 3BK1A 4B0EA 1HQRD 4RH6A 4JPSA 4OW0A 1L4DB 1ZOYB 4H2AA 3ZJVA 1EU4A 2DYMA 2WXIA 2RDGA 3PO0A 4GDLB 4HROA 4ZHPA 3VR9B 1TS2A 4C7YA 2LFIA 2KWDA 3ZYYX 2ON8A 1FNUA 3AEGB 1GPXA 2FUG1 5FK9C 4YTPB 1L0YB 5C2TB 2ZW0A 1KF6B 1KTKA 5H8YE 1L6UA 1TKGA 1IBXB 2K3UA 1V1PA 1E6EB 1ET9A 4N59A 1L0VB 1TS5A 3AEEB 1TS3A 1F77A 4NZLB 3ZQ4A 4DXGA 1QOFA 4ZOHC 1FM0D 2WXFA 1FFVA 4KGSA 2BS3B 3P63A 3P4SB 1AYFA 1DYQA 3PZ8A 1GOZA 2B76B 3GS2A 1GB4A 5HI1A 2INNE 1ZXIA 1C4CA 3W9CB 1IGDA 4ZRQA 4A55A 1B1ZA 1WSPA 2OHFA 3FAHA 1RYJA 3CIRB 1E0ZA 2CJNA 1KH0A 1ZPSA 2PTLA 1K51A 1PGAA 1VJKA 3E56A 2WXOA 1OQRA 3BZDB 1T3QA 4D2KA 2GB1A 1SSNA 1FFUA 3TSSA 3AB5A 1N62A 5BMGA 2Z8LA 2XN9C 2L52A 1I4HA 3U7ZA 5BMIA 3SEBA 1WXQA 3TEZA 2WXGA 3BYYB 4TQ1A 2JWUA 2DWQA 1CK1A 1FD6A 2R61A 3EGRA 3VQIA 3HVZA 1K53A 2M56B 4WWMA 2I38A 5BYRA 1YN5A 4NAMA 2L1AA 2I2YA 1CQVA 3B2GA 1SE3A 1QILA 2L83A 1SXTA 1ET6A 1HZ6A 2V3NA 4L2YA 1NVID 3B2FA 2VZKB 2QJLA 3CWIA 3AEDB 1HXYD 3BWUD 1C76A 1MHHE 1T5XD 3H8HA 1YJIA 4KGTA 1SIJA 2JZPA 2PKOA 5BMHA 1EWCA 4N6EB 3MP9A 5EE1A 2DBYA 2CU3A 4YSZB 1GAQB 3AE3B 3U2SC 1JALA 1TKEA 2V0GA 1IUEA 1MVKA 4XDDA 2M19A 4IOIE 1I7HA 1L5PA 3NZ3A 1UNSA 5TSSA 1FNVA 3KLSX 4C7ZA 1ZDXA 2WXPA 3Q8AA 4HKQA 1LO5D 1NENB 3AEAB 3MFGA 3O13A 2N0SB 1NEKB 3MC0B 3ZGZA 4PT5A 1VDVA 2WNMA 4LLGM 1N61A 3AE8B 1WGKA 5GXGB 2N7JA 5D3IB 1PGXA 2HTME 4MM3B 1VZ6A 1K52A 2PIAA 4A8XC 1AN8A 4RGNA 1QLBB 3URYA 4RCOA 3AE5B 4DQOC 1QT9A 5EE9A 1FRRA 1QKZA 2J42A 3T3OA 1PUTA 1YQ4B 1QOAA 5HFYA 4J3OD 1TY0A 1JWUD 1RWSA 3HUIA 2RPVA 4RF1A 4AS1A 2IDYA 3B9JA 4IDIA 5AUIA 5T8IA 1YN4A 1N5XA 3AE4B 2SEBD 2IJ0A 3AH7A 1AW7A 4TSSA 1MI0A 2WU5B 1C4PA 4M0WA 4ARIA 1XLOA 1EU3A 2MJ3A 3NVWA 2J52A 4O1NA 1NI3A 3BYTB 1CZPA 3SR6A 3TUOA 4TQ0A 1WRIA 1XLNA 1YJJA 2H89B 5LNK1 2WQYB 3ABVB 2INPE 1KLGD 3Q8BA 2MH7A 3AM9A 4ITKA 1F2RC 1SF0A 2QILA 2K0PA 2W82A 3BVZA 5H92C 2LMCA 2RMMA 5EE0A 1KFYB 3NVVA 4HEA1 1YN3A 2IPKD 2LEKA 5D3DA 4XWWA 2E3TA 1I4RA 2EKIA 1ROEA 5FR3A 1SBBB 2IGHA 2X38A 2BB6A 2LGIA 3R2TA 4B0MA 2JQRB 1V1OA 3Q8EA 2VZKD 4ZYSA 1D5MC 1FRDA 2G1EA 4L1BA 1N60A 1QQRA 3RPFC 1MHXA 1PGBA 4DXFA 3V05A 1QF6A 1E9MA 2JYTA 1F2RI 2ACZB 2BTEA 3ZJTA 3AMZA 2N9LA 5G5HA 5MPOA 1D5XC 1Y56A 2DYOA 1L4ZB 3BIID 2ZW1A 2Q5WD 2MJEA 1HZ5A 3TEWA 2ONQA 1WYGA 2MJDA 4R3DA 2WDQB 1J7CA 2WXRA 1VZ7A 2KDMA 2TSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJG E;  1YMH E;  1MVK A;  2QMT A;  3FIL B;  2GI9 A;  4IOI E;  2LHD A;  3MP9 A;  2N7J A;  1PGX A;  2LUM A;  2QSD A;  1FCL A;  1UWX A;  1YNT E;  1K52 A;  1P7E A;  1EM7 A;  1XCQ L;  4HKZ E;  2IGD A;  1D4B A;  1QKZ A;  2JSV X;  2KWD A;  2ON8 A;  5HFY A;  2NMQ A;  2ZW0 A;  1IBX B;  2RPV A;  2JXT A;  4MAC A;  1GB1 A;  3GB1 A;  1K50 A;  1Q10 A;  4KGR A;  1MPE A;  4KGS A;  1MI0 A;  2KQ4 X;  2J52 A;  1GB4 A;  4OZC A;  5HI1 A;  2PLP A;  4OZB A;  3FIL A;  1IGD A;  2N9K A;  2EEL A;  1KH0 A;  2JU6 X;  2PTL A;  3V3X A;  1JML A;  1K51 A;  1PGA A;  1F2R C;  3UI3 A;  2K0P A;  5HG2 A;  4D2K A;  2GB1 A;  2RMM A;  5HHD G;  2IGG A;  5BMG A;  2IGH A;  4WH4 A;  5BMI A;  1IGC A;  2LGI A;  2LHE A;  2JWU A;  1FD6 A;  1K53 A;  1MHX A;  1FCC C;  1PGB A;  2KN4 A;  1HEZ E;  1IBX A;  2I38 A;  1P7F A;  2J53 A;  1XF5 L;  1F2R I;  2I2Y A;  1XCT L;  5JXV A;  1ZXH A;  2N9L A;  1HZ6 A;  4OZA A;  2ZW1 A;  1MHH E;  1HZ5 A;  2ONQ A;  4KGT A;  2JZP A;  5BMH A;  1C9F A;  4GLS C;  2OED A;  2KDM A;  4IKG A;  2PW9 A;  2KAC A; 
#chains in the Genus database with same CATH topology
 1ENF A;  1WXA A;  4GDK B;  2J0K A;  1LGR A;  2KDB A;  2KLC A;  2JUO A;  3IT6 B;  3ZJU A;  2CU1 A;  4HDQ A;  3OLM D;  4MJS A;  1Z5S B;  4C56 C;  4RNA A;  2PVG C;  2KVZ A;  1JWS D;  1WE6 A;  2D3B A;  4C4V B;  1KM7 A;  2QSD A;  2WLB A;  2NTT A;  3W2D A;  4KDI C;  4EFO A;  4YTM B;  1RFA A;  2WDV B;  3DBH B;  3DBR I;  1QOB A;  3BVM A;  1KOT A;  3IAS 1;  2D3G A;  3PS6 A;  1BUI C;  3QA8 A;  3H9D A;  4HRS A;  2Z0E B;  2K6Q A;  1C78 A;  2YEP F;  3HRD D;  4P1C C;  4REZ A;  4J6I A;  2NMQ A;  2NPT A;  2ZZP B;  1YOV B;  4RGO S;  4MAC A;  3A4S C;  5BYQ A;  1TS4 A;  4GOC A;  3PRZ A;  1K8R B;  1Q10 A;  2LAS A;  3KWV A;  3N20 C;  4MGZ E;  1Z2M A;  4G3X B;  3KVF B;  4AP4 C;  2JZ3 B;  2PLP A;  1J7A A;  5C3J B;  4FJV B;  4KKJ A;  2EEL A;  2ZPN A;  2WX0 A;  1E8W A;  2BB5 A;  4YT0 B;  5HHD G;  2L05 A;  2H88 B;  3VH4 B;  2E6X A;  3RZW C;  3V62 A;  2KVR A;  5J18 A;  2KN5 A;  4NJC A;  2KJ6 A;  3EC8 A;  3LJ3 A;  2PVO D;  4JLC A;  2AX5 A;  2VH1 A;  1ZKH A;  3AV8 A;  3Q8C A;  2KWU B;  2GLS A;  3NJT A;  5IA7 A;  3M3J A;  2IO1 B;  4IC7 B;  4MGI E;  4YSX B;  2V3P A;  5BYS A;  1DGJ A;  4IKG A;  4AQ7 A;  1YMH E;  3P1M A;  4DHJ B;  2A4Z A;  4XDC A;  3C0R B;  3U52 E;  1P1A A;  4ZHO A;  4W9H A;  4MT5 A;  3HIZ A;  3DBS A;  4JWU C;  2DEN B;  2JVC A;  5J2R A;  3BVG A;  3DWG C;  2HDE A;  3RNB C;  2KO3 A;  2WXN A;  2IGD A;  2W55 A;  4A20 A;  4ANU A;  2LI5 A;  1D4B A;  4B95 A;  5LXI B;  1KRH A;  4ARC A;  2Y5C A;  3SFE B;  1ZP0 B;  1PYW D;  3GB1 A;  4DXA B;  3BY4 B;  1SE2 A;  1I4P A;  2BS2 B;  5C23 A;  1R4M B;  4NAW B;  3NZS A;  3RYT A;  2D2Q A;  5J17 A;  4GN1 A;  1QOG A;  2BPS A;  1RLF A;  2LRW A;  3KWL A;  3AEC B;  1CMX B;  3TMP B;  4W9I A;  5BO4 B;  2DHZ A;  2J0M A;  3LB8 C;  4N9F 4;  1ESF A;  2FID A;  1MG4 A;  3Q3N C;  1WXS A;  3OWE B;  3L08 A;  3L54 A;  3W5U B;  4KVG B;  3ZXV A;  2M4N A;  2WP9 B;  1YQ3 B;  4I6L B;  3JYU A;  4HWI B;  3H1U A;  3P4P B;  3NUH B;  1D6E C;  2JZZ A;  4LNN A;  2JPH A;  4XC2 A;  1ZXH A;  2G4D B;  2ZPY A;  4LTU A;  2QIE B;  4NNJ B;  1E8Z A;  3NS1 A;  3WAP A;  2MBQ A;  2JYE A;  2L0F A;  2L0T A;  3R8B A;  3VH3 B;  1TJE A;  2KAC A;  3A9J A;  4JQW C;  1VZ8 A;  1X1M A;  1RAX A;  1PFD A;  1WJ6 A;  4E71 A;  4K7U A;  3IT4 B;  1FEH A;  3FIL B;  1XO3 A;  4WUR A;  3LYY A;  3AN1 A;  1WXV A;  1ZDV A;  2L32 A;  2G3Q B;  2DZI A;  4ASW C;  4EOY A;  2GRI A;  4B0E A;  1SE9 A;  5D94 A;  3ZUN A;  1EU4 A;  2WXI A;  3KUD B;  4ICV A;  4ZHP A;  3ONS A;  2KWD A;  3ZYY X;  4YTP B;  1L0Y B;  2EMT A;  1KTK A;  1L6U A;  1TKG A;  4LJO B;  5LLI A;  1V1P A;  4FAD A;  4NZL B;  3PTF C;  3VVW B;  4TKN A;  4K7S A;  2B76 B;  1WR1 A;  2REX A;  1C4C A;  3PHX B;  3DBL B;  1WSP A;  2MSE D;  1RYJ A;  1KH0 A;  1ZPS A;  1J8C A;  3QK0 A;  4X57 B;  1WFY A;  1WMH B;  4D2K A;  2GB1 A;  3PZD A;  1TIF A;  1SSN A;  5L95 C;  1L2N A;  1HTQ A;  1N62 A;  4HDO A;  4BKS D;  3ZIM A;  3ZNG C;  1D3Z A;  2DWQ A;  4E3C A;  4BKS A;  3U8Z A;  1CK1 A;  3VQI A;  2FCM A;  2M8S A;  1VCB A;  4ACF A;  1GC7 A;  4WWM A;  3R3M A;  3GZN B;  5BYR A;  2DZM A;  1PQS A;  2L83 A;  2D10 A;  2UU7 A;  4KV2 A;  4II2 B;  4WJP A;  3B2F A;  2EMS A;  2QJL A;  3APF A;  3AED B;  3CWI A;  3Q2A C;  5CHW A;  4IWP A;  2GBN A;  1MHH E;  2L00 B;  4BKG A;  1SIJ A;  2BYE A;  5BMH A;  2MWS B;  2DBY A;  4LDT B;  3U2S C;  1TKE A;  2V0G A;  1OQY A;  5TSS A;  1UNS A;  1FNV A;  3KLS X;  2WXP A;  1LO5 D;  1J0G A;  3RMK C;  3AE8 B;  3WAO A;  2ZEQ A;  4G11 A;  4AUQ C;  2D11 A;  2Z59 B;  2KDE B;  1AN8 A;  4RGN A;  3URY A;  5IO9 A;  4DQO C;  1FRR A;  2MRP A;  4WWO A;  3T3O A;  1PUT A;  1QOA A;  2QCZ A;  3VFK A;  1JWU D;  2HE7 A;  2RPV A;  2KK8 A;  3B9J A;  3DQV A;  3PPA A;  1P98 A;  3RCZ A;  2SEB D;  2WYQ A;  3ZRF A;  1MI0 A;  1C4P A;  1MFW A;  4ARI A;  1XLO A;  1EU3 A;  2FUH B;  3NVW A;  3BYT B;  2XBB C;  1WF9 A;  3NHE B;  2AL3 A;  3QAQ A;  2W9N A;  2KFK A;  2INP E;  3AUL A;  2V4L A;  1SF0 A;  1NBF C;  2LGX A;  2QIL A;  3DHG C;  5H92 C;  2LMC A;  4XYC A;  1YN3 A;  2KAN A;  3DPD A;  3SHQ A;  1I4R A;  4ANV A;  5FR3 A;  2IGH A;  1QZE A;  2BB6 A;  2N1V A;  4B0M A;  2JQR B;  3RN9 C;  4F1S A;  1LM8 B;  3Q8E A;  3EHV A;  3RPF C;  1MHX A;  3IBE A;  1QF6 A;  2LRU A;  1E9M A;  1F2R I;  1GC6 A;  3ZJT A;  2DNF A;  5CHF A;  1D5X C;  2FCN A;  3AU4 A;  1H4R A;  4IM0 A;  3PRE A;  1V81 A;  2NR2 A;  2WDQ B;  2M19 A;  3Q8B A;  2KDM A;  3TIX A;  3UQB A;  4CQN A;  5KHQ A;  4ZDV A;  4XX5 A;  2HD5 B;  1D5Z C;  2KMA A;  1VLB A;  2LJ5 A;  1TZO A;  4P6V F;  4MEM A;  1WH3 A;  3AE2 B;  3QCA A;  2FE8 A;  2GBM A;  3L13 A;  3MJW A;  2N7E A;  2KMM A;  3VR8 B;  3TJP A;  1YQB A;  2FCQ A;  2QEJ C;  1NYQ A;  2NBV B;  1V80 A;  1C1Y B;  3VTU A;  3L17 A;  1WX7 A;  2KNB A;  3ZO5 B;  1JWM D;  3ZNI D;  3EFU A;  4HPL B;  4GDL A;  1ISN A;  2DLB A;  1G6J A;  2RPQ A;  4AJY B;  4OZC A;  4A90 A;  5G55 A;  2AQ2 B;  3HHM A;  1C79 A;  2VH2 A;  1I35 A;  2W54 A;  4WJQ A;  2CR5 A;  1WJU A;  2PEA A;  3ZTD A;  3RNG C;  3T8M A;  2D3A A;  3PV1 A;  2R2Q A;  3TEY A;  1WXM A;  3EUB 2;  2D07 B;  2J53 A;  4FJY A;  1E5W A;  2NPT B;  5E6P A;  2O2V A;  3DWM A;  1L7Y A;  2PE6 B;  2KKC A;  3P42 A;  4YXD B;  2KQS A;  4DDI D;  4IM2 A;  3QX1 A;  4YTN B;  4HJG E;  3AEF B;  3B1L X;  1SEB D;  2KFJ A;  2MW5 A;  2KYW A;  4KIK B;  4ZRP A;  1R7S A;  2FCS A;  3PVL A;  3KW5 B;  2MP2 B;  2IO0 B;  1JRP A;  4WIP A;  2K9X A;  2JT4 B;  1U4A A;  3BK2 A;  1DOY A;  3NOB A;  3P4Q B;  3A1Q A;  1YNT E;  2G45 B;  2CS4 A;  1T0R C;  2J4X A;  2KT7 A;  3N3K B;  1N5W A;  4BBN F;  3TEX A;  4DHZ E;  3VXW A;  3WCQ A;  1EUV B;  2PMV A;  3NZU A;  1LXD A;  1I4Q A;  3B0A A;  4XWT A;  2JXT A;  4EUT A;  4MH0 E;  2XK5 B;  3CST A;  3AE7 B;  3W1S A;  1MPE A;  3GZN I;  4GMV A;  2ZVO A;  2KQ4 X;  3ETR A;  3RNA C;  2W3R A;  3GP7 A;  4NPN A;  4US9 A;  1JWA D;  4ANW A;  4WJO A;  2Y5B B;  1UF0 A;  2FBW B;  5IN7 A;  5JH5 C;  1V8C A;  1JML A;  1SE4 A;  1HE8 A;  3Q8F A;  1TKY A;  3SU8 X;  3O65 B;  1WIA A;  1UUP A;  4BAX A;  5DPT A;  2ICI A;  1I4G A;  3UIO B;  4C80 A;  3QQ8 B;  2KAJ A;  3Q3F A;  3AE1 B;  4TUU A;  5C1Z A;  1J7B A;  5I4D A;  4S17 A;  4PS8 A;  1FCC C;  4RGT A;  2ZNV B;  1UBQ A;  4DHZ B;  2V1Y A;  3R7R A;  2YEP B;  1IBX A;  1XF5 L;  2JRI B;  1EWY C;  2CKH B;  4ZRJ A;  3FC4 A;  3IHP C;  1T6B X;  4N58 A;  1WWT A;  3KH0 A;  1ZW7 A;  1OQQ A;  2KOX A;  3AE9 B;  2WXJ A;  4BOS C;  1Q5W B;  4NJ7 A;  1WGG A;  3HK0 A;  1SJH D;  2IND C;  2DX5 B;  1WY8 A;  1GUA B;  3V60 A;  3IXS A;  1GG3 A;  3WA0 A;  1VRA B;  1ZUD 2;  2BQQ A;  2MBO A;  5DPS A;  3L0W B;  5TR5 A;  2WXH A;  4OHJ A;  1HQR D;  4JPS A;  4OW0 A;  1L4D B;  4H2A A;  3ZJV A;  2GOW A;  2QHO A;  4K7W A;  4IWO A;  2IBI B;  3KYD D;  4C7Y A;  3DCG A;  3KUZ A;  2BWF A;  1R4N B;  5C2T B;  3ZVV A;  4PYU A;  1ZGU B;  3QAR A;  2K3U A;  1E6E B;  1ET9 A;  1WZ0 A;  2IO2 B;  2K8H A;  4N59 A;  3NS8 A;  4C4V A;  2A5U A;  4LCD E;  1F77 A;  5JHB A;  1QOF A;  1FM0 D;  2WXF A;  4CO7 A;  1FFV A;  4KGS A;  2BS3 B;  2RDB C;  4M8M A;  3P63 A;  3P4S B;  1TZ1 A;  3PZ8 A;  1GOZ A;  3GS2 A;  1GB4 A;  1WM3 A;  1WRD B;  1V86 A;  3W9C B;  1IGD A;  4XZ4 A;  1B1Z A;  3FAH A;  3CIR B;  2KQ7 A;  4DBG A;  3E56 A;  1FPY A;  1OQR A;  3BZD B;  1MG8 A;  1YD8 U;  3X0W A;  1FFU A;  3UF8 A;  3AB5 A;  2C7M B;  2Z8L A;  5BMI A;  2EKE C;  1WXQ A;  3ALB A;  2WXG A;  1V5O A;  3BYY B;  2JWU A;  2D3C A;  4B6W A;  1FD6 A;  2R61 A;  4BVU C;  3HVZ A;  4HXD A;  1K53 A;  4FHK A;  4K3C A;  4TV3 A;  4AJW A;  2M56 B;  3Q3O C;  4NAM A;  1ET6 A;  1WI0 A;  2V3N A;  4FHJ A;  1HXY D;  3BWU D;  4PS3 A;  1YJI A;  1TBE A;  2PKO A;  3ZLZ A;  3MC8 A;  1EWC A;  3MP9 A;  4JIO U;  3AE3 B;  5KHO A;  4FJZ A;  1MVK A;  4IUM B;  2LVO A;  2KJH B;  2JWZ A;  1ZDX A;  4HKQ A;  1NEN B;  4LJP B;  2N0S B;  3VTW A;  3PLV A;  1V2Y A;  3APC A;  3JSV B;  2N7J A;  3S2A A;  4MM3 B;  2C5L C;  5DPR A;  2M1M A;  4DHJ D;  1E7U A;  4MGK E;  4A8X C;  1WGR A;  3Q14 C;  3ZNH B;  2MQJ A;  3EFC A;  1QLB B;  4RCO A;  1YX6 B;  1QT9 A;  2KTF A;  2N4F A;  5EE9 A;  1P3Q U;  2AYO B;  1YQ4 B;  4J3O D;  1LQB A;  4RF1 A;  4AS1 A;  2CHZ A;  2YVC A;  2DAJ A;  2KX0 A;  1MJD A;  4MGY E;  1AW7 A;  4TSS A;  2BKF A;  2C7H A;  4M0W A;  3TBL D;  2MJ3 A;  5JZE B;  4O1N A;  1XLN A;  5L83 A;  2CHX A;  2DZJ A;  2N1W A;  1OEY J;  1SGH A;  2MH7 A;  4KSL C;  3V6C B;  2K0P A;  4MSM B;  2BVC A;  1KFY B;  2IPK D;  2MCN B;  3DHH C;  2E3T A;  2V3S A;  4MSQ B;  4XWW A;  1V5T A;  1ROE A;  3Q3M C;  2X38 A;  2LGI A;  2K1F A;  5D2M B;  1FRD A;  2PPH A;  1PGB A;  4DXF A;  2JYT A;  2ACZ B;  4FUL A;  3AMZ A;  5G5H A;  1F52 A;  2DYO A;  3BII D;  1HZ5 A;  2MA9 B;  1EO6 A;  2B3A A;  2ONQ A;  1WYG A;  2K25 A;  1UGM A;  2LUM A;  2OED A;  2Z0D B;  3ECI A;  4JX1 C;  2HJ8 A;  2KHW B;  3RFZ B;  2QMT A;  3Q69 A;  2Y5P A;  2WU2 B;  3N9Y C;  3DBH I;  1E7P B;  1FO4 A;  4WAF A;  4RMA A;  4UDU C;  4QAY A;  3H7P A;  3Q3J A;  3E9S A;  2ZVN A;  4L23 A;  2HTH A;  1E8Y A;  5FKA C;  4FXC A;  1XLQ A;  2BS4 B;  2GBK A;  5E6J A;  2NS5 A;  2BW2 A;  2JSV X;  3DBR B;  1V9J A;  2AEH A;  4KSK C;  1WGY A;  4M01 A;  3N32 A;  1FMA D;  3I57 A;  3NVZ A;  1F9J A;  1GB1 A;  3VRA B;  2KX3 A;  1SIF A;  3U30 A;  3VRB B;  1XLP A;  1FXI A;  3SFD B;  3DVG Y;  4HVB A;  4OZB A;  1FNW A;  3HVD A;  1NDD A;  3MHZ A;  1I42 A;  2JU6 X;  4MEL A;  1UH6 A;  2N9P C;  5HG2 A;  1N6Z A;  4M02 A;  2K39 A;  4I6N B;  4P16 A;  1TYG B;  5AZF A;  4HLE A;  3NRZ A;  2MBE A;  3ENE A;  1OEY A;  3NVY A;  4RF0 A;  1E10 A;  4CYE A;  2AL6 A;  4RGM A;  2CHW A;  1ACC A;  2K5P A;  5LXH A;  2KN4 A;  1WMH A;  3PSE B;  1P7F A;  2XNA C;  3WAN A;  3N1Y C;  2G9H D;  1XCT L;  5JXV A;  5D6J B;  2KMC A;  4IG7 B;  4HJK A;  4G0N B;  4WWP A;  4JL9 A;  2KTR A;  3Q6B A;  1JRU A;  1ZE3 D;  2KJR A;  3IAM 1;  4W9D A;  4W9F A;  2K6D B;  2GI9 A;  3A9K A;  3PZ7 A;  3M63 B;  4EE2 A;  3R66 C;  4LDT D;  5EE3 A;  1KLV A;  4WJN A;  2KLG A;  2FAZ A;  1UWX A;  3GE8 C;  1EM7 A;  2WS3 B;  4HKZ E;  4AWJ A;  3VDZ A;  1XXG A;  2WGS A;  5AZH A;  4S0R A;  4M00 A;  2O6V B;  3W5V B;  4BKT A;  1JRO A;  2LWP A;  4YWG G;  1R4M I;  3LDZ E;  5IKC M;  1LFD A;  2PJH A;  3V61 A;  2WDR B;  1WM2 A;  3I9V 1;  1M94 A;  2LXC A;  2ZNV C;  2OJR A;  3N1Z C;  2NTS A;  4ANX A;  2N9K A;  3R2I A;  2BT6 A;  2LGY A;  1J19 A;  4NQL B;  5HKH A;  3V3X A;  2RDH A;  4FN2 A;  1BML C;  2BYV E;  4YSY B;  3PRM B;  3OJ4 B;  2NCN A;  5G5G A;  3QWZ B;  1TT5 B;  3KQ4 A;  1DOI A;  1IPG A;  2MLB A;  5AUK A;  1EF5 A;  1JW9 D;  5CTR C;  1HEZ E;  4K81 A;  2M0A A;  1FXA A;  3K9O B;  1S3S G;  4MJS B;  1WYW B;  4LNO A;  1IP9 A;  2YLM A;  2IY1 B;  2JX5 A;  3LXF A;  1UD7 A;  3RZF A;  2PW9 A;  4XE0 A;  1WX9 A;  2Y3A A;  5JHA A;  1BXT A;  2MHJ A;  3PHW B;  5AZG A;  3ZW3 A;  4WAA A;  1DOX A;  3BK1 A;  5IAA C;  4LNF A;  3DVG X;  3WIM A;  1AAR A;  4PK1 A;  4HPP A;  2DYM A;  2RDG A;  2BGF A;  3PO0 A;  2FIF A;  3SDL C;  4HRO A;  3X23 A;  3VR9 B;  1TS2 A;  2LFI A;  4HPM B;  1GPX A;  2FUG 1;  3WAL A;  4EKU A;  1IBX B;  3AEE B;  1TS3 A;  3DBL I;  4ZOH C;  1Q1O A;  2INN E;  2X8X X;  3GE3 C;  2KZR A;  2WDT B;  2INC C;  4A55 A;  3ZTC A;  2OHF A;  3IVF A;  2CJN A;  4W9G A;  3I5J C;  1K51 A;  1BT0 A;  4C00 A;  2K8C A;  3N1X C;  3ZDM C;  3TSS A;  3RD2 A;  2XN9 C;  2LXA A;  2I1J A;  3TEZ A;  4TQ1 A;  4EZK A;  2C60 A;  2IZV B;  1UEL A;  4FBJ B;  2KC2 A;  2L1A A;  2I2Y A;  1CQV A;  3B2G A;  1SE3 A;  3H7S A;  1NVI D;  2K8B A;  1C76 A;  3H8H A;  1V6E A;  4KGT A;  2KDF B;  2WX1 A;  4N6E B;  5EE1 A;  1GAQ B;  2KWC A;  3BIN A;  1IUE A;  3WAM A;  3RUI B;  4IOI E;  3NZ3 A;  3MFG A;  3AEA B;  3O13 A;  1S1Q B;  5DPW A;  4LLG M;  1N61 A;  1WGK A;  5GXG B;  5D3I B;  3A4R A;  4A3P A;  2HTM E;  2R2O A;  2PIA A;  2LD9 A;  3AU5 A;  3AE5 B;  4KIK A;  2QC8 A;  4PYZ A;  3R7Q A;  2NBW B;  5HFY A;  2J0J A;  4EEW A;  1TY0 A;  2MP2 A;  3HUI A;  4IW0 A;  1KJT A;  2IDY A;  3ML8 A;  2I1K A;  4II3 B;  5AUI A;  5T8I A;  1YN4 A;  2IJ0 A;  3AH7 A;  1WGD A;  2WU5 B;  1Y8R C;  2J52 A;  2LZ6 A;  5EDS A;  3TUO A;  4GDK A;  4TQ0 A;  2H89 B;  5LNK 1;  1YJJ A;  4P1B C;  1KLG D;  3ZRC A;  3AM9 A;  2LVP A;  2XK5 A;  3DVN V;  2W82 A;  4XGA B;  5EE0 A;  3NVV A;  3AI5 A;  3MTN B;  2L3Z A;  2EKI A;  1SBB B;  1YIW A;  3R2T A;  4W9L A;  3KYC D;  4ZYS A;  1D5M C;  1WR6 E;  4L1B A;  3A9J B;  1QQR A;  3RNE C;  1E8X A;  2BTE A;  2BKR B;  4ICU A;  1IYF A;  1Y56 A;  1L4Z B;  4JGH B;  2IO3 B;  2Q5W D;  2ZW1 A;  2MJE A;  2BYF A;  3TEW A;  2AWT A;  2WXR A;  4IM3 A;  3I3T B;  3MC9 A;  1VZ7 A;  2TSS A;  4M0W B;  2KXJ A;  1I4X A;  4HK2 A;  3P2B A;  1XEE A;  4K3B A;  3UIN B;  1WZ3 A;  2NBU A;  3AE6 B;  4RFB A;  1V1P B;  4LK0 M;  1FXT B;  2BBC A;  4OVU A;  1UGJ A;  2J7Q B;  4A9A A;  1RFK A;  3AXC A;  4DWF A;  4ZYN A;  3ZNZ B;  4ZRK A;  2UYZ B;  4KZ0 A;  2AQ1 B;  1PDX A;  3J9C A;  3M95 A;  4USA A;  1RM6 C;  2AQ3 B;  4WQO B;  3QC8 B;  3RI7 C;  4A6Q A;  4HCP B;  4KGR A;  3T3N A;  2C9W B;  2RSU A;  2WXK A;  1WGH A;  3VAW A;  3OG5 A;  4KKI A;  4MDK E;  3UQA A;  1N63 A;  3EA6 A;  3MJ5 A;  2JRH A;  4CHK A;  1L6V A;  1M4V A;  3UI3 A;  1HTO A;  1C4A A;  1T0Y A;  5CX3 A;  1FIQ A;  3M62 B;  2IGG A;  3QJZ A;  4FA6 A;  3H7P B;  3C19 A;  4NJ6 A;  4GIV A;  1NI2 A;  2N9E B;  2UWQ A;  5D7G A;  1XQQ A;  2WWZ A;  4NY0 A;  2D5G A;  2HJ1 A;  2RR9 A;  2WXQ A;  4OVZ A;  1WX8 A;  2K22 A;  3U4E G;  5FR6 A;  2N7D A;  4WQM A;  3RNC C;  3PRP B;  4NAW A;  2ZCB A;  4RM8 A;  1NYR A;  1C9F A;  4GLS C;  1STE A;  3DDC B;  2L76 A;  1UWM A;  4F8C B;  3NY5 A;  4TMA B;  1V49 A;  5IOI A;  1TY2 A;  1L0X B;  4K1R B;  2KD0 A;  2NVU I;  3ZDT A;  1FCL A;  1H8C A;  1AWD A;  1C77 A;  5AEK B;  2CJO A;  2PE9 A;  2XEW A;  1P7E A;  4JWS C;  3IG3 A;  1XCQ L;  4MH8 A;  1T0S C;  2KC1 A;  4LNI A;  2BYT A;  1JWB D;  4JE3 B;  4GU2 A;  3QIJ A;  3AEB B;  2KFK B;  3H6N A;  2OOB B;  4IWQ A;  3JSV A;  3APD A;  2W3S A;  1UBI A;  3P4R B;  3C8Y A;  4MM3 A;  4EZL A;  4DK5 A;  5E6O A;  4BZA A;  3OJ3 A;  1GNU A;  1K50 A;  1OFF A;  5CHV C;  3L4P A;  4URK A;  1V97 A;  2DZK A;  2KTR B;  2IY0 B;  1B9R A;  4GGQ A;  2WXL A;  2SAK A;  4BOZ B;  3FIL A;  3UGB B;  1JQ4 A;  2GBJ A;  4NQK E;  3W1S C;  3D32 A;  3A9K B;  2MEK A;  4KX6 B;  4P7I A;  1HA5 A;  4Q2J A;  4KDL B;  2DAF A;  2WXM A;  3T9L A;  1CJE A;  1KLU D;  4WH4 A;  1IGC A;  2ZCC A;  3IFW B;  2BF8 B;  3PGE A;  2LHE A;  2N9X A;  1WE7 A;  1XT9 B;  1GJZ A;  3EEC A;  2LGD A;  1A70 A;  4RM9 A;  1VD2 A;  4A3O A;  4OZA A;  4DDG D;  4US8 A;  1SB3 C;  3ZXR A;  1E7V A;  2KWV B;  1UZX B;  2V4I B;  1Q0W B;  3CSF A;  2V9H A;  2G4S A;  3TCA A;  1SJE D;  2LJI A;  2L8J A;  2RGF A;  3NG0 A;  2LHD A;  1VR9 A;  1OTR B;  3JW0 X;  3W1Y A;  3SD5 A;  1JCK B;  1F0Z A;  4ZRI A;  5E6N A;  4EZJ A;  4RH6 A;  3HM3 A;  3VUW A;  1R4N I;  1ZOY B;  2DYB A;  3PLU A;  4OVV A;  4GDL B;  1OGW A;  1TTN A;  1C3T A;  2ON8 A;  1FNU A;  3AEG B;  4B9K A;  5FK9 C;  2ZW0 A;  1KF6 B;  5H8Y E;  4F7Z A;  3OAW A;  1L0V B;  1TS5 A;  4M8N A;  4BBN C;  4DXG A;  3ZQ4 A;  3CMM B;  1AYF A;  1DYQ A;  2LVQ A;  5HI1 A;  3HM6 X;  1ZXI A;  2L7R A;  3JVZ X;  4ZRQ A;  1E0Z A;  2PTL A;  3DOW A;  1PGA A;  3FKY A;  2ZJD A;  1VJK A;  2GMI C;  2WXO A;  1T3Q A;  2O2V B;  3VHT C;  5BMG A;  5IP4 D;  2L52 A;  1I4H A;  3RUL A;  3U7Z A;  2KDI A;  3SEB A;  5GMV A;  2WHI A;  2LGS A;  3B08 A;  3RNF C;  1P9D U;  3EGR A;  3TL5 A;  4PS7 A;  3CF6 E;  2I38 A;  1RRB A;  1YN5 A;  3UIP B;  5G2N A;  3GOE A;  1QIL A;  1SXT A;  1HZ6 A;  4L2Y A;  2VZK B;  3VTV A;  2BWE S;  1T5X D;  2JZP A;  3A1Q B;  4G50 A;  2CU3 A;  4GSW A;  4YSZ B;  1YJ1 A;  2IYD B;  1JAL A;  4XDD A;  1TGZ B;  1I7H A;  1L5P A;  4LNK A;  4W9K A;  1WJN A;  3A33 B;  3L10 B;  4C7Z A;  3Q8A A;  3QHT A;  1NEK B;  3MC0 B;  4HCN B;  3ZGZ A;  4PT5 A;  2MBH A;  1VDV A;  2WNM A;  4E74 A;  1PGX A;  3K9P B;  4BFR A;  2OJW A;  1VZ6 A;  1K52 A;  1T0Q C;  2LUE A;  3I63 C;  1YX5 B;  1XD3 B;  4GXB A;  2M0X A;  3VUX A;  1QKZ A;  2J42 A;  3ML9 A;  1P0R A;  3V6E B;  2JF5 A;  3MHS D;  1RWS A;  3N30 A;  2FNJ B;  4IDI A;  1EF1 A;  5DCN A;  1N5X A;  3AE4 B;  2O6V D;  4GB9 A;  1NI3 A;  2ASQ A;  1CZP A;  3SR6 A;  4I6P A;  1WRI A;  2O6V A;  2WQY B;  2M17 A;  3ABV B;  2RD0 A;  4FLH A;  4KZC A;  2C7N B;  4ITK A;  4W9C A;  1F2R C;  3BVZ A;  2QDF A;  2RMM A;  4HEA 1;  1E90 A;  2LEK A;  2MBB B;  5D3D A;  1A5R A;  3DVN U;  3ZKJ C;  2JXX A;  1WJ4 A;  3DHI C;  1V1O A;  2GBR A;  2VZK D;  2G1E A;  3VUY A;  1N60 A;  2VRR B;  3PT2 B;  3V05 A;  3RT3 B;  4W9J A;  2MX2 A;  3L16 A;  2N9L A;  5MPO A;  4W9E A;  3KUC B;  2JY6 A;  1F1H A;  4AOF A;  4WWN A;  4YL8 A;  2MJD A;  4R3D A;  1J7C A;  3U7D A; 
#chains in the Genus database with same CATH homology
 4JX1 C;  1ENF A;  1I4X A;  3RFZ B;  2QMT A;  3Q69 A;  4GDK B;  4CQN A;  2Y5P A;  2WU2 B;  3N9Y C;  1XEE A;  3IT6 B;  3ZJU A;  3AE6 B;  1D5Z C;  1E7P B;  1VLB A;  4RFB A;  4RNA A;  4C56 C;  2PVG C;  1FO4 A;  4WAF A;  4UDU C;  1V1P B;  1JWS D;  1TZO A;  4LK0 M;  2LUM A;  2BBC A;  2QSD A;  2WLB A;  4P6V F;  2NTT A;  1UGJ A;  3AE2 B;  3E9S A;  3W2D A;  2FE8 A;  4YTM B;  2WDV B;  4L23 A;  4A9A A;  1RFK A;  5FKA C;  1QOB A;  4FXC A;  3BVM A;  1XLQ A;  2BS4 B;  3IAS 1;  1BUI C;  5E6J A;  4HRS A;  2KMM A;  3VR8 B;  2BW2 A;  2JSV X;  2AQ1 B;  1C78 A;  2YEP F;  1PDX A;  3HRD D;  3J9C A;  4REZ A;  4USA A;  2NMQ A;  1RM6 C;  2AQ3 B;  2QEJ C;  1NYQ A;  1FMA D;  3I57 A;  4RGO S;  3NVZ A;  4MAC A;  4A6Q A;  5BYQ A;  1GB1 A;  3VRA B;  1TS4 A;  1JWM D;  3VRB B;  1Q10 A;  4KGR A;  3T3N A;  1XLP A;  3KWV A;  2WXK A;  1FXI A;  2DLB A;  3SFD B;  4KKI A;  4OZC A;  4A90 A;  2PLP A;  4OZB A;  1J7A A;  5C3J B;  1FNW A;  3HVD A;  4KKJ A;  2EEL A;  1N63 A;  3EA6 A;  3MJ5 A;  3MHZ A;  2JU6 X;  1L6V A;  2AQ2 B;  2BB5 A;  1M4V A;  4YT0 B;  1C79 A;  3UI3 A;  5HG2 A;  2W54 A;  1C4A A;  5HHD G;  1FIQ A;  4P16 A;  2IGG A;  2H88 B;  1TYG B;  2OED A;  2E6X A;  3NRZ A;  3NVY A;  4NJC A;  5D7G A;  4RF0 A;  1E10 A;  4RGM A;  3TEY A;  1ACC A;  2K5P A;  3EUB 2;  2KN4 A;  2PVO D;  2AX5 A;  2D5G A;  1P7F A;  2J53 A;  2XNA C;  2G9H D;  1XCT L;  5JXV A;  2WXQ A;  3AV8 A;  4OVZ A;  3Q8C A;  3DWM A;  2K22 A;  3U4E G;  4WQM A;  3P42 A;  4YXD B;  4YTN B;  1NYR A;  2V3P A;  1DGJ A;  4GLS C;  4YSX B;  5BYS A;  1C9F A;  1STE A;  4IKG A;  1ZE3 D;  3IAM 1;  4AQ7 A;  4HJG E;  3AEF B;  1UWM A;  1YMH E;  1SEB D;  4TMA B;  3P1M A;  2GI9 A;  1TY2 A;  1L0X B;  3PZ7 A;  4ZRP A;  1R7S A;  4XDC A;  4EE2 A;  3U52 E;  5EE3 A;  4ZHO A;  4MT5 A;  1JRP A;  4WIP A;  2K9X A;  4JWU C;  3BK2 A;  1DOY A;  1FCL A;  3P4Q B;  1AWD A;  1UWX A;  1C77 A;  1YNT E;  3BVG A;  3DWG C;  2HDE A;  2CJO A;  2J4X A;  1P7E A;  1EM7 A;  4JWS C;  1XCQ L;  2WS3 B;  2WXN A;  1N5W A;  4HKZ E;  4MH8 A;  3TEX A;  3WCQ A;  2IGD A;  2W55 A;  2PMV A;  1D4B A;  1XXG A;  1I4Q A;  2BYT A;  1JWB D;  4JE3 B;  3W5V B;  3AEB B;  1KRH A;  1JRO A;  4YWG G;  4XWT A;  2W3S A;  4ARC A;  2Y5C A;  2JXT A;  3P4R B;  3C8Y A;  3SFE B;  2WDR B;  1ZP0 B;  1PYW D;  3AE7 B;  3W1S A;  3I9V 1;  3GB1 A;  1K50 A;  1MPE A;  1SE2 A;  1I4P A;  1OFF A;  2BS2 B;  3L4P A;  1V97 A;  2KQ4 X;  3ETR A;  2W3R A;  3GP7 A;  4NAW B;  4US9 A;  1B9R A;  2WXL A;  1JWA D;  2SAK A;  1QOG A;  2FBW B;  2NTS A;  3FIL A;  2N9K A;  3R2I A;  2BT6 A;  1JQ4 A;  1V8C A;  3KWL A;  3AEC B;  3V3X A;  1JML A;  1SE4 A;  2RDH A;  2MEK A;  4KX6 B;  1HA5 A;  1BML C;  3LB8 C;  3Q8F A;  4Q2J A;  4YSY B;  1TKY A;  1ESF A;  1UUP A;  5G5G A;  2WXM A;  3OWE B;  1CJE A;  2ICI A;  3W5U B;  1I4G A;  1KLU D;  4C80 A;  4WH4 A;  2KAJ A;  1IGC A;  3KQ4 A;  2WP9 B;  1DOI A;  1YQ3 B;  2LHE A;  3AE1 B;  5AUK A;  3P4P B;  1JW9 D;  1J7B A;  3NUH B;  5I4D A;  1D6E C;  1FCC C;  4RGT A;  1HEZ E;  1IBX A;  2YEP B;  1XF5 L;  1A70 A;  2M0A A;  1EWY C;  1FXA A;  1ZXH A;  3FC4 A;  4LTU A;  1T6B X;  4N58 A;  2QIE B;  1WWT A;  4OZA A;  4US8 A;  3NS1 A;  2JYE A;  1OQQ A;  3AE9 B;  1SB3 C;  2WXJ A;  2V4I B;  2JX5 A;  3LXF A;  3R8B A;  2PW9 A;  2KAC A;  1TJE A;  1VZ8 A;  4XE0 A;  1PFD A;  2Y3A A;  1SJE D;  2LJI A;  1SJH D;  3IT4 B;  1FEH A;  3FIL B;  1BXT A;  1XO3 A;  2LHD A;  3IXS A;  1VR9 A;  4WUR A;  3LYY A;  3AN1 A;  1VRA B;  1ZDV A;  2L32 A;  1ZUD 2;  1JCK B;  1F0Z A;  1DOX A;  2WXH A;  4OHJ A;  2GRI A;  3BK1 A;  4B0E A;  1HQR D;  4RH6 A;  4JPS A;  4OW0 A;  1L4D B;  1ZOY B;  4H2A A;  3ZJV A;  1EU4 A;  2DYM A;  2WXI A;  2RDG A;  3PO0 A;  4GDL B;  4HRO A;  4ZHP A;  3VR9 B;  1TS2 A;  4C7Y A;  2LFI A;  2KWD A;  3ZYY X;  2ON8 A;  1FNU A;  3AEG B;  1GPX A;  2FUG 1;  5FK9 C;  4YTP B;  1L0Y B;  5C2T B;  2ZW0 A;  1KF6 B;  1KTK A;  5H8Y E;  1L6U A;  1TKG A;  1IBX B;  2K3U A;  1V1P A;  1E6E B;  1ET9 A;  4N59 A;  1L0V B;  1TS5 A;  3AEE B;  1TS3 A;  1F77 A;  4NZL B;  3ZQ4 A;  4DXG A;  1QOF A;  4ZOH C;  1FM0 D;  2WXF A;  1FFV A;  4KGS A;  2BS3 B;  3P63 A;  3P4S B;  1AYF A;  1DYQ A;  3PZ8 A;  1GOZ A;  2B76 B;  3GS2 A;  1GB4 A;  5HI1 A;  2INN E;  1ZXI A;  1C4C A;  3W9C B;  1IGD A;  4ZRQ A;  4A55 A;  1B1Z A;  1WSP A;  2OHF A;  3FAH A;  1RYJ A;  3CIR B;  1E0Z A;  2CJN A;  1KH0 A;  1ZPS A;  2PTL A;  1K51 A;  1PGA A;  1VJK A;  3E56 A;  2WXO A;  1OQR A;  3BZD B;  1T3Q A;  4D2K A;  2GB1 A;  1SSN A;  1FFU A;  3TSS A;  3AB5 A;  1N62 A;  5BMG A;  2Z8L A;  2XN9 C;  2L52 A;  1I4H A;  3U7Z A;  5BMI A;  3SEB A;  1WXQ A;  3TEZ A;  2WXG A;  3BYY B;  4TQ1 A;  2JWU A;  2DWQ A;  1CK1 A;  1FD6 A;  2R61 A;  3EGR A;  3VQI A;  3HVZ A;  1K53 A;  2M56 B;  4WWM A;  2I38 A;  5BYR A;  1YN5 A;  4NAM A;  2L1A A;  2I2Y A;  1CQV A;  3B2G A;  1SE3 A;  1QIL A;  2L83 A;  1SXT A;  1ET6 A;  1HZ6 A;  2V3N A;  4L2Y A;  1NVI D;  3B2F A;  2VZK B;  2QJL A;  3CWI A;  3AED B;  1HXY D;  3BWU D;  1C76 A;  1MHH E;  1T5X D;  3H8H A;  1YJI A;  4KGT A;  1SIJ A;  2JZP A;  2PKO A;  5BMH A;  1EWC A;  4N6E B;  3MP9 A;  5EE1 A;  2DBY A;  2CU3 A;  4YSZ B;  1GAQ B;  3AE3 B;  3U2S C;  1JAL A;  1TKE A;  2V0G A;  1IUE A;  1MVK A;  4XDD A;  2M19 A;  4IOI E;  1I7H A;  1L5P A;  3NZ3 A;  1UNS A;  5TSS A;  1FNV A;  3KLS X;  4C7Z A;  1ZDX A;  2WXP A;  3Q8A A;  4HKQ A;  1LO5 D;  1NEN B;  3AEA B;  3MFG A;  3O13 A;  2N0S B;  1NEK B;  3MC0 B;  3ZGZ A;  4PT5 A;  1VDV A;  2WNM A;  4LLG M;  1N61 A;  3AE8 B;  1WGK A;  5GXG B;  2N7J A;  5D3I B;  1PGX A;  2HTM E;  4MM3 B;  1VZ6 A;  1K52 A;  2PIA A;  4A8X C;  1AN8 A;  4RGN A;  1QLB B;  3URY A;  4RCO A;  3AE5 B;  4DQO C;  1QT9 A;  5EE9 A;  1FRR A;  1QKZ A;  2J42 A;  3T3O A;  1PUT A;  1YQ4 B;  1QOA A;  5HFY A;  4J3O D;  1TY0 A;  1JWU D;  1RWS A;  3HUI A;  2RPV A;  4RF1 A;  4AS1 A;  2IDY A;  3B9J A;  4IDI A;  5AUI A;  5T8I A;  1YN4 A;  1N5X A;  3AE4 B;  2SEB D;  2IJ0 A;  3AH7 A;  1AW7 A;  4TSS A;  1MI0 A;  2WU5 B;  1C4P A;  4M0W A;  4ARI A;  1XLO A;  1EU3 A;  2MJ3 A;  3NVW A;  2J52 A;  4O1N A;  1NI3 A;  3BYT B;  1CZP A;  3SR6 A;  3TUO A;  4TQ0 A;  1WRI A;  1XLN A;  1YJJ A;  2H89 B;  5LNK 1;  2WQY B;  3ABV B;  2INP E;  1KLG D;  3Q8B A;  2MH7 A;  3AM9 A;  4ITK A;  1F2R C;  1SF0 A;  2QIL A;  2K0P A;  2W82 A;  3BVZ A;  5H92 C;  2LMC A;  2RMM A;  5EE0 A;  1KFY B;  3NVV A;  4HEA 1;  1YN3 A;  2IPK D;  2LEK A;  5D3D A;  4XWW A;  2E3T A;  1I4R A;  2EKI A;  1ROE A;  5FR3 A;  1SBB B;  2IGH A;  2X38 A;  2BB6 A;  2LGI A;  3R2T A;  4B0M A;  2JQR B;  1V1O A;  3Q8E A;  2VZK D;  4ZYS A;  1D5M C;  1FRD A;  2G1E A;  4L1B A;  1N60 A;  1QQR A;  3RPF C;  1MHX A;  1PGB A;  4DXF A;  3V05 A;  1QF6 A;  1E9M A;  2JYT A;  1F2R I;  2ACZ B;  2BTE A;  3ZJT A;  3AMZ A;  2N9L A;  5G5H A;  5MPO A;  1D5X C;  1Y56 A;  2DYO A;  1L4Z B;  3BII D;  2ZW1 A;  2Q5W D;  2MJE A;  1HZ5 A;  3TEW A;  2ONQ A;  1WYG A;  2MJD A;  4R3D A;  2WDQ B;  1J7C A;  2WXR A;  1VZ7 A;  2KDM A;  2TSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...