4OZAA

Backbone modifications in the protein gb1 helix: beta-3-ala24, beta-3-lys28, beta-3-gln32, beta-3-asp36
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
52
Chain Sequence
DTYKLILNGKTLKGETTTEAVDATAEVFKYANNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptococcal Protein GB1 Backbone Modified Variant: beta-3-
publication title Folding Thermodynamics of Protein-Like Oligomers with Heterogeneous Backbones.
pubmed doi rcsb
molecule tags De novo protein
total genus 12
structure length 52
sequence length 56
ec nomenclature
pdb deposition date 2014-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ozaA00
3V3XA 2PW9A 1MPEA 2RPVA 1K53A 1F2RI 2GB1A 1YMHE 2JSVX 3MP9A 1GB1A 2QSDA 2JU6X 4OZBA 5HI1A 2N9LA 2NMQA 5HFYA 1K52A 1EM7A 1K51A 1MHHE 2JXTA 2KN4A 2OEDA 3GB1A 1P7EA 2LHEA 2KACA 2N9KA 2QMTA 2JZPA 2ONQA 4IKGA 4KGTA 1MI0A 1FD6A 1IBXB 1F2RC 1YNTE 2EELA 2ON8A 1ZXHA 1FCCC 5HG2A 2RMMA 2LGIA 4D2KA 2I2YA 1JMLA 2KWDA 1UWXA 2LHDA 4KGRA 1HZ6A 1Q10A 4MACA 1IGCA 1XF5L 2K0PA 4IOIE 1XCTL 2GI9A 1C9FA 1K50A 5BMHA 5BMGA 1HEZE 1IBXA 3FILB 1FCLA 1GB4A 2LUMA 1HZ5A 5HHDG 4GLSC 2J53A 4KGSA 5BMIA 4HKZE 2KQ4X 2ZW0A 2IGHA 1P7FA 2ZW1A 2PTLA 1MVKA 4HJGE 4OZAA 5JXVA 2J52A 1IGDA 1PGBA 2JWUA 1PGAA 2IGDA 4OZCA 4WH4A 1MHXA 3UI3A 2IGGA 1PGXA 2N7JA 1XCQL 3FILA 2I38A 1D4BA 2PLPA 2KDMA 1KH0A 1QKZA
chains in the Genus database with same CATH superfamily
1SE3A 2KD0A 5IOIA 3SDLC 4YWGG 1K53A 1RLFA 2C9WB 1GOZA 2LRWA 3DVNV 2WGSA 1WMHB 3M63B 4IW0A 1NBFC 2JX5A 3A9KB 2H88B 1JWMD 1WGYA 5TSSA 1TY2A 3HM3A 1QF6A 2KN4A 4II3B 4GDLB 3C8YA 4NZLB 3V60A 4S17A 2BTEA 1BMLC 2PEAA 3BVZA 4MELA 1R4NB 2QMTA 4ZRQA 3JSVA 1FD6A 4NJ6A 1F0ZA 4UDUC 3E56A 3PLVA 3NRZA 2MEKA 2V3SA 3VTVA 3AV8A 3K9PB 4YSYB 3R8BA 3MJ5A 4NPNA 4C4VA 5D6JB 3GS2A 3BZDB 5FR3A 1GC6A 2LZ6A 2PVOD 2J0MA 4LJPB 1OEYA 2QC8A 1K50A 1ZE3D 1NYQA 1TIFA 1WX7A 2W54A 3HM6X 2AX5A 5C1ZA 5LLIA 3OAWA 4ZYNA 1UF0A 5CX3A 3TL5A 2FIDA 1RM6C 2LJ5A 5J18A 2R2OA 1UGJA 1NEKB 1J0GA 2KJHB 3DBLI 1S1QB 3ZTCA 1PGAA 4TMAB 5HKHA 1V2YA 5GXGB 3KWLA 2CR5A 2DLBA 1KRHA 2QCZA 2IYDB 1NDDA 1WZ3A 2DAFA 4MH8A 1RAXA 2C60A 4PYUA 4HCNB 1C76A 2KFKB 2PW9A 3DHGC 2AEHA 3W1YA 4XYCA 5EE3A 2PJHA 3KLSX 1C4PA 2SAKA 1Y56A 3MP9A 1Q1OA 4M8MA 1ISNA 3Q8AA 3T9LA 4YXDB 3DWMA 1P3QU 1SXTA 2WDRB 3Q69A 2BWFA 1JW9D 4RGTA 5L83A 1GPXA 3H7PA 1N62A 5E6OA 1TY0A 3P42A 4K3BA 3GZNI 1V1OA 2N9XA 1YN4A 3NVVA 4XGAB 4GB9A 2KLGA 3IT4B 4G11A 5D7GA 3PRZA 4D2KA 3TEYA 2KVZA 4ACFA 1LM8B 2HTHA 3A4SC 1M94A 2X8XX 2V1YA 3U30A 2DZIA 4MACA 1XF5L 2G9HD 1BT0A 2AWTA 1WJ4A 3RZWC 3KUCB 4A55A 2YLMA 4BFRA 3AE5B 4HEA1 1QT9A 3FILB 4ZYSA 2FCSA 2O6VB 1GAQB 3WIMA 3A4RA 1I7HA 2KANA 3NOBA 1HA5A 1P7FA 4F8CB 3PVLA 3DQVA 1WM3A 1WIAA 1SSNA 4K7WA 1E8XA 2CKHB 1R4MI 1V97A 1TS2A 2IGGA 2L32A 4DHZE 4ZRPA 3PZ7A 1GC7A 1WXSA 3ZUNA 2KWCA 4GXBA 4TSSA 1GNUA 5JH5C 2GBRA 2L0FA 2NVUI 2LJIA 1QLBB 1OQYA 3L4PA 5HI1A 4EZLA 2V0GA 2KDIA 3P4QB 3BIID 4HWIB 2MJ3A 4A3PA 3DVGX 3QHTA 3R66C 1P7EA 3RD2A 1EWYC 5JHAA 2YVCA 1D6EC 2UYZB 4PS7A 1JRUA 2D5GA 1ZP0B 1L4DB 3QARA 4YTPB 3OLMD 4AJYB 4EEWA 4EOYA 2AYOB 1FCCC 1YQBA 1B9RA 2JPHA 1Z5SB 3V61A 4KSLC 1UWXA 2IBIB 2CHXA 4LNNA 4MEMA 3PPAA 4K7SA 2IZVB 3ETRA 5D94A 3BVGA 3H8HA 3VUWA 2REXA 2K8CA 3DVGY 5LXIB 2W3RA 3TMPB 2LUMA 2WU5B 1QOAA 2A5UA 2J53A 1OGWA 3ZRFA 2KQ4X 3PRMB 2FUG1 1R4MB 4ANUA 2WXQA 2ZW1A 1SE2A 2D3AA 4LDTD 4P1BC 2K25A 2J52A 4E3CA 5G5GA 4BKTA 5FKAC 4NJ7A 4HPPA 1RFKA 3ZLZA 2D3GA 1EU3A 3R3MA 3P4PB 2WQYB 3BYYB 2M56B 4J6IA 3EECA 2BKFA 3KWVA 2LVOA 3U52E 2RDGA 2BS2B 2KDMA 2MBQA 2KQ7A 2D10A 1UZXB 2MBHA 1V1PA 2PE9A 4I6PA 1CJEA 2KXJA 1E7UA 1AN8A 4DXFA 2I1JA 1HXYD 1WXAA 1WH3A 4N59A 2WDQB 4FHKA 3SFEB 3W2DA 1YJ1A 4KVGB 4BAXA 1FRDA 4TUUA 1DOXA 3CWIA 2L83A 2K6DB 1T5XD 2FCMA 4BBNF 3TEWA 1STEA 2KTFA 4HPLB 1Z2MA 1ZXHA 4YL8A 4YSXB 4RFBA 2M0XA 1DYQA 4CQNA 4B9KA 1I4XA 4DHJD 1L0VB 2M4NA 4L23A 3I57A 5DPRA 1GUAB 3NVZA 1AARA 3APCA 2MW5A 1I35A 1X1MA 3OJ4B 2O2VA 5BMHA 1QOBA 1ESFA 2NBVB 1XLNA 3QC8B 4AUQC 2L00B 5HHDG 2OOBB 1YN3A 4AQ7A 2FCNA 2BB5A 3EC8A 4XWWA 3QX1A 1I4RA 3AEDB 2IGDA 1AYFA 3B2GA 3AU4A 1WJUA 2N7JA 4NQKE 3A1QB 1XO3A 4HCPB 3KYCD 2KDBA 2WXHA 5G2NA 5DPWA 4ICUA 2IY0B 1CK1A 3S2AA 4KX6B 1OQRA 5EE9A 2KJ6A 1FXIA 2KO3A 2N1WA 3P2BA 2DX5B 5KHOA 1N6ZA 4DXGA 2VZKB 3I5JC 2WX1A 2J0JA 4II2B 2R2QA 3U8ZA 4W9EA 2CS4A 3DCGA 4RGMA 3ZXVA 1V81A 2ASQA 4MM3A 1RRBA 3GP7A 1MI0A 4LNOA 3RZFA 2QEJC 2NS5A 2K8HA 3AM9A 2GLSA 4NAMA 2J42A 3AH7A 5D3DA 1FNVA 3AXCA 3B1LX 3ZRCA 1JMLA 2LHDA 2ZVOA 5E6JA 1EU4A 1ROEA 1QQRA 3JVZX 3B0AA 4IG7B 5FK9C 3ZXRA 2ZCCA 3ML8A 1FO4A 4FLHA 5BYQA 3EA6A 1E9MA 3L08A 1OTRB 2BGFA 4KV2A 2G1EA 3L13A 4W9JA 1WGRA 4FADA 4IWPA 3AN1A 3Q3NC 3N20C 1R7SA 1WF9A 3APDA 1TGZB 2BVCA 2QILA 1EUVB 2JWUA 2KC2A 2BF8B 4B95A 4G3XB 4BKSD 3Q3OC 3A33B 2NTSA 1NVID 1TZOA 4YSZB 2H89B 3CSTA 2MH7A 4A3OA 2DBYA 5BYRA 2PLPA 3APFA 4WQMA 2O2VB 1YIWA 4P16A 2K39A 5J2RA 4ZHOA 1V49A 3DOWA 5T8IA 2N0SB 1SIJA 2LWPA 4A20A 2GB1A 2BQQA 3TUOA 4G50A 3T3NA 5HFYA 4FBJB 4M0WB 1MHHE 2RR9A 4OW0A 3MC0B 2VH2A 3GB1A 1WXQA 2LGSA 5FR6A 4CYEA 5E6NA 4JX1C 1I4QA 5H8YE 1H4RA 3VRAB 3L17A 3ECIA 2DENB 1TYGB 4W9DA 3RI7C 1E8WA 3V6EB 1T3QA 4HROA 4GDKB 2JRIB 4CO7A 5L95C 2B76B 2KMMA 3ZKJC 4C00A 5D3IB 3AE1B 3AB5A 1WWTA 3K9OB 2HDEA 1JQ4A 3AEBB 2JY6A 5BYSA 1IBXA 2MWSB 4MGKE 4HKQA 2JVCA 3BY4B 4LLGM 5BMIA 3ABVB 1Q0WB 1ZKHA 2IGHA 2XNAC 4PS8A 1UBQA 2UWQA 3N3KB 5CHFA 1TBEA 2BYTA 2J7QB 1SE4A 2KWVB 2Y5CA 3H6NA 2L0TA 5IP4D 4NQLB 2LXAA 2Z0EB 4WQOB 4M00A 3BK2A 2IO3B 2ZEQA 1T0YA 1N60A 3ZNZB 4RF1A 1EWCA 2YEPF 3RNEC 1PQSA 4BKSA 2LD9A 2E3TA 2NPTA 3BYTB 4KDIC 4EE2A 1D4BA 3VFKA 1KLVA 3KW5B 3I63C 3V3XA 3BWUD 2GBNA 4B0MA 1L2NA 2BWES 3HUIA 1XLOA 4C80A 3JW0X 3GE3C 1T0SC 4OVVA 1IP9A 2OEDA 2KX3A 2N9PC 3VXWA 4DDGD 3NZUA 2K3UA 1WRIA 1HTQA 1ZOYB 3FKYA 3PT2B 4W9HA 2WXJA 1LGRA 1UWMA 1C4CA 3KUDB 3L54A 3Q8CA 5J17A 2G4SA 4LJOB 1TS5A 2JYEA 2IY1B 3V05A 3HIZA 3IBEA 3DDCB 1I4GA 4PS3A 3EGRA 4EFOA 3SD5A 1YD8U 2AL3A 1FFUA 4HDOA 3IHPC 3P4SB 1E0ZA 1H8CA 3U4EG 1KOTA 3L0WB 1QOGA 4IM2A 4YT0B 1J19A 2Y3AA 1GB4A 3NS1A 1FEHA 2M19A 1YN5A 2WXPA 4NNJB 3ZW3A 1WZ0A 1N61A 2I1KA 3C19A 3DBRI 5C2TB 4Q2JA 3R7RA 4MJSA 4TV3A 5EDSA 4HJGE 4C7ZA 1WSPA 3AE3B 2GBMA 2WXNA 3DBHI 4K3CA 2BPSA 5IA7A 4LNFA 1NYRA 3UIPB 1XCQL 2WLBA 3DBLB 2FCQA 3N9YC 4HPMB 1WE7A 3KYDD 3UQAA 2JF5A 3JSVB 2BW2A 4WIPA 2FNJB 1FMAD 1XLQA 5KHQA 3IXSA 2JU6X 4BBNC 3DPDA 2JXXA 2VZKD 1K52A 1UUPA 4C4VB 4GSWA 4ZDVA 4KKJA 1KM7A 1BXTA 1WJ6A 2V4IB 1WM2A 2RDHA 3PHXB 5G5HA 1S3SG 1WGKA 4WJQA 4WWMA 1C1YB 2LGYA 3VHTC 4HRSA 1KTKA 1IPGA 4NY0A 3TIXA 1E8YA 3HHMA 2V4LA 3CMMB 3DVNU 2NPTB 2WU2B 4YTNB 3ZDMC 4TQ0A 3N30A 1YQ4B 1CZPA 3M95A 4A9AA 1P9DU 3GZNB 4JGHB 4M01A 1HZ6A 2LGDA 1IGCA 1EF1A 1Q5WB 2CJOA 3EUB2 1C9FA 3GOEA 4ASWC 1T0QC 2DWQA 3NG0A 3DBRB 1WX8A 4BKGA 3ZGZA 4I6NB 1HZ5A 2LMCA 5TR5A 4KGSA 3PS6A 2MX2A 1E10A 3WALA 4EUTA 3FC4A 2BYVE 2RD0A 1MFWA 4US9A 3T8MA 4HXDA 2PTLA 3P1MA 2L8JA 2CU3A 3R2TA 4FA6A 2QDFA 4A6QA 4W9LA 4WWNA 2L52A 1QOFA 4YTMB 1SIFA 4BZAA 3SHQA 1SE9A 1WY8A 2V3NA 3VDZA 4PYZA 3TEZA 2XK5A 3X23A 4ANXA 3H7PB 3T3OA 4WWOA 4JWUC 4FULA 1QKZA 2WXOA 3RNAC 2MRPA 1LXDA 2OJRA 2GBJA 4W9GA 2MBOA 3CIRB 1ET6A 5H92C 1YQ3B 4ZRJA 1M4VA 3VVWB 2LASA 2MBEA 4KDLB 1VDVA 2NR2A 4MJSB 4DXAB 4TKNA 4WAAA 4AJWA 3Q3FA 1L6VA 1MG4A 2GOWA 1ACCA 4I6LB 3ZJVA 4IWOA 4IKGA 1V80A 1V5OA 1FNWA 1F77A 2INNE 2M0AA 3W5VB 2EELA 2ON8A 1VRAB 3QQ8B 3AULA 1PYWD 2NTTA 4DDID 1MJDA 1A70A 2LGIA 3VR9B 3SFDB 5JHBA 4RH6A 2DAJA 4DWFA 1B1ZA 5CHVC 3ZQ4A 2OJWA 3QIJA 1AW7A 2WXLA 3VTWA 1SB3C 2PE6B 1VZ6A 2WX0A 3Q8FA 1NI3A 2WXFA 3ZNGC 4QAYA 2KYWA 4JPSA 3PRPB 3NHEB 2MP2A 2CJNA 2JT4B 3VH4B 4MH0E 4OZCA 4WH4A 3V6CB 1JWBD 1WYGA 4RM8A 2L7RA 4N6EB 3RPFC 1I4PA 3A9JA 4US8A 1UNSA 2LI5A 2JRHA 2HE7A 2IO2B 3M62B 4PK1A 2AL6A 1WGGA 1YX6B 1P1AA 4GIVA 3VRBB 3MHZA 4IUMB 2L3ZA 2FE8A 2LVPA 2ZZPB 1TKYA 2JSVX 2IO0B 1GB1A 2WXRA 1WGDA 5LNK1 1DGJA 1K51A 1WI0A 2B3AA 2KTRA 2M1MA 2JXTA 2MLBA 1UELA 3NJTA 4IC7B 4IM0A 3Q8BA 1RWSA 3PGEA 3AMZA 5BO4B 2BBCA 2V3PA 4P1CC 4MGIE 2HJ8A 2EKIA 4EZJA 3W1SA 2XK5B 2PMVA 2ZVNA 4NJCA 3RMKC 1F9JA 3L10B 4K7UA 4LCDE 2DZJA 1WMHA 2W3SA 4XDCA 3VUYA 1V86A 1F1HA 3A9KA 4L1BA 1WR1A 2M17A 5EE0A 4LTUA 3NVWA 2N1VA 5LXHA 3IT6B 1FIQA 3ZTDA 1N5WA 3B2FA 2PVGC 2L76A 4ARCA 4RGOS 4ITKA 1A5RA 3LB8C 2WP9B 3AEEB 2HJ1A 2MJEA 1GG3A 1KF6B 2HTME 1XXGA 3MHSD 4HLEA 2LFIA 1L7YA 2JUOA 1V1PB 4A8XC 4XX5A 4JWSC 1V6EA 3B9JA 2BKRB 1MG8A 5DCNA 5MPOA 2K9XA 2LRUA 3RNBC 3UIOB 2HD5B 3QAQA 1ET9A 2WYQA 2O6VD 1HE8A 4GMVA 2I38A 1AWDA 3PREA 2BYFA 1SJED 1KH0A 3MTNB 2RPVA 4LK0M 3B08A 5I4DA 2WXMA 1FRRA 5DPTA 3BVMA 3ENEA 3QJZA 2FBWB 1N5XA 2DHZA 3AE9B 1E7VA 2VRRB 3PV1A 2MP2B 3PLUA 1XLPA 4ZRKA 1KJTA 2WWZA 3AEGB 4KGTA 3PZDA 4FN2A 1ZDVA 3EFUA 1ZW7A 2OHFA 2ZCBA 1YNTE 3AE2B 1TZ1A 4J3OD 3VTUA 4KIKA 3O65B 4EZKA 3DWGC 3EHVA 2Q5WD 3RNGC 3OWEB 1LFDA 5IO9A 1C78A 2ZPYA 3VH3B 1FXAA 4LDTB 4IOIE 3EFCA 2GI9A 1JWUD 4FXCA 5AUIA 1HEZE 3N1XC 4MGZE 1WX9A 3FAHA 4GLSC 3LXFA 2G4DB 1IUEA 2DNFA 4WURA 2KC1A 3VR8B 2ACZB 4W9IA 4ZOHC 2W55A 3W5UB 1JCKB 3CSFA 4KKIA 1GJZA 2J4XA 1FXTB 1MVKA 2ZPNA 4OZAA 5JXVA 5CHWA 2JZ3B 2NBWB 1E6EB 3GE8C 4C7YA 2CU1A 2WNMA 3O13A 2MQJA 4CHKA 3WA0A 4MT5A 2D3BA 3UI3A 2UU7A 3VQIA 3NS8A 2ZNVB 3SR6A 3ZJTA 3FILA 3WCQA 2O6VA 4MM3B 5DPSA 1FNUA 1TTNA 3AI5A 5AZHA 3WANA 3AECB 4JE3B 1V5TA 2QSDA 2KNBA 2RPQA 4OZBA 4FJYA 1ZGUB 4IM3A 4JQWC 1ZUD2 3OJ3A 4XC2A 1DOIA 3W1SC 2LUEA 1WYWB 4DHJB 3PZ8A 1FFVA 1XT9B 1EF5A 3AE4B 4OVUA 4WJPA 3QK0A 4GGQA 3ZVVA 1UH6A 1XQQA 4ZHPA 1CMXB 3WAMA 2CHWA 1TS3A 3RUIB 3HVZA 1JALA 2ZNVC 2FUHB 3IAS1 1NI2A 2V9HA 2QJLA 3DBSA 4HDQA 5G55A 2BYEA 2KWDA 5JZEB 3DHHC 3NY5A 1VD2A 1YJIA 3H1UA 2DZMA 1U4AA 4K81A 4FJVB 2KX0A 3IG3A 3AE8B 1TT5B 2E6XA 3IAM1 2L05A 3ZNHB 2EMSA 2AQ1B 3PSEB 1L0XB 2Y5BB 1TKGA 4G0NB 1FCLA 2Y5PA 3KH0A 4DHZB 1E7PB 1P98A 5IKCM 3ZNID 3R7QA 1KFYB 4USAA 4GN1A 1D5MC 4REZA 1YJJA 2KVRA 2K8BA 2IJ0A 1PGBA 4RNAA 2BS3B 4C56C 3L16A 4KIKB 1D3ZA 2R61A 1PGXA 2QIEB 3NZSA 3H9DA 4DBGA 4RM9A 1C3TA 4O1NA 2AQ2B 2VH1A 2KMAA 3JYUA 4IWQA 1F2RI 1WXVA 4AP4C 2XN9C 2PPHA 1J7BA 4PT5A 1DOYA 2BB6A 5C3JB 1J7CA 4HJKA 2WDVB 4S0RA 4OVZA 3UQBA 2ICIA 3RFZB 1KLUD 2KACA 2ZJDA 1I42A 1JWAD 3QA8A 1L4ZB 1IBXB 1ZXIA 1YX5B 3P63A 2KDFB 5HG2A 3NZ3A 3LJ3A 3AU5A 1D5XC 2MA9B 2K22A 1HQRD 2GBKA 2Z59B 3QCAA 2KDEB 2K6QA 1C77A 2PIAA 3TBLD 2INDC 4N9F4 1SJHD 3ZIMA 2Z0DB 3HK0A 1FM0D 2ZW0A 4H2AA 3IFWB 1E8ZA 1VZ7A 1VZ8A 2W82A 4MSQB 1IGDA 3ALBA 1C79A 3D32A 1MHXA 2WHIA 2KJRA 1LQBA 3E9SA 2AQ3B 1HTOA 2JZZA 3ONSA 3UF8A 2G45B 3DBHB 1IYFA 3Q6BA 4ANWA 4DQOC 3RNFC 1L5PA 1ZDXA 1VLBA 1UD7A 4MDKE 4JL9A 4FHJA 3J9CA 3NUHB 5CTRC 3Q14C 4XWTA 2WXGA 4LNKA 2XBBC 4E74A 3A1QA 2PKOA 1WJNA 3TCAA 2JYTA 1ENFA 1EO6A 3U2SC 2MSED 3HRDD 4ANVA 2EKEC 2C7HA 2MCNB 1CQVA 3RCZA 3IVFA 1YOVB 4K1RB 1F2RC 3ZJUA 1BUIC 3Q3MC 4JLCA 1K8RB 4WAFA 1QZEA 3TEXA 2MHJA 3VAWA 3U7DA 4RF0A 3ZO5B 2EMTA 4P7IA 3Q8EA 1Y8RC 2WXKA 3BINA 1ZPSA 3AE6B 3BK1A 1L0YB 4ICVA 3WAOA 4DK5A 4W9FA 2GRIA 2N9EB 2DYMA 3ML9A 1V9JA 3N1YC 4ARIA 2C7MB 2KHWB 4AS1A 4BVUC 3PHWB 4MGYE 1WR6E 3ZYYX 1SF0A 2KK8A 4HK2A 1WFYA 2C7NB 3AEAB 3R2IA 4XE0A 2WS3B 1TKEA 5IAAC 4BOSC 1C4AA 1NENB 2L1AA 1RYJA 1SEBD 1JWSD 1MPEA 1P0RA 2W9NA 3MC9A 1XEEA 1YMHE 1WXMA 2N9LA 1PFDA 2NMQA 1JRPA 4B6WA 2JWZA 2DYBA 1WGHA 4IDIA 4KZ0A 2IPKD 4EKUA 1PUTA 3RNCC 2RDBC 5AZFA 4X57B 4NAWA 4BOZB 2N7EA 2LHEA 2WXIA 2WDTB 2N9KA 3X0WA 1SBBB 2JZPA 2ONQA 2RGFA 2J0KA 2M8SA 4N58A 1RFAA 2BT6A 3SEBA 1E5WA 2IO1B 3Q2AC 4XDDA 2LEKA 2BS4B 2NCNA 2RMMA 2SEBD 1OEYJ 2CHZA 1UBIA 4M0WA 1I4HA 4KGRA 3AEFB 1UGMA 2KT7A 5GMVA 4RMAA 3V62A 1Q10A 2NBUA 3RN9C 1XCTL 2YEPB 4ZRIA 2KFJA 3H7SA 2DZKA 3QWZB 3WAPA 3CF6E 4M8NA 4RCOA 1XD3B 2A4ZA 2KN5A 3RULA 3DHIC 1VJKA 1OFFA 5C23A 4GDKA 3C0RB 1TJEA 3SU8X 4AWJA 1L6UA 3NVYA 2K1FA 4GDLA 3LDZE 4JIOU 1G6JA 2X38A 3HVDA 4B0EA 2TSSA 3OG5A 2N4FA 4FJZA 3P4RB 4GU2A 3ZDTA 4W9CA 2KWUB 5E6PA 4M02A 2KQSA 2D3CA 2G3QB 4W9KA 3VUXA 1F52A 3LYYA 4HVBA 4WJNA 3URYA 4LNIA 2LVQA 2GMIC 4XZ4A 2KOXA 2QHOA 1VR9A 5AZGA 3KUZA 3PTFC 1TS4A 2FIFA 4GOCA 1EM7A 2DYOA 4MSMB 2KZRA 2FAZA 2INCC 2N7DA 2LXCA 1PDXA 5AUKA 3PO0A 1T6BX 3RYTA 3TJPA 1J8CA 3I9V1 2D2QA 2KAJA 4R3DA 4E71A 4URKA 3KVFB 3UGBB 4F7ZA 2C5LC 1QILA 1LO5D 1SGHA 1JROA 1E90A 3KQ4A 3U7ZA 1R4NI 2MBBB 2LGXA 3Q3JA 2KLCA 2Z8LA 2I2YA 2D07B 2D11A 2K5PA 4WWPA 3RT3B 4TQ1A 4P6VF 4KZCA 1N63A 1D5ZC 2K0PA 1J7AA 4A90A 2JQRB 1FPYA 4KSKC 1WRDB 2KFKA 3A9JB 3MJWA 5BMGA 2IDYA 1WE6A 3N32A 5IN7A 1KLGD 2RSUA 4NAWB 3TSSA 3MFGA 4OHJA 4HKZE 4WJOA 5EE1A 3W9CB 2XEWA 1V8CA 2MJDA 4L2YA 3N1ZC 4RGNA 1OQQA 4AOFA 3AE7B 2INPE 2KTRB 2KMCA 2KKCA 5AEKB 3UINB 3I3TB 1VCBA 5D2MB 1T0RC 3MC8A 4F1SA 3M3JA
chains in the Genus database with same CATH topology
4KX6B 1OQRA 1SE3A 4YWGG 1K53A 5EE9A 3CIRB 1F2RI 1FXIA 1ET6A 1GOZA 2XN9C 5H92C 1YQ3B 1J7BA 4PT5A 1DOYA 2BB6A 1M4VA 2JX5A 5C3JB 2H88B 4DXGA 1JWMD 1J7CA 2VZKB 1VDVA 2WDVB 5TSSA 1TY2A 4OVZA 1QF6A 2KN4A 2ICIA 4GDLB 3C8YA 4NZLB 3RFZB 2BTEA 1BMLC 1KLUD 1L6VA 4RGMA 2KACA 3BVZA 1ACCA 3ZJVA 2QMTA 4ZRQA 4IKGA 1FNWA 3GP7A 1JWAD 1MI0A 1FD6A 1F77A 1L4ZB 2QEJC 1IBXB 1ZXIA 1F0ZA 4UDUC 2INNE 3E56A 3NRZA 2M0AA 3W5VB 3AM9A 2MEKA 2EELA 2ON8A 3P63A 1VRAB 4NAMA 2J42A 3AH7A 5D3DA 5HG2A 1PYWD 1FNVA 2NTTA 3AV8A 1A70A 2LGIA 3NZ3A 4YSYB 3R8BA 3MJ5A 1JMLA 2LHDA 1D5XC 3GS2A 3BZDB 5FR3A 5E6JA 3VR9B 1EU4A 1ROEA 3SFDB 2K22A 2PVOD 4RH6A 1QQRA 1B1ZA 1HQRD 5FK9C 1K50A 1ZE3D 1NYQA 2W54A 1FO4A 3ZQ4A 5BYQA 3EA6A 1C77A 1E9MA 2PIAA 2AX5A 1AW7A 2WXLA 2G1EA 1SJHD 1SB3C 3AN1A 1FM0D 1VZ6A 2ZW0A 3Q8FA 4H2AA 1RM6C 1R7SA 1NI3A 1UGJA 1VZ7A 2WXFA 1VZ8A 2W82A 1NEKB 4JPSA 2QILA 1IGDA 2CJNA 2JWUA 1C79A 1PGAA 4TMAB 4OZCA 5GXGB 4WH4A 1JWBD 1MHXA 1WYGA 3KWLA 4N6EB 2DLBA 2NTSA 1NVID 1TZOA 1KRHA 4YSZB 3E9SA 3RPFC 1I4PA 2AQ3B 2H89B 1UNSA 4US8A 2MH7A 4MH8A 2DBYA 5BYRA 2PLPA 4WQMA 1C76A 3VRBB 4P16A 4DQOC 2PW9A 3MHZA 2FE8A 1L5PA 1TKYA 1ZDXA 5EE3A 4ZHOA 3KLSX 5T8IA 1C4PA 2N0SB 1SIJA 1VLBA 2GB1A 2SAKA 1Y56A 2JSVX 3MP9A 3TUOA 1GB1A 2WXRA 3J9CA 3T3NA 3NUHB 5LNK1 3Q8AA 5HFYA 1DGJA 4YXDB 1K51A 1MHHE 4XWTA 2JXTA 3DWMA 4OW0A 2WXGA 1SXTA 2WDRB 3Q69A 3MC0B 2PKOA 1WXQA 3GB1A 2JYTA 1ENFA 1JW9D 4JX1C 4RGTA 1I4QA 5H8YE 3U2SC 1GPXA 3Q8BA 1RWSA 3VRAB 3AMZA 3HRDD 1N62A 2BBCA 1TYGB 2V3PA 1CQVA 1TY0A 2EKIA 3P42A 1T3QA 3W1SA 4HROA 1F2RC 2PMVA 4NJCA 3ZJUA 1V1OA 1BUIC 4GDKB 1YN4A 3NVVA 2W3SA 4XDCA 3IT4B 5D7GA 4WAFA 4D2KA 3TEYA 4L1BA 2B76B 2KMMA 3TEXA 5EE0A 4LTUA 4RF0A 3NVWA 5D3IB 3AE1B 3AB5A 4MACA 1WWTA 1XF5L 3IT6B 2G9HD 1FIQA 1N5WA 2HDEA 3B2FA 3Q8EA 2PVGC 4ARCA 2WXKA 4A55A 1JQ4A 4RGOS 3AEBB 4ITKA 3LB8C 1ZPSA 3AE5B 3AE6B 1QT9A 4HEA1 5BYSA 2WP9B 1IBXA 3FILB 3AEEB 4ZYSA 3BK1A 4HKQA 2MJEA 4LLGM 1KF6B 1L0YB 5BMIA 1GAQB 3ABVB 1I7HA 2HTME 2GRIA 1XXGA 2DYMA 2IGHA 1HA5A 2XNAC 1P7FA 2LFIA 2BYTA 4ARIA 1V1PB 4A8XC 1SE4A 4JWSC 2Y5CA 3B9JA 4AS1A 5MPOA 1SSNA 3ZYYX 2K9XA 1V97A 3BK2A 1SF0A 1N60A 4RF1A 1EWCA 1TS2A 2YEPF 1ET9A 2IGGA 3AEAB 3R2IA 2WS3B 4XE0A 1TKEA 2L32A 4ZRPA 3PZ7A 1C4AA 2E3TA 3BYTB 2I38A 4EE2A 1D4BA 1AWDA 1NENB 1SJED 1KH0A 4TSSA 2L1AA 3V3XA 1RYJA 1SEBD 1JWSD 1MPEA 3BWUD 2RPVA 2LJIA 4LK0M 1QLBB 1XEEA 1YMHE 2WXMA 1FRRA 3L4PA 5I4DA 4B0MA 5HI1A 2N9LA 1PFDA 2NMQA 1JRPA 3BVMA 3HUIA 2V0GA 1XLOA 3P4QB 4IDIA 3BIID 4C80A 2IPKD 2MJ3A 1PUTA 2FBWB 1N5XA 3AE9B 2OEDA 2K3UA 1WRIA 1P7EA 1ZOYB 1EWYC 2LHEA 1XLPA 2WXIA 2N9KA 1D6EC 2WXJA 1SBBB 2JZPA 2ONQA 1UWMA 2D5GA 3AEGB 1C4CA 1ZP0B 3Q8CA 4KGTA 1L4DB 4N58A 4YTPB 1TS5A 1ZDVA 2JYEA 2OHFA 2BT6A 3SEBA 1YNTE 3V05A 4XDDA 3AE2B 1FCCC 2LEKA 1B9RA 4J3OD 2BS4B 1I4GA 2RMMA 2SEBD 3EGRA 1FFUA 3DWGC 2Q5WD 4M0WA 1I4HA 1UWXA 4KGRA 3AEFB 3P4SB 3OWEB 1E0ZA 1C78A 1Q10A 3U4EG 1FXAA 4IOIE 1XCTL 2YEPB 2GI9A 3ETRA 1JWUD 3BVGA 1QOGA 3H8HA 4FXCA 4RCOA 5AUIA 1HEZE 4YT0B 2W3RA 2Y3AA 1GB4A 1VJKA 2LUMA 1OFFA 2WU5B 1QOAA 3FAHA 2J53A 1FEHA 3NS1A 4GLSC 3LXFA 2M19A 1IUEA 1YN5A 2WXPA 4WURA 2KQ4X 2FUG1 2ACZB 3VR8B 4ZOHC 1TJEA 2W55A 1N61A 2WXQA 3W5UB 2ZW1A 1SE2A 1JCKB 1L6UA 3NVYA 4Q2JA 5C2TB 4KKIA 2J4XA 1MVKA 4HJGE 4OZAA 5JXVA 1E6EB 2J52A 4C7YA 2X38A 5G5GA 3HVDA 5FKAC 2WNMA 2TSSA 3O13A 4B0EA 1RFKA 4C7ZA 1WSPA 3AE3B 2WXNA 1EU3A 3P4PB 2WQYB 4MT5A 3UI3A 3P4RB 3BYYB 1NYRA 1XCQL 3VQIA 2WLBA 2M56B 3KWVA 3SR6A 3ZJTA 3FILA 3WCQA 3U52E 3N9YC 4MM3B 2RDGA 2BS2B 3LYYA 2KDMA 1FNUA 3URYA 2BW2A 4WIPA 1FMAD 3AECB 1XLQA 1V1PA 4JE3B 1CJEA 3IXSA 1VR9A 2JU6X 2QSDA 4OZBA 1AN8A 4DXFA 1HXYD 1TS4A 2VZKD 1K52A 1EM7A 2DYOA 1UUPA 1ZUD2 4N59A 1DOIA 4KKJA 2WDQB 1PDXA 1BXTA 5AUKA 3PZ8A 2V4IB 1FFVA 3PO0A 3AE4B 1T6BX 3SFEB 2RDHA 5G5HA 3W2DA 1DOXA 1FRDA 1WGKA 2KAJA 3I9V1 4R3DA 4WWMA 4ZHPA 3CWIA 2L83A 1T5XD 1TS3A 4HRSA 1KTKA 3TEWA 1STEA 3HVZA 1JALA 1QILA 1LO5D 1JROA 3IAS1 3KQ4A 1ZXHA 2WU2B 4YTNB 4YSXB 3U7ZA 4TQ0A 2QJLA 4RFBA 1DYQA 4CQNA 1YQ4B 1CZPA 4A9AA 1I4XA 2Z8LA 2I2YA 2KWDA 1L0VB 1YJIA 4L23A 2K5PA 3I57A 1HZ6A 4TQ1A 4P6VF 1N63A 1IGCA 1D5ZC 2K0PA 1J7AA 4A90A 2CJOA 2JQRB 3NVZA 3AE8B 3EUB2 1C9FA 2E6XA 3IAM1 5BMHA 1QOBA 1ESFA 2AQ1B 1XLNA 2DWQA 1L0XB 5BMGA 1TKGA 2IDYA 1FCLA 3ZGZA 2Y5PA 1HZ5A 2LMCA 5HHDG 1E7PB 1KLGD 4KGSA 4NAWB 3TSSA 3MFGA 4OHJA 4HKZE 1E10A 1YN3A 5EE1A 4AQ7A 3W9CB 3FC4A 1KFYB 4USAA 2BB5A 4US9A 1V8CA 2MJDA 1D5MC 4L2YA 2PTLA 4REZA 1YJJA 3P1MA 4XWWA 2CU3A 3R2TA 1I4RA 2IJ0A 4RGNA 1OQQA 4A6QA 2L52A 1PGBA 4RNAA 2BS3B 4C56C 1QOFA 2IGDA 3AEDB 1AYFA 4YTMB 3AE7B 3B2GA 2INPE 2V3NA 2R61A 1PGXA 2N7JA 3TEZA 1XO3A 2QIEB 2WXHA 4O1NA 3T3OA 4JWUC 2AQ2B 1QKZA 2WXOA 1CK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V3X A;  2PW9 A;  1MPE A;  2RPV A;  1K53 A;  1F2R I;  2GB1 A;  1YMH E;  2JSV X;  3MP9 A;  1GB1 A;  2QSD A;  2JU6 X;  4OZB A;  5HI1 A;  2N9L A;  2NMQ A;  5HFY A;  1K52 A;  1EM7 A;  1K51 A;  1MHH E;  2JXT A;  2KN4 A;  2OED A;  3GB1 A;  1P7E A;  2LHE A;  2KAC A;  2N9K A;  2QMT A;  2JZP A;  2ONQ A;  4IKG A;  4KGT A;  1MI0 A;  1FD6 A;  1IBX B;  1F2R C;  1YNT E;  2EEL A;  2ON8 A;  1ZXH A;  1FCC C;  5HG2 A;  2RMM A;  2LGI A;  4D2K A;  2I2Y A;  1JML A;  2KWD A;  1UWX A;  2LHD A;  4KGR A;  1HZ6 A;  1Q10 A;  4MAC A;  1IGC A;  1XF5 L;  2K0P A;  4IOI E;  1XCT L;  2GI9 A;  1C9F A;  1K50 A;  5BMH A;  5BMG A;  1HEZ E;  1IBX A;  3FIL B;  1FCL A;  1GB4 A;  2LUM A;  1HZ5 A;  5HHD G;  4GLS C;  2J53 A;  4KGS A;  5BMI A;  4HKZ E;  2KQ4 X;  2ZW0 A;  2IGH A;  1P7F A;  2ZW1 A;  2PTL A;  1MVK A;  4HJG E;  4OZA A;  5JXV A;  2J52 A;  1IGD A;  1PGB A;  2JWU A;  1PGA A;  2IGD A;  4OZC A;  4WH4 A;  1MHX A;  3UI3 A;  2IGG A;  1PGX A;  2N7J A;  1XCQ L;  3FIL A;  2I38 A;  1D4B A;  2PLP A;  2KDM A;  1KH0 A;  1QKZ A; 
#chains in the Genus database with same CATH topology
 1SE3 A;  2KD0 A;  5IOI A;  3SDL C;  4YWG G;  1K53 A;  1RLF A;  2C9W B;  1GOZ A;  2LRW A;  3DVN V;  2WGS A;  1WMH B;  3M63 B;  4IW0 A;  1NBF C;  2JX5 A;  3A9K B;  2H88 B;  1JWM D;  1WGY A;  5TSS A;  1TY2 A;  3HM3 A;  1QF6 A;  2KN4 A;  4II3 B;  4GDL B;  3C8Y A;  4NZL B;  3V60 A;  4S17 A;  2BTE A;  1BML C;  2PEA A;  3BVZ A;  4MEL A;  1R4N B;  2QMT A;  4ZRQ A;  3JSV A;  1FD6 A;  4NJ6 A;  1F0Z A;  4UDU C;  3E56 A;  3PLV A;  3NRZ A;  2MEK A;  2V3S A;  3VTV A;  3AV8 A;  3K9P B;  4YSY B;  3R8B A;  3MJ5 A;  4NPN A;  4C4V A;  5D6J B;  3GS2 A;  3BZD B;  5FR3 A;  1GC6 A;  2LZ6 A;  2PVO D;  2J0M A;  4LJP B;  1OEY A;  2QC8 A;  1K50 A;  1ZE3 D;  1NYQ A;  1TIF A;  1WX7 A;  2W54 A;  3HM6 X;  2AX5 A;  5C1Z A;  5LLI A;  3OAW A;  4ZYN A;  1UF0 A;  5CX3 A;  3TL5 A;  2FID A;  1RM6 C;  2LJ5 A;  5J18 A;  2R2O A;  1UGJ A;  1NEK B;  1J0G A;  2KJH B;  3DBL I;  1S1Q B;  3ZTC A;  1PGA A;  4TMA B;  5HKH A;  1V2Y A;  5GXG B;  3KWL A;  2CR5 A;  2DLB A;  1KRH A;  2QCZ A;  2IYD B;  1NDD A;  1WZ3 A;  2DAF A;  4MH8 A;  1RAX A;  2C60 A;  4PYU A;  4HCN B;  1C76 A;  2KFK B;  2PW9 A;  3DHG C;  2AEH A;  3W1Y A;  4XYC A;  5EE3 A;  2PJH A;  3KLS X;  1C4P A;  2SAK A;  1Y56 A;  3MP9 A;  1Q1O A;  4M8M A;  1ISN A;  3Q8A A;  3T9L A;  4YXD B;  3DWM A;  1P3Q U;  1SXT A;  2WDR B;  3Q69 A;  2BWF A;  1JW9 D;  4RGT A;  5L83 A;  1GPX A;  3H7P A;  1N62 A;  5E6O A;  1TY0 A;  3P42 A;  4K3B A;  3GZN I;  1V1O A;  2N9X A;  1YN4 A;  3NVV A;  4XGA B;  4GB9 A;  2KLG A;  3IT4 B;  4G11 A;  5D7G A;  3PRZ A;  4D2K A;  3TEY A;  2KVZ A;  4ACF A;  1LM8 B;  2HTH A;  3A4S C;  1M94 A;  2X8X X;  2V1Y A;  3U30 A;  2DZI A;  4MAC A;  1XF5 L;  2G9H D;  1BT0 A;  2AWT A;  1WJ4 A;  3RZW C;  3KUC B;  4A55 A;  2YLM A;  4BFR A;  3AE5 B;  4HEA 1;  1QT9 A;  3FIL B;  4ZYS A;  2FCS A;  2O6V B;  1GAQ B;  3WIM A;  3A4R A;  1I7H A;  2KAN A;  3NOB A;  1HA5 A;  1P7F A;  4F8C B;  3PVL A;  3DQV A;  1WM3 A;  1WIA A;  1SSN A;  4K7W A;  1E8X A;  2CKH B;  1R4M I;  1V97 A;  1TS2 A;  2IGG A;  2L32 A;  4DHZ E;  4ZRP A;  3PZ7 A;  1GC7 A;  1WXS A;  3ZUN A;  2KWC A;  4GXB A;  4TSS A;  1GNU A;  5JH5 C;  2GBR A;  2L0F A;  2NVU I;  2LJI A;  1QLB B;  1OQY A;  3L4P A;  5HI1 A;  4EZL A;  2V0G A;  2KDI A;  3P4Q B;  3BII D;  4HWI B;  2MJ3 A;  4A3P A;  3DVG X;  3QHT A;  3R66 C;  1P7E A;  3RD2 A;  1EWY C;  5JHA A;  2YVC A;  1D6E C;  2UYZ B;  4PS7 A;  1JRU A;  2D5G A;  1ZP0 B;  1L4D B;  3QAR A;  4YTP B;  3OLM D;  4AJY B;  4EEW A;  4EOY A;  2AYO B;  1FCC C;  1YQB A;  1B9R A;  2JPH A;  1Z5S B;  3V61 A;  4KSL C;  1UWX A;  2IBI B;  2CHX A;  4LNN A;  4MEM A;  3PPA A;  4K7S A;  2IZV B;  3ETR A;  5D94 A;  3BVG A;  3H8H A;  3VUW A;  2REX A;  2K8C A;  3DVG Y;  5LXI B;  2W3R A;  3TMP B;  2LUM A;  2WU5 B;  1QOA A;  2A5U A;  2J53 A;  1OGW A;  3ZRF A;  2KQ4 X;  3PRM B;  2FUG 1;  1R4M B;  4ANU A;  2WXQ A;  2ZW1 A;  1SE2 A;  2D3A A;  4LDT D;  4P1B C;  2K25 A;  2J52 A;  4E3C A;  5G5G A;  4BKT A;  5FKA C;  4NJ7 A;  4HPP A;  1RFK A;  3ZLZ A;  2D3G A;  1EU3 A;  3R3M A;  3P4P B;  2WQY B;  3BYY B;  2M56 B;  4J6I A;  3EEC A;  2BKF A;  3KWV A;  2LVO A;  3U52 E;  2RDG A;  2BS2 B;  2KDM A;  2MBQ A;  2KQ7 A;  2D10 A;  1UZX B;  2MBH A;  1V1P A;  2PE9 A;  4I6P A;  1CJE A;  2KXJ A;  1E7U A;  1AN8 A;  4DXF A;  2I1J A;  1HXY D;  1WXA A;  1WH3 A;  4N59 A;  2WDQ B;  4FHK A;  3SFE B;  3W2D A;  1YJ1 A;  4KVG B;  4BAX A;  1FRD A;  4TUU A;  1DOX A;  3CWI A;  2L83 A;  2K6D B;  1T5X D;  2FCM A;  4BBN F;  3TEW A;  1STE A;  2KTF A;  4HPL B;  1Z2M A;  1ZXH A;  4YL8 A;  4YSX B;  4RFB A;  2M0X A;  1DYQ A;  4CQN A;  4B9K A;  1I4X A;  4DHJ D;  1L0V B;  2M4N A;  4L23 A;  3I57 A;  5DPR A;  1GUA B;  3NVZ A;  1AAR A;  3APC A;  2MW5 A;  1I35 A;  1X1M A;  3OJ4 B;  2O2V A;  5BMH A;  1QOB A;  1ESF A;  2NBV B;  1XLN A;  3QC8 B;  4AUQ C;  2L00 B;  5HHD G;  2OOB B;  1YN3 A;  4AQ7 A;  2FCN A;  2BB5 A;  3EC8 A;  4XWW A;  3QX1 A;  1I4R A;  3AED B;  2IGD A;  1AYF A;  3B2G A;  3AU4 A;  1WJU A;  2N7J A;  4NQK E;  3A1Q B;  1XO3 A;  4HCP B;  3KYC D;  2KDB A;  2WXH A;  5G2N A;  5DPW A;  4ICU A;  2IY0 B;  1CK1 A;  3S2A A;  4KX6 B;  1OQR A;  5EE9 A;  2KJ6 A;  1FXI A;  2KO3 A;  2N1W A;  3P2B A;  2DX5 B;  5KHO A;  1N6Z A;  4DXG A;  2VZK B;  3I5J C;  2WX1 A;  2J0J A;  4II2 B;  2R2Q A;  3U8Z A;  4W9E A;  2CS4 A;  3DCG A;  4RGM A;  3ZXV A;  1V81 A;  2ASQ A;  4MM3 A;  1RRB A;  3GP7 A;  1MI0 A;  4LNO A;  3RZF A;  2QEJ C;  2NS5 A;  2K8H A;  3AM9 A;  2GLS A;  4NAM A;  2J42 A;  3AH7 A;  5D3D A;  1FNV A;  3AXC A;  3B1L X;  3ZRC A;  1JML A;  2LHD A;  2ZVO A;  5E6J A;  1EU4 A;  1ROE A;  1QQR A;  3JVZ X;  3B0A A;  4IG7 B;  5FK9 C;  3ZXR A;  2ZCC A;  3ML8 A;  1FO4 A;  4FLH A;  5BYQ A;  3EA6 A;  1E9M A;  3L08 A;  1OTR B;  2BGF A;  4KV2 A;  2G1E A;  3L13 A;  4W9J A;  1WGR A;  4FAD A;  4IWP A;  3AN1 A;  3Q3N C;  3N20 C;  1R7S A;  1WF9 A;  3APD A;  1TGZ B;  2BVC A;  2QIL A;  1EUV B;  2JWU A;  2KC2 A;  2BF8 B;  4B95 A;  4G3X B;  4BKS D;  3Q3O C;  3A33 B;  2NTS A;  1NVI D;  1TZO A;  4YSZ B;  2H89 B;  3CST A;  2MH7 A;  4A3O A;  2DBY A;  5BYR A;  2PLP A;  3APF A;  4WQM A;  2O2V B;  1YIW A;  4P16 A;  2K39 A;  5J2R A;  4ZHO A;  1V49 A;  3DOW A;  5T8I A;  2N0S B;  1SIJ A;  2LWP A;  4A20 A;  2GB1 A;  2BQQ A;  3TUO A;  4G50 A;  3T3N A;  5HFY A;  4FBJ B;  4M0W B;  1MHH E;  2RR9 A;  4OW0 A;  3MC0 B;  2VH2 A;  3GB1 A;  1WXQ A;  2LGS A;  5FR6 A;  4CYE A;  5E6N A;  4JX1 C;  1I4Q A;  5H8Y E;  1H4R A;  3VRA B;  3L17 A;  3ECI A;  2DEN B;  1TYG B;  4W9D A;  3RI7 C;  1E8W A;  3V6E B;  1T3Q A;  4HRO A;  4GDK B;  2JRI B;  4CO7 A;  5L95 C;  2B76 B;  2KMM A;  3ZKJ C;  4C00 A;  5D3I B;  3AE1 B;  3AB5 A;  1WWT A;  3K9O B;  2HDE A;  1JQ4 A;  3AEB B;  2JY6 A;  5BYS A;  1IBX A;  2MWS B;  4MGK E;  4HKQ A;  2JVC A;  3BY4 B;  4LLG M;  5BMI A;  3ABV B;  1Q0W B;  1ZKH A;  2IGH A;  2XNA C;  4PS8 A;  1UBQ A;  2UWQ A;  3N3K B;  5CHF A;  1TBE A;  2BYT A;  2J7Q B;  1SE4 A;  2KWV B;  2Y5C A;  3H6N A;  2L0T A;  5IP4 D;  4NQL B;  2LXA A;  2Z0E B;  4WQO B;  4M00 A;  3BK2 A;  2IO3 B;  2ZEQ A;  1T0Y A;  1N60 A;  3ZNZ B;  4RF1 A;  1EWC A;  2YEP F;  3RNE C;  1PQS A;  4BKS A;  2LD9 A;  2E3T A;  2NPT A;  3BYT B;  4KDI C;  4EE2 A;  1D4B A;  3VFK A;  1KLV A;  3KW5 B;  3I63 C;  3V3X A;  3BWU D;  2GBN A;  4B0M A;  1L2N A;  2BWE S;  3HUI A;  1XLO A;  4C80 A;  3JW0 X;  3GE3 C;  1T0S C;  4OVV A;  1IP9 A;  2OED A;  2KX3 A;  2N9P C;  3VXW A;  4DDG D;  3NZU A;  2K3U A;  1WRI A;  1HTQ A;  1ZOY B;  3FKY A;  3PT2 B;  4W9H A;  2WXJ A;  1LGR A;  1UWM A;  1C4C A;  3KUD B;  3L54 A;  3Q8C A;  5J17 A;  2G4S A;  4LJO B;  1TS5 A;  2JYE A;  2IY1 B;  3V05 A;  3HIZ A;  3IBE A;  3DDC B;  1I4G A;  4PS3 A;  3EGR A;  4EFO A;  3SD5 A;  1YD8 U;  2AL3 A;  1FFU A;  4HDO A;  3IHP C;  3P4S B;  1E0Z A;  1H8C A;  3U4E G;  1KOT A;  3L0W B;  1QOG A;  4IM2 A;  4YT0 B;  1J19 A;  2Y3A A;  1GB4 A;  3NS1 A;  1FEH A;  2M19 A;  1YN5 A;  2WXP A;  4NNJ B;  3ZW3 A;  1WZ0 A;  1N61 A;  2I1K A;  3C19 A;  3DBR I;  5C2T B;  4Q2J A;  3R7R A;  4MJS A;  4TV3 A;  5EDS A;  4HJG E;  4C7Z A;  1WSP A;  3AE3 B;  2GBM A;  2WXN A;  3DBH I;  4K3C A;  2BPS A;  5IA7 A;  4LNF A;  1NYR A;  3UIP B;  1XCQ L;  2WLB A;  3DBL B;  2FCQ A;  3N9Y C;  4HPM B;  1WE7 A;  3KYD D;  3UQA A;  2JF5 A;  3JSV B;  2BW2 A;  4WIP A;  2FNJ B;  1FMA D;  1XLQ A;  5KHQ A;  3IXS A;  2JU6 X;  4BBN C;  3DPD A;  2JXX A;  2VZK D;  1K52 A;  1UUP A;  4C4V B;  4GSW A;  4ZDV A;  4KKJ A;  1KM7 A;  1BXT A;  1WJ6 A;  2V4I B;  1WM2 A;  2RDH A;  3PHX B;  5G5H A;  1S3S G;  1WGK A;  4WJQ A;  4WWM A;  1C1Y B;  2LGY A;  3VHT C;  4HRS A;  1KTK A;  1IPG A;  4NY0 A;  3TIX A;  1E8Y A;  3HHM A;  2V4L A;  3CMM B;  3DVN U;  2NPT B;  2WU2 B;  4YTN B;  3ZDM C;  4TQ0 A;  3N30 A;  1YQ4 B;  1CZP A;  3M95 A;  4A9A A;  1P9D U;  3GZN B;  4JGH B;  4M01 A;  1HZ6 A;  2LGD A;  1IGC A;  1EF1 A;  1Q5W B;  2CJO A;  3EUB 2;  1C9F A;  3GOE A;  4ASW C;  1T0Q C;  2DWQ A;  3NG0 A;  3DBR B;  1WX8 A;  4BKG A;  3ZGZ A;  4I6N B;  1HZ5 A;  2LMC A;  5TR5 A;  4KGS A;  3PS6 A;  2MX2 A;  1E10 A;  3WAL A;  4EUT A;  3FC4 A;  2BYV E;  2RD0 A;  1MFW A;  4US9 A;  3T8M A;  4HXD A;  2PTL A;  3P1M A;  2L8J A;  2CU3 A;  3R2T A;  4FA6 A;  2QDF A;  4A6Q A;  4W9L A;  4WWN A;  2L52 A;  1QOF A;  4YTM B;  1SIF A;  4BZA A;  3SHQ A;  1SE9 A;  1WY8 A;  2V3N A;  3VDZ A;  4PYZ A;  3TEZ A;  2XK5 A;  3X23 A;  4ANX A;  3H7P B;  3T3O A;  4WWO A;  4JWU C;  4FUL A;  1QKZ A;  2WXO A;  3RNA C;  2MRP A;  1LXD A;  2OJR A;  2GBJ A;  4W9G A;  2MBO A;  3CIR B;  1ET6 A;  5H92 C;  1YQ3 B;  4ZRJ A;  1M4V A;  3VVW B;  2LAS A;  2MBE A;  4KDL B;  1VDV A;  2NR2 A;  4MJS B;  4DXA B;  4TKN A;  4WAA A;  4AJW A;  3Q3F A;  1L6V A;  1MG4 A;  2GOW A;  1ACC A;  4I6L B;  3ZJV A;  4IWO A;  4IKG A;  1V80 A;  1V5O A;  1FNW A;  1F77 A;  2INN E;  2M0A A;  3W5V B;  2EEL A;  2ON8 A;  1VRA B;  3QQ8 B;  3AUL A;  1PYW D;  2NTT A;  4DDI D;  1MJD A;  1A70 A;  2LGI A;  3VR9 B;  3SFD B;  5JHB A;  4RH6 A;  2DAJ A;  4DWF A;  1B1Z A;  5CHV C;  3ZQ4 A;  2OJW A;  3QIJ A;  1AW7 A;  2WXL A;  3VTW A;  1SB3 C;  2PE6 B;  1VZ6 A;  2WX0 A;  3Q8F A;  1NI3 A;  2WXF A;  3ZNG C;  4QAY A;  2KYW A;  4JPS A;  3PRP B;  3NHE B;  2MP2 A;  2CJN A;  2JT4 B;  3VH4 B;  4MH0 E;  4OZC A;  4WH4 A;  3V6C B;  1JWB D;  1WYG A;  4RM8 A;  2L7R A;  4N6E B;  3RPF C;  1I4P A;  3A9J A;  4US8 A;  1UNS A;  2LI5 A;  2JRH A;  2HE7 A;  2IO2 B;  3M62 B;  4PK1 A;  2AL6 A;  1WGG A;  1YX6 B;  1P1A A;  4GIV A;  3VRB B;  3MHZ A;  4IUM B;  2L3Z A;  2FE8 A;  2LVP A;  2ZZP B;  1TKY A;  2JSV X;  2IO0 B;  1GB1 A;  2WXR A;  1WGD A;  5LNK 1;  1DGJ A;  1K51 A;  1WI0 A;  2B3A A;  2KTR A;  2M1M A;  2JXT A;  2MLB A;  1UEL A;  3NJT A;  4IC7 B;  4IM0 A;  3Q8B A;  1RWS A;  3PGE A;  3AMZ A;  5BO4 B;  2BBC A;  2V3P A;  4P1C C;  4MGI E;  2HJ8 A;  2EKI A;  4EZJ A;  3W1S A;  2XK5 B;  2PMV A;  2ZVN A;  4NJC A;  3RMK C;  1F9J A;  3L10 B;  4K7U A;  4LCD E;  2DZJ A;  1WMH A;  2W3S A;  4XDC A;  3VUY A;  1V86 A;  1F1H A;  3A9K A;  4L1B A;  1WR1 A;  2M17 A;  5EE0 A;  4LTU A;  3NVW A;  2N1V A;  5LXH A;  3IT6 B;  1FIQ A;  3ZTD A;  1N5W A;  3B2F A;  2PVG C;  2L76 A;  4ARC A;  4RGO S;  4ITK A;  1A5R A;  3LB8 C;  2WP9 B;  3AEE B;  2HJ1 A;  2MJE A;  1GG3 A;  1KF6 B;  2HTM E;  1XXG A;  3MHS D;  4HLE A;  2LFI A;  1L7Y A;  2JUO A;  1V1P B;  4A8X C;  4XX5 A;  4JWS C;  1V6E A;  3B9J A;  2BKR B;  1MG8 A;  5DCN A;  5MPO A;  2K9X A;  2LRU A;  3RNB C;  3UIO B;  2HD5 B;  3QAQ A;  1ET9 A;  2WYQ A;  2O6V D;  1HE8 A;  4GMV A;  2I38 A;  1AWD A;  3PRE A;  2BYF A;  1SJE D;  1KH0 A;  3MTN B;  2RPV A;  4LK0 M;  3B08 A;  5I4D A;  2WXM A;  1FRR A;  5DPT A;  3BVM A;  3ENE A;  3QJZ A;  2FBW B;  1N5X A;  2DHZ A;  3AE9 B;  1E7V A;  2VRR B;  3PV1 A;  2MP2 B;  3PLU A;  1XLP A;  4ZRK A;  1KJT A;  2WWZ A;  3AEG B;  4KGT A;  3PZD A;  4FN2 A;  1ZDV A;  3EFU A;  1ZW7 A;  2OHF A;  2ZCB A;  1YNT E;  3AE2 B;  1TZ1 A;  4J3O D;  3VTU A;  4KIK A;  3O65 B;  4EZK A;  3DWG C;  3EHV A;  2Q5W D;  3RNG C;  3OWE B;  1LFD A;  5IO9 A;  1C78 A;  2ZPY A;  3VH3 B;  1FXA A;  4LDT B;  4IOI E;  3EFC A;  2GI9 A;  1JWU D;  4FXC A;  5AUI A;  1HEZ E;  3N1X C;  4MGZ E;  1WX9 A;  3FAH A;  4GLS C;  3LXF A;  2G4D B;  1IUE A;  2DNF A;  4WUR A;  2KC1 A;  3VR8 B;  2ACZ B;  4W9I A;  4ZOH C;  2W55 A;  3W5U B;  1JCK B;  3CSF A;  4KKI A;  1GJZ A;  2J4X A;  1FXT B;  1MVK A;  2ZPN A;  4OZA A;  5JXV A;  5CHW A;  2JZ3 B;  2NBW B;  1E6E B;  3GE8 C;  4C7Y A;  2CU1 A;  2WNM A;  3O13 A;  2MQJ A;  4CHK A;  3WA0 A;  4MT5 A;  2D3B A;  3UI3 A;  2UU7 A;  3VQI A;  3NS8 A;  2ZNV B;  3SR6 A;  3ZJT A;  3FIL A;  3WCQ A;  2O6V A;  4MM3 B;  5DPS A;  1FNU A;  1TTN A;  3AI5 A;  5AZH A;  3WAN A;  3AEC B;  4JE3 B;  1V5T A;  2QSD A;  2KNB A;  2RPQ A;  4OZB A;  4FJY A;  1ZGU B;  4IM3 A;  4JQW C;  1ZUD 2;  3OJ3 A;  4XC2 A;  1DOI A;  3W1S C;  2LUE A;  1WYW B;  4DHJ B;  3PZ8 A;  1FFV A;  1XT9 B;  1EF5 A;  3AE4 B;  4OVU A;  4WJP A;  3QK0 A;  4GGQ A;  3ZVV A;  1UH6 A;  1XQQ A;  4ZHP A;  1CMX B;  3WAM A;  2CHW A;  1TS3 A;  3RUI B;  3HVZ A;  1JAL A;  2ZNV C;  2FUH B;  3IAS 1;  1NI2 A;  2V9H A;  2QJL A;  3DBS A;  4HDQ A;  5G55 A;  2BYE A;  2KWD A;  5JZE B;  3DHH C;  3NY5 A;  1VD2 A;  1YJI A;  3H1U A;  2DZM A;  1U4A A;  4K81 A;  4FJV B;  2KX0 A;  3IG3 A;  3AE8 B;  1TT5 B;  2E6X A;  3IAM 1;  2L05 A;  3ZNH B;  2EMS A;  2AQ1 B;  3PSE B;  1L0X B;  2Y5B B;  1TKG A;  4G0N B;  1FCL A;  2Y5P A;  3KH0 A;  4DHZ B;  1E7P B;  1P98 A;  5IKC M;  3ZNI D;  3R7Q A;  1KFY B;  4USA A;  4GN1 A;  1D5M C;  4REZ A;  1YJJ A;  2KVR A;  2K8B A;  2IJ0 A;  1PGB A;  4RNA A;  2BS3 B;  4C56 C;  3L16 A;  4KIK B;  1D3Z A;  2R61 A;  1PGX A;  2QIE B;  3NZS A;  3H9D A;  4DBG A;  4RM9 A;  1C3T A;  4O1N A;  2AQ2 B;  2VH1 A;  2KMA A;  3JYU A;  4IWQ A;  1F2R I;  1WXV A;  4AP4 C;  2XN9 C;  2PPH A;  1J7B A;  4PT5 A;  1DOY A;  2BB6 A;  5C3J B;  1J7C A;  4HJK A;  2WDV B;  4S0R A;  4OVZ A;  3UQB A;  2ICI A;  3RFZ B;  1KLU D;  2KAC A;  2ZJD A;  1I42 A;  1JWA D;  3QA8 A;  1L4Z B;  1IBX B;  1ZXI A;  1YX5 B;  3P63 A;  2KDF B;  5HG2 A;  3NZ3 A;  3LJ3 A;  3AU5 A;  1D5X C;  2MA9 B;  2K22 A;  1HQR D;  2GBK A;  2Z59 B;  3QCA A;  2KDE B;  2K6Q A;  1C77 A;  2PIA A;  3TBL D;  2IND C;  4N9F 4;  1SJH D;  3ZIM A;  2Z0D B;  3HK0 A;  1FM0 D;  2ZW0 A;  4H2A A;  3IFW B;  1E8Z A;  1VZ7 A;  1VZ8 A;  2W82 A;  4MSQ B;  1IGD A;  3ALB A;  1C79 A;  3D32 A;  1MHX A;  2WHI A;  2KJR A;  1LQB A;  3E9S A;  2AQ3 B;  1HTO A;  2JZZ A;  3ONS A;  3UF8 A;  2G45 B;  3DBH B;  1IYF A;  3Q6B A;  4ANW A;  4DQO C;  3RNF C;  1L5P A;  1ZDX A;  1VLB A;  1UD7 A;  4MDK E;  4JL9 A;  4FHJ A;  3J9C A;  3NUH B;  5CTR C;  3Q14 C;  4XWT A;  2WXG A;  4LNK A;  2XBB C;  4E74 A;  3A1Q A;  2PKO A;  1WJN A;  3TCA A;  2JYT A;  1ENF A;  1EO6 A;  3U2S C;  2MSE D;  3HRD D;  4ANV A;  2EKE C;  2C7H A;  2MCN B;  1CQV A;  3RCZ A;  3IVF A;  1YOV B;  4K1R B;  1F2R C;  3ZJU A;  1BUI C;  3Q3M C;  4JLC A;  1K8R B;  4WAF A;  1QZE A;  3TEX A;  2MHJ A;  3VAW A;  3U7D A;  4RF0 A;  3ZO5 B;  2EMT A;  4P7I A;  3Q8E A;  1Y8R C;  2WXK A;  3BIN A;  1ZPS A;  3AE6 B;  3BK1 A;  1L0Y B;  4ICV A;  3WAO A;  4DK5 A;  4W9F A;  2GRI A;  2N9E B;  2DYM A;  3ML9 A;  1V9J A;  3N1Y C;  4ARI A;  2C7M B;  2KHW B;  4AS1 A;  4BVU C;  3PHW B;  4MGY E;  1WR6 E;  3ZYY X;  1SF0 A;  2KK8 A;  4HK2 A;  1WFY A;  2C7N B;  3AEA B;  3R2I A;  4XE0 A;  2WS3 B;  1TKE A;  5IAA C;  4BOS C;  1C4A A;  1NEN B;  2L1A A;  1RYJ A;  1SEB D;  1JWS D;  1MPE A;  1P0R A;  2W9N A;  3MC9 A;  1XEE A;  1YMH E;  1WXM A;  2N9L A;  1PFD A;  2NMQ A;  1JRP A;  4B6W A;  2JWZ A;  2DYB A;  1WGH A;  4IDI A;  4KZ0 A;  2IPK D;  4EKU A;  1PUT A;  3RNC C;  2RDB C;  5AZF A;  4X57 B;  4NAW A;  4BOZ B;  2N7E A;  2LHE A;  2WXI A;  2WDT B;  2N9K A;  3X0W A;  1SBB B;  2JZP A;  2ONQ A;  2RGF A;  2J0K A;  2M8S A;  4N58 A;  1RFA A;  2BT6 A;  3SEB A;  1E5W A;  2IO1 B;  3Q2A C;  4XDD A;  2LEK A;  2BS4 B;  2NCN A;  2RMM A;  2SEB D;  1OEY J;  2CHZ A;  1UBI A;  4M0W A;  1I4H A;  4KGR A;  3AEF B;  1UGM A;  2KT7 A;  5GMV A;  4RMA A;  3V62 A;  1Q10 A;  2NBU A;  3RN9 C;  1XCT L;  2YEP B;  4ZRI A;  2KFJ A;  3H7S A;  2DZK A;  3QWZ B;  3WAP A;  3CF6 E;  4M8N A;  4RCO A;  1XD3 B;  2A4Z A;  2KN5 A;  3RUL A;  3DHI C;  1VJK A;  1OFF A;  5C23 A;  4GDK A;  3C0R B;  1TJE A;  3SU8 X;  4AWJ A;  1L6U A;  3NVY A;  2K1F A;  4GDL A;  3LDZ E;  4JIO U;  1G6J A;  2X38 A;  3HVD A;  4B0E A;  2TSS A;  3OG5 A;  2N4F A;  4FJZ A;  3P4R B;  4GU2 A;  3ZDT A;  4W9C A;  2KWU B;  5E6P A;  4M02 A;  2KQS A;  2D3C A;  2G3Q B;  4W9K A;  3VUX A;  1F52 A;  3LYY A;  4HVB A;  4WJN A;  3URY A;  4LNI A;  2LVQ A;  2GMI C;  4XZ4 A;  2KOX A;  2QHO A;  1VR9 A;  5AZG A;  3KUZ A;  3PTF C;  1TS4 A;  2FIF A;  4GOC A;  1EM7 A;  2DYO A;  4MSM B;  2KZR A;  2FAZ A;  2INC C;  2N7D A;  2LXC A;  1PDX A;  5AUK A;  3PO0 A;  1T6B X;  3RYT A;  3TJP A;  1J8C A;  3I9V 1;  2D2Q A;  2KAJ A;  4R3D A;  4E71 A;  4URK A;  3KVF B;  3UGB B;  4F7Z A;  2C5L C;  1QIL A;  1LO5 D;  1SGH A;  1JRO A;  1E90 A;  3KQ4 A;  3U7Z A;  1R4N I;  2MBB B;  2LGX A;  3Q3J A;  2KLC A;  2Z8L A;  2I2Y A;  2D07 B;  2D11 A;  2K5P A;  4WWP A;  3RT3 B;  4TQ1 A;  4P6V F;  4KZC A;  1N63 A;  1D5Z C;  2K0P A;  1J7A A;  4A90 A;  2JQR B;  1FPY A;  4KSK C;  1WRD B;  2KFK A;  3A9J B;  3MJW A;  5BMG A;  2IDY A;  1WE6 A;  3N32 A;  5IN7 A;  1KLG D;  2RSU A;  4NAW B;  3TSS A;  3MFG A;  4OHJ A;  4HKZ E;  4WJO A;  5EE1 A;  3W9C B;  2XEW A;  1V8C A;  2MJD A;  4L2Y A;  3N1Z C;  4RGN A;  1OQQ A;  4AOF A;  3AE7 B;  2INP E;  2KTR B;  2KMC A;  2KKC A;  5AEK B;  3UIN B;  3I3T B;  1VCB A;  5D2M B;  1T0R C;  3MC8 A;  4F1S A;  3M3J A; 
#chains in the Genus database with same CATH homology
 4KX6 B;  1OQR A;  1SE3 A;  4YWG G;  1K53 A;  5EE9 A;  3CIR B;  1F2R I;  1FXI A;  1ET6 A;  1GOZ A;  2XN9 C;  5H92 C;  1YQ3 B;  1J7B A;  4PT5 A;  1DOY A;  2BB6 A;  1M4V A;  2JX5 A;  5C3J B;  2H88 B;  4DXG A;  1JWM D;  1J7C A;  2VZK B;  1VDV A;  2WDV B;  5TSS A;  1TY2 A;  4OVZ A;  1QF6 A;  2KN4 A;  2ICI A;  4GDL B;  3C8Y A;  4NZL B;  3RFZ B;  2BTE A;  1BML C;  1KLU D;  1L6V A;  4RGM A;  2KAC A;  3BVZ A;  1ACC A;  3ZJV A;  2QMT A;  4ZRQ A;  4IKG A;  1FNW A;  3GP7 A;  1JWA D;  1MI0 A;  1FD6 A;  1F77 A;  1L4Z B;  2QEJ C;  1IBX B;  1ZXI A;  1F0Z A;  4UDU C;  2INN E;  3E56 A;  3NRZ A;  2M0A A;  3W5V B;  3AM9 A;  2MEK A;  2EEL A;  2ON8 A;  3P63 A;  1VRA B;  4NAM A;  2J42 A;  3AH7 A;  5D3D A;  5HG2 A;  1PYW D;  1FNV A;  2NTT A;  3AV8 A;  1A70 A;  2LGI A;  3NZ3 A;  4YSY B;  3R8B A;  3MJ5 A;  1JML A;  2LHD A;  1D5X C;  3GS2 A;  3BZD B;  5FR3 A;  5E6J A;  3VR9 B;  1EU4 A;  1ROE A;  3SFD B;  2K22 A;  2PVO D;  4RH6 A;  1QQR A;  1B1Z A;  1HQR D;  5FK9 C;  1K50 A;  1ZE3 D;  1NYQ A;  2W54 A;  1FO4 A;  3ZQ4 A;  5BYQ A;  3EA6 A;  1C77 A;  1E9M A;  2PIA A;  2AX5 A;  1AW7 A;  2WXL A;  2G1E A;  1SJH D;  1SB3 C;  3AN1 A;  1FM0 D;  1VZ6 A;  2ZW0 A;  3Q8F A;  4H2A A;  1RM6 C;  1R7S A;  1NI3 A;  1UGJ A;  1VZ7 A;  2WXF A;  1VZ8 A;  2W82 A;  1NEK B;  4JPS A;  2QIL A;  1IGD A;  2CJN A;  2JWU A;  1C79 A;  1PGA A;  4TMA B;  4OZC A;  5GXG B;  4WH4 A;  1JWB D;  1MHX A;  1WYG A;  3KWL A;  4N6E B;  2DLB A;  2NTS A;  1NVI D;  1TZO A;  1KRH A;  4YSZ B;  3E9S A;  3RPF C;  1I4P A;  2AQ3 B;  2H89 B;  1UNS A;  4US8 A;  2MH7 A;  4MH8 A;  2DBY A;  5BYR A;  2PLP A;  4WQM A;  1C76 A;  3VRB B;  4P16 A;  4DQO C;  2PW9 A;  3MHZ A;  2FE8 A;  1L5P A;  1TKY A;  1ZDX A;  5EE3 A;  4ZHO A;  3KLS X;  5T8I A;  1C4P A;  2N0S B;  1SIJ A;  1VLB A;  2GB1 A;  2SAK A;  1Y56 A;  2JSV X;  3MP9 A;  3TUO A;  1GB1 A;  2WXR A;  3J9C A;  3T3N A;  3NUH B;  5LNK 1;  3Q8A A;  5HFY A;  1DGJ A;  4YXD B;  1K51 A;  1MHH E;  4XWT A;  2JXT A;  3DWM A;  4OW0 A;  2WXG A;  1SXT A;  2WDR B;  3Q69 A;  3MC0 B;  2PKO A;  1WXQ A;  3GB1 A;  2JYT A;  1ENF A;  1JW9 D;  4JX1 C;  4RGT A;  1I4Q A;  5H8Y E;  3U2S C;  1GPX A;  3Q8B A;  1RWS A;  3VRA B;  3AMZ A;  3HRD D;  1N62 A;  2BBC A;  1TYG B;  2V3P A;  1CQV A;  1TY0 A;  2EKI A;  3P42 A;  1T3Q A;  3W1S A;  4HRO A;  1F2R C;  2PMV A;  4NJC A;  3ZJU A;  1V1O A;  1BUI C;  4GDK B;  1YN4 A;  3NVV A;  2W3S A;  4XDC A;  3IT4 B;  5D7G A;  4WAF A;  4D2K A;  3TEY A;  4L1B A;  2B76 B;  2KMM A;  3TEX A;  5EE0 A;  4LTU A;  4RF0 A;  3NVW A;  5D3I B;  3AE1 B;  3AB5 A;  4MAC A;  1WWT A;  1XF5 L;  3IT6 B;  2G9H D;  1FIQ A;  1N5W A;  2HDE A;  3B2F A;  3Q8E A;  2PVG C;  4ARC A;  2WXK A;  4A55 A;  1JQ4 A;  4RGO S;  3AEB B;  4ITK A;  3LB8 C;  1ZPS A;  3AE5 B;  3AE6 B;  1QT9 A;  4HEA 1;  5BYS A;  2WP9 B;  1IBX A;  3FIL B;  3AEE B;  4ZYS A;  3BK1 A;  4HKQ A;  2MJE A;  4LLG M;  1KF6 B;  1L0Y B;  5BMI A;  1GAQ B;  3ABV B;  1I7H A;  2HTM E;  2GRI A;  1XXG A;  2DYM A;  2IGH A;  1HA5 A;  2XNA C;  1P7F A;  2LFI A;  2BYT A;  4ARI A;  1V1P B;  4A8X C;  1SE4 A;  4JWS C;  2Y5C A;  3B9J A;  4AS1 A;  5MPO A;  1SSN A;  3ZYY X;  2K9X A;  1V97 A;  3BK2 A;  1SF0 A;  1N60 A;  4RF1 A;  1EWC A;  1TS2 A;  2YEP F;  1ET9 A;  2IGG A;  3AEA B;  3R2I A;  2WS3 B;  4XE0 A;  1TKE A;  2L32 A;  4ZRP A;  3PZ7 A;  1C4A A;  2E3T A;  3BYT B;  2I38 A;  4EE2 A;  1D4B A;  1AWD A;  1NEN B;  1SJE D;  1KH0 A;  4TSS A;  2L1A A;  3V3X A;  1RYJ A;  1SEB D;  1JWS D;  1MPE A;  3BWU D;  2RPV A;  2LJI A;  4LK0 M;  1QLB B;  1XEE A;  1YMH E;  2WXM A;  1FRR A;  3L4P A;  5I4D A;  4B0M A;  5HI1 A;  2N9L A;  1PFD A;  2NMQ A;  1JRP A;  3BVM A;  3HUI A;  2V0G A;  1XLO A;  3P4Q B;  4IDI A;  3BII D;  4C80 A;  2IPK D;  2MJ3 A;  1PUT A;  2FBW B;  1N5X A;  3AE9 B;  2OED A;  2K3U A;  1WRI A;  1P7E A;  1ZOY B;  1EWY C;  2LHE A;  1XLP A;  2WXI A;  2N9K A;  1D6E C;  2WXJ A;  1SBB B;  2JZP A;  2ONQ A;  1UWM A;  2D5G A;  3AEG B;  1C4C A;  1ZP0 B;  3Q8C A;  4KGT A;  1L4D B;  4N58 A;  4YTP B;  1TS5 A;  1ZDV A;  2JYE A;  2OHF A;  2BT6 A;  3SEB A;  1YNT E;  3V05 A;  4XDD A;  3AE2 B;  1FCC C;  2LEK A;  1B9R A;  4J3O D;  2BS4 B;  1I4G A;  2RMM A;  2SEB D;  3EGR A;  1FFU A;  3DWG C;  2Q5W D;  4M0W A;  1I4H A;  1UWX A;  4KGR A;  3AEF B;  3P4S B;  3OWE B;  1E0Z A;  1C78 A;  1Q10 A;  3U4E G;  1FXA A;  4IOI E;  1XCT L;  2YEP B;  2GI9 A;  3ETR A;  1JWU D;  3BVG A;  1QOG A;  3H8H A;  4FXC A;  4RCO A;  5AUI A;  1HEZ E;  4YT0 B;  2W3R A;  2Y3A A;  1GB4 A;  1VJK A;  2LUM A;  1OFF A;  2WU5 B;  1QOA A;  3FAH A;  2J53 A;  1FEH A;  3NS1 A;  4GLS C;  3LXF A;  2M19 A;  1IUE A;  1YN5 A;  2WXP A;  4WUR A;  2KQ4 X;  2FUG 1;  2ACZ B;  3VR8 B;  4ZOH C;  1TJE A;  2W55 A;  1N61 A;  2WXQ A;  3W5U B;  2ZW1 A;  1SE2 A;  1JCK B;  1L6U A;  3NVY A;  4Q2J A;  5C2T B;  4KKI A;  2J4X A;  1MVK A;  4HJG E;  4OZA A;  5JXV A;  1E6E B;  2J52 A;  4C7Y A;  2X38 A;  5G5G A;  3HVD A;  5FKA C;  2WNM A;  2TSS A;  3O13 A;  4B0E A;  1RFK A;  4C7Z A;  1WSP A;  3AE3 B;  2WXN A;  1EU3 A;  3P4P B;  2WQY B;  4MT5 A;  3UI3 A;  3P4R B;  3BYY B;  1NYR A;  1XCQ L;  3VQI A;  2WLB A;  2M56 B;  3KWV A;  3SR6 A;  3ZJT A;  3FIL A;  3WCQ A;  3U52 E;  3N9Y C;  4MM3 B;  2RDG A;  2BS2 B;  3LYY A;  2KDM A;  1FNU A;  3URY A;  2BW2 A;  4WIP A;  1FMA D;  3AEC B;  1XLQ A;  1V1P A;  4JE3 B;  1CJE A;  3IXS A;  1VR9 A;  2JU6 X;  2QSD A;  4OZB A;  1AN8 A;  4DXF A;  1HXY D;  1TS4 A;  2VZK D;  1K52 A;  1EM7 A;  2DYO A;  1UUP A;  1ZUD 2;  4N59 A;  1DOI A;  4KKJ A;  2WDQ B;  1PDX A;  1BXT A;  5AUK A;  3PZ8 A;  2V4I B;  1FFV A;  3PO0 A;  3AE4 B;  1T6B X;  3SFE B;  2RDH A;  5G5H A;  3W2D A;  1DOX A;  1FRD A;  1WGK A;  2KAJ A;  3I9V 1;  4R3D A;  4WWM A;  4ZHP A;  3CWI A;  2L83 A;  1T5X D;  1TS3 A;  4HRS A;  1KTK A;  3TEW A;  1STE A;  3HVZ A;  1JAL A;  1QIL A;  1LO5 D;  1JRO A;  3IAS 1;  3KQ4 A;  1ZXH A;  2WU2 B;  4YTN B;  4YSX B;  3U7Z A;  4TQ0 A;  2QJL A;  4RFB A;  1DYQ A;  4CQN A;  1YQ4 B;  1CZP A;  4A9A A;  1I4X A;  2Z8L A;  2I2Y A;  2KWD A;  1L0V B;  1YJI A;  4L23 A;  2K5P A;  3I57 A;  1HZ6 A;  4TQ1 A;  4P6V F;  1N63 A;  1IGC A;  1D5Z C;  2K0P A;  1J7A A;  4A90 A;  2CJO A;  2JQR B;  3NVZ A;  3AE8 B;  3EUB 2;  1C9F A;  2E6X A;  3IAM 1;  5BMH A;  1QOB A;  1ESF A;  2AQ1 B;  1XLN A;  2DWQ A;  1L0X B;  5BMG A;  1TKG A;  2IDY A;  1FCL A;  3ZGZ A;  2Y5P A;  1HZ5 A;  2LMC A;  5HHD G;  1E7P B;  1KLG D;  4KGS A;  4NAW B;  3TSS A;  3MFG A;  4OHJ A;  4HKZ E;  1E10 A;  1YN3 A;  5EE1 A;  4AQ7 A;  3W9C B;  3FC4 A;  1KFY B;  4USA A;  2BB5 A;  4US9 A;  1V8C A;  2MJD A;  1D5M C;  4L2Y A;  2PTL A;  4REZ A;  1YJJ A;  3P1M A;  4XWW A;  2CU3 A;  3R2T A;  1I4R A;  2IJ0 A;  4RGN A;  1OQQ A;  4A6Q A;  2L52 A;  1PGB A;  4RNA A;  2BS3 B;  4C56 C;  1QOF A;  2IGD A;  3AED B;  1AYF A;  4YTM B;  3AE7 B;  3B2G A;  2INP E;  2V3N A;  2R61 A;  1PGX A;  2N7J A;  3TEZ A;  1XO3 A;  2QIE B;  2WXH A;  4O1N A;  3T3O A;  4JWU C;  2AQ2 B;  1QKZ A;  2WXO A;  1CK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...