4OZAA

Backbone modifications in the protein gb1 helix: beta-3-ala24, beta-3-lys28, beta-3-gln32, beta-3-asp36
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
52
Chain Sequence
b'DTYKLILNGKTLKGETTTEAVDATAEVFKYANNGVDGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptococcal Protein GB1 Backbone Modified Variant: beta-3-
publication title Folding Thermodynamics of Protein-Like Oligomers with Heterogeneous Backbones.
pubmed doi rcsb
molecule tags De novo protein
total genus 12
structure length 52
sequence length 56
ec nomenclature
pdb deposition date 2014-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ozaA00
1QKZA 2N7JA 2QSDA 1XCTL 2RMMA 4D2KA 1FD6A 3GB1A 1MPEA 2QMTA 1YNTE 4OZBA 2PW9A 1K52A 2ZW0A 2JU6X 1IGCA 2ON8A 5HG2A 1MHXA 2KDMA 3UI3A 2LUMA 1KH0A 1XCQL 2KQ4X 1MI0A 1XF5L 4MACA 5HI1A 2KACA 2JWUA 4IKGA 1UWXA 1K50A 5BMHA 2JSVX 2J53A 1EM7A 2PTLA 1P7FA 1GB1A 2LHDA 5BMGA 2ONQA 1P7EA 1C9FA 3MP9A 4GLSC 1F2RC 1FCCC 2N9KA 2PLPA 1PGAA 2I38A 1FCLA 1HZ5A 4HJGE 1K53A 2KN4A 5HHDG 2NMQA 1D4BA 1F2RI 4KGRA 3FILA 2LGIA 1IGDA 1K51A 1GB4A 2K0PA 1IBXA 2EELA 5HFYA 4OZAA 5BMIA 2JXTA 2ZW1A 4WH4A 2I2YA 2KWDA 1JMLA 3FILB 2LHEA 4IOIE 3V3XA 2J52A 4OZCA 1HEZE 2OEDA 1IBXB 2GI9A 2RPVA 1MVKA 2GB1A 2IGDA 1HZ6A 1PGBA 5JXVA 2N9LA 1Q10A 4HKZE 1YMHE 2JZPA 1PGXA 4KGSA 2IGGA 1ZXHA 2IGHA 1MHHE 4KGTA
chains in the Genus database with same CATH superfamily
1WSPA 3QJZA 1Y56A 1V1OA 4P1BC 1EF5A 1I4RA 4I6PA 4RNAA 5GXGB 2NS5A 5LXHA 4CHKA 2KVRA 2K5PA 3TEXA 2WNMA 2N1WA 3DHIC 4XE0A 3ZJVA 4IUMB 3S2AA 3QQ8B 3V05A 1J0GA 2N7DA 1IGCA 2ON8A 2MH7A 1MHXA 3DVNU 4XWTA 2UU7A 5CHVC 3KYDD 3UIPB 2OJRA 1D5XC 1QZEA 3W5UB 1KLVA 4W9EA 3ZO5B 1WWTA 3PV1A 4M02A 2WXLA 5LLIA 1ZP0B 4HWIB 4IC7B 4LDTB 2IO3B 2XNAC 1ISNA 2IY0B 3FC4A 2LASA 1FPYA 1P7FA 3ZNHB 3PRMB 1CMXB 1PFDA 1RM6C 4KIKB 2CKHB 4HVBA 4UDUC 1GC6A 5IOIA 1HZ5A 1Q1OA 2WDQB 4MM3B 1WGHA 5BYRA 1UBIA 1UNSA 3E56A 4IWOA 3Q14C 3QWZB 3QC8B 1TZOA 4TMAB 4G3XB 1QLBB 2WLBA 2CR5A 1C76A 1ZE3D 4WH4A 2Z8LA 4HRSA 2DENB 2CHWA 4RFBA 1RRBA 3JW0X 1WM2A 1FNVA 2KWUB 2DAFA 3OG5A 2MJDA 3PS6A 4II3B 4MH8A 2IJ0A 1RFKA 3KWVA 4YTNB 1PGXA 1L6UA 2WDVB 2KWCA 3AXCA 4MGKE 2LVOA 2W9NA 2VZKB 4PT5A 3RN9C 2L76A 2BQQA 1YQ3B 5EE1A 2J42A 2GLSA 3TEYA 2BB5A 3DPDA 5C2TB 3CSFA 4ZYNA 2MBOA 2KHWB 1SE3A 2UYZB 2KDBA 1WYGA 4A90A 1EO6A 2WU2B 1ROEA 3RZFA 1VD2A 1JALA 3ZJUA 2J53A 2HD5B 1E7UA 4MSMB 1I4GA 1CZPA 2KTRA 2O6VD 4M8MA 2H88B 3DBHB 4WWOA 3AEFB 2O6VA 5AZGA 1XXGA 4W9KA 3PSEB 2IBIB 1HXYD 1FCLA 2KMCA 4B0MA 5HKHA 4LNIA 5C3JB 4RCOA 3URYA 2L32A 1R4NI 1TJEA 4ACFA 1ZOYB 3HK0A 3ML9A 1JMLA 4US9A 2BWES 5J18A 4OZCA 3HHMA 2OEDA 2KJRA 2DYBA 2WHIA 1Q10A 4GDKB 1T0RC 4DHJB 2IGGA 3QHTA 5GMVA 1MHHE 2LGXA 3ENEA 2INNE 3HUIA 4ZRQA 3W1YA 2KN5A 1C4AA 2KLCA 1GC7A 1F77A 3SFDB 1FD6A 1QOAA 4NZLB 3X23A 2M4NA 3K9OB 4WJPA 4IM0A 2QDFA 2PW9A 3AEGB 2K8HA 3M3JA 1TS2A 3DBLI 2DWQA 3AE8B 4ITKA 2V0GA 3LJ3A 3H7SA 3SEBA 4DHJD 1VZ6A 3NS1A 2BYTA 1CK1A 3O65B 2PPHA 3EECA 3FKYA 4K1RB 3L13A 4AOFA 4IW0A 2M56B 2IO2B 1ZGUB 3VUWA 2L83A 3R2IA 2HDEA 1V49A 1XLNA 4HCPB 3CF6E 1T0SC 5DPRA 2I38A 4G11A 1C4PA 2WXMA 1K53A 3DBSA 1Q0WB 3IVFA 1WGDA 2K6DB 2FUG1 2KDEB 3VRBB 3PRPB 1V9JA 2DZJA 4MJSA 5HFYA 1JWUD 3KQ4A 1XLPA 3RNAC 4S0RA 1WE6A 1LO5D 3V3XA 4ZYSA 2XN9C 2AL3A 2LJIA 2Y5BB 1MVKA 2YEPB 1Z2MA 1PGBA 2K39A 3QX1A 3UIOB 3W9CB 2B76B 2WYQA 2KK8A 5E6NA 4HDQA 2C9WB 4KGSA 4DHZB 4B95A 1TKEA 4KGTA 1L0XB 3W2DA 4HROA 1FMAD 3TEWA 2RDBC 3P63A 1DYQA 3W1SA 3CIRB 5E6JA 1MPEA 2HE7A 3AEDB 1JWSD 3I57A 4KSLC 3CSTA 1H8CA 1E10A 4DWFA 3T3OA 2INDC 2RSUA 1XCQL 3ECIA 4ICUA 3ZXVA 3GE3C 1XF5L 4KZCA 4C4VB 4MACA 2KX0A 2E3TA 2ZCBA 3AU5A 2LVPA 1TY0A 2LXAA 2QIEB 4WWNA 2KWVB 4WAFA 2KLGA 4MT5A 3KLSX 4MELA 2G3QB 4MEMA 2PE9A 1C9FA 1V2YA 3W1SC 1Q5WB 1E9MA 1F2RC 2BBCA 3PLUA 4KZ0A 1SF0A 3B9JA 3Q8EA 2AX5A 4W9FA 1GJZA 2WS3B 3QARA 4HEA1 4LK0M 4OW0A 1F2RI 3TMPB 5JHBA 1FM0D 2BTEA 1PYWD 3L0WB 3I3TB 2KWDA 4ZRJA 2NPTA 1RWSA 4FULA 2M0XA 4ZRPA 2O2VA 3RPFC 3EC8A 3DQVA 3Q8FA 1WMHA 3HM6X 1A5RA 3AE2B 3TIXA 3ZNID 2GBKA 1YMHE 4NNJB 2FCMA 2KXJA 3X0WA 2D07B 2C60A 3KUZA 3C19A 1J7AA 2WXPA 1FFVA 2LMCA 3AE9B 4XDDA 2IDYA 1VZ7A 4EZLA 3AECB 1UWMA 1SE4A 4AUQC 2JY6A 2ZZPB 3ZVVA 2LXCA 3KUCB 4M0WA 5IO9A 1E5WA 2KDMA 1VLBA 1TGZB 3N32A 4HCNB 4N58A 3PO0A 4BZAA 1QQRA 1U4AA 4E74A 5HI1A 4DDGD 4JE3B 4AJWA 2L00B 3ZRFA 2HTHA 5DPWA 1GOZA 2KVZA 4GB9A 5FR6A 2DZIA 3ALBA 4ARIA 4E71A 3U52E 1TTNA 1QOGA 3N1YC 3LB8C 3MP9A 4CYEA 1D3ZA 2WDRB 4K7UA 1WYWB 1PGAA 5KHQA 4RM8A 2MBQA 1WFYA 4A6QA 3OJ4B 3DHHC 4KGRA 1MFWA 3VVWB 4IDIA 2KDIA 5DCNA 2K0PA 2EELA 4Q2JA 3TSSA 4LNFA 2Y5PA 4K7WA 1UUPA 3U7ZA 3A9KA 1WJ4A 4DDID 3JSVB 1VJKA 3P2BA 1RYJA 2JUOA 5LXIB 3KYCD 3T8MA 3P4RB 2RDHA 1YJ1A 2MP2B 2N9EB 4NQKE 2N9LA 2AQ1B 3RYTA 1XD3B 1ZXHA 2FUHB 2HTME 2V1YA 2BS3B 4L2YA 1SJHD 2OOBB 3Q6BA 4NAWA 4DXFA 2ZEQA 3RT3B 2MJ3A 5E6PA 2GMIC 4WIPA 3VH4B 3AH7A 5D2MB 2LUEA 1TIFA 2Q5WD 1GUAB 2GRIA 2SEBD 2JF5A 1BUIC 3NOBA 1SB3C 4H2AA 1YD8U 2ZNVC 3PLVA 3E9SA 2GBMA 1J7BA 3ZTDA 1KLGD 3MC0B 1ESFA 1E8ZA 1TT5B 5BYQA 3EFUA 3A1QA 3VTWA 2MBHA 3QCAA 4W9DA 2LHDA 4GN1A 3ZQ4A 3VAWA 2WXFA 1P0RA 1WJNA 2ONQA 2UWQA 4GMVA 4TSSA 3H1UA 1TY2A 2YLMA 5EE9A 3P42A 4XDCA 4WJOA 5MPOA 3KW5B 1H4RA 4GIVA 2W55A 4A55A 1V1PA 2N7EA 3FILA 3FAHA 4DXAB 4ZHPA 2ZVNA 2V9HA 1L7YA 1GPXA 1KJTA 1OTRB 4G0NB 3L08A 4I6NB 4AJYB 3P1MA 4A3OA 1ZW7A 2D3CA 3NVWA 2ZVOA 5AEKB 4WURA 3VDZA 4K3BA 1MJDA 4FJYA 3Q3OC 2BF8B 1N5XA 1HEZE 1WZ0A 4W9GA 4EKUA 3B0AA 4PYUA 3WAMA 3EUB2 1QF6A 4ICVA 2WXHA 1JRPA 5DPSA 4FBJB 1KFYB 3IBEA 1WXAA 1AN8A 3GZNB 2VRRB 5FK9C 3IT6B 5G2NA 4LNNA 4N59A 3ZGZA 3V60A 3QAQA 1R4NB 2W3RA 3MHZA 1WRDB 1QKZA 1I4XA 3BINA 4N6EB 1RLFA 4QAYA 3VUXA 2WDTB 4S17A 2BPSA 2R61A 1C78A 4GDLB 4US8A 3DBRI 2FBWB 4JLCA 3VXWA 3TL5A 1NEKB 3A9JB 2I1KA 2JYTA 2QJLA 4X57B 1C77A 1SGHA 1WGGA 1IYFA 2M8SA 3K9PB 3NS8A 2X8XX 2DYMA 4DK5A 4YL8A 1VZ8A 1XLOA 3BVZA 4J3OD 3QIJA 3RNBC 1E7VA 1UGJA 2O6VB 1K50A 4KIKA 3DWGC 3UQAA 3NY5A 1L4DB 1STEA 2L52A 3BYTB 3A4RA 4C7ZA 4MM3A 4W9IA 4USAA 3VH3B 2ZPYA 4NJ6A 1TKGA 1L5PA 3BZDB 3WCQA 2AQ2B 2PJHA 2FNJB 2E6XA 2G45B 1V81A 1SBBB 2KN4A 4BAXA 4JIOU 3RNCC 1EU4A 1IGDA 2R2QA 2CS4A 2SAKA 3ONSA 3PZDA 4B0EA 2LGDA 3RZWC 3IHPC 2BGFA 3DWMA 1UELA 4IOIE 3GE8C 3LDZE 1TS3A 4BFRA 1A70A 3IXSA 3NVZA 3AM9A 1L2NA 3P4PB 4NJ7A 3R7RA 3I5JC 2V4IB 5IN7A 4XGAB 4LNKA 1WR6E 5BYSA 1D5ZC 1YN4A 2KQSA 3BK1A 3UGBB 1N62A 1M4VA 2DZKA 1TBEA 1WY8A 5T8IA 4WAAA 3L10B 3ZTCA 4JPSA 2FIDA 3EHVA 3R8BA 1S1QB 2INCC 3IAS1 2AQ3B 1OQQA 1YQ4B 5CTRC 1FXIA 3DVGY 3HM3A 1NI3A 4RGNA 1SE2A 3RCZA 5L83A 5E6OA 1I42A 1WXVA 2KFKB 1KH0A 2XK5B 4P6VF 2L05A 1VRAB 1WJUA 3R3MA 4EUTA 2L0TA 5EDSA 2DLBA 2KKCA 4RGOS 2VH1A 2G4DB 5G5GA 2JWZA 5D3DA 2BS4B 4MJSB 1SEBD 2Y5CA 1G6JA 1EUVB 2KAJA 2AL6A 1B1ZA 3AE7B 2JQRB 4EOYA 3GP7A 1HA5A 1N63A 4RMAA 2Z0DB 1E0ZA 4A20A 3RI7C 1B9RA 2RR9A 4PS3A 4II2B 5H92C 5BO4B 2PE6B 4TUUA 3SR6A 2CJNA 1KF6B 3J9CA 3DBHI 5AUIA 1NYQA 4ANXA 2N4FA 3ZNGC 2JZPA 2W54A 1AYFA 1YIWA 2K8CA 2V3SA 1KRHA 4MDKE 4W9CA 5EE3A 3N9YC 5H8YE 1JRUA 1UBQA 3ZDTA 3EGRA 1YX6B 1NDDA 5IP4D 3TJPA 2M0AA 3Q8BA 2CU1A 3AE4B 3VTUA 1WGYA 2WP9B 3KH0A 2D5GA 2AYOB 4NJCA 3M63B 1R4MB 5C23A 2JX5A 1FNUA 1AW7A 1BMLC 2HJ8A 2KACA 2BYEA 1I7HA 4JQWC 3A33B 1L0YB 1ZXIA 2EKIA 4YXDB 2LZ6A 3R66C 4PS7A 1P3QU 4FJZA 3ETRA 4GLSC 1FCCC 3U30A 3UQBA 3LXFA 1V8CA 1ACCA 1WR1A 3GS2A 2RDGA 1TKYA 2Z59B 2GOWA 2BS2B 2B3AA 2QEJC 2C5LC 1SJED 2O2VB 1N5WA 5AUKA 1GB4A 4DBGA 2BWFA 4BBNC 1J19A 4OZAA 3JVZX 1WMHB 1M94A 2D11A 4RF1A 2IYDB 2C7MB 1FRRA 4HK2A 2MLBA 3OAWA 4YWGG 3CMMB 5C1ZA 5IKCM 4K81A 1IBXB 4P16A 2CHXA 4F7ZA 3RULA 3VTVA 2DHZA 2KTFA 5G5HA 4BKTA 1QOFA 2ZPNA 4NQLB 3L4PA 2ZCCA 1NBFC 1P9DU 2WX1A 2N7JA 2DBYA 2QCZA 1NI2A 1PUTA 2JT4B 1XCTL 2JYEA 3AN1A 1KTKA 1J8CA 5AZHA 5J2RA 2BKFA 3BVGA 2ICIA 2QMTA 4F8CB 3Q8AA 1MG4A 2L0FA 4JWSC 4IM2A 2K1FA 3APDA 3PPAA 4JX1C 5G55A 4TQ0A 1WIAA 1NVID 1OQYA 2KQ4X 3H9DA 3APCA 4TV3A 3H7PA 1UWXA 1EWCA 1AWDA 2M1MA 4BKGA 1FXTB 1SIJA 1F52A 1EM7A 2MQJA 2PTLA 3M95A 2C7NB 3VRAB 4G50A 4TKNA 3N1ZC 2FCNA 5IA7A 2Y3AA 2K6QA 2NTTA 3GOEA 3NVYA 2N9KA 1F9JA 3V62A 2WXQA 5JHAA 4MGIE 4KSKC 2CJOA 3SDLC 1GAQB 2J7QB 3L17A 4LJPB 3PZ8A 4XX5A 1F0ZA 3WIMA 3QK0A 2INPE 4YSXB 2RPQA 4HXDA 2D3GA 1XEEA 3DVGX 1JWBD 3NVVA 2K9XA 4FHJA 4FADA 1JROA 3MC9A 2W3SA 3TBLD 2MW5A 2JVCA 1TYGB 1JWMD 1YN5A 3N20C 4PK1A 1E90A 1LGRA 2JXXA 2LGYA 5CX3A 3WANA 2QSDA 2GBNA 1WJ6A 1YOVB 2JPHA 4ZOHC 3RNGC 1D6EC 4EFOA 4PS8A 1WM3A 2LJ5A 3L16A 4FXCA 2KANA 3ZDMC 4MGZE 3PHWB 2MEKA 1OQRA 4URKA 3KUDB 1SXTA 2Z0EB 4CQNA 2NBWB 2D3BA 4ZHOA 5D6JB 4GXBA 2PKOA 3JYUA 1WXMA 3DDCB 1L0VB 1XO3A 1FNWA 1WX8A 4KVGB 3ZKJC 1I4PA 1V1PB 3BIID 1FEHA 1YQBA 2A4ZA 4YTPB 3SD5A 1VDVA 5EE0A 3Q3MC 3WAOA 5DPTA 3B2FA 1SE9A 1S3SG 3U8ZA 4BKSA 4XYCA 2H89B 2MCNB 2LGIA 2PEAA 3PRZA 1K51A 1V97A 2IY1B 1NYRA 3N1XC 1WXQA 1HTQA 3DVNV 5BMIA 1ET6A 2MP2A 3H8HA 2J0JA 1EU3A 2N0SB 1RAXA 1T5XD 4PYZA 3BWUD 4HJKA 5FR3A 3PZ7A 2XEWA 2MJEA 2MSED 4W9JA 3HRDD 1LFDA 1HZ6A 4NPNA 1KLUD 2WXGA 4KV2A 4WQOB 3B1LX 5CHWA 2ACZB 2A5UA 1ZKHA 1OEYA 3AV8A 4IWPA 3N3KB 2V3NA 4W9HA 3AEEB 3NUHB 1V6EA 4GU2A 4D2KA 2WGSA 2K22A 4OVVA 1Z5SB 3P4QB 3TCAA 1UGMA 1UF0A 2JU6X 4BBNF 3IT4B 4XC2A 3UI3A 4B9KA 2WXOA 1E7PB 4LCDE 3T3NA 1GG3A 1XQQA 4W9LA 5TR5A 3U4EG 3PGEA 3B2GA 4WJQA 5J17A 1EF1A 1VCBA 1JW9D 5BMHA 1T0YA 3EA6A 1C4CA 2JSVX 2QILA 4KDIC 1GB1A 2FCQA 4LDTD 1VR9A 3IFWB 2KDFB 4MGYE 1C1YB 2PLPA 3NZUA 3O13A 1HQRD 2KTRB 1D4BA 2VH2A 1YX5B 1FIQA 4BOSC 2KC1A 2YEPF 1N6ZA 3OWEB 1DOXA 2IPKD 1ZUD2 2JXTA 4I6LB 2OJWA 2LHEA 1XT9B 2XBBC 3TEZA 2WXJA 2J52A 1KM7A 1SIFA 3DBLB 4EEWA 5JH5C 3Q3FA 4DHZE 3C8YA 4RF0A 2BW2A 1HTOA 1ZPSA 4KKIA 1EWYC 2NBVB 2QC8A 1T0QC 2NTSA 2PIAA 1DGJA 4M00A 4BVUC 4AP4C 2QHOA 4GDLA 1UZXB 3MFGA 1IUEA 2MRPA 1WX7A 4R3DA 3A9JA 4ZRKA 2RMMA 2WX0A 3GB1A 3VR9B 2VZKD 1N60A 3D32A 4OHJA 1YNTE 2BKRB 3A4SC 1K52A 4AS1A 2M17A 4CO7A 1QT9A 4O1NA 3WALA 4LTUA 4ANUA 3ZW3A 5LNK1 4ASWC 5D7GA 3ZYYX 2MHJA 4EZKA 4HDOA 2L7RA 3U7DA 3AU4A 3DHGC 4YTMB 3HVZA 2IZVB 2K8BA 3GZNI 1MI0A 1CJEA 2DAJA 2ZJDA 4NAMA 5AZFA 5IAAC 4XWWA 2MBEA 1OGWA 4IKGA 3RNFC 1I4QA 1TS4A 3VR8B 2FIFA 2KMAA 2M19A 1J7CA 4N9F4 2LEKA 4B6WA 3W5VB 2L3ZA 2D2QA 1JQ4A 1E8XA 3I63C 5D3IB 3RD2A 3BY4B 3IG3A 3HVDA 2G1EA 1T3QA 2KJHB 2N9PC 3TUOA 2ASQA 4ANVA 1ZDVA 3NHEB 4EZJA 4FJVB 4YT0B 2N1VA 4KX6B 4WJNA 1K8RB 1QILA 3AMZA 3V61A 3ZUNA 1AARA 4ANWA 2IGDA 3AE6B 2D3AA 3AE5B 4IWQA 4HKZE 1FXAA 4FN2A 4A8XC 1BT0A 1LQBA 2AWTA 4RGTA 4NY0A 2NCNA 1RFAA 4GDKA 1UH6A 3RFZB 2WU5B 4KDLB 2R2OA 3EFCA 3VFKA 3B08A 2KFKA 3MC8A 4M8NA 2XK5A 3ZLZA 2BVCA 4E3CA 1SSNA 2V3PA 3ABVB 2JZ3B 1V5TA 5TSSA 2JRHA 4C00A 2BYFA 3I9V1 1FFUA 1FRDA 2FE8A 2V4LA 2WWZA 3NRZA 2DNFA 1FO4A 1GNUA 3KWLA 1WZ3A 3PREA 1P98A 4RM9A 3IAM1 1T6BX 2JRIB 3M62B 3MJWA 2EMSA 2KFJA 3BVMA 3ZXRA 2TSSA 3RUIB 2WXKA 4KKJA 4HKQA 2EMTA 3ZNZB 5BMGA 4GGQA 2K25A 3BYYB 3UINB 2LD9A 4C80A 3AULA 4GOCA 1DOYA 2IO1B 3H6NA 2EKEC 1L6VA 2N9XA 3WAPA 1CQVA 4JL9A 1JCKB 2OHFA 3Q8CA 4HJGE 1C3TA 4L23A 2KNBA 1UD7A 2NMQA 3ZRCA 1WXSA 2CHZA 5KHOA 3U2SC 1PQSA 2ZW1A 1XLQA 4AQ7A 4P7IA 2JZZA 4FA6A 4ARCA 3RMKC 4C7YA 3AI5A 1ENFA 2BB6A 2HJ1A 2PVGC 3Q69A 4FLHA 2AEHA 1LM8B 3AEBB 2NPTB 3MHSD 2MBBB 1X1MA 4C56C 2WXRA 3NZ3A 1R7SA 3DCGA 3KVFB 4HPMB 3L54A 4LNOA 3MJ5A 2K3UA 2KT7A 2LFIA 2GBJA 2GBRA 3APFA 4TQ1A 2FAZA 2LGSA 1YJIA 1YJJA 1V86A 3WA0A 3Q2AC 2KC2A 2PVOD 3PT2B 4A9AA 1DOIA 3OJ3A 2ZW0A 3HIZA 1C79A 3LYYA 2WXIA 4L1BA 3H7PB 3ZJTA 2X38A 2DZMA 5D94A 4REZA 2LWPA 3BK2A 5FKAC 4WWMA 4GSWA 2FCSA 1BXTA 3AE1B 2JWUA 3Q3NC 2J0KA 2RGFA 3AEAB 3QA8A 4M0WB 4M01A 2KO3A 2L1AA 4YSYB 1JWAD 1NENB 1WE7A 4C4VA 2WXNA 1P7EA 1E8YA 2KZRA 1WH3A 2LVQA 1WI0A 3PTFC 1D5MC 3CWIA 2BT6A 1Y8RC 1WRIA 2C7HA 3SHQA 4JGHB 2IO0B 3NJTA 5HHDG 4RGMA 2G4SA 3MTNB 4K3CA 1R4MI 2DX5B 1IBXA 1PDXA 3R7QA 3AE3B 5L95C 4WQMA 2MWSB 2LI5A 2RD0A 3V6EB 3NG0A 4ZRIA 4JWUC 1IPGA 2GI9A 5JZEB 3PVLA 2RPVA 4DXGA 4F1SA 2GB1A 3A9KB 3UF8A 4YSZB 2MX2A 1KOTA 3SFEB 1IP9A 1E8WA 4LLGM 2KX3A 4OVZA 4XZ4A 3VQIA 1ZDXA 2NR2A 2IGHA 1V80A 2ZNVB 1OEYJ 4IG7B 1OFFA 1TZ1A 2LRUA 2MA9B 3AB5A 1WF9A 1E6EB 2KD0A 2DYOA 4DQOC 2NBUA 2PMVA 3C0RB 1WX9A 3V6CB 4OZBA 2LRWA 4AWJA 1LXDA 2J4XA 3OLMD 4NAWB 2BYVE 4P1CC 3T9LA 1HE8A 5HG2A 2W82A 4HLEA 1P1AA 2LUMA 1I35A 1N61A 1TS5A 3DOWA 3SU8X 3P4SB 2KJ6A 4HPLB 3N30A 2KQ7A 1MG8A 3Q3JA 5I4DA 4LJOB 4MSQB 4K7SA 4ZDVA 4MH0E 2YVCA 4A3PA 4EE2A 1YN3A 3NZSA 1V5OA 1ET9A 2KOXA 3A1QB 2KYWA 3ZIMA 4HPPA 4WWPA 3VUYA 3R2TA 2CU3A 1WGRA 1QOBA 5CHFA 1I4HA 2NVUI 1L4ZB 2REXA 2KMMA 4FHKA 1F1HA 2I2YA 3RNEC 2D10A 3DBRB 3FILB 4IM3A 4J6IA 4RH6A 4BKSD 2WQYB 2L8JA 3VHTC 5JXVA 2J0MA 2I1JA 3JSVA 1WGKA 3ML8A 3PHXB 2G9HD 4BOZB 4OVUA
chains in the Genus database with same CATH topology
1IUEA 1WSPA 1Y56A 1J7AA 4R3DA 1V1OA 2WXPA 1FFVA 2RMMA 5EE3A 1I4RA 2LMCA 3AE9B 3N9YC 4RNAA 4XDDA 5GXGB 5H8YE 2IDYA 2K5PA 1VZ7A 3GB1A 3TEXA 2VZKD 2WNMA 3VR9B 3EGRA 1N60A 3AECB 4XE0A 4OHJA 1YNTE 3ZJVA 1UWMA 1SE4A 1K52A 2M0AA 3V05A 4AS1A 3Q8BA 3AE4B 1QT9A 1IGCA 4O1NA 2ON8A 4M0WA 2MH7A 4LTUA 5LNK1 2WP9B 1MHXA 2D5GA 2KDMA 5D7GA 1VLBA 4XWTA 4NJCA 3ZYYX 4YTMB 2JX5A 1D5XC 1FNUA 3HVZA 4N58A 1AW7A 3PO0A 1BMLC 1MI0A 1CJEA 1QQRA 4NAMA 3W5UB 4XWWA 5HI1A 2KACA 1WWTA 1I7HA 4JE3B 4IKGA 1L0YB 2WXLA 1ZP0B 1I4QA 1TS4A 1ZXIA 2EKIA 3VR8B 4YXDB 2XNAC 1GOZA 3FC4A 1P7FA 2M19A 1J7CA 4ARIA 1PFDA 2LEKA 3U52E 1RM6C 3W5VB 1QOGA 1JQ4A 3LB8C 3MP9A 3ETRA 4GLSC 4UDUC 5D3IB 2WDRB 1FCCC 3HVDA 1PGAA 2G1EA 3LXFA 1V8CA 1ACCA 1HZ5A 4A6QA 2WDQB 4MM3B 3GS2A 2RDGA 5BYRA 1T3QA 1TKYA 1UNSA 4KGRA 3E56A 4IDIA 2BS2B 2QEJC 3TUOA 1SJED 1TZOA 4TMAB 1N5WA 5AUKA 1QLBB 1GB4A 2K0PA 2WLBA 2EELA 1ZDVA 4Q2JA 1C76A 3TSSA 1ZE3D 4OZAA 4YT0B 2Y5PA 3U7ZA 1UUPA 4RF1A 4WH4A 2Z8LA 1FRRA 4HRSA 4KX6B 4RFBA 1QILA 1VJKA 4YWGG 3AMZA 1RYJA 1IBXB 1FNVA 4P16A 3P4RB 2RDHA 2IGDA 3AE6B 2MJDA 4MH8A 2N9LA 3AE5B 2AQ1B 4HKZE 5G5HA 2IJ0A 1RFKA 3KWVA 1FXAA 1QOFA 4YTNB 4A8XC 1PGXA 1L6UA 3L4PA 1ZXHA 2WDVB 2HTME 4RGTA 2BS3B 4L2YA 2VZKB 2N7JA 1SJHD 2DBYA 1PUTA 4PT5A 3RFZB 1XCTL 2JYEA 3AN1A 1KTKA 2WU5B 4DXFA 2MJ3A 3BVGA 1YQ3B 5EE1A 2J42A 2ICIA 2QMTA 4WIPA 3AH7A 3TEYA 2BB5A 3Q8AA 4JWSC 1SSNA 2V3PA 3ABVB 4JX1C 2Q5WD 5TSSA 5C2TB 2GRIA 4TQ0A 2SEBD 3I9V1 1FFUA 1FRDA 1BUIC 1NVID 2FE8A 3NRZA 1FO4A 1SB3C 3KWLA 1SE3A 4H2AA 2KQ4X 3E9SA 1WYGA 1J7BA 4A90A 1KLGD 3MC0B 1UWXA 3IAM1 1EWCA 1AWDA 1T6BX 1ESFA 2WU2B 1ROEA 1JALA 3BVMA 2J53A 5BYQA 1SIJA 3ZJUA 1EM7A 2TSSA 2PTLA 2WXKA 4KKJA 4HKQA 2LHDA 1I4GA 1CZPA 5BMGA 3ZQ4A 2WXFA 3VRAB 2ONQA 2H88B 3BYYB 4TSSA 4C80A 1TY2A 3AEFB 1DOYA 5EE9A 1XXGA 3P42A 4XDCA 2Y3AA 1L6VA 2NTTA 3NVYA 2N9KA 1CQVA 1HXYD 1JCKB 4B0MA 5MPOA 1FCLA 2WXQA 2OHFA 3Q8CA 4HJGE 4L23A 2W55A 2CJOA 2NMQA 4A55A 5C3JB 4RCOA 1V1PA 3URYA 2L32A 3FILA 3FAHA 4ZHPA 1GAQB 1GPXA 3PZ8A 3U2SC 1TJEA 1F0ZA 3P1MA 2ZW1A 3NVWA 2INPE 1ZOYB 1XLQA 4YSXB 1JMLA 4WURA 4US9A 4AQ7A 4ARCA 1XEEA 1N5XA 4OZCA 4C7YA 1ENFA 1HEZE 1JWBD 2BB6A 3NVVA 2K9XA 2PVGC 2OEDA 3Q69A 1JROA 3EUB2 1QF6A 2WXHA 1JRPA 3AEBB 1KFYB 2W3SA 4C56C 2WXRA 3NZ3A 1Q10A 1R7SA 1AN8A 4GDKB 5FK9C 3IT6B 3MJ5A 2K3UA 2IGGA 1TYGB 1JWMD 2LFIA 4N59A 3ZGZA 1MHHE 1YN5A 2INNE 3HUIA 4TQ1A 2W3RA 3MHZA 4ZRQA 1QKZA 2QSDA 1YJIA 1C4AA 1I4XA 4N6EB 1YJJA 1F77A 3SFDB 4ZOHC 1FD6A 1QOAA 4NZLB 1D6EC 2PVOD 2R61A 1C78A 4GDLB 4A9AA 4US8A 4FXCA 1DOIA 2FBWB 2PW9A 3AEGB 1NEKB 2MEKA 1OQRA 2ZW0A 3LYYA 1C79A 2JYTA 2QJLA 2WXIA 1C77A 4L1BA 1TS2A 3ZJTA 2X38A 2DWQA 2DYMA 3AE8B 4REZA 3BK2A 5FKAC 4ITKA 1SXTA 2V0GA 4WWMA 4CQNA 1VZ8A 3SEBA 4ZHOA 1VZ6A 3NS1A 2BYTA 1BXTA 1CK1A 1XLOA 2PKOA 3AE1B 2JWUA 3AEAB 3BVZA 4J3OD 1UGJA 1K50A 2L1AA 3DWGC 2M56B 1L4DB 4YSYB 1STEA 2L52A 3BYTB 1L0VB 1JWAD 1NENB 1XO3A 1FNWA 4C7ZA 4USAA 2WXNA 1P7EA 2L83A 3R2IA 1I4PA 2HDEA 1V1PB 3BIID 1XLNA 1TKGA 1L5PA 3BZDB 1FEHA 3WCQA 2AQ2B 1D5MC 3CWIA 2BT6A 2E6XA 2I38A 1WRIA 4YTPB 1C4PA 1SBBB 1VDVA 5EE0A 3B2FA 2WXMA 1K53A 2KN4A 5HHDG 4RGMA 2H89B 2LGIA 1EU4A 2FUG1 1IGDA 1K51A 1V97A 3VRBB 1NYRA 1WXQA 2SAKA 1IBXA 4B0EA 5HFYA 1JWUD 5BMIA 1PDXA 3KQ4A 1ET6A 1XLPA 3AE3B 4WQMA 3DWMA 3H8HA 4IOIE 1EU3A 1LO5D 2N0SB 3V3XA 1T5XD 4ZYSA 2XN9C 4JWUC 3BWUD 1TS3A 2LJIA 1A70A 5FR3A 2GI9A 3IXSA 3PZ7A 2MJEA 2RPVA 1MVKA 3NVZA 3AM9A 4DXGA 3HRDD 2GB1A 2YEPB 3P4PB 1HZ6A 1PGBA 2V4IB 4YSZB 3SFEB 1KLUD 3W9CB 2B76B 2WXGA 5BYSA 4LLGM 1D5ZC 4OVZA 4KGSA 3VQIA 1ZDXA 1YN4A 1TKEA 2ACZB 2IGHA 3BK1A 1N62A 4KGTA 1L0XB 3AV8A 1M4VA 2V3NA 3W2DA 4HROA 1FMAD 1OFFA 3AEEB 3NUHB 5T8IA 3TEWA 3AB5A 4JPSA 3P63A 1E6EB 4D2KA 2DYOA 1DYQA 3W1SA 3CIRB 5E6JA 2K22A 4DQOC 2PMVA 1MPEA 3AEDB 4OZBA 3R8BA 1JWSD 3I57A 3P4QB 3IAS1 2AQ3B 1OQQA 2J4XA 4NAWB 1YQ4B 2JU6X 1FXIA 1NI3A 4RGNA 1SE2A 3IT4B 5HG2A 1E10A 2W82A 3T3OA 3UI3A 2WXOA 2LUMA 1KH0A 1E7PB 1N61A 1XCQL 3T3NA 4P6VF 1TS5A 1VRAB 1XF5L 4MACA 3U4EG 3P4SB 2E3TA 3B2GA 1JW9D 5BMHA 1TY0A 3EA6A 2QIEB 1C4CA 2JSVX 4WAFA 5I4DA 2QILA 4MT5A 1GB1A 2DLBA 3KLSX 4RGOS 1VR9A 5G5GA 1C9FA 4EE2A 1E9MA 1F2RC 1YN3A 2BBCA 1SF0A 3B9JA 3Q8EA 2AX5A 2PLPA 1ET9A 5D3DA 2BS4B 2WS3B 3O13A 1HQRD 1SEBD 2Y5CA 4HEA1 4LK0M 4OW0A 1D4BA 3R2TA 1F2RI 2KAJA 2CU3A 1B1ZA 1FIQA 1FM0D 2BTEA 1QOBA 2YEPF 2JQRB 3AE7B 1I4HA 3GP7A 3OWEB 1HA5A 1PYWD 1DOXA 1L4ZB 1N63A 2IPKD 2KMMA 1ZUD2 2JXTA 1E0ZA 2I2YA 2KWDA 1B9RA 1RWSA 3FILB 2LHEA 3TEZA 4ZRPA 2WXJA 2J52A 5H92C 3RPFC 3Q8FA 4RH6A 3SR6A 2WQYB 2CJNA 1KF6B 3J9CA 5JXVA 3C8YA 4RF0A 2BW2A 5AUIA 3AE2B 1NYQA 1ZPSA 1YMHE 4KKIA 1WGKA 1EWYC 2JZPA 2NTSA 2PIAA 2W54A 1DGJA 1AYFA 2G9HD 1KRHA 3MFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QKZ A;  2N7J A;  2QSD A;  1XCT L;  2RMM A;  4D2K A;  1FD6 A;  3GB1 A;  1MPE A;  2QMT A;  1YNT E;  4OZB A;  2PW9 A;  1K52 A;  2ZW0 A;  2JU6 X;  1IGC A;  2ON8 A;  5HG2 A;  1MHX A;  2KDM A;  3UI3 A;  2LUM A;  1KH0 A;  1XCQ L;  2KQ4 X;  1MI0 A;  1XF5 L;  4MAC A;  5HI1 A;  2KAC A;  2JWU A;  4IKG A;  1UWX A;  1K50 A;  5BMH A;  2JSV X;  2J53 A;  1EM7 A;  2PTL A;  1P7F A;  1GB1 A;  2LHD A;  5BMG A;  2ONQ A;  1P7E A;  1C9F A;  3MP9 A;  4GLS C;  1F2R C;  1FCC C;  2N9K A;  2PLP A;  1PGA A;  2I38 A;  1FCL A;  1HZ5 A;  4HJG E;  1K53 A;  2KN4 A;  5HHD G;  2NMQ A;  1D4B A;  1F2R I;  4KGR A;  3FIL A;  2LGI A;  1IGD A;  1K51 A;  1GB4 A;  2K0P A;  1IBX A;  2EEL A;  5HFY A;  4OZA A;  5BMI A;  2JXT A;  2ZW1 A;  4WH4 A;  2I2Y A;  2KWD A;  1JML A;  3FIL B;  2LHE A;  4IOI E;  3V3X A;  2J52 A;  4OZC A;  1HEZ E;  2OED A;  1IBX B;  2GI9 A;  2RPV A;  1MVK A;  2GB1 A;  2IGD A;  1HZ6 A;  1PGB A;  5JXV A;  2N9L A;  1Q10 A;  4HKZ E;  1YMH E;  2JZP A;  1PGX A;  4KGS A;  2IGG A;  1ZXH A;  2IGH A;  1MHH E;  4KGT A; 
#chains in the Genus database with same CATH topology
 1WSP A;  3QJZ A;  1Y56 A;  1V1O A;  4P1B C;  1EF5 A;  1I4R A;  4I6P A;  4RNA A;  5GXG B;  2NS5 A;  5LXH A;  4CHK A;  2KVR A;  2K5P A;  3TEX A;  2WNM A;  2N1W A;  3DHI C;  4XE0 A;  3ZJV A;  4IUM B;  3S2A A;  3QQ8 B;  3V05 A;  1J0G A;  2N7D A;  1IGC A;  2ON8 A;  2MH7 A;  1MHX A;  3DVN U;  4XWT A;  2UU7 A;  5CHV C;  3KYD D;  3UIP B;  2OJR A;  1D5X C;  1QZE A;  3W5U B;  1KLV A;  4W9E A;  3ZO5 B;  1WWT A;  3PV1 A;  4M02 A;  2WXL A;  5LLI A;  1ZP0 B;  4HWI B;  4IC7 B;  4LDT B;  2IO3 B;  2XNA C;  1ISN A;  2IY0 B;  3FC4 A;  2LAS A;  1FPY A;  1P7F A;  3ZNH B;  3PRM B;  1CMX B;  1PFD A;  1RM6 C;  4KIK B;  2CKH B;  4HVB A;  4UDU C;  1GC6 A;  5IOI A;  1HZ5 A;  1Q1O A;  2WDQ B;  4MM3 B;  1WGH A;  5BYR A;  1UBI A;  1UNS A;  3E56 A;  4IWO A;  3Q14 C;  3QWZ B;  3QC8 B;  1TZO A;  4TMA B;  4G3X B;  1QLB B;  2WLB A;  2CR5 A;  1C76 A;  1ZE3 D;  4WH4 A;  2Z8L A;  4HRS A;  2DEN B;  2CHW A;  4RFB A;  1RRB A;  3JW0 X;  1WM2 A;  1FNV A;  2KWU B;  2DAF A;  3OG5 A;  2MJD A;  3PS6 A;  4II3 B;  4MH8 A;  2IJ0 A;  1RFK A;  3KWV A;  4YTN B;  1PGX A;  1L6U A;  2WDV B;  2KWC A;  3AXC A;  4MGK E;  2LVO A;  2W9N A;  2VZK B;  4PT5 A;  3RN9 C;  2L76 A;  2BQQ A;  1YQ3 B;  5EE1 A;  2J42 A;  2GLS A;  3TEY A;  2BB5 A;  3DPD A;  5C2T B;  3CSF A;  4ZYN A;  2MBO A;  2KHW B;  1SE3 A;  2UYZ B;  2KDB A;  1WYG A;  4A90 A;  1EO6 A;  2WU2 B;  1ROE A;  3RZF A;  1VD2 A;  1JAL A;  3ZJU A;  2J53 A;  2HD5 B;  1E7U A;  4MSM B;  1I4G A;  1CZP A;  2KTR A;  2O6V D;  4M8M A;  2H88 B;  3DBH B;  4WWO A;  3AEF B;  2O6V A;  5AZG A;  1XXG A;  4W9K A;  3PSE B;  2IBI B;  1HXY D;  1FCL A;  2KMC A;  4B0M A;  5HKH A;  4LNI A;  5C3J B;  4RCO A;  3URY A;  2L32 A;  1R4N I;  1TJE A;  4ACF A;  1ZOY B;  3HK0 A;  3ML9 A;  1JML A;  4US9 A;  2BWE S;  5J18 A;  4OZC A;  3HHM A;  2OED A;  2KJR A;  2DYB A;  2WHI A;  1Q10 A;  4GDK B;  1T0R C;  4DHJ B;  2IGG A;  3QHT A;  5GMV A;  1MHH E;  2LGX A;  3ENE A;  2INN E;  3HUI A;  4ZRQ A;  3W1Y A;  2KN5 A;  1C4A A;  2KLC A;  1GC7 A;  1F77 A;  3SFD B;  1FD6 A;  1QOA A;  4NZL B;  3X23 A;  2M4N A;  3K9O B;  4WJP A;  4IM0 A;  2QDF A;  2PW9 A;  3AEG B;  2K8H A;  3M3J A;  1TS2 A;  3DBL I;  2DWQ A;  3AE8 B;  4ITK A;  2V0G A;  3LJ3 A;  3H7S A;  3SEB A;  4DHJ D;  1VZ6 A;  3NS1 A;  2BYT A;  1CK1 A;  3O65 B;  2PPH A;  3EEC A;  3FKY A;  4K1R B;  3L13 A;  4AOF A;  4IW0 A;  2M56 B;  2IO2 B;  1ZGU B;  3VUW A;  2L83 A;  3R2I A;  2HDE A;  1V49 A;  1XLN A;  4HCP B;  3CF6 E;  1T0S C;  5DPR A;  2I38 A;  4G11 A;  1C4P A;  2WXM A;  1K53 A;  3DBS A;  1Q0W B;  3IVF A;  1WGD A;  2K6D B;  2FUG 1;  2KDE B;  3VRB B;  3PRP B;  1V9J A;  2DZJ A;  4MJS A;  5HFY A;  1JWU D;  3KQ4 A;  1XLP A;  3RNA C;  4S0R A;  1WE6 A;  1LO5 D;  3V3X A;  4ZYS A;  2XN9 C;  2AL3 A;  2LJI A;  2Y5B B;  1MVK A;  2YEP B;  1Z2M A;  1PGB A;  2K39 A;  3QX1 A;  3UIO B;  3W9C B;  2B76 B;  2WYQ A;  2KK8 A;  5E6N A;  4HDQ A;  2C9W B;  4KGS A;  4DHZ B;  4B95 A;  1TKE A;  4KGT A;  1L0X B;  3W2D A;  4HRO A;  1FMA D;  3TEW A;  2RDB C;  3P63 A;  1DYQ A;  3W1S A;  3CIR B;  5E6J A;  1MPE A;  2HE7 A;  3AED B;  1JWS D;  3I57 A;  4KSL C;  3CST A;  1H8C A;  1E10 A;  4DWF A;  3T3O A;  2IND C;  2RSU A;  1XCQ L;  3ECI A;  4ICU A;  3ZXV A;  3GE3 C;  1XF5 L;  4KZC A;  4C4V B;  4MAC A;  2KX0 A;  2E3T A;  2ZCB A;  3AU5 A;  2LVP A;  1TY0 A;  2LXA A;  2QIE B;  4WWN A;  2KWV B;  4WAF A;  2KLG A;  4MT5 A;  3KLS X;  4MEL A;  2G3Q B;  4MEM A;  2PE9 A;  1C9F A;  1V2Y A;  3W1S C;  1Q5W B;  1E9M A;  1F2R C;  2BBC A;  3PLU A;  4KZ0 A;  1SF0 A;  3B9J A;  3Q8E A;  2AX5 A;  4W9F A;  1GJZ A;  2WS3 B;  3QAR A;  4HEA 1;  4LK0 M;  4OW0 A;  1F2R I;  3TMP B;  5JHB A;  1FM0 D;  2BTE A;  1PYW D;  3L0W B;  3I3T B;  2KWD A;  4ZRJ A;  2NPT A;  1RWS A;  4FUL A;  2M0X A;  4ZRP A;  2O2V A;  3RPF C;  3EC8 A;  3DQV A;  3Q8F A;  1WMH A;  3HM6 X;  1A5R A;  3AE2 B;  3TIX A;  3ZNI D;  2GBK A;  1YMH E;  4NNJ B;  2FCM A;  2KXJ A;  3X0W A;  2D07 B;  2C60 A;  3KUZ A;  3C19 A;  1J7A A;  2WXP A;  1FFV A;  2LMC A;  3AE9 B;  4XDD A;  2IDY A;  1VZ7 A;  4EZL A;  3AEC B;  1UWM A;  1SE4 A;  4AUQ C;  2JY6 A;  2ZZP B;  3ZVV A;  2LXC A;  3KUC B;  4M0W A;  5IO9 A;  1E5W A;  2KDM A;  1VLB A;  1TGZ B;  3N32 A;  4HCN B;  4N58 A;  3PO0 A;  4BZA A;  1QQR A;  1U4A A;  4E74 A;  5HI1 A;  4DDG D;  4JE3 B;  4AJW A;  2L00 B;  3ZRF A;  2HTH A;  5DPW A;  1GOZ A;  2KVZ A;  4GB9 A;  5FR6 A;  2DZI A;  3ALB A;  4ARI A;  4E71 A;  3U52 E;  1TTN A;  1QOG A;  3N1Y C;  3LB8 C;  3MP9 A;  4CYE A;  1D3Z A;  2WDR B;  4K7U A;  1WYW B;  1PGA A;  5KHQ A;  4RM8 A;  2MBQ A;  1WFY A;  4A6Q A;  3OJ4 B;  3DHH C;  4KGR A;  1MFW A;  3VVW B;  4IDI A;  2KDI A;  5DCN A;  2K0P A;  2EEL A;  4Q2J A;  3TSS A;  4LNF A;  2Y5P A;  4K7W A;  1UUP A;  3U7Z A;  3A9K A;  1WJ4 A;  4DDI D;  3JSV B;  1VJK A;  3P2B A;  1RYJ A;  2JUO A;  5LXI B;  3KYC D;  3T8M A;  3P4R B;  2RDH A;  1YJ1 A;  2MP2 B;  2N9E B;  4NQK E;  2N9L A;  2AQ1 B;  3RYT A;  1XD3 B;  1ZXH A;  2FUH B;  2HTM E;  2V1Y A;  2BS3 B;  4L2Y A;  1SJH D;  2OOB B;  3Q6B A;  4NAW A;  4DXF A;  2ZEQ A;  3RT3 B;  2MJ3 A;  5E6P A;  2GMI C;  4WIP A;  3VH4 B;  3AH7 A;  5D2M B;  2LUE A;  1TIF A;  2Q5W D;  1GUA B;  2GRI A;  2SEB D;  2JF5 A;  1BUI C;  3NOB A;  1SB3 C;  4H2A A;  1YD8 U;  2ZNV C;  3PLV A;  3E9S A;  2GBM A;  1J7B A;  3ZTD A;  1KLG D;  3MC0 B;  1ESF A;  1E8Z A;  1TT5 B;  5BYQ A;  3EFU A;  3A1Q A;  3VTW A;  2MBH A;  3QCA A;  4W9D A;  2LHD A;  4GN1 A;  3ZQ4 A;  3VAW A;  2WXF A;  1P0R A;  1WJN A;  2ONQ A;  2UWQ A;  4GMV A;  4TSS A;  3H1U A;  1TY2 A;  2YLM A;  5EE9 A;  3P42 A;  4XDC A;  4WJO A;  5MPO A;  3KW5 B;  1H4R A;  4GIV A;  2W55 A;  4A55 A;  1V1P A;  2N7E A;  3FIL A;  3FAH A;  4DXA B;  4ZHP A;  2ZVN A;  2V9H A;  1L7Y A;  1GPX A;  1KJT A;  1OTR B;  4G0N B;  3L08 A;  4I6N B;  4AJY B;  3P1M A;  4A3O A;  1ZW7 A;  2D3C A;  3NVW A;  2ZVO A;  5AEK B;  4WUR A;  3VDZ A;  4K3B A;  1MJD A;  4FJY A;  3Q3O C;  2BF8 B;  1N5X A;  1HEZ E;  1WZ0 A;  4W9G A;  4EKU A;  3B0A A;  4PYU A;  3WAM A;  3EUB 2;  1QF6 A;  4ICV A;  2WXH A;  1JRP A;  5DPS A;  4FBJ B;  1KFY B;  3IBE A;  1WXA A;  1AN8 A;  3GZN B;  2VRR B;  5FK9 C;  3IT6 B;  5G2N A;  4LNN A;  4N59 A;  3ZGZ A;  3V60 A;  3QAQ A;  1R4N B;  2W3R A;  3MHZ A;  1WRD B;  1QKZ A;  1I4X A;  3BIN A;  4N6E B;  1RLF A;  4QAY A;  3VUX A;  2WDT B;  4S17 A;  2BPS A;  2R61 A;  1C78 A;  4GDL B;  4US8 A;  3DBR I;  2FBW B;  4JLC A;  3VXW A;  3TL5 A;  1NEK B;  3A9J B;  2I1K A;  2JYT A;  2QJL A;  4X57 B;  1C77 A;  1SGH A;  1WGG A;  1IYF A;  2M8S A;  3K9P B;  3NS8 A;  2X8X X;  2DYM A;  4DK5 A;  4YL8 A;  1VZ8 A;  1XLO A;  3BVZ A;  4J3O D;  3QIJ A;  3RNB C;  1E7V A;  1UGJ A;  2O6V B;  1K50 A;  4KIK A;  3DWG C;  3UQA A;  3NY5 A;  1L4D B;  1STE A;  2L52 A;  3BYT B;  3A4R A;  4C7Z A;  4MM3 A;  4W9I A;  4USA A;  3VH3 B;  2ZPY A;  4NJ6 A;  1TKG A;  1L5P A;  3BZD B;  3WCQ A;  2AQ2 B;  2PJH A;  2FNJ B;  2E6X A;  2G45 B;  1V81 A;  1SBB B;  2KN4 A;  4BAX A;  4JIO U;  3RNC C;  1EU4 A;  1IGD A;  2R2Q A;  2CS4 A;  2SAK A;  3ONS A;  3PZD A;  4B0E A;  2LGD A;  3RZW C;  3IHP C;  2BGF A;  3DWM A;  1UEL A;  4IOI E;  3GE8 C;  3LDZ E;  1TS3 A;  4BFR A;  1A70 A;  3IXS A;  3NVZ A;  3AM9 A;  1L2N A;  3P4P B;  4NJ7 A;  3R7R A;  3I5J C;  2V4I B;  5IN7 A;  4XGA B;  4LNK A;  1WR6 E;  5BYS A;  1D5Z C;  1YN4 A;  2KQS A;  3BK1 A;  3UGB B;  1N62 A;  1M4V A;  2DZK A;  1TBE A;  1WY8 A;  5T8I A;  4WAA A;  3L10 B;  3ZTC A;  4JPS A;  2FID A;  3EHV A;  3R8B A;  1S1Q B;  2INC C;  3IAS 1;  2AQ3 B;  1OQQ A;  1YQ4 B;  5CTR C;  1FXI A;  3DVG Y;  3HM3 A;  1NI3 A;  4RGN A;  1SE2 A;  3RCZ A;  5L83 A;  5E6O A;  1I42 A;  1WXV A;  2KFK B;  1KH0 A;  2XK5 B;  4P6V F;  2L05 A;  1VRA B;  1WJU A;  3R3M A;  4EUT A;  2L0T A;  5EDS A;  2DLB A;  2KKC A;  4RGO S;  2VH1 A;  2G4D B;  5G5G A;  2JWZ A;  5D3D A;  2BS4 B;  4MJS B;  1SEB D;  2Y5C A;  1G6J A;  1EUV B;  2KAJ A;  2AL6 A;  1B1Z A;  3AE7 B;  2JQR B;  4EOY A;  3GP7 A;  1HA5 A;  1N63 A;  4RMA A;  2Z0D B;  1E0Z A;  4A20 A;  3RI7 C;  1B9R A;  2RR9 A;  4PS3 A;  4II2 B;  5H92 C;  5BO4 B;  2PE6 B;  4TUU A;  3SR6 A;  2CJN A;  1KF6 B;  3J9C A;  3DBH I;  5AUI A;  1NYQ A;  4ANX A;  2N4F A;  3ZNG C;  2JZP A;  2W54 A;  1AYF A;  1YIW A;  2K8C A;  2V3S A;  1KRH A;  4MDK E;  4W9C A;  5EE3 A;  3N9Y C;  5H8Y E;  1JRU A;  1UBQ A;  3ZDT A;  3EGR A;  1YX6 B;  1NDD A;  5IP4 D;  3TJP A;  2M0A A;  3Q8B A;  2CU1 A;  3AE4 B;  3VTU A;  1WGY A;  2WP9 B;  3KH0 A;  2D5G A;  2AYO B;  4NJC A;  3M63 B;  1R4M B;  5C23 A;  2JX5 A;  1FNU A;  1AW7 A;  1BML C;  2HJ8 A;  2KAC A;  2BYE A;  1I7H A;  4JQW C;  3A33 B;  1L0Y B;  1ZXI A;  2EKI A;  4YXD B;  2LZ6 A;  3R66 C;  4PS7 A;  1P3Q U;  4FJZ A;  3ETR A;  4GLS C;  1FCC C;  3U30 A;  3UQB A;  3LXF A;  1V8C A;  1ACC A;  1WR1 A;  3GS2 A;  2RDG A;  1TKY A;  2Z59 B;  2GOW A;  2BS2 B;  2B3A A;  2QEJ C;  2C5L C;  1SJE D;  2O2V B;  1N5W A;  5AUK A;  1GB4 A;  4DBG A;  2BWF A;  4BBN C;  1J19 A;  4OZA A;  3JVZ X;  1WMH B;  1M94 A;  2D11 A;  4RF1 A;  2IYD B;  2C7M B;  1FRR A;  4HK2 A;  2MLB A;  3OAW A;  4YWG G;  3CMM B;  5C1Z A;  5IKC M;  4K81 A;  1IBX B;  4P16 A;  2CHX A;  4F7Z A;  3RUL A;  3VTV A;  2DHZ A;  2KTF A;  5G5H A;  4BKT A;  1QOF A;  2ZPN A;  4NQL B;  3L4P A;  2ZCC A;  1NBF C;  1P9D U;  2WX1 A;  2N7J A;  2DBY A;  2QCZ A;  1NI2 A;  1PUT A;  2JT4 B;  1XCT L;  2JYE A;  3AN1 A;  1KTK A;  1J8C A;  5AZH A;  5J2R A;  2BKF A;  3BVG A;  2ICI A;  2QMT A;  4F8C B;  3Q8A A;  1MG4 A;  2L0F A;  4JWS C;  4IM2 A;  2K1F A;  3APD A;  3PPA A;  4JX1 C;  5G55 A;  4TQ0 A;  1WIA A;  1NVI D;  1OQY A;  2KQ4 X;  3H9D A;  3APC A;  4TV3 A;  3H7P A;  1UWX A;  1EWC A;  1AWD A;  2M1M A;  4BKG A;  1FXT B;  1SIJ A;  1F52 A;  1EM7 A;  2MQJ A;  2PTL A;  3M95 A;  2C7N B;  3VRA B;  4G50 A;  4TKN A;  3N1Z C;  2FCN A;  5IA7 A;  2Y3A A;  2K6Q A;  2NTT A;  3GOE A;  3NVY A;  2N9K A;  1F9J A;  3V62 A;  2WXQ A;  5JHA A;  4MGI E;  4KSK C;  2CJO A;  3SDL C;  1GAQ B;  2J7Q B;  3L17 A;  4LJP B;  3PZ8 A;  4XX5 A;  1F0Z A;  3WIM A;  3QK0 A;  2INP E;  4YSX B;  2RPQ A;  4HXD A;  2D3G A;  1XEE A;  3DVG X;  1JWB D;  3NVV A;  2K9X A;  4FHJ A;  4FAD A;  1JRO A;  3MC9 A;  2W3S A;  3TBL D;  2MW5 A;  2JVC A;  1TYG B;  1JWM D;  1YN5 A;  3N20 C;  4PK1 A;  1E90 A;  1LGR A;  2JXX A;  2LGY A;  5CX3 A;  3WAN A;  2QSD A;  2GBN A;  1WJ6 A;  1YOV B;  2JPH A;  4ZOH C;  3RNG C;  1D6E C;  4EFO A;  4PS8 A;  1WM3 A;  2LJ5 A;  3L16 A;  4FXC A;  2KAN A;  3ZDM C;  4MGZ E;  3PHW B;  2MEK A;  1OQR A;  4URK A;  3KUD B;  1SXT A;  2Z0E B;  4CQN A;  2NBW B;  2D3B A;  4ZHO A;  5D6J B;  4GXB A;  2PKO A;  3JYU A;  1WXM A;  3DDC B;  1L0V B;  1XO3 A;  1FNW A;  1WX8 A;  4KVG B;  3ZKJ C;  1I4P A;  1V1P B;  3BII D;  1FEH A;  1YQB A;  2A4Z A;  4YTP B;  3SD5 A;  1VDV A;  5EE0 A;  3Q3M C;  3WAO A;  5DPT A;  3B2F A;  1SE9 A;  1S3S G;  3U8Z A;  4BKS A;  4XYC A;  2H89 B;  2MCN B;  2LGI A;  2PEA A;  3PRZ A;  1K51 A;  1V97 A;  2IY1 B;  1NYR A;  3N1X C;  1WXQ A;  1HTQ A;  3DVN V;  5BMI A;  1ET6 A;  2MP2 A;  3H8H A;  2J0J A;  1EU3 A;  2N0S B;  1RAX A;  1T5X D;  4PYZ A;  3BWU D;  4HJK A;  5FR3 A;  3PZ7 A;  2XEW A;  2MJE A;  2MSE D;  4W9J A;  3HRD D;  1LFD A;  1HZ6 A;  4NPN A;  1KLU D;  2WXG A;  4KV2 A;  4WQO B;  3B1L X;  5CHW A;  2ACZ B;  2A5U A;  1ZKH A;  1OEY A;  3AV8 A;  4IWP A;  3N3K B;  2V3N A;  4W9H A;  3AEE B;  3NUH B;  1V6E A;  4GU2 A;  4D2K A;  2WGS A;  2K22 A;  4OVV A;  1Z5S B;  3P4Q B;  3TCA A;  1UGM A;  1UF0 A;  2JU6 X;  4BBN F;  3IT4 B;  4XC2 A;  3UI3 A;  4B9K A;  2WXO A;  1E7P B;  4LCD E;  3T3N A;  1GG3 A;  1XQQ A;  4W9L A;  5TR5 A;  3U4E G;  3PGE A;  3B2G A;  4WJQ A;  5J17 A;  1EF1 A;  1VCB A;  1JW9 D;  5BMH A;  1T0Y A;  3EA6 A;  1C4C A;  2JSV X;  2QIL A;  4KDI C;  1GB1 A;  2FCQ A;  4LDT D;  1VR9 A;  3IFW B;  2KDF B;  4MGY E;  1C1Y B;  2PLP A;  3NZU A;  3O13 A;  1HQR D;  2KTR B;  1D4B A;  2VH2 A;  1YX5 B;  1FIQ A;  4BOS C;  2KC1 A;  2YEP F;  1N6Z A;  3OWE B;  1DOX A;  2IPK D;  1ZUD 2;  2JXT A;  4I6L B;  2OJW A;  2LHE A;  1XT9 B;  2XBB C;  3TEZ A;  2WXJ A;  2J52 A;  1KM7 A;  1SIF A;  3DBL B;  4EEW A;  5JH5 C;  3Q3F A;  4DHZ E;  3C8Y A;  4RF0 A;  2BW2 A;  1HTO A;  1ZPS A;  4KKI A;  1EWY C;  2NBV B;  2QC8 A;  1T0Q C;  2NTS A;  2PIA A;  1DGJ A;  4M00 A;  4BVU C;  4AP4 C;  2QHO A;  4GDL A;  1UZX B;  3MFG A;  1IUE A;  2MRP A;  1WX7 A;  4R3D A;  3A9J A;  4ZRK A;  2RMM A;  2WX0 A;  3GB1 A;  3VR9 B;  2VZK D;  1N60 A;  3D32 A;  4OHJ A;  1YNT E;  2BKR B;  3A4S C;  1K52 A;  4AS1 A;  2M17 A;  4CO7 A;  1QT9 A;  4O1N A;  3WAL A;  4LTU A;  4ANU A;  3ZW3 A;  5LNK 1;  4ASW C;  5D7G A;  3ZYY X;  2MHJ A;  4EZK A;  4HDO A;  2L7R A;  3U7D A;  3AU4 A;  3DHG C;  4YTM B;  3HVZ A;  2IZV B;  2K8B A;  3GZN I;  1MI0 A;  1CJE A;  2DAJ A;  2ZJD A;  4NAM A;  5AZF A;  5IAA C;  4XWW A;  2MBE A;  1OGW A;  4IKG A;  3RNF C;  1I4Q A;  1TS4 A;  3VR8 B;  2FIF A;  2KMA A;  2M19 A;  1J7C A;  4N9F 4;  2LEK A;  4B6W A;  3W5V B;  2L3Z A;  2D2Q A;  1JQ4 A;  1E8X A;  3I63 C;  5D3I B;  3RD2 A;  3BY4 B;  3IG3 A;  3HVD A;  2G1E A;  1T3Q A;  2KJH B;  2N9P C;  3TUO A;  2ASQ A;  4ANV A;  1ZDV A;  3NHE B;  4EZJ A;  4FJV B;  4YT0 B;  2N1V A;  4KX6 B;  4WJN A;  1K8R B;  1QIL A;  3AMZ A;  3V61 A;  3ZUN A;  1AAR A;  4ANW A;  2IGD A;  3AE6 B;  2D3A A;  3AE5 B;  4IWQ A;  4HKZ E;  1FXA A;  4FN2 A;  4A8X C;  1BT0 A;  1LQB A;  2AWT A;  4RGT A;  4NY0 A;  2NCN A;  1RFA A;  4GDK A;  1UH6 A;  3RFZ B;  2WU5 B;  4KDL B;  2R2O A;  3EFC A;  3VFK A;  3B08 A;  2KFK A;  3MC8 A;  4M8N A;  2XK5 A;  3ZLZ A;  2BVC A;  4E3C A;  1SSN A;  2V3P A;  3ABV B;  2JZ3 B;  1V5T A;  5TSS A;  2JRH A;  4C00 A;  2BYF A;  3I9V 1;  1FFU A;  1FRD A;  2FE8 A;  2V4L A;  2WWZ A;  3NRZ A;  2DNF A;  1FO4 A;  1GNU A;  3KWL A;  1WZ3 A;  3PRE A;  1P98 A;  4RM9 A;  3IAM 1;  1T6B X;  2JRI B;  3M62 B;  3MJW A;  2EMS A;  2KFJ A;  3BVM A;  3ZXR A;  2TSS A;  3RUI B;  2WXK A;  4KKJ A;  4HKQ A;  2EMT A;  3ZNZ B;  5BMG A;  4GGQ A;  2K25 A;  3BYY B;  3UIN B;  2LD9 A;  4C80 A;  3AUL A;  4GOC A;  1DOY A;  2IO1 B;  3H6N A;  2EKE C;  1L6V A;  2N9X A;  3WAP A;  1CQV A;  4JL9 A;  1JCK B;  2OHF A;  3Q8C A;  4HJG E;  1C3T A;  4L23 A;  2KNB A;  1UD7 A;  2NMQ A;  3ZRC A;  1WXS A;  2CHZ A;  5KHO A;  3U2S C;  1PQS A;  2ZW1 A;  1XLQ A;  4AQ7 A;  4P7I A;  2JZZ A;  4FA6 A;  4ARC A;  3RMK C;  4C7Y A;  3AI5 A;  1ENF A;  2BB6 A;  2HJ1 A;  2PVG C;  3Q69 A;  4FLH A;  2AEH A;  1LM8 B;  3AEB B;  2NPT B;  3MHS D;  2MBB B;  1X1M A;  4C56 C;  2WXR A;  3NZ3 A;  1R7S A;  3DCG A;  3KVF B;  4HPM B;  3L54 A;  4LNO A;  3MJ5 A;  2K3U A;  2KT7 A;  2LFI A;  2GBJ A;  2GBR A;  3APF A;  4TQ1 A;  2FAZ A;  2LGS A;  1YJI A;  1YJJ A;  1V86 A;  3WA0 A;  3Q2A C;  2KC2 A;  2PVO D;  3PT2 B;  4A9A A;  1DOI A;  3OJ3 A;  2ZW0 A;  3HIZ A;  1C79 A;  3LYY A;  2WXI A;  4L1B A;  3H7P B;  3ZJT A;  2X38 A;  2DZM A;  5D94 A;  4REZ A;  2LWP A;  3BK2 A;  5FKA C;  4WWM A;  4GSW A;  2FCS A;  1BXT A;  3AE1 B;  2JWU A;  3Q3N C;  2J0K A;  2RGF A;  3AEA B;  3QA8 A;  4M0W B;  4M01 A;  2KO3 A;  2L1A A;  4YSY B;  1JWA D;  1NEN B;  1WE7 A;  4C4V A;  2WXN A;  1P7E A;  1E8Y A;  2KZR A;  1WH3 A;  2LVQ A;  1WI0 A;  3PTF C;  1D5M C;  3CWI A;  2BT6 A;  1Y8R C;  1WRI A;  2C7H A;  3SHQ A;  4JGH B;  2IO0 B;  3NJT A;  5HHD G;  4RGM A;  2G4S A;  3MTN B;  4K3C A;  1R4M I;  2DX5 B;  1IBX A;  1PDX A;  3R7Q A;  3AE3 B;  5L95 C;  4WQM A;  2MWS B;  2LI5 A;  2RD0 A;  3V6E B;  3NG0 A;  4ZRI A;  4JWU C;  1IPG A;  2GI9 A;  5JZE B;  3PVL A;  2RPV A;  4DXG A;  4F1S A;  2GB1 A;  3A9K B;  3UF8 A;  4YSZ B;  2MX2 A;  1KOT A;  3SFE B;  1IP9 A;  1E8W A;  4LLG M;  2KX3 A;  4OVZ A;  4XZ4 A;  3VQI A;  1ZDX A;  2NR2 A;  2IGH A;  1V80 A;  2ZNV B;  1OEY J;  4IG7 B;  1OFF A;  1TZ1 A;  2LRU A;  2MA9 B;  3AB5 A;  1WF9 A;  1E6E B;  2KD0 A;  2DYO A;  4DQO C;  2NBU A;  2PMV A;  3C0R B;  1WX9 A;  3V6C B;  4OZB A;  2LRW A;  4AWJ A;  1LXD A;  2J4X A;  3OLM D;  4NAW B;  2BYV E;  4P1C C;  3T9L A;  1HE8 A;  5HG2 A;  2W82 A;  4HLE A;  1P1A A;  2LUM A;  1I35 A;  1N61 A;  1TS5 A;  3DOW A;  3SU8 X;  3P4S B;  2KJ6 A;  4HPL B;  3N30 A;  2KQ7 A;  1MG8 A;  3Q3J A;  5I4D A;  4LJO B;  4MSQ B;  4K7S A;  4ZDV A;  4MH0 E;  2YVC A;  4A3P A;  4EE2 A;  1YN3 A;  3NZS A;  1V5O A;  1ET9 A;  2KOX A;  3A1Q B;  2KYW A;  3ZIM A;  4HPP A;  4WWP A;  3VUY A;  3R2T A;  2CU3 A;  1WGR A;  1QOB A;  5CHF A;  1I4H A;  2NVU I;  1L4Z B;  2REX A;  2KMM A;  4FHK A;  1F1H A;  2I2Y A;  3RNE C;  2D10 A;  3DBR B;  3FIL B;  4IM3 A;  4J6I A;  4RH6 A;  4BKS D;  2WQY B;  2L8J A;  3VHT C;  5JXV A;  2J0M A;  2I1J A;  3JSV A;  1WGK A;  3ML8 A;  3PHX B;  2G9H D;  4BOZ B;  4OVU A; 
#chains in the Genus database with same CATH homology
 1IUE A;  1WSP A;  1Y56 A;  1J7A A;  4R3D A;  1V1O A;  2WXP A;  1FFV A;  2RMM A;  5EE3 A;  1I4R A;  2LMC A;  3AE9 B;  3N9Y C;  4RNA A;  4XDD A;  5GXG B;  5H8Y E;  2IDY A;  2K5P A;  1VZ7 A;  3GB1 A;  3TEX A;  2VZK D;  2WNM A;  3VR9 B;  3EGR A;  1N60 A;  3AEC B;  4XE0 A;  4OHJ A;  1YNT E;  3ZJV A;  1UWM A;  1SE4 A;  1K52 A;  2M0A A;  3V05 A;  4AS1 A;  3Q8B A;  3AE4 B;  1QT9 A;  1IGC A;  4O1N A;  2ON8 A;  4M0W A;  2MH7 A;  4LTU A;  5LNK 1;  2WP9 B;  1MHX A;  2D5G A;  2KDM A;  5D7G A;  1VLB A;  4XWT A;  4NJC A;  3ZYY X;  4YTM B;  2JX5 A;  1D5X C;  1FNU A;  3HVZ A;  4N58 A;  1AW7 A;  3PO0 A;  1BML C;  1MI0 A;  1CJE A;  1QQR A;  4NAM A;  3W5U B;  4XWW A;  5HI1 A;  2KAC A;  1WWT A;  1I7H A;  4JE3 B;  4IKG A;  1L0Y B;  2WXL A;  1ZP0 B;  1I4Q A;  1TS4 A;  1ZXI A;  2EKI A;  3VR8 B;  4YXD B;  2XNA C;  1GOZ A;  3FC4 A;  1P7F A;  2M19 A;  1J7C A;  4ARI A;  1PFD A;  2LEK A;  3U52 E;  1RM6 C;  3W5V B;  1QOG A;  1JQ4 A;  3LB8 C;  3MP9 A;  3ETR A;  4GLS C;  4UDU C;  5D3I B;  2WDR B;  1FCC C;  3HVD A;  1PGA A;  2G1E A;  3LXF A;  1V8C A;  1ACC A;  1HZ5 A;  4A6Q A;  2WDQ B;  4MM3 B;  3GS2 A;  2RDG A;  5BYR A;  1T3Q A;  1TKY A;  1UNS A;  4KGR A;  3E56 A;  4IDI A;  2BS2 B;  2QEJ C;  3TUO A;  1SJE D;  1TZO A;  4TMA B;  1N5W A;  5AUK A;  1QLB B;  1GB4 A;  2K0P A;  2WLB A;  2EEL A;  1ZDV A;  4Q2J A;  1C76 A;  3TSS A;  1ZE3 D;  4OZA A;  4YT0 B;  2Y5P A;  3U7Z A;  1UUP A;  4RF1 A;  4WH4 A;  2Z8L A;  1FRR A;  4HRS A;  4KX6 B;  4RFB A;  1QIL A;  1VJK A;  4YWG G;  3AMZ A;  1RYJ A;  1IBX B;  1FNV A;  4P16 A;  3P4R B;  2RDH A;  2IGD A;  3AE6 B;  2MJD A;  4MH8 A;  2N9L A;  3AE5 B;  2AQ1 B;  4HKZ E;  5G5H A;  2IJ0 A;  1RFK A;  3KWV A;  1FXA A;  1QOF A;  4YTN B;  4A8X C;  1PGX A;  1L6U A;  3L4P A;  1ZXH A;  2WDV B;  2HTM E;  4RGT A;  2BS3 B;  4L2Y A;  2VZK B;  2N7J A;  1SJH D;  2DBY A;  1PUT A;  4PT5 A;  3RFZ B;  1XCT L;  2JYE A;  3AN1 A;  1KTK A;  2WU5 B;  4DXF A;  2MJ3 A;  3BVG A;  1YQ3 B;  5EE1 A;  2J42 A;  2ICI A;  2QMT A;  4WIP A;  3AH7 A;  3TEY A;  2BB5 A;  3Q8A A;  4JWS C;  1SSN A;  2V3P A;  3ABV B;  4JX1 C;  2Q5W D;  5TSS A;  5C2T B;  2GRI A;  4TQ0 A;  2SEB D;  3I9V 1;  1FFU A;  1FRD A;  1BUI C;  1NVI D;  2FE8 A;  3NRZ A;  1FO4 A;  1SB3 C;  3KWL A;  1SE3 A;  4H2A A;  2KQ4 X;  3E9S A;  1WYG A;  1J7B A;  4A90 A;  1KLG D;  3MC0 B;  1UWX A;  3IAM 1;  1EWC A;  1AWD A;  1T6B X;  1ESF A;  2WU2 B;  1ROE A;  1JAL A;  3BVM A;  2J53 A;  5BYQ A;  1SIJ A;  3ZJU A;  1EM7 A;  2TSS A;  2PTL A;  2WXK A;  4KKJ A;  4HKQ A;  2LHD A;  1I4G A;  1CZP A;  5BMG A;  3ZQ4 A;  2WXF A;  3VRA B;  2ONQ A;  2H88 B;  3BYY B;  4TSS A;  4C80 A;  1TY2 A;  3AEF B;  1DOY A;  5EE9 A;  1XXG A;  3P42 A;  4XDC A;  2Y3A A;  1L6V A;  2NTT A;  3NVY A;  2N9K A;  1CQV A;  1HXY D;  1JCK B;  4B0M A;  5MPO A;  1FCL A;  2WXQ A;  2OHF A;  3Q8C A;  4HJG E;  4L23 A;  2W55 A;  2CJO A;  2NMQ A;  4A55 A;  5C3J B;  4RCO A;  1V1P A;  3URY A;  2L32 A;  3FIL A;  3FAH A;  4ZHP A;  1GAQ B;  1GPX A;  3PZ8 A;  3U2S C;  1TJE A;  1F0Z A;  3P1M A;  2ZW1 A;  3NVW A;  2INP E;  1ZOY B;  1XLQ A;  4YSX B;  1JML A;  4WUR A;  4US9 A;  4AQ7 A;  4ARC A;  1XEE A;  1N5X A;  4OZC A;  4C7Y A;  1ENF A;  1HEZ E;  1JWB D;  2BB6 A;  3NVV A;  2K9X A;  2PVG C;  2OED A;  3Q69 A;  1JRO A;  3EUB 2;  1QF6 A;  2WXH A;  1JRP A;  3AEB B;  1KFY B;  2W3S A;  4C56 C;  2WXR A;  3NZ3 A;  1Q10 A;  1R7S A;  1AN8 A;  4GDK B;  5FK9 C;  3IT6 B;  3MJ5 A;  2K3U A;  2IGG A;  1TYG B;  1JWM D;  2LFI A;  4N59 A;  3ZGZ A;  1MHH E;  1YN5 A;  2INN E;  3HUI A;  4TQ1 A;  2W3R A;  3MHZ A;  4ZRQ A;  1QKZ A;  2QSD A;  1YJI A;  1C4A A;  1I4X A;  4N6E B;  1YJJ A;  1F77 A;  3SFD B;  4ZOH C;  1FD6 A;  1QOA A;  4NZL B;  1D6E C;  2PVO D;  2R61 A;  1C78 A;  4GDL B;  4A9A A;  4US8 A;  4FXC A;  1DOI A;  2FBW B;  2PW9 A;  3AEG B;  1NEK B;  2MEK A;  1OQR A;  2ZW0 A;  3LYY A;  1C79 A;  2JYT A;  2QJL A;  2WXI A;  1C77 A;  4L1B A;  1TS2 A;  3ZJT A;  2X38 A;  2DWQ A;  2DYM A;  3AE8 B;  4REZ A;  3BK2 A;  5FKA C;  4ITK A;  1SXT A;  2V0G A;  4WWM A;  4CQN A;  1VZ8 A;  3SEB A;  4ZHO A;  1VZ6 A;  3NS1 A;  2BYT A;  1BXT A;  1CK1 A;  1XLO A;  2PKO A;  3AE1 B;  2JWU A;  3AEA B;  3BVZ A;  4J3O D;  1UGJ A;  1K50 A;  2L1A A;  3DWG C;  2M56 B;  1L4D B;  4YSY B;  1STE A;  2L52 A;  3BYT B;  1L0V B;  1JWA D;  1NEN B;  1XO3 A;  1FNW A;  4C7Z A;  4USA A;  2WXN A;  1P7E A;  2L83 A;  3R2I A;  1I4P A;  2HDE A;  1V1P B;  3BII D;  1XLN A;  1TKG A;  1L5P A;  3BZD B;  1FEH A;  3WCQ A;  2AQ2 B;  1D5M C;  3CWI A;  2BT6 A;  2E6X A;  2I38 A;  1WRI A;  4YTP B;  1C4P A;  1SBB B;  1VDV A;  5EE0 A;  3B2F A;  2WXM A;  1K53 A;  2KN4 A;  5HHD G;  4RGM A;  2H89 B;  2LGI A;  1EU4 A;  2FUG 1;  1IGD A;  1K51 A;  1V97 A;  3VRB B;  1NYR A;  1WXQ A;  2SAK A;  1IBX A;  4B0E A;  5HFY A;  1JWU D;  5BMI A;  1PDX A;  3KQ4 A;  1ET6 A;  1XLP A;  3AE3 B;  4WQM A;  3DWM A;  3H8H A;  4IOI E;  1EU3 A;  1LO5 D;  2N0S B;  3V3X A;  1T5X D;  4ZYS A;  2XN9 C;  4JWU C;  3BWU D;  1TS3 A;  2LJI A;  1A70 A;  5FR3 A;  2GI9 A;  3IXS A;  3PZ7 A;  2MJE A;  2RPV A;  1MVK A;  3NVZ A;  3AM9 A;  4DXG A;  3HRD D;  2GB1 A;  2YEP B;  3P4P B;  1HZ6 A;  1PGB A;  2V4I B;  4YSZ B;  3SFE B;  1KLU D;  3W9C B;  2B76 B;  2WXG A;  5BYS A;  4LLG M;  1D5Z C;  4OVZ A;  4KGS A;  3VQI A;  1ZDX A;  1YN4 A;  1TKE A;  2ACZ B;  2IGH A;  3BK1 A;  1N62 A;  4KGT A;  1L0X B;  3AV8 A;  1M4V A;  2V3N A;  3W2D A;  4HRO A;  1FMA D;  1OFF A;  3AEE B;  3NUH B;  5T8I A;  3TEW A;  3AB5 A;  4JPS A;  3P63 A;  1E6E B;  4D2K A;  2DYO A;  1DYQ A;  3W1S A;  3CIR B;  5E6J A;  2K22 A;  4DQO C;  2PMV A;  1MPE A;  3AED B;  4OZB A;  3R8B A;  1JWS D;  3I57 A;  3P4Q B;  3IAS 1;  2AQ3 B;  1OQQ A;  2J4X A;  4NAW B;  1YQ4 B;  2JU6 X;  1FXI A;  1NI3 A;  4RGN A;  1SE2 A;  3IT4 B;  5HG2 A;  1E10 A;  2W82 A;  3T3O A;  3UI3 A;  2WXO A;  2LUM A;  1KH0 A;  1E7P B;  1N61 A;  1XCQ L;  3T3N A;  4P6V F;  1TS5 A;  1VRA B;  1XF5 L;  4MAC A;  3U4E G;  3P4S B;  2E3T A;  3B2G A;  1JW9 D;  5BMH A;  1TY0 A;  3EA6 A;  2QIE B;  1C4C A;  2JSV X;  4WAF A;  5I4D A;  2QIL A;  4MT5 A;  1GB1 A;  2DLB A;  3KLS X;  4RGO S;  1VR9 A;  5G5G A;  1C9F A;  4EE2 A;  1E9M A;  1F2R C;  1YN3 A;  2BBC A;  1SF0 A;  3B9J A;  3Q8E A;  2AX5 A;  2PLP A;  1ET9 A;  5D3D A;  2BS4 B;  2WS3 B;  3O13 A;  1HQR D;  1SEB D;  2Y5C A;  4HEA 1;  4LK0 M;  4OW0 A;  1D4B A;  3R2T A;  1F2R I;  2KAJ A;  2CU3 A;  1B1Z A;  1FIQ A;  1FM0 D;  2BTE A;  1QOB A;  2YEP F;  2JQR B;  3AE7 B;  1I4H A;  3GP7 A;  3OWE B;  1HA5 A;  1PYW D;  1DOX A;  1L4Z B;  1N63 A;  2IPK D;  2KMM A;  1ZUD 2;  2JXT A;  1E0Z A;  2I2Y A;  2KWD A;  1B9R A;  1RWS A;  3FIL B;  2LHE A;  3TEZ A;  4ZRP A;  2WXJ A;  2J52 A;  5H92 C;  3RPF C;  3Q8F A;  4RH6 A;  3SR6 A;  2WQY B;  2CJN A;  1KF6 B;  3J9C A;  5JXV A;  3C8Y A;  4RF0 A;  2BW2 A;  5AUI A;  3AE2 B;  1NYQ A;  1ZPS A;  1YMH E;  4KKI A;  1WGK A;  1EWY C;  2JZP A;  2NTS A;  2PIA A;  2W54 A;  1DGJ A;  1AYF A;  2G9H D;  1KRH A;  3MFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...