2B3AA

Solution structure of the ras-binding domain of the ral guanosine dissociation stimulator
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
87
structure length
87
Chain Sequence
DCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ral guanine nucleotide dissociation stimulator
publication title New insights into binding of the possible cancer target RalGDS
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 17
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2005-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2b3aA00
2FIFA 2KC1A 2NBVB 4I6LB 4URKA 2KKCA 2FCMA 5GMVA 1LM8B 3R3MA 1RRBA 3B1LX 5AZGA 2AL6A 2O6VB 4ICUA 5D2MB 4BKSD 1IP9A 4BVUC 1E7UA 2YVCA 2FIDA 4IWPA 4EZKA 2MSED 3KYCD 2KWCA 2O2VA 4GN1A 5E6PA 2CU1A 4NNJB 3IG3A 3JSVB 2D11A 3VTVA 2ZVOA 4F7ZA 1V49A 2DZIA 1Z2MA 3HK0A 1SGHA 2C7MB 3ONSA 2NBWB 2LASA 2FUHB 4GXBA 4KZCA 2WWZA 4PS8A 5E6NA 4WJPA 2ASQA 2K25A 4GGQA 3RZFA 1WR1A 3ML9A 2BYVE 2BF8B 3LJ3A 1WE7A 3IBEA 3WANA 2I1JA 4E71A 3K9OB 2C60A 3UIOB 4IG7B 4IWQA 3VFKA 2N9XA 4OVVA 2KJ6A 3L13A 4KSKC 3SU8X 1EF5A 1WMHB 2KXJA 4K1RB 3M62B 4AJYB 4HCPB 2LJ5A 3ZTCA 4F1SA 1WE6A 5EDSA 3TJPA 1J8CA 3ZW3A 1WJNA 1E8WA 4FJYA 4FA6A 4W9EA 1VCBA 4AOFA 2KFKB 3GOEA 4MEMA 2ZZPB 4TKNA 2L3ZA 4K7SA 5CHVC 3BY4B 2O6VA 3SD5A 3QCAA 1Q1OA 1WX8A 1WGHA 4LDTD 2MA9B 4K7UA 1WXVA 3JVZX 4WAAA 1YD8U 2MX2A 2MBBB 2LVOA 2DZKA 2IYDB 4XX5A 2KO3A 2KJHB 3DBHI 3HIZA 2XK5B 2LXCA 5AZFA 2Z0DB 2DX5B 2D3GA 3QIJA 4JL9A 3TIXA 3PREA 2GBKA 1WXMA 2M8SA 3QHTA 5DCNA 5D7GA 2KDIA 2FNJB 3NY5A 3DBRI 3HM3A 4KDIC 3VUYA 2KC2A 1UBQA 4ANUA 3L54A 1WXSA 2JZ3B 1ZGUB 2K1FA 2L7RA 1WMHA 3H1UA 3AU4A 3O65B 3DPDA 3X23A 5DPRA 3V61A 4PYUA 3DVGX 3H7SA 3PS6A 4K81A 4TQ0A 4I6NB 1YIWA 5LXHA 1TGZB 2BYEA 3WALA 5JZEB 3V60A 3WA0A 5IA7A 3L16A 1WJUA 2VRRB 2ZJDA 4FJZA 2EKEC 4MSMB 2HJ8A 3NOBA 1RAXA 5D94A 1GC7A 2KNBA 1Z5SB 2ZPYA 3NS8A 4W9GA 1GJZA 3MTNB 1P3QU 2M0XA 4N9F4 3RT3B 3JW0X 2KTRB 2LGDA 4DHJB 3UGBB 2KDFB 1PQSA 1U4AA 5AZHA 1Y8RC 2XK5A 3L17A 2MBQA 1WGRA 2R2OA 2K39A 4YL8A 4K7WA 5G2NA 2EMSA 4KDLB 1H4RA 3HHMA 2QHOA 4B9KA 4WJNA 1WJ6A 2XEWA 1C3TA 4MJSB 4GB9A 1OGWA 1V81A 2KX0A 3UQAA 4NJ6A 4IWOA 2ZVNA 4PYZA 1L2NA 4MELA 1FXTB 2PPHA 3QJZA 5KHQA 1WGYA 2CR5A 2KANA 4EZJA 1WXAA 2MW5A 2HTHA 3TL5A 2DHZA 4BKGA 3L08A 3RYTA 4HDOA 2KQ7A 4MM3A 3KUCB 2KTRA 1XQQA 3ZDMC 3A1QB 2EMTA 2JF5A 3KUDB 2IBIB 1NI2A 1OQYA 5J18A 2LVPA 3UIPB 1BT0A 3L10B 3H7PB 4HVBA 3APFA 1GNUA 1E90A 3TCAA 3PVLA 4WWNA 3QWZB 1UGMA 2WX1A 3U7DA 1EO6A 4NPNA 4IUMB 1TBEA 1UBIA 5DPTA 2KJRA 3UF8A 3P2BA 1EUVB 1OEYJ 2K6DB 2DAFA 3VH4B 3ZKJC 3CSFA 4WJOA 4X57B 2Y5BB 2LUEA 1P1AA 1LFDA 2AWTA 4MJSA 3VUWA 3SHQA 1KJTA 3QK0A 5CHFA 3DBLI 3N3KB 4LJOB 1E5WA 3ECIA 5AEKB 1YX6B 3A9JB 2JY6A 5LXIB 4IM0A 2KZRA 3I3TB 3KH0A 5FR6A 4MGZE 1MG8A 3SDLC 1GUAB 3V62A 2FCQA 4NAWB 2GBNA 2RSUA 1EF1A 1SIFA 4GIVA 2J0MA 4LDTB 3PLVA 3RZWC 3TMPB 4DDGD 3A4RA 2KDBA 4BKTA 3D32A 3H7PA 4HWIB 3PSEB 3N32A 3TBLD 2MWSB 4KVGB 2CHWA 4AJWA 4EFOA 4HPLB 4ZRKA 3DDCB 3ZLZA 1S1QB 1V9JA 4WWPA 4CHKA 3ZVVA 1WH3A 4TUUA 5JH5C 4II2B 3NZSA 5LLIA 3JSVA 3R7QA 3BINA 3PV1A 2K8HA 3PT2B 4FULA 2JPHA 4RM8A 1YX5B 2CKHB 4BOSC 1UELA 2WYQA 2NCNA 1HE8A 3A9JA 1A5RA 4KV2A 3NHEB 1WZ3A 1NBFC 2GMIC 4B6WA 2KDEB 2MBEA 4IC7B 1WYWB 4ZRIA 2L00B 1WM3A 3X0WA 4NAWA 2DZMA 2N7DA 2N9PC 3APDA 3VAWA 2DYBA 2FCSA 2CHXA 3HM6X 4NQKE 5L83A 2NR2A 3IHPC 3EC8A 2IO0B 4BBNF 4W9JA 1P9DU 2MBOA 2KFKA 2RPQA 4JQWC 4NY0A 3PRZA 2Z59B 1I42A 1E8XA 4AP4C 4AWJA 5CTRC 1L7YA 2L8JA 3JYUA 3WAOA 4NJ7A 3A9KB 4HLEA 1SE9A 1V2YA 3A33B 2KLGA 3W1SC 3S2AA 1WGDA 4ANVA 2DAJA 2ZEQA 3H9DA 4KZ0A 2AEHA 2WX0A 2V1YA 3QX1A 1YJ1A 2B3AA 1AARA 1WR6E 2RD0A 3KW5B 3QQ8B 4G0NB 2N4FA 2M1MA 5DPSA 4A20A 2MQJA 1H8CA 2KMAA 1UD7A 1E7VA 3ALBA 3T8MA 2N9EB 4IM3A 3QA8A 2WDTB 2KTFA 4HCNB 5G55A 4EOYA 1YQBA 4MGIE 4W9KA 4ZRJA 2DENB 2K6QA 3WAPA 1WIAA 2RGFA 3ZRCA 3ZIMA 3K9PB 4DHZB 3C0RB 2J0KA 2JT4B 4MSQB 3R7RA 4GDLB 3UQBA 3MJWA 1WRDB 3NZUA 4G3XB 3AULA 2LGYA 3ZTDA 4HK2A 2MP2B 1RLFA 3QARA 4IW0A 1WX7A 4WQOB 3IVFA 4CO7A 4XC2A 1WZ0A 4DHZE 3OLMD 1XD3B 3EECA 2FAZA 3U8ZA 5CHWA 3PRPB 3Q3FA 3WIMA 2XBBC 1TZ1A 3UINB 3LDZE 2D10A 1V5TA 1WF9A 2MRPA 2ZNVC 3A9KA 4TQ1A 3M3JA 2IZVB 2DYMA 4LCDE 4DK5A 2O2VB 3DVGY 4W9FA 3EHVA 2JVCA 2NPTB 3V6EB 3CSTA 2KK8A 1X1MA 2N7EA 3GZNI 2V4LA 3PHXB 2JUOA 4HXDA 1NDDA 4KSLC 1WGGA 4W9LA 4G50A 2G4SA 4WWOA 1ISNA 3M95A 1UZXB 3PLUA 3PTFC 2PE6B 3VHTC 1J19A 2ZCCA 4AUQC 3PZDA 1WX9A 4EKUA 2D2QA 4JGHB 3B0AA 4FJVB 1UH6A 3AXCA 4GDLA 2LGXA 4XZ4A 2G3QB 3ML8A 3VTUA 1LQBA 2AYOB 3H6NA 2A5UA 1V80A 1RFAA 2L76A 2MP2A 4M8NA 1XT9B 5JHAA 1WM2A 1V86A 3DBSA 2BWES 1Q5WB 2M17A 4FN2A 5KHOA 2LI5A 3IFWB 3M63B 3B08A 3ZUNA 1VD2A 4HDQA 5TR5A 5J2RA 1KLVA 3ZNID 4B95A 1KOTA 4GOCA 2KFJA 2M4NA 4BKSA 3V6CB 4A3PA 3A1QA 3ZRFA 3AU5A 4F8CB 3OJ3A 2NPTA 2BYFA 3DCGA 2Z0EB 4GU2A 4GMVA 3RULA 4DWFA 3RUIB 2K8CA 1D3ZA 3VUXA 2O6VD 1TTNA 2GOWA 2JXXA 2ZNVB 2BPSA 1V6EA 1R4MI 4IM2A 4FHKA 4ICVA 3W1SA 4J6IA 3CF6E 4PS3A 2OJRA 3WAMA 2HD5B 4G11A 2L05A 4W9DA 3DQVA 3N30A 4FHJA 2KWUB 1JRUA 3Q3JA 1WI0A 2L0TA 1P98A 2BGFA 3PRMB 2DZJA 2KWVB 4E74A 2N1WA 4CYEA 4GSWA 3CMMB 4W9CA 3VXWA 5DPWA 2KD0A 1GG3A 4MGYE 4JLCA 2KMCA 2IO1B 2IY0B 4GDKB 3A4SC 4ZDVA 3W1YA 5C1ZA 3PPAA 4HJKA 3RCZA 2BKRB 2C7HA 2JWZA 1CMXB 2JZZA 2REXA 3QC8B 4MDKE 2KVRA 4II3B 1J0GA 1G6JA 2BWFA 3U30A 4NQLB 4DBGA 3KUZA 3ZDTA 2MCNB 5D6JB 4DXAB 2D07B 2YLMA 1OTRB 4JIOU 4M0WB 4W9IA 2RR9A 2LXAA 3PGEA 4ZYNA 4RM9A 5JHBA 1S3SG 2DYOA 2PJHA 2ZPNA 1IPGA 2L0FA 2FCNA 3KVFB 3QAQA 4TV3A 3OJ4B 2G4DB 4ANWA 2MBHA 3L0WB 4KIKB 2GBRA 3DVNV 2V3SA 5C23A 1V5OA 2IO2B 3VDZA 4BFRA 2A4ZA 4P7IA 3VTWA 2LZ6A 2KLCA 2CS4A 2CHZA 2KQSA 1WY8A 2NS5A 2W9NA 4PS7A 2LWPA 4FADA 4GDKA 4M8MA 4W9HA 2ZCBA 2C7NB 1C1YB 2K8BA 2PE9A 2UYZB 2KHWB 3AI5A 2KOXA 4DDID 2J7QB 2JRHA 3MHSD 5BO4B 2NVUI 5CX3A 1T0YA 4I6PA 3APCA 2UWQA 1P0RA 2KN5A 2LRUA 3PHWB 1K8RB 3EFUA 4E3CA 4BOZB 4EZLA 3KYDD 5HKHA 3R66C 4MH0E 3VH3B 4EUTA 4MGKE 2OOBB 2C9WB 3OAWA 4DHJD 2J0JA 2KX3A 1I35A 1F9JA 4BBNC 1WJ4A 4RMAA 5J17A 3ZO5B 2AL3A 1E8ZA 1KM7A 3T9LA 2IO3B 1ZW7A 5E6OA 3ZNZB 4KIKA 1R4NI 4A3OA 2IY1B 4ASWC 1Q0WB 4HPMB 2LD9A 2LRWA 2BKFA 3ZNHB 2JRIB 4FLHA 3ZNGC 1QZEA 2HE7A 4OVUA 4ANXA 1IYFA 5L95C 2GBJA 2LVQA 2MLBA 4LJPB 4EEWA 2N1VA 1M94A 3ENEA 5IAAC 3VVWB 1WFYA 3DOWA 3DVNU 2C5LC 2G45B 2NBUA 3VQIA 1OEYA 3RD2A 1E8YA 1LXDA 4WJQA 4FBJB 1GC6A 2R2QA 2PEAA 1ZKHA 2I1KA 2GBMA
chains in the Genus database with same CATH superfamily
2KC1A 1Q10A 2GRIA 1P7FA 5IN7A 1HXYD 2AL6A 1T3QA 2O6VB 1FFVA 5D2MB 4FXCA 1HZ5A 4GN1A 2CU1A 3IG3A 1XEEA 4OHJA 4F7ZA 3BIID 2C7MB 4KZCA 2WWZA 3RZFA 3ML9A 4YXDB 3LJ3A 2I1JA 4E71A 3UIOB 4OVVA 5FR3A 2KJ6A 4AJYB 2CU3A 3ZTCA 3ZYYX 3GOEA 4MEMA 2XNAC 4A8XC 3GS2A 1JALA 3GP7A 4K7SA 3R2IA 1Q1OA 1YQ3B 4LDTD 3WCQA 1YOVB 1YD8U 1N60A 2MBBB 3DBHI 2KQ4X 4P1BC 2DX5B 3QIJA 4WH4A 1D5ZC 3RI7C 5D7GA 3CWIA 3VUYA 3L54A 2HJ1A 2JZ3B 1WMHA 3H1UA 5FKAC 2INPE 3X23A 5DPRA 4ARCA 4ACFA 4L1BA 2K22A 1RWSA 3DVGX 2BYEA 5IA7A 4MSMB 3NOBA 1GC7A 2ZPYA 1LO5D 2M0XA 3JW0X 4DHJB 2VZKB 2BBCA 1NYQA 4J3OD 2KDFB 5AZHA 4DQOC 4P1CC 1YJJA 2K39A 4K7WA 2QJLA 1H4RA 3EGRA 1WJ6A 2JYTA 1KRHA 1T5XD 2PIAA 4GB9A 1OGWA 3DWGC 1MVKA 4H2AA 3UQAA 5G5HA 4HKQA 5HI1A 2KANA 2DBYA 1WXAA 4BKGA 2KQ7A 3ABVB 3A1QB 2WLBA 4NAMA 2IBIB 1NI2A 1OQYA 5J18A 1WYGA 3H7PB 4LNOA 4HVBA 1GNUA 1E90A 3TCAA 1K53A 2PMVA 1EO6A 4HKZE 4YWGG 1TBEA 1UBIA 3UF8A 3P2BA 2Y5PA 4X57B 2LUEA 1LFDA 1V1PB 1FXIA 1JWUD 3VUWA 1KJTA 2E6XA 4LJOB 3ZQ4A 5AEKB 1YX6B 2VH1A 2B76B 5FR6A 3TEWA 4C7ZA 1PGAA 4DXFA 5E6JA 3AM9A 3RZWC 3TMPB 1UNSA 5C2TB 2KDBA 2I38A 5H92C 5T8IA 4HWIB 1HTOA 4EFOA 4ZRKA 4ZHOA 4CHKA 5BMGA 3NZSA 4RF0A 3BINA 2JPHA 3AV8A 4RM8A 1YN4A 2WYQA 3A9JA 1A70A 2XN9C 1NBFC 4B6WA 3VAWA 2FCSA 4LNNA 3B2FA 4BBNF 2PLPA 1P9DU 4NY0A 3HRDD 2L8JA 1BXTA 4NJ7A 3A9KB 4ANVA 2DAJA 3ZGZA 2V1YA 4HJGE 4G0NB 4RF1A 2N4FA 2KMAA 3ALBA 4RGNA 1YQBA 5JZEB 3WAPA 4DHZB 3C0RB 4MSQB 3UQBA 1XO3A 2LGYA 5LNK1 1XLOA 1ZP0B 1RLFA 1K51A 4WQOB 4CO7A 2ZW0A 3EECA 2FAZA 3U8ZA 2K5PA 1TIFA 5CHWA 2KDMA 3WIMA 3UI3A 2QMTA 1TZ1A 4JWUC 3NJTA 3TEYA 3LB8C 5IO9A 5BYQA 2ZNVC 2WXNA 2DYMA 4DK5A 2O2VB 2JVCA 2NPTB 2V4LA 3PHXB 2JUOA 4KSLC 2G4SA 4WWOA 2PE6B 1T0SC 4FJVB 1UH6A 4GDLA 2LGXA 2RDBC 2AYOB 3H6NA 3ETRA 1V80A 3DBLB 1WM2A 3DBSA 2BWES 2M17A 1E7PB 5KHOA 2LI5A 2RMMA 3IFWB 3B08A 3ZUNA 4HDQA 4YSZB 4B0MA 1KOTA 2KFJA 1D5MC 2L52A 4A3PA 3A1QA 3FC4A 2BYFA 2X38A 1V97A 2PVGC 2Z0EB 4GU2A 4GMVA 3RULA 1VZ7A 4DWFA 4WWMA 1QOBA 2K8CA 4Q2JA 3RNAC 4RFBA 2GOWA 2JXXA 1JROA 1IBXB 1V6EA 1Y56A 3BK1A 2G9HD 3CF6E 2HD5B 4AS1A 1IGDA 3FILB 3Q3JA 2BGFA 2DZJA 4WIPA 2N1WA 4CYEA 4GSWA 3URYA 4JLCA 3C19A 3VR9B 1HQRD 3E9SA 3RCZA 4NJCA 1NENB 1C76A 2JWZA 4YTPB 1CMXB 2JZZA 2REXA 5G5GA 3P4PB 1G6JA 1J0GA 3U30A 1LGRA 4C4VB 3HUIA 4ZYNA 4M0WB 3PGEA 2NMQA 1SE2A 4C7YA 3QAQA 1ZDVA 3L0WB 4LTUA 3DVNV 2V3SA 1V5OA 2BS4B 2IO2B 3VDZA 2NS5A 2KQSA 3KWLA 4W9HA 2KT7A 1MHHE 4XWWA 3DHIC 5BYSA 5CX3A 3APCA 4MH8A 1P0RA 3IT6B 2IGHA 3EFUA 1B1ZA 4EZLA 3KYDD 4UDUC 5IP4D 1I4PA 3P1MA 2C9WB 2V3PA 1TYGB 1I35A 4BBNC 1WJ4A 3U4EG 3T9LA 4KIKA 4KKJA 4HPMB 4LLGM 3PZ8A 2M0AA 2WP9B 1JCKB 5L95C 5BYRA 2MLBA 3MC8A 4LJPB 3VVWB 2W3RA 3DVNU 1VJKA 1OEYA 4OZCA 1ET9A 4LNFA 2I2YA 1GC6A 2WXQA 4D2KA 1FPYA 2FIFA 2NBVB 4URKA 2KKCA 2FCMA 1I7HA 3GE8C 1RRBA 2BB5A 3SFEB 1SB3C 1JWMD 1IP9A 4BVUC 1E7UA 4IWPA 2MSED 3KYCD 2O2VA 3VTVA 5E6PA 2CJNA 3JSVB 2GLSA 2DZIA 1Z2MA 2WNMA 4PS8A 5E6NA 1EU3A 5D3DA 4WJPA 2K25A 3BYYB 2BYVE 3IBEA 1ZUD2 2PTLA 2C60A 4IG7B 3SU8X 1EF5A 1ENFA 1VZ8A 1WMHB 2E3TA 3M62B 1TKEA 4HCPB 2WXFA 4F1SA 1OFFA 3TJPA 3ZW3A 2LGIA 1KH0A 4FJYA 4B0EA 1I4GA 2KFKB 1WXQA 4TKNA 5CHVC 3SD5A 5BMHA 3T3NA 2VH2A 2EKIA 2LXCA 1E9MA 1T6BX 2JYEA 3Q8FA 4YTNB 3QHTA 2M8SA 3DBRB 3HM3A 1ZGUB 2K1FA 3BVMA 3SFDB 3O65B 3DPDA 3H7SA 3OWEB 4TQ0A 4I6NB 1YIWA 2JX5A 1TGZB 5LXHA 3WALA 4RNAA 3V60A 4MACA 2N9KA 2EKEC 2M56B 4A6QA 4A55A 2KNBA 1GJZA 3NS8A 3ZJVA 1NYRA 3UGBB 2BYTA 3OG5A 2XK5A 3L17A 2ICIA 1WGRA 3N1YC 2LEKA 4B9KA 4WJNA 2XEWA 1V81A 1L4ZB 4NJ6A 1L2NA 4RH6A 1FXTB 1WGYA 4RCOA 1N6ZA 3TL5A 2HTHA 4ARIA 2DHZA 1NVID 2JZPA 2KAJA 1PYWD 4MM3A 2KTRA 1MFWA 1HA5A 3UIPB 1BT0A 3L10B 1BMLC 4YSXB 3APFA 3PVLA 4WWNA 3QWZB 3P4QB 3SR6A 4IUMB 2MH7A 4OW0A 1EUVB 2K6DB 3ZKJC 3CSFA 2Y5BB 2AWTA 4MJSA 3DBLI 4N6EB 3A9JB 3ZJTA 1FD6A 2KZRA 4MGZE 3V62A 2RSUA 1CK1A 3Q3NC 4GIVA 2J0MA 4LDTB 3PLVA 3N32A 2MWSB 2CHWA 2WDRB 4HPLB 3DDCB 1S1QB 4P6VF 4WWPA 1QOFA 2EELA 2K0PA 5LLIA 1FXAA 1VR9A 3JSVA 3AEFB 3PT2B 1ZXIA 1YX5B 3LXFA 1UELA 1STEA 2NCNA 3NZ3A 2K9XA 1ZDXA 4IC7B 1MI0A 2L00B 1WM3A 3X0WA 2DZMA 3APDA 2CHXA 3HM6X 3IHPC 3U7ZA 2MBOA 2KFKA 2Z59B 3WAOA 1GB1A 4P16A 1P7EA 3A33B 1V2YA 3H9DA 4KZ0A 2AEHA 1YJ1A 2QCZA 1AARA 1WR6E 2RD0A 3KW5B 5DPSA 2M1MA 4A20A 1H8CA 5G55A 4EOYA 3RNFC 2RGFA 3KQ4A 1JWSD 1R7SA 3R7RA 4GDLB 1WRDB 2AQ1B 4YSYB 4G3XB 5GXGB 1EM7A 3ZTDA 3QARA 1WX7A 2BTEA 4XC2A 4N59A 2W55A 2G1EA 3IAM1 2WXGA 2XBBC 3H8HA 5C3JB 4PT5A 3BZDB 1V5TA 2MRPA 3DHHC 2H88B 1NEKB 3DVGY 4W9FA 2LHEA 3V6EB 2H89B 3GZNB 2KK8A 2INNE 3SEBA 5EE3A 1ZE3D 1OQQA 1WGGA 3HVDA 3M95A 3RFZB 2OJWA 3AE2B 2ZCCA 2Z8LA 2WXIA 1WX9A 4EKUA 4JGHB 3B0AA 2R61A 4XZ4A 3VTUA 3NUHB 2A5UA 2L76A 2MP2A 4M8NA 4DXGA 1Q5WB 2MJEA 3M63B 1VD2A 5TSSA 5J2RA 1KLVA 1SEBD 5I4DA 3Q69A 3OJ3A 2AX5A 3DCGA 4C56C 3NS1A 2V4IB 1R4MB 2ZNVB 3PO0A 1TS3A 4IM2A 2MJ3A 3Q8BA 4ICVA 1JMLA 2OJRA 3WAMA 4QAYA 4W9DA 4R3DA 1YJIA 1FRRA 3DHGC 3PRMB 4W9CA 1ET6A 3AEBB 2KD0A 5EE9A 2KMCA 1C78A 4OVZA 1C4AA 3NG0A 3PPAA 4HJKA 3Q6BA 1TS2A 2KVRA 2BWFA 2M19A 3IXSA 3O13A 4KKIA 2YLMA 1TJEA 4JIOU 4L23A 2LXAA 2BB6A 5JHBA 3AE5B 3RPFC 2ZPNA 3KVFB 4XGAB 3NVYA 4KIKB 2GBRA 3PZ7A 5C23A 4A90A 4BFRA 1XCQL 2A4ZA 2LZ6A 4USAA 2CS4A 2CHZA 1UGJA 1WY8A 4PS7A 3NVVA 2C7NB 2KHWB 3MHSD 2NVUI 1DGJA 4I6PA 3W5VB 3TEXA 2HTME 1HTQA 4E3CA 3R66C 1KFYB 4MGKE 3GE3C 1F9JA 2YEPF 2AL3A 1KM7A 1YN3A 5HG2A 5E6OA 3AE3B 1JRPA 1R4NI 4A3OA 2IY1B 1Q0WB 2QILA 1SF0A 2BKFA 2QSDA 4FLHA 4M01A 3ZNGC 4HROA 4ANXA 2HE7A 4OZAA 2LVQA 1TY0A 1M94A 2GI9A 1WFYA 1D5XC 2C5LC 3RD2A 1E8YA 1LXDA 3MJ5A 4WJQA 4FBJB 1N5XA 1L4DB 1GB4A 3TUOA 3E56A 4KGSA 1LM8B 5AZGA 3Q3MC 1J7BA 1TT5B 4BKSD 1FFUA 2YVCA 4EZKA 4F8CB 2WU2B 3HK0A 4GXBA 2BF8B 3WANA 1XLNA 3VFKA 4KX6B 1L0VB 2N9XA 3L13A 4KSKC 1N62A 1CQVA 2J53A 4REZA 1ACCA 2LJ5A 1HEZE 5EDSA 1J8CA 3AE1B 2MEKA 1WJNA 1E8WA 4FA6A 1F1HA 4W9EA 1VCBA 4AOFA 3MHZA 4M02A 2ZZPB 1PFDA 2L3ZA 3QCAA 1WX8A 2MA9B 4K7UA 1FRDA 1GOZA 1WXVA 3JVZX 4WAAA 4XDDA 2MX2A 1ZXHA 3DBHB 2KO3A 2KJHB 3AE9B 2XK5B 1MG4A 3TIXA 2D3GA 2Q5WD 3IAS1 3PREA 1WXMA 5DCNA 2J42A 2KDIA 3EA6A 3NY5A 3NRZA 3GB1A 2KC2A 4ANUA 3ZXRA 1WXSA 2JWUA 1F52A 2L7RA 3RMKC 1PGXA 3T3OA 1WRIA 4ZYSA 5AUIA 3RNGC 1EWCA 4K81A 2UU7A 1J7AA 3P4RB 3I63C 1K50A 3WA0A 1WGKA 4S17A 1B9RA 2ZJDA 2HJ8A 5D94A 4M00A 4MM3B 2KTRB 2JSVX 1Y8RC 4YTMB 3I5JC 2MBQA 1J7CA 2NTSA 2R2OA 5MPOA 3HHMA 1BUIC 2J4XA 1C9FA 1C3TA 2LMCA 4MJSB 2KX0A 4HEA1 4XE0A 4IWOA 2ZVNA 4MELA 4EZJA 1E10A 2MW5A 1RM6C 3I9V1 1M4VA 3L08A 3RYTA 2Y5CA 2D5GA 3KUCB 1XQQA 3Q2AC 1XF5L 2JF5A 3V05A 1MPEA 2LVPA 1UGMA 4NPNA 5DPTA 2KJRA 2DAFA 3VH4B 4WJOA 1QT9A 1P1AA 3BYTB 2WXOA 3R8BA 3MC0B 3SHQA 3QK0A 3N3KB 1E5WA 3ECIA 4ITKA 2WHIA 5LXIB 4IM0A 4S0RA 3I3TB 1SXTA 3KH0A 1I4QA 1GUAB 2FCQA 1L5PA 2GBNA 1EF1A 1SIFA 4DDGD 4NZLB 3A4RA 4IKGA 1FMAD 2WXPA 1GPXA 1PDXA 1FEHA 1V9JA 3Q3OC 5JH5C 1QQRA 1TKGA 1QLBB 3R7QA 2K8HA 2CKHB 4MT5A 4US8A 1A5RA 4KV2A 1WZ3A 4RGMA 2GMIC 1SJHD 1WYWB 4NAWA 2KN4A 2N9PC 3EFCA 3P63A 2DYBA 2NR2A 3EC8A 2J52A 4JQWC 1AYFA 1I42A 2IJ0A 5CTRC 4AWJA 3JYUA 4A9AA 2DNFA 5D3IB 2ON8A 1IUEA 1WGDA 2ZEQA 2WX0A 2B3AA 4PK1A 2MQJA 3W5UB 1E7VA 1QKZA 2KTFA 4HCNB 2LFIA 4MGIE 4W9KA 2DENB 2K6QA 1WIAA 3K9PB 4JPSA 2JT4B 2AQ2B 2FE8A 4HK2A 2MP2B 1YNTE 4IW0A 3IVFA 1WZ0A 3OLMD 1SSNA 1XD3B 3PRPB 3RNBC 1JQ4A 2D10A 1DOIA 2W54A 1DOXA 1GAQB 3N9YC 4LCDE 2FBWB 1N61A 3EHVA 4ZRPA 1NDDA 2PVOD 1ISNA 1UZXB 1V1OA 3VRBB 3VHTC 3TEZA 4AUQC 3P42A 3PZDA 1F0ZA 4N58A 1FIQA 2D3AA 3ML8A 2N7JA 3ZJUA 2W3SA 1RFAA 5JHAA 2MJDA 1V86A 4FN2A 2QIEB 1FNWA 5TR5A 2PKOA 2GB1A 4GOCA 1FCLA 2WDVB 3J9CA 3AU5A 2V3NA 4ZRQA 1XLQA 3RUIB 2INDC 4YT0B 1D3ZA 2HDEA 2O6VD 3CIRB 2PW9A 2BPSA 2WXKA 1L0YB 2WXRA 4J6IA 2BS3B 4G11A 2L05A 1F2RI 3N30A 4FHJA 2KWUB 1TKYA 1JRUA 1UWMA 2L0TA 1P98A 2AQ3B 2KWVB 3CMMB 3VXWA 5DPWA 5IKCM 2IGDA 4LNIA 2IO1B 2IY0B 4ZDVA 3W1YA 5C1ZA 1IGCA 2BKRB 2TSSA 4MDKE 1JW9D 2BQQA 3I57A 4DBGA 1MHXA 1DYQA 4DXAB 1UUPA 1AWDA 4W9IA 2RR9A 1SJED 5FK9C 2X8XX 1S3SG 2PJHA 1XXGA 1UF0A 2MBHA 1VLBA 4O1NA 2L1AA 3FAHA 3KWVA 3BK2A 4C80A 2KLCA 1HZ6A 3FKYA 2ACZB 4GDKA 4M8MA 4US9A 1C1YB 1C79A 3AI5A 1AW7A 4DDID 2L83A 4RGOS 1C77A 2UWQA 5EE1A 2KN5A 1K8RB 4BOZB 3VH3B 2OOBB 5EE0A 4DHJD 2J0JA 2VZKD 1SIJA 1FCCC 1KLUD 2KACA 5J17A 1E8ZA 3ZNZB 2LGSA 4ASWC 1RFKA 2KYWA 2LD9A 2LRWA 4BAXA 2JRIB 2KWDA 2LUMA 2KMMA 1IYFA 3AECB 2L32A 4CQNA 4EEWA 2N1VA 3ENEA 5IAAC 2G45B 3MC9A 3VQIA 2IGGA 1KLGD 1I4RA 1QF6A 2R2QA 2I1KA 3U52E 2JQRB 1SBBB 1RYJA 4I6LB 3BVZA 4ZOHC 5GMVA 5HHDG 3AEEB 3R3MA 1QILA 3AN1A 3B1LX 4ICUA 2FIDA 2KWCA 4NNJB 1TS5A 2D11A 2ZVOA 1V49A 3L4PA 4JWSC 1SGHA 3ONSA 2NBWB 1VRAB 2FUHB 2LASA 1TY2A 4LK0M 2ASQA 4GGQA 4KGTA 1WR1A 1WE7A 2D3BA 2RDGA 3K9OB 4IWQA 1TS4A 3TSSA 2KXJA 3AE6B 4K1RB 1KF6B 1WE6A 1OQRA 3BY4B 2O6VA 4HPPA 1WGHA 4K3BA 2LVOA 3BVGA 2DZKA 2IYDB 3DWMA 4XX5A 2DLBA 3HIZA 2N9LA 5AZFA 4OZBA 2RPVA 2Z0DB 4JL9A 3C8YA 4HRSA 2GBKA 3VR8B 4XWTA 2FNJB 2WGSA 2LHDA 2WXJA 3DBRI 4KDIC 4RGTA 1UBQA 4XDCA 3EUB2 3P4SB 1VZ6A 3AU4A 2BT6A 2IPKD 3V61A 4PYUA 3PS6A 3AMZA 2OEDA 1DOYA 3AEDB 3L16A 1WJUA 5AUKA 2VRRB 2DWQA 4FJZA 1RAXA 1EU4A 1Z5SB 4W9GA 3HVZA 3MTNB 1P3QU 4AQ7A 4N9F4 3RT3B 2LGDA 3NVZA 1PQSA 1U4AA 2WXHA 2BS2B 4WQMA 4LNKA 4YL8A 5G2NA 2V9HA 2EMSA 2QC8A 4KDLB 1XLPA 1C4CA 2QHOA 2N0SB 2SAKA 1I4HA 1L0XB 3Q8CA 4PYZA 5KHQA 2PPHA 3QJZA 2CR5A 1I4XA 1JWAD 3VRAB 4HDOA 3ZDMC 2V0GA 2EMTA 3KUDB 1FM0D 1SE4A 4GLSC 1KTKA 3U7DA 2WX1A 1OEYJ 2BW2A 3N1ZC 1C4PA 1T0QC 1E0ZA 2K3UA 1T0RC 5JXVA 4WURA 2ONQA 3B9JA 5CHFA 2KVZA 1ZPSA 2JY6A 1N63A 4ZHPA 2QDFA 1MG8A 3SDLC 1K52A 3KLSX 4NAWB 2OHFA 2WU5B 2RDHA 4C00A 1FNVA 2FUG1 4BKTA 1TZOA 3D32A 3H7PA 3PSEB 3R2TA 3TBLD 4KVGB 4AJWA 2WXMA 3ZLZA 3ZVVA 1WH3A 4TUUA 4II2B 1FNUA 1EWYC 3PV1A 4FULA 1V1PA 4BOSC 2CJOA 3AH7A 1YN5A 1HE8A 3NHEB 1YMHE 3LYYA 1D4BA 1L6UA 2KDEB 2MBEA 4ZRIA 2N7DA 4NQKE 1CJEA 2JU6X 5L83A 2YEPB 2WXLA 2IO0B 4W9JA 2RPQA 2INCC 3PRZA 1E8XA 4AP4C 1L7YA 3NVWA 4HLEA 3Q8AA 1SE9A 1CZPA 2KLGA 3W1SC 3S2AA 3AE8B 1L6VA 3QX1A 1JWBD 3QQ8B 1UD7A 3T8MA 2D3CA 2N9EB 4IM3A 3QA8A 2WDTB 3ZRCA 4ZRJA 3ZIMA 2J0KA 3MJWA 1ZOYB 3NZUA 3AULA 4XYCA 4IDIA 4DHZE 1E6EB 2MHJA 3Q3FA 1D6EC 3UINB 3LDZE 1WF9A 1VDVA 3A9KA 4TQ1A 3M3JA 2IZVB 1PGBA 1F2RC 3CSTA 1X1MA 2N7EA 3GZNI 3AE7B 4HXDA 4W9LA 4G50A 1AN8A 3PLUA 3PTFC 5BMIA 1J19A 3IT4B 3MFGA 2NTTA 1WWTA 2D2QA 3AXCA 1ESFA 2ZW1A 2G3QB 3W2DA 1LQBA 3MP9A 1XT9B 1WSPA 3Q8EA 3ZNID 4B95A 1ROEA 1QOGA 2M4NA 3RN9C 4BKSA 3V6CB 3ZRFA 4IOIE 2NPTA 4TMAB 1UWXA 3AEGB 3VUXA 2IDYA 1TTNA 1N5WA 1R4MI 1XCTL 3ZXVA 4FHKA 3W1SA 1YQ4B 4PS3A 1NI3A 3DQVA 2WS3B 2WDQB 4K3CA 1WI0A 4E74A 2JXTA 4JX1C 1GG3A 4MGYE 4GDKB 3A4SC 3V3XA 2W82A 3Q14C 1QOAA 2C7HA 3AEAB 3QC8B 1PUTA 4II3B 4NQLB 4TSSA 2LJIA 3KUZA 2BVCA 3ZDTA 2MCNB 4WAFA 5D6JB 2D07B 1OTRB 1IBXA 4RM9A 2DYOA 4BZAA 5HFYA 1IPGA 2L0FA 2FCNA 4TV3A 3OJ4B 2G4DB 4L2YA 4ANWA 3W9CB 3FILA 3RNEC 1F77A 3AE4B 3RNCC 1SE3A 4P7IA 3U2SC 3VTWA 2W9NA 4FADA 2LWPA 2ZCBA 2UYZB 2K8BA 2PE9A 5IOIA 2WQYB 2KOXA 3AB5A 2J7QB 2JRHA 5BO4B 4JE3B 1T0YA 4C4VA 2LRUA 3PHWB 5HKHA 4MH0E 4M0WA 4EUTA 3N20C 3OAWA 2Y3AA 2KX3A 4RMAA 3ZO5B 2IO3B 1ZW7A 1R4NB 3ZNHB 4KGRA 3B2GA 1QZEA 4OVUA 5H8YE 2GBJA 4EE2A 3BWUD 1MJDA 3DOWA 1V8CA 3N1XC 2NBUA 2QEJC 2SEBD 2PEAA 1ZKHA 1FO4A 2GBMA
chains in the Genus database with same CATH topology
2FIFA 2KC1A 2NBVB 4I6LB 4URKA 2KKCA 2FCMA 5GMVA 1LM8B 3R3MA 1RRBA 3B1LX 5AZGA 2AL6A 2O6VB 4ICUA 5D2MB 4BKSD 1IP9A 4BVUC 1E7UA 2YVCA 2FIDA 4IWPA 4EZKA 2MSED 3KYCD 2KWCA 2O2VA 4GN1A 5E6PA 2CU1A 4NNJB 3IG3A 3JSVB 2D11A 3VTVA 2ZVOA 4F7ZA 1V49A 2DZIA 1Z2MA 3HK0A 1SGHA 2C7MB 3ONSA 2NBWB 2LASA 2FUHB 4GXBA 4KZCA 2WWZA 4PS8A 5E6NA 4WJPA 2ASQA 2K25A 4GGQA 3RZFA 1WR1A 3ML9A 2BYVE 2BF8B 3LJ3A 1WE7A 3IBEA 3WANA 2I1JA 4E71A 3K9OB 2C60A 3UIOB 4IG7B 4IWQA 3VFKA 2N9XA 4OVVA 2KJ6A 3L13A 4KSKC 3SU8X 1EF5A 1WMHB 2KXJA 4K1RB 3M62B 4AJYB 4HCPB 2LJ5A 3ZTCA 4F1SA 1WE6A 5EDSA 3TJPA 1J8CA 3ZW3A 1WJNA 1E8WA 4FJYA 4FA6A 4W9EA 1VCBA 4AOFA 2KFKB 3GOEA 4MEMA 2ZZPB 4TKNA 2L3ZA 4K7SA 5CHVC 3BY4B 2O6VA 3SD5A 3QCAA 1Q1OA 1WX8A 1WGHA 4LDTD 2MA9B 4K7UA 1WXVA 3JVZX 4WAAA 1YD8U 2MX2A 2MBBB 2LVOA 2DZKA 2IYDB 4XX5A 2KO3A 2KJHB 3DBHI 3HIZA 2XK5B 2LXCA 5AZFA 2Z0DB 2DX5B 2D3GA 3QIJA 4JL9A 3TIXA 3PREA 2GBKA 1WXMA 2M8SA 3QHTA 5DCNA 5D7GA 2KDIA 2FNJB 3NY5A 3DBRI 3HM3A 4KDIC 3VUYA 2KC2A 1UBQA 4ANUA 3L54A 1WXSA 2JZ3B 1ZGUB 2K1FA 2L7RA 1WMHA 3H1UA 3AU4A 3O65B 3DPDA 3X23A 5DPRA 3V61A 4PYUA 3DVGX 3H7SA 3PS6A 4K81A 4TQ0A 4I6NB 1YIWA 5LXHA 1TGZB 2BYEA 3WALA 5JZEB 3V60A 3WA0A 5IA7A 3L16A 1WJUA 2VRRB 2ZJDA 4FJZA 2EKEC 4MSMB 2HJ8A 3NOBA 1RAXA 5D94A 1GC7A 2KNBA 1Z5SB 2ZPYA 3NS8A 4W9GA 1GJZA 3MTNB 1P3QU 2M0XA 4N9F4 3RT3B 3JW0X 2KTRB 2LGDA 4DHJB 3UGBB 2KDFB 1PQSA 1U4AA 5AZHA 1Y8RC 2XK5A 3L17A 2MBQA 1WGRA 2R2OA 2K39A 4YL8A 4K7WA 5G2NA 2EMSA 4KDLB 1H4RA 3HHMA 2QHOA 4B9KA 4WJNA 1WJ6A 2XEWA 1C3TA 4MJSB 4GB9A 1OGWA 1V81A 2KX0A 3UQAA 4NJ6A 4IWOA 2ZVNA 4PYZA 1L2NA 4MELA 1FXTB 2PPHA 3QJZA 5KHQA 1WGYA 2CR5A 2KANA 4EZJA 1WXAA 2MW5A 2HTHA 3TL5A 2DHZA 4BKGA 3L08A 3RYTA 4HDOA 2KQ7A 4MM3A 3KUCB 2KTRA 1XQQA 3ZDMC 3A1QB 2EMTA 2JF5A 3KUDB 2IBIB 1NI2A 1OQYA 5J18A 2LVPA 3UIPB 1BT0A 3L10B 3H7PB 4HVBA 3APFA 1GNUA 1E90A 3TCAA 3PVLA 4WWNA 3QWZB 1UGMA 2WX1A 3U7DA 1EO6A 4NPNA 4IUMB 1TBEA 1UBIA 5DPTA 2KJRA 3UF8A 3P2BA 1EUVB 1OEYJ 2K6DB 2DAFA 3VH4B 3ZKJC 3CSFA 4WJOA 4X57B 2Y5BB 2LUEA 1P1AA 1LFDA 2AWTA 4MJSA 3VUWA 3SHQA 1KJTA 3QK0A 5CHFA 3DBLI 3N3KB 4LJOB 1E5WA 3ECIA 5AEKB 1YX6B 3A9JB 2JY6A 5LXIB 4IM0A 2KZRA 3I3TB 3KH0A 5FR6A 4MGZE 1MG8A 3SDLC 1GUAB 3V62A 2FCQA 4NAWB 2GBNA 2RSUA 1EF1A 1SIFA 4GIVA 2J0MA 4LDTB 3PLVA 3RZWC 3TMPB 4DDGD 3A4RA 2KDBA 4BKTA 3D32A 3H7PA 4HWIB 3PSEB 3N32A 3TBLD 2MWSB 4KVGB 2CHWA 4AJWA 4EFOA 4HPLB 4ZRKA 3DDCB 3ZLZA 1S1QB 1V9JA 4WWPA 4CHKA 3ZVVA 1WH3A 4TUUA 5JH5C 4II2B 3NZSA 5LLIA 3JSVA 3R7QA 3BINA 3PV1A 2K8HA 3PT2B 4FULA 2JPHA 4RM8A 1YX5B 2CKHB 4BOSC 1UELA 2WYQA 2NCNA 1HE8A 3A9JA 1A5RA 4KV2A 3NHEB 1WZ3A 1NBFC 2GMIC 4B6WA 2KDEB 2MBEA 4IC7B 1WYWB 4ZRIA 2L00B 1WM3A 3X0WA 4NAWA 2DZMA 2N7DA 2N9PC 3APDA 3VAWA 2DYBA 2FCSA 2CHXA 3HM6X 4NQKE 5L83A 2NR2A 3IHPC 3EC8A 2IO0B 4BBNF 4W9JA 1P9DU 2MBOA 2KFKA 2RPQA 4JQWC 4NY0A 3PRZA 2Z59B 1I42A 1E8XA 4AP4C 4AWJA 5CTRC 1L7YA 2L8JA 3JYUA 3WAOA 4NJ7A 3A9KB 4HLEA 1SE9A 1V2YA 3A33B 2KLGA 3W1SC 3S2AA 1WGDA 4ANVA 2DAJA 2ZEQA 3H9DA 4KZ0A 2AEHA 2WX0A 2V1YA 3QX1A 1YJ1A 2B3AA 1AARA 1WR6E 2RD0A 3KW5B 3QQ8B 4G0NB 2N4FA 2M1MA 5DPSA 4A20A 2MQJA 1H8CA 2KMAA 1UD7A 1E7VA 3ALBA 3T8MA 2N9EB 4IM3A 3QA8A 2WDTB 2KTFA 4HCNB 5G55A 4EOYA 1YQBA 4MGIE 4W9KA 4ZRJA 2DENB 2K6QA 3WAPA 1WIAA 2RGFA 3ZRCA 3ZIMA 3K9PB 4DHZB 3C0RB 2J0KA 2JT4B 4MSQB 3R7RA 4GDLB 3UQBA 3MJWA 1WRDB 3NZUA 4G3XB 3AULA 2LGYA 3ZTDA 4HK2A 2MP2B 1RLFA 3QARA 4IW0A 1WX7A 4WQOB 3IVFA 4CO7A 4XC2A 1WZ0A 4DHZE 3OLMD 1XD3B 3EECA 2FAZA 3U8ZA 5CHWA 3PRPB 3Q3FA 3WIMA 2XBBC 1TZ1A 3UINB 3LDZE 2D10A 1V5TA 1WF9A 2MRPA 2ZNVC 3A9KA 4TQ1A 3M3JA 2IZVB 2DYMA 4LCDE 4DK5A 2O2VB 3DVGY 4W9FA 3EHVA 2JVCA 2NPTB 3V6EB 3CSTA 2KK8A 1X1MA 2N7EA 3GZNI 2V4LA 3PHXB 2JUOA 4HXDA 1NDDA 4KSLC 1WGGA 4W9LA 4G50A 2G4SA 4WWOA 1ISNA 3M95A 1UZXB 3PLUA 3PTFC 2PE6B 3VHTC 1J19A 2ZCCA 4AUQC 3PZDA 1WX9A 4EKUA 2D2QA 4JGHB 3B0AA 4FJVB 1UH6A 3AXCA 4GDLA 2LGXA 4XZ4A 2G3QB 3ML8A 3VTUA 1LQBA 2AYOB 3H6NA 2A5UA 1V80A 1RFAA 2L76A 2MP2A 4M8NA 1XT9B 5JHAA 1WM2A 1V86A 3DBSA 2BWES 1Q5WB 2M17A 4FN2A 5KHOA 2LI5A 3IFWB 3M63B 3B08A 3ZUNA 1VD2A 4HDQA 5TR5A 5J2RA 1KLVA 3ZNID 4B95A 1KOTA 4GOCA 2KFJA 2M4NA 4BKSA 3V6CB 4A3PA 3A1QA 3ZRFA 3AU5A 4F8CB 3OJ3A 2NPTA 2BYFA 3DCGA 2Z0EB 4GU2A 4GMVA 3RULA 4DWFA 3RUIB 2K8CA 1D3ZA 3VUXA 2O6VD 1TTNA 2GOWA 2JXXA 2ZNVB 2BPSA 1V6EA 1R4MI 4IM2A 4FHKA 4ICVA 3W1SA 4J6IA 3CF6E 4PS3A 2OJRA 3WAMA 2HD5B 4G11A 2L05A 4W9DA 3DQVA 3N30A 4FHJA 2KWUB 1JRUA 3Q3JA 1WI0A 2L0TA 1P98A 2BGFA 3PRMB 2DZJA 2KWVB 4E74A 2N1WA 4CYEA 4GSWA 3CMMB 4W9CA 3VXWA 5DPWA 2KD0A 1GG3A 4MGYE 4JLCA 2KMCA 2IO1B 2IY0B 4GDKB 3A4SC 4ZDVA 3W1YA 5C1ZA 3PPAA 4HJKA 3RCZA 2BKRB 2C7HA 2JWZA 1CMXB 2JZZA 2REXA 3QC8B 4MDKE 2KVRA 4II3B 1J0GA 1G6JA 2BWFA 3U30A 4NQLB 4DBGA 3KUZA 3ZDTA 2MCNB 5D6JB 4DXAB 2D07B 2YLMA 1OTRB 4JIOU 4M0WB 4W9IA 2RR9A 2LXAA 3PGEA 4ZYNA 4RM9A 5JHBA 1S3SG 2DYOA 2PJHA 2ZPNA 1IPGA 2L0FA 2FCNA 3KVFB 3QAQA 4TV3A 3OJ4B 2G4DB 4ANWA 2MBHA 3L0WB 4KIKB 2GBRA 3DVNV 2V3SA 5C23A 1V5OA 2IO2B 3VDZA 4BFRA 2A4ZA 4P7IA 3VTWA 2LZ6A 2KLCA 2CS4A 2CHZA 2KQSA 1WY8A 2NS5A 2W9NA 4PS7A 2LWPA 4FADA 4GDKA 4M8MA 4W9HA 2ZCBA 2C7NB 1C1YB 2K8BA 2PE9A 2UYZB 2KHWB 3AI5A 2KOXA 4DDID 2J7QB 2JRHA 3MHSD 5BO4B 2NVUI 5CX3A 1T0YA 4I6PA 3APCA 2UWQA 1P0RA 2KN5A 2LRUA 3PHWB 1K8RB 3EFUA 4E3CA 4BOZB 4EZLA 3KYDD 5HKHA 3R66C 4MH0E 3VH3B 4EUTA 4MGKE 2OOBB 2C9WB 3OAWA 4DHJD 2J0JA 2KX3A 1I35A 1F9JA 4BBNC 1WJ4A 4RMAA 5J17A 3ZO5B 2AL3A 1E8ZA 1KM7A 3T9LA 2IO3B 1ZW7A 5E6OA 3ZNZB 4KIKA 1R4NI 4A3OA 2IY1B 4ASWC 1Q0WB 4HPMB 2LD9A 2LRWA 2BKFA 3ZNHB 2JRIB 4FLHA 3ZNGC 1QZEA 2HE7A 4OVUA 4ANXA 1IYFA 5L95C 2GBJA 2LVQA 2MLBA 4LJPB 4EEWA 2N1VA 1M94A 3ENEA 5IAAC 3VVWB 1WFYA 3DOWA 3DVNU 2C5LC 2G45B 2NBUA 3VQIA 1OEYA 3RD2A 1E8YA 1LXDA 4WJQA 4FBJB 1GC6A 2R2QA 2PEAA 1ZKHA 2I1KA 2GBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FIF A;  2KC1 A;  2NBV B;  4I6L B;  4URK A;  2KKC A;  2FCM A;  5GMV A;  1LM8 B;  3R3M A;  1RRB A;  3B1L X;  5AZG A;  2AL6 A;  2O6V B;  4ICU A;  5D2M B;  4BKS D;  1IP9 A;  4BVU C;  1E7U A;  2YVC A;  2FID A;  4IWP A;  4EZK A;  2MSE D;  3KYC D;  2KWC A;  2O2V A;  4GN1 A;  5E6P A;  2CU1 A;  4NNJ B;  3IG3 A;  3JSV B;  2D11 A;  3VTV A;  2ZVO A;  4F7Z A;  1V49 A;  2DZI A;  1Z2M A;  3HK0 A;  1SGH A;  2C7M B;  3ONS A;  2NBW B;  2LAS A;  2FUH B;  4GXB A;  4KZC A;  2WWZ A;  4PS8 A;  5E6N A;  4WJP A;  2ASQ A;  2K25 A;  4GGQ A;  3RZF A;  1WR1 A;  3ML9 A;  2BYV E;  2BF8 B;  3LJ3 A;  1WE7 A;  3IBE A;  3WAN A;  2I1J A;  4E71 A;  3K9O B;  2C60 A;  3UIO B;  4IG7 B;  4IWQ A;  3VFK A;  2N9X A;  4OVV A;  2KJ6 A;  3L13 A;  4KSK C;  3SU8 X;  1EF5 A;  1WMH B;  2KXJ A;  4K1R B;  3M62 B;  4AJY B;  4HCP B;  2LJ5 A;  3ZTC A;  4F1S A;  1WE6 A;  5EDS A;  3TJP A;  1J8C A;  3ZW3 A;  1WJN A;  1E8W A;  4FJY A;  4FA6 A;  4W9E A;  1VCB A;  4AOF A;  2KFK B;  3GOE A;  4MEM A;  2ZZP B;  4TKN A;  2L3Z A;  4K7S A;  5CHV C;  3BY4 B;  2O6V A;  3SD5 A;  3QCA A;  1Q1O A;  1WX8 A;  1WGH A;  4LDT D;  2MA9 B;  4K7U A;  1WXV A;  3JVZ X;  4WAA A;  1YD8 U;  2MX2 A;  2MBB B;  2LVO A;  2DZK A;  2IYD B;  4XX5 A;  2KO3 A;  2KJH B;  3DBH I;  3HIZ A;  2XK5 B;  2LXC A;  5AZF A;  2Z0D B;  2DX5 B;  2D3G A;  3QIJ A;  4JL9 A;  3TIX A;  3PRE A;  2GBK A;  1WXM A;  2M8S A;  3QHT A;  5DCN A;  5D7G A;  2KDI A;  2FNJ B;  3NY5 A;  3DBR I;  3HM3 A;  4KDI C;  3VUY A;  2KC2 A;  1UBQ A;  4ANU A;  3L54 A;  1WXS A;  2JZ3 B;  1ZGU B;  2K1F A;  2L7R A;  1WMH A;  3H1U A;  3AU4 A;  3O65 B;  3DPD A;  3X23 A;  5DPR A;  3V61 A;  4PYU A;  3DVG X;  3H7S A;  3PS6 A;  4K81 A;  4TQ0 A;  4I6N B;  1YIW A;  5LXH A;  1TGZ B;  2BYE A;  3WAL A;  5JZE B;  3V60 A;  3WA0 A;  5IA7 A;  3L16 A;  1WJU A;  2VRR B;  2ZJD A;  4FJZ A;  2EKE C;  4MSM B;  2HJ8 A;  3NOB A;  1RAX A;  5D94 A;  1GC7 A;  2KNB A;  1Z5S B;  2ZPY A;  3NS8 A;  4W9G A;  1GJZ A;  3MTN B;  1P3Q U;  2M0X A;  4N9F 4;  3RT3 B;  3JW0 X;  2KTR B;  2LGD A;  4DHJ B;  3UGB B;  2KDF B;  1PQS A;  1U4A A;  5AZH A;  1Y8R C;  2XK5 A;  3L17 A;  2MBQ A;  1WGR A;  2R2O A;  2K39 A;  4YL8 A;  4K7W A;  5G2N A;  2EMS A;  4KDL B;  1H4R A;  3HHM A;  2QHO A;  4B9K A;  4WJN A;  1WJ6 A;  2XEW A;  1C3T A;  4MJS B;  4GB9 A;  1OGW A;  1V81 A;  2KX0 A;  3UQA A;  4NJ6 A;  4IWO A;  2ZVN A;  4PYZ A;  1L2N A;  4MEL A;  1FXT B;  2PPH A;  3QJZ A;  5KHQ A;  1WGY A;  2CR5 A;  2KAN A;  4EZJ A;  1WXA A;  2MW5 A;  2HTH A;  3TL5 A;  2DHZ A;  4BKG A;  3L08 A;  3RYT A;  4HDO A;  2KQ7 A;  4MM3 A;  3KUC B;  2KTR A;  1XQQ A;  3ZDM C;  3A1Q B;  2EMT A;  2JF5 A;  3KUD B;  2IBI B;  1NI2 A;  1OQY A;  5J18 A;  2LVP A;  3UIP B;  1BT0 A;  3L10 B;  3H7P B;  4HVB A;  3APF A;  1GNU A;  1E90 A;  3TCA A;  3PVL A;  4WWN A;  3QWZ B;  1UGM A;  2WX1 A;  3U7D A;  1EO6 A;  4NPN A;  4IUM B;  1TBE A;  1UBI A;  5DPT A;  2KJR A;  3UF8 A;  3P2B A;  1EUV B;  1OEY J;  2K6D B;  2DAF A;  3VH4 B;  3ZKJ C;  3CSF A;  4WJO A;  4X57 B;  2Y5B B;  2LUE A;  1P1A A;  1LFD A;  2AWT A;  4MJS A;  3VUW A;  3SHQ A;  1KJT A;  3QK0 A;  5CHF A;  3DBL I;  3N3K B;  4LJO B;  1E5W A;  3ECI A;  5AEK B;  1YX6 B;  3A9J B;  2JY6 A;  5LXI B;  4IM0 A;  2KZR A;  3I3T B;  3KH0 A;  5FR6 A;  4MGZ E;  1MG8 A;  3SDL C;  1GUA B;  3V62 A;  2FCQ A;  4NAW B;  2GBN A;  2RSU A;  1EF1 A;  1SIF A;  4GIV A;  2J0M A;  4LDT B;  3PLV A;  3RZW C;  3TMP B;  4DDG D;  3A4R A;  2KDB A;  4BKT A;  3D32 A;  3H7P A;  4HWI B;  3PSE B;  3N32 A;  3TBL D;  2MWS B;  4KVG B;  2CHW A;  4AJW A;  4EFO A;  4HPL B;  4ZRK A;  3DDC B;  3ZLZ A;  1S1Q B;  1V9J A;  4WWP A;  4CHK A;  3ZVV A;  1WH3 A;  4TUU A;  5JH5 C;  4II2 B;  3NZS A;  5LLI A;  3JSV A;  3R7Q A;  3BIN A;  3PV1 A;  2K8H A;  3PT2 B;  4FUL A;  2JPH A;  4RM8 A;  1YX5 B;  2CKH B;  4BOS C;  1UEL A;  2WYQ A;  2NCN A;  1HE8 A;  3A9J A;  1A5R A;  4KV2 A;  3NHE B;  1WZ3 A;  1NBF C;  2GMI C;  4B6W A;  2KDE B;  2MBE A;  4IC7 B;  1WYW B;  4ZRI A;  2L00 B;  1WM3 A;  3X0W A;  4NAW A;  2DZM A;  2N7D A;  2N9P C;  3APD A;  3VAW A;  2DYB A;  2FCS A;  2CHX A;  3HM6 X;  4NQK E;  5L83 A;  2NR2 A;  3IHP C;  3EC8 A;  2IO0 B;  4BBN F;  4W9J A;  1P9D U;  2MBO A;  2KFK A;  2RPQ A;  4JQW C;  4NY0 A;  3PRZ A;  2Z59 B;  1I42 A;  1E8X A;  4AP4 C;  4AWJ A;  5CTR C;  1L7Y A;  2L8J A;  3JYU A;  3WAO A;  4NJ7 A;  3A9K B;  4HLE A;  1SE9 A;  1V2Y A;  3A33 B;  2KLG A;  3W1S C;  3S2A A;  1WGD A;  4ANV A;  2DAJ A;  2ZEQ A;  3H9D A;  4KZ0 A;  2AEH A;  2WX0 A;  2V1Y A;  3QX1 A;  1YJ1 A;  2B3A A;  1AAR A;  1WR6 E;  2RD0 A;  3KW5 B;  3QQ8 B;  4G0N B;  2N4F A;  2M1M A;  5DPS A;  4A20 A;  2MQJ A;  1H8C A;  2KMA A;  1UD7 A;  1E7V A;  3ALB A;  3T8M A;  2N9E B;  4IM3 A;  3QA8 A;  2WDT B;  2KTF A;  4HCN B;  5G55 A;  4EOY A;  1YQB A;  4MGI E;  4W9K A;  4ZRJ A;  2DEN B;  2K6Q A;  3WAP A;  1WIA A;  2RGF A;  3ZRC A;  3ZIM A;  3K9P B;  4DHZ B;  3C0R B;  2J0K A;  2JT4 B;  4MSQ B;  3R7R A;  4GDL B;  3UQB A;  3MJW A;  1WRD B;  3NZU A;  4G3X B;  3AUL A;  2LGY A;  3ZTD A;  4HK2 A;  2MP2 B;  1RLF A;  3QAR A;  4IW0 A;  1WX7 A;  4WQO B;  3IVF A;  4CO7 A;  4XC2 A;  1WZ0 A;  4DHZ E;  3OLM D;  1XD3 B;  3EEC A;  2FAZ A;  3U8Z A;  5CHW A;  3PRP B;  3Q3F A;  3WIM A;  2XBB C;  1TZ1 A;  3UIN B;  3LDZ E;  2D10 A;  1V5T A;  1WF9 A;  2MRP A;  2ZNV C;  3A9K A;  4TQ1 A;  3M3J A;  2IZV B;  2DYM A;  4LCD E;  4DK5 A;  2O2V B;  3DVG Y;  4W9F A;  3EHV A;  2JVC A;  2NPT B;  3V6E B;  3CST A;  2KK8 A;  1X1M A;  2N7E A;  3GZN I;  2V4L A;  3PHX B;  2JUO A;  4HXD A;  1NDD A;  4KSL C;  1WGG A;  4W9L A;  4G50 A;  2G4S A;  4WWO A;  1ISN A;  3M95 A;  1UZX B;  3PLU A;  3PTF C;  2PE6 B;  3VHT C;  1J19 A;  2ZCC A;  4AUQ C;  3PZD A;  1WX9 A;  4EKU A;  2D2Q A;  4JGH B;  3B0A A;  4FJV B;  1UH6 A;  3AXC A;  4GDL A;  2LGX A;  4XZ4 A;  2G3Q B;  3ML8 A;  3VTU A;  1LQB A;  2AYO B;  3H6N A;  2A5U A;  1V80 A;  1RFA A;  2L76 A;  2MP2 A;  4M8N A;  1XT9 B;  5JHA A;  1WM2 A;  1V86 A;  3DBS A;  2BWE S;  1Q5W B;  2M17 A;  4FN2 A;  5KHO A;  2LI5 A;  3IFW B;  3M63 B;  3B08 A;  3ZUN A;  1VD2 A;  4HDQ A;  5TR5 A;  5J2R A;  1KLV A;  3ZNI D;  4B95 A;  1KOT A;  4GOC A;  2KFJ A;  2M4N A;  4BKS A;  3V6C B;  4A3P A;  3A1Q A;  3ZRF A;  3AU5 A;  4F8C B;  3OJ3 A;  2NPT A;  2BYF A;  3DCG A;  2Z0E B;  4GU2 A;  4GMV A;  3RUL A;  4DWF A;  3RUI B;  2K8C A;  1D3Z A;  3VUX A;  2O6V D;  1TTN A;  2GOW A;  2JXX A;  2ZNV B;  2BPS A;  1V6E A;  1R4M I;  4IM2 A;  4FHK A;  4ICV A;  3W1S A;  4J6I A;  3CF6 E;  4PS3 A;  2OJR A;  3WAM A;  2HD5 B;  4G11 A;  2L05 A;  4W9D A;  3DQV A;  3N30 A;  4FHJ A;  2KWU B;  1JRU A;  3Q3J A;  1WI0 A;  2L0T A;  1P98 A;  2BGF A;  3PRM B;  2DZJ A;  2KWV B;  4E74 A;  2N1W A;  4CYE A;  4GSW A;  3CMM B;  4W9C A;  3VXW A;  5DPW A;  2KD0 A;  1GG3 A;  4MGY E;  4JLC A;  2KMC A;  2IO1 B;  2IY0 B;  4GDK B;  3A4S C;  4ZDV A;  3W1Y A;  5C1Z A;  3PPA A;  4HJK A;  3RCZ A;  2BKR B;  2C7H A;  2JWZ A;  1CMX B;  2JZZ A;  2REX A;  3QC8 B;  4MDK E;  2KVR A;  4II3 B;  1J0G A;  1G6J A;  2BWF A;  3U30 A;  4NQL B;  4DBG A;  3KUZ A;  3ZDT A;  2MCN B;  5D6J B;  4DXA B;  2D07 B;  2YLM A;  1OTR B;  4JIO U;  4M0W B;  4W9I A;  2RR9 A;  2LXA A;  3PGE A;  4ZYN A;  4RM9 A;  5JHB A;  1S3S G;  2DYO A;  2PJH A;  2ZPN A;  1IPG A;  2L0F A;  2FCN A;  3KVF B;  3QAQ A;  4TV3 A;  3OJ4 B;  2G4D B;  4ANW A;  2MBH A;  3L0W B;  4KIK B;  2GBR A;  3DVN V;  2V3S A;  5C23 A;  1V5O A;  2IO2 B;  3VDZ A;  4BFR A;  2A4Z A;  4P7I A;  3VTW A;  2LZ6 A;  2KLC A;  2CS4 A;  2CHZ A;  2KQS A;  1WY8 A;  2NS5 A;  2W9N A;  4PS7 A;  2LWP A;  4FAD A;  4GDK A;  4M8M A;  4W9H A;  2ZCB A;  2C7N B;  1C1Y B;  2K8B A;  2PE9 A;  2UYZ B;  2KHW B;  3AI5 A;  2KOX A;  4DDI D;  2J7Q B;  2JRH A;  3MHS D;  5BO4 B;  2NVU I;  5CX3 A;  1T0Y A;  4I6P A;  3APC A;  2UWQ A;  1P0R A;  2KN5 A;  2LRU A;  3PHW B;  1K8R B;  3EFU A;  4E3C A;  4BOZ B;  4EZL A;  3KYD D;  5HKH A;  3R66 C;  4MH0 E;  3VH3 B;  4EUT A;  4MGK E;  2OOB B;  2C9W B;  3OAW A;  4DHJ D;  2J0J A;  2KX3 A;  1I35 A;  1F9J A;  4BBN C;  1WJ4 A;  4RMA A;  5J17 A;  3ZO5 B;  2AL3 A;  1E8Z A;  1KM7 A;  3T9L A;  2IO3 B;  1ZW7 A;  5E6O A;  3ZNZ B;  4KIK A;  1R4N I;  4A3O A;  2IY1 B;  4ASW C;  1Q0W B;  4HPM B;  2LD9 A;  2LRW A;  2BKF A;  3ZNH B;  2JRI B;  4FLH A;  3ZNG C;  1QZE A;  2HE7 A;  4OVU A;  4ANX A;  1IYF A;  5L95 C;  2GBJ A;  2LVQ A;  2MLB A;  4LJP B;  4EEW A;  2N1V A;  1M94 A;  3ENE A;  5IAA C;  3VVW B;  1WFY A;  3DOW A;  3DVN U;  2C5L C;  2G45 B;  2NBU A;  3VQI A;  1OEY A;  3RD2 A;  1E8Y A;  1LXD A;  4WJQ A;  4FBJ B;  1GC6 A;  2R2Q A;  2PEA A;  1ZKH A;  2I1K A;  2GBM A; 
#chains in the Genus database with same CATH topology
 2KC1 A;  1Q10 A;  2GRI A;  1P7F A;  5IN7 A;  1HXY D;  2AL6 A;  1T3Q A;  2O6V B;  1FFV A;  5D2M B;  4FXC A;  1HZ5 A;  4GN1 A;  2CU1 A;  3IG3 A;  1XEE A;  4OHJ A;  4F7Z A;  3BII D;  2C7M B;  4KZC A;  2WWZ A;  3RZF A;  3ML9 A;  4YXD B;  3LJ3 A;  2I1J A;  4E71 A;  3UIO B;  4OVV A;  5FR3 A;  2KJ6 A;  4AJY B;  2CU3 A;  3ZTC A;  3ZYY X;  3GOE A;  4MEM A;  2XNA C;  4A8X C;  3GS2 A;  1JAL A;  3GP7 A;  4K7S A;  3R2I A;  1Q1O A;  1YQ3 B;  4LDT D;  3WCQ A;  1YOV B;  1YD8 U;  1N60 A;  2MBB B;  3DBH I;  2KQ4 X;  4P1B C;  2DX5 B;  3QIJ A;  4WH4 A;  1D5Z C;  3RI7 C;  5D7G A;  3CWI A;  3VUY A;  3L54 A;  2HJ1 A;  2JZ3 B;  1WMH A;  3H1U A;  5FKA C;  2INP E;  3X23 A;  5DPR A;  4ARC A;  4ACF A;  4L1B A;  2K22 A;  1RWS A;  3DVG X;  2BYE A;  5IA7 A;  4MSM B;  3NOB A;  1GC7 A;  2ZPY A;  1LO5 D;  2M0X A;  3JW0 X;  4DHJ B;  2VZK B;  2BBC A;  1NYQ A;  4J3O D;  2KDF B;  5AZH A;  4DQO C;  4P1C C;  1YJJ A;  2K39 A;  4K7W A;  2QJL A;  1H4R A;  3EGR A;  1WJ6 A;  2JYT A;  1KRH A;  1T5X D;  2PIA A;  4GB9 A;  1OGW A;  3DWG C;  1MVK A;  4H2A A;  3UQA A;  5G5H A;  4HKQ A;  5HI1 A;  2KAN A;  2DBY A;  1WXA A;  4BKG A;  2KQ7 A;  3ABV B;  3A1Q B;  2WLB A;  4NAM A;  2IBI B;  1NI2 A;  1OQY A;  5J18 A;  1WYG A;  3H7P B;  4LNO A;  4HVB A;  1GNU A;  1E90 A;  3TCA A;  1K53 A;  2PMV A;  1EO6 A;  4HKZ E;  4YWG G;  1TBE A;  1UBI A;  3UF8 A;  3P2B A;  2Y5P A;  4X57 B;  2LUE A;  1LFD A;  1V1P B;  1FXI A;  1JWU D;  3VUW A;  1KJT A;  2E6X A;  4LJO B;  3ZQ4 A;  5AEK B;  1YX6 B;  2VH1 A;  2B76 B;  5FR6 A;  3TEW A;  4C7Z A;  1PGA A;  4DXF A;  5E6J A;  3AM9 A;  3RZW C;  3TMP B;  1UNS A;  5C2T B;  2KDB A;  2I38 A;  5H92 C;  5T8I A;  4HWI B;  1HTO A;  4EFO A;  4ZRK A;  4ZHO A;  4CHK A;  5BMG A;  3NZS A;  4RF0 A;  3BIN A;  2JPH A;  3AV8 A;  4RM8 A;  1YN4 A;  2WYQ A;  3A9J A;  1A70 A;  2XN9 C;  1NBF C;  4B6W A;  3VAW A;  2FCS A;  4LNN A;  3B2F A;  4BBN F;  2PLP A;  1P9D U;  4NY0 A;  3HRD D;  2L8J A;  1BXT A;  4NJ7 A;  3A9K B;  4ANV A;  2DAJ A;  3ZGZ A;  2V1Y A;  4HJG E;  4G0N B;  4RF1 A;  2N4F A;  2KMA A;  3ALB A;  4RGN A;  1YQB A;  5JZE B;  3WAP A;  4DHZ B;  3C0R B;  4MSQ B;  3UQB A;  1XO3 A;  2LGY A;  5LNK 1;  1XLO A;  1ZP0 B;  1RLF A;  1K51 A;  4WQO B;  4CO7 A;  2ZW0 A;  3EEC A;  2FAZ A;  3U8Z A;  2K5P A;  1TIF A;  5CHW A;  2KDM A;  3WIM A;  3UI3 A;  2QMT A;  1TZ1 A;  4JWU C;  3NJT A;  3TEY A;  3LB8 C;  5IO9 A;  5BYQ A;  2ZNV C;  2WXN A;  2DYM A;  4DK5 A;  2O2V B;  2JVC A;  2NPT B;  2V4L A;  3PHX B;  2JUO A;  4KSL C;  2G4S A;  4WWO A;  2PE6 B;  1T0S C;  4FJV B;  1UH6 A;  4GDL A;  2LGX A;  2RDB C;  2AYO B;  3H6N A;  3ETR A;  1V80 A;  3DBL B;  1WM2 A;  3DBS A;  2BWE S;  2M17 A;  1E7P B;  5KHO A;  2LI5 A;  2RMM A;  3IFW B;  3B08 A;  3ZUN A;  4HDQ A;  4YSZ B;  4B0M A;  1KOT A;  2KFJ A;  1D5M C;  2L52 A;  4A3P A;  3A1Q A;  3FC4 A;  2BYF A;  2X38 A;  1V97 A;  2PVG C;  2Z0E B;  4GU2 A;  4GMV A;  3RUL A;  1VZ7 A;  4DWF A;  4WWM A;  1QOB A;  2K8C A;  4Q2J A;  3RNA C;  4RFB A;  2GOW A;  2JXX A;  1JRO A;  1IBX B;  1V6E A;  1Y56 A;  3BK1 A;  2G9H D;  3CF6 E;  2HD5 B;  4AS1 A;  1IGD A;  3FIL B;  3Q3J A;  2BGF A;  2DZJ A;  4WIP A;  2N1W A;  4CYE A;  4GSW A;  3URY A;  4JLC A;  3C19 A;  3VR9 B;  1HQR D;  3E9S A;  3RCZ A;  4NJC A;  1NEN B;  1C76 A;  2JWZ A;  4YTP B;  1CMX B;  2JZZ A;  2REX A;  5G5G A;  3P4P B;  1G6J A;  1J0G A;  3U30 A;  1LGR A;  4C4V B;  3HUI A;  4ZYN A;  4M0W B;  3PGE A;  2NMQ A;  1SE2 A;  4C7Y A;  3QAQ A;  1ZDV A;  3L0W B;  4LTU A;  3DVN V;  2V3S A;  1V5O A;  2BS4 B;  2IO2 B;  3VDZ A;  2NS5 A;  2KQS A;  3KWL A;  4W9H A;  2KT7 A;  1MHH E;  4XWW A;  3DHI C;  5BYS A;  5CX3 A;  3APC A;  4MH8 A;  1P0R A;  3IT6 B;  2IGH A;  3EFU A;  1B1Z A;  4EZL A;  3KYD D;  4UDU C;  5IP4 D;  1I4P A;  3P1M A;  2C9W B;  2V3P A;  1TYG B;  1I35 A;  4BBN C;  1WJ4 A;  3U4E G;  3T9L A;  4KIK A;  4KKJ A;  4HPM B;  4LLG M;  3PZ8 A;  2M0A A;  2WP9 B;  1JCK B;  5L95 C;  5BYR A;  2MLB A;  3MC8 A;  4LJP B;  3VVW B;  2W3R A;  3DVN U;  1VJK A;  1OEY A;  4OZC A;  1ET9 A;  4LNF A;  2I2Y A;  1GC6 A;  2WXQ A;  4D2K A;  1FPY A;  2FIF A;  2NBV B;  4URK A;  2KKC A;  2FCM A;  1I7H A;  3GE8 C;  1RRB A;  2BB5 A;  3SFE B;  1SB3 C;  1JWM D;  1IP9 A;  4BVU C;  1E7U A;  4IWP A;  2MSE D;  3KYC D;  2O2V A;  3VTV A;  5E6P A;  2CJN A;  3JSV B;  2GLS A;  2DZI A;  1Z2M A;  2WNM A;  4PS8 A;  5E6N A;  1EU3 A;  5D3D A;  4WJP A;  2K25 A;  3BYY B;  2BYV E;  3IBE A;  1ZUD 2;  2PTL A;  2C60 A;  4IG7 B;  3SU8 X;  1EF5 A;  1ENF A;  1VZ8 A;  1WMH B;  2E3T A;  3M62 B;  1TKE A;  4HCP B;  2WXF A;  4F1S A;  1OFF A;  3TJP A;  3ZW3 A;  2LGI A;  1KH0 A;  4FJY A;  4B0E A;  1I4G A;  2KFK B;  1WXQ A;  4TKN A;  5CHV C;  3SD5 A;  5BMH A;  3T3N A;  2VH2 A;  2EKI A;  2LXC A;  1E9M A;  1T6B X;  2JYE A;  3Q8F A;  4YTN B;  3QHT A;  2M8S A;  3DBR B;  3HM3 A;  1ZGU B;  2K1F A;  3BVM A;  3SFD B;  3O65 B;  3DPD A;  3H7S A;  3OWE B;  4TQ0 A;  4I6N B;  1YIW A;  2JX5 A;  1TGZ B;  5LXH A;  3WAL A;  4RNA A;  3V60 A;  4MAC A;  2N9K A;  2EKE C;  2M56 B;  4A6Q A;  4A55 A;  2KNB A;  1GJZ A;  3NS8 A;  3ZJV A;  1NYR A;  3UGB B;  2BYT A;  3OG5 A;  2XK5 A;  3L17 A;  2ICI A;  1WGR A;  3N1Y C;  2LEK A;  4B9K A;  4WJN A;  2XEW A;  1V81 A;  1L4Z B;  4NJ6 A;  1L2N A;  4RH6 A;  1FXT B;  1WGY A;  4RCO A;  1N6Z A;  3TL5 A;  2HTH A;  4ARI A;  2DHZ A;  1NVI D;  2JZP A;  2KAJ A;  1PYW D;  4MM3 A;  2KTR A;  1MFW A;  1HA5 A;  3UIP B;  1BT0 A;  3L10 B;  1BML C;  4YSX B;  3APF A;  3PVL A;  4WWN A;  3QWZ B;  3P4Q B;  3SR6 A;  4IUM B;  2MH7 A;  4OW0 A;  1EUV B;  2K6D B;  3ZKJ C;  3CSF A;  2Y5B B;  2AWT A;  4MJS A;  3DBL I;  4N6E B;  3A9J B;  3ZJT A;  1FD6 A;  2KZR A;  4MGZ E;  3V62 A;  2RSU A;  1CK1 A;  3Q3N C;  4GIV A;  2J0M A;  4LDT B;  3PLV A;  3N32 A;  2MWS B;  2CHW A;  2WDR B;  4HPL B;  3DDC B;  1S1Q B;  4P6V F;  4WWP A;  1QOF A;  2EEL A;  2K0P A;  5LLI A;  1FXA A;  1VR9 A;  3JSV A;  3AEF B;  3PT2 B;  1ZXI A;  1YX5 B;  3LXF A;  1UEL A;  1STE A;  2NCN A;  3NZ3 A;  2K9X A;  1ZDX A;  4IC7 B;  1MI0 A;  2L00 B;  1WM3 A;  3X0W A;  2DZM A;  3APD A;  2CHX A;  3HM6 X;  3IHP C;  3U7Z A;  2MBO A;  2KFK A;  2Z59 B;  3WAO A;  1GB1 A;  4P16 A;  1P7E A;  3A33 B;  1V2Y A;  3H9D A;  4KZ0 A;  2AEH A;  1YJ1 A;  2QCZ A;  1AAR A;  1WR6 E;  2RD0 A;  3KW5 B;  5DPS A;  2M1M A;  4A20 A;  1H8C A;  5G55 A;  4EOY A;  3RNF C;  2RGF A;  3KQ4 A;  1JWS D;  1R7S A;  3R7R A;  4GDL B;  1WRD B;  2AQ1 B;  4YSY B;  4G3X B;  5GXG B;  1EM7 A;  3ZTD A;  3QAR A;  1WX7 A;  2BTE A;  4XC2 A;  4N59 A;  2W55 A;  2G1E A;  3IAM 1;  2WXG A;  2XBB C;  3H8H A;  5C3J B;  4PT5 A;  3BZD B;  1V5T A;  2MRP A;  3DHH C;  2H88 B;  1NEK B;  3DVG Y;  4W9F A;  2LHE A;  3V6E B;  2H89 B;  3GZN B;  2KK8 A;  2INN E;  3SEB A;  5EE3 A;  1ZE3 D;  1OQQ A;  1WGG A;  3HVD A;  3M95 A;  3RFZ B;  2OJW A;  3AE2 B;  2ZCC A;  2Z8L A;  2WXI A;  1WX9 A;  4EKU A;  4JGH B;  3B0A A;  2R61 A;  4XZ4 A;  3VTU A;  3NUH B;  2A5U A;  2L76 A;  2MP2 A;  4M8N A;  4DXG A;  1Q5W B;  2MJE A;  3M63 B;  1VD2 A;  5TSS A;  5J2R A;  1KLV A;  1SEB D;  5I4D A;  3Q69 A;  3OJ3 A;  2AX5 A;  3DCG A;  4C56 C;  3NS1 A;  2V4I B;  1R4M B;  2ZNV B;  3PO0 A;  1TS3 A;  4IM2 A;  2MJ3 A;  3Q8B A;  4ICV A;  1JML A;  2OJR A;  3WAM A;  4QAY A;  4W9D A;  4R3D A;  1YJI A;  1FRR A;  3DHG C;  3PRM B;  4W9C A;  1ET6 A;  3AEB B;  2KD0 A;  5EE9 A;  2KMC A;  1C78 A;  4OVZ A;  1C4A A;  3NG0 A;  3PPA A;  4HJK A;  3Q6B A;  1TS2 A;  2KVR A;  2BWF A;  2M19 A;  3IXS A;  3O13 A;  4KKI A;  2YLM A;  1TJE A;  4JIO U;  4L23 A;  2LXA A;  2BB6 A;  5JHB A;  3AE5 B;  3RPF C;  2ZPN A;  3KVF B;  4XGA B;  3NVY A;  4KIK B;  2GBR A;  3PZ7 A;  5C23 A;  4A90 A;  4BFR A;  1XCQ L;  2A4Z A;  2LZ6 A;  4USA A;  2CS4 A;  2CHZ A;  1UGJ A;  1WY8 A;  4PS7 A;  3NVV A;  2C7N B;  2KHW B;  3MHS D;  2NVU I;  1DGJ A;  4I6P A;  3W5V B;  3TEX A;  2HTM E;  1HTQ A;  4E3C A;  3R66 C;  1KFY B;  4MGK E;  3GE3 C;  1F9J A;  2YEP F;  2AL3 A;  1KM7 A;  1YN3 A;  5HG2 A;  5E6O A;  3AE3 B;  1JRP A;  1R4N I;  4A3O A;  2IY1 B;  1Q0W B;  2QIL A;  1SF0 A;  2BKF A;  2QSD A;  4FLH A;  4M01 A;  3ZNG C;  4HRO A;  4ANX A;  2HE7 A;  4OZA A;  2LVQ A;  1TY0 A;  1M94 A;  2GI9 A;  1WFY A;  1D5X C;  2C5L C;  3RD2 A;  1E8Y A;  1LXD A;  3MJ5 A;  4WJQ A;  4FBJ B;  1N5X A;  1L4D B;  1GB4 A;  3TUO A;  3E56 A;  4KGS A;  1LM8 B;  5AZG A;  3Q3M C;  1J7B A;  1TT5 B;  4BKS D;  1FFU A;  2YVC A;  4EZK A;  4F8C B;  2WU2 B;  3HK0 A;  4GXB A;  2BF8 B;  3WAN A;  1XLN A;  3VFK A;  4KX6 B;  1L0V B;  2N9X A;  3L13 A;  4KSK C;  1N62 A;  1CQV A;  2J53 A;  4REZ A;  1ACC A;  2LJ5 A;  1HEZ E;  5EDS A;  1J8C A;  3AE1 B;  2MEK A;  1WJN A;  1E8W A;  4FA6 A;  1F1H A;  4W9E A;  1VCB A;  4AOF A;  3MHZ A;  4M02 A;  2ZZP B;  1PFD A;  2L3Z A;  3QCA A;  1WX8 A;  2MA9 B;  4K7U A;  1FRD A;  1GOZ A;  1WXV A;  3JVZ X;  4WAA A;  4XDD A;  2MX2 A;  1ZXH A;  3DBH B;  2KO3 A;  2KJH B;  3AE9 B;  2XK5 B;  1MG4 A;  3TIX A;  2D3G A;  2Q5W D;  3IAS 1;  3PRE A;  1WXM A;  5DCN A;  2J42 A;  2KDI A;  3EA6 A;  3NY5 A;  3NRZ A;  3GB1 A;  2KC2 A;  4ANU A;  3ZXR A;  1WXS A;  2JWU A;  1F52 A;  2L7R A;  3RMK C;  1PGX A;  3T3O A;  1WRI A;  4ZYS A;  5AUI A;  3RNG C;  1EWC A;  4K81 A;  2UU7 A;  1J7A A;  3P4R B;  3I63 C;  1K50 A;  3WA0 A;  1WGK A;  4S17 A;  1B9R A;  2ZJD A;  2HJ8 A;  5D94 A;  4M00 A;  4MM3 B;  2KTR B;  2JSV X;  1Y8R C;  4YTM B;  3I5J C;  2MBQ A;  1J7C A;  2NTS A;  2R2O A;  5MPO A;  3HHM A;  1BUI C;  2J4X A;  1C9F A;  1C3T A;  2LMC A;  4MJS B;  2KX0 A;  4HEA 1;  4XE0 A;  4IWO A;  2ZVN A;  4MEL A;  4EZJ A;  1E10 A;  2MW5 A;  1RM6 C;  3I9V 1;  1M4V A;  3L08 A;  3RYT A;  2Y5C A;  2D5G A;  3KUC B;  1XQQ A;  3Q2A C;  1XF5 L;  2JF5 A;  3V05 A;  1MPE A;  2LVP A;  1UGM A;  4NPN A;  5DPT A;  2KJR A;  2DAF A;  3VH4 B;  4WJO A;  1QT9 A;  1P1A A;  3BYT B;  2WXO A;  3R8B A;  3MC0 B;  3SHQ A;  3QK0 A;  3N3K B;  1E5W A;  3ECI A;  4ITK A;  2WHI A;  5LXI B;  4IM0 A;  4S0R A;  3I3T B;  1SXT A;  3KH0 A;  1I4Q A;  1GUA B;  2FCQ A;  1L5P A;  2GBN A;  1EF1 A;  1SIF A;  4DDG D;  4NZL B;  3A4R A;  4IKG A;  1FMA D;  2WXP A;  1GPX A;  1PDX A;  1FEH A;  1V9J A;  3Q3O C;  5JH5 C;  1QQR A;  1TKG A;  1QLB B;  3R7Q A;  2K8H A;  2CKH B;  4MT5 A;  4US8 A;  1A5R A;  4KV2 A;  1WZ3 A;  4RGM A;  2GMI C;  1SJH D;  1WYW B;  4NAW A;  2KN4 A;  2N9P C;  3EFC A;  3P63 A;  2DYB A;  2NR2 A;  3EC8 A;  2J52 A;  4JQW C;  1AYF A;  1I42 A;  2IJ0 A;  5CTR C;  4AWJ A;  3JYU A;  4A9A A;  2DNF A;  5D3I B;  2ON8 A;  1IUE A;  1WGD A;  2ZEQ A;  2WX0 A;  2B3A A;  4PK1 A;  2MQJ A;  3W5U B;  1E7V A;  1QKZ A;  2KTF A;  4HCN B;  2LFI A;  4MGI E;  4W9K A;  2DEN B;  2K6Q A;  1WIA A;  3K9P B;  4JPS A;  2JT4 B;  2AQ2 B;  2FE8 A;  4HK2 A;  2MP2 B;  1YNT E;  4IW0 A;  3IVF A;  1WZ0 A;  3OLM D;  1SSN A;  1XD3 B;  3PRP B;  3RNB C;  1JQ4 A;  2D10 A;  1DOI A;  2W54 A;  1DOX A;  1GAQ B;  3N9Y C;  4LCD E;  2FBW B;  1N61 A;  3EHV A;  4ZRP A;  1NDD A;  2PVO D;  1ISN A;  1UZX B;  1V1O A;  3VRB B;  3VHT C;  3TEZ A;  4AUQ C;  3P42 A;  3PZD A;  1F0Z A;  4N58 A;  1FIQ A;  2D3A A;  3ML8 A;  2N7J A;  3ZJU A;  2W3S A;  1RFA A;  5JHA A;  2MJD A;  1V86 A;  4FN2 A;  2QIE B;  1FNW A;  5TR5 A;  2PKO A;  2GB1 A;  4GOC A;  1FCL A;  2WDV B;  3J9C A;  3AU5 A;  2V3N A;  4ZRQ A;  1XLQ A;  3RUI B;  2IND C;  4YT0 B;  1D3Z A;  2HDE A;  2O6V D;  3CIR B;  2PW9 A;  2BPS A;  2WXK A;  1L0Y B;  2WXR A;  4J6I A;  2BS3 B;  4G11 A;  2L05 A;  1F2R I;  3N30 A;  4FHJ A;  2KWU B;  1TKY A;  1JRU A;  1UWM A;  2L0T A;  1P98 A;  2AQ3 B;  2KWV B;  3CMM B;  3VXW A;  5DPW A;  5IKC M;  2IGD A;  4LNI A;  2IO1 B;  2IY0 B;  4ZDV A;  3W1Y A;  5C1Z A;  1IGC A;  2BKR B;  2TSS A;  4MDK E;  1JW9 D;  2BQQ A;  3I57 A;  4DBG A;  1MHX A;  1DYQ A;  4DXA B;  1UUP A;  1AWD A;  4W9I A;  2RR9 A;  1SJE D;  5FK9 C;  2X8X X;  1S3S G;  2PJH A;  1XXG A;  1UF0 A;  2MBH A;  1VLB A;  4O1N A;  2L1A A;  3FAH A;  3KWV A;  3BK2 A;  4C80 A;  2KLC A;  1HZ6 A;  3FKY A;  2ACZ B;  4GDK A;  4M8M A;  4US9 A;  1C1Y B;  1C79 A;  3AI5 A;  1AW7 A;  4DDI D;  2L83 A;  4RGO S;  1C77 A;  2UWQ A;  5EE1 A;  2KN5 A;  1K8R B;  4BOZ B;  3VH3 B;  2OOB B;  5EE0 A;  4DHJ D;  2J0J A;  2VZK D;  1SIJ A;  1FCC C;  1KLU D;  2KAC A;  5J17 A;  1E8Z A;  3ZNZ B;  2LGS A;  4ASW C;  1RFK A;  2KYW A;  2LD9 A;  2LRW A;  4BAX A;  2JRI B;  2KWD A;  2LUM A;  2KMM A;  1IYF A;  3AEC B;  2L32 A;  4CQN A;  4EEW A;  2N1V A;  3ENE A;  5IAA C;  2G45 B;  3MC9 A;  3VQI A;  2IGG A;  1KLG D;  1I4R A;  1QF6 A;  2R2Q A;  2I1K A;  3U52 E;  2JQR B;  1SBB B;  1RYJ A;  4I6L B;  3BVZ A;  4ZOH C;  5GMV A;  5HHD G;  3AEE B;  3R3M A;  1QIL A;  3AN1 A;  3B1L X;  4ICU A;  2FID A;  2KWC A;  4NNJ B;  1TS5 A;  2D11 A;  2ZVO A;  1V49 A;  3L4P A;  4JWS C;  1SGH A;  3ONS A;  2NBW B;  1VRA B;  2FUH B;  2LAS A;  1TY2 A;  4LK0 M;  2ASQ A;  4GGQ A;  4KGT A;  1WR1 A;  1WE7 A;  2D3B A;  2RDG A;  3K9O B;  4IWQ A;  1TS4 A;  3TSS A;  2KXJ A;  3AE6 B;  4K1R B;  1KF6 B;  1WE6 A;  1OQR A;  3BY4 B;  2O6V A;  4HPP A;  1WGH A;  4K3B A;  2LVO A;  3BVG A;  2DZK A;  2IYD B;  3DWM A;  4XX5 A;  2DLB A;  3HIZ A;  2N9L A;  5AZF A;  4OZB A;  2RPV A;  2Z0D B;  4JL9 A;  3C8Y A;  4HRS A;  2GBK A;  3VR8 B;  4XWT A;  2FNJ B;  2WGS A;  2LHD A;  2WXJ A;  3DBR I;  4KDI C;  4RGT A;  1UBQ A;  4XDC A;  3EUB 2;  3P4S B;  1VZ6 A;  3AU4 A;  2BT6 A;  2IPK D;  3V61 A;  4PYU A;  3PS6 A;  3AMZ A;  2OED A;  1DOY A;  3AED B;  3L16 A;  1WJU A;  5AUK A;  2VRR B;  2DWQ A;  4FJZ A;  1RAX A;  1EU4 A;  1Z5S B;  4W9G A;  3HVZ A;  3MTN B;  1P3Q U;  4AQ7 A;  4N9F 4;  3RT3 B;  2LGD A;  3NVZ A;  1PQS A;  1U4A A;  2WXH A;  2BS2 B;  4WQM A;  4LNK A;  4YL8 A;  5G2N A;  2V9H A;  2EMS A;  2QC8 A;  4KDL B;  1XLP A;  1C4C A;  2QHO A;  2N0S B;  2SAK A;  1I4H A;  1L0X B;  3Q8C A;  4PYZ A;  5KHQ A;  2PPH A;  3QJZ A;  2CR5 A;  1I4X A;  1JWA D;  3VRA B;  4HDO A;  3ZDM C;  2V0G A;  2EMT A;  3KUD B;  1FM0 D;  1SE4 A;  4GLS C;  1KTK A;  3U7D A;  2WX1 A;  1OEY J;  2BW2 A;  3N1Z C;  1C4P A;  1T0Q C;  1E0Z A;  2K3U A;  1T0R C;  5JXV A;  4WUR A;  2ONQ A;  3B9J A;  5CHF A;  2KVZ A;  1ZPS A;  2JY6 A;  1N63 A;  4ZHP A;  2QDF A;  1MG8 A;  3SDL C;  1K52 A;  3KLS X;  4NAW B;  2OHF A;  2WU5 B;  2RDH A;  4C00 A;  1FNV A;  2FUG 1;  4BKT A;  1TZO A;  3D32 A;  3H7P A;  3PSE B;  3R2T A;  3TBL D;  4KVG B;  4AJW A;  2WXM A;  3ZLZ A;  3ZVV A;  1WH3 A;  4TUU A;  4II2 B;  1FNU A;  1EWY C;  3PV1 A;  4FUL A;  1V1P A;  4BOS C;  2CJO A;  3AH7 A;  1YN5 A;  1HE8 A;  3NHE B;  1YMH E;  3LYY A;  1D4B A;  1L6U A;  2KDE B;  2MBE A;  4ZRI A;  2N7D A;  4NQK E;  1CJE A;  2JU6 X;  5L83 A;  2YEP B;  2WXL A;  2IO0 B;  4W9J A;  2RPQ A;  2INC C;  3PRZ A;  1E8X A;  4AP4 C;  1L7Y A;  3NVW A;  4HLE A;  3Q8A A;  1SE9 A;  1CZP A;  2KLG A;  3W1S C;  3S2A A;  3AE8 B;  1L6V A;  3QX1 A;  1JWB D;  3QQ8 B;  1UD7 A;  3T8M A;  2D3C A;  2N9E B;  4IM3 A;  3QA8 A;  2WDT B;  3ZRC A;  4ZRJ A;  3ZIM A;  2J0K A;  3MJW A;  1ZOY B;  3NZU A;  3AUL A;  4XYC A;  4IDI A;  4DHZ E;  1E6E B;  2MHJ A;  3Q3F A;  1D6E C;  3UIN B;  3LDZ E;  1WF9 A;  1VDV A;  3A9K A;  4TQ1 A;  3M3J A;  2IZV B;  1PGB A;  1F2R C;  3CST A;  1X1M A;  2N7E A;  3GZN I;  3AE7 B;  4HXD A;  4W9L A;  4G50 A;  1AN8 A;  3PLU A;  3PTF C;  5BMI A;  1J19 A;  3IT4 B;  3MFG A;  2NTT A;  1WWT A;  2D2Q A;  3AXC A;  1ESF A;  2ZW1 A;  2G3Q B;  3W2D A;  1LQB A;  3MP9 A;  1XT9 B;  1WSP A;  3Q8E A;  3ZNI D;  4B95 A;  1ROE A;  1QOG A;  2M4N A;  3RN9 C;  4BKS A;  3V6C B;  3ZRF A;  4IOI E;  2NPT A;  4TMA B;  1UWX A;  3AEG B;  3VUX A;  2IDY A;  1TTN A;  1N5W A;  1R4M I;  1XCT L;  3ZXV A;  4FHK A;  3W1S A;  1YQ4 B;  4PS3 A;  1NI3 A;  3DQV A;  2WS3 B;  2WDQ B;  4K3C A;  1WI0 A;  4E74 A;  2JXT A;  4JX1 C;  1GG3 A;  4MGY E;  4GDK B;  3A4S C;  3V3X A;  2W82 A;  3Q14 C;  1QOA A;  2C7H A;  3AEA B;  3QC8 B;  1PUT A;  4II3 B;  4NQL B;  4TSS A;  2LJI A;  3KUZ A;  2BVC A;  3ZDT A;  2MCN B;  4WAF A;  5D6J B;  2D07 B;  1OTR B;  1IBX A;  4RM9 A;  2DYO A;  4BZA A;  5HFY A;  1IPG A;  2L0F A;  2FCN A;  4TV3 A;  3OJ4 B;  2G4D B;  4L2Y A;  4ANW A;  3W9C B;  3FIL A;  3RNE C;  1F77 A;  3AE4 B;  3RNC C;  1SE3 A;  4P7I A;  3U2S C;  3VTW A;  2W9N A;  4FAD A;  2LWP A;  2ZCB A;  2UYZ B;  2K8B A;  2PE9 A;  5IOI A;  2WQY B;  2KOX A;  3AB5 A;  2J7Q B;  2JRH A;  5BO4 B;  4JE3 B;  1T0Y A;  4C4V A;  2LRU A;  3PHW B;  5HKH A;  4MH0 E;  4M0W A;  4EUT A;  3N20 C;  3OAW A;  2Y3A A;  2KX3 A;  4RMA A;  3ZO5 B;  2IO3 B;  1ZW7 A;  1R4N B;  3ZNH B;  4KGR A;  3B2G A;  1QZE A;  4OVU A;  5H8Y E;  2GBJ A;  4EE2 A;  3BWU D;  1MJD A;  3DOW A;  1V8C A;  3N1X C;  2NBU A;  2QEJ C;  2SEB D;  2PEA A;  1ZKH A;  1FO4 A;  2GBM A; 
#chains in the Genus database with same CATH homology
 2FIF A;  2KC1 A;  2NBV B;  4I6L B;  4URK A;  2KKC A;  2FCM A;  5GMV A;  1LM8 B;  3R3M A;  1RRB A;  3B1L X;  5AZG A;  2AL6 A;  2O6V B;  4ICU A;  5D2M B;  4BKS D;  1IP9 A;  4BVU C;  1E7U A;  2YVC A;  2FID A;  4IWP A;  4EZK A;  2MSE D;  3KYC D;  2KWC A;  2O2V A;  4GN1 A;  5E6P A;  2CU1 A;  4NNJ B;  3IG3 A;  3JSV B;  2D11 A;  3VTV A;  2ZVO A;  4F7Z A;  1V49 A;  2DZI A;  1Z2M A;  3HK0 A;  1SGH A;  2C7M B;  3ONS A;  2NBW B;  2LAS A;  2FUH B;  4GXB A;  4KZC A;  2WWZ A;  4PS8 A;  5E6N A;  4WJP A;  2ASQ A;  2K25 A;  4GGQ A;  3RZF A;  1WR1 A;  3ML9 A;  2BYV E;  2BF8 B;  3LJ3 A;  1WE7 A;  3IBE A;  3WAN A;  2I1J A;  4E71 A;  3K9O B;  2C60 A;  3UIO B;  4IG7 B;  4IWQ A;  3VFK A;  2N9X A;  4OVV A;  2KJ6 A;  3L13 A;  4KSK C;  3SU8 X;  1EF5 A;  1WMH B;  2KXJ A;  4K1R B;  3M62 B;  4AJY B;  4HCP B;  2LJ5 A;  3ZTC A;  4F1S A;  1WE6 A;  5EDS A;  3TJP A;  1J8C A;  3ZW3 A;  1WJN A;  1E8W A;  4FJY A;  4FA6 A;  4W9E A;  1VCB A;  4AOF A;  2KFK B;  3GOE A;  4MEM A;  2ZZP B;  4TKN A;  2L3Z A;  4K7S A;  5CHV C;  3BY4 B;  2O6V A;  3SD5 A;  3QCA A;  1Q1O A;  1WX8 A;  1WGH A;  4LDT D;  2MA9 B;  4K7U A;  1WXV A;  3JVZ X;  4WAA A;  1YD8 U;  2MX2 A;  2MBB B;  2LVO A;  2DZK A;  2IYD B;  4XX5 A;  2KO3 A;  2KJH B;  3DBH I;  3HIZ A;  2XK5 B;  2LXC A;  5AZF A;  2Z0D B;  2DX5 B;  2D3G A;  3QIJ A;  4JL9 A;  3TIX A;  3PRE A;  2GBK A;  1WXM A;  2M8S A;  3QHT A;  5DCN A;  5D7G A;  2KDI A;  2FNJ B;  3NY5 A;  3DBR I;  3HM3 A;  4KDI C;  3VUY A;  2KC2 A;  1UBQ A;  4ANU A;  3L54 A;  1WXS A;  2JZ3 B;  1ZGU B;  2K1F A;  2L7R A;  1WMH A;  3H1U A;  3AU4 A;  3O65 B;  3DPD A;  3X23 A;  5DPR A;  3V61 A;  4PYU A;  3DVG X;  3H7S A;  3PS6 A;  4K81 A;  4TQ0 A;  4I6N B;  1YIW A;  5LXH A;  1TGZ B;  2BYE A;  3WAL A;  5JZE B;  3V60 A;  3WA0 A;  5IA7 A;  3L16 A;  1WJU A;  2VRR B;  2ZJD A;  4FJZ A;  2EKE C;  4MSM B;  2HJ8 A;  3NOB A;  1RAX A;  5D94 A;  1GC7 A;  2KNB A;  1Z5S B;  2ZPY A;  3NS8 A;  4W9G A;  1GJZ A;  3MTN B;  1P3Q U;  2M0X A;  4N9F 4;  3RT3 B;  3JW0 X;  2KTR B;  2LGD A;  4DHJ B;  3UGB B;  2KDF B;  1PQS A;  1U4A A;  5AZH A;  1Y8R C;  2XK5 A;  3L17 A;  2MBQ A;  1WGR A;  2R2O A;  2K39 A;  4YL8 A;  4K7W A;  5G2N A;  2EMS A;  4KDL B;  1H4R A;  3HHM A;  2QHO A;  4B9K A;  4WJN A;  1WJ6 A;  2XEW A;  1C3T A;  4MJS B;  4GB9 A;  1OGW A;  1V81 A;  2KX0 A;  3UQA A;  4NJ6 A;  4IWO A;  2ZVN A;  4PYZ A;  1L2N A;  4MEL A;  1FXT B;  2PPH A;  3QJZ A;  5KHQ A;  1WGY A;  2CR5 A;  2KAN A;  4EZJ A;  1WXA A;  2MW5 A;  2HTH A;  3TL5 A;  2DHZ A;  4BKG A;  3L08 A;  3RYT A;  4HDO A;  2KQ7 A;  4MM3 A;  3KUC B;  2KTR A;  1XQQ A;  3ZDM C;  3A1Q B;  2EMT A;  2JF5 A;  3KUD B;  2IBI B;  1NI2 A;  1OQY A;  5J18 A;  2LVP A;  3UIP B;  1BT0 A;  3L10 B;  3H7P B;  4HVB A;  3APF A;  1GNU A;  1E90 A;  3TCA A;  3PVL A;  4WWN A;  3QWZ B;  1UGM A;  2WX1 A;  3U7D A;  1EO6 A;  4NPN A;  4IUM B;  1TBE A;  1UBI A;  5DPT A;  2KJR A;  3UF8 A;  3P2B A;  1EUV B;  1OEY J;  2K6D B;  2DAF A;  3VH4 B;  3ZKJ C;  3CSF A;  4WJO A;  4X57 B;  2Y5B B;  2LUE A;  1P1A A;  1LFD A;  2AWT A;  4MJS A;  3VUW A;  3SHQ A;  1KJT A;  3QK0 A;  5CHF A;  3DBL I;  3N3K B;  4LJO B;  1E5W A;  3ECI A;  5AEK B;  1YX6 B;  3A9J B;  2JY6 A;  5LXI B;  4IM0 A;  2KZR A;  3I3T B;  3KH0 A;  5FR6 A;  4MGZ E;  1MG8 A;  3SDL C;  1GUA B;  3V62 A;  2FCQ A;  4NAW B;  2GBN A;  2RSU A;  1EF1 A;  1SIF A;  4GIV A;  2J0M A;  4LDT B;  3PLV A;  3RZW C;  3TMP B;  4DDG D;  3A4R A;  2KDB A;  4BKT A;  3D32 A;  3H7P A;  4HWI B;  3PSE B;  3N32 A;  3TBL D;  2MWS B;  4KVG B;  2CHW A;  4AJW A;  4EFO A;  4HPL B;  4ZRK A;  3DDC B;  3ZLZ A;  1S1Q B;  1V9J A;  4WWP A;  4CHK A;  3ZVV A;  1WH3 A;  4TUU A;  5JH5 C;  4II2 B;  3NZS A;  5LLI A;  3JSV A;  3R7Q A;  3BIN A;  3PV1 A;  2K8H A;  3PT2 B;  4FUL A;  2JPH A;  4RM8 A;  1YX5 B;  2CKH B;  4BOS C;  1UEL A;  2WYQ A;  2NCN A;  1HE8 A;  3A9J A;  1A5R A;  4KV2 A;  3NHE B;  1WZ3 A;  1NBF C;  2GMI C;  4B6W A;  2KDE B;  2MBE A;  4IC7 B;  1WYW B;  4ZRI A;  2L00 B;  1WM3 A;  3X0W A;  4NAW A;  2DZM A;  2N7D A;  2N9P C;  3APD A;  3VAW A;  2DYB A;  2FCS A;  2CHX A;  3HM6 X;  4NQK E;  5L83 A;  2NR2 A;  3IHP C;  3EC8 A;  2IO0 B;  4BBN F;  4W9J A;  1P9D U;  2MBO A;  2KFK A;  2RPQ A;  4JQW C;  4NY0 A;  3PRZ A;  2Z59 B;  1I42 A;  1E8X A;  4AP4 C;  4AWJ A;  5CTR C;  1L7Y A;  2L8J A;  3JYU A;  3WAO A;  4NJ7 A;  3A9K B;  4HLE A;  1SE9 A;  1V2Y A;  3A33 B;  2KLG A;  3W1S C;  3S2A A;  1WGD A;  4ANV A;  2DAJ A;  2ZEQ A;  3H9D A;  4KZ0 A;  2AEH A;  2WX0 A;  2V1Y A;  3QX1 A;  1YJ1 A;  2B3A A;  1AAR A;  1WR6 E;  2RD0 A;  3KW5 B;  3QQ8 B;  4G0N B;  2N4F A;  2M1M A;  5DPS A;  4A20 A;  2MQJ A;  1H8C A;  2KMA A;  1UD7 A;  1E7V A;  3ALB A;  3T8M A;  2N9E B;  4IM3 A;  3QA8 A;  2WDT B;  2KTF A;  4HCN B;  5G55 A;  4EOY A;  1YQB A;  4MGI E;  4W9K A;  4ZRJ A;  2DEN B;  2K6Q A;  3WAP A;  1WIA A;  2RGF A;  3ZRC A;  3ZIM A;  3K9P B;  4DHZ B;  3C0R B;  2J0K A;  2JT4 B;  4MSQ B;  3R7R A;  4GDL B;  3UQB A;  3MJW A;  1WRD B;  3NZU A;  4G3X B;  3AUL A;  2LGY A;  3ZTD A;  4HK2 A;  2MP2 B;  1RLF A;  3QAR A;  4IW0 A;  1WX7 A;  4WQO B;  3IVF A;  4CO7 A;  4XC2 A;  1WZ0 A;  4DHZ E;  3OLM D;  1XD3 B;  3EEC A;  2FAZ A;  3U8Z A;  5CHW A;  3PRP B;  3Q3F A;  3WIM A;  2XBB C;  1TZ1 A;  3UIN B;  3LDZ E;  2D10 A;  1V5T A;  1WF9 A;  2MRP A;  2ZNV C;  3A9K A;  4TQ1 A;  3M3J A;  2IZV B;  2DYM A;  4LCD E;  4DK5 A;  2O2V B;  3DVG Y;  4W9F A;  3EHV A;  2JVC A;  2NPT B;  3V6E B;  3CST A;  2KK8 A;  1X1M A;  2N7E A;  3GZN I;  2V4L A;  3PHX B;  2JUO A;  4HXD A;  1NDD A;  4KSL C;  1WGG A;  4W9L A;  4G50 A;  2G4S A;  4WWO A;  1ISN A;  3M95 A;  1UZX B;  3PLU A;  3PTF C;  2PE6 B;  3VHT C;  1J19 A;  2ZCC A;  4AUQ C;  3PZD A;  1WX9 A;  4EKU A;  2D2Q A;  4JGH B;  3B0A A;  4FJV B;  1UH6 A;  3AXC A;  4GDL A;  2LGX A;  4XZ4 A;  2G3Q B;  3ML8 A;  3VTU A;  1LQB A;  2AYO B;  3H6N A;  2A5U A;  1V80 A;  1RFA A;  2L76 A;  2MP2 A;  4M8N A;  1XT9 B;  5JHA A;  1WM2 A;  1V86 A;  3DBS A;  2BWE S;  1Q5W B;  2M17 A;  4FN2 A;  5KHO A;  2LI5 A;  3IFW B;  3M63 B;  3B08 A;  3ZUN A;  1VD2 A;  4HDQ A;  5TR5 A;  5J2R A;  1KLV A;  3ZNI D;  4B95 A;  1KOT A;  4GOC A;  2KFJ A;  2M4N A;  4BKS A;  3V6C B;  4A3P A;  3A1Q A;  3ZRF A;  3AU5 A;  4F8C B;  3OJ3 A;  2NPT A;  2BYF A;  3DCG A;  2Z0E B;  4GU2 A;  4GMV A;  3RUL A;  4DWF A;  3RUI B;  2K8C A;  1D3Z A;  3VUX A;  2O6V D;  1TTN A;  2GOW A;  2JXX A;  2ZNV B;  2BPS A;  1V6E A;  1R4M I;  4IM2 A;  4FHK A;  4ICV A;  3W1S A;  4J6I A;  3CF6 E;  4PS3 A;  2OJR A;  3WAM A;  2HD5 B;  4G11 A;  2L05 A;  4W9D A;  3DQV A;  3N30 A;  4FHJ A;  2KWU B;  1JRU A;  3Q3J A;  1WI0 A;  2L0T A;  1P98 A;  2BGF A;  3PRM B;  2DZJ A;  2KWV B;  4E74 A;  2N1W A;  4CYE A;  4GSW A;  3CMM B;  4W9C A;  3VXW A;  5DPW A;  2KD0 A;  1GG3 A;  4MGY E;  4JLC A;  2KMC A;  2IO1 B;  2IY0 B;  4GDK B;  3A4S C;  4ZDV A;  3W1Y A;  5C1Z A;  3PPA A;  4HJK A;  3RCZ A;  2BKR B;  2C7H A;  2JWZ A;  1CMX B;  2JZZ A;  2REX A;  3QC8 B;  4MDK E;  2KVR A;  4II3 B;  1J0G A;  1G6J A;  2BWF A;  3U30 A;  4NQL B;  4DBG A;  3KUZ A;  3ZDT A;  2MCN B;  5D6J B;  4DXA B;  2D07 B;  2YLM A;  1OTR B;  4JIO U;  4M0W B;  4W9I A;  2RR9 A;  2LXA A;  3PGE A;  4ZYN A;  4RM9 A;  5JHB A;  1S3S G;  2DYO A;  2PJH A;  2ZPN A;  1IPG A;  2L0F A;  2FCN A;  3KVF B;  3QAQ A;  4TV3 A;  3OJ4 B;  2G4D B;  4ANW A;  2MBH A;  3L0W B;  4KIK B;  2GBR A;  3DVN V;  2V3S A;  5C23 A;  1V5O A;  2IO2 B;  3VDZ A;  4BFR A;  2A4Z A;  4P7I A;  3VTW A;  2LZ6 A;  2KLC A;  2CS4 A;  2CHZ A;  2KQS A;  1WY8 A;  2NS5 A;  2W9N A;  4PS7 A;  2LWP A;  4FAD A;  4GDK A;  4M8M A;  4W9H A;  2ZCB A;  2C7N B;  1C1Y B;  2K8B A;  2PE9 A;  2UYZ B;  2KHW B;  3AI5 A;  2KOX A;  4DDI D;  2J7Q B;  2JRH A;  3MHS D;  5BO4 B;  2NVU I;  5CX3 A;  1T0Y A;  4I6P A;  3APC A;  2UWQ A;  1P0R A;  2KN5 A;  2LRU A;  3PHW B;  1K8R B;  3EFU A;  4E3C A;  4BOZ B;  4EZL A;  3KYD D;  5HKH A;  3R66 C;  4MH0 E;  3VH3 B;  4EUT A;  4MGK E;  2OOB B;  2C9W B;  3OAW A;  4DHJ D;  2J0J A;  2KX3 A;  1I35 A;  1F9J A;  4BBN C;  1WJ4 A;  4RMA A;  5J17 A;  3ZO5 B;  2AL3 A;  1E8Z A;  1KM7 A;  3T9L A;  2IO3 B;  1ZW7 A;  5E6O A;  3ZNZ B;  4KIK A;  1R4N I;  4A3O A;  2IY1 B;  4ASW C;  1Q0W B;  4HPM B;  2LD9 A;  2LRW A;  2BKF A;  3ZNH B;  2JRI B;  4FLH A;  3ZNG C;  1QZE A;  2HE7 A;  4OVU A;  4ANX A;  1IYF A;  5L95 C;  2GBJ A;  2LVQ A;  2MLB A;  4LJP B;  4EEW A;  2N1V A;  1M94 A;  3ENE A;  5IAA C;  3VVW B;  1WFY A;  3DOW A;  3DVN U;  2C5L C;  2G45 B;  2NBU A;  3VQI A;  1OEY A;  3RD2 A;  1E8Y A;  1LXD A;  4WJQ A;  4FBJ B;  1GC6 A;  2R2Q A;  2PEA A;  1ZKH A;  2I1K A;  2GBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...