2B3AA

Solution structure of the ras-binding domain of the ral guanosine dissociation stimulator
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
87
structure length
87
Chain Sequence
DCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New insights into binding of the possible cancer target RalGDS
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ral guanine nucleotide dissociation stimulator
total genus 17
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2005-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2b3aA00
5DPSA 3L08A 4GDKB 4JL9A 1E7VA 1GNUA 4BKSD 2BYFA 3KW5B 4IC7B 1WM2A 5DPRA 3ZKJC 1M94A 3ZNZB 1LM8B 1WXSA 4F7ZA 3A4RA 4CYEA 2GBRA 3CSFA 4DWFA 3RZFA 1L2NA 3ZRFA 3JW0X 5C1ZA 2LD9A 4K7SA 4WJPA 4M0WB 2LRUA 4G0NB 4W9FA 3TCAA 2O6VB 4GIVA 3UIOB 2KWVB 2ZCCA 1Q5WB 2KXJA 5D7GA 3ZDMC 1E5WA 3QC8B 3L0WB 3WALA 4HCNB 4F8CB 2C5LC 3DBRI 1X1MA 3QHTA 1WXVA 2MRPA 1C1YB 3N32A 2KMAA 2D07B 4FHKA 2LVOA 3VAWA 5EDSA 3AU5A 2O6VA 2JRHA 2M17A 1TGZB 1HE8A 1WF9A 5IAAC 2LVPA 2JRIB 1V49A 2NR2A 2HTHA 4MJSA 2J0JA 2KHWB 2JVCA 2NBWB 2L8JA 4WWPA 3U8ZA 2RD0A 1RLFA 3DVNU 1RRBA 4WWNA 3V62A 2ZZPB 4MSQB 2IO3B 1WX8A 2NVUI 2PJHA 1LXDA 4IWQA 3TBLD 2DYMA 2KTFA 1KLVA 4K81A 4PS8A 1WJNA 4TUUA 2PE6B 2FCMA 3AXCA 3TIXA 3ZTDA 2N7EA 4BOSC 1YIWA 3JYUA 4K7UA 4W9JA 2KX3A 1XQQA 2PEAA 4JQWC 3L13A 2LRWA 3WAPA 3H6NA 4BVUC 2A5UA 3SU8X 4WAAA 1OGWA 2KDEB 1E8XA 5CHVC 4MEMA 1GUAB 2J0MA 3DVGY 3IG3A 3KVFB 3ONSA 3QQ8B 4I6LB 4WWOA 5GMVA 2KJHB 4FJYA 4MM3A 1SE9A 2CHXA 2LJ5A 2W9NA 1I35A 3MHSD 1V9JA 2RR9A 3HHMA 4KDIC 4MGZE 4FJZA 1SGHA 2B3AA 4BFRA 2G4SA 1AARA 4GDKA 5CTRC 5D2MB 1WH3A 1WRDB 2BYVE 5HKHA 2C7MB 2L05A 1WR1A 4HDOA 1LFDA 1V5OA 2VRRB 1WXAA 4F1SA 1S1QB 4P7IA 4AUQC 2KOXA 4PYUA 2JY6A 2EMSA 2FIFA 2CHWA 2FNJB 4IUMB 4OVUA 3KYDD 2V4LA 3ZRCA 4DHZB 3UQBA 3ENEA 1S3SG 2CS4A 2C9WB 2I1KA 3M3JA 3NOBA 4FA6A 4GGQA 3PS6A 3WIMA 4G50A 4WJOA 1IYFA 2NBVB 3OLMD 2BKFA 2BWES 3BY4B 3H1UA 3QARA 4WJQA 3NY5A 5D94A 1UZXB 4AJWA 1ZGUB 3QJZA 3UF8A 3O65B 1E8YA 3L54A 2ZPYA 4DXAB 3DBSA 1V86A 4LCDE 5DPTA 2MBEA 3DQVA 3KUZA 2G3QB 2NS5A 3VUYA 2MA9B 2DHZA 4DHJD 3PVLA 2V1YA 3EHVA 2N9XA 4GSWA 3NZSA 1VD2A 2RSUA 1IP9A 2NCNA 3LDZE 4NAWB 2KZRA 4W9KA 4AJYB 1WGGA 2OJRA 3R3MA 1WZ3A 5AEKB 2KFKA 3A4SC 3ZW3A 3P2BA 2D2QA 5KHOA 1WMHB 2KFKB 4W9GA 4LDTB 4MELA 4ZYNA 4URKA 4HVBA 2KLCA 2LWPA 4WQOB 2UYZB 2XK5A 1WJ4A 3R7RA 2N7DA 1D3ZA 2AWTA 2M1MA 1YX5B 3TMPB 1WJ6A 2CKHB 3A9KA 1WYWB 2XEWA 4FULA 5J17A 3H7SA 1GJZA 1E8ZA 3CF6E 3QAQA 3RCZA 3U30A 2J7QB 4IM2A 4RM8A 4E74A 2MBHA 2RGFA 1Z2MA 4KSLC 4G3XB 1YX6B 2I1JA 2GMIC 1WFYA 1TBEA 4GU2A 4M8NA 1J8CA 2J0KA 2G45B 2GBNA 4IM3A 3VHTC 3RD2A 2M4NA 2K39A 3DVNV 3TJPA 4MGKE 2KTRA 2GBMA 1WGHA 2FAZA 3HIZA 3A9JA 3R7QA 2N9PC 3L10B 1NDDA 3VUXA 3PLUA 5JZEB 2BYEA 2D11A 4IWPA 4B95A 1K8RB 1NI2A 1YJ1A 3R66C 4PS3A 2XK5B 2KQSA 3ALBA 4IW0A 4YL8A 3VTUA 5L83A 2AEHA 2Z0EB 4W9EA 5E6PA 3HM6X 3PREA 3T8MA 2NPTA 2XBBC 3EFUA 3SDLC 3IHPC 3CMMB 1MG8A 2LGDA 3PZDA 1VCBA 3Q3FA 2JZ3B 3H7PA 3V6EB 4M8MA 3JSVB 1A5RA 1Y8RC 3PT2B 3ZNHB 1IPGA 3JSVA 4BKTA 3DCGA 3OJ4B 1Z5SB 2HE7A 2OOBB 5KHQA 5CX3A 1PQSA 1FXTB 3S2AA 2A4ZA 3RZWC 3NS8A 2DZKA 3ZDTA 4IM0A 3B1LX 4W9IA 2ASQA 3W1SC 2CU1A 4KZ0A 3VH4B 4LDTD 2IO0B 3W1YA 2AL6A 2O2VA 4FBJB 3AU4A 3DDCB 4MH0E 5JH5C 3M95A 3VQIA 1BT0A 1JRUA 1E8WA 2LXAA 3VH3B 4W9LA 3OJ3A 2MWSB 4HPLB 2YVCA 3H9DA 1WIAA 4TQ1A 2WWZA 2KO3A 1P3QU 1E7UA 3ML8A 4RM9A 4BKGA 2QHOA 4HPMB 2KC1A 3ZNGC 1F9JA 1TTNA 2LUEA 2GOWA 2LGYA 4XZ4A 4AWJA 3UQAA 3L16A 3K9PB 4GN1A 2JXXA 3NZUA 2K8CA 2M0XA 1WX9A 2BWFA 2JZZA 1G6JA 3WAOA 4CO7A 3RT3B 1P0RA 2FCQA 2JPHA 2MCNB 3APDA 2Z0DB 3DOWA 3GOEA 2IO2B 4A3OA 2L76A 3VTVA 4GDLA 1WE7A 1XT9B 2REXA 2DYBA 3IBEA 1P9DU 1RAXA 3VDZA 3D32A 4TKNA 2KKCA 4KDLB 3PRZA 3MJWA 1H8CA 3PHWB 4X57B 2N1WA 2KX0A 2K6QA 3WANA 3LJ3A 4NNJB 1R4MI 2NPTB 2KQ7A 2JUOA 2LVQA 2HJ8A 1P1AA 4KVGB 1Q0WB 4HXDA 2DZIA 2ZVOA 2O6VD 5FR6A 5L95C 1T0YA 3W1SA 2FCNA 4NPNA 2IY1B 4MJSB 2N9EB 1EF5A 3A9JB 2AL3A 2L7RA 2KANA 1H4RA 2K25A 2FIDA 3AULA 4FLHA 5JHAA 4RMAA 1E90A 1NBFC 3PPAA 4ZRIA 2N1VA 3KUCB 2KVRA 4N9F4 1TZ1A 3RULA 4PS7A 4IWOA 2HD5B 2D3GA 4E71A 2MSED 4FHJA 2MLBA 3H7PB 1C3TA 5AZFA 3ZNID 2L0FA 4CHKA 4ZRJA 1WX7A 5DPWA 1ISNA 2CR5A 1YD8U 1QZEA 2PE9A 3UIPB 3M63B 4DHJB 5JHBA 4W9CA 3VFKA 2DZMA 3PRPB 1UH6A 2KN5A 3TL5A 2UWQA 3HK0A 1P98A 4JGHB 2WYQA 2YLMA 4EZJA 4GDLB 3B0AA 2IZVB 1UBIA 1UD7A 4FADA 4GB9A 2KC2A 1OTRB 1L7YA 3ZUNA 4EEWA 3ZTCA 4PYZA 1WGYA 4II2B 3PV1A 2O2VB 2GBJA 2KWCA 3QA8A 3PLVA 3I3TB 2WX1A 3QWZB 2K8HA 5AZHA 1WY8A 3Q3JA 5E6OA 1U4AA 4DBGA 2KJRA 2WDTB 4XX5A 2DAJA 4B6WA 5IA7A 4HJKA 2RPQA 2KLGA 2EKEC 5AZGA 4IG7B 1EUVB 4E3CA 3V61A 2BPSA 3V60A 4BKSA 4KSKC 2L0TA 4LJOB 4BOZB 2DAFA 4K1RB 4MGYE 4NY0A 2LXCA 1V6EA 3ZIMA 4JLCA 1J0GA 3KUDB 2MBBB 4EKUA 4GOCA 3VUWA 1OEYA 2GBKA 3X0WA 3APCA 4HLEA 2ZVNA 4ANVA 3T9LA 2LASA 2CHZA 3DVGX 2FUHB 1OQYA 2DX5B 2K8BA 4W9DA 3PGEA 5J2RA 3QK0A 3NHEB 4A3PA 3QCAA 3QIJA 4MDKE 2ZEQA 4ANUA 2DZJA 4WJNA 1YQBA 1XD3B 2FCSA 1KM7A 3CSTA 3EC8A 3A1QA 4MGIE 1UBQA 1ZW7A 2R2QA 4ANXA 4EFOA 2JT4B 4HWIB 4ANWA 3MTNB 4MSMB 3RUIB 4DDID 2Z59B 4BBNC 2N4FA 3UINB 1CMXB 1OEYJ 3ECIA 4OVVA 3IFWB 4II3B 5LLIA 4NJ6A 2R2OA 2LI5A 3A1QB 3L17A 4TQ0A 2MBOA 4XC2A 3DBHI 3SHQA 3DPDA 2IY0B 4G11A 2KMCA 3M62B 3VTWA 2AYOB 2NBUA 2MBQA 4FJVB 4NQKE 2Y5BB 3IVFA 4TV3A 2KK8A 1V80A 3HM3A 4NAWA 1LQBA 2KTRB 2ZNVC 3JVZX 3OAWA 2K6DB 4GMVA 4NQLB 1Q1OA 4FN2A 3GZNI 3VVWB 4AOFA 2LGXA 2L00B 3B08A 3SD5A 2C60A 2MP2A 3V6CB 1R4NI 2G4DB 3N3KB 3WA0A 1KJTA 1WR6E 2ZPNA 5LXIB 4B9KA 3ZLZA 4JIOU 4KV2A 5BO4B 3K9OB 3A9KB 4BBNF 1I42A 5C23A 5J18A 1EO6A 5TR5A 1WXMA 2ZCBA 2KDFB 4K7WA 4HK2A 4KIKB 3RYTA 3X23A 2JWZA 4NJ7A 3APFA 4ZRKA 2KDBA 2MQJA 1WJUA 4GXBA 5D6JB 1WMHA 1WI0A 1V81A 2IBIB 4DDGD 5G55A 3A33B 5E6NA 4HCPB 1UELA 3EECA 1KOTA 1WGDA 1SIFA 1UGMA 2MW5A 4I6NB 1EF1A 2DYOA 3QX1A 2V3SA 3PTFC 3DBLI 3KYCD 1V5TA 4J6IA 4LJPB 2K1FA 2C7NB 5CHWA 1J19A 2C7HA 2KWUB 1GC7A 4EUTA 4A20A 1GG3A 2KD0A 4ICVA 2LZ6A 3PHXB 2MP2B 2PPHA 1WE6A 4EOYA 3ZO5B 4AP4C 5DCNA 1V2YA 2ZJDA 4HDQA 3ML9A 3AI5A 3C0RB 4ASWC 1RFAA 3UGBB 2WX0A 3PRMB 4ZDVA 3U7DA 4KZCA 2JF5A 2KFJA 2L3ZA 4EZKA 4EZLA 3ZVVA 4I6PA 4DK5A 4W9HA 1WGRA 1WZ0A 2IYDB 2D10A 2EMTA 2KDIA 3N30A 4KIKA 5G2NA 4DHZE 1GC6A 5CHFA 2MX2A 5LXHA 2KNBA 3WAMA 2M8SA 1WM3A 2BF8B 3PSEB 2BKRB 2KJ6A 3BINA 3KH0A 2ZNVB 4ICUA 2BGFA 3VXWA 1ZKHA 2DENB 2IO1B
chains in the Genus database with same CATH superfamily
1E7PB 1GNUA 4BKSD 2BYFA 5DPRA 5EE1A 3ZNZB 3ZKJC 1M94A 1HZ5A 2R61A 1WXSA 5I4DA 3RZFA 3L4PA 1D4BA 2LD9A 3BYYB 4M0WB 2LRUA 4G0NB 4GIVA 5D7GA 3ZDMC 3U52E 4C4VB 3L0WB 3DBRI 2MRPA 1TY0A 3VAWA 1R4MB 2QILA 2JRIB 4YTMB 1T6BX 5BYQA 3Q8BA 3AV8A 2KHWB 2JVCA 4JWUC 3NVWA 4ZYSA 1F2RI 4EE2A 2DYMA 1WJNA 4US8A 2N7EA 1STEA 4K7UA 2KX3A 2FE8A 1XQQA 3H6NA 4BVUC 2A5UA 1Y56A 2KDEB 1E8XA 4WH4A 2W82A 5CHVC 4MEMA 2J0MA 3IG3A 4D2KA 2W9NA 4OZAA 4AQ7A 4WIPA 1SGHA 1AARA 3Q6BA 5D2MB 3TUOA 1QOFA 1D6EC 1WRDB 2BYVE 2WP9B 1T0SC 1F1HA 1FMAD 4F1SA 1TS3A 4AUQC 5FK9C 4MACA 4OW0A 1RFKA 4C7ZA 4YSYB 1I4QA 3KQ4A 4HPPA 2INCC 2C9WB 2I1KA 1HXYD 3PS6A 2KVZA 3NRZA 4PT5A 3OLMD 4WJQA 1N60A 3QJZA 3L54A 5DPTA 4LCDE 3KUZA 3VUYA 1E9MA 3PVLA 3RPFC 2V1YA 2N9XA 3LDZE 4W9KA 2KZRA 5G5HA 1WGGA 2OJRA 3R3MA 4ZOHC 3A4SC 3P2BA 1WMHB 3PO0A 4LDTB 1ZDXA 3SR6A 3RMKC 4MH8A 4WQOB 1IUEA 1AW7A 1ET9A 2N7DA 3U2SC 3TMPB 1WJ6A 2CKHB 1GJZA 5J17A 3H7SA 3W9CB 1SSNA 3RCZA 2BYTA 1SIJA 3AE9B 1UGJA 4GU2A 2GBNA 3MP9A 3VHTC 4KGTA 1MPEA 2DBYA 2M4NA 1SJHD 2K39A 2QDFA 3PZ7A 2D3BA 2JYTA 4MGKE 2KTRA 5JZEB 1NDDA 3PLUA 2BBCA 4IWPA 4B95A 1M4VA 1YJ1A 3R66C 4PS3A 1NENB 4YL8A 4IW0A 3DHIC 5HG2A 2AEHA 2Z0EB 4W9EA 3HM6X 3SDLC 5H92C 2LGDA 3JSVB 3ZNHB 1IPGA 2I38A 2OOBB 1ZXHA 5CX3A 4ARIA 1FXTB 3S2AA 2PVOD 2LJIA 2DZKA 1XLNA 3W1SC 4KZ0A 1TKGA 3SEBA 3MJ5A 3VQIA 3NVYA 3VH3B 2N9LA 2MWSB 2WWZA 4LK0M 3Q69A 1E7UA 1HZ6A 2GB1A 1C4CA 1YJIA 1TTNA 2GOWA 4AWJA 4N58A 3K9PB 1RYJA 3NZUA 1WXQA 1G6JA 1P0RA 2JPHA 3GOEA 2KKCA 3ZXRA 2SEBD 3MJWA 2KX0A 4NNJB 2HJ8A 1P1AA 4KVGB 1QKZA 1C76A 1Q0WB 4Q2JA 1T0YA 1UF0A 3KWVA 2N9EB 1EF5A 2AL3A 2KANA 2K25A 1VJKA 2IPKD 4FLHA 3RNFC 1E90A 1NBFC 1CK1A 3KUCB 2PW9A 3RULA 3RNGC 2M56B 4E71A 4FHJA 3I57A 1C3TA 1ZDVA 4ZRJA 5LNK1 5DPWA 4OZCA 4DHJB 3M63B 1JQ4A 2DZMA 2LGSA 1FNWA 3IAM1 3HK0A 4JGHB 2YLMA 4EZJA 4GDLB 2CJNA 4GB9A 1OTRB 1ZUD2 3ZTCA 3LYYA 4PYZA 4II2B 2O2VB 2MHJA 2GBJA 4O1NA 1PYWD 1T5XD 3P42A 2KWCA 3PLVA 3I3TB 2WX1A 5AZHA 1WY8A 1U4AA 2WDTB 4BAXA 4XX5A 3SFDB 2ONQA 4HJKA 1UNSA 5AZGA 3V61A 4BKSA 4RNAA 4K1RB 4MGYE 1J7CA 3GP7A 1B9RA 2NTSA 4WURA 4GOCA 3X0WA 3VR8B 3APCA 1YN5A 4HLEA 1C78A 4RGNA 2DX5B 4W9DA 5J2RA 4LNIA 3NHEB 1XLOA 3B9JA 4RFBA 4TSSA 2MH7A 2KACA 2FCSA 3A1QA 1ZW7A 2R2QA 4ANXA 2JT4B 3RUIB 4DDID 2K3UA 3IFWB 4US9A 1FFUA 1HEZE 3AEAB 3DPDA 2L32A 4XWWA 5BYSA 2BVCA 4FJVB 4NQKE 1V80A 2KK8A 4HEA1 1TIFA 4NQLB 4FN2A 3VVWB 3B08A 1FPYA 1SF0A 3ZLZA 3KWLA 3K9OB 5C23A 5J18A 1J7BA 5TR5A 2BB6A 2KDFB 4NJ7A 3AECB 2KDBA 4ZHPA 2MQJA 1CQVA 4DDGD 1FIQA 2BTEA 4HCPB 1SIFA 2WHIA 3U4EG 4I6NB 1EF1A 2DYOA 2UU7A 3QX1A 4C7YA 3DBLI 3BVZA 4LJPB 3NVVA 2C7NB 2C7HA 1OFFA 3R2TA 1WE6A 4AP4C 3VRAB 3ML9A 3ZQ4A 1KF6B 3PRMB 2JF5A 2KFJA 4EZLA 3MHZA 3ZVVA 1WGRA 2IYDB 2KDIA 4KIKA 5LXHA 1TZOA 2CU3A 1YOVB 2MX2A 4P1CC 1L6VA 2BF8B 2G9HD 3AE3B 1VZ8A 1SBBB 4GDKB 1E7VA 2BB5A 1L4ZB 4F7ZA 4A55A 4CYEA 2GBRA 4NAMA 4WJPA 3TCAA 2KMMA 2O6VB 3UIOB 2ZCCA 1Q5WB 1E5WA 2C5LC 1X1MA 1C1YB 2N7JA 3AN1A 2D07B 5EDSA 1BUIC 2M17A 1TGZB 1WF9A 5IAAC 4RH6A 2NR2A 1KLUD 3BWUD 2HTHA 1NYRA 2L8JA 4WWPA 3U8ZA 4USAA 3DWMA 1RRBA 4WWNA 3V62A 1L0VB 2ZZPB 4MSQB 1PFDA 1WX8A 2NVUI 1LXDA 2KTFA 4TUUA 4HKQA 2FCMA 3ZTDA 4BOSC 1C79A 3L13A 4XDDA 3SU8X 1DGJA 1GUAB 3N1YC 4WWOA 3QQ8B 4K3CA 1SE9A 2CHXA 2LJ5A 1I35A 3T3OA 3HHMA 4MGZE 4BFRA 3P63A 2G4SA 4GDKA 4CQNA 2V3NA 5HKHA 2C7MB 4HDOA 1LFDA 2WGSA 3B2FA 1V5OA 2VRRB 1SE4A 1WXAA 1I4HA 1S1QB 3EA6A 4PYUA 2JY6A 3AEEB 2EMSA 2CHWA 2FNJB 3ZRCA 3UQBA 2PTLA 3KYDD 1S3SG 2LFIA 2BKFA 3H1UA 3IT6B 3QARA 3NY5A 4AJWA 3O65B 1E8YA 4DXAB 2ZPYA 1V86A 5BMGA 2MBEA 2NMQA 2G3QB 3C8YA 3EHVA 4GSWA 4AS1A 1VD2A 1IP9A 2KFKB 1IBXA 4MELA 4URKA 4B0EA 2X8XX 1FRRA 1V97A 2WXIA 1OQRA 4KGSA 3R7RA 1YX5B 4FULA 2WQYB 2J7QB 4C00A 4E74A 5GXGB 1YX6B 2GMIC 2I1JA 1WFYA 2JQRB 2BS2B 2J0KA 3WCQA 1SB3C 1ESFA 3TEXA 3TJPA 1PDXA 2H88B 4XYCA 2FAZA 1R4NB 3B2GA 1NYQA 5EE3A 3R7QA 3VUXA 5G5GA 1K8RB 2KQSA 2L52A 5L83A 2XBBC 3ZXVA 3PZDA 1KRHA 2FBWB 4H2AA 2M19A 1A5RA 3PT2B 2D3CA 4XGAB 3ZJTA 2WXKA 3OJ4B 1Z5SB 1C77A 2JSVX 2WXMA 3ZDTA 4IM0A 4W9IA 3VH4B 4LDTD 2O2VA 4MH0E 5JH5C 3M95A 1JRUA 4HPLB 2YVCA 4TQ1A 4XWTA 1TKEA 1P3QU 3ML8A 1P7FA 4HPMB 1B1ZA 2INDC 2PIAA 2LUEA 3DWGC 4GN1A 2JXXA 2K8CA 2MJ3A 3WAOA 4CO7A 3LB8C 3TEWA 3APDA 2DLBA 3DOWA 3GS2A 1WE7A 3TEYA 2REXA 4JX1C 4KDLB 3AE1B 5HFYA 2Q5WD 4X57B 3LJ3A 1GB1A 1R4MI 4RCOA 2LVQA 2JUOA 2OEDA 3FILB 3HVDA 2O6VD 5FR6A 2IY1B 4MJSB 3AEFB 3PPAA 4ZRIA 4N9F4 1TZ1A 1T0QC 4IWOA 2HD5B 2XN9C 3H7PB 1DYQA 1QOGA 3HRDD 1WX7A 1HTQA 2CR5A 1YD8U 3ZJVA 4GLSC 3VFKA 1GOZA 2KN5A 2UWQA 1WYGA 1BMLC 1P98A 2QCZA 3B0AA 2N0SB 2KC2A 3NJTA 4EEWA 2YEPB 3PV1A 1VRAB 2D3AA 2WLBA 3NS1A 3Q3JA 2KJRA 2DAJA 5IA7A 3OG5A 4C80A 3RFZB 2EKIA 3R2IA 3DBHB 3CIRB 5C3JB 1K51A 3V60A 2QC8A 2DAFA 3BVMA 2MJDA 3N1XC 2MBBB 3J9CA 2GBKA 3AB5A 3E56A 2V9HA 2IDYA 3QIJA 1VZ7A 4ITKA 5BMIA 3EC8A 4EFOA 2GRIA 4LNFA 3UINB 1CMXB 4ZHOA 1OEYJ 4II3B 2R2OA 2LI5A 2L83A 1N6ZA 2MBOA 4XC2A 4G11A 3ABVB 1QLBB 2NBUA 4LNNA 1HTOA 2W3RA 4J3OD 2HJ1A 2Y3AA 1N5XA 4NAWA 1LQBA 2HDEA 1IGCA 4P1BC 4AOFA 2L00B 1AN8A 2AQ1B 3SD5A 1N62A 3V6CB 2G4DB 1WR6E 2M0AA 2ZPNA 5AUIA 1XEEA 4L1BA 4KV2A 2PMVA 5BO4B 1WSPA 3A9KB 4OZBA 1WXMA 3NUHB 4S0RA 1SXTA 2E3TA 4K7WA 1WJUA 4GXBA 5D6JB 1V81A 5G55A 5E6NA 3EECA 1KOTA 1UGMA 4RGTA 2V3SA 1PGBA 2KDMA 2LEKA 2LMCA 2LZ6A 3PHXB 4EOYA 1V2YA 2WDRB 3AI5A 1HQRD 2WU2B 3AE4B 3C0RB 4ASWC 3UGBB 2WX0A 4KZCA 1ENFA 4YXDB 4W9HA 5G2NA 4DHZE 1GC6A 1D5ZC 1N61A 3BINA 3KH0A 1D5XC 4ICUA 2WXHA 1ZKHA 2PKOA 2WXRA 2QMTA 2L1AA 5DPSA 3L08A 1GPXA 1DOXA 3KW5B 3NZ3A 1LM8B 3W5VB 3CSFA 3JW0X 3TSSA 3RN9C 3E9SA 2KWVB 3NG0A 2KXJA 1SJED 1KH0A 4HJGE 3QC8B 4A9AA 3WALA 4F8CB 3QHTA 1WXVA 3IT4B 3N32A 4FHKA 2LVOA 1UWMA 1TS5A 3AU5A 4A90A 1V49A 4MJSA 2J0JA 4MM3B 2RD0A 1RLFA 4WWMA 3TBLD 1KLVA 4A8XC 2PJHA 3MFGA 4K81A 1QOBA 2PE6B 1L4DB 2J4XA 2WXQA 4L23A 1YIWA 3JYUA 3I63C 2PEAA 2LRWA 4YSZB 5D3DA 4WAAA 3RI7C 1OGWA 2RDGA 2VH1A 3DVGY 3KVFB 3ONSA 1ROEA 1LO5D 4FJYA 4XDCA 1V9JA 3AE6B 3URYA 4FJZA 1I4GA 1OQQA 1ZOYB 2KQ4X 4ACFA 4MT5A 4TMAB 1JWSD 1UUPA 1XO3A 3Q2AC 4P7IA 2KOXA 4OVUA 1E0ZA 4DHZB 2QSDA 3M3JA 1EU3A 4FA6A 3WIMA 4G50A 4WJOA 1IYFA 2MEKA 2BWES 3BY4B 4RF0A 1UZXB 1F0ZA 1ZGUB 3UF8A 3AMZA 1V1OA 3DBSA 2Y5PA 3DQVA 2NS5A 2WU5B 2DHZA 4DHJD 4YWGG 4XE0A 2RSUA 3EUB2 2NCNA 4NAWB 4AJYB 5AEKB 3ZW3A 4JPSA 5KHOA 3Q3MC 2WXPA 4ZYNA 1YNTE 1QF6A 4HVBA 3ZGZA 1I4PA 2LWPA 4ZRPA 2XK5A 1WJ4A 1MG4A 4S17A 1D3ZA 1WYWB 3CF6E 1BXTA 4IM2A 2RGFA 4KSLC 3Q8FA 4G3XB 1QILA 4IM3A 1YJJA 3DVNV 1NVID 1WGHA 3VR9B 1GB4A 3A9JA 4C56C 2D11A 1NI2A 3GE3C 3CWIA 2KT7A 3ALBA 2QJLA 2DNFA 3N9YC 2NPTA 3SFEB 3T8MA 3EFUA 1XLQA 3CMMB 1MG8A 1VCBA 3BIID 3Q3FA 2JZ3B 3H7PA 3EGRA 1Y8RC 3Q8CA 1YN3A 2RPVA 3JSVA 2HE7A 1TY2A 5KHQA 5BMHA 1PQSA 3AM9A 3RZWC 2AQ2B 4UDUC 1NI3A 1TS4A 1VZ6A 3B1LX 1FM0D 1EWYC 2ASQA 3W1YA 2AL6A 3AU4A 3DDCB 1E8WA 4W9LA 2JX5A 3OJ3A 1J7AA 3H9DA 1WIAA 3HUIA 3GE8C 2KO3A 4RM9A 3ZJUA 3ZNGC 1F9JA 2LGYA 1KLGD 2Z8LA 4XZ4A 3L16A 3U7ZA 2SAKA 1E6EB 2BWFA 3UI3A 1L6UA 1JCKB 2ZW1A 2FCQA 4LNOA 2WXLA 2IO2B 4A3OA 2L76A 3V05A 2B76B 2DYBA 3FKYA 1P9DU 2W3SA 3D32A 4BZAA 1H8CA 1TT5B 2N1WA 2K6QA 3WANA 2NPTB 2KQ7A 1ZPSA 2V0GA 2DZIA 1MI0A 3DBRB 3W1SA 2FCNA 3A9JB 2FIDA 4B0MA 1WGKA 3Q8EA 1TJEA 2KVRA 4P6VF 2D3GA 2WDQB 2MSED 5AZFA 2KAJA 2L0FA 1PUTA 1XLPA 2OHFA 4CHKA 3FILA 1ISNA 2WXFA 5C2TB 2G1EA 2ACZB 2PE9A 3LXFA 5JHBA 4W9CA 3PRPB 1UH6A 3TL5A 4DXFA 1L0YB 1K53A 2IZVB 4KKJA 4FADA 5HI1A 1VR9A 1WGYA 2IGGA 2LHDA 3QWZB 3I5JC 2RDHA 3BZDB 2INNE 4N59A 4ZRQA 1QOAA 4B6WA 2RPQA 2KLGA 2EKEC 1A70A 4IG7B 3Q14C 4E3CA 2WNMA 3W5UB 4LJOB 4N6EB 4KGRA 4NY0A 2LXCA 1V6EA 3MC8A 4QAYA 4JLCA 1XXGA 1FD6A 1MVKA 4EKUA 1OEYA 2V3PA 2BS3B 4ANVA 3VRBB 2CHZA 2FUHB 1OQYA 2K8BA 4A3PA 1JW9D 2D5GA 3Q8AA 3BK1A 4MDKE 1YMHE 4ANUA 1XD3B 1FXIA 1UBQA 5BYRA 4ANWA 2E6XA 5IOIA 2Z59B 2LGIA 5FKAC 2DWQA 3ECIA 4OVVA 1FFVA 1KTKA 3L17A 4TQ0A 1C4PA 3R8BA 5T8IA 1MHXA 3DBHI 4WAFA 2KMCA 3OWEB 1Q10A 3VTWA 2AYOB 2MBQA 2Y5BB 3IVFA 4TV3A 2K6DB 4GMVA 1JROA 3GZNI 4KKIA 5EE0A 2C60A 2MP2A 1JRPA 3N3KB 1KJTA 2RDBC 5LXIB 2K5PA 1EU4A 1MFWA 3T3NA 2Y5CA 5IN7A 1PGAA 3RYTA 3KLSX 1JMLA 1WMHA 1WI0A 2IBIB 1SEBD 2NTTA 2WXOA 1WGDA 4YTPB 2MW5A 2ZW0A 4J6IA 1FNUA 2K1FA 1YQ4B 5CHWA 2BS4B 1CJEA 2MP2B 2PPHA 2JXTA 1N63A 4DQOC 1L0XB 1RFAA 4ZDVA 1YN4A 2WXGA 4EZKA 4I6PA 2D10A 5CHFA 2KNBA 1QQRA 3WAMA 2M8SA 3AE8B 1WM3A 3PSEB 2BKRB 2KJ6A 2ZNVB 1R7SA 2BGFA 2BW2A 2WXJA 2DENB 1ZXIA 3O13A 4JL9A 4IC7B 1TKYA 1YQ3B 1WM2A 1I4XA 5JXVA 1FNVA 3A4RA 3RNBC 1VDVA 1L2NA 4DWFA 3ZRFA 2VH2A 2LUMA 5C1ZA 4K7SA 4W9FA 2X38A 1WWTA 4HCNB 1FRDA 1FCLA 1I7HA 1DOIA 2KMAA 2FUG1 2PVGC 4JE3B 2O6VA 2JRHA 1HE8A 2LVPA 4DXGA 2KWDA 4YTNB 2NBWB 1D5MC 3H8HA 3AEBB 3DVNU 2IO3B 4IWQA 4IKGA 4PS8A 4HROA 1K50A 3AXCA 3TIXA 5IKCM 3P4PB 2KYWA 4W9JA 1LGRA 3WAPA 4JQWC 1F77A 2OJWA 3BYTB 1E10A 4I6LB 5GMVA 2KJHB 4MM3A 3MHSD 2RR9A 4KDIC 4R3DA 4LNKA 2B3AA 5CTRC 1WH3A 2L05A 1WR1A 4RF1A 2WDVB 2FIFA 4IUMB 4IDIA 2V4LA 3ENEA 2CS4A 3NOBA 4LLGM 4GGQA 4HRSA 1PGXA 2NBVB 2J52A 1F52A 5D94A 4JWSC 1XCTL 2MA9B 2PLPA 3NZSA 1WZ3A 2N9KA 2KFKA 2J53A 4C4VA 4P16A 2D2QA 1TS2A 4W9GA 1RM6C 2KLCA 1NEKB 4HKZE 2UYZB 4REZA 3DHHC 2AWTA 2M1MA 5IP4D 3A9KA 2XEWA 2W54A 1E8ZA 1K52A 2KN4A 3QAQA 3U30A 3ETRA 4RM8A 2MBHA 2H89B 1Z2MA 3P1MA 4M8NA 1FO4A 1J8CA 1TBEA 5HHDG 5MPOA 2K22A 2G45B 5IO9A 3RD2A 3RNCC 2IJ0A 3N20C 3P4SB 4FXCA 2GBMA 3HIZA 2N9PC 3L10B 2BYEA 2XK5B 3VTUA 1SE3A 4PK1A 2K9XA 1ET6A 3PREA 1DOYA 3IHPC 3P4RB 3IAS1 1UWXA 1V1PA 1N5WA 3V6EB 2MJEA 4M8MA 2GLSA 3RNAC 2IGHA 3DCGA 4BKTA 2TSSA 3I9V1 1C4AA 1TYGB 3NVZA 2A4ZA 3NS8A 3TEZA 3MC0B 2CU1A 2IO0B 3DBLB 4FBJB 2V4IB 1BT0A 4RGOS 2LXAA 2AX5A 4IOIE 1AYFA 1T0RC 3Q3OC 4YT0B 3BK2A 1KFYB 1JWMD 4BKGA 2QHOA 2I2YA 2KC1A 2ICIA 3UQAA 2YEPF 1F2RC 2M0XA 1WX9A 2JZZA 3W2DA 1AWDA 3P4QB 3N1ZC 3RT3B 2MCNB 2K0PA 2Z0DB 3VTVA 4ARCA 4GDLA 2BQQA 1XT9B 4NJCA 3IBEA 1RAXA 3VDZA 3AE2B 4TKNA 3PRZA 2HTME 1WRIA 2VZKD 3PHWB 2JZPA 1ACCA 4OHJA 3HVZA 4HXDA 2LHEA 1QT9A 2ZVOA 5L95C 4NPNA 5D3IB 2L7RA 1H4RA 3AULA 5JHAA 4RMAA 5E6JA 2N1VA 1EWCA 1CZPA 1IBXB 4PS7A 2WS3B 3Q3NC 2MLBA 3ZNID 3GB1A 1QZEA 5AUKA 3UIPB 2CJOA 2WYQA 5H8YE 1UBIA 1UD7A 3RNEC 1L7YA 3ZUNA 1T3QA 3AE5B 3QA8A 4M00A 2K8HA 5E6OA 4LTUA 4DBGA 1JALA 2JU6X 3BVGA 4K3BA 1GAQB 2VZKB 1EUVB 2INPE 4A6QA 2BPSA 4KSKC 2L0TA 4BOZB 4M02A 3ZIMA 5EE9A 1J0GA 3EFCA 2QIEB 3KUDB 3VUWA 3MC9A 2GI9A 1L5PA 5TSSA 2ZVNA 3T9LA 2LASA 4L2YA 3DVGX 3PGEA 3QK0A 3QCAA 3AE7B 2ZEQA 2DZJA 1HA5A 1YQBA 4WJNA 1ZP0B 1MHHE 2W55A 1KM7A 3CSTA 4RGMA 4MGIE 4HWIB 3MTNB 4MSMB 1I4RA 1FXAA 2EELA 1MJDA 4BBNC 1RWSA 2N4FA 3AEGB 1JWBD 5LLIA 3V3XA 4NJ6A 3A1QB 3PZ8A 1XCQL 1FCCC 4NZLB 3SHQA 2IY0B 2WXNA 3M62B 1VLBA 3HM3A 2QEJC 3FAHA 2ZNVC 2KTRB 3OAWA 3JVZX 1Q1OA 2LGXA 1XF5L 1R4NI 3WA0A 1ZE3D 4B9KA 1V1PB 4JIOU 4BBNF 1I42A 1V8CA 2IGDA 2ON8A 1EO6A 1FEHA 2ZCBA 2AQ3B 4KIKB 4HK2A 3C19A 3X23A 2JWZA 2J42A 3APFA 4ZRKA 5FR3A 4M01A 3ZYYX 3A33B 1UELA 1EM7A 3AEDB 3IXSA 1IGDA 1SE2A 3PTFC 2JYEA 3KYCD 1JWAD 1V5TA 1J19A 3FC4A 2KWUB 1GC7A 4EUTA 4YSXB 4A20A 1GG3A 2KD0A 4ICVA 3ZO5B 5DCNA 2ZJDA 4HDQA 3DHGC 2XNAC 3GZNB 1P7EA 2RMMA 4WQMA 3U7DA 1JWUD 2L3ZA 4OVZA 4M0WA 4KX6B 4DK5A 1WZ0A 2EMTA 3N30A 1C9FA 2JWUA 2BT6A 3VXWA 3AH7A 5E6PA 2IO1B
chains in the Genus database with same CATH topology
5DPSA 3L08A 4GDKB 4JL9A 1E7VA 1GNUA 4BKSD 2BYFA 3KW5B 4IC7B 1WM2A 5DPRA 3ZKJC 1M94A 3ZNZB 1LM8B 1WXSA 4F7ZA 3A4RA 4CYEA 2GBRA 3CSFA 4DWFA 3RZFA 1L2NA 3ZRFA 3JW0X 5C1ZA 2LD9A 4K7SA 4WJPA 4M0WB 2LRUA 4G0NB 4W9FA 3TCAA 2O6VB 4GIVA 3UIOB 2KWVB 2ZCCA 1Q5WB 2KXJA 5D7GA 3ZDMC 1E5WA 3QC8B 3L0WB 3WALA 4HCNB 4F8CB 2C5LC 3DBRI 1X1MA 3QHTA 1WXVA 2MRPA 1C1YB 3N32A 2KMAA 2D07B 4FHKA 2LVOA 3VAWA 5EDSA 3AU5A 2O6VA 2JRHA 2M17A 1TGZB 1HE8A 1WF9A 5IAAC 2LVPA 2JRIB 1V49A 2NR2A 2HTHA 4MJSA 2J0JA 2KHWB 2JVCA 2NBWB 2L8JA 4WWPA 3U8ZA 2RD0A 1RLFA 3DVNU 1RRBA 4WWNA 3V62A 2ZZPB 4MSQB 2IO3B 1WX8A 2NVUI 2PJHA 1LXDA 4IWQA 3TBLD 2DYMA 2KTFA 1KLVA 4K81A 4PS8A 1WJNA 4TUUA 2PE6B 2FCMA 3AXCA 3TIXA 3ZTDA 2N7EA 4BOSC 1YIWA 3JYUA 4K7UA 4W9JA 2KX3A 1XQQA 2PEAA 4JQWC 3L13A 2LRWA 3WAPA 3H6NA 4BVUC 2A5UA 3SU8X 4WAAA 1OGWA 2KDEB 1E8XA 5CHVC 4MEMA 1GUAB 2J0MA 3DVGY 3IG3A 3KVFB 3ONSA 3QQ8B 4I6LB 4WWOA 5GMVA 2KJHB 4FJYA 4MM3A 1SE9A 2CHXA 2LJ5A 2W9NA 1I35A 3MHSD 1V9JA 2RR9A 3HHMA 4KDIC 4MGZE 4FJZA 1SGHA 2B3AA 4BFRA 2G4SA 1AARA 4GDKA 5CTRC 5D2MB 1WH3A 1WRDB 2BYVE 5HKHA 2C7MB 2L05A 1WR1A 4HDOA 1LFDA 1V5OA 2VRRB 1WXAA 4F1SA 1S1QB 4P7IA 4AUQC 2KOXA 4PYUA 2JY6A 2EMSA 2FIFA 2CHWA 2FNJB 4IUMB 4OVUA 3KYDD 2V4LA 3ZRCA 4DHZB 3UQBA 3ENEA 1S3SG 2CS4A 2C9WB 2I1KA 3M3JA 3NOBA 4FA6A 4GGQA 3PS6A 3WIMA 4G50A 4WJOA 1IYFA 2NBVB 3OLMD 2BKFA 2BWES 3BY4B 3H1UA 3QARA 4WJQA 3NY5A 5D94A 1UZXB 4AJWA 1ZGUB 3QJZA 3UF8A 3O65B 1E8YA 3L54A 2ZPYA 4DXAB 3DBSA 1V86A 4LCDE 5DPTA 2MBEA 3DQVA 3KUZA 2G3QB 2NS5A 3VUYA 2MA9B 2DHZA 4DHJD 3PVLA 2V1YA 3EHVA 2N9XA 4GSWA 3NZSA 1VD2A 2RSUA 1IP9A 2NCNA 3LDZE 4NAWB 2KZRA 4W9KA 4AJYB 1WGGA 2OJRA 3R3MA 1WZ3A 5AEKB 2KFKA 3A4SC 3ZW3A 3P2BA 2D2QA 5KHOA 1WMHB 2KFKB 4W9GA 4LDTB 4MELA 4ZYNA 4URKA 4HVBA 2KLCA 2LWPA 4WQOB 2UYZB 2XK5A 1WJ4A 3R7RA 2N7DA 1D3ZA 2AWTA 2M1MA 1YX5B 3TMPB 1WJ6A 2CKHB 3A9KA 1WYWB 2XEWA 4FULA 5J17A 3H7SA 1GJZA 1E8ZA 3CF6E 3QAQA 3RCZA 3U30A 2J7QB 4IM2A 4RM8A 4E74A 2MBHA 2RGFA 1Z2MA 4KSLC 4G3XB 1YX6B 2I1JA 2GMIC 1WFYA 1TBEA 4GU2A 4M8NA 1J8CA 2J0KA 2G45B 2GBNA 4IM3A 3VHTC 3RD2A 2M4NA 2K39A 3DVNV 3TJPA 4MGKE 2KTRA 2GBMA 1WGHA 2FAZA 3HIZA 3A9JA 3R7QA 2N9PC 3L10B 1NDDA 3VUXA 3PLUA 5JZEB 2BYEA 2D11A 4IWPA 4B95A 1K8RB 1NI2A 1YJ1A 3R66C 4PS3A 2XK5B 2KQSA 3ALBA 4IW0A 4YL8A 3VTUA 5L83A 2AEHA 2Z0EB 4W9EA 5E6PA 3HM6X 3PREA 3T8MA 2NPTA 2XBBC 3EFUA 3SDLC 3IHPC 3CMMB 1MG8A 2LGDA 3PZDA 1VCBA 3Q3FA 2JZ3B 3H7PA 3V6EB 4M8MA 3JSVB 1A5RA 1Y8RC 3PT2B 3ZNHB 1IPGA 3JSVA 4BKTA 3DCGA 3OJ4B 1Z5SB 2HE7A 2OOBB 5KHQA 5CX3A 1PQSA 1FXTB 3S2AA 2A4ZA 3RZWC 3NS8A 2DZKA 3ZDTA 4IM0A 3B1LX 4W9IA 2ASQA 3W1SC 2CU1A 4KZ0A 3VH4B 4LDTD 2IO0B 3W1YA 2AL6A 2O2VA 4FBJB 3AU4A 3DDCB 4MH0E 5JH5C 3M95A 3VQIA 1BT0A 1JRUA 1E8WA 2LXAA 3VH3B 4W9LA 3OJ3A 2MWSB 4HPLB 2YVCA 3H9DA 1WIAA 4TQ1A 2WWZA 2KO3A 1P3QU 1E7UA 3ML8A 4RM9A 4BKGA 2QHOA 4HPMB 2KC1A 3ZNGC 1F9JA 1TTNA 2LUEA 2GOWA 2LGYA 4XZ4A 4AWJA 3UQAA 3L16A 3K9PB 4GN1A 2JXXA 3NZUA 2K8CA 2M0XA 1WX9A 2BWFA 2JZZA 1G6JA 3WAOA 4CO7A 3RT3B 1P0RA 2FCQA 2JPHA 2MCNB 3APDA 2Z0DB 3DOWA 3GOEA 2IO2B 4A3OA 2L76A 3VTVA 4GDLA 1WE7A 1XT9B 2REXA 2DYBA 3IBEA 1P9DU 1RAXA 3VDZA 3D32A 4TKNA 2KKCA 4KDLB 3PRZA 3MJWA 1H8CA 3PHWB 4X57B 2N1WA 2KX0A 2K6QA 3WANA 3LJ3A 4NNJB 1R4MI 2NPTB 2KQ7A 2JUOA 2LVQA 2HJ8A 1P1AA 4KVGB 1Q0WB 4HXDA 2DZIA 2ZVOA 2O6VD 5FR6A 5L95C 1T0YA 3W1SA 2FCNA 4NPNA 2IY1B 4MJSB 2N9EB 1EF5A 3A9JB 2AL3A 2L7RA 2KANA 1H4RA 2K25A 2FIDA 3AULA 4FLHA 5JHAA 4RMAA 1E90A 1NBFC 3PPAA 4ZRIA 2N1VA 3KUCB 2KVRA 4N9F4 1TZ1A 3RULA 4PS7A 4IWOA 2HD5B 2D3GA 4E71A 2MSED 4FHJA 2MLBA 3H7PB 1C3TA 5AZFA 3ZNID 2L0FA 4CHKA 4ZRJA 1WX7A 5DPWA 1ISNA 2CR5A 1YD8U 1QZEA 2PE9A 3UIPB 3M63B 4DHJB 5JHBA 4W9CA 3VFKA 2DZMA 3PRPB 1UH6A 2KN5A 3TL5A 2UWQA 3HK0A 1P98A 4JGHB 2WYQA 2YLMA 4EZJA 4GDLB 3B0AA 2IZVB 1UBIA 1UD7A 4FADA 4GB9A 2KC2A 1OTRB 1L7YA 3ZUNA 4EEWA 3ZTCA 4PYZA 1WGYA 4II2B 3PV1A 2O2VB 2GBJA 2KWCA 3QA8A 3PLVA 3I3TB 2WX1A 3QWZB 2K8HA 5AZHA 1WY8A 3Q3JA 5E6OA 1U4AA 4DBGA 2KJRA 2WDTB 4XX5A 2DAJA 4B6WA 5IA7A 4HJKA 2RPQA 2KLGA 2EKEC 5AZGA 4IG7B 1EUVB 4E3CA 3V61A 2BPSA 3V60A 4BKSA 4KSKC 2L0TA 4LJOB 4BOZB 2DAFA 4K1RB 4MGYE 4NY0A 2LXCA 1V6EA 3ZIMA 4JLCA 1J0GA 3KUDB 2MBBB 4EKUA 4GOCA 3VUWA 1OEYA 2GBKA 3X0WA 3APCA 4HLEA 2ZVNA 4ANVA 3T9LA 2LASA 2CHZA 3DVGX 2FUHB 1OQYA 2DX5B 2K8BA 4W9DA 3PGEA 5J2RA 3QK0A 3NHEB 4A3PA 3QCAA 3QIJA 4MDKE 2ZEQA 4ANUA 2DZJA 4WJNA 1YQBA 1XD3B 2FCSA 1KM7A 3CSTA 3EC8A 3A1QA 4MGIE 1UBQA 1ZW7A 2R2QA 4ANXA 4EFOA 2JT4B 4HWIB 4ANWA 3MTNB 4MSMB 3RUIB 4DDID 2Z59B 4BBNC 2N4FA 3UINB 1CMXB 1OEYJ 3ECIA 4OVVA 3IFWB 4II3B 5LLIA 4NJ6A 2R2OA 2LI5A 3A1QB 3L17A 4TQ0A 2MBOA 4XC2A 3DBHI 3SHQA 3DPDA 2IY0B 4G11A 2KMCA 3M62B 3VTWA 2AYOB 2NBUA 2MBQA 4FJVB 4NQKE 2Y5BB 3IVFA 4TV3A 2KK8A 1V80A 3HM3A 4NAWA 1LQBA 2KTRB 2ZNVC 3JVZX 3OAWA 2K6DB 4GMVA 4NQLB 1Q1OA 4FN2A 3GZNI 3VVWB 4AOFA 2LGXA 2L00B 3B08A 3SD5A 2C60A 2MP2A 3V6CB 1R4NI 2G4DB 3N3KB 3WA0A 1KJTA 1WR6E 2ZPNA 5LXIB 4B9KA 3ZLZA 4JIOU 4KV2A 5BO4B 3K9OB 3A9KB 4BBNF 1I42A 5C23A 5J18A 1EO6A 5TR5A 1WXMA 2ZCBA 2KDFB 4K7WA 4HK2A 4KIKB 3RYTA 3X23A 2JWZA 4NJ7A 3APFA 4ZRKA 2KDBA 2MQJA 1WJUA 4GXBA 5D6JB 1WMHA 1WI0A 1V81A 2IBIB 4DDGD 5G55A 3A33B 5E6NA 4HCPB 1UELA 3EECA 1KOTA 1WGDA 1SIFA 1UGMA 2MW5A 4I6NB 1EF1A 2DYOA 3QX1A 2V3SA 3PTFC 3DBLI 3KYCD 1V5TA 4J6IA 4LJPB 2K1FA 2C7NB 5CHWA 1J19A 2C7HA 2KWUB 1GC7A 4EUTA 4A20A 1GG3A 2KD0A 4ICVA 2LZ6A 3PHXB 2MP2B 2PPHA 1WE6A 4EOYA 3ZO5B 4AP4C 5DCNA 1V2YA 2ZJDA 4HDQA 3ML9A 3AI5A 3C0RB 4ASWC 1RFAA 3UGBB 2WX0A 3PRMB 4ZDVA 3U7DA 4KZCA 2JF5A 2KFJA 2L3ZA 4EZKA 4EZLA 3ZVVA 4I6PA 4DK5A 4W9HA 1WGRA 1WZ0A 2IYDB 2D10A 2EMTA 2KDIA 3N30A 4KIKA 5G2NA 4DHZE 1GC6A 5CHFA 2MX2A 5LXHA 2KNBA 3WAMA 2M8SA 1WM3A 2BF8B 3PSEB 2BKRB 2KJ6A 3BINA 3KH0A 2ZNVB 4ICUA 2BGFA 3VXWA 1ZKHA 2DENB 2IO1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DPS A;  3L08 A;  4GDK B;  4JL9 A;  1E7V A;  1GNU A;  4BKS D;  2BYF A;  3KW5 B;  4IC7 B;  1WM2 A;  5DPR A;  3ZKJ C;  1M94 A;  3ZNZ B;  1LM8 B;  1WXS A;  4F7Z A;  3A4R A;  4CYE A;  2GBR A;  3CSF A;  4DWF A;  3RZF A;  1L2N A;  3ZRF A;  3JW0 X;  5C1Z A;  2LD9 A;  4K7S A;  4WJP A;  4M0W B;  2LRU A;  4G0N B;  4W9F A;  3TCA A;  2O6V B;  4GIV A;  3UIO B;  2KWV B;  2ZCC A;  1Q5W B;  2KXJ A;  5D7G A;  3ZDM C;  1E5W A;  3QC8 B;  3L0W B;  3WAL A;  4HCN B;  4F8C B;  2C5L C;  3DBR I;  1X1M A;  3QHT A;  1WXV A;  2MRP A;  1C1Y B;  3N32 A;  2KMA A;  2D07 B;  4FHK A;  2LVO A;  3VAW A;  5EDS A;  3AU5 A;  2O6V A;  2JRH A;  2M17 A;  1TGZ B;  1HE8 A;  1WF9 A;  5IAA C;  2LVP A;  2JRI B;  1V49 A;  2NR2 A;  2HTH A;  4MJS A;  2J0J A;  2KHW B;  2JVC A;  2NBW B;  2L8J A;  4WWP A;  3U8Z A;  2RD0 A;  1RLF A;  3DVN U;  1RRB A;  4WWN A;  3V62 A;  2ZZP B;  4MSQ B;  2IO3 B;  1WX8 A;  2NVU I;  2PJH A;  1LXD A;  4IWQ A;  3TBL D;  2DYM A;  2KTF A;  1KLV A;  4K81 A;  4PS8 A;  1WJN A;  4TUU A;  2PE6 B;  2FCM A;  3AXC A;  3TIX A;  3ZTD A;  2N7E A;  4BOS C;  1YIW A;  3JYU A;  4K7U A;  4W9J A;  2KX3 A;  1XQQ A;  2PEA A;  4JQW C;  3L13 A;  2LRW A;  3WAP A;  3H6N A;  4BVU C;  2A5U A;  3SU8 X;  4WAA A;  1OGW A;  2KDE B;  1E8X A;  5CHV C;  4MEM A;  1GUA B;  2J0M A;  3DVG Y;  3IG3 A;  3KVF B;  3ONS A;  3QQ8 B;  4I6L B;  4WWO A;  5GMV A;  2KJH B;  4FJY A;  4MM3 A;  1SE9 A;  2CHX A;  2LJ5 A;  2W9N A;  1I35 A;  3MHS D;  1V9J A;  2RR9 A;  3HHM A;  4KDI C;  4MGZ E;  4FJZ A;  1SGH A;  2B3A A;  4BFR A;  2G4S A;  1AAR A;  4GDK A;  5CTR C;  5D2M B;  1WH3 A;  1WRD B;  2BYV E;  5HKH A;  2C7M B;  2L05 A;  1WR1 A;  4HDO A;  1LFD A;  1V5O A;  2VRR B;  1WXA A;  4F1S A;  1S1Q B;  4P7I A;  4AUQ C;  2KOX A;  4PYU A;  2JY6 A;  2EMS A;  2FIF A;  2CHW A;  2FNJ B;  4IUM B;  4OVU A;  3KYD D;  2V4L A;  3ZRC A;  4DHZ B;  3UQB A;  3ENE A;  1S3S G;  2CS4 A;  2C9W B;  2I1K A;  3M3J A;  3NOB A;  4FA6 A;  4GGQ A;  3PS6 A;  3WIM A;  4G50 A;  4WJO A;  1IYF A;  2NBV B;  3OLM D;  2BKF A;  2BWE S;  3BY4 B;  3H1U A;  3QAR A;  4WJQ A;  3NY5 A;  5D94 A;  1UZX B;  4AJW A;  1ZGU B;  3QJZ A;  3UF8 A;  3O65 B;  1E8Y A;  3L54 A;  2ZPY A;  4DXA B;  3DBS A;  1V86 A;  4LCD E;  5DPT A;  2MBE A;  3DQV A;  3KUZ A;  2G3Q B;  2NS5 A;  3VUY A;  2MA9 B;  2DHZ A;  4DHJ D;  3PVL A;  2V1Y A;  3EHV A;  2N9X A;  4GSW A;  3NZS A;  1VD2 A;  2RSU A;  1IP9 A;  2NCN A;  3LDZ E;  4NAW B;  2KZR A;  4W9K A;  4AJY B;  1WGG A;  2OJR A;  3R3M A;  1WZ3 A;  5AEK B;  2KFK A;  3A4S C;  3ZW3 A;  3P2B A;  2D2Q A;  5KHO A;  1WMH B;  2KFK B;  4W9G A;  4LDT B;  4MEL A;  4ZYN A;  4URK A;  4HVB A;  2KLC A;  2LWP A;  4WQO B;  2UYZ B;  2XK5 A;  1WJ4 A;  3R7R A;  2N7D A;  1D3Z A;  2AWT A;  2M1M A;  1YX5 B;  3TMP B;  1WJ6 A;  2CKH B;  3A9K A;  1WYW B;  2XEW A;  4FUL A;  5J17 A;  3H7S A;  1GJZ A;  1E8Z A;  3CF6 E;  3QAQ A;  3RCZ A;  3U30 A;  2J7Q B;  4IM2 A;  4RM8 A;  4E74 A;  2MBH A;  2RGF A;  1Z2M A;  4KSL C;  4G3X B;  1YX6 B;  2I1J A;  2GMI C;  1WFY A;  1TBE A;  4GU2 A;  4M8N A;  1J8C A;  2J0K A;  2G45 B;  2GBN A;  4IM3 A;  3VHT C;  3RD2 A;  2M4N A;  2K39 A;  3DVN V;  3TJP A;  4MGK E;  2KTR A;  2GBM A;  1WGH A;  2FAZ A;  3HIZ A;  3A9J A;  3R7Q A;  2N9P C;  3L10 B;  1NDD A;  3VUX A;  3PLU A;  5JZE B;  2BYE A;  2D11 A;  4IWP A;  4B95 A;  1K8R B;  1NI2 A;  1YJ1 A;  3R66 C;  4PS3 A;  2XK5 B;  2KQS A;  3ALB A;  4IW0 A;  4YL8 A;  3VTU A;  5L83 A;  2AEH A;  2Z0E B;  4W9E A;  5E6P A;  3HM6 X;  3PRE A;  3T8M A;  2NPT A;  2XBB C;  3EFU A;  3SDL C;  3IHP C;  3CMM B;  1MG8 A;  2LGD A;  3PZD A;  1VCB A;  3Q3F A;  2JZ3 B;  3H7P A;  3V6E B;  4M8M A;  3JSV B;  1A5R A;  1Y8R C;  3PT2 B;  3ZNH B;  1IPG A;  3JSV A;  4BKT A;  3DCG A;  3OJ4 B;  1Z5S B;  2HE7 A;  2OOB B;  5KHQ A;  5CX3 A;  1PQS A;  1FXT B;  3S2A A;  2A4Z A;  3RZW C;  3NS8 A;  2DZK A;  3ZDT A;  4IM0 A;  3B1L X;  4W9I A;  2ASQ A;  3W1S C;  2CU1 A;  4KZ0 A;  3VH4 B;  4LDT D;  2IO0 B;  3W1Y A;  2AL6 A;  2O2V A;  4FBJ B;  3AU4 A;  3DDC B;  4MH0 E;  5JH5 C;  3M95 A;  3VQI A;  1BT0 A;  1JRU A;  1E8W A;  2LXA A;  3VH3 B;  4W9L A;  3OJ3 A;  2MWS B;  4HPL B;  2YVC A;  3H9D A;  1WIA A;  4TQ1 A;  2WWZ A;  2KO3 A;  1P3Q U;  1E7U A;  3ML8 A;  4RM9 A;  4BKG A;  2QHO A;  4HPM B;  2KC1 A;  3ZNG C;  1F9J A;  1TTN A;  2LUE A;  2GOW A;  2LGY A;  4XZ4 A;  4AWJ A;  3UQA A;  3L16 A;  3K9P B;  4GN1 A;  2JXX A;  3NZU A;  2K8C A;  2M0X A;  1WX9 A;  2BWF A;  2JZZ A;  1G6J A;  3WAO A;  4CO7 A;  3RT3 B;  1P0R A;  2FCQ A;  2JPH A;  2MCN B;  3APD A;  2Z0D B;  3DOW A;  3GOE A;  2IO2 B;  4A3O A;  2L76 A;  3VTV A;  4GDL A;  1WE7 A;  1XT9 B;  2REX A;  2DYB A;  3IBE A;  1P9D U;  1RAX A;  3VDZ A;  3D32 A;  4TKN A;  2KKC A;  4KDL B;  3PRZ A;  3MJW A;  1H8C A;  3PHW B;  4X57 B;  2N1W A;  2KX0 A;  2K6Q A;  3WAN A;  3LJ3 A;  4NNJ B;  1R4M I;  2NPT B;  2KQ7 A;  2JUO A;  2LVQ A;  2HJ8 A;  1P1A A;  4KVG B;  1Q0W B;  4HXD A;  2DZI A;  2ZVO A;  2O6V D;  5FR6 A;  5L95 C;  1T0Y A;  3W1S A;  2FCN A;  4NPN A;  2IY1 B;  4MJS B;  2N9E B;  1EF5 A;  3A9J B;  2AL3 A;  2L7R A;  2KAN A;  1H4R A;  2K25 A;  2FID A;  3AUL A;  4FLH A;  5JHA A;  4RMA A;  1E90 A;  1NBF C;  3PPA A;  4ZRI A;  2N1V A;  3KUC B;  2KVR A;  4N9F 4;  1TZ1 A;  3RUL A;  4PS7 A;  4IWO A;  2HD5 B;  2D3G A;  4E71 A;  2MSE D;  4FHJ A;  2MLB A;  3H7P B;  1C3T A;  5AZF A;  3ZNI D;  2L0F A;  4CHK A;  4ZRJ A;  1WX7 A;  5DPW A;  1ISN A;  2CR5 A;  1YD8 U;  1QZE A;  2PE9 A;  3UIP B;  3M63 B;  4DHJ B;  5JHB A;  4W9C A;  3VFK A;  2DZM A;  3PRP B;  1UH6 A;  2KN5 A;  3TL5 A;  2UWQ A;  3HK0 A;  1P98 A;  4JGH B;  2WYQ A;  2YLM A;  4EZJ A;  4GDL B;  3B0A A;  2IZV B;  1UBI A;  1UD7 A;  4FAD A;  4GB9 A;  2KC2 A;  1OTR B;  1L7Y A;  3ZUN A;  4EEW A;  3ZTC A;  4PYZ A;  1WGY A;  4II2 B;  3PV1 A;  2O2V B;  2GBJ A;  2KWC A;  3QA8 A;  3PLV A;  3I3T B;  2WX1 A;  3QWZ B;  2K8H A;  5AZH A;  1WY8 A;  3Q3J A;  5E6O A;  1U4A A;  4DBG A;  2KJR A;  2WDT B;  4XX5 A;  2DAJ A;  4B6W A;  5IA7 A;  4HJK A;  2RPQ A;  2KLG A;  2EKE C;  5AZG A;  4IG7 B;  1EUV B;  4E3C A;  3V61 A;  2BPS A;  3V60 A;  4BKS A;  4KSK C;  2L0T A;  4LJO B;  4BOZ B;  2DAF A;  4K1R B;  4MGY E;  4NY0 A;  2LXC A;  1V6E A;  3ZIM A;  4JLC A;  1J0G A;  3KUD B;  2MBB B;  4EKU A;  4GOC A;  3VUW A;  1OEY A;  2GBK A;  3X0W A;  3APC A;  4HLE A;  2ZVN A;  4ANV A;  3T9L A;  2LAS A;  2CHZ A;  3DVG X;  2FUH B;  1OQY A;  2DX5 B;  2K8B A;  4W9D A;  3PGE A;  5J2R A;  3QK0 A;  3NHE B;  4A3P A;  3QCA A;  3QIJ A;  4MDK E;  2ZEQ A;  4ANU A;  2DZJ A;  4WJN A;  1YQB A;  1XD3 B;  2FCS A;  1KM7 A;  3CST A;  3EC8 A;  3A1Q A;  4MGI E;  1UBQ A;  1ZW7 A;  2R2Q A;  4ANX A;  4EFO A;  2JT4 B;  4HWI B;  4ANW A;  3MTN B;  4MSM B;  3RUI B;  4DDI D;  2Z59 B;  4BBN C;  2N4F A;  3UIN B;  1CMX B;  1OEY J;  3ECI A;  4OVV A;  3IFW B;  4II3 B;  5LLI A;  4NJ6 A;  2R2O A;  2LI5 A;  3A1Q B;  3L17 A;  4TQ0 A;  2MBO A;  4XC2 A;  3DBH I;  3SHQ A;  3DPD A;  2IY0 B;  4G11 A;  2KMC A;  3M62 B;  3VTW A;  2AYO B;  2NBU A;  2MBQ A;  4FJV B;  4NQK E;  2Y5B B;  3IVF A;  4TV3 A;  2KK8 A;  1V80 A;  3HM3 A;  4NAW A;  1LQB A;  2KTR B;  2ZNV C;  3JVZ X;  3OAW A;  2K6D B;  4GMV A;  4NQL B;  1Q1O A;  4FN2 A;  3GZN I;  3VVW B;  4AOF A;  2LGX A;  2L00 B;  3B08 A;  3SD5 A;  2C60 A;  2MP2 A;  3V6C B;  1R4N I;  2G4D B;  3N3K B;  3WA0 A;  1KJT A;  1WR6 E;  2ZPN A;  5LXI B;  4B9K A;  3ZLZ A;  4JIO U;  4KV2 A;  5BO4 B;  3K9O B;  3A9K B;  4BBN F;  1I42 A;  5C23 A;  5J18 A;  1EO6 A;  5TR5 A;  1WXM A;  2ZCB A;  2KDF B;  4K7W A;  4HK2 A;  4KIK B;  3RYT A;  3X23 A;  2JWZ A;  4NJ7 A;  3APF A;  4ZRK A;  2KDB A;  2MQJ A;  1WJU A;  4GXB A;  5D6J B;  1WMH A;  1WI0 A;  1V81 A;  2IBI B;  4DDG D;  5G55 A;  3A33 B;  5E6N A;  4HCP B;  1UEL A;  3EEC A;  1KOT A;  1WGD A;  1SIF A;  1UGM A;  2MW5 A;  4I6N B;  1EF1 A;  2DYO A;  3QX1 A;  2V3S A;  3PTF C;  3DBL I;  3KYC D;  1V5T A;  4J6I A;  4LJP B;  2K1F A;  2C7N B;  5CHW A;  1J19 A;  2C7H A;  2KWU B;  1GC7 A;  4EUT A;  4A20 A;  1GG3 A;  2KD0 A;  4ICV A;  2LZ6 A;  3PHX B;  2MP2 B;  2PPH A;  1WE6 A;  4EOY A;  3ZO5 B;  4AP4 C;  5DCN A;  1V2Y A;  2ZJD A;  4HDQ A;  3ML9 A;  3AI5 A;  3C0R B;  4ASW C;  1RFA A;  3UGB B;  2WX0 A;  3PRM B;  4ZDV A;  3U7D A;  4KZC A;  2JF5 A;  2KFJ A;  2L3Z A;  4EZK A;  4EZL A;  3ZVV A;  4I6P A;  4DK5 A;  4W9H A;  1WGR A;  1WZ0 A;  2IYD B;  2D10 A;  2EMT A;  2KDI A;  3N30 A;  4KIK A;  5G2N A;  4DHZ E;  1GC6 A;  5CHF A;  2MX2 A;  5LXH A;  2KNB A;  3WAM A;  2M8S A;  1WM3 A;  2BF8 B;  3PSE B;  2BKR B;  2KJ6 A;  3BIN A;  3KH0 A;  2ZNV B;  4ICU A;  2BGF A;  3VXW A;  1ZKH A;  2DEN B;  2IO1 B; 
#chains in the Genus database with same CATH topology
 1E7P B;  1GNU A;  4BKS D;  2BYF A;  5DPR A;  5EE1 A;  3ZNZ B;  3ZKJ C;  1M94 A;  1HZ5 A;  2R61 A;  1WXS A;  5I4D A;  3RZF A;  3L4P A;  1D4B A;  2LD9 A;  3BYY B;  4M0W B;  2LRU A;  4G0N B;  4GIV A;  5D7G A;  3ZDM C;  3U52 E;  4C4V B;  3L0W B;  3DBR I;  2MRP A;  1TY0 A;  3VAW A;  1R4M B;  2QIL A;  2JRI B;  4YTM B;  1T6B X;  5BYQ A;  3Q8B A;  3AV8 A;  2KHW B;  2JVC A;  4JWU C;  3NVW A;  4ZYS A;  1F2R I;  4EE2 A;  2DYM A;  1WJN A;  4US8 A;  2N7E A;  1STE A;  4K7U A;  2KX3 A;  2FE8 A;  1XQQ A;  3H6N A;  4BVU C;  2A5U A;  1Y56 A;  2KDE B;  1E8X A;  4WH4 A;  2W82 A;  5CHV C;  4MEM A;  2J0M A;  3IG3 A;  4D2K A;  2W9N A;  4OZA A;  4AQ7 A;  4WIP A;  1SGH A;  1AAR A;  3Q6B A;  5D2M B;  3TUO A;  1QOF A;  1D6E C;  1WRD B;  2BYV E;  2WP9 B;  1T0S C;  1F1H A;  1FMA D;  4F1S A;  1TS3 A;  4AUQ C;  5FK9 C;  4MAC A;  4OW0 A;  1RFK A;  4C7Z A;  4YSY B;  1I4Q A;  3KQ4 A;  4HPP A;  2INC C;  2C9W B;  2I1K A;  1HXY D;  3PS6 A;  2KVZ A;  3NRZ A;  4PT5 A;  3OLM D;  4WJQ A;  1N60 A;  3QJZ A;  3L54 A;  5DPT A;  4LCD E;  3KUZ A;  3VUY A;  1E9M A;  3PVL A;  3RPF C;  2V1Y A;  2N9X A;  3LDZ E;  4W9K A;  2KZR A;  5G5H A;  1WGG A;  2OJR A;  3R3M A;  4ZOH C;  3A4S C;  3P2B A;  1WMH B;  3PO0 A;  4LDT B;  1ZDX A;  3SR6 A;  3RMK C;  4MH8 A;  4WQO B;  1IUE A;  1AW7 A;  1ET9 A;  2N7D A;  3U2S C;  3TMP B;  1WJ6 A;  2CKH B;  1GJZ A;  5J17 A;  3H7S A;  3W9C B;  1SSN A;  3RCZ A;  2BYT A;  1SIJ A;  3AE9 B;  1UGJ A;  4GU2 A;  2GBN A;  3MP9 A;  3VHT C;  4KGT A;  1MPE A;  2DBY A;  2M4N A;  1SJH D;  2K39 A;  2QDF A;  3PZ7 A;  2D3B A;  2JYT A;  4MGK E;  2KTR A;  5JZE B;  1NDD A;  3PLU A;  2BBC A;  4IWP A;  4B95 A;  1M4V A;  1YJ1 A;  3R66 C;  4PS3 A;  1NEN B;  4YL8 A;  4IW0 A;  3DHI C;  5HG2 A;  2AEH A;  2Z0E B;  4W9E A;  3HM6 X;  3SDL C;  5H92 C;  2LGD A;  3JSV B;  3ZNH B;  1IPG A;  2I38 A;  2OOB B;  1ZXH A;  5CX3 A;  4ARI A;  1FXT B;  3S2A A;  2PVO D;  2LJI A;  2DZK A;  1XLN A;  3W1S C;  4KZ0 A;  1TKG A;  3SEB A;  3MJ5 A;  3VQI A;  3NVY A;  3VH3 B;  2N9L A;  2MWS B;  2WWZ A;  4LK0 M;  3Q69 A;  1E7U A;  1HZ6 A;  2GB1 A;  1C4C A;  1YJI A;  1TTN A;  2GOW A;  4AWJ A;  4N58 A;  3K9P B;  1RYJ A;  3NZU A;  1WXQ A;  1G6J A;  1P0R A;  2JPH A;  3GOE A;  2KKC A;  3ZXR A;  2SEB D;  3MJW A;  2KX0 A;  4NNJ B;  2HJ8 A;  1P1A A;  4KVG B;  1QKZ A;  1C76 A;  1Q0W B;  4Q2J A;  1T0Y A;  1UF0 A;  3KWV A;  2N9E B;  1EF5 A;  2AL3 A;  2KAN A;  2K25 A;  1VJK A;  2IPK D;  4FLH A;  3RNF C;  1E90 A;  1NBF C;  1CK1 A;  3KUC B;  2PW9 A;  3RUL A;  3RNG C;  2M56 B;  4E71 A;  4FHJ A;  3I57 A;  1C3T A;  1ZDV A;  4ZRJ A;  5LNK 1;  5DPW A;  4OZC A;  4DHJ B;  3M63 B;  1JQ4 A;  2DZM A;  2LGS A;  1FNW A;  3IAM 1;  3HK0 A;  4JGH B;  2YLM A;  4EZJ A;  4GDL B;  2CJN A;  4GB9 A;  1OTR B;  1ZUD 2;  3ZTC A;  3LYY A;  4PYZ A;  4II2 B;  2O2V B;  2MHJ A;  2GBJ A;  4O1N A;  1PYW D;  1T5X D;  3P42 A;  2KWC A;  3PLV A;  3I3T B;  2WX1 A;  5AZH A;  1WY8 A;  1U4A A;  2WDT B;  4BAX A;  4XX5 A;  3SFD B;  2ONQ A;  4HJK A;  1UNS A;  5AZG A;  3V61 A;  4BKS A;  4RNA A;  4K1R B;  4MGY E;  1J7C A;  3GP7 A;  1B9R A;  2NTS A;  4WUR A;  4GOC A;  3X0W A;  3VR8 B;  3APC A;  1YN5 A;  4HLE A;  1C78 A;  4RGN A;  2DX5 B;  4W9D A;  5J2R A;  4LNI A;  3NHE B;  1XLO A;  3B9J A;  4RFB A;  4TSS A;  2MH7 A;  2KAC A;  2FCS A;  3A1Q A;  1ZW7 A;  2R2Q A;  4ANX A;  2JT4 B;  3RUI B;  4DDI D;  2K3U A;  3IFW B;  4US9 A;  1FFU A;  1HEZ E;  3AEA B;  3DPD A;  2L32 A;  4XWW A;  5BYS A;  2BVC A;  4FJV B;  4NQK E;  1V80 A;  2KK8 A;  4HEA 1;  1TIF A;  4NQL B;  4FN2 A;  3VVW B;  3B08 A;  1FPY A;  1SF0 A;  3ZLZ A;  3KWL A;  3K9O B;  5C23 A;  5J18 A;  1J7B A;  5TR5 A;  2BB6 A;  2KDF B;  4NJ7 A;  3AEC B;  2KDB A;  4ZHP A;  2MQJ A;  1CQV A;  4DDG D;  1FIQ A;  2BTE A;  4HCP B;  1SIF A;  2WHI A;  3U4E G;  4I6N B;  1EF1 A;  2DYO A;  2UU7 A;  3QX1 A;  4C7Y A;  3DBL I;  3BVZ A;  4LJP B;  3NVV A;  2C7N B;  2C7H A;  1OFF A;  3R2T A;  1WE6 A;  4AP4 C;  3VRA B;  3ML9 A;  3ZQ4 A;  1KF6 B;  3PRM B;  2JF5 A;  2KFJ A;  4EZL A;  3MHZ A;  3ZVV A;  1WGR A;  2IYD B;  2KDI A;  4KIK A;  5LXH A;  1TZO A;  2CU3 A;  1YOV B;  2MX2 A;  4P1C C;  1L6V A;  2BF8 B;  2G9H D;  3AE3 B;  1VZ8 A;  1SBB B;  4GDK B;  1E7V A;  2BB5 A;  1L4Z B;  4F7Z A;  4A55 A;  4CYE A;  2GBR A;  4NAM A;  4WJP A;  3TCA A;  2KMM A;  2O6V B;  3UIO B;  2ZCC A;  1Q5W B;  1E5W A;  2C5L C;  1X1M A;  1C1Y B;  2N7J A;  3AN1 A;  2D07 B;  5EDS A;  1BUI C;  2M17 A;  1TGZ B;  1WF9 A;  5IAA C;  4RH6 A;  2NR2 A;  1KLU D;  3BWU D;  2HTH A;  1NYR A;  2L8J A;  4WWP A;  3U8Z A;  4USA A;  3DWM A;  1RRB A;  4WWN A;  3V62 A;  1L0V B;  2ZZP B;  4MSQ B;  1PFD A;  1WX8 A;  2NVU I;  1LXD A;  2KTF A;  4TUU A;  4HKQ A;  2FCM A;  3ZTD A;  4BOS C;  1C79 A;  3L13 A;  4XDD A;  3SU8 X;  1DGJ A;  1GUA B;  3N1Y C;  4WWO A;  3QQ8 B;  4K3C A;  1SE9 A;  2CHX A;  2LJ5 A;  1I35 A;  3T3O A;  3HHM A;  4MGZ E;  4BFR A;  3P63 A;  2G4S A;  4GDK A;  4CQN A;  2V3N A;  5HKH A;  2C7M B;  4HDO A;  1LFD A;  2WGS A;  3B2F A;  1V5O A;  2VRR B;  1SE4 A;  1WXA A;  1I4H A;  1S1Q B;  3EA6 A;  4PYU A;  2JY6 A;  3AEE B;  2EMS A;  2CHW A;  2FNJ B;  3ZRC A;  3UQB A;  2PTL A;  3KYD D;  1S3S G;  2LFI A;  2BKF A;  3H1U A;  3IT6 B;  3QAR A;  3NY5 A;  4AJW A;  3O65 B;  1E8Y A;  4DXA B;  2ZPY A;  1V86 A;  5BMG A;  2MBE A;  2NMQ A;  2G3Q B;  3C8Y A;  3EHV A;  4GSW A;  4AS1 A;  1VD2 A;  1IP9 A;  2KFK B;  1IBX A;  4MEL A;  4URK A;  4B0E A;  2X8X X;  1FRR A;  1V97 A;  2WXI A;  1OQR A;  4KGS A;  3R7R A;  1YX5 B;  4FUL A;  2WQY B;  2J7Q B;  4C00 A;  4E74 A;  5GXG B;  1YX6 B;  2GMI C;  2I1J A;  1WFY A;  2JQR B;  2BS2 B;  2J0K A;  3WCQ A;  1SB3 C;  1ESF A;  3TEX A;  3TJP A;  1PDX A;  2H88 B;  4XYC A;  2FAZ A;  1R4N B;  3B2G A;  1NYQ A;  5EE3 A;  3R7Q A;  3VUX A;  5G5G A;  1K8R B;  2KQS A;  2L52 A;  5L83 A;  2XBB C;  3ZXV A;  3PZD A;  1KRH A;  2FBW B;  4H2A A;  2M19 A;  1A5R A;  3PT2 B;  2D3C A;  4XGA B;  3ZJT A;  2WXK A;  3OJ4 B;  1Z5S B;  1C77 A;  2JSV X;  2WXM A;  3ZDT A;  4IM0 A;  4W9I A;  3VH4 B;  4LDT D;  2O2V A;  4MH0 E;  5JH5 C;  3M95 A;  1JRU A;  4HPL B;  2YVC A;  4TQ1 A;  4XWT A;  1TKE A;  1P3Q U;  3ML8 A;  1P7F A;  4HPM B;  1B1Z A;  2IND C;  2PIA A;  2LUE A;  3DWG C;  4GN1 A;  2JXX A;  2K8C A;  2MJ3 A;  3WAO A;  4CO7 A;  3LB8 C;  3TEW A;  3APD A;  2DLB A;  3DOW A;  3GS2 A;  1WE7 A;  3TEY A;  2REX A;  4JX1 C;  4KDL B;  3AE1 B;  5HFY A;  2Q5W D;  4X57 B;  3LJ3 A;  1GB1 A;  1R4M I;  4RCO A;  2LVQ A;  2JUO A;  2OED A;  3FIL B;  3HVD A;  2O6V D;  5FR6 A;  2IY1 B;  4MJS B;  3AEF B;  3PPA A;  4ZRI A;  4N9F 4;  1TZ1 A;  1T0Q C;  4IWO A;  2HD5 B;  2XN9 C;  3H7P B;  1DYQ A;  1QOG A;  3HRD D;  1WX7 A;  1HTQ A;  2CR5 A;  1YD8 U;  3ZJV A;  4GLS C;  3VFK A;  1GOZ A;  2KN5 A;  2UWQ A;  1WYG A;  1BML C;  1P98 A;  2QCZ A;  3B0A A;  2N0S B;  2KC2 A;  3NJT A;  4EEW A;  2YEP B;  3PV1 A;  1VRA B;  2D3A A;  2WLB A;  3NS1 A;  3Q3J A;  2KJR A;  2DAJ A;  5IA7 A;  3OG5 A;  4C80 A;  3RFZ B;  2EKI A;  3R2I A;  3DBH B;  3CIR B;  5C3J B;  1K51 A;  3V60 A;  2QC8 A;  2DAF A;  3BVM A;  2MJD A;  3N1X C;  2MBB B;  3J9C A;  2GBK A;  3AB5 A;  3E56 A;  2V9H A;  2IDY A;  3QIJ A;  1VZ7 A;  4ITK A;  5BMI A;  3EC8 A;  4EFO A;  2GRI A;  4LNF A;  3UIN B;  1CMX B;  4ZHO A;  1OEY J;  4II3 B;  2R2O A;  2LI5 A;  2L83 A;  1N6Z A;  2MBO A;  4XC2 A;  4G11 A;  3ABV B;  1QLB B;  2NBU A;  4LNN A;  1HTO A;  2W3R A;  4J3O D;  2HJ1 A;  2Y3A A;  1N5X A;  4NAW A;  1LQB A;  2HDE A;  1IGC A;  4P1B C;  4AOF A;  2L00 B;  1AN8 A;  2AQ1 B;  3SD5 A;  1N62 A;  3V6C B;  2G4D B;  1WR6 E;  2M0A A;  2ZPN A;  5AUI A;  1XEE A;  4L1B A;  4KV2 A;  2PMV A;  5BO4 B;  1WSP A;  3A9K B;  4OZB A;  1WXM A;  3NUH B;  4S0R A;  1SXT A;  2E3T A;  4K7W A;  1WJU A;  4GXB A;  5D6J B;  1V81 A;  5G55 A;  5E6N A;  3EEC A;  1KOT A;  1UGM A;  4RGT A;  2V3S A;  1PGB A;  2KDM A;  2LEK A;  2LMC A;  2LZ6 A;  3PHX B;  4EOY A;  1V2Y A;  2WDR B;  3AI5 A;  1HQR D;  2WU2 B;  3AE4 B;  3C0R B;  4ASW C;  3UGB B;  2WX0 A;  4KZC A;  1ENF A;  4YXD B;  4W9H A;  5G2N A;  4DHZ E;  1GC6 A;  1D5Z C;  1N61 A;  3BIN A;  3KH0 A;  1D5X C;  4ICU A;  2WXH A;  1ZKH A;  2PKO A;  2WXR A;  2QMT A;  2L1A A;  5DPS A;  3L08 A;  1GPX A;  1DOX A;  3KW5 B;  3NZ3 A;  1LM8 B;  3W5V B;  3CSF A;  3JW0 X;  3TSS A;  3RN9 C;  3E9S A;  2KWV B;  3NG0 A;  2KXJ A;  1SJE D;  1KH0 A;  4HJG E;  3QC8 B;  4A9A A;  3WAL A;  4F8C B;  3QHT A;  1WXV A;  3IT4 B;  3N32 A;  4FHK A;  2LVO A;  1UWM A;  1TS5 A;  3AU5 A;  4A90 A;  1V49 A;  4MJS A;  2J0J A;  4MM3 B;  2RD0 A;  1RLF A;  4WWM A;  3TBL D;  1KLV A;  4A8X C;  2PJH A;  3MFG A;  4K81 A;  1QOB A;  2PE6 B;  1L4D B;  2J4X A;  2WXQ A;  4L23 A;  1YIW A;  3JYU A;  3I63 C;  2PEA A;  2LRW A;  4YSZ B;  5D3D A;  4WAA A;  3RI7 C;  1OGW A;  2RDG A;  2VH1 A;  3DVG Y;  3KVF B;  3ONS A;  1ROE A;  1LO5 D;  4FJY A;  4XDC A;  1V9J A;  3AE6 B;  3URY A;  4FJZ A;  1I4G A;  1OQQ A;  1ZOY B;  2KQ4 X;  4ACF A;  4MT5 A;  4TMA B;  1JWS D;  1UUP A;  1XO3 A;  3Q2A C;  4P7I A;  2KOX A;  4OVU A;  1E0Z A;  4DHZ B;  2QSD A;  3M3J A;  1EU3 A;  4FA6 A;  3WIM A;  4G50 A;  4WJO A;  1IYF A;  2MEK A;  2BWE S;  3BY4 B;  4RF0 A;  1UZX B;  1F0Z A;  1ZGU B;  3UF8 A;  3AMZ A;  1V1O A;  3DBS A;  2Y5P A;  3DQV A;  2NS5 A;  2WU5 B;  2DHZ A;  4DHJ D;  4YWG G;  4XE0 A;  2RSU A;  3EUB 2;  2NCN A;  4NAW B;  4AJY B;  5AEK B;  3ZW3 A;  4JPS A;  5KHO A;  3Q3M C;  2WXP A;  4ZYN A;  1YNT E;  1QF6 A;  4HVB A;  3ZGZ A;  1I4P A;  2LWP A;  4ZRP A;  2XK5 A;  1WJ4 A;  1MG4 A;  4S17 A;  1D3Z A;  1WYW B;  3CF6 E;  1BXT A;  4IM2 A;  2RGF A;  4KSL C;  3Q8F A;  4G3X B;  1QIL A;  4IM3 A;  1YJJ A;  3DVN V;  1NVI D;  1WGH A;  3VR9 B;  1GB4 A;  3A9J A;  4C56 C;  2D11 A;  1NI2 A;  3GE3 C;  3CWI A;  2KT7 A;  3ALB A;  2QJL A;  2DNF A;  3N9Y C;  2NPT A;  3SFE B;  3T8M A;  3EFU A;  1XLQ A;  3CMM B;  1MG8 A;  1VCB A;  3BII D;  3Q3F A;  2JZ3 B;  3H7P A;  3EGR A;  1Y8R C;  3Q8C A;  1YN3 A;  2RPV A;  3JSV A;  2HE7 A;  1TY2 A;  5KHQ A;  5BMH A;  1PQS A;  3AM9 A;  3RZW C;  2AQ2 B;  4UDU C;  1NI3 A;  1TS4 A;  1VZ6 A;  3B1L X;  1FM0 D;  1EWY C;  2ASQ A;  3W1Y A;  2AL6 A;  3AU4 A;  3DDC B;  1E8W A;  4W9L A;  2JX5 A;  3OJ3 A;  1J7A A;  3H9D A;  1WIA A;  3HUI A;  3GE8 C;  2KO3 A;  4RM9 A;  3ZJU A;  3ZNG C;  1F9J A;  2LGY A;  1KLG D;  2Z8L A;  4XZ4 A;  3L16 A;  3U7Z A;  2SAK A;  1E6E B;  2BWF A;  3UI3 A;  1L6U A;  1JCK B;  2ZW1 A;  2FCQ A;  4LNO A;  2WXL A;  2IO2 B;  4A3O A;  2L76 A;  3V05 A;  2B76 B;  2DYB A;  3FKY A;  1P9D U;  2W3S A;  3D32 A;  4BZA A;  1H8C A;  1TT5 B;  2N1W A;  2K6Q A;  3WAN A;  2NPT B;  2KQ7 A;  1ZPS A;  2V0G A;  2DZI A;  1MI0 A;  3DBR B;  3W1S A;  2FCN A;  3A9J B;  2FID A;  4B0M A;  1WGK A;  3Q8E A;  1TJE A;  2KVR A;  4P6V F;  2D3G A;  2WDQ B;  2MSE D;  5AZF A;  2KAJ A;  2L0F A;  1PUT A;  1XLP A;  2OHF A;  4CHK A;  3FIL A;  1ISN A;  2WXF A;  5C2T B;  2G1E A;  2ACZ B;  2PE9 A;  3LXF A;  5JHB A;  4W9C A;  3PRP B;  1UH6 A;  3TL5 A;  4DXF A;  1L0Y B;  1K53 A;  2IZV B;  4KKJ A;  4FAD A;  5HI1 A;  1VR9 A;  1WGY A;  2IGG A;  2LHD A;  3QWZ B;  3I5J C;  2RDH A;  3BZD B;  2INN E;  4N59 A;  4ZRQ A;  1QOA A;  4B6W A;  2RPQ A;  2KLG A;  2EKE C;  1A70 A;  4IG7 B;  3Q14 C;  4E3C A;  2WNM A;  3W5U B;  4LJO B;  4N6E B;  4KGR A;  4NY0 A;  2LXC A;  1V6E A;  3MC8 A;  4QAY A;  4JLC A;  1XXG A;  1FD6 A;  1MVK A;  4EKU A;  1OEY A;  2V3P A;  2BS3 B;  4ANV A;  3VRB B;  2CHZ A;  2FUH B;  1OQY A;  2K8B A;  4A3P A;  1JW9 D;  2D5G A;  3Q8A A;  3BK1 A;  4MDK E;  1YMH E;  4ANU A;  1XD3 B;  1FXI A;  1UBQ A;  5BYR A;  4ANW A;  2E6X A;  5IOI A;  2Z59 B;  2LGI A;  5FKA C;  2DWQ A;  3ECI A;  4OVV A;  1FFV A;  1KTK A;  3L17 A;  4TQ0 A;  1C4P A;  3R8B A;  5T8I A;  1MHX A;  3DBH I;  4WAF A;  2KMC A;  3OWE B;  1Q10 A;  3VTW A;  2AYO B;  2MBQ A;  2Y5B B;  3IVF A;  4TV3 A;  2K6D B;  4GMV A;  1JRO A;  3GZN I;  4KKI A;  5EE0 A;  2C60 A;  2MP2 A;  1JRP A;  3N3K B;  1KJT A;  2RDB C;  5LXI B;  2K5P A;  1EU4 A;  1MFW A;  3T3N A;  2Y5C A;  5IN7 A;  1PGA A;  3RYT A;  3KLS X;  1JML A;  1WMH A;  1WI0 A;  2IBI B;  1SEB D;  2NTT A;  2WXO A;  1WGD A;  4YTP B;  2MW5 A;  2ZW0 A;  4J6I A;  1FNU A;  2K1F A;  1YQ4 B;  5CHW A;  2BS4 B;  1CJE A;  2MP2 B;  2PPH A;  2JXT A;  1N63 A;  4DQO C;  1L0X B;  1RFA A;  4ZDV A;  1YN4 A;  2WXG A;  4EZK A;  4I6P A;  2D10 A;  5CHF A;  2KNB A;  1QQR A;  3WAM A;  2M8S A;  3AE8 B;  1WM3 A;  3PSE B;  2BKR B;  2KJ6 A;  2ZNV B;  1R7S A;  2BGF A;  2BW2 A;  2WXJ A;  2DEN B;  1ZXI A;  3O13 A;  4JL9 A;  4IC7 B;  1TKY A;  1YQ3 B;  1WM2 A;  1I4X A;  5JXV A;  1FNV A;  3A4R A;  3RNB C;  1VDV A;  1L2N A;  4DWF A;  3ZRF A;  2VH2 A;  2LUM A;  5C1Z A;  4K7S A;  4W9F A;  2X38 A;  1WWT A;  4HCN B;  1FRD A;  1FCL A;  1I7H A;  1DOI A;  2KMA A;  2FUG 1;  2PVG C;  4JE3 B;  2O6V A;  2JRH A;  1HE8 A;  2LVP A;  4DXG A;  2KWD A;  4YTN B;  2NBW B;  1D5M C;  3H8H A;  3AEB B;  3DVN U;  2IO3 B;  4IWQ A;  4IKG A;  4PS8 A;  4HRO A;  1K50 A;  3AXC A;  3TIX A;  5IKC M;  3P4P B;  2KYW A;  4W9J A;  1LGR A;  3WAP A;  4JQW C;  1F77 A;  2OJW A;  3BYT B;  1E10 A;  4I6L B;  5GMV A;  2KJH B;  4MM3 A;  3MHS D;  2RR9 A;  4KDI C;  4R3D A;  4LNK A;  2B3A A;  5CTR C;  1WH3 A;  2L05 A;  1WR1 A;  4RF1 A;  2WDV B;  2FIF A;  4IUM B;  4IDI A;  2V4L A;  3ENE A;  2CS4 A;  3NOB A;  4LLG M;  4GGQ A;  4HRS A;  1PGX A;  2NBV B;  2J52 A;  1F52 A;  5D94 A;  4JWS C;  1XCT L;  2MA9 B;  2PLP A;  3NZS A;  1WZ3 A;  2N9K A;  2KFK A;  2J53 A;  4C4V A;  4P16 A;  2D2Q A;  1TS2 A;  4W9G A;  1RM6 C;  2KLC A;  1NEK B;  4HKZ E;  2UYZ B;  4REZ A;  3DHH C;  2AWT A;  2M1M A;  5IP4 D;  3A9K A;  2XEW A;  2W54 A;  1E8Z A;  1K52 A;  2KN4 A;  3QAQ A;  3U30 A;  3ETR A;  4RM8 A;  2MBH A;  2H89 B;  1Z2M A;  3P1M A;  4M8N A;  1FO4 A;  1J8C A;  1TBE A;  5HHD G;  5MPO A;  2K22 A;  2G45 B;  5IO9 A;  3RD2 A;  3RNC C;  2IJ0 A;  3N20 C;  3P4S B;  4FXC A;  2GBM A;  3HIZ A;  2N9P C;  3L10 B;  2BYE A;  2XK5 B;  3VTU A;  1SE3 A;  4PK1 A;  2K9X A;  1ET6 A;  3PRE A;  1DOY A;  3IHP C;  3P4R B;  3IAS 1;  1UWX A;  1V1P A;  1N5W A;  3V6E B;  2MJE A;  4M8M A;  2GLS A;  3RNA C;  2IGH A;  3DCG A;  4BKT A;  2TSS A;  3I9V 1;  1C4A A;  1TYG B;  3NVZ A;  2A4Z A;  3NS8 A;  3TEZ A;  3MC0 B;  2CU1 A;  2IO0 B;  3DBL B;  4FBJ B;  2V4I B;  1BT0 A;  4RGO S;  2LXA A;  2AX5 A;  4IOI E;  1AYF A;  1T0R C;  3Q3O C;  4YT0 B;  3BK2 A;  1KFY B;  1JWM D;  4BKG A;  2QHO A;  2I2Y A;  2KC1 A;  2ICI A;  3UQA A;  2YEP F;  1F2R C;  2M0X A;  1WX9 A;  2JZZ A;  3W2D A;  1AWD A;  3P4Q B;  3N1Z C;  3RT3 B;  2MCN B;  2K0P A;  2Z0D B;  3VTV A;  4ARC A;  4GDL A;  2BQQ A;  1XT9 B;  4NJC A;  3IBE A;  1RAX A;  3VDZ A;  3AE2 B;  4TKN A;  3PRZ A;  2HTM E;  1WRI A;  2VZK D;  3PHW B;  2JZP A;  1ACC A;  4OHJ A;  3HVZ A;  4HXD A;  2LHE A;  1QT9 A;  2ZVO A;  5L95 C;  4NPN A;  5D3I B;  2L7R A;  1H4R A;  3AUL A;  5JHA A;  4RMA A;  5E6J A;  2N1V A;  1EWC A;  1CZP A;  1IBX B;  4PS7 A;  2WS3 B;  3Q3N C;  2MLB A;  3ZNI D;  3GB1 A;  1QZE A;  5AUK A;  3UIP B;  2CJO A;  2WYQ A;  5H8Y E;  1UBI A;  1UD7 A;  3RNE C;  1L7Y A;  3ZUN A;  1T3Q A;  3AE5 B;  3QA8 A;  4M00 A;  2K8H A;  5E6O A;  4LTU A;  4DBG A;  1JAL A;  2JU6 X;  3BVG A;  4K3B A;  1GAQ B;  2VZK B;  1EUV B;  2INP E;  4A6Q A;  2BPS A;  4KSK C;  2L0T A;  4BOZ B;  4M02 A;  3ZIM A;  5EE9 A;  1J0G A;  3EFC A;  2QIE B;  3KUD B;  3VUW A;  3MC9 A;  2GI9 A;  1L5P A;  5TSS A;  2ZVN A;  3T9L A;  2LAS A;  4L2Y A;  3DVG X;  3PGE A;  3QK0 A;  3QCA A;  3AE7 B;  2ZEQ A;  2DZJ A;  1HA5 A;  1YQB A;  4WJN A;  1ZP0 B;  1MHH E;  2W55 A;  1KM7 A;  3CST A;  4RGM A;  4MGI E;  4HWI B;  3MTN B;  4MSM B;  1I4R A;  1FXA A;  2EEL A;  1MJD A;  4BBN C;  1RWS A;  2N4F A;  3AEG B;  1JWB D;  5LLI A;  3V3X A;  4NJ6 A;  3A1Q B;  3PZ8 A;  1XCQ L;  1FCC C;  4NZL B;  3SHQ A;  2IY0 B;  2WXN A;  3M62 B;  1VLB A;  3HM3 A;  2QEJ C;  3FAH A;  2ZNV C;  2KTR B;  3OAW A;  3JVZ X;  1Q1O A;  2LGX A;  1XF5 L;  1R4N I;  3WA0 A;  1ZE3 D;  4B9K A;  1V1P B;  4JIO U;  4BBN F;  1I42 A;  1V8C A;  2IGD A;  2ON8 A;  1EO6 A;  1FEH A;  2ZCB A;  2AQ3 B;  4KIK B;  4HK2 A;  3C19 A;  3X23 A;  2JWZ A;  2J42 A;  3APF A;  4ZRK A;  5FR3 A;  4M01 A;  3ZYY X;  3A33 B;  1UEL A;  1EM7 A;  3AED B;  3IXS A;  1IGD A;  1SE2 A;  3PTF C;  2JYE A;  3KYC D;  1JWA D;  1V5T A;  1J19 A;  3FC4 A;  2KWU B;  1GC7 A;  4EUT A;  4YSX B;  4A20 A;  1GG3 A;  2KD0 A;  4ICV A;  3ZO5 B;  5DCN A;  2ZJD A;  4HDQ A;  3DHG C;  2XNA C;  3GZN B;  1P7E A;  2RMM A;  4WQM A;  3U7D A;  1JWU D;  2L3Z A;  4OVZ A;  4M0W A;  4KX6 B;  4DK5 A;  1WZ0 A;  2EMT A;  3N30 A;  1C9F A;  2JWU A;  2BT6 A;  3VXW A;  3AH7 A;  5E6P A;  2IO1 B; 
#chains in the Genus database with same CATH homology
 5DPS A;  3L08 A;  4GDK B;  4JL9 A;  1E7V A;  1GNU A;  4BKS D;  2BYF A;  3KW5 B;  4IC7 B;  1WM2 A;  5DPR A;  3ZKJ C;  1M94 A;  3ZNZ B;  1LM8 B;  1WXS A;  4F7Z A;  3A4R A;  4CYE A;  2GBR A;  3CSF A;  4DWF A;  3RZF A;  1L2N A;  3ZRF A;  3JW0 X;  5C1Z A;  2LD9 A;  4K7S A;  4WJP A;  4M0W B;  2LRU A;  4G0N B;  4W9F A;  3TCA A;  2O6V B;  4GIV A;  3UIO B;  2KWV B;  2ZCC A;  1Q5W B;  2KXJ A;  5D7G A;  3ZDM C;  1E5W A;  3QC8 B;  3L0W B;  3WAL A;  4HCN B;  4F8C B;  2C5L C;  3DBR I;  1X1M A;  3QHT A;  1WXV A;  2MRP A;  1C1Y B;  3N32 A;  2KMA A;  2D07 B;  4FHK A;  2LVO A;  3VAW A;  5EDS A;  3AU5 A;  2O6V A;  2JRH A;  2M17 A;  1TGZ B;  1HE8 A;  1WF9 A;  5IAA C;  2LVP A;  2JRI B;  1V49 A;  2NR2 A;  2HTH A;  4MJS A;  2J0J A;  2KHW B;  2JVC A;  2NBW B;  2L8J A;  4WWP A;  3U8Z A;  2RD0 A;  1RLF A;  3DVN U;  1RRB A;  4WWN A;  3V62 A;  2ZZP B;  4MSQ B;  2IO3 B;  1WX8 A;  2NVU I;  2PJH A;  1LXD A;  4IWQ A;  3TBL D;  2DYM A;  2KTF A;  1KLV A;  4K81 A;  4PS8 A;  1WJN A;  4TUU A;  2PE6 B;  2FCM A;  3AXC A;  3TIX A;  3ZTD A;  2N7E A;  4BOS C;  1YIW A;  3JYU A;  4K7U A;  4W9J A;  2KX3 A;  1XQQ A;  2PEA A;  4JQW C;  3L13 A;  2LRW A;  3WAP A;  3H6N A;  4BVU C;  2A5U A;  3SU8 X;  4WAA A;  1OGW A;  2KDE B;  1E8X A;  5CHV C;  4MEM A;  1GUA B;  2J0M A;  3DVG Y;  3IG3 A;  3KVF B;  3ONS A;  3QQ8 B;  4I6L B;  4WWO A;  5GMV A;  2KJH B;  4FJY A;  4MM3 A;  1SE9 A;  2CHX A;  2LJ5 A;  2W9N A;  1I35 A;  3MHS D;  1V9J A;  2RR9 A;  3HHM A;  4KDI C;  4MGZ E;  4FJZ A;  1SGH A;  2B3A A;  4BFR A;  2G4S A;  1AAR A;  4GDK A;  5CTR C;  5D2M B;  1WH3 A;  1WRD B;  2BYV E;  5HKH A;  2C7M B;  2L05 A;  1WR1 A;  4HDO A;  1LFD A;  1V5O A;  2VRR B;  1WXA A;  4F1S A;  1S1Q B;  4P7I A;  4AUQ C;  2KOX A;  4PYU A;  2JY6 A;  2EMS A;  2FIF A;  2CHW A;  2FNJ B;  4IUM B;  4OVU A;  3KYD D;  2V4L A;  3ZRC A;  4DHZ B;  3UQB A;  3ENE A;  1S3S G;  2CS4 A;  2C9W B;  2I1K A;  3M3J A;  3NOB A;  4FA6 A;  4GGQ A;  3PS6 A;  3WIM A;  4G50 A;  4WJO A;  1IYF A;  2NBV B;  3OLM D;  2BKF A;  2BWE S;  3BY4 B;  3H1U A;  3QAR A;  4WJQ A;  3NY5 A;  5D94 A;  1UZX B;  4AJW A;  1ZGU B;  3QJZ A;  3UF8 A;  3O65 B;  1E8Y A;  3L54 A;  2ZPY A;  4DXA B;  3DBS A;  1V86 A;  4LCD E;  5DPT A;  2MBE A;  3DQV A;  3KUZ A;  2G3Q B;  2NS5 A;  3VUY A;  2MA9 B;  2DHZ A;  4DHJ D;  3PVL A;  2V1Y A;  3EHV A;  2N9X A;  4GSW A;  3NZS A;  1VD2 A;  2RSU A;  1IP9 A;  2NCN A;  3LDZ E;  4NAW B;  2KZR A;  4W9K A;  4AJY B;  1WGG A;  2OJR A;  3R3M A;  1WZ3 A;  5AEK B;  2KFK A;  3A4S C;  3ZW3 A;  3P2B A;  2D2Q A;  5KHO A;  1WMH B;  2KFK B;  4W9G A;  4LDT B;  4MEL A;  4ZYN A;  4URK A;  4HVB A;  2KLC A;  2LWP A;  4WQO B;  2UYZ B;  2XK5 A;  1WJ4 A;  3R7R A;  2N7D A;  1D3Z A;  2AWT A;  2M1M A;  1YX5 B;  3TMP B;  1WJ6 A;  2CKH B;  3A9K A;  1WYW B;  2XEW A;  4FUL A;  5J17 A;  3H7S A;  1GJZ A;  1E8Z A;  3CF6 E;  3QAQ A;  3RCZ A;  3U30 A;  2J7Q B;  4IM2 A;  4RM8 A;  4E74 A;  2MBH A;  2RGF A;  1Z2M A;  4KSL C;  4G3X B;  1YX6 B;  2I1J A;  2GMI C;  1WFY A;  1TBE A;  4GU2 A;  4M8N A;  1J8C A;  2J0K A;  2G45 B;  2GBN A;  4IM3 A;  3VHT C;  3RD2 A;  2M4N A;  2K39 A;  3DVN V;  3TJP A;  4MGK E;  2KTR A;  2GBM A;  1WGH A;  2FAZ A;  3HIZ A;  3A9J A;  3R7Q A;  2N9P C;  3L10 B;  1NDD A;  3VUX A;  3PLU A;  5JZE B;  2BYE A;  2D11 A;  4IWP A;  4B95 A;  1K8R B;  1NI2 A;  1YJ1 A;  3R66 C;  4PS3 A;  2XK5 B;  2KQS A;  3ALB A;  4IW0 A;  4YL8 A;  3VTU A;  5L83 A;  2AEH A;  2Z0E B;  4W9E A;  5E6P A;  3HM6 X;  3PRE A;  3T8M A;  2NPT A;  2XBB C;  3EFU A;  3SDL C;  3IHP C;  3CMM B;  1MG8 A;  2LGD A;  3PZD A;  1VCB A;  3Q3F A;  2JZ3 B;  3H7P A;  3V6E B;  4M8M A;  3JSV B;  1A5R A;  1Y8R C;  3PT2 B;  3ZNH B;  1IPG A;  3JSV A;  4BKT A;  3DCG A;  3OJ4 B;  1Z5S B;  2HE7 A;  2OOB B;  5KHQ A;  5CX3 A;  1PQS A;  1FXT B;  3S2A A;  2A4Z A;  3RZW C;  3NS8 A;  2DZK A;  3ZDT A;  4IM0 A;  3B1L X;  4W9I A;  2ASQ A;  3W1S C;  2CU1 A;  4KZ0 A;  3VH4 B;  4LDT D;  2IO0 B;  3W1Y A;  2AL6 A;  2O2V A;  4FBJ B;  3AU4 A;  3DDC B;  4MH0 E;  5JH5 C;  3M95 A;  3VQI A;  1BT0 A;  1JRU A;  1E8W A;  2LXA A;  3VH3 B;  4W9L A;  3OJ3 A;  2MWS B;  4HPL B;  2YVC A;  3H9D A;  1WIA A;  4TQ1 A;  2WWZ A;  2KO3 A;  1P3Q U;  1E7U A;  3ML8 A;  4RM9 A;  4BKG A;  2QHO A;  4HPM B;  2KC1 A;  3ZNG C;  1F9J A;  1TTN A;  2LUE A;  2GOW A;  2LGY A;  4XZ4 A;  4AWJ A;  3UQA A;  3L16 A;  3K9P B;  4GN1 A;  2JXX A;  3NZU A;  2K8C A;  2M0X A;  1WX9 A;  2BWF A;  2JZZ A;  1G6J A;  3WAO A;  4CO7 A;  3RT3 B;  1P0R A;  2FCQ A;  2JPH A;  2MCN B;  3APD A;  2Z0D B;  3DOW A;  3GOE A;  2IO2 B;  4A3O A;  2L76 A;  3VTV A;  4GDL A;  1WE7 A;  1XT9 B;  2REX A;  2DYB A;  3IBE A;  1P9D U;  1RAX A;  3VDZ A;  3D32 A;  4TKN A;  2KKC A;  4KDL B;  3PRZ A;  3MJW A;  1H8C A;  3PHW B;  4X57 B;  2N1W A;  2KX0 A;  2K6Q A;  3WAN A;  3LJ3 A;  4NNJ B;  1R4M I;  2NPT B;  2KQ7 A;  2JUO A;  2LVQ A;  2HJ8 A;  1P1A A;  4KVG B;  1Q0W B;  4HXD A;  2DZI A;  2ZVO A;  2O6V D;  5FR6 A;  5L95 C;  1T0Y A;  3W1S A;  2FCN A;  4NPN A;  2IY1 B;  4MJS B;  2N9E B;  1EF5 A;  3A9J B;  2AL3 A;  2L7R A;  2KAN A;  1H4R A;  2K25 A;  2FID A;  3AUL A;  4FLH A;  5JHA A;  4RMA A;  1E90 A;  1NBF C;  3PPA A;  4ZRI A;  2N1V A;  3KUC B;  2KVR A;  4N9F 4;  1TZ1 A;  3RUL A;  4PS7 A;  4IWO A;  2HD5 B;  2D3G A;  4E71 A;  2MSE D;  4FHJ A;  2MLB A;  3H7P B;  1C3T A;  5AZF A;  3ZNI D;  2L0F A;  4CHK A;  4ZRJ A;  1WX7 A;  5DPW A;  1ISN A;  2CR5 A;  1YD8 U;  1QZE A;  2PE9 A;  3UIP B;  3M63 B;  4DHJ B;  5JHB A;  4W9C A;  3VFK A;  2DZM A;  3PRP B;  1UH6 A;  2KN5 A;  3TL5 A;  2UWQ A;  3HK0 A;  1P98 A;  4JGH B;  2WYQ A;  2YLM A;  4EZJ A;  4GDL B;  3B0A A;  2IZV B;  1UBI A;  1UD7 A;  4FAD A;  4GB9 A;  2KC2 A;  1OTR B;  1L7Y A;  3ZUN A;  4EEW A;  3ZTC A;  4PYZ A;  1WGY A;  4II2 B;  3PV1 A;  2O2V B;  2GBJ A;  2KWC A;  3QA8 A;  3PLV A;  3I3T B;  2WX1 A;  3QWZ B;  2K8H A;  5AZH A;  1WY8 A;  3Q3J A;  5E6O A;  1U4A A;  4DBG A;  2KJR A;  2WDT B;  4XX5 A;  2DAJ A;  4B6W A;  5IA7 A;  4HJK A;  2RPQ A;  2KLG A;  2EKE C;  5AZG A;  4IG7 B;  1EUV B;  4E3C A;  3V61 A;  2BPS A;  3V60 A;  4BKS A;  4KSK C;  2L0T A;  4LJO B;  4BOZ B;  2DAF A;  4K1R B;  4MGY E;  4NY0 A;  2LXC A;  1V6E A;  3ZIM A;  4JLC A;  1J0G A;  3KUD B;  2MBB B;  4EKU A;  4GOC A;  3VUW A;  1OEY A;  2GBK A;  3X0W A;  3APC A;  4HLE A;  2ZVN A;  4ANV A;  3T9L A;  2LAS A;  2CHZ A;  3DVG X;  2FUH B;  1OQY A;  2DX5 B;  2K8B A;  4W9D A;  3PGE A;  5J2R A;  3QK0 A;  3NHE B;  4A3P A;  3QCA A;  3QIJ A;  4MDK E;  2ZEQ A;  4ANU A;  2DZJ A;  4WJN A;  1YQB A;  1XD3 B;  2FCS A;  1KM7 A;  3CST A;  3EC8 A;  3A1Q A;  4MGI E;  1UBQ A;  1ZW7 A;  2R2Q A;  4ANX A;  4EFO A;  2JT4 B;  4HWI B;  4ANW A;  3MTN B;  4MSM B;  3RUI B;  4DDI D;  2Z59 B;  4BBN C;  2N4F A;  3UIN B;  1CMX B;  1OEY J;  3ECI A;  4OVV A;  3IFW B;  4II3 B;  5LLI A;  4NJ6 A;  2R2O A;  2LI5 A;  3A1Q B;  3L17 A;  4TQ0 A;  2MBO A;  4XC2 A;  3DBH I;  3SHQ A;  3DPD A;  2IY0 B;  4G11 A;  2KMC A;  3M62 B;  3VTW A;  2AYO B;  2NBU A;  2MBQ A;  4FJV B;  4NQK E;  2Y5B B;  3IVF A;  4TV3 A;  2KK8 A;  1V80 A;  3HM3 A;  4NAW A;  1LQB A;  2KTR B;  2ZNV C;  3JVZ X;  3OAW A;  2K6D B;  4GMV A;  4NQL B;  1Q1O A;  4FN2 A;  3GZN I;  3VVW B;  4AOF A;  2LGX A;  2L00 B;  3B08 A;  3SD5 A;  2C60 A;  2MP2 A;  3V6C B;  1R4N I;  2G4D B;  3N3K B;  3WA0 A;  1KJT A;  1WR6 E;  2ZPN A;  5LXI B;  4B9K A;  3ZLZ A;  4JIO U;  4KV2 A;  5BO4 B;  3K9O B;  3A9K B;  4BBN F;  1I42 A;  5C23 A;  5J18 A;  1EO6 A;  5TR5 A;  1WXM A;  2ZCB A;  2KDF B;  4K7W A;  4HK2 A;  4KIK B;  3RYT A;  3X23 A;  2JWZ A;  4NJ7 A;  3APF A;  4ZRK A;  2KDB A;  2MQJ A;  1WJU A;  4GXB A;  5D6J B;  1WMH A;  1WI0 A;  1V81 A;  2IBI B;  4DDG D;  5G55 A;  3A33 B;  5E6N A;  4HCP B;  1UEL A;  3EEC A;  1KOT A;  1WGD A;  1SIF A;  1UGM A;  2MW5 A;  4I6N B;  1EF1 A;  2DYO A;  3QX1 A;  2V3S A;  3PTF C;  3DBL I;  3KYC D;  1V5T A;  4J6I A;  4LJP B;  2K1F A;  2C7N B;  5CHW A;  1J19 A;  2C7H A;  2KWU B;  1GC7 A;  4EUT A;  4A20 A;  1GG3 A;  2KD0 A;  4ICV A;  2LZ6 A;  3PHX B;  2MP2 B;  2PPH A;  1WE6 A;  4EOY A;  3ZO5 B;  4AP4 C;  5DCN A;  1V2Y A;  2ZJD A;  4HDQ A;  3ML9 A;  3AI5 A;  3C0R B;  4ASW C;  1RFA A;  3UGB B;  2WX0 A;  3PRM B;  4ZDV A;  3U7D A;  4KZC A;  2JF5 A;  2KFJ A;  2L3Z A;  4EZK A;  4EZL A;  3ZVV A;  4I6P A;  4DK5 A;  4W9H A;  1WGR A;  1WZ0 A;  2IYD B;  2D10 A;  2EMT A;  2KDI A;  3N30 A;  4KIK A;  5G2N A;  4DHZ E;  1GC6 A;  5CHF A;  2MX2 A;  5LXH A;  2KNB A;  3WAM A;  2M8S A;  1WM3 A;  2BF8 B;  3PSE B;  2BKR B;  2KJ6 A;  3BIN A;  3KH0 A;  2ZNV B;  4ICU A;  2BGF A;  3VXW A;  1ZKH A;  2DEN B;  2IO1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...