2B3AA

Solution structure of the ras-binding domain of the ral guanosine dissociation stimulator
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
87
structure length
87
Chain Sequence
DCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New insights into binding of the possible cancer target RalGDS
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ral guanine nucleotide dissociation stimulator
total genus 17
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2005-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2b3aA00
2ZPNA 3PS6A 2D11A 3QA8A 1XQQA 4IUMB 1WGYA 1Z2MA 3VTVA 4MGIE 3WAOA 3UINB 2A5UA 2GBNA 4A3PA 2K8CA 1OEYJ 4KZ0A 1NBFC 3ZDMC 4WWPA 1XD3B 2BWES 2CHZA 2J0KA 3DOWA 3EC8A 2PE6B 3QARA 4AWJA 1WE7A 1ZW7A 2KC2A 4KZCA 3VUYA 2KLCA 3UIOB 1E8WA 2DZIA 3TJPA 3KYDD 3PLVA 5IA7A 2DZKA 2DZJA 4BBNF 3M63B 2K8BA 2LASA 5DCNA 5J17A 1D3ZA 2GBMA 1WM3A 2MP2A 5L83A 2DAJA 4KSLC 5FR6A 3HM6X 2GMIC 4BOZB 2DX5B 2GBKA 4MGKE 4LCDE 2KJ6A 3QC8B 2J0JA 1V49A 3L10B 3TL5A 3DPDA 2O6VD 4FJYA 2N4FA 2O6VA 1VD2A 1G6JA 4MJSB 2DYBA 4OVVA 2LXAA 3M3JA 4DHZB 4TQ0A 2MA9B 2G45B 3BY4B 1WZ3A 2FCMA 2WYQA 4TV3A 5D94A 3ECIA 2LVPA 2KMCA 3PRMB 5E6NA 3CSTA 1PQSA 5JH5C 4KVGB 4W9EA 4XC2A 3H1UA 1WRDB 2KDIA 3PVLA 4GDLB 2GOWA 4IM3A 3N3KB 3MHSD 3R3MA 2NPTB 3CMMB 2K39A 4JL9A 1TGZB 1UBIA 3M95A 4WAAA 4BVUC 4GU2A 2XK5A 3Q3FA 2FCQA 2LRUA 3DBSA 4MM3A 4NNJB 3VFKA 2VRRB 1WI0A 1ZKHA 4RM9A 3T8MA 2M8SA 2BYEA 4TKNA 3NS8A 4PS8A 2JZ3B 2DYOA 2K1FA 2RPQA 2KFJA 4PYUA 4FHKA 1V81A 2MW5A 3WIMA 1V2YA 1IPGA 1TTNA 2C7MB 2L0FA 3KUCB 4GDLA 4FN2A 3K9PB 2NBVB 3JVZX 2IO0B 3JYUA 3ZNHB 3ZRFA 5KHQA 1KLVA 3PPAA 3QAQA 4N9F4 1GC7A 3PV1A 1V5OA 2I1KA 1WM2A 3OJ3A 3RD2A 1RAXA 2L0TA 4KIKA 5CHFA 1WMHA 4HPMB 4II2B 2PEAA 3NOBA 5E6PA 4ANVA 1WX8A 2W9NA 4KIKB 2DHZA 4F8CB 1I42A 4LDTD 5GMVA 2M1MA 2GBJA 4HJKA 4K81A 4KSKC 2R2QA 3AU4A 3R66C 3MTNB 2MX2A 2K8HA 4II3B 1WJ6A 4CO7A 2LXCA 4W9DA 5C23A 3A4RA 4NJ6A 2AL6A 3PHWB 4I6PA 2WX0A 5L95C 1EUVB 2KANA 2M0XA 5G2NA 3S2AA 4J6IA 4IWPA 1KOTA 1R4NI 3U7DA 2MLBA 5JHAA 1LQBA 2KZRA 4XZ4A 2HE7A 4WJNA 4IC7B 2QHOA 4JLCA 2L00B 2L76A 2L8JA 2LUEA 2YVCA 3VH4B 2K25A 3WA0A 2FNJB 2LI5A 4LJPB 3LJ3A 5JHBA 4MELA 2ZPYA 4JIOU 4ZRIA 5CTRC 2D10A 1GUAB 2LZ6A 2OJRA 2IY0B 3ZO5B 2N9EB 4HWIB 3KVFB 4IG7B 4P7IA 2MBBB 3CSFA 4HPLB 1GJZA 1C3TA 2LVOA 4M8MA 4ASWC 2EMSA 1S3SG 5LXHA 3KW5B 2DENB 1WGDA 1TBEA 2ZNVB 3HK0A 4MSQB 4WWNA 2MCNB 1KM7A 3B08A 2RGFA 2IO2B 4WJOA 3W1YA 1Q5WB 2WX1A 1R4MI 1F9JA 3KYCD 3PZDA 4E3CA 1V5TA 3H7PA 1WJUA 2NBWB 1RRBA 4WWOA 2DZMA 4HCPB 2AL3A 2BPSA 1E5WA 1V9JA 1J0GA 3JSVB 3TMPB 3ZNZB 2V3SA 1WXVA 2HD5B 4NJ7A 4RM8A 3V6CB 4W9HA 3TIXA 1V6EA 1WZ0A 2ZVOA 2LWPA 3I3TB 1UH6A 3ZUNA 2ZZPB 3ENEA 1IP9A 2JY6A 5JZEB 1A5RA 1KJTA 2XK5B 1WR1A 3JW0X 5E6OA 3UF8A 2NR2A 2G4SA 4FJVB 4DWFA 3PREA 4DXAB 2KFKA 1AARA 1HE8A 2L05A 3RUIB 2D07B 3UGBB 3V62A 1WY8A 3AULA 4FJZA 3RT3B 4GN1A 2NVUI 4K7WA 1EF5A 2PPHA 1GC6A 1VCBA 4W9GA 3ZTCA 1E7UA 4TQ1A 3ZNID 1P9DU 4GSWA 3IVFA 2IY1B 4CYEA 1WX9A 1WE6A 2PE9A 3IG3A 4G0NB 4WJPA 3Q3JA 3L16A 1WX7A 4B6WA 1LXDA 2ZNVC 4F7ZA 2OOBB 4FA6A 2CKHB 5D2MB 2HTHA 1WMHB 2C7HA 3ML8A 1UELA 4G50A 1S1QB 2JRHA 3PRZA 3NZUA 1Q1OA 2C60A 2NS5A 2GBRA 3PHXB 5DPSA 3U8ZA 4ANUA 4G3XB 2C9WB 3H9DA 3RZWC 3N30A 4IW0A 3KUDB 2CS4A 2AWTA 2N1VA 3OLMD 3ONSA 3X23A 1E8YA 5LLIA 4EKUA 3DDCB 2AYOB 3A9JA 2IBIB 2L3ZA 4BKSD 3VVWB 2G3QB 2N7EA 2RR9A 2I1JA 2MP2B 2KX3A 2KKCA 3ZRCA 4FADA 2D2QA 1C1YB 1YIWA 3APCA 4LDTB 2KMAA 1WXMA 2CHWA 4NPNA 3VH3B 2JT4B 2O2VB 4IM0A 4W9KA 2KWUB 3L08A 4YL8A 3VTWA 3ZTDA 1Y8RC 3SD5A 4W9JA 3V60A 4AP4C 4B95A 3WAMA 2L7RA 2MBHA 2KLGA 3PT2B 1Q0WB 4ANWA 1WFYA 1OGWA 2ZEQA 2KVRA 5G55A 3ZKJC 4BKTA 2BWFA 3V61A 1OTRB 2IO1B 4W9IA 3VHTC 3MJWA 1WXAA 3W1SA 2RSUA 2G4DB 2KC1A 4HVBA 2KTRA 5AZGA 2JZZA 2K6QA 2LGDA 3PTFC 4XX5A 1V86A 3B1LX 2CR5A 2NBUA 1ZGUB 2O6VB 3TCAA 1LM8B 5CX3A 1U4AA 1M94A 2CHXA 4B9KA 4DBGA 2K6DB 2LRWA 4W9CA 2FIFA 3WANA 4HK2A 4FBJB 2FCNA 3V6EB 2BGFA 4NAWA 3IFWB 4PS7A 2JF5A 2JXXA 2LGXA 2KNBA 2LVQA 3QHTA 4MSMB 2MWSB 2D3GA 1EO6A 1H4RA 5IAAC 4M8NA 1WGRA 2KD0A 4IWOA 3JSVA 3U30A 1OQYA 4DK5A 4MEMA 5J18A 3OJ4B 3SHQA 1NDDA 1E90A 2WWZA 4MH0E 2IO3B 3QQ8B 3QJZA 1WGGA 3VXWA 3DVGY 2KK8A 4DDID 1P0RA 3H7SA 1WH3A 4E74A 4LJOB 3LDZE 4AJWA 3A33B 3RYTA 4EZKA 2ZCBA 2R2OA 5D7GA 5BO4B 3CF6E 4DHZE 2KTFA 1E8ZA 1E7VA 3ALBA 3DVGX 2LD9A 3DBLI 1XT9B 1YJ1A 3K9OB 4FHJA 2LJ5A 4HXDA 4RMAA 5DPWA 4K7SA 5C1ZA 4DHJB 3VDZA 4EOYA 4ZRKA 2Y5BB 2BKRB 4EFOA 2BF8B 3H6NA 3DVNU 1L7YA 4ICUA 2KQSA 3UQAA 4M0WB 1JRUA 4ICVA 1J8CA 4HCNB 1WXSA 2AEHA 3H7PB 4BFRA 2FAZA 1WIAA 3O65B 3NZSA 4GDKA 4IM2A 4BKSA 5AEKB 2ZJDA 3EHVA 3WALA 3QX1A 2PJHA 4G11A 3RULA 2ZCCA 3R7RA 1UD7A 5LXIB 4I6NB 4TUUA 4BOSC 3HM3A 2V1YA 2BKFA 3OAWA 1SGHA 3EFUA 2KWVB 3VAWA 4GIVA 4HDQA 3TBLD 2FCSA 3PSEB 3ZIMA 3ZVVA 4NQKE 5D6JB 4GOCA 4ZDVA 2ASQA 3M62B 1EF1A 3L0WB 4FULA 4NQLB 3SDLC 4CHKA 4AUQC 3KUZA 3B0AA 5CHWA 3C0RB 1SE9A 2NPTA 3DQVA 4OVUA 3N32A 3SU8X 2MRPA 1WJNA 2J7QB 4GXBA 4JQWC 2KDEB 4GB9A 2N7DA 3ZDTA 3NY5A 4A3OA 2REXA 1T0YA 3X0WA 1H8CA 4BKGA 4EEWA 3QK0A 2HJ8A 1RFAA 4WJQA 2UWQA 2V4LA 2KDFB 1YQBA 2B3AA 4JGHB 3ZNGC 4AOFA 3ZW3A 2JPHA 3DVNV 3P2BA 2FUHB 1WJ4A 4F1SA 1WR6E 3UQBA 3A1QB 4MGZE 3DCGA 3D32A 3L54A 4KV2A 2C5LC 1X1MA 2KTRB 3GOEA 1K8RB 2Z59B 3PLUA 3AI5A 1LFDA 2XEWA 3L17A 2KFKB 1L2NA 2BYVE 2EMTA 1P1AA 4PS3A 4E71A 1P98A 4KDLB 3HIZA 5HKHA 3VUWA 5KHOA 1YX6B 2KQ7A 2N9PC 2JVCA 2KX0A 3VTUA 4HLEA 3APFA 1SIFA 2KDBA 3EECA 2Z0DB 3DBHI 3HHMA 4NAWB 4A20A 5CHVC 4PYZA 3AXCA 4GMVA 2A4ZA 1GG3A 5DPTA 2M4NA 2LGYA 4AJYB 4MDKE 2JRIB 3KH0A 4GGQA 1WF9A 4MGYE 3RZFA 3RCZA 3ML9A 5TR5A 4HDOA 2KWCA 4K7UA 5AZFA 3T9LA 2KO3A 2DYMA 2WDTB 3WAPA 4BBNC 2KOXA 2IYDB 1J19A 3BINA 2MQJA 3DBRI 4KDIC 2KJHB 3ZLZA 4URKA 2C7NB 2EKEC 3QCAA 3QWZB 2NCNA 2MBEA 1V80A 3VUXA 2Z0EB 2N1WA 3R7QA 5DPRA 2FIDA 2ZVNA 3APDA 4EZLA 1UGMA 4ZRJA 3A4SC 3NHEB 1CMXB 1WYWB 2RD0A 2MSED 4ZYNA 3IBEA 3L13A 4X57B 1IYFA 5AZHA 2IZVB 2XBBC 1I35A 4NY0A 2DAFA 4K1RB 1P3QU 1UBQA 2CU1A 2JUOA 3VQIA 2KN5A 3A1QA 2J0MA 3W1SC 3UIPB 5J2RA 2JWZA 1TZ1A 2KHWB 4ANXA 4GDKB 4EUTA 2O2VA 4MJSA 1WGHA 1NI2A 4DHJD 1FXTB 2BYFA 1E8XA 4DDGD 2N9XA 1BT0A 3PRPB 2YLMA 1YX5B 4FLHA 3A9JB 3IHPC 2KJRA 4WQOB 3QIJA 4W9LA 3A9KB 4I6LB 2UYZB 2M17A 2KXJA 4W9FA 3GZNI 4IWQA 3AU5A 1GNUA 1OEYA 1ISNA 3A9KA 1QZEA 1MG8A 1UZXB 4EZJA 2MBOA 3PGEA 5EDSA 1Z5SB 1RLFA 1YD8U 2MBQA
chains in the Genus database with same CATH superfamily
1D4BA 1F1HA 2W3SA 2GBNA 2K8CA 1FRRA 3SFDB 1XD3B 2CHZA 2WXHA 3QARA 1QQRA 2DZIA 3KYDD 1RWSA 1IGCA 3PLVA 2BYTA 4WAFA 5FR6A 4LCDE 2KJ6A 4YSXB 1ZE3D 1V49A 3L10B 4RGOS 1GAQB 2O6VD 2LXAA 3DHIC 3ZQ4A 1WZ3A 2Q5WD 4XC2A 1WRDB 1EU3A 3B9JA 4JL9A 3M95A 1VZ6A 3T3OA 4GU2A 2LRUA 4MM3A 3FAHA 5C2TB 5I4DA 4RM9A 2M8SA 2BYEA 1B9RA 3ZGZA 5EE3A 4TKNA 1ET9A 1FNUA 3NS8A 1XLQA 4OZCA 3RNEC 1IPGA 2C7MB 3KUCB 5HHDG 4FN2A 3JVZX 1KLVA 3ZNHB 2L1AA 1C9FA 1HQRD 2L0TA 3EFCA 4ZOHC 2PEAA 3NOBA 2DBYA 2W9NA 2L83A 2DHZA 1VRAB 3BVGA 4LDTD 4M01A 3R2IA 4KSKC 3R66C 3MTNB 1WJ6A 1HTQA 2LXCA 4W9DA 5C23A 2WQYB 5L95C 2KANA 1R4NI 4XZ4A 2HE7A 2LUEA 2YVCA 3VH4B 4LJPB 5JHBA 2AQ1B 1J7CA 3EA6A 2OJRA 2IY0B 2N9EB 3KVFB 5D3IB 4WWNA 1KM7A 3BVZA 2XN9C 4GLSC 1XCTL 1F9JA 3KYCD 2DZMA 2AL3A 1F2RC 1WXVA 2HD5B 4RM8A 3V6CB 5IO9A 1IP9A 1XLNA 3ENEA 5JZEB 1KJTA 2XK5B 1WR1A 4DWFA 4DXAB 1FCLA 2L05A 1GPXA 1L0XB 1WY8A 1ZDVA 2NVUI 1FNVA 2BQQA 2W82A 4K3CA 3TEWA 3W5VB 1VCBA 5AUIA 4TQ1A 4GSWA 4G0NB 4Q2JA 1NI3A 3Q3JA 1L4ZB 2OOBB 2CKHB 1HZ6A 3MJ5A 2JRHA 1DYQA 2NS5A 2GBRA 5DPSA 3URYA 2N9LA 4WURA 1JQ4A 2N1VA 1GOZA 3OLMD 3ONSA 4A6QA 3DDCB 2AYOB 2L3ZA 4OHJA 2G3QB 3NVZA 2MP2B 1YIWA 3FILA 2HDEA 3VH3B 1WXMA 2CHWA 5HFYA 4IM0A 2O2VB 4W9KA 4OVZA 1F2RI 3NZ3A 1L6UA 3SD5A 4W9JA 3V60A 4B95A 3RNFC 1UWXA 2L7RA 4P16A 2MBHA 1Q0WB 4ANWA 2IGDA 4BKTA 4RF0A 2BWFA 3V61A 1OTRB 2LHDA 4H2AA 3MJWA 3MC0B 4IOIE 2OJWA 3HVDA 2JZZA 5AZGA 3E56A 1ZGUB 3TCAA 1LM8B 4DBGA 2CHXA 2K6DB 2PTLA 4HK2A 4L23A 2FCNA 3GE8C 4XGAB 3WANA 3V6EB 4NAWA 3DHGC 4MSMB 3Q8CA 4M8NA 4IWOA 1MPEA 1OQYA 2BVCA 3QQ8B 3P42A 1WGGA 3H7SA 3LDZE 4UDUC 1CK1A 2ZCBA 3DBHB 1KH0A 4RF1A 2KTFA 3ALBA 4KX6B 2LD9A 4RMAA 1XT9B 1YJ1A 3B2GA 4TMAB 1I7HA 3VDZA 4EFOA 1QT9A 3UQAA 1FIQA 3FILB 1J8CA 1N5XA 2K0PA 4HCNB 3H7PB 1YNTE 3L4PA 5AEKB 3NZSA 4BKSA 5HI1A 4KGRA 2BTEA 1GB4A 3QX1A 2N0SB 1UD7A 1SE2A 4TUUA 3Q2AC 2BKFA 4GIVA 4ZYSA 2FCSA 2WS3B 3PSEB 2MJEA 4NQKE 1QF6A 4GOCA 2ASQA 1JMLA 4FULA 1WWTA 2NPTA 1PFDA 4OVUA 1UGJA 4C4VB 2BT6A 1WJNA 4JQWC 1YN3A 1T0YA 1H8CA 4BKGA 3QK0A 4USAA 2KDFB 4YSZB 3NS1A 2B3AA 3ZNGC 3ZW3A 3P2BA 2FUHB 1OQRA 2QIEB 4ZHOA 2YEPB 3PLUA 1LFDA 3ZJVA 5LNK1 1CZPA 2D3AA 5KHOA 2N9PC 2JVCA 3APFA 4N6EB 4JX1C 3DBHI 2A4ZA 3AECB 1GG3A 2ACZB 1KLGD 4MDKE 2DNFA 4MGYE 1FMAD 4K7UA 5AZFA 1KF6B 4KDIC 3BIID 2SAKA 2N1WA 3R7QA 1F52A 4MM3B 2KVZA 2V4IB 1C4PA 2RD0A 4ZYNA 1JALA 2MSED 4RCOA 3L13A 1YJIA 5AZHA 2XBBC 4K1RB 2JUOA 2GLSA 3P4QB 4ANXA 4EUTA 4MJSA 1WGHA 1NI2A 4DHJD 1FXTB 4DDGD 3AN1A 1BT0A 2YLMA 4FLHA 3A9JB 3IHPC 2KJRA 3ZJUA 4W9LA 3EGRA 3ZXRA 4IWQA 1OEYA 3I5JC 3A9KA 1QZEA 1TYGB 5EDSA 3N1ZC 2KZRA 1Z5SB 1RLFA 2IJ0A 2ZPNA 2D11A 1XQQA 1WGYA 1Z2MA 3VTVA 2A5UA 1NBFC 2NMQA 1MHHE 2BWES 2J0KA 3AE8B 4AWJA 1C77A 4LTUA 3VUYA 1E8WA 4ZRQA 4BZAA 2GBMA 3BVMA 2MP2A 3TEXA 4XDDA 1FXIA 1PGBA 1UNSA 2K3UA 1CJEA 3GE3C 3P1MA 5H92C 2MA9B 2K5PA 2FCMA 3ECIA 2LVPA 3H8HA 5JH5C 4W9EA 3GZNB 3H1UA 2KDIA 3PVLA 4IM3A 3KQ4A 3R3MA 3CMMB 1V97A 2K39A 3AEEB 3OG5A 4HKZE 1JROA 2XK5A 4HROA 3VFKA 1RM6C 3U2SC 1ZKHA 3T8MA 3P4SB 2JZ3B 2KYWA 2RPQA 2KFJA 1V81A 2MW5A 1V2YA 1TTNA 2L0FA 1YN4A 1LO5D 3ZRFA 1RYJA 5KHQA 2LMCA 4ACFA 1V5OA 1ET6A 3AEDB 4HPMB 1WX8A 4KIKB 1IGDA 3N9YC 2R2QA 2WXFA 3NJTA 2LGSA 3A4RA 2JYTA 1KFYB 1EUVB 2M0XA 5G5HA 1LQBA 2MH7A 2L00B 3T3NA 1FPYA 3WA0A 2ZPYA 2VH1A 4RFBA 1DOIA 4TSSA 2D10A 1GUAB 2R61A 5IKCM 4HWIB 4IG7B 3CSFA 3R8BA 1S3SG 2QDFA 2CJNA 3HK0A 4MSQB 2MCNB 1R4MB 2LGIA 2RGFA 4ARIA 4WJOA 1Q5WB 1IBXA 3AE5B 4E3CA 1V5TA 2NBWB 1RRBA 4WWOA 3SR6A 5C3JB 1HTOA 1E5WA 1NENB 3JSVB 4HRSA 4NJ7A 2OHFA 1V6EA 1WZ0A 2WXJA 3I3TB 3ZUNA 1UH6A 2JY6A 3UF8A 3PZ8A 3DWGC 3AULA 1GB1A 4FJZA 2WXKA 4K7WA 3ZJTA 1SXTA 1GC6A 2L52A 2PLPA 3ZTCA 1E7UA 2NTSA 1AN8A 5FK9C 1ZXIA 1NYQA 3ZYYX 1FEHA 2ZNVC 3UI3A 1WXQA 4G50A 4NAMA 3PRZA 3PHXB 4ANUA 4G3XB 2D3BA 4MH8A 4IW0A 2CS4A 1JWSD 1I4QA 3X23A 1E8YA 3LXFA 2K9XA 4BKSD 3VVWB 2N7JA 2N7EA 5MPOA 2G1EA 2KX3A 4FADA 3U7ZA 2Y3AA 4LDTB 5J17A 1VLBA 1NYRA 4YSYB 3ZTDA 3P4PB 2LEKA 3AE4B 1TS5A 2OEDA 1YQ3B 4W9IA 3VHTC 1ZPSA 1WXAA 2RSUA 2G4DB 2KC1A 3RN9C 4US8A 2KTRA 3PTFC 1V86A 2NBUA 2O6VB 3I9V1 1AWDA 3TEZA 5CX3A 1M94A 1EU4A 1ESFA 2LRWA 4W9CA 5JXVA 1QOAA 1SJED 1N61A 4PS7A 2CJOA 2JXXA 3E9SA 2KNBA 3QHTA 1H4RA 5BYQA 3Q3MC 3U30A 4DK5A 2WWZA 3DBRB 2PVOD 4XYCA 3ZXVA 4E74A 2V9HA 1E9MA 1HA5A 3A33B 1ZUD2 5D7GA 2R2OA 1TIFA 1D6EC 4DHZE 1I4XA 4IKGA 5DPWA 2WDQB 3DBLB 4EOYA 4ZRKA 1PGXA 1L7YA 1JRUA 4ICVA 4KKJA 1M4VA 2AEHA 1KTKA 4BFRA 1WIAA 3O65B 3KWVA 5E6JA 3WALA 3HRDD 2E3TA 1C4CA 4G11A 3RULA 3OAWA 1SGHA 3EFUA 4HPPA 2LUMA 1TKEA 3ZIMA 4ZDVA 3M62B 1YMHE 3L0WB 4NQLB 4M00A 1V1OA 1FRDA 5FR3A 3Q8BA 5IN7A 2KDEB 3NY5A 3PZ7A 1RFKA 3VR9B 4EEWA 2HJ8A 1RFAA 4WJQA 3LYYA 2VZKB 3ABVB 1DOXA 4JGHB 3Q3NC 4AOFA 1F0ZA 1UF0A 3VR8B 3UQBA 3DCGA 3D32A 3L54A 4KGSA 3GOEA 2C5LC 2WDVB 3AI5A 2KFKB 1P1AA 2NTTA 3R2TA 2QC8A 1FCCC 1YX6B 2WXMA 1P7FA 1TKYA 2Z0DB 5H8YE 5BMHA 2LGYA 4AJYB 2V3NA 1LGRA 3RZFA 4HDOA 3WAPA 2KO3A 2WDTB 4HEA1 4BBNC 1WYGA 1J19A 2MQJA 1E10A 2D3CA 3V05A 2GI9A 2MBEA 3VUXA 2KQ4X 3MP9A 2ZVNA 3APDA 3TUOA 4ZRJA 2IGGA 2LFIA 1WYWB 3GB1A 2J52A 1STEA 3W2DA 3SFEB 1I35A 3Q8EA 2INNE 2DAFA 1Y56A 4WWMA 3A1QA 2WHIA 1N60A 2WLBA 1IUEA 5J2RA 3AE2B 4C00A 3V3XA 2JQRB 1ENFA 3FC4A 1YX5B 4YXDB 3N1XC 1ZP0B 2KDMA 3QIJA 3A9KB 4I6LB 2UYZB 1C76A 2I38A 2Z8LA 1ISNA 4A90A 1MG8A 4EZJA 2ZW0A 3AEAB 3PGEA 5GXGB 4MGIE 3WAOA 2IGHA 4A3PA 4WH4A 1OEYJ 4KZ0A 4A55A 1JRPA 2RDBC 3J9CA 3RNCC 3DOWA 3EC8A 2PE6B 1WE7A 1ZW7A 4KZCA 2KLCA 1VZ7A 3TJPA 1ACCA 5IA7A 2DZKA 2DZJA 4BBNF 2X38A 2LASA 4KSLC 3RI7C 3HM6X 3U4EG 1N63A 2GMIC 1D5XC 2KT7A 2J0JA 1TY0A 4YTPB 3TL5A 3DPDA 5FKAC 4FJYA 3RMKC 1VD2A 4O1NA 4MJSB 1G6JA 2DYBA 4TQ0A 1FFUA 2G45B 3BY4B 5D94A 1PQSA 5D3DA 4KVGB 4P1BC 3LB8C 2WXRA 3WCQA 3N3KB 2JU6X 3MHSD 2NPTB 1UBIA 2G9HD 3VRAB 4BVUC 5BMIA 4ARCA 3Q3FA 2FCQA 4NNJB 1D5MC 2RDHA 3SEBA 4A9AA 4PS8A 3BYYB 4WIPA 2DYOA 2K1FA 1SE4A 4FHKA 3WIMA 4GDLA 4ZHPA 3K9PB 2NBVB 2IO0B 3TEYA 1FNWA 4QAYA 3JYUA 3PPAA 4R3DA 4N9F4 1FD6A 3OJ3A 1DOYA 4K3BA 4KIKA 1TY2A 1J7AA 1N62A 4II2B 1B1ZA 1YN5A 4ITKA 1I42A 5GMVA 4HJKA 3P63A 1QOGA 2K8HA 4II3B 1NEKB 4NJ6A 2AL6A 2QSDA 4KKIA 2WX0A 4L1BA 4C7ZA 5G2NA 3MHZA 4J6IA 3U7DA 2MLBA 5BMGA 3MC9A 1L6VA 3RFZB 2QHOA 2BS3B 4JLCA 4C4VA 2K25A 4WQMA 2LI5A 4MELA 1YOVB 1T0QC 5BYRA 3DHHC 4KGTA 1QLBB 4YTMB 1GJZA 5T8IA 1C3TA 1F77A 2LVOA 4M8MA 1XF5L 4ASWC 2EMSA 3KW5B 2DENB 1TBEA 1L0VB 2J4XA 2ZNVB 3B08A 4P6VF 2IO2B 3IT4B 1TKGA 4AQ7A 1R4MI 1T6BX 3PZDA 1QOBA 4J3OD 1WJUA 4LK0M 2WXIA 3P4RB 2RMMA 4HCPB 2BPSA 1L5PA 1J0GA 2V3SA 4RNAA 1JWAD 2LWPA 4M0WA 3JW0X 5E6OA 2GB1A 4M02A 2KFKA 1HE8A 3RUIB 3UGBB 4BAXA 4HJGE 3RT3B 2CU3A 4GN1A 1MVKA 1T5XD 1P7EA 1EF5A 3AE9B 3ZNID 3IVFA 2IY1B 4N58A 2PE9A 2FUG1 1WX7A 2H89B 1DGJA 2H88B 4FA6A 1WMHB 1CQVA 5EE9A 2FBWB 1Q1OA 3NZUA 3Q8FA 3H9DA 3AV8A 2AWTA 4LNNA 4B0EA 5LLIA 4EKUA 3A9JA 4AS1A 1FXAA 2D5GA 2I1JA 2KKCA 3ZRCA 1R4NB 1C1YB 2HTME 4NPNA 3L08A 3AE7B 1Y8RC 3NVVA 1K52A 4XWTA 3WAMA 2KLGA 1OGWA 2ZEQA 2KVRA 5G55A 3ZKJC 1MG4A 1WGKA 4LNOA 3KWLA 2PW9A 2K6QA 2LGDA 2CR5A 2W3RA 2Y5PA 2FIFA 2BW2A 2BGFA 1V1PB 3IFWB 2JF5A 2LVQA 2MJDA 2MWSB 3RNAC 1WGRA 4MEMA 3IAM1 5J18A 3OJ4B 1XO3A 1E90A 1NDDA 4MH0E 1SIJA 1TZOA 3VXWA 3DVGY 4DDID 1P0RA 1WH3A 1IBXB 4AJWA 4EZKA 3CF6E 4DQOC 2WU2B 1E8ZA 1E7VA 3DVGX 4IDIA 2WXOA 3O13A 3K9OB 4FHJA 4K7SA 4DHJB 4C56C 2BF8B 1N6ZA 3H6NA 3DVNU 4ICUA 1JWUD 2KQSA 3BK2A 1SE3A 4IM2A 1C4AA 3N1YC 2ZJDA 3Q14C 2PJHA 2RDGA 5LXIB 4I6NB 1MFWA 2GRIA 2IDYA 2PVGC 4NJCA 5D6JB 3SDLC 3KUZA 1K50A 4HKQA 5CHWA 3C0RB 3DQVA 3SU8X 2QMTA 1YJJA 1TJEA 4GB9A 2REXA 3C19A 4OW0A 1A70A 2UWQA 4A8XC 1YQBA 4DXFA 1ROEA 2JPHA 1BUIC 1R7SA 1WJ4A 4F1SA 1WR6E 4MGZE 4KV2A 3W5UB 1X1MA 2INCC 2Z59B 3L17A 1T0RC 2WXPA 2EMTA 4E71A 1P98A 2ON8A 2KQ7A 2KX0A 4HLEA 1E0ZA 1SIFA 2KDBA 2K22A 4S0RA 3EECA 3I57A 3RNBC 4NAWB 2BS4B 4A20A 5CHVC 1L4DB 3AXCA 4GMVA 5DPTA 2MHJA 2JRIB 1WF9A 1FO4A 4XE0A 5TR5A 2KWCA 4OZAA 3T9LA 2DYMA 2KOXA 2IYDB 3BINA 2KJHB 2KAJA 2EKEC 4JE3B 1V80A 1VZ8A 1K53A 2FIDA 4EZLA 3NHEB 2QJLA 4YWGG 3AM9A 2W54A 1TS4A 1C79A 1P3QU 1UBQA 2CU1A 3VQIA 2J0MA 2JWZA 1TZ1A 2KHWB 1L0YB 4GDKB 2N9KA 1E8XA 3PRPB 3B2FA 3IAS1 1JCKB 4MT5A 4WQOB 2AQ2B 1K51A 4W9FA 2KXJA 3OWEB 1JW9D 4LNKA 2Y5CA 1UZXB 1N5WA 4N59A 4LNIA 1YD8U 2MBQA 3NRZA 4YT0B 2KWDA 3PS6A 4F8CB 3QA8A 4IUMB 2INDC 3UINB 4C7YA 3ZDMC 4WWPA 4PK1A 2DLBA 1TT5B 1EWYC 5IOIA 4LLGM 2KC2A 3UIOB 1VJKA 3CWIA 1J7BA 2W55A 3M63B 2K8BA 5DCNA 1D3ZA 1WM3A 5L83A 2DAJA 4BOZB 1XEEA 2DX5B 1BMLC 2GBKA 4MGKE 3QC8B 1XCQL 4FXCA 2N4FA 2O6VA 3Q69A 1I4RA 4OVVA 3M3JA 4DHZB 3IXSA 2WYQA 1I4PA 4TV3A 2KMCA 3PRMB 5E6NA 2EELA 3CSTA 4GDLB 3VRBB 2GOWA 1I4GA 4JWUC 5AUKA 1TGZB 5IP4D 4WAAA 1QOFA 3DBSA 4REZA 2VRRB 1WI0A 3GP7A 1SBBB 4EE2A 1T3QA 4S17A 3BWUD 2AX5A 1EM7A 4JPSA 2JWUA 4PYUA 1SSNA 2TSSA 3TSSA 2QEJC 3AMZA 4OZBA 4C80A 1TS3A 3QAQA 3DWMA 1GC7A 1VR9A 3PV1A 2I1KA 1WM2A 3RD2A 1RAXA 3N20C 1WMHA 5CHFA 5E6PA 4ANVA 4D2KA 1C78A 2M1MA 2GBJA 1T0SC 4K81A 3AU4A 3NVYA 2MX2A 2ICIA 4CO7A 4B0MA 3RNGC 3PHWB 4I6PA 2LHEA 3S2AA 4IWPA 2RPVA 1KOTA 5JHAA 4WJNA 4IC7B 4L2YA 3MC8A 2L76A 2L8JA 3HUIA 2FNJB 3LJ3A 4JIOU 4ZRIA 5CTRC 2PMVA 2LZ6A 3ZO5B 3CIRB 1Q10A 4P7IA 2MBBB 4HPLB 3Q6BA 1PDXA 5LXHA 1WGDA 1OQQA 3W1YA 2BBCA 2WX1A 3AE6B 2HJ1A 3H7PA 1ZOYB 3Q3OC 1MI0A 1PUTA 2YEPF 1FFVA 1V9JA 3TMPB 1HEZE 2KMMA 3ZNZB 4W9HA 3TIXA 2ZVOA 5TSSA 2ZZPB 1A5RA 2NR2A 2G4SA 4FJVB 3PREA 1YQ4B 1FM0D 1AARA 3V62A 2D07B 1KRHA 1KLUD 2VH2A 2KACA 3NVWA 2JYEA 2PPHA 4W9GA 1P9DU 2QILA 2WNMA 4CYEA 1WX9A 1WE6A 3IG3A 4WJPA 2PIAA 1HXYD 3L16A 4B6WA 1LXDA 4F7ZA 4ZRPA 5D2MB 2WDRB 2HTHA 2C7HA 3ML8A 1UELA 4JWSC 3FKYA 1S1QB 3PO0A 2C60A 3U8ZA 2E6XA 1BXTA 2C9WB 3RZWC 3N30A 3KUDB 1MHXA 4CQNA 4RGNA 2UU7A 2IBIB 2WXLA 3I63C 2XNAC 1SB3C 2RR9A 2J53A 4MACA 2D2QA 2KMAA 1UWMA 4XDCA 1JWBD 2JT4B 3VTWA 2KWUB 4YL8A 4YTNB 2BB6A 4AP4C 2QCZA 4NZLB 3PT2B 1WFYA 1V1PA 1E7PB 2MJ3A 2IO1B 1MJDA 3IT6B 3W1SA 3Q8AA 4HVBA 2X8XX 4XX5A 1PYWD 2KN4A 3B1LX 2WXGA 1U4AA 3GS2A 4B9KA 3AEBB 4FBJB 3BZDB 1OFFA 2ONQA 2WGSA 3KLSX 2LGXA 1VDVA 2MEKA 2D3GA 1EO6A 2VZKD 5IAAC 2KD0A 3JSVA 2WP9B 2JSVX 3MFGA 3SHQA 2IO3B 3QJZA 2KK8A 4LJOB 3EUB2 2M19A 3RYTA 2V3PA 5BO4B 2BB5A 3DBLI 4HXDA 2LJ5A 5C1ZA 1ZXHA 2JXTA 2WXQA 2Y5BB 2BKRB 1WRIA 1SJHD 4RH6A 3RPFC 4M0WB 1WXSA 5EE0A 2FAZA 2PKOA 4GDKA 3EHVA 2I2YA 2EKIA 1D5ZC 3BYTB 2B76B 2ZCCA 3R7RA 4BOSC 3HM3A 3AB5A 2V1YA 2WXNA 2LJIA 2KWVB 3VAWA 4HDQA 3TBLD 3ZVVA 1EF1A 2INPE 4CHKA 2L32A 1PGAA 4AUQC 1NVID 3B0AA 1SE9A 5BYSA 1E6EB 3N32A 1XLOA 2MRPA 2J7QB 4GXBA 2N7DA 3ZDTA 3AEFB 4A3OA 3X0WA 4P1CC 2V4LA 3AEGB 3DVNV 3AE1B 2WU5B 3A1QB 5HG2A 4DXGA 2KTRB 1UUPA 1K8RB 2SEBD 2XEWA 1L2NA 2FE8A 1HZ5A 2BYVE 4PS3A 1QKZA 4KDLB 3HIZA 5HKHA 3VUWA 1TS2A 3VTUA 2J42A 1SEBD 3AE3B 3HVZA 1XLPA 3HHMA 1ZDXA 2IPKD 4PYZA 1AW7A 3BK1A 3NUHB 5G5GA 2M4NA 2JZPA 3KH0A 4GGQA 1EWCA 3RCZA 1JWMD 3ML9A 3DBRI 3ZLZA 4URKA 2C7NB 4PT5A 1I4HA 3QCAA 2NCNA 3QWZB 1XXGA 5EE1A 2Z0EB 4RGMA 5DPRA 2BS2B 1UGMA 3A4SC 4XWWA 1CMXB 1QILA 3IBEA 4X57B 1IYFA 2DWQA 2IZVB 4NY0A 2KN5A 3U52E 3W1SC 3UIPB 2V0GA 1AYFA 2O2VA 2ZW1A 3NG0A 2BYFA 2N9XA 1SF0A 3ETRA 2M56B 4LNFA 3W9CB 1V8CA 2JX5A 4RGTA 2M17A 3C8YA 4US9A 3GZNI 3AH7A 3AU5A 1GNUA 2M0AA 2AQ3B 1WSPA 2MBOA 3APCA
chains in the Genus database with same CATH topology
2ZPNA 3PS6A 2D11A 3QA8A 1XQQA 4IUMB 1WGYA 1Z2MA 3VTVA 4MGIE 3WAOA 3UINB 2A5UA 2GBNA 4A3PA 2K8CA 1OEYJ 4KZ0A 1NBFC 3ZDMC 4WWPA 1XD3B 2BWES 2CHZA 2J0KA 3DOWA 3EC8A 2PE6B 3QARA 4AWJA 1WE7A 1ZW7A 2KC2A 4KZCA 3VUYA 2KLCA 3UIOB 1E8WA 2DZIA 3TJPA 3KYDD 3PLVA 5IA7A 2DZKA 2DZJA 4BBNF 3M63B 2K8BA 2LASA 5DCNA 5J17A 1D3ZA 2GBMA 1WM3A 2MP2A 5L83A 2DAJA 4KSLC 5FR6A 3HM6X 2GMIC 4BOZB 2DX5B 2GBKA 4MGKE 4LCDE 2KJ6A 3QC8B 2J0JA 1V49A 3L10B 3TL5A 3DPDA 2O6VD 4FJYA 2N4FA 2O6VA 1VD2A 1G6JA 4MJSB 2DYBA 4OVVA 2LXAA 3M3JA 4DHZB 4TQ0A 2MA9B 2G45B 3BY4B 1WZ3A 2FCMA 2WYQA 4TV3A 5D94A 3ECIA 2LVPA 2KMCA 3PRMB 5E6NA 3CSTA 1PQSA 5JH5C 4KVGB 4W9EA 4XC2A 3H1UA 1WRDB 2KDIA 3PVLA 4GDLB 2GOWA 4IM3A 3N3KB 3MHSD 3R3MA 2NPTB 3CMMB 2K39A 4JL9A 1TGZB 1UBIA 3M95A 4WAAA 4BVUC 4GU2A 2XK5A 3Q3FA 2FCQA 2LRUA 3DBSA 4MM3A 4NNJB 3VFKA 2VRRB 1WI0A 1ZKHA 4RM9A 3T8MA 2M8SA 2BYEA 4TKNA 3NS8A 4PS8A 2JZ3B 2DYOA 2K1FA 2RPQA 2KFJA 4PYUA 4FHKA 1V81A 2MW5A 3WIMA 1V2YA 1IPGA 1TTNA 2C7MB 2L0FA 3KUCB 4GDLA 4FN2A 3K9PB 2NBVB 3JVZX 2IO0B 3JYUA 3ZNHB 3ZRFA 5KHQA 1KLVA 3PPAA 3QAQA 4N9F4 1GC7A 3PV1A 1V5OA 2I1KA 1WM2A 3OJ3A 3RD2A 1RAXA 2L0TA 4KIKA 5CHFA 1WMHA 4HPMB 4II2B 2PEAA 3NOBA 5E6PA 4ANVA 1WX8A 2W9NA 4KIKB 2DHZA 4F8CB 1I42A 4LDTD 5GMVA 2M1MA 2GBJA 4HJKA 4K81A 4KSKC 2R2QA 3AU4A 3R66C 3MTNB 2MX2A 2K8HA 4II3B 1WJ6A 4CO7A 2LXCA 4W9DA 5C23A 3A4RA 4NJ6A 2AL6A 3PHWB 4I6PA 2WX0A 5L95C 1EUVB 2KANA 2M0XA 5G2NA 3S2AA 4J6IA 4IWPA 1KOTA 1R4NI 3U7DA 2MLBA 5JHAA 1LQBA 2KZRA 4XZ4A 2HE7A 4WJNA 4IC7B 2QHOA 4JLCA 2L00B 2L76A 2L8JA 2LUEA 2YVCA 3VH4B 2K25A 3WA0A 2FNJB 2LI5A 4LJPB 3LJ3A 5JHBA 4MELA 2ZPYA 4JIOU 4ZRIA 5CTRC 2D10A 1GUAB 2LZ6A 2OJRA 2IY0B 3ZO5B 2N9EB 4HWIB 3KVFB 4IG7B 4P7IA 2MBBB 3CSFA 4HPLB 1GJZA 1C3TA 2LVOA 4M8MA 4ASWC 2EMSA 1S3SG 5LXHA 3KW5B 2DENB 1WGDA 1TBEA 2ZNVB 3HK0A 4MSQB 4WWNA 2MCNB 1KM7A 3B08A 2RGFA 2IO2B 4WJOA 3W1YA 1Q5WB 2WX1A 1R4MI 1F9JA 3KYCD 3PZDA 4E3CA 1V5TA 3H7PA 1WJUA 2NBWB 1RRBA 4WWOA 2DZMA 4HCPB 2AL3A 2BPSA 1E5WA 1V9JA 1J0GA 3JSVB 3TMPB 3ZNZB 2V3SA 1WXVA 2HD5B 4NJ7A 4RM8A 3V6CB 4W9HA 3TIXA 1V6EA 1WZ0A 2ZVOA 2LWPA 3I3TB 1UH6A 3ZUNA 2ZZPB 3ENEA 1IP9A 2JY6A 5JZEB 1A5RA 1KJTA 2XK5B 1WR1A 3JW0X 5E6OA 3UF8A 2NR2A 2G4SA 4FJVB 4DWFA 3PREA 4DXAB 2KFKA 1AARA 1HE8A 2L05A 3RUIB 2D07B 3UGBB 3V62A 1WY8A 3AULA 4FJZA 3RT3B 4GN1A 2NVUI 4K7WA 1EF5A 2PPHA 1GC6A 1VCBA 4W9GA 3ZTCA 1E7UA 4TQ1A 3ZNID 1P9DU 4GSWA 3IVFA 2IY1B 4CYEA 1WX9A 1WE6A 2PE9A 3IG3A 4G0NB 4WJPA 3Q3JA 3L16A 1WX7A 4B6WA 1LXDA 2ZNVC 4F7ZA 2OOBB 4FA6A 2CKHB 5D2MB 2HTHA 1WMHB 2C7HA 3ML8A 1UELA 4G50A 1S1QB 2JRHA 3PRZA 3NZUA 1Q1OA 2C60A 2NS5A 2GBRA 3PHXB 5DPSA 3U8ZA 4ANUA 4G3XB 2C9WB 3H9DA 3RZWC 3N30A 4IW0A 3KUDB 2CS4A 2AWTA 2N1VA 3OLMD 3ONSA 3X23A 1E8YA 5LLIA 4EKUA 3DDCB 2AYOB 3A9JA 2IBIB 2L3ZA 4BKSD 3VVWB 2G3QB 2N7EA 2RR9A 2I1JA 2MP2B 2KX3A 2KKCA 3ZRCA 4FADA 2D2QA 1C1YB 1YIWA 3APCA 4LDTB 2KMAA 1WXMA 2CHWA 4NPNA 3VH3B 2JT4B 2O2VB 4IM0A 4W9KA 2KWUB 3L08A 4YL8A 3VTWA 3ZTDA 1Y8RC 3SD5A 4W9JA 3V60A 4AP4C 4B95A 3WAMA 2L7RA 2MBHA 2KLGA 3PT2B 1Q0WB 4ANWA 1WFYA 1OGWA 2ZEQA 2KVRA 5G55A 3ZKJC 4BKTA 2BWFA 3V61A 1OTRB 2IO1B 4W9IA 3VHTC 3MJWA 1WXAA 3W1SA 2RSUA 2G4DB 2KC1A 4HVBA 2KTRA 5AZGA 2JZZA 2K6QA 2LGDA 3PTFC 4XX5A 1V86A 3B1LX 2CR5A 2NBUA 1ZGUB 2O6VB 3TCAA 1LM8B 5CX3A 1U4AA 1M94A 2CHXA 4B9KA 4DBGA 2K6DB 2LRWA 4W9CA 2FIFA 3WANA 4HK2A 4FBJB 2FCNA 3V6EB 2BGFA 4NAWA 3IFWB 4PS7A 2JF5A 2JXXA 2LGXA 2KNBA 2LVQA 3QHTA 4MSMB 2MWSB 2D3GA 1EO6A 1H4RA 5IAAC 4M8NA 1WGRA 2KD0A 4IWOA 3JSVA 3U30A 1OQYA 4DK5A 4MEMA 5J18A 3OJ4B 3SHQA 1NDDA 1E90A 2WWZA 4MH0E 2IO3B 3QQ8B 3QJZA 1WGGA 3VXWA 3DVGY 2KK8A 4DDID 1P0RA 3H7SA 1WH3A 4E74A 4LJOB 3LDZE 4AJWA 3A33B 3RYTA 4EZKA 2ZCBA 2R2OA 5D7GA 5BO4B 3CF6E 4DHZE 2KTFA 1E8ZA 1E7VA 3ALBA 3DVGX 2LD9A 3DBLI 1XT9B 1YJ1A 3K9OB 4FHJA 2LJ5A 4HXDA 4RMAA 5DPWA 4K7SA 5C1ZA 4DHJB 3VDZA 4EOYA 4ZRKA 2Y5BB 2BKRB 4EFOA 2BF8B 3H6NA 3DVNU 1L7YA 4ICUA 2KQSA 3UQAA 4M0WB 1JRUA 4ICVA 1J8CA 4HCNB 1WXSA 2AEHA 3H7PB 4BFRA 2FAZA 1WIAA 3O65B 3NZSA 4GDKA 4IM2A 4BKSA 5AEKB 2ZJDA 3EHVA 3WALA 3QX1A 2PJHA 4G11A 3RULA 2ZCCA 3R7RA 1UD7A 5LXIB 4I6NB 4TUUA 4BOSC 3HM3A 2V1YA 2BKFA 3OAWA 1SGHA 3EFUA 2KWVB 3VAWA 4GIVA 4HDQA 3TBLD 2FCSA 3PSEB 3ZIMA 3ZVVA 4NQKE 5D6JB 4GOCA 4ZDVA 2ASQA 3M62B 1EF1A 3L0WB 4FULA 4NQLB 3SDLC 4CHKA 4AUQC 3KUZA 3B0AA 5CHWA 3C0RB 1SE9A 2NPTA 3DQVA 4OVUA 3N32A 3SU8X 2MRPA 1WJNA 2J7QB 4GXBA 4JQWC 2KDEB 4GB9A 2N7DA 3ZDTA 3NY5A 4A3OA 2REXA 1T0YA 3X0WA 1H8CA 4BKGA 4EEWA 3QK0A 2HJ8A 1RFAA 4WJQA 2UWQA 2V4LA 2KDFB 1YQBA 2B3AA 4JGHB 3ZNGC 4AOFA 3ZW3A 2JPHA 3DVNV 3P2BA 2FUHB 1WJ4A 4F1SA 1WR6E 3UQBA 3A1QB 4MGZE 3DCGA 3D32A 3L54A 4KV2A 2C5LC 1X1MA 2KTRB 3GOEA 1K8RB 2Z59B 3PLUA 3AI5A 1LFDA 2XEWA 3L17A 2KFKB 1L2NA 2BYVE 2EMTA 1P1AA 4PS3A 4E71A 1P98A 4KDLB 3HIZA 5HKHA 3VUWA 5KHOA 1YX6B 2KQ7A 2N9PC 2JVCA 2KX0A 3VTUA 4HLEA 3APFA 1SIFA 2KDBA 3EECA 2Z0DB 3DBHI 3HHMA 4NAWB 4A20A 5CHVC 4PYZA 3AXCA 4GMVA 2A4ZA 1GG3A 5DPTA 2M4NA 2LGYA 4AJYB 4MDKE 2JRIB 3KH0A 4GGQA 1WF9A 4MGYE 3RZFA 3RCZA 3ML9A 5TR5A 4HDOA 2KWCA 4K7UA 5AZFA 3T9LA 2KO3A 2DYMA 2WDTB 3WAPA 4BBNC 2KOXA 2IYDB 1J19A 3BINA 2MQJA 3DBRI 4KDIC 2KJHB 3ZLZA 4URKA 2C7NB 2EKEC 3QCAA 3QWZB 2NCNA 2MBEA 1V80A 3VUXA 2Z0EB 2N1WA 3R7QA 5DPRA 2FIDA 2ZVNA 3APDA 4EZLA 1UGMA 4ZRJA 3A4SC 3NHEB 1CMXB 1WYWB 2RD0A 2MSED 4ZYNA 3IBEA 3L13A 4X57B 1IYFA 5AZHA 2IZVB 2XBBC 1I35A 4NY0A 2DAFA 4K1RB 1P3QU 1UBQA 2CU1A 2JUOA 3VQIA 2KN5A 3A1QA 2J0MA 3W1SC 3UIPB 5J2RA 2JWZA 1TZ1A 2KHWB 4ANXA 4GDKB 4EUTA 2O2VA 4MJSA 1WGHA 1NI2A 4DHJD 1FXTB 2BYFA 1E8XA 4DDGD 2N9XA 1BT0A 3PRPB 2YLMA 1YX5B 4FLHA 3A9JB 3IHPC 2KJRA 4WQOB 3QIJA 4W9LA 3A9KB 4I6LB 2UYZB 2M17A 2KXJA 4W9FA 3GZNI 4IWQA 3AU5A 1GNUA 1OEYA 1ISNA 3A9KA 1QZEA 1MG8A 1UZXB 4EZJA 2MBOA 3PGEA 5EDSA 1Z5SB 1RLFA 1YD8U 2MBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPN A;  3PS6 A;  2D11 A;  3QA8 A;  1XQQ A;  4IUM B;  1WGY A;  1Z2M A;  3VTV A;  4MGI E;  3WAO A;  3UIN B;  2A5U A;  2GBN A;  4A3P A;  2K8C A;  1OEY J;  4KZ0 A;  1NBF C;  3ZDM C;  4WWP A;  1XD3 B;  2BWE S;  2CHZ A;  2J0K A;  3DOW A;  3EC8 A;  2PE6 B;  3QAR A;  4AWJ A;  1WE7 A;  1ZW7 A;  2KC2 A;  4KZC A;  3VUY A;  2KLC A;  3UIO B;  1E8W A;  2DZI A;  3TJP A;  3KYD D;  3PLV A;  5IA7 A;  2DZK A;  2DZJ A;  4BBN F;  3M63 B;  2K8B A;  2LAS A;  5DCN A;  5J17 A;  1D3Z A;  2GBM A;  1WM3 A;  2MP2 A;  5L83 A;  2DAJ A;  4KSL C;  5FR6 A;  3HM6 X;  2GMI C;  4BOZ B;  2DX5 B;  2GBK A;  4MGK E;  4LCD E;  2KJ6 A;  3QC8 B;  2J0J A;  1V49 A;  3L10 B;  3TL5 A;  3DPD A;  2O6V D;  4FJY A;  2N4F A;  2O6V A;  1VD2 A;  1G6J A;  4MJS B;  2DYB A;  4OVV A;  2LXA A;  3M3J A;  4DHZ B;  4TQ0 A;  2MA9 B;  2G45 B;  3BY4 B;  1WZ3 A;  2FCM A;  2WYQ A;  4TV3 A;  5D94 A;  3ECI A;  2LVP A;  2KMC A;  3PRM B;  5E6N A;  3CST A;  1PQS A;  5JH5 C;  4KVG B;  4W9E A;  4XC2 A;  3H1U A;  1WRD B;  2KDI A;  3PVL A;  4GDL B;  2GOW A;  4IM3 A;  3N3K B;  3MHS D;  3R3M A;  2NPT B;  3CMM B;  2K39 A;  4JL9 A;  1TGZ B;  1UBI A;  3M95 A;  4WAA A;  4BVU C;  4GU2 A;  2XK5 A;  3Q3F A;  2FCQ A;  2LRU A;  3DBS A;  4MM3 A;  4NNJ B;  3VFK A;  2VRR B;  1WI0 A;  1ZKH A;  4RM9 A;  3T8M A;  2M8S A;  2BYE A;  4TKN A;  3NS8 A;  4PS8 A;  2JZ3 B;  2DYO A;  2K1F A;  2RPQ A;  2KFJ A;  4PYU A;  4FHK A;  1V81 A;  2MW5 A;  3WIM A;  1V2Y A;  1IPG A;  1TTN A;  2C7M B;  2L0F A;  3KUC B;  4GDL A;  4FN2 A;  3K9P B;  2NBV B;  3JVZ X;  2IO0 B;  3JYU A;  3ZNH B;  3ZRF A;  5KHQ A;  1KLV A;  3PPA A;  3QAQ A;  4N9F 4;  1GC7 A;  3PV1 A;  1V5O A;  2I1K A;  1WM2 A;  3OJ3 A;  3RD2 A;  1RAX A;  2L0T A;  4KIK A;  5CHF A;  1WMH A;  4HPM B;  4II2 B;  2PEA A;  3NOB A;  5E6P A;  4ANV A;  1WX8 A;  2W9N A;  4KIK B;  2DHZ A;  4F8C B;  1I42 A;  4LDT D;  5GMV A;  2M1M A;  2GBJ A;  4HJK A;  4K81 A;  4KSK C;  2R2Q A;  3AU4 A;  3R66 C;  3MTN B;  2MX2 A;  2K8H A;  4II3 B;  1WJ6 A;  4CO7 A;  2LXC A;  4W9D A;  5C23 A;  3A4R A;  4NJ6 A;  2AL6 A;  3PHW B;  4I6P A;  2WX0 A;  5L95 C;  1EUV B;  2KAN A;  2M0X A;  5G2N A;  3S2A A;  4J6I A;  4IWP A;  1KOT A;  1R4N I;  3U7D A;  2MLB A;  5JHA A;  1LQB A;  2KZR A;  4XZ4 A;  2HE7 A;  4WJN A;  4IC7 B;  2QHO A;  4JLC A;  2L00 B;  2L76 A;  2L8J A;  2LUE A;  2YVC A;  3VH4 B;  2K25 A;  3WA0 A;  2FNJ B;  2LI5 A;  4LJP B;  3LJ3 A;  5JHB A;  4MEL A;  2ZPY A;  4JIO U;  4ZRI A;  5CTR C;  2D10 A;  1GUA B;  2LZ6 A;  2OJR A;  2IY0 B;  3ZO5 B;  2N9E B;  4HWI B;  3KVF B;  4IG7 B;  4P7I A;  2MBB B;  3CSF A;  4HPL B;  1GJZ A;  1C3T A;  2LVO A;  4M8M A;  4ASW C;  2EMS A;  1S3S G;  5LXH A;  3KW5 B;  2DEN B;  1WGD A;  1TBE A;  2ZNV B;  3HK0 A;  4MSQ B;  4WWN A;  2MCN B;  1KM7 A;  3B08 A;  2RGF A;  2IO2 B;  4WJO A;  3W1Y A;  1Q5W B;  2WX1 A;  1R4M I;  1F9J A;  3KYC D;  3PZD A;  4E3C A;  1V5T A;  3H7P A;  1WJU A;  2NBW B;  1RRB A;  4WWO A;  2DZM A;  4HCP B;  2AL3 A;  2BPS A;  1E5W A;  1V9J A;  1J0G A;  3JSV B;  3TMP B;  3ZNZ B;  2V3S A;  1WXV A;  2HD5 B;  4NJ7 A;  4RM8 A;  3V6C B;  4W9H A;  3TIX A;  1V6E A;  1WZ0 A;  2ZVO A;  2LWP A;  3I3T B;  1UH6 A;  3ZUN A;  2ZZP B;  3ENE A;  1IP9 A;  2JY6 A;  5JZE B;  1A5R A;  1KJT A;  2XK5 B;  1WR1 A;  3JW0 X;  5E6O A;  3UF8 A;  2NR2 A;  2G4S A;  4FJV B;  4DWF A;  3PRE A;  4DXA B;  2KFK A;  1AAR A;  1HE8 A;  2L05 A;  3RUI B;  2D07 B;  3UGB B;  3V62 A;  1WY8 A;  3AUL A;  4FJZ A;  3RT3 B;  4GN1 A;  2NVU I;  4K7W A;  1EF5 A;  2PPH A;  1GC6 A;  1VCB A;  4W9G A;  3ZTC A;  1E7U A;  4TQ1 A;  3ZNI D;  1P9D U;  4GSW A;  3IVF A;  2IY1 B;  4CYE A;  1WX9 A;  1WE6 A;  2PE9 A;  3IG3 A;  4G0N B;  4WJP A;  3Q3J A;  3L16 A;  1WX7 A;  4B6W A;  1LXD A;  2ZNV C;  4F7Z A;  2OOB B;  4FA6 A;  2CKH B;  5D2M B;  2HTH A;  1WMH B;  2C7H A;  3ML8 A;  1UEL A;  4G50 A;  1S1Q B;  2JRH A;  3PRZ A;  3NZU A;  1Q1O A;  2C60 A;  2NS5 A;  2GBR A;  3PHX B;  5DPS A;  3U8Z A;  4ANU A;  4G3X B;  2C9W B;  3H9D A;  3RZW C;  3N30 A;  4IW0 A;  3KUD B;  2CS4 A;  2AWT A;  2N1V A;  3OLM D;  3ONS A;  3X23 A;  1E8Y A;  5LLI A;  4EKU A;  3DDC B;  2AYO B;  3A9J A;  2IBI B;  2L3Z A;  4BKS D;  3VVW B;  2G3Q B;  2N7E A;  2RR9 A;  2I1J A;  2MP2 B;  2KX3 A;  2KKC A;  3ZRC A;  4FAD A;  2D2Q A;  1C1Y B;  1YIW A;  3APC A;  4LDT B;  2KMA A;  1WXM A;  2CHW A;  4NPN A;  3VH3 B;  2JT4 B;  2O2V B;  4IM0 A;  4W9K A;  2KWU B;  3L08 A;  4YL8 A;  3VTW A;  3ZTD A;  1Y8R C;  3SD5 A;  4W9J A;  3V60 A;  4AP4 C;  4B95 A;  3WAM A;  2L7R A;  2MBH A;  2KLG A;  3PT2 B;  1Q0W B;  4ANW A;  1WFY A;  1OGW A;  2ZEQ A;  2KVR A;  5G55 A;  3ZKJ C;  4BKT A;  2BWF A;  3V61 A;  1OTR B;  2IO1 B;  4W9I A;  3VHT C;  3MJW A;  1WXA A;  3W1S A;  2RSU A;  2G4D B;  2KC1 A;  4HVB A;  2KTR A;  5AZG A;  2JZZ A;  2K6Q A;  2LGD A;  3PTF C;  4XX5 A;  1V86 A;  3B1L X;  2CR5 A;  2NBU A;  1ZGU B;  2O6V B;  3TCA A;  1LM8 B;  5CX3 A;  1U4A A;  1M94 A;  2CHX A;  4B9K A;  4DBG A;  2K6D B;  2LRW A;  4W9C A;  2FIF A;  3WAN A;  4HK2 A;  4FBJ B;  2FCN A;  3V6E B;  2BGF A;  4NAW A;  3IFW B;  4PS7 A;  2JF5 A;  2JXX A;  2LGX A;  2KNB A;  2LVQ A;  3QHT A;  4MSM B;  2MWS B;  2D3G A;  1EO6 A;  1H4R A;  5IAA C;  4M8N A;  1WGR A;  2KD0 A;  4IWO A;  3JSV A;  3U30 A;  1OQY A;  4DK5 A;  4MEM A;  5J18 A;  3OJ4 B;  3SHQ A;  1NDD A;  1E90 A;  2WWZ A;  4MH0 E;  2IO3 B;  3QQ8 B;  3QJZ A;  1WGG A;  3VXW A;  3DVG Y;  2KK8 A;  4DDI D;  1P0R A;  3H7S A;  1WH3 A;  4E74 A;  4LJO B;  3LDZ E;  4AJW A;  3A33 B;  3RYT A;  4EZK A;  2ZCB A;  2R2O A;  5D7G A;  5BO4 B;  3CF6 E;  4DHZ E;  2KTF A;  1E8Z A;  1E7V A;  3ALB A;  3DVG X;  2LD9 A;  3DBL I;  1XT9 B;  1YJ1 A;  3K9O B;  4FHJ A;  2LJ5 A;  4HXD A;  4RMA A;  5DPW A;  4K7S A;  5C1Z A;  4DHJ B;  3VDZ A;  4EOY A;  4ZRK A;  2Y5B B;  2BKR B;  4EFO A;  2BF8 B;  3H6N A;  3DVN U;  1L7Y A;  4ICU A;  2KQS A;  3UQA A;  4M0W B;  1JRU A;  4ICV A;  1J8C A;  4HCN B;  1WXS A;  2AEH A;  3H7P B;  4BFR A;  2FAZ A;  1WIA A;  3O65 B;  3NZS A;  4GDK A;  4IM2 A;  4BKS A;  5AEK B;  2ZJD A;  3EHV A;  3WAL A;  3QX1 A;  2PJH A;  4G11 A;  3RUL A;  2ZCC A;  3R7R A;  1UD7 A;  5LXI B;  4I6N B;  4TUU A;  4BOS C;  3HM3 A;  2V1Y A;  2BKF A;  3OAW A;  1SGH A;  3EFU A;  2KWV B;  3VAW A;  4GIV A;  4HDQ A;  3TBL D;  2FCS A;  3PSE B;  3ZIM A;  3ZVV A;  4NQK E;  5D6J B;  4GOC A;  4ZDV A;  2ASQ A;  3M62 B;  1EF1 A;  3L0W B;  4FUL A;  4NQL B;  3SDL C;  4CHK A;  4AUQ C;  3KUZ A;  3B0A A;  5CHW A;  3C0R B;  1SE9 A;  2NPT A;  3DQV A;  4OVU A;  3N32 A;  3SU8 X;  2MRP A;  1WJN A;  2J7Q B;  4GXB A;  4JQW C;  2KDE B;  4GB9 A;  2N7D A;  3ZDT A;  3NY5 A;  4A3O A;  2REX A;  1T0Y A;  3X0W A;  1H8C A;  4BKG A;  4EEW A;  3QK0 A;  2HJ8 A;  1RFA A;  4WJQ A;  2UWQ A;  2V4L A;  2KDF B;  1YQB A;  2B3A A;  4JGH B;  3ZNG C;  4AOF A;  3ZW3 A;  2JPH A;  3DVN V;  3P2B A;  2FUH B;  1WJ4 A;  4F1S A;  1WR6 E;  3UQB A;  3A1Q B;  4MGZ E;  3DCG A;  3D32 A;  3L54 A;  4KV2 A;  2C5L C;  1X1M A;  2KTR B;  3GOE A;  1K8R B;  2Z59 B;  3PLU A;  3AI5 A;  1LFD A;  2XEW A;  3L17 A;  2KFK B;  1L2N A;  2BYV E;  2EMT A;  1P1A A;  4PS3 A;  4E71 A;  1P98 A;  4KDL B;  3HIZ A;  5HKH A;  3VUW A;  5KHO A;  1YX6 B;  2KQ7 A;  2N9P C;  2JVC A;  2KX0 A;  3VTU A;  4HLE A;  3APF A;  1SIF A;  2KDB A;  3EEC A;  2Z0D B;  3DBH I;  3HHM A;  4NAW B;  4A20 A;  5CHV C;  4PYZ A;  3AXC A;  4GMV A;  2A4Z A;  1GG3 A;  5DPT A;  2M4N A;  2LGY A;  4AJY B;  4MDK E;  2JRI B;  3KH0 A;  4GGQ A;  1WF9 A;  4MGY E;  3RZF A;  3RCZ A;  3ML9 A;  5TR5 A;  4HDO A;  2KWC A;  4K7U A;  5AZF A;  3T9L A;  2KO3 A;  2DYM A;  2WDT B;  3WAP A;  4BBN C;  2KOX A;  2IYD B;  1J19 A;  3BIN A;  2MQJ A;  3DBR I;  4KDI C;  2KJH B;  3ZLZ A;  4URK A;  2C7N B;  2EKE C;  3QCA A;  3QWZ B;  2NCN A;  2MBE A;  1V80 A;  3VUX A;  2Z0E B;  2N1W A;  3R7Q A;  5DPR A;  2FID A;  2ZVN A;  3APD A;  4EZL A;  1UGM A;  4ZRJ A;  3A4S C;  3NHE B;  1CMX B;  1WYW B;  2RD0 A;  2MSE D;  4ZYN A;  3IBE A;  3L13 A;  4X57 B;  1IYF A;  5AZH A;  2IZV B;  2XBB C;  1I35 A;  4NY0 A;  2DAF A;  4K1R B;  1P3Q U;  1UBQ A;  2CU1 A;  2JUO A;  3VQI A;  2KN5 A;  3A1Q A;  2J0M A;  3W1S C;  3UIP B;  5J2R A;  2JWZ A;  1TZ1 A;  2KHW B;  4ANX A;  4GDK B;  4EUT A;  2O2V A;  4MJS A;  1WGH A;  1NI2 A;  4DHJ D;  1FXT B;  2BYF A;  1E8X A;  4DDG D;  2N9X A;  1BT0 A;  3PRP B;  2YLM A;  1YX5 B;  4FLH A;  3A9J B;  3IHP C;  2KJR A;  4WQO B;  3QIJ A;  4W9L A;  3A9K B;  4I6L B;  2UYZ B;  2M17 A;  2KXJ A;  4W9F A;  3GZN I;  4IWQ A;  3AU5 A;  1GNU A;  1OEY A;  1ISN A;  3A9K A;  1QZE A;  1MG8 A;  1UZX B;  4EZJ A;  2MBO A;  3PGE A;  5EDS A;  1Z5S B;  1RLF A;  1YD8 U;  2MBQ A; 
#chains in the Genus database with same CATH topology
 1D4B A;  1F1H A;  2W3S A;  2GBN A;  2K8C A;  1FRR A;  3SFD B;  1XD3 B;  2CHZ A;  2WXH A;  3QAR A;  1QQR A;  2DZI A;  3KYD D;  1RWS A;  1IGC A;  3PLV A;  2BYT A;  4WAF A;  5FR6 A;  4LCD E;  2KJ6 A;  4YSX B;  1ZE3 D;  1V49 A;  3L10 B;  4RGO S;  1GAQ B;  2O6V D;  2LXA A;  3DHI C;  3ZQ4 A;  1WZ3 A;  2Q5W D;  4XC2 A;  1WRD B;  1EU3 A;  3B9J A;  4JL9 A;  3M95 A;  1VZ6 A;  3T3O A;  4GU2 A;  2LRU A;  4MM3 A;  3FAH A;  5C2T B;  5I4D A;  4RM9 A;  2M8S A;  2BYE A;  1B9R A;  3ZGZ A;  5EE3 A;  4TKN A;  1ET9 A;  1FNU A;  3NS8 A;  1XLQ A;  4OZC A;  3RNE C;  1IPG A;  2C7M B;  3KUC B;  5HHD G;  4FN2 A;  3JVZ X;  1KLV A;  3ZNH B;  2L1A A;  1C9F A;  1HQR D;  2L0T A;  3EFC A;  4ZOH C;  2PEA A;  3NOB A;  2DBY A;  2W9N A;  2L83 A;  2DHZ A;  1VRA B;  3BVG A;  4LDT D;  4M01 A;  3R2I A;  4KSK C;  3R66 C;  3MTN B;  1WJ6 A;  1HTQ A;  2LXC A;  4W9D A;  5C23 A;  2WQY B;  5L95 C;  2KAN A;  1R4N I;  4XZ4 A;  2HE7 A;  2LUE A;  2YVC A;  3VH4 B;  4LJP B;  5JHB A;  2AQ1 B;  1J7C A;  3EA6 A;  2OJR A;  2IY0 B;  2N9E B;  3KVF B;  5D3I B;  4WWN A;  1KM7 A;  3BVZ A;  2XN9 C;  4GLS C;  1XCT L;  1F9J A;  3KYC D;  2DZM A;  2AL3 A;  1F2R C;  1WXV A;  2HD5 B;  4RM8 A;  3V6C B;  5IO9 A;  1IP9 A;  1XLN A;  3ENE A;  5JZE B;  1KJT A;  2XK5 B;  1WR1 A;  4DWF A;  4DXA B;  1FCL A;  2L05 A;  1GPX A;  1L0X B;  1WY8 A;  1ZDV A;  2NVU I;  1FNV A;  2BQQ A;  2W82 A;  4K3C A;  3TEW A;  3W5V B;  1VCB A;  5AUI A;  4TQ1 A;  4GSW A;  4G0N B;  4Q2J A;  1NI3 A;  3Q3J A;  1L4Z B;  2OOB B;  2CKH B;  1HZ6 A;  3MJ5 A;  2JRH A;  1DYQ A;  2NS5 A;  2GBR A;  5DPS A;  3URY A;  2N9L A;  4WUR A;  1JQ4 A;  2N1V A;  1GOZ A;  3OLM D;  3ONS A;  4A6Q A;  3DDC B;  2AYO B;  2L3Z A;  4OHJ A;  2G3Q B;  3NVZ A;  2MP2 B;  1YIW A;  3FIL A;  2HDE A;  3VH3 B;  1WXM A;  2CHW A;  5HFY A;  4IM0 A;  2O2V B;  4W9K A;  4OVZ A;  1F2R I;  3NZ3 A;  1L6U A;  3SD5 A;  4W9J A;  3V60 A;  4B95 A;  3RNF C;  1UWX A;  2L7R A;  4P16 A;  2MBH A;  1Q0W B;  4ANW A;  2IGD A;  4BKT A;  4RF0 A;  2BWF A;  3V61 A;  1OTR B;  2LHD A;  4H2A A;  3MJW A;  3MC0 B;  4IOI E;  2OJW A;  3HVD A;  2JZZ A;  5AZG A;  3E56 A;  1ZGU B;  3TCA A;  1LM8 B;  4DBG A;  2CHX A;  2K6D B;  2PTL A;  4HK2 A;  4L23 A;  2FCN A;  3GE8 C;  4XGA B;  3WAN A;  3V6E B;  4NAW A;  3DHG C;  4MSM B;  3Q8C A;  4M8N A;  4IWO A;  1MPE A;  1OQY A;  2BVC A;  3QQ8 B;  3P42 A;  1WGG A;  3H7S A;  3LDZ E;  4UDU C;  1CK1 A;  2ZCB A;  3DBH B;  1KH0 A;  4RF1 A;  2KTF A;  3ALB A;  4KX6 B;  2LD9 A;  4RMA A;  1XT9 B;  1YJ1 A;  3B2G A;  4TMA B;  1I7H A;  3VDZ A;  4EFO A;  1QT9 A;  3UQA A;  1FIQ A;  3FIL B;  1J8C A;  1N5X A;  2K0P A;  4HCN B;  3H7P B;  1YNT E;  3L4P A;  5AEK B;  3NZS A;  4BKS A;  5HI1 A;  4KGR A;  2BTE A;  1GB4 A;  3QX1 A;  2N0S B;  1UD7 A;  1SE2 A;  4TUU A;  3Q2A C;  2BKF A;  4GIV A;  4ZYS A;  2FCS A;  2WS3 B;  3PSE B;  2MJE A;  4NQK E;  1QF6 A;  4GOC A;  2ASQ A;  1JML A;  4FUL A;  1WWT A;  2NPT A;  1PFD A;  4OVU A;  1UGJ A;  4C4V B;  2BT6 A;  1WJN A;  4JQW C;  1YN3 A;  1T0Y A;  1H8C A;  4BKG A;  3QK0 A;  4USA A;  2KDF B;  4YSZ B;  3NS1 A;  2B3A A;  3ZNG C;  3ZW3 A;  3P2B A;  2FUH B;  1OQR A;  2QIE B;  4ZHO A;  2YEP B;  3PLU A;  1LFD A;  3ZJV A;  5LNK 1;  1CZP A;  2D3A A;  5KHO A;  2N9P C;  2JVC A;  3APF A;  4N6E B;  4JX1 C;  3DBH I;  2A4Z A;  3AEC B;  1GG3 A;  2ACZ B;  1KLG D;  4MDK E;  2DNF A;  4MGY E;  1FMA D;  4K7U A;  5AZF A;  1KF6 B;  4KDI C;  3BII D;  2SAK A;  2N1W A;  3R7Q A;  1F52 A;  4MM3 B;  2KVZ A;  2V4I B;  1C4P A;  2RD0 A;  4ZYN A;  1JAL A;  2MSE D;  4RCO A;  3L13 A;  1YJI A;  5AZH A;  2XBB C;  4K1R B;  2JUO A;  2GLS A;  3P4Q B;  4ANX A;  4EUT A;  4MJS A;  1WGH A;  1NI2 A;  4DHJ D;  1FXT B;  4DDG D;  3AN1 A;  1BT0 A;  2YLM A;  4FLH A;  3A9J B;  3IHP C;  2KJR A;  3ZJU A;  4W9L A;  3EGR A;  3ZXR A;  4IWQ A;  1OEY A;  3I5J C;  3A9K A;  1QZE A;  1TYG B;  5EDS A;  3N1Z C;  2KZR A;  1Z5S B;  1RLF A;  2IJ0 A;  2ZPN A;  2D11 A;  1XQQ A;  1WGY A;  1Z2M A;  3VTV A;  2A5U A;  1NBF C;  2NMQ A;  1MHH E;  2BWE S;  2J0K A;  3AE8 B;  4AWJ A;  1C77 A;  4LTU A;  3VUY A;  1E8W A;  4ZRQ A;  4BZA A;  2GBM A;  3BVM A;  2MP2 A;  3TEX A;  4XDD A;  1FXI A;  1PGB A;  1UNS A;  2K3U A;  1CJE A;  3GE3 C;  3P1M A;  5H92 C;  2MA9 B;  2K5P A;  2FCM A;  3ECI A;  2LVP A;  3H8H A;  5JH5 C;  4W9E A;  3GZN B;  3H1U A;  2KDI A;  3PVL A;  4IM3 A;  3KQ4 A;  3R3M A;  3CMM B;  1V97 A;  2K39 A;  3AEE B;  3OG5 A;  4HKZ E;  1JRO A;  2XK5 A;  4HRO A;  3VFK A;  1RM6 C;  3U2S C;  1ZKH A;  3T8M A;  3P4S B;  2JZ3 B;  2KYW A;  2RPQ A;  2KFJ A;  1V81 A;  2MW5 A;  1V2Y A;  1TTN A;  2L0F A;  1YN4 A;  1LO5 D;  3ZRF A;  1RYJ A;  5KHQ A;  2LMC A;  4ACF A;  1V5O A;  1ET6 A;  3AED B;  4HPM B;  1WX8 A;  4KIK B;  1IGD A;  3N9Y C;  2R2Q A;  2WXF A;  3NJT A;  2LGS A;  3A4R A;  2JYT A;  1KFY B;  1EUV B;  2M0X A;  5G5H A;  1LQB A;  2MH7 A;  2L00 B;  3T3N A;  1FPY A;  3WA0 A;  2ZPY A;  2VH1 A;  4RFB A;  1DOI A;  4TSS A;  2D10 A;  1GUA B;  2R61 A;  5IKC M;  4HWI B;  4IG7 B;  3CSF A;  3R8B A;  1S3S G;  2QDF A;  2CJN A;  3HK0 A;  4MSQ B;  2MCN B;  1R4M B;  2LGI A;  2RGF A;  4ARI A;  4WJO A;  1Q5W B;  1IBX A;  3AE5 B;  4E3C A;  1V5T A;  2NBW B;  1RRB A;  4WWO A;  3SR6 A;  5C3J B;  1HTO A;  1E5W A;  1NEN B;  3JSV B;  4HRS A;  4NJ7 A;  2OHF A;  1V6E A;  1WZ0 A;  2WXJ A;  3I3T B;  3ZUN A;  1UH6 A;  2JY6 A;  3UF8 A;  3PZ8 A;  3DWG C;  3AUL A;  1GB1 A;  4FJZ A;  2WXK A;  4K7W A;  3ZJT A;  1SXT A;  1GC6 A;  2L52 A;  2PLP A;  3ZTC A;  1E7U A;  2NTS A;  1AN8 A;  5FK9 C;  1ZXI A;  1NYQ A;  3ZYY X;  1FEH A;  2ZNV C;  3UI3 A;  1WXQ A;  4G50 A;  4NAM A;  3PRZ A;  3PHX B;  4ANU A;  4G3X B;  2D3B A;  4MH8 A;  4IW0 A;  2CS4 A;  1JWS D;  1I4Q A;  3X23 A;  1E8Y A;  3LXF A;  2K9X A;  4BKS D;  3VVW B;  2N7J A;  2N7E A;  5MPO A;  2G1E A;  2KX3 A;  4FAD A;  3U7Z A;  2Y3A A;  4LDT B;  5J17 A;  1VLB A;  1NYR A;  4YSY B;  3ZTD A;  3P4P B;  2LEK A;  3AE4 B;  1TS5 A;  2OED A;  1YQ3 B;  4W9I A;  3VHT C;  1ZPS A;  1WXA A;  2RSU A;  2G4D B;  2KC1 A;  3RN9 C;  4US8 A;  2KTR A;  3PTF C;  1V86 A;  2NBU A;  2O6V B;  3I9V 1;  1AWD A;  3TEZ A;  5CX3 A;  1M94 A;  1EU4 A;  1ESF A;  2LRW A;  4W9C A;  5JXV A;  1QOA A;  1SJE D;  1N61 A;  4PS7 A;  2CJO A;  2JXX A;  3E9S A;  2KNB A;  3QHT A;  1H4R A;  5BYQ A;  3Q3M C;  3U30 A;  4DK5 A;  2WWZ A;  3DBR B;  2PVO D;  4XYC A;  3ZXV A;  4E74 A;  2V9H A;  1E9M A;  1HA5 A;  3A33 B;  1ZUD 2;  5D7G A;  2R2O A;  1TIF A;  1D6E C;  4DHZ E;  1I4X A;  4IKG A;  5DPW A;  2WDQ B;  3DBL B;  4EOY A;  4ZRK A;  1PGX A;  1L7Y A;  1JRU A;  4ICV A;  4KKJ A;  1M4V A;  2AEH A;  1KTK A;  4BFR A;  1WIA A;  3O65 B;  3KWV A;  5E6J A;  3WAL A;  3HRD D;  2E3T A;  1C4C A;  4G11 A;  3RUL A;  3OAW A;  1SGH A;  3EFU A;  4HPP A;  2LUM A;  1TKE A;  3ZIM A;  4ZDV A;  3M62 B;  1YMH E;  3L0W B;  4NQL B;  4M00 A;  1V1O A;  1FRD A;  5FR3 A;  3Q8B A;  5IN7 A;  2KDE B;  3NY5 A;  3PZ7 A;  1RFK A;  3VR9 B;  4EEW A;  2HJ8 A;  1RFA A;  4WJQ A;  3LYY A;  2VZK B;  3ABV B;  1DOX A;  4JGH B;  3Q3N C;  4AOF A;  1F0Z A;  1UF0 A;  3VR8 B;  3UQB A;  3DCG A;  3D32 A;  3L54 A;  4KGS A;  3GOE A;  2C5L C;  2WDV B;  3AI5 A;  2KFK B;  1P1A A;  2NTT A;  3R2T A;  2QC8 A;  1FCC C;  1YX6 B;  2WXM A;  1P7F A;  1TKY A;  2Z0D B;  5H8Y E;  5BMH A;  2LGY A;  4AJY B;  2V3N A;  1LGR A;  3RZF A;  4HDO A;  3WAP A;  2KO3 A;  2WDT B;  4HEA 1;  4BBN C;  1WYG A;  1J19 A;  2MQJ A;  1E10 A;  2D3C A;  3V05 A;  2GI9 A;  2MBE A;  3VUX A;  2KQ4 X;  3MP9 A;  2ZVN A;  3APD A;  3TUO A;  4ZRJ A;  2IGG A;  2LFI A;  1WYW B;  3GB1 A;  2J52 A;  1STE A;  3W2D A;  3SFE B;  1I35 A;  3Q8E A;  2INN E;  2DAF A;  1Y56 A;  4WWM A;  3A1Q A;  2WHI A;  1N60 A;  2WLB A;  1IUE A;  5J2R A;  3AE2 B;  4C00 A;  3V3X A;  2JQR B;  1ENF A;  3FC4 A;  1YX5 B;  4YXD B;  3N1X C;  1ZP0 B;  2KDM A;  3QIJ A;  3A9K B;  4I6L B;  2UYZ B;  1C76 A;  2I38 A;  2Z8L A;  1ISN A;  4A90 A;  1MG8 A;  4EZJ A;  2ZW0 A;  3AEA B;  3PGE A;  5GXG B;  4MGI E;  3WAO A;  2IGH A;  4A3P A;  4WH4 A;  1OEY J;  4KZ0 A;  4A55 A;  1JRP A;  2RDB C;  3J9C A;  3RNC C;  3DOW A;  3EC8 A;  2PE6 B;  1WE7 A;  1ZW7 A;  4KZC A;  2KLC A;  1VZ7 A;  3TJP A;  1ACC A;  5IA7 A;  2DZK A;  2DZJ A;  4BBN F;  2X38 A;  2LAS A;  4KSL C;  3RI7 C;  3HM6 X;  3U4E G;  1N63 A;  2GMI C;  1D5X C;  2KT7 A;  2J0J A;  1TY0 A;  4YTP B;  3TL5 A;  3DPD A;  5FKA C;  4FJY A;  3RMK C;  1VD2 A;  4O1N A;  4MJS B;  1G6J A;  2DYB A;  4TQ0 A;  1FFU A;  2G45 B;  3BY4 B;  5D94 A;  1PQS A;  5D3D A;  4KVG B;  4P1B C;  3LB8 C;  2WXR A;  3WCQ A;  3N3K B;  2JU6 X;  3MHS D;  2NPT B;  1UBI A;  2G9H D;  3VRA B;  4BVU C;  5BMI A;  4ARC A;  3Q3F A;  2FCQ A;  4NNJ B;  1D5M C;  2RDH A;  3SEB A;  4A9A A;  4PS8 A;  3BYY B;  4WIP A;  2DYO A;  2K1F A;  1SE4 A;  4FHK A;  3WIM A;  4GDL A;  4ZHP A;  3K9P B;  2NBV B;  2IO0 B;  3TEY A;  1FNW A;  4QAY A;  3JYU A;  3PPA A;  4R3D A;  4N9F 4;  1FD6 A;  3OJ3 A;  1DOY A;  4K3B A;  4KIK A;  1TY2 A;  1J7A A;  1N62 A;  4II2 B;  1B1Z A;  1YN5 A;  4ITK A;  1I42 A;  5GMV A;  4HJK A;  3P63 A;  1QOG A;  2K8H A;  4II3 B;  1NEK B;  4NJ6 A;  2AL6 A;  2QSD A;  4KKI A;  2WX0 A;  4L1B A;  4C7Z A;  5G2N A;  3MHZ A;  4J6I A;  3U7D A;  2MLB A;  5BMG A;  3MC9 A;  1L6V A;  3RFZ B;  2QHO A;  2BS3 B;  4JLC A;  4C4V A;  2K25 A;  4WQM A;  2LI5 A;  4MEL A;  1YOV B;  1T0Q C;  5BYR A;  3DHH C;  4KGT A;  1QLB B;  4YTM B;  1GJZ A;  5T8I A;  1C3T A;  1F77 A;  2LVO A;  4M8M A;  1XF5 L;  4ASW C;  2EMS A;  3KW5 B;  2DEN B;  1TBE A;  1L0V B;  2J4X A;  2ZNV B;  3B08 A;  4P6V F;  2IO2 B;  3IT4 B;  1TKG A;  4AQ7 A;  1R4M I;  1T6B X;  3PZD A;  1QOB A;  4J3O D;  1WJU A;  4LK0 M;  2WXI A;  3P4R B;  2RMM A;  4HCP B;  2BPS A;  1L5P A;  1J0G A;  2V3S A;  4RNA A;  1JWA D;  2LWP A;  4M0W A;  3JW0 X;  5E6O A;  2GB1 A;  4M02 A;  2KFK A;  1HE8 A;  3RUI B;  3UGB B;  4BAX A;  4HJG E;  3RT3 B;  2CU3 A;  4GN1 A;  1MVK A;  1T5X D;  1P7E A;  1EF5 A;  3AE9 B;  3ZNI D;  3IVF A;  2IY1 B;  4N58 A;  2PE9 A;  2FUG 1;  1WX7 A;  2H89 B;  1DGJ A;  2H88 B;  4FA6 A;  1WMH B;  1CQV A;  5EE9 A;  2FBW B;  1Q1O A;  3NZU A;  3Q8F A;  3H9D A;  3AV8 A;  2AWT A;  4LNN A;  4B0E A;  5LLI A;  4EKU A;  3A9J A;  4AS1 A;  1FXA A;  2D5G A;  2I1J A;  2KKC A;  3ZRC A;  1R4N B;  1C1Y B;  2HTM E;  4NPN A;  3L08 A;  3AE7 B;  1Y8R C;  3NVV A;  1K52 A;  4XWT A;  3WAM A;  2KLG A;  1OGW A;  2ZEQ A;  2KVR A;  5G55 A;  3ZKJ C;  1MG4 A;  1WGK A;  4LNO A;  3KWL A;  2PW9 A;  2K6Q A;  2LGD A;  2CR5 A;  2W3R A;  2Y5P A;  2FIF A;  2BW2 A;  2BGF A;  1V1P B;  3IFW B;  2JF5 A;  2LVQ A;  2MJD A;  2MWS B;  3RNA C;  1WGR A;  4MEM A;  3IAM 1;  5J18 A;  3OJ4 B;  1XO3 A;  1E90 A;  1NDD A;  4MH0 E;  1SIJ A;  1TZO A;  3VXW A;  3DVG Y;  4DDI D;  1P0R A;  1WH3 A;  1IBX B;  4AJW A;  4EZK A;  3CF6 E;  4DQO C;  2WU2 B;  1E8Z A;  1E7V A;  3DVG X;  4IDI A;  2WXO A;  3O13 A;  3K9O B;  4FHJ A;  4K7S A;  4DHJ B;  4C56 C;  2BF8 B;  1N6Z A;  3H6N A;  3DVN U;  4ICU A;  1JWU D;  2KQS A;  3BK2 A;  1SE3 A;  4IM2 A;  1C4A A;  3N1Y C;  2ZJD A;  3Q14 C;  2PJH A;  2RDG A;  5LXI B;  4I6N B;  1MFW A;  2GRI A;  2IDY A;  2PVG C;  4NJC A;  5D6J B;  3SDL C;  3KUZ A;  1K50 A;  4HKQ A;  5CHW A;  3C0R B;  3DQV A;  3SU8 X;  2QMT A;  1YJJ A;  1TJE A;  4GB9 A;  2REX A;  3C19 A;  4OW0 A;  1A70 A;  2UWQ A;  4A8X C;  1YQB A;  4DXF A;  1ROE A;  2JPH A;  1BUI C;  1R7S A;  1WJ4 A;  4F1S A;  1WR6 E;  4MGZ E;  4KV2 A;  3W5U B;  1X1M A;  2INC C;  2Z59 B;  3L17 A;  1T0R C;  2WXP A;  2EMT A;  4E71 A;  1P98 A;  2ON8 A;  2KQ7 A;  2KX0 A;  4HLE A;  1E0Z A;  1SIF A;  2KDB A;  2K22 A;  4S0R A;  3EEC A;  3I57 A;  3RNB C;  4NAW B;  2BS4 B;  4A20 A;  5CHV C;  1L4D B;  3AXC A;  4GMV A;  5DPT A;  2MHJ A;  2JRI B;  1WF9 A;  1FO4 A;  4XE0 A;  5TR5 A;  2KWC A;  4OZA A;  3T9L A;  2DYM A;  2KOX A;  2IYD B;  3BIN A;  2KJH B;  2KAJ A;  2EKE C;  4JE3 B;  1V80 A;  1VZ8 A;  1K53 A;  2FID A;  4EZL A;  3NHE B;  2QJL A;  4YWG G;  3AM9 A;  2W54 A;  1TS4 A;  1C79 A;  1P3Q U;  1UBQ A;  2CU1 A;  3VQI A;  2J0M A;  2JWZ A;  1TZ1 A;  2KHW B;  1L0Y B;  4GDK B;  2N9K A;  1E8X A;  3PRP B;  3B2F A;  3IAS 1;  1JCK B;  4MT5 A;  4WQO B;  2AQ2 B;  1K51 A;  4W9F A;  2KXJ A;  3OWE B;  1JW9 D;  4LNK A;  2Y5C A;  1UZX B;  1N5W A;  4N59 A;  4LNI A;  1YD8 U;  2MBQ A;  3NRZ A;  4YT0 B;  2KWD A;  3PS6 A;  4F8C B;  3QA8 A;  4IUM B;  2IND C;  3UIN B;  4C7Y A;  3ZDM C;  4WWP A;  4PK1 A;  2DLB A;  1TT5 B;  1EWY C;  5IOI A;  4LLG M;  2KC2 A;  3UIO B;  1VJK A;  3CWI A;  1J7B A;  2W55 A;  3M63 B;  2K8B A;  5DCN A;  1D3Z A;  1WM3 A;  5L83 A;  2DAJ A;  4BOZ B;  1XEE A;  2DX5 B;  1BML C;  2GBK A;  4MGK E;  3QC8 B;  1XCQ L;  4FXC A;  2N4F A;  2O6V A;  3Q69 A;  1I4R A;  4OVV A;  3M3J A;  4DHZ B;  3IXS A;  2WYQ A;  1I4P A;  4TV3 A;  2KMC A;  3PRM B;  5E6N A;  2EEL A;  3CST A;  4GDL B;  3VRB B;  2GOW A;  1I4G A;  4JWU C;  5AUK A;  1TGZ B;  5IP4 D;  4WAA A;  1QOF A;  3DBS A;  4REZ A;  2VRR B;  1WI0 A;  3GP7 A;  1SBB B;  4EE2 A;  1T3Q A;  4S17 A;  3BWU D;  2AX5 A;  1EM7 A;  4JPS A;  2JWU A;  4PYU A;  1SSN A;  2TSS A;  3TSS A;  2QEJ C;  3AMZ A;  4OZB A;  4C80 A;  1TS3 A;  3QAQ A;  3DWM A;  1GC7 A;  1VR9 A;  3PV1 A;  2I1K A;  1WM2 A;  3RD2 A;  1RAX A;  3N20 C;  1WMH A;  5CHF A;  5E6P A;  4ANV A;  4D2K A;  1C78 A;  2M1M A;  2GBJ A;  1T0S C;  4K81 A;  3AU4 A;  3NVY A;  2MX2 A;  2ICI A;  4CO7 A;  4B0M A;  3RNG C;  3PHW B;  4I6P A;  2LHE A;  3S2A A;  4IWP A;  2RPV A;  1KOT A;  5JHA A;  4WJN A;  4IC7 B;  4L2Y A;  3MC8 A;  2L76 A;  2L8J A;  3HUI A;  2FNJ B;  3LJ3 A;  4JIO U;  4ZRI A;  5CTR C;  2PMV A;  2LZ6 A;  3ZO5 B;  3CIR B;  1Q10 A;  4P7I A;  2MBB B;  4HPL B;  3Q6B A;  1PDX A;  5LXH A;  1WGD A;  1OQQ A;  3W1Y A;  2BBC A;  2WX1 A;  3AE6 B;  2HJ1 A;  3H7P A;  1ZOY B;  3Q3O C;  1MI0 A;  1PUT A;  2YEP F;  1FFV A;  1V9J A;  3TMP B;  1HEZ E;  2KMM A;  3ZNZ B;  4W9H A;  3TIX A;  2ZVO A;  5TSS A;  2ZZP B;  1A5R A;  2NR2 A;  2G4S A;  4FJV B;  3PRE A;  1YQ4 B;  1FM0 D;  1AAR A;  3V62 A;  2D07 B;  1KRH A;  1KLU D;  2VH2 A;  2KAC A;  3NVW A;  2JYE A;  2PPH A;  4W9G A;  1P9D U;  2QIL A;  2WNM A;  4CYE A;  1WX9 A;  1WE6 A;  3IG3 A;  4WJP A;  2PIA A;  1HXY D;  3L16 A;  4B6W A;  1LXD A;  4F7Z A;  4ZRP A;  5D2M B;  2WDR B;  2HTH A;  2C7H A;  3ML8 A;  1UEL A;  4JWS C;  3FKY A;  1S1Q B;  3PO0 A;  2C60 A;  3U8Z A;  2E6X A;  1BXT A;  2C9W B;  3RZW C;  3N30 A;  3KUD B;  1MHX A;  4CQN A;  4RGN A;  2UU7 A;  2IBI B;  2WXL A;  3I63 C;  2XNA C;  1SB3 C;  2RR9 A;  2J53 A;  4MAC A;  2D2Q A;  2KMA A;  1UWM A;  4XDC A;  1JWB D;  2JT4 B;  3VTW A;  2KWU B;  4YL8 A;  4YTN B;  2BB6 A;  4AP4 C;  2QCZ A;  4NZL B;  3PT2 B;  1WFY A;  1V1P A;  1E7P B;  2MJ3 A;  2IO1 B;  1MJD A;  3IT6 B;  3W1S A;  3Q8A A;  4HVB A;  2X8X X;  4XX5 A;  1PYW D;  2KN4 A;  3B1L X;  2WXG A;  1U4A A;  3GS2 A;  4B9K A;  3AEB B;  4FBJ B;  3BZD B;  1OFF A;  2ONQ A;  2WGS A;  3KLS X;  2LGX A;  1VDV A;  2MEK A;  2D3G A;  1EO6 A;  2VZK D;  5IAA C;  2KD0 A;  3JSV A;  2WP9 B;  2JSV X;  3MFG A;  3SHQ A;  2IO3 B;  3QJZ A;  2KK8 A;  4LJO B;  3EUB 2;  2M19 A;  3RYT A;  2V3P A;  5BO4 B;  2BB5 A;  3DBL I;  4HXD A;  2LJ5 A;  5C1Z A;  1ZXH A;  2JXT A;  2WXQ A;  2Y5B B;  2BKR B;  1WRI A;  1SJH D;  4RH6 A;  3RPF C;  4M0W B;  1WXS A;  5EE0 A;  2FAZ A;  2PKO A;  4GDK A;  3EHV A;  2I2Y A;  2EKI A;  1D5Z C;  3BYT B;  2B76 B;  2ZCC A;  3R7R A;  4BOS C;  3HM3 A;  3AB5 A;  2V1Y A;  2WXN A;  2LJI A;  2KWV B;  3VAW A;  4HDQ A;  3TBL D;  3ZVV A;  1EF1 A;  2INP E;  4CHK A;  2L32 A;  1PGA A;  4AUQ C;  1NVI D;  3B0A A;  1SE9 A;  5BYS A;  1E6E B;  3N32 A;  1XLO A;  2MRP A;  2J7Q B;  4GXB A;  2N7D A;  3ZDT A;  3AEF B;  4A3O A;  3X0W A;  4P1C C;  2V4L A;  3AEG B;  3DVN V;  3AE1 B;  2WU5 B;  3A1Q B;  5HG2 A;  4DXG A;  2KTR B;  1UUP A;  1K8R B;  2SEB D;  2XEW A;  1L2N A;  2FE8 A;  1HZ5 A;  2BYV E;  4PS3 A;  1QKZ A;  4KDL B;  3HIZ A;  5HKH A;  3VUW A;  1TS2 A;  3VTU A;  2J42 A;  1SEB D;  3AE3 B;  3HVZ A;  1XLP A;  3HHM A;  1ZDX A;  2IPK D;  4PYZ A;  1AW7 A;  3BK1 A;  3NUH B;  5G5G A;  2M4N A;  2JZP A;  3KH0 A;  4GGQ A;  1EWC A;  3RCZ A;  1JWM D;  3ML9 A;  3DBR I;  3ZLZ A;  4URK A;  2C7N B;  4PT5 A;  1I4H A;  3QCA A;  2NCN A;  3QWZ B;  1XXG A;  5EE1 A;  2Z0E B;  4RGM A;  5DPR A;  2BS2 B;  1UGM A;  3A4S C;  4XWW A;  1CMX B;  1QIL A;  3IBE A;  4X57 B;  1IYF A;  2DWQ A;  2IZV B;  4NY0 A;  2KN5 A;  3U52 E;  3W1S C;  3UIP B;  2V0G A;  1AYF A;  2O2V A;  2ZW1 A;  3NG0 A;  2BYF A;  2N9X A;  1SF0 A;  3ETR A;  2M56 B;  4LNF A;  3W9C B;  1V8C A;  2JX5 A;  4RGT A;  2M17 A;  3C8Y A;  4US9 A;  3GZN I;  3AH7 A;  3AU5 A;  1GNU A;  2M0A A;  2AQ3 B;  1WSP A;  2MBO A;  3APC A; 
#chains in the Genus database with same CATH homology
 2ZPN A;  3PS6 A;  2D11 A;  3QA8 A;  1XQQ A;  4IUM B;  1WGY A;  1Z2M A;  3VTV A;  4MGI E;  3WAO A;  3UIN B;  2A5U A;  2GBN A;  4A3P A;  2K8C A;  1OEY J;  4KZ0 A;  1NBF C;  3ZDM C;  4WWP A;  1XD3 B;  2BWE S;  2CHZ A;  2J0K A;  3DOW A;  3EC8 A;  2PE6 B;  3QAR A;  4AWJ A;  1WE7 A;  1ZW7 A;  2KC2 A;  4KZC A;  3VUY A;  2KLC A;  3UIO B;  1E8W A;  2DZI A;  3TJP A;  3KYD D;  3PLV A;  5IA7 A;  2DZK A;  2DZJ A;  4BBN F;  3M63 B;  2K8B A;  2LAS A;  5DCN A;  5J17 A;  1D3Z A;  2GBM A;  1WM3 A;  2MP2 A;  5L83 A;  2DAJ A;  4KSL C;  5FR6 A;  3HM6 X;  2GMI C;  4BOZ B;  2DX5 B;  2GBK A;  4MGK E;  4LCD E;  2KJ6 A;  3QC8 B;  2J0J A;  1V49 A;  3L10 B;  3TL5 A;  3DPD A;  2O6V D;  4FJY A;  2N4F A;  2O6V A;  1VD2 A;  1G6J A;  4MJS B;  2DYB A;  4OVV A;  2LXA A;  3M3J A;  4DHZ B;  4TQ0 A;  2MA9 B;  2G45 B;  3BY4 B;  1WZ3 A;  2FCM A;  2WYQ A;  4TV3 A;  5D94 A;  3ECI A;  2LVP A;  2KMC A;  3PRM B;  5E6N A;  3CST A;  1PQS A;  5JH5 C;  4KVG B;  4W9E A;  4XC2 A;  3H1U A;  1WRD B;  2KDI A;  3PVL A;  4GDL B;  2GOW A;  4IM3 A;  3N3K B;  3MHS D;  3R3M A;  2NPT B;  3CMM B;  2K39 A;  4JL9 A;  1TGZ B;  1UBI A;  3M95 A;  4WAA A;  4BVU C;  4GU2 A;  2XK5 A;  3Q3F A;  2FCQ A;  2LRU A;  3DBS A;  4MM3 A;  4NNJ B;  3VFK A;  2VRR B;  1WI0 A;  1ZKH A;  4RM9 A;  3T8M A;  2M8S A;  2BYE A;  4TKN A;  3NS8 A;  4PS8 A;  2JZ3 B;  2DYO A;  2K1F A;  2RPQ A;  2KFJ A;  4PYU A;  4FHK A;  1V81 A;  2MW5 A;  3WIM A;  1V2Y A;  1IPG A;  1TTN A;  2C7M B;  2L0F A;  3KUC B;  4GDL A;  4FN2 A;  3K9P B;  2NBV B;  3JVZ X;  2IO0 B;  3JYU A;  3ZNH B;  3ZRF A;  5KHQ A;  1KLV A;  3PPA A;  3QAQ A;  4N9F 4;  1GC7 A;  3PV1 A;  1V5O A;  2I1K A;  1WM2 A;  3OJ3 A;  3RD2 A;  1RAX A;  2L0T A;  4KIK A;  5CHF A;  1WMH A;  4HPM B;  4II2 B;  2PEA A;  3NOB A;  5E6P A;  4ANV A;  1WX8 A;  2W9N A;  4KIK B;  2DHZ A;  4F8C B;  1I42 A;  4LDT D;  5GMV A;  2M1M A;  2GBJ A;  4HJK A;  4K81 A;  4KSK C;  2R2Q A;  3AU4 A;  3R66 C;  3MTN B;  2MX2 A;  2K8H A;  4II3 B;  1WJ6 A;  4CO7 A;  2LXC A;  4W9D A;  5C23 A;  3A4R A;  4NJ6 A;  2AL6 A;  3PHW B;  4I6P A;  2WX0 A;  5L95 C;  1EUV B;  2KAN A;  2M0X A;  5G2N A;  3S2A A;  4J6I A;  4IWP A;  1KOT A;  1R4N I;  3U7D A;  2MLB A;  5JHA A;  1LQB A;  2KZR A;  4XZ4 A;  2HE7 A;  4WJN A;  4IC7 B;  2QHO A;  4JLC A;  2L00 B;  2L76 A;  2L8J A;  2LUE A;  2YVC A;  3VH4 B;  2K25 A;  3WA0 A;  2FNJ B;  2LI5 A;  4LJP B;  3LJ3 A;  5JHB A;  4MEL A;  2ZPY A;  4JIO U;  4ZRI A;  5CTR C;  2D10 A;  1GUA B;  2LZ6 A;  2OJR A;  2IY0 B;  3ZO5 B;  2N9E B;  4HWI B;  3KVF B;  4IG7 B;  4P7I A;  2MBB B;  3CSF A;  4HPL B;  1GJZ A;  1C3T A;  2LVO A;  4M8M A;  4ASW C;  2EMS A;  1S3S G;  5LXH A;  3KW5 B;  2DEN B;  1WGD A;  1TBE A;  2ZNV B;  3HK0 A;  4MSQ B;  4WWN A;  2MCN B;  1KM7 A;  3B08 A;  2RGF A;  2IO2 B;  4WJO A;  3W1Y A;  1Q5W B;  2WX1 A;  1R4M I;  1F9J A;  3KYC D;  3PZD A;  4E3C A;  1V5T A;  3H7P A;  1WJU A;  2NBW B;  1RRB A;  4WWO A;  2DZM A;  4HCP B;  2AL3 A;  2BPS A;  1E5W A;  1V9J A;  1J0G A;  3JSV B;  3TMP B;  3ZNZ B;  2V3S A;  1WXV A;  2HD5 B;  4NJ7 A;  4RM8 A;  3V6C B;  4W9H A;  3TIX A;  1V6E A;  1WZ0 A;  2ZVO A;  2LWP A;  3I3T B;  1UH6 A;  3ZUN A;  2ZZP B;  3ENE A;  1IP9 A;  2JY6 A;  5JZE B;  1A5R A;  1KJT A;  2XK5 B;  1WR1 A;  3JW0 X;  5E6O A;  3UF8 A;  2NR2 A;  2G4S A;  4FJV B;  4DWF A;  3PRE A;  4DXA B;  2KFK A;  1AAR A;  1HE8 A;  2L05 A;  3RUI B;  2D07 B;  3UGB B;  3V62 A;  1WY8 A;  3AUL A;  4FJZ A;  3RT3 B;  4GN1 A;  2NVU I;  4K7W A;  1EF5 A;  2PPH A;  1GC6 A;  1VCB A;  4W9G A;  3ZTC A;  1E7U A;  4TQ1 A;  3ZNI D;  1P9D U;  4GSW A;  3IVF A;  2IY1 B;  4CYE A;  1WX9 A;  1WE6 A;  2PE9 A;  3IG3 A;  4G0N B;  4WJP A;  3Q3J A;  3L16 A;  1WX7 A;  4B6W A;  1LXD A;  2ZNV C;  4F7Z A;  2OOB B;  4FA6 A;  2CKH B;  5D2M B;  2HTH A;  1WMH B;  2C7H A;  3ML8 A;  1UEL A;  4G50 A;  1S1Q B;  2JRH A;  3PRZ A;  3NZU A;  1Q1O A;  2C60 A;  2NS5 A;  2GBR A;  3PHX B;  5DPS A;  3U8Z A;  4ANU A;  4G3X B;  2C9W B;  3H9D A;  3RZW C;  3N30 A;  4IW0 A;  3KUD B;  2CS4 A;  2AWT A;  2N1V A;  3OLM D;  3ONS A;  3X23 A;  1E8Y A;  5LLI A;  4EKU A;  3DDC B;  2AYO B;  3A9J A;  2IBI B;  2L3Z A;  4BKS D;  3VVW B;  2G3Q B;  2N7E A;  2RR9 A;  2I1J A;  2MP2 B;  2KX3 A;  2KKC A;  3ZRC A;  4FAD A;  2D2Q A;  1C1Y B;  1YIW A;  3APC A;  4LDT B;  2KMA A;  1WXM A;  2CHW A;  4NPN A;  3VH3 B;  2JT4 B;  2O2V B;  4IM0 A;  4W9K A;  2KWU B;  3L08 A;  4YL8 A;  3VTW A;  3ZTD A;  1Y8R C;  3SD5 A;  4W9J A;  3V60 A;  4AP4 C;  4B95 A;  3WAM A;  2L7R A;  2MBH A;  2KLG A;  3PT2 B;  1Q0W B;  4ANW A;  1WFY A;  1OGW A;  2ZEQ A;  2KVR A;  5G55 A;  3ZKJ C;  4BKT A;  2BWF A;  3V61 A;  1OTR B;  2IO1 B;  4W9I A;  3VHT C;  3MJW A;  1WXA A;  3W1S A;  2RSU A;  2G4D B;  2KC1 A;  4HVB A;  2KTR A;  5AZG A;  2JZZ A;  2K6Q A;  2LGD A;  3PTF C;  4XX5 A;  1V86 A;  3B1L X;  2CR5 A;  2NBU A;  1ZGU B;  2O6V B;  3TCA A;  1LM8 B;  5CX3 A;  1U4A A;  1M94 A;  2CHX A;  4B9K A;  4DBG A;  2K6D B;  2LRW A;  4W9C A;  2FIF A;  3WAN A;  4HK2 A;  4FBJ B;  2FCN A;  3V6E B;  2BGF A;  4NAW A;  3IFW B;  4PS7 A;  2JF5 A;  2JXX A;  2LGX A;  2KNB A;  2LVQ A;  3QHT A;  4MSM B;  2MWS B;  2D3G A;  1EO6 A;  1H4R A;  5IAA C;  4M8N A;  1WGR A;  2KD0 A;  4IWO A;  3JSV A;  3U30 A;  1OQY A;  4DK5 A;  4MEM A;  5J18 A;  3OJ4 B;  3SHQ A;  1NDD A;  1E90 A;  2WWZ A;  4MH0 E;  2IO3 B;  3QQ8 B;  3QJZ A;  1WGG A;  3VXW A;  3DVG Y;  2KK8 A;  4DDI D;  1P0R A;  3H7S A;  1WH3 A;  4E74 A;  4LJO B;  3LDZ E;  4AJW A;  3A33 B;  3RYT A;  4EZK A;  2ZCB A;  2R2O A;  5D7G A;  5BO4 B;  3CF6 E;  4DHZ E;  2KTF A;  1E8Z A;  1E7V A;  3ALB A;  3DVG X;  2LD9 A;  3DBL I;  1XT9 B;  1YJ1 A;  3K9O B;  4FHJ A;  2LJ5 A;  4HXD A;  4RMA A;  5DPW A;  4K7S A;  5C1Z A;  4DHJ B;  3VDZ A;  4EOY A;  4ZRK A;  2Y5B B;  2BKR B;  4EFO A;  2BF8 B;  3H6N A;  3DVN U;  1L7Y A;  4ICU A;  2KQS A;  3UQA A;  4M0W B;  1JRU A;  4ICV A;  1J8C A;  4HCN B;  1WXS A;  2AEH A;  3H7P B;  4BFR A;  2FAZ A;  1WIA A;  3O65 B;  3NZS A;  4GDK A;  4IM2 A;  4BKS A;  5AEK B;  2ZJD A;  3EHV A;  3WAL A;  3QX1 A;  2PJH A;  4G11 A;  3RUL A;  2ZCC A;  3R7R A;  1UD7 A;  5LXI B;  4I6N B;  4TUU A;  4BOS C;  3HM3 A;  2V1Y A;  2BKF A;  3OAW A;  1SGH A;  3EFU A;  2KWV B;  3VAW A;  4GIV A;  4HDQ A;  3TBL D;  2FCS A;  3PSE B;  3ZIM A;  3ZVV A;  4NQK E;  5D6J B;  4GOC A;  4ZDV A;  2ASQ A;  3M62 B;  1EF1 A;  3L0W B;  4FUL A;  4NQL B;  3SDL C;  4CHK A;  4AUQ C;  3KUZ A;  3B0A A;  5CHW A;  3C0R B;  1SE9 A;  2NPT A;  3DQV A;  4OVU A;  3N32 A;  3SU8 X;  2MRP A;  1WJN A;  2J7Q B;  4GXB A;  4JQW C;  2KDE B;  4GB9 A;  2N7D A;  3ZDT A;  3NY5 A;  4A3O A;  2REX A;  1T0Y A;  3X0W A;  1H8C A;  4BKG A;  4EEW A;  3QK0 A;  2HJ8 A;  1RFA A;  4WJQ A;  2UWQ A;  2V4L A;  2KDF B;  1YQB A;  2B3A A;  4JGH B;  3ZNG C;  4AOF A;  3ZW3 A;  2JPH A;  3DVN V;  3P2B A;  2FUH B;  1WJ4 A;  4F1S A;  1WR6 E;  3UQB A;  3A1Q B;  4MGZ E;  3DCG A;  3D32 A;  3L54 A;  4KV2 A;  2C5L C;  1X1M A;  2KTR B;  3GOE A;  1K8R B;  2Z59 B;  3PLU A;  3AI5 A;  1LFD A;  2XEW A;  3L17 A;  2KFK B;  1L2N A;  2BYV E;  2EMT A;  1P1A A;  4PS3 A;  4E71 A;  1P98 A;  4KDL B;  3HIZ A;  5HKH A;  3VUW A;  5KHO A;  1YX6 B;  2KQ7 A;  2N9P C;  2JVC A;  2KX0 A;  3VTU A;  4HLE A;  3APF A;  1SIF A;  2KDB A;  3EEC A;  2Z0D B;  3DBH I;  3HHM A;  4NAW B;  4A20 A;  5CHV C;  4PYZ A;  3AXC A;  4GMV A;  2A4Z A;  1GG3 A;  5DPT A;  2M4N A;  2LGY A;  4AJY B;  4MDK E;  2JRI B;  3KH0 A;  4GGQ A;  1WF9 A;  4MGY E;  3RZF A;  3RCZ A;  3ML9 A;  5TR5 A;  4HDO A;  2KWC A;  4K7U A;  5AZF A;  3T9L A;  2KO3 A;  2DYM A;  2WDT B;  3WAP A;  4BBN C;  2KOX A;  2IYD B;  1J19 A;  3BIN A;  2MQJ A;  3DBR I;  4KDI C;  2KJH B;  3ZLZ A;  4URK A;  2C7N B;  2EKE C;  3QCA A;  3QWZ B;  2NCN A;  2MBE A;  1V80 A;  3VUX A;  2Z0E B;  2N1W A;  3R7Q A;  5DPR A;  2FID A;  2ZVN A;  3APD A;  4EZL A;  1UGM A;  4ZRJ A;  3A4S C;  3NHE B;  1CMX B;  1WYW B;  2RD0 A;  2MSE D;  4ZYN A;  3IBE A;  3L13 A;  4X57 B;  1IYF A;  5AZH A;  2IZV B;  2XBB C;  1I35 A;  4NY0 A;  2DAF A;  4K1R B;  1P3Q U;  1UBQ A;  2CU1 A;  2JUO A;  3VQI A;  2KN5 A;  3A1Q A;  2J0M A;  3W1S C;  3UIP B;  5J2R A;  2JWZ A;  1TZ1 A;  2KHW B;  4ANX A;  4GDK B;  4EUT A;  2O2V A;  4MJS A;  1WGH A;  1NI2 A;  4DHJ D;  1FXT B;  2BYF A;  1E8X A;  4DDG D;  2N9X A;  1BT0 A;  3PRP B;  2YLM A;  1YX5 B;  4FLH A;  3A9J B;  3IHP C;  2KJR A;  4WQO B;  3QIJ A;  4W9L A;  3A9K B;  4I6L B;  2UYZ B;  2M17 A;  2KXJ A;  4W9F A;  3GZN I;  4IWQ A;  3AU5 A;  1GNU A;  1OEY A;  1ISN A;  3A9K A;  1QZE A;  1MG8 A;  1UZX B;  4EZJ A;  2MBO A;  3PGE A;  5EDS A;  1Z5S B;  1RLF A;  1YD8 U;  2MBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...