2B3AA

Solution structure of the ras-binding domain of the ral guanosine dissociation stimulator
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
87
structure length
87
Chain Sequence
DCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ral guanine nucleotide dissociation stimulator
publication title New insights into binding of the possible cancer target RalGDS
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 17
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2005-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2b3aA00
2PPHA 1OTRB 4HJKA 3UQAA 2KKCA 2C7HA 2KC1A 4KZ0A 1K8RB 4FBJB 2JWZA 1SGHA 2R2OA 4DDID 3PPAA 4GDLB 1WXMA 4IM3A 2A4ZA 3EC8A 2GBRA 3DOWA 2FCSA 3VTUA 2M1MA 2W9NA 2LVOA 2BPSA 2JZ3B 2HE7A 3VDZA 3ZDTA 2C9WB 3ML9A 5D6JB 4IW0A 3T9LA 1OGWA 3VXWA 3RZWC 4I6LB 4CYEA 1V49A 1WJ6A 3GOEA 4GXBA 3ZNGC 3UF8A 2JVCA 2ZEQA 2NVUI 4J6IA 2KC2A 4E71A 5DPTA 3PT2B 2K6DB 1EO6A 1V81A 2KWVB 4WWNA 2ZVNA 4GB9A 4BKSA 4M8MA 2GBNA 2KFKB 4HVBA 4DDGD 2BYVE 2J7QB 4LJOB 1UZXB 1HE8A 2LXCA 5E6PA 2KQSA 2BYEA 1JRUA 2BWFA 2DYBA 3VAWA 1Q0WB 3WAPA 1WX7A 2N4FA 4XZ4A 2LZ6A 2GBMA 2KMAA 3B1LX 2MSED 4CO7A 2AL6A 4AUQC 4CHKA 1Z2MA 1C3TA 1H8CA 1WE7A 4MDKE 3NZSA 4TQ1A 3OJ4B 4G0NB 1NBFC 2KX0A 2L7RA 2LUEA 2FNJB 4MGYE 4KSKC 2GOWA 5E6OA 3NY5A 3HM3A 3HIZA 2A5UA 4BOZB 3KUCB 4FJVB 5CTRC 3VUXA 2R2QA 2LASA 1R4MI 3APFA 4II3B 2K8CA 1RLFA 2KLCA 4KZCA 3VFKA 4GN1A 3V62A 3WAMA 3ZNZB 3IVFA 3IBEA 1UH6A 2GMIC 4NQKE 1ZGUB 1L7YA 3PZDA 2MQJA 1QZEA 2KLGA 3ZRCA 2MP2A 4TQ0A 2JXXA 4YL8A 3H7SA 3PLVA 2D11A 4K1RB 2V4LA 1T0YA 3A33B 4WJQA 4ANUA 4I6PA 3VUWA 4NQLB 1OEYJ 2K25A 4KIKB 4BOSC 3HK0A 3UINB 3C0RB 4GOCA 1V86A 3PSEB 4MGKE 3A9JB 3M63B 1NI2A 1WXVA 5E6NA 3K9OB 1IP9A 2PE9A 1WJUA 4M8NA 1P9DU 4X57B 2K6QA 4BKSD 2KHWB 2JPHA 2KX3A 3N30A 4HCPB 4W9DA 3S2AA 5FR6A 3ZNHB 2C5LC 1Y8RC 4F8CB 3ENEA 3VH3B 1V5OA 3D32A 4FHKA 4KVGB 1SE9A 1LXDA 2LRWA 3NOBA 1XD3B 2EMSA 1WGRA 5AZFA 2N9EB 2JF5A 4M0WB 4F1SA 4ANWA 1I42A 2XBBC 4ZRKA 2JZZA 3LDZE 4ZRJA 3ZO5B 4GDKB 1E8XA 3VQIA 4BBNC 1WGGA 2C7MB 1A5RA 2WX0A 2D2QA 3P2BA 4HDQA 2ZNVB 3DDCB 3VTWA 3KYDD 2MBOA 4IWPA 1G6JA 2BWES 3M3JA 3LJ3A 2N1VA 4GSWA 3L10B 1WZ3A 3RZFA 3AU5A 1XT9B 4A3PA 2KFKA 1E5WA 3ZLZA 2PEAA 4ICUA 2JRHA 3ZIMA 3AI5A 2N7EA 5KHQA 1WM3A 3OAWA 1H4RA 2WX1A 3RCZA 3UGBB 1D3ZA 3PV1A 4DHJB 1TZ1A 4K7SA 1WMHB 5D2MB 3ZTCA 2RGFA 1V5TA 3QWZB 3QHTA 4TV3A 2HJ8A 2L3ZA 3MJWA 1TGZB 2DZMA 4MSMB 4JL9A 2Z59B 1LM8B 3MHSD 2KTFA 1LFDA 3R7RA 1GC7A 2REXA 2NBUA 2ZZPB 2LWPA 4NPNA 5IAAC 3KUZA 3L17A 4MM3A 1V80A 3PLUA 3MTNB 2Y5BB 3WALA 1E7UA 2KO3A 4JLCA 4WJPA 1UD7A 4B9KA 1YD8U 3QAQA 1S3SG 1Q5WB 1UELA 4HPLB 4WAAA 3WAOA 4EUTA 2NPTA 1YX6B 4NJ6A 2JY6A 5IA7A 3TL5A 4W9EA 4AJYB 1WIAA 2ZCCA 3KVFB 3QJZA 3A1QA 2DYOA 3L08A 4NNJB 2AWTA 1WGYA 3CF6E 4URKA 5CHVC 5AZHA 1V6EA 4JQWC 4GIVA 4NAWB 4LDTB 3ZDMC 3BY4B 3QC8B 3UIPB 1P0RA 4OVUA 2YLMA 1WX8A 3EFUA 2CHXA 1YIWA 2K8BA 2BGFA 2BKRB 4IWOA 4IG7B 2ZPYA 2FIFA 3RUIB 3GZNI 1R4NI 3KW5B 3AU4A 3QARA 3VH4B 4K7WA 1P3QU 4FJZA 2GBJA 1Z5SB 3DVNV 3KYCD 3PGEA 2N9XA 5CX3A 2XK5B 2O2VA 4LJPB 1VD2A 1WX9A 3M95A 4FN2A 1ZW7A 3ML8A 2G4SA 3O65B 3V6EB 2D10A 4RMAA 5J2RA 3Q3FA 5AEKB 2KDIA 3B0AA 3H1UA 4W9JA 1IYFA 3PRMB 3A4RA 2G45B 3L13A 5L83A 2KMCA 3JVZX 4JIOU 2KOXA 3H6NA 3WANA 2K39A 1J19A 4F7ZA 1V9JA 4ANVA 3RYTA 4TKNA 2KD0A 2BYFA 2KN5A 2DHZA 3T8MA 1BT0A 1PQSA 2L76A 2O6VA 4HXDA 3WIMA 3X23A 2I1KA 4DK5A 3PTFC 1WZ0A 1YQBA 3H9DA 3NS8A 5KHOA 1XQQA 3A9KA 4LCDE 4ZYNA 2CHWA 4II2B 3I3TB 1E90A 4AJWA 3PVLA 3N3KB 3ZVVA 2LJ5A 3OLMD 1UGMA 2YVCA 3SD5A 3V6CB 1WY8A 2CS4A 4BKGA 4FULA 2Z0DB 2CHZA 2FCNA 4K7UA 4KDLB 1J8CA 4IC7B 3V60A 1EF5A 3VHTC 2RSUA 4EKUA 1GJZA 1CMXB 3DBHI 1UBQA 5G2NA 5JH5C 1WR6E 2ZVOA 4B6WA 4EZKA 4DWFA 2RD0A 4ZRIA 4GDLA 1YJ1A 4JGHB 3NZUA 2N1WA 4K81A 2NBVB 2KVRA 2KK8A 4EEWA 2KWCA 2DAJA 3QK0A 2G4DB 1S1QB 4HLEA 1L2NA 5LLIA 2HTHA 2V3SA 4FLHA 1WR1A 5AZGA 2IY0B 2KZRA 1EUVB 3WA0A 4MJSB 1ZKHA 3U8ZA 1E7VA 4AWJA 4GU2A 3RD2A 4AP4C 2J0KA 1SIFA 1E8WA 2IY1B 2IO0B 2N7DA 4XC2A 3PREA 2C7NB 1GG3A 3B08A 2MWSB 3KH0A 3PHXB 2UWQA 4XX5A 5LXIB 4MGZE 2IO2B 2KNBA 4W9GA 2DX5B 3SDLC 3EHVA 3UIOB 3ZRFA 2O6VD 5DPRA 4HDOA 3QX1A 3DPDA 2ASQA 4EOYA 3EECA 3KUDB 3CMMB 2LGYA 3SHQA 4ANXA 4E3CA 1WFYA 4TUUA 3QCAA 4W9CA 4HPMB 2AEHA 3H7PB 3HHMA 1WJ4A 4DXAB 3U30A 4MH0E 2MBEA 2MP2B 3QA8A 1KJTA 3DBRI 4DHJD 3ONSA 4HCNB 4IWQA 4MSQB 3HM6X 1Q1OA 3R66C 3W1YA 2EMTA 3RULA 1WGDA 3ZKJC 2OJRA 4HWIB 3JSVB 1WI0A 4BBNF 2CR5A 4W9FA 2CU1A 1KLVA 4AOFA 2AYOB 4ZDVA 2JUOA 1VCBA 1YX5B 3BINA 2FUHB 2K1FA 2M0XA 3TIXA 5EDSA 2N9PC 5GMVA 2ZPNA 2UYZB 1E8YA 4NY0A 5C23A 1OEYA 4P7IA 3QQ8B 3JW0X 1LQBA 4KIKA 2LD9A 1EF1A 3Q3JA 5J18A 4PS3A 2IBIB 2L05A 4ASWC 4E74A 4RM9A 3PS6A 2MBHA 3A9JA 2K8HA 2LXAA 2Z0EB 2KXJA 2RR9A 2XEWA 2MCNB 4GMVA 2J0JA 3APDA 2L0FA 2FCQA 2V1YA 4LDTD 3QIJA 1OQYA 4IM2A 5DPSA 2NS5A 3DVGY 2KQ7A 4WQOB 2NR2A 3TBLD 3DBLI 2LVQA 2DZJA 2MX2A 3PHWB 3W1SA 4DHZB 4FJYA 4NJ7A 2MW5A 2DYMA 5HKHA 2D07B 5JHBA 4GDKA 2LGXA 3TJPA 2KTRB 2M17A 5G55A 4KSLC 3PRZA 4DHZE 1U4AA 2NBWB 4MJSA 3IFWB 4MELA 3DCGA 4W9IA 2B3AA 4G50A 1F9JA 2KWUB 3W1SC 2L00B 1FXTB 2ZJDA 1WRDB 5J17A 3R7QA 2IO1B 1UBIA 2KDBA 3VVWB 5D94A 4HK2A 5BO4B 1WM2A 2KJ6A 2ZNVC 4W9HA 1WJNA 4W9KA 3ZNID 2IO3B 2IZVB 3AULA 1P1AA 2KDFB 3ECIA 4I6NB 2PE6B 4B95A 2NCNA 3L16A 2KDEB 4WJNA 4EZJA 1E8ZA 1WMHA 4GGQA 4WJOA 5L95C 3R3MA 3L54A 5D7GA 5CHWA 1WGHA 3H7PA 5LXHA 2RPQA 3M62B 2GBKA 3TCAA 4WWPA 2NPTB 2DZKA 2IYDB 2FIDA 2QHOA 2EKEC 1GUAB 3APCA 3VTVA 2MBQA 2L8JA 3U7DA 3SU8X 5JHAA 3A1QB 4PS7A 2MRPA 2D3GA 3ZTDA 4BFRA 3DVGX 4BKTA 4DBGA 2M4NA 3JSVA 5DCNA 4KV2A 3L0WB 2CKHB 4N9F4 4W9LA 3A4SC 3DVNU 1KM7A 1RRBA 1RFAA 2VRRB 2MA9B 3OJ3A 1J0GA 3TMPB 1WXAA 2KANA 2KFJA 3UQBA 1TTNA 1V2YA 4FA6A 2O2VB 4EZLA 2JRIB 1TBEA 2KJRA 3K9PB 3X0WA 4ICVA 2DZIA 2FAZA 3ALBA 2M8SA 4NAWA 4BVUC 4RM8A 3CSFA 2WWZA 4A20A 3V61A 1WF9A 4A3OA 4PYZA 4MGIE 2BKFA 2DAFA 3JYUA 2KJHB 4G11A 2BF8B 1AARA 4IUMB 1I35A 1C1YB 2DENB 2LRUA 5C1ZA 3ZUNA 2PJHA 3IG3A 3DQVA 5TR5A 3AXCA 2O6VB 4FHJA 4PYUA 2XK5A 5CHFA 2WDTB 2FCMA 1KOTA 1WYWB 2OOBB 2JT4B 4IM0A 4OVVA 3A9KB 2MBBB 2C60A 2I1JA 4PS8A 1M94A 3DBSA 4EFOA 1IPGA 2G3QB 1NDDA 2KTRA 3NHEB 5DPWA 3RT3B 3IHPC 4G3XB 2LI5A 2J0MA 2MLBA 3CSTA 3ZW3A 2L0TA 1MG8A 2LVPA 1WE6A 2AL3A 1WH3A 1WXSA 1X1MA 3VUYA 1RAXA 4WWOA 4KDIC 2WYQA 3N32A 4FADA 1P98A 2ZCBA 1GC6A 2HD5B 2LGDA 1GNUA 3PRPB 5JZEB 1ISNA 4MEMA
chains in the Genus database with same CATH superfamily
3R2IA 4HJKA 2L32A 4KZ0A 1QOGA 2GBRA 3VTUA 2W9NA 2JZ3B 2D5GA 3T9LA 1OGWA 4S17A 3GOEA 1M4VA 2WXFA 4J6IA 5EE1A 1FRRA 2DBYA 4N59A 5EE3A 2I38A 1EO6A 3DHHC 2ZVNA 4HVBA 4DDGD 1KLUD 2J7QB 4LJOB 2DYBA 3ZQ4A 1YQ3B 1TYGB 4CHKA 1FNUA 2M19A 3NZSA 4TQ1A 3ZJUA 1NBFC 2KX0A 2WNMA 3NY5A 1T0RC 3HIZA 2AQ2B 4FJVB 2Q5WD 4ZYSA 2KLCA 3VFKA 3AEFB 1N5XA 2KMMA 1UH6A 4NQKE 4TSSA 1TKEA 2KLGA 2MP2A 4YXDB 2JXXA 4YL8A 3H7SA 3PLVA 1TKGA 1DGJA 3U2SC 4I6PA 4NQLB 3AV8A 3P42A 1OEYJ 1I4QA 1ZUD2 1FCLA 2L83A 1V86A 2NTTA 4MGKE 5E6NA 3K9OB 1OQQA 2JPHA 3ZNHB 1DOYA 3ENEA 2WXIA 3VH3B 4KVGB 2LRWA 1I42A 4B0EA 4ANWA 2GB1A 1E8XA 1WGGA 2C7MB 2TSSA 2D2QA 4HDQA 2KYWA 1G6JA 3LJ3A 2BQQA 3L10B 2PVGC 3RZFA 2KFKA 2PEAA 5D3DA 2QMTA 2M0AA 2LUMA 3NUHB 1XO3A 1H4RA 3UGBB 1WMHB 5D2MB 3ZTCA 2LJIA 2N0SB 1SE4A 2BYTA 4MSMB 2PIAA 4JL9A 2Z59B 1LM8B 2KTFA 2ZZPB 1FO4A 1E7UA 2KO3A 4XE0A 3PZ7A 3QAQA 3TL5A 3KVFB 2DYOA 4ZRQA 3SFEB 5CHVC 1IUEA 4JQWC 3Q8FA 3QC8B 2OHFA 3P1MA 1WX8A 2BGFA 4IWOA 3GZNI 1R4NI 3KW5B 3QARA 4K7WA 1K52A 2Y5CA 2O2VA 1VD2A 4HROA 2G4SA 1F2RI 3Q14C 2KDIA 1I7HA 2Y5PA 2Z8LA 3L13A 1ESFA 1YNTE 2KMCA 4JIOU 3WANA 4YSXB 1J19A 1PDXA 4RGNA 2KD0A 4HXDA 1F77A 3AE6B 3WIMA 3Q3NC 2I1KA 3AE5B 3PTFC 1L6UA 2RDHA 3Q69A 1XQQA 4ZYNA 2CHWA 4AJWA 1MVKA 3N3KB 2NTSA 5G5GA 2YVCA 4MT5A 2INNE 3AEDB 1GPXA 2CHZA 2FCNA 4K7UA 4KDLB 1J8CA 4IC7B 3V60A 1EF5A 2WXJA 1CMXB 3DBHI 3BVZA 2ZVOA 4EZKA 1YJ1A 2JSVX 2N1WA 2OJWA 1ENFA 2NBVB 2WDRB 2KVRA 3IAS1 4EEWA 3QK0A 3DHGC 3GS2A 5LLIA 2VZKB 2V3SA 1ZP0B 2WQYB 5AZGA 1B9RA 4C56C 1ET9A 3U8ZA 3RD2A 4AP4C 1RM6C 1SIFA 3KQ4A 2IY1B 4RFBA 4NJCA 2C7NB 1QQRA 2W3RA 2UWQA 1FMAD 1E10A 2KNBA 4ARCA 2DX5B 3ZRFA 3QX1A 2LMCA 3EECA 2LGYA 2SEBD 4TUUA 4HPMB 4DXAB 3U30A 1KJTA 3DBRI 4K3BA 3IT4B 1FXAA 3R66C 1I4HA 3RULA 3EA6A 2OJRA 4W9FA 1N60A 2CU1A 4C7YA 2AYOB 1T0SC 5EDSA 2K0PA 5GMVA 3AM9A 1OEYA 1STEA 3QQ8B 3JW0X 5G5HA 5E6JA 4PS3A 1I4XA 4OVZA 2K8HA 2Z0EB 1N5WA 3AB5A 2J0JA 2OEDA 3APDA 5DPSA 1N6ZA 4PT5A 2KQ7A 4S0RA 2LVQA 1XXGA 5FR3A 2EKIA 1YOVB 1MFWA 2WHIA 4LNOA 2N9KA 5G55A 4YTPB 4KSLC 4XWWA 1U4AA 3FILA 1F9JA 3AN1A 1FXTB 1C76A 2V3PA 3VRBB 1N61A 2IO1B 5D94A 4H2AA 2IO3B 1SJHD 1P1AA 3ECIA 1WXQA 2PE6B 2ZW0A 1WMHA 4GGQA 2SAKA 3R3MA 1MPEA 2GBKA 1TS2A 2DZKA 2FE8A 2KQ4X 3U7DA 3A1QB 1CJEA 2MRPA 2D3GA 4BFRA 3EGRA 1RWSA 4BKTA 2M4NA 3JSVA 5DCNA 1PGAA 3I9V1 1EWYC 3DVNU 1RRBA 1TJEA 2KANA 2KFJA 1E9MA 4FA6A 2VZKD 1TBEA 3AH7A 2FAZA 3NVZA 3Q8BA 3UI3A 4TMAB 3BK2A 1WF9A 2VH2A 1VDVA 3SR6A 1VZ7A 2BKFA 2DAFA 4G11A 4RCOA 2DENB 1IGDA 3FKYA 2PJHA 3DQVA 5TR5A 2O6VB 5CHFA 3VRAB 2OOBB 4A90A 2MBBB 2C60A 2H88B 3B9JA 1M94A 1T6BX 3DBSA 1SEBD 2WLBA 1QLBB 2KTRA 1SIJA 2QILA 2LI5A 2J0MA 2AL3A 1WH3A 1X1MA 3NZ3A 1GC6A 2KC1A 1SGHA 4P1BC 4GDLB 2N9LA 1EWCA 3VDZA 2C9WB 4C4VB 4HJGE 2CU3A 1OFFA 2JYTA 4CYEA 1L5PA 3UF8A 2NVUI 3VR9B 2GI9A 2KC2A 1QT9A 3PT2B 1V81A 4WWNA 2KFKB 1EM7A 1UZXB 5FKAC 2LXCA 3VAWA 2KQSA 2KVZA 1WX7A 4LK0M 4B0MA 4XZ4A 1JMLA 2LZ6A 2GBMA 2KMAA 2MSED 2AL6A 4AUQC 1Z2MA 4P16A 2FBWB 4DQOC 1L4DB 4MDKE 3OJ4B 4KKJA 4G0NB 2L7RA 4MGYE 2FNJB 2X8XX 5E6OA 2BW2A 3AMZA 2W82A 3KUCB 1V8CA 2RMMA 2LASA 3APFA 1V1PA 2BVCA 3NVVA 3V62A 3IVFA 2GMIC 1L7YA 3RPFC 1QZEA 3ZRCA 5HI1A 1TS5A 1VJKA 2W55A 4WJQA 5H8YE 3VUWA 2K25A 1R4MB 5IO9A 4ZRPA 3C0RB 4GOCA 3PSEB 2AX5A 1NI2A 1WXVA 3FC4A 3GE8C 1P9DU 2K6QA 2KX3A 3N30A 4W9DA 1JW9D 3S2AA 4F8CB 1FD6A 3RFZB 3W2DA 2AQ1B 3NOBA 5AZFA 1WGRA 2JWUA 2N9EB 4M0WB 4F1SA 1E7PB 3LDZE 3ZO5B 4RGTA 1Y56A 3NJTA 2WP9B 2WX0A 1EU4A 2ON8A 1I4RA 2ZNVB 4J3OD 3KYDD 3DWMA 1F0ZA 3HVZA 2BWES 4GSWA 1WZ3A 3AU5A 2YEPF 4A3PA 2V9HA 1KRHA 2JRHA 1UWMA 1D3ZA 1PGBA 1TZ1A 1XEEA 3KWLA 2MJEA 1DYQA 1V5TA 1JWBD 4TV3A 3MJ5A 1D5ZC 3AEAB 2DZMA 1HXYD 4RNAA 3MHSD 1E0ZA 1LFDA 5AUIA 2REXA 4NPNA 4ITKA 4YT0B 5T8IA 5AUKA 3W5UB 3PLUA 3MTNB 3WALA 3I57A 1UD7A 4B9KA 1Q5WB 1UELA 4HPLB 2KT7A 1WSPA 5IA7A 2ZCCA 4OZBA 3A1QA 3L08A 2AWTA 3LYYA 3CF6E 1ZOYB 3ZXRA 4LDTB 1P0RA 1JWMD 2BB6A 1YIWA 3BWUD 2BKRB 2ZPYA 2FIFA 3HVDA 1FFVA 1XLPA 1SF0A 1P3QU 4L1BA 3ETRA 2GBJA 1Z5SB 3DVNV 3KYCD 3B2FA 3PGEA 2N9XA 3M95A 4FN2A 3ZJTA 3NRZA 2D10A 3B0AA 2PVOD 3PRMB 2G45B 4WIPA 2KOXA 2K39A 1ROEA 4TKNA 4HPPA 4RH6A 2KN5A 2O6VA 3NS8A 5KHOA 1HQRD 4LCDE 2XN9C 4II2B 3I3TB 3P4QB 1B1ZA 2LJ5A 3OLMD 3HRDD 2DLBA 4PK1A 1UGMA 2L1AA 1D4BA 5IOIA 1UBQA 1WR6E 4B6WA 4DWFA 4GDLA 4JGHB 4M01A 3NZUA 5IP4D 1T3QA 3TUOA 2KK8A 2BBCA 4C4VA 2G4DB 1S1QB 4O1NA 1FFUA 3LB8C 3LXFA 1GAQB 3WA0A 3GE3C 4GU2A 3FILB 5IN7A 1K50A 4XC2A 2N7DA 2KWDA 2MWSB 3C8YA 3L4PA 3SDLC 3EHVA 1VR9A 4HDOA 3I5JC 3BZDB 1F52A 3SHQA 4ANXA 1L4ZB 3OWEB 2L52A 1WFYA 3QCAA 3GP7A 2MBEA 1MJDA 1TY2A 1KTKA 4IWQA 2WS3B 4K3CA 3ZXVA 1HZ6A 3ABVB 1WGDA 3JSVB 4BBNF 2FUG1 2EELA 1KLVA 3NS1A 4ZDVA 2JUOA 1YX5B 2N9PC 1ZDVA 4LNFA 2UYZB 4NY0A 3AECB 2LD9A 5J18A 2IBIB 2L05A 3E9SA 4E74A 4EE2A 2MBHA 5C2TB 2XEWA 4GMVA 1EU3A 2L0FA 4LDTD 4IM2A 1JWSD 4WQOB 2NR2A 2WXLA 1QILA 3W1SA 1RYJA 2E6XA 3AEGB 4LLGM 4NJ7A 3AE8B 4M0WA 2MW5A 2DYMA 5I4DA 2D07B 2V4IB 5JHBA 2LGXA 1ET6A 2KTRB 2IGGA 2HJ1A 4MJSA 3IFWB 4P6VF 4G50A 4RGOS 3W1SC 1WRDB 3MC9A 3AE1B 3R7QA 3DBLB 3VVWB 3Q8AA 4HK2A 1WM2A 4YTMB 1LO5D 2ZNVC 1WJNA 2JXTA 4W9KA 4B95A 4WJNA 4MM3B 1SE2A 4WJOA 1BXTA 3H7PA 4WWPA 2IYDB 2QHOA 1GUAB 3B2GA 4M02A 2WXPA 4PS7A 2I2YA 3ZTDA 4DBGA 3SFDB 3L0WB 4N9F4 4W9LA 3A4SC 1HZ5A 3RNGC 5BYRA 4BAXA 1J7AA 3TMPB 1WXAA 1OQRA 2CJNA 1TIFA 4EZLA 2JRIB 2KJRA 4ICVA 2DZIA 1GB4A 3MHZA 4RM8A 4P1CC 1JROA 4A3OA 1J7CA 2BF8B 1V1PB 4IUMB 1I35A 1XLQA 2J52A 3IG3A 2RDBC 1HTQA 3N1XC 4PYUA 1A70A 5HFYA 2JT4B 2I1JA 3T3NA 1UF0A 4IKGA 5DPWA 3IHPC 3CSTA 1WE6A 1WXSA 1RAXA 4WWOA 1R7SA 4KDIC 4OW0A 3PRPB 2LGDA 3RCZA 1QKZA 1ISNA 4R3DA 4MEMA 2PPHA 1OTRB 3V05A 3UQAA 2KKCA 2HTME 1K8RB 2JWZA 4DDID 2IDYA 3PPAA 2FCSA 2M1MA 1YJIA 3ZDTA 3ML9A 5D6JB 1JCKB 4IW0A 4I6LB 1V49A 2WXHA 4GXBA 2WXQA 4A55A 2LGIA 3Q2AC 2H89B 4JX1C 2KWVB 3O13A 4GB9A 3RN9C 4BKSA 2GBNA 2BYVE 1HE8A 2BWFA 1Q0WB 5HG2A 1JWUD 1C3TA 1UWXA 1H8CA 2K5PA 3P4PB 2LUEA 2GOWA 2QSDA 4OZAA 1QOAA 3TEXA 3N1YC 1WWTA 3VUXA 3RNBC 2ONQA 2D3BA 4Q2JA 1UNSA 4GN1A 1CZPA 3ZNZB 2V3NA 4ACFA 3IBEA 1ZGUB 2JYEA 3PZDA 3URYA 1TKYA 2MH7A 1SBBB 1CK1A 2V4LA 1T0YA 2MHJA 4REZA 1YN5A 4IOIE 1DOXA 1PFDA 3UINB 1ACCA 1T5XD 1LGRA 3M63B 1IP9A 4M8NA 1FM0D 5FR6A 2C5LC 1Y8RC 3EFCA 4FHKA 1LXDA 2EMSA 2K22A 2JF5A 5BMGA 2JZZA 4BBNC 2WDQB 3Q8EA 2MJDA 3VQIA 1A5RA 3P2BA 3KLSX 4ZHOA 4IWPA 1YN4A 2N1VA 5BYQA 1BUIC 1UUPA 1XT9B 1E5WA 2IGHA 3ZLZA 3KWVA 4ICUA 3AI5A 5KHQA 1WM3A 2INPE 3OAWA 3PV1A 4DHJB 1C4AA 3AEEB 4K7SA 1F1HA 1C79A 3Q3OC 2E3TA 3ZYYX 3QWZB 4KX6B 2HJ8A 1SJED 1HA5A 1QF6A 3MJWA 3R7RA 2NBUA 1AW7A 3KUZA 3I63C 4MM3A 1V80A 2Y5BB 3BYTB 4C00A 1YD8U 1S3SG 4HKZE 4EUTA 4WAAA 4XGAB 1C77A 2JY6A 4W9EA 1XCQL 1NVID 2RPVA 4NNJB 4GLSC 1WGYA 2IGDA 2QDFA 4OZCA 3U7ZA 1V6EA 1VZ6A 4NAWB 3ZDMC 3BY4B 3UIPB 1P7FA 2CHXA 3EFUA 4RGMA 3TEWA 1NYRA 1IGCA 1PUTA 2J4XA 2LHDA 4JWSC 4C80A 4FJZA 3WCQA 5CX3A 1ZW7A 3ML8A 3RMKC 4A6QA 2J42A 2NMQA 3V6EB 3TEZA 5J2RA 5AEKB 3H1UA 4W9JA 1IYFA 3A4RA 3NVWA 2V0GA 2M56B 3CIRB 3H6NA 3RYTA 3GZNB 1R4NB 1BT0A 1PQSA 2GLSA 2L76A 2GRIA 3N9YC 1HEZE 2J53A 4D2KA 4US8A 3H9DA 4WURA 2D3CA 5EE9A 2DNFA 4IDIA 1WY8A 2XNAC 3FAHA 2CS4A 4BKGA 4FULA 2Z0DB 4EKUA 1I4GA 4QAYA 2DWQA 5G2NA 5JH5C 2RD0A 4ZRIA 2MJ3A 3Q6BA 2KWCA 4WWMA 5TSSA 1DOIA 2DAJA 1TY0A 1D5MC 1YQ4B 1L2NA 2HTHA 3VR8B 4FLHA 2IY0B 2KZRA 4MJSB 1FCCC 4AWJA 3DBHB 1QOFA 1E8WA 2IO0B 3PREA 2VH1A 1ZXHA 1GG3A 2ZW1A 4YTNB 3PHXB 5LXIB 4L23A 5H92C 1P7EA 2O6VD 5DPRA 3DPDA 2ASQA 1L0VB 5BMHA 3CMMB 4E3CA 3N20C 2AEHA 4XDDA 3H7PB 1WJ4A 1FXIA 2INCC 4UDUC 1D5XC 4DHJD 4HCNB 4MSQB 3HM6X 3W1YA 2EMTA 5BYSA 1WYGA 3ZKJC 4HWIB 5GXGB 3NVYA 1VCBA 2ACZB 2FUHB 2M0XA 3BINA 1FRDA 4N6EB 3DBRB 2RDGA 1E8YA 5C23A 4P7IA 2W3SA 1C9FA 3IT6B 1XLOA 3GB1A 1EF1A 1KF6B 1N62A 2QIEB 4RM9A 2LXAA 2N7JA 2MCNB 4OHJA 3R8BA 1NENB 1KH0A 1MI0A 2V1YA 2CJOA 4JWUC 2MX2A 4AS1A 3HUIA 4DHZB 5C3JB 3BVMA 2D3AA 2LFIA 1UGJA 3TJPA 4XWTA 4DHZE 3PRZA 4LNIA 4N58A 3E56A 3EUB2 4MELA 2B3AA 1C78A 2KWUB 2L00B 3PZ8A 2WU2B 4MH8A 2KDBA 1YJJA 2KJ6A 1L6VA 2IZVB 5HHDG 4I6NB 2NCNA 3L16A 2KDEB 1NEKB 1E8ZA 5MPOA 4KGSA 1AWDA 1N63A 1WGHA 2WDVB 1QOBA 2NPTB 3W9CB 3C19A 1SE3A 3VTVA 2MBQA 4YWGG 2G9HD 2L8JA 3SU8X 3TSSA 3J9CA 3AE9B 2INDC 3P4RB 4KV2A 1NI3A 1KM7A 1RFAA 1K51A 3BIID 1TTNA 1V2YA 3SEBA 3K9PB 2QEJC 4CQNA 1L0XB 2LGSA 4NAWA 3ZJVA 2WXOA 4BVUC 2PW9A 4A20A 4PYZA 1E6EB 4A9AA 2KJHB 1C1YB 2LRUA 2AQ3B 1L0YB 4FHJA 2JU6X 3RNEC 1KOTA 1WYWB 4OVVA 4IM0A 2WXGA 3A9KB 3NG0A 2WXRA 1IPGA 1YMHE 2G3QB 3NHEB 3RT3B 2L0TA 1MG8A 3VUYA 4BZAA 2KACA 2QC8A 3N32A 2HD5B 1GNUA 5JZEB 1ZPSA 2C7HA 1ZXIA 5D3IB 2R2OA 4FBJB 3W5VB 4IM3A 1WXMA 3OG5A 2A4ZA 3EC8A 4NZLB 3CWIA 3DOWA 2LVOA 2BPSA 2HE7A 1FNVA 3VXWA 1F2RC 3RZWC 1WJ6A 3ZNGC 2JVCA 1IBXB 2ZEQA 3RNAC 4E71A 5DPTA 2K6DB 1FIQA 3MP9A 4M8MA 1AYFA 4WH4A 2WXMA 1J7BA 5E6PA 2BYEA 1JRUA 5BMIA 2UU7A 3WAPA 2N4FA 4CO7A 3B1LX 1TZOA 1WE7A 3AE7B 2KDMA 1XCTL 4KSKC 3HM3A 3RNCC 1WRIA 2A5UA 4BOZB 2BS2B 5CTRC 2R2QA 3AE4B 1R4MI 4II3B 2K8CA 1RLFA 4KZCA 3T3OA 3WAMA 1VRAB 2MQJA 4TQ0A 2PKOA 2D11A 4K1RB 4A8XC 3A33B 4ANUA 4KIKB 4BOSC 1MG4A 3P63A 3HK0A 1K53A 5FK9C 3A9JB 2PE9A 1WJUA 4X57B 3U4EG 4BKSD 2KHWB 4HCPB 1V5OA 4ZOHC 3D32A 4DXGA 4L2YA 1SE9A 1XD3B 2XBBC 4ZRKA 4ZRJA 2WU5B 4GDKB 1GB1A 2JX5A 1D6EC 3PO0A 3DDCB 3VTWA 2MBOA 1XF5L 3M3JA 1NYQA 4ZHPA 3R2TA 3ZIMA 4XYCA 2N7EA 1KFYB 2WX1A 1TT5B 3DWGC 2W54A 3TEYA 2RGFA 1T0QC 1VLBA 3N1ZC 3QHTA 4LTUA 2L3ZA 1TGZB 2BB5A 4LNNA 3RNFC 1GC7A 3IXSA 2LWPA 5IAAC 3L17A 2B76B 4JLCA 4WJPA 3WAOA 2NPTA 1YX6B 4NJ6A 1PYWD 4AJYB 1WIAA 3QJZA 3AEBB 2X38A 1XLNA 3ZGZA 4URKA 5AZHA 4GIVA 1SXTA 4OVUA 2YLMA 1MHHE 4JE3B 2QCZA 2K8BA 1FEHA 3RUIB 4IG7B 3AU4A 3VH4B 3Q3MC 2XK5B 4LJPB 1WX9A 1BMLC 3O65B 4RMAA 1VZ8A 1JQ4A 2LHEA 3Q3FA 3MC0B 1AN8A 5L83A 3JVZX 4WQMA 4F7ZA 1V9JA 2K9XA 4ANVA 2BYFA 2LEKA 2DHZA 3T8MA 3X23A 4WAFA 4DK5A 1WZ0A 1YQBA 2JZPA 2MEKA 3A9KA 4RF0A 1E90A 3PVLA 2BT6A 3ZVVA 2PLPA 3V3XA 3SD5A 4KGRA 3V6CB 4HKQA 2WXKA 3BK1A 3VHTC 2RSUA 1GJZA 4JPSA 2K3UA 3U52E 4K81A 4M00A 2G1EA 1SSNA 2R61A 1V1OA 4HLEA 1WR1A 1EUVB 1ZDXA 5JXVA 1ZKHA 1E7VA 1IBXA 2J0KA 5EE0A 1GOZA 3B08A 3KH0A 4XX5A 4MGZE 2IO2B 4W9GA 1V97A 2IJ0A 3UIOB 4ARIA 1CQVA 3BYYB 4EOYA 3KUDB 4W9CA 2KAJA 1HTOA 3HHMA 2IPKD 4MH0E 1FNWA 2MP2B 3QA8A 3H8HA 2WGSA 3ONSA 4RF1A 2BS4B 1Q1OA 4FXCA 1MHXA 1WI0A 2CR5A 3RI7C 1SB3C 5IKCM 4AOFA 1ZE3D 2K1FA 2BTEA 3TIXA 2WXNA 4DXFA 2ZPNA 3IAM1 2BS3B 3MFGA 1JALA 1LQBA 4KIKA 3Q3JA 4YSYB 4ASWC 1PGXA 3PS6A 3A9JA 2HDEA 4US9A 2KXJA 2RR9A 2Y3AA 2FCQA 4MACA 3QIJA 1OQYA 2NS5A 3DVGY 4USAA 4HEA1 3TBLD 3DBLI 2DZJA 2KN4A 3PHWB 4FJYA 5HKHA 4C7ZA 4KGTA 4GDKA 2M17A 2NBWB 4NAMA 1C4CA 3DCGA 4W9IA 1FPYA 1TS3A 2ZJDA 1JWAD 5J17A 1UBIA 5BO4B 4HRSA 4W9HA 3DHIC 2JQRB 3ZNID 3AULA 3MC8A 2KDFB 4EZJA 5L95C 4LNKA 3L54A 5D7GA 5LNK1 1Q10A 5CHWA 3AE2B 4KKIA 5LXHA 2RPQA 3M62B 3TCAA 1TS4A 2FIDA 2EKEC 3APCA 5JHAA 3DVGX 3P4SB 3Q8CA 2CKHB 1WGKA 1C4PA 1RFKA 2VRRB 2MA9B 3AE3B 3OJ3A 1J0GA 4AQ7A 3UQBA 3BVGA 2O2VB 3X0WA 2ICIA 2PTLA 3ALBA 2M8SA 3CSFA 2WWZA 3V61A 4MGIE 3JYUA 1AARA 1YN3A 5C1ZA 3ZUNA 3AXCA 2XK5A 2WDTB 2FCMA 1JRPA 4PS8A 1I4PA 4XDCA 1KLGD 4YSZB 4EFOA 1NDDA 2QJLA 4G3XB 2MLBA 3ZW3A 2YEPB 2LVPA 2PMVA 2WYQA 4FADA 1P98A 2ZCBA
chains in the Genus database with same CATH topology
2PPHA 1OTRB 4HJKA 3UQAA 2KKCA 2C7HA 2KC1A 4KZ0A 1K8RB 4FBJB 2JWZA 1SGHA 2R2OA 4DDID 3PPAA 4GDLB 1WXMA 4IM3A 2A4ZA 3EC8A 2GBRA 3DOWA 2FCSA 3VTUA 2M1MA 2W9NA 2LVOA 2BPSA 2JZ3B 2HE7A 3VDZA 3ZDTA 2C9WB 3ML9A 5D6JB 4IW0A 3T9LA 1OGWA 3VXWA 3RZWC 4I6LB 4CYEA 1V49A 1WJ6A 3GOEA 4GXBA 3ZNGC 3UF8A 2JVCA 2ZEQA 2NVUI 4J6IA 2KC2A 4E71A 5DPTA 3PT2B 2K6DB 1EO6A 1V81A 2KWVB 4WWNA 2ZVNA 4GB9A 4BKSA 4M8MA 2GBNA 2KFKB 4HVBA 4DDGD 2BYVE 2J7QB 4LJOB 1UZXB 1HE8A 2LXCA 5E6PA 2KQSA 2BYEA 1JRUA 2BWFA 2DYBA 3VAWA 1Q0WB 3WAPA 1WX7A 2N4FA 4XZ4A 2LZ6A 2GBMA 2KMAA 3B1LX 2MSED 4CO7A 2AL6A 4AUQC 4CHKA 1Z2MA 1C3TA 1H8CA 1WE7A 4MDKE 3NZSA 4TQ1A 3OJ4B 4G0NB 1NBFC 2KX0A 2L7RA 2LUEA 2FNJB 4MGYE 4KSKC 2GOWA 5E6OA 3NY5A 3HM3A 3HIZA 2A5UA 4BOZB 3KUCB 4FJVB 5CTRC 3VUXA 2R2QA 2LASA 1R4MI 3APFA 4II3B 2K8CA 1RLFA 2KLCA 4KZCA 3VFKA 4GN1A 3V62A 3WAMA 3ZNZB 3IVFA 3IBEA 1UH6A 2GMIC 4NQKE 1ZGUB 1L7YA 3PZDA 2MQJA 1QZEA 2KLGA 3ZRCA 2MP2A 4TQ0A 2JXXA 4YL8A 3H7SA 3PLVA 2D11A 4K1RB 2V4LA 1T0YA 3A33B 4WJQA 4ANUA 4I6PA 3VUWA 4NQLB 1OEYJ 2K25A 4KIKB 4BOSC 3HK0A 3UINB 3C0RB 4GOCA 1V86A 3PSEB 4MGKE 3A9JB 3M63B 1NI2A 1WXVA 5E6NA 3K9OB 1IP9A 2PE9A 1WJUA 4M8NA 1P9DU 4X57B 2K6QA 4BKSD 2KHWB 2JPHA 2KX3A 3N30A 4HCPB 4W9DA 3S2AA 5FR6A 3ZNHB 2C5LC 1Y8RC 4F8CB 3ENEA 3VH3B 1V5OA 3D32A 4FHKA 4KVGB 1SE9A 1LXDA 2LRWA 3NOBA 1XD3B 2EMSA 1WGRA 5AZFA 2N9EB 2JF5A 4M0WB 4F1SA 4ANWA 1I42A 2XBBC 4ZRKA 2JZZA 3LDZE 4ZRJA 3ZO5B 4GDKB 1E8XA 3VQIA 4BBNC 1WGGA 2C7MB 1A5RA 2WX0A 2D2QA 3P2BA 4HDQA 2ZNVB 3DDCB 3VTWA 3KYDD 2MBOA 4IWPA 1G6JA 2BWES 3M3JA 3LJ3A 2N1VA 4GSWA 3L10B 1WZ3A 3RZFA 3AU5A 1XT9B 4A3PA 2KFKA 1E5WA 3ZLZA 2PEAA 4ICUA 2JRHA 3ZIMA 3AI5A 2N7EA 5KHQA 1WM3A 3OAWA 1H4RA 2WX1A 3RCZA 3UGBB 1D3ZA 3PV1A 4DHJB 1TZ1A 4K7SA 1WMHB 5D2MB 3ZTCA 2RGFA 1V5TA 3QWZB 3QHTA 4TV3A 2HJ8A 2L3ZA 3MJWA 1TGZB 2DZMA 4MSMB 4JL9A 2Z59B 1LM8B 3MHSD 2KTFA 1LFDA 3R7RA 1GC7A 2REXA 2NBUA 2ZZPB 2LWPA 4NPNA 5IAAC 3KUZA 3L17A 4MM3A 1V80A 3PLUA 3MTNB 2Y5BB 3WALA 1E7UA 2KO3A 4JLCA 4WJPA 1UD7A 4B9KA 1YD8U 3QAQA 1S3SG 1Q5WB 1UELA 4HPLB 4WAAA 3WAOA 4EUTA 2NPTA 1YX6B 4NJ6A 2JY6A 5IA7A 3TL5A 4W9EA 4AJYB 1WIAA 2ZCCA 3KVFB 3QJZA 3A1QA 2DYOA 3L08A 4NNJB 2AWTA 1WGYA 3CF6E 4URKA 5CHVC 5AZHA 1V6EA 4JQWC 4GIVA 4NAWB 4LDTB 3ZDMC 3BY4B 3QC8B 3UIPB 1P0RA 4OVUA 2YLMA 1WX8A 3EFUA 2CHXA 1YIWA 2K8BA 2BGFA 2BKRB 4IWOA 4IG7B 2ZPYA 2FIFA 3RUIB 3GZNI 1R4NI 3KW5B 3AU4A 3QARA 3VH4B 4K7WA 1P3QU 4FJZA 2GBJA 1Z5SB 3DVNV 3KYCD 3PGEA 2N9XA 5CX3A 2XK5B 2O2VA 4LJPB 1VD2A 1WX9A 3M95A 4FN2A 1ZW7A 3ML8A 2G4SA 3O65B 3V6EB 2D10A 4RMAA 5J2RA 3Q3FA 5AEKB 2KDIA 3B0AA 3H1UA 4W9JA 1IYFA 3PRMB 3A4RA 2G45B 3L13A 5L83A 2KMCA 3JVZX 4JIOU 2KOXA 3H6NA 3WANA 2K39A 1J19A 4F7ZA 1V9JA 4ANVA 3RYTA 4TKNA 2KD0A 2BYFA 2KN5A 2DHZA 3T8MA 1BT0A 1PQSA 2L76A 2O6VA 4HXDA 3WIMA 3X23A 2I1KA 4DK5A 3PTFC 1WZ0A 1YQBA 3H9DA 3NS8A 5KHOA 1XQQA 3A9KA 4LCDE 4ZYNA 2CHWA 4II2B 3I3TB 1E90A 4AJWA 3PVLA 3N3KB 3ZVVA 2LJ5A 3OLMD 1UGMA 2YVCA 3SD5A 3V6CB 1WY8A 2CS4A 4BKGA 4FULA 2Z0DB 2CHZA 2FCNA 4K7UA 4KDLB 1J8CA 4IC7B 3V60A 1EF5A 3VHTC 2RSUA 4EKUA 1GJZA 1CMXB 3DBHI 1UBQA 5G2NA 5JH5C 1WR6E 2ZVOA 4B6WA 4EZKA 4DWFA 2RD0A 4ZRIA 4GDLA 1YJ1A 4JGHB 3NZUA 2N1WA 4K81A 2NBVB 2KVRA 2KK8A 4EEWA 2KWCA 2DAJA 3QK0A 2G4DB 1S1QB 4HLEA 1L2NA 5LLIA 2HTHA 2V3SA 4FLHA 1WR1A 5AZGA 2IY0B 2KZRA 1EUVB 3WA0A 4MJSB 1ZKHA 3U8ZA 1E7VA 4AWJA 4GU2A 3RD2A 4AP4C 2J0KA 1SIFA 1E8WA 2IY1B 2IO0B 2N7DA 4XC2A 3PREA 2C7NB 1GG3A 3B08A 2MWSB 3KH0A 3PHXB 2UWQA 4XX5A 5LXIB 4MGZE 2IO2B 2KNBA 4W9GA 2DX5B 3SDLC 3EHVA 3UIOB 3ZRFA 2O6VD 5DPRA 4HDOA 3QX1A 3DPDA 2ASQA 4EOYA 3EECA 3KUDB 3CMMB 2LGYA 3SHQA 4ANXA 4E3CA 1WFYA 4TUUA 3QCAA 4W9CA 4HPMB 2AEHA 3H7PB 3HHMA 1WJ4A 4DXAB 3U30A 4MH0E 2MBEA 2MP2B 3QA8A 1KJTA 3DBRI 4DHJD 3ONSA 4HCNB 4IWQA 4MSQB 3HM6X 1Q1OA 3R66C 3W1YA 2EMTA 3RULA 1WGDA 3ZKJC 2OJRA 4HWIB 3JSVB 1WI0A 4BBNF 2CR5A 4W9FA 2CU1A 1KLVA 4AOFA 2AYOB 4ZDVA 2JUOA 1VCBA 1YX5B 3BINA 2FUHB 2K1FA 2M0XA 3TIXA 5EDSA 2N9PC 5GMVA 2ZPNA 2UYZB 1E8YA 4NY0A 5C23A 1OEYA 4P7IA 3QQ8B 3JW0X 1LQBA 4KIKA 2LD9A 1EF1A 3Q3JA 5J18A 4PS3A 2IBIB 2L05A 4ASWC 4E74A 4RM9A 3PS6A 2MBHA 3A9JA 2K8HA 2LXAA 2Z0EB 2KXJA 2RR9A 2XEWA 2MCNB 4GMVA 2J0JA 3APDA 2L0FA 2FCQA 2V1YA 4LDTD 3QIJA 1OQYA 4IM2A 5DPSA 2NS5A 3DVGY 2KQ7A 4WQOB 2NR2A 3TBLD 3DBLI 2LVQA 2DZJA 2MX2A 3PHWB 3W1SA 4DHZB 4FJYA 4NJ7A 2MW5A 2DYMA 5HKHA 2D07B 5JHBA 4GDKA 2LGXA 3TJPA 2KTRB 2M17A 5G55A 4KSLC 3PRZA 4DHZE 1U4AA 2NBWB 4MJSA 3IFWB 4MELA 3DCGA 4W9IA 2B3AA 4G50A 1F9JA 2KWUB 3W1SC 2L00B 1FXTB 2ZJDA 1WRDB 5J17A 3R7QA 2IO1B 1UBIA 2KDBA 3VVWB 5D94A 4HK2A 5BO4B 1WM2A 2KJ6A 2ZNVC 4W9HA 1WJNA 4W9KA 3ZNID 2IO3B 2IZVB 3AULA 1P1AA 2KDFB 3ECIA 4I6NB 2PE6B 4B95A 2NCNA 3L16A 2KDEB 4WJNA 4EZJA 1E8ZA 1WMHA 4GGQA 4WJOA 5L95C 3R3MA 3L54A 5D7GA 5CHWA 1WGHA 3H7PA 5LXHA 2RPQA 3M62B 2GBKA 3TCAA 4WWPA 2NPTB 2DZKA 2IYDB 2FIDA 2QHOA 2EKEC 1GUAB 3APCA 3VTVA 2MBQA 2L8JA 3U7DA 3SU8X 5JHAA 3A1QB 4PS7A 2MRPA 2D3GA 3ZTDA 4BFRA 3DVGX 4BKTA 4DBGA 2M4NA 3JSVA 5DCNA 4KV2A 3L0WB 2CKHB 4N9F4 4W9LA 3A4SC 3DVNU 1KM7A 1RRBA 1RFAA 2VRRB 2MA9B 3OJ3A 1J0GA 3TMPB 1WXAA 2KANA 2KFJA 3UQBA 1TTNA 1V2YA 4FA6A 2O2VB 4EZLA 2JRIB 1TBEA 2KJRA 3K9PB 3X0WA 4ICVA 2DZIA 2FAZA 3ALBA 2M8SA 4NAWA 4BVUC 4RM8A 3CSFA 2WWZA 4A20A 3V61A 1WF9A 4A3OA 4PYZA 4MGIE 2BKFA 2DAFA 3JYUA 2KJHB 4G11A 2BF8B 1AARA 4IUMB 1I35A 1C1YB 2DENB 2LRUA 5C1ZA 3ZUNA 2PJHA 3IG3A 3DQVA 5TR5A 3AXCA 2O6VB 4FHJA 4PYUA 2XK5A 5CHFA 2WDTB 2FCMA 1KOTA 1WYWB 2OOBB 2JT4B 4IM0A 4OVVA 3A9KB 2MBBB 2C60A 2I1JA 4PS8A 1M94A 3DBSA 4EFOA 1IPGA 2G3QB 1NDDA 2KTRA 3NHEB 5DPWA 3RT3B 3IHPC 4G3XB 2LI5A 2J0MA 2MLBA 3CSTA 3ZW3A 2L0TA 1MG8A 2LVPA 1WE6A 2AL3A 1WH3A 1WXSA 1X1MA 3VUYA 1RAXA 4WWOA 4KDIC 2WYQA 3N32A 4FADA 1P98A 2ZCBA 1GC6A 2HD5B 2LGDA 1GNUA 3PRPB 5JZEB 1ISNA 4MEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPH A;  1OTR B;  4HJK A;  3UQA A;  2KKC A;  2C7H A;  2KC1 A;  4KZ0 A;  1K8R B;  4FBJ B;  2JWZ A;  1SGH A;  2R2O A;  4DDI D;  3PPA A;  4GDL B;  1WXM A;  4IM3 A;  2A4Z A;  3EC8 A;  2GBR A;  3DOW A;  2FCS A;  3VTU A;  2M1M A;  2W9N A;  2LVO A;  2BPS A;  2JZ3 B;  2HE7 A;  3VDZ A;  3ZDT A;  2C9W B;  3ML9 A;  5D6J B;  4IW0 A;  3T9L A;  1OGW A;  3VXW A;  3RZW C;  4I6L B;  4CYE A;  1V49 A;  1WJ6 A;  3GOE A;  4GXB A;  3ZNG C;  3UF8 A;  2JVC A;  2ZEQ A;  2NVU I;  4J6I A;  2KC2 A;  4E71 A;  5DPT A;  3PT2 B;  2K6D B;  1EO6 A;  1V81 A;  2KWV B;  4WWN A;  2ZVN A;  4GB9 A;  4BKS A;  4M8M A;  2GBN A;  2KFK B;  4HVB A;  4DDG D;  2BYV E;  2J7Q B;  4LJO B;  1UZX B;  1HE8 A;  2LXC A;  5E6P A;  2KQS A;  2BYE A;  1JRU A;  2BWF A;  2DYB A;  3VAW A;  1Q0W B;  3WAP A;  1WX7 A;  2N4F A;  4XZ4 A;  2LZ6 A;  2GBM A;  2KMA A;  3B1L X;  2MSE D;  4CO7 A;  2AL6 A;  4AUQ C;  4CHK A;  1Z2M A;  1C3T A;  1H8C A;  1WE7 A;  4MDK E;  3NZS A;  4TQ1 A;  3OJ4 B;  4G0N B;  1NBF C;  2KX0 A;  2L7R A;  2LUE A;  2FNJ B;  4MGY E;  4KSK C;  2GOW A;  5E6O A;  3NY5 A;  3HM3 A;  3HIZ A;  2A5U A;  4BOZ B;  3KUC B;  4FJV B;  5CTR C;  3VUX A;  2R2Q A;  2LAS A;  1R4M I;  3APF A;  4II3 B;  2K8C A;  1RLF A;  2KLC A;  4KZC A;  3VFK A;  4GN1 A;  3V62 A;  3WAM A;  3ZNZ B;  3IVF A;  3IBE A;  1UH6 A;  2GMI C;  4NQK E;  1ZGU B;  1L7Y A;  3PZD A;  2MQJ A;  1QZE A;  2KLG A;  3ZRC A;  2MP2 A;  4TQ0 A;  2JXX A;  4YL8 A;  3H7S A;  3PLV A;  2D11 A;  4K1R B;  2V4L A;  1T0Y A;  3A33 B;  4WJQ A;  4ANU A;  4I6P A;  3VUW A;  4NQL B;  1OEY J;  2K25 A;  4KIK B;  4BOS C;  3HK0 A;  3UIN B;  3C0R B;  4GOC A;  1V86 A;  3PSE B;  4MGK E;  3A9J B;  3M63 B;  1NI2 A;  1WXV A;  5E6N A;  3K9O B;  1IP9 A;  2PE9 A;  1WJU A;  4M8N A;  1P9D U;  4X57 B;  2K6Q A;  4BKS D;  2KHW B;  2JPH A;  2KX3 A;  3N30 A;  4HCP B;  4W9D A;  3S2A A;  5FR6 A;  3ZNH B;  2C5L C;  1Y8R C;  4F8C B;  3ENE A;  3VH3 B;  1V5O A;  3D32 A;  4FHK A;  4KVG B;  1SE9 A;  1LXD A;  2LRW A;  3NOB A;  1XD3 B;  2EMS A;  1WGR A;  5AZF A;  2N9E B;  2JF5 A;  4M0W B;  4F1S A;  4ANW A;  1I42 A;  2XBB C;  4ZRK A;  2JZZ A;  3LDZ E;  4ZRJ A;  3ZO5 B;  4GDK B;  1E8X A;  3VQI A;  4BBN C;  1WGG A;  2C7M B;  1A5R A;  2WX0 A;  2D2Q A;  3P2B A;  4HDQ A;  2ZNV B;  3DDC B;  3VTW A;  3KYD D;  2MBO A;  4IWP A;  1G6J A;  2BWE S;  3M3J A;  3LJ3 A;  2N1V A;  4GSW A;  3L10 B;  1WZ3 A;  3RZF A;  3AU5 A;  1XT9 B;  4A3P A;  2KFK A;  1E5W A;  3ZLZ A;  2PEA A;  4ICU A;  2JRH A;  3ZIM A;  3AI5 A;  2N7E A;  5KHQ A;  1WM3 A;  3OAW A;  1H4R A;  2WX1 A;  3RCZ A;  3UGB B;  1D3Z A;  3PV1 A;  4DHJ B;  1TZ1 A;  4K7S A;  1WMH B;  5D2M B;  3ZTC A;  2RGF A;  1V5T A;  3QWZ B;  3QHT A;  4TV3 A;  2HJ8 A;  2L3Z A;  3MJW A;  1TGZ B;  2DZM A;  4MSM B;  4JL9 A;  2Z59 B;  1LM8 B;  3MHS D;  2KTF A;  1LFD A;  3R7R A;  1GC7 A;  2REX A;  2NBU A;  2ZZP B;  2LWP A;  4NPN A;  5IAA C;  3KUZ A;  3L17 A;  4MM3 A;  1V80 A;  3PLU A;  3MTN B;  2Y5B B;  3WAL A;  1E7U A;  2KO3 A;  4JLC A;  4WJP A;  1UD7 A;  4B9K A;  1YD8 U;  3QAQ A;  1S3S G;  1Q5W B;  1UEL A;  4HPL B;  4WAA A;  3WAO A;  4EUT A;  2NPT A;  1YX6 B;  4NJ6 A;  2JY6 A;  5IA7 A;  3TL5 A;  4W9E A;  4AJY B;  1WIA A;  2ZCC A;  3KVF B;  3QJZ A;  3A1Q A;  2DYO A;  3L08 A;  4NNJ B;  2AWT A;  1WGY A;  3CF6 E;  4URK A;  5CHV C;  5AZH A;  1V6E A;  4JQW C;  4GIV A;  4NAW B;  4LDT B;  3ZDM C;  3BY4 B;  3QC8 B;  3UIP B;  1P0R A;  4OVU A;  2YLM A;  1WX8 A;  3EFU A;  2CHX A;  1YIW A;  2K8B A;  2BGF A;  2BKR B;  4IWO A;  4IG7 B;  2ZPY A;  2FIF A;  3RUI B;  3GZN I;  1R4N I;  3KW5 B;  3AU4 A;  3QAR A;  3VH4 B;  4K7W A;  1P3Q U;  4FJZ A;  2GBJ A;  1Z5S B;  3DVN V;  3KYC D;  3PGE A;  2N9X A;  5CX3 A;  2XK5 B;  2O2V A;  4LJP B;  1VD2 A;  1WX9 A;  3M95 A;  4FN2 A;  1ZW7 A;  3ML8 A;  2G4S A;  3O65 B;  3V6E B;  2D10 A;  4RMA A;  5J2R A;  3Q3F A;  5AEK B;  2KDI A;  3B0A A;  3H1U A;  4W9J A;  1IYF A;  3PRM B;  3A4R A;  2G45 B;  3L13 A;  5L83 A;  2KMC A;  3JVZ X;  4JIO U;  2KOX A;  3H6N A;  3WAN A;  2K39 A;  1J19 A;  4F7Z A;  1V9J A;  4ANV A;  3RYT A;  4TKN A;  2KD0 A;  2BYF A;  2KN5 A;  2DHZ A;  3T8M A;  1BT0 A;  1PQS A;  2L76 A;  2O6V A;  4HXD A;  3WIM A;  3X23 A;  2I1K A;  4DK5 A;  3PTF C;  1WZ0 A;  1YQB A;  3H9D A;  3NS8 A;  5KHO A;  1XQQ A;  3A9K A;  4LCD E;  4ZYN A;  2CHW A;  4II2 B;  3I3T B;  1E90 A;  4AJW A;  3PVL A;  3N3K B;  3ZVV A;  2LJ5 A;  3OLM D;  1UGM A;  2YVC A;  3SD5 A;  3V6C B;  1WY8 A;  2CS4 A;  4BKG A;  4FUL A;  2Z0D B;  2CHZ A;  2FCN A;  4K7U A;  4KDL B;  1J8C A;  4IC7 B;  3V60 A;  1EF5 A;  3VHT C;  2RSU A;  4EKU A;  1GJZ A;  1CMX B;  3DBH I;  1UBQ A;  5G2N A;  5JH5 C;  1WR6 E;  2ZVO A;  4B6W A;  4EZK A;  4DWF A;  2RD0 A;  4ZRI A;  4GDL A;  1YJ1 A;  4JGH B;  3NZU A;  2N1W A;  4K81 A;  2NBV B;  2KVR A;  2KK8 A;  4EEW A;  2KWC A;  2DAJ A;  3QK0 A;  2G4D B;  1S1Q B;  4HLE A;  1L2N A;  5LLI A;  2HTH A;  2V3S A;  4FLH A;  1WR1 A;  5AZG A;  2IY0 B;  2KZR A;  1EUV B;  3WA0 A;  4MJS B;  1ZKH A;  3U8Z A;  1E7V A;  4AWJ A;  4GU2 A;  3RD2 A;  4AP4 C;  2J0K A;  1SIF A;  1E8W A;  2IY1 B;  2IO0 B;  2N7D A;  4XC2 A;  3PRE A;  2C7N B;  1GG3 A;  3B08 A;  2MWS B;  3KH0 A;  3PHX B;  2UWQ A;  4XX5 A;  5LXI B;  4MGZ E;  2IO2 B;  2KNB A;  4W9G A;  2DX5 B;  3SDL C;  3EHV A;  3UIO B;  3ZRF A;  2O6V D;  5DPR A;  4HDO A;  3QX1 A;  3DPD A;  2ASQ A;  4EOY A;  3EEC A;  3KUD B;  3CMM B;  2LGY A;  3SHQ A;  4ANX A;  4E3C A;  1WFY A;  4TUU A;  3QCA A;  4W9C A;  4HPM B;  2AEH A;  3H7P B;  3HHM A;  1WJ4 A;  4DXA B;  3U30 A;  4MH0 E;  2MBE A;  2MP2 B;  3QA8 A;  1KJT A;  3DBR I;  4DHJ D;  3ONS A;  4HCN B;  4IWQ A;  4MSQ B;  3HM6 X;  1Q1O A;  3R66 C;  3W1Y A;  2EMT A;  3RUL A;  1WGD A;  3ZKJ C;  2OJR A;  4HWI B;  3JSV B;  1WI0 A;  4BBN F;  2CR5 A;  4W9F A;  2CU1 A;  1KLV A;  4AOF A;  2AYO B;  4ZDV A;  2JUO A;  1VCB A;  1YX5 B;  3BIN A;  2FUH B;  2K1F A;  2M0X A;  3TIX A;  5EDS A;  2N9P C;  5GMV A;  2ZPN A;  2UYZ B;  1E8Y A;  4NY0 A;  5C23 A;  1OEY A;  4P7I A;  3QQ8 B;  3JW0 X;  1LQB A;  4KIK A;  2LD9 A;  1EF1 A;  3Q3J A;  5J18 A;  4PS3 A;  2IBI B;  2L05 A;  4ASW C;  4E74 A;  4RM9 A;  3PS6 A;  2MBH A;  3A9J A;  2K8H A;  2LXA A;  2Z0E B;  2KXJ A;  2RR9 A;  2XEW A;  2MCN B;  4GMV A;  2J0J A;  3APD A;  2L0F A;  2FCQ A;  2V1Y A;  4LDT D;  3QIJ A;  1OQY A;  4IM2 A;  5DPS A;  2NS5 A;  3DVG Y;  2KQ7 A;  4WQO B;  2NR2 A;  3TBL D;  3DBL I;  2LVQ A;  2DZJ A;  2MX2 A;  3PHW B;  3W1S A;  4DHZ B;  4FJY A;  4NJ7 A;  2MW5 A;  2DYM A;  5HKH A;  2D07 B;  5JHB A;  4GDK A;  2LGX A;  3TJP A;  2KTR B;  2M17 A;  5G55 A;  4KSL C;  3PRZ A;  4DHZ E;  1U4A A;  2NBW B;  4MJS A;  3IFW B;  4MEL A;  3DCG A;  4W9I A;  2B3A A;  4G50 A;  1F9J A;  2KWU B;  3W1S C;  2L00 B;  1FXT B;  2ZJD A;  1WRD B;  5J17 A;  3R7Q A;  2IO1 B;  1UBI A;  2KDB A;  3VVW B;  5D94 A;  4HK2 A;  5BO4 B;  1WM2 A;  2KJ6 A;  2ZNV C;  4W9H A;  1WJN A;  4W9K A;  3ZNI D;  2IO3 B;  2IZV B;  3AUL A;  1P1A A;  2KDF B;  3ECI A;  4I6N B;  2PE6 B;  4B95 A;  2NCN A;  3L16 A;  2KDE B;  4WJN A;  4EZJ A;  1E8Z A;  1WMH A;  4GGQ A;  4WJO A;  5L95 C;  3R3M A;  3L54 A;  5D7G A;  5CHW A;  1WGH A;  3H7P A;  5LXH A;  2RPQ A;  3M62 B;  2GBK A;  3TCA A;  4WWP A;  2NPT B;  2DZK A;  2IYD B;  2FID A;  2QHO A;  2EKE C;  1GUA B;  3APC A;  3VTV A;  2MBQ A;  2L8J A;  3U7D A;  3SU8 X;  5JHA A;  3A1Q B;  4PS7 A;  2MRP A;  2D3G A;  3ZTD A;  4BFR A;  3DVG X;  4BKT A;  4DBG A;  2M4N A;  3JSV A;  5DCN A;  4KV2 A;  3L0W B;  2CKH B;  4N9F 4;  4W9L A;  3A4S C;  3DVN U;  1KM7 A;  1RRB A;  1RFA A;  2VRR B;  2MA9 B;  3OJ3 A;  1J0G A;  3TMP B;  1WXA A;  2KAN A;  2KFJ A;  3UQB A;  1TTN A;  1V2Y A;  4FA6 A;  2O2V B;  4EZL A;  2JRI B;  1TBE A;  2KJR A;  3K9P B;  3X0W A;  4ICV A;  2DZI A;  2FAZ A;  3ALB A;  2M8S A;  4NAW A;  4BVU C;  4RM8 A;  3CSF A;  2WWZ A;  4A20 A;  3V61 A;  1WF9 A;  4A3O A;  4PYZ A;  4MGI E;  2BKF A;  2DAF A;  3JYU A;  2KJH B;  4G11 A;  2BF8 B;  1AAR A;  4IUM B;  1I35 A;  1C1Y B;  2DEN B;  2LRU A;  5C1Z A;  3ZUN A;  2PJH A;  3IG3 A;  3DQV A;  5TR5 A;  3AXC A;  2O6V B;  4FHJ A;  4PYU A;  2XK5 A;  5CHF A;  2WDT B;  2FCM A;  1KOT A;  1WYW B;  2OOB B;  2JT4 B;  4IM0 A;  4OVV A;  3A9K B;  2MBB B;  2C60 A;  2I1J A;  4PS8 A;  1M94 A;  3DBS A;  4EFO A;  1IPG A;  2G3Q B;  1NDD A;  2KTR A;  3NHE B;  5DPW A;  3RT3 B;  3IHP C;  4G3X B;  2LI5 A;  2J0M A;  2MLB A;  3CST A;  3ZW3 A;  2L0T A;  1MG8 A;  2LVP A;  1WE6 A;  2AL3 A;  1WH3 A;  1WXS A;  1X1M A;  3VUY A;  1RAX A;  4WWO A;  4KDI C;  2WYQ A;  3N32 A;  4FAD A;  1P98 A;  2ZCB A;  1GC6 A;  2HD5 B;  2LGD A;  1GNU A;  3PRP B;  5JZE B;  1ISN A;  4MEM A; 
#chains in the Genus database with same CATH topology
 3R2I A;  4HJK A;  2L32 A;  4KZ0 A;  1QOG A;  2GBR A;  3VTU A;  2W9N A;  2JZ3 B;  2D5G A;  3T9L A;  1OGW A;  4S17 A;  3GOE A;  1M4V A;  2WXF A;  4J6I A;  5EE1 A;  1FRR A;  2DBY A;  4N59 A;  5EE3 A;  2I38 A;  1EO6 A;  3DHH C;  2ZVN A;  4HVB A;  4DDG D;  1KLU D;  2J7Q B;  4LJO B;  2DYB A;  3ZQ4 A;  1YQ3 B;  1TYG B;  4CHK A;  1FNU A;  2M19 A;  3NZS A;  4TQ1 A;  3ZJU A;  1NBF C;  2KX0 A;  2WNM A;  3NY5 A;  1T0R C;  3HIZ A;  2AQ2 B;  4FJV B;  2Q5W D;  4ZYS A;  2KLC A;  3VFK A;  3AEF B;  1N5X A;  2KMM A;  1UH6 A;  4NQK E;  4TSS A;  1TKE A;  2KLG A;  2MP2 A;  4YXD B;  2JXX A;  4YL8 A;  3H7S A;  3PLV A;  1TKG A;  1DGJ A;  3U2S C;  4I6P A;  4NQL B;  3AV8 A;  3P42 A;  1OEY J;  1I4Q A;  1ZUD 2;  1FCL A;  2L83 A;  1V86 A;  2NTT A;  4MGK E;  5E6N A;  3K9O B;  1OQQ A;  2JPH A;  3ZNH B;  1DOY A;  3ENE A;  2WXI A;  3VH3 B;  4KVG B;  2LRW A;  1I42 A;  4B0E A;  4ANW A;  2GB1 A;  1E8X A;  1WGG A;  2C7M B;  2TSS A;  2D2Q A;  4HDQ A;  2KYW A;  1G6J A;  3LJ3 A;  2BQQ A;  3L10 B;  2PVG C;  3RZF A;  2KFK A;  2PEA A;  5D3D A;  2QMT A;  2M0A A;  2LUM A;  3NUH B;  1XO3 A;  1H4R A;  3UGB B;  1WMH B;  5D2M B;  3ZTC A;  2LJI A;  2N0S B;  1SE4 A;  2BYT A;  4MSM B;  2PIA A;  4JL9 A;  2Z59 B;  1LM8 B;  2KTF A;  2ZZP B;  1FO4 A;  1E7U A;  2KO3 A;  4XE0 A;  3PZ7 A;  3QAQ A;  3TL5 A;  3KVF B;  2DYO A;  4ZRQ A;  3SFE B;  5CHV C;  1IUE A;  4JQW C;  3Q8F A;  3QC8 B;  2OHF A;  3P1M A;  1WX8 A;  2BGF A;  4IWO A;  3GZN I;  1R4N I;  3KW5 B;  3QAR A;  4K7W A;  1K52 A;  2Y5C A;  2O2V A;  1VD2 A;  4HRO A;  2G4S A;  1F2R I;  3Q14 C;  2KDI A;  1I7H A;  2Y5P A;  2Z8L A;  3L13 A;  1ESF A;  1YNT E;  2KMC A;  4JIO U;  3WAN A;  4YSX B;  1J19 A;  1PDX A;  4RGN A;  2KD0 A;  4HXD A;  1F77 A;  3AE6 B;  3WIM A;  3Q3N C;  2I1K A;  3AE5 B;  3PTF C;  1L6U A;  2RDH A;  3Q69 A;  1XQQ A;  4ZYN A;  2CHW A;  4AJW A;  1MVK A;  3N3K B;  2NTS A;  5G5G A;  2YVC A;  4MT5 A;  2INN E;  3AED B;  1GPX A;  2CHZ A;  2FCN A;  4K7U A;  4KDL B;  1J8C A;  4IC7 B;  3V60 A;  1EF5 A;  2WXJ A;  1CMX B;  3DBH I;  3BVZ A;  2ZVO A;  4EZK A;  1YJ1 A;  2JSV X;  2N1W A;  2OJW A;  1ENF A;  2NBV B;  2WDR B;  2KVR A;  3IAS 1;  4EEW A;  3QK0 A;  3DHG C;  3GS2 A;  5LLI A;  2VZK B;  2V3S A;  1ZP0 B;  2WQY B;  5AZG A;  1B9R A;  4C56 C;  1ET9 A;  3U8Z A;  3RD2 A;  4AP4 C;  1RM6 C;  1SIF A;  3KQ4 A;  2IY1 B;  4RFB A;  4NJC A;  2C7N B;  1QQR A;  2W3R A;  2UWQ A;  1FMA D;  1E10 A;  2KNB A;  4ARC A;  2DX5 B;  3ZRF A;  3QX1 A;  2LMC A;  3EEC A;  2LGY A;  2SEB D;  4TUU A;  4HPM B;  4DXA B;  3U30 A;  1KJT A;  3DBR I;  4K3B A;  3IT4 B;  1FXA A;  3R66 C;  1I4H A;  3RUL A;  3EA6 A;  2OJR A;  4W9F A;  1N60 A;  2CU1 A;  4C7Y A;  2AYO B;  1T0S C;  5EDS A;  2K0P A;  5GMV A;  3AM9 A;  1OEY A;  1STE A;  3QQ8 B;  3JW0 X;  5G5H A;  5E6J A;  4PS3 A;  1I4X A;  4OVZ A;  2K8H A;  2Z0E B;  1N5W A;  3AB5 A;  2J0J A;  2OED A;  3APD A;  5DPS A;  1N6Z A;  4PT5 A;  2KQ7 A;  4S0R A;  2LVQ A;  1XXG A;  5FR3 A;  2EKI A;  1YOV B;  1MFW A;  2WHI A;  4LNO A;  2N9K A;  5G55 A;  4YTP B;  4KSL C;  4XWW A;  1U4A A;  3FIL A;  1F9J A;  3AN1 A;  1FXT B;  1C76 A;  2V3P A;  3VRB B;  1N61 A;  2IO1 B;  5D94 A;  4H2A A;  2IO3 B;  1SJH D;  1P1A A;  3ECI A;  1WXQ A;  2PE6 B;  2ZW0 A;  1WMH A;  4GGQ A;  2SAK A;  3R3M A;  1MPE A;  2GBK A;  1TS2 A;  2DZK A;  2FE8 A;  2KQ4 X;  3U7D A;  3A1Q B;  1CJE A;  2MRP A;  2D3G A;  4BFR A;  3EGR A;  1RWS A;  4BKT A;  2M4N A;  3JSV A;  5DCN A;  1PGA A;  3I9V 1;  1EWY C;  3DVN U;  1RRB A;  1TJE A;  2KAN A;  2KFJ A;  1E9M A;  4FA6 A;  2VZK D;  1TBE A;  3AH7 A;  2FAZ A;  3NVZ A;  3Q8B A;  3UI3 A;  4TMA B;  3BK2 A;  1WF9 A;  2VH2 A;  1VDV A;  3SR6 A;  1VZ7 A;  2BKF A;  2DAF A;  4G11 A;  4RCO A;  2DEN B;  1IGD A;  3FKY A;  2PJH A;  3DQV A;  5TR5 A;  2O6V B;  5CHF A;  3VRA B;  2OOB B;  4A90 A;  2MBB B;  2C60 A;  2H88 B;  3B9J A;  1M94 A;  1T6B X;  3DBS A;  1SEB D;  2WLB A;  1QLB B;  2KTR A;  1SIJ A;  2QIL A;  2LI5 A;  2J0M A;  2AL3 A;  1WH3 A;  1X1M A;  3NZ3 A;  1GC6 A;  2KC1 A;  1SGH A;  4P1B C;  4GDL B;  2N9L A;  1EWC A;  3VDZ A;  2C9W B;  4C4V B;  4HJG E;  2CU3 A;  1OFF A;  2JYT A;  4CYE A;  1L5P A;  3UF8 A;  2NVU I;  3VR9 B;  2GI9 A;  2KC2 A;  1QT9 A;  3PT2 B;  1V81 A;  4WWN A;  2KFK B;  1EM7 A;  1UZX B;  5FKA C;  2LXC A;  3VAW A;  2KQS A;  2KVZ A;  1WX7 A;  4LK0 M;  4B0M A;  4XZ4 A;  1JML A;  2LZ6 A;  2GBM A;  2KMA A;  2MSE D;  2AL6 A;  4AUQ C;  1Z2M A;  4P16 A;  2FBW B;  4DQO C;  1L4D B;  4MDK E;  3OJ4 B;  4KKJ A;  4G0N B;  2L7R A;  4MGY E;  2FNJ B;  2X8X X;  5E6O A;  2BW2 A;  3AMZ A;  2W82 A;  3KUC B;  1V8C A;  2RMM A;  2LAS A;  3APF A;  1V1P A;  2BVC A;  3NVV A;  3V62 A;  3IVF A;  2GMI C;  1L7Y A;  3RPF C;  1QZE A;  3ZRC A;  5HI1 A;  1TS5 A;  1VJK A;  2W55 A;  4WJQ A;  5H8Y E;  3VUW A;  2K25 A;  1R4M B;  5IO9 A;  4ZRP A;  3C0R B;  4GOC A;  3PSE B;  2AX5 A;  1NI2 A;  1WXV A;  3FC4 A;  3GE8 C;  1P9D U;  2K6Q A;  2KX3 A;  3N30 A;  4W9D A;  1JW9 D;  3S2A A;  4F8C B;  1FD6 A;  3RFZ B;  3W2D A;  2AQ1 B;  3NOB A;  5AZF A;  1WGR A;  2JWU A;  2N9E B;  4M0W B;  4F1S A;  1E7P B;  3LDZ E;  3ZO5 B;  4RGT A;  1Y56 A;  3NJT A;  2WP9 B;  2WX0 A;  1EU4 A;  2ON8 A;  1I4R A;  2ZNV B;  4J3O D;  3KYD D;  3DWM A;  1F0Z A;  3HVZ A;  2BWE S;  4GSW A;  1WZ3 A;  3AU5 A;  2YEP F;  4A3P A;  2V9H A;  1KRH A;  2JRH A;  1UWM A;  1D3Z A;  1PGB A;  1TZ1 A;  1XEE A;  3KWL A;  2MJE A;  1DYQ A;  1V5T A;  1JWB D;  4TV3 A;  3MJ5 A;  1D5Z C;  3AEA B;  2DZM A;  1HXY D;  4RNA A;  3MHS D;  1E0Z A;  1LFD A;  5AUI A;  2REX A;  4NPN A;  4ITK A;  4YT0 B;  5T8I A;  5AUK A;  3W5U B;  3PLU A;  3MTN B;  3WAL A;  3I57 A;  1UD7 A;  4B9K A;  1Q5W B;  1UEL A;  4HPL B;  2KT7 A;  1WSP A;  5IA7 A;  2ZCC A;  4OZB A;  3A1Q A;  3L08 A;  2AWT A;  3LYY A;  3CF6 E;  1ZOY B;  3ZXR A;  4LDT B;  1P0R A;  1JWM D;  2BB6 A;  1YIW A;  3BWU D;  2BKR B;  2ZPY A;  2FIF A;  3HVD A;  1FFV A;  1XLP A;  1SF0 A;  1P3Q U;  4L1B A;  3ETR A;  2GBJ A;  1Z5S B;  3DVN V;  3KYC D;  3B2F A;  3PGE A;  2N9X A;  3M95 A;  4FN2 A;  3ZJT A;  3NRZ A;  2D10 A;  3B0A A;  2PVO D;  3PRM B;  2G45 B;  4WIP A;  2KOX A;  2K39 A;  1ROE A;  4TKN A;  4HPP A;  4RH6 A;  2KN5 A;  2O6V A;  3NS8 A;  5KHO A;  1HQR D;  4LCD E;  2XN9 C;  4II2 B;  3I3T B;  3P4Q B;  1B1Z A;  2LJ5 A;  3OLM D;  3HRD D;  2DLB A;  4PK1 A;  1UGM A;  2L1A A;  1D4B A;  5IOI A;  1UBQ A;  1WR6 E;  4B6W A;  4DWF A;  4GDL A;  4JGH B;  4M01 A;  3NZU A;  5IP4 D;  1T3Q A;  3TUO A;  2KK8 A;  2BBC A;  4C4V A;  2G4D B;  1S1Q B;  4O1N A;  1FFU A;  3LB8 C;  3LXF A;  1GAQ B;  3WA0 A;  3GE3 C;  4GU2 A;  3FIL B;  5IN7 A;  1K50 A;  4XC2 A;  2N7D A;  2KWD A;  2MWS B;  3C8Y A;  3L4P A;  3SDL C;  3EHV A;  1VR9 A;  4HDO A;  3I5J C;  3BZD B;  1F52 A;  3SHQ A;  4ANX A;  1L4Z B;  3OWE B;  2L52 A;  1WFY A;  3QCA A;  3GP7 A;  2MBE A;  1MJD A;  1TY2 A;  1KTK A;  4IWQ A;  2WS3 B;  4K3C A;  3ZXV A;  1HZ6 A;  3ABV B;  1WGD A;  3JSV B;  4BBN F;  2FUG 1;  2EEL A;  1KLV A;  3NS1 A;  4ZDV A;  2JUO A;  1YX5 B;  2N9P C;  1ZDV A;  4LNF A;  2UYZ B;  4NY0 A;  3AEC B;  2LD9 A;  5J18 A;  2IBI B;  2L05 A;  3E9S A;  4E74 A;  4EE2 A;  2MBH A;  5C2T B;  2XEW A;  4GMV A;  1EU3 A;  2L0F A;  4LDT D;  4IM2 A;  1JWS D;  4WQO B;  2NR2 A;  2WXL A;  1QIL A;  3W1S A;  1RYJ A;  2E6X A;  3AEG B;  4LLG M;  4NJ7 A;  3AE8 B;  4M0W A;  2MW5 A;  2DYM A;  5I4D A;  2D07 B;  2V4I B;  5JHB A;  2LGX A;  1ET6 A;  2KTR B;  2IGG A;  2HJ1 A;  4MJS A;  3IFW B;  4P6V F;  4G50 A;  4RGO S;  3W1S C;  1WRD B;  3MC9 A;  3AE1 B;  3R7Q A;  3DBL B;  3VVW B;  3Q8A A;  4HK2 A;  1WM2 A;  4YTM B;  1LO5 D;  2ZNV C;  1WJN A;  2JXT A;  4W9K A;  4B95 A;  4WJN A;  4MM3 B;  1SE2 A;  4WJO A;  1BXT A;  3H7P A;  4WWP A;  2IYD B;  2QHO A;  1GUA B;  3B2G A;  4M02 A;  2WXP A;  4PS7 A;  2I2Y A;  3ZTD A;  4DBG A;  3SFD B;  3L0W B;  4N9F 4;  4W9L A;  3A4S C;  1HZ5 A;  3RNG C;  5BYR A;  4BAX A;  1J7A A;  3TMP B;  1WXA A;  1OQR A;  2CJN A;  1TIF A;  4EZL A;  2JRI B;  2KJR A;  4ICV A;  2DZI A;  1GB4 A;  3MHZ A;  4RM8 A;  4P1C C;  1JRO A;  4A3O A;  1J7C A;  2BF8 B;  1V1P B;  4IUM B;  1I35 A;  1XLQ A;  2J52 A;  3IG3 A;  2RDB C;  1HTQ A;  3N1X C;  4PYU A;  1A70 A;  5HFY A;  2JT4 B;  2I1J A;  3T3N A;  1UF0 A;  4IKG A;  5DPW A;  3IHP C;  3CST A;  1WE6 A;  1WXS A;  1RAX A;  4WWO A;  1R7S A;  4KDI C;  4OW0 A;  3PRP B;  2LGD A;  3RCZ A;  1QKZ A;  1ISN A;  4R3D A;  4MEM A;  2PPH A;  1OTR B;  3V05 A;  3UQA A;  2KKC A;  2HTM E;  1K8R B;  2JWZ A;  4DDI D;  2IDY A;  3PPA A;  2FCS A;  2M1M A;  1YJI A;  3ZDT A;  3ML9 A;  5D6J B;  1JCK B;  4IW0 A;  4I6L B;  1V49 A;  2WXH A;  4GXB A;  2WXQ A;  4A55 A;  2LGI A;  3Q2A C;  2H89 B;  4JX1 C;  2KWV B;  3O13 A;  4GB9 A;  3RN9 C;  4BKS A;  2GBN A;  2BYV E;  1HE8 A;  2BWF A;  1Q0W B;  5HG2 A;  1JWU D;  1C3T A;  1UWX A;  1H8C A;  2K5P A;  3P4P B;  2LUE A;  2GOW A;  2QSD A;  4OZA A;  1QOA A;  3TEX A;  3N1Y C;  1WWT A;  3VUX A;  3RNB C;  2ONQ A;  2D3B A;  4Q2J A;  1UNS A;  4GN1 A;  1CZP A;  3ZNZ B;  2V3N A;  4ACF A;  3IBE A;  1ZGU B;  2JYE A;  3PZD A;  3URY A;  1TKY A;  2MH7 A;  1SBB B;  1CK1 A;  2V4L A;  1T0Y A;  2MHJ A;  4REZ A;  1YN5 A;  4IOI E;  1DOX A;  1PFD A;  3UIN B;  1ACC A;  1T5X D;  1LGR A;  3M63 B;  1IP9 A;  4M8N A;  1FM0 D;  5FR6 A;  2C5L C;  1Y8R C;  3EFC A;  4FHK A;  1LXD A;  2EMS A;  2K22 A;  2JF5 A;  5BMG A;  2JZZ A;  4BBN C;  2WDQ B;  3Q8E A;  2MJD A;  3VQI A;  1A5R A;  3P2B A;  3KLS X;  4ZHO A;  4IWP A;  1YN4 A;  2N1V A;  5BYQ A;  1BUI C;  1UUP A;  1XT9 B;  1E5W A;  2IGH A;  3ZLZ A;  3KWV A;  4ICU A;  3AI5 A;  5KHQ A;  1WM3 A;  2INP E;  3OAW A;  3PV1 A;  4DHJ B;  1C4A A;  3AEE B;  4K7S A;  1F1H A;  1C79 A;  3Q3O C;  2E3T A;  3ZYY X;  3QWZ B;  4KX6 B;  2HJ8 A;  1SJE D;  1HA5 A;  1QF6 A;  3MJW A;  3R7R A;  2NBU A;  1AW7 A;  3KUZ A;  3I63 C;  4MM3 A;  1V80 A;  2Y5B B;  3BYT B;  4C00 A;  1YD8 U;  1S3S G;  4HKZ E;  4EUT A;  4WAA A;  4XGA B;  1C77 A;  2JY6 A;  4W9E A;  1XCQ L;  1NVI D;  2RPV A;  4NNJ B;  4GLS C;  1WGY A;  2IGD A;  2QDF A;  4OZC A;  3U7Z A;  1V6E A;  1VZ6 A;  4NAW B;  3ZDM C;  3BY4 B;  3UIP B;  1P7F A;  2CHX A;  3EFU A;  4RGM A;  3TEW A;  1NYR A;  1IGC A;  1PUT A;  2J4X A;  2LHD A;  4JWS C;  4C80 A;  4FJZ A;  3WCQ A;  5CX3 A;  1ZW7 A;  3ML8 A;  3RMK C;  4A6Q A;  2J42 A;  2NMQ A;  3V6E B;  3TEZ A;  5J2R A;  5AEK B;  3H1U A;  4W9J A;  1IYF A;  3A4R A;  3NVW A;  2V0G A;  2M56 B;  3CIR B;  3H6N A;  3RYT A;  3GZN B;  1R4N B;  1BT0 A;  1PQS A;  2GLS A;  2L76 A;  2GRI A;  3N9Y C;  1HEZ E;  2J53 A;  4D2K A;  4US8 A;  3H9D A;  4WUR A;  2D3C A;  5EE9 A;  2DNF A;  4IDI A;  1WY8 A;  2XNA C;  3FAH A;  2CS4 A;  4BKG A;  4FUL A;  2Z0D B;  4EKU A;  1I4G A;  4QAY A;  2DWQ A;  5G2N A;  5JH5 C;  2RD0 A;  4ZRI A;  2MJ3 A;  3Q6B A;  2KWC A;  4WWM A;  5TSS A;  1DOI A;  2DAJ A;  1TY0 A;  1D5M C;  1YQ4 B;  1L2N A;  2HTH A;  3VR8 B;  4FLH A;  2IY0 B;  2KZR A;  4MJS B;  1FCC C;  4AWJ A;  3DBH B;  1QOF A;  1E8W A;  2IO0 B;  3PRE A;  2VH1 A;  1ZXH A;  1GG3 A;  2ZW1 A;  4YTN B;  3PHX B;  5LXI B;  4L23 A;  5H92 C;  1P7E A;  2O6V D;  5DPR A;  3DPD A;  2ASQ A;  1L0V B;  5BMH A;  3CMM B;  4E3C A;  3N20 C;  2AEH A;  4XDD A;  3H7P B;  1WJ4 A;  1FXI A;  2INC C;  4UDU C;  1D5X C;  4DHJ D;  4HCN B;  4MSQ B;  3HM6 X;  3W1Y A;  2EMT A;  5BYS A;  1WYG A;  3ZKJ C;  4HWI B;  5GXG B;  3NVY A;  1VCB A;  2ACZ B;  2FUH B;  2M0X A;  3BIN A;  1FRD A;  4N6E B;  3DBR B;  2RDG A;  1E8Y A;  5C23 A;  4P7I A;  2W3S A;  1C9F A;  3IT6 B;  1XLO A;  3GB1 A;  1EF1 A;  1KF6 B;  1N62 A;  2QIE B;  4RM9 A;  2LXA A;  2N7J A;  2MCN B;  4OHJ A;  3R8B A;  1NEN B;  1KH0 A;  1MI0 A;  2V1Y A;  2CJO A;  4JWU C;  2MX2 A;  4AS1 A;  3HUI A;  4DHZ B;  5C3J B;  3BVM A;  2D3A A;  2LFI A;  1UGJ A;  3TJP A;  4XWT A;  4DHZ E;  3PRZ A;  4LNI A;  4N58 A;  3E56 A;  3EUB 2;  4MEL A;  2B3A A;  1C78 A;  2KWU B;  2L00 B;  3PZ8 A;  2WU2 B;  4MH8 A;  2KDB A;  1YJJ A;  2KJ6 A;  1L6V A;  2IZV B;  5HHD G;  4I6N B;  2NCN A;  3L16 A;  2KDE B;  1NEK B;  1E8Z A;  5MPO A;  4KGS A;  1AWD A;  1N63 A;  1WGH A;  2WDV B;  1QOB A;  2NPT B;  3W9C B;  3C19 A;  1SE3 A;  3VTV A;  2MBQ A;  4YWG G;  2G9H D;  2L8J A;  3SU8 X;  3TSS A;  3J9C A;  3AE9 B;  2IND C;  3P4R B;  4KV2 A;  1NI3 A;  1KM7 A;  1RFA A;  1K51 A;  3BII D;  1TTN A;  1V2Y A;  3SEB A;  3K9P B;  2QEJ C;  4CQN A;  1L0X B;  2LGS A;  4NAW A;  3ZJV A;  2WXO A;  4BVU C;  2PW9 A;  4A20 A;  4PYZ A;  1E6E B;  4A9A A;  2KJH B;  1C1Y B;  2LRU A;  2AQ3 B;  1L0Y B;  4FHJ A;  2JU6 X;  3RNE C;  1KOT A;  1WYW B;  4OVV A;  4IM0 A;  2WXG A;  3A9K B;  3NG0 A;  2WXR A;  1IPG A;  1YMH E;  2G3Q B;  3NHE B;  3RT3 B;  2L0T A;  1MG8 A;  3VUY A;  4BZA A;  2KAC A;  2QC8 A;  3N32 A;  2HD5 B;  1GNU A;  5JZE B;  1ZPS A;  2C7H A;  1ZXI A;  5D3I B;  2R2O A;  4FBJ B;  3W5V B;  4IM3 A;  1WXM A;  3OG5 A;  2A4Z A;  3EC8 A;  4NZL B;  3CWI A;  3DOW A;  2LVO A;  2BPS A;  2HE7 A;  1FNV A;  3VXW A;  1F2R C;  3RZW C;  1WJ6 A;  3ZNG C;  2JVC A;  1IBX B;  2ZEQ A;  3RNA C;  4E71 A;  5DPT A;  2K6D B;  1FIQ A;  3MP9 A;  4M8M A;  1AYF A;  4WH4 A;  2WXM A;  1J7B A;  5E6P A;  2BYE A;  1JRU A;  5BMI A;  2UU7 A;  3WAP A;  2N4F A;  4CO7 A;  3B1L X;  1TZO A;  1WE7 A;  3AE7 B;  2KDM A;  1XCT L;  4KSK C;  3HM3 A;  3RNC C;  1WRI A;  2A5U A;  4BOZ B;  2BS2 B;  5CTR C;  2R2Q A;  3AE4 B;  1R4M I;  4II3 B;  2K8C A;  1RLF A;  4KZC A;  3T3O A;  3WAM A;  1VRA B;  2MQJ A;  4TQ0 A;  2PKO A;  2D11 A;  4K1R B;  4A8X C;  3A33 B;  4ANU A;  4KIK B;  4BOS C;  1MG4 A;  3P63 A;  3HK0 A;  1K53 A;  5FK9 C;  3A9J B;  2PE9 A;  1WJU A;  4X57 B;  3U4E G;  4BKS D;  2KHW B;  4HCP B;  1V5O A;  4ZOH C;  3D32 A;  4DXG A;  4L2Y A;  1SE9 A;  1XD3 B;  2XBB C;  4ZRK A;  4ZRJ A;  2WU5 B;  4GDK B;  1GB1 A;  2JX5 A;  1D6E C;  3PO0 A;  3DDC B;  3VTW A;  2MBO A;  1XF5 L;  3M3J A;  1NYQ A;  4ZHP A;  3R2T A;  3ZIM A;  4XYC A;  2N7E A;  1KFY B;  2WX1 A;  1TT5 B;  3DWG C;  2W54 A;  3TEY A;  2RGF A;  1T0Q C;  1VLB A;  3N1Z C;  3QHT A;  4LTU A;  2L3Z A;  1TGZ B;  2BB5 A;  4LNN A;  3RNF C;  1GC7 A;  3IXS A;  2LWP A;  5IAA C;  3L17 A;  2B76 B;  4JLC A;  4WJP A;  3WAO A;  2NPT A;  1YX6 B;  4NJ6 A;  1PYW D;  4AJY B;  1WIA A;  3QJZ A;  3AEB B;  2X38 A;  1XLN A;  3ZGZ A;  4URK A;  5AZH A;  4GIV A;  1SXT A;  4OVU A;  2YLM A;  1MHH E;  4JE3 B;  2QCZ A;  2K8B A;  1FEH A;  3RUI B;  4IG7 B;  3AU4 A;  3VH4 B;  3Q3M C;  2XK5 B;  4LJP B;  1WX9 A;  1BML C;  3O65 B;  4RMA A;  1VZ8 A;  1JQ4 A;  2LHE A;  3Q3F A;  3MC0 B;  1AN8 A;  5L83 A;  3JVZ X;  4WQM A;  4F7Z A;  1V9J A;  2K9X A;  4ANV A;  2BYF A;  2LEK A;  2DHZ A;  3T8M A;  3X23 A;  4WAF A;  4DK5 A;  1WZ0 A;  1YQB A;  2JZP A;  2MEK A;  3A9K A;  4RF0 A;  1E90 A;  3PVL A;  2BT6 A;  3ZVV A;  2PLP A;  3V3X A;  3SD5 A;  4KGR A;  3V6C B;  4HKQ A;  2WXK A;  3BK1 A;  3VHT C;  2RSU A;  1GJZ A;  4JPS A;  2K3U A;  3U52 E;  4K81 A;  4M00 A;  2G1E A;  1SSN A;  2R61 A;  1V1O A;  4HLE A;  1WR1 A;  1EUV B;  1ZDX A;  5JXV A;  1ZKH A;  1E7V A;  1IBX A;  2J0K A;  5EE0 A;  1GOZ A;  3B08 A;  3KH0 A;  4XX5 A;  4MGZ E;  2IO2 B;  4W9G A;  1V97 A;  2IJ0 A;  3UIO B;  4ARI A;  1CQV A;  3BYY B;  4EOY A;  3KUD B;  4W9C A;  2KAJ A;  1HTO A;  3HHM A;  2IPK D;  4MH0 E;  1FNW A;  2MP2 B;  3QA8 A;  3H8H A;  2WGS A;  3ONS A;  4RF1 A;  2BS4 B;  1Q1O A;  4FXC A;  1MHX A;  1WI0 A;  2CR5 A;  3RI7 C;  1SB3 C;  5IKC M;  4AOF A;  1ZE3 D;  2K1F A;  2BTE A;  3TIX A;  2WXN A;  4DXF A;  2ZPN A;  3IAM 1;  2BS3 B;  3MFG A;  1JAL A;  1LQB A;  4KIK A;  3Q3J A;  4YSY B;  4ASW C;  1PGX A;  3PS6 A;  3A9J A;  2HDE A;  4US9 A;  2KXJ A;  2RR9 A;  2Y3A A;  2FCQ A;  4MAC A;  3QIJ A;  1OQY A;  2NS5 A;  3DVG Y;  4USA A;  4HEA 1;  3TBL D;  3DBL I;  2DZJ A;  2KN4 A;  3PHW B;  4FJY A;  5HKH A;  4C7Z A;  4KGT A;  4GDK A;  2M17 A;  2NBW B;  4NAM A;  1C4C A;  3DCG A;  4W9I A;  1FPY A;  1TS3 A;  2ZJD A;  1JWA D;  5J17 A;  1UBI A;  5BO4 B;  4HRS A;  4W9H A;  3DHI C;  2JQR B;  3ZNI D;  3AUL A;  3MC8 A;  2KDF B;  4EZJ A;  5L95 C;  4LNK A;  3L54 A;  5D7G A;  5LNK 1;  1Q10 A;  5CHW A;  3AE2 B;  4KKI A;  5LXH A;  2RPQ A;  3M62 B;  3TCA A;  1TS4 A;  2FID A;  2EKE C;  3APC A;  5JHA A;  3DVG X;  3P4S B;  3Q8C A;  2CKH B;  1WGK A;  1C4P A;  1RFK A;  2VRR B;  2MA9 B;  3AE3 B;  3OJ3 A;  1J0G A;  4AQ7 A;  3UQB A;  3BVG A;  2O2V B;  3X0W A;  2ICI A;  2PTL A;  3ALB A;  2M8S A;  3CSF A;  2WWZ A;  3V61 A;  4MGI E;  3JYU A;  1AAR A;  1YN3 A;  5C1Z A;  3ZUN A;  3AXC A;  2XK5 A;  2WDT B;  2FCM A;  1JRP A;  4PS8 A;  1I4P A;  4XDC A;  1KLG D;  4YSZ B;  4EFO A;  1NDD A;  2QJL A;  4G3X B;  2MLB A;  3ZW3 A;  2YEP B;  2LVP A;  2PMV A;  2WYQ A;  4FAD A;  1P98 A;  2ZCB A; 
#chains in the Genus database with same CATH homology
 2PPH A;  1OTR B;  4HJK A;  3UQA A;  2KKC A;  2C7H A;  2KC1 A;  4KZ0 A;  1K8R B;  4FBJ B;  2JWZ A;  1SGH A;  2R2O A;  4DDI D;  3PPA A;  4GDL B;  1WXM A;  4IM3 A;  2A4Z A;  3EC8 A;  2GBR A;  3DOW A;  2FCS A;  3VTU A;  2M1M A;  2W9N A;  2LVO A;  2BPS A;  2JZ3 B;  2HE7 A;  3VDZ A;  3ZDT A;  2C9W B;  3ML9 A;  5D6J B;  4IW0 A;  3T9L A;  1OGW A;  3VXW A;  3RZW C;  4I6L B;  4CYE A;  1V49 A;  1WJ6 A;  3GOE A;  4GXB A;  3ZNG C;  3UF8 A;  2JVC A;  2ZEQ A;  2NVU I;  4J6I A;  2KC2 A;  4E71 A;  5DPT A;  3PT2 B;  2K6D B;  1EO6 A;  1V81 A;  2KWV B;  4WWN A;  2ZVN A;  4GB9 A;  4BKS A;  4M8M A;  2GBN A;  2KFK B;  4HVB A;  4DDG D;  2BYV E;  2J7Q B;  4LJO B;  1UZX B;  1HE8 A;  2LXC A;  5E6P A;  2KQS A;  2BYE A;  1JRU A;  2BWF A;  2DYB A;  3VAW A;  1Q0W B;  3WAP A;  1WX7 A;  2N4F A;  4XZ4 A;  2LZ6 A;  2GBM A;  2KMA A;  3B1L X;  2MSE D;  4CO7 A;  2AL6 A;  4AUQ C;  4CHK A;  1Z2M A;  1C3T A;  1H8C A;  1WE7 A;  4MDK E;  3NZS A;  4TQ1 A;  3OJ4 B;  4G0N B;  1NBF C;  2KX0 A;  2L7R A;  2LUE A;  2FNJ B;  4MGY E;  4KSK C;  2GOW A;  5E6O A;  3NY5 A;  3HM3 A;  3HIZ A;  2A5U A;  4BOZ B;  3KUC B;  4FJV B;  5CTR C;  3VUX A;  2R2Q A;  2LAS A;  1R4M I;  3APF A;  4II3 B;  2K8C A;  1RLF A;  2KLC A;  4KZC A;  3VFK A;  4GN1 A;  3V62 A;  3WAM A;  3ZNZ B;  3IVF A;  3IBE A;  1UH6 A;  2GMI C;  4NQK E;  1ZGU B;  1L7Y A;  3PZD A;  2MQJ A;  1QZE A;  2KLG A;  3ZRC A;  2MP2 A;  4TQ0 A;  2JXX A;  4YL8 A;  3H7S A;  3PLV A;  2D11 A;  4K1R B;  2V4L A;  1T0Y A;  3A33 B;  4WJQ A;  4ANU A;  4I6P A;  3VUW A;  4NQL B;  1OEY J;  2K25 A;  4KIK B;  4BOS C;  3HK0 A;  3UIN B;  3C0R B;  4GOC A;  1V86 A;  3PSE B;  4MGK E;  3A9J B;  3M63 B;  1NI2 A;  1WXV A;  5E6N A;  3K9O B;  1IP9 A;  2PE9 A;  1WJU A;  4M8N A;  1P9D U;  4X57 B;  2K6Q A;  4BKS D;  2KHW B;  2JPH A;  2KX3 A;  3N30 A;  4HCP B;  4W9D A;  3S2A A;  5FR6 A;  3ZNH B;  2C5L C;  1Y8R C;  4F8C B;  3ENE A;  3VH3 B;  1V5O A;  3D32 A;  4FHK A;  4KVG B;  1SE9 A;  1LXD A;  2LRW A;  3NOB A;  1XD3 B;  2EMS A;  1WGR A;  5AZF A;  2N9E B;  2JF5 A;  4M0W B;  4F1S A;  4ANW A;  1I42 A;  2XBB C;  4ZRK A;  2JZZ A;  3LDZ E;  4ZRJ A;  3ZO5 B;  4GDK B;  1E8X A;  3VQI A;  4BBN C;  1WGG A;  2C7M B;  1A5R A;  2WX0 A;  2D2Q A;  3P2B A;  4HDQ A;  2ZNV B;  3DDC B;  3VTW A;  3KYD D;  2MBO A;  4IWP A;  1G6J A;  2BWE S;  3M3J A;  3LJ3 A;  2N1V A;  4GSW A;  3L10 B;  1WZ3 A;  3RZF A;  3AU5 A;  1XT9 B;  4A3P A;  2KFK A;  1E5W A;  3ZLZ A;  2PEA A;  4ICU A;  2JRH A;  3ZIM A;  3AI5 A;  2N7E A;  5KHQ A;  1WM3 A;  3OAW A;  1H4R A;  2WX1 A;  3RCZ A;  3UGB B;  1D3Z A;  3PV1 A;  4DHJ B;  1TZ1 A;  4K7S A;  1WMH B;  5D2M B;  3ZTC A;  2RGF A;  1V5T A;  3QWZ B;  3QHT A;  4TV3 A;  2HJ8 A;  2L3Z A;  3MJW A;  1TGZ B;  2DZM A;  4MSM B;  4JL9 A;  2Z59 B;  1LM8 B;  3MHS D;  2KTF A;  1LFD A;  3R7R A;  1GC7 A;  2REX A;  2NBU A;  2ZZP B;  2LWP A;  4NPN A;  5IAA C;  3KUZ A;  3L17 A;  4MM3 A;  1V80 A;  3PLU A;  3MTN B;  2Y5B B;  3WAL A;  1E7U A;  2KO3 A;  4JLC A;  4WJP A;  1UD7 A;  4B9K A;  1YD8 U;  3QAQ A;  1S3S G;  1Q5W B;  1UEL A;  4HPL B;  4WAA A;  3WAO A;  4EUT A;  2NPT A;  1YX6 B;  4NJ6 A;  2JY6 A;  5IA7 A;  3TL5 A;  4W9E A;  4AJY B;  1WIA A;  2ZCC A;  3KVF B;  3QJZ A;  3A1Q A;  2DYO A;  3L08 A;  4NNJ B;  2AWT A;  1WGY A;  3CF6 E;  4URK A;  5CHV C;  5AZH A;  1V6E A;  4JQW C;  4GIV A;  4NAW B;  4LDT B;  3ZDM C;  3BY4 B;  3QC8 B;  3UIP B;  1P0R A;  4OVU A;  2YLM A;  1WX8 A;  3EFU A;  2CHX A;  1YIW A;  2K8B A;  2BGF A;  2BKR B;  4IWO A;  4IG7 B;  2ZPY A;  2FIF A;  3RUI B;  3GZN I;  1R4N I;  3KW5 B;  3AU4 A;  3QAR A;  3VH4 B;  4K7W A;  1P3Q U;  4FJZ A;  2GBJ A;  1Z5S B;  3DVN V;  3KYC D;  3PGE A;  2N9X A;  5CX3 A;  2XK5 B;  2O2V A;  4LJP B;  1VD2 A;  1WX9 A;  3M95 A;  4FN2 A;  1ZW7 A;  3ML8 A;  2G4S A;  3O65 B;  3V6E B;  2D10 A;  4RMA A;  5J2R A;  3Q3F A;  5AEK B;  2KDI A;  3B0A A;  3H1U A;  4W9J A;  1IYF A;  3PRM B;  3A4R A;  2G45 B;  3L13 A;  5L83 A;  2KMC A;  3JVZ X;  4JIO U;  2KOX A;  3H6N A;  3WAN A;  2K39 A;  1J19 A;  4F7Z A;  1V9J A;  4ANV A;  3RYT A;  4TKN A;  2KD0 A;  2BYF A;  2KN5 A;  2DHZ A;  3T8M A;  1BT0 A;  1PQS A;  2L76 A;  2O6V A;  4HXD A;  3WIM A;  3X23 A;  2I1K A;  4DK5 A;  3PTF C;  1WZ0 A;  1YQB A;  3H9D A;  3NS8 A;  5KHO A;  1XQQ A;  3A9K A;  4LCD E;  4ZYN A;  2CHW A;  4II2 B;  3I3T B;  1E90 A;  4AJW A;  3PVL A;  3N3K B;  3ZVV A;  2LJ5 A;  3OLM D;  1UGM A;  2YVC A;  3SD5 A;  3V6C B;  1WY8 A;  2CS4 A;  4BKG A;  4FUL A;  2Z0D B;  2CHZ A;  2FCN A;  4K7U A;  4KDL B;  1J8C A;  4IC7 B;  3V60 A;  1EF5 A;  3VHT C;  2RSU A;  4EKU A;  1GJZ A;  1CMX B;  3DBH I;  1UBQ A;  5G2N A;  5JH5 C;  1WR6 E;  2ZVO A;  4B6W A;  4EZK A;  4DWF A;  2RD0 A;  4ZRI A;  4GDL A;  1YJ1 A;  4JGH B;  3NZU A;  2N1W A;  4K81 A;  2NBV B;  2KVR A;  2KK8 A;  4EEW A;  2KWC A;  2DAJ A;  3QK0 A;  2G4D B;  1S1Q B;  4HLE A;  1L2N A;  5LLI A;  2HTH A;  2V3S A;  4FLH A;  1WR1 A;  5AZG A;  2IY0 B;  2KZR A;  1EUV B;  3WA0 A;  4MJS B;  1ZKH A;  3U8Z A;  1E7V A;  4AWJ A;  4GU2 A;  3RD2 A;  4AP4 C;  2J0K A;  1SIF A;  1E8W A;  2IY1 B;  2IO0 B;  2N7D A;  4XC2 A;  3PRE A;  2C7N B;  1GG3 A;  3B08 A;  2MWS B;  3KH0 A;  3PHX B;  2UWQ A;  4XX5 A;  5LXI B;  4MGZ E;  2IO2 B;  2KNB A;  4W9G A;  2DX5 B;  3SDL C;  3EHV A;  3UIO B;  3ZRF A;  2O6V D;  5DPR A;  4HDO A;  3QX1 A;  3DPD A;  2ASQ A;  4EOY A;  3EEC A;  3KUD B;  3CMM B;  2LGY A;  3SHQ A;  4ANX A;  4E3C A;  1WFY A;  4TUU A;  3QCA A;  4W9C A;  4HPM B;  2AEH A;  3H7P B;  3HHM A;  1WJ4 A;  4DXA B;  3U30 A;  4MH0 E;  2MBE A;  2MP2 B;  3QA8 A;  1KJT A;  3DBR I;  4DHJ D;  3ONS A;  4HCN B;  4IWQ A;  4MSQ B;  3HM6 X;  1Q1O A;  3R66 C;  3W1Y A;  2EMT A;  3RUL A;  1WGD A;  3ZKJ C;  2OJR A;  4HWI B;  3JSV B;  1WI0 A;  4BBN F;  2CR5 A;  4W9F A;  2CU1 A;  1KLV A;  4AOF A;  2AYO B;  4ZDV A;  2JUO A;  1VCB A;  1YX5 B;  3BIN A;  2FUH B;  2K1F A;  2M0X A;  3TIX A;  5EDS A;  2N9P C;  5GMV A;  2ZPN A;  2UYZ B;  1E8Y A;  4NY0 A;  5C23 A;  1OEY A;  4P7I A;  3QQ8 B;  3JW0 X;  1LQB A;  4KIK A;  2LD9 A;  1EF1 A;  3Q3J A;  5J18 A;  4PS3 A;  2IBI B;  2L05 A;  4ASW C;  4E74 A;  4RM9 A;  3PS6 A;  2MBH A;  3A9J A;  2K8H A;  2LXA A;  2Z0E B;  2KXJ A;  2RR9 A;  2XEW A;  2MCN B;  4GMV A;  2J0J A;  3APD A;  2L0F A;  2FCQ A;  2V1Y A;  4LDT D;  3QIJ A;  1OQY A;  4IM2 A;  5DPS A;  2NS5 A;  3DVG Y;  2KQ7 A;  4WQO B;  2NR2 A;  3TBL D;  3DBL I;  2LVQ A;  2DZJ A;  2MX2 A;  3PHW B;  3W1S A;  4DHZ B;  4FJY A;  4NJ7 A;  2MW5 A;  2DYM A;  5HKH A;  2D07 B;  5JHB A;  4GDK A;  2LGX A;  3TJP A;  2KTR B;  2M17 A;  5G55 A;  4KSL C;  3PRZ A;  4DHZ E;  1U4A A;  2NBW B;  4MJS A;  3IFW B;  4MEL A;  3DCG A;  4W9I A;  2B3A A;  4G50 A;  1F9J A;  2KWU B;  3W1S C;  2L00 B;  1FXT B;  2ZJD A;  1WRD B;  5J17 A;  3R7Q A;  2IO1 B;  1UBI A;  2KDB A;  3VVW B;  5D94 A;  4HK2 A;  5BO4 B;  1WM2 A;  2KJ6 A;  2ZNV C;  4W9H A;  1WJN A;  4W9K A;  3ZNI D;  2IO3 B;  2IZV B;  3AUL A;  1P1A A;  2KDF B;  3ECI A;  4I6N B;  2PE6 B;  4B95 A;  2NCN A;  3L16 A;  2KDE B;  4WJN A;  4EZJ A;  1E8Z A;  1WMH A;  4GGQ A;  4WJO A;  5L95 C;  3R3M A;  3L54 A;  5D7G A;  5CHW A;  1WGH A;  3H7P A;  5LXH A;  2RPQ A;  3M62 B;  2GBK A;  3TCA A;  4WWP A;  2NPT B;  2DZK A;  2IYD B;  2FID A;  2QHO A;  2EKE C;  1GUA B;  3APC A;  3VTV A;  2MBQ A;  2L8J A;  3U7D A;  3SU8 X;  5JHA A;  3A1Q B;  4PS7 A;  2MRP A;  2D3G A;  3ZTD A;  4BFR A;  3DVG X;  4BKT A;  4DBG A;  2M4N A;  3JSV A;  5DCN A;  4KV2 A;  3L0W B;  2CKH B;  4N9F 4;  4W9L A;  3A4S C;  3DVN U;  1KM7 A;  1RRB A;  1RFA A;  2VRR B;  2MA9 B;  3OJ3 A;  1J0G A;  3TMP B;  1WXA A;  2KAN A;  2KFJ A;  3UQB A;  1TTN A;  1V2Y A;  4FA6 A;  2O2V B;  4EZL A;  2JRI B;  1TBE A;  2KJR A;  3K9P B;  3X0W A;  4ICV A;  2DZI A;  2FAZ A;  3ALB A;  2M8S A;  4NAW A;  4BVU C;  4RM8 A;  3CSF A;  2WWZ A;  4A20 A;  3V61 A;  1WF9 A;  4A3O A;  4PYZ A;  4MGI E;  2BKF A;  2DAF A;  3JYU A;  2KJH B;  4G11 A;  2BF8 B;  1AAR A;  4IUM B;  1I35 A;  1C1Y B;  2DEN B;  2LRU A;  5C1Z A;  3ZUN A;  2PJH A;  3IG3 A;  3DQV A;  5TR5 A;  3AXC A;  2O6V B;  4FHJ A;  4PYU A;  2XK5 A;  5CHF A;  2WDT B;  2FCM A;  1KOT A;  1WYW B;  2OOB B;  2JT4 B;  4IM0 A;  4OVV A;  3A9K B;  2MBB B;  2C60 A;  2I1J A;  4PS8 A;  1M94 A;  3DBS A;  4EFO A;  1IPG A;  2G3Q B;  1NDD A;  2KTR A;  3NHE B;  5DPW A;  3RT3 B;  3IHP C;  4G3X B;  2LI5 A;  2J0M A;  2MLB A;  3CST A;  3ZW3 A;  2L0T A;  1MG8 A;  2LVP A;  1WE6 A;  2AL3 A;  1WH3 A;  1WXS A;  1X1M A;  3VUY A;  1RAX A;  4WWO A;  4KDI C;  2WYQ A;  3N32 A;  4FAD A;  1P98 A;  2ZCB A;  1GC6 A;  2HD5 B;  2LGD A;  1GNU A;  3PRP B;  5JZE B;  1ISN A;  4MEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...