2B3AA

Solution structure of the ras-binding domain of the ral guanosine dissociation stimulator
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
87
structure length
87
Chain Sequence
DCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ral guanine nucleotide dissociation stimulator
publication title New insights into binding of the possible cancer target RalGDS
rcsb
source organism Homo sapiens
total genus 17
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2005-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2b3aA00
4AP4C 2I1JA 4BOZB 4GIVA 3IBEA 1XQQA 1P3QU 3D32A 2RR9A 3H7SA 2BYFA 2NCNA 3RUIB 3X23A 1TZ1A 3RZWC 2KFKB 3GZNI 2D11A 1P1AA 4GOCA 4JL9A 2WDTB 4MGZE 5E6PA 2MP2A 4CYEA 2R2OA 2MBQA 4MH0E 3AU5A 3DOWA 1L2NA 2RD0A 3H7PA 3NZSA 4I6PA 4KIKA 2A4ZA 4W9CA 3APFA 4GN1A 3ENEA 4WJQA 3UGBB 1KOTA 3A4RA 2CU1A 3AI5A 5LLIA 1QZEA 5E6OA 2KK8A 4URKA 2KKCA 2BWFA 2KANA 2MQJA 3VUYA 3WAOA 1YX5B 2KDBA 2FIFA 4WWPA 5DPWA 3SDLC 3R7QA 4F1SA 4GDKB 1VD2A 1WX7A 4W9HA 5JHBA 1WY8A 5TR5A 2ZVOA 3APCA 4KZ0A 3N3KB 2XK5A 4F8CB 4PS7A 1WMHA 4TV3A 5KHQA 2CR5A 2LXCA 2MBHA 3VXWA 2JUOA 2G4SA 2HE7A 1E5WA 5GMVA 2J0MA 2FAZA 1Q0WB 4MSQB 4NJ6A 2KMAA 5D94A 3RD2A 1WXSA 1UD7A 1EF5A 1GNUA 2JRHA 2KFJA 4HVBA 3W1SC 1TBEA 3TCAA 3ALBA 2L76A 2JZZA 3A1QA 3PRMB 2BKRB 3VVWB 2MA9B 2M1MA 4JLCA 3PRZA 4JGHB 4AJWA 3AULA 4ZRJA 2V4LA 4IM0A 3V61A 2WWZA 2HTHA 3KUCB 4GU2A 3PV1A 2MP2B 3DDCB 4N9F4 2PE9A 2UYZB 3AU4A 5G55A 5BO4B 3SHQA 1RRBA 4FJZA 2K1FA 3QARA 4GXBA 4I6LB 2IZVB 2L0TA 4XZ4A 3H7PB 4G50A 4KIKB 3IVFA 4NQKE 1WX8A 2NS5A 2WYQA 1WI0A 3HIZA 5JHAA 2N7EA 4IW0A 4A3OA 2CKHB 1Q1OA 4IG7B 3JVZX 2KJHB 2DYOA 2LVOA 1LM8B 4II2B 4MJSB 2IY0B 2KWVB 2ZZPB 2NBUA 4EUTA 2KFKA 3JSVA 2MBBB 3BINA 3A4SC 1ZW7A 2JRIB 2KDFB 4ZRKA 2MBOA 2LUEA 1Q5WB 1X1MA 2N1VA 4E71A 1UBIA 2HD5B 1E90A 3B1LX 4WJPA 3PS6A 3L08A 2C7MB 2GBNA 4LJPB 3PHXB 4KSLC 3X0WA 2XK5B 2IO1B 3H6NA 2K39A 4M8NA 2J0KA 3TBLD 3WALA 4BKTA 3EC8A 3ZTCA 2L3ZA 4K7SA 2OJRA 2CHZA 2KO3A 3OAWA 4II3B 2KHWB 1ISNA 5AZHA 4CO7A 2KQ7A 3VAWA 4DBGA 1E8ZA 1PQSA 2A5UA 2V3SA 4IUMB 1LXDA 2KD0A 1WE6A 3DBSA 4BOSC 4HJKA 3ZO5B 3TL5A 4K7UA 3I3TB 4DHZE 3UQBA 4MELA 4KVGB 3ZTDA 2NR2A 4AJYB 4DXAB 4EOYA 2FNJB 2N9PC 2ZPNA 4GDKA 3ECIA 4J6IA 4HPLB 1UBQA 4MEMA 4BKSD 1XT9B 3SD5A 1E7VA 2N4FA 3JYUA 4HCPB 4YL8A 3TMPB 1SIFA 2Z59B 3KYDD 3RYTA 2FIDA 1S3SG 1K8RB 3OJ4B 3PT2B 4ANUA 4W9KA 3HHMA 3V6CB 3ZRFA 1WGHA 4WWOA 2C60A 4DHJD 1L7YA 4M8MA 4DK5A 4BKSA 2CS4A 3MTNB 4EZKA 1Z5SB 2CHWA 2V1YA 2LI5A 3PGEA 4GMVA 3PREA 4W9JA 3PVLA 2AEHA 3DBHI 2N9XA 1V81A 3R66C 3ZUNA 3MHSD 4IWPA 1EUVB 4AOFA 3U30A 3JSVB 1WJUA 1XD3B 3UIOB 2YLMA 2KJ6A 1U4AA 3K9PB 3BY4B 4WAAA 2EMSA 3B08A 2MW5A 2PPHA 3EECA 2AYOB 2BF8B 3RULA 2C9WB 3PLVA 4NJ7A 4AUQC 3V60A 3KW5B 2ZNVB 2G45B 2DENB 2GBMA 1Z2MA 2LGXA 1MG8A 3M95A 3VTWA 3L13A 2PE6B 4MJSA 5CHFA 3QIJA 4TKNA 1WR1A 1V9JA 2D07B 3WIMA 2FUHB 2K6DB 5D7GA 2AL6A 5J2RA 4AWJA 2M17A 4PS3A 5L83A 4GGQA 2BKFA 1H8CA 2PJHA 1V80A 2C7HA 3TJPA 4G0NB 3IG3A 2KNBA 2YVCA 4E3CA 4ZRIA 3KYCD 4NQLB 4WWNA 4BBNC 2MWSB 3OJ3A 2NVUI 4HDOA 4DHZB 3OLMD 2LRWA 3K9OB 1P9DU 2NPTB 1YX6B 3QAQA 4ICVA 1RFAA 2KVRA 4LJOB 3R7RA 1CMXB 3SU8X 5EDSA 1WGDA 2LGDA 4NNJB 3VDZA 1ZGUB 3PTFC 3VTUA 4FA6A 5L95C 3AXCA 2JVCA 3KUDB 4KSKC 1A5RA 2AWTA 5G2NA 4OVUA 4FHKA 2LWPA 1V6EA 2WX0A 4P7IA 3ZIMA 4DHJB 3QA8A 1WGGA 3W1YA 3TIXA 3VH4B 4RMAA 3ZW3A 2DZMA 2N1WA 2KWCA 1WIAA 2IO2B 2MBEA 1LQBA 2K8HA 4W9DA 2D2QA 4EFOA 2GBJA 1D3ZA 2KX3A 4NAWB 3UINB 4BBNF 3L17A 5D6JB 4MGYE 2AL3A 2HJ8A 4CHKA 1T0YA 1V49A 2DHZA 1WRDB 3LJ3A 2J7QB 3PLUA 4HCNB 3CSFA 4IM2A 1EF1A 3VH3B 4EZJA 2IO3B 3W1SA 2N9EB 4ANVA 3N32A 4TUUA 3A9KB 4HPMB 4PS8A 4W9IA 5JH5C 4FULA 5AZGA 2KZRA 1E8WA 2KX0A 4XC2A 2KC1A 3M63B 3T8MA 2ASQA 3ZNHB 4FLHA 3U7DA 1AARA 3MJWA 5E6NA 1LFDA 3NS8A 3IFWB 4BVUC 4PYUA 3B0AA 3DVGX 2KJRA 5DPRA 3PPAA 1UGMA 2LXAA 4HK2A 4GDLB 2Z0EB 3DQVA 5IAAC 2JWZA 4M0WB 2O2VB 3DVNV 4FJVB 1WJNA 3KUZA 5CHWA 1KLVA 4B6WA 2KQSA 4IWOA 3JW0X 4HWIB 2IO0B 4PYZA 2L05A 3RT3B 1WXMA 5CX3A 2O6VD 2K8BA 2M0XA 3GOEA 2G4DB 3ZNGC 4HLEA 1ZKHA 4G11A 2DAFA 1C3TA 4WQOB 1P98A 3NZUA 3V62A 2L00B 3EHVA 3QWZB 2G3QB 4ICUA 3ZVVA 5C1ZA 3L0WB 3L10B 2LZ6A 3L54A 4IC7B 3IHPC 4EKUA 5LXHA 2IBIB 2IYDB 3ZKJC 2C5LC 1YQBA 2NPTA 2K8CA 2GBKA 4G3XB 2MX2A 2LJ5A 3ZDMC 2FCQA 2KLCA 1E8XA 2LRUA 3M3JA 1OEYJ 2JT4B 1C1YB 2NBVB 3QC8B 4TQ0A 2JF5A 4ZDVA 3ML8A 4IM3A 3S2AA 2L0FA 3CSTA 3UF8A 3DBLI 3DVNU 2L7RA 1FXTB 2DZIA 2LASA 2DZKA 4EZLA 4FN2A 4ANXA 4DDGD 4DDID 1G6JA 1TTNA 3APDA 1KM7A 1WXVA 3NY5A 4NAWA 1EO6A 1M94A 5CTRC 2FCSA 4ZYNA 1GC7A 3A9JB 1WZ0A 1TGZB 1V5TA 4W9LA 2LVQA 1NDDA 2JXXA 2JZ3B 3EFUA 4W9FA 2C7NB 2KTRB 4JQWC 1YD8U 1YJ1A 4FHJA 2W9NA 2BGFA 2FCMA 2MLBA 1J19A 2L8JA 3A9KA 3C0RB 5D2MB 2K25A 1V2YA 4WJOA 3ZRCA 2BPSA 2KDEB 3WAMA 5AZFA 2DYBA 3M62B 4A20A 1GC6A 4BKGA 3V6EB 3L16A 1RAXA 2JY6A 1WX9A 2XBBC 3ZLZA 3KH0A 1F9JA 5KHOA 5DPTA 1GUAB 2B3AA 4NPNA 4OVVA 1IP9A 4GDLA 4JIOU 1V86A 2DX5B 3KVFB 1E7UA 4HXDA 4XX5A 2O2VA 4F7ZA 2KDIA 3N30A 3H1UA 2N7DA 4RM9A 3U8ZA 2NBWB 4KDIC 2O6VB 2ZJDA 2RPQA 2ZVNA 1WGRA 3O65B 3A33B 5AEKB 3NOBA 3RZFA 4MM3A 4LDTB 2KLGA 3RCZA 3ML9A 3Q3FA 5DCNA 3T9LA 2MSED 4IWQA 1YIWA 3DBRI 4K7WA 1R4NI 2D3GA 3ZNID 1H4RA 4BFRA 3QX1A 1GJZA 3QHTA 2LGYA 4ANWA 2RGFA 2M4NA 2GBRA 2KWUB 2ZCCA 2KN5A 5HKHA 2CHXA 3ZNZB 1RLFA 1J0GA 4B95A 2UWQA 2MRPA 1WE7A 5FR6A 1SE9A 3CMMB 2XEWA 4KZCA 1I35A 2PEAA 3H9DA 4W9GA 1IPGA 1JRUA 4B9KA 5JZEB 1UZXB 1J8CA 2J0JA 3VQIA 1NBFC 5CHVC 1WM3A 2EKEC 2GOWA 4K1RB 4NY0A 2VRRB 3PHWB 2KOXA 2R2QA 1WYWB 2ZNVC 3Q3JA 3WAPA 2QHOA 4MGIE 3DVGY 1E8YA 2BYEA 3ONSA 2I1KA 1WGYA 4W9EA 2JPHA 3DCGA 1SGHA 5J17A 4I6NB 2IY1B 1Y8RC 1WJ6A 1WF9A 3QJZA 2DZJA 2RSUA 4K81A 4A3PA 3A9JA 3QK0A 1VCBA 5LXIB 1GG3A 2EMTA 2KTRA 1OQYA 5C23A 3WA0A 3UQAA 1WXAA 1OEYA 2MCNB 3HM3A 4X57B 4MSMB 2DAJA 2ZEQA 2KXJA 3WANA 2KMCA 2LVPA 1KJTA 1UELA 2DYMA 2OOBB 4KV2A 4RM8A 2GMIC 1S1QB 4LCDE 3UIPB 2M8SA 3QCAA 1WMHB 3VUWA 4LDTD 4ASWC 2BYVE 3PRPB 1IYFA 2Y5BB 1WZ3A 2LD9A 3DPDA 1OGWA 1I42A 2WX1A 1R4MI 4HDQA 4WJNA 1HE8A 4KDLB 4MGKE 5J18A 3NHEB 4GB9A 3VFKA 4DWFA 2REXA 3HK0A 3VHTC 3A1QB 4E74A 1OTRB 2O6VA 1WH3A 3LDZE 3ZDTA 4FADA 2K6QA 3CF6E 4FBJB 2D10A 3PSEB 4EEWA 1WFYA 2KTFA 2ZPYA 3R3MA 4FJYA 1BT0A 4GSWA 4TQ1A 5DPSA 2FCNA 3QQ8B 1WR6E 1WJ4A 3PZDA 5IA7A 3VUXA 1P0RA 4MDKE 3VTVA 1UH6A 2Z0DB 2BWES 1WM2A 3P2BA 2ZCBA 1NI2A 2KC2A 1V5OA 3HM6X
chains in the Genus database with same CATH superfamily
2I1JA 2HJ1A 1SF0A 1XQQA 1QOGA 1UWMA 2RR9A 3H7SA 5I4DA 3RZWC 3GZNI 1P1AA 4GOCA 3P63A 3ZJTA 5LNK1 4A90A 3AE4B 1HTOA 2A4ZA 3RN9C 1PDXA 3A4RA 3TEWA 2KK8A 2BWFA 3AE7B 2KDBA 2FIFA 3ZYYX 2L83A 1TT5B 3SDLC 1TKEA 4F1SA 3RFZB 1MI0A 1KTKA 1WX7A 1Q10A 5TR5A 2MHJA 3T3OA 3N3KB 2XK5A 3RNBC 2KN4A 2CR5A 2LXCA 2MBHA 3VXWA 1L4DB 1TIFA 1E5WA 5GMVA 2J0MA 1Q0WB 4WQMA 5D94A 2L52A 3ZXVA 2D3CA 2ICIA 2L76A 2JZZA 4K3CA 3VVWB 1RWSA 3AE8B 4JLCA 2V4LA 2HTHA 3PV1A 3I63C 2MP2B 3DDCB 1RRBA 2K1FA 3QARA 4I6LB 3H7PB 4XGAB 3IVFA 5JHAA 1WI0A 4IW0A 4A3OA 1Q1OA 1JWUD 3JVZX 2LVOA 2IY0B 4EUTA 3JSVA 5IOIA 3B2FA 4JWUC 3RNCC 2KDFB 2MBOA 3AEBB 1Q5WB 2N1VA 2NTSA 4YTPB 3PS6A 2C7MB 4RH6A 4XWTA 4LJPB 1K53A 1YOVB 2K39A 3H6NA 3WALA 1XLQA 3ZTCA 2OJRA 5AZHA 2KQ7A 1E8ZA 4IUMB 3BYTB 3C19A 3I9V1 3DBSA 4PT5A 4HJKA 5H92C 4DHZE 3ZTDA 1TKYA 1XT9B 4RGTA 1E7VA 3JYUA 2KT7A 1SIFA 2Z59B 3EA6A 3KYDD 2JWUA 1K8RB 1QF6A 1BUIC 1SJHD 4ANUA 4WWOA 4M8MA 1GB1A 2WQYB 1JWSD 1Z5SB 1GOZA 2LI5A 3PREA 3DWGC 2VZKD 3PVLA 2N9LA 4AOFA 3U30A 1WJUA 3UIOB 2IGGA 3Q8AA 3BY4B 4RGOS 4RNAA 2MW5A 3EECA 2R61A 1FFUA 3RULA 2C9WB 3PLVA 4AUQC 2ZNVB 1WRIA 2G45B 2DENB 2QDFA 1MG8A 1UNSA 3FILB 2BVCA 2V3PA 1V9JA 3WIMA 5D7GA 2M17A 4LLGM 3H8HA 2BKFA 4USAA 3PZ7A 2C7HA 2MWSB 3OJ3A 2BBCA 4HDOA 1R4MB 3K9OB 3QAQA 2NPTB 3R7RA 2VH2A 1WGDA 2LGDA 3LXFA 3PTFC 3VTUA 4FA6A 4LK0M 3N1ZC 2LWPA 3QA8A 4XE0A 3AEAB 1QQRA 2N1WA 2IO2B 2MBEA 1LQBA 2K8HA 4EFOA 1D3ZA 4NAWB 2M19A 1ROEA 1QOBA 1GPXA 1WRDB 3LJ3A 1TYGB 3W1SA 4MACA 4ANVA 2N9KA 5JH5C 1V1OA 3BVGA 4FULA 2KZRA 2JU6X 4A9AA 3T8MA 2ASQA 4FLHA 3U7DA 3MJWA 1I7HA 3EFCA 3B0AA 3DVGX 3NVZA 3Q3MC 4HK2A 3FILA 1UGJA 1C4AA 1NYRA 2WDQB 5GXGB 4M01A 2JZPA 3DVNV 2BT6A 2YEPB 4FJVB 1ZUD2 4B6WA 3U7ZA 2IGDA 1L6VA 2O6VD 5CX3A 1ZKHA 2DAFA 1GAQB 3R2IA 1P98A 3NZUA 2LUMA 3ZVVA 1N60A 3L54A 1B9RA 2IYDB 1TS4A 2PKOA 1YQBA 2NPTA 4A55A 1I4GA 2INCC 2MX2A 3N1XC 5TSSA 1M4VA 1C1YB 4IM3A 3UF8A 3DBLI 3DVNU 2LASA 4FN2A 4ANXA 4DDGD 1G6JA 1STEA 1JWMD 2ON8A 2RPVA 3NY5A 4NAWA 1QLBB 3A9JB 1WZ0A 2QILA 3TSSA 4W9LA 2JXXA 1SB3C 3EFUA 2C7NB 2KTRB 1YJ1A 5EE9A 2BGFA 2JYTA 2L8JA 3BYYB 3C0RB 5D2MB 3ZRCA 4WAFA 1QOFA 3M62B 1GC6A 3V6EB 2ZW0A 2OEDA 4HKZE 5FKAC 1WX9A 1JQ4A 1DGJA 5DPTA 2B3AA 1MHHE 4OVVA 1IP9A 2I2YA 1E7UA 4HXDA 4C00A 1D5XC 2J4XA 2ZVNA 3KWLA 3VR8B 3T9LA 1BXTA 5BYSA 4IWQA 1YIWA 4BFRA 4RF0A 1R4NI 1YJJA 2D3GA 1C4CA 3QX1A 4HROA 4ZRQA 2LGYA 4YWGG 3GE3C 1N61A 2CHXA 1RLFA 1UF0A 2UWQA 1DOIA 1V1PA 2MRPA 1WE7A 3CMMB 4KZCA 2PEAA 3AB5A 3H9DA 4P1BC 4W9GA 4B9KA 5JZEB 3VQIA 2LEKA 3ZGZA 2EKEC 1WWTA 2QHOA 1E8YA 2JXTA 3ONSA 5HFYA 2BB5A 4RGMA 4W9EA 2JPHA 3DCGA 4OHJA 3WCQA 1ZDXA 2RSUA 3A9JA 1QILA 2KTRA 1MFWA 4X57B 4LNOA 4MSMB 1L0XB 2KMCA 2LVPA 2OOBB 2DYMA 4RM8A 2FE8A 3QCAA 3O13A 2L32A 1EM7A 4ASWC 2BYVE 2LD9A 4R3DA 4WJNA 3Q69A 4KDLB 4GB9A 3AEDB 2NMQA 3HK0A 4DXGA 2K6QA 3DHIC 1XO3A 2D10A 1F77A 2KTFA 1JRPA 4TQ1A 1XCQL 2Y5CA 1WJ4A 4MDKE 4P1CC 1L5PA 2CJOA 5JXVA 1TS2A 1NI2A 4NJCA 2MJEA 2BS2B 1V5OA 4J6IA 4TQ0A 3T3NA 4GIVA 4WURA 3IBEA 4C56C 3D32A 4OW0A 1XCTL 2NCNA 1OFFA 4JL9A 2WDTB 4MGZE 5E6PA 3AEEB 2R2OA 4MH0E 5IP4D 3DOWA 1L2NA 4US9A 4US8A 1N5XA 3APFA 4GN1A 3ENEA 4EE2A 3I5JC 1SE4A 1KOTA 3AI5A 5LLIA 3VUYA 3R7QA 4GDKB 5E6JA 4KZ0A 1NEKB 1ZE3D 2QIEB 4L1BA 4LNNA 3V3XA 5BMIA 2FBWB 4YTMB 2HE7A 4NJ6A 4MSQB 3RD2A 1UD7A 4HVBA 1FRDA 1SE3A 1N6ZA 1CQVA 3SFDB 2BKRB 3ETRA 1C9FA 2MA9B 4AJWA 3PRZA 3AULA 4ZRJA 1RFKA 1KFYB 2WWZA 2MJ3A 2FUG1 3KUCB 4N9F4 1RM6C 1PFDA 3SHQA 1AWDA 2IZVB 4G50A 4NQKE 2WYQA 1SXTA 2KJHB 2DYOA 5IN7A 2ZZPB 1ZW7A 2JRIB 4E71A 1X1MA 3DHHC 4WJPA 3I57A 4IDIA 4BAXA 3PHXB 4KSLC 2XK5B 1L0VB 2IO1B 4M8NA 1FD6A 1MPEA 3VAWA 2WDRB 3BVMA 2PIAA 2D5GA 3SR6A 3ZO5B 5HG2A 4K7UA 4MELA 2E6XA 1XLOA 2N9PC 1FPYA 3NVWA 4GDKA 3ECIA 4MEMA 4HPLB 5HHDG 3VR9B 1VRAB 4C4VA 2BQQA 2FIDA 2BB6A 3PO0A 3GP7A 2KDMA 2BW2A 5HI1A 1WGHA 2C60A 1T0SC 4DHJD 1L7YA 4DK5A 3MTNB 4EZKA 4KGTA 1HA5A 3URYA 2AEHA 3DBHI 1ZXHA 2N9XA 1EUVB 2QCZA 3JSVB 1XD3B 1IBXA 1PGXA 3K9PB 1D5MC 3B08A 3AE3B 2RDHA 3V60A 2HTME 2MEKA 3BVZA 2Y5PA 3M95A 2PE6B 5BMGA 5CHFA 1PYWD 3QIJA 4TKNA 2INDC 1WR1A 2WNMA 1XEEA 3L4PA 2K6DB 2AL6A 4AWJA 4PS3A 1TS3A 2PJHA 3IG3A 4E3CA 3AEFB 3NRZA 4NQLB 4D2KA 5EE1A 4ZHOA 1VDVA 1T5XD 3SU8X 3R8BA 1PGAA 4NNJB 1AN8A 2IGHA 1C78A 1YNTE 1ZGUB 3VRAB 1A70A 1QKZA 2WX0A 1V6EA 1HEZE 1K51A 3W1YA 2W54A 3VH4B 3B9JA 1FO4A 1WIAA 4W9DA 2D2QA 3UINB 1IUEA 3L17A 2HJ8A 4CHKA 2KQ4X 1L0YB 1T0YA 1V49A 4HCNB 2J7QB 4IM2A 3GZNB 3KWVA 2IO3B 5MPOA 1YQ3B 1FFVA 3N32A 3A9KB 4HPMB 4KX6B 1P7FA 1E8WA 3B2GA 4XC2A 3ZNHB 1NYQA 1AARA 3NS8A 2WXLA 3IT4B 3GE8C 2LXAA 3DQVA 5EE0A 2QEJC 4RCOA 1BMLC 2W55A 1NI3A 3KUZA 4IWOA 2OHFA 3JW0X 1VR9A 1WXMA 3GOEA 4HLEA 4WQOB 2G3QB 5C1ZA 4PK1A 3L0WB 3L10B 4IC7B 4EKUA 2IBIB 3Q8FA 2K8CA 3TEYA 2DWQA 3ZDMC 3FKYA 1E8XA 2J53A 2JF5A 3ML8A 3S2AA 2CJNA 4ARIA 1FXTB 2DZIA 4IOIE 2WXHA 3GS2A 4FXCA 5FR3A 3KQ4A 1TY2A 1TTNA 1WXVA 5CTRC 1GC7A 4A8XC 2LVQA 2JZ3B 1VJKA 2SEBD 2J42A 3W9CB 2MLBA 3A9KA 3ZJUA 2K25A 1V2YA 4WJOA 1D4BA 2BPSA 3TEXA 2KDEB 4BKGA 1JROA 3ZLZA 2ACZB 1F9JA 5KHOA 1GUAB 1XF5L 3N20C 1EWCA 4NPNA 3W5UB 1HTQA 3VRBB 4S0RA 3V05A 3N30A 4RM9A 3MC0B 4KDIC 2RPQA 3O65B 1SE2A 3A33B 3RZFA 3OWEB 4A6QA 1TZOA 2MSED 1KRHA 1KLGD 3DBRI 1H4RA 3IT6B 3QHTA 2ZCCA 5HKHA 2KN5A 3N1YC 5FR6A 1I35A 3AE6B 1JRUA 2PTLA 3KLSX 1JWAD 2R2QA 2ZNVC 1WYWB 1KLUD 4C7ZA 4GLSC 4MGIE 2BYEA 1WGYA 2BYTA 1SGHA 4I6NB 2IY1B 1WF9A 2DZJA 1T0RC 4A3PA 2XNAC 3QK0A 1N5WA 5C23A 3WA0A 1AW7A 2MCNB 1JMLA 2DAJA 2KXJA 2ONQA 4AQ7A 3WANA 2WXMA 2SAKA 4REZA 1YQ4B 1UELA 1S1QB 1T6BX 4LCDE 1ZDVA 1IYFA 2Y5BB 1OQQA 3AM9A 1WZ3A 1KF6B 2QJLA 4HDQA 4MGKE 1GB4A 1V1PB 2REXA 3VHTC 3A1QB 4E74A 1UUPA 3CF6E 4FBJB 1KH0A 4EEWA 4WH4A 2KYWA 2FCNA 1YN3A 1XLNA 1UH6A 1WM2A 2ZCBA 2KVZA 2DZKA 4AP4C 3E56A 1P3QU 2BYFA 2XN9C 3RUIB 3X23A 3P4SB 4CYEA 4KGRA 4Q2JA 3Q8EA 2QC8A 3HUIA 2WXOA 3AU5A 3MFGA 2RD0A 2WXIA 3U2SC 4KIKA 1SBBB 4W9CA 4WJQA 3UGBB 1LO5D 2RMMA 2CU1A 1QZEA 3ABVB 2MQJA 3TEZA 2AQ1B 1YMHE 1YX5B 2H88B 2Q5WD 2GB1A 4N58A 4WWPA 2LFIA 4H2AA 4W9HA 2ZVOA 3SFEB 4PS7A 5KHQA 2JUOA 2K3UA 2G4SA 2QSDA 2KMAA 3MP9A 1EF5A 2KFJA 2YEPF 1TBEA 3ALBA 2KMMA 3A1QA 2EKIA 2ZW1A 2M1MA 3W2DA 4LNKA 4IM0A 3DBLB 2V9HA 1VLBA 4ITKA 5G55A 5BO4B 2LGSA 4FJZA 1MG4A 1FMAD 2L0TA 1EWYC 1VZ7A 1WX8A 3HIZA 4XDDA 2N7EA 3NG0A 2CKHB 4J3OD 1SSNA 4IG7B 4II2B 1T0QC 2KWVB 4XWWA 3LB8C 3BINA 3A4SC 2IJ0A 2LUEA 1UBIA 3B1LX 2DBYA 1FCLA 3EC8A 2L3ZA 3AMZA 4K7SA 1E7PB 1I4PA 4II3B 2KHWB 3NVVA 3HVDA 2V3SA 2EELA 2LMCA 1WE6A 1XXGA 4NAMA 3I3TB 4KVGB 4DXAB 4EOYA 2FNJB 2HDEA 2ZPNA 4BKSD 2N4FA 3RYTA 1J7BA 1S3SG 5FK9C 2BTEA 4CQNA 1R4NB 3OJ4B 4W9KA 3HHMA 3V6CB 3ZRFA 2GRIA 5T8IA 2CS4A 4JWSC 1C79A 2V1YA 2Z8LA 4N6EB 1ZP0B 2RDGA 3EGRA 2JSVX 3TUOA 4IWPA 3DWMA 2YLMA 3EUB2 2PPHA 2AYOB 2BF8B 4NJ7A 3KW5B 1Z2MA 2LGXA 3VTWA 3L13A 2V3NA 3BIID 5C2TB 1HZ5A 2J52A 1H8CA 4L2YA 4G0NB 4C4VB 4ZRIA 3KYCD 2NVUI 4DHZB 4YTNB 4NZLB 4LJOB 1RFAA 3NS1A 1CMXB 1ZXIA 3VDZA 1ZPSA 3BZDB 5L95C 5IO9A 3AXCA 3KUDB 1C76A 1RYJA 2GI9A 4KSKC 1L4ZB 1N63A 1IBXB 1TJEA 4P7IA 1WGGA 3TIXA 2DZMA 2KWCA 2VZKB 2GBJA 4HPPA 5BYQA 3AEGB 4MGYE 2AL3A 2DHZA 3PLUA 3CSFA 1EF1A 5G5GA 4EZJA 2AX5A 4HJGE 4QAYA 5G5HA 4AS1A 4PS8A 4W9IA 5AZGA 2KX0A 1E10A 4BVUC 3AN1A 2KJRA 5DPRA 3PPAA 1EU3A 1UGMA 2WLBA 5IAAC 2JWZA 4M0WB 1VZ8A 3DHGC 4XDCA 1ENFA 2KQSA 4MM3B 4PYZA 2L05A 1R7SA 2M0XA 1C3TA 5BMHA 4ICUA 1F2RI 2X38A 3IHPC 2C5LC 4G3XB 1Y56A 2JT4B 2NBVB 3QC8B 1F1HA 4ZDVA 2WXRA 5C3JB 2L0FA 1NENB 2WU2B 2WU5B 3BK1A 2E3TA 4LTUA 2W3SA 4LNFA 1E0ZA 3N9YC 2K22A 1EO6A 2QMTA 1ET9A 2FCSA 4ZYNA 1V5TA 5EE3A 1NDDA 2AQ2B 4W9FA 1YD8U 4DXFA 1JALA 2FCMA 1J19A 3CWIA 4TMAB 5AZFA 1RAXA 1PUTA 2JY6A 2WXFA 2XBBC 1I4QA 3KH0A 3E9SA 4S17A 2JYEA 2B76B 2K9XA 3KVFB 2PVOD 4M0WA 3SEBA 4M02A 3H1UA 2N7DA 4JX1C 2UU7A 2O6VB 3NUHB 1L6UA 3NOBA 4MM3A 2KLGA 2CU3A 1TY0A 3ML9A 3Q3FA 3Q8CA 2OJWA 2JQRB 4K7WA 3RNGC 3ZNID 3J9CA 1DOYA 2RGFA 2GBRA 4N59A 2N7JA 3ZNZB 1ACCA 2WXPA 1SE9A 2KACA 2N0SB 1J8CA 1UZXB 3MJ5A 2J0JA 1NBFC 3DBHB 5CHVC 1I4RA 2PLPA 4K1RB 2VRRB 2KOXA 5BYRA 3Q3JA 3DVGY 3NVYA 4YSXB 1FM0D 4OZAA 3HRDD 5J17A 1Y8RC 2MH7A 3QJZA 4MT5A 2G9HD 1VCBA 5LXIB 3UQAA 3U52E 2BS4B 1V8CA 4P6VF 3Q3OC 2DLBA 3FAHA 1K52A 1F2RC 4KV2A 5AUIA 3UIPB 2M8SA 4K3BA 3AE5B 1WMHB 3VUWA 2LHEA 4LDTD 3PRPB 1FIQA 1I42A 1J7CA 3RNFC 1R4MI 3BWUD 5J18A 2O6VA 1WH3A 3LDZE 3PSEB 5DPSA 4FJYA 1BT0A 1MJDA 1I4XA 1EU4A 3QQ8B 3PZDA 3MHZA 5IA7A 3P4PB 3VUXA 2Z0DB 2BWES 1TS5A 4ICVA 2KC2A 3HM6X 2X8XX 4BOZB 4RGNA 4HKQA 1V97A 1TZ1A 2KFKB 2NTTA 4IKGA 2D11A 2MP2A 1LGRA 2MBQA 2WXQA 2VH1A 1FEHA 2LJIA 2TSSA 3H7PA 3NZSA 4I6PA 2IDYA 4URKA 5E6OA 2KKCA 2JX5A 2KANA 4TSSA 1D5ZC 3WAOA 1NVID 2WGSA 5DPWA 1FNUA 1E9MA 1VD2A 5JHBA 1WY8A 3APCA 2WXGA 2KWDA 4F8CB 1WMHA 4TV3A 1C77A 2FAZA 1WXSA 1T3QA 1GNUA 2JRHA 2GLSA 2L1AA 4KKJA 3W1SC 3TCAA 1QT9A 3PRMB 1MHXA 4YXDB 4JGHB 3V61A 3PZ8A 1XLPA 4GU2A 3ZXRA 1C4PA 2PE9A 2UYZB 3AU4A 4XYCA 1DYQA 4GXBA 4XZ4A 4KIKB 3NJTA 2NS5A 2INNE 4ZYSA 1LM8B 4MJSB 3C8YA 1WYGA 2NBUA 2KFKA 2PVGC 2MBBB 3Q2AC 4ZRKA 2HD5B 1E90A 4RFBA 2W3RA 3L08A 2GBNA 3AE1B 3X0WA 3RMKC 2J0KA 3TBLD 4BKTA 2CHZA 2KO3A 3OAWA 1P7EA 1QOAA 1ISNA 4CO7A 4DBGA 2RDBC 1PQSA 2A5UA 1LXDA 2KD0A 4BOSC 3UQBA 2M0AA 3TL5A 4BZAA 1SJED 2NR2A 4AJYB 1UBQA 3SD5A 3R2TA 4HCPB 4YL8A 1DOXA 2V4IB 4DQOC 3TMPB 2PW9A 3FC4A 2LGIA 3P4RB 3DBRB 3P42A 3PT2B 2V0GA 1FNVA 1YN5A 2WDVB 4BKSA 2CHWA 3PGEA 4GMVA 4W9JA 3R66C 3ZUNA 1V81A 2H89B 3MHSD 4B0EA 4OZBA 1F0ZA 2KJ6A 1U4AA 4ZHPA 2M56B 4WAAA 2EMSA 2INPE 2WXJA 2WP9B 1CZPA 2GBMA 4MJSA 3GB1A 2D07B 2FUHB 4M00A 1CJEA 4C7YA 2K5PA 4ACFA 5J2RA 1I4HA 5L83A 4GGQA 1K50A 1V80A 3TJPA 2KNBA 2YVCA 2G1EA 4WWNA 4BBNC 4YT0B 3OLMD 2LRWA 1P9DU 1YX6B 2KVRA 5EDSA 3OG5A 2JVCA 4WIPA 1HQRD 1A5RA 2AWTA 5G2NA 4JPSA 4OVUA 4FHKA 1CK1A 3ZIMA 4DHJB 1IGDA 3Q6BA 4HEA1 2DNFA 4RMAA 3ZW3A 1WXQA 3Q8BA 1OQRA 2W82A 2KX3A 4BBNF 1FXAA 1JWBD 5D6JB 1WSPA 1ZOYB 3U4EG 3VH3B 2WHIA 3Q14C 2N9EB 3RPFC 4TUUA 4YSYB 1FNWA 1HZ6A 3RI7C 2KC1A 3M63B 3LYYA 5E6NA 1LFDA 3IFWB 4PYUA 1YN4A 4GDLB 1VZ6A 2Z0EB 5D3DA 4UDUC 2LHDA 4C80A 2O2VB 4OVZA 1WJNA 1ESFA 3BK2A 5CHWA 1KLVA 4HRSA 4HWIB 2IO0B 3RT3B 2K8BA 3ZNGC 2G4DB 4G11A 3W5VB 3V62A 2L00B 3EHVA 3QWZB 4L23A 1AYFA 2LZ6A 5LXHA 3ZKJC 4ZOHC 1ET6A 2GBKA 2LJ5A 2FCQA 2KLCA 3HVZA 2LRUA 3M3JA 1OEYJ 1IGCA 1B1ZA 3CSTA 2L7RA 4ZRPA 3AE2B 3ZQ4A 3ZJVA 4EZLA 1UWXA 1PGBA 4DDID 4YSZB 3APDA 1KM7A 3NZ3A 1M94A 3IXSA 1TGZB 3MC9A 4JE3B 2BS3B 2D3BA 3RNAC 4JQWC 2Y3AA 4FHJA 2W9NA 5H8YE 1SEBD 2PMVA 3WAMA 4A20A 2DYBA 4P16A 3L16A 3AE9B 4KGSA 3P4QB 4B0MA 4GDLA 2WXKA 4JIOU 1V86A 2DX5B 1N62A 4XX5A 1FCCC 4WWMA 2O2VA 2D3AA 4F7ZA 2KDIA 1JW9D 2IPKD 3U8ZA 2NBWB 2ZJDA 1WGRA 5AEKB 1HXYD 4LDTB 3RCZA 4MH8A 1J7AA 5DCNA 3IAS1 1GJZA 4ANWA 2M4NA 2KWUB 5D3IB 1J0GA 5IKCM 2K0PA 4B95A 2XEWA 1IPGA 4KKIA 1F52A 3CIRB 1WM3A 2GOWA 2AQ3B 4NY0A 4OZCA 3PHWB 3AV8A 3WAPA 2I38A 2I1KA 1JCKB 1YJIA 2WS3B 4LNIA 1WJ6A 4K81A 2MJDA 5AUKA 3IAM1 1GG3A 2EMTA 1OQYA 4ARCA 1WXAA 1OEYA 3HM3A 2ZEQA 1KJTA 3UI3A 3AECB 1MVKA 2GMIC 1FXIA 1TKGA 1E6EB 3DPDA 1OGWA 2WX1A 1HE8A 3NHEB 3VFKA 4DWFA 4RF1A 3RNEC 2KAJA 3P1MA 1OTRB 2WXNA 4FADA 3ZDTA 3Q3NC 4O1NA 1WFYA 1WGKA 2ZPYA 3MC8A 3R3MA 4GSWA 3AH7A 1WR6E 1FRRA 1P0RA 3VTVA 3P2BA 1D6EC 1SIJA
chains in the Genus database with same CATH topology
4AP4C 2I1JA 4BOZB 4GIVA 3IBEA 1XQQA 1P3QU 3D32A 2RR9A 3H7SA 2BYFA 2NCNA 3RUIB 3X23A 1TZ1A 3RZWC 2KFKB 3GZNI 2D11A 1P1AA 4GOCA 4JL9A 2WDTB 4MGZE 5E6PA 2MP2A 4CYEA 2R2OA 2MBQA 4MH0E 3AU5A 3DOWA 1L2NA 2RD0A 3H7PA 3NZSA 4I6PA 4KIKA 2A4ZA 4W9CA 3APFA 4GN1A 3ENEA 4WJQA 3UGBB 1KOTA 3A4RA 2CU1A 3AI5A 5LLIA 1QZEA 5E6OA 2KK8A 4URKA 2KKCA 2BWFA 2KANA 2MQJA 3VUYA 3WAOA 1YX5B 2KDBA 2FIFA 4WWPA 5DPWA 3SDLC 3R7QA 4F1SA 4GDKB 1VD2A 1WX7A 4W9HA 5JHBA 1WY8A 5TR5A 2ZVOA 3APCA 4KZ0A 3N3KB 2XK5A 4F8CB 4PS7A 1WMHA 4TV3A 5KHQA 2CR5A 2LXCA 2MBHA 3VXWA 2JUOA 2G4SA 2HE7A 1E5WA 5GMVA 2J0MA 2FAZA 1Q0WB 4MSQB 4NJ6A 2KMAA 5D94A 3RD2A 1WXSA 1UD7A 1EF5A 1GNUA 2JRHA 2KFJA 4HVBA 3W1SC 1TBEA 3TCAA 3ALBA 2L76A 2JZZA 3A1QA 3PRMB 2BKRB 3VVWB 2MA9B 2M1MA 4JLCA 3PRZA 4JGHB 4AJWA 3AULA 4ZRJA 2V4LA 4IM0A 3V61A 2WWZA 2HTHA 3KUCB 4GU2A 3PV1A 2MP2B 3DDCB 4N9F4 2PE9A 2UYZB 3AU4A 5G55A 5BO4B 3SHQA 1RRBA 4FJZA 2K1FA 3QARA 4GXBA 4I6LB 2IZVB 2L0TA 4XZ4A 3H7PB 4G50A 4KIKB 3IVFA 4NQKE 1WX8A 2NS5A 2WYQA 1WI0A 3HIZA 5JHAA 2N7EA 4IW0A 4A3OA 2CKHB 1Q1OA 4IG7B 3JVZX 2KJHB 2DYOA 2LVOA 1LM8B 4II2B 4MJSB 2IY0B 2KWVB 2ZZPB 2NBUA 4EUTA 2KFKA 3JSVA 2MBBB 3BINA 3A4SC 1ZW7A 2JRIB 2KDFB 4ZRKA 2MBOA 2LUEA 1Q5WB 1X1MA 2N1VA 4E71A 1UBIA 2HD5B 1E90A 3B1LX 4WJPA 3PS6A 3L08A 2C7MB 2GBNA 4LJPB 3PHXB 4KSLC 3X0WA 2XK5B 2IO1B 3H6NA 2K39A 4M8NA 2J0KA 3TBLD 3WALA 4BKTA 3EC8A 3ZTCA 2L3ZA 4K7SA 2OJRA 2CHZA 2KO3A 3OAWA 4II3B 2KHWB 1ISNA 5AZHA 4CO7A 2KQ7A 3VAWA 4DBGA 1E8ZA 1PQSA 2A5UA 2V3SA 4IUMB 1LXDA 2KD0A 1WE6A 3DBSA 4BOSC 4HJKA 3ZO5B 3TL5A 4K7UA 3I3TB 4DHZE 3UQBA 4MELA 4KVGB 3ZTDA 2NR2A 4AJYB 4DXAB 4EOYA 2FNJB 2N9PC 2ZPNA 4GDKA 3ECIA 4J6IA 4HPLB 1UBQA 4MEMA 4BKSD 1XT9B 3SD5A 1E7VA 2N4FA 3JYUA 4HCPB 4YL8A 3TMPB 1SIFA 2Z59B 3KYDD 3RYTA 2FIDA 1S3SG 1K8RB 3OJ4B 3PT2B 4ANUA 4W9KA 3HHMA 3V6CB 3ZRFA 1WGHA 4WWOA 2C60A 4DHJD 1L7YA 4M8MA 4DK5A 4BKSA 2CS4A 3MTNB 4EZKA 1Z5SB 2CHWA 2V1YA 2LI5A 3PGEA 4GMVA 3PREA 4W9JA 3PVLA 2AEHA 3DBHI 2N9XA 1V81A 3R66C 3ZUNA 3MHSD 4IWPA 1EUVB 4AOFA 3U30A 3JSVB 1WJUA 1XD3B 3UIOB 2YLMA 2KJ6A 1U4AA 3K9PB 3BY4B 4WAAA 2EMSA 3B08A 2MW5A 2PPHA 3EECA 2AYOB 2BF8B 3RULA 2C9WB 3PLVA 4NJ7A 4AUQC 3V60A 3KW5B 2ZNVB 2G45B 2DENB 2GBMA 1Z2MA 2LGXA 1MG8A 3M95A 3VTWA 3L13A 2PE6B 4MJSA 5CHFA 3QIJA 4TKNA 1WR1A 1V9JA 2D07B 3WIMA 2FUHB 2K6DB 5D7GA 2AL6A 5J2RA 4AWJA 2M17A 4PS3A 5L83A 4GGQA 2BKFA 1H8CA 2PJHA 1V80A 2C7HA 3TJPA 4G0NB 3IG3A 2KNBA 2YVCA 4E3CA 4ZRIA 3KYCD 4NQLB 4WWNA 4BBNC 2MWSB 3OJ3A 2NVUI 4HDOA 4DHZB 3OLMD 2LRWA 3K9OB 1P9DU 2NPTB 1YX6B 3QAQA 4ICVA 1RFAA 2KVRA 4LJOB 3R7RA 1CMXB 3SU8X 5EDSA 1WGDA 2LGDA 4NNJB 3VDZA 1ZGUB 3PTFC 3VTUA 4FA6A 5L95C 3AXCA 2JVCA 3KUDB 4KSKC 1A5RA 2AWTA 5G2NA 4OVUA 4FHKA 2LWPA 1V6EA 2WX0A 4P7IA 3ZIMA 4DHJB 3QA8A 1WGGA 3W1YA 3TIXA 3VH4B 4RMAA 3ZW3A 2DZMA 2N1WA 2KWCA 1WIAA 2IO2B 2MBEA 1LQBA 2K8HA 4W9DA 2D2QA 4EFOA 2GBJA 1D3ZA 2KX3A 4NAWB 3UINB 4BBNF 3L17A 5D6JB 4MGYE 2AL3A 2HJ8A 4CHKA 1T0YA 1V49A 2DHZA 1WRDB 3LJ3A 2J7QB 3PLUA 4HCNB 3CSFA 4IM2A 1EF1A 3VH3B 4EZJA 2IO3B 3W1SA 2N9EB 4ANVA 3N32A 4TUUA 3A9KB 4HPMB 4PS8A 4W9IA 5JH5C 4FULA 5AZGA 2KZRA 1E8WA 2KX0A 4XC2A 2KC1A 3M63B 3T8MA 2ASQA 3ZNHB 4FLHA 3U7DA 1AARA 3MJWA 5E6NA 1LFDA 3NS8A 3IFWB 4BVUC 4PYUA 3B0AA 3DVGX 2KJRA 5DPRA 3PPAA 1UGMA 2LXAA 4HK2A 4GDLB 2Z0EB 3DQVA 5IAAC 2JWZA 4M0WB 2O2VB 3DVNV 4FJVB 1WJNA 3KUZA 5CHWA 1KLVA 4B6WA 2KQSA 4IWOA 3JW0X 4HWIB 2IO0B 4PYZA 2L05A 3RT3B 1WXMA 5CX3A 2O6VD 2K8BA 2M0XA 3GOEA 2G4DB 3ZNGC 4HLEA 1ZKHA 4G11A 2DAFA 1C3TA 4WQOB 1P98A 3NZUA 3V62A 2L00B 3EHVA 3QWZB 2G3QB 4ICUA 3ZVVA 5C1ZA 3L0WB 3L10B 2LZ6A 3L54A 4IC7B 3IHPC 4EKUA 5LXHA 2IBIB 2IYDB 3ZKJC 2C5LC 1YQBA 2NPTA 2K8CA 2GBKA 4G3XB 2MX2A 2LJ5A 3ZDMC 2FCQA 2KLCA 1E8XA 2LRUA 3M3JA 1OEYJ 2JT4B 1C1YB 2NBVB 3QC8B 4TQ0A 2JF5A 4ZDVA 3ML8A 4IM3A 3S2AA 2L0FA 3CSTA 3UF8A 3DBLI 3DVNU 2L7RA 1FXTB 2DZIA 2LASA 2DZKA 4EZLA 4FN2A 4ANXA 4DDGD 4DDID 1G6JA 1TTNA 3APDA 1KM7A 1WXVA 3NY5A 4NAWA 1EO6A 1M94A 5CTRC 2FCSA 4ZYNA 1GC7A 3A9JB 1WZ0A 1TGZB 1V5TA 4W9LA 2LVQA 1NDDA 2JXXA 2JZ3B 3EFUA 4W9FA 2C7NB 2KTRB 4JQWC 1YD8U 1YJ1A 4FHJA 2W9NA 2BGFA 2FCMA 2MLBA 1J19A 2L8JA 3A9KA 3C0RB 5D2MB 2K25A 1V2YA 4WJOA 3ZRCA 2BPSA 2KDEB 3WAMA 5AZFA 2DYBA 3M62B 4A20A 1GC6A 4BKGA 3V6EB 3L16A 1RAXA 2JY6A 1WX9A 2XBBC 3ZLZA 3KH0A 1F9JA 5KHOA 5DPTA 1GUAB 2B3AA 4NPNA 4OVVA 1IP9A 4GDLA 4JIOU 1V86A 2DX5B 3KVFB 1E7UA 4HXDA 4XX5A 2O2VA 4F7ZA 2KDIA 3N30A 3H1UA 2N7DA 4RM9A 3U8ZA 2NBWB 4KDIC 2O6VB 2ZJDA 2RPQA 2ZVNA 1WGRA 3O65B 3A33B 5AEKB 3NOBA 3RZFA 4MM3A 4LDTB 2KLGA 3RCZA 3ML9A 3Q3FA 5DCNA 3T9LA 2MSED 4IWQA 1YIWA 3DBRI 4K7WA 1R4NI 2D3GA 3ZNID 1H4RA 4BFRA 3QX1A 1GJZA 3QHTA 2LGYA 4ANWA 2RGFA 2M4NA 2GBRA 2KWUB 2ZCCA 2KN5A 5HKHA 2CHXA 3ZNZB 1RLFA 1J0GA 4B95A 2UWQA 2MRPA 1WE7A 5FR6A 1SE9A 3CMMB 2XEWA 4KZCA 1I35A 2PEAA 3H9DA 4W9GA 1IPGA 1JRUA 4B9KA 5JZEB 1UZXB 1J8CA 2J0JA 3VQIA 1NBFC 5CHVC 1WM3A 2EKEC 2GOWA 4K1RB 4NY0A 2VRRB 3PHWB 2KOXA 2R2QA 1WYWB 2ZNVC 3Q3JA 3WAPA 2QHOA 4MGIE 3DVGY 1E8YA 2BYEA 3ONSA 2I1KA 1WGYA 4W9EA 2JPHA 3DCGA 1SGHA 5J17A 4I6NB 2IY1B 1Y8RC 1WJ6A 1WF9A 3QJZA 2DZJA 2RSUA 4K81A 4A3PA 3A9JA 3QK0A 1VCBA 5LXIB 1GG3A 2EMTA 2KTRA 1OQYA 5C23A 3WA0A 3UQAA 1WXAA 1OEYA 2MCNB 3HM3A 4X57B 4MSMB 2DAJA 2ZEQA 2KXJA 3WANA 2KMCA 2LVPA 1KJTA 1UELA 2DYMA 2OOBB 4KV2A 4RM8A 2GMIC 1S1QB 4LCDE 3UIPB 2M8SA 3QCAA 1WMHB 3VUWA 4LDTD 4ASWC 2BYVE 3PRPB 1IYFA 2Y5BB 1WZ3A 2LD9A 3DPDA 1OGWA 1I42A 2WX1A 1R4MI 4HDQA 4WJNA 1HE8A 4KDLB 4MGKE 5J18A 3NHEB 4GB9A 3VFKA 4DWFA 2REXA 3HK0A 3VHTC 3A1QB 4E74A 1OTRB 2O6VA 1WH3A 3LDZE 3ZDTA 4FADA 2K6QA 3CF6E 4FBJB 2D10A 3PSEB 4EEWA 1WFYA 2KTFA 2ZPYA 3R3MA 4FJYA 1BT0A 4GSWA 4TQ1A 5DPSA 2FCNA 3QQ8B 1WR6E 1WJ4A 3PZDA 5IA7A 3VUXA 1P0RA 4MDKE 3VTVA 1UH6A 2Z0DB 2BWES 1WM2A 3P2BA 2ZCBA 1NI2A 2KC2A 1V5OA 3HM6X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AP4 C;  2I1J A;  4BOZ B;  4GIV A;  3IBE A;  1XQQ A;  1P3Q U;  3D32 A;  2RR9 A;  3H7S A;  2BYF A;  2NCN A;  3RUI B;  3X23 A;  1TZ1 A;  3RZW C;  2KFK B;  3GZN I;  2D11 A;  1P1A A;  4GOC A;  4JL9 A;  2WDT B;  4MGZ E;  5E6P A;  2MP2 A;  4CYE A;  2R2O A;  2MBQ A;  4MH0 E;  3AU5 A;  3DOW A;  1L2N A;  2RD0 A;  3H7P A;  3NZS A;  4I6P A;  4KIK A;  2A4Z A;  4W9C A;  3APF A;  4GN1 A;  3ENE A;  4WJQ A;  3UGB B;  1KOT A;  3A4R A;  2CU1 A;  3AI5 A;  5LLI A;  1QZE A;  5E6O A;  2KK8 A;  4URK A;  2KKC A;  2BWF A;  2KAN A;  2MQJ A;  3VUY A;  3WAO A;  1YX5 B;  2KDB A;  2FIF A;  4WWP A;  5DPW A;  3SDL C;  3R7Q A;  4F1S A;  4GDK B;  1VD2 A;  1WX7 A;  4W9H A;  5JHB A;  1WY8 A;  5TR5 A;  2ZVO A;  3APC A;  4KZ0 A;  3N3K B;  2XK5 A;  4F8C B;  4PS7 A;  1WMH A;  4TV3 A;  5KHQ A;  2CR5 A;  2LXC A;  2MBH A;  3VXW A;  2JUO A;  2G4S A;  2HE7 A;  1E5W A;  5GMV A;  2J0M A;  2FAZ A;  1Q0W B;  4MSQ B;  4NJ6 A;  2KMA A;  5D94 A;  3RD2 A;  1WXS A;  1UD7 A;  1EF5 A;  1GNU A;  2JRH A;  2KFJ A;  4HVB A;  3W1S C;  1TBE A;  3TCA A;  3ALB A;  2L76 A;  2JZZ A;  3A1Q A;  3PRM B;  2BKR B;  3VVW B;  2MA9 B;  2M1M A;  4JLC A;  3PRZ A;  4JGH B;  4AJW A;  3AUL A;  4ZRJ A;  2V4L A;  4IM0 A;  3V61 A;  2WWZ A;  2HTH A;  3KUC B;  4GU2 A;  3PV1 A;  2MP2 B;  3DDC B;  4N9F 4;  2PE9 A;  2UYZ B;  3AU4 A;  5G55 A;  5BO4 B;  3SHQ A;  1RRB A;  4FJZ A;  2K1F A;  3QAR A;  4GXB A;  4I6L B;  2IZV B;  2L0T A;  4XZ4 A;  3H7P B;  4G50 A;  4KIK B;  3IVF A;  4NQK E;  1WX8 A;  2NS5 A;  2WYQ A;  1WI0 A;  3HIZ A;  5JHA A;  2N7E A;  4IW0 A;  4A3O A;  2CKH B;  1Q1O A;  4IG7 B;  3JVZ X;  2KJH B;  2DYO A;  2LVO A;  1LM8 B;  4II2 B;  4MJS B;  2IY0 B;  2KWV B;  2ZZP B;  2NBU A;  4EUT A;  2KFK A;  3JSV A;  2MBB B;  3BIN A;  3A4S C;  1ZW7 A;  2JRI B;  2KDF B;  4ZRK A;  2MBO A;  2LUE A;  1Q5W B;  1X1M A;  2N1V A;  4E71 A;  1UBI A;  2HD5 B;  1E90 A;  3B1L X;  4WJP A;  3PS6 A;  3L08 A;  2C7M B;  2GBN A;  4LJP B;  3PHX B;  4KSL C;  3X0W A;  2XK5 B;  2IO1 B;  3H6N A;  2K39 A;  4M8N A;  2J0K A;  3TBL D;  3WAL A;  4BKT A;  3EC8 A;  3ZTC A;  2L3Z A;  4K7S A;  2OJR A;  2CHZ A;  2KO3 A;  3OAW A;  4II3 B;  2KHW B;  1ISN A;  5AZH A;  4CO7 A;  2KQ7 A;  3VAW A;  4DBG A;  1E8Z A;  1PQS A;  2A5U A;  2V3S A;  4IUM B;  1LXD A;  2KD0 A;  1WE6 A;  3DBS A;  4BOS C;  4HJK A;  3ZO5 B;  3TL5 A;  4K7U A;  3I3T B;  4DHZ E;  3UQB A;  4MEL A;  4KVG B;  3ZTD A;  2NR2 A;  4AJY B;  4DXA B;  4EOY A;  2FNJ B;  2N9P C;  2ZPN A;  4GDK A;  3ECI A;  4J6I A;  4HPL B;  1UBQ A;  4MEM A;  4BKS D;  1XT9 B;  3SD5 A;  1E7V A;  2N4F A;  3JYU A;  4HCP B;  4YL8 A;  3TMP B;  1SIF A;  2Z59 B;  3KYD D;  3RYT A;  2FID A;  1S3S G;  1K8R B;  3OJ4 B;  3PT2 B;  4ANU A;  4W9K A;  3HHM A;  3V6C B;  3ZRF A;  1WGH A;  4WWO A;  2C60 A;  4DHJ D;  1L7Y A;  4M8M A;  4DK5 A;  4BKS A;  2CS4 A;  3MTN B;  4EZK A;  1Z5S B;  2CHW A;  2V1Y A;  2LI5 A;  3PGE A;  4GMV A;  3PRE A;  4W9J A;  3PVL A;  2AEH A;  3DBH I;  2N9X A;  1V81 A;  3R66 C;  3ZUN A;  3MHS D;  4IWP A;  1EUV B;  4AOF A;  3U30 A;  3JSV B;  1WJU A;  1XD3 B;  3UIO B;  2YLM A;  2KJ6 A;  1U4A A;  3K9P B;  3BY4 B;  4WAA A;  2EMS A;  3B08 A;  2MW5 A;  2PPH A;  3EEC A;  2AYO B;  2BF8 B;  3RUL A;  2C9W B;  3PLV A;  4NJ7 A;  4AUQ C;  3V60 A;  3KW5 B;  2ZNV B;  2G45 B;  2DEN B;  2GBM A;  1Z2M A;  2LGX A;  1MG8 A;  3M95 A;  3VTW A;  3L13 A;  2PE6 B;  4MJS A;  5CHF A;  3QIJ A;  4TKN A;  1WR1 A;  1V9J A;  2D07 B;  3WIM A;  2FUH B;  2K6D B;  5D7G A;  2AL6 A;  5J2R A;  4AWJ A;  2M17 A;  4PS3 A;  5L83 A;  4GGQ A;  2BKF A;  1H8C A;  2PJH A;  1V80 A;  2C7H A;  3TJP A;  4G0N B;  3IG3 A;  2KNB A;  2YVC A;  4E3C A;  4ZRI A;  3KYC D;  4NQL B;  4WWN A;  4BBN C;  2MWS B;  3OJ3 A;  2NVU I;  4HDO A;  4DHZ B;  3OLM D;  2LRW A;  3K9O B;  1P9D U;  2NPT B;  1YX6 B;  3QAQ A;  4ICV A;  1RFA A;  2KVR A;  4LJO B;  3R7R A;  1CMX B;  3SU8 X;  5EDS A;  1WGD A;  2LGD A;  4NNJ B;  3VDZ A;  1ZGU B;  3PTF C;  3VTU A;  4FA6 A;  5L95 C;  3AXC A;  2JVC A;  3KUD B;  4KSK C;  1A5R A;  2AWT A;  5G2N A;  4OVU A;  4FHK A;  2LWP A;  1V6E A;  2WX0 A;  4P7I A;  3ZIM A;  4DHJ B;  3QA8 A;  1WGG A;  3W1Y A;  3TIX A;  3VH4 B;  4RMA A;  3ZW3 A;  2DZM A;  2N1W A;  2KWC A;  1WIA A;  2IO2 B;  2MBE A;  1LQB A;  2K8H A;  4W9D A;  2D2Q A;  4EFO A;  2GBJ A;  1D3Z A;  2KX3 A;  4NAW B;  3UIN B;  4BBN F;  3L17 A;  5D6J B;  4MGY E;  2AL3 A;  2HJ8 A;  4CHK A;  1T0Y A;  1V49 A;  2DHZ A;  1WRD B;  3LJ3 A;  2J7Q B;  3PLU A;  4HCN B;  3CSF A;  4IM2 A;  1EF1 A;  3VH3 B;  4EZJ A;  2IO3 B;  3W1S A;  2N9E B;  4ANV A;  3N32 A;  4TUU A;  3A9K B;  4HPM B;  4PS8 A;  4W9I A;  5JH5 C;  4FUL A;  5AZG A;  2KZR A;  1E8W A;  2KX0 A;  4XC2 A;  2KC1 A;  3M63 B;  3T8M A;  2ASQ A;  3ZNH B;  4FLH A;  3U7D A;  1AAR A;  3MJW A;  5E6N A;  1LFD A;  3NS8 A;  3IFW B;  4BVU C;  4PYU A;  3B0A A;  3DVG X;  2KJR A;  5DPR A;  3PPA A;  1UGM A;  2LXA A;  4HK2 A;  4GDL B;  2Z0E B;  3DQV A;  5IAA C;  2JWZ A;  4M0W B;  2O2V B;  3DVN V;  4FJV B;  1WJN A;  3KUZ A;  5CHW A;  1KLV A;  4B6W A;  2KQS A;  4IWO A;  3JW0 X;  4HWI B;  2IO0 B;  4PYZ A;  2L05 A;  3RT3 B;  1WXM A;  5CX3 A;  2O6V D;  2K8B A;  2M0X A;  3GOE A;  2G4D B;  3ZNG C;  4HLE A;  1ZKH A;  4G11 A;  2DAF A;  1C3T A;  4WQO B;  1P98 A;  3NZU A;  3V62 A;  2L00 B;  3EHV A;  3QWZ B;  2G3Q B;  4ICU A;  3ZVV A;  5C1Z A;  3L0W B;  3L10 B;  2LZ6 A;  3L54 A;  4IC7 B;  3IHP C;  4EKU A;  5LXH A;  2IBI B;  2IYD B;  3ZKJ C;  2C5L C;  1YQB A;  2NPT A;  2K8C A;  2GBK A;  4G3X B;  2MX2 A;  2LJ5 A;  3ZDM C;  2FCQ A;  2KLC A;  1E8X A;  2LRU A;  3M3J A;  1OEY J;  2JT4 B;  1C1Y B;  2NBV B;  3QC8 B;  4TQ0 A;  2JF5 A;  4ZDV A;  3ML8 A;  4IM3 A;  3S2A A;  2L0F A;  3CST A;  3UF8 A;  3DBL I;  3DVN U;  2L7R A;  1FXT B;  2DZI A;  2LAS A;  2DZK A;  4EZL A;  4FN2 A;  4ANX A;  4DDG D;  4DDI D;  1G6J A;  1TTN A;  3APD A;  1KM7 A;  1WXV A;  3NY5 A;  4NAW A;  1EO6 A;  1M94 A;  5CTR C;  2FCS A;  4ZYN A;  1GC7 A;  3A9J B;  1WZ0 A;  1TGZ B;  1V5T A;  4W9L A;  2LVQ A;  1NDD A;  2JXX A;  2JZ3 B;  3EFU A;  4W9F A;  2C7N B;  2KTR B;  4JQW C;  1YD8 U;  1YJ1 A;  4FHJ A;  2W9N A;  2BGF A;  2FCM A;  2MLB A;  1J19 A;  2L8J A;  3A9K A;  3C0R B;  5D2M B;  2K25 A;  1V2Y A;  4WJO A;  3ZRC A;  2BPS A;  2KDE B;  3WAM A;  5AZF A;  2DYB A;  3M62 B;  4A20 A;  1GC6 A;  4BKG A;  3V6E B;  3L16 A;  1RAX A;  2JY6 A;  1WX9 A;  2XBB C;  3ZLZ A;  3KH0 A;  1F9J A;  5KHO A;  5DPT A;  1GUA B;  2B3A A;  4NPN A;  4OVV A;  1IP9 A;  4GDL A;  4JIO U;  1V86 A;  2DX5 B;  3KVF B;  1E7U A;  4HXD A;  4XX5 A;  2O2V A;  4F7Z A;  2KDI A;  3N30 A;  3H1U A;  2N7D A;  4RM9 A;  3U8Z A;  2NBW B;  4KDI C;  2O6V B;  2ZJD A;  2RPQ A;  2ZVN A;  1WGR A;  3O65 B;  3A33 B;  5AEK B;  3NOB A;  3RZF A;  4MM3 A;  4LDT B;  2KLG A;  3RCZ A;  3ML9 A;  3Q3F A;  5DCN A;  3T9L A;  2MSE D;  4IWQ A;  1YIW A;  3DBR I;  4K7W A;  1R4N I;  2D3G A;  3ZNI D;  1H4R A;  4BFR A;  3QX1 A;  1GJZ A;  3QHT A;  2LGY A;  4ANW A;  2RGF A;  2M4N A;  2GBR A;  2KWU B;  2ZCC A;  2KN5 A;  5HKH A;  2CHX A;  3ZNZ B;  1RLF A;  1J0G A;  4B95 A;  2UWQ A;  2MRP A;  1WE7 A;  5FR6 A;  1SE9 A;  3CMM B;  2XEW A;  4KZC A;  1I35 A;  2PEA A;  3H9D A;  4W9G A;  1IPG A;  1JRU A;  4B9K A;  5JZE B;  1UZX B;  1J8C A;  2J0J A;  3VQI A;  1NBF C;  5CHV C;  1WM3 A;  2EKE C;  2GOW A;  4K1R B;  4NY0 A;  2VRR B;  3PHW B;  2KOX A;  2R2Q A;  1WYW B;  2ZNV C;  3Q3J A;  3WAP A;  2QHO A;  4MGI E;  3DVG Y;  1E8Y A;  2BYE A;  3ONS A;  2I1K A;  1WGY A;  4W9E A;  2JPH A;  3DCG A;  1SGH A;  5J17 A;  4I6N B;  2IY1 B;  1Y8R C;  1WJ6 A;  1WF9 A;  3QJZ A;  2DZJ A;  2RSU A;  4K81 A;  4A3P A;  3A9J A;  3QK0 A;  1VCB A;  5LXI B;  1GG3 A;  2EMT A;  2KTR A;  1OQY A;  5C23 A;  3WA0 A;  3UQA A;  1WXA A;  1OEY A;  2MCN B;  3HM3 A;  4X57 B;  4MSM B;  2DAJ A;  2ZEQ A;  2KXJ A;  3WAN A;  2KMC A;  2LVP A;  1KJT A;  1UEL A;  2DYM A;  2OOB B;  4KV2 A;  4RM8 A;  2GMI C;  1S1Q B;  4LCD E;  3UIP B;  2M8S A;  3QCA A;  1WMH B;  3VUW A;  4LDT D;  4ASW C;  2BYV E;  3PRP B;  1IYF A;  2Y5B B;  1WZ3 A;  2LD9 A;  3DPD A;  1OGW A;  1I42 A;  2WX1 A;  1R4M I;  4HDQ A;  4WJN A;  1HE8 A;  4KDL B;  4MGK E;  5J18 A;  3NHE B;  4GB9 A;  3VFK A;  4DWF A;  2REX A;  3HK0 A;  3VHT C;  3A1Q B;  4E74 A;  1OTR B;  2O6V A;  1WH3 A;  3LDZ E;  3ZDT A;  4FAD A;  2K6Q A;  3CF6 E;  4FBJ B;  2D10 A;  3PSE B;  4EEW A;  1WFY A;  2KTF A;  2ZPY A;  3R3M A;  4FJY A;  1BT0 A;  4GSW A;  4TQ1 A;  5DPS A;  2FCN A;  3QQ8 B;  1WR6 E;  1WJ4 A;  3PZD A;  5IA7 A;  3VUX A;  1P0R A;  4MDK E;  3VTV A;  1UH6 A;  2Z0D B;  2BWE S;  1WM2 A;  3P2B A;  2ZCB A;  1NI2 A;  2KC2 A;  1V5O A;  3HM6 X; 
#chains in the Genus database with same CATH topology
 2I1J A;  2HJ1 A;  1SF0 A;  1XQQ A;  1QOG A;  1UWM A;  2RR9 A;  3H7S A;  5I4D A;  3RZW C;  3GZN I;  1P1A A;  4GOC A;  3P63 A;  3ZJT A;  5LNK 1;  4A90 A;  3AE4 B;  1HTO A;  2A4Z A;  3RN9 C;  1PDX A;  3A4R A;  3TEW A;  2KK8 A;  2BWF A;  3AE7 B;  2KDB A;  2FIF A;  3ZYY X;  2L83 A;  1TT5 B;  3SDL C;  1TKE A;  4F1S A;  3RFZ B;  1MI0 A;  1KTK A;  1WX7 A;  1Q10 A;  5TR5 A;  2MHJ A;  3T3O A;  3N3K B;  2XK5 A;  3RNB C;  2KN4 A;  2CR5 A;  2LXC A;  2MBH A;  3VXW A;  1L4D B;  1TIF A;  1E5W A;  5GMV A;  2J0M A;  1Q0W B;  4WQM A;  5D94 A;  2L52 A;  3ZXV A;  2D3C A;  2ICI A;  2L76 A;  2JZZ A;  4K3C A;  3VVW B;  1RWS A;  3AE8 B;  4JLC A;  2V4L A;  2HTH A;  3PV1 A;  3I63 C;  2MP2 B;  3DDC B;  1RRB A;  2K1F A;  3QAR A;  4I6L B;  3H7P B;  4XGA B;  3IVF A;  5JHA A;  1WI0 A;  4IW0 A;  4A3O A;  1Q1O A;  1JWU D;  3JVZ X;  2LVO A;  2IY0 B;  4EUT A;  3JSV A;  5IOI A;  3B2F A;  4JWU C;  3RNC C;  2KDF B;  2MBO A;  3AEB B;  1Q5W B;  2N1V A;  2NTS A;  4YTP B;  3PS6 A;  2C7M B;  4RH6 A;  4XWT A;  4LJP B;  1K53 A;  1YOV B;  2K39 A;  3H6N A;  3WAL A;  1XLQ A;  3ZTC A;  2OJR A;  5AZH A;  2KQ7 A;  1E8Z A;  4IUM B;  3BYT B;  3C19 A;  3I9V 1;  3DBS A;  4PT5 A;  4HJK A;  5H92 C;  4DHZ E;  3ZTD A;  1TKY A;  1XT9 B;  4RGT A;  1E7V A;  3JYU A;  2KT7 A;  1SIF A;  2Z59 B;  3EA6 A;  3KYD D;  2JWU A;  1K8R B;  1QF6 A;  1BUI C;  1SJH D;  4ANU A;  4WWO A;  4M8M A;  1GB1 A;  2WQY B;  1JWS D;  1Z5S B;  1GOZ A;  2LI5 A;  3PRE A;  3DWG C;  2VZK D;  3PVL A;  2N9L A;  4AOF A;  3U30 A;  1WJU A;  3UIO B;  2IGG A;  3Q8A A;  3BY4 B;  4RGO S;  4RNA A;  2MW5 A;  3EEC A;  2R61 A;  1FFU A;  3RUL A;  2C9W B;  3PLV A;  4AUQ C;  2ZNV B;  1WRI A;  2G45 B;  2DEN B;  2QDF A;  1MG8 A;  1UNS A;  3FIL B;  2BVC A;  2V3P A;  1V9J A;  3WIM A;  5D7G A;  2M17 A;  4LLG M;  3H8H A;  2BKF A;  4USA A;  3PZ7 A;  2C7H A;  2MWS B;  3OJ3 A;  2BBC A;  4HDO A;  1R4M B;  3K9O B;  3QAQ A;  2NPT B;  3R7R A;  2VH2 A;  1WGD A;  2LGD A;  3LXF A;  3PTF C;  3VTU A;  4FA6 A;  4LK0 M;  3N1Z C;  2LWP A;  3QA8 A;  4XE0 A;  3AEA B;  1QQR A;  2N1W A;  2IO2 B;  2MBE A;  1LQB A;  2K8H A;  4EFO A;  1D3Z A;  4NAW B;  2M19 A;  1ROE A;  1QOB A;  1GPX A;  1WRD B;  3LJ3 A;  1TYG B;  3W1S A;  4MAC A;  4ANV A;  2N9K A;  5JH5 C;  1V1O A;  3BVG A;  4FUL A;  2KZR A;  2JU6 X;  4A9A A;  3T8M A;  2ASQ A;  4FLH A;  3U7D A;  3MJW A;  1I7H A;  3EFC A;  3B0A A;  3DVG X;  3NVZ A;  3Q3M C;  4HK2 A;  3FIL A;  1UGJ A;  1C4A A;  1NYR A;  2WDQ B;  5GXG B;  4M01 A;  2JZP A;  3DVN V;  2BT6 A;  2YEP B;  4FJV B;  1ZUD 2;  4B6W A;  3U7Z A;  2IGD A;  1L6V A;  2O6V D;  5CX3 A;  1ZKH A;  2DAF A;  1GAQ B;  3R2I A;  1P98 A;  3NZU A;  2LUM A;  3ZVV A;  1N60 A;  3L54 A;  1B9R A;  2IYD B;  1TS4 A;  2PKO A;  1YQB A;  2NPT A;  4A55 A;  1I4G A;  2INC C;  2MX2 A;  3N1X C;  5TSS A;  1M4V A;  1C1Y B;  4IM3 A;  3UF8 A;  3DBL I;  3DVN U;  2LAS A;  4FN2 A;  4ANX A;  4DDG D;  1G6J A;  1STE A;  1JWM D;  2ON8 A;  2RPV A;  3NY5 A;  4NAW A;  1QLB B;  3A9J B;  1WZ0 A;  2QIL A;  3TSS A;  4W9L A;  2JXX A;  1SB3 C;  3EFU A;  2C7N B;  2KTR B;  1YJ1 A;  5EE9 A;  2BGF A;  2JYT A;  2L8J A;  3BYY B;  3C0R B;  5D2M B;  3ZRC A;  4WAF A;  1QOF A;  3M62 B;  1GC6 A;  3V6E B;  2ZW0 A;  2OED A;  4HKZ E;  5FKA C;  1WX9 A;  1JQ4 A;  1DGJ A;  5DPT A;  2B3A A;  1MHH E;  4OVV A;  1IP9 A;  2I2Y A;  1E7U A;  4HXD A;  4C00 A;  1D5X C;  2J4X A;  2ZVN A;  3KWL A;  3VR8 B;  3T9L A;  1BXT A;  5BYS A;  4IWQ A;  1YIW A;  4BFR A;  4RF0 A;  1R4N I;  1YJJ A;  2D3G A;  1C4C A;  3QX1 A;  4HRO A;  4ZRQ A;  2LGY A;  4YWG G;  3GE3 C;  1N61 A;  2CHX A;  1RLF A;  1UF0 A;  2UWQ A;  1DOI A;  1V1P A;  2MRP A;  1WE7 A;  3CMM B;  4KZC A;  2PEA A;  3AB5 A;  3H9D A;  4P1B C;  4W9G A;  4B9K A;  5JZE B;  3VQI A;  2LEK A;  3ZGZ A;  2EKE C;  1WWT A;  2QHO A;  1E8Y A;  2JXT A;  3ONS A;  5HFY A;  2BB5 A;  4RGM A;  4W9E A;  2JPH A;  3DCG A;  4OHJ A;  3WCQ A;  1ZDX A;  2RSU A;  3A9J A;  1QIL A;  2KTR A;  1MFW A;  4X57 B;  4LNO A;  4MSM B;  1L0X B;  2KMC A;  2LVP A;  2OOB B;  2DYM A;  4RM8 A;  2FE8 A;  3QCA A;  3O13 A;  2L32 A;  1EM7 A;  4ASW C;  2BYV E;  2LD9 A;  4R3D A;  4WJN A;  3Q69 A;  4KDL B;  4GB9 A;  3AED B;  2NMQ A;  3HK0 A;  4DXG A;  2K6Q A;  3DHI C;  1XO3 A;  2D10 A;  1F77 A;  2KTF A;  1JRP A;  4TQ1 A;  1XCQ L;  2Y5C A;  1WJ4 A;  4MDK E;  4P1C C;  1L5P A;  2CJO A;  5JXV A;  1TS2 A;  1NI2 A;  4NJC A;  2MJE A;  2BS2 B;  1V5O A;  4J6I A;  4TQ0 A;  3T3N A;  4GIV A;  4WUR A;  3IBE A;  4C56 C;  3D32 A;  4OW0 A;  1XCT L;  2NCN A;  1OFF A;  4JL9 A;  2WDT B;  4MGZ E;  5E6P A;  3AEE B;  2R2O A;  4MH0 E;  5IP4 D;  3DOW A;  1L2N A;  4US9 A;  4US8 A;  1N5X A;  3APF A;  4GN1 A;  3ENE A;  4EE2 A;  3I5J C;  1SE4 A;  1KOT A;  3AI5 A;  5LLI A;  3VUY A;  3R7Q A;  4GDK B;  5E6J A;  4KZ0 A;  1NEK B;  1ZE3 D;  2QIE B;  4L1B A;  4LNN A;  3V3X A;  5BMI A;  2FBW B;  4YTM B;  2HE7 A;  4NJ6 A;  4MSQ B;  3RD2 A;  1UD7 A;  4HVB A;  1FRD A;  1SE3 A;  1N6Z A;  1CQV A;  3SFD B;  2BKR B;  3ETR A;  1C9F A;  2MA9 B;  4AJW A;  3PRZ A;  3AUL A;  4ZRJ A;  1RFK A;  1KFY B;  2WWZ A;  2MJ3 A;  2FUG 1;  3KUC B;  4N9F 4;  1RM6 C;  1PFD A;  3SHQ A;  1AWD A;  2IZV B;  4G50 A;  4NQK E;  2WYQ A;  1SXT A;  2KJH B;  2DYO A;  5IN7 A;  2ZZP B;  1ZW7 A;  2JRI B;  4E71 A;  1X1M A;  3DHH C;  4WJP A;  3I57 A;  4IDI A;  4BAX A;  3PHX B;  4KSL C;  2XK5 B;  1L0V B;  2IO1 B;  4M8N A;  1FD6 A;  1MPE A;  3VAW A;  2WDR B;  3BVM A;  2PIA A;  2D5G A;  3SR6 A;  3ZO5 B;  5HG2 A;  4K7U A;  4MEL A;  2E6X A;  1XLO A;  2N9P C;  1FPY A;  3NVW A;  4GDK A;  3ECI A;  4MEM A;  4HPL B;  5HHD G;  3VR9 B;  1VRA B;  4C4V A;  2BQQ A;  2FID A;  2BB6 A;  3PO0 A;  3GP7 A;  2KDM A;  2BW2 A;  5HI1 A;  1WGH A;  2C60 A;  1T0S C;  4DHJ D;  1L7Y A;  4DK5 A;  3MTN B;  4EZK A;  4KGT A;  1HA5 A;  3URY A;  2AEH A;  3DBH I;  1ZXH A;  2N9X A;  1EUV B;  2QCZ A;  3JSV B;  1XD3 B;  1IBX A;  1PGX A;  3K9P B;  1D5M C;  3B08 A;  3AE3 B;  2RDH A;  3V60 A;  2HTM E;  2MEK A;  3BVZ A;  2Y5P A;  3M95 A;  2PE6 B;  5BMG A;  5CHF A;  1PYW D;  3QIJ A;  4TKN A;  2IND C;  1WR1 A;  2WNM A;  1XEE A;  3L4P A;  2K6D B;  2AL6 A;  4AWJ A;  4PS3 A;  1TS3 A;  2PJH A;  3IG3 A;  4E3C A;  3AEF B;  3NRZ A;  4NQL B;  4D2K A;  5EE1 A;  4ZHO A;  1VDV A;  1T5X D;  3SU8 X;  3R8B A;  1PGA A;  4NNJ B;  1AN8 A;  2IGH A;  1C78 A;  1YNT E;  1ZGU B;  3VRA B;  1A70 A;  1QKZ A;  2WX0 A;  1V6E A;  1HEZ E;  1K51 A;  3W1Y A;  2W54 A;  3VH4 B;  3B9J A;  1FO4 A;  1WIA A;  4W9D A;  2D2Q A;  3UIN B;  1IUE A;  3L17 A;  2HJ8 A;  4CHK A;  2KQ4 X;  1L0Y B;  1T0Y A;  1V49 A;  4HCN B;  2J7Q B;  4IM2 A;  3GZN B;  3KWV A;  2IO3 B;  5MPO A;  1YQ3 B;  1FFV A;  3N32 A;  3A9K B;  4HPM B;  4KX6 B;  1P7F A;  1E8W A;  3B2G A;  4XC2 A;  3ZNH B;  1NYQ A;  1AAR A;  3NS8 A;  2WXL A;  3IT4 B;  3GE8 C;  2LXA A;  3DQV A;  5EE0 A;  2QEJ C;  4RCO A;  1BML C;  2W55 A;  1NI3 A;  3KUZ A;  4IWO A;  2OHF A;  3JW0 X;  1VR9 A;  1WXM A;  3GOE A;  4HLE A;  4WQO B;  2G3Q B;  5C1Z A;  4PK1 A;  3L0W B;  3L10 B;  4IC7 B;  4EKU A;  2IBI B;  3Q8F A;  2K8C A;  3TEY A;  2DWQ A;  3ZDM C;  3FKY A;  1E8X A;  2J53 A;  2JF5 A;  3ML8 A;  3S2A A;  2CJN A;  4ARI A;  1FXT B;  2DZI A;  4IOI E;  2WXH A;  3GS2 A;  4FXC A;  5FR3 A;  3KQ4 A;  1TY2 A;  1TTN A;  1WXV A;  5CTR C;  1GC7 A;  4A8X C;  2LVQ A;  2JZ3 B;  1VJK A;  2SEB D;  2J42 A;  3W9C B;  2MLB A;  3A9K A;  3ZJU A;  2K25 A;  1V2Y A;  4WJO A;  1D4B A;  2BPS A;  3TEX A;  2KDE B;  4BKG A;  1JRO A;  3ZLZ A;  2ACZ B;  1F9J A;  5KHO A;  1GUA B;  1XF5 L;  3N20 C;  1EWC A;  4NPN A;  3W5U B;  1HTQ A;  3VRB B;  4S0R A;  3V05 A;  3N30 A;  4RM9 A;  3MC0 B;  4KDI C;  2RPQ A;  3O65 B;  1SE2 A;  3A33 B;  3RZF A;  3OWE B;  4A6Q A;  1TZO A;  2MSE D;  1KRH A;  1KLG D;  3DBR I;  1H4R A;  3IT6 B;  3QHT A;  2ZCC A;  5HKH A;  2KN5 A;  3N1Y C;  5FR6 A;  1I35 A;  3AE6 B;  1JRU A;  2PTL A;  3KLS X;  1JWA D;  2R2Q A;  2ZNV C;  1WYW B;  1KLU D;  4C7Z A;  4GLS C;  4MGI E;  2BYE A;  1WGY A;  2BYT A;  1SGH A;  4I6N B;  2IY1 B;  1WF9 A;  2DZJ A;  1T0R C;  4A3P A;  2XNA C;  3QK0 A;  1N5W A;  5C23 A;  3WA0 A;  1AW7 A;  2MCN B;  1JML A;  2DAJ A;  2KXJ A;  2ONQ A;  4AQ7 A;  3WAN A;  2WXM A;  2SAK A;  4REZ A;  1YQ4 B;  1UEL A;  1S1Q B;  1T6B X;  4LCD E;  1ZDV A;  1IYF A;  2Y5B B;  1OQQ A;  3AM9 A;  1WZ3 A;  1KF6 B;  2QJL A;  4HDQ A;  4MGK E;  1GB4 A;  1V1P B;  2REX A;  3VHT C;  3A1Q B;  4E74 A;  1UUP A;  3CF6 E;  4FBJ B;  1KH0 A;  4EEW A;  4WH4 A;  2KYW A;  2FCN A;  1YN3 A;  1XLN A;  1UH6 A;  1WM2 A;  2ZCB A;  2KVZ A;  2DZK A;  4AP4 C;  3E56 A;  1P3Q U;  2BYF A;  2XN9 C;  3RUI B;  3X23 A;  3P4S B;  4CYE A;  4KGR A;  4Q2J A;  3Q8E A;  2QC8 A;  3HUI A;  2WXO A;  3AU5 A;  3MFG A;  2RD0 A;  2WXI A;  3U2S C;  4KIK A;  1SBB B;  4W9C A;  4WJQ A;  3UGB B;  1LO5 D;  2RMM A;  2CU1 A;  1QZE A;  3ABV B;  2MQJ A;  3TEZ A;  2AQ1 B;  1YMH E;  1YX5 B;  2H88 B;  2Q5W D;  2GB1 A;  4N58 A;  4WWP A;  2LFI A;  4H2A A;  4W9H A;  2ZVO A;  3SFE B;  4PS7 A;  5KHQ A;  2JUO A;  2K3U A;  2G4S A;  2QSD A;  2KMA A;  3MP9 A;  1EF5 A;  2KFJ A;  2YEP F;  1TBE A;  3ALB A;  2KMM A;  3A1Q A;  2EKI A;  2ZW1 A;  2M1M A;  3W2D A;  4LNK A;  4IM0 A;  3DBL B;  2V9H A;  1VLB A;  4ITK A;  5G55 A;  5BO4 B;  2LGS A;  4FJZ A;  1MG4 A;  1FMA D;  2L0T A;  1EWY C;  1VZ7 A;  1WX8 A;  3HIZ A;  4XDD A;  2N7E A;  3NG0 A;  2CKH B;  4J3O D;  1SSN A;  4IG7 B;  4II2 B;  1T0Q C;  2KWV B;  4XWW A;  3LB8 C;  3BIN A;  3A4S C;  2IJ0 A;  2LUE A;  1UBI A;  3B1L X;  2DBY A;  1FCL A;  3EC8 A;  2L3Z A;  3AMZ A;  4K7S A;  1E7P B;  1I4P A;  4II3 B;  2KHW B;  3NVV A;  3HVD A;  2V3S A;  2EEL A;  2LMC A;  1WE6 A;  1XXG A;  4NAM A;  3I3T B;  4KVG B;  4DXA B;  4EOY A;  2FNJ B;  2HDE A;  2ZPN A;  4BKS D;  2N4F A;  3RYT A;  1J7B A;  1S3S G;  5FK9 C;  2BTE A;  4CQN A;  1R4N B;  3OJ4 B;  4W9K A;  3HHM A;  3V6C B;  3ZRF A;  2GRI A;  5T8I A;  2CS4 A;  4JWS C;  1C79 A;  2V1Y A;  2Z8L A;  4N6E B;  1ZP0 B;  2RDG A;  3EGR A;  2JSV X;  3TUO A;  4IWP A;  3DWM A;  2YLM A;  3EUB 2;  2PPH A;  2AYO B;  2BF8 B;  4NJ7 A;  3KW5 B;  1Z2M A;  2LGX A;  3VTW A;  3L13 A;  2V3N A;  3BII D;  5C2T B;  1HZ5 A;  2J52 A;  1H8C A;  4L2Y A;  4G0N B;  4C4V B;  4ZRI A;  3KYC D;  2NVU I;  4DHZ B;  4YTN B;  4NZL B;  4LJO B;  1RFA A;  3NS1 A;  1CMX B;  1ZXI A;  3VDZ A;  1ZPS A;  3BZD B;  5L95 C;  5IO9 A;  3AXC A;  3KUD B;  1C76 A;  1RYJ A;  2GI9 A;  4KSK C;  1L4Z B;  1N63 A;  1IBX B;  1TJE A;  4P7I A;  1WGG A;  3TIX A;  2DZM A;  2KWC A;  2VZK B;  2GBJ A;  4HPP A;  5BYQ A;  3AEG B;  4MGY E;  2AL3 A;  2DHZ A;  3PLU A;  3CSF A;  1EF1 A;  5G5G A;  4EZJ A;  2AX5 A;  4HJG E;  4QAY A;  5G5H A;  4AS1 A;  4PS8 A;  4W9I A;  5AZG A;  2KX0 A;  1E10 A;  4BVU C;  3AN1 A;  2KJR A;  5DPR A;  3PPA A;  1EU3 A;  1UGM A;  2WLB A;  5IAA C;  2JWZ A;  4M0W B;  1VZ8 A;  3DHG C;  4XDC A;  1ENF A;  2KQS A;  4MM3 B;  4PYZ A;  2L05 A;  1R7S A;  2M0X A;  1C3T A;  5BMH A;  4ICU A;  1F2R I;  2X38 A;  3IHP C;  2C5L C;  4G3X B;  1Y56 A;  2JT4 B;  2NBV B;  3QC8 B;  1F1H A;  4ZDV A;  2WXR A;  5C3J B;  2L0F A;  1NEN B;  2WU2 B;  2WU5 B;  3BK1 A;  2E3T A;  4LTU A;  2W3S A;  4LNF A;  1E0Z A;  3N9Y C;  2K22 A;  1EO6 A;  2QMT A;  1ET9 A;  2FCS A;  4ZYN A;  1V5T A;  5EE3 A;  1NDD A;  2AQ2 B;  4W9F A;  1YD8 U;  4DXF A;  1JAL A;  2FCM A;  1J19 A;  3CWI A;  4TMA B;  5AZF A;  1RAX A;  1PUT A;  2JY6 A;  2WXF A;  2XBB C;  1I4Q A;  3KH0 A;  3E9S A;  4S17 A;  2JYE A;  2B76 B;  2K9X A;  3KVF B;  2PVO D;  4M0W A;  3SEB A;  4M02 A;  3H1U A;  2N7D A;  4JX1 C;  2UU7 A;  2O6V B;  3NUH B;  1L6U A;  3NOB A;  4MM3 A;  2KLG A;  2CU3 A;  1TY0 A;  3ML9 A;  3Q3F A;  3Q8C A;  2OJW A;  2JQR B;  4K7W A;  3RNG C;  3ZNI D;  3J9C A;  1DOY A;  2RGF A;  2GBR A;  4N59 A;  2N7J A;  3ZNZ B;  1ACC A;  2WXP A;  1SE9 A;  2KAC A;  2N0S B;  1J8C A;  1UZX B;  3MJ5 A;  2J0J A;  1NBF C;  3DBH B;  5CHV C;  1I4R A;  2PLP A;  4K1R B;  2VRR B;  2KOX A;  5BYR A;  3Q3J A;  3DVG Y;  3NVY A;  4YSX B;  1FM0 D;  4OZA A;  3HRD D;  5J17 A;  1Y8R C;  2MH7 A;  3QJZ A;  4MT5 A;  2G9H D;  1VCB A;  5LXI B;  3UQA A;  3U52 E;  2BS4 B;  1V8C A;  4P6V F;  3Q3O C;  2DLB A;  3FAH A;  1K52 A;  1F2R C;  4KV2 A;  5AUI A;  3UIP B;  2M8S A;  4K3B A;  3AE5 B;  1WMH B;  3VUW A;  2LHE A;  4LDT D;  3PRP B;  1FIQ A;  1I42 A;  1J7C A;  3RNF C;  1R4M I;  3BWU D;  5J18 A;  2O6V A;  1WH3 A;  3LDZ E;  3PSE B;  5DPS A;  4FJY A;  1BT0 A;  1MJD A;  1I4X A;  1EU4 A;  3QQ8 B;  3PZD A;  3MHZ A;  5IA7 A;  3P4P B;  3VUX A;  2Z0D B;  2BWE S;  1TS5 A;  4ICV A;  2KC2 A;  3HM6 X;  2X8X X;  4BOZ B;  4RGN A;  4HKQ A;  1V97 A;  1TZ1 A;  2KFK B;  2NTT A;  4IKG A;  2D11 A;  2MP2 A;  1LGR A;  2MBQ A;  2WXQ A;  2VH1 A;  1FEH A;  2LJI A;  2TSS A;  3H7P A;  3NZS A;  4I6P A;  2IDY A;  4URK A;  5E6O A;  2KKC A;  2JX5 A;  2KAN A;  4TSS A;  1D5Z C;  3WAO A;  1NVI D;  2WGS A;  5DPW A;  1FNU A;  1E9M A;  1VD2 A;  5JHB A;  1WY8 A;  3APC A;  2WXG A;  2KWD A;  4F8C B;  1WMH A;  4TV3 A;  1C77 A;  2FAZ A;  1WXS A;  1T3Q A;  1GNU A;  2JRH A;  2GLS A;  2L1A A;  4KKJ A;  3W1S C;  3TCA A;  1QT9 A;  3PRM B;  1MHX A;  4YXD B;  4JGH B;  3V61 A;  3PZ8 A;  1XLP A;  4GU2 A;  3ZXR A;  1C4P A;  2PE9 A;  2UYZ B;  3AU4 A;  4XYC A;  1DYQ A;  4GXB A;  4XZ4 A;  4KIK B;  3NJT A;  2NS5 A;  2INN E;  4ZYS A;  1LM8 B;  4MJS B;  3C8Y A;  1WYG A;  2NBU A;  2KFK A;  2PVG C;  2MBB B;  3Q2A C;  4ZRK A;  2HD5 B;  1E90 A;  4RFB A;  2W3R A;  3L08 A;  2GBN A;  3AE1 B;  3X0W A;  3RMK C;  2J0K A;  3TBL D;  4BKT A;  2CHZ A;  2KO3 A;  3OAW A;  1P7E A;  1QOA A;  1ISN A;  4CO7 A;  4DBG A;  2RDB C;  1PQS A;  2A5U A;  1LXD A;  2KD0 A;  4BOS C;  3UQB A;  2M0A A;  3TL5 A;  4BZA A;  1SJE D;  2NR2 A;  4AJY B;  1UBQ A;  3SD5 A;  3R2T A;  4HCP B;  4YL8 A;  1DOX A;  2V4I B;  4DQO C;  3TMP B;  2PW9 A;  3FC4 A;  2LGI A;  3P4R B;  3DBR B;  3P42 A;  3PT2 B;  2V0G A;  1FNV A;  1YN5 A;  2WDV B;  4BKS A;  2CHW A;  3PGE A;  4GMV A;  4W9J A;  3R66 C;  3ZUN A;  1V81 A;  2H89 B;  3MHS D;  4B0E A;  4OZB A;  1F0Z A;  2KJ6 A;  1U4A A;  4ZHP A;  2M56 B;  4WAA A;  2EMS A;  2INP E;  2WXJ A;  2WP9 B;  1CZP A;  2GBM A;  4MJS A;  3GB1 A;  2D07 B;  2FUH B;  4M00 A;  1CJE A;  4C7Y A;  2K5P A;  4ACF A;  5J2R A;  1I4H A;  5L83 A;  4GGQ A;  1K50 A;  1V80 A;  3TJP A;  2KNB A;  2YVC A;  2G1E A;  4WWN A;  4BBN C;  4YT0 B;  3OLM D;  2LRW A;  1P9D U;  1YX6 B;  2KVR A;  5EDS A;  3OG5 A;  2JVC A;  4WIP A;  1HQR D;  1A5R A;  2AWT A;  5G2N A;  4JPS A;  4OVU A;  4FHK A;  1CK1 A;  3ZIM A;  4DHJ B;  1IGD A;  3Q6B A;  4HEA 1;  2DNF A;  4RMA A;  3ZW3 A;  1WXQ A;  3Q8B A;  1OQR A;  2W82 A;  2KX3 A;  4BBN F;  1FXA A;  1JWB D;  5D6J B;  1WSP A;  1ZOY B;  3U4E G;  3VH3 B;  2WHI A;  3Q14 C;  2N9E B;  3RPF C;  4TUU A;  4YSY B;  1FNW A;  1HZ6 A;  3RI7 C;  2KC1 A;  3M63 B;  3LYY A;  5E6N A;  1LFD A;  3IFW B;  4PYU A;  1YN4 A;  4GDL B;  1VZ6 A;  2Z0E B;  5D3D A;  4UDU C;  2LHD A;  4C80 A;  2O2V B;  4OVZ A;  1WJN A;  1ESF A;  3BK2 A;  5CHW A;  1KLV A;  4HRS A;  4HWI B;  2IO0 B;  3RT3 B;  2K8B A;  3ZNG C;  2G4D B;  4G11 A;  3W5V B;  3V62 A;  2L00 B;  3EHV A;  3QWZ B;  4L23 A;  1AYF A;  2LZ6 A;  5LXH A;  3ZKJ C;  4ZOH C;  1ET6 A;  2GBK A;  2LJ5 A;  2FCQ A;  2KLC A;  3HVZ A;  2LRU A;  3M3J A;  1OEY J;  1IGC A;  1B1Z A;  3CST A;  2L7R A;  4ZRP A;  3AE2 B;  3ZQ4 A;  3ZJV A;  4EZL A;  1UWX A;  1PGB A;  4DDI D;  4YSZ B;  3APD A;  1KM7 A;  3NZ3 A;  1M94 A;  3IXS A;  1TGZ B;  3MC9 A;  4JE3 B;  2BS3 B;  2D3B A;  3RNA C;  4JQW C;  2Y3A A;  4FHJ A;  2W9N A;  5H8Y E;  1SEB D;  2PMV A;  3WAM A;  4A20 A;  2DYB A;  4P16 A;  3L16 A;  3AE9 B;  4KGS A;  3P4Q B;  4B0M A;  4GDL A;  2WXK A;  4JIO U;  1V86 A;  2DX5 B;  1N62 A;  4XX5 A;  1FCC C;  4WWM A;  2O2V A;  2D3A A;  4F7Z A;  2KDI A;  1JW9 D;  2IPK D;  3U8Z A;  2NBW B;  2ZJD A;  1WGR A;  5AEK B;  1HXY D;  4LDT B;  3RCZ A;  4MH8 A;  1J7A A;  5DCN A;  3IAS 1;  1GJZ A;  4ANW A;  2M4N A;  2KWU B;  5D3I B;  1J0G A;  5IKC M;  2K0P A;  4B95 A;  2XEW A;  1IPG A;  4KKI A;  1F52 A;  3CIR B;  1WM3 A;  2GOW A;  2AQ3 B;  4NY0 A;  4OZC A;  3PHW B;  3AV8 A;  3WAP A;  2I38 A;  2I1K A;  1JCK B;  1YJI A;  2WS3 B;  4LNI A;  1WJ6 A;  4K81 A;  2MJD A;  5AUK A;  3IAM 1;  1GG3 A;  2EMT A;  1OQY A;  4ARC A;  1WXA A;  1OEY A;  3HM3 A;  2ZEQ A;  1KJT A;  3UI3 A;  3AEC B;  1MVK A;  2GMI C;  1FXI A;  1TKG A;  1E6E B;  3DPD A;  1OGW A;  2WX1 A;  1HE8 A;  3NHE B;  3VFK A;  4DWF A;  4RF1 A;  3RNE C;  2KAJ A;  3P1M A;  1OTR B;  2WXN A;  4FAD A;  3ZDT A;  3Q3N C;  4O1N A;  1WFY A;  1WGK A;  2ZPY A;  3MC8 A;  3R3M A;  4GSW A;  3AH7 A;  1WR6 E;  1FRR A;  1P0R A;  3VTV A;  3P2B A;  1D6E C;  1SIJ A; 
#chains in the Genus database with same CATH homology
 4AP4 C;  2I1J A;  4BOZ B;  4GIV A;  3IBE A;  1XQQ A;  1P3Q U;  3D32 A;  2RR9 A;  3H7S A;  2BYF A;  2NCN A;  3RUI B;  3X23 A;  1TZ1 A;  3RZW C;  2KFK B;  3GZN I;  2D11 A;  1P1A A;  4GOC A;  4JL9 A;  2WDT B;  4MGZ E;  5E6P A;  2MP2 A;  4CYE A;  2R2O A;  2MBQ A;  4MH0 E;  3AU5 A;  3DOW A;  1L2N A;  2RD0 A;  3H7P A;  3NZS A;  4I6P A;  4KIK A;  2A4Z A;  4W9C A;  3APF A;  4GN1 A;  3ENE A;  4WJQ A;  3UGB B;  1KOT A;  3A4R A;  2CU1 A;  3AI5 A;  5LLI A;  1QZE A;  5E6O A;  2KK8 A;  4URK A;  2KKC A;  2BWF A;  2KAN A;  2MQJ A;  3VUY A;  3WAO A;  1YX5 B;  2KDB A;  2FIF A;  4WWP A;  5DPW A;  3SDL C;  3R7Q A;  4F1S A;  4GDK B;  1VD2 A;  1WX7 A;  4W9H A;  5JHB A;  1WY8 A;  5TR5 A;  2ZVO A;  3APC A;  4KZ0 A;  3N3K B;  2XK5 A;  4F8C B;  4PS7 A;  1WMH A;  4TV3 A;  5KHQ A;  2CR5 A;  2LXC A;  2MBH A;  3VXW A;  2JUO A;  2G4S A;  2HE7 A;  1E5W A;  5GMV A;  2J0M A;  2FAZ A;  1Q0W B;  4MSQ B;  4NJ6 A;  2KMA A;  5D94 A;  3RD2 A;  1WXS A;  1UD7 A;  1EF5 A;  1GNU A;  2JRH A;  2KFJ A;  4HVB A;  3W1S C;  1TBE A;  3TCA A;  3ALB A;  2L76 A;  2JZZ A;  3A1Q A;  3PRM B;  2BKR B;  3VVW B;  2MA9 B;  2M1M A;  4JLC A;  3PRZ A;  4JGH B;  4AJW A;  3AUL A;  4ZRJ A;  2V4L A;  4IM0 A;  3V61 A;  2WWZ A;  2HTH A;  3KUC B;  4GU2 A;  3PV1 A;  2MP2 B;  3DDC B;  4N9F 4;  2PE9 A;  2UYZ B;  3AU4 A;  5G55 A;  5BO4 B;  3SHQ A;  1RRB A;  4FJZ A;  2K1F A;  3QAR A;  4GXB A;  4I6L B;  2IZV B;  2L0T A;  4XZ4 A;  3H7P B;  4G50 A;  4KIK B;  3IVF A;  4NQK E;  1WX8 A;  2NS5 A;  2WYQ A;  1WI0 A;  3HIZ A;  5JHA A;  2N7E A;  4IW0 A;  4A3O A;  2CKH B;  1Q1O A;  4IG7 B;  3JVZ X;  2KJH B;  2DYO A;  2LVO A;  1LM8 B;  4II2 B;  4MJS B;  2IY0 B;  2KWV B;  2ZZP B;  2NBU A;  4EUT A;  2KFK A;  3JSV A;  2MBB B;  3BIN A;  3A4S C;  1ZW7 A;  2JRI B;  2KDF B;  4ZRK A;  2MBO A;  2LUE A;  1Q5W B;  1X1M A;  2N1V A;  4E71 A;  1UBI A;  2HD5 B;  1E90 A;  3B1L X;  4WJP A;  3PS6 A;  3L08 A;  2C7M B;  2GBN A;  4LJP B;  3PHX B;  4KSL C;  3X0W A;  2XK5 B;  2IO1 B;  3H6N A;  2K39 A;  4M8N A;  2J0K A;  3TBL D;  3WAL A;  4BKT A;  3EC8 A;  3ZTC A;  2L3Z A;  4K7S A;  2OJR A;  2CHZ A;  2KO3 A;  3OAW A;  4II3 B;  2KHW B;  1ISN A;  5AZH A;  4CO7 A;  2KQ7 A;  3VAW A;  4DBG A;  1E8Z A;  1PQS A;  2A5U A;  2V3S A;  4IUM B;  1LXD A;  2KD0 A;  1WE6 A;  3DBS A;  4BOS C;  4HJK A;  3ZO5 B;  3TL5 A;  4K7U A;  3I3T B;  4DHZ E;  3UQB A;  4MEL A;  4KVG B;  3ZTD A;  2NR2 A;  4AJY B;  4DXA B;  4EOY A;  2FNJ B;  2N9P C;  2ZPN A;  4GDK A;  3ECI A;  4J6I A;  4HPL B;  1UBQ A;  4MEM A;  4BKS D;  1XT9 B;  3SD5 A;  1E7V A;  2N4F A;  3JYU A;  4HCP B;  4YL8 A;  3TMP B;  1SIF A;  2Z59 B;  3KYD D;  3RYT A;  2FID A;  1S3S G;  1K8R B;  3OJ4 B;  3PT2 B;  4ANU A;  4W9K A;  3HHM A;  3V6C B;  3ZRF A;  1WGH A;  4WWO A;  2C60 A;  4DHJ D;  1L7Y A;  4M8M A;  4DK5 A;  4BKS A;  2CS4 A;  3MTN B;  4EZK A;  1Z5S B;  2CHW A;  2V1Y A;  2LI5 A;  3PGE A;  4GMV A;  3PRE A;  4W9J A;  3PVL A;  2AEH A;  3DBH I;  2N9X A;  1V81 A;  3R66 C;  3ZUN A;  3MHS D;  4IWP A;  1EUV B;  4AOF A;  3U30 A;  3JSV B;  1WJU A;  1XD3 B;  3UIO B;  2YLM A;  2KJ6 A;  1U4A A;  3K9P B;  3BY4 B;  4WAA A;  2EMS A;  3B08 A;  2MW5 A;  2PPH A;  3EEC A;  2AYO B;  2BF8 B;  3RUL A;  2C9W B;  3PLV A;  4NJ7 A;  4AUQ C;  3V60 A;  3KW5 B;  2ZNV B;  2G45 B;  2DEN B;  2GBM A;  1Z2M A;  2LGX A;  1MG8 A;  3M95 A;  3VTW A;  3L13 A;  2PE6 B;  4MJS A;  5CHF A;  3QIJ A;  4TKN A;  1WR1 A;  1V9J A;  2D07 B;  3WIM A;  2FUH B;  2K6D B;  5D7G A;  2AL6 A;  5J2R A;  4AWJ A;  2M17 A;  4PS3 A;  5L83 A;  4GGQ A;  2BKF A;  1H8C A;  2PJH A;  1V80 A;  2C7H A;  3TJP A;  4G0N B;  3IG3 A;  2KNB A;  2YVC A;  4E3C A;  4ZRI A;  3KYC D;  4NQL B;  4WWN A;  4BBN C;  2MWS B;  3OJ3 A;  2NVU I;  4HDO A;  4DHZ B;  3OLM D;  2LRW A;  3K9O B;  1P9D U;  2NPT B;  1YX6 B;  3QAQ A;  4ICV A;  1RFA A;  2KVR A;  4LJO B;  3R7R A;  1CMX B;  3SU8 X;  5EDS A;  1WGD A;  2LGD A;  4NNJ B;  3VDZ A;  1ZGU B;  3PTF C;  3VTU A;  4FA6 A;  5L95 C;  3AXC A;  2JVC A;  3KUD B;  4KSK C;  1A5R A;  2AWT A;  5G2N A;  4OVU A;  4FHK A;  2LWP A;  1V6E A;  2WX0 A;  4P7I A;  3ZIM A;  4DHJ B;  3QA8 A;  1WGG A;  3W1Y A;  3TIX A;  3VH4 B;  4RMA A;  3ZW3 A;  2DZM A;  2N1W A;  2KWC A;  1WIA A;  2IO2 B;  2MBE A;  1LQB A;  2K8H A;  4W9D A;  2D2Q A;  4EFO A;  2GBJ A;  1D3Z A;  2KX3 A;  4NAW B;  3UIN B;  4BBN F;  3L17 A;  5D6J B;  4MGY E;  2AL3 A;  2HJ8 A;  4CHK A;  1T0Y A;  1V49 A;  2DHZ A;  1WRD B;  3LJ3 A;  2J7Q B;  3PLU A;  4HCN B;  3CSF A;  4IM2 A;  1EF1 A;  3VH3 B;  4EZJ A;  2IO3 B;  3W1S A;  2N9E B;  4ANV A;  3N32 A;  4TUU A;  3A9K B;  4HPM B;  4PS8 A;  4W9I A;  5JH5 C;  4FUL A;  5AZG A;  2KZR A;  1E8W A;  2KX0 A;  4XC2 A;  2KC1 A;  3M63 B;  3T8M A;  2ASQ A;  3ZNH B;  4FLH A;  3U7D A;  1AAR A;  3MJW A;  5E6N A;  1LFD A;  3NS8 A;  3IFW B;  4BVU C;  4PYU A;  3B0A A;  3DVG X;  2KJR A;  5DPR A;  3PPA A;  1UGM A;  2LXA A;  4HK2 A;  4GDL B;  2Z0E B;  3DQV A;  5IAA C;  2JWZ A;  4M0W B;  2O2V B;  3DVN V;  4FJV B;  1WJN A;  3KUZ A;  5CHW A;  1KLV A;  4B6W A;  2KQS A;  4IWO A;  3JW0 X;  4HWI B;  2IO0 B;  4PYZ A;  2L05 A;  3RT3 B;  1WXM A;  5CX3 A;  2O6V D;  2K8B A;  2M0X A;  3GOE A;  2G4D B;  3ZNG C;  4HLE A;  1ZKH A;  4G11 A;  2DAF A;  1C3T A;  4WQO B;  1P98 A;  3NZU A;  3V62 A;  2L00 B;  3EHV A;  3QWZ B;  2G3Q B;  4ICU A;  3ZVV A;  5C1Z A;  3L0W B;  3L10 B;  2LZ6 A;  3L54 A;  4IC7 B;  3IHP C;  4EKU A;  5LXH A;  2IBI B;  2IYD B;  3ZKJ C;  2C5L C;  1YQB A;  2NPT A;  2K8C A;  2GBK A;  4G3X B;  2MX2 A;  2LJ5 A;  3ZDM C;  2FCQ A;  2KLC A;  1E8X A;  2LRU A;  3M3J A;  1OEY J;  2JT4 B;  1C1Y B;  2NBV B;  3QC8 B;  4TQ0 A;  2JF5 A;  4ZDV A;  3ML8 A;  4IM3 A;  3S2A A;  2L0F A;  3CST A;  3UF8 A;  3DBL I;  3DVN U;  2L7R A;  1FXT B;  2DZI A;  2LAS A;  2DZK A;  4EZL A;  4FN2 A;  4ANX A;  4DDG D;  4DDI D;  1G6J A;  1TTN A;  3APD A;  1KM7 A;  1WXV A;  3NY5 A;  4NAW A;  1EO6 A;  1M94 A;  5CTR C;  2FCS A;  4ZYN A;  1GC7 A;  3A9J B;  1WZ0 A;  1TGZ B;  1V5T A;  4W9L A;  2LVQ A;  1NDD A;  2JXX A;  2JZ3 B;  3EFU A;  4W9F A;  2C7N B;  2KTR B;  4JQW C;  1YD8 U;  1YJ1 A;  4FHJ A;  2W9N A;  2BGF A;  2FCM A;  2MLB A;  1J19 A;  2L8J A;  3A9K A;  3C0R B;  5D2M B;  2K25 A;  1V2Y A;  4WJO A;  3ZRC A;  2BPS A;  2KDE B;  3WAM A;  5AZF A;  2DYB A;  3M62 B;  4A20 A;  1GC6 A;  4BKG A;  3V6E B;  3L16 A;  1RAX A;  2JY6 A;  1WX9 A;  2XBB C;  3ZLZ A;  3KH0 A;  1F9J A;  5KHO A;  5DPT A;  1GUA B;  2B3A A;  4NPN A;  4OVV A;  1IP9 A;  4GDL A;  4JIO U;  1V86 A;  2DX5 B;  3KVF B;  1E7U A;  4HXD A;  4XX5 A;  2O2V A;  4F7Z A;  2KDI A;  3N30 A;  3H1U A;  2N7D A;  4RM9 A;  3U8Z A;  2NBW B;  4KDI C;  2O6V B;  2ZJD A;  2RPQ A;  2ZVN A;  1WGR A;  3O65 B;  3A33 B;  5AEK B;  3NOB A;  3RZF A;  4MM3 A;  4LDT B;  2KLG A;  3RCZ A;  3ML9 A;  3Q3F A;  5DCN A;  3T9L A;  2MSE D;  4IWQ A;  1YIW A;  3DBR I;  4K7W A;  1R4N I;  2D3G A;  3ZNI D;  1H4R A;  4BFR A;  3QX1 A;  1GJZ A;  3QHT A;  2LGY A;  4ANW A;  2RGF A;  2M4N A;  2GBR A;  2KWU B;  2ZCC A;  2KN5 A;  5HKH A;  2CHX A;  3ZNZ B;  1RLF A;  1J0G A;  4B95 A;  2UWQ A;  2MRP A;  1WE7 A;  5FR6 A;  1SE9 A;  3CMM B;  2XEW A;  4KZC A;  1I35 A;  2PEA A;  3H9D A;  4W9G A;  1IPG A;  1JRU A;  4B9K A;  5JZE B;  1UZX B;  1J8C A;  2J0J A;  3VQI A;  1NBF C;  5CHV C;  1WM3 A;  2EKE C;  2GOW A;  4K1R B;  4NY0 A;  2VRR B;  3PHW B;  2KOX A;  2R2Q A;  1WYW B;  2ZNV C;  3Q3J A;  3WAP A;  2QHO A;  4MGI E;  3DVG Y;  1E8Y A;  2BYE A;  3ONS A;  2I1K A;  1WGY A;  4W9E A;  2JPH A;  3DCG A;  1SGH A;  5J17 A;  4I6N B;  2IY1 B;  1Y8R C;  1WJ6 A;  1WF9 A;  3QJZ A;  2DZJ A;  2RSU A;  4K81 A;  4A3P A;  3A9J A;  3QK0 A;  1VCB A;  5LXI B;  1GG3 A;  2EMT A;  2KTR A;  1OQY A;  5C23 A;  3WA0 A;  3UQA A;  1WXA A;  1OEY A;  2MCN B;  3HM3 A;  4X57 B;  4MSM B;  2DAJ A;  2ZEQ A;  2KXJ A;  3WAN A;  2KMC A;  2LVP A;  1KJT A;  1UEL A;  2DYM A;  2OOB B;  4KV2 A;  4RM8 A;  2GMI C;  1S1Q B;  4LCD E;  3UIP B;  2M8S A;  3QCA A;  1WMH B;  3VUW A;  4LDT D;  4ASW C;  2BYV E;  3PRP B;  1IYF A;  2Y5B B;  1WZ3 A;  2LD9 A;  3DPD A;  1OGW A;  1I42 A;  2WX1 A;  1R4M I;  4HDQ A;  4WJN A;  1HE8 A;  4KDL B;  4MGK E;  5J18 A;  3NHE B;  4GB9 A;  3VFK A;  4DWF A;  2REX A;  3HK0 A;  3VHT C;  3A1Q B;  4E74 A;  1OTR B;  2O6V A;  1WH3 A;  3LDZ E;  3ZDT A;  4FAD A;  2K6Q A;  3CF6 E;  4FBJ B;  2D10 A;  3PSE B;  4EEW A;  1WFY A;  2KTF A;  2ZPY A;  3R3M A;  4FJY A;  1BT0 A;  4GSW A;  4TQ1 A;  5DPS A;  2FCN A;  3QQ8 B;  1WR6 E;  1WJ4 A;  3PZD A;  5IA7 A;  3VUX A;  1P0R A;  4MDK E;  3VTV A;  1UH6 A;  2Z0D B;  2BWE S;  1WM2 A;  3P2B A;  2ZCB A;  1NI2 A;  2KC2 A;  1V5O A;  3HM6 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...