2B3AA

Solution structure of the ras-binding domain of the ral guanosine dissociation stimulator
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
87
structure length
87
Chain Sequence
b'DCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ral guanine nucleotide dissociation stimulator
publication title New insights into binding of the possible cancer target RalGDS
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 17
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2005-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2b3aA00
2LXCA 2CS4A 2PJHA 2DZJA 1V86A 2NS5A 3BINA 3QX1A 4LJOB 4A20A 3UQBA 3R7RA 4EZJA 4MSQB 2HE7A 3SD5A 3RULA 3WAPA 4K7UA 3DDCB 3NZUA 2KTRB 1NI2A 2AEHA 2YLMA 2K6DB 5CHVC 3PVLA 3TMPB 3H7PA 4HDOA 3A1QB 4MGZE 1K8RB 2KC2A 2KDIA 2Y5BB 4KSKC 3VH4B 4K7SA 3GZNI 5CTRC 2C7MB 3IG3A 4GU2A 5DCNA 2UWQA 4E3CA 4W9LA 1P98A 3KVFB 4LJPB 2N4FA 5DPSA 3W1SA 2GMIC 2LRUA 2LGDA 3ZIMA 3JSVA 3BY4B 4MDKE 4B6WA 2C60A 2HJ8A 3QK0A 2JF5A 4M8MA 1WMHB 2MBEA 4JL9A 3ZDMC 4A3PA 2K8CA 4MGYE 2BGFA 2L00B 2XBBC 5AZFA 2JY6A 2O6VD 3C0RB 1V6EA 4WJPA 4IC7B 2KOXA 3ZRFA 2QHOA 5CHWA 2CR5A 2KO3A 2LVQA 2R2OA 2XEWA 4IM0A 1RRBA 2EMTA 2ZCCA 2KFJA 2VRRB 3ZTDA 3TL5A 5HKHA 3WANA 3HIZA 5IAAC 5JHAA 1V2YA 3NHEB 1Q0WB 2KK8A 2JT4B 1TTNA 3ZNZB 2KFKB 2LVOA 1YX5B 2FCSA 3EHVA 1KJTA 2PEAA 5C1ZA 4I6NB 3V6CB 2GBKA 2MX2A 4MJSB 4MEMA 3U7DA 3VDZA 4AJYB 2ASQA 2PE9A 2IO3B 2Z0EB 4FULA 2JXXA 1SIFA 2LJ5A 2K8BA 2GBRA 3RCZA 3CMMB 1J19A 3LJ3A 3L13A 3DVNU 1V5OA 3KUDB 3VQIA 2C7NB 5D7GA 1TBEA 4HJKA 2L05A 2ZNVC 3QAQA 3DOWA 1GG3A 2KC1A 2RSUA 2GBNA 2KTRA 3T8MA 2V4LA 3HM6X 4AP4C 4NJ7A 4PS3A 1E90A 3A1QA 1X1MA 1Y8RC 3JW0X 2L7RA 4MGKE 3VH3B 1WGDA 2CHXA 1GC7A 1YIWA 1Q1OA 1TZ1A 2G4DB 3WA0A 4XX5A 5IA7A 3PREA 1L7YA 3W1YA 1YQBA 3QA8A 3PS6A 4OVVA 4HXDA 3L0WB 2N1WA 2KX0A 4GB9A 1WR1A 1Z2MA 3QJZA 5GMVA 5EDSA 3KYDD 4LCDE 2IO0B 3ZDTA 2JZZA 3PTFC 4GIVA 5DPRA 4EUTA 1UELA 4ZRJA 2RR9A 3VFKA 3JYUA 4HWIB 1WX8A 4K7WA 3H9DA 2D11A 2FNJB 4GXBA 2IY0B 2DX5B 4FBJB 2K39A 4CO7A 3I3TB 2AL3A 3A9KB 1ZGUB 2KWUB 2L8JA 4WAAA 1ZW7A 2G4SA 1C1YB 2L0FA 2J0MA 1EUVB 4WJOA 2WWZA 2C5LC 3NOBA 3LDZE 2C9WB 2MA9B 2LD9A 2KJHB 4W9GA 1J8CA 1D3ZA 3A4SC 4NAWA 1OEYJ 4ANUA 3RT3B 1WJ6A 2B3AA 1V9JA 3R66C 1U4AA 5KHOA 2NBVB 3O65B 1I42A 3L17A 1WZ3A 2K1FA 1RFAA 4YL8A 4W9FA 1WM2A 4J6IA 1EF5A 1WXVA 2XK5B 1P1AA 4ANVA 1WI0A 3DQVA 2MLBA 2KDEB 2KQSA 4JIOU 3VAWA 2O2VB 1E8WA 2ZZPB 3N30A 3CF6E 4IWPA 1G6JA 1UZXB 2FCQA 1L2NA 4WQOB 2N7DA 4MELA 3V60A 1OTRB 2G3QB 4W9CA 2EMSA 3KH0A 2GBMA 4IUMB 4WWOA 4P7IA 3UQAA 1C3TA 2NPTA 3KUCB 4LDTB 3UIOB 3VTWA 3ZNGC 2MBBB 4AJWA 3PSEB 1BT0A 3ZO5B 1EO6A 2ZEQA 2LRWA 1NDDA 3OAWA 1WE7A 2IBIB 3AU5A 2HD5B 2NBWB 3ML9A 3L16A 1XD3B 3UF8A 3MHSD 4FJYA 2LGYA 4KDIC 2WYQA 2MP2B 4DDGD 2MBHA 1FXTB 2DZIA 1WYWB 3EECA 4CHKA 2RD0A 2JRIB 2MW5A 4WWNA 1RAXA 4KIKA 2OJRA 1F9JA 1UH6A 3A9JB 4M8NA 5G55A 5C23A 1IP9A 3RUIB 3DPDA 3RZFA 4GDLB 2NR2A 4GDKA 4OVUA 4RM8A 4ICUA 3M62B 4NNJB 2M8SA 4F7ZA 4W9HA 3VUWA 3PRZA 1WFYA 3DBLI 4BBNC 1WX9A 4FA6A 3PT2B 4DBGA 1WGYA 3ZW3A 2FAZA 4DHZE 4JQWC 2N7EA 5JHBA 2BKRB 3IBEA 4IG7B 1LQBA 1WJNA 2A5UA 2IY1B 3NS8A 1V49A 4I6PA 3OJ4B 5DPTA 2RGFA 3WALA 3S2AA 3L08A 2KXJA 1JRUA 2KDBA 3V6EB 2JZ3B 4DHJB 1GC6A 4GOCA 1WXMA 3ZNHB 3IVFA 3ZNID 2KVRA 2IZVB 2MRPA 4G0NB 3ZLZA 2KMAA 2XK5A 5AZGA 3PPAA 5FR6A 3N32A 4BOSC 1J0GA 2KKCA 1UGMA 1WGRA 4MM3A 5G2NA 2KWCA 2AL6A 3V62A 1KLVA 3ZVVA 2N9PC 1OGWA 4WWPA 1R4NI 2IO2B 1QZEA 2O6VB 4ZRIA 4ANWA 2J0JA 3AXCA 4W9JA 3MTNB 2N9XA 1WIAA 2G45B 2LZ6A 3ML8A 3W1SC 1WRDB 2NCNA 5D94A 4II2B 4EZLA 2L76A 2N1VA 4DXAB 2M4NA 3KW5B 3U30A 2JUOA 4II3B 3KYCD 3B0AA 4IM2A 4HCNB 4KSLC 3UIPB 3QHTA 3B08A 2IYDB 2MQJA 2DHZA 3HK0A 5CHFA 1WMHA 5J2RA 2BYEA 3SDLC 4GGQA 3ECIA 2ZNVB 1T0YA 3VUYA 2ZPYA 4ZRKA 4AWJA 2KANA 4EKUA 4G11A 2RPQA 2YVCA 3KUZA 3RD2A 2BYVE 2WDTB 4ICVA 3ALBA 3Q3JA 1P0RA 2LI5A 2MBQA 3A9JA 3ZKJC 2M1MA 3CSTA 4IWOA 1YD8U 4B9KA 4BBNF 4WJQA 4GDLA 1UD7A 2FUHB 4KDLB 3EFUA 4AOFA 2LWPA 3M95A 4MGIE 4DWFA 3A4RA 3ZUNA 2JWZA 4HDQA 1ISNA 1Z5SB 2BYFA 2KFKA 3PHXB 3QQ8B 4PYUA 2N9EB 2ZCBA 3V61A 4DDID 4NJ6A 2KDFB 2AWTA 4PS7A 3TCAA 4WJNA 5E6NA 3TJPA 5J18A 4MJSA 5D6JB 1KM7A 1XQQA 2KHWB 3M3JA 1M94A 2BKFA 4LDTD 3UINB 1R4MI 2W9NA 2PPHA 2KLCA 4BVUC 3SU8X 1PQSA 3L54A 2C7HA 2L3ZA 2M0XA 3HM3A 2D3GA 4TQ0A 3A33B 4HVBA 3DBHI 1GNUA 3WAMA 3JVZX 2KTFA 4F8CB 1IYFA 4X57B 4BKTA 4E74A 4FJZA 4A3OA 5L95C 1WE6A 3PZDA 4W9EA 2DYMA 2EKEC 4FJVB 2BF8B 2UYZB 3DVGY 3X23A 3ZRCA 5JH5C 3WAOA 1H8CA 2BPSA 3VTUA 5AZHA 1GUAB 1UBIA 3ONSA 1I35A 1WH3A 1WR6E 2MCNB 4EEWA 4ZYNA 4I6LB 2DZMA 1S3SG 2DENB 5JZEB 3VUXA 4EFOA 2LXAA 4B95A 3ZTCA 4IWQA 2BWFA 2NBUA 4HPMB 3VHTC 4NQKE 2KLGA 2DAJA 2JVCA 3DVGX 3R3MA 3OJ3A 4KZ0A 4W9KA 3X0WA 3APFA 1WX7A 1E5WA 4FHKA 2DAFA 3TBLD 4ANXA 2LUEA 1WJUA 4EOYA 3RYTA 3ENEA 1S1QB 4XZ4A 3UGBB 1E8ZA 4W9DA 5E6OA 3IHPC 2LVPA 2DZKA 2K25A 4PS8A 4DHJD 3U8ZA 3PGEA 3A9KA 2DYBA 4IW0A 1YJ1A 4NPNA 3TIXA 5KHQA 2KQ7A 3VTVA 1XT9B 3D32A 4FADA 1Q5WB 1AARA 2A4ZA 2D2QA 4NQLB 1LM8B 1NBFC 1YX6B 4BKSA 2REXA 4JGHB 1WF9A 3CSFA 4GSWA 1WXSA 3QC8B 4DHZB 5AEKB 4JLCA 4NY0A 4TV3A 2K6QA 2WX0A 4TQ1A 3PV1A 3APCA 3DBSA 4EZKA 4KZCA 1GJZA 3M63B 1WZ0A 2LASA 3AULA 1UBQA 2FCNA 5J17A 5TR5A 3MJWA 2GOWA 3H6NA 4TUUA 1WGGA 2CHZA 2Z59B 2O2VA 4URKA 4NAWB 3B1LX 3H1UA 1E7VA 2DYOA 4KV2A 2ZPNA 4BKGA 3PHWB 2HTHA 1LXDA 5E6PA 2KMCA 4KVGB 1A5RA 1P3QU 2MSED 4GMVA 5LXIB 1EF1A 3DBRI 3APDA 2KD0A 2I1JA 2FCMA 2M17A 3QARA 2ZJDA 2KNBA 3PLUA 2KN5A 2OOBB 5LXHA 3QIJA 3NZSA 2ZVNA 3DCGA 4BKSD 3H7PB 5CX3A 3PRPB 4M0WB 4F1SA 2V3SA 2I1KA 4TKNA 2MP2A 3QCAA 2D10A 4RMAA 2IO1B 1ZKHA 1SE9A 2KJRA 2CKHB 1V80A 2NPTB 4BOZB 3Q3FA 3VXWA 2J0KA 5D2MB 1WJ4A 2NVUI 3R7QA 2D07B 3PLVA 4MSMB 1P9DU 4FHJA 2CU1A 2Z0DB 1V81A 3P2BA 3JSVB 3L10B 2KX3A 4K81A 4FLHA 2JPHA 4GN1A 4IM3A 2FIDA 4K1RB 4CYEA 1KOTA 3H7SA 3K9PB 1E8YA 1E7UA 4ZDVA 3DVNV 2R2QA 1WGHA 3NY5A 4MH0E 3PRMB 1SGHA 2PE6B 2KZRA 1RLFA 3K9OB 3OLMD 4KIKB 4XC2A 5BO4B 5DPWA 3GOEA 3AU4A 1WXAA 1V5TA 3AI5A 3HHMA 3WIMA 1HE8A 4G50A 2AYOB 1IPGA 4GDKB 2ZVOA 1WM3A 5LLIA 4HPLB 4ASWC 3VVWB 3QWZB 4HK2A 1VD2A 4HLEA 2V1YA 3EC8A 4E71A 1E8XA 1H4RA 4HCPB 4G3XB 3RZWC 2J7QB 3SHQA 4DK5A 1WY8A 1CMXB 4BFRA 1MG8A 2CHWA 5L83A 4PYZA 2MBOA 2K8HA 2LGXA 4W9IA 2L0TA 2O6VA 2FIFA 2WX1A 1LFDA 3IFWB 1OQYA 2JRHA 4FN2A 3N3KB 2MWSB 3T9LA 1OEYA 1VCBA 2GBJA 4RM9A 2KWVB 4N9F4 1TGZB 2KJ6A 4AUQC 2BWES
chains in the Genus database with same CATH superfamily
2CS4A 4LJOB 4A20A 4RH6A 3WAPA 1NI2A 2YLMA 1TZOA 3PVLA 3KLSX 4L2YA 4HDOA 3A1QB 1K8RB 4YSXB 2Y5BB 1JW9D 4EE2A 2C7MB 1P98A 2OJWA 3KVFB 2N4FA 2N9KA 2GMIC 2HJ8A 3QK0A 1ZUD2 4WIPA 2WGSA 1WMHB 2MBEA 2K8CA 4MGYE 2XBBC 1V6EA 4WJPA 1FD6A 5TSSA 2WNMA 2KO3A 2R2OA 4MT5A 2VRRB 3ZTDA 1VRAB 3WANA 3HIZA 1TTNA 1SJHD 1KJTA 1MI0A 4P16A 4I6NB 2GBKA 4N6EB 4MJSB 4MEMA 1BXTA 1OQQA 3VDZA 1C4PA 2PE9A 2L1AA 1SIFA 3U7ZA 2ACZB 3ZJTA 2K8BA 3L13A 3KUDB 1MHXA 1UNSA 5D7GA 1EU3A 2L05A 2MJ3A 4AS1A 1AYFA 1GG3A 1V1PB 5FKAC 1VJKA 4H2AA 4WQMA 4AP4C 4PS3A 1E90A 2QMTA 2JZPA 1P7FA 2DNFA 4HEA1 3T3NA 1Q1OA 5IA7A 3PREA 1L7YA 3W1YA 1YQBA 3PS6A 1C78A 4GLSC 4HKQA 2N1WA 1WR1A 1Z2MA 5GMVA 4KGRA 2LUMA 3VRAB 4K7WA 4B0EA 3AE6B 2FNJB 4Q2JA 2K39A 4WAAA 1ZW7A 1C1YB 1SEBD 1QKZA 4LTUA 3C19A 2C5LC 2MA9B 5HFYA 2LD9A 1EWCA 2Z8LA 1WJ6A 1V9JA 1XF5L 4R3DA 1RFAA 1WM2A 4J6IA 1SJED 1WXVA 1ET6A 1N60A 1SXTA 3N20C 2KDEB 2KQSA 4A6QA 2O2VB 3N30A 1L2NA 1UZXB 3V60A 2D3CA 5IO9A 2G3QB 4W9CA 1JWBD 1C3TA 4LDTB 4AJWA 1B1ZA 3VR8B 4FJYA 4KDIC 2MP2B 4DDGD 2HDEA 4CHKA 2OJRA 1F9JA 1UUPA 3A9JB 4M8NA 3AMZA 1IP9A 3RUIB 1SSNA 3DPDA 3RZFA 4GDLB 4OVUA 4ICUA 4W9HA 1WFYA 1I4HA 3PT2B 3NS1A 3N1XC 3IBEA 4IG7B 3BIID 1T0QC 3BK2A 1K52A 3SFEB 4I6PA 3OJ4B 1SE2A 1R4NB 2WXHA 2KDBA 3V6EB 3CIRB 3IVFA 5AUIA 1VR9A 5AZGA 4BOSC 1F52A 4MM3A 4C4VB 3ZVVA 1R4NI 3TEWA 2O6VB 4ZRIA 2OHFA 4ANWA 5LNK1 1A70A 4LNKA 4KKJA 2LZ6A 2NCNA 5D94A 4DXAB 3TEZA 3KW5B 1FM0D 1GB4A 3ZJUA 1SF0A 3UIPB 1I4PA 4TMAB 1WMHA 2BYEA 3SDLC 3ECIA 2UU7A 1T0YA 2WXRA 2ZPYA 1YMHE 3MHZA 1RWSA 1WRIA 3KUZA 2D5GA 2M1MA 3CSTA 4IWOA 1YD8U 4WJQA 1KLUD 4KDLB 3RI7C 3EFUA 3N9YC 2JWZA 1Z5SB 2MHJA 4PYUA 4DDID 3BYYB 4BAXA 3TJPA 3BVMA 5I4DA 4MJSA 5AUKA 2G1EA 2W54A 4LK0M 3SFDB 2WXKA 1TKEA 2M0XA 3R2TA 4P1CC 3B2GA 2FBWB 3JVZX 2KTFA 1FNUA 4F8CB 1L0XB 4E74A 5L95C 4A3OA 1V1PA 3B2FA 4FJVB 1VZ7A 2DYMA 2BF8B 1I4GA 3NVVA 3HRDD 1GUAB 2X8XX 1WR6E 2DZMA 2LXAA 3BWUD 4B95A 4HPMB 1T6BX 4NQKE 4C7ZA 1CQVA 2DAJA 1N62A 2JVCA 2K3UA 4C00A 3DWGC 3Q3NC 2H89B 3OJ3A 4W9KA 1YQ3B 2DWQA 1WXQA 1WJUA 3ENEA 3AEBB 2LVPA 2DZKA 3Q3OC 2DYBA 4IW0A 5KHQA 2IJ0A 4FADA 1Q5WB 2D2QA 1JWUD 1NBFC 4WURA 2JYEA 1WF9A 3CSFA 3PZ8A 1E6EB 3QC8B 2PVGC 4ZRPA 2WX0A 3BK1A 3APCA 1GJZA 1WZ0A 4A90A 3GE8C 2MJDA 1C79A 3P42A 5IOIA 5TR5A 3AE7B 3DBRB 1WGGA 2WXLA 2GLSA 2O2VA 3B1LX 1J7CA 1V97A 2DYOA 5IN7A 1LXDA 2KMCA 4KVGB 1A5RA 3P4PB 5LXIB 1EF1A 3DBRI 2OOBB 3QIJA 4S0RA 2ZVNA 5C2TB 4M0WB 2WXQA 2MP2A 3QCAA 2D10A 2KQ4X 1ZKHA 1OQRA 4RNAA 3BYTB 3VXWA 3I9V1 1WJ4A 2WDQB 1P9DU 3AECB 2CU1A 1MVKA 1WGKA 3KWLA 3L10B 2KX3A 4K81A 1TYGB 4ZDVA 1E8YA 3DVNV 1QLBB 1WGHA 2YEPB 3PRMB 1SGHA 2K22A 4KIKB 1HE8A 1MJDA 2ZVOA 2V4IB 4ASWC 3EC8A 4G3XB 2WXIA 2DBYA 3SHQA 1CMXB 2BYTA 4RGNA 4C4VA 1PUTA 2MBOA 3LXFA 2AQ3B 2LHEA 1TJEA 2O6VA 2WX1A 1TT5B 1OQYA 2JRHA 3EUB2 2MWSB 4WH4A 4RM9A 2KWVB 2ZW1A 4N9F4 4XGAB 1FNVA 2BWES 3GZNB 2PJHA 2DZJA 2HJ1A 1V86A 3BINA 4EZJA 1QQRA 4MSQB 3DDCB 5IP4D 2K6DB 3ZXVA 5BYQA 3GZNI 2VZKB 5CTRC 3IG3A 2PIAA 3BZDB 2UWQA 4E3CA 4XE0A 1T3QA 2LRUA 3JSVA 3BY4B 4B6WA 2JF5A 3ZDMC 2NTSA 2WP9B 2BGFA 1JWMD 3ETRA 4LNNA 2LVQA 2M0AA 2JQRB 1ZDVA 4L1BA 3P4SB 1STEA 5JHAA 1V2YA 2JT4B 3FILA 3ZNZB 2WXJA 1YX5B 3EHVA 3EA6A 3ZGZA 3V6CB 4QAYA 1FPYA 3AM9A 4FULA 4LNFA 1J19A 1AW7A 1V5OA 1I4QA 3VQIA 3QAQA 3DOWA 2RSUA 2GBNA 2QCZA 2KVZA 3JW0X 1C4AA 2CHXA 2JU6X 1MPEA 4XX5A 1GAQB 4HXDA 1ET9A 1GOZA 3PO0A 5EDSA 1FEHA 4LCDE 2JZZA 3PTFC 4YSZB 4EUTA 2RR9A 3JYUA 3GB1A 4HWIB 4P6VF 3H9DA 2D11A 4GXBA 2ON8A 1TY0A 2G9HD 3I3TB 3A9KB 1ZGUB 2KWUB 5G5HA 2N7JA 2G4SA 2J0MA 4HRSA 4WJOA 3AB5A 2ICIA 3W2DA 3LDZE 2C9WB 3E56A 3A4SC 1IUEA 1OEYJ 3RT3B 2B3AA 3IAS1 4A55A 3UI3A 3ZYYX 1WZ3A 2K1FA 2AX5A 4W9FA 1P1AA 4MM3B 3MC8A 1G6JA 4IWPA 2KYWA 4M0WA 4WQOB 1OTRB 1QOAA 2EMSA 3KH0A 1MG4A 1JALA 3VTWA 2MBBB 2KT7A 3ZO5B 5H92C 4HJGE 3OAWA 2LRWA 4C80A 1WE7A 2IBIB 2HD5B 2LGSA 2NBWB 2INNE 2YEPF 3L16A 3GP7A 3RNAC 2MBHA 3DBLB 2DZIA 2OEDA 2MW5A 2LMCA 4KIKA 2Y3AA 5C23A 4RM8A 3KQ4A 1K53A 4NNJB 4XYCA 3DBLI 1WX9A 4DBGA 2WXPA 3AEFB 2FAZA 2NMQA 4JX1C 4RF0A 2V3NA 1LQBA 5FR3A 2A5UA 2KACA 3WALA 2JXTA 1D5MC 2JZ3B 4DHJB 4GOCA 1I7HA 1WXMA 3ZNHB 3EGRA 3ZNID 2KVRA 3ZLZA 2KMAA 3PPAA 4L23A 5EE1A 4S17A 1N5WA 3U4EG 1UGMA 4ZYSA 2N9PC 2IO2B 4IDIA 2J0JA 3AXCA 4W9JA 3MTNB 3W1SC 1FRDA 4N59A 4EZLA 2L76A 2N1VA 4US9A 2M4NA 3U30A 3B0AA 3O13A 2D3AA 4KSLC 3QHTA 3B08A 2IYDB 2MQJA 2DHZA 1M4VA 2GB1A 3HK0A 5J2RA 2ZNVB 3AE5B 3I5JC 1K50A 4AWJA 2TSSA 4EKUA 4HPPA 2WDTB 1L5PA 3Q3JA 3ZKJC 3AV8A 1FXAA 1UD7A 4CQNA 4C56C 1HXYD 3W9CB 3M95A 4DWFA 4HDQA 1ISNA 3PHXB 3QQ8B 3V61A 1NVID 3RNEC 5J18A 5D6JB 2KHWB 3M3JA 1M94A 2BKFA 4LDTD 3UINB 1R4MI 3R8BA 3NUHB 1PQSA 3L54A 4TQ0A 2IGGA 2VH1A 4DQOC 1GNUA 4J3OD 2QSDA 2IDYA 2N9LA 3PZDA 1KLGD 1SIJA 3DWMA 1N5XA 4ARIA 3ZRCA 3WAOA 3Q8BA 1YNTE 1WH3A 2MCNB 4ZYNA 5JZEB 4EFOA 4OHJA 1JCKB 3R3MA 2X38A 3X0WA 3MJ5A 4FHKA 4ZOHC 3Q8AA 1BUIC 1HZ6A 3UGBB 4W9DA 5HHDG 1JWSD 3AH7A 3U8ZA 3A9KA 1CZPA 4NPNA 4PK1A 2LHDA 3VTVA 3D32A 3AEAB 4JLCA 4NY0A 5BMHA 3NG0A 3DBSA 1SB3C 2XN9C 3P63A 5EE0A 2FCNA 1B9RA 3H6NA 1YJJA 2M56B 3BVGA 4NAWB 5H8YE 1HTOA 3H1UA 3RMKC 4KV2A 4ZRQA 3Q8CA 1P3QU 1KF6B 3QARA 2KD0A 2M17A 3NVYA 2KNBA 2CJNA 3NZSA 4BKSD 4F1SA 3E9SA 2I1KA 1CJEA 1KTKA 2E3TA 1V80A 1LO5D 3JSVB 4BZAA 3RNGC 4FLHA 4IM3A 4N58A 4CYEA 3AE4B 1DYQA 3H7SA 1E7UA 1C77A 2R2QA 2PE6B 3K9OB 3CWIA 4XC2A 5BO4B 3GOEA 1WXAA 2IGHA 3HHMA 3WIMA 4G50A 2AYOB 1IPGA 5EE3A 4YT0B 1TS2A 5LLIA 3NZ3A 4HPLB 3FILB 3VVWB 4HK2A 2V1YA 1FCLA 4E71A 1E8XA 4HCPB 2W55A 1WY8A 2CJOA 4BFRA 2WXFA 4JPSA 4P1BC 2K8HA 1DOXA 1EWYC 1PYWD 2J52A 1YOVB 2PTLA 3IFWB 4FN2A 1VCBA 2GBJA 2KJ6A 4AUQC 2NTTA 2EELA 2LXCA 1T0SC 3QX1A 4M02A 2K9XA 1WWTA 2HE7A 3SD5A 3RULA 3TMPB 5CHVC 4KGSA 2WHIA 4LNOA 4MGZE 4KSKC 2VH2A 5DCNA 4GU2A 1YJIA 2WDVB 3IAM1 2M19A 3MP9A 1EU4A 4M8MA 1V1OA 4YWGG 4JE3B 5AZFA 2JY6A 1WSPA 2KOXA 1FFUA 2CR5A 3H8HA 2XEWA 4IM0A 2EMTA 3EFCA 2KFJA 3TL5A 3HVZA 5HKHA 4C7YA 5BYRA 2FUG1 2MEKA 2LVOA 2FCSA 2PEAA 1FO4A 5T8IA 1QILA 2MX2A 1DOIA 3OWEB 4AJYB 3FAHA 1ZXIA 5GXGB 2JXXA 2GBRA 3DVNU 2PKOA 1TBEA 4HKZE 5JXVA 2KTRA 3ABVB 1N63A 2V4LA 3B9JA 4NJ7A 1IBXB 2L7RA 1ENFA 1QF6A 1GC7A 1YIWA 2G4DB 3RNFC 4OVVA 2KX0A 3QJZA 2IO0B 1ZE3D 4ZRJA 3VFKA 2H88B 2W3SA 3Q8FA 1Q10A 4FBJB 4OZCA 2AL3A 2HTME 2L8JA 4YTMB 4NJCA 3RPFC 1EUVB 2W82A 4JWSC 3J9CA 1I4RA 1DOYA 2KJHB 1J8CA 1XCQL 2BTEA 1D3ZA 4NAWA 3VRBB 2BB5A 4M00A 3I63C 4ANUA 1AWDA 2JYTA 2IPKD 1VDVA 2NBVB 1J7BA 1I42A 2XNAC 1QT9A 4YL8A 5IKCM 1EF5A 1F0ZA 5BMIA 2MLBA 4MACA 1J7AA 4M01A 3VAWA 1E8WA 4JWUC 3CF6E 3IT4B 2FCQA 4UDUC 4RGTA 4IUMB 4WWOA 4P7IA 3UQAA 3UIOB 1EO6A 1IGDA 2PMVA 4IOIE 3R2IA 5MPOA 3ML9A 2LFIA 3GE3C 1D5ZC 4K3BA 4KX6B 2WYQA 1HEZE 1WYWB 3EECA 2KWDA 2RD0A 1RAXA 1XLOA 1UGJA 5G55A 2WXNA 4F7ZA 3ZW3A 1JMLA 1N6ZA 2Y5PA 4JQWC 1L0VB 2N7EA 3Q3MC 1WJNA 3C8YA 3NS8A 5DPTA 3TEXA 2RGFA 3S2AA 3L08A 2KXJA 2RDGA 3PZ7A 4WWMA 1MHHE 1WYGA 2MRPA 4G0NB 2XK5A 1J0GA 1XO3A 2QILA 1D5XC 2AL6A 3V62A 1KLVA 3NVWA 4WWPA 2WXOA 3DHHC 2JUOA 4II3B 3KYCD 5EE9A 4IM2A 4HCNB 3U2SC 4ARCA 3NVZA 5CHFA 1L6UA 4YSYB 4ZRKA 2KANA 1F2RC 1C4CA 1P7EA 3RD2A 1TS4A 3ALBA 2LI5A 2MBQA 2FUHB 4AOFA 4MGIE 2QJLA 4O1NA 3A4RA 2N0SB 2BYFA 1IGCA 3DBHB 1V8CA 2AQ2B 2AWTA 3TCAA 4ITKA 2KDMA 1KM7A 1XQQA 2W9NA 1TY2A 4BVUC 2L3ZA 3A33B 1TKGA 3L4PA 3DBHI 2J42A 2MJEA 3WAMA 1IYFA 4X57B 4BKTA 4FJZA 1XLPA 4ACFA 4W9EA 1H8CA 2WXGA 3X23A 1RFKA 1NYQA 2EKIA 1HA5A 3VTUA 1ROEA 2GRIA 4FXCA 1IBXA 3HUIA 1I35A 3LB8C 3P4RB 1S3SG 1UWXA 3VUXA 2L32A 2WQYB 3ZTCA 2KLGA 4KZ0A 5C3JB 3TBLD 4ANXA 2BW2A 2LUEA 4KKIA 3KWVA 1S1QB 3TUOA 2SAKA 4OZAA 5E6OA 3IHPC 1F77A 4PS8A 4DHJD 1YJ1A 1HQRD 3TIXA 3P4QB 1QOGA 4REZA 4B0MA 1AARA 3DHIC 1L4ZB 2REXA 1TIFA 4JGHB 3ZQ4A 4GSWA 1WXSA 2E6XA 5AEKB 4TV3A 2K6QA 1JRPA 1NENB 4TQ1A 3N1YC 3VR9B 4EZKA 4KZCA 3M63B 2LASA 3AULA 1PFDA 1YN5A 1UBQA 3MJWA 1YQ4B 4TUUA 2JSVX 2KMMA 1ZXHA 2WXMA 2Z59B 3FC4A 5D3DA 4DXFA 3PHWB 3TSSA 5D3IB 2MSED 4GMVA 3APDA 3ZXRA 2I1JA 3PLUA 2FE8A 1JROA 3V3XA 2BS4B 3MC9A 3Q14C 1HTQA 3PRPB 2V3SA 1DGJA 5BYSA 4TKNA 1E9MA 4RMAA 2KJRA 1QOBA 2NPTB 4BOZB 3Q3FA 2NVUI 3R7QA 3PLVA 1R7SA 4FHJA 2Z0DB 1V81A 2J4XA 5E6JA 2QDFA 1R4MB 2PVOD 1FCCC 4GN1A 1FRRA 1UF0A 4K1RB 1KOTA 2BS2B 3NY5A 4MH0E 1K51A 2LEKA 2K5PA 1ZPSA 4GDKB 1XLNA 4HLEA 1XXGA 1VD2A 1H4RA 4NAMA 3RZWC 4DK5A 1MG8A 3BVZA 2CHWA 4PYZA 2JX5A 2LGXA 4W9IA 1RM6C 2W3RA 3SEBA 1NI3A 3GS2A 3Q8EA 2NS5A 3UQBA 3R7RA 4K7UA 3NZUA 2KTRB 2AEHA 2RDHA 3H7PA 1BMLC 2KC2A 2KDIA 3AN1A 3VH4B 4K7SA 1T0RC 3LYYA 4W9LA 1PGAA 1GPXA 4LJPB 5DPSA 3W1SA 3ZIMA 2LGDA 4MDKE 2C60A 4JL9A 4A3PA 3W5VB 2L00B 1FXIA 2O6VD 3C0RB 2QC8A 4IC7B 3ZRFA 2QHOA 5CHWA 1RRBA 2ZCCA 2QIEB 2QEJC 5IAAC 3NHEB 1Q0WB 2KK8A 2KFKB 4PT5A 5C1ZA 1T5XD 3AE2B 3U7DA 2ASQA 2IO3B 2Z0EB 2RMMA 3AE1B 2LJ5A 4XDCA 3IT6B 3RCZA 3CMMB 3LJ3A 2I2YA 2C7NB 2I38A 4HJKA 1VZ6A 2RPVA 2ZNVC 2KC1A 3T8MA 1NYRA 2MH7A 3HM6X 1LGRA 3A1QA 1X1MA 1Y8RC 4MGKE 3VH3B 4D2KA 1WGDA 1TZ1A 3WA0A 1XEEA 3QA8A 2LGIA 1EM7A 3L0WB 4GB9A 3KYDD 3ZDTA 3Q2AC 3AE8B 4GIVA 5DPRA 1UELA 2BBCA 1SBBB 2V9HA 1WX8A 2SEBD 1FMAD 2IY0B 3T3OA 2DX5B 1HZ5A 4RF1A 4CO7A 3RNBC 2KN4A 1FNWA 1RYJA 2L0FA 2WS3B 1JQ4A 4K3CA 2WWZA 3ZJVA 3NOBA 1SE3A 4W9GA 2BS3B 1PDXA 1KH0A 3R66C 1U4AA 5KHOA 2CU3A 2DLBA 1XCTL 3O65B 3L17A 2XK5B 3AE3B 3MC0B 4ANVA 1WI0A 3DQVA 2PW9A 4JIOU 4AQ7A 2ZZPB 1I4XA 2N7DA 4MELA 2GBMA 2WU2B 1E10A 2NPTA 3KUCB 4USAA 3ZNGC 3PSEB 1BT0A 2BB6A 2ZEQA 1NDDA 3AU5A 1XLQA 4YXDB 1XD3B 3UF8A 4TSSA 2ZW0A 3MHSD 2LGYA 3AEDB 1AN8A 1FXTB 5HG2A 1TS3A 2JRIB 4WWNA 3RFZB 1UH6A 2WDRB 2LJIA 2NR2A 4GDKA 3M62B 2M8SA 2BVCA 3VUWA 3PRZA 4A8XC 4BBNC 1QOFA 4FA6A 1WGYA 1OFFA 4DHZE 5JHBA 2BKRB 1YN3A 3Q69A 2V3PA 4MH8A 4A9AA 2IY1B 1V49A 1KRHA 4YTNB 2D3BA 1PGXA 1JRUA 1L4DB 1ESFA 1GC6A 2JWUA 2AQ1B 2IZVB 1E7PB 5FR6A 2WU5B 3N32A 2KKCA 4HROA 1WGRA 4XDDA 5G2NA 2KWCA 1OGWA 1L6VA 4RCOA 1QZEA 3TEYA 1PGBA 3HVDA 4ZHPA 1ZDXA 2N9XA 3AE9B 1WIAA 2G45B 3ML8A 1WRDB 4II2B 2V0GA 4XWWA 3RNCC 1JWAD 4GGQA 1D4BA 3VUYA 3DHGC 4G11A 2RPQA 1FFVA 2YVCA 2BYVE 4ICVA 3RN9C 1P0RA 3A9JA 4BBNF 2ONQA 4B9KA 3NRZA 4GDLA 2LWPA 3ZUNA 2KFKA 2N9EB 2ZCBA 1KFYB 4NJ6A 4RFBA 2KDFB 4PS7A 4WJNA 5E6NA 2VZKD 3FKYA 4IKGA 2PPHA 1TKYA 2KLCA 3SU8X 1CK1A 2C7HA 4HVBA 3HM3A 1YN4A 2D3GA 1ZP0B 2J53A 1WE6A 1ACCA 2EKEC 4WAFA 1Y56A 1F2RI 2UYZB 3DVGY 5JH5C 2BPSA 2KAJA 3NJTA 1D6EC 5AZHA 3OG5A 5BMGA 1UBIA 3ONSA 4OZBA 4EEWA 3N1ZC 4I6LB 2L83A 2DENB 4IWQA 2BWFA 2INDC 2NBUA 3VHTC 1SE4A 2Q5WD 3DVGX 3SR6A 3APFA 1WX7A 1E5WA 3IXSA 3WCQA 2DAFA 4RGMA 2L52A 4OW0A 1TS5A 4EOYA 3RYTA 5G5GA 4XZ4A 1E8ZA 2K25A 3MFGA 3PGEA 2KQ7A 1ZOYB 1XT9B 1E0ZA 4NQLB 2A4ZA 1LM8B 1YX6B 4BKSA 1MFWA 4NZLB 3P1MA 4DHZB 1C76A 1FIQA 2R61A 1C9FA 3PV1A 3U52E 2INPE 1L0YB 5J17A 3URYA 2GOWA 2CHZA 4URKA 2IGDA 4KGTA 1E7VA 2ZPNA 3V05A 4BKGA 2HTHA 5E6PA 3W5UB 2FCMA 2ZJDA 2KN5A 5LXHA 4US8A 3DCGA 2WLBA 3H7PB 5CX3A 1UWMA 2GI9A 2IO1B 3AEGB 1SE9A 2CKHB 1VLBA 3Q6BA 4LNIA 4ZHOA 2J0KA 5D2MB 2D07B 4MSMB 2INCC 1NEKB 3P2BA 4DXGA 2BT6A 2K0PA 2PLPA 2JPHA 2FIDA 4XWTA 5FK9C 3K9PB 4OVZA 4RGOS 3OLMD 2KZRA 1RLFA 2RDBC 5DPWA 3AU4A 1V5TA 2B76B 3AI5A 2Y5CA 1WM3A 2BQQA 3QWZB 2J7QB 3I57A 5L83A 5HI1A 4YTPB 1F1HA 2L0TA 2FIFA 1LFDA 4LLGM 3T9LA 3N3KB 1OEYA 1GB1A 1TGZB 1N61A 1VZ8A 3AEEB
chains in the Genus database with same CATH topology
2LXCA 2CS4A 2PJHA 2DZJA 1V86A 2NS5A 3BINA 3QX1A 4LJOB 4A20A 3UQBA 3R7RA 4EZJA 4MSQB 2HE7A 3SD5A 3RULA 3WAPA 4K7UA 3DDCB 3NZUA 2KTRB 1NI2A 2AEHA 2YLMA 2K6DB 5CHVC 3PVLA 3TMPB 3H7PA 4HDOA 3A1QB 4MGZE 1K8RB 2KC2A 2KDIA 2Y5BB 4KSKC 3VH4B 4K7SA 3GZNI 5CTRC 2C7MB 3IG3A 4GU2A 5DCNA 2UWQA 4E3CA 4W9LA 1P98A 3KVFB 4LJPB 2N4FA 5DPSA 3W1SA 2GMIC 2LRUA 2LGDA 3ZIMA 3JSVA 3BY4B 4MDKE 4B6WA 2C60A 2HJ8A 3QK0A 2JF5A 4M8MA 1WMHB 2MBEA 4JL9A 3ZDMC 4A3PA 2K8CA 4MGYE 2BGFA 2L00B 2XBBC 5AZFA 2JY6A 2O6VD 3C0RB 1V6EA 4WJPA 4IC7B 2KOXA 3ZRFA 2QHOA 5CHWA 2CR5A 2KO3A 2LVQA 2R2OA 2XEWA 4IM0A 1RRBA 2EMTA 2ZCCA 2KFJA 2VRRB 3ZTDA 3TL5A 5HKHA 3WANA 3HIZA 5IAAC 5JHAA 1V2YA 3NHEB 1Q0WB 2KK8A 2JT4B 1TTNA 3ZNZB 2KFKB 2LVOA 1YX5B 2FCSA 3EHVA 1KJTA 2PEAA 5C1ZA 4I6NB 3V6CB 2GBKA 2MX2A 4MJSB 4MEMA 3U7DA 3VDZA 4AJYB 2ASQA 2PE9A 2IO3B 2Z0EB 4FULA 2JXXA 1SIFA 2LJ5A 2K8BA 2GBRA 3RCZA 3CMMB 1J19A 3LJ3A 3L13A 3DVNU 1V5OA 3KUDB 3VQIA 2C7NB 5D7GA 1TBEA 4HJKA 2L05A 2ZNVC 3QAQA 3DOWA 1GG3A 2KC1A 2RSUA 2GBNA 2KTRA 3T8MA 2V4LA 3HM6X 4AP4C 4NJ7A 4PS3A 1E90A 3A1QA 1X1MA 1Y8RC 3JW0X 2L7RA 4MGKE 3VH3B 1WGDA 2CHXA 1GC7A 1YIWA 1Q1OA 1TZ1A 2G4DB 3WA0A 4XX5A 5IA7A 3PREA 1L7YA 3W1YA 1YQBA 3QA8A 3PS6A 4OVVA 4HXDA 3L0WB 2N1WA 2KX0A 4GB9A 1WR1A 1Z2MA 3QJZA 5GMVA 5EDSA 3KYDD 4LCDE 2IO0B 3ZDTA 2JZZA 3PTFC 4GIVA 5DPRA 4EUTA 1UELA 4ZRJA 2RR9A 3VFKA 3JYUA 4HWIB 1WX8A 4K7WA 3H9DA 2D11A 2FNJB 4GXBA 2IY0B 2DX5B 4FBJB 2K39A 4CO7A 3I3TB 2AL3A 3A9KB 1ZGUB 2KWUB 2L8JA 4WAAA 1ZW7A 2G4SA 1C1YB 2L0FA 2J0MA 1EUVB 4WJOA 2WWZA 2C5LC 3NOBA 3LDZE 2C9WB 2MA9B 2LD9A 2KJHB 4W9GA 1J8CA 1D3ZA 3A4SC 4NAWA 1OEYJ 4ANUA 3RT3B 1WJ6A 2B3AA 1V9JA 3R66C 1U4AA 5KHOA 2NBVB 3O65B 1I42A 3L17A 1WZ3A 2K1FA 1RFAA 4YL8A 4W9FA 1WM2A 4J6IA 1EF5A 1WXVA 2XK5B 1P1AA 4ANVA 1WI0A 3DQVA 2MLBA 2KDEB 2KQSA 4JIOU 3VAWA 2O2VB 1E8WA 2ZZPB 3N30A 3CF6E 4IWPA 1G6JA 1UZXB 2FCQA 1L2NA 4WQOB 2N7DA 4MELA 3V60A 1OTRB 2G3QB 4W9CA 2EMSA 3KH0A 2GBMA 4IUMB 4WWOA 4P7IA 3UQAA 1C3TA 2NPTA 3KUCB 4LDTB 3UIOB 3VTWA 3ZNGC 2MBBB 4AJWA 3PSEB 1BT0A 3ZO5B 1EO6A 2ZEQA 2LRWA 1NDDA 3OAWA 1WE7A 2IBIB 3AU5A 2HD5B 2NBWB 3ML9A 3L16A 1XD3B 3UF8A 3MHSD 4FJYA 2LGYA 4KDIC 2WYQA 2MP2B 4DDGD 2MBHA 1FXTB 2DZIA 1WYWB 3EECA 4CHKA 2RD0A 2JRIB 2MW5A 4WWNA 1RAXA 4KIKA 2OJRA 1F9JA 1UH6A 3A9JB 4M8NA 5G55A 5C23A 1IP9A 3RUIB 3DPDA 3RZFA 4GDLB 2NR2A 4GDKA 4OVUA 4RM8A 4ICUA 3M62B 4NNJB 2M8SA 4F7ZA 4W9HA 3VUWA 3PRZA 1WFYA 3DBLI 4BBNC 1WX9A 4FA6A 3PT2B 4DBGA 1WGYA 3ZW3A 2FAZA 4DHZE 4JQWC 2N7EA 5JHBA 2BKRB 3IBEA 4IG7B 1LQBA 1WJNA 2A5UA 2IY1B 3NS8A 1V49A 4I6PA 3OJ4B 5DPTA 2RGFA 3WALA 3S2AA 3L08A 2KXJA 1JRUA 2KDBA 3V6EB 2JZ3B 4DHJB 1GC6A 4GOCA 1WXMA 3ZNHB 3IVFA 3ZNID 2KVRA 2IZVB 2MRPA 4G0NB 3ZLZA 2KMAA 2XK5A 5AZGA 3PPAA 5FR6A 3N32A 4BOSC 1J0GA 2KKCA 1UGMA 1WGRA 4MM3A 5G2NA 2KWCA 2AL6A 3V62A 1KLVA 3ZVVA 2N9PC 1OGWA 4WWPA 1R4NI 2IO2B 1QZEA 2O6VB 4ZRIA 4ANWA 2J0JA 3AXCA 4W9JA 3MTNB 2N9XA 1WIAA 2G45B 2LZ6A 3ML8A 3W1SC 1WRDB 2NCNA 5D94A 4II2B 4EZLA 2L76A 2N1VA 4DXAB 2M4NA 3KW5B 3U30A 2JUOA 4II3B 3KYCD 3B0AA 4IM2A 4HCNB 4KSLC 3UIPB 3QHTA 3B08A 2IYDB 2MQJA 2DHZA 3HK0A 5CHFA 1WMHA 5J2RA 2BYEA 3SDLC 4GGQA 3ECIA 2ZNVB 1T0YA 3VUYA 2ZPYA 4ZRKA 4AWJA 2KANA 4EKUA 4G11A 2RPQA 2YVCA 3KUZA 3RD2A 2BYVE 2WDTB 4ICVA 3ALBA 3Q3JA 1P0RA 2LI5A 2MBQA 3A9JA 3ZKJC 2M1MA 3CSTA 4IWOA 1YD8U 4B9KA 4BBNF 4WJQA 4GDLA 1UD7A 2FUHB 4KDLB 3EFUA 4AOFA 2LWPA 3M95A 4MGIE 4DWFA 3A4RA 3ZUNA 2JWZA 4HDQA 1ISNA 1Z5SB 2BYFA 2KFKA 3PHXB 3QQ8B 4PYUA 2N9EB 2ZCBA 3V61A 4DDID 4NJ6A 2KDFB 2AWTA 4PS7A 3TCAA 4WJNA 5E6NA 3TJPA 5J18A 4MJSA 5D6JB 1KM7A 1XQQA 2KHWB 3M3JA 1M94A 2BKFA 4LDTD 3UINB 1R4MI 2W9NA 2PPHA 2KLCA 4BVUC 3SU8X 1PQSA 3L54A 2C7HA 2L3ZA 2M0XA 3HM3A 2D3GA 4TQ0A 3A33B 4HVBA 3DBHI 1GNUA 3WAMA 3JVZX 2KTFA 4F8CB 1IYFA 4X57B 4BKTA 4E74A 4FJZA 4A3OA 5L95C 1WE6A 3PZDA 4W9EA 2DYMA 2EKEC 4FJVB 2BF8B 2UYZB 3DVGY 3X23A 3ZRCA 5JH5C 3WAOA 1H8CA 2BPSA 3VTUA 5AZHA 1GUAB 1UBIA 3ONSA 1I35A 1WH3A 1WR6E 2MCNB 4EEWA 4ZYNA 4I6LB 2DZMA 1S3SG 2DENB 5JZEB 3VUXA 4EFOA 2LXAA 4B95A 3ZTCA 4IWQA 2BWFA 2NBUA 4HPMB 3VHTC 4NQKE 2KLGA 2DAJA 2JVCA 3DVGX 3R3MA 3OJ3A 4KZ0A 4W9KA 3X0WA 3APFA 1WX7A 1E5WA 4FHKA 2DAFA 3TBLD 4ANXA 2LUEA 1WJUA 4EOYA 3RYTA 3ENEA 1S1QB 4XZ4A 3UGBB 1E8ZA 4W9DA 5E6OA 3IHPC 2LVPA 2DZKA 2K25A 4PS8A 4DHJD 3U8ZA 3PGEA 3A9KA 2DYBA 4IW0A 1YJ1A 4NPNA 3TIXA 5KHQA 2KQ7A 3VTVA 1XT9B 3D32A 4FADA 1Q5WB 1AARA 2A4ZA 2D2QA 4NQLB 1LM8B 1NBFC 1YX6B 4BKSA 2REXA 4JGHB 1WF9A 3CSFA 4GSWA 1WXSA 3QC8B 4DHZB 5AEKB 4JLCA 4NY0A 4TV3A 2K6QA 2WX0A 4TQ1A 3PV1A 3APCA 3DBSA 4EZKA 4KZCA 1GJZA 3M63B 1WZ0A 2LASA 3AULA 1UBQA 2FCNA 5J17A 5TR5A 3MJWA 2GOWA 3H6NA 4TUUA 1WGGA 2CHZA 2Z59B 2O2VA 4URKA 4NAWB 3B1LX 3H1UA 1E7VA 2DYOA 4KV2A 2ZPNA 4BKGA 3PHWB 2HTHA 1LXDA 5E6PA 2KMCA 4KVGB 1A5RA 1P3QU 2MSED 4GMVA 5LXIB 1EF1A 3DBRI 3APDA 2KD0A 2I1JA 2FCMA 2M17A 3QARA 2ZJDA 2KNBA 3PLUA 2KN5A 2OOBB 5LXHA 3QIJA 3NZSA 2ZVNA 3DCGA 4BKSD 3H7PB 5CX3A 3PRPB 4M0WB 4F1SA 2V3SA 2I1KA 4TKNA 2MP2A 3QCAA 2D10A 4RMAA 2IO1B 1ZKHA 1SE9A 2KJRA 2CKHB 1V80A 2NPTB 4BOZB 3Q3FA 3VXWA 2J0KA 5D2MB 1WJ4A 2NVUI 3R7QA 2D07B 3PLVA 4MSMB 1P9DU 4FHJA 2CU1A 2Z0DB 1V81A 3P2BA 3JSVB 3L10B 2KX3A 4K81A 4FLHA 2JPHA 4GN1A 4IM3A 2FIDA 4K1RB 4CYEA 1KOTA 3H7SA 3K9PB 1E8YA 1E7UA 4ZDVA 3DVNV 2R2QA 1WGHA 3NY5A 4MH0E 3PRMB 1SGHA 2PE6B 2KZRA 1RLFA 3K9OB 3OLMD 4KIKB 4XC2A 5BO4B 5DPWA 3GOEA 3AU4A 1WXAA 1V5TA 3AI5A 3HHMA 3WIMA 1HE8A 4G50A 2AYOB 1IPGA 4GDKB 2ZVOA 1WM3A 5LLIA 4HPLB 4ASWC 3VVWB 3QWZB 4HK2A 1VD2A 4HLEA 2V1YA 3EC8A 4E71A 1E8XA 1H4RA 4HCPB 4G3XB 3RZWC 2J7QB 3SHQA 4DK5A 1WY8A 1CMXB 4BFRA 1MG8A 2CHWA 5L83A 4PYZA 2MBOA 2K8HA 2LGXA 4W9IA 2L0TA 2O6VA 2FIFA 2WX1A 1LFDA 3IFWB 1OQYA 2JRHA 4FN2A 3N3KB 2MWSB 3T9LA 1OEYA 1VCBA 2GBJA 4RM9A 2KWVB 4N9F4 1TGZB 2KJ6A 4AUQC 2BWES
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXC A;  2CS4 A;  2PJH A;  2DZJ A;  1V86 A;  2NS5 A;  3BIN A;  3QX1 A;  4LJO B;  4A20 A;  3UQB A;  3R7R A;  4EZJ A;  4MSQ B;  2HE7 A;  3SD5 A;  3RUL A;  3WAP A;  4K7U A;  3DDC B;  3NZU A;  2KTR B;  1NI2 A;  2AEH A;  2YLM A;  2K6D B;  5CHV C;  3PVL A;  3TMP B;  3H7P A;  4HDO A;  3A1Q B;  4MGZ E;  1K8R B;  2KC2 A;  2KDI A;  2Y5B B;  4KSK C;  3VH4 B;  4K7S A;  3GZN I;  5CTR C;  2C7M B;  3IG3 A;  4GU2 A;  5DCN A;  2UWQ A;  4E3C A;  4W9L A;  1P98 A;  3KVF B;  4LJP B;  2N4F A;  5DPS A;  3W1S A;  2GMI C;  2LRU A;  2LGD A;  3ZIM A;  3JSV A;  3BY4 B;  4MDK E;  4B6W A;  2C60 A;  2HJ8 A;  3QK0 A;  2JF5 A;  4M8M A;  1WMH B;  2MBE A;  4JL9 A;  3ZDM C;  4A3P A;  2K8C A;  4MGY E;  2BGF A;  2L00 B;  2XBB C;  5AZF A;  2JY6 A;  2O6V D;  3C0R B;  1V6E A;  4WJP A;  4IC7 B;  2KOX A;  3ZRF A;  2QHO A;  5CHW A;  2CR5 A;  2KO3 A;  2LVQ A;  2R2O A;  2XEW A;  4IM0 A;  1RRB A;  2EMT A;  2ZCC A;  2KFJ A;  2VRR B;  3ZTD A;  3TL5 A;  5HKH A;  3WAN A;  3HIZ A;  5IAA C;  5JHA A;  1V2Y A;  3NHE B;  1Q0W B;  2KK8 A;  2JT4 B;  1TTN A;  3ZNZ B;  2KFK B;  2LVO A;  1YX5 B;  2FCS A;  3EHV A;  1KJT A;  2PEA A;  5C1Z A;  4I6N B;  3V6C B;  2GBK A;  2MX2 A;  4MJS B;  4MEM A;  3U7D A;  3VDZ A;  4AJY B;  2ASQ A;  2PE9 A;  2IO3 B;  2Z0E B;  4FUL A;  2JXX A;  1SIF A;  2LJ5 A;  2K8B A;  2GBR A;  3RCZ A;  3CMM B;  1J19 A;  3LJ3 A;  3L13 A;  3DVN U;  1V5O A;  3KUD B;  3VQI A;  2C7N B;  5D7G A;  1TBE A;  4HJK A;  2L05 A;  2ZNV C;  3QAQ A;  3DOW A;  1GG3 A;  2KC1 A;  2RSU A;  2GBN A;  2KTR A;  3T8M A;  2V4L A;  3HM6 X;  4AP4 C;  4NJ7 A;  4PS3 A;  1E90 A;  3A1Q A;  1X1M A;  1Y8R C;  3JW0 X;  2L7R A;  4MGK E;  3VH3 B;  1WGD A;  2CHX A;  1GC7 A;  1YIW A;  1Q1O A;  1TZ1 A;  2G4D B;  3WA0 A;  4XX5 A;  5IA7 A;  3PRE A;  1L7Y A;  3W1Y A;  1YQB A;  3QA8 A;  3PS6 A;  4OVV A;  4HXD A;  3L0W B;  2N1W A;  2KX0 A;  4GB9 A;  1WR1 A;  1Z2M A;  3QJZ A;  5GMV A;  5EDS A;  3KYD D;  4LCD E;  2IO0 B;  3ZDT A;  2JZZ A;  3PTF C;  4GIV A;  5DPR A;  4EUT A;  1UEL A;  4ZRJ A;  2RR9 A;  3VFK A;  3JYU A;  4HWI B;  1WX8 A;  4K7W A;  3H9D A;  2D11 A;  2FNJ B;  4GXB A;  2IY0 B;  2DX5 B;  4FBJ B;  2K39 A;  4CO7 A;  3I3T B;  2AL3 A;  3A9K B;  1ZGU B;  2KWU B;  2L8J A;  4WAA A;  1ZW7 A;  2G4S A;  1C1Y B;  2L0F A;  2J0M A;  1EUV B;  4WJO A;  2WWZ A;  2C5L C;  3NOB A;  3LDZ E;  2C9W B;  2MA9 B;  2LD9 A;  2KJH B;  4W9G A;  1J8C A;  1D3Z A;  3A4S C;  4NAW A;  1OEY J;  4ANU A;  3RT3 B;  1WJ6 A;  2B3A A;  1V9J A;  3R66 C;  1U4A A;  5KHO A;  2NBV B;  3O65 B;  1I42 A;  3L17 A;  1WZ3 A;  2K1F A;  1RFA A;  4YL8 A;  4W9F A;  1WM2 A;  4J6I A;  1EF5 A;  1WXV A;  2XK5 B;  1P1A A;  4ANV A;  1WI0 A;  3DQV A;  2MLB A;  2KDE B;  2KQS A;  4JIO U;  3VAW A;  2O2V B;  1E8W A;  2ZZP B;  3N30 A;  3CF6 E;  4IWP A;  1G6J A;  1UZX B;  2FCQ A;  1L2N A;  4WQO B;  2N7D A;  4MEL A;  3V60 A;  1OTR B;  2G3Q B;  4W9C A;  2EMS A;  3KH0 A;  2GBM A;  4IUM B;  4WWO A;  4P7I A;  3UQA A;  1C3T A;  2NPT A;  3KUC B;  4LDT B;  3UIO B;  3VTW A;  3ZNG C;  2MBB B;  4AJW A;  3PSE B;  1BT0 A;  3ZO5 B;  1EO6 A;  2ZEQ A;  2LRW A;  1NDD A;  3OAW A;  1WE7 A;  2IBI B;  3AU5 A;  2HD5 B;  2NBW B;  3ML9 A;  3L16 A;  1XD3 B;  3UF8 A;  3MHS D;  4FJY A;  2LGY A;  4KDI C;  2WYQ A;  2MP2 B;  4DDG D;  2MBH A;  1FXT B;  2DZI A;  1WYW B;  3EEC A;  4CHK A;  2RD0 A;  2JRI B;  2MW5 A;  4WWN A;  1RAX A;  4KIK A;  2OJR A;  1F9J A;  1UH6 A;  3A9J B;  4M8N A;  5G55 A;  5C23 A;  1IP9 A;  3RUI B;  3DPD A;  3RZF A;  4GDL B;  2NR2 A;  4GDK A;  4OVU A;  4RM8 A;  4ICU A;  3M62 B;  4NNJ B;  2M8S A;  4F7Z A;  4W9H A;  3VUW A;  3PRZ A;  1WFY A;  3DBL I;  4BBN C;  1WX9 A;  4FA6 A;  3PT2 B;  4DBG A;  1WGY A;  3ZW3 A;  2FAZ A;  4DHZ E;  4JQW C;  2N7E A;  5JHB A;  2BKR B;  3IBE A;  4IG7 B;  1LQB A;  1WJN A;  2A5U A;  2IY1 B;  3NS8 A;  1V49 A;  4I6P A;  3OJ4 B;  5DPT A;  2RGF A;  3WAL A;  3S2A A;  3L08 A;  2KXJ A;  1JRU A;  2KDB A;  3V6E B;  2JZ3 B;  4DHJ B;  1GC6 A;  4GOC A;  1WXM A;  3ZNH B;  3IVF A;  3ZNI D;  2KVR A;  2IZV B;  2MRP A;  4G0N B;  3ZLZ A;  2KMA A;  2XK5 A;  5AZG A;  3PPA A;  5FR6 A;  3N32 A;  4BOS C;  1J0G A;  2KKC A;  1UGM A;  1WGR A;  4MM3 A;  5G2N A;  2KWC A;  2AL6 A;  3V62 A;  1KLV A;  3ZVV A;  2N9P C;  1OGW A;  4WWP A;  1R4N I;  2IO2 B;  1QZE A;  2O6V B;  4ZRI A;  4ANW A;  2J0J A;  3AXC A;  4W9J A;  3MTN B;  2N9X A;  1WIA A;  2G45 B;  2LZ6 A;  3ML8 A;  3W1S C;  1WRD B;  2NCN A;  5D94 A;  4II2 B;  4EZL A;  2L76 A;  2N1V A;  4DXA B;  2M4N A;  3KW5 B;  3U30 A;  2JUO A;  4II3 B;  3KYC D;  3B0A A;  4IM2 A;  4HCN B;  4KSL C;  3UIP B;  3QHT A;  3B08 A;  2IYD B;  2MQJ A;  2DHZ A;  3HK0 A;  5CHF A;  1WMH A;  5J2R A;  2BYE A;  3SDL C;  4GGQ A;  3ECI A;  2ZNV B;  1T0Y A;  3VUY A;  2ZPY A;  4ZRK A;  4AWJ A;  2KAN A;  4EKU A;  4G11 A;  2RPQ A;  2YVC A;  3KUZ A;  3RD2 A;  2BYV E;  2WDT B;  4ICV A;  3ALB A;  3Q3J A;  1P0R A;  2LI5 A;  2MBQ A;  3A9J A;  3ZKJ C;  2M1M A;  3CST A;  4IWO A;  1YD8 U;  4B9K A;  4BBN F;  4WJQ A;  4GDL A;  1UD7 A;  2FUH B;  4KDL B;  3EFU A;  4AOF A;  2LWP A;  3M95 A;  4MGI E;  4DWF A;  3A4R A;  3ZUN A;  2JWZ A;  4HDQ A;  1ISN A;  1Z5S B;  2BYF A;  2KFK A;  3PHX B;  3QQ8 B;  4PYU A;  2N9E B;  2ZCB A;  3V61 A;  4DDI D;  4NJ6 A;  2KDF B;  2AWT A;  4PS7 A;  3TCA A;  4WJN A;  5E6N A;  3TJP A;  5J18 A;  4MJS A;  5D6J B;  1KM7 A;  1XQQ A;  2KHW B;  3M3J A;  1M94 A;  2BKF A;  4LDT D;  3UIN B;  1R4M I;  2W9N A;  2PPH A;  2KLC A;  4BVU C;  3SU8 X;  1PQS A;  3L54 A;  2C7H A;  2L3Z A;  2M0X A;  3HM3 A;  2D3G A;  4TQ0 A;  3A33 B;  4HVB A;  3DBH I;  1GNU A;  3WAM A;  3JVZ X;  2KTF A;  4F8C B;  1IYF A;  4X57 B;  4BKT A;  4E74 A;  4FJZ A;  4A3O A;  5L95 C;  1WE6 A;  3PZD A;  4W9E A;  2DYM A;  2EKE C;  4FJV B;  2BF8 B;  2UYZ B;  3DVG Y;  3X23 A;  3ZRC A;  5JH5 C;  3WAO A;  1H8C A;  2BPS A;  3VTU A;  5AZH A;  1GUA B;  1UBI A;  3ONS A;  1I35 A;  1WH3 A;  1WR6 E;  2MCN B;  4EEW A;  4ZYN A;  4I6L B;  2DZM A;  1S3S G;  2DEN B;  5JZE B;  3VUX A;  4EFO A;  2LXA A;  4B95 A;  3ZTC A;  4IWQ A;  2BWF A;  2NBU A;  4HPM B;  3VHT C;  4NQK E;  2KLG A;  2DAJ A;  2JVC A;  3DVG X;  3R3M A;  3OJ3 A;  4KZ0 A;  4W9K A;  3X0W A;  3APF A;  1WX7 A;  1E5W A;  4FHK A;  2DAF A;  3TBL D;  4ANX A;  2LUE A;  1WJU A;  4EOY A;  3RYT A;  3ENE A;  1S1Q B;  4XZ4 A;  3UGB B;  1E8Z A;  4W9D A;  5E6O A;  3IHP C;  2LVP A;  2DZK A;  2K25 A;  4PS8 A;  4DHJ D;  3U8Z A;  3PGE A;  3A9K A;  2DYB A;  4IW0 A;  1YJ1 A;  4NPN A;  3TIX A;  5KHQ A;  2KQ7 A;  3VTV A;  1XT9 B;  3D32 A;  4FAD A;  1Q5W B;  1AAR A;  2A4Z A;  2D2Q A;  4NQL B;  1LM8 B;  1NBF C;  1YX6 B;  4BKS A;  2REX A;  4JGH B;  1WF9 A;  3CSF A;  4GSW A;  1WXS A;  3QC8 B;  4DHZ B;  5AEK B;  4JLC A;  4NY0 A;  4TV3 A;  2K6Q A;  2WX0 A;  4TQ1 A;  3PV1 A;  3APC A;  3DBS A;  4EZK A;  4KZC A;  1GJZ A;  3M63 B;  1WZ0 A;  2LAS A;  3AUL A;  1UBQ A;  2FCN A;  5J17 A;  5TR5 A;  3MJW A;  2GOW A;  3H6N A;  4TUU A;  1WGG A;  2CHZ A;  2Z59 B;  2O2V A;  4URK A;  4NAW B;  3B1L X;  3H1U A;  1E7V A;  2DYO A;  4KV2 A;  2ZPN A;  4BKG A;  3PHW B;  2HTH A;  1LXD A;  5E6P A;  2KMC A;  4KVG B;  1A5R A;  1P3Q U;  2MSE D;  4GMV A;  5LXI B;  1EF1 A;  3DBR I;  3APD A;  2KD0 A;  2I1J A;  2FCM A;  2M17 A;  3QAR A;  2ZJD A;  2KNB A;  3PLU A;  2KN5 A;  2OOB B;  5LXH A;  3QIJ A;  3NZS A;  2ZVN A;  3DCG A;  4BKS D;  3H7P B;  5CX3 A;  3PRP B;  4M0W B;  4F1S A;  2V3S A;  2I1K A;  4TKN A;  2MP2 A;  3QCA A;  2D10 A;  4RMA A;  2IO1 B;  1ZKH A;  1SE9 A;  2KJR A;  2CKH B;  1V80 A;  2NPT B;  4BOZ B;  3Q3F A;  3VXW A;  2J0K A;  5D2M B;  1WJ4 A;  2NVU I;  3R7Q A;  2D07 B;  3PLV A;  4MSM B;  1P9D U;  4FHJ A;  2CU1 A;  2Z0D B;  1V81 A;  3P2B A;  3JSV B;  3L10 B;  2KX3 A;  4K81 A;  4FLH A;  2JPH A;  4GN1 A;  4IM3 A;  2FID A;  4K1R B;  4CYE A;  1KOT A;  3H7S A;  3K9P B;  1E8Y A;  1E7U A;  4ZDV A;  3DVN V;  2R2Q A;  1WGH A;  3NY5 A;  4MH0 E;  3PRM B;  1SGH A;  2PE6 B;  2KZR A;  1RLF A;  3K9O B;  3OLM D;  4KIK B;  4XC2 A;  5BO4 B;  5DPW A;  3GOE A;  3AU4 A;  1WXA A;  1V5T A;  3AI5 A;  3HHM A;  3WIM A;  1HE8 A;  4G50 A;  2AYO B;  1IPG A;  4GDK B;  2ZVO A;  1WM3 A;  5LLI A;  4HPL B;  4ASW C;  3VVW B;  3QWZ B;  4HK2 A;  1VD2 A;  4HLE A;  2V1Y A;  3EC8 A;  4E71 A;  1E8X A;  1H4R A;  4HCP B;  4G3X B;  3RZW C;  2J7Q B;  3SHQ A;  4DK5 A;  1WY8 A;  1CMX B;  4BFR A;  1MG8 A;  2CHW A;  5L83 A;  4PYZ A;  2MBO A;  2K8H A;  2LGX A;  4W9I A;  2L0T A;  2O6V A;  2FIF A;  2WX1 A;  1LFD A;  3IFW B;  1OQY A;  2JRH A;  4FN2 A;  3N3K B;  2MWS B;  3T9L A;  1OEY A;  1VCB A;  2GBJ A;  4RM9 A;  2KWV B;  4N9F 4;  1TGZ B;  2KJ6 A;  4AUQ C;  2BWE S; 
#chains in the Genus database with same CATH topology
 2CS4 A;  4LJO B;  4A20 A;  4RH6 A;  3WAP A;  1NI2 A;  2YLM A;  1TZO A;  3PVL A;  3KLS X;  4L2Y A;  4HDO A;  3A1Q B;  1K8R B;  4YSX B;  2Y5B B;  1JW9 D;  4EE2 A;  2C7M B;  1P98 A;  2OJW A;  3KVF B;  2N4F A;  2N9K A;  2GMI C;  2HJ8 A;  3QK0 A;  1ZUD 2;  4WIP A;  2WGS A;  1WMH B;  2MBE A;  2K8C A;  4MGY E;  2XBB C;  1V6E A;  4WJP A;  1FD6 A;  5TSS A;  2WNM A;  2KO3 A;  2R2O A;  4MT5 A;  2VRR B;  3ZTD A;  1VRA B;  3WAN A;  3HIZ A;  1TTN A;  1SJH D;  1KJT A;  1MI0 A;  4P16 A;  4I6N B;  2GBK A;  4N6E B;  4MJS B;  4MEM A;  1BXT A;  1OQQ A;  3VDZ A;  1C4P A;  2PE9 A;  2L1A A;  1SIF A;  3U7Z A;  2ACZ B;  3ZJT A;  2K8B A;  3L13 A;  3KUD B;  1MHX A;  1UNS A;  5D7G A;  1EU3 A;  2L05 A;  2MJ3 A;  4AS1 A;  1AYF A;  1GG3 A;  1V1P B;  5FKA C;  1VJK A;  4H2A A;  4WQM A;  4AP4 C;  4PS3 A;  1E90 A;  2QMT A;  2JZP A;  1P7F A;  2DNF A;  4HEA 1;  3T3N A;  1Q1O A;  5IA7 A;  3PRE A;  1L7Y A;  3W1Y A;  1YQB A;  3PS6 A;  1C78 A;  4GLS C;  4HKQ A;  2N1W A;  1WR1 A;  1Z2M A;  5GMV A;  4KGR A;  2LUM A;  3VRA B;  4K7W A;  4B0E A;  3AE6 B;  2FNJ B;  4Q2J A;  2K39 A;  4WAA A;  1ZW7 A;  1C1Y B;  1SEB D;  1QKZ A;  4LTU A;  3C19 A;  2C5L C;  2MA9 B;  5HFY A;  2LD9 A;  1EWC A;  2Z8L A;  1WJ6 A;  1V9J A;  1XF5 L;  4R3D A;  1RFA A;  1WM2 A;  4J6I A;  1SJE D;  1WXV A;  1ET6 A;  1N60 A;  1SXT A;  3N20 C;  2KDE B;  2KQS A;  4A6Q A;  2O2V B;  3N30 A;  1L2N A;  1UZX B;  3V60 A;  2D3C A;  5IO9 A;  2G3Q B;  4W9C A;  1JWB D;  1C3T A;  4LDT B;  4AJW A;  1B1Z A;  3VR8 B;  4FJY A;  4KDI C;  2MP2 B;  4DDG D;  2HDE A;  4CHK A;  2OJR A;  1F9J A;  1UUP A;  3A9J B;  4M8N A;  3AMZ A;  1IP9 A;  3RUI B;  1SSN A;  3DPD A;  3RZF A;  4GDL B;  4OVU A;  4ICU A;  4W9H A;  1WFY A;  1I4H A;  3PT2 B;  3NS1 A;  3N1X C;  3IBE A;  4IG7 B;  3BII D;  1T0Q C;  3BK2 A;  1K52 A;  3SFE B;  4I6P A;  3OJ4 B;  1SE2 A;  1R4N B;  2WXH A;  2KDB A;  3V6E B;  3CIR B;  3IVF A;  5AUI A;  1VR9 A;  5AZG A;  4BOS C;  1F52 A;  4MM3 A;  4C4V B;  3ZVV A;  1R4N I;  3TEW A;  2O6V B;  4ZRI A;  2OHF A;  4ANW A;  5LNK 1;  1A70 A;  4LNK A;  4KKJ A;  2LZ6 A;  2NCN A;  5D94 A;  4DXA B;  3TEZ A;  3KW5 B;  1FM0 D;  1GB4 A;  3ZJU A;  1SF0 A;  3UIP B;  1I4P A;  4TMA B;  1WMH A;  2BYE A;  3SDL C;  3ECI A;  2UU7 A;  1T0Y A;  2WXR A;  2ZPY A;  1YMH E;  3MHZ A;  1RWS A;  1WRI A;  3KUZ A;  2D5G A;  2M1M A;  3CST A;  4IWO A;  1YD8 U;  4WJQ A;  1KLU D;  4KDL B;  3RI7 C;  3EFU A;  3N9Y C;  2JWZ A;  1Z5S B;  2MHJ A;  4PYU A;  4DDI D;  3BYY B;  4BAX A;  3TJP A;  3BVM A;  5I4D A;  4MJS A;  5AUK A;  2G1E A;  2W54 A;  4LK0 M;  3SFD B;  2WXK A;  1TKE A;  2M0X A;  3R2T A;  4P1C C;  3B2G A;  2FBW B;  3JVZ X;  2KTF A;  1FNU A;  4F8C B;  1L0X B;  4E74 A;  5L95 C;  4A3O A;  1V1P A;  3B2F A;  4FJV B;  1VZ7 A;  2DYM A;  2BF8 B;  1I4G A;  3NVV A;  3HRD D;  1GUA B;  2X8X X;  1WR6 E;  2DZM A;  2LXA A;  3BWU D;  4B95 A;  4HPM B;  1T6B X;  4NQK E;  4C7Z A;  1CQV A;  2DAJ A;  1N62 A;  2JVC A;  2K3U A;  4C00 A;  3DWG C;  3Q3N C;  2H89 B;  3OJ3 A;  4W9K A;  1YQ3 B;  2DWQ A;  1WXQ A;  1WJU A;  3ENE A;  3AEB B;  2LVP A;  2DZK A;  3Q3O C;  2DYB A;  4IW0 A;  5KHQ A;  2IJ0 A;  4FAD A;  1Q5W B;  2D2Q A;  1JWU D;  1NBF C;  4WUR A;  2JYE A;  1WF9 A;  3CSF A;  3PZ8 A;  1E6E B;  3QC8 B;  2PVG C;  4ZRP A;  2WX0 A;  3BK1 A;  3APC A;  1GJZ A;  1WZ0 A;  4A90 A;  3GE8 C;  2MJD A;  1C79 A;  3P42 A;  5IOI A;  5TR5 A;  3AE7 B;  3DBR B;  1WGG A;  2WXL A;  2GLS A;  2O2V A;  3B1L X;  1J7C A;  1V97 A;  2DYO A;  5IN7 A;  1LXD A;  2KMC A;  4KVG B;  1A5R A;  3P4P B;  5LXI B;  1EF1 A;  3DBR I;  2OOB B;  3QIJ A;  4S0R A;  2ZVN A;  5C2T B;  4M0W B;  2WXQ A;  2MP2 A;  3QCA A;  2D10 A;  2KQ4 X;  1ZKH A;  1OQR A;  4RNA A;  3BYT B;  3VXW A;  3I9V 1;  1WJ4 A;  2WDQ B;  1P9D U;  3AEC B;  2CU1 A;  1MVK A;  1WGK A;  3KWL A;  3L10 B;  2KX3 A;  4K81 A;  1TYG B;  4ZDV A;  1E8Y A;  3DVN V;  1QLB B;  1WGH A;  2YEP B;  3PRM B;  1SGH A;  2K22 A;  4KIK B;  1HE8 A;  1MJD A;  2ZVO A;  2V4I B;  4ASW C;  3EC8 A;  4G3X B;  2WXI A;  2DBY A;  3SHQ A;  1CMX B;  2BYT A;  4RGN A;  4C4V A;  1PUT A;  2MBO A;  3LXF A;  2AQ3 B;  2LHE A;  1TJE A;  2O6V A;  2WX1 A;  1TT5 B;  1OQY A;  2JRH A;  3EUB 2;  2MWS B;  4WH4 A;  4RM9 A;  2KWV B;  2ZW1 A;  4N9F 4;  4XGA B;  1FNV A;  2BWE S;  3GZN B;  2PJH A;  2DZJ A;  2HJ1 A;  1V86 A;  3BIN A;  4EZJ A;  1QQR A;  4MSQ B;  3DDC B;  5IP4 D;  2K6D B;  3ZXV A;  5BYQ A;  3GZN I;  2VZK B;  5CTR C;  3IG3 A;  2PIA A;  3BZD B;  2UWQ A;  4E3C A;  4XE0 A;  1T3Q A;  2LRU A;  3JSV A;  3BY4 B;  4B6W A;  2JF5 A;  3ZDM C;  2NTS A;  2WP9 B;  2BGF A;  1JWM D;  3ETR A;  4LNN A;  2LVQ A;  2M0A A;  2JQR B;  1ZDV A;  4L1B A;  3P4S B;  1STE A;  5JHA A;  1V2Y A;  2JT4 B;  3FIL A;  3ZNZ B;  2WXJ A;  1YX5 B;  3EHV A;  3EA6 A;  3ZGZ A;  3V6C B;  4QAY A;  1FPY A;  3AM9 A;  4FUL A;  4LNF A;  1J19 A;  1AW7 A;  1V5O A;  1I4Q A;  3VQI A;  3QAQ A;  3DOW A;  2RSU A;  2GBN A;  2QCZ A;  2KVZ A;  3JW0 X;  1C4A A;  2CHX A;  2JU6 X;  1MPE A;  4XX5 A;  1GAQ B;  4HXD A;  1ET9 A;  1GOZ A;  3PO0 A;  5EDS A;  1FEH A;  4LCD E;  2JZZ A;  3PTF C;  4YSZ B;  4EUT A;  2RR9 A;  3JYU A;  3GB1 A;  4HWI B;  4P6V F;  3H9D A;  2D11 A;  4GXB A;  2ON8 A;  1TY0 A;  2G9H D;  3I3T B;  3A9K B;  1ZGU B;  2KWU B;  5G5H A;  2N7J A;  2G4S A;  2J0M A;  4HRS A;  4WJO A;  3AB5 A;  2ICI A;  3W2D A;  3LDZ E;  2C9W B;  3E56 A;  3A4S C;  1IUE A;  1OEY J;  3RT3 B;  2B3A A;  3IAS 1;  4A55 A;  3UI3 A;  3ZYY X;  1WZ3 A;  2K1F A;  2AX5 A;  4W9F A;  1P1A A;  4MM3 B;  3MC8 A;  1G6J A;  4IWP A;  2KYW A;  4M0W A;  4WQO B;  1OTR B;  1QOA A;  2EMS A;  3KH0 A;  1MG4 A;  1JAL A;  3VTW A;  2MBB B;  2KT7 A;  3ZO5 B;  5H92 C;  4HJG E;  3OAW A;  2LRW A;  4C80 A;  1WE7 A;  2IBI B;  2HD5 B;  2LGS A;  2NBW B;  2INN E;  2YEP F;  3L16 A;  3GP7 A;  3RNA C;  2MBH A;  3DBL B;  2DZI A;  2OED A;  2MW5 A;  2LMC A;  4KIK A;  2Y3A A;  5C23 A;  4RM8 A;  3KQ4 A;  1K53 A;  4NNJ B;  4XYC A;  3DBL I;  1WX9 A;  4DBG A;  2WXP A;  3AEF B;  2FAZ A;  2NMQ A;  4JX1 C;  4RF0 A;  2V3N A;  1LQB A;  5FR3 A;  2A5U A;  2KAC A;  3WAL A;  2JXT A;  1D5M C;  2JZ3 B;  4DHJ B;  4GOC A;  1I7H A;  1WXM A;  3ZNH B;  3EGR A;  3ZNI D;  2KVR A;  3ZLZ A;  2KMA A;  3PPA A;  4L23 A;  5EE1 A;  4S17 A;  1N5W A;  3U4E G;  1UGM A;  4ZYS A;  2N9P C;  2IO2 B;  4IDI A;  2J0J A;  3AXC A;  4W9J A;  3MTN B;  3W1S C;  1FRD A;  4N59 A;  4EZL A;  2L76 A;  2N1V A;  4US9 A;  2M4N A;  3U30 A;  3B0A A;  3O13 A;  2D3A A;  4KSL C;  3QHT A;  3B08 A;  2IYD B;  2MQJ A;  2DHZ A;  1M4V A;  2GB1 A;  3HK0 A;  5J2R A;  2ZNV B;  3AE5 B;  3I5J C;  1K50 A;  4AWJ A;  2TSS A;  4EKU A;  4HPP A;  2WDT B;  1L5P A;  3Q3J A;  3ZKJ C;  3AV8 A;  1FXA A;  1UD7 A;  4CQN A;  4C56 C;  1HXY D;  3W9C B;  3M95 A;  4DWF A;  4HDQ A;  1ISN A;  3PHX B;  3QQ8 B;  3V61 A;  1NVI D;  3RNE C;  5J18 A;  5D6J B;  2KHW B;  3M3J A;  1M94 A;  2BKF A;  4LDT D;  3UIN B;  1R4M I;  3R8B A;  3NUH B;  1PQS A;  3L54 A;  4TQ0 A;  2IGG A;  2VH1 A;  4DQO C;  1GNU A;  4J3O D;  2QSD A;  2IDY A;  2N9L A;  3PZD A;  1KLG D;  1SIJ A;  3DWM A;  1N5X A;  4ARI A;  3ZRC A;  3WAO A;  3Q8B A;  1YNT E;  1WH3 A;  2MCN B;  4ZYN A;  5JZE B;  4EFO A;  4OHJ A;  1JCK B;  3R3M A;  2X38 A;  3X0W A;  3MJ5 A;  4FHK A;  4ZOH C;  3Q8A A;  1BUI C;  1HZ6 A;  3UGB B;  4W9D A;  5HHD G;  1JWS D;  3AH7 A;  3U8Z A;  3A9K A;  1CZP A;  4NPN A;  4PK1 A;  2LHD A;  3VTV A;  3D32 A;  3AEA B;  4JLC A;  4NY0 A;  5BMH A;  3NG0 A;  3DBS A;  1SB3 C;  2XN9 C;  3P63 A;  5EE0 A;  2FCN A;  1B9R A;  3H6N A;  1YJJ A;  2M56 B;  3BVG A;  4NAW B;  5H8Y E;  1HTO A;  3H1U A;  3RMK C;  4KV2 A;  4ZRQ A;  3Q8C A;  1P3Q U;  1KF6 B;  3QAR A;  2KD0 A;  2M17 A;  3NVY A;  2KNB A;  2CJN A;  3NZS A;  4BKS D;  4F1S A;  3E9S A;  2I1K A;  1CJE A;  1KTK A;  2E3T A;  1V80 A;  1LO5 D;  3JSV B;  4BZA A;  3RNG C;  4FLH A;  4IM3 A;  4N58 A;  4CYE A;  3AE4 B;  1DYQ A;  3H7S A;  1E7U A;  1C77 A;  2R2Q A;  2PE6 B;  3K9O B;  3CWI A;  4XC2 A;  5BO4 B;  3GOE A;  1WXA A;  2IGH A;  3HHM A;  3WIM A;  4G50 A;  2AYO B;  1IPG A;  5EE3 A;  4YT0 B;  1TS2 A;  5LLI A;  3NZ3 A;  4HPL B;  3FIL B;  3VVW B;  4HK2 A;  2V1Y A;  1FCL A;  4E71 A;  1E8X A;  4HCP B;  2W55 A;  1WY8 A;  2CJO A;  4BFR A;  2WXF A;  4JPS A;  4P1B C;  2K8H A;  1DOX A;  1EWY C;  1PYW D;  2J52 A;  1YOV B;  2PTL A;  3IFW B;  4FN2 A;  1VCB A;  2GBJ A;  2KJ6 A;  4AUQ C;  2NTT A;  2EEL A;  2LXC A;  1T0S C;  3QX1 A;  4M02 A;  2K9X A;  1WWT A;  2HE7 A;  3SD5 A;  3RUL A;  3TMP B;  5CHV C;  4KGS A;  2WHI A;  4LNO A;  4MGZ E;  4KSK C;  2VH2 A;  5DCN A;  4GU2 A;  1YJI A;  2WDV B;  3IAM 1;  2M19 A;  3MP9 A;  1EU4 A;  4M8M A;  1V1O A;  4YWG G;  4JE3 B;  5AZF A;  2JY6 A;  1WSP A;  2KOX A;  1FFU A;  2CR5 A;  3H8H A;  2XEW A;  4IM0 A;  2EMT A;  3EFC A;  2KFJ A;  3TL5 A;  3HVZ A;  5HKH A;  4C7Y A;  5BYR A;  2FUG 1;  2MEK A;  2LVO A;  2FCS A;  2PEA A;  1FO4 A;  5T8I A;  1QIL A;  2MX2 A;  1DOI A;  3OWE B;  4AJY B;  3FAH A;  1ZXI A;  5GXG B;  2JXX A;  2GBR A;  3DVN U;  2PKO A;  1TBE A;  4HKZ E;  5JXV A;  2KTR A;  3ABV B;  1N63 A;  2V4L A;  3B9J A;  4NJ7 A;  1IBX B;  2L7R A;  1ENF A;  1QF6 A;  1GC7 A;  1YIW A;  2G4D B;  3RNF C;  4OVV A;  2KX0 A;  3QJZ A;  2IO0 B;  1ZE3 D;  4ZRJ A;  3VFK A;  2H88 B;  2W3S A;  3Q8F A;  1Q10 A;  4FBJ B;  4OZC A;  2AL3 A;  2HTM E;  2L8J A;  4YTM B;  4NJC A;  3RPF C;  1EUV B;  2W82 A;  4JWS C;  3J9C A;  1I4R A;  1DOY A;  2KJH B;  1J8C A;  1XCQ L;  2BTE A;  1D3Z A;  4NAW A;  3VRB B;  2BB5 A;  4M00 A;  3I63 C;  4ANU A;  1AWD A;  2JYT A;  2IPK D;  1VDV A;  2NBV B;  1J7B A;  1I42 A;  2XNA C;  1QT9 A;  4YL8 A;  5IKC M;  1EF5 A;  1F0Z A;  5BMI A;  2MLB A;  4MAC A;  1J7A A;  4M01 A;  3VAW A;  1E8W A;  4JWU C;  3CF6 E;  3IT4 B;  2FCQ A;  4UDU C;  4RGT A;  4IUM B;  4WWO A;  4P7I A;  3UQA A;  3UIO B;  1EO6 A;  1IGD A;  2PMV A;  4IOI E;  3R2I A;  5MPO A;  3ML9 A;  2LFI A;  3GE3 C;  1D5Z C;  4K3B A;  4KX6 B;  2WYQ A;  1HEZ E;  1WYW B;  3EEC A;  2KWD A;  2RD0 A;  1RAX A;  1XLO A;  1UGJ A;  5G55 A;  2WXN A;  4F7Z A;  3ZW3 A;  1JML A;  1N6Z A;  2Y5P A;  4JQW C;  1L0V B;  2N7E A;  3Q3M C;  1WJN A;  3C8Y A;  3NS8 A;  5DPT A;  3TEX A;  2RGF A;  3S2A A;  3L08 A;  2KXJ A;  2RDG A;  3PZ7 A;  4WWM A;  1MHH E;  1WYG A;  2MRP A;  4G0N B;  2XK5 A;  1J0G A;  1XO3 A;  2QIL A;  1D5X C;  2AL6 A;  3V62 A;  1KLV A;  3NVW A;  4WWP A;  2WXO A;  3DHH C;  2JUO A;  4II3 B;  3KYC D;  5EE9 A;  4IM2 A;  4HCN B;  3U2S C;  4ARC A;  3NVZ A;  5CHF A;  1L6U A;  4YSY B;  4ZRK A;  2KAN A;  1F2R C;  1C4C A;  1P7E A;  3RD2 A;  1TS4 A;  3ALB A;  2LI5 A;  2MBQ A;  2FUH B;  4AOF A;  4MGI E;  2QJL A;  4O1N A;  3A4R A;  2N0S B;  2BYF A;  1IGC A;  3DBH B;  1V8C A;  2AQ2 B;  2AWT A;  3TCA A;  4ITK A;  2KDM A;  1KM7 A;  1XQQ A;  2W9N A;  1TY2 A;  4BVU C;  2L3Z A;  3A33 B;  1TKG A;  3L4P A;  3DBH I;  2J42 A;  2MJE A;  3WAM A;  1IYF A;  4X57 B;  4BKT A;  4FJZ A;  1XLP A;  4ACF A;  4W9E A;  1H8C A;  2WXG A;  3X23 A;  1RFK A;  1NYQ A;  2EKI A;  1HA5 A;  3VTU A;  1ROE A;  2GRI A;  4FXC A;  1IBX A;  3HUI A;  1I35 A;  3LB8 C;  3P4R B;  1S3S G;  1UWX A;  3VUX A;  2L32 A;  2WQY B;  3ZTC A;  2KLG A;  4KZ0 A;  5C3J B;  3TBL D;  4ANX A;  2BW2 A;  2LUE A;  4KKI A;  3KWV A;  1S1Q B;  3TUO A;  2SAK A;  4OZA A;  5E6O A;  3IHP C;  1F77 A;  4PS8 A;  4DHJ D;  1YJ1 A;  1HQR D;  3TIX A;  3P4Q B;  1QOG A;  4REZ A;  4B0M A;  1AAR A;  3DHI C;  1L4Z B;  2REX A;  1TIF A;  4JGH B;  3ZQ4 A;  4GSW A;  1WXS A;  2E6X A;  5AEK B;  4TV3 A;  2K6Q A;  1JRP A;  1NEN B;  4TQ1 A;  3N1Y C;  3VR9 B;  4EZK A;  4KZC A;  3M63 B;  2LAS A;  3AUL A;  1PFD A;  1YN5 A;  1UBQ A;  3MJW A;  1YQ4 B;  4TUU A;  2JSV X;  2KMM A;  1ZXH A;  2WXM A;  2Z59 B;  3FC4 A;  5D3D A;  4DXF A;  3PHW B;  3TSS A;  5D3I B;  2MSE D;  4GMV A;  3APD A;  3ZXR A;  2I1J A;  3PLU A;  2FE8 A;  1JRO A;  3V3X A;  2BS4 B;  3MC9 A;  3Q14 C;  1HTQ A;  3PRP B;  2V3S A;  1DGJ A;  5BYS A;  4TKN A;  1E9M A;  4RMA A;  2KJR A;  1QOB A;  2NPT B;  4BOZ B;  3Q3F A;  2NVU I;  3R7Q A;  3PLV A;  1R7S A;  4FHJ A;  2Z0D B;  1V81 A;  2J4X A;  5E6J A;  2QDF A;  1R4M B;  2PVO D;  1FCC C;  4GN1 A;  1FRR A;  1UF0 A;  4K1R B;  1KOT A;  2BS2 B;  3NY5 A;  4MH0 E;  1K51 A;  2LEK A;  2K5P A;  1ZPS A;  4GDK B;  1XLN A;  4HLE A;  1XXG A;  1VD2 A;  1H4R A;  4NAM A;  3RZW C;  4DK5 A;  1MG8 A;  3BVZ A;  2CHW A;  4PYZ A;  2JX5 A;  2LGX A;  4W9I A;  1RM6 C;  2W3R A;  3SEB A;  1NI3 A;  3GS2 A;  3Q8E A;  2NS5 A;  3UQB A;  3R7R A;  4K7U A;  3NZU A;  2KTR B;  2AEH A;  2RDH A;  3H7P A;  1BML C;  2KC2 A;  2KDI A;  3AN1 A;  3VH4 B;  4K7S A;  1T0R C;  3LYY A;  4W9L A;  1PGA A;  1GPX A;  4LJP B;  5DPS A;  3W1S A;  3ZIM A;  2LGD A;  4MDK E;  2C60 A;  4JL9 A;  4A3P A;  3W5V B;  2L00 B;  1FXI A;  2O6V D;  3C0R B;  2QC8 A;  4IC7 B;  3ZRF A;  2QHO A;  5CHW A;  1RRB A;  2ZCC A;  2QIE B;  2QEJ C;  5IAA C;  3NHE B;  1Q0W B;  2KK8 A;  2KFK B;  4PT5 A;  5C1Z A;  1T5X D;  3AE2 B;  3U7D A;  2ASQ A;  2IO3 B;  2Z0E B;  2RMM A;  3AE1 B;  2LJ5 A;  4XDC A;  3IT6 B;  3RCZ A;  3CMM B;  3LJ3 A;  2I2Y A;  2C7N B;  2I38 A;  4HJK A;  1VZ6 A;  2RPV A;  2ZNV C;  2KC1 A;  3T8M A;  1NYR A;  2MH7 A;  3HM6 X;  1LGR A;  3A1Q A;  1X1M A;  1Y8R C;  4MGK E;  3VH3 B;  4D2K A;  1WGD A;  1TZ1 A;  3WA0 A;  1XEE A;  3QA8 A;  2LGI A;  1EM7 A;  3L0W B;  4GB9 A;  3KYD D;  3ZDT A;  3Q2A C;  3AE8 B;  4GIV A;  5DPR A;  1UEL A;  2BBC A;  1SBB B;  2V9H A;  1WX8 A;  2SEB D;  1FMA D;  2IY0 B;  3T3O A;  2DX5 B;  1HZ5 A;  4RF1 A;  4CO7 A;  3RNB C;  2KN4 A;  1FNW A;  1RYJ A;  2L0F A;  2WS3 B;  1JQ4 A;  4K3C A;  2WWZ A;  3ZJV A;  3NOB A;  1SE3 A;  4W9G A;  2BS3 B;  1PDX A;  1KH0 A;  3R66 C;  1U4A A;  5KHO A;  2CU3 A;  2DLB A;  1XCT L;  3O65 B;  3L17 A;  2XK5 B;  3AE3 B;  3MC0 B;  4ANV A;  1WI0 A;  3DQV A;  2PW9 A;  4JIO U;  4AQ7 A;  2ZZP B;  1I4X A;  2N7D A;  4MEL A;  2GBM A;  2WU2 B;  1E10 A;  2NPT A;  3KUC B;  4USA A;  3ZNG C;  3PSE B;  1BT0 A;  2BB6 A;  2ZEQ A;  1NDD A;  3AU5 A;  1XLQ A;  4YXD B;  1XD3 B;  3UF8 A;  4TSS A;  2ZW0 A;  3MHS D;  2LGY A;  3AED B;  1AN8 A;  1FXT B;  5HG2 A;  1TS3 A;  2JRI B;  4WWN A;  3RFZ B;  1UH6 A;  2WDR B;  2LJI A;  2NR2 A;  4GDK A;  3M62 B;  2M8S A;  2BVC A;  3VUW A;  3PRZ A;  4A8X C;  4BBN C;  1QOF A;  4FA6 A;  1WGY A;  1OFF A;  4DHZ E;  5JHB A;  2BKR B;  1YN3 A;  3Q69 A;  2V3P A;  4MH8 A;  4A9A A;  2IY1 B;  1V49 A;  1KRH A;  4YTN B;  2D3B A;  1PGX A;  1JRU A;  1L4D B;  1ESF A;  1GC6 A;  2JWU A;  2AQ1 B;  2IZV B;  1E7P B;  5FR6 A;  2WU5 B;  3N32 A;  2KKC A;  4HRO A;  1WGR A;  4XDD A;  5G2N A;  2KWC A;  1OGW A;  1L6V A;  4RCO A;  1QZE A;  3TEY A;  1PGB A;  3HVD A;  4ZHP A;  1ZDX A;  2N9X A;  3AE9 B;  1WIA A;  2G45 B;  3ML8 A;  1WRD B;  4II2 B;  2V0G A;  4XWW A;  3RNC C;  1JWA D;  4GGQ A;  1D4B A;  3VUY A;  3DHG C;  4G11 A;  2RPQ A;  1FFV A;  2YVC A;  2BYV E;  4ICV A;  3RN9 C;  1P0R A;  3A9J A;  4BBN F;  2ONQ A;  4B9K A;  3NRZ A;  4GDL A;  2LWP A;  3ZUN A;  2KFK A;  2N9E B;  2ZCB A;  1KFY B;  4NJ6 A;  4RFB A;  2KDF B;  4PS7 A;  4WJN A;  5E6N A;  2VZK D;  3FKY A;  4IKG A;  2PPH A;  1TKY A;  2KLC A;  3SU8 X;  1CK1 A;  2C7H A;  4HVB A;  3HM3 A;  1YN4 A;  2D3G A;  1ZP0 B;  2J53 A;  1WE6 A;  1ACC A;  2EKE C;  4WAF A;  1Y56 A;  1F2R I;  2UYZ B;  3DVG Y;  5JH5 C;  2BPS A;  2KAJ A;  3NJT A;  1D6E C;  5AZH A;  3OG5 A;  5BMG A;  1UBI A;  3ONS A;  4OZB A;  4EEW A;  3N1Z C;  4I6L B;  2L83 A;  2DEN B;  4IWQ A;  2BWF A;  2IND C;  2NBU A;  3VHT C;  1SE4 A;  2Q5W D;  3DVG X;  3SR6 A;  3APF A;  1WX7 A;  1E5W A;  3IXS A;  3WCQ A;  2DAF A;  4RGM A;  2L52 A;  4OW0 A;  1TS5 A;  4EOY A;  3RYT A;  5G5G A;  4XZ4 A;  1E8Z A;  2K25 A;  3MFG A;  3PGE A;  2KQ7 A;  1ZOY B;  1XT9 B;  1E0Z A;  4NQL B;  2A4Z A;  1LM8 B;  1YX6 B;  4BKS A;  1MFW A;  4NZL B;  3P1M A;  4DHZ B;  1C76 A;  1FIQ A;  2R61 A;  1C9F A;  3PV1 A;  3U52 E;  2INP E;  1L0Y B;  5J17 A;  3URY A;  2GOW A;  2CHZ A;  4URK A;  2IGD A;  4KGT A;  1E7V A;  2ZPN A;  3V05 A;  4BKG A;  2HTH A;  5E6P A;  3W5U B;  2FCM A;  2ZJD A;  2KN5 A;  5LXH A;  4US8 A;  3DCG A;  2WLB A;  3H7P B;  5CX3 A;  1UWM A;  2GI9 A;  2IO1 B;  3AEG B;  1SE9 A;  2CKH B;  1VLB A;  3Q6B A;  4LNI A;  4ZHO A;  2J0K A;  5D2M B;  2D07 B;  4MSM B;  2INC C;  1NEK B;  3P2B A;  4DXG A;  2BT6 A;  2K0P A;  2PLP A;  2JPH A;  2FID A;  4XWT A;  5FK9 C;  3K9P B;  4OVZ A;  4RGO S;  3OLM D;  2KZR A;  1RLF A;  2RDB C;  5DPW A;  3AU4 A;  1V5T A;  2B76 B;  3AI5 A;  2Y5C A;  1WM3 A;  2BQQ A;  3QWZ B;  2J7Q B;  3I57 A;  5L83 A;  5HI1 A;  4YTP B;  1F1H A;  2L0T A;  2FIF A;  1LFD A;  4LLG M;  3T9L A;  3N3K B;  1OEY A;  1GB1 A;  1TGZ B;  1N61 A;  1VZ8 A;  3AEE B; 
#chains in the Genus database with same CATH homology
 2LXC A;  2CS4 A;  2PJH A;  2DZJ A;  1V86 A;  2NS5 A;  3BIN A;  3QX1 A;  4LJO B;  4A20 A;  3UQB A;  3R7R A;  4EZJ A;  4MSQ B;  2HE7 A;  3SD5 A;  3RUL A;  3WAP A;  4K7U A;  3DDC B;  3NZU A;  2KTR B;  1NI2 A;  2AEH A;  2YLM A;  2K6D B;  5CHV C;  3PVL A;  3TMP B;  3H7P A;  4HDO A;  3A1Q B;  4MGZ E;  1K8R B;  2KC2 A;  2KDI A;  2Y5B B;  4KSK C;  3VH4 B;  4K7S A;  3GZN I;  5CTR C;  2C7M B;  3IG3 A;  4GU2 A;  5DCN A;  2UWQ A;  4E3C A;  4W9L A;  1P98 A;  3KVF B;  4LJP B;  2N4F A;  5DPS A;  3W1S A;  2GMI C;  2LRU A;  2LGD A;  3ZIM A;  3JSV A;  3BY4 B;  4MDK E;  4B6W A;  2C60 A;  2HJ8 A;  3QK0 A;  2JF5 A;  4M8M A;  1WMH B;  2MBE A;  4JL9 A;  3ZDM C;  4A3P A;  2K8C A;  4MGY E;  2BGF A;  2L00 B;  2XBB C;  5AZF A;  2JY6 A;  2O6V D;  3C0R B;  1V6E A;  4WJP A;  4IC7 B;  2KOX A;  3ZRF A;  2QHO A;  5CHW A;  2CR5 A;  2KO3 A;  2LVQ A;  2R2O A;  2XEW A;  4IM0 A;  1RRB A;  2EMT A;  2ZCC A;  2KFJ A;  2VRR B;  3ZTD A;  3TL5 A;  5HKH A;  3WAN A;  3HIZ A;  5IAA C;  5JHA A;  1V2Y A;  3NHE B;  1Q0W B;  2KK8 A;  2JT4 B;  1TTN A;  3ZNZ B;  2KFK B;  2LVO A;  1YX5 B;  2FCS A;  3EHV A;  1KJT A;  2PEA A;  5C1Z A;  4I6N B;  3V6C B;  2GBK A;  2MX2 A;  4MJS B;  4MEM A;  3U7D A;  3VDZ A;  4AJY B;  2ASQ A;  2PE9 A;  2IO3 B;  2Z0E B;  4FUL A;  2JXX A;  1SIF A;  2LJ5 A;  2K8B A;  2GBR A;  3RCZ A;  3CMM B;  1J19 A;  3LJ3 A;  3L13 A;  3DVN U;  1V5O A;  3KUD B;  3VQI A;  2C7N B;  5D7G A;  1TBE A;  4HJK A;  2L05 A;  2ZNV C;  3QAQ A;  3DOW A;  1GG3 A;  2KC1 A;  2RSU A;  2GBN A;  2KTR A;  3T8M A;  2V4L A;  3HM6 X;  4AP4 C;  4NJ7 A;  4PS3 A;  1E90 A;  3A1Q A;  1X1M A;  1Y8R C;  3JW0 X;  2L7R A;  4MGK E;  3VH3 B;  1WGD A;  2CHX A;  1GC7 A;  1YIW A;  1Q1O A;  1TZ1 A;  2G4D B;  3WA0 A;  4XX5 A;  5IA7 A;  3PRE A;  1L7Y A;  3W1Y A;  1YQB A;  3QA8 A;  3PS6 A;  4OVV A;  4HXD A;  3L0W B;  2N1W A;  2KX0 A;  4GB9 A;  1WR1 A;  1Z2M A;  3QJZ A;  5GMV A;  5EDS A;  3KYD D;  4LCD E;  2IO0 B;  3ZDT A;  2JZZ A;  3PTF C;  4GIV A;  5DPR A;  4EUT A;  1UEL A;  4ZRJ A;  2RR9 A;  3VFK A;  3JYU A;  4HWI B;  1WX8 A;  4K7W A;  3H9D A;  2D11 A;  2FNJ B;  4GXB A;  2IY0 B;  2DX5 B;  4FBJ B;  2K39 A;  4CO7 A;  3I3T B;  2AL3 A;  3A9K B;  1ZGU B;  2KWU B;  2L8J A;  4WAA A;  1ZW7 A;  2G4S A;  1C1Y B;  2L0F A;  2J0M A;  1EUV B;  4WJO A;  2WWZ A;  2C5L C;  3NOB A;  3LDZ E;  2C9W B;  2MA9 B;  2LD9 A;  2KJH B;  4W9G A;  1J8C A;  1D3Z A;  3A4S C;  4NAW A;  1OEY J;  4ANU A;  3RT3 B;  1WJ6 A;  2B3A A;  1V9J A;  3R66 C;  1U4A A;  5KHO A;  2NBV B;  3O65 B;  1I42 A;  3L17 A;  1WZ3 A;  2K1F A;  1RFA A;  4YL8 A;  4W9F A;  1WM2 A;  4J6I A;  1EF5 A;  1WXV A;  2XK5 B;  1P1A A;  4ANV A;  1WI0 A;  3DQV A;  2MLB A;  2KDE B;  2KQS A;  4JIO U;  3VAW A;  2O2V B;  1E8W A;  2ZZP B;  3N30 A;  3CF6 E;  4IWP A;  1G6J A;  1UZX B;  2FCQ A;  1L2N A;  4WQO B;  2N7D A;  4MEL A;  3V60 A;  1OTR B;  2G3Q B;  4W9C A;  2EMS A;  3KH0 A;  2GBM A;  4IUM B;  4WWO A;  4P7I A;  3UQA A;  1C3T A;  2NPT A;  3KUC B;  4LDT B;  3UIO B;  3VTW A;  3ZNG C;  2MBB B;  4AJW A;  3PSE B;  1BT0 A;  3ZO5 B;  1EO6 A;  2ZEQ A;  2LRW A;  1NDD A;  3OAW A;  1WE7 A;  2IBI B;  3AU5 A;  2HD5 B;  2NBW B;  3ML9 A;  3L16 A;  1XD3 B;  3UF8 A;  3MHS D;  4FJY A;  2LGY A;  4KDI C;  2WYQ A;  2MP2 B;  4DDG D;  2MBH A;  1FXT B;  2DZI A;  1WYW B;  3EEC A;  4CHK A;  2RD0 A;  2JRI B;  2MW5 A;  4WWN A;  1RAX A;  4KIK A;  2OJR A;  1F9J A;  1UH6 A;  3A9J B;  4M8N A;  5G55 A;  5C23 A;  1IP9 A;  3RUI B;  3DPD A;  3RZF A;  4GDL B;  2NR2 A;  4GDK A;  4OVU A;  4RM8 A;  4ICU A;  3M62 B;  4NNJ B;  2M8S A;  4F7Z A;  4W9H A;  3VUW A;  3PRZ A;  1WFY A;  3DBL I;  4BBN C;  1WX9 A;  4FA6 A;  3PT2 B;  4DBG A;  1WGY A;  3ZW3 A;  2FAZ A;  4DHZ E;  4JQW C;  2N7E A;  5JHB A;  2BKR B;  3IBE A;  4IG7 B;  1LQB A;  1WJN A;  2A5U A;  2IY1 B;  3NS8 A;  1V49 A;  4I6P A;  3OJ4 B;  5DPT A;  2RGF A;  3WAL A;  3S2A A;  3L08 A;  2KXJ A;  1JRU A;  2KDB A;  3V6E B;  2JZ3 B;  4DHJ B;  1GC6 A;  4GOC A;  1WXM A;  3ZNH B;  3IVF A;  3ZNI D;  2KVR A;  2IZV B;  2MRP A;  4G0N B;  3ZLZ A;  2KMA A;  2XK5 A;  5AZG A;  3PPA A;  5FR6 A;  3N32 A;  4BOS C;  1J0G A;  2KKC A;  1UGM A;  1WGR A;  4MM3 A;  5G2N A;  2KWC A;  2AL6 A;  3V62 A;  1KLV A;  3ZVV A;  2N9P C;  1OGW A;  4WWP A;  1R4N I;  2IO2 B;  1QZE A;  2O6V B;  4ZRI A;  4ANW A;  2J0J A;  3AXC A;  4W9J A;  3MTN B;  2N9X A;  1WIA A;  2G45 B;  2LZ6 A;  3ML8 A;  3W1S C;  1WRD B;  2NCN A;  5D94 A;  4II2 B;  4EZL A;  2L76 A;  2N1V A;  4DXA B;  2M4N A;  3KW5 B;  3U30 A;  2JUO A;  4II3 B;  3KYC D;  3B0A A;  4IM2 A;  4HCN B;  4KSL C;  3UIP B;  3QHT A;  3B08 A;  2IYD B;  2MQJ A;  2DHZ A;  3HK0 A;  5CHF A;  1WMH A;  5J2R A;  2BYE A;  3SDL C;  4GGQ A;  3ECI A;  2ZNV B;  1T0Y A;  3VUY A;  2ZPY A;  4ZRK A;  4AWJ A;  2KAN A;  4EKU A;  4G11 A;  2RPQ A;  2YVC A;  3KUZ A;  3RD2 A;  2BYV E;  2WDT B;  4ICV A;  3ALB A;  3Q3J A;  1P0R A;  2LI5 A;  2MBQ A;  3A9J A;  3ZKJ C;  2M1M A;  3CST A;  4IWO A;  1YD8 U;  4B9K A;  4BBN F;  4WJQ A;  4GDL A;  1UD7 A;  2FUH B;  4KDL B;  3EFU A;  4AOF A;  2LWP A;  3M95 A;  4MGI E;  4DWF A;  3A4R A;  3ZUN A;  2JWZ A;  4HDQ A;  1ISN A;  1Z5S B;  2BYF A;  2KFK A;  3PHX B;  3QQ8 B;  4PYU A;  2N9E B;  2ZCB A;  3V61 A;  4DDI D;  4NJ6 A;  2KDF B;  2AWT A;  4PS7 A;  3TCA A;  4WJN A;  5E6N A;  3TJP A;  5J18 A;  4MJS A;  5D6J B;  1KM7 A;  1XQQ A;  2KHW B;  3M3J A;  1M94 A;  2BKF A;  4LDT D;  3UIN B;  1R4M I;  2W9N A;  2PPH A;  2KLC A;  4BVU C;  3SU8 X;  1PQS A;  3L54 A;  2C7H A;  2L3Z A;  2M0X A;  3HM3 A;  2D3G A;  4TQ0 A;  3A33 B;  4HVB A;  3DBH I;  1GNU A;  3WAM A;  3JVZ X;  2KTF A;  4F8C B;  1IYF A;  4X57 B;  4BKT A;  4E74 A;  4FJZ A;  4A3O A;  5L95 C;  1WE6 A;  3PZD A;  4W9E A;  2DYM A;  2EKE C;  4FJV B;  2BF8 B;  2UYZ B;  3DVG Y;  3X23 A;  3ZRC A;  5JH5 C;  3WAO A;  1H8C A;  2BPS A;  3VTU A;  5AZH A;  1GUA B;  1UBI A;  3ONS A;  1I35 A;  1WH3 A;  1WR6 E;  2MCN B;  4EEW A;  4ZYN A;  4I6L B;  2DZM A;  1S3S G;  2DEN B;  5JZE B;  3VUX A;  4EFO A;  2LXA A;  4B95 A;  3ZTC A;  4IWQ A;  2BWF A;  2NBU A;  4HPM B;  3VHT C;  4NQK E;  2KLG A;  2DAJ A;  2JVC A;  3DVG X;  3R3M A;  3OJ3 A;  4KZ0 A;  4W9K A;  3X0W A;  3APF A;  1WX7 A;  1E5W A;  4FHK A;  2DAF A;  3TBL D;  4ANX A;  2LUE A;  1WJU A;  4EOY A;  3RYT A;  3ENE A;  1S1Q B;  4XZ4 A;  3UGB B;  1E8Z A;  4W9D A;  5E6O A;  3IHP C;  2LVP A;  2DZK A;  2K25 A;  4PS8 A;  4DHJ D;  3U8Z A;  3PGE A;  3A9K A;  2DYB A;  4IW0 A;  1YJ1 A;  4NPN A;  3TIX A;  5KHQ A;  2KQ7 A;  3VTV A;  1XT9 B;  3D32 A;  4FAD A;  1Q5W B;  1AAR A;  2A4Z A;  2D2Q A;  4NQL B;  1LM8 B;  1NBF C;  1YX6 B;  4BKS A;  2REX A;  4JGH B;  1WF9 A;  3CSF A;  4GSW A;  1WXS A;  3QC8 B;  4DHZ B;  5AEK B;  4JLC A;  4NY0 A;  4TV3 A;  2K6Q A;  2WX0 A;  4TQ1 A;  3PV1 A;  3APC A;  3DBS A;  4EZK A;  4KZC A;  1GJZ A;  3M63 B;  1WZ0 A;  2LAS A;  3AUL A;  1UBQ A;  2FCN A;  5J17 A;  5TR5 A;  3MJW A;  2GOW A;  3H6N A;  4TUU A;  1WGG A;  2CHZ A;  2Z59 B;  2O2V A;  4URK A;  4NAW B;  3B1L X;  3H1U A;  1E7V A;  2DYO A;  4KV2 A;  2ZPN A;  4BKG A;  3PHW B;  2HTH A;  1LXD A;  5E6P A;  2KMC A;  4KVG B;  1A5R A;  1P3Q U;  2MSE D;  4GMV A;  5LXI B;  1EF1 A;  3DBR I;  3APD A;  2KD0 A;  2I1J A;  2FCM A;  2M17 A;  3QAR A;  2ZJD A;  2KNB A;  3PLU A;  2KN5 A;  2OOB B;  5LXH A;  3QIJ A;  3NZS A;  2ZVN A;  3DCG A;  4BKS D;  3H7P B;  5CX3 A;  3PRP B;  4M0W B;  4F1S A;  2V3S A;  2I1K A;  4TKN A;  2MP2 A;  3QCA A;  2D10 A;  4RMA A;  2IO1 B;  1ZKH A;  1SE9 A;  2KJR A;  2CKH B;  1V80 A;  2NPT B;  4BOZ B;  3Q3F A;  3VXW A;  2J0K A;  5D2M B;  1WJ4 A;  2NVU I;  3R7Q A;  2D07 B;  3PLV A;  4MSM B;  1P9D U;  4FHJ A;  2CU1 A;  2Z0D B;  1V81 A;  3P2B A;  3JSV B;  3L10 B;  2KX3 A;  4K81 A;  4FLH A;  2JPH A;  4GN1 A;  4IM3 A;  2FID A;  4K1R B;  4CYE A;  1KOT A;  3H7S A;  3K9P B;  1E8Y A;  1E7U A;  4ZDV A;  3DVN V;  2R2Q A;  1WGH A;  3NY5 A;  4MH0 E;  3PRM B;  1SGH A;  2PE6 B;  2KZR A;  1RLF A;  3K9O B;  3OLM D;  4KIK B;  4XC2 A;  5BO4 B;  5DPW A;  3GOE A;  3AU4 A;  1WXA A;  1V5T A;  3AI5 A;  3HHM A;  3WIM A;  1HE8 A;  4G50 A;  2AYO B;  1IPG A;  4GDK B;  2ZVO A;  1WM3 A;  5LLI A;  4HPL B;  4ASW C;  3VVW B;  3QWZ B;  4HK2 A;  1VD2 A;  4HLE A;  2V1Y A;  3EC8 A;  4E71 A;  1E8X A;  1H4R A;  4HCP B;  4G3X B;  3RZW C;  2J7Q B;  3SHQ A;  4DK5 A;  1WY8 A;  1CMX B;  4BFR A;  1MG8 A;  2CHW A;  5L83 A;  4PYZ A;  2MBO A;  2K8H A;  2LGX A;  4W9I A;  2L0T A;  2O6V A;  2FIF A;  2WX1 A;  1LFD A;  3IFW B;  1OQY A;  2JRH A;  4FN2 A;  3N3K B;  2MWS B;  3T9L A;  1OEY A;  1VCB A;  2GBJ A;  4RM9 A;  2KWV B;  4N9F 4;  1TGZ B;  2KJ6 A;  4AUQ C;  2BWE S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...