1J0GA

Solution structure of mouse hypothetical 9.1 kda protein, a ubiquitin-like fold
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
92
structure length
92
Chain Sequence
GSEGAATMSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical Protein 1810045K17
publication title Solution Structure of Mouse Hypothetical 9.1 kDa Protein, A Ubiquitin-like Fold
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 9
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2002-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03671 Ufm1 Ubiquitin fold modifier 1 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1j0gA00
3NOBA 2MQJA 2ZEQA 1EO6A 2AYOB 1ISNA 2KK8A 3NY5A 2KNBA 5J2RA 1D3ZA 1TTNA 3RUIB 1AARA 3CSTA 2KMAA 4W9CA 3PPAA 3V6CB 2O6VA 3NHEB 4IM3A 2ZPYA 2ZNVB 3DVNV 1WH3A 3BINA 5KHOA 4YL8A 4LJOB 1V49A 3DBLI 3VUXA 1WRDB 4KVGB 2VRRB 2MLBA 3O65B 4WJNA 3RCZA 3U8ZA 3ECIA 1WIAA 4WWPA 4E3CA 2FIDA 2FUHB 1KLVA 4IWPA 4HXDA 1ZW7A 2ASQA 2OJRA 1WR1A 4DDID 3HK0A 2REXA 4JQWC 3A1QB 4X57B 2N7EA 4CYEA 2LUEA 2UWQA 3KUDB 3KYCD 2KJHB 1S1QB 3L13A 1P1AA 4II2B 4FJVB 3VUYA 2M1MA 4W9GA 3PV1A 1WMHB 4F1SA 4MELA 1K8RB 4OVUA 4II3B 2M4NA 3JYUA 2LD9A 2PE6B 2AL3A 5C23A 1XT9B 1XQQA 2DAFA 2DYMA 3RT3B 4EZLA 4G3XB 3N30A 3V60A 2WYQA 4ZYNA 1WXMA 4GDKA 1E90A 3DVGX 2OOBB 4I6LB 3RULA 2DZIA 1E8XA 1LFDA 2KFKA 3TCAA 3TMPB 3QK0A 3VTVA 4BFRA 4MH0E 1CMXB 2BPSA 2LVOA 1WZ0A 1XD3B 1WX7A 2FIFA 3PHXB 4A3OA 1WZ3A 1UELA 2MP2A 5D6JB 5J17A 4WJOA 3N32A 2AWTA 5D7GA 1OGWA 1P9DU 4ZDVA 3LDZE 4ASWC 3NZSA 1F9JA 2LGDA 4IM0A 2RSUA 4BOZB 3A9JA 4M8MA 4K1RB 3ALBA 2KXJA 4B6WA 3H7PB 1GC7A 2DX5B 4RMAA 5E6OA 3WIMA 3PT2B 2QHOA 4DHJB 2FNJB 3N3KB 2KLGA 3QARA 4LDTB 3PRPB 3T8MA 4FHKA 2D07B 3CMMB 1SGHA 3VDZA 2KMCA 4K81A 3Q3FA 4J6IA 2KTFA 2MBBB 5DPTA 3NZUA 2YLMA 3IHPC 5DPSA 2KANA 3VUWA 3R7QA 2IYDB 1S3SG 3DOWA 1UGMA 2B3AA 3PREA 3V6EB 4MJSA 3ZNHB 3PTFC 5JHAA 3QCAA 1V6EA 1IYFA 5DPRA 3WANA 2GBRA 4A20A 2LZ6A 4NAWB 2GBMA 3TL5A 3KVFB 1WF9A 3DBSA 4AP4C 2L00B 1VD2A 2Z0EB 2ZJDA 4GB9A 1A5RA 4FULA 2XK5B 3JSVB 4GXBA 4W9IA 4W9FA 3WAPA 5AZFA 3K9PB 4FBJB 3R7RA 1LM8B 4PS3A 1P0RA 3OAWA 3A9KB 2LXAA 2G4DB 2G45B 1WGYA 4FHJA 2JZ3B 3WALA 4ANWA 2O6VD 4DXAB 3UIPB 3BY4B 2KO3A 2N7DA 4KSKC 2KWCA 2NPTB 3DBRI 4NPNA 1NI2A 3RZFA 4IUMB 4IC7B 2KWUB 5JZEB 3DCGA 2L7RA 2LRWA 2JPHA 2JUOA 2LXCA 1P98A 1V9JA 3QWZB 4GU2A 3VTWA 4BKSD 3HIZA 1WGRA 1GUAB 2LASA 1BT0A 2WWZA 5JHBA 4PS7A 1YX5B 3VFKA 4FN2A 3B0AA 4XZ4A 2Z59B 3DVGY 2KDEB 2FCSA 4RM9A 2UYZB 1RRBA 3ZNZB 4G11A 2JF5A 1NBFC 2JXXA 2L05A 2DENB 2IO1B 1WM2A 3DVNU 1TZ1A 2C7MB 3HHMA 4A3PA 3ZLZA 2O2VB 3A4SC 4M0WB 5IA7A 4M8NA 4WJPA 5LXHA 3ML9A 2NCNA 3C0RB 1WFYA 4GDLA 4KIKB 1YJ1A 2KN5A 2LRUA 1LXDA 1OEYJ 1UH6A 2FAZA 2BYEA 2M0XA 4I6NB 4FLHA 4BBNF 5EDSA 1V81A 3VH4B 2MRPA 2EMSA 4WQOB 2JT4B 3PLUA 2KTRB 4HJKA 3VVWB 4W9KA 1OEYA 2JRHA 4TQ0A 1SIFA 2IBIB 4HLEA 3PZDA 3W1SC 4JL9A 4KZ0A 3JW0X 4MGYE 5JH5C 2EKEC 2KD0A 5CTRC 3EHVA 3SDLC 2CHXA 3QX1A 2G3QB 4AJWA 4BKGA 1C3TA 2HJ8A 2C60A 1WX9A 2GBKA 2L3ZA 2DHZA 2N4FA 4W9JA 5TR5A 2KZRA 4BOSC 4DDGD 3ZW3A 3VTUA 3OLMD 4MEMA 4E74A 4MGKE 4AWJA 2LGYA 2LVPA 1EF1A 2M17A 4CHKA 2ZCBA 3KH0A 4KZCA 3VHTC 3MJWA 2WX1A 2RD0A 3MHSD 3APFA 4MDKE 3PRMB 4NY0A 2HD5B 3IVFA 4IWQA 1T0YA 4MSQB 4AJYB 4DWFA 4IWOA 4TQ1A 4DHZB 1OTRB 4MGIE 1WXAA 1NDDA 2MBEA 4HWIB 3HM3A 5G2NA 4EUTA 3VH3B 3SU8X 1Q0WB 2I1KA 3QAQA 2CHWA 2XEWA 2MA9B 3QJZA 5L83A 3TIXA 2BKRB 1E7VA 1GC6A 3QIJA 4JGHB 2AEHA 2BF8B 3KUCB 4HDOA 4IG7B 4AUQC 2MBQA 2PPHA 1WGDA 1UBQA 2KDIA 3UINB 4F8CB 1E8YA 2IY0B 2BGFA 3DDCB 2CR5A 2MBHA 2NS5A 3WA0A 1WMHA 1YIWA 1QZEA 3AULA 2G4SA 1UZXB 2MCNB 1WY8A 2BWES 3KW5B 1RFAA 3QA8A 1U4AA 2YVCA 3RYTA 4BBNC 2DYOA 4WWOA 3P2BA 3Q3JA 3U7DA 3UGBB 4BVUC 1G6JA 2CHZA 3IG3A 3GZNI 3PRZA 4HK2A 4NQKE 4P7IA 2EMTA 5D2MB 3B1LX 4NJ6A 4G0NB 2N9EB 2O6VB 3DQVA 2MX2A 4GMVA 4FJYA 2K8HA 1E7UA 3VAWA 1KOTA 2IO3B 4GN1A 4KDLB 1Z2MA 3ZIMA 2WX0A 2ZVNA 4EFOA 1PQSA 1KJTA 3QHTA 2ZNVC 3PLVA 1WGGA 2MBOA 2I1JA 5E6PA 3V62A 3AXCA 1Q1OA 3H7PA 1IPGA 2KDFB 1L2NA 2KVRA 3L08A 3X0WA 2N9PC 3ZVVA 4DBGA 1P3QU 2XBBC 3AU4A 4MSMB 2FCQA 2Z0DB 4EZKA 2J7QB 5AZHA 3OJ4B 1E8ZA 4GSWA 1E8WA 1VCBA 2FCNA 2JY6A 3S2AA 3L10B 4IM2A 4G50A 3D32A 5DPWA 1H4RA 4XC2A 2KQ7A 2RPQA 4PYZA 5HKHA 2BKFA 4GDKB 4HDQA 4DK5A 2WDTB 1WR6E 3PSEB 2KOXA 4NAWA 4JIOU 3KYDD 1C1YB 4W9HA 2KFKB 3TBLD 2A5UA 4WJQA 3KUZA 1UBIA 4FJZA 4PYUA 1OQYA 4GGQA 2FCMA 4WWNA 3UF8A 2XK5A 3JSVA 4IW0A 4BKTA 4DHZE 3M95A 1TBEA 3EFUA 1RLFA 3SHQA 2L8JA 2MP2B 3L0WB 2MWSB 3A4RA 3ZO5B 3W1YA 4RM8A 3JVZX 2IO2B 4HPMB 3A9KA 2J0JA 4K7UA 1WYWB 3L17A 2BWFA 3ZRCA 2LVQA 3A9JB 4LJPB 5CHVC 2CS4A 4ZRJA 5DCNA 2IZVB 2N9XA 2C7NB 3X23A 1HE8A 3ZDMC 4TV3A 4OVVA 2NPTA 3IBEA 5E6NA 2KC1A 2K6DB 3K9OB 1V2YA 5KHQA 1YD8U 4MGZE 2D2QA 3L54A 2LWPA 2NBUA 2IO0B 2KFJA 4BKSA 4EKUA 4E71A 3UQAA 3R3MA 3U30A 4AOFA 5BO4B 4FADA 2BYFA 3EC8A 2KHWB 1L7YA 4KSLC 1EUVB 4MJSB 3DBHI 2C9WB 3ZRFA 4HVBA 5D94A 4ZRIA 3H7SA 2J0KA 3HM6X 3EECA 2KLCA 4W9LA 4MM3A 2C7HA 1EF5A 3CSFA 3PHWB 1WE7A 2NBVB 2RR9A 3RD2A 4EOYA 2O2VA 5C1ZA 2RGFA 2L76A 2KKCA 1E5WA 1SE9A 1R4NI 2ZCCA 3QQ8B 4TKNA 5J18A 2K8CA 1WGHA 2GMIC 3ZUNA 3ENEA 4KIKA 3M62B 4ANVA 5LLIA 4GIVA 4TUUA 2GBNA 1ZKHA 2KC2A 3MTNB 3DPDA 4I6PA 3PGEA 4ICVA 2K25A 3M3JA 1Q5WB 2JVCA 2L0FA 1WJUA 5CX3A 3H6NA 2MSED 1V5OA 1Z5SB 1LQBA 3I3TB 5AZGA 2CU1A 3A33B 3TJPA 3ZNGC 4GOCA 4CO7A 2V3SA 3A1QA 3SD5A 1WXSA 2D11A 2AL6A 2KX3A 2K6QA 2ZZPB 4PS8A 4ANUA 3VQIA 2KTRA 5L95C 2L0TA 2PEAA 4KDIC 2LJ5A 2DYBA 5LXIB 2KX0A 5FR6A 2D3GA 2NR2A 3RZWC 1ZGUB 2V1YA 4URKA 4EZJA 4W9EA 1V5TA 2JRIB 2NVUI 2KDBA 1RAXA 4DHJD 4LDTD 2ZVOA 3WAOA 2IY1B 2A4ZA 3V61A 3APCA 2PE9A 3ZNID 3VXWA 4JLCA 5IAAC 4ANXA 4K7WA 1GNUA 4B9KA 5GMVA 1X1MA 1Y8RC 3ZDTA 4NQLB 2CKHB 1I35A 3UQBA 4WAAA 1WJ6A 2JZZA 2DAJA 1I42A 1GG3A 2KWVB 4LCDE 1R4MI 3AU5A 3M63B 4GDLB 2K39A 1WI0A 1TGZB 4K7SA 1GJZA 2KJRA 3ONSA 1WJNA 1WJ4A 2PJHA 3GOEA 4N9F4 4HPLB 1J8CA 3PVLA 2D10A 3AI5A 1IP9A 4F7ZA 2HTHA 2N1WA 3QC8B 3OJ3A 4ICUA 1YX6B 3ZKJC 1JRUA 1MG8A 1FXTB 2J0MA 4NJ7A 5CHWA 3H1UA 3B08A 1V80A 2KQSA 1J19A 2N1VA 2DZKA 5CHFA 2W9NA 3ML8A 4HCPB 3T9LA 3CF6E 3L16A 3APDA 3UIOB 2K1FA 1WX8A 3W1SA 3H9DA 2R2QA 2ZPNA 3R66C 4NNJB 2GOWA 2GBJA 2HE7A 4ZRKA 2JWZA 3IFWB 4HCNB 2LGXA 4KV2A 3ZTCA 2LI5A 2M8SA 1V86A 3LJ3A 1J0GA 5AEKB 3ZTDA 3PS6A 2R2OA 2K8BA 1UD7A 2C5LC 4B95A 2BYVE 4EEWA 1YQBA 2Y5BB 1WM3A 2DZJA 4XX5A 1M94A 3WAMA 1H8CA 4W9DA 1KM7A 2DZMA 1WXVA 5G55A 2MW5A 4FA6A 3NS8A 2NBWB 2KJ6A 2V4LA 1WE6A
chains in the Genus database with same CATH superfamily
3NOBA 2MQJA 2ZEQA 3SR6A 1D3ZA 3RUIB 1AARA 3CSTA 2KMAA 3L4PA 1AWDA 3T3NA 4LJOB 3DBLI 1WRDB 1D5XC 3RCZA 4WJNA 5E6JA 1WIAA 4WWPA 2IGGA 4IWPA 4HXDA 2ASQA 4DDID 1JROA 3HK0A 3A1QB 2LUEA 5EE9A 3KUDB 1S1QB 1ENFA 2IJ0A 1P1AA 4MELA 1LO5D 1TIFA 4II3B 4N59A 2PE6B 5C23A 2DYMA 3V60A 3DBHB 1WXMA 2IGDA 4L1BA 4HKQA 3RULA 1STEA 4EE2A 3QK0A 2M56B 4MH0E 4HRSA 2LVOA 2FIFA 1N5XA 1UELA 4XYCA 5D7GA 2IGHA 1P9DU 4ZDVA 3NZSA 2LGDA 5IOIA 2RSUA 1XXGA 2KXJA 3WIMA 2FNJB 4LDTB 2KLGA 4LNKA 1JWUD 1QOGA 3KWVA 3DHGC 4J6IA 1ESFA 2HJ1A 3VUWA 2AQ2B 4NZLB 1IUEA 1LGRA 4MJSA 1FXIA 2W3SA 2QSDA 4M01A 1WYGA 2Y5PA 5FKAC 4A20A 2TSSA 2GBMA 4AP4C 1QF6A 2WXGA 4FULA 1JWAD 2XK5B 4GXBA 4W9FA 3N9YC 1LM8B 1MHXA 1P0RA 1FO4A 1WGYA 1D4BA 2WNMA 2JZ3B 2NMQA 3B2GA 3UIPB 3BY4B 4MT5A 2NPTB 3DBRI 1NI2A 4IC7B 2KWUB 3AM9A 2LRWA 1L0XB 1V9JA 2LXCA 3QWZB 1YQ4B 3DVGY 2JU6X 2KDEB 3ZNZB 4G11A 2L05A 1ET9A 2ICIA 2V3NA 1TZ1A 1QQRA 5AUKA 3HHMA 4M0WB 4ZRPA 3BYYB 2NCNA 3WCQA 4KIKB 2J53A 4YWGG 2LRUA 2I2YA 1JALA 4FLHA 4BBNF 3IXSA 1JW9D 1V81A 1P7EA 2MRPA 2EMSA 2L83A 1ZDVA 4JWUC 1E0ZA 2IDYA 3VVWB 4S17A 4RNAA 1TZOA 4HLEA 3HVDA 4JL9A 1DYQA 4MGYE 1F2RC 1HXYD 2KD0A 5CTRC 3NG0A 1J7BA 3W5VB 3Q8FA 1C3TA 1F77A 3SFEB 2L3ZA 5TR5A 4W9JA 4MEMA 4MGKE 2LVPA 1Y56A 2LMCA 3BK2A 4FXCA 3MHSD 5TSSA 2RDGA 2Z8LA 3IVFA 3IAS1 1T0YA 1TY2A 2DBYA 4OZBA 3RNEC 2CU3A 1OTRB 1VRAB 4ZRQA 5T8IA 3RN9C 4WAFA 2XEWA 3TIXA 2BYTA 2BKRB 1E7VA 1GC6A 1YN3A 1WGDA 1UBQA 2KDIA 3FAHA 3CWIA 1E8YA 3BK1A 3DDCB 2MBHA 3P4QB 1YIWA 1WY8A 3V3XA 2PLPA 4C4VB 3CIRB 2YVCA 2DYOA 4WWOA 1YOVB 3TUOA 3Q3JA 2CJOA 2J42A 4BVUC 1UUPA 2JYTA 3ZXRA 4G0NB 1PGBA 4GMVA 1E7UA 2K5PA 1KOTA 2IO3B 1RM6C 3ZIMA 2WX0A 1M4VA 1PQSA 1ZDXA 2ZNVC 2PW9A 2MBOA 3AXCA 1SJHD 1IPGA 1YQ3B 1L2NA 3X0WA 2NTTA 2H89B 3ZVVA 1PUTA 1P3QU 4IKGA 4EZKA 5AZHA 1SBBB 3AE5B 1E8ZA 1TKGA 1E8WA 2FCNA 5I4DA 3ABVB 3S2AA 1FCLA 5DPWA 4XC2A 3R2TA 5HKHA 4RGNA 4GDKB 4HDQA 4KKIA 3N1YC 4WWNA 1OQYA 3UF8A 4BKTA 4LNIA 2QC8A 1TBEA 3EFUA 2MP2B 3MJ5A 3ZO5B 3W1YA 4RM8A 3JVZX 4K7UA 1I4PA 3A9JB 5CHVC 2RDBC 2C7NB 1HE8A 4TV3A 5E6NA 2KC1A 2K6DB 1V2YA 4YXDB 4WH4A 2WXPA 3L54A 1QOAA 3UQAA 4P1CC 3AE7B 1IBXB 2WXRA 4FADA 3EC8A 2FBWB 3DBHI 4ZRIA 1GB1A 3H7SA 3HM6X 3EECA 3IAM1 3P1MA 3CSFA 1WE7A 2NBVB 3OG5A 2RR9A 3RMKC 2O2VA 2RGFA 1R4NI 3ETRA 5IKCM 3ZUNA 3ENEA 5LLIA 4TUUA 3E56A 2KC2A 3DPDA 4ICVA 3U7DA 3H6NA 1Z5SB 3A33B 1WXSA 2AL6A 2K6QA 4PS8A 2KTRA 3GE8C 2PEAA 3RZWC 3N1XC 4LLGM 4EZJA 3B9JA 2WQYB 4LDTD 2ZVOA 3WAOA 2IY1B 1TS5A 1DOYA 3URYA 5IAAC 1I35A 4L23A 2JZZA 4KKJA 1I42A 3AE6B 4J3OD 1YJJA 1WI0A 1WJNA 2WXLA 3GZNB 4K3CA 2D10A 1IP9A 4F7ZA 3ZKJC 1YX6B 2BS4B 1FXTB 2J0MA 4NJ7A 4C7ZA 2BVCA 3B08A 2KQSA 5CHFA 3ML8A 4HCPB 1YN5A 1HA5A 5MPOA 1WX8A 3W1SA 2R2QA 2ZPNA 3R66C 4NNJB 2HE7A 3BVMA 3IFWB 4KV2A 1V86A 2K8BA 2C5LC 3SEBA 4HKZE 4EEWA 1WM3A 4XX5A 2N7JA 1KM7A 3AB5A 2NBWB 4ITKA 5D3IB 1ISNA 2KNBA 1NENB 4W9CA 3TSSA 3V6CB 2O6VA 3RNFC 5BMGA 2JYEA 1WH3A 5KHOA 3BVGA 2KT7A 3VUXA 4KVGB 3EUB2 2MLBA 3O65B 1I4GA 3ECIA 4C00A 1ZW7A 2OJRA 1WR1A 4O1NA 3VR9B 2XN9C 2N7EA 4CYEA 5C2TB 3KYCD 2KJHB 1GAQB 4KGTA 2MH7A 3MC8A 4II2B 4HPPA 5G5HA 1K8RB 2L32A 2M4NA 2AL3A 1XT9B 3RT3B 1JQ4A 4C56C 1FFVA 3DVGX 2OOBB 5H92C 3NVZA 2DZIA 2N0SB 3TEWA 2ZW0A 3VTVA 1CMXB 1XD3B 3PHXB 1EU3A 1I4XA 4XDCA 5D6JB 4WJOA 3N32A 3PZ8A 3BWUD 5EE1A 3NVVA 3LDZE 4ASWC 2L52A 3B2FA 4K1RB 3ALBA 3PZ7A 4B6WA 2DX5B 4OHJA 3NZ3A 4DHJB 3N3KB 2JXTA 3PRPB 2DWQA 3DHIC 4FHKA 4K81A 3Q3FA 2MBBB 1C79A 3NZUA 2YLMA 1XLPA 5DPSA 1S3SG 1K52A 1UGMA 3PREA 3V6EB 1I7HA 3ZNHB 3PTFC 4ARIA 2GBRA 2JQRB 3KVFB 3DBSA 1VD2A 4GB9A 1A5RA 3JSVB 4W9IA 1T6BX 4JX1C 5AZFA 4USAA 3Q3OC 1R4MB 1GB4A 2X38A 4PS3A 2G4DB 4CQNA 1NYRA 1N63A 4ANWA 3MC0B 3U7ZA 2BBCA 2L7RA 2JPHA 1Q10A 4GU2A 3HIZA 1WGRA 2WWZA 5JHBA 2FCSA 3KQ4A 1RRBA 1NBFC 2JXXA 2DENB 3AEEB 4MM3B 2C7MB 3SFDB 2CJNA 3A4SC 3ML9A 5HI1A 3C0RB 1WFYA 4HROA 1QLBB 2I38A 1XEEA 3AMZA 1OEYJ 2BW2A 1UH6A 4I6NB 2BYEA 2MJDA 2JT4B 2LHEA 2JRHA 2IBIB 4RGOS 2QMTA 4KZ0A 3I9V1 4RF1A 3ZGZA 1KRHA 3SDLC 4JPSA 4AJWA 3Q8EA 3BIID 1UWMA 2N4FA 4BOSC 2BS2B 1FPYA 4AWJA 1EF1A 4CHKA 3KH0A 2GLSA 3VHTC 3MJWA 2WX1A 2RD0A 3APFA 4MDKE 2WXMA 4MSQB 4RGMA 5HFYA 1FNWA 4MGIE 1WXAA 2GI9A 3HM3A 3NRZA 3SU8X 1Q0WB 2I1KA 1K51A 2CHWA 4WIPA 1N61A 5BMIA 4TSSA 2WXHA 4P6VF 4AUQC 3KUCB 1FNUA 1T0QC 1ZXIA 2PPHA 3GS2A 3RNGC 3WA0A 1WMHA 1QZEA 2G4SA 2MCNB 2LGIA 1VZ6A 1WWTA 1TYGB 1U4AA 3RYTA 1G6JA 1T5XD 3GZNI 1EWYC 4NQKE 2D5GA 3B1LX 4NJ6A 2N9EB 4FJYA 2K8HA 3Q69A 3VAWA 3ZJTA 1WSPA 2INPE 4KDLB 2ZVNA 2WXKA 3OWEB 2WDVB 4A90A 4ZYSA 4NAMA 1WGGA 3NVYA 1RFKA 2LUMA 3VR8B 1Q1OA 3H7PA 4RF0A 2D3CA 1D6EC 2KVRA 3ZXVA 4DBGA 3AU4A 1FIQA 2Z0DB 3N1ZC 2WP9B 2DLBA 2VH1A 1C9FA 2W54A 3P4SB 3D32A 1VZ8A 2KQ7A 4NAWA 2KOXA 1C1YB 4W9HA 2A5UA 3LYYA 4AQ7A 1YN4A 3FILA 4BAXA 2FCMA 3M95A 2HTME 3SHQA 2L8JA 4HPMB 3A9KA 3ZRCA 2LVQA 2IZVB 3I63C 2OJWA 3VRAB 4A8XC 3K9OB 5KHQA 3GE3C 2D2QA 2M0AA 2WHIA 1L5PA 2IO0B 2NBUA 4EKUA 4YSXB 1C4CA 2DNFA 5BO4B 2BYFA 2QJLA 2KDMA 1L7YA 4KSLC 4MJSB 2C9WB 1CK1A 3ZRFA 1L6VA 5BYRA 3AEDB 4A9AA 2KKCA 1E5WA 2ZCCA 2HDEA 1MFWA 3QQ8B 4TKNA 3AE2B 2K8CA 4MH8A 1WGHA 4GIVA 3MTNB 1K50A 4I6PA 2LJIA 1Q5WB 2L0FA 5CX3A 1WJUA 1K53A 3ZNGC 2CU1A 2QCZA 3HVZA 3GP7A 2V3SA 4DXFA 2J4XA 3VQIA 1WGKA 5LXIB 2KX0A 4H2AA 1XLOA 2NR2A 1ZGUB 4URKA 2OHFA 1V5TA 2NVUI 2KDBA 1RAXA 3P63A 4DHJD 2QDFA 1MVKA 2INCC 2PE9A 3ZNID 3VXWA 4JLCA 5G5GA 5GMVA 1X1MA 1Y8RC 3ZDTA 4NQLB 4WAAA 1XLQA 1V8CA 1C4AA 1WJ6A 2DAJA 1R4MI 3RNAC 2K39A 1TGZB 3V05A 3ONSA 3RNCC 4TMAB 3GOEA 1PYWD 3PVLA 2HTHA 2N1WA 2PMVA 3OJ3A 1JRUA 3H1UA 3MHZA 1J19A 2N1VA 2DZKA 1EM7A 3CF6E 3L16A 1DGJA 3UIOB 3H9DA 1T3QA 1FD6A 4OZAA 2LGXA 3ZTDA 4B95A 2BYVE 4IDIA 3T3OA 2UU7A 2DZJA 2NTSA 1MHHE 3WAMA 4YTPB 1WXVA 2MW5A 4FA6A 2KJ6A 3O13A 1WE6A 1V97A 2OEDA 1EO6A 2AYOB 5J2RA 4AS1A 1TS4A 1TTNA 1L6UA 3RFZB 2AQ1B 3ZYYX 3PPAA 1I4QA 5D3DA 4M00A 2ZNVB 3DVNV 4YL8A 1V1PA 1V49A 4E3CA 1KLVA 5HHDG 4XWWA 4JQWC 4LNOA 2UWQA 2Y5CA 3MFGA 3L13A 3VUYA 4FJVB 2M1MA 1UWXA 3MC9A 3Q8AA 4OVUA 4YTNB 4R3DA 2X8XX 1R7SA 4EZLA 2WYQA 2INNE 1E90A 1E8XA 2KACA 2KFKA 3TCAA 3Q6BA 1OQQA 2ONQA 3P42A 2AWTA 2YEPB 1OGWA 4XDDA 4C7YA 1F9JA 4IM0A 4BOZB 1N6ZA 1GC7A 1E6EB 4A6QA 2LGSA 5DPTA 2E6XA 3IHPC 5HG2A 3R7QA 3DOWA 5IN7A 2WU2B 2B3AA 4YT0B 1FEHA 2V9HA 1V6EA 1IYFA 2V4IB 2KVZA 2INDC 3TL5A 3TEZA 3TEYA 2L00B 2ZJDA 3AN1A 3K9PB 3R7RA 4LNNA 2L1AA 2LXAA 2G45B 1NVID 3U52E 4DXAB 2KO3A 2N7DA 4KSKC 2KWCA 2LHDA 2RMMA 4YTMB 4YSYB 2JUOA 1P98A 3VTWA 1GUAB 2LASA 3AE3B 3AECB 2B76B 1YX5B 3VFKA 4FN2A 4XZ4A 2Z59B 2UYZB 3DBRB 2JF5A 3DHHC 4OW0A 3FC4A 4PT5A 2W82A 4A3PA 2O2VB 4ARCA 5LXHA 4S0RA 3NVWA 4GDLA 2VZKB 1JWBD 4RGTA 1B1ZA 1YJ1A 2KN5A 2FAZA 2WS3B 1NI3A 3VH4B 4JWSC 3W5UB 5JXVA 1QOFA 4WQOB 2KTRB 4HJKA 4W9KA 1OEYA 4TQ0A 1SIFA 3PZDA 3W1SC 1BUIC 1RYJA 5JH5C 3BYTB 3EHVA 4IOIE 1EU4A 3QX1A 2G3QB 3AEGB 2RDHA 2HJ8A 2C60A 1FCCC 2GBKA 2DHZA 2AQ3B 2KZRA 3J9CA 3ZW3A 4E74A 2LGYA 1ZP0B 2M17A 4OZCA 2PVOD 1QOBA 1ZUD2 5EE3A 3H8HA 3PRMB 1C4PA 4DWFA 4IWOA 1BMLC 1F2RI 1HEZE 4DHZB 3LXFA 1NDDA 5G2NA 4EUTA 2MHJA 4JE3B 2ZW1A 2MA9B 5IO9A 1SE3A 4QAYA 4DXGA 3QIJA 4JGHB 1XO3A 2AEHA 2BF8B 4HDOA 4IG7B 2MBQA 2KN4A 3DWGC 2IY0B 5BMHA 2BGFA 3UI3A 3AEFB 3AULA 1UZXB 1KTKA 3KWLA 1RFAA 3EGRA 5IP4D 3IG3A 3PRZA 4YSZB 4P7IA 4C80A 5D2MB 2EELA 1XCQL 2O6VB 3DQVA 1NEKB 1SXTA 4XWTA 1Z2MA 3QHTA 1VDVA 3HUIA 2I1JA 5E6PA 1T0SC 1FM0D 1CQVA 1EWCA 2N9PC 2XBBC 4MSMB 2FCQA 2J7QB 3OJ4B 4GSWA 1P7FA 1VCBA 1MG4A 3Q8CA 3P4PB 1H4RA 1SSNA 3DWMA 2RPQA 3KLSX 2BKFA 4DK5A 3PSEB 4JIOU 3KYDD 4WJQA 2BQQA 2KYWA 3KUZA 4FJZA 4GGQA 2XK5A 1AW7A 1HQRD 3L0WB 3RPFC 2ACZB 1WYWB 1D5MC 4ZRJA 2CS4A 5DCNA 1TS2A 4OVVA 2NPTA 2WXFA 4N6EB 2K0PA 3AE1B 2R61A 4MGZE 2K9XA 2KAJA 2LWPA 4E71A 1SJED 1TKYA 2N9LA 4HVBA 5D94A 3C19A 2J0KA 3TEXA 2KLCA 3R8BA 3PHWB 4M0WA 5C1ZA 2L76A 5J18A 1HZ5A 4KIKA 3M62B 4ANVA 4BBNC 2GBNA 3EFCA 1IGDA 2JVCA 2MSED 1V5OA 5AZGA 4CO7A 1R4NB 3SD5A 4ANUA 1AYFA 2KX3A 2ZZPB 1TJEA 4ZHPA 5L95C 2L0TA 4KDIC 4US8A 5FR6A 2IPKD 2V1YA 1TY0A 4W9EA 1N62A 1MI0A 1ZXHA 1L0YB 2A4ZA 3APCA 4GLSC 2LFIA 1JCKB 1L4DB 2JZPA 1PGXA 4KX6B 4LCDE 1C77A 3M63B 2WXOA 3AE8B 2KJRA 2BS3B 1WJ4A 1J8CA 1NYQA 3QC8B 4XE0A 4ICUA 1V80A 4REZA 3ZJUA 2WU5B 3NJTA 1L0VB 3AH7A 2GOWA 2GBJA 4ZRKA 3ZTCA 1J0GA 3PS6A 1UD7A 1N60A 1IGCA 3E9SA 1FXAA 4RH6A 4C4VA 3I5JC 2MJEA 2BB6A 5G55A 3NS8A 1F1HA 3W9CB 2KK8A 1QKZA 3NY5A 4K3BA 1ZPSA 3NHEB 3C8YA 4IM3A 2ZPYA 3BINA 2VZKD 1DOIA 2VRRB 3U8ZA 1GPXA 2FIDA 2FUHB 1L4ZB 4ZOHC 1WRIA 4LK0M 5EE0A 2REXA 4LNFA 4X57B 2EKIA 3ZJVA 1ROEA 1AN8A 1T0RC 2QEJC 2W55A 4W9GA 2G1EA 2WXQA 3PV1A 1WMHB 4F1SA 1V1OA 3Q3NC 4MACA 1SIJA 3NS1A 3JYUA 2LD9A 1CZPA 3RI7C 1XQQA 2DAFA 4G3XB 3N30A 1I4RA 4ZYNA 3MP9A 4GDKA 3AE4B 1BXTA 1TKEA 4I6LB 5AUIA 1UGJA 1LFDA 4P1BC 3TMPB 4BFRA 5H8YE 2BPSA 2FE8A 2GRIA 1WZ0A 2M19A 1WX7A 1PGAA 4A3OA 1WZ3A 2MP2A 5J17A 2WGSA 2E3TA 1I4HA 3A9JA 4M8MA 3H7PB 1ZE3D 1CJEA 4RMAA 5E6OA 2SAKA 3PT2B 2QHOA 3QARA 3T8MA 2WLBA 4LTUA 2D07B 3CMMB 1MPEA 1SGHA 1F0ZA 3VDZA 2KMCA 2KTFA 1PDXA 1IBXA 2KANA 4Q2JA 2IYDB 1UNSA 5FR3A 1D5ZC 3AEAB 1VZ7A 4M02A 1JWSD 1YMHE 1KLUD 2JSVX 1YJIA 5JHAA 3QCAA 3P4RB 5DPRA 3WANA 3HRDD 2H88B 2LZ6A 4NAWB 1HZ6A 1XLNA 1WF9A 1SF0A 2WDQB 2Z0EB 3I57A 2G9HD 3FILB 2V0GA 3WAPA 4FBJB 1OQRA 3Q8BA 3OAWA 3A9KB 2PVGC 1F52A 4FHJA 4KGSA 1SE2A 3WALA 2O6VD 3W2DA 5BYSA 4NPNA 3RZFA 4IUMB 3Q14C 3BZDB 3DCGA 4P16A 5JZEB 4BKSD 1BT0A 4PS7A 3B0AA 4RM9A 2IO1B 1WM2A 3DVNU 4ACFA 3U2SC 3ZLZA 4A55A 5IA7A 4M8NA 4WJPA 1YNTE 2K22A 1LXDA 4RFBA 3R2IA 2M0XA 5EDSA 5LNK1 1C76A 3PLUA 1KLGD 2LEKA 1FRRA 3DBLB 1JWMD 4OVZA 4UDUC 1PFDA 3JW0X 2EKEC 1FFUA 2WDRB 2CHXA 4BKGA 3Q3MC 1WX9A 1SEBD 3AE9B 4HJGE 4DDGD 1J7CA 3VTUA 3OLMD 2MJ3A 2JWUA 2ZCBA 4B0EA 4KZCA 3N20C 2ON8A 4NY0A 1J7AA 1UF0A 2HD5B 4IWQA 4AJYB 3AEBB 3VRBB 4TQ1A 1E9MA 2MBEA 4HWIB 3VH3B 1JMLA 3QAQA 5L83A 3QJZA 1HTOA 3FKYA 2AX5A 3UINB 4F8CB 2CR5A 2NS5A 4B0MA 2BWES 3KW5B 3QA8A 3P2BA 3UGBB 2CHZA 3RNBC 4HK2A 2KQ4X 4DQOC 2EMTA 2MX2A 1RWSA 4GN1A 1V1PB 1ACCA 1TT5B 4EFOA 2YEPF 1KJTA 1VLBA 3PLVA 1MJDA 3LB8C 5GXGB 3V62A 2WXIA 4D2KA 2KDFB 1ET6A 3L08A 2D3AA 3IT4B 1XF5L 3NUHB 1VJKA 1KH0A 2MEKA 2JY6A 2QILA 3L10B 4IM2A 4G50A 4PK1A 4PYZA 1B9RA 2WDTB 1WR6E 2KFKB 3AV8A 3TBLD 1KF6B 2KMMA 1UBIA 4PYUA 3JSVA 4IW0A 4DHZE 3GB1A 2K3UA 1RLFA 2MWSB 3A4RA 2IO2B 1SE4A 2J0JA 2WXNA 3L17A 2BWFA 4LJPB 1JRPA 2W3RA 2N9XA 3X23A 4N58A 4BZAA 3ZDMC 1ZOYB 1N5WA 3IBEA 1C78A 3EA6A 1YD8U 2KFJA 4BKSA 3R3MA 3U30A 1VR9A 4AOFA 2KHWB 4ZHOA 1EUVB 1KFYB 1XCTL 4W9LA 4XGAB 4MM3A 2C7HA 1EF5A 2SEBD 3RD2A 2J52A 2QIEB 4EOYA 1FMAD 5C3JB 1SE9A 4US9A 2WXJA 2RPVA 2BT6A 1E10A 1A70A 2GMIC 1ZKHA 4WQMA 3PGEA 2N9KA 2K25A 3M3JA 2PTLA 1QILA 3I3TB 3TJPA 1LQBA 4GOCA 3A1QA 1FRDA 2D11A 5BYQA 2LJ5A 2DYBA 2GB1A 5FK9C 2D3GA 1FNVA 2JRIB 2Q5WD 3PO0A 2PIAA 2V3PA 1GOZA 1E7PB 4L2YA 3V61A 2D3BA 4WWMA 4ANXA 4K7WA 1GNUA 4B9KA 2BB5A 2XNAC 2CKHB 3UQBA 1SB3C 2PKOA 1GG3A 2KWVB 3AU5A 4GDLB 4KGRA 1QT9A 2JX5A 4WURA 2BTEA 4K7SA 1GJZA 3U4EG 2VH2A 2PJHA 4N9F4 4HPLB 3AI5A 1TS3A 4NJCA 1MG8A 5CHWA 1WXQA 4RCOA 2W9NA 3T9LA 2KWDA 4HEA1 3ZQ4A 3APDA 2K1FA 2FUG1 1HTQA 3BVZA 2JWZA 4HCNB 2Y3AA 2LI5A 2M8SA 3LJ3A 5AEKB 1DOXA 2R2OA 1YQBA 2Y5BB 3IT6B 1M94A 1H8CA 4W9DA 2DZMA 3Q2AC 1OFFA 2V4LA
chains in the Genus database with same CATH topology
3NOBA 2MQJA 2ZEQA 1EO6A 2AYOB 1ISNA 2KK8A 3NY5A 2KNBA 5J2RA 1D3ZA 1TTNA 3RUIB 1AARA 3CSTA 2KMAA 4W9CA 3PPAA 3V6CB 2O6VA 3NHEB 4IM3A 2ZPYA 2ZNVB 3DVNV 1WH3A 3BINA 5KHOA 4YL8A 4LJOB 1V49A 3DBLI 3VUXA 1WRDB 4KVGB 2VRRB 2MLBA 3O65B 4WJNA 3RCZA 3U8ZA 3ECIA 1WIAA 4WWPA 4E3CA 2FIDA 2FUHB 1KLVA 4IWPA 4HXDA 1ZW7A 2ASQA 2OJRA 1WR1A 4DDID 3HK0A 2REXA 4JQWC 3A1QB 4X57B 2N7EA 4CYEA 2LUEA 2UWQA 3KUDB 3KYCD 2KJHB 1S1QB 3L13A 1P1AA 4II2B 4FJVB 3VUYA 2M1MA 4W9GA 3PV1A 1WMHB 4F1SA 4MELA 1K8RB 4OVUA 4II3B 2M4NA 3JYUA 2LD9A 2PE6B 2AL3A 5C23A 1XT9B 1XQQA 2DAFA 2DYMA 3RT3B 4EZLA 4G3XB 3N30A 3V60A 2WYQA 4ZYNA 1WXMA 4GDKA 1E90A 3DVGX 2OOBB 4I6LB 3RULA 2DZIA 1E8XA 1LFDA 2KFKA 3TCAA 3TMPB 3QK0A 3VTVA 4BFRA 4MH0E 1CMXB 2BPSA 2LVOA 1WZ0A 1XD3B 1WX7A 2FIFA 3PHXB 4A3OA 1WZ3A 1UELA 2MP2A 5D6JB 5J17A 4WJOA 3N32A 2AWTA 5D7GA 1OGWA 1P9DU 4ZDVA 3LDZE 4ASWC 3NZSA 1F9JA 2LGDA 4IM0A 2RSUA 4BOZB 3A9JA 4M8MA 4K1RB 3ALBA 2KXJA 4B6WA 3H7PB 1GC7A 2DX5B 4RMAA 5E6OA 3WIMA 3PT2B 2QHOA 4DHJB 2FNJB 3N3KB 2KLGA 3QARA 4LDTB 3PRPB 3T8MA 4FHKA 2D07B 3CMMB 1SGHA 3VDZA 2KMCA 4K81A 3Q3FA 4J6IA 2KTFA 2MBBB 5DPTA 3NZUA 2YLMA 3IHPC 5DPSA 2KANA 3VUWA 3R7QA 2IYDB 1S3SG 3DOWA 1UGMA 2B3AA 3PREA 3V6EB 4MJSA 3ZNHB 3PTFC 5JHAA 3QCAA 1V6EA 1IYFA 5DPRA 3WANA 2GBRA 4A20A 2LZ6A 4NAWB 2GBMA 3TL5A 3KVFB 1WF9A 3DBSA 4AP4C 2L00B 1VD2A 2Z0EB 2ZJDA 4GB9A 1A5RA 4FULA 2XK5B 3JSVB 4GXBA 4W9IA 4W9FA 3WAPA 5AZFA 3K9PB 4FBJB 3R7RA 1LM8B 4PS3A 1P0RA 3OAWA 3A9KB 2LXAA 2G4DB 2G45B 1WGYA 4FHJA 2JZ3B 3WALA 4ANWA 2O6VD 4DXAB 3UIPB 3BY4B 2KO3A 2N7DA 4KSKC 2KWCA 2NPTB 3DBRI 4NPNA 1NI2A 3RZFA 4IUMB 4IC7B 2KWUB 5JZEB 3DCGA 2L7RA 2LRWA 2JPHA 2JUOA 2LXCA 1P98A 1V9JA 3QWZB 4GU2A 3VTWA 4BKSD 3HIZA 1WGRA 1GUAB 2LASA 1BT0A 2WWZA 5JHBA 4PS7A 1YX5B 3VFKA 4FN2A 3B0AA 4XZ4A 2Z59B 3DVGY 2KDEB 2FCSA 4RM9A 2UYZB 1RRBA 3ZNZB 4G11A 2JF5A 1NBFC 2JXXA 2L05A 2DENB 2IO1B 1WM2A 3DVNU 1TZ1A 2C7MB 3HHMA 4A3PA 3ZLZA 2O2VB 3A4SC 4M0WB 5IA7A 4M8NA 4WJPA 5LXHA 3ML9A 2NCNA 3C0RB 1WFYA 4GDLA 4KIKB 1YJ1A 2KN5A 2LRUA 1LXDA 1OEYJ 1UH6A 2FAZA 2BYEA 2M0XA 4I6NB 4FLHA 4BBNF 5EDSA 1V81A 3VH4B 2MRPA 2EMSA 4WQOB 2JT4B 3PLUA 2KTRB 4HJKA 3VVWB 4W9KA 1OEYA 2JRHA 4TQ0A 1SIFA 2IBIB 4HLEA 3PZDA 3W1SC 4JL9A 4KZ0A 3JW0X 4MGYE 5JH5C 2EKEC 2KD0A 5CTRC 3EHVA 3SDLC 2CHXA 3QX1A 2G3QB 4AJWA 4BKGA 1C3TA 2HJ8A 2C60A 1WX9A 2GBKA 2L3ZA 2DHZA 2N4FA 4W9JA 5TR5A 2KZRA 4BOSC 4DDGD 3ZW3A 3VTUA 3OLMD 4MEMA 4E74A 4MGKE 4AWJA 2LGYA 2LVPA 1EF1A 2M17A 4CHKA 2ZCBA 3KH0A 4KZCA 3VHTC 3MJWA 2WX1A 2RD0A 3MHSD 3APFA 4MDKE 3PRMB 4NY0A 2HD5B 3IVFA 4IWQA 1T0YA 4MSQB 4AJYB 4DWFA 4IWOA 4TQ1A 4DHZB 1OTRB 4MGIE 1WXAA 1NDDA 2MBEA 4HWIB 3HM3A 5G2NA 4EUTA 3VH3B 3SU8X 1Q0WB 2I1KA 3QAQA 2CHWA 2XEWA 2MA9B 3QJZA 5L83A 3TIXA 2BKRB 1E7VA 1GC6A 3QIJA 4JGHB 2AEHA 2BF8B 3KUCB 4HDOA 4IG7B 4AUQC 2MBQA 2PPHA 1WGDA 1UBQA 2KDIA 3UINB 4F8CB 1E8YA 2IY0B 2BGFA 3DDCB 2CR5A 2MBHA 2NS5A 3WA0A 1WMHA 1YIWA 1QZEA 3AULA 2G4SA 1UZXB 2MCNB 1WY8A 2BWES 3KW5B 1RFAA 3QA8A 1U4AA 2YVCA 3RYTA 4BBNC 2DYOA 4WWOA 3P2BA 3Q3JA 3U7DA 3UGBB 4BVUC 1G6JA 2CHZA 3IG3A 3GZNI 3PRZA 4HK2A 4NQKE 4P7IA 2EMTA 5D2MB 3B1LX 4NJ6A 4G0NB 2N9EB 2O6VB 3DQVA 2MX2A 4GMVA 4FJYA 2K8HA 1E7UA 3VAWA 1KOTA 2IO3B 4GN1A 4KDLB 1Z2MA 3ZIMA 2WX0A 2ZVNA 4EFOA 1PQSA 1KJTA 3QHTA 2ZNVC 3PLVA 1WGGA 2MBOA 2I1JA 5E6PA 3V62A 3AXCA 1Q1OA 3H7PA 1IPGA 2KDFB 1L2NA 2KVRA 3L08A 3X0WA 2N9PC 3ZVVA 4DBGA 1P3QU 2XBBC 3AU4A 4MSMB 2FCQA 2Z0DB 4EZKA 2J7QB 5AZHA 3OJ4B 1E8ZA 4GSWA 1E8WA 1VCBA 2FCNA 2JY6A 3S2AA 3L10B 4IM2A 4G50A 3D32A 5DPWA 1H4RA 4XC2A 2KQ7A 2RPQA 4PYZA 5HKHA 2BKFA 4GDKB 4HDQA 4DK5A 2WDTB 1WR6E 3PSEB 2KOXA 4NAWA 4JIOU 3KYDD 1C1YB 4W9HA 2KFKB 3TBLD 2A5UA 4WJQA 3KUZA 1UBIA 4FJZA 4PYUA 1OQYA 4GGQA 2FCMA 4WWNA 3UF8A 2XK5A 3JSVA 4IW0A 4BKTA 4DHZE 3M95A 1TBEA 3EFUA 1RLFA 3SHQA 2L8JA 2MP2B 3L0WB 2MWSB 3A4RA 3ZO5B 3W1YA 4RM8A 3JVZX 2IO2B 4HPMB 3A9KA 2J0JA 4K7UA 1WYWB 3L17A 2BWFA 3ZRCA 2LVQA 3A9JB 4LJPB 5CHVC 2CS4A 4ZRJA 5DCNA 2IZVB 2N9XA 2C7NB 3X23A 1HE8A 3ZDMC 4TV3A 4OVVA 2NPTA 3IBEA 5E6NA 2KC1A 2K6DB 3K9OB 1V2YA 5KHQA 1YD8U 4MGZE 2D2QA 3L54A 2LWPA 2NBUA 2IO0B 2KFJA 4BKSA 4EKUA 4E71A 3UQAA 3R3MA 3U30A 4AOFA 5BO4B 4FADA 2BYFA 3EC8A 2KHWB 1L7YA 4KSLC 1EUVB 4MJSB 3DBHI 2C9WB 3ZRFA 4HVBA 5D94A 4ZRIA 3H7SA 2J0KA 3HM6X 3EECA 2KLCA 4W9LA 4MM3A 2C7HA 1EF5A 3CSFA 3PHWB 1WE7A 2NBVB 2RR9A 3RD2A 4EOYA 2O2VA 5C1ZA 2RGFA 2L76A 2KKCA 1E5WA 1SE9A 1R4NI 2ZCCA 3QQ8B 4TKNA 5J18A 2K8CA 1WGHA 2GMIC 3ZUNA 3ENEA 4KIKA 3M62B 4ANVA 5LLIA 4GIVA 4TUUA 2GBNA 1ZKHA 2KC2A 3MTNB 3DPDA 4I6PA 3PGEA 4ICVA 2K25A 3M3JA 1Q5WB 2JVCA 2L0FA 1WJUA 5CX3A 3H6NA 2MSED 1V5OA 1Z5SB 1LQBA 3I3TB 5AZGA 2CU1A 3A33B 3TJPA 3ZNGC 4GOCA 4CO7A 2V3SA 3A1QA 3SD5A 1WXSA 2D11A 2AL6A 2KX3A 2K6QA 2ZZPB 4PS8A 4ANUA 3VQIA 2KTRA 5L95C 2L0TA 2PEAA 4KDIC 2LJ5A 2DYBA 5LXIB 2KX0A 5FR6A 2D3GA 2NR2A 3RZWC 1ZGUB 2V1YA 4URKA 4EZJA 4W9EA 1V5TA 2JRIB 2NVUI 2KDBA 1RAXA 4DHJD 4LDTD 2ZVOA 3WAOA 2IY1B 2A4ZA 3V61A 3APCA 2PE9A 3ZNID 3VXWA 4JLCA 5IAAC 4ANXA 4K7WA 1GNUA 4B9KA 5GMVA 1X1MA 1Y8RC 3ZDTA 4NQLB 2CKHB 1I35A 3UQBA 4WAAA 1WJ6A 2JZZA 2DAJA 1I42A 1GG3A 2KWVB 4LCDE 1R4MI 3AU5A 3M63B 4GDLB 2K39A 1WI0A 1TGZB 4K7SA 1GJZA 2KJRA 3ONSA 1WJNA 1WJ4A 2PJHA 3GOEA 4N9F4 4HPLB 1J8CA 3PVLA 2D10A 3AI5A 1IP9A 4F7ZA 2HTHA 2N1WA 3QC8B 3OJ3A 4ICUA 1YX6B 3ZKJC 1JRUA 1MG8A 1FXTB 2J0MA 4NJ7A 5CHWA 3H1UA 3B08A 1V80A 2KQSA 1J19A 2N1VA 2DZKA 5CHFA 2W9NA 3ML8A 4HCPB 3T9LA 3CF6E 3L16A 3APDA 3UIOB 2K1FA 1WX8A 3W1SA 3H9DA 2R2QA 2ZPNA 3R66C 4NNJB 2GOWA 2GBJA 2HE7A 4ZRKA 2JWZA 3IFWB 4HCNB 2LGXA 4KV2A 3ZTCA 2LI5A 2M8SA 1V86A 3LJ3A 1J0GA 5AEKB 3ZTDA 3PS6A 2R2OA 2K8BA 1UD7A 2C5LC 4B95A 2BYVE 4EEWA 1YQBA 2Y5BB 1WM3A 2DZJA 4XX5A 1M94A 3WAMA 1H8CA 4W9DA 1KM7A 2DZMA 1WXVA 5G55A 2MW5A 4FA6A 3NS8A 2NBWB 2KJ6A 2V4LA 1WE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOB A;  2MQJ A;  2ZEQ A;  1EO6 A;  2AYO B;  1ISN A;  2KK8 A;  3NY5 A;  2KNB A;  5J2R A;  1D3Z A;  1TTN A;  3RUI B;  1AAR A;  3CST A;  2KMA A;  4W9C A;  3PPA A;  3V6C B;  2O6V A;  3NHE B;  4IM3 A;  2ZPY A;  2ZNV B;  3DVN V;  1WH3 A;  3BIN A;  5KHO A;  4YL8 A;  4LJO B;  1V49 A;  3DBL I;  3VUX A;  1WRD B;  4KVG B;  2VRR B;  2MLB A;  3O65 B;  4WJN A;  3RCZ A;  3U8Z A;  3ECI A;  1WIA A;  4WWP A;  4E3C A;  2FID A;  2FUH B;  1KLV A;  4IWP A;  4HXD A;  1ZW7 A;  2ASQ A;  2OJR A;  1WR1 A;  4DDI D;  3HK0 A;  2REX A;  4JQW C;  3A1Q B;  4X57 B;  2N7E A;  4CYE A;  2LUE A;  2UWQ A;  3KUD B;  3KYC D;  2KJH B;  1S1Q B;  3L13 A;  1P1A A;  4II2 B;  4FJV B;  3VUY A;  2M1M A;  4W9G A;  3PV1 A;  1WMH B;  4F1S A;  4MEL A;  1K8R B;  4OVU A;  4II3 B;  2M4N A;  3JYU A;  2LD9 A;  2PE6 B;  2AL3 A;  5C23 A;  1XT9 B;  1XQQ A;  2DAF A;  2DYM A;  3RT3 B;  4EZL A;  4G3X B;  3N30 A;  3V60 A;  2WYQ A;  4ZYN A;  1WXM A;  4GDK A;  1E90 A;  3DVG X;  2OOB B;  4I6L B;  3RUL A;  2DZI A;  1E8X A;  1LFD A;  2KFK A;  3TCA A;  3TMP B;  3QK0 A;  3VTV A;  4BFR A;  4MH0 E;  1CMX B;  2BPS A;  2LVO A;  1WZ0 A;  1XD3 B;  1WX7 A;  2FIF A;  3PHX B;  4A3O A;  1WZ3 A;  1UEL A;  2MP2 A;  5D6J B;  5J17 A;  4WJO A;  3N32 A;  2AWT A;  5D7G A;  1OGW A;  1P9D U;  4ZDV A;  3LDZ E;  4ASW C;  3NZS A;  1F9J A;  2LGD A;  4IM0 A;  2RSU A;  4BOZ B;  3A9J A;  4M8M A;  4K1R B;  3ALB A;  2KXJ A;  4B6W A;  3H7P B;  1GC7 A;  2DX5 B;  4RMA A;  5E6O A;  3WIM A;  3PT2 B;  2QHO A;  4DHJ B;  2FNJ B;  3N3K B;  2KLG A;  3QAR A;  4LDT B;  3PRP B;  3T8M A;  4FHK A;  2D07 B;  3CMM B;  1SGH A;  3VDZ A;  2KMC A;  4K81 A;  3Q3F A;  4J6I A;  2KTF A;  2MBB B;  5DPT A;  3NZU A;  2YLM A;  3IHP C;  5DPS A;  2KAN A;  3VUW A;  3R7Q A;  2IYD B;  1S3S G;  3DOW A;  1UGM A;  2B3A A;  3PRE A;  3V6E B;  4MJS A;  3ZNH B;  3PTF C;  5JHA A;  3QCA A;  1V6E A;  1IYF A;  5DPR A;  3WAN A;  2GBR A;  4A20 A;  2LZ6 A;  4NAW B;  2GBM A;  3TL5 A;  3KVF B;  1WF9 A;  3DBS A;  4AP4 C;  2L00 B;  1VD2 A;  2Z0E B;  2ZJD A;  4GB9 A;  1A5R A;  4FUL A;  2XK5 B;  3JSV B;  4GXB A;  4W9I A;  4W9F A;  3WAP A;  5AZF A;  3K9P B;  4FBJ B;  3R7R A;  1LM8 B;  4PS3 A;  1P0R A;  3OAW A;  3A9K B;  2LXA A;  2G4D B;  2G45 B;  1WGY A;  4FHJ A;  2JZ3 B;  3WAL A;  4ANW A;  2O6V D;  4DXA B;  3UIP B;  3BY4 B;  2KO3 A;  2N7D A;  4KSK C;  2KWC A;  2NPT B;  3DBR I;  4NPN A;  1NI2 A;  3RZF A;  4IUM B;  4IC7 B;  2KWU B;  5JZE B;  3DCG A;  2L7R A;  2LRW A;  2JPH A;  2JUO A;  2LXC A;  1P98 A;  1V9J A;  3QWZ B;  4GU2 A;  3VTW A;  4BKS D;  3HIZ A;  1WGR A;  1GUA B;  2LAS A;  1BT0 A;  2WWZ A;  5JHB A;  4PS7 A;  1YX5 B;  3VFK A;  4FN2 A;  3B0A A;  4XZ4 A;  2Z59 B;  3DVG Y;  2KDE B;  2FCS A;  4RM9 A;  2UYZ B;  1RRB A;  3ZNZ B;  4G11 A;  2JF5 A;  1NBF C;  2JXX A;  2L05 A;  2DEN B;  2IO1 B;  1WM2 A;  3DVN U;  1TZ1 A;  2C7M B;  3HHM A;  4A3P A;  3ZLZ A;  2O2V B;  3A4S C;  4M0W B;  5IA7 A;  4M8N A;  4WJP A;  5LXH A;  3ML9 A;  2NCN A;  3C0R B;  1WFY A;  4GDL A;  4KIK B;  1YJ1 A;  2KN5 A;  2LRU A;  1LXD A;  1OEY J;  1UH6 A;  2FAZ A;  2BYE A;  2M0X A;  4I6N B;  4FLH A;  4BBN F;  5EDS A;  1V81 A;  3VH4 B;  2MRP A;  2EMS A;  4WQO B;  2JT4 B;  3PLU A;  2KTR B;  4HJK A;  3VVW B;  4W9K A;  1OEY A;  2JRH A;  4TQ0 A;  1SIF A;  2IBI B;  4HLE A;  3PZD A;  3W1S C;  4JL9 A;  4KZ0 A;  3JW0 X;  4MGY E;  5JH5 C;  2EKE C;  2KD0 A;  5CTR C;  3EHV A;  3SDL C;  2CHX A;  3QX1 A;  2G3Q B;  4AJW A;  4BKG A;  1C3T A;  2HJ8 A;  2C60 A;  1WX9 A;  2GBK A;  2L3Z A;  2DHZ A;  2N4F A;  4W9J A;  5TR5 A;  2KZR A;  4BOS C;  4DDG D;  3ZW3 A;  3VTU A;  3OLM D;  4MEM A;  4E74 A;  4MGK E;  4AWJ A;  2LGY A;  2LVP A;  1EF1 A;  2M17 A;  4CHK A;  2ZCB A;  3KH0 A;  4KZC A;  3VHT C;  3MJW A;  2WX1 A;  2RD0 A;  3MHS D;  3APF A;  4MDK E;  3PRM B;  4NY0 A;  2HD5 B;  3IVF A;  4IWQ A;  1T0Y A;  4MSQ B;  4AJY B;  4DWF A;  4IWO A;  4TQ1 A;  4DHZ B;  1OTR B;  4MGI E;  1WXA A;  1NDD A;  2MBE A;  4HWI B;  3HM3 A;  5G2N A;  4EUT A;  3VH3 B;  3SU8 X;  1Q0W B;  2I1K A;  3QAQ A;  2CHW A;  2XEW A;  2MA9 B;  3QJZ A;  5L83 A;  3TIX A;  2BKR B;  1E7V A;  1GC6 A;  3QIJ A;  4JGH B;  2AEH A;  2BF8 B;  3KUC B;  4HDO A;  4IG7 B;  4AUQ C;  2MBQ A;  2PPH A;  1WGD A;  1UBQ A;  2KDI A;  3UIN B;  4F8C B;  1E8Y A;  2IY0 B;  2BGF A;  3DDC B;  2CR5 A;  2MBH A;  2NS5 A;  3WA0 A;  1WMH A;  1YIW A;  1QZE A;  3AUL A;  2G4S A;  1UZX B;  2MCN B;  1WY8 A;  2BWE S;  3KW5 B;  1RFA A;  3QA8 A;  1U4A A;  2YVC A;  3RYT A;  4BBN C;  2DYO A;  4WWO A;  3P2B A;  3Q3J A;  3U7D A;  3UGB B;  4BVU C;  1G6J A;  2CHZ A;  3IG3 A;  3GZN I;  3PRZ A;  4HK2 A;  4NQK E;  4P7I A;  2EMT A;  5D2M B;  3B1L X;  4NJ6 A;  4G0N B;  2N9E B;  2O6V B;  3DQV A;  2MX2 A;  4GMV A;  4FJY A;  2K8H A;  1E7U A;  3VAW A;  1KOT A;  2IO3 B;  4GN1 A;  4KDL B;  1Z2M A;  3ZIM A;  2WX0 A;  2ZVN A;  4EFO A;  1PQS A;  1KJT A;  3QHT A;  2ZNV C;  3PLV A;  1WGG A;  2MBO A;  2I1J A;  5E6P A;  3V62 A;  3AXC A;  1Q1O A;  3H7P A;  1IPG A;  2KDF B;  1L2N A;  2KVR A;  3L08 A;  3X0W A;  2N9P C;  3ZVV A;  4DBG A;  1P3Q U;  2XBB C;  3AU4 A;  4MSM B;  2FCQ A;  2Z0D B;  4EZK A;  2J7Q B;  5AZH A;  3OJ4 B;  1E8Z A;  4GSW A;  1E8W A;  1VCB A;  2FCN A;  2JY6 A;  3S2A A;  3L10 B;  4IM2 A;  4G50 A;  3D32 A;  5DPW A;  1H4R A;  4XC2 A;  2KQ7 A;  2RPQ A;  4PYZ A;  5HKH A;  2BKF A;  4GDK B;  4HDQ A;  4DK5 A;  2WDT B;  1WR6 E;  3PSE B;  2KOX A;  4NAW A;  4JIO U;  3KYD D;  1C1Y B;  4W9H A;  2KFK B;  3TBL D;  2A5U A;  4WJQ A;  3KUZ A;  1UBI A;  4FJZ A;  4PYU A;  1OQY A;  4GGQ A;  2FCM A;  4WWN A;  3UF8 A;  2XK5 A;  3JSV A;  4IW0 A;  4BKT A;  4DHZ E;  3M95 A;  1TBE A;  3EFU A;  1RLF A;  3SHQ A;  2L8J A;  2MP2 B;  3L0W B;  2MWS B;  3A4R A;  3ZO5 B;  3W1Y A;  4RM8 A;  3JVZ X;  2IO2 B;  4HPM B;  3A9K A;  2J0J A;  4K7U A;  1WYW B;  3L17 A;  2BWF A;  3ZRC A;  2LVQ A;  3A9J B;  4LJP B;  5CHV C;  2CS4 A;  4ZRJ A;  5DCN A;  2IZV B;  2N9X A;  2C7N B;  3X23 A;  1HE8 A;  3ZDM C;  4TV3 A;  4OVV A;  2NPT A;  3IBE A;  5E6N A;  2KC1 A;  2K6D B;  3K9O B;  1V2Y A;  5KHQ A;  1YD8 U;  4MGZ E;  2D2Q A;  3L54 A;  2LWP A;  2NBU A;  2IO0 B;  2KFJ A;  4BKS A;  4EKU A;  4E71 A;  3UQA A;  3R3M A;  3U30 A;  4AOF A;  5BO4 B;  4FAD A;  2BYF A;  3EC8 A;  2KHW B;  1L7Y A;  4KSL C;  1EUV B;  4MJS B;  3DBH I;  2C9W B;  3ZRF A;  4HVB A;  5D94 A;  4ZRI A;  3H7S A;  2J0K A;  3HM6 X;  3EEC A;  2KLC A;  4W9L A;  4MM3 A;  2C7H A;  1EF5 A;  3CSF A;  3PHW B;  1WE7 A;  2NBV B;  2RR9 A;  3RD2 A;  4EOY A;  2O2V A;  5C1Z A;  2RGF A;  2L76 A;  2KKC A;  1E5W A;  1SE9 A;  1R4N I;  2ZCC A;  3QQ8 B;  4TKN A;  5J18 A;  2K8C A;  1WGH A;  2GMI C;  3ZUN A;  3ENE A;  4KIK A;  3M62 B;  4ANV A;  5LLI A;  4GIV A;  4TUU A;  2GBN A;  1ZKH A;  2KC2 A;  3MTN B;  3DPD A;  4I6P A;  3PGE A;  4ICV A;  2K25 A;  3M3J A;  1Q5W B;  2JVC A;  2L0F A;  1WJU A;  5CX3 A;  3H6N A;  2MSE D;  1V5O A;  1Z5S B;  1LQB A;  3I3T B;  5AZG A;  2CU1 A;  3A33 B;  3TJP A;  3ZNG C;  4GOC A;  4CO7 A;  2V3S A;  3A1Q A;  3SD5 A;  1WXS A;  2D11 A;  2AL6 A;  2KX3 A;  2K6Q A;  2ZZP B;  4PS8 A;  4ANU A;  3VQI A;  2KTR A;  5L95 C;  2L0T A;  2PEA A;  4KDI C;  2LJ5 A;  2DYB A;  5LXI B;  2KX0 A;  5FR6 A;  2D3G A;  2NR2 A;  3RZW C;  1ZGU B;  2V1Y A;  4URK A;  4EZJ A;  4W9E A;  1V5T A;  2JRI B;  2NVU I;  2KDB A;  1RAX A;  4DHJ D;  4LDT D;  2ZVO A;  3WAO A;  2IY1 B;  2A4Z A;  3V61 A;  3APC A;  2PE9 A;  3ZNI D;  3VXW A;  4JLC A;  5IAA C;  4ANX A;  4K7W A;  1GNU A;  4B9K A;  5GMV A;  1X1M A;  1Y8R C;  3ZDT A;  4NQL B;  2CKH B;  1I35 A;  3UQB A;  4WAA A;  1WJ6 A;  2JZZ A;  2DAJ A;  1I42 A;  1GG3 A;  2KWV B;  4LCD E;  1R4M I;  3AU5 A;  3M63 B;  4GDL B;  2K39 A;  1WI0 A;  1TGZ B;  4K7S A;  1GJZ A;  2KJR A;  3ONS A;  1WJN A;  1WJ4 A;  2PJH A;  3GOE A;  4N9F 4;  4HPL B;  1J8C A;  3PVL A;  2D10 A;  3AI5 A;  1IP9 A;  4F7Z A;  2HTH A;  2N1W A;  3QC8 B;  3OJ3 A;  4ICU A;  1YX6 B;  3ZKJ C;  1JRU A;  1MG8 A;  1FXT B;  2J0M A;  4NJ7 A;  5CHW A;  3H1U A;  3B08 A;  1V80 A;  2KQS A;  1J19 A;  2N1V A;  2DZK A;  5CHF A;  2W9N A;  3ML8 A;  4HCP B;  3T9L A;  3CF6 E;  3L16 A;  3APD A;  3UIO B;  2K1F A;  1WX8 A;  3W1S A;  3H9D A;  2R2Q A;  2ZPN A;  3R66 C;  4NNJ B;  2GOW A;  2GBJ A;  2HE7 A;  4ZRK A;  2JWZ A;  3IFW B;  4HCN B;  2LGX A;  4KV2 A;  3ZTC A;  2LI5 A;  2M8S A;  1V86 A;  3LJ3 A;  1J0G A;  5AEK B;  3ZTD A;  3PS6 A;  2R2O A;  2K8B A;  1UD7 A;  2C5L C;  4B95 A;  2BYV E;  4EEW A;  1YQB A;  2Y5B B;  1WM3 A;  2DZJ A;  4XX5 A;  1M94 A;  3WAM A;  1H8C A;  4W9D A;  1KM7 A;  2DZM A;  1WXV A;  5G55 A;  2MW5 A;  4FA6 A;  3NS8 A;  2NBW B;  2KJ6 A;  2V4L A;  1WE6 A; 
#chains in the Genus database with same CATH topology
 3NOB A;  2MQJ A;  2ZEQ A;  3SR6 A;  1D3Z A;  3RUI B;  1AAR A;  3CST A;  2KMA A;  3L4P A;  1AWD A;  3T3N A;  4LJO B;  3DBL I;  1WRD B;  1D5X C;  3RCZ A;  4WJN A;  5E6J A;  1WIA A;  4WWP A;  2IGG A;  4IWP A;  4HXD A;  2ASQ A;  4DDI D;  1JRO A;  3HK0 A;  3A1Q B;  2LUE A;  5EE9 A;  3KUD B;  1S1Q B;  1ENF A;  2IJ0 A;  1P1A A;  4MEL A;  1LO5 D;  1TIF A;  4II3 B;  4N59 A;  2PE6 B;  5C23 A;  2DYM A;  3V60 A;  3DBH B;  1WXM A;  2IGD A;  4L1B A;  4HKQ A;  3RUL A;  1STE A;  4EE2 A;  3QK0 A;  2M56 B;  4MH0 E;  4HRS A;  2LVO A;  2FIF A;  1N5X A;  1UEL A;  4XYC A;  5D7G A;  2IGH A;  1P9D U;  4ZDV A;  3NZS A;  2LGD A;  5IOI A;  2RSU A;  1XXG A;  2KXJ A;  3WIM A;  2FNJ B;  4LDT B;  2KLG A;  4LNK A;  1JWU D;  1QOG A;  3KWV A;  3DHG C;  4J6I A;  1ESF A;  2HJ1 A;  3VUW A;  2AQ2 B;  4NZL B;  1IUE A;  1LGR A;  4MJS A;  1FXI A;  2W3S A;  2QSD A;  4M01 A;  1WYG A;  2Y5P A;  5FKA C;  4A20 A;  2TSS A;  2GBM A;  4AP4 C;  1QF6 A;  2WXG A;  4FUL A;  1JWA D;  2XK5 B;  4GXB A;  4W9F A;  3N9Y C;  1LM8 B;  1MHX A;  1P0R A;  1FO4 A;  1WGY A;  1D4B A;  2WNM A;  2JZ3 B;  2NMQ A;  3B2G A;  3UIP B;  3BY4 B;  4MT5 A;  2NPT B;  3DBR I;  1NI2 A;  4IC7 B;  2KWU B;  3AM9 A;  2LRW A;  1L0X B;  1V9J A;  2LXC A;  3QWZ B;  1YQ4 B;  3DVG Y;  2JU6 X;  2KDE B;  3ZNZ B;  4G11 A;  2L05 A;  1ET9 A;  2ICI A;  2V3N A;  1TZ1 A;  1QQR A;  5AUK A;  3HHM A;  4M0W B;  4ZRP A;  3BYY B;  2NCN A;  3WCQ A;  4KIK B;  2J53 A;  4YWG G;  2LRU A;  2I2Y A;  1JAL A;  4FLH A;  4BBN F;  3IXS A;  1JW9 D;  1V81 A;  1P7E A;  2MRP A;  2EMS A;  2L83 A;  1ZDV A;  4JWU C;  1E0Z A;  2IDY A;  3VVW B;  4S17 A;  4RNA A;  1TZO A;  4HLE A;  3HVD A;  4JL9 A;  1DYQ A;  4MGY E;  1F2R C;  1HXY D;  2KD0 A;  5CTR C;  3NG0 A;  1J7B A;  3W5V B;  3Q8F A;  1C3T A;  1F77 A;  3SFE B;  2L3Z A;  5TR5 A;  4W9J A;  4MEM A;  4MGK E;  2LVP A;  1Y56 A;  2LMC A;  3BK2 A;  4FXC A;  3MHS D;  5TSS A;  2RDG A;  2Z8L A;  3IVF A;  3IAS 1;  1T0Y A;  1TY2 A;  2DBY A;  4OZB A;  3RNE C;  2CU3 A;  1OTR B;  1VRA B;  4ZRQ A;  5T8I A;  3RN9 C;  4WAF A;  2XEW A;  3TIX A;  2BYT A;  2BKR B;  1E7V A;  1GC6 A;  1YN3 A;  1WGD A;  1UBQ A;  2KDI A;  3FAH A;  3CWI A;  1E8Y A;  3BK1 A;  3DDC B;  2MBH A;  3P4Q B;  1YIW A;  1WY8 A;  3V3X A;  2PLP A;  4C4V B;  3CIR B;  2YVC A;  2DYO A;  4WWO A;  1YOV B;  3TUO A;  3Q3J A;  2CJO A;  2J42 A;  4BVU C;  1UUP A;  2JYT A;  3ZXR A;  4G0N B;  1PGB A;  4GMV A;  1E7U A;  2K5P A;  1KOT A;  2IO3 B;  1RM6 C;  3ZIM A;  2WX0 A;  1M4V A;  1PQS A;  1ZDX A;  2ZNV C;  2PW9 A;  2MBO A;  3AXC A;  1SJH D;  1IPG A;  1YQ3 B;  1L2N A;  3X0W A;  2NTT A;  2H89 B;  3ZVV A;  1PUT A;  1P3Q U;  4IKG A;  4EZK A;  5AZH A;  1SBB B;  3AE5 B;  1E8Z A;  1TKG A;  1E8W A;  2FCN A;  5I4D A;  3ABV B;  3S2A A;  1FCL A;  5DPW A;  4XC2 A;  3R2T A;  5HKH A;  4RGN A;  4GDK B;  4HDQ A;  4KKI A;  3N1Y C;  4WWN A;  1OQY A;  3UF8 A;  4BKT A;  4LNI A;  2QC8 A;  1TBE A;  3EFU A;  2MP2 B;  3MJ5 A;  3ZO5 B;  3W1Y A;  4RM8 A;  3JVZ X;  4K7U A;  1I4P A;  3A9J B;  5CHV C;  2RDB C;  2C7N B;  1HE8 A;  4TV3 A;  5E6N A;  2KC1 A;  2K6D B;  1V2Y A;  4YXD B;  4WH4 A;  2WXP A;  3L54 A;  1QOA A;  3UQA A;  4P1C C;  3AE7 B;  1IBX B;  2WXR A;  4FAD A;  3EC8 A;  2FBW B;  3DBH I;  4ZRI A;  1GB1 A;  3H7S A;  3HM6 X;  3EEC A;  3IAM 1;  3P1M A;  3CSF A;  1WE7 A;  2NBV B;  3OG5 A;  2RR9 A;  3RMK C;  2O2V A;  2RGF A;  1R4N I;  3ETR A;  5IKC M;  3ZUN A;  3ENE A;  5LLI A;  4TUU A;  3E56 A;  2KC2 A;  3DPD A;  4ICV A;  3U7D A;  3H6N A;  1Z5S B;  3A33 B;  1WXS A;  2AL6 A;  2K6Q A;  4PS8 A;  2KTR A;  3GE8 C;  2PEA A;  3RZW C;  3N1X C;  4LLG M;  4EZJ A;  3B9J A;  2WQY B;  4LDT D;  2ZVO A;  3WAO A;  2IY1 B;  1TS5 A;  1DOY A;  3URY A;  5IAA C;  1I35 A;  4L23 A;  2JZZ A;  4KKJ A;  1I42 A;  3AE6 B;  4J3O D;  1YJJ A;  1WI0 A;  1WJN A;  2WXL A;  3GZN B;  4K3C A;  2D10 A;  1IP9 A;  4F7Z A;  3ZKJ C;  1YX6 B;  2BS4 B;  1FXT B;  2J0M A;  4NJ7 A;  4C7Z A;  2BVC A;  3B08 A;  2KQS A;  5CHF A;  3ML8 A;  4HCP B;  1YN5 A;  1HA5 A;  5MPO A;  1WX8 A;  3W1S A;  2R2Q A;  2ZPN A;  3R66 C;  4NNJ B;  2HE7 A;  3BVM A;  3IFW B;  4KV2 A;  1V86 A;  2K8B A;  2C5L C;  3SEB A;  4HKZ E;  4EEW A;  1WM3 A;  4XX5 A;  2N7J A;  1KM7 A;  3AB5 A;  2NBW B;  4ITK A;  5D3I B;  1ISN A;  2KNB A;  1NEN B;  4W9C A;  3TSS A;  3V6C B;  2O6V A;  3RNF C;  5BMG A;  2JYE A;  1WH3 A;  5KHO A;  3BVG A;  2KT7 A;  3VUX A;  4KVG B;  3EUB 2;  2MLB A;  3O65 B;  1I4G A;  3ECI A;  4C00 A;  1ZW7 A;  2OJR A;  1WR1 A;  4O1N A;  3VR9 B;  2XN9 C;  2N7E A;  4CYE A;  5C2T B;  3KYC D;  2KJH B;  1GAQ B;  4KGT A;  2MH7 A;  3MC8 A;  4II2 B;  4HPP A;  5G5H A;  1K8R B;  2L32 A;  2M4N A;  2AL3 A;  1XT9 B;  3RT3 B;  1JQ4 A;  4C56 C;  1FFV A;  3DVG X;  2OOB B;  5H92 C;  3NVZ A;  2DZI A;  2N0S B;  3TEW A;  2ZW0 A;  3VTV A;  1CMX B;  1XD3 B;  3PHX B;  1EU3 A;  1I4X A;  4XDC A;  5D6J B;  4WJO A;  3N32 A;  3PZ8 A;  3BWU D;  5EE1 A;  3NVV A;  3LDZ E;  4ASW C;  2L52 A;  3B2F A;  4K1R B;  3ALB A;  3PZ7 A;  4B6W A;  2DX5 B;  4OHJ A;  3NZ3 A;  4DHJ B;  3N3K B;  2JXT A;  3PRP B;  2DWQ A;  3DHI C;  4FHK A;  4K81 A;  3Q3F A;  2MBB B;  1C79 A;  3NZU A;  2YLM A;  1XLP A;  5DPS A;  1S3S G;  1K52 A;  1UGM A;  3PRE A;  3V6E B;  1I7H A;  3ZNH B;  3PTF C;  4ARI A;  2GBR A;  2JQR B;  3KVF B;  3DBS A;  1VD2 A;  4GB9 A;  1A5R A;  3JSV B;  4W9I A;  1T6B X;  4JX1 C;  5AZF A;  4USA A;  3Q3O C;  1R4M B;  1GB4 A;  2X38 A;  4PS3 A;  2G4D B;  4CQN A;  1NYR A;  1N63 A;  4ANW A;  3MC0 B;  3U7Z A;  2BBC A;  2L7R A;  2JPH A;  1Q10 A;  4GU2 A;  3HIZ A;  1WGR A;  2WWZ A;  5JHB A;  2FCS A;  3KQ4 A;  1RRB A;  1NBF C;  2JXX A;  2DEN B;  3AEE B;  4MM3 B;  2C7M B;  3SFD B;  2CJN A;  3A4S C;  3ML9 A;  5HI1 A;  3C0R B;  1WFY A;  4HRO A;  1QLB B;  2I38 A;  1XEE A;  3AMZ A;  1OEY J;  2BW2 A;  1UH6 A;  4I6N B;  2BYE A;  2MJD A;  2JT4 B;  2LHE A;  2JRH A;  2IBI B;  4RGO S;  2QMT A;  4KZ0 A;  3I9V 1;  4RF1 A;  3ZGZ A;  1KRH A;  3SDL C;  4JPS A;  4AJW A;  3Q8E A;  3BII D;  1UWM A;  2N4F A;  4BOS C;  2BS2 B;  1FPY A;  4AWJ A;  1EF1 A;  4CHK A;  3KH0 A;  2GLS A;  3VHT C;  3MJW A;  2WX1 A;  2RD0 A;  3APF A;  4MDK E;  2WXM A;  4MSQ B;  4RGM A;  5HFY A;  1FNW A;  4MGI E;  1WXA A;  2GI9 A;  3HM3 A;  3NRZ A;  3SU8 X;  1Q0W B;  2I1K A;  1K51 A;  2CHW A;  4WIP A;  1N61 A;  5BMI A;  4TSS A;  2WXH A;  4P6V F;  4AUQ C;  3KUC B;  1FNU A;  1T0Q C;  1ZXI A;  2PPH A;  3GS2 A;  3RNG C;  3WA0 A;  1WMH A;  1QZE A;  2G4S A;  2MCN B;  2LGI A;  1VZ6 A;  1WWT A;  1TYG B;  1U4A A;  3RYT A;  1G6J A;  1T5X D;  3GZN I;  1EWY C;  4NQK E;  2D5G A;  3B1L X;  4NJ6 A;  2N9E B;  4FJY A;  2K8H A;  3Q69 A;  3VAW A;  3ZJT A;  1WSP A;  2INP E;  4KDL B;  2ZVN A;  2WXK A;  3OWE B;  2WDV B;  4A90 A;  4ZYS A;  4NAM A;  1WGG A;  3NVY A;  1RFK A;  2LUM A;  3VR8 B;  1Q1O A;  3H7P A;  4RF0 A;  2D3C A;  1D6E C;  2KVR A;  3ZXV A;  4DBG A;  3AU4 A;  1FIQ A;  2Z0D B;  3N1Z C;  2WP9 B;  2DLB A;  2VH1 A;  1C9F A;  2W54 A;  3P4S B;  3D32 A;  1VZ8 A;  2KQ7 A;  4NAW A;  2KOX A;  1C1Y B;  4W9H A;  2A5U A;  3LYY A;  4AQ7 A;  1YN4 A;  3FIL A;  4BAX A;  2FCM A;  3M95 A;  2HTM E;  3SHQ A;  2L8J A;  4HPM B;  3A9K A;  3ZRC A;  2LVQ A;  2IZV B;  3I63 C;  2OJW A;  3VRA B;  4A8X C;  3K9O B;  5KHQ A;  3GE3 C;  2D2Q A;  2M0A A;  2WHI A;  1L5P A;  2IO0 B;  2NBU A;  4EKU A;  4YSX B;  1C4C A;  2DNF A;  5BO4 B;  2BYF A;  2QJL A;  2KDM A;  1L7Y A;  4KSL C;  4MJS B;  2C9W B;  1CK1 A;  3ZRF A;  1L6V A;  5BYR A;  3AED B;  4A9A A;  2KKC A;  1E5W A;  2ZCC A;  2HDE A;  1MFW A;  3QQ8 B;  4TKN A;  3AE2 B;  2K8C A;  4MH8 A;  1WGH A;  4GIV A;  3MTN B;  1K50 A;  4I6P A;  2LJI A;  1Q5W B;  2L0F A;  5CX3 A;  1WJU A;  1K53 A;  3ZNG C;  2CU1 A;  2QCZ A;  3HVZ A;  3GP7 A;  2V3S A;  4DXF A;  2J4X A;  3VQI A;  1WGK A;  5LXI B;  2KX0 A;  4H2A A;  1XLO A;  2NR2 A;  1ZGU B;  4URK A;  2OHF A;  1V5T A;  2NVU I;  2KDB A;  1RAX A;  3P63 A;  4DHJ D;  2QDF A;  1MVK A;  2INC C;  2PE9 A;  3ZNI D;  3VXW A;  4JLC A;  5G5G A;  5GMV A;  1X1M A;  1Y8R C;  3ZDT A;  4NQL B;  4WAA A;  1XLQ A;  1V8C A;  1C4A A;  1WJ6 A;  2DAJ A;  1R4M I;  3RNA C;  2K39 A;  1TGZ B;  3V05 A;  3ONS A;  3RNC C;  4TMA B;  3GOE A;  1PYW D;  3PVL A;  2HTH A;  2N1W A;  2PMV A;  3OJ3 A;  1JRU A;  3H1U A;  3MHZ A;  1J19 A;  2N1V A;  2DZK A;  1EM7 A;  3CF6 E;  3L16 A;  1DGJ A;  3UIO B;  3H9D A;  1T3Q A;  1FD6 A;  4OZA A;  2LGX A;  3ZTD A;  4B95 A;  2BYV E;  4IDI A;  3T3O A;  2UU7 A;  2DZJ A;  2NTS A;  1MHH E;  3WAM A;  4YTP B;  1WXV A;  2MW5 A;  4FA6 A;  2KJ6 A;  3O13 A;  1WE6 A;  1V97 A;  2OED A;  1EO6 A;  2AYO B;  5J2R A;  4AS1 A;  1TS4 A;  1TTN A;  1L6U A;  3RFZ B;  2AQ1 B;  3ZYY X;  3PPA A;  1I4Q A;  5D3D A;  4M00 A;  2ZNV B;  3DVN V;  4YL8 A;  1V1P A;  1V49 A;  4E3C A;  1KLV A;  5HHD G;  4XWW A;  4JQW C;  4LNO A;  2UWQ A;  2Y5C A;  3MFG A;  3L13 A;  3VUY A;  4FJV B;  2M1M A;  1UWX A;  3MC9 A;  3Q8A A;  4OVU A;  4YTN B;  4R3D A;  2X8X X;  1R7S A;  4EZL A;  2WYQ A;  2INN E;  1E90 A;  1E8X A;  2KAC A;  2KFK A;  3TCA A;  3Q6B A;  1OQQ A;  2ONQ A;  3P42 A;  2AWT A;  2YEP B;  1OGW A;  4XDD A;  4C7Y A;  1F9J A;  4IM0 A;  4BOZ B;  1N6Z A;  1GC7 A;  1E6E B;  4A6Q A;  2LGS A;  5DPT A;  2E6X A;  3IHP C;  5HG2 A;  3R7Q A;  3DOW A;  5IN7 A;  2WU2 B;  2B3A A;  4YT0 B;  1FEH A;  2V9H A;  1V6E A;  1IYF A;  2V4I B;  2KVZ A;  2IND C;  3TL5 A;  3TEZ A;  3TEY A;  2L00 B;  2ZJD A;  3AN1 A;  3K9P B;  3R7R A;  4LNN A;  2L1A A;  2LXA A;  2G45 B;  1NVI D;  3U52 E;  4DXA B;  2KO3 A;  2N7D A;  4KSK C;  2KWC A;  2LHD A;  2RMM A;  4YTM B;  4YSY B;  2JUO A;  1P98 A;  3VTW A;  1GUA B;  2LAS A;  3AE3 B;  3AEC B;  2B76 B;  1YX5 B;  3VFK A;  4FN2 A;  4XZ4 A;  2Z59 B;  2UYZ B;  3DBR B;  2JF5 A;  3DHH C;  4OW0 A;  3FC4 A;  4PT5 A;  2W82 A;  4A3P A;  2O2V B;  4ARC A;  5LXH A;  4S0R A;  3NVW A;  4GDL A;  2VZK B;  1JWB D;  4RGT A;  1B1Z A;  1YJ1 A;  2KN5 A;  2FAZ A;  2WS3 B;  1NI3 A;  3VH4 B;  4JWS C;  3W5U B;  5JXV A;  1QOF A;  4WQO B;  2KTR B;  4HJK A;  4W9K A;  1OEY A;  4TQ0 A;  1SIF A;  3PZD A;  3W1S C;  1BUI C;  1RYJ A;  5JH5 C;  3BYT B;  3EHV A;  4IOI E;  1EU4 A;  3QX1 A;  2G3Q B;  3AEG B;  2RDH A;  2HJ8 A;  2C60 A;  1FCC C;  2GBK A;  2DHZ A;  2AQ3 B;  2KZR A;  3J9C A;  3ZW3 A;  4E74 A;  2LGY A;  1ZP0 B;  2M17 A;  4OZC A;  2PVO D;  1QOB A;  1ZUD 2;  5EE3 A;  3H8H A;  3PRM B;  1C4P A;  4DWF A;  4IWO A;  1BML C;  1F2R I;  1HEZ E;  4DHZ B;  3LXF A;  1NDD A;  5G2N A;  4EUT A;  2MHJ A;  4JE3 B;  2ZW1 A;  2MA9 B;  5IO9 A;  1SE3 A;  4QAY A;  4DXG A;  3QIJ A;  4JGH B;  1XO3 A;  2AEH A;  2BF8 B;  4HDO A;  4IG7 B;  2MBQ A;  2KN4 A;  3DWG C;  2IY0 B;  5BMH A;  2BGF A;  3UI3 A;  3AEF B;  3AUL A;  1UZX B;  1KTK A;  3KWL A;  1RFA A;  3EGR A;  5IP4 D;  3IG3 A;  3PRZ A;  4YSZ B;  4P7I A;  4C80 A;  5D2M B;  2EEL A;  1XCQ L;  2O6V B;  3DQV A;  1NEK B;  1SXT A;  4XWT A;  1Z2M A;  3QHT A;  1VDV A;  3HUI A;  2I1J A;  5E6P A;  1T0S C;  1FM0 D;  1CQV A;  1EWC A;  2N9P C;  2XBB C;  4MSM B;  2FCQ A;  2J7Q B;  3OJ4 B;  4GSW A;  1P7F A;  1VCB A;  1MG4 A;  3Q8C A;  3P4P B;  1H4R A;  1SSN A;  3DWM A;  2RPQ A;  3KLS X;  2BKF A;  4DK5 A;  3PSE B;  4JIO U;  3KYD D;  4WJQ A;  2BQQ A;  2KYW A;  3KUZ A;  4FJZ A;  4GGQ A;  2XK5 A;  1AW7 A;  1HQR D;  3L0W B;  3RPF C;  2ACZ B;  1WYW B;  1D5M C;  4ZRJ A;  2CS4 A;  5DCN A;  1TS2 A;  4OVV A;  2NPT A;  2WXF A;  4N6E B;  2K0P A;  3AE1 B;  2R61 A;  4MGZ E;  2K9X A;  2KAJ A;  2LWP A;  4E71 A;  1SJE D;  1TKY A;  2N9L A;  4HVB A;  5D94 A;  3C19 A;  2J0K A;  3TEX A;  2KLC A;  3R8B A;  3PHW B;  4M0W A;  5C1Z A;  2L76 A;  5J18 A;  1HZ5 A;  4KIK A;  3M62 B;  4ANV A;  4BBN C;  2GBN A;  3EFC A;  1IGD A;  2JVC A;  2MSE D;  1V5O A;  5AZG A;  4CO7 A;  1R4N B;  3SD5 A;  4ANU A;  1AYF A;  2KX3 A;  2ZZP B;  1TJE A;  4ZHP A;  5L95 C;  2L0T A;  4KDI C;  4US8 A;  5FR6 A;  2IPK D;  2V1Y A;  1TY0 A;  4W9E A;  1N62 A;  1MI0 A;  1ZXH A;  1L0Y B;  2A4Z A;  3APC A;  4GLS C;  2LFI A;  1JCK B;  1L4D B;  2JZP A;  1PGX A;  4KX6 B;  4LCD E;  1C77 A;  3M63 B;  2WXO A;  3AE8 B;  2KJR A;  2BS3 B;  1WJ4 A;  1J8C A;  1NYQ A;  3QC8 B;  4XE0 A;  4ICU A;  1V80 A;  4REZ A;  3ZJU A;  2WU5 B;  3NJT A;  1L0V B;  3AH7 A;  2GOW A;  2GBJ A;  4ZRK A;  3ZTC A;  1J0G A;  3PS6 A;  1UD7 A;  1N60 A;  1IGC A;  3E9S A;  1FXA A;  4RH6 A;  4C4V A;  3I5J C;  2MJE A;  2BB6 A;  5G55 A;  3NS8 A;  1F1H A;  3W9C B;  2KK8 A;  1QKZ A;  3NY5 A;  4K3B A;  1ZPS A;  3NHE B;  3C8Y A;  4IM3 A;  2ZPY A;  3BIN A;  2VZK D;  1DOI A;  2VRR B;  3U8Z A;  1GPX A;  2FID A;  2FUH B;  1L4Z B;  4ZOH C;  1WRI A;  4LK0 M;  5EE0 A;  2REX A;  4LNF A;  4X57 B;  2EKI A;  3ZJV A;  1ROE A;  1AN8 A;  1T0R C;  2QEJ C;  2W55 A;  4W9G A;  2G1E A;  2WXQ A;  3PV1 A;  1WMH B;  4F1S A;  1V1O A;  3Q3N C;  4MAC A;  1SIJ A;  3NS1 A;  3JYU A;  2LD9 A;  1CZP A;  3RI7 C;  1XQQ A;  2DAF A;  4G3X B;  3N30 A;  1I4R A;  4ZYN A;  3MP9 A;  4GDK A;  3AE4 B;  1BXT A;  1TKE A;  4I6L B;  5AUI A;  1UGJ A;  1LFD A;  4P1B C;  3TMP B;  4BFR A;  5H8Y E;  2BPS A;  2FE8 A;  2GRI A;  1WZ0 A;  2M19 A;  1WX7 A;  1PGA A;  4A3O A;  1WZ3 A;  2MP2 A;  5J17 A;  2WGS A;  2E3T A;  1I4H A;  3A9J A;  4M8M A;  3H7P B;  1ZE3 D;  1CJE A;  4RMA A;  5E6O A;  2SAK A;  3PT2 B;  2QHO A;  3QAR A;  3T8M A;  2WLB A;  4LTU A;  2D07 B;  3CMM B;  1MPE A;  1SGH A;  1F0Z A;  3VDZ A;  2KMC A;  2KTF A;  1PDX A;  1IBX A;  2KAN A;  4Q2J A;  2IYD B;  1UNS A;  5FR3 A;  1D5Z C;  3AEA B;  1VZ7 A;  4M02 A;  1JWS D;  1YMH E;  1KLU D;  2JSV X;  1YJI A;  5JHA A;  3QCA A;  3P4R B;  5DPR A;  3WAN A;  3HRD D;  2H88 B;  2LZ6 A;  4NAW B;  1HZ6 A;  1XLN A;  1WF9 A;  1SF0 A;  2WDQ B;  2Z0E B;  3I57 A;  2G9H D;  3FIL B;  2V0G A;  3WAP A;  4FBJ B;  1OQR A;  3Q8B A;  3OAW A;  3A9K B;  2PVG C;  1F52 A;  4FHJ A;  4KGS A;  1SE2 A;  3WAL A;  2O6V D;  3W2D A;  5BYS A;  4NPN A;  3RZF A;  4IUM B;  3Q14 C;  3BZD B;  3DCG A;  4P16 A;  5JZE B;  4BKS D;  1BT0 A;  4PS7 A;  3B0A A;  4RM9 A;  2IO1 B;  1WM2 A;  3DVN U;  4ACF A;  3U2S C;  3ZLZ A;  4A55 A;  5IA7 A;  4M8N A;  4WJP A;  1YNT E;  2K22 A;  1LXD A;  4RFB A;  3R2I A;  2M0X A;  5EDS A;  5LNK 1;  1C76 A;  3PLU A;  1KLG D;  2LEK A;  1FRR A;  3DBL B;  1JWM D;  4OVZ A;  4UDU C;  1PFD A;  3JW0 X;  2EKE C;  1FFU A;  2WDR B;  2CHX A;  4BKG A;  3Q3M C;  1WX9 A;  1SEB D;  3AE9 B;  4HJG E;  4DDG D;  1J7C A;  3VTU A;  3OLM D;  2MJ3 A;  2JWU A;  2ZCB A;  4B0E A;  4KZC A;  3N20 C;  2ON8 A;  4NY0 A;  1J7A A;  1UF0 A;  2HD5 B;  4IWQ A;  4AJY B;  3AEB B;  3VRB B;  4TQ1 A;  1E9M A;  2MBE A;  4HWI B;  3VH3 B;  1JML A;  3QAQ A;  5L83 A;  3QJZ A;  1HTO A;  3FKY A;  2AX5 A;  3UIN B;  4F8C B;  2CR5 A;  2NS5 A;  4B0M A;  2BWE S;  3KW5 B;  3QA8 A;  3P2B A;  3UGB B;  2CHZ A;  3RNB C;  4HK2 A;  2KQ4 X;  4DQO C;  2EMT A;  2MX2 A;  1RWS A;  4GN1 A;  1V1P B;  1ACC A;  1TT5 B;  4EFO A;  2YEP F;  1KJT A;  1VLB A;  3PLV A;  1MJD A;  3LB8 C;  5GXG B;  3V62 A;  2WXI A;  4D2K A;  2KDF B;  1ET6 A;  3L08 A;  2D3A A;  3IT4 B;  1XF5 L;  3NUH B;  1VJK A;  1KH0 A;  2MEK A;  2JY6 A;  2QIL A;  3L10 B;  4IM2 A;  4G50 A;  4PK1 A;  4PYZ A;  1B9R A;  2WDT B;  1WR6 E;  2KFK B;  3AV8 A;  3TBL D;  1KF6 B;  2KMM A;  1UBI A;  4PYU A;  3JSV A;  4IW0 A;  4DHZ E;  3GB1 A;  2K3U A;  1RLF A;  2MWS B;  3A4R A;  2IO2 B;  1SE4 A;  2J0J A;  2WXN A;  3L17 A;  2BWF A;  4LJP B;  1JRP A;  2W3R A;  2N9X A;  3X23 A;  4N58 A;  4BZA A;  3ZDM C;  1ZOY B;  1N5W A;  3IBE A;  1C78 A;  3EA6 A;  1YD8 U;  2KFJ A;  4BKS A;  3R3M A;  3U30 A;  1VR9 A;  4AOF A;  2KHW B;  4ZHO A;  1EUV B;  1KFY B;  1XCT L;  4W9L A;  4XGA B;  4MM3 A;  2C7H A;  1EF5 A;  2SEB D;  3RD2 A;  2J52 A;  2QIE B;  4EOY A;  1FMA D;  5C3J B;  1SE9 A;  4US9 A;  2WXJ A;  2RPV A;  2BT6 A;  1E10 A;  1A70 A;  2GMI C;  1ZKH A;  4WQM A;  3PGE A;  2N9K A;  2K25 A;  3M3J A;  2PTL A;  1QIL A;  3I3T B;  3TJP A;  1LQB A;  4GOC A;  3A1Q A;  1FRD A;  2D11 A;  5BYQ A;  2LJ5 A;  2DYB A;  2GB1 A;  5FK9 C;  2D3G A;  1FNV A;  2JRI B;  2Q5W D;  3PO0 A;  2PIA A;  2V3P A;  1GOZ A;  1E7P B;  4L2Y A;  3V61 A;  2D3B A;  4WWM A;  4ANX A;  4K7W A;  1GNU A;  4B9K A;  2BB5 A;  2XNA C;  2CKH B;  3UQB A;  1SB3 C;  2PKO A;  1GG3 A;  2KWV B;  3AU5 A;  4GDL B;  4KGR A;  1QT9 A;  2JX5 A;  4WUR A;  2BTE A;  4K7S A;  1GJZ A;  3U4E G;  2VH2 A;  2PJH A;  4N9F 4;  4HPL B;  3AI5 A;  1TS3 A;  4NJC A;  1MG8 A;  5CHW A;  1WXQ A;  4RCO A;  2W9N A;  3T9L A;  2KWD A;  4HEA 1;  3ZQ4 A;  3APD A;  2K1F A;  2FUG 1;  1HTQ A;  3BVZ A;  2JWZ A;  4HCN B;  2Y3A A;  2LI5 A;  2M8S A;  3LJ3 A;  5AEK B;  1DOX A;  2R2O A;  1YQB A;  2Y5B B;  3IT6 B;  1M94 A;  1H8C A;  4W9D A;  2DZM A;  3Q2A C;  1OFF A;  2V4L A; 
#chains in the Genus database with same CATH homology
 3NOB A;  2MQJ A;  2ZEQ A;  1EO6 A;  2AYO B;  1ISN A;  2KK8 A;  3NY5 A;  2KNB A;  5J2R A;  1D3Z A;  1TTN A;  3RUI B;  1AAR A;  3CST A;  2KMA A;  4W9C A;  3PPA A;  3V6C B;  2O6V A;  3NHE B;  4IM3 A;  2ZPY A;  2ZNV B;  3DVN V;  1WH3 A;  3BIN A;  5KHO A;  4YL8 A;  4LJO B;  1V49 A;  3DBL I;  3VUX A;  1WRD B;  4KVG B;  2VRR B;  2MLB A;  3O65 B;  4WJN A;  3RCZ A;  3U8Z A;  3ECI A;  1WIA A;  4WWP A;  4E3C A;  2FID A;  2FUH B;  1KLV A;  4IWP A;  4HXD A;  1ZW7 A;  2ASQ A;  2OJR A;  1WR1 A;  4DDI D;  3HK0 A;  2REX A;  4JQW C;  3A1Q B;  4X57 B;  2N7E A;  4CYE A;  2LUE A;  2UWQ A;  3KUD B;  3KYC D;  2KJH B;  1S1Q B;  3L13 A;  1P1A A;  4II2 B;  4FJV B;  3VUY A;  2M1M A;  4W9G A;  3PV1 A;  1WMH B;  4F1S A;  4MEL A;  1K8R B;  4OVU A;  4II3 B;  2M4N A;  3JYU A;  2LD9 A;  2PE6 B;  2AL3 A;  5C23 A;  1XT9 B;  1XQQ A;  2DAF A;  2DYM A;  3RT3 B;  4EZL A;  4G3X B;  3N30 A;  3V60 A;  2WYQ A;  4ZYN A;  1WXM A;  4GDK A;  1E90 A;  3DVG X;  2OOB B;  4I6L B;  3RUL A;  2DZI A;  1E8X A;  1LFD A;  2KFK A;  3TCA A;  3TMP B;  3QK0 A;  3VTV A;  4BFR A;  4MH0 E;  1CMX B;  2BPS A;  2LVO A;  1WZ0 A;  1XD3 B;  1WX7 A;  2FIF A;  3PHX B;  4A3O A;  1WZ3 A;  1UEL A;  2MP2 A;  5D6J B;  5J17 A;  4WJO A;  3N32 A;  2AWT A;  5D7G A;  1OGW A;  1P9D U;  4ZDV A;  3LDZ E;  4ASW C;  3NZS A;  1F9J A;  2LGD A;  4IM0 A;  2RSU A;  4BOZ B;  3A9J A;  4M8M A;  4K1R B;  3ALB A;  2KXJ A;  4B6W A;  3H7P B;  1GC7 A;  2DX5 B;  4RMA A;  5E6O A;  3WIM A;  3PT2 B;  2QHO A;  4DHJ B;  2FNJ B;  3N3K B;  2KLG A;  3QAR A;  4LDT B;  3PRP B;  3T8M A;  4FHK A;  2D07 B;  3CMM B;  1SGH A;  3VDZ A;  2KMC A;  4K81 A;  3Q3F A;  4J6I A;  2KTF A;  2MBB B;  5DPT A;  3NZU A;  2YLM A;  3IHP C;  5DPS A;  2KAN A;  3VUW A;  3R7Q A;  2IYD B;  1S3S G;  3DOW A;  1UGM A;  2B3A A;  3PRE A;  3V6E B;  4MJS A;  3ZNH B;  3PTF C;  5JHA A;  3QCA A;  1V6E A;  1IYF A;  5DPR A;  3WAN A;  2GBR A;  4A20 A;  2LZ6 A;  4NAW B;  2GBM A;  3TL5 A;  3KVF B;  1WF9 A;  3DBS A;  4AP4 C;  2L00 B;  1VD2 A;  2Z0E B;  2ZJD A;  4GB9 A;  1A5R A;  4FUL A;  2XK5 B;  3JSV B;  4GXB A;  4W9I A;  4W9F A;  3WAP A;  5AZF A;  3K9P B;  4FBJ B;  3R7R A;  1LM8 B;  4PS3 A;  1P0R A;  3OAW A;  3A9K B;  2LXA A;  2G4D B;  2G45 B;  1WGY A;  4FHJ A;  2JZ3 B;  3WAL A;  4ANW A;  2O6V D;  4DXA B;  3UIP B;  3BY4 B;  2KO3 A;  2N7D A;  4KSK C;  2KWC A;  2NPT B;  3DBR I;  4NPN A;  1NI2 A;  3RZF A;  4IUM B;  4IC7 B;  2KWU B;  5JZE B;  3DCG A;  2L7R A;  2LRW A;  2JPH A;  2JUO A;  2LXC A;  1P98 A;  1V9J A;  3QWZ B;  4GU2 A;  3VTW A;  4BKS D;  3HIZ A;  1WGR A;  1GUA B;  2LAS A;  1BT0 A;  2WWZ A;  5JHB A;  4PS7 A;  1YX5 B;  3VFK A;  4FN2 A;  3B0A A;  4XZ4 A;  2Z59 B;  3DVG Y;  2KDE B;  2FCS A;  4RM9 A;  2UYZ B;  1RRB A;  3ZNZ B;  4G11 A;  2JF5 A;  1NBF C;  2JXX A;  2L05 A;  2DEN B;  2IO1 B;  1WM2 A;  3DVN U;  1TZ1 A;  2C7M B;  3HHM A;  4A3P A;  3ZLZ A;  2O2V B;  3A4S C;  4M0W B;  5IA7 A;  4M8N A;  4WJP A;  5LXH A;  3ML9 A;  2NCN A;  3C0R B;  1WFY A;  4GDL A;  4KIK B;  1YJ1 A;  2KN5 A;  2LRU A;  1LXD A;  1OEY J;  1UH6 A;  2FAZ A;  2BYE A;  2M0X A;  4I6N B;  4FLH A;  4BBN F;  5EDS A;  1V81 A;  3VH4 B;  2MRP A;  2EMS A;  4WQO B;  2JT4 B;  3PLU A;  2KTR B;  4HJK A;  3VVW B;  4W9K A;  1OEY A;  2JRH A;  4TQ0 A;  1SIF A;  2IBI B;  4HLE A;  3PZD A;  3W1S C;  4JL9 A;  4KZ0 A;  3JW0 X;  4MGY E;  5JH5 C;  2EKE C;  2KD0 A;  5CTR C;  3EHV A;  3SDL C;  2CHX A;  3QX1 A;  2G3Q B;  4AJW A;  4BKG A;  1C3T A;  2HJ8 A;  2C60 A;  1WX9 A;  2GBK A;  2L3Z A;  2DHZ A;  2N4F A;  4W9J A;  5TR5 A;  2KZR A;  4BOS C;  4DDG D;  3ZW3 A;  3VTU A;  3OLM D;  4MEM A;  4E74 A;  4MGK E;  4AWJ A;  2LGY A;  2LVP A;  1EF1 A;  2M17 A;  4CHK A;  2ZCB A;  3KH0 A;  4KZC A;  3VHT C;  3MJW A;  2WX1 A;  2RD0 A;  3MHS D;  3APF A;  4MDK E;  3PRM B;  4NY0 A;  2HD5 B;  3IVF A;  4IWQ A;  1T0Y A;  4MSQ B;  4AJY B;  4DWF A;  4IWO A;  4TQ1 A;  4DHZ B;  1OTR B;  4MGI E;  1WXA A;  1NDD A;  2MBE A;  4HWI B;  3HM3 A;  5G2N A;  4EUT A;  3VH3 B;  3SU8 X;  1Q0W B;  2I1K A;  3QAQ A;  2CHW A;  2XEW A;  2MA9 B;  3QJZ A;  5L83 A;  3TIX A;  2BKR B;  1E7V A;  1GC6 A;  3QIJ A;  4JGH B;  2AEH A;  2BF8 B;  3KUC B;  4HDO A;  4IG7 B;  4AUQ C;  2MBQ A;  2PPH A;  1WGD A;  1UBQ A;  2KDI A;  3UIN B;  4F8C B;  1E8Y A;  2IY0 B;  2BGF A;  3DDC B;  2CR5 A;  2MBH A;  2NS5 A;  3WA0 A;  1WMH A;  1YIW A;  1QZE A;  3AUL A;  2G4S A;  1UZX B;  2MCN B;  1WY8 A;  2BWE S;  3KW5 B;  1RFA A;  3QA8 A;  1U4A A;  2YVC A;  3RYT A;  4BBN C;  2DYO A;  4WWO A;  3P2B A;  3Q3J A;  3U7D A;  3UGB B;  4BVU C;  1G6J A;  2CHZ A;  3IG3 A;  3GZN I;  3PRZ A;  4HK2 A;  4NQK E;  4P7I A;  2EMT A;  5D2M B;  3B1L X;  4NJ6 A;  4G0N B;  2N9E B;  2O6V B;  3DQV A;  2MX2 A;  4GMV A;  4FJY A;  2K8H A;  1E7U A;  3VAW A;  1KOT A;  2IO3 B;  4GN1 A;  4KDL B;  1Z2M A;  3ZIM A;  2WX0 A;  2ZVN A;  4EFO A;  1PQS A;  1KJT A;  3QHT A;  2ZNV C;  3PLV A;  1WGG A;  2MBO A;  2I1J A;  5E6P A;  3V62 A;  3AXC A;  1Q1O A;  3H7P A;  1IPG A;  2KDF B;  1L2N A;  2KVR A;  3L08 A;  3X0W A;  2N9P C;  3ZVV A;  4DBG A;  1P3Q U;  2XBB C;  3AU4 A;  4MSM B;  2FCQ A;  2Z0D B;  4EZK A;  2J7Q B;  5AZH A;  3OJ4 B;  1E8Z A;  4GSW A;  1E8W A;  1VCB A;  2FCN A;  2JY6 A;  3S2A A;  3L10 B;  4IM2 A;  4G50 A;  3D32 A;  5DPW A;  1H4R A;  4XC2 A;  2KQ7 A;  2RPQ A;  4PYZ A;  5HKH A;  2BKF A;  4GDK B;  4HDQ A;  4DK5 A;  2WDT B;  1WR6 E;  3PSE B;  2KOX A;  4NAW A;  4JIO U;  3KYD D;  1C1Y B;  4W9H A;  2KFK B;  3TBL D;  2A5U A;  4WJQ A;  3KUZ A;  1UBI A;  4FJZ A;  4PYU A;  1OQY A;  4GGQ A;  2FCM A;  4WWN A;  3UF8 A;  2XK5 A;  3JSV A;  4IW0 A;  4BKT A;  4DHZ E;  3M95 A;  1TBE A;  3EFU A;  1RLF A;  3SHQ A;  2L8J A;  2MP2 B;  3L0W B;  2MWS B;  3A4R A;  3ZO5 B;  3W1Y A;  4RM8 A;  3JVZ X;  2IO2 B;  4HPM B;  3A9K A;  2J0J A;  4K7U A;  1WYW B;  3L17 A;  2BWF A;  3ZRC A;  2LVQ A;  3A9J B;  4LJP B;  5CHV C;  2CS4 A;  4ZRJ A;  5DCN A;  2IZV B;  2N9X A;  2C7N B;  3X23 A;  1HE8 A;  3ZDM C;  4TV3 A;  4OVV A;  2NPT A;  3IBE A;  5E6N A;  2KC1 A;  2K6D B;  3K9O B;  1V2Y A;  5KHQ A;  1YD8 U;  4MGZ E;  2D2Q A;  3L54 A;  2LWP A;  2NBU A;  2IO0 B;  2KFJ A;  4BKS A;  4EKU A;  4E71 A;  3UQA A;  3R3M A;  3U30 A;  4AOF A;  5BO4 B;  4FAD A;  2BYF A;  3EC8 A;  2KHW B;  1L7Y A;  4KSL C;  1EUV B;  4MJS B;  3DBH I;  2C9W B;  3ZRF A;  4HVB A;  5D94 A;  4ZRI A;  3H7S A;  2J0K A;  3HM6 X;  3EEC A;  2KLC A;  4W9L A;  4MM3 A;  2C7H A;  1EF5 A;  3CSF A;  3PHW B;  1WE7 A;  2NBV B;  2RR9 A;  3RD2 A;  4EOY A;  2O2V A;  5C1Z A;  2RGF A;  2L76 A;  2KKC A;  1E5W A;  1SE9 A;  1R4N I;  2ZCC A;  3QQ8 B;  4TKN A;  5J18 A;  2K8C A;  1WGH A;  2GMI C;  3ZUN A;  3ENE A;  4KIK A;  3M62 B;  4ANV A;  5LLI A;  4GIV A;  4TUU A;  2GBN A;  1ZKH A;  2KC2 A;  3MTN B;  3DPD A;  4I6P A;  3PGE A;  4ICV A;  2K25 A;  3M3J A;  1Q5W B;  2JVC A;  2L0F A;  1WJU A;  5CX3 A;  3H6N A;  2MSE D;  1V5O A;  1Z5S B;  1LQB A;  3I3T B;  5AZG A;  2CU1 A;  3A33 B;  3TJP A;  3ZNG C;  4GOC A;  4CO7 A;  2V3S A;  3A1Q A;  3SD5 A;  1WXS A;  2D11 A;  2AL6 A;  2KX3 A;  2K6Q A;  2ZZP B;  4PS8 A;  4ANU A;  3VQI A;  2KTR A;  5L95 C;  2L0T A;  2PEA A;  4KDI C;  2LJ5 A;  2DYB A;  5LXI B;  2KX0 A;  5FR6 A;  2D3G A;  2NR2 A;  3RZW C;  1ZGU B;  2V1Y A;  4URK A;  4EZJ A;  4W9E A;  1V5T A;  2JRI B;  2NVU I;  2KDB A;  1RAX A;  4DHJ D;  4LDT D;  2ZVO A;  3WAO A;  2IY1 B;  2A4Z A;  3V61 A;  3APC A;  2PE9 A;  3ZNI D;  3VXW A;  4JLC A;  5IAA C;  4ANX A;  4K7W A;  1GNU A;  4B9K A;  5GMV A;  1X1M A;  1Y8R C;  3ZDT A;  4NQL B;  2CKH B;  1I35 A;  3UQB A;  4WAA A;  1WJ6 A;  2JZZ A;  2DAJ A;  1I42 A;  1GG3 A;  2KWV B;  4LCD E;  1R4M I;  3AU5 A;  3M63 B;  4GDL B;  2K39 A;  1WI0 A;  1TGZ B;  4K7S A;  1GJZ A;  2KJR A;  3ONS A;  1WJN A;  1WJ4 A;  2PJH A;  3GOE A;  4N9F 4;  4HPL B;  1J8C A;  3PVL A;  2D10 A;  3AI5 A;  1IP9 A;  4F7Z A;  2HTH A;  2N1W A;  3QC8 B;  3OJ3 A;  4ICU A;  1YX6 B;  3ZKJ C;  1JRU A;  1MG8 A;  1FXT B;  2J0M A;  4NJ7 A;  5CHW A;  3H1U A;  3B08 A;  1V80 A;  2KQS A;  1J19 A;  2N1V A;  2DZK A;  5CHF A;  2W9N A;  3ML8 A;  4HCP B;  3T9L A;  3CF6 E;  3L16 A;  3APD A;  3UIO B;  2K1F A;  1WX8 A;  3W1S A;  3H9D A;  2R2Q A;  2ZPN A;  3R66 C;  4NNJ B;  2GOW A;  2GBJ A;  2HE7 A;  4ZRK A;  2JWZ A;  3IFW B;  4HCN B;  2LGX A;  4KV2 A;  3ZTC A;  2LI5 A;  2M8S A;  1V86 A;  3LJ3 A;  1J0G A;  5AEK B;  3ZTD A;  3PS6 A;  2R2O A;  2K8B A;  1UD7 A;  2C5L C;  4B95 A;  2BYV E;  4EEW A;  1YQB A;  2Y5B B;  1WM3 A;  2DZJ A;  4XX5 A;  1M94 A;  3WAM A;  1H8C A;  4W9D A;  1KM7 A;  2DZM A;  1WXV A;  5G55 A;  2MW5 A;  4FA6 A;  3NS8 A;  2NBW B;  2KJ6 A;  2V4L A;  1WE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...