1J0GA

Solution structure of mouse hypothetical 9.1 kda protein, a ubiquitin-like fold
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
92
structure length
92
Chain Sequence
b'GSEGAATMSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical Protein 1810045K17
molecule tags Structural genomics, unknown function
source organism Mus musculus
publication title Solution Structure of Mouse Hypothetical 9.1 kDa Protein, A Ubiquitin-like Fold
rcsb
total genus 9
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2002-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03671 Ufm1 Ubiquitin fold modifier 1 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1j0gA00
4IW0A 4GOCA 4KDLB 4GDLB 5HKHA 2N9PC 1GC7A 1H8CA 2DZKA 2IY1B 3DBLI 3D32A 1E7VA 1ZKHA 5D7GA 3HM6X 1WJNA 4IWPA 3AU4A 3WIMA 3N30A 3VUWA 1NI2A 3R7RA 1SE9A 3V61A 4MEMA 2RGFA 3AULA 3HIZA 1GG3A 4PYZA 2I1JA 3PREA 3DDCB 3CMMB 2JUOA 4LDTB 5L83A 1P0RA 4MGIE 4WAAA 4A20A 4KSKC 4KZCA 1LM8B 4DBGA 3VAWA 4W9JA 4GSWA 1WI0A 2FCSA 2HTHA 2ZJDA 2B3AA 1U4AA 1V5TA 4RM8A 3KUDB 3UINB 4G3XB 3PTFC 4ANXA 4FJZA 3S2AA 3VHTC 3GZNI 2NPTB 3PLVA 2AL6A 1E8XA 5AEKB 2JT4B 4EKUA 4EEWA 2C7HA 2MRPA 4E74A 4HVBA 4HCPB 5FR6A 3M63B 4AJYB 4ZRIA 2IO1B 2UWQA 1XD3B 4J6IA 1J0GA 5CHFA 3NOBA 1M94A 2WX1A 3NHEB 3A9KA 4MH0E 3MJWA 3P2BA 2LASA 3KYDD 3Q3JA 2FCNA 1G6JA 1ISNA 2QHOA 4G50A 3B08A 3ZNGC 1LXDA 2J0JA 1WZ3A 2KX0A 1YX5B 2LJ5A 3VH3B 2KMCA 3A1QA 3RZFA 3ZO5B 2ZCBA 1WGRA 2KQSA 2L7RA 3VVWB 2C7MB 3TIXA 2XEWA 2D2QA 1RFAA 2JRIB 4LJOB 3H7SA 3A4SC 5C1ZA 3ZNZB 3ZVVA 2AYOB 3DCGA 1GNUA 3PRZA 2KN5A 2KWCA 2O6VB 4EOYA 1P1AA 4EZKA 2ZNVC 3VDZA 2I1KA 1EF5A 3ECIA 2IO2B 4IUMB 3H1UA 2KJHB 4GMVA 3DVNV 3PSEB 3HK0A 5LLIA 4WWOA 2NPTA 2LD9A 2MCNB 5L95C 2O2VA 4DHZB 1EUVB 2MQJA 2J0KA 2MWSB 2IZVB 3H7PA 3KYCD 4KDIC 3IG3A 4CO7A 2KK8A 2KFKB 2D10A 4W9KA 2K8HA 3KW5B 4K7UA 1WGGA 2LXCA 1QZEA 2KDIA 1SIFA 4LJPB 3APFA 4B95A 1WF9A 4F1SA 1TGZB 3BY4B 1YD8U 3AI5A 3MHSD 3PHWB 1KJTA 1F9JA 2XBBC 4IM2A 1WGHA 4W9FA 1A5RA 1LQBA 2G4DB 1WX7A 3L17A 5CX3A 4GN1A 4PS3A 2NR2A 2LRUA 2M1MA 2Y5BB 2KXJA 3H6NA 5J2RA 5DPTA 5DCNA 1IPGA 3DBSA 2MBOA 3L13A 1WJUA 3VQIA 2MP2B 3A33B 3UIPB 1OTRB 4B9KA 5D6JB 2FCQA 3DBHI 1Q1OA 2EKEC 3A4RA 1WR1A 4ICVA 4WJOA 1WFYA 3WA0A 4BVUC 1WXSA 1WMHA 2V4LA 4MSQB 4K7WA 4ZRKA 1RAXA 4W9HA 3OJ4B 1P9DU 2DHZA 4P7IA 4BOSC 3H7PB 1TBEA 2LRWA 2FNJB 3VUYA 1T0YA 4ANWA 1UELA 3UQBA 4MGYE 1C1YB 3WALA 4MGKE 2AL3A 2PPHA 2JVCA 3HM3A 3V62A 1S1QB 2C9WB 4IM3A 4NJ7A 5TR5A 2GBNA 2JF5A 1V49A 3UQAA 4FHKA 3PLUA 2C7NB 3PS6A 5D94A 4CYEA 2L8JA 4B6WA 1WYWB 2D3GA 1E8ZA 3RCZA 1WRDB 4MGZE 2DYBA 1CMXB 4NNJB 3U7DA 3C0RB 5IAAC 2BKRB 2C60A 5E6PA 3ZW3A 4ANUA 1V9JA 4K1RB 1JRUA 2FIDA 2MLBA 3PHXB 2KQ7A 3IVFA 4HCNB 4X57B 3WANA 2MBHA 4OVVA 2KX3A 4W9EA 3DVGX 4GIVA 4K81A 2CKHB 2PE6B 3APCA 3DVNU 2K6DB 4II2B 2N7EA 2Z0EB 2N9EB 4ZRJA 5AZHA 3VH4B 1NBFC 3K9OB 2IO3B 4FJYA 3ZDTA 3QIJA 4WJPA 1UGMA 1AARA 2ZZPB 1X1MA 5LXIB 4ANVA 2JZZA 1WE7A 3QQ8B 4AUQC 5KHQA 1V5OA 2N9XA 2RR9A 2KJRA 4MELA 3LJ3A 4BFRA 1UZXB 3DQVA 3APDA 4ASWC 1MG8A 4JIOU 2DZIA 4E3CA 2G45B 4MJSA 1H4RA 2BF8B 1ZGUB 1WH3A 2N4FA 1UD7A 1VD2A 2IY0B 4GB9A 3RUIB 4BBNC 3QARA 2CR5A 4URKA 1ZW7A 3AU5A 3PZDA 1WGYA 1Y8RC 2LUEA 2KOXA 2KKCA 2ZVNA 3T9LA 1WX8A 2ZPNA 3PGEA 4AJWA 1V6EA 5E6OA 2KO3A 2G3QB 2DZMA 2KANA 3L16A 3VFKA 4W9GA 1IYFA 4A3PA 3ZTDA 2MSED 2UYZB 1FXTB 1E90A 4KV2A 5LXHA 2K1FA 4M0WB 4G0NB 4A3OA 2KDFB 5J18A 3DVGY 2ASQA 3W1YA 3A1QB 2V3SA 4HK2A 1IP9A 4TV3A 4EZLA 2M17A 4W9CA 1GJZA 1D3ZA 2GBRA 2JY6A 3HHMA 1KLVA 2KTRA 1NDDA 4HPMB 5CTRC 3WAOA 4GDKB 2DAJA 2MBBB 3TBLD 2NBVB 4TQ1A 4MJSB 4JL9A 1I35A 2VRRB 3EHVA 2JWZA 1EO6A 3JSVA 1E8YA 4MM3A 3NY5A 3ZTCA 2YVCA 3EFUA 3IBEA 3ZIMA 2MP2A 3VTVA 2BWES 2G4SA 3VTWA 1Z2MA 2KTFA 3QCAA 3SD5A 2YLMA 4KZ0A 2JXXA 1J8CA 4WWNA 2CS4A 2PE9A 3ZNID 4FA6A 4I6PA 2BKFA 2K6QA 3UGBB 3V6CB 2LWPA 4DDGD 4I6LB 2N7DA 4PS7A 3V60A 1HE8A 3RULA 2BGFA 3SU8X 2AWTA 4HLEA 4CHKA 5CHVC 3K9PB 1RLFA 3M3JA 2RPQA 2D07B 4BOZB 3R7QA 4BKSA 1WM3A 2NBUA 4HJKA 4ZDVA 3IHPC 3PV1A 2V1YA 1E8WA 4FJVB 3PT2B 3Q3FA 2BPSA 2N1WA 4W9LA 2LGDA 3WAPA 1XQQA 3ZRFA 3RYTA 2K39A 4PS8A 3LDZE 3M95A 2R2OA 4K7SA 1WX9A 2J7QB 3QC8B 2CU1A 2LVOA 3ZNHB 1WXVA 4EZJA 3KVFB 4AOFA 2KVRA 3GOEA 4IWOA 3RD2A 2K25A 3JW0X 2JRHA 2O6VD 2FAZA 4F8CB 5JHAA 3L10B 2JZ3B 5AZGA 4NPNA 1Q5WB 2LVPA 3B1LX 2LI5A 1P98A 4FBJB 2MBQA 3ONSA 3PRPB 2GBKA 3VUXA 1V80A 3U8ZA 4YL8A 5C23A 4II3B 2KFKA 3H9DA 4XX5A 3JVZX 2KLCA 2JPHA 2L76A 2KHWB 4ZYNA 2PEAA 3MTNB 2BWFA 2L00B 2AEHA 2HJ8A 3ZDMC 2L3ZA 3QX1A 4HXDA 2DZJA 3L0WB 2MX2A 2RD0A 2DENB 4IM0A 4RM9A 5DPRA 2WYQA 2FUHB 4JQWC 5CHWA 2DYOA 2K8BA 2FCMA 1WGDA 4MDKE 2O6VA 4HDQA 4IG7B 3TL5A 1WM2A 3L08A 2K8CA 3A9JA 1UBIA 5D2MB 1R4MI 2J0MA 3N32A 3PVLA 2EMTA 4NQKE 4W9DA 1LFDA 1RRBA 1UH6A 4IC7B 5EDSA 4WJQA 2D11A 2KWVB 4HPLB 4G11A 4AP4C 2N1VA 1K8RB 1OEYJ 1YIWA 4NQLB 4RMAA 1V2YA 1WMHB 4W9IA 2M4NA 2KC2A 2NVUI 2FIFA 2LZ6A 3O65B 3VXWA 2C5LC 1TZ1A 4DXAB 2L0TA 1WE6A 3QWZB 2L0FA 3DOWA 3SHQA 3ZUNA 1E7UA 1P3QU 2KNBA 4FADA 3QAQA 3N3KB 3CSTA 1L2NA 3KUCB 3TCAA 3X0WA 3ENEA 3A9KB 1SGHA 2PJHA 2KMAA 3QA8A 4BKTA 4EUTA 1GC6A 3AXCA 4F7ZA 3EC8A 5GMVA 2IBIB 2A4ZA 2KTRB 3UF8A 3X23A 2ZPYA 2CHWA 4N9F4 4BKSD 4WQOB 1WXAA 1GUAB 2LGYA 4FN2A 4NY0A 3QHTA 2LVQA 5G55A 1EF1A 4AWJA 1WIAA 2KLGA 2L05A 2ZCCA 2WDTB 4BKGA 4FHJA 1KM7A 2KDEB 2XK5A 1TTNA 2GOWA 3I3TB 2DYMA 3ML9A 3NS8A 2ZVOA 2KD0A 2NCNA 1V86A 5AZFA 1R4NI 4PYUA 2W9NA 4LCDE 1YJ1A 3U30A 4EFOA 3UIOB 3NZUA 2O2VB 2MBEA 2KC1A 1YQBA 2EMSA 4M8NA 3R66C 2BYFA 5DPSA 2LXAA 3V6EB 1Z5SB 4TQ0A 2MA9B 4JGHB 3RT3B 3VTUA 4GDKA 5E6NA 3JYUA 4TKNA 2M0XA 3B0AA 4KSLC 5IA7A 3QK0A 4GXBA 1L7YA 2KWUB 3T8MA 2Z0DB 4NAWA 3W1SA 2IYDB 2BYEA 4KIKA 1WR6E 3TMPB 3ALBA 4M8MA 3KUZA 1PQSA 4TUUA 1I42A 5JH5C 4WWPA 3OJ3A 3ML8A 3CSFA 1OEYA 4DK5A 4IWQA 2CHXA 2OJRA 1WZ0A 1YX6B 3EECA 2KJ6A 2LGXA 4HDOA 4E71A 1XT9B 3SDLC 2BYVE 3CF6E 5KHOA 3DBRI 2ZEQA 4ICUA 2KFJA 4JLCA 4HWIB 4DHJD 1KOTA 3QJZA 4NJ6A 4BBNF 4I6NB 4DWFA 2MW5A 2XK5B 4DDID 2DAFA 3KH0A 5JHBA 4GDLA 2DX5B 2KZRA 4DHZE 3DPDA 3PRMB 1WY8A 2ZNVB 4MSMB 3TJPA 1VCBA 1WXMA 2GBMA 3L54A 1WJ4A 2KDBA 4GGQA 2GBJA 2Z59B 3OLMD 3RZWC 3M62B 2OOBB 1OQYA 3IFWB 4WJNA 2HE7A 4GU2A 5J17A 3W1SC 3ZLZA 4OVUA 4NAWB 1S3SG 2NS5A 4KIKB 3NZSA 1BT0A 1E5WA 5BO4B 5JZEB 1C3TA 2WWZA 2IO0B 3OAWA 3WAMA 1WJ6A 5G2NA 3BINA 3ZRCA 4FLHA 1OGWA 1Q0WB 1V81A 2WX0A 4FULA 3A9JB 3ZKJC 2HD5B 2REXA 4LDTD 1UBQA 2R2QA 4KVGB 1J19A 3R3MA 4DHJB 3JSVB 4XC2A 4XZ4A 5DPWA 2CHZA 3PPAA 2NBWB 2A5UA 2GMIC 2RSUA 2M8SA
chains in the Genus database with same CATH superfamily
4GOCA 5HKHA 1H8CA 3VR9B 3D32A 1HQRD 1HTQA 3O13A 4L2YA 5D3DA 1JWAD 3AU4A 3VUWA 1PUTA 3N9YC 4MEMA 2KN4A 2IGGA 2K22A 4LDTB 1LM8B 1L0XB 4GSWA 2ZJDA 1U4AA 1YN3A 3DBLB 2Q5WD 3S2AA 3VHTC 3GZNI 2AL6A 3ZYYX 2KDMA 4HVBA 2WXNA 2FBWB 3M63B 2QCZA 4AJYB 4YTMB 2IO1B 1XCTL 2EELA 4MH0E 3MJWA 3Q3JA 1ISNA 1QLBB 2WXQA 3RNEC 3VH3B 4ZRQA 2ZCBA 3VVWB 2L7RA 2C7MB 5C3JB 3Q8BA 1RFAA 3P1MA 3PRZA 4EOYA 1P1AA 3ECIA 3MC0B 2KJHB 4YTPB 5LLIA 4WWOA 1SE4A 2O2VA 2MQJA 2J0KA 2MWSB 2IZVB 3KYCD 3AM9A 4CO7A 2KK8A 3KW5B 1UGJA 2L83A 1QZEA 4B95A 4F1SA 1WF9A 5FR3A 1WRIA 3BVZA 3H6NA 2NR2A 1P7FA 1FEHA 2MBOA 1WJUA 1OTRB 4B9KA 3DBHI 1Q1OA 1NYQA 4BVUC 4K7WA 1RFKA 3VUYA 1UELA 4MGKE 2RPVA 3HM3A 3Q14C 4IM3A 1V49A 3UQAA 2V9HA 4RNAA 1JRPA 1PGXA 1WRDB 4MGZE 3FAHA 3U7DA 1RYJA 1OQRA 2MJEA 4US9A 2BW2A 5E6PA 3ZW3A 4K1RB 2MLBA 2WU2B 3PHXB 3BWUD 2OJWA 1TJEA 4K81A 3APCA 2Z0EB 3VH4B 3P4QB 1NBFC 4P1BC 3K9OB 2I38A 4M0WA 1VDVA 3Q8EA 1E7PB 2JZZA 1WE7A 1TKGA 4AUQC 2ZW0A 1AW7A 3NUHB 2KJRA 4MELA 4XGAB 5GXGB 2UU7A 3U52E 1NEKB 1ZGUB 4ZYSA 3RN9C 1D5ZC 3QARA 2CR5A 1ZDXA 3PZDA 1Y8RC 2ZVNA 4AJWA 5E6OA 1YJJA 2KO3A 2Z8LA 3L16A 4JWSC 4A3PA 3ZTDA 1E90A 3GP7A 4KV2A 4ZHOA 3NVWA 4M0WB 2Y3AA 4WWMA 4A3OA 5IKCM 3DVGY 2BTEA 3W1YA 5IO9A 1FMAD 4HK2A 1FCLA 4W9CA 1D3ZA 3Q8CA 5HG2A 4OVZA 1NDDA 4HPMB 3WAOA 2G9HD 1C78A 4DQOC 4MJSB 1I35A 3BVMA 2VZKB 4MM3A 3ZIMA 3VTVA 4S17A 3VTWA 2KTFA 4H2AA 3NVVA 2YLMA 4KZ0A 2JXXA 2PKOA 3ZNID 3AE2B 2BS3B 2LWPA 2AQ1B 2B76B 2PVGC 4DDGD 2IDYA 4PS7A 1HE8A 2BGFA 4S0RA 1FO4A 3MHZA 1RLFA 1CJEA 2RPQA 4BKSA 4XDCA 3H8HA 3AV8A 3IHPC 2WXMA 2LGIA 2V1YA 4FJVB 1XQQA 1QILA 2J7QB 3ZNHB 4EZJA 5T8IA 2KVRA 3AN1A 3RD2A 3GS2A 2K25A 3JW0X 5AZGA 5BMGA 4XYCA 3AE5B 1VR9A 2LVPA 3B1LX 3VRBB 2BBCA 5BMHA 1V1PA 4ZHPA 3N1YC 1K52A 2X8XX 4ZYNA 1N5XA 3N20C 3CWIA 1T3QA 2L3ZA 2J42A 2RD0A 2DENB 2WYQA 2QEJC 2DYOA 2K8BA 2FCMA 2WDQB 3L08A 2K8CA 1UBIA 1R4MI 3NJTA 4NQKE 3EUB2 4XE0A 1JWUD 1L4DB 4C7ZA 1OFFA 2RMMA 1M4VA 3O65B 2KC2A 2LZ6A 3AE9B 1TZ1A 3QWZB 3ZUNA 2LMCA 1E7UA 1P3QU 4AS1A 1N62A 3N3KB 3ENEA 3J9CA 4EUTA 1OQQA 1ACCA 1YQ3B 2CU3A 2KTRB 5EE9A 1GUAB 2LVQA 5G55A 4AWJA 3PZ8A 2ZCCA 1E6EB 2WDTB 4BKGA 4JX1C 2KDEB 2DYMA 2ZVOA 2KD0A 2NCNA 3GE8C 1R4NI 1SB3C 3ZJUA 4EFOA 2NMQA 2MBEA 3R66C 2BYFA 5DPSA 3V6EB 4LNIA 3JYUA 1IBXA 2M0XA 3AE3B 2KWUB 3W1SA 2BYEA 1WR6E 3ETRA 3KUZA 2K0PA 4WWPA 1NENB 2J53A 3CSFA 1GAQB 4DK5A 2CHXA 1WZ0A 3EECA 1FPYA 1FCCC 2VZKD 4E71A 2VH2A 2WDRB 4HWIB 1E9MA 1FNWA 3QJZA 4I6NB 4NJ6A 4DWFA 3KH0A 5JHBA 2KZRA 1XCQL 4DHZE 1WY8A 2DWQA 3C8YA 1VCBA 1FD6A 2DLBA 1I4XA 1F0ZA 4GGQA 3CIRB 3MC8A 3M62B 1J7CA 2KAJA 4WJNA 1SJHD 1KLGD 2NS5A 3NZSA 3NVYA 1BT0A 1QOFA 5BO4B 1C3TA 2WWZA 3BINA 4FULA 2WX0A 2ONQA 4KVGB 1J19A 4DHJB 2RDHA 4LNNA 4MM3B 4C7YA 3PPAA 2NBWB 1D5MC 1HZ6A 2M8SA 4IW0A 2DBYA 4KDLB 3W2DA 1F2RI 2N9PC 3Q3MC 3DBLI 5D7GA 1ZKHA 1T6BX 3N30A 3KQ4A 1JWSD 1SE9A 4K3BA 1P7EA 3LB8C 1JCKB 3V61A 2I1JA 3DDCB 4KZCA 1N61A 2W3SA 1WI0A 2HTHA 4RGTA 4EE2A 1N60A 1XEEA 2GRIA 1V5TA 4G3XB 2LHDA 1E8XA 1GB4A 1CZPA 4HCPB 2PLPA 2I2YA 2WX1A 1RM6C 1XO3A 1I4GA 3P2BA 2LASA 3KYDD 1HEZE 2WXKA 2QHOA 2FE8A 4G50A 3B08A 1PGBA 1LXDA 1WZ3A 2KX0A 1YX5B 1IBXB 3TUOA 2GB1A 1WGRA 2KQSA 3W9CB 4D2KA 3TIXA 2D2QA 2JRIB 4LJOB 1D4BA 5C1ZA 2KYWA 3DCGA 2ZNVC 3H1UA 1ZOYB 4IKGA 3DVNV 3PSEB 3HK0A 1YN5A 1EUVB 3IG3A 2LFIA 3IAS1 2V0GA 1SIFA 1YD8U 3MHSD 4KX6B 4QAYA 1LQBA 2G1EA 4IOIE 3LYYA 1WX7A 3Q8FA 5I4DA 3PO0A 4PS3A 1TS3A 2INCC 2LRUA 2KXJA 3P42A 3MC9A 1MI0A 5D6JB 3A4RA 4WJOA 1WFYA 1WXQA 3WA0A 1SE3A 4MSQB 3OJ4B 1VZ8A 3NRZA 4BOSC 3H7PB 1IGDA 2LRWA 4WAFA 2FNJB 4ANWA 1I4PA 2WU5B 1R4MB 1C1YB 1XXGA 1S1QB 1VJKA 4RFBA 3T3OA 5FKAC 2GBNA 1E10A 2X38A 2K5PA 3PLUA 5D94A 2D3BA 1IUEA 4CYEA 1C77A 4M00A 3IT6B 1FFUA 2D3GA 1N63A 4NNJB 5IAAC 2LHEA 2C60A 4LNFA 3AMZA 3VR8B 4HCNB 3IVFA 4PT5A 3WANA 2MBHA 1PYWD 4GIVA 2QMTA 5AZHA 1TKEA 2N9EB 4ZRJA 2IO3B 4FJYA 3ZDTA 3QIJA 4WJPA 1UGMA 5AUIA 4ANVA 4BFRA 2W3RA 1UZXB 3DQVA 3APDA 1MG8A 4JIOU 2DZIA 4KKIA 2BF8B 1TT5B 5EE3A 1UD7A 1VD2A 3T3NA 2WXPA 2AX5A 1ZW7A 4A90A 1V1OA 3ZXRA 1V6EA 1HXYD 2MSED 2UYZB 1FXTB 3R8BA 5LXHA 4Q2JA 2JZPA 2ASQA 3I57A 1XF5L 3AEGB 1F77A 4HEA1 2CJNA 5IP4D 5CTRC 1TY2A 2NBVB 1ZXIA 3TEXA 4O1NA 3JSVA 1E8YA 3NS1A 3NY5A 3EFUA 5H8YE 2KWDA 3AEFB 4WH4A 4WWNA 3Q8AA 2BKFA 3V6CB 4M02A 4RGMA 1AYFA 2N7DA 3RNAC 3V60A 3R2IA 2V3NA 4HLEA 2AWTA 1VLBA 5CHVC 3K9PB 2BS2B 4MACA 1KH0A 1HTOA 2PVOD 2E3TA 1WM3A 3PV1A 1C4PA 1E8WA 3PT2B 1JQ4A 2BPSA 4W9LA 3KWLA 2Y5CA 3RNFC 2K39A 4P16A 4K7SA 1TS5A 4KKJA 1WX9A 4LTUA 2CU1A 4A8XC 1WXVA 4AOFA 1NYRA 3IXSA 3RMKC 3GOEA 4F8CB 1N6ZA 5BYQA 1Q5WB 2MHJA 2LI5A 3ONSA 5HHDG 3PZ7A 4YL8A 5C23A 4II3B 2KFKA 1I4HA 3H9DA 3JVZX 4A6QA 1J7BA 2PEAA 3MTNB 2BWFA 3AECB 4LNKA 2DZJA 3L0WB 5DPRA 5CHWA 4JQWC 3BK2A 4IG7B 3A9JA 5C2TB 3DHIC 1DOXA 1RRBA 5EDSA 4WJQA 4HPLB 2N1VA 3AB5A 1JWMD 2WDVB 4RMAA 1WMHB 4W9IA 2FIFA 1LGRA 3DBHB 2C5LC 1WE6A 3MP9A 2L0FA 3DOWA 4RF1A 2GLSA 2L32A 3ZQ4A 2H88B 2M0AA 3TCAA 3X0WA 3A9KB 2PJHA 2KMAA 1GC6A 3AXCA 3EC8A 1RWSA 2A4ZA 2D3CA 2JSVX 4N9F4 1WXAA 2LGYA 4NY0A 1EF1A 1WIAA 2KLGA 1YN4A 1GOZA 1SJED 1KM7A 2XK5A 1TTNA 3ML9A 4B0MA 3NVZA 5AZFA 1FNVA 4PYUA 2W9NA 3U30A 1L6VA 1YQBA 2LUMA 1EWYC 2MA9B 3VTUA 5E6NA 4KSLC 3B0AA 5IA7A 3QK0A 2AQ3B 2Z0DB 1T0SC 2IYDB 4KIKA 2BQQA 4P6VF 4NJCA 3TMPB 4M8MA 3UI3A 4TUUA 5JH5C 1K50A 3ML8A 1OEYA 3SFEB 1J7AA 2M19A 4HDOA 1K53A 3SDLC 2BYVE 3CF6E 3DBRI 2XN9C 4ICUA 4JLCA 1KOTA 1WSPA 3U7ZA 2XK5B 3P4SB 2ZNVB 4MSMB 1WXMA 3E56A 3SFDB 1DOYA 1WJ4A 2KDBA 1TYGB 1ZXHA 2IGDA 1OQYA 3Q6BA 3IFWB 2HE7A 4GU2A 4OVUA 2JX5A 1S3SG 4KIKB 1BUIC 1T0QC 2IO0B 3OAWA 3WCQA 4ARIA 1WJ6A 1YOVB 5G2NA 1V81A 1TS2A 3A9JB 2R2QA 3GB1A 5DPWA 2WXRA 2CHZA 2A5UA 4JWUC 2J4XA 4GDLB 1GC7A 2DZKA 2IY1B 4KGSA 1WYGA 2N9KA 3B9JA 1MVKA 2N7JA 1WJNA 3WIMA 1ZDVA 1L0YB 3FILB 2RGFA 2N0SB 1GG3A 4OZBA 1JW9D 1QOGA 4PK1A 5L83A 1P0RA 4OHJA 4WAAA 4KSKC 4DBGA 2FCSA 1L6UA 2OEDA 4RM8A 5G5HA 4C56C 4N6EB 3UINB 4FJZA 2NPTB 3PLVA 2JT4B 4EKUA 5EE0A 4EEWA 2C7HA 2MRPA 5FR6A 1YJIA 4ZRIA 2UWQA 1XD3B 4J6IA 1L0VB 3EGRA 1M94A 3NHEB 1QOBA 1G6JA 3DHGC 3ZNGC 4DXGA 2TSSA 2J0JA 4KGRA 2KMCA 3A1QA 4XDDA 2XEWA 1IGCA 3H7SA 3A4SC 2ZW1A 1UNSA 2AYOB 1MJDA 1JWBD 1NI3A 2KN5A 2H89B 2IO2B 2ON8A 3AEAB 1EU3A 3EA6A 1FFVA 1TY0A 2MCNB 4RGOS 2NPTA 2SAKA 1ZPSA 4ARCA 4DHZB 4REZA 2V3PA 3ZXVA 4KDIC 2D10A 4AQ7A 4LLGM 1MHHE 4UDUC 1C79A 3APFA 4OZAA 1TGZB 1WGHA 2YEPF 1A5RA 3L17A 5CX3A 3BVGA 1I7HA 2M1MA 3P4PB 5DPTA 3FC4A 3DBSA 1ESFA 1QKZA 1XLPA 2MP2B 3UIPB 4C00A 1YQ4B 2EKEC 4ZRPA 1YNTE 1QF6A 4RH6A 2V4IB 1RAXA 4W9HA 2DHZA 3Q3NC 1TBEA 1T0YA 4A55A 4MGYE 1B9RA 2AL3A 1FNUA 2JVCA 4M01A 3V62A 4N58A 2BB5A 5TR5A 2PTLA 1PGAA 4FHKA 1LO5D 2C7NB 3PS6A 4B6WA 1ZE3D 3RCZA 1SXTA 2DYBA 1TKYA 2BKRB 4ANUA 1V9JA 2KQ7A 1K51A 3U4EG 2KX3A 3DVGX 3B2GA 2CKHB 2PE6B 1YMHE 2K6DB 5LNK1 2JYEA 4BAXA 4C80A 1AARA 2ZZPB 1X1MA 5LXIB 2LGSA 5KHQA 2RR9A 3HUIA 4YXDB 4ASWC 4MJSA 1H4RA 2WXGA 1WH3A 2N4FA 3RUIB 2IY0B 4URKA 3AU5A 1WGYA 3T9LA 3PGEA 3ABVB 3C19A 4RF0A 2WXHA 5EE1A 3VFKA 4W9GA 2IPKD 2QIEB 4G0NB 2KDFB 5J18A 4MT5A 1FRDA 2BVCA 2V3SA 2LJIA 4EZLA 1GJZA 2HTME 4HKZE 2GBRA 4YWGG 3HHMA 1KLVA 2KTRA 3AE4B 4LNOA 4GDKB 2DAJA 3DBRB 4TQ1A 1AN8A 4YT0B 3V3XA 1ET6A 4JL9A 2VRRB 3EHVA 1EO6A 1CK1A 3DWMA 2YVCA 3IBEA 2MP2A 3SD5A 3HRDD 2IJ0A 2CS4A 2PE9A 2KQ4X 2VH1A 2XNAC 4FA6A 4ACFA 2K6QA 3BYYB 3RULA 3SU8X 2WXIA 3Q69A 3R7QA 1ZUD2 2NBUA 2QDFA 2Y5PA 4ZDVA 2WP9B 5MPOA 3Q3FA 3AEDB 2N1WA 3WAPA 3ZRFA 1DGJA 4PS8A 2WLBA 1A70A 2R61A 1F1HA 1JALA 4IWOA 1FXAA 2JRHA 2O6VD 2FAZA 5JHAA 3L10B 4NPNA 1WGKA 1P98A 4FBJB 2MBQA 2GBKA 3I5JC 1V80A 3N1ZC 2INDC 1F2RC 2KLCA 2JPHA 2L76A 2KHWB 1SEBD 2L00B 2AEHA 3ZDMC 3QX1A 4HXDA 2MX2A 2KMMA 4IM0A 3OG5A 3EFCA 2FUHB 2WXOA 3TL5A 1WGDA 4MDKE 2O6VA 1WM2A 3KWVA 2PIAA 1UF0A 2J0MA 2DNFA 3N32A 1KLUD 3PVLA 1UH6A 4IC7B 2D11A 1ENFA 4HRSA 4G11A 5AUKA 1OEYJ 1C4AA 2M4NA 2NVUI 4P1CC 1F52A 2L0TA 1SIJA 1AWDA 3SHQA 1MG4A 3LXFA 4FADA 3QAQA 1L2NA 3QA8A 1SGHA 4J3OD 3FKYA 2KT7A 2WQYB 5BMIA 2IBIB 3UF8A 2ZPYA 2CHWA 2LEKA 3HVDA 4WQOB 1XLOA 3TEWA 3TSSA 2L05A 1C9FA 2M56B 4NAMA 2KACA 2GOWA 3VRAB 3NS8A 1YJ1A 2WXJA 2O2VB 4M8NA 2LXAA 4TQ0A 5IOIA 3RT3B 3W5UB 4GXBA 1L7YA 3AE7B 4NAWA 1Q10A 3RFZB 1I42A 3BK1A 3OJ3A 2PMVA 4A9AA 1YX6B 3BIID 2KJ6A 1XT9B 3N1XC 2ZEQA 2KFJA 4BBNF 2MW5A 4IDIA 4YSYB 2DX5B 2INNE 3Q2AC 3TJPA 4FXCA 1STEA 2GBMA 1T0RC 1UWMA 2NTTA 4WURA 2RDBC 3ZLZA 4TMAB 4NAWB 4C4VB 1E5WA 4MH8A 5JZEB 3WAMA 1OGWA 1Q0WB 4N59A 3ZKJC 2HD5B 5G5GA 2BS4B 2REXA 4LDTD 1UBQA 1QT9A 3OWEB 4JE3B 2RSUA 3R2TA 5BYSA 1N5WA 2N9LA 2W54A 1E7VA 3HM6X 4IWPA 1Y56A 1EWCA 1NI2A 3R7RA 1BXTA 2QJLA 5FK9C 3HIZA 3AULA 3KLSX 2W82A 4PYZA 3PREA 4C4VA 1ET9A 3CMMB 2JUOA 1VRAB 4MGIE 4A20A 2SEBD 3VAWA 4W9JA 2IGHA 2B3AA 2AQ2B 4XWTA 3ZGZA 3U2SC 3KUDB 3AE8B 3PTFC 4ANXA 3DWGC 1MFWA 3V05A 5AEKB 4US8A 4E74A 3SR6A 4CQNA 1J0GA 5CHFA 4YSXB 3NOBA 3A9KA 2FCNA 2CJOA 2LJ5A 3RZFA 3ZO5B 1I4QA 1KF6B 3GZNB 4ITKA 1CQVA 3ZNZB 5TSSA 3ZVVA 1QQRA 1GNUA 2KWCA 2O6VB 4EZKA 3VDZA 2I1KA 1EF5A 3RNCC 4IUMB 3E9SA 4GMVA 2EKIA 5L95C 2LD9A 3AEEB 3H7PA 2FUG1 1JROA 3L4PA 2KFKB 4W9KA 2K8HA 4K7UA 1WGGA 2LXCA 1V8CA 2KDIA 4LJPB 3AH7A 3BY4B 3P4RB 3AI5A 3PHWB 1KJTA 1F9JA 1TS4A 2XBBC 4USAA 4IM2A 4W9FA 2G4DB 4GN1A 2Y5BB 1EU4A 3BZDB 5J2RA 5DCNA 1IPGA 1D5XC 3L13A 3VQIA 3A33B 1V97A 3I63C 1PFDA 4GLSC 2FCQA 1WR1A 4ICVA 1WXSA 1WMHA 2V4LA 4ZRKA 3ZJTA 1P9DU 4P7IA 3ZJVA 3SEBA 3BYTB 1HZ5A 3UQBA 3WALA 2PPHA 2C9WB 1KRHA 4NJ7A 2BYTA 2JF5A 1SE2A 1VZ7A 1SF0A 2JXTA 1XLQA 2L8JA 1WYWB 1E8ZA 1CMXB 3C0RB 1JRUA 2FIDA 4X57B 4OVVA 4W9EA 2QC8A 3TEYA 3DVNU 4II2B 2N7EA 1GB1A 2QILA 4HJGE 3RPFC 1B1ZA 2QSDA 4TSSA 3NZ3A 2WNMA 4XWWA 3QQ8B 1V5OA 1C76A 2N9XA 2HDEA 3LJ3A 2MJ3A 4E3CA 1FIQA 2G45B 4BBNC 4GB9A 2JQRB 1FM0D 2LUEA 2KOXA 2KKCA 4BZAA 1WX8A 2ZPNA 3IT4B 2G3QB 2DZMA 2KANA 1IYFA 1T5XD 1ZP0B 2WGSA 4WQMA 2K1FA 2NTSA 3A1QB 2WXFA 2L1AA 4TV3A 1IP9A 2M17A 5E6JA 2JY6A 2BT6A 3W5VB 2MBBB 3I9V1 3TBLD 1D6EC 4OW0A 2JWZA 4ZOHC 3URYA 2E6XA 3ZTCA 1VZ6A 2BWES 2G4SA 1Z2MA 2K3UA 3QCAA 5JXVA 2JYTA 3MFGA 1J8CA 3GE3C 2HJ1A 4I6PA 3UGBB 3RI7C 1L5PA 3FILA 4I6LB 4CHKA 2J52A 4JPSA 3M3JA 3NG0A 3AEBB 2D07B 4BOZB 4K3CA 2JWUA 4HJKA 1DOIA 2LGDA 3RYTA 1PDXA 1I4RA 3LDZE 3M95A 2R2OA 3AE6B 3QC8B 2LVOA 2ACZB 1KFYB 3KVFB 5BYRA 1QOAA 3MJ5A 3HVZA 4B0EA 4OZCA 2WS3B 3IAM1 2JZ3B 3PRPB 3VUXA 2BB6A 1MHXA 3U8ZA 4XX5A 4DXFA 2HJ8A 1NVID 2MJDA 4RM9A 3X23A 5H92C 4HDQA 2ICIA 3DHHC 2L52A 3TEZA 2KVZA 5D2MB 4RCOA 2EMTA 2RDGA 3RNBC 4W9DA 4YSZB 1LFDA 1WWTA 2KWVB 4AP4C 2PW9A 2K9XA 1K8RB 1C4CA 1YIWA 4NQLB 4LK0M 1UWXA 1V2YA 4YTNB 3VXWA 1R4NB 2OHFA 4DXAB 4L1BA 2KNBA 3CSTA 3KUCB 2YEPB 2WXLA 4BKTA 1UUPA 4F7ZA 5GMVA 1FRRA 1ROEA 4BKSD 4FN2A 3QHTA 2MEKA 1MPEA 1TZOA 1SSNA 3B2FA 4FHJA 4KGTA 3I3TB 1V86A 4LCDE 3UIOB 3NZUA 1L4ZB 2KC1A 2EMSA 4L23A 2WHIA 1Z5SB 1GPXA 2INPE 4JGHB 5HI1A 4GDKA 4TKNA 3T8MA 5HFYA 4R3DA 4HPPA 3ALBA 1PQSA 2GI9A 1FXIA 1XLNA 4IWQA 2OJRA 3P63A 2LGXA 4RGNA 3Q3OC 5KHOA 4DHJD 4DDID 2DAFA 4GDLA 3DPDA 3PRMB 1HA5A 1SBBB 4WIPA 3L54A 4HROA 5D3IB 4HKQA 2GBJA 1R7SA 2Z59B 3OLMD 3RZWC 2OOBB 5J17A 2MH7A 3W1SC 1TIFA 2JU6X 1E0ZA 5IN7A 3RNGC 1DYQA 2D3AA 1KTKA 1BMLC 3ZRCA 4FLHA 1JMLA 4NZLB 3R3MA 3AE1B 3JSVB 4XC2A 2D5GA 4XZ4A 1V1PB 2W55A 2GMIC 1EM7A
chains in the Genus database with same CATH topology
4IW0A 4GOCA 4KDLB 4GDLB 5HKHA 2N9PC 1GC7A 1H8CA 2DZKA 2IY1B 3DBLI 3D32A 1E7VA 1ZKHA 5D7GA 3HM6X 1WJNA 4IWPA 3AU4A 3WIMA 3N30A 3VUWA 1NI2A 3R7RA 1SE9A 3V61A 4MEMA 2RGFA 3AULA 3HIZA 1GG3A 4PYZA 2I1JA 3PREA 3DDCB 3CMMB 2JUOA 4LDTB 5L83A 1P0RA 4MGIE 4WAAA 4A20A 4KSKC 4KZCA 1LM8B 4DBGA 3VAWA 4W9JA 4GSWA 1WI0A 2FCSA 2HTHA 2ZJDA 2B3AA 1U4AA 1V5TA 4RM8A 3KUDB 3UINB 4G3XB 3PTFC 4ANXA 4FJZA 3S2AA 3VHTC 3GZNI 2NPTB 3PLVA 2AL6A 1E8XA 5AEKB 2JT4B 4EKUA 4EEWA 2C7HA 2MRPA 4E74A 4HVBA 4HCPB 5FR6A 3M63B 4AJYB 4ZRIA 2IO1B 2UWQA 1XD3B 4J6IA 1J0GA 5CHFA 3NOBA 1M94A 2WX1A 3NHEB 3A9KA 4MH0E 3MJWA 3P2BA 2LASA 3KYDD 3Q3JA 2FCNA 1G6JA 1ISNA 2QHOA 4G50A 3B08A 3ZNGC 1LXDA 2J0JA 1WZ3A 2KX0A 1YX5B 2LJ5A 3VH3B 2KMCA 3A1QA 3RZFA 3ZO5B 2ZCBA 1WGRA 2KQSA 2L7RA 3VVWB 2C7MB 3TIXA 2XEWA 2D2QA 1RFAA 2JRIB 4LJOB 3H7SA 3A4SC 5C1ZA 3ZNZB 3ZVVA 2AYOB 3DCGA 1GNUA 3PRZA 2KN5A 2KWCA 2O6VB 4EOYA 1P1AA 4EZKA 2ZNVC 3VDZA 2I1KA 1EF5A 3ECIA 2IO2B 4IUMB 3H1UA 2KJHB 4GMVA 3DVNV 3PSEB 3HK0A 5LLIA 4WWOA 2NPTA 2LD9A 2MCNB 5L95C 2O2VA 4DHZB 1EUVB 2MQJA 2J0KA 2MWSB 2IZVB 3H7PA 3KYCD 4KDIC 3IG3A 4CO7A 2KK8A 2KFKB 2D10A 4W9KA 2K8HA 3KW5B 4K7UA 1WGGA 2LXCA 1QZEA 2KDIA 1SIFA 4LJPB 3APFA 4B95A 1WF9A 4F1SA 1TGZB 3BY4B 1YD8U 3AI5A 3MHSD 3PHWB 1KJTA 1F9JA 2XBBC 4IM2A 1WGHA 4W9FA 1A5RA 1LQBA 2G4DB 1WX7A 3L17A 5CX3A 4GN1A 4PS3A 2NR2A 2LRUA 2M1MA 2Y5BB 2KXJA 3H6NA 5J2RA 5DPTA 5DCNA 1IPGA 3DBSA 2MBOA 3L13A 1WJUA 3VQIA 2MP2B 3A33B 3UIPB 1OTRB 4B9KA 5D6JB 2FCQA 3DBHI 1Q1OA 2EKEC 3A4RA 1WR1A 4ICVA 4WJOA 1WFYA 3WA0A 4BVUC 1WXSA 1WMHA 2V4LA 4MSQB 4K7WA 4ZRKA 1RAXA 4W9HA 3OJ4B 1P9DU 2DHZA 4P7IA 4BOSC 3H7PB 1TBEA 2LRWA 2FNJB 3VUYA 1T0YA 4ANWA 1UELA 3UQBA 4MGYE 1C1YB 3WALA 4MGKE 2AL3A 2PPHA 2JVCA 3HM3A 3V62A 1S1QB 2C9WB 4IM3A 4NJ7A 5TR5A 2GBNA 2JF5A 1V49A 3UQAA 4FHKA 3PLUA 2C7NB 3PS6A 5D94A 4CYEA 2L8JA 4B6WA 1WYWB 2D3GA 1E8ZA 3RCZA 1WRDB 4MGZE 2DYBA 1CMXB 4NNJB 3U7DA 3C0RB 5IAAC 2BKRB 2C60A 5E6PA 3ZW3A 4ANUA 1V9JA 4K1RB 1JRUA 2FIDA 2MLBA 3PHXB 2KQ7A 3IVFA 4HCNB 4X57B 3WANA 2MBHA 4OVVA 2KX3A 4W9EA 3DVGX 4GIVA 4K81A 2CKHB 2PE6B 3APCA 3DVNU 2K6DB 4II2B 2N7EA 2Z0EB 2N9EB 4ZRJA 5AZHA 3VH4B 1NBFC 3K9OB 2IO3B 4FJYA 3ZDTA 3QIJA 4WJPA 1UGMA 1AARA 2ZZPB 1X1MA 5LXIB 4ANVA 2JZZA 1WE7A 3QQ8B 4AUQC 5KHQA 1V5OA 2N9XA 2RR9A 2KJRA 4MELA 3LJ3A 4BFRA 1UZXB 3DQVA 3APDA 4ASWC 1MG8A 4JIOU 2DZIA 4E3CA 2G45B 4MJSA 1H4RA 2BF8B 1ZGUB 1WH3A 2N4FA 1UD7A 1VD2A 2IY0B 4GB9A 3RUIB 4BBNC 3QARA 2CR5A 4URKA 1ZW7A 3AU5A 3PZDA 1WGYA 1Y8RC 2LUEA 2KOXA 2KKCA 2ZVNA 3T9LA 1WX8A 2ZPNA 3PGEA 4AJWA 1V6EA 5E6OA 2KO3A 2G3QB 2DZMA 2KANA 3L16A 3VFKA 4W9GA 1IYFA 4A3PA 3ZTDA 2MSED 2UYZB 1FXTB 1E90A 4KV2A 5LXHA 2K1FA 4M0WB 4G0NB 4A3OA 2KDFB 5J18A 3DVGY 2ASQA 3W1YA 3A1QB 2V3SA 4HK2A 1IP9A 4TV3A 4EZLA 2M17A 4W9CA 1GJZA 1D3ZA 2GBRA 2JY6A 3HHMA 1KLVA 2KTRA 1NDDA 4HPMB 5CTRC 3WAOA 4GDKB 2DAJA 2MBBB 3TBLD 2NBVB 4TQ1A 4MJSB 4JL9A 1I35A 2VRRB 3EHVA 2JWZA 1EO6A 3JSVA 1E8YA 4MM3A 3NY5A 3ZTCA 2YVCA 3EFUA 3IBEA 3ZIMA 2MP2A 3VTVA 2BWES 2G4SA 3VTWA 1Z2MA 2KTFA 3QCAA 3SD5A 2YLMA 4KZ0A 2JXXA 1J8CA 4WWNA 2CS4A 2PE9A 3ZNID 4FA6A 4I6PA 2BKFA 2K6QA 3UGBB 3V6CB 2LWPA 4DDGD 4I6LB 2N7DA 4PS7A 3V60A 1HE8A 3RULA 2BGFA 3SU8X 2AWTA 4HLEA 4CHKA 5CHVC 3K9PB 1RLFA 3M3JA 2RPQA 2D07B 4BOZB 3R7QA 4BKSA 1WM3A 2NBUA 4HJKA 4ZDVA 3IHPC 3PV1A 2V1YA 1E8WA 4FJVB 3PT2B 3Q3FA 2BPSA 2N1WA 4W9LA 2LGDA 3WAPA 1XQQA 3ZRFA 3RYTA 2K39A 4PS8A 3LDZE 3M95A 2R2OA 4K7SA 1WX9A 2J7QB 3QC8B 2CU1A 2LVOA 3ZNHB 1WXVA 4EZJA 3KVFB 4AOFA 2KVRA 3GOEA 4IWOA 3RD2A 2K25A 3JW0X 2JRHA 2O6VD 2FAZA 4F8CB 5JHAA 3L10B 2JZ3B 5AZGA 4NPNA 1Q5WB 2LVPA 3B1LX 2LI5A 1P98A 4FBJB 2MBQA 3ONSA 3PRPB 2GBKA 3VUXA 1V80A 3U8ZA 4YL8A 5C23A 4II3B 2KFKA 3H9DA 4XX5A 3JVZX 2KLCA 2JPHA 2L76A 2KHWB 4ZYNA 2PEAA 3MTNB 2BWFA 2L00B 2AEHA 2HJ8A 3ZDMC 2L3ZA 3QX1A 4HXDA 2DZJA 3L0WB 2MX2A 2RD0A 2DENB 4IM0A 4RM9A 5DPRA 2WYQA 2FUHB 4JQWC 5CHWA 2DYOA 2K8BA 2FCMA 1WGDA 4MDKE 2O6VA 4HDQA 4IG7B 3TL5A 1WM2A 3L08A 2K8CA 3A9JA 1UBIA 5D2MB 1R4MI 2J0MA 3N32A 3PVLA 2EMTA 4NQKE 4W9DA 1LFDA 1RRBA 1UH6A 4IC7B 5EDSA 4WJQA 2D11A 2KWVB 4HPLB 4G11A 4AP4C 2N1VA 1K8RB 1OEYJ 1YIWA 4NQLB 4RMAA 1V2YA 1WMHB 4W9IA 2M4NA 2KC2A 2NVUI 2FIFA 2LZ6A 3O65B 3VXWA 2C5LC 1TZ1A 4DXAB 2L0TA 1WE6A 3QWZB 2L0FA 3DOWA 3SHQA 3ZUNA 1E7UA 1P3QU 2KNBA 4FADA 3QAQA 3N3KB 3CSTA 1L2NA 3KUCB 3TCAA 3X0WA 3ENEA 3A9KB 1SGHA 2PJHA 2KMAA 3QA8A 4BKTA 4EUTA 1GC6A 3AXCA 4F7ZA 3EC8A 5GMVA 2IBIB 2A4ZA 2KTRB 3UF8A 3X23A 2ZPYA 2CHWA 4N9F4 4BKSD 4WQOB 1WXAA 1GUAB 2LGYA 4FN2A 4NY0A 3QHTA 2LVQA 5G55A 1EF1A 4AWJA 1WIAA 2KLGA 2L05A 2ZCCA 2WDTB 4BKGA 4FHJA 1KM7A 2KDEB 2XK5A 1TTNA 2GOWA 3I3TB 2DYMA 3ML9A 3NS8A 2ZVOA 2KD0A 2NCNA 1V86A 5AZFA 1R4NI 4PYUA 2W9NA 4LCDE 1YJ1A 3U30A 4EFOA 3UIOB 3NZUA 2O2VB 2MBEA 2KC1A 1YQBA 2EMSA 4M8NA 3R66C 2BYFA 5DPSA 2LXAA 3V6EB 1Z5SB 4TQ0A 2MA9B 4JGHB 3RT3B 3VTUA 4GDKA 5E6NA 3JYUA 4TKNA 2M0XA 3B0AA 4KSLC 5IA7A 3QK0A 4GXBA 1L7YA 2KWUB 3T8MA 2Z0DB 4NAWA 3W1SA 2IYDB 2BYEA 4KIKA 1WR6E 3TMPB 3ALBA 4M8MA 3KUZA 1PQSA 4TUUA 1I42A 5JH5C 4WWPA 3OJ3A 3ML8A 3CSFA 1OEYA 4DK5A 4IWQA 2CHXA 2OJRA 1WZ0A 1YX6B 3EECA 2KJ6A 2LGXA 4HDOA 4E71A 1XT9B 3SDLC 2BYVE 3CF6E 5KHOA 3DBRI 2ZEQA 4ICUA 2KFJA 4JLCA 4HWIB 4DHJD 1KOTA 3QJZA 4NJ6A 4BBNF 4I6NB 4DWFA 2MW5A 2XK5B 4DDID 2DAFA 3KH0A 5JHBA 4GDLA 2DX5B 2KZRA 4DHZE 3DPDA 3PRMB 1WY8A 2ZNVB 4MSMB 3TJPA 1VCBA 1WXMA 2GBMA 3L54A 1WJ4A 2KDBA 4GGQA 2GBJA 2Z59B 3OLMD 3RZWC 3M62B 2OOBB 1OQYA 3IFWB 4WJNA 2HE7A 4GU2A 5J17A 3W1SC 3ZLZA 4OVUA 4NAWB 1S3SG 2NS5A 4KIKB 3NZSA 1BT0A 1E5WA 5BO4B 5JZEB 1C3TA 2WWZA 2IO0B 3OAWA 3WAMA 1WJ6A 5G2NA 3BINA 3ZRCA 4FLHA 1OGWA 1Q0WB 1V81A 2WX0A 4FULA 3A9JB 3ZKJC 2HD5B 2REXA 4LDTD 1UBQA 2R2QA 4KVGB 1J19A 3R3MA 4DHJB 3JSVB 4XC2A 4XZ4A 5DPWA 2CHZA 3PPAA 2NBWB 2A5UA 2GMIC 2RSUA 2M8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IW0 A;  4GOC A;  4KDL B;  4GDL B;  5HKH A;  2N9P C;  1GC7 A;  1H8C A;  2DZK A;  2IY1 B;  3DBL I;  3D32 A;  1E7V A;  1ZKH A;  5D7G A;  3HM6 X;  1WJN A;  4IWP A;  3AU4 A;  3WIM A;  3N30 A;  3VUW A;  1NI2 A;  3R7R A;  1SE9 A;  3V61 A;  4MEM A;  2RGF A;  3AUL A;  3HIZ A;  1GG3 A;  4PYZ A;  2I1J A;  3PRE A;  3DDC B;  3CMM B;  2JUO A;  4LDT B;  5L83 A;  1P0R A;  4MGI E;  4WAA A;  4A20 A;  4KSK C;  4KZC A;  1LM8 B;  4DBG A;  3VAW A;  4W9J A;  4GSW A;  1WI0 A;  2FCS A;  2HTH A;  2ZJD A;  2B3A A;  1U4A A;  1V5T A;  4RM8 A;  3KUD B;  3UIN B;  4G3X B;  3PTF C;  4ANX A;  4FJZ A;  3S2A A;  3VHT C;  3GZN I;  2NPT B;  3PLV A;  2AL6 A;  1E8X A;  5AEK B;  2JT4 B;  4EKU A;  4EEW A;  2C7H A;  2MRP A;  4E74 A;  4HVB A;  4HCP B;  5FR6 A;  3M63 B;  4AJY B;  4ZRI A;  2IO1 B;  2UWQ A;  1XD3 B;  4J6I A;  1J0G A;  5CHF A;  3NOB A;  1M94 A;  2WX1 A;  3NHE B;  3A9K A;  4MH0 E;  3MJW A;  3P2B A;  2LAS A;  3KYD D;  3Q3J A;  2FCN A;  1G6J A;  1ISN A;  2QHO A;  4G50 A;  3B08 A;  3ZNG C;  1LXD A;  2J0J A;  1WZ3 A;  2KX0 A;  1YX5 B;  2LJ5 A;  3VH3 B;  2KMC A;  3A1Q A;  3RZF A;  3ZO5 B;  2ZCB A;  1WGR A;  2KQS A;  2L7R A;  3VVW B;  2C7M B;  3TIX A;  2XEW A;  2D2Q A;  1RFA A;  2JRI B;  4LJO B;  3H7S A;  3A4S C;  5C1Z A;  3ZNZ B;  3ZVV A;  2AYO B;  3DCG A;  1GNU A;  3PRZ A;  2KN5 A;  2KWC A;  2O6V B;  4EOY A;  1P1A A;  4EZK A;  2ZNV C;  3VDZ A;  2I1K A;  1EF5 A;  3ECI A;  2IO2 B;  4IUM B;  3H1U A;  2KJH B;  4GMV A;  3DVN V;  3PSE B;  3HK0 A;  5LLI A;  4WWO A;  2NPT A;  2LD9 A;  2MCN B;  5L95 C;  2O2V A;  4DHZ B;  1EUV B;  2MQJ A;  2J0K A;  2MWS B;  2IZV B;  3H7P A;  3KYC D;  4KDI C;  3IG3 A;  4CO7 A;  2KK8 A;  2KFK B;  2D10 A;  4W9K A;  2K8H A;  3KW5 B;  4K7U A;  1WGG A;  2LXC A;  1QZE A;  2KDI A;  1SIF A;  4LJP B;  3APF A;  4B95 A;  1WF9 A;  4F1S A;  1TGZ B;  3BY4 B;  1YD8 U;  3AI5 A;  3MHS D;  3PHW B;  1KJT A;  1F9J A;  2XBB C;  4IM2 A;  1WGH A;  4W9F A;  1A5R A;  1LQB A;  2G4D B;  1WX7 A;  3L17 A;  5CX3 A;  4GN1 A;  4PS3 A;  2NR2 A;  2LRU A;  2M1M A;  2Y5B B;  2KXJ A;  3H6N A;  5J2R A;  5DPT A;  5DCN A;  1IPG A;  3DBS A;  2MBO A;  3L13 A;  1WJU A;  3VQI A;  2MP2 B;  3A33 B;  3UIP B;  1OTR B;  4B9K A;  5D6J B;  2FCQ A;  3DBH I;  1Q1O A;  2EKE C;  3A4R A;  1WR1 A;  4ICV A;  4WJO A;  1WFY A;  3WA0 A;  4BVU C;  1WXS A;  1WMH A;  2V4L A;  4MSQ B;  4K7W A;  4ZRK A;  1RAX A;  4W9H A;  3OJ4 B;  1P9D U;  2DHZ A;  4P7I A;  4BOS C;  3H7P B;  1TBE A;  2LRW A;  2FNJ B;  3VUY A;  1T0Y A;  4ANW A;  1UEL A;  3UQB A;  4MGY E;  1C1Y B;  3WAL A;  4MGK E;  2AL3 A;  2PPH A;  2JVC A;  3HM3 A;  3V62 A;  1S1Q B;  2C9W B;  4IM3 A;  4NJ7 A;  5TR5 A;  2GBN A;  2JF5 A;  1V49 A;  3UQA A;  4FHK A;  3PLU A;  2C7N B;  3PS6 A;  5D94 A;  4CYE A;  2L8J A;  4B6W A;  1WYW B;  2D3G A;  1E8Z A;  3RCZ A;  1WRD B;  4MGZ E;  2DYB A;  1CMX B;  4NNJ B;  3U7D A;  3C0R B;  5IAA C;  2BKR B;  2C60 A;  5E6P A;  3ZW3 A;  4ANU A;  1V9J A;  4K1R B;  1JRU A;  2FID A;  2MLB A;  3PHX B;  2KQ7 A;  3IVF A;  4HCN B;  4X57 B;  3WAN A;  2MBH A;  4OVV A;  2KX3 A;  4W9E A;  3DVG X;  4GIV A;  4K81 A;  2CKH B;  2PE6 B;  3APC A;  3DVN U;  2K6D B;  4II2 B;  2N7E A;  2Z0E B;  2N9E B;  4ZRJ A;  5AZH A;  3VH4 B;  1NBF C;  3K9O B;  2IO3 B;  4FJY A;  3ZDT A;  3QIJ A;  4WJP A;  1UGM A;  1AAR A;  2ZZP B;  1X1M A;  5LXI B;  4ANV A;  2JZZ A;  1WE7 A;  3QQ8 B;  4AUQ C;  5KHQ A;  1V5O A;  2N9X A;  2RR9 A;  2KJR A;  4MEL A;  3LJ3 A;  4BFR A;  1UZX B;  3DQV A;  3APD A;  4ASW C;  1MG8 A;  4JIO U;  2DZI A;  4E3C A;  2G45 B;  4MJS A;  1H4R A;  2BF8 B;  1ZGU B;  1WH3 A;  2N4F A;  1UD7 A;  1VD2 A;  2IY0 B;  4GB9 A;  3RUI B;  4BBN C;  3QAR A;  2CR5 A;  4URK A;  1ZW7 A;  3AU5 A;  3PZD A;  1WGY A;  1Y8R C;  2LUE A;  2KOX A;  2KKC A;  2ZVN A;  3T9L A;  1WX8 A;  2ZPN A;  3PGE A;  4AJW A;  1V6E A;  5E6O A;  2KO3 A;  2G3Q B;  2DZM A;  2KAN A;  3L16 A;  3VFK A;  4W9G A;  1IYF A;  4A3P A;  3ZTD A;  2MSE D;  2UYZ B;  1FXT B;  1E90 A;  4KV2 A;  5LXH A;  2K1F A;  4M0W B;  4G0N B;  4A3O A;  2KDF B;  5J18 A;  3DVG Y;  2ASQ A;  3W1Y A;  3A1Q B;  2V3S A;  4HK2 A;  1IP9 A;  4TV3 A;  4EZL A;  2M17 A;  4W9C A;  1GJZ A;  1D3Z A;  2GBR A;  2JY6 A;  3HHM A;  1KLV A;  2KTR A;  1NDD A;  4HPM B;  5CTR C;  3WAO A;  4GDK B;  2DAJ A;  2MBB B;  3TBL D;  2NBV B;  4TQ1 A;  4MJS B;  4JL9 A;  1I35 A;  2VRR B;  3EHV A;  2JWZ A;  1EO6 A;  3JSV A;  1E8Y A;  4MM3 A;  3NY5 A;  3ZTC A;  2YVC A;  3EFU A;  3IBE A;  3ZIM A;  2MP2 A;  3VTV A;  2BWE S;  2G4S A;  3VTW A;  1Z2M A;  2KTF A;  3QCA A;  3SD5 A;  2YLM A;  4KZ0 A;  2JXX A;  1J8C A;  4WWN A;  2CS4 A;  2PE9 A;  3ZNI D;  4FA6 A;  4I6P A;  2BKF A;  2K6Q A;  3UGB B;  3V6C B;  2LWP A;  4DDG D;  4I6L B;  2N7D A;  4PS7 A;  3V60 A;  1HE8 A;  3RUL A;  2BGF A;  3SU8 X;  2AWT A;  4HLE A;  4CHK A;  5CHV C;  3K9P B;  1RLF A;  3M3J A;  2RPQ A;  2D07 B;  4BOZ B;  3R7Q A;  4BKS A;  1WM3 A;  2NBU A;  4HJK A;  4ZDV A;  3IHP C;  3PV1 A;  2V1Y A;  1E8W A;  4FJV B;  3PT2 B;  3Q3F A;  2BPS A;  2N1W A;  4W9L A;  2LGD A;  3WAP A;  1XQQ A;  3ZRF A;  3RYT A;  2K39 A;  4PS8 A;  3LDZ E;  3M95 A;  2R2O A;  4K7S A;  1WX9 A;  2J7Q B;  3QC8 B;  2CU1 A;  2LVO A;  3ZNH B;  1WXV A;  4EZJ A;  3KVF B;  4AOF A;  2KVR A;  3GOE A;  4IWO A;  3RD2 A;  2K25 A;  3JW0 X;  2JRH A;  2O6V D;  2FAZ A;  4F8C B;  5JHA A;  3L10 B;  2JZ3 B;  5AZG A;  4NPN A;  1Q5W B;  2LVP A;  3B1L X;  2LI5 A;  1P98 A;  4FBJ B;  2MBQ A;  3ONS A;  3PRP B;  2GBK A;  3VUX A;  1V80 A;  3U8Z A;  4YL8 A;  5C23 A;  4II3 B;  2KFK A;  3H9D A;  4XX5 A;  3JVZ X;  2KLC A;  2JPH A;  2L76 A;  2KHW B;  4ZYN A;  2PEA A;  3MTN B;  2BWF A;  2L00 B;  2AEH A;  2HJ8 A;  3ZDM C;  2L3Z A;  3QX1 A;  4HXD A;  2DZJ A;  3L0W B;  2MX2 A;  2RD0 A;  2DEN B;  4IM0 A;  4RM9 A;  5DPR A;  2WYQ A;  2FUH B;  4JQW C;  5CHW A;  2DYO A;  2K8B A;  2FCM A;  1WGD A;  4MDK E;  2O6V A;  4HDQ A;  4IG7 B;  3TL5 A;  1WM2 A;  3L08 A;  2K8C A;  3A9J A;  1UBI A;  5D2M B;  1R4M I;  2J0M A;  3N32 A;  3PVL A;  2EMT A;  4NQK E;  4W9D A;  1LFD A;  1RRB A;  1UH6 A;  4IC7 B;  5EDS A;  4WJQ A;  2D11 A;  2KWV B;  4HPL B;  4G11 A;  4AP4 C;  2N1V A;  1K8R B;  1OEY J;  1YIW A;  4NQL B;  4RMA A;  1V2Y A;  1WMH B;  4W9I A;  2M4N A;  2KC2 A;  2NVU I;  2FIF A;  2LZ6 A;  3O65 B;  3VXW A;  2C5L C;  1TZ1 A;  4DXA B;  2L0T A;  1WE6 A;  3QWZ B;  2L0F A;  3DOW A;  3SHQ A;  3ZUN A;  1E7U A;  1P3Q U;  2KNB A;  4FAD A;  3QAQ A;  3N3K B;  3CST A;  1L2N A;  3KUC B;  3TCA A;  3X0W A;  3ENE A;  3A9K B;  1SGH A;  2PJH A;  2KMA A;  3QA8 A;  4BKT A;  4EUT A;  1GC6 A;  3AXC A;  4F7Z A;  3EC8 A;  5GMV A;  2IBI B;  2A4Z A;  2KTR B;  3UF8 A;  3X23 A;  2ZPY A;  2CHW A;  4N9F 4;  4BKS D;  4WQO B;  1WXA A;  1GUA B;  2LGY A;  4FN2 A;  4NY0 A;  3QHT A;  2LVQ A;  5G55 A;  1EF1 A;  4AWJ A;  1WIA A;  2KLG A;  2L05 A;  2ZCC A;  2WDT B;  4BKG A;  4FHJ A;  1KM7 A;  2KDE B;  2XK5 A;  1TTN A;  2GOW A;  3I3T B;  2DYM A;  3ML9 A;  3NS8 A;  2ZVO A;  2KD0 A;  2NCN A;  1V86 A;  5AZF A;  1R4N I;  4PYU A;  2W9N A;  4LCD E;  1YJ1 A;  3U30 A;  4EFO A;  3UIO B;  3NZU A;  2O2V B;  2MBE A;  2KC1 A;  1YQB A;  2EMS A;  4M8N A;  3R66 C;  2BYF A;  5DPS A;  2LXA A;  3V6E B;  1Z5S B;  4TQ0 A;  2MA9 B;  4JGH B;  3RT3 B;  3VTU A;  4GDK A;  5E6N A;  3JYU A;  4TKN A;  2M0X A;  3B0A A;  4KSL C;  5IA7 A;  3QK0 A;  4GXB A;  1L7Y A;  2KWU B;  3T8M A;  2Z0D B;  4NAW A;  3W1S A;  2IYD B;  2BYE A;  4KIK A;  1WR6 E;  3TMP B;  3ALB A;  4M8M A;  3KUZ A;  1PQS A;  4TUU A;  1I42 A;  5JH5 C;  4WWP A;  3OJ3 A;  3ML8 A;  3CSF A;  1OEY A;  4DK5 A;  4IWQ A;  2CHX A;  2OJR A;  1WZ0 A;  1YX6 B;  3EEC A;  2KJ6 A;  2LGX A;  4HDO A;  4E71 A;  1XT9 B;  3SDL C;  2BYV E;  3CF6 E;  5KHO A;  3DBR I;  2ZEQ A;  4ICU A;  2KFJ A;  4JLC A;  4HWI B;  4DHJ D;  1KOT A;  3QJZ A;  4NJ6 A;  4BBN F;  4I6N B;  4DWF A;  2MW5 A;  2XK5 B;  4DDI D;  2DAF A;  3KH0 A;  5JHB A;  4GDL A;  2DX5 B;  2KZR A;  4DHZ E;  3DPD A;  3PRM B;  1WY8 A;  2ZNV B;  4MSM B;  3TJP A;  1VCB A;  1WXM A;  2GBM A;  3L54 A;  1WJ4 A;  2KDB A;  4GGQ A;  2GBJ A;  2Z59 B;  3OLM D;  3RZW C;  3M62 B;  2OOB B;  1OQY A;  3IFW B;  4WJN A;  2HE7 A;  4GU2 A;  5J17 A;  3W1S C;  3ZLZ A;  4OVU A;  4NAW B;  1S3S G;  2NS5 A;  4KIK B;  3NZS A;  1BT0 A;  1E5W A;  5BO4 B;  5JZE B;  1C3T A;  2WWZ A;  2IO0 B;  3OAW A;  3WAM A;  1WJ6 A;  5G2N A;  3BIN A;  3ZRC A;  4FLH A;  1OGW A;  1Q0W B;  1V81 A;  2WX0 A;  4FUL A;  3A9J B;  3ZKJ C;  2HD5 B;  2REX A;  4LDT D;  1UBQ A;  2R2Q A;  4KVG B;  1J19 A;  3R3M A;  4DHJ B;  3JSV B;  4XC2 A;  4XZ4 A;  5DPW A;  2CHZ A;  3PPA A;  2NBW B;  2A5U A;  2GMI C;  2RSU A;  2M8S A; 
#chains in the Genus database with same CATH topology
 4GOC A;  5HKH A;  1H8C A;  3VR9 B;  3D32 A;  1HQR D;  1HTQ A;  3O13 A;  4L2Y A;  5D3D A;  1JWA D;  3AU4 A;  3VUW A;  1PUT A;  3N9Y C;  4MEM A;  2KN4 A;  2IGG A;  2K22 A;  4LDT B;  1LM8 B;  1L0X B;  4GSW A;  2ZJD A;  1U4A A;  1YN3 A;  3DBL B;  2Q5W D;  3S2A A;  3VHT C;  3GZN I;  2AL6 A;  3ZYY X;  2KDM A;  4HVB A;  2WXN A;  2FBW B;  3M63 B;  2QCZ A;  4AJY B;  4YTM B;  2IO1 B;  1XCT L;  2EEL A;  4MH0 E;  3MJW A;  3Q3J A;  1ISN A;  1QLB B;  2WXQ A;  3RNE C;  3VH3 B;  4ZRQ A;  2ZCB A;  3VVW B;  2L7R A;  2C7M B;  5C3J B;  3Q8B A;  1RFA A;  3P1M A;  3PRZ A;  4EOY A;  1P1A A;  3ECI A;  3MC0 B;  2KJH B;  4YTP B;  5LLI A;  4WWO A;  1SE4 A;  2O2V A;  2MQJ A;  2J0K A;  2MWS B;  2IZV B;  3KYC D;  3AM9 A;  4CO7 A;  2KK8 A;  3KW5 B;  1UGJ A;  2L83 A;  1QZE A;  4B95 A;  4F1S A;  1WF9 A;  5FR3 A;  1WRI A;  3BVZ A;  3H6N A;  2NR2 A;  1P7F A;  1FEH A;  2MBO A;  1WJU A;  1OTR B;  4B9K A;  3DBH I;  1Q1O A;  1NYQ A;  4BVU C;  4K7W A;  1RFK A;  3VUY A;  1UEL A;  4MGK E;  2RPV A;  3HM3 A;  3Q14 C;  4IM3 A;  1V49 A;  3UQA A;  2V9H A;  4RNA A;  1JRP A;  1PGX A;  1WRD B;  4MGZ E;  3FAH A;  3U7D A;  1RYJ A;  1OQR A;  2MJE A;  4US9 A;  2BW2 A;  5E6P A;  3ZW3 A;  4K1R B;  2MLB A;  2WU2 B;  3PHX B;  3BWU D;  2OJW A;  1TJE A;  4K81 A;  3APC A;  2Z0E B;  3VH4 B;  3P4Q B;  1NBF C;  4P1B C;  3K9O B;  2I38 A;  4M0W A;  1VDV A;  3Q8E A;  1E7P B;  2JZZ A;  1WE7 A;  1TKG A;  4AUQ C;  2ZW0 A;  1AW7 A;  3NUH B;  2KJR A;  4MEL A;  4XGA B;  5GXG B;  2UU7 A;  3U52 E;  1NEK B;  1ZGU B;  4ZYS A;  3RN9 C;  1D5Z C;  3QAR A;  2CR5 A;  1ZDX A;  3PZD A;  1Y8R C;  2ZVN A;  4AJW A;  5E6O A;  1YJJ A;  2KO3 A;  2Z8L A;  3L16 A;  4JWS C;  4A3P A;  3ZTD A;  1E90 A;  3GP7 A;  4KV2 A;  4ZHO A;  3NVW A;  4M0W B;  2Y3A A;  4WWM A;  4A3O A;  5IKC M;  3DVG Y;  2BTE A;  3W1Y A;  5IO9 A;  1FMA D;  4HK2 A;  1FCL A;  4W9C A;  1D3Z A;  3Q8C A;  5HG2 A;  4OVZ A;  1NDD A;  4HPM B;  3WAO A;  2G9H D;  1C78 A;  4DQO C;  4MJS B;  1I35 A;  3BVM A;  2VZK B;  4MM3 A;  3ZIM A;  3VTV A;  4S17 A;  3VTW A;  2KTF A;  4H2A A;  3NVV A;  2YLM A;  4KZ0 A;  2JXX A;  2PKO A;  3ZNI D;  3AE2 B;  2BS3 B;  2LWP A;  2AQ1 B;  2B76 B;  2PVG C;  4DDG D;  2IDY A;  4PS7 A;  1HE8 A;  2BGF A;  4S0R A;  1FO4 A;  3MHZ A;  1RLF A;  1CJE A;  2RPQ A;  4BKS A;  4XDC A;  3H8H A;  3AV8 A;  3IHP C;  2WXM A;  2LGI A;  2V1Y A;  4FJV B;  1XQQ A;  1QIL A;  2J7Q B;  3ZNH B;  4EZJ A;  5T8I A;  2KVR A;  3AN1 A;  3RD2 A;  3GS2 A;  2K25 A;  3JW0 X;  5AZG A;  5BMG A;  4XYC A;  3AE5 B;  1VR9 A;  2LVP A;  3B1L X;  3VRB B;  2BBC A;  5BMH A;  1V1P A;  4ZHP A;  3N1Y C;  1K52 A;  2X8X X;  4ZYN A;  1N5X A;  3N20 C;  3CWI A;  1T3Q A;  2L3Z A;  2J42 A;  2RD0 A;  2DEN B;  2WYQ A;  2QEJ C;  2DYO A;  2K8B A;  2FCM A;  2WDQ B;  3L08 A;  2K8C A;  1UBI A;  1R4M I;  3NJT A;  4NQK E;  3EUB 2;  4XE0 A;  1JWU D;  1L4D B;  4C7Z A;  1OFF A;  2RMM A;  1M4V A;  3O65 B;  2KC2 A;  2LZ6 A;  3AE9 B;  1TZ1 A;  3QWZ B;  3ZUN A;  2LMC A;  1E7U A;  1P3Q U;  4AS1 A;  1N62 A;  3N3K B;  3ENE A;  3J9C A;  4EUT A;  1OQQ A;  1ACC A;  1YQ3 B;  2CU3 A;  2KTR B;  5EE9 A;  1GUA B;  2LVQ A;  5G55 A;  4AWJ A;  3PZ8 A;  2ZCC A;  1E6E B;  2WDT B;  4BKG A;  4JX1 C;  2KDE B;  2DYM A;  2ZVO A;  2KD0 A;  2NCN A;  3GE8 C;  1R4N I;  1SB3 C;  3ZJU A;  4EFO A;  2NMQ A;  2MBE A;  3R66 C;  2BYF A;  5DPS A;  3V6E B;  4LNI A;  3JYU A;  1IBX A;  2M0X A;  3AE3 B;  2KWU B;  3W1S A;  2BYE A;  1WR6 E;  3ETR A;  3KUZ A;  2K0P A;  4WWP A;  1NEN B;  2J53 A;  3CSF A;  1GAQ B;  4DK5 A;  2CHX A;  1WZ0 A;  3EEC A;  1FPY A;  1FCC C;  2VZK D;  4E71 A;  2VH2 A;  2WDR B;  4HWI B;  1E9M A;  1FNW A;  3QJZ A;  4I6N B;  4NJ6 A;  4DWF A;  3KH0 A;  5JHB A;  2KZR A;  1XCQ L;  4DHZ E;  1WY8 A;  2DWQ A;  3C8Y A;  1VCB A;  1FD6 A;  2DLB A;  1I4X A;  1F0Z A;  4GGQ A;  3CIR B;  3MC8 A;  3M62 B;  1J7C A;  2KAJ A;  4WJN A;  1SJH D;  1KLG D;  2NS5 A;  3NZS A;  3NVY A;  1BT0 A;  1QOF A;  5BO4 B;  1C3T A;  2WWZ A;  3BIN A;  4FUL A;  2WX0 A;  2ONQ A;  4KVG B;  1J19 A;  4DHJ B;  2RDH A;  4LNN A;  4MM3 B;  4C7Y A;  3PPA A;  2NBW B;  1D5M C;  1HZ6 A;  2M8S A;  4IW0 A;  2DBY A;  4KDL B;  3W2D A;  1F2R I;  2N9P C;  3Q3M C;  3DBL I;  5D7G A;  1ZKH A;  1T6B X;  3N30 A;  3KQ4 A;  1JWS D;  1SE9 A;  4K3B A;  1P7E A;  3LB8 C;  1JCK B;  3V61 A;  2I1J A;  3DDC B;  4KZC A;  1N61 A;  2W3S A;  1WI0 A;  2HTH A;  4RGT A;  4EE2 A;  1N60 A;  1XEE A;  2GRI A;  1V5T A;  4G3X B;  2LHD A;  1E8X A;  1GB4 A;  1CZP A;  4HCP B;  2PLP A;  2I2Y A;  2WX1 A;  1RM6 C;  1XO3 A;  1I4G A;  3P2B A;  2LAS A;  3KYD D;  1HEZ E;  2WXK A;  2QHO A;  2FE8 A;  4G50 A;  3B08 A;  1PGB A;  1LXD A;  1WZ3 A;  2KX0 A;  1YX5 B;  1IBX B;  3TUO A;  2GB1 A;  1WGR A;  2KQS A;  3W9C B;  4D2K A;  3TIX A;  2D2Q A;  2JRI B;  4LJO B;  1D4B A;  5C1Z A;  2KYW A;  3DCG A;  2ZNV C;  3H1U A;  1ZOY B;  4IKG A;  3DVN V;  3PSE B;  3HK0 A;  1YN5 A;  1EUV B;  3IG3 A;  2LFI A;  3IAS 1;  2V0G A;  1SIF A;  1YD8 U;  3MHS D;  4KX6 B;  4QAY A;  1LQB A;  2G1E A;  4IOI E;  3LYY A;  1WX7 A;  3Q8F A;  5I4D A;  3PO0 A;  4PS3 A;  1TS3 A;  2INC C;  2LRU A;  2KXJ A;  3P42 A;  3MC9 A;  1MI0 A;  5D6J B;  3A4R A;  4WJO A;  1WFY A;  1WXQ A;  3WA0 A;  1SE3 A;  4MSQ B;  3OJ4 B;  1VZ8 A;  3NRZ A;  4BOS C;  3H7P B;  1IGD A;  2LRW A;  4WAF A;  2FNJ B;  4ANW A;  1I4P A;  2WU5 B;  1R4M B;  1C1Y B;  1XXG A;  1S1Q B;  1VJK A;  4RFB A;  3T3O A;  5FKA C;  2GBN A;  1E10 A;  2X38 A;  2K5P A;  3PLU A;  5D94 A;  2D3B A;  1IUE A;  4CYE A;  1C77 A;  4M00 A;  3IT6 B;  1FFU A;  2D3G A;  1N63 A;  4NNJ B;  5IAA C;  2LHE A;  2C60 A;  4LNF A;  3AMZ A;  3VR8 B;  4HCN B;  3IVF A;  4PT5 A;  3WAN A;  2MBH A;  1PYW D;  4GIV A;  2QMT A;  5AZH A;  1TKE A;  2N9E B;  4ZRJ A;  2IO3 B;  4FJY A;  3ZDT A;  3QIJ A;  4WJP A;  1UGM A;  5AUI A;  4ANV A;  4BFR A;  2W3R A;  1UZX B;  3DQV A;  3APD A;  1MG8 A;  4JIO U;  2DZI A;  4KKI A;  2BF8 B;  1TT5 B;  5EE3 A;  1UD7 A;  1VD2 A;  3T3N A;  2WXP A;  2AX5 A;  1ZW7 A;  4A90 A;  1V1O A;  3ZXR A;  1V6E A;  1HXY D;  2MSE D;  2UYZ B;  1FXT B;  3R8B A;  5LXH A;  4Q2J A;  2JZP A;  2ASQ A;  3I57 A;  1XF5 L;  3AEG B;  1F77 A;  4HEA 1;  2CJN A;  5IP4 D;  5CTR C;  1TY2 A;  2NBV B;  1ZXI A;  3TEX A;  4O1N A;  3JSV A;  1E8Y A;  3NS1 A;  3NY5 A;  3EFU A;  5H8Y E;  2KWD A;  3AEF B;  4WH4 A;  4WWN A;  3Q8A A;  2BKF A;  3V6C B;  4M02 A;  4RGM A;  1AYF A;  2N7D A;  3RNA C;  3V60 A;  3R2I A;  2V3N A;  4HLE A;  2AWT A;  1VLB A;  5CHV C;  3K9P B;  2BS2 B;  4MAC A;  1KH0 A;  1HTO A;  2PVO D;  2E3T A;  1WM3 A;  3PV1 A;  1C4P A;  1E8W A;  3PT2 B;  1JQ4 A;  2BPS A;  4W9L A;  3KWL A;  2Y5C A;  3RNF C;  2K39 A;  4P16 A;  4K7S A;  1TS5 A;  4KKJ A;  1WX9 A;  4LTU A;  2CU1 A;  4A8X C;  1WXV A;  4AOF A;  1NYR A;  3IXS A;  3RMK C;  3GOE A;  4F8C B;  1N6Z A;  5BYQ A;  1Q5W B;  2MHJ A;  2LI5 A;  3ONS A;  5HHD G;  3PZ7 A;  4YL8 A;  5C23 A;  4II3 B;  2KFK A;  1I4H A;  3H9D A;  3JVZ X;  4A6Q A;  1J7B A;  2PEA A;  3MTN B;  2BWF A;  3AEC B;  4LNK A;  2DZJ A;  3L0W B;  5DPR A;  5CHW A;  4JQW C;  3BK2 A;  4IG7 B;  3A9J A;  5C2T B;  3DHI C;  1DOX A;  1RRB A;  5EDS A;  4WJQ A;  4HPL B;  2N1V A;  3AB5 A;  1JWM D;  2WDV B;  4RMA A;  1WMH B;  4W9I A;  2FIF A;  1LGR A;  3DBH B;  2C5L C;  1WE6 A;  3MP9 A;  2L0F A;  3DOW A;  4RF1 A;  2GLS A;  2L32 A;  3ZQ4 A;  2H88 B;  2M0A A;  3TCA A;  3X0W A;  3A9K B;  2PJH A;  2KMA A;  1GC6 A;  3AXC A;  3EC8 A;  1RWS A;  2A4Z A;  2D3C A;  2JSV X;  4N9F 4;  1WXA A;  2LGY A;  4NY0 A;  1EF1 A;  1WIA A;  2KLG A;  1YN4 A;  1GOZ A;  1SJE D;  1KM7 A;  2XK5 A;  1TTN A;  3ML9 A;  4B0M A;  3NVZ A;  5AZF A;  1FNV A;  4PYU A;  2W9N A;  3U30 A;  1L6V A;  1YQB A;  2LUM A;  1EWY C;  2MA9 B;  3VTU A;  5E6N A;  4KSL C;  3B0A A;  5IA7 A;  3QK0 A;  2AQ3 B;  2Z0D B;  1T0S C;  2IYD B;  4KIK A;  2BQQ A;  4P6V F;  4NJC A;  3TMP B;  4M8M A;  3UI3 A;  4TUU A;  5JH5 C;  1K50 A;  3ML8 A;  1OEY A;  3SFE B;  1J7A A;  2M19 A;  4HDO A;  1K53 A;  3SDL C;  2BYV E;  3CF6 E;  3DBR I;  2XN9 C;  4ICU A;  4JLC A;  1KOT A;  1WSP A;  3U7Z A;  2XK5 B;  3P4S B;  2ZNV B;  4MSM B;  1WXM A;  3E56 A;  3SFD B;  1DOY A;  1WJ4 A;  2KDB A;  1TYG B;  1ZXH A;  2IGD A;  1OQY A;  3Q6B A;  3IFW B;  2HE7 A;  4GU2 A;  4OVU A;  2JX5 A;  1S3S G;  4KIK B;  1BUI C;  1T0Q C;  2IO0 B;  3OAW A;  3WCQ A;  4ARI A;  1WJ6 A;  1YOV B;  5G2N A;  1V81 A;  1TS2 A;  3A9J B;  2R2Q A;  3GB1 A;  5DPW A;  2WXR A;  2CHZ A;  2A5U A;  4JWU C;  2J4X A;  4GDL B;  1GC7 A;  2DZK A;  2IY1 B;  4KGS A;  1WYG A;  2N9K A;  3B9J A;  1MVK A;  2N7J A;  1WJN A;  3WIM A;  1ZDV A;  1L0Y B;  3FIL B;  2RGF A;  2N0S B;  1GG3 A;  4OZB A;  1JW9 D;  1QOG A;  4PK1 A;  5L83 A;  1P0R A;  4OHJ A;  4WAA A;  4KSK C;  4DBG A;  2FCS A;  1L6U A;  2OED A;  4RM8 A;  5G5H A;  4C56 C;  4N6E B;  3UIN B;  4FJZ A;  2NPT B;  3PLV A;  2JT4 B;  4EKU A;  5EE0 A;  4EEW A;  2C7H A;  2MRP A;  5FR6 A;  1YJI A;  4ZRI A;  2UWQ A;  1XD3 B;  4J6I A;  1L0V B;  3EGR A;  1M94 A;  3NHE B;  1QOB A;  1G6J A;  3DHG C;  3ZNG C;  4DXG A;  2TSS A;  2J0J A;  4KGR A;  2KMC A;  3A1Q A;  4XDD A;  2XEW A;  1IGC A;  3H7S A;  3A4S C;  2ZW1 A;  1UNS A;  2AYO B;  1MJD A;  1JWB D;  1NI3 A;  2KN5 A;  2H89 B;  2IO2 B;  2ON8 A;  3AEA B;  1EU3 A;  3EA6 A;  1FFV A;  1TY0 A;  2MCN B;  4RGO S;  2NPT A;  2SAK A;  1ZPS A;  4ARC A;  4DHZ B;  4REZ A;  2V3P A;  3ZXV A;  4KDI C;  2D10 A;  4AQ7 A;  4LLG M;  1MHH E;  4UDU C;  1C79 A;  3APF A;  4OZA A;  1TGZ B;  1WGH A;  2YEP F;  1A5R A;  3L17 A;  5CX3 A;  3BVG A;  1I7H A;  2M1M A;  3P4P B;  5DPT A;  3FC4 A;  3DBS A;  1ESF A;  1QKZ A;  1XLP A;  2MP2 B;  3UIP B;  4C00 A;  1YQ4 B;  2EKE C;  4ZRP A;  1YNT E;  1QF6 A;  4RH6 A;  2V4I B;  1RAX A;  4W9H A;  2DHZ A;  3Q3N C;  1TBE A;  1T0Y A;  4A55 A;  4MGY E;  1B9R A;  2AL3 A;  1FNU A;  2JVC A;  4M01 A;  3V62 A;  4N58 A;  2BB5 A;  5TR5 A;  2PTL A;  1PGA A;  4FHK A;  1LO5 D;  2C7N B;  3PS6 A;  4B6W A;  1ZE3 D;  3RCZ A;  1SXT A;  2DYB A;  1TKY A;  2BKR B;  4ANU A;  1V9J A;  2KQ7 A;  1K51 A;  3U4E G;  2KX3 A;  3DVG X;  3B2G A;  2CKH B;  2PE6 B;  1YMH E;  2K6D B;  5LNK 1;  2JYE A;  4BAX A;  4C80 A;  1AAR A;  2ZZP B;  1X1M A;  5LXI B;  2LGS A;  5KHQ A;  2RR9 A;  3HUI A;  4YXD B;  4ASW C;  4MJS A;  1H4R A;  2WXG A;  1WH3 A;  2N4F A;  3RUI B;  2IY0 B;  4URK A;  3AU5 A;  1WGY A;  3T9L A;  3PGE A;  3ABV B;  3C19 A;  4RF0 A;  2WXH A;  5EE1 A;  3VFK A;  4W9G A;  2IPK D;  2QIE B;  4G0N B;  2KDF B;  5J18 A;  4MT5 A;  1FRD A;  2BVC A;  2V3S A;  2LJI A;  4EZL A;  1GJZ A;  2HTM E;  4HKZ E;  2GBR A;  4YWG G;  3HHM A;  1KLV A;  2KTR A;  3AE4 B;  4LNO A;  4GDK B;  2DAJ A;  3DBR B;  4TQ1 A;  1AN8 A;  4YT0 B;  3V3X A;  1ET6 A;  4JL9 A;  2VRR B;  3EHV A;  1EO6 A;  1CK1 A;  3DWM A;  2YVC A;  3IBE A;  2MP2 A;  3SD5 A;  3HRD D;  2IJ0 A;  2CS4 A;  2PE9 A;  2KQ4 X;  2VH1 A;  2XNA C;  4FA6 A;  4ACF A;  2K6Q A;  3BYY B;  3RUL A;  3SU8 X;  2WXI A;  3Q69 A;  3R7Q A;  1ZUD 2;  2NBU A;  2QDF A;  2Y5P A;  4ZDV A;  2WP9 B;  5MPO A;  3Q3F A;  3AED B;  2N1W A;  3WAP A;  3ZRF A;  1DGJ A;  4PS8 A;  2WLB A;  1A70 A;  2R61 A;  1F1H A;  1JAL A;  4IWO A;  1FXA A;  2JRH A;  2O6V D;  2FAZ A;  5JHA A;  3L10 B;  4NPN A;  1WGK A;  1P98 A;  4FBJ B;  2MBQ A;  2GBK A;  3I5J C;  1V80 A;  3N1Z C;  2IND C;  1F2R C;  2KLC A;  2JPH A;  2L76 A;  2KHW B;  1SEB D;  2L00 B;  2AEH A;  3ZDM C;  3QX1 A;  4HXD A;  2MX2 A;  2KMM A;  4IM0 A;  3OG5 A;  3EFC A;  2FUH B;  2WXO A;  3TL5 A;  1WGD A;  4MDK E;  2O6V A;  1WM2 A;  3KWV A;  2PIA A;  1UF0 A;  2J0M A;  2DNF A;  3N32 A;  1KLU D;  3PVL A;  1UH6 A;  4IC7 B;  2D11 A;  1ENF A;  4HRS A;  4G11 A;  5AUK A;  1OEY J;  1C4A A;  2M4N A;  2NVU I;  4P1C C;  1F52 A;  2L0T A;  1SIJ A;  1AWD A;  3SHQ A;  1MG4 A;  3LXF A;  4FAD A;  3QAQ A;  1L2N A;  3QA8 A;  1SGH A;  4J3O D;  3FKY A;  2KT7 A;  2WQY B;  5BMI A;  2IBI B;  3UF8 A;  2ZPY A;  2CHW A;  2LEK A;  3HVD A;  4WQO B;  1XLO A;  3TEW A;  3TSS A;  2L05 A;  1C9F A;  2M56 B;  4NAM A;  2KAC A;  2GOW A;  3VRA B;  3NS8 A;  1YJ1 A;  2WXJ A;  2O2V B;  4M8N A;  2LXA A;  4TQ0 A;  5IOI A;  3RT3 B;  3W5U B;  4GXB A;  1L7Y A;  3AE7 B;  4NAW A;  1Q10 A;  3RFZ B;  1I42 A;  3BK1 A;  3OJ3 A;  2PMV A;  4A9A A;  1YX6 B;  3BII D;  2KJ6 A;  1XT9 B;  3N1X C;  2ZEQ A;  2KFJ A;  4BBN F;  2MW5 A;  4IDI A;  4YSY B;  2DX5 B;  2INN E;  3Q2A C;  3TJP A;  4FXC A;  1STE A;  2GBM A;  1T0R C;  1UWM A;  2NTT A;  4WUR A;  2RDB C;  3ZLZ A;  4TMA B;  4NAW B;  4C4V B;  1E5W A;  4MH8 A;  5JZE B;  3WAM A;  1OGW A;  1Q0W B;  4N59 A;  3ZKJ C;  2HD5 B;  5G5G A;  2BS4 B;  2REX A;  4LDT D;  1UBQ A;  1QT9 A;  3OWE B;  4JE3 B;  2RSU A;  3R2T A;  5BYS A;  1N5W A;  2N9L A;  2W54 A;  1E7V A;  3HM6 X;  4IWP A;  1Y56 A;  1EWC A;  1NI2 A;  3R7R A;  1BXT A;  2QJL A;  5FK9 C;  3HIZ A;  3AUL A;  3KLS X;  2W82 A;  4PYZ A;  3PRE A;  4C4V A;  1ET9 A;  3CMM B;  2JUO A;  1VRA B;  4MGI E;  4A20 A;  2SEB D;  3VAW A;  4W9J A;  2IGH A;  2B3A A;  2AQ2 B;  4XWT A;  3ZGZ A;  3U2S C;  3KUD B;  3AE8 B;  3PTF C;  4ANX A;  3DWG C;  1MFW A;  3V05 A;  5AEK B;  4US8 A;  4E74 A;  3SR6 A;  4CQN A;  1J0G A;  5CHF A;  4YSX B;  3NOB A;  3A9K A;  2FCN A;  2CJO A;  2LJ5 A;  3RZF A;  3ZO5 B;  1I4Q A;  1KF6 B;  3GZN B;  4ITK A;  1CQV A;  3ZNZ B;  5TSS A;  3ZVV A;  1QQR A;  1GNU A;  2KWC A;  2O6V B;  4EZK A;  3VDZ A;  2I1K A;  1EF5 A;  3RNC C;  4IUM B;  3E9S A;  4GMV A;  2EKI A;  5L95 C;  2LD9 A;  3AEE B;  3H7P A;  2FUG 1;  1JRO A;  3L4P A;  2KFK B;  4W9K A;  2K8H A;  4K7U A;  1WGG A;  2LXC A;  1V8C A;  2KDI A;  4LJP B;  3AH7 A;  3BY4 B;  3P4R B;  3AI5 A;  3PHW B;  1KJT A;  1F9J A;  1TS4 A;  2XBB C;  4USA A;  4IM2 A;  4W9F A;  2G4D B;  4GN1 A;  2Y5B B;  1EU4 A;  3BZD B;  5J2R A;  5DCN A;  1IPG A;  1D5X C;  3L13 A;  3VQI A;  3A33 B;  1V97 A;  3I63 C;  1PFD A;  4GLS C;  2FCQ A;  1WR1 A;  4ICV A;  1WXS A;  1WMH A;  2V4L A;  4ZRK A;  3ZJT A;  1P9D U;  4P7I A;  3ZJV A;  3SEB A;  3BYT B;  1HZ5 A;  3UQB A;  3WAL A;  2PPH A;  2C9W B;  1KRH A;  4NJ7 A;  2BYT A;  2JF5 A;  1SE2 A;  1VZ7 A;  1SF0 A;  2JXT A;  1XLQ A;  2L8J A;  1WYW B;  1E8Z A;  1CMX B;  3C0R B;  1JRU A;  2FID A;  4X57 B;  4OVV A;  4W9E A;  2QC8 A;  3TEY A;  3DVN U;  4II2 B;  2N7E A;  1GB1 A;  2QIL A;  4HJG E;  3RPF C;  1B1Z A;  2QSD A;  4TSS A;  3NZ3 A;  2WNM A;  4XWW A;  3QQ8 B;  1V5O A;  1C76 A;  2N9X A;  2HDE A;  3LJ3 A;  2MJ3 A;  4E3C A;  1FIQ A;  2G45 B;  4BBN C;  4GB9 A;  2JQR B;  1FM0 D;  2LUE A;  2KOX A;  2KKC A;  4BZA A;  1WX8 A;  2ZPN A;  3IT4 B;  2G3Q B;  2DZM A;  2KAN A;  1IYF A;  1T5X D;  1ZP0 B;  2WGS A;  4WQM A;  2K1F A;  2NTS A;  3A1Q B;  2WXF A;  2L1A A;  4TV3 A;  1IP9 A;  2M17 A;  5E6J A;  2JY6 A;  2BT6 A;  3W5V B;  2MBB B;  3I9V 1;  3TBL D;  1D6E C;  4OW0 A;  2JWZ A;  4ZOH C;  3URY A;  2E6X A;  3ZTC A;  1VZ6 A;  2BWE S;  2G4S A;  1Z2M A;  2K3U A;  3QCA A;  5JXV A;  2JYT A;  3MFG A;  1J8C A;  3GE3 C;  2HJ1 A;  4I6P A;  3UGB B;  3RI7 C;  1L5P A;  3FIL A;  4I6L B;  4CHK A;  2J52 A;  4JPS A;  3M3J A;  3NG0 A;  3AEB B;  2D07 B;  4BOZ B;  4K3C A;  2JWU A;  4HJK A;  1DOI A;  2LGD A;  3RYT A;  1PDX A;  1I4R A;  3LDZ E;  3M95 A;  2R2O A;  3AE6 B;  3QC8 B;  2LVO A;  2ACZ B;  1KFY B;  3KVF B;  5BYR A;  1QOA A;  3MJ5 A;  3HVZ A;  4B0E A;  4OZC A;  2WS3 B;  3IAM 1;  2JZ3 B;  3PRP B;  3VUX A;  2BB6 A;  1MHX A;  3U8Z A;  4XX5 A;  4DXF A;  2HJ8 A;  1NVI D;  2MJD A;  4RM9 A;  3X23 A;  5H92 C;  4HDQ A;  2ICI A;  3DHH C;  2L52 A;  3TEZ A;  2KVZ A;  5D2M B;  4RCO A;  2EMT A;  2RDG A;  3RNB C;  4W9D A;  4YSZ B;  1LFD A;  1WWT A;  2KWV B;  4AP4 C;  2PW9 A;  2K9X A;  1K8R B;  1C4C A;  1YIW A;  4NQL B;  4LK0 M;  1UWX A;  1V2Y A;  4YTN B;  3VXW A;  1R4N B;  2OHF A;  4DXA B;  4L1B A;  2KNB A;  3CST A;  3KUC B;  2YEP B;  2WXL A;  4BKT A;  1UUP A;  4F7Z A;  5GMV A;  1FRR A;  1ROE A;  4BKS D;  4FN2 A;  3QHT A;  2MEK A;  1MPE A;  1TZO A;  1SSN A;  3B2F A;  4FHJ A;  4KGT A;  3I3T B;  1V86 A;  4LCD E;  3UIO B;  3NZU A;  1L4Z B;  2KC1 A;  2EMS A;  4L23 A;  2WHI A;  1Z5S B;  1GPX A;  2INP E;  4JGH B;  5HI1 A;  4GDK A;  4TKN A;  3T8M A;  5HFY A;  4R3D A;  4HPP A;  3ALB A;  1PQS A;  2GI9 A;  1FXI A;  1XLN A;  4IWQ A;  2OJR A;  3P63 A;  2LGX A;  4RGN A;  3Q3O C;  5KHO A;  4DHJ D;  4DDI D;  2DAF A;  4GDL A;  3DPD A;  3PRM B;  1HA5 A;  1SBB B;  4WIP A;  3L54 A;  4HRO A;  5D3I B;  4HKQ A;  2GBJ A;  1R7S A;  2Z59 B;  3OLM D;  3RZW C;  2OOB B;  5J17 A;  2MH7 A;  3W1S C;  1TIF A;  2JU6 X;  1E0Z A;  5IN7 A;  3RNG C;  1DYQ A;  2D3A A;  1KTK A;  1BML C;  3ZRC A;  4FLH A;  1JML A;  4NZL B;  3R3M A;  3AE1 B;  3JSV B;  4XC2 A;  2D5G A;  4XZ4 A;  1V1P B;  2W55 A;  2GMI C;  1EM7 A; 
#chains in the Genus database with same CATH homology
 4IW0 A;  4GOC A;  4KDL B;  4GDL B;  5HKH A;  2N9P C;  1GC7 A;  1H8C A;  2DZK A;  2IY1 B;  3DBL I;  3D32 A;  1E7V A;  1ZKH A;  5D7G A;  3HM6 X;  1WJN A;  4IWP A;  3AU4 A;  3WIM A;  3N30 A;  3VUW A;  1NI2 A;  3R7R A;  1SE9 A;  3V61 A;  4MEM A;  2RGF A;  3AUL A;  3HIZ A;  1GG3 A;  4PYZ A;  2I1J A;  3PRE A;  3DDC B;  3CMM B;  2JUO A;  4LDT B;  5L83 A;  1P0R A;  4MGI E;  4WAA A;  4A20 A;  4KSK C;  4KZC A;  1LM8 B;  4DBG A;  3VAW A;  4W9J A;  4GSW A;  1WI0 A;  2FCS A;  2HTH A;  2ZJD A;  2B3A A;  1U4A A;  1V5T A;  4RM8 A;  3KUD B;  3UIN B;  4G3X B;  3PTF C;  4ANX A;  4FJZ A;  3S2A A;  3VHT C;  3GZN I;  2NPT B;  3PLV A;  2AL6 A;  1E8X A;  5AEK B;  2JT4 B;  4EKU A;  4EEW A;  2C7H A;  2MRP A;  4E74 A;  4HVB A;  4HCP B;  5FR6 A;  3M63 B;  4AJY B;  4ZRI A;  2IO1 B;  2UWQ A;  1XD3 B;  4J6I A;  1J0G A;  5CHF A;  3NOB A;  1M94 A;  2WX1 A;  3NHE B;  3A9K A;  4MH0 E;  3MJW A;  3P2B A;  2LAS A;  3KYD D;  3Q3J A;  2FCN A;  1G6J A;  1ISN A;  2QHO A;  4G50 A;  3B08 A;  3ZNG C;  1LXD A;  2J0J A;  1WZ3 A;  2KX0 A;  1YX5 B;  2LJ5 A;  3VH3 B;  2KMC A;  3A1Q A;  3RZF A;  3ZO5 B;  2ZCB A;  1WGR A;  2KQS A;  2L7R A;  3VVW B;  2C7M B;  3TIX A;  2XEW A;  2D2Q A;  1RFA A;  2JRI B;  4LJO B;  3H7S A;  3A4S C;  5C1Z A;  3ZNZ B;  3ZVV A;  2AYO B;  3DCG A;  1GNU A;  3PRZ A;  2KN5 A;  2KWC A;  2O6V B;  4EOY A;  1P1A A;  4EZK A;  2ZNV C;  3VDZ A;  2I1K A;  1EF5 A;  3ECI A;  2IO2 B;  4IUM B;  3H1U A;  2KJH B;  4GMV A;  3DVN V;  3PSE B;  3HK0 A;  5LLI A;  4WWO A;  2NPT A;  2LD9 A;  2MCN B;  5L95 C;  2O2V A;  4DHZ B;  1EUV B;  2MQJ A;  2J0K A;  2MWS B;  2IZV B;  3H7P A;  3KYC D;  4KDI C;  3IG3 A;  4CO7 A;  2KK8 A;  2KFK B;  2D10 A;  4W9K A;  2K8H A;  3KW5 B;  4K7U A;  1WGG A;  2LXC A;  1QZE A;  2KDI A;  1SIF A;  4LJP B;  3APF A;  4B95 A;  1WF9 A;  4F1S A;  1TGZ B;  3BY4 B;  1YD8 U;  3AI5 A;  3MHS D;  3PHW B;  1KJT A;  1F9J A;  2XBB C;  4IM2 A;  1WGH A;  4W9F A;  1A5R A;  1LQB A;  2G4D B;  1WX7 A;  3L17 A;  5CX3 A;  4GN1 A;  4PS3 A;  2NR2 A;  2LRU A;  2M1M A;  2Y5B B;  2KXJ A;  3H6N A;  5J2R A;  5DPT A;  5DCN A;  1IPG A;  3DBS A;  2MBO A;  3L13 A;  1WJU A;  3VQI A;  2MP2 B;  3A33 B;  3UIP B;  1OTR B;  4B9K A;  5D6J B;  2FCQ A;  3DBH I;  1Q1O A;  2EKE C;  3A4R A;  1WR1 A;  4ICV A;  4WJO A;  1WFY A;  3WA0 A;  4BVU C;  1WXS A;  1WMH A;  2V4L A;  4MSQ B;  4K7W A;  4ZRK A;  1RAX A;  4W9H A;  3OJ4 B;  1P9D U;  2DHZ A;  4P7I A;  4BOS C;  3H7P B;  1TBE A;  2LRW A;  2FNJ B;  3VUY A;  1T0Y A;  4ANW A;  1UEL A;  3UQB A;  4MGY E;  1C1Y B;  3WAL A;  4MGK E;  2AL3 A;  2PPH A;  2JVC A;  3HM3 A;  3V62 A;  1S1Q B;  2C9W B;  4IM3 A;  4NJ7 A;  5TR5 A;  2GBN A;  2JF5 A;  1V49 A;  3UQA A;  4FHK A;  3PLU A;  2C7N B;  3PS6 A;  5D94 A;  4CYE A;  2L8J A;  4B6W A;  1WYW B;  2D3G A;  1E8Z A;  3RCZ A;  1WRD B;  4MGZ E;  2DYB A;  1CMX B;  4NNJ B;  3U7D A;  3C0R B;  5IAA C;  2BKR B;  2C60 A;  5E6P A;  3ZW3 A;  4ANU A;  1V9J A;  4K1R B;  1JRU A;  2FID A;  2MLB A;  3PHX B;  2KQ7 A;  3IVF A;  4HCN B;  4X57 B;  3WAN A;  2MBH A;  4OVV A;  2KX3 A;  4W9E A;  3DVG X;  4GIV A;  4K81 A;  2CKH B;  2PE6 B;  3APC A;  3DVN U;  2K6D B;  4II2 B;  2N7E A;  2Z0E B;  2N9E B;  4ZRJ A;  5AZH A;  3VH4 B;  1NBF C;  3K9O B;  2IO3 B;  4FJY A;  3ZDT A;  3QIJ A;  4WJP A;  1UGM A;  1AAR A;  2ZZP B;  1X1M A;  5LXI B;  4ANV A;  2JZZ A;  1WE7 A;  3QQ8 B;  4AUQ C;  5KHQ A;  1V5O A;  2N9X A;  2RR9 A;  2KJR A;  4MEL A;  3LJ3 A;  4BFR A;  1UZX B;  3DQV A;  3APD A;  4ASW C;  1MG8 A;  4JIO U;  2DZI A;  4E3C A;  2G45 B;  4MJS A;  1H4R A;  2BF8 B;  1ZGU B;  1WH3 A;  2N4F A;  1UD7 A;  1VD2 A;  2IY0 B;  4GB9 A;  3RUI B;  4BBN C;  3QAR A;  2CR5 A;  4URK A;  1ZW7 A;  3AU5 A;  3PZD A;  1WGY A;  1Y8R C;  2LUE A;  2KOX A;  2KKC A;  2ZVN A;  3T9L A;  1WX8 A;  2ZPN A;  3PGE A;  4AJW A;  1V6E A;  5E6O A;  2KO3 A;  2G3Q B;  2DZM A;  2KAN A;  3L16 A;  3VFK A;  4W9G A;  1IYF A;  4A3P A;  3ZTD A;  2MSE D;  2UYZ B;  1FXT B;  1E90 A;  4KV2 A;  5LXH A;  2K1F A;  4M0W B;  4G0N B;  4A3O A;  2KDF B;  5J18 A;  3DVG Y;  2ASQ A;  3W1Y A;  3A1Q B;  2V3S A;  4HK2 A;  1IP9 A;  4TV3 A;  4EZL A;  2M17 A;  4W9C A;  1GJZ A;  1D3Z A;  2GBR A;  2JY6 A;  3HHM A;  1KLV A;  2KTR A;  1NDD A;  4HPM B;  5CTR C;  3WAO A;  4GDK B;  2DAJ A;  2MBB B;  3TBL D;  2NBV B;  4TQ1 A;  4MJS B;  4JL9 A;  1I35 A;  2VRR B;  3EHV A;  2JWZ A;  1EO6 A;  3JSV A;  1E8Y A;  4MM3 A;  3NY5 A;  3ZTC A;  2YVC A;  3EFU A;  3IBE A;  3ZIM A;  2MP2 A;  3VTV A;  2BWE S;  2G4S A;  3VTW A;  1Z2M A;  2KTF A;  3QCA A;  3SD5 A;  2YLM A;  4KZ0 A;  2JXX A;  1J8C A;  4WWN A;  2CS4 A;  2PE9 A;  3ZNI D;  4FA6 A;  4I6P A;  2BKF A;  2K6Q A;  3UGB B;  3V6C B;  2LWP A;  4DDG D;  4I6L B;  2N7D A;  4PS7 A;  3V60 A;  1HE8 A;  3RUL A;  2BGF A;  3SU8 X;  2AWT A;  4HLE A;  4CHK A;  5CHV C;  3K9P B;  1RLF A;  3M3J A;  2RPQ A;  2D07 B;  4BOZ B;  3R7Q A;  4BKS A;  1WM3 A;  2NBU A;  4HJK A;  4ZDV A;  3IHP C;  3PV1 A;  2V1Y A;  1E8W A;  4FJV B;  3PT2 B;  3Q3F A;  2BPS A;  2N1W A;  4W9L A;  2LGD A;  3WAP A;  1XQQ A;  3ZRF A;  3RYT A;  2K39 A;  4PS8 A;  3LDZ E;  3M95 A;  2R2O A;  4K7S A;  1WX9 A;  2J7Q B;  3QC8 B;  2CU1 A;  2LVO A;  3ZNH B;  1WXV A;  4EZJ A;  3KVF B;  4AOF A;  2KVR A;  3GOE A;  4IWO A;  3RD2 A;  2K25 A;  3JW0 X;  2JRH A;  2O6V D;  2FAZ A;  4F8C B;  5JHA A;  3L10 B;  2JZ3 B;  5AZG A;  4NPN A;  1Q5W B;  2LVP A;  3B1L X;  2LI5 A;  1P98 A;  4FBJ B;  2MBQ A;  3ONS A;  3PRP B;  2GBK A;  3VUX A;  1V80 A;  3U8Z A;  4YL8 A;  5C23 A;  4II3 B;  2KFK A;  3H9D A;  4XX5 A;  3JVZ X;  2KLC A;  2JPH A;  2L76 A;  2KHW B;  4ZYN A;  2PEA A;  3MTN B;  2BWF A;  2L00 B;  2AEH A;  2HJ8 A;  3ZDM C;  2L3Z A;  3QX1 A;  4HXD A;  2DZJ A;  3L0W B;  2MX2 A;  2RD0 A;  2DEN B;  4IM0 A;  4RM9 A;  5DPR A;  2WYQ A;  2FUH B;  4JQW C;  5CHW A;  2DYO A;  2K8B A;  2FCM A;  1WGD A;  4MDK E;  2O6V A;  4HDQ A;  4IG7 B;  3TL5 A;  1WM2 A;  3L08 A;  2K8C A;  3A9J A;  1UBI A;  5D2M B;  1R4M I;  2J0M A;  3N32 A;  3PVL A;  2EMT A;  4NQK E;  4W9D A;  1LFD A;  1RRB A;  1UH6 A;  4IC7 B;  5EDS A;  4WJQ A;  2D11 A;  2KWV B;  4HPL B;  4G11 A;  4AP4 C;  2N1V A;  1K8R B;  1OEY J;  1YIW A;  4NQL B;  4RMA A;  1V2Y A;  1WMH B;  4W9I A;  2M4N A;  2KC2 A;  2NVU I;  2FIF A;  2LZ6 A;  3O65 B;  3VXW A;  2C5L C;  1TZ1 A;  4DXA B;  2L0T A;  1WE6 A;  3QWZ B;  2L0F A;  3DOW A;  3SHQ A;  3ZUN A;  1E7U A;  1P3Q U;  2KNB A;  4FAD A;  3QAQ A;  3N3K B;  3CST A;  1L2N A;  3KUC B;  3TCA A;  3X0W A;  3ENE A;  3A9K B;  1SGH A;  2PJH A;  2KMA A;  3QA8 A;  4BKT A;  4EUT A;  1GC6 A;  3AXC A;  4F7Z A;  3EC8 A;  5GMV A;  2IBI B;  2A4Z A;  2KTR B;  3UF8 A;  3X23 A;  2ZPY A;  2CHW A;  4N9F 4;  4BKS D;  4WQO B;  1WXA A;  1GUA B;  2LGY A;  4FN2 A;  4NY0 A;  3QHT A;  2LVQ A;  5G55 A;  1EF1 A;  4AWJ A;  1WIA A;  2KLG A;  2L05 A;  2ZCC A;  2WDT B;  4BKG A;  4FHJ A;  1KM7 A;  2KDE B;  2XK5 A;  1TTN A;  2GOW A;  3I3T B;  2DYM A;  3ML9 A;  3NS8 A;  2ZVO A;  2KD0 A;  2NCN A;  1V86 A;  5AZF A;  1R4N I;  4PYU A;  2W9N A;  4LCD E;  1YJ1 A;  3U30 A;  4EFO A;  3UIO B;  3NZU A;  2O2V B;  2MBE A;  2KC1 A;  1YQB A;  2EMS A;  4M8N A;  3R66 C;  2BYF A;  5DPS A;  2LXA A;  3V6E B;  1Z5S B;  4TQ0 A;  2MA9 B;  4JGH B;  3RT3 B;  3VTU A;  4GDK A;  5E6N A;  3JYU A;  4TKN A;  2M0X A;  3B0A A;  4KSL C;  5IA7 A;  3QK0 A;  4GXB A;  1L7Y A;  2KWU B;  3T8M A;  2Z0D B;  4NAW A;  3W1S A;  2IYD B;  2BYE A;  4KIK A;  1WR6 E;  3TMP B;  3ALB A;  4M8M A;  3KUZ A;  1PQS A;  4TUU A;  1I42 A;  5JH5 C;  4WWP A;  3OJ3 A;  3ML8 A;  3CSF A;  1OEY A;  4DK5 A;  4IWQ A;  2CHX A;  2OJR A;  1WZ0 A;  1YX6 B;  3EEC A;  2KJ6 A;  2LGX A;  4HDO A;  4E71 A;  1XT9 B;  3SDL C;  2BYV E;  3CF6 E;  5KHO A;  3DBR I;  2ZEQ A;  4ICU A;  2KFJ A;  4JLC A;  4HWI B;  4DHJ D;  1KOT A;  3QJZ A;  4NJ6 A;  4BBN F;  4I6N B;  4DWF A;  2MW5 A;  2XK5 B;  4DDI D;  2DAF A;  3KH0 A;  5JHB A;  4GDL A;  2DX5 B;  2KZR A;  4DHZ E;  3DPD A;  3PRM B;  1WY8 A;  2ZNV B;  4MSM B;  3TJP A;  1VCB A;  1WXM A;  2GBM A;  3L54 A;  1WJ4 A;  2KDB A;  4GGQ A;  2GBJ A;  2Z59 B;  3OLM D;  3RZW C;  3M62 B;  2OOB B;  1OQY A;  3IFW B;  4WJN A;  2HE7 A;  4GU2 A;  5J17 A;  3W1S C;  3ZLZ A;  4OVU A;  4NAW B;  1S3S G;  2NS5 A;  4KIK B;  3NZS A;  1BT0 A;  1E5W A;  5BO4 B;  5JZE B;  1C3T A;  2WWZ A;  2IO0 B;  3OAW A;  3WAM A;  1WJ6 A;  5G2N A;  3BIN A;  3ZRC A;  4FLH A;  1OGW A;  1Q0W B;  1V81 A;  2WX0 A;  4FUL A;  3A9J B;  3ZKJ C;  2HD5 B;  2REX A;  4LDT D;  1UBQ A;  2R2Q A;  4KVG B;  1J19 A;  3R3M A;  4DHJ B;  3JSV B;  4XC2 A;  4XZ4 A;  5DPW A;  2CHZ A;  3PPA A;  2NBW B;  2A5U A;  2GMI C;  2RSU A;  2M8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...