1J0GA

Solution structure of mouse hypothetical 9.1 kda protein, a ubiquitin-like fold
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
92
structure length
92
Chain Sequence
GSEGAATMSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical Protein 1810045K17
publication title Solution Structure of Mouse Hypothetical 9.1 kDa Protein, A Ubiquitin-like Fold
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 9
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2002-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03671 Ufm1 Ubiquitin fold modifier 1 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1j0gA00
4MJSB 2A4ZA 2FAZA 2J7QB 2KDFB 5J17A 2DZKA 1GNUA 3VTUA 3RD2A 4XX5A 4HK2A 3PRMB 3UGBB 3APCA 3CMMB 4FHJA 2AYOB 1XT9B 4BKSA 3ZNGC 3DVNU 3V6EB 4EZJA 4HJKA 3KUCB 4W9DA 2JWZA 1E8ZA 2KFKA 2FIDA 1X1MA 3A9JA 3AXCA 3DVNV 3H6NA 3K9PB 4IG7B 3IBEA 5BO4B 3ZNID 2NBVB 3A33B 2LUEA 2ZZPB 4ZDVA 5AEKB 1U4AA 3B0AA 1WY8A 3W1SC 5AZGA 4KV2A 3DBSA 4IM0A 2ZVNA 2KANA 3Q3FA 4JLCA 5DCNA 3W1SA 1KLVA 4GMVA 2G4SA 3VH3B 2I1KA 1TTNA 3OJ4B 2K39A 2KD0A 1LQBA 3VAWA 3ZW3A 3QA8A 3WAOA 5DPWA 1SE9A 2CU1A 3MHSD 3R3MA 5CHWA 3ZVVA 3X23A 1LFDA 1G6JA 4GDKA 2NS5A 1IYFA 4MM3A 4A3OA 1RLFA 2XBBC 3TCAA 2L3ZA 3PV1A 4ANUA 3JSVB 2IY1B 3B1LX 3JVZX 4GU2A 4ZRJA 1LM8B 2DENB 1YIWA 4AOFA 4NAWA 3EHVA 2HTHA 4ANVA 1WXSA 2LD9A 3SDLC 2QHOA 1NBFC 1H8CA 4KZ0A 3QHTA 4BOZB 2KZRA 1YJ1A 1UGMA 3ZRFA 2ZNVC 3PSEB 2V1YA 3ZO5B 2L0TA 3UIPB 3WALA 3RT3B 2N7EA 4ANXA 2AEHA 4I6NB 4WJOA 2NCNA 2HE7A 1K8RB 4ANWA 1VD2A 2CHWA 4MGYE 1P3QU 1WIAA 2M0XA 2OOBB 2PPHA 1WE7A 3QARA 4HCPB 1PQSA 2KMCA 3U8ZA 4FJVB 3HM6X 1OEYA 3QJZA 4PS7A 3JW0X 4HVBA 2BYEA 2HD5B 3QK0A 3KH0A 5HKHA 4M0WB 4FLHA 2NBUA 4URKA 3L16A 3AI5A 4ZRKA 4KDIC 4KDLB 1Q5WB 1R4MI 2WX1A 3B08A 1WM2A 3ML9A 4GDLA 3UQAA 3PLUA 1WMHA 3OLMD 2K8HA 2DAFA 5KHQA 4GXBA 5AZHA 2ASQA 4WWOA 3DDCB 3Q3JA 4DWFA 4HWIB 3H1UA 3DVGX 1YD8U 2L76A 4E3CA 4P7IA 2RD0A 4DBGA 3KUZA 3TBLD 3GOEA 4PS8A 1EUVB 3SHQA 2KQSA 2JZ3B 4N9F4 5CHFA 4DDGD 2LGDA 3H7SA 5L95C 1Q0WB 2C7HA 3KYDD 3HHMA 1WM3A 4TQ1A 4HDOA 4MELA 4W9EA 2Z0EB 2KWVB 1ISNA 2AL3A 4MSMB 4B9KA 3BINA 3LJ3A 2IO3B 2GBRA 3PREA 2K25A 2LZ6A 2BWFA 4A3PA 3VXWA 1P9DU 4G11A 4M8NA 3KUDB 2GBNA 3WA0A 4OVVA 3T9LA 2REXA 2FCMA 1V5TA 1E7VA 2D2QA 3GZNI 4FADA 4MDKE 2XK5B 4ASWC 4BVUC 1XD3B 2KDBA 1WX8A 2KK8A 2O6VB 3CSFA 1UBIA 2KOXA 2LJ5A 4W9IA 1H4RA 1YX5B 2YLMA 1P0RA 1RRBA 2CKHB 2OJRA 3SD5A 3UINB 3VUYA 5C1ZA 2MP2B 4J6IA 4KIKB 2O2VB 5LLIA 4II3B 2BYVE 3WIMA 2B3AA 4LDTD 2M8SA 5G55A 5IAAC 1Y8RC 2BPSA 2KFJA 2KMAA 4DXAB 2D10A 2MBBB 3H7PA 3JSVA 4W9GA 3UF8A 4B6WA 4LJPB 3RCZA 3PHXB 3KYCD 1EO6A 1IPGA 1V86A 4K81A 1KJTA 1D3ZA 2N4FA 2GBJA 3EECA 4DHZE 4AWJA 1WXAA 4GN1A 4WAAA 4DHJD 3EC8A 3EFUA 4E71A 3NOBA 2J0MA 1IP9A 5J2RA 2DZJA 2I1JA 2MBOA 2KC2A 1AARA 1I42A 5FR6A 2LVPA 3R7QA 4NJ6A 5JHAA 1RFAA 2GBMA 2M1MA 2NVUI 3H9DA 5LXHA 3BY4B 3A4RA 1L7YA 3N32A 1WJ4A 2BKRB 3KVFB 3AU4A 3TL5A 3V61A 3O65B 2KTFA 3ZLZA 3L54A 4BOSC 5CHVC 2GMIC 1E7UA 4AJYB 4IUMB 3IG3A 2N1WA 2NBWB 2KC1A 3LDZE 3DOWA 2KX0A 2JF5A 4ICUA 1WX7A 3S2AA 4F7ZA 2RR9A 3MTNB 4K7SA 4LCDE 1Q1OA 3A4SC 4MGZE 1WGGA 2CR5A 4WJPA 2D3GA 3PT2B 2KO3A 2DZIA 4WJNA 5CTRC 4I6LB 4BKSD 2DYMA 1E8WA 2DYBA 3IVFA 1JRUA 1WI0A 3ONSA 3QWZB 2G4DB 2K8BA 3RZFA 2FUHB 2ZPYA 2AL6A 2MQJA 1I35A 1FXTB 2Z59B 1CMXB 2K6DB 2KLGA 2KLCA 2C7NB 2NR2A 3M95A 3X0WA 2C7MB 3QCAA 1WGHA 4FHKA 1GG3A 2FCQA 2JZZA 2K1FA 3TIXA 4M8MA 3NZUA 2EMSA 2AWTA 4KZCA 2KX3A 2XK5A 2K8CA 2JPHA 3VH4B 4K1RB 2C5LC 2O6VA 1WR6E 2ZCBA 1J8CA 2KJHB 1R4NI 2FCSA 3MJWA 2ZEQA 4YL8A 5DPSA 4PS3A 1RAXA 3L08A 4EKUA 1SIFA 2CHXA 2MP2A 2V3SA 3QAQA 2LRWA 1E8YA 4JQWC 3NZSA 2O2VA 4KIKA 4W9KA 3T8MA 2MBHA 4NPNA 2DAJA 4ZYNA 4MJSA 2LASA 5DPRA 4XZ4A 5D7GA 1V5OA 3HM3A 4JIOU 1TBEA 1UBQA 5E6NA 4OVUA 3ZKJC 3U7DA 1MG8A 3V60A 2C60A 2IY0B 4HPLB 5J18A 1E5WA 1WGRA 2RPQA 4FA6A 3PPAA 3PS6A 2MLBA 3QQ8B 3V6CB 2MW5A 3VDZA 1WGYA 2UWQA 1EF5A 3L10B 3M62B 1WFYA 5G2NA 2G45B 2L0FA 3QIJA 1ZGUB 5E6PA 3AULA 4GDKB 1WJ6A 2WDTB 3DQVA 1V80A 1WRDB 1OEYJ 2L7RA 1S3SG 2M17A 1UH6A 2WX0A 3VHTC 1E90A 3OAWA 2MX2A 3PRPB 4CHKA 2KN5A 4NQLB 2ZJDA 4NAWB 4TKNA 3WAMA 2L8JA 4MGIE 1BT0A 3PGEA 4W9CA 2IO0B 3ZNZB 5IA7A 3QX1A 3ZDTA 2L00B 2MA9B 4MEMA 4F8CB 2BF8B 2IO2B 4LJOB 1TGZB 3D32A 4W9JA 4G50A 3SU8X 4KVGB 4BKGA 5LXIB 3I3TB 1TZ1A 4EOYA 2PE9A 3R66C 3A1QB 4W9FA 1GJZA 4X57B 5TR5A 1GC6A 2YVCA 3DPDA 4NJ7A 4WWPA 1V81A 2DYOA 4KSKC 3VTWA 3ZRCA 2J0JA 4RMAA 3W1YA 4ZRIA 3TMPB 3VUWA 3VQIA 3RULA 2C9WB 2IBIB 4K7UA 2DZMA 2KNBA 3NHEB 4G3XB 4RM9A 2PEAA 4LDTB 4F1SA 1GUAB 1UD7A 2ZVOA 4W9LA 1WE6A 4IM3A 2G3QB 3PVLA 4GB9A 2KXJA 2K6QA 1L2NA 3NY5A 2FNJB 2VRRB 1P98A 2GOWA 2WYQA 3RUIB 2DX5B 2KTRB 2MRPA 4I6PA 4PYUA 2IO1B 3ZNHB 4NQKE 2KQ7A 4A20A 3L13A 4DHJB 2LXCA 4K7WA 3V62A 2KVRA 1WZ0A 2KKCA 2N9XA 3CSTA 1WJNA 2N7DA 4FULA 2N9EB 1EF1A 3ENEA 1WYWB 3IFWB 4BKTA 4FJZA 5E6OA 3L0WB 4AP4C 1OTRB 1WR1A 1YX6B 2D11A 4JGHB 4TV3A 2R2QA 3APFA 3A9KB 2RSUA 2JT4B 2BWES 5D2MB 1P1AA 5JHBA 1HE8A 2NPTB 3OJ3A 4GGQA 2ZPNA 4WWNA 5CX3A 4HCNB 3ZTDA 4KSLC 4W9HA 3VUXA 4PYZA 4GSWA 1E8XA 5GMVA 3DVGY 2MBQA 4ICVA 3ML8A 1NI2A 4HPMB 4IW0A 2LI5A 1ZKHA 4GOCA 5EDSA 3C0RB 2UYZB 1V6EA 2PJHA 2JUOA 2LXAA 2KJRA 2BYFA 4IWQA 4GIVA 3PRZA 2JRHA 4BBNF 1V2YA 3P2BA 5D94A 1J19A 3CF6E 3ALBA 3M63B 2ZCCA 3H7PB 4TQ0A 1WJUA 1WXMA 1WF9A 4MH0E 3RZWC 2IZVB 1WXVA 1WX9A 4DHZB 4DDID 3DCGA 1QZEA 4CO7A 2LGYA 2KFKB 3A9JB 3HIZA 4E74A 2DHZA 1KOTA 2KDEB 5KHOA 1A5RA 4AUQC 4DK5A 2FIFA 2LVQA 5L83A 4CYEA 2V4LA 3JYUA 1T0YA 2LGXA 4II2B 4IWPA 4HXDA 3UQBA 2MSED 3IHPC 3DBRI 2MCNB 3U30A 3WANA 2Z0DB 3A1QA 2EMTA 2IYDB 2KWCA 2LVOA 4IC7B 2W9NA 2EKEC 3ZTCA 1WGDA 1XQQA 3UIOB 2KHWB 2N1VA 2CS4A 5AZFA 1ZW7A 3DBHI 1C3TA 1UZXB 2LRUA 3ZIMA 1Z2MA 2J0KA 3N30A 3DBLI 3PLVA 4G0NB 1Z5SB 3N3KB 2HJ8A 2L05A 1V49A 2CHZA 2KJ6A 1C1YB 3APDA 4FJYA 4IWOA 1WZ3A 3QC8B 4FN2A 4TUUA 5D6JB 1NDDA 2BGFA 3VFKA 5DPTA 3KW5B 4NY0A 3WAPA 2KWUB 1VCBA 5C23A 4EZKA 4XC2A 2Y5BB 3L17A 4WJQA 2KTRA 2JY6A 3PZDA 4AJWA 4EEWA 4RM8A 3VVWB 4HLEA 2MBEA 4EUTA 5JH5C 1YQBA 2JXXA 2O6VD 4MGKE 3M3JA 4EFOA 3ZDMC 3PTFC 3VTVA 3R7RA 1F9JA 1OQYA 2MWSB 2ZNVB 2KDIA 4NNJB 2BKFA 4MSQB 1KM7A 2JRIB 2R2OA 3A9KA 2PE6B 2N9PC 4BFRA 3AU5A 1V9JA 3PHWB 1WH3A 3TJPA 1M94A 2NPTA 4FBJB 3K9OB 4EZLA 2XEWA 1S1QB 1UELA 4HDQA 1LXDA 2RGFA 1SGHA 2WWZA 3HK0A 4B95A 3ECIA 4IM2A 2A5UA 1J0GA 2LWPA 3NS8A 2FCNA 4BBNC 2M4NA 2JVCA 4JL9A 4GDLB 1WMHB 3RYTA 5JZEB 2D07B 1OGWA 4WQOB 2GBKA 1GC7A 3ZUNA
chains in the Genus database with same CATH superfamily
4MJSB 1GB1A 2L32A 1D5ZC 4OHJA 3VTUA 4XX5A 4HK2A 4KKJA 3UGBB 1IBXB 4FHJA 3ZNGC 5H92C 3KUCB 2KFKA 1X1MA 4YT0B 1VZ6A 2NBVB 2LUEA 2WDQB 1L6VA 2ZVNA 1UWXA 3Q3FA 4OZCA 2I1KA 3ZW3A 3WAOA 3P63A 3R3MA 1LFDA 1G6JA 4GDKA 2K9XA 1RLFA 2L3ZA 2MEKA 1YIWA 1WXSA 2LD9A 1NBFC 3E56A 1PDXA 1DGJA 4UDUC 3ZRFA 2L0TA 4I6NB 2NCNA 2HE7A 5BYQA 1VZ7A 1WIAA 3QARA 1PQSA 3U8ZA 4WWMA 4FJVB 1OEYA 2HD5B 3QK0A 5HKHA 3AEFB 2KQ4X 3NRZA 1V1OA 1AWDA 3CIRB 1Q5WB 3Q8CA 2IGDA 3N9YC 1JW9D 3AEEB 2WGSA 5KHQA 5G5GA 5AZHA 4DWFA 3DVGX 4JWUC 2IGHA 4LNFA 4P7IA 2RD0A 3GOEA 4PS8A 1C79A 3SHQA 4N9F4 1MHHE 3H7SA 1IBXA 2D3AA 2BTEA 1T0SC 1TS5A 1ZP0B 4MSMB 4AS1A 4RGNA 1J7BA 3U2SC 2IO3B 3PREA 2LZ6A 1EM7A 4M8NA 3KUDB 2ON8A 2REXA 1SF0A 4FADA 3P42A 4BVUC 1WX8A 2Y5PA 1UBIA 2KOXA 1FM0D 1H4RA 2PIAA 5GXGB 3UINB 2CKHB 2OJRA 2XNAC 5HHDG 3VUYA 1F0ZA 4C56C 3DWGC 1FRRA 4KIKB 4L1BA 5LLIA 3ZJVA 2WXNA 4XGAB 3WIMA 1MI0A 2B3AA 4LDTD 4C7ZA 4B6WA 3RCZA 3C19A 1CQVA 3BK1A 1EO6A 4OZAA 2DLBA 1HTOA 2WNMA 4GN1A 3EFUA 3HUIA 3NOBA 2BT6A 1SXTA 2MBOA 1AARA 2ZW0A 2LVPA 3GZNB 3R7QA 2PKOA 4A6QA 3A4RA 1QLBB 4FXCA 3KVFB 3B2GA 3O65B 2H88B 2K5PA 3BZDB 3RNCC 2GMIC 2M56B 2KYWA 3DWMA 3IG3A 4DQOC 2N1WA 1TZOA 3DOWA 3MC8A 3ZJUA 1MJDA 2RR9A 2WDVB 4LCDE 2W3SA 1WGGA 4WJPA 2D3GA 2KACA 4WJNA 1WI0A 2NTSA 3QWZB 1KFYB 2G4DB 2AL6A 4IOIE 2MQJA 3E9SA 2KLCA 2NR2A 2C7MB 4FHKA 1T0QC 3BK2A 2KX3A 4L23A 5EE1A 4K1RB 4YL8A 5DPSA 2WXPA 4EKUA 1SB3C 4C00A 2CHXA 4LTUA 4KIKA 4YTMB 2V3NA 4NPNA 4WQMA 3P4RB 2BQQA 3HM3A 4D2KA 1TBEA 1WWTA 5E6NA 2N7JA 3U7DA 1DYQA 4HPLB 5J18A 1WGRA 5D3DA 3V6CB 4XDDA 1EF5A 1MHXA 2J53A 1WFYA 2J42A 1NVID 3NG0A 2L7RA 1UH6A 2K3UA 1P7EA 1I4QA 2HDEA 4CHKA 3NZ3A 4NAWB 3GP7A 2MA9B 4MEMA 2BF8B 1ZPSA 1I4GA 4W9JA 3SU8X 4KVGB 3V05A 1TZ1A 2MH7A 5TR5A 2YVCA 1SE4A 3OG5A 4KSKC 1YMHE 2D3CA 3VUWA 1TYGB 2LHDA 2FBWB 2DZMA 2KNBA 3NHEB 1UD7A 4IM3A 3RNGC 2KMMA 4GB9A 2K6QA 3NY5A 2FNJB 2VRRB 4RCOA 2GOWA 1YN5A 1EWYC 2IO1B 1K51A 4NQKE 4YTNB 3L13A 4DHJB 2WXFA 4ARIA 2HTME 3ZXRA 3RPFC 3TEYA 3L0WB 3SR6A 1JQ4A 2R2QA 1T5XD 2JT4B 2BWES 3ZQ4A 2NPTB 4WWNA 1P7FA 5AUKA 1FRDA 3ZTDA 3R8BA 1E8XA 3DVGY 3P4QB 4ICVA 3ML8A 2JQRB 4HPMB 4IW0A 4RF1A 3TUOA 3BYTB 3RI7C 4USAA 2LXAA 3KQ4A 3SFDB 2JRHA 2PVGC 2ZCCA 4TQ0A 1FEHA 1WXMA 2WXKA 4MH0E 1SE3A 1XLQA 1JROA 2LEKA 2LGYA 1I4PA 2W82A 3HIZA 2KDEB 1VZ8A 1A5RA 2AQ3B 4CYEA 4NJCA 3T3OA 4HXDA 3U30A 4US8A 1HEZE 2N0SB 2EMTA 2IYDB 2I38A 2W9NA 2WXJA 1WGDA 1XQQA 3UIOB 5AZFA 2MHJA 2J0KA 3AM9A 3PLVA 3N3KB 4A9AA 1HQRD 2CHZA 3APDA 3FAHA 4MM3B 1WZ3A 3Q3MC 3I57A 1ZOYB 5D6JB 4LK0M 1CK1A 4XC2A 1N62A 2Y5BB 3L17A 2LMCA 2MBEA 2JXXA 3BVGA 3ZDMC 3Q3NC 3PTFC 3DBRB 2JWUA 4RGTA 1F9JA 1OQYA 1XLPA 2BKFA 4MSQB 2D5GA 4A8XC 1WH3A 2NPTA 4HDQA 5BMGA 1LXDA 3HK0A 4IM2A 3GE3C 1J0GA 4HRSA 1QQRA 4GDLB 2PVOD 2GBKA 2W54A 2A4ZA 4IKGA 4IDIA 2KDFB 4C7YA 5J17A 1VJKA 3R2IA 2JSVX 3APCA 2AYOB 4BKSA 3I63C 4HJKA 1E8ZA 3AXCA 3K9PB 3DVNV 2XN9C 4RGOS 3NVZA 3A33B 2ZZPB 5AEKB 1WY8A 3NVYA 1PGAA 5AZGA 4KV2A 1BMLC 4IM0A 2WXGA 2KANA 5DCNA 3W1SA 2G4SA 2V0GA 2K39A 2KD0A 1ZDXA 1LQBA 5DPWA 2ZW1A 1SE9A 1ZE3D 1C9FA 1E6EB 3NVVA 3X23A 1IYFA 4MM3A 4A3OA 1N63A 1UWMA 3PZ7A 3TCAA 3B1LX 4P1CC 3JVZX 2DENB 3BYYB 4AOFA 3EHVA 2HTHA 4KGSA 3SDLC 4ZYSA 4KZ0A 1ET6A 4BOZB 2AQ1B 2KZRA 2N9LA 1CZPA 1YJ1A 1UGMA 1KLGD 3U4EG 3PSEB 2V1YA 3UIPB 4KGRA 3RT3B 4WJOA 2QMTA 2INDC 4CQNA 4ANWA 1K50A 4REZA 1P3QU 2OOBB 4HCPB 2KMCA 1LGRA 1YQ4B 3AECB 4FLHA 3HVZA 4OVZA 4KDLB 1STEA 4WIPA 3B08A 1WM2A 4GDLA 3UQAA 3OLMD 2K8HA 1TKGA 3DDCB 4YSZB 4HWIB 2L76A 4DBGA 3KUZA 2KQSA 2JZ3B 4DDGD 4ZHOA 4YTPB 2LGDA 2C7HA 3KYDD 4RNAA 2UU7A 4MELA 4W9EA 2Z0EB 2SEBD 4P6VF 1ISNA 1HZ5A 3LJ3A 2K25A 4N59A 3VXWA 5HG2A 2WXIA 2GBNA 2WHIA 4OVVA 3T9LA 1PUTA 2FCMA 3DBHB 2XK5B 2KDBA 2KK8A 3CSFA 2LJ5A 3DBLB 1R4MB 4M01A 2YLMA 1RRBA 5C1ZA 4J6IA 3AE3B 4II3B 2BYVE 2M8SA 5G55A 2R61A 5D3IB 1OQQA 4DXAB 1FCCC 1IGDA 2N9KA 3PHXB 4K81A 1KJTA 2N4FA 3HVDA 3EC8A 2L52A 1VR9A 2DZJA 3R2TA 5J2RA 2I1JA 1WRIA 1E0ZA 2NVUI 4M00A 4LNKA 5LXHA 3BY4B 1GOZA 1LO5D 3N32A 3LB8C 4DXFA 3AU4A 1RWSA 3V61A 1TY0A 2KTFA 3L54A 2GRIA 3LDZE 1I4RA 3Q8EA 2WLBA 4MGZE 4NZLB 3PT2B 2KO3A 5LNK1 5CTRC 4R3DA 4PK1A 2DYBA 4US9A 2WXRA 3SEBA 3RNFC 3AMZA 2Z59B 1CMXB 2K6DB 4ACFA 2C7NB 3X0WA 3GS2A 3IT4B 1F77A 1QKZA 2AX5A 2FCQA 2K1FA 4YSXB 3TIXA 4M8MA 1QOAA 2EMSA 4KZCA 1QOFA 2XK5A 2K8CA 2JPHA 1SE2A 1F52A 2ZCBA 1YN4A 3AE2B 2ZEQA 3QAQA 2LRWA 1E8YA 2DAJA 4MJSA 3TEZA 1NEKB 1J7CA 1UBQA 4YXDB 1MG8A 2C60A 2IY0B 1ROEA 3PPAA 3QQ8B 4GLSC 1YOVB 5BMHA 3L10B 1TS3A 3M62B 3AEAB 3L4PA 1F2RC 5E6PA 2YEPF 1E90A 3OAWA 2MX2A 2E6XA 4NQLB 4PT5A 3WAMA 2L8JA 4MGIE 2BS3B 4W9CA 2IO0B 3QX1A 3ZDTA 2L00B 4F8CB 3IT6B 1TGZB 1TJEA 1HZ6A 3FILB 3I3TB 2Q5WD 1V81A 1F1HA 3ZRCA 1B1ZA 2J0JA 4RMAA 3I9V1 1KLUD 4K7UA 2Z8LA 4G3XB 4RM9A 2DWQA 2PEAA 4LDTB 2ZVOA 1WE6A 4KGTA 1KH0A 4C4VB 2G3QB 3PVLA 1V8CA 4I6PA 1EWCA 4A20A 3V62A 2KVRA 1D5MC 3ENEA 3IFWB 3UI3A 1PGXA 4FJZA 5E6OA 4AP4C 4JE3B 2D11A 1YX6B 1NI3A 3A9KB 3I5JC 3N1ZC 5CX3A 4YSYB 4HCNB 2SAKA 3VUXA 5IKCM 4ARCA 5GMVA 1BXTA 2MBQA 2IDYA 1L4ZB 2LI5A 2JUOA 1UNSA 2KJRA 5MPOA 3PRZA 4HKZE 1A70A 3P2BA 1E10A 3CF6E 1JWAD 3H7PB 2VZKD 1DOIA 1JALA 4A90A 1WX9A 3RNEC 1C4AA 4DDID 3DCGA 4CO7A 3A9JB 1WXQA 1ET9A 1IUEA 4AUQC 1TY2A 2LVQA 1XF5L 3JYUA 2LGXA 4II2B 3FILA 3UQBA 2KWCA 3IXSA 2KHWB 2N1VA 1QOBA 2WS3B 1ZW7A 3DBHI 2RMMA 1JRPA 3DBLI 1YJJA 2HJ8A 5C3JB 2KJ6A 4O1NA 3KLSX 3QC8B 4C4VA 4BAXA 1QILA 3KW5B 3B9JA 4NY0A 3KWVA 4EZKA 4WJQA 2V9HA 4AJWA 4EEWA 1M4VA 1R4NB 3VVWB 4HLEA 1C76A 3P4SB 1CJEA 2O6VD 1N5XA 3Q8AA 1IGCA 1TS4A 2WQYB 3R7RA 4WH4A 1GPXA 3Q69A 1QOGA 2MWSB 2KDIA 1K52A 3A9KA 2PE6B 3URYA 3AE5B 3Q3OC 1HXYD 3PO0A 1KRHA 3MC9A 4EZLA 1DOYA 1E9MA 2RGFA 2WWZA 3ZXVA 1SSNA 3KWLA 4JL9A 4YWGG 1WMHB 3ZUNA 4LNNA 1N6ZA 1XO3A 1JCKB 3RD2A 3PRMB 1XT9B 3V6EB 4HROA 1BUIC 1YNTE 2JWZA 3H6NA 3A9JA 1T6BX 2FIDA 3IBEA 5BO4B 2G1EA 1MFWA 2DBYA 3B0AA 3V3XA 2QEJC 3DBSA 2LJIA 4J3OD 2BB5A 4JLCA 4RFBA 3RFZB 1UUPA 3VH3B 1AYFA 4K3BA 3OJ4B 1PYWD 2JYTA 3VAWA 3QA8A 2CU1A 5CHWA 1FFVA 4TSSA 1C4PA 1FFUA 1L5PA 2XBBC 4WURA 3DHGC 3PV1A 1OFFA 4GU2A 4NAWA 2QHOA 4BZAA 3QHTA 2ZNVC 1D5XC 3ZO5B 4ANXA 1SEBD 2AEHA 1Q10A 1K8RB 3GB1A 5IN7A 3HRDD 3QJZA 4PS7A 3JW0X 2BYEA 3FKYA 3KH0A 2VH1A 4M0WB 2J52A 2NBUA 1NENB 3L16A 3AI5A 4ZRKA 4KDIC 3TEWA 2WX1A 1FXAA 3PLUA 1WMHA 2DAFA 4GXBA 2ASQA 2BBCA 2GB1A 3H1UA 1YD8U 4E3CA 2QCZA 3TBLD 1Y56A 1V97A 1EUVB 5CHFA 1Q0WB 3C8YA 3HHMA 1HTQA 1WM3A 4TQ1A 3AEBB 1I4XA 2AL3A 4B9KA 2KT7A 3EGRA 2WXLA 1WSPA 4XYCA 1P9DU 3WA0A 1V5TA 3GZNI 4MDKE 4ZOHC 1XD3B 4P16A 5EE0A 2IJ0A 2MJEA 1P0RA 2JZPA 4K3CA 2MP2B 1TT5B 1HA5A 3ZGZA 2PW9A 2BPSA 2KFJA 2X8XX 2D10A 2WXMA 4XWWA 2D3BA 1IPGA 1V86A 3TSSA 2GBJA 3EECA 4DHZE 1T0RC 1WXAA 1RYJA 3NVWA 4E71A 2J0MA 1WYGA 1KF6B 3ZJTA 1EU3A 1I42A 5FR6A 3BVZA 1ENFA 4NJ6A 2GBMA 1WJ4A 2LGIA 2LGSA 4BOSC 1L4DB 5CHVC 4M02A 4AJYB 4OZBA 2KC1A 2KX0A 2QIEB 1WX7A 3IAM1 4RGMA 3MTNB 4F7ZA 4MACA 4K7SA 1Q1OA 3A4SC 1FNWA 2CR5A 1XLNA 1E8WA 3N1XC 3U52E 3IVFA 2BS4B 2Y5CA 3AEGB 2K8BA 2FUHB 3BWUD 2TSSA 1I35A 4KX6B 2KLGA 2RDHA 3QCAA 1WGHA 1GG3A 3CWIA 2JZZA 4H2AA 2AWTA 3VH4B 4P1BC 2C5LC 1WR6E 3WCQA 2RDGA 1R4NI 2FCSA 3MJWA 4PS3A 3L08A 3AE6B 1SIFA 2V3SA 2MP2A 3NZSA 5BMIA 4W9KA 3AE7B 5DPRA 5D7GA 1V5OA 1QF6A 3ZKJC 4AQ7A 1E5WA 3PS6A 2MLBA 2MW5A 2IPKD 5G2NA 2JU6X 3QIJA 2WXQA 3AULA 4GDKB 2YEPB 1WJ6A 3LYYA 2ICIA 1V80A 1WRDB 5EE3A 1S3SG 2RDBC 2WX0A 1PGBA 3VHTC 1ZDVA 2KN5A 2CJNA 2OJWA 3BVMA 1TKEA 2E3TA 2WDRB 5AUIA 3PGEA 1QT9A 3ZNZB 2IO2B 1E7PB 2BB6A 1TS2A 1T3QA 3W2DA 3R66C 3A1QB 4W9FA 3MHZA 4X57B 5I4DA 1GC6A 3DPDA 4NJ7A 2DYOA 3VTWA 2K22A 3MFGA 3EA6A 4ZRIA 3VQIA 2C9WB 4HEA1 1ZUD2 1L6UA 2CU3A 2INNE 3RUIB 2MRPA 3ZNHB 2KQ7A 1RFKA 4LLGM 2LXCA 1C77A 3FC4A 4K7WA 2N9XA 3CSTA 4FULA 1EF1A 2I2YA 1WYWB 4BKTA 1JWSD 1OTRB 1WR1A 3AE1B 3APFA 3N1YC 2IGGA 1P1AA 1HE8A 3OJ3A 4GGQA 2KDMA 2ZPNA 3ETRA 4JX1C 1FPYA 4W9HA 5TSSA 4PYZA 5HI1A 3RMKC 1NI2A 4GOCA 2UYZB 4ITKA 1JMLA 2BYFA 1VLBA 1R7SA 4GIVA 1V2YA 5D94A 1J19A 1TKYA 3ALBA 1WF9A 3RZWC 1WXVA 1YJIA 3B2FA 2DHZA 5E6JA 2JYEA 2INPE 1T0YA 4IWPA 2MSED 3IHPC 1D6EC 3DBRI 2W3RA 2MCNB 3WANA 3A1QA 2LVOA 4IC7B 1AN8A 2QDFA 2EKEC 3ZTCA 5IP4D 1NYRA 4EE2A 1C3TA 1UZXB 3Q2AC 3AB5A 1Z2MA 3N30A 2BYTA 1SJHD 1Z5SB 2L05A 4L2YA 2L1AA 3J9CA 2BGFA 5DPTA 1VCBA 5C23A 2JY6A 1ACCA 5C2TB 1YQBA 4JPSA 3AH7A 3VTVA 3P1MA 2BS2B 3EFCA 3ABVB 3W5VB 1KM7A 2N9PC 3TJPA 3PHWB 1M94A 4RH6A 4FBJB 3K9OB 2XEWA 1S1QB 1PFDA 1SGHA 4B95A 2RPVA 2LWPA 2FCNA 4BBNC 4C80A 2M4NA 2JVCA 1FNVA 1GB4A 3RYTA 2D07B 2GLSA 2FAZA 2J7QB 3NJTA 4JWSC 2B76B 2DZKA 1GNUA 5H8YE 3RN9C 2QILA 1ZXHA 2Y3AA 3CMMB 3DVNU 4EZJA 4W9DA 3RNBC 4IG7B 2QSDA 1KTKA 5FK9C 3P4PB 3ZNID 3PZ8A 4ZDVA 1U4AA 2WXHA 3W1SC 2PMVA 1N61A 3W9CB 1D4BA 3O13A 2PTLA 2V3PA 1KLVA 4GMVA 1TTNA 4S0RA 3MHSD 3ZVVA 3ZYYX 2NS5A 1XEEA 4KKIA 1I4HA 2KN4A 4NAMA 4ANUA 1UGJA 4WAFA 2DNFA 2KAJA 3JSVB 2IY1B 4ZRJA 1LM8B 1FO4A 4ANVA 2L83A 1H8CA 2EELA 3NS1A 2HJ1A 2M19A 3WALA 2N7EA 2VZKB 1JWBD 3IAS1 5BYSA 1VD2A 2CHWA 4MGYE 2M0XA 2PPHA 5FKAC 1WE7A 1L0YB 3HM6X 4HVBA 4URKA 2X38A 3H8HA 1R4MI 3ML9A 4LNOA 3N20C 1MVKA 5HFYA 4WWOA 3Q3JA 5IOIA 1FD6A 2MJ3A 2KVZA 1N5WA 2NTTA 4ZRQA 5L95C 2KWDA 5EE9A 4HDOA 2KWVB 1FXIA 3BINA 4ZRPA 2GBRA 2BWFA 4A3PA 4G11A 5BYRA 4N6EB 4XDCA 1C4CA 1E7VA 2D2QA 4ASWC 2OEDA 2O6VB 1FIQA 4W9IA 1YX5B 3SD5A 2K0PA 2BW2A 2O2VB 2ACZB 4HPPA 1L0VB 5IAAC 1J7AA 1Y8RC 2KMAA 3MP9A 2MBBB 3H7PA 3JSVA 4W9GA 3UF8A 4B0EA 4LJPB 3KYCD 3OWEB 1D3ZA 1XCTL 4AWJA 4WAAA 4DHJD 1MPEA 2G9HD 5FR3A 1IP9A 2KC2A 5JHAA 1RFAA 2M1MA 3H9DA 2QC8A 1L7YA 1FNUA 2BKRB 3TL5A 2FUG1 3ZLZA 1XLOA 1E7UA 3VRBB 4IUMB 3AEDB 1XCQL 2NBWB 1N60A 2LHEA 4QAYA 2JF5A 4ICUA 3MJ5A 3S2AA 3VR8B 2LUMA 2DZIA 4I6LB 4BKSD 2DYMA 1JRUA 4MH8A 3ONSA 3RZFA 2ZPYA 3VRAB 1FXTB 2W55A 3M95A 1I7HA 3W5UB 2BVCA 3NZUA 1VDVA 4XE0A 2WXOA 4ZHPA 2O6VA 1J8CA 4B0MA 2KJHB 1RM6C 1XXGA 1RAXA 3LXFA 4JQWC 2O2VA 3T8MA 2MBHA 4ZYNA 3AN1A 2LASA 4XZ4A 4JIOU 2WP9B 1YN3A 1VRAB 4OVUA 3V60A 1EU4A 2RPQA 4FA6A 3VDZA 1WGYA 3AE9B 2UWQA 3BIID 3GE8C 2G45B 2L0FA 4HKQA 1ZGUB 4Q2JA 2WDTB 3DQVA 4XWTA 1OEYJ 2M17A 2LFIA 2H89B 3PRPB 5T8IA 3NUHB 2ZJDA 1SBBB 2WU2B 1TIFA 4TKNA 1BT0A 1WGKA 5IA7A 4LNIA 2EKIA 1GC7A 4LJOB 4N58A 4BKGA 3D32A 4G50A 5LXIB 2GI9A 4EOYA 4MT5A 2PE9A 3Q6BA 2NMQA 1GJZA 4WWPA 2INCC 1AW7A 2WU5B 3W1YA 3TMPB 3RULA 2IBIB 2MJDA 2QJLA 3AE8B 4F1SA 1GUAB 4W9LA 2CJOA 1C78A 4A55A 2KXJA 1L2NA 3VR9B 1P98A 2WYQA 2DX5B 2KTRB 4PYUA 1YQ3B 2JX5A 4HJGE 1L0XB 1WZ0A 2KKCA 1WJNA 2N7DA 4M0WA 2N9EB 3AE4B 5G5HA 4JGHB 4TV3A 2RSUA 5JHBA 5D2MB 1V1PB 2FE8A 3Q14C 3SFEB 4KSLC 4GSWA 1ZKHA 5EDSA 3C0RB 1FMAD 1V6EA 2PJHA 4IWQA 1JWMD 4BBNF 3M63B 1WJUA 2VH2A 2IZVB 1B9RA 4DHZB 1QZEA 4S17A 5IO9A 2KFKB 4E74A 1KOTA 3U7ZA 5KHOA 1ZXIA 4DK5A 2FIFA 5L83A 2V4LA 1JWUD 1SJED 3AV8A 4TMAB 2J4XA 1MG4A 2Z0DB 3T3NA 1K53A 3DHIC 4OW0A 3MC0B 2LRUA 3ZIMA 4G0NB 1V49A 2AQ2B 3Q8BA 1OQRA 2JXTA 1C1YB 2PLPA 4FJYA 4IWOA 3DHHC 1GAQB 4FN2A 4TUUA 1NDDA 3VFKA 2ONQA 2KWUB 3WAPA 1DOXA 3Q8FA 1ESFA 2KTRA 3PZDA 4DXGA 4RM8A 4EUTA 5JH5C 4MGKE 3M3JA 4EFOA 5JXVA 4NNJB 2ZNVB 4RF0A 2OHFA 2JRIB 2R2OA 1F2RI 3EUB2 3AU5A 4BFRA 1V9JA 1V1PA 2V4IB 3TEXA 1UELA 1SIJA 1UF0A 2A5UA 2M0AA 3ECIA 3NS8A 3RNAC 1FCLA 5JZEB 1OGWA 4WQOB 2CS4A 1NYQA
chains in the Genus database with same CATH topology
4MJSB 2A4ZA 2FAZA 2J7QB 2KDFB 5J17A 2DZKA 1GNUA 3VTUA 3RD2A 4XX5A 4HK2A 3PRMB 3UGBB 3APCA 3CMMB 4FHJA 2AYOB 1XT9B 4BKSA 3ZNGC 3DVNU 3V6EB 4EZJA 4HJKA 3KUCB 4W9DA 2JWZA 1E8ZA 2KFKA 2FIDA 1X1MA 3A9JA 3AXCA 3DVNV 3H6NA 3K9PB 4IG7B 3IBEA 5BO4B 3ZNID 2NBVB 3A33B 2LUEA 2ZZPB 4ZDVA 5AEKB 1U4AA 3B0AA 1WY8A 3W1SC 5AZGA 4KV2A 3DBSA 4IM0A 2ZVNA 2KANA 3Q3FA 4JLCA 5DCNA 3W1SA 1KLVA 4GMVA 2G4SA 3VH3B 2I1KA 1TTNA 3OJ4B 2K39A 2KD0A 1LQBA 3VAWA 3ZW3A 3QA8A 3WAOA 5DPWA 1SE9A 2CU1A 3MHSD 3R3MA 5CHWA 3ZVVA 3X23A 1LFDA 1G6JA 4GDKA 2NS5A 1IYFA 4MM3A 4A3OA 1RLFA 2XBBC 3TCAA 2L3ZA 3PV1A 4ANUA 3JSVB 2IY1B 3B1LX 3JVZX 4GU2A 4ZRJA 1LM8B 2DENB 1YIWA 4AOFA 4NAWA 3EHVA 2HTHA 4ANVA 1WXSA 2LD9A 3SDLC 2QHOA 1NBFC 1H8CA 4KZ0A 3QHTA 4BOZB 2KZRA 1YJ1A 1UGMA 3ZRFA 2ZNVC 3PSEB 2V1YA 3ZO5B 2L0TA 3UIPB 3WALA 3RT3B 2N7EA 4ANXA 2AEHA 4I6NB 4WJOA 2NCNA 2HE7A 1K8RB 4ANWA 1VD2A 2CHWA 4MGYE 1P3QU 1WIAA 2M0XA 2OOBB 2PPHA 1WE7A 3QARA 4HCPB 1PQSA 2KMCA 3U8ZA 4FJVB 3HM6X 1OEYA 3QJZA 4PS7A 3JW0X 4HVBA 2BYEA 2HD5B 3QK0A 3KH0A 5HKHA 4M0WB 4FLHA 2NBUA 4URKA 3L16A 3AI5A 4ZRKA 4KDIC 4KDLB 1Q5WB 1R4MI 2WX1A 3B08A 1WM2A 3ML9A 4GDLA 3UQAA 3PLUA 1WMHA 3OLMD 2K8HA 2DAFA 5KHQA 4GXBA 5AZHA 2ASQA 4WWOA 3DDCB 3Q3JA 4DWFA 4HWIB 3H1UA 3DVGX 1YD8U 2L76A 4E3CA 4P7IA 2RD0A 4DBGA 3KUZA 3TBLD 3GOEA 4PS8A 1EUVB 3SHQA 2KQSA 2JZ3B 4N9F4 5CHFA 4DDGD 2LGDA 3H7SA 5L95C 1Q0WB 2C7HA 3KYDD 3HHMA 1WM3A 4TQ1A 4HDOA 4MELA 4W9EA 2Z0EB 2KWVB 1ISNA 2AL3A 4MSMB 4B9KA 3BINA 3LJ3A 2IO3B 2GBRA 3PREA 2K25A 2LZ6A 2BWFA 4A3PA 3VXWA 1P9DU 4G11A 4M8NA 3KUDB 2GBNA 3WA0A 4OVVA 3T9LA 2REXA 2FCMA 1V5TA 1E7VA 2D2QA 3GZNI 4FADA 4MDKE 2XK5B 4ASWC 4BVUC 1XD3B 2KDBA 1WX8A 2KK8A 2O6VB 3CSFA 1UBIA 2KOXA 2LJ5A 4W9IA 1H4RA 1YX5B 2YLMA 1P0RA 1RRBA 2CKHB 2OJRA 3SD5A 3UINB 3VUYA 5C1ZA 2MP2B 4J6IA 4KIKB 2O2VB 5LLIA 4II3B 2BYVE 3WIMA 2B3AA 4LDTD 2M8SA 5G55A 5IAAC 1Y8RC 2BPSA 2KFJA 2KMAA 4DXAB 2D10A 2MBBB 3H7PA 3JSVA 4W9GA 3UF8A 4B6WA 4LJPB 3RCZA 3PHXB 3KYCD 1EO6A 1IPGA 1V86A 4K81A 1KJTA 1D3ZA 2N4FA 2GBJA 3EECA 4DHZE 4AWJA 1WXAA 4GN1A 4WAAA 4DHJD 3EC8A 3EFUA 4E71A 3NOBA 2J0MA 1IP9A 5J2RA 2DZJA 2I1JA 2MBOA 2KC2A 1AARA 1I42A 5FR6A 2LVPA 3R7QA 4NJ6A 5JHAA 1RFAA 2GBMA 2M1MA 2NVUI 3H9DA 5LXHA 3BY4B 3A4RA 1L7YA 3N32A 1WJ4A 2BKRB 3KVFB 3AU4A 3TL5A 3V61A 3O65B 2KTFA 3ZLZA 3L54A 4BOSC 5CHVC 2GMIC 1E7UA 4AJYB 4IUMB 3IG3A 2N1WA 2NBWB 2KC1A 3LDZE 3DOWA 2KX0A 2JF5A 4ICUA 1WX7A 3S2AA 4F7ZA 2RR9A 3MTNB 4K7SA 4LCDE 1Q1OA 3A4SC 4MGZE 1WGGA 2CR5A 4WJPA 2D3GA 3PT2B 2KO3A 2DZIA 4WJNA 5CTRC 4I6LB 4BKSD 2DYMA 1E8WA 2DYBA 3IVFA 1JRUA 1WI0A 3ONSA 3QWZB 2G4DB 2K8BA 3RZFA 2FUHB 2ZPYA 2AL6A 2MQJA 1I35A 1FXTB 2Z59B 1CMXB 2K6DB 2KLGA 2KLCA 2C7NB 2NR2A 3M95A 3X0WA 2C7MB 3QCAA 1WGHA 4FHKA 1GG3A 2FCQA 2JZZA 2K1FA 3TIXA 4M8MA 3NZUA 2EMSA 2AWTA 4KZCA 2KX3A 2XK5A 2K8CA 2JPHA 3VH4B 4K1RB 2C5LC 2O6VA 1WR6E 2ZCBA 1J8CA 2KJHB 1R4NI 2FCSA 3MJWA 2ZEQA 4YL8A 5DPSA 4PS3A 1RAXA 3L08A 4EKUA 1SIFA 2CHXA 2MP2A 2V3SA 3QAQA 2LRWA 1E8YA 4JQWC 3NZSA 2O2VA 4KIKA 4W9KA 3T8MA 2MBHA 4NPNA 2DAJA 4ZYNA 4MJSA 2LASA 5DPRA 4XZ4A 5D7GA 1V5OA 3HM3A 4JIOU 1TBEA 1UBQA 5E6NA 4OVUA 3ZKJC 3U7DA 1MG8A 3V60A 2C60A 2IY0B 4HPLB 5J18A 1E5WA 1WGRA 2RPQA 4FA6A 3PPAA 3PS6A 2MLBA 3QQ8B 3V6CB 2MW5A 3VDZA 1WGYA 2UWQA 1EF5A 3L10B 3M62B 1WFYA 5G2NA 2G45B 2L0FA 3QIJA 1ZGUB 5E6PA 3AULA 4GDKB 1WJ6A 2WDTB 3DQVA 1V80A 1WRDB 1OEYJ 2L7RA 1S3SG 2M17A 1UH6A 2WX0A 3VHTC 1E90A 3OAWA 2MX2A 3PRPB 4CHKA 2KN5A 4NQLB 2ZJDA 4NAWB 4TKNA 3WAMA 2L8JA 4MGIE 1BT0A 3PGEA 4W9CA 2IO0B 3ZNZB 5IA7A 3QX1A 3ZDTA 2L00B 2MA9B 4MEMA 4F8CB 2BF8B 2IO2B 4LJOB 1TGZB 3D32A 4W9JA 4G50A 3SU8X 4KVGB 4BKGA 5LXIB 3I3TB 1TZ1A 4EOYA 2PE9A 3R66C 3A1QB 4W9FA 1GJZA 4X57B 5TR5A 1GC6A 2YVCA 3DPDA 4NJ7A 4WWPA 1V81A 2DYOA 4KSKC 3VTWA 3ZRCA 2J0JA 4RMAA 3W1YA 4ZRIA 3TMPB 3VUWA 3VQIA 3RULA 2C9WB 2IBIB 4K7UA 2DZMA 2KNBA 3NHEB 4G3XB 4RM9A 2PEAA 4LDTB 4F1SA 1GUAB 1UD7A 2ZVOA 4W9LA 1WE6A 4IM3A 2G3QB 3PVLA 4GB9A 2KXJA 2K6QA 1L2NA 3NY5A 2FNJB 2VRRB 1P98A 2GOWA 2WYQA 3RUIB 2DX5B 2KTRB 2MRPA 4I6PA 4PYUA 2IO1B 3ZNHB 4NQKE 2KQ7A 4A20A 3L13A 4DHJB 2LXCA 4K7WA 3V62A 2KVRA 1WZ0A 2KKCA 2N9XA 3CSTA 1WJNA 2N7DA 4FULA 2N9EB 1EF1A 3ENEA 1WYWB 3IFWB 4BKTA 4FJZA 5E6OA 3L0WB 4AP4C 1OTRB 1WR1A 1YX6B 2D11A 4JGHB 4TV3A 2R2QA 3APFA 3A9KB 2RSUA 2JT4B 2BWES 5D2MB 1P1AA 5JHBA 1HE8A 2NPTB 3OJ3A 4GGQA 2ZPNA 4WWNA 5CX3A 4HCNB 3ZTDA 4KSLC 4W9HA 3VUXA 4PYZA 4GSWA 1E8XA 5GMVA 3DVGY 2MBQA 4ICVA 3ML8A 1NI2A 4HPMB 4IW0A 2LI5A 1ZKHA 4GOCA 5EDSA 3C0RB 2UYZB 1V6EA 2PJHA 2JUOA 2LXAA 2KJRA 2BYFA 4IWQA 4GIVA 3PRZA 2JRHA 4BBNF 1V2YA 3P2BA 5D94A 1J19A 3CF6E 3ALBA 3M63B 2ZCCA 3H7PB 4TQ0A 1WJUA 1WXMA 1WF9A 4MH0E 3RZWC 2IZVB 1WXVA 1WX9A 4DHZB 4DDID 3DCGA 1QZEA 4CO7A 2LGYA 2KFKB 3A9JB 3HIZA 4E74A 2DHZA 1KOTA 2KDEB 5KHOA 1A5RA 4AUQC 4DK5A 2FIFA 2LVQA 5L83A 4CYEA 2V4LA 3JYUA 1T0YA 2LGXA 4II2B 4IWPA 4HXDA 3UQBA 2MSED 3IHPC 3DBRI 2MCNB 3U30A 3WANA 2Z0DB 3A1QA 2EMTA 2IYDB 2KWCA 2LVOA 4IC7B 2W9NA 2EKEC 3ZTCA 1WGDA 1XQQA 3UIOB 2KHWB 2N1VA 2CS4A 5AZFA 1ZW7A 3DBHI 1C3TA 1UZXB 2LRUA 3ZIMA 1Z2MA 2J0KA 3N30A 3DBLI 3PLVA 4G0NB 1Z5SB 3N3KB 2HJ8A 2L05A 1V49A 2CHZA 2KJ6A 1C1YB 3APDA 4FJYA 4IWOA 1WZ3A 3QC8B 4FN2A 4TUUA 5D6JB 1NDDA 2BGFA 3VFKA 5DPTA 3KW5B 4NY0A 3WAPA 2KWUB 1VCBA 5C23A 4EZKA 4XC2A 2Y5BB 3L17A 4WJQA 2KTRA 2JY6A 3PZDA 4AJWA 4EEWA 4RM8A 3VVWB 4HLEA 2MBEA 4EUTA 5JH5C 1YQBA 2JXXA 2O6VD 4MGKE 3M3JA 4EFOA 3ZDMC 3PTFC 3VTVA 3R7RA 1F9JA 1OQYA 2MWSB 2ZNVB 2KDIA 4NNJB 2BKFA 4MSQB 1KM7A 2JRIB 2R2OA 3A9KA 2PE6B 2N9PC 4BFRA 3AU5A 1V9JA 3PHWB 1WH3A 3TJPA 1M94A 2NPTA 4FBJB 3K9OB 4EZLA 2XEWA 1S1QB 1UELA 4HDQA 1LXDA 2RGFA 1SGHA 2WWZA 3HK0A 4B95A 3ECIA 4IM2A 2A5UA 1J0GA 2LWPA 3NS8A 2FCNA 4BBNC 2M4NA 2JVCA 4JL9A 4GDLB 1WMHB 3RYTA 5JZEB 2D07B 1OGWA 4WQOB 2GBKA 1GC7A 3ZUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MJS B;  2A4Z A;  2FAZ A;  2J7Q B;  2KDF B;  5J17 A;  2DZK A;  1GNU A;  3VTU A;  3RD2 A;  4XX5 A;  4HK2 A;  3PRM B;  3UGB B;  3APC A;  3CMM B;  4FHJ A;  2AYO B;  1XT9 B;  4BKS A;  3ZNG C;  3DVN U;  3V6E B;  4EZJ A;  4HJK A;  3KUC B;  4W9D A;  2JWZ A;  1E8Z A;  2KFK A;  2FID A;  1X1M A;  3A9J A;  3AXC A;  3DVN V;  3H6N A;  3K9P B;  4IG7 B;  3IBE A;  5BO4 B;  3ZNI D;  2NBV B;  3A33 B;  2LUE A;  2ZZP B;  4ZDV A;  5AEK B;  1U4A A;  3B0A A;  1WY8 A;  3W1S C;  5AZG A;  4KV2 A;  3DBS A;  4IM0 A;  2ZVN A;  2KAN A;  3Q3F A;  4JLC A;  5DCN A;  3W1S A;  1KLV A;  4GMV A;  2G4S A;  3VH3 B;  2I1K A;  1TTN A;  3OJ4 B;  2K39 A;  2KD0 A;  1LQB A;  3VAW A;  3ZW3 A;  3QA8 A;  3WAO A;  5DPW A;  1SE9 A;  2CU1 A;  3MHS D;  3R3M A;  5CHW A;  3ZVV A;  3X23 A;  1LFD A;  1G6J A;  4GDK A;  2NS5 A;  1IYF A;  4MM3 A;  4A3O A;  1RLF A;  2XBB C;  3TCA A;  2L3Z A;  3PV1 A;  4ANU A;  3JSV B;  2IY1 B;  3B1L X;  3JVZ X;  4GU2 A;  4ZRJ A;  1LM8 B;  2DEN B;  1YIW A;  4AOF A;  4NAW A;  3EHV A;  2HTH A;  4ANV A;  1WXS A;  2LD9 A;  3SDL C;  2QHO A;  1NBF C;  1H8C A;  4KZ0 A;  3QHT A;  4BOZ B;  2KZR A;  1YJ1 A;  1UGM A;  3ZRF A;  2ZNV C;  3PSE B;  2V1Y A;  3ZO5 B;  2L0T A;  3UIP B;  3WAL A;  3RT3 B;  2N7E A;  4ANX A;  2AEH A;  4I6N B;  4WJO A;  2NCN A;  2HE7 A;  1K8R B;  4ANW A;  1VD2 A;  2CHW A;  4MGY E;  1P3Q U;  1WIA A;  2M0X A;  2OOB B;  2PPH A;  1WE7 A;  3QAR A;  4HCP B;  1PQS A;  2KMC A;  3U8Z A;  4FJV B;  3HM6 X;  1OEY A;  3QJZ A;  4PS7 A;  3JW0 X;  4HVB A;  2BYE A;  2HD5 B;  3QK0 A;  3KH0 A;  5HKH A;  4M0W B;  4FLH A;  2NBU A;  4URK A;  3L16 A;  3AI5 A;  4ZRK A;  4KDI C;  4KDL B;  1Q5W B;  1R4M I;  2WX1 A;  3B08 A;  1WM2 A;  3ML9 A;  4GDL A;  3UQA A;  3PLU A;  1WMH A;  3OLM D;  2K8H A;  2DAF A;  5KHQ A;  4GXB A;  5AZH A;  2ASQ A;  4WWO A;  3DDC B;  3Q3J A;  4DWF A;  4HWI B;  3H1U A;  3DVG X;  1YD8 U;  2L76 A;  4E3C A;  4P7I A;  2RD0 A;  4DBG A;  3KUZ A;  3TBL D;  3GOE A;  4PS8 A;  1EUV B;  3SHQ A;  2KQS A;  2JZ3 B;  4N9F 4;  5CHF A;  4DDG D;  2LGD A;  3H7S A;  5L95 C;  1Q0W B;  2C7H A;  3KYD D;  3HHM A;  1WM3 A;  4TQ1 A;  4HDO A;  4MEL A;  4W9E A;  2Z0E B;  2KWV B;  1ISN A;  2AL3 A;  4MSM B;  4B9K A;  3BIN A;  3LJ3 A;  2IO3 B;  2GBR A;  3PRE A;  2K25 A;  2LZ6 A;  2BWF A;  4A3P A;  3VXW A;  1P9D U;  4G11 A;  4M8N A;  3KUD B;  2GBN A;  3WA0 A;  4OVV A;  3T9L A;  2REX A;  2FCM A;  1V5T A;  1E7V A;  2D2Q A;  3GZN I;  4FAD A;  4MDK E;  2XK5 B;  4ASW C;  4BVU C;  1XD3 B;  2KDB A;  1WX8 A;  2KK8 A;  2O6V B;  3CSF A;  1UBI A;  2KOX A;  2LJ5 A;  4W9I A;  1H4R A;  1YX5 B;  2YLM A;  1P0R A;  1RRB A;  2CKH B;  2OJR A;  3SD5 A;  3UIN B;  3VUY A;  5C1Z A;  2MP2 B;  4J6I A;  4KIK B;  2O2V B;  5LLI A;  4II3 B;  2BYV E;  3WIM A;  2B3A A;  4LDT D;  2M8S A;  5G55 A;  5IAA C;  1Y8R C;  2BPS A;  2KFJ A;  2KMA A;  4DXA B;  2D10 A;  2MBB B;  3H7P A;  3JSV A;  4W9G A;  3UF8 A;  4B6W A;  4LJP B;  3RCZ A;  3PHX B;  3KYC D;  1EO6 A;  1IPG A;  1V86 A;  4K81 A;  1KJT A;  1D3Z A;  2N4F A;  2GBJ A;  3EEC A;  4DHZ E;  4AWJ A;  1WXA A;  4GN1 A;  4WAA A;  4DHJ D;  3EC8 A;  3EFU A;  4E71 A;  3NOB A;  2J0M A;  1IP9 A;  5J2R A;  2DZJ A;  2I1J A;  2MBO A;  2KC2 A;  1AAR A;  1I42 A;  5FR6 A;  2LVP A;  3R7Q A;  4NJ6 A;  5JHA A;  1RFA A;  2GBM A;  2M1M A;  2NVU I;  3H9D A;  5LXH A;  3BY4 B;  3A4R A;  1L7Y A;  3N32 A;  1WJ4 A;  2BKR B;  3KVF B;  3AU4 A;  3TL5 A;  3V61 A;  3O65 B;  2KTF A;  3ZLZ A;  3L54 A;  4BOS C;  5CHV C;  2GMI C;  1E7U A;  4AJY B;  4IUM B;  3IG3 A;  2N1W A;  2NBW B;  2KC1 A;  3LDZ E;  3DOW A;  2KX0 A;  2JF5 A;  4ICU A;  1WX7 A;  3S2A A;  4F7Z A;  2RR9 A;  3MTN B;  4K7S A;  4LCD E;  1Q1O A;  3A4S C;  4MGZ E;  1WGG A;  2CR5 A;  4WJP A;  2D3G A;  3PT2 B;  2KO3 A;  2DZI A;  4WJN A;  5CTR C;  4I6L B;  4BKS D;  2DYM A;  1E8W A;  2DYB A;  3IVF A;  1JRU A;  1WI0 A;  3ONS A;  3QWZ B;  2G4D B;  2K8B A;  3RZF A;  2FUH B;  2ZPY A;  2AL6 A;  2MQJ A;  1I35 A;  1FXT B;  2Z59 B;  1CMX B;  2K6D B;  2KLG A;  2KLC A;  2C7N B;  2NR2 A;  3M95 A;  3X0W A;  2C7M B;  3QCA A;  1WGH A;  4FHK A;  1GG3 A;  2FCQ A;  2JZZ A;  2K1F A;  3TIX A;  4M8M A;  3NZU A;  2EMS A;  2AWT A;  4KZC A;  2KX3 A;  2XK5 A;  2K8C A;  2JPH A;  3VH4 B;  4K1R B;  2C5L C;  2O6V A;  1WR6 E;  2ZCB A;  1J8C A;  2KJH B;  1R4N I;  2FCS A;  3MJW A;  2ZEQ A;  4YL8 A;  5DPS A;  4PS3 A;  1RAX A;  3L08 A;  4EKU A;  1SIF A;  2CHX A;  2MP2 A;  2V3S A;  3QAQ A;  2LRW A;  1E8Y A;  4JQW C;  3NZS A;  2O2V A;  4KIK A;  4W9K A;  3T8M A;  2MBH A;  4NPN A;  2DAJ A;  4ZYN A;  4MJS A;  2LAS A;  5DPR A;  4XZ4 A;  5D7G A;  1V5O A;  3HM3 A;  4JIO U;  1TBE A;  1UBQ A;  5E6N A;  4OVU A;  3ZKJ C;  3U7D A;  1MG8 A;  3V60 A;  2C60 A;  2IY0 B;  4HPL B;  5J18 A;  1E5W A;  1WGR A;  2RPQ A;  4FA6 A;  3PPA A;  3PS6 A;  2MLB A;  3QQ8 B;  3V6C B;  2MW5 A;  3VDZ A;  1WGY A;  2UWQ A;  1EF5 A;  3L10 B;  3M62 B;  1WFY A;  5G2N A;  2G45 B;  2L0F A;  3QIJ A;  1ZGU B;  5E6P A;  3AUL A;  4GDK B;  1WJ6 A;  2WDT B;  3DQV A;  1V80 A;  1WRD B;  1OEY J;  2L7R A;  1S3S G;  2M17 A;  1UH6 A;  2WX0 A;  3VHT C;  1E90 A;  3OAW A;  2MX2 A;  3PRP B;  4CHK A;  2KN5 A;  4NQL B;  2ZJD A;  4NAW B;  4TKN A;  3WAM A;  2L8J A;  4MGI E;  1BT0 A;  3PGE A;  4W9C A;  2IO0 B;  3ZNZ B;  5IA7 A;  3QX1 A;  3ZDT A;  2L00 B;  2MA9 B;  4MEM A;  4F8C B;  2BF8 B;  2IO2 B;  4LJO B;  1TGZ B;  3D32 A;  4W9J A;  4G50 A;  3SU8 X;  4KVG B;  4BKG A;  5LXI B;  3I3T B;  1TZ1 A;  4EOY A;  2PE9 A;  3R66 C;  3A1Q B;  4W9F A;  1GJZ A;  4X57 B;  5TR5 A;  1GC6 A;  2YVC A;  3DPD A;  4NJ7 A;  4WWP A;  1V81 A;  2DYO A;  4KSK C;  3VTW A;  3ZRC A;  2J0J A;  4RMA A;  3W1Y A;  4ZRI A;  3TMP B;  3VUW A;  3VQI A;  3RUL A;  2C9W B;  2IBI B;  4K7U A;  2DZM A;  2KNB A;  3NHE B;  4G3X B;  4RM9 A;  2PEA A;  4LDT B;  4F1S A;  1GUA B;  1UD7 A;  2ZVO A;  4W9L A;  1WE6 A;  4IM3 A;  2G3Q B;  3PVL A;  4GB9 A;  2KXJ A;  2K6Q A;  1L2N A;  3NY5 A;  2FNJ B;  2VRR B;  1P98 A;  2GOW A;  2WYQ A;  3RUI B;  2DX5 B;  2KTR B;  2MRP A;  4I6P A;  4PYU A;  2IO1 B;  3ZNH B;  4NQK E;  2KQ7 A;  4A20 A;  3L13 A;  4DHJ B;  2LXC A;  4K7W A;  3V62 A;  2KVR A;  1WZ0 A;  2KKC A;  2N9X A;  3CST A;  1WJN A;  2N7D A;  4FUL A;  2N9E B;  1EF1 A;  3ENE A;  1WYW B;  3IFW B;  4BKT A;  4FJZ A;  5E6O A;  3L0W B;  4AP4 C;  1OTR B;  1WR1 A;  1YX6 B;  2D11 A;  4JGH B;  4TV3 A;  2R2Q A;  3APF A;  3A9K B;  2RSU A;  2JT4 B;  2BWE S;  5D2M B;  1P1A A;  5JHB A;  1HE8 A;  2NPT B;  3OJ3 A;  4GGQ A;  2ZPN A;  4WWN A;  5CX3 A;  4HCN B;  3ZTD A;  4KSL C;  4W9H A;  3VUX A;  4PYZ A;  4GSW A;  1E8X A;  5GMV A;  3DVG Y;  2MBQ A;  4ICV A;  3ML8 A;  1NI2 A;  4HPM B;  4IW0 A;  2LI5 A;  1ZKH A;  4GOC A;  5EDS A;  3C0R B;  2UYZ B;  1V6E A;  2PJH A;  2JUO A;  2LXA A;  2KJR A;  2BYF A;  4IWQ A;  4GIV A;  3PRZ A;  2JRH A;  4BBN F;  1V2Y A;  3P2B A;  5D94 A;  1J19 A;  3CF6 E;  3ALB A;  3M63 B;  2ZCC A;  3H7P B;  4TQ0 A;  1WJU A;  1WXM A;  1WF9 A;  4MH0 E;  3RZW C;  2IZV B;  1WXV A;  1WX9 A;  4DHZ B;  4DDI D;  3DCG A;  1QZE A;  4CO7 A;  2LGY A;  2KFK B;  3A9J B;  3HIZ A;  4E74 A;  2DHZ A;  1KOT A;  2KDE B;  5KHO A;  1A5R A;  4AUQ C;  4DK5 A;  2FIF A;  2LVQ A;  5L83 A;  4CYE A;  2V4L A;  3JYU A;  1T0Y A;  2LGX A;  4II2 B;  4IWP A;  4HXD A;  3UQB A;  2MSE D;  3IHP C;  3DBR I;  2MCN B;  3U30 A;  3WAN A;  2Z0D B;  3A1Q A;  2EMT A;  2IYD B;  2KWC A;  2LVO A;  4IC7 B;  2W9N A;  2EKE C;  3ZTC A;  1WGD A;  1XQQ A;  3UIO B;  2KHW B;  2N1V A;  2CS4 A;  5AZF A;  1ZW7 A;  3DBH I;  1C3T A;  1UZX B;  2LRU A;  3ZIM A;  1Z2M A;  2J0K A;  3N30 A;  3DBL I;  3PLV A;  4G0N B;  1Z5S B;  3N3K B;  2HJ8 A;  2L05 A;  1V49 A;  2CHZ A;  2KJ6 A;  1C1Y B;  3APD A;  4FJY A;  4IWO A;  1WZ3 A;  3QC8 B;  4FN2 A;  4TUU A;  5D6J B;  1NDD A;  2BGF A;  3VFK A;  5DPT A;  3KW5 B;  4NY0 A;  3WAP A;  2KWU B;  1VCB A;  5C23 A;  4EZK A;  4XC2 A;  2Y5B B;  3L17 A;  4WJQ A;  2KTR A;  2JY6 A;  3PZD A;  4AJW A;  4EEW A;  4RM8 A;  3VVW B;  4HLE A;  2MBE A;  4EUT A;  5JH5 C;  1YQB A;  2JXX A;  2O6V D;  4MGK E;  3M3J A;  4EFO A;  3ZDM C;  3PTF C;  3VTV A;  3R7R A;  1F9J A;  1OQY A;  2MWS B;  2ZNV B;  2KDI A;  4NNJ B;  2BKF A;  4MSQ B;  1KM7 A;  2JRI B;  2R2O A;  3A9K A;  2PE6 B;  2N9P C;  4BFR A;  3AU5 A;  1V9J A;  3PHW B;  1WH3 A;  3TJP A;  1M94 A;  2NPT A;  4FBJ B;  3K9O B;  4EZL A;  2XEW A;  1S1Q B;  1UEL A;  4HDQ A;  1LXD A;  2RGF A;  1SGH A;  2WWZ A;  3HK0 A;  4B95 A;  3ECI A;  4IM2 A;  2A5U A;  1J0G A;  2LWP A;  3NS8 A;  2FCN A;  4BBN C;  2M4N A;  2JVC A;  4JL9 A;  4GDL B;  1WMH B;  3RYT A;  5JZE B;  2D07 B;  1OGW A;  4WQO B;  2GBK A;  1GC7 A;  3ZUN A; 
#chains in the Genus database with same CATH topology
 4MJS B;  1GB1 A;  2L32 A;  1D5Z C;  4OHJ A;  3VTU A;  4XX5 A;  4HK2 A;  4KKJ A;  3UGB B;  1IBX B;  4FHJ A;  3ZNG C;  5H92 C;  3KUC B;  2KFK A;  1X1M A;  4YT0 B;  1VZ6 A;  2NBV B;  2LUE A;  2WDQ B;  1L6V A;  2ZVN A;  1UWX A;  3Q3F A;  4OZC A;  2I1K A;  3ZW3 A;  3WAO A;  3P63 A;  3R3M A;  1LFD A;  1G6J A;  4GDK A;  2K9X A;  1RLF A;  2L3Z A;  2MEK A;  1YIW A;  1WXS A;  2LD9 A;  1NBF C;  3E56 A;  1PDX A;  1DGJ A;  4UDU C;  3ZRF A;  2L0T A;  4I6N B;  2NCN A;  2HE7 A;  5BYQ A;  1VZ7 A;  1WIA A;  3QAR A;  1PQS A;  3U8Z A;  4WWM A;  4FJV B;  1OEY A;  2HD5 B;  3QK0 A;  5HKH A;  3AEF B;  2KQ4 X;  3NRZ A;  1V1O A;  1AWD A;  3CIR B;  1Q5W B;  3Q8C A;  2IGD A;  3N9Y C;  1JW9 D;  3AEE B;  2WGS A;  5KHQ A;  5G5G A;  5AZH A;  4DWF A;  3DVG X;  4JWU C;  2IGH A;  4LNF A;  4P7I A;  2RD0 A;  3GOE A;  4PS8 A;  1C79 A;  3SHQ A;  4N9F 4;  1MHH E;  3H7S A;  1IBX A;  2D3A A;  2BTE A;  1T0S C;  1TS5 A;  1ZP0 B;  4MSM B;  4AS1 A;  4RGN A;  1J7B A;  3U2S C;  2IO3 B;  3PRE A;  2LZ6 A;  1EM7 A;  4M8N A;  3KUD B;  2ON8 A;  2REX A;  1SF0 A;  4FAD A;  3P42 A;  4BVU C;  1WX8 A;  2Y5P A;  1UBI A;  2KOX A;  1FM0 D;  1H4R A;  2PIA A;  5GXG B;  3UIN B;  2CKH B;  2OJR A;  2XNA C;  5HHD G;  3VUY A;  1F0Z A;  4C56 C;  3DWG C;  1FRR A;  4KIK B;  4L1B A;  5LLI A;  3ZJV A;  2WXN A;  4XGA B;  3WIM A;  1MI0 A;  2B3A A;  4LDT D;  4C7Z A;  4B6W A;  3RCZ A;  3C19 A;  1CQV A;  3BK1 A;  1EO6 A;  4OZA A;  2DLB A;  1HTO A;  2WNM A;  4GN1 A;  3EFU A;  3HUI A;  3NOB A;  2BT6 A;  1SXT A;  2MBO A;  1AAR A;  2ZW0 A;  2LVP A;  3GZN B;  3R7Q A;  2PKO A;  4A6Q A;  3A4R A;  1QLB B;  4FXC A;  3KVF B;  3B2G A;  3O65 B;  2H88 B;  2K5P A;  3BZD B;  3RNC C;  2GMI C;  2M56 B;  2KYW A;  3DWM A;  3IG3 A;  4DQO C;  2N1W A;  1TZO A;  3DOW A;  3MC8 A;  3ZJU A;  1MJD A;  2RR9 A;  2WDV B;  4LCD E;  2W3S A;  1WGG A;  4WJP A;  2D3G A;  2KAC A;  4WJN A;  1WI0 A;  2NTS A;  3QWZ B;  1KFY B;  2G4D B;  2AL6 A;  4IOI E;  2MQJ A;  3E9S A;  2KLC A;  2NR2 A;  2C7M B;  4FHK A;  1T0Q C;  3BK2 A;  2KX3 A;  4L23 A;  5EE1 A;  4K1R B;  4YL8 A;  5DPS A;  2WXP A;  4EKU A;  1SB3 C;  4C00 A;  2CHX A;  4LTU A;  4KIK A;  4YTM B;  2V3N A;  4NPN A;  4WQM A;  3P4R B;  2BQQ A;  3HM3 A;  4D2K A;  1TBE A;  1WWT A;  5E6N A;  2N7J A;  3U7D A;  1DYQ A;  4HPL B;  5J18 A;  1WGR A;  5D3D A;  3V6C B;  4XDD A;  1EF5 A;  1MHX A;  2J53 A;  1WFY A;  2J42 A;  1NVI D;  3NG0 A;  2L7R A;  1UH6 A;  2K3U A;  1P7E A;  1I4Q A;  2HDE A;  4CHK A;  3NZ3 A;  4NAW B;  3GP7 A;  2MA9 B;  4MEM A;  2BF8 B;  1ZPS A;  1I4G A;  4W9J A;  3SU8 X;  4KVG B;  3V05 A;  1TZ1 A;  2MH7 A;  5TR5 A;  2YVC A;  1SE4 A;  3OG5 A;  4KSK C;  1YMH E;  2D3C A;  3VUW A;  1TYG B;  2LHD A;  2FBW B;  2DZM A;  2KNB A;  3NHE B;  1UD7 A;  4IM3 A;  3RNG C;  2KMM A;  4GB9 A;  2K6Q A;  3NY5 A;  2FNJ B;  2VRR B;  4RCO A;  2GOW A;  1YN5 A;  1EWY C;  2IO1 B;  1K51 A;  4NQK E;  4YTN B;  3L13 A;  4DHJ B;  2WXF A;  4ARI A;  2HTM E;  3ZXR A;  3RPF C;  3TEY A;  3L0W B;  3SR6 A;  1JQ4 A;  2R2Q A;  1T5X D;  2JT4 B;  2BWE S;  3ZQ4 A;  2NPT B;  4WWN A;  1P7F A;  5AUK A;  1FRD A;  3ZTD A;  3R8B A;  1E8X A;  3DVG Y;  3P4Q B;  4ICV A;  3ML8 A;  2JQR B;  4HPM B;  4IW0 A;  4RF1 A;  3TUO A;  3BYT B;  3RI7 C;  4USA A;  2LXA A;  3KQ4 A;  3SFD B;  2JRH A;  2PVG C;  2ZCC A;  4TQ0 A;  1FEH A;  1WXM A;  2WXK A;  4MH0 E;  1SE3 A;  1XLQ A;  1JRO A;  2LEK A;  2LGY A;  1I4P A;  2W82 A;  3HIZ A;  2KDE B;  1VZ8 A;  1A5R A;  2AQ3 B;  4CYE A;  4NJC A;  3T3O A;  4HXD A;  3U30 A;  4US8 A;  1HEZ E;  2N0S B;  2EMT A;  2IYD B;  2I38 A;  2W9N A;  2WXJ A;  1WGD A;  1XQQ A;  3UIO B;  5AZF A;  2MHJ A;  2J0K A;  3AM9 A;  3PLV A;  3N3K B;  4A9A A;  1HQR D;  2CHZ A;  3APD A;  3FAH A;  4MM3 B;  1WZ3 A;  3Q3M C;  3I57 A;  1ZOY B;  5D6J B;  4LK0 M;  1CK1 A;  4XC2 A;  1N62 A;  2Y5B B;  3L17 A;  2LMC A;  2MBE A;  2JXX A;  3BVG A;  3ZDM C;  3Q3N C;  3PTF C;  3DBR B;  2JWU A;  4RGT A;  1F9J A;  1OQY A;  1XLP A;  2BKF A;  4MSQ B;  2D5G A;  4A8X C;  1WH3 A;  2NPT A;  4HDQ A;  5BMG A;  1LXD A;  3HK0 A;  4IM2 A;  3GE3 C;  1J0G A;  4HRS A;  1QQR A;  4GDL B;  2PVO D;  2GBK A;  2W54 A;  2A4Z A;  4IKG A;  4IDI A;  2KDF B;  4C7Y A;  5J17 A;  1VJK A;  3R2I A;  2JSV X;  3APC A;  2AYO B;  4BKS A;  3I63 C;  4HJK A;  1E8Z A;  3AXC A;  3K9P B;  3DVN V;  2XN9 C;  4RGO S;  3NVZ A;  3A33 B;  2ZZP B;  5AEK B;  1WY8 A;  3NVY A;  1PGA A;  5AZG A;  4KV2 A;  1BML C;  4IM0 A;  2WXG A;  2KAN A;  5DCN A;  3W1S A;  2G4S A;  2V0G A;  2K39 A;  2KD0 A;  1ZDX A;  1LQB A;  5DPW A;  2ZW1 A;  1SE9 A;  1ZE3 D;  1C9F A;  1E6E B;  3NVV A;  3X23 A;  1IYF A;  4MM3 A;  4A3O A;  1N63 A;  1UWM A;  3PZ7 A;  3TCA A;  3B1L X;  4P1C C;  3JVZ X;  2DEN B;  3BYY B;  4AOF A;  3EHV A;  2HTH A;  4KGS A;  3SDL C;  4ZYS A;  4KZ0 A;  1ET6 A;  4BOZ B;  2AQ1 B;  2KZR A;  2N9L A;  1CZP A;  1YJ1 A;  1UGM A;  1KLG D;  3U4E G;  3PSE B;  2V1Y A;  3UIP B;  4KGR A;  3RT3 B;  4WJO A;  2QMT A;  2IND C;  4CQN A;  4ANW A;  1K50 A;  4REZ A;  1P3Q U;  2OOB B;  4HCP B;  2KMC A;  1LGR A;  1YQ4 B;  3AEC B;  4FLH A;  3HVZ A;  4OVZ A;  4KDL B;  1STE A;  4WIP A;  3B08 A;  1WM2 A;  4GDL A;  3UQA A;  3OLM D;  2K8H A;  1TKG A;  3DDC B;  4YSZ B;  4HWI B;  2L76 A;  4DBG A;  3KUZ A;  2KQS A;  2JZ3 B;  4DDG D;  4ZHO A;  4YTP B;  2LGD A;  2C7H A;  3KYD D;  4RNA A;  2UU7 A;  4MEL A;  4W9E A;  2Z0E B;  2SEB D;  4P6V F;  1ISN A;  1HZ5 A;  3LJ3 A;  2K25 A;  4N59 A;  3VXW A;  5HG2 A;  2WXI A;  2GBN A;  2WHI A;  4OVV A;  3T9L A;  1PUT A;  2FCM A;  3DBH B;  2XK5 B;  2KDB A;  2KK8 A;  3CSF A;  2LJ5 A;  3DBL B;  1R4M B;  4M01 A;  2YLM A;  1RRB A;  5C1Z A;  4J6I A;  3AE3 B;  4II3 B;  2BYV E;  2M8S A;  5G55 A;  2R61 A;  5D3I B;  1OQQ A;  4DXA B;  1FCC C;  1IGD A;  2N9K A;  3PHX B;  4K81 A;  1KJT A;  2N4F A;  3HVD A;  3EC8 A;  2L52 A;  1VR9 A;  2DZJ A;  3R2T A;  5J2R A;  2I1J A;  1WRI A;  1E0Z A;  2NVU I;  4M00 A;  4LNK A;  5LXH A;  3BY4 B;  1GOZ A;  1LO5 D;  3N32 A;  3LB8 C;  4DXF A;  3AU4 A;  1RWS A;  3V61 A;  1TY0 A;  2KTF A;  3L54 A;  2GRI A;  3LDZ E;  1I4R A;  3Q8E A;  2WLB A;  4MGZ E;  4NZL B;  3PT2 B;  2KO3 A;  5LNK 1;  5CTR C;  4R3D A;  4PK1 A;  2DYB A;  4US9 A;  2WXR A;  3SEB A;  3RNF C;  3AMZ A;  2Z59 B;  1CMX B;  2K6D B;  4ACF A;  2C7N B;  3X0W A;  3GS2 A;  3IT4 B;  1F77 A;  1QKZ A;  2AX5 A;  2FCQ A;  2K1F A;  4YSX B;  3TIX A;  4M8M A;  1QOA A;  2EMS A;  4KZC A;  1QOF A;  2XK5 A;  2K8C A;  2JPH A;  1SE2 A;  1F52 A;  2ZCB A;  1YN4 A;  3AE2 B;  2ZEQ A;  3QAQ A;  2LRW A;  1E8Y A;  2DAJ A;  4MJS A;  3TEZ A;  1NEK B;  1J7C A;  1UBQ A;  4YXD B;  1MG8 A;  2C60 A;  2IY0 B;  1ROE A;  3PPA A;  3QQ8 B;  4GLS C;  1YOV B;  5BMH A;  3L10 B;  1TS3 A;  3M62 B;  3AEA B;  3L4P A;  1F2R C;  5E6P A;  2YEP F;  1E90 A;  3OAW A;  2MX2 A;  2E6X A;  4NQL B;  4PT5 A;  3WAM A;  2L8J A;  4MGI E;  2BS3 B;  4W9C A;  2IO0 B;  3QX1 A;  3ZDT A;  2L00 B;  4F8C B;  3IT6 B;  1TGZ B;  1TJE A;  1HZ6 A;  3FIL B;  3I3T B;  2Q5W D;  1V81 A;  1F1H A;  3ZRC A;  1B1Z A;  2J0J A;  4RMA A;  3I9V 1;  1KLU D;  4K7U A;  2Z8L A;  4G3X B;  4RM9 A;  2DWQ A;  2PEA A;  4LDT B;  2ZVO A;  1WE6 A;  4KGT A;  1KH0 A;  4C4V B;  2G3Q B;  3PVL A;  1V8C A;  4I6P A;  1EWC A;  4A20 A;  3V62 A;  2KVR A;  1D5M C;  3ENE A;  3IFW B;  3UI3 A;  1PGX A;  4FJZ A;  5E6O A;  4AP4 C;  4JE3 B;  2D11 A;  1YX6 B;  1NI3 A;  3A9K B;  3I5J C;  3N1Z C;  5CX3 A;  4YSY B;  4HCN B;  2SAK A;  3VUX A;  5IKC M;  4ARC A;  5GMV A;  1BXT A;  2MBQ A;  2IDY A;  1L4Z B;  2LI5 A;  2JUO A;  1UNS A;  2KJR A;  5MPO A;  3PRZ A;  4HKZ E;  1A70 A;  3P2B A;  1E10 A;  3CF6 E;  1JWA D;  3H7P B;  2VZK D;  1DOI A;  1JAL A;  4A90 A;  1WX9 A;  3RNE C;  1C4A A;  4DDI D;  3DCG A;  4CO7 A;  3A9J B;  1WXQ A;  1ET9 A;  1IUE A;  4AUQ C;  1TY2 A;  2LVQ A;  1XF5 L;  3JYU A;  2LGX A;  4II2 B;  3FIL A;  3UQB A;  2KWC A;  3IXS A;  2KHW B;  2N1V A;  1QOB A;  2WS3 B;  1ZW7 A;  3DBH I;  2RMM A;  1JRP A;  3DBL I;  1YJJ A;  2HJ8 A;  5C3J B;  2KJ6 A;  4O1N A;  3KLS X;  3QC8 B;  4C4V A;  4BAX A;  1QIL A;  3KW5 B;  3B9J A;  4NY0 A;  3KWV A;  4EZK A;  4WJQ A;  2V9H A;  4AJW A;  4EEW A;  1M4V A;  1R4N B;  3VVW B;  4HLE A;  1C76 A;  3P4S B;  1CJE A;  2O6V D;  1N5X A;  3Q8A A;  1IGC A;  1TS4 A;  2WQY B;  3R7R A;  4WH4 A;  1GPX A;  3Q69 A;  1QOG A;  2MWS B;  2KDI A;  1K52 A;  3A9K A;  2PE6 B;  3URY A;  3AE5 B;  3Q3O C;  1HXY D;  3PO0 A;  1KRH A;  3MC9 A;  4EZL A;  1DOY A;  1E9M A;  2RGF A;  2WWZ A;  3ZXV A;  1SSN A;  3KWL A;  4JL9 A;  4YWG G;  1WMH B;  3ZUN A;  4LNN A;  1N6Z A;  1XO3 A;  1JCK B;  3RD2 A;  3PRM B;  1XT9 B;  3V6E B;  4HRO A;  1BUI C;  1YNT E;  2JWZ A;  3H6N A;  3A9J A;  1T6B X;  2FID A;  3IBE A;  5BO4 B;  2G1E A;  1MFW A;  2DBY A;  3B0A A;  3V3X A;  2QEJ C;  3DBS A;  2LJI A;  4J3O D;  2BB5 A;  4JLC A;  4RFB A;  3RFZ B;  1UUP A;  3VH3 B;  1AYF A;  4K3B A;  3OJ4 B;  1PYW D;  2JYT A;  3VAW A;  3QA8 A;  2CU1 A;  5CHW A;  1FFV A;  4TSS A;  1C4P A;  1FFU A;  1L5P A;  2XBB C;  4WUR A;  3DHG C;  3PV1 A;  1OFF A;  4GU2 A;  4NAW A;  2QHO A;  4BZA A;  3QHT A;  2ZNV C;  1D5X C;  3ZO5 B;  4ANX A;  1SEB D;  2AEH A;  1Q10 A;  1K8R B;  3GB1 A;  5IN7 A;  3HRD D;  3QJZ A;  4PS7 A;  3JW0 X;  2BYE A;  3FKY A;  3KH0 A;  2VH1 A;  4M0W B;  2J52 A;  2NBU A;  1NEN B;  3L16 A;  3AI5 A;  4ZRK A;  4KDI C;  3TEW A;  2WX1 A;  1FXA A;  3PLU A;  1WMH A;  2DAF A;  4GXB A;  2ASQ A;  2BBC A;  2GB1 A;  3H1U A;  1YD8 U;  4E3C A;  2QCZ A;  3TBL D;  1Y56 A;  1V97 A;  1EUV B;  5CHF A;  1Q0W B;  3C8Y A;  3HHM A;  1HTQ A;  1WM3 A;  4TQ1 A;  3AEB B;  1I4X A;  2AL3 A;  4B9K A;  2KT7 A;  3EGR A;  2WXL A;  1WSP A;  4XYC A;  1P9D U;  3WA0 A;  1V5T A;  3GZN I;  4MDK E;  4ZOH C;  1XD3 B;  4P16 A;  5EE0 A;  2IJ0 A;  2MJE A;  1P0R A;  2JZP A;  4K3C A;  2MP2 B;  1TT5 B;  1HA5 A;  3ZGZ A;  2PW9 A;  2BPS A;  2KFJ A;  2X8X X;  2D10 A;  2WXM A;  4XWW A;  2D3B A;  1IPG A;  1V86 A;  3TSS A;  2GBJ A;  3EEC A;  4DHZ E;  1T0R C;  1WXA A;  1RYJ A;  3NVW A;  4E71 A;  2J0M A;  1WYG A;  1KF6 B;  3ZJT A;  1EU3 A;  1I42 A;  5FR6 A;  3BVZ A;  1ENF A;  4NJ6 A;  2GBM A;  1WJ4 A;  2LGI A;  2LGS A;  4BOS C;  1L4D B;  5CHV C;  4M02 A;  4AJY B;  4OZB A;  2KC1 A;  2KX0 A;  2QIE B;  1WX7 A;  3IAM 1;  4RGM A;  3MTN B;  4F7Z A;  4MAC A;  4K7S A;  1Q1O A;  3A4S C;  1FNW A;  2CR5 A;  1XLN A;  1E8W A;  3N1X C;  3U52 E;  3IVF A;  2BS4 B;  2Y5C A;  3AEG B;  2K8B A;  2FUH B;  3BWU D;  2TSS A;  1I35 A;  4KX6 B;  2KLG A;  2RDH A;  3QCA A;  1WGH A;  1GG3 A;  3CWI A;  2JZZ A;  4H2A A;  2AWT A;  3VH4 B;  4P1B C;  2C5L C;  1WR6 E;  3WCQ A;  2RDG A;  1R4N I;  2FCS A;  3MJW A;  4PS3 A;  3L08 A;  3AE6 B;  1SIF A;  2V3S A;  2MP2 A;  3NZS A;  5BMI A;  4W9K A;  3AE7 B;  5DPR A;  5D7G A;  1V5O A;  1QF6 A;  3ZKJ C;  4AQ7 A;  1E5W A;  3PS6 A;  2MLB A;  2MW5 A;  2IPK D;  5G2N A;  2JU6 X;  3QIJ A;  2WXQ A;  3AUL A;  4GDK B;  2YEP B;  1WJ6 A;  3LYY A;  2ICI A;  1V80 A;  1WRD B;  5EE3 A;  1S3S G;  2RDB C;  2WX0 A;  1PGB A;  3VHT C;  1ZDV A;  2KN5 A;  2CJN A;  2OJW A;  3BVM A;  1TKE A;  2E3T A;  2WDR B;  5AUI A;  3PGE A;  1QT9 A;  3ZNZ B;  2IO2 B;  1E7P B;  2BB6 A;  1TS2 A;  1T3Q A;  3W2D A;  3R66 C;  3A1Q B;  4W9F A;  3MHZ A;  4X57 B;  5I4D A;  1GC6 A;  3DPD A;  4NJ7 A;  2DYO A;  3VTW A;  2K22 A;  3MFG A;  3EA6 A;  4ZRI A;  3VQI A;  2C9W B;  4HEA 1;  1ZUD 2;  1L6U A;  2CU3 A;  2INN E;  3RUI B;  2MRP A;  3ZNH B;  2KQ7 A;  1RFK A;  4LLG M;  2LXC A;  1C77 A;  3FC4 A;  4K7W A;  2N9X A;  3CST A;  4FUL A;  1EF1 A;  2I2Y A;  1WYW B;  4BKT A;  1JWS D;  1OTR B;  1WR1 A;  3AE1 B;  3APF A;  3N1Y C;  2IGG A;  1P1A A;  1HE8 A;  3OJ3 A;  4GGQ A;  2KDM A;  2ZPN A;  3ETR A;  4JX1 C;  1FPY A;  4W9H A;  5TSS A;  4PYZ A;  5HI1 A;  3RMK C;  1NI2 A;  4GOC A;  2UYZ B;  4ITK A;  1JML A;  2BYF A;  1VLB A;  1R7S A;  4GIV A;  1V2Y A;  5D94 A;  1J19 A;  1TKY A;  3ALB A;  1WF9 A;  3RZW C;  1WXV A;  1YJI A;  3B2F A;  2DHZ A;  5E6J A;  2JYE A;  2INP E;  1T0Y A;  4IWP A;  2MSE D;  3IHP C;  1D6E C;  3DBR I;  2W3R A;  2MCN B;  3WAN A;  3A1Q A;  2LVO A;  4IC7 B;  1AN8 A;  2QDF A;  2EKE C;  3ZTC A;  5IP4 D;  1NYR A;  4EE2 A;  1C3T A;  1UZX B;  3Q2A C;  3AB5 A;  1Z2M A;  3N30 A;  2BYT A;  1SJH D;  1Z5S B;  2L05 A;  4L2Y A;  2L1A A;  3J9C A;  2BGF A;  5DPT A;  1VCB A;  5C23 A;  2JY6 A;  1ACC A;  5C2T B;  1YQB A;  4JPS A;  3AH7 A;  3VTV A;  3P1M A;  2BS2 B;  3EFC A;  3ABV B;  3W5V B;  1KM7 A;  2N9P C;  3TJP A;  3PHW B;  1M94 A;  4RH6 A;  4FBJ B;  3K9O B;  2XEW A;  1S1Q B;  1PFD A;  1SGH A;  4B95 A;  2RPV A;  2LWP A;  2FCN A;  4BBN C;  4C80 A;  2M4N A;  2JVC A;  1FNV A;  1GB4 A;  3RYT A;  2D07 B;  2GLS A;  2FAZ A;  2J7Q B;  3NJT A;  4JWS C;  2B76 B;  2DZK A;  1GNU A;  5H8Y E;  3RN9 C;  2QIL A;  1ZXH A;  2Y3A A;  3CMM B;  3DVN U;  4EZJ A;  4W9D A;  3RNB C;  4IG7 B;  2QSD A;  1KTK A;  5FK9 C;  3P4P B;  3ZNI D;  3PZ8 A;  4ZDV A;  1U4A A;  2WXH A;  3W1S C;  2PMV A;  1N61 A;  3W9C B;  1D4B A;  3O13 A;  2PTL A;  2V3P A;  1KLV A;  4GMV A;  1TTN A;  4S0R A;  3MHS D;  3ZVV A;  3ZYY X;  2NS5 A;  1XEE A;  4KKI A;  1I4H A;  2KN4 A;  4NAM A;  4ANU A;  1UGJ A;  4WAF A;  2DNF A;  2KAJ A;  3JSV B;  2IY1 B;  4ZRJ A;  1LM8 B;  1FO4 A;  4ANV A;  2L83 A;  1H8C A;  2EEL A;  3NS1 A;  2HJ1 A;  2M19 A;  3WAL A;  2N7E A;  2VZK B;  1JWB D;  3IAS 1;  5BYS A;  1VD2 A;  2CHW A;  4MGY E;  2M0X A;  2PPH A;  5FKA C;  1WE7 A;  1L0Y B;  3HM6 X;  4HVB A;  4URK A;  2X38 A;  3H8H A;  1R4M I;  3ML9 A;  4LNO A;  3N20 C;  1MVK A;  5HFY A;  4WWO A;  3Q3J A;  5IOI A;  1FD6 A;  2MJ3 A;  2KVZ A;  1N5W A;  2NTT A;  4ZRQ A;  5L95 C;  2KWD A;  5EE9 A;  4HDO A;  2KWV B;  1FXI A;  3BIN A;  4ZRP A;  2GBR A;  2BWF A;  4A3P A;  4G11 A;  5BYR A;  4N6E B;  4XDC A;  1C4C A;  1E7V A;  2D2Q A;  4ASW C;  2OED A;  2O6V B;  1FIQ A;  4W9I A;  1YX5 B;  3SD5 A;  2K0P A;  2BW2 A;  2O2V B;  2ACZ B;  4HPP A;  1L0V B;  5IAA C;  1J7A A;  1Y8R C;  2KMA A;  3MP9 A;  2MBB B;  3H7P A;  3JSV A;  4W9G A;  3UF8 A;  4B0E A;  4LJP B;  3KYC D;  3OWE B;  1D3Z A;  1XCT L;  4AWJ A;  4WAA A;  4DHJ D;  1MPE A;  2G9H D;  5FR3 A;  1IP9 A;  2KC2 A;  5JHA A;  1RFA A;  2M1M A;  3H9D A;  2QC8 A;  1L7Y A;  1FNU A;  2BKR B;  3TL5 A;  2FUG 1;  3ZLZ A;  1XLO A;  1E7U A;  3VRB B;  4IUM B;  3AED B;  1XCQ L;  2NBW B;  1N60 A;  2LHE A;  4QAY A;  2JF5 A;  4ICU A;  3MJ5 A;  3S2A A;  3VR8 B;  2LUM A;  2DZI A;  4I6L B;  4BKS D;  2DYM A;  1JRU A;  4MH8 A;  3ONS A;  3RZF A;  2ZPY A;  3VRA B;  1FXT B;  2W55 A;  3M95 A;  1I7H A;  3W5U B;  2BVC A;  3NZU A;  1VDV A;  4XE0 A;  2WXO A;  4ZHP A;  2O6V A;  1J8C A;  4B0M A;  2KJH B;  1RM6 C;  1XXG A;  1RAX A;  3LXF A;  4JQW C;  2O2V A;  3T8M A;  2MBH A;  4ZYN A;  3AN1 A;  2LAS A;  4XZ4 A;  4JIO U;  2WP9 B;  1YN3 A;  1VRA B;  4OVU A;  3V60 A;  1EU4 A;  2RPQ A;  4FA6 A;  3VDZ A;  1WGY A;  3AE9 B;  2UWQ A;  3BII D;  3GE8 C;  2G45 B;  2L0F A;  4HKQ A;  1ZGU B;  4Q2J A;  2WDT B;  3DQV A;  4XWT A;  1OEY J;  2M17 A;  2LFI A;  2H89 B;  3PRP B;  5T8I A;  3NUH B;  2ZJD A;  1SBB B;  2WU2 B;  1TIF A;  4TKN A;  1BT0 A;  1WGK A;  5IA7 A;  4LNI A;  2EKI A;  1GC7 A;  4LJO B;  4N58 A;  4BKG A;  3D32 A;  4G50 A;  5LXI B;  2GI9 A;  4EOY A;  4MT5 A;  2PE9 A;  3Q6B A;  2NMQ A;  1GJZ A;  4WWP A;  2INC C;  1AW7 A;  2WU5 B;  3W1Y A;  3TMP B;  3RUL A;  2IBI B;  2MJD A;  2QJL A;  3AE8 B;  4F1S A;  1GUA B;  4W9L A;  2CJO A;  1C78 A;  4A55 A;  2KXJ A;  1L2N A;  3VR9 B;  1P98 A;  2WYQ A;  2DX5 B;  2KTR B;  4PYU A;  1YQ3 B;  2JX5 A;  4HJG E;  1L0X B;  1WZ0 A;  2KKC A;  1WJN A;  2N7D A;  4M0W A;  2N9E B;  3AE4 B;  5G5H A;  4JGH B;  4TV3 A;  2RSU A;  5JHB A;  5D2M B;  1V1P B;  2FE8 A;  3Q14 C;  3SFE B;  4KSL C;  4GSW A;  1ZKH A;  5EDS A;  3C0R B;  1FMA D;  1V6E A;  2PJH A;  4IWQ A;  1JWM D;  4BBN F;  3M63 B;  1WJU A;  2VH2 A;  2IZV B;  1B9R A;  4DHZ B;  1QZE A;  4S17 A;  5IO9 A;  2KFK B;  4E74 A;  1KOT A;  3U7Z A;  5KHO A;  1ZXI A;  4DK5 A;  2FIF A;  5L83 A;  2V4L A;  1JWU D;  1SJE D;  3AV8 A;  4TMA B;  2J4X A;  1MG4 A;  2Z0D B;  3T3N A;  1K53 A;  3DHI C;  4OW0 A;  3MC0 B;  2LRU A;  3ZIM A;  4G0N B;  1V49 A;  2AQ2 B;  3Q8B A;  1OQR A;  2JXT A;  1C1Y B;  2PLP A;  4FJY A;  4IWO A;  3DHH C;  1GAQ B;  4FN2 A;  4TUU A;  1NDD A;  3VFK A;  2ONQ A;  2KWU B;  3WAP A;  1DOX A;  3Q8F A;  1ESF A;  2KTR A;  3PZD A;  4DXG A;  4RM8 A;  4EUT A;  5JH5 C;  4MGK E;  3M3J A;  4EFO A;  5JXV A;  4NNJ B;  2ZNV B;  4RF0 A;  2OHF A;  2JRI B;  2R2O A;  1F2R I;  3EUB 2;  3AU5 A;  4BFR A;  1V9J A;  1V1P A;  2V4I B;  3TEX A;  1UEL A;  1SIJ A;  1UF0 A;  2A5U A;  2M0A A;  3ECI A;  3NS8 A;  3RNA C;  1FCL A;  5JZE B;  1OGW A;  4WQO B;  2CS4 A;  1NYQ A; 
#chains in the Genus database with same CATH homology
 4MJS B;  2A4Z A;  2FAZ A;  2J7Q B;  2KDF B;  5J17 A;  2DZK A;  1GNU A;  3VTU A;  3RD2 A;  4XX5 A;  4HK2 A;  3PRM B;  3UGB B;  3APC A;  3CMM B;  4FHJ A;  2AYO B;  1XT9 B;  4BKS A;  3ZNG C;  3DVN U;  3V6E B;  4EZJ A;  4HJK A;  3KUC B;  4W9D A;  2JWZ A;  1E8Z A;  2KFK A;  2FID A;  1X1M A;  3A9J A;  3AXC A;  3DVN V;  3H6N A;  3K9P B;  4IG7 B;  3IBE A;  5BO4 B;  3ZNI D;  2NBV B;  3A33 B;  2LUE A;  2ZZP B;  4ZDV A;  5AEK B;  1U4A A;  3B0A A;  1WY8 A;  3W1S C;  5AZG A;  4KV2 A;  3DBS A;  4IM0 A;  2ZVN A;  2KAN A;  3Q3F A;  4JLC A;  5DCN A;  3W1S A;  1KLV A;  4GMV A;  2G4S A;  3VH3 B;  2I1K A;  1TTN A;  3OJ4 B;  2K39 A;  2KD0 A;  1LQB A;  3VAW A;  3ZW3 A;  3QA8 A;  3WAO A;  5DPW A;  1SE9 A;  2CU1 A;  3MHS D;  3R3M A;  5CHW A;  3ZVV A;  3X23 A;  1LFD A;  1G6J A;  4GDK A;  2NS5 A;  1IYF A;  4MM3 A;  4A3O A;  1RLF A;  2XBB C;  3TCA A;  2L3Z A;  3PV1 A;  4ANU A;  3JSV B;  2IY1 B;  3B1L X;  3JVZ X;  4GU2 A;  4ZRJ A;  1LM8 B;  2DEN B;  1YIW A;  4AOF A;  4NAW A;  3EHV A;  2HTH A;  4ANV A;  1WXS A;  2LD9 A;  3SDL C;  2QHO A;  1NBF C;  1H8C A;  4KZ0 A;  3QHT A;  4BOZ B;  2KZR A;  1YJ1 A;  1UGM A;  3ZRF A;  2ZNV C;  3PSE B;  2V1Y A;  3ZO5 B;  2L0T A;  3UIP B;  3WAL A;  3RT3 B;  2N7E A;  4ANX A;  2AEH A;  4I6N B;  4WJO A;  2NCN A;  2HE7 A;  1K8R B;  4ANW A;  1VD2 A;  2CHW A;  4MGY E;  1P3Q U;  1WIA A;  2M0X A;  2OOB B;  2PPH A;  1WE7 A;  3QAR A;  4HCP B;  1PQS A;  2KMC A;  3U8Z A;  4FJV B;  3HM6 X;  1OEY A;  3QJZ A;  4PS7 A;  3JW0 X;  4HVB A;  2BYE A;  2HD5 B;  3QK0 A;  3KH0 A;  5HKH A;  4M0W B;  4FLH A;  2NBU A;  4URK A;  3L16 A;  3AI5 A;  4ZRK A;  4KDI C;  4KDL B;  1Q5W B;  1R4M I;  2WX1 A;  3B08 A;  1WM2 A;  3ML9 A;  4GDL A;  3UQA A;  3PLU A;  1WMH A;  3OLM D;  2K8H A;  2DAF A;  5KHQ A;  4GXB A;  5AZH A;  2ASQ A;  4WWO A;  3DDC B;  3Q3J A;  4DWF A;  4HWI B;  3H1U A;  3DVG X;  1YD8 U;  2L76 A;  4E3C A;  4P7I A;  2RD0 A;  4DBG A;  3KUZ A;  3TBL D;  3GOE A;  4PS8 A;  1EUV B;  3SHQ A;  2KQS A;  2JZ3 B;  4N9F 4;  5CHF A;  4DDG D;  2LGD A;  3H7S A;  5L95 C;  1Q0W B;  2C7H A;  3KYD D;  3HHM A;  1WM3 A;  4TQ1 A;  4HDO A;  4MEL A;  4W9E A;  2Z0E B;  2KWV B;  1ISN A;  2AL3 A;  4MSM B;  4B9K A;  3BIN A;  3LJ3 A;  2IO3 B;  2GBR A;  3PRE A;  2K25 A;  2LZ6 A;  2BWF A;  4A3P A;  3VXW A;  1P9D U;  4G11 A;  4M8N A;  3KUD B;  2GBN A;  3WA0 A;  4OVV A;  3T9L A;  2REX A;  2FCM A;  1V5T A;  1E7V A;  2D2Q A;  3GZN I;  4FAD A;  4MDK E;  2XK5 B;  4ASW C;  4BVU C;  1XD3 B;  2KDB A;  1WX8 A;  2KK8 A;  2O6V B;  3CSF A;  1UBI A;  2KOX A;  2LJ5 A;  4W9I A;  1H4R A;  1YX5 B;  2YLM A;  1P0R A;  1RRB A;  2CKH B;  2OJR A;  3SD5 A;  3UIN B;  3VUY A;  5C1Z A;  2MP2 B;  4J6I A;  4KIK B;  2O2V B;  5LLI A;  4II3 B;  2BYV E;  3WIM A;  2B3A A;  4LDT D;  2M8S A;  5G55 A;  5IAA C;  1Y8R C;  2BPS A;  2KFJ A;  2KMA A;  4DXA B;  2D10 A;  2MBB B;  3H7P A;  3JSV A;  4W9G A;  3UF8 A;  4B6W A;  4LJP B;  3RCZ A;  3PHX B;  3KYC D;  1EO6 A;  1IPG A;  1V86 A;  4K81 A;  1KJT A;  1D3Z A;  2N4F A;  2GBJ A;  3EEC A;  4DHZ E;  4AWJ A;  1WXA A;  4GN1 A;  4WAA A;  4DHJ D;  3EC8 A;  3EFU A;  4E71 A;  3NOB A;  2J0M A;  1IP9 A;  5J2R A;  2DZJ A;  2I1J A;  2MBO A;  2KC2 A;  1AAR A;  1I42 A;  5FR6 A;  2LVP A;  3R7Q A;  4NJ6 A;  5JHA A;  1RFA A;  2GBM A;  2M1M A;  2NVU I;  3H9D A;  5LXH A;  3BY4 B;  3A4R A;  1L7Y A;  3N32 A;  1WJ4 A;  2BKR B;  3KVF B;  3AU4 A;  3TL5 A;  3V61 A;  3O65 B;  2KTF A;  3ZLZ A;  3L54 A;  4BOS C;  5CHV C;  2GMI C;  1E7U A;  4AJY B;  4IUM B;  3IG3 A;  2N1W A;  2NBW B;  2KC1 A;  3LDZ E;  3DOW A;  2KX0 A;  2JF5 A;  4ICU A;  1WX7 A;  3S2A A;  4F7Z A;  2RR9 A;  3MTN B;  4K7S A;  4LCD E;  1Q1O A;  3A4S C;  4MGZ E;  1WGG A;  2CR5 A;  4WJP A;  2D3G A;  3PT2 B;  2KO3 A;  2DZI A;  4WJN A;  5CTR C;  4I6L B;  4BKS D;  2DYM A;  1E8W A;  2DYB A;  3IVF A;  1JRU A;  1WI0 A;  3ONS A;  3QWZ B;  2G4D B;  2K8B A;  3RZF A;  2FUH B;  2ZPY A;  2AL6 A;  2MQJ A;  1I35 A;  1FXT B;  2Z59 B;  1CMX B;  2K6D B;  2KLG A;  2KLC A;  2C7N B;  2NR2 A;  3M95 A;  3X0W A;  2C7M B;  3QCA A;  1WGH A;  4FHK A;  1GG3 A;  2FCQ A;  2JZZ A;  2K1F A;  3TIX A;  4M8M A;  3NZU A;  2EMS A;  2AWT A;  4KZC A;  2KX3 A;  2XK5 A;  2K8C A;  2JPH A;  3VH4 B;  4K1R B;  2C5L C;  2O6V A;  1WR6 E;  2ZCB A;  1J8C A;  2KJH B;  1R4N I;  2FCS A;  3MJW A;  2ZEQ A;  4YL8 A;  5DPS A;  4PS3 A;  1RAX A;  3L08 A;  4EKU A;  1SIF A;  2CHX A;  2MP2 A;  2V3S A;  3QAQ A;  2LRW A;  1E8Y A;  4JQW C;  3NZS A;  2O2V A;  4KIK A;  4W9K A;  3T8M A;  2MBH A;  4NPN A;  2DAJ A;  4ZYN A;  4MJS A;  2LAS A;  5DPR A;  4XZ4 A;  5D7G A;  1V5O A;  3HM3 A;  4JIO U;  1TBE A;  1UBQ A;  5E6N A;  4OVU A;  3ZKJ C;  3U7D A;  1MG8 A;  3V60 A;  2C60 A;  2IY0 B;  4HPL B;  5J18 A;  1E5W A;  1WGR A;  2RPQ A;  4FA6 A;  3PPA A;  3PS6 A;  2MLB A;  3QQ8 B;  3V6C B;  2MW5 A;  3VDZ A;  1WGY A;  2UWQ A;  1EF5 A;  3L10 B;  3M62 B;  1WFY A;  5G2N A;  2G45 B;  2L0F A;  3QIJ A;  1ZGU B;  5E6P A;  3AUL A;  4GDK B;  1WJ6 A;  2WDT B;  3DQV A;  1V80 A;  1WRD B;  1OEY J;  2L7R A;  1S3S G;  2M17 A;  1UH6 A;  2WX0 A;  3VHT C;  1E90 A;  3OAW A;  2MX2 A;  3PRP B;  4CHK A;  2KN5 A;  4NQL B;  2ZJD A;  4NAW B;  4TKN A;  3WAM A;  2L8J A;  4MGI E;  1BT0 A;  3PGE A;  4W9C A;  2IO0 B;  3ZNZ B;  5IA7 A;  3QX1 A;  3ZDT A;  2L00 B;  2MA9 B;  4MEM A;  4F8C B;  2BF8 B;  2IO2 B;  4LJO B;  1TGZ B;  3D32 A;  4W9J A;  4G50 A;  3SU8 X;  4KVG B;  4BKG A;  5LXI B;  3I3T B;  1TZ1 A;  4EOY A;  2PE9 A;  3R66 C;  3A1Q B;  4W9F A;  1GJZ A;  4X57 B;  5TR5 A;  1GC6 A;  2YVC A;  3DPD A;  4NJ7 A;  4WWP A;  1V81 A;  2DYO A;  4KSK C;  3VTW A;  3ZRC A;  2J0J A;  4RMA A;  3W1Y A;  4ZRI A;  3TMP B;  3VUW A;  3VQI A;  3RUL A;  2C9W B;  2IBI B;  4K7U A;  2DZM A;  2KNB A;  3NHE B;  4G3X B;  4RM9 A;  2PEA A;  4LDT B;  4F1S A;  1GUA B;  1UD7 A;  2ZVO A;  4W9L A;  1WE6 A;  4IM3 A;  2G3Q B;  3PVL A;  4GB9 A;  2KXJ A;  2K6Q A;  1L2N A;  3NY5 A;  2FNJ B;  2VRR B;  1P98 A;  2GOW A;  2WYQ A;  3RUI B;  2DX5 B;  2KTR B;  2MRP A;  4I6P A;  4PYU A;  2IO1 B;  3ZNH B;  4NQK E;  2KQ7 A;  4A20 A;  3L13 A;  4DHJ B;  2LXC A;  4K7W A;  3V62 A;  2KVR A;  1WZ0 A;  2KKC A;  2N9X A;  3CST A;  1WJN A;  2N7D A;  4FUL A;  2N9E B;  1EF1 A;  3ENE A;  1WYW B;  3IFW B;  4BKT A;  4FJZ A;  5E6O A;  3L0W B;  4AP4 C;  1OTR B;  1WR1 A;  1YX6 B;  2D11 A;  4JGH B;  4TV3 A;  2R2Q A;  3APF A;  3A9K B;  2RSU A;  2JT4 B;  2BWE S;  5D2M B;  1P1A A;  5JHB A;  1HE8 A;  2NPT B;  3OJ3 A;  4GGQ A;  2ZPN A;  4WWN A;  5CX3 A;  4HCN B;  3ZTD A;  4KSL C;  4W9H A;  3VUX A;  4PYZ A;  4GSW A;  1E8X A;  5GMV A;  3DVG Y;  2MBQ A;  4ICV A;  3ML8 A;  1NI2 A;  4HPM B;  4IW0 A;  2LI5 A;  1ZKH A;  4GOC A;  5EDS A;  3C0R B;  2UYZ B;  1V6E A;  2PJH A;  2JUO A;  2LXA A;  2KJR A;  2BYF A;  4IWQ A;  4GIV A;  3PRZ A;  2JRH A;  4BBN F;  1V2Y A;  3P2B A;  5D94 A;  1J19 A;  3CF6 E;  3ALB A;  3M63 B;  2ZCC A;  3H7P B;  4TQ0 A;  1WJU A;  1WXM A;  1WF9 A;  4MH0 E;  3RZW C;  2IZV B;  1WXV A;  1WX9 A;  4DHZ B;  4DDI D;  3DCG A;  1QZE A;  4CO7 A;  2LGY A;  2KFK B;  3A9J B;  3HIZ A;  4E74 A;  2DHZ A;  1KOT A;  2KDE B;  5KHO A;  1A5R A;  4AUQ C;  4DK5 A;  2FIF A;  2LVQ A;  5L83 A;  4CYE A;  2V4L A;  3JYU A;  1T0Y A;  2LGX A;  4II2 B;  4IWP A;  4HXD A;  3UQB A;  2MSE D;  3IHP C;  3DBR I;  2MCN B;  3U30 A;  3WAN A;  2Z0D B;  3A1Q A;  2EMT A;  2IYD B;  2KWC A;  2LVO A;  4IC7 B;  2W9N A;  2EKE C;  3ZTC A;  1WGD A;  1XQQ A;  3UIO B;  2KHW B;  2N1V A;  2CS4 A;  5AZF A;  1ZW7 A;  3DBH I;  1C3T A;  1UZX B;  2LRU A;  3ZIM A;  1Z2M A;  2J0K A;  3N30 A;  3DBL I;  3PLV A;  4G0N B;  1Z5S B;  3N3K B;  2HJ8 A;  2L05 A;  1V49 A;  2CHZ A;  2KJ6 A;  1C1Y B;  3APD A;  4FJY A;  4IWO A;  1WZ3 A;  3QC8 B;  4FN2 A;  4TUU A;  5D6J B;  1NDD A;  2BGF A;  3VFK A;  5DPT A;  3KW5 B;  4NY0 A;  3WAP A;  2KWU B;  1VCB A;  5C23 A;  4EZK A;  4XC2 A;  2Y5B B;  3L17 A;  4WJQ A;  2KTR A;  2JY6 A;  3PZD A;  4AJW A;  4EEW A;  4RM8 A;  3VVW B;  4HLE A;  2MBE A;  4EUT A;  5JH5 C;  1YQB A;  2JXX A;  2O6V D;  4MGK E;  3M3J A;  4EFO A;  3ZDM C;  3PTF C;  3VTV A;  3R7R A;  1F9J A;  1OQY A;  2MWS B;  2ZNV B;  2KDI A;  4NNJ B;  2BKF A;  4MSQ B;  1KM7 A;  2JRI B;  2R2O A;  3A9K A;  2PE6 B;  2N9P C;  4BFR A;  3AU5 A;  1V9J A;  3PHW B;  1WH3 A;  3TJP A;  1M94 A;  2NPT A;  4FBJ B;  3K9O B;  4EZL A;  2XEW A;  1S1Q B;  1UEL A;  4HDQ A;  1LXD A;  2RGF A;  1SGH A;  2WWZ A;  3HK0 A;  4B95 A;  3ECI A;  4IM2 A;  2A5U A;  1J0G A;  2LWP A;  3NS8 A;  2FCN A;  4BBN C;  2M4N A;  2JVC A;  4JL9 A;  4GDL B;  1WMH B;  3RYT A;  5JZE B;  2D07 B;  1OGW A;  4WQO B;  2GBK A;  1GC7 A;  3ZUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...