5IOIA

X-ray structure of the n-terminal domain of human doublecortin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
LVPRGSHMAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFDDVEYTKNVNPNWSVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Neuronal migration protein doublecortin
publication title Crystal Structures of the Human Doublecortin C- and N-terminal Domains in Complex with Specific Antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 107
sequence length 107
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 5ioiA00
1MFWA 5IKCM 5IP4D 1UF0A 5IN7A 5IOIA 2DNFA 2BQQA 1MJDA 5IO9A 1MG4A
chains in the Genus database with same CATH superfamily
4KZ0A 5JH5C 3CF6E 1WGDA 2C7HA 1R4MI 4JIOU 2RDHA 2KN4A 4GOCA 5AZFA 2O6VB 2RD0A 3AEEB 4NJ6A 1LO5D 2JZ3B 4DXFA 2MW5A 4AJYB 1V9JA 3KUZA 3VXWA 3V62A 2GRIA 2LWPA 4WWPA 4RH6A 5HFYA 3RNBC 1UUPA 4OZBA 1HA5A 4HXDA 1YX5B 3OJ3A 4I6NB 4A3PA 3KYDD 2DAFA 1OTRB 4EZJA 1B1ZA 4KKJA 1J7CA 4TQ0A 1P7FA 2SEBD 2K5PA 1WE6A 2M1MA 3SHQA 4HKQA 3D32A 3AE7B 2R2OA 3B1LX 1KF6B 1AYFA 2G9HD 3ABVB 2KQ4X 3IT4B 2VH1A 1J8CA 3BYTB 1G6JA 3ZDTA 5H92C 2JX5A 2BWES 4BFRA 3H7PB 2WU5B 3A9KB 1WWTA 1AARA 3HK0A 3ML9A 3QC8B 2WXLA 3AEBB 2DZJA 4N59A 1OGWA 2R61A 1CJEA 1XEEA 4RF0A 1NEKB 2J52A 1YN4A 4MT5A 3KUDB 2INCC 4RGTA 1WJUA 1SBBB 4KX6B 3AE4B 2KDIA 3B2FA 1PYWD 3QARA 4IWOA 4MSMB 2LFIA 3GP7A 2L1AA 5GXGB 1WI0A 5G55A 5DPWA 5DPSA 3RCZA 4W9CA 2L0FA 3AE3B 2KC1A 3AI5A 1ZKHA 3Q8EA 1L6UA 1XLQA 4FADA 1XLOA 1T3QA 2FUHB 3QHTA 2OOBB 1T0QC 1YMHE 4II2B 3A9JB 2WHIA 3N9YC 1RAXA 1WXAA 4AP4C 2JXXA 4E3CA 3OWEB 5GMVA 3H7PA 2N7DA 4YL8A 4FBJB 2KWUB 1KH0A 3A9KA 4Q2JA 4FN2A 3ZVVA 2L83A 3AXCA 3H6NA 2K1FA 3J9CA 2B76B 3AE1B 3DBLI 2WXPA 1UH6A 3L4PA 2L52A 5HI1A 1V5TA 1WJ6A 1TY2A 3DBRI 1FM0D 3TCAA 5IP4D 3AE8B 2KKCA 4WJQA 4HK2A 2BB6A 3DVNV 4YSXB 4II3B 2JUOA 4OHJA 3PO0A 5LNK1 3PLUA 2IGDA 1ZE3D 1C9FA 1ET6A 1GC7A 5J2RA 3ZGZA 5KHOA 4MDKE 4RM8A 2KTRB 3NOBA 2DZKA 1C4PA 2TSSA 3A9JA 4WWNA 3HVZA 3P63A 3AE9B 3RNAC 1FNVA 4NPNA 1UELA 2PMVA 1M4VA 3L13A 4MH8A 3UGBB 4BAXA 1E8XA 1EF1A 4WWOA 1J19A 2LJIA 4LCDE 3ZRFA 3RUIB 4O1NA 2KLCA 4MM3B 1RFAA 2MRPA 2NBUA 2IO1B 1EUVB 2V3PA 1FIQA 3EFUA 4NNJB 4IOIE 5LXIB 1XF5L 5CTRC 4PS8A 1PDXA 4QAYA 3N1YC 2W55A 3RNFC 1L5PA 1V81A 3PRZA 3A4RA 4I6LB 2KAJA 2ACZB 1DYQA 3L10B 2VZKD 3FILB 2KTRA 4M01A 5FR6A 2WNMA 4UDUC 1ESFA 2C9WB 4XWWA 4L1BA 4ARCA 2KWVB 1UD7A 3RZFA 4MGYE 2BS3B 1QOGA 1GJZA 2NMQA 4M0WB 3SEBA 3ONSA 3KUCB 3KWVA 1FNWA 1DGJA 1VR9A 1ZW7A 2IBIB 4DK5A 2DBYA 4B6WA 2M8SA 3EFCA 2KT7A 5CHFA 4ZRQA 4DXGA 3N1XC 4XX5A 2J0KA 4MM3A 1I35A 2QDFA 3P4RB 3Q8BA 2CU3A 1JMLA 3AB5A 3V61A 2MBQA 4S17A 4HRSA 1D3ZA 3MP9A 1FFVA 1AWDA 3IAS1 4PK1A 1E0ZA 2Z8LA 4W9IA 2KYWA 2G1EA 1VLBA 1L6VA 2AWTA 1P7EA 2X38A 3FILA 4ZHPA 1QOBA 2L3ZA 2HE7A 2MCNB 5DPTA 4IDIA 3NUHB 1I4QA 3ZO5B 2ZCCA 4XGAB 3ZUNA 3Q69A 1JALA 4M0WA 3KWLA 1D5ZC 5AZGA 1D6EC 1K50A 2BYTA 3GS2A 4OVVA 4HPMB 3HIZA 5DPRA 3LDZE 2PVOD 2G4DB 2QILA 3DHHC 1FXTB 1MPEA 2KLGA 3RT3B 3MC0B 3C8YA 2FIDA 2JYEA 2W54A 1WRIA 1OQYA 4K3CA 4JLCA 1I4HA 4ASWC 5BYQA 1K52A 3DBSA 3DWGC 3ZNGC 1KM7A 4WAFA 3WALA 3URYA 3A4SC 4CQNA 1WXMA 1TTNA 2N9LA 4MEMA 4FJYA 2FCSA 3VQIA 3M63B 2J4XA 2MP2B 3K9PB 2C7MB 2NTTA 5LXHA 2N7JA 4W9DA 2LJ5A 2MH7A 4OVUA 1N60A 2NVUI 2BYVE 4CO7A 3DCGA 2WU2B 5D2MB 1D5MC 1ZXIA 2FAZA 4A55A 3CIRB 4WH4A 2HJ8A 4IG7B 3KLSX 2MBHA 1SSNA 4YXDB 2EMSA 3LJ3A 2WXKA 5HKHA 5DCNA 1FRRA 2KHWB 2EMTA 2I1JA 4I6PA 4KVGB 3IVFA 1F52A 1NYQA 2J0MA 3DBHB 4TUUA 4PYZA 4ZYSA 1GB1A 4EOYA 1EO6A 2N1VA 4M8MA 4HKZE 4RM9A 3UI3A 1WZ0A 2AQ1B 2MP2A 4RGNA 2LGYA 4HPPA 2RGFA 2RSUA 3AECB 4EFOA 2D3BA 1RM6C 4WURA 2WYQA 2ZVOA 3RNCC 2HDEA 4XDDA 3HVDA 3O13A 4R3DA 2JSVX 2PTLA 2LI5A 1WJNA 1TBEA 1WGRA 2JPHA 1JWSD 3BZDB 5BYRA 1C4CA 3AEDB 3LB8C 1F77A 1TS3A 5HHDG 1YNTE 2QHOA 1T5XD 3B9JA 5G2NA 2D5GA 1P98A 3VUWA 1KOTA 2KK8A 2N9PC 3VDZA 4C4VB 3TJPA 1QLBB 2BYFA 3VTWA 4N6EB 1FPYA 1EM7A 2GI9A 1WX8A 3VHTC 2PJHA 4G11A 2R2QA 4OZAA 3NJTA 1C1YB 1PUTA 1V8CA 1I4XA 4P16A 2AL3A 1SE4A 1ENFA 3UIPB 2YEPF 4LNNA 2DZIA 3UQAA 3KYCD 5E6PA 1TKYA 1F2RI 1ZGUB 3T3OA 5IKCM 3N32A 4MJSA 1KTKA 2IGGA 1PQSA 2MA9B 2KJRA 2Z0EB 3QAQA 5EE9A 5AUIA 2JWZA 4MELA 1TGZB 1Q0WB 3I57A 1TS4A 1ZUD2 5FKAC 1WMHB 4YT0B 3L08A 4C4VA 4NAWB 4WQOB 4XYCA 4BOSC 4MACA 5JHBA 4D2KA 2JRIB 1FD6A 4W9HA 2L00B 3R8BA 4K7SA 4EKUA 1VZ6A 3Q8AA 2FCQA 3APCA 2CJNA 1GB4A 2FE8A 1AW7A 4XC2A 3AH7A 1FXIA 3NY5A 2KOXA 1XD3B 3RI7C 2BKRB 1YN5A 4WJPA 2IZVB 4BZAA 1MHXA 2LGIA 5C1ZA 1NENB 2A5UA 1WX9A 3ZTDA 1T0YA 2RR9A 2WDQB 3MTNB 2RPQA 3JW0X 4JGHB 1F1HA 2KVZA 5D3IB 3TEWA 1TKGA 2MLBA 4KIKB 4LNIA 3N20C 2JZPA 2KWDA 1CQVA 2QIEB 4NAWA 4EE2A 4BOZB 2CR5A 2LVOA 3MFGA 5D7GA 3UF8A 2LXCA 4JWSC 1F9JA 2JZZA 1XT9B 1HEZE 2BB5A 3L0WB 4B0MA 4FA6A 4W9EA 3I63C 3R3MA 4GMVA 1SIJA 3RD2A 4MH0E 3M62B 1JRPA 2K22A 2GMIC 3MC9A 3NZSA 3M95A 3AN1A 3EGRA 2XK5B 1X1MA 3V05A 1J7AA 4E71A 2N4FA 3IHPC 2Q5WD 2BT6A 3KH0A 2XEWA 3Q14C 1PGAA 2RDBC 2O6VA 4FJVB 1WGKA 2MX2A 4F7ZA 1SF0A 3TIXA 5JHAA 3C19A 1MI0A 3IXSA 4KIKA 3HRDD 3NVWA 2NPTB 1V1OA 4K3BA 3ZIMA 4IM0A 3W5UB 2V4LA 3GZNB 1QQRA 2KQ7A 4IC7B 1QOAA 1WZ3A 3QCAA 2G4SA 1R4NI 1F0ZA 2KC2A 1WRDB 2J53A 3U8ZA 1SGHA 3P42A 1E10A 3MC8A 3N30A 2BW2A 2INPE 5TR5A 4C7YA 2MJEA 1WX7A 3U52E 1WFYA 3GB1A 3B08A 4ANVA 2LMCA 4EZKA 2XK5A 5JZEB 5C3JB 2W3SA 5L83A 2FCNA 1NYRA 3NS8A 5MPOA 4FHKA 4E74A 4IWPA 4ZYNA 1WXSA 4ITKA 1ZXHA 1E90A 2MBEA 2INDC 4P1BC 1WJ4A 4YTPB 1KLVA 2KDBA 1K51A 2CKHB 4TKNA 3TL5A 3R66C 1UBIA 4MSQB 1SEBD 2IO2B 3IAM1 3APFA 4REZA 3NRZA 3KQ4A 1ET9A 4IM2A 1T0SC 4IKGA 1MJDA 3WIMA 2DENB 1V2YA 2XN9C 1C76A 4GDLB 2WX1A 3U7ZA 1WR6E 1V86A 3GE8C 3X23A 5BMGA 3IFWB 5JXVA 1GNUA 1D5XC 2WGSA 2V3SA 2WXHA 2L76A 3HUIA 4DQOC 1R4MB 2NS5A 5E6OA 3SDLC 1I4GA 2K8BA 3CWIA 4EUTA 5AZHA 3H7SA 4GN1A 2KMCA 2JYTA 5D94A 4XDCA 3ZJUA 4DWFA 2WXNA 2OJRA 4RNAA 4F1SA 3Q8FA 3LXFA 2IJ0A 3RMKC 2CU1A 1IGDA 1C77A 4A90A 2BTEA 1OQQA 4GDLA 1N6ZA 1NBFC 4DBGA 3PZ7A 1I42A 1FCCC 5BYSA 1OQRA 4FJZA 3PV1A 2KMMA 4AUQC 1ACCA 3BVGA 4G0NB 2IGHA 3ZKJC 3DBHI 1JROA 4KDIC 1DOIA 2KMAA 4ZOHC 2UYZB 1MFWA 2D11A 3RYTA 1P3QU 1FO4A 1T6BX 1LQBA 1WM3A 3BVMA 4HLEA 2D3CA 2IPKD 2PW9A 4LDTD 1VZ7A 2O2VB 1K8RB 3DVGY 1FEHA 2M0XA 2KACA 4JL9A 3BK1A 3ZJTA 4OW0A 4US9A 3CSTA 3TUOA 2MHJA 3R2TA 2I2YA 2K6DB 2GBNA 5LLIA 3V6CB 2M4NA 3NVZA 3TSSA 4KGSA 3WAOA 4LK0M 2WXOA 4XZ4A 3H9DA 5IA7A 1TY0A 1P1AA 2G3QB 4BBNC 5I4DA 1YQ3B 2MSED 1FCLA 4F8CB 1XCTL 3B0AA 3BINA 2K6QA 4YWGG 4AOFA 2W3RA 3T8MA 1VZ8A 2AYOB 3DWMA 4EEWA 2O6VD 3KVFB 4FLHA 2ZPYA 3OJ4B 2W82A 3DBLB 2LGXA 2WXRA 2WXGA 3IBEA 3PRPB 4A3OA 2I1KA 2ZW0A 3U30A 1TT5B 3UIOB 2AL6A 3PGEA 3DBRB 2O2VA 1ZOYB 2KWCA 2ZNVC 3PT2B 3ZJVA 2SAKA 2OJWA 4BKTA 1E7UA 4NAMA 4URKA 4P7IA 4W9LA 4WWMA 2EKIA 3VUYA 3C0RB 3SU8X 4OVZA 4K7UA 1WE7A 2MWSB 3ETRA 4X57B 2DYOA 3VVWB 2HD5B 2BS4B 4LLGM 1SJHD 5FR3A 3NVYA 2K8HA 2VH2A 3P4QB 3U2SC 2BQQA 2D07B 1JRUA 4NJ7A 1I4PA 5IN7A 2QEJC 3Q3FA 1N61A 3WANA 5EE0A 1ISNA 2J7QB 1QT9A 2ON8A 3R7RA 2KFKB 4JE3B 2NBVB 4MGKE 3ZLZA 2Z59B 1Y56A 3A1QB 1GG3A 2N1WA 2D3GA 4C80A 2BWFA 3PSEB 2CHZA 3AEFB 4BBNF 3Q8CA 2K39A 4YTNB 2Z0DB 3A33B 3T9LA 2KX3A 3BY4B 1XCQL 2IY1B 3BYYB 3VFKA 1I4RA 2AQ2B 1BMLC 3SD5A 1SE9A 4FHJA 1SIFA 3NS1A 2IYDB 2LHEA 5IO9A 2KDMA 3ECIA 1FMAD 2M56B 2WXFA 4PT5A 3PHXB 1E7PB 1XQQA 2D10A 3K9OB 3VUXA 1PGBA 4DHZB 2JY6A 2KX0A 2HJ1A 2ZNVB 1MHHE 2MBOA 2V1YA 3RZWC 2IO0B 2FUG1 2ZCBA 5EE3A 1VJKA 3VAWA 1TZOA 1Z2MA 2FCMA 1GUAB 2KFKA 2WLBA 4JWUC 4K1RB 4ICUA 5IOIA 4KSKC 2AX5A 1IUEA 4CYEA 3QX1A 4CHKA 4MGZE 2LASA 4C56C 3JSVB 3ZRCA 2WWZA 4YTMB 2INNE 3R7QA 4M8NA 3ZQ4A 4ANWA 5L95C 4HWIB 4WAAA 4NQKE 3ZNHB 4TQ1A 4NJCA 1N5XA 1CMXB 1WXVA 3QJZA 3AE5B 2OEDA 5T8IA 3OLMD 2PVGC 3PLVA 5D6JB 2LHDA 2PKOA 3FKYA 2RMMA 1NVID 2KVRA 1JWAD 4A8XC 1RWSA 1YD8U 1L4DB 1ZDVA 3EHVA 4AWJA 2NBWB 1QZEA 3WAMA 2ZJDA 2KDFB 1KJTA 1QF6A 1Q5WB 1I7HA 4B95A 1V80A 2A4ZA 3SFEB 4ZHOA 2ZPNA 3CSFA 1JQ4A 1DOXA 2D2QA 5EE1A 3VTVA 3ZNID 3JVZX 2LXAA 3JSVA 2VRRB 1GOZA 3BWUD 1UBQA 3PREA 4L2YA 2EKEC 3W5VB 5C2TB 2LVQA 4NZLB 1SB3C 3PS6A 3GE3C 1UGJA 4RFBA 4RCOA 1AN8A 2JVCA 1EWCA 2V3NA 1JWMD 2DZMA 3PPAA 4PS7A 3WAPA 2UWQA 1YOVB 2BVCA 4B9KA 5AUKA 1WMHA 3W2DA 4P1CC 1P0RA 1OEYA 1SJED 1ROEA 1BXTA 5AEKB 4P6VF 4KGTA 4DHJB 3DHIC 2DNFA 4RGMA 4AJWA 4TSSA 4DDGD 2DLBA 3AU5A 4MGIE 2YVCA 3NZUA 3BIID 2BKFA 1UZXB 1ZPSA 2GBMA 4S0RA 5CHWA 3ZXRA 4H2AA 4J6IA 2K3UA 2GLSA 3ZXVA 1MG4A 2BF8B 1KLGD 2AEHA 2DWQA 4RGOS 4ZRJA 3RNEC 3AE6B 2C60A 3DQVA 4HEA1 1LGRA 1N62A 3Q6BA 2I38A 3NG0A 2MBBB 2M17A 4KSLC 4W9JA 2JF5A 3AM9A 2CHWA 3EUB2 2X8XX 3IG3A 3JYUA 1FXAA 4DDID 3W1SA 1V97A 4A20A 4KV2A 1WR1A 3UINB 1WF9A 3NZ3A 1YX6B 5H8YE 4ANUA 1L0VB 4N9F4 4LNOA 1E8WA 4RMAA 1IPGA 2FIFA 1P9DU 3B2GA 1V5OA 1JW9D 2Y3AA 3UQBA 2PLPA 1CZPA 2N7EA 4AQ7A 4BKSA 2DAJA 3DPDA 3NVVA 1V6EA 3MJWA 2Y5CA 2JT4B 3ENEA 3EECA 2N0SB 4GSWA 1RLFA 3TEYA 2LGSA 1VCBA 1WGGA 3BK2A 1UNSA 1J7BA 3GOEA 4LTUA 2WQYB 2ZEQA 3S2AA 3AE2B 2WDVB 1ZDXA 3VH4B 2NPTA 5C23A 4HJGE 4HROA 2FNJB 1WGHA 3TBLD 3U4EG 1E7VA 3FAHA 1Z5SB 1TKEA 2H88B 3Q3NC 4W9FA 4PS3A 1C3TA 2IY0B 2KZRA 4BVUC 1C4AA 2C7NB 1EF5A 2PPHA 4KKIA 4PYUA 1JCKB 3BVZA 3V60A 1IP9A 1WYWB 1C79A 4HJKA 2L0TA 2MJDA 3AMZA 2NCNA 2OHFA 3MJ5A 1GAQB 2LRUA 2QMTA 4OZCA 4HCPB 2K0PA 2PE6B 2LVPA 3OG5A 2KO3A 3TEZA 3Q3MC 1EU3A 1HTQA 3MHSD 2LUMA 2FBWB 2M0AA 1H4RA 2REXA 2WP9B 5BMHA 3AU4A 3ZTCA 3N1ZC 2GOWA 1WGYA 1FFUA 2WS3B 1NDDA 4GXBA 2L7RA 2L32A 4TV3A 2AQ3B 3SR6A 2RDGA 1QKZA 3PZ8A 1C78A 2DYMA 2KJHB 2WDRB 4HDOA 1H8CA 3ZW3A 1R7SA 3P4SB 2LEKA 1RRBA 5J17A 5HG2A 4M02A 2ZW1A 2BBCA 1JWBD 5BO4B 2KNBA 2ICIA 2KQSA 1STEA 1NI2A 3EA6A 2JRHA 4K7WA 4ICVA 1TIFA 3VRBB 4ACFA 1BUIC 1YIWA 3RNGC 4C7ZA 1SE3A 1SXTA 3R2IA 4B0EA 4BKGA 4KDLB 4K81A 4GDKB 1R4NB 4GU2A 2M19A 3PVLA 2KFJA 4G3XB 5IAAC 4AS1A 2V4IB 4TMAB 4XWTA 1HZ6A 4ARIA 2JQRB 3RN9C 1LM8B 3RULA 2KN5A 3E56A 4RF1A 3VR9B 1VRAB 2IO3B 2NTSA 1YQ4B 2V0GA 1EU4A 3Q2AC 2GBRA 1EWYC 3SFDB 1K53A 2K25A 3EC8A 3X0WA 2ZVNA 3TMPB 2GBKA 3P4PB 1V1PB 4IUMB 1XXGA 1SE2A 1WXQA 1DOYA 1FNUA 2HTHA 3E9SA 3P1MA 3ZYYX 1OEYJ 1TYGB 1YJJA 2LZ6A 1ZP0B 4N58A 1PFDA 5BMIA 5CHVC 2NR2A 4L23A 3P2BA 3Q3JA 4G50A 3LYYA 3T3NA 1OFFA 2UU7A 2MQJA 3PHWB 1WSPA 3TEXA 2BGFA 4DHJD 3AV8A 1S3SG 2G45B 3OAWA 1PGXA 4DHZE 4GDKA 2IDYA 2KDEB 4LJOB 2L8JA 1KLUD 2LRWA 2PIAA 1CK1A 1HXYD 1XLNA 3W9CB 2DYBA 4BKSD 1UF0A 2KD0A 3N3KB 1RFKA 2E6XA 4IWQA 3WCQA 4USAA 4XE0A 3RPFC 3W1YA 4HPLB 5FK9C 4LJPB 3VR8B 1V1PA 4HVBA 4ANXA 2BYEA 4JQWC 2V9HA 1Q10A 5E6JA 2ONQA 2MEKA 5G5HA 2XBBC 2XNAC 2KTFA 4YSZB 2KANA 3KW5B 3Q3OC 4M00A 3PZDA 1A5RA 1VDVA 3V6EB 2KXJA 3QIJA 1WY8A 2GB1A 4EZLA 4J3OD 2J0JA 3AEGB 1FRDA 4A6QA 2E3TA 3HHMA 2JXTA 1N63A 3VH3B 1D4BA 2HTME 4LNKA 1WM2A 1BT0A 2YLMA 4A9AA 4WIPA 1E8ZA 4HCNB 3L54A 1YJ1A 1A70A 5J18A 1JWUD 4GIVA 3I9V1 3M3JA 1E6EB 1MVKA 1T0RC 4JPSA 2BS2B 4ZRKA 1L4ZB 4NY0A 4KZCA 1IBXB 5EDSA 4GLSC 1KFYB 2W9NA 3O65B 5KHQA 2LD9A 4WJNA 1MG8A 1XO3A 3I3TB 1HZ5A 4WJOA 3QQ8B 2C5LC 4LNFA 3WA0A 4C00A 5CX3A 2N9EB 2CJOA 1E8YA 2RPVA 3L16A 3DVNU 2K9XA 2ASQA 2PEAA 4FULA 4MJSB 1Y8RC 3A1QA 3H1UA 1E9MA 1HQRD 2DX5B 4W9KA 4W9GA 2KJ6A 1KRHA 3U7DA 3DOWA 2QSDA 1S1QB 5D3DA 4JX1C 1YN3A 3RFZB 3QA8A 4WQMA 1VD2A 1L7YA 2EELA 3DHGC 3PRMB 1L0YB 3DVGX 1HTOA 2WXQA 2L05A 2JU6X 3W1SC 1WH3A 2D3AA 4GB9A 1HE8A 4FXCA 2Y5BB 2QCZA 1YJIA 1TJEA 1WYGA 3APDA 1LFDA 1QILA 3GZNI 1UWMA 5TSSA 1E5WA 1IBXA 1GPXA 2H89B 1IGCA 5E6NA 3AULA 2YEPB 5G5GA 2WXJA 3AEAB 2MJ3A 2LGDA 1L0XB 2VZKB 2N9KA 1Q1OA 2J42A 2K8CA 1GC6A 4DXAB 2CS4A 1L2NA 3NHEB 1UGMA 3L17A 3VTUA 1TZ1A 4ZRIA 1J0GA 3CMMB 1IYFA 2GBJA 2DHZA 2WXMA 3MHZA 2CHXA 3HM6X 1RYJA 3VRAB 1V49A 3ZNZB 4YSYB 1YQBA 1LXDA 4LDTB 2N9XA 3H8HA 4ZDVA 3I5JC 1QOFA 2BPSA 3QK0A 2Y5PA 3ALBA 3FC4A 3V3XA 2B3AA 4HDQA 3ZDMC 4GGQA 4US8A 4NQLB 1N5WA 2PE9A 2WXIA 2JWUA 4ZRPA 1TS5A 3HM3A 1B9RA 3ML8A 1TS2A 1U4AA 3QWZB 3IT6B 4IM3A 2WDTB 2LUEA 1M94A 4IW0A 1UWXA 2ZZPB 4KGRA 2WX0A 1NI3A 2QJLA 1XLPA 3PTFC 3DDCB 1WIAA 1F2RC 2QC8A
chains in the Genus database with same CATH topology
1MFWA 5IKCM 5IP4D 1UF0A 5IN7A 5IOIA 2DNFA 2BQQA 1MJDA 5IO9A 1MG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MFW A;  5IKC M;  5IP4 D;  1UF0 A;  5IN7 A;  5IOI A;  2DNF A;  2BQQ A;  1MJD A;  5IO9 A;  1MG4 A; 
#chains in the Genus database with same CATH topology
 4KZ0 A;  5JH5 C;  3CF6 E;  1WGD A;  2C7H A;  1R4M I;  4JIO U;  2RDH A;  2KN4 A;  4GOC A;  5AZF A;  2O6V B;  2RD0 A;  3AEE B;  4NJ6 A;  1LO5 D;  2JZ3 B;  4DXF A;  2MW5 A;  4AJY B;  1V9J A;  3KUZ A;  3VXW A;  3V62 A;  2GRI A;  2LWP A;  4WWP A;  4RH6 A;  5HFY A;  3RNB C;  1UUP A;  4OZB A;  1HA5 A;  4HXD A;  1YX5 B;  3OJ3 A;  4I6N B;  4A3P A;  3KYD D;  2DAF A;  1OTR B;  4EZJ A;  1B1Z A;  4KKJ A;  1J7C A;  4TQ0 A;  1P7F A;  2SEB D;  2K5P A;  1WE6 A;  2M1M A;  3SHQ A;  4HKQ A;  3D32 A;  3AE7 B;  2R2O A;  3B1L X;  1KF6 B;  1AYF A;  2G9H D;  3ABV B;  2KQ4 X;  3IT4 B;  2VH1 A;  1J8C A;  3BYT B;  1G6J A;  3ZDT A;  5H92 C;  2JX5 A;  2BWE S;  4BFR A;  3H7P B;  2WU5 B;  3A9K B;  1WWT A;  1AAR A;  3HK0 A;  3ML9 A;  3QC8 B;  2WXL A;  3AEB B;  2DZJ A;  4N59 A;  1OGW A;  2R61 A;  1CJE A;  1XEE A;  4RF0 A;  1NEK B;  2J52 A;  1YN4 A;  4MT5 A;  3KUD B;  2INC C;  4RGT A;  1WJU A;  1SBB B;  4KX6 B;  3AE4 B;  2KDI A;  3B2F A;  1PYW D;  3QAR A;  4IWO A;  4MSM B;  2LFI A;  3GP7 A;  2L1A A;  5GXG B;  1WI0 A;  5G55 A;  5DPW A;  5DPS A;  3RCZ A;  4W9C A;  2L0F A;  3AE3 B;  2KC1 A;  3AI5 A;  1ZKH A;  3Q8E A;  1L6U A;  1XLQ A;  4FAD A;  1XLO A;  1T3Q A;  2FUH B;  3QHT A;  2OOB B;  1T0Q C;  1YMH E;  4II2 B;  3A9J B;  2WHI A;  3N9Y C;  1RAX A;  1WXA A;  4AP4 C;  2JXX A;  4E3C A;  3OWE B;  5GMV A;  3H7P A;  2N7D A;  4YL8 A;  4FBJ B;  2KWU B;  1KH0 A;  3A9K A;  4Q2J A;  4FN2 A;  3ZVV A;  2L83 A;  3AXC A;  3H6N A;  2K1F A;  3J9C A;  2B76 B;  3AE1 B;  3DBL I;  2WXP A;  1UH6 A;  3L4P A;  2L52 A;  5HI1 A;  1V5T A;  1WJ6 A;  1TY2 A;  3DBR I;  1FM0 D;  3TCA A;  5IP4 D;  3AE8 B;  2KKC A;  4WJQ A;  4HK2 A;  2BB6 A;  3DVN V;  4YSX B;  4II3 B;  2JUO A;  4OHJ A;  3PO0 A;  5LNK 1;  3PLU A;  2IGD A;  1ZE3 D;  1C9F A;  1ET6 A;  1GC7 A;  5J2R A;  3ZGZ A;  5KHO A;  4MDK E;  4RM8 A;  2KTR B;  3NOB A;  2DZK A;  1C4P A;  2TSS A;  3A9J A;  4WWN A;  3HVZ A;  3P63 A;  3AE9 B;  3RNA C;  1FNV A;  4NPN A;  1UEL A;  2PMV A;  1M4V A;  3L13 A;  4MH8 A;  3UGB B;  4BAX A;  1E8X A;  1EF1 A;  4WWO A;  1J19 A;  2LJI A;  4LCD E;  3ZRF A;  3RUI B;  4O1N A;  2KLC A;  4MM3 B;  1RFA A;  2MRP A;  2NBU A;  2IO1 B;  1EUV B;  2V3P A;  1FIQ A;  3EFU A;  4NNJ B;  4IOI E;  5LXI B;  1XF5 L;  5CTR C;  4PS8 A;  1PDX A;  4QAY A;  3N1Y C;  2W55 A;  3RNF C;  1L5P A;  1V81 A;  3PRZ A;  3A4R A;  4I6L B;  2KAJ A;  2ACZ B;  1DYQ A;  3L10 B;  2VZK D;  3FIL B;  2KTR A;  4M01 A;  5FR6 A;  2WNM A;  4UDU C;  1ESF A;  2C9W B;  4XWW A;  4L1B A;  4ARC A;  2KWV B;  1UD7 A;  3RZF A;  4MGY E;  2BS3 B;  1QOG A;  1GJZ A;  2NMQ A;  4M0W B;  3SEB A;  3ONS A;  3KUC B;  3KWV A;  1FNW A;  1DGJ A;  1VR9 A;  1ZW7 A;  2IBI B;  4DK5 A;  2DBY A;  4B6W A;  2M8S A;  3EFC A;  2KT7 A;  5CHF A;  4ZRQ A;  4DXG A;  3N1X C;  4XX5 A;  2J0K A;  4MM3 A;  1I35 A;  2QDF A;  3P4R B;  3Q8B A;  2CU3 A;  1JML A;  3AB5 A;  3V61 A;  2MBQ A;  4S17 A;  4HRS A;  1D3Z A;  3MP9 A;  1FFV A;  1AWD A;  3IAS 1;  4PK1 A;  1E0Z A;  2Z8L A;  4W9I A;  2KYW A;  2G1E A;  1VLB A;  1L6V A;  2AWT A;  1P7E A;  2X38 A;  3FIL A;  4ZHP A;  1QOB A;  2L3Z A;  2HE7 A;  2MCN B;  5DPT A;  4IDI A;  3NUH B;  1I4Q A;  3ZO5 B;  2ZCC A;  4XGA B;  3ZUN A;  3Q69 A;  1JAL A;  4M0W A;  3KWL A;  1D5Z C;  5AZG A;  1D6E C;  1K50 A;  2BYT A;  3GS2 A;  4OVV A;  4HPM B;  3HIZ A;  5DPR A;  3LDZ E;  2PVO D;  2G4D B;  2QIL A;  3DHH C;  1FXT B;  1MPE A;  2KLG A;  3RT3 B;  3MC0 B;  3C8Y A;  2FID A;  2JYE A;  2W54 A;  1WRI A;  1OQY A;  4K3C A;  4JLC A;  1I4H A;  4ASW C;  5BYQ A;  1K52 A;  3DBS A;  3DWG C;  3ZNG C;  1KM7 A;  4WAF A;  3WAL A;  3URY A;  3A4S C;  4CQN A;  1WXM A;  1TTN A;  2N9L A;  4MEM A;  4FJY A;  2FCS A;  3VQI A;  3M63 B;  2J4X A;  2MP2 B;  3K9P B;  2C7M B;  2NTT A;  5LXH A;  2N7J A;  4W9D A;  2LJ5 A;  2MH7 A;  4OVU A;  1N60 A;  2NVU I;  2BYV E;  4CO7 A;  3DCG A;  2WU2 B;  5D2M B;  1D5M C;  1ZXI A;  2FAZ A;  4A55 A;  3CIR B;  4WH4 A;  2HJ8 A;  4IG7 B;  3KLS X;  2MBH A;  1SSN A;  4YXD B;  2EMS A;  3LJ3 A;  2WXK A;  5HKH A;  5DCN A;  1FRR A;  2KHW B;  2EMT A;  2I1J A;  4I6P A;  4KVG B;  3IVF A;  1F52 A;  1NYQ A;  2J0M A;  3DBH B;  4TUU A;  4PYZ A;  4ZYS A;  1GB1 A;  4EOY A;  1EO6 A;  2N1V A;  4M8M A;  4HKZ E;  4RM9 A;  3UI3 A;  1WZ0 A;  2AQ1 B;  2MP2 A;  4RGN A;  2LGY A;  4HPP A;  2RGF A;  2RSU A;  3AEC B;  4EFO A;  2D3B A;  1RM6 C;  4WUR A;  2WYQ A;  2ZVO A;  3RNC C;  2HDE A;  4XDD A;  3HVD A;  3O13 A;  4R3D A;  2JSV X;  2PTL A;  2LI5 A;  1WJN A;  1TBE A;  1WGR A;  2JPH A;  1JWS D;  3BZD B;  5BYR A;  1C4C A;  3AED B;  3LB8 C;  1F77 A;  1TS3 A;  5HHD G;  1YNT E;  2QHO A;  1T5X D;  3B9J A;  5G2N A;  2D5G A;  1P98 A;  3VUW A;  1KOT A;  2KK8 A;  2N9P C;  3VDZ A;  4C4V B;  3TJP A;  1QLB B;  2BYF A;  3VTW A;  4N6E B;  1FPY A;  1EM7 A;  2GI9 A;  1WX8 A;  3VHT C;  2PJH A;  4G11 A;  2R2Q A;  4OZA A;  3NJT A;  1C1Y B;  1PUT A;  1V8C A;  1I4X A;  4P16 A;  2AL3 A;  1SE4 A;  1ENF A;  3UIP B;  2YEP F;  4LNN A;  2DZI A;  3UQA A;  3KYC D;  5E6P A;  1TKY A;  1F2R I;  1ZGU B;  3T3O A;  5IKC M;  3N32 A;  4MJS A;  1KTK A;  2IGG A;  1PQS A;  2MA9 B;  2KJR A;  2Z0E B;  3QAQ A;  5EE9 A;  5AUI A;  2JWZ A;  4MEL A;  1TGZ B;  1Q0W B;  3I57 A;  1TS4 A;  1ZUD 2;  5FKA C;  1WMH B;  4YT0 B;  3L08 A;  4C4V A;  4NAW B;  4WQO B;  4XYC A;  4BOS C;  4MAC A;  5JHB A;  4D2K A;  2JRI B;  1FD6 A;  4W9H A;  2L00 B;  3R8B A;  4K7S A;  4EKU A;  1VZ6 A;  3Q8A A;  2FCQ A;  3APC A;  2CJN A;  1GB4 A;  2FE8 A;  1AW7 A;  4XC2 A;  3AH7 A;  1FXI A;  3NY5 A;  2KOX A;  1XD3 B;  3RI7 C;  2BKR B;  1YN5 A;  4WJP A;  2IZV B;  4BZA A;  1MHX A;  2LGI A;  5C1Z A;  1NEN B;  2A5U A;  1WX9 A;  3ZTD A;  1T0Y A;  2RR9 A;  2WDQ B;  3MTN B;  2RPQ A;  3JW0 X;  4JGH B;  1F1H A;  2KVZ A;  5D3I B;  3TEW A;  1TKG A;  2MLB A;  4KIK B;  4LNI A;  3N20 C;  2JZP A;  2KWD A;  1CQV A;  2QIE B;  4NAW A;  4EE2 A;  4BOZ B;  2CR5 A;  2LVO A;  3MFG A;  5D7G A;  3UF8 A;  2LXC A;  4JWS C;  1F9J A;  2JZZ A;  1XT9 B;  1HEZ E;  2BB5 A;  3L0W B;  4B0M A;  4FA6 A;  4W9E A;  3I63 C;  3R3M A;  4GMV A;  1SIJ A;  3RD2 A;  4MH0 E;  3M62 B;  1JRP A;  2K22 A;  2GMI C;  3MC9 A;  3NZS A;  3M95 A;  3AN1 A;  3EGR A;  2XK5 B;  1X1M A;  3V05 A;  1J7A A;  4E71 A;  2N4F A;  3IHP C;  2Q5W D;  2BT6 A;  3KH0 A;  2XEW A;  3Q14 C;  1PGA A;  2RDB C;  2O6V A;  4FJV B;  1WGK A;  2MX2 A;  4F7Z A;  1SF0 A;  3TIX A;  5JHA A;  3C19 A;  1MI0 A;  3IXS A;  4KIK A;  3HRD D;  3NVW A;  2NPT B;  1V1O A;  4K3B A;  3ZIM A;  4IM0 A;  3W5U B;  2V4L A;  3GZN B;  1QQR A;  2KQ7 A;  4IC7 B;  1QOA A;  1WZ3 A;  3QCA A;  2G4S A;  1R4N I;  1F0Z A;  2KC2 A;  1WRD B;  2J53 A;  3U8Z A;  1SGH A;  3P42 A;  1E10 A;  3MC8 A;  3N30 A;  2BW2 A;  2INP E;  5TR5 A;  4C7Y A;  2MJE A;  1WX7 A;  3U52 E;  1WFY A;  3GB1 A;  3B08 A;  4ANV A;  2LMC A;  4EZK A;  2XK5 A;  5JZE B;  5C3J B;  2W3S A;  5L83 A;  2FCN A;  1NYR A;  3NS8 A;  5MPO A;  4FHK A;  4E74 A;  4IWP A;  4ZYN A;  1WXS A;  4ITK A;  1ZXH A;  1E90 A;  2MBE A;  2IND C;  4P1B C;  1WJ4 A;  4YTP B;  1KLV A;  2KDB A;  1K51 A;  2CKH B;  4TKN A;  3TL5 A;  3R66 C;  1UBI A;  4MSQ B;  1SEB D;  2IO2 B;  3IAM 1;  3APF A;  4REZ A;  3NRZ A;  3KQ4 A;  1ET9 A;  4IM2 A;  1T0S C;  4IKG A;  1MJD A;  3WIM A;  2DEN B;  1V2Y A;  2XN9 C;  1C76 A;  4GDL B;  2WX1 A;  3U7Z A;  1WR6 E;  1V86 A;  3GE8 C;  3X23 A;  5BMG A;  3IFW B;  5JXV A;  1GNU A;  1D5X C;  2WGS A;  2V3S A;  2WXH A;  2L76 A;  3HUI A;  4DQO C;  1R4M B;  2NS5 A;  5E6O A;  3SDL C;  1I4G A;  2K8B A;  3CWI A;  4EUT A;  5AZH A;  3H7S A;  4GN1 A;  2KMC A;  2JYT A;  5D94 A;  4XDC A;  3ZJU A;  4DWF A;  2WXN A;  2OJR A;  4RNA A;  4F1S A;  3Q8F A;  3LXF A;  2IJ0 A;  3RMK C;  2CU1 A;  1IGD A;  1C77 A;  4A90 A;  2BTE A;  1OQQ A;  4GDL A;  1N6Z A;  1NBF C;  4DBG A;  3PZ7 A;  1I42 A;  1FCC C;  5BYS A;  1OQR A;  4FJZ A;  3PV1 A;  2KMM A;  4AUQ C;  1ACC A;  3BVG A;  4G0N B;  2IGH A;  3ZKJ C;  3DBH I;  1JRO A;  4KDI C;  1DOI A;  2KMA A;  4ZOH C;  2UYZ B;  1MFW A;  2D11 A;  3RYT A;  1P3Q U;  1FO4 A;  1T6B X;  1LQB A;  1WM3 A;  3BVM A;  4HLE A;  2D3C A;  2IPK D;  2PW9 A;  4LDT D;  1VZ7 A;  2O2V B;  1K8R B;  3DVG Y;  1FEH A;  2M0X A;  2KAC A;  4JL9 A;  3BK1 A;  3ZJT A;  4OW0 A;  4US9 A;  3CST A;  3TUO A;  2MHJ A;  3R2T A;  2I2Y A;  2K6D B;  2GBN A;  5LLI A;  3V6C B;  2M4N A;  3NVZ A;  3TSS A;  4KGS A;  3WAO A;  4LK0 M;  2WXO A;  4XZ4 A;  3H9D A;  5IA7 A;  1TY0 A;  1P1A A;  2G3Q B;  4BBN C;  5I4D A;  1YQ3 B;  2MSE D;  1FCL A;  4F8C B;  1XCT L;  3B0A A;  3BIN A;  2K6Q A;  4YWG G;  4AOF A;  2W3R A;  3T8M A;  1VZ8 A;  2AYO B;  3DWM A;  4EEW A;  2O6V D;  3KVF B;  4FLH A;  2ZPY A;  3OJ4 B;  2W82 A;  3DBL B;  2LGX A;  2WXR A;  2WXG A;  3IBE A;  3PRP B;  4A3O A;  2I1K A;  2ZW0 A;  3U30 A;  1TT5 B;  3UIO B;  2AL6 A;  3PGE A;  3DBR B;  2O2V A;  1ZOY B;  2KWC A;  2ZNV C;  3PT2 B;  3ZJV A;  2SAK A;  2OJW A;  4BKT A;  1E7U A;  4NAM A;  4URK A;  4P7I A;  4W9L A;  4WWM A;  2EKI A;  3VUY A;  3C0R B;  3SU8 X;  4OVZ A;  4K7U A;  1WE7 A;  2MWS B;  3ETR A;  4X57 B;  2DYO A;  3VVW B;  2HD5 B;  2BS4 B;  4LLG M;  1SJH D;  5FR3 A;  3NVY A;  2K8H A;  2VH2 A;  3P4Q B;  3U2S C;  2BQQ A;  2D07 B;  1JRU A;  4NJ7 A;  1I4P A;  5IN7 A;  2QEJ C;  3Q3F A;  1N61 A;  3WAN A;  5EE0 A;  1ISN A;  2J7Q B;  1QT9 A;  2ON8 A;  3R7R A;  2KFK B;  4JE3 B;  2NBV B;  4MGK E;  3ZLZ A;  2Z59 B;  1Y56 A;  3A1Q B;  1GG3 A;  2N1W A;  2D3G A;  4C80 A;  2BWF A;  3PSE B;  2CHZ A;  3AEF B;  4BBN F;  3Q8C A;  2K39 A;  4YTN B;  2Z0D B;  3A33 B;  3T9L A;  2KX3 A;  3BY4 B;  1XCQ L;  2IY1 B;  3BYY B;  3VFK A;  1I4R A;  2AQ2 B;  1BML C;  3SD5 A;  1SE9 A;  4FHJ A;  1SIF A;  3NS1 A;  2IYD B;  2LHE A;  5IO9 A;  2KDM A;  3ECI A;  1FMA D;  2M56 B;  2WXF A;  4PT5 A;  3PHX B;  1E7P B;  1XQQ A;  2D10 A;  3K9O B;  3VUX A;  1PGB A;  4DHZ B;  2JY6 A;  2KX0 A;  2HJ1 A;  2ZNV B;  1MHH E;  2MBO A;  2V1Y A;  3RZW C;  2IO0 B;  2FUG 1;  2ZCB A;  5EE3 A;  1VJK A;  3VAW A;  1TZO A;  1Z2M A;  2FCM A;  1GUA B;  2KFK A;  2WLB A;  4JWU C;  4K1R B;  4ICU A;  5IOI A;  4KSK C;  2AX5 A;  1IUE A;  4CYE A;  3QX1 A;  4CHK A;  4MGZ E;  2LAS A;  4C56 C;  3JSV B;  3ZRC A;  2WWZ A;  4YTM B;  2INN E;  3R7Q A;  4M8N A;  3ZQ4 A;  4ANW A;  5L95 C;  4HWI B;  4WAA A;  4NQK E;  3ZNH B;  4TQ1 A;  4NJC A;  1N5X A;  1CMX B;  1WXV A;  3QJZ A;  3AE5 B;  2OED A;  5T8I A;  3OLM D;  2PVG C;  3PLV A;  5D6J B;  2LHD A;  2PKO A;  3FKY A;  2RMM A;  1NVI D;  2KVR A;  1JWA D;  4A8X C;  1RWS A;  1YD8 U;  1L4D B;  1ZDV A;  3EHV A;  4AWJ A;  2NBW B;  1QZE A;  3WAM A;  2ZJD A;  2KDF B;  1KJT A;  1QF6 A;  1Q5W B;  1I7H A;  4B95 A;  1V80 A;  2A4Z A;  3SFE B;  4ZHO A;  2ZPN A;  3CSF A;  1JQ4 A;  1DOX A;  2D2Q A;  5EE1 A;  3VTV A;  3ZNI D;  3JVZ X;  2LXA A;  3JSV A;  2VRR B;  1GOZ A;  3BWU D;  1UBQ A;  3PRE A;  4L2Y A;  2EKE C;  3W5V B;  5C2T B;  2LVQ A;  4NZL B;  1SB3 C;  3PS6 A;  3GE3 C;  1UGJ A;  4RFB A;  4RCO A;  1AN8 A;  2JVC A;  1EWC A;  2V3N A;  1JWM D;  2DZM A;  3PPA A;  4PS7 A;  3WAP A;  2UWQ A;  1YOV B;  2BVC A;  4B9K A;  5AUK A;  1WMH A;  3W2D A;  4P1C C;  1P0R A;  1OEY A;  1SJE D;  1ROE A;  1BXT A;  5AEK B;  4P6V F;  4KGT A;  4DHJ B;  3DHI C;  2DNF A;  4RGM A;  4AJW A;  4TSS A;  4DDG D;  2DLB A;  3AU5 A;  4MGI E;  2YVC A;  3NZU A;  3BII D;  2BKF A;  1UZX B;  1ZPS A;  2GBM A;  4S0R A;  5CHW A;  3ZXR A;  4H2A A;  4J6I A;  2K3U A;  2GLS A;  3ZXV A;  1MG4 A;  2BF8 B;  1KLG D;  2AEH A;  2DWQ A;  4RGO S;  4ZRJ A;  3RNE C;  3AE6 B;  2C60 A;  3DQV A;  4HEA 1;  1LGR A;  1N62 A;  3Q6B A;  2I38 A;  3NG0 A;  2MBB B;  2M17 A;  4KSL C;  4W9J A;  2JF5 A;  3AM9 A;  2CHW A;  3EUB 2;  2X8X X;  3IG3 A;  3JYU A;  1FXA A;  4DDI D;  3W1S A;  1V97 A;  4A20 A;  4KV2 A;  1WR1 A;  3UIN B;  1WF9 A;  3NZ3 A;  1YX6 B;  5H8Y E;  4ANU A;  1L0V B;  4N9F 4;  4LNO A;  1E8W A;  4RMA A;  1IPG A;  2FIF A;  1P9D U;  3B2G A;  1V5O A;  1JW9 D;  2Y3A A;  3UQB A;  2PLP A;  1CZP A;  2N7E A;  4AQ7 A;  4BKS A;  2DAJ A;  3DPD A;  3NVV A;  1V6E A;  3MJW A;  2Y5C A;  2JT4 B;  3ENE A;  3EEC A;  2N0S B;  4GSW A;  1RLF A;  3TEY A;  2LGS A;  1VCB A;  1WGG A;  3BK2 A;  1UNS A;  1J7B A;  3GOE A;  4LTU A;  2WQY B;  2ZEQ A;  3S2A A;  3AE2 B;  2WDV B;  1ZDX A;  3VH4 B;  2NPT A;  5C23 A;  4HJG E;  4HRO A;  2FNJ B;  1WGH A;  3TBL D;  3U4E G;  1E7V A;  3FAH A;  1Z5S B;  1TKE A;  2H88 B;  3Q3N C;  4W9F A;  4PS3 A;  1C3T A;  2IY0 B;  2KZR A;  4BVU C;  1C4A A;  2C7N B;  1EF5 A;  2PPH A;  4KKI A;  4PYU A;  1JCK B;  3BVZ A;  3V60 A;  1IP9 A;  1WYW B;  1C79 A;  4HJK A;  2L0T A;  2MJD A;  3AMZ A;  2NCN A;  2OHF A;  3MJ5 A;  1GAQ B;  2LRU A;  2QMT A;  4OZC A;  4HCP B;  2K0P A;  2PE6 B;  2LVP A;  3OG5 A;  2KO3 A;  3TEZ A;  3Q3M C;  1EU3 A;  1HTQ A;  3MHS D;  2LUM A;  2FBW B;  2M0A A;  1H4R A;  2REX A;  2WP9 B;  5BMH A;  3AU4 A;  3ZTC A;  3N1Z C;  2GOW A;  1WGY A;  1FFU A;  2WS3 B;  1NDD A;  4GXB A;  2L7R A;  2L32 A;  4TV3 A;  2AQ3 B;  3SR6 A;  2RDG A;  1QKZ A;  3PZ8 A;  1C78 A;  2DYM A;  2KJH B;  2WDR B;  4HDO A;  1H8C A;  3ZW3 A;  1R7S A;  3P4S B;  2LEK A;  1RRB A;  5J17 A;  5HG2 A;  4M02 A;  2ZW1 A;  2BBC A;  1JWB D;  5BO4 B;  2KNB A;  2ICI A;  2KQS A;  1STE A;  1NI2 A;  3EA6 A;  2JRH A;  4K7W A;  4ICV A;  1TIF A;  3VRB B;  4ACF A;  1BUI C;  1YIW A;  3RNG C;  4C7Z A;  1SE3 A;  1SXT A;  3R2I A;  4B0E A;  4BKG A;  4KDL B;  4K81 A;  4GDK B;  1R4N B;  4GU2 A;  2M19 A;  3PVL A;  2KFJ A;  4G3X B;  5IAA C;  4AS1 A;  2V4I B;  4TMA B;  4XWT A;  1HZ6 A;  4ARI A;  2JQR B;  3RN9 C;  1LM8 B;  3RUL A;  2KN5 A;  3E56 A;  4RF1 A;  3VR9 B;  1VRA B;  2IO3 B;  2NTS A;  1YQ4 B;  2V0G A;  1EU4 A;  3Q2A C;  2GBR A;  1EWY C;  3SFD B;  1K53 A;  2K25 A;  3EC8 A;  3X0W A;  2ZVN A;  3TMP B;  2GBK A;  3P4P B;  1V1P B;  4IUM B;  1XXG A;  1SE2 A;  1WXQ A;  1DOY A;  1FNU A;  2HTH A;  3E9S A;  3P1M A;  3ZYY X;  1OEY J;  1TYG B;  1YJJ A;  2LZ6 A;  1ZP0 B;  4N58 A;  1PFD A;  5BMI A;  5CHV C;  2NR2 A;  4L23 A;  3P2B A;  3Q3J A;  4G50 A;  3LYY A;  3T3N A;  1OFF A;  2UU7 A;  2MQJ A;  3PHW B;  1WSP A;  3TEX A;  2BGF A;  4DHJ D;  3AV8 A;  1S3S G;  2G45 B;  3OAW A;  1PGX A;  4DHZ E;  4GDK A;  2IDY A;  2KDE B;  4LJO B;  2L8J A;  1KLU D;  2LRW A;  2PIA A;  1CK1 A;  1HXY D;  1XLN A;  3W9C B;  2DYB A;  4BKS D;  1UF0 A;  2KD0 A;  3N3K B;  1RFK A;  2E6X A;  4IWQ A;  3WCQ A;  4USA A;  4XE0 A;  3RPF C;  3W1Y A;  4HPL B;  5FK9 C;  4LJP B;  3VR8 B;  1V1P A;  4HVB A;  4ANX A;  2BYE A;  4JQW C;  2V9H A;  1Q10 A;  5E6J A;  2ONQ A;  2MEK A;  5G5H A;  2XBB C;  2XNA C;  2KTF A;  4YSZ B;  2KAN A;  3KW5 B;  3Q3O C;  4M00 A;  3PZD A;  1A5R A;  1VDV A;  3V6E B;  2KXJ A;  3QIJ A;  1WY8 A;  2GB1 A;  4EZL A;  4J3O D;  2J0J A;  3AEG B;  1FRD A;  4A6Q A;  2E3T A;  3HHM A;  2JXT A;  1N63 A;  3VH3 B;  1D4B A;  2HTM E;  4LNK A;  1WM2 A;  1BT0 A;  2YLM A;  4A9A A;  4WIP A;  1E8Z A;  4HCN B;  3L54 A;  1YJ1 A;  1A70 A;  5J18 A;  1JWU D;  4GIV A;  3I9V 1;  3M3J A;  1E6E B;  1MVK A;  1T0R C;  4JPS A;  2BS2 B;  4ZRK A;  1L4Z B;  4NY0 A;  4KZC A;  1IBX B;  5EDS A;  4GLS C;  1KFY B;  2W9N A;  3O65 B;  5KHQ A;  2LD9 A;  4WJN A;  1MG8 A;  1XO3 A;  3I3T B;  1HZ5 A;  4WJO A;  3QQ8 B;  2C5L C;  4LNF A;  3WA0 A;  4C00 A;  5CX3 A;  2N9E B;  2CJO A;  1E8Y A;  2RPV A;  3L16 A;  3DVN U;  2K9X A;  2ASQ A;  2PEA A;  4FUL A;  4MJS B;  1Y8R C;  3A1Q A;  3H1U A;  1E9M A;  1HQR D;  2DX5 B;  4W9K A;  4W9G A;  2KJ6 A;  1KRH A;  3U7D A;  3DOW A;  2QSD A;  1S1Q B;  5D3D A;  4JX1 C;  1YN3 A;  3RFZ B;  3QA8 A;  4WQM A;  1VD2 A;  1L7Y A;  2EEL A;  3DHG C;  3PRM B;  1L0Y B;  3DVG X;  1HTO A;  2WXQ A;  2L05 A;  2JU6 X;  3W1S C;  1WH3 A;  2D3A A;  4GB9 A;  1HE8 A;  4FXC A;  2Y5B B;  2QCZ A;  1YJI A;  1TJE A;  1WYG A;  3APD A;  1LFD A;  1QIL A;  3GZN I;  1UWM A;  5TSS A;  1E5W A;  1IBX A;  1GPX A;  2H89 B;  1IGC A;  5E6N A;  3AUL A;  2YEP B;  5G5G A;  2WXJ A;  3AEA B;  2MJ3 A;  2LGD A;  1L0X B;  2VZK B;  2N9K A;  1Q1O A;  2J42 A;  2K8C A;  1GC6 A;  4DXA B;  2CS4 A;  1L2N A;  3NHE B;  1UGM A;  3L17 A;  3VTU A;  1TZ1 A;  4ZRI A;  1J0G A;  3CMM B;  1IYF A;  2GBJ A;  2DHZ A;  2WXM A;  3MHZ A;  2CHX A;  3HM6 X;  1RYJ A;  3VRA B;  1V49 A;  3ZNZ B;  4YSY B;  1YQB A;  1LXD A;  4LDT B;  2N9X A;  3H8H A;  4ZDV A;  3I5J C;  1QOF A;  2BPS A;  3QK0 A;  2Y5P A;  3ALB A;  3FC4 A;  3V3X A;  2B3A A;  4HDQ A;  3ZDM C;  4GGQ A;  4US8 A;  4NQL B;  1N5W A;  2PE9 A;  2WXI A;  2JWU A;  4ZRP A;  1TS5 A;  3HM3 A;  1B9R A;  3ML8 A;  1TS2 A;  1U4A A;  3QWZ B;  3IT6 B;  4IM3 A;  2WDT B;  2LUE A;  1M94 A;  4IW0 A;  1UWX A;  2ZZP B;  4KGR A;  2WX0 A;  1NI3 A;  2QJL A;  1XLP A;  3PTF C;  3DDC B;  1WIA A;  1F2R C;  2QC8 A; 
#chains in the Genus database with same CATH homology
 1MFW A;  5IKC M;  5IP4 D;  1UF0 A;  5IN7 A;  5IOI A;  2DNF A;  2BQQ A;  1MJD A;  5IO9 A;  1MG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...