5IOIA

X-ray structure of the n-terminal domain of human doublecortin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
b'LVPRGSHMAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFDDVEYTKNVNPNWSVNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neuronal migration protein doublecortin
publication title Crystal Structures of the Human Doublecortin C- and N-terminal Domains in Complex with Specific Antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 25
structure length 107
sequence length 107
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 5ioiA00
1UF0A 5IO9A 5IP4D 5IKCM 5IN7A 1MG4A 1MFWA 2DNFA 2BQQA 5IOIA 1MJDA
chains in the Genus database with same CATH superfamily
2RR9A 1V81A 2W54A 1FXIA 3APDA 4W9KA 2KTFA 5HHDG 2E6XA 3VXWA 1TT5B 1IP9A 1OFFA 3QHTA 4AWJA 2MP2A 4RGMA 1EF1A 4RNAA 3H7SA 4E74A 2ZZPB 1MVKA 2WXLA 1FCLA 4KX6B 3KVFB 3P4SB 2K25A 2KFJA 4ZHPA 1T5XD 2Z59B 4EZKA 2GBKA 4ZHOA 3R2TA 2PLPA 4G50A 4ANVA 2RSUA 2XK5A 2WXMA 3PVLA 1C4CA 2C7NB 4LNIA 4TV3A 3V6CB 1LM8B 4DWFA 3D32A 1WR6E 1QZEA 2PVOD 1F2RC 1UUPA 3QCAA 3VRBB 4US9A 2DHZA 3GE3C 1LXDA 2PJHA 3ZW3A 2EKEC 3M62B 2MWSB 1E6EB 3O13A 2OJRA 1VZ6A 5HKHA 3ZLZA 1WE6A 3NG0A 2WDVB 2RDHA 2NBUA 4DBGA 2N7JA 4OZAA 1SE4A 4WURA 3DHIC 3NZSA 3RNEC 3RUIB 4XDCA 1GC7A 2MP2B 4ZYNA 3L4PA 1Q10A 1T0YA 1DGJA 1WJUA 2ZJDA 4NJCA 4WJOA 4O1NA 2WS3B 2WXNA 4ZYSA 2BYEA 1WGHA 3T9LA 2XK5B 2D11A 3AE8B 2WX0A 1HQRD 3HM6X 3AB5A 3J9CA 3AE9B 3L16A 5G5HA 4PYUA 3WAPA 2YLMA 1FXTB 4MT5A 4GB9A 1E8ZA 2GBMA 1KRHA 2L7RA 3TIXA 2BKRB 2REXA 1KM7A 2KLGA 1QQRA 3JSVA 1BT0A 1CJEA 1SBBB 1T6BX 3QA8A 2W3RA 2JVCA 4PYZA 2WXPA 4LJOB 4K7UA 2V3PA 1I4PA 3P1MA 3H7PA 5LXIB 2MQJA 1LGRA 3L13A 5AUKA 3PSEB 4REZA 1GB1A 1RFAA 1WI0A 1WX7A 2N9EB 4GMVA 3B0AA 1JQ4A 3N30A 2ZNVC 1N62A 3EA6A 2Y3AA 2ZVNA 3DVGY 2WP9B 2MA9B 3A4SC 3B08A 4N9F4 2LEKA 2MRPA 2BYTA 3V60A 1EUVB 3PRMB 5IO9A 2V9HA 2WDTB 1Z2MA 4BKSD 3AV8A 3N9YC 2ZPNA 4KZCA 1MPEA 2KAJA 4F7ZA 1CMXB 5H92C 1SE3A 3Q8AA 3L0WB 2KJRA 3U30A 2FAZA 1DOXA 2RMMA 2Y5CA 4US8A 2J0JA 3FC4A 4G3XB 3GOEA 4NQKE 3AEGB 5HFYA 2LUEA 3H7PB 4WWNA 4DXAB 1UZXB 1YJIA 2Y5PA 1VZ7A 1L0YB 2KN5A 2KT7A 3KUCB 1E8YA 2O6VD 2KMAA 2K1FA 4EEWA 2GBRA 4HROA 4AJYB 4XGAB 2INPE 3ZYYX 1TGZB 1ET9A 4XWTA 3Q3FA 1PUTA 3EC8A 4IKGA 4GOCA 4CO7A 2XBBC 4G11A 1WXVA 3A9KA 4RFBA 2KLCA 5G55A 4FADA 4ARCA 2K6DB 2WYQA 1EWYC 3C19A 2D3AA 4W9DA 2WXQA 1ZKHA 1WF9A 3RZWC 2NPTA 4TUUA 1KH0A 1ENFA 2R2OA 5LXHA 4RGNA 4MELA 3BVMA 3V6EB 3EFUA 3KLSX 2JYEA 3IAM1 1U4AA 1MHHE 4HEA1 2IGDA 2W9NA 4AOFA 2K6QA 2G9HD 5J18A 3KH0A 1P1AA 3QIJA 3N1ZC 3TUOA 2L1AA 4EFOA 4IC7B 4NAMA 2NMQA 4MGKE 2ONQA 4H2AA 3AXCA 4FHKA 1RYJA 1OEYA 1Q0WB 4A6QA 3CF6E 2IJ0A 2RPQA 3OJ3A 1H8CA 2DX5B 3HUIA 3MHSD 1GAQB 3A9KB 5E6PA 3VR9B 1E7VA 4BKSA 1XLPA 1C4PA 2IY0B 5MPOA 2JRHA 1E90A 2HDEA 2JWUA 1STEA 1UF0A 2ZW1A 1ZE3D 3DOWA 2MBHA 3ZRCA 2V1YA 4CHKA 1IYFA 5LNK1 1CK1A 4MGIE 3RULA 2LZ6A 3NHEB 1V5OA 5AZGA 3ETRA 2QHOA 4BOZB 4EZJA 3CIRB 4URKA 4XYCA 4JGHB 2JZ3B 4YSXB 3DVNU 5BO4B 3IAS1 4N6EB 3TEWA 4AP4C 1YQ4B 4AUQC 2O6VA 1FO4A 2HTME 1UBQA 1V49A 1KOTA 1N63A 1KLUD 3ENEA 2QMTA 4PK1A 3EFCA 4HKQA 2INCC 1ZW7A 3P4QB 1V8CA 5DPRA 3V3XA 2K39A 3IVFA 1HXYD 4KKJA 2IZVB 2LGSA 4FN2A 4X57B 1PQSA 2LFIA 1I7HA 3A9JA 4ZRIA 4K3BA 4ACFA 3GZNB 1E10A 2J53A 2DBYA 1LFDA 2B3AA 2AQ3B 1JWUD 2LJ5A 2QJLA 4NNJB 2WHIA 1L5PA 2LHEA 2KDIA 3PRZA 2LGYA 3PGEA 3QJZA 2CU3A 3UIPB 4II3B 1RWSA 2JPHA 3H6NA 2KDFB 2BWES 2KYWA 2LD9A 4NZLB 2FUHB 3EHVA 1MHXA 4KZ0A 2AX5A 4DHJB 3RMKC 2DZIA 3AEAB 2FCNA 1FEHA 4NAWA 4NQLB 1A5RA 5D7GA 2O6VB 4FLHA 3FAHA 1YN4A 4JE3B 1EF5A 4ZRPA 2WXJA 1E7PB 4HWIB 5JHAA 3P63A 2CR5A 4HPLB 3ZJTA 2NS5A 4BBNF 2KQ7A 4TKNA 4JLCA 1WH3A 3Q14C 2KFKA 3NVWA 3SU8X 3NY5A 1NYRA 1SE9A 3KWVA 1N60A 3APFA 3RT3B 3L10B 1TIFA 5D3IB 4WAAA 4HDQA 4BAXA 3H8HA 1QT9A 1T0SC 1L6UA 2D10A 4R3DA 1QLBB 5J2RA 2OOBB 4W9EA 1TYGB 4M02A 2BB6A 3ZJVA 4TQ0A 4EE2A 2I38A 3KUDB 2ZCBA 3VH3B 3T8MA 3DWGC 4NAWB 2K9XA 5HI1A 1L4ZB 3L17A 2NR2A 2J52A 4K81A 4C00A 3ZUNA 5KHQA 5GMVA 2BWFA 2QEJC 3NVZA 1F52A 1MG8A 2LVPA 1A70A 3LXFA 5CHFA 3SHQA 2VH1A 4IOIE 4IM3A 3RNBC 1YX6B 3ZGZA 1WYGA 2KWVB 3JVZX 1HZ5A 2NBVB 2A5UA 5D2MB 4YTNB 1MI0A 4IDIA 1RRBA 1S3SG 2QC8A 1JWSD 3DVNV 2IPKD 5IOIA 3VTVA 3PT2B 4HJKA 1GJZA 1E9MA 1FPYA 4II2B 4L1BA 3GZNI 2WNMA 4PS7A 1GB4A 3Q8BA 1JWMD 4K3CA 3TSSA 4NJ6A 4MH8A 5CX3A 2FIDA 1ZGUB 2INDC 5C23A 2WWZA 3BYTB 1JWAD 1UH6A 4HKZE 2JT4B 2I2YA 1FMAD 1B1ZA 4IWQA 2J0KA 2KC1A 4WH4A 5EE1A 2KX0A 2JU6X 4RF1A 2LVOA 4WJQA 2D07B 2KOXA 4XC2A 1GNUA 2VH2A 3HM3A 1F2RI 2DWQA 1WM3A 4HRSA 1M94A 3WAMA 2CKHB 2RGFA 4I6NB 3VQIA 2N1WA 1XCQL 1K53A 4XDDA 2IO1B 3BY4B 4OVZA 4FJYA 4KIKA 5IKCM 3DDCB 4IUMB 1XO3A 2N9KA 5KHOA 1ROEA 1J7CA 1PGXA 2V4IB 1D5XC 2EMTA 2WQYB 1XQQA 2KVRA 1VDVA 4NPNA 4W9HA 2DZKA 5TSSA 2BTEA 4EOYA 5L95C 2PEAA 1WJ4A 3U8ZA 5D6JB 4OHJA 3V05A 4RM9A 3IXSA 2MJDA 4BOSC 4JQWC 4E3CA 4K7WA 4JWUC 2JSVX 3L08A 1E0ZA 2MBQA 2N4FA 1QOAA 1LO5D 1UELA 2JXTA 3ZDTA 2PIAA 3SD5A 2WGSA 5FR3A 3AE3B 3BZDB 4ICVA 4RM8A 1XF5L 2M17A 4BZAA 1E8XA 1IPGA 4C4VA 3DCGA 3GS2A 3OLMD 5G5GA 2L8JA 3VVWB 3R3MA 3UIOB 4A90A 1MJDA 3W1SC 1DYQA 1WXMA 4KIKB 4PS8A 3X23A 1V2YA 2VRRB 3Q3JA 1WIAA 1UD7A 3AI5A 3RFZB 2CS4A 4LTUA 2IO2B 3T3OA 1JRUA 1V80A 3PRPB 1FCCC 2HTHA 3AEFB 5DPSA 2MEKA 1FFVA 2CHZA 5BYRA 3HHMA 4GXBA 3MJWA 1EM7A 1L0XB 2SAKA 4BFRA 2NTSA 4HPMB 1WGYA 4KSLC 1I4XA 2KNBA 2DYOA 2BS2B 4M0WA 3CSTA 2A4ZA 3OJ4B 1IGDA 1YJ1A 3C0RB 3QWZB 3BIID 3U7DA 4RGOS 2H88B 2C7MB 1SJED 2L3ZA 4KKIA 2LUMA 4C4VB 1UGMA 1XEEA 3RD2A 3OWEB 2X8XX 3RN9C 3PREA 4L23A 1YJJA 3TJPA 3ZQ4A 1TS4A 4S0RA 4N59A 1I42A 4B0EA 1QILA 3EUB2 3ALBA 3JSVB 1D5MC 3TL5A 4Q2JA 2HD5B 2ZVOA 3JYUA 4ZDVA 1JROA 3CWIA 2K3UA 3P4PB 3GP7A 4KV2A 1OEYJ 1DOIA 5FK9C 5AZFA 4DDGD 1M4VA 3A1QA 3DPDA 4ZOHC 2HJ1A 1OQRA 2N9PC 1TS5A 1IBXA 1N61A 1SSNA 4LNFA 2DAJA 2KACA 2W3SA 2FNJB 2L52A 2DENB 3ZTCA 5JH5C 2BS4B 5BMGA 2CJOA 2O2VA 5FR6A 1ZXHA 4HCPB 4M0WB 4ITKA 3FILA 1YNTE 4GGQA 2CU1A 3AE2B 3PTFC 3Q3OC 2XEWA 1T0RC 3QX1A 1V1OA 2N1VA 4A20A 2WU5B 3VH4B 1DOYA 3TMPB 4OZBA 4XZ4A 4FJVB 1ZPSA 3ZNID 3Q8CA 2M4NA 1JALA 2BBCA 4BKGA 2MH7A 2KN4A 2KANA 4M8MA 3N32A 4USAA 1YN5A 1TY2A 2C7HA 3N1YC 4F8CB 3VDZA 1KLVA 1SXTA 1E7UA 3AMZA 3RI7C 1NI2A 4S17A 5H8YE 4DK5A 3WALA 1CQVA 3VR8B 1YOVB 5GXGB 4G0NB 4YSYB 1X1MA 1WZ0A 4DXGA 1TTNA 2LXAA 2KJHB 4OVVA 3T3NA 1IBXB 3TEZA 4LLGM 4C80A 2OEDA 1WWTA 2IO3B 1D3ZA 2LI5A 4KDLB 3N1XC 5DPWA 2KJ6A 3DHGC 1J19A 2M1MA 2YEPF 2O2VB 3FILB 3V62A 3ZNHB 2BKFA 2L0TA 2Y5BB 4ANUA 2V3SA 3H9DA 2V3NA 2CJNA 1WE7A 3DBHB 5T8IA 1VJKA 4HK2A 3BK2A 1UWXA 2CHXA 2NPTB 1ZDXA 3KYCD 3PV1A 2EMSA 4DHZB 3GB1A 1RAXA 1EWCA 2X38A 3P4RB 4OW0A 2KWUB 4XE0A 3AE4B 2PKOA 3WCQA 1GUAB 3AULA 4B0MA 2PVGC 2ZEQA 3URYA 2LGDA 4TQ1A 1P7FA 3W5VB 3WANA 4A8XC 2YVCA 2Z8LA 3BVGA 3VAWA 1D4BA 1GC6A 1TKGA 1I35A 4RH6A 1F77A 4JL9A 3M3JA 2D5GA 3M95A 1C78A 1QOBA 1WJ6A 2C9WB 2KWDA 4W9FA 1V6EA 4ARIA 2ON8A 1WFYA 3IT4B 3W1YA 1Z5SB 3AEEB 1RLFA 3ZNZB 4CYEA 2D3CA 4MH0E 2LMCA 1I4HA 1B9RA 2BVCA 1R7SA 2NTTA 2IGGA 2Z0DB 4DHZE 1ZXIA 2FCSA 3SFEB 4F1SA 4LNOA 1K52A 1WZ3A 1R4MB 1F9JA 4M00A 4MSMB 3TEYA 5D3DA 4IW0A 1NI3A 3HK0A 4W9LA 4A9AA 3HRDD 3ZTDA 1YN3A 5AUIA 4GDKA 5EE0A 3UINB 2RDBC 4GLSC 3U2SC 3I3TB 3WA0A 1J7AA 3HVDA 3W1SA 1E8WA 1NDDA 3Q6BA 2R61A 5EE9A 3ZO5B 2BQQA 3RNGC 2M0AA 5TR5A 1FD6A 4K1RB 3KW5B 3VTUA 4WJPA 2KMMA 4YTMB 2BPSA 3VFKA 2B76B 1GG3A 3LJ3A 3A9JB 1I4QA 3VHTC 1OQQA 1FNVA 2PPHA 2MW5A 2BYVE 3ECIA 3MHZA 2K8HA 2INNE 1J8CA 4M01A 3PS6A 1G6JA 1WX8A 4BVUC 1PFDA 3DBHI 4YL8A 5IA7A 3S2AA 1BMLC 3SR6A 3UI3A 2M0XA 4A55A 4AJWA 2H89B 2DZJA 1P98A 1V97A 2LWPA 1XLOA 4C56C 4ICUA 4D2KA 1J7BA 1FNUA 3U4EG 3RNAC 2PE9A 1HZ6A 1WGDA 2M19A 1ZUD2 2GLSA 1ISNA 4HXDA 3HVZA 1L6VA 2OHFA 4A3OA 3I5JC 4ASWC 1XLQA 3B2GA 4HCNB 2L83A 1ACCA 1UBIA 2BT6A 3VUWA 4FA6A 1H4RA 1L4DB 3SDLC 3I9V1 4KDIC 1SJHD 2KFKB 2KDBA 4YWGG 1AN8A 4TMAB 1GOZA 1NEKB 1WXSA 4HDOA 3AEDB 2PE6B 4I6LB 2WXOA 3TCAA 3IBEA 1I4RA 5IN7A 4MACA 1JW9D 3ABVB 2KTRA 2ZNVB 2KO3A 3JW0X 2DYBA 3DBLI 1AW7A 3R2IA 2AYOB 1R4NB 2WDRB 3I63C 3Q8FA 1IGCA 4WQOB 4IWOA 1YMHE 3OG5A 1P3QU 3SFDB 2CHWA 3X0WA 2M8SA 1FNWA 2W55A 3UQAA 4ZRKA 1OQYA 3VRAB 3EGRA 2RDGA 3TEXA 3ZJUA 3RZFA 2ZCCA 1UWMA 1R4MI 2E3TA 1SEBD 2DZMA 1TKYA 3CMMB 2LRWA 2JWZA 2XN9C 3AEBB 2MHJA 2IYDB 4KVGB 4MGYE 3AM9A 1Q5WB 3MP9A 3PO0A 3U7ZA 3M63B 4JX1C 1XD3B 2UU7A 1KLGD 1V86A 2VZKD 1ZOYB 1VRAB 4WJNA 4EKUA 1WXAA 4K7SA 1TS3A 3DBSA 3PLVA 3W5UB 2RD0A 3P2BA 2KTRB 1E5WA 1PGAA 5BYQA 1GPXA 4B6WA 2YEPB 3I57A 2V4LA 2N9LA 1AYFA 5I4DA 1UNSA 3AN1A 5DCNA 3WIMA 1JCKB 2G4SA 2UYZB 2R2QA 2LXCA 3Q3NC 3AU4A 2LHDA 3O65B 3ZNGC 1Y56A 4N58A 2C60A 3ZXVA 2GBJA 2C5LC 2V0GA 2MCNB 3PHXB 1FXAA 1P0RA 4IM2A 1ZDVA 3AE5B 4HJGE 3ZVVA 2FCQA 1V5TA 1D6EC 3OAWA 3B9JA 4DQOC 1C1YB 1N5WA 5FKAC 3A33B 3U52E 1JMLA 2J42A 3UGBB 3PZ7A 1PGBA 3Q2AC 5C1ZA 2NBWB 3NS8A 2DLBA 1AARA 4ANWA 1JRPA 2BB5A 1FRDA 3ZKJC 5JHBA 3VUXA 4FULA 5LLIA 5BMHA 3AE7B 2FIFA 2WXIA 2N9XA 2JZZA 3K9OB 1HA5A 3PZDA 4J6IA 1WXQA 2N7DA 3UQBA 4RMAA 2N7EA 2GI9A 1R4NI 1KTKA 4MM3A 2JZPA 2LASA 1HTQA 4WWMA 4E71A 2PMVA 4TSSA 1UGJA 3C8YA 4W9JA 4LK0M 2FUG1 3AH7A 1TZOA 1EU4A 4OZCA 2PTLA 4P1BC 4WWOA 2QIEB 4IWPA 2JUOA 1WRDB 3BINA 3R7QA 5G2NA 4ZRQA 2BYFA 2IBIB 2HE7A 2D3GA 3MC9A 5L83A 3EECA 4GIVA 4HVBA 3DBRB 1YIWA 1Y8RC 1N6ZA 3ML8A 2BF8B 3P42A 2MJ3A 1NVID 2GOWA 2D2QA 3BWUD 3H1UA 1SF0A 1WSPA 1KJTA 2K22A 2LVQA 3A4RA 3PLUA 2KX3A 2L76A 3DWMA 3NVYA 5EE3A 3FKYA 4KGTA 3NVVA 1VR9A 2D3BA 4L2YA 1N5XA 3UF8A 1FIQA 4EZLA 3VUYA 2AQ2B 4MM3B 4RF0A 1WX9A 2XNAC 2DYMA 1P7EA 1PDXA 4DHJD 2G3QB 2BS3B 4LDTD 3R8BA 2K0PA 3RYTA 5C3JB 2K5PA 3E56A 2JF5A 3PPAA 1FRRA 1C79A 3AU5A 4P1CC 2NVUI 2Z0EB 3IFWB 1WM2A 1WJNA 5HG2A 1HE8A 1FM0D 1C9FA 5C2TB 4W9GA 2ASQA 2IGHA 1TJEA 2VZKB 3MJ5A 2WXRA 2RPVA 1WYWB 3LYYA 3DQVA 2GB1A 4KSKC 4GU2A 3NS1A 1MG4A 1XXGA 2DAFA 4UDUC 3RCZA 1WMHA 2WU2B 1YQBA 2FBWB 5IP4D 3V61A 2AQ1B 3KQ4A 3SEBA 1C76A 5E6OA 2HJ8A 1K8RB 2MBBB 1F1HA 2I1JA 3ZRFA 1TBEA 3R7RA 4RCOA 3AE1B 2WXFA 3A1QB 4IM0A 1L2NA 3NZUA 3Q8EA 3ML9A 1VD2A 3AE6B 1ET6A 5JZEB 4M8NA 4WQMA 2L05A 1FFUA 4YTPB 5E6NA 2J0MA 1NYQA 3KUZA 1L7YA 1EO6A 4W9CA 4WIPA 2M56B 1OTRB 2MSED 3NRZA 4HPPA 3LDZE 5CHVC 2ZW0A 4GN1A 4C7YA 3N3KB 5EDSA 1BUIC 1NBFC 2OJWA 5J17A 3B2FA 3W9CB 4RGTA 2G4DB 2GMIC 5BMIA 1SE2A 3KYDD 2WDQB 5E6JA 4P7IA 3LB8C 5JXVA 2BW2A 1YX5B 2IO0B 4FJZA 4FBJB 4ZRJA 1WGKA 1RM6C 2KHWB 4C7ZA 3VTWA 2ICIA 2WLBA 2WXHA 4B95A 3Q3MC 2MBEA 1QOFA 1K50A 1C3TA 2NCNA 1WMHB 3K9PB 3DBRI 1VLBA 3QK0A 1IUEA 3CSFA 1T3QA 1C77A 4KGSA 1L0VB 3TBLD 1WR1A 1BXTA 4PS3A 4LNNA 4P16A 5CTRC 2KK8A 2MJEA 1NENB 2J7QB 1QOGA 2MX2A 2GBNA 1RFKA 2L32A 2J4XA 1SB3C 2JQRB 1P9DU 1TY0A 3Q69A 4MJSA 2KC2A 4HLEA 2LGIA 4FXCA 3RPFC 4JPSA 3ZXRA 4YXDB 4EUTA 2ACZB 2JRIB 2L00B 3WAOA 4CQNA 3ONSA 3MC8A 2GRIA 1VZ8A 2KKCA 4DDID 3DBLB 1F0ZA 2LRUA 3BK1A 2QSDA 4P6VF 4QAYA 3QARA 4YSZB 5DPTA 4BBNC 1I4GA 2JXXA 2BGFA 2LJIA 1TKEA 1S1QB 2FE8A 2UWQA 5IAAC 3R66C 4BKTA 2G45B 2WXKA 1LQBA 1XLNA 2AL6A 1XT9B 1SIJA 1K51A 2G1EA 2KVZA 4YT0B 2K8BA 1KF6B 4AQ7A 2KD0A 3QAQA 2QDFA 1C4AA 4J3OD 4W9IA 1VCBA 2QCZA 4FHJA 1MFWA 4PT5A 3AECB 3NOBA 1TS2A 3HIZA 2KQ4X 4MJSB 2FCMA 4IG7B 2IY1B 1Q1OA 1SIFA 2W82A 1EU3A 2KDEB 3NZ3A 2DNFA 2LGXA 1V9JA 2PW9A 2K8CA 4LDTB 1OGWA 3APCA 2L0FA 1AWDA 3B1LX 3E9SA 2KXJA 4GDLA 4OVUA 1KFYB 1WY8A 3RNCC 1V1PA 3NJTA 3PHWB 4XWWA 4XX5A 3W2DA 4MEMA 2QILA 1HEZE 3RNFC 2Q5WD 1YD8U 4LJPB 4LNKA 2AEHA 2MLBA 3QC8B 3MFGA 2KDMA 5CHWA 3NUHB 4JWSC 2WXGA 2JYTA 1CZPA 2JY6A 1QKZA 4B9KA 1ZP0B 4JIOU 4GDKB 1T0QC 2EELA 5BYSA 4GSWA 3PZ8A 3DVGX 2TSSA 4NY0A 1YQ3B 3GE8C 4ANXA 1HTOA 4KGRA 2IDYA 4MGZE 3ZDMC 2ZPYA 3BVZA 2SEBD 3DHHC 1TZ1A 3IG3A 4LCDE 1ESFA 1WGGA 3ZIMA 3IHPC 4I6PA 2JX5A 4WAFA 3MC0B 4MDKE 1WGRA 5AEKB 2MBOA 2KZRA 2KWCA 3IT6B 2KQSA 4GDLB 2AL3A 1PYWD 5D94A 3QQ8B 2KMCA 1QF6A 1V1PB 2I1KA 1J0GA 2EKIA 4AS1A 1WRIA 3KWLA 3MTNB 3L54A 5AZHA 4NJ7A 2WX1A 1XCTL 1JWBD 3BYYB 4DXFA 1D5ZC 3N20C 4WWPA 4A3PA 2N0SB 1SGHA 4MSQB 2AWTA
chains in the Genus database with same CATH topology
1UF0A 5IO9A 5IP4D 5IKCM 5IN7A 1MG4A 1MFWA 2DNFA 2BQQA 5IOIA 1MJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UF0 A;  5IO9 A;  5IP4 D;  5IKC M;  5IN7 A;  1MG4 A;  1MFW A;  2DNF A;  2BQQ A;  5IOI A;  1MJD A; 
#chains in the Genus database with same CATH topology
 2RR9 A;  1V81 A;  2W54 A;  1FXI A;  3APD A;  4W9K A;  2KTF A;  5HHD G;  2E6X A;  3VXW A;  1TT5 B;  1IP9 A;  1OFF A;  3QHT A;  4AWJ A;  2MP2 A;  4RGM A;  1EF1 A;  4RNA A;  3H7S A;  4E74 A;  2ZZP B;  1MVK A;  2WXL A;  1FCL A;  4KX6 B;  3KVF B;  3P4S B;  2K25 A;  2KFJ A;  4ZHP A;  1T5X D;  2Z59 B;  4EZK A;  2GBK A;  4ZHO A;  3R2T A;  2PLP A;  4G50 A;  4ANV A;  2RSU A;  2XK5 A;  2WXM A;  3PVL A;  1C4C A;  2C7N B;  4LNI A;  4TV3 A;  3V6C B;  1LM8 B;  4DWF A;  3D32 A;  1WR6 E;  1QZE A;  2PVO D;  1F2R C;  1UUP A;  3QCA A;  3VRB B;  4US9 A;  2DHZ A;  3GE3 C;  1LXD A;  2PJH A;  3ZW3 A;  2EKE C;  3M62 B;  2MWS B;  1E6E B;  3O13 A;  2OJR A;  1VZ6 A;  5HKH A;  3ZLZ A;  1WE6 A;  3NG0 A;  2WDV B;  2RDH A;  2NBU A;  4DBG A;  2N7J A;  4OZA A;  1SE4 A;  4WUR A;  3DHI C;  3NZS A;  3RNE C;  3RUI B;  4XDC A;  1GC7 A;  2MP2 B;  4ZYN A;  3L4P A;  1Q10 A;  1T0Y A;  1DGJ A;  1WJU A;  2ZJD A;  4NJC A;  4WJO A;  4O1N A;  2WS3 B;  2WXN A;  4ZYS A;  2BYE A;  1WGH A;  3T9L A;  2XK5 B;  2D11 A;  3AE8 B;  2WX0 A;  1HQR D;  3HM6 X;  3AB5 A;  3J9C A;  3AE9 B;  3L16 A;  5G5H A;  4PYU A;  3WAP A;  2YLM A;  1FXT B;  4MT5 A;  4GB9 A;  1E8Z A;  2GBM A;  1KRH A;  2L7R A;  3TIX A;  2BKR B;  2REX A;  1KM7 A;  2KLG A;  1QQR A;  3JSV A;  1BT0 A;  1CJE A;  1SBB B;  1T6B X;  3QA8 A;  2W3R A;  2JVC A;  4PYZ A;  2WXP A;  4LJO B;  4K7U A;  2V3P A;  1I4P A;  3P1M A;  3H7P A;  5LXI B;  2MQJ A;  1LGR A;  3L13 A;  5AUK A;  3PSE B;  4REZ A;  1GB1 A;  1RFA A;  1WI0 A;  1WX7 A;  2N9E B;  4GMV A;  3B0A A;  1JQ4 A;  3N30 A;  2ZNV C;  1N62 A;  3EA6 A;  2Y3A A;  2ZVN A;  3DVG Y;  2WP9 B;  2MA9 B;  3A4S C;  3B08 A;  4N9F 4;  2LEK A;  2MRP A;  2BYT A;  3V60 A;  1EUV B;  3PRM B;  5IO9 A;  2V9H A;  2WDT B;  1Z2M A;  4BKS D;  3AV8 A;  3N9Y C;  2ZPN A;  4KZC A;  1MPE A;  2KAJ A;  4F7Z A;  1CMX B;  5H92 C;  1SE3 A;  3Q8A A;  3L0W B;  2KJR A;  3U30 A;  2FAZ A;  1DOX A;  2RMM A;  2Y5C A;  4US8 A;  2J0J A;  3FC4 A;  4G3X B;  3GOE A;  4NQK E;  3AEG B;  5HFY A;  2LUE A;  3H7P B;  4WWN A;  4DXA B;  1UZX B;  1YJI A;  2Y5P A;  1VZ7 A;  1L0Y B;  2KN5 A;  2KT7 A;  3KUC B;  1E8Y A;  2O6V D;  2KMA A;  2K1F A;  4EEW A;  2GBR A;  4HRO A;  4AJY B;  4XGA B;  2INP E;  3ZYY X;  1TGZ B;  1ET9 A;  4XWT A;  3Q3F A;  1PUT A;  3EC8 A;  4IKG A;  4GOC A;  4CO7 A;  2XBB C;  4G11 A;  1WXV A;  3A9K A;  4RFB A;  2KLC A;  5G55 A;  4FAD A;  4ARC A;  2K6D B;  2WYQ A;  1EWY C;  3C19 A;  2D3A A;  4W9D A;  2WXQ A;  1ZKH A;  1WF9 A;  3RZW C;  2NPT A;  4TUU A;  1KH0 A;  1ENF A;  2R2O A;  5LXH A;  4RGN A;  4MEL A;  3BVM A;  3V6E B;  3EFU A;  3KLS X;  2JYE A;  3IAM 1;  1U4A A;  1MHH E;  4HEA 1;  2IGD A;  2W9N A;  4AOF A;  2K6Q A;  2G9H D;  5J18 A;  3KH0 A;  1P1A A;  3QIJ A;  3N1Z C;  3TUO A;  2L1A A;  4EFO A;  4IC7 B;  4NAM A;  2NMQ A;  4MGK E;  2ONQ A;  4H2A A;  3AXC A;  4FHK A;  1RYJ A;  1OEY A;  1Q0W B;  4A6Q A;  3CF6 E;  2IJ0 A;  2RPQ A;  3OJ3 A;  1H8C A;  2DX5 B;  3HUI A;  3MHS D;  1GAQ B;  3A9K B;  5E6P A;  3VR9 B;  1E7V A;  4BKS A;  1XLP A;  1C4P A;  2IY0 B;  5MPO A;  2JRH A;  1E90 A;  2HDE A;  2JWU A;  1STE A;  1UF0 A;  2ZW1 A;  1ZE3 D;  3DOW A;  2MBH A;  3ZRC A;  2V1Y A;  4CHK A;  1IYF A;  5LNK 1;  1CK1 A;  4MGI E;  3RUL A;  2LZ6 A;  3NHE B;  1V5O A;  5AZG A;  3ETR A;  2QHO A;  4BOZ B;  4EZJ A;  3CIR B;  4URK A;  4XYC A;  4JGH B;  2JZ3 B;  4YSX B;  3DVN U;  5BO4 B;  3IAS 1;  4N6E B;  3TEW A;  4AP4 C;  1YQ4 B;  4AUQ C;  2O6V A;  1FO4 A;  2HTM E;  1UBQ A;  1V49 A;  1KOT A;  1N63 A;  1KLU D;  3ENE A;  2QMT A;  4PK1 A;  3EFC A;  4HKQ A;  2INC C;  1ZW7 A;  3P4Q B;  1V8C A;  5DPR A;  3V3X A;  2K39 A;  3IVF A;  1HXY D;  4KKJ A;  2IZV B;  2LGS A;  4FN2 A;  4X57 B;  1PQS A;  2LFI A;  1I7H A;  3A9J A;  4ZRI A;  4K3B A;  4ACF A;  3GZN B;  1E10 A;  2J53 A;  2DBY A;  1LFD A;  2B3A A;  2AQ3 B;  1JWU D;  2LJ5 A;  2QJL A;  4NNJ B;  2WHI A;  1L5P A;  2LHE A;  2KDI A;  3PRZ A;  2LGY A;  3PGE A;  3QJZ A;  2CU3 A;  3UIP B;  4II3 B;  1RWS A;  2JPH A;  3H6N A;  2KDF B;  2BWE S;  2KYW A;  2LD9 A;  4NZL B;  2FUH B;  3EHV A;  1MHX A;  4KZ0 A;  2AX5 A;  4DHJ B;  3RMK C;  2DZI A;  3AEA B;  2FCN A;  1FEH A;  4NAW A;  4NQL B;  1A5R A;  5D7G A;  2O6V B;  4FLH A;  3FAH A;  1YN4 A;  4JE3 B;  1EF5 A;  4ZRP A;  2WXJ A;  1E7P B;  4HWI B;  5JHA A;  3P63 A;  2CR5 A;  4HPL B;  3ZJT A;  2NS5 A;  4BBN F;  2KQ7 A;  4TKN A;  4JLC A;  1WH3 A;  3Q14 C;  2KFK A;  3NVW A;  3SU8 X;  3NY5 A;  1NYR A;  1SE9 A;  3KWV A;  1N60 A;  3APF A;  3RT3 B;  3L10 B;  1TIF A;  5D3I B;  4WAA A;  4HDQ A;  4BAX A;  3H8H A;  1QT9 A;  1T0S C;  1L6U A;  2D10 A;  4R3D A;  1QLB B;  5J2R A;  2OOB B;  4W9E A;  1TYG B;  4M02 A;  2BB6 A;  3ZJV A;  4TQ0 A;  4EE2 A;  2I38 A;  3KUD B;  2ZCB A;  3VH3 B;  3T8M A;  3DWG C;  4NAW B;  2K9X A;  5HI1 A;  1L4Z B;  3L17 A;  2NR2 A;  2J52 A;  4K81 A;  4C00 A;  3ZUN A;  5KHQ A;  5GMV A;  2BWF A;  2QEJ C;  3NVZ A;  1F52 A;  1MG8 A;  2LVP A;  1A70 A;  3LXF A;  5CHF A;  3SHQ A;  2VH1 A;  4IOI E;  4IM3 A;  3RNB C;  1YX6 B;  3ZGZ A;  1WYG A;  2KWV B;  3JVZ X;  1HZ5 A;  2NBV B;  2A5U A;  5D2M B;  4YTN B;  1MI0 A;  4IDI A;  1RRB A;  1S3S G;  2QC8 A;  1JWS D;  3DVN V;  2IPK D;  5IOI A;  3VTV A;  3PT2 B;  4HJK A;  1GJZ A;  1E9M A;  1FPY A;  4II2 B;  4L1B A;  3GZN I;  2WNM A;  4PS7 A;  1GB4 A;  3Q8B A;  1JWM D;  4K3C A;  3TSS A;  4NJ6 A;  4MH8 A;  5CX3 A;  2FID A;  1ZGU B;  2IND C;  5C23 A;  2WWZ A;  3BYT B;  1JWA D;  1UH6 A;  4HKZ E;  2JT4 B;  2I2Y A;  1FMA D;  1B1Z A;  4IWQ A;  2J0K A;  2KC1 A;  4WH4 A;  5EE1 A;  2KX0 A;  2JU6 X;  4RF1 A;  2LVO A;  4WJQ A;  2D07 B;  2KOX A;  4XC2 A;  1GNU A;  2VH2 A;  3HM3 A;  1F2R I;  2DWQ A;  1WM3 A;  4HRS A;  1M94 A;  3WAM A;  2CKH B;  2RGF A;  4I6N B;  3VQI A;  2N1W A;  1XCQ L;  1K53 A;  4XDD A;  2IO1 B;  3BY4 B;  4OVZ A;  4FJY A;  4KIK A;  5IKC M;  3DDC B;  4IUM B;  1XO3 A;  2N9K A;  5KHO A;  1ROE A;  1J7C A;  1PGX A;  2V4I B;  1D5X C;  2EMT A;  2WQY B;  1XQQ A;  2KVR A;  1VDV A;  4NPN A;  4W9H A;  2DZK A;  5TSS A;  2BTE A;  4EOY A;  5L95 C;  2PEA A;  1WJ4 A;  3U8Z A;  5D6J B;  4OHJ A;  3V05 A;  4RM9 A;  3IXS A;  2MJD A;  4BOS C;  4JQW C;  4E3C A;  4K7W A;  4JWU C;  2JSV X;  3L08 A;  1E0Z A;  2MBQ A;  2N4F A;  1QOA A;  1LO5 D;  1UEL A;  2JXT A;  3ZDT A;  2PIA A;  3SD5 A;  2WGS A;  5FR3 A;  3AE3 B;  3BZD B;  4ICV A;  4RM8 A;  1XF5 L;  2M17 A;  4BZA A;  1E8X A;  1IPG A;  4C4V A;  3DCG A;  3GS2 A;  3OLM D;  5G5G A;  2L8J A;  3VVW B;  3R3M A;  3UIO B;  4A90 A;  1MJD A;  3W1S C;  1DYQ A;  1WXM A;  4KIK B;  4PS8 A;  3X23 A;  1V2Y A;  2VRR B;  3Q3J A;  1WIA A;  1UD7 A;  3AI5 A;  3RFZ B;  2CS4 A;  4LTU A;  2IO2 B;  3T3O A;  1JRU A;  1V80 A;  3PRP B;  1FCC C;  2HTH A;  3AEF B;  5DPS A;  2MEK A;  1FFV A;  2CHZ A;  5BYR A;  3HHM A;  4GXB A;  3MJW A;  1EM7 A;  1L0X B;  2SAK A;  4BFR A;  2NTS A;  4HPM B;  1WGY A;  4KSL C;  1I4X A;  2KNB A;  2DYO A;  2BS2 B;  4M0W A;  3CST A;  2A4Z A;  3OJ4 B;  1IGD A;  1YJ1 A;  3C0R B;  3QWZ B;  3BII D;  3U7D A;  4RGO S;  2H88 B;  2C7M B;  1SJE D;  2L3Z A;  4KKI A;  2LUM A;  4C4V B;  1UGM A;  1XEE A;  3RD2 A;  3OWE B;  2X8X X;  3RN9 C;  3PRE A;  4L23 A;  1YJJ A;  3TJP A;  3ZQ4 A;  1TS4 A;  4S0R A;  4N59 A;  1I42 A;  4B0E A;  1QIL A;  3EUB 2;  3ALB A;  3JSV B;  1D5M C;  3TL5 A;  4Q2J A;  2HD5 B;  2ZVO A;  3JYU A;  4ZDV A;  1JRO A;  3CWI A;  2K3U A;  3P4P B;  3GP7 A;  4KV2 A;  1OEY J;  1DOI A;  5FK9 C;  5AZF A;  4DDG D;  1M4V A;  3A1Q A;  3DPD A;  4ZOH C;  2HJ1 A;  1OQR A;  2N9P C;  1TS5 A;  1IBX A;  1N61 A;  1SSN A;  4LNF A;  2DAJ A;  2KAC A;  2W3S A;  2FNJ B;  2L52 A;  2DEN B;  3ZTC A;  5JH5 C;  2BS4 B;  5BMG A;  2CJO A;  2O2V A;  5FR6 A;  1ZXH A;  4HCP B;  4M0W B;  4ITK A;  3FIL A;  1YNT E;  4GGQ A;  2CU1 A;  3AE2 B;  3PTF C;  3Q3O C;  2XEW A;  1T0R C;  3QX1 A;  1V1O A;  2N1V A;  4A20 A;  2WU5 B;  3VH4 B;  1DOY A;  3TMP B;  4OZB A;  4XZ4 A;  4FJV B;  1ZPS A;  3ZNI D;  3Q8C A;  2M4N A;  1JAL A;  2BBC A;  4BKG A;  2MH7 A;  2KN4 A;  2KAN A;  4M8M A;  3N32 A;  4USA A;  1YN5 A;  1TY2 A;  2C7H A;  3N1Y C;  4F8C B;  3VDZ A;  1KLV A;  1SXT A;  1E7U A;  3AMZ A;  3RI7 C;  1NI2 A;  4S17 A;  5H8Y E;  4DK5 A;  3WAL A;  1CQV A;  3VR8 B;  1YOV B;  5GXG B;  4G0N B;  4YSY B;  1X1M A;  1WZ0 A;  4DXG A;  1TTN A;  2LXA A;  2KJH B;  4OVV A;  3T3N A;  1IBX B;  3TEZ A;  4LLG M;  4C80 A;  2OED A;  1WWT A;  2IO3 B;  1D3Z A;  2LI5 A;  4KDL B;  3N1X C;  5DPW A;  2KJ6 A;  3DHG C;  1J19 A;  2M1M A;  2YEP F;  2O2V B;  3FIL B;  3V62 A;  3ZNH B;  2BKF A;  2L0T A;  2Y5B B;  4ANU A;  2V3S A;  3H9D A;  2V3N A;  2CJN A;  1WE7 A;  3DBH B;  5T8I A;  1VJK A;  4HK2 A;  3BK2 A;  1UWX A;  2CHX A;  2NPT B;  1ZDX A;  3KYC D;  3PV1 A;  2EMS A;  4DHZ B;  3GB1 A;  1RAX A;  1EWC A;  2X38 A;  3P4R B;  4OW0 A;  2KWU B;  4XE0 A;  3AE4 B;  2PKO A;  3WCQ A;  1GUA B;  3AUL A;  4B0M A;  2PVG C;  2ZEQ A;  3URY A;  2LGD A;  4TQ1 A;  1P7F A;  3W5V B;  3WAN A;  4A8X C;  2YVC A;  2Z8L A;  3BVG A;  3VAW A;  1D4B A;  1GC6 A;  1TKG A;  1I35 A;  4RH6 A;  1F77 A;  4JL9 A;  3M3J A;  2D5G A;  3M95 A;  1C78 A;  1QOB A;  1WJ6 A;  2C9W B;  2KWD A;  4W9F A;  1V6E A;  4ARI A;  2ON8 A;  1WFY A;  3IT4 B;  3W1Y A;  1Z5S B;  3AEE B;  1RLF A;  3ZNZ B;  4CYE A;  2D3C A;  4MH0 E;  2LMC A;  1I4H A;  1B9R A;  2BVC A;  1R7S A;  2NTT A;  2IGG A;  2Z0D B;  4DHZ E;  1ZXI A;  2FCS A;  3SFE B;  4F1S A;  4LNO A;  1K52 A;  1WZ3 A;  1R4M B;  1F9J A;  4M00 A;  4MSM B;  3TEY A;  5D3D A;  4IW0 A;  1NI3 A;  3HK0 A;  4W9L A;  4A9A A;  3HRD D;  3ZTD A;  1YN3 A;  5AUI A;  4GDK A;  5EE0 A;  3UIN B;  2RDB C;  4GLS C;  3U2S C;  3I3T B;  3WA0 A;  1J7A A;  3HVD A;  3W1S A;  1E8W A;  1NDD A;  3Q6B A;  2R61 A;  5EE9 A;  3ZO5 B;  2BQQ A;  3RNG C;  2M0A A;  5TR5 A;  1FD6 A;  4K1R B;  3KW5 B;  3VTU A;  4WJP A;  2KMM A;  4YTM B;  2BPS A;  3VFK A;  2B76 B;  1GG3 A;  3LJ3 A;  3A9J B;  1I4Q A;  3VHT C;  1OQQ A;  1FNV A;  2PPH A;  2MW5 A;  2BYV E;  3ECI A;  3MHZ A;  2K8H A;  2INN E;  1J8C A;  4M01 A;  3PS6 A;  1G6J A;  1WX8 A;  4BVU C;  1PFD A;  3DBH I;  4YL8 A;  5IA7 A;  3S2A A;  1BML C;  3SR6 A;  3UI3 A;  2M0X A;  4A55 A;  4AJW A;  2H89 B;  2DZJ A;  1P98 A;  1V97 A;  2LWP A;  1XLO A;  4C56 C;  4ICU A;  4D2K A;  1J7B A;  1FNU A;  3U4E G;  3RNA C;  2PE9 A;  1HZ6 A;  1WGD A;  2M19 A;  1ZUD 2;  2GLS A;  1ISN A;  4HXD A;  3HVZ A;  1L6V A;  2OHF A;  4A3O A;  3I5J C;  4ASW C;  1XLQ A;  3B2G A;  4HCN B;  2L83 A;  1ACC A;  1UBI A;  2BT6 A;  3VUW A;  4FA6 A;  1H4R A;  1L4D B;  3SDL C;  3I9V 1;  4KDI C;  1SJH D;  2KFK B;  2KDB A;  4YWG G;  1AN8 A;  4TMA B;  1GOZ A;  1NEK B;  1WXS A;  4HDO A;  3AED B;  2PE6 B;  4I6L B;  2WXO A;  3TCA A;  3IBE A;  1I4R A;  5IN7 A;  4MAC A;  1JW9 D;  3ABV B;  2KTR A;  2ZNV B;  2KO3 A;  3JW0 X;  2DYB A;  3DBL I;  1AW7 A;  3R2I A;  2AYO B;  1R4N B;  2WDR B;  3I63 C;  3Q8F A;  1IGC A;  4WQO B;  4IWO A;  1YMH E;  3OG5 A;  1P3Q U;  3SFD B;  2CHW A;  3X0W A;  2M8S A;  1FNW A;  2W55 A;  3UQA A;  4ZRK A;  1OQY A;  3VRA B;  3EGR A;  2RDG A;  3TEX A;  3ZJU A;  3RZF A;  2ZCC A;  1UWM A;  1R4M I;  2E3T A;  1SEB D;  2DZM A;  1TKY A;  3CMM B;  2LRW A;  2JWZ A;  2XN9 C;  3AEB B;  2MHJ A;  2IYD B;  4KVG B;  4MGY E;  3AM9 A;  1Q5W B;  3MP9 A;  3PO0 A;  3U7Z A;  3M63 B;  4JX1 C;  1XD3 B;  2UU7 A;  1KLG D;  1V86 A;  2VZK D;  1ZOY B;  1VRA B;  4WJN A;  4EKU A;  1WXA A;  4K7S A;  1TS3 A;  3DBS A;  3PLV A;  3W5U B;  2RD0 A;  3P2B A;  2KTR B;  1E5W A;  1PGA A;  5BYQ A;  1GPX A;  4B6W A;  2YEP B;  3I57 A;  2V4L A;  2N9L A;  1AYF A;  5I4D A;  1UNS A;  3AN1 A;  5DCN A;  3WIM A;  1JCK B;  2G4S A;  2UYZ B;  2R2Q A;  2LXC A;  3Q3N C;  3AU4 A;  2LHD A;  3O65 B;  3ZNG C;  1Y56 A;  4N58 A;  2C60 A;  3ZXV A;  2GBJ A;  2C5L C;  2V0G A;  2MCN B;  3PHX B;  1FXA A;  1P0R A;  4IM2 A;  1ZDV A;  3AE5 B;  4HJG E;  3ZVV A;  2FCQ A;  1V5T A;  1D6E C;  3OAW A;  3B9J A;  4DQO C;  1C1Y B;  1N5W A;  5FKA C;  3A33 B;  3U52 E;  1JML A;  2J42 A;  3UGB B;  3PZ7 A;  1PGB A;  3Q2A C;  5C1Z A;  2NBW B;  3NS8 A;  2DLB A;  1AAR A;  4ANW A;  1JRP A;  2BB5 A;  1FRD A;  3ZKJ C;  5JHB A;  3VUX A;  4FUL A;  5LLI A;  5BMH A;  3AE7 B;  2FIF A;  2WXI A;  2N9X A;  2JZZ A;  3K9O B;  1HA5 A;  3PZD A;  4J6I A;  1WXQ A;  2N7D A;  3UQB A;  4RMA A;  2N7E A;  2GI9 A;  1R4N I;  1KTK A;  4MM3 A;  2JZP A;  2LAS A;  1HTQ A;  4WWM A;  4E71 A;  2PMV A;  4TSS A;  1UGJ A;  3C8Y A;  4W9J A;  4LK0 M;  2FUG 1;  3AH7 A;  1TZO A;  1EU4 A;  4OZC A;  2PTL A;  4P1B C;  4WWO A;  2QIE B;  4IWP A;  2JUO A;  1WRD B;  3BIN A;  3R7Q A;  5G2N A;  4ZRQ A;  2BYF A;  2IBI B;  2HE7 A;  2D3G A;  3MC9 A;  5L83 A;  3EEC A;  4GIV A;  4HVB A;  3DBR B;  1YIW A;  1Y8R C;  1N6Z A;  3ML8 A;  2BF8 B;  3P42 A;  2MJ3 A;  1NVI D;  2GOW A;  2D2Q A;  3BWU D;  3H1U A;  1SF0 A;  1WSP A;  1KJT A;  2K22 A;  2LVQ A;  3A4R A;  3PLU A;  2KX3 A;  2L76 A;  3DWM A;  3NVY A;  5EE3 A;  3FKY A;  4KGT A;  3NVV A;  1VR9 A;  2D3B A;  4L2Y A;  1N5X A;  3UF8 A;  1FIQ A;  4EZL A;  3VUY A;  2AQ2 B;  4MM3 B;  4RF0 A;  1WX9 A;  2XNA C;  2DYM A;  1P7E A;  1PDX A;  4DHJ D;  2G3Q B;  2BS3 B;  4LDT D;  3R8B A;  2K0P A;  3RYT A;  5C3J B;  2K5P A;  3E56 A;  2JF5 A;  3PPA A;  1FRR A;  1C79 A;  3AU5 A;  4P1C C;  2NVU I;  2Z0E B;  3IFW B;  1WM2 A;  1WJN A;  5HG2 A;  1HE8 A;  1FM0 D;  1C9F A;  5C2T B;  4W9G A;  2ASQ A;  2IGH A;  1TJE A;  2VZK B;  3MJ5 A;  2WXR A;  2RPV A;  1WYW B;  3LYY A;  3DQV A;  2GB1 A;  4KSK C;  4GU2 A;  3NS1 A;  1MG4 A;  1XXG A;  2DAF A;  4UDU C;  3RCZ A;  1WMH A;  2WU2 B;  1YQB A;  2FBW B;  5IP4 D;  3V61 A;  2AQ1 B;  3KQ4 A;  3SEB A;  1C76 A;  5E6O A;  2HJ8 A;  1K8R B;  2MBB B;  1F1H A;  2I1J A;  3ZRF A;  1TBE A;  3R7R A;  4RCO A;  3AE1 B;  2WXF A;  3A1Q B;  4IM0 A;  1L2N A;  3NZU A;  3Q8E A;  3ML9 A;  1VD2 A;  3AE6 B;  1ET6 A;  5JZE B;  4M8N A;  4WQM A;  2L05 A;  1FFU A;  4YTP B;  5E6N A;  2J0M A;  1NYQ A;  3KUZ A;  1L7Y A;  1EO6 A;  4W9C A;  4WIP A;  2M56 B;  1OTR B;  2MSE D;  3NRZ A;  4HPP A;  3LDZ E;  5CHV C;  2ZW0 A;  4GN1 A;  4C7Y A;  3N3K B;  5EDS A;  1BUI C;  1NBF C;  2OJW A;  5J17 A;  3B2F A;  3W9C B;  4RGT A;  2G4D B;  2GMI C;  5BMI A;  1SE2 A;  3KYD D;  2WDQ B;  5E6J A;  4P7I A;  3LB8 C;  5JXV A;  2BW2 A;  1YX5 B;  2IO0 B;  4FJZ A;  4FBJ B;  4ZRJ A;  1WGK A;  1RM6 C;  2KHW B;  4C7Z A;  3VTW A;  2ICI A;  2WLB A;  2WXH A;  4B95 A;  3Q3M C;  2MBE A;  1QOF A;  1K50 A;  1C3T A;  2NCN A;  1WMH B;  3K9P B;  3DBR I;  1VLB A;  3QK0 A;  1IUE A;  3CSF A;  1T3Q A;  1C77 A;  4KGS A;  1L0V B;  3TBL D;  1WR1 A;  1BXT A;  4PS3 A;  4LNN A;  4P16 A;  5CTR C;  2KK8 A;  2MJE A;  1NEN B;  2J7Q B;  1QOG A;  2MX2 A;  2GBN A;  1RFK A;  2L32 A;  2J4X A;  1SB3 C;  2JQR B;  1P9D U;  1TY0 A;  3Q69 A;  4MJS A;  2KC2 A;  4HLE A;  2LGI A;  4FXC A;  3RPF C;  4JPS A;  3ZXR A;  4YXD B;  4EUT A;  2ACZ B;  2JRI B;  2L00 B;  3WAO A;  4CQN A;  3ONS A;  3MC8 A;  2GRI A;  1VZ8 A;  2KKC A;  4DDI D;  3DBL B;  1F0Z A;  2LRU A;  3BK1 A;  2QSD A;  4P6V F;  4QAY A;  3QAR A;  4YSZ B;  5DPT A;  4BBN C;  1I4G A;  2JXX A;  2BGF A;  2LJI A;  1TKE A;  1S1Q B;  2FE8 A;  2UWQ A;  5IAA C;  3R66 C;  4BKT A;  2G45 B;  2WXK A;  1LQB A;  1XLN A;  2AL6 A;  1XT9 B;  1SIJ A;  1K51 A;  2G1E A;  2KVZ A;  4YT0 B;  2K8B A;  1KF6 B;  4AQ7 A;  2KD0 A;  3QAQ A;  2QDF A;  1C4A A;  4J3O D;  4W9I A;  1VCB A;  2QCZ A;  4FHJ A;  1MFW A;  4PT5 A;  3AEC B;  3NOB A;  1TS2 A;  3HIZ A;  2KQ4 X;  4MJS B;  2FCM A;  4IG7 B;  2IY1 B;  1Q1O A;  1SIF A;  2W82 A;  1EU3 A;  2KDE B;  3NZ3 A;  2DNF A;  2LGX A;  1V9J A;  2PW9 A;  2K8C A;  4LDT B;  1OGW A;  3APC A;  2L0F A;  1AWD A;  3B1L X;  3E9S A;  2KXJ A;  4GDL A;  4OVU A;  1KFY B;  1WY8 A;  3RNC C;  1V1P A;  3NJT A;  3PHW B;  4XWW A;  4XX5 A;  3W2D A;  4MEM A;  2QIL A;  1HEZ E;  3RNF C;  2Q5W D;  1YD8 U;  4LJP B;  4LNK A;  2AEH A;  2MLB A;  3QC8 B;  3MFG A;  2KDM A;  5CHW A;  3NUH B;  4JWS C;  2WXG A;  2JYT A;  1CZP A;  2JY6 A;  1QKZ A;  4B9K A;  1ZP0 B;  4JIO U;  4GDK B;  1T0Q C;  2EEL A;  5BYS A;  4GSW A;  3PZ8 A;  3DVG X;  2TSS A;  4NY0 A;  1YQ3 B;  3GE8 C;  4ANX A;  1HTO A;  4KGR A;  2IDY A;  4MGZ E;  3ZDM C;  2ZPY A;  3BVZ A;  2SEB D;  3DHH C;  1TZ1 A;  3IG3 A;  4LCD E;  1ESF A;  1WGG A;  3ZIM A;  3IHP C;  4I6P A;  2JX5 A;  4WAF A;  3MC0 B;  4MDK E;  1WGR A;  5AEK B;  2MBO A;  2KZR A;  2KWC A;  3IT6 B;  2KQS A;  4GDL B;  2AL3 A;  1PYW D;  5D94 A;  3QQ8 B;  2KMC A;  1QF6 A;  1V1P B;  2I1K A;  1J0G A;  2EKI A;  4AS1 A;  1WRI A;  3KWL A;  3MTN B;  3L54 A;  5AZH A;  4NJ7 A;  2WX1 A;  1XCT L;  1JWB D;  3BYY B;  4DXF A;  1D5Z C;  3N20 C;  4WWP A;  4A3P A;  2N0S B;  1SGH A;  4MSQ B;  2AWT A; 
#chains in the Genus database with same CATH homology
 1UF0 A;  5IO9 A;  5IP4 D;  5IKC M;  5IN7 A;  1MG4 A;  1MFW A;  2DNF A;  2BQQ A;  5IOI A;  1MJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...