5IOIA

X-ray structure of the n-terminal domain of human doublecortin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
LVPRGSHMAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFDDVEYTKNVNPNWSVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of the Human Doublecortin C- and N-terminal Domains in Complex with Specific Antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Neuronal migration protein doublecortin
total genus 25
structure length 107
sequence length 107
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 5ioiA00
5IOIA 1MJDA 2DNFA 1MFWA 2BQQA 5IO9A 5IKCM 5IP4D 1MG4A 1UF0A 5IN7A
chains in the Genus database with same CATH superfamily
3Q3NC 2LVOA 1FCCC 2LUMA 2N9KA 3U52E 1D4BA 3DVGY 4YSYB 1FMAD 1FXTB 2L00B 2CS4A 3H6NA 4ANUA 2G4DB 1TZOA 2PVOD 5L95C 3VR8B 1TS2A 2UU7A 4MH8A 4GOCA 1J7CA 3BYTB 2BKFA 3DHHC 2I1JA 2GB1A 3NZSA 3KUDB 3OAWA 4NAWA 2BS3B 3B0AA 1HQRD 4RM8A 1FXAA 1XEEA 1XXGA 3RMKC 2K39A 1PFDA 3J9CA 3B1LX 3UIPB 3VTWA 2PJHA 4JE3B 4YTMB 1MG8A 5E6JA 3C0RB 1A70A 1ZGUB 4GDLA 3L16A 2ICIA 3V6CB 1V86A 2WDTB 1XLPA 3IBEA 3ENEA 4IM3A 3N30A 4E3CA 1RWSA 3BINA 3Q14C 3IFWB 4TUUA 1WM3A 2D10A 2D3GA 1YNTE 2PKOA 3KVFB 5I4DA 4IDIA 1J19A 1QZEA 2IPKD 1LGRA 3ZRCA 3U7ZA 1M4VA 1OQRA 5AZGA 5CHWA 3MFGA 4M01A 1HTQA 1OEYJ 4IWQA 5LXIB 3EUB2 1ZPSA 2KN4A 2B3AA 1WXQA 4C4VA 5IAAC 3MHZA 2N9LA 2LUEA 2YLMA 4M8MA 3T9LA 2WS3B 2XNAC 2NBUA 3PPAA 1E10A 3RD2A 3X0WA 2FCNA 3VXWA 1MFWA 4DHJB 2KYWA 2N1WA 3ZW3A 2HE7A 2WXLA 2FIDA 4B95A 2BTEA 2AEHA 2RDGA 1PGBA 5FK9C 5IKCM 5G5GA 3UI3A 1WXAA 3I9V1 3KYCD 2H88B 3VRAB 2RPQA 2C7MB 4C80A 4LJOB 1KFYB 1ZUD2 3A9KB 2IO1B 1STEA 2AQ2B 2QJLA 3QK0A 2K3UA 1K50A 2X8XX 2ZNVC 3U8ZA 2VH1A 1UD7A 3URYA 2L0FA 3DDCB 1TKGA 2OJRA 4L1BA 2GLSA 3MJ5A 2OJWA 2Z0DB 2EMTA 2KFKB 3Q8EA 3H7SA 3L17A 3R7RA 4OZAA 3DBHI 3AE3B 4K7WA 1WF9A 1Y56A 1KOTA 3AU4A 1Q0WB 1Q5WB 1NEKB 5AEKB 4TQ0A 1TTNA 3NVVA 1SGHA 1E7PB 2JZPA 3WAPA 4EZJA 3HIZA 4LNIA 3W1SC 3PHWB 4EFOA 4B9KA 4M8NA 2L8JA 4YT0B 1NYQA 2ZJDA 1QILA 1SJHD 2YEPF 1LM8B 1E90A 3DVGX 3BZDB 1ZXIA 2LRUA 1L0VB 2I38A 1YX6B 5D94A 1N6ZA 4A20A 5AZHA 2KJ6A 3DWMA 3L4PA 4IM2A 4A3OA 1UELA 4ARIA 1VR9A 2ACZB 3CWIA 4WWOA 2N7EA 3VAWA 2IYDB 1AW7A 2A5UA 4GIVA 4IC7B 1V9JA 4KSLC 3TL5A 4ASWC 2LD9A 2WQYB 3ZDMC 1CMXB 1FRRA 1VZ7A 2CHXA 3P4SB 2QILA 1TT5B 1ZP0B 1IBXA 1WE7A 1BMLC 2QIEB 4US8A 2IO3B 2WXNA 4MH0E 1E8XA 1XLQA 2XK5B 2N9PC 3AN1A 1N5XA 4BBNF 1I4GA 4JX1C 1YQ4B 3NVWA 2O6VA 4NPNA 2KFJA 2KDBA 4KIKA 2KNBA 2I1KA 2NMQA 1P3QU 4G3XB 4MGYE 3VTUA 2GOWA 4P6VF 1L6UA 2D5GA 1E6EB 5IP4D 4DBGA 3UF8A 3BVGA 3FAHA 1RLFA 2QEJC 3I5JC 2PIAA 4MM3B 2BYEA 3ZNGC 2JT4B 4ZRPA 2LZ6A 3ZNHB 1JWMD 4FLHA 5JHBA 3SFDB 2G4SA 3R66C 3L10B 2K9XA 4HDQA 1L0XB 2KKCA 2ASQA 2DBYA 4UDUC 1V6EA 3ZGZA 4X57B 4LDTD 1WYGA 1IGCA 2CKHB 1CZPA 1YQBA 2MA9B 2BWES 2WXOA 3B9JA 3T3OA 4PS8A 2BB6A 5JHAA 2J4XA 1WGYA 2AL6A 3BIID 1GOZA 4ACFA 3MC8A 4A3PA 3TEYA 2NCNA 3JSVB 3PHXB 3HUIA 2RSUA 4YWGG 4XYCA 2PPHA 2PLPA 5JH5C 1L5PA 2LI5A 3DHGC 3V05A 1E7UA 3DHIC 4CYEA 2LWPA 4HPMB 2R2OA 3TIXA 4P1CC 1ISNA 3DQVA 4FJYA 4RF0A 1MHXA 2INDC 1VZ8A 3CSFA 3U4EG 1KF6B 2JY6A 1B9RA 4JIOU 1K52A 4ANXA 2KMMA 3SDLC 4W9KA 2FNJB 1F77A 2DX5B 1XD3B 3AE6B 3UQBA 5D6JB 3U30A 1QQRA 4NJ6A 1UBQA 5HG2A 3OJ4B 3TUOA 3ZVVA 1JROA 5E6OA 2INPE 3R8BA 4NY0A 1JQ4A 2QSDA 3V62A 1SE3A 1HEZE 2HJ8A 1IPGA 2IO2B 2WXIA 2M19A 4KV2A 1EF5A 3VR9B 3AEBB 5DPRA 1S3SG 4YSXB 4LK0M 4C7ZA 5AZFA 2XN9C 1F2RI 2KK8A 3VDZA 2LJ5A 2JZ3B 1WZ3A 3QX1A 3Q2AC 2JXTA 2Z59B 2EKIA 4W9FA 3ZYYX 1RFAA 1C4PA 1QOBA 4JWSC 1JMLA 2OOBB 4AWJA 4EKUA 2C7HA 1I4RA 1YJJA 1VDVA 2KZRA 3ECIA 4FXCA 3UQAA 1L4DB 4AP4C 2N4FA 2HDEA 5E6PA 4KSKC 3PREA 4XDCA 3ZDTA 2ZCCA 2PVGC 3KUZA 1P9DU 2K25A 4RGNA 2R2QA 4I6LB 2WXGA 3W2DA 4EE2A 1CJEA 4WAAA 3L54A 4MT5A 4B0MA 1I4QA 5J17A 1MPEA 1FCLA 2NR2A 3NRZA 2NTTA 3CMMB 3RZWC 3HK0A 4OZBA 3NUHB 5BYSA 1SE9A 1R4NI 2FCQA 2D3AA 3PRZA 1SE2A 4LNFA 2DYBA 1R7SA 3AEFB 4M0WB 2KHWB 2WNMA 3EA6A 3Q8FA 5C23A 1EWCA 2MLBA 1B1ZA 2MSED 4WQMA 4YTNB 3B2FA 2MBBB 4EZKA 4MACA 4D2KA 3Q8CA 4N59A 4J3OD 2DENB 3A9KA 3A33B 3VTVA 1HTOA 3TJPA 4MDKE 4Q2JA 4IW0A 5FKAC 3PT2B 1UUPA 4HJKA 3PLUA 1N63A 3PZ8A 3GOEA 1WYWB 3GE3C 4CQNA 1WGRA 2WDQB 4KZ0A 3BWUD 3A4RA 4LNOA 3DPDA 1YN4A 1RRBA 3PRMB 4FBJB 2WXPA 4S17A 1MHHE 4N6EB 3ZKJC 4TMAB 1FFVA 4G50A 2BS4B 2DZMA 5BMIA 1SXTA 2KVRA 3PLVA 4KDIC 4MGIE 1TIFA 1I7HA 1BUIC 3M62B 1T0QC 3AV8A 2VZKD 1TY0A 2O2VB 4TV3A 4AQ7A 3OJ3A 1V49A 4NQKE 1RM6C 5H8YE 2G9HD 5D3DA 1KTKA 2QHOA 2MJEA 3P2BA 2NPTA 2G45B 5HKHA 3KWLA 2INNE 4ZRQA 1NI2A 1OFFA 5C1ZA 1YN3A 1HZ6A 3T3NA 2M0XA 2C9WB 1N61A 3IT4B 2DAFA 1Q10A 5D3IB 2MP2B 1YX5B 1WX7A 3AI5A 4YTPB 1ET6A 2W3RA 1MG4A 2DZKA 4FN2A 1PUTA 1TGZB 1TS4A 3E56A 1L7YA 4RFBA 5G55A 3ZNZB 3MTNB 4MJSB 4O1NA 2RGFA 4P7IA 3EHVA 3Q8BA 2M4NA 4PS3A 4WWNA 3P42A 4IKGA 1LO5D 1V1PB 2Z8LA 3GB1A 3AE9B 4DQOC 2V4IB 2KWDA 1XLOA 5BMHA 1V1PA 1AARA 2KOXA 1D6EC 2ZPYA 3NJTA 1HXYD 4PT5A 1C76A 2X38A 3P4QB 3TSSA 2AL3A 2LGYA 4US9A 4A55A 2BVCA 3VQIA 1WH3A 1E7VA 2IO0B 2GBJA 5BMGA 1R4NB 4RNAA 3TMPB 1D3ZA 3GE8C 4BFRA 3AEEB 3UIOB 5J2RA 1UWMA 1J8CA 3SU8X 4IOIE 4XE0A 4L23A 1XCQL 3AH7A 2KXJA 1IP9A 2RR9A 2DAJA 5KHQA 3LXFA 1JRUA 5FR6A 1GG3A 4MSQB 2J53A 2J52A 1QT9A 2JUOA 4HKZE 2CJOA 3TEXA 4HEA1 4NJCA 4FHJA 3VH3B 3BY4B 4KVGB 1NYRA 5CTRC 1ZXHA 1JW9D 1FEHA 2L1AA 4E74A 3QQ8B 1ENFA 2OEDA 2IGHA 3KYDD 2V3PA 4GDLB 1GB1A 4XX5A 5LNK1 4GDKB 4ANVA 2L3ZA 3KWVA 4A8XC 2K8CA 4TKNA 5IN7A 1T3QA 4PS7A 4AJYB 4XZ4A 3AEDB 1FPYA 2KTRA 4GXBA 4E71A 1YIWA 3RNAC 4YSZB 4W9EA 1WJ4A 2M8SA 3N1ZC 2LRWA 2KWVB 2KFKA 5G5HA 4BKSD 1L2NA 1UBIA 1XT9B 2MW5A 2BYFA 2N7DA 2LJIA 3SR6A 5FR3A 1L6VA 3ML9A 1FNWA 4M02A 5BYRA 4IWOA 1SF0A 2AQ3B 1YN5A 1QKZA 3H1UA 3PGEA 1ACCA 2FCMA 1H8CA 5JZEB 3DOWA 3LYYA 3ZXVA 3RZFA 1MVKA 1GC6A 1TY2A 5LLIA 1T0YA 4YL8A 3L13A 1C4AA 2LEKA 5C2TB 3TBLD 3RN9C 3CF6E 3BYYB 2N7JA 2JRIB 2BYTA 1WR6E 1E0ZA 1U4AA 2INCC 3R2IA 3FILA 2QCZA 3Q8AA 5CX3A 1Y8RC 2MJ3A 5DPSA 1P7FA 1V1OA 3QWZB 3AMZA 4WJPA 4ZDVA 3AB5A 1E8WA 2M1MA 4EUTA 4JWUC 1PYWD 2KDFB 2LHEA 4XWWA 3R7QA 4MEMA 1F2RC 2DHZA 4NAWB 4EZLA 1DOYA 4GSWA 4ZHPA 4HJGE 1UZXB 2L05A 4LLGM 5GMVA 2MBHA 3W9CB 1NENB 4RMAA 1AN8A 3I57A 3O13A 2WDRB 4HK2A 1L0YB 1VD2A 4ZHOA 1YOVB 1UGMA 1NDDA 3RNGC 2VZKB 4ARCA 3Q3MC 3RYTA 4OHJA 2UYZB 2HJ1A 1MJDA 3QJZA 5IA7A 5MPOA 1KRHA 1SE4A 2KACA 2Y5CA 2W9NA 1PDXA 3DWGC 1FXIA 5IO9A 5DPWA 3ZLZA 1WE6A 2WXQA 3NVZA 2KMCA 2IGDA 3HVZA 1SIJA 1E5WA 3W1YA 4KDLB 2ZNVB 4HWIB 2FAZA 2KWCA 3SD5A 2MJDA 2GI9A 4W9JA 3AE4B 4FA6A 1C4CA 1WRIA 1WXMA 3D32A 4XWTA 1H4RA 4L2YA 3NS8A 3Q3OC 3IXSA 4ICUA 1ET9A 3SHQA 3WANA 3NZ3A 4DXFA 3MC0B 1KLUD 2J42A 3P4PB 2PE6B 3AEGB 5AUIA 2KO3A 1R4MI 3Q3FA 3ZIMA 2KLGA 5EE1A 3M3JA 4KGSA 4WJNA 1V81A 1WGKA 2L76A 1WX8A 3ONSA 2BPSA 1F0ZA 4HRSA 2JX5A 3IAS1 4HLEA 2KDIA 2K1FA 4S0RA 3K9PB 4EOYA 3DBRB 3IVFA 3B08A 1I4XA 1JALA 1C3TA 1NI3A 1P0RA 4FADA 5HFYA 3A9JB 1V97A 1GB4A 3A1QA 3GS2A 3BVMA 5HHDG 1OGWA 2V0GA 1SBBB 2MP2A 1RYJA 1YD8U 1EU3A 4HPPA 4ITKA 4W9LA 4WURA 2W54A 4JQWC 3ZRFA 1XLNA 1AYFA 1FFUA 3LDZE 1E8ZA 4W9IA 1TYGB 2JVCA 3HVDA 1GJZA 2XEWA 1WM2A 1UH6A 2EKEC 2N0SB 4IM0A 4LNNA 2WP9B 4GLSC 1NVID 4KIKB 3O65B 3RNFC 5AUKA 2CHWA 2K5PA 1WZ0A 4HPLB 1EF1A 1ZE3D 2BYVE 4WAFA 4II3B 4B6WA 4II2B 4KZCA 3KUCB 2J0KA 4JL9A 3ETRA 2IDYA 3ZTDA 2FIFA 2ONQA 2KQ4X 4F7ZA 4GGQA 2BS2B 4KGRA 4BZAA 4DXGA 2KD0A 1D5MC 2HTHA 3W5UB 4RGOS 2W55A 2YVCA 2V3NA 1KLGD 2WXFA 1E8YA 4ZOHC 2HTME 2H89B 3OG5A 1WX9A 4EEWA 3JW0X 1GC7A 2D11A 4R3DA 1DOXA 3RPFC 1BXTA 1QOAA 2SEBD 4KX6B 1M94A 2SAKA 1YJIA 2W3SA 1JWUD 3A9JA 4BOSC 3SFEB 1VRAB 3Q6BA 2LMCA 3PS6A 3MHSD 4CO7A 4BVUC 1X1MA 3ZJTA 2N9XA 4PYZA 2CU1A 1F52A 1OQQA 2RDHA 1D5XC 4N9F4 1UNSA 2NPTB 2ZVOA 3PVLA 2K8HA 2BBCA 2REXA 3U7DA 1KH0A 5CHVC 3ZQ4A 4HDOA 2M0AA 2C7NB 4OZCA 2L0TA 4DHZE 2WX0A 4C7YA 3ZJVA 4ZRJA 5EE0A 3HM6X 4JLCA 1J7BA 4H2AA 1T5XD 4ZRIA 1K51A 2NS5A 3KLSX 3RUIB 3LB8C 2PEAA 4I6NB 4DHJD 1IGDA 2Y3AA 1FIQA 3ZNID 1Q1OA 3ALBA 4ANWA 1HE8A 4JGHB 3RI7C 1JCKB 3X23A 3L0WB 2DYOA 1SEBD 2FCSA 3L08A 3QC8B 2VRRB 2K0PA 3WIMA 1V5TA 3QARA 4HCNB 2KDMA 1GNUA 3ZO5B 1LFDA 1WY8A 3A1QB 1YQ3B 3NY5A 1YMHE 2A4ZA 4ZYSA 1WR1A 2V4LA 2Z0EB 1WI0A 1NBFC 2MBOA 4F8CB 3PZDA 1QOGA 2I2YA 2DZIA 2V3SA 2MBEA 3AE2B 3V60A 2KMAA 2KQSA 1WGHA 1P7EA 2K8BA 2WDVB 5GXGB 3N32A 3APCA 1R4MB 4MGKE 3DBRI 3VUXA 4LTUA 1V5OA 3ML8A 5C3JB 3RCZA 3FC4A 1K8RB 2O6VB 3T8MA 3U2SC 4AJWA 1UWXA 3QAQA 3OLMD 1TBEA 3KH0A 2KVZA 2J0MA 5LXHA 2B76B 1GAQB 2LVPA 2GMIC 2ZW0A 3N9YC 4GMVA 2JWZA 3V6EB 2MQJA 4QAYA 1QF6A 3AULA 1C9FA 5D7GA 3A4SC 3PV1A 3WAMA 5TR5A 1VCBA 1ROEA 4C4VB 3CSTA 2L7RA 1RFKA 5HI1A 3H7PA 1I4PA 4A90A 1WMHA 2KX0A 4MJSA 4NAMA 2W82A 1F9JA 4RM9A 1C1YB 2Q5WD 2ZZPB 1FO4A 1GUAB 2AQ1B 2BT6A 4K7UA 1XCTL 2C5LC 4W9GA 4W9DA 1IYFA 2FUG1 2GBKA 1WRDB 4HXDA 3PZ7A 3VH4B 1J0GA 2HD5B 4IUMB 4K1RB 4MELA 1GPXA 2GBNA 1KLVA 2BGFA 2KLCA 1EM7A 1SJED 1WJUA 3W1SA 1ZDVA 2D07B 1JRPA 4DXAB 2WWZA 2KQ7A 1XO3A 1ZKHA 5EDSA 3QCAA 1SB3C 4RGMA 4KKIA 4M00A 5DPTA 3C19A 3AXCA 2OHFA 1XQQA 3H7PB 2ZVNA 2JF5A 2EELA 4J6IA 4WWPA 1TKEA 3VHTC 2PMVA 2MRPA 1LQBA 3TEWA 2PW9A 4BKTA 4MM3A 5D2MB 4G11A 3M63B 3TEZA 3GZNB 4YXDB 2KAJA 2DLBA 4REZA 2JPHA 2KX3A 2L83A 1V80A 2IY0B 3DBLI 4NJ7A 3PSEB 2MCNB 2RPVA 3NG0A 2RD0A 2BB5A 4TQ1A 2WHIA 2WGSA 3C8YA 1P98A 3RNCC 2JWUA 5BO4B 2KC1A 4HCPB 2KTRB 1D5ZC 3I63C 2BQQA 4WH4A 5E6NA 1TS5A 4MGZE 4PK1A 1EO6A 3UGBB 5DCNA 2WXRA 2XBBC 1C79A 1WFYA 1EU4A 1WGGA 2EMSA 2WU2B 5KHOA 2C60A 2WYQA 3AE1B 1TKYA 1SIFA 2G3QB 4P1BC 3QA8A 4XGAB 2BWFA 5G2NA 3UINB 3EFCA 3OWEB 4BKSA 4BKGA 2CR5A 2KANA 1WMHB 2DYMA 5T8IA 2VH2A 1Z5SB 4WJOA 5L83A 4GU2A 4M0WA 1PGXA 1T0RC 1WIAA 4AS1A 2MHJA 4USAA 2IGGA 2WU5B 2JQRB 2K22A 3V61A 3HM3A 1WJNA 2ZCBA 1VZ6A 1CQVA 2ZW1A 4A6QA 2LGSA 5BYQA 3N3KB 2MWSB 1JWBD 3AECB 2E6XA 3EFUA 1KM7A 3VVWB 3P63A 3AM9A 4NNJB 1I42A 4LNKA 1VLBA 4OVVA 1VJKA 2WLBA 3GP7A 3ZTCA 3EGRA 4FHKA 4DK5A 3N1XC 2D3BA 4RGTA 2QC8A 3N20C 3I3TB 3DBHB 2MBQA 1WXSA 4CHKA 2DNFA 3IT6B 3RT3B 1JWSD 4OVZA 3QHTA 2K6QA 3BK1A 3IAM1 4MSMB 2QMTA 4IWPA 4OW0A 4DDID 1RAXA 1V2YA 3ABVB 3E9SA 2XK5A 2NBVB 1IUEA 4WWMA 2LXCA 3APFA 2ZEQA 3N1YC 3WA0A 1WWTA 2IBIB 3WALA 3AU5A 2NBWB 4HVBA 2RMMA 3PRPB 2QDFA 2RDBC 2N9EB 2PTLA 3W5VB 2AYOB 1IBXB 2O6VD 4TSSA 3JSVA 1ESFA 2KC2A 3AE8B 3FILB 3KQ4A 2IY1B 2WXMA 2E3TA 4RF1A 3MJWA 1UGJA 2LGDA 4FJZA 1TS3A 2JRHA 1BT0A 2MH7A 4FULA 1WGDA 2GBMA 4GB9A 3H9DA 2WX1A 2MEKA 4K7SA 3NOBA 3IHPC 3TCAA 1C78A 1OQYA 1A5RA 4K3CA 4GDKA 1DOIA 3P1MA 1LXDA 2CU3A 3WCQA 1YJ1A 3BK2A 5EE3A 3R2TA 2DWQA 3QIJA 2NTSA 4BAXA 1I35A 2J7QB 3EECA 4KKJA 1I4HA 2NVUI 1WSPA 2IJ0A 4WQOB 2D2QA 3AE7B 3BVZA 2MX2A 4RCOA 2Y5PA 2J0JA 3VRBB 1N5WA 2CHZA 3CIRB 2UWQA 2FUHB 4FJVB 3ZUNA 3MC9A 1FRDA 3APDA 3VUWA 1J7AA 4F1SA 3NZUA 4DWFA 2GBRA 1WJ6A 2JXXA 1DYQA 4G0NB 3KW5B 1XF5L 2L32A 2KWUB 1CK1A 1TJEA 4IG7B 3DBLB 4C00A 4K3BA 3R3MA 3NVYA 1FM0D 3FKYA 4WJQA 2JU6X 2IZVB 1ZW7A 1V8CA 2WXJA 4B0EA 4OVUA 1TZ1A 5EE9A 1PQSA 2TSSA 3HHMA 2FBWB 2M56B 3NHEB 2V9HA 3K9OB 3VFKA 3NS1A 2LHDA 5CHFA 1G6JA 3RULA 2K6DB 3M95A 1FNUA 2LGXA 4BBNC 4ZYNA 2JYTA 2ON8A 5JXVA 4W9CA 1QLBB 2YEPB 1OTRB 4C56C 3PTFC 3RNBC 4LCDE 1FNVA 1DGJA 1N60A 3IG3A 1WXVA 2KT7A 4KGTA 3RFZB 2M17A 1EUVB 2Y5BB 2BKRB 4GN1A 3DVNU 2ZPNA 4K81A 3S2AA 2BF8B 2DZJA 2KTFA 2AX5A 3SEBA 3AEAB 4AOFA 1ZDXA 2JZZA 2KJRA 3Q69A 4NZLB 1OEYA 3Q3JA 4HKQA 1N62A 4NQLB 1S1QB 2JYEA 1JWAD 3DCGA 4LDTB 2L52A 2KN5A 4ICVA 2GRIA 2PE9A 4HROA 1K53A 1T0SC 5IOIA 4RH6A 1MI0A 2LASA 2LXAA 1EWYC 3PO0A 2O2VA 2WXKA 4LJPB 3VUYA 5TSSA 2KDEB 1KJTA 1L4ZB 1QOFA 3EC8A 3LJ3A 1PGAA 5H92C 1Z2MA 3WAOA 1HZ5A 2LFIA 2N1VA 4PYUA 1ZOYB 3AE5B 4XC2A 3DBSA 1SSNA 2CJNA 1FD6A 1C77A 4N58A 4W9HA 2R61A 1P1AA 1HA5A 2LGIA 4AUQC 2BW2A 2FE8A 3HRDD 1AWDA 4A9AA 2D3CA 2JSVX 3ZXRA 2LVQA 3H8HA 1T6BX 3V3XA 2V1YA 1F1HA 1UF0A 4P16A 1E9MA 4I6PA 4URKA 2G1EA 4JPSA 5J18A 4XDDA 4DHZB 4DDGD 3JVZX 3DVNV 3GZNI 4WIPA 3MP9A 4BOZB 2KJHB 3JYUA 3B2GA 3P4RB 2WXHA 3ZJUA 2AWTA 3RNEC 4ZRKA
chains in the Genus database with same CATH topology
5IOIA 1MJDA 2DNFA 1MFWA 2BQQA 5IO9A 5IKCM 5IP4D 1MG4A 1UF0A 5IN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOI A;  1MJD A;  2DNF A;  1MFW A;  2BQQ A;  5IO9 A;  5IKC M;  5IP4 D;  1MG4 A;  1UF0 A;  5IN7 A; 
#chains in the Genus database with same CATH topology
 3Q3N C;  2LVO A;  1FCC C;  2LUM A;  2N9K A;  3U52 E;  1D4B A;  3DVG Y;  4YSY B;  1FMA D;  1FXT B;  2L00 B;  2CS4 A;  3H6N A;  4ANU A;  2G4D B;  1TZO A;  2PVO D;  5L95 C;  3VR8 B;  1TS2 A;  2UU7 A;  4MH8 A;  4GOC A;  1J7C A;  3BYT B;  2BKF A;  3DHH C;  2I1J A;  2GB1 A;  3NZS A;  3KUD B;  3OAW A;  4NAW A;  2BS3 B;  3B0A A;  1HQR D;  4RM8 A;  1FXA A;  1XEE A;  1XXG A;  3RMK C;  2K39 A;  1PFD A;  3J9C A;  3B1L X;  3UIP B;  3VTW A;  2PJH A;  4JE3 B;  4YTM B;  1MG8 A;  5E6J A;  3C0R B;  1A70 A;  1ZGU B;  4GDL A;  3L16 A;  2ICI A;  3V6C B;  1V86 A;  2WDT B;  1XLP A;  3IBE A;  3ENE A;  4IM3 A;  3N30 A;  4E3C A;  1RWS A;  3BIN A;  3Q14 C;  3IFW B;  4TUU A;  1WM3 A;  2D10 A;  2D3G A;  1YNT E;  2PKO A;  3KVF B;  5I4D A;  4IDI A;  1J19 A;  1QZE A;  2IPK D;  1LGR A;  3ZRC A;  3U7Z A;  1M4V A;  1OQR A;  5AZG A;  5CHW A;  3MFG A;  4M01 A;  1HTQ A;  1OEY J;  4IWQ A;  5LXI B;  3EUB 2;  1ZPS A;  2KN4 A;  2B3A A;  1WXQ A;  4C4V A;  5IAA C;  3MHZ A;  2N9L A;  2LUE A;  2YLM A;  4M8M A;  3T9L A;  2WS3 B;  2XNA C;  2NBU A;  3PPA A;  1E10 A;  3RD2 A;  3X0W A;  2FCN A;  3VXW A;  1MFW A;  4DHJ B;  2KYW A;  2N1W A;  3ZW3 A;  2HE7 A;  2WXL A;  2FID A;  4B95 A;  2BTE A;  2AEH A;  2RDG A;  1PGB A;  5FK9 C;  5IKC M;  5G5G A;  3UI3 A;  1WXA A;  3I9V 1;  3KYC D;  2H88 B;  3VRA B;  2RPQ A;  2C7M B;  4C80 A;  4LJO B;  1KFY B;  1ZUD 2;  3A9K B;  2IO1 B;  1STE A;  2AQ2 B;  2QJL A;  3QK0 A;  2K3U A;  1K50 A;  2X8X X;  2ZNV C;  3U8Z A;  2VH1 A;  1UD7 A;  3URY A;  2L0F A;  3DDC B;  1TKG A;  2OJR A;  4L1B A;  2GLS A;  3MJ5 A;  2OJW A;  2Z0D B;  2EMT A;  2KFK B;  3Q8E A;  3H7S A;  3L17 A;  3R7R A;  4OZA A;  3DBH I;  3AE3 B;  4K7W A;  1WF9 A;  1Y56 A;  1KOT A;  3AU4 A;  1Q0W B;  1Q5W B;  1NEK B;  5AEK B;  4TQ0 A;  1TTN A;  3NVV A;  1SGH A;  1E7P B;  2JZP A;  3WAP A;  4EZJ A;  3HIZ A;  4LNI A;  3W1S C;  3PHW B;  4EFO A;  4B9K A;  4M8N A;  2L8J A;  4YT0 B;  1NYQ A;  2ZJD A;  1QIL A;  1SJH D;  2YEP F;  1LM8 B;  1E90 A;  3DVG X;  3BZD B;  1ZXI A;  2LRU A;  1L0V B;  2I38 A;  1YX6 B;  5D94 A;  1N6Z A;  4A20 A;  5AZH A;  2KJ6 A;  3DWM A;  3L4P A;  4IM2 A;  4A3O A;  1UEL A;  4ARI A;  1VR9 A;  2ACZ B;  3CWI A;  4WWO A;  2N7E A;  3VAW A;  2IYD B;  1AW7 A;  2A5U A;  4GIV A;  4IC7 B;  1V9J A;  4KSL C;  3TL5 A;  4ASW C;  2LD9 A;  2WQY B;  3ZDM C;  1CMX B;  1FRR A;  1VZ7 A;  2CHX A;  3P4S B;  2QIL A;  1TT5 B;  1ZP0 B;  1IBX A;  1WE7 A;  1BML C;  2QIE B;  4US8 A;  2IO3 B;  2WXN A;  4MH0 E;  1E8X A;  1XLQ A;  2XK5 B;  2N9P C;  3AN1 A;  1N5X A;  4BBN F;  1I4G A;  4JX1 C;  1YQ4 B;  3NVW A;  2O6V A;  4NPN A;  2KFJ A;  2KDB A;  4KIK A;  2KNB A;  2I1K A;  2NMQ A;  1P3Q U;  4G3X B;  4MGY E;  3VTU A;  2GOW A;  4P6V F;  1L6U A;  2D5G A;  1E6E B;  5IP4 D;  4DBG A;  3UF8 A;  3BVG A;  3FAH A;  1RLF A;  2QEJ C;  3I5J C;  2PIA A;  4MM3 B;  2BYE A;  3ZNG C;  2JT4 B;  4ZRP A;  2LZ6 A;  3ZNH B;  1JWM D;  4FLH A;  5JHB A;  3SFD B;  2G4S A;  3R66 C;  3L10 B;  2K9X A;  4HDQ A;  1L0X B;  2KKC A;  2ASQ A;  2DBY A;  4UDU C;  1V6E A;  3ZGZ A;  4X57 B;  4LDT D;  1WYG A;  1IGC A;  2CKH B;  1CZP A;  1YQB A;  2MA9 B;  2BWE S;  2WXO A;  3B9J A;  3T3O A;  4PS8 A;  2BB6 A;  5JHA A;  2J4X A;  1WGY A;  2AL6 A;  3BII D;  1GOZ A;  4ACF A;  3MC8 A;  4A3P A;  3TEY A;  2NCN A;  3JSV B;  3PHX B;  3HUI A;  2RSU A;  4YWG G;  4XYC A;  2PPH A;  2PLP A;  5JH5 C;  1L5P A;  2LI5 A;  3DHG C;  3V05 A;  1E7U A;  3DHI C;  4CYE A;  2LWP A;  4HPM B;  2R2O A;  3TIX A;  4P1C C;  1ISN A;  3DQV A;  4FJY A;  4RF0 A;  1MHX A;  2IND C;  1VZ8 A;  3CSF A;  3U4E G;  1KF6 B;  2JY6 A;  1B9R A;  4JIO U;  1K52 A;  4ANX A;  2KMM A;  3SDL C;  4W9K A;  2FNJ B;  1F77 A;  2DX5 B;  1XD3 B;  3AE6 B;  3UQB A;  5D6J B;  3U30 A;  1QQR A;  4NJ6 A;  1UBQ A;  5HG2 A;  3OJ4 B;  3TUO A;  3ZVV A;  1JRO A;  5E6O A;  2INP E;  3R8B A;  4NY0 A;  1JQ4 A;  2QSD A;  3V62 A;  1SE3 A;  1HEZ E;  2HJ8 A;  1IPG A;  2IO2 B;  2WXI A;  2M19 A;  4KV2 A;  1EF5 A;  3VR9 B;  3AEB B;  5DPR A;  1S3S G;  4YSX B;  4LK0 M;  4C7Z A;  5AZF A;  2XN9 C;  1F2R I;  2KK8 A;  3VDZ A;  2LJ5 A;  2JZ3 B;  1WZ3 A;  3QX1 A;  3Q2A C;  2JXT A;  2Z59 B;  2EKI A;  4W9F A;  3ZYY X;  1RFA A;  1C4P A;  1QOB A;  4JWS C;  1JML A;  2OOB B;  4AWJ A;  4EKU A;  2C7H A;  1I4R A;  1YJJ A;  1VDV A;  2KZR A;  3ECI A;  4FXC A;  3UQA A;  1L4D B;  4AP4 C;  2N4F A;  2HDE A;  5E6P A;  4KSK C;  3PRE A;  4XDC A;  3ZDT A;  2ZCC A;  2PVG C;  3KUZ A;  1P9D U;  2K25 A;  4RGN A;  2R2Q A;  4I6L B;  2WXG A;  3W2D A;  4EE2 A;  1CJE A;  4WAA A;  3L54 A;  4MT5 A;  4B0M A;  1I4Q A;  5J17 A;  1MPE A;  1FCL A;  2NR2 A;  3NRZ A;  2NTT A;  3CMM B;  3RZW C;  3HK0 A;  4OZB A;  3NUH B;  5BYS A;  1SE9 A;  1R4N I;  2FCQ A;  2D3A A;  3PRZ A;  1SE2 A;  4LNF A;  2DYB A;  1R7S A;  3AEF B;  4M0W B;  2KHW B;  2WNM A;  3EA6 A;  3Q8F A;  5C23 A;  1EWC A;  2MLB A;  1B1Z A;  2MSE D;  4WQM A;  4YTN B;  3B2F A;  2MBB B;  4EZK A;  4MAC A;  4D2K A;  3Q8C A;  4N59 A;  4J3O D;  2DEN B;  3A9K A;  3A33 B;  3VTV A;  1HTO A;  3TJP A;  4MDK E;  4Q2J A;  4IW0 A;  5FKA C;  3PT2 B;  1UUP A;  4HJK A;  3PLU A;  1N63 A;  3PZ8 A;  3GOE A;  1WYW B;  3GE3 C;  4CQN A;  1WGR A;  2WDQ B;  4KZ0 A;  3BWU D;  3A4R A;  4LNO A;  3DPD A;  1YN4 A;  1RRB A;  3PRM B;  4FBJ B;  2WXP A;  4S17 A;  1MHH E;  4N6E B;  3ZKJ C;  4TMA B;  1FFV A;  4G50 A;  2BS4 B;  2DZM A;  5BMI A;  1SXT A;  2KVR A;  3PLV A;  4KDI C;  4MGI E;  1TIF A;  1I7H A;  1BUI C;  3M62 B;  1T0Q C;  3AV8 A;  2VZK D;  1TY0 A;  2O2V B;  4TV3 A;  4AQ7 A;  3OJ3 A;  1V49 A;  4NQK E;  1RM6 C;  5H8Y E;  2G9H D;  5D3D A;  1KTK A;  2QHO A;  2MJE A;  3P2B A;  2NPT A;  2G45 B;  5HKH A;  3KWL A;  2INN E;  4ZRQ A;  1NI2 A;  1OFF A;  5C1Z A;  1YN3 A;  1HZ6 A;  3T3N A;  2M0X A;  2C9W B;  1N61 A;  3IT4 B;  2DAF A;  1Q10 A;  5D3I B;  2MP2 B;  1YX5 B;  1WX7 A;  3AI5 A;  4YTP B;  1ET6 A;  2W3R A;  1MG4 A;  2DZK A;  4FN2 A;  1PUT A;  1TGZ B;  1TS4 A;  3E56 A;  1L7Y A;  4RFB A;  5G55 A;  3ZNZ B;  3MTN B;  4MJS B;  4O1N A;  2RGF A;  4P7I A;  3EHV A;  3Q8B A;  2M4N A;  4PS3 A;  4WWN A;  3P42 A;  4IKG A;  1LO5 D;  1V1P B;  2Z8L A;  3GB1 A;  3AE9 B;  4DQO C;  2V4I B;  2KWD A;  1XLO A;  5BMH A;  1V1P A;  1AAR A;  2KOX A;  1D6E C;  2ZPY A;  3NJT A;  1HXY D;  4PT5 A;  1C76 A;  2X38 A;  3P4Q B;  3TSS A;  2AL3 A;  2LGY A;  4US9 A;  4A55 A;  2BVC A;  3VQI A;  1WH3 A;  1E7V A;  2IO0 B;  2GBJ A;  5BMG A;  1R4N B;  4RNA A;  3TMP B;  1D3Z A;  3GE8 C;  4BFR A;  3AEE B;  3UIO B;  5J2R A;  1UWM A;  1J8C A;  3SU8 X;  4IOI E;  4XE0 A;  4L23 A;  1XCQ L;  3AH7 A;  2KXJ A;  1IP9 A;  2RR9 A;  2DAJ A;  5KHQ A;  3LXF A;  1JRU A;  5FR6 A;  1GG3 A;  4MSQ B;  2J53 A;  2J52 A;  1QT9 A;  2JUO A;  4HKZ E;  2CJO A;  3TEX A;  4HEA 1;  4NJC A;  4FHJ A;  3VH3 B;  3BY4 B;  4KVG B;  1NYR A;  5CTR C;  1ZXH A;  1JW9 D;  1FEH A;  2L1A A;  4E74 A;  3QQ8 B;  1ENF A;  2OED A;  2IGH A;  3KYD D;  2V3P A;  4GDL B;  1GB1 A;  4XX5 A;  5LNK 1;  4GDK B;  4ANV A;  2L3Z A;  3KWV A;  4A8X C;  2K8C A;  4TKN A;  5IN7 A;  1T3Q A;  4PS7 A;  4AJY B;  4XZ4 A;  3AED B;  1FPY A;  2KTR A;  4GXB A;  4E71 A;  1YIW A;  3RNA C;  4YSZ B;  4W9E A;  1WJ4 A;  2M8S A;  3N1Z C;  2LRW A;  2KWV B;  2KFK A;  5G5H A;  4BKS D;  1L2N A;  1UBI A;  1XT9 B;  2MW5 A;  2BYF A;  2N7D A;  2LJI A;  3SR6 A;  5FR3 A;  1L6V A;  3ML9 A;  1FNW A;  4M02 A;  5BYR A;  4IWO A;  1SF0 A;  2AQ3 B;  1YN5 A;  1QKZ A;  3H1U A;  3PGE A;  1ACC A;  2FCM A;  1H8C A;  5JZE B;  3DOW A;  3LYY A;  3ZXV A;  3RZF A;  1MVK A;  1GC6 A;  1TY2 A;  5LLI A;  1T0Y A;  4YL8 A;  3L13 A;  1C4A A;  2LEK A;  5C2T B;  3TBL D;  3RN9 C;  3CF6 E;  3BYY B;  2N7J A;  2JRI B;  2BYT A;  1WR6 E;  1E0Z A;  1U4A A;  2INC C;  3R2I A;  3FIL A;  2QCZ A;  3Q8A A;  5CX3 A;  1Y8R C;  2MJ3 A;  5DPS A;  1P7F A;  1V1O A;  3QWZ B;  3AMZ A;  4WJP A;  4ZDV A;  3AB5 A;  1E8W A;  2M1M A;  4EUT A;  4JWU C;  1PYW D;  2KDF B;  2LHE A;  4XWW A;  3R7Q A;  4MEM A;  1F2R C;  2DHZ A;  4NAW B;  4EZL A;  1DOY A;  4GSW A;  4ZHP A;  4HJG E;  1UZX B;  2L05 A;  4LLG M;  5GMV A;  2MBH A;  3W9C B;  1NEN B;  4RMA A;  1AN8 A;  3I57 A;  3O13 A;  2WDR B;  4HK2 A;  1L0Y B;  1VD2 A;  4ZHO A;  1YOV B;  1UGM A;  1NDD A;  3RNG C;  2VZK B;  4ARC A;  3Q3M C;  3RYT A;  4OHJ A;  2UYZ B;  2HJ1 A;  1MJD A;  3QJZ A;  5IA7 A;  5MPO A;  1KRH A;  1SE4 A;  2KAC A;  2Y5C A;  2W9N A;  1PDX A;  3DWG C;  1FXI A;  5IO9 A;  5DPW A;  3ZLZ A;  1WE6 A;  2WXQ A;  3NVZ A;  2KMC A;  2IGD A;  3HVZ A;  1SIJ A;  1E5W A;  3W1Y A;  4KDL B;  2ZNV B;  4HWI B;  2FAZ A;  2KWC A;  3SD5 A;  2MJD A;  2GI9 A;  4W9J A;  3AE4 B;  4FA6 A;  1C4C A;  1WRI A;  1WXM A;  3D32 A;  4XWT A;  1H4R A;  4L2Y A;  3NS8 A;  3Q3O C;  3IXS A;  4ICU A;  1ET9 A;  3SHQ A;  3WAN A;  3NZ3 A;  4DXF A;  3MC0 B;  1KLU D;  2J42 A;  3P4P B;  2PE6 B;  3AEG B;  5AUI A;  2KO3 A;  1R4M I;  3Q3F A;  3ZIM A;  2KLG A;  5EE1 A;  3M3J A;  4KGS A;  4WJN A;  1V81 A;  1WGK A;  2L76 A;  1WX8 A;  3ONS A;  2BPS A;  1F0Z A;  4HRS A;  2JX5 A;  3IAS 1;  4HLE A;  2KDI A;  2K1F A;  4S0R A;  3K9P B;  4EOY A;  3DBR B;  3IVF A;  3B08 A;  1I4X A;  1JAL A;  1C3T A;  1NI3 A;  1P0R A;  4FAD A;  5HFY A;  3A9J B;  1V97 A;  1GB4 A;  3A1Q A;  3GS2 A;  3BVM A;  5HHD G;  1OGW A;  2V0G A;  1SBB B;  2MP2 A;  1RYJ A;  1YD8 U;  1EU3 A;  4HPP A;  4ITK A;  4W9L A;  4WUR A;  2W54 A;  4JQW C;  3ZRF A;  1XLN A;  1AYF A;  1FFU A;  3LDZ E;  1E8Z A;  4W9I A;  1TYG B;  2JVC A;  3HVD A;  1GJZ A;  2XEW A;  1WM2 A;  1UH6 A;  2EKE C;  2N0S B;  4IM0 A;  4LNN A;  2WP9 B;  4GLS C;  1NVI D;  4KIK B;  3O65 B;  3RNF C;  5AUK A;  2CHW A;  2K5P A;  1WZ0 A;  4HPL B;  1EF1 A;  1ZE3 D;  2BYV E;  4WAF A;  4II3 B;  4B6W A;  4II2 B;  4KZC A;  3KUC B;  2J0K A;  4JL9 A;  3ETR A;  2IDY A;  3ZTD A;  2FIF A;  2ONQ A;  2KQ4 X;  4F7Z A;  4GGQ A;  2BS2 B;  4KGR A;  4BZA A;  4DXG A;  2KD0 A;  1D5M C;  2HTH A;  3W5U B;  4RGO S;  2W55 A;  2YVC A;  2V3N A;  1KLG D;  2WXF A;  1E8Y A;  4ZOH C;  2HTM E;  2H89 B;  3OG5 A;  1WX9 A;  4EEW A;  3JW0 X;  1GC7 A;  2D11 A;  4R3D A;  1DOX A;  3RPF C;  1BXT A;  1QOA A;  2SEB D;  4KX6 B;  1M94 A;  2SAK A;  1YJI A;  2W3S A;  1JWU D;  3A9J A;  4BOS C;  3SFE B;  1VRA B;  3Q6B A;  2LMC A;  3PS6 A;  3MHS D;  4CO7 A;  4BVU C;  1X1M A;  3ZJT A;  2N9X A;  4PYZ A;  2CU1 A;  1F52 A;  1OQQ A;  2RDH A;  1D5X C;  4N9F 4;  1UNS A;  2NPT B;  2ZVO A;  3PVL A;  2K8H A;  2BBC A;  2REX A;  3U7D A;  1KH0 A;  5CHV C;  3ZQ4 A;  4HDO A;  2M0A A;  2C7N B;  4OZC A;  2L0T A;  4DHZ E;  2WX0 A;  4C7Y A;  3ZJV A;  4ZRJ A;  5EE0 A;  3HM6 X;  4JLC A;  1J7B A;  4H2A A;  1T5X D;  4ZRI A;  1K51 A;  2NS5 A;  3KLS X;  3RUI B;  3LB8 C;  2PEA A;  4I6N B;  4DHJ D;  1IGD A;  2Y3A A;  1FIQ A;  3ZNI D;  1Q1O A;  3ALB A;  4ANW A;  1HE8 A;  4JGH B;  3RI7 C;  1JCK B;  3X23 A;  3L0W B;  2DYO A;  1SEB D;  2FCS A;  3L08 A;  3QC8 B;  2VRR B;  2K0P A;  3WIM A;  1V5T A;  3QAR A;  4HCN B;  2KDM A;  1GNU A;  3ZO5 B;  1LFD A;  1WY8 A;  3A1Q B;  1YQ3 B;  3NY5 A;  1YMH E;  2A4Z A;  4ZYS A;  1WR1 A;  2V4L A;  2Z0E B;  1WI0 A;  1NBF C;  2MBO A;  4F8C B;  3PZD A;  1QOG A;  2I2Y A;  2DZI A;  2V3S A;  2MBE A;  3AE2 B;  3V60 A;  2KMA A;  2KQS A;  1WGH A;  1P7E A;  2K8B A;  2WDV B;  5GXG B;  3N32 A;  3APC A;  1R4M B;  4MGK E;  3DBR I;  3VUX A;  4LTU A;  1V5O A;  3ML8 A;  5C3J B;  3RCZ A;  3FC4 A;  1K8R B;  2O6V B;  3T8M A;  3U2S C;  4AJW A;  1UWX A;  3QAQ A;  3OLM D;  1TBE A;  3KH0 A;  2KVZ A;  2J0M A;  5LXH A;  2B76 B;  1GAQ B;  2LVP A;  2GMI C;  2ZW0 A;  3N9Y C;  4GMV A;  2JWZ A;  3V6E B;  2MQJ A;  4QAY A;  1QF6 A;  3AUL A;  1C9F A;  5D7G A;  3A4S C;  3PV1 A;  3WAM A;  5TR5 A;  1VCB A;  1ROE A;  4C4V B;  3CST A;  2L7R A;  1RFK A;  5HI1 A;  3H7P A;  1I4P A;  4A90 A;  1WMH A;  2KX0 A;  4MJS A;  4NAM A;  2W82 A;  1F9J A;  4RM9 A;  1C1Y B;  2Q5W D;  2ZZP B;  1FO4 A;  1GUA B;  2AQ1 B;  2BT6 A;  4K7U A;  1XCT L;  2C5L C;  4W9G A;  4W9D A;  1IYF A;  2FUG 1;  2GBK A;  1WRD B;  4HXD A;  3PZ7 A;  3VH4 B;  1J0G A;  2HD5 B;  4IUM B;  4K1R B;  4MEL A;  1GPX A;  2GBN A;  1KLV A;  2BGF A;  2KLC A;  1EM7 A;  1SJE D;  1WJU A;  3W1S A;  1ZDV A;  2D07 B;  1JRP A;  4DXA B;  2WWZ A;  2KQ7 A;  1XO3 A;  1ZKH A;  5EDS A;  3QCA A;  1SB3 C;  4RGM A;  4KKI A;  4M00 A;  5DPT A;  3C19 A;  3AXC A;  2OHF A;  1XQQ A;  3H7P B;  2ZVN A;  2JF5 A;  2EEL A;  4J6I A;  4WWP A;  1TKE A;  3VHT C;  2PMV A;  2MRP A;  1LQB A;  3TEW A;  2PW9 A;  4BKT A;  4MM3 A;  5D2M B;  4G11 A;  3M63 B;  3TEZ A;  3GZN B;  4YXD B;  2KAJ A;  2DLB A;  4REZ A;  2JPH A;  2KX3 A;  2L83 A;  1V80 A;  2IY0 B;  3DBL I;  4NJ7 A;  3PSE B;  2MCN B;  2RPV A;  3NG0 A;  2RD0 A;  2BB5 A;  4TQ1 A;  2WHI A;  2WGS A;  3C8Y A;  1P98 A;  3RNC C;  2JWU A;  5BO4 B;  2KC1 A;  4HCP B;  2KTR B;  1D5Z C;  3I63 C;  2BQQ A;  4WH4 A;  5E6N A;  1TS5 A;  4MGZ E;  4PK1 A;  1EO6 A;  3UGB B;  5DCN A;  2WXR A;  2XBB C;  1C79 A;  1WFY A;  1EU4 A;  1WGG A;  2EMS A;  2WU2 B;  5KHO A;  2C60 A;  2WYQ A;  3AE1 B;  1TKY A;  1SIF A;  2G3Q B;  4P1B C;  3QA8 A;  4XGA B;  2BWF A;  5G2N A;  3UIN B;  3EFC A;  3OWE B;  4BKS A;  4BKG A;  2CR5 A;  2KAN A;  1WMH B;  2DYM A;  5T8I A;  2VH2 A;  1Z5S B;  4WJO A;  5L83 A;  4GU2 A;  4M0W A;  1PGX A;  1T0R C;  1WIA A;  4AS1 A;  2MHJ A;  4USA A;  2IGG A;  2WU5 B;  2JQR B;  2K22 A;  3V61 A;  3HM3 A;  1WJN A;  2ZCB A;  1VZ6 A;  1CQV A;  2ZW1 A;  4A6Q A;  2LGS A;  5BYQ A;  3N3K B;  2MWS B;  1JWB D;  3AEC B;  2E6X A;  3EFU A;  1KM7 A;  3VVW B;  3P63 A;  3AM9 A;  4NNJ B;  1I42 A;  4LNK A;  1VLB A;  4OVV A;  1VJK A;  2WLB A;  3GP7 A;  3ZTC A;  3EGR A;  4FHK A;  4DK5 A;  3N1X C;  2D3B A;  4RGT A;  2QC8 A;  3N20 C;  3I3T B;  3DBH B;  2MBQ A;  1WXS A;  4CHK A;  2DNF A;  3IT6 B;  3RT3 B;  1JWS D;  4OVZ A;  3QHT A;  2K6Q A;  3BK1 A;  3IAM 1;  4MSM B;  2QMT A;  4IWP A;  4OW0 A;  4DDI D;  1RAX A;  1V2Y A;  3ABV B;  3E9S A;  2XK5 A;  2NBV B;  1IUE A;  4WWM A;  2LXC A;  3APF A;  2ZEQ A;  3N1Y C;  3WA0 A;  1WWT A;  2IBI B;  3WAL A;  3AU5 A;  2NBW B;  4HVB A;  2RMM A;  3PRP B;  2QDF A;  2RDB C;  2N9E B;  2PTL A;  3W5V B;  2AYO B;  1IBX B;  2O6V D;  4TSS A;  3JSV A;  1ESF A;  2KC2 A;  3AE8 B;  3FIL B;  3KQ4 A;  2IY1 B;  2WXM A;  2E3T A;  4RF1 A;  3MJW A;  1UGJ A;  2LGD A;  4FJZ A;  1TS3 A;  2JRH A;  1BT0 A;  2MH7 A;  4FUL A;  1WGD A;  2GBM A;  4GB9 A;  3H9D A;  2WX1 A;  2MEK A;  4K7S A;  3NOB A;  3IHP C;  3TCA A;  1C78 A;  1OQY A;  1A5R A;  4K3C A;  4GDK A;  1DOI A;  3P1M A;  1LXD A;  2CU3 A;  3WCQ A;  1YJ1 A;  3BK2 A;  5EE3 A;  3R2T A;  2DWQ A;  3QIJ A;  2NTS A;  4BAX A;  1I35 A;  2J7Q B;  3EEC A;  4KKJ A;  1I4H A;  2NVU I;  1WSP A;  2IJ0 A;  4WQO B;  2D2Q A;  3AE7 B;  3BVZ A;  2MX2 A;  4RCO A;  2Y5P A;  2J0J A;  3VRB B;  1N5W A;  2CHZ A;  3CIR B;  2UWQ A;  2FUH B;  4FJV B;  3ZUN A;  3MC9 A;  1FRD A;  3APD A;  3VUW A;  1J7A A;  4F1S A;  3NZU A;  4DWF A;  2GBR A;  1WJ6 A;  2JXX A;  1DYQ A;  4G0N B;  3KW5 B;  1XF5 L;  2L32 A;  2KWU B;  1CK1 A;  1TJE A;  4IG7 B;  3DBL B;  4C00 A;  4K3B A;  3R3M A;  3NVY A;  1FM0 D;  3FKY A;  4WJQ A;  2JU6 X;  2IZV B;  1ZW7 A;  1V8C A;  2WXJ A;  4B0E A;  4OVU A;  1TZ1 A;  5EE9 A;  1PQS A;  2TSS A;  3HHM A;  2FBW B;  2M56 B;  3NHE B;  2V9H A;  3K9O B;  3VFK A;  3NS1 A;  2LHD A;  5CHF A;  1G6J A;  3RUL A;  2K6D B;  3M95 A;  1FNU A;  2LGX A;  4BBN C;  4ZYN A;  2JYT A;  2ON8 A;  5JXV A;  4W9C A;  1QLB B;  2YEP B;  1OTR B;  4C56 C;  3PTF C;  3RNB C;  4LCD E;  1FNV A;  1DGJ A;  1N60 A;  3IG3 A;  1WXV A;  2KT7 A;  4KGT A;  3RFZ B;  2M17 A;  1EUV B;  2Y5B B;  2BKR B;  4GN1 A;  3DVN U;  2ZPN A;  4K81 A;  3S2A A;  2BF8 B;  2DZJ A;  2KTF A;  2AX5 A;  3SEB A;  3AEA B;  4AOF A;  1ZDX A;  2JZZ A;  2KJR A;  3Q69 A;  4NZL B;  1OEY A;  3Q3J A;  4HKQ A;  1N62 A;  4NQL B;  1S1Q B;  2JYE A;  1JWA D;  3DCG A;  4LDT B;  2L52 A;  2KN5 A;  4ICV A;  2GRI A;  2PE9 A;  4HRO A;  1K53 A;  1T0S C;  5IOI A;  4RH6 A;  1MI0 A;  2LAS A;  2LXA A;  1EWY C;  3PO0 A;  2O2V A;  2WXK A;  4LJP B;  3VUY A;  5TSS A;  2KDE B;  1KJT A;  1L4Z B;  1QOF A;  3EC8 A;  3LJ3 A;  1PGA A;  5H92 C;  1Z2M A;  3WAO A;  1HZ5 A;  2LFI A;  2N1V A;  4PYU A;  1ZOY B;  3AE5 B;  4XC2 A;  3DBS A;  1SSN A;  2CJN A;  1FD6 A;  1C77 A;  4N58 A;  4W9H A;  2R61 A;  1P1A A;  1HA5 A;  2LGI A;  4AUQ C;  2BW2 A;  2FE8 A;  3HRD D;  1AWD A;  4A9A A;  2D3C A;  2JSV X;  3ZXR A;  2LVQ A;  3H8H A;  1T6B X;  3V3X A;  2V1Y A;  1F1H A;  1UF0 A;  4P16 A;  1E9M A;  4I6P A;  4URK A;  2G1E A;  4JPS A;  5J18 A;  4XDD A;  4DHZ B;  4DDG D;  3JVZ X;  3DVN V;  3GZN I;  4WIP A;  3MP9 A;  4BOZ B;  2KJH B;  3JYU A;  3B2G A;  3P4R B;  2WXH A;  3ZJU A;  2AWT A;  3RNE C;  4ZRK A; 
#chains in the Genus database with same CATH homology
 5IOI A;  1MJD A;  2DNF A;  1MFW A;  2BQQ A;  5IO9 A;  5IKC M;  5IP4 D;  1MG4 A;  1UF0 A;  5IN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...