2EKEC

Structure of a sumo-binding-motif mimic bound to smt3p-ubc9p: conservation of a noncovalent ubiquitin-like protein-e2 complex as a platform for selective interactions within a sumo pathway
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
DPLVPRGSEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SUMO-conjugating enzyme UBC9
publication title Structure of a SUMO-binding-motif Mimic Bound to Smt3p-Ubc9p: Conservation of a Non-covalent Ubiquitin-like Protein-E2 Complex as a Platform for Selective Interactions within a SUMO Pathway
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase/protein binding
total genus 18
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ekeC01
2K1FA 2KK8A 3QX1A 4FBJB 5C23A 2G4DB 3WAOA 3A9JB 2K8HA 5CX3A 5DPTA 2JZZA 2A4ZA 3AU5A 2NS5A 2KTFA 2GMIC 3HM6X 5C1ZA 4IWOA 1Q5WB 1V5TA 4ZDVA 4BKSD 4F1SA 4K7SA 4K81A 2ZZPB 2K25A 3MHSD 2BWES 4KDLB 3ML9A 2J0JA 3VUXA 3B1LX 1WJ6A 2MBBB 4P7IA 4WAAA 3APDA 4EZKA 5LXHA 2A5UA 2LUEA 4N9F4 4GB9A 2BYEA 4NQKE 2ZNVB 1QZEA 1V6EA 2KWUB 4GDKB 2K8BA 2D11A 2LVOA 4G50A 1XT9B 4MEMA 4BOSC 3L16A 1EF5A 3UQAA 2ZCCA 3IVFA 5L95C 4WWNA 3ZDTA 4DWFA 3QCAA 4W9CA 4DHJB 2RD0A 3P2BA 2JUOA 2KDFB 2RR9A 3APCA 4DHJD 4ZRIA 2LRWA 2ZVOA 2IO3B 2DX5B 2NR2A 3DDCB 4NAWA 3TL5A 2C5LC 3DVGX 1I35A 2IO1B 3VQIA 1G6JA 2CS4A 3Q3JA 2DZKA 5CTRC 2LD9A 1UZXB 5LXIB 3WA0A 1L7YA 2MCNB 2L05A 3OAWA 2LVQA 3WALA 4ANUA 5EDSA 2KN5A 3CF6E 3T9LA 1WJNA 3N32A 5BO4B 2FUHB 3AXCA 1WJ4A 3DOWA 2AL6A 2PEAA 2GBKA 1E7VA 2XK5A 4GIVA 1J8CA 3L0WB 4F7ZA 3ONSA 1WFYA 1OEYJ 3AI5A 2FAZA 1WH3A 2WX0A 2BYFA 2O2VA 2ZPNA 4W9EA 2MQJA 4ZRJA 4OVVA 3ZTDA 2MBHA 2MW5A 3ZO5B 2M0XA 4TV3A 3QARA 1WZ0A 4DHZB 4GDLB 4PYZA 2RSUA 3HM3A 1WXAA 4TKNA 2GOWA 4IWQA 3A1QB 2C7NB 2KMAA 2LVPA 3VXWA 2EMTA 4IM2A 3RYTA 1VCBA 1E8XA 1GUAB 3EC8A 2IBIB 1WGDA 4K1RB 2L7RA 2M1MA 1RFAA 1GC7A 5E6NA 4A20A 2JZ3B 2LRUA 3RZFA 1V49A 3KUDB 2B3AA 2MSED 2FIFA 3PTFC 2LASA 3BY4B 3K9PB 2ZJDA 5DCNA 3S2AA 3QQ8B 4IG7B 4W9DA 1P1AA 2MWSB 1S3SG 1V9JA 1KM7A 2N9PC 1C3TA 5D2MB 4HJKA 3ZNID 4MM3A 1X1MA 2BF8B 4MGZE 5CHFA 5IAAC 2HTHA 2LGXA 4JGHB 2BYVE 4K7UA 4FN2A 2IY0B 3JVZX 1YQBA 5D94A 3T8MA 2C7MB 1GNUA 2JXXA 5J17A 3VH4B 2KTRA 3MTNB 3I3TB 2VRRB 4KZ0A 4K7WA 1WXMA 2L3ZA 4HCNB 2GBRA 4EKUA 2FCSA 1E8YA 1WRDB 3WANA 2W9NA 3ZUNA 2C9WB 1LQBA 2N7EA 3VUYA 3HHMA 1SE9A 4BKTA 2JRHA 3UINB 5IA7A 3UIOB 3PVLA 1V2YA 4IWPA 4BKGA 3QK0A 4NAWB 3O65B 4FHJA 1WX7A 2D10A 3SDLC 2PJHA 1YJ1A 2NBVB 4DHZE 2M17A 3HK0A 4FADA 4ANXA 3CMMB 4RMAA 3U30A 2JY6A 3PHWB 2DENB 2WX1A 4E3CA 1OGWA 1I42A 3R3MA 4I6NB 5AZFA 2M8SA 2G45B 2GBJA 5AZHA 2KFJA 3VTVA 2L0TA 2XK5B 3PV1A 4J6IA 4M0WB 3DVNU 2L8JA 2ZCBA 2JT4B 1GG3A 2MBQA 3Q3FA 2K8CA 2EMSA 3GZNI 3IG3A 4WJOA 2BPSA 2LI5A 3DVNV 4MGKE 4W9GA 2O2VB 1UBIA 1ZGUB 2KX0A 2N1WA 1KLVA 5E6OA 4WJQA 4KIKA 2FNJB 2D3GA 3PZDA 1WGYA 2N9XA 2NBWB 3PHXB 2D2QA 4NPNA 1E7UA 4WJPA 2N9EB 1P98A 3EECA 4W9HA 2ASQA 4KVGB 3U8ZA 2GBNA 1WGHA 1TGZB 1CMXB 2FCQA 5TR5A 1Q0WB 2PE6B 2Z0EB 4JIOU 5KHQA 1P0RA 1H4RA 3RZWC 3W1SC 2WYQA 4BFRA 2QHOA 1KJTA 3VFKA 2JVCA 3H7PA 1M94A 1MG8A 2IO0B 1AARA 2KNBA 3LJ3A 1R4NI 4IW0A 3VDZA 1GC6A 3DBSA 5HKHA 2CHXA 4AWJA 4CO7A 1YX5B 3TIXA 3VTUA 3ZTCA 2MP2A 1T0YA 2N7DA 2DZMA 2EKEC 4PYUA 5FR6A 4W9JA 2KZRA 2FCMA 4M8MA 2ZVNA 2Z59B 4W9KA 5G55A 3OJ4B 1ISNA 4TUUA 2AWTA 1YIWA 3JSVA 4W9LA 1P9DU 2KC1A 1LM8B 2KDBA 3ZNZB 3ZKJC 2AEHA 2JPHA 2KFKA 3NOBA 1WGRA 1WR6E 3H7SA 4OVUA 4DXAB 3W1SA 2NPTA 5JHBA 2YLMA 3H9DA 2KHWB 4PS3A 1WIAA 4FJZA 2KTRB 3DBRI 3PT2B 1P3QU 2KANA 2KX3A 3VHTC 5AEKB 4PS7A 2K6QA 3IHPC 1J19A 2C60A 1GJZA 4W9IA 3DBHI 2I1JA 4FJVB 5AZGA 1HE8A 3W1YA 1WJUA 2JF5A 2C7HA 4NJ6A 4MJSA 3SD5A 2D07B 3A9KA 3H6NA 4GN1A 1WGGA 2YVCA 4RM8A 1Z5SB 1WYWB 2XEWA 2AL3A 3PLUA 1Y8RC 5CHVC 4GXBA 1EF1A 3DVGY 4BOZB 4EOYA 4TQ0A 4EZJA 2KKCA 3QJZA 3ENEA 4GSWA 1IYFA 3PRZA 2CHZA 3L54A 2XBBC 5L83A 3ALBA 3UGBB 2KXJA 2PPHA 2NBUA 2KVRA 3UQBA 1WE6A 4G0NB 1NI2A 2NVUI 4HPMB 4AJWA 3HIZA 2IZVB 2I1KA 1ZKHA 1Q1OA 1OTRB 2KDEB 3U7DA 1UELA 1UH6A 2BKFA 4ZRKA 4F8CB 2Y5BB 3IFWB 2JWZA 3WAPA 3AULA 4BBNC 4HLEA 1LXDA 2PE9A 2GBMA 3CSFA 2L00B 4ANVA 2MX2A 3M3JA 1UGMA 2Z0DB 4GGQA 5J2RA 3R7QA 1IP9A 1JRUA 3M62B 4WWOA 4KZCA 4DK5A 1WXSA 4KIKB 2MBOA 2G3QB 2KDIA 3RT3B 2NCNA 1WM3A 4CHKA 4G3XB 4ICUA 3KUCB 4II2B 1RRBA 2R2QA 4B6WA 3QAQA 3L08A 4LJPB 4NY0A 4TQ1A 2IYDB 4XC2A 3SU8X 4FHKA 3GOEA 3H7PB 4ASWC 4AUQC 3TBLD 5LLIA 3H1UA 4JL9A 5E6PA 3QHTA 2OJRA 4PS8A 2JRIB 3SHQA 1EO6A 3QC8B 2KQ7A 3QA8A 4MELA 2J7QB 2KMCA 2LGDA 2MP2B 2O6VA 1R4MI 4WJNA 2KOXA 3A33B 1WI0A 4I6LB 4XZ4A 3RCZA 2LXAA 3ZIMA 2MA9B 3TMPB 4ZYNA 4BBNF 2KJRA 2LZ6A 3PGEA 3A4SC 4NJ7A 4B9KA 3UF8A 3NZUA 1UD7A 1E8ZA 3IBEA 3OLMD 3R7RA 1H8CA 1SGHA 3ECIA 2J0KA 2KLGA 3C0RB 2UYZB 3JSVB 4JLCA 1C1YB 4AP4C 4G11A 3VVWB 4IC7B 3EFUA 1WX9A 1Z2MA 4E74A 3UIPB 1XQQA 4X57B 4AOFA 3R66C 2KFKB 5CHWA 1WR1A 2NPTB 4RM9A 3M95A 2FIDA 1IPGA 1LFDA 3ZNHB 3RULA 3JW0X 3V6EB 2CHWA 2K6DB 4DDGD 3V60A 3B08A 5GMVA 2KJHB 3M63B 2HE7A 3D32A 1WE7A 3K9OB 4URKA 1L2NA 3ZLZA 2DYMA 3KUZA 2DYBA 2LWPA 1WY8A 1V5OA 3JYUA 4MJSB 3A9KB 3ZRCA 5DPWA 1NDDA 3DBLI 3QWZB 4MDKE 4FA6A 4HPLB 1D3ZA 2KC2A 5KHOA 4W9FA 2N4FA 3KYDD 1E90A 3BINA 4LDTB 2ZNVC 3KH0A 3NZSA 4CYEA 5D7GA 4WQOB 1WMHA 4HDQA 2CR5A 2J0MA 2MRPA 1E8WA 4LDTD 2G4SA 5J18A 3CSTA 4AJYB 4DBGA 2DAFA 1V86A 5G2NA 3A9JA 3PSEB 3DPDA 4BKSA 4MGYE 3VAWA 4KSLC 1FXTB 3OJ3A 2V3SA 2CU1A 2LJ5A 3PS6A 4WWPA 2WWZA 3X23A 3V61A 3ZDMC 3VTWA 4EFOA 5JZEB 4I6PA 4IM3A 2KWVB 2HJ8A 4EZLA 4JQWC 3WAMA 1PQSA 4FJYA 3NS8A 1S1QB 3V6CB 2DAJA 5JHAA 3WIMA 3EHVA 4MGIE 2WDTB 2RPQA 1V80A 4HDOA 2DZJA 4GDKA 4HXDA 2V4LA 3V62A 1OQYA 3ZRFA 4E71A 1WZ3A 2FCNA 4B95A 1K8RB 1RAXA 1WXVA 2IY1B 2KJ6A 2L0FA 2LGYA 4MSMB 3TJPA 2N1VA 2LXCA 4GMVA 2BKRB 3PREA 4NQLB 2OOBB 1TBEA 4MSQB 4IM0A 1WX8A 3L17A 2KLCA 2KWCA 2O6VB 2REXA 3ZVVA 1E5WA 1ZW7A 2ZEQA 3KVFB 4KSKC 2O6VD 2KQSA 5JH5C 3MJWA 5DPSA 3RUIB 4II3B 3L10B 2R2OA 3B0AA 3KW5B 1F9JA 1YD8U 2HD5B 2RGFA 3A4RA 2UWQA 1WM2A 4YL8A 3TCAA 4A3PA 1UBQA 1BT0A 4BVUC 3NY5A 4EEWA 2BWFA 4HCPB 3LDZE 1XD3B 3X0WA 2DZIA 3PRMB 4HWIB 4M8NA 2M4NA 4HVBA 1EUVB 3RD2A 2IO2B 3PRPB 1NBFC 4GOCA 2DYOA 3AU4A 3L13A 5D6JB 3APFA 4LCDE 4ANWA 2DHZA 2V1YA 4FULA 1WF9A 2L76A 2ZPYA 3VH3B 3ML8A 4KV2A 2CKHB 4MH0E 1U4AA 1VD2A 2MLBA 2MBEA 4IUMB 1TTNA 1OEYA 4GDLA 4XX5A 4LJOB 1SIFA 4EUTA 3DQVA 4ICVA 1RLFA 3A1QA 2K39A 1J0GA 3KYCD 3QIJA 3PLVA 4A3OA 1YX6B 4DDID 2AYOB 2KO3A 3DCGA 4HK2A 1KOTA 3VUWA 2BGFA 3N3KB 3PPAA 5DPRA 4FLHA 3N30A 1A5RA 4KDIC 1WMHB 4NNJB 1TZ1A 2KD0A 1V81A 4GU2A 3NHEB 3ZW3A 3ZNGC
chains in the Genus database with same CATH superfamily
2K1FA 3QX1A 2INPE 3P42A 2A4ZA 1XO3A 2N9LA 3HM6X 4ZDVA 1K52A 1KH0A 1NVID 1OQQA 4K81A 2D3AA 3B1LX 1WJ6A 1MHXA 3B9JA 2BYTA 4GDKB 2K8BA 2WU2B 3L16A 1IBXA 3ZDTA 4DWFA 2WQYB 1FXAA 4W9CA 4DHJB 3APCA 2QC8A 3TEZA 4MACA 2LRWA 3NUHB 1VZ8A 1L0YB 2KMMA 2NR2A 3DDCB 2CJNA 4NAWA 2C5LC 3VQIA 2CS4A 3Q3JA 1JROA 1BUIC 3AEBB 1YQ3B 1ENFA 5EDSA 5BYQA 3T9LA 2FUHB 3AXCA 1WJ4A 5LNK1 1XEEA 2AL6A 2YEPF 1ZDXA 3BVGA 2LEKA 1MJDA 2XK5A 4GIVA 4RH6A 1RYJA 3LB8C 1OEYJ 1XXGA 1WXQA 1F0ZA 4C7YA 1MI0A 1WH3A 4W9EA 4ZRJA 1YMHE 1SEBD 2M0XA 2PIAA 4PYZA 3SEBA 2RSUA 1WXAA 2VH2A 3A1QB 2LVPA 2SAKA 1KLGD 2INCC 1K51A 2IPKD 4DXFA 3RYTA 1E8XA 2Y5CA 1GUAB 2WLBA 2IBIB 2M1MA 1YN3A 3NRZA 1CQVA 5E6NA 1QQRA 1FNUA 2JZ3B 1JCKB 2LRUA 2KAJA 1V49A 1SSNA 2LASA 3QQ8B 4IG7B 3FAHA 2MWSB 2X8XX 1C3TA 4WURA 3EUB2 4AQ7A 4DXGA 2ICIA 4MGZE 2HTHA 2BB5A 4FN2A 3JVZX 1YQBA 5D94A 3T8MA 1GNUA 2PW9A 2G9HD 4K7WA 2GBRA 3T3OA 2VZKD 2C9WB 3VUYA 1ZDVA 1SE9A 1AYFA 1TYGB 2WXGA 5IA7A 4L2YA 3QK0A 4HKQA 1YJ1A 3HK0A 1YJJA 1E0ZA 4RMAA 2DENB 1NI3A 3I9V1 2YEPB 1KLUD 2V0GA 4BAXA 4EE2A 2INDC 5MPOA 4R3DA 2IGDA 2EKIA 2MBQA 2WXHA 3GZNB 1J7AA 2K8CA 2EMSA 4WJOA 2LI5A 3CWIA 2KX0A 1KLVA 4WJQA 2FNJB 2D3GA 3PZDA 2N9XA 2D2QA 1E7UA 2N9EB 3EECA 2NTTA 4W9HA 3U8ZA 2FCQA 1Q0WB 1P0RA 2WYQA 4BFRA 3VFKA 2WXJA 1R4NI 3DBSA 2FE8A 4CO7A 1D5MC 3R2IA 2MP2A 4K3CA 1SJHD 2EKEC 1L0XB 5FR6A 2KZRA 4M8MA 3OJ4B 1ISNA 1QOAA 2AQ2B 1LO5D 3TUOA 2QJLA 1J7BA 1C4CA 3P4QB 1YOVB 3ZNZB 3R2TA 2KFKA 1WGRA 3DHGC 4OVUA 2NPTA 1D5ZC 5JHBA 2KHWB 4FJZA 2KTRB 3DBRI 4WH4A 3RMKC 3BK2A 1J19A 5AUKA 1GJZA 5AZGA 1IUEA 2C7HA 4WIPA 2D07B 2WXRA 3E56A 1WGGA 1Z5SB 1WSPA 5CHVC 4TQ0A 2KKCA 3AE2B 3L54A 2XBBC 3ALBA 2KVRA 2Z8LA 2IZVB 1OTRB 3ZXRA 1UELA 3WAPA 4HLEA 3CSFA 3M3JA 3L4PA 3WCQA 4DK5A 1WXSA 2MBOA 4A90A 4P16A 2WDQB 2W82A 4OZAA 3MC9A 1QOGA 5BYSA 2QDFA 1SXTA 4AUQC 3TBLD 5LLIA 1FIQA 4JL9A 2KQ7A 4MELA 1R4MB 2O6VA 2KOXA 1ZXHA 3U52E 1UD7A 3R7RA 1JMLA 3JSVB 3B2FA 1LGRA 3EFUA 1XQQA 1D5XC 4AOFA 3U4EG 5CHWA 3ZNHB 3TEXA 1F2RI 4DDGD 3SFDB 2HE7A 4KGSA 3D32A 1C4PA 1WE7A 1ZXIA 2G1EA 3NVZA 1WY8A 1C9FA 3DBLI 2D3CA 3RI7C 1VJKA 4LDTB 3KH0A 3NZSA 4CYEA 5D7GA 4HDQA 4GLSC 3CSTA 4DBGA 1V86A 4HPPA 3V3XA 3A9JA 1SIJA 3P1MA 4MGYE 3VAWA 3P4SB 4KSLC 2LHEA 3Q3MC 2LJ5A 2WWZA 3V61A 3VTWA 3W2DA 2HJ8A 1HTQA 2WS3B 3V6CB 2DAJA 1TT5B 1FPYA 1XCQL 4HDOA 1FCLA 4HXDA 1OQYA 3DWGC 1WZ3A 4B95A 3N1XC 1N60A 1ZP0B 4MSMB 2LGYA 3KLSX 4M02A 2LXCA 4C56C 3I57A 4LNNA 1JW9D 3FILB 1TBEA 4MSQB 4IM0A 1XLOA 3L17A 3VRBB 3C8YA 2DLBA 3IAS1 2IDYA 1ZW7A 4XYCA 3EGRA 3MJWA 3RUIB 3L10B 2RGFA 4NJCA 4OZBA 4HWIB 3W9CB 2M4NA 4HVBA 3RD2A 2DYOA 3AU4A 2NMQA 5D6JB 2LGSA 1HTOA 3GP7A 4LNIA 3ML8A 3BK1A 4KV2A 3UI3A 1VD2A 1JWBD 1JWSD 1OEYA 4GDLA 4XX5A 2MEKA 3QIJA 1E9MA 3P4RB 2KO3A 2BGFA 2SEBD 3N3KB 1GB1A 5FK9C 4Q2JA 4D2KA 3BYYB 3N30A 1A5RA 3Q69A 2KK8A 2G4DB 2K8HA 2K22A 2W55A 3O13A 2KTFA 2GMIC 5C1ZA 1TIFA 4BKSD 4F1SA 4K7SA 3RNCC 1PYWD 2ZZPB 2BWES 2J0JA 1DYQA 1FXIA 1TZOA 2J4XA 3MHZA 2BT6A 1C76A 4GB9A 4XE0A 2KWUB 2D11A 4BOSC 5L95C 4WWNA 4YTMB 1TS2A 1FO4A 2RD0A 3P2BA 2JUOA 1WGKA 1TS5A 2KDFB 4RGMA 5T8IA 1ROEA 1I4RA 3DVGX 1I35A 2IO1B 3DHIC 2BW2A 5LXIB 3WA0A 1L7YA 3OAWA 2JU6X 2PKOA 1RM6C 3DOWA 4YXDB 1UNSA 1E7VA 1J8CA 4M0WA 3L0WB 3AI5A 3W5UB 3Q14C 2BYFA 1V1PA 2WXQA 2E3TA 2MW5A 3ZO5B 1TY2A 1ACCA 4S0RA 5BMGA 2GOWA 2GI9A 4IWQA 4DQOC 2EMTA 3KWVA 4P6VF 2RDGA 1VCBA 1MPEA 3AEDB 1HZ6A 2K5PA 4K1RB 1GC7A 5IO9A 4A20A 1CK1A 3AE6B 1T0SC 2MSED 3AN1A 3BY4B 2BBCA 4W9DA 3Q8FA 1JWUD 4HJKA 4MM3A 1PFDA 5CHFA 4JGHB 3Q3OC 4P1BC 4K7UA 2IY0B 2VH1A 2C7MB 2JXXA 2VRRB 1WXMA 4EKUA 4JWSC 4RGNA 1E8YA 1WRDB 3DHHC 2V3PA 1IBXB 2BB6A 2N7EA 3ABVB 3U2SC 1L6VA 2Q5WD 1JWMD 3UIOB 4IWPA 2IGGA 4NAWB 2V3NA 1EU3A 2WXIA 3T3NA 2NBVB 2M17A 4ANXA 3CMMB 2J42A 3U30A 3PHWB 3R3MA 3AEEB 2M8SA 3ZJTA 2G45B 3V05A 2KFJA 2XK5B 4J6IA 1AN8A 4C7ZA 4XWWA 3DVNU 2JQRB 2LJIA 1GG3A 3Q3FA 3GZNI 2BPSA 4MGKE 3DVNV 1NEKB 2LFIA 2OEDA 1ZGUB 3AH7A 3DWMA 4KIKA 2NBWB 4NPNA 1C4AA 1P98A 2ASQA 1I4XA 5IN7A 2DNFA 3N1ZC 4JIOU 5HI1A 1H4RA 3ZJUA 5J17A 1F2RC 1AARA 1I4QA 4IW0A 2W3RA 2WP9B 3N20C 1YX5B 3VTUA 1I4GA 2DZMA 3VR9B 2KACA 5G55A 5AUIA 1TKEA 1JQ4A 4XDDA 2B76B 2BS3B 4LNKA 4W9LA 1P9DU 2KC1A 4K3BA 2KDBA 3ZKJC 3BYTB 3NOBA 1WR6E 4DXAB 3RNAC 1J7CA 3H9DA 4ZRPA 3FKYA 2V4IB 4PS7A 2K6QA 2C60A 3BVMA 2LGIA 2I1JA 2QMTA 4FJVB 1WJUA 2JF5A 3A9KA 2FUG1 4GN1A 2PTLA 4RM8A 3DVGY 4GSWA 3PRZA 4IDIA 3GB1A 1ZE3D 3LXFA 2PPHA 2NBUA 1F77A 1WE6A 1FMAD 4G0NB 2NVUI 3HIZA 1FM0D 2KDEB 3H8HA 2K0PA 1UH6A 2BKFA 1FFUA 4F8CB 2JWZA 4BBNC 2PE9A 2GBMA 3KWLA 2MX2A 1UGMA 2WDRB 4GGQA 2BQQA 3TEYA 1JRUA 1NYQA 4KGRA 4WWOA 2RDHA 4KKIA 2G3QB 2KDIA 2NCNA 1WM3A 4ICUA 2LMCA 3KUCB 4II2B 4B6WA 3L08A 4LJPB 1TS3A 4XC2A 2N0SB 5EE0A 1C78A 2WHIA 5E6PA 3SHQA 1EO6A 4N6EB 5HG2A 2J7QB 4A6QA 2MP2B 1R4MI 3TEWA 3HUIA 1WI0A 3ZIMA 2NTSA 4PK1A 4ZYNA 2KJRA 3PGEA 3A4SC 4NJ7A 3AE1B 4OW0A 4B9KA 3UF8A 2JYEA 1RFKA 2KLGA 3C0RB 4IC7B 3HRDD 2JSVX 3IT4B 1ET9A 4LLGM 3R66C 2KFKB 5I4DA 1MFWA 2NPTB 3IXSA 3ZYYX 1FD6A 3P4PB 3BIID 3JW0X 5GMVA 3M63B 5E6JA 1L2NA 3ZLZA 2AQ3B 3JYUA 4IKGA 3URYA 5DPWA 3I5JC 2RMMA 2N4FA 3BINA 1YQ4B 2WXFA 2WXPA 1WMHA 1N5WA 3MP9A 2J0MA 1E8WA 1PGXA 5J18A 4US8A 4AS1A 2X38A 3PSEB 3DPDA 4BKSA 3AMZA 4O1NA 1TJEA 2BTEA 2V3SA 4J3OD 2CU1A 3PS6A 4N59A 3ZDMC 5JZEB 1IGDA 2KWVB 4N58A 2MJDA 3IAM1 4LNOA 2TSSA 4LTUA 3EHVA 4KKJA 3N1YC 1SE2A 3V62A 4E71A 2EELA 2N1VA 2INNE 2BKRB 3PREA 3AM9A 2OOBB 1WX8A 1TS4A 2KWCA 2O6VB 3ZVVA 1E5WA 2ZEQA 3ZGZA 4JPSA 4KSKC 2R2OA 1F9JA 1VLBA 4RNAA 2UWQA 3TCAA 4BVUC 1UBQA 1BT0A 4EEWA 2H88B 1EM7A 4M8NA 3PRPB 4LCDE 1VDVA 2DHZA 4FULA 3VH3B 2L76A 2CKHB 4MH0E 2W54A 2MLBA 4IUMB 2AX5A 4ICVA 2K39A 1J0GA 3KYCD 1VZ6A 4A3OA 1YX6B 3DCGA 1XCTL 4FLHA 4C80A 3A9JB 1N5XA 2NS5A 1OFFA 4IWOA 1Q5WB 1V5TA 2M19A 4ZYSA 3RPFC 2K25A 3ML9A 2MBBB 1V1OA 2PMVA 3APDA 2GLSA 2I2YA 2LUEA 2PVGC 2ZNVB 1T0RC 2LVOA 1N6ZA 1XT9B 4G50A 4MEMA 1EF5A 3UQAA 2ZCCA 3RNFC 3BVZA 3QCAA 2R61A 4DHJD 3J9CA 4ZRIA 1A70A 2ZVOA 4B0MA 1G6JA 5CTRC 1UZXB 2L05A 4REZA 3WALA 2OJWA 5BMIA 2GBKA 3RNBC 2MJ3A 3Q8BA 3AE7B 1WFYA 1QOFA 3EFCA 3AE4B 1KF6B 2ZPNA 2O2VA 2MQJA 2KQ4X 1V97A 3ZTDA 1F52A 4TV3A 3QARA 4GDLB 3HVDA 3IT6B 4TKNA 2C7NB 2KMAA 3VXWA 4JWUC 3W5VB 2HDEA 4IM2A 1SF0A 4LK0M 3EC8A 2L7RA 2RDBC 3AEFB 3KQ4A 1N61A 3RZFA 2UU7A 2WXOA 1ZUD2 3KUDB 1C79A 1P7FA 2FIFA 3PTFC 3K9PB 3S2AA 4YSYB 3RN9C 1V9JA 1KM7A 5D2MB 3ZNID 1X1MA 1QLBB 2K3UA 3RNEC 2LGXA 2BYVE 1B9RA 2LUMA 3I3TB 4KZ0A 2VZKB 4P1CC 2L3ZA 4HCNB 5FKAC 3ZUNA 4BKTA 2JRHA 3PVLA 3GE3C 4BKGA 4WAFA 3O65B 4FHJA 2AQ1B 1WX7A 4DHZE 3VRAB 4FADA 2WX1A 1OGWA 1I42A 2HJ1A 4I6NB 2GBJA 1SB3C 1JALA 1SE3A 2PLPA 4L23A 3VTVA 1XLNA 4M0WB 2JT4B 4OZCA 3IG3A 4W9GA 1V1PB 4WJPA 3PHXB 4KVGB 1WGHA 1TGZB 2MJEA 3RZWC 3W1SC 1CZPA 1KJTA 5BMHA 3H7PA 1M94A 1MG8A 3Q8EA 1L5PA 2DBYA 3TIXA 1T0YA 4USAA 2KN4A 2ZVNA 1B1ZA 4ZHOA 2AWTA 1YIWA 4MM3B 5GXGB 4HRSA 2YLMA 1DGJA 1WIAA 5EE1A 3PT2B 1P3QU 4IOIE 5AEKB 1KFYB 3DBHB 5TSSA 1PDXA 4HEA1 2Y5PA 1N63A 4C4VB 1HE8A 3OG5A 4MJSA 3SD5A 2YVCA 2XEWA 1WYWB 2AL3A 4BOZB 1V8CA 3ETRA 4GXBA 1EF1A 4EOYA 3QJZA 1IYFA 2CHZA 3AE5B 5L83A 2QCZA 2KXJA 4KGTA 1P7EA 4YSXB 1ZOYB 4HPMB 1EWCA 1VR9A 1Q1OA 3MFGA 2ZW0A 3MJ5A 4ZRKA 2Y5BB 2GRIA 4ANVA 2Z0DB 1GPXA 1IP9A 2MH7A 4KIKB 4YSZB 3RT3B 4C4VA 1F1HA 4HROA 1UWXA 1RRBA 2R2QA 5IP4D 3QAQA 4NY0A 4TQ1A 4ZRQA 4ASWC 4FHKA 3Q6BA 3H1UA 2OJRA 2KMCA 1AW7A 1PGBA 2WXLA 3TMPB 2LZ6A 1E7PB 3NZUA 2E6XA 1E8ZA 4ZHPA 1DOXA 1H8CA 3ECIA 2J0KA 2UYZB 1L4DB 1C1YB 4G11A 3VVWB 1Z2MA 3UIPB 5HHDG 4X57B 4RM9A 3M95A 2KDMA 1IPGA 1C77A 1HEZE 2CHWA 2K6DB 4RFBA 2QEJC 4URKA 2K9XA 1DOIA 2ONQA 2DYMA 3KUZA 1RWSA 2DYBA 1V5OA 3A9KB 1NDDA 3QWZB 4FA6A 4HPLB 3KYDD 1E90A 4WQOB 2MRPA 4LDTD 2WXKA 1UWMA 1Y56A 5G2NA 2ON8A 2J52A 3GS2A 2WXMA 3OJ3A 1HQRD 4NZLB 4ZOHC 4EFOA 2XN9C 5G5GA 4IM3A 4EZLA 4JQWC 4FJYA 3NS8A 1S1QB 3WIMA 2WDTB 2RPQA 2DZJA 4GDKA 1I4PA 2V4LA 2KT7A 3ZRFA 2BS4B 1K8RB 1RAXA 1T3QA 1WXVA 4S17A 4JE3B 2KLCA 3SFEB 1QT9A 3TSSA 1UF0A 4BZAA 1YJIA 3LYYA 3ZXVA 4MT5A 5DPSA 1TKYA 4II3B 3PZ8A 3KW5B 1YD8U 2HTME 1WM2A 1QOBA 1XLQA 1T6BX 2PVOD 2BWFA 4HCPB 4XWTA 3X0WA 2DZIA 1Q10A 2WDVB 2IO2B 4GOCA 2L83A 4C00A 4ANWA 3NVYA 2V1YA 1WF9A 2KVZA 3I63C 3ZQ4A 1FCCC 1SIFA 1D6EC 1RLFA 3A1QA 2IGHA 1FNWA 3PLVA 3BWUD 4DDID 2WXNA 3FC4A 1NYRA 3PPAA 4OHJA 4KDIC 1WMHB 4NNJB 1BMLC 1V81A 3NHEB 1E6EB 3ZNGC 2WNMA 4FBJB 5C23A 3WAOA 5CX3A 1N62A 5DPTA 2JZZA 3AU5A 1GAQB 3AE3B 4HKZE 4JX1C 3MHSD 1TKGA 4KDLB 1PGAA 3VUXA 4P7IA 4WAAA 2JXTA 4EZKA 5LXHA 1FRDA 2A5UA 3GE8C 1JRPA 3AEAB 4N9F4 2BYEA 4NQKE 1QZEA 3VR8B 1V6EA 1YN5A 2QIEB 3IVFA 1KRHA 4XDCA 5H92C 1HZ5A 2RR9A 2L32A 1I4HA 4A9AA 2IO3B 2DX5B 3TL5A 5BYRA 1PUTA 3R8BA 2DZKA 2LD9A 3Q2AC 2MCNB 3AE8B 2LVQA 4ANUA 2KN5A 3CF6E 1WJNA 3N32A 5BO4B 2PEAA 5JXVA 2W3SA 3B2GA 3MC8A 4OVZA 4F7ZA 4ARIA 3ONSA 3Q8CA 2FAZA 4ITKA 2WX0A 4OVVA 2MBHA 5EE9A 3NG0A 1WZ0A 4TMAB 1FEHA 1YNTE 4DHZB 4RF0A 5D3IB 2D3BA 3HM3A 1NENB 2BVCA 1E10A 5C2TB 2M0AA 2JWUA 1WGDA 1L0VB 1RFAA 1FRRA 3Q8AA 1QF6A 4RF1A 2KWDA 2B3AA 5IKCM 4CQNA 2ZJDA 5DCNA 4KX6B 1P1AA 1GB4A 1S3SG 4A8XC 2N9PC 1D4BA 2BF8B 5IAAC 2WU5B 5H8YE 3P63A 3VH4B 3RFZB 2KTRA 3MTNB 3SR6A 3AEGB 2FCSA 3WANA 1L6UA 2W9NA 1LQBA 2IJ0A 3HHMA 1QKZA 3UINB 3HVZA 4YTNB 1EWYC 2QILA 4ACFA 3NVVA 1V2YA 2D10A 3SDLC 2PJHA 2JY6A 4E3CA 1IGCA 4XGAB 5AZFA 2ZW1A 1WWTA 1MVKA 1HXYD 5AZHA 2L0TA 3PV1A 1KTKA 2L8JA 2ZCBA 2RPVA 2ACZB 2O2VB 1UBIA 3AB5A 2N1WA 5E6OA 3X23A 1WGYA 5FR3A 4UDUC 1ET6A 2GBNA 1CMXB 2N7JA 5TR5A 2PE6B 2Z0EB 2V9HA 5KHQA 2QHOA 1R4NB 2JVCA 3VDZA 2IO0B 2KNBA 3LJ3A 5J2RA 1CJEA 1GC6A 1XF5L 5HKHA 2CHXA 4AWJA 3ZTCA 2N7DA 2JYTA 4PYUA 4W9JA 4W9KA 2FCMA 1OQRA 2Z59B 3AV8A 4TUUA 2FBWB 2CU3A 1K53A 3JSVA 1LM8B 2QSDA 1T0QC 2AEHA 2JPHA 3H7SA 3U7ZA 3CIRB 3W1SA 4QAYA 1SBBB 4PS3A 3DBRB 2KANA 2J53A 2KX3A 3VHTC 3IHPC 3AE9B 4W9IA 3DBHI 1EU4A 3W1YA 4NJ6A 3ZJVA 1L4ZB 2CJOA 3H6NA 3PLUA 1Y8RC 4EZJA 2N9KA 3NS1A 1XLPA 3ENEA 1AWDA 3UGBB 1QILA 3Q3NC 1BXTA 3UQBA 4RGTA 1NI2A 4AJWA 1WRIA 1ZPSA 2I1KA 1ZKHA 3U7DA 3IFWB 4WWMA 2JZPA 3AULA 1LXDA 2L00B 3R7QA 3M62B 3NJTA 4KZCA 2MHJA 4CHKA 4G3XB 4YT0B 1HA5A 3E9SA 2IYDB 3SU8X 3PZ7A 3GOEA 1VZ7A 3H7PB 1UGJA 3QHTA 3FILA 4PS8A 2JRIB 3QC8B 3QA8A 4B0EA 3OWEB 1SE4A 2LGDA 4WJNA 3A33B 4I6LB 4XZ4A 1UUPA 3RCZA 2LXAA 4BBNF 2MA9B 5D3DA 4YWGG 1K50A 3IBEA 3OLMD 5EE3A 4JLCA 1SGHA 1MG4A 4AP4C 2JX5A 1TY0A 1WX9A 4E74A 4H2AA 4M00A 1WR1A 2FIDA 1LFDA 3RULA 5IOIA 1YN4A 3V6EB 3V60A 3B08A 2KJHB 3K9OB 2Y3AA 3EA6A 2LWPA 4HJGE 3DBLB 4MJSB 3ZRCA 4MDKE 1D3ZA 2KC2A 5KHOA 4W9FA 2L52A 2ZNVC 2OHFA 2M56B 3N9YC 5G5HA 1T5XD 2CR5A 2G4SA 2DWQA 2I38A 4MH8A 4AJYB 3NZ3A 4YTPB 1ESFA 2DAFA 1SJED 4US9A 3RNGC 1MHHE 4L1BA 1FXTB 1VRAB 3BZDB 4WWPA 4LNFA 4A55A 3MC0B 4RCOA 4I6PA 5HFYA 3WAMA 1PQSA 4RGOS 5JHAA 4MGIE 1FFVA 1V80A 2D5GA 2FCNA 4NAMA 2IY1B 2KJ6A 2L0FA 4FXCA 3TJPA 3AECB 4GMVA 4NQLB 4WQMA 2REXA 2BS2B 3KVFB 3PO0A 2O6VD 4PT5A 1GOZA 4ARCA 2KQSA 5JH5C 2L1AA 3B0AA 1JWAD 1R7SA 2HD5B 3A4RA 4YL8A 1M4VA 2LHDA 1FNVA 2XNAC 4A3PA 3NY5A 3LDZE 1XD3B 3PRMB 4TSSA 1STEA 1EUVB 1NBFC 3L13A 3APFA 5C3JB 4M01A 2ZPYA 3NVWA 2GB1A 1U4AA 2MBEA 1TTNA 2H89B 4LJOB 4EUTA 3DQVA 4HK2A 2AYOB 3C19A 3VUWA 1KOTA 5DPRA 2KYWA 1DOYA 1I7HA 2WGSA 1WYGA 1TZ1A 2KD0A 4GU2A 3ZW3A
chains in the Genus database with same CATH topology
2K1FA 2KK8A 3QX1A 4FBJB 5C23A 2G4DB 3WAOA 3A9JB 2K8HA 5CX3A 5DPTA 2JZZA 2A4ZA 3AU5A 2NS5A 2KTFA 2GMIC 3HM6X 5C1ZA 4IWOA 1Q5WB 1V5TA 4ZDVA 4BKSD 4F1SA 4K7SA 4K81A 2ZZPB 2K25A 3MHSD 2BWES 4KDLB 3ML9A 2J0JA 3VUXA 3B1LX 1WJ6A 2MBBB 4P7IA 4WAAA 3APDA 4EZKA 5LXHA 2A5UA 2LUEA 4N9F4 4GB9A 2BYEA 4NQKE 2ZNVB 1QZEA 1V6EA 2KWUB 4GDKB 2K8BA 2D11A 2LVOA 4G50A 1XT9B 4MEMA 4BOSC 3L16A 1EF5A 3UQAA 2ZCCA 3IVFA 5L95C 4WWNA 3ZDTA 4DWFA 3QCAA 4W9CA 4DHJB 2RD0A 3P2BA 2JUOA 2KDFB 2RR9A 3APCA 4DHJD 4ZRIA 2LRWA 2ZVOA 2IO3B 2DX5B 2NR2A 3DDCB 4NAWA 3TL5A 2C5LC 3DVGX 1I35A 2IO1B 3VQIA 1G6JA 2CS4A 3Q3JA 2DZKA 5CTRC 2LD9A 1UZXB 5LXIB 3WA0A 1L7YA 2MCNB 2L05A 3OAWA 2LVQA 3WALA 4ANUA 5EDSA 2KN5A 3CF6E 3T9LA 1WJNA 3N32A 5BO4B 2FUHB 3AXCA 1WJ4A 3DOWA 2AL6A 2PEAA 2GBKA 1E7VA 2XK5A 4GIVA 1J8CA 3L0WB 4F7ZA 3ONSA 1WFYA 1OEYJ 3AI5A 2FAZA 1WH3A 2WX0A 2BYFA 2O2VA 2ZPNA 4W9EA 2MQJA 4ZRJA 4OVVA 3ZTDA 2MBHA 2MW5A 3ZO5B 2M0XA 4TV3A 3QARA 1WZ0A 4DHZB 4GDLB 4PYZA 2RSUA 3HM3A 1WXAA 4TKNA 2GOWA 4IWQA 3A1QB 2C7NB 2KMAA 2LVPA 3VXWA 2EMTA 4IM2A 3RYTA 1VCBA 1E8XA 1GUAB 3EC8A 2IBIB 1WGDA 4K1RB 2L7RA 2M1MA 1RFAA 1GC7A 5E6NA 4A20A 2JZ3B 2LRUA 3RZFA 1V49A 3KUDB 2B3AA 2MSED 2FIFA 3PTFC 2LASA 3BY4B 3K9PB 2ZJDA 5DCNA 3S2AA 3QQ8B 4IG7B 4W9DA 1P1AA 2MWSB 1S3SG 1V9JA 1KM7A 2N9PC 1C3TA 5D2MB 4HJKA 3ZNID 4MM3A 1X1MA 2BF8B 4MGZE 5CHFA 5IAAC 2HTHA 2LGXA 4JGHB 2BYVE 4K7UA 4FN2A 2IY0B 3JVZX 1YQBA 5D94A 3T8MA 2C7MB 1GNUA 2JXXA 5J17A 3VH4B 2KTRA 3MTNB 3I3TB 2VRRB 4KZ0A 4K7WA 1WXMA 2L3ZA 4HCNB 2GBRA 4EKUA 2FCSA 1E8YA 1WRDB 3WANA 2W9NA 3ZUNA 2C9WB 1LQBA 2N7EA 3VUYA 3HHMA 1SE9A 4BKTA 2JRHA 3UINB 5IA7A 3UIOB 3PVLA 1V2YA 4IWPA 4BKGA 3QK0A 4NAWB 3O65B 4FHJA 1WX7A 2D10A 3SDLC 2PJHA 1YJ1A 2NBVB 4DHZE 2M17A 3HK0A 4FADA 4ANXA 3CMMB 4RMAA 3U30A 2JY6A 3PHWB 2DENB 2WX1A 4E3CA 1OGWA 1I42A 3R3MA 4I6NB 5AZFA 2M8SA 2G45B 2GBJA 5AZHA 2KFJA 3VTVA 2L0TA 2XK5B 3PV1A 4J6IA 4M0WB 3DVNU 2L8JA 2ZCBA 2JT4B 1GG3A 2MBQA 3Q3FA 2K8CA 2EMSA 3GZNI 3IG3A 4WJOA 2BPSA 2LI5A 3DVNV 4MGKE 4W9GA 2O2VB 1UBIA 1ZGUB 2KX0A 2N1WA 1KLVA 5E6OA 4WJQA 4KIKA 2FNJB 2D3GA 3PZDA 1WGYA 2N9XA 2NBWB 3PHXB 2D2QA 4NPNA 1E7UA 4WJPA 2N9EB 1P98A 3EECA 4W9HA 2ASQA 4KVGB 3U8ZA 2GBNA 1WGHA 1TGZB 1CMXB 2FCQA 5TR5A 1Q0WB 2PE6B 2Z0EB 4JIOU 5KHQA 1P0RA 1H4RA 3RZWC 3W1SC 2WYQA 4BFRA 2QHOA 1KJTA 3VFKA 2JVCA 3H7PA 1M94A 1MG8A 2IO0B 1AARA 2KNBA 3LJ3A 1R4NI 4IW0A 3VDZA 1GC6A 3DBSA 5HKHA 2CHXA 4AWJA 4CO7A 1YX5B 3TIXA 3VTUA 3ZTCA 2MP2A 1T0YA 2N7DA 2DZMA 2EKEC 4PYUA 5FR6A 4W9JA 2KZRA 2FCMA 4M8MA 2ZVNA 2Z59B 4W9KA 5G55A 3OJ4B 1ISNA 4TUUA 2AWTA 1YIWA 3JSVA 4W9LA 1P9DU 2KC1A 1LM8B 2KDBA 3ZNZB 3ZKJC 2AEHA 2JPHA 2KFKA 3NOBA 1WGRA 1WR6E 3H7SA 4OVUA 4DXAB 3W1SA 2NPTA 5JHBA 2YLMA 3H9DA 2KHWB 4PS3A 1WIAA 4FJZA 2KTRB 3DBRI 3PT2B 1P3QU 2KANA 2KX3A 3VHTC 5AEKB 4PS7A 2K6QA 3IHPC 1J19A 2C60A 1GJZA 4W9IA 3DBHI 2I1JA 4FJVB 5AZGA 1HE8A 3W1YA 1WJUA 2JF5A 2C7HA 4NJ6A 4MJSA 3SD5A 2D07B 3A9KA 3H6NA 4GN1A 1WGGA 2YVCA 4RM8A 1Z5SB 1WYWB 2XEWA 2AL3A 3PLUA 1Y8RC 5CHVC 4GXBA 1EF1A 3DVGY 4BOZB 4EOYA 4TQ0A 4EZJA 2KKCA 3QJZA 3ENEA 4GSWA 1IYFA 3PRZA 2CHZA 3L54A 2XBBC 5L83A 3ALBA 3UGBB 2KXJA 2PPHA 2NBUA 2KVRA 3UQBA 1WE6A 4G0NB 1NI2A 2NVUI 4HPMB 4AJWA 3HIZA 2IZVB 2I1KA 1ZKHA 1Q1OA 1OTRB 2KDEB 3U7DA 1UELA 1UH6A 2BKFA 4ZRKA 4F8CB 2Y5BB 3IFWB 2JWZA 3WAPA 3AULA 4BBNC 4HLEA 1LXDA 2PE9A 2GBMA 3CSFA 2L00B 4ANVA 2MX2A 3M3JA 1UGMA 2Z0DB 4GGQA 5J2RA 3R7QA 1IP9A 1JRUA 3M62B 4WWOA 4KZCA 4DK5A 1WXSA 4KIKB 2MBOA 2G3QB 2KDIA 3RT3B 2NCNA 1WM3A 4CHKA 4G3XB 4ICUA 3KUCB 4II2B 1RRBA 2R2QA 4B6WA 3QAQA 3L08A 4LJPB 4NY0A 4TQ1A 2IYDB 4XC2A 3SU8X 4FHKA 3GOEA 3H7PB 4ASWC 4AUQC 3TBLD 5LLIA 3H1UA 4JL9A 5E6PA 3QHTA 2OJRA 4PS8A 2JRIB 3SHQA 1EO6A 3QC8B 2KQ7A 3QA8A 4MELA 2J7QB 2KMCA 2LGDA 2MP2B 2O6VA 1R4MI 4WJNA 2KOXA 3A33B 1WI0A 4I6LB 4XZ4A 3RCZA 2LXAA 3ZIMA 2MA9B 3TMPB 4ZYNA 4BBNF 2KJRA 2LZ6A 3PGEA 3A4SC 4NJ7A 4B9KA 3UF8A 3NZUA 1UD7A 1E8ZA 3IBEA 3OLMD 3R7RA 1H8CA 1SGHA 3ECIA 2J0KA 2KLGA 3C0RB 2UYZB 3JSVB 4JLCA 1C1YB 4AP4C 4G11A 3VVWB 4IC7B 3EFUA 1WX9A 1Z2MA 4E74A 3UIPB 1XQQA 4X57B 4AOFA 3R66C 2KFKB 5CHWA 1WR1A 2NPTB 4RM9A 3M95A 2FIDA 1IPGA 1LFDA 3ZNHB 3RULA 3JW0X 3V6EB 2CHWA 2K6DB 4DDGD 3V60A 3B08A 5GMVA 2KJHB 3M63B 2HE7A 3D32A 1WE7A 3K9OB 4URKA 1L2NA 3ZLZA 2DYMA 3KUZA 2DYBA 2LWPA 1WY8A 1V5OA 3JYUA 4MJSB 3A9KB 3ZRCA 5DPWA 1NDDA 3DBLI 3QWZB 4MDKE 4FA6A 4HPLB 1D3ZA 2KC2A 5KHOA 4W9FA 2N4FA 3KYDD 1E90A 3BINA 4LDTB 2ZNVC 3KH0A 3NZSA 4CYEA 5D7GA 4WQOB 1WMHA 4HDQA 2CR5A 2J0MA 2MRPA 1E8WA 4LDTD 2G4SA 5J18A 3CSTA 4AJYB 4DBGA 2DAFA 1V86A 5G2NA 3A9JA 3PSEB 3DPDA 4BKSA 4MGYE 3VAWA 4KSLC 1FXTB 3OJ3A 2V3SA 2CU1A 2LJ5A 3PS6A 4WWPA 2WWZA 3X23A 3V61A 3ZDMC 3VTWA 4EFOA 5JZEB 4I6PA 4IM3A 2KWVB 2HJ8A 4EZLA 4JQWC 3WAMA 1PQSA 4FJYA 3NS8A 1S1QB 3V6CB 2DAJA 5JHAA 3WIMA 3EHVA 4MGIE 2WDTB 2RPQA 1V80A 4HDOA 2DZJA 4GDKA 4HXDA 2V4LA 3V62A 1OQYA 3ZRFA 4E71A 1WZ3A 2FCNA 4B95A 1K8RB 1RAXA 1WXVA 2IY1B 2KJ6A 2L0FA 2LGYA 4MSMB 3TJPA 2N1VA 2LXCA 4GMVA 2BKRB 3PREA 4NQLB 2OOBB 1TBEA 4MSQB 4IM0A 1WX8A 3L17A 2KLCA 2KWCA 2O6VB 2REXA 3ZVVA 1E5WA 1ZW7A 2ZEQA 3KVFB 4KSKC 2O6VD 2KQSA 5JH5C 3MJWA 5DPSA 3RUIB 4II3B 3L10B 2R2OA 3B0AA 3KW5B 1F9JA 1YD8U 2HD5B 2RGFA 3A4RA 2UWQA 1WM2A 4YL8A 3TCAA 4A3PA 1UBQA 1BT0A 4BVUC 3NY5A 4EEWA 2BWFA 4HCPB 3LDZE 1XD3B 3X0WA 2DZIA 3PRMB 4HWIB 4M8NA 2M4NA 4HVBA 1EUVB 3RD2A 2IO2B 3PRPB 1NBFC 4GOCA 2DYOA 3AU4A 3L13A 5D6JB 3APFA 4LCDE 4ANWA 2DHZA 2V1YA 4FULA 1WF9A 2L76A 2ZPYA 3VH3B 3ML8A 4KV2A 2CKHB 4MH0E 1U4AA 1VD2A 2MLBA 2MBEA 4IUMB 1TTNA 1OEYA 4GDLA 4XX5A 4LJOB 1SIFA 4EUTA 3DQVA 4ICVA 1RLFA 3A1QA 2K39A 1J0GA 3KYCD 3QIJA 3PLVA 4A3OA 1YX6B 4DDID 2AYOB 2KO3A 3DCGA 4HK2A 1KOTA 3VUWA 2BGFA 3N3KB 3PPAA 5DPRA 4FLHA 3N30A 1A5RA 4KDIC 1WMHB 4NNJB 1TZ1A 2KD0A 1V81A 4GU2A 3NHEB 3ZW3A 3ZNGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1F A;  2KK8 A;  3QX1 A;  4FBJ B;  5C23 A;  2G4D B;  3WAO A;  3A9J B;  2K8H A;  5CX3 A;  5DPT A;  2JZZ A;  2A4Z A;  3AU5 A;  2NS5 A;  2KTF A;  2GMI C;  3HM6 X;  5C1Z A;  4IWO A;  1Q5W B;  1V5T A;  4ZDV A;  4BKS D;  4F1S A;  4K7S A;  4K81 A;  2ZZP B;  2K25 A;  3MHS D;  2BWE S;  4KDL B;  3ML9 A;  2J0J A;  3VUX A;  3B1L X;  1WJ6 A;  2MBB B;  4P7I A;  4WAA A;  3APD A;  4EZK A;  5LXH A;  2A5U A;  2LUE A;  4N9F 4;  4GB9 A;  2BYE A;  4NQK E;  2ZNV B;  1QZE A;  1V6E A;  2KWU B;  4GDK B;  2K8B A;  2D11 A;  2LVO A;  4G50 A;  1XT9 B;  4MEM A;  4BOS C;  3L16 A;  1EF5 A;  3UQA A;  2ZCC A;  3IVF A;  5L95 C;  4WWN A;  3ZDT A;  4DWF A;  3QCA A;  4W9C A;  4DHJ B;  2RD0 A;  3P2B A;  2JUO A;  2KDF B;  2RR9 A;  3APC A;  4DHJ D;  4ZRI A;  2LRW A;  2ZVO A;  2IO3 B;  2DX5 B;  2NR2 A;  3DDC B;  4NAW A;  3TL5 A;  2C5L C;  3DVG X;  1I35 A;  2IO1 B;  3VQI A;  1G6J A;  2CS4 A;  3Q3J A;  2DZK A;  5CTR C;  2LD9 A;  1UZX B;  5LXI B;  3WA0 A;  1L7Y A;  2MCN B;  2L05 A;  3OAW A;  2LVQ A;  3WAL A;  4ANU A;  5EDS A;  2KN5 A;  3CF6 E;  3T9L A;  1WJN A;  3N32 A;  5BO4 B;  2FUH B;  3AXC A;  1WJ4 A;  3DOW A;  2AL6 A;  2PEA A;  2GBK A;  1E7V A;  2XK5 A;  4GIV A;  1J8C A;  3L0W B;  4F7Z A;  3ONS A;  1WFY A;  1OEY J;  3AI5 A;  2FAZ A;  1WH3 A;  2WX0 A;  2BYF A;  2O2V A;  2ZPN A;  4W9E A;  2MQJ A;  4ZRJ A;  4OVV A;  3ZTD A;  2MBH A;  2MW5 A;  3ZO5 B;  2M0X A;  4TV3 A;  3QAR A;  1WZ0 A;  4DHZ B;  4GDL B;  4PYZ A;  2RSU A;  3HM3 A;  1WXA A;  4TKN A;  2GOW A;  4IWQ A;  3A1Q B;  2C7N B;  2KMA A;  2LVP A;  3VXW A;  2EMT A;  4IM2 A;  3RYT A;  1VCB A;  1E8X A;  1GUA B;  3EC8 A;  2IBI B;  1WGD A;  4K1R B;  2L7R A;  2M1M A;  1RFA A;  1GC7 A;  5E6N A;  4A20 A;  2JZ3 B;  2LRU A;  3RZF A;  1V49 A;  3KUD B;  2B3A A;  2MSE D;  2FIF A;  3PTF C;  2LAS A;  3BY4 B;  3K9P B;  2ZJD A;  5DCN A;  3S2A A;  3QQ8 B;  4IG7 B;  4W9D A;  1P1A A;  2MWS B;  1S3S G;  1V9J A;  1KM7 A;  2N9P C;  1C3T A;  5D2M B;  4HJK A;  3ZNI D;  4MM3 A;  1X1M A;  2BF8 B;  4MGZ E;  5CHF A;  5IAA C;  2HTH A;  2LGX A;  4JGH B;  2BYV E;  4K7U A;  4FN2 A;  2IY0 B;  3JVZ X;  1YQB A;  5D94 A;  3T8M A;  2C7M B;  1GNU A;  2JXX A;  5J17 A;  3VH4 B;  2KTR A;  3MTN B;  3I3T B;  2VRR B;  4KZ0 A;  4K7W A;  1WXM A;  2L3Z A;  4HCN B;  2GBR A;  4EKU A;  2FCS A;  1E8Y A;  1WRD B;  3WAN A;  2W9N A;  3ZUN A;  2C9W B;  1LQB A;  2N7E A;  3VUY A;  3HHM A;  1SE9 A;  4BKT A;  2JRH A;  3UIN B;  5IA7 A;  3UIO B;  3PVL A;  1V2Y A;  4IWP A;  4BKG A;  3QK0 A;  4NAW B;  3O65 B;  4FHJ A;  1WX7 A;  2D10 A;  3SDL C;  2PJH A;  1YJ1 A;  2NBV B;  4DHZ E;  2M17 A;  3HK0 A;  4FAD A;  4ANX A;  3CMM B;  4RMA A;  3U30 A;  2JY6 A;  3PHW B;  2DEN B;  2WX1 A;  4E3C A;  1OGW A;  1I42 A;  3R3M A;  4I6N B;  5AZF A;  2M8S A;  2G45 B;  2GBJ A;  5AZH A;  2KFJ A;  3VTV A;  2L0T A;  2XK5 B;  3PV1 A;  4J6I A;  4M0W B;  3DVN U;  2L8J A;  2ZCB A;  2JT4 B;  1GG3 A;  2MBQ A;  3Q3F A;  2K8C A;  2EMS A;  3GZN I;  3IG3 A;  4WJO A;  2BPS A;  2LI5 A;  3DVN V;  4MGK E;  4W9G A;  2O2V B;  1UBI A;  1ZGU B;  2KX0 A;  2N1W A;  1KLV A;  5E6O A;  4WJQ A;  4KIK A;  2FNJ B;  2D3G A;  3PZD A;  1WGY A;  2N9X A;  2NBW B;  3PHX B;  2D2Q A;  4NPN A;  1E7U A;  4WJP A;  2N9E B;  1P98 A;  3EEC A;  4W9H A;  2ASQ A;  4KVG B;  3U8Z A;  2GBN A;  1WGH A;  1TGZ B;  1CMX B;  2FCQ A;  5TR5 A;  1Q0W B;  2PE6 B;  2Z0E B;  4JIO U;  5KHQ A;  1P0R A;  1H4R A;  3RZW C;  3W1S C;  2WYQ A;  4BFR A;  2QHO A;  1KJT A;  3VFK A;  2JVC A;  3H7P A;  1M94 A;  1MG8 A;  2IO0 B;  1AAR A;  2KNB A;  3LJ3 A;  1R4N I;  4IW0 A;  3VDZ A;  1GC6 A;  3DBS A;  5HKH A;  2CHX A;  4AWJ A;  4CO7 A;  1YX5 B;  3TIX A;  3VTU A;  3ZTC A;  2MP2 A;  1T0Y A;  2N7D A;  2DZM A;  2EKE C;  4PYU A;  5FR6 A;  4W9J A;  2KZR A;  2FCM A;  4M8M A;  2ZVN A;  2Z59 B;  4W9K A;  5G55 A;  3OJ4 B;  1ISN A;  4TUU A;  2AWT A;  1YIW A;  3JSV A;  4W9L A;  1P9D U;  2KC1 A;  1LM8 B;  2KDB A;  3ZNZ B;  3ZKJ C;  2AEH A;  2JPH A;  2KFK A;  3NOB A;  1WGR A;  1WR6 E;  3H7S A;  4OVU A;  4DXA B;  3W1S A;  2NPT A;  5JHB A;  2YLM A;  3H9D A;  2KHW B;  4PS3 A;  1WIA A;  4FJZ A;  2KTR B;  3DBR I;  3PT2 B;  1P3Q U;  2KAN A;  2KX3 A;  3VHT C;  5AEK B;  4PS7 A;  2K6Q A;  3IHP C;  1J19 A;  2C60 A;  1GJZ A;  4W9I A;  3DBH I;  2I1J A;  4FJV B;  5AZG A;  1HE8 A;  3W1Y A;  1WJU A;  2JF5 A;  2C7H A;  4NJ6 A;  4MJS A;  3SD5 A;  2D07 B;  3A9K A;  3H6N A;  4GN1 A;  1WGG A;  2YVC A;  4RM8 A;  1Z5S B;  1WYW B;  2XEW A;  2AL3 A;  3PLU A;  1Y8R C;  5CHV C;  4GXB A;  1EF1 A;  3DVG Y;  4BOZ B;  4EOY A;  4TQ0 A;  4EZJ A;  2KKC A;  3QJZ A;  3ENE A;  4GSW A;  1IYF A;  3PRZ A;  2CHZ A;  3L54 A;  2XBB C;  5L83 A;  3ALB A;  3UGB B;  2KXJ A;  2PPH A;  2NBU A;  2KVR A;  3UQB A;  1WE6 A;  4G0N B;  1NI2 A;  2NVU I;  4HPM B;  4AJW A;  3HIZ A;  2IZV B;  2I1K A;  1ZKH A;  1Q1O A;  1OTR B;  2KDE B;  3U7D A;  1UEL A;  1UH6 A;  2BKF A;  4ZRK A;  4F8C B;  2Y5B B;  3IFW B;  2JWZ A;  3WAP A;  3AUL A;  4BBN C;  4HLE A;  1LXD A;  2PE9 A;  2GBM A;  3CSF A;  2L00 B;  4ANV A;  2MX2 A;  3M3J A;  1UGM A;  2Z0D B;  4GGQ A;  5J2R A;  3R7Q A;  1IP9 A;  1JRU A;  3M62 B;  4WWO A;  4KZC A;  4DK5 A;  1WXS A;  4KIK B;  2MBO A;  2G3Q B;  2KDI A;  3RT3 B;  2NCN A;  1WM3 A;  4CHK A;  4G3X B;  4ICU A;  3KUC B;  4II2 B;  1RRB A;  2R2Q A;  4B6W A;  3QAQ A;  3L08 A;  4LJP B;  4NY0 A;  4TQ1 A;  2IYD B;  4XC2 A;  3SU8 X;  4FHK A;  3GOE A;  3H7P B;  4ASW C;  4AUQ C;  3TBL D;  5LLI A;  3H1U A;  4JL9 A;  5E6P A;  3QHT A;  2OJR A;  4PS8 A;  2JRI B;  3SHQ A;  1EO6 A;  3QC8 B;  2KQ7 A;  3QA8 A;  4MEL A;  2J7Q B;  2KMC A;  2LGD A;  2MP2 B;  2O6V A;  1R4M I;  4WJN A;  2KOX A;  3A33 B;  1WI0 A;  4I6L B;  4XZ4 A;  3RCZ A;  2LXA A;  3ZIM A;  2MA9 B;  3TMP B;  4ZYN A;  4BBN F;  2KJR A;  2LZ6 A;  3PGE A;  3A4S C;  4NJ7 A;  4B9K A;  3UF8 A;  3NZU A;  1UD7 A;  1E8Z A;  3IBE A;  3OLM D;  3R7R A;  1H8C A;  1SGH A;  3ECI A;  2J0K A;  2KLG A;  3C0R B;  2UYZ B;  3JSV B;  4JLC A;  1C1Y B;  4AP4 C;  4G11 A;  3VVW B;  4IC7 B;  3EFU A;  1WX9 A;  1Z2M A;  4E74 A;  3UIP B;  1XQQ A;  4X57 B;  4AOF A;  3R66 C;  2KFK B;  5CHW A;  1WR1 A;  2NPT B;  4RM9 A;  3M95 A;  2FID A;  1IPG A;  1LFD A;  3ZNH B;  3RUL A;  3JW0 X;  3V6E B;  2CHW A;  2K6D B;  4DDG D;  3V60 A;  3B08 A;  5GMV A;  2KJH B;  3M63 B;  2HE7 A;  3D32 A;  1WE7 A;  3K9O B;  4URK A;  1L2N A;  3ZLZ A;  2DYM A;  3KUZ A;  2DYB A;  2LWP A;  1WY8 A;  1V5O A;  3JYU A;  4MJS B;  3A9K B;  3ZRC A;  5DPW A;  1NDD A;  3DBL I;  3QWZ B;  4MDK E;  4FA6 A;  4HPL B;  1D3Z A;  2KC2 A;  5KHO A;  4W9F A;  2N4F A;  3KYD D;  1E90 A;  3BIN A;  4LDT B;  2ZNV C;  3KH0 A;  3NZS A;  4CYE A;  5D7G A;  4WQO B;  1WMH A;  4HDQ A;  2CR5 A;  2J0M A;  2MRP A;  1E8W A;  4LDT D;  2G4S A;  5J18 A;  3CST A;  4AJY B;  4DBG A;  2DAF A;  1V86 A;  5G2N A;  3A9J A;  3PSE B;  3DPD A;  4BKS A;  4MGY E;  3VAW A;  4KSL C;  1FXT B;  3OJ3 A;  2V3S A;  2CU1 A;  2LJ5 A;  3PS6 A;  4WWP A;  2WWZ A;  3X23 A;  3V61 A;  3ZDM C;  3VTW A;  4EFO A;  5JZE B;  4I6P A;  4IM3 A;  2KWV B;  2HJ8 A;  4EZL A;  4JQW C;  3WAM A;  1PQS A;  4FJY A;  3NS8 A;  1S1Q B;  3V6C B;  2DAJ A;  5JHA A;  3WIM A;  3EHV A;  4MGI E;  2WDT B;  2RPQ A;  1V80 A;  4HDO A;  2DZJ A;  4GDK A;  4HXD A;  2V4L A;  3V62 A;  1OQY A;  3ZRF A;  4E71 A;  1WZ3 A;  2FCN A;  4B95 A;  1K8R B;  1RAX A;  1WXV A;  2IY1 B;  2KJ6 A;  2L0F A;  2LGY A;  4MSM B;  3TJP A;  2N1V A;  2LXC A;  4GMV A;  2BKR B;  3PRE A;  4NQL B;  2OOB B;  1TBE A;  4MSQ B;  4IM0 A;  1WX8 A;  3L17 A;  2KLC A;  2KWC A;  2O6V B;  2REX A;  3ZVV A;  1E5W A;  1ZW7 A;  2ZEQ A;  3KVF B;  4KSK C;  2O6V D;  2KQS A;  5JH5 C;  3MJW A;  5DPS A;  3RUI B;  4II3 B;  3L10 B;  2R2O A;  3B0A A;  3KW5 B;  1F9J A;  1YD8 U;  2HD5 B;  2RGF A;  3A4R A;  2UWQ A;  1WM2 A;  4YL8 A;  3TCA A;  4A3P A;  1UBQ A;  1BT0 A;  4BVU C;  3NY5 A;  4EEW A;  2BWF A;  4HCP B;  3LDZ E;  1XD3 B;  3X0W A;  2DZI A;  3PRM B;  4HWI B;  4M8N A;  2M4N A;  4HVB A;  1EUV B;  3RD2 A;  2IO2 B;  3PRP B;  1NBF C;  4GOC A;  2DYO A;  3AU4 A;  3L13 A;  5D6J B;  3APF A;  4LCD E;  4ANW A;  2DHZ A;  2V1Y A;  4FUL A;  1WF9 A;  2L76 A;  2ZPY A;  3VH3 B;  3ML8 A;  4KV2 A;  2CKH B;  4MH0 E;  1U4A A;  1VD2 A;  2MLB A;  2MBE A;  4IUM B;  1TTN A;  1OEY A;  4GDL A;  4XX5 A;  4LJO B;  1SIF A;  4EUT A;  3DQV A;  4ICV A;  1RLF A;  3A1Q A;  2K39 A;  1J0G A;  3KYC D;  3QIJ A;  3PLV A;  4A3O A;  1YX6 B;  4DDI D;  2AYO B;  2KO3 A;  3DCG A;  4HK2 A;  1KOT A;  3VUW A;  2BGF A;  3N3K B;  3PPA A;  5DPR A;  4FLH A;  3N30 A;  1A5R A;  4KDI C;  1WMH B;  4NNJ B;  1TZ1 A;  2KD0 A;  1V81 A;  4GU2 A;  3NHE B;  3ZW3 A;  3ZNG C; 
#chains in the Genus database with same CATH topology
 2K1F A;  3QX1 A;  2INP E;  3P42 A;  2A4Z A;  1XO3 A;  2N9L A;  3HM6 X;  4ZDV A;  1K52 A;  1KH0 A;  1NVI D;  1OQQ A;  4K81 A;  2D3A A;  3B1L X;  1WJ6 A;  1MHX A;  3B9J A;  2BYT A;  4GDK B;  2K8B A;  2WU2 B;  3L16 A;  1IBX A;  3ZDT A;  4DWF A;  2WQY B;  1FXA A;  4W9C A;  4DHJ B;  3APC A;  2QC8 A;  3TEZ A;  4MAC A;  2LRW A;  3NUH B;  1VZ8 A;  1L0Y B;  2KMM A;  2NR2 A;  3DDC B;  2CJN A;  4NAW A;  2C5L C;  3VQI A;  2CS4 A;  3Q3J A;  1JRO A;  1BUI C;  3AEB B;  1YQ3 B;  1ENF A;  5EDS A;  5BYQ A;  3T9L A;  2FUH B;  3AXC A;  1WJ4 A;  5LNK 1;  1XEE A;  2AL6 A;  2YEP F;  1ZDX A;  3BVG A;  2LEK A;  1MJD A;  2XK5 A;  4GIV A;  4RH6 A;  1RYJ A;  3LB8 C;  1OEY J;  1XXG A;  1WXQ A;  1F0Z A;  4C7Y A;  1MI0 A;  1WH3 A;  4W9E A;  4ZRJ A;  1YMH E;  1SEB D;  2M0X A;  2PIA A;  4PYZ A;  3SEB A;  2RSU A;  1WXA A;  2VH2 A;  3A1Q B;  2LVP A;  2SAK A;  1KLG D;  2INC C;  1K51 A;  2IPK D;  4DXF A;  3RYT A;  1E8X A;  2Y5C A;  1GUA B;  2WLB A;  2IBI B;  2M1M A;  1YN3 A;  3NRZ A;  1CQV A;  5E6N A;  1QQR A;  1FNU A;  2JZ3 B;  1JCK B;  2LRU A;  2KAJ A;  1V49 A;  1SSN A;  2LAS A;  3QQ8 B;  4IG7 B;  3FAH A;  2MWS B;  2X8X X;  1C3T A;  4WUR A;  3EUB 2;  4AQ7 A;  4DXG A;  2ICI A;  4MGZ E;  2HTH A;  2BB5 A;  4FN2 A;  3JVZ X;  1YQB A;  5D94 A;  3T8M A;  1GNU A;  2PW9 A;  2G9H D;  4K7W A;  2GBR A;  3T3O A;  2VZK D;  2C9W B;  3VUY A;  1ZDV A;  1SE9 A;  1AYF A;  1TYG B;  2WXG A;  5IA7 A;  4L2Y A;  3QK0 A;  4HKQ A;  1YJ1 A;  3HK0 A;  1YJJ A;  1E0Z A;  4RMA A;  2DEN B;  1NI3 A;  3I9V 1;  2YEP B;  1KLU D;  2V0G A;  4BAX A;  4EE2 A;  2IND C;  5MPO A;  4R3D A;  2IGD A;  2EKI A;  2MBQ A;  2WXH A;  3GZN B;  1J7A A;  2K8C A;  2EMS A;  4WJO A;  2LI5 A;  3CWI A;  2KX0 A;  1KLV A;  4WJQ A;  2FNJ B;  2D3G A;  3PZD A;  2N9X A;  2D2Q A;  1E7U A;  2N9E B;  3EEC A;  2NTT A;  4W9H A;  3U8Z A;  2FCQ A;  1Q0W B;  1P0R A;  2WYQ A;  4BFR A;  3VFK A;  2WXJ A;  1R4N I;  3DBS A;  2FE8 A;  4CO7 A;  1D5M C;  3R2I A;  2MP2 A;  4K3C A;  1SJH D;  2EKE C;  1L0X B;  5FR6 A;  2KZR A;  4M8M A;  3OJ4 B;  1ISN A;  1QOA A;  2AQ2 B;  1LO5 D;  3TUO A;  2QJL A;  1J7B A;  1C4C A;  3P4Q B;  1YOV B;  3ZNZ B;  3R2T A;  2KFK A;  1WGR A;  3DHG C;  4OVU A;  2NPT A;  1D5Z C;  5JHB A;  2KHW B;  4FJZ A;  2KTR B;  3DBR I;  4WH4 A;  3RMK C;  3BK2 A;  1J19 A;  5AUK A;  1GJZ A;  5AZG A;  1IUE A;  2C7H A;  4WIP A;  2D07 B;  2WXR A;  3E56 A;  1WGG A;  1Z5S B;  1WSP A;  5CHV C;  4TQ0 A;  2KKC A;  3AE2 B;  3L54 A;  2XBB C;  3ALB A;  2KVR A;  2Z8L A;  2IZV B;  1OTR B;  3ZXR A;  1UEL A;  3WAP A;  4HLE A;  3CSF A;  3M3J A;  3L4P A;  3WCQ A;  4DK5 A;  1WXS A;  2MBO A;  4A90 A;  4P16 A;  2WDQ B;  2W82 A;  4OZA A;  3MC9 A;  1QOG A;  5BYS A;  2QDF A;  1SXT A;  4AUQ C;  3TBL D;  5LLI A;  1FIQ A;  4JL9 A;  2KQ7 A;  4MEL A;  1R4M B;  2O6V A;  2KOX A;  1ZXH A;  3U52 E;  1UD7 A;  3R7R A;  1JML A;  3JSV B;  3B2F A;  1LGR A;  3EFU A;  1XQQ A;  1D5X C;  4AOF A;  3U4E G;  5CHW A;  3ZNH B;  3TEX A;  1F2R I;  4DDG D;  3SFD B;  2HE7 A;  4KGS A;  3D32 A;  1C4P A;  1WE7 A;  1ZXI A;  2G1E A;  3NVZ A;  1WY8 A;  1C9F A;  3DBL I;  2D3C A;  3RI7 C;  1VJK A;  4LDT B;  3KH0 A;  3NZS A;  4CYE A;  5D7G A;  4HDQ A;  4GLS C;  3CST A;  4DBG A;  1V86 A;  4HPP A;  3V3X A;  3A9J A;  1SIJ A;  3P1M A;  4MGY E;  3VAW A;  3P4S B;  4KSL C;  2LHE A;  3Q3M C;  2LJ5 A;  2WWZ A;  3V61 A;  3VTW A;  3W2D A;  2HJ8 A;  1HTQ A;  2WS3 B;  3V6C B;  2DAJ A;  1TT5 B;  1FPY A;  1XCQ L;  4HDO A;  1FCL A;  4HXD A;  1OQY A;  3DWG C;  1WZ3 A;  4B95 A;  3N1X C;  1N60 A;  1ZP0 B;  4MSM B;  2LGY A;  3KLS X;  4M02 A;  2LXC A;  4C56 C;  3I57 A;  4LNN A;  1JW9 D;  3FIL B;  1TBE A;  4MSQ B;  4IM0 A;  1XLO A;  3L17 A;  3VRB B;  3C8Y A;  2DLB A;  3IAS 1;  2IDY A;  1ZW7 A;  4XYC A;  3EGR A;  3MJW A;  3RUI B;  3L10 B;  2RGF A;  4NJC A;  4OZB A;  4HWI B;  3W9C B;  2M4N A;  4HVB A;  3RD2 A;  2DYO A;  3AU4 A;  2NMQ A;  5D6J B;  2LGS A;  1HTO A;  3GP7 A;  4LNI A;  3ML8 A;  3BK1 A;  4KV2 A;  3UI3 A;  1VD2 A;  1JWB D;  1JWS D;  1OEY A;  4GDL A;  4XX5 A;  2MEK A;  3QIJ A;  1E9M A;  3P4R B;  2KO3 A;  2BGF A;  2SEB D;  3N3K B;  1GB1 A;  5FK9 C;  4Q2J A;  4D2K A;  3BYY B;  3N30 A;  1A5R A;  3Q69 A;  2KK8 A;  2G4D B;  2K8H A;  2K22 A;  2W55 A;  3O13 A;  2KTF A;  2GMI C;  5C1Z A;  1TIF A;  4BKS D;  4F1S A;  4K7S A;  3RNC C;  1PYW D;  2ZZP B;  2BWE S;  2J0J A;  1DYQ A;  1FXI A;  1TZO A;  2J4X A;  3MHZ A;  2BT6 A;  1C76 A;  4GB9 A;  4XE0 A;  2KWU B;  2D11 A;  4BOS C;  5L95 C;  4WWN A;  4YTM B;  1TS2 A;  1FO4 A;  2RD0 A;  3P2B A;  2JUO A;  1WGK A;  1TS5 A;  2KDF B;  4RGM A;  5T8I A;  1ROE A;  1I4R A;  3DVG X;  1I35 A;  2IO1 B;  3DHI C;  2BW2 A;  5LXI B;  3WA0 A;  1L7Y A;  3OAW A;  2JU6 X;  2PKO A;  1RM6 C;  3DOW A;  4YXD B;  1UNS A;  1E7V A;  1J8C A;  4M0W A;  3L0W B;  3AI5 A;  3W5U B;  3Q14 C;  2BYF A;  1V1P A;  2WXQ A;  2E3T A;  2MW5 A;  3ZO5 B;  1TY2 A;  1ACC A;  4S0R A;  5BMG A;  2GOW A;  2GI9 A;  4IWQ A;  4DQO C;  2EMT A;  3KWV A;  4P6V F;  2RDG A;  1VCB A;  1MPE A;  3AED B;  1HZ6 A;  2K5P A;  4K1R B;  1GC7 A;  5IO9 A;  4A20 A;  1CK1 A;  3AE6 B;  1T0S C;  2MSE D;  3AN1 A;  3BY4 B;  2BBC A;  4W9D A;  3Q8F A;  1JWU D;  4HJK A;  4MM3 A;  1PFD A;  5CHF A;  4JGH B;  3Q3O C;  4P1B C;  4K7U A;  2IY0 B;  2VH1 A;  2C7M B;  2JXX A;  2VRR B;  1WXM A;  4EKU A;  4JWS C;  4RGN A;  1E8Y A;  1WRD B;  3DHH C;  2V3P A;  1IBX B;  2BB6 A;  2N7E A;  3ABV B;  3U2S C;  1L6V A;  2Q5W D;  1JWM D;  3UIO B;  4IWP A;  2IGG A;  4NAW B;  2V3N A;  1EU3 A;  2WXI A;  3T3N A;  2NBV B;  2M17 A;  4ANX A;  3CMM B;  2J42 A;  3U30 A;  3PHW B;  3R3M A;  3AEE B;  2M8S A;  3ZJT A;  2G45 B;  3V05 A;  2KFJ A;  2XK5 B;  4J6I A;  1AN8 A;  4C7Z A;  4XWW A;  3DVN U;  2JQR B;  2LJI A;  1GG3 A;  3Q3F A;  3GZN I;  2BPS A;  4MGK E;  3DVN V;  1NEK B;  2LFI A;  2OED A;  1ZGU B;  3AH7 A;  3DWM A;  4KIK A;  2NBW B;  4NPN A;  1C4A A;  1P98 A;  2ASQ A;  1I4X A;  5IN7 A;  2DNF A;  3N1Z C;  4JIO U;  5HI1 A;  1H4R A;  3ZJU A;  5J17 A;  1F2R C;  1AAR A;  1I4Q A;  4IW0 A;  2W3R A;  2WP9 B;  3N20 C;  1YX5 B;  3VTU A;  1I4G A;  2DZM A;  3VR9 B;  2KAC A;  5G55 A;  5AUI A;  1TKE A;  1JQ4 A;  4XDD A;  2B76 B;  2BS3 B;  4LNK A;  4W9L A;  1P9D U;  2KC1 A;  4K3B A;  2KDB A;  3ZKJ C;  3BYT B;  3NOB A;  1WR6 E;  4DXA B;  3RNA C;  1J7C A;  3H9D A;  4ZRP A;  3FKY A;  2V4I B;  4PS7 A;  2K6Q A;  2C60 A;  3BVM A;  2LGI A;  2I1J A;  2QMT A;  4FJV B;  1WJU A;  2JF5 A;  3A9K A;  2FUG 1;  4GN1 A;  2PTL A;  4RM8 A;  3DVG Y;  4GSW A;  3PRZ A;  4IDI A;  3GB1 A;  1ZE3 D;  3LXF A;  2PPH A;  2NBU A;  1F77 A;  1WE6 A;  1FMA D;  4G0N B;  2NVU I;  3HIZ A;  1FM0 D;  2KDE B;  3H8H A;  2K0P A;  1UH6 A;  2BKF A;  1FFU A;  4F8C B;  2JWZ A;  4BBN C;  2PE9 A;  2GBM A;  3KWL A;  2MX2 A;  1UGM A;  2WDR B;  4GGQ A;  2BQQ A;  3TEY A;  1JRU A;  1NYQ A;  4KGR A;  4WWO A;  2RDH A;  4KKI A;  2G3Q B;  2KDI A;  2NCN A;  1WM3 A;  4ICU A;  2LMC A;  3KUC B;  4II2 B;  4B6W A;  3L08 A;  4LJP B;  1TS3 A;  4XC2 A;  2N0S B;  5EE0 A;  1C78 A;  2WHI A;  5E6P A;  3SHQ A;  1EO6 A;  4N6E B;  5HG2 A;  2J7Q B;  4A6Q A;  2MP2 B;  1R4M I;  3TEW A;  3HUI A;  1WI0 A;  3ZIM A;  2NTS A;  4PK1 A;  4ZYN A;  2KJR A;  3PGE A;  3A4S C;  4NJ7 A;  3AE1 B;  4OW0 A;  4B9K A;  3UF8 A;  2JYE A;  1RFK A;  2KLG A;  3C0R B;  4IC7 B;  3HRD D;  2JSV X;  3IT4 B;  1ET9 A;  4LLG M;  3R66 C;  2KFK B;  5I4D A;  1MFW A;  2NPT B;  3IXS A;  3ZYY X;  1FD6 A;  3P4P B;  3BII D;  3JW0 X;  5GMV A;  3M63 B;  5E6J A;  1L2N A;  3ZLZ A;  2AQ3 B;  3JYU A;  4IKG A;  3URY A;  5DPW A;  3I5J C;  2RMM A;  2N4F A;  3BIN A;  1YQ4 B;  2WXF A;  2WXP A;  1WMH A;  1N5W A;  3MP9 A;  2J0M A;  1E8W A;  1PGX A;  5J18 A;  4US8 A;  4AS1 A;  2X38 A;  3PSE B;  3DPD A;  4BKS A;  3AMZ A;  4O1N A;  1TJE A;  2BTE A;  2V3S A;  4J3O D;  2CU1 A;  3PS6 A;  4N59 A;  3ZDM C;  5JZE B;  1IGD A;  2KWV B;  4N58 A;  2MJD A;  3IAM 1;  4LNO A;  2TSS A;  4LTU A;  3EHV A;  4KKJ A;  3N1Y C;  1SE2 A;  3V62 A;  4E71 A;  2EEL A;  2N1V A;  2INN E;  2BKR B;  3PRE A;  3AM9 A;  2OOB B;  1WX8 A;  1TS4 A;  2KWC A;  2O6V B;  3ZVV A;  1E5W A;  2ZEQ A;  3ZGZ A;  4JPS A;  4KSK C;  2R2O A;  1F9J A;  1VLB A;  4RNA A;  2UWQ A;  3TCA A;  4BVU C;  1UBQ A;  1BT0 A;  4EEW A;  2H88 B;  1EM7 A;  4M8N A;  3PRP B;  4LCD E;  1VDV A;  2DHZ A;  4FUL A;  3VH3 B;  2L76 A;  2CKH B;  4MH0 E;  2W54 A;  2MLB A;  4IUM B;  2AX5 A;  4ICV A;  2K39 A;  1J0G A;  3KYC D;  1VZ6 A;  4A3O A;  1YX6 B;  3DCG A;  1XCT L;  4FLH A;  4C80 A;  3A9J B;  1N5X A;  2NS5 A;  1OFF A;  4IWO A;  1Q5W B;  1V5T A;  2M19 A;  4ZYS A;  3RPF C;  2K25 A;  3ML9 A;  2MBB B;  1V1O A;  2PMV A;  3APD A;  2GLS A;  2I2Y A;  2LUE A;  2PVG C;  2ZNV B;  1T0R C;  2LVO A;  1N6Z A;  1XT9 B;  4G50 A;  4MEM A;  1EF5 A;  3UQA A;  2ZCC A;  3RNF C;  3BVZ A;  3QCA A;  2R61 A;  4DHJ D;  3J9C A;  4ZRI A;  1A70 A;  2ZVO A;  4B0M A;  1G6J A;  5CTR C;  1UZX B;  2L05 A;  4REZ A;  3WAL A;  2OJW A;  5BMI A;  2GBK A;  3RNB C;  2MJ3 A;  3Q8B A;  3AE7 B;  1WFY A;  1QOF A;  3EFC A;  3AE4 B;  1KF6 B;  2ZPN A;  2O2V A;  2MQJ A;  2KQ4 X;  1V97 A;  3ZTD A;  1F52 A;  4TV3 A;  3QAR A;  4GDL B;  3HVD A;  3IT6 B;  4TKN A;  2C7N B;  2KMA A;  3VXW A;  4JWU C;  3W5V B;  2HDE A;  4IM2 A;  1SF0 A;  4LK0 M;  3EC8 A;  2L7R A;  2RDB C;  3AEF B;  3KQ4 A;  1N61 A;  3RZF A;  2UU7 A;  2WXO A;  1ZUD 2;  3KUD B;  1C79 A;  1P7F A;  2FIF A;  3PTF C;  3K9P B;  3S2A A;  4YSY B;  3RN9 C;  1V9J A;  1KM7 A;  5D2M B;  3ZNI D;  1X1M A;  1QLB B;  2K3U A;  3RNE C;  2LGX A;  2BYV E;  1B9R A;  2LUM A;  3I3T B;  4KZ0 A;  2VZK B;  4P1C C;  2L3Z A;  4HCN B;  5FKA C;  3ZUN A;  4BKT A;  2JRH A;  3PVL A;  3GE3 C;  4BKG A;  4WAF A;  3O65 B;  4FHJ A;  2AQ1 B;  1WX7 A;  4DHZ E;  3VRA B;  4FAD A;  2WX1 A;  1OGW A;  1I42 A;  2HJ1 A;  4I6N B;  2GBJ A;  1SB3 C;  1JAL A;  1SE3 A;  2PLP A;  4L23 A;  3VTV A;  1XLN A;  4M0W B;  2JT4 B;  4OZC A;  3IG3 A;  4W9G A;  1V1P B;  4WJP A;  3PHX B;  4KVG B;  1WGH A;  1TGZ B;  2MJE A;  3RZW C;  3W1S C;  1CZP A;  1KJT A;  5BMH A;  3H7P A;  1M94 A;  1MG8 A;  3Q8E A;  1L5P A;  2DBY A;  3TIX A;  1T0Y A;  4USA A;  2KN4 A;  2ZVN A;  1B1Z A;  4ZHO A;  2AWT A;  1YIW A;  4MM3 B;  5GXG B;  4HRS A;  2YLM A;  1DGJ A;  1WIA A;  5EE1 A;  3PT2 B;  1P3Q U;  4IOI E;  5AEK B;  1KFY B;  3DBH B;  5TSS A;  1PDX A;  4HEA 1;  2Y5P A;  1N63 A;  4C4V B;  1HE8 A;  3OG5 A;  4MJS A;  3SD5 A;  2YVC A;  2XEW A;  1WYW B;  2AL3 A;  4BOZ B;  1V8C A;  3ETR A;  4GXB A;  1EF1 A;  4EOY A;  3QJZ A;  1IYF A;  2CHZ A;  3AE5 B;  5L83 A;  2QCZ A;  2KXJ A;  4KGT A;  1P7E A;  4YSX B;  1ZOY B;  4HPM B;  1EWC A;  1VR9 A;  1Q1O A;  3MFG A;  2ZW0 A;  3MJ5 A;  4ZRK A;  2Y5B B;  2GRI A;  4ANV A;  2Z0D B;  1GPX A;  1IP9 A;  2MH7 A;  4KIK B;  4YSZ B;  3RT3 B;  4C4V A;  1F1H A;  4HRO A;  1UWX A;  1RRB A;  2R2Q A;  5IP4 D;  3QAQ A;  4NY0 A;  4TQ1 A;  4ZRQ A;  4ASW C;  4FHK A;  3Q6B A;  3H1U A;  2OJR A;  2KMC A;  1AW7 A;  1PGB A;  2WXL A;  3TMP B;  2LZ6 A;  1E7P B;  3NZU A;  2E6X A;  1E8Z A;  4ZHP A;  1DOX A;  1H8C A;  3ECI A;  2J0K A;  2UYZ B;  1L4D B;  1C1Y B;  4G11 A;  3VVW B;  1Z2M A;  3UIP B;  5HHD G;  4X57 B;  4RM9 A;  3M95 A;  2KDM A;  1IPG A;  1C77 A;  1HEZ E;  2CHW A;  2K6D B;  4RFB A;  2QEJ C;  4URK A;  2K9X A;  1DOI A;  2ONQ A;  2DYM A;  3KUZ A;  1RWS A;  2DYB A;  1V5O A;  3A9K B;  1NDD A;  3QWZ B;  4FA6 A;  4HPL B;  3KYD D;  1E90 A;  4WQO B;  2MRP A;  4LDT D;  2WXK A;  1UWM A;  1Y56 A;  5G2N A;  2ON8 A;  2J52 A;  3GS2 A;  2WXM A;  3OJ3 A;  1HQR D;  4NZL B;  4ZOH C;  4EFO A;  2XN9 C;  5G5G A;  4IM3 A;  4EZL A;  4JQW C;  4FJY A;  3NS8 A;  1S1Q B;  3WIM A;  2WDT B;  2RPQ A;  2DZJ A;  4GDK A;  1I4P A;  2V4L A;  2KT7 A;  3ZRF A;  2BS4 B;  1K8R B;  1RAX A;  1T3Q A;  1WXV A;  4S17 A;  4JE3 B;  2KLC A;  3SFE B;  1QT9 A;  3TSS A;  1UF0 A;  4BZA A;  1YJI A;  3LYY A;  3ZXV A;  4MT5 A;  5DPS A;  1TKY A;  4II3 B;  3PZ8 A;  3KW5 B;  1YD8 U;  2HTM E;  1WM2 A;  1QOB A;  1XLQ A;  1T6B X;  2PVO D;  2BWF A;  4HCP B;  4XWT A;  3X0W A;  2DZI A;  1Q10 A;  2WDV B;  2IO2 B;  4GOC A;  2L83 A;  4C00 A;  4ANW A;  3NVY A;  2V1Y A;  1WF9 A;  2KVZ A;  3I63 C;  3ZQ4 A;  1FCC C;  1SIF A;  1D6E C;  1RLF A;  3A1Q A;  2IGH A;  1FNW A;  3PLV A;  3BWU D;  4DDI D;  2WXN A;  3FC4 A;  1NYR A;  3PPA A;  4OHJ A;  4KDI C;  1WMH B;  4NNJ B;  1BML C;  1V81 A;  3NHE B;  1E6E B;  3ZNG C;  2WNM A;  4FBJ B;  5C23 A;  3WAO A;  5CX3 A;  1N62 A;  5DPT A;  2JZZ A;  3AU5 A;  1GAQ B;  3AE3 B;  4HKZ E;  4JX1 C;  3MHS D;  1TKG A;  4KDL B;  1PGA A;  3VUX A;  4P7I A;  4WAA A;  2JXT A;  4EZK A;  5LXH A;  1FRD A;  2A5U A;  3GE8 C;  1JRP A;  3AEA B;  4N9F 4;  2BYE A;  4NQK E;  1QZE A;  3VR8 B;  1V6E A;  1YN5 A;  2QIE B;  3IVF A;  1KRH A;  4XDC A;  5H92 C;  1HZ5 A;  2RR9 A;  2L32 A;  1I4H A;  4A9A A;  2IO3 B;  2DX5 B;  3TL5 A;  5BYR A;  1PUT A;  3R8B A;  2DZK A;  2LD9 A;  3Q2A C;  2MCN B;  3AE8 B;  2LVQ A;  4ANU A;  2KN5 A;  3CF6 E;  1WJN A;  3N32 A;  5BO4 B;  2PEA A;  5JXV A;  2W3S A;  3B2G A;  3MC8 A;  4OVZ A;  4F7Z A;  4ARI A;  3ONS A;  3Q8C A;  2FAZ A;  4ITK A;  2WX0 A;  4OVV A;  2MBH A;  5EE9 A;  3NG0 A;  1WZ0 A;  4TMA B;  1FEH A;  1YNT E;  4DHZ B;  4RF0 A;  5D3I B;  2D3B A;  3HM3 A;  1NEN B;  2BVC A;  1E10 A;  5C2T B;  2M0A A;  2JWU A;  1WGD A;  1L0V B;  1RFA A;  1FRR A;  3Q8A A;  1QF6 A;  4RF1 A;  2KWD A;  2B3A A;  5IKC M;  4CQN A;  2ZJD A;  5DCN A;  4KX6 B;  1P1A A;  1GB4 A;  1S3S G;  4A8X C;  2N9P C;  1D4B A;  2BF8 B;  5IAA C;  2WU5 B;  5H8Y E;  3P63 A;  3VH4 B;  3RFZ B;  2KTR A;  3MTN B;  3SR6 A;  3AEG B;  2FCS A;  3WAN A;  1L6U A;  2W9N A;  1LQB A;  2IJ0 A;  3HHM A;  1QKZ A;  3UIN B;  3HVZ A;  4YTN B;  1EWY C;  2QIL A;  4ACF A;  3NVV A;  1V2Y A;  2D10 A;  3SDL C;  2PJH A;  2JY6 A;  4E3C A;  1IGC A;  4XGA B;  5AZF A;  2ZW1 A;  1WWT A;  1MVK A;  1HXY D;  5AZH A;  2L0T A;  3PV1 A;  1KTK A;  2L8J A;  2ZCB A;  2RPV A;  2ACZ B;  2O2V B;  1UBI A;  3AB5 A;  2N1W A;  5E6O A;  3X23 A;  1WGY A;  5FR3 A;  4UDU C;  1ET6 A;  2GBN A;  1CMX B;  2N7J A;  5TR5 A;  2PE6 B;  2Z0E B;  2V9H A;  5KHQ A;  2QHO A;  1R4N B;  2JVC A;  3VDZ A;  2IO0 B;  2KNB A;  3LJ3 A;  5J2R A;  1CJE A;  1GC6 A;  1XF5 L;  5HKH A;  2CHX A;  4AWJ A;  3ZTC A;  2N7D A;  2JYT A;  4PYU A;  4W9J A;  4W9K A;  2FCM A;  1OQR A;  2Z59 B;  3AV8 A;  4TUU A;  2FBW B;  2CU3 A;  1K53 A;  3JSV A;  1LM8 B;  2QSD A;  1T0Q C;  2AEH A;  2JPH A;  3H7S A;  3U7Z A;  3CIR B;  3W1S A;  4QAY A;  1SBB B;  4PS3 A;  3DBR B;  2KAN A;  2J53 A;  2KX3 A;  3VHT C;  3IHP C;  3AE9 B;  4W9I A;  3DBH I;  1EU4 A;  3W1Y A;  4NJ6 A;  3ZJV A;  1L4Z B;  2CJO A;  3H6N A;  3PLU A;  1Y8R C;  4EZJ A;  2N9K A;  3NS1 A;  1XLP A;  3ENE A;  1AWD A;  3UGB B;  1QIL A;  3Q3N C;  1BXT A;  3UQB A;  4RGT A;  1NI2 A;  4AJW A;  1WRI A;  1ZPS A;  2I1K A;  1ZKH A;  3U7D A;  3IFW B;  4WWM A;  2JZP A;  3AUL A;  1LXD A;  2L00 B;  3R7Q A;  3M62 B;  3NJT A;  4KZC A;  2MHJ A;  4CHK A;  4G3X B;  4YT0 B;  1HA5 A;  3E9S A;  2IYD B;  3SU8 X;  3PZ7 A;  3GOE A;  1VZ7 A;  3H7P B;  1UGJ A;  3QHT A;  3FIL A;  4PS8 A;  2JRI B;  3QC8 B;  3QA8 A;  4B0E A;  3OWE B;  1SE4 A;  2LGD A;  4WJN A;  3A33 B;  4I6L B;  4XZ4 A;  1UUP A;  3RCZ A;  2LXA A;  4BBN F;  2MA9 B;  5D3D A;  4YWG G;  1K50 A;  3IBE A;  3OLM D;  5EE3 A;  4JLC A;  1SGH A;  1MG4 A;  4AP4 C;  2JX5 A;  1TY0 A;  1WX9 A;  4E74 A;  4H2A A;  4M00 A;  1WR1 A;  2FID A;  1LFD A;  3RUL A;  5IOI A;  1YN4 A;  3V6E B;  3V60 A;  3B08 A;  2KJH B;  3K9O B;  2Y3A A;  3EA6 A;  2LWP A;  4HJG E;  3DBL B;  4MJS B;  3ZRC A;  4MDK E;  1D3Z A;  2KC2 A;  5KHO A;  4W9F A;  2L52 A;  2ZNV C;  2OHF A;  2M56 B;  3N9Y C;  5G5H A;  1T5X D;  2CR5 A;  2G4S A;  2DWQ A;  2I38 A;  4MH8 A;  4AJY B;  3NZ3 A;  4YTP B;  1ESF A;  2DAF A;  1SJE D;  4US9 A;  3RNG C;  1MHH E;  4L1B A;  1FXT B;  1VRA B;  3BZD B;  4WWP A;  4LNF A;  4A55 A;  3MC0 B;  4RCO A;  4I6P A;  5HFY A;  3WAM A;  1PQS A;  4RGO S;  5JHA A;  4MGI E;  1FFV A;  1V80 A;  2D5G A;  2FCN A;  4NAM A;  2IY1 B;  2KJ6 A;  2L0F A;  4FXC A;  3TJP A;  3AEC B;  4GMV A;  4NQL B;  4WQM A;  2REX A;  2BS2 B;  3KVF B;  3PO0 A;  2O6V D;  4PT5 A;  1GOZ A;  4ARC A;  2KQS A;  5JH5 C;  2L1A A;  3B0A A;  1JWA D;  1R7S A;  2HD5 B;  3A4R A;  4YL8 A;  1M4V A;  2LHD A;  1FNV A;  2XNA C;  4A3P A;  3NY5 A;  3LDZ E;  1XD3 B;  3PRM B;  4TSS A;  1STE A;  1EUV B;  1NBF C;  3L13 A;  3APF A;  5C3J B;  4M01 A;  2ZPY A;  3NVW A;  2GB1 A;  1U4A A;  2MBE A;  1TTN A;  2H89 B;  4LJO B;  4EUT A;  3DQV A;  4HK2 A;  2AYO B;  3C19 A;  3VUW A;  1KOT A;  5DPR A;  2KYW A;  1DOY A;  1I7H A;  2WGS A;  1WYG A;  1TZ1 A;  2KD0 A;  4GU2 A;  3ZW3 A; 
#chains in the Genus database with same CATH homology
 2K1F A;  2KK8 A;  3QX1 A;  4FBJ B;  5C23 A;  2G4D B;  3WAO A;  3A9J B;  2K8H A;  5CX3 A;  5DPT A;  2JZZ A;  2A4Z A;  3AU5 A;  2NS5 A;  2KTF A;  2GMI C;  3HM6 X;  5C1Z A;  4IWO A;  1Q5W B;  1V5T A;  4ZDV A;  4BKS D;  4F1S A;  4K7S A;  4K81 A;  2ZZP B;  2K25 A;  3MHS D;  2BWE S;  4KDL B;  3ML9 A;  2J0J A;  3VUX A;  3B1L X;  1WJ6 A;  2MBB B;  4P7I A;  4WAA A;  3APD A;  4EZK A;  5LXH A;  2A5U A;  2LUE A;  4N9F 4;  4GB9 A;  2BYE A;  4NQK E;  2ZNV B;  1QZE A;  1V6E A;  2KWU B;  4GDK B;  2K8B A;  2D11 A;  2LVO A;  4G50 A;  1XT9 B;  4MEM A;  4BOS C;  3L16 A;  1EF5 A;  3UQA A;  2ZCC A;  3IVF A;  5L95 C;  4WWN A;  3ZDT A;  4DWF A;  3QCA A;  4W9C A;  4DHJ B;  2RD0 A;  3P2B A;  2JUO A;  2KDF B;  2RR9 A;  3APC A;  4DHJ D;  4ZRI A;  2LRW A;  2ZVO A;  2IO3 B;  2DX5 B;  2NR2 A;  3DDC B;  4NAW A;  3TL5 A;  2C5L C;  3DVG X;  1I35 A;  2IO1 B;  3VQI A;  1G6J A;  2CS4 A;  3Q3J A;  2DZK A;  5CTR C;  2LD9 A;  1UZX B;  5LXI B;  3WA0 A;  1L7Y A;  2MCN B;  2L05 A;  3OAW A;  2LVQ A;  3WAL A;  4ANU A;  5EDS A;  2KN5 A;  3CF6 E;  3T9L A;  1WJN A;  3N32 A;  5BO4 B;  2FUH B;  3AXC A;  1WJ4 A;  3DOW A;  2AL6 A;  2PEA A;  2GBK A;  1E7V A;  2XK5 A;  4GIV A;  1J8C A;  3L0W B;  4F7Z A;  3ONS A;  1WFY A;  1OEY J;  3AI5 A;  2FAZ A;  1WH3 A;  2WX0 A;  2BYF A;  2O2V A;  2ZPN A;  4W9E A;  2MQJ A;  4ZRJ A;  4OVV A;  3ZTD A;  2MBH A;  2MW5 A;  3ZO5 B;  2M0X A;  4TV3 A;  3QAR A;  1WZ0 A;  4DHZ B;  4GDL B;  4PYZ A;  2RSU A;  3HM3 A;  1WXA A;  4TKN A;  2GOW A;  4IWQ A;  3A1Q B;  2C7N B;  2KMA A;  2LVP A;  3VXW A;  2EMT A;  4IM2 A;  3RYT A;  1VCB A;  1E8X A;  1GUA B;  3EC8 A;  2IBI B;  1WGD A;  4K1R B;  2L7R A;  2M1M A;  1RFA A;  1GC7 A;  5E6N A;  4A20 A;  2JZ3 B;  2LRU A;  3RZF A;  1V49 A;  3KUD B;  2B3A A;  2MSE D;  2FIF A;  3PTF C;  2LAS A;  3BY4 B;  3K9P B;  2ZJD A;  5DCN A;  3S2A A;  3QQ8 B;  4IG7 B;  4W9D A;  1P1A A;  2MWS B;  1S3S G;  1V9J A;  1KM7 A;  2N9P C;  1C3T A;  5D2M B;  4HJK A;  3ZNI D;  4MM3 A;  1X1M A;  2BF8 B;  4MGZ E;  5CHF A;  5IAA C;  2HTH A;  2LGX A;  4JGH B;  2BYV E;  4K7U A;  4FN2 A;  2IY0 B;  3JVZ X;  1YQB A;  5D94 A;  3T8M A;  2C7M B;  1GNU A;  2JXX A;  5J17 A;  3VH4 B;  2KTR A;  3MTN B;  3I3T B;  2VRR B;  4KZ0 A;  4K7W A;  1WXM A;  2L3Z A;  4HCN B;  2GBR A;  4EKU A;  2FCS A;  1E8Y A;  1WRD B;  3WAN A;  2W9N A;  3ZUN A;  2C9W B;  1LQB A;  2N7E A;  3VUY A;  3HHM A;  1SE9 A;  4BKT A;  2JRH A;  3UIN B;  5IA7 A;  3UIO B;  3PVL A;  1V2Y A;  4IWP A;  4BKG A;  3QK0 A;  4NAW B;  3O65 B;  4FHJ A;  1WX7 A;  2D10 A;  3SDL C;  2PJH A;  1YJ1 A;  2NBV B;  4DHZ E;  2M17 A;  3HK0 A;  4FAD A;  4ANX A;  3CMM B;  4RMA A;  3U30 A;  2JY6 A;  3PHW B;  2DEN B;  2WX1 A;  4E3C A;  1OGW A;  1I42 A;  3R3M A;  4I6N B;  5AZF A;  2M8S A;  2G45 B;  2GBJ A;  5AZH A;  2KFJ A;  3VTV A;  2L0T A;  2XK5 B;  3PV1 A;  4J6I A;  4M0W B;  3DVN U;  2L8J A;  2ZCB A;  2JT4 B;  1GG3 A;  2MBQ A;  3Q3F A;  2K8C A;  2EMS A;  3GZN I;  3IG3 A;  4WJO A;  2BPS A;  2LI5 A;  3DVN V;  4MGK E;  4W9G A;  2O2V B;  1UBI A;  1ZGU B;  2KX0 A;  2N1W A;  1KLV A;  5E6O A;  4WJQ A;  4KIK A;  2FNJ B;  2D3G A;  3PZD A;  1WGY A;  2N9X A;  2NBW B;  3PHX B;  2D2Q A;  4NPN A;  1E7U A;  4WJP A;  2N9E B;  1P98 A;  3EEC A;  4W9H A;  2ASQ A;  4KVG B;  3U8Z A;  2GBN A;  1WGH A;  1TGZ B;  1CMX B;  2FCQ A;  5TR5 A;  1Q0W B;  2PE6 B;  2Z0E B;  4JIO U;  5KHQ A;  1P0R A;  1H4R A;  3RZW C;  3W1S C;  2WYQ A;  4BFR A;  2QHO A;  1KJT A;  3VFK A;  2JVC A;  3H7P A;  1M94 A;  1MG8 A;  2IO0 B;  1AAR A;  2KNB A;  3LJ3 A;  1R4N I;  4IW0 A;  3VDZ A;  1GC6 A;  3DBS A;  5HKH A;  2CHX A;  4AWJ A;  4CO7 A;  1YX5 B;  3TIX A;  3VTU A;  3ZTC A;  2MP2 A;  1T0Y A;  2N7D A;  2DZM A;  2EKE C;  4PYU A;  5FR6 A;  4W9J A;  2KZR A;  2FCM A;  4M8M A;  2ZVN A;  2Z59 B;  4W9K A;  5G55 A;  3OJ4 B;  1ISN A;  4TUU A;  2AWT A;  1YIW A;  3JSV A;  4W9L A;  1P9D U;  2KC1 A;  1LM8 B;  2KDB A;  3ZNZ B;  3ZKJ C;  2AEH A;  2JPH A;  2KFK A;  3NOB A;  1WGR A;  1WR6 E;  3H7S A;  4OVU A;  4DXA B;  3W1S A;  2NPT A;  5JHB A;  2YLM A;  3H9D A;  2KHW B;  4PS3 A;  1WIA A;  4FJZ A;  2KTR B;  3DBR I;  3PT2 B;  1P3Q U;  2KAN A;  2KX3 A;  3VHT C;  5AEK B;  4PS7 A;  2K6Q A;  3IHP C;  1J19 A;  2C60 A;  1GJZ A;  4W9I A;  3DBH I;  2I1J A;  4FJV B;  5AZG A;  1HE8 A;  3W1Y A;  1WJU A;  2JF5 A;  2C7H A;  4NJ6 A;  4MJS A;  3SD5 A;  2D07 B;  3A9K A;  3H6N A;  4GN1 A;  1WGG A;  2YVC A;  4RM8 A;  1Z5S B;  1WYW B;  2XEW A;  2AL3 A;  3PLU A;  1Y8R C;  5CHV C;  4GXB A;  1EF1 A;  3DVG Y;  4BOZ B;  4EOY A;  4TQ0 A;  4EZJ A;  2KKC A;  3QJZ A;  3ENE A;  4GSW A;  1IYF A;  3PRZ A;  2CHZ A;  3L54 A;  2XBB C;  5L83 A;  3ALB A;  3UGB B;  2KXJ A;  2PPH A;  2NBU A;  2KVR A;  3UQB A;  1WE6 A;  4G0N B;  1NI2 A;  2NVU I;  4HPM B;  4AJW A;  3HIZ A;  2IZV B;  2I1K A;  1ZKH A;  1Q1O A;  1OTR B;  2KDE B;  3U7D A;  1UEL A;  1UH6 A;  2BKF A;  4ZRK A;  4F8C B;  2Y5B B;  3IFW B;  2JWZ A;  3WAP A;  3AUL A;  4BBN C;  4HLE A;  1LXD A;  2PE9 A;  2GBM A;  3CSF A;  2L00 B;  4ANV A;  2MX2 A;  3M3J A;  1UGM A;  2Z0D B;  4GGQ A;  5J2R A;  3R7Q A;  1IP9 A;  1JRU A;  3M62 B;  4WWO A;  4KZC A;  4DK5 A;  1WXS A;  4KIK B;  2MBO A;  2G3Q B;  2KDI A;  3RT3 B;  2NCN A;  1WM3 A;  4CHK A;  4G3X B;  4ICU A;  3KUC B;  4II2 B;  1RRB A;  2R2Q A;  4B6W A;  3QAQ A;  3L08 A;  4LJP B;  4NY0 A;  4TQ1 A;  2IYD B;  4XC2 A;  3SU8 X;  4FHK A;  3GOE A;  3H7P B;  4ASW C;  4AUQ C;  3TBL D;  5LLI A;  3H1U A;  4JL9 A;  5E6P A;  3QHT A;  2OJR A;  4PS8 A;  2JRI B;  3SHQ A;  1EO6 A;  3QC8 B;  2KQ7 A;  3QA8 A;  4MEL A;  2J7Q B;  2KMC A;  2LGD A;  2MP2 B;  2O6V A;  1R4M I;  4WJN A;  2KOX A;  3A33 B;  1WI0 A;  4I6L B;  4XZ4 A;  3RCZ A;  2LXA A;  3ZIM A;  2MA9 B;  3TMP B;  4ZYN A;  4BBN F;  2KJR A;  2LZ6 A;  3PGE A;  3A4S C;  4NJ7 A;  4B9K A;  3UF8 A;  3NZU A;  1UD7 A;  1E8Z A;  3IBE A;  3OLM D;  3R7R A;  1H8C A;  1SGH A;  3ECI A;  2J0K A;  2KLG A;  3C0R B;  2UYZ B;  3JSV B;  4JLC A;  1C1Y B;  4AP4 C;  4G11 A;  3VVW B;  4IC7 B;  3EFU A;  1WX9 A;  1Z2M A;  4E74 A;  3UIP B;  1XQQ A;  4X57 B;  4AOF A;  3R66 C;  2KFK B;  5CHW A;  1WR1 A;  2NPT B;  4RM9 A;  3M95 A;  2FID A;  1IPG A;  1LFD A;  3ZNH B;  3RUL A;  3JW0 X;  3V6E B;  2CHW A;  2K6D B;  4DDG D;  3V60 A;  3B08 A;  5GMV A;  2KJH B;  3M63 B;  2HE7 A;  3D32 A;  1WE7 A;  3K9O B;  4URK A;  1L2N A;  3ZLZ A;  2DYM A;  3KUZ A;  2DYB A;  2LWP A;  1WY8 A;  1V5O A;  3JYU A;  4MJS B;  3A9K B;  3ZRC A;  5DPW A;  1NDD A;  3DBL I;  3QWZ B;  4MDK E;  4FA6 A;  4HPL B;  1D3Z A;  2KC2 A;  5KHO A;  4W9F A;  2N4F A;  3KYD D;  1E90 A;  3BIN A;  4LDT B;  2ZNV C;  3KH0 A;  3NZS A;  4CYE A;  5D7G A;  4WQO B;  1WMH A;  4HDQ A;  2CR5 A;  2J0M A;  2MRP A;  1E8W A;  4LDT D;  2G4S A;  5J18 A;  3CST A;  4AJY B;  4DBG A;  2DAF A;  1V86 A;  5G2N A;  3A9J A;  3PSE B;  3DPD A;  4BKS A;  4MGY E;  3VAW A;  4KSL C;  1FXT B;  3OJ3 A;  2V3S A;  2CU1 A;  2LJ5 A;  3PS6 A;  4WWP A;  2WWZ A;  3X23 A;  3V61 A;  3ZDM C;  3VTW A;  4EFO A;  5JZE B;  4I6P A;  4IM3 A;  2KWV B;  2HJ8 A;  4EZL A;  4JQW C;  3WAM A;  1PQS A;  4FJY A;  3NS8 A;  1S1Q B;  3V6C B;  2DAJ A;  5JHA A;  3WIM A;  3EHV A;  4MGI E;  2WDT B;  2RPQ A;  1V80 A;  4HDO A;  2DZJ A;  4GDK A;  4HXD A;  2V4L A;  3V62 A;  1OQY A;  3ZRF A;  4E71 A;  1WZ3 A;  2FCN A;  4B95 A;  1K8R B;  1RAX A;  1WXV A;  2IY1 B;  2KJ6 A;  2L0F A;  2LGY A;  4MSM B;  3TJP A;  2N1V A;  2LXC A;  4GMV A;  2BKR B;  3PRE A;  4NQL B;  2OOB B;  1TBE A;  4MSQ B;  4IM0 A;  1WX8 A;  3L17 A;  2KLC A;  2KWC A;  2O6V B;  2REX A;  3ZVV A;  1E5W A;  1ZW7 A;  2ZEQ A;  3KVF B;  4KSK C;  2O6V D;  2KQS A;  5JH5 C;  3MJW A;  5DPS A;  3RUI B;  4II3 B;  3L10 B;  2R2O A;  3B0A A;  3KW5 B;  1F9J A;  1YD8 U;  2HD5 B;  2RGF A;  3A4R A;  2UWQ A;  1WM2 A;  4YL8 A;  3TCA A;  4A3P A;  1UBQ A;  1BT0 A;  4BVU C;  3NY5 A;  4EEW A;  2BWF A;  4HCP B;  3LDZ E;  1XD3 B;  3X0W A;  2DZI A;  3PRM B;  4HWI B;  4M8N A;  2M4N A;  4HVB A;  1EUV B;  3RD2 A;  2IO2 B;  3PRP B;  1NBF C;  4GOC A;  2DYO A;  3AU4 A;  3L13 A;  5D6J B;  3APF A;  4LCD E;  4ANW A;  2DHZ A;  2V1Y A;  4FUL A;  1WF9 A;  2L76 A;  2ZPY A;  3VH3 B;  3ML8 A;  4KV2 A;  2CKH B;  4MH0 E;  1U4A A;  1VD2 A;  2MLB A;  2MBE A;  4IUM B;  1TTN A;  1OEY A;  4GDL A;  4XX5 A;  4LJO B;  1SIF A;  4EUT A;  3DQV A;  4ICV A;  1RLF A;  3A1Q A;  2K39 A;  1J0G A;  3KYC D;  3QIJ A;  3PLV A;  4A3O A;  1YX6 B;  4DDI D;  2AYO B;  2KO3 A;  3DCG A;  4HK2 A;  1KOT A;  3VUW A;  2BGF A;  3N3K B;  3PPA A;  5DPR A;  4FLH A;  3N30 A;  1A5R A;  4KDI C;  1WMH B;  4NNJ B;  1TZ1 A;  2KD0 A;  1V81 A;  4GU2 A;  3NHE B;  3ZW3 A;  3ZNG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...