2EKEC

Structure of a sumo-binding-motif mimic bound to smt3p-ubc9p: conservation of a noncovalent ubiquitin-like protein-e2 complex as a platform for selective interactions within a sumo pathway
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
DPLVPRGSEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SUMO-conjugating enzyme UBC9
publication title Structure of a SUMO-binding-motif Mimic Bound to Smt3p-Ubc9p: Conservation of a Non-covalent Ubiquitin-like Protein-E2 Complex as a Platform for Selective Interactions within a SUMO Pathway
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase/protein binding
total genus 18
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ekeC01
1RLFA 2R2QA 1Q0WB 4A3OA 4W9IA 3D32A 1FXTB 1WR1A 4KDIC 3T9LA 2MBOA 2KLCA 3VH4B 5AEKB 4BFRA 3VH3B 5CHWA 2RGFA 3ZIMA 5J18A 1YJ1A 3CF6E 1EF5A 1Z2MA 4M8MA 4MEMA 4RM8A 4AJYB 1X1MA 2O2VA 4W9LA 3B0AA 4ASWC 5LXIB 2ZVNA 1L2NA 1UBIA 4RM9A 1NDDA 2M1MA 4W9FA 4EUTA 2FCSA 2KZRA 4HDQA 4BKGA 2LRUA 4N9F4 4ANWA 2ASQA 2DZJA 3HM3A 2RPQA 2LGXA 3IG3A 5E6NA 3QQ8B 1WXSA 1YIWA 3APFA 4EOYA 1GC6A 4URKA 2DYBA 2D2QA 2IO0B 3PSEB 2K1FA 4JL9A 2M0XA 2KDIA 2K25A 4DDID 2LASA 3TBLD 4GDKB 5EDSA 2BWES 4RMAA 3R7RA 1GUAB 2BYFA 3DDCB 4TQ1A 2KFKB 2KOXA 5AZGA 1C3TA 1WMHB 2DZMA 4EZKA 1H8CA 4DHZB 2J7QB 4ICVA 4BBNF 4OVUA 3A33B 1WF9A 3ZTDA 5DPTA 3VTUA 4NQLB 1E7VA 3PT2B 4BKSD 4CO7A 4FLHA 2YLMA 3ML9A 1EO6A 3ZRCA 4PYZA 2PPHA 1UELA 1WGRA 1PQSA 3L13A 4F8CB 1WXMA 2MW5A 2I1JA 2C7NB 3MTNB 3QHTA 2L05A 2D11A 3PS6A 2NCNA 4J6IA 4KSKC 3KYDD 2RD0A 3UIOB 2XK5A 1YQBA 3KW5B 2KVRA 3AU4A 2D3GA 2PJHA 4I6LB 3SU8X 2MCNB 4GDLA 1P98A 4I6PA 3VUWA 3ENEA 3HM6X 5CX3A 2L7RA 4AWJA 4ANXA 2HJ8A 1KM7A 4W9EA 5HKHA 3NHEB 1AARA 3U30A 3W1YA 2GBNA 4MDKE 2D07B 4WWOA 4TQ0A 1J8CA 1C1YB 2PEAA 3AU5A 1E5WA 2IZVB 1WJUA 3AXCA 3NS8A 1H4RA 3NZUA 2K39A 3NOBA 2KK8A 2CHWA 4AOFA 5DCNA 2O2VB 2LZ6A 3A4SC 1YX6B 1WJNA 5CHFA 5LLIA 4WJOA 2LI5A 2IY0B 2GOWA 4LJOB 3I3TB 1E8XA 4A20A 3OAWA 5IAAC 3IHPC 1OEYJ 2KXJA 1OTRB 1WR6E 3C0RB 4MGKE 2L0TA 2BKFA 2ZNVC 1E8ZA 3M3JA 4HK2A 4XZ4A 3UQBA 4MM3A 4WWPA 1ZKHA 4JQWC 2O6VA 4IWQA 3WA0A 3DBHI 3X0WA 2WWZA 2N9PC 2CS4A 4TKNA 2N1WA 3APDA 5JHBA 1UD7A 2AWTA 2ZVOA 2MSED 4KIKA 3H1UA 2JWZA 4MSQB 3H7PA 4AJWA 2KJHB 3A1QA 2B3AA 1HE8A 1WXAA 4ZRKA 4W9GA 2FUHB 2ZCCA 4XX5A 3RZFA 4BOZB 1RRBA 4LDTB 2XEWA 1SIFA 2KMCA 4CHKA 4FA6A 2G45B 2MBBB 3EECA 1OQYA 2Y5BB 4LCDE 3ECIA 4GIVA 3PHWB 5AZFA 1ZGUB 2PE6B 3TL5A 1E8WA 4IG7B 1NI2A 5KHOA 2CR5A 3WIMA 3TJPA 3PRMB 4GSWA 4E3CA 2K8BA 3K9PB 3DVNU 3N32A 2XK5B 4B9KA 5E6PA 1UBQA 3VQIA 4DK5A 4NPNA 4GMVA 3L10B 4KSLC 2EMSA 2C7MB 3GZNI 4G11A 5D94A 3IVFA 4GDLB 3QJZA 5D7GA 1VD2A 3R3MA 5L95C 2JRIB 4YL8A 2MP2A 2LGDA 2DHZA 2JF5A 3QX1A 2GBJA 3KH0A 4P7IA 1T0YA 2KN5A 3ZW3A 3S2AA 2I1KA 2MBHA 2JPHA 4MGYE 2NBUA 2ZPYA 4F7ZA 1Z5SB 2V1YA 3MHSD 3AI5A 2KD0A 5IA7A 2REXA 3SHQA 1WI0A 3PREA 4W9JA 2AL3A 3JSVA 3HK0A 2XBBC 3UINB 2WX0A 3PLUA 2N7EA 1K8RB 2FAZA 4ZRIA 4EZLA 2QHOA 4M0WB 3QK0A 4FADA 5KHQA 2D10A 3R7QA 3W1SA 2CHXA 4MGIE 2O6VD 3QIJA 3TCAA 3EC8A 2KANA 5L83A 1LXDA 3PV1A 2O6VB 2JUOA 2ZPNA 1WE7A 1EUVB 4W9CA 3MJWA 4X57B 4IWPA 3QCAA 4ZYNA 4DXAB 2EKEC 4KIKB 1S3SG 3PGEA 2C7HA 4FN2A 1A5RA 1D3ZA 1WRDB 3H7PB 3V6CB 2YVCA 3A1QB 4HVBA 2DYMA 3X23A 3ZRFA 1E8YA 4HPMB 3A9KA 3L08A 3VFKA 2GBMA 4K1RB 4GU2A 3QAQA 1S1QB 1KOTA 2L00B 2LVQA 3BY4B 3DBRI 3VAWA 2MBEA 4MSMB 4M8NA 2JZZA 4E71A 3HHMA 4F1SA 1YX5B 3A9JB 2BPSA 2IBIB 2NS5A 4WJPA 3TIXA 2M4NA 1WZ0A 4G50A 3NZSA 3H9DA 4MELA 3VUXA 1UGMA 3LDZE 3RZWC 3ZLZA 3WALA 2ZZPB 4LJPB 4KZ0A 4NQKE 4DDGD 4EZJA 1V5TA 2DENB 3PVLA 3KUZA 2N1VA 1E7UA 2N7DA 5BO4B 3T8MA 2MP2B 1V2YA 3DOWA 4GOCA 2LJ5A 1WYWB 4G0NB 1KJTA 4B6WA 2GBKA 2JXXA 1BT0A 2FCNA 3H7SA 4NJ7A 2JT4B 5G2NA 1JRUA 4GB9A 4BOSC 2KJRA 3VVWB 1QZEA 2BYVE 4W9KA 3M63B 2J0MA 3L0WB 4K7SA 3QA8A 3U8ZA 3JSVB 1IYFA 1V81A 4IC7B 4NJ6A 2C5LC 2CU1A 2RSUA 2LGYA 4ANUA 4DWFA 2K8CA 1WH3A 3CSTA 3LJ3A 4DBGA 4HWIB 5C1ZA 1WXVA 2K8HA 2VRRB 3ZNHB 5JH5C 4K7UA 4NAWB 5JZEB 4MJSA 4II3B 4IW0A 2HD5B 3ZDTA 2AEHA 4PS3A 1YD8U 5G55A 3OJ3A 2ZCBA 3ZTCA 2MQJA 3DCGA 4IWOA 3RT3B 2L8JA 4LDTD 2BF8B 3KUCB 1GNUA 3GOEA 4ZDVA 2NBVB 4ICUA 3L16A 1M94A 3DQVA 3VUYA 3VDZA 3ZNID 4BKTA 3APCA 3DVNV 1TBEA 2R2OA 3IBEA 4JIOU 4GN1A 3UIPB 2HTHA 1SE9A 5DPRA 2HE7A 3WANA 2NPTA 2KJ6A 3A9JA 4IM2A 4CYEA 1XD3B 4NY0A 5DPWA 1WIAA 3A9KB 3V6EB 3NY5A 3ZDMC 3K9OB 2MWSB 1R4NI 2DZKA 2FIDA 2IO2B 2Z59B 3ONSA 3BINA 3PZDA 2LRWA 3KVFB 3UF8A 3WAPA 3DVGY 2J0JA 2G4DB 2JVCA 2G3QB 4JGHB 2LXCA 4K7WA 2MA9B 3PRPB 3EFUA 4KV2A 1LM8B 4HCPB 4DHJD 2MRPA 2FCMA 3QWZB 4DHJB 1Y8RC 3ALBA 3OLMD 4JLCA 5D2MB 3R66C 2KLGA 3OJ4B 2AYOB 4OVVA 3B1LX 4PS7A 3N30A 3RCZA 3WAMA 2KX3A 1V49A 2KTRA 3M95A 2NR2A 5C23A 5J2RA 1OGWA 2DYOA 3L54A 4FBJB 1P9DU 2A4ZA 5J17A 2KO3A 2CKHB 4KZCA 2CHZA 4HXDA 3DBLI 2DZIA 3PHXB 4FJYA 4WJQA 1V9JA 2G4SA 4BVUC 3V62A 2KFJA 1V86A 2MLBA 4MGZE 2JY6A 5LXHA 4FJVB 4A3PA 2A5UA 2JRHA 4NAWA 1RAXA 2Z0EB 5DPSA 3CSFA 1P1AA 1CMXB 2BWFA 1UZXB 3JYUA 2LUEA 1GG3A 2FCQA 2N4FA 1LFDA 2KKCA 2IO3B 4W9DA 2LXAA 2OOBB 4MJSB 4AP4C 2Z0DB 1IPGA 4GXBA 4DHZE 2DAFA 2L0FA 4IUMB 1SGHA 5JHAA 1ISNA 1Q5WB 5AZHA 2KX0A 3QARA 2ZEQA 1XT9B 1XQQA 3VHTC 2M17A 1TZ1A 1WY8A 3TMPB 1LQBA 3A4RA 5D6JB 1I42A 1GJZA 5FR6A 4HPLB 1WGYA 4IM3A 3DVGX 1WGHA 2KC2A 2LVOA 1KLVA 1VCBA 3CMMB 3P2BA 4I6NB 4PYUA 3SD5A 2NPTB 2L3ZA 3PPAA 2RR9A 2GMIC 4G3XB 3DPDA 4EFOA 2BGFA 1WE6A 3L17A 3QC8B 3B08A 1V80A 2KTFA 4IM0A 4E74A 1TTNA 1R4MI 3V60A 2GBRA 2PE9A 2MBQA 1WGGA 2DAJA 1V5OA 2IO1B 5TR5A 4EKUA 2FIFA 2W9NA 3ZUNA 1L7YA 4II2B 4WJNA 4HJKA 4HCNB 1J19A 3V61A 2KQSA 4MH0E 3UGBB 1G6JA 2C9WB 2JZ3B 4GGQA 2NVUI 2AL6A 2WDTB 2ZJDA 3KYCD 3PLVA 4XC2A 1WFYA 5GMVA 3EHVA 1ZW7A 2M8SA 3VXWA 2L76A 3U7DA 2NBWB 2LWPA 3M62B 2DX5B 1NBFC 1OEYA 2KC1A 2N9XA 2KTRB 3ZVVA 4ZRJA 4ANVA 4AUQC 1WM2A 3ZKJC 2WX1A 4KVGB 2KWCA 1IP9A 1RFAA 1I35A 4BBNC 3VTVA 4WQOB 4B95A 2BKRB 2FNJB 3ZNZB 2LVPA 3W1SC 4HDOA 2IYDB 3RD2A 2KDEB 3Q3JA 1J0GA 3ZNGC 2WYQA 1EF1A 1TGZB 1F9JA 2KDFB 5CHVC 4EEWA 1WX9A 2MX2A 2KWVB 4FHJA 4GDKA 2N9EB 3AULA 1E90A 4TV3A 3H6NA 4HLEA 2K6DB 4W9HA 2ZNVB 3VTWA 3N3KB 2KFKA 5CTRC 3RYTA 1WZ3A 1WMHA 2J0KA 2EMTA 4PS8A 4TUUA 3UQAA 5E6OA 3PTFC 2V4LA 2V3SA 3RULA 3JVZX 2C60A 3ZO5B 1WGDA 1P3QU 1UH6A 2KWUB 2OJRA 4WWNA 3RUIB 3DBSA 3KUDB 4BKSA 1WM3A 2KDBA 2KMAA 2LD9A 1U4AA 1WX8A 3SDLC 2IY1B 3HIZA 1GC7A 1WJ6A 1WX7A 2K6QA 3PRZA 3WAOA 3O65B 2BYEA 2KHWB 3JW0X 1MG8A 1P0RA 4FJZA 4FULA 3ML8A 4KDLB 4WAAA 3Q3FA 2KNBA 1Q1OA 1V6EA 2UYZB 2KQ7A 3IFWB 4K81A 1WJ4A 2UWQA 4NNJB 4FHKA
chains in the Genus database with same CATH superfamily
1RLFA 1Q0WB 2MBOA 4LNNA 2LGSA 1SB3C 1YJ1A 3TEXA 2QILA 1HZ5A 1I4RA 4MEMA 4USAA 2WNMA 2LMCA 4ASWC 4RM9A 1FIQA 5IO9A 3U7ZA 4HDQA 4BKGA 4N9F4 3HM3A 3HUIA 1M4VA 3IG3A 3W5UB 3APFA 2D2QA 1XCTL 3U2SC 2K1FA 4JL9A 2KDIA 2JU6X 4DQOC 5EDSA 1IBXB 3R7RA 3DWGC 1GUAB 2BYFA 3DDCB 5AZGA 2KOXA 1J7AA 4DHZB 5EE0A 1C79A 4OVUA 5DPTA 4NQLB 3PT2B 4BKSD 2QMTA 2IDYA 2PMVA 1ROEA 4PYZA 1UELA 3LXFA 3L13A 4F8CB 1WXMA 2MW5A 3QHTA 2RD0A 2M56B 1YQBA 3KW5B 2KVRA 2Y5CA 2D3GA 2PJHA 3SU8X 2MCNB 1C77A 3ENEA 4AWJA 2HJ8A 5HKHA 3NHEB 1F2RC 4LNKA 3W1YA 2GBNA 2V0GA 1J8CA 2PEAA 5MPOA 4RFBA 2IZVB 1I4GA 1V97A 2K39A 3NOBA 4RF1A 1QOBA 3A4SC 1WJNA 5LLIA 4LJOB 4P6VF 1ZOYB 3OG5A 1FD6A 3RN9C 3LYYA 4C7ZA 1EWYC 2BT6A 3M3JA 1PGAA 3GB1A 4XZ4A 2IGDA 1RWSA 3X0WA 2ZVOA 5AUIA 4AJWA 2B3AA 3MHZA 3AE1B 2NMQA 3V05A 4W9GA 2FUHB 1SIFA 1JROA 4YTMB 4LCDE 3MP9A 2MEKA 1YJIA 3NS1A 5AZFA 1HXYD 4IG7B 5KHOA 4GSWA 3N32A 5E6PA 1C4PA 3FILA 3VQIA 2J42A 3ZJUA 3L10B 4KSLC 2C7MB 1TT5B 3Q3MC 3QJZA 1VD2A 1E0ZA 3KLSX 5L95C 2JRIB 4YL8A 1N60A 2MP2A 2VH2A 2GBJA 4RF0A 4P7IA 2BS4B 3Q8CA 2KN5A 1K52A 2MBHA 5G5GA 1NENB 1WI0A 3BYTB 4W9JA 2AL3A 2WGSA 2N7EA 1FO4A 2B76B 2FAZA 4ZRIA 4EZLA 3IAM1 4M0WB 3QK0A 3R7QA 2WXKA 2CHXA 1IGDA 4AS1A 4MM3B 3P63A 3PV1A 2V3PA 3AE9B 3SR6A 2MJEA 4MH8A 3QCAA 1R7SA 4KIKB 3PGEA 4FN2A 3IT4B 3A1QB 3AE3B 3ZRFA 1N5WA 4HPMB 3VFKA 1S1QB 1KOTA 1WSPA 2L00B 1L6VA 1VRAB 2MBEA 2VZKB 4E71A 3BVGA 3HHMA 4F1SA 3A9JB 2BPSA 4WJPA 1XEEA 3TIXA 2M4NA 1WZ0A 1GB4A 3ZLZA 2WU2B 3WALA 4DDGD 2DENB 2JQRB 4GOCA 1BT0A 2JT4B 1PDXA 1JRUA 1BMLC 2QDFA 5G2NA 4A6QA 4M0WA 3QA8A 3JSVB 4IC7B 1N63A 1V1OA 4R3DA 5T8IA 4DWFA 3LJ3A 4DBGA 5C2TB 4HWIB 2YEPB 3VRBB 4OW0A 4K7UA 3KWVA 4NAWB 4MJSA 2AQ1B 3AE6B 2MJ3A 3AB5A 4XE0A 3MC9A 3ZDTA 2AEHA 4JE3B 3GZNB 3RT3B 2BF8B 3GOEA 4ZDVA 2NBVB 1M94A 3VUYA 3VDZA 3ZNID 3IBEA 3B9JA 1SE9A 2IGHA 1KRHA 3AEGB 3A9JA 4IM2A 1XD3B 5DPWA 1WIAA 2PVOD 1PUTA 1MHXA 3ZDMC 4JX1C 1VDVA 2MWSB 1R4NI 2DZKA 3PZDA 2LRWA 3UF8A 2J0JA 1ET9A 1RM6C 2QCZA 2LHDA 3PRPB 4KV2A 3ZYYX 1LM8B 1SIJA 3GE8C 3N1ZC 4DHJB 4YTNB 1Y8RC 4OZCA 5D2MB 3B1LX 3RCZA 2KX3A 3BZDB 2DYOA 4YSYB 2A4ZA 2CKHB 2WXLA 4FJYA 2K3UA 5LXHA 4C4VA 2KACA 3L4PA 4NAWA 4S17A 1UZXB 3JYUA 3ZXVA 4BZAA 1GG3A 2CJOA 2N4FA 3NRZA 2IO3B 3Q69A 4W9DA 2LXAA 2ZW0A 1T0QC 2OOBB 1T0SC 2Z0DB 2L0FA 4O1NA 5JHAA 4HRSA 1XQQA 3AE2B 3A4RA 1GJZA 2XN9C 5FR6A 2VZKD 1SE3A 4ACFA 2RDHA 4PYUA 2NPTB 3NJTA 3BWUD 3L17A 3QC8B 4US9A 4IM0A 4E74A 1R4MI 3CWIA 2WXOA 1MJDA 1K50A 4II2B 3N1XC 4HJKA 4HCNB 1FNVA 5FKAC 4MH0E 3UGBB 1IUEA 4N59A 2K22A 1I7HA 1SE2A 2PTLA 3VRAB 3PLVA 2E6XA 1FCCC 1ZW7A 3C19A 2V9HA 2L76A 4REZA 2G1EA 2DX5B 1OEYA 2N9XA 3NZ3A 3C8YA 4C7YA 2RDBC 3MJ5A 2BS2B 3ZNZB 2LJIA 4HDOA 5I4DA 3P1MA 2GI9A 1TGZB 4P1CC 3P42A 1F9JA 1WX9A 2MX2A 4FHJA 4GDKA 2WDQB 1E90A 2MHJA 3RYTA 2KFKA 2WXNA 3ZXRA 3AEEB 3JVZX 2DBYA 2OJRA 2WXPA 4D2KA 1KF6B 3SDLC 1U4AA 1WX8A 1TYGB 5IP4D 1YJJA 1K53A 2KHWB 1MG8A 2LFIA 1F1HA 4KDLB 4WAAA 2FE8A 1Q1OA 1V6EA 1NEKB 4K81A 3RPFC 4FHKA 1K51A 1SE4A 4BFRA 1WYGA 5CHWA 1QOGA 1J7CA 1HTOA 1AYFA 4AJYB 1VZ7A 1X1MA 2O2VA 1NYQA 1NDDA 5BMIA 2GRIA 4W9FA 1EU3A 2FCSA 4L1BA 4ANWA 3HVZA 2RPQA 2MH7A 1XLQA 1YIWA 4NZLB 2GB1A 1BXTA 2W55A 1OQRA 4DDID 2DNFA 2LASA 1C3TA 1WMHB 2DZMA 1QLBB 1JALA 3CIRB 1WF9A 3ZTDA 3NVYA 1XF5L 4FLHA 1L0YB 1YMHE 2K0PA 1EO6A 4OHJA 3ZRCA 1L5PA 2PPHA 1WGRA 2L05A 3KYDD 2RDGA 1WXQA 4LNOA 3BK1A 3AU4A 4GDLA 4HROA 5EE1A 1AARA 4TQ0A 1E5WA 3AN1A 1HZ6A 2KK8A 2CHWA 5DCNA 2LZ6A 1YX6B 2LI5A 2IY0B 1XLPA 3I3TB 4A20A 2KXJA 1L0XB 1WR6E 1ACCA 4MGKE 2ZNVC 5C3JB 1MI0A 4WWPA 1ZKHA 4JQWC 2O6VA 4IWQA 2WWZA 2N1WA 3APDA 2AWTA 2LHEA 2N7JA 1I4QA 2JWZA 5BMGA 1ZXHA 3ZJVA 2KJHB 2G45B 2N0SB 4HEA1 2PE6B 3H8HA 3WIMA 1PGBA 3TJPA 1UBQA 4NPNA 4G11A 5D94A 5D7GA 4YT0B 2ZW1A 1FXIA 2JF5A 3QX1A 5TSSA 1T3QA 2N9LA 3S2AA 1QOAA 5HG2A 2R61A 2V1YA 3MHSD 1L4DB 3AI5A 1ESFA 2NTSA 1LO5D 3PREA 3HK0A 1XLNA 1GOZA 5EE9A 1OQQA 5KHQA 2NTTA 1MFWA 4BAXA 2V4IB 4MGIE 2O6VD 2WXRA 3QIJA 3TCAA 1LXDA 3ABVB 3TUOA 2D3AA 4X57B 4DXAB 3RMKC 1A5RA 1WRDB 4KGSA 2YVCA 3BK2A 1J7BA 2ACZB 1E8YA 4L2YA 3A9KA 1STEA 4K1RB 3QAQA 2QC8A 3DBRI 4MSMB 2JZZA 4IKGA 4FXCA 3B2GA 2IBIB 1TS4A 4XWTA 3RNAC 3NZSA 1UGMA 3FILB 2ZZPB 4KZ0A 4NQKE 3KUZA 5BO4B 3DBHB 2MP2B 1V2YA 1QT9A 1IGCA 1KJTA 4B6WA 2JXXA 2WXGA 1ET6A 2FCNA 4M01A 4W9KA 2J0MA 3L0WB 3U8ZA 1TKYA 4HPPA 1ZP0B 3I63C 1FCLA 3CSTA 5E6JA 5G5HA 1CQVA 2BYTA 2VRRB 3ZNHB 5JH5C 4PS3A 5G55A 1P7FA 1JWSD 2ZCBA 1QF6A 1UNSA 2MQJA 2K5PA 4RNAA 2L8JA 4ICUA 4BKTA 3APCA 3DVNV 3KWLA 4JIOU 2KJ6A 4CYEA 1VZ8A 3NY5A 3EFCA 1PGXA 2CU3A 3J9CA 4K3BA 1MPEA 4K7WA 4OZAA 2WU5B 3P4RB 2FCMA 2BB6A 4A55A 3ALBA 4JLCA 3AE5B 3R66C 3OJ4B 1FXAA 2KYWA 1V49A 2KTRA 5C23A 2FBWB 1P9DU 4KZCA 2DZIA 1V9JA 3O13A 3V62A 2M0AA 2JY6A 4FJVB 1HQRD 3TEYA 1RAXA 2OJWA 5DPSA 1WGKA 2HJ1A 1CMXB 1JW9D 2LUMA 2Y5PA 4YSXB 3SFDB 1UGJA 4MJSB 1KH0A 4AP4C 3E9SA 4IUMB 1XCQL 2KX0A 2M17A 1TZ1A 1LQBA 2AQ2B 5D6JB 5AUKA 3AV8A 1V1PA 1KLGD 1WGYA 2KC2A 1KLVA 1KFYB 3CMMB 1YN5A 2YEPF 2INPE 3AEDB 1T0RC 2BGFA 1WE6A 4EE2A 3B08A 2KTFA 2EKIA 1FM0D 4YWGG 1D5MC 3V60A 2MBQA 2DAJA 5TR5A 4EKUA 1FRDA 2WP9B 2KQSA 3TEWA 1G6JA 2C9WB 3AE4B 2JZ3B 4GGQA 2JSVX 4TMAB 3Q2AC 3VR8B 3IAS1 3KYCD 1ZDVA 4WWMA 2NBWB 2VH1A 4IDIA 2LWPA 2KC1A 1SEBD 4LNIA 3UI3A 2GLSA 3B2FA 4AUQC 4WQOB 1SJHD 2FNJB 1MVKA 4C4VB 2LVPA 3W1SC 2IYDB 3Q3JA 1TS3A 4L23A 5CHVC 2IPKD 4EEWA 4TV3A 4HLEA 3H6NA 1XXGA 5CTRC 2MJDA 3UQAA 3MC0B 3PTFC 2V3SA 2C60A 2KQ4X 4WWNA 2JZPA 3KUDB 1GAQB 2KDBA 2KMAA 2LD9A 2JYEA 3HIZA 3GS2A 1NI3A 1JWUD 1TY2A 3DBLB 3PRZA 3JW0X 1BUIC 2RMMA 2PW9A 3P4QB 2J52A 2KQ7A 3IFWB 1TJEA 1WJ4A 2UWQA 4NNJB 4KKJA 2V3NA 1D5XC 4A3OA 4W9IA 3D32A 4KDIC 1TKGA 3RFZB 2WXFA 2RGFA 4TSSA 5J18A 4ITKA 1D4BA 3CF6E 2ONQA 4ZHOA 2KMMA 4W9LA 3B0AA 4MT5A 5LXIB 2ZVNA 1L2NA 1UBIA 2H89B 2JX5A 2L32A 4EUTA 2KZRA 2J4XA 2LRUA 2DZJA 5E6NA 2JXTA 4EOYA 3RNFC 2IO0B 1C76A 2M0XA 2K25A 4XGAB 4GDKB 2KFKB 4EZKA 1H8CA 4ICVA 1JWMD 5BMHA 1E7VA 1SF0A 3PZ7A 1YNTE 2YLMA 4KGTA 1HTQA 2I1JA 2C7NB 2D11A 3UIOB 4K3CA 2XK5A 4YSZB 4XDDA 4I6LB 2WS3B 3AH7A 1P98A 1L4ZB 4I6PA 5CX3A 2L7RA 3EUB2 1L0VB 1KM7A 4W9EA 3Q14C 3BYYB 3U30A 3AEBB 2D07B 4WWOA 1EM7A 3NG0A 1C1YB 4WURA 1WJUA 3AXCA 1H4RA 1OFFA 1WWTA 3NZUA 4AOFA 2O2VB 5CHFA 4B0EA 4WJOA 2GOWA 2RPVA 1E8XA 3OAWA 3C0RB 1TZOA 2L0TA 1E8ZA 4HK2A 4PK1A 5HHDG 3LB8C 2G9HD 5H92C 2CS4A 3P4PB 2WDVB 1DYQA 4TKNA 1UD7A 3SFEB 2OHFA 1GB1A 3GE3C 1XO3A 3H7PA 1C4AA 4ZRKA 1ZDXA 3MFGA 4XX5A 4BOZB 1UWMA 2KMCA 4FA6A 4M00A 3IT6B 3ZGZA 1OQYA 4GIVA 3PHWB 1ZGUB 1E8WA 2BTEA 4E3CA 4DK5A 2TSSA 3AE7B 2D3CA 3GZNI 2X38A 1LGRA 4HJGE 1N61A 4GDLB 3R3MA 4B0MA 1AWDA 2LGDA 4XYCA 4DXGA 3KH0A 3HRDD 2X8XX 3ZW3A 2I1KA 1FFUA 2ZPYA 1Z5SB 2KD0A 2DWQA 3UINB 3Q3NC 1K8RB 1D5ZC 2JWUA 1QKZA 3W1SA 3DBRB 5L83A 3EC8A 2KANA 2O6VB 1WE7A 3MJWA 3URYA 4IWPA 1DOIA 4ZYNA 1S3SG 1SSNA 2CJNA 1D3ZA 3V6CB 4C56C 4HVBA 2DYMA 3X23A 2W82A 2GBMA 3BIID 2AX5A 2LVQA 4KX6B 3BY4B 4HKQA 2DLBA 3P4SB 3H9DA 4MELA 3VUXA 3LDZE 1NVID 3RNEC 3T8MA 3BVMA 1WYWB 2GBKA 3H7SA 4NJ7A 4GB9A 4BOSC 2KJRA 3VVWB 3M63B 4N58A 1JWBD 1IYFA 1L6UA 2CU1A 2RSUA 4ANUA 2K8CA 4XWWA 5C1ZA 1WXVA 2K8HA 4JPSA 4IW0A 4P1BC 1YQ3B 4RGTA 1F52A 3KUCB 2LEKA 2N9KA 3L16A 5BYSA 4OZBA 3UIPB 4ZRQA 1E6EB 1T5XD 4ZHPA 3A9KB 3TSSA 3V6EB 3K9OB 4GLSC 4C00A 2IO2B 2Z59B 3ONSA 2WDRB 1ENFA 1CJEA 1F0ZA 3DVGY 3ZQ4A 2JVCA 2G3QB 4JGHB 2LXCA 2MA9B 4ARCA 3Q8AA 3R2TA 2OEDA 2ON8A 4HCPB 1N6ZA 3OLMD 1V8CA 2AYOB 4OVVA 2L83A 4YTPB 1E10A 3N30A 3WAMA 3NVZA 2NR2A 5J2RA 1OGWA 3L54A 4FBJB 1C78A 3ETRA 3OWEB 1QQRA 5J17A 4HXDA 4WAFA 2G4SA 4BVUC 2KFJA 1V86A 2MLBA 1F77A 4MGZE 4A3PA 2A5UA 2JRHA 1FPYA 1EWCA 3Q6BA 3CSFA 1TS5A 2BVCA 2WXIA 2BWFA 3R8BA 1AW7A 2LUEA 2FCQA 4GXBA 2DAFA 2WXHA 1SGHA 3N20C 3QARA 2ZEQA 1XT9B 3VHTC 4S0RA 1WY8A 2WXQA 3TMPB 1I42A 1PFDA 4IM3A 2LVOA 1FFVA 1VCBA 2INNE 3P2BA 1JRPA 2SAKA 3PPAA 4G3XB 1SBBB 4EFOA 1I4XA 2Y3AA 1GPXA 1V80A 1E7PB 2WHIA 2IGGA 4WQMA 1V5OA 1HEZE 2W9NA 1L7YA 4WJNA 1UF0A 4AQ7A 2AL6A 2WDTB 1C9FA 3AEFB 1WFYA 3EHVA 3U7DA 1VR9A 1NBFC 1VZ6A 3ZVVA 2KTRB 3HVDA 2INDC 4ANVA 1WM2A 3W2DA 4XDCA 3ZKJC 1TS2A 4KVGB 4J3OD 2KWCA 1E9MA 1IP9A 1RFAA 1I35A 4BBNC 3VTVA 1Q10A 4B95A 3RD2A 1R4NB 1DOYA 2WYQA 1EF1A 4LNFA 1DGJA 1Y56A 2PKOA 2KWVB 1IBXA 4C80A 2H88B 2ZNVB 1KLUD 1WZ3A 2EMTA 2HDEA 3RULA 3ZO5B 1P3QU 2KWUB 3RUIB 3NUHB 1V1PB 1CK1A 3AMZA 3AE8B 1NYRA 5IOIA 1WJ6A 4Q2JA 3PZ8A 2WQYB 4CQNA 4FULA 3ML8A 1FNUA 3Q3FA 4RGNA 1VLBA 1EU4A 2UYZB 1ZPSA 2R2QA 3RNBC 1FXTB 1WR1A 3DHIC 3T9LA 2WLBA 2KLCA 3VH4B 1YQ4B 4US8A 5AEKB 3VH3B 4RGMA 3RI7C 3ZIMA 1RYJA 3DHHC 1EF5A 1Z2MA 3GP7A 4M8MA 1N62A 4RM8A 2XNAC 2QIEB 2M1MA 5HI1A 3ZJTA 1QOFA 1FMAD 1N5XA 2ASQA 3Q8EA 2LGXA 3QQ8B 1WXSA 4ZRPA 1GC6A 4URKA 2DYBA 5EE3A 1R4MB 3PSEB 1ZUD2 1HA5A 3TBLD 1TKEA 4ZYSA 2BWES 4RMAA 4A8XC 4TQ1A 1QILA 2HTME 2J7QB 3W5VB 4BBNF 3A33B 4A90A 3VTUA 4CO7A 3ML9A 3EGRA 1PQSA 1JCKB 1FEHA 3MTNB 2KAJA 4KSKC 3PS6A 3DHGC 2NCNA 4J6IA 2KN4A 2KT7A 2PVGC 3N9YC 2LGIA 3VUWA 3HM6X 4ANXA 1UWXA 4P16A 2QEJC 4ZOHC 4MDKE 3AU5A 3BVZA 3MC8A 4NAMA 5JXVA 1TIFA 3NS8A 3R2IA 1SJED 3U4EG 4DXFA 5H8YE 1PYWD 5LNK1 5IAAC 3E56A 2K9XA 3IHPC 1OEYJ 1OTRB 3U52E 2BKFA 3I9V1 4A9AA 1I4HA 1YN3A 3UQBA 4MM3A 2KDMA 3WA0A 3DBHI 2N9PC 5JHBA 4KIKA 2MSED 2M19A 3PO0A 1FRRA 3H1UA 4MSQB 3A1QA 1HE8A 1WXAA 1AN8A 2ZCCA 3RZFA 1RRBA 4LDTB 2XEWA 4CHKA 1YN4A 2IJ0A 2MBBB 3EECA 2AQ3B 2Y5BB 3ECIA 3TL5A 5GXGB 1NI2A 2CR5A 4NJCA 3PRMB 2K8BA 3K9PB 3DVNU 4B9KA 2XK5B 4GMVA 4LK0M 2EMSA 2BW2A 3IVFA 1ZE3D 2DHZA 1D6EC 1T0YA 1TY0A 2JPHA 4MGYE 2NBUA 1FNWA 4F7ZA 5IA7A 2REXA 3SHQA 3JSVA 2XBBC 2WX0A 3PLUA 1C4CA 4WH4A 5HFYA 2QHOA 4FADA 2D10A 4UDUC 2WXJA 2JUOA 2ZPNA 4W9CA 1EUVB 2BBCA 2EKEC 2Z8LA 2C7HA 3H7PB 1KTKA 2SEBD 3L08A 2L52A 4GU2A 4HKZE 2L1AA 3VAWA 4M8NA 1YX5B 4H2AA 2NS5A 3AM9A 4G50A 2D3BA 3RZWC 3KQ4A 3W9CB 4LJPB 4EZJA 1V5TA 1UUPA 3PVLA 2N1VA 1E7UA 2N7DA 3DWMA 3DOWA 2LJ5A 4G0NB 4WIPA 3I5JC 1MHHE 3AECB 1VJKA 3Q8FA 3VR9B 1QZEA 2BYVE 4RH6A 4K7SA 2BS3B 1V81A 4NJ6A 2J53A 2C5LC 4ARIA 2LGYA 3Q3OC 1WH3A 1T6BX 4KKIA 1XLOA 4PT5A 1DOXA 2PLPA 5JZEB 4II3B 2W54A 2ICIA 4LLGM 4KGRA 2EELA 2HD5B 1YD8U 3T3OA 3OJ3A 3ZTCA 3DCGA 4IWOA 4LDTD 1GNUA 1A70A 2Q5WD 3DQVA 1F2RI 1TBEA 2R2OA 3WANA 4GN1A 2HTHA 5DPRA 2HE7A 2NPTA 4YXDB 4NY0A 1JWAD 4LTUA 2FIDA 4M02A 3BINA 2W3SA 3KVFB 3WAPA 3N1YC 2PIAA 2JYTA 2G4DB 3IXSA 3EFUA 4OVZA 3EA6A 2MRPA 1SXTA 4DHJD 3QWZB 2I2YA 1B1ZA 2KLGA 4PS7A 2FUG1 3M95A 2KWDA 2KO3A 2CHZA 3T3NA 3DBLI 3PHXB 5IN7A 4WJQA 4IOIE 3FC4A 4JWUC 1CZPA 2Z0EB 2D5GA 1P1AA 1P7EA 1RFKA 1LFDA 2WXMA 2KKCA 4MACA 2QSDA 4DHZE 3TEZA 1IPGA 3RNGC 1ISNA 2W3RA 1Q5WB 4RGOS 5AZHA 5FR3A 2BB5A 5BYRA 5FK9C 1I4PA 4HPLB 4JWSC 3DVGX 1WGHA 4I6NB 3SD5A 2L3ZA 2RR9A 2GMIC 3DPDA 3Q8BA 1TTNA 2GBRA 2PE9A 1WGGA 1JQ4A 2IO1B 2I38A 2FIFA 3ZUNA 5IKCM 1J19A 3V61A 2KVZA 2UU7A 2NVUI 2BQQA 2ZJDA 4XC2A 1MG4A 5GMVA 2M8SA 3VXWA 3V3XA 3M62B 5BYQA 4ZRJA 1YOVB 4RCOA 2WX1A 2BKRB 2E3TA 4QAYA 4N6EB 1ZXIA 2KDEB 1J0GA 3SEBA 1WRIA 3I57A 3ZNGC 3RNCC 3FAHA 2KDFB 2N9EB 3AULA 2K6DB 4W9HA 3VTWA 3N3KB 3NVVA 4PS8A 1WMHA 2J0KA 4TUUA 5E6OA 1B9RA 2V4LA 3AEAB 3NVWA 3WCQA 1JMLA 1WGDA 1UH6A 5D3DA 5D3IB 3DBSA 4BKSA 1WM3A 2INCC 2IY1B 1GC7A 2QJLA 1WX7A 2K6QA 3WAOA 3O65B 2BYEA 1P0RA 4FJZA 3FKYA 2KNBA
chains in the Genus database with same CATH topology
1RLFA 2R2QA 1Q0WB 4A3OA 4W9IA 3D32A 1FXTB 1WR1A 4KDIC 3T9LA 2MBOA 2KLCA 3VH4B 5AEKB 4BFRA 3VH3B 5CHWA 2RGFA 3ZIMA 5J18A 1YJ1A 3CF6E 1EF5A 1Z2MA 4M8MA 4MEMA 4RM8A 4AJYB 1X1MA 2O2VA 4W9LA 3B0AA 4ASWC 5LXIB 2ZVNA 1L2NA 1UBIA 4RM9A 1NDDA 2M1MA 4W9FA 4EUTA 2FCSA 2KZRA 4HDQA 4BKGA 2LRUA 4N9F4 4ANWA 2ASQA 2DZJA 3HM3A 2RPQA 2LGXA 3IG3A 5E6NA 3QQ8B 1WXSA 1YIWA 3APFA 4EOYA 1GC6A 4URKA 2DYBA 2D2QA 2IO0B 3PSEB 2K1FA 4JL9A 2M0XA 2KDIA 2K25A 4DDID 2LASA 3TBLD 4GDKB 5EDSA 2BWES 4RMAA 3R7RA 1GUAB 2BYFA 3DDCB 4TQ1A 2KFKB 2KOXA 5AZGA 1C3TA 1WMHB 2DZMA 4EZKA 1H8CA 4DHZB 2J7QB 4ICVA 4BBNF 4OVUA 3A33B 1WF9A 3ZTDA 5DPTA 3VTUA 4NQLB 1E7VA 3PT2B 4BKSD 4CO7A 4FLHA 2YLMA 3ML9A 1EO6A 3ZRCA 4PYZA 2PPHA 1UELA 1WGRA 1PQSA 3L13A 4F8CB 1WXMA 2MW5A 2I1JA 2C7NB 3MTNB 3QHTA 2L05A 2D11A 3PS6A 2NCNA 4J6IA 4KSKC 3KYDD 2RD0A 3UIOB 2XK5A 1YQBA 3KW5B 2KVRA 3AU4A 2D3GA 2PJHA 4I6LB 3SU8X 2MCNB 4GDLA 1P98A 4I6PA 3VUWA 3ENEA 3HM6X 5CX3A 2L7RA 4AWJA 4ANXA 2HJ8A 1KM7A 4W9EA 5HKHA 3NHEB 1AARA 3U30A 3W1YA 2GBNA 4MDKE 2D07B 4WWOA 4TQ0A 1J8CA 1C1YB 2PEAA 3AU5A 1E5WA 2IZVB 1WJUA 3AXCA 3NS8A 1H4RA 3NZUA 2K39A 3NOBA 2KK8A 2CHWA 4AOFA 5DCNA 2O2VB 2LZ6A 3A4SC 1YX6B 1WJNA 5CHFA 5LLIA 4WJOA 2LI5A 2IY0B 2GOWA 4LJOB 3I3TB 1E8XA 4A20A 3OAWA 5IAAC 3IHPC 1OEYJ 2KXJA 1OTRB 1WR6E 3C0RB 4MGKE 2L0TA 2BKFA 2ZNVC 1E8ZA 3M3JA 4HK2A 4XZ4A 3UQBA 4MM3A 4WWPA 1ZKHA 4JQWC 2O6VA 4IWQA 3WA0A 3DBHI 3X0WA 2WWZA 2N9PC 2CS4A 4TKNA 2N1WA 3APDA 5JHBA 1UD7A 2AWTA 2ZVOA 2MSED 4KIKA 3H1UA 2JWZA 4MSQB 3H7PA 4AJWA 2KJHB 3A1QA 2B3AA 1HE8A 1WXAA 4ZRKA 4W9GA 2FUHB 2ZCCA 4XX5A 3RZFA 4BOZB 1RRBA 4LDTB 2XEWA 1SIFA 2KMCA 4CHKA 4FA6A 2G45B 2MBBB 3EECA 1OQYA 2Y5BB 4LCDE 3ECIA 4GIVA 3PHWB 5AZFA 1ZGUB 2PE6B 3TL5A 1E8WA 4IG7B 1NI2A 5KHOA 2CR5A 3WIMA 3TJPA 3PRMB 4GSWA 4E3CA 2K8BA 3K9PB 3DVNU 3N32A 2XK5B 4B9KA 5E6PA 1UBQA 3VQIA 4DK5A 4NPNA 4GMVA 3L10B 4KSLC 2EMSA 2C7MB 3GZNI 4G11A 5D94A 3IVFA 4GDLB 3QJZA 5D7GA 1VD2A 3R3MA 5L95C 2JRIB 4YL8A 2MP2A 2LGDA 2DHZA 2JF5A 3QX1A 2GBJA 3KH0A 4P7IA 1T0YA 2KN5A 3ZW3A 3S2AA 2I1KA 2MBHA 2JPHA 4MGYE 2NBUA 2ZPYA 4F7ZA 1Z5SB 2V1YA 3MHSD 3AI5A 2KD0A 5IA7A 2REXA 3SHQA 1WI0A 3PREA 4W9JA 2AL3A 3JSVA 3HK0A 2XBBC 3UINB 2WX0A 3PLUA 2N7EA 1K8RB 2FAZA 4ZRIA 4EZLA 2QHOA 4M0WB 3QK0A 4FADA 5KHQA 2D10A 3R7QA 3W1SA 2CHXA 4MGIE 2O6VD 3QIJA 3TCAA 3EC8A 2KANA 5L83A 1LXDA 3PV1A 2O6VB 2JUOA 2ZPNA 1WE7A 1EUVB 4W9CA 3MJWA 4X57B 4IWPA 3QCAA 4ZYNA 4DXAB 2EKEC 4KIKB 1S3SG 3PGEA 2C7HA 4FN2A 1A5RA 1D3ZA 1WRDB 3H7PB 3V6CB 2YVCA 3A1QB 4HVBA 2DYMA 3X23A 3ZRFA 1E8YA 4HPMB 3A9KA 3L08A 3VFKA 2GBMA 4K1RB 4GU2A 3QAQA 1S1QB 1KOTA 2L00B 2LVQA 3BY4B 3DBRI 3VAWA 2MBEA 4MSMB 4M8NA 2JZZA 4E71A 3HHMA 4F1SA 1YX5B 3A9JB 2BPSA 2IBIB 2NS5A 4WJPA 3TIXA 2M4NA 1WZ0A 4G50A 3NZSA 3H9DA 4MELA 3VUXA 1UGMA 3LDZE 3RZWC 3ZLZA 3WALA 2ZZPB 4LJPB 4KZ0A 4NQKE 4DDGD 4EZJA 1V5TA 2DENB 3PVLA 3KUZA 2N1VA 1E7UA 2N7DA 5BO4B 3T8MA 2MP2B 1V2YA 3DOWA 4GOCA 2LJ5A 1WYWB 4G0NB 1KJTA 4B6WA 2GBKA 2JXXA 1BT0A 2FCNA 3H7SA 4NJ7A 2JT4B 5G2NA 1JRUA 4GB9A 4BOSC 2KJRA 3VVWB 1QZEA 2BYVE 4W9KA 3M63B 2J0MA 3L0WB 4K7SA 3QA8A 3U8ZA 3JSVB 1IYFA 1V81A 4IC7B 4NJ6A 2C5LC 2CU1A 2RSUA 2LGYA 4ANUA 4DWFA 2K8CA 1WH3A 3CSTA 3LJ3A 4DBGA 4HWIB 5C1ZA 1WXVA 2K8HA 2VRRB 3ZNHB 5JH5C 4K7UA 4NAWB 5JZEB 4MJSA 4II3B 4IW0A 2HD5B 3ZDTA 2AEHA 4PS3A 1YD8U 5G55A 3OJ3A 2ZCBA 3ZTCA 2MQJA 3DCGA 4IWOA 3RT3B 2L8JA 4LDTD 2BF8B 3KUCB 1GNUA 3GOEA 4ZDVA 2NBVB 4ICUA 3L16A 1M94A 3DQVA 3VUYA 3VDZA 3ZNID 4BKTA 3APCA 3DVNV 1TBEA 2R2OA 3IBEA 4JIOU 4GN1A 3UIPB 2HTHA 1SE9A 5DPRA 2HE7A 3WANA 2NPTA 2KJ6A 3A9JA 4IM2A 4CYEA 1XD3B 4NY0A 5DPWA 1WIAA 3A9KB 3V6EB 3NY5A 3ZDMC 3K9OB 2MWSB 1R4NI 2DZKA 2FIDA 2IO2B 2Z59B 3ONSA 3BINA 3PZDA 2LRWA 3KVFB 3UF8A 3WAPA 3DVGY 2J0JA 2G4DB 2JVCA 2G3QB 4JGHB 2LXCA 4K7WA 2MA9B 3PRPB 3EFUA 4KV2A 1LM8B 4HCPB 4DHJD 2MRPA 2FCMA 3QWZB 4DHJB 1Y8RC 3ALBA 3OLMD 4JLCA 5D2MB 3R66C 2KLGA 3OJ4B 2AYOB 4OVVA 3B1LX 4PS7A 3N30A 3RCZA 3WAMA 2KX3A 1V49A 2KTRA 3M95A 2NR2A 5C23A 5J2RA 1OGWA 2DYOA 3L54A 4FBJB 1P9DU 2A4ZA 5J17A 2KO3A 2CKHB 4KZCA 2CHZA 4HXDA 3DBLI 2DZIA 3PHXB 4FJYA 4WJQA 1V9JA 2G4SA 4BVUC 3V62A 2KFJA 1V86A 2MLBA 4MGZE 2JY6A 5LXHA 4FJVB 4A3PA 2A5UA 2JRHA 4NAWA 1RAXA 2Z0EB 5DPSA 3CSFA 1P1AA 1CMXB 2BWFA 1UZXB 3JYUA 2LUEA 1GG3A 2FCQA 2N4FA 1LFDA 2KKCA 2IO3B 4W9DA 2LXAA 2OOBB 4MJSB 4AP4C 2Z0DB 1IPGA 4GXBA 4DHZE 2DAFA 2L0FA 4IUMB 1SGHA 5JHAA 1ISNA 1Q5WB 5AZHA 2KX0A 3QARA 2ZEQA 1XT9B 1XQQA 3VHTC 2M17A 1TZ1A 1WY8A 3TMPB 1LQBA 3A4RA 5D6JB 1I42A 1GJZA 5FR6A 4HPLB 1WGYA 4IM3A 3DVGX 1WGHA 2KC2A 2LVOA 1KLVA 1VCBA 3CMMB 3P2BA 4I6NB 4PYUA 3SD5A 2NPTB 2L3ZA 3PPAA 2RR9A 2GMIC 4G3XB 3DPDA 4EFOA 2BGFA 1WE6A 3L17A 3QC8B 3B08A 1V80A 2KTFA 4IM0A 4E74A 1TTNA 1R4MI 3V60A 2GBRA 2PE9A 2MBQA 1WGGA 2DAJA 1V5OA 2IO1B 5TR5A 4EKUA 2FIFA 2W9NA 3ZUNA 1L7YA 4II2B 4WJNA 4HJKA 4HCNB 1J19A 3V61A 2KQSA 4MH0E 3UGBB 1G6JA 2C9WB 2JZ3B 4GGQA 2NVUI 2AL6A 2WDTB 2ZJDA 3KYCD 3PLVA 4XC2A 1WFYA 5GMVA 3EHVA 1ZW7A 2M8SA 3VXWA 2L76A 3U7DA 2NBWB 2LWPA 3M62B 2DX5B 1NBFC 1OEYA 2KC1A 2N9XA 2KTRB 3ZVVA 4ZRJA 4ANVA 4AUQC 1WM2A 3ZKJC 2WX1A 4KVGB 2KWCA 1IP9A 1RFAA 1I35A 4BBNC 3VTVA 4WQOB 4B95A 2BKRB 2FNJB 3ZNZB 2LVPA 3W1SC 4HDOA 2IYDB 3RD2A 2KDEB 3Q3JA 1J0GA 3ZNGC 2WYQA 1EF1A 1TGZB 1F9JA 2KDFB 5CHVC 4EEWA 1WX9A 2MX2A 2KWVB 4FHJA 4GDKA 2N9EB 3AULA 1E90A 4TV3A 3H6NA 4HLEA 2K6DB 4W9HA 2ZNVB 3VTWA 3N3KB 2KFKA 5CTRC 3RYTA 1WZ3A 1WMHA 2J0KA 2EMTA 4PS8A 4TUUA 3UQAA 5E6OA 3PTFC 2V4LA 2V3SA 3RULA 3JVZX 2C60A 3ZO5B 1WGDA 1P3QU 1UH6A 2KWUB 2OJRA 4WWNA 3RUIB 3DBSA 3KUDB 4BKSA 1WM3A 2KDBA 2KMAA 2LD9A 1U4AA 1WX8A 3SDLC 2IY1B 3HIZA 1GC7A 1WJ6A 1WX7A 2K6QA 3PRZA 3WAOA 3O65B 2BYEA 2KHWB 3JW0X 1MG8A 1P0RA 4FJZA 4FULA 3ML8A 4KDLB 4WAAA 3Q3FA 2KNBA 1Q1OA 1V6EA 2UYZB 2KQ7A 3IFWB 4K81A 1WJ4A 2UWQA 4NNJB 4FHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RLF A;  2R2Q A;  1Q0W B;  4A3O A;  4W9I A;  3D32 A;  1FXT B;  1WR1 A;  4KDI C;  3T9L A;  2MBO A;  2KLC A;  3VH4 B;  5AEK B;  4BFR A;  3VH3 B;  5CHW A;  2RGF A;  3ZIM A;  5J18 A;  1YJ1 A;  3CF6 E;  1EF5 A;  1Z2M A;  4M8M A;  4MEM A;  4RM8 A;  4AJY B;  1X1M A;  2O2V A;  4W9L A;  3B0A A;  4ASW C;  5LXI B;  2ZVN A;  1L2N A;  1UBI A;  4RM9 A;  1NDD A;  2M1M A;  4W9F A;  4EUT A;  2FCS A;  2KZR A;  4HDQ A;  4BKG A;  2LRU A;  4N9F 4;  4ANW A;  2ASQ A;  2DZJ A;  3HM3 A;  2RPQ A;  2LGX A;  3IG3 A;  5E6N A;  3QQ8 B;  1WXS A;  1YIW A;  3APF A;  4EOY A;  1GC6 A;  4URK A;  2DYB A;  2D2Q A;  2IO0 B;  3PSE B;  2K1F A;  4JL9 A;  2M0X A;  2KDI A;  2K25 A;  4DDI D;  2LAS A;  3TBL D;  4GDK B;  5EDS A;  2BWE S;  4RMA A;  3R7R A;  1GUA B;  2BYF A;  3DDC B;  4TQ1 A;  2KFK B;  2KOX A;  5AZG A;  1C3T A;  1WMH B;  2DZM A;  4EZK A;  1H8C A;  4DHZ B;  2J7Q B;  4ICV A;  4BBN F;  4OVU A;  3A33 B;  1WF9 A;  3ZTD A;  5DPT A;  3VTU A;  4NQL B;  1E7V A;  3PT2 B;  4BKS D;  4CO7 A;  4FLH A;  2YLM A;  3ML9 A;  1EO6 A;  3ZRC A;  4PYZ A;  2PPH A;  1UEL A;  1WGR A;  1PQS A;  3L13 A;  4F8C B;  1WXM A;  2MW5 A;  2I1J A;  2C7N B;  3MTN B;  3QHT A;  2L05 A;  2D11 A;  3PS6 A;  2NCN A;  4J6I A;  4KSK C;  3KYD D;  2RD0 A;  3UIO B;  2XK5 A;  1YQB A;  3KW5 B;  2KVR A;  3AU4 A;  2D3G A;  2PJH A;  4I6L B;  3SU8 X;  2MCN B;  4GDL A;  1P98 A;  4I6P A;  3VUW A;  3ENE A;  3HM6 X;  5CX3 A;  2L7R A;  4AWJ A;  4ANX A;  2HJ8 A;  1KM7 A;  4W9E A;  5HKH A;  3NHE B;  1AAR A;  3U30 A;  3W1Y A;  2GBN A;  4MDK E;  2D07 B;  4WWO A;  4TQ0 A;  1J8C A;  1C1Y B;  2PEA A;  3AU5 A;  1E5W A;  2IZV B;  1WJU A;  3AXC A;  3NS8 A;  1H4R A;  3NZU A;  2K39 A;  3NOB A;  2KK8 A;  2CHW A;  4AOF A;  5DCN A;  2O2V B;  2LZ6 A;  3A4S C;  1YX6 B;  1WJN A;  5CHF A;  5LLI A;  4WJO A;  2LI5 A;  2IY0 B;  2GOW A;  4LJO B;  3I3T B;  1E8X A;  4A20 A;  3OAW A;  5IAA C;  3IHP C;  1OEY J;  2KXJ A;  1OTR B;  1WR6 E;  3C0R B;  4MGK E;  2L0T A;  2BKF A;  2ZNV C;  1E8Z A;  3M3J A;  4HK2 A;  4XZ4 A;  3UQB A;  4MM3 A;  4WWP A;  1ZKH A;  4JQW C;  2O6V A;  4IWQ A;  3WA0 A;  3DBH I;  3X0W A;  2WWZ A;  2N9P C;  2CS4 A;  4TKN A;  2N1W A;  3APD A;  5JHB A;  1UD7 A;  2AWT A;  2ZVO A;  2MSE D;  4KIK A;  3H1U A;  2JWZ A;  4MSQ B;  3H7P A;  4AJW A;  2KJH B;  3A1Q A;  2B3A A;  1HE8 A;  1WXA A;  4ZRK A;  4W9G A;  2FUH B;  2ZCC A;  4XX5 A;  3RZF A;  4BOZ B;  1RRB A;  4LDT B;  2XEW A;  1SIF A;  2KMC A;  4CHK A;  4FA6 A;  2G45 B;  2MBB B;  3EEC A;  1OQY A;  2Y5B B;  4LCD E;  3ECI A;  4GIV A;  3PHW B;  5AZF A;  1ZGU B;  2PE6 B;  3TL5 A;  1E8W A;  4IG7 B;  1NI2 A;  5KHO A;  2CR5 A;  3WIM A;  3TJP A;  3PRM B;  4GSW A;  4E3C A;  2K8B A;  3K9P B;  3DVN U;  3N32 A;  2XK5 B;  4B9K A;  5E6P A;  1UBQ A;  3VQI A;  4DK5 A;  4NPN A;  4GMV A;  3L10 B;  4KSL C;  2EMS A;  2C7M B;  3GZN I;  4G11 A;  5D94 A;  3IVF A;  4GDL B;  3QJZ A;  5D7G A;  1VD2 A;  3R3M A;  5L95 C;  2JRI B;  4YL8 A;  2MP2 A;  2LGD A;  2DHZ A;  2JF5 A;  3QX1 A;  2GBJ A;  3KH0 A;  4P7I A;  1T0Y A;  2KN5 A;  3ZW3 A;  3S2A A;  2I1K A;  2MBH A;  2JPH A;  4MGY E;  2NBU A;  2ZPY A;  4F7Z A;  1Z5S B;  2V1Y A;  3MHS D;  3AI5 A;  2KD0 A;  5IA7 A;  2REX A;  3SHQ A;  1WI0 A;  3PRE A;  4W9J A;  2AL3 A;  3JSV A;  3HK0 A;  2XBB C;  3UIN B;  2WX0 A;  3PLU A;  2N7E A;  1K8R B;  2FAZ A;  4ZRI A;  4EZL A;  2QHO A;  4M0W B;  3QK0 A;  4FAD A;  5KHQ A;  2D10 A;  3R7Q A;  3W1S A;  2CHX A;  4MGI E;  2O6V D;  3QIJ A;  3TCA A;  3EC8 A;  2KAN A;  5L83 A;  1LXD A;  3PV1 A;  2O6V B;  2JUO A;  2ZPN A;  1WE7 A;  1EUV B;  4W9C A;  3MJW A;  4X57 B;  4IWP A;  3QCA A;  4ZYN A;  4DXA B;  2EKE C;  4KIK B;  1S3S G;  3PGE A;  2C7H A;  4FN2 A;  1A5R A;  1D3Z A;  1WRD B;  3H7P B;  3V6C B;  2YVC A;  3A1Q B;  4HVB A;  2DYM A;  3X23 A;  3ZRF A;  1E8Y A;  4HPM B;  3A9K A;  3L08 A;  3VFK A;  2GBM A;  4K1R B;  4GU2 A;  3QAQ A;  1S1Q B;  1KOT A;  2L00 B;  2LVQ A;  3BY4 B;  3DBR I;  3VAW A;  2MBE A;  4MSM B;  4M8N A;  2JZZ A;  4E71 A;  3HHM A;  4F1S A;  1YX5 B;  3A9J B;  2BPS A;  2IBI B;  2NS5 A;  4WJP A;  3TIX A;  2M4N A;  1WZ0 A;  4G50 A;  3NZS A;  3H9D A;  4MEL A;  3VUX A;  1UGM A;  3LDZ E;  3RZW C;  3ZLZ A;  3WAL A;  2ZZP B;  4LJP B;  4KZ0 A;  4NQK E;  4DDG D;  4EZJ A;  1V5T A;  2DEN B;  3PVL A;  3KUZ A;  2N1V A;  1E7U A;  2N7D A;  5BO4 B;  3T8M A;  2MP2 B;  1V2Y A;  3DOW A;  4GOC A;  2LJ5 A;  1WYW B;  4G0N B;  1KJT A;  4B6W A;  2GBK A;  2JXX A;  1BT0 A;  2FCN A;  3H7S A;  4NJ7 A;  2JT4 B;  5G2N A;  1JRU A;  4GB9 A;  4BOS C;  2KJR A;  3VVW B;  1QZE A;  2BYV E;  4W9K A;  3M63 B;  2J0M A;  3L0W B;  4K7S A;  3QA8 A;  3U8Z A;  3JSV B;  1IYF A;  1V81 A;  4IC7 B;  4NJ6 A;  2C5L C;  2CU1 A;  2RSU A;  2LGY A;  4ANU A;  4DWF A;  2K8C A;  1WH3 A;  3CST A;  3LJ3 A;  4DBG A;  4HWI B;  5C1Z A;  1WXV A;  2K8H A;  2VRR B;  3ZNH B;  5JH5 C;  4K7U A;  4NAW B;  5JZE B;  4MJS A;  4II3 B;  4IW0 A;  2HD5 B;  3ZDT A;  2AEH A;  4PS3 A;  1YD8 U;  5G55 A;  3OJ3 A;  2ZCB A;  3ZTC A;  2MQJ A;  3DCG A;  4IWO A;  3RT3 B;  2L8J A;  4LDT D;  2BF8 B;  3KUC B;  1GNU A;  3GOE A;  4ZDV A;  2NBV B;  4ICU A;  3L16 A;  1M94 A;  3DQV A;  3VUY A;  3VDZ A;  3ZNI D;  4BKT A;  3APC A;  3DVN V;  1TBE A;  2R2O A;  3IBE A;  4JIO U;  4GN1 A;  3UIP B;  2HTH A;  1SE9 A;  5DPR A;  2HE7 A;  3WAN A;  2NPT A;  2KJ6 A;  3A9J A;  4IM2 A;  4CYE A;  1XD3 B;  4NY0 A;  5DPW A;  1WIA A;  3A9K B;  3V6E B;  3NY5 A;  3ZDM C;  3K9O B;  2MWS B;  1R4N I;  2DZK A;  2FID A;  2IO2 B;  2Z59 B;  3ONS A;  3BIN A;  3PZD A;  2LRW A;  3KVF B;  3UF8 A;  3WAP A;  3DVG Y;  2J0J A;  2G4D B;  2JVC A;  2G3Q B;  4JGH B;  2LXC A;  4K7W A;  2MA9 B;  3PRP B;  3EFU A;  4KV2 A;  1LM8 B;  4HCP B;  4DHJ D;  2MRP A;  2FCM A;  3QWZ B;  4DHJ B;  1Y8R C;  3ALB A;  3OLM D;  4JLC A;  5D2M B;  3R66 C;  2KLG A;  3OJ4 B;  2AYO B;  4OVV A;  3B1L X;  4PS7 A;  3N30 A;  3RCZ A;  3WAM A;  2KX3 A;  1V49 A;  2KTR A;  3M95 A;  2NR2 A;  5C23 A;  5J2R A;  1OGW A;  2DYO A;  3L54 A;  4FBJ B;  1P9D U;  2A4Z A;  5J17 A;  2KO3 A;  2CKH B;  4KZC A;  2CHZ A;  4HXD A;  3DBL I;  2DZI A;  3PHX B;  4FJY A;  4WJQ A;  1V9J A;  2G4S A;  4BVU C;  3V62 A;  2KFJ A;  1V86 A;  2MLB A;  4MGZ E;  2JY6 A;  5LXH A;  4FJV B;  4A3P A;  2A5U A;  2JRH A;  4NAW A;  1RAX A;  2Z0E B;  5DPS A;  3CSF A;  1P1A A;  1CMX B;  2BWF A;  1UZX B;  3JYU A;  2LUE A;  1GG3 A;  2FCQ A;  2N4F A;  1LFD A;  2KKC A;  2IO3 B;  4W9D A;  2LXA A;  2OOB B;  4MJS B;  4AP4 C;  2Z0D B;  1IPG A;  4GXB A;  4DHZ E;  2DAF A;  2L0F A;  4IUM B;  1SGH A;  5JHA A;  1ISN A;  1Q5W B;  5AZH A;  2KX0 A;  3QAR A;  2ZEQ A;  1XT9 B;  1XQQ A;  3VHT C;  2M17 A;  1TZ1 A;  1WY8 A;  3TMP B;  1LQB A;  3A4R A;  5D6J B;  1I42 A;  1GJZ A;  5FR6 A;  4HPL B;  1WGY A;  4IM3 A;  3DVG X;  1WGH A;  2KC2 A;  2LVO A;  1KLV A;  1VCB A;  3CMM B;  3P2B A;  4I6N B;  4PYU A;  3SD5 A;  2NPT B;  2L3Z A;  3PPA A;  2RR9 A;  2GMI C;  4G3X B;  3DPD A;  4EFO A;  2BGF A;  1WE6 A;  3L17 A;  3QC8 B;  3B08 A;  1V80 A;  2KTF A;  4IM0 A;  4E74 A;  1TTN A;  1R4M I;  3V60 A;  2GBR A;  2PE9 A;  2MBQ A;  1WGG A;  2DAJ A;  1V5O A;  2IO1 B;  5TR5 A;  4EKU A;  2FIF A;  2W9N A;  3ZUN A;  1L7Y A;  4II2 B;  4WJN A;  4HJK A;  4HCN B;  1J19 A;  3V61 A;  2KQS A;  4MH0 E;  3UGB B;  1G6J A;  2C9W B;  2JZ3 B;  4GGQ A;  2NVU I;  2AL6 A;  2WDT B;  2ZJD A;  3KYC D;  3PLV A;  4XC2 A;  1WFY A;  5GMV A;  3EHV A;  1ZW7 A;  2M8S A;  3VXW A;  2L76 A;  3U7D A;  2NBW B;  2LWP A;  3M62 B;  2DX5 B;  1NBF C;  1OEY A;  2KC1 A;  2N9X A;  2KTR B;  3ZVV A;  4ZRJ A;  4ANV A;  4AUQ C;  1WM2 A;  3ZKJ C;  2WX1 A;  4KVG B;  2KWC A;  1IP9 A;  1RFA A;  1I35 A;  4BBN C;  3VTV A;  4WQO B;  4B95 A;  2BKR B;  2FNJ B;  3ZNZ B;  2LVP A;  3W1S C;  4HDO A;  2IYD B;  3RD2 A;  2KDE B;  3Q3J A;  1J0G A;  3ZNG C;  2WYQ A;  1EF1 A;  1TGZ B;  1F9J A;  2KDF B;  5CHV C;  4EEW A;  1WX9 A;  2MX2 A;  2KWV B;  4FHJ A;  4GDK A;  2N9E B;  3AUL A;  1E90 A;  4TV3 A;  3H6N A;  4HLE A;  2K6D B;  4W9H A;  2ZNV B;  3VTW A;  3N3K B;  2KFK A;  5CTR C;  3RYT A;  1WZ3 A;  1WMH A;  2J0K A;  2EMT A;  4PS8 A;  4TUU A;  3UQA A;  5E6O A;  3PTF C;  2V4L A;  2V3S A;  3RUL A;  3JVZ X;  2C60 A;  3ZO5 B;  1WGD A;  1P3Q U;  1UH6 A;  2KWU B;  2OJR A;  4WWN A;  3RUI B;  3DBS A;  3KUD B;  4BKS A;  1WM3 A;  2KDB A;  2KMA A;  2LD9 A;  1U4A A;  1WX8 A;  3SDL C;  2IY1 B;  3HIZ A;  1GC7 A;  1WJ6 A;  1WX7 A;  2K6Q A;  3PRZ A;  3WAO A;  3O65 B;  2BYE A;  2KHW B;  3JW0 X;  1MG8 A;  1P0R A;  4FJZ A;  4FUL A;  3ML8 A;  4KDL B;  4WAA A;  3Q3F A;  2KNB A;  1Q1O A;  1V6E A;  2UYZ B;  2KQ7 A;  3IFW B;  4K81 A;  1WJ4 A;  2UWQ A;  4NNJ B;  4FHK A; 
#chains in the Genus database with same CATH topology
 1RLF A;  1Q0W B;  2MBO A;  4LNN A;  2LGS A;  1SB3 C;  1YJ1 A;  3TEX A;  2QIL A;  1HZ5 A;  1I4R A;  4MEM A;  4USA A;  2WNM A;  2LMC A;  4ASW C;  4RM9 A;  1FIQ A;  5IO9 A;  3U7Z A;  4HDQ A;  4BKG A;  4N9F 4;  3HM3 A;  3HUI A;  1M4V A;  3IG3 A;  3W5U B;  3APF A;  2D2Q A;  1XCT L;  3U2S C;  2K1F A;  4JL9 A;  2KDI A;  2JU6 X;  4DQO C;  5EDS A;  1IBX B;  3R7R A;  3DWG C;  1GUA B;  2BYF A;  3DDC B;  5AZG A;  2KOX A;  1J7A A;  4DHZ B;  5EE0 A;  1C79 A;  4OVU A;  5DPT A;  4NQL B;  3PT2 B;  4BKS D;  2QMT A;  2IDY A;  2PMV A;  1ROE A;  4PYZ A;  1UEL A;  3LXF A;  3L13 A;  4F8C B;  1WXM A;  2MW5 A;  3QHT A;  2RD0 A;  2M56 B;  1YQB A;  3KW5 B;  2KVR A;  2Y5C A;  2D3G A;  2PJH A;  3SU8 X;  2MCN B;  1C77 A;  3ENE A;  4AWJ A;  2HJ8 A;  5HKH A;  3NHE B;  1F2R C;  4LNK A;  3W1Y A;  2GBN A;  2V0G A;  1J8C A;  2PEA A;  5MPO A;  4RFB A;  2IZV B;  1I4G A;  1V97 A;  2K39 A;  3NOB A;  4RF1 A;  1QOB A;  3A4S C;  1WJN A;  5LLI A;  4LJO B;  4P6V F;  1ZOY B;  3OG5 A;  1FD6 A;  3RN9 C;  3LYY A;  4C7Z A;  1EWY C;  2BT6 A;  3M3J A;  1PGA A;  3GB1 A;  4XZ4 A;  2IGD A;  1RWS A;  3X0W A;  2ZVO A;  5AUI A;  4AJW A;  2B3A A;  3MHZ A;  3AE1 B;  2NMQ A;  3V05 A;  4W9G A;  2FUH B;  1SIF A;  1JRO A;  4YTM B;  4LCD E;  3MP9 A;  2MEK A;  1YJI A;  3NS1 A;  5AZF A;  1HXY D;  4IG7 B;  5KHO A;  4GSW A;  3N32 A;  5E6P A;  1C4P A;  3FIL A;  3VQI A;  2J42 A;  3ZJU A;  3L10 B;  4KSL C;  2C7M B;  1TT5 B;  3Q3M C;  3QJZ A;  1VD2 A;  1E0Z A;  3KLS X;  5L95 C;  2JRI B;  4YL8 A;  1N60 A;  2MP2 A;  2VH2 A;  2GBJ A;  4RF0 A;  4P7I A;  2BS4 B;  3Q8C A;  2KN5 A;  1K52 A;  2MBH A;  5G5G A;  1NEN B;  1WI0 A;  3BYT B;  4W9J A;  2AL3 A;  2WGS A;  2N7E A;  1FO4 A;  2B76 B;  2FAZ A;  4ZRI A;  4EZL A;  3IAM 1;  4M0W B;  3QK0 A;  3R7Q A;  2WXK A;  2CHX A;  1IGD A;  4AS1 A;  4MM3 B;  3P63 A;  3PV1 A;  2V3P A;  3AE9 B;  3SR6 A;  2MJE A;  4MH8 A;  3QCA A;  1R7S A;  4KIK B;  3PGE A;  4FN2 A;  3IT4 B;  3A1Q B;  3AE3 B;  3ZRF A;  1N5W A;  4HPM B;  3VFK A;  1S1Q B;  1KOT A;  1WSP A;  2L00 B;  1L6V A;  1VRA B;  2MBE A;  2VZK B;  4E71 A;  3BVG A;  3HHM A;  4F1S A;  3A9J B;  2BPS A;  4WJP A;  1XEE A;  3TIX A;  2M4N A;  1WZ0 A;  1GB4 A;  3ZLZ A;  2WU2 B;  3WAL A;  4DDG D;  2DEN B;  2JQR B;  4GOC A;  1BT0 A;  2JT4 B;  1PDX A;  1JRU A;  1BML C;  2QDF A;  5G2N A;  4A6Q A;  4M0W A;  3QA8 A;  3JSV B;  4IC7 B;  1N63 A;  1V1O A;  4R3D A;  5T8I A;  4DWF A;  3LJ3 A;  4DBG A;  5C2T B;  4HWI B;  2YEP B;  3VRB B;  4OW0 A;  4K7U A;  3KWV A;  4NAW B;  4MJS A;  2AQ1 B;  3AE6 B;  2MJ3 A;  3AB5 A;  4XE0 A;  3MC9 A;  3ZDT A;  2AEH A;  4JE3 B;  3GZN B;  3RT3 B;  2BF8 B;  3GOE A;  4ZDV A;  2NBV B;  1M94 A;  3VUY A;  3VDZ A;  3ZNI D;  3IBE A;  3B9J A;  1SE9 A;  2IGH A;  1KRH A;  3AEG B;  3A9J A;  4IM2 A;  1XD3 B;  5DPW A;  1WIA A;  2PVO D;  1PUT A;  1MHX A;  3ZDM C;  4JX1 C;  1VDV A;  2MWS B;  1R4N I;  2DZK A;  3PZD A;  2LRW A;  3UF8 A;  2J0J A;  1ET9 A;  1RM6 C;  2QCZ A;  2LHD A;  3PRP B;  4KV2 A;  3ZYY X;  1LM8 B;  1SIJ A;  3GE8 C;  3N1Z C;  4DHJ B;  4YTN B;  1Y8R C;  4OZC A;  5D2M B;  3B1L X;  3RCZ A;  2KX3 A;  3BZD B;  2DYO A;  4YSY B;  2A4Z A;  2CKH B;  2WXL A;  4FJY A;  2K3U A;  5LXH A;  4C4V A;  2KAC A;  3L4P A;  4NAW A;  4S17 A;  1UZX B;  3JYU A;  3ZXV A;  4BZA A;  1GG3 A;  2CJO A;  2N4F A;  3NRZ A;  2IO3 B;  3Q69 A;  4W9D A;  2LXA A;  2ZW0 A;  1T0Q C;  2OOB B;  1T0S C;  2Z0D B;  2L0F A;  4O1N A;  5JHA A;  4HRS A;  1XQQ A;  3AE2 B;  3A4R A;  1GJZ A;  2XN9 C;  5FR6 A;  2VZK D;  1SE3 A;  4ACF A;  2RDH A;  4PYU A;  2NPT B;  3NJT A;  3BWU D;  3L17 A;  3QC8 B;  4US9 A;  4IM0 A;  4E74 A;  1R4M I;  3CWI A;  2WXO A;  1MJD A;  1K50 A;  4II2 B;  3N1X C;  4HJK A;  4HCN B;  1FNV A;  5FKA C;  4MH0 E;  3UGB B;  1IUE A;  4N59 A;  2K22 A;  1I7H A;  1SE2 A;  2PTL A;  3VRA B;  3PLV A;  2E6X A;  1FCC C;  1ZW7 A;  3C19 A;  2V9H A;  2L76 A;  4REZ A;  2G1E A;  2DX5 B;  1OEY A;  2N9X A;  3NZ3 A;  3C8Y A;  4C7Y A;  2RDB C;  3MJ5 A;  2BS2 B;  3ZNZ B;  2LJI A;  4HDO A;  5I4D A;  3P1M A;  2GI9 A;  1TGZ B;  4P1C C;  3P42 A;  1F9J A;  1WX9 A;  2MX2 A;  4FHJ A;  4GDK A;  2WDQ B;  1E90 A;  2MHJ A;  3RYT A;  2KFK A;  2WXN A;  3ZXR A;  3AEE B;  3JVZ X;  2DBY A;  2OJR A;  2WXP A;  4D2K A;  1KF6 B;  3SDL C;  1U4A A;  1WX8 A;  1TYG B;  5IP4 D;  1YJJ A;  1K53 A;  2KHW B;  1MG8 A;  2LFI A;  1F1H A;  4KDL B;  4WAA A;  2FE8 A;  1Q1O A;  1V6E A;  1NEK B;  4K81 A;  3RPF C;  4FHK A;  1K51 A;  1SE4 A;  4BFR A;  1WYG A;  5CHW A;  1QOG A;  1J7C A;  1HTO A;  1AYF A;  4AJY B;  1VZ7 A;  1X1M A;  2O2V A;  1NYQ A;  1NDD A;  5BMI A;  2GRI A;  4W9F A;  1EU3 A;  2FCS A;  4L1B A;  4ANW A;  3HVZ A;  2RPQ A;  2MH7 A;  1XLQ A;  1YIW A;  4NZL B;  2GB1 A;  1BXT A;  2W55 A;  1OQR A;  4DDI D;  2DNF A;  2LAS A;  1C3T A;  1WMH B;  2DZM A;  1QLB B;  1JAL A;  3CIR B;  1WF9 A;  3ZTD A;  3NVY A;  1XF5 L;  4FLH A;  1L0Y B;  1YMH E;  2K0P A;  1EO6 A;  4OHJ A;  3ZRC A;  1L5P A;  2PPH A;  1WGR A;  2L05 A;  3KYD D;  2RDG A;  1WXQ A;  4LNO A;  3BK1 A;  3AU4 A;  4GDL A;  4HRO A;  5EE1 A;  1AAR A;  4TQ0 A;  1E5W A;  3AN1 A;  1HZ6 A;  2KK8 A;  2CHW A;  5DCN A;  2LZ6 A;  1YX6 B;  2LI5 A;  2IY0 B;  1XLP A;  3I3T B;  4A20 A;  2KXJ A;  1L0X B;  1WR6 E;  1ACC A;  4MGK E;  2ZNV C;  5C3J B;  1MI0 A;  4WWP A;  1ZKH A;  4JQW C;  2O6V A;  4IWQ A;  2WWZ A;  2N1W A;  3APD A;  2AWT A;  2LHE A;  2N7J A;  1I4Q A;  2JWZ A;  5BMG A;  1ZXH A;  3ZJV A;  2KJH B;  2G45 B;  2N0S B;  4HEA 1;  2PE6 B;  3H8H A;  3WIM A;  1PGB A;  3TJP A;  1UBQ A;  4NPN A;  4G11 A;  5D94 A;  5D7G A;  4YT0 B;  2ZW1 A;  1FXI A;  2JF5 A;  3QX1 A;  5TSS A;  1T3Q A;  2N9L A;  3S2A A;  1QOA A;  5HG2 A;  2R61 A;  2V1Y A;  3MHS D;  1L4D B;  3AI5 A;  1ESF A;  2NTS A;  1LO5 D;  3PRE A;  3HK0 A;  1XLN A;  1GOZ A;  5EE9 A;  1OQQ A;  5KHQ A;  2NTT A;  1MFW A;  4BAX A;  2V4I B;  4MGI E;  2O6V D;  2WXR A;  3QIJ A;  3TCA A;  1LXD A;  3ABV B;  3TUO A;  2D3A A;  4X57 B;  4DXA B;  3RMK C;  1A5R A;  1WRD B;  4KGS A;  2YVC A;  3BK2 A;  1J7B A;  2ACZ B;  1E8Y A;  4L2Y A;  3A9K A;  1STE A;  4K1R B;  3QAQ A;  2QC8 A;  3DBR I;  4MSM B;  2JZZ A;  4IKG A;  4FXC A;  3B2G A;  2IBI B;  1TS4 A;  4XWT A;  3RNA C;  3NZS A;  1UGM A;  3FIL B;  2ZZP B;  4KZ0 A;  4NQK E;  3KUZ A;  5BO4 B;  3DBH B;  2MP2 B;  1V2Y A;  1QT9 A;  1IGC A;  1KJT A;  4B6W A;  2JXX A;  2WXG A;  1ET6 A;  2FCN A;  4M01 A;  4W9K A;  2J0M A;  3L0W B;  3U8Z A;  1TKY A;  4HPP A;  1ZP0 B;  3I63 C;  1FCL A;  3CST A;  5E6J A;  5G5H A;  1CQV A;  2BYT A;  2VRR B;  3ZNH B;  5JH5 C;  4PS3 A;  5G55 A;  1P7F A;  1JWS D;  2ZCB A;  1QF6 A;  1UNS A;  2MQJ A;  2K5P A;  4RNA A;  2L8J A;  4ICU A;  4BKT A;  3APC A;  3DVN V;  3KWL A;  4JIO U;  2KJ6 A;  4CYE A;  1VZ8 A;  3NY5 A;  3EFC A;  1PGX A;  2CU3 A;  3J9C A;  4K3B A;  1MPE A;  4K7W A;  4OZA A;  2WU5 B;  3P4R B;  2FCM A;  2BB6 A;  4A55 A;  3ALB A;  4JLC A;  3AE5 B;  3R66 C;  3OJ4 B;  1FXA A;  2KYW A;  1V49 A;  2KTR A;  5C23 A;  2FBW B;  1P9D U;  4KZC A;  2DZI A;  1V9J A;  3O13 A;  3V62 A;  2M0A A;  2JY6 A;  4FJV B;  1HQR D;  3TEY A;  1RAX A;  2OJW A;  5DPS A;  1WGK A;  2HJ1 A;  1CMX B;  1JW9 D;  2LUM A;  2Y5P A;  4YSX B;  3SFD B;  1UGJ A;  4MJS B;  1KH0 A;  4AP4 C;  3E9S A;  4IUM B;  1XCQ L;  2KX0 A;  2M17 A;  1TZ1 A;  1LQB A;  2AQ2 B;  5D6J B;  5AUK A;  3AV8 A;  1V1P A;  1KLG D;  1WGY A;  2KC2 A;  1KLV A;  1KFY B;  3CMM B;  1YN5 A;  2YEP F;  2INP E;  3AED B;  1T0R C;  2BGF A;  1WE6 A;  4EE2 A;  3B08 A;  2KTF A;  2EKI A;  1FM0 D;  4YWG G;  1D5M C;  3V60 A;  2MBQ A;  2DAJ A;  5TR5 A;  4EKU A;  1FRD A;  2WP9 B;  2KQS A;  3TEW A;  1G6J A;  2C9W B;  3AE4 B;  2JZ3 B;  4GGQ A;  2JSV X;  4TMA B;  3Q2A C;  3VR8 B;  3IAS 1;  3KYC D;  1ZDV A;  4WWM A;  2NBW B;  2VH1 A;  4IDI A;  2LWP A;  2KC1 A;  1SEB D;  4LNI A;  3UI3 A;  2GLS A;  3B2F A;  4AUQ C;  4WQO B;  1SJH D;  2FNJ B;  1MVK A;  4C4V B;  2LVP A;  3W1S C;  2IYD B;  3Q3J A;  1TS3 A;  4L23 A;  5CHV C;  2IPK D;  4EEW A;  4TV3 A;  4HLE A;  3H6N A;  1XXG A;  5CTR C;  2MJD A;  3UQA A;  3MC0 B;  3PTF C;  2V3S A;  2C60 A;  2KQ4 X;  4WWN A;  2JZP A;  3KUD B;  1GAQ B;  2KDB A;  2KMA A;  2LD9 A;  2JYE A;  3HIZ A;  3GS2 A;  1NI3 A;  1JWU D;  1TY2 A;  3DBL B;  3PRZ A;  3JW0 X;  1BUI C;  2RMM A;  2PW9 A;  3P4Q B;  2J52 A;  2KQ7 A;  3IFW B;  1TJE A;  1WJ4 A;  2UWQ A;  4NNJ B;  4KKJ A;  2V3N A;  1D5X C;  4A3O A;  4W9I A;  3D32 A;  4KDI C;  1TKG A;  3RFZ B;  2WXF A;  2RGF A;  4TSS A;  5J18 A;  4ITK A;  1D4B A;  3CF6 E;  2ONQ A;  4ZHO A;  2KMM A;  4W9L A;  3B0A A;  4MT5 A;  5LXI B;  2ZVN A;  1L2N A;  1UBI A;  2H89 B;  2JX5 A;  2L32 A;  4EUT A;  2KZR A;  2J4X A;  2LRU A;  2DZJ A;  5E6N A;  2JXT A;  4EOY A;  3RNF C;  2IO0 B;  1C76 A;  2M0X A;  2K25 A;  4XGA B;  4GDK B;  2KFK B;  4EZK A;  1H8C A;  4ICV A;  1JWM D;  5BMH A;  1E7V A;  1SF0 A;  3PZ7 A;  1YNT E;  2YLM A;  4KGT A;  1HTQ A;  2I1J A;  2C7N B;  2D11 A;  3UIO B;  4K3C A;  2XK5 A;  4YSZ B;  4XDD A;  4I6L B;  2WS3 B;  3AH7 A;  1P98 A;  1L4Z B;  4I6P A;  5CX3 A;  2L7R A;  3EUB 2;  1L0V B;  1KM7 A;  4W9E A;  3Q14 C;  3BYY B;  3U30 A;  3AEB B;  2D07 B;  4WWO A;  1EM7 A;  3NG0 A;  1C1Y B;  4WUR A;  1WJU A;  3AXC A;  1H4R A;  1OFF A;  1WWT A;  3NZU A;  4AOF A;  2O2V B;  5CHF A;  4B0E A;  4WJO A;  2GOW A;  2RPV A;  1E8X A;  3OAW A;  3C0R B;  1TZO A;  2L0T A;  1E8Z A;  4HK2 A;  4PK1 A;  5HHD G;  3LB8 C;  2G9H D;  5H92 C;  2CS4 A;  3P4P B;  2WDV B;  1DYQ A;  4TKN A;  1UD7 A;  3SFE B;  2OHF A;  1GB1 A;  3GE3 C;  1XO3 A;  3H7P A;  1C4A A;  4ZRK A;  1ZDX A;  3MFG A;  4XX5 A;  4BOZ B;  1UWM A;  2KMC A;  4FA6 A;  4M00 A;  3IT6 B;  3ZGZ A;  1OQY A;  4GIV A;  3PHW B;  1ZGU B;  1E8W A;  2BTE A;  4E3C A;  4DK5 A;  2TSS A;  3AE7 B;  2D3C A;  3GZN I;  2X38 A;  1LGR A;  4HJG E;  1N61 A;  4GDL B;  3R3M A;  4B0M A;  1AWD A;  2LGD A;  4XYC A;  4DXG A;  3KH0 A;  3HRD D;  2X8X X;  3ZW3 A;  2I1K A;  1FFU A;  2ZPY A;  1Z5S B;  2KD0 A;  2DWQ A;  3UIN B;  3Q3N C;  1K8R B;  1D5Z C;  2JWU A;  1QKZ A;  3W1S A;  3DBR B;  5L83 A;  3EC8 A;  2KAN A;  2O6V B;  1WE7 A;  3MJW A;  3URY A;  4IWP A;  1DOI A;  4ZYN A;  1S3S G;  1SSN A;  2CJN A;  1D3Z A;  3V6C B;  4C56 C;  4HVB A;  2DYM A;  3X23 A;  2W82 A;  2GBM A;  3BII D;  2AX5 A;  2LVQ A;  4KX6 B;  3BY4 B;  4HKQ A;  2DLB A;  3P4S B;  3H9D A;  4MEL A;  3VUX A;  3LDZ E;  1NVI D;  3RNE C;  3T8M A;  3BVM A;  1WYW B;  2GBK A;  3H7S A;  4NJ7 A;  4GB9 A;  4BOS C;  2KJR A;  3VVW B;  3M63 B;  4N58 A;  1JWB D;  1IYF A;  1L6U A;  2CU1 A;  2RSU A;  4ANU A;  2K8C A;  4XWW A;  5C1Z A;  1WXV A;  2K8H A;  4JPS A;  4IW0 A;  4P1B C;  1YQ3 B;  4RGT A;  1F52 A;  3KUC B;  2LEK A;  2N9K A;  3L16 A;  5BYS A;  4OZB A;  3UIP B;  4ZRQ A;  1E6E B;  1T5X D;  4ZHP A;  3A9K B;  3TSS A;  3V6E B;  3K9O B;  4GLS C;  4C00 A;  2IO2 B;  2Z59 B;  3ONS A;  2WDR B;  1ENF A;  1CJE A;  1F0Z A;  3DVG Y;  3ZQ4 A;  2JVC A;  2G3Q B;  4JGH B;  2LXC A;  2MA9 B;  4ARC A;  3Q8A A;  3R2T A;  2OED A;  2ON8 A;  4HCP B;  1N6Z A;  3OLM D;  1V8C A;  2AYO B;  4OVV A;  2L83 A;  4YTP B;  1E10 A;  3N30 A;  3WAM A;  3NVZ A;  2NR2 A;  5J2R A;  1OGW A;  3L54 A;  4FBJ B;  1C78 A;  3ETR A;  3OWE B;  1QQR A;  5J17 A;  4HXD A;  4WAF A;  2G4S A;  4BVU C;  2KFJ A;  1V86 A;  2MLB A;  1F77 A;  4MGZ E;  4A3P A;  2A5U A;  2JRH A;  1FPY A;  1EWC A;  3Q6B A;  3CSF A;  1TS5 A;  2BVC A;  2WXI A;  2BWF A;  3R8B A;  1AW7 A;  2LUE A;  2FCQ A;  4GXB A;  2DAF A;  2WXH A;  1SGH A;  3N20 C;  3QAR A;  2ZEQ A;  1XT9 B;  3VHT C;  4S0R A;  1WY8 A;  2WXQ A;  3TMP B;  1I42 A;  1PFD A;  4IM3 A;  2LVO A;  1FFV A;  1VCB A;  2INN E;  3P2B A;  1JRP A;  2SAK A;  3PPA A;  4G3X B;  1SBB B;  4EFO A;  1I4X A;  2Y3A A;  1GPX A;  1V80 A;  1E7P B;  2WHI A;  2IGG A;  4WQM A;  1V5O A;  1HEZ E;  2W9N A;  1L7Y A;  4WJN A;  1UF0 A;  4AQ7 A;  2AL6 A;  2WDT B;  1C9F A;  3AEF B;  1WFY A;  3EHV A;  3U7D A;  1VR9 A;  1NBF C;  1VZ6 A;  3ZVV A;  2KTR B;  3HVD A;  2IND C;  4ANV A;  1WM2 A;  3W2D A;  4XDC A;  3ZKJ C;  1TS2 A;  4KVG B;  4J3O D;  2KWC A;  1E9M A;  1IP9 A;  1RFA A;  1I35 A;  4BBN C;  3VTV A;  1Q10 A;  4B95 A;  3RD2 A;  1R4N B;  1DOY A;  2WYQ A;  1EF1 A;  4LNF A;  1DGJ A;  1Y56 A;  2PKO A;  2KWV B;  1IBX A;  4C80 A;  2H88 B;  2ZNV B;  1KLU D;  1WZ3 A;  2EMT A;  2HDE A;  3RUL A;  3ZO5 B;  1P3Q U;  2KWU B;  3RUI B;  3NUH B;  1V1P B;  1CK1 A;  3AMZ A;  3AE8 B;  1NYR A;  5IOI A;  1WJ6 A;  4Q2J A;  3PZ8 A;  2WQY B;  4CQN A;  4FUL A;  3ML8 A;  1FNU A;  3Q3F A;  4RGN A;  1VLB A;  1EU4 A;  2UYZ B;  1ZPS A;  2R2Q A;  3RNB C;  1FXT B;  1WR1 A;  3DHI C;  3T9L A;  2WLB A;  2KLC A;  3VH4 B;  1YQ4 B;  4US8 A;  5AEK B;  3VH3 B;  4RGM A;  3RI7 C;  3ZIM A;  1RYJ A;  3DHH C;  1EF5 A;  1Z2M A;  3GP7 A;  4M8M A;  1N62 A;  4RM8 A;  2XNA C;  2QIE B;  2M1M A;  5HI1 A;  3ZJT A;  1QOF A;  1FMA D;  1N5X A;  2ASQ A;  3Q8E A;  2LGX A;  3QQ8 B;  1WXS A;  4ZRP A;  1GC6 A;  4URK A;  2DYB A;  5EE3 A;  1R4M B;  3PSE B;  1ZUD 2;  1HA5 A;  3TBL D;  1TKE A;  4ZYS A;  2BWE S;  4RMA A;  4A8X C;  4TQ1 A;  1QIL A;  2HTM E;  2J7Q B;  3W5V B;  4BBN F;  3A33 B;  4A90 A;  3VTU A;  4CO7 A;  3ML9 A;  3EGR A;  1PQS A;  1JCK B;  1FEH A;  3MTN B;  2KAJ A;  4KSK C;  3PS6 A;  3DHG C;  2NCN A;  4J6I A;  2KN4 A;  2KT7 A;  2PVG C;  3N9Y C;  2LGI A;  3VUW A;  3HM6 X;  4ANX A;  1UWX A;  4P16 A;  2QEJ C;  4ZOH C;  4MDK E;  3AU5 A;  3BVZ A;  3MC8 A;  4NAM A;  5JXV A;  1TIF A;  3NS8 A;  3R2I A;  1SJE D;  3U4E G;  4DXF A;  5H8Y E;  1PYW D;  5LNK 1;  5IAA C;  3E56 A;  2K9X A;  3IHP C;  1OEY J;  1OTR B;  3U52 E;  2BKF A;  3I9V 1;  4A9A A;  1I4H A;  1YN3 A;  3UQB A;  4MM3 A;  2KDM A;  3WA0 A;  3DBH I;  2N9P C;  5JHB A;  4KIK A;  2MSE D;  2M19 A;  3PO0 A;  1FRR A;  3H1U A;  4MSQ B;  3A1Q A;  1HE8 A;  1WXA A;  1AN8 A;  2ZCC A;  3RZF A;  1RRB A;  4LDT B;  2XEW A;  4CHK A;  1YN4 A;  2IJ0 A;  2MBB B;  3EEC A;  2AQ3 B;  2Y5B B;  3ECI A;  3TL5 A;  5GXG B;  1NI2 A;  2CR5 A;  4NJC A;  3PRM B;  2K8B A;  3K9P B;  3DVN U;  4B9K A;  2XK5 B;  4GMV A;  4LK0 M;  2EMS A;  2BW2 A;  3IVF A;  1ZE3 D;  2DHZ A;  1D6E C;  1T0Y A;  1TY0 A;  2JPH A;  4MGY E;  2NBU A;  1FNW A;  4F7Z A;  5IA7 A;  2REX A;  3SHQ A;  3JSV A;  2XBB C;  2WX0 A;  3PLU A;  1C4C A;  4WH4 A;  5HFY A;  2QHO A;  4FAD A;  2D10 A;  4UDU C;  2WXJ A;  2JUO A;  2ZPN A;  4W9C A;  1EUV B;  2BBC A;  2EKE C;  2Z8L A;  2C7H A;  3H7P B;  1KTK A;  2SEB D;  3L08 A;  2L52 A;  4GU2 A;  4HKZ E;  2L1A A;  3VAW A;  4M8N A;  1YX5 B;  4H2A A;  2NS5 A;  3AM9 A;  4G50 A;  2D3B A;  3RZW C;  3KQ4 A;  3W9C B;  4LJP B;  4EZJ A;  1V5T A;  1UUP A;  3PVL A;  2N1V A;  1E7U A;  2N7D A;  3DWM A;  3DOW A;  2LJ5 A;  4G0N B;  4WIP A;  3I5J C;  1MHH E;  3AEC B;  1VJK A;  3Q8F A;  3VR9 B;  1QZE A;  2BYV E;  4RH6 A;  4K7S A;  2BS3 B;  1V81 A;  4NJ6 A;  2J53 A;  2C5L C;  4ARI A;  2LGY A;  3Q3O C;  1WH3 A;  1T6B X;  4KKI A;  1XLO A;  4PT5 A;  1DOX A;  2PLP A;  5JZE B;  4II3 B;  2W54 A;  2ICI A;  4LLG M;  4KGR A;  2EEL A;  2HD5 B;  1YD8 U;  3T3O A;  3OJ3 A;  3ZTC A;  3DCG A;  4IWO A;  4LDT D;  1GNU A;  1A70 A;  2Q5W D;  3DQV A;  1F2R I;  1TBE A;  2R2O A;  3WAN A;  4GN1 A;  2HTH A;  5DPR A;  2HE7 A;  2NPT A;  4YXD B;  4NY0 A;  1JWA D;  4LTU A;  2FID A;  4M02 A;  3BIN A;  2W3S A;  3KVF B;  3WAP A;  3N1Y C;  2PIA A;  2JYT A;  2G4D B;  3IXS A;  3EFU A;  4OVZ A;  3EA6 A;  2MRP A;  1SXT A;  4DHJ D;  3QWZ B;  2I2Y A;  1B1Z A;  2KLG A;  4PS7 A;  2FUG 1;  3M95 A;  2KWD A;  2KO3 A;  2CHZ A;  3T3N A;  3DBL I;  3PHX B;  5IN7 A;  4WJQ A;  4IOI E;  3FC4 A;  4JWU C;  1CZP A;  2Z0E B;  2D5G A;  1P1A A;  1P7E A;  1RFK A;  1LFD A;  2WXM A;  2KKC A;  4MAC A;  2QSD A;  4DHZ E;  3TEZ A;  1IPG A;  3RNG C;  1ISN A;  2W3R A;  1Q5W B;  4RGO S;  5AZH A;  5FR3 A;  2BB5 A;  5BYR A;  5FK9 C;  1I4P A;  4HPL B;  4JWS C;  3DVG X;  1WGH A;  4I6N B;  3SD5 A;  2L3Z A;  2RR9 A;  2GMI C;  3DPD A;  3Q8B A;  1TTN A;  2GBR A;  2PE9 A;  1WGG A;  1JQ4 A;  2IO1 B;  2I38 A;  2FIF A;  3ZUN A;  5IKC M;  1J19 A;  3V61 A;  2KVZ A;  2UU7 A;  2NVU I;  2BQQ A;  2ZJD A;  4XC2 A;  1MG4 A;  5GMV A;  2M8S A;  3VXW A;  3V3X A;  3M62 B;  5BYQ A;  4ZRJ A;  1YOV B;  4RCO A;  2WX1 A;  2BKR B;  2E3T A;  4QAY A;  4N6E B;  1ZXI A;  2KDE B;  1J0G A;  3SEB A;  1WRI A;  3I57 A;  3ZNG C;  3RNC C;  3FAH A;  2KDF B;  2N9E B;  3AUL A;  2K6D B;  4W9H A;  3VTW A;  3N3K B;  3NVV A;  4PS8 A;  1WMH A;  2J0K A;  4TUU A;  5E6O A;  1B9R A;  2V4L A;  3AEA B;  3NVW A;  3WCQ A;  1JML A;  1WGD A;  1UH6 A;  5D3D A;  5D3I B;  3DBS A;  4BKS A;  1WM3 A;  2INC C;  2IY1 B;  1GC7 A;  2QJL A;  1WX7 A;  2K6Q A;  3WAO A;  3O65 B;  2BYE A;  1P0R A;  4FJZ A;  3FKY A;  2KNB A; 
#chains in the Genus database with same CATH homology
 1RLF A;  2R2Q A;  1Q0W B;  4A3O A;  4W9I A;  3D32 A;  1FXT B;  1WR1 A;  4KDI C;  3T9L A;  2MBO A;  2KLC A;  3VH4 B;  5AEK B;  4BFR A;  3VH3 B;  5CHW A;  2RGF A;  3ZIM A;  5J18 A;  1YJ1 A;  3CF6 E;  1EF5 A;  1Z2M A;  4M8M A;  4MEM A;  4RM8 A;  4AJY B;  1X1M A;  2O2V A;  4W9L A;  3B0A A;  4ASW C;  5LXI B;  2ZVN A;  1L2N A;  1UBI A;  4RM9 A;  1NDD A;  2M1M A;  4W9F A;  4EUT A;  2FCS A;  2KZR A;  4HDQ A;  4BKG A;  2LRU A;  4N9F 4;  4ANW A;  2ASQ A;  2DZJ A;  3HM3 A;  2RPQ A;  2LGX A;  3IG3 A;  5E6N A;  3QQ8 B;  1WXS A;  1YIW A;  3APF A;  4EOY A;  1GC6 A;  4URK A;  2DYB A;  2D2Q A;  2IO0 B;  3PSE B;  2K1F A;  4JL9 A;  2M0X A;  2KDI A;  2K25 A;  4DDI D;  2LAS A;  3TBL D;  4GDK B;  5EDS A;  2BWE S;  4RMA A;  3R7R A;  1GUA B;  2BYF A;  3DDC B;  4TQ1 A;  2KFK B;  2KOX A;  5AZG A;  1C3T A;  1WMH B;  2DZM A;  4EZK A;  1H8C A;  4DHZ B;  2J7Q B;  4ICV A;  4BBN F;  4OVU A;  3A33 B;  1WF9 A;  3ZTD A;  5DPT A;  3VTU A;  4NQL B;  1E7V A;  3PT2 B;  4BKS D;  4CO7 A;  4FLH A;  2YLM A;  3ML9 A;  1EO6 A;  3ZRC A;  4PYZ A;  2PPH A;  1UEL A;  1WGR A;  1PQS A;  3L13 A;  4F8C B;  1WXM A;  2MW5 A;  2I1J A;  2C7N B;  3MTN B;  3QHT A;  2L05 A;  2D11 A;  3PS6 A;  2NCN A;  4J6I A;  4KSK C;  3KYD D;  2RD0 A;  3UIO B;  2XK5 A;  1YQB A;  3KW5 B;  2KVR A;  3AU4 A;  2D3G A;  2PJH A;  4I6L B;  3SU8 X;  2MCN B;  4GDL A;  1P98 A;  4I6P A;  3VUW A;  3ENE A;  3HM6 X;  5CX3 A;  2L7R A;  4AWJ A;  4ANX A;  2HJ8 A;  1KM7 A;  4W9E A;  5HKH A;  3NHE B;  1AAR A;  3U30 A;  3W1Y A;  2GBN A;  4MDK E;  2D07 B;  4WWO A;  4TQ0 A;  1J8C A;  1C1Y B;  2PEA A;  3AU5 A;  1E5W A;  2IZV B;  1WJU A;  3AXC A;  3NS8 A;  1H4R A;  3NZU A;  2K39 A;  3NOB A;  2KK8 A;  2CHW A;  4AOF A;  5DCN A;  2O2V B;  2LZ6 A;  3A4S C;  1YX6 B;  1WJN A;  5CHF A;  5LLI A;  4WJO A;  2LI5 A;  2IY0 B;  2GOW A;  4LJO B;  3I3T B;  1E8X A;  4A20 A;  3OAW A;  5IAA C;  3IHP C;  1OEY J;  2KXJ A;  1OTR B;  1WR6 E;  3C0R B;  4MGK E;  2L0T A;  2BKF A;  2ZNV C;  1E8Z A;  3M3J A;  4HK2 A;  4XZ4 A;  3UQB A;  4MM3 A;  4WWP A;  1ZKH A;  4JQW C;  2O6V A;  4IWQ A;  3WA0 A;  3DBH I;  3X0W A;  2WWZ A;  2N9P C;  2CS4 A;  4TKN A;  2N1W A;  3APD A;  5JHB A;  1UD7 A;  2AWT A;  2ZVO A;  2MSE D;  4KIK A;  3H1U A;  2JWZ A;  4MSQ B;  3H7P A;  4AJW A;  2KJH B;  3A1Q A;  2B3A A;  1HE8 A;  1WXA A;  4ZRK A;  4W9G A;  2FUH B;  2ZCC A;  4XX5 A;  3RZF A;  4BOZ B;  1RRB A;  4LDT B;  2XEW A;  1SIF A;  2KMC A;  4CHK A;  4FA6 A;  2G45 B;  2MBB B;  3EEC A;  1OQY A;  2Y5B B;  4LCD E;  3ECI A;  4GIV A;  3PHW B;  5AZF A;  1ZGU B;  2PE6 B;  3TL5 A;  1E8W A;  4IG7 B;  1NI2 A;  5KHO A;  2CR5 A;  3WIM A;  3TJP A;  3PRM B;  4GSW A;  4E3C A;  2K8B A;  3K9P B;  3DVN U;  3N32 A;  2XK5 B;  4B9K A;  5E6P A;  1UBQ A;  3VQI A;  4DK5 A;  4NPN A;  4GMV A;  3L10 B;  4KSL C;  2EMS A;  2C7M B;  3GZN I;  4G11 A;  5D94 A;  3IVF A;  4GDL B;  3QJZ A;  5D7G A;  1VD2 A;  3R3M A;  5L95 C;  2JRI B;  4YL8 A;  2MP2 A;  2LGD A;  2DHZ A;  2JF5 A;  3QX1 A;  2GBJ A;  3KH0 A;  4P7I A;  1T0Y A;  2KN5 A;  3ZW3 A;  3S2A A;  2I1K A;  2MBH A;  2JPH A;  4MGY E;  2NBU A;  2ZPY A;  4F7Z A;  1Z5S B;  2V1Y A;  3MHS D;  3AI5 A;  2KD0 A;  5IA7 A;  2REX A;  3SHQ A;  1WI0 A;  3PRE A;  4W9J A;  2AL3 A;  3JSV A;  3HK0 A;  2XBB C;  3UIN B;  2WX0 A;  3PLU A;  2N7E A;  1K8R B;  2FAZ A;  4ZRI A;  4EZL A;  2QHO A;  4M0W B;  3QK0 A;  4FAD A;  5KHQ A;  2D10 A;  3R7Q A;  3W1S A;  2CHX A;  4MGI E;  2O6V D;  3QIJ A;  3TCA A;  3EC8 A;  2KAN A;  5L83 A;  1LXD A;  3PV1 A;  2O6V B;  2JUO A;  2ZPN A;  1WE7 A;  1EUV B;  4W9C A;  3MJW A;  4X57 B;  4IWP A;  3QCA A;  4ZYN A;  4DXA B;  2EKE C;  4KIK B;  1S3S G;  3PGE A;  2C7H A;  4FN2 A;  1A5R A;  1D3Z A;  1WRD B;  3H7P B;  3V6C B;  2YVC A;  3A1Q B;  4HVB A;  2DYM A;  3X23 A;  3ZRF A;  1E8Y A;  4HPM B;  3A9K A;  3L08 A;  3VFK A;  2GBM A;  4K1R B;  4GU2 A;  3QAQ A;  1S1Q B;  1KOT A;  2L00 B;  2LVQ A;  3BY4 B;  3DBR I;  3VAW A;  2MBE A;  4MSM B;  4M8N A;  2JZZ A;  4E71 A;  3HHM A;  4F1S A;  1YX5 B;  3A9J B;  2BPS A;  2IBI B;  2NS5 A;  4WJP A;  3TIX A;  2M4N A;  1WZ0 A;  4G50 A;  3NZS A;  3H9D A;  4MEL A;  3VUX A;  1UGM A;  3LDZ E;  3RZW C;  3ZLZ A;  3WAL A;  2ZZP B;  4LJP B;  4KZ0 A;  4NQK E;  4DDG D;  4EZJ A;  1V5T A;  2DEN B;  3PVL A;  3KUZ A;  2N1V A;  1E7U A;  2N7D A;  5BO4 B;  3T8M A;  2MP2 B;  1V2Y A;  3DOW A;  4GOC A;  2LJ5 A;  1WYW B;  4G0N B;  1KJT A;  4B6W A;  2GBK A;  2JXX A;  1BT0 A;  2FCN A;  3H7S A;  4NJ7 A;  2JT4 B;  5G2N A;  1JRU A;  4GB9 A;  4BOS C;  2KJR A;  3VVW B;  1QZE A;  2BYV E;  4W9K A;  3M63 B;  2J0M A;  3L0W B;  4K7S A;  3QA8 A;  3U8Z A;  3JSV B;  1IYF A;  1V81 A;  4IC7 B;  4NJ6 A;  2C5L C;  2CU1 A;  2RSU A;  2LGY A;  4ANU A;  4DWF A;  2K8C A;  1WH3 A;  3CST A;  3LJ3 A;  4DBG A;  4HWI B;  5C1Z A;  1WXV A;  2K8H A;  2VRR B;  3ZNH B;  5JH5 C;  4K7U A;  4NAW B;  5JZE B;  4MJS A;  4II3 B;  4IW0 A;  2HD5 B;  3ZDT A;  2AEH A;  4PS3 A;  1YD8 U;  5G55 A;  3OJ3 A;  2ZCB A;  3ZTC A;  2MQJ A;  3DCG A;  4IWO A;  3RT3 B;  2L8J A;  4LDT D;  2BF8 B;  3KUC B;  1GNU A;  3GOE A;  4ZDV A;  2NBV B;  4ICU A;  3L16 A;  1M94 A;  3DQV A;  3VUY A;  3VDZ A;  3ZNI D;  4BKT A;  3APC A;  3DVN V;  1TBE A;  2R2O A;  3IBE A;  4JIO U;  4GN1 A;  3UIP B;  2HTH A;  1SE9 A;  5DPR A;  2HE7 A;  3WAN A;  2NPT A;  2KJ6 A;  3A9J A;  4IM2 A;  4CYE A;  1XD3 B;  4NY0 A;  5DPW A;  1WIA A;  3A9K B;  3V6E B;  3NY5 A;  3ZDM C;  3K9O B;  2MWS B;  1R4N I;  2DZK A;  2FID A;  2IO2 B;  2Z59 B;  3ONS A;  3BIN A;  3PZD A;  2LRW A;  3KVF B;  3UF8 A;  3WAP A;  3DVG Y;  2J0J A;  2G4D B;  2JVC A;  2G3Q B;  4JGH B;  2LXC A;  4K7W A;  2MA9 B;  3PRP B;  3EFU A;  4KV2 A;  1LM8 B;  4HCP B;  4DHJ D;  2MRP A;  2FCM A;  3QWZ B;  4DHJ B;  1Y8R C;  3ALB A;  3OLM D;  4JLC A;  5D2M B;  3R66 C;  2KLG A;  3OJ4 B;  2AYO B;  4OVV A;  3B1L X;  4PS7 A;  3N30 A;  3RCZ A;  3WAM A;  2KX3 A;  1V49 A;  2KTR A;  3M95 A;  2NR2 A;  5C23 A;  5J2R A;  1OGW A;  2DYO A;  3L54 A;  4FBJ B;  1P9D U;  2A4Z A;  5J17 A;  2KO3 A;  2CKH B;  4KZC A;  2CHZ A;  4HXD A;  3DBL I;  2DZI A;  3PHX B;  4FJY A;  4WJQ A;  1V9J A;  2G4S A;  4BVU C;  3V62 A;  2KFJ A;  1V86 A;  2MLB A;  4MGZ E;  2JY6 A;  5LXH A;  4FJV B;  4A3P A;  2A5U A;  2JRH A;  4NAW A;  1RAX A;  2Z0E B;  5DPS A;  3CSF A;  1P1A A;  1CMX B;  2BWF A;  1UZX B;  3JYU A;  2LUE A;  1GG3 A;  2FCQ A;  2N4F A;  1LFD A;  2KKC A;  2IO3 B;  4W9D A;  2LXA A;  2OOB B;  4MJS B;  4AP4 C;  2Z0D B;  1IPG A;  4GXB A;  4DHZ E;  2DAF A;  2L0F A;  4IUM B;  1SGH A;  5JHA A;  1ISN A;  1Q5W B;  5AZH A;  2KX0 A;  3QAR A;  2ZEQ A;  1XT9 B;  1XQQ A;  3VHT C;  2M17 A;  1TZ1 A;  1WY8 A;  3TMP B;  1LQB A;  3A4R A;  5D6J B;  1I42 A;  1GJZ A;  5FR6 A;  4HPL B;  1WGY A;  4IM3 A;  3DVG X;  1WGH A;  2KC2 A;  2LVO A;  1KLV A;  1VCB A;  3CMM B;  3P2B A;  4I6N B;  4PYU A;  3SD5 A;  2NPT B;  2L3Z A;  3PPA A;  2RR9 A;  2GMI C;  4G3X B;  3DPD A;  4EFO A;  2BGF A;  1WE6 A;  3L17 A;  3QC8 B;  3B08 A;  1V80 A;  2KTF A;  4IM0 A;  4E74 A;  1TTN A;  1R4M I;  3V60 A;  2GBR A;  2PE9 A;  2MBQ A;  1WGG A;  2DAJ A;  1V5O A;  2IO1 B;  5TR5 A;  4EKU A;  2FIF A;  2W9N A;  3ZUN A;  1L7Y A;  4II2 B;  4WJN A;  4HJK A;  4HCN B;  1J19 A;  3V61 A;  2KQS A;  4MH0 E;  3UGB B;  1G6J A;  2C9W B;  2JZ3 B;  4GGQ A;  2NVU I;  2AL6 A;  2WDT B;  2ZJD A;  3KYC D;  3PLV A;  4XC2 A;  1WFY A;  5GMV A;  3EHV A;  1ZW7 A;  2M8S A;  3VXW A;  2L76 A;  3U7D A;  2NBW B;  2LWP A;  3M62 B;  2DX5 B;  1NBF C;  1OEY A;  2KC1 A;  2N9X A;  2KTR B;  3ZVV A;  4ZRJ A;  4ANV A;  4AUQ C;  1WM2 A;  3ZKJ C;  2WX1 A;  4KVG B;  2KWC A;  1IP9 A;  1RFA A;  1I35 A;  4BBN C;  3VTV A;  4WQO B;  4B95 A;  2BKR B;  2FNJ B;  3ZNZ B;  2LVP A;  3W1S C;  4HDO A;  2IYD B;  3RD2 A;  2KDE B;  3Q3J A;  1J0G A;  3ZNG C;  2WYQ A;  1EF1 A;  1TGZ B;  1F9J A;  2KDF B;  5CHV C;  4EEW A;  1WX9 A;  2MX2 A;  2KWV B;  4FHJ A;  4GDK A;  2N9E B;  3AUL A;  1E90 A;  4TV3 A;  3H6N A;  4HLE A;  2K6D B;  4W9H A;  2ZNV B;  3VTW A;  3N3K B;  2KFK A;  5CTR C;  3RYT A;  1WZ3 A;  1WMH A;  2J0K A;  2EMT A;  4PS8 A;  4TUU A;  3UQA A;  5E6O A;  3PTF C;  2V4L A;  2V3S A;  3RUL A;  3JVZ X;  2C60 A;  3ZO5 B;  1WGD A;  1P3Q U;  1UH6 A;  2KWU B;  2OJR A;  4WWN A;  3RUI B;  3DBS A;  3KUD B;  4BKS A;  1WM3 A;  2KDB A;  2KMA A;  2LD9 A;  1U4A A;  1WX8 A;  3SDL C;  2IY1 B;  3HIZ A;  1GC7 A;  1WJ6 A;  1WX7 A;  2K6Q A;  3PRZ A;  3WAO A;  3O65 B;  2BYE A;  2KHW B;  3JW0 X;  1MG8 A;  1P0R A;  4FJZ A;  4FUL A;  3ML8 A;  4KDL B;  4WAA A;  3Q3F A;  2KNB A;  1Q1O A;  1V6E A;  2UYZ B;  2KQ7 A;  3IFW B;  4K81 A;  1WJ4 A;  2UWQ A;  4NNJ B;  4FHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...