2EKEC

Structure of a sumo-binding-motif mimic bound to smt3p-ubc9p: conservation of a noncovalent ubiquitin-like protein-e2 complex as a platform for selective interactions within a sumo pathway
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
b'DPLVPRGSEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SUMO-conjugating enzyme UBC9
molecule tags Ligase/protein binding
source organism Saccharomyces cerevisiae
publication title Structure of a SUMO-binding-motif Mimic Bound to Smt3p-Ubc9p: Conservation of a Non-covalent Ubiquitin-like Protein-E2 Complex as a Platform for Selective Interactions within a SUMO Pathway
pubmed doi rcsb
total genus 18
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ekeC01
4HJKA 2DZKA 1WGDA 2CHWA 2I1KA 2LD9A 2KKCA 3CSFA 1FXTB 2GBNA 3WALA 4TUUA 5E6PA 2L0TA 3KUZA 2RR9A 1J8CA 5L83A 1NBFC 4I6PA 2Z59B 4MH0E 5E6OA 3ZIMA 3APDA 4JLCA 1WE7A 2KTFA 2L0FA 3PZDA 3KVFB 1YX6B 4PS8A 2MBQA 2FIDA 3PVLA 4HDQA 2BYVE 3AXCA 1UD7A 2CHZA 1MG8A 2WYQA 4MJSB 4JGHB 1QZEA 4K7SA 1XT9B 4GB9A 4EEWA 4ZDVA 3DVGY 4MM3A 5L95C 3NY5A 3KUDB 3U30A 3A33B 3VH3B 3TJPA 2L05A 1J19A 2NCNA 1ZKHA 2GOWA 2D3GA 4JIOU 2EKEC 2BGFA 4B95A 3DOWA 3PRPB 2MX2A 1UH6A 3X0WA 3BINA 2IO2B 1WX7A 2LVOA 1WGYA 4DHZB 1IYFA 4ASWC 2Y5BB 2KXJA 3L13A 2KMCA 2LUEA 3QARA 3BY4B 2PPHA 4G3XB 2KTRB 4W9LA 3A4RA 3VVWB 5KHOA 3LJ3A 4GDLA 2BKRB 2O2VB 4IUMB 4AWJA 4MSMB 2J0JA 4WJQA 5AEKB 2EMSA 2IO1B 2M17A 2HE7A 4FHJA 4MGYE 2BYFA 2NVUI 3CF6E 3M95A 2O2VA 3KYCD 1GUAB 3ZVVA 2IO3B 4DWFA 2RPQA 2V3SA 2A5UA 3AU5A 2I1JA 3QQ8B 4FA6A 3DQVA 2D07B 2JRIB 3V60A 4HLEA 3K9PB 4K81A 4RM8A 2FCQA 4URKA 4ZRIA 4J6IA 4HCPB 3WIMA 4GMVA 3TBLD 4MGZE 5JH5C 2MRPA 2UYZB 1C1YB 4NNJB 3VH4B 2DZMA 3H7SA 4FBJB 4BOSC 4IWQA 1V2YA 1V6EA 1E8YA 2BPSA 2KDBA 2KD0A 3KUCB 2KNBA 5AZGA 1IP9A 2BWES 3ZNZB 4TQ0A 3ALBA 2CHXA 3QX1A 3QJZA 4IWPA 1XD3B 2JXXA 2N9PC 3DBLI 4G50A 2KO3A 1WR1A 2NR2A 2YVCA 3B1LX 2KC1A 2L76A 2OJRA 2PE6B 3PHXB 3PS6A 2D2QA 3H7PB 1LM8B 4ZRJA 1UBQA 2D10A 3VXWA 1E5WA 2DZIA 4LJOB 2C7MB 4NAWB 2R2QA 2GBRA 4ZYNA 2KFKA 1TBEA 3H7PA 3PLVA 4MGIE 1HE8A 1Z2MA 4JL9A 2WDTB 5CTRC 4MELA 1PQSA 4M8NA 1WX9A 3QA8A 1OEYA 5CHFA 4NJ6A 1GC6A 4G0NB 1V80A 3VUXA 5LXIB 4IW0A 5J2RA 2KDIA 3MTNB 3S2AA 5KHQA 4GSWA 2C7NB 4DDID 1V81A 2ZEQA 3APFA 2M4NA 2EMTA 1WJ4A 4W9FA 3A1QA 4KSKC 5IA7A 1RLFA 3ZO5B 1WF9A 4MJSA 1ISNA 4NPNA 3ZDTA 3H9DA 3QCAA 1E90A 1V49A 3NS8A 2J0MA 2KDFB 4FHKA 4W9GA 4GGQA 1V9JA 4EUTA 3A1QB 2C9WB 4E74A 2DX5B 1WZ0A 2AWTA 2K25A 2KJRA 1P9DU 1UELA 4NQLB 4W9DA 4DXAB 3W1YA 1UZXB 2DZJA 3EC8A 3EFUA 4F7ZA 1WGGA 4IM3A 2ZNVB 3JYUA 3IBEA 3VHTC 5GMVA 4IM0A 3JSVB 1P3QU 2MLBA 3B08A 1LFDA 1P98A 1WYWB 2O6VA 1E8ZA 2G4DB 4NJ7A 4DBGA 1I42A 1EO6A 2NS5A 2LXCA 2KWVB 3CSTA 3WAPA 4A3OA 2M1MA 1ZGUB 1WMHB 3JSVA 3EECA 5CHWA 3SDLC 4EZLA 1WI0A 2MQJA 3V62A 3ZNGC 2BKFA 1UBIA 1WFYA 3KYDD 2N1VA 5TR5A 3PGEA 2JRHA 2MBEA 1JRUA 3DBRI 4HXDA 2MWSB 4W9KA 4HPMB 3HIZA 3OJ3A 3U7DA 3ZRFA 3HK0A 2K6QA 2MW5A 4RM9A 4YL8A 1P0RA 3PPAA 4NY0A 4FADA 2ZCCA 2GBMA 4PS7A 1L7YA 1V5OA 2KTRA 4KIKB 3VTVA 1S3SG 2HJ8A 2L3ZA 2IYDB 5D94A 5FR6A 3RCZA 2LVQA 4WWOA 3AU4A 2KWCA 2YLMA 4MDKE 2HD5B 2JZZA 1OQYA 2D11A 2MP2A 5C23A 5J17A 2XK5B 1R4NI 2L7RA 4XX5A 3OJ4B 3ZRCA 4PS3A 1SGHA 5BO4B 2L00B 3B0AA 3V6CB 3ONSA 1Q0WB 4RMAA 4XZ4A 5JZEB 1TZ1A 1WE6A 2K39A 3PHWB 4DHJB 4II3B 5LLIA 3DBHI 2RSUA 5E6NA 2PEAA 2IBIB 3DVNV 4WAAA 1S1QB 1WJ6A 1YD8U 3DVNU 3UQAA 3KH0A 4K7UA 2QHOA 1Z5SB 1XQQA 2N9XA 1A5RA 2Z0DB 2GBJA 2J0KA 4W9HA 2PE9A 4I6NB 3VFKA 3QC8B 3WA0A 2OOBB 2RD0A 4K1RB 4CHKA 2BWFA 3ZNHB 2N1WA 1Q1OA 1WGRA 5AZFA 4HCNB 2NBWB 1J0GA 3ZUNA 2C5LC 3NOBA 1R4MI 4W9IA 3RZFA 2IO0B 2O6VB 4B6WA 1E7VA 2MBHA 4GDKB 1EF5A 3VQIA 3IVFA 1OGWA 3MJWA 1YX5B 2C7HA 2PJHA 1WIAA 3PREA 2LGYA 1GNUA 1Y8RC 2ZPYA 2FCMA 4ANXA 3K9OB 2ASQA 4IWOA 3QIJA 3L54A 3ENEA 4W9CA 4FJYA 1L2NA 1WM2A 5JHBA 3N32A 1WM3A 4IG7B 1VCBA 4MEMA 4EFOA 3ECIA 1YIWA 4XC2A 2CU1A 2LI5A 4TQ1A 4KDIC 2K1FA 3N3KB 4ICUA 3GOEA 2CKHB 3QK0A 5C1ZA 1X1MA 2M8SA 2XK5A 3EHVA 4BBNF 1G6JA 3N30A 1WY8A 1AARA 2G3QB 2KOXA 4HK2A 2G45B 5DCNA 3VUYA 1T0YA 1KJTA 3P2BA 3ZNID 3IG3A 4NQKE 5DPRA 4I6LB 5AZHA 3VTWA 3QAQA 2KANA 1WMHA 4BVUC 3GZNI 3I3TB 1E8XA 4BBNC 2AL3A 1RFAA 4FLHA 4P7IA 3VAWA 3V6EB 3JVZX 1OTRB 4WWPA 4IM2A 2AL6A 3VTUA 2HTHA 2CR5A 3LDZE 4OVUA 5J18A 1H4RA 2W9NA 2GBKA 4KV2A 3W1SC 4AOFA 4HWIB 4BKGA 4BOZB 1V5TA 3L08A 3WAMA 3ZTCA 3M62B 1WH3A 3AULA 3T9LA 3UGBB 3TL5A 3R7RA 1U4AA 4HVBA 2LJ5A 2MBBB 2N7EA 3M3JA 4GU2A 4LJPB 3IFWB 4FN2A 1KOTA 1WR6E 2FCNA 3M63B 3OLMD 2K6DB 3L10B 4AP4C 3PTFC 2RGFA 1C3TA 4PYUA 3Q3FA 4FJVB 4KIKA 2LZ6A 2V4LA 4BKTA 1WGHA 2XBBC 3KW5B 5CX3A 1GJZA 5CHVC 4X57B 4CO7A 4GXBA 3QWZB 1M94A 2NBVB 4JQWC 4W9JA 3RZWC 3UQBA 2R2OA 3RYTA 2JUOA 3H1UA 2MP2B 4ANWA 1E7UA 4M8MA 2NBUA 4EZJA 1YJ1A 3PV1A 2AEHA 4HPLB 1WXSA 1WJUA 4WJNA 3TMPB 4DDGD 4NAWA 1D3ZA 2KHWB 5JHAA 3R3MA 1WZ3A 2JF5A 4B9KA 4ZRKA 4KDLB 4PYZA 2CS4A 4W9EA 3W1SA 3PLUA 4AJWA 4DK5A 2KN5A 2V1YA 4WWNA 3HM3A 2ZNVC 3A9JA 3Q3JA 2L8JA 4GDLB 4KVGB 1UGMA 2M0XA 2B3AA 2LRUA 2C60A 5G2NA 3HHMA 2FIFA 3RULA 2NPTB 3R66C 4K7WA 4N9F4 3SU8X 3H6NA 3VDZA 2KLCA 2KQSA 4ANVA 1RAXA 2IZVB 5EDSA 1TTNA 2DENB 2N7DA 2KX3A 4GN1A 2KJHB 1NDDA 2Z0EB 1CMXB 2KLGA 2XEWA 1V86A 4WJPA 5D2MB 2GMIC 1WXAA 3A9KA 3R7QA 3AI5A 2KK8A 3DVGX 2N4FA 3NHEB 2K8HA 4IC7B 3D32A 1I35A 5D6JB 2DAJA 2K8BA 4WJOA 3NZSA 4WQOB 1WJNA 2A4ZA 2BYEA 2ZVOA 2JZ3B 1TGZB 3A9KB 3PSEB 1GG3A 4EKUA 2WWZA 4G11A 3RUIB 1SIFA 2LXAA 2KQ7A 4II2B 2UWQA 1P1AA 2IY1B 3MHSD 2AYOB 3PT2B 4BKSD 2NPTA 4A3PA 2K8CA 3ML9A 5D7GA 4F8CB 2KX0A 3L17A 4TV3A 2KFJA 1WXMA 3RT3B 1KM7A 2DYBA 3NZUA 4MGKE 3ML8A 1YQBA 2DHZA 3SHQA 4BFRA 2N9EB 3ZDMC 1OEYJ 2BF8B 4AJYB 4CYEA 2FUHB 1GC7A 3U8ZA 3V61A 3DCGA 2WX1A 2KFKB 2REXA 4M0WB 3RD2A 3ZTDA 2JWZA 2ZZPB 4A20A 3C0RB 3PRMB 2JPHA 5HKHA 2DAFA 4E3CA 4ANUA 4BKSA 4KZ0A 4AUQC 1EUVB 3CMMB 2ZPNA 3SD5A 3ZKJC 2LGDA 3WANA 1WRDB 3QHTA 2KVRA 5G55A 3UIPB 2MA9B 2JT4B 2KDEB 2IY0B 2MCNB 2VRRB 2KMAA 1ZW7A 4GOCA 2MBOA 4MSQB 1BT0A 2DYOA 1VD2A 2MSED 1EF1A 2KJ6A 2FAZA 5DPTA 4KSLC 4GIVA 1E8WA 1WXVA 4DHJD 2FNJB 3A4SC 3DBSA 2KWUB 1K8RB 3ZLZA 1LQBA 3DPDA 4ICVA 4F1SA 2J7QB 4EOYA 3PRZA 4HDOA 2ZJDA 1H8CA 2LASA 4LCDE 1LXDA 4FULA 4KZCA 1NI2A 2FCSA 2WX0A 5IAAC 3ZW3A 3X23A 2G4SA 2DYMA 4OVVA 3HM6X 3IHPC 3UINB 5DPWA 2ZVNA 1Q5WB 4FJZA 2LGXA 3WAOA 4EZKA 1WX8A 4TKNA 1F9JA 1SE9A 1RRBA 3DDCB 3UF8A 3UIOB 1IPGA 4LDTD 4DHZE 2KC2A 3O65B 2LRWA 3L16A 3TCAA 1KLVA 3JW0X 4E71A 2JY6A 3T8MA 2LVPA 3VUWA 2O6VD 2KZRA 4GDKA 2LWPA 3L0WB 5DPSA 2JVCA 3OAWA 3TIXA 3A9JB 4LDTB 5LXHA 2ZCBA 3APCA
chains in the Genus database with same CATH superfamily
2KKCA 2L0TA 1J8CA 4DXFA 1TS5A 5E6OA 3IXSA 3GS2A 2KTFA 2V0GA 2AQ1B 1C77A 4MM3B 3PVLA 3FAHA 1UD7A 2CHZA 2W55A 2WYQA 4JGHB 1XT9B 1UGJA 5C3JB 2L1AA 5L95C 3U30A 3A33B 3L4PA 1J19A 2QCZA 1VZ8A 4Q2JA 1ZKHA 4JIOU 5TSSA 3PRPB 1UH6A 3BINA 4DHZB 1WGYA 2BS4B 1K52A 2KXJA 4G3XB 2KTRB 1I7HA 2WNMA 1GB4A 4MGYE 2KQ4X 1YN4A 3M95A 3TEYA 3ZVVA 2IO3B 2A5UA 2L83A 2Z8LA 1VRAB 2WDQB 3K9PB 1SE3A 1QQRA 4IKGA 4J6IA 3WIMA 1FEHA 1XEEA 4WWMA 5JH5C 2MRPA 1C1YB 4RGOS 4IWQA 1YN5A 1E8YA 2KNBA 2JU6X 1IP9A 1N63A 3ALBA 2CHXA 2BS2B 1XD3B 2JXXA 3FILA 2NR2A 1T5XD 2YVCA 2PE6B 2NTSA 1WRIA 3H7PB 4ZRJA 2DZIA 3PZ8A 1FCCC 4NAWB 3I5JC 4ZYNA 2KFKA 1TBEA 1CQVA 4LK0M 2TSSA 1XO3A 2WDTB 3CWIA 4M8NA 1WX9A 3QA8A 5CHFA 3DBHB 1GC6A 2WXKA 2KMMA 5LXIB 4K3CA 3APFA 3AE5B 2EMTA 3A1QA 3AMZA 1TY0A 4KSKC 1WF9A 1ISNA 4NPNA 3ZGZA 2AQ3B 3QCAA 2KDFB 1AWDA 1P9DU 2DNFA 3W1YA 1Y56A 2DZJA 2VH2A 1T0RC 1WGGA 2JXTA 3JYUA 1HZ5A 3JSVB 2MLBA 5EE9A 3B08A 1LFDA 1P98A 2G4DB 1D6EC 1T0QC 1QOFA 3CSTA 3NRZA 4P16A 5CHWA 3HRDD 2BKFA 1UBIA 5TR5A 3PGEA 2MBEA 4HXDA 3R2IA 3U7DA 1SB3C 3OJ3A 4K3BA 4YL8A 2DLBA 1P0RA 3GZNB 2GBMA 4PS7A 1L7YA 3J9CA 1I4PA 3ZJVA 5FR6A 5D94A 4WWOA 3MC8A 3AU4A 2KWCA 2YLMA 4MDKE 2ON8A 2D11A 1IUEA 1PGAA 5J17A 1KLUD 1STEA 1R4NI 4XX5A 3OJ4B 4ITKA 1OFFA 3NG0A 1YMHE 2L00B 2WU2B 3B0AA 5LNK1 1TZ1A 2BVCA 1RWSA 3FKYA 1WE6A 4II3B 3DBHI 1TKYA 2IBIB 4MH8A 1MJDA 1F2RC 4K7UA 2QHOA 4OHJA 4AQ7A 2GBJA 1SJED 2PE9A 3QC8B 2W3RA 2PKOA 3P1MA 3WA0A 4CHKA 1TT5B 1WGRA 2NBWB 4QAYA 3BK2A 1RM6C 1XCTL 1OGWA 2X8XX 4IOIE 2C7HA 2PW9A 2FUG1 2PJHA 1V8CA 1QILA 3PREA 3K9OB 2IPKD 1CK1A 3GE8C 4CQNA 1F0ZA 4IG7B 4MEMA 2FE8A 3KWVA 1XF5L 5T8IA 2RDHA 1VZ7A 2KWDA 2M8SA 1C4CA 2KYWA 2XK5A 4BBNF 1WY8A 2G3QB 2KOXA 5DCNA 1T0YA 3IG3A 2OEDA 5DPRA 2KANA 4BVUC 2PMVA 1E8XA 2AL3A 1NEKB 1IBXB 3DHHC 4WWPA 4NAMA 5EE3A 2BYTA 1H4RA 3W1SC 4BOZB 4AOFA 4HWIB 3M62B 1T6BX 3UGBB 4HVBA 1SSNA 2K22A 2MBBB 4RGTA 3M3JA 1M4VA 4AS1A 1WR6E 2FCNA 1IGCA 3M63B 3OLMD 4AP4C 3MC0B 2RGFA 2LZ6A 2V4LA 3KW5B 5CX3A 1VZ6A 3QWZB 1M94A 1AW7A 1PUTA 2MP2B 4C7YA 4EZJA 2WS3B 1YJ1A 4HPLB 1WJUA 2PLPA 3R3MA 1V1PB 4B9KA 1RFKA 2V3NA 3OG5A 3W1SA 2KN5A 5I4DA 3VRAB 1ET9A 3A9JA 4P1BC 3Q8FA 4KVGB 2M0XA 1DYQA 2C60A 2K5PA 3SU8X 3H6NA 2KQSA 4RNAA 2N7DA 1F1HA 2KJHB 1JWUD 1NDDA 2Z0EB 2XEWA 4L1BA 2GMIC 4RCOA 3DVGX 2KK8A 1TS2A 4WJOA 4WQOB 1WJNA 2A4ZA 2JZ3B 3PSEB 1PDXA 5H92C 2WWZA 2D3AA 3RUIB 1DOYA 1SIFA 1V97A 3N9YC 3MHSD 3O13A 2NPTA 2K8CA 4FXCA 3ML9A 4F8CB 1QKZA 3L17A 3RT3B 2DYBA 3NZUA 2KAJA 3AE8B 1E10A 3RNFC 1OEYJ 2BQQA 4AJYB 3Q8EA 3NVWA 2WX1A 1B1ZA 4KX6B 3ZTDA 4WQMA 1D5MC 3PRMB 4E3CA 3SD5A 2LGDA 1N62A 1PFDA 4D2KA 2MA9B 2KDEB 2IY0B 2M56B 1NVID 2MBOA 2DYOA 1FPYA 2MSED 1Q10A 5DPTA 3KLSX 2IJ0A 4O1NA 1K8RB 5HHDG 4C7ZA 1VLBA 3ZLZA 3TEWA 4ICVA 4EOYA 2R61A 4HDOA 3I57A 1H8CA 2LASA 3AEFB 4KZCA 2WX0A 4WH4A 5IAAC 3SFDB 4OVVA 1BUIC 2ZVNA 4FJZA 1RRBA 4LDTD 3TCAA 1FXIA 4E71A 2LVPA 4RF0A 5DPSA 4RH6A 3VR8B 1SEBD 4LNIA 3A9JB 4HJKA 2CHWA 1FXTB 1DGJA 3AN1A 4MH0E 4JLCA 4RFBA 1FFVA 1YX6B 2FIDA 4HDQA 3AXCA 1D4BA 1QZEA 3PO0A 4ZDVA 3R2TA 4MM3A 2BB5A 1C4AA 2H89B 3KWLA 2IGHA 2NCNA 3RPFC 2BGFA 4ARIA 2QC8A 1QLBB 1XXGA 2IO2B 1WX7A 1IYFA 2Y5BB 5BYRA 2LUEA 5EE0A 4W9LA 3A4RA 4ZRQA 3U52E 1ET6A 4WJQA 2IO1B 2M17A 2BYFA 3CF6E 4ZHPA 2RPQA 4L2YA 1MFWA 4N6EB 3GB1A 2V3SA 3P4SB 2I1JA 1TS4A 1JCKB 3DQVA 3HVZA 4URKA 3AE9B 4GMVA 1EWCA 2WU5B 4MGZE 3BIID 2UYZB 1L4ZB 2DZMA 2KN4A 5E6JA 1QF6A 2LGSA 3P42A 1V2YA 1V6EA 3Q3MC 2KDBA 5AZGA 2BWES 4TQ0A 3QJZA 3ABVB 4G50A 3V3XA 1WR1A 2KC1A 2OJRA 2WP9B 3PHXB 2D2QA 3P4QB 1UBQA 5IO9A 1E5WA 2JWUA 4REZA 2XNAC 2GBRA 4HEA1 2X38A 3H7PA 4MGIE 3W5VB 1GAQB 1YOVB 2WDVB 3AEEB 3NUHB 1SIJA 1MVKA 1V80A 3VUXA 4IW0A 5J2RA 3S2AA 1WJ4A 3T3OA 1ZDXA 3V05A 2EKIA 3ZDTA 1V49A 4EUTA 2E3TA 3A1QB 1L4DB 2DX5B 2K25A 2KJRA 4W9DA 1UELA 1N5XA 3IAS1 4NQLB 1UZXB 2RPVA 2XN9C 1ZE3D 1YQ3B 1FCLA 1C4PA 1P3QU 2O6VA 4DBGA 1I42A 4NJ7A 2L52A 2W54A 2EELA 2LXCA 3WAPA 4A3OA 2M1MA 1ZGUB 1WMHB 3JSVA 4EZLA 3SDLC 1XLPA 2WXPA 3V62A 3ZXVA 1FM0D 4YWGG 2JRHA 3B2GA 4HPMB 3BVMA 3HIZA 4RM9A 3PPAA 4NY0A 4BZAA 2ZCCA 1V5OA 3Q6BA 1GB1A 2KTRA 3W5UB 2HJ8A 2IYDB 1AN8A 4M00A 4XYCA 2HD5B 2JZZA 2L7RA 2PVGC 3AE1B 2HTME 5BO4B 1FXAA 3ONSA 5FK9C 4XZ4A 3GE3C 3ZJUA 2PEAA 4WAAA 3DVNV 4C4VB 1S1QB 1YD8U 2W3SA 3KH0A 1K50A 3NVVA 1XQQA 2G1EA 3LB8C 4I6NB 2WLBA 3ZXRA 4A90A 2WXLA 1FMAD 5AZFA 4P6VF 1ZUD2 3P4PB 4W9IA 1QOBA 3AEGB 1E7VA 2MBHA 2B76B 1EF5A 3IVFA 1KLGD 1TYGB 1Y8RC 4ANXA 1MHXA 1QOAA 3AEBB 2QSDA 1TKGA 1WM2A 5JHBA 1VCBA 4JPSA 4EFOA 1YIWA 4XC2A 3RNAC 3UI3A 2LI5A 4HJGE 3GOEA 5C1ZA 1X1MA 4JE3B 4EE2A 3NVYA 3ZNID 5BMHA 4I6LB 2KVZA 1P7EA 1WMHA 1RFAA 1ACCA 4P7IA 2VZKD 3V6EB 2M19A 1L6VA 2CR5A 2HDEA 2W9NA 2GBKA 2ZW1A 1UWXA 2ONQA 1WH3A 2PTLA 3R7RA 1U4AA 1K51A 4MACA 2LJ5A 1TY2A 3IFWB 2WXMA 4FN2A 1PGBA 1C3TA 1GJZA 3AEDB 4X57B 4GXBA 4OZCA 3UQBA 4W9JA 2JUOA 1ZP0B 3H1UA 1E7UA 4UDUC 1WXSA 5JHAA 1WSPA 2DWQA 4KDLB 4ZRKA 2MH7A 2ZNVC 1V1PA 4GDLB 1UGMA 2B3AA 4ACFA 5G2NA 1N61A 3RULA 3VDZA 4N9F4 3NVZA 1EM7A 2QJLA 2KX3A 1CMXB 3BVGA 2MJEA 2UU7A 3AE3B 3A9KA 2N4FA 3D32A 1I35A 2DAJA 2BYEA 3E56A 1TGZB 1GG3A 1JWMD 2WHIA 1UNSA 4G11A 2JYEA 1P1AA 2IY1B 3PT2B 2AYOB 1R4MB 4A3PA 2SAKA 2KFJA 4GLSC 3Q3NC 2INPE 1YQBA 2DHZA 3SHQA 2N9EB 3RI7C 3ZDMC 2IGGA 1KTKA 4CYEA 3LXFA 5IP4D 1P7FA 4M0WB 2REXA 2ZZPB 4A20A 4KZ0A 1FFUA 2ZPNA 1WRDB 2K9XA 3QHTA 2ACZB 3UIPB 1T0SC 2BW2A 4HPPA 3TSSA 1R4NB 4MSQB 1JRPA 1EF1A 2FAZA 1C9FA 3RNEC 2KT7A 4DHJD 3TEZA 1E6EB 2QMTA 3TEXA 3IT6B 2ZJDA 4LNFA 1MHHE 1LXDA 4C00A 3X23A 2G4SA 2DYMA 3HM6X 3UINB 2W82A 2LFIA 3LYYA 4TKNA 1F9JA 1VR9A 3UIOB 3Q2AC 3O65B 1XLOA 2KZRA 4GDKA 4USAA 2WXOA 2JVCA 1SF0A 1SE2A 2DZKA 2LD9A 2GBNA 5E6PA 4HROA 3KUZA 2RR9A 1BXTA 2N7JA 2Z59B 3AH7A 3BYYB 3ZIMA 1WE7A 2L0FA 3PZDA 3KVFB 4PS8A 4MJSB 4K7SA 4GB9A 4YTPB 3AE7B 4S0RA 3NY5A 3KUDB 3VH3B 1HA5A 1IBXA 1UWMA 2D3GA 2N9LA 4ZOHC 2EKEC 4B95A 3DOWA 4LNNA 4XWWA 2MX2A 2LVOA 3RNGC 1SE4A 3L13A 1QOGA 3Q8BA 2KMCA 3QARA 3BY4B 2PPHA 3DBRB 3VVWB 4GDLA 2BKRB 2O2VB 4IUMB 2QIEB 3DHIC 5AEKB 2EMSA 2HE7A 4FHJA 4LTUA 1GUAB 1C79A 2D07B 3V60A 2BT6A 4HLEA 4JWUC 4K81A 4RM8A 2FCQA 4HCPB 2WQYB 1FNUA 4NNJB 3VH4B 4FBJB 3H7SA 4BOSC 5H8YE 2KD0A 4BAXA 1EU3A 2BTEA 3B2FA 4LNOA 2N9PC 3DBLI 3B1LX 4MT5A 2L76A 3RFZB 2H88B 2D10A 3WCQA 4RGMA 4M0WA 3PLVA 4XWTA 3AECB 1ESFA 3KQ4A 2CJNA 1HE8A 1Z2MA 2INNE 1PQSA 3DWMA 2WXQA 4KGTA 2KDIA 3MTNB 5KHQA 2C7NB 4DDID 1N5WA 2ZEQA 2J52A 4W9FA 2SEBD 5IA7A 3IT4B 1E0ZA 1RLFA 4MJSA 1D5XC 4M01A 1OQQA 4W9GA 1V9JA 3SR6A 4US8A 2C9WB 1WZ0A 1KRHA 4DXAB 4N59A 2V3PA 3EFUA 1YN3A 2ZNVB 5GMVA 4IM0A 5IN7A 1E8ZA 3RMKC 1YNTE 1EO6A 2NS5A 1JWSD 4C80A 1TZOA 4YXDB 3EECA 1FNWA 1OQRA 1WI0A 3N1YC 1WFYA 1MG4A 4W9KA 1ZXIA 2MWSB 3ZRFA 3HK0A 1KF6B 2K6QA 4FADA 2YEPF 5D3IB 4KIKB 3VTVA 3RCZA 2FBWB 2WXFA 1JWBD 5C23A 1NENB 4OVZA 3V6CB 1HTOA 2MHJA 5JZEB 3IAM1 2OHFA 3PHWB 4DHJB 4XGAB 3DVNU 2L32A 2D3CA 4A9AA 1TKEA 2J42A 1A5RA 2QILA 2J0KA 2RD0A 2NMQA 4K1RB 2BWFA 4TSSA 3ZNHB 1Q1OA 1CJEA 4LNKA 4N58A 2C5LC 2YEPB 3NOBA 2O6VB 3URYA 2N9KA 4GDKB 1FRRA 2LGYA 1GNUA 2Y3AA 1JMLA 1DOXA 2WGSA 3QIJA 3L54A 1SBBB 3ENEA 4YTMB 4W9CA 4FJYA 5JXVA 1L2NA 3N32A 1WM3A 1V1OA 3ECIA 2CU1A 2I38A 4TQ1A 4ZRPA 2WXRA 4KDIC 2K1FA 2LMCA 3ETRA 3N3KB 2CKHB 2LUMA 3EHVA 1G6JA 2AQ2B 3OWEB 1L5PA 2G45B 4LLGM 3VUYA 1KJTA 1WXQA 4H2AA 4NQKE 3N1ZC 4WURA 2VZKB 5AZHA 5EE1A 3ZYYX 3BWUD 3I3TB 4BBNC 1JALA 2E6XA 3VAWA 1NI3A 1OTRB 3JVZX 2HTHA 3LDZE 5J18A 4ZHOA 3L08A 1HXYD 3ZTCA 3AULA 2MJ3A 3C8YA 2N7EA 1XLQA 4LJPB 1KOTA 2K6DB 3L10B 4ARCA 3PTFC 2ZW0A 4PYUA 3Q3FA 2INCC 4BKTA 1WGHA 1K53A 1PYWD 2WXNA 5CHVC 4US9A 2OJWA 2R2OA 4M8MA 3PV1A 4WJNA 1D3ZA 2KHWB 1WZ3A 2JF5A 1B9RA 4W9EA 4DK5A 4AJWA 2IDYA 2V1YA 3HM3A 2LHDA 3AE2B 5IOIA 1ZDVA 2LRUA 3HHMA 2NPTB 3R66C 3HUIA 5BYQA 4ANVA 1RAXA 2IZVB 3BK1A 5BMIA 2D5GA 1TTNA 1I4GA 2DENB 5BYSA 1LO5D 1FNVA 4GN1A 2KLGA 1V86A 4JWSC 2ICIA 1ZOYB 1UUPA 3R7QA 3AI5A 3FILB 3NHEB 2JYTA 4DXGA 2ZVOA 3A9KB 4OW0A 1PGXA 2JZPA 4YSXB 2LXAA 1YJJA 4II2B 3VRBB 1AYFA 1ROEA 5D7GA 2KX0A 4MGKE 3Q69A 3AEAB 3ML8A 4BFRA 2BF8B 3AM9A 2WXHA 1GC7A 3U8ZA 2CU3A 3Q8CA 3V61A 3DCGA 1VDVA 1TS3A 2JPHA 2DAFA 4ANUA 4AUQC 3E9SA 1EUVB 1J7BA 1KH0A 1E7PB 3WANA 2KVRA 3DWGC 5G55A 2JT4B 3Q14C 3EFCA 1BT0A 2RDGA 3RNBC 4GIVA 1E8WA 1WXVA 2FNJB 3A4SC 3DBSA 1FRDA 3P4RB 3P63A 5FR3A 1LQBA 3DPDA 1XCQL 2J7QB 1FO4A 2FCSA 3MFGA 3IHPC 5DPWA 2J4XA 2K3UA 3WAOA 2LGXA 4EZKA 1WX8A 1SE9A 3UF8A 1IPGA 4DHZE 1ZPSA 4WAFA 1KLVA 4B0EA 2WXIA 2LWPA 3L0WB 3TIXA 2BBCA 2ZCBA 3APCA 4PT5A 4YTNB 1WGDA 2I1KA 2JSVX 3CSFA 3WALA 3SFEB 4HKQA 4R3DA 4TUUA 5L83A 1NBFC 4I6PA 3APDA 3DHGC 1RYJA 1E9MA 3RN9C 2MBQA 4B0MA 4KKIA 2BYVE 2LGIA 3I9V1 1MG8A 2BB6A 2QEJC 4EEWA 1SXTA 3DVGY 3TJPA 2L05A 4WIPA 1I4RA 2GOWA 3TUOA 5HG2A 3X0WA 4ASWC 3U7ZA 5KHOA 3LJ3A 2G9HD 4AWJA 4MSMB 2J0JA 3EGRA 1F77A 5AUKA 4RF1A 2NVUI 2O2VA 3B9JA 3KYCD 1MPEA 1N6ZA 2NTTA 2RMMA 4DWFA 1I4QA 1LGRA 3AU5A 3EUB2 4HRSA 3QQ8B 4FA6A 4A55A 2JRIB 5D3DA 3PZ7A 2K0PA 5BMGA 4ZRIA 1L0VB 3TBLD 3N1XC 1HEZE 5C2TB 2BPSA 1TJEA 1I4HA 3KUCB 1UF0A 3N20C 2GB1A 4C56C 3ZNZB 4OZBA 3QX1A 4IWPA 2KO3A 2MEKA 3PS6A 4YT0B 1LM8B 3VXWA 1FD6A 4LJOB 2C7MB 2LJIA 2WXJA 1CZPA 2GRIA 2R2QA 2LHEA 2GI9A 3R8BA 4JL9A 4S17A 2BS3B 5CTRC 1NYQA 3BYTB 3NZ3A 2DBYA 1EU4A 1WWTA 4MELA 1OEYA 4NJ6A 1F2RI 4G0NB 1HZ6A 4GSWA 1V81A 2M4NA 1J7AA 3EA6A 2KDMA 3AE6B 4TMAB 3ZO5B 3H9DA 1E90A 2JQRB 3NS8A 2J0MA 4FHKA 4GGQA 4E74A 2AWTA 1KFYB 4F7ZA 3EC8A 4IM3A 4NZLB 4KGSA 3IBEA 3VHTC 2Y5CA 1WYWB 1I4XA 2PVOD 1SJHD 2KWVB 4PK1A 1A70A 2MQJA 3MC9A 3ZNGC 2VH1A 3KYDD 2N1VA 1JRUA 3DBRI 4NJCA 2MW5A 4XDCA 2INDC 3W9CB 2IGDA 1S3SG 2L3ZA 2LVQA 1VJKA 1OQYA 2MP2A 1ENFA 2XK5B 3ZRCA 4KKJA 4PS3A 1SGHA 2I2YA 1JROA 1Q0WB 4RMAA 2K39A 5LLIA 2JX5A 2RSUA 5E6NA 3Q8AA 1WJ6A 3NJTA 3UQAA 4YSYB 1L0XB 1Z5SB 1N60A 2N9XA 2RDBC 2Z0DB 2QDFA 4W9HA 3Q3OC 3BZDB 3VFKA 2OOBB 1FIQA 2N1WA 4OZAA 2CJOA 4HCNB 1J0GA 3ZUNA 5MPOA 1R4MI 3RNCC 2WXGA 3RZFA 3ZQ4A 5FKAC 2IO0B 4B6WA 4M02A 3VQIA 1F52A 3MJWA 2V9HA 1YX5B 4C4VA 5IKCM 1L6UA 5HI1A 1WIAA 3H8HA 2ZPYA 3SEBA 2FCMA 2ASQA 4IWOA 4XDDA 3T3NA 3U2SC 1GPXA 4ICUA 3QK0A 3AV8A 3N30A 1AARA 4HK2A 3P2BA 3VTWA 5AUIA 3QAQA 3AE4B 2GLSA 3GZNI 4FLHA 5GXGB 3GP7A 3VTUA 3DBLB 2AL6A 4IM2A 4ZYSA 1C76A 4IDIA 4OVUA 4KV2A 4BKGA 1D5ZC 1ZXHA 1V5TA 3WAMA 3T9LA 3TL5A 4GU2A 3CIRB 1IGDA 4FJVB 4KIKA 2XBBC 1HQRD 4CO7A 4JQWC 2NBVB 2AX5A 3RZWC 3RYTA 1JWAD 4ANWA 2NBUA 2AEHA 4L23A 3TMPB 4DDGD 4NAWA 2J53A 4PYZA 2CS4A 3PLUA 4WWNA 1YJIA 3FC4A 1WYGA 1L0YB 3Q3JA 2L8JA 2N0SB 2PIAA 1HTQA 1J7CA 3VR9B 4HKZE 2FIFA 4K7WA 2KLCA 5EDSA 5D2MB 4WJPA 1WXAA 3HVDA 3MP9A 2K8HA 1NYRA 3NS1A 4P1CC 4IC7B 5D6JB 2K8BA 1JW9D 3NZSA 1WGKA 2KACA 4A8XC 4EKUA 2KQ7A 2UWQA 2Y5PA 2D3BA 2M0AA 1T3QA 4XE0A 4BKSD 1TIFA 4TV3A 1WXMA 1XLNA 1KM7A 1JQ4A 5G5GA 1MI0A 1YQ4B 3U4EG 1R7SA 2FUHB 1DOIA 3C19A 5G5HA 2KFKB 3RD2A 2JWZA 3C0RB 5HKHA 4BKSA 3CMMB 3ZKJC 4J3OD 3I63C 4A6QA 2HJ1A 4RGNA 2MCNB 2VRRB 2KMAA 1ZW7A 4GOCA 1VD2A 2KJ6A 4JX1C 4KSLC 1BMLC 3MHZA 3ZJTA 2Q5WD 2KWUB 4F1SA 5HFYA 4KGRA 3PRZA 2MJDA 1EWYC 4YSZB 3MJ5A 4LCDE 4FULA 1NI2A 3ZW3A 3W2DA 1Q5WB 2WDRB 3DDCB 1GOZA 2KC2A 2LRWA 1C78A 3L16A 2LEKA 3AB5A 3JW0X 2JY6A 3T8MA 3VUWA 2V4IB 2O6VD 3BVZA 3OAWA 1QT9A 4LDTB 5LXHA 4DQOC
chains in the Genus database with same CATH topology
4HJKA 2DZKA 1WGDA 2CHWA 2I1KA 2LD9A 2KKCA 3CSFA 1FXTB 2GBNA 3WALA 4TUUA 5E6PA 2L0TA 3KUZA 2RR9A 1J8CA 5L83A 1NBFC 4I6PA 2Z59B 4MH0E 5E6OA 3ZIMA 3APDA 4JLCA 1WE7A 2KTFA 2L0FA 3PZDA 3KVFB 1YX6B 4PS8A 2MBQA 2FIDA 3PVLA 4HDQA 2BYVE 3AXCA 1UD7A 2CHZA 1MG8A 2WYQA 4MJSB 4JGHB 1QZEA 4K7SA 1XT9B 4GB9A 4EEWA 4ZDVA 3DVGY 4MM3A 5L95C 3NY5A 3KUDB 3U30A 3A33B 3VH3B 3TJPA 2L05A 1J19A 2NCNA 1ZKHA 2GOWA 2D3GA 4JIOU 2EKEC 2BGFA 4B95A 3DOWA 3PRPB 2MX2A 1UH6A 3X0WA 3BINA 2IO2B 1WX7A 2LVOA 1WGYA 4DHZB 1IYFA 4ASWC 2Y5BB 2KXJA 3L13A 2KMCA 2LUEA 3QARA 3BY4B 2PPHA 4G3XB 2KTRB 4W9LA 3A4RA 3VVWB 5KHOA 3LJ3A 4GDLA 2BKRB 2O2VB 4IUMB 4AWJA 4MSMB 2J0JA 4WJQA 5AEKB 2EMSA 2IO1B 2M17A 2HE7A 4FHJA 4MGYE 2BYFA 2NVUI 3CF6E 3M95A 2O2VA 3KYCD 1GUAB 3ZVVA 2IO3B 4DWFA 2RPQA 2V3SA 2A5UA 3AU5A 2I1JA 3QQ8B 4FA6A 3DQVA 2D07B 2JRIB 3V60A 4HLEA 3K9PB 4K81A 4RM8A 2FCQA 4URKA 4ZRIA 4J6IA 4HCPB 3WIMA 4GMVA 3TBLD 4MGZE 5JH5C 2MRPA 2UYZB 1C1YB 4NNJB 3VH4B 2DZMA 3H7SA 4FBJB 4BOSC 4IWQA 1V2YA 1V6EA 1E8YA 2BPSA 2KDBA 2KD0A 3KUCB 2KNBA 5AZGA 1IP9A 2BWES 3ZNZB 4TQ0A 3ALBA 2CHXA 3QX1A 3QJZA 4IWPA 1XD3B 2JXXA 2N9PC 3DBLI 4G50A 2KO3A 1WR1A 2NR2A 2YVCA 3B1LX 2KC1A 2L76A 2OJRA 2PE6B 3PHXB 3PS6A 2D2QA 3H7PB 1LM8B 4ZRJA 1UBQA 2D10A 3VXWA 1E5WA 2DZIA 4LJOB 2C7MB 4NAWB 2R2QA 2GBRA 4ZYNA 2KFKA 1TBEA 3H7PA 3PLVA 4MGIE 1HE8A 1Z2MA 4JL9A 2WDTB 5CTRC 4MELA 1PQSA 4M8NA 1WX9A 3QA8A 1OEYA 5CHFA 4NJ6A 1GC6A 4G0NB 1V80A 3VUXA 5LXIB 4IW0A 5J2RA 2KDIA 3MTNB 3S2AA 5KHQA 4GSWA 2C7NB 4DDID 1V81A 2ZEQA 3APFA 2M4NA 2EMTA 1WJ4A 4W9FA 3A1QA 4KSKC 5IA7A 1RLFA 3ZO5B 1WF9A 4MJSA 1ISNA 4NPNA 3ZDTA 3H9DA 3QCAA 1E90A 1V49A 3NS8A 2J0MA 2KDFB 4FHKA 4W9GA 4GGQA 1V9JA 4EUTA 3A1QB 2C9WB 4E74A 2DX5B 1WZ0A 2AWTA 2K25A 2KJRA 1P9DU 1UELA 4NQLB 4W9DA 4DXAB 3W1YA 1UZXB 2DZJA 3EC8A 3EFUA 4F7ZA 1WGGA 4IM3A 2ZNVB 3JYUA 3IBEA 3VHTC 5GMVA 4IM0A 3JSVB 1P3QU 2MLBA 3B08A 1LFDA 1P98A 1WYWB 2O6VA 1E8ZA 2G4DB 4NJ7A 4DBGA 1I42A 1EO6A 2NS5A 2LXCA 2KWVB 3CSTA 3WAPA 4A3OA 2M1MA 1ZGUB 1WMHB 3JSVA 3EECA 5CHWA 3SDLC 4EZLA 1WI0A 2MQJA 3V62A 3ZNGC 2BKFA 1UBIA 1WFYA 3KYDD 2N1VA 5TR5A 3PGEA 2JRHA 2MBEA 1JRUA 3DBRI 4HXDA 2MWSB 4W9KA 4HPMB 3HIZA 3OJ3A 3U7DA 3ZRFA 3HK0A 2K6QA 2MW5A 4RM9A 4YL8A 1P0RA 3PPAA 4NY0A 4FADA 2ZCCA 2GBMA 4PS7A 1L7YA 1V5OA 2KTRA 4KIKB 3VTVA 1S3SG 2HJ8A 2L3ZA 2IYDB 5D94A 5FR6A 3RCZA 2LVQA 4WWOA 3AU4A 2KWCA 2YLMA 4MDKE 2HD5B 2JZZA 1OQYA 2D11A 2MP2A 5C23A 5J17A 2XK5B 1R4NI 2L7RA 4XX5A 3OJ4B 3ZRCA 4PS3A 1SGHA 5BO4B 2L00B 3B0AA 3V6CB 3ONSA 1Q0WB 4RMAA 4XZ4A 5JZEB 1TZ1A 1WE6A 2K39A 3PHWB 4DHJB 4II3B 5LLIA 3DBHI 2RSUA 5E6NA 2PEAA 2IBIB 3DVNV 4WAAA 1S1QB 1WJ6A 1YD8U 3DVNU 3UQAA 3KH0A 4K7UA 2QHOA 1Z5SB 1XQQA 2N9XA 1A5RA 2Z0DB 2GBJA 2J0KA 4W9HA 2PE9A 4I6NB 3VFKA 3QC8B 3WA0A 2OOBB 2RD0A 4K1RB 4CHKA 2BWFA 3ZNHB 2N1WA 1Q1OA 1WGRA 5AZFA 4HCNB 2NBWB 1J0GA 3ZUNA 2C5LC 3NOBA 1R4MI 4W9IA 3RZFA 2IO0B 2O6VB 4B6WA 1E7VA 2MBHA 4GDKB 1EF5A 3VQIA 3IVFA 1OGWA 3MJWA 1YX5B 2C7HA 2PJHA 1WIAA 3PREA 2LGYA 1GNUA 1Y8RC 2ZPYA 2FCMA 4ANXA 3K9OB 2ASQA 4IWOA 3QIJA 3L54A 3ENEA 4W9CA 4FJYA 1L2NA 1WM2A 5JHBA 3N32A 1WM3A 4IG7B 1VCBA 4MEMA 4EFOA 3ECIA 1YIWA 4XC2A 2CU1A 2LI5A 4TQ1A 4KDIC 2K1FA 3N3KB 4ICUA 3GOEA 2CKHB 3QK0A 5C1ZA 1X1MA 2M8SA 2XK5A 3EHVA 4BBNF 1G6JA 3N30A 1WY8A 1AARA 2G3QB 2KOXA 4HK2A 2G45B 5DCNA 3VUYA 1T0YA 1KJTA 3P2BA 3ZNID 3IG3A 4NQKE 5DPRA 4I6LB 5AZHA 3VTWA 3QAQA 2KANA 1WMHA 4BVUC 3GZNI 3I3TB 1E8XA 4BBNC 2AL3A 1RFAA 4FLHA 4P7IA 3VAWA 3V6EB 3JVZX 1OTRB 4WWPA 4IM2A 2AL6A 3VTUA 2HTHA 2CR5A 3LDZE 4OVUA 5J18A 1H4RA 2W9NA 2GBKA 4KV2A 3W1SC 4AOFA 4HWIB 4BKGA 4BOZB 1V5TA 3L08A 3WAMA 3ZTCA 3M62B 1WH3A 3AULA 3T9LA 3UGBB 3TL5A 3R7RA 1U4AA 4HVBA 2LJ5A 2MBBB 2N7EA 3M3JA 4GU2A 4LJPB 3IFWB 4FN2A 1KOTA 1WR6E 2FCNA 3M63B 3OLMD 2K6DB 3L10B 4AP4C 3PTFC 2RGFA 1C3TA 4PYUA 3Q3FA 4FJVB 4KIKA 2LZ6A 2V4LA 4BKTA 1WGHA 2XBBC 3KW5B 5CX3A 1GJZA 5CHVC 4X57B 4CO7A 4GXBA 3QWZB 1M94A 2NBVB 4JQWC 4W9JA 3RZWC 3UQBA 2R2OA 3RYTA 2JUOA 3H1UA 2MP2B 4ANWA 1E7UA 4M8MA 2NBUA 4EZJA 1YJ1A 3PV1A 2AEHA 4HPLB 1WXSA 1WJUA 4WJNA 3TMPB 4DDGD 4NAWA 1D3ZA 2KHWB 5JHAA 3R3MA 1WZ3A 2JF5A 4B9KA 4ZRKA 4KDLB 4PYZA 2CS4A 4W9EA 3W1SA 3PLUA 4AJWA 4DK5A 2KN5A 2V1YA 4WWNA 3HM3A 2ZNVC 3A9JA 3Q3JA 2L8JA 4GDLB 4KVGB 1UGMA 2M0XA 2B3AA 2LRUA 2C60A 5G2NA 3HHMA 2FIFA 3RULA 2NPTB 3R66C 4K7WA 4N9F4 3SU8X 3H6NA 3VDZA 2KLCA 2KQSA 4ANVA 1RAXA 2IZVB 5EDSA 1TTNA 2DENB 2N7DA 2KX3A 4GN1A 2KJHB 1NDDA 2Z0EB 1CMXB 2KLGA 2XEWA 1V86A 4WJPA 5D2MB 2GMIC 1WXAA 3A9KA 3R7QA 3AI5A 2KK8A 3DVGX 2N4FA 3NHEB 2K8HA 4IC7B 3D32A 1I35A 5D6JB 2DAJA 2K8BA 4WJOA 3NZSA 4WQOB 1WJNA 2A4ZA 2BYEA 2ZVOA 2JZ3B 1TGZB 3A9KB 3PSEB 1GG3A 4EKUA 2WWZA 4G11A 3RUIB 1SIFA 2LXAA 2KQ7A 4II2B 2UWQA 1P1AA 2IY1B 3MHSD 2AYOB 3PT2B 4BKSD 2NPTA 4A3PA 2K8CA 3ML9A 5D7GA 4F8CB 2KX0A 3L17A 4TV3A 2KFJA 1WXMA 3RT3B 1KM7A 2DYBA 3NZUA 4MGKE 3ML8A 1YQBA 2DHZA 3SHQA 4BFRA 2N9EB 3ZDMC 1OEYJ 2BF8B 4AJYB 4CYEA 2FUHB 1GC7A 3U8ZA 3V61A 3DCGA 2WX1A 2KFKB 2REXA 4M0WB 3RD2A 3ZTDA 2JWZA 2ZZPB 4A20A 3C0RB 3PRMB 2JPHA 5HKHA 2DAFA 4E3CA 4ANUA 4BKSA 4KZ0A 4AUQC 1EUVB 3CMMB 2ZPNA 3SD5A 3ZKJC 2LGDA 3WANA 1WRDB 3QHTA 2KVRA 5G55A 3UIPB 2MA9B 2JT4B 2KDEB 2IY0B 2MCNB 2VRRB 2KMAA 1ZW7A 4GOCA 2MBOA 4MSQB 1BT0A 2DYOA 1VD2A 2MSED 1EF1A 2KJ6A 2FAZA 5DPTA 4KSLC 4GIVA 1E8WA 1WXVA 4DHJD 2FNJB 3A4SC 3DBSA 2KWUB 1K8RB 3ZLZA 1LQBA 3DPDA 4ICVA 4F1SA 2J7QB 4EOYA 3PRZA 4HDOA 2ZJDA 1H8CA 2LASA 4LCDE 1LXDA 4FULA 4KZCA 1NI2A 2FCSA 2WX0A 5IAAC 3ZW3A 3X23A 2G4SA 2DYMA 4OVVA 3HM6X 3IHPC 3UINB 5DPWA 2ZVNA 1Q5WB 4FJZA 2LGXA 3WAOA 4EZKA 1WX8A 4TKNA 1F9JA 1SE9A 1RRBA 3DDCB 3UF8A 3UIOB 1IPGA 4LDTD 4DHZE 2KC2A 3O65B 2LRWA 3L16A 3TCAA 1KLVA 3JW0X 4E71A 2JY6A 3T8MA 2LVPA 3VUWA 2O6VD 2KZRA 4GDKA 2LWPA 3L0WB 5DPSA 2JVCA 3OAWA 3TIXA 3A9JB 4LDTB 5LXHA 2ZCBA 3APCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJK A;  2DZK A;  1WGD A;  2CHW A;  2I1K A;  2LD9 A;  2KKC A;  3CSF A;  1FXT B;  2GBN A;  3WAL A;  4TUU A;  5E6P A;  2L0T A;  3KUZ A;  2RR9 A;  1J8C A;  5L83 A;  1NBF C;  4I6P A;  2Z59 B;  4MH0 E;  5E6O A;  3ZIM A;  3APD A;  4JLC A;  1WE7 A;  2KTF A;  2L0F A;  3PZD A;  3KVF B;  1YX6 B;  4PS8 A;  2MBQ A;  2FID A;  3PVL A;  4HDQ A;  2BYV E;  3AXC A;  1UD7 A;  2CHZ A;  1MG8 A;  2WYQ A;  4MJS B;  4JGH B;  1QZE A;  4K7S A;  1XT9 B;  4GB9 A;  4EEW A;  4ZDV A;  3DVG Y;  4MM3 A;  5L95 C;  3NY5 A;  3KUD B;  3U30 A;  3A33 B;  3VH3 B;  3TJP A;  2L05 A;  1J19 A;  2NCN A;  1ZKH A;  2GOW A;  2D3G A;  4JIO U;  2EKE C;  2BGF A;  4B95 A;  3DOW A;  3PRP B;  2MX2 A;  1UH6 A;  3X0W A;  3BIN A;  2IO2 B;  1WX7 A;  2LVO A;  1WGY A;  4DHZ B;  1IYF A;  4ASW C;  2Y5B B;  2KXJ A;  3L13 A;  2KMC A;  2LUE A;  3QAR A;  3BY4 B;  2PPH A;  4G3X B;  2KTR B;  4W9L A;  3A4R A;  3VVW B;  5KHO A;  3LJ3 A;  4GDL A;  2BKR B;  2O2V B;  4IUM B;  4AWJ A;  4MSM B;  2J0J A;  4WJQ A;  5AEK B;  2EMS A;  2IO1 B;  2M17 A;  2HE7 A;  4FHJ A;  4MGY E;  2BYF A;  2NVU I;  3CF6 E;  3M95 A;  2O2V A;  3KYC D;  1GUA B;  3ZVV A;  2IO3 B;  4DWF A;  2RPQ A;  2V3S A;  2A5U A;  3AU5 A;  2I1J A;  3QQ8 B;  4FA6 A;  3DQV A;  2D07 B;  2JRI B;  3V60 A;  4HLE A;  3K9P B;  4K81 A;  4RM8 A;  2FCQ A;  4URK A;  4ZRI A;  4J6I A;  4HCP B;  3WIM A;  4GMV A;  3TBL D;  4MGZ E;  5JH5 C;  2MRP A;  2UYZ B;  1C1Y B;  4NNJ B;  3VH4 B;  2DZM A;  3H7S A;  4FBJ B;  4BOS C;  4IWQ A;  1V2Y A;  1V6E A;  1E8Y A;  2BPS A;  2KDB A;  2KD0 A;  3KUC B;  2KNB A;  5AZG A;  1IP9 A;  2BWE S;  3ZNZ B;  4TQ0 A;  3ALB A;  2CHX A;  3QX1 A;  3QJZ A;  4IWP A;  1XD3 B;  2JXX A;  2N9P C;  3DBL I;  4G50 A;  2KO3 A;  1WR1 A;  2NR2 A;  2YVC A;  3B1L X;  2KC1 A;  2L76 A;  2OJR A;  2PE6 B;  3PHX B;  3PS6 A;  2D2Q A;  3H7P B;  1LM8 B;  4ZRJ A;  1UBQ A;  2D10 A;  3VXW A;  1E5W A;  2DZI A;  4LJO B;  2C7M B;  4NAW B;  2R2Q A;  2GBR A;  4ZYN A;  2KFK A;  1TBE A;  3H7P A;  3PLV A;  4MGI E;  1HE8 A;  1Z2M A;  4JL9 A;  2WDT B;  5CTR C;  4MEL A;  1PQS A;  4M8N A;  1WX9 A;  3QA8 A;  1OEY A;  5CHF A;  4NJ6 A;  1GC6 A;  4G0N B;  1V80 A;  3VUX A;  5LXI B;  4IW0 A;  5J2R A;  2KDI A;  3MTN B;  3S2A A;  5KHQ A;  4GSW A;  2C7N B;  4DDI D;  1V81 A;  2ZEQ A;  3APF A;  2M4N A;  2EMT A;  1WJ4 A;  4W9F A;  3A1Q A;  4KSK C;  5IA7 A;  1RLF A;  3ZO5 B;  1WF9 A;  4MJS A;  1ISN A;  4NPN A;  3ZDT A;  3H9D A;  3QCA A;  1E90 A;  1V49 A;  3NS8 A;  2J0M A;  2KDF B;  4FHK A;  4W9G A;  4GGQ A;  1V9J A;  4EUT A;  3A1Q B;  2C9W B;  4E74 A;  2DX5 B;  1WZ0 A;  2AWT A;  2K25 A;  2KJR A;  1P9D U;  1UEL A;  4NQL B;  4W9D A;  4DXA B;  3W1Y A;  1UZX B;  2DZJ A;  3EC8 A;  3EFU A;  4F7Z A;  1WGG A;  4IM3 A;  2ZNV B;  3JYU A;  3IBE A;  3VHT C;  5GMV A;  4IM0 A;  3JSV B;  1P3Q U;  2MLB A;  3B08 A;  1LFD A;  1P98 A;  1WYW B;  2O6V A;  1E8Z A;  2G4D B;  4NJ7 A;  4DBG A;  1I42 A;  1EO6 A;  2NS5 A;  2LXC A;  2KWV B;  3CST A;  3WAP A;  4A3O A;  2M1M A;  1ZGU B;  1WMH B;  3JSV A;  3EEC A;  5CHW A;  3SDL C;  4EZL A;  1WI0 A;  2MQJ A;  3V62 A;  3ZNG C;  2BKF A;  1UBI A;  1WFY A;  3KYD D;  2N1V A;  5TR5 A;  3PGE A;  2JRH A;  2MBE A;  1JRU A;  3DBR I;  4HXD A;  2MWS B;  4W9K A;  4HPM B;  3HIZ A;  3OJ3 A;  3U7D A;  3ZRF A;  3HK0 A;  2K6Q A;  2MW5 A;  4RM9 A;  4YL8 A;  1P0R A;  3PPA A;  4NY0 A;  4FAD A;  2ZCC A;  2GBM A;  4PS7 A;  1L7Y A;  1V5O A;  2KTR A;  4KIK B;  3VTV A;  1S3S G;  2HJ8 A;  2L3Z A;  2IYD B;  5D94 A;  5FR6 A;  3RCZ A;  2LVQ A;  4WWO A;  3AU4 A;  2KWC A;  2YLM A;  4MDK E;  2HD5 B;  2JZZ A;  1OQY A;  2D11 A;  2MP2 A;  5C23 A;  5J17 A;  2XK5 B;  1R4N I;  2L7R A;  4XX5 A;  3OJ4 B;  3ZRC A;  4PS3 A;  1SGH A;  5BO4 B;  2L00 B;  3B0A A;  3V6C B;  3ONS A;  1Q0W B;  4RMA A;  4XZ4 A;  5JZE B;  1TZ1 A;  1WE6 A;  2K39 A;  3PHW B;  4DHJ B;  4II3 B;  5LLI A;  3DBH I;  2RSU A;  5E6N A;  2PEA A;  2IBI B;  3DVN V;  4WAA A;  1S1Q B;  1WJ6 A;  1YD8 U;  3DVN U;  3UQA A;  3KH0 A;  4K7U A;  2QHO A;  1Z5S B;  1XQQ A;  2N9X A;  1A5R A;  2Z0D B;  2GBJ A;  2J0K A;  4W9H A;  2PE9 A;  4I6N B;  3VFK A;  3QC8 B;  3WA0 A;  2OOB B;  2RD0 A;  4K1R B;  4CHK A;  2BWF A;  3ZNH B;  2N1W A;  1Q1O A;  1WGR A;  5AZF A;  4HCN B;  2NBW B;  1J0G A;  3ZUN A;  2C5L C;  3NOB A;  1R4M I;  4W9I A;  3RZF A;  2IO0 B;  2O6V B;  4B6W A;  1E7V A;  2MBH A;  4GDK B;  1EF5 A;  3VQI A;  3IVF A;  1OGW A;  3MJW A;  1YX5 B;  2C7H A;  2PJH A;  1WIA A;  3PRE A;  2LGY A;  1GNU A;  1Y8R C;  2ZPY A;  2FCM A;  4ANX A;  3K9O B;  2ASQ A;  4IWO A;  3QIJ A;  3L54 A;  3ENE A;  4W9C A;  4FJY A;  1L2N A;  1WM2 A;  5JHB A;  3N32 A;  1WM3 A;  4IG7 B;  1VCB A;  4MEM A;  4EFO A;  3ECI A;  1YIW A;  4XC2 A;  2CU1 A;  2LI5 A;  4TQ1 A;  4KDI C;  2K1F A;  3N3K B;  4ICU A;  3GOE A;  2CKH B;  3QK0 A;  5C1Z A;  1X1M A;  2M8S A;  2XK5 A;  3EHV A;  4BBN F;  1G6J A;  3N30 A;  1WY8 A;  1AAR A;  2G3Q B;  2KOX A;  4HK2 A;  2G45 B;  5DCN A;  3VUY A;  1T0Y A;  1KJT A;  3P2B A;  3ZNI D;  3IG3 A;  4NQK E;  5DPR A;  4I6L B;  5AZH A;  3VTW A;  3QAQ A;  2KAN A;  1WMH A;  4BVU C;  3GZN I;  3I3T B;  1E8X A;  4BBN C;  2AL3 A;  1RFA A;  4FLH A;  4P7I A;  3VAW A;  3V6E B;  3JVZ X;  1OTR B;  4WWP A;  4IM2 A;  2AL6 A;  3VTU A;  2HTH A;  2CR5 A;  3LDZ E;  4OVU A;  5J18 A;  1H4R A;  2W9N A;  2GBK A;  4KV2 A;  3W1S C;  4AOF A;  4HWI B;  4BKG A;  4BOZ B;  1V5T A;  3L08 A;  3WAM A;  3ZTC A;  3M62 B;  1WH3 A;  3AUL A;  3T9L A;  3UGB B;  3TL5 A;  3R7R A;  1U4A A;  4HVB A;  2LJ5 A;  2MBB B;  2N7E A;  3M3J A;  4GU2 A;  4LJP B;  3IFW B;  4FN2 A;  1KOT A;  1WR6 E;  2FCN A;  3M63 B;  3OLM D;  2K6D B;  3L10 B;  4AP4 C;  3PTF C;  2RGF A;  1C3T A;  4PYU A;  3Q3F A;  4FJV B;  4KIK A;  2LZ6 A;  2V4L A;  4BKT A;  1WGH A;  2XBB C;  3KW5 B;  5CX3 A;  1GJZ A;  5CHV C;  4X57 B;  4CO7 A;  4GXB A;  3QWZ B;  1M94 A;  2NBV B;  4JQW C;  4W9J A;  3RZW C;  3UQB A;  2R2O A;  3RYT A;  2JUO A;  3H1U A;  2MP2 B;  4ANW A;  1E7U A;  4M8M A;  2NBU A;  4EZJ A;  1YJ1 A;  3PV1 A;  2AEH A;  4HPL B;  1WXS A;  1WJU A;  4WJN A;  3TMP B;  4DDG D;  4NAW A;  1D3Z A;  2KHW B;  5JHA A;  3R3M A;  1WZ3 A;  2JF5 A;  4B9K A;  4ZRK A;  4KDL B;  4PYZ A;  2CS4 A;  4W9E A;  3W1S A;  3PLU A;  4AJW A;  4DK5 A;  2KN5 A;  2V1Y A;  4WWN A;  3HM3 A;  2ZNV C;  3A9J A;  3Q3J A;  2L8J A;  4GDL B;  4KVG B;  1UGM A;  2M0X A;  2B3A A;  2LRU A;  2C60 A;  5G2N A;  3HHM A;  2FIF A;  3RUL A;  2NPT B;  3R66 C;  4K7W A;  4N9F 4;  3SU8 X;  3H6N A;  3VDZ A;  2KLC A;  2KQS A;  4ANV A;  1RAX A;  2IZV B;  5EDS A;  1TTN A;  2DEN B;  2N7D A;  2KX3 A;  4GN1 A;  2KJH B;  1NDD A;  2Z0E B;  1CMX B;  2KLG A;  2XEW A;  1V86 A;  4WJP A;  5D2M B;  2GMI C;  1WXA A;  3A9K A;  3R7Q A;  3AI5 A;  2KK8 A;  3DVG X;  2N4F A;  3NHE B;  2K8H A;  4IC7 B;  3D32 A;  1I35 A;  5D6J B;  2DAJ A;  2K8B A;  4WJO A;  3NZS A;  4WQO B;  1WJN A;  2A4Z A;  2BYE A;  2ZVO A;  2JZ3 B;  1TGZ B;  3A9K B;  3PSE B;  1GG3 A;  4EKU A;  2WWZ A;  4G11 A;  3RUI B;  1SIF A;  2LXA A;  2KQ7 A;  4II2 B;  2UWQ A;  1P1A A;  2IY1 B;  3MHS D;  2AYO B;  3PT2 B;  4BKS D;  2NPT A;  4A3P A;  2K8C A;  3ML9 A;  5D7G A;  4F8C B;  2KX0 A;  3L17 A;  4TV3 A;  2KFJ A;  1WXM A;  3RT3 B;  1KM7 A;  2DYB A;  3NZU A;  4MGK E;  3ML8 A;  1YQB A;  2DHZ A;  3SHQ A;  4BFR A;  2N9E B;  3ZDM C;  1OEY J;  2BF8 B;  4AJY B;  4CYE A;  2FUH B;  1GC7 A;  3U8Z A;  3V61 A;  3DCG A;  2WX1 A;  2KFK B;  2REX A;  4M0W B;  3RD2 A;  3ZTD A;  2JWZ A;  2ZZP B;  4A20 A;  3C0R B;  3PRM B;  2JPH A;  5HKH A;  2DAF A;  4E3C A;  4ANU A;  4BKS A;  4KZ0 A;  4AUQ C;  1EUV B;  3CMM B;  2ZPN A;  3SD5 A;  3ZKJ C;  2LGD A;  3WAN A;  1WRD B;  3QHT A;  2KVR A;  5G55 A;  3UIP B;  2MA9 B;  2JT4 B;  2KDE B;  2IY0 B;  2MCN B;  2VRR B;  2KMA A;  1ZW7 A;  4GOC A;  2MBO A;  4MSQ B;  1BT0 A;  2DYO A;  1VD2 A;  2MSE D;  1EF1 A;  2KJ6 A;  2FAZ A;  5DPT A;  4KSL C;  4GIV A;  1E8W A;  1WXV A;  4DHJ D;  2FNJ B;  3A4S C;  3DBS A;  2KWU B;  1K8R B;  3ZLZ A;  1LQB A;  3DPD A;  4ICV A;  4F1S A;  2J7Q B;  4EOY A;  3PRZ A;  4HDO A;  2ZJD A;  1H8C A;  2LAS A;  4LCD E;  1LXD A;  4FUL A;  4KZC A;  1NI2 A;  2FCS A;  2WX0 A;  5IAA C;  3ZW3 A;  3X23 A;  2G4S A;  2DYM A;  4OVV A;  3HM6 X;  3IHP C;  3UIN B;  5DPW A;  2ZVN A;  1Q5W B;  4FJZ A;  2LGX A;  3WAO A;  4EZK A;  1WX8 A;  4TKN A;  1F9J A;  1SE9 A;  1RRB A;  3DDC B;  3UF8 A;  3UIO B;  1IPG A;  4LDT D;  4DHZ E;  2KC2 A;  3O65 B;  2LRW A;  3L16 A;  3TCA A;  1KLV A;  3JW0 X;  4E71 A;  2JY6 A;  3T8M A;  2LVP A;  3VUW A;  2O6V D;  2KZR A;  4GDK A;  2LWP A;  3L0W B;  5DPS A;  2JVC A;  3OAW A;  3TIX A;  3A9J B;  4LDT B;  5LXH A;  2ZCB A;  3APC A; 
#chains in the Genus database with same CATH topology
 2KKC A;  2L0T A;  1J8C A;  4DXF A;  1TS5 A;  5E6O A;  3IXS A;  3GS2 A;  2KTF A;  2V0G A;  2AQ1 B;  1C77 A;  4MM3 B;  3PVL A;  3FAH A;  1UD7 A;  2CHZ A;  2W55 A;  2WYQ A;  4JGH B;  1XT9 B;  1UGJ A;  5C3J B;  2L1A A;  5L95 C;  3U30 A;  3A33 B;  3L4P A;  1J19 A;  2QCZ A;  1VZ8 A;  4Q2J A;  1ZKH A;  4JIO U;  5TSS A;  3PRP B;  1UH6 A;  3BIN A;  4DHZ B;  1WGY A;  2BS4 B;  1K52 A;  2KXJ A;  4G3X B;  2KTR B;  1I7H A;  2WNM A;  1GB4 A;  4MGY E;  2KQ4 X;  1YN4 A;  3M95 A;  3TEY A;  3ZVV A;  2IO3 B;  2A5U A;  2L83 A;  2Z8L A;  1VRA B;  2WDQ B;  3K9P B;  1SE3 A;  1QQR A;  4IKG A;  4J6I A;  3WIM A;  1FEH A;  1XEE A;  4WWM A;  5JH5 C;  2MRP A;  1C1Y B;  4RGO S;  4IWQ A;  1YN5 A;  1E8Y A;  2KNB A;  2JU6 X;  1IP9 A;  1N63 A;  3ALB A;  2CHX A;  2BS2 B;  1XD3 B;  2JXX A;  3FIL A;  2NR2 A;  1T5X D;  2YVC A;  2PE6 B;  2NTS A;  1WRI A;  3H7P B;  4ZRJ A;  2DZI A;  3PZ8 A;  1FCC C;  4NAW B;  3I5J C;  4ZYN A;  2KFK A;  1TBE A;  1CQV A;  4LK0 M;  2TSS A;  1XO3 A;  2WDT B;  3CWI A;  4M8N A;  1WX9 A;  3QA8 A;  5CHF A;  3DBH B;  1GC6 A;  2WXK A;  2KMM A;  5LXI B;  4K3C A;  3APF A;  3AE5 B;  2EMT A;  3A1Q A;  3AMZ A;  1TY0 A;  4KSK C;  1WF9 A;  1ISN A;  4NPN A;  3ZGZ A;  2AQ3 B;  3QCA A;  2KDF B;  1AWD A;  1P9D U;  2DNF A;  3W1Y A;  1Y56 A;  2DZJ A;  2VH2 A;  1T0R C;  1WGG A;  2JXT A;  3JYU A;  1HZ5 A;  3JSV B;  2MLB A;  5EE9 A;  3B08 A;  1LFD A;  1P98 A;  2G4D B;  1D6E C;  1T0Q C;  1QOF A;  3CST A;  3NRZ A;  4P16 A;  5CHW A;  3HRD D;  2BKF A;  1UBI A;  5TR5 A;  3PGE A;  2MBE A;  4HXD A;  3R2I A;  3U7D A;  1SB3 C;  3OJ3 A;  4K3B A;  4YL8 A;  2DLB A;  1P0R A;  3GZN B;  2GBM A;  4PS7 A;  1L7Y A;  3J9C A;  1I4P A;  3ZJV A;  5FR6 A;  5D94 A;  4WWO A;  3MC8 A;  3AU4 A;  2KWC A;  2YLM A;  4MDK E;  2ON8 A;  2D11 A;  1IUE A;  1PGA A;  5J17 A;  1KLU D;  1STE A;  1R4N I;  4XX5 A;  3OJ4 B;  4ITK A;  1OFF A;  3NG0 A;  1YMH E;  2L00 B;  2WU2 B;  3B0A A;  5LNK 1;  1TZ1 A;  2BVC A;  1RWS A;  3FKY A;  1WE6 A;  4II3 B;  3DBH I;  1TKY A;  2IBI B;  4MH8 A;  1MJD A;  1F2R C;  4K7U A;  2QHO A;  4OHJ A;  4AQ7 A;  2GBJ A;  1SJE D;  2PE9 A;  3QC8 B;  2W3R A;  2PKO A;  3P1M A;  3WA0 A;  4CHK A;  1TT5 B;  1WGR A;  2NBW B;  4QAY A;  3BK2 A;  1RM6 C;  1XCT L;  1OGW A;  2X8X X;  4IOI E;  2C7H A;  2PW9 A;  2FUG 1;  2PJH A;  1V8C A;  1QIL A;  3PRE A;  3K9O B;  2IPK D;  1CK1 A;  3GE8 C;  4CQN A;  1F0Z A;  4IG7 B;  4MEM A;  2FE8 A;  3KWV A;  1XF5 L;  5T8I A;  2RDH A;  1VZ7 A;  2KWD A;  2M8S A;  1C4C A;  2KYW A;  2XK5 A;  4BBN F;  1WY8 A;  2G3Q B;  2KOX A;  5DCN A;  1T0Y A;  3IG3 A;  2OED A;  5DPR A;  2KAN A;  4BVU C;  2PMV A;  1E8X A;  2AL3 A;  1NEK B;  1IBX B;  3DHH C;  4WWP A;  4NAM A;  5EE3 A;  2BYT A;  1H4R A;  3W1S C;  4BOZ B;  4AOF A;  4HWI B;  3M62 B;  1T6B X;  3UGB B;  4HVB A;  1SSN A;  2K22 A;  2MBB B;  4RGT A;  3M3J A;  1M4V A;  4AS1 A;  1WR6 E;  2FCN A;  1IGC A;  3M63 B;  3OLM D;  4AP4 C;  3MC0 B;  2RGF A;  2LZ6 A;  2V4L A;  3KW5 B;  5CX3 A;  1VZ6 A;  3QWZ B;  1M94 A;  1AW7 A;  1PUT A;  2MP2 B;  4C7Y A;  4EZJ A;  2WS3 B;  1YJ1 A;  4HPL B;  1WJU A;  2PLP A;  3R3M A;  1V1P B;  4B9K A;  1RFK A;  2V3N A;  3OG5 A;  3W1S A;  2KN5 A;  5I4D A;  3VRA B;  1ET9 A;  3A9J A;  4P1B C;  3Q8F A;  4KVG B;  2M0X A;  1DYQ A;  2C60 A;  2K5P A;  3SU8 X;  3H6N A;  2KQS A;  4RNA A;  2N7D A;  1F1H A;  2KJH B;  1JWU D;  1NDD A;  2Z0E B;  2XEW A;  4L1B A;  2GMI C;  4RCO A;  3DVG X;  2KK8 A;  1TS2 A;  4WJO A;  4WQO B;  1WJN A;  2A4Z A;  2JZ3 B;  3PSE B;  1PDX A;  5H92 C;  2WWZ A;  2D3A A;  3RUI B;  1DOY A;  1SIF A;  1V97 A;  3N9Y C;  3MHS D;  3O13 A;  2NPT A;  2K8C A;  4FXC A;  3ML9 A;  4F8C B;  1QKZ A;  3L17 A;  3RT3 B;  2DYB A;  3NZU A;  2KAJ A;  3AE8 B;  1E10 A;  3RNF C;  1OEY J;  2BQQ A;  4AJY B;  3Q8E A;  3NVW A;  2WX1 A;  1B1Z A;  4KX6 B;  3ZTD A;  4WQM A;  1D5M C;  3PRM B;  4E3C A;  3SD5 A;  2LGD A;  1N62 A;  1PFD A;  4D2K A;  2MA9 B;  2KDE B;  2IY0 B;  2M56 B;  1NVI D;  2MBO A;  2DYO A;  1FPY A;  2MSE D;  1Q10 A;  5DPT A;  3KLS X;  2IJ0 A;  4O1N A;  1K8R B;  5HHD G;  4C7Z A;  1VLB A;  3ZLZ A;  3TEW A;  4ICV A;  4EOY A;  2R61 A;  4HDO A;  3I57 A;  1H8C A;  2LAS A;  3AEF B;  4KZC A;  2WX0 A;  4WH4 A;  5IAA C;  3SFD B;  4OVV A;  1BUI C;  2ZVN A;  4FJZ A;  1RRB A;  4LDT D;  3TCA A;  1FXI A;  4E71 A;  2LVP A;  4RF0 A;  5DPS A;  4RH6 A;  3VR8 B;  1SEB D;  4LNI A;  3A9J B;  4HJK A;  2CHW A;  1FXT B;  1DGJ A;  3AN1 A;  4MH0 E;  4JLC A;  4RFB A;  1FFV A;  1YX6 B;  2FID A;  4HDQ A;  3AXC A;  1D4B A;  1QZE A;  3PO0 A;  4ZDV A;  3R2T A;  4MM3 A;  2BB5 A;  1C4A A;  2H89 B;  3KWL A;  2IGH A;  2NCN A;  3RPF C;  2BGF A;  4ARI A;  2QC8 A;  1QLB B;  1XXG A;  2IO2 B;  1WX7 A;  1IYF A;  2Y5B B;  5BYR A;  2LUE A;  5EE0 A;  4W9L A;  3A4R A;  4ZRQ A;  3U52 E;  1ET6 A;  4WJQ A;  2IO1 B;  2M17 A;  2BYF A;  3CF6 E;  4ZHP A;  2RPQ A;  4L2Y A;  1MFW A;  4N6E B;  3GB1 A;  2V3S A;  3P4S B;  2I1J A;  1TS4 A;  1JCK B;  3DQV A;  3HVZ A;  4URK A;  3AE9 B;  4GMV A;  1EWC A;  2WU5 B;  4MGZ E;  3BII D;  2UYZ B;  1L4Z B;  2DZM A;  2KN4 A;  5E6J A;  1QF6 A;  2LGS A;  3P42 A;  1V2Y A;  1V6E A;  3Q3M C;  2KDB A;  5AZG A;  2BWE S;  4TQ0 A;  3QJZ A;  3ABV B;  4G50 A;  3V3X A;  1WR1 A;  2KC1 A;  2OJR A;  2WP9 B;  3PHX B;  2D2Q A;  3P4Q B;  1UBQ A;  5IO9 A;  1E5W A;  2JWU A;  4REZ A;  2XNA C;  2GBR A;  4HEA 1;  2X38 A;  3H7P A;  4MGI E;  3W5V B;  1GAQ B;  1YOV B;  2WDV B;  3AEE B;  3NUH B;  1SIJ A;  1MVK A;  1V80 A;  3VUX A;  4IW0 A;  5J2R A;  3S2A A;  1WJ4 A;  3T3O A;  1ZDX A;  3V05 A;  2EKI A;  3ZDT A;  1V49 A;  4EUT A;  2E3T A;  3A1Q B;  1L4D B;  2DX5 B;  2K25 A;  2KJR A;  4W9D A;  1UEL A;  1N5X A;  3IAS 1;  4NQL B;  1UZX B;  2RPV A;  2XN9 C;  1ZE3 D;  1YQ3 B;  1FCL A;  1C4P A;  1P3Q U;  2O6V A;  4DBG A;  1I42 A;  4NJ7 A;  2L52 A;  2W54 A;  2EEL A;  2LXC A;  3WAP A;  4A3O A;  2M1M A;  1ZGU B;  1WMH B;  3JSV A;  4EZL A;  3SDL C;  1XLP A;  2WXP A;  3V62 A;  3ZXV A;  1FM0 D;  4YWG G;  2JRH A;  3B2G A;  4HPM B;  3BVM A;  3HIZ A;  4RM9 A;  3PPA A;  4NY0 A;  4BZA A;  2ZCC A;  1V5O A;  3Q6B A;  1GB1 A;  2KTR A;  3W5U B;  2HJ8 A;  2IYD B;  1AN8 A;  4M00 A;  4XYC A;  2HD5 B;  2JZZ A;  2L7R A;  2PVG C;  3AE1 B;  2HTM E;  5BO4 B;  1FXA A;  3ONS A;  5FK9 C;  4XZ4 A;  3GE3 C;  3ZJU A;  2PEA A;  4WAA A;  3DVN V;  4C4V B;  1S1Q B;  1YD8 U;  2W3S A;  3KH0 A;  1K50 A;  3NVV A;  1XQQ A;  2G1E A;  3LB8 C;  4I6N B;  2WLB A;  3ZXR A;  4A90 A;  2WXL A;  1FMA D;  5AZF A;  4P6V F;  1ZUD 2;  3P4P B;  4W9I A;  1QOB A;  3AEG B;  1E7V A;  2MBH A;  2B76 B;  1EF5 A;  3IVF A;  1KLG D;  1TYG B;  1Y8R C;  4ANX A;  1MHX A;  1QOA A;  3AEB B;  2QSD A;  1TKG A;  1WM2 A;  5JHB A;  1VCB A;  4JPS A;  4EFO A;  1YIW A;  4XC2 A;  3RNA C;  3UI3 A;  2LI5 A;  4HJG E;  3GOE A;  5C1Z A;  1X1M A;  4JE3 B;  4EE2 A;  3NVY A;  3ZNI D;  5BMH A;  4I6L B;  2KVZ A;  1P7E A;  1WMH A;  1RFA A;  1ACC A;  4P7I A;  2VZK D;  3V6E B;  2M19 A;  1L6V A;  2CR5 A;  2HDE A;  2W9N A;  2GBK A;  2ZW1 A;  1UWX A;  2ONQ A;  1WH3 A;  2PTL A;  3R7R A;  1U4A A;  1K51 A;  4MAC A;  2LJ5 A;  1TY2 A;  3IFW B;  2WXM A;  4FN2 A;  1PGB A;  1C3T A;  1GJZ A;  3AED B;  4X57 B;  4GXB A;  4OZC A;  3UQB A;  4W9J A;  2JUO A;  1ZP0 B;  3H1U A;  1E7U A;  4UDU C;  1WXS A;  5JHA A;  1WSP A;  2DWQ A;  4KDL B;  4ZRK A;  2MH7 A;  2ZNV C;  1V1P A;  4GDL B;  1UGM A;  2B3A A;  4ACF A;  5G2N A;  1N61 A;  3RUL A;  3VDZ A;  4N9F 4;  3NVZ A;  1EM7 A;  2QJL A;  2KX3 A;  1CMX B;  3BVG A;  2MJE A;  2UU7 A;  3AE3 B;  3A9K A;  2N4F A;  3D32 A;  1I35 A;  2DAJ A;  2BYE A;  3E56 A;  1TGZ B;  1GG3 A;  1JWM D;  2WHI A;  1UNS A;  4G11 A;  2JYE A;  1P1A A;  2IY1 B;  3PT2 B;  2AYO B;  1R4M B;  4A3P A;  2SAK A;  2KFJ A;  4GLS C;  3Q3N C;  2INP E;  1YQB A;  2DHZ A;  3SHQ A;  2N9E B;  3RI7 C;  3ZDM C;  2IGG A;  1KTK A;  4CYE A;  3LXF A;  5IP4 D;  1P7F A;  4M0W B;  2REX A;  2ZZP B;  4A20 A;  4KZ0 A;  1FFU A;  2ZPN A;  1WRD B;  2K9X A;  3QHT A;  2ACZ B;  3UIP B;  1T0S C;  2BW2 A;  4HPP A;  3TSS A;  1R4N B;  4MSQ B;  1JRP A;  1EF1 A;  2FAZ A;  1C9F A;  3RNE C;  2KT7 A;  4DHJ D;  3TEZ A;  1E6E B;  2QMT A;  3TEX A;  3IT6 B;  2ZJD A;  4LNF A;  1MHH E;  1LXD A;  4C00 A;  3X23 A;  2G4S A;  2DYM A;  3HM6 X;  3UIN B;  2W82 A;  2LFI A;  3LYY A;  4TKN A;  1F9J A;  1VR9 A;  3UIO B;  3Q2A C;  3O65 B;  1XLO A;  2KZR A;  4GDK A;  4USA A;  2WXO A;  2JVC A;  1SF0 A;  1SE2 A;  2DZK A;  2LD9 A;  2GBN A;  5E6P A;  4HRO A;  3KUZ A;  2RR9 A;  1BXT A;  2N7J A;  2Z59 B;  3AH7 A;  3BYY B;  3ZIM A;  1WE7 A;  2L0F A;  3PZD A;  3KVF B;  4PS8 A;  4MJS B;  4K7S A;  4GB9 A;  4YTP B;  3AE7 B;  4S0R A;  3NY5 A;  3KUD B;  3VH3 B;  1HA5 A;  1IBX A;  1UWM A;  2D3G A;  2N9L A;  4ZOH C;  2EKE C;  4B95 A;  3DOW A;  4LNN A;  4XWW A;  2MX2 A;  2LVO A;  3RNG C;  1SE4 A;  3L13 A;  1QOG A;  3Q8B A;  2KMC A;  3QAR A;  3BY4 B;  2PPH A;  3DBR B;  3VVW B;  4GDL A;  2BKR B;  2O2V B;  4IUM B;  2QIE B;  3DHI C;  5AEK B;  2EMS A;  2HE7 A;  4FHJ A;  4LTU A;  1GUA B;  1C79 A;  2D07 B;  3V60 A;  2BT6 A;  4HLE A;  4JWU C;  4K81 A;  4RM8 A;  2FCQ A;  4HCP B;  2WQY B;  1FNU A;  4NNJ B;  3VH4 B;  4FBJ B;  3H7S A;  4BOS C;  5H8Y E;  2KD0 A;  4BAX A;  1EU3 A;  2BTE A;  3B2F A;  4LNO A;  2N9P C;  3DBL I;  3B1L X;  4MT5 A;  2L76 A;  3RFZ B;  2H88 B;  2D10 A;  3WCQ A;  4RGM A;  4M0W A;  3PLV A;  4XWT A;  3AEC B;  1ESF A;  3KQ4 A;  2CJN A;  1HE8 A;  1Z2M A;  2INN E;  1PQS A;  3DWM A;  2WXQ A;  4KGT A;  2KDI A;  3MTN B;  5KHQ A;  2C7N B;  4DDI D;  1N5W A;  2ZEQ A;  2J52 A;  4W9F A;  2SEB D;  5IA7 A;  3IT4 B;  1E0Z A;  1RLF A;  4MJS A;  1D5X C;  4M01 A;  1OQQ A;  4W9G A;  1V9J A;  3SR6 A;  4US8 A;  2C9W B;  1WZ0 A;  1KRH A;  4DXA B;  4N59 A;  2V3P A;  3EFU A;  1YN3 A;  2ZNV B;  5GMV A;  4IM0 A;  5IN7 A;  1E8Z A;  3RMK C;  1YNT E;  1EO6 A;  2NS5 A;  1JWS D;  4C80 A;  1TZO A;  4YXD B;  3EEC A;  1FNW A;  1OQR A;  1WI0 A;  3N1Y C;  1WFY A;  1MG4 A;  4W9K A;  1ZXI A;  2MWS B;  3ZRF A;  3HK0 A;  1KF6 B;  2K6Q A;  4FAD A;  2YEP F;  5D3I B;  4KIK B;  3VTV A;  3RCZ A;  2FBW B;  2WXF A;  1JWB D;  5C23 A;  1NEN B;  4OVZ A;  3V6C B;  1HTO A;  2MHJ A;  5JZE B;  3IAM 1;  2OHF A;  3PHW B;  4DHJ B;  4XGA B;  3DVN U;  2L32 A;  2D3C A;  4A9A A;  1TKE A;  2J42 A;  1A5R A;  2QIL A;  2J0K A;  2RD0 A;  2NMQ A;  4K1R B;  2BWF A;  4TSS A;  3ZNH B;  1Q1O A;  1CJE A;  4LNK A;  4N58 A;  2C5L C;  2YEP B;  3NOB A;  2O6V B;  3URY A;  2N9K A;  4GDK B;  1FRR A;  2LGY A;  1GNU A;  2Y3A A;  1JML A;  1DOX A;  2WGS A;  3QIJ A;  3L54 A;  1SBB B;  3ENE A;  4YTM B;  4W9C A;  4FJY A;  5JXV A;  1L2N A;  3N32 A;  1WM3 A;  1V1O A;  3ECI A;  2CU1 A;  2I38 A;  4TQ1 A;  4ZRP A;  2WXR A;  4KDI C;  2K1F A;  2LMC A;  3ETR A;  3N3K B;  2CKH B;  2LUM A;  3EHV A;  1G6J A;  2AQ2 B;  3OWE B;  1L5P A;  2G45 B;  4LLG M;  3VUY A;  1KJT A;  1WXQ A;  4H2A A;  4NQK E;  3N1Z C;  4WUR A;  2VZK B;  5AZH A;  5EE1 A;  3ZYY X;  3BWU D;  3I3T B;  4BBN C;  1JAL A;  2E6X A;  3VAW A;  1NI3 A;  1OTR B;  3JVZ X;  2HTH A;  3LDZ E;  5J18 A;  4ZHO A;  3L08 A;  1HXY D;  3ZTC A;  3AUL A;  2MJ3 A;  3C8Y A;  2N7E A;  1XLQ A;  4LJP B;  1KOT A;  2K6D B;  3L10 B;  4ARC A;  3PTF C;  2ZW0 A;  4PYU A;  3Q3F A;  2INC C;  4BKT A;  1WGH A;  1K53 A;  1PYW D;  2WXN A;  5CHV C;  4US9 A;  2OJW A;  2R2O A;  4M8M A;  3PV1 A;  4WJN A;  1D3Z A;  2KHW B;  1WZ3 A;  2JF5 A;  1B9R A;  4W9E A;  4DK5 A;  4AJW A;  2IDY A;  2V1Y A;  3HM3 A;  2LHD A;  3AE2 B;  5IOI A;  1ZDV A;  2LRU A;  3HHM A;  2NPT B;  3R66 C;  3HUI A;  5BYQ A;  4ANV A;  1RAX A;  2IZV B;  3BK1 A;  5BMI A;  2D5G A;  1TTN A;  1I4G A;  2DEN B;  5BYS A;  1LO5 D;  1FNV A;  4GN1 A;  2KLG A;  1V86 A;  4JWS C;  2ICI A;  1ZOY B;  1UUP A;  3R7Q A;  3AI5 A;  3FIL B;  3NHE B;  2JYT A;  4DXG A;  2ZVO A;  3A9K B;  4OW0 A;  1PGX A;  2JZP A;  4YSX B;  2LXA A;  1YJJ A;  4II2 B;  3VRB B;  1AYF A;  1ROE A;  5D7G A;  2KX0 A;  4MGK E;  3Q69 A;  3AEA B;  3ML8 A;  4BFR A;  2BF8 B;  3AM9 A;  2WXH A;  1GC7 A;  3U8Z A;  2CU3 A;  3Q8C A;  3V61 A;  3DCG A;  1VDV A;  1TS3 A;  2JPH A;  2DAF A;  4ANU A;  4AUQ C;  3E9S A;  1EUV B;  1J7B A;  1KH0 A;  1E7P B;  3WAN A;  2KVR A;  3DWG C;  5G55 A;  2JT4 B;  3Q14 C;  3EFC A;  1BT0 A;  2RDG A;  3RNB C;  4GIV A;  1E8W A;  1WXV A;  2FNJ B;  3A4S C;  3DBS A;  1FRD A;  3P4R B;  3P63 A;  5FR3 A;  1LQB A;  3DPD A;  1XCQ L;  2J7Q B;  1FO4 A;  2FCS A;  3MFG A;  3IHP C;  5DPW A;  2J4X A;  2K3U A;  3WAO A;  2LGX A;  4EZK A;  1WX8 A;  1SE9 A;  3UF8 A;  1IPG A;  4DHZ E;  1ZPS A;  4WAF A;  1KLV A;  4B0E A;  2WXI A;  2LWP A;  3L0W B;  3TIX A;  2BBC A;  2ZCB A;  3APC A;  4PT5 A;  4YTN B;  1WGD A;  2I1K A;  2JSV X;  3CSF A;  3WAL A;  3SFE B;  4HKQ A;  4R3D A;  4TUU A;  5L83 A;  1NBF C;  4I6P A;  3APD A;  3DHG C;  1RYJ A;  1E9M A;  3RN9 C;  2MBQ A;  4B0M A;  4KKI A;  2BYV E;  2LGI A;  3I9V 1;  1MG8 A;  2BB6 A;  2QEJ C;  4EEW A;  1SXT A;  3DVG Y;  3TJP A;  2L05 A;  4WIP A;  1I4R A;  2GOW A;  3TUO A;  5HG2 A;  3X0W A;  4ASW C;  3U7Z A;  5KHO A;  3LJ3 A;  2G9H D;  4AWJ A;  4MSM B;  2J0J A;  3EGR A;  1F77 A;  5AUK A;  4RF1 A;  2NVU I;  2O2V A;  3B9J A;  3KYC D;  1MPE A;  1N6Z A;  2NTT A;  2RMM A;  4DWF A;  1I4Q A;  1LGR A;  3AU5 A;  3EUB 2;  4HRS A;  3QQ8 B;  4FA6 A;  4A55 A;  2JRI B;  5D3D A;  3PZ7 A;  2K0P A;  5BMG A;  4ZRI A;  1L0V B;  3TBL D;  3N1X C;  1HEZ E;  5C2T B;  2BPS A;  1TJE A;  1I4H A;  3KUC B;  1UF0 A;  3N20 C;  2GB1 A;  4C56 C;  3ZNZ B;  4OZB A;  3QX1 A;  4IWP A;  2KO3 A;  2MEK A;  3PS6 A;  4YT0 B;  1LM8 B;  3VXW A;  1FD6 A;  4LJO B;  2C7M B;  2LJI A;  2WXJ A;  1CZP A;  2GRI A;  2R2Q A;  2LHE A;  2GI9 A;  3R8B A;  4JL9 A;  4S17 A;  2BS3 B;  5CTR C;  1NYQ A;  3BYT B;  3NZ3 A;  2DBY A;  1EU4 A;  1WWT A;  4MEL A;  1OEY A;  4NJ6 A;  1F2R I;  4G0N B;  1HZ6 A;  4GSW A;  1V81 A;  2M4N A;  1J7A A;  3EA6 A;  2KDM A;  3AE6 B;  4TMA B;  3ZO5 B;  3H9D A;  1E90 A;  2JQR B;  3NS8 A;  2J0M A;  4FHK A;  4GGQ A;  4E74 A;  2AWT A;  1KFY B;  4F7Z A;  3EC8 A;  4IM3 A;  4NZL B;  4KGS A;  3IBE A;  3VHT C;  2Y5C A;  1WYW B;  1I4X A;  2PVO D;  1SJH D;  2KWV B;  4PK1 A;  1A70 A;  2MQJ A;  3MC9 A;  3ZNG C;  2VH1 A;  3KYD D;  2N1V A;  1JRU A;  3DBR I;  4NJC A;  2MW5 A;  4XDC A;  2IND C;  3W9C B;  2IGD A;  1S3S G;  2L3Z A;  2LVQ A;  1VJK A;  1OQY A;  2MP2 A;  1ENF A;  2XK5 B;  3ZRC A;  4KKJ A;  4PS3 A;  1SGH A;  2I2Y A;  1JRO A;  1Q0W B;  4RMA A;  2K39 A;  5LLI A;  2JX5 A;  2RSU A;  5E6N A;  3Q8A A;  1WJ6 A;  3NJT A;  3UQA A;  4YSY B;  1L0X B;  1Z5S B;  1N60 A;  2N9X A;  2RDB C;  2Z0D B;  2QDF A;  4W9H A;  3Q3O C;  3BZD B;  3VFK A;  2OOB B;  1FIQ A;  2N1W A;  4OZA A;  2CJO A;  4HCN B;  1J0G A;  3ZUN A;  5MPO A;  1R4M I;  3RNC C;  2WXG A;  3RZF A;  3ZQ4 A;  5FKA C;  2IO0 B;  4B6W A;  4M02 A;  3VQI A;  1F52 A;  3MJW A;  2V9H A;  1YX5 B;  4C4V A;  5IKC M;  1L6U A;  5HI1 A;  1WIA A;  3H8H A;  2ZPY A;  3SEB A;  2FCM A;  2ASQ A;  4IWO A;  4XDD A;  3T3N A;  3U2S C;  1GPX A;  4ICU A;  3QK0 A;  3AV8 A;  3N30 A;  1AAR A;  4HK2 A;  3P2B A;  3VTW A;  5AUI A;  3QAQ A;  3AE4 B;  2GLS A;  3GZN I;  4FLH A;  5GXG B;  3GP7 A;  3VTU A;  3DBL B;  2AL6 A;  4IM2 A;  4ZYS A;  1C76 A;  4IDI A;  4OVU A;  4KV2 A;  4BKG A;  1D5Z C;  1ZXH A;  1V5T A;  3WAM A;  3T9L A;  3TL5 A;  4GU2 A;  3CIR B;  1IGD A;  4FJV B;  4KIK A;  2XBB C;  1HQR D;  4CO7 A;  4JQW C;  2NBV B;  2AX5 A;  3RZW C;  3RYT A;  1JWA D;  4ANW A;  2NBU A;  2AEH A;  4L23 A;  3TMP B;  4DDG D;  4NAW A;  2J53 A;  4PYZ A;  2CS4 A;  3PLU A;  4WWN A;  1YJI A;  3FC4 A;  1WYG A;  1L0Y B;  3Q3J A;  2L8J A;  2N0S B;  2PIA A;  1HTQ A;  1J7C A;  3VR9 B;  4HKZ E;  2FIF A;  4K7W A;  2KLC A;  5EDS A;  5D2M B;  4WJP A;  1WXA A;  3HVD A;  3MP9 A;  2K8H A;  1NYR A;  3NS1 A;  4P1C C;  4IC7 B;  5D6J B;  2K8B A;  1JW9 D;  3NZS A;  1WGK A;  2KAC A;  4A8X C;  4EKU A;  2KQ7 A;  2UWQ A;  2Y5P A;  2D3B A;  2M0A A;  1T3Q A;  4XE0 A;  4BKS D;  1TIF A;  4TV3 A;  1WXM A;  1XLN A;  1KM7 A;  1JQ4 A;  5G5G A;  1MI0 A;  1YQ4 B;  3U4E G;  1R7S A;  2FUH B;  1DOI A;  3C19 A;  5G5H A;  2KFK B;  3RD2 A;  2JWZ A;  3C0R B;  5HKH A;  4BKS A;  3CMM B;  3ZKJ C;  4J3O D;  3I63 C;  4A6Q A;  2HJ1 A;  4RGN A;  2MCN B;  2VRR B;  2KMA A;  1ZW7 A;  4GOC A;  1VD2 A;  2KJ6 A;  4JX1 C;  4KSL C;  1BML C;  3MHZ A;  3ZJT A;  2Q5W D;  2KWU B;  4F1S A;  5HFY A;  4KGR A;  3PRZ A;  2MJD A;  1EWY C;  4YSZ B;  3MJ5 A;  4LCD E;  4FUL A;  1NI2 A;  3ZW3 A;  3W2D A;  1Q5W B;  2WDR B;  3DDC B;  1GOZ A;  2KC2 A;  2LRW A;  1C78 A;  3L16 A;  2LEK A;  3AB5 A;  3JW0 X;  2JY6 A;  3T8M A;  3VUW A;  2V4I B;  2O6V D;  3BVZ A;  3OAW A;  1QT9 A;  4LDT B;  5LXH A;  4DQO C; 
#chains in the Genus database with same CATH homology
 4HJK A;  2DZK A;  1WGD A;  2CHW A;  2I1K A;  2LD9 A;  2KKC A;  3CSF A;  1FXT B;  2GBN A;  3WAL A;  4TUU A;  5E6P A;  2L0T A;  3KUZ A;  2RR9 A;  1J8C A;  5L83 A;  1NBF C;  4I6P A;  2Z59 B;  4MH0 E;  5E6O A;  3ZIM A;  3APD A;  4JLC A;  1WE7 A;  2KTF A;  2L0F A;  3PZD A;  3KVF B;  1YX6 B;  4PS8 A;  2MBQ A;  2FID A;  3PVL A;  4HDQ A;  2BYV E;  3AXC A;  1UD7 A;  2CHZ A;  1MG8 A;  2WYQ A;  4MJS B;  4JGH B;  1QZE A;  4K7S A;  1XT9 B;  4GB9 A;  4EEW A;  4ZDV A;  3DVG Y;  4MM3 A;  5L95 C;  3NY5 A;  3KUD B;  3U30 A;  3A33 B;  3VH3 B;  3TJP A;  2L05 A;  1J19 A;  2NCN A;  1ZKH A;  2GOW A;  2D3G A;  4JIO U;  2EKE C;  2BGF A;  4B95 A;  3DOW A;  3PRP B;  2MX2 A;  1UH6 A;  3X0W A;  3BIN A;  2IO2 B;  1WX7 A;  2LVO A;  1WGY A;  4DHZ B;  1IYF A;  4ASW C;  2Y5B B;  2KXJ A;  3L13 A;  2KMC A;  2LUE A;  3QAR A;  3BY4 B;  2PPH A;  4G3X B;  2KTR B;  4W9L A;  3A4R A;  3VVW B;  5KHO A;  3LJ3 A;  4GDL A;  2BKR B;  2O2V B;  4IUM B;  4AWJ A;  4MSM B;  2J0J A;  4WJQ A;  5AEK B;  2EMS A;  2IO1 B;  2M17 A;  2HE7 A;  4FHJ A;  4MGY E;  2BYF A;  2NVU I;  3CF6 E;  3M95 A;  2O2V A;  3KYC D;  1GUA B;  3ZVV A;  2IO3 B;  4DWF A;  2RPQ A;  2V3S A;  2A5U A;  3AU5 A;  2I1J A;  3QQ8 B;  4FA6 A;  3DQV A;  2D07 B;  2JRI B;  3V60 A;  4HLE A;  3K9P B;  4K81 A;  4RM8 A;  2FCQ A;  4URK A;  4ZRI A;  4J6I A;  4HCP B;  3WIM A;  4GMV A;  3TBL D;  4MGZ E;  5JH5 C;  2MRP A;  2UYZ B;  1C1Y B;  4NNJ B;  3VH4 B;  2DZM A;  3H7S A;  4FBJ B;  4BOS C;  4IWQ A;  1V2Y A;  1V6E A;  1E8Y A;  2BPS A;  2KDB A;  2KD0 A;  3KUC B;  2KNB A;  5AZG A;  1IP9 A;  2BWE S;  3ZNZ B;  4TQ0 A;  3ALB A;  2CHX A;  3QX1 A;  3QJZ A;  4IWP A;  1XD3 B;  2JXX A;  2N9P C;  3DBL I;  4G50 A;  2KO3 A;  1WR1 A;  2NR2 A;  2YVC A;  3B1L X;  2KC1 A;  2L76 A;  2OJR A;  2PE6 B;  3PHX B;  3PS6 A;  2D2Q A;  3H7P B;  1LM8 B;  4ZRJ A;  1UBQ A;  2D10 A;  3VXW A;  1E5W A;  2DZI A;  4LJO B;  2C7M B;  4NAW B;  2R2Q A;  2GBR A;  4ZYN A;  2KFK A;  1TBE A;  3H7P A;  3PLV A;  4MGI E;  1HE8 A;  1Z2M A;  4JL9 A;  2WDT B;  5CTR C;  4MEL A;  1PQS A;  4M8N A;  1WX9 A;  3QA8 A;  1OEY A;  5CHF A;  4NJ6 A;  1GC6 A;  4G0N B;  1V80 A;  3VUX A;  5LXI B;  4IW0 A;  5J2R A;  2KDI A;  3MTN B;  3S2A A;  5KHQ A;  4GSW A;  2C7N B;  4DDI D;  1V81 A;  2ZEQ A;  3APF A;  2M4N A;  2EMT A;  1WJ4 A;  4W9F A;  3A1Q A;  4KSK C;  5IA7 A;  1RLF A;  3ZO5 B;  1WF9 A;  4MJS A;  1ISN A;  4NPN A;  3ZDT A;  3H9D A;  3QCA A;  1E90 A;  1V49 A;  3NS8 A;  2J0M A;  2KDF B;  4FHK A;  4W9G A;  4GGQ A;  1V9J A;  4EUT A;  3A1Q B;  2C9W B;  4E74 A;  2DX5 B;  1WZ0 A;  2AWT A;  2K25 A;  2KJR A;  1P9D U;  1UEL A;  4NQL B;  4W9D A;  4DXA B;  3W1Y A;  1UZX B;  2DZJ A;  3EC8 A;  3EFU A;  4F7Z A;  1WGG A;  4IM3 A;  2ZNV B;  3JYU A;  3IBE A;  3VHT C;  5GMV A;  4IM0 A;  3JSV B;  1P3Q U;  2MLB A;  3B08 A;  1LFD A;  1P98 A;  1WYW B;  2O6V A;  1E8Z A;  2G4D B;  4NJ7 A;  4DBG A;  1I42 A;  1EO6 A;  2NS5 A;  2LXC A;  2KWV B;  3CST A;  3WAP A;  4A3O A;  2M1M A;  1ZGU B;  1WMH B;  3JSV A;  3EEC A;  5CHW A;  3SDL C;  4EZL A;  1WI0 A;  2MQJ A;  3V62 A;  3ZNG C;  2BKF A;  1UBI A;  1WFY A;  3KYD D;  2N1V A;  5TR5 A;  3PGE A;  2JRH A;  2MBE A;  1JRU A;  3DBR I;  4HXD A;  2MWS B;  4W9K A;  4HPM B;  3HIZ A;  3OJ3 A;  3U7D A;  3ZRF A;  3HK0 A;  2K6Q A;  2MW5 A;  4RM9 A;  4YL8 A;  1P0R A;  3PPA A;  4NY0 A;  4FAD A;  2ZCC A;  2GBM A;  4PS7 A;  1L7Y A;  1V5O A;  2KTR A;  4KIK B;  3VTV A;  1S3S G;  2HJ8 A;  2L3Z A;  2IYD B;  5D94 A;  5FR6 A;  3RCZ A;  2LVQ A;  4WWO A;  3AU4 A;  2KWC A;  2YLM A;  4MDK E;  2HD5 B;  2JZZ A;  1OQY A;  2D11 A;  2MP2 A;  5C23 A;  5J17 A;  2XK5 B;  1R4N I;  2L7R A;  4XX5 A;  3OJ4 B;  3ZRC A;  4PS3 A;  1SGH A;  5BO4 B;  2L00 B;  3B0A A;  3V6C B;  3ONS A;  1Q0W B;  4RMA A;  4XZ4 A;  5JZE B;  1TZ1 A;  1WE6 A;  2K39 A;  3PHW B;  4DHJ B;  4II3 B;  5LLI A;  3DBH I;  2RSU A;  5E6N A;  2PEA A;  2IBI B;  3DVN V;  4WAA A;  1S1Q B;  1WJ6 A;  1YD8 U;  3DVN U;  3UQA A;  3KH0 A;  4K7U A;  2QHO A;  1Z5S B;  1XQQ A;  2N9X A;  1A5R A;  2Z0D B;  2GBJ A;  2J0K A;  4W9H A;  2PE9 A;  4I6N B;  3VFK A;  3QC8 B;  3WA0 A;  2OOB B;  2RD0 A;  4K1R B;  4CHK A;  2BWF A;  3ZNH B;  2N1W A;  1Q1O A;  1WGR A;  5AZF A;  4HCN B;  2NBW B;  1J0G A;  3ZUN A;  2C5L C;  3NOB A;  1R4M I;  4W9I A;  3RZF A;  2IO0 B;  2O6V B;  4B6W A;  1E7V A;  2MBH A;  4GDK B;  1EF5 A;  3VQI A;  3IVF A;  1OGW A;  3MJW A;  1YX5 B;  2C7H A;  2PJH A;  1WIA A;  3PRE A;  2LGY A;  1GNU A;  1Y8R C;  2ZPY A;  2FCM A;  4ANX A;  3K9O B;  2ASQ A;  4IWO A;  3QIJ A;  3L54 A;  3ENE A;  4W9C A;  4FJY A;  1L2N A;  1WM2 A;  5JHB A;  3N32 A;  1WM3 A;  4IG7 B;  1VCB A;  4MEM A;  4EFO A;  3ECI A;  1YIW A;  4XC2 A;  2CU1 A;  2LI5 A;  4TQ1 A;  4KDI C;  2K1F A;  3N3K B;  4ICU A;  3GOE A;  2CKH B;  3QK0 A;  5C1Z A;  1X1M A;  2M8S A;  2XK5 A;  3EHV A;  4BBN F;  1G6J A;  3N30 A;  1WY8 A;  1AAR A;  2G3Q B;  2KOX A;  4HK2 A;  2G45 B;  5DCN A;  3VUY A;  1T0Y A;  1KJT A;  3P2B A;  3ZNI D;  3IG3 A;  4NQK E;  5DPR A;  4I6L B;  5AZH A;  3VTW A;  3QAQ A;  2KAN A;  1WMH A;  4BVU C;  3GZN I;  3I3T B;  1E8X A;  4BBN C;  2AL3 A;  1RFA A;  4FLH A;  4P7I A;  3VAW A;  3V6E B;  3JVZ X;  1OTR B;  4WWP A;  4IM2 A;  2AL6 A;  3VTU A;  2HTH A;  2CR5 A;  3LDZ E;  4OVU A;  5J18 A;  1H4R A;  2W9N A;  2GBK A;  4KV2 A;  3W1S C;  4AOF A;  4HWI B;  4BKG A;  4BOZ B;  1V5T A;  3L08 A;  3WAM A;  3ZTC A;  3M62 B;  1WH3 A;  3AUL A;  3T9L A;  3UGB B;  3TL5 A;  3R7R A;  1U4A A;  4HVB A;  2LJ5 A;  2MBB B;  2N7E A;  3M3J A;  4GU2 A;  4LJP B;  3IFW B;  4FN2 A;  1KOT A;  1WR6 E;  2FCN A;  3M63 B;  3OLM D;  2K6D B;  3L10 B;  4AP4 C;  3PTF C;  2RGF A;  1C3T A;  4PYU A;  3Q3F A;  4FJV B;  4KIK A;  2LZ6 A;  2V4L A;  4BKT A;  1WGH A;  2XBB C;  3KW5 B;  5CX3 A;  1GJZ A;  5CHV C;  4X57 B;  4CO7 A;  4GXB A;  3QWZ B;  1M94 A;  2NBV B;  4JQW C;  4W9J A;  3RZW C;  3UQB A;  2R2O A;  3RYT A;  2JUO A;  3H1U A;  2MP2 B;  4ANW A;  1E7U A;  4M8M A;  2NBU A;  4EZJ A;  1YJ1 A;  3PV1 A;  2AEH A;  4HPL B;  1WXS A;  1WJU A;  4WJN A;  3TMP B;  4DDG D;  4NAW A;  1D3Z A;  2KHW B;  5JHA A;  3R3M A;  1WZ3 A;  2JF5 A;  4B9K A;  4ZRK A;  4KDL B;  4PYZ A;  2CS4 A;  4W9E A;  3W1S A;  3PLU A;  4AJW A;  4DK5 A;  2KN5 A;  2V1Y A;  4WWN A;  3HM3 A;  2ZNV C;  3A9J A;  3Q3J A;  2L8J A;  4GDL B;  4KVG B;  1UGM A;  2M0X A;  2B3A A;  2LRU A;  2C60 A;  5G2N A;  3HHM A;  2FIF A;  3RUL A;  2NPT B;  3R66 C;  4K7W A;  4N9F 4;  3SU8 X;  3H6N A;  3VDZ A;  2KLC A;  2KQS A;  4ANV A;  1RAX A;  2IZV B;  5EDS A;  1TTN A;  2DEN B;  2N7D A;  2KX3 A;  4GN1 A;  2KJH B;  1NDD A;  2Z0E B;  1CMX B;  2KLG A;  2XEW A;  1V86 A;  4WJP A;  5D2M B;  2GMI C;  1WXA A;  3A9K A;  3R7Q A;  3AI5 A;  2KK8 A;  3DVG X;  2N4F A;  3NHE B;  2K8H A;  4IC7 B;  3D32 A;  1I35 A;  5D6J B;  2DAJ A;  2K8B A;  4WJO A;  3NZS A;  4WQO B;  1WJN A;  2A4Z A;  2BYE A;  2ZVO A;  2JZ3 B;  1TGZ B;  3A9K B;  3PSE B;  1GG3 A;  4EKU A;  2WWZ A;  4G11 A;  3RUI B;  1SIF A;  2LXA A;  2KQ7 A;  4II2 B;  2UWQ A;  1P1A A;  2IY1 B;  3MHS D;  2AYO B;  3PT2 B;  4BKS D;  2NPT A;  4A3P A;  2K8C A;  3ML9 A;  5D7G A;  4F8C B;  2KX0 A;  3L17 A;  4TV3 A;  2KFJ A;  1WXM A;  3RT3 B;  1KM7 A;  2DYB A;  3NZU A;  4MGK E;  3ML8 A;  1YQB A;  2DHZ A;  3SHQ A;  4BFR A;  2N9E B;  3ZDM C;  1OEY J;  2BF8 B;  4AJY B;  4CYE A;  2FUH B;  1GC7 A;  3U8Z A;  3V61 A;  3DCG A;  2WX1 A;  2KFK B;  2REX A;  4M0W B;  3RD2 A;  3ZTD A;  2JWZ A;  2ZZP B;  4A20 A;  3C0R B;  3PRM B;  2JPH A;  5HKH A;  2DAF A;  4E3C A;  4ANU A;  4BKS A;  4KZ0 A;  4AUQ C;  1EUV B;  3CMM B;  2ZPN A;  3SD5 A;  3ZKJ C;  2LGD A;  3WAN A;  1WRD B;  3QHT A;  2KVR A;  5G55 A;  3UIP B;  2MA9 B;  2JT4 B;  2KDE B;  2IY0 B;  2MCN B;  2VRR B;  2KMA A;  1ZW7 A;  4GOC A;  2MBO A;  4MSQ B;  1BT0 A;  2DYO A;  1VD2 A;  2MSE D;  1EF1 A;  2KJ6 A;  2FAZ A;  5DPT A;  4KSL C;  4GIV A;  1E8W A;  1WXV A;  4DHJ D;  2FNJ B;  3A4S C;  3DBS A;  2KWU B;  1K8R B;  3ZLZ A;  1LQB A;  3DPD A;  4ICV A;  4F1S A;  2J7Q B;  4EOY A;  3PRZ A;  4HDO A;  2ZJD A;  1H8C A;  2LAS A;  4LCD E;  1LXD A;  4FUL A;  4KZC A;  1NI2 A;  2FCS A;  2WX0 A;  5IAA C;  3ZW3 A;  3X23 A;  2G4S A;  2DYM A;  4OVV A;  3HM6 X;  3IHP C;  3UIN B;  5DPW A;  2ZVN A;  1Q5W B;  4FJZ A;  2LGX A;  3WAO A;  4EZK A;  1WX8 A;  4TKN A;  1F9J A;  1SE9 A;  1RRB A;  3DDC B;  3UF8 A;  3UIO B;  1IPG A;  4LDT D;  4DHZ E;  2KC2 A;  3O65 B;  2LRW A;  3L16 A;  3TCA A;  1KLV A;  3JW0 X;  4E71 A;  2JY6 A;  3T8M A;  2LVP A;  3VUW A;  2O6V D;  2KZR A;  4GDK A;  2LWP A;  3L0W B;  5DPS A;  2JVC A;  3OAW A;  3TIX A;  3A9J B;  4LDT B;  5LXH A;  2ZCB A;  3APC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...