2EKEC

Structure of a sumo-binding-motif mimic bound to smt3p-ubc9p: conservation of a noncovalent ubiquitin-like protein-e2 complex as a platform for selective interactions within a sumo pathway
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
DPLVPRGSEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase/protein binding
molecule keywords SUMO-conjugating enzyme UBC9
publication title Structure of a SUMO-binding-motif Mimic Bound to Smt3p-Ubc9p: Conservation of a Non-covalent Ubiquitin-like Protein-E2 Complex as a Platform for Selective Interactions within a SUMO Pathway
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 18
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ekeC01
3QAQA 1V80A 5L95C 1WGHA 2IO0B 4JIOU 4NQLB 4NNJB 3ML8A 2AL6A 2EMSA 3OAWA 2MA9B 2O2VB 1ZGUB 2IZVB 5AZGA 1GC6A 1E8WA 2KWUB 2MW5A 2L0TA 2BKFA 3A9KB 3IVFA 4OVUA 3HM6X 4DDGD 4YL8A 4RM8A 4W9KA 1BT0A 1WGGA 1WR6E 3K9OB 3UGBB 3UIPB 2KLGA 1E8XA 4M8NA 1J19A 5J18A 2EMTA 3PPAA 2W9NA 3ZNID 4BFRA 2K1FA 1D3ZA 5LXIB 3KH0A 2J7QB 4PS3A 1CMXB 1P0RA 2A5UA 3V6CB 1IP9A 2DZJA 2M17A 1E5WA 2GBNA 2KDIA 5AZHA 4F7ZA 5D6JB 1V5TA 2V3SA 2FIDA 3TCAA 4FHKA 2BYEA 4II3B 4ICVA 1ZW7A 4GIVA 4WJNA 3BY4B 4FA6A 4II2B 1I42A 2OOBB 1AARA 5DPWA 3VVWB 3JVZX 2DHZA 2CU1A 2KFKB 2N9XA 3KUCB 2MX2A 4DHJB 4BVUC 2KC2A 3H1UA 2NVUI 4BBNC 3PVLA 4MM3A 3EFUA 4MGYE 5DPRA 3ZIMA 2CS4A 2N1VA 2WYQA 3VTWA 1NDDA 2MLBA 3R3MA 2EKEC 1OQYA 4WJQA 4EZJA 2O6VB 4JQWC 2NBVB 2ZNVC 4M8MA 4W9FA 4AUQC 2HTHA 2K39A 4BBNF 4GU2A 1TZ1A 4I6NB 3VUXA 4KDLB 4PS8A 5E6NA 1E90A 1UD7A 5CHVC 3H7PA 2KMAA 3I3TB 2KLCA 2Z59B 4W9DA 4EUTA 2I1KA 3P2BA 2MCNB 3A9JA 4IM2A 1SIFA 3QK0A 4AJWA 1L7YA 4IWPA 2ZCBA 4WQOB 3WANA 4A3PA 3GOEA 1WXAA 1C3TA 4TQ1A 4ANWA 3H7SA 4CHKA 3RULA 4MELA 1ISNA 3VUYA 3RZWC 3SU8X 2YLMA 2KZRA 1WRDB 2AL3A 4LDTD 3DPDA 2MBHA 4B9KA 4ICUA 1WMHA 5J17A 3QJZA 1VCBA 3VDZA 1V81A 1WXVA 3N32A 2M4NA 4W9EA 2CKHB 4IWOA 3TJPA 4FADA 1GUAB 1C1YB 3ZW3A 4MGIE 2ASQA 1S1QB 1L2NA 2MP2A 4B6WA 4PS7A 4FJVB 5HKHA 2KC1A 3QIJA 2LUEA 1LXDA 2LGYA 3O65B 3MHSD 4DDID 4ZRIA 3A4RA 2C7HA 2KNBA 4GDLA 3NZUA 2KJ6A 5CX3A 3PRMB 1YX5B 2NPTB 3HK0A 4TV3A 2RD0A 5DCNA 4AWJA 1XD3B 3A1QB 1OEYA 3VHTC 4DXAB 5AZFA 2GBKA 4EOYA 3AU4A 1VD2A 1WGYA 1WX9A 2AYOB 1F9JA 1WJ4A 2AWTA 2N9PC 2UWQA 4KZCA 4AP4C 3WALA 1T0YA 2BKRB 5G55A 2C60A 2PEAA 3JSVA 3QA8A 4NQKE 1E7VA 2HJ8A 4LJOB 2JZZA 4ZRKA 2J0JA 1KOTA 5CHFA 3VH3B 2B3AA 2JT4B 5D2MB 1WFYA 2KX3A 3UINB 2Z0EB 4BOZB 2HE7A 4HJKA 2M8SA 5IAAC 2N9EB 4DHJD 2KOXA 4XX5A 4DBGA 2DZIA 2K8BA 1EUVB 2Z0DB 2FIFA 1XT9B 3PLVA 3WAPA 5C23A 2O6VD 2KJHB 5E6PA 3UF8A 2IY0B 4EEWA 4HXDA 4FHJA 4HCNB 5E6OA 2ZCCA 2BYFA 1WGRA 4W9HA 4W9LA 2IYDB 3PS6A 2XBBC 3AI5A 4FBJB 2JWZA 2KTRB 1V49A 4K7UA 1WX7A 2DYOA 1OTRB 4IWQA 3EC8A 1V5OA 3CSTA 3X23A 2L3ZA 2XK5B 4E71A 2D11A 4JLCA 3X0WA 2M1MA 1GG3A 3PRPB 4E74A 5J2RA 3ZNZB 2LJ5A 2G45B 3ZNHB 4ANVA 3AXCA 3ENEA 2FNJB 4MEMA 1MG8A 2D10A 1TBEA 4IUMB 4KDIC 3DBRI 4HDOA 2KK8A 2AEHA 3RD2A 4DHZB 3B0AA 4XC2A 1WZ0A 4P7IA 3L13A 4M0WB 1RFAA 3PV1A 4PYUA 2GMIC 5D94A 2K25A 4IW0A 2K8CA 2IY1B 2C7NB 1ZKHA 2JRIB 2C7MB 1GNUA 2J0MA 2K8HA 2O2VA 2IBIB 3A9KA 3VUWA 4MDKE 1OGWA 2CHWA 2KWCA 4G0NB 4ANXA 1WYWB 2V1YA 4GGQA 3VXWA 2BGFA 2LVPA 3DVGX 4W9JA 3VFKA 3DOWA 1E7UA 2IO3B 3DVNU 3V60A 2L7RA 3ALBA 3NY5A 2LGXA 3PHWB 3ZDTA 2D07B 3R66C 4G3XB 2KFJA 1A5RA 3ZRCA 2KQ7A 2MBOA 3Q3FA 2ZNVB 2C5LC 4WWNA 1TTNA 1P98A 2KMCA 3A4SC 3ZVVA 2G4SA 3DQVA 2KKCA 3TBLD 4KVGB 3ZLZA 2G3QB 1WY8A 4KZ0A 2FAZA 1WE7A 4NJ7A 3RT3B 1WXMA 1V2YA 3N30A 1H8CA 5AEKB 2NS5A 4FLHA 4CYEA 2JZ3B 4F1SA 4I6PA 3L54A 4ZDVA 2BWES 5EDSA 4MSQB 4WJOA 1UBQA 2KFKA 1UH6A 3ECIA 3PRZA 2RPQA 5FR6A 4NY0A 3PSEB 3ZKJC 1JRUA 2FCQA 3QARA 3SD5A 3M95A 3VTUA 3L16A 2WWZA 2KO3A 1NI2A 2KHWB 4RM9A 1J0GA 2KANA 2O6VA 3SHQA 3B08A 4BKTA 3DDCB 2YVCA 4PYZA 2R2QA 1YX6B 1WF9A 3APFA 2NR2A 2WDTB 4HWIB 2BPSA 4K7WA 3V62A 3VH4B 4NAWB 3R7RA 1LFDA 2LWPA 3JYUA 2LD9A 4EFOA 4G50A 2MQJA 2REXA 3AULA 3K9PB 3M3JA 3ONSA 2CR5A 3QCAA 2NBWB 3KUDB 2N1WA 1NBFC 5G2NA 3TIXA 4TKNA 3V61A 2LVOA 3UIOB 2I1JA 3LDZE 1Q5WB 4K1RB 2ZZPB 4KV2A 3PHXB 4MSMB 2ZPYA 4MJSB 4W9CA 2BWFA 1H4RA 5L83A 1QZEA 2GOWA 3APDA 3ZTDA 4GDKB 3PT2B 4MGZE 4X57B 1SE9A 3RYTA 2MBQA 5JZEB 2UYZB 2ZVNA 4I6LB 2LXAA 3B1LX 4RMAA 2L0FA 2KWVB 3IHPC 4IM0A 5JH5C 3M63B 3U30A 3RZFA 4CO7A 4HVBA 1SGHA 2L8JA 2PPHA 2KDBA 3GZNI 1WM2A 3AU5A 3QHTA 1X1MA 1YD8U 3L0WB 2FCNA 4LCDE 4N9F4 4URKA 2DENB 3W1YA 1XQQA 2IO2B 3DCGA 2CHXA 3JW0X 3CSFA 3QC8B 3WIMA 2DAJA 4DHZE 1WJ6A 2GBMA 1P3QU 3H9DA 2KQSA 1YJ1A 1I35A 2KXJA 4KIKA 2VRRB 5DPTA 3T8MA 4NPNA 2K6QA 2LXCA 5LXHA 2NCNA 5BO4B 4DWFA 4ZRJA 1EF1A 4ZYNA 3KUZA 1Q1OA 4E3CA 2FCMA 1WJNA 2LASA 5LLIA 3PLUA 2Y5BB 2JUOA 2RGFA 4LDTB 2DX5B 2ZVOA 4TQ0A 4WJPA 3V6EB 1WIAA 4GSWA 1V86A 2XEWA 4B95A 2N4FA 3SDLC 3WAMA 3IFWB 4HPLB 3VAWA 3C0RB 1LM8B 1E8YA 2L05A 1G6JA 2BF8B 3DVNV 3OJ3A 4KSLC 4BKSD 1RLFA 4FJYA 2LRWA 3HIZA 3DBSA 3KVFB 4MH0E 2FCSA 2LZ6A 4A3OA 2BYVE 3PREA 1GJZA 4GN1A 3D32A 5IA7A 2QHOA 2KDFB 3RUIB 5JHBA 3MJWA 2WX1A 2DZMA 3ZO5B 2ZJDA 3ZUNA 1GC7A 5DPSA 3H7PB 3HHMA 3L17A 4K7SA 1Z2MA 1KM7A 4BOSC 3U7DA 3A9JB 1LQBA 4LJPB 1EO6A 1Y8RC 2KJRA 1R4MI 3IG3A 4AJYB 2KTRA 4F8CB 4HDQA 3Q3JA 4IM3A 4K81A 4HLEA 1V9JA 1WJUA 1WZ3A 2KTFA 2LVQA 2LI5A 2PE9A 3NS8A 4G11A 4J6IA 5CHWA 2WX0A 5GMVA 3KYDD 2XK5A 3BINA 1WH3A 4IC7B 4GOCA 3HM3A 3OJ4B 2MRPA 3MTNB 3A33B 1YIWA 1WMHB 1WR1A 2R2OA 3NZSA 4JL9A 3TMPB 1V6EA 3ZRFA 5CTRC 2JXXA 3L10B 2DYBA 2PE6B 1TGZB 3EECA 4A20A 4ANUA 2JF5A 2MP2B 3DBHI 1EF5A 3ZTCA 1OEYJ 3UQBA 1UBIA 3APCA 3S2AA 1FXTB 2DZKA 3KW5B 3ZNGC 3U8ZA 3NHEB 4GDLB 5KHOA 2C9WB 2J0KA 4MGKE 2JVCA 4HK2A 4WWPA 2KDEB 2ZEQA 4JGHB 2GBJA 5D7GA 1WXSA 3T9LA 2V4LA 3UQAA 3TL5A 2RSUA 1UZXB 4TUUA 1M94A 2MBBB 3PGEA 2OJRA 3EHVA 3R7QA 1WI0A 4EZLA 3CF6E 4GB9A 1J8CA 1WX8A 2KN5A 3DBLI 2L76A 1HE8A 1WE6A 2CHZA 3PTFC 1RRBA 2LRUA 1Z5SB 2D2QA 3JSVB 1P1AA 4ASWC 4HPMB 3ZDMC 2GBRA 4FULA 3M62B 3WA0A 3PZDA 3DVGY 4WAAA 1WM3A 3N3KB 2HD5B 1YQBA 4W9GA 1P9DU 2KD0A 3W1SC 4BKSA 2KX0A 3L08A 4HCPB 3IBEA 3WAOA 3QX1A 4WWOA 4OVVA 2M0XA 1KLVA 5C1ZA 3H6NA 4KIKB 3LJ3A 2A4ZA 2RR9A 4NJ6A 1IYFA 1KJTA 1WGDA 2K6DB 2JPHA 1IPGA 4EKUA 2MWSB 3W1SA 2DAFA 2DYMA 2FUHB 4GMVA 3KYCD 5KHQA 4FJZA 4KSKC 4NAWA 1U4AA 1PQSA 1Q0WB 2ZPNA 3ML9A 2JRHA 2LGDA 2NPTA 3RCZA 4BKGA 4W9IA 2NBUA 4DK5A 1RAXA 1R4NI 3QQ8B 3OLMD 2IO1B 2N7EA 1S3SG 2L00B 3A1QA 5TR5A 2N7DA 3VTVA 3NOBA 2MSED 2KVRA 1UGMA 1K8RB 4AOFA 4MJSA 3CMMB 2JY6A 1E8ZA 4GDKA 2PJHA 2G4DB 2MBEA 2D3GA 1UELA 5JHAA 3QWZB 4IG7B 3VQIA 4FN2A 4EZKA 4XZ4A 4GXBA
chains in the Genus database with same CATH superfamily
1V80A 5L95C 3EFCA 2JX5A 2AL6A 2WXOA 1SF0A 2MA9B 4PK1A 3HM6X 1BT0A 1WGGA 3K9OB 3UIPB 1E8XA 1ZPSA 5J18A 3DBLB 3ZNID 2M56B 1DOYA 5LXIB 1E10A 1CMXB 1IP9A 2FIDA 3I57A 4J3OD 4GIVA 3BY4B 2OOBB 3P42A 3BVGA 4HPPA 2N9XA 4JE3B 2QDFA 1XO3A 1C4CA 4MM3A 3TEYA 2CS4A 2WYQA 2MLBA 2EKEC 4JQWC 2NBVB 4W9FA 3NZ3A 2HTHA 4BBNF 3AE4B 3ETRA 4I6NB 4PS8A 1AYFA 5E6NA 1E90A 1L6VA 1T3QA 3H7PA 3I3TB 2KLCA 2Z59B 1SIFA 3QK0A 1CQVA 1L7YA 3SFDB 3WANA 4RGOS 4A3PA 3GOEA 4K3CA 1WXAA 4MELA 3VUYA 4AQ7A 1ZDXA 2AL3A 2OEDA 3DPDA 4B9KA 3SR6A 1WMHA 4MT5A 3VDZA 1V81A 2CKHB 4JPSA 3TJPA 4FADA 1GUAB 1C1YB 2ASQA 4PS7A 2LJIA 1F77A 1VZ7A 4DDID 4ZRIA 3A4RA 1JCKB 1YJIA 3PRMB 3AE6B 3A1QB 4EOYA 2AYOB 1WGYA 1FXIA 2SAKA 2I2YA 1F2RI 3W5VB 3ZQ4A 2PEAA 3QA8A 4OW0A 1GB1A 2JT4B 1FCCC 1FFUA 3R2TA 5IN7A 2K3UA 4K3BA 1KRHA 2V0GA 2DNFA 2Z8LA 5E6PA 3FAHA 4EEWA 2ZCCA 1IGDA 3B2FA 2IYDB 2J42A 4ZYSA 1I7HA 1WX7A 4MH8A 1OTRB 3EC8A 3X23A 2XK5B 3N1XC 3C8YA 1GG3A 4E74A 4IKGA 1I4XA 4ANVA 4MEMA 1MG8A 2D10A 3NJTA 1J7CA 4IUMB 4ZHOA 3DBRI 2KK8A 1CK1A 2RDHA 4XC2A 1R7SA 4IW0A 2ACZB 3RNBC 3AE2B 1J7BA 2KWCA 3DHIC 4ANXA 3P63A 1WYWB 2AQ1B 2D07B 1ENFA 1I4PA 1T5XD 2MBOA 3Q3FA 4HKZE 1FIQA 2C5LC 1WRIA 2KKCA 2IJ0A 4KVGB 5LNK1 1EU3A 4XYCA 3DHHC 3RT3B 1V2YA 3N30A 1KF6B 4OVZA 1T0QC 4I6PA 3L54A 4F1SA 4ZDVA 3AE3B 4MSQB 4WJOA 1UH6A 3PRZA 3RNAC 1JRUA 3AE7B 3SD5A 3LB8C 2R61A 3B9JA 4RM9A 2KANA 3OWEB 4BKTA 3DDCB 3VR8B 1YX6B 1RYJA 4LNNA 2BPSA 1MPEA 4K7WA 3P1MA 2CU3A 4YSYB 1SIJA 2L52A 4RF1A 3QCAA 1T0SC 3DBRB 3KUDB 5G2NA 2SEBD 2I1JA 4K1RB 2ZZPB 4MSMB 2KVZA 4RNAA 2BWFA 5L83A 2GOWA 4GDKB 3PT2B 4MGZE 3RYTA 3ZXRA 1WYGA 2LXAA 1JWAD 2EKIA 3NVZA 3C19A 1AWDA 3GZNI 2GI9A 1X1MA 1XQQA 4EE2A 1SE3A 3CSFA 3Q8AA 4WURA 2KQSA 1YJ1A 4LNOA 1I35A 4KIKA 1KH0A 3T8MA 4IDIA 1WGKA 2DBYA 4S17A 5LXHA 3KLSX 4ZRJA 1EF1A 1Q1OA 3PLUA 2ONQA 2RGFA 2ZVOA 4XWTA 1NENB 3IFWB 1AW7A 3VAWA 2L05A 5FKAC 5T8IA 3DVNV 3OJ3A 4KSLC 2WU5B 1Q10A 3KVFB 1VDVA 4MH0E 2M19A 2FCSA 2G9HD 3ZXVA 4A3OA 1GJZA 3D32A 2KDFB 1YN4A 5JHBA 2WXPA 1MVKA 2RPVA 3L17A 1EO6A 3IG3A 2KJRA 1R4MI 4HDQA 4IM3A 4KKIA 1JALA 2LFIA 2PE9A 5CHWA 2WX0A 3GZNB 2XK5A 4RGMA 4IC7B 1GAQB 3HM3A 3MTNB 2KMMA 1WR1A 3ZRFA 1V1OA 1TS4A 2PE6B 1TGZB 3EECA 4A20A 1TY2A 3AEDB 2MP2B 2WXRA 4GLSC 1KLGD 3KW5B 3ZNGC 1STEA 5KHOA 4MGKE 4HK2A 1MJDA 1NVID 1TYGB 3NVWA 1FRRA 1ET6A 2RSUA 3PGEA 4OZBA 3R7QA 2G1EA 1WI0A 2CJOA 3N1ZC 2BYTA 1WE6A 1P1AA 4HPMB 3ZDMC 1N60A 2KAJA 2KWDA 3PZDA 3DVGY 1WM3A 4BKSA 2WLBA 3IBEA 3WAOA 3QX1A 2V3PA 4WWOA 2M0XA 4LTUA 1WSPA 1R4MB 2RR9A 1ROEA 1F0ZA 4P1BC 2JPHA 3SFEB 4IOIE 2Q5WD 3W1SA 1PFDA 2DYMA 2JQRB 1PUTA 2ZPNA 5D3IB 3NS1A 3RCZA 3RNFC 4BKGA 4C7ZA 2WDVB 2N7DA 3NOBA 2KVRA 3CMMB 1RWSA 2JY6A 1JWSD 4GDKA 2PIAA 4P6VF 4IG7B 4FN2A 4EZKA 4XZ4A 1UWXA 3QAQA 2L1AA 1YQ4B 1SXTA 1TS3A 3ML8A 2PVGC 4OHJA 5AZGA 1ZGUB 2IZVB 1E8WA 2MW5A 2L0TA 3A9KB 4CQNA 4DDGD 4YL8A 2JWUA 1WR6E 1QKZA 2K9XA 3H8HA 2KLGA 4ZRQA 4M8NA 1J19A 1V97A 3PPAA 2W9NA 3KH0A 1P0RA 2A5UA 2DZJA 2M17A 3DWGC 1E5WA 5AZHA 1E9MA 2LEKA 2BQQA 2N7JA 4FHKA 2BYEA 4WJNA 1I42A 3ZJVA 3IAS1 1TS2A 3JVZX 3KUCB 2MX2A 5DPRA 3ZIMA 1QILA 3VTWA 1NDDA 2B76B 2WXQA 3Q8FA 4A8XC 2BB6A 2M0AA 1TZ1A 4KDLB 4USAA 2KMAA 4EUTA 2WXFA 3R8BA 5EE1A 5MPOA 3P2BA 1FXAA 2MCNB 1VR9A 4B0EA 1GOZA 1FO4A 1BUIC 4AJWA 2ZCBA 3I5JC 4KGSA 1C3TA 3H7SA 4CHKA 1ISNA 1XCQL 1JWMD 2NTTA 2MBHA 3NVYA 1VCBA 2D3AA 4HJGE 3ZW3A 1NI3A 1B1ZA 1ACCA 1JMLA 2MP2A 3AEFB 4B6WA 4N58A 1HQRD 3QIJA 2LGYA 3Q3MC 3MHSD 4Q2JA 1XLOA 2C7HA 3O13A 3TEZA 2BVCA 3NZUA 2INDC 3HUIA 3VHTC 4DXAB 5AZFA 3AU4A 1WJ4A 1DGJA 2UWQA 2WXNA 4AP4C 2BKRB 2QEJC 2C60A 4NQKE 3IAM1 2HJ8A 4P16A 2J0JA 1KOTA 3VH3B 2HJ1A 3DBHB 2B3AA 3TEXA 3VR9B 4BOZB 1YMHE 1MFWA 2M8SA 2DZIA 3PLVA 3V05A 3KWLA 2O6VD 3BIID 2KJHB 2IY0B 4HXDA 5E6OA 1HTOA 4YXDB 2BYFA 4W9LA 2XBBC 4FBJB 2JWZA 2WP9B 1UGJA 3GS2A 4K7UA 4WIPA 4NZLB 3FILA 5HI1A 1XEEA 3X0WA 4WH4A 2M1MA 3PRPB 5J2RA 1EWYC 2LJ5A 3AXCA 1N61A 3RD2A 3B0AA 1RFAA 4PYUA 2IY1B 3QWZB 2J0MA 1GNUA 3A9KA 4G0NB 3GB1A 2LVPA 3Q8EA 4TSSA 3DOWA 4YT0B 3NY5A 3PHWB 3ZDTA 4G3XB 1VLBA 1RFKA 1R4NB 2KMCA 3A4SC 3DQVA 4US8A 2UU7A 2G3QB 4KZ0A 4M00A 4NJ7A 1WXMA 3NRZA 2PKOA 5AUKA 1KTKA 2NS5A 4CYEA 3IT6B 3ZKJC 3PSEB 2FCQA 3M95A 3UI3A 2KT7A 3AE9B 1N5WA 2KO3A 3EUB2 3E56A 2LGIA 3P4RB 1I4RA 4R3DA 4PYZA 4RCOA 3VH4B 1J7AA 4TMAB 3R7RA 1LFDA 2NMQA 2LD9A 4EFOA 1FNVA 2NBWB 1NBFC 3TIXA 2V9HA 5E6JA 2ZPYA 1ZDVA 4MJSB 1H4RA 5HG2A 5BMHA 2MJDA 2I38A 4X57B 2QJLA 2UYZB 2ZVNA 4RMAA 1C4PA 2L0FA 3M63B 2L8JA 2PPHA 1YNTE 5BYQA 1D5XC 3NVVA 2FCNA 1F52A 3AEEB 3BYTB 2CHXA 3QC8B 3WIMA 3BWUD 3R2IA 2KXJA 2EELA 4NPNA 5AUIA 2LXCA 2NCNA 5BO4B 1OQQA 4E3CA 5LLIA 1WJNA 2Y5BB 3Q6BA 2DX5B 1V86A 2XEWA 2X38A 1TS5A 4FJYA 4WWMA 2LZ6A 1E7PB 1Y56A 2Y5PA 3B2GA 3PREA 1I4HA 2QHOA 1ZP0B 3SEBA 5BYSA 1HA5A 3BVZA 1KM7A 3A9JB 1Y8RC 3EA6A 2VH1A 3U2SC 4F8CB 3CIRB 4HLEA 1V9JA 1WJUA 2KTFA 2LI5A 1VJKA 4ACFA 3KYDD 3PZ8A 2WXKA 1WH3A 3OJ4B 4JL9A 2R2OA 3BVMA 1T6BX 1SE4A 3OG5A 5IP4D 1N6ZA 1L0XB 1F2RC 2ZW1A 4ANUA 2JF5A 3HRDD 3ZJTA 2KDMA 2WXIA 3ZTCA 1BXTA 3BK1A 4RGTA 3U8ZA 3NHEB 2JVCA 1ESFA 2KDEB 2ZEQA 3N20C 4JGHB 1PGXA 3T9LA 2V4LA 3UQAA 3RNCC 2QILA 3RNEC 1IUEA 1SE2A 1UUPA 3NG0A 4GB9A 3URYA 2L76A 1QOBA 2CHZA 1Z5SB 3JSVB 4ASWC 2RMMA 2GBRA 5GXGB 1TKEA 3M62B 1XLQA 4WAAA 4L2YA 1YQBA 3W1SC 2KX0A 4B0MA 5C1ZA 3H6NA 2A4ZA 4NJ6A 2HDEA 1IPGA 2MWSB 2DAFA 4GMVA 3KYCD 1PQSA 5D3DA 3ML9A 2GLSA 4W9IA 2L32A 2NBUA 4DK5A 3QQ8B 3OLMD 2IO1B 2N7EA 1S3SG 3A1QA 3AEBB 4MJSA 1E8ZA 3RPFC 2PJHA 4RH6A 2MBEA 2D3GA 1WGHA 1OQRA 2EMSA 2BW2A 3OAWA 3CWIA 2W82A 4OVUA 1EWCA 3MP9A 4RM8A 2LHEA 4LLGM 2TSSA 4LNKA 4BFRA 1YOVB 2K1FA 1D3ZA 2J7QB 1IGCA 3N1YC 4PS3A 1L6UA 3V6CB 2GBNA 1V5TA 4ARCA 3AMZA 3W9CB 4ICVA 1ZW7A 4FA6A 4II2B 3HVDA 1AARA 3VVWB 2FUG1 4C7YA 4O1NA 2CU1A 2KFKB 1GPXA 2NVUI 1D5ZC 4BBNC 3EFUA 4MGYE 1OQYA 2O6VB 2ZNVC 1I4GA 1C4AA 2K39A 4GU2A 4L1BA 1SJED 1I4QA 3MJ5A 5CHVC 2I1KA 3A9JA 4IM2A 4IWPA 4BZAA 1XCTL 4JX1C 1FPYA 4JWSC 3RZWC 1SSNA 2K22A 1WRDB 5J17A 3N32A 1SJHD 2M4NA 4W9EA 1B9RA 1PGAA 1ZE3D 2QCZA 4XGAB 2D3CA 4MGIE 1L2NA 1YN3A 1TIFA 5HKHA 5C3JB 2LUEA 1LXDA 3O65B 2AQ3B 4DXGA 2KNBA 3RI7C 3E9SA 1F1HA 1YX5B 2NPTB 3HK0A 2QC8A 4AWJA 1XD3B 2X8XX 1KFYB 3TEWA 1VD2A 1WX9A 2AWTA 4HEA1 1T0YA 3AE8B 1ET9A 2J52A 3JSVA 1E7VA 1UNSA 4LJOB 4D2KA 4ZRKA 1NYQA 5CHFA 5C2TB 5D2MB 2KX3A 3UINB 2HE7A 4DHJD 2N9EB 4XX5A 3WCQA 1GB4A 2JZPA 5IKCM 1VRAB 1L4ZB 1QT9A 2CJNA 5C23A 2WXMA 2IGGA 2LUMA 3NUHB 4M02A 3PS6A 2WXJA 1FEHA 1V8CA 3ZYYX 2DYOA 3ABVB 2N0SB 4IWQA 4JLCA 3ZNZB 2BBCA 1EM7A 4C56C 3ENEA 2WDRB 4KDIC 4HDOA 2Y5CA 4P7IA 1CJEA 1TKYA 5D94A 2K8HA 2JRIB 1ZKHA 1N5XA 2C7MB 2IBIB 3VUWA 4MDKE 2CHWA 4ZRPA 4GGQA 2V1YA 3FC4A 2BGFA 3LXFA 3DVGX 4W9JA 3VFKA 1P7EA 1TZOA 3P4PB 2IO3B 3V60A 3Q69A 2LGXA 2J4XA 1CZPA 4DQOC 1VZ6A 2KQ7A 4WWNA 3ZVVA 3AM9A 3ZLZA 3TUOA 1JW9D 2N9KA 3U4EG 3W5UB 5AEKB 3DWMA 2W3SA 4FLHA 2JZ3B 4OZCA 2BWES 5EDSA 1UBQA 2KFKA 2WS3B 3ECIA 5FR6A 3QARA 3VTUA 3L16A 2WWZA 1N63A 1V1PB 1NI2A 1HZ5A 3Q8BA 2O6VA 3DHGC 4A9AA 2NR2A 2WDTB 4HWIB 3V62A 4G50A 2MQJA 2QMTA 2REXA 1RM6C 1SEBD 3ONSA 3M3JA 2CR5A 2LVOA 3LDZE 1Q5WB 3GP7A 4KV2A 5BMIA 4W9CA 3APDA 1JWUD 3ZTDA 1SE9A 5JZEB 3B1LX 3IHPC 2JXTA 4CO7A 4HVBA 1SGHA 2KDBA 3QHTA 3AU5A 4N9F4 1FM0D 4URKA 2DENB 3W1YA 3KQ4A 2IO2B 4UDUC 2WGSA 3JW0X 3I9V1 2N9LA 2JSVX 2DAJA 4DHZE 2GBMA 3GE3C 1XXGA 2OJWA 5DPTA 1TKGA 2BS2B 4C00A 2K6QA 4KKJA 4DWFA 4ZYNA 3KUZA 2FCMA 2JUOA 4LDTB 2INPE 3IXSA 4WJPA 3V6EB 1WIAA 2DLBA 2N4FA 3SDLC 2E6XA 2H88B 3C0RB 1LM8B 1E8YA 1G6JA 1XLNA 2PTLA 1RLFA 2L83A 4OZAA 3DBSA 2JU6X 2WXLA 1IBXB 4GN1A 5IA7A 3MHZA 3MJWA 2WX1A 2V4IB 2DZMA 3ZO5B 3ZUNA 1GC7A 5DPSA 3HHMA 1Z2MA 3N9YC 4BOSC 2D5GA 4M01A 3U7DA 4LJPB 3ZGZA 2RDBC 1WZ3A 2LVQA 1T0RC 4G11A 3NS8A 4YTMB 2MHJA 5JXVA 4GOCA 2MRPA 4YSXB 3GE8C 1MI0A 1V6EA 4C4VB 5CTRC 2JXXA 3L10B 1D6EC 1VZ8A 2DYBA 1SB3C 4N6EB 1EF5A 1OEYJ 3Q2AC 1UBIA 2DZKA 2QIEB 4GDLB 2C9WB 4HRSA 4WWPA 1D4BA 2GBJA 3BYYB 1MHHE 3P4QB 1TT5B 1WXSA 2QSDA 3TL5A 4NAMA 1FNWA 2INCC 1UZXB 4TUUA 4US9A 3IT4B 3CF6E 2KN5A 4ITKA 1HE8A 1QOAA 1RRBA 2LRUA 1MHXA 3WA0A 3AECB 2HD5B 2NTSA 3Q3NC 2WNMA 4AS1A 1KLVA 4LNIA 1V1PA 4KIKB 3FKYA 1IYFA 1WGDA 1TJEA 2INNE 2ON8A 2GRIA 2GB1A 5KHQA 2WDQB 2WQYB 4XDDA 1U4AA 1Q0WB 4YTNB 1DOIA 2FBWB 1L0VB 2L00B 5TR5A 3VTVA 1DOXA 1K8RB 3RMKC 2FE8A 2AQ2B 2G4DB 1UELA 4S0RA 3VQIA 5HHDG 3AEAB 2IO0B 4JIOU 4NQLB 4NNJB 2BS4B 2JYTA 2O2VB 3W2DA 1GC6A 2KWUB 3IVFA 2BKFA 4W9KA 3UGBB 2PLPA 4BAXA 5FR3A 3BK2A 3ZJUA 2EMTA 4LK0M 1FFVA 4KX6B 1C78A 2KDIA 4F7ZA 3HVZA 1HTQA 1TY0A 5D6JB 2V3SA 1E0ZA 3TCAA 4II3B 2LGSA 1N62A 5DPWA 2WHIA 2DHZA 4DHJB 4BVUC 2KC2A 2ZW0A 3H1UA 1K51A 3PVLA 2N1VA 1IBXA 4EZJA 3R3MA 4WJQA 4M8MA 4AUQC 1BMLC 2KQ4X 3VUXA 1C76A 2WXGA 3MFGA 2PMVA 1UD7A 5BYRA 1JROA 1HXYD 4RGNA 2XNAC 4W9DA 1FNUA 4JWUC 1QF6A 1M4VA 4YWGG 4WQOB 2HTME 1NYRA 4TQ1A 4ANWA 3RULA 3MC8A 4RFBA 2YEPB 3SU8X 2YLMA 2KZRA 4LDTD 4ICUA 5G5GA 3QJZA 4C4VA 1WXVA 4IWOA 1S1QB 4FJVB 2KC1A 3VRBB 4GDLA 3BZDB 1YQ3B 2KJ6A 5CX3A 4ZHPA 1YN5A 5DCNA 4TV3A 2RD0A 2MJ3A 1ZUD2 2KACA 1OEYA 2GBKA 1F9JA 2BS3B 2N9PC 1PGBA 3MC0B 4KZCA 3WALA 4WQMA 5G55A 4A6QA 3RNGC 2JZZA 4N59A 4KGTA 1WFYA 2Z0EB 2WU2B 3EGRA 2VZKB 4HJKA 5IAAC 2KOXA 4DBGA 2K8BA 3V3XA 1EUVB 2E3TA 2FIFA 2Z0DB 3T3OA 1XT9B 3WAPA 1UF0A 3UF8A 2MEKA 4FHJA 3KWVA 4HCNB 2H89B 1WGRA 4W9HA 5I4DA 3AI5A 2KTRB 1V49A 4YTPB 5G5HA 3AE5B 5EE3A 1V5OA 3CSTA 2L3ZA 4E71A 2D11A 4H2AA 1XF5L 1P7FA 2G45B 3ZNHB 2FNJB 1TBEA 4HKQA 2AEHA 4DHZB 1WZ0A 3L13A 1E6EB 4M0WB 3PV1A 2GMIC 2K25A 2K8CA 2C7NB 2O2VA 1XLPA 1LGRA 1OGWA 2KN4A 3VXWA 1ZOYB 1E7UA 4FXCA 3DVNU 4KGRA 2L7RA 1YJJA 3ALBA 3U7ZA 3R66C 4C80A 2KFJA 4WAFA 1A5RA 3ZRCA 2ZNVB 1P98A 1TTNA 2G4SA 3TBLD 2BTEA 4ZOHC 1C79A 1WY8A 2FAZA 1WE7A 2OHFA 1H8CA 1QLBB 5IO9A 3PO0A 4ARIA 3AN1A 2IGDA 2RPQA 4NY0A 2K0PA 1FD6A 2VH2A 2KHWB 1J0GA 3SHQA 3B08A 1ZXHA 1ZXIA 1L5PA 4RF0A 2YVCA 2R2QA 1WF9A 3APFA 4NAWB 1WWTA 2LWPA 3JYUA 3MC9A 3K9PB 3AULA 2N1WA 3V61A 3AE1B 4TKNA 3UIOB 2LMCA 4MACA 3PHXB 2BT6A 1NEKB 1K53A 1QZEA 3Q3OC 2MBQA 4I6LB 1PDXA 4LNFA 2KWVB 5JH5C 4IM0A 3U30A 5TSSA 3RZFA 5FK9C 1WM2A 1YD8U 3L0WB 4LCDE 2IPKD 1JQ4A 1WXQA 3DCGA 1WJ6A 3H9DA 1P3QU 1L4DB 3U52E 1HZ6A 3Q8CA 1K52A 2D3BA 2VRRB 2W3RA 3FILB 3PZ7A 1FRDA 2WXHA 1L0YB 2LASA 1DYQA 3AH7A 4TQ0A 1JWBD 4GSWA 4B95A 3WAMA 4HPLB 2BF8B 4BKSD 2LRWA 3HIZA 1OFFA 4MM3B 4DXFA 2BYVE 4REZA 2KYWA 4L23A 3RN9C 3RUIB 2RDGA 1QOGA 2ZJDA 3VRAB 1EU4A 1PYWD 3H7PB 4K7SA 3AB5A 5IOIA 1LQBA 4AJYB 2KTRA 3Q3JA 4K81A 2ICIA 4J6IA 2IGHA 5H8YE 5GMVA 1QOFA 3BINA 3A33B 3Q14C 1QQRA 3L4PA 2J53A 1YIWA 1WMHB 3NZSA 3TMPB 1MG4A 1D5MC 1C77A 3RFZB 3DBHI 4M0WA 2K5PA 4HROA 5EE9A 2VZKD 3UQBA 2V3NA 3APCA 3S2AA 1FXTB 2JYEA 1AN8A 2J0KA 2W54A 1C9FA 2Y3AA 2PW9A 1LO5D 5D7GA 1K50A 2AX5A 5EE0A 4XE0A 2BB5A 5BMGA 1M94A 2IDYA 2MBBB 2OJRA 2W55A 3EHVA 4EZLA 1J8CA 1JRPA 4A90A 1WX8A 1FMAD 3DBLI 2YEPF 3PTFC 4PT5A 2D2QA 2XN9C 4QAYA 4FULA 3N3KB 4W9GA 1P9DU 2KD0A 3TSSA 3L08A 4HCPB 2DWQA 4OVVA 1HEZE 1SBBB 2MH7A 2LHDA 5H92C 3LJ3A 2PVOD 1KJTA 2K6DB 4XDCA 1A70A 3LYYA 3P4SB 5HFYA 4EKUA 4P1CC 1KLUD 3I63C 2FUHB 3J9CA 1FCLA 4FJZA 4KSKC 4NAWA 4NJCA 2JRHA 2LGDA 2NPTA 3T3NA 3AV8A 1RAXA 1R4NI 1UWMA 2MSED 1UGMA 4AOFA 3AEGB 4A55A 4YSZB 4XWWA 2MJEA 5JHAA 4GXBA
chains in the Genus database with same CATH topology
3QAQA 1V80A 5L95C 1WGHA 2IO0B 4JIOU 4NQLB 4NNJB 3ML8A 2AL6A 2EMSA 3OAWA 2MA9B 2O2VB 1ZGUB 2IZVB 5AZGA 1GC6A 1E8WA 2KWUB 2MW5A 2L0TA 2BKFA 3A9KB 3IVFA 4OVUA 3HM6X 4DDGD 4YL8A 4RM8A 4W9KA 1BT0A 1WGGA 1WR6E 3K9OB 3UGBB 3UIPB 2KLGA 1E8XA 4M8NA 1J19A 5J18A 2EMTA 3PPAA 2W9NA 3ZNID 4BFRA 2K1FA 1D3ZA 5LXIB 3KH0A 2J7QB 4PS3A 1CMXB 1P0RA 2A5UA 3V6CB 1IP9A 2DZJA 2M17A 1E5WA 2GBNA 2KDIA 5AZHA 4F7ZA 5D6JB 1V5TA 2V3SA 2FIDA 3TCAA 4FHKA 2BYEA 4II3B 4ICVA 1ZW7A 4GIVA 4WJNA 3BY4B 4FA6A 4II2B 1I42A 2OOBB 1AARA 5DPWA 3VVWB 3JVZX 2DHZA 2CU1A 2KFKB 2N9XA 3KUCB 2MX2A 4DHJB 4BVUC 2KC2A 3H1UA 2NVUI 4BBNC 3PVLA 4MM3A 3EFUA 4MGYE 5DPRA 3ZIMA 2CS4A 2N1VA 2WYQA 3VTWA 1NDDA 2MLBA 3R3MA 2EKEC 1OQYA 4WJQA 4EZJA 2O6VB 4JQWC 2NBVB 2ZNVC 4M8MA 4W9FA 4AUQC 2HTHA 2K39A 4BBNF 4GU2A 1TZ1A 4I6NB 3VUXA 4KDLB 4PS8A 5E6NA 1E90A 1UD7A 5CHVC 3H7PA 2KMAA 3I3TB 2KLCA 2Z59B 4W9DA 4EUTA 2I1KA 3P2BA 2MCNB 3A9JA 4IM2A 1SIFA 3QK0A 4AJWA 1L7YA 4IWPA 2ZCBA 4WQOB 3WANA 4A3PA 3GOEA 1WXAA 1C3TA 4TQ1A 4ANWA 3H7SA 4CHKA 3RULA 4MELA 1ISNA 3VUYA 3RZWC 3SU8X 2YLMA 2KZRA 1WRDB 2AL3A 4LDTD 3DPDA 2MBHA 4B9KA 4ICUA 1WMHA 5J17A 3QJZA 1VCBA 3VDZA 1V81A 1WXVA 3N32A 2M4NA 4W9EA 2CKHB 4IWOA 3TJPA 4FADA 1GUAB 1C1YB 3ZW3A 4MGIE 2ASQA 1S1QB 1L2NA 2MP2A 4B6WA 4PS7A 4FJVB 5HKHA 2KC1A 3QIJA 2LUEA 1LXDA 2LGYA 3O65B 3MHSD 4DDID 4ZRIA 3A4RA 2C7HA 2KNBA 4GDLA 3NZUA 2KJ6A 5CX3A 3PRMB 1YX5B 2NPTB 3HK0A 4TV3A 2RD0A 5DCNA 4AWJA 1XD3B 3A1QB 1OEYA 3VHTC 4DXAB 5AZFA 2GBKA 4EOYA 3AU4A 1VD2A 1WGYA 1WX9A 2AYOB 1F9JA 1WJ4A 2AWTA 2N9PC 2UWQA 4KZCA 4AP4C 3WALA 1T0YA 2BKRB 5G55A 2C60A 2PEAA 3JSVA 3QA8A 4NQKE 1E7VA 2HJ8A 4LJOB 2JZZA 4ZRKA 2J0JA 1KOTA 5CHFA 3VH3B 2B3AA 2JT4B 5D2MB 1WFYA 2KX3A 3UINB 2Z0EB 4BOZB 2HE7A 4HJKA 2M8SA 5IAAC 2N9EB 4DHJD 2KOXA 4XX5A 4DBGA 2DZIA 2K8BA 1EUVB 2Z0DB 2FIFA 1XT9B 3PLVA 3WAPA 5C23A 2O6VD 2KJHB 5E6PA 3UF8A 2IY0B 4EEWA 4HXDA 4FHJA 4HCNB 5E6OA 2ZCCA 2BYFA 1WGRA 4W9HA 4W9LA 2IYDB 3PS6A 2XBBC 3AI5A 4FBJB 2JWZA 2KTRB 1V49A 4K7UA 1WX7A 2DYOA 1OTRB 4IWQA 3EC8A 1V5OA 3CSTA 3X23A 2L3ZA 2XK5B 4E71A 2D11A 4JLCA 3X0WA 2M1MA 1GG3A 3PRPB 4E74A 5J2RA 3ZNZB 2LJ5A 2G45B 3ZNHB 4ANVA 3AXCA 3ENEA 2FNJB 4MEMA 1MG8A 2D10A 1TBEA 4IUMB 4KDIC 3DBRI 4HDOA 2KK8A 2AEHA 3RD2A 4DHZB 3B0AA 4XC2A 1WZ0A 4P7IA 3L13A 4M0WB 1RFAA 3PV1A 4PYUA 2GMIC 5D94A 2K25A 4IW0A 2K8CA 2IY1B 2C7NB 1ZKHA 2JRIB 2C7MB 1GNUA 2J0MA 2K8HA 2O2VA 2IBIB 3A9KA 3VUWA 4MDKE 1OGWA 2CHWA 2KWCA 4G0NB 4ANXA 1WYWB 2V1YA 4GGQA 3VXWA 2BGFA 2LVPA 3DVGX 4W9JA 3VFKA 3DOWA 1E7UA 2IO3B 3DVNU 3V60A 2L7RA 3ALBA 3NY5A 2LGXA 3PHWB 3ZDTA 2D07B 3R66C 4G3XB 2KFJA 1A5RA 3ZRCA 2KQ7A 2MBOA 3Q3FA 2ZNVB 2C5LC 4WWNA 1TTNA 1P98A 2KMCA 3A4SC 3ZVVA 2G4SA 3DQVA 2KKCA 3TBLD 4KVGB 3ZLZA 2G3QB 1WY8A 4KZ0A 2FAZA 1WE7A 4NJ7A 3RT3B 1WXMA 1V2YA 3N30A 1H8CA 5AEKB 2NS5A 4FLHA 4CYEA 2JZ3B 4F1SA 4I6PA 3L54A 4ZDVA 2BWES 5EDSA 4MSQB 4WJOA 1UBQA 2KFKA 1UH6A 3ECIA 3PRZA 2RPQA 5FR6A 4NY0A 3PSEB 3ZKJC 1JRUA 2FCQA 3QARA 3SD5A 3M95A 3VTUA 3L16A 2WWZA 2KO3A 1NI2A 2KHWB 4RM9A 1J0GA 2KANA 2O6VA 3SHQA 3B08A 4BKTA 3DDCB 2YVCA 4PYZA 2R2QA 1YX6B 1WF9A 3APFA 2NR2A 2WDTB 4HWIB 2BPSA 4K7WA 3V62A 3VH4B 4NAWB 3R7RA 1LFDA 2LWPA 3JYUA 2LD9A 4EFOA 4G50A 2MQJA 2REXA 3AULA 3K9PB 3M3JA 3ONSA 2CR5A 3QCAA 2NBWB 3KUDB 2N1WA 1NBFC 5G2NA 3TIXA 4TKNA 3V61A 2LVOA 3UIOB 2I1JA 3LDZE 1Q5WB 4K1RB 2ZZPB 4KV2A 3PHXB 4MSMB 2ZPYA 4MJSB 4W9CA 2BWFA 1H4RA 5L83A 1QZEA 2GOWA 3APDA 3ZTDA 4GDKB 3PT2B 4MGZE 4X57B 1SE9A 3RYTA 2MBQA 5JZEB 2UYZB 2ZVNA 4I6LB 2LXAA 3B1LX 4RMAA 2L0FA 2KWVB 3IHPC 4IM0A 5JH5C 3M63B 3U30A 3RZFA 4CO7A 4HVBA 1SGHA 2L8JA 2PPHA 2KDBA 3GZNI 1WM2A 3AU5A 3QHTA 1X1MA 1YD8U 3L0WB 2FCNA 4LCDE 4N9F4 4URKA 2DENB 3W1YA 1XQQA 2IO2B 3DCGA 2CHXA 3JW0X 3CSFA 3QC8B 3WIMA 2DAJA 4DHZE 1WJ6A 2GBMA 1P3QU 3H9DA 2KQSA 1YJ1A 1I35A 2KXJA 4KIKA 2VRRB 5DPTA 3T8MA 4NPNA 2K6QA 2LXCA 5LXHA 2NCNA 5BO4B 4DWFA 4ZRJA 1EF1A 4ZYNA 3KUZA 1Q1OA 4E3CA 2FCMA 1WJNA 2LASA 5LLIA 3PLUA 2Y5BB 2JUOA 2RGFA 4LDTB 2DX5B 2ZVOA 4TQ0A 4WJPA 3V6EB 1WIAA 4GSWA 1V86A 2XEWA 4B95A 2N4FA 3SDLC 3WAMA 3IFWB 4HPLB 3VAWA 3C0RB 1LM8B 1E8YA 2L05A 1G6JA 2BF8B 3DVNV 3OJ3A 4KSLC 4BKSD 1RLFA 4FJYA 2LRWA 3HIZA 3DBSA 3KVFB 4MH0E 2FCSA 2LZ6A 4A3OA 2BYVE 3PREA 1GJZA 4GN1A 3D32A 5IA7A 2QHOA 2KDFB 3RUIB 5JHBA 3MJWA 2WX1A 2DZMA 3ZO5B 2ZJDA 3ZUNA 1GC7A 5DPSA 3H7PB 3HHMA 3L17A 4K7SA 1Z2MA 1KM7A 4BOSC 3U7DA 3A9JB 1LQBA 4LJPB 1EO6A 1Y8RC 2KJRA 1R4MI 3IG3A 4AJYB 2KTRA 4F8CB 4HDQA 3Q3JA 4IM3A 4K81A 4HLEA 1V9JA 1WJUA 1WZ3A 2KTFA 2LVQA 2LI5A 2PE9A 3NS8A 4G11A 4J6IA 5CHWA 2WX0A 5GMVA 3KYDD 2XK5A 3BINA 1WH3A 4IC7B 4GOCA 3HM3A 3OJ4B 2MRPA 3MTNB 3A33B 1YIWA 1WMHB 1WR1A 2R2OA 3NZSA 4JL9A 3TMPB 1V6EA 3ZRFA 5CTRC 2JXXA 3L10B 2DYBA 2PE6B 1TGZB 3EECA 4A20A 4ANUA 2JF5A 2MP2B 3DBHI 1EF5A 3ZTCA 1OEYJ 3UQBA 1UBIA 3APCA 3S2AA 1FXTB 2DZKA 3KW5B 3ZNGC 3U8ZA 3NHEB 4GDLB 5KHOA 2C9WB 2J0KA 4MGKE 2JVCA 4HK2A 4WWPA 2KDEB 2ZEQA 4JGHB 2GBJA 5D7GA 1WXSA 3T9LA 2V4LA 3UQAA 3TL5A 2RSUA 1UZXB 4TUUA 1M94A 2MBBB 3PGEA 2OJRA 3EHVA 3R7QA 1WI0A 4EZLA 3CF6E 4GB9A 1J8CA 1WX8A 2KN5A 3DBLI 2L76A 1HE8A 1WE6A 2CHZA 3PTFC 1RRBA 2LRUA 1Z5SB 2D2QA 3JSVB 1P1AA 4ASWC 4HPMB 3ZDMC 2GBRA 4FULA 3M62B 3WA0A 3PZDA 3DVGY 4WAAA 1WM3A 3N3KB 2HD5B 1YQBA 4W9GA 1P9DU 2KD0A 3W1SC 4BKSA 2KX0A 3L08A 4HCPB 3IBEA 3WAOA 3QX1A 4WWOA 4OVVA 2M0XA 1KLVA 5C1ZA 3H6NA 4KIKB 3LJ3A 2A4ZA 2RR9A 4NJ6A 1IYFA 1KJTA 1WGDA 2K6DB 2JPHA 1IPGA 4EKUA 2MWSB 3W1SA 2DAFA 2DYMA 2FUHB 4GMVA 3KYCD 5KHQA 4FJZA 4KSKC 4NAWA 1U4AA 1PQSA 1Q0WB 2ZPNA 3ML9A 2JRHA 2LGDA 2NPTA 3RCZA 4BKGA 4W9IA 2NBUA 4DK5A 1RAXA 1R4NI 3QQ8B 3OLMD 2IO1B 2N7EA 1S3SG 2L00B 3A1QA 5TR5A 2N7DA 3VTVA 3NOBA 2MSED 2KVRA 1UGMA 1K8RB 4AOFA 4MJSA 3CMMB 2JY6A 1E8ZA 4GDKA 2PJHA 2G4DB 2MBEA 2D3GA 1UELA 5JHAA 3QWZB 4IG7B 3VQIA 4FN2A 4EZKA 4XZ4A 4GXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QAQ A;  1V80 A;  5L95 C;  1WGH A;  2IO0 B;  4JIO U;  4NQL B;  4NNJ B;  3ML8 A;  2AL6 A;  2EMS A;  3OAW A;  2MA9 B;  2O2V B;  1ZGU B;  2IZV B;  5AZG A;  1GC6 A;  1E8W A;  2KWU B;  2MW5 A;  2L0T A;  2BKF A;  3A9K B;  3IVF A;  4OVU A;  3HM6 X;  4DDG D;  4YL8 A;  4RM8 A;  4W9K A;  1BT0 A;  1WGG A;  1WR6 E;  3K9O B;  3UGB B;  3UIP B;  2KLG A;  1E8X A;  4M8N A;  1J19 A;  5J18 A;  2EMT A;  3PPA A;  2W9N A;  3ZNI D;  4BFR A;  2K1F A;  1D3Z A;  5LXI B;  3KH0 A;  2J7Q B;  4PS3 A;  1CMX B;  1P0R A;  2A5U A;  3V6C B;  1IP9 A;  2DZJ A;  2M17 A;  1E5W A;  2GBN A;  2KDI A;  5AZH A;  4F7Z A;  5D6J B;  1V5T A;  2V3S A;  2FID A;  3TCA A;  4FHK A;  2BYE A;  4II3 B;  4ICV A;  1ZW7 A;  4GIV A;  4WJN A;  3BY4 B;  4FA6 A;  4II2 B;  1I42 A;  2OOB B;  1AAR A;  5DPW A;  3VVW B;  3JVZ X;  2DHZ A;  2CU1 A;  2KFK B;  2N9X A;  3KUC B;  2MX2 A;  4DHJ B;  4BVU C;  2KC2 A;  3H1U A;  2NVU I;  4BBN C;  3PVL A;  4MM3 A;  3EFU A;  4MGY E;  5DPR A;  3ZIM A;  2CS4 A;  2N1V A;  2WYQ A;  3VTW A;  1NDD A;  2MLB A;  3R3M A;  2EKE C;  1OQY A;  4WJQ A;  4EZJ A;  2O6V B;  4JQW C;  2NBV B;  2ZNV C;  4M8M A;  4W9F A;  4AUQ C;  2HTH A;  2K39 A;  4BBN F;  4GU2 A;  1TZ1 A;  4I6N B;  3VUX A;  4KDL B;  4PS8 A;  5E6N A;  1E90 A;  1UD7 A;  5CHV C;  3H7P A;  2KMA A;  3I3T B;  2KLC A;  2Z59 B;  4W9D A;  4EUT A;  2I1K A;  3P2B A;  2MCN B;  3A9J A;  4IM2 A;  1SIF A;  3QK0 A;  4AJW A;  1L7Y A;  4IWP A;  2ZCB A;  4WQO B;  3WAN A;  4A3P A;  3GOE A;  1WXA A;  1C3T A;  4TQ1 A;  4ANW A;  3H7S A;  4CHK A;  3RUL A;  4MEL A;  1ISN A;  3VUY A;  3RZW C;  3SU8 X;  2YLM A;  2KZR A;  1WRD B;  2AL3 A;  4LDT D;  3DPD A;  2MBH A;  4B9K A;  4ICU A;  1WMH A;  5J17 A;  3QJZ A;  1VCB A;  3VDZ A;  1V81 A;  1WXV A;  3N32 A;  2M4N A;  4W9E A;  2CKH B;  4IWO A;  3TJP A;  4FAD A;  1GUA B;  1C1Y B;  3ZW3 A;  4MGI E;  2ASQ A;  1S1Q B;  1L2N A;  2MP2 A;  4B6W A;  4PS7 A;  4FJV B;  5HKH A;  2KC1 A;  3QIJ A;  2LUE A;  1LXD A;  2LGY A;  3O65 B;  3MHS D;  4DDI D;  4ZRI A;  3A4R A;  2C7H A;  2KNB A;  4GDL A;  3NZU A;  2KJ6 A;  5CX3 A;  3PRM B;  1YX5 B;  2NPT B;  3HK0 A;  4TV3 A;  2RD0 A;  5DCN A;  4AWJ A;  1XD3 B;  3A1Q B;  1OEY A;  3VHT C;  4DXA B;  5AZF A;  2GBK A;  4EOY A;  3AU4 A;  1VD2 A;  1WGY A;  1WX9 A;  2AYO B;  1F9J A;  1WJ4 A;  2AWT A;  2N9P C;  2UWQ A;  4KZC A;  4AP4 C;  3WAL A;  1T0Y A;  2BKR B;  5G55 A;  2C60 A;  2PEA A;  3JSV A;  3QA8 A;  4NQK E;  1E7V A;  2HJ8 A;  4LJO B;  2JZZ A;  4ZRK A;  2J0J A;  1KOT A;  5CHF A;  3VH3 B;  2B3A A;  2JT4 B;  5D2M B;  1WFY A;  2KX3 A;  3UIN B;  2Z0E B;  4BOZ B;  2HE7 A;  4HJK A;  2M8S A;  5IAA C;  2N9E B;  4DHJ D;  2KOX A;  4XX5 A;  4DBG A;  2DZI A;  2K8B A;  1EUV B;  2Z0D B;  2FIF A;  1XT9 B;  3PLV A;  3WAP A;  5C23 A;  2O6V D;  2KJH B;  5E6P A;  3UF8 A;  2IY0 B;  4EEW A;  4HXD A;  4FHJ A;  4HCN B;  5E6O A;  2ZCC A;  2BYF A;  1WGR A;  4W9H A;  4W9L A;  2IYD B;  3PS6 A;  2XBB C;  3AI5 A;  4FBJ B;  2JWZ A;  2KTR B;  1V49 A;  4K7U A;  1WX7 A;  2DYO A;  1OTR B;  4IWQ A;  3EC8 A;  1V5O A;  3CST A;  3X23 A;  2L3Z A;  2XK5 B;  4E71 A;  2D11 A;  4JLC A;  3X0W A;  2M1M A;  1GG3 A;  3PRP B;  4E74 A;  5J2R A;  3ZNZ B;  2LJ5 A;  2G45 B;  3ZNH B;  4ANV A;  3AXC A;  3ENE A;  2FNJ B;  4MEM A;  1MG8 A;  2D10 A;  1TBE A;  4IUM B;  4KDI C;  3DBR I;  4HDO A;  2KK8 A;  2AEH A;  3RD2 A;  4DHZ B;  3B0A A;  4XC2 A;  1WZ0 A;  4P7I A;  3L13 A;  4M0W B;  1RFA A;  3PV1 A;  4PYU A;  2GMI C;  5D94 A;  2K25 A;  4IW0 A;  2K8C A;  2IY1 B;  2C7N B;  1ZKH A;  2JRI B;  2C7M B;  1GNU A;  2J0M A;  2K8H A;  2O2V A;  2IBI B;  3A9K A;  3VUW A;  4MDK E;  1OGW A;  2CHW A;  2KWC A;  4G0N B;  4ANX A;  1WYW B;  2V1Y A;  4GGQ A;  3VXW A;  2BGF A;  2LVP A;  3DVG X;  4W9J A;  3VFK A;  3DOW A;  1E7U A;  2IO3 B;  3DVN U;  3V60 A;  2L7R A;  3ALB A;  3NY5 A;  2LGX A;  3PHW B;  3ZDT A;  2D07 B;  3R66 C;  4G3X B;  2KFJ A;  1A5R A;  3ZRC A;  2KQ7 A;  2MBO A;  3Q3F A;  2ZNV B;  2C5L C;  4WWN A;  1TTN A;  1P98 A;  2KMC A;  3A4S C;  3ZVV A;  2G4S A;  3DQV A;  2KKC A;  3TBL D;  4KVG B;  3ZLZ A;  2G3Q B;  1WY8 A;  4KZ0 A;  2FAZ A;  1WE7 A;  4NJ7 A;  3RT3 B;  1WXM A;  1V2Y A;  3N30 A;  1H8C A;  5AEK B;  2NS5 A;  4FLH A;  4CYE A;  2JZ3 B;  4F1S A;  4I6P A;  3L54 A;  4ZDV A;  2BWE S;  5EDS A;  4MSQ B;  4WJO A;  1UBQ A;  2KFK A;  1UH6 A;  3ECI A;  3PRZ A;  2RPQ A;  5FR6 A;  4NY0 A;  3PSE B;  3ZKJ C;  1JRU A;  2FCQ A;  3QAR A;  3SD5 A;  3M95 A;  3VTU A;  3L16 A;  2WWZ A;  2KO3 A;  1NI2 A;  2KHW B;  4RM9 A;  1J0G A;  2KAN A;  2O6V A;  3SHQ A;  3B08 A;  4BKT A;  3DDC B;  2YVC A;  4PYZ A;  2R2Q A;  1YX6 B;  1WF9 A;  3APF A;  2NR2 A;  2WDT B;  4HWI B;  2BPS A;  4K7W A;  3V62 A;  3VH4 B;  4NAW B;  3R7R A;  1LFD A;  2LWP A;  3JYU A;  2LD9 A;  4EFO A;  4G50 A;  2MQJ A;  2REX A;  3AUL A;  3K9P B;  3M3J A;  3ONS A;  2CR5 A;  3QCA A;  2NBW B;  3KUD B;  2N1W A;  1NBF C;  5G2N A;  3TIX A;  4TKN A;  3V61 A;  2LVO A;  3UIO B;  2I1J A;  3LDZ E;  1Q5W B;  4K1R B;  2ZZP B;  4KV2 A;  3PHX B;  4MSM B;  2ZPY A;  4MJS B;  4W9C A;  2BWF A;  1H4R A;  5L83 A;  1QZE A;  2GOW A;  3APD A;  3ZTD A;  4GDK B;  3PT2 B;  4MGZ E;  4X57 B;  1SE9 A;  3RYT A;  2MBQ A;  5JZE B;  2UYZ B;  2ZVN A;  4I6L B;  2LXA A;  3B1L X;  4RMA A;  2L0F A;  2KWV B;  3IHP C;  4IM0 A;  5JH5 C;  3M63 B;  3U30 A;  3RZF A;  4CO7 A;  4HVB A;  1SGH A;  2L8J A;  2PPH A;  2KDB A;  3GZN I;  1WM2 A;  3AU5 A;  3QHT A;  1X1M A;  1YD8 U;  3L0W B;  2FCN A;  4LCD E;  4N9F 4;  4URK A;  2DEN B;  3W1Y A;  1XQQ A;  2IO2 B;  3DCG A;  2CHX A;  3JW0 X;  3CSF A;  3QC8 B;  3WIM A;  2DAJ A;  4DHZ E;  1WJ6 A;  2GBM A;  1P3Q U;  3H9D A;  2KQS A;  1YJ1 A;  1I35 A;  2KXJ A;  4KIK A;  2VRR B;  5DPT A;  3T8M A;  4NPN A;  2K6Q A;  2LXC A;  5LXH A;  2NCN A;  5BO4 B;  4DWF A;  4ZRJ A;  1EF1 A;  4ZYN A;  3KUZ A;  1Q1O A;  4E3C A;  2FCM A;  1WJN A;  2LAS A;  5LLI A;  3PLU A;  2Y5B B;  2JUO A;  2RGF A;  4LDT B;  2DX5 B;  2ZVO A;  4TQ0 A;  4WJP A;  3V6E B;  1WIA A;  4GSW A;  1V86 A;  2XEW A;  4B95 A;  2N4F A;  3SDL C;  3WAM A;  3IFW B;  4HPL B;  3VAW A;  3C0R B;  1LM8 B;  1E8Y A;  2L05 A;  1G6J A;  2BF8 B;  3DVN V;  3OJ3 A;  4KSL C;  4BKS D;  1RLF A;  4FJY A;  2LRW A;  3HIZ A;  3DBS A;  3KVF B;  4MH0 E;  2FCS A;  2LZ6 A;  4A3O A;  2BYV E;  3PRE A;  1GJZ A;  4GN1 A;  3D32 A;  5IA7 A;  2QHO A;  2KDF B;  3RUI B;  5JHB A;  3MJW A;  2WX1 A;  2DZM A;  3ZO5 B;  2ZJD A;  3ZUN A;  1GC7 A;  5DPS A;  3H7P B;  3HHM A;  3L17 A;  4K7S A;  1Z2M A;  1KM7 A;  4BOS C;  3U7D A;  3A9J B;  1LQB A;  4LJP B;  1EO6 A;  1Y8R C;  2KJR A;  1R4M I;  3IG3 A;  4AJY B;  2KTR A;  4F8C B;  4HDQ A;  3Q3J A;  4IM3 A;  4K81 A;  4HLE A;  1V9J A;  1WJU A;  1WZ3 A;  2KTF A;  2LVQ A;  2LI5 A;  2PE9 A;  3NS8 A;  4G11 A;  4J6I A;  5CHW A;  2WX0 A;  5GMV A;  3KYD D;  2XK5 A;  3BIN A;  1WH3 A;  4IC7 B;  4GOC A;  3HM3 A;  3OJ4 B;  2MRP A;  3MTN B;  3A33 B;  1YIW A;  1WMH B;  1WR1 A;  2R2O A;  3NZS A;  4JL9 A;  3TMP B;  1V6E A;  3ZRF A;  5CTR C;  2JXX A;  3L10 B;  2DYB A;  2PE6 B;  1TGZ B;  3EEC A;  4A20 A;  4ANU A;  2JF5 A;  2MP2 B;  3DBH I;  1EF5 A;  3ZTC A;  1OEY J;  3UQB A;  1UBI A;  3APC A;  3S2A A;  1FXT B;  2DZK A;  3KW5 B;  3ZNG C;  3U8Z A;  3NHE B;  4GDL B;  5KHO A;  2C9W B;  2J0K A;  4MGK E;  2JVC A;  4HK2 A;  4WWP A;  2KDE B;  2ZEQ A;  4JGH B;  2GBJ A;  5D7G A;  1WXS A;  3T9L A;  2V4L A;  3UQA A;  3TL5 A;  2RSU A;  1UZX B;  4TUU A;  1M94 A;  2MBB B;  3PGE A;  2OJR A;  3EHV A;  3R7Q A;  1WI0 A;  4EZL A;  3CF6 E;  4GB9 A;  1J8C A;  1WX8 A;  2KN5 A;  3DBL I;  2L76 A;  1HE8 A;  1WE6 A;  2CHZ A;  3PTF C;  1RRB A;  2LRU A;  1Z5S B;  2D2Q A;  3JSV B;  1P1A A;  4ASW C;  4HPM B;  3ZDM C;  2GBR A;  4FUL A;  3M62 B;  3WA0 A;  3PZD A;  3DVG Y;  4WAA A;  1WM3 A;  3N3K B;  2HD5 B;  1YQB A;  4W9G A;  1P9D U;  2KD0 A;  3W1S C;  4BKS A;  2KX0 A;  3L08 A;  4HCP B;  3IBE A;  3WAO A;  3QX1 A;  4WWO A;  4OVV A;  2M0X A;  1KLV A;  5C1Z A;  3H6N A;  4KIK B;  3LJ3 A;  2A4Z A;  2RR9 A;  4NJ6 A;  1IYF A;  1KJT A;  1WGD A;  2K6D B;  2JPH A;  1IPG A;  4EKU A;  2MWS B;  3W1S A;  2DAF A;  2DYM A;  2FUH B;  4GMV A;  3KYC D;  5KHQ A;  4FJZ A;  4KSK C;  4NAW A;  1U4A A;  1PQS A;  1Q0W B;  2ZPN A;  3ML9 A;  2JRH A;  2LGD A;  2NPT A;  3RCZ A;  4BKG A;  4W9I A;  2NBU A;  4DK5 A;  1RAX A;  1R4N I;  3QQ8 B;  3OLM D;  2IO1 B;  2N7E A;  1S3S G;  2L00 B;  3A1Q A;  5TR5 A;  2N7D A;  3VTV A;  3NOB A;  2MSE D;  2KVR A;  1UGM A;  1K8R B;  4AOF A;  4MJS A;  3CMM B;  2JY6 A;  1E8Z A;  4GDK A;  2PJH A;  2G4D B;  2MBE A;  2D3G A;  1UEL A;  5JHA A;  3QWZ B;  4IG7 B;  3VQI A;  4FN2 A;  4EZK A;  4XZ4 A;  4GXB A; 
#chains in the Genus database with same CATH topology
 1V80 A;  5L95 C;  3EFC A;  2JX5 A;  2AL6 A;  2WXO A;  1SF0 A;  2MA9 B;  4PK1 A;  3HM6 X;  1BT0 A;  1WGG A;  3K9O B;  3UIP B;  1E8X A;  1ZPS A;  5J18 A;  3DBL B;  3ZNI D;  2M56 B;  1DOY A;  5LXI B;  1E10 A;  1CMX B;  1IP9 A;  2FID A;  3I57 A;  4J3O D;  4GIV A;  3BY4 B;  2OOB B;  3P42 A;  3BVG A;  4HPP A;  2N9X A;  4JE3 B;  2QDF A;  1XO3 A;  1C4C A;  4MM3 A;  3TEY A;  2CS4 A;  2WYQ A;  2MLB A;  2EKE C;  4JQW C;  2NBV B;  4W9F A;  3NZ3 A;  2HTH A;  4BBN F;  3AE4 B;  3ETR A;  4I6N B;  4PS8 A;  1AYF A;  5E6N A;  1E90 A;  1L6V A;  1T3Q A;  3H7P A;  3I3T B;  2KLC A;  2Z59 B;  1SIF A;  3QK0 A;  1CQV A;  1L7Y A;  3SFD B;  3WAN A;  4RGO S;  4A3P A;  3GOE A;  4K3C A;  1WXA A;  4MEL A;  3VUY A;  4AQ7 A;  1ZDX A;  2AL3 A;  2OED A;  3DPD A;  4B9K A;  3SR6 A;  1WMH A;  4MT5 A;  3VDZ A;  1V81 A;  2CKH B;  4JPS A;  3TJP A;  4FAD A;  1GUA B;  1C1Y B;  2ASQ A;  4PS7 A;  2LJI A;  1F77 A;  1VZ7 A;  4DDI D;  4ZRI A;  3A4R A;  1JCK B;  1YJI A;  3PRM B;  3AE6 B;  3A1Q B;  4EOY A;  2AYO B;  1WGY A;  1FXI A;  2SAK A;  2I2Y A;  1F2R I;  3W5V B;  3ZQ4 A;  2PEA A;  3QA8 A;  4OW0 A;  1GB1 A;  2JT4 B;  1FCC C;  1FFU A;  3R2T A;  5IN7 A;  2K3U A;  4K3B A;  1KRH A;  2V0G A;  2DNF A;  2Z8L A;  5E6P A;  3FAH A;  4EEW A;  2ZCC A;  1IGD A;  3B2F A;  2IYD B;  2J42 A;  4ZYS A;  1I7H A;  1WX7 A;  4MH8 A;  1OTR B;  3EC8 A;  3X23 A;  2XK5 B;  3N1X C;  3C8Y A;  1GG3 A;  4E74 A;  4IKG A;  1I4X A;  4ANV A;  4MEM A;  1MG8 A;  2D10 A;  3NJT A;  1J7C A;  4IUM B;  4ZHO A;  3DBR I;  2KK8 A;  1CK1 A;  2RDH A;  4XC2 A;  1R7S A;  4IW0 A;  2ACZ B;  3RNB C;  3AE2 B;  1J7B A;  2KWC A;  3DHI C;  4ANX A;  3P63 A;  1WYW B;  2AQ1 B;  2D07 B;  1ENF A;  1I4P A;  1T5X D;  2MBO A;  3Q3F A;  4HKZ E;  1FIQ A;  2C5L C;  1WRI A;  2KKC A;  2IJ0 A;  4KVG B;  5LNK 1;  1EU3 A;  4XYC A;  3DHH C;  3RT3 B;  1V2Y A;  3N30 A;  1KF6 B;  4OVZ A;  1T0Q C;  4I6P A;  3L54 A;  4F1S A;  4ZDV A;  3AE3 B;  4MSQ B;  4WJO A;  1UH6 A;  3PRZ A;  3RNA C;  1JRU A;  3AE7 B;  3SD5 A;  3LB8 C;  2R61 A;  3B9J A;  4RM9 A;  2KAN A;  3OWE B;  4BKT A;  3DDC B;  3VR8 B;  1YX6 B;  1RYJ A;  4LNN A;  2BPS A;  1MPE A;  4K7W A;  3P1M A;  2CU3 A;  4YSY B;  1SIJ A;  2L52 A;  4RF1 A;  3QCA A;  1T0S C;  3DBR B;  3KUD B;  5G2N A;  2SEB D;  2I1J A;  4K1R B;  2ZZP B;  4MSM B;  2KVZ A;  4RNA A;  2BWF A;  5L83 A;  2GOW A;  4GDK B;  3PT2 B;  4MGZ E;  3RYT A;  3ZXR A;  1WYG A;  2LXA A;  1JWA D;  2EKI A;  3NVZ A;  3C19 A;  1AWD A;  3GZN I;  2GI9 A;  1X1M A;  1XQQ A;  4EE2 A;  1SE3 A;  3CSF A;  3Q8A A;  4WUR A;  2KQS A;  1YJ1 A;  4LNO A;  1I35 A;  4KIK A;  1KH0 A;  3T8M A;  4IDI A;  1WGK A;  2DBY A;  4S17 A;  5LXH A;  3KLS X;  4ZRJ A;  1EF1 A;  1Q1O A;  3PLU A;  2ONQ A;  2RGF A;  2ZVO A;  4XWT A;  1NEN B;  3IFW B;  1AW7 A;  3VAW A;  2L05 A;  5FKA C;  5T8I A;  3DVN V;  3OJ3 A;  4KSL C;  2WU5 B;  1Q10 A;  3KVF B;  1VDV A;  4MH0 E;  2M19 A;  2FCS A;  2G9H D;  3ZXV A;  4A3O A;  1GJZ A;  3D32 A;  2KDF B;  1YN4 A;  5JHB A;  2WXP A;  1MVK A;  2RPV A;  3L17 A;  1EO6 A;  3IG3 A;  2KJR A;  1R4M I;  4HDQ A;  4IM3 A;  4KKI A;  1JAL A;  2LFI A;  2PE9 A;  5CHW A;  2WX0 A;  3GZN B;  2XK5 A;  4RGM A;  4IC7 B;  1GAQ B;  3HM3 A;  3MTN B;  2KMM A;  1WR1 A;  3ZRF A;  1V1O A;  1TS4 A;  2PE6 B;  1TGZ B;  3EEC A;  4A20 A;  1TY2 A;  3AED B;  2MP2 B;  2WXR A;  4GLS C;  1KLG D;  3KW5 B;  3ZNG C;  1STE A;  5KHO A;  4MGK E;  4HK2 A;  1MJD A;  1NVI D;  1TYG B;  3NVW A;  1FRR A;  1ET6 A;  2RSU A;  3PGE A;  4OZB A;  3R7Q A;  2G1E A;  1WI0 A;  2CJO A;  3N1Z C;  2BYT A;  1WE6 A;  1P1A A;  4HPM B;  3ZDM C;  1N60 A;  2KAJ A;  2KWD A;  3PZD A;  3DVG Y;  1WM3 A;  4BKS A;  2WLB A;  3IBE A;  3WAO A;  3QX1 A;  2V3P A;  4WWO A;  2M0X A;  4LTU A;  1WSP A;  1R4M B;  2RR9 A;  1ROE A;  1F0Z A;  4P1B C;  2JPH A;  3SFE B;  4IOI E;  2Q5W D;  3W1S A;  1PFD A;  2DYM A;  2JQR B;  1PUT A;  2ZPN A;  5D3I B;  3NS1 A;  3RCZ A;  3RNF C;  4BKG A;  4C7Z A;  2WDV B;  2N7D A;  3NOB A;  2KVR A;  3CMM B;  1RWS A;  2JY6 A;  1JWS D;  4GDK A;  2PIA A;  4P6V F;  4IG7 B;  4FN2 A;  4EZK A;  4XZ4 A;  1UWX A;  3QAQ A;  2L1A A;  1YQ4 B;  1SXT A;  1TS3 A;  3ML8 A;  2PVG C;  4OHJ A;  5AZG A;  1ZGU B;  2IZV B;  1E8W A;  2MW5 A;  2L0T A;  3A9K B;  4CQN A;  4DDG D;  4YL8 A;  2JWU A;  1WR6 E;  1QKZ A;  2K9X A;  3H8H A;  2KLG A;  4ZRQ A;  4M8N A;  1J19 A;  1V97 A;  3PPA A;  2W9N A;  3KH0 A;  1P0R A;  2A5U A;  2DZJ A;  2M17 A;  3DWG C;  1E5W A;  5AZH A;  1E9M A;  2LEK A;  2BQQ A;  2N7J A;  4FHK A;  2BYE A;  4WJN A;  1I42 A;  3ZJV A;  3IAS 1;  1TS2 A;  3JVZ X;  3KUC B;  2MX2 A;  5DPR A;  3ZIM A;  1QIL A;  3VTW A;  1NDD A;  2B76 B;  2WXQ A;  3Q8F A;  4A8X C;  2BB6 A;  2M0A A;  1TZ1 A;  4KDL B;  4USA A;  2KMA A;  4EUT A;  2WXF A;  3R8B A;  5EE1 A;  5MPO A;  3P2B A;  1FXA A;  2MCN B;  1VR9 A;  4B0E A;  1GOZ A;  1FO4 A;  1BUI C;  4AJW A;  2ZCB A;  3I5J C;  4KGS A;  1C3T A;  3H7S A;  4CHK A;  1ISN A;  1XCQ L;  1JWM D;  2NTT A;  2MBH A;  3NVY A;  1VCB A;  2D3A A;  4HJG E;  3ZW3 A;  1NI3 A;  1B1Z A;  1ACC A;  1JML A;  2MP2 A;  3AEF B;  4B6W A;  4N58 A;  1HQR D;  3QIJ A;  2LGY A;  3Q3M C;  3MHS D;  4Q2J A;  1XLO A;  2C7H A;  3O13 A;  3TEZ A;  2BVC A;  3NZU A;  2IND C;  3HUI A;  3VHT C;  4DXA B;  5AZF A;  3AU4 A;  1WJ4 A;  1DGJ A;  2UWQ A;  2WXN A;  4AP4 C;  2BKR B;  2QEJ C;  2C60 A;  4NQK E;  3IAM 1;  2HJ8 A;  4P16 A;  2J0J A;  1KOT A;  3VH3 B;  2HJ1 A;  3DBH B;  2B3A A;  3TEX A;  3VR9 B;  4BOZ B;  1YMH E;  1MFW A;  2M8S A;  2DZI A;  3PLV A;  3V05 A;  3KWL A;  2O6V D;  3BII D;  2KJH B;  2IY0 B;  4HXD A;  5E6O A;  1HTO A;  4YXD B;  2BYF A;  4W9L A;  2XBB C;  4FBJ B;  2JWZ A;  2WP9 B;  1UGJ A;  3GS2 A;  4K7U A;  4WIP A;  4NZL B;  3FIL A;  5HI1 A;  1XEE A;  3X0W A;  4WH4 A;  2M1M A;  3PRP B;  5J2R A;  1EWY C;  2LJ5 A;  3AXC A;  1N61 A;  3RD2 A;  3B0A A;  1RFA A;  4PYU A;  2IY1 B;  3QWZ B;  2J0M A;  1GNU A;  3A9K A;  4G0N B;  3GB1 A;  2LVP A;  3Q8E A;  4TSS A;  3DOW A;  4YT0 B;  3NY5 A;  3PHW B;  3ZDT A;  4G3X B;  1VLB A;  1RFK A;  1R4N B;  2KMC A;  3A4S C;  3DQV A;  4US8 A;  2UU7 A;  2G3Q B;  4KZ0 A;  4M00 A;  4NJ7 A;  1WXM A;  3NRZ A;  2PKO A;  5AUK A;  1KTK A;  2NS5 A;  4CYE A;  3IT6 B;  3ZKJ C;  3PSE B;  2FCQ A;  3M95 A;  3UI3 A;  2KT7 A;  3AE9 B;  1N5W A;  2KO3 A;  3EUB 2;  3E56 A;  2LGI A;  3P4R B;  1I4R A;  4R3D A;  4PYZ A;  4RCO A;  3VH4 B;  1J7A A;  4TMA B;  3R7R A;  1LFD A;  2NMQ A;  2LD9 A;  4EFO A;  1FNV A;  2NBW B;  1NBF C;  3TIX A;  2V9H A;  5E6J A;  2ZPY A;  1ZDV A;  4MJS B;  1H4R A;  5HG2 A;  5BMH A;  2MJD A;  2I38 A;  4X57 B;  2QJL A;  2UYZ B;  2ZVN A;  4RMA A;  1C4P A;  2L0F A;  3M63 B;  2L8J A;  2PPH A;  1YNT E;  5BYQ A;  1D5X C;  3NVV A;  2FCN A;  1F52 A;  3AEE B;  3BYT B;  2CHX A;  3QC8 B;  3WIM A;  3BWU D;  3R2I A;  2KXJ A;  2EEL A;  4NPN A;  5AUI A;  2LXC A;  2NCN A;  5BO4 B;  1OQQ A;  4E3C A;  5LLI A;  1WJN A;  2Y5B B;  3Q6B A;  2DX5 B;  1V86 A;  2XEW A;  2X38 A;  1TS5 A;  4FJY A;  4WWM A;  2LZ6 A;  1E7P B;  1Y56 A;  2Y5P A;  3B2G A;  3PRE A;  1I4H A;  2QHO A;  1ZP0 B;  3SEB A;  5BYS A;  1HA5 A;  3BVZ A;  1KM7 A;  3A9J B;  1Y8R C;  3EA6 A;  2VH1 A;  3U2S C;  4F8C B;  3CIR B;  4HLE A;  1V9J A;  1WJU A;  2KTF A;  2LI5 A;  1VJK A;  4ACF A;  3KYD D;  3PZ8 A;  2WXK A;  1WH3 A;  3OJ4 B;  4JL9 A;  2R2O A;  3BVM A;  1T6B X;  1SE4 A;  3OG5 A;  5IP4 D;  1N6Z A;  1L0X B;  1F2R C;  2ZW1 A;  4ANU A;  2JF5 A;  3HRD D;  3ZJT A;  2KDM A;  2WXI A;  3ZTC A;  1BXT A;  3BK1 A;  4RGT A;  3U8Z A;  3NHE B;  2JVC A;  1ESF A;  2KDE B;  2ZEQ A;  3N20 C;  4JGH B;  1PGX A;  3T9L A;  2V4L A;  3UQA A;  3RNC C;  2QIL A;  3RNE C;  1IUE A;  1SE2 A;  1UUP A;  3NG0 A;  4GB9 A;  3URY A;  2L76 A;  1QOB A;  2CHZ A;  1Z5S B;  3JSV B;  4ASW C;  2RMM A;  2GBR A;  5GXG B;  1TKE A;  3M62 B;  1XLQ A;  4WAA A;  4L2Y A;  1YQB A;  3W1S C;  2KX0 A;  4B0M A;  5C1Z A;  3H6N A;  2A4Z A;  4NJ6 A;  2HDE A;  1IPG A;  2MWS B;  2DAF A;  4GMV A;  3KYC D;  1PQS A;  5D3D A;  3ML9 A;  2GLS A;  4W9I A;  2L32 A;  2NBU A;  4DK5 A;  3QQ8 B;  3OLM D;  2IO1 B;  2N7E A;  1S3S G;  3A1Q A;  3AEB B;  4MJS A;  1E8Z A;  3RPF C;  2PJH A;  4RH6 A;  2MBE A;  2D3G A;  1WGH A;  1OQR A;  2EMS A;  2BW2 A;  3OAW A;  3CWI A;  2W82 A;  4OVU A;  1EWC A;  3MP9 A;  4RM8 A;  2LHE A;  4LLG M;  2TSS A;  4LNK A;  4BFR A;  1YOV B;  2K1F A;  1D3Z A;  2J7Q B;  1IGC A;  3N1Y C;  4PS3 A;  1L6U A;  3V6C B;  2GBN A;  1V5T A;  4ARC A;  3AMZ A;  3W9C B;  4ICV A;  1ZW7 A;  4FA6 A;  4II2 B;  3HVD A;  1AAR A;  3VVW B;  2FUG 1;  4C7Y A;  4O1N A;  2CU1 A;  2KFK B;  1GPX A;  2NVU I;  1D5Z C;  4BBN C;  3EFU A;  4MGY E;  1OQY A;  2O6V B;  2ZNV C;  1I4G A;  1C4A A;  2K39 A;  4GU2 A;  4L1B A;  1SJE D;  1I4Q A;  3MJ5 A;  5CHV C;  2I1K A;  3A9J A;  4IM2 A;  4IWP A;  4BZA A;  1XCT L;  4JX1 C;  1FPY A;  4JWS C;  3RZW C;  1SSN A;  2K22 A;  1WRD B;  5J17 A;  3N32 A;  1SJH D;  2M4N A;  4W9E A;  1B9R A;  1PGA A;  1ZE3 D;  2QCZ A;  4XGA B;  2D3C A;  4MGI E;  1L2N A;  1YN3 A;  1TIF A;  5HKH A;  5C3J B;  2LUE A;  1LXD A;  3O65 B;  2AQ3 B;  4DXG A;  2KNB A;  3RI7 C;  3E9S A;  1F1H A;  1YX5 B;  2NPT B;  3HK0 A;  2QC8 A;  4AWJ A;  1XD3 B;  2X8X X;  1KFY B;  3TEW A;  1VD2 A;  1WX9 A;  2AWT A;  4HEA 1;  1T0Y A;  3AE8 B;  1ET9 A;  2J52 A;  3JSV A;  1E7V A;  1UNS A;  4LJO B;  4D2K A;  4ZRK A;  1NYQ A;  5CHF A;  5C2T B;  5D2M B;  2KX3 A;  3UIN B;  2HE7 A;  4DHJ D;  2N9E B;  4XX5 A;  3WCQ A;  1GB4 A;  2JZP A;  5IKC M;  1VRA B;  1L4Z B;  1QT9 A;  2CJN A;  5C23 A;  2WXM A;  2IGG A;  2LUM A;  3NUH B;  4M02 A;  3PS6 A;  2WXJ A;  1FEH A;  1V8C A;  3ZYY X;  2DYO A;  3ABV B;  2N0S B;  4IWQ A;  4JLC A;  3ZNZ B;  2BBC A;  1EM7 A;  4C56 C;  3ENE A;  2WDR B;  4KDI C;  4HDO A;  2Y5C A;  4P7I A;  1CJE A;  1TKY A;  5D94 A;  2K8H A;  2JRI B;  1ZKH A;  1N5X A;  2C7M B;  2IBI B;  3VUW A;  4MDK E;  2CHW A;  4ZRP A;  4GGQ A;  2V1Y A;  3FC4 A;  2BGF A;  3LXF A;  3DVG X;  4W9J A;  3VFK A;  1P7E A;  1TZO A;  3P4P B;  2IO3 B;  3V60 A;  3Q69 A;  2LGX A;  2J4X A;  1CZP A;  4DQO C;  1VZ6 A;  2KQ7 A;  4WWN A;  3ZVV A;  3AM9 A;  3ZLZ A;  3TUO A;  1JW9 D;  2N9K A;  3U4E G;  3W5U B;  5AEK B;  3DWM A;  2W3S A;  4FLH A;  2JZ3 B;  4OZC A;  2BWE S;  5EDS A;  1UBQ A;  2KFK A;  2WS3 B;  3ECI A;  5FR6 A;  3QAR A;  3VTU A;  3L16 A;  2WWZ A;  1N63 A;  1V1P B;  1NI2 A;  1HZ5 A;  3Q8B A;  2O6V A;  3DHG C;  4A9A A;  2NR2 A;  2WDT B;  4HWI B;  3V62 A;  4G50 A;  2MQJ A;  2QMT A;  2REX A;  1RM6 C;  1SEB D;  3ONS A;  3M3J A;  2CR5 A;  2LVO A;  3LDZ E;  1Q5W B;  3GP7 A;  4KV2 A;  5BMI A;  4W9C A;  3APD A;  1JWU D;  3ZTD A;  1SE9 A;  5JZE B;  3B1L X;  3IHP C;  2JXT A;  4CO7 A;  4HVB A;  1SGH A;  2KDB A;  3QHT A;  3AU5 A;  4N9F 4;  1FM0 D;  4URK A;  2DEN B;  3W1Y A;  3KQ4 A;  2IO2 B;  4UDU C;  2WGS A;  3JW0 X;  3I9V 1;  2N9L A;  2JSV X;  2DAJ A;  4DHZ E;  2GBM A;  3GE3 C;  1XXG A;  2OJW A;  5DPT A;  1TKG A;  2BS2 B;  4C00 A;  2K6Q A;  4KKJ A;  4DWF A;  4ZYN A;  3KUZ A;  2FCM A;  2JUO A;  4LDT B;  2INP E;  3IXS A;  4WJP A;  3V6E B;  1WIA A;  2DLB A;  2N4F A;  3SDL C;  2E6X A;  2H88 B;  3C0R B;  1LM8 B;  1E8Y A;  1G6J A;  1XLN A;  2PTL A;  1RLF A;  2L83 A;  4OZA A;  3DBS A;  2JU6 X;  2WXL A;  1IBX B;  4GN1 A;  5IA7 A;  3MHZ A;  3MJW A;  2WX1 A;  2V4I B;  2DZM A;  3ZO5 B;  3ZUN A;  1GC7 A;  5DPS A;  3HHM A;  1Z2M A;  3N9Y C;  4BOS C;  2D5G A;  4M01 A;  3U7D A;  4LJP B;  3ZGZ A;  2RDB C;  1WZ3 A;  2LVQ A;  1T0R C;  4G11 A;  3NS8 A;  4YTM B;  2MHJ A;  5JXV A;  4GOC A;  2MRP A;  4YSX B;  3GE8 C;  1MI0 A;  1V6E A;  4C4V B;  5CTR C;  2JXX A;  3L10 B;  1D6E C;  1VZ8 A;  2DYB A;  1SB3 C;  4N6E B;  1EF5 A;  1OEY J;  3Q2A C;  1UBI A;  2DZK A;  2QIE B;  4GDL B;  2C9W B;  4HRS A;  4WWP A;  1D4B A;  2GBJ A;  3BYY B;  1MHH E;  3P4Q B;  1TT5 B;  1WXS A;  2QSD A;  3TL5 A;  4NAM A;  1FNW A;  2INC C;  1UZX B;  4TUU A;  4US9 A;  3IT4 B;  3CF6 E;  2KN5 A;  4ITK A;  1HE8 A;  1QOA A;  1RRB A;  2LRU A;  1MHX A;  3WA0 A;  3AEC B;  2HD5 B;  2NTS A;  3Q3N C;  2WNM A;  4AS1 A;  1KLV A;  4LNI A;  1V1P A;  4KIK B;  3FKY A;  1IYF A;  1WGD A;  1TJE A;  2INN E;  2ON8 A;  2GRI A;  2GB1 A;  5KHQ A;  2WDQ B;  2WQY B;  4XDD A;  1U4A A;  1Q0W B;  4YTN B;  1DOI A;  2FBW B;  1L0V B;  2L00 B;  5TR5 A;  3VTV A;  1DOX A;  1K8R B;  3RMK C;  2FE8 A;  2AQ2 B;  2G4D B;  1UEL A;  4S0R A;  3VQI A;  5HHD G;  3AEA B;  2IO0 B;  4JIO U;  4NQL B;  4NNJ B;  2BS4 B;  2JYT A;  2O2V B;  3W2D A;  1GC6 A;  2KWU B;  3IVF A;  2BKF A;  4W9K A;  3UGB B;  2PLP A;  4BAX A;  5FR3 A;  3BK2 A;  3ZJU A;  2EMT A;  4LK0 M;  1FFV A;  4KX6 B;  1C78 A;  2KDI A;  4F7Z A;  3HVZ A;  1HTQ A;  1TY0 A;  5D6J B;  2V3S A;  1E0Z A;  3TCA A;  4II3 B;  2LGS A;  1N62 A;  5DPW A;  2WHI A;  2DHZ A;  4DHJ B;  4BVU C;  2KC2 A;  2ZW0 A;  3H1U A;  1K51 A;  3PVL A;  2N1V A;  1IBX A;  4EZJ A;  3R3M A;  4WJQ A;  4M8M A;  4AUQ C;  1BML C;  2KQ4 X;  3VUX A;  1C76 A;  2WXG A;  3MFG A;  2PMV A;  1UD7 A;  5BYR A;  1JRO A;  1HXY D;  4RGN A;  2XNA C;  4W9D A;  1FNU A;  4JWU C;  1QF6 A;  1M4V A;  4YWG G;  4WQO B;  2HTM E;  1NYR A;  4TQ1 A;  4ANW A;  3RUL A;  3MC8 A;  4RFB A;  2YEP B;  3SU8 X;  2YLM A;  2KZR A;  4LDT D;  4ICU A;  5G5G A;  3QJZ A;  4C4V A;  1WXV A;  4IWO A;  1S1Q B;  4FJV B;  2KC1 A;  3VRB B;  4GDL A;  3BZD B;  1YQ3 B;  2KJ6 A;  5CX3 A;  4ZHP A;  1YN5 A;  5DCN A;  4TV3 A;  2RD0 A;  2MJ3 A;  1ZUD 2;  2KAC A;  1OEY A;  2GBK A;  1F9J A;  2BS3 B;  2N9P C;  1PGB A;  3MC0 B;  4KZC A;  3WAL A;  4WQM A;  5G55 A;  4A6Q A;  3RNG C;  2JZZ A;  4N59 A;  4KGT A;  1WFY A;  2Z0E B;  2WU2 B;  3EGR A;  2VZK B;  4HJK A;  5IAA C;  2KOX A;  4DBG A;  2K8B A;  3V3X A;  1EUV B;  2E3T A;  2FIF A;  2Z0D B;  3T3O A;  1XT9 B;  3WAP A;  1UF0 A;  3UF8 A;  2MEK A;  4FHJ A;  3KWV A;  4HCN B;  2H89 B;  1WGR A;  4W9H A;  5I4D A;  3AI5 A;  2KTR B;  1V49 A;  4YTP B;  5G5H A;  3AE5 B;  5EE3 A;  1V5O A;  3CST A;  2L3Z A;  4E71 A;  2D11 A;  4H2A A;  1XF5 L;  1P7F A;  2G45 B;  3ZNH B;  2FNJ B;  1TBE A;  4HKQ A;  2AEH A;  4DHZ B;  1WZ0 A;  3L13 A;  1E6E B;  4M0W B;  3PV1 A;  2GMI C;  2K25 A;  2K8C A;  2C7N B;  2O2V A;  1XLP A;  1LGR A;  1OGW A;  2KN4 A;  3VXW A;  1ZOY B;  1E7U A;  4FXC A;  3DVN U;  4KGR A;  2L7R A;  1YJJ A;  3ALB A;  3U7Z A;  3R66 C;  4C80 A;  2KFJ A;  4WAF A;  1A5R A;  3ZRC A;  2ZNV B;  1P98 A;  1TTN A;  2G4S A;  3TBL D;  2BTE A;  4ZOH C;  1C79 A;  1WY8 A;  2FAZ A;  1WE7 A;  2OHF A;  1H8C A;  1QLB B;  5IO9 A;  3PO0 A;  4ARI A;  3AN1 A;  2IGD A;  2RPQ A;  4NY0 A;  2K0P A;  1FD6 A;  2VH2 A;  2KHW B;  1J0G A;  3SHQ A;  3B08 A;  1ZXH A;  1ZXI A;  1L5P A;  4RF0 A;  2YVC A;  2R2Q A;  1WF9 A;  3APF A;  4NAW B;  1WWT A;  2LWP A;  3JYU A;  3MC9 A;  3K9P B;  3AUL A;  2N1W A;  3V61 A;  3AE1 B;  4TKN A;  3UIO B;  2LMC A;  4MAC A;  3PHX B;  2BT6 A;  1NEK B;  1K53 A;  1QZE A;  3Q3O C;  2MBQ A;  4I6L B;  1PDX A;  4LNF A;  2KWV B;  5JH5 C;  4IM0 A;  3U30 A;  5TSS A;  3RZF A;  5FK9 C;  1WM2 A;  1YD8 U;  3L0W B;  4LCD E;  2IPK D;  1JQ4 A;  1WXQ A;  3DCG A;  1WJ6 A;  3H9D A;  1P3Q U;  1L4D B;  3U52 E;  1HZ6 A;  3Q8C A;  1K52 A;  2D3B A;  2VRR B;  2W3R A;  3FIL B;  3PZ7 A;  1FRD A;  2WXH A;  1L0Y B;  2LAS A;  1DYQ A;  3AH7 A;  4TQ0 A;  1JWB D;  4GSW A;  4B95 A;  3WAM A;  4HPL B;  2BF8 B;  4BKS D;  2LRW A;  3HIZ A;  1OFF A;  4MM3 B;  4DXF A;  2BYV E;  4REZ A;  2KYW A;  4L23 A;  3RN9 C;  3RUI B;  2RDG A;  1QOG A;  2ZJD A;  3VRA B;  1EU4 A;  1PYW D;  3H7P B;  4K7S A;  3AB5 A;  5IOI A;  1LQB A;  4AJY B;  2KTR A;  3Q3J A;  4K81 A;  2ICI A;  4J6I A;  2IGH A;  5H8Y E;  5GMV A;  1QOF A;  3BIN A;  3A33 B;  3Q14 C;  1QQR A;  3L4P A;  2J53 A;  1YIW A;  1WMH B;  3NZS A;  3TMP B;  1MG4 A;  1D5M C;  1C77 A;  3RFZ B;  3DBH I;  4M0W A;  2K5P A;  4HRO A;  5EE9 A;  2VZK D;  3UQB A;  2V3N A;  3APC A;  3S2A A;  1FXT B;  2JYE A;  1AN8 A;  2J0K A;  2W54 A;  1C9F A;  2Y3A A;  2PW9 A;  1LO5 D;  5D7G A;  1K50 A;  2AX5 A;  5EE0 A;  4XE0 A;  2BB5 A;  5BMG A;  1M94 A;  2IDY A;  2MBB B;  2OJR A;  2W55 A;  3EHV A;  4EZL A;  1J8C A;  1JRP A;  4A90 A;  1WX8 A;  1FMA D;  3DBL I;  2YEP F;  3PTF C;  4PT5 A;  2D2Q A;  2XN9 C;  4QAY A;  4FUL A;  3N3K B;  4W9G A;  1P9D U;  2KD0 A;  3TSS A;  3L08 A;  4HCP B;  2DWQ A;  4OVV A;  1HEZ E;  1SBB B;  2MH7 A;  2LHD A;  5H92 C;  3LJ3 A;  2PVO D;  1KJT A;  2K6D B;  4XDC A;  1A70 A;  3LYY A;  3P4S B;  5HFY A;  4EKU A;  4P1C C;  1KLU D;  3I63 C;  2FUH B;  3J9C A;  1FCL A;  4FJZ A;  4KSK C;  4NAW A;  4NJC A;  2JRH A;  2LGD A;  2NPT A;  3T3N A;  3AV8 A;  1RAX A;  1R4N I;  1UWM A;  2MSE D;  1UGM A;  4AOF A;  3AEG B;  4A55 A;  4YSZ B;  4XWW A;  2MJE A;  5JHA A;  4GXB A; 
#chains in the Genus database with same CATH homology
 3QAQ A;  1V80 A;  5L95 C;  1WGH A;  2IO0 B;  4JIO U;  4NQL B;  4NNJ B;  3ML8 A;  2AL6 A;  2EMS A;  3OAW A;  2MA9 B;  2O2V B;  1ZGU B;  2IZV B;  5AZG A;  1GC6 A;  1E8W A;  2KWU B;  2MW5 A;  2L0T A;  2BKF A;  3A9K B;  3IVF A;  4OVU A;  3HM6 X;  4DDG D;  4YL8 A;  4RM8 A;  4W9K A;  1BT0 A;  1WGG A;  1WR6 E;  3K9O B;  3UGB B;  3UIP B;  2KLG A;  1E8X A;  4M8N A;  1J19 A;  5J18 A;  2EMT A;  3PPA A;  2W9N A;  3ZNI D;  4BFR A;  2K1F A;  1D3Z A;  5LXI B;  3KH0 A;  2J7Q B;  4PS3 A;  1CMX B;  1P0R A;  2A5U A;  3V6C B;  1IP9 A;  2DZJ A;  2M17 A;  1E5W A;  2GBN A;  2KDI A;  5AZH A;  4F7Z A;  5D6J B;  1V5T A;  2V3S A;  2FID A;  3TCA A;  4FHK A;  2BYE A;  4II3 B;  4ICV A;  1ZW7 A;  4GIV A;  4WJN A;  3BY4 B;  4FA6 A;  4II2 B;  1I42 A;  2OOB B;  1AAR A;  5DPW A;  3VVW B;  3JVZ X;  2DHZ A;  2CU1 A;  2KFK B;  2N9X A;  3KUC B;  2MX2 A;  4DHJ B;  4BVU C;  2KC2 A;  3H1U A;  2NVU I;  4BBN C;  3PVL A;  4MM3 A;  3EFU A;  4MGY E;  5DPR A;  3ZIM A;  2CS4 A;  2N1V A;  2WYQ A;  3VTW A;  1NDD A;  2MLB A;  3R3M A;  2EKE C;  1OQY A;  4WJQ A;  4EZJ A;  2O6V B;  4JQW C;  2NBV B;  2ZNV C;  4M8M A;  4W9F A;  4AUQ C;  2HTH A;  2K39 A;  4BBN F;  4GU2 A;  1TZ1 A;  4I6N B;  3VUX A;  4KDL B;  4PS8 A;  5E6N A;  1E90 A;  1UD7 A;  5CHV C;  3H7P A;  2KMA A;  3I3T B;  2KLC A;  2Z59 B;  4W9D A;  4EUT A;  2I1K A;  3P2B A;  2MCN B;  3A9J A;  4IM2 A;  1SIF A;  3QK0 A;  4AJW A;  1L7Y A;  4IWP A;  2ZCB A;  4WQO B;  3WAN A;  4A3P A;  3GOE A;  1WXA A;  1C3T A;  4TQ1 A;  4ANW A;  3H7S A;  4CHK A;  3RUL A;  4MEL A;  1ISN A;  3VUY A;  3RZW C;  3SU8 X;  2YLM A;  2KZR A;  1WRD B;  2AL3 A;  4LDT D;  3DPD A;  2MBH A;  4B9K A;  4ICU A;  1WMH A;  5J17 A;  3QJZ A;  1VCB A;  3VDZ A;  1V81 A;  1WXV A;  3N32 A;  2M4N A;  4W9E A;  2CKH B;  4IWO A;  3TJP A;  4FAD A;  1GUA B;  1C1Y B;  3ZW3 A;  4MGI E;  2ASQ A;  1S1Q B;  1L2N A;  2MP2 A;  4B6W A;  4PS7 A;  4FJV B;  5HKH A;  2KC1 A;  3QIJ A;  2LUE A;  1LXD A;  2LGY A;  3O65 B;  3MHS D;  4DDI D;  4ZRI A;  3A4R A;  2C7H A;  2KNB A;  4GDL A;  3NZU A;  2KJ6 A;  5CX3 A;  3PRM B;  1YX5 B;  2NPT B;  3HK0 A;  4TV3 A;  2RD0 A;  5DCN A;  4AWJ A;  1XD3 B;  3A1Q B;  1OEY A;  3VHT C;  4DXA B;  5AZF A;  2GBK A;  4EOY A;  3AU4 A;  1VD2 A;  1WGY A;  1WX9 A;  2AYO B;  1F9J A;  1WJ4 A;  2AWT A;  2N9P C;  2UWQ A;  4KZC A;  4AP4 C;  3WAL A;  1T0Y A;  2BKR B;  5G55 A;  2C60 A;  2PEA A;  3JSV A;  3QA8 A;  4NQK E;  1E7V A;  2HJ8 A;  4LJO B;  2JZZ A;  4ZRK A;  2J0J A;  1KOT A;  5CHF A;  3VH3 B;  2B3A A;  2JT4 B;  5D2M B;  1WFY A;  2KX3 A;  3UIN B;  2Z0E B;  4BOZ B;  2HE7 A;  4HJK A;  2M8S A;  5IAA C;  2N9E B;  4DHJ D;  2KOX A;  4XX5 A;  4DBG A;  2DZI A;  2K8B A;  1EUV B;  2Z0D B;  2FIF A;  1XT9 B;  3PLV A;  3WAP A;  5C23 A;  2O6V D;  2KJH B;  5E6P A;  3UF8 A;  2IY0 B;  4EEW A;  4HXD A;  4FHJ A;  4HCN B;  5E6O A;  2ZCC A;  2BYF A;  1WGR A;  4W9H A;  4W9L A;  2IYD B;  3PS6 A;  2XBB C;  3AI5 A;  4FBJ B;  2JWZ A;  2KTR B;  1V49 A;  4K7U A;  1WX7 A;  2DYO A;  1OTR B;  4IWQ A;  3EC8 A;  1V5O A;  3CST A;  3X23 A;  2L3Z A;  2XK5 B;  4E71 A;  2D11 A;  4JLC A;  3X0W A;  2M1M A;  1GG3 A;  3PRP B;  4E74 A;  5J2R A;  3ZNZ B;  2LJ5 A;  2G45 B;  3ZNH B;  4ANV A;  3AXC A;  3ENE A;  2FNJ B;  4MEM A;  1MG8 A;  2D10 A;  1TBE A;  4IUM B;  4KDI C;  3DBR I;  4HDO A;  2KK8 A;  2AEH A;  3RD2 A;  4DHZ B;  3B0A A;  4XC2 A;  1WZ0 A;  4P7I A;  3L13 A;  4M0W B;  1RFA A;  3PV1 A;  4PYU A;  2GMI C;  5D94 A;  2K25 A;  4IW0 A;  2K8C A;  2IY1 B;  2C7N B;  1ZKH A;  2JRI B;  2C7M B;  1GNU A;  2J0M A;  2K8H A;  2O2V A;  2IBI B;  3A9K A;  3VUW A;  4MDK E;  1OGW A;  2CHW A;  2KWC A;  4G0N B;  4ANX A;  1WYW B;  2V1Y A;  4GGQ A;  3VXW A;  2BGF A;  2LVP A;  3DVG X;  4W9J A;  3VFK A;  3DOW A;  1E7U A;  2IO3 B;  3DVN U;  3V60 A;  2L7R A;  3ALB A;  3NY5 A;  2LGX A;  3PHW B;  3ZDT A;  2D07 B;  3R66 C;  4G3X B;  2KFJ A;  1A5R A;  3ZRC A;  2KQ7 A;  2MBO A;  3Q3F A;  2ZNV B;  2C5L C;  4WWN A;  1TTN A;  1P98 A;  2KMC A;  3A4S C;  3ZVV A;  2G4S A;  3DQV A;  2KKC A;  3TBL D;  4KVG B;  3ZLZ A;  2G3Q B;  1WY8 A;  4KZ0 A;  2FAZ A;  1WE7 A;  4NJ7 A;  3RT3 B;  1WXM A;  1V2Y A;  3N30 A;  1H8C A;  5AEK B;  2NS5 A;  4FLH A;  4CYE A;  2JZ3 B;  4F1S A;  4I6P A;  3L54 A;  4ZDV A;  2BWE S;  5EDS A;  4MSQ B;  4WJO A;  1UBQ A;  2KFK A;  1UH6 A;  3ECI A;  3PRZ A;  2RPQ A;  5FR6 A;  4NY0 A;  3PSE B;  3ZKJ C;  1JRU A;  2FCQ A;  3QAR A;  3SD5 A;  3M95 A;  3VTU A;  3L16 A;  2WWZ A;  2KO3 A;  1NI2 A;  2KHW B;  4RM9 A;  1J0G A;  2KAN A;  2O6V A;  3SHQ A;  3B08 A;  4BKT A;  3DDC B;  2YVC A;  4PYZ A;  2R2Q A;  1YX6 B;  1WF9 A;  3APF A;  2NR2 A;  2WDT B;  4HWI B;  2BPS A;  4K7W A;  3V62 A;  3VH4 B;  4NAW B;  3R7R A;  1LFD A;  2LWP A;  3JYU A;  2LD9 A;  4EFO A;  4G50 A;  2MQJ A;  2REX A;  3AUL A;  3K9P B;  3M3J A;  3ONS A;  2CR5 A;  3QCA A;  2NBW B;  3KUD B;  2N1W A;  1NBF C;  5G2N A;  3TIX A;  4TKN A;  3V61 A;  2LVO A;  3UIO B;  2I1J A;  3LDZ E;  1Q5W B;  4K1R B;  2ZZP B;  4KV2 A;  3PHX B;  4MSM B;  2ZPY A;  4MJS B;  4W9C A;  2BWF A;  1H4R A;  5L83 A;  1QZE A;  2GOW A;  3APD A;  3ZTD A;  4GDK B;  3PT2 B;  4MGZ E;  4X57 B;  1SE9 A;  3RYT A;  2MBQ A;  5JZE B;  2UYZ B;  2ZVN A;  4I6L B;  2LXA A;  3B1L X;  4RMA A;  2L0F A;  2KWV B;  3IHP C;  4IM0 A;  5JH5 C;  3M63 B;  3U30 A;  3RZF A;  4CO7 A;  4HVB A;  1SGH A;  2L8J A;  2PPH A;  2KDB A;  3GZN I;  1WM2 A;  3AU5 A;  3QHT A;  1X1M A;  1YD8 U;  3L0W B;  2FCN A;  4LCD E;  4N9F 4;  4URK A;  2DEN B;  3W1Y A;  1XQQ A;  2IO2 B;  3DCG A;  2CHX A;  3JW0 X;  3CSF A;  3QC8 B;  3WIM A;  2DAJ A;  4DHZ E;  1WJ6 A;  2GBM A;  1P3Q U;  3H9D A;  2KQS A;  1YJ1 A;  1I35 A;  2KXJ A;  4KIK A;  2VRR B;  5DPT A;  3T8M A;  4NPN A;  2K6Q A;  2LXC A;  5LXH A;  2NCN A;  5BO4 B;  4DWF A;  4ZRJ A;  1EF1 A;  4ZYN A;  3KUZ A;  1Q1O A;  4E3C A;  2FCM A;  1WJN A;  2LAS A;  5LLI A;  3PLU A;  2Y5B B;  2JUO A;  2RGF A;  4LDT B;  2DX5 B;  2ZVO A;  4TQ0 A;  4WJP A;  3V6E B;  1WIA A;  4GSW A;  1V86 A;  2XEW A;  4B95 A;  2N4F A;  3SDL C;  3WAM A;  3IFW B;  4HPL B;  3VAW A;  3C0R B;  1LM8 B;  1E8Y A;  2L05 A;  1G6J A;  2BF8 B;  3DVN V;  3OJ3 A;  4KSL C;  4BKS D;  1RLF A;  4FJY A;  2LRW A;  3HIZ A;  3DBS A;  3KVF B;  4MH0 E;  2FCS A;  2LZ6 A;  4A3O A;  2BYV E;  3PRE A;  1GJZ A;  4GN1 A;  3D32 A;  5IA7 A;  2QHO A;  2KDF B;  3RUI B;  5JHB A;  3MJW A;  2WX1 A;  2DZM A;  3ZO5 B;  2ZJD A;  3ZUN A;  1GC7 A;  5DPS A;  3H7P B;  3HHM A;  3L17 A;  4K7S A;  1Z2M A;  1KM7 A;  4BOS C;  3U7D A;  3A9J B;  1LQB A;  4LJP B;  1EO6 A;  1Y8R C;  2KJR A;  1R4M I;  3IG3 A;  4AJY B;  2KTR A;  4F8C B;  4HDQ A;  3Q3J A;  4IM3 A;  4K81 A;  4HLE A;  1V9J A;  1WJU A;  1WZ3 A;  2KTF A;  2LVQ A;  2LI5 A;  2PE9 A;  3NS8 A;  4G11 A;  4J6I A;  5CHW A;  2WX0 A;  5GMV A;  3KYD D;  2XK5 A;  3BIN A;  1WH3 A;  4IC7 B;  4GOC A;  3HM3 A;  3OJ4 B;  2MRP A;  3MTN B;  3A33 B;  1YIW A;  1WMH B;  1WR1 A;  2R2O A;  3NZS A;  4JL9 A;  3TMP B;  1V6E A;  3ZRF A;  5CTR C;  2JXX A;  3L10 B;  2DYB A;  2PE6 B;  1TGZ B;  3EEC A;  4A20 A;  4ANU A;  2JF5 A;  2MP2 B;  3DBH I;  1EF5 A;  3ZTC A;  1OEY J;  3UQB A;  1UBI A;  3APC A;  3S2A A;  1FXT B;  2DZK A;  3KW5 B;  3ZNG C;  3U8Z A;  3NHE B;  4GDL B;  5KHO A;  2C9W B;  2J0K A;  4MGK E;  2JVC A;  4HK2 A;  4WWP A;  2KDE B;  2ZEQ A;  4JGH B;  2GBJ A;  5D7G A;  1WXS A;  3T9L A;  2V4L A;  3UQA A;  3TL5 A;  2RSU A;  1UZX B;  4TUU A;  1M94 A;  2MBB B;  3PGE A;  2OJR A;  3EHV A;  3R7Q A;  1WI0 A;  4EZL A;  3CF6 E;  4GB9 A;  1J8C A;  1WX8 A;  2KN5 A;  3DBL I;  2L76 A;  1HE8 A;  1WE6 A;  2CHZ A;  3PTF C;  1RRB A;  2LRU A;  1Z5S B;  2D2Q A;  3JSV B;  1P1A A;  4ASW C;  4HPM B;  3ZDM C;  2GBR A;  4FUL A;  3M62 B;  3WA0 A;  3PZD A;  3DVG Y;  4WAA A;  1WM3 A;  3N3K B;  2HD5 B;  1YQB A;  4W9G A;  1P9D U;  2KD0 A;  3W1S C;  4BKS A;  2KX0 A;  3L08 A;  4HCP B;  3IBE A;  3WAO A;  3QX1 A;  4WWO A;  4OVV A;  2M0X A;  1KLV A;  5C1Z A;  3H6N A;  4KIK B;  3LJ3 A;  2A4Z A;  2RR9 A;  4NJ6 A;  1IYF A;  1KJT A;  1WGD A;  2K6D B;  2JPH A;  1IPG A;  4EKU A;  2MWS B;  3W1S A;  2DAF A;  2DYM A;  2FUH B;  4GMV A;  3KYC D;  5KHQ A;  4FJZ A;  4KSK C;  4NAW A;  1U4A A;  1PQS A;  1Q0W B;  2ZPN A;  3ML9 A;  2JRH A;  2LGD A;  2NPT A;  3RCZ A;  4BKG A;  4W9I A;  2NBU A;  4DK5 A;  1RAX A;  1R4N I;  3QQ8 B;  3OLM D;  2IO1 B;  2N7E A;  1S3S G;  2L00 B;  3A1Q A;  5TR5 A;  2N7D A;  3VTV A;  3NOB A;  2MSE D;  2KVR A;  1UGM A;  1K8R B;  4AOF A;  4MJS A;  3CMM B;  2JY6 A;  1E8Z A;  4GDK A;  2PJH A;  2G4D B;  2MBE A;  2D3G A;  1UEL A;  5JHA A;  3QWZ B;  4IG7 B;  3VQI A;  4FN2 A;  4EZK A;  4XZ4 A;  4GXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...