2K5PA

Nmr solution structure of a thiamine biosynthesis protein from geobacter metallireducens: northeast structural genomics consortium target gmr137
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
78
structure length
78
Chain Sequence
b'MNLTVNGKPSTVDGAESLNVTELLSALKVAQAEYVTVELNGEVLEREAFDATTVKDGDAVEFLYFMGGGKLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thiamine-biosynthesis protein
publication title NMR Solution Structure of a Thiamine Biosynthesis Protein from Geobacter Metallireducens: Northeast Structural Genomics Consortium Target GmR137
rcsb
source organism Geobacter metallireducens gs-15
molecule tags Biosynthetic protein
total genus 11
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2k5pA00
1NYQA 1OQQA 1N61A 1ZP0B 2ACZB 1E6EB 1OFFA 5H8YE 1N63A 1TYGB 1RWSA 1WGKA 4WWMA 4P6VF 1SF0A 2W3RA 4YTPB 1N5WA 5AUKA 1TKGA 5EE0A 2H89B 3ZYYX 1SB3C 5EE9A 1NENB 2PKOA 1PUTA 5H92C 4C80A 3NVZA 1RFKA 4YXDB 1GPXA 1QOBA 2K22A 2PVGC 2W54A 1KRHA 3AEAB 2WDRB 1KF6B 2MJEA 1XLQA 2L52A 3FAHA 1L5PA 3P63A 2HTME 3B9JA 2MH7A 2JQRB 2Q5WD 2KAJA 1WXQA 2M19A 3SFEB 3ETRA 3NVVA 5C2TB 2DBYA 4ZOHC 3RPFC 3EUB2 1E0ZA 4HROA 1A70A 1YJJA 3CIRB 1QLBB 1SIJA 1QOGA 1WWTA 1N60A 3P4SB 1ZUD2 2KMMA 2WDQB 1RM6C 1V97A 1JW9D 2L83A 2WDVB 5AUIA 2W3SA 3VRAB 3W5VB 1E7PB 1FRDA 3DWMA 4N6EB 2W55A 1JWBD 2M56B 1J7AA 1WRIA 2H88B 4YT0B 3AE3B 3AE4B 2LEKA 1XO3A 1T3QA 1ZOYB 3NS1A 1GAQB 1JROA 1OQRA 1JRPA 1TJEA 2FBWB 2BS4B 2N0SB 1ROEA 2QJLA 3AE8B 3HRDD 4ITKA 4YTMB 1N5XA 1QT9A 3CWIA 3NRZA 4USAA 1E10A 4US8A 4JWUC 3AE5B 4YSXB 2G1EA 3P4RB 3DWGC 3AE1B 4C7ZA 3NVYA 2AX5A 1QF6A 3AEDB 3VR9B 1QOFA 2K9XA 5C3JB 1NYRA 4N58A 3P4PB 1FXAA 2WQYB 3AV8A 2WLBA 3LXFA 4KX6B 1DOYA 5G5HA 1FRRA 1VJKA 2QIEB 4YTNB 4YSZB 1KFYB 2E3TA 3AEFB 2K5PA 2PVOD 3AE9B 1I7HA 1N62A 5EE3A 3W5UB 1DOXA 3AEBB 3VRBB 4WQMA 3AMZA 3HVZA 1R7SA 2CJOA 4N59A 1FMAD 3W9CB 4C7YA 1J7BA 3AH7A 2MJ3A 2BT6A 2CU3A 3AE7B 3BIID 3AN1A 2WS3B 1FXIA 1XLNA 3SFDB 2BS3B 3VR8B 2Y5CA 3PO0A 5EE1A 4ZHPA 4JWSC 1TKEA 4HRSA 4ZHOA 1V8CA 3AB5A 4JX1C 1PFDA 1AYFA 3B2GA 1B9RA 1F0ZA 1JQ4A 1TKYA 2CJNA 3NVWA 1CJEA 1JWAD 1NEKB 4IDIA 3WCQA 1CZPA 2OHFA 3L4PA 1YQ4B 3SR6A 3AECB 1XLPA 3B2FA 1QOAA 1ZXIA 1J7CA 4YSYB 1FFUA 1XLOA 2DWQA 4A9AA 1PDXA 3ABVB 2WP9B 3AM9A 3P1MA 1DGJA 1NVID 3AE2B 4LTUA 1JALA 5G5GA 1VLBA 3KWLA 2EKIA 5MPOA 2B76B 4FXCA 1FM0D 1EWYC 1L0VB 3AEGB 3LB8C 4US9A 1E9MA 1L6UA 1WYGA 1DOIA 1FO4A 1L6VA 2WU2B 1YQ3B 1VDVA 3HUIA 2WU5B 3FC4A 1RYJA 1UWMA 2MJDA 3P4QB 2BS2B 1YJIA 3AE6B 1NI3A 2JX5A 1FIQA 3AEEB 5GXGB 1AWDA 2PIAA 1FFVA 1IUEA
chains in the Genus database with same CATH superfamily
1ZP0B 2NVUI 1T0YA 1OFFA 2BWES 2M0XA 4ICUA 3ZRCA 2DZJA 4FBJB 4BKSA 2BYVE 3QHTA 5C1ZA 2KWDA 3AEAB 1GB1A 1XLQA 4EZLA 1FEHA 3ZTDA 1XQQA 2JQRB 5C2TB 1Y8RC 3DHHC 4ZOHC 2KDFB 3RD2A 4NQKE 4J3OD 5G55A 3P4SB 3ZDTA 2LD9A 4A3PA 4A55A 2KOXA 2I2YA 1J7AA 4B9KA 3H7SA 2N0SB 2JU6X 4P7IA 5HI1A 1T5XD 4BKSD 1MG8A 3KYDD 3MC0B 4LLGM 1E5WA 4MM3B 2PPHA 1NYRA 4BZAA 1GC7A 5EE3A 2BB6A 2WXKA 2LFIA 2N9EB 2MBQA 2FE8A 3ZLZA 3AB5A 1B9RA 4RGOS 2WXFA 3X0WA 3KUDB 3GE8C 4KV2A 2LZ6A 2Z0EB 4IUMB 2K39A 1CQVA 1FCCC 5AZHA 3P1MA 3ZIMA 3J9CA 2K8HA 4MGYE 1UWXA 4WIPA 1L6UA 3H9DA 2W9NA 3DBRB 1J0GA 3FC4A 3PHWB 3P4QB 3U4EG 4LNOA 1ZKHA 1HEZE 1XEEA 2NR2A 4HKZE 2R2OA 2CS4A 1SXTA 4PK1A 2ACZB 3SD5A 1NI2A 1WH3A 2INNE 1NENB 3PRMB 5D7GA 2KJ6A 4P1BC 5KHQA 1QQRA 1L7YA 3VFKA 1YX6B 3FAHA 1C9FA 3MFGA 2GBKA 2L00B 1Q0WB 4KDLB 1TZOA 2EMTA 2KACA 3RPFC 1YJJA 3QIJA 4JGHB 3W5VB 3VRAB 2W3SA 1E7PB 1FRDA 3H1UA 2OJWA 2X38A 1YQBA 1F1HA 1MVKA 3UIPB 3ZDMC 2WX1A 2XK5B 2KVZA 1WGDA 1IPGA 4JWUC 4MGZE 1HZ6A 2LMCA 2G1EA 3WANA 2VZKD 3NZ3A 1QF6A 1WY8A 4FULA 4RF0A 5C3JB 3QWZB 4WJNA 1DOYA 3AV8A 1FNWA 4KX6B 2UYZB 2MSED 5IA7A 1IYFA 3PSEB 3DHIC 2KTRA 3NUHB 1I35A 4WAAA 1ZDXA 2M8SA 4AS1A 3V61A 2JYTA 3ML9A 4ANWA 4MH8A 4I6NB 2RPVA 3ZRFA 1WGYA 2WX0A 3TIXA 2OHFA 3DHGC 4P1CC 5HHDG 1J7CA 2VZKB 1L4ZB 2J0MA 3L16A 2ZVOA 4EFOA 5AZGA 2BWFA 3MHZA 3IT6B 1AW7A 1WE7A 3RT3B 1D3ZA 1NI3A 1AWDA 4MSMB 1NYQA 2OOBB 1E6EB 2KXJA 1JMLA 1TYGB 3L17A 2VH2A 3KYCD 4OZBA 4WH4A 3KLSX 1E8WA 2LJ5A 4C80A 3KQ4A 4HCNB 2L0FA 4W9EA 5HKHA 1KRHA 3IAM1 1F2RI 1KLGD 2KMCA 3I5JC 2L32A 3URYA 1K50A 1C3TA 1EU3A 1WI0A 1ZUD2 2FIDA 1HXYD 2ON8A 2OEDA 5LXIB 5IKCM 2KFKB 3PHXB 1WXSA 1XO3A 1ZOYB 2QJLA 2KN4A 1HQRD 1I4XA 1QT9A 2WWZA 3I63C 2Y5BB 1SE4A 4ASWC 1T6BX 1F52A 4TQ0A 2AX5A 3V6EB 2HTHA 3NZUA 1GJZA 2D10A 1VJKA 4IW0A 3PLUA 4GDLA 4PS3A 2C7MB 4KDIC 1TT5B 3WCQA 2D3AA 3AN1A 1ET9A 4AQ7A 4XGAB 3TEXA 1FXIA 3AULA 3KUCB 4OVZA 1V8CA 4ZHOA 4E71A 1AYFA 3GP7A 1I4HA 1UGJA 1J19A 3KVFB 3ZW3A 2KJRA 2KT7A 3CSFA 4AOFA 4ICVA 3DPDA 4ZYSA 2JRHA 3TMPB 1JWMD 5D2MB 2MJDA 2INPE 2KN5A 4KVGB 3N1YC 1GNUA 1SE3A 2KQ7A 3PRPB 4G11A 4NAWB 2YEPB 1BUIC 3C8YA 5BYQA 3NG0A 1GPXA 2K22A 4K7UA 2LVOA 3DBSA 1L5PA 1E8ZA 3R3MA 1F9JA 4KZCA 2AWTA 1L4DB 2GRIA 2FCSA 4XX5A 4ZRQA 4II2B 2BYTA 4IM2A 3N3KB 5J2RA 1V5TA 2ZPYA 4AJWA 1TS5A 2HE7A 4M8NA 4YT0B 2MP2B 1ET6A 2J4XA 1RAXA 4GXBA 2FUG1 2SAKA 3BY4B 2BPSA 1BT0A 3ZXRA 3QAQA 1LQBA 5KHOA 1WJ6A 2NCNA 1JWUD 3UIOB 1WMHB 4P16A 2K9XA 4FJYA 4XE0A 3PZ7A 1N62A 4GGQA 1IGCA 4A20A 1FMAD 1OEYA 3BVGA 2NMQA 3PGEA 3IXSA 2AQ1B 1SE2A 3DQVA 3A1QA 4WJOA 3U30A 1BMLC 3E56A 3OJ3A 2QC8A 4IM0A 2CU1A 3I57A 3MJWA 5CTRC 3EECA 3NVWA 1NEKB 3AU5A 5CHWA 4I6PA 4NJCA 1DYQA 3U52E 3M62B 4K81A 1Q10A 4NY0A 2RD0A 4B95A 2E6XA 4M8MA 3AE2B 2JPHA 4K7SA 2EKIA 2WXPA 1FM0D 1D5ZC 2AQ2B 1VR9A 1FO4A 4DHZB 4IKGA 2BBCA 1RYJA 1D4BA 3RNBC 5T8IA 3SU8X 2BTEA 4PYZA 2ZNVB 3WAOA 4YTPB 1PGBA 1TKGA 3APFA 5JXVA 2KC1A 2PKOA 2KLCA 1V80A 4YXDB 4G50A 3H7PA 4FHKA 1MHHE 1P7EA 4C00A 1V1PA 2LRWA 1WXQA 3ETRA 2LHDA 2GI9A 1QLBB 1Q5WB 3ZVVA 1YNTE 3DVGY 2QSDA 2IPKD 4I6LB 5TR5A 3R2IA 2ZCBA 1P98A 2M56B 2O2VA 2IGHA 3GZNB 3CF6E 2NPTA 4ARIA 3A9JA 4E74A 3A9KB 1WXMA 4US8A 3O13A 2KJHB 3AEDB 3EHVA 2G4SA 5FKAC 3NOBA 2LVQA 2WQYB 4TSSA 1G6JA 2L76A 2V4LA 4C4VB 4EZKA 3T3OA 1RFAA 3RNGC 3UQBA 4N59A 4F8CB 4JPSA 3RNCC 1TS3A 2Y5CA 1STEA 3PZDA 1UGMA 4K3CA 1V1OA 4KIKB 5IAAC 3L13A 5IO9A 4EKUA 4XWWA 2IGDA 4CYEA 4B0MA 3HK0A 3RFZB 4GDKB 2HJ1A 4PYUA 2LGYA 3RZFA 1RRBA 3L08A 2WU5B 2IO2B 3R2TA 4TQ1A 3MC9A 1YN5A 3E9SA 1C4PA 3N9YC 3ZNGC 1KM7A 3BINA 3NZSA 1SEBD 3P2BA 1WGKA 2WHIA 2W3RA 2MEKA 3EA6A 2H89B 3BVZA 4ANUA 2LVPA 1R4MI 3L54A 1SBBB 3P63A 2RDGA 3SFEB 1JCKB 3DBLB 4DWFA 3FKYA 4W9JA 3BK2A 2DZIA 3HM6X 4DDID 5D6JB 1WRIA 3AE3B 3AE4B 3AE8B 4A90A 3JVZX 2IDYA 3WAMA 4YWGG 3OWEB 4MEMA 2ICIA 2NTSA 3ONSA 3APCA 2D3GA 3ZUNA 2QILA 2HDEA 3AU4A 3VH3B 4AUQC 1YD8U 1KFYB 1ENFA 3JYUA 1I7HA 4WQMA 1UBQA 2CJOA 2GMIC 4C7YA 3SFDB 2CR5A 3PPAA 2KQSA 4M0WB 4WQOB 2PJHA 2JT4B 3V3XA 3HVDA 3H8HA 3IFWB 4EE2A 4MJSA 4GOCA 2FCQA 3OLMD 3Q3MC 3GOEA 2GBNA 4J6IA 3VAWA 1MJDA 1R4NI 1L0XB 3EC8A 1D6EC 4L2YA 5D3DA 2YEPF 4HWIB 2KWVB 1VDVA 1EM7A 2O6VA 3IAS1 4HDOA 3PZ8A 3DBHB 4BOZB 2IYDB 2QMTA 3AEEB 2WXGA 2PIAA 5E6OA 2KYWA 1WX9A 3RNAC 5GMVA 5FR3A 1RWSA 1WJUA 2LWPA 2LUEA 3Q3OC 3VQIA 2RR9A 2WXHA 3Q8EA 4WWPA 4EOYA 1P7FA 5FK9C 2K8CA 1L2NA 4KKJA 2AYOB 2PVGC 1KF6B 5C23A 4RNAA 2ONQA 2J42A 1JRUA 3IHPC 2XNAC 2DBYA 2O6VD 1S1QB 2IO0B 3ZNID 1TY0A 1QZEA 3HIZA 2UWQA 3K9OB 1RM6C 1V97A 2L83A 2IY1B 1JWSD 3M3JA 2KDBA 3W1SC 1VZ7A 5JHAA 4LNIA 3NS1A 1CK1A 2MLBA 5EDSA 2K6DB 3NS8A 1V86A 2MRPA 2G9HD 4CHKA 4HEA1 2XN9C 2ZPNA 2DNFA 2QCZA 2WLBA 2WXNA 5G5HA 1B1ZA 4XWTA 2PE9A 3BIID 1ISNA 3AE7B 3DCGA 2TSSA 4DK5A 2K6QA 2CJNA 3P42A 3AECB 1QILA 3V6CB 2WP9B 1F77A 4PT5A 1JALA 2JSVX 4RF1A 5MPOA 5DPSA 1L0VB 2AEHA 1UD7A 4L23A 1DOIA 2LUMA 2KNBA 1K8RB 3HM3A 1WGRA 2BQQA 3D32A 1PYWD 4S17A 1TTNA 1FPYA 4W9DA 3BYYB 4IOIE 2LGIA 2KWCA 3Q69A 4HLEA 2OJRA 5H8YE 1K52A 4GU2A 4P6VF 3JSVA 4HDQA 1N5WA 5AUKA 3VUXA 4PS8A 5L95C 3VHTC 1YOVB 3ALBA 2DYOA 3RNFC 2KLGA 3DDCB 4BOSC 3NVVA 3SDLC 4HROA 1HTOA 1UNSA 4N9F4 3VXWA 2LGXA 4UDUC 5AUIA 2WDVB 1WIAA 3OAWA 3GB1A 4MT5A 5JHBA 3DVNU 4XC2A 1N5XA 4HJKA 2N7JA 1UF0A 4O1NA 3N1ZC 2K1FA 1ZXHA 3AE1B 2KTRB 2FCMA 2M0AA 1QOFA 2GBRA 1WGHA 1S3SG 5JH5C 3BK1A 1TIFA 1ZE3D 4YSZB 1XXGA 2DLBA 3BZDB 3VTVA 4JL9A 3T3NA 5DPWA 4M02A 4GSWA 4HRSA 4JX1C 1PFDA 4NZLB 2FIFA 2KC2A 4ZRPA 3W2DA 4EUTA 4IDIA 4ANXA 1CZPA 1WM2A 1V9JA 3N32A 1UUPA 4TMAB 1PDXA 1C77A 1D5XC 1WXVA 3AM9A 4DXGA 2R61A 4MDKE 3EFUA 1BXTA 2MCNB 1UH6A 2R2QA 5HFYA 1TS4A 3CSTA 3DBRI 1WJ4A 3WA0A 3PV1A 3VUWA 3KUZA 4D2KA 2N4FA 3VUYA 2JWUA 2AL3A 1IGDA 3FILA 4LJPB 4NJ7A 2GLSA 3NVZA 2J7QB 5DPTA 3ZJVA 3IG3A 2MHJA 2PEAA 4A6QA 4BBNF 3B9JA 5J17A 2CHXA 4LNNA 3Q6BA 4WAFA 4IC7B 3I9V1 2BYFA 4FHJA 2LGSA 2WXMA 4XYCA 4FA6A 3L10B 1JROA 5HG2A 3HRDD 4MSQB 1I4QA 1YMHE 1YN4A 2GB1A 3VDZA 2D11A 4GDLB 1YIWA 3P4RB 2SEBD 2G3QB 3VR9B 2KK8A 1XCTL 3U2SC 2AL6A 2DZMA 2V9HA 5JZEB 3BYTB 1V81A 1WGGA 3AEFB 1DOXA 2BT6A 2JY6A 2N1WA 2BF8B 3PO0A 3ZJUA 3EFCA 1IBXA 3RZWC 1KTKA 3ZKJC 1YQ4B 1FD6A 4HPPA 1QOAA 1ZXIA 2DWQA 2RDHA 4K1RB 1WRDB 1DGJA 1NVID 4BVUC 2WXQA 3MP9A 4TV3A 3MHSD 1X1MA 1LM8B 4HJGE 4FXCA 3PLVA 3R7QA 1AN8A 1V49A 3HUIA 3U7ZA 3TSSA 4KSKC 2D07B 1FFVA 1RLFA 5BO4B 3N30A 3B0AA 2QHOA 4XZ4A 2IZVB 4RM8A 2Z0DB 2DAFA 2MW5A 1SB3C 1C4CA 3M95A 4DBGA 2HTME 3SHQA 1GUAB 2NBVB 4A8XC 4K3BA 1K51A 2LXAA 1A70A 1SIJA 1P9DU 1N60A 1KJTA 1OEYJ 1C79A 2PE6B 5E6NA 4WJPA 2XEWA 3ENEA 3RCZA 3RUIB 2L05A 2NS5A 1TZ1A 1ROEA 4YTMB 5DCNA 3CWIA 1E10A 3NY5A 2IO1B 2I1KA 2Y5PA 4YSXB 1V6EA 3W1YA 2K0PA 2I1JA 3Q8AA 3A1QB 4RMAA 2GBMA 1I4RA 4NPNA 3S2AA 5FR6A 4QAYA 1C78A 1ZDVA 2QIEB 1I4PA 2K8BA 2PVOD 2BGFA 3UI3A 1WR1A 2FAZA 4E3CA 1MPEA 3LYYA 4HKQA 1D5MC 2WYQA 3IT4B 1JWAD 4RM9A 5DPRA 4AJYB 1XCQL 1WFYA 3SEBA 2FUHB 4LTUA 2KDMA 3H6NA 1V2YA 4IG7B 4NJ6A 5D3IB 1E9MA 5CX3A 4IWPA 3UINB 3EGRA 3RNEC 4NNJB 1YJIA 2QEJC 3UF8A 1XT9B 4YSYB 3MTNB 3L0WB 3H7PB 2AQ3B 4HPMB 3TJPA 4CQNA 1V1PB 5EE0A 3TEYA 1E90A 4BBNC 4MELA 2HJ8A 5E6JA 1UBIA 3A33B 2V3PA 2A4ZA 2O2VB 2ZCCA 2NPTB 2KFJA 3V05A 3A9JB 3KW5B 4ARCA 3JW0X 1J8CA 3UQAA 1VZ8A 2WNMA 4B0EA 3VTWA 2W55A 5D94A 2LHEA 3GS2A 4GMVA 1KH0A 1GAQB 1OQRA 1TJEA 4H2AA 4GB9A 4BKTA 4ITKA 4USAA 3AE5B 4EZJA 4LNKA 4FN2A 3NVYA 2FCNA 3NJTA 3TBLD 3CMMB 3QC8B 3RMKC 2N9LA 2DYMA 1U4AA 3U7DA 1MFWA 1Q1OA 2EKEC 3AEBB 3HVZA 2VH1A 2N9PC 2V3SA 3PT2B 2CU3A 2DAJA 1E7VA 4MM3A 4OVUA 4K7WA 5E6PA 3ML8A 4REZA 5CHFA 1JQ4A 4JIOU 4XDCA 1TGZB 3NHEB 1XLPA 2L0TA 3Q3JA 4WWNA 2NBWB 4S0RA 2BKFA 2VRRB 3QX1A 1YJ1A 1EUVB 2JZPA 3AE6B 2JX5A 4W9IA 4LCDE 1N61A 4LNFA 4RGNA 2WXLA 1SF0A 3U8ZA 3AI5A 4WURA 4BKGA 5EE9A 5H92C 1PUTA 1I4GA 1M4VA 5BYRA 4X57B 1ZW7A 2WDRB 4TUUA 2IGGA 2KVRA 4KGSA 4LK0M 2LJIA 2N7DA 4HVBA 3EUB2 3T9LA 1WX7A 5IP4D 3C19A 2KMMA 2C9WB 4ACFA 4RGTA 1OGWA 2H88B 2MWSB 1GC6A 3GZNI 4URKA 2KDEB 3NRZA 2LXCA 3KH0A 4ZDVA 1Z5SB 4DQOC 4W9HA 2CHWA 1ZPSA 3DWGC 3WALA 2K25A 5IN7A 5LXHA 4MACA 1ESFA 1NBFC 4IWQA 2XK5A 3Q2AC 4AP4C 4YTNB 3AE9B 3QARA 2CKHB 4MJSB 1SIFA 1EF5A 1SE9A 1PGAA 3M63B 4ZHPA 3RI7C 1P3QU 1EF1A 1WYWB 3W1SA 1WE6A 2DYBA 2J52A 3SR6A 2JRIB 1XD3B 2O6VB 3N1XC 2X8XX 3R7RA 5AZFA 3I3TB 2KX3A 4LDTD 3Q8CA 2NTTA 2KHWB 1ACCA 1EU4A 3AEGB 1L6VA 2ZVNA 2ZJDA 5G2NA 1FNVA 1GB4A 1VRAB 1NDDA 2LASA 4HXDA 2N9KA 1OQQA 4M01A 4CO7A 1N63A 2IY0B 4WWMA 3PREA 2KZRA 1WX8A 1T0SC 4LDTB 4ZRKA 2G45B 1QOBA 3RULA 3ZNHB 2L52A 3PTFC 2PMVA 1SGHA 2L7RA 2MH7A 3QCAA 3Q8BA 4WJQA 2KAJA 3MJ5A 2M19A 5I4DA 3QK0A 1VD2A 4DHJD 1E8XA 2JYEA 3DBLI 1QOGA 1EWCA 1SSNA 1WWTA 2WXOA 1GOZA 4W9GA 4DXFA 2WDQB 4MH0E 1JWBD 1K53A 4XDDA 4ZYNA 4W9KA 2J53A 2YVCA 5BMIA 2BS4B 4RFBA 3TL5A 2Z8LA 1WR6E 2WXJA 3C0RB 5LLIA 2MA9B 2KWUB 3BWUD 1YN3A 2PW9A 1WZ3A 3DOWA 2KFKA 1V5OA 2PTLA 2INCC 5BMHA 4DXAB 3P4PB 3LXFA 4DHJB 3PRZA 4MGKE 2GOWA 3Q14C 2JXXA 3VH4B 2JUOA 2KMAA 3AMZA 1AARA 1GG3A 2J0KA 3W9CB 1KLUD 1J7BA 3AH7A 2MJ3A 2WS3B 2HD5B 2XBBC 3QA8A 3B2GA 1F0ZA 1TKYA 3K9PB 1CJEA 2BW2A 4LJOB 3LDZE 2LRUA 2C7NB 3PS6A 1M94A 1MHXA 3ABVB 1FNUA 2N7EA 1E8YA 2M17A 2QDFA 2KX0A 1WM3A 2BB5A 3JSVB 3ZNZB 1MG4A 3IBEA 5IOIA 1P0RA 3DBHI 3WAPA 1IUEA 3QQ8B 1ZGUB 3B08A 2KKCA 4JE3B 1OTRB 1WZ0A 1E7UA 2L8JA 4MGIE 1RFKA 1PGXA 2L3ZA 2RMMA 2IJ0A 1EO6A 4R3DA 2MBOA 4NAWA 1L0YB 3A4SC 2N9XA 2V4IB 2UU7A 4DDGD 1H4RA 1SJED 3BVMA 2RGFA 3Q8FA 2L1AA 2W82A 1C4AA 2IO3B 4FJZA 3ECIA 3IVFA 1WSPA 3Q3FA 1T3QA 2BVCA 2FBWB 4OHJA 3ZXVA 5L83A 1OQYA 2A5UA 1TY2A 2C5LC 1TBEA 4PS7A 4OW0A 1KOTA 2I38A 2MP2A 4KGRA 2PLPA 1FXAA 3R66C 1FRRA 2K5PA 2DHZA 3W5UB 4W9LA 2C7HA 1WMHA 4BFRA 4FLHA 1T0RC 1XLNA 4DHZE 4FJVB 1Y56A 2B3AA 2G4DB 1I42A 2KDIA 1A5RA 1LXDA 4B6WA 2BKRB 2V1YA 3B1LX 2WGSA 4KGTA 1WJNA 2JWZA 4F7ZA 2CHZA 1PQSA 1C76A 2FNJB 3T8MA 2B76B 1FXTB 4US9A 4ANVA 2MBHA 3ZJTA 3FILB 4OZAA 3R8BA 2RDBC 2IBIB 4HK2A 5GXGB 1UZXB 2WDTB 4OZCA 2MBBB 3VTUA 1HA5A 4HPLB 2ZNVC 1VZ6A 5CHVC 2NBUA 1R4MB 1N6ZA 3TCAA 1WF9A 2ZW1A 4W9FA 2M1MA 4W9CA 3CIRB 3UGBB 4WWOA 2KO3A 1TS2A 2KANA 1HTQA 1JW9D 3DWMA 2Z59B 4G3XB 4II3B 2REXA 4NQLB 2YLMA 1VCBA 3TEZA 3V60A 4C7ZA 4Q2JA 2LGDA 5BYSA 1UELA 4GLSC 2DZKA 2KQ4X 3O65B 3OG5A 4C56C 4KKIA 4OVVA 1SJHD 3A9KA 1IBXB 5BMGA 2E3TA 3KWVA 3TUOA 3VRBB 1R7SA 1KLVA 4RCOA 3ZTCA 3VR8B 2M4NA 3OJ4B 4RGMA 1TKEA 2D2QA 3AXCA 4C4VA 1LGRA 4ZRIA 2JF5A 2JZZA 3L4PA 2D5GA 1LFDA 1IP9A 2INDC 3B2FA 3RYTA 2JXTA 4A9AA 1HZ5A 3DVNV 1R4NB 2Y3AA 3QJZA 4BAXA 2EMSA 3TEWA 4KIKA 5G5GA 1VLBA 3GE3C 3KWLA 4EEWA 4TKNA 2ZW0A 2GBJA 4ZRJA 1YQ3B 3N20C 4IM3A 2K3UA 3LJ3A 1UWMA 4GDKA 2ASQA 2DENB 2MX2A 1FIQA 1LO5D 1WYGA 2V3NA 2BYEA 2MQJA 3MC8A 2ZZPB 1MI0A 3ZYYX 2D3CA 4IWOA 2W54A 3RN9C 2MJEA 1C1YB 1HE8A 3V62A 2Q5WD 4JLCA 2DX5B 2KD0A 3WIMA 4NAMA 1E0ZA 5TSSA 4KZ0A 4G0NB 4FADA 2KTFA 1XF5L 2N1VA 2WXIA 4RH6A 4N6EB 2LI5A 2RSUA 2WXRA 3ZO5B 2LEKA 1QKZA 4F1SA 2EELA 1JRPA 4M00A 4A3OA 4KSLC 3ZQ4A 2C60A 1P1AA 4N58A 4YL8A 1CMXB 3DVGX 1Z2MA 1YX5B 2D3BA 3APDA 3Q3NC 2RPQA 3A4RA 2V0GA 5AEKB 4HCPB 3ZGZA 4L1BA 2BS3B 5EE1A 4JWSC 4AWJA 5LNK1 1FCLA 2J0JA 1T0QC 1FFUA 1XLOA 3PVLA 4M0WA 3VVWB 4GN1A 2ZEQA 2JVCA 4GIVA 1EWYC 3LB8C 3X23A 2JZ3B 2WU2B 3HHMA 1H8CA 1F2RC 2MBEA 2BS2B 1WXAA 4JQWC 5J18A
chains in the Genus database with same CATH topology
4D2KA 1OQQA 1ZP0B 1OFFA 2JWUA 1N63A 4WWMA 4YTPB 1IGDA 1PGBA 1TKGA 3FILA 5JXVA 2PKOA 3NVZA 4YXDB 3ZJVA 1QOBA 2KWDA 3AEAB 4A6QA 1GB1A 1XLQA 2L52A 1FEHA 2PMVA 3B9JA 1MHHE 1P7EA 2MH7A 3Q8BA 2JQRB 1V1PA 2KAJA 3MJ5A 4WAFA 1WXQA 2M19A 5I4DA 3ETRA 5C2TB 4ZOHC 2LHDA 3I9V1 2GI9A 1QLBB 2JYEA 4J3OD 1QOGA 1EWCA 1SSNA 1WWTA 2WXOA 1GOZA 3P4SB 4DXFA 1YNTE 2WDQB 2QSDA 2WXMA 2IPKD 4A55A 3R2IA 1JWBD 1K53A 1J7AA 2M56B 4XDDA 2I2YA 2J53A 2IGHA 1JROA 5HG2A 3HRDD 5BMIA 1I4QA 4ARIA 2BS4B 2N0SB 2JU6X 4RFBA 1YMHE 5HI1A 1YN4A 2GB1A 1T5XD 2Z8LA 2WXJA 4US8A 3MC0B 4LLGM 4GDLB 3BWUD 3P4RB 1YN3A 3O13A 2SEBD 2PW9A 2PTLA 3AEDB 3VR9B 4MM3B 5BMHA 5FKAC 1NYRA 1XCTL 3P4PB 3LXFA 2WQYB 3U2SC 4TSSA 3BYTB 3T3OA 3AEFB 5EE3A 1DOXA 2BB6A 2WXKA 2LFIA 3AMZA 4N59A 3W9CB 1KLUD 1J7BA 3AH7A 2MJ3A 2BT6A 4JPSA 2WS3B 1TS3A 2Y5CA 3PO0A 2FE8A 1STEA 1V1OA 3AB5A 3ZJUA 1B9RA 3B2GA 1F0ZA 1IBXA 1KTKA 1TKYA 1CJEA 4RGOS 2BW2A 2WXFA 1YQ4B 4XWWA 1FD6A 1QOAA 1ZXIA 2IGDA 2DWQA 1MHXA 2RDHA 3ABVB 4B0MA 1CQVA 1FCCC 1FNUA 3RFZB 3P1MA 4GDKB 1DGJA 1NVID 2WXQA 3MP9A 3J9CA 4HJGE 1UWXA 4FXCA 4WIPA 1L6UA 1AN8A 2BB5A 3HUIA 2WU5B 3FC4A 3U7ZA 3R2TA 3TSSA 3P4QB 3U4EG 1HEZE 1XEEA 4HKZE 4TQ1A 1FFVA 1IUEA 1SXTA 1YN5A 3E9SA 1C4PA 2ACZB 3N9YC 1SEBD 1WGKA 4JE3B 2W3RA 2MEKA 3EA6A 2H89B 3BVZA 1SB3C 2INNE 1NENB 5D7GA 1C4CA 1RFKA 1PGXA 1QQRA 2RMMA 2IJ0A 3FAHA 1SBBB 3P63A 4R3DA 2HTME 1C9FA 3MFGA 4A8XC 1L0YB 2RDGA 1TZOA 1K51A 3SFEB 2KACA 3RPFC 2V4IB 1JCKB 1A70A 1YJJA 1SJED 1SIJA 3BVMA 3Q8FA 1N60A 2L1AA 2W82A 3BK2A 1C4AA 1C79A 3W5VB 3VRAB 2W3SA 1E7PB 1FRDA 1WRIA 2X38A 3AE3B 3AE4B 1WSPA 1MVKA 1T3QA 2FBWB 3AE8B 4A90A 1ROEA 4YTMB 4OHJA 3CWIA 1E10A 2IDYA 4JWUC 4YSXB 1HZ6A 2LMCA 2G1EA 2Y5PA 4YWGG 1TY2A 3OWEB 2ICIA 2NTSA 2VZKD 3NZ3A 4OW0A 1QF6A 2I38A 4KGRA 2K0PA 3Q8AA 4RF0A 2PLPA 5C3JB 1I4RA 1DOYA 1FXAA 2QILA 1FNWA 3AV8A 4KX6B 2HDEA 1C78A 1ZDVA 1FRRA 2QIEB 1I4PA 1KFYB 1ENFA 2K5PA 2PVOD 1I7HA 3W5UB 4WQMA 3UI3A 2CJOA 4C7YA 3NUHB 1ZDXA 3SFDB 4AS1A 1MPEA 1XLNA 3LYYA 2JYTA 4HKQA 1Y56A 4MH8A 1D5MC 3V3XA 3HVDA 2RPVA 3H8HA 4EE2A 3IT4B 1JWAD 2OHFA 4KGTA 5HHDG 1J7CA 1XCQL 1L4ZB 2VZKB 3SEBA 1C76A 1L0XB 2KDMA 4LTUA 1D6EC 2B76B 5D3IB 4L2YA 5D3DA 2YEPF 4US9A 1E9MA 3ZJTA 1VDVA 1EM7A 3FILB 3IAS1 4OZAA 3EGRA 3R8BA 3MHZA 3PZ8A 3IT6B 1AW7A 1YJIA 2QEJC 2QMTA 1NI3A 3AEEB 5GXGB 1AWDA 2PIAA 2WXGA 4YSYB 1NYQA 5FR3A 2AQ3B 1E6EB 4OZCA 4CQNA 1JMLA 1TYGB 1RWSA 4WH4A 1HA5A 4OZBA 1V1PB 3VQIA 3KLSX 5EE0A 2WXHA 3Q8EA 3TEYA 4C80A 1P7FA 1VZ6A 3KQ4A 5FK9C 4KKJA 2PVGC 2ZW1A 1KRHA 3IAM1 5E6JA 1KF6B 1F2RI 1KLGD 4RNAA 2ONQA 2L32A 2V3PA 1K50A 2J42A 3URYA 2XNAC 2DBYA 3V05A 1TY0A 3CIRB 4ARCA 1TS2A 1EU3A 1ZUD2 1HXYD 1VZ8A 2WNMA 1RM6C 1V97A 1JW9D 2L83A 2OEDA 2ON8A 4B0EA 3DWMA 1JWSD 2W55A 2LHEA 3GS2A 1VZ7A 1KH0A 1XO3A 1ZOYB 3NS1A 1CK1A 1GAQB 1OQRA 2QJLA 1TJEA 4H2AA 4ITKA 2KN4A 1HQRD 1I4XA 1QT9A 4USAA 3AE5B 3TEZA 2G9HD 1SE4A 1T6BX 4C7ZA 4Q2JA 3NVYA 5BYSA 4TQ0A 4GLSC 2AX5A 4HEA1 2KQ4X 2XN9C 4C56C 4KKIA 2WLBA 2WXNA 5G5HA 1SJHD 1VJKA 2N9LA 1IBXB 5BMGA 2DYMA 2E3TA 1B1ZA 3KWVA 3TUOA 3AEBB 4XWTA 3VRBB 3HVZA 1R7SA 4RCOA 3WCQA 3BIID 3AN1A 1ET9A 2CU3A 3AE7B 3TEXA 3VR8B 1FXIA 4AQ7A 2TSSA 4RGMA 1TKEA 4OVZA 1V8CA 4ZHOA 4REZA 1AYFA 1JQ4A 4XDCA 3GP7A 2CJNA 1I4HA 3P42A 1UGJA 3L4PA 2D5GA 3AECB 1XLPA 3B2FA 1QILA 2JXTA 4A9AA 2WP9B 1HZ5A 1F77A 4ZYSA 2Y3AA 4PT5A 1JALA 3TEWA 1JWMD 2JSVX 1VLBA 4RF1A 5G5GA 3KWLA 5MPOA 1L0VB 2ZW0A 4L23A 1DOIA 2LUMA 1YQ3B 2K3UA 1UWMA 2MJDA 2INPE 1PYWD 2JZPA 3AE6B 2JX5A 1FIQA 1LO5D 1WYGA 1SE3A 3BYYB 2V3NA 1N61A 4IOIE 2LGIA 3Q69A 5H8YE 4NAWB 2YEPB 1K52A 4RGNA 2WXLA 1SF0A 4P6VF 1MI0A 1BUIC 1N5WA 5AUKA 3ZYYX 4WURA 3C8YA 5EE9A 5H92C 1PUTA 1I4GA 1M4VA 5BYQA 5BYRA 1GPXA 2DYOA 2W54A 2K22A 2WDRB 2MJEA 1L5PA 2IGGA 2Q5WD 4KGSA 4LK0M 2LJIA 1L4DB 3NVVA 2GRIA 4NAMA 3EUB2 1E0ZA 4HROA 5TSSA 4ZRQA 1UNSA 4UDUC 2KMMA 2BYTA 1XF5L 5AUIA 2WDVB 2WXIA 4RH6A 4N6EB 4RGTA 2WXRA 1TS5A 2H88B 4YT0B 3GB1A 4MT5A 1ET6A 2J4XA 1QKZA 2LEKA 2FUG1 2EELA 2SAKA 1JRPA 1N5XA 3NRZA 2N7JA 4O1NA 3ZQ4A 4DQOC 1ZPSA 3DWGC 1ZXHA 3AE1B 1JWUD 2M0AA 4P16A 4MACA 1ESFA 1QOFA 2K9XA 4N58A 3BK1A 1ZE3D 4YTNB 4YSZB 1XXGA 4XE0A 3AE9B 3PZ7A 1N62A 2DLBA 1IGCA 3BZDB 2V0GA 1FMAD 3BVGA 2NMQA 3T3NA 3IXSA 3ZGZA 2AQ1B 1SE2A 4L1BA 2BS3B 1BMLC 1PGAA 3E56A 5EE1A 4ZHPA 4JWSC 4HRSA 3I57A 1PFDA 4JX1C 4NZLB 3W1SA 5LNK1 4ZRPA 3W2DA 3NVWA 4IDIA 1NEKB 2J52A 1CZPA 1FCLA 3SR6A 4NJCA 1DYQA 3U52E 1Q10A 1UUPA 1FFUA 1XLOA 4TMAB 1PDXA 2E6XA 1C77A 1D5XC 3AM9A 4M0WA 3Q8CA 2NTTA 4DXGA 3AE2B 1ACCA 2R61A 1EU4A 2EKIA 2WXPA 1BXTA 1FM0D 1EWYC 1D5ZC 2AQ2B 3AEGB 3LB8C 1VR9A 5HFYA 1FO4A 1L6VA 1TS4A 2BBCA 2WU2B 4IKGA 1F2RC 1RYJA 1D4BA 1FNVA 2BS2B 1GB4A 5T8IA 1VRAB 2BTEA 2N9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYQ A;  1OQQ A;  1N61 A;  1ZP0 B;  2ACZ B;  1E6E B;  1OFF A;  5H8Y E;  1N63 A;  1TYG B;  1RWS A;  1WGK A;  4WWM A;  4P6V F;  1SF0 A;  2W3R A;  4YTP B;  1N5W A;  5AUK A;  1TKG A;  5EE0 A;  2H89 B;  3ZYY X;  1SB3 C;  5EE9 A;  1NEN B;  2PKO A;  1PUT A;  5H92 C;  4C80 A;  3NVZ A;  1RFK A;  4YXD B;  1GPX A;  1QOB A;  2K22 A;  2PVG C;  2W54 A;  1KRH A;  3AEA B;  2WDR B;  1KF6 B;  2MJE A;  1XLQ A;  2L52 A;  3FAH A;  1L5P A;  3P63 A;  2HTM E;  3B9J A;  2MH7 A;  2JQR B;  2Q5W D;  2KAJ A;  1WXQ A;  2M19 A;  3SFE B;  3ETR A;  3NVV A;  5C2T B;  2DBY A;  4ZOH C;  3RPF C;  3EUB 2;  1E0Z A;  4HRO A;  1A70 A;  1YJJ A;  3CIR B;  1QLB B;  1SIJ A;  1QOG A;  1WWT A;  1N60 A;  3P4S B;  1ZUD 2;  2KMM A;  2WDQ B;  1RM6 C;  1V97 A;  1JW9 D;  2L83 A;  2WDV B;  5AUI A;  2W3S A;  3VRA B;  3W5V B;  1E7P B;  1FRD A;  3DWM A;  4N6E B;  2W55 A;  1JWB D;  2M56 B;  1J7A A;  1WRI A;  2H88 B;  4YT0 B;  3AE3 B;  3AE4 B;  2LEK A;  1XO3 A;  1T3Q A;  1ZOY B;  3NS1 A;  1GAQ B;  1JRO A;  1OQR A;  1JRP A;  1TJE A;  2FBW B;  2BS4 B;  2N0S B;  1ROE A;  2QJL A;  3AE8 B;  3HRD D;  4ITK A;  4YTM B;  1N5X A;  1QT9 A;  3CWI A;  3NRZ A;  4USA A;  1E10 A;  4US8 A;  4JWU C;  3AE5 B;  4YSX B;  2G1E A;  3P4R B;  3DWG C;  3AE1 B;  4C7Z A;  3NVY A;  2AX5 A;  1QF6 A;  3AED B;  3VR9 B;  1QOF A;  2K9X A;  5C3J B;  1NYR A;  4N58 A;  3P4P B;  1FXA A;  2WQY B;  3AV8 A;  2WLB A;  3LXF A;  4KX6 B;  1DOY A;  5G5H A;  1FRR A;  1VJK A;  2QIE B;  4YTN B;  4YSZ B;  1KFY B;  2E3T A;  3AEF B;  2K5P A;  2PVO D;  3AE9 B;  1I7H A;  1N62 A;  5EE3 A;  3W5U B;  1DOX A;  3AEB B;  3VRB B;  4WQM A;  3AMZ A;  3HVZ A;  1R7S A;  2CJO A;  4N59 A;  1FMA D;  3W9C B;  4C7Y A;  1J7B A;  3AH7 A;  2MJ3 A;  2BT6 A;  2CU3 A;  3AE7 B;  3BII D;  3AN1 A;  2WS3 B;  1FXI A;  1XLN A;  3SFD B;  2BS3 B;  3VR8 B;  2Y5C A;  3PO0 A;  5EE1 A;  4ZHP A;  4JWS C;  1TKE A;  4HRS A;  4ZHO A;  1V8C A;  3AB5 A;  4JX1 C;  1PFD A;  1AYF A;  3B2G A;  1B9R A;  1F0Z A;  1JQ4 A;  1TKY A;  2CJN A;  3NVW A;  1CJE A;  1JWA D;  1NEK B;  4IDI A;  3WCQ A;  1CZP A;  2OHF A;  3L4P A;  1YQ4 B;  3SR6 A;  3AEC B;  1XLP A;  3B2F A;  1QOA A;  1ZXI A;  1J7C A;  4YSY B;  1FFU A;  1XLO A;  2DWQ A;  4A9A A;  1PDX A;  3ABV B;  2WP9 B;  3AM9 A;  3P1M A;  1DGJ A;  1NVI D;  3AE2 B;  4LTU A;  1JAL A;  5G5G A;  1VLB A;  3KWL A;  2EKI A;  5MPO A;  2B76 B;  4FXC A;  1FM0 D;  1EWY C;  1L0V B;  3AEG B;  3LB8 C;  4US9 A;  1E9M A;  1L6U A;  1WYG A;  1DOI A;  1FO4 A;  1L6V A;  2WU2 B;  1YQ3 B;  1VDV A;  3HUI A;  2WU5 B;  3FC4 A;  1RYJ A;  1UWM A;  2MJD A;  3P4Q B;  2BS2 B;  1YJI A;  3AE6 B;  1NI3 A;  2JX5 A;  1FIQ A;  3AEE B;  5GXG B;  1AWD A;  2PIA A;  1FFV A;  1IUE A; 
#chains in the Genus database with same CATH topology
 1ZP0 B;  2NVU I;  1T0Y A;  1OFF A;  2BWE S;  2M0X A;  4ICU A;  3ZRC A;  2DZJ A;  4FBJ B;  4BKS A;  2BYV E;  3QHT A;  5C1Z A;  2KWD A;  3AEA B;  1GB1 A;  1XLQ A;  4EZL A;  1FEH A;  3ZTD A;  1XQQ A;  2JQR B;  5C2T B;  1Y8R C;  3DHH C;  4ZOH C;  2KDF B;  3RD2 A;  4NQK E;  4J3O D;  5G55 A;  3P4S B;  3ZDT A;  2LD9 A;  4A3P A;  4A55 A;  2KOX A;  2I2Y A;  1J7A A;  4B9K A;  3H7S A;  2N0S B;  2JU6 X;  4P7I A;  5HI1 A;  1T5X D;  4BKS D;  1MG8 A;  3KYD D;  3MC0 B;  4LLG M;  1E5W A;  4MM3 B;  2PPH A;  1NYR A;  4BZA A;  1GC7 A;  5EE3 A;  2BB6 A;  2WXK A;  2LFI A;  2N9E B;  2MBQ A;  2FE8 A;  3ZLZ A;  3AB5 A;  1B9R A;  4RGO S;  2WXF A;  3X0W A;  3KUD B;  3GE8 C;  4KV2 A;  2LZ6 A;  2Z0E B;  4IUM B;  2K39 A;  1CQV A;  1FCC C;  5AZH A;  3P1M A;  3ZIM A;  3J9C A;  2K8H A;  4MGY E;  1UWX A;  4WIP A;  1L6U A;  3H9D A;  2W9N A;  3DBR B;  1J0G A;  3FC4 A;  3PHW B;  3P4Q B;  3U4E G;  4LNO A;  1ZKH A;  1HEZ E;  1XEE A;  2NR2 A;  4HKZ E;  2R2O A;  2CS4 A;  1SXT A;  4PK1 A;  2ACZ B;  3SD5 A;  1NI2 A;  1WH3 A;  2INN E;  1NEN B;  3PRM B;  5D7G A;  2KJ6 A;  4P1B C;  5KHQ A;  1QQR A;  1L7Y A;  3VFK A;  1YX6 B;  3FAH A;  1C9F A;  3MFG A;  2GBK A;  2L00 B;  1Q0W B;  4KDL B;  1TZO A;  2EMT A;  2KAC A;  3RPF C;  1YJJ A;  3QIJ A;  4JGH B;  3W5V B;  3VRA B;  2W3S A;  1E7P B;  1FRD A;  3H1U A;  2OJW A;  2X38 A;  1YQB A;  1F1H A;  1MVK A;  3UIP B;  3ZDM C;  2WX1 A;  2XK5 B;  2KVZ A;  1WGD A;  1IPG A;  4JWU C;  4MGZ E;  1HZ6 A;  2LMC A;  2G1E A;  3WAN A;  2VZK D;  3NZ3 A;  1QF6 A;  1WY8 A;  4FUL A;  4RF0 A;  5C3J B;  3QWZ B;  4WJN A;  1DOY A;  3AV8 A;  1FNW A;  4KX6 B;  2UYZ B;  2MSE D;  5IA7 A;  1IYF A;  3PSE B;  3DHI C;  2KTR A;  3NUH B;  1I35 A;  4WAA A;  1ZDX A;  2M8S A;  4AS1 A;  3V61 A;  2JYT A;  3ML9 A;  4ANW A;  4MH8 A;  4I6N B;  2RPV A;  3ZRF A;  1WGY A;  2WX0 A;  3TIX A;  2OHF A;  3DHG C;  4P1C C;  5HHD G;  1J7C A;  2VZK B;  1L4Z B;  2J0M A;  3L16 A;  2ZVO A;  4EFO A;  5AZG A;  2BWF A;  3MHZ A;  3IT6 B;  1AW7 A;  1WE7 A;  3RT3 B;  1D3Z A;  1NI3 A;  1AWD A;  4MSM B;  1NYQ A;  2OOB B;  1E6E B;  2KXJ A;  1JML A;  1TYG B;  3L17 A;  2VH2 A;  3KYC D;  4OZB A;  4WH4 A;  3KLS X;  1E8W A;  2LJ5 A;  4C80 A;  3KQ4 A;  4HCN B;  2L0F A;  4W9E A;  5HKH A;  1KRH A;  3IAM 1;  1F2R I;  1KLG D;  2KMC A;  3I5J C;  2L32 A;  3URY A;  1K50 A;  1C3T A;  1EU3 A;  1WI0 A;  1ZUD 2;  2FID A;  1HXY D;  2ON8 A;  2OED A;  5LXI B;  5IKC M;  2KFK B;  3PHX B;  1WXS A;  1XO3 A;  1ZOY B;  2QJL A;  2KN4 A;  1HQR D;  1I4X A;  1QT9 A;  2WWZ A;  3I63 C;  2Y5B B;  1SE4 A;  4ASW C;  1T6B X;  1F52 A;  4TQ0 A;  2AX5 A;  3V6E B;  2HTH A;  3NZU A;  1GJZ A;  2D10 A;  1VJK A;  4IW0 A;  3PLU A;  4GDL A;  4PS3 A;  2C7M B;  4KDI C;  1TT5 B;  3WCQ A;  2D3A A;  3AN1 A;  1ET9 A;  4AQ7 A;  4XGA B;  3TEX A;  1FXI A;  3AUL A;  3KUC B;  4OVZ A;  1V8C A;  4ZHO A;  4E71 A;  1AYF A;  3GP7 A;  1I4H A;  1UGJ A;  1J19 A;  3KVF B;  3ZW3 A;  2KJR A;  2KT7 A;  3CSF A;  4AOF A;  4ICV A;  3DPD A;  4ZYS A;  2JRH A;  3TMP B;  1JWM D;  5D2M B;  2MJD A;  2INP E;  2KN5 A;  4KVG B;  3N1Y C;  1GNU A;  1SE3 A;  2KQ7 A;  3PRP B;  4G11 A;  4NAW B;  2YEP B;  1BUI C;  3C8Y A;  5BYQ A;  3NG0 A;  1GPX A;  2K22 A;  4K7U A;  2LVO A;  3DBS A;  1L5P A;  1E8Z A;  3R3M A;  1F9J A;  4KZC A;  2AWT A;  1L4D B;  2GRI A;  2FCS A;  4XX5 A;  4ZRQ A;  4II2 B;  2BYT A;  4IM2 A;  3N3K B;  5J2R A;  1V5T A;  2ZPY A;  4AJW A;  1TS5 A;  2HE7 A;  4M8N A;  4YT0 B;  2MP2 B;  1ET6 A;  2J4X A;  1RAX A;  4GXB A;  2FUG 1;  2SAK A;  3BY4 B;  2BPS A;  1BT0 A;  3ZXR A;  3QAQ A;  1LQB A;  5KHO A;  1WJ6 A;  2NCN A;  1JWU D;  3UIO B;  1WMH B;  4P16 A;  2K9X A;  4FJY A;  4XE0 A;  3PZ7 A;  1N62 A;  4GGQ A;  1IGC A;  4A20 A;  1FMA D;  1OEY A;  3BVG A;  2NMQ A;  3PGE A;  3IXS A;  2AQ1 B;  1SE2 A;  3DQV A;  3A1Q A;  4WJO A;  3U30 A;  1BML C;  3E56 A;  3OJ3 A;  2QC8 A;  4IM0 A;  2CU1 A;  3I57 A;  3MJW A;  5CTR C;  3EEC A;  3NVW A;  1NEK B;  3AU5 A;  5CHW A;  4I6P A;  4NJC A;  1DYQ A;  3U52 E;  3M62 B;  4K81 A;  1Q10 A;  4NY0 A;  2RD0 A;  4B95 A;  2E6X A;  4M8M A;  3AE2 B;  2JPH A;  4K7S A;  2EKI A;  2WXP A;  1FM0 D;  1D5Z C;  2AQ2 B;  1VR9 A;  1FO4 A;  4DHZ B;  4IKG A;  2BBC A;  1RYJ A;  1D4B A;  3RNB C;  5T8I A;  3SU8 X;  2BTE A;  4PYZ A;  2ZNV B;  3WAO A;  4YTP B;  1PGB A;  1TKG A;  3APF A;  5JXV A;  2KC1 A;  2PKO A;  2KLC A;  1V80 A;  4YXD B;  4G50 A;  3H7P A;  4FHK A;  1MHH E;  1P7E A;  4C00 A;  1V1P A;  2LRW A;  1WXQ A;  3ETR A;  2LHD A;  2GI9 A;  1QLB B;  1Q5W B;  3ZVV A;  1YNT E;  3DVG Y;  2QSD A;  2IPK D;  4I6L B;  5TR5 A;  3R2I A;  2ZCB A;  1P98 A;  2M56 B;  2O2V A;  2IGH A;  3GZN B;  3CF6 E;  2NPT A;  4ARI A;  3A9J A;  4E74 A;  3A9K B;  1WXM A;  4US8 A;  3O13 A;  2KJH B;  3AED B;  3EHV A;  2G4S A;  5FKA C;  3NOB A;  2LVQ A;  2WQY B;  4TSS A;  1G6J A;  2L76 A;  2V4L A;  4C4V B;  4EZK A;  3T3O A;  1RFA A;  3RNG C;  3UQB A;  4N59 A;  4F8C B;  4JPS A;  3RNC C;  1TS3 A;  2Y5C A;  1STE A;  3PZD A;  1UGM A;  4K3C A;  1V1O A;  4KIK B;  5IAA C;  3L13 A;  5IO9 A;  4EKU A;  4XWW A;  2IGD A;  4CYE A;  4B0M A;  3HK0 A;  3RFZ B;  4GDK B;  2HJ1 A;  4PYU A;  2LGY A;  3RZF A;  1RRB A;  3L08 A;  2WU5 B;  2IO2 B;  3R2T A;  4TQ1 A;  3MC9 A;  1YN5 A;  3E9S A;  1C4P A;  3N9Y C;  3ZNG C;  1KM7 A;  3BIN A;  3NZS A;  1SEB D;  3P2B A;  1WGK A;  2WHI A;  2W3R A;  2MEK A;  3EA6 A;  2H89 B;  3BVZ A;  4ANU A;  2LVP A;  1R4M I;  3L54 A;  1SBB B;  3P63 A;  2RDG A;  3SFE B;  1JCK B;  3DBL B;  4DWF A;  3FKY A;  4W9J A;  3BK2 A;  2DZI A;  3HM6 X;  4DDI D;  5D6J B;  1WRI A;  3AE3 B;  3AE4 B;  3AE8 B;  4A90 A;  3JVZ X;  2IDY A;  3WAM A;  4YWG G;  3OWE B;  4MEM A;  2ICI A;  2NTS A;  3ONS A;  3APC A;  2D3G A;  3ZUN A;  2QIL A;  2HDE A;  3AU4 A;  3VH3 B;  4AUQ C;  1YD8 U;  1KFY B;  1ENF A;  3JYU A;  1I7H A;  4WQM A;  1UBQ A;  2CJO A;  2GMI C;  4C7Y A;  3SFD B;  2CR5 A;  3PPA A;  2KQS A;  4M0W B;  4WQO B;  2PJH A;  2JT4 B;  3V3X A;  3HVD A;  3H8H A;  3IFW B;  4EE2 A;  4MJS A;  4GOC A;  2FCQ A;  3OLM D;  3Q3M C;  3GOE A;  2GBN A;  4J6I A;  3VAW A;  1MJD A;  1R4N I;  1L0X B;  3EC8 A;  1D6E C;  4L2Y A;  5D3D A;  2YEP F;  4HWI B;  2KWV B;  1VDV A;  1EM7 A;  2O6V A;  3IAS 1;  4HDO A;  3PZ8 A;  3DBH B;  4BOZ B;  2IYD B;  2QMT A;  3AEE B;  2WXG A;  2PIA A;  5E6O A;  2KYW A;  1WX9 A;  3RNA C;  5GMV A;  5FR3 A;  1RWS A;  1WJU A;  2LWP A;  2LUE A;  3Q3O C;  3VQI A;  2RR9 A;  2WXH A;  3Q8E A;  4WWP A;  4EOY A;  1P7F A;  5FK9 C;  2K8C A;  1L2N A;  4KKJ A;  2AYO B;  2PVG C;  1KF6 B;  5C23 A;  4RNA A;  2ONQ A;  2J42 A;  1JRU A;  3IHP C;  2XNA C;  2DBY A;  2O6V D;  1S1Q B;  2IO0 B;  3ZNI D;  1TY0 A;  1QZE A;  3HIZ A;  2UWQ A;  3K9O B;  1RM6 C;  1V97 A;  2L83 A;  2IY1 B;  1JWS D;  3M3J A;  2KDB A;  3W1S C;  1VZ7 A;  5JHA A;  4LNI A;  3NS1 A;  1CK1 A;  2MLB A;  5EDS A;  2K6D B;  3NS8 A;  1V86 A;  2MRP A;  2G9H D;  4CHK A;  4HEA 1;  2XN9 C;  2ZPN A;  2DNF A;  2QCZ A;  2WLB A;  2WXN A;  5G5H A;  1B1Z A;  4XWT A;  2PE9 A;  3BII D;  1ISN A;  3AE7 B;  3DCG A;  2TSS A;  4DK5 A;  2K6Q A;  2CJN A;  3P42 A;  3AEC B;  1QIL A;  3V6C B;  2WP9 B;  1F77 A;  4PT5 A;  1JAL A;  2JSV X;  4RF1 A;  5MPO A;  5DPS A;  1L0V B;  2AEH A;  1UD7 A;  4L23 A;  1DOI A;  2LUM A;  2KNB A;  1K8R B;  3HM3 A;  1WGR A;  2BQQ A;  3D32 A;  1PYW D;  4S17 A;  1TTN A;  1FPY A;  4W9D A;  3BYY B;  4IOI E;  2LGI A;  2KWC A;  3Q69 A;  4HLE A;  2OJR A;  5H8Y E;  1K52 A;  4GU2 A;  4P6V F;  3JSV A;  4HDQ A;  1N5W A;  5AUK A;  3VUX A;  4PS8 A;  5L95 C;  3VHT C;  1YOV B;  3ALB A;  2DYO A;  3RNF C;  2KLG A;  3DDC B;  4BOS C;  3NVV A;  3SDL C;  4HRO A;  1HTO A;  1UNS A;  4N9F 4;  3VXW A;  2LGX A;  4UDU C;  5AUI A;  2WDV B;  1WIA A;  3OAW A;  3GB1 A;  4MT5 A;  5JHB A;  3DVN U;  4XC2 A;  1N5X A;  4HJK A;  2N7J A;  1UF0 A;  4O1N A;  3N1Z C;  2K1F A;  1ZXH A;  3AE1 B;  2KTR B;  2FCM A;  2M0A A;  1QOF A;  2GBR A;  1WGH A;  1S3S G;  5JH5 C;  3BK1 A;  1TIF A;  1ZE3 D;  4YSZ B;  1XXG A;  2DLB A;  3BZD B;  3VTV A;  4JL9 A;  3T3N A;  5DPW A;  4M02 A;  4GSW A;  4HRS A;  4JX1 C;  1PFD A;  4NZL B;  2FIF A;  2KC2 A;  4ZRP A;  3W2D A;  4EUT A;  4IDI A;  4ANX A;  1CZP A;  1WM2 A;  1V9J A;  3N32 A;  1UUP A;  4TMA B;  1PDX A;  1C77 A;  1D5X C;  1WXV A;  3AM9 A;  4DXG A;  2R61 A;  4MDK E;  3EFU A;  1BXT A;  2MCN B;  1UH6 A;  2R2Q A;  5HFY A;  1TS4 A;  3CST A;  3DBR I;  1WJ4 A;  3WA0 A;  3PV1 A;  3VUW A;  3KUZ A;  4D2K A;  2N4F A;  3VUY A;  2JWU A;  2AL3 A;  1IGD A;  3FIL A;  4LJP B;  4NJ7 A;  2GLS A;  3NVZ A;  2J7Q B;  5DPT A;  3ZJV A;  3IG3 A;  2MHJ A;  2PEA A;  4A6Q A;  4BBN F;  3B9J A;  5J17 A;  2CHX A;  4LNN A;  3Q6B A;  4WAF A;  4IC7 B;  3I9V 1;  2BYF A;  4FHJ A;  2LGS A;  2WXM A;  4XYC A;  4FA6 A;  3L10 B;  1JRO A;  5HG2 A;  3HRD D;  4MSQ B;  1I4Q A;  1YMH E;  1YN4 A;  2GB1 A;  3VDZ A;  2D11 A;  4GDL B;  1YIW A;  3P4R B;  2SEB D;  2G3Q B;  3VR9 B;  2KK8 A;  1XCT L;  3U2S C;  2AL6 A;  2DZM A;  2V9H A;  5JZE B;  3BYT B;  1V81 A;  1WGG A;  3AEF B;  1DOX A;  2BT6 A;  2JY6 A;  2N1W A;  2BF8 B;  3PO0 A;  3ZJU A;  3EFC A;  1IBX A;  3RZW C;  1KTK A;  3ZKJ C;  1YQ4 B;  1FD6 A;  4HPP A;  1QOA A;  1ZXI A;  2DWQ A;  2RDH A;  4K1R B;  1WRD B;  1DGJ A;  1NVI D;  4BVU C;  2WXQ A;  3MP9 A;  4TV3 A;  3MHS D;  1X1M A;  1LM8 B;  4HJG E;  4FXC A;  3PLV A;  3R7Q A;  1AN8 A;  1V49 A;  3HUI A;  3U7Z A;  3TSS A;  4KSK C;  2D07 B;  1FFV A;  1RLF A;  5BO4 B;  3N30 A;  3B0A A;  2QHO A;  4XZ4 A;  2IZV B;  4RM8 A;  2Z0D B;  2DAF A;  2MW5 A;  1SB3 C;  1C4C A;  3M95 A;  4DBG A;  2HTM E;  3SHQ A;  1GUA B;  2NBV B;  4A8X C;  4K3B A;  1K51 A;  2LXA A;  1A70 A;  1SIJ A;  1P9D U;  1N60 A;  1KJT A;  1OEY J;  1C79 A;  2PE6 B;  5E6N A;  4WJP A;  2XEW A;  3ENE A;  3RCZ A;  3RUI B;  2L05 A;  2NS5 A;  1TZ1 A;  1ROE A;  4YTM B;  5DCN A;  3CWI A;  1E10 A;  3NY5 A;  2IO1 B;  2I1K A;  2Y5P A;  4YSX B;  1V6E A;  3W1Y A;  2K0P A;  2I1J A;  3Q8A A;  3A1Q B;  4RMA A;  2GBM A;  1I4R A;  4NPN A;  3S2A A;  5FR6 A;  4QAY A;  1C78 A;  1ZDV A;  2QIE B;  1I4P A;  2K8B A;  2PVO D;  2BGF A;  3UI3 A;  1WR1 A;  2FAZ A;  4E3C A;  1MPE A;  3LYY A;  4HKQ A;  1D5M C;  2WYQ A;  3IT4 B;  1JWA D;  4RM9 A;  5DPR A;  4AJY B;  1XCQ L;  1WFY A;  3SEB A;  2FUH B;  4LTU A;  2KDM A;  3H6N A;  1V2Y A;  4IG7 B;  4NJ6 A;  5D3I B;  1E9M A;  5CX3 A;  4IWP A;  3UIN B;  3EGR A;  3RNE C;  4NNJ B;  1YJI A;  2QEJ C;  3UF8 A;  1XT9 B;  4YSY B;  3MTN B;  3L0W B;  3H7P B;  2AQ3 B;  4HPM B;  3TJP A;  4CQN A;  1V1P B;  5EE0 A;  3TEY A;  1E90 A;  4BBN C;  4MEL A;  2HJ8 A;  5E6J A;  1UBI A;  3A33 B;  2V3P A;  2A4Z A;  2O2V B;  2ZCC A;  2NPT B;  2KFJ A;  3V05 A;  3A9J B;  3KW5 B;  4ARC A;  3JW0 X;  1J8C A;  3UQA A;  1VZ8 A;  2WNM A;  4B0E A;  3VTW A;  2W55 A;  5D94 A;  2LHE A;  3GS2 A;  4GMV A;  1KH0 A;  1GAQ B;  1OQR A;  1TJE A;  4H2A A;  4GB9 A;  4BKT A;  4ITK A;  4USA A;  3AE5 B;  4EZJ A;  4LNK A;  4FN2 A;  3NVY A;  2FCN A;  3NJT A;  3TBL D;  3CMM B;  3QC8 B;  3RMK C;  2N9L A;  2DYM A;  1U4A A;  3U7D A;  1MFW A;  1Q1O A;  2EKE C;  3AEB B;  3HVZ A;  2VH1 A;  2N9P C;  2V3S A;  3PT2 B;  2CU3 A;  2DAJ A;  1E7V A;  4MM3 A;  4OVU A;  4K7W A;  5E6P A;  3ML8 A;  4REZ A;  5CHF A;  1JQ4 A;  4JIO U;  4XDC A;  1TGZ B;  3NHE B;  1XLP A;  2L0T A;  3Q3J A;  4WWN A;  2NBW B;  4S0R A;  2BKF A;  2VRR B;  3QX1 A;  1YJ1 A;  1EUV B;  2JZP A;  3AE6 B;  2JX5 A;  4W9I A;  4LCD E;  1N61 A;  4LNF A;  4RGN A;  2WXL A;  1SF0 A;  3U8Z A;  3AI5 A;  4WUR A;  4BKG A;  5EE9 A;  5H92 C;  1PUT A;  1I4G A;  1M4V A;  5BYR A;  4X57 B;  1ZW7 A;  2WDR B;  4TUU A;  2IGG A;  2KVR A;  4KGS A;  4LK0 M;  2LJI A;  2N7D A;  4HVB A;  3EUB 2;  3T9L A;  1WX7 A;  5IP4 D;  3C19 A;  2KMM A;  2C9W B;  4ACF A;  4RGT A;  1OGW A;  2H88 B;  2MWS B;  1GC6 A;  3GZN I;  4URK A;  2KDE B;  3NRZ A;  2LXC A;  3KH0 A;  4ZDV A;  1Z5S B;  4DQO C;  4W9H A;  2CHW A;  1ZPS A;  3DWG C;  3WAL A;  2K25 A;  5IN7 A;  5LXH A;  4MAC A;  1ESF A;  1NBF C;  4IWQ A;  2XK5 A;  3Q2A C;  4AP4 C;  4YTN B;  3AE9 B;  3QAR A;  2CKH B;  4MJS B;  1SIF A;  1EF5 A;  1SE9 A;  1PGA A;  3M63 B;  4ZHP A;  3RI7 C;  1P3Q U;  1EF1 A;  1WYW B;  3W1S A;  1WE6 A;  2DYB A;  2J52 A;  3SR6 A;  2JRI B;  1XD3 B;  2O6V B;  3N1X C;  2X8X X;  3R7R A;  5AZF A;  3I3T B;  2KX3 A;  4LDT D;  3Q8C A;  2NTT A;  2KHW B;  1ACC A;  1EU4 A;  3AEG B;  1L6V A;  2ZVN A;  2ZJD A;  5G2N A;  1FNV A;  1GB4 A;  1VRA B;  1NDD A;  2LAS A;  4HXD A;  2N9K A;  1OQQ A;  4M01 A;  4CO7 A;  1N63 A;  2IY0 B;  4WWM A;  3PRE A;  2KZR A;  1WX8 A;  1T0S C;  4LDT B;  4ZRK A;  2G45 B;  1QOB A;  3RUL A;  3ZNH B;  2L52 A;  3PTF C;  2PMV A;  1SGH A;  2L7R A;  2MH7 A;  3QCA A;  3Q8B A;  4WJQ A;  2KAJ A;  3MJ5 A;  2M19 A;  5I4D A;  3QK0 A;  1VD2 A;  4DHJ D;  1E8X A;  2JYE A;  3DBL I;  1QOG A;  1EWC A;  1SSN A;  1WWT A;  2WXO A;  1GOZ A;  4W9G A;  4DXF A;  2WDQ B;  4MH0 E;  1JWB D;  1K53 A;  4XDD A;  4ZYN A;  4W9K A;  2J53 A;  2YVC A;  5BMI A;  2BS4 B;  4RFB A;  3TL5 A;  2Z8L A;  1WR6 E;  2WXJ A;  3C0R B;  5LLI A;  2MA9 B;  2KWU B;  3BWU D;  1YN3 A;  2PW9 A;  1WZ3 A;  3DOW A;  2KFK A;  1V5O A;  2PTL A;  2INC C;  5BMH A;  4DXA B;  3P4P B;  3LXF A;  4DHJ B;  3PRZ A;  4MGK E;  2GOW A;  3Q14 C;  2JXX A;  3VH4 B;  2JUO A;  2KMA A;  3AMZ A;  1AAR A;  1GG3 A;  2J0K A;  3W9C B;  1KLU D;  1J7B A;  3AH7 A;  2MJ3 A;  2WS3 B;  2HD5 B;  2XBB C;  3QA8 A;  3B2G A;  1F0Z A;  1TKY A;  3K9P B;  1CJE A;  2BW2 A;  4LJO B;  3LDZ E;  2LRU A;  2C7N B;  3PS6 A;  1M94 A;  1MHX A;  3ABV B;  1FNU A;  2N7E A;  1E8Y A;  2M17 A;  2QDF A;  2KX0 A;  1WM3 A;  2BB5 A;  3JSV B;  3ZNZ B;  1MG4 A;  3IBE A;  5IOI A;  1P0R A;  3DBH I;  3WAP A;  1IUE A;  3QQ8 B;  1ZGU B;  3B08 A;  2KKC A;  4JE3 B;  1OTR B;  1WZ0 A;  1E7U A;  2L8J A;  4MGI E;  1RFK A;  1PGX A;  2L3Z A;  2RMM A;  2IJ0 A;  1EO6 A;  4R3D A;  2MBO A;  4NAW A;  1L0Y B;  3A4S C;  2N9X A;  2V4I B;  2UU7 A;  4DDG D;  1H4R A;  1SJE D;  3BVM A;  2RGF A;  3Q8F A;  2L1A A;  2W82 A;  1C4A A;  2IO3 B;  4FJZ A;  3ECI A;  3IVF A;  1WSP A;  3Q3F A;  1T3Q A;  2BVC A;  2FBW B;  4OHJ A;  3ZXV A;  5L83 A;  1OQY A;  2A5U A;  1TY2 A;  2C5L C;  1TBE A;  4PS7 A;  4OW0 A;  1KOT A;  2I38 A;  2MP2 A;  4KGR A;  2PLP A;  1FXA A;  3R66 C;  1FRR A;  2K5P A;  2DHZ A;  3W5U B;  4W9L A;  2C7H A;  1WMH A;  4BFR A;  4FLH A;  1T0R C;  1XLN A;  4DHZ E;  4FJV B;  1Y56 A;  2B3A A;  2G4D B;  1I42 A;  2KDI A;  1A5R A;  1LXD A;  4B6W A;  2BKR B;  2V1Y A;  3B1L X;  2WGS A;  4KGT A;  1WJN A;  2JWZ A;  4F7Z A;  2CHZ A;  1PQS A;  1C76 A;  2FNJ B;  3T8M A;  2B76 B;  1FXT B;  4US9 A;  4ANV A;  2MBH A;  3ZJT A;  3FIL B;  4OZA A;  3R8B A;  2RDB C;  2IBI B;  4HK2 A;  5GXG B;  1UZX B;  2WDT B;  4OZC A;  2MBB B;  3VTU A;  1HA5 A;  4HPL B;  2ZNV C;  1VZ6 A;  5CHV C;  2NBU A;  1R4M B;  1N6Z A;  3TCA A;  1WF9 A;  2ZW1 A;  4W9F A;  2M1M A;  4W9C A;  3CIR B;  3UGB B;  4WWO A;  2KO3 A;  1TS2 A;  2KAN A;  1HTQ A;  1JW9 D;  3DWM A;  2Z59 B;  4G3X B;  4II3 B;  2REX A;  4NQL B;  2YLM A;  1VCB A;  3TEZ A;  3V60 A;  4C7Z A;  4Q2J A;  2LGD A;  5BYS A;  1UEL A;  4GLS C;  2DZK A;  2KQ4 X;  3O65 B;  3OG5 A;  4C56 C;  4KKI A;  4OVV A;  1SJH D;  3A9K A;  1IBX B;  5BMG A;  2E3T A;  3KWV A;  3TUO A;  3VRB B;  1R7S A;  1KLV A;  4RCO A;  3ZTC A;  3VR8 B;  2M4N A;  3OJ4 B;  4RGM A;  1TKE A;  2D2Q A;  3AXC A;  4C4V A;  1LGR A;  4ZRI A;  2JF5 A;  2JZZ A;  3L4P A;  2D5G A;  1LFD A;  1IP9 A;  2IND C;  3B2F A;  3RYT A;  2JXT A;  4A9A A;  1HZ5 A;  3DVN V;  1R4N B;  2Y3A A;  3QJZ A;  4BAX A;  2EMS A;  3TEW A;  4KIK A;  5G5G A;  1VLB A;  3GE3 C;  3KWL A;  4EEW A;  4TKN A;  2ZW0 A;  2GBJ A;  4ZRJ A;  1YQ3 B;  3N20 C;  4IM3 A;  2K3U A;  3LJ3 A;  1UWM A;  4GDK A;  2ASQ A;  2DEN B;  2MX2 A;  1FIQ A;  1LO5 D;  1WYG A;  2V3N A;  2BYE A;  2MQJ A;  3MC8 A;  2ZZP B;  1MI0 A;  3ZYY X;  2D3C A;  4IWO A;  2W54 A;  3RN9 C;  2MJE A;  1C1Y B;  1HE8 A;  3V62 A;  2Q5W D;  4JLC A;  2DX5 B;  2KD0 A;  3WIM A;  4NAM A;  1E0Z A;  5TSS A;  4KZ0 A;  4G0N B;  4FAD A;  2KTF A;  1XF5 L;  2N1V A;  2WXI A;  4RH6 A;  4N6E B;  2LI5 A;  2RSU A;  2WXR A;  3ZO5 B;  2LEK A;  1QKZ A;  4F1S A;  2EEL A;  1JRP A;  4M00 A;  4A3O A;  4KSL C;  3ZQ4 A;  2C60 A;  1P1A A;  4N58 A;  4YL8 A;  1CMX B;  3DVG X;  1Z2M A;  1YX5 B;  2D3B A;  3APD A;  3Q3N C;  2RPQ A;  3A4R A;  2V0G A;  5AEK B;  4HCP B;  3ZGZ A;  4L1B A;  2BS3 B;  5EE1 A;  4JWS C;  4AWJ A;  5LNK 1;  1FCL A;  2J0J A;  1T0Q C;  1FFU A;  1XLO A;  3PVL A;  4M0W A;  3VVW B;  4GN1 A;  2ZEQ A;  2JVC A;  4GIV A;  1EWY C;  3LB8 C;  3X23 A;  2JZ3 B;  2WU2 B;  3HHM A;  1H8C A;  1F2R C;  2MBE A;  2BS2 B;  1WXA A;  4JQW C;  5J18 A; 
#chains in the Genus database with same CATH homology
 4D2K A;  1OQQ A;  1ZP0 B;  1OFF A;  2JWU A;  1N63 A;  4WWM A;  4YTP B;  1IGD A;  1PGB A;  1TKG A;  3FIL A;  5JXV A;  2PKO A;  3NVZ A;  4YXD B;  3ZJV A;  1QOB A;  2KWD A;  3AEA B;  4A6Q A;  1GB1 A;  1XLQ A;  2L52 A;  1FEH A;  2PMV A;  3B9J A;  1MHH E;  1P7E A;  2MH7 A;  3Q8B A;  2JQR B;  1V1P A;  2KAJ A;  3MJ5 A;  4WAF A;  1WXQ A;  2M19 A;  5I4D A;  3ETR A;  5C2T B;  4ZOH C;  2LHD A;  3I9V 1;  2GI9 A;  1QLB B;  2JYE A;  4J3O D;  1QOG A;  1EWC A;  1SSN A;  1WWT A;  2WXO A;  1GOZ A;  3P4S B;  4DXF A;  1YNT E;  2WDQ B;  2QSD A;  2WXM A;  2IPK D;  4A55 A;  3R2I A;  1JWB D;  1K53 A;  1J7A A;  2M56 B;  4XDD A;  2I2Y A;  2J53 A;  2IGH A;  1JRO A;  5HG2 A;  3HRD D;  5BMI A;  1I4Q A;  4ARI A;  2BS4 B;  2N0S B;  2JU6 X;  4RFB A;  1YMH E;  5HI1 A;  1YN4 A;  2GB1 A;  1T5X D;  2Z8L A;  2WXJ A;  4US8 A;  3MC0 B;  4LLG M;  4GDL B;  3BWU D;  3P4R B;  1YN3 A;  3O13 A;  2SEB D;  2PW9 A;  2PTL A;  3AED B;  3VR9 B;  4MM3 B;  5BMH A;  5FKA C;  1NYR A;  1XCT L;  3P4P B;  3LXF A;  2WQY B;  3U2S C;  4TSS A;  3BYT B;  3T3O A;  3AEF B;  5EE3 A;  1DOX A;  2BB6 A;  2WXK A;  2LFI A;  3AMZ A;  4N59 A;  3W9C B;  1KLU D;  1J7B A;  3AH7 A;  2MJ3 A;  2BT6 A;  4JPS A;  2WS3 B;  1TS3 A;  2Y5C A;  3PO0 A;  2FE8 A;  1STE A;  1V1O A;  3AB5 A;  3ZJU A;  1B9R A;  3B2G A;  1F0Z A;  1IBX A;  1KTK A;  1TKY A;  1CJE A;  4RGO S;  2BW2 A;  2WXF A;  1YQ4 B;  4XWW A;  1FD6 A;  1QOA A;  1ZXI A;  2IGD A;  2DWQ A;  1MHX A;  2RDH A;  3ABV B;  4B0M A;  1CQV A;  1FCC C;  1FNU A;  3RFZ B;  3P1M A;  4GDK B;  1DGJ A;  1NVI D;  2WXQ A;  3MP9 A;  3J9C A;  4HJG E;  1UWX A;  4FXC A;  4WIP A;  1L6U A;  1AN8 A;  2BB5 A;  3HUI A;  2WU5 B;  3FC4 A;  3U7Z A;  3R2T A;  3TSS A;  3P4Q B;  3U4E G;  1HEZ E;  1XEE A;  4HKZ E;  4TQ1 A;  1FFV A;  1IUE A;  1SXT A;  1YN5 A;  3E9S A;  1C4P A;  2ACZ B;  3N9Y C;  1SEB D;  1WGK A;  4JE3 B;  2W3R A;  2MEK A;  3EA6 A;  2H89 B;  3BVZ A;  1SB3 C;  2INN E;  1NEN B;  5D7G A;  1C4C A;  1RFK A;  1PGX A;  1QQR A;  2RMM A;  2IJ0 A;  3FAH A;  1SBB B;  3P63 A;  4R3D A;  2HTM E;  1C9F A;  3MFG A;  4A8X C;  1L0Y B;  2RDG A;  1TZO A;  1K51 A;  3SFE B;  2KAC A;  3RPF C;  2V4I B;  1JCK B;  1A70 A;  1YJJ A;  1SJE D;  1SIJ A;  3BVM A;  3Q8F A;  1N60 A;  2L1A A;  2W82 A;  3BK2 A;  1C4A A;  1C79 A;  3W5V B;  3VRA B;  2W3S A;  1E7P B;  1FRD A;  1WRI A;  2X38 A;  3AE3 B;  3AE4 B;  1WSP A;  1MVK A;  1T3Q A;  2FBW B;  3AE8 B;  4A90 A;  1ROE A;  4YTM B;  4OHJ A;  3CWI A;  1E10 A;  2IDY A;  4JWU C;  4YSX B;  1HZ6 A;  2LMC A;  2G1E A;  2Y5P A;  4YWG G;  1TY2 A;  3OWE B;  2ICI A;  2NTS A;  2VZK D;  3NZ3 A;  4OW0 A;  1QF6 A;  2I38 A;  4KGR A;  2K0P A;  3Q8A A;  4RF0 A;  2PLP A;  5C3J B;  1I4R A;  1DOY A;  1FXA A;  2QIL A;  1FNW A;  3AV8 A;  4KX6 B;  2HDE A;  1C78 A;  1ZDV A;  1FRR A;  2QIE B;  1I4P A;  1KFY B;  1ENF A;  2K5P A;  2PVO D;  1I7H A;  3W5U B;  4WQM A;  3UI3 A;  2CJO A;  4C7Y A;  3NUH B;  1ZDX A;  3SFD B;  4AS1 A;  1MPE A;  1XLN A;  3LYY A;  2JYT A;  4HKQ A;  1Y56 A;  4MH8 A;  1D5M C;  3V3X A;  3HVD A;  2RPV A;  3H8H A;  4EE2 A;  3IT4 B;  1JWA D;  2OHF A;  4KGT A;  5HHD G;  1J7C A;  1XCQ L;  1L4Z B;  2VZK B;  3SEB A;  1C76 A;  1L0X B;  2KDM A;  4LTU A;  1D6E C;  2B76 B;  5D3I B;  4L2Y A;  5D3D A;  2YEP F;  4US9 A;  1E9M A;  3ZJT A;  1VDV A;  1EM7 A;  3FIL B;  3IAS 1;  4OZA A;  3EGR A;  3R8B A;  3MHZ A;  3PZ8 A;  3IT6 B;  1AW7 A;  1YJI A;  2QEJ C;  2QMT A;  1NI3 A;  3AEE B;  5GXG B;  1AWD A;  2PIA A;  2WXG A;  4YSY B;  1NYQ A;  5FR3 A;  2AQ3 B;  1E6E B;  4OZC A;  4CQN A;  1JML A;  1TYG B;  1RWS A;  4WH4 A;  1HA5 A;  4OZB A;  1V1P B;  3VQI A;  3KLS X;  5EE0 A;  2WXH A;  3Q8E A;  3TEY A;  4C80 A;  1P7F A;  1VZ6 A;  3KQ4 A;  5FK9 C;  4KKJ A;  2PVG C;  2ZW1 A;  1KRH A;  3IAM 1;  5E6J A;  1KF6 B;  1F2R I;  1KLG D;  4RNA A;  2ONQ A;  2L32 A;  2V3P A;  1K50 A;  2J42 A;  3URY A;  2XNA C;  2DBY A;  3V05 A;  1TY0 A;  3CIR B;  4ARC A;  1TS2 A;  1EU3 A;  1ZUD 2;  1HXY D;  1VZ8 A;  2WNM A;  1RM6 C;  1V97 A;  1JW9 D;  2L83 A;  2OED A;  2ON8 A;  4B0E A;  3DWM A;  1JWS D;  2W55 A;  2LHE A;  3GS2 A;  1VZ7 A;  1KH0 A;  1XO3 A;  1ZOY B;  3NS1 A;  1CK1 A;  1GAQ B;  1OQR A;  2QJL A;  1TJE A;  4H2A A;  4ITK A;  2KN4 A;  1HQR D;  1I4X A;  1QT9 A;  4USA A;  3AE5 B;  3TEZ A;  2G9H D;  1SE4 A;  1T6B X;  4C7Z A;  4Q2J A;  3NVY A;  5BYS A;  4TQ0 A;  4GLS C;  2AX5 A;  4HEA 1;  2KQ4 X;  2XN9 C;  4C56 C;  4KKI A;  2WLB A;  2WXN A;  5G5H A;  1SJH D;  1VJK A;  2N9L A;  1IBX B;  5BMG A;  2DYM A;  2E3T A;  1B1Z A;  3KWV A;  3TUO A;  3AEB B;  4XWT A;  3VRB B;  3HVZ A;  1R7S A;  4RCO A;  3WCQ A;  3BII D;  3AN1 A;  1ET9 A;  2CU3 A;  3AE7 B;  3TEX A;  3VR8 B;  1FXI A;  4AQ7 A;  2TSS A;  4RGM A;  1TKE A;  4OVZ A;  1V8C A;  4ZHO A;  4REZ A;  1AYF A;  1JQ4 A;  4XDC A;  3GP7 A;  2CJN A;  1I4H A;  3P42 A;  1UGJ A;  3L4P A;  2D5G A;  3AEC B;  1XLP A;  3B2F A;  1QIL A;  2JXT A;  4A9A A;  2WP9 B;  1HZ5 A;  1F77 A;  4ZYS A;  2Y3A A;  4PT5 A;  1JAL A;  3TEW A;  1JWM D;  2JSV X;  1VLB A;  4RF1 A;  5G5G A;  3KWL A;  5MPO A;  1L0V B;  2ZW0 A;  4L23 A;  1DOI A;  2LUM A;  1YQ3 B;  2K3U A;  1UWM A;  2MJD A;  2INP E;  1PYW D;  2JZP A;  3AE6 B;  2JX5 A;  1FIQ A;  1LO5 D;  1WYG A;  1SE3 A;  3BYY B;  2V3N A;  1N61 A;  4IOI E;  2LGI A;  3Q69 A;  5H8Y E;  4NAW B;  2YEP B;  1K52 A;  4RGN A;  2WXL A;  1SF0 A;  4P6V F;  1MI0 A;  1BUI C;  1N5W A;  5AUK A;  3ZYY X;  4WUR A;  3C8Y A;  5EE9 A;  5H92 C;  1PUT A;  1I4G A;  1M4V A;  5BYQ A;  5BYR A;  1GPX A;  2DYO A;  2W54 A;  2K22 A;  2WDR B;  2MJE A;  1L5P A;  2IGG A;  2Q5W D;  4KGS A;  4LK0 M;  2LJI A;  1L4D B;  3NVV A;  2GRI A;  4NAM A;  3EUB 2;  1E0Z A;  4HRO A;  5TSS A;  4ZRQ A;  1UNS A;  4UDU C;  2KMM A;  2BYT A;  1XF5 L;  5AUI A;  2WDV B;  2WXI A;  4RH6 A;  4N6E B;  4RGT A;  2WXR A;  1TS5 A;  2H88 B;  4YT0 B;  3GB1 A;  4MT5 A;  1ET6 A;  2J4X A;  1QKZ A;  2LEK A;  2FUG 1;  2EEL A;  2SAK A;  1JRP A;  1N5X A;  3NRZ A;  2N7J A;  4O1N A;  3ZQ4 A;  4DQO C;  1ZPS A;  3DWG C;  1ZXH A;  3AE1 B;  1JWU D;  2M0A A;  4P16 A;  4MAC A;  1ESF A;  1QOF A;  2K9X A;  4N58 A;  3BK1 A;  1ZE3 D;  4YTN B;  4YSZ B;  1XXG A;  4XE0 A;  3AE9 B;  3PZ7 A;  1N62 A;  2DLB A;  1IGC A;  3BZD B;  2V0G A;  1FMA D;  3BVG A;  2NMQ A;  3T3N A;  3IXS A;  3ZGZ A;  2AQ1 B;  1SE2 A;  4L1B A;  2BS3 B;  1BML C;  1PGA A;  3E56 A;  5EE1 A;  4ZHP A;  4JWS C;  4HRS A;  3I57 A;  1PFD A;  4JX1 C;  4NZL B;  3W1S A;  5LNK 1;  4ZRP A;  3W2D A;  3NVW A;  4IDI A;  1NEK B;  2J52 A;  1CZP A;  1FCL A;  3SR6 A;  4NJC A;  1DYQ A;  3U52 E;  1Q10 A;  1UUP A;  1FFU A;  1XLO A;  4TMA B;  1PDX A;  2E6X A;  1C77 A;  1D5X C;  3AM9 A;  4M0W A;  3Q8C A;  2NTT A;  4DXG A;  3AE2 B;  1ACC A;  2R61 A;  1EU4 A;  2EKI A;  2WXP A;  1BXT A;  1FM0 D;  1EWY C;  1D5Z C;  2AQ2 B;  3AEG B;  3LB8 C;  1VR9 A;  5HFY A;  1FO4 A;  1L6V A;  1TS4 A;  2BBC A;  2WU2 B;  4IKG A;  1F2R C;  1RYJ A;  1D4B A;  1FNV A;  2BS2 B;  1GB4 A;  5T8I A;  1VRA B;  2BTE A;  2N9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...