2K5PA

Nmr solution structure of a thiamine biosynthesis protein from geobacter metallireducens: northeast structural genomics consortium target gmr137
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
78
structure length
78
Chain Sequence
MNLTVNGKPSTVDGAESLNVTELLSALKVAQAEYVTVELNGEVLEREAFDATTVKDGDAVEFLYFMGGGKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords thiamine-biosynthesis protein
publication title NMR Solution Structure of a Thiamine Biosynthesis Protein from Geobacter Metallireducens: Northeast Structural Genomics Consortium Target GmR137
rcsb
source organism Geobacter metallireducens gs-15
total genus 11
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2k5pA00
1A70A 3VRAB 3AE3B 3AH7A 1KFYB 3VR8B 4C7ZA 2M19A 1DOIA 2K9XA 4YSYB 4YTNB 1JW9D 1DOXA 1I7HA 2ACZB 3ABVB 1J7BA 1N63A 2LEKA 1N5WA 2WDVB 3LB8C 1YQ4B 4US9A 2W3SA 3B2FA 1SIJA 1E0ZA 1OQQA 3AE6B 1FO4A 3AEGB 2BS3B 3AE7B 3NVYA 1YQ3B 3BIID 1L0VB 3CIRB 3SFDB 1L6VA 2PKOA 1R7SA 1TKYA 2BT6A 2MJEA 1UWMA 2KAJA 4YTPB 2FBWB 5G5GA 3VRBB 3DWGC 4P6VF 3AEAB 1VJKA 2E3TA 3ZYYX 2CU3A 3AN1A 1B9RA 2G1EA 1WYGA 3W5VB 1NI3A 1L6UA 2JQRB 1FXAA 3AEEB 2CJNA 4LTUA 1F0ZA 3HRDD 3NVWA 1QOFA 1WWTA 4WQMA 1GPXA 3PO0A 2OHFA 4USAA 1TKGA 2DWQA 2L83A 2W55A 3P4RB 5H92C 1FRRA 1CJEA 3AB5A 3DWMA 2B76B 1ZUD2 2WLBA 2N0SB 2M56B 3AM9A 4YT0B 1TYGB 1PDXA 3AE8B 4KX6B 1FIQA 3NVZA 2DBYA 2WU2B 4IDIA 5H8YE 1XLNA 1V97A 2L52A 5C3JB 1N60A 3W5UB 1PUTA 3ETRA 5EE1A 3AEDB 3P4QB 5EE0A 1YJIA 1QOGA 1TJEA 1JALA 2QIEB 3KWLA 2QJLA 2WU5B 5G5HA 4US8A 3W9CB 3LXFA 1N61A 1KF6B 2MH7A 1QLBB 3FC4A 3NVVA 3L4PA 1ROEA 1N62A 1GAQB 1WGKA 2BS4B 2EKIA 4ZHPA 2Q5WD 3AMZA 3NRZA 1NYQA 4N6EB 1PFDA 4ITKA 2WS3B 3AECB 4YTMB 1FFUA 1OFFA 4JWUC 1RFKA 3WCQA 1RM6C 1OQRA 2CJOA 2W3RA 3EUB2 1XO3A 2PIAA 2W54A 1VDVA 1E10A 1NVID 1TKEA 2KMMA 4ZHOA 1DGJA 2WP9B 2Y5CA 1SB3C 1FRDA 3AEFB 1RYJA 1SF0A 1JROA 1QOBA 1ZOYB 2WDQB 5AUIA 3AE2B 1JRPA 2MJ3A 2PVOD 5MPOA 3HUIA 1ZP0B 3VR9B 1YJJA 2BS2B 1QOAA 5C2TB 4YSXB 4YXDB 1FXIA 2H89B 5GXGB 3AE9B 1AYFA 1DOYA 3B2GA 3P4PB 1ZXIA 2PVGC 2MJDA 1N5XA 1VLBA 2WDRB 3AE4B 3CWIA 3NS1A 2H88B 1FM0D 1QT9A 1WRIA 3AE1B 3P4SB 4JWSC 4HROA 1CZPA 2AX5A 4ZOHC 1WXQA 1QF6A 1NENB 4JX1C 4WWMA 1E7PB 5EE9A 3SR6A 1FFVA 1NEKB 2K5PA 3HVZA 1KRHA 1NYRA 1RWSA 1XLPA 3SFEB 4A9AA 5AUKA 1JWBD 3AEBB 4C80A 3AV8A 4N58A 1J7AA 1FMAD 4N59A 3P63A 1IUEA 2JX5A 1AWDA 2WQYB 3AE5B 1E6EB 3FAHA 4HRSA 1T3QA 1E9MA 1J7CA 1XLOA 1XLQA 2K22A 3P1MA 1JWAD 1V8CA 1L5PA 5EE3A 3RPFC 4C7YA 4FXCA 4YSZB 1EWYC 3B9JA 2HTME 1JQ4A
chains in the Genus database with same CATH superfamily
3VRAB 2ICIA 3V05A 3ABVB 1N5WA 4US9A 4NNJB 1FO4A 3U7DA 1STEA 2KQSA 1HZ6A 3LDZE 4FA6A 5LXHA 2C7NB 3GOEA 3JSVA 4ZRJA 2WNMA 2CKHB 2ZJDA 2NTSA 3T8MA 4TMAB 1FXAA 1TGZB 4A55A 1WWTA 4F8CB 3LJ3A 4USAA 3J9CA 1VR9A 4KIKA 1F9JA 1SE3A 4BAXA 2N7JA 2N0SB 4YT0B 1SXTA 1WX7A 3Q6BA 4JGHB 2LHDA 1M94A 5C3JB 4W9DA 4LJOB 4NJ7A 3Q8AA 5BMGA 4HWIB 2MBHA 4FJYA 1K50A 3N9YC 5G2NA 5FR3A 1KJTA 3WAOA 2FNJB 1UZXB 3PSEB 3UIPB 4XX5A 4GSWA 4WQOB 1YN4A 2LXCA 1RM6C 4JQWC 3L13A 1E10A 1XO3A 3OWEB 4TQ0A 4JPSA 4F1SA 3NJTA 4FADA 3BK2A 3HUIA 5C2TB 1EWCA 1KTKA 1LXDA 3T3OA 2IO3B 1N5XA 1KLGD 4BBNC 2OEDA 3HVDA 5KHQA 4K3BA 3LYYA 1Y8RC 3TEXA 2MQJA 4Q2JA 2XNAC 4ZYNA 2DAFA 3OAWA 1AWDA 3VHTC 3UI3A 3ECIA 4ANUA 1T3QA 4KGRA 1SE9A 2IY1B 3DBHI 3GS2A 2ASQA 4M0WB 4A8XC 1KFYB 2ZVOA 2W3SA 3PVLA 1N6ZA 2MP2B 4C4VB 1YQ3B 5JHAA 4QAYA 1L6VA 4ICUA 1V86A 4DXAB 1IGDA 1WYGA 1VZ6A 1QZEA 3M95A 4HCNB 3N1XC 1GB1A 1TKGA 5IP4D 1WFYA 1GUAB 2L8JA 4JLCA 4W9HA 4IC7B 1WJ4A 4LK0M 2DBYA 4FHJA 5E6JA 3IHPC 1TTNA 3AXCA 1ZPSA 1QOGA 1YX5B 2I2YA 4B0MA 3X0WA 4GN1A 2B3AA 2Q5WD 1TS4A 3VXWA 2WS3B 3N20C 3PRMB 3NZSA 1V9JA 3IAM1 2WXLA 1QILA 2ZZPB 4II3B 1XXGA 3Q8EA 4RH6A 1FRDA 2WDQB 2D3CA 2LD9A 1PGXA 1AW7A 3APCA 3VTWA 3L08A 3WIMA 5JH5C 1UF0A 4NAMA 4M02A 1ZXIA 2YLMA 2KTRA 1R4NI 3T9LA 2RDGA 3DQVA 1RWSA 2FCMA 3BZDB 4IUMB 2NS5A 1GC7A 2KXJA 4DHZE 2J4XA 2IGHA 3WA0A 2N1VA 2LRWA 2M19A 3VR8B 1DOXA 3BVMA 5T8IA 4C00A 1J8CA 2L05A 2M0AA 4M8NA 1EUVB 3AEGB 1MG8A 2DYOA 3T3NA 5LNK1 2EMTA 2BT6A 5G5GA 3R3MA 2E3TA 1BUIC 3GP7A 3ALBA 3EHVA 4BOSC 3RN9C 1WM2A 3I57A 2GBMA 5FKAC 1QOFA 2RDBC 4FLHA 3ZNHB 1D3ZA 2ONQA 4AOFA 4A3PA 3H7PA 1YOVB 3EFCA 4FHKA 3W2DA 3AM9A 4BZAA 4REZA 2N7EA 5H8YE 3IG3A 3OJ3A 3W5UB 4LCDE 1PUTA 3ETRA 3RFZB 4LNFA 1YJIA 4OVZA 5G5HA 3ZW3A 5E6NA 1C1YB 2Y3AA 1GB4A 2LFIA 2KN5A 2KQ4X 4YTMB 2K6DB 2KHWB 4A6QA 5D6JB 2OJRA 1WE7A 2XN9C 2KMMA 2D3GA 1XCQL 1DGJA 2FIDA 2BGFA 4GOCA 1YJJA 4HKZE 2EMSA 1SE4A 3H7SA 1VLBA 4N6EB 1F1HA 1WZ0A 1C4AA 3CMMB 4XDCA 2KC1A 4PS3A 4MM3B 2RD0A 5AUKA 1T0QC 3UINB 4UDUC 2WQYB 1HQRD 2KACA 3FAHA 4C7YA 2BKFA 4HEA1 2WXNA 3VQIA 1N63A 2LEKA 1XF5L 2NCNA 2JXTA 4TV3A 2PKOA 4YTPB 3A4SC 3PHXB 3KYCD 2L76A 5D3DA 5AZHA 2KMAA 2K3UA 4KGSA 1EF5A 3RNEC 1M4VA 1V5OA 4I6LB 3RULA 3K9PB 4XDDA 3VTUA 4NY0A 2V0GA 2MW5A 3MP9A 2Z0DB 2LI5A 1TYGB 3N1ZC 2CHWA 3A1QA 3NVZA 1UGJA 2FUG1 3NZ3A 1GJZA 3H8HA 4LNIA 2HE7A 1JALA 5CHFA 2VZKD 3W9CB 3RMKC 5D7GA 2ZW1A 2BYVE 2JY6A 4MH8A 1FD6A 4MH0E 3EC8A 3RT3B 4MGIE 4AJWA 4GDLA 1C77A 3ML9A 3KVFB 3ZIMA 2PIAA 4NQKE 2C5LC 3R2IA 3Q8FA 1K8RB 3MHSD 1OTRB 4WAAA 3TEZA 5MPOA 3U8ZA 3DVNV 5JXVA 4KZ0A 2XK5A 4W9IA 3AI5A 3IT4B 2D11A 3VUYA 4ZOHC 3PRZA 2A5UA 4GB9A 4NAWB 4GMVA 1KRHA 2GI9A 1ENFA 4ACFA 2KVRA 1UD7A 1VCBA 3PV1A 1C4PA 4N59A 1WY8A 1Q1OA 4R3DA 2K22A 1XLOA 3P1MA 4A20A 1UNSA 3A33B 2KN4A 2MBQA 2KC2A 4W9FA 3B2FA 3L54A 3TJPA 2UYZB 2NBVB 4XWWA 1HTQA 1UWXA 1VD2A 3ZUNA 2QHOA 4XZ4A 3BINA 3GE3C 5AZFA 1ACCA 3W5VB 4OVUA 1UH6A 2FIFA 4LTUA 1F0ZA 3Q3OC 2I38A 1WE6A 4HVBA 2B76B 1WGGA 1ZUD2 2N4FA 4ICVA 4RGTA 1WXSA 2DNFA 3SEBA 1V1PA 2JVCA 2WU2B 2IPKD 2L52A 2V9HA 4B0EA 4G0NB 3R66C 4K1RB 1YN5A 2FCQA 2QIEB 2WU5B 4RNAA 4WJPA 1SIFA 3TBLD 4OZBA 2AYOB 4ZHPA 1IYFA 3BYYB 2MCNB 1OFFA 4ANXA 3PLVA 1TS2A 1VDVA 1FNVA 1YQBA 2KNBA 3DBLB 3DPDA 3V62A 2BTEA 1QOBA 4DQOC 1SJED 4AP4C 1JRPA 1ZE3D 2HDEA 4YSXB 1ZP0B 3NS8A 5CHVC 1Q5WB 3MHZA 1YMHE 2CHXA 3B2GA 4JIOU 3P4SB 2UU7A 3ZDTA 2BBCA 1E5WA 1I4HA 1WXQA 1HE8A 4M00A 4XYCA 2QCZA 5D2MB 3AULA 4A9AA 1E90A 2O2VA 4URKA 1L2NA 1H8CA 3R7QA 5AZGA 3R8BA 3GZNB 3WAMA 2Y5BB 4FJZA 2KVZA 3KUDB 1TIFA 1PQSA 4C56C 2K9XA 4AJYB 2KYWA 1I7HA 2IJ0A 3RNGC 2MBEA 1SIJA 2KWDA 2MRPA 3TEYA 1WJUA 2ON8A 4BKSA 3ZRCA 2KTFA 2BB6A 3PS6A 2LVOA 4EZKA 2BPSA 4ZRKA 2JQRB 1WMHB 2CJNA 3P2BA 1MVKA 3A9KA 1GPXA 1SJHD 4IM0A 4J3OD 5JHBA 2R2OA 2DYMA 2KFJA 3VFKA 4K7WA 2WXMA 2X8XX 3L0WB 2K39A 1F52A 3MJWA 1V5TA 3CSFA 1KH0A 1TJEA 4G50A 2QJLA 1N61A 1KF6B 3NVVA 1ET6A 1GAQB 5BYSA 5DPSA 3RNCC 2EKIA 2GRIA 3PHWB 1BT0A 3EECA 4RGOS 4KV2A 3DVNU 4ZRQA 3RZFA 2JF5A 1FEHA 3PLUA 3QC8B 2AQ1B 1RYJA 4P16A 1ZKHA 1MFWA 2ZCCA 1TS3A 1EU4A 1T6BX 2LWPA 3QCAA 5GXGB 4WH4A 2NPTB 2KQ7A 4K7UA 4XC2A 3Q2AC 1FM0D 2REXA 4HROA 4WAFA 1WYWB 4IWQA 3C19A 1L4ZB 3ZO5B 2PLPA 1JWBD 4PYZA 4S0RA 1IUEA 1E9MA 2OOBB 3ZTCA 1A70A 4KGTA 2BWFA 2DZIA 2GMIC 2K25A 3U30A 1J7BA 1SSNA 3NHEB 4BBNF 2JZZA 2GOWA 1IPGA 4NQLB 1LQBA 5HFYA 1VJKA 3MTNB 4LDTB 2QMTA 3VDZA 2WXFA 1MI0A 4HCPB 1ZW7A 3W1SC 2OHFA 4W9KA 5IOIA 4P1BC 2ZPYA 4LNNA 2ZW0A 2LRUA 3DBHB 3ZXVA 1FIQA 5CTRC 4OW0A 3VH3B 4BKGA 2MBBB 1V97A 4YL8A 2XBBC 4N9F4 2LJ5A 2NVUI 2NMQA 4WWNA 4US8A 2KDMA 4BFRA 2KANA 3HM6X 3BK1A 2L0TA 4W9GA 4ZRPA 3U4EG 5GMVA 1ZDVA 2PE6B 1E8YA 1MJDA 3V3XA 3TUOA 3U2SC 2YEPB 4H2AA 4ZHOA 2FE8A 3N3KB 2G9HD 2O6VA 2JT4B 4G3XB 2BVCA 4II2B 2BB5A 5CHWA 2BS2B 2C7HA 2DX5B 1V2YA 3Q3JA 2OJWA 1JRUA 3DHGC 1C9FA 1IBXA 2JSVX 2ZVNA 5EDSA 2KMCA 4GDKA 1NEKB 1YJ1A 3SFEB 4JE3B 3UQBA 4HRSA 3RYTA 4MGZE 1J7CA 2J53A 4P1CC 2SEBD 1V8CA 4W9CA 1T0YA 4FXCA 4YSZB 1EWYC 1I42A 2D3AA 1P7FA 1P9DU 4GXBA 2J0MA 4ZYSA 3I9V1 1YQ4B 4ANWA 1JWUD 2N9XA 4X57B 2K6QA 2INNE 1L0VB 3SFDB 1TKYA 4DHZB 3DWGC 2AL6A 2WYQA 2BF8B 2N9KA 4DHJB 4EZJA 3TMPB 1NI3A 1R4NB 2KJRA 4WQMA 1QQRA 3DHIC 3U7ZA 3V6EB 1CQVA 1TZ1A 3AU4A 1F77A 3AB5A 3DWMA 1WSPA 1ZXHA 1D5ZC 2LVPA 2L3ZA 4IDIA 1XLNA 4IWPA 3KYDD 1V1OA 3P4QB 5IA7A 1C4CA 2N9LA 3L16A 2QILA 1K53A 1WGKA 1YN3A 1C78A 2WXRA 3QQ8B 3NRZA 4WIPA 2IO2B 2VZKB 1T5XD 1Q10A 1J19A 1OQRA 4WJOA 4EKUA 2XK5B 3IXSA 4GU2A 3APFA 2IY0B 4B95A 3NOBA 1SB3C 1WXAA 1T0SC 4MJSB 4E3CA 2PVOD 4ARIA 4EEWA 2PEAA 1AYFA 2G4DB 2MJDA 2WDRB 1QT9A 3KWVA 3ZJUA 1VRAB 2TSSA 1HTOA 2L32A 1VZ7A 4M0WA 2DZKA 3SU8X 4N58A 1WGHA 2WXGA 4KSLC 1RAXA 2LMCA 2ZEQA 5EE3A 2MP2A 3ZJTA 3O65B 4C4VA 2PJHA 5L95C 5AEKB 1RFAA 2ACZB 1FCCC 4F7ZA 2BS3B 4OHJA 1ISNA 4FULA 2JRHA 4K81A 2KZRA 3UF8A 4EUTA 2ZCBA 3N32A 2WWZA 4RGNA 2LXAA 5IAAC 3TCAA 5LLIA 1C76A 2V4LA 4PS8A 1L7YA 1V49A 1FCLA 2M56B 2KD0A 1V80A 4PYUA 1KLUD 3ML8A 2KX0A 2R2QA 1UELA 2DYBA 3VUWA 1JCKB 3GB1A 5C1ZA 2FAZA 4TSSA 1Y56A 3ZDMC 3RCZA 4BVUC 2J7QB 3PZ7A 4HJGE 2IZVB 2JZPA 3ZNGC 1E8XA 1JWMD 2VH2A 4HLEA 1GC6A 3Q3NC 4K7SA 4ITKA 2LJIA 2K8HA 1P0RA 2GBRA 4FN2A 3E56A 1NVID 3JYUA 3KH0A 1K51A 5CX3A 3MC0B 3WAPA 3A9JB 2KDFB 4D2KA 1QKZA 3A4RA 4HPPA 2KX3A 2D3BA 5DPRA 2L7RA 1A5RA 4JWSC 2KFKB 2KWCA 4JX1C 4J6IA 2K5PA 1XLPA 3IT6B 2D07B 1CK1A 3ZJVA 2VH1A 3VUXA 1CMXB 5E6OA 2JX5A 3UQAA 2WXPA 1E7UA 3D32A 4RFBA 3B9JA 2G4SA 2HTME 2KK8A 3DBRI 3H6NA 2JZ3B 2M1MA 4C7ZA 3FKYA 1SBBB 1EM7A 3Q3MC 4WWOA 2LHEA 2J0KA 3LB8C 4IM2A 4FJVB 1I4XA 1OQQA 2LGIA 4A3OA 3BIID 1MHHE 4MDKE 3A9KB 2FBWB 1WXMA 2CU3A 3DBSA 4DXGA 2KLGA 3OG5A 3M3JA 3DHHC 2Z8LA 1D4BA 2KKCA 1GOZA 1V81A 2M4NA 4IKGA 3JSVB 2L83A 1ET9A 5H92C 1FPYA 2IO1B 4IG7B 2KWUB 4M8MA 4E74A 4LNOA 2MX2A 1WZ3A 3DVGY 3KUCB 4KX6B 4GIVA 4PS7A 2DHZA 3NY5A 4KIKB 3B0AA 4A90A 4AS1A 1P98A 2BS4B 2Z0EB 2NBUA 2K1FA 3BVZA 5HG2A 1PFDA 2INCC 2INDC 1D6EC 1ZGUB 2JUOA 1RFKA 2N1WA 2RPVA 3EA6A 1OEYA 2I1JA 2Y5CA 3ZTDA 5AUIA 1WR6E 1Z5SB 1NDDA 2HJ8A 4MM3A 5TR5A 4I6NB 2CS4A 1R4MB 1I35A 1XD3B 4PT5A 3AE4B 3Q3FA 4L1BA 2AX5A 3TL5A 1IGCA 3PREA 1FFVA 3HVZA 4ARCA 2M8SA 1F2RI 3BWUD 2AEHA 2G45B 1GG3A 1RLFA 3K9OB 4WJNA 1FMAD 2V3SA 3AE5B 2GLSA 4KKIA 5DPWA 5BMHA 2LUMA 4TUUA 2DZMA 2X38A 5LXIB 2HTHA 2DLBA 3C0RB 2C7MB 4DDID 5J2RA 3VRBB 2NTTA 4BKSD 5FR6A 3TEWA 2VRRB 1PYWD 4W9LA 3KUZA 1YNTE 2GBKA 2I1KA 1WGYA 1TY2A 3N1YC 3ENEA 3UIOB 4MELA 3AU5A 4B9KA 1V6EA 4KSKC 3URYA 2JRIB 2CU1A 2ZPNA 3QHTA 1XT9B 1AARA 3ONSA 3RNBC 3FC4A 4E71A 2WXQA 4HPLB 3VTVA 1NYQA 3HIZA 2KWVB 1FNUA 2GB1A 2SAKA 1FFUA 1HXYD 1NI2A 3VAWA 4JWUC 3EUB2 2BYTA 3VH4B 1TKEA 2MA9B 2L00B 4NAWA 5BYQA 2RMMA 4BKTA 2JWZA 1FXIA 2H89B 3KW5B 5FK9C 1E8WA 2PVGC 4EOYA 2LGXA 1TY0A 1XQQA 1I4PA 3I63C 2IGGA 1E7PB 3GE8C 3ZGZA 2MBOA 2RGFA 3X23A 2KJHB 3PZDA 3DCGA 1WF9A 1WRDB 1E6EB 1SE2A 4OZCA 3JW0X 1LGRA 2Y5PA 2KTRB 1RRBA 1BXTA 2QDFA 4YTNB 2JYEA 1JWSD 5DPTA 1U4AA 3R2TA 2V3PA 2IO0B 3NVYA 1R7SA 2M17A 1B9RA 2KDBA 1E7VA 3W1YA 1VZ8A 5BYRA 3VVWB 4IOIE 2L0FA 2JPHA 4AUQC 2DWQA 3P4RB 3QARA 1FRRA 4GGQA 1CJEA 4L23A 3QK0A 1PDXA 3IFWB 5TSSA 2V1YA 3FILA 3ZRFA 5J18A 5EE1A 3AEDB 1TS5A 3H7PB 2MH7A 4G11A 3L4PA 2WDTB 1WX9A 2PTLA 2QEJC 3PPAA 2AWTA 1WIAA 2KT7A 2BKRB 2J52A 4RM8A 1XEEA 2KJ6A 3OLMD 3AE2B 2MJ3A 3VR9B 1IP9A 2O6VD 1QOAA 1Q0WB 2A4ZA 3AE9B 4TQ1A 2N9PC 3CWIA 4GLSC 3Q8BA 2KLCA 2AL3A 3R7RA 4NZLB 2C60A 3KLSX 4DBGA 4C80A 3OJ4B 4HDQA 3UGBB 2YVCA 2WGSA 4M01A 4HJKA 5J17A 2L1AA 2MEKA 2LUEA 5IN7A 4I6PA 4YSYB 2D10A 3HM3A 1WGDA 1WMHA 4HPMB 3AE7B 3QJZA 3MC8A 3IBEA 1UUPA 2BWES 1OQYA 2FCSA 2KO3A 1HZ5A 3HK0A 4NPNA 2WXJA 4AWJA 5E6PA 3CF6E 2JWUA 5HHDG 4HK2A 3C8YA 1WGRA 4YWGG 2W55A 2N9EB 2WHIA 2K8CA 1PGBA 3O13A 2CHZA 1N60A 3MC9A 3W1SA 4WWPA 2JXXA 2IDYA 1WH3A 2D2QA 2ZNVB 4XGAB 2EELA 5DCNA 3A1QB 2NR2A 3Q69A 2GBJA 3TIXA 2UWQA 1WR1A 1WJNA 3AECB 1MPEA 2QSDA 3BVGA 2NPTA 4O1NA 5KHOA 2YEPF 1JMLA 4MEMA 3DOWA 4RF0A 3ZVVA 2WXIA 4GDLB 4YXDB 1P3QU 4MGKE 1UBIA 1WRIA 2BQQA 2IGDA 1CZPA 2PPHA 2PMVA 1QF6A 2BYEA 1L4DB 3SDLC 4LDTD 4WWMA 4L2YA 2RR9A 3Q8CA 1B1ZA 4KDLB 1XLQA 3B08A 2FUHB 4LNKA 3NZUA 3DDCB 4MT5A 4OZAA 4NJ6A 1JQ4A 3IAS1 3AH7A 1EU3A 1DOIA 3KQ4A 1XCTL 5IO9A 1ESFA 2Z59B 4S17A 2LVQA 3CSTA 3S2AA 2IYDB 4P7IA 3WANA 1MHXA 3RI7C 3CIRB 3RZWC 5BO4B 4P6VF 4OVVA 2ZNVC 3NG0A 3QWZB 1L6UA 4RGMA 2NBWB 2GBNA 3PZ8A 2BYFA 3QAQA 4MSMB 4IW0A 1L0YB 4DDGD 1DYQA 1HA5A 4ZDVA 5G55A 3RD2A 3AE8B 3PT2B 1WM3A 3RNAC 1FNWA 1N62A 1V1PB 2HD5B 2D5GA 3H1UA 1LO5D 4LLGM 2CJOA 1G6JA 5IKCM 4WJQA 5D94A 1SF0A 1ZOYB 4WURA 3PGEA 5L83A 3L17A 2PW9A 1YX6B 2FCNA 3P4PB 1ZDXA 3AE1B 1K52A 2KDEB 4DHJD 5D3IB 2KDIA 3SR6A 4NJCA 3M62B 1E8ZA 3EFUA 4RF1A 1WJ6A 4AQ7A 3I3TB 2K8BA 2N7DA 2E6XA 1JWAD 1L5PA 2R61A 3APDA 1KOTA 2LZ6A 2RDHA 2WX1A 2O2VB 3V6CB 3AE3B 3ZLZA 3ZQ4A 1HEZE 4FBJB 1GNUA 3AE6B 3SD5A 3IVFA 1P1AA 2RPQA 3JVZX 4B6WA 2MJEA 1AN8A 1UWMA 2KAJA 4XE0A 4CYEA 1OEYJ 3AEAB 3ZYYX 4HKQA 3U52E 3HRDD 3NVWA 4IM3A 1KLVA 4MACA 4DWFA 3NUHB 4DK5A 1D5MC 3DBRB 1LM8B 4EE2A 3ZNID 2PE9A 5EE0A 3KWLA 2EKEC 1Z2MA 3E9SA 2KOXA 4HXDA 1I4RA 1SGHA 1ROEA 1BMLC 3QIJA 2V4IB 1LFDA 2G3QB 3B1LX 4MJSA 3PRPB 1WX8A 4RM9A 1D5XC 2BW2A 3EGRA 4EZLA 2LASA 2W54A 1X1MA 3AEFB 1JROA 3HHMA 1C79A 1T0RC 4EFOA 2MLBA 5HKHA 1DOYA 1FXTB 2MHJA 4XWTA 1TBEA 1J0GA 4MGYE 4IWOA 4W9JA 1NYRA 4CO7A 3N30A 1WXVA 4ANVA 3AEBB 4RCOA 3AV8A 1YIWA 2V3NA 3P63A 1YD8U 3RPFC 4CQNA 3ZKJC 5BMIA 1NBFC 4KKJA 3M63B 3BY4B 2WXHA 3H9DA 1S3SG 1JW9D 2J42A 2WXOA 2INPE 2JYTA 2WDVB 4RMAA 3WALA 2WXKA 1R4MI 1E0ZA 2HJ1A 4BOZB 1SEBD 2JU6X 2LGSA 3I5JC 5HI1A 4TKNA 3MJ5A 3AN1A 4W9EA 2M0XA 2W9NA 3QA8A 2G1EA 1I4QA 3AEEB 4KDIC 2C9WB 2WX0A 3PO0A 1EO6A 3DBLI 3FILB 2IBIB 1UGMA 4ASWC 2WLBA 2CR5A 3P42A 2J0JA 3BYTB 2MWSB 1KM7A 3V60A 3TSSA 2LGYA 3LXFA 1P7EA 1QLBB 4KVGB 4ZRIA 1MG4A 2AQ2B 3L10B 4LJPB 2XEWA 2W82A 3ZXRA 3AMZA 1OGWA 3GZNI 3A9JA 1PGAA 1WI0A 4DXFA 2DAJA 1S1QB 2K0PA 4HDOA 5C23A 3WCQA 4MSQB 4KZCA 2W3RA 1C3TA 3SHQA 2QC8A 3QX1A 4JL9A 5JZEB 2WP9B 2KFKA 3ZNZB 3DVGX 1L0XB 2DENB 2AQ3B 1TT5B 1TZOA 3NS1A 2H88B 2RSUA 4CHKA 1NENB 3V61A 5I4DA 2O6VB 5EE9A 2MSED 1EF1A 4K3CA 1I4GA 3MFGA 1J7AA 2DZJA 2LGDA 3RNFC 1IBXB 1H4RA 3Q14C 1UBQA 3RUIB 4PK1A 1F2RC 4GDKB 3PTFC
chains in the Genus database with same CATH topology
2L1AA 2MEKA 3VRAB 2ICIA 2KN4A 3V05A 4YSYB 2ACZB 3ABVB 1N5WA 4US9A 3B2FA 1FCCC 1FO4A 2BS3B 4OHJA 1STEA 3AE7B 4XWWA 1HZ6A 1UWXA 1UUPA 2WNMA 1ACCA 1HZ5A 2NTSA 3W5VB 4TMAB 1FXAA 4LTUA 1F0ZA 2WXJA 4A55A 4RGNA 1WWTA 2JWUA 2I38A 5HHDG 4USAA 3C8YA 3J9CA 1VR9A 4YWGG 2W55A 1C76A 2B76B 1SE3A 1ZUD2 2N7JA 2N0SB 2M56B 4YT0B 1FCLA 1SXTA 1PGBA 1KLUD 3O13A 4RGTA 2LHDA 3SEBA 1V1PA 2WU2B 2IPKD 2L52A 5C3JB 1N60A 3W1SA 4B0EA 1JCKB 3GB1A 3Q8AA 2IDYA 4TSSA 1Y56A 1YN5A 5BMGA 2QIEB 2WU5B 4RNAA 1K50A 2EELA 3N9YC 3PZ7A 4HJGE 2JZPA 5FR3A 4OZBA 1JWMD 3Q69A 4ZHPA 4ITKA 2LJIA 3BYYB 3AECB 1OFFA 1YN4A 1RM6C 1MPEA 2QSDA 1TS2A 3BVGA 4O1NA 1E10A 1XO3A 3OWEB 4TQ0A 1VDVA 2YEPF 3E56A 1FNVA 1JMLA 1NVID 1K51A 3MC0B 2BTEA 1QOBA 4RF0A 4JPSA 4DQOC 1SJED 4D2KA 1JRPA 1QKZA 1ZE3D 2HDEA 2WXIA 3BK2A 1ZP0B 3HUIA 4GDLB 5C2TB 4YSXB 1EWCA 4YXDB 1KTKA 3MHZA 1YMHE 3B2GA 3T3OA 1N5XA 1KLGD 3P4SB 1WRIA 2OEDA 2IGDA 4JWSC 2BBCA 3HVDA 1CZPA 1I4HA 2PMVA 1WXQA 1QF6A 1L4DB 4JX1C 4L2YA 4WWMA 3LYYA 2K5PA 3Q8CA 3TEXA 4A9AA 1XLPA 1B1ZA 4Q2JA 3IT6B 2XNAC 1CK1A 3ZJVA 2JX5A 1AWDA 3UI3A 1T3QA 1XLQA 2WXPA 3R8BA 4KGRA 4MT5A 3GS2A 4OZAA 4RFBA 3B9JA 2HTME 1JQ4A 3IAS1 4A8XC 3AH7A 1KFYB 1EU3A 4C56C 4C7ZA 1DOIA 1SBBB 2K9XA 1EM7A 3KQ4A 1I7HA 1XCTL 2LHEA 2IJ0A 3LB8C 1ESFA 2W3SA 1I4XA 1SIJA 1OQQA 2LGIA 2KWDA 1MHXA 1YQ3B 3BIID 3CIRB 1MHHE 1L6VA 3TEYA 2FBWB 2ON8A 4P6VF 2BB6A 2CU3A 1IGDA 1WYGA 1VZ6A 4DXGA 1L6UA 2JQRB 2CJNA 1MVKA 4RGMA 2Z8LA 1GPXA 1D4BA 1SJHD 3PZ8A 1GOZA 4J3OD 4IKGA 1GB1A 2DYMA 1TKGA 2L83A 1ET9A 2WXMA 5H92C 1L0YB 1DYQA 1HA5A 3AE8B 4KX6B 4LK0M 2DBYA 5E6JA 1FNWA 1KH0A 1ZPSA 1QOGA 1TJEA 2QJLA 1N61A 1KF6B 3NVVA 2I2YA 4A90A 4B0MA 1ET6A 1N62A 1GAQB 5BYSA 4AS1A 1V1PB 2BS4B 2EKIA 2GRIA 2Q5WD 1TS4A 3BVZA 5HG2A 1PFDA 2WS3B 2D5GA 1D6EC 4RGOS 4ZRQA 1LO5D 1RFKA 4LLGM 2CJOA 2RPVA 1FEHA 3IAM1 2WXLA 3EA6A 1QILA 2Y5CA 1XXGA 3Q8EA 4RH6A 1FRDA 2AQ1B 1RYJA 1SF0A 2WDQB 1ZOYB 4WURA 5AUIA 4P16A 1PGXA 1TS3A 1AW7A 1EU4A 2PW9A 1T6BX 5GXGB 4WH4A 4NAMA 3P4PB 1ZXIA 1ZDXA 4PT5A 3AE4B 3AE1B 1FM0D 4L1BA 4HROA 2AX5A 4WAFA 1K52A 1IGCA 5D3IB 2RDGA 3SR6A 4NJCA 1FFVA 3HVZA 1RWSA 3BZDB 4RF1A 4ARCA 1F2RI 1L4ZB 2PLPA 1JWBD 3BWUD 1FMAD 4AQ7A 1IUEA 3AE5B 4KKIA 1E9MA 2E6XA 1JWAD 1L5PA 2R61A 5BMHA 2LUMA 2RDHA 1A70A 3ZQ4A 2J4XA 3AE3B 2IGHA 3VR8B 2M19A 4KGTA 2X38A 1DOXA 3BVMA 5T8IA 1HEZE 1J7BA 2DLBA 2M0AA 3AE6B 1SSNA 3AEGB 2DYOA 3T3NA 5LNK1 2MJEA 1AN8A 2BT6A 5G5GA 1UWMA 2KAJA 3VRBB 4XE0A 2NTTA 3AEAB 5HFYA 1VJKA 2E3TA 3ZYYX 1BUIC 3GP7A 4HKQA 3TEWA 2QMTA 3I57A 3U52E 1PYWD 3HRDD 5FKAC 3NVWA 2WXFA 1QOFA 1MI0A 1YNTE 4MACA 2OHFA 2ONQA 3NUHB 1TY2A 3W2DA 2ZW0A 3AM9A 1D5MC 1FIQA 4REZA 4OW0A 3URYA 5H8YE 4EE2A 1V97A 3W5UB 1PUTA 3ETRA 3RFZB 5EE0A 2NMQA 1YJIA 3KWLA 4OVZA 5G5HA 4US8A 2KDMA 3E9SA 3FC4A 1I4RA 1ROEA 1BMLC 2WXQA 3BK1A 2Y3AA 2V4IB 1GB4A 2LFIA 1NYQA 4ZRPA 3U4EG 2KQ4X 1ZDVA 1FNUA 2GB1A 2SAKA 1FFUA 4YTMB 1HXYD 1D5XC 2BW2A 3EGRA 4JWUC 3TUOA 3V3XA 4A6QA 3U2SC 2YEPB 3EUB2 4H2AA 2BYTA 2W54A 2XN9C 1TKEA 2KMMA 1XCQL 1DGJA 4ZHOA 2FE8A 2G9HD 3AEFB 1JROA 1C79A 5BYQA 2BB5A 1YJJA 2BS2B 2RMMA 4HKZE 5FK9C 1FXIA 2H89B 1SE4A 1DOYA 2PVGC 1VLBA 4N6EB 1C9FA 1IBXA 2JSVX 1TY0A 4XWTA 1I4PA 2IGGA 1C4AA 1E7PB 4XDCA 1NEKB 4MM3B 1NYRA 3SFEB 3ZGZA 5AUKA 3AEBB 4RCOA 3AV8A 4JE3B 2V3NA 3P63A 4UDUC 2WQYB 1HQRD 1E6EB 2KACA 1SE2A 3FAHA 4HRSA 1J7CA 2J53A 4OZCA 2SEBD 3RPFC 4C7YA 1V8CA 4CQNA 4HEA1 2Y5PA 5BMIA 4FXCA 4KKJA 1EWYC 4YSZB 1BXTA 2WXNA 2WXHA 1P7FA 3VQIA 4YTNB 1JW9D 2J42A 2WXOA 2INPE 4ZYSA 2JYEA 1JWSD 1N63A 2JYTA 2LEKA 2WDVB 3I9V1 1YQ4B 3R2TA 2WXKA 1XF5L 1JWUD 2V3PA 1E0ZA 1SEBD 2INNE 3NVYA 1L0VB 2JXTA 3SFDB 2JU6X 2PKOA 1R7SA 1TKYA 4YTPB 5HI1A 3DWGC 1B9RA 3MJ5A 3AN1A 5D3DA 2N9KA 2G1EA 1NI3A 1VZ8A 1I4QA 3AEEB 5BYRA 4IOIE 4KGSA 2K3UA 4WQMA 1QQRA 3PO0A 3U7ZA 3FILB 1CQVA 1M4VA 2DWQA 3P4RB 1F77A 1FRRA 4XDDA 1CJEA 3AB5A 3DWMA 1WSPA 4L23A 1ZXHA 2V0GA 2WLBA 3MP9A 1D5ZC 1TYGB 1PDXA 3P42A 5TSSA 3BYTB 3NVZA 1UGJA 4IDIA 2FUG1 1XLNA 3FILA 3NZ3A 5EE1A 3TSSA 3AEDB 1TS5A 1V1OA 3P4QB 3H8HA 1JALA 1C4CA 2VZKD 3W9CB 3LXFA 2MH7A 2N9LA 1P7EA 1QLBB 3L4PA 2AQ2B 2QILA 5D7GA 1K53A 2ZW1A 1WGKA 4MH8A 1YN3A 1C78A 1FD6A 2W82A 2WXRA 3AMZA 2PTLA 3NRZA 4WIPA 2QEJC 1PGAA 4DXFA 2VZKB 2K0PA 1T5XD 1Q10A 1C77A 3WCQA 1OQRA 2W3RA 2PIAA 2J52A 3IXSA 3R2IA 3Q8FA 2WP9B 1SB3C 1XEEA 3AE2B 1L0XB 3TEZA 2MJ3A 2PVOD 4ARIA 5MPOA 3VR9B 1QOAA 2AQ3B 5JXVA 3AE9B 1AYFA 4TQ1A 2MJDA 1TZOA 2WDRB 3CWIA 3NS1A 2H88B 1QT9A 3IT4B 4ZOHC 3KWVA 1NENB 4NAWB 5I4DA 3ZJUA 5EE9A 1VRAB 4GLSC 2TSSA 3Q8BA 2L32A 1VZ7A 4M0WA 1KRHA 2GI9A 1ENFA 1I4GA 4NZLB 3KLSX 4C80A 3MFGA 4N58A 1J7AA 1C4PA 4N59A 4R3DA 1IBXB 2K22A 1XLOA 2WXGA 5EE3A 2LMCA 3P1MA 3ZJTA 1F2RC 4GDKB 1UNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A70 A;  3VRA B;  3AE3 B;  3AH7 A;  1KFY B;  3VR8 B;  4C7Z A;  2M19 A;  1DOI A;  2K9X A;  4YSY B;  4YTN B;  1JW9 D;  1DOX A;  1I7H A;  2ACZ B;  3ABV B;  1J7B A;  1N63 A;  2LEK A;  1N5W A;  2WDV B;  3LB8 C;  1YQ4 B;  4US9 A;  2W3S A;  3B2F A;  1SIJ A;  1E0Z A;  1OQQ A;  3AE6 B;  1FO4 A;  3AEG B;  2BS3 B;  3AE7 B;  3NVY A;  1YQ3 B;  3BII D;  1L0V B;  3CIR B;  3SFD B;  1L6V A;  2PKO A;  1R7S A;  1TKY A;  2BT6 A;  2MJE A;  1UWM A;  2KAJ A;  4YTP B;  2FBW B;  5G5G A;  3VRB B;  3DWG C;  4P6V F;  3AEA B;  1VJK A;  2E3T A;  3ZYY X;  2CU3 A;  3AN1 A;  1B9R A;  2G1E A;  1WYG A;  3W5V B;  1NI3 A;  1L6U A;  2JQR B;  1FXA A;  3AEE B;  2CJN A;  4LTU A;  1F0Z A;  3HRD D;  3NVW A;  1QOF A;  1WWT A;  4WQM A;  1GPX A;  3PO0 A;  2OHF A;  4USA A;  1TKG A;  2DWQ A;  2L83 A;  2W55 A;  3P4R B;  5H92 C;  1FRR A;  1CJE A;  3AB5 A;  3DWM A;  2B76 B;  1ZUD 2;  2WLB A;  2N0S B;  2M56 B;  3AM9 A;  4YT0 B;  1TYG B;  1PDX A;  3AE8 B;  4KX6 B;  1FIQ A;  3NVZ A;  2DBY A;  2WU2 B;  4IDI A;  5H8Y E;  1XLN A;  1V97 A;  2L52 A;  5C3J B;  1N60 A;  3W5U B;  1PUT A;  3ETR A;  5EE1 A;  3AED B;  3P4Q B;  5EE0 A;  1YJI A;  1QOG A;  1TJE A;  1JAL A;  2QIE B;  3KWL A;  2QJL A;  2WU5 B;  5G5H A;  4US8 A;  3W9C B;  3LXF A;  1N61 A;  1KF6 B;  2MH7 A;  1QLB B;  3FC4 A;  3NVV A;  3L4P A;  1ROE A;  1N62 A;  1GAQ B;  1WGK A;  2BS4 B;  2EKI A;  4ZHP A;  2Q5W D;  3AMZ A;  3NRZ A;  1NYQ A;  4N6E B;  1PFD A;  4ITK A;  2WS3 B;  3AEC B;  4YTM B;  1FFU A;  1OFF A;  4JWU C;  1RFK A;  3WCQ A;  1RM6 C;  1OQR A;  2CJO A;  2W3R A;  3EUB 2;  1XO3 A;  2PIA A;  2W54 A;  1VDV A;  1E10 A;  1NVI D;  1TKE A;  2KMM A;  4ZHO A;  1DGJ A;  2WP9 B;  2Y5C A;  1SB3 C;  1FRD A;  3AEF B;  1RYJ A;  1SF0 A;  1JRO A;  1QOB A;  1ZOY B;  2WDQ B;  5AUI A;  3AE2 B;  1JRP A;  2MJ3 A;  2PVO D;  5MPO A;  3HUI A;  1ZP0 B;  3VR9 B;  1YJJ A;  2BS2 B;  1QOA A;  5C2T B;  4YSX B;  4YXD B;  1FXI A;  2H89 B;  5GXG B;  3AE9 B;  1AYF A;  1DOY A;  3B2G A;  3P4P B;  1ZXI A;  2PVG C;  2MJD A;  1N5X A;  1VLB A;  2WDR B;  3AE4 B;  3CWI A;  3NS1 A;  2H88 B;  1FM0 D;  1QT9 A;  1WRI A;  3AE1 B;  3P4S B;  4JWS C;  4HRO A;  1CZP A;  2AX5 A;  4ZOH C;  1WXQ A;  1QF6 A;  1NEN B;  4JX1 C;  4WWM A;  1E7P B;  5EE9 A;  3SR6 A;  1FFV A;  1NEK B;  2K5P A;  3HVZ A;  1KRH A;  1NYR A;  1RWS A;  1XLP A;  3SFE B;  4A9A A;  5AUK A;  1JWB D;  3AEB B;  4C80 A;  3AV8 A;  4N58 A;  1J7A A;  1FMA D;  4N59 A;  3P63 A;  1IUE A;  2JX5 A;  1AWD A;  2WQY B;  3AE5 B;  1E6E B;  3FAH A;  4HRS A;  1T3Q A;  1E9M A;  1J7C A;  1XLO A;  1XLQ A;  2K22 A;  3P1M A;  1JWA D;  1V8C A;  1L5P A;  5EE3 A;  3RPF C;  4C7Y A;  4FXC A;  4YSZ B;  1EWY C;  3B9J A;  2HTM E;  1JQ4 A; 
#chains in the Genus database with same CATH topology
 3VRA B;  2ICI A;  3V05 A;  3ABV B;  1N5W A;  4US9 A;  4NNJ B;  1FO4 A;  3U7D A;  1STE A;  2KQS A;  1HZ6 A;  3LDZ E;  4FA6 A;  5LXH A;  2C7N B;  3GOE A;  3JSV A;  4ZRJ A;  2WNM A;  2CKH B;  2ZJD A;  2NTS A;  3T8M A;  4TMA B;  1FXA A;  1TGZ B;  4A55 A;  1WWT A;  4F8C B;  3LJ3 A;  4USA A;  3J9C A;  1VR9 A;  4KIK A;  1F9J A;  1SE3 A;  4BAX A;  2N7J A;  2N0S B;  4YT0 B;  1SXT A;  1WX7 A;  3Q6B A;  4JGH B;  2LHD A;  1M94 A;  5C3J B;  4W9D A;  4LJO B;  4NJ7 A;  3Q8A A;  5BMG A;  4HWI B;  2MBH A;  4FJY A;  1K50 A;  3N9Y C;  5G2N A;  5FR3 A;  1KJT A;  3WAO A;  2FNJ B;  1UZX B;  3PSE B;  3UIP B;  4XX5 A;  4GSW A;  4WQO B;  1YN4 A;  2LXC A;  1RM6 C;  4JQW C;  3L13 A;  1E10 A;  1XO3 A;  3OWE B;  4TQ0 A;  4JPS A;  4F1S A;  3NJT A;  4FAD A;  3BK2 A;  3HUI A;  5C2T B;  1EWC A;  1KTK A;  1LXD A;  3T3O A;  2IO3 B;  1N5X A;  1KLG D;  4BBN C;  2OED A;  3HVD A;  5KHQ A;  4K3B A;  3LYY A;  1Y8R C;  3TEX A;  2MQJ A;  4Q2J A;  2XNA C;  4ZYN A;  2DAF A;  3OAW A;  1AWD A;  3VHT C;  3UI3 A;  3ECI A;  4ANU A;  1T3Q A;  4KGR A;  1SE9 A;  2IY1 B;  3DBH I;  3GS2 A;  2ASQ A;  4M0W B;  4A8X C;  1KFY B;  2ZVO A;  2W3S A;  3PVL A;  1N6Z A;  2MP2 B;  4C4V B;  1YQ3 B;  5JHA A;  4QAY A;  1L6V A;  4ICU A;  1V86 A;  4DXA B;  1IGD A;  1WYG A;  1VZ6 A;  1QZE A;  3M95 A;  4HCN B;  3N1X C;  1GB1 A;  1TKG A;  5IP4 D;  1WFY A;  1GUA B;  2L8J A;  4JLC A;  4W9H A;  4IC7 B;  1WJ4 A;  4LK0 M;  2DBY A;  4FHJ A;  5E6J A;  3IHP C;  1TTN A;  3AXC A;  1ZPS A;  1QOG A;  1YX5 B;  2I2Y A;  4B0M A;  3X0W A;  4GN1 A;  2B3A A;  2Q5W D;  1TS4 A;  3VXW A;  2WS3 B;  3N20 C;  3PRM B;  3NZS A;  1V9J A;  3IAM 1;  2WXL A;  1QIL A;  2ZZP B;  4II3 B;  1XXG A;  3Q8E A;  4RH6 A;  1FRD A;  2WDQ B;  2D3C A;  2LD9 A;  1PGX A;  1AW7 A;  3APC A;  3VTW A;  3L08 A;  3WIM A;  5JH5 C;  1UF0 A;  4NAM A;  4M02 A;  1ZXI A;  2YLM A;  2KTR A;  1R4N I;  3T9L A;  2RDG A;  3DQV A;  1RWS A;  2FCM A;  3BZD B;  4IUM B;  2NS5 A;  1GC7 A;  2KXJ A;  4DHZ E;  2J4X A;  2IGH A;  3WA0 A;  2N1V A;  2LRW A;  2M19 A;  3VR8 B;  1DOX A;  3BVM A;  5T8I A;  4C00 A;  1J8C A;  2L05 A;  2M0A A;  4M8N A;  1EUV B;  3AEG B;  1MG8 A;  2DYO A;  3T3N A;  5LNK 1;  2EMT A;  2BT6 A;  5G5G A;  3R3M A;  2E3T A;  1BUI C;  3GP7 A;  3ALB A;  3EHV A;  4BOS C;  3RN9 C;  1WM2 A;  3I57 A;  2GBM A;  5FKA C;  1QOF A;  2RDB C;  4FLH A;  3ZNH B;  1D3Z A;  2ONQ A;  4AOF A;  4A3P A;  3H7P A;  1YOV B;  3EFC A;  4FHK A;  3W2D A;  3AM9 A;  4BZA A;  4REZ A;  2N7E A;  5H8Y E;  3IG3 A;  3OJ3 A;  3W5U B;  4LCD E;  1PUT A;  3ETR A;  3RFZ B;  4LNF A;  1YJI A;  4OVZ A;  5G5H A;  3ZW3 A;  5E6N A;  1C1Y B;  2Y3A A;  1GB4 A;  2LFI A;  2KN5 A;  2KQ4 X;  4YTM B;  2K6D B;  2KHW B;  4A6Q A;  5D6J B;  2OJR A;  1WE7 A;  2XN9 C;  2KMM A;  2D3G A;  1XCQ L;  1DGJ A;  2FID A;  2BGF A;  4GOC A;  1YJJ A;  4HKZ E;  2EMS A;  1SE4 A;  3H7S A;  1VLB A;  4N6E B;  1F1H A;  1WZ0 A;  1C4A A;  3CMM B;  4XDC A;  2KC1 A;  4PS3 A;  4MM3 B;  2RD0 A;  5AUK A;  1T0Q C;  3UIN B;  4UDU C;  2WQY B;  1HQR D;  2KAC A;  3FAH A;  4C7Y A;  2BKF A;  4HEA 1;  2WXN A;  3VQI A;  1N63 A;  2LEK A;  1XF5 L;  2NCN A;  2JXT A;  4TV3 A;  2PKO A;  4YTP B;  3A4S C;  3PHX B;  3KYC D;  2L76 A;  5D3D A;  5AZH A;  2KMA A;  2K3U A;  4KGS A;  1EF5 A;  3RNE C;  1M4V A;  1V5O A;  4I6L B;  3RUL A;  3K9P B;  4XDD A;  3VTU A;  4NY0 A;  2V0G A;  2MW5 A;  3MP9 A;  2Z0D B;  2LI5 A;  1TYG B;  3N1Z C;  2CHW A;  3A1Q A;  3NVZ A;  1UGJ A;  2FUG 1;  3NZ3 A;  1GJZ A;  3H8H A;  4LNI A;  2HE7 A;  1JAL A;  5CHF A;  2VZK D;  3W9C B;  3RMK C;  5D7G A;  2ZW1 A;  2BYV E;  2JY6 A;  4MH8 A;  1FD6 A;  4MH0 E;  3EC8 A;  3RT3 B;  4MGI E;  4AJW A;  4GDL A;  1C77 A;  3ML9 A;  3KVF B;  3ZIM A;  2PIA A;  4NQK E;  2C5L C;  3R2I A;  3Q8F A;  1K8R B;  3MHS D;  1OTR B;  4WAA A;  3TEZ A;  5MPO A;  3U8Z A;  3DVN V;  5JXV A;  4KZ0 A;  2XK5 A;  4W9I A;  3AI5 A;  3IT4 B;  2D11 A;  3VUY A;  4ZOH C;  3PRZ A;  2A5U A;  4GB9 A;  4NAW B;  4GMV A;  1KRH A;  2GI9 A;  1ENF A;  4ACF A;  2KVR A;  1UD7 A;  1VCB A;  3PV1 A;  1C4P A;  4N59 A;  1WY8 A;  1Q1O A;  4R3D A;  2K22 A;  1XLO A;  3P1M A;  4A20 A;  1UNS A;  3A33 B;  2KN4 A;  2MBQ A;  2KC2 A;  4W9F A;  3B2F A;  3L54 A;  3TJP A;  2UYZ B;  2NBV B;  4XWW A;  1HTQ A;  1UWX A;  1VD2 A;  3ZUN A;  2QHO A;  4XZ4 A;  3BIN A;  3GE3 C;  5AZF A;  1ACC A;  3W5V B;  4OVU A;  1UH6 A;  2FIF A;  4LTU A;  1F0Z A;  3Q3O C;  2I38 A;  1WE6 A;  4HVB A;  2B76 B;  1WGG A;  1ZUD 2;  2N4F A;  4ICV A;  4RGT A;  1WXS A;  2DNF A;  3SEB A;  1V1P A;  2JVC A;  2WU2 B;  2IPK D;  2L52 A;  2V9H A;  4B0E A;  4G0N B;  3R66 C;  4K1R B;  1YN5 A;  2FCQ A;  2QIE B;  2WU5 B;  4RNA A;  4WJP A;  1SIF A;  3TBL D;  4OZB A;  2AYO B;  4ZHP A;  1IYF A;  3BYY B;  2MCN B;  1OFF A;  4ANX A;  3PLV A;  1TS2 A;  1VDV A;  1FNV A;  1YQB A;  2KNB A;  3DBL B;  3DPD A;  3V62 A;  2BTE A;  1QOB A;  4DQO C;  1SJE D;  4AP4 C;  1JRP A;  1ZE3 D;  2HDE A;  4YSX B;  1ZP0 B;  3NS8 A;  5CHV C;  1Q5W B;  3MHZ A;  1YMH E;  2CHX A;  3B2G A;  4JIO U;  3P4S B;  2UU7 A;  3ZDT A;  2BBC A;  1E5W A;  1I4H A;  1WXQ A;  1HE8 A;  4M00 A;  4XYC A;  2QCZ A;  5D2M B;  3AUL A;  4A9A A;  1E90 A;  2O2V A;  4URK A;  1L2N A;  1H8C A;  3R7Q A;  5AZG A;  3R8B A;  3GZN B;  3WAM A;  2Y5B B;  4FJZ A;  2KVZ A;  3KUD B;  1TIF A;  1PQS A;  4C56 C;  2K9X A;  4AJY B;  2KYW A;  1I7H A;  2IJ0 A;  3RNG C;  2MBE A;  1SIJ A;  2KWD A;  2MRP A;  3TEY A;  1WJU A;  2ON8 A;  4BKS A;  3ZRC A;  2KTF A;  2BB6 A;  3PS6 A;  2LVO A;  4EZK A;  2BPS A;  4ZRK A;  2JQR B;  1WMH B;  2CJN A;  3P2B A;  1MVK A;  3A9K A;  1GPX A;  1SJH D;  4IM0 A;  4J3O D;  5JHB A;  2R2O A;  2DYM A;  2KFJ A;  3VFK A;  4K7W A;  2WXM A;  2X8X X;  3L0W B;  2K39 A;  1F52 A;  3MJW A;  1V5T A;  3CSF A;  1KH0 A;  1TJE A;  4G50 A;  2QJL A;  1N61 A;  1KF6 B;  3NVV A;  1ET6 A;  1GAQ B;  5BYS A;  5DPS A;  3RNC C;  2EKI A;  2GRI A;  3PHW B;  1BT0 A;  3EEC A;  4RGO S;  4KV2 A;  3DVN U;  4ZRQ A;  3RZF A;  2JF5 A;  1FEH A;  3PLU A;  3QC8 B;  2AQ1 B;  1RYJ A;  4P16 A;  1ZKH A;  1MFW A;  2ZCC A;  1TS3 A;  1EU4 A;  1T6B X;  2LWP A;  3QCA A;  5GXG B;  4WH4 A;  2NPT B;  2KQ7 A;  4K7U A;  4XC2 A;  3Q2A C;  1FM0 D;  2REX A;  4HRO A;  4WAF A;  1WYW B;  4IWQ A;  3C19 A;  1L4Z B;  3ZO5 B;  2PLP A;  1JWB D;  4PYZ A;  4S0R A;  1IUE A;  1E9M A;  2OOB B;  3ZTC A;  1A70 A;  4KGT A;  2BWF A;  2DZI A;  2GMI C;  2K25 A;  3U30 A;  1J7B A;  1SSN A;  3NHE B;  4BBN F;  2JZZ A;  2GOW A;  1IPG A;  4NQL B;  1LQB A;  5HFY A;  1VJK A;  3MTN B;  4LDT B;  2QMT A;  3VDZ A;  2WXF A;  1MI0 A;  4HCP B;  1ZW7 A;  3W1S C;  2OHF A;  4W9K A;  5IOI A;  4P1B C;  2ZPY A;  4LNN A;  2ZW0 A;  2LRU A;  3DBH B;  3ZXV A;  1FIQ A;  5CTR C;  4OW0 A;  3VH3 B;  4BKG A;  2MBB B;  1V97 A;  4YL8 A;  2XBB C;  4N9F 4;  2LJ5 A;  2NVU I;  2NMQ A;  4WWN A;  4US8 A;  2KDM A;  4BFR A;  2KAN A;  3HM6 X;  3BK1 A;  2L0T A;  4W9G A;  4ZRP A;  3U4E G;  5GMV A;  1ZDV A;  2PE6 B;  1E8Y A;  1MJD A;  3V3X A;  3TUO A;  3U2S C;  2YEP B;  4H2A A;  4ZHO A;  2FE8 A;  3N3K B;  2G9H D;  2O6V A;  2JT4 B;  4G3X B;  2BVC A;  4II2 B;  2BB5 A;  5CHW A;  2BS2 B;  2C7H A;  2DX5 B;  1V2Y A;  3Q3J A;  2OJW A;  1JRU A;  3DHG C;  1C9F A;  1IBX A;  2JSV X;  2ZVN A;  5EDS A;  2KMC A;  4GDK A;  1NEK B;  1YJ1 A;  3SFE B;  4JE3 B;  3UQB A;  4HRS A;  3RYT A;  4MGZ E;  1J7C A;  2J53 A;  4P1C C;  2SEB D;  1V8C A;  4W9C A;  1T0Y A;  4FXC A;  4YSZ B;  1EWY C;  1I42 A;  2D3A A;  1P7F A;  1P9D U;  4GXB A;  2J0M A;  4ZYS A;  3I9V 1;  1YQ4 B;  4ANW A;  1JWU D;  2N9X A;  4X57 B;  2K6Q A;  2INN E;  1L0V B;  3SFD B;  1TKY A;  4DHZ B;  3DWG C;  2AL6 A;  2WYQ A;  2BF8 B;  2N9K A;  4DHJ B;  4EZJ A;  3TMP B;  1NI3 A;  1R4N B;  2KJR A;  4WQM A;  1QQR A;  3DHI C;  3U7Z A;  3V6E B;  1CQV A;  1TZ1 A;  3AU4 A;  1F77 A;  3AB5 A;  3DWM A;  1WSP A;  1ZXH A;  1D5Z C;  2LVP A;  2L3Z A;  4IDI A;  1XLN A;  4IWP A;  3KYD D;  1V1O A;  3P4Q B;  5IA7 A;  1C4C A;  2N9L A;  3L16 A;  2QIL A;  1K53 A;  1WGK A;  1YN3 A;  1C78 A;  2WXR A;  3QQ8 B;  3NRZ A;  4WIP A;  2IO2 B;  2VZK B;  1T5X D;  1Q10 A;  1J19 A;  1OQR A;  4WJO A;  4EKU A;  2XK5 B;  3IXS A;  4GU2 A;  3APF A;  2IY0 B;  4B95 A;  3NOB A;  1SB3 C;  1WXA A;  1T0S C;  4MJS B;  4E3C A;  2PVO D;  4ARI A;  4EEW A;  2PEA A;  1AYF A;  2G4D B;  2MJD A;  2WDR B;  1QT9 A;  3KWV A;  3ZJU A;  1VRA B;  2TSS A;  1HTO A;  2L32 A;  1VZ7 A;  4M0W A;  2DZK A;  3SU8 X;  4N58 A;  1WGH A;  2WXG A;  4KSL C;  1RAX A;  2LMC A;  2ZEQ A;  5EE3 A;  2MP2 A;  3ZJT A;  3O65 B;  4C4V A;  2PJH A;  5L95 C;  5AEK B;  1RFA A;  2ACZ B;  1FCC C;  4F7Z A;  2BS3 B;  4OHJ A;  1ISN A;  4FUL A;  2JRH A;  4K81 A;  2KZR A;  3UF8 A;  4EUT A;  2ZCB A;  3N32 A;  2WWZ A;  4RGN A;  2LXA A;  5IAA C;  3TCA A;  5LLI A;  1C76 A;  2V4L A;  4PS8 A;  1L7Y A;  1V49 A;  1FCL A;  2M56 B;  2KD0 A;  1V80 A;  4PYU A;  1KLU D;  3ML8 A;  2KX0 A;  2R2Q A;  1UEL A;  2DYB A;  3VUW A;  1JCK B;  3GB1 A;  5C1Z A;  2FAZ A;  4TSS A;  1Y56 A;  3ZDM C;  3RCZ A;  4BVU C;  2J7Q B;  3PZ7 A;  4HJG E;  2IZV B;  2JZP A;  3ZNG C;  1E8X A;  1JWM D;  2VH2 A;  4HLE A;  1GC6 A;  3Q3N C;  4K7S A;  4ITK A;  2LJI A;  2K8H A;  1P0R A;  2GBR A;  4FN2 A;  3E56 A;  1NVI D;  3JYU A;  3KH0 A;  1K51 A;  5CX3 A;  3MC0 B;  3WAP A;  3A9J B;  2KDF B;  4D2K A;  1QKZ A;  3A4R A;  4HPP A;  2KX3 A;  2D3B A;  5DPR A;  2L7R A;  1A5R A;  4JWS C;  2KFK B;  2KWC A;  4JX1 C;  4J6I A;  2K5P A;  1XLP A;  3IT6 B;  2D07 B;  1CK1 A;  3ZJV A;  2VH1 A;  3VUX A;  1CMX B;  5E6O A;  2JX5 A;  3UQA A;  2WXP A;  1E7U A;  3D32 A;  4RFB A;  3B9J A;  2G4S A;  2HTM E;  2KK8 A;  3DBR I;  3H6N A;  2JZ3 B;  2M1M A;  4C7Z A;  3FKY A;  1SBB B;  1EM7 A;  3Q3M C;  4WWO A;  2LHE A;  2J0K A;  3LB8 C;  4IM2 A;  4FJV B;  1I4X A;  1OQQ A;  2LGI A;  4A3O A;  3BII D;  1MHH E;  4MDK E;  3A9K B;  2FBW B;  1WXM A;  2CU3 A;  3DBS A;  4DXG A;  2KLG A;  3OG5 A;  3M3J A;  3DHH C;  2Z8L A;  1D4B A;  2KKC A;  1GOZ A;  1V81 A;  2M4N A;  4IKG A;  3JSV B;  2L83 A;  1ET9 A;  5H92 C;  1FPY A;  2IO1 B;  4IG7 B;  2KWU B;  4M8M A;  4E74 A;  4LNO A;  2MX2 A;  1WZ3 A;  3DVG Y;  3KUC B;  4KX6 B;  4GIV A;  4PS7 A;  2DHZ A;  3NY5 A;  4KIK B;  3B0A A;  4A90 A;  4AS1 A;  1P98 A;  2BS4 B;  2Z0E B;  2NBU A;  2K1F A;  3BVZ A;  5HG2 A;  1PFD A;  2INC C;  2IND C;  1D6E C;  1ZGU B;  2JUO A;  1RFK A;  2N1W A;  2RPV A;  3EA6 A;  1OEY A;  2I1J A;  2Y5C A;  3ZTD A;  5AUI A;  1WR6 E;  1Z5S B;  1NDD A;  2HJ8 A;  4MM3 A;  5TR5 A;  4I6N B;  2CS4 A;  1R4M B;  1I35 A;  1XD3 B;  4PT5 A;  3AE4 B;  3Q3F A;  4L1B A;  2AX5 A;  3TL5 A;  1IGC A;  3PRE A;  1FFV A;  3HVZ A;  4ARC A;  2M8S A;  1F2R I;  3BWU D;  2AEH A;  2G45 B;  1GG3 A;  1RLF A;  3K9O B;  4WJN A;  1FMA D;  2V3S A;  3AE5 B;  2GLS A;  4KKI A;  5DPW A;  5BMH A;  2LUM A;  4TUU A;  2DZM A;  2X38 A;  5LXI B;  2HTH A;  2DLB A;  3C0R B;  2C7M B;  4DDI D;  5J2R A;  3VRB B;  2NTT A;  4BKS D;  5FR6 A;  3TEW A;  2VRR B;  1PYW D;  4W9L A;  3KUZ A;  1YNT E;  2GBK A;  2I1K A;  1WGY A;  1TY2 A;  3N1Y C;  3ENE A;  3UIO B;  4MEL A;  3AU5 A;  4B9K A;  1V6E A;  4KSK C;  3URY A;  2JRI B;  2CU1 A;  2ZPN A;  3QHT A;  1XT9 B;  1AAR A;  3ONS A;  3RNB C;  3FC4 A;  4E71 A;  2WXQ A;  4HPL B;  3VTV A;  1NYQ A;  3HIZ A;  2KWV B;  1FNU A;  2GB1 A;  2SAK A;  1FFU A;  1HXY D;  1NI2 A;  3VAW A;  4JWU C;  3EUB 2;  2BYT A;  3VH4 B;  1TKE A;  2MA9 B;  2L00 B;  4NAW A;  5BYQ A;  2RMM A;  4BKT A;  2JWZ A;  1FXI A;  2H89 B;  3KW5 B;  5FK9 C;  1E8W A;  2PVG C;  4EOY A;  2LGX A;  1TY0 A;  1XQQ A;  1I4P A;  3I63 C;  2IGG A;  1E7P B;  3GE8 C;  3ZGZ A;  2MBO A;  2RGF A;  3X23 A;  2KJH B;  3PZD A;  3DCG A;  1WF9 A;  1WRD B;  1E6E B;  1SE2 A;  4OZC A;  3JW0 X;  1LGR A;  2Y5P A;  2KTR B;  1RRB A;  1BXT A;  2QDF A;  4YTN B;  2JYE A;  1JWS D;  5DPT A;  1U4A A;  3R2T A;  2V3P A;  2IO0 B;  3NVY A;  1R7S A;  2M17 A;  1B9R A;  2KDB A;  1E7V A;  3W1Y A;  1VZ8 A;  5BYR A;  3VVW B;  4IOI E;  2L0F A;  2JPH A;  4AUQ C;  2DWQ A;  3P4R B;  3QAR A;  1FRR A;  4GGQ A;  1CJE A;  4L23 A;  3QK0 A;  1PDX A;  3IFW B;  5TSS A;  2V1Y A;  3FIL A;  3ZRF A;  5J18 A;  5EE1 A;  3AED B;  1TS5 A;  3H7P B;  2MH7 A;  4G11 A;  3L4P A;  2WDT B;  1WX9 A;  2PTL A;  2QEJ C;  3PPA A;  2AWT A;  1WIA A;  2KT7 A;  2BKR B;  2J52 A;  4RM8 A;  1XEE A;  2KJ6 A;  3OLM D;  3AE2 B;  2MJ3 A;  3VR9 B;  1IP9 A;  2O6V D;  1QOA A;  1Q0W B;  2A4Z A;  3AE9 B;  4TQ1 A;  2N9P C;  3CWI A;  4GLS C;  3Q8B A;  2KLC A;  2AL3 A;  3R7R A;  4NZL B;  2C60 A;  3KLS X;  4DBG A;  4C80 A;  3OJ4 B;  4HDQ A;  3UGB B;  2YVC A;  2WGS A;  4M01 A;  4HJK A;  5J17 A;  2L1A A;  2MEK A;  2LUE A;  5IN7 A;  4I6P A;  4YSY B;  2D10 A;  3HM3 A;  1WGD A;  1WMH A;  4HPM B;  3AE7 B;  3QJZ A;  3MC8 A;  3IBE A;  1UUP A;  2BWE S;  1OQY A;  2FCS A;  2KO3 A;  1HZ5 A;  3HK0 A;  4NPN A;  2WXJ A;  4AWJ A;  5E6P A;  3CF6 E;  2JWU A;  5HHD G;  4HK2 A;  3C8Y A;  1WGR A;  4YWG G;  2W55 A;  2N9E B;  2WHI A;  2K8C A;  1PGB A;  3O13 A;  2CHZ A;  1N60 A;  3MC9 A;  3W1S A;  4WWP A;  2JXX A;  2IDY A;  1WH3 A;  2D2Q A;  2ZNV B;  4XGA B;  2EEL A;  5DCN A;  3A1Q B;  2NR2 A;  3Q69 A;  2GBJ A;  3TIX A;  2UWQ A;  1WR1 A;  1WJN A;  3AEC B;  1MPE A;  2QSD A;  3BVG A;  2NPT A;  4O1N A;  5KHO A;  2YEP F;  1JML A;  4MEM A;  3DOW A;  4RF0 A;  3ZVV A;  2WXI A;  4GDL B;  4YXD B;  1P3Q U;  4MGK E;  1UBI A;  1WRI A;  2BQQ A;  2IGD A;  1CZP A;  2PPH A;  2PMV A;  1QF6 A;  2BYE A;  1L4D B;  3SDL C;  4LDT D;  4WWM A;  4L2Y A;  2RR9 A;  3Q8C A;  1B1Z A;  4KDL B;  1XLQ A;  3B08 A;  2FUH B;  4LNK A;  3NZU A;  3DDC B;  4MT5 A;  4OZA A;  4NJ6 A;  1JQ4 A;  3IAS 1;  3AH7 A;  1EU3 A;  1DOI A;  3KQ4 A;  1XCT L;  5IO9 A;  1ESF A;  2Z59 B;  4S17 A;  2LVQ A;  3CST A;  3S2A A;  2IYD B;  4P7I A;  3WAN A;  1MHX A;  3RI7 C;  3CIR B;  3RZW C;  5BO4 B;  4P6V F;  4OVV A;  2ZNV C;  3NG0 A;  3QWZ B;  1L6U A;  4RGM A;  2NBW B;  2GBN A;  3PZ8 A;  2BYF A;  3QAQ A;  4MSM B;  4IW0 A;  1L0Y B;  4DDG D;  1DYQ A;  1HA5 A;  4ZDV A;  5G55 A;  3RD2 A;  3AE8 B;  3PT2 B;  1WM3 A;  3RNA C;  1FNW A;  1N62 A;  1V1P B;  2HD5 B;  2D5G A;  3H1U A;  1LO5 D;  4LLG M;  2CJO A;  1G6J A;  5IKC M;  4WJQ A;  5D94 A;  1SF0 A;  1ZOY B;  4WUR A;  3PGE A;  5L83 A;  3L17 A;  2PW9 A;  1YX6 B;  2FCN A;  3P4P B;  1ZDX A;  3AE1 B;  1K52 A;  2KDE B;  4DHJ D;  5D3I B;  2KDI A;  3SR6 A;  4NJC A;  3M62 B;  1E8Z A;  3EFU A;  4RF1 A;  1WJ6 A;  4AQ7 A;  3I3T B;  2K8B A;  2N7D A;  2E6X A;  1JWA D;  1L5P A;  2R61 A;  3APD A;  1KOT A;  2LZ6 A;  2RDH A;  2WX1 A;  2O2V B;  3V6C B;  3AE3 B;  3ZLZ A;  3ZQ4 A;  1HEZ E;  4FBJ B;  1GNU A;  3AE6 B;  3SD5 A;  3IVF A;  1P1A A;  2RPQ A;  3JVZ X;  4B6W A;  2MJE A;  1AN8 A;  1UWM A;  2KAJ A;  4XE0 A;  4CYE A;  1OEY J;  3AEA B;  3ZYY X;  4HKQ A;  3U52 E;  3HRD D;  3NVW A;  4IM3 A;  1KLV A;  4MAC A;  4DWF A;  3NUH B;  4DK5 A;  1D5M C;  3DBR B;  1LM8 B;  4EE2 A;  3ZNI D;  2PE9 A;  5EE0 A;  3KWL A;  2EKE C;  1Z2M A;  3E9S A;  2KOX A;  4HXD A;  1I4R A;  1SGH A;  1ROE A;  1BML C;  3QIJ A;  2V4I B;  1LFD A;  2G3Q B;  3B1L X;  4MJS A;  3PRP B;  1WX8 A;  4RM9 A;  1D5X C;  2BW2 A;  3EGR A;  4EZL A;  2LAS A;  2W54 A;  1X1M A;  3AEF B;  1JRO A;  3HHM A;  1C79 A;  1T0R C;  4EFO A;  2MLB A;  5HKH A;  1DOY A;  1FXT B;  2MHJ A;  4XWT A;  1TBE A;  1J0G A;  4MGY E;  4IWO A;  4W9J A;  1NYR A;  4CO7 A;  3N30 A;  1WXV A;  4ANV A;  3AEB B;  4RCO A;  3AV8 A;  1YIW A;  2V3N A;  3P63 A;  1YD8 U;  3RPF C;  4CQN A;  3ZKJ C;  5BMI A;  1NBF C;  4KKJ A;  3M63 B;  3BY4 B;  2WXH A;  3H9D A;  1S3S G;  1JW9 D;  2J42 A;  2WXO A;  2INP E;  2JYT A;  2WDV B;  4RMA A;  3WAL A;  2WXK A;  1R4M I;  1E0Z A;  2HJ1 A;  4BOZ B;  1SEB D;  2JU6 X;  2LGS A;  3I5J C;  5HI1 A;  4TKN A;  3MJ5 A;  3AN1 A;  4W9E A;  2M0X A;  2W9N A;  3QA8 A;  2G1E A;  1I4Q A;  3AEE B;  4KDI C;  2C9W B;  2WX0 A;  3PO0 A;  1EO6 A;  3DBL I;  3FIL B;  2IBI B;  1UGM A;  4ASW C;  2WLB A;  2CR5 A;  3P42 A;  2J0J A;  3BYT B;  2MWS B;  1KM7 A;  3V60 A;  3TSS A;  2LGY A;  3LXF A;  1P7E A;  1QLB B;  4KVG B;  4ZRI A;  1MG4 A;  2AQ2 B;  3L10 B;  4LJP B;  2XEW A;  2W82 A;  3ZXR A;  3AMZ A;  1OGW A;  3GZN I;  3A9J A;  1PGA A;  1WI0 A;  4DXF A;  2DAJ A;  1S1Q B;  2K0P A;  4HDO A;  5C23 A;  3WCQ A;  4MSQ B;  4KZC A;  2W3R A;  1C3T A;  3SHQ A;  2QC8 A;  3QX1 A;  4JL9 A;  5JZE B;  2WP9 B;  2KFK A;  3ZNZ B;  3DVG X;  1L0X B;  2DEN B;  2AQ3 B;  1TT5 B;  1TZO A;  3NS1 A;  2H88 B;  2RSU A;  4CHK A;  1NEN B;  3V61 A;  5I4D A;  2O6V B;  5EE9 A;  2MSE D;  1EF1 A;  4K3C A;  1I4G A;  3MFG A;  1J7A A;  2DZJ A;  2LGD A;  3RNF C;  1IBX B;  1H4R A;  3Q14 C;  1UBQ A;  3RUI B;  4PK1 A;  1F2R C;  4GDK B;  3PTF C; 
#chains in the Genus database with same CATH homology
 2L1A A;  2MEK A;  3VRA B;  2ICI A;  2KN4 A;  3V05 A;  4YSY B;  2ACZ B;  3ABV B;  1N5W A;  4US9 A;  3B2F A;  1FCC C;  1FO4 A;  2BS3 B;  4OHJ A;  1STE A;  3AE7 B;  4XWW A;  1HZ6 A;  1UWX A;  1UUP A;  2WNM A;  1ACC A;  1HZ5 A;  2NTS A;  3W5V B;  4TMA B;  1FXA A;  4LTU A;  1F0Z A;  2WXJ A;  4A55 A;  4RGN A;  1WWT A;  2JWU A;  2I38 A;  5HHD G;  4USA A;  3C8Y A;  3J9C A;  1VR9 A;  4YWG G;  2W55 A;  1C76 A;  2B76 B;  1SE3 A;  1ZUD 2;  2N7J A;  2N0S B;  2M56 B;  4YT0 B;  1FCL A;  1SXT A;  1PGB A;  1KLU D;  3O13 A;  4RGT A;  2LHD A;  3SEB A;  1V1P A;  2WU2 B;  2IPK D;  2L52 A;  5C3J B;  1N60 A;  3W1S A;  4B0E A;  1JCK B;  3GB1 A;  3Q8A A;  2IDY A;  4TSS A;  1Y56 A;  1YN5 A;  5BMG A;  2QIE B;  2WU5 B;  4RNA A;  1K50 A;  2EEL A;  3N9Y C;  3PZ7 A;  4HJG E;  2JZP A;  5FR3 A;  4OZB A;  1JWM D;  3Q69 A;  4ZHP A;  4ITK A;  2LJI A;  3BYY B;  3AEC B;  1OFF A;  1YN4 A;  1RM6 C;  1MPE A;  2QSD A;  1TS2 A;  3BVG A;  4O1N A;  1E10 A;  1XO3 A;  3OWE B;  4TQ0 A;  1VDV A;  2YEP F;  3E56 A;  1FNV A;  1JML A;  1NVI D;  1K51 A;  3MC0 B;  2BTE A;  1QOB A;  4RF0 A;  4JPS A;  4DQO C;  1SJE D;  4D2K A;  1JRP A;  1QKZ A;  1ZE3 D;  2HDE A;  2WXI A;  3BK2 A;  1ZP0 B;  3HUI A;  4GDL B;  5C2T B;  4YSX B;  1EWC A;  4YXD B;  1KTK A;  3MHZ A;  1YMH E;  3B2G A;  3T3O A;  1N5X A;  1KLG D;  3P4S B;  1WRI A;  2OED A;  2IGD A;  4JWS C;  2BBC A;  3HVD A;  1CZP A;  1I4H A;  2PMV A;  1WXQ A;  1QF6 A;  1L4D B;  4JX1 C;  4L2Y A;  4WWM A;  3LYY A;  2K5P A;  3Q8C A;  3TEX A;  4A9A A;  1XLP A;  1B1Z A;  4Q2J A;  3IT6 B;  2XNA C;  1CK1 A;  3ZJV A;  2JX5 A;  1AWD A;  3UI3 A;  1T3Q A;  1XLQ A;  2WXP A;  3R8B A;  4KGR A;  4MT5 A;  3GS2 A;  4OZA A;  4RFB A;  3B9J A;  2HTM E;  1JQ4 A;  3IAS 1;  4A8X C;  3AH7 A;  1KFY B;  1EU3 A;  4C56 C;  4C7Z A;  1DOI A;  1SBB B;  2K9X A;  1EM7 A;  3KQ4 A;  1I7H A;  1XCT L;  2LHE A;  2IJ0 A;  3LB8 C;  1ESF A;  2W3S A;  1I4X A;  1SIJ A;  1OQQ A;  2LGI A;  2KWD A;  1MHX A;  1YQ3 B;  3BII D;  3CIR B;  1MHH E;  1L6V A;  3TEY A;  2FBW B;  2ON8 A;  4P6V F;  2BB6 A;  2CU3 A;  1IGD A;  1WYG A;  1VZ6 A;  4DXG A;  1L6U A;  2JQR B;  2CJN A;  1MVK A;  4RGM A;  2Z8L A;  1GPX A;  1D4B A;  1SJH D;  3PZ8 A;  1GOZ A;  4J3O D;  4IKG A;  1GB1 A;  2DYM A;  1TKG A;  2L83 A;  1ET9 A;  2WXM A;  5H92 C;  1L0Y B;  1DYQ A;  1HA5 A;  3AE8 B;  4KX6 B;  4LK0 M;  2DBY A;  5E6J A;  1FNW A;  1KH0 A;  1ZPS A;  1QOG A;  1TJE A;  2QJL A;  1N61 A;  1KF6 B;  3NVV A;  2I2Y A;  4A90 A;  4B0M A;  1ET6 A;  1N62 A;  1GAQ B;  5BYS A;  4AS1 A;  1V1P B;  2BS4 B;  2EKI A;  2GRI A;  2Q5W D;  1TS4 A;  3BVZ A;  5HG2 A;  1PFD A;  2WS3 B;  2D5G A;  1D6E C;  4RGO S;  4ZRQ A;  1LO5 D;  1RFK A;  4LLG M;  2CJO A;  2RPV A;  1FEH A;  3IAM 1;  2WXL A;  3EA6 A;  1QIL A;  2Y5C A;  1XXG A;  3Q8E A;  4RH6 A;  1FRD A;  2AQ1 B;  1RYJ A;  1SF0 A;  2WDQ B;  1ZOY B;  4WUR A;  5AUI A;  4P16 A;  1PGX A;  1TS3 A;  1AW7 A;  1EU4 A;  2PW9 A;  1T6B X;  5GXG B;  4WH4 A;  4NAM A;  3P4P B;  1ZXI A;  1ZDX A;  4PT5 A;  3AE4 B;  3AE1 B;  1FM0 D;  4L1B A;  4HRO A;  2AX5 A;  4WAF A;  1K52 A;  1IGC A;  5D3I B;  2RDG A;  3SR6 A;  4NJC A;  1FFV A;  3HVZ A;  1RWS A;  3BZD B;  4RF1 A;  4ARC A;  1F2R I;  1L4Z B;  2PLP A;  1JWB D;  3BWU D;  1FMA D;  4AQ7 A;  1IUE A;  3AE5 B;  4KKI A;  1E9M A;  2E6X A;  1JWA D;  1L5P A;  2R61 A;  5BMH A;  2LUM A;  2RDH A;  1A70 A;  3ZQ4 A;  2J4X A;  3AE3 B;  2IGH A;  3VR8 B;  2M19 A;  4KGT A;  2X38 A;  1DOX A;  3BVM A;  5T8I A;  1HEZ E;  1J7B A;  2DLB A;  2M0A A;  3AE6 B;  1SSN A;  3AEG B;  2DYO A;  3T3N A;  5LNK 1;  2MJE A;  1AN8 A;  2BT6 A;  5G5G A;  1UWM A;  2KAJ A;  3VRB B;  4XE0 A;  2NTT A;  3AEA B;  5HFY A;  1VJK A;  2E3T A;  3ZYY X;  1BUI C;  3GP7 A;  4HKQ A;  3TEW A;  2QMT A;  3I57 A;  3U52 E;  1PYW D;  3HRD D;  5FKA C;  3NVW A;  2WXF A;  1QOF A;  1MI0 A;  1YNT E;  4MAC A;  2OHF A;  2ONQ A;  3NUH B;  1TY2 A;  3W2D A;  2ZW0 A;  3AM9 A;  1D5M C;  1FIQ A;  4REZ A;  4OW0 A;  3URY A;  5H8Y E;  4EE2 A;  1V97 A;  3W5U B;  1PUT A;  3ETR A;  3RFZ B;  5EE0 A;  2NMQ A;  1YJI A;  3KWL A;  4OVZ A;  5G5H A;  4US8 A;  2KDM A;  3E9S A;  3FC4 A;  1I4R A;  1ROE A;  1BML C;  2WXQ A;  3BK1 A;  2Y3A A;  2V4I B;  1GB4 A;  2LFI A;  1NYQ A;  4ZRP A;  3U4E G;  2KQ4 X;  1ZDV A;  1FNU A;  2GB1 A;  2SAK A;  1FFU A;  4YTM B;  1HXY D;  1D5X C;  2BW2 A;  3EGR A;  4JWU C;  3TUO A;  3V3X A;  4A6Q A;  3U2S C;  2YEP B;  3EUB 2;  4H2A A;  2BYT A;  2W54 A;  2XN9 C;  1TKE A;  2KMM A;  1XCQ L;  1DGJ A;  4ZHO A;  2FE8 A;  2G9H D;  3AEF B;  1JRO A;  1C79 A;  5BYQ A;  2BB5 A;  1YJJ A;  2BS2 B;  2RMM A;  4HKZ E;  5FK9 C;  1FXI A;  2H89 B;  1SE4 A;  1DOY A;  2PVG C;  1VLB A;  4N6E B;  1C9F A;  1IBX A;  2JSV X;  1TY0 A;  4XWT A;  1I4P A;  2IGG A;  1C4A A;  1E7P B;  4XDC A;  1NEK B;  4MM3 B;  1NYR A;  3SFE B;  3ZGZ A;  5AUK A;  3AEB B;  4RCO A;  3AV8 A;  4JE3 B;  2V3N A;  3P63 A;  4UDU C;  2WQY B;  1HQR D;  1E6E B;  2KAC A;  1SE2 A;  3FAH A;  4HRS A;  1J7C A;  2J53 A;  4OZC A;  2SEB D;  3RPF C;  4C7Y A;  1V8C A;  4CQN A;  4HEA 1;  2Y5P A;  5BMI A;  4FXC A;  4KKJ A;  1EWY C;  4YSZ B;  1BXT A;  2WXN A;  2WXH A;  1P7F A;  3VQI A;  4YTN B;  1JW9 D;  2J42 A;  2WXO A;  2INP E;  4ZYS A;  2JYE A;  1JWS D;  1N63 A;  2JYT A;  2LEK A;  2WDV B;  3I9V 1;  1YQ4 B;  3R2T A;  2WXK A;  1XF5 L;  1JWU D;  2V3P A;  1E0Z A;  1SEB D;  2INN E;  3NVY A;  1L0V B;  2JXT A;  3SFD B;  2JU6 X;  2PKO A;  1R7S A;  1TKY A;  4YTP B;  5HI1 A;  3DWG C;  1B9R A;  3MJ5 A;  3AN1 A;  5D3D A;  2N9K A;  2G1E A;  1NI3 A;  1VZ8 A;  1I4Q A;  3AEE B;  5BYR A;  4IOI E;  4KGS A;  2K3U A;  4WQM A;  1QQR A;  3PO0 A;  3U7Z A;  3FIL B;  1CQV A;  1M4V A;  2DWQ A;  3P4R B;  1F77 A;  1FRR A;  4XDD A;  1CJE A;  3AB5 A;  3DWM A;  1WSP A;  4L23 A;  1ZXH A;  2V0G A;  2WLB A;  3MP9 A;  1D5Z C;  1TYG B;  1PDX A;  3P42 A;  5TSS A;  3BYT B;  3NVZ A;  1UGJ A;  4IDI A;  2FUG 1;  1XLN A;  3FIL A;  3NZ3 A;  5EE1 A;  3TSS A;  3AED B;  1TS5 A;  1V1O A;  3P4Q B;  3H8H A;  1JAL A;  1C4C A;  2VZK D;  3W9C B;  3LXF A;  2MH7 A;  2N9L A;  1P7E A;  1QLB B;  3L4P A;  2AQ2 B;  2QIL A;  5D7G A;  1K53 A;  2ZW1 A;  1WGK A;  4MH8 A;  1YN3 A;  1C78 A;  1FD6 A;  2W82 A;  2WXR A;  3AMZ A;  2PTL A;  3NRZ A;  4WIP A;  2QEJ C;  1PGA A;  4DXF A;  2VZK B;  2K0P A;  1T5X D;  1Q10 A;  1C77 A;  3WCQ A;  1OQR A;  2W3R A;  2PIA A;  2J52 A;  3IXS A;  3R2I A;  3Q8F A;  2WP9 B;  1SB3 C;  1XEE A;  3AE2 B;  1L0X B;  3TEZ A;  2MJ3 A;  2PVO D;  4ARI A;  5MPO A;  3VR9 B;  1QOA A;  2AQ3 B;  5JXV A;  3AE9 B;  1AYF A;  4TQ1 A;  2MJD A;  1TZO A;  2WDR B;  3CWI A;  3NS1 A;  2H88 B;  1QT9 A;  3IT4 B;  4ZOH C;  3KWV A;  1NEN B;  4NAW B;  5I4D A;  3ZJU A;  5EE9 A;  1VRA B;  4GLS C;  2TSS A;  3Q8B A;  2L32 A;  1VZ7 A;  4M0W A;  1KRH A;  2GI9 A;  1ENF A;  1I4G A;  4NZL B;  3KLS X;  4C80 A;  3MFG A;  4N58 A;  1J7A A;  1C4P A;  4N59 A;  4R3D A;  1IBX B;  2K22 A;  1XLO A;  2WXG A;  5EE3 A;  2LMC A;  3P1M A;  3ZJT A;  1F2R C;  4GDK B;  1UNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...