2K5PA

Nmr solution structure of a thiamine biosynthesis protein from geobacter metallireducens: northeast structural genomics consortium target gmr137
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
78
structure length
78
Chain Sequence
MNLTVNGKPSTVDGAESLNVTELLSALKVAQAEYVTVELNGEVLEREAFDATTVKDGDAVEFLYFMGGGKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thiamine-biosynthesis protein
publication title NMR Solution Structure of a Thiamine Biosynthesis Protein from Geobacter Metallireducens: Northeast Structural Genomics Consortium Target GmR137
rcsb
source organism Geobacter metallireducens gs-15
molecule tags Biosynthetic protein
total genus 11
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2k5pA00
3AE5B 1DOYA 1JROA 3P4QB 4YTMB 1L0VB 4A9AA 3L4PA 1FO4A 4ITKA 3B2FA 1TJEA 3BIID 4HROA 1T3QA 1SIJA 2WDVB 2WDQB 3LXFA 4WQMA 3ZYYX 1PFDA 1WYGA 2OHFA 1OQRA 4YSXB 2DBYA 2LEKA 3LB8C 1L5PA 3AN1A 3VR9B 2E3TA 2W54A 3AE2B 1QLBB 1XO3A 1JW9D 4HRSA 1E10A 1QF6A 3AECB 4YTPB 5C3JB 2MJ3A 1NEKB 3P4SB 5C2TB 1TYGB 3NRZA 3W5UB 4C80A 4US8A 1JWAD 3AEEB 1F0ZA 5G5HA 1V97A 3VRBB 1VDVA 4JWSC 1FIQA 5EE1A 1GPXA 2G1EA 3AEFB 2W3SA 2BS3B 2WU5B 2QJLA 3AE6B 1I7HA 4N6EB 1ZOYB 3SR6A 4JX1C 3P1MA 1FRRA 2QIEB 3HUIA 5H92C 1XLQA 2HTME 4US9A 1DGJA 1RYJA 1EWYC 1V8CA 2H89B 1ZP0B 2PVGC 3HRDD 1VJKA 2BS4B 1L6UA 1JRPA 1QT9A 2L52A 3AE4B 3AE1B 1J7BA 1KRHA 1XLPA 2WDRB 1FM0D 1FFUA 1GAQB 1YJIA 1YQ3B 1J7AA 2PKOA 3AEGB 1YQ4B 1NENB 2MH7A 1AYFA 1JWBD 3VR8B 1IUEA 1N61A 3RPFC 1CZPA 1NYQA 3P4PB 3AM9A 2K5PA 2B76B 5AUIA 1QOBA 1RM6C 1TKYA 1UWMA 1FRDA 1XLOA 3ETRA 2ACZB 2AX5A 2PVOD 2M56B 2WQYB 1DOIA 1E7PB 4YXDB 1ROEA 2Q5WD 2JQRB 3AE7B 2KAJA 2CJOA 1J7CA 4ZHOA 1N60A 3AMZA 4JWUC 3EUB2 1NVID 2M19A 3SFDB 3AEDB 4ZHPA 3AE9B 4ZOHC 3AH7A 1TKEA 3HVZA 5GXGB 4USAA 2EKIA 1AWDA 1WWTA 1OFFA 1PDXA 1RFKA 3NVVA 4LTUA 1N5WA 3NS1A 4C7ZA 1WXQA 4YTNB 5AUKA 5EE9A 3B9JA 3FC4A 2K9XA 2FBWB 4IDIA 1FXIA 4YSYB 1E6EB 1N63A 2PIAA 3AEBB 3AE8B 3WCQA 2BT6A 3SFEB 2N0SB 3W5VB 1B9RA 2W3RA 3NVWA 1E9MA 1KF6B 2L83A 3DWGC 1E0ZA 1JQ4A 5EE0A 3NVYA 1NYRA 5EE3A 1NI3A 1CJEA 1R7SA 3KWLA 3NVZA 1SF0A 1XLNA 2CU3A 2WS3B 1QOGA 1TKGA 4P6VF 2KMMA 1OQQA 2DWQA 1YJJA 2JX5A 3ABVB 3W9CB 5G5GA 1ZUD2 1KFYB 3CIRB 4C7YA 1ZXIA 4N59A 1WRIA 3DWMA 3AEAB 1QOAA 1L6VA 3P63A 4N58A 1DOXA 4KX6B 3PO0A 1FMAD 2Y5CA 1PUTA 5H8YE 1SB3C 1FXAA 2MJDA 3P4RB 2W55A 1WGKA 4YSZB 1RWSA 3B2GA 2CJNA 3AE3B 2WLBA 4YT0B 5MPOA 4FXCA 3VRAB 3AB5A 2WU2B 3AV8A 1FFVA 2WP9B 3CWIA 1N5XA 3FAHA 1N62A 2BS2B 1JALA 2H88B 1A70A 1QOFA 1VLBA 4WWMA 2K22A 2MJEA
chains in the Genus database with same CATH superfamily
3AE5B 3OWEB 1HTQA 4GU2A 3LXFA 1F52A 4KSLC 3TUOA 2YVCA 1ZE3D 2IGHA 4KDIC 2W54A 2D3GA 2GLSA 3DVGY 3WANA 1CK1A 1SE4A 4W9JA 4BKSA 1WM2A 4NJ7A 2J4XA 1A5RA 2CR5A 3QX1A 4HDQA 2JRIB 3SD5A 2R2OA 2D3CA 4IW0A 1FFUA 1YQ3B 1YQ4B 5FKAC 1WX8A 1VZ7A 2KQSA 3Q3MC 3L08A 4GGQA 5IN7A 4G11A 4NAWB 5L83A 1GB1A 1YN4A 2JSVX 4R3DA 2N7EA 1WIAA 3EGRA 2IY1B 2JZZA 3QK0A 3C19A 4ANUA 1XCQL 4GDKB 3OAWA 1ET9A 2BT6A 5EE0A 2PEAA 4NAWA 1HZ5A 2WDTB 3KWLA 2JX5A 4WAAA 2FAZA 3ZJTA 3KUDB 3AEAB 3U8ZA 1P1AA 3ZKJC 2KC2A 1ENFA 2JYTA 2J0KA 2LGSA 1XQQA 3KVFB 2AL3A 4A3OA 1Q1OA 4ANXA 4WURA 2H88B 1QOFA 3DBRB 4A9AA 2INDC 1NBFC 4OVZA 3KYCD 3ZYYX 2FIFA 1L5PA 1LFDA 4MGKE 4BKTA 2L32A 2E3TA 1D3ZA 4II2B 2BYEA 4P1CC 1P3QU 2DAJA 2JY6A 4C80A 1TYGB 2EKEC 2M1MA 1XXGA 2HJ8A 2AEHA 1Q0WB 4XWWA 2D3AA 4W9KA 3SR6A 2LVQA 4RGNA 2WHIA 4W9HA 5FR3A 3AE1B 1KLVA 3KUCB 1GC7A 3PSEB 4CYEA 1KOTA 2GBNA 2KN5A 4IM2A 3AM9A 3PLUA 1C4PA 5KHQA 3L0WB 4EUTA 5LXHA 2MEKA 2MWSB 4NAMA 1JMLA 2B3AA 2K0PA 2V0GA 2N9XA 3ZXVA 4RF1A 3VQIA 4KGSA 3V05A 2RD0A 3QWZB 1V86A 4CQNA 5IO9A 1K53A 1TGZB 5HFYA 1HEZE 1NVID 1YX6B 3Q8BA 3AEDB 4ZHPA 3ENEA 1GNUA 3HM6X 4MH0E 4RF0A 1M94A 1ACCA 3SHQA 2UWQA 1PDXA 2Z0DB 1N5WA 3NS1A 5E6NA 4YTNB 2R61A 4XGAB 5CTRC 1WJ4A 3TL5A 1YJ1A 5D6JB 1YMHE 3UGBB 1R7SA 4GXBA 2KYWA 3NVZA 1C78A 2YLMA 2KK8A 2JF5A 3A33B 2LGIA 1WM3A 1L6VA 3QC8B 4DXFA 2BPSA 1FMAD 2JVCA 4YSZB 1IBXB 5JHBA 3DPDA 3RT3B 3ZTCA 1WF9A 3AB5A 3E9SA 1X1MA 2WU2B 1U4AA 1V5TA 5D2MB 1A70A 2BS2B 5IKCM 2J52A 2WXRA 2K3UA 3PRMB 2LHDA 4LJOB 4LCDE 2MRPA 1F2RC 2INCC 2IO0B 3IXSA 4EKUA 1I4PA 4MSQB 4KZ0A 4DHJD 1QF6A 1AARA 4NPNA 3AEEB 5C23A 2VZKB 2G1EA 1WX9A 2KN4A 1WXSA 4PT5A 2MP2A 4RFBA 3AU5A 1VJKA 2Y5BB 5D94A 5HHDG 2EMTA 2AQ2B 2MLBA 4HPMB 4OHJA 1K8RB 4ANVA 1QQRA 4QAYA 2K5PA 4TMAB 4BZAA 2O6VD 1L2NA 4RH6A 1T0YA 2R2QA 2D2QA 2IPKD 4YXDB 1MHXA 2MQJA 2I38A 1SSNA 1QILA 3JYUA 2KDEB 2BYVE 1WXAA 1IBXA 2AYOB 4LTUA 4GMVA 4UDUC 3BK2A 2I1KA 1HA5A 4IM0A 3NVWA 1C1YB 1WY8A 3QA8A 1EUVB 1E8ZA 2ZW0A 1C77A 4F8CB 4FULA 3W1SC 5HI1A 4L23A 2DENB 4RGTA 2WYQA 3WAMA 2RDGA 3QAQA 4N58A 2BGFA 4HCPB 1PGBA 3V6CB 2WXHA 4P16A 4BVUC 2CJNA 3MTNB 2DYBA 3DVNV 1WJUA 4A6QA 3NUHB 1L7YA 3UQBA 4RCOA 4MT5A 2MBOA 3CSTA 3B2FA 2OOBB 1YD8U 4WQMA 1TS5A 4M8MA 3J9CA 4KIKA 3M62B 1V1OA 5D7GA 1QLBB 1UELA 4PYZA 2BB6A 3RZWC 2NPTA 1GOZA 2DZIA 2C60A 5EE1A 2LGDA 4C56C 3QCAA 4GLSC 1JWMD 4NQKE 4DQOC 4FA6A 2LRUA 3JW0X 2VH2A 3C0RB 2NBVB 4E71A 2ASQA 2KLGA 4DXAB 1N61A 2LGXA 1SBBB 2XBBC 4MM3B 4YWGG 1GC6A 3RYTA 1RM6C 3DBLI 2BW2A 4B9KA 2CS4A 5BMIA 3IHPC 1VD2A 3R8BA 1TKEA 4FHKA 1ESFA 3U52E 1IPGA 4OZAA 4IDIA 2NBUA 3SU8X 2PIAA 4URKA 1NI3A 1WX7A 3DWMA 2L0TA 2E6XA 2DYMA 1WJ6A 2MJDA 4IWQA 2MBQA 2ZZPB 4IC7B 4E74A 4K7SA 2DZMA 2WXGA 1UBIA 1WMHB 1D5XC 3GE8C 2WGSA 4YTMB 1C76A 1I4RA 1R4NB 3M63B 1V80A 5AZHA 3APDA 3AN1A 4WAFA 1JW9D 4MM3A 1E10A 3PLVA 2WXLA 1V97A 4XE0A 4C00A 2PE6B 2WU5B 1JQ4A 2QCZA 2ZPYA 4A55A 2QIEB 2FCSA 1TS3A 1BUIC 3HHMA 4XC2A 2DNFA 3N20C 2RGFA 3NY5A 5FR6A 1TS2A 4K7UA 4LDTD 3I57A 3ETRA 1B1ZA 4HXDA 1NDDA 2KX0A 1ZPSA 2Q5WD 5BMGA 1E7UA 2CJOA 3WIMA 2KOXA 2FIDA 3L13A 3AE9B 1EU3A 2EKIA 1WWTA 4XX5A 3L17A 2WXKA 2BVCA 2KTFA 4GIVA 4HJGE 2IGGA 1EU4A 3MFGA 1XCTL 2O2VB 1FPYA 1CJEA 1WXMA 1EWCA 1WE6A 2MHJA 1N6ZA 2JWZA 2J0JA 2GBJA 1E8XA 2KVZA 4J6IA 2KJHB 4CHKA 4JE3B 3ZRCA 1Y8RC 2PPHA 1TZOA 3ZDMC 2D10A 3V3XA 4IOIE 1XF5L 1E7VA 4J3OD 3T3NA 3HM3A 3DQVA 3ZXRA 1L4ZB 2LRWA 2WDVB 2WDQB 3I3TB 4ZRIA 4MELA 2ON8A 3RI7C 3VR9B 4A90A 4EZKA 3ZDTA 1J8CA 1P7FA 3RFZB 4LNIA 2LXAA 3BINA 3U7DA 4N6EB 1I7HA 2GI9A 5LXIB 2BKRB 1XLQA 3HRDD 4OZCA 4PS3A 1QT9A 2MBHA 5BYRA 2K6DB 4DK5A 1J7AA 3R2TA 2LJIA 2LGYA 1MG4A 1JRUA 1I4HA 4HWIB 4OW0A 4KKJA 2KDIA 4IG7B 2QSDA 4ASWC 2AX5A 3A4RA 4WWOA 5L95C 1Q5WB 2LUMA 2Z0EB 3EUB2 3SFDB 1GUAB 3RNGC 2GB1A 3JVZX 2GRIA 3N1XC 1RFKA 3RNAC 2KLCA 3A1QB 4AS1A 2PJHA 2N1WA 3MC8A 2N0SB 1KF6B 4JL9A 2JZ3B 4LNOA 2CHZA 4NJ6A 1PGAA 3RNFC 1HQRD 3KH0A 2DWQA 1I42A 3BK1A 1IYFA 2WX0A 1T5XD 1P9DU 1IP9A 4KX6B 3PO0A 2Y5CA 2G4DB 1WGKA 1J19A 3RUIB 2WLBA 1GB4A 3AU4A 2SEBD 3U30A 2N7DA 3IAS1 2K22A 2EMSA 4RNAA 1WZ3A 4AUQC 3NZ3A 1OQRA 3IFWB 3ZQ4A 3NS8A 2LWPA 2L0FA 4ZRKA 3X0WA 4K3CA 5BO4B 3DBLB 1GPXA 2PLPA 2KDFB 3VVWB 4B95A 1M4VA 1SGHA 3O65B 2M4NA 1EWYC 3RN9C 1KLGD 1ZDXA 2RPQA 1FM0D 4KGRA 3MJ5A 4M02A 4H2AA 1SE2A 4XDCA 1SEBD 2MH7A 3BYYB 5DPSA 2V1YA 1FNUA 3URYA 4BOSC 1UWMA 3TBLD 2WWZA 3ZIMA 1PGXA 2WXPA 2REXA 3FKYA 5JZEB 1TY2A 2NCNA 1N60A 3TEYA 1UD7A 2K1FA 4GDLB 3JSVB 3SEBA 4G50A 2HTHA 5G2NA 2WX1A 4GDKA 1I4XA 2LASA 2V9HA 3FILB 4ARCA 3B08A 1NI2A 4MGIE 2KDMA 2IGDA 5EDSA 2IO3B 1V2YA 3ECIA 1YJJA 3SDLC 3P2BA 2KACA 2CHWA 3MHZA 3R3MA 3VUYA 1PUTA 1FXAA 3P4RB 2G4SA 1E5WA 3VH3B 3VXWA 2DX5B 4MH8A 4FXCA 4WJOA 2FE8A 3ZNGC 2WP9B 1N5XA 3TEZA 1N62A 1PYWD 1VLBA 4WWMA 3UIPB 4IKGA 3ZVVA 3P4QB 2XNAC 4L1BA 1FEHA 1V9JA 4EZLA 5FK9C 2OHFA 2I2YA 1MVKA 2QMTA 3E56A 2X8XX 2NR2A 4HRSA 4PYUA 5DPTA 5HKHA 2KFJA 3EHVA 2NTTA 1WXVA 2PMVA 1OEYA 3AEFB 3DHGC 3RD2A 4JX1C 4G3XB 2H89B 3B0AA 4GDLA 1XLPA 2CKHB 2JXTA 1P7EA 5D3IB 1IUEA 1SE9A 3ALBA 5TSSA 2KX3A 2ZCBA 2NTSA 2Z59B 4P1BC 4HKZE 3OJ3A 1DOIA 1GG3A 1T0QC 3AE7B 2KAJA 2KZRA 1WGRA 2BYFA 1OGWA 5CHFA 1HXYD 2IO1B 5LLIA 3BVGA 3TIXA 3N3KB 2KQ4X 4DHJB 1CQVA 4ACFA 2LI5A 1E6EB 3AE8B 2JPHA 2KMCA 2L83A 3IVFA 1T0RC 4B0EA 2DZKA 2M0AA 1XLNA 5E6JA 2VH1A 3Q6BA 4MACA 4FBJB 4WJPA 4ANWA 1R4MI 2WXQA 1Z2MA 2QHOA 2TSSA 5H8YE 1SB3C 2W55A 3AI5A 4HKQA 4NJCA 4IWOA 2O6VB 3NG0A 5IAAC 3AV8A 3FAHA 4LK0M 4EOYA 3V61A 2L7RA 2FUHB 2QC8A 4DDID 3ML8A 3O13A 2BB5A 1L0XB 2DZJA 1JWSD 3ZNHB 2XK5B 5JH5C 2J0MA 1NEKB 1WR6E 3P4SB 1G6JA 5G5HA 1VDVA 1K51A 5JHAA 4HCNB 1HZ6A 3NOBA 1ZP0B 3W1SA 2X38A 3A4SC 1GAQB 3AEGB 3APCA 4FJYA 1TZ1A 1AYFA 2LZ6A 2C7MB 3QJZA 2WXNA 1NYQA 2NMQA 3IG3A 1VCBA 3B1LX 3KWVA 2ACZB 1MFWA 1V6EA 2ZPNA 1J0GA 4M8NA 4AJYB 3CF6E 3Q2AC 3LDZE 2MCNB 4MSMB 3M3JA 3AMZA 2LD9A 1AWDA 2MA9B 3EA6A 5E6PA 3DVGX 4TQ1A 4NY0A 5EE9A 4RGMA 2O6VA 1S3SG 4YSYB 4ZDVA 2LVOA 2YEPF 3MP9A 4BBNC 4D2KA 1F77A 4G0NB 4IM3A 2GMIC 1WGHA 3ZRFA 2CU3A 4XWTA 2A4ZA 5BMHA 2ZEQA 3ML9A 1ZXIA 4MGZE 4WIPA 3UIOB 1XD3B 3AE3B 3H9DA 1YN5A 4LNNA 4HEA1 4WWPA 2GOWA 3N30A 1YNTE 3L4PA 3HIZA 3TJPA 5IOIA 2DBYA 3TSSA 2LUEA 3AE2B 3AECB 1E8WA 1L4DB 2MJ3A 1C3TA 1VZ6A 4JWSC 1V49A 2QILA 3MC9A 2HTME 2K25A 1RYJA 2LFIA 3VDZA 1JRPA 4TKNA 2WDRB 4RMAA 4F7ZA 2N9PC 4M01A 2L3ZA 1WZ0A 3KUZA 2B76B 5AUIA 1UWXA 3V6EB 3RZFA 1OQYA 3W1YA 3NZSA 4BBNF 3LYYA 4JWUC 3N1ZC 4PS7A 4TUUA 3AH7A 4WH4A 1UGMA 3NHEB 1Y56A 2ZVOA 3GZNI 5BYSA 2J42A 4M0WB 4WQOB 3FC4A 1WRDB 2FBWB 1SJHD 3AEBB 2EELA 3VFKA 4DBGA 1TBEA 3OG5A 2N1VA 2G9HD 2HD5B 2DLBA 1ZUD2 3CIRB 3BVZA 4ZRPA 1WRIA 1LQBA 3DBHI 3VUWA 3PRZA 4MGYE 4B0MA 1H4RA 4REZA 1S1QB 1F9JA 5C1ZA 2J53A 4W9LA 4LDTB 3RMKC 4BKSD 3ZGZA 1D5MC 2M17A 3CWIA 1KM7A 1OEYJ 4ICUA 4I6LB 3P1MA 1WMHA 1WSPA 3VTUA 1JROA 3BIID 1SIJA 4C4VB 3HVDA 1D5ZC 3LB8C 3PRPB 2C7NB 1FNVA 2PW9A 4ZRJA 1PQSA 1YN3A 1F1HA 2BQQA 4YTPB 3KW5B 2LVPA 3VRBB 3ZW3A 5LNK1 2QJLA 5BYQA 1L6UA 2IJ0A 1J7BA 1KRHA 3I9V1 4HPLB 2PKOA 1YJIA 1ZDVA 4M0WA 5CX3A 3PPAA 2AWTA 2GBKA 2XN9C 4FN2A 1WFYA 4ICVA 1D6EC 2IBIB 2K39A 2N9EB 2LXCA 2W82A 3NZUA 1WH3A 4KSKC 2BTEA 2KFKB 3PHWB 2JYEA 4E3CA 2HE7A 2IO2B 5CHWA 1C9FA 1TIFA 4W9IA 4W9DA 2BWES 1R4MB 2NBWB 4AOFA 3PT2B 4PK1A 1N63A 3SFEB 1B9RA 3I63C 3UINB 1E9MA 2WXMA 2O2VA 4Q2JA 3AULA 3EFCA 2IDYA 1QOGA 2I1JA 2MX2A 4C4VA 1KFYB 2KXJA 1TTNA 1UZXB 2C7HA 4GOCA 1FCCC 1DOXA 4B6WA 3WAPA 2FCNA 4EFOA 2JZPA 3T9LA 1HTOA 2WXJA 4JIOU 4W9EA 4I6PA 3VRAB 4JGHB 1SIFA 4US9A 4RGOS 1DOYA 2L00B 3MHSD 2JT4B 5JXVA 1FO4A 1STEA 1TJEA 1PFDA 2LEKA 1C79A 2K8HA 3Q8AA 3PZ8A 1JWAD 4FJZA 1ISNA 3OJ4B 1FIQA 4WJNA 2KFKA 3EECA 4A8XC 2K6QA 5H92C 3U4EG 3BVMA 2BS4B 2A5UA 1KTKA 2L52A 3AE4B 3ZJVA 1I4GA 2FCMA 2WXIA 2INPE 3IT6B 2ONQA 1I35A 3VR8B 1V5OA 1CZPA 1MI0A 3DVNU 3P4PB 4L2YA 3GB1A 1FRDA 3UI3A 1BT0A 2WQYB 1AN8A 2JQRB 1J7CA 3A9KB 4HK2A 1EF1A 3RULA 2OJRA 3HVZA 1OFFA 2V4IB 3K9OB 4X57B 2JWUA 3A1QA 5AUKA 3RNCC 1FXIA 2JU6X 1K52A 3T3OA 4K3BA 1NYRA 5EE3A 3R66C 4IWPA 5C2TB 1TKGA 4N9F4 5J17A 1V81A 3VHTC 3QHTA 2V4LA 3C8YA 2L1AA 1TS4A 3D32A 4ARIA 2LJ5A 4YL8A 2K8CA 3B2GA 3N32A 2OEDA 3P42A 2G45B 4AWJA 1WGGA 3ZUNA 1WI0A 4JLCA 1UNSA 3Q14C 2KTRB 1L0YB 2FNJB 3H6NA 4HROA 1R4NI 2KQ7A 3NJTA 3VAWA 1EF5A 3W2DA 4RM9A 4O1NA 4OZBA 2BBCA 1IGCA 4CO7A 3H7SA 2LMCA 3AE6B 1ZOYB 3KYDD 3HUIA 1DGJA 2MP2B 3KQ4A 3A9KA 3N9YC 3Q3NC 1BXTA 5CHVC 2D11A 2JXXA 2L8JA 1E90A 3GZNB 2KNBA 2WNMA 4DXGA 4HDOA 2INNE 2IYDB 3ONSA 4W9GA 4JPSA 1ZXHA 2NS5A 2L76A 3R7QA 1ROEA 3TCAA 3DBSA 4ZHOA 2RDBC 4W9FA 2RSUA 2Z8LA 2DHZA 1QZEA 1YX5B 3APFA 2AQ1B 3DBHB 3JSVA 3PZ7A 1EM7A 2BF8B 1LO5D 2BKFA 3FILA 3ZO5B 3K9PB 2YEPB 3W5VB 2VZKD 3ZNID 1ZKHA 1CMXB 3DWGC 1VRAB 4A3PA 2KTRA 1WJNA 2D5GA 3PVLA 3PZDA 3DOWA 1OQQA 1WGYA 2RPVA 3DCGA 3GS2A 4MDKE 5G5GA 3W9CB 2G3QB 4LNKA 3H1UA 3UF8A 4N59A 2D07B 2KKCA 2KMAA 1T0SC 4ZYSA 4YT0B 2UYZB 4HLEA 1FNWA 4ZRQA 1SE3A 2N9LA 4DHZB 3HK0A 1JWUD 1L0VB 4K7WA 4ITKA 4HVBA 4C7ZA 5GMVA 3WALA 4KIKB 4MJSB 1UGJA 2KO3A 4F1SA 2NPTB 5C3JB 3W5UB 2LHEA 1F0ZA 2N7JA 4K81A 2MBBB 4KGTA 3DHIC 2W3SA 2BS3B 2KWVB 1FRRA 2C5LC 3CMMB 3GOEA 2N9KA 2PVGC 1WE7A 1ZW7A 3N1YC 2V3NA 4KZCA 2C9WB 2M0XA 3Q3OC 1ZGUB 5IA7A 1JWBD 3CSFA 5KHOA 1WGDA 2FCQA 2KT7A 1BMLC 1MG8A 1QOBA 2L05A 1DYQA 1LGRA 1TKYA 1XLOA 2IZVB 1KJTA 5E6OA 2UU7A 3DDCB 4DWFA 4S0RA 2M19A 4JQWC 4XYCA 4ZOHC 4USAA 1VR9A 1WR1A 2ZW1A 3PTFC 4IUMB 4WJQA 1YIWA 2K9XA 3ZNZB 5IP4D 1MPEA 2K8BA 3OLMD 2MSED 4LNFA 4C7YA 1EO6A 4MJSA 1UF0A 3IT4B 3P63A 1V1PB 2ZJDA 4HJKA 3I5JC 5T8IA 5G55A 1VZ8A 3MC0B 4RM8A 3V60A 1FFVA 4BKGA 1JALA 3KLSX 1I4QA 1MJDA 2OJWA 2QDFA 2RDHA 4I6NB 3ZLZA 2ZNVB 1IGDA 3A9JB 1T3QA 4GSWA 4DDGD 1QKZA 3MJWA 4YSXB 4BOZB 1UUPA 2D3BA 5HG2A 4BAXA 1D4BA 2XK5A 1RRBA 3PHXB 2ZCCA 1H8CA 3BZDB 3WAOA 3WA0A 5AZGA 3DBRI 4K1RB 4LLGM 3V62A 4ZYNA 3S2AA 1V8CA 4WWNA 4KVGB 2GBRA 3VTVA 2KD0A 2DAFA 2AL6A 1RFAA 4PS8A 1MHHE 3UQAA 1FD6A 2CU1A 3VH4B 4BFRA 5AZFA 3RPFC 4NQLB 4KKIA 4KV2A 4M00A 2Y3AA 3ZJUA 4KDLB 3U2SC 5AEKB 4P7IA 3VTWA 2PVOD 2M56B 4EEWA 5J18A 1E7PB 2ZNVC 3L16A 4MEMA 3RNEC 2KWUB 3U7ZA 1SJED 4NNJB 3BWUD 1V1PA 5J2RA 4DHZE 3R2IA 2V3PA 3PGEA 1WXQA 3B9JA 1YOVB 3WCQA 4OVVA 2N4FA 2NVUI 3BYTB 2VRRB 3TEXA 3GE3C 1XT9B 1P98A 1E0ZA 1Z5SB 1RAXA 4XDDA 3IBEA 3ZTDA 1SF0A 2BWFA 2KMMA 3QQ8B 3A9JA 3Q8EA 2MBEA 3RCZA 2W9NA 1QOAA 3EFUA 4A20A 3TEWA 1F2RI 1E8YA 3PS6A 4EZJA 1TT5B 1P0RA 2KWDA 4W9CA 5MPOA 2PE9A 4GB9A 4EE2A 1SXTA 2RR9A 3EC8A 2CHXA 2HJ1A 2WXFA 2M8SA 4II3B 3L54A 2BYTA 1UBQA 2V3SA 2SAKA 1JCKB 1WYGA 2XEWA 4FLHA 1OTRB 1XO3A 1AW7A 4US8A 1C4CA 3NRZA 2IY0B 3H7PB 2JUOA 4TQ0A 1YQBA 4FADA 2KVRA 1WYWB 4FJVB 2AQ3B 3Q8FA 3T8MA 5DPRA 1LM8B 2J7QB 1NENB 1K50A 2KDBA 2MW5A 3DHHC 3R7RA 3Q8CA 2KC1A 4AJWA 4NZLB 2HDEA 4OVUA 4AQ7A 4TSSA 2KJRA 5DCNA 3BY4B 3QIJA 3VUXA 3M95A 2KANA 2DYOA 4LJPB 1XEEA 3LJ3A 3Q3JA 1UH6A 5GXGB 1FXTB 3PV1A 3NVVA 4GN1A 2Y5PA 4HPPA 3PREA 4FHJA 4S17A 4AP4C 2QEJC 2RMMA 2W3RA 2ZVNA 5TR5A 5D3DA 5DPWA 2KJ6A 3QARA 3L10B 3NVYA 1KH0A 4TV3A 1TY0A 3GP7A 2JRHA 4P6VF 2WS3B 2WXOA 3ABVB 1C4AA 3RNBC 3Q3FA 3AXCA 3IAM1 1KLUD 2GBMA 3Q69A 1Q10A 3X23A 1RLFA 1GJZA 2PTLA 4XZ4A 2FUG1 5I4DA 1RWSA 3H7PA 3TMPB 3H8HA 1T6BX 1ET6A 1FCLA 1LXDA 2ICIA 2KWCA 1HE8A 2KHWB 2MJEA
chains in the Genus database with same CATH topology
1UNSA 3AE5B 3OWEB 1D5XC 1L0YB 4YTMB 3O13A 4HROA 1C76A 1I4RA 2BB5A 3LXFA 1L0XB 3TUOA 1JWSD 1ZE3D 2IGHA 3AN1A 3W2DA 4O1NA 2W54A 4OZBA 4WAFA 2BBCA 1JW9D 1IGCA 1E10A 1CK1A 1SE4A 1NEKB 3P4SB 2LMCA 2J4XA 2WXLA 5G5HA 1V97A 1VDVA 4XE0A 1K51A 2WU5B 3AE6B 1JQ4A 1ZOYB 4A55A 2QIEB 3HUIA 1TS3A 1HZ6A 1BUIC 1DGJA 1ZP0B 3KQ4A 3N9YC 3W1SA 2X38A 1BXTA 1FFUA 1GAQB 1YQ3B 3AEGB 1YQ4B 5FKAC 1AYFA 2WNMA 4DXGA 2WXNA 1TS2A 1VZ7A 1NYQA 2NMQA 2INNE 3I57A 3KWVA 3ETRA 4JPSA 2ACZB 1B1ZA 1ZXHA 4NAWB 1GB1A 1ZPSA 1ROEA 2Q5WD 5BMGA 1YN4A 2CJOA 2JSVX 4R3DA 4ZHOA 3AMZA 2Z8LA 2AQ1B 3AE9B 3EGRA 1EU3A 3PZ7A 2EKIA 1AWDA 1WWTA 1EM7A 3EA6A 1LO5D 4TQ1A 1XCQL 3FILA 4GDKB 2WXKA 5EE9A 4RGMA 2YEPB 4YSYB 1ET9A 2BT6A 3W5VB 4HJGE 2VZKD 2YEPF 2IGGA 1EU4A 3DWGC 3MFGA 1F77A 3MP9A 5EE0A 1VRAB 1XCTL 4D2KA 1HZ5A 1CJEA 3KWLA 2D5GA 1EWCA 2CU3A 4XWTA 1OQQA 2RPVA 2JX5A 3GS2A 5BMHA 3W9CB 5G5GA 1ZXIA 4N59A 3ZJTA 3AEAB 4JE3B 4WIPA 1TZOA 3V3XA 4IOIE 1XF5L 3AE3B 4ZYSA 4YT0B 4J3OD 1ENFA 2JYTA 1YN5A 3T3NA 4HEA1 1FNWA 4WURA 2H88B 1QOFA 4ZRQA 1SE3A 2N9LA 1JWUD 1L0VB 1YNTE 3L4PA 4A9AA 4ITKA 1L4ZB 4C7ZA 2WDVB 2WDQB 4OVZA 3ZYYX 2ON8A 2DBYA 1L5PA 1UGJA 3VR9B 2L32A 2E3TA 4A90A 3TSSA 3AE2B 3AECB 1L4DB 1P7FA 5C3JB 2MJ3A 4C80A 3RFZB 1TYGB 3W5UB 2LHEA 1F0ZA 1VZ6A 1XXGA 2N7JA 4JWSC 2QILA 4KGTA 4XWWA 2W3SA 2BS3B 4N6EB 1I7HA 2GI9A 3SR6A 1FRRA 1XLQA 2HTME 2N9KA 1RYJA 2LFIA 2PVGC 3HRDD 4OZCA 4RGNA 1QT9A 1JRPA 5BYRA 2V3NA 5FR3A 3AE1B 2WDRB 1J7AA 3R2TA 2LJIA 1JWBD 1I4HA 4OW0A 3AM9A 1BMLC 2B76B 4KKJA 1C4PA 5AUIA 1QOBA 1DYQA 1TKYA 2MEKA 4NAMA 1UWXA 1XLOA 2QSDA 1JMLA 2AX5A 2V0GA 4RF1A 3VQIA 4KGSA 3V05A 4CQNA 1K53A 5HFYA 1HEZE 2LUMA 3LYYA 3EUB2 1NVID 2M19A 3Q8BA 4JWUC 3SFDB 3AEDB 4ZHPA 4RF0A 2GB1A 1ACCA 3AH7A 4WH4A 4ZOHC 4USAA 2GRIA 1PDXA 1RFKA 1VR9A 1N5WA 1Y56A 2ZW1A 3NS1A 4YTNB 2J42A 5BYSA 4AS1A 3FC4A 2K9XA 2FBWB 2R61A 1SJHD 3AEBB 2EELA 2N0SB 1KF6B 1MPEA 1YMHE 1R7SA 2G9HD 3NVZA 1C78A 2DLBA 1PGAA 1HQRD 2DWQA 3BK1A 1ZUD2 3CIRB 4C7YA 1T5XD 3BVZA 4ZRPA 1WRIA 2LGIA 3IT4B 1L6VA 3P63A 1V1PB 4KX6B 3PO0A 1FMAD 4DXFA 2Y5CA 4B0MA 5T8IA 4REZA 4YSZB 1WGKA 1IBXB 2J53A 1VZ8A 2WLBA 1GB4A 2SEBD 3MC0B 3AB5A 3E9SA 2WU2B 3ZGZA 1D5MC 1FFVA 3CWIA 1JALA 3KLSX 1A70A 2BS2B 3P1MA 1I4QA 3IAS1 2J52A 2RDHA 2K22A 1WSPA 2WXRA 2K3UA 1JROA 4RNAA 2LHDA 1IGDA 3BIID 1T3QA 1SIJA 3HVDA 3NZ3A 1D5ZC 1F2RC 1OQRA 1QKZA 4YSXB 3IXSA 3LB8C 3ZQ4A 1FNVA 1I4PA 1UUPA 2PW9A 5HG2A 1D4BA 1YN3A 1QF6A 4YTPB 3AEEB 2VZKB 3BZDB 3VRBB 1GPXA 2G1EA 5LNK1 2QJLA 2PLPA 5BYQA 1M4VA 2KN4A 4LLGM 4PT5A 4RFBA 1EWYC 1V8CA 1VJKA 1L6UA 1KLGD 1ZDXA 1MHHE 2IJ0A 1J7BA 1KRHA 5HHDG 3I9V1 1FM0D 2PKOA 4KGRA 1YJIA 2AQ2B 3MJ5A 1FD6A 4H2AA 1SE2A 4XDCA 1SEBD 2MH7A 1ZDVA 3BYYB 4M0WA 4OHJA 3RPFC 4KKIA 2XN9C 1QQRA 4TMAB 2K5PA 2Y3AA 1D6EC 1FNUA 3URYA 1UWMA 3ZJUA 2W82A 4RH6A 3U2SC 2PVOD 2M56B 2BTEA 2IPKD 1PGXA 2WXPA 1E7PB 1MHXA 4YXDB 2JYEA 1TY2A 2I38A 1C9FA 1SSNA 1QILA 1N60A 3U7ZA 1SJED 3TEYA 3BWUD 1V1PA 4GDLB 3SEBA 3R2IA 1IBXA 4LTUA 2V3PA 4UDUC 1I4XA 1WXQA 3BK2A 4ARCA 3FILB 3B9JA 3WCQA 1HA5A 1N63A 3SFEB 1B9RA 3NVWA 3BYTB 3TEXA 1E9MA 2WXMA 1E0ZA 4XDDA 4Q2JA 2ZW0A 1C77A 1SF0A 2KDMA 2IDYA 2IGDA 1QOGA 2KMMA 1YJJA 3Q8EA 5HI1A 4L23A 1KFYB 2KACA 4RGTA 3MHZA 2RDGA 1QOAA 1FCCC 4N58A 1DOXA 3TEWA 1F2RI 1PUTA 1FXAA 1PGBA 2JZPA 3P4RB 2KWDA 2WXHA 4P16A 2CJNA 2WXJA 4MH8A 5MPOA 4FXCA 3VRAB 4A6QA 1SXTA 4EE2A 2FE8A 3NUHB 2WP9B 1N5XA 3TEZA 1N62A 1PYWD 1VLBA 4US9A 4RGOS 4WWMA 4IKGA 4RCOA 1DOYA 2WXFA 5JXVA 3P4QB 2XNAC 4MT5A 1FO4A 1STEA 3B2FA 1TJEA 4WQMA 4L1BA 1FEHA 1TS5A 2BYTA 5FK9C 1PFDA 2SAKA 1JCKB 1WYGA 2OHFA 3J9CA 2I2YA 1MVKA 1V1OA 2LEKA 2QMTA 5D7GA 3E56A 1C79A 1QLBB 1XO3A 1AW7A 4HRSA 2BB6A 3Q8AA 1GOZA 3PZ8A 4US8A 1C4CA 3NRZA 1JWAD 2NTTA 4TQ0A 2PMVA 1FIQA 5EE1A 4C56C 3AEFB 4GLSC 1JWMD 4JX1C 4A8XC 5H92C 3U4EG 4DQOC 2H89B 2AQ3B 3Q8FA 3BVMA 2BS4B 2L52A 1KTKA 3AE4B 3ZJVA 1I4GA 1XLPA 2WXIA 2INPE 3IT6B 2JXTA 2ONQA 1NENB 1P7EA 1K50A 5D3IB 3VR8B 1IUEA 1N61A 3Q8CA 1SBBB 4MM3B 5TSSA 1CZPA 1MI0A 2HDEA 4NZLB 4YWGG 4AQ7A 3P4PB 4TSSA 4L2YA 2NTSA 3GB1A 1RM6C 4HKZE 1FRDA 3UI3A 2BW2A 2WQYB 1AN8A 1DOIA 2DYOA 1XEEA 2JQRB 3AE7B 2KAJA 5BMIA 1J7CA 1HXYD 3R8BA 3HVZA 1TKEA 3BVGA 5GXGB 2KQ4X 1OFFA 2V4IB 3NVVA 2Y5PA 1CQVA 1ESFA 2JWUA 3U52E 5AUKA 4OZAA 4IDIA 1FXIA 1E6EB 2PIAA 2JU6X 2QEJC 3AE8B 2RMMA 2W3RA 1K52A 3T3OA 5D3DA 2L83A 3NVYA 1KH0A 1NYRA 5EE3A 1NI3A 1TY0A 4B0EA 2M0AA 3GP7A 1XLNA 4P6VF 5E6JA 2WS3B 2WXOA 1TKGA 5C2TB 3ABVB 1C4AA 4MACA 3IAM1 1KLUD 3Q69A 3C8YA 1Q10A 3DWMA 2L1AA 1TS4A 2E6XA 2WXQA 4ARIA 2TSSA 2PTLA 2DYMA 1SB3C 5H8YE 2MJDA 2W55A 2FUG1 5I4DA 1RWSA 3B2GA 3H8HA 4HKQA 1T6BX 4NJCA 1ET6A 2OEDA 3P42A 1FCLA 2ICIA 2WXGA 3AV8A 3FAHA 4LK0M 2K0PA 2MJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE5 B;  1DOY A;  1JRO A;  3P4Q B;  4YTM B;  1L0V B;  4A9A A;  3L4P A;  1FO4 A;  4ITK A;  3B2F A;  1TJE A;  3BII D;  4HRO A;  1T3Q A;  1SIJ A;  2WDV B;  2WDQ B;  3LXF A;  4WQM A;  3ZYY X;  1PFD A;  1WYG A;  2OHF A;  1OQR A;  4YSX B;  2DBY A;  2LEK A;  3LB8 C;  1L5P A;  3AN1 A;  3VR9 B;  2E3T A;  2W54 A;  3AE2 B;  1QLB B;  1XO3 A;  1JW9 D;  4HRS A;  1E10 A;  1QF6 A;  3AEC B;  4YTP B;  5C3J B;  2MJ3 A;  1NEK B;  3P4S B;  5C2T B;  1TYG B;  3NRZ A;  3W5U B;  4C80 A;  4US8 A;  1JWA D;  3AEE B;  1F0Z A;  5G5H A;  1V97 A;  3VRB B;  1VDV A;  4JWS C;  1FIQ A;  5EE1 A;  1GPX A;  2G1E A;  3AEF B;  2W3S A;  2BS3 B;  2WU5 B;  2QJL A;  3AE6 B;  1I7H A;  4N6E B;  1ZOY B;  3SR6 A;  4JX1 C;  3P1M A;  1FRR A;  2QIE B;  3HUI A;  5H92 C;  1XLQ A;  2HTM E;  4US9 A;  1DGJ A;  1RYJ A;  1EWY C;  1V8C A;  2H89 B;  1ZP0 B;  2PVG C;  3HRD D;  1VJK A;  2BS4 B;  1L6U A;  1JRP A;  1QT9 A;  2L52 A;  3AE4 B;  3AE1 B;  1J7B A;  1KRH A;  1XLP A;  2WDR B;  1FM0 D;  1FFU A;  1GAQ B;  1YJI A;  1YQ3 B;  1J7A A;  2PKO A;  3AEG B;  1YQ4 B;  1NEN B;  2MH7 A;  1AYF A;  1JWB D;  3VR8 B;  1IUE A;  1N61 A;  3RPF C;  1CZP A;  1NYQ A;  3P4P B;  3AM9 A;  2K5P A;  2B76 B;  5AUI A;  1QOB A;  1RM6 C;  1TKY A;  1UWM A;  1FRD A;  1XLO A;  3ETR A;  2ACZ B;  2AX5 A;  2PVO D;  2M56 B;  2WQY B;  1DOI A;  1E7P B;  4YXD B;  1ROE A;  2Q5W D;  2JQR B;  3AE7 B;  2KAJ A;  2CJO A;  1J7C A;  4ZHO A;  1N60 A;  3AMZ A;  4JWU C;  3EUB 2;  1NVI D;  2M19 A;  3SFD B;  3AED B;  4ZHP A;  3AE9 B;  4ZOH C;  3AH7 A;  1TKE A;  3HVZ A;  5GXG B;  4USA A;  2EKI A;  1AWD A;  1WWT A;  1OFF A;  1PDX A;  1RFK A;  3NVV A;  4LTU A;  1N5W A;  3NS1 A;  4C7Z A;  1WXQ A;  4YTN B;  5AUK A;  5EE9 A;  3B9J A;  3FC4 A;  2K9X A;  2FBW B;  4IDI A;  1FXI A;  4YSY B;  1E6E B;  1N63 A;  2PIA A;  3AEB B;  3AE8 B;  3WCQ A;  2BT6 A;  3SFE B;  2N0S B;  3W5V B;  1B9R A;  2W3R A;  3NVW A;  1E9M A;  1KF6 B;  2L83 A;  3DWG C;  1E0Z A;  1JQ4 A;  5EE0 A;  3NVY A;  1NYR A;  5EE3 A;  1NI3 A;  1CJE A;  1R7S A;  3KWL A;  3NVZ A;  1SF0 A;  1XLN A;  2CU3 A;  2WS3 B;  1QOG A;  1TKG A;  4P6V F;  2KMM A;  1OQQ A;  2DWQ A;  1YJJ A;  2JX5 A;  3ABV B;  3W9C B;  5G5G A;  1ZUD 2;  1KFY B;  3CIR B;  4C7Y A;  1ZXI A;  4N59 A;  1WRI A;  3DWM A;  3AEA B;  1QOA A;  1L6V A;  3P63 A;  4N58 A;  1DOX A;  4KX6 B;  3PO0 A;  1FMA D;  2Y5C A;  1PUT A;  5H8Y E;  1SB3 C;  1FXA A;  2MJD A;  3P4R B;  2W55 A;  1WGK A;  4YSZ B;  1RWS A;  3B2G A;  2CJN A;  3AE3 B;  2WLB A;  4YT0 B;  5MPO A;  4FXC A;  3VRA B;  3AB5 A;  2WU2 B;  3AV8 A;  1FFV A;  2WP9 B;  3CWI A;  1N5X A;  3FAH A;  1N62 A;  2BS2 B;  1JAL A;  2H88 B;  1A70 A;  1QOF A;  1VLB A;  4WWM A;  2K22 A;  2MJE A; 
#chains in the Genus database with same CATH topology
 3AE5 B;  3OWE B;  1HTQ A;  4GU2 A;  3LXF A;  1F52 A;  4KSL C;  3TUO A;  2YVC A;  1ZE3 D;  2IGH A;  4KDI C;  2W54 A;  2D3G A;  2GLS A;  3DVG Y;  3WAN A;  1CK1 A;  1SE4 A;  4W9J A;  4BKS A;  1WM2 A;  4NJ7 A;  2J4X A;  1A5R A;  2CR5 A;  3QX1 A;  4HDQ A;  2JRI B;  3SD5 A;  2R2O A;  2D3C A;  4IW0 A;  1FFU A;  1YQ3 B;  1YQ4 B;  5FKA C;  1WX8 A;  1VZ7 A;  2KQS A;  3Q3M C;  3L08 A;  4GGQ A;  5IN7 A;  4G11 A;  4NAW B;  5L83 A;  1GB1 A;  1YN4 A;  2JSV X;  4R3D A;  2N7E A;  1WIA A;  3EGR A;  2IY1 B;  2JZZ A;  3QK0 A;  3C19 A;  4ANU A;  1XCQ L;  4GDK B;  3OAW A;  1ET9 A;  2BT6 A;  5EE0 A;  2PEA A;  4NAW A;  1HZ5 A;  2WDT B;  3KWL A;  2JX5 A;  4WAA A;  2FAZ A;  3ZJT A;  3KUD B;  3AEA B;  3U8Z A;  1P1A A;  3ZKJ C;  2KC2 A;  1ENF A;  2JYT A;  2J0K A;  2LGS A;  1XQQ A;  3KVF B;  2AL3 A;  4A3O A;  1Q1O A;  4ANX A;  4WUR A;  2H88 B;  1QOF A;  3DBR B;  4A9A A;  2IND C;  1NBF C;  4OVZ A;  3KYC D;  3ZYY X;  2FIF A;  1L5P A;  1LFD A;  4MGK E;  4BKT A;  2L32 A;  2E3T A;  1D3Z A;  4II2 B;  2BYE A;  4P1C C;  1P3Q U;  2DAJ A;  2JY6 A;  4C80 A;  1TYG B;  2EKE C;  2M1M A;  1XXG A;  2HJ8 A;  2AEH A;  1Q0W B;  4XWW A;  2D3A A;  4W9K A;  3SR6 A;  2LVQ A;  4RGN A;  2WHI A;  4W9H A;  5FR3 A;  3AE1 B;  1KLV A;  3KUC B;  1GC7 A;  3PSE B;  4CYE A;  1KOT A;  2GBN A;  2KN5 A;  4IM2 A;  3AM9 A;  3PLU A;  1C4P A;  5KHQ A;  3L0W B;  4EUT A;  5LXH A;  2MEK A;  2MWS B;  4NAM A;  1JML A;  2B3A A;  2K0P A;  2V0G A;  2N9X A;  3ZXV A;  4RF1 A;  3VQI A;  4KGS A;  3V05 A;  2RD0 A;  3QWZ B;  1V86 A;  4CQN A;  5IO9 A;  1K53 A;  1TGZ B;  5HFY A;  1HEZ E;  1NVI D;  1YX6 B;  3Q8B A;  3AED B;  4ZHP A;  3ENE A;  1GNU A;  3HM6 X;  4MH0 E;  4RF0 A;  1M94 A;  1ACC A;  3SHQ A;  2UWQ A;  1PDX A;  2Z0D B;  1N5W A;  3NS1 A;  5E6N A;  4YTN B;  2R61 A;  4XGA B;  5CTR C;  1WJ4 A;  3TL5 A;  1YJ1 A;  5D6J B;  1YMH E;  3UGB B;  1R7S A;  4GXB A;  2KYW A;  3NVZ A;  1C78 A;  2YLM A;  2KK8 A;  2JF5 A;  3A33 B;  2LGI A;  1WM3 A;  1L6V A;  3QC8 B;  4DXF A;  2BPS A;  1FMA D;  2JVC A;  4YSZ B;  1IBX B;  5JHB A;  3DPD A;  3RT3 B;  3ZTC A;  1WF9 A;  3AB5 A;  3E9S A;  1X1M A;  2WU2 B;  1U4A A;  1V5T A;  5D2M B;  1A70 A;  2BS2 B;  5IKC M;  2J52 A;  2WXR A;  2K3U A;  3PRM B;  2LHD A;  4LJO B;  4LCD E;  2MRP A;  1F2R C;  2INC C;  2IO0 B;  3IXS A;  4EKU A;  1I4P A;  4MSQ B;  4KZ0 A;  4DHJ D;  1QF6 A;  1AAR A;  4NPN A;  3AEE B;  5C23 A;  2VZK B;  2G1E A;  1WX9 A;  2KN4 A;  1WXS A;  4PT5 A;  2MP2 A;  4RFB A;  3AU5 A;  1VJK A;  2Y5B B;  5D94 A;  5HHD G;  2EMT A;  2AQ2 B;  2MLB A;  4HPM B;  4OHJ A;  1K8R B;  4ANV A;  1QQR A;  4QAY A;  2K5P A;  4TMA B;  4BZA A;  2O6V D;  1L2N A;  4RH6 A;  1T0Y A;  2R2Q A;  2D2Q A;  2IPK D;  4YXD B;  1MHX A;  2MQJ A;  2I38 A;  1SSN A;  1QIL A;  3JYU A;  2KDE B;  2BYV E;  1WXA A;  1IBX A;  2AYO B;  4LTU A;  4GMV A;  4UDU C;  3BK2 A;  2I1K A;  1HA5 A;  4IM0 A;  3NVW A;  1C1Y B;  1WY8 A;  3QA8 A;  1EUV B;  1E8Z A;  2ZW0 A;  1C77 A;  4F8C B;  4FUL A;  3W1S C;  5HI1 A;  4L23 A;  2DEN B;  4RGT A;  2WYQ A;  3WAM A;  2RDG A;  3QAQ A;  4N58 A;  2BGF A;  4HCP B;  1PGB A;  3V6C B;  2WXH A;  4P16 A;  4BVU C;  2CJN A;  3MTN B;  2DYB A;  3DVN V;  1WJU A;  4A6Q A;  3NUH B;  1L7Y A;  3UQB A;  4RCO A;  4MT5 A;  2MBO A;  3CST A;  3B2F A;  2OOB B;  1YD8 U;  4WQM A;  1TS5 A;  4M8M A;  3J9C A;  4KIK A;  3M62 B;  1V1O A;  5D7G A;  1QLB B;  1UEL A;  4PYZ A;  2BB6 A;  3RZW C;  2NPT A;  1GOZ A;  2DZI A;  2C60 A;  5EE1 A;  2LGD A;  4C56 C;  3QCA A;  4GLS C;  1JWM D;  4NQK E;  4DQO C;  4FA6 A;  2LRU A;  3JW0 X;  2VH2 A;  3C0R B;  2NBV B;  4E71 A;  2ASQ A;  2KLG A;  4DXA B;  1N61 A;  2LGX A;  1SBB B;  2XBB C;  4MM3 B;  4YWG G;  1GC6 A;  3RYT A;  1RM6 C;  3DBL I;  2BW2 A;  4B9K A;  2CS4 A;  5BMI A;  3IHP C;  1VD2 A;  3R8B A;  1TKE A;  4FHK A;  1ESF A;  3U52 E;  1IPG A;  4OZA A;  4IDI A;  2NBU A;  3SU8 X;  2PIA A;  4URK A;  1NI3 A;  1WX7 A;  3DWM A;  2L0T A;  2E6X A;  2DYM A;  1WJ6 A;  2MJD A;  4IWQ A;  2MBQ A;  2ZZP B;  4IC7 B;  4E74 A;  4K7S A;  2DZM A;  2WXG A;  1UBI A;  1WMH B;  1D5X C;  3GE8 C;  2WGS A;  4YTM B;  1C76 A;  1I4R A;  1R4N B;  3M63 B;  1V80 A;  5AZH A;  3APD A;  3AN1 A;  4WAF A;  1JW9 D;  4MM3 A;  1E10 A;  3PLV A;  2WXL A;  1V97 A;  4XE0 A;  4C00 A;  2PE6 B;  2WU5 B;  1JQ4 A;  2QCZ A;  2ZPY A;  4A55 A;  2QIE B;  2FCS A;  1TS3 A;  1BUI C;  3HHM A;  4XC2 A;  2DNF A;  3N20 C;  2RGF A;  3NY5 A;  5FR6 A;  1TS2 A;  4K7U A;  4LDT D;  3I57 A;  3ETR A;  1B1Z A;  4HXD A;  1NDD A;  2KX0 A;  1ZPS A;  2Q5W D;  5BMG A;  1E7U A;  2CJO A;  3WIM A;  2KOX A;  2FID A;  3L13 A;  3AE9 B;  1EU3 A;  2EKI A;  1WWT A;  4XX5 A;  3L17 A;  2WXK A;  2BVC A;  2KTF A;  4GIV A;  4HJG E;  2IGG A;  1EU4 A;  3MFG A;  1XCT L;  2O2V B;  1FPY A;  1CJE A;  1WXM A;  1EWC A;  1WE6 A;  2MHJ A;  1N6Z A;  2JWZ A;  2J0J A;  2GBJ A;  1E8X A;  2KVZ A;  4J6I A;  2KJH B;  4CHK A;  4JE3 B;  3ZRC A;  1Y8R C;  2PPH A;  1TZO A;  3ZDM C;  2D10 A;  3V3X A;  4IOI E;  1XF5 L;  1E7V A;  4J3O D;  3T3N A;  3HM3 A;  3DQV A;  3ZXR A;  1L4Z B;  2LRW A;  2WDV B;  2WDQ B;  3I3T B;  4ZRI A;  4MEL A;  2ON8 A;  3RI7 C;  3VR9 B;  4A90 A;  4EZK A;  3ZDT A;  1J8C A;  1P7F A;  3RFZ B;  4LNI A;  2LXA A;  3BIN A;  3U7D A;  4N6E B;  1I7H A;  2GI9 A;  5LXI B;  2BKR B;  1XLQ A;  3HRD D;  4OZC A;  4PS3 A;  1QT9 A;  2MBH A;  5BYR A;  2K6D B;  4DK5 A;  1J7A A;  3R2T A;  2LJI A;  2LGY A;  1MG4 A;  1JRU A;  1I4H A;  4HWI B;  4OW0 A;  4KKJ A;  2KDI A;  4IG7 B;  2QSD A;  4ASW C;  2AX5 A;  3A4R A;  4WWO A;  5L95 C;  1Q5W B;  2LUM A;  2Z0E B;  3EUB 2;  3SFD B;  1GUA B;  3RNG C;  2GB1 A;  3JVZ X;  2GRI A;  3N1X C;  1RFK A;  3RNA C;  2KLC A;  3A1Q B;  4AS1 A;  2PJH A;  2N1W A;  3MC8 A;  2N0S B;  1KF6 B;  4JL9 A;  2JZ3 B;  4LNO A;  2CHZ A;  4NJ6 A;  1PGA A;  3RNF C;  1HQR D;  3KH0 A;  2DWQ A;  1I42 A;  3BK1 A;  1IYF A;  2WX0 A;  1T5X D;  1P9D U;  1IP9 A;  4KX6 B;  3PO0 A;  2Y5C A;  2G4D B;  1WGK A;  1J19 A;  3RUI B;  2WLB A;  1GB4 A;  3AU4 A;  2SEB D;  3U30 A;  2N7D A;  3IAS 1;  2K22 A;  2EMS A;  4RNA A;  1WZ3 A;  4AUQ C;  3NZ3 A;  1OQR A;  3IFW B;  3ZQ4 A;  3NS8 A;  2LWP A;  2L0F A;  4ZRK A;  3X0W A;  4K3C A;  5BO4 B;  3DBL B;  1GPX A;  2PLP A;  2KDF B;  3VVW B;  4B95 A;  1M4V A;  1SGH A;  3O65 B;  2M4N A;  1EWY C;  3RN9 C;  1KLG D;  1ZDX A;  2RPQ A;  1FM0 D;  4KGR A;  3MJ5 A;  4M02 A;  4H2A A;  1SE2 A;  4XDC A;  1SEB D;  2MH7 A;  3BYY B;  5DPS A;  2V1Y A;  1FNU A;  3URY A;  4BOS C;  1UWM A;  3TBL D;  2WWZ A;  3ZIM A;  1PGX A;  2WXP A;  2REX A;  3FKY A;  5JZE B;  1TY2 A;  2NCN A;  1N60 A;  3TEY A;  1UD7 A;  2K1F A;  4GDL B;  3JSV B;  3SEB A;  4G50 A;  2HTH A;  5G2N A;  2WX1 A;  4GDK A;  1I4X A;  2LAS A;  2V9H A;  3FIL B;  4ARC A;  3B08 A;  1NI2 A;  4MGI E;  2KDM A;  2IGD A;  5EDS A;  2IO3 B;  1V2Y A;  3ECI A;  1YJJ A;  3SDL C;  3P2B A;  2KAC A;  2CHW A;  3MHZ A;  3R3M A;  3VUY A;  1PUT A;  1FXA A;  3P4R B;  2G4S A;  1E5W A;  3VH3 B;  3VXW A;  2DX5 B;  4MH8 A;  4FXC A;  4WJO A;  2FE8 A;  3ZNG C;  2WP9 B;  1N5X A;  3TEZ A;  1N62 A;  1PYW D;  1VLB A;  4WWM A;  3UIP B;  4IKG A;  3ZVV A;  3P4Q B;  2XNA C;  4L1B A;  1FEH A;  1V9J A;  4EZL A;  5FK9 C;  2OHF A;  2I2Y A;  1MVK A;  2QMT A;  3E56 A;  2X8X X;  2NR2 A;  4HRS A;  4PYU A;  5DPT A;  5HKH A;  2KFJ A;  3EHV A;  2NTT A;  1WXV A;  2PMV A;  1OEY A;  3AEF B;  3DHG C;  3RD2 A;  4JX1 C;  4G3X B;  2H89 B;  3B0A A;  4GDL A;  1XLP A;  2CKH B;  2JXT A;  1P7E A;  5D3I B;  1IUE A;  1SE9 A;  3ALB A;  5TSS A;  2KX3 A;  2ZCB A;  2NTS A;  2Z59 B;  4P1B C;  4HKZ E;  3OJ3 A;  1DOI A;  1GG3 A;  1T0Q C;  3AE7 B;  2KAJ A;  2KZR A;  1WGR A;  2BYF A;  1OGW A;  5CHF A;  1HXY D;  2IO1 B;  5LLI A;  3BVG A;  3TIX A;  3N3K B;  2KQ4 X;  4DHJ B;  1CQV A;  4ACF A;  2LI5 A;  1E6E B;  3AE8 B;  2JPH A;  2KMC A;  2L83 A;  3IVF A;  1T0R C;  4B0E A;  2DZK A;  2M0A A;  1XLN A;  5E6J A;  2VH1 A;  3Q6B A;  4MAC A;  4FBJ B;  4WJP A;  4ANW A;  1R4M I;  2WXQ A;  1Z2M A;  2QHO A;  2TSS A;  5H8Y E;  1SB3 C;  2W55 A;  3AI5 A;  4HKQ A;  4NJC A;  4IWO A;  2O6V B;  3NG0 A;  5IAA C;  3AV8 A;  3FAH A;  4LK0 M;  4EOY A;  3V61 A;  2L7R A;  2FUH B;  2QC8 A;  4DDI D;  3ML8 A;  3O13 A;  2BB5 A;  1L0X B;  2DZJ A;  1JWS D;  3ZNH B;  2XK5 B;  5JH5 C;  2J0M A;  1NEK B;  1WR6 E;  3P4S B;  1G6J A;  5G5H A;  1VDV A;  1K51 A;  5JHA A;  4HCN B;  1HZ6 A;  3NOB A;  1ZP0 B;  3W1S A;  2X38 A;  3A4S C;  1GAQ B;  3AEG B;  3APC A;  4FJY A;  1TZ1 A;  1AYF A;  2LZ6 A;  2C7M B;  3QJZ A;  2WXN A;  1NYQ A;  2NMQ A;  3IG3 A;  1VCB A;  3B1L X;  3KWV A;  2ACZ B;  1MFW A;  1V6E A;  2ZPN A;  1J0G A;  4M8N A;  4AJY B;  3CF6 E;  3Q2A C;  3LDZ E;  2MCN B;  4MSM B;  3M3J A;  3AMZ A;  2LD9 A;  1AWD A;  2MA9 B;  3EA6 A;  5E6P A;  3DVG X;  4TQ1 A;  4NY0 A;  5EE9 A;  4RGM A;  2O6V A;  1S3S G;  4YSY B;  4ZDV A;  2LVO A;  2YEP F;  3MP9 A;  4BBN C;  4D2K A;  1F77 A;  4G0N B;  4IM3 A;  2GMI C;  1WGH A;  3ZRF A;  2CU3 A;  4XWT A;  2A4Z A;  5BMH A;  2ZEQ A;  3ML9 A;  1ZXI A;  4MGZ E;  4WIP A;  3UIO B;  1XD3 B;  3AE3 B;  3H9D A;  1YN5 A;  4LNN A;  4HEA 1;  4WWP A;  2GOW A;  3N30 A;  1YNT E;  3L4P A;  3HIZ A;  3TJP A;  5IOI A;  2DBY A;  3TSS A;  2LUE A;  3AE2 B;  3AEC B;  1E8W A;  1L4D B;  2MJ3 A;  1C3T A;  1VZ6 A;  4JWS C;  1V49 A;  2QIL A;  3MC9 A;  2HTM E;  2K25 A;  1RYJ A;  2LFI A;  3VDZ A;  1JRP A;  4TKN A;  2WDR B;  4RMA A;  4F7Z A;  2N9P C;  4M01 A;  2L3Z A;  1WZ0 A;  3KUZ A;  2B76 B;  5AUI A;  1UWX A;  3V6E B;  3RZF A;  1OQY A;  3W1Y A;  3NZS A;  4BBN F;  3LYY A;  4JWU C;  3N1Z C;  4PS7 A;  4TUU A;  3AH7 A;  4WH4 A;  1UGM A;  3NHE B;  1Y56 A;  2ZVO A;  3GZN I;  5BYS A;  2J42 A;  4M0W B;  4WQO B;  3FC4 A;  1WRD B;  2FBW B;  1SJH D;  3AEB B;  2EEL A;  3VFK A;  4DBG A;  1TBE A;  3OG5 A;  2N1V A;  2G9H D;  2HD5 B;  2DLB A;  1ZUD 2;  3CIR B;  3BVZ A;  4ZRP A;  1WRI A;  1LQB A;  3DBH I;  3VUW A;  3PRZ A;  4MGY E;  4B0M A;  1H4R A;  4REZ A;  1S1Q B;  1F9J A;  5C1Z A;  2J53 A;  4W9L A;  4LDT B;  3RMK C;  4BKS D;  3ZGZ A;  1D5M C;  2M17 A;  3CWI A;  1KM7 A;  1OEY J;  4ICU A;  4I6L B;  3P1M A;  1WMH A;  1WSP A;  3VTU A;  1JRO A;  3BII D;  1SIJ A;  4C4V B;  3HVD A;  1D5Z C;  3LB8 C;  3PRP B;  2C7N B;  1FNV A;  2PW9 A;  4ZRJ A;  1PQS A;  1YN3 A;  1F1H A;  2BQQ A;  4YTP B;  3KW5 B;  2LVP A;  3VRB B;  3ZW3 A;  5LNK 1;  2QJL A;  5BYQ A;  1L6U A;  2IJ0 A;  1J7B A;  1KRH A;  3I9V 1;  4HPL B;  2PKO A;  1YJI A;  1ZDV A;  4M0W A;  5CX3 A;  3PPA A;  2AWT A;  2GBK A;  2XN9 C;  4FN2 A;  1WFY A;  4ICV A;  1D6E C;  2IBI B;  2K39 A;  2N9E B;  2LXC A;  2W82 A;  3NZU A;  1WH3 A;  4KSK C;  2BTE A;  2KFK B;  3PHW B;  2JYE A;  4E3C A;  2HE7 A;  2IO2 B;  5CHW A;  1C9F A;  1TIF A;  4W9I A;  4W9D A;  2BWE S;  1R4M B;  2NBW B;  4AOF A;  3PT2 B;  4PK1 A;  1N63 A;  3SFE B;  1B9R A;  3I63 C;  3UIN B;  1E9M A;  2WXM A;  2O2V A;  4Q2J A;  3AUL A;  3EFC A;  2IDY A;  1QOG A;  2I1J A;  2MX2 A;  4C4V A;  1KFY B;  2KXJ A;  1TTN A;  1UZX B;  2C7H A;  4GOC A;  1FCC C;  1DOX A;  4B6W A;  3WAP A;  2FCN A;  4EFO A;  2JZP A;  3T9L A;  1HTO A;  2WXJ A;  4JIO U;  4W9E A;  4I6P A;  3VRA B;  4JGH B;  1SIF A;  4US9 A;  4RGO S;  1DOY A;  2L00 B;  3MHS D;  2JT4 B;  5JXV A;  1FO4 A;  1STE A;  1TJE A;  1PFD A;  2LEK A;  1C79 A;  2K8H A;  3Q8A A;  3PZ8 A;  1JWA D;  4FJZ A;  1ISN A;  3OJ4 B;  1FIQ A;  4WJN A;  2KFK A;  3EEC A;  4A8X C;  2K6Q A;  5H92 C;  3U4E G;  3BVM A;  2BS4 B;  2A5U A;  1KTK A;  2L52 A;  3AE4 B;  3ZJV A;  1I4G A;  2FCM A;  2WXI A;  2INP E;  3IT6 B;  2ONQ A;  1I35 A;  3VR8 B;  1V5O A;  1CZP A;  1MI0 A;  3DVN U;  3P4P B;  4L2Y A;  3GB1 A;  1FRD A;  3UI3 A;  1BT0 A;  2WQY B;  1AN8 A;  2JQR B;  1J7C A;  3A9K B;  4HK2 A;  1EF1 A;  3RUL A;  2OJR A;  3HVZ A;  1OFF A;  2V4I B;  3K9O B;  4X57 B;  2JWU A;  3A1Q A;  5AUK A;  3RNC C;  1FXI A;  2JU6 X;  1K52 A;  3T3O A;  4K3B A;  1NYR A;  5EE3 A;  3R66 C;  4IWP A;  5C2T B;  1TKG A;  4N9F 4;  5J17 A;  1V81 A;  3VHT C;  3QHT A;  2V4L A;  3C8Y A;  2L1A A;  1TS4 A;  3D32 A;  4ARI A;  2LJ5 A;  4YL8 A;  2K8C A;  3B2G A;  3N32 A;  2OED A;  3P42 A;  2G45 B;  4AWJ A;  1WGG A;  3ZUN A;  1WI0 A;  4JLC A;  1UNS A;  3Q14 C;  2KTR B;  1L0Y B;  2FNJ B;  3H6N A;  4HRO A;  1R4N I;  2KQ7 A;  3NJT A;  3VAW A;  1EF5 A;  3W2D A;  4RM9 A;  4O1N A;  4OZB A;  2BBC A;  1IGC A;  4CO7 A;  3H7S A;  2LMC A;  3AE6 B;  1ZOY B;  3KYD D;  3HUI A;  1DGJ A;  2MP2 B;  3KQ4 A;  3A9K A;  3N9Y C;  3Q3N C;  1BXT A;  5CHV C;  2D11 A;  2JXX A;  2L8J A;  1E90 A;  3GZN B;  2KNB A;  2WNM A;  4DXG A;  4HDO A;  2INN E;  2IYD B;  3ONS A;  4W9G A;  4JPS A;  1ZXH A;  2NS5 A;  2L76 A;  3R7Q A;  1ROE A;  3TCA A;  3DBS A;  4ZHO A;  2RDB C;  4W9F A;  2RSU A;  2Z8L A;  2DHZ A;  1QZE A;  1YX5 B;  3APF A;  2AQ1 B;  3DBH B;  3JSV A;  3PZ7 A;  1EM7 A;  2BF8 B;  1LO5 D;  2BKF A;  3FIL A;  3ZO5 B;  3K9P B;  2YEP B;  3W5V B;  2VZK D;  3ZNI D;  1ZKH A;  1CMX B;  3DWG C;  1VRA B;  4A3P A;  2KTR A;  1WJN A;  2D5G A;  3PVL A;  3PZD A;  3DOW A;  1OQQ A;  1WGY A;  2RPV A;  3DCG A;  3GS2 A;  4MDK E;  5G5G A;  3W9C B;  2G3Q B;  4LNK A;  3H1U A;  3UF8 A;  4N59 A;  2D07 B;  2KKC A;  2KMA A;  1T0S C;  4ZYS A;  4YT0 B;  2UYZ B;  4HLE A;  1FNW A;  4ZRQ A;  1SE3 A;  2N9L A;  4DHZ B;  3HK0 A;  1JWU D;  1L0V B;  4K7W A;  4ITK A;  4HVB A;  4C7Z A;  5GMV A;  3WAL A;  4KIK B;  4MJS B;  1UGJ A;  2KO3 A;  4F1S A;  2NPT B;  5C3J B;  3W5U B;  2LHE A;  1F0Z A;  2N7J A;  4K81 A;  2MBB B;  4KGT A;  3DHI C;  2W3S A;  2BS3 B;  2KWV B;  1FRR A;  2C5L C;  3CMM B;  3GOE A;  2N9K A;  2PVG C;  1WE7 A;  1ZW7 A;  3N1Y C;  2V3N A;  4KZC A;  2C9W B;  2M0X A;  3Q3O C;  1ZGU B;  5IA7 A;  1JWB D;  3CSF A;  5KHO A;  1WGD A;  2FCQ A;  2KT7 A;  1BML C;  1MG8 A;  1QOB A;  2L05 A;  1DYQ A;  1LGR A;  1TKY A;  1XLO A;  2IZV B;  1KJT A;  5E6O A;  2UU7 A;  3DDC B;  4DWF A;  4S0R A;  2M19 A;  4JQW C;  4XYC A;  4ZOH C;  4USA A;  1VR9 A;  1WR1 A;  2ZW1 A;  3PTF C;  4IUM B;  4WJQ A;  1YIW A;  2K9X A;  3ZNZ B;  5IP4 D;  1MPE A;  2K8B A;  3OLM D;  2MSE D;  4LNF A;  4C7Y A;  1EO6 A;  4MJS A;  1UF0 A;  3IT4 B;  3P63 A;  1V1P B;  2ZJD A;  4HJK A;  3I5J C;  5T8I A;  5G55 A;  1VZ8 A;  3MC0 B;  4RM8 A;  3V60 A;  1FFV A;  4BKG A;  1JAL A;  3KLS X;  1I4Q A;  1MJD A;  2OJW A;  2QDF A;  2RDH A;  4I6N B;  3ZLZ A;  2ZNV B;  1IGD A;  3A9J B;  1T3Q A;  4GSW A;  4DDG D;  1QKZ A;  3MJW A;  4YSX B;  4BOZ B;  1UUP A;  2D3B A;  5HG2 A;  4BAX A;  1D4B A;  2XK5 A;  1RRB A;  3PHX B;  2ZCC A;  1H8C A;  3BZD B;  3WAO A;  3WA0 A;  5AZG A;  3DBR I;  4K1R B;  4LLG M;  3V62 A;  4ZYN A;  3S2A A;  1V8C A;  4WWN A;  4KVG B;  2GBR A;  3VTV A;  2KD0 A;  2DAF A;  2AL6 A;  1RFA A;  4PS8 A;  1MHH E;  3UQA A;  1FD6 A;  2CU1 A;  3VH4 B;  4BFR A;  5AZF A;  3RPF C;  4NQL B;  4KKI A;  4KV2 A;  4M00 A;  2Y3A A;  3ZJU A;  4KDL B;  3U2S C;  5AEK B;  4P7I A;  3VTW A;  2PVO D;  2M56 B;  4EEW A;  5J18 A;  1E7P B;  2ZNV C;  3L16 A;  4MEM A;  3RNE C;  2KWU B;  3U7Z A;  1SJE D;  4NNJ B;  3BWU D;  1V1P A;  5J2R A;  4DHZ E;  3R2I A;  2V3P A;  3PGE A;  1WXQ A;  3B9J A;  1YOV B;  3WCQ A;  4OVV A;  2N4F A;  2NVU I;  3BYT B;  2VRR B;  3TEX A;  3GE3 C;  1XT9 B;  1P98 A;  1E0Z A;  1Z5S B;  1RAX A;  4XDD A;  3IBE A;  3ZTD A;  1SF0 A;  2BWF A;  2KMM A;  3QQ8 B;  3A9J A;  3Q8E A;  2MBE A;  3RCZ A;  2W9N A;  1QOA A;  3EFU A;  4A20 A;  3TEW A;  1F2R I;  1E8Y A;  3PS6 A;  4EZJ A;  1TT5 B;  1P0R A;  2KWD A;  4W9C A;  5MPO A;  2PE9 A;  4GB9 A;  4EE2 A;  1SXT A;  2RR9 A;  3EC8 A;  2CHX A;  2HJ1 A;  2WXF A;  2M8S A;  4II3 B;  3L54 A;  2BYT A;  1UBQ A;  2V3S A;  2SAK A;  1JCK B;  1WYG A;  2XEW A;  4FLH A;  1OTR B;  1XO3 A;  1AW7 A;  4US8 A;  1C4C A;  3NRZ A;  2IY0 B;  3H7P B;  2JUO A;  4TQ0 A;  1YQB A;  4FAD A;  2KVR A;  1WYW B;  4FJV B;  2AQ3 B;  3Q8F A;  3T8M A;  5DPR A;  1LM8 B;  2J7Q B;  1NEN B;  1K50 A;  2KDB A;  2MW5 A;  3DHH C;  3R7R A;  3Q8C A;  2KC1 A;  4AJW A;  4NZL B;  2HDE A;  4OVU A;  4AQ7 A;  4TSS A;  2KJR A;  5DCN A;  3BY4 B;  3QIJ A;  3VUX A;  3M95 A;  2KAN A;  2DYO A;  4LJP B;  1XEE A;  3LJ3 A;  3Q3J A;  1UH6 A;  5GXG B;  1FXT B;  3PV1 A;  3NVV A;  4GN1 A;  2Y5P A;  4HPP A;  3PRE A;  4FHJ A;  4S17 A;  4AP4 C;  2QEJ C;  2RMM A;  2W3R A;  2ZVN A;  5TR5 A;  5D3D A;  5DPW A;  2KJ6 A;  3QAR A;  3L10 B;  3NVY A;  1KH0 A;  4TV3 A;  1TY0 A;  3GP7 A;  2JRH A;  4P6V F;  2WS3 B;  2WXO A;  3ABV B;  1C4A A;  3RNB C;  3Q3F A;  3AXC A;  3IAM 1;  1KLU D;  2GBM A;  3Q69 A;  1Q10 A;  3X23 A;  1RLF A;  1GJZ A;  2PTL A;  4XZ4 A;  2FUG 1;  5I4D A;  1RWS A;  3H7P A;  3TMP B;  3H8H A;  1T6B X;  1ET6 A;  1FCL A;  1LXD A;  2ICI A;  2KWC A;  1HE8 A;  2KHW B;  2MJE A; 
#chains in the Genus database with same CATH homology
 1UNS A;  3AE5 B;  3OWE B;  1D5X C;  1L0Y B;  4YTM B;  3O13 A;  4HRO A;  1C76 A;  1I4R A;  2BB5 A;  3LXF A;  1L0X B;  3TUO A;  1JWS D;  1ZE3 D;  2IGH A;  3AN1 A;  3W2D A;  4O1N A;  2W54 A;  4OZB A;  4WAF A;  2BBC A;  1JW9 D;  1IGC A;  1E10 A;  1CK1 A;  1SE4 A;  1NEK B;  3P4S B;  2LMC A;  2J4X A;  2WXL A;  5G5H A;  1V97 A;  1VDV A;  4XE0 A;  1K51 A;  2WU5 B;  3AE6 B;  1JQ4 A;  1ZOY B;  4A55 A;  2QIE B;  3HUI A;  1TS3 A;  1HZ6 A;  1BUI C;  1DGJ A;  1ZP0 B;  3KQ4 A;  3N9Y C;  3W1S A;  2X38 A;  1BXT A;  1FFU A;  1GAQ B;  1YQ3 B;  3AEG B;  1YQ4 B;  5FKA C;  1AYF A;  2WNM A;  4DXG A;  2WXN A;  1TS2 A;  1VZ7 A;  1NYQ A;  2NMQ A;  2INN E;  3I57 A;  3KWV A;  3ETR A;  4JPS A;  2ACZ B;  1B1Z A;  1ZXH A;  4NAW B;  1GB1 A;  1ZPS A;  1ROE A;  2Q5W D;  5BMG A;  1YN4 A;  2CJO A;  2JSV X;  4R3D A;  4ZHO A;  3AMZ A;  2Z8L A;  2AQ1 B;  3AE9 B;  3EGR A;  1EU3 A;  3PZ7 A;  2EKI A;  1AWD A;  1WWT A;  1EM7 A;  3EA6 A;  1LO5 D;  4TQ1 A;  1XCQ L;  3FIL A;  4GDK B;  2WXK A;  5EE9 A;  4RGM A;  2YEP B;  4YSY B;  1ET9 A;  2BT6 A;  3W5V B;  4HJG E;  2VZK D;  2YEP F;  2IGG A;  1EU4 A;  3DWG C;  3MFG A;  1F77 A;  3MP9 A;  5EE0 A;  1VRA B;  1XCT L;  4D2K A;  1HZ5 A;  1CJE A;  3KWL A;  2D5G A;  1EWC A;  2CU3 A;  4XWT A;  1OQQ A;  2RPV A;  2JX5 A;  3GS2 A;  5BMH A;  3W9C B;  5G5G A;  1ZXI A;  4N59 A;  3ZJT A;  3AEA B;  4JE3 B;  4WIP A;  1TZO A;  3V3X A;  4IOI E;  1XF5 L;  3AE3 B;  4ZYS A;  4YT0 B;  4J3O D;  1ENF A;  2JYT A;  1YN5 A;  3T3N A;  4HEA 1;  1FNW A;  4WUR A;  2H88 B;  1QOF A;  4ZRQ A;  1SE3 A;  2N9L A;  1JWU D;  1L0V B;  1YNT E;  3L4P A;  4A9A A;  4ITK A;  1L4Z B;  4C7Z A;  2WDV B;  2WDQ B;  4OVZ A;  3ZYY X;  2ON8 A;  2DBY A;  1L5P A;  1UGJ A;  3VR9 B;  2L32 A;  2E3T A;  4A90 A;  3TSS A;  3AE2 B;  3AEC B;  1L4D B;  1P7F A;  5C3J B;  2MJ3 A;  4C80 A;  3RFZ B;  1TYG B;  3W5U B;  2LHE A;  1F0Z A;  1VZ6 A;  1XXG A;  2N7J A;  4JWS C;  2QIL A;  4KGT A;  4XWW A;  2W3S A;  2BS3 B;  4N6E B;  1I7H A;  2GI9 A;  3SR6 A;  1FRR A;  1XLQ A;  2HTM E;  2N9K A;  1RYJ A;  2LFI A;  2PVG C;  3HRD D;  4OZC A;  4RGN A;  1QT9 A;  1JRP A;  5BYR A;  2V3N A;  5FR3 A;  3AE1 B;  2WDR B;  1J7A A;  3R2T A;  2LJI A;  1JWB D;  1I4H A;  4OW0 A;  3AM9 A;  1BML C;  2B76 B;  4KKJ A;  1C4P A;  5AUI A;  1QOB A;  1DYQ A;  1TKY A;  2MEK A;  4NAM A;  1UWX A;  1XLO A;  2QSD A;  1JML A;  2AX5 A;  2V0G A;  4RF1 A;  3VQI A;  4KGS A;  3V05 A;  4CQN A;  1K53 A;  5HFY A;  1HEZ E;  2LUM A;  3LYY A;  3EUB 2;  1NVI D;  2M19 A;  3Q8B A;  4JWU C;  3SFD B;  3AED B;  4ZHP A;  4RF0 A;  2GB1 A;  1ACC A;  3AH7 A;  4WH4 A;  4ZOH C;  4USA A;  2GRI A;  1PDX A;  1RFK A;  1VR9 A;  1N5W A;  1Y56 A;  2ZW1 A;  3NS1 A;  4YTN B;  2J42 A;  5BYS A;  4AS1 A;  3FC4 A;  2K9X A;  2FBW B;  2R61 A;  1SJH D;  3AEB B;  2EEL A;  2N0S B;  1KF6 B;  1MPE A;  1YMH E;  1R7S A;  2G9H D;  3NVZ A;  1C78 A;  2DLB A;  1PGA A;  1HQR D;  2DWQ A;  3BK1 A;  1ZUD 2;  3CIR B;  4C7Y A;  1T5X D;  3BVZ A;  4ZRP A;  1WRI A;  2LGI A;  3IT4 B;  1L6V A;  3P63 A;  1V1P B;  4KX6 B;  3PO0 A;  1FMA D;  4DXF A;  2Y5C A;  4B0M A;  5T8I A;  4REZ A;  4YSZ B;  1WGK A;  1IBX B;  2J53 A;  1VZ8 A;  2WLB A;  1GB4 A;  2SEB D;  3MC0 B;  3AB5 A;  3E9S A;  2WU2 B;  3ZGZ A;  1D5M C;  1FFV A;  3CWI A;  1JAL A;  3KLS X;  1A70 A;  2BS2 B;  3P1M A;  1I4Q A;  3IAS 1;  2J52 A;  2RDH A;  2K22 A;  1WSP A;  2WXR A;  2K3U A;  1JRO A;  4RNA A;  2LHD A;  1IGD A;  3BII D;  1T3Q A;  1SIJ A;  3HVD A;  3NZ3 A;  1D5Z C;  1F2R C;  1OQR A;  1QKZ A;  4YSX B;  3IXS A;  3LB8 C;  3ZQ4 A;  1FNV A;  1I4P A;  1UUP A;  2PW9 A;  5HG2 A;  1D4B A;  1YN3 A;  1QF6 A;  4YTP B;  3AEE B;  2VZK B;  3BZD B;  3VRB B;  1GPX A;  2G1E A;  5LNK 1;  2QJL A;  2PLP A;  5BYQ A;  1M4V A;  2KN4 A;  4LLG M;  4PT5 A;  4RFB A;  1EWY C;  1V8C A;  1VJK A;  1L6U A;  1KLG D;  1ZDX A;  1MHH E;  2IJ0 A;  1J7B A;  1KRH A;  5HHD G;  3I9V 1;  1FM0 D;  2PKO A;  4KGR A;  1YJI A;  2AQ2 B;  3MJ5 A;  1FD6 A;  4H2A A;  1SE2 A;  4XDC A;  1SEB D;  2MH7 A;  1ZDV A;  3BYY B;  4M0W A;  4OHJ A;  3RPF C;  4KKI A;  2XN9 C;  1QQR A;  4TMA B;  2K5P A;  2Y3A A;  1D6E C;  1FNU A;  3URY A;  1UWM A;  3ZJU A;  2W82 A;  4RH6 A;  3U2S C;  2PVO D;  2M56 B;  2BTE A;  2IPK D;  1PGX A;  2WXP A;  1E7P B;  1MHX A;  4YXD B;  2JYE A;  1TY2 A;  2I38 A;  1C9F A;  1SSN A;  1QIL A;  1N60 A;  3U7Z A;  1SJE D;  3TEY A;  3BWU D;  1V1P A;  4GDL B;  3SEB A;  3R2I A;  1IBX A;  4LTU A;  2V3P A;  4UDU C;  1I4X A;  1WXQ A;  3BK2 A;  4ARC A;  3FIL B;  3B9J A;  3WCQ A;  1HA5 A;  1N63 A;  3SFE B;  1B9R A;  3NVW A;  3BYT B;  3TEX A;  1E9M A;  2WXM A;  1E0Z A;  4XDD A;  4Q2J A;  2ZW0 A;  1C77 A;  1SF0 A;  2KDM A;  2IDY A;  2IGD A;  1QOG A;  2KMM A;  1YJJ A;  3Q8E A;  5HI1 A;  4L23 A;  1KFY B;  2KAC A;  4RGT A;  3MHZ A;  2RDG A;  1QOA A;  1FCC C;  4N58 A;  1DOX A;  3TEW A;  1F2R I;  1PUT A;  1FXA A;  1PGB A;  2JZP A;  3P4R B;  2KWD A;  2WXH A;  4P16 A;  2CJN A;  2WXJ A;  4MH8 A;  5MPO A;  4FXC A;  3VRA B;  4A6Q A;  1SXT A;  4EE2 A;  2FE8 A;  3NUH B;  2WP9 B;  1N5X A;  3TEZ A;  1N62 A;  1PYW D;  1VLB A;  4US9 A;  4RGO S;  4WWM A;  4IKG A;  4RCO A;  1DOY A;  2WXF A;  5JXV A;  3P4Q B;  2XNA C;  4MT5 A;  1FO4 A;  1STE A;  3B2F A;  1TJE A;  4WQM A;  4L1B A;  1FEH A;  1TS5 A;  2BYT A;  5FK9 C;  1PFD A;  2SAK A;  1JCK B;  1WYG A;  2OHF A;  3J9C A;  2I2Y A;  1MVK A;  1V1O A;  2LEK A;  2QMT A;  5D7G A;  3E56 A;  1C79 A;  1QLB B;  1XO3 A;  1AW7 A;  4HRS A;  2BB6 A;  3Q8A A;  1GOZ A;  3PZ8 A;  4US8 A;  1C4C A;  3NRZ A;  1JWA D;  2NTT A;  4TQ0 A;  2PMV A;  1FIQ A;  5EE1 A;  4C56 C;  3AEF B;  4GLS C;  1JWM D;  4JX1 C;  4A8X C;  5H92 C;  3U4E G;  4DQO C;  2H89 B;  2AQ3 B;  3Q8F A;  3BVM A;  2BS4 B;  2L52 A;  1KTK A;  3AE4 B;  3ZJV A;  1I4G A;  1XLP A;  2WXI A;  2INP E;  3IT6 B;  2JXT A;  2ONQ A;  1NEN B;  1P7E A;  1K50 A;  5D3I B;  3VR8 B;  1IUE A;  1N61 A;  3Q8C A;  1SBB B;  4MM3 B;  5TSS A;  1CZP A;  1MI0 A;  2HDE A;  4NZL B;  4YWG G;  4AQ7 A;  3P4P B;  4TSS A;  4L2Y A;  2NTS A;  3GB1 A;  1RM6 C;  4HKZ E;  1FRD A;  3UI3 A;  2BW2 A;  2WQY B;  1AN8 A;  1DOI A;  2DYO A;  1XEE A;  2JQR B;  3AE7 B;  2KAJ A;  5BMI A;  1J7C A;  1HXY D;  3R8B A;  3HVZ A;  1TKE A;  3BVG A;  5GXG B;  2KQ4 X;  1OFF A;  2V4I B;  3NVV A;  2Y5P A;  1CQV A;  1ESF A;  2JWU A;  3U52 E;  5AUK A;  4OZA A;  4IDI A;  1FXI A;  1E6E B;  2PIA A;  2JU6 X;  2QEJ C;  3AE8 B;  2RMM A;  2W3R A;  1K52 A;  3T3O A;  5D3D A;  2L83 A;  3NVY A;  1KH0 A;  1NYR A;  5EE3 A;  1NI3 A;  1TY0 A;  4B0E A;  2M0A A;  3GP7 A;  1XLN A;  4P6V F;  5E6J A;  2WS3 B;  2WXO A;  1TKG A;  5C2T B;  3ABV B;  1C4A A;  4MAC A;  3IAM 1;  1KLU D;  3Q69 A;  3C8Y A;  1Q10 A;  3DWM A;  2L1A A;  1TS4 A;  2E6X A;  2WXQ A;  4ARI A;  2TSS A;  2PTL A;  2DYM A;  1SB3 C;  5H8Y E;  2MJD A;  2W55 A;  2FUG 1;  5I4D A;  1RWS A;  3B2G A;  3H8H A;  4HKQ A;  1T6B X;  4NJC A;  1ET6 A;  2OED A;  3P42 A;  1FCL A;  2ICI A;  2WXG A;  3AV8 A;  3FAH A;  4LK0 M;  2K0P A;  2MJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...