2NPTB

Crystal structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (map2k5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (map3k2-phox)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
82
structure length
82
Chain Sequence
NDVRVKFEHRGEKRILQFPRPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLVING
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 5
publication title Crystal Structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (MAP2K5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (MAP3K2-phox)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 21
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2nptB01
3R3MA 4GDLA 4YL8A 4G3XB 3DDCB 3ZIMA 1LQBA 3EC8A 2QHOA 2BYEA 4FJYA 4I6LB 4MDKE 3K9PB 2K1FA 5E6PA 1EO6A 4ANWA 2KKCA 4CO7A 2JWZA 1WGDA 2KO3A 1R4MI 4GOCA 4JQWC 2WYQA 3VAWA 3RT3B 4HWIB 3DVNV 3KW5B 4JIOU 2IBIB 3QA8A 3ZNGC 2LVQA 1V49A 2J7QB 1YJ1A 4GN1A 3H7SA 4II2B 4DBGA 3PLVA 1WY8A 2V3SA 5AEKB 1V5TA 1WGRA 2BKFA 4IWPA 3PSEB 3U30A 4DHZB 2IY1B 3M62B 4GDKA 2ZJDA 3DVGX 1WFYA 3IG3A 2Z0EB 5G2NA 1WR1A 2KQSA 2WX1A 3VDZA 2WWZA 4NJ6A 3ZRCA 2G4SA 4W9LA 2DENB 3P2BA 2RPQA 2VRRB 4MGIE 1GC6A 1H4RA 4K1RB 4DHJD 4RMAA 3R7QA 3U7DA 3CMMB 2ZCCA 3PS6A 4NY0A 4E3CA 2BKRB 2KK8A 1I42A 2MWSB 3ZUNA 2C7HA 2HE7A 2EMSA 2NPTB 4EUTA 4MEMA 2UYZB 1V2YA 3TCAA 4TV3A 2GBRA 4TKNA 3A33B 4WWOA 4F1SA 1WMHB 2FIDA 1V9JA 1WIAA 4FLHA 5JHBA 2JF5A 2C7NB 1HE8A 2JZ3B 4IM2A 3RCZA 4X57B 4GIVA 1SIFA 2KX0A 2MW5A 3EFUA 2ZNVB 4W9IA 2KC2A 3TMPB 3IBEA 2B3AA 3WAPA 2DZIA 2FCQA 2LRWA 3DBRI 2J0MA 3L54A 3MHSD 1R4NI 1WXSA 4GSWA 2MCNB 4TQ0A 5JHAA 1XD3B 2AYOB 2KC1A 3L13A 3H7PB 2JXXA 3V60A 3R66C 1WXVA 3ZDTA 2KJHB 4FN2A 4EFOA 4WWNA 2XK5B 4CYEA 3SHQA 4KSKC 2OOBB 4XX5A 5C23A 4FJZA 1GUAB 3I3TB 2G3QB 1C3TA 2HTHA 3PRZA 2ASQA 1S3SG 3A9JB 2KWVB 4HPMB 3ZLZA 1WE7A 3B1LX 5KHOA 4B9KA 4EZKA 4W9CA 2N4FA 5TR5A 5E6OA 1EF1A 2O6VB 4IM3A 2JRHA 1OEYJ 2LVOA 3H1UA 3NZSA 4GXBA 1TBEA 2ZPYA 2KTRB 3CSTA 3VFKA 2LVPA 2IZVB 4BBNF 2MP2A 4WWPA 3CSFA 1X1MA 4DK5A 1Q5WB 1V6EA 2DYOA 2KDIA 1WJ4A 2G4DB 3DBHI 1UGMA 4IC7B 4PS8A 2DYBA 2GOWA 4W9HA 3WIMA 4EZLA 1WYWB 4LJOB 3ZKJC 5J18A 2KLGA 3PZDA 2G45B 4BVUC 1E8WA 3PHWB 2BWES 2DX5B 4PYUA 4HCNB 3VUWA 3UQBA 2V4LA 2MBQA 3IFWB 5E6NA 4AOFA 2CS4A 4KDIC 2HJ8A 3W1SC 2L8JA 1E8YA 4I6NB 2R2QA 4XC2A 5GMVA 3HM3A 2ZCBA 3AXCA 4ANUA 4EOYA 4EEWA 1WF9A 2MBBB 2NR2A 4GDKB 3QHTA 3JW0X 3AU4A 3Q3FA 5KHQA 2LWPA 4DDID 1E7UA 3RUIB 2GBKA 3HHMA 4ZRIA 1ZKHA 3KYDD 2RGFA 2N1VA 2V1YA 3A9KA 2YVCA 3APFA 3H9DA 1LFDA 3ECIA 2AWTA 3ZW3A 4W9KA 2L0TA 3VHTC 1YIWA 3EHVA 2O2VB 2CKHB 3RZFA 4MM3A 5AZHA 2Z59B 2KWCA 1E90A 1WX7A 3OAWA 3UQAA 4NQKE 2M0XA 2K8HA 1TGZB 4BBNC 4XZ4A 2Z0DB 3PPAA 3QAQA 3DQVA 1WXAA 5DPRA 3DBSA 3H6NA 1EUVB 4CHKA 3U8ZA 3V62A 3N3KB 1TZ1A 1L7YA 4EZJA 5LXHA 4MJSB 2LUEA 4IWOA 3TIXA 1GC7A 4ASWC 4AJYB 4AP4C 5D94A 4BOZB 3UF8A 2LD9A 1WI0A 4W9JA 4NAWA 2MBEA 2YLMA 3A1QA 4AJWA 1OEYA 2LI5A 4RM9A 3B0AA 2XBBC 3N32A 4IM0A 2JVCA 2L76A 5FR6A 1WE6A 5AZGA 2KXJA 4B6WA 1WZ0A 1F9JA 2M1MA 1IP9A 2UWQA 1RAXA 4F8CB 1E5WA 3DOWA 1OGWA 4HJKA 2C5LC 1CMXB 2MX2A 4K7WA 1J19A 3WANA 2GBJA 3JVZX 1L2NA 3NHEB 2KX3A 4W9GA 4HLEA 3KH0A 4WJNA 4KZ0A 3HM6X 1IPGA 3JSVB 3PRPB 4M0WB 1LM8B 2KZRA 5BO4B 5CHVC 3LJ3A 4KZCA 1WGGA 4WJOA 3SD5A 4LCDE 2JY6A 4GGQA 1WGHA 2N1WA 3K9OB 3X0WA 4DHJB 3T8MA 1P0RA 5IA7A 4NJ7A 1RLFA 4HCPB 5G55A 3L16A 4IW0A 2K6QA 3BY4B 2OJRA 2PE6B 2AL6A 4KDLB 4OVVA 2ZZPB 4AWJA 2KDEB 5JH5C 2LGDA 4TQ1A 4P7IA 2KJRA 2IO0B 1V80A 1JRUA 1WJUA 2AL3A 2L0FA 3ML9A 1WX9A 4LDTB 1LXDA 1FXTB 1PQSA 4K7UA 1SGHA 2ZNVC 5D6JB 2CU1A 1QZEA 4ZDVA 3MJWA 2A4ZA 2DAFA 2DZJA 1UELA 3VH4B 1GJZA 1YD8U 2KFKA 2NBWB 4B95A 2REXA 1UH6A 2C60A 4WQOB 1M94A 1WM3A 3ALBA 1E7VA 2NPTA 3PGEA 1T0YA 4PS7A 1Z2MA 4KIKA 2FIFA 3WA0A 5HKHA 2MA9B 3EECA 1WGYA 3PREA 4N9F4 1WMHA 2AEHA 2WX0A 1P9DU 2CR5A 2JZZA 4GDLB 2M4NA 2KOXA 3A9KB 4NNJB 3L17A 1XQQA 3IVFA 5JZEB 4IUMB 4A3OA 2DZMA 5D7GA 1J0GA 2NBUA 4ICVA 4W9DA 2FNJB 3QIJA 1J8CA 3D32A 2IYDB 4BKTA 3ZNHB 1VD2A 3SU8X 3VTVA 2LJ5A 1NBFC 4MELA 1OQYA 4BFRA 3VUYA 2RR9A 3DVNU 2KQ7A 2FCMA 3QCAA 2KFJA 4ANVA 4FADA 2MRPA 2CHZA 1WR6E 2MLBA 2RSUA 4NQLB 5J2RA 2R2OA 1MG8A 3DVGY 3X23A 4G0NB 4MGKE 3OJ3A 4HDQA 5DPWA 4NAWB 2LGYA 1AARA 2LGXA 3UINB 3ZO5B 2FUHB 3PRMB 4DDGD 2KHWB 4W9FA 3PHXB 1GNUA 1RRBA 4MGYE 4HPLB 1ZW7A 1TTNA 1YX5B 3RD2A 3DBLI 3ZTCA 2K39A 3WAOA 2L7RA 3QC8B 2J0JA 2L00B 4DXAB 3WAMA 3RULA 1VCBA 3S2AA 3VXWA 2N7EA 1UD7A 3Q3JA 4HK2A 4IWQA 1S1QB 3L0WB 1NI2A 1U4AA 2PJHA 3HIZA 3KYCD 5CX3A 3TL5A 4A3PA 4FA6A 2CHXA 1WXMA 2KTFA 3ZTDA 2FCSA 1UBQA 4G11A 3M63B 1WZ3A 1Q1OA 3HK0A 3AU5A 3OJ4B 3N30A 3TBLD 2KD0A 2NCNA 4ANXA 2D2QA 3PTFC 3V61A 4OVUA 2ZVOA 2A5UA 1P98A 1UZXB 2ZEQA 2D3GA 2BYFA 3ML8A 4GMVA 2JPHA 2FCNA 1WH3A 4GB9A 2C9WB 1KLVA 1P3QU 4MSMB 2KN5A 1YX6B 3SDLC 1H8CA 2I1KA 2PE9A 2K8CA 2KANA 2M17A 2NVUI 2KNBA 2GBNA 4URKA 1KM7A 4JGHB 2MSED 3DCGA 2BGFA 3APDA 2LXCA 4JL9A 1ZGUB 1WM2A 4DWFA 5LXIB 4BKSD 4HDOA 1SE9A 3NY5A 1Y8RC 3MTNB 3VTWA 1WRDB 3W1YA 2IO2B 4ZYNA 3L10B 5CHFA 3QJZA 5CTRC 5L83A 4F7ZA 2D07B 4WAAA 3M95A 2K6DB 3C0RB 5DCNA 2KFKB 3AI5A 2MBHA 5DPTA 2EKEC 2I1JA 2KDBA 3UIPB 2JRIB 2O2VA 4II3B 2XEWA 2PEAA 4WJQA 1OTRB 4G50A 2KDFB 4KVGB 2MP2B 2DZKA 2KMCA 2IO1B 4KIKB 4M8NA 3QK0A 3VUXA 3ZRFA 3L08A 4FHJA 5CHWA 4A20A 3UIOB 3KUCB 4FULA 4E74A 3QX1A 4FHKA 1D3ZA 2RD0A 1Z5SB 3A4SC 2BPSA 4LDTD 2K25A 2N9XA 3AULA 3PVLA 2M8SA 4JLCA 4LJPB 4MJSA 4ZRJA 2BF8B 4WJPA 3GOEA 2ZVNA 2O6VD 4MSQB 5IAAC 4FBJB 3DPDA 3TJPA 3T9LA 2JUOA 2DHZA 2L05A 1WX8A 4I6PA 4ZRKA 4KV2A 3M3JA 2N9EB 2GBMA 3GZNI 4AUQC 3OLMD 2N9PC 1ISNA 3PLUA 2IO3B 4E71A 3LDZE 2EMTA 1E8ZA 2NS5A 4HXDA 4W9EA 4J6IA 2Y5BB 1P1AA 1V81A 4ICUA 2K8BA 1UBIA 2CHWA 2KJ6A 3PT2B 1RFAA 2KWUB 5DPSA 3VTUA 3KVFB 2W9NA 3ZVVA 3QWZB 2J0KA 3V6EB 5C1ZA 1KJTA 4BKSA 3JYUA 4BOSC 2L3ZA 3JSVA 4EKUA 3NZUA 1Q0WB 3NOBA 2KLCA 2BWFA 2LZ6A 5LLIA 1NDDA 3VH3B 1XT9B 2D11A 1YQBA 2C7MB 3RZWC 1A5RA 1IYFA 4BKGA 2DAJA 2KMAA 3H7PA 1BT0A 3R7RA 2WDTB 1E8XA 1KOTA 3BINA 3KUZA 1WJ6A 2XK5A 4IG7B 5L95C 4K7SA 4MGZE 1K8RB 1EF5A 3CF6E 3ENEA 1C1YB 4MH0E 3ZDMC 3QARA 3APCA 3RYTA 3O65B 3ONSA 3A1QB 4M8MA 3IHPC 4TUUA 4HVBA 4GU2A 3A9JA 2DYMA 2JT4B 1I35A 2MQJA 3NS8A 4FJVB 3W1SA 2LXAA 2D10A 2FAZA 4K81A 2NBVB 3VVWB 5J17A 1GG3A 2O6VA 3A4RA 2GMIC 4NPNA 3ZNZB 1WJNA 1V5OA 2IY0B 2KVRA 2ZPNA 5D2MB 3KUDB 2LASA 1G6JA 2KTRA 2PPHA 3V6CB 4KSLC 4PYZA 2MBOA 2LRUA 4RM8A 5EDSA 3ZNID 4PS3A 2BYVE 2N7DA 3B08A 5AZFA 3VQIA 1V86A 2HD5B 4DHZE 3QQ8B 3UGBB 3PV1A 3WALA
chains in the Genus database with same CATH superfamily
3ZIMA 1SJED 5FKAC 2XN9C 2KQ4X 4YSZB 3ZXVA 3CIRB 5E6PA 1EO6A 1KFYB 1IGDA 1F1HA 4CO7A 1WXQA 2KO3A 4GOCA 4GLSC 3DVNV 3KW5B 4A55A 2LVQA 1V49A 4II2B 3H7SA 4DBGA 2KT7A 4IWPA 1WGRA 3U30A 3PSEB 2IY1B 3M62B 4GDKA 1QQRA 2ZJDA 2SEBD 1VDVA 2WX1A 3ZRCA 4W9LA 3KWLA 1H4RA 1FCLA 3B2GA 5LNK1 2KK8A 4NAMA 2MWSB 1L4ZB 2C7HA 2HE7A 2EMSA 4EUTA 2MJDA 5JHBA 2JF5A 4IM2A 4YTPB 4X57B 1SIFA 2KX0A 2ZNVB 2KC2A 1SB3C 5BYRA 4WIPA 2R61A 2B3AA 2AQ2B 2LRWA 2WHIA 2WXRA 3L54A 2N9LA 3MHSD 2MCNB 5D3DA 2AYOB 3J9CA 1IUEA 3BK2A 3H7PB 2JXXA 2ZW1A 3OWEB 3R66C 5E6JA 1MI0A 3RNFC 4WWNA 4KSKC 4LNKA 3MC0B 5C23A 4FJZA 3RFZB 1VRAB 3I3TB 2G3QB 2DWQA 3ETRA 2ASQA 4HPMB 1WE7A 3B1LX 1XLQA 5E6OA 1EF1A 4IM3A 2LVOA 3H1UA 1CK1A 2BS3B 1FRDA 1FMAD 3CSFA 4DK5A 2XNAC 1ACCA 1WJ4A 3DBHI 1UGMA 4W9HA 2H89B 1WYWB 2KLGA 4BVUC 2G45B 5GXGB 2JZPA 2BWES 4PYUA 1TKEA 2EELA 1FRRA 3IFWB 1WSPA 4AOFA 2HJ8A 2J52A 3Q3NC 1YN3A 2R2QA 4XC2A 3DWGC 4US9A 3HM3A 4ANUA 4XWWA 1WF9A 3AU4A 3EA6A 3RUIB 3HHMA 1ZKHA 1WWTA 2V1YA 3A9KA 4ZYSA 3OG5A 4W9KA 4ZRPA 5IKCM 2L0TA 3VHTC 1YIWA 3EHVA 1EWCA 2CKHB 3DWMA 2WXQA 1K53A 4IOIE 2K8HA 3QAQA 3H6NA 1EUVB 4CHKA 3V62A 2BQQA 3N3KB 4MACA 4EZJA 2LUEA 3RPFC 4IWOA 2JYEA 5I4DA 4AP4C 4JWSC 1WI0A 4W9JA 4AJWA 2YLMA 3A1QA 4CQNA 4OZBA 3B0AA 2J4XA 3N32A 2KMMA 3P42A 4JPSA 2KXJA 1TKYA 1QOFA 2M1MA 1IP9A 2UWQA 2W82A 1VZ7A 4HJKA 1CMXB 4K7WA 1L2NA 2KX3A 1E10A 3MC8A 4KZ0A 3HM6X 5CHVC 4YTNB 4P6VF 1WGGA 1C4CA 3K9OB 3X0WA 2WXPA 5G55A 3BY4B 2OJRA 2PE6B 2K0PA 5JH5C 3FILA 4ZRQA 1QLBB 2LGIA 2ACZB 5JXVA 4LDTB 1XO3A 2I2YA 5T8IA 1YD8U 2NBWB 2REXA 2C60A 4WQOB 1JWAD 1E7VA 5MPOA 1T0YA 2Y3AA 3WA0A 3EECA 1WGYA 1SIJA 4N9F4 1WMHA 2AEHA 2WX0A 3T3OA 4GDLB 2KOXA 2I38A 5IOIA 5D7GA 1J7BA 4ICVA 4W9DA 2L52A 3ZNHB 1QOBA 1JWMD 1NBFC 1OQYA 5FK9C 3BIID 2FCMA 1B9RA 2MRPA 2CHZA 2RSUA 4OZAA 1MG8A 3DVGY 4G0NB 1ET6A 2W55A 2WDQB 4WQMA 2KHWB 1FFVA 2HJ1A 3WAOA 2JXTA 1GB4A 3RULA 2PW9A 3L0WB 3R2IA 1NI2A 3MJ5A 4A3PA 2CHXA 2KTFA 5EE9A 3ZTDA 1UBQA 3C8YA 2CJNA 3TUOA 4LK0M 4A9AA 2KD0A 2BW2A 5EE1A 2ZVOA 1P98A 2ZEQA 2BYFA 1WH3A 1KLVA 2C9WB 3WCQA 4C56C 4MH8A 2NVUI 1JQ4A 2K3UA 4URKA 1ZGUB 4BKSD 4HDOA 3NY5A 3RNGC 2INCC 3L10B 4OZCA 4WAAA 1YN5A 3AI5A 2EKEC 4WJQA 2XEWA 1OTRB 2KDFB 2MP2B 4LLGM 3VUXA 4FHJA 3UIOB 3IT4B 1PUTA 3IT6B 1EU4A 2BPSA 2N9XA 5EE0A 2Z8LA 3AULA 1PFDA 2M8SA 5IO9A 1JALA 1QOGA 4ZHOA 2ICIA 3TJPA 3T9LA 2OHFA 1WX8A 3M3JA 1CQVA 3Q3OC 3GZNI 1P1AA 3PO0A 4ICUA 2CHWA 5DPSA 3ABVB 2WDRB 2WXLA 3KVFB 4YWGG 1XLPA 2QIEB 3QWZB 2J0KA 2BB5A 4BKSA 3JYUA 4BOSC 2L3ZA 3BVZA 4M0WA 4EKUA 1TS2A 1F52A 2D11A 1YQBA 3TEWA 4RGTA 3R7RA 1AYFA 2WDTB 3V3XA 4IG7B 1SE3A 4ZHPA 3ENEA 4MH0E 3APCA 3N1YC 3SFDB 1E7PB 4M8MA 4GU2A 4FJVB 2L1AA 3ZNZB 2IY0B 2ZPNA 4KKIA 2KTRA 2PPHA 1V1PB 4KSLC 4PYZA 1L4DB 1NYQA 2MBOA 3GE3C 3R3MA 1Q10A 4YL8A 3DDCB 4WWMA 1RWSA 4C4VB 1IBXB 1JW9D 2PLPA 2K1FA 4LNNA 2WP9B 4ANWA 1R4MI 4HWIB 4KGTA 5D3IB 2IBIB 3QA8A 3H8HA 1YJ1A 2BYTA 2GB1A 2V3SA 5AEKB 2BKFA 2KVZA 3BVMA 3DVGX 2Z0EB 5G2NA 2KQSA 2DENB 2RPQA 3AE2B 2VRRB 4MGIE 1GC6A 1JROA 3Q69A 4S0RA 1F0ZA 3AECB 4RMAA 3PS6A 1I42A 2Q5WD 2NPTB 1SF0A 3NVZA 4MEMA 2UYZB 1TS3A 1ZDVA 3AN1A 4TV3A 3TCAA 3A33B 4WWOA 1C79A 1V9JA 2QJLA 1KLUD 1HE8A 2JZ3B 4GIVA 3IXSA 4S17A 2MW5A 1FNVA 1YOVB 3IBEA 5HFYA 2MHJA 1QKZA 1R4NI 1WXSA 4GSWA 1WGKA 2KWDA 1XD3B 4USAA 3W9CB 3NJTA 3V60A 2KJHB 3U2SC 1YNTE 2XK5B 3SHQA 5G5GA 1LO5D 3ZJVA 4YSYB 4RGNA 4RCOA 1HZ6A 1C78A 3C19A 3A9JB 2KWVB 3AE9B 4HRSA 5TR5A 1FM0D 2O6VB 2JYTA 1UNSA 4GXBA 4LNFA 3VFKA 3AEGB 4BBNF 3MFGA 3KQ4A 1GOZA 5IP4D 1I7HA 1V6EA 2DYOA 3AE5B 4IC7B 4AQ7A 3I9V1 4A6QA 2GOWA 3T3NA 4LJOB 3O13A 5J18A 1NENB 3VUWA 3GP7A 2QDFA 3HVDA 2CS4A 2VZKD 4RF0A 1E8YA 4H2AA 2M0AA 5GMVA 2QILA 2ZCBA 4EOYA 2VH1A 4EEWA 2MBBB 4GDKB 1E7UA 3AEDB 5H8YE 1BMLC 4HKQA 4ZRIA 3NZ3A 2J53A 2N1VA 3EFCA 2YVCA 4B0MA 3ECIA 3BWUD 4KKJA 2O2VB 3NVVA 1DOXA 4MM3A 1QILA 2OJWA 1QT9A 1D5ZC 2KWCA 2V4IB 1A70A 1WX7A 3OAWA 2M0XA 4HROA 2GRIA 1GAQB 3DQVA 1WXAA 3DBSA 1L7YA 1PDXA 1PGBA 4C00A 1GC7A 4ASWC 2LD9A 2QCZA 1L0VB 2RPVA 2L76A 5FR6A 3RN9C 3I63C 2M19A 4B6WA 4XDDA 1F9JA 2J42A 1J19A 4P1CC 4HLEA 3KH0A 1KLGD 3PZ7A 1D6EC 1VR9A 3LJ3A 1Y56A 4KZCA 3BZDB 2WXFA 3SD5A 2JY6A 1P0RA 5AUKA 1HXYD 4HCPB 3L16A 4A90A 2DBYA 1XF5L 2AL6A 5HG2A 4TQ1A 2KJRA 1N63A 3AB5A 2ON8A 1XXGA 2AL3A 1WX9A 2UU7A 1YJJA 1ESFA 1PQSA 2BB6A 5D6JB 4ZDVA 2CU1A 3UI3A 2KYWA 2A4ZA 2DZJA 1TS5A 2E3TA 2PMVA 3NVWA 1M94A 1WM3A 3ALBA 1HEZE 3L4PA 3PGEA 1JWUD 1Z2MA 3N9YC 4KIKA 3VR9B 3PREA 1P9DU 2M4NA 3A9KB 5BMGA 4NNJB 3L17A 2HTME 1I4PA 4A3OA 2NBUA 3BYTB 1J8CA 1JMLA 3D32A 3GZNB 1VD2A 1AW7A 3LB8C 4MELA 2RR9A 3ZYYX 1TJEA 3DVNU 2INDC 3QCAA 1PGAA 3AE7B 2MLBA 5J2RA 2R2OA 3X23A 2LEKA 5DPWA 2LGYA 1AARA 3UINB 2FUHB 4OVZA 2AX5A 1L5PA 3LYYA 1V97A 2QC8A 5C3JB 4L1BA 2N7EA 4US8A 1NI3A 3Q3JA 5CX3A 1T3QA 4EE2A 2WXGA 3EGRA 2FCSA 4IKGA 4A8XC 3M63B 1WZ3A 1Q1OA 3NUHB 3TEYA 3V61A 2M56B 4GMVA 2A5UA 1UZXB 2MH7A 2D3GA 3ML8A 1HQRD 2JPHA 1P3QU 1YX6B 2PE9A 2WDVB 2KANA 3FILB 2KNBA 4ACFA 4JGHB 1NVID 3Q3MC 4N58A 1YQ3B 3DCGA 2LXCA 4DWFA 3SEBA 3VTWA 3W1YA 2IO2B 3QJZA 1EWYC 5CTRC 5L83A 1R4MB 4F7ZA 3M95A 5DCNA 1D5MC 2KDBA 1STEA 2PEAA 4G50A 4KVGB 4B0EA 4M8NA 2RMMA 2WXKA 2RDBC 4M00A 1XLNA 2OEDA 1Z5SB 4LDTD 3DHHC 4LJPB 4JLCA 2Y5CA 1BUIC 3EUB2 3DPDA 1IGCA 1D5XC 2QMTA 3I5JC 4I6PA 2L05A 1HTOA 2GBMA 2KACA 4HPPA 1ISNA 1MPEA 2D3CA 4HXDA 3GS2A 4J6IA 2Y5BB 1V81A 2KJ6A 2W9NA 3ZVVA 3P4SB 4DXGA 1FO4A 5C1ZA 1R4NB 3RNAC 1C4AA 1Q0WB 2WXIA 5LLIA 3VH3B 3AE8B 4RGMA 1A5RA 4BKGA 1OQRA 2DAJA 1P7FA 4BAXA 4RFBA 3KUZA 5L95C 4MGZE 2EKIA 3Q2AC 3TSSA 3CF6E 3ZDMC 3QARA 3O65B 4MT5A 1N61A 2WU2B 2DYMA 3N1ZC 1I35A 3NS8A 2D10A 4K81A 2GMIC 4RH6A 5D2MB 1G6JA 5BYSA 2LASA 3V6CB 1CZPA 2VH2A 2X38A 3HUIA 4PS3A 5AZFA 2N7DA 2HD5B 3SR6A 2LGSA 5C2TB 3WALA 4GDLA 4G3XB 1LQBA 2QHOA 4I6LB 4MDKE 2KKCA 4HJGE 1TY0A 1WGDA 1N60A 1SSNA 2LMCA 2N9KA 4JQWC 2WYQA 1T5XD 3P4PB 3VAWA 3RT3B 3ZNGC 1ENFA 3IAM1 3P63A 2J7QB 1WY8A 1J0GA 4DQOC 2YEPF 2WXMA 1J7CA 3VDZA 2PTLA 4NJ6A 2N7JA 5EE3A 1V1OA 2WNMA 3DHGC 4K1RB 4DHJD 3U7DA 3CMMB 1DOYA 2NTTA 4NY0A 4XWTA 2BKRB 5H92C 4WURA 2GBRA 4TKNA 1NEKB 2FIDA 4FLHA 2YEPB 3RCZA 2SAKA 3WAPA 2DZIA 2FCQA 2INPE 4AS1A 2J0MA 4TQ0A 4WH4A 1UWMA 1EU3A 2JWUA 3L13A 1ZXHA 2PVOD 3ZDTA 4EFOA 4YT0B 1F2RC 4CYEA 2OOBB 2WXOA 4XX5A 3R2TA 1GUAB 3SFEB 1C3TA 2HTHA 3N1XC 3PRZA 1PYWD 2WU5B 1S3SG 2DLBA 5KHOA 4W9CA 1OEYJ 3R8BA 1TBEA 4Q2JA 2ZPYA 2KTRB 2LVPA 2IZVB 2MP2A 2AQ3B 3Q8FA 4R3DA 4N59A 4PS8A 1OQQA 2G4DB 2FBWB 2DYBA 2IGHA 4EZLA 3ZKJC 1K50A 1N5WA 3PHWB 2DX5B 2K22A 4K3BA 5FR3A 2V4LA 3Q6BA 4KDIC 2G9HD 2BBCA 2L8JA 2GI9A 2WGSA 3AXCA 5TSSA 1SEBD 3QHTA 3JW0X 3Q3FA 5KHQA 2LWPA 1ZUD2 1C4PA 2RGFA 4YSXB 3H9DA 1LFDA 3ZW3A 1T0QC 5AZHA 1J7AA 2LJIA 3UQAA 1N6ZA 2WXNA 4NQKE 3PPAA 1L6VA 5DPRA 1XCTL 1TZ1A 4J3OD 4MJSB 2KN4A 3P4RB 5D94A 3UF8A 3E9SA 4NAWA 2MBEA 2WXJA 1OEYA 2V3NA 4IM0A 2JVCA 4FXCA 1WE6A 1WZ0A 3HVZA 1RAXA 1E5WA 1CJEA 3DOWA 1OGWA 1DYQA 1SJHD 3WANA 3NHEB 1I4QA 4W9GA 4YTMB 2LUMA 3JSVB 3PRPB 5BO4B 1B1ZA 4GGQA 1WGHA 1C76A 3T8MA 5IA7A 1ZP0B 4IW0A 2H88B 2K6QA 3GE8C 5HI1A 2PKOA 4KDLB 4OVVA 4AWJA 2LGDA 3DHIC 1MHXA 3P1MA 4ZOHC 1JRUA 2IO0B 4XYCA 1LXDA 2LHEA 2QSDA 4K7UA 1QZEA 3MJWA 3VH4B 3P4QB 1GJZA 1KRHA 2KFKA 2V9HA 1UH6A 2IGDA 2NPTA 4PS7A 5HKHA 2FIFA 2MA9B 1TYGB 2JZZA 2CR5A 3IVFA 2WS3B 4IUMB 1GB1A 2DZMA 3Q8EA 3QIJA 4BKTA 4MM3B 3SU8X 3VTVA 1YQ4B 1DOIA 4O1NA 3VRAB 4BFRA 2KQ7A 1RYJA 2WQYB 4ANVA 4FADA 1WR6E 4NQLB 4MGKE 3OJ3A 4HDQA 2LGXA 1JWBD 4IDIA 3ZO5B 3PHXB 1GNUA 1RRBA 4HPLB 1ZW7A 1TTNA 2VZKB 3DBLI 2K39A 1T0RC 2L7RA 2J0JA 2L00B 4DXAB 3VXWA 1UD7A 4L2YA 4HK2A 4IWQA 1S1QB 3FKYA 3TL5A 1U4AA 2PJHA 3HIZA 3KYCD 4FA6A 2D3BA 1WXMA 4G11A 3AU5A 3OJ4B 3N30A 3TBLD 1FEHA 4ANXA 2D2QA 3TMPB 2FCNA 4MSMB 1HZ5A 1MJDA 3SDLC 3ZJUA 1FCCC 2M17A 3Q8BA 1FIQA 2ONQA 1KM7A 2BGFA 1ZOYB 4XGAB 1WM2A 2BVCA 1SE9A 2D5GA 1I4XA 4ZYNA 5CHFA 2K6DB 3C0RB 1HA5A 4TMAB 5AUIA 3W2DA 2MBHA 5DPTA 1RM6C 2JRIB 2O2VA 4OHJA 1R7SA 2MJ3A 2KMCA 4ITKA 3KWVA 4KIKB 3QK0A 4RGOS 3ZRFA 3L08A 4FULA 3QX1A 1D4BA 1D3ZA 2B76B 3A4SC 2K25A 3PVLA 4ZRJA 2BF8B 4WJPA 3U4EG 2LHDA 3RNBC 5IAAC 1FFUA 1UUPA 4KV2A 2N9EB 3OLMD 3PLUA 2IO3B 2EMTA 1JRPA 1E8ZA 2NS5A 4W9EA 3BK1A 1RFKA 3VTUA 1UBIA 3PT2B 1RFAA 4RF1A 3V6EB 2FUG1 1MHHE 3I57A 2LZ6A 1JCKB 4UDUC 1BXTA 2CU3A 3H7PA 2K9XA 1BT0A 1AWDA 3MHZA 3NG0A 3U52E 3BINA 2D3AA 1K8RB 2IDYA 4P16A 1WRIA 3RYTA 1MFWA 3A1QB 4TUUA 2JT4B 1UWXA 1TIFA 2MQJA 3VVWB 1QF6A 3A4RA 4NPNA 1V5OA 2V3PA 4N6EB 3TEZA 2LRUA 4RM8A 2W3RA 3ZNID 4ARIA 4D2KA 1UF0A 3QQ8B 3PV1A 2RDGA 1F77A 2NTSA 1TZOA 3EC8A 2BYEA 2NMQA 4FJYA 3K9PB 5IN7A 1ZPSA 2JWZA 1L0YB 2W54A 1OFFA 1FNUA 4JIOU 4HKZE 4GN1A 1L0XB 3PLVA 2L83A 1V5TA 4DHZB 1WFYA 2CJOA 3IG3A 1WR1A 2WWZA 2G4SA 4REZA 1FXAA 3P2BA 1XEEA 3R7QA 2E6XA 2ZCCA 4E3CA 1ROEA 3ZUNA 2V0GA 1I4HA 2KDMA 1V2YA 1K52A 4F1SA 1WMHB 1FXIA 2JU6X 1WIAA 2C7NB 3EFUA 1M4VA 4W9IA 3N20C 3DBRI 1XCQL 1SE2A 3AE3B 1VJKA 5JHAA 2W3SA 2KC1A 3AEAB 1UGJA 1WXVA 4FN2A 1K51A 3FC4A 4C7YA 3E56A 1I4GA 3KLSX 3ZLZA 4B9KA 3NRZA 3PZ8A 4EZKA 2N4FA 3AEFB 2ZW0A 2JRHA 3NZSA 3MP9A 3AE6B 3CSTA 4WWPA 1LGRA 1X1MA 1V8CA 1Q5WB 1ZXIA 2KDIA 3WIMA 4KX6B 3ZGZA 4LNIA 2K5PA 2INNE 3PZDA 1E8WA 4HCNB 1GPXA 3UQBA 2MBQA 1MG4A 5E6NA 4JX1C 3B2FA 3W1SC 4I6NB 1FD6A 2G1EA 2NR2A 1HTQA 4DDID 2GBKA 1P7EA 3KYDD 3W5VB 3NS1A 3APFA 2AWTA 3RZFA 3AH7A 3BVGA 2Z59B 1NYRA 1E90A 4XDCA 3LXFA 2KAJA 2BS4B 1TGZB 4BBNC 2JX5A 2FE8A 4XZ4A 2Z0DB 1F2RI 3U8ZA 3AMZA 4C7ZA 5LXHA 3TIXA 4AJYB 4BOZB 4M02A 3DBLB 1FNWA 3U7ZA 3HRDD 2LI5A 4RM9A 2XBBC 4LNOA 5AZGA 1WYGA 4F8CB 4NJCA 2C5LC 2MX2A 3RMKC 1ZE3D 3ZXRA 2GBJA 3JVZX 3BYYB 3Q8CA 1TKGA 1KH0A 4WJNA 1IPGA 1E9MA 3MC9A 4M0WB 1LM8B 1KTKA 2KZRA 1QOAA 3Q8AA 4KGSA 4WJOA 4LCDE 2N1WA 4JWUC 4DHJB 1L6UA 2WLBA 4NJ7A 3URYA 1C9FA 1RLFA 3AM9A 2ZZPB 2N0SB 2KDEB 4P7IA 1MVKA 3V05A 1V80A 2DNFA 1WJUA 2L0FA 3ML9A 4XE0A 4HEA1 1FXTB 1SGHA 2ZNVC 4PT5A 2DAFA 1UELA 4B95A 2BTEA 3IAS1 2JSVX 4C80A 1YJIA 1E0ZA 3RNCC 1I4RA 3FAHA 1XQQA 2AQ1B 5JZEB 2LFIA 4OW0A 1SBBB 2FNJB 2IYDB 4LTUA 3TEXA 2PVGC 2LJ5A 4ARCA 3VUYA 4TSSA 4K3CA 3AEBB 1XLOA 4QAYA 2KFJA 1TS4A 1C77A 5HHDG 2WXHA 3Q14C 2RDHA 1YN4A 4NAWB 4RNAA 4DDGD 3PRMB 5G5HA 4W9FA 3RI7C 2HDEA 3AEEB 3W5UB 4MGYE 1ZDXA 1YX5B 3RD2A 3ZTCA 3QC8B 3DBHB 3WAMA 1VCBA 3S2AA 1VLBA 3AE1B 3HK0A 2MEKA 2PIAA 2NCNA 3PTFC 2Y5PA 4OVUA 4L23A 1DGJA 4GB9A 2X8XX 1ET9A 3VR8B 2BS2B 3B9JA 2KN5A 4WAFA 1H8CA 2I1KA 2K8CA 3NVYA 2GBNA 1V1PA 2MSED 3APDA 4JL9A 1N62A 5LXIB 1Y8RC 3MTNB 2JQRB 1WRDB 3ZQ4A 3AV8A 4C4VA 2BT6A 1IBXA 2D07B 2L32A 2KFKB 1SE4A 4JE3B 2I1JA 3UIPB 4II3B 4PK1A 4P1BC 2DZKA 3AE4B 2IO1B 4E74A 5CHWA 4A20A 2QEJC 3KUCB 4FHKA 3VRBB 2RD0A 4YXDB 4MJSA 3GOEA 4NZLB 1SXTA 3ZJTA 1FPYA 2O6VD 2ZVNA 4MSQB 4FBJB 2JUOA 2DHZA 4ZRKA 1T0SC 5BYQA 2IJ0A 4AUQC 1VZ6A 2N9PC 4E71A 1TY2A 3LDZE 5BMIA 1JWSD 1YMHE 2K8BA 2KWUB 1AN8A 1VZ8A 3DBRB 3GB1A 1KJTA 3JSVA 2MJEA 3NZUA 3NOBA 2KLCA 2BWFA 4DXFA 1NDDA 1XT9B 3RZWC 2C7MB 1T6BX 1IYFA 2IPKD 3CWIA 2KMAA 3RNEC 1EM7A 1E8XA 1KOTA 1WJ6A 2XK5A 4M01A 4K7SA 1E6EB 1EF5A 5BMHA 1C1YB 2IGGA 1N5XA 3ONSA 3IHPC 4HVBA 2GLSA 3A9JA 4KGRA 3W1SA 2LXAA 2FAZA 2NBVB 5J17A 1GG3A 2O6VA 2TSSA 1WJNA 2KVRA 4BZAA 3KUDB 5EDSA 1KF6B 2BYVE 3B08A 3VQIA 1V86A 4DHZE 1TT5B 1PGXA 3UGBB
chains in the Genus database with same CATH topology
3R3MA 4GDLA 4YL8A 4G3XB 3DDCB 3ZIMA 1LQBA 3EC8A 2QHOA 2BYEA 4FJYA 4I6LB 4MDKE 3K9PB 2K1FA 5E6PA 1EO6A 4ANWA 2KKCA 4CO7A 2JWZA 1WGDA 2KO3A 1R4MI 4GOCA 4JQWC 2WYQA 3VAWA 3RT3B 4HWIB 3DVNV 3KW5B 4JIOU 2IBIB 3QA8A 3ZNGC 2LVQA 1V49A 2J7QB 1YJ1A 4GN1A 3H7SA 4II2B 4DBGA 3PLVA 1WY8A 2V3SA 5AEKB 1V5TA 1WGRA 2BKFA 4IWPA 3PSEB 3U30A 4DHZB 2IY1B 3M62B 4GDKA 2ZJDA 3DVGX 1WFYA 3IG3A 2Z0EB 5G2NA 1WR1A 2KQSA 2WX1A 3VDZA 2WWZA 4NJ6A 3ZRCA 2G4SA 4W9LA 2DENB 3P2BA 2RPQA 2VRRB 4MGIE 1GC6A 1H4RA 4K1RB 4DHJD 4RMAA 3R7QA 3U7DA 3CMMB 2ZCCA 3PS6A 4NY0A 4E3CA 2BKRB 2KK8A 1I42A 2MWSB 3ZUNA 2C7HA 2HE7A 2EMSA 2NPTB 4EUTA 4MEMA 2UYZB 1V2YA 3TCAA 4TV3A 2GBRA 4TKNA 3A33B 4WWOA 4F1SA 1WMHB 2FIDA 1V9JA 1WIAA 4FLHA 5JHBA 2JF5A 2C7NB 1HE8A 2JZ3B 4IM2A 3RCZA 4X57B 4GIVA 1SIFA 2KX0A 2MW5A 3EFUA 2ZNVB 4W9IA 2KC2A 3TMPB 3IBEA 2B3AA 3WAPA 2DZIA 2FCQA 2LRWA 3DBRI 2J0MA 3L54A 3MHSD 1R4NI 1WXSA 4GSWA 2MCNB 4TQ0A 5JHAA 1XD3B 2AYOB 2KC1A 3L13A 3H7PB 2JXXA 3V60A 3R66C 1WXVA 3ZDTA 2KJHB 4FN2A 4EFOA 4WWNA 2XK5B 4CYEA 3SHQA 4KSKC 2OOBB 4XX5A 5C23A 4FJZA 1GUAB 3I3TB 2G3QB 1C3TA 2HTHA 3PRZA 2ASQA 1S3SG 3A9JB 2KWVB 4HPMB 3ZLZA 1WE7A 3B1LX 5KHOA 4B9KA 4EZKA 4W9CA 2N4FA 5TR5A 5E6OA 1EF1A 2O6VB 4IM3A 2JRHA 1OEYJ 2LVOA 3H1UA 3NZSA 4GXBA 1TBEA 2ZPYA 2KTRB 3CSTA 3VFKA 2LVPA 2IZVB 4BBNF 2MP2A 4WWPA 3CSFA 1X1MA 4DK5A 1Q5WB 1V6EA 2DYOA 2KDIA 1WJ4A 2G4DB 3DBHI 1UGMA 4IC7B 4PS8A 2DYBA 2GOWA 4W9HA 3WIMA 4EZLA 1WYWB 4LJOB 3ZKJC 5J18A 2KLGA 3PZDA 2G45B 4BVUC 1E8WA 3PHWB 2BWES 2DX5B 4PYUA 4HCNB 3VUWA 3UQBA 2V4LA 2MBQA 3IFWB 5E6NA 4AOFA 2CS4A 4KDIC 2HJ8A 3W1SC 2L8JA 1E8YA 4I6NB 2R2QA 4XC2A 5GMVA 3HM3A 2ZCBA 3AXCA 4ANUA 4EOYA 4EEWA 1WF9A 2MBBB 2NR2A 4GDKB 3QHTA 3JW0X 3AU4A 3Q3FA 5KHQA 2LWPA 4DDID 1E7UA 3RUIB 2GBKA 3HHMA 4ZRIA 1ZKHA 3KYDD 2RGFA 2N1VA 2V1YA 3A9KA 2YVCA 3APFA 3H9DA 1LFDA 3ECIA 2AWTA 3ZW3A 4W9KA 2L0TA 3VHTC 1YIWA 3EHVA 2O2VB 2CKHB 3RZFA 4MM3A 5AZHA 2Z59B 2KWCA 1E90A 1WX7A 3OAWA 3UQAA 4NQKE 2M0XA 2K8HA 1TGZB 4BBNC 4XZ4A 2Z0DB 3PPAA 3QAQA 3DQVA 1WXAA 5DPRA 3DBSA 3H6NA 1EUVB 4CHKA 3U8ZA 3V62A 3N3KB 1TZ1A 1L7YA 4EZJA 5LXHA 4MJSB 2LUEA 4IWOA 3TIXA 1GC7A 4ASWC 4AJYB 4AP4C 5D94A 4BOZB 3UF8A 2LD9A 1WI0A 4W9JA 4NAWA 2MBEA 2YLMA 3A1QA 4AJWA 1OEYA 2LI5A 4RM9A 3B0AA 2XBBC 3N32A 4IM0A 2JVCA 2L76A 5FR6A 1WE6A 5AZGA 2KXJA 4B6WA 1WZ0A 1F9JA 2M1MA 1IP9A 2UWQA 1RAXA 4F8CB 1E5WA 3DOWA 1OGWA 4HJKA 2C5LC 1CMXB 2MX2A 4K7WA 1J19A 3WANA 2GBJA 3JVZX 1L2NA 3NHEB 2KX3A 4W9GA 4HLEA 3KH0A 4WJNA 4KZ0A 3HM6X 1IPGA 3JSVB 3PRPB 4M0WB 1LM8B 2KZRA 5BO4B 5CHVC 3LJ3A 4KZCA 1WGGA 4WJOA 3SD5A 4LCDE 2JY6A 4GGQA 1WGHA 2N1WA 3K9OB 3X0WA 4DHJB 3T8MA 1P0RA 5IA7A 4NJ7A 1RLFA 4HCPB 5G55A 3L16A 4IW0A 2K6QA 3BY4B 2OJRA 2PE6B 2AL6A 4KDLB 4OVVA 2ZZPB 4AWJA 2KDEB 5JH5C 2LGDA 4TQ1A 4P7IA 2KJRA 2IO0B 1V80A 1JRUA 1WJUA 2AL3A 2L0FA 3ML9A 1WX9A 4LDTB 1LXDA 1FXTB 1PQSA 4K7UA 1SGHA 2ZNVC 5D6JB 2CU1A 1QZEA 4ZDVA 3MJWA 2A4ZA 2DAFA 2DZJA 1UELA 3VH4B 1GJZA 1YD8U 2KFKA 2NBWB 4B95A 2REXA 1UH6A 2C60A 4WQOB 1M94A 1WM3A 3ALBA 1E7VA 2NPTA 3PGEA 1T0YA 4PS7A 1Z2MA 4KIKA 2FIFA 3WA0A 5HKHA 2MA9B 3EECA 1WGYA 3PREA 4N9F4 1WMHA 2AEHA 2WX0A 1P9DU 2CR5A 2JZZA 4GDLB 2M4NA 2KOXA 3A9KB 4NNJB 3L17A 1XQQA 3IVFA 5JZEB 4IUMB 4A3OA 2DZMA 5D7GA 1J0GA 2NBUA 4ICVA 4W9DA 2FNJB 3QIJA 1J8CA 3D32A 2IYDB 4BKTA 3ZNHB 1VD2A 3SU8X 3VTVA 2LJ5A 1NBFC 4MELA 1OQYA 4BFRA 3VUYA 2RR9A 3DVNU 2KQ7A 2FCMA 3QCAA 2KFJA 4ANVA 4FADA 2MRPA 2CHZA 1WR6E 2MLBA 2RSUA 4NQLB 5J2RA 2R2OA 1MG8A 3DVGY 3X23A 4G0NB 4MGKE 3OJ3A 4HDQA 5DPWA 4NAWB 2LGYA 1AARA 2LGXA 3UINB 3ZO5B 2FUHB 3PRMB 4DDGD 2KHWB 4W9FA 3PHXB 1GNUA 1RRBA 4MGYE 4HPLB 1ZW7A 1TTNA 1YX5B 3RD2A 3DBLI 3ZTCA 2K39A 3WAOA 2L7RA 3QC8B 2J0JA 2L00B 4DXAB 3WAMA 3RULA 1VCBA 3S2AA 3VXWA 2N7EA 1UD7A 3Q3JA 4HK2A 4IWQA 1S1QB 3L0WB 1NI2A 1U4AA 2PJHA 3HIZA 3KYCD 5CX3A 3TL5A 4A3PA 4FA6A 2CHXA 1WXMA 2KTFA 3ZTDA 2FCSA 1UBQA 4G11A 3M63B 1WZ3A 1Q1OA 3HK0A 3AU5A 3OJ4B 3N30A 3TBLD 2KD0A 2NCNA 4ANXA 2D2QA 3PTFC 3V61A 4OVUA 2ZVOA 2A5UA 1P98A 1UZXB 2ZEQA 2D3GA 2BYFA 3ML8A 4GMVA 2JPHA 2FCNA 1WH3A 4GB9A 2C9WB 1KLVA 1P3QU 4MSMB 2KN5A 1YX6B 3SDLC 1H8CA 2I1KA 2PE9A 2K8CA 2KANA 2M17A 2NVUI 2KNBA 2GBNA 4URKA 1KM7A 4JGHB 2MSED 3DCGA 2BGFA 3APDA 2LXCA 4JL9A 1ZGUB 1WM2A 4DWFA 5LXIB 4BKSD 4HDOA 1SE9A 3NY5A 1Y8RC 3MTNB 3VTWA 1WRDB 3W1YA 2IO2B 4ZYNA 3L10B 5CHFA 3QJZA 5CTRC 5L83A 4F7ZA 2D07B 4WAAA 3M95A 2K6DB 3C0RB 5DCNA 2KFKB 3AI5A 2MBHA 5DPTA 2EKEC 2I1JA 2KDBA 3UIPB 2JRIB 2O2VA 4II3B 2XEWA 2PEAA 4WJQA 1OTRB 4G50A 2KDFB 4KVGB 2MP2B 2DZKA 2KMCA 2IO1B 4KIKB 4M8NA 3QK0A 3VUXA 3ZRFA 3L08A 4FHJA 5CHWA 4A20A 3UIOB 3KUCB 4FULA 4E74A 3QX1A 4FHKA 1D3ZA 2RD0A 1Z5SB 3A4SC 2BPSA 4LDTD 2K25A 2N9XA 3AULA 3PVLA 2M8SA 4JLCA 4LJPB 4MJSA 4ZRJA 2BF8B 4WJPA 3GOEA 2ZVNA 2O6VD 4MSQB 5IAAC 4FBJB 3DPDA 3TJPA 3T9LA 2JUOA 2DHZA 2L05A 1WX8A 4I6PA 4ZRKA 4KV2A 3M3JA 2N9EB 2GBMA 3GZNI 4AUQC 3OLMD 2N9PC 1ISNA 3PLUA 2IO3B 4E71A 3LDZE 2EMTA 1E8ZA 2NS5A 4HXDA 4W9EA 4J6IA 2Y5BB 1P1AA 1V81A 4ICUA 2K8BA 1UBIA 2CHWA 2KJ6A 3PT2B 1RFAA 2KWUB 5DPSA 3VTUA 3KVFB 2W9NA 3ZVVA 3QWZB 2J0KA 3V6EB 5C1ZA 1KJTA 4BKSA 3JYUA 4BOSC 2L3ZA 3JSVA 4EKUA 3NZUA 1Q0WB 3NOBA 2KLCA 2BWFA 2LZ6A 5LLIA 1NDDA 3VH3B 1XT9B 2D11A 1YQBA 2C7MB 3RZWC 1A5RA 1IYFA 4BKGA 2DAJA 2KMAA 3H7PA 1BT0A 3R7RA 2WDTB 1E8XA 1KOTA 3BINA 3KUZA 1WJ6A 2XK5A 4IG7B 5L95C 4K7SA 4MGZE 1K8RB 1EF5A 3CF6E 3ENEA 1C1YB 4MH0E 3ZDMC 3QARA 3APCA 3RYTA 3O65B 3ONSA 3A1QB 4M8MA 3IHPC 4TUUA 4HVBA 4GU2A 3A9JA 2DYMA 2JT4B 1I35A 2MQJA 3NS8A 4FJVB 3W1SA 2LXAA 2D10A 2FAZA 4K81A 2NBVB 3VVWB 5J17A 1GG3A 2O6VA 3A4RA 2GMIC 4NPNA 3ZNZB 1WJNA 1V5OA 2IY0B 2KVRA 2ZPNA 5D2MB 3KUDB 2LASA 1G6JA 2KTRA 2PPHA 3V6CB 4KSLC 4PYZA 2MBOA 2LRUA 4RM8A 5EDSA 3ZNID 4PS3A 2BYVE 2N7DA 3B08A 5AZFA 3VQIA 1V86A 2HD5B 4DHZE 3QQ8B 3UGBB 3PV1A 3WALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R3M A;  4GDL A;  4YL8 A;  4G3X B;  3DDC B;  3ZIM A;  1LQB A;  3EC8 A;  2QHO A;  2BYE A;  4FJY A;  4I6L B;  4MDK E;  3K9P B;  2K1F A;  5E6P A;  1EO6 A;  4ANW A;  2KKC A;  4CO7 A;  2JWZ A;  1WGD A;  2KO3 A;  1R4M I;  4GOC A;  4JQW C;  2WYQ A;  3VAW A;  3RT3 B;  4HWI B;  3DVN V;  3KW5 B;  4JIO U;  2IBI B;  3QA8 A;  3ZNG C;  2LVQ A;  1V49 A;  2J7Q B;  1YJ1 A;  4GN1 A;  3H7S A;  4II2 B;  4DBG A;  3PLV A;  1WY8 A;  2V3S A;  5AEK B;  1V5T A;  1WGR A;  2BKF A;  4IWP A;  3PSE B;  3U30 A;  4DHZ B;  2IY1 B;  3M62 B;  4GDK A;  2ZJD A;  3DVG X;  1WFY A;  3IG3 A;  2Z0E B;  5G2N A;  1WR1 A;  2KQS A;  2WX1 A;  3VDZ A;  2WWZ A;  4NJ6 A;  3ZRC A;  2G4S A;  4W9L A;  2DEN B;  3P2B A;  2RPQ A;  2VRR B;  4MGI E;  1GC6 A;  1H4R A;  4K1R B;  4DHJ D;  4RMA A;  3R7Q A;  3U7D A;  3CMM B;  2ZCC A;  3PS6 A;  4NY0 A;  4E3C A;  2BKR B;  2KK8 A;  1I42 A;  2MWS B;  3ZUN A;  2C7H A;  2HE7 A;  2EMS A;  2NPT B;  4EUT A;  4MEM A;  2UYZ B;  1V2Y A;  3TCA A;  4TV3 A;  2GBR A;  4TKN A;  3A33 B;  4WWO A;  4F1S A;  1WMH B;  2FID A;  1V9J A;  1WIA A;  4FLH A;  5JHB A;  2JF5 A;  2C7N B;  1HE8 A;  2JZ3 B;  4IM2 A;  3RCZ A;  4X57 B;  4GIV A;  1SIF A;  2KX0 A;  2MW5 A;  3EFU A;  2ZNV B;  4W9I A;  2KC2 A;  3TMP B;  3IBE A;  2B3A A;  3WAP A;  2DZI A;  2FCQ A;  2LRW A;  3DBR I;  2J0M A;  3L54 A;  3MHS D;  1R4N I;  1WXS A;  4GSW A;  2MCN B;  4TQ0 A;  5JHA A;  1XD3 B;  2AYO B;  2KC1 A;  3L13 A;  3H7P B;  2JXX A;  3V60 A;  3R66 C;  1WXV A;  3ZDT A;  2KJH B;  4FN2 A;  4EFO A;  4WWN A;  2XK5 B;  4CYE A;  3SHQ A;  4KSK C;  2OOB B;  4XX5 A;  5C23 A;  4FJZ A;  1GUA B;  3I3T B;  2G3Q B;  1C3T A;  2HTH A;  3PRZ A;  2ASQ A;  1S3S G;  3A9J B;  2KWV B;  4HPM B;  3ZLZ A;  1WE7 A;  3B1L X;  5KHO A;  4B9K A;  4EZK A;  4W9C A;  2N4F A;  5TR5 A;  5E6O A;  1EF1 A;  2O6V B;  4IM3 A;  2JRH A;  1OEY J;  2LVO A;  3H1U A;  3NZS A;  4GXB A;  1TBE A;  2ZPY A;  2KTR B;  3CST A;  3VFK A;  2LVP A;  2IZV B;  4BBN F;  2MP2 A;  4WWP A;  3CSF A;  1X1M A;  4DK5 A;  1Q5W B;  1V6E A;  2DYO A;  2KDI A;  1WJ4 A;  2G4D B;  3DBH I;  1UGM A;  4IC7 B;  4PS8 A;  2DYB A;  2GOW A;  4W9H A;  3WIM A;  4EZL A;  1WYW B;  4LJO B;  3ZKJ C;  5J18 A;  2KLG A;  3PZD A;  2G45 B;  4BVU C;  1E8W A;  3PHW B;  2BWE S;  2DX5 B;  4PYU A;  4HCN B;  3VUW A;  3UQB A;  2V4L A;  2MBQ A;  3IFW B;  5E6N A;  4AOF A;  2CS4 A;  4KDI C;  2HJ8 A;  3W1S C;  2L8J A;  1E8Y A;  4I6N B;  2R2Q A;  4XC2 A;  5GMV A;  3HM3 A;  2ZCB A;  3AXC A;  4ANU A;  4EOY A;  4EEW A;  1WF9 A;  2MBB B;  2NR2 A;  4GDK B;  3QHT A;  3JW0 X;  3AU4 A;  3Q3F A;  5KHQ A;  2LWP A;  4DDI D;  1E7U A;  3RUI B;  2GBK A;  3HHM A;  4ZRI A;  1ZKH A;  3KYD D;  2RGF A;  2N1V A;  2V1Y A;  3A9K A;  2YVC A;  3APF A;  3H9D A;  1LFD A;  3ECI A;  2AWT A;  3ZW3 A;  4W9K A;  2L0T A;  3VHT C;  1YIW A;  3EHV A;  2O2V B;  2CKH B;  3RZF A;  4MM3 A;  5AZH A;  2Z59 B;  2KWC A;  1E90 A;  1WX7 A;  3OAW A;  3UQA A;  4NQK E;  2M0X A;  2K8H A;  1TGZ B;  4BBN C;  4XZ4 A;  2Z0D B;  3PPA A;  3QAQ A;  3DQV A;  1WXA A;  5DPR A;  3DBS A;  3H6N A;  1EUV B;  4CHK A;  3U8Z A;  3V62 A;  3N3K B;  1TZ1 A;  1L7Y A;  4EZJ A;  5LXH A;  4MJS B;  2LUE A;  4IWO A;  3TIX A;  1GC7 A;  4ASW C;  4AJY B;  4AP4 C;  5D94 A;  4BOZ B;  3UF8 A;  2LD9 A;  1WI0 A;  4W9J A;  4NAW A;  2MBE A;  2YLM A;  3A1Q A;  4AJW A;  1OEY A;  2LI5 A;  4RM9 A;  3B0A A;  2XBB C;  3N32 A;  4IM0 A;  2JVC A;  2L76 A;  5FR6 A;  1WE6 A;  5AZG A;  2KXJ A;  4B6W A;  1WZ0 A;  1F9J A;  2M1M A;  1IP9 A;  2UWQ A;  1RAX A;  4F8C B;  1E5W A;  3DOW A;  1OGW A;  4HJK A;  2C5L C;  1CMX B;  2MX2 A;  4K7W A;  1J19 A;  3WAN A;  2GBJ A;  3JVZ X;  1L2N A;  3NHE B;  2KX3 A;  4W9G A;  4HLE A;  3KH0 A;  4WJN A;  4KZ0 A;  3HM6 X;  1IPG A;  3JSV B;  3PRP B;  4M0W B;  1LM8 B;  2KZR A;  5BO4 B;  5CHV C;  3LJ3 A;  4KZC A;  1WGG A;  4WJO A;  3SD5 A;  4LCD E;  2JY6 A;  4GGQ A;  1WGH A;  2N1W A;  3K9O B;  3X0W A;  4DHJ B;  3T8M A;  1P0R A;  5IA7 A;  4NJ7 A;  1RLF A;  4HCP B;  5G55 A;  3L16 A;  4IW0 A;  2K6Q A;  3BY4 B;  2OJR A;  2PE6 B;  2AL6 A;  4KDL B;  4OVV A;  2ZZP B;  4AWJ A;  2KDE B;  5JH5 C;  2LGD A;  4TQ1 A;  4P7I A;  2KJR A;  2IO0 B;  1V80 A;  1JRU A;  1WJU A;  2AL3 A;  2L0F A;  3ML9 A;  1WX9 A;  4LDT B;  1LXD A;  1FXT B;  1PQS A;  4K7U A;  1SGH A;  2ZNV C;  5D6J B;  2CU1 A;  1QZE A;  4ZDV A;  3MJW A;  2A4Z A;  2DAF A;  2DZJ A;  1UEL A;  3VH4 B;  1GJZ A;  1YD8 U;  2KFK A;  2NBW B;  4B95 A;  2REX A;  1UH6 A;  2C60 A;  4WQO B;  1M94 A;  1WM3 A;  3ALB A;  1E7V A;  2NPT A;  3PGE A;  1T0Y A;  4PS7 A;  1Z2M A;  4KIK A;  2FIF A;  3WA0 A;  5HKH A;  2MA9 B;  3EEC A;  1WGY A;  3PRE A;  4N9F 4;  1WMH A;  2AEH A;  2WX0 A;  1P9D U;  2CR5 A;  2JZZ A;  4GDL B;  2M4N A;  2KOX A;  3A9K B;  4NNJ B;  3L17 A;  1XQQ A;  3IVF A;  5JZE B;  4IUM B;  4A3O A;  2DZM A;  5D7G A;  1J0G A;  2NBU A;  4ICV A;  4W9D A;  2FNJ B;  3QIJ A;  1J8C A;  3D32 A;  2IYD B;  4BKT A;  3ZNH B;  1VD2 A;  3SU8 X;  3VTV A;  2LJ5 A;  1NBF C;  4MEL A;  1OQY A;  4BFR A;  3VUY A;  2RR9 A;  3DVN U;  2KQ7 A;  2FCM A;  3QCA A;  2KFJ A;  4ANV A;  4FAD A;  2MRP A;  2CHZ A;  1WR6 E;  2MLB A;  2RSU A;  4NQL B;  5J2R A;  2R2O A;  1MG8 A;  3DVG Y;  3X23 A;  4G0N B;  4MGK E;  3OJ3 A;  4HDQ A;  5DPW A;  4NAW B;  2LGY A;  1AAR A;  2LGX A;  3UIN B;  3ZO5 B;  2FUH B;  3PRM B;  4DDG D;  2KHW B;  4W9F A;  3PHX B;  1GNU A;  1RRB A;  4MGY E;  4HPL B;  1ZW7 A;  1TTN A;  1YX5 B;  3RD2 A;  3DBL I;  3ZTC A;  2K39 A;  3WAO A;  2L7R A;  3QC8 B;  2J0J A;  2L00 B;  4DXA B;  3WAM A;  3RUL A;  1VCB A;  3S2A A;  3VXW A;  2N7E A;  1UD7 A;  3Q3J A;  4HK2 A;  4IWQ A;  1S1Q B;  3L0W B;  1NI2 A;  1U4A A;  2PJH A;  3HIZ A;  3KYC D;  5CX3 A;  3TL5 A;  4A3P A;  4FA6 A;  2CHX A;  1WXM A;  2KTF A;  3ZTD A;  2FCS A;  1UBQ A;  4G11 A;  3M63 B;  1WZ3 A;  1Q1O A;  3HK0 A;  3AU5 A;  3OJ4 B;  3N30 A;  3TBL D;  2KD0 A;  2NCN A;  4ANX A;  2D2Q A;  3PTF C;  3V61 A;  4OVU A;  2ZVO A;  2A5U A;  1P98 A;  1UZX B;  2ZEQ A;  2D3G A;  2BYF A;  3ML8 A;  4GMV A;  2JPH A;  2FCN A;  1WH3 A;  4GB9 A;  2C9W B;  1KLV A;  1P3Q U;  4MSM B;  2KN5 A;  1YX6 B;  3SDL C;  1H8C A;  2I1K A;  2PE9 A;  2K8C A;  2KAN A;  2M17 A;  2NVU I;  2KNB A;  2GBN A;  4URK A;  1KM7 A;  4JGH B;  2MSE D;  3DCG A;  2BGF A;  3APD A;  2LXC A;  4JL9 A;  1ZGU B;  1WM2 A;  4DWF A;  5LXI B;  4BKS D;  4HDO A;  1SE9 A;  3NY5 A;  1Y8R C;  3MTN B;  3VTW A;  1WRD B;  3W1Y A;  2IO2 B;  4ZYN A;  3L10 B;  5CHF A;  3QJZ A;  5CTR C;  5L83 A;  4F7Z A;  2D07 B;  4WAA A;  3M95 A;  2K6D B;  3C0R B;  5DCN A;  2KFK B;  3AI5 A;  2MBH A;  5DPT A;  2EKE C;  2I1J A;  2KDB A;  3UIP B;  2JRI B;  2O2V A;  4II3 B;  2XEW A;  2PEA A;  4WJQ A;  1OTR B;  4G50 A;  2KDF B;  4KVG B;  2MP2 B;  2DZK A;  2KMC A;  2IO1 B;  4KIK B;  4M8N A;  3QK0 A;  3VUX A;  3ZRF A;  3L08 A;  4FHJ A;  5CHW A;  4A20 A;  3UIO B;  3KUC B;  4FUL A;  4E74 A;  3QX1 A;  4FHK A;  1D3Z A;  2RD0 A;  1Z5S B;  3A4S C;  2BPS A;  4LDT D;  2K25 A;  2N9X A;  3AUL A;  3PVL A;  2M8S A;  4JLC A;  4LJP B;  4MJS A;  4ZRJ A;  2BF8 B;  4WJP A;  3GOE A;  2ZVN A;  2O6V D;  4MSQ B;  5IAA C;  4FBJ B;  3DPD A;  3TJP A;  3T9L A;  2JUO A;  2DHZ A;  2L05 A;  1WX8 A;  4I6P A;  4ZRK A;  4KV2 A;  3M3J A;  2N9E B;  2GBM A;  3GZN I;  4AUQ C;  3OLM D;  2N9P C;  1ISN A;  3PLU A;  2IO3 B;  4E71 A;  3LDZ E;  2EMT A;  1E8Z A;  2NS5 A;  4HXD A;  4W9E A;  4J6I A;  2Y5B B;  1P1A A;  1V81 A;  4ICU A;  2K8B A;  1UBI A;  2CHW A;  2KJ6 A;  3PT2 B;  1RFA A;  2KWU B;  5DPS A;  3VTU A;  3KVF B;  2W9N A;  3ZVV A;  3QWZ B;  2J0K A;  3V6E B;  5C1Z A;  1KJT A;  4BKS A;  3JYU A;  4BOS C;  2L3Z A;  3JSV A;  4EKU A;  3NZU A;  1Q0W B;  3NOB A;  2KLC A;  2BWF A;  2LZ6 A;  5LLI A;  1NDD A;  3VH3 B;  1XT9 B;  2D11 A;  1YQB A;  2C7M B;  3RZW C;  1A5R A;  1IYF A;  4BKG A;  2DAJ A;  2KMA A;  3H7P A;  1BT0 A;  3R7R A;  2WDT B;  1E8X A;  1KOT A;  3BIN A;  3KUZ A;  1WJ6 A;  2XK5 A;  4IG7 B;  5L95 C;  4K7S A;  4MGZ E;  1K8R B;  1EF5 A;  3CF6 E;  3ENE A;  1C1Y B;  4MH0 E;  3ZDM C;  3QAR A;  3APC A;  3RYT A;  3O65 B;  3ONS A;  3A1Q B;  4M8M A;  3IHP C;  4TUU A;  4HVB A;  4GU2 A;  3A9J A;  2DYM A;  2JT4 B;  1I35 A;  2MQJ A;  3NS8 A;  4FJV B;  3W1S A;  2LXA A;  2D10 A;  2FAZ A;  4K81 A;  2NBV B;  3VVW B;  5J17 A;  1GG3 A;  2O6V A;  3A4R A;  2GMI C;  4NPN A;  3ZNZ B;  1WJN A;  1V5O A;  2IY0 B;  2KVR A;  2ZPN A;  5D2M B;  3KUD B;  2LAS A;  1G6J A;  2KTR A;  2PPH A;  3V6C B;  4KSL C;  4PYZ A;  2MBO A;  2LRU A;  4RM8 A;  5EDS A;  3ZNI D;  4PS3 A;  2BYV E;  2N7D A;  3B08 A;  5AZF A;  3VQI A;  1V86 A;  2HD5 B;  4DHZ E;  3QQ8 B;  3UGB B;  3PV1 A;  3WAL A; 
#chains in the Genus database with same CATH topology
 3ZIM A;  1SJE D;  5FKA C;  2XN9 C;  2KQ4 X;  4YSZ B;  3ZXV A;  3CIR B;  5E6P A;  1EO6 A;  1KFY B;  1IGD A;  1F1H A;  4CO7 A;  1WXQ A;  2KO3 A;  4GOC A;  4GLS C;  3DVN V;  3KW5 B;  4A55 A;  2LVQ A;  1V49 A;  4II2 B;  3H7S A;  4DBG A;  2KT7 A;  4IWP A;  1WGR A;  3U30 A;  3PSE B;  2IY1 B;  3M62 B;  4GDK A;  1QQR A;  2ZJD A;  2SEB D;  1VDV A;  2WX1 A;  3ZRC A;  4W9L A;  3KWL A;  1H4R A;  1FCL A;  3B2G A;  5LNK 1;  2KK8 A;  4NAM A;  2MWS B;  1L4Z B;  2C7H A;  2HE7 A;  2EMS A;  4EUT A;  2MJD A;  5JHB A;  2JF5 A;  4IM2 A;  4YTP B;  4X57 B;  1SIF A;  2KX0 A;  2ZNV B;  2KC2 A;  1SB3 C;  5BYR A;  4WIP A;  2R61 A;  2B3A A;  2AQ2 B;  2LRW A;  2WHI A;  2WXR A;  3L54 A;  2N9L A;  3MHS D;  2MCN B;  5D3D A;  2AYO B;  3J9C A;  1IUE A;  3BK2 A;  3H7P B;  2JXX A;  2ZW1 A;  3OWE B;  3R66 C;  5E6J A;  1MI0 A;  3RNF C;  4WWN A;  4KSK C;  4LNK A;  3MC0 B;  5C23 A;  4FJZ A;  3RFZ B;  1VRA B;  3I3T B;  2G3Q B;  2DWQ A;  3ETR A;  2ASQ A;  4HPM B;  1WE7 A;  3B1L X;  1XLQ A;  5E6O A;  1EF1 A;  4IM3 A;  2LVO A;  3H1U A;  1CK1 A;  2BS3 B;  1FRD A;  1FMA D;  3CSF A;  4DK5 A;  2XNA C;  1ACC A;  1WJ4 A;  3DBH I;  1UGM A;  4W9H A;  2H89 B;  1WYW B;  2KLG A;  4BVU C;  2G45 B;  5GXG B;  2JZP A;  2BWE S;  4PYU A;  1TKE A;  2EEL A;  1FRR A;  3IFW B;  1WSP A;  4AOF A;  2HJ8 A;  2J52 A;  3Q3N C;  1YN3 A;  2R2Q A;  4XC2 A;  3DWG C;  4US9 A;  3HM3 A;  4ANU A;  4XWW A;  1WF9 A;  3AU4 A;  3EA6 A;  3RUI B;  3HHM A;  1ZKH A;  1WWT A;  2V1Y A;  3A9K A;  4ZYS A;  3OG5 A;  4W9K A;  4ZRP A;  5IKC M;  2L0T A;  3VHT C;  1YIW A;  3EHV A;  1EWC A;  2CKH B;  3DWM A;  2WXQ A;  1K53 A;  4IOI E;  2K8H A;  3QAQ A;  3H6N A;  1EUV B;  4CHK A;  3V62 A;  2BQQ A;  3N3K B;  4MAC A;  4EZJ A;  2LUE A;  3RPF C;  4IWO A;  2JYE A;  5I4D A;  4AP4 C;  4JWS C;  1WI0 A;  4W9J A;  4AJW A;  2YLM A;  3A1Q A;  4CQN A;  4OZB A;  3B0A A;  2J4X A;  3N32 A;  2KMM A;  3P42 A;  4JPS A;  2KXJ A;  1TKY A;  1QOF A;  2M1M A;  1IP9 A;  2UWQ A;  2W82 A;  1VZ7 A;  4HJK A;  1CMX B;  4K7W A;  1L2N A;  2KX3 A;  1E10 A;  3MC8 A;  4KZ0 A;  3HM6 X;  5CHV C;  4YTN B;  4P6V F;  1WGG A;  1C4C A;  3K9O B;  3X0W A;  2WXP A;  5G55 A;  3BY4 B;  2OJR A;  2PE6 B;  2K0P A;  5JH5 C;  3FIL A;  4ZRQ A;  1QLB B;  2LGI A;  2ACZ B;  5JXV A;  4LDT B;  1XO3 A;  2I2Y A;  5T8I A;  1YD8 U;  2NBW B;  2REX A;  2C60 A;  4WQO B;  1JWA D;  1E7V A;  5MPO A;  1T0Y A;  2Y3A A;  3WA0 A;  3EEC A;  1WGY A;  1SIJ A;  4N9F 4;  1WMH A;  2AEH A;  2WX0 A;  3T3O A;  4GDL B;  2KOX A;  2I38 A;  5IOI A;  5D7G A;  1J7B A;  4ICV A;  4W9D A;  2L52 A;  3ZNH B;  1QOB A;  1JWM D;  1NBF C;  1OQY A;  5FK9 C;  3BII D;  2FCM A;  1B9R A;  2MRP A;  2CHZ A;  2RSU A;  4OZA A;  1MG8 A;  3DVG Y;  4G0N B;  1ET6 A;  2W55 A;  2WDQ B;  4WQM A;  2KHW B;  1FFV A;  2HJ1 A;  3WAO A;  2JXT A;  1GB4 A;  3RUL A;  2PW9 A;  3L0W B;  3R2I A;  1NI2 A;  3MJ5 A;  4A3P A;  2CHX A;  2KTF A;  5EE9 A;  3ZTD A;  1UBQ A;  3C8Y A;  2CJN A;  3TUO A;  4LK0 M;  4A9A A;  2KD0 A;  2BW2 A;  5EE1 A;  2ZVO A;  1P98 A;  2ZEQ A;  2BYF A;  1WH3 A;  1KLV A;  2C9W B;  3WCQ A;  4C56 C;  4MH8 A;  2NVU I;  1JQ4 A;  2K3U A;  4URK A;  1ZGU B;  4BKS D;  4HDO A;  3NY5 A;  3RNG C;  2INC C;  3L10 B;  4OZC A;  4WAA A;  1YN5 A;  3AI5 A;  2EKE C;  4WJQ A;  2XEW A;  1OTR B;  2KDF B;  2MP2 B;  4LLG M;  3VUX A;  4FHJ A;  3UIO B;  3IT4 B;  1PUT A;  3IT6 B;  1EU4 A;  2BPS A;  2N9X A;  5EE0 A;  2Z8L A;  3AUL A;  1PFD A;  2M8S A;  5IO9 A;  1JAL A;  1QOG A;  4ZHO A;  2ICI A;  3TJP A;  3T9L A;  2OHF A;  1WX8 A;  3M3J A;  1CQV A;  3Q3O C;  3GZN I;  1P1A A;  3PO0 A;  4ICU A;  2CHW A;  5DPS A;  3ABV B;  2WDR B;  2WXL A;  3KVF B;  4YWG G;  1XLP A;  2QIE B;  3QWZ B;  2J0K A;  2BB5 A;  4BKS A;  3JYU A;  4BOS C;  2L3Z A;  3BVZ A;  4M0W A;  4EKU A;  1TS2 A;  1F52 A;  2D11 A;  1YQB A;  3TEW A;  4RGT A;  3R7R A;  1AYF A;  2WDT B;  3V3X A;  4IG7 B;  1SE3 A;  4ZHP A;  3ENE A;  4MH0 E;  3APC A;  3N1Y C;  3SFD B;  1E7P B;  4M8M A;  4GU2 A;  4FJV B;  2L1A A;  3ZNZ B;  2IY0 B;  2ZPN A;  4KKI A;  2KTR A;  2PPH A;  1V1P B;  4KSL C;  4PYZ A;  1L4D B;  1NYQ A;  2MBO A;  3GE3 C;  3R3M A;  1Q10 A;  4YL8 A;  3DDC B;  4WWM A;  1RWS A;  4C4V B;  1IBX B;  1JW9 D;  2PLP A;  2K1F A;  4LNN A;  2WP9 B;  4ANW A;  1R4M I;  4HWI B;  4KGT A;  5D3I B;  2IBI B;  3QA8 A;  3H8H A;  1YJ1 A;  2BYT A;  2GB1 A;  2V3S A;  5AEK B;  2BKF A;  2KVZ A;  3BVM A;  3DVG X;  2Z0E B;  5G2N A;  2KQS A;  2DEN B;  2RPQ A;  3AE2 B;  2VRR B;  4MGI E;  1GC6 A;  1JRO A;  3Q69 A;  4S0R A;  1F0Z A;  3AEC B;  4RMA A;  3PS6 A;  1I42 A;  2Q5W D;  2NPT B;  1SF0 A;  3NVZ A;  4MEM A;  2UYZ B;  1TS3 A;  1ZDV A;  3AN1 A;  4TV3 A;  3TCA A;  3A33 B;  4WWO A;  1C79 A;  1V9J A;  2QJL A;  1KLU D;  1HE8 A;  2JZ3 B;  4GIV A;  3IXS A;  4S17 A;  2MW5 A;  1FNV A;  1YOV B;  3IBE A;  5HFY A;  2MHJ A;  1QKZ A;  1R4N I;  1WXS A;  4GSW A;  1WGK A;  2KWD A;  1XD3 B;  4USA A;  3W9C B;  3NJT A;  3V60 A;  2KJH B;  3U2S C;  1YNT E;  2XK5 B;  3SHQ A;  5G5G A;  1LO5 D;  3ZJV A;  4YSY B;  4RGN A;  4RCO A;  1HZ6 A;  1C78 A;  3C19 A;  3A9J B;  2KWV B;  3AE9 B;  4HRS A;  5TR5 A;  1FM0 D;  2O6V B;  2JYT A;  1UNS A;  4GXB A;  4LNF A;  3VFK A;  3AEG B;  4BBN F;  3MFG A;  3KQ4 A;  1GOZ A;  5IP4 D;  1I7H A;  1V6E A;  2DYO A;  3AE5 B;  4IC7 B;  4AQ7 A;  3I9V 1;  4A6Q A;  2GOW A;  3T3N A;  4LJO B;  3O13 A;  5J18 A;  1NEN B;  3VUW A;  3GP7 A;  2QDF A;  3HVD A;  2CS4 A;  2VZK D;  4RF0 A;  1E8Y A;  4H2A A;  2M0A A;  5GMV A;  2QIL A;  2ZCB A;  4EOY A;  2VH1 A;  4EEW A;  2MBB B;  4GDK B;  1E7U A;  3AED B;  5H8Y E;  1BML C;  4HKQ A;  4ZRI A;  3NZ3 A;  2J53 A;  2N1V A;  3EFC A;  2YVC A;  4B0M A;  3ECI A;  3BWU D;  4KKJ A;  2O2V B;  3NVV A;  1DOX A;  4MM3 A;  1QIL A;  2OJW A;  1QT9 A;  1D5Z C;  2KWC A;  2V4I B;  1A70 A;  1WX7 A;  3OAW A;  2M0X A;  4HRO A;  2GRI A;  1GAQ B;  3DQV A;  1WXA A;  3DBS A;  1L7Y A;  1PDX A;  1PGB A;  4C00 A;  1GC7 A;  4ASW C;  2LD9 A;  2QCZ A;  1L0V B;  2RPV A;  2L76 A;  5FR6 A;  3RN9 C;  3I63 C;  2M19 A;  4B6W A;  4XDD A;  1F9J A;  2J42 A;  1J19 A;  4P1C C;  4HLE A;  3KH0 A;  1KLG D;  3PZ7 A;  1D6E C;  1VR9 A;  3LJ3 A;  1Y56 A;  4KZC A;  3BZD B;  2WXF A;  3SD5 A;  2JY6 A;  1P0R A;  5AUK A;  1HXY D;  4HCP B;  3L16 A;  4A90 A;  2DBY A;  1XF5 L;  2AL6 A;  5HG2 A;  4TQ1 A;  2KJR A;  1N63 A;  3AB5 A;  2ON8 A;  1XXG A;  2AL3 A;  1WX9 A;  2UU7 A;  1YJJ A;  1ESF A;  1PQS A;  2BB6 A;  5D6J B;  4ZDV A;  2CU1 A;  3UI3 A;  2KYW A;  2A4Z A;  2DZJ A;  1TS5 A;  2E3T A;  2PMV A;  3NVW A;  1M94 A;  1WM3 A;  3ALB A;  1HEZ E;  3L4P A;  3PGE A;  1JWU D;  1Z2M A;  3N9Y C;  4KIK A;  3VR9 B;  3PRE A;  1P9D U;  2M4N A;  3A9K B;  5BMG A;  4NNJ B;  3L17 A;  2HTM E;  1I4P A;  4A3O A;  2NBU A;  3BYT B;  1J8C A;  1JML A;  3D32 A;  3GZN B;  1VD2 A;  1AW7 A;  3LB8 C;  4MEL A;  2RR9 A;  3ZYY X;  1TJE A;  3DVN U;  2IND C;  3QCA A;  1PGA A;  3AE7 B;  2MLB A;  5J2R A;  2R2O A;  3X23 A;  2LEK A;  5DPW A;  2LGY A;  1AAR A;  3UIN B;  2FUH B;  4OVZ A;  2AX5 A;  1L5P A;  3LYY A;  1V97 A;  2QC8 A;  5C3J B;  4L1B A;  2N7E A;  4US8 A;  1NI3 A;  3Q3J A;  5CX3 A;  1T3Q A;  4EE2 A;  2WXG A;  3EGR A;  2FCS A;  4IKG A;  4A8X C;  3M63 B;  1WZ3 A;  1Q1O A;  3NUH B;  3TEY A;  3V61 A;  2M56 B;  4GMV A;  2A5U A;  1UZX B;  2MH7 A;  2D3G A;  3ML8 A;  1HQR D;  2JPH A;  1P3Q U;  1YX6 B;  2PE9 A;  2WDV B;  2KAN A;  3FIL B;  2KNB A;  4ACF A;  4JGH B;  1NVI D;  3Q3M C;  4N58 A;  1YQ3 B;  3DCG A;  2LXC A;  4DWF A;  3SEB A;  3VTW A;  3W1Y A;  2IO2 B;  3QJZ A;  1EWY C;  5CTR C;  5L83 A;  1R4M B;  4F7Z A;  3M95 A;  5DCN A;  1D5M C;  2KDB A;  1STE A;  2PEA A;  4G50 A;  4KVG B;  4B0E A;  4M8N A;  2RMM A;  2WXK A;  2RDB C;  4M00 A;  1XLN A;  2OED A;  1Z5S B;  4LDT D;  3DHH C;  4LJP B;  4JLC A;  2Y5C A;  1BUI C;  3EUB 2;  3DPD A;  1IGC A;  1D5X C;  2QMT A;  3I5J C;  4I6P A;  2L05 A;  1HTO A;  2GBM A;  2KAC A;  4HPP A;  1ISN A;  1MPE A;  2D3C A;  4HXD A;  3GS2 A;  4J6I A;  2Y5B B;  1V81 A;  2KJ6 A;  2W9N A;  3ZVV A;  3P4S B;  4DXG A;  1FO4 A;  5C1Z A;  1R4N B;  3RNA C;  1C4A A;  1Q0W B;  2WXI A;  5LLI A;  3VH3 B;  3AE8 B;  4RGM A;  1A5R A;  4BKG A;  1OQR A;  2DAJ A;  1P7F A;  4BAX A;  4RFB A;  3KUZ A;  5L95 C;  4MGZ E;  2EKI A;  3Q2A C;  3TSS A;  3CF6 E;  3ZDM C;  3QAR A;  3O65 B;  4MT5 A;  1N61 A;  2WU2 B;  2DYM A;  3N1Z C;  1I35 A;  3NS8 A;  2D10 A;  4K81 A;  2GMI C;  4RH6 A;  5D2M B;  1G6J A;  5BYS A;  2LAS A;  3V6C B;  1CZP A;  2VH2 A;  2X38 A;  3HUI A;  4PS3 A;  5AZF A;  2N7D A;  2HD5 B;  3SR6 A;  2LGS A;  5C2T B;  3WAL A;  4GDL A;  4G3X B;  1LQB A;  2QHO A;  4I6L B;  4MDK E;  2KKC A;  4HJG E;  1TY0 A;  1WGD A;  1N60 A;  1SSN A;  2LMC A;  2N9K A;  4JQW C;  2WYQ A;  1T5X D;  3P4P B;  3VAW A;  3RT3 B;  3ZNG C;  1ENF A;  3IAM 1;  3P63 A;  2J7Q B;  1WY8 A;  1J0G A;  4DQO C;  2YEP F;  2WXM A;  1J7C A;  3VDZ A;  2PTL A;  4NJ6 A;  2N7J A;  5EE3 A;  1V1O A;  2WNM A;  3DHG C;  4K1R B;  4DHJ D;  3U7D A;  3CMM B;  1DOY A;  2NTT A;  4NY0 A;  4XWT A;  2BKR B;  5H92 C;  4WUR A;  2GBR A;  4TKN A;  1NEK B;  2FID A;  4FLH A;  2YEP B;  3RCZ A;  2SAK A;  3WAP A;  2DZI A;  2FCQ A;  2INP E;  4AS1 A;  2J0M A;  4TQ0 A;  4WH4 A;  1UWM A;  1EU3 A;  2JWU A;  3L13 A;  1ZXH A;  2PVO D;  3ZDT A;  4EFO A;  4YT0 B;  1F2R C;  4CYE A;  2OOB B;  2WXO A;  4XX5 A;  3R2T A;  1GUA B;  3SFE B;  1C3T A;  2HTH A;  3N1X C;  3PRZ A;  1PYW D;  2WU5 B;  1S3S G;  2DLB A;  5KHO A;  4W9C A;  1OEY J;  3R8B A;  1TBE A;  4Q2J A;  2ZPY A;  2KTR B;  2LVP A;  2IZV B;  2MP2 A;  2AQ3 B;  3Q8F A;  4R3D A;  4N59 A;  4PS8 A;  1OQQ A;  2G4D B;  2FBW B;  2DYB A;  2IGH A;  4EZL A;  3ZKJ C;  1K50 A;  1N5W A;  3PHW B;  2DX5 B;  2K22 A;  4K3B A;  5FR3 A;  2V4L A;  3Q6B A;  4KDI C;  2G9H D;  2BBC A;  2L8J A;  2GI9 A;  2WGS A;  3AXC A;  5TSS A;  1SEB D;  3QHT A;  3JW0 X;  3Q3F A;  5KHQ A;  2LWP A;  1ZUD 2;  1C4P A;  2RGF A;  4YSX B;  3H9D A;  1LFD A;  3ZW3 A;  1T0Q C;  5AZH A;  1J7A A;  2LJI A;  3UQA A;  1N6Z A;  2WXN A;  4NQK E;  3PPA A;  1L6V A;  5DPR A;  1XCT L;  1TZ1 A;  4J3O D;  4MJS B;  2KN4 A;  3P4R B;  5D94 A;  3UF8 A;  3E9S A;  4NAW A;  2MBE A;  2WXJ A;  1OEY A;  2V3N A;  4IM0 A;  2JVC A;  4FXC A;  1WE6 A;  1WZ0 A;  3HVZ A;  1RAX A;  1E5W A;  1CJE A;  3DOW A;  1OGW A;  1DYQ A;  1SJH D;  3WAN A;  3NHE B;  1I4Q A;  4W9G A;  4YTM B;  2LUM A;  3JSV B;  3PRP B;  5BO4 B;  1B1Z A;  4GGQ A;  1WGH A;  1C76 A;  3T8M A;  5IA7 A;  1ZP0 B;  4IW0 A;  2H88 B;  2K6Q A;  3GE8 C;  5HI1 A;  2PKO A;  4KDL B;  4OVV A;  4AWJ A;  2LGD A;  3DHI C;  1MHX A;  3P1M A;  4ZOH C;  1JRU A;  2IO0 B;  4XYC A;  1LXD A;  2LHE A;  2QSD A;  4K7U A;  1QZE A;  3MJW A;  3VH4 B;  3P4Q B;  1GJZ A;  1KRH A;  2KFK A;  2V9H A;  1UH6 A;  2IGD A;  2NPT A;  4PS7 A;  5HKH A;  2FIF A;  2MA9 B;  1TYG B;  2JZZ A;  2CR5 A;  3IVF A;  2WS3 B;  4IUM B;  1GB1 A;  2DZM A;  3Q8E A;  3QIJ A;  4BKT A;  4MM3 B;  3SU8 X;  3VTV A;  1YQ4 B;  1DOI A;  4O1N A;  3VRA B;  4BFR A;  2KQ7 A;  1RYJ A;  2WQY B;  4ANV A;  4FAD A;  1WR6 E;  4NQL B;  4MGK E;  3OJ3 A;  4HDQ A;  2LGX A;  1JWB D;  4IDI A;  3ZO5 B;  3PHX B;  1GNU A;  1RRB A;  4HPL B;  1ZW7 A;  1TTN A;  2VZK B;  3DBL I;  2K39 A;  1T0R C;  2L7R A;  2J0J A;  2L00 B;  4DXA B;  3VXW A;  1UD7 A;  4L2Y A;  4HK2 A;  4IWQ A;  1S1Q B;  3FKY A;  3TL5 A;  1U4A A;  2PJH A;  3HIZ A;  3KYC D;  4FA6 A;  2D3B A;  1WXM A;  4G11 A;  3AU5 A;  3OJ4 B;  3N30 A;  3TBL D;  1FEH A;  4ANX A;  2D2Q A;  3TMP B;  2FCN A;  4MSM B;  1HZ5 A;  1MJD A;  3SDL C;  3ZJU A;  1FCC C;  2M17 A;  3Q8B A;  1FIQ A;  2ONQ A;  1KM7 A;  2BGF A;  1ZOY B;  4XGA B;  1WM2 A;  2BVC A;  1SE9 A;  2D5G A;  1I4X A;  4ZYN A;  5CHF A;  2K6D B;  3C0R B;  1HA5 A;  4TMA B;  5AUI A;  3W2D A;  2MBH A;  5DPT A;  1RM6 C;  2JRI B;  2O2V A;  4OHJ A;  1R7S A;  2MJ3 A;  2KMC A;  4ITK A;  3KWV A;  4KIK B;  3QK0 A;  4RGO S;  3ZRF A;  3L08 A;  4FUL A;  3QX1 A;  1D4B A;  1D3Z A;  2B76 B;  3A4S C;  2K25 A;  3PVL A;  4ZRJ A;  2BF8 B;  4WJP A;  3U4E G;  2LHD A;  3RNB C;  5IAA C;  1FFU A;  1UUP A;  4KV2 A;  2N9E B;  3OLM D;  3PLU A;  2IO3 B;  2EMT A;  1JRP A;  1E8Z A;  2NS5 A;  4W9E A;  3BK1 A;  1RFK A;  3VTU A;  1UBI A;  3PT2 B;  1RFA A;  4RF1 A;  3V6E B;  2FUG 1;  1MHH E;  3I57 A;  2LZ6 A;  1JCK B;  4UDU C;  1BXT A;  2CU3 A;  3H7P A;  2K9X A;  1BT0 A;  1AWD A;  3MHZ A;  3NG0 A;  3U52 E;  3BIN A;  2D3A A;  1K8R B;  2IDY A;  4P16 A;  1WRI A;  3RYT A;  1MFW A;  3A1Q B;  4TUU A;  2JT4 B;  1UWX A;  1TIF A;  2MQJ A;  3VVW B;  1QF6 A;  3A4R A;  4NPN A;  1V5O A;  2V3P A;  4N6E B;  3TEZ A;  2LRU A;  4RM8 A;  2W3R A;  3ZNI D;  4ARI A;  4D2K A;  1UF0 A;  3QQ8 B;  3PV1 A;  2RDG A;  1F77 A;  2NTS A;  1TZO A;  3EC8 A;  2BYE A;  2NMQ A;  4FJY A;  3K9P B;  5IN7 A;  1ZPS A;  2JWZ A;  1L0Y B;  2W54 A;  1OFF A;  1FNU A;  4JIO U;  4HKZ E;  4GN1 A;  1L0X B;  3PLV A;  2L83 A;  1V5T A;  4DHZ B;  1WFY A;  2CJO A;  3IG3 A;  1WR1 A;  2WWZ A;  2G4S A;  4REZ A;  1FXA A;  3P2B A;  1XEE A;  3R7Q A;  2E6X A;  2ZCC A;  4E3C A;  1ROE A;  3ZUN A;  2V0G A;  1I4H A;  2KDM A;  1V2Y A;  1K52 A;  4F1S A;  1WMH B;  1FXI A;  2JU6 X;  1WIA A;  2C7N B;  3EFU A;  1M4V A;  4W9I A;  3N20 C;  3DBR I;  1XCQ L;  1SE2 A;  3AE3 B;  1VJK A;  5JHA A;  2W3S A;  2KC1 A;  3AEA B;  1UGJ A;  1WXV A;  4FN2 A;  1K51 A;  3FC4 A;  4C7Y A;  3E56 A;  1I4G A;  3KLS X;  3ZLZ A;  4B9K A;  3NRZ A;  3PZ8 A;  4EZK A;  2N4F A;  3AEF B;  2ZW0 A;  2JRH A;  3NZS A;  3MP9 A;  3AE6 B;  3CST A;  4WWP A;  1LGR A;  1X1M A;  1V8C A;  1Q5W B;  1ZXI A;  2KDI A;  3WIM A;  4KX6 B;  3ZGZ A;  4LNI A;  2K5P A;  2INN E;  3PZD A;  1E8W A;  4HCN B;  1GPX A;  3UQB A;  2MBQ A;  1MG4 A;  5E6N A;  4JX1 C;  3B2F A;  3W1S C;  4I6N B;  1FD6 A;  2G1E A;  2NR2 A;  1HTQ A;  4DDI D;  2GBK A;  1P7E A;  3KYD D;  3W5V B;  3NS1 A;  3APF A;  2AWT A;  3RZF A;  3AH7 A;  3BVG A;  2Z59 B;  1NYR A;  1E90 A;  4XDC A;  3LXF A;  2KAJ A;  2BS4 B;  1TGZ B;  4BBN C;  2JX5 A;  2FE8 A;  4XZ4 A;  2Z0D B;  1F2R I;  3U8Z A;  3AMZ A;  4C7Z A;  5LXH A;  3TIX A;  4AJY B;  4BOZ B;  4M02 A;  3DBL B;  1FNW A;  3U7Z A;  3HRD D;  2LI5 A;  4RM9 A;  2XBB C;  4LNO A;  5AZG A;  1WYG A;  4F8C B;  4NJC A;  2C5L C;  2MX2 A;  3RMK C;  1ZE3 D;  3ZXR A;  2GBJ A;  3JVZ X;  3BYY B;  3Q8C A;  1TKG A;  1KH0 A;  4WJN A;  1IPG A;  1E9M A;  3MC9 A;  4M0W B;  1LM8 B;  1KTK A;  2KZR A;  1QOA A;  3Q8A A;  4KGS A;  4WJO A;  4LCD E;  2N1W A;  4JWU C;  4DHJ B;  1L6U A;  2WLB A;  4NJ7 A;  3URY A;  1C9F A;  1RLF A;  3AM9 A;  2ZZP B;  2N0S B;  2KDE B;  4P7I A;  1MVK A;  3V05 A;  1V80 A;  2DNF A;  1WJU A;  2L0F A;  3ML9 A;  4XE0 A;  4HEA 1;  1FXT B;  1SGH A;  2ZNV C;  4PT5 A;  2DAF A;  1UEL A;  4B95 A;  2BTE A;  3IAS 1;  2JSV X;  4C80 A;  1YJI A;  1E0Z A;  3RNC C;  1I4R A;  3FAH A;  1XQQ A;  2AQ1 B;  5JZE B;  2LFI A;  4OW0 A;  1SBB B;  2FNJ B;  2IYD B;  4LTU A;  3TEX A;  2PVG C;  2LJ5 A;  4ARC A;  3VUY A;  4TSS A;  4K3C A;  3AEB B;  1XLO A;  4QAY A;  2KFJ A;  1TS4 A;  1C77 A;  5HHD G;  2WXH A;  3Q14 C;  2RDH A;  1YN4 A;  4NAW B;  4RNA A;  4DDG D;  3PRM B;  5G5H A;  4W9F A;  3RI7 C;  2HDE A;  3AEE B;  3W5U B;  4MGY E;  1ZDX A;  1YX5 B;  3RD2 A;  3ZTC A;  3QC8 B;  3DBH B;  3WAM A;  1VCB A;  3S2A A;  1VLB A;  3AE1 B;  3HK0 A;  2MEK A;  2PIA A;  2NCN A;  3PTF C;  2Y5P A;  4OVU A;  4L23 A;  1DGJ A;  4GB9 A;  2X8X X;  1ET9 A;  3VR8 B;  2BS2 B;  3B9J A;  2KN5 A;  4WAF A;  1H8C A;  2I1K A;  2K8C A;  3NVY A;  2GBN A;  1V1P A;  2MSE D;  3APD A;  4JL9 A;  1N62 A;  5LXI B;  1Y8R C;  3MTN B;  2JQR B;  1WRD B;  3ZQ4 A;  3AV8 A;  4C4V A;  2BT6 A;  1IBX A;  2D07 B;  2L32 A;  2KFK B;  1SE4 A;  4JE3 B;  2I1J A;  3UIP B;  4II3 B;  4PK1 A;  4P1B C;  2DZK A;  3AE4 B;  2IO1 B;  4E74 A;  5CHW A;  4A20 A;  2QEJ C;  3KUC B;  4FHK A;  3VRB B;  2RD0 A;  4YXD B;  4MJS A;  3GOE A;  4NZL B;  1SXT A;  3ZJT A;  1FPY A;  2O6V D;  2ZVN A;  4MSQ B;  4FBJ B;  2JUO A;  2DHZ A;  4ZRK A;  1T0S C;  5BYQ A;  2IJ0 A;  4AUQ C;  1VZ6 A;  2N9P C;  4E71 A;  1TY2 A;  3LDZ E;  5BMI A;  1JWS D;  1YMH E;  2K8B A;  2KWU B;  1AN8 A;  1VZ8 A;  3DBR B;  3GB1 A;  1KJT A;  3JSV A;  2MJE A;  3NZU A;  3NOB A;  2KLC A;  2BWF A;  4DXF A;  1NDD A;  1XT9 B;  3RZW C;  2C7M B;  1T6B X;  1IYF A;  2IPK D;  3CWI A;  2KMA A;  3RNE C;  1EM7 A;  1E8X A;  1KOT A;  1WJ6 A;  2XK5 A;  4M01 A;  4K7S A;  1E6E B;  1EF5 A;  5BMH A;  1C1Y B;  2IGG A;  1N5X A;  3ONS A;  3IHP C;  4HVB A;  2GLS A;  3A9J A;  4KGR A;  3W1S A;  2LXA A;  2FAZ A;  2NBV B;  5J17 A;  1GG3 A;  2O6V A;  2TSS A;  1WJN A;  2KVR A;  4BZA A;  3KUD B;  5EDS A;  1KF6 B;  2BYV E;  3B08 A;  3VQI A;  1V86 A;  4DHZ E;  1TT5 B;  1PGX A;  3UGB B; 
#chains in the Genus database with same CATH homology
 3R3M A;  4GDL A;  4YL8 A;  4G3X B;  3DDC B;  3ZIM A;  1LQB A;  3EC8 A;  2QHO A;  2BYE A;  4FJY A;  4I6L B;  4MDK E;  3K9P B;  2K1F A;  5E6P A;  1EO6 A;  4ANW A;  2KKC A;  4CO7 A;  2JWZ A;  1WGD A;  2KO3 A;  1R4M I;  4GOC A;  4JQW C;  2WYQ A;  3VAW A;  3RT3 B;  4HWI B;  3DVN V;  3KW5 B;  4JIO U;  2IBI B;  3QA8 A;  3ZNG C;  2LVQ A;  1V49 A;  2J7Q B;  1YJ1 A;  4GN1 A;  3H7S A;  4II2 B;  4DBG A;  3PLV A;  1WY8 A;  2V3S A;  5AEK B;  1V5T A;  1WGR A;  2BKF A;  4IWP A;  3PSE B;  3U30 A;  4DHZ B;  2IY1 B;  3M62 B;  4GDK A;  2ZJD A;  3DVG X;  1WFY A;  3IG3 A;  2Z0E B;  5G2N A;  1WR1 A;  2KQS A;  2WX1 A;  3VDZ A;  2WWZ A;  4NJ6 A;  3ZRC A;  2G4S A;  4W9L A;  2DEN B;  3P2B A;  2RPQ A;  2VRR B;  4MGI E;  1GC6 A;  1H4R A;  4K1R B;  4DHJ D;  4RMA A;  3R7Q A;  3U7D A;  3CMM B;  2ZCC A;  3PS6 A;  4NY0 A;  4E3C A;  2BKR B;  2KK8 A;  1I42 A;  2MWS B;  3ZUN A;  2C7H A;  2HE7 A;  2EMS A;  2NPT B;  4EUT A;  4MEM A;  2UYZ B;  1V2Y A;  3TCA A;  4TV3 A;  2GBR A;  4TKN A;  3A33 B;  4WWO A;  4F1S A;  1WMH B;  2FID A;  1V9J A;  1WIA A;  4FLH A;  5JHB A;  2JF5 A;  2C7N B;  1HE8 A;  2JZ3 B;  4IM2 A;  3RCZ A;  4X57 B;  4GIV A;  1SIF A;  2KX0 A;  2MW5 A;  3EFU A;  2ZNV B;  4W9I A;  2KC2 A;  3TMP B;  3IBE A;  2B3A A;  3WAP A;  2DZI A;  2FCQ A;  2LRW A;  3DBR I;  2J0M A;  3L54 A;  3MHS D;  1R4N I;  1WXS A;  4GSW A;  2MCN B;  4TQ0 A;  5JHA A;  1XD3 B;  2AYO B;  2KC1 A;  3L13 A;  3H7P B;  2JXX A;  3V60 A;  3R66 C;  1WXV A;  3ZDT A;  2KJH B;  4FN2 A;  4EFO A;  4WWN A;  2XK5 B;  4CYE A;  3SHQ A;  4KSK C;  2OOB B;  4XX5 A;  5C23 A;  4FJZ A;  1GUA B;  3I3T B;  2G3Q B;  1C3T A;  2HTH A;  3PRZ A;  2ASQ A;  1S3S G;  3A9J B;  2KWV B;  4HPM B;  3ZLZ A;  1WE7 A;  3B1L X;  5KHO A;  4B9K A;  4EZK A;  4W9C A;  2N4F A;  5TR5 A;  5E6O A;  1EF1 A;  2O6V B;  4IM3 A;  2JRH A;  1OEY J;  2LVO A;  3H1U A;  3NZS A;  4GXB A;  1TBE A;  2ZPY A;  2KTR B;  3CST A;  3VFK A;  2LVP A;  2IZV B;  4BBN F;  2MP2 A;  4WWP A;  3CSF A;  1X1M A;  4DK5 A;  1Q5W B;  1V6E A;  2DYO A;  2KDI A;  1WJ4 A;  2G4D B;  3DBH I;  1UGM A;  4IC7 B;  4PS8 A;  2DYB A;  2GOW A;  4W9H A;  3WIM A;  4EZL A;  1WYW B;  4LJO B;  3ZKJ C;  5J18 A;  2KLG A;  3PZD A;  2G45 B;  4BVU C;  1E8W A;  3PHW B;  2BWE S;  2DX5 B;  4PYU A;  4HCN B;  3VUW A;  3UQB A;  2V4L A;  2MBQ A;  3IFW B;  5E6N A;  4AOF A;  2CS4 A;  4KDI C;  2HJ8 A;  3W1S C;  2L8J A;  1E8Y A;  4I6N B;  2R2Q A;  4XC2 A;  5GMV A;  3HM3 A;  2ZCB A;  3AXC A;  4ANU A;  4EOY A;  4EEW A;  1WF9 A;  2MBB B;  2NR2 A;  4GDK B;  3QHT A;  3JW0 X;  3AU4 A;  3Q3F A;  5KHQ A;  2LWP A;  4DDI D;  1E7U A;  3RUI B;  2GBK A;  3HHM A;  4ZRI A;  1ZKH A;  3KYD D;  2RGF A;  2N1V A;  2V1Y A;  3A9K A;  2YVC A;  3APF A;  3H9D A;  1LFD A;  3ECI A;  2AWT A;  3ZW3 A;  4W9K A;  2L0T A;  3VHT C;  1YIW A;  3EHV A;  2O2V B;  2CKH B;  3RZF A;  4MM3 A;  5AZH A;  2Z59 B;  2KWC A;  1E90 A;  1WX7 A;  3OAW A;  3UQA A;  4NQK E;  2M0X A;  2K8H A;  1TGZ B;  4BBN C;  4XZ4 A;  2Z0D B;  3PPA A;  3QAQ A;  3DQV A;  1WXA A;  5DPR A;  3DBS A;  3H6N A;  1EUV B;  4CHK A;  3U8Z A;  3V62 A;  3N3K B;  1TZ1 A;  1L7Y A;  4EZJ A;  5LXH A;  4MJS B;  2LUE A;  4IWO A;  3TIX A;  1GC7 A;  4ASW C;  4AJY B;  4AP4 C;  5D94 A;  4BOZ B;  3UF8 A;  2LD9 A;  1WI0 A;  4W9J A;  4NAW A;  2MBE A;  2YLM A;  3A1Q A;  4AJW A;  1OEY A;  2LI5 A;  4RM9 A;  3B0A A;  2XBB C;  3N32 A;  4IM0 A;  2JVC A;  2L76 A;  5FR6 A;  1WE6 A;  5AZG A;  2KXJ A;  4B6W A;  1WZ0 A;  1F9J A;  2M1M A;  1IP9 A;  2UWQ A;  1RAX A;  4F8C B;  1E5W A;  3DOW A;  1OGW A;  4HJK A;  2C5L C;  1CMX B;  2MX2 A;  4K7W A;  1J19 A;  3WAN A;  2GBJ A;  3JVZ X;  1L2N A;  3NHE B;  2KX3 A;  4W9G A;  4HLE A;  3KH0 A;  4WJN A;  4KZ0 A;  3HM6 X;  1IPG A;  3JSV B;  3PRP B;  4M0W B;  1LM8 B;  2KZR A;  5BO4 B;  5CHV C;  3LJ3 A;  4KZC A;  1WGG A;  4WJO A;  3SD5 A;  4LCD E;  2JY6 A;  4GGQ A;  1WGH A;  2N1W A;  3K9O B;  3X0W A;  4DHJ B;  3T8M A;  1P0R A;  5IA7 A;  4NJ7 A;  1RLF A;  4HCP B;  5G55 A;  3L16 A;  4IW0 A;  2K6Q A;  3BY4 B;  2OJR A;  2PE6 B;  2AL6 A;  4KDL B;  4OVV A;  2ZZP B;  4AWJ A;  2KDE B;  5JH5 C;  2LGD A;  4TQ1 A;  4P7I A;  2KJR A;  2IO0 B;  1V80 A;  1JRU A;  1WJU A;  2AL3 A;  2L0F A;  3ML9 A;  1WX9 A;  4LDT B;  1LXD A;  1FXT B;  1PQS A;  4K7U A;  1SGH A;  2ZNV C;  5D6J B;  2CU1 A;  1QZE A;  4ZDV A;  3MJW A;  2A4Z A;  2DAF A;  2DZJ A;  1UEL A;  3VH4 B;  1GJZ A;  1YD8 U;  2KFK A;  2NBW B;  4B95 A;  2REX A;  1UH6 A;  2C60 A;  4WQO B;  1M94 A;  1WM3 A;  3ALB A;  1E7V A;  2NPT A;  3PGE A;  1T0Y A;  4PS7 A;  1Z2M A;  4KIK A;  2FIF A;  3WA0 A;  5HKH A;  2MA9 B;  3EEC A;  1WGY A;  3PRE A;  4N9F 4;  1WMH A;  2AEH A;  2WX0 A;  1P9D U;  2CR5 A;  2JZZ A;  4GDL B;  2M4N A;  2KOX A;  3A9K B;  4NNJ B;  3L17 A;  1XQQ A;  3IVF A;  5JZE B;  4IUM B;  4A3O A;  2DZM A;  5D7G A;  1J0G A;  2NBU A;  4ICV A;  4W9D A;  2FNJ B;  3QIJ A;  1J8C A;  3D32 A;  2IYD B;  4BKT A;  3ZNH B;  1VD2 A;  3SU8 X;  3VTV A;  2LJ5 A;  1NBF C;  4MEL A;  1OQY A;  4BFR A;  3VUY A;  2RR9 A;  3DVN U;  2KQ7 A;  2FCM A;  3QCA A;  2KFJ A;  4ANV A;  4FAD A;  2MRP A;  2CHZ A;  1WR6 E;  2MLB A;  2RSU A;  4NQL B;  5J2R A;  2R2O A;  1MG8 A;  3DVG Y;  3X23 A;  4G0N B;  4MGK E;  3OJ3 A;  4HDQ A;  5DPW A;  4NAW B;  2LGY A;  1AAR A;  2LGX A;  3UIN B;  3ZO5 B;  2FUH B;  3PRM B;  4DDG D;  2KHW B;  4W9F A;  3PHX B;  1GNU A;  1RRB A;  4MGY E;  4HPL B;  1ZW7 A;  1TTN A;  1YX5 B;  3RD2 A;  3DBL I;  3ZTC A;  2K39 A;  3WAO A;  2L7R A;  3QC8 B;  2J0J A;  2L00 B;  4DXA B;  3WAM A;  3RUL A;  1VCB A;  3S2A A;  3VXW A;  2N7E A;  1UD7 A;  3Q3J A;  4HK2 A;  4IWQ A;  1S1Q B;  3L0W B;  1NI2 A;  1U4A A;  2PJH A;  3HIZ A;  3KYC D;  5CX3 A;  3TL5 A;  4A3P A;  4FA6 A;  2CHX A;  1WXM A;  2KTF A;  3ZTD A;  2FCS A;  1UBQ A;  4G11 A;  3M63 B;  1WZ3 A;  1Q1O A;  3HK0 A;  3AU5 A;  3OJ4 B;  3N30 A;  3TBL D;  2KD0 A;  2NCN A;  4ANX A;  2D2Q A;  3PTF C;  3V61 A;  4OVU A;  2ZVO A;  2A5U A;  1P98 A;  1UZX B;  2ZEQ A;  2D3G A;  2BYF A;  3ML8 A;  4GMV A;  2JPH A;  2FCN A;  1WH3 A;  4GB9 A;  2C9W B;  1KLV A;  1P3Q U;  4MSM B;  2KN5 A;  1YX6 B;  3SDL C;  1H8C A;  2I1K A;  2PE9 A;  2K8C A;  2KAN A;  2M17 A;  2NVU I;  2KNB A;  2GBN A;  4URK A;  1KM7 A;  4JGH B;  2MSE D;  3DCG A;  2BGF A;  3APD A;  2LXC A;  4JL9 A;  1ZGU B;  1WM2 A;  4DWF A;  5LXI B;  4BKS D;  4HDO A;  1SE9 A;  3NY5 A;  1Y8R C;  3MTN B;  3VTW A;  1WRD B;  3W1Y A;  2IO2 B;  4ZYN A;  3L10 B;  5CHF A;  3QJZ A;  5CTR C;  5L83 A;  4F7Z A;  2D07 B;  4WAA A;  3M95 A;  2K6D B;  3C0R B;  5DCN A;  2KFK B;  3AI5 A;  2MBH A;  5DPT A;  2EKE C;  2I1J A;  2KDB A;  3UIP B;  2JRI B;  2O2V A;  4II3 B;  2XEW A;  2PEA A;  4WJQ A;  1OTR B;  4G50 A;  2KDF B;  4KVG B;  2MP2 B;  2DZK A;  2KMC A;  2IO1 B;  4KIK B;  4M8N A;  3QK0 A;  3VUX A;  3ZRF A;  3L08 A;  4FHJ A;  5CHW A;  4A20 A;  3UIO B;  3KUC B;  4FUL A;  4E74 A;  3QX1 A;  4FHK A;  1D3Z A;  2RD0 A;  1Z5S B;  3A4S C;  2BPS A;  4LDT D;  2K25 A;  2N9X A;  3AUL A;  3PVL A;  2M8S A;  4JLC A;  4LJP B;  4MJS A;  4ZRJ A;  2BF8 B;  4WJP A;  3GOE A;  2ZVN A;  2O6V D;  4MSQ B;  5IAA C;  4FBJ B;  3DPD A;  3TJP A;  3T9L A;  2JUO A;  2DHZ A;  2L05 A;  1WX8 A;  4I6P A;  4ZRK A;  4KV2 A;  3M3J A;  2N9E B;  2GBM A;  3GZN I;  4AUQ C;  3OLM D;  2N9P C;  1ISN A;  3PLU A;  2IO3 B;  4E71 A;  3LDZ E;  2EMT A;  1E8Z A;  2NS5 A;  4HXD A;  4W9E A;  4J6I A;  2Y5B B;  1P1A A;  1V81 A;  4ICU A;  2K8B A;  1UBI A;  2CHW A;  2KJ6 A;  3PT2 B;  1RFA A;  2KWU B;  5DPS A;  3VTU A;  3KVF B;  2W9N A;  3ZVV A;  3QWZ B;  2J0K A;  3V6E B;  5C1Z A;  1KJT A;  4BKS A;  3JYU A;  4BOS C;  2L3Z A;  3JSV A;  4EKU A;  3NZU A;  1Q0W B;  3NOB A;  2KLC A;  2BWF A;  2LZ6 A;  5LLI A;  1NDD A;  3VH3 B;  1XT9 B;  2D11 A;  1YQB A;  2C7M B;  3RZW C;  1A5R A;  1IYF A;  4BKG A;  2DAJ A;  2KMA A;  3H7P A;  1BT0 A;  3R7R A;  2WDT B;  1E8X A;  1KOT A;  3BIN A;  3KUZ A;  1WJ6 A;  2XK5 A;  4IG7 B;  5L95 C;  4K7S A;  4MGZ E;  1K8R B;  1EF5 A;  3CF6 E;  3ENE A;  1C1Y B;  4MH0 E;  3ZDM C;  3QAR A;  3APC A;  3RYT A;  3O65 B;  3ONS A;  3A1Q B;  4M8M A;  3IHP C;  4TUU A;  4HVB A;  4GU2 A;  3A9J A;  2DYM A;  2JT4 B;  1I35 A;  2MQJ A;  3NS8 A;  4FJV B;  3W1S A;  2LXA A;  2D10 A;  2FAZ A;  4K81 A;  2NBV B;  3VVW B;  5J17 A;  1GG3 A;  2O6V A;  3A4R A;  2GMI C;  4NPN A;  3ZNZ B;  1WJN A;  1V5O A;  2IY0 B;  2KVR A;  2ZPN A;  5D2M B;  3KUD B;  2LAS A;  1G6J A;  2KTR A;  2PPH A;  3V6C B;  4KSL C;  4PYZ A;  2MBO A;  2LRU A;  4RM8 A;  5EDS A;  3ZNI D;  4PS3 A;  2BYV E;  2N7D A;  3B08 A;  5AZF A;  3VQI A;  1V86 A;  2HD5 B;  4DHZ E;  3QQ8 B;  3UGB B;  3PV1 A;  3WAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...