2NPTB

Crystal structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (map2k5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (map3k2-phox)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
82
structure length
82
Chain Sequence
NDVRVKFEHRGEKRILQFPRPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLVING
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 5
publication title Crystal Structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (MAP2K5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (MAP3K2-phox)
rcsb
source organism Homo sapiens
total genus 21
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2nptB01
4WJQA 4KSKC 4I6LB 5AZGA 3SHQA 2R2QA 1ZGUB 3VH4B 1V9JA 1SE9A 3RZWC 2Z0DB 2CS4A 2GBMA 1V5OA 3PSEB 3SD5A 4HPMB 4IUMB 5G2NA 1C1YB 3PLVA 4LDTB 2I1KA 2KDFB 4IC7B 3WALA 4TQ0A 4B9KA 2EMTA 1E7VA 1WMHB 2PE9A 3PV1A 4NPNA 3ZNGC 2RD0A 2KMCA 1PQSA 2KX0A 3TJPA 3QK0A 2DZMA 4W9KA 1R4NI 2FNJB 1E7UA 2J0JA 4NQKE 3DPDA 4ANVA 4AJWA 2LWPA 4IM0A 4B95A 1UELA 2CU1A 3VUXA 2NBUA 3UIPB 4GOCA 3O65B 3OJ3A 4MGYE 2KANA 4EOYA 5LXIB 3RD2A 1VD2A 2GBJA 3WA0A 4JLCA 3H7PA 1UH6A 2N9XA 4HVBA 3ECIA 4A3PA 1S1QB 2HTHA 2JY6A 2NR2A 5CHWA 4JL9A 4F8CB 2MBEA 5DCNA 5C23A 2ZVNA 3KW5B 4WAAA 2KJHB 3V61A 2LGYA 3EFUA 2KVRA 2K25A 4W9HA 4DDGD 2G4SA 1WZ3A 2OOBB 2JZZA 3K9OB 4LJPB 4M0WB 5E6NA 3VQIA 2ZPNA 1UBIA 3QWZB 1MG8A 4MEMA 4HCPB 3ZUNA 2KN5A 3AULA 2RGFA 3EC8A 4GXBA 5DPRA 2GBNA 2KNBA 2OJRA 4W9IA 5G55A 3H9DA 3W1SC 4BOZB 4FJYA 2FCMA 2V3SA 4MSQB 4WWPA 2FUHB 4GB9A 1NDDA 2NS5A 5E6OA 3UQAA 4AUQC 2M17A 2C7NB 1UD7A 1P1AA 1WYWB 3A1QB 5CX3A 1E8WA 2KMAA 3M95A 4ZRKA 1V49A 2MA9B 3A9KA 1L7YA 2Y5BB 1GC6A 4CO7A 1C3TA 2JUOA 1JRUA 2LD9A 1WRDB 4WJPA 3UINB 2N7DA 1SIFA 2DENB 2YVCA 4KIKB 1WJ6A 3QHTA 3PRZA 4NAWB 4W9DA 4W9GA 3A9JB 2ZCBA 4WJNA 3CMMB 4MJSB 5HKHA 4P7IA 1HE8A 2DYOA 3APDA 2NPTB 1J19A 2REXA 1J0GA 1E8ZA 1R4MI 1V6EA 4K81A 4N9F4 2VRRB 1SGHA 2QHOA 2K6QA 4I6NB 1UBQA 2UWQA 2LRUA 3KUZA 5TR5A 1WM2A 4AOFA 2NCNA 2EMSA 3D32A 4IWQA 2CHZA 3QJZA 3PS6A 5J2RA 4WJOA 3VTUA 3HHMA 5J17A 3P2BA 4ZRIA 4MGKE 3NS8A 3RT3B 5CHFA 2MWSB 4GMVA 2DHZA 4GDLB 4RM8A 3UQBA 3L17A 2IO3B 3UGBB 1V86A 1WMHA 4BFRA 4BOSC 1XD3B 2BWES 2JT4B 4URKA 1YIWA 2D3GA 3MTNB 4GGQA 3ONSA 4MSMB 4NY0A 2O2VB 2ZPYA 1WI0A 4K7WA 2J0KA 3PRMB 3R7QA 2L0TA 3L0WB 3L13A 3EECA 5AEKB 2FIFA 5L95C 2LJ5A 3PGEA 4W9EA 2L3ZA 2FCSA 3PHXB 2KFKA 1WR6E 2MP2A 5IA7A 1J8CA 4W9CA 2G3QB 1VCBA 4TQ1A 3X23A 1F9JA 2WX1A 1EF5A 3EHVA 4II2B 3HM3A 4DBGA 4GDKB 3T9LA 2J0MA 2MSED 3LDZE 4NNJB 1EO6A 4HK2A 2KK8A 2W9NA 3ZO5B 2KTRB 2I1JA 2FCNA 4HLEA 2K8BA 4DDID 4IWOA 1FXTB 3JSVB 2LVQA 4GN1A 3VH3B 2GMIC 2Z59B 2KDEB 3NZSA 3RUIB 4GSWA 5D7GA 3QCAA 4EZLA 1WX7A 4IM2A 2KWVB 1GG3A 3RCZA 3H6NA 1WXAA 3DVGX 2AL3A 2MRPA 1Q1OA 3T8MA 2K1FA 3V62A 3KUCB 2RR9A 4J6IA 1S3SG 2LGXA 2IY0B 2LXCA 3KVFB 5AZHA 2IYDB 2LVPA 3ZDMC 2G4DB 1KJTA 3PLUA 4X57B 4OVVA 4ZDVA 3TIXA 4RM9A 1UGMA 1WGHA 4JGHB 3VFKA 3QIJA 3SDLC 1Q0WB 2JXXA 3WANA 3DVGY 5JHBA 4E71A 1WR1A 5BO4B 3IFWB 4TUUA 3R7RA 3MHSD 3A9JA 4G50A 1TTNA 1WXSA 2B3AA 2NVUI 2ZNVC 1CMXB 1H8CA 3DBRI 4DXAB 2KD0A 2O6VA 4WWNA 2N7EA 2Z0EB 3ZTDA 3W1YA 2IO0B 2K6DB 2L0FA 3QAQA 2DX5B 4KV2A 1IP9A 4FHJA 3M3JA 4W9JA 3B0AA 3R66C 3H7SA 2NBVB 3ZIMA 1T0YA 4HDQA 2LASA 5JH5C 1WJUA 3V6CB 4TV3A 4CHKA 5D6JB 1I35A 2KLGA 2BWFA 5CTRC 4E74A 1YD8U 1OTRB 4FADA 2JVCA 3DVNV 1RLFA 1KM7A 1Y8RC 2N1WA 2ZVOA 3WAPA 4E3CA 1GJZA 4ANWA 2BYVE 4NJ6A 1L2NA 1OEYJ 1LXDA 2MX2A 5KHQA 2L7RA 4LJOB 2FCQA 5GMVA 4XX5A 4IWPA 3R3MA 3K9PB 3AU4A 3V60A 3A33B 2K39A 4AJYB 4A20A 2KZRA 3PREA 4YL8A 4DK5A 2PE6B 3AU5A 2L00B 2G45B 2KO3A 2LUEA 3CF6E 3VHTC 2LZ6A 3JYUA 3H7PB 3ZKJC 3U7DA 3VXWA 2NBWB 2KC2A 2DZKA 4DHJD 4KZCA 1ZKHA 4JIOU 4BBNC 1XT9B 2EKEC 1WE6A 2FAZA 2KJRA 3X0WA 4IM3A 4F1SA 3OLMD 4EKUA 1KOTA 5EDSA 3PRPB 4MELA 4ASWC 1XQQA 2D10A 1WE7A 2YLMA 3VUWA 2AYOB 1H4RA 3QARA 1P3QU 2DZIA 3VUYA 2KTRA 3ZTCA 2M4NA 4BVUC 3HM6X 4K7UA 4BKGA 5DPWA 1D3ZA 2FIDA 2N1VA 3NZUA 2MBHA 3B08A 4FA6A 2KC1A 3VDZA 5LLIA 4HPLB 4BKSA 2C9WB 1WH3A 2XK5B 1X1MA 2ZCCA 1I42A 4DHJB 3ZNZB 4PS3A 4FULA 4BBNF 4KDIC 1Q5WB 2C7MB 1E5WA 2M8SA 1RFAA 2IY1B 3MJWA 1NBFC 1IPGA 2J7QB 3IHPC 3S2AA 2ZJDA 3AI5A 3A9KB 2N4FA 1LM8B 3BINA 3NOBA 4M8MA 2JRIB 5KHOA 3HIZA 2ZEQA 3Q3JA 3IBEA 4TKNA 2DZJA 4PYZA 3QQ8B 5D94A 2LVOA 4LDTD 4ANXA 3CSTA 2BGFA 3N30A 3ZW3A 4EZKA 1LFDA 1WXMA 2AWTA 4M8NA 3TL5A 2D07B 2V1YA 2WX0A 3QC8B 2KKCA 3PT2B 4G0NB 4RMAA 4KVGB 2KQ7A 1E8YA 3KYCD 3WAOA 1TBEA 1G6JA 2GBRA 2R2OA 4W9LA 2LGDA 4PS8A 1GNUA 1U4AA 3RYTA 2UYZB 2WWZA 3VAWA 1NI2A 1YX5B 2IBIB 2CR5A 1WM3A 1WGDA 1WX9A 1IYFA 1WX8A 4XC2A 2KTFA 2KOXA 1KLVA 2AL6A 3NHEB 2GOWA 3UF8A 1P9DU 2D2QA 3U30A 4FN2A 4ICVA 1WJNA 3JW0X 3A1QA 3GZNI 3PHWB 2A5UA 2RPQA 3IG3A 4NJ7A 2IO2B 2AEHA 4DWFA 4II3B 2MBOA 4IW0A 4DHZB 5DPTA 4LCDE 5J18A 3L16A 3PVLA 2D11A 1K8RB 5AZFA 2C60A 3V6EB 2DYBA 3C0RB 2DAFA 3RULA 1WIAA 3PTFC 2N9PC 4KIKA 2BYFA 2M0XA 3QX1A 4NAWA 4B6WA 4MGIE 2K8CA 4FJZA 4GIVA 1OEYA 1TZ1A 4MJSA 3W1SA 3APCA 3M63B 4XZ4A 1OQYA 2NPTA 1OGWA 3KUDB 3VTWA 1TGZB 4EEWA 3U8ZA 2KFKB 2MP2B 3WAMA 3Q3FA 4MM3A 2KXJA 2ZNVB 4EFOA 4I6PA 1V2YA 2JZ3B 1E90A 3GOEA 3IVFA 3AXCA 5IAAC 3VVWB 4K7SA 1EUVB 5JHAA 1LQBA 2JPHA 3TBLD 1YQBA 2CHWA 4FJVB 2KDIA 5E6PA 2PJHA 3KH0A 1WZ0A 4G3XB 3DDCB 3NY5A 3OJ4B 5D2MB 4CYEA 2XEWA 2V4LA 4GDLA 2BPSA 3L10B 3PZDA 2MW5A 2KDBA 2BKFA 2N9EB 3VTVA 2GBKA 4HWIB 3TMPB 4FLHA 1EF1A 3DVNU 1Z2MA 5DPSA 3N3KB 2O6VD 1WY8A 1WXVA 2O2VA 2XK5A 1YJ1A 3APFA 3SU8X 4NQLB 4F7ZA 5CHVC 4AP4C 1YX6B 2MBBB 3PPAA 3OAWA 1V5TA 1AARA 2PEAA 2DAJA 2WYQA 3ZLZA 1M94A 3ZDTA 3M62B 3ZRFA 2KFJA 3UIOB 1A5RA 2KWCA 5FR6A 2L8JA 2MCNB 3L08A 3LJ3A 2KQSA 4HJKA 4ZYNA 1V81A 2JRHA 3ZVVA 1ISNA 1P0RA 2A4ZA 2RSUA 4GDKA 3DQVA 1WF9A 4JQWC 1WFYA 3ML9A 2M1MA 4PS7A 4KZ0A 3ZNID 4WQOB 3L54A 2KX3A 4ICUA 2LRWA 2BYEA 2C5LC 2O6VB 3QA8A 4FBJB 4A3OA 3A4RA 3ZNHB 3JSVA 4ANUA 3H1UA 3KYDD 1P98A 1WJ4A 2JF5A 3TCAA 1QZEA 4FHKA 3DBLI 2ASQA 2IO1B 5LXHA 2C7HA 3DBSA 2BF8B 3JVZX 4OVUA 2CKHB 1Z5SB 2LI5A 3HK0A 3N32A 4KSLC 3RZFA 2KLCA 2BKRB 4GU2A 2MBQA 3ZRCA 2K8HA 2LXAA 4MH0E 4EZJA 1RRBA 4MGZE 4K1RB 4HXDA 2HJ8A 2PPHA 2WDTB 1BT0A 4DHZE 3WIMA 4BKTA 4PYUA 4WWOA 1UZXB 4IG7B 2JWZA 3A4SC 4W9FA 1ZW7A 3CSFA 5C1ZA 2CHXA 4KDLB 3ML8A 4AWJA 2KHWB 4ZRJA 2IZVB 4HCNB 4EUTA 1RAXA 3I3TB 2L76A 2DYMA 4BKSD 3DOWA 1V80A 2KJ6A 1WGGA 1GUAB 4HDOA 2HE7A 1WGRA 2XBBC 2ZZPB 3ALBA 3ENEA 5L83A 1GC7A 3BY4B 2MLBA 4G11A 2KWUB 5JZEB 2HD5B 4MDKE 1WGYA 2L05A 3DBHI 3B1LX 3DCGA 2MQJA 1E8XA
chains in the Genus database with same CATH superfamily
3CIRB 1SE4A 1VLBA 2KQ4X 4B0EA 1SE3A 3PSEB 2GBMA 3W1SA 2RMMA 4IUMB 4TQ0A 4IC7B 2PE9A 1E7VA 4NPNA 4LNIA 2KMCA 3O13A 3TJPA 1GB1A 2DZMA 1NYRA 1R4NI 1E7UA 3DHHC 3I9V1 4ANVA 2BS2B 1K51A 4YTMB 4RGMA 1ENFA 5BYRA 3UIPB 5H8YE 2KANA 2GBJA 4JLCA 4OW0A 3H7PA 2H89B 4A3PA 4HVBA 2Z8LA 3P42A 4AQ7A 1ZDVA 4WAAA 3V61A 4W9HA 1YN4A 2G4SA 1WZ3A 2OOBB 5E6NA 3Q8AA 2WU2B 3MHZA 1UBIA 2KN5A 2RGFA 2KNBA 2TSSA 2OJRA 2AQ3B 4W9IA 3H9DA 2FE8A 2V3SA 1NDDA 2NS5A 5E6OA 3UQAA 2M17A 4ZRKA 2MA9B 3N20C 1FRDA 4M02A 1C3TA 3IAS1 1JRUA 2LD9A 1WRDB 4WJPA 3FILA 1SIFA 2YVCA 3A9JB 1D6EC 2ZCBA 2ZW0A 5IP4D 2REXA 4K81A 1R4MI 4N9F4 3SR6A 4ARCA 2VRRB 2JQRB 3NZ3A 2UWQA 4AOFA 1SEBD 1AN8A 3BVZA 2SEBD 1ZXIA 3R8BA 2VZKD 3L17A 1WMHA 4BOSC 3I57A 4MSMB 3AEDB 4DQOC 3MJ5A 4K7WA 3TEXA 4M01A 3L13A 4LNFA 4IDIA 2LJ5A 4W9EA 1VCBA 3X23A 2WXGA 4C4VA 3U52E 3P4SB 3T9LA 2MSED 4HK2A 3ZO5B 1AW7A 2CJOA 1QILA 4DXFA 2K8BA 4XDDA 2LUMA 2V3NA 2JSVX 2KDEB 3RUIB 1R4NB 1WX7A 2GRIA 3ZGZA 4MH8A 2KT7A 1WXAA 3BYYB 3N9YC 1Q1OA 1TS3A 3V62A 4C00A 2RR9A 1HQRD 3ZJVA 1V1PB 5AZHA 2IYDB 3TUOA 3TIXA 1UGMA 2AQ1B 3QIJA 5BMIA 4LNKA 2NTTA 3AE9B 2LJIA 4TUUA 1MHXA 4G50A 2KD0A 3W1YA 1ZDXA 2L0FA 4FHJA 3H7SA 1T0YA 1CQVA 5D6JB 2KLGA 1FMAD 2BWFA 1UGJA 3DVNV 1RLFA 2N1WA 4ANWA 1FCCC 1L0VB 2WU5B 2MX2A 4BZAA 2V9HA 1NYQA 2FCQA 2INCC 4XX5A 5GMVA 3AU4A 2IPKD 3V60A 2K39A 1SIJA 4AJYB 2KZRA 4YL8A 5H92C 3ZKJC 4B0MA 2IJ0A 2L1AA 3NS1A 4JIOU 1XT9B 1WE6A 3OLMD 2QCZA 4NAMA 3RNAC 5EDSA 1FRRA 2D10A 4A90A 4CQNA 2DZIA 4UDUC 2VH1A 1D3ZA 3BIID 2WXQA 4HPLB 3Q3MC 1WH3A 1TS5A 3BWUD 3E56A 1QT9A 2M8SA 3S2AA 3IHPC 2WXLA 3Q2AC 1VZ7A 1SXTA 3IBEA 1FFVA 2LVOA 4YTNB 4ANXA 2BGFA 4EZKA 1WXMA 2WLBA 4RF0A 3NJTA 4RMAA 2IGHA 3KYCD 3B2FA 4PS8A 2UYZB 5EE3A 2G1EA 1WX8A 2KOXA 5EE1A 3UF8A 1VDVA 3BVMA 1QOBA 2I2YA 3U30A 4FN2A 3JW0X 2IGDA 1P7FA 2IO2B 2AEHA 4DWFA 4II3B 1QOAA 3L16A 2I38A 1OQQA 2C60A 2DAFA 1WIAA 1VZ8A 2MJEA 2M0XA 4C7YA 4B6WA 2K8CA 4FJZA 4GIVA 3M63B 4XZ4A 3KUDB 1TGZB 3W9CB 2KFKB 3WAMA 1E90A 1WRIA 5IAAC 3R2TA 4FJVB 4LNNA 3DDCB 4YWGG 2BPSA 3ZJUA 2MW5A 2KDBA 2BKFA 3GB1A 5C3JB 1LGRA 4HWIB 4FLHA 1DGJA 2QMTA 4P1BC 1E7PB 3N3KB 5D3IB 3PPAA 3M62B 1YQ4B 5FR6A 5G5GA 1MG4A 2W55A 2WDQB 2KN4A 4OVZA 1FCLA 2RSUA 1WFYA 2C5LC 1UWMA 1TKYA 3KYDD 1WJ4A 2JF5A 3DBLI 1D5MC 3RFZB 4C7ZA 2BS3B 1Z5SB 3IT6B 5E6JA 4GU2A 2BKRB 2RDGA 1IGCA 4EZJA 4OZBA 1V1PA 4K1RB 4MGZE 4HXDA 2PPHA 1C9FA 1BT0A 4DHZE 3FILB 4IG7B 3A4SC 3WCQA 3AE3B 2IZVB 2DYMA 2KJ6A 3EA6A 1SSNA 2ZZPB 2XBBC 3ALBA 2MLBA 2KWUB 5JZEB 2HD5B 1WGYA 3DCGA 3WALA 3H1UA 1E8XA 3Q8CA 4WJQA 2L32A 4D2KA 4I6LB 5G5HA 3SHQA 2R2QA 2Z0DB 2CS4A 5G2NA 4B9KA 2EMTA 1WMHB 3SEBA 3AE7B 2V4IB 2KX0A 2M19A 4W9KA 2J0JA 2PVOD 1XLPA 2LWPA 4LNOA 1D5XC 4GOCA 3OJ3A 3AECB 4WQMA 3KWVA 1S1QB 2HTHA 1EU3A 2K3UA 2ICIA 5CHWA 1UWXA 4LLGM 5C23A 2KJHB 2KVRA 2K25A 1Q10A 3UI3A 4BAXA 2ZPNA 2IGGA 3EC8A 4GXBA 2H88B 2GBNA 5G55A 4MSQB 2FUHB 4WWMA 4GB9A 4AUQC 2C7NB 1P1AA 2B76B 1C79A 1WYWB 3A1QB 1E8WA 1SB3C 1XF5L 2Y5BB 3FC4A 3RMKC 3QHTA 4W9DA 1L0XB 4W9GA 5HKHA 4WJNA 5JXVA 2NPTB 1J19A 1J0GA 4WIPA 1HXYD 2ZW1A 5TSSA 3DBLB 4I6NB 3GE3C 2MJDA 2QSDA 1UBQA 1PGXA 2WXIA 3KUZA 3OWEB 3SFDB 4RGTA 1WM2A 2NCNA 3D32A 5J2RA 1VJKA 2WXPA 3HHMA 5J17A 2JYTA 4ZRIA 3NS8A 4C56C 5CHFA 2MWSB 2PKOA 2WDVB 4GDLB 4RM8A 2ACZB 3KQ4A 2LHDA 4URKA 1YN5A 4NY0A 4K3BA 2BQQA 4H2AA 2O2VB 3I63C 2ZPYA 2MHJA 3P4QB 3L0WB 1ZXHA 4K3CA 4PK1A 2FIFA 5L95C 1JROA 2Y5PA 3PGEA 3VRAB 2L3ZA 2KFKA 1WR6E 1NI3A 4TQ1A 2NTSA 3HM3A 4DBGA 2YEPB 3LDZE 5AUKA 3RNGC 2WS3B 1TYGB 1FNWA 2W82A 3U4EG 2EKIA 1L6UA 3QCAA 1FFUA 3HUIA 3AE4B 1MJDA 3H6NA 2MRPA 3HVZA 1P7EA 2YEPF 3Q8FA 1RM6C 4J6IA 1N61A 1S3SG 2QEJC 1UUPA 2IY0B 3KVFB 3ZDMC 1KJTA 3PLUA 4X57B 4ZDVA 4JGHB 3VFKA 3SDLC 1JWMD 1JALA 3AEEB 1T6BX 1SJED 1B9RA 1L5PA 1F52A 2NVUI 2ZNVC 1CMXB 1H8CA 4TMAB 2N7EA 2K6DB 3FAHA 2LGIA 5C2TB 5T8IA 3M3JA 2NBVB 3ZIMA 1QOFA 4HDQA 4CHKA 3BK1A 1TT5B 2K22A 1Y8RC 3WAPA 4E3CA 4RCOA 1N6ZA 2BYVE 1L2NA 1N63A 1HZ6A 1LXDA 2WXRA 5KHQA 4LJOB 2R61A 3K9PB 2JX5A 1EWYC 3A33B 1T0QC 3FKYA 4A20A 3PREA 4A55A 3AU5A 2L00B 1N60A 2KO3A 3CF6E 1FIQA 2LZ6A 3Q8BA 3E9SA 3VXWA 4DHJD 1IGDA 1ZKHA 2CJNA 2FAZA 2KJRA 1KLGD 4EKUA 1KOTA 4QAYA 3VUWA 2KTRA 3GS2A 4BVUC 3HM6X 4K7UA 2BTEA 2FIDA 2N1VA 3NZUA 5IOIA 5LLIA 4BKSA 4HROA 2C9WB 3IT4B 2ZCCA 1E0ZA 4PS3A 2C7MB 2IY1B 3AM9A 2J7QB 2ZJDA 2N4FA 1LM8B 3NOBA 4KKJA 2JRIB 5KHOA 3HIZA 3TEZA 4OZAA 4PYZA 3QQ8B 1HEZE 3CSTA 3N30A 1C77A 1ROEA 1K52A 2ON8A 4M8NA 2QIEB 3QC8B 2V1YA 4W9LA 2LGDA 3VAWA 1GNUA 2IBIB 1FO4A 2CR5A 4USAA 1WGDA 2BBCA 4XC2A 1XLOA 2X38A 1KLVA 2GOWA 2D2QA 1PYWD 2CU3A 5HHDG 3A1QA 3PHWB 1WXQA 2MBOA 4LCDE 3PVLA 4J3OD 1K8RB 5AZFA 3PTFC 4REZA 4PT5A 3SFEB 4MGIE 1TZ1A 1OQYA 2NPTA 4OHJA 3VTWA 4EEWA 3U8ZA 2RDHA 1DOIA 2DBYA 4JWSC 1XLQA 1N5WA 3VVWB 5JHAA 1I4QA 2E6XA 3TBLD 2CHWA 1L4DB 1MVKA 1ET6A 1XLNA 1WZ0A 1JCKB 1IBXB 5D2MB 2V4LA 4GDLA 3L10B 3PZDA 2N9EB 3VTVA 2MEKA 1EF1A 5DPSA 3VR8B 2O2VA 1WXVA 4HJGE 1ZE3D 2IDYA 2JWUA 1PFDA 4F7ZA 5CHVC 1YX6B 2MBBB 3BYTB 3OAWA 1V5TA 1TY0A 2DAJA 2Y5CA 3ZLZA 4RNAA 1YJJA 3AE6B 1A5RA 2KWCA 2KQSA 1MHHE 1V81A 4XE0A 2W3RA 4JQWC 3ML9A 4TSSA 4WQOB 2KX3A 1D4BA 2O6VB 3QA8A 4A3OA 3A4RA 1P98A 3AE8B 3TCAA 1QZEA 2IO1B 5LXHA 2FUG1 1KLUD 1YJIA 2M0AA 1ESFA 2WXJA 3N32A 2LI5A 2BYTA 2KLCA 2MBQA 3ZRCA 3C19A 4MH0E 4XGAB 2WDTB 3N1ZC 1F77A 3DWGC 2JWZA 1VZ6A 4W9FA 5C1ZA 2CHXA 4AWJA 3DHIC 4ZRJA 3LYYA 3Q14C 5AUIA 2L76A 2KVZA 1V80A 3NVVA 4ZHOA 4HPPA 1GUAB 4RH6A 3ENEA 1WGRA 1GC7A 4YXDB 4MDKE 4KZCA 2BB5A 2MQJA 4M00A 1HTOA 4KSKC 3VH4B 4MT5A 1V9JA 1SE9A 3SD5A 1V5OA 3BVGA 1GB4A 4LDTB 2I1KA 2KDFB 2RD0A 2D5GA 1I4XA 4JE3B 2K0PA 1PQSA 3QK0A 2FNJB 4JX1C 3DPDA 4AJWA 4IM0A 1YMHE 1B1ZA 4B95A 1HTQA 1D5ZC 2NBUA 1JWUD 1QKZA 3MP9A 3O65B 2OEDA 2HDEA 1UH6A 2N9XA 3W5UB 4JL9A 2KDMA 5DCNA 4MACA 3H8HA 4IOIE 1CJEA 2LGYA 3EFUA 1WSPA 4L2YA 3K9OB 2JZZA 4LJPB 4S0RA 3RI7C 5FK9C 3VQIA 2RDBC 4HCPB 3ZUNA 3AULA 5DPRA 3NVWA 3W1SC 2PVGC 2HJ1A 5CX3A 1UF0A 1V49A 3AE1B 1L7YA 1XO3A 1GC6A 1ZP0B 2LEKA 3TEYA 2N7DA 2DENB 4KIKB 1WJ6A 1C76A 1C78A 4P7IA 2DYOA 1DOYA 3APDA 1E8ZA 4WAFA 4MM3B 3W2DA 3DHGC 5IO9A 5TR5A 1J7AA 3BZDB 2EMSA 4ZYSA 3PS6A 1JWBD 1JQ4A 3ZQ4A 3P2BA 4MGKE 3RT3B 4GMVA 3MC9A 3P4RB 3UGBB 1V86A 1ZPSA 1YIWA 3MTNB 4GGQA 3ONSA 5LNK1 3R7QA 1KF6B 5HI1A 3RNCC 3EECA 5AEKB 1F1HA 2J52A 1KH0A 2Q5WD 1FD6A 2FCSA 2QILA 5IA7A 4AS1A 3AE2B 4LK0M 1F9JA 2WX1A 3EHVA 4II2B 3BK2A 4GDKB 2VZKB 1EO6A 1R7SA 2KTRB 4HLEA 1IBXA 1FXTB 4GN1A 3VH3B 1JW9D 2GMIC 4Q2JA 3NZSA 3N1YC 3RNBC 4IM2A 1GG3A 3Q69A 3ABVB 3DVGX 1HA5A 3T8MA 3KUCB 3ETRA 1NENB 4DXGA 2GB1A 4OVVA 3LXFA 4O1NA 5BYSA 5HFYA 1WYGA 2UU7A 2JXXA 3DVGY 5BO4B 1J7BA 1KFYB 3HRDD 3MHSD 1WGKA 2MH7A 1M4VA 3EUB2 2O6VA 4WWNA 1E6EB 2IO0B 4KV2A 1RWSA 3R66C 1FXIA 2LASA 5JH5C 1WJUA 3V6CB 4TV3A 1I35A 5BMGA 1TS4A 4FADA 4E74A 2JVCA 2AX5A 1GJZA 1L6VA 4NJ6A 1XCQL 1PUTA 1GAQB 1OEYJ 3U2SC 2L7RA 2QJLA 4ZRQA 2WDRB 1KRHA 2WNMA 3R3MA 4IWPA 4KGTA 1JWSD 4DK5A 2PW9A 2PE6B 1C4PA 1EU4A 2G45B 3VHTC 2LUEA 3JYUA 2NBWB 2KC2A 2DZKA 3EFCA 1XXGA 4BBNC 4IM3A 2D3BA 2JYEA 4ZRPA 4ASWC 2K9XA 2VH2A 2AYOB 5GXGB 1P3QU 2OJWA 3ZTCA 4BKGA 5DPWA 2BS4B 3B9JA 2MBHA 4N59A 4GLSC 1FXAA 4LTUA 1X1MA 1I42A 4FULA 4BBNF 4KDIC 1E5WA 4ZHPA 3MJWA 1NBFC 2J42A 3AI5A 3A9KB 2BW2A 3N1XC 1BUIC 1C4AA 3Q3JA 4TKNA 1L0YB 1V8CA 4LDTD 4A6QA 4WH4A 3ZW3A 3ZJTA 1LFDA 2AWTA 3V05A 2D07B 2WX0A 2KKCA 4G0NB 4KVGB 1G6JA 2GBRA 2R2OA 2W54A 3RYTA 2WWZA 1DYQA 1YX5B 4P16A 3AV8A 1WM3A 1WX9A 3B2GA 1IYFA 2KTFA 3P63A 2AL6A 3NHEB 1P9DU 1PGBA 3GZNI 2GLSA 4IW0A 3NUHB 5J18A 3V6EB 3C0RB 4KIKA 2BYFA 3QX1A 3ZXVA 1OEYA 2PIAA 3Q3OC 3Q8EA 1JMLA 2MP2B 4MM3A 2KXJA 2ZNVB 4EFOA 3AEBB 1TS2A 2INNE 2J53A 4K7SA 1EUVB 1LQBA 2KDIA 1KTKA 5E6PA 2PJHA 4G3XB 3AEAB 3OJ4B 2XEWA 1N62A 1EM7A 2XN9C 1FEHA 1BMLC 2PMVA 3TMPB 1FNVA 1Z2MA 3DVNU 1T5XD 1WY8A 2XK5A 1YJ1A 1YN3A 2PEAA 2WYQA 3ZDTA 3ZRFA 2OHFA 2N7JA 3L08A 3LJ3A 4HJKA 4ZYNA 3GP7A 2JRHA 3ZVVA 1ISNA 1P0RA 2A4ZA 3AN1A 4N6EB 4GDKA 4PS7A 4KZ0A 3ZNID 2XNAC 3L54A 4ICUA 2LRWA 3AB5A 2BYEA 4FBJB 3PZ8A 5FR3A 2Y3AA 2C7HA 3DBSA 1VRAB 3JVZX 2CKHB 4KSLC 3HK0A 3RZFA 2MJ3A 1NVID 2KAJA 4KGRA 3IAM1 2K8HA 3KWLA 1QF6A 3MC8A 1AWDA 2HJ8A 1EWCA 1DOXA 4WWOA 3T3NA 1UZXB 1ZW7A 3CSFA 3ML8A 2KHWB 1RAXA 3I3TB 3RPFC 4BKSD 4R3DA 2JU6X 4JWUC 3AMZA 3DBHB 3BY4B 5IKCM 4G11A 4XYCA 2L05A 3I5JC 3P1MA 5AZGA 3RNFC 1ZGUB 2EELA 3RZWC 3GZNB 5BMHA 4HPMB 1C1YB 3PLVA 3PV1A 3ZNGC 1V1OA 3MC0B 3TEWA 4NQKE 4KKIA 3URYA 1UELA 2CU1A 3VUXA 4HEA1 4MGYE 4EOYA 5LXIB 3RD2A 1VD2A 3WA0A 1AYFA 3ECIA 3EGRA 2JY6A 2NR2A 4WURA 2K5PA 4F8CB 2MBEA 2LMCA 2ZVNA 3KW5B 2NMQA 2WQYB 3KLSX 4DDGD 4M0WB 2KYWA 4NZLB 3GE8C 4ZOHC 2WXHA 1MG8A 3QWZB 4MEMA 4KX6B 2N9KA 2LHEA 4RGOS 4BOZB 4FJYA 2FCMA 4WWPA 3VR9B 1F0ZA 1UD7A 2KMAA 3M95A 2JXTA 2N0SB 3A9KA 5BYQA 3W5VB 4KGSA 1QLBB 1K53A 4XWWA 4CO7A 2JUOA 5EE0A 3UINB 4RF1A 1XCTL 3PRZA 4NAWB 2WXFA 1R4MB 3CMMB 4MJSB 4ARIA 1HE8A 3Q6BA 1V6EA 2DWQA 1SGHA 2QHOA 2K6QA 2QC8A 2LFIA 5IN7A 2LRUA 3RNEC 2W3SA 1TZOA 4IWQA 3HVDA 2CHZA 3QJZA 1OQRA 4WJOA 3VTUA 1BXTA 1TKGA 3PO0A 4US8A 1UNSA 2DHZA 4IKGA 3UQBA 3NRZA 2IO3B 3MFGA 4BFRA 1XD3B 2BWES 2JT4B 5D3DA 1TJEA 2D3GA 1WI0A 4ITKA 2J0KA 3PRMB 2L0TA 2M56B 1PGAA 3PHXB 2MP2A 1V97A 1J8CA 1I4HA 2X8XX 4W9CA 2G3QB 3AE5B 2JZPA 4N58A 1EF5A 2J0MA 4NNJB 1HZ5A 2KK8A 2W9NA 4ACFA 2I1JA 3ZYYX 2FCNA 4DDID 4IWOA 3JSVB 2LVQA 2Z59B 3AH7A 4GSWA 5D7GA 1E9MA 4EZLA 3ZXRA 2KWVB 3R2IA 1TKEA 1FM0D 4EE2A 2BB6A 3RCZA 4FXCA 2AL3A 2K1FA 1JWAD 2LGXA 2LXCA 2PLPA 2LVPA 1QOGA 2G4DB 2PTLA 2FBWB 1VR9A 2L52A 1N5XA 4RM9A 1WGHA 1Q0WB 3WANA 3U7ZA 5JHBA 2INPE 4E71A 1WR1A 4YSYB 3IFWB 2GI9A 3R7RA 2SAKA 3A9JA 1TTNA 1WXSA 2B3AA 2KACA 1T0SC 3DBRI 4L23A 4DXAB 1J7CA 2Z0EB 3AEFB 3ZTDA 3PZ7A 1IP9A 3QAQA 2DX5B 2AQ2B 4W9JA 3B0AA 1NEKB 1Y56A 5CTRC 1YD8U 1OTRB 1KM7A 2DLBA 2N9LA 2ZVOA 4YT0B 4A8XC 1SF0A 4L1BA 1MFWA 2WHIA 2D3AA 1E10A 4S17A 2J4XA 1GPXA 1YQ3B 1F2RI 3H7PB 1ZUD2 3IXSA 3U7DA 2D3CA 2WXNA 2RPVA 4RFBA 1ET9A 2EKEC 4XDCA 3X0WA 3NG0A 1MPEA 4F1SA 3P4PB 5MPOA 3PRPB 4MELA 1XQQA 1I4GA 1L4ZB 1WE7A 2YLMA 4HKQA 1H4RA 1CK1A 2WGSA 3QARA 2V3PA 3VUYA 2M4NA 1STEA 4FA6A 3B08A 2KC1A 3VDZA 1QQRA 1YNTE 4C80A 2XK5B 4DHJB 3ZNZB 4XWTA 1T3QA 1Q5WB 1SJHD 1RFAA 4HRSA 1IPGA 1CZPA 3BINA 1A70A 1PDXA 3OG5A 4M8MA 2ZEQA 2QDFA 3Q3NC 2WXOA 2DZJA 5D94A 5FKAC 1YOVB 1FPYA 4HKZE 2LGSA 3TL5A 3PT2B 3TSSA 2KQ7A 1E8YA 3WAOA 1TBEA 4M0WA 1RFKA 1U4AA 3VRBB 1NI2A 4US9A 3V3XA 1OFFA 2E3TA 3CWIA 4ICVA 1TIFA 1WJNA 1ACCA 2A5UA 2RPQA 3IG3A 4NJ7A 4OZCA 1I7HA 2BVCA 4DHZB 1IUEA 1SBBB 5DPTA 5I4DA 1T0RC 2D11A 1JRPA 2DYBA 2WXKA 1ZOYB 3RULA 2N9PC 1FNUA 3NVYA 4NAWA 3DWMA 4NJCA 3DBRB 4MJSA 3APCA 1OGWA 2L83A 3NVZA 1LO5D 3Q3FA 2HTME 4YTPB 4I6PA 1V2YA 2JZ3B 3GOEA 3IVFA 4C4VB 3AXCA 2ONQA 1GOZA 1XEEA 1RYJA 2JPHA 1YQBA 5HG2A 3KH0A 4YSXB 4P1CC 3NY5A 3RN9C 4CYEA 2GBKA 2KMMA 1F2RC 2V0GA 2O6VD 3APFA 3SU8X 4NQLB 4AP4C 1AARA 1M94A 1WWTA 1I4PA 2KFJA 3UIOB 3LB8C 1TY2A 2MCNB 2L8JA 2WP9B 3J9CA 3T3OA 1C4CA 5EE9A 3DQVA 1WF9A 2M1MA 4P6VF 1I4RA 4JPSA 4YSZB 1MI0A 3JSVA 3ZNHB 4ANUA 3C8YA 4FHKA 2ASQA 1K50A 2INDC 2WXMA 2BF8B 4OVUA 3AEGB 4RGNA 2LXAA 1RRBA 4A9AA 3WIMA 3L4PA 2G9HD 4BKTA 4PYUA 2BT6A 4KDLB 4HCNB 4EUTA 3DOWA 1WGGA 4HDOA 2HE7A 5L83A 2KWDA 1SE2A 3DBHI 2DNFA 3B1LX
chains in the Genus database with same CATH topology
4WJQA 4KSKC 4I6LB 5AZGA 3SHQA 2R2QA 1ZGUB 3VH4B 1V9JA 1SE9A 3RZWC 2Z0DB 2CS4A 2GBMA 1V5OA 3PSEB 3SD5A 4HPMB 4IUMB 5G2NA 1C1YB 3PLVA 4LDTB 2I1KA 2KDFB 4IC7B 3WALA 4TQ0A 4B9KA 2EMTA 1E7VA 1WMHB 2PE9A 3PV1A 4NPNA 3ZNGC 2RD0A 2KMCA 1PQSA 2KX0A 3TJPA 3QK0A 2DZMA 4W9KA 1R4NI 2FNJB 1E7UA 2J0JA 4NQKE 3DPDA 4ANVA 4AJWA 2LWPA 4IM0A 4B95A 1UELA 2CU1A 3VUXA 2NBUA 3UIPB 4GOCA 3O65B 3OJ3A 4MGYE 2KANA 4EOYA 5LXIB 3RD2A 1VD2A 2GBJA 3WA0A 4JLCA 3H7PA 1UH6A 2N9XA 4HVBA 3ECIA 4A3PA 1S1QB 2HTHA 2JY6A 2NR2A 5CHWA 4JL9A 4F8CB 2MBEA 5DCNA 5C23A 2ZVNA 3KW5B 4WAAA 2KJHB 3V61A 2LGYA 3EFUA 2KVRA 2K25A 4W9HA 4DDGD 2G4SA 1WZ3A 2OOBB 2JZZA 3K9OB 4LJPB 4M0WB 5E6NA 3VQIA 2ZPNA 1UBIA 3QWZB 1MG8A 4MEMA 4HCPB 3ZUNA 2KN5A 3AULA 2RGFA 3EC8A 4GXBA 5DPRA 2GBNA 2KNBA 2OJRA 4W9IA 5G55A 3H9DA 3W1SC 4BOZB 4FJYA 2FCMA 2V3SA 4MSQB 4WWPA 2FUHB 4GB9A 1NDDA 2NS5A 5E6OA 3UQAA 4AUQC 2M17A 2C7NB 1UD7A 1P1AA 1WYWB 3A1QB 5CX3A 1E8WA 2KMAA 3M95A 4ZRKA 1V49A 2MA9B 3A9KA 1L7YA 2Y5BB 1GC6A 4CO7A 1C3TA 2JUOA 1JRUA 2LD9A 1WRDB 4WJPA 3UINB 2N7DA 1SIFA 2DENB 2YVCA 4KIKB 1WJ6A 3QHTA 3PRZA 4NAWB 4W9DA 4W9GA 3A9JB 2ZCBA 4WJNA 3CMMB 4MJSB 5HKHA 4P7IA 1HE8A 2DYOA 3APDA 2NPTB 1J19A 2REXA 1J0GA 1E8ZA 1R4MI 1V6EA 4K81A 4N9F4 2VRRB 1SGHA 2QHOA 2K6QA 4I6NB 1UBQA 2UWQA 2LRUA 3KUZA 5TR5A 1WM2A 4AOFA 2NCNA 2EMSA 3D32A 4IWQA 2CHZA 3QJZA 3PS6A 5J2RA 4WJOA 3VTUA 3HHMA 5J17A 3P2BA 4ZRIA 4MGKE 3NS8A 3RT3B 5CHFA 2MWSB 4GMVA 2DHZA 4GDLB 4RM8A 3UQBA 3L17A 2IO3B 3UGBB 1V86A 1WMHA 4BFRA 4BOSC 1XD3B 2BWES 2JT4B 4URKA 1YIWA 2D3GA 3MTNB 4GGQA 3ONSA 4MSMB 4NY0A 2O2VB 2ZPYA 1WI0A 4K7WA 2J0KA 3PRMB 3R7QA 2L0TA 3L0WB 3L13A 3EECA 5AEKB 2FIFA 5L95C 2LJ5A 3PGEA 4W9EA 2L3ZA 2FCSA 3PHXB 2KFKA 1WR6E 2MP2A 5IA7A 1J8CA 4W9CA 2G3QB 1VCBA 4TQ1A 3X23A 1F9JA 2WX1A 1EF5A 3EHVA 4II2B 3HM3A 4DBGA 4GDKB 3T9LA 2J0MA 2MSED 3LDZE 4NNJB 1EO6A 4HK2A 2KK8A 2W9NA 3ZO5B 2KTRB 2I1JA 2FCNA 4HLEA 2K8BA 4DDID 4IWOA 1FXTB 3JSVB 2LVQA 4GN1A 3VH3B 2GMIC 2Z59B 2KDEB 3NZSA 3RUIB 4GSWA 5D7GA 3QCAA 4EZLA 1WX7A 4IM2A 2KWVB 1GG3A 3RCZA 3H6NA 1WXAA 3DVGX 2AL3A 2MRPA 1Q1OA 3T8MA 2K1FA 3V62A 3KUCB 2RR9A 4J6IA 1S3SG 2LGXA 2IY0B 2LXCA 3KVFB 5AZHA 2IYDB 2LVPA 3ZDMC 2G4DB 1KJTA 3PLUA 4X57B 4OVVA 4ZDVA 3TIXA 4RM9A 1UGMA 1WGHA 4JGHB 3VFKA 3QIJA 3SDLC 1Q0WB 2JXXA 3WANA 3DVGY 5JHBA 4E71A 1WR1A 5BO4B 3IFWB 4TUUA 3R7RA 3MHSD 3A9JA 4G50A 1TTNA 1WXSA 2B3AA 2NVUI 2ZNVC 1CMXB 1H8CA 3DBRI 4DXAB 2KD0A 2O6VA 4WWNA 2N7EA 2Z0EB 3ZTDA 3W1YA 2IO0B 2K6DB 2L0FA 3QAQA 2DX5B 4KV2A 1IP9A 4FHJA 3M3JA 4W9JA 3B0AA 3R66C 3H7SA 2NBVB 3ZIMA 1T0YA 4HDQA 2LASA 5JH5C 1WJUA 3V6CB 4TV3A 4CHKA 5D6JB 1I35A 2KLGA 2BWFA 5CTRC 4E74A 1YD8U 1OTRB 4FADA 2JVCA 3DVNV 1RLFA 1KM7A 1Y8RC 2N1WA 2ZVOA 3WAPA 4E3CA 1GJZA 4ANWA 2BYVE 4NJ6A 1L2NA 1OEYJ 1LXDA 2MX2A 5KHQA 2L7RA 4LJOB 2FCQA 5GMVA 4XX5A 4IWPA 3R3MA 3K9PB 3AU4A 3V60A 3A33B 2K39A 4AJYB 4A20A 2KZRA 3PREA 4YL8A 4DK5A 2PE6B 3AU5A 2L00B 2G45B 2KO3A 2LUEA 3CF6E 3VHTC 2LZ6A 3JYUA 3H7PB 3ZKJC 3U7DA 3VXWA 2NBWB 2KC2A 2DZKA 4DHJD 4KZCA 1ZKHA 4JIOU 4BBNC 1XT9B 2EKEC 1WE6A 2FAZA 2KJRA 3X0WA 4IM3A 4F1SA 3OLMD 4EKUA 1KOTA 5EDSA 3PRPB 4MELA 4ASWC 1XQQA 2D10A 1WE7A 2YLMA 3VUWA 2AYOB 1H4RA 3QARA 1P3QU 2DZIA 3VUYA 2KTRA 3ZTCA 2M4NA 4BVUC 3HM6X 4K7UA 4BKGA 5DPWA 1D3ZA 2FIDA 2N1VA 3NZUA 2MBHA 3B08A 4FA6A 2KC1A 3VDZA 5LLIA 4HPLB 4BKSA 2C9WB 1WH3A 2XK5B 1X1MA 2ZCCA 1I42A 4DHJB 3ZNZB 4PS3A 4FULA 4BBNF 4KDIC 1Q5WB 2C7MB 1E5WA 2M8SA 1RFAA 2IY1B 3MJWA 1NBFC 1IPGA 2J7QB 3IHPC 3S2AA 2ZJDA 3AI5A 3A9KB 2N4FA 1LM8B 3BINA 3NOBA 4M8MA 2JRIB 5KHOA 3HIZA 2ZEQA 3Q3JA 3IBEA 4TKNA 2DZJA 4PYZA 3QQ8B 5D94A 2LVOA 4LDTD 4ANXA 3CSTA 2BGFA 3N30A 3ZW3A 4EZKA 1LFDA 1WXMA 2AWTA 4M8NA 3TL5A 2D07B 2V1YA 2WX0A 3QC8B 2KKCA 3PT2B 4G0NB 4RMAA 4KVGB 2KQ7A 1E8YA 3KYCD 3WAOA 1TBEA 1G6JA 2GBRA 2R2OA 4W9LA 2LGDA 4PS8A 1GNUA 1U4AA 3RYTA 2UYZB 2WWZA 3VAWA 1NI2A 1YX5B 2IBIB 2CR5A 1WM3A 1WGDA 1WX9A 1IYFA 1WX8A 4XC2A 2KTFA 2KOXA 1KLVA 2AL6A 3NHEB 2GOWA 3UF8A 1P9DU 2D2QA 3U30A 4FN2A 4ICVA 1WJNA 3JW0X 3A1QA 3GZNI 3PHWB 2A5UA 2RPQA 3IG3A 4NJ7A 2IO2B 2AEHA 4DWFA 4II3B 2MBOA 4IW0A 4DHZB 5DPTA 4LCDE 5J18A 3L16A 3PVLA 2D11A 1K8RB 5AZFA 2C60A 3V6EB 2DYBA 3C0RB 2DAFA 3RULA 1WIAA 3PTFC 2N9PC 4KIKA 2BYFA 2M0XA 3QX1A 4NAWA 4B6WA 4MGIE 2K8CA 4FJZA 4GIVA 1OEYA 1TZ1A 4MJSA 3W1SA 3APCA 3M63B 4XZ4A 1OQYA 2NPTA 1OGWA 3KUDB 3VTWA 1TGZB 4EEWA 3U8ZA 2KFKB 2MP2B 3WAMA 3Q3FA 4MM3A 2KXJA 2ZNVB 4EFOA 4I6PA 1V2YA 2JZ3B 1E90A 3GOEA 3IVFA 3AXCA 5IAAC 3VVWB 4K7SA 1EUVB 5JHAA 1LQBA 2JPHA 3TBLD 1YQBA 2CHWA 4FJVB 2KDIA 5E6PA 2PJHA 3KH0A 1WZ0A 4G3XB 3DDCB 3NY5A 3OJ4B 5D2MB 4CYEA 2XEWA 2V4LA 4GDLA 2BPSA 3L10B 3PZDA 2MW5A 2KDBA 2BKFA 2N9EB 3VTVA 2GBKA 4HWIB 3TMPB 4FLHA 1EF1A 3DVNU 1Z2MA 5DPSA 3N3KB 2O6VD 1WY8A 1WXVA 2O2VA 2XK5A 1YJ1A 3APFA 3SU8X 4NQLB 4F7ZA 5CHVC 4AP4C 1YX6B 2MBBB 3PPAA 3OAWA 1V5TA 1AARA 2PEAA 2DAJA 2WYQA 3ZLZA 1M94A 3ZDTA 3M62B 3ZRFA 2KFJA 3UIOB 1A5RA 2KWCA 5FR6A 2L8JA 2MCNB 3L08A 3LJ3A 2KQSA 4HJKA 4ZYNA 1V81A 2JRHA 3ZVVA 1ISNA 1P0RA 2A4ZA 2RSUA 4GDKA 3DQVA 1WF9A 4JQWC 1WFYA 3ML9A 2M1MA 4PS7A 4KZ0A 3ZNID 4WQOB 3L54A 2KX3A 4ICUA 2LRWA 2BYEA 2C5LC 2O6VB 3QA8A 4FBJB 4A3OA 3A4RA 3ZNHB 3JSVA 4ANUA 3H1UA 3KYDD 1P98A 1WJ4A 2JF5A 3TCAA 1QZEA 4FHKA 3DBLI 2ASQA 2IO1B 5LXHA 2C7HA 3DBSA 2BF8B 3JVZX 4OVUA 2CKHB 1Z5SB 2LI5A 3HK0A 3N32A 4KSLC 3RZFA 2KLCA 2BKRB 4GU2A 2MBQA 3ZRCA 2K8HA 2LXAA 4MH0E 4EZJA 1RRBA 4MGZE 4K1RB 4HXDA 2HJ8A 2PPHA 2WDTB 1BT0A 4DHZE 3WIMA 4BKTA 4PYUA 4WWOA 1UZXB 4IG7B 2JWZA 3A4SC 4W9FA 1ZW7A 3CSFA 5C1ZA 2CHXA 4KDLB 3ML8A 4AWJA 2KHWB 4ZRJA 2IZVB 4HCNB 4EUTA 1RAXA 3I3TB 2L76A 2DYMA 4BKSD 3DOWA 1V80A 2KJ6A 1WGGA 1GUAB 4HDOA 2HE7A 1WGRA 2XBBC 2ZZPB 3ALBA 3ENEA 5L83A 1GC7A 3BY4B 2MLBA 4G11A 2KWUB 5JZEB 2HD5B 4MDKE 1WGYA 2L05A 3DBHI 3B1LX 3DCGA 2MQJA 1E8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WJQ A;  4KSK C;  4I6L B;  5AZG A;  3SHQ A;  2R2Q A;  1ZGU B;  3VH4 B;  1V9J A;  1SE9 A;  3RZW C;  2Z0D B;  2CS4 A;  2GBM A;  1V5O A;  3PSE B;  3SD5 A;  4HPM B;  4IUM B;  5G2N A;  1C1Y B;  3PLV A;  4LDT B;  2I1K A;  2KDF B;  4IC7 B;  3WAL A;  4TQ0 A;  4B9K A;  2EMT A;  1E7V A;  1WMH B;  2PE9 A;  3PV1 A;  4NPN A;  3ZNG C;  2RD0 A;  2KMC A;  1PQS A;  2KX0 A;  3TJP A;  3QK0 A;  2DZM A;  4W9K A;  1R4N I;  2FNJ B;  1E7U A;  2J0J A;  4NQK E;  3DPD A;  4ANV A;  4AJW A;  2LWP A;  4IM0 A;  4B95 A;  1UEL A;  2CU1 A;  3VUX A;  2NBU A;  3UIP B;  4GOC A;  3O65 B;  3OJ3 A;  4MGY E;  2KAN A;  4EOY A;  5LXI B;  3RD2 A;  1VD2 A;  2GBJ A;  3WA0 A;  4JLC A;  3H7P A;  1UH6 A;  2N9X A;  4HVB A;  3ECI A;  4A3P A;  1S1Q B;  2HTH A;  2JY6 A;  2NR2 A;  5CHW A;  4JL9 A;  4F8C B;  2MBE A;  5DCN A;  5C23 A;  2ZVN A;  3KW5 B;  4WAA A;  2KJH B;  3V61 A;  2LGY A;  3EFU A;  2KVR A;  2K25 A;  4W9H A;  4DDG D;  2G4S A;  1WZ3 A;  2OOB B;  2JZZ A;  3K9O B;  4LJP B;  4M0W B;  5E6N A;  3VQI A;  2ZPN A;  1UBI A;  3QWZ B;  1MG8 A;  4MEM A;  4HCP B;  3ZUN A;  2KN5 A;  3AUL A;  2RGF A;  3EC8 A;  4GXB A;  5DPR A;  2GBN A;  2KNB A;  2OJR A;  4W9I A;  5G55 A;  3H9D A;  3W1S C;  4BOZ B;  4FJY A;  2FCM A;  2V3S A;  4MSQ B;  4WWP A;  2FUH B;  4GB9 A;  1NDD A;  2NS5 A;  5E6O A;  3UQA A;  4AUQ C;  2M17 A;  2C7N B;  1UD7 A;  1P1A A;  1WYW B;  3A1Q B;  5CX3 A;  1E8W A;  2KMA A;  3M95 A;  4ZRK A;  1V49 A;  2MA9 B;  3A9K A;  1L7Y A;  2Y5B B;  1GC6 A;  4CO7 A;  1C3T A;  2JUO A;  1JRU A;  2LD9 A;  1WRD B;  4WJP A;  3UIN B;  2N7D A;  1SIF A;  2DEN B;  2YVC A;  4KIK B;  1WJ6 A;  3QHT A;  3PRZ A;  4NAW B;  4W9D A;  4W9G A;  3A9J B;  2ZCB A;  4WJN A;  3CMM B;  4MJS B;  5HKH A;  4P7I A;  1HE8 A;  2DYO A;  3APD A;  2NPT B;  1J19 A;  2REX A;  1J0G A;  1E8Z A;  1R4M I;  1V6E A;  4K81 A;  4N9F 4;  2VRR B;  1SGH A;  2QHO A;  2K6Q A;  4I6N B;  1UBQ A;  2UWQ A;  2LRU A;  3KUZ A;  5TR5 A;  1WM2 A;  4AOF A;  2NCN A;  2EMS A;  3D32 A;  4IWQ A;  2CHZ A;  3QJZ A;  3PS6 A;  5J2R A;  4WJO A;  3VTU A;  3HHM A;  5J17 A;  3P2B A;  4ZRI A;  4MGK E;  3NS8 A;  3RT3 B;  5CHF A;  2MWS B;  4GMV A;  2DHZ A;  4GDL B;  4RM8 A;  3UQB A;  3L17 A;  2IO3 B;  3UGB B;  1V86 A;  1WMH A;  4BFR A;  4BOS C;  1XD3 B;  2BWE S;  2JT4 B;  4URK A;  1YIW A;  2D3G A;  3MTN B;  4GGQ A;  3ONS A;  4MSM B;  4NY0 A;  2O2V B;  2ZPY A;  1WI0 A;  4K7W A;  2J0K A;  3PRM B;  3R7Q A;  2L0T A;  3L0W B;  3L13 A;  3EEC A;  5AEK B;  2FIF A;  5L95 C;  2LJ5 A;  3PGE A;  4W9E A;  2L3Z A;  2FCS A;  3PHX B;  2KFK A;  1WR6 E;  2MP2 A;  5IA7 A;  1J8C A;  4W9C A;  2G3Q B;  1VCB A;  4TQ1 A;  3X23 A;  1F9J A;  2WX1 A;  1EF5 A;  3EHV A;  4II2 B;  3HM3 A;  4DBG A;  4GDK B;  3T9L A;  2J0M A;  2MSE D;  3LDZ E;  4NNJ B;  1EO6 A;  4HK2 A;  2KK8 A;  2W9N A;  3ZO5 B;  2KTR B;  2I1J A;  2FCN A;  4HLE A;  2K8B A;  4DDI D;  4IWO A;  1FXT B;  3JSV B;  2LVQ A;  4GN1 A;  3VH3 B;  2GMI C;  2Z59 B;  2KDE B;  3NZS A;  3RUI B;  4GSW A;  5D7G A;  3QCA A;  4EZL A;  1WX7 A;  4IM2 A;  2KWV B;  1GG3 A;  3RCZ A;  3H6N A;  1WXA A;  3DVG X;  2AL3 A;  2MRP A;  1Q1O A;  3T8M A;  2K1F A;  3V62 A;  3KUC B;  2RR9 A;  4J6I A;  1S3S G;  2LGX A;  2IY0 B;  2LXC A;  3KVF B;  5AZH A;  2IYD B;  2LVP A;  3ZDM C;  2G4D B;  1KJT A;  3PLU A;  4X57 B;  4OVV A;  4ZDV A;  3TIX A;  4RM9 A;  1UGM A;  1WGH A;  4JGH B;  3VFK A;  3QIJ A;  3SDL C;  1Q0W B;  2JXX A;  3WAN A;  3DVG Y;  5JHB A;  4E71 A;  1WR1 A;  5BO4 B;  3IFW B;  4TUU A;  3R7R A;  3MHS D;  3A9J A;  4G50 A;  1TTN A;  1WXS A;  2B3A A;  2NVU I;  2ZNV C;  1CMX B;  1H8C A;  3DBR I;  4DXA B;  2KD0 A;  2O6V A;  4WWN A;  2N7E A;  2Z0E B;  3ZTD A;  3W1Y A;  2IO0 B;  2K6D B;  2L0F A;  3QAQ A;  2DX5 B;  4KV2 A;  1IP9 A;  4FHJ A;  3M3J A;  4W9J A;  3B0A A;  3R66 C;  3H7S A;  2NBV B;  3ZIM A;  1T0Y A;  4HDQ A;  2LAS A;  5JH5 C;  1WJU A;  3V6C B;  4TV3 A;  4CHK A;  5D6J B;  1I35 A;  2KLG A;  2BWF A;  5CTR C;  4E74 A;  1YD8 U;  1OTR B;  4FAD A;  2JVC A;  3DVN V;  1RLF A;  1KM7 A;  1Y8R C;  2N1W A;  2ZVO A;  3WAP A;  4E3C A;  1GJZ A;  4ANW A;  2BYV E;  4NJ6 A;  1L2N A;  1OEY J;  1LXD A;  2MX2 A;  5KHQ A;  2L7R A;  4LJO B;  2FCQ A;  5GMV A;  4XX5 A;  4IWP A;  3R3M A;  3K9P B;  3AU4 A;  3V60 A;  3A33 B;  2K39 A;  4AJY B;  4A20 A;  2KZR A;  3PRE A;  4YL8 A;  4DK5 A;  2PE6 B;  3AU5 A;  2L00 B;  2G45 B;  2KO3 A;  2LUE A;  3CF6 E;  3VHT C;  2LZ6 A;  3JYU A;  3H7P B;  3ZKJ C;  3U7D A;  3VXW A;  2NBW B;  2KC2 A;  2DZK A;  4DHJ D;  4KZC A;  1ZKH A;  4JIO U;  4BBN C;  1XT9 B;  2EKE C;  1WE6 A;  2FAZ A;  2KJR A;  3X0W A;  4IM3 A;  4F1S A;  3OLM D;  4EKU A;  1KOT A;  5EDS A;  3PRP B;  4MEL A;  4ASW C;  1XQQ A;  2D10 A;  1WE7 A;  2YLM A;  3VUW A;  2AYO B;  1H4R A;  3QAR A;  1P3Q U;  2DZI A;  3VUY A;  2KTR A;  3ZTC A;  2M4N A;  4BVU C;  3HM6 X;  4K7U A;  4BKG A;  5DPW A;  1D3Z A;  2FID A;  2N1V A;  3NZU A;  2MBH A;  3B08 A;  4FA6 A;  2KC1 A;  3VDZ A;  5LLI A;  4HPL B;  4BKS A;  2C9W B;  1WH3 A;  2XK5 B;  1X1M A;  2ZCC A;  1I42 A;  4DHJ B;  3ZNZ B;  4PS3 A;  4FUL A;  4BBN F;  4KDI C;  1Q5W B;  2C7M B;  1E5W A;  2M8S A;  1RFA A;  2IY1 B;  3MJW A;  1NBF C;  1IPG A;  2J7Q B;  3IHP C;  3S2A A;  2ZJD A;  3AI5 A;  3A9K B;  2N4F A;  1LM8 B;  3BIN A;  3NOB A;  4M8M A;  2JRI B;  5KHO A;  3HIZ A;  2ZEQ A;  3Q3J A;  3IBE A;  4TKN A;  2DZJ A;  4PYZ A;  3QQ8 B;  5D94 A;  2LVO A;  4LDT D;  4ANX A;  3CST A;  2BGF A;  3N30 A;  3ZW3 A;  4EZK A;  1LFD A;  1WXM A;  2AWT A;  4M8N A;  3TL5 A;  2D07 B;  2V1Y A;  2WX0 A;  3QC8 B;  2KKC A;  3PT2 B;  4G0N B;  4RMA A;  4KVG B;  2KQ7 A;  1E8Y A;  3KYC D;  3WAO A;  1TBE A;  1G6J A;  2GBR A;  2R2O A;  4W9L A;  2LGD A;  4PS8 A;  1GNU A;  1U4A A;  3RYT A;  2UYZ B;  2WWZ A;  3VAW A;  1NI2 A;  1YX5 B;  2IBI B;  2CR5 A;  1WM3 A;  1WGD A;  1WX9 A;  1IYF A;  1WX8 A;  4XC2 A;  2KTF A;  2KOX A;  1KLV A;  2AL6 A;  3NHE B;  2GOW A;  3UF8 A;  1P9D U;  2D2Q A;  3U30 A;  4FN2 A;  4ICV A;  1WJN A;  3JW0 X;  3A1Q A;  3GZN I;  3PHW B;  2A5U A;  2RPQ A;  3IG3 A;  4NJ7 A;  2IO2 B;  2AEH A;  4DWF A;  4II3 B;  2MBO A;  4IW0 A;  4DHZ B;  5DPT A;  4LCD E;  5J18 A;  3L16 A;  3PVL A;  2D11 A;  1K8R B;  5AZF A;  2C60 A;  3V6E B;  2DYB A;  3C0R B;  2DAF A;  3RUL A;  1WIA A;  3PTF C;  2N9P C;  4KIK A;  2BYF A;  2M0X A;  3QX1 A;  4NAW A;  4B6W A;  4MGI E;  2K8C A;  4FJZ A;  4GIV A;  1OEY A;  1TZ1 A;  4MJS A;  3W1S A;  3APC A;  3M63 B;  4XZ4 A;  1OQY A;  2NPT A;  1OGW A;  3KUD B;  3VTW A;  1TGZ B;  4EEW A;  3U8Z A;  2KFK B;  2MP2 B;  3WAM A;  3Q3F A;  4MM3 A;  2KXJ A;  2ZNV B;  4EFO A;  4I6P A;  1V2Y A;  2JZ3 B;  1E90 A;  3GOE A;  3IVF A;  3AXC A;  5IAA C;  3VVW B;  4K7S A;  1EUV B;  5JHA A;  1LQB A;  2JPH A;  3TBL D;  1YQB A;  2CHW A;  4FJV B;  2KDI A;  5E6P A;  2PJH A;  3KH0 A;  1WZ0 A;  4G3X B;  3DDC B;  3NY5 A;  3OJ4 B;  5D2M B;  4CYE A;  2XEW A;  2V4L A;  4GDL A;  2BPS A;  3L10 B;  3PZD A;  2MW5 A;  2KDB A;  2BKF A;  2N9E B;  3VTV A;  2GBK A;  4HWI B;  3TMP B;  4FLH A;  1EF1 A;  3DVN U;  1Z2M A;  5DPS A;  3N3K B;  2O6V D;  1WY8 A;  1WXV A;  2O2V A;  2XK5 A;  1YJ1 A;  3APF A;  3SU8 X;  4NQL B;  4F7Z A;  5CHV C;  4AP4 C;  1YX6 B;  2MBB B;  3PPA A;  3OAW A;  1V5T A;  1AAR A;  2PEA A;  2DAJ A;  2WYQ A;  3ZLZ A;  1M94 A;  3ZDT A;  3M62 B;  3ZRF A;  2KFJ A;  3UIO B;  1A5R A;  2KWC A;  5FR6 A;  2L8J A;  2MCN B;  3L08 A;  3LJ3 A;  2KQS A;  4HJK A;  4ZYN A;  1V81 A;  2JRH A;  3ZVV A;  1ISN A;  1P0R A;  2A4Z A;  2RSU A;  4GDK A;  3DQV A;  1WF9 A;  4JQW C;  1WFY A;  3ML9 A;  2M1M A;  4PS7 A;  4KZ0 A;  3ZNI D;  4WQO B;  3L54 A;  2KX3 A;  4ICU A;  2LRW A;  2BYE A;  2C5L C;  2O6V B;  3QA8 A;  4FBJ B;  4A3O A;  3A4R A;  3ZNH B;  3JSV A;  4ANU A;  3H1U A;  3KYD D;  1P98 A;  1WJ4 A;  2JF5 A;  3TCA A;  1QZE A;  4FHK A;  3DBL I;  2ASQ A;  2IO1 B;  5LXH A;  2C7H A;  3DBS A;  2BF8 B;  3JVZ X;  4OVU A;  2CKH B;  1Z5S B;  2LI5 A;  3HK0 A;  3N32 A;  4KSL C;  3RZF A;  2KLC A;  2BKR B;  4GU2 A;  2MBQ A;  3ZRC A;  2K8H A;  2LXA A;  4MH0 E;  4EZJ A;  1RRB A;  4MGZ E;  4K1R B;  4HXD A;  2HJ8 A;  2PPH A;  2WDT B;  1BT0 A;  4DHZ E;  3WIM A;  4BKT A;  4PYU A;  4WWO A;  1UZX B;  4IG7 B;  2JWZ A;  3A4S C;  4W9F A;  1ZW7 A;  3CSF A;  5C1Z A;  2CHX A;  4KDL B;  3ML8 A;  4AWJ A;  2KHW B;  4ZRJ A;  2IZV B;  4HCN B;  4EUT A;  1RAX A;  3I3T B;  2L76 A;  2DYM A;  4BKS D;  3DOW A;  1V80 A;  2KJ6 A;  1WGG A;  1GUA B;  4HDO A;  2HE7 A;  1WGR A;  2XBB C;  2ZZP B;  3ALB A;  3ENE A;  5L83 A;  1GC7 A;  3BY4 B;  2MLB A;  4G11 A;  2KWU B;  5JZE B;  2HD5 B;  4MDK E;  1WGY A;  2L05 A;  3DBH I;  3B1L X;  3DCG A;  2MQJ A;  1E8X A; 
#chains in the Genus database with same CATH topology
 3CIR B;  1SE4 A;  1VLB A;  2KQ4 X;  4B0E A;  1SE3 A;  3PSE B;  2GBM A;  3W1S A;  2RMM A;  4IUM B;  4TQ0 A;  4IC7 B;  2PE9 A;  1E7V A;  4NPN A;  4LNI A;  2KMC A;  3O13 A;  3TJP A;  1GB1 A;  2DZM A;  1NYR A;  1R4N I;  1E7U A;  3DHH C;  3I9V 1;  4ANV A;  2BS2 B;  1K51 A;  4YTM B;  4RGM A;  1ENF A;  5BYR A;  3UIP B;  5H8Y E;  2KAN A;  2GBJ A;  4JLC A;  4OW0 A;  3H7P A;  2H89 B;  4A3P A;  4HVB A;  2Z8L A;  3P42 A;  4AQ7 A;  1ZDV A;  4WAA A;  3V61 A;  4W9H A;  1YN4 A;  2G4S A;  1WZ3 A;  2OOB B;  5E6N A;  3Q8A A;  2WU2 B;  3MHZ A;  1UBI A;  2KN5 A;  2RGF A;  2KNB A;  2TSS A;  2OJR A;  2AQ3 B;  4W9I A;  3H9D A;  2FE8 A;  2V3S A;  1NDD A;  2NS5 A;  5E6O A;  3UQA A;  2M17 A;  4ZRK A;  2MA9 B;  3N20 C;  1FRD A;  4M02 A;  1C3T A;  3IAS 1;  1JRU A;  2LD9 A;  1WRD B;  4WJP A;  3FIL A;  1SIF A;  2YVC A;  3A9J B;  1D6E C;  2ZCB A;  2ZW0 A;  5IP4 D;  2REX A;  4K81 A;  1R4M I;  4N9F 4;  3SR6 A;  4ARC A;  2VRR B;  2JQR B;  3NZ3 A;  2UWQ A;  4AOF A;  1SEB D;  1AN8 A;  3BVZ A;  2SEB D;  1ZXI A;  3R8B A;  2VZK D;  3L17 A;  1WMH A;  4BOS C;  3I57 A;  4MSM B;  3AED B;  4DQO C;  3MJ5 A;  4K7W A;  3TEX A;  4M01 A;  3L13 A;  4LNF A;  4IDI A;  2LJ5 A;  4W9E A;  1VCB A;  3X23 A;  2WXG A;  4C4V A;  3U52 E;  3P4S B;  3T9L A;  2MSE D;  4HK2 A;  3ZO5 B;  1AW7 A;  2CJO A;  1QIL A;  4DXF A;  2K8B A;  4XDD A;  2LUM A;  2V3N A;  2JSV X;  2KDE B;  3RUI B;  1R4N B;  1WX7 A;  2GRI A;  3ZGZ A;  4MH8 A;  2KT7 A;  1WXA A;  3BYY B;  3N9Y C;  1Q1O A;  1TS3 A;  3V62 A;  4C00 A;  2RR9 A;  1HQR D;  3ZJV A;  1V1P B;  5AZH A;  2IYD B;  3TUO A;  3TIX A;  1UGM A;  2AQ1 B;  3QIJ A;  5BMI A;  4LNK A;  2NTT A;  3AE9 B;  2LJI A;  4TUU A;  1MHX A;  4G50 A;  2KD0 A;  3W1Y A;  1ZDX A;  2L0F A;  4FHJ A;  3H7S A;  1T0Y A;  1CQV A;  5D6J B;  2KLG A;  1FMA D;  2BWF A;  1UGJ A;  3DVN V;  1RLF A;  2N1W A;  4ANW A;  1FCC C;  1L0V B;  2WU5 B;  2MX2 A;  4BZA A;  2V9H A;  1NYQ A;  2FCQ A;  2INC C;  4XX5 A;  5GMV A;  3AU4 A;  2IPK D;  3V60 A;  2K39 A;  1SIJ A;  4AJY B;  2KZR A;  4YL8 A;  5H92 C;  3ZKJ C;  4B0M A;  2IJ0 A;  2L1A A;  3NS1 A;  4JIO U;  1XT9 B;  1WE6 A;  3OLM D;  2QCZ A;  4NAM A;  3RNA C;  5EDS A;  1FRR A;  2D10 A;  4A90 A;  4CQN A;  2DZI A;  4UDU C;  2VH1 A;  1D3Z A;  3BII D;  2WXQ A;  4HPL B;  3Q3M C;  1WH3 A;  1TS5 A;  3BWU D;  3E56 A;  1QT9 A;  2M8S A;  3S2A A;  3IHP C;  2WXL A;  3Q2A C;  1VZ7 A;  1SXT A;  3IBE A;  1FFV A;  2LVO A;  4YTN B;  4ANX A;  2BGF A;  4EZK A;  1WXM A;  2WLB A;  4RF0 A;  3NJT A;  4RMA A;  2IGH A;  3KYC D;  3B2F A;  4PS8 A;  2UYZ B;  5EE3 A;  2G1E A;  1WX8 A;  2KOX A;  5EE1 A;  3UF8 A;  1VDV A;  3BVM A;  1QOB A;  2I2Y A;  3U30 A;  4FN2 A;  3JW0 X;  2IGD A;  1P7F A;  2IO2 B;  2AEH A;  4DWF A;  4II3 B;  1QOA A;  3L16 A;  2I38 A;  1OQQ A;  2C60 A;  2DAF A;  1WIA A;  1VZ8 A;  2MJE A;  2M0X A;  4C7Y A;  4B6W A;  2K8C A;  4FJZ A;  4GIV A;  3M63 B;  4XZ4 A;  3KUD B;  1TGZ B;  3W9C B;  2KFK B;  3WAM A;  1E90 A;  1WRI A;  5IAA C;  3R2T A;  4FJV B;  4LNN A;  3DDC B;  4YWG G;  2BPS A;  3ZJU A;  2MW5 A;  2KDB A;  2BKF A;  3GB1 A;  5C3J B;  1LGR A;  4HWI B;  4FLH A;  1DGJ A;  2QMT A;  4P1B C;  1E7P B;  3N3K B;  5D3I B;  3PPA A;  3M62 B;  1YQ4 B;  5FR6 A;  5G5G A;  1MG4 A;  2W55 A;  2WDQ B;  2KN4 A;  4OVZ A;  1FCL A;  2RSU A;  1WFY A;  2C5L C;  1UWM A;  1TKY A;  3KYD D;  1WJ4 A;  2JF5 A;  3DBL I;  1D5M C;  3RFZ B;  4C7Z A;  2BS3 B;  1Z5S B;  3IT6 B;  5E6J A;  4GU2 A;  2BKR B;  2RDG A;  1IGC A;  4EZJ A;  4OZB A;  1V1P A;  4K1R B;  4MGZ E;  4HXD A;  2PPH A;  1C9F A;  1BT0 A;  4DHZ E;  3FIL B;  4IG7 B;  3A4S C;  3WCQ A;  3AE3 B;  2IZV B;  2DYM A;  2KJ6 A;  3EA6 A;  1SSN A;  2ZZP B;  2XBB C;  3ALB A;  2MLB A;  2KWU B;  5JZE B;  2HD5 B;  1WGY A;  3DCG A;  3WAL A;  3H1U A;  1E8X A;  3Q8C A;  4WJQ A;  2L32 A;  4D2K A;  4I6L B;  5G5H A;  3SHQ A;  2R2Q A;  2Z0D B;  2CS4 A;  5G2N A;  4B9K A;  2EMT A;  1WMH B;  3SEB A;  3AE7 B;  2V4I B;  2KX0 A;  2M19 A;  4W9K A;  2J0J A;  2PVO D;  1XLP A;  2LWP A;  4LNO A;  1D5X C;  4GOC A;  3OJ3 A;  3AEC B;  4WQM A;  3KWV A;  1S1Q B;  2HTH A;  1EU3 A;  2K3U A;  2ICI A;  5CHW A;  1UWX A;  4LLG M;  5C23 A;  2KJH B;  2KVR A;  2K25 A;  1Q10 A;  3UI3 A;  4BAX A;  2ZPN A;  2IGG A;  3EC8 A;  4GXB A;  2H88 B;  2GBN A;  5G55 A;  4MSQ B;  2FUH B;  4WWM A;  4GB9 A;  4AUQ C;  2C7N B;  1P1A A;  2B76 B;  1C79 A;  1WYW B;  3A1Q B;  1E8W A;  1SB3 C;  1XF5 L;  2Y5B B;  3FC4 A;  3RMK C;  3QHT A;  4W9D A;  1L0X B;  4W9G A;  5HKH A;  4WJN A;  5JXV A;  2NPT B;  1J19 A;  1J0G A;  4WIP A;  1HXY D;  2ZW1 A;  5TSS A;  3DBL B;  4I6N B;  3GE3 C;  2MJD A;  2QSD A;  1UBQ A;  1PGX A;  2WXI A;  3KUZ A;  3OWE B;  3SFD B;  4RGT A;  1WM2 A;  2NCN A;  3D32 A;  5J2R A;  1VJK A;  2WXP A;  3HHM A;  5J17 A;  2JYT A;  4ZRI A;  3NS8 A;  4C56 C;  5CHF A;  2MWS B;  2PKO A;  2WDV B;  4GDL B;  4RM8 A;  2ACZ B;  3KQ4 A;  2LHD A;  4URK A;  1YN5 A;  4NY0 A;  4K3B A;  2BQQ A;  4H2A A;  2O2V B;  3I63 C;  2ZPY A;  2MHJ A;  3P4Q B;  3L0W B;  1ZXH A;  4K3C A;  4PK1 A;  2FIF A;  5L95 C;  1JRO A;  2Y5P A;  3PGE A;  3VRA B;  2L3Z A;  2KFK A;  1WR6 E;  1NI3 A;  4TQ1 A;  2NTS A;  3HM3 A;  4DBG A;  2YEP B;  3LDZ E;  5AUK A;  3RNG C;  2WS3 B;  1TYG B;  1FNW A;  2W82 A;  3U4E G;  2EKI A;  1L6U A;  3QCA A;  1FFU A;  3HUI A;  3AE4 B;  1MJD A;  3H6N A;  2MRP A;  3HVZ A;  1P7E A;  2YEP F;  3Q8F A;  1RM6 C;  4J6I A;  1N61 A;  1S3S G;  2QEJ C;  1UUP A;  2IY0 B;  3KVF B;  3ZDM C;  1KJT A;  3PLU A;  4X57 B;  4ZDV A;  4JGH B;  3VFK A;  3SDL C;  1JWM D;  1JAL A;  3AEE B;  1T6B X;  1SJE D;  1B9R A;  1L5P A;  1F52 A;  2NVU I;  2ZNV C;  1CMX B;  1H8C A;  4TMA B;  2N7E A;  2K6D B;  3FAH A;  2LGI A;  5C2T B;  5T8I A;  3M3J A;  2NBV B;  3ZIM A;  1QOF A;  4HDQ A;  4CHK A;  3BK1 A;  1TT5 B;  2K22 A;  1Y8R C;  3WAP A;  4E3C A;  4RCO A;  1N6Z A;  2BYV E;  1L2N A;  1N63 A;  1HZ6 A;  1LXD A;  2WXR A;  5KHQ A;  4LJO B;  2R61 A;  3K9P B;  2JX5 A;  1EWY C;  3A33 B;  1T0Q C;  3FKY A;  4A20 A;  3PRE A;  4A55 A;  3AU5 A;  2L00 B;  1N60 A;  2KO3 A;  3CF6 E;  1FIQ A;  2LZ6 A;  3Q8B A;  3E9S A;  3VXW A;  4DHJ D;  1IGD A;  1ZKH A;  2CJN A;  2FAZ A;  2KJR A;  1KLG D;  4EKU A;  1KOT A;  4QAY A;  3VUW A;  2KTR A;  3GS2 A;  4BVU C;  3HM6 X;  4K7U A;  2BTE A;  2FID A;  2N1V A;  3NZU A;  5IOI A;  5LLI A;  4BKS A;  4HRO A;  2C9W B;  3IT4 B;  2ZCC A;  1E0Z A;  4PS3 A;  2C7M B;  2IY1 B;  3AM9 A;  2J7Q B;  2ZJD A;  2N4F A;  1LM8 B;  3NOB A;  4KKJ A;  2JRI B;  5KHO A;  3HIZ A;  3TEZ A;  4OZA A;  4PYZ A;  3QQ8 B;  1HEZ E;  3CST A;  3N30 A;  1C77 A;  1ROE A;  1K52 A;  2ON8 A;  4M8N A;  2QIE B;  3QC8 B;  2V1Y A;  4W9L A;  2LGD A;  3VAW A;  1GNU A;  2IBI B;  1FO4 A;  2CR5 A;  4USA A;  1WGD A;  2BBC A;  4XC2 A;  1XLO A;  2X38 A;  1KLV A;  2GOW A;  2D2Q A;  1PYW D;  2CU3 A;  5HHD G;  3A1Q A;  3PHW B;  1WXQ A;  2MBO A;  4LCD E;  3PVL A;  4J3O D;  1K8R B;  5AZF A;  3PTF C;  4REZ A;  4PT5 A;  3SFE B;  4MGI E;  1TZ1 A;  1OQY A;  2NPT A;  4OHJ A;  3VTW A;  4EEW A;  3U8Z A;  2RDH A;  1DOI A;  2DBY A;  4JWS C;  1XLQ A;  1N5W A;  3VVW B;  5JHA A;  1I4Q A;  2E6X A;  3TBL D;  2CHW A;  1L4D B;  1MVK A;  1ET6 A;  1XLN A;  1WZ0 A;  1JCK B;  1IBX B;  5D2M B;  2V4L A;  4GDL A;  3L10 B;  3PZD A;  2N9E B;  3VTV A;  2MEK A;  1EF1 A;  5DPS A;  3VR8 B;  2O2V A;  1WXV A;  4HJG E;  1ZE3 D;  2IDY A;  2JWU A;  1PFD A;  4F7Z A;  5CHV C;  1YX6 B;  2MBB B;  3BYT B;  3OAW A;  1V5T A;  1TY0 A;  2DAJ A;  2Y5C A;  3ZLZ A;  4RNA A;  1YJJ A;  3AE6 B;  1A5R A;  2KWC A;  2KQS A;  1MHH E;  1V81 A;  4XE0 A;  2W3R A;  4JQW C;  3ML9 A;  4TSS A;  4WQO B;  2KX3 A;  1D4B A;  2O6V B;  3QA8 A;  4A3O A;  3A4R A;  1P98 A;  3AE8 B;  3TCA A;  1QZE A;  2IO1 B;  5LXH A;  2FUG 1;  1KLU D;  1YJI A;  2M0A A;  1ESF A;  2WXJ A;  3N32 A;  2LI5 A;  2BYT A;  2KLC A;  2MBQ A;  3ZRC A;  3C19 A;  4MH0 E;  4XGA B;  2WDT B;  3N1Z C;  1F77 A;  3DWG C;  2JWZ A;  1VZ6 A;  4W9F A;  5C1Z A;  2CHX A;  4AWJ A;  3DHI C;  4ZRJ A;  3LYY A;  3Q14 C;  5AUI A;  2L76 A;  2KVZ A;  1V80 A;  3NVV A;  4ZHO A;  4HPP A;  1GUA B;  4RH6 A;  3ENE A;  1WGR A;  1GC7 A;  4YXD B;  4MDK E;  4KZC A;  2BB5 A;  2MQJ A;  4M00 A;  1HTO A;  4KSK C;  3VH4 B;  4MT5 A;  1V9J A;  1SE9 A;  3SD5 A;  1V5O A;  3BVG A;  1GB4 A;  4LDT B;  2I1K A;  2KDF B;  2RD0 A;  2D5G A;  1I4X A;  4JE3 B;  2K0P A;  1PQS A;  3QK0 A;  2FNJ B;  4JX1 C;  3DPD A;  4AJW A;  4IM0 A;  1YMH E;  1B1Z A;  4B95 A;  1HTQ A;  1D5Z C;  2NBU A;  1JWU D;  1QKZ A;  3MP9 A;  3O65 B;  2OED A;  2HDE A;  1UH6 A;  2N9X A;  3W5U B;  4JL9 A;  2KDM A;  5DCN A;  4MAC A;  3H8H A;  4IOI E;  1CJE A;  2LGY A;  3EFU A;  1WSP A;  4L2Y A;  3K9O B;  2JZZ A;  4LJP B;  4S0R A;  3RI7 C;  5FK9 C;  3VQI A;  2RDB C;  4HCP B;  3ZUN A;  3AUL A;  5DPR A;  3NVW A;  3W1S C;  2PVG C;  2HJ1 A;  5CX3 A;  1UF0 A;  1V49 A;  3AE1 B;  1L7Y A;  1XO3 A;  1GC6 A;  1ZP0 B;  2LEK A;  3TEY A;  2N7D A;  2DEN B;  4KIK B;  1WJ6 A;  1C76 A;  1C78 A;  4P7I A;  2DYO A;  1DOY A;  3APD A;  1E8Z A;  4WAF A;  4MM3 B;  3W2D A;  3DHG C;  5IO9 A;  5TR5 A;  1J7A A;  3BZD B;  2EMS A;  4ZYS A;  3PS6 A;  1JWB D;  1JQ4 A;  3ZQ4 A;  3P2B A;  4MGK E;  3RT3 B;  4GMV A;  3MC9 A;  3P4R B;  3UGB B;  1V86 A;  1ZPS A;  1YIW A;  3MTN B;  4GGQ A;  3ONS A;  5LNK 1;  3R7Q A;  1KF6 B;  5HI1 A;  3RNC C;  3EEC A;  5AEK B;  1F1H A;  2J52 A;  1KH0 A;  2Q5W D;  1FD6 A;  2FCS A;  2QIL A;  5IA7 A;  4AS1 A;  3AE2 B;  4LK0 M;  1F9J A;  2WX1 A;  3EHV A;  4II2 B;  3BK2 A;  4GDK B;  2VZK B;  1EO6 A;  1R7S A;  2KTR B;  4HLE A;  1IBX A;  1FXT B;  4GN1 A;  3VH3 B;  1JW9 D;  2GMI C;  4Q2J A;  3NZS A;  3N1Y C;  3RNB C;  4IM2 A;  1GG3 A;  3Q69 A;  3ABV B;  3DVG X;  1HA5 A;  3T8M A;  3KUC B;  3ETR A;  1NEN B;  4DXG A;  2GB1 A;  4OVV A;  3LXF A;  4O1N A;  5BYS A;  5HFY A;  1WYG A;  2UU7 A;  2JXX A;  3DVG Y;  5BO4 B;  1J7B A;  1KFY B;  3HRD D;  3MHS D;  1WGK A;  2MH7 A;  1M4V A;  3EUB 2;  2O6V A;  4WWN A;  1E6E B;  2IO0 B;  4KV2 A;  1RWS A;  3R66 C;  1FXI A;  2LAS A;  5JH5 C;  1WJU A;  3V6C B;  4TV3 A;  1I35 A;  5BMG A;  1TS4 A;  4FAD A;  4E74 A;  2JVC A;  2AX5 A;  1GJZ A;  1L6V A;  4NJ6 A;  1XCQ L;  1PUT A;  1GAQ B;  1OEY J;  3U2S C;  2L7R A;  2QJL A;  4ZRQ A;  2WDR B;  1KRH A;  2WNM A;  3R3M A;  4IWP A;  4KGT A;  1JWS D;  4DK5 A;  2PW9 A;  2PE6 B;  1C4P A;  1EU4 A;  2G45 B;  3VHT C;  2LUE A;  3JYU A;  2NBW B;  2KC2 A;  2DZK A;  3EFC A;  1XXG A;  4BBN C;  4IM3 A;  2D3B A;  2JYE A;  4ZRP A;  4ASW C;  2K9X A;  2VH2 A;  2AYO B;  5GXG B;  1P3Q U;  2OJW A;  3ZTC A;  4BKG A;  5DPW A;  2BS4 B;  3B9J A;  2MBH A;  4N59 A;  4GLS C;  1FXA A;  4LTU A;  1X1M A;  1I42 A;  4FUL A;  4BBN F;  4KDI C;  1E5W A;  4ZHP A;  3MJW A;  1NBF C;  2J42 A;  3AI5 A;  3A9K B;  2BW2 A;  3N1X C;  1BUI C;  1C4A A;  3Q3J A;  4TKN A;  1L0Y B;  1V8C A;  4LDT D;  4A6Q A;  4WH4 A;  3ZW3 A;  3ZJT A;  1LFD A;  2AWT A;  3V05 A;  2D07 B;  2WX0 A;  2KKC A;  4G0N B;  4KVG B;  1G6J A;  2GBR A;  2R2O A;  2W54 A;  3RYT A;  2WWZ A;  1DYQ A;  1YX5 B;  4P16 A;  3AV8 A;  1WM3 A;  1WX9 A;  3B2G A;  1IYF A;  2KTF A;  3P63 A;  2AL6 A;  3NHE B;  1P9D U;  1PGB A;  3GZN I;  2GLS A;  4IW0 A;  3NUH B;  5J18 A;  3V6E B;  3C0R B;  4KIK A;  2BYF A;  3QX1 A;  3ZXV A;  1OEY A;  2PIA A;  3Q3O C;  3Q8E A;  1JML A;  2MP2 B;  4MM3 A;  2KXJ A;  2ZNV B;  4EFO A;  3AEB B;  1TS2 A;  2INN E;  2J53 A;  4K7S A;  1EUV B;  1LQB A;  2KDI A;  1KTK A;  5E6P A;  2PJH A;  4G3X B;  3AEA B;  3OJ4 B;  2XEW A;  1N62 A;  1EM7 A;  2XN9 C;  1FEH A;  1BML C;  2PMV A;  3TMP B;  1FNV A;  1Z2M A;  3DVN U;  1T5X D;  1WY8 A;  2XK5 A;  1YJ1 A;  1YN3 A;  2PEA A;  2WYQ A;  3ZDT A;  3ZRF A;  2OHF A;  2N7J A;  3L08 A;  3LJ3 A;  4HJK A;  4ZYN A;  3GP7 A;  2JRH A;  3ZVV A;  1ISN A;  1P0R A;  2A4Z A;  3AN1 A;  4N6E B;  4GDK A;  4PS7 A;  4KZ0 A;  3ZNI D;  2XNA C;  3L54 A;  4ICU A;  2LRW A;  3AB5 A;  2BYE A;  4FBJ B;  3PZ8 A;  5FR3 A;  2Y3A A;  2C7H A;  3DBS A;  1VRA B;  3JVZ X;  2CKH B;  4KSL C;  3HK0 A;  3RZF A;  2MJ3 A;  1NVI D;  2KAJ A;  4KGR A;  3IAM 1;  2K8H A;  3KWL A;  1QF6 A;  3MC8 A;  1AWD A;  2HJ8 A;  1EWC A;  1DOX A;  4WWO A;  3T3N A;  1UZX B;  1ZW7 A;  3CSF A;  3ML8 A;  2KHW B;  1RAX A;  3I3T B;  3RPF C;  4BKS D;  4R3D A;  2JU6 X;  4JWU C;  3AMZ A;  3DBH B;  3BY4 B;  5IKC M;  4G11 A;  4XYC A;  2L05 A;  3I5J C;  3P1M A;  5AZG A;  3RNF C;  1ZGU B;  2EEL A;  3RZW C;  3GZN B;  5BMH A;  4HPM B;  1C1Y B;  3PLV A;  3PV1 A;  3ZNG C;  1V1O A;  3MC0 B;  3TEW A;  4NQK E;  4KKI A;  3URY A;  1UEL A;  2CU1 A;  3VUX A;  4HEA 1;  4MGY E;  4EOY A;  5LXI B;  3RD2 A;  1VD2 A;  3WA0 A;  1AYF A;  3ECI A;  3EGR A;  2JY6 A;  2NR2 A;  4WUR A;  2K5P A;  4F8C B;  2MBE A;  2LMC A;  2ZVN A;  3KW5 B;  2NMQ A;  2WQY B;  3KLS X;  4DDG D;  4M0W B;  2KYW A;  4NZL B;  3GE8 C;  4ZOH C;  2WXH A;  1MG8 A;  3QWZ B;  4MEM A;  4KX6 B;  2N9K A;  2LHE A;  4RGO S;  4BOZ B;  4FJY A;  2FCM A;  4WWP A;  3VR9 B;  1F0Z A;  1UD7 A;  2KMA A;  3M95 A;  2JXT A;  2N0S B;  3A9K A;  5BYQ A;  3W5V B;  4KGS A;  1QLB B;  1K53 A;  4XWW A;  4CO7 A;  2JUO A;  5EE0 A;  3UIN B;  4RF1 A;  1XCT L;  3PRZ A;  4NAW B;  2WXF A;  1R4M B;  3CMM B;  4MJS B;  4ARI A;  1HE8 A;  3Q6B A;  1V6E A;  2DWQ A;  1SGH A;  2QHO A;  2K6Q A;  2QC8 A;  2LFI A;  5IN7 A;  2LRU A;  3RNE C;  2W3S A;  1TZO A;  4IWQ A;  3HVD A;  2CHZ A;  3QJZ A;  1OQR A;  4WJO A;  3VTU A;  1BXT A;  1TKG A;  3PO0 A;  4US8 A;  1UNS A;  2DHZ A;  4IKG A;  3UQB A;  3NRZ A;  2IO3 B;  3MFG A;  4BFR A;  1XD3 B;  2BWE S;  2JT4 B;  5D3D A;  1TJE A;  2D3G A;  1WI0 A;  4ITK A;  2J0K A;  3PRM B;  2L0T A;  2M56 B;  1PGA A;  3PHX B;  2MP2 A;  1V97 A;  1J8C A;  1I4H A;  2X8X X;  4W9C A;  2G3Q B;  3AE5 B;  2JZP A;  4N58 A;  1EF5 A;  2J0M A;  4NNJ B;  1HZ5 A;  2KK8 A;  2W9N A;  4ACF A;  2I1J A;  3ZYY X;  2FCN A;  4DDI D;  4IWO A;  3JSV B;  2LVQ A;  2Z59 B;  3AH7 A;  4GSW A;  5D7G A;  1E9M A;  4EZL A;  3ZXR A;  2KWV B;  3R2I A;  1TKE A;  1FM0 D;  4EE2 A;  2BB6 A;  3RCZ A;  4FXC A;  2AL3 A;  2K1F A;  1JWA D;  2LGX A;  2LXC A;  2PLP A;  2LVP A;  1QOG A;  2G4D B;  2PTL A;  2FBW B;  1VR9 A;  2L52 A;  1N5X A;  4RM9 A;  1WGH A;  1Q0W B;  3WAN A;  3U7Z A;  5JHB A;  2INP E;  4E71 A;  1WR1 A;  4YSY B;  3IFW B;  2GI9 A;  3R7R A;  2SAK A;  3A9J A;  1TTN A;  1WXS A;  2B3A A;  2KAC A;  1T0S C;  3DBR I;  4L23 A;  4DXA B;  1J7C A;  2Z0E B;  3AEF B;  3ZTD A;  3PZ7 A;  1IP9 A;  3QAQ A;  2DX5 B;  2AQ2 B;  4W9J A;  3B0A A;  1NEK B;  1Y56 A;  5CTR C;  1YD8 U;  1OTR B;  1KM7 A;  2DLB A;  2N9L A;  2ZVO A;  4YT0 B;  4A8X C;  1SF0 A;  4L1B A;  1MFW A;  2WHI A;  2D3A A;  1E10 A;  4S17 A;  2J4X A;  1GPX A;  1YQ3 B;  1F2R I;  3H7P B;  1ZUD 2;  3IXS A;  3U7D A;  2D3C A;  2WXN A;  2RPV A;  4RFB A;  1ET9 A;  2EKE C;  4XDC A;  3X0W A;  3NG0 A;  1MPE A;  4F1S A;  3P4P B;  5MPO A;  3PRP B;  4MEL A;  1XQQ A;  1I4G A;  1L4Z B;  1WE7 A;  2YLM A;  4HKQ A;  1H4R A;  1CK1 A;  2WGS A;  3QAR A;  2V3P A;  3VUY A;  2M4N A;  1STE A;  4FA6 A;  3B08 A;  2KC1 A;  3VDZ A;  1QQR A;  1YNT E;  4C80 A;  2XK5 B;  4DHJ B;  3ZNZ B;  4XWT A;  1T3Q A;  1Q5W B;  1SJH D;  1RFA A;  4HRS A;  1IPG A;  1CZP A;  3BIN A;  1A70 A;  1PDX A;  3OG5 A;  4M8M A;  2ZEQ A;  2QDF A;  3Q3N C;  2WXO A;  2DZJ A;  5D94 A;  5FKA C;  1YOV B;  1FPY A;  4HKZ E;  2LGS A;  3TL5 A;  3PT2 B;  3TSS A;  2KQ7 A;  1E8Y A;  3WAO A;  1TBE A;  4M0W A;  1RFK A;  1U4A A;  3VRB B;  1NI2 A;  4US9 A;  3V3X A;  1OFF A;  2E3T A;  3CWI A;  4ICV A;  1TIF A;  1WJN A;  1ACC A;  2A5U A;  2RPQ A;  3IG3 A;  4NJ7 A;  4OZC A;  1I7H A;  2BVC A;  4DHZ B;  1IUE A;  1SBB B;  5DPT A;  5I4D A;  1T0R C;  2D11 A;  1JRP A;  2DYB A;  2WXK A;  1ZOY B;  3RUL A;  2N9P C;  1FNU A;  3NVY A;  4NAW A;  3DWM A;  4NJC A;  3DBR B;  4MJS A;  3APC A;  1OGW A;  2L83 A;  3NVZ A;  1LO5 D;  3Q3F A;  2HTM E;  4YTP B;  4I6P A;  1V2Y A;  2JZ3 B;  3GOE A;  3IVF A;  4C4V B;  3AXC A;  2ONQ A;  1GOZ A;  1XEE A;  1RYJ A;  2JPH A;  1YQB A;  5HG2 A;  3KH0 A;  4YSX B;  4P1C C;  3NY5 A;  3RN9 C;  4CYE A;  2GBK A;  2KMM A;  1F2R C;  2V0G A;  2O6V D;  3APF A;  3SU8 X;  4NQL B;  4AP4 C;  1AAR A;  1M94 A;  1WWT A;  1I4P A;  2KFJ A;  3UIO B;  3LB8 C;  1TY2 A;  2MCN B;  2L8J A;  2WP9 B;  3J9C A;  3T3O A;  1C4C A;  5EE9 A;  3DQV A;  1WF9 A;  2M1M A;  4P6V F;  1I4R A;  4JPS A;  4YSZ B;  1MI0 A;  3JSV A;  3ZNH B;  4ANU A;  3C8Y A;  4FHK A;  2ASQ A;  1K50 A;  2IND C;  2WXM A;  2BF8 B;  4OVU A;  3AEG B;  4RGN A;  2LXA A;  1RRB A;  4A9A A;  3WIM A;  3L4P A;  2G9H D;  4BKT A;  4PYU A;  2BT6 A;  4KDL B;  4HCN B;  4EUT A;  3DOW A;  1WGG A;  4HDO A;  2HE7 A;  5L83 A;  2KWD A;  1SE2 A;  3DBH I;  2DNF A;  3B1L X; 
#chains in the Genus database with same CATH homology
 4WJQ A;  4KSK C;  4I6L B;  5AZG A;  3SHQ A;  2R2Q A;  1ZGU B;  3VH4 B;  1V9J A;  1SE9 A;  3RZW C;  2Z0D B;  2CS4 A;  2GBM A;  1V5O A;  3PSE B;  3SD5 A;  4HPM B;  4IUM B;  5G2N A;  1C1Y B;  3PLV A;  4LDT B;  2I1K A;  2KDF B;  4IC7 B;  3WAL A;  4TQ0 A;  4B9K A;  2EMT A;  1E7V A;  1WMH B;  2PE9 A;  3PV1 A;  4NPN A;  3ZNG C;  2RD0 A;  2KMC A;  1PQS A;  2KX0 A;  3TJP A;  3QK0 A;  2DZM A;  4W9K A;  1R4N I;  2FNJ B;  1E7U A;  2J0J A;  4NQK E;  3DPD A;  4ANV A;  4AJW A;  2LWP A;  4IM0 A;  4B95 A;  1UEL A;  2CU1 A;  3VUX A;  2NBU A;  3UIP B;  4GOC A;  3O65 B;  3OJ3 A;  4MGY E;  2KAN A;  4EOY A;  5LXI B;  3RD2 A;  1VD2 A;  2GBJ A;  3WA0 A;  4JLC A;  3H7P A;  1UH6 A;  2N9X A;  4HVB A;  3ECI A;  4A3P A;  1S1Q B;  2HTH A;  2JY6 A;  2NR2 A;  5CHW A;  4JL9 A;  4F8C B;  2MBE A;  5DCN A;  5C23 A;  2ZVN A;  3KW5 B;  4WAA A;  2KJH B;  3V61 A;  2LGY A;  3EFU A;  2KVR A;  2K25 A;  4W9H A;  4DDG D;  2G4S A;  1WZ3 A;  2OOB B;  2JZZ A;  3K9O B;  4LJP B;  4M0W B;  5E6N A;  3VQI A;  2ZPN A;  1UBI A;  3QWZ B;  1MG8 A;  4MEM A;  4HCP B;  3ZUN A;  2KN5 A;  3AUL A;  2RGF A;  3EC8 A;  4GXB A;  5DPR A;  2GBN A;  2KNB A;  2OJR A;  4W9I A;  5G55 A;  3H9D A;  3W1S C;  4BOZ B;  4FJY A;  2FCM A;  2V3S A;  4MSQ B;  4WWP A;  2FUH B;  4GB9 A;  1NDD A;  2NS5 A;  5E6O A;  3UQA A;  4AUQ C;  2M17 A;  2C7N B;  1UD7 A;  1P1A A;  1WYW B;  3A1Q B;  5CX3 A;  1E8W A;  2KMA A;  3M95 A;  4ZRK A;  1V49 A;  2MA9 B;  3A9K A;  1L7Y A;  2Y5B B;  1GC6 A;  4CO7 A;  1C3T A;  2JUO A;  1JRU A;  2LD9 A;  1WRD B;  4WJP A;  3UIN B;  2N7D A;  1SIF A;  2DEN B;  2YVC A;  4KIK B;  1WJ6 A;  3QHT A;  3PRZ A;  4NAW B;  4W9D A;  4W9G A;  3A9J B;  2ZCB A;  4WJN A;  3CMM B;  4MJS B;  5HKH A;  4P7I A;  1HE8 A;  2DYO A;  3APD A;  2NPT B;  1J19 A;  2REX A;  1J0G A;  1E8Z A;  1R4M I;  1V6E A;  4K81 A;  4N9F 4;  2VRR B;  1SGH A;  2QHO A;  2K6Q A;  4I6N B;  1UBQ A;  2UWQ A;  2LRU A;  3KUZ A;  5TR5 A;  1WM2 A;  4AOF A;  2NCN A;  2EMS A;  3D32 A;  4IWQ A;  2CHZ A;  3QJZ A;  3PS6 A;  5J2R A;  4WJO A;  3VTU A;  3HHM A;  5J17 A;  3P2B A;  4ZRI A;  4MGK E;  3NS8 A;  3RT3 B;  5CHF A;  2MWS B;  4GMV A;  2DHZ A;  4GDL B;  4RM8 A;  3UQB A;  3L17 A;  2IO3 B;  3UGB B;  1V86 A;  1WMH A;  4BFR A;  4BOS C;  1XD3 B;  2BWE S;  2JT4 B;  4URK A;  1YIW A;  2D3G A;  3MTN B;  4GGQ A;  3ONS A;  4MSM B;  4NY0 A;  2O2V B;  2ZPY A;  1WI0 A;  4K7W A;  2J0K A;  3PRM B;  3R7Q A;  2L0T A;  3L0W B;  3L13 A;  3EEC A;  5AEK B;  2FIF A;  5L95 C;  2LJ5 A;  3PGE A;  4W9E A;  2L3Z A;  2FCS A;  3PHX B;  2KFK A;  1WR6 E;  2MP2 A;  5IA7 A;  1J8C A;  4W9C A;  2G3Q B;  1VCB A;  4TQ1 A;  3X23 A;  1F9J A;  2WX1 A;  1EF5 A;  3EHV A;  4II2 B;  3HM3 A;  4DBG A;  4GDK B;  3T9L A;  2J0M A;  2MSE D;  3LDZ E;  4NNJ B;  1EO6 A;  4HK2 A;  2KK8 A;  2W9N A;  3ZO5 B;  2KTR B;  2I1J A;  2FCN A;  4HLE A;  2K8B A;  4DDI D;  4IWO A;  1FXT B;  3JSV B;  2LVQ A;  4GN1 A;  3VH3 B;  2GMI C;  2Z59 B;  2KDE B;  3NZS A;  3RUI B;  4GSW A;  5D7G A;  3QCA A;  4EZL A;  1WX7 A;  4IM2 A;  2KWV B;  1GG3 A;  3RCZ A;  3H6N A;  1WXA A;  3DVG X;  2AL3 A;  2MRP A;  1Q1O A;  3T8M A;  2K1F A;  3V62 A;  3KUC B;  2RR9 A;  4J6I A;  1S3S G;  2LGX A;  2IY0 B;  2LXC A;  3KVF B;  5AZH A;  2IYD B;  2LVP A;  3ZDM C;  2G4D B;  1KJT A;  3PLU A;  4X57 B;  4OVV A;  4ZDV A;  3TIX A;  4RM9 A;  1UGM A;  1WGH A;  4JGH B;  3VFK A;  3QIJ A;  3SDL C;  1Q0W B;  2JXX A;  3WAN A;  3DVG Y;  5JHB A;  4E71 A;  1WR1 A;  5BO4 B;  3IFW B;  4TUU A;  3R7R A;  3MHS D;  3A9J A;  4G50 A;  1TTN A;  1WXS A;  2B3A A;  2NVU I;  2ZNV C;  1CMX B;  1H8C A;  3DBR I;  4DXA B;  2KD0 A;  2O6V A;  4WWN A;  2N7E A;  2Z0E B;  3ZTD A;  3W1Y A;  2IO0 B;  2K6D B;  2L0F A;  3QAQ A;  2DX5 B;  4KV2 A;  1IP9 A;  4FHJ A;  3M3J A;  4W9J A;  3B0A A;  3R66 C;  3H7S A;  2NBV B;  3ZIM A;  1T0Y A;  4HDQ A;  2LAS A;  5JH5 C;  1WJU A;  3V6C B;  4TV3 A;  4CHK A;  5D6J B;  1I35 A;  2KLG A;  2BWF A;  5CTR C;  4E74 A;  1YD8 U;  1OTR B;  4FAD A;  2JVC A;  3DVN V;  1RLF A;  1KM7 A;  1Y8R C;  2N1W A;  2ZVO A;  3WAP A;  4E3C A;  1GJZ A;  4ANW A;  2BYV E;  4NJ6 A;  1L2N A;  1OEY J;  1LXD A;  2MX2 A;  5KHQ A;  2L7R A;  4LJO B;  2FCQ A;  5GMV A;  4XX5 A;  4IWP A;  3R3M A;  3K9P B;  3AU4 A;  3V60 A;  3A33 B;  2K39 A;  4AJY B;  4A20 A;  2KZR A;  3PRE A;  4YL8 A;  4DK5 A;  2PE6 B;  3AU5 A;  2L00 B;  2G45 B;  2KO3 A;  2LUE A;  3CF6 E;  3VHT C;  2LZ6 A;  3JYU A;  3H7P B;  3ZKJ C;  3U7D A;  3VXW A;  2NBW B;  2KC2 A;  2DZK A;  4DHJ D;  4KZC A;  1ZKH A;  4JIO U;  4BBN C;  1XT9 B;  2EKE C;  1WE6 A;  2FAZ A;  2KJR A;  3X0W A;  4IM3 A;  4F1S A;  3OLM D;  4EKU A;  1KOT A;  5EDS A;  3PRP B;  4MEL A;  4ASW C;  1XQQ A;  2D10 A;  1WE7 A;  2YLM A;  3VUW A;  2AYO B;  1H4R A;  3QAR A;  1P3Q U;  2DZI A;  3VUY A;  2KTR A;  3ZTC A;  2M4N A;  4BVU C;  3HM6 X;  4K7U A;  4BKG A;  5DPW A;  1D3Z A;  2FID A;  2N1V A;  3NZU A;  2MBH A;  3B08 A;  4FA6 A;  2KC1 A;  3VDZ A;  5LLI A;  4HPL B;  4BKS A;  2C9W B;  1WH3 A;  2XK5 B;  1X1M A;  2ZCC A;  1I42 A;  4DHJ B;  3ZNZ B;  4PS3 A;  4FUL A;  4BBN F;  4KDI C;  1Q5W B;  2C7M B;  1E5W A;  2M8S A;  1RFA A;  2IY1 B;  3MJW A;  1NBF C;  1IPG A;  2J7Q B;  3IHP C;  3S2A A;  2ZJD A;  3AI5 A;  3A9K B;  2N4F A;  1LM8 B;  3BIN A;  3NOB A;  4M8M A;  2JRI B;  5KHO A;  3HIZ A;  2ZEQ A;  3Q3J A;  3IBE A;  4TKN A;  2DZJ A;  4PYZ A;  3QQ8 B;  5D94 A;  2LVO A;  4LDT D;  4ANX A;  3CST A;  2BGF A;  3N30 A;  3ZW3 A;  4EZK A;  1LFD A;  1WXM A;  2AWT A;  4M8N A;  3TL5 A;  2D07 B;  2V1Y A;  2WX0 A;  3QC8 B;  2KKC A;  3PT2 B;  4G0N B;  4RMA A;  4KVG B;  2KQ7 A;  1E8Y A;  3KYC D;  3WAO A;  1TBE A;  1G6J A;  2GBR A;  2R2O A;  4W9L A;  2LGD A;  4PS8 A;  1GNU A;  1U4A A;  3RYT A;  2UYZ B;  2WWZ A;  3VAW A;  1NI2 A;  1YX5 B;  2IBI B;  2CR5 A;  1WM3 A;  1WGD A;  1WX9 A;  1IYF A;  1WX8 A;  4XC2 A;  2KTF A;  2KOX A;  1KLV A;  2AL6 A;  3NHE B;  2GOW A;  3UF8 A;  1P9D U;  2D2Q A;  3U30 A;  4FN2 A;  4ICV A;  1WJN A;  3JW0 X;  3A1Q A;  3GZN I;  3PHW B;  2A5U A;  2RPQ A;  3IG3 A;  4NJ7 A;  2IO2 B;  2AEH A;  4DWF A;  4II3 B;  2MBO A;  4IW0 A;  4DHZ B;  5DPT A;  4LCD E;  5J18 A;  3L16 A;  3PVL A;  2D11 A;  1K8R B;  5AZF A;  2C60 A;  3V6E B;  2DYB A;  3C0R B;  2DAF A;  3RUL A;  1WIA A;  3PTF C;  2N9P C;  4KIK A;  2BYF A;  2M0X A;  3QX1 A;  4NAW A;  4B6W A;  4MGI E;  2K8C A;  4FJZ A;  4GIV A;  1OEY A;  1TZ1 A;  4MJS A;  3W1S A;  3APC A;  3M63 B;  4XZ4 A;  1OQY A;  2NPT A;  1OGW A;  3KUD B;  3VTW A;  1TGZ B;  4EEW A;  3U8Z A;  2KFK B;  2MP2 B;  3WAM A;  3Q3F A;  4MM3 A;  2KXJ A;  2ZNV B;  4EFO A;  4I6P A;  1V2Y A;  2JZ3 B;  1E90 A;  3GOE A;  3IVF A;  3AXC A;  5IAA C;  3VVW B;  4K7S A;  1EUV B;  5JHA A;  1LQB A;  2JPH A;  3TBL D;  1YQB A;  2CHW A;  4FJV B;  2KDI A;  5E6P A;  2PJH A;  3KH0 A;  1WZ0 A;  4G3X B;  3DDC B;  3NY5 A;  3OJ4 B;  5D2M B;  4CYE A;  2XEW A;  2V4L A;  4GDL A;  2BPS A;  3L10 B;  3PZD A;  2MW5 A;  2KDB A;  2BKF A;  2N9E B;  3VTV A;  2GBK A;  4HWI B;  3TMP B;  4FLH A;  1EF1 A;  3DVN U;  1Z2M A;  5DPS A;  3N3K B;  2O6V D;  1WY8 A;  1WXV A;  2O2V A;  2XK5 A;  1YJ1 A;  3APF A;  3SU8 X;  4NQL B;  4F7Z A;  5CHV C;  4AP4 C;  1YX6 B;  2MBB B;  3PPA A;  3OAW A;  1V5T A;  1AAR A;  2PEA A;  2DAJ A;  2WYQ A;  3ZLZ A;  1M94 A;  3ZDT A;  3M62 B;  3ZRF A;  2KFJ A;  3UIO B;  1A5R A;  2KWC A;  5FR6 A;  2L8J A;  2MCN B;  3L08 A;  3LJ3 A;  2KQS A;  4HJK A;  4ZYN A;  1V81 A;  2JRH A;  3ZVV A;  1ISN A;  1P0R A;  2A4Z A;  2RSU A;  4GDK A;  3DQV A;  1WF9 A;  4JQW C;  1WFY A;  3ML9 A;  2M1M A;  4PS7 A;  4KZ0 A;  3ZNI D;  4WQO B;  3L54 A;  2KX3 A;  4ICU A;  2LRW A;  2BYE A;  2C5L C;  2O6V B;  3QA8 A;  4FBJ B;  4A3O A;  3A4R A;  3ZNH B;  3JSV A;  4ANU A;  3H1U A;  3KYD D;  1P98 A;  1WJ4 A;  2JF5 A;  3TCA A;  1QZE A;  4FHK A;  3DBL I;  2ASQ A;  2IO1 B;  5LXH A;  2C7H A;  3DBS A;  2BF8 B;  3JVZ X;  4OVU A;  2CKH B;  1Z5S B;  2LI5 A;  3HK0 A;  3N32 A;  4KSL C;  3RZF A;  2KLC A;  2BKR B;  4GU2 A;  2MBQ A;  3ZRC A;  2K8H A;  2LXA A;  4MH0 E;  4EZJ A;  1RRB A;  4MGZ E;  4K1R B;  4HXD A;  2HJ8 A;  2PPH A;  2WDT B;  1BT0 A;  4DHZ E;  3WIM A;  4BKT A;  4PYU A;  4WWO A;  1UZX B;  4IG7 B;  2JWZ A;  3A4S C;  4W9F A;  1ZW7 A;  3CSF A;  5C1Z A;  2CHX A;  4KDL B;  3ML8 A;  4AWJ A;  2KHW B;  4ZRJ A;  2IZV B;  4HCN B;  4EUT A;  1RAX A;  3I3T B;  2L76 A;  2DYM A;  4BKS D;  3DOW A;  1V80 A;  2KJ6 A;  1WGG A;  1GUA B;  4HDO A;  2HE7 A;  1WGR A;  2XBB C;  2ZZP B;  3ALB A;  3ENE A;  5L83 A;  1GC7 A;  3BY4 B;  2MLB A;  4G11 A;  2KWU B;  5JZE B;  2HD5 B;  4MDK E;  1WGY A;  2L05 A;  3DBH I;  3B1L X;  3DCG A;  2MQJ A;  1E8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...