2NTSA

Crystal structure of sek-hvb5.1
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
217
structure length
217
Chain Sequence
QGDIGIDNLRNFYTKKDFVDLKDVKDNDTPIANQLQFSNESYDLISESKDFNKFSNFKGKKLDVFGISYNGQSNTKYIYGGVTATNEYLDKSRNIPINIWINGNHKTISTNKVSTNKKFVTAQEIDVKLRKYLQEEYNIYGHNGTKKGEEYGHKSKFYSGFNIGKVTFHLNNNDTFSYDLFYTGDDGLPKSFLKIYEDNKTVESEKFHLDVDISYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel loop domain in superantigens extends their T cell receptor recognition site
pubmed doi rcsb
source organism Homo sapiens
molecule tags Toxin/immune system
molecule keywords TRBC1 protein
total genus 66
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ntsA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ntsA01
4RCOA 1PZKD 2RDGA 3KLSX 4L6TB 1CHQD 5TSSA 5I4DA 1PZJD 1EU3A 1PRTB 2TSSA 2NTTA 1TS2A 5ELBA 1BCPD 1SEBD 5D3IB 4RGOS 1F77A 4ZYSA 1L0XB 1PTOH 1LT4D 1S5FD 4BWGB 2IJ0A 1TS4A 1EFID 3W2DA 1TY2A 4RHSA 4RGMA 2QEJC 1SE2A 2AQ1B 1SJED 1KLGD 1LTBD 1FNWA 1LTGD 1T5XD 1STEA 1LTSD 1CK1A 1DJRD 1G8ZD 5FKAC 1AW7A 1DYQA 1PZID 1SJHD 1LTAD 2CHBD 4NZLB 5ELFA 1RF2D 1KTKA 1EEID 1AN8A 1S5ED 1BCPF 1LTID 2XRSD 3O13A 2O2LD 5ELEA 1I4RA 3BVMA 4UDUC 2R61A 1I4GA 1TS3A 1YN3A 1BCPC 3BYYB 1I4QA 4OHJA 2AQ2B 1JWMD 5D3DA 4DXGA 3OWEB 3TSSA 1SXTA 5ELCA 2J4XA 3V05A 1D5ZC 3BVZA 5FK9C 1I4XA 1SE3A 1PRTD 1PTOF 2XRQD 2NTSA 1CQVA 1FNVA 1LLRD 1V1OA 1HTLD 3EA6A 1S5CD 1CHPD 2AQ3B 3BYTB 1SE4A 3MC0B 1QILA 2G9HD 3BVGA 4L63B 1BCPB 1YN5A 2XNAC 3DWQA 1PTOB 4RGTA 2RDHA 1YN4A 4Z9CB 1D5MC 4RFBA 1I4HA 1JR0D 3SEBA 1PRTF 1ESFA 1I4PA 1LTTD 5ELDA 1PRTC 1ET6A 1D5XC 4TSSA 4DXFA 1D6EC 1XXGA 1RD9D 1EEFD 2Z8LA 4C56C 1FGBD 2WV6D 4RHRA 1B44D 1B1ZA 1HA5A 1LT3D 3DWAA 2QILA 1PTOC 1L0YB 1KLUD 3R2TA 1UUPA 3URYA 1EWCA 3R2IA 1JQYD 1BXTA 3EFXD 3BZDB 4O1NA 1JWUD 1TY0A 1ET9A 1S5DD 2IPKD 2XN9C 1LT5D 1LTRD 1LT6D 3MFGA 4RGNA 1M4VA 1MD2D 1ENFA 1V1PA 1HXYD 1FD7D 3DWPA 4K6LA 1CT1D 4RH6A 1FNUA 1RCVD 1TS5A 1UNSA 1V1PB 1EU4A 3GP7A 1GOZA 1LO5D 1S5BD 1RDPD 2SEBD 1PTOD 1JCKB 1PYWD 1JWSD 1XTCD 1HQRD 1SBBB 3CHBD 2ICIA 3R8BA
chains in the Genus database with same CATH superfamily
2F1MA 1EY7A 4ULLA 4GOPA 3ND8A 2KCMA 4HTHA 2L1AA 2V4IB 2CWPA 5DM73 3L13A 4ZHPA 3HKSA 4A3MG 3H9DA 2NTTA 5HGTA 2QHOA 3SFEB 3I4MB 4YTMB 2I2YA 1DXMA 1EY6A 4RGOS 3DOWA 4LUZA 4HPPA 1L0XB 2ICEC 4P2CB 1TKGA 3PV1A 3CW2C 4OX9L 2J0TD 2NPTA 1TY2A 2B3GA 4RGMA 4LF9L 3HOWH 2K1FA 4BY7G 2L55A 3PGZA 1XD3B 1DZ1A 1UF0A 4PV1C 2JQOA 3U50C 4X57B 4FNFA 1V81A 5HKHA 4AH6A 2PW7A 4KV2A 1TWGH 2KFKA 3ECIA 2XGTA 3MA2B 4LFBQ 2FCQA 2PVGC 5M3FH 1R4MI 3H8HA 2AHOB 2VQEL 5M5WB 4DWFA 4EX5A 4LF9Q 1RTNA 1PH7A 4FADA 4RM8A 1SYEA 3QOJA 4II3B 2RKSA 3HM6X 3E56A 4ICUA 3TSSA 3VUWA 3JVZX 5JVG3 1ZKHA 5ELCA 1HFGA 3QR8A 4DR3Q 3PZ8A 5EKKA 4OVUA 1WRDB 4QGUA 4GLXA 3AFQA 3AU4A 4ZKCB 5LXHA 4K2KA 2MHJA 3AE4B 3OJ4B 3EA6A 4LF6L 1VRAB 4M01A 2IY1B 4X65Q 3AN1A 2LD9A 5MPOA 4PS7A 4N8FA 4QUCA 5CGKA 1C77A 2G9HD 4IPDA 3KYDD 1CZWA 2FAZA 4MTKA 1ILQA 2WAQB 4CGYB 2PPBC 3U2SC 1T0QC 3AQQA 4XT1B 4W9DA 4KKJA 1D5MC 1MIUA 3GD7A 4YCWA 1F2LA 5LMUQ 4NXMQ 2PNHA 3QK0A 3HKZG 5J1ZA 3A8KE 3VDYA 2IGHA 2MJEA 3Q3MC 1LTTD 3IKJA 4A93G 2VZAA 1SR3A 2K39A 4BBNF 5L95C 2E74C 3H7SA 3L54A 1ASZA 2MUYA 2KTFA 3WWVA 4ICVA 1VS0A 1B44D 1VQLA 4DHJB 1E10A 2GBNA 2ZXPA 1WR1A 2NZHA 1DCZA 4TKNA 2WXOA 5KNCA 4DR2Q 1O7IA 1IBMQ 3R2IA 4IUQA 4O1NA 1MFWA 5IP4D 1MHWC 1TQOA 1VQNA 4DV5Q 3KFUA 2J0MA 1YIWA 1ET9A 5IOCA 4IOIE 1WTRA 2HCIA 5C3EG 2JA5B 3T53B 1M4VA 3A33B 2F3IA 2JA5H 1GO3E 3N32A 4G0NB 4R3DA 1X3QA 4REZA 3MEFA 4A75A 3AYHB 4IQZA 4A6QA 5E1FA 2L83A 4GKKQ 3VR8B 1Q3LA 3FDTA 4H2AA 4ZCKA 2K6AA 2FUG1 1GOZA 2HD5B 1E8YA 2CHWA 1NBWA 3OTOQ 1YJ1A 2YLMA 2BBCA 4DR4L 3UDXA 4EUTA 1V86A 3MTNB 3MXPA 1D2BA 1CFMA 2LXCA 2N55A 2VH2A 3GZNB 2DHZA 1R4NB 3FVQA 2X69A 2MNAA 2CHXA 3SK4A 1E1TA 2KC2A 3DBRI 3JAMi 3CCEA 4A3JB 3HHMA 1BF4A 1PQSA 1O78A 4FBJB 2LGDA 1SEBD 1IBXB 5EJWA 1Q10A 4A3EG 4MHEA 4A3FB 2EKEC 3RNBC 3PSEB 2JXMB 4RHSA 1UD7A 2YEPB 2F0GA 1NVID 4E71A 4WWOA 2ZXRA 4YSZB 3R3MA 3GE3C 3F2DA 5IWAQ 5HI1A 2DX5B 4BBSB 3LWEA 3M3JA 2EMTA 2QCPX 1G8ZD 1FFUA 4ANWA 2AYOB 4AUQC 2F4IA 1T9HA 1F0ZA 1RF2D 3DUZA 5JHBA 3RT3B 3LWUA 1VMPA 3GS2A 3U30A 4P6VF 5IYCH 3QWZB 5EKLA 2DUDA 3TP6A 2KKCA 2GN5A 2LZ6A 1A3VA 1BBWA 4OWWB 4YSYB 3P4PB 4ME5A 4N9F4 3J81L 3K58A 2BH2A 1UBIA 2D3CA 4HXDA 2FE8A 4EZLA 4A3JH 3K9PB 4PMWA 2WHIA 1CZPA 4XT3B 1I4XA 1W6KA 3SHLA 1IXRA 1PRTD 4A3JG 4IKGA 3E9HA 4IURA 1YX5B 4KN4C 5D2MB 5IP7G 3I4LA 1N32Q 3P4SB 5E6NA 1VQKA 2BH8A 4YWKA 1PV4A 2HJ8A 3AV8A 2D3AA 2ACZB 2Z1CA 2I1KA 1JJCB 4KHVA 1PLFA 2LRUA 1L0WA 4OZCA 2BOSA 1WTOA 2WINB 1IW7D 3F2CA 3WANA 1MKHA 3T1HQ 3HEJA 1I94L 2FINB 2JE6I 5FLMH 1ESFA 2KVZA 2I1JA 3UE0A 3M7NA 4X3UA 3HG9A 4K5WA 2KQ4X 4PZ8A 4TSSA 1SGHA 4F1SA 3NBHA 4BY1H 1JE5A 1XXGA 2BTEA 2Q2HA 3M63B 2NVTH 3RNCC 4FULA 2HUGA 2AL3A 2H1EA 2EYPA 5KYLA 2KNBA 3H3VC 1DM0B 3WAPA 1KQSA 2R92B 3T1HL 1EWCA 5EPJA 1S40A 2MCNB 4LNQA 4ZUIA 1DOKA 5KEEA 3DBHB 3IXSA 4QJFA 2V4DA 3IFWB 1TY0A 1U4MA 2IL8A 2NVXH 2KDEB 1FR3A 4JE3B 1VQHA 3NZSA 2M0AA 2MPMA 2DZKA 3LYYA 1YNJD 3TJPA 3DCGA 5IA7A 3EFCA 3IFDA 4DUZL 4R4QA 1ZXIA 3K9OB 3PF5A 1V1PA 4K7WA 5FR6A 1XMOQ 2N88A 3NOBA 4K6LA 1PVOA 3NENA 1UBQA 2AWNA 2W54A 3SVMA 2EYLA 1VQOA 3BDOA 2KEDA 4I7ZC 3VFKA 2Z4IA 3M4OH 2KCNA 1STNA 4HJAA 5FOBB 2XSCA 1X56A 3EROA 3DBLI 2EOTA 1IYVA 1ZDXA 1VQ8A 4AJWA 2O5IC 2HTHA 4P1BC 1EZ8A 1YNTE 2V1YA 3AE8B 2R93G 1PH3A 4RCOA 2JN4A 4B08A 5AJ3Q 5CV6A 1BVSA 2DN8A 4XQJA 1BT0A 1YQBA 1N32L 3EGRA 3MXGA 2E2IH 2L15A 1TWHH 4OVVA 1IBML 4Q2JA 3FPUB 1K8GA 4JX1C 4ZYSA 1HQMC 2EPBA 2YVCA 3ZDMC 1B3AA 3CRLC 1SMYC 3PO3G 1RHPA 1QOBA 4LNIA 2K50A 5CV8A 4CO7A 3KUCB 1LTSD 1Q1BA 5M3MG 4USAA 1YEZA 5FKAC 1JWBD 1QOGA 5BMHA 3S24A 4MGKE 4ACFA 4WURA 3KF6B 2F4VL 4KZ0A 2D2QA 3ZKJC 4WWPA 1UWVA 1OXUA 1HZ9A 3S2AA 4DV3L 5C6AA 3K0YA 2JZZA 1L2NA 2ZT9C 2I38A 4JG2A 1V1QA 5KRUA 1BCPC 2WDTB 3FPPA 5T1GA 5IYDG 3NUCA 3H15A 1JORA 1OXVA 5FLMG 1PGXA 3RMKC 1X3EA 2KX0A 2B2YA 5BN3A 1XNQL 4JI8Q 4CJ2C 3MFYA 4LUVA 2HJ1A 3PHXB 2SOBA 1KAWA 1QT9A 1CHPD 2AQ3B 1P98A 1ZP0B 2IBIB 2L76A 4LFAQ 1AZPA 2G4SA 4KGRA 1BUVT 2BPSA 3I5JC 4LLGM 3CKIB 5E7NA 1FD6A 2E2JB 4A3MH 3S2HH 2F0MA 3Q2AC 5IWAL 2RBMA 1NMGA 4YXDB 3BINA 3DWQA 3K80C 4QAYA 2A68D 1EQRA 3RNAC 2DLBA 2LS01 4NP5A 1VQCA 2B8GA 2VY3A 1W6JA 2MFIA 4RFBA 5KYIA 4DR7L 2REXA 1PRTF 1YNJC 3GTQH 3PMFA 3HVZA 4US9A 4IPHA 3Q3JA 3DEOA 3QJYA 5IE8A 4WFN3 1SDFA 4TKOB 4QB4A 2Z8LA 3T4AC 2ATWA 1HNWL 4EEWA 1XO3A 4B3ML 2AWOA 2NVYH 3S2DB 3AE5B 1D3ZA 3NS1A 5C44B 1XPOA 1IYFA 1K51A 2RDFA 2OTLA 3NG0A 4GOPC 3IT4B 1PMRA 4JCVE 2YTVA 2N7EA 2MQJA 5C4XB 1Y14B 1ZKOA 4DF7A 1QVFA 4JI1L 4DV7Q 1G6ZA 1TJEA 2MSED 3NBHB 1E0BA 3D6WA 4LWCA 1HNXL 3R7QA 4JGHB 3A7AB 4NJCA 1J0GA 3HZXA 1S72A 2A5UA 2F0UA 3DEPA 1S5DD 2KAJA 4C3HB 5JZEB 2CQAA 1HNWQ 3NBIA 3NELA 3VR5A 3K5OA 5IGCA 2K75A 2Q5WD 1K8RB 5LLIA 1YITA 1WFQA 1QQRA 4KN7C 5EPLA 3TCAA 1PFNA 2MJ3A 1V1PB 4A93H 1DONA 4JI1Q 1EF5A 5H1SE 4DV6L 3TS0A 4JBKA 1J7BA 3M4YA 1B2TA 5CBEE 3HOXB 1XTCD 2GBRA 3CHBD 1Y8NB 2A73B 2JJQA 1MHHE 4HCPB 4HK2A 3W5VB 3ERQA 1U0LA 2EXDA 3GE8C 3M95A 3TEXA 1D1IA 2INNE 2KT7A 4BBNC 1EWHA 2HDLA 4XIGS 3J9CA 2UUCL 3OG5A 4ZYNA 2R7ZB 1T0YA 5EBCA 2XTIA 4JI2L 1GJZA 3SK5A 4C3HG 5FLXL 1PFDA 5ISRA 2LFNA 2MO1A 3FP9A 4JW0A 2K6QA 4G11A 3KF8B 4DK0A 1XLPA 4KLKA 5C3EH 1HR0Q 1EFID 2OXPA 4LAAA 5M5YH 5IYBH 1YD8U 1X3FA 2FIDA 1ZDVA 2QA4A 3GTGH 4GSWA 4GNXB 1Y56A 3X3MA 1LTBD 4I65A 2WXKA 1FNWA 3VYSA 1XMOL 1Y1VH 3E9SA 3NS8A 4A3IG 2D62A 1JC7A 4WRDA 4LFBL 1NDDA 2CQOA 3ONAB 2K52A 2WDVB 4HPLB 4DV2Q 2G5DA 5FR3A 4BBRG 2MX2A 3HVDA 4ODGA 3Q3NC 3GO5A 1WRIA 2MBQA 4LF5Q 3KBGA 3PGEA 4K1RB 1NNXA 2KBNA 3NHHA 5FO8B 4DR3L 1HR0L 5LL6S 4JI7L 1YI2A 2M56B 3AE6B 1AZQA 4IPCA 4A20A 3BYYB 4OHJA 2BF8B 4W9KA 1MPEA 2X38A 4MACA 2H88B 1X54A 3OWEB 3JAMc 2LKVA 2RSNA 3KYHC 4C3IB 5HURA 4KHZA 1SE3A 3TQYA 2RPQA 1H9MA 1T0RC 3AEDB 5COYA 1RFAA 2UUAQ 4XE0A 3WIMA 1ILPA 4JPSA 2RHSB 3C1EA 3CAMA 2GOWA 2TMPA 4GLVB 4IOAA 3TRZA 1I5FA 2N1WA 3VR9B 2W3RA 4DV6Q 1WCMH 3B08A 4TQ1A 1YN4A 1RIPA 1VQ4A 2R93H 4QUFA 3ABVB 4FJZA 4DK3C 4JBMA 1WZ3A 1WM3A 4FLHA 5BO4B 3U9OA 1KF6B 2YEPF 4ZHOA 1OFFA 2X6GA 1OEYA 4DR5Q 1E7UA 3BU2A 4N9PA 3BS1A 1D5XC 5JAVA 2PE9A 5EE1A 3DMUA 1O7ZA 1E2WA 3BG3A 4IUVA 1F2MA 3Q6SA 2LUEA 3DPDA 5I9PA 5CHVC 4RCNA 4JWUC 4YTPB 1L1OA 3NTIA 1QWYA 4UP7A 3I57A 4DAMA 3NHEB 1JWAD 1WTPA 2IY5B 3GOEA 2WXQA 5D7GA 5HY6A 2Y0SE 1GNUA 2K04A 1EQQA 2WB1E 1JWUD 1WMHB 1R9TB 2VXWA 2HQLA 3IAYA 5D65A 2IX1A 1P9DU 2V0GA 3TUOA 4BY1B 4YTNB 3ETRA 3TZDA 4GDLB 1H9KA 4W9IA 4DR4Q 5GADC 4W9FA 1H8CA 3PO3H 1ENFA 2N8NA 1X32A 1NI3A 3Q8CA 2Z6KA 1OTCA 1WYGA 3A8IE 1SRUA 1LFDA 2KHSA 2E3TA 3QWNA 4C2MB 2ON8A 3C0RB 1HTQA 2WU5B 3NZUA 2DENB 4L5TA 2KK8A 4WJNA 4XDXA 4FYDA 4H13C 1PYWD 1E9MA 2F0TA 2KENA 3L2PA 2JA8H 3I8ZA 5IGEA 1JJGA 2K3UA 3Q8FA 3W1SC 3KOJA 2BVCA 4GDKA 1E1OA 1VDZA 3CMAA 2JA8G 4HLEA 1UE5A 2F03A 2I5LX 2KDMA 1SNOA 5FO7B 4FVMA 2WACA 5EAYA 2XK5B 5CV9A 3RULA 2WXMA 1FXIA 2MBEA 1XPUA 1KH0A 3GB1A 1KL9A 1PTOH 1SMXA 5HHDG 5IO9A 1LT4D 2MP1A 1NYRA 3UIOB 4YHHQ 2M9VA 1E2ZA 3I73A 4LMQD 1A8VA 2JSOA 4YWMA 1EY9A 1T5XD 3NTKA 2Q2IA 3X3NA 2WDQB 1TWGB 3I72A 2E2HB 3DM1A 2OCEA 1HJPA 1PZID 2G1EA 4B3SQ 3HP3A 2XRSD 2D5GA 2XEWA 4JL9A 3DWMA 1K83B 1QUQA 1FFVA 3I4NH 1YQ4B 5CV5A 3UIPB 1S3SG 3B9JA 1D7QA 3RZDB 4HR7B 4A3KH 2B2YC 4K2LA 1NENB 2LJ5A 2AQ2B 4WJOA 4BKTA 4NAWA 2LGIA 5BYRA 5LXIB 2E75C 2BB5A 4LJPB 1F9SA 3BJUA 2N9EB 1C9FA 1H9JA 1D5ZC 1VZ6A 1GC6A 4HMIA 3TEHB 1Z47A 1WTXA 5IIFA 1WJ6A 3A9KB 3PO2G 1J9OA 4DAPA 1FXTB 2WXFA 1CKOA 4BVUC 2NR2A 1V49A 4TV3A 1HNZQ 2C9OA 1KDAA 2LUMA 4TUUA 2BWFA 3HRDD 5CV4A 2RGFA 3H94A 4WAAA 3HOZG 1UGMA 3RCZA 4EQPA 1BCPB 2KDFB 4FA6A 2WFWA 3JW0X 4DDID 1EWIA 4K7SA 4Z9CB 3TIXA 2M19A 3UGBB 1ZW7A 1MJEA 4F7ZA 3AXCA 4YL8A 3SGIA 2F52A 1G91A 4IALA 4DR1Q 4JYAL 1B3QA 5DEHA 2KTRB 2PCFB 3SK6A 1KFYB 2JA8B 1FO4A 3RNGC 1O7LA 2CJOA 2JA7G 3W5UB 1WM2A 1L6UA 2N7JA 3S1MB 4LJOB 1CM9A 3PZDA 4TQUS 1KLUD 2GBKA 1ICWA 4KD4A 3HOWB 4B3MQ 3T3OA 1BXTA 3BZDB 2I07B 1WE7A 1ZPSA 3DDCB 4L8JA 1I3QB 3TN2A 3TZUA 4UY8C 5JJIA 1LTLA 3NTHA 1TIID 1WGDA 2D3BA 4X64L 1M94A 1UEAB 3CP0A 1EY5A 3OAWA 4CDCC 1VQIA 3T1YQ 1G6PA 3NWSA 1ZE3D 2ZJRA 4NDXA 5J22A 4XQNA 2K6DB 4BKSA 4G7HC 2H4OA 3DWPA 5FLXc 2LHDA 4RH6A 4CYEA 1Z5SB 2Q2UA 3FILA 2EXZA 3D8GA 4HCSA 3TBIB 2A8VA 4GKJQ 2EYOA 1C4PA 5CV7A 4HCEA 1EU4A 1PTOD 1JCKB 2E2JH 4W9JA 1JALA 2CFMA 1P16A 1H9SB 4GZYC 1L2FA 3IAM1 3BK2A 1VLBA 4L6TB 5C4XG 4AP4C 1DOXA 1SIFA 1PRTB 3HOUB 1FPYA 3PO3B 5IOIA 4J1MA 3ENEA 2C35B 5ELBA 1N33L 3ZRCA 1EY4A 4BBSG 1WF9A 3S1NB 4NXNL 1NJIC 3IAS1 5E6PA 3CCSA 4BAXA 2F3WA 2VB2X 1CMXB 4DV3Q 5D94A 4FXCA 1ZOYB 4K0KQ 3AE7B 4M8NA 1JB7A 4R8NA 2KCCA 1RAXA 4MH8A 1GUNA 3KUZA 1J6QA 2RA4A 3C8YA 3CIRB 2K33A 1LTGD 2G9DA 2PMZE 2DYBA 3PRPB 4L5SA 3OMCA 4R4IA 3E5SA 1E24A 3ZDTA 2PI2A 1YNND 4OZBA 1X3PA 3AEVA 2OQKA 1NR2A 1PFMA 2JEBI 1X55A 2CKZB 2WIIB 1OQYA 2PZWA 4JI0L 3W1YA 5BYQA 3A55A 2KA7A 1WVLA 3IT6B 1BKBA 2K32A 2R61A 3PCOB 1TS3A 2E5LL 2EKIA 3QARA 1U4PA 1TBEA 3VQIA 1KD1C 2YTYA 4JI6Q 1TWCH 4HKQA 4XYQA 2K01A 3I4MH 3M62B 1EZ6A 4PS3A 4BY7H 3KW5B 3RR5A 4QL5A 3PTFC 1GXDC 1L4DB 3UDIA 1MJDA 4ASWC 4KY6A 4MSQB 3N6RA 5I2YA 2VZKB 4B0EA 3FKIB 4B3RL 2BA0A 3C3LA 4IFDH 3NVZA 2I5MX 2K5QA 1BR9A 2ZNVB 3OW2A 1KOTA 2VZKD 1C4AA 4UAIA 4R1JA 5G3LD 1K0SA 4MGIE 1HTPA 2DYOA 1NSNS 3HK0A 4DA2A 4I6NB 3SEBA 5M5YB 2WB1B 3AMUA 4KSKC 2MHVA 2K5WA 4JBWA 5M3FB 3MC8A 5IYBG 3DVGY 3V6EB 3L0WB 3KWLA 4P73A 5ELDA 2WQYB 2RHQB 2HHHQ 1QOFA 1PDXA 4N58A 3VR3A 1KM7A 4WIPA 5J18A 4QIWE 4RHRA 5JPNC 3NPPA 3PF4A 1Z2MA 3IG3A 3L10B 5AZFA 1HA5A 1JOOA 1LT3D 1QOHA 3DWAA 1EUJA 4A90A 1K3BC 1B9RA 4GLSC 1L0YB 1WYDA 2KX3A 2ZW0A 4J3OD 4FF4A 3U58A 3C2PA 3EFXD 4OXPA 1EOVA 1QUQB 4UP8A 1SE9A 4LNOA 1ML0D 1E22A 1A6XA 3U4VA 3I4MG 1SYGA 1WGGA 1JICA 2WX1A 2GLSA 3HOWG 1LT6D 2DJFC 3D4DA 3VDZA 3KVFB 4MTNA 4DV5L 3AFPA 4ZLTF 5FLXE 2B39A 3GV3A 1SFOB 1JT8A 1L6VA 2N7DA 3V60A 2K03A 3Q8DA 4LNNA 3VAWA 4DR2L 3H91A 3EN2A 5LMNW 1WTWA 1BBXC 1K8OA 2INCC 4LJZC 3NUHB 2KMCA 1LO5D 3CCMA 4IUTA 3PS6A 1KXLA 1D1KA 3BK1A 1IBXA 1L5PA 1LXDA 4IM2A 3X0WA 1E0ZA 1YHAA 3CF6E 4AQ7A 1STAA 2ONQA 2MH7A 3A8JE 3CWIA 1KDCA 1H9RA 3VYUA 1TGZB 1BQQT 1QG7A 4DR6L 2IZVB 4M0WA 4A3EH 3NVVA 2TSSA 1VQJA 2ASBA 3CC2A 4FJYA 4MT5A 1WWTA 4ZAIA 1E7VA 2JZPA 2JU6X 4RMAA 3HOUG 4IUUA 4DR7Q 3PUVA 2F0OA 2YV5A 2KQ7A 2C5LC 2AQ1B 2AUJD 3Q23A 1VQGA 4HDOA 2ZNVC 1TZOA 4A3CH 1WOCA 5C44G 4DR6Q 2B2WA 3WDNA 1WTVA 1GC7A 2HHHL 2VQEQ 3CCQA 3S14B 3S1QH 3TDQA 1FEHA 3T8MA 3OLMD 2N9KA 2PIAA 1RYJA 4G57A 1GB4A 4M8MA 4ANUA 2K5PA 3P1MA 3SK8A 1V9PA 1PH2A 1B9NA 1BBUA 1RL2A 4JI5Q 4G7OC 3GDEA 4I6PA 1A2TA 2B2TA 2NYZD 1Q1OA 2DWQA 3AEBB 5IKCM 5JPMC 2RF4A 2VS1A 1E2VA 1SYDA 2WP8J 2A6HD 3V05A 3CCVA 4HIOA 2Z0DB 3FAHA 4RF0A 3F2BA 1N33Q 2CR5A 2A6HC 4TVAB 4Y52H 1PH9A 2WP9B 3FKIH 4ZK9B 3BY4B 3PQIA 4ZRPA 4RNAA 3TP5A 4WWNA 1XQQA 2B76B 3MC0B 3GTJB 1L4ZB 4B0MA 2VQFL 3PSIA 2PYKA 2KQ3A 3HOVG 4IW0A 2GRIA 3J80L 5C0XJ 2INPE 2CS4A 2QDFA 3VA5A 1WXMA 3NVYA 2XWBB 3KDFA 4B95A 5GROA 1G51A 1Y8OB 4D2KA 1UWXA 3PUZA 2F0QA 3D31A 5GAGC 2WU2B 1P0RA 2EELA 1AE3A 1SYFA 2FCSA 5L83A 4US8A 4N8X1 4AQYL 1RD9D 3K8AA 1I35A 2F4VQ 3ZNZB 1XCTL 2KACA 1STGA 2L0CA 1RJTA 2PZTA 1UE7A 4B3TL 1FMAD 5DLQE 3F2UA 4HJKA 3OSOA 2B3AA 2BS3B 4K3CA 1KDBA 3KLWA 3URYA 4IJLA 1FGUA 3EHVA 1V8CA 2Z4HA 3W1SA 4EZJA 2D9UA 2EY5A 1KJTA 2V1CC 2H5XA 4JLCA 3ONSA 5C3XA 3HOVH 2UUBQ 3ZNID 4X62L 1LTRD 2Y0SG 3GV6A 3PIO3 1SF0A 4NAWB 4WJWA 4RGNA 1NMFA 3A1QA 4ABNA 2WAQG 4JI3Q 3CQZB 4UHVA 4A55A 3GTPH 1HRJA 4FF3A 2L7RA 4IC7B 1XX8A 2ALYB 4W9EA 1OO9B 4P7IA 3ZLZA 4HEDA 2QDBA 3ZJYC 2SEBD 3S17H 2RVLA 2NVTB 1YX6B 3VH3B 1QNUA 2PO4A 3P4RB 4JI7Q 3R8BA 1OTRB 1WD1A 2BYTA 5TSSA 1CHQD 2UUAL 3Q8EA 2QJLA 1TWAH 1YHBA 4DUZQ 2YTXA 1CTMA 2CKHB 4X66L 1Q82C 4ILWA 1ROEA 2BW2A 3WAOA 4PYUA 2LHEA 4C1NK 3PZ7A 5AJ3L 2YU9H 1AE2A 3EJIA 1TT5B 3A9JA 2BWES 2DZIA 2Y5PA 1STHA 4MM3A 2Q8RE 2PQAB 5DM63 1VQMA 2NZOA 3FMCA 3I90A 1N9WA 1WCMB 4LF4L 1JQ4A 2Q8TA 3QA8A 1EY8A 1BUIC 2L8JA 5C23A 5JJKA 3S14H 4WQMA 3SD5A 5C3JB 1WGYA 2NVUI 4YIJA 1KABA 4C00A 2EDGA 1QVCA 2EJFC 4AYBB 1WGKA 3L17A 4DR5L 2EYFA 3M4QA 4MH0E 4M1UB 2I0QA 4UDUC 4K14A 4ZQ3A 3GTKH 3RZOB 2KJ6A 3RPFC 3ZQ4A 2KOXA 1UAPA 2SNSA 3J80E 1V43A 4HSVA 5K36H 4GDLA 2VUMG 2L0FA 1VQ5A 2RMMA 4ZRKA 1G2TA 3LGJA 4HN7A 4PNYA 4XTCS 2ZPYA 5G55A 3BVZA 3G6JB 2LI5A 2JA7B 3CCLA 4HJ9A 1TKWB 2C5CA 3I4NB 2JA6B 3IHPC 1PTOF 2PE6B 4BKSD 1V1OA 5F2DA 4HSPA 2K22A 1IZ6A 2CH4W 2KCTA 2OHFA 2K4KA 2A19A 1XPRA 4W9HA 3D32A 2MA9B 1R4QB 1VQAA 5J39A 1MBYA 1PTOB 4YWLA 1MHXA 2JT4B 4A3IB 3QCAA 5LNK1 1UELA 2WKCA 1HTOA 5DNFA 5T8IA 1G291 2KOLA 1A62A 1ASYA 5EE0A 4HIKA 4LF5L 1VQBA 3KLSA 3HOXG 4OL7A 3M3YB 1YOVB 4HJGE 2SAKA 1E3PA 4ZRJA 4OIJA 2YYZA 4X64Q 1E7PB 3OTOL 3K5MA 4DV2L 4C56C 2BA1A 2WV6D 3STBD 1P1AA 1CA5A 2GBJA 3P63A 1NI2A 4JOIA 4P72A 1HA6A 3N20C 1DGJA 4AJYB 1T6BX 3PLUA 3P2BA 3PLVA 5FJ8G 2KMMA 4OEMB 1WJNA 1UUPA 2H89B 2X6LA 1YJWA 2PI2E 3NP8A 4DNIA 2QSDA 2QGQA 4XYOA 2BKFA 3GTLH 3KF8A 2BE5D 3A1QB 3SFDB 5H92C 4WAFA 5D14A 4CBVA 1VCIA 1X65A 1Q1EA 2E2IB 1V80A 2F0WA 4EE2A 4LF6Q 3Q0AA 2BS2B 2B63G 1CT1D 1MG4A 1RCVD 1KRHA 5NUCA 1DOMA 4DU9A 1IBLL 4JV5Q 3OMGA 3S17B 3E0EA 2MBBB 3EFUA 2RSUA 4C3JH 4GS3A 2NVYB 2Z0SA 3S2DH 1CZGA 4AQYQ 1QKZA 1XF5L 3Q14C 5C4JH 3KK7A 2MO0A 3D3RA 5IAAC 2SDFA 1PZKD 3K7UC 3H0GH 3I3CA 1IP9A 2NUCA 1IYUA 5EBDA 4GNXA 5M9OA 2JQRB 2UU7A 4GB9A 4I6LB 2D07B 1NEKB 4PK1A 5A2QE 2XVSA 4GIVA 5IGBA 1GAQB 1C4QA 2HTME 4MGZE 4XXEA 2KANA 2IGDA 4KIKB 4ZOHC 1JW9D 1W3SA 3PRMB 3PT2B 4AWJA 4X6AH 2QKIC 2DNFA 2MP2A 2WS3B 2KDBA 2CU1A 2FCMA 1SMYD 4JI4Q 1X1MA 3HOZB 1Q46A 1WJ4A 2BB6A 3BDLA 4E6IA 5JH5C 4O0AA 2KVMA 2JVCA 4MM3B 5J17A 2L9HA 2WKDA 3OIPA 3CC7A 2PMVA 3TBLD 4PMBA 5EQ0A 3R93A 1VJKA 3Q6BA 1J5EL 3ZJTA 4DNRB 1ESRA 3U9SA 1KTKA 3RYTA 1AN8A 1S5ED 1BCPF 3L0OA 3UI2A 1IUEA 4IM0A 4BBSH 1IBKL 4C4VA 2R6GA 3UDFA 1V2YA 1SNPA 4DR1L 4JYAQ 4OX9Q 1XCQL 2R2QA 2HD3A 1Q90A 2IO1B 3B2FA 4JI4L 2K5DA 4B9WA 3CD6A 3IFTA 4AS1A 1GG3A 1PH6A 3GTOH 3UDGA 1F2RC 2WXGA 4A9AA 3G71A 3J81E 1P8LA 1ACCA 4LFAL 4M8AA 1MSHA 1SYCA 3ZUNA 2QIEB 3G6EA 1A15A 1K73C 3NY5A 3K59A 2JEAI 2I46A 4MN3A 1Q86C 1S5CD 2RDBC 4G7ZC 1MSGA 3U8ZA 2K1BA 1SE4A 1GJXA 3GQBA 3H3VH 2KVRA 2A6EC 4FO2A 2K7VA 1NYQA 1VQ7A 4BY7B 4L63B 4PMCA 3DLLA 1YN5A 2AUKA 2XNAC 5C5MA 4MJSA 3ZGZA 4M0WB 2RDHA 3CSFA 1AYFA 2KHIA 3SR1A 1JR0D 2KD0A 3DWGC 2LXKA 2VQFQ 1P7EA 3W5OA 2PLPA 4GOCA 4GKJL 1JE4A 4YCVA 3T51B 1WX7A 3CMMB 4MZ9A 2HDEA 1XTDA 3S16H 1WGHA 1ENAA 2UXDQ 1RFKA 3N3KB 1D6EC 1WYWB 2M00A 1WMHA 2KLGA 1LM8B 1EEFD 4KZCA 1YVCA 2F0VA 2PQAA 2DY8A 2M4NA 3WOFA 2D5DA 2JY6A 2LGYA 2EVBA 1QZHA 3VR4A 1ENCA 1HNXQ 3C46A 4RA8A 2KWDA 1PTOC 2W3SA 2KWVB 4LDTB 1IL2A 3H6NA 3RZFA 4NMZA 3V96A 4FP5D 4GKKL 4DHZE 1IKLA 3TL5A 1C8CA 1R4NI 2N9LA 2KLCA 2B2VC 3AE9B 4EQOA 1AEXA 5IYDH 2O6VA 1L1OB 4YSXB 2AWTA 4QF4A 4DV4Q 1STYA 1N34L 1F1HA 2KWUB 3Q69A 1YHQA 4XC2A 1K8AC 4A3PA 4A3GH 4HAEA 4YCUA 1NAPA 3ML8A 2K8CA 3APCA 2F0SA 1EYGA 1JRUA 1UNSA 1TT2A 5IP9H 1GD7A 5GAEC 4MIUA 3HUIA 1ISNA 5GXGB 2NWGA 3H0GG 1YJ9A 1C0AA 1B53A 5AZHA 1VMCA 3PIP3 4G3XB 5M3MH 1ZXHA 2HIXA 1Y69U 3S1MH 2J0JA 4DV4L 1N34Q 1F9RA 4C3JG 3CQZH 4IWQA 5HFYA 2EYJA 3CXCA 4R8IA 3GTQB 2QDLA 1WIAA 1M90C 1STBA 3ULPA 3CCUA 1TWFB 1JMCA 1EIHA 3AM9A 4ME3A 1BCPD 5D3IB 5CMDA 3M3YH 3N1YC 2CJNA 3AU5A 1R4PB 3L16A 4NY0A 3B2GA 1C7YA 4ARCA 3NK9A 3W2DA 4JBJA 2F0FA 1A63A 4ZDVA 1SE2A 1GHJA 1XMQQ 2KJRA 3RD2A 1UE6A 2RCNA 4PQXA 3C1FA 1HEZE 2XK5A 3DHHC 3ZIMA 4H44C 1C79A 1DYQA 1CKNA 1WXQA 2V3PA 2OTJA 2FMCA 3K81C 4RF1A 2L0TA 2HQEA 2O2LD 1R7SA 2O2VA 4A3BH 2WXPA 2OT2A 3CPWA 1FL0A 4PZ7A 4S0RA 1TIFA 2GBMA 1BMLC 1KRSA 4G50A 1JWMD 3VR6A 3DM3A 4GN1A 3PPAA 1SE8A 2J42A 2N9PC 4CKEA 1HE8A 1SIJA 1ZXTA 4C4VB 2HE7A 1XLNA 1I50H 2MBOA 3MHBA 1IPGA 1N61A 1LLRD 3NEMA 3H09A 4DXAB 1VZ8A 4A3FG 4II2B 2CU3A 1Z7TA 1DD2A 1SLJA 3EVQA 3LX0A 3OWFA 2RSOA 3BVGA 2BE5C 2LY7A 4YWGG 1N36Q 1N63A 3CF5A 3ZNGC 4RGTA 3WOEA 5J3BA 5KHOA 4K0KL 1I4HA 3VYRA 1RRBA 3J7AV 2ZM6L 4FDBA 3A54A 2VRRB 2L4NA 4WORA 1GUWA 1ET6A 1HNZL 3S9WA 1WJJA 5JJLA 3UINB 2MQHA 4NW2A 2QMTA 2UUBL 4U673 3HOUH 3HRZC 1RWSA 3A4SC 2DGYA 3TP8A 4GXBA 3BDCA 5DCNA 1QNKA 2EYHA 3H7PB 4QMGA 1ZYRD 2EJMA 4L5QA 5T1IA 1WE6A 3RN9C 2FNJB 1VQFA 1WJUA 2WLBA 3RUIB 1PFSA 4ITKA 2A1AA 4P74A 1Y1WG 4JI6L 1FM0D 2LWPA 4LK0M 4N6EB 2HDMA 1IYJB 4HJ7A 3M4PA 1Y8PB 1GVPA 1V8QA 2A6ED 3KJOA 2BYFA 2Z0EB 1BDOA 2EYMA 2IPKD 1WCMG 4XWWA 3I9V1 1HH2P 4ID6A 2R7ZH 1VDVA 4LNFA 1PUTA 2BQQA 4S17A 4PZ6A 4DN4M 1D8LA 2OJRA 3FILB 5M3FG 4A3KG 1PGAA 5CORA 5IP9G 1J7AA 2O6VD 2MGSA 2UXCQ 3H3VI 1OQRA 2AMCB 2UU9L 2JUOA 2MEKA 1XNRQ 1FXAA 1FNUA 2MW5A 2ZPNA 4HDQA 2WB1G 1XWEA 5I2XA 5CTRC 3SR6A 1E8ZA 3VTVA 2LXJA 2JRIB 4IUMB 4XZ4A 2KXJA 1S5BD 3F8TA 3EQLC 3UI3A 3M4OB 4ZRIA 2KJXA 4A93B 4HVBA 1WY8A 2ZCBA 3KUPA 3NSWA 4X66Q 2ICIA 3M7GA 1HFNA 3RI7C 3GTMB 1IBLQ 4JV5L 5C4ZA 3GTPB 2D3GA 2CW0D 1GUOA 1R4MB 2LASA 1I42A 3CCJA 1PHJA 1V5TA 1H9SA 3A5ZB 4F7XA 4L1BA 2L00B 3NQIA 1TS2A 2KZRA 2O4XA 2HCCA 1C48A 3S16B 1OXSC 5CC4A 1EY0A 1JROA 4A3LG 1U4AA 5AUIA 4ANVA 2W9NA 2A69C 2BYEA 1KHIA 1TS4A 4A3KB 3I4OA 3VHTC 1FIQA 1Y1VG 4A3CG 4LDTD 3AEGB 2JX5A 4O2DA 2CVRA 2JWUA 3VXWA 3E9IA 2PTLA 4LF7Q 3J7AF 2PZUA 3N9YC 5DPTA 1EF1A 2KEEA 1GUTA 5ELFA 2JA7H 3PO0A 4DDGD 1ONLA 5H8YE 1IW7C 1Y1VB 3Q8BA 1MVKA 4GLAC 4J6IA 1GHKA 4KJNA 5LHY1 2JXTA 4IM3A 4BFRA 2LJIA 1WI5A 3CPFA 1PYSB 4JK1C 3HS0C 2F0PA 1J5EQ 4CHTB 1DOIA 2ZEQA 4IO9A 4F88A 4BA1I 4OO1H 1V97A 1IBKQ 2OF1A 4FHJA 1CKNB 5C0XH 3Q22A 4KDIC 3DVNU 4I7AA 3K5NA 2E5LQ 2Y5BB 1B7YB 2LVPA 3GTJH 2LGSA 2Z59B 2VNUD 4BXXG 3ICEA 2EE1A 3ZXRA 3NVWA 4P16A 2NTSA 2UYZB 4KMUC 1HR0W 4JVZA 1H4RA 1MI2A 5M3MB 4K6DA 2M17A 4APVA 4CJ0B 4WH4A 1XLQA 2WXJA 1SNCA 1RLFA 4ZKBB 3RLOA 3PUYA 1F2ZA 2FMMA 2ENBA 3PREA 4OW0A 3GTOB 3A74A 5C2TB 3K6OA 4KGTA 5CHFA 1KIXA 1WXVA 3I56A 4GNXC 4JQWC 4V190 4DHJD 1HHVA 2EJGC 4NB3A 1PRTC 3SXHA 3N52A 4LUOA 1MGSA 4Y7NH 5C0XG 3LDZE 2E2DC 2B63H 2KWCA 2NMQA 4PS8A 4Q0FA 2DJGC 2C7HA 2KYWA 3QIJA 1C76A 3KBXA 2LGXA 1CKMA 1YZ6A 2F0EA 1PH5A 4WJ4A 1L0VB 3AMZA 2E8GA 1RM6C 2G3QB 4JI5L 3ZRFA 5J2RA 3U52E 1JJ2A 4BKGA 2CW0C 2D0OA 5C4HA 5KNDA 1PH1A 2J53A 2O2VB 1N5WA 4A76A 4KSLC 2K25A 1PDQA 5BMGA 5C0XI 2DNEA 3TEYA 3MVVA 1GB1A 1K3RA 4JIOU 5GMVA 1LT5D 4RKBA 3QQ8B 5E6OA 4R4OA 1N62A 1F52A 1E8WA 4EVOA 1WXAA 2G4DB 3Q3FA 1EUVB 1KC8C 2QF7A 5I6WA 5JXVA 4A3LH 2FBWB 1IHZA 4BBRB 3KLRA 1OGWA 2SNMA 4JOIC 1YJNA 1EOTA 3GP7A 1O7YA 1TXYA 4IUNA 1ZGUB 2I5HA 2QW7A 3ZTCA 2N9XA 2R92H 2B63B 3Q3OC 1LGRA 1ZUD2 4JC0A 2F0NA 3JSVA 4KY7A 2A68C 3MJ5A 3R7RA 4M02A 4DAYA 4A3GB 4IUPA 3U4ZA 4XDCA 1XEEA 2O5JC 4CHKA 3VH4B 1EU3A 3PUWA 3MHZA 4JPBW 1QZGA 2N3SA 3A56A 4IWPA 1Q8KA 3QX1A 1YIJA 4ANXA 3I4NG 3VRAB 1F9QA 1EIFA 2JYOA 2NN6G 3G7LA 3RN5A 1VR9A 2HIVA 4BOSC 5DPSA 3T16A 4K8IA 4CDDC 3J80i 5C3WA 3LNNA 1VZ7A 5EDSA 5LL6X 5IP7H 2B2UC 3TREA 1T0SC 2WDRB 3QHTA 5CR3A 4K3BA 5IN7A 3W1GA 3RLFA 4ZRZA 2PEAA 3KWVA 2PJHA 1LV9A 1I6HH 4QY7A 2WXNA 3CSTA 3U7DA 2F0HA 2Z9HA 1AW7A 4KJOA 1LTAD 4EFOA 4FXKC 1NUCA 5CBAE 2NN6I 4C80A 2EMSA 5E6JA 2K5NA 1FYCA 1NTGA 3HOZH 1HZAA 2JXXA 5BN4A 1IKMA 2KFKB 5IYCG 4GDKB 2EIFA 5AUKA 1CSPA 2ZJPA 2WNMA 1YNXA 1GPXA 1TKYA 4LFCL 4URKA 1IL8A 3AULA 3HOYB 3VYTA 3APDA 4KTAA 2CHZA 1SSOA 4WQOB 4KX6B 2XWJB 1EL0A 2XRQD 1CQVA 3H0GB 2KUMA 1LACA 3W1BA 2FXQA 5HGQA 3OHXC 1B4OA 4GU2A 2Z6KC 3Q8AA 1QZEA 1EYCA 2DAFA 3FKIG 3HM3A 1QCBD 4IFDG 4A3DH 1M8AA 2W82A 3NE5B 1PXUA 4B9KA 5EE3A 2GA4B 3PIOA 5BN5A 2R7DA 2EY1A 1B8AA 3PHWB 3P42A 2KHJA 3A4RA 4HJ5A 2VL6A 5IGFA 2OOBB 3KDFB 3DQVA 2K0PA 2DZJA 3MHSD 2BYVE 4DXFA 2IWHA 5C4JB 4B3SL 3V6CB 3OIQA 4X3TA 1S1QB 2EQSA 4F87A 5EE9A 4ZUJA 1FRDA 2IX0A 4DUYL 2NZ1D 4MEMA 5A35A 3K7AH 1JQYD 2ZTCA 3V3XA 3A0JA 1GKHA 4XDDA 1K8MA 3TMPB 3RNFC 3A9JB 1FJGQ 4POFA 1W2BA 4K81A 3G4SA 2L3ZA 4NPSA 1KRTA 2JP1A 3MFGA 2FIFA 3EECA 3RNEC 1MD2D 3HKZB 1P7FA 2ZVNA 2P5ZX 5M5XB 3I7FA 4QCLA 3N1XC 5TR5A 4PT5A 2CH4A 2BDOA 4Q5VA 1XLOA 3ULJA 3HOXH 1KLVA 4AIMA 4TRDA 2C60A 5KNBA 1SNMA 1KNAA 1IGCA 2ZW1A 5EPKA 5C4XH 3J81j 5KGUA 2UXCL 2ASQA 1JWSD 3L08A 1XNRL 1HQRD 3NZ3A 1E6EB 1BOSA 4N9TA 4F8CB 2B8FA 4MELA 4FF1A 3I55A 4OO1I 4FXGC 4JI3L 1QVGA 3EC8A 4BOZB 3TP7A 5EGTA 1DGSA 4IPGA 1TKEA 2WXIA 3JSVB 1O80A 1RODA 5JEAJ 2AEHA 4HCNB 3UQBA 2JA9A 5JEAG 1F77A 2DY7A 1TWCB 3ER0A 3PUXA 2PKOA 4BXXH 1DOYA 1S5FD 2IJ0A 5G5HA 4A3IH 5LMUL 1N8RC 2PW9A 1SJED 4LF8Q 2L05A 4KVGB 1HUMA 2IX3A 3J81i 4IN3A 3V2TA 1DJRD 1ZYRC 4IWOA 4A3OA 1A2UA 2D10A 4RWSC 4AYBE 4WJ3M 1SB3C 2IO2B 1Y1WH 1JB3A 4DKAC 4B9XA 2E2HH 5DAUA 3ZXVA 2Q8IB 2WXLA 2B2TC 2L11A 2PNRC 3M9BA 1I7HA 5LMNQ 1QE6A 1UEBA 5I6YA 2R2OA 3G48A 3RUZA 1C9OA 1FVIA 2NCNA 3HIZA 2FUHB 4GN3B 1I6VC 3AEFB 3K57A 4KHPQ 1LUZA 2ZTEA 1N36L 1I4QA 3HOYH 1QOAA 1PA6A 1DOLA 1D4BA 1AP0A 1EWYC 2Q2TA 2RPVA 1C78A 3MWYW 1PH8A 4A3MB 1PYBA 3S2HB 1P3QU 3KJPA 3B6YA 3K5LA 2EZVA 3ZVVA 2AKWB 1HTLD 5LMNL 1U4RA 3T3NA 5E3FA 3JAML 2A74C 5K5PA 1WX9A 2RR9A 3NRZA 4HJ8A 3U7ZA 3P7JA 3S15B 2NBVB 4EZKA 5BYSA 2LEKA 1XNQQ 3SU8X 4HROA 3AU7A 4A3FH 2EY6A 2J0KA 2B2WC 4ZRQA 4IJHA 2D0PA 1X6OA 4WJQA 4A4IA 2QEXA 1F9PA 1YBYA 1K50A 1WR6E 1ZEQX 2ZXOA 2ZZPB 3GTKB 1I4PA 4OELB 1TWAB 3PIPA 2IYDB 3MAQA 4HKZE 2F0KA 3DHGC 1FGBD 3CC4A 4QQBX 4LFCQ 1I6HB 1T3QA 2QCZA 2OEDA 5BMIA 3T56B 4YHHL 2WAQE 4OGQC 3R3OA 3R2TA 1BO0A 2LMCB 1EIYB 2K8HA 1UE1A 1QB5D 4X3KA 4NJ7A 4OWXB 3M85A 1CI3M 4H0LC 1CQFA 1MI0A 1JMLA 3FEWX 3D4RA 3MC9A 2DBYA 1Q7YC 2UWQA 1HZ6A 4A3EB 1TVXA 1XT9B 4BA2I 2M1MA 1JRPA 4DNTB 3AECB 5G5GA 1EYDA 1NBFC 1HXYD 3EBEA 2LVQA 1Z6HA 2OWOA 4GMVA 5JJZA 1YJJA 2V3SA 4BS9A 4DAVA 4HWIB 3X23A 1OXTA 2JA6G 1PFBA 3MZ5A 1RDPD 4EOYA 4P1CC 3U4EG 1U4LA 1H95A 4KIKA 3ZYYX 1EQVA 2MLBA 2ZVOA 3VRBB 2V4LA 3AB5A 2FFKB 4W9GA 3KLSX 5JOBA 1PZJD 5K36G 5G3LF 2UXDL 3K0XA 2ID0A 1F2RI 5ELNA 4FN2A 5IGDA 2FJ2A 4NNJB 2F0IA 2GB1A 2R93B 3DVGX 4LF4Q 1PH4A 3KUDB 1F9JA 1FJGL 1IGDA 2KTRA 1VD2A 3JYUA 3E0JA 3OOCA 4POGA 2RCFA 3S15H 2W55A 4BY1G 3KF6A 4CQNA 1CK1A 4XQQA 1U9RA 2E76C 3A7LA 4KY5A 5CHWA 3QG1A 1AH9A 1CUKA 2JA6H 1SJHD 4A3DG 2CHBD 2K9XA 4FHKA 3P4QB 2D11A 1EEID 4KKSA 3LB8C 3JAME 1G6JA 2ZM6Q 5ELEA 5A2QL 2LVOA 4DK1A 1HCZA 4EKUA 5FJ8H 2KN4A 3A9KA 2C7NB 4HRSA 1I4GA 2GMIC 5C3EB 2JA5G 2KC1A 1G2SA 1XJVA 3TEWA 3IL8A 1GM5A 5D3DA 3EUB2 2BS4B 4HIDA 1SXTA 1TWFH 4B3TQ 2IO3B 3RFZB 2G45B 3QB3A 5FK9C 5KHQA 1YJIA 5FO9B 3T1YL 1Y1WB 4FJVB 4F8MA 4GN4B 4DPGA 5AEKB 1RTOA 5BR8Q 1FNVA 2D2CC 3J80c 2J7QB 2L32A 4JI0Q 2A4ZA 5JHAA 2INDC 3BYTB 3ZW3A 4ARIA 1A70A 3L3OC 4V0BA 1GUSA 5AFWA 3J7YW 2JRHA 1LM0A 2DYMA 1UH6A 1WSPA 3ND9A 3AEEB 4PYZA 5CX3A 5L37A 1SYBA 4GOPB 1V9JA 2JYEA 2WXRA 2KJHB 2Y0SB 3J7A5 3I63C 5G2NA 3E3XA 2N1VA 3VUXA 2N78A 5E4XA 4OZAA 2NBFA 5BR8L 4X65L 2NBUA 2L5TA 1SSNA 4MDKE 4OWTB 3GTMH 1K52A 5GQOA 2IT1A 4A3GG 4DGZA 2K5VA 4NKLA 4CDFC 1Q0WB 1B1ZA 2VW9A 2HT1A 2LMCA 3PRZA 2QILA 5IY0A 1S3OA 4DHZB 1J7CA 2BT6A 3S1RH 4OIKA 2R92G 1A5RA 5C44H 1VF7A 3CMEA 1J8CA 4C1NI 5IT9c 1C1YB 4RKLA 3H6MA 4R4TA 4X3SA 3BZKA 4RG1A 1AFPA 2A5HA 3APFA 3AH7A 3E6ZX 1A3UA 2KN5A 3H1UA 3I3TB 2FCNA 3STBC 3HOVB 1FD7D 3VVWB 2CCZA 4C3HH 3K7AB 1EO6A 1MG8A 2NN6H 2ZTDA 1WXSA 2JYTA 3HGBA 2IHFA 3DHQA 3UF8A 3Q24A 3J7ZC 1M1KC 2OJWA 3AB9A 3QOLA 2B2VA 4A3DB 4HMJA 2O6VB 1WH3A 2IHEA 3OYYA 3ZTDA 5DPWA 3NWTA 2L52A 2UUCQ 4IFDJ 3V62A 3VTUA 3ZNHB 4JI2Q 4KD3A 2WYQA 5C1ZA 4OONA 4M00A 1E8XA 3SE0A 4J15A 4KKTA 4K5VA 1GUAB 4HEA1 4B3RQ 4BZAA 4J6HA 3MXNA 4Y7NB 4N59A 3PO2B 5ELOA 1VQDA 1Q5WB 2AX5A 4W9CA 2ES2A 1GUGA 4LCDE 1J19A 1MJCA 3RD4A 4BWGB 4IFDI 1WI0A 2NVQH 4DV1Q 2QEJC 2M8SA 1HZCA 3MXUA 4HIMA 1HZ5A 4R9WA 4XX5A 2NS5A 1K83H 3DBRB 1STEA 4DK5A 2XBBC 4XGAB 1YMHE 1V6EA 3IVFA 1C4CA 3S1QB 2GVAA 3QO2A 2UU9Q 4NZLB 3L7ZC 1NCVA 3FRPB 1QJOA 1XMQL 1LABA 3SDLC 3O13A 3AI5A 1A0IA 4E3CA 4UPAA 2BCOA 3C19A 3IBEA 3BVMA 1RKNA 2KDIA 3I2ZA 1VQ6A 1Y8RC 3SDZA 4MSMB 2FHTA 4DV1L 2WX0A 3FC4A 4A8XC 4OVZA 2LRWA 4B6WA 4EGVA 4P71A 3RZOH 4L23A 2IO0B 4RM9A 3D4WA 4KV6A 4DXGA 3AEAB 5D6JB 3VTWA 4AOFA 3LJ3A 3TS2A 1T5EA 2JPHA 3PO2H 2J4XA 3H7PA 1UWMA 3KYCD 1EQTA 2F3VA 4NXNQ 3DBHI 3EIVA 2BGFA 2IY0B 4U68A 2V9HA 3W3AA 1LYLA 1CSQA 2RQXA 5C5LA 1WGRA 2KQSA 3ZJVA 3CCRA 3V61A 4ALPA 1TU2B 4PG3A 3J81c 1QILA 3D0FA 2OQ0A 2XIWA 2E6XA 4NXML 4H02A 2MJDA 3NJTA 4TMAB 3MTSA 1SNDA 4G4KA 4GN5A 2KMAA 3B0AA 1SN8A 1VQ9A 3WA0A 1TTNA 2YU9B 4DUYQ 1JOKA 4C7YA 3QIAA 5AZGA 5GAHC 1QLBB 2MBHA 1N5XA 4H7BA 1TZ1A 3ZJUA 4JWSC 3L9AX 5KIXA 4DQOC 3TMEA 4WJPA 1A3TA 3S1NH 2NPTB 2ZJQA 1TWHB 2L12A 3ULLA 3NXWA 4OO1G 1Q12A 1OEYJ 4NPNA 1VF5C 2N4FA 3IRBA 1I3QH 3CRKC 3I70A 2PW5A 1BNZA 1HUNA 3TEZA 1WX8A 3KQ4A 2JSVX 4QIWB 3RMHA 1V5OA 4KKUA 3P1HA 3R66C 1K53A 1PGBA 3ITPA 1VCBA 2BKRB 2B29A 4RMFA 4C3JB 2IDYA 3OJ3A 1XYIA 3MP9A 2K28A 5IT9E 3DHIC 4CDEC 4EQ5A 4TQ0A 2QC8A 1QF6A 1EIGA 2DNCA 1J8IA 2PVOD 3T9LA 2XN9C 1TR5A 3BZCA 1SFOH 4KGSA 3DBLB 2R7FA 3OPOA 1CA6A 3GTLB 3AE1B 4KKIA 1R9TH 2C9WB 1KAAA 4CKBA 3VR2A 1N6ZA 2N0SB 1X3GA 4LNKA 1WD0A 2V3NA 2KHWB 1TS5A 1L1OC 4XWTA 4K7UA 3FHWA 4KI0A 3T13A 3F1ZA 2DAJA 1SNQA 2ZCCA 1YNNC 1UGJA 5IODA 2KFJA 2J7ZA 3D6CA 1SBBB 4LK1C 5IT9L 4R4CA 4C2MH 5JVH3 1LQBA 1OQQA 3QAQA 4NQLB 3RZWC 2RDGA 5I4DA 1NE3A 5M5XH 3ERSX 3DXJC 1SROA 4XYCA 2X8XX 1HZBA 4EQNA 2JK8A 4K8JA 3VA7A 4DV0L 1E90A 2AL6A 4C3IH 4KDLB 3DVNV 1HPCA 4DV7L 4MNOA 4LF8L 4FXDA 2PPHA 3N30A 2IW3A 2MRPA 2PQEA 4C3IG 4P75A 2NBWB 4HPMB 3NQTA 2OEOA 2M2LA 4K5XA 4YT0B 4WWMA 2CWAA 3HFZB 4DFAA 3GZNI 2L1BA 2UXBQ 3VUYA 1KLGD 1E5WA 3KH0A 2WXHA 5DPRA 1X9NA 4DBGA 4IOCA 2VH1A 3AE2B 1I50B 2N49A 2F0JA 2K14A 2ZJDA 1JOQA 5I9OA 1Q81C 1NY4A 2C7MB 4NQKE 5HG2A 1K28A 1LTID 1K0RA 2GI9A 3QC8B 3WALA 3A5UA 2JF5A 3BIID 1I4RA 4LF7L 4MGYE 5E4WC 3MEHA 1AARA 3QJZA 4IG7B 4LW1A 1YN3A 1VQEA 1WTHA 2NVQB 2NB0A 2JZ3B 2UXBL 5M5WH 3MJWA 2LXAA 3WAMA 1S4ZA 1CJEA 4A3BB 3LXFA 2KO3A 1B9MA 3MXNB 3RZDH 5EKIA 4CJ1B 3HOYG 1YQ3B 4CKCA 4X62Q 2Z6BA 2K8BA 3UE1A 2VB3X 1WTQA 3ML9A 1Z9FA 1U5KA 1WZ0A 3W9CB 2DZMA 1L7YA 4DK6C 1FCCC 1SAPA 1I94Q 1B70B 4JI8L 3WCQA 2WGSA 2BDNA 3ZO5B 3UQAA 4UP9A 1EM7A 3BWUD 2GVBA 3DBSA 1EYAA 2R3ZA 1E7ZA 3JC66 4BBRH 5IGGA 3FKYA 4GGQA 2A69D 3PV0A 2B2UA 2MWSB 3N1ZC 3L4PA 4FF2A 2MJ8A 1F2YA 4O42A 1NR4A 1ICFB 1OXXK 3O65B 3I91A 3B1LX 4S3SA 5JEAH 3CU7A 4DV0Q 2MP2B 2NVXB 3P20A 4MJSB 3HKZE 1II3A 1VQPA 1TYGB 1N60A 2F0LA 2F0DA 2EY2A 4J8QA 1WFYA 2IGGA 2LFIA 4KK7A 4W9LA 2WWZA 2JWZA 2LSSA 4RAUC 4LTUA 4A3BG 1FRRA 1FCLA 3GTGB 2M0XA 4YY3L 2PMZB 1EFWA 1KNEA 4IZ8A 3RN2A 2R7ZG 2VUMH 3PVLA 1UZXB 1C3TA 2VUMB 2K05A 2J52A 3AE3B 1AWDA 4L5RC 3OW7A 4E74A 1B50A 4L2YA 4DAYB 3SHQA 1Q8IA 5CYUA 3S1RB 4C7ZA 4AYBG 4KHPL 4YY3Q 4NJ6A 1K9MC 2RD0A 4NAMA 2Y3AA 3ALBA 3RNUA 3RLNA 2Y5CA 4IDIA 2KECA 3P75A 2K5HA
chains in the Genus database with same CATH topology
2F1MA 1EY7A 4ULLA 2V4IB 3ND8A 2L1AA 4HTHA 4ZHPA 5DM73 2NTTA 5HGTA 3SFEB 2I2YA 3I4MB 4YTMB 1DXMA 1EY6A 4RGOS 1L0XB 2ICEC 4P2CB 1TKGA 2J0TD 1TY2A 4RGMA 2L55A 1DZ1A 4PV1C 4FNFA 2PW7A 3MA2B 2PVGC 3H8HA 5M5WB 1RTNA 1SYEA 3QOJA 2RKSA 3E56A 3TSSA 5JVG3 5ELCA 1HFGA 3PZ8A 5EKKA 4ZKCB 4K2KA 3AE4B 3EA6A 1VRAB 5MPOA 3AN1A 4QUCA 5CGKA 1C77A 2G9HD 1CZWA 1ILQA 2WAQB 4CGYB 2PPBC 3U2SC 4XT1B 4KKJA 1D5MC 3GD7A 1F2LA 5J1ZA 3A8KE 2IGHA 2MJEA 1LTTD 3IKJA 2E74C 2MUYA 1E10A 1B44D 2ZXPA 1DCZA 2WXOA 5KNCA 3R2IA 4IUQA 4O1NA 1TQOA 1ET9A 5IOCA 4IOIE 1WTRA 2HCIA 2JA5B 3T53B 1M4VA 4R3DA 1X3QA 4REZA 4A6QA 4IQZA 5E1FA 2L83A 3VR8B 1Q3LA 3FDTA 4H2AA 2K6AA 2FUG1 1GOZA 2BBCA 3MXPA 1D2BA 1CFMA 2N55A 3FVQA 2X69A 3SK4A 4A3JB 1BF4A 1O78A 1SEBD 1IBXB 5EJWA 1Q10A 4MHEA 4A3FB 2JXMB 4RHSA 2YEPB 2F0GA 1NVID 2ZXRA 4YSZB 5HI1A 4BBSB 3LWEA 2QCPX 1G8ZD 1FFUA 2F4IA 1F0ZA 1RF2D 3DUZA 3LWUA 1VMPA 3GS2A 4P6VF 5EKLA 3TP6A 1A3VA 4YSYB 3P4PB 4ME5A 3J81L 3K58A 2FE8A 4PMWA 1CZPA 4XT3B 1I4XA 1W6KA 3SHLA 1PRTD 4IKGA 4IURA 4KN4C 3I4LA 3P4SB 3AV8A 2ACZB 2Z1CA 4KHVA 1PLFA 4OZCA 2BOSA 1WTOA 2WINB 1IW7D 3HEJA 2FINB 2JE6I 1ESFA 3M7NA 4X3UA 3HG9A 4K5WA 2KQ4X 4TSSA 3NBHA 1XXGA 2BTEA 2HUGA 2H1EA 2EYPA 5KYLA 3H3VC 1DM0B 2R92B 1EWCA 5EPJA 4ZUIA 1DOKA 5KEEA 3IXSA 2V4DA 1TY0A 1U4MA 2IL8A 4JE3B 1FR3A 2M0AA 2MPMA 3LYYA 1YNJD 3IFDA 1ZXIA 1V1PA 2N88A 4K6LA 2AWNA 2W54A 3SVMA 2EYLA 3BDOA 2KEDA 4I7ZC 2Z4IA 2KCNA 1STNA 5FOBB 2XSCA 3EROA 2EOTA 1IYVA 1ZDXA 2O5IC 1EZ8A 1YNTE 3AE8B 4RCOA 4B08A 5CV6A 2DN8A 4XQJA 3EGRA 3MXGA 4Q2JA 3FPUB 4JX1C 4ZYSA 1HQMC 2EPBA 1B3AA 3CRLC 1SMYC 1RHPA 1QOBA 5CV8A 1LTSD 1Q1BA 4USAA 5FKAC 1JWBD 1QOGA 5BMHA 4WURA 1OXUA 5C6AA 3K0YA 2ZT9C 2I38A 5KRUA 1BCPC 3FPPA 5T1GA 3NUCA 1JORA 1OXVA 1PGXA 2B2YA 5BN3A 4CJ2C 3MFYA 2SOBA 1QT9A 1CHPD 2AQ3B 1ZP0B 1AZPA 4LLGM 4KGRA 1BUVT 3CKIB 1FD6A 2E2JB 2F0MA 2RBMA 4YXDB 3DWQA 2A68D 2DLBA 2LS01 4NP5A 4RFBA 2B8GA 1W6JA 5KYIA 1PRTF 1YNJC 3PMFA 3HVZA 4US9A 3DEOA 4WFN3 3QJYA 1SDFA 4TKOB 4QB4A 2Z8LA 3T4AC 1XO3A 2AWOA 3S2DB 3AE5B 3NS1A 5C44B 1K51A 2RDFA 3IT4B 1PMRA 5C4XB 1ZKOA 1G6ZA 4DF7A 1TJEA 1E0BA 3D6WA 3A7AB 4NJCA 3HZXA 2KAJA 2F0UA 3DEPA 1S5DD 4C3HB 2CQAA 3NBIA 3VR5A 3K5OA 5IGCA 2Q5WD 1QQRA 4KN7C 5EPLA 1PFNA 2MJ3A 1V1PB 1DONA 1J7BA 3M4YA 1B2TA 5CBEE 3HOXB 1XTCD 3CHBD 1Y8NB 2A73B 1MHHE 3W5VB 3ERQA 3TEXA 1D1IA 2INNE 1EWHA 2HDLA 4XIGS 3J9CA 2R7ZB 5EBCA 3SK5A 4C3HG 5FLXL 1PFDA 5ISRA 2LFNA 4DK0A 1XLPA 1EFID 2OXPA 4LAAA 1ZDVA 1Y56A 3X3MA 1LTBD 4I65A 2WXKA 1FNWA 3VYSA 3E9SA 2D62A 1JC7A 4WRDA 3ONAB 2WDVB 5FR3A 3HVDA 4ODGA 3GO5A 1WRIA 3KBGA 3NHHA 5FO8B 5LL6S 2M56B 3AE6B 1AZQA 3BYYB 4OHJA 1MPEA 2X38A 4MACA 2H88B 3OWEB 2LKVA 2RSNA 5HURA 4C3IB 4KHZA 1SE3A 1H9MA 3AEDB 5COYA 4XE0A 1ILPA 4JPSA 3C1EA 2TMPA 3VR9B 2W3RA 4TQ1A 1YN4A 3ABVB 4QUFA 3U9OA 1KF6B 2YEPF 4ZHOA 1OFFA 2X6GA 4N9PA 3BS1A 1D5XC 5JAVA 5EE1A 3DMUA 1O7ZA 1E2WA 3BG3A 4IUVA 1F2MA 3Q6SA 4YTPB 5I9PA 4RCNA 4JWUC 3I57A 3NTIA 1QWYA 1JWAD 1WTPA 2WXQA 5D7GA 2K04A 1JWUD 1R9TB 2VXWA 3IAYA 5D65A 2IX1A 2V0GA 3TUOA 4BY1B 4YTNB 3ETRA 3TZDA 4GDLB 1H9KA 1ENFA 1NI3A 1X32A 3Q8CA 1WYGA 3A8IE 2KHSA 2E3TA 3QWNA 4C2MB 2ON8A 2WU5B 4XDXA 4FYDA 4H13C 1PYWD 1E9MA 2F0TA 2K3UA 3I8ZA 5IGEA 3Q8FA 1VDZA 2F03A 2KDMA 1SNOA 5FO7B 4FVMA 2WACA 5CV9A 2WXMA 1FXIA 1KH0A 3GB1A 1PTOH 5HHDG 1LT4D 2MP1A 1NYRA 2M9VA 1E2ZA 3I73A 4LMQD 2JSOA 1EY9A 1T5XD 3NTKA 3X3NA 2WDQB 1TWGB 3I72A 2E2HB 3DM1A 2G1EA 1PZID 3HP3A 2XRSD 2D5GA 3DWMA 1K83B 1FFVA 1YQ4B 5CV5A 3B9JA 3RZDB 4HR7B 2B2YC 4K2LA 1NENB 2AQ2B 2LGIA 5BYRA 2E75C 2BB5A 1F9SA 1C9FA 1H9JA 1D5ZC 1VZ6A 4HMIA 1Z47A 1WTXA 5IIFA 1J9OA 4DAPA 2WXFA 2C9OA 1KDAA 2LUMA 3HRDD 5CV4A 3H94A 4EQPA 1BCPB 4Z9CB 2M19A 1G91A 4IALA 5DEHA 2PCFB 3SK6A 1KFYB 2JA8B 1FO4A 1O7LA 2CJOA 3W5UB 2N7JA 1L6UA 3S1MB 1CM9A 4TQUS 1KLUD 1ICWA 4KD4A 3HOWB 3T3OA 1BXTA 3BZDB 2I07B 1ZPSA 4L8JA 1I3QB 3TN2A 3TZUA 3NTHA 1TIID 1UEAB 1EY5A 3NWSA 1ZE3D 4NDXA 5J22A 4XQNA 4G7HC 2H4OA 3DWPA 2LHDA 4RH6A 3FILA 2EXZA 3D8GA 4HCSA 3TBIB 2EYOA 1C4PA 5CV7A 4HCEA 1EU4A 1PTOD 1JCKB 1JALA 1H9SB 4GZYC 3IAM1 3BK2A 1VLBA 4L6TB 1DOXA 1PRTB 3HOUB 3PO3B 4J1MA 5ELBA 1EY4A 3S1NB 3IAS1 2F3WA 2VB2X 4FXCA 1ZOYB 3AE7B 4R8NA 2KCCA 4MH8A 1GUNA 2RA4A 3C8YA 3CIRB 2K33A 1LTGD 2G9DA 3OMCA 3E5SA 1YNND 4OZBA 1X3PA 1NR2A 1PFMA 2JEBI 2WIIB 2PZWA 5BYQA 3A55A 2KA7A 1WVLA 3IT6B 2K32A 2R61A 2EKIA 1TS3A 1U4PA 3VQIA 4HKQA 4XYQA 2K01A 1EZ6A 1GXDC 1L4DB 4KY6A 3N6RA 5I2YA 2VZKB 4B0EA 3FKIB 2BA0A 3C3LA 4IFDH 3NVZA 2K5QA 1BR9A 2VZKD 1C4AA 4UAIA 5G3LD 1HTPA 2DYOA 1NSNS 4DA2A 3SEBA 5M5YB 2WB1B 3AMUA 2MHVA 2K5WA 4JBWA 5M3FB 3KWLA 5ELDA 2WQYB 1QOFA 1PDXA 4N58A 3VR3A 4WIPA 5JPNC 4RHRA 3NPPA 1HA5A 1JOOA 1LT3D 1QOHA 3DWAA 4A90A 1B9RA 4GLSC 1L0YB 2ZW0A 4J3OD 4FF4A 3C2PA 3EFXD 1ML0D 1A6XA 1SYGA 1JICA 1LT6D 3D4DA 4ZLTF 5FLXE 2B39A 3GV3A 1SFOB 1L6VA 2K03A 3H91A 1WTWA 1BBXC 1K8OA 4LJZC 3NUHB 1LO5D 4IUTA 1D1KA 3BK1A 1IBXA 1L5PA 1E0ZA 4AQ7A 1STAA 2ONQA 2MH7A 3A8JE 3CWIA 1KDCA 1H9RA 3VYUA 1BQQT 1QG7A 4M0WA 3NVVA 2TSSA 4MT5A 1WWTA 4ZAIA 2JZPA 2JU6X 4IUUA 3PUVA 2F0OA 2AQ1B 2AUJD 3Q23A 1TZOA 2B2WA 3WDNA 1WTVA 3S14B 1FEHA 3TDQA 2N9KA 2PIAA 1RYJA 4G57A 1GB4A 2K5PA 3P1MA 3SK8A 1B9NA 4G7OC 1A2TA 2B2TA 2NYZD 2DWQA 3AEBB 5JPMC 1E2VA 1SYDA 2WP8J 2A6HD 3V05A 3FAHA 4RF0A 2A6HC 2WP9B 4ZK9B 4ZRPA 4RNAA 3TP5A 2B76B 3MC0B 3GTJB 1L4ZB 4B0MA 2PYKA 2KQ3A 2GRIA 3J80L 5C0XJ 2INPE 3VA5A 3NVYA 2XWBB 1Y8OB 4D2KA 1UWXA 3PUZA 2F0QA 3D31A 2WU2B 2EELA 1SYFA 4US8A 1RD9D 1XCTL 2KACA 1STGA 2L0CA 1RJTA 2PZTA 1FMAD 3F2UA 3OSOA 2BS3B 1KDBA 3URYA 1V8CA 2Z4HA 3W1SA 2D9UA 2EY5A 5C3XA 3PIO3 1LTRD 3GV6A 1SF0A 4NAWB 4WJWA 4RGNA 4ABNA 3CQZB 4A55A 1HRJA 4FF3A 1XX8A 1OO9B 4HEDA 2QDBA 2SEBD 2RVLA 2NVTB 1QNUA 2PO4A 3P4RB 3R8BA 1WD1A 2BYTA 5TSSA 1CHQD 3Q8EA 2QJLA 1CTMA 4ILWA 1ROEA 2BW2A 2LHEA 4C1NK 3PZ7A 3EJIA 2Y5PA 1STHA 2Q8RE 5DM63 3FMCA 3I90A 1WCMB 1JQ4A 2Q8TA 1EY8A 1BUIC 4WQMA 5C3JB 4YIJA 1KABA 2EDGA 2EJFC 4AYBB 1WGKA 2EYFA 4M1UB 4UDUC 4K14A 4ZQ3A 3RZOB 3RPFC 3ZQ4A 1UAPA 2SNSA 3J80E 1V43A 4HSVA 5K36H 2RMMA 1G2TA 4HN7A 4PNYA 4XTCS 3BVZA 3G6JB 2JA7B 1TKWB 2C5CA 3I4NB 2JA6B 1PTOF 1V1OA 5F2DA 4HSPA 2K22A 2OHFA 1R4QB 5J39A 1MBYA 1PTOB 1MHXA 4A3IB 5LNK1 2WKCA 5DNFA 5T8IA 1G291 2KOLA 5EE0A 3KLSA 3M3YB 4OL7A 4HJGE 2SAKA 4OIJA 2YYZA 1E7PB 3K5MA 4C56C 2BA1A 2WV6D 1CA5A 3P63A 1HA6A 1DGJA 1T6BX 2KMMA 1UUPA 2H89B 2X6LA 3NP8A 2QSDA 4XYOA 3KF8A 2BE5D 3SFDB 5H92C 4WAFA 5D14A 4CBVA 1VCIA 1Q1EA 2E2IB 2F0WA 4EE2A 3Q0AA 2BS2B 1CT1D 1RCVD 1KRHA 5NUCA 1DOMA 4DU9A 3OMGA 3S17B 2NVYB 1CZGA 1QKZA 1XF5L 3KK7A 3D3RA 2SDFA 1PZKD 3I3CA 2NUCA 1IYUA 5EBDA 2JQRB 5M9OA 1NEKB 5A2QE 2XVSA 5IGBA 1GAQB 1C4QA 2HTME 4XXEA 2IGDA 4ZOHC 1JW9D 2QKIC 2WS3B 1SMYD 2BB6A 3HOZB 3BDLA 4E6IA 2KVMA 4MM3B 2L9HA 2WKDA 3OIPA 2PMVA 4PMBA 5EQ0A 3R93A 1VJKA 3ZJTA 4DNRB 1ESRA 3U9SA 1KTKA 1AN8A 1S5ED 1BCPF 3UI2A 1IUEA 2R6GA 1SNPA 1XCQL 1Q90A 3B2FA 2K5DA 4B9WA 3IFTA 4AS1A 2WXGA 1F2RC 4A9AA 3J81E 1ACCA 4M8AA 1MSHA 1SYCA 2QIEB 1A15A 3K59A 2JEAI 2I46A 4MN3A 1S5CD 4G7ZC 1MSGA 2K1BA 1SE4A 1GJXA 3GQBA 2A6EC 4FO2A 2K7VA 1NYQA 4BY7B 4L63B 4PMCA 1YN5A 2AUKA 2XNAC 5C5MA 3ZGZA 2RDHA 1AYFA 3DWGC 3SR1A 1JR0D 1P7EA 2PLPA 1JE4A 3T51B 2HDEA 1ENAA 1RFKA 1D6EC 2M00A 1EEFD 2F0VA 2DY8A 3WOFA 2D5DA 2EVBA 3VR4A 1ENCA 3C46A 4RA8A 2KWDA 1PTOC 2W3SA 4NMZA 3V96A 4FP5D 1IKLA 1C8CA 2N9LA 2B2VC 3AE9B 4EQOA 1AEXA 4YSXB 4QF4A 1STYA 3Q69A 4HAEA 1NAPA 2F0SA 1UNSA 1TT2A 4MIUA 3HUIA 5GXGB 2NWGA 1B53A 1VMCA 3PIP3 1ZXHA 1Y69U 5HFYA 1F9RA 4C3JG 2EYJA 4R8IA 3GTQB 1STBA 1TWFB 1EIHA 3AM9A 1BCPD 5D3IB 5CMDA 2CJNA 1R4PB 3B2GA 4ARCA 3NK9A 3W2DA 2F0FA 1SE2A 1GHJA 4PQXA 1HEZE 3C1FA 4H44C 1C79A 1DYQA 1WXQA 2V3PA 2FMCA 4RF1A 2HQEA 2O2LD 1R7SA 2WXPA 2OT2A 1BMLC 1JWMD 3VR6A 2J42A 4CKEA 1SIJA 1ZXTA 1XLNA 3MHBA 1N61A 1LLRD 3H09A 1VZ8A 2CU3A 1Z7TA 1DD2A 3EVQA 3LX0A 3OWFA 2RSOA 3BVGA 2BE5C 2LY7A 4YWGG 1N63A 4RGTA 3WOEA 1I4HA 3VYRA 3J7AV 3A54A 2L4NA 4WORA 1GUWA 1ET6A 3S9WA 4NW2A 2QMTA 4U673 3HRZC 1RWSA 3TP8A 3BDCA 1QNKA 2EYHA 4QMGA 1ZYRD 2EJMA 5T1IA 2WLBA 4ITKA 1FM0D 4LK0M 4N6EB 2HDMA 1Y8PB 1V8QA 2A6ED 1BDOA 2EYMA 2IPKD 4XWWA 3I9V1 4ID6A 1VDVA 1PUTA 4DN4M 3FILB 1PGAA 5CORA 1J7AA 2MGSA 2MEKA 1OQRA 1FXAA 1FNUA 1XWEA 5I2XA 3SR6A 1S5BD 3EQLC 3UI3A 3M4OB 2KJXA 4A93B 3KUPA 3NSWA 1HFNA 2ICIA 3M7GA 3GTMB 5C4ZA 3GTPB 2CW0D 1GUOA 1H9SA 4F7XA 4L1BA 3NQIA 1TS2A 2O4XA 2HCCA 1C48A 3S16B 1OXSC 5CC4A 1EY0A 1JROA 5AUIA 2A69C 1TS4A 4A3KB 1FIQA 3AEGB 2JX5A 2CVRA 2JWUA 2PTLA 3J7AF 2PZUA 3N9YC 2KEEA 1GUTA 5ELFA 3PO0A 1ONLA 5H8YE 1IW7C 1Y1VB 3Q8BA 1MVKA 1GHKA 4KJNA 5LHY1 2JXTA 2LJIA 4JK1C 3HS0C 2F0PA 4CHTB 1DOIA 4F88A 4BA1I 4OO1H 1V97A 2OF1A 5C0XH 3Q22A 3K5NA 2VNUD 2EE1A 3NVWA 4P16A 2NTSA 4KMUC 1MI2A 5M3MB 4K6DA 4CJ0B 4WH4A 1XLQA 2WXJA 1SNCA 4ZKBB 3PUYA 1F2ZA 2FMMA 2ENBA 4OW0A 3GTOB 5C2TB 3K6OA 4KGTA 4V190 1HHVA 2EJGC 1PRTC 3SXHA 3N52A 1MGSA 5C0XG 2E2DC 2NMQA 4Q0FA 1C76A 3KBXA 3AMZA 2F0EA 1L0VB 1RM6C 3U52E 2CW0C 5C4HA 5KNDA 2J53A 1N5WA 1PDQA 5BMGA 5C0XI 2DNEA 3TEYA 3MVVA 1GB1A 1LT5D 4RKBA 1N62A 4EVOA 2QF7A 5I6WA 5JXVA 2FBWB 1IHZA 4BBRB 3KLRA 2SNMA 1EOTA 3GP7A 1O7YA 4IUNA 2B63B 1ZUD2 3MJ5A 2F0NA 4KY7A 2A68C 4DAYA 4A3GB 4IUPA 4XDCA 1XEEA 2O5JC 1EU3A 3PUWA 3MHZA 3A56A 3VRAB 1F9QA 2JYOA 2NN6G 3G7LA 1VR9A 3T16A 4K8IA 5C3WA 3LNNA 1VZ7A 5LL6X 2WDRB 2B2UC 5CR3A 3RLFA 4ZRZA 3KWVA 1LV9A 2WXNA 2F0HA 1AW7A 4KJOA 1LTAD 4FXKC 1NUCA 5CBAE 2NN6I 4C80A 5E6JA 1FYCA 5BN4A 1IKMA 4GDKB 5AUKA 2WNMA 1GPXA 1IL8A 3HOYB 3VYTA 4KTAA 1SSOA 4KX6B 2XWJB 1EL0A 2XRQD 1CQVA 3H0GB 2KUMA 1LACA 3OHXC 1B4OA 3Q8AA 1EYCA 1QCBD 4IFDG 1M8AA 2W82A 3NE5B 1PXUA 5EE3A 2GA4B 5BN5A 2EY1A 3P42A 5IGFA 2K0PA 4DXFA 2IWHA 5C4JB 3OIQA 4X3TA 4F87A 5EE9A 4ZUJA 1FRDA 2IX0A 2NZ1D 5A35A 1JQYD 3V3XA 4XDDA 1K8MA 2JP1A 3MFGA 1MD2D 3HKZB 1P7FA 5M5XB 4QCLA 4PT5A 2BDOA 4Q5VA 1XLOA 4TRDA 5KNBA 1SNMA 1KNAA 1IGCA 2ZW1A 5EPKA 5KGUA 1JWSD 1HQRD 3NZ3A 1E6EB 1BOSA 4N9TA 2B8FA 4FF1A 4OO1I 4FXGC 3TP7A 5EGTA 1TKEA 2WXIA 1O80A 1RODA 5JEAJ 5JEAG 1F77A 2DY7A 1TWCB 3PUXA 2PKOA 1DOYA 1S5FD 2IJ0A 5G5HA 2PW9A 1SJED 1HUMA 2IX3A 4IN3A 3V2TA 1DJRD 1ZYRC 1A2UA 4RWSC 1SB3C 1JB3A 4B9XA 5DAUA 2Q8IB 2WXLA 2B2TC 2L11A 2PNRC 1I7HA 1QE6A 5I6YA 3RUZA 1I6VC 3AEFB 3K57A 1I4QA 1QOAA 1DOLA 1D4BA 1AP0A 1EWYC 1C78A 3MWYW 4A3MB 3S2HB 3K5LA 2EZVA 1HTLD 1U4RA 3T3NA 5E3FA 3JAML 2A74C 5K5PA 3NRZA 3U7ZA 3P7JA 3S15B 5BYSA 2LEKA 4HROA 3AU7A 2EY6A 4ZRQA 2B2WC 1F9PA 1K50A 1ZEQX 2ZXOA 3GTKB 1I4PA 1TWAB 3MAQA 4HKZE 2F0KA 1FGBD 1I6HB 1T3QA 2OEDA 5BMIA 3T56B 4OGQC 3R3OA 3R2TA 1BO0A 2LMCB 4X3KA 1QB5D 3M85A 1CI3M 4H0LC 1CQFA 1MI0A 1JMLA 3FEWX 3D4RA 2DBYA 1HZ6A 4A3EB 1TVXA 4BA2I 1JRPA 4DNTB 3AECB 5G5GA 1EYDA 1HXYD 1Z6HA 5JJZA 1YJJA 4BS9A 4DAVA 1OXTA 1PFBA 3MZ5A 1RDPD 3U4EG 1U4LA 3ZYYX 1EQVA 3VRBB 3AB5A 2FFKB 3KLSX 5JOBA 1PZJD 5K36G 5G3LF 2ID0A 1F2RI 5IGDA 2FJ2A 2F0IA 2GB1A 2R93B 1IGDA 3E0JA 3OOCA 2W55A 4CQNA 1CK1A 4XQQA 1U9RA 2E76C 3A7LA 4KY5A 3QG1A 1SJHD 2K9XA 2CHBD 3P4QB 1EEID 4KKSA 3LB8C 3JAME 5ELEA 5A2QL 4DK1A 1HCZA 2KN4A 4HRSA 1I4GA 5C3EB 1G2SA 3TEWA 3IL8A 5D3DA 3EUB2 2BS4B 1SXTA 3RFZB 3QB3A 5FK9C 1YJIA 5FO9B 1Y1WB 4F8MA 1RTOA 1FNVA 2D2CC 2L32A 3BYTB 4ARIA 1A70A 3L3OC 4V0BA 1GUSA 5AFWA 3J7YW 2DYMA 1WSPA 3ND9A 3AEEB 1SYBA 2WXRA 2JYEA 2Y0SB 5E4XA 4OZAA 2NBFA 2L5TA 1SSNA 1K52A 2IT1A 4DGZA 4NKLA 1B1ZA 2LMCA 2QILA 1J7CA 2BT6A 4OIKA 1VF7A 4C1NI 4RKLA 3H6MA 4X3SA 1AFPA 2A5HA 3AH7A 3E6ZX 1A3UA 3HOVB 1FD7D 2RPVA 3K7AB 2NN6H 2JYTA 3HGBA 3DHQA 3Q24A 3AB9A 3QOLA 2B2VA 4A3DB 4HMJA 3NWTA 2L52A 4IFDJ 4KD3A 3SE0A 4KKTA 4K5VA 4HEA1 4J6HA 3MXNA 4Y7NB 4N59A 3PO2B 2AX5A 1GUGA 4IFDI 3RD4A 4BWGB 2QEJC 3MXUA 1HZ5A 4R9WA 1STEA 1YMHE 1C4CA 3S1QB 3QO2A 4NZLB 3L7ZC 1NCVA 3FRPB 1QJOA 1LABA 3O13A 2BCOA 3BVMA 1RKNA 3SDZA 2FHTA 3FC4A 4A8XC 4OVZA 4EGVA 4L23A 3D4WA 4KV6A 4DXGA 3AEAB 1T5EA 2J4XA 1UWMA 1EQTA 2F3VA 4U68A 3W3AA 2RQXA 5C5LA 3ZJVA 1TU2B 1QILA 2XIWA 2E6XA 2MJDA 4TMAB 3MTSA 1SNDA 4G4KA 2YU9B 1JOKA 4C7YA 3QIAA 1QLBB 1N5XA 4H7BA 3ZJUA 4JWSC 3L9AX 5KIXA 4DQOC 3TMEA 1A3TA 1TWHB 2L12A 3NXWA 4OO1G 1Q12A 1VF5C 3CRKC 3I70A 2PW5A 1BNZA 1HUNA 3TEZA 3KQ4A 2JSVX 4QIWB 3RMHA 3P1HA 4KKUA 1K53A 1PGBA 3ITPA 4C3JB 2IDYA 1XYIA 3MP9A 2K28A 5IT9E 4TQ0A 1QF6A 1EIGA 2DNCA 1J8IA 2PVOD 2XN9C 1TR5A 4KGSA 1CA6A 3OPOA 3GTLB 3AE1B 4KKIA 1KAAA 4CKBA 3VR2A 2N0SB 1WD0A 2V3NA 1TS5A 4XWTA 4KI0A 3T13A 1SNQA 1YNNC 1UGJA 5IODA 2J7ZA 3D6CA 1SBBB 4LK1C 5IT9L 1OQQA 1TKYA 5JVH3 2RDGA 5I4DA 3DXJC 4EQNA 4K8JA 3VA7A 1HPCA 4FXDA 2IW3A 2PQEA 4C3IG 3NQTA 2OEOA 2M2LA 4K5XA 4YT0B 4WWMA 4DFAA 2L1BA 1KLGD 2WXHA 3AE2B 1I50B 2F0JA 1JOQA 5I9OA 5HG2A 1LTID 2GI9A 3BIID 1I4RA 5E4WC 3MEHA 1YN3A 2NVQB 2NB0A 1S4ZA 1CJEA 4A3BB 3LXFA 1B9MA 5EKIA