2NTSA

Crystal structure of sek-hvb5.1
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
217
structure length
217
Chain Sequence
QGDIGIDNLRNFYTKKDFVDLKDVKDNDTPIANQLQFSNESYDLISESKDFNKFSNFKGKKLDVFGISYNGQSNTKYIYGGVTATNEYLDKSRNIPINIWINGNHKTISTNKVSTNKKFVTAQEIDVKLRKYLQEEYNIYGHNGTKKGEEYGHKSKFYSGFNIGKVTFHLNNNDTFSYDLFYTGDDGLPKSFLKIYEDNKTVESEKFHLDVDISYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRBC1 protein
publication title A novel loop domain in superantigens extends their T cell receptor recognition site
pubmed doi rcsb
source organism Homo sapiens
molecule tags Toxin/immune system
total genus 66
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ntsA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ntsA01
2AQ2B 1LT4D 3R2TA 1LTRD 4C56C 1PZJD 1PTOC 1V1PA 1PTOH 1AW7A 2QEJC 1FNWA 2NTTA 2SEBD 3O13A 4RGNA 1D5XC 5ELCA 1JWMD 1TS5A 1S5DD 1KLGD 4DXFA 1CK1A 4RFBA 5I4DA 1SXTA 1ESFA 1CQVA 1PTOD 1STEA 1FGBD 1PZKD 3CHBD 4TSSA 1V1PB 2O2LD 3W2DA 1JQYD 3DWQA 1LT5D 1LTID 1F77A 1JWSD 1DYQA 2NTSA 2TSSA 4RGOS 1RF2D 4RGMA 1YN5A 2AQ1B 1B44D 5D3IB 1DJRD 1FNVA 1JCKB 1S5ED 1I4QA 1TY2A 1D6EC 1ENFA 2ICIA 2XRQD 1JR0D 1RDPD 5ELDA 1XTCD 5FKAC 1PYWD 1T5XD 1LTSD 1I4PA 4OHJA 5D3DA 1BCPC 1PTOB 5ELFA 1PRTC 3DWPA 1EEFD 1KLUD 1TS2A 1SJED 1EFID 1JWUD 1YN3A 1PTOF 3EA6A 1BXTA 2Z8LA 3MFGA 2QILA 1HTLD 1B1ZA 1LT3D 2IJ0A 5TSSA 1LTGD 1UUPA 1SE2A 1XXGA 1LT6D 3EFXD 1RD9D 1SJHD 4K6LA 4BWGB 1I4GA 1PRTD 4L63B 1KTKA 2XNAC 3OWEB 1SBBB 3URYA 1EEID 1LTTD 1YN4A 3TSSA 1D5MC 1LO5D 3BYTB 1V1OA 1D5ZC 1ET9A 1I4RA 4DXGA 2AQ3B 1AN8A 1ET6A 1CHQD 3MC0B 3BVMA 3V05A 2XRSD 5ELEA 3R8BA 1TY0A 1GOZA 1PRTB 1LLRD 1LTAD 3BVZA 2WV6D 4RGTA 4Z9CB 1S5BD 4L6TB 3DWAA 2RDHA 1FD7D 1RCVD 1UNSA 3R2IA 1BCPD 1FNUA 1LTBD 1PRTF 2J4XA 3BZDB 1HA5A 1CT1D 1G8ZD 1M4VA 1MD2D 4RHRA 1I4HA 5ELBA 1S5FD 1SEBD 1S5CD 1HQRD 4RHSA 1QILA 4NZLB 1SE4A 2XN9C 1PZID 1L0YB 2R61A 1CHPD 1L0XB 4RCOA 1TS3A 4O1NA 1EU3A 4UDUC 5FK9C 2CHBD 1I4XA 2RDGA 1BCPB 1EWCA 3SEBA 1TS4A 3BVGA 4RH6A 3KLSX 4ZYSA 2G9HD 3BYYB 3GP7A 1EU4A 2IPKD 1SE3A 1HXYD 1BCPF
chains in the Genus database with same CATH superfamily
2LGDA 1RJTA 3Q6BA 2L4NA 3R2TA 4HJ8A 1PZJD 1SSOA 4DR4Q 1PFNA 4UY8C 2E2JB 2L83A 2WXQA 3I63C 4E6IA 3S24A 3DVNU 3HOYG 3STBC 4S3SA 3GTGB 3T8MA 4ACFA 1SMXA 4R4TA 2IX0A 4NXML 3TRZA 1WXSA 4I7AA 1HE8A 3Q23A 1STEA 1UE1A 3QARA 3KYHC 2AEHA 2QCZA 1ZKHA 4FJVB 3RN9C 1O7IA 4OIKA 4B3ML 5EAYA 1FPYA 4P72A 4LTUA 1S4ZA 2K7VA 1KAWA 2F3WA 4PS7A 1CKOA 4TQUS 4CHKA 3QJYA 3OSOA 3S9WA 1HHVA 1YQBA 2DBYA 4IG7B 1JR0D 3CWIA 3OHXC 2Y5CA 3PLUA 1MIUA 4JIOU 1K53A 2R6GA 2FNJB 4JYAQ 2RA4A 3G71A 3CRKC 3GTJH 4MGKE 4JI6L 1TWGH 3KWVA 5M5XH 4POGA 3Q3OC 3RCZA 3WAPA 3N6RA 1L2NA 1V49A 1OO9B 3JAME 5LL6X 1I50H 1UUPA 2EYLA 2KMAA 4HIDA 1FFVA 4II2B 2D07B 4IKGA 3TCAA 4X62L 5CORA 1IZ6A 1RYJA 1CQFA 4PMCA 1A0IA 1KTKA 3E0EA 4WORA 1CKMA 5J39A 4B3SQ 3DEOA 4OWWB 1WJNA 4GLAC 4F1SA 4HSVA 3MWYW 4X3KA 2P5ZX 1EEID 4X66L 3QO2A 4HJGE 1B9MA 3T13A 2KFKB 1UAPA 2FFKB 4QF4A 3P20A 1HJPA 4G7HC 2JZPA 3CSTA 4KDIC 3KBGA 4A3KB 4QUFA 2ZJQA 5A2QL 1C4CA 1MVKA 3BK2A 3BG3A 3RD2A 4CGYB 5NUCA 1PRTB 1JOQA 1IKLA 2UUCQ 4WWMA 1P3QU 4GNXA 2W82A 2JQRB 4KX6B 3U58A 1LM8B 4IC7B 1KJTA 1TKGA 1FXTB 2Z0DB 2NN6I 1E7ZA 1WFYA 3ABVB 3K9PB 4A76A 1G51A 3L3OC 4E71A 3PO2G 1MD2D 2ZXPA 1E8YA 1SYFA 1VQ7A 5JXVA 2OJRA 3W3AA 4AQ7A 4ANVA 2FIDA 3AEGB 3U2SC 3NRZA 2JJQA 1TS3A 1EY4A 1QZHA 1H9SA 3HOWH 4KN4C 2BT6A 3PRZA 4HXDA 2JXMB 1WTWA 3V60A 3V6CB 2K6QA 1VR9A 1AP0A 2B8GA 2UU9Q 1A3VA 2C60A 1NUCA 3T53B 4LF4Q 5G5HA 4DK3C 1HXYD 1BCPF 2VZKD 3BDCA 2Z6KC 2K0PA 3SVMA 4A3BG 1KLVA 1TWHB 5EQ0A 5DM73 3M3YH 5M5YB 3B1LX 3PO2B 2W54A 4LJZC 2CU1A 1WJUA 1II3A 1NE3A 4OGQC 1I7HA 5E6NA 1WGGA 3DHHC 2X6GA 5I6WA 3O13A 1CZGA 1SN8A 2DNEA 3L9AX 3NP8A 2ACZB 2QSDA 4LDTB 2DZKA 4IUQA 5IYDH 1R4NB 4MEMA 3W5UB 2PW9A 1STGA 1T0RC 2FUHB 4LF7Q 4DR6L 3H7SA 5AZHA 4BBRG 5KHOA 2EMSA 1SXTA 2KUMA 2F0DA 3EQLC 2BB6A 5IOIA 1OQQA 2BYVE 2HD3A 1HRJA 3I4NG 1I3QB 4K14A 2VQFL 2L8JA 1A63A 2KHJA 2A6ED 4EZLA 4KI0A 2KAJA 4N8X1 3I57A 2PQEA 1EQVA 3QA8A 4C80A 3NZUA 3UDGA 1B50A 2LWPA 1GO3E 1WTVA 5ELDA 4W9CA 2M9VA 5HG2A 3RZFA 4WAAA 3KLSA 2K5NA 4IUNA 3RR5A 4AQYL 3PREA 4XYOA 3TBIB 2MBQA 4FNFA 1HR0Q 4JGHB 1C79A 1KAAA 5EPKA 1C77A 4JI7L 4LFBL 1F9RA 1V2YA 4ZHOA 1QJOA 2B2WC 1UF0A 4G50A 3IKJA 4MTNA 1Q10A 2WXFA 3V62A 2UXBL 4XDDA 3M4OB 1WCMB 1N32Q 1AARA 1PUTA 3KJOA 1NCVA 2D5GA 4W9IA 4TKNA 2QILA 3ZJTA 4DUZQ 1B1ZA 1LT3D 1VQMA 3Q24A 1MG4A 1S40A 4HJ9A 4L8JA 1YIWA 1SE8A 2D2QA 3A1QB 2KDEB 5C6AA 4KN7C 3HOVH 1PVOA 5BYQA 4DHZE 3OLMD 1E8XA 4WWNA 3GTQH 3NPPA 1GUAB 2WAQG 1KC8C 5E1FA 2KLCA 2CWAA 2L12A 4DR7Q 1QQRA 4JI2L 4FULA 3OIPA 3RNBC 4BOZB 3NUCA 4IO9A 1LUZA 1YJJA 4MH8A 3UI2A 1XLPA 1OXSC 1UWVA 3SFDB 4TRDA 2HJ1A 1EWIA 1WZ3A 5HHDG 2EXDA 4W9GA 2A74C 3D4DA 1YJIA 4KGTA 4FADA 4GKKL 1AFPA 2LXKA 4L6TB 1TWAB 2WNMA 1XTDA 1RCVD 2MO0A 2E6XA 3FC4A 3R7RA 2MQJA 2RHQB 1PRTF 3J81E 3VR8B 3PF4A 5G3LF 3KWLA 2BYTA 2N9LA 1OXUA 1H9MA 1SDFA 1IP9A 4IWQA 5JHAA 4R4IA 2L32A 4OO1H 2KTRA 3RPFC 3PUXA 5C3EH 2WAQB 5C3XA 2KNBA 3ZTDA 1VQOA 5BYSA 1S5CD 4DPGA 2KWDA 4W9FA 2B39A 5IWAQ 3NEMA 1JOKA 4FF1A 4LUVA 3ZNGC 4O1NA 4UP9A 4ZLTF 3SDZA 3I72A 2KKCA 3FKYA 3M63B 1PLFA 3JSVB 1T0SC 2JYOA 2WXLA 2VUMG 3D6WA 4YHHL 1IGDA 2FINB 3E9SA 1XX8A 1GJXA 3T3NA 2M17A 4HSPA 2K9XA 2PMVA 5IGDA 2GLSA 2W3SA 2R92H 4S17A 5JEAJ 2EY1A 2JK8A 5JPNC 1UEAB 4DV0Q 4F87A 3NVZA 4M02A 4KKJA 3M7GA 3VAWA 1YQ3B 2C7MB 3ZNHB 3K59A 3T1YL 2PPBC 2NBVB 1N63A 1U4MA 1JWMD 1F9SA 5C44B 2O6VB 1Q7YC 3IBEA 1CK1A 2NZHA 3TREA 1XMQL 3KF8A 1Z7TA 2Z4HA 4S0RA 4USAA 3E6ZX 3S1QB 1CJEA 1KNEA 1WGKA 2K05A 4GU2A 1QT9A 1UBIA 3TP6A 4G11A 1GNUA 4R8IA 1QNKA 1V1PB 5ELOA 5C0XI 1RLFA 3IFWB 1LM0A 3K5OA 5AUIA 2E5LQ 3ONAB 2JEAI 1GAQB 1VQNA 5CBEE 1C4AA 4HR7B 2LVPA 5E6JA 1S72A 1QOGA 4RNAA 5BYRA 3MXGA 1CA5A 3GTOB 4DKAC 3DLLA 2KTFA 2AX5A 3LB8C 3KBXA 1QVCA 4DUYQ 3M85A 3H3VI 3NOBA 2DN8A 1UEBA 4UPAA 5EE1A 1PTOB 1DCZA 2UUAL 1Q0WB 2I46A 1TKYA 1ZDVA 5C3WA 3DBLB 4ALPA 4NXNL 2I1JA 1K50A 1J8CA 4B9WA 3OMCA 2X8XX 1B9RA 1S3OA 4UP7A 2CJNA 2ZVNA 3HFZB 4X57B 5FR3A 3PIO3 5GQOA 4YY3L 1F2MA 2L9HA 5IGFA 2KWUB 3QHTA 1VF5C 3KYCD 2I5LX 2B2UC 1JE4A 2JA5H 2JRHA 4L63B 4IUMB 4CO7A 4M8AA 1XPOA 3OWEB 2EE1A 3DVGY 2A6HC 1RAXA 1DOMA 5EE3A 4A3JH 2JA6B 4AJYB 4DV4L 1J5EQ 2WXPA 1I94Q 2IBIB 3NJTA 1EFWA 3TSSA 4EE2A 2XIWA 2BQQA 2KJXA 3AMZA 3MA2B 2KDIA 3N52A 4MM3A 1SFOH 2F0PA 2JE6I 1ILQA 4KD3A 3NWSA 4CDEC 5M3FH 1GVPA 1JMCA 2NVQH 3HVZA 4KY7A 3SGIA 5AJ3L 1VZ8A 2M1MA 2QC8A 2B2UA 1N8RC 3H7PA 3PGEA 3RNGC 3RZDH 3TL5A 4JI0L 4IPHA 1GPXA 3HOUG 2YTYA 1BBXC 3PIOA 1XNRL 3PQIA 3J80i 1IBKL 3F1ZA 3C2PA 2OEOA 3DWAA 5IGGA 1GHJA 1NTGA 2A1AA 4HRSA 4DK1A 1BCPD 4KKUA 3RT3B 3AE5B 3KVFB 4J6IA 2C5CA 3WOFA 3U4ZA 5K36H 2JPHA 4NJCA 4BOSC 2A73B 4JW0A 3VDZA 2QA4A 3AEBB 2Z0EB 4K3CA 2LEKA 3ALBA 4DV2L 5JPMC 4Y7NB 4RMAA 4WFN3 1TZOA 4P1CC 3NE5B 1XMOQ 3GTGH 3OPOA 1UELA 1Y8RC 4WJOA 5D14A 3OTOL 2B63B 3ZGZA 2YTXA 4A3MG 2K25A 1CZPA 2PJHA 4IOIE 3T51B 5LMUL 4M1UB 1LQBA 5HI1A 3GZNI 3QC8B 3HOUB 5JVG3 4XE0A 1K8AC 3KLSX 3Q8DA 1DOLA 3PHWB 4NAWB 4URKA 1EU4A 1STBA 3S15B 1WX8A 4FBJB 3D4WA 4ZQ3A 2QMTA 3MVVA 4GZYC 3HIZA 4OZBA 1SRUA 3PUWA 3H1UA 2GBMA 3ZJYC 3Q8AA 4TQ1A 1BR9A 2D3BA 4JI1L 2NR2A 2EYOA 4K8JA 2XTIA 4G7ZC 4A93G 1AW7A 3B6YA 4O0AA 3V6EB 5CYUA 1DGJA 3L16A 1P8LA 4A3MB 2KLGA 2YU9B 3M4YA 3HEJA 2QDFA 4ZAIA 4ZUJA 1WWTA 2M8SA 3VR3A 2E2IB 3Q22A 4MACA 1FGBD 3SU8X 3NG0A 1TYGB 3MP9A 2Y5BB 1QOHA 1TWFB 4QIWB 4APVA 2NTSA 1K28A 4QUCA 2GMIC 1SNCA 2N8NA 4LNFA 3CF6E 1B44D 4LFCL 4I6LB 1DJRD 3CKIB 1NY4A 1VLBA 2KA7A 1RFAA 3HHMA 2OOBB 3RYTA 1A8VA 1O78A 2RQXA 2IWHA 4ANUA 1SIJA 2UYZB 3CMMB 1X65A 3AEAB 1HZ5A 4A3KH 2KQ3A 4JPBW 2F4VQ 2N1WA 5G5GA 4NPNA 3KUZA 3VR5A 1DOYA 1F2RC 2BE5D 1HCZA 1YI2A 1XT9B 2OJWA 1VQFA 2EYJA 1PTOF 2WFWA 1BF4A 4LCDE 2RHSB 3WCQA 2NZOA 2IO1B 2L5TA 1L4ZB 1WJJA 2NVUI 1E5WA 1XXGA 5CV8A 4XC2A 4K3BA 1VQCA 3JYUA 1K83B 2LKVA 1W6JA 1VQGA 3T4AC 3M9BA 1MHHE 4HPPA 4LF9Q 1VF7A 4A3CH 2MEKA 1E2VA 1PRTD 2R93G 1T3QA 5G3LD 4A3EG 5CR3A 4DV3Q 2F0EA 3CQZB 5GAGC 3KJPA 3NS1A 4EUTA 1E8ZA 1RKNA 1P7EA 2AWOA 5D7GA 2F0HA 1GXDC 1LTLA 3M3JA 5JEAG 4JV5Q 1EO6A 2XK5A 2ASBA 5IYBG 4YTNB 3SHQA 4W9JA 1I4RA 2K32A 2UXCL 1ZPSA 3J7ZC 2IX1A 2FCNA 3ULLA 2BYFA 3EFUA 3PSIA 2QHOA 3NBHB 3R8BA 2KJRA 3Q0AA 3CCRA 3L0OA 4JI4L 2B2VC 3OJ3A 4ULLA 2K14A 2NBUA 4XX5A 1GM5A 4HMJA 1L1OB 3LJ3A 5JOBA 2WAQE 2ZW0A 3E9HA 1TWHH 5M5YH 4KZ0A 3PO2H 2R93B 5IN7A 4DHJB 1XLOA 4JVZA 1HZCA 1PMRA 1DGSA 1R9TB 2N1VA 4GS3A 2C7HA 2WX0A 4AP4C 1C3TA 1Y56A 4PYZA 2ZM6Q 1QILA 1P1AA 4A20A 3BZKA 2KZRA 2HHHQ 2N7JA 2UU7A 2R2OA 4BKTA 3NWTA 2GBRA 4BXXG 2CCZA 2JA7G 2PI2E 1VD2A 3PSEB 1EIGA 5LNK1 2KEEA 1F0ZA 1PH9A 4CJ1B 3AN1A 1TS4A 3SK5A 3SK6A 5KGUA 4BKSD 1TR5A 4DR2L 4LDTD 1I3QH 1NEKB 1V9JA 2JF5A 3S14B 1MI0A 2INNE 2D10A 4K6DA 4LUOA 2LJ5A 4GB9A 5EDSA 4H7BA 4L1BA 1PGXA 3MTNB 2EOTA 2AWTA 1VRAB 4IFDJ 1LTRD 3RI7C 3ZJVA 4MNOA 4H02A 4DR3L 3AE6B 4JBKA 1B3QA 1FNWA 4NW2A 2F0GA 5IYCG 3PMFA 1M94A 3P63A 5BN5A 4DV7Q 4X3SA 1N34Q 3QK0A 3M4OH 1WCMH 4X65L 3AQQA 3JAMc 3EN2A 4IQZA 3Q3FA 3HUIA 4CBVA 4KK7A 5E3FA 4ANXA 3IAS1 4Q0FA 1M90C 3DBHB 3I55A 1LTID 1F77A 2RF4A 3NQTA 4G7OC 3PLVA 1YNJD 2MBOA 5EE0A 1S5ED 4WWOA 3L4PA 3KW5B 1WGYA 1D6EC 3UQAA 3HK0A 3PV0A 4DN4M 4OZCA 1E24A 3JAML 2NWGA 3MZ5A 3J7AF 1IBMQ 4C00A 3BINA 1WF9A 4ARCA 1WD0A 2LXCA 2KCTA 1VQLA 1FM0D 1PRTC 3DWPA 4J6HA 2OXPA 4FDBA 1KLUD 3TS2A 3R3MA 4NY0A 4PK1A 3TZDA 1Q90A 3VH3B 2Q2IA 3KF6B 1V5OA 1QKZA 4RKLA 2B76B 1TWAH 2AWNA 2Z8LA 1N62A 1OXXK 2KFKA 3CCUA 3I4LA 5TSSA 4C7YA 2Q5WD 2C9OA 1X9NA 4KY5A 4XZ4A 1SJHD 1QVFA 3CSFA 4DR5Q 1K8OA 3AULA 2O5IC 1WTOA 3VRBB 1EYCA 5CTRC 3SFEB 4Q5VA 3H09A 4YSYB 5IKCM 1F9QA 2VQEL 3JC66 1TTNA 2IZVB 2PE6B 1EIYB 4PYUA 2WINB 1YITA 1F2LA 2LUMA 1F2YA 1C4QA 2UUBQ 4A90A 4HROA 2WXMA 1F2ZA 3SXHA 5IA7A 2DZMA 4MT5A 1VQBA 3AEDB 1KM7A 4HIMA 4X3UA 4A55A 2JY6A 3H0GB 3RZOB 2NZ1D 3D3RA 1QCBD 2JRIB 3C0RB 4L2YA 1WTQA 2G1EA 1NI3A 4B3RL 5AZGA 4DR1L 2BBCA 1YMHE 3Q69A 2RR9A 3QJZA 4H0LC 1E22A 2H89B 2KC1A 4IUPA 1VZ6A 2VXWA 5KHQA 4PG3A 2ZPYA 1JROA 5CMDA 4FYDA 1X3QA 4LW1A 1N60A 1IL8A 1QZEA 4B6WA 3VVWB 3DM1A 5C44H 1S5FD 4X64L 3HOXG 4KSKC 2BKRB 2C9WB 4ICUA 5JH5C 4KY6A 3S1QH 3DHGC 1XNQQ 2E2HB 4R9WA 4OXPA 3Q14C 3ERQA 1FO4A 2CQAA 2MUYA 3BU2A 4RH6A 1LV9A 2GVBA 2K5QA 3KLWA 1LFDA 2O6VD 4IW0A 4BKSA 4PZ7A 1LGRA 4JCVE 1OXTA 4HCPB 2BTEA 1C9OA 2UXDL 3F2CA 2XVSA 3GTOH 2NMQA 4X3TA 4XT3B 4C56C 2XEWA 2RPVA 1ILPA 3L0WB 3APCA 2JA5B 1TWCB 1PTOH 2ZPNA 2E74C 2F0LA 5IIFA 3HOXB 1JW9D 1EIHA 4MSQB 1FEHA 1SF0A 1SYEA 1FXIA 4QIWE 1Y1WG 4EFOA 2PMZB 1HZBA 1L7YA 1UD7A 5IP9H 1FCCC 4LNOA 1EYAA 4DAYA 1CQVA 1PTOD 2R7FA 1Q8IA 5LMNL 2ZJRA 4XWWA 4DV6L 3R7QA 2V4DA 3RN2A 2L3ZA 2X6LA 4DNRB 2B2YA 1CUKA 4YCVA 4K0KL 2W55A 5J2RA 1RF2D 4GIVA 1VQEA 1U9RA 3H6NA 1JJGA 3K80C 4O42A 2JA6H 3UINB 1ENFA 1IYFA 4BY7B 2BCOA 3K5LA 2Q2UA 4HCNB 2R7ZB 2KQ7A 1YX5B 3OIQA 4P6VF 4OX9L 2F0UA 5ELFA 4DGZA 3A1QA 3EBEA 4DBGA 1K3BC 1Y1WB 1N36Q 3N32A 5JJKA 3DBSA 1QVGA 4OZAA 1NYQA 1D4BA 5IODA 1JWUD 1MG8A 1YN3A 2K8HA 2M00A 3MFGA 1SROA 2ENBA 2WB1G 3J81c 2F3VA 4MELA 4XQJA 4ZK9B 4BWGB 1D1IA 5KYIA 2LI5A 5L83A 3AE4B 5EBDA 4Y7NH 3AEEB 2GB1A 2JP1A 1LTTD 2KX3A 3P4PB 4DR4L 4J3OD 1QF6A 1WX7A 5IGCA 1VQJA 5FLXc 2BA1A 2NVTB 4JLCA 1JMLA 4G3XB 2B63H 1WJ4A 2LASA 1HTQA 5C0XJ 3HOYB 4DXGA 3J81L 2PVOD 1K8GA 3AE3B 5JZEB 1JRUA 3PHXB 2LSSA 3HOUH 2XRSD 1UWXA 1PYSB 5IP7H 1EQQA 5CX3A 3S15H 4ZDVA 4IALA 2NN6G 4W9KA 3CCQA 4A4IA 1PH7A 1ZOYB 2N7EA 4HDQA 1CTMA 3LNNA 3JSVA 2N9XA 5LXHA 4BY1G 1PFDA 1WM3A 3TEZA 5C4JB 3NTHA 4LF8Q 1ENAA 2LRWA 2KOLA 3W9CB 5C2TB 1EIFA 1UH6A 2I5MX 2PI2A 2LHDA 1YJ9A 4A3MH 1WX9A 2YU9H 3CC4A 3HM3A 1EQRA 4G57A 1KXLA 1AEXA 4GKJQ 1U4LA 3U9OA 4IFDI 5IAAC 1MHWC 2E2IH 1XWEA 4F7XA 5M5WB 2RDGA 1LYLA 1EWCA 2ID0A 1EYDA 4FA6A 4FO2A 3MEFA 1TWFH 4P2CB 3MFYA 3BK1A 2K1BA 1C0AA 3BYYB 2QF7A 1VQPA 1J7AA 1SE3A 2HE7A 2O6VA 2Y3AA 3DPDA 4A3LG 3EVQA 2GA4B 4O2DA 5G55A 4WWPA 2KK8A 2N9KA 2RSNA 1PTOC 4B3SL 1V1PA 2IO0B 2XBBC 1MGSA 3BDLA 5DPTA 1E7PB 2RGFA 3U4EG 2FIFA 1D5XC 4JBMA 4LNKA 1WJ6A 2PZUA 1S5DD 3DCGA 1GB1A 1I35A 1X55A 3RNCC 2F0IA 4WIPA 3NTIA 2LXAA 5I4DA 2HUGA 5AZFA 3K7UC 1JORA 1ASYA 3MXNB 2CKHB 2F0JA 2DNCA 1STYA 3ZVVA 1K83H 2EDGA 2SNSA 4RCNA 3P1HA 2CW0D 4JQWC 4A3PA 2XWJB 4XQQA 4CKCA 2N78A 5C5LA 2WKCA 4II3B 3CCMA 5FOBB 1HA6A 3CQZH 1OQYA 2KC2A 5IP4D 4DNTB 2BVCA 3M4QA 1R4QB 2XRQD 2VNUD 1E7VA 2C5LC 4G0NB 1A62A 1A2UA 3A5UA 1EYGA 3PZ8A 2FCMA 4OHJA 2RMMA 1GKHA 3AEFB 1B53A 1NI2A 3BWUD 3T3OA 3W1YA 1SB3C 4DR6Q 2OQ0A 4LFAQ 3RULA 4WJ4A 3HOZG 5JAVA 4C3HG 3PO3G 3C19A 3T9LA 1EWHA 2VRRB 1PFMA 4OONA 3DQVA 4ICVA 2FHTA 2CHZA 2Z6KA 1IL2A 1AZQA 1C1YB 1N33Q 4HPLB 5C3JB 2OWOA 4L5TA 2Q8IB 1FIQA 2B8FA 5GAEC 2H5XA 4EQOA 1ZEQX 2UU9L 3ZIMA 1LTGD 1HNZQ 2R93H 4LF6Q 4LF4L 4Q2JA 1LT6D 1OEYA 2ASQA 4HKQA 1KABA 4A3BB 3AE1B 4FJYA 1U0LA 1R9TH 1EZ8A 3GS2A 1MKHA 3MEHA 1BNZA 4DDID 4KDLB 2JXXA 4NJ6A 2V9HA 5LXIB 3UDFA 4DK0A 1G6ZA 1WMHB 1W6KA 3BYTB 1FR3A 3VA7A 4WH4A 4DAYB 2DUDA 1Q86C 1YIJA 1ICFB 2G4DB 2LGYA 4DHJD 3PO3B 4KZCA 3AE7B 2KT7A 3MC0B 3A4SC 2IY5B 2PCFB 1QG7A 3CC2A 2MHVA 2LGSA 4BBRB 4DK6C 1TY0A 1Y8PB 1J7BA 3S14H 2KN5A 2DX5B 1ZYRD 2PLPA 1SLJA 2K01A 2A4ZA 5EJWA 1QE6A 3A54A 3R2IA 3I4NB 3I5JC 1KOTA 3QOJA 2PTLA 3AE8B 3E0JA 3NBIA 4E3CA 3HZXA 5M3MG 4E74A 2KD0A 1FL0A 3L10B 4EEWA 1B8AA 3NUHB 4NAMA 4ZRIA 1V9PA 3QX1A 1TU2B 4NB3A 2KMMA 3K57A 4NAWA 2B2WA 1CSQA 2Q8TA 3A8IE 4BXXH 3ETRA 1WD1A 2XGTA 2LGIA 3S16B 2BB5A 4DAVA 1HR0L 2ATWA 2RSOA 4RCOA 5FJ8G 1I4XA 1MBYA 3Q6SA 4GKKQ 1R4MI 3P4QB 1VQAA 5LLIA 1KDAA 4EX5A 2A6HD 5ISRA 1N32L 4AUQC 4ZYSA 4DUZL 1QUQB 3PGZA 4HIOA 1Y8NB 3RNUA 3VTWA 1CSPA 1NYRA 1OFFA 4IJLA 2ES2A 3GB1A 2D3GA 2AQ2B 2FCQA 1PQSA 2PMZE 3GTPB 2RSUA 3T16A 2ZVOA 3I91A 3DOWA 2K22A 1NENB 1KL9A 2TMPA 4DAPA 2CW0C 4ZRZA 5EKLA 2F0WA 4R1JA 1V97A 1Q46A 5ELCA 2O2VB 4DR7L 3K5MA 2FUG1 4FJZA 4HPMB 5FLXE 2LY7A 1TVXA 5CC4A 1H4RA 1U4AA 4EQ5A 1YNTE 5C0XG 4B9XA 3A8KE 2HTHA 3PF5A 2ZCCA 4WJQA 1PZKD 1N61A 4JG2A 4GOCA 1WZ0A 2EXZA 3CMAA 3J7AV 2D0OA 1LT5D 4WRDA 2EY6A 4RGMA 2NPTB 3IXSA 5BMGA 4C3JG 1RTNA 1AWDA 3DBRI 1IYVA 1HNXQ 2G5DA 3SHLA 3T1YQ 3ZUNA 1HEZE 3C1EA 1F9JA 3VUWA 4YSXB 4BA2I 5EBCA 3NVVA 3EECA 3ZNZB 1BOSA 2Q8RE 1FD6A 3PUVA 2WP9B 2JXTA 2HDMA 5IWAL 4K7UA 4KIKB 3H0GH 3RZOH 5C1ZA 4K8IA 1L1OC 3ZKJC 2BDNA 4YCUA 3WALA 3DVNV 2QDLA 2KWVB 4PT5A 2AUKA 5FO9B 2EELA 1NAPA 1GUOA 2PIAA 2VUMB 3NZ3A 5ELNA 3KFUA 3WAOA 2NB0A 4ID6A 5CV9A 4GOPB 2DNFA 2J7ZA 2JSOA 3EFXD 2KX0A 4FXGC 2A68D 5I2XA 3NBHA 1IYUA 1OXVA 4C3JB 3IFTA 3J80c 3G4SA 4MJSB 4A3GG 2XSCA 1IYJB 3H91A 2GBKA 3A8JE 3RMHA 5HGTA 3L7ZC 1MSGA 3URYA 2BF8B 3GE8C 3CP0A 3UF8A 5I9OA 4LJPB 1L1OA 3I2ZA 4DV0L 1ZYRC 3I56A 1T6BX 3ML8A 3FKIG 1V1OA 1Q1OA 2E2HH 1L6VA 4RG1A 1HTOA 1TBEA 1H9KA 3WIMA 1ET6A 1X32A 3UQBA 4IWPA 1SMYC 2CH4A 2ICEC 4TKOB 3J80L 2IW3A 2JA8G 3BZCA 1BDOA 1E1TA 3QWNA 4C3IG 2ZNVC 5D6JB 3OOCA 3VRAB 2EKIA 4RGTA 1A15A 1D3ZA 1F9PA 1IW7C 1FRDA 1GD7A 1U5KA 3K0YA 3GTMB 1ZGUB 3BS1A 3CPFA 3OYYA 3NVYA 2E5LL 1K51A 1FNUA 3PIP3 3I90A 4A3GB 2L0TA 1TWCH 5BMIA 2KVZA 4DV1Q 2D3AA 3HOXH 2KFJA 3N1YC 4ILWA 3M95A 1EL0A 3FKIB 3ER0A 3TEYA 4DUYL 2OHFA 3R93A 5JHBA 2ZXRA 3AU7A 1SNQA 1GJZA 3MHSD 3RNEC 3HRDD 3IHPC 2BDOA 4GLSC 2JA8B 2D5DA 2I5HA 2D62A 3HKZG 2NVYB 4P75A 3DBLI 1PDXA 5CHFA 1XNRQ 1IBLQ 4HCSA 4KV2A 3PTFC 4AIMA 2KN4A 3CCEA 2LS01 1C48A 3ZDMC 4XTCS 4GN4B 1WR1A 3VHTC 1LT4D 2FMCA 4N8FA 3TS0A 1EY8A 4C1NI 2R7ZH 4BY7H 4R4OA 3HVDA 3QIJA 2VH1A 5JVH3 2M4NA 3UDIA 1J5EL 4HLEA 1I94L 2NTTA 1Y1WH 2OF1A 3U30A 4FLHA 2IO2B 1KF6B 3HM6X 2QDBA 2L15A 4DV5L 4HIKA 3X3NA 2RDFA 1DOIA 3DHQA 1VMPA 4RF0A 3IFDA 5C5MA 4OL7A 1CFMA 5CGKA 1AZPA 4BA1I 3CHBD 2ZJPA 3TMEA 4WQMA 1GUSA 1NNXA 2EYHA 3TEWA 1J0GA 4AOFA 4KV6A 3ZLZA 3NHHA 4OEMB 5T1GA 4CKEA 4ITKA 1V80A 2JUOA 3KF6A 5IY0A 1OTRB 1I4QA 4HCEA 3FILA 4JWUC 4M0WB 4JI1Q 4V190 2NVTH 5CV4A 2BWES 4BFRA 5FKAC 1V43A 2Z59B 3OAWA 3FVQA 4NMZA 1LTSD 4N9PA 3HOYH 2ZEQA 3KUCB 2F0SA 4FN2A 5T8IA 1X6OA 1J6QA 2K39A 1Z5SB 1XMOL 5HKHA 2A68C 2PNHA 4TVAB 1XPRA 2Q2TA 1O80A 2X38A 3G7LA 3B08A 2L7RA 1WXVA 1BXTA 2QIEB 1VQ9A 1VCBA 3F2BA 3ZRFA 3MC9A 1XQQA 4AYBG 4K5WA 1ZP0B 3K5NA 3M62B 3A56A 2W3RA 3MXPA 1KQSA 3TDQA 5C4JH 1DXMA 2EYFA 2K5VA 1FJGQ 3VR2A 4KSLC 2KDMA 4OVVA 2N88A 1LXDA 3FAHA 1Z2MA 4L5RC 2K1FA 4RMFA 4XT1B 2L1BA 1SSNA 1YN4A 2L11A 1D5MC 4A93B 1GUWA 4RM9A 5DPSA 5FR6A 4ZOHC 1ET9A 5BR8Q 3ZQ4A 1P7FA 2K5HA 5M5WH 4GDLB 1PH3A 2E76C 1SGHA 1T0YA 4QMGA 3V05A 2BS3B 3AE2B 4HJAA 4IM2A 4HEDA 1GOZA 2DY8A 1T9HA 4Z9CB 4PS8A 2RD0A 4LK1C 1RFKA 4AYBB 1JALA 2KOXA 1CMXB 3OMGA 4JBJA 1JT8A 1JC7A 2IY0B 3LWEA 2EJMA 2VB2X 5HFYA 2F0VA 2HCIA 1M4VA 2PW5A 2ALYB 3B9JA 2J0JA 4M00A 2J52A 3P75A 2K04A 4JI5Q 2LHEA 2EJFC 4RHRA 2LJIA 3G48A 2LFNA 4B3TQ 1VQDA 4JBWA 1VQ6A 1PYBA 2G3QB 3LXFA 3NTKA 1ONLA 4HTHA 1PZID 1WFQA 5JJIA 2F4VL 1RRBA 3F2UA 3GE3C 4IWOA 1B3AA 3CAMA 3S1MB 5IYDG 1F52A 2KHSA 4L5QA 1OTCA 1RWSA 1Q1BA 1XEEA 5DCNA 3BVGA 3OWFA 4A3LH 2MJ3A 1KRTA 4D2KA 3VYRA 3D8GA 2V3SA 1YNXA 3APFA 1V8CA 2BWFA 1X3FA 2K52A 1BBWA 1E10A 4PZ6A 1STAA 2EVBA 4ZRPA 4EKUA 1VDVA 4LF9L 5KEEA 3J7YW 1EWYC 4A3EB 1KFYB 2DWQA 4R8NA 4DXAB 3E56A 4DV3L 3J80E 2KCNA 1IXRA 2DYMA 2WACA 1QOFA 2M19A 3ZTCA 5TR5A 4H44C 4JV5L 2V4IB 2B2VA 2YV5A 1YNNC 4C4VB 1UBQA 1TIFA 4RFBA 2DHZA 1X54A 1ZKOA 5KNDA 4MGIE 3W1SC 4PQXA 1TZ1A 3X0WA 2Z4IA 4PNYA 3JVZX 5CHWA 1J9OA 4NPSA 5IOCA 4DF7A 4M01A 2A69C 4FF3A 4K5XA 4A3FG 1HZ6A 3CW2C 4LUZA 4RF1A 5KNBA 3N30A 1Z9FA 4A3BH 1FVIA 2KMCA 3DWQA 2ZNVB 1JWSD 2K33A 1DYQA 3ITPA 2CR5A 4OWTB 3APDA 3V96A 2HJ8A 2IHEA 5I9PA 4HJ5A 2JWUA 2N49A 3NSWA 4NKLA 3UE1A 3S2DB 3PO3H 4FHKA 3TJPA 5L95C 2WXJA 2ZM6L 4IJHA 3D6CA 3ZDTA 2PQAA 4BBRH 1PDQA 2JA7B 2QEXA 3K6OA 5IT9E 2V1CC 1ASZA 4CYEA 4JI8Q 3VR4A 4KKTA 3EA6A 3FPPA 4H2AA 3AB9A 4IPGA 4A3FB 2OT2A 5A35A 2G4SA 4FHJA 3I4NH 1NBFC 4A3OA 4V0BA 2F0TA 3U50C 4IPDA 5D65A 3WWVA 4US9A 2MCNB 3T1HQ 1I6VC 2XWBB 3KH0A 5DNFA 4JI3L 4A75A 2FMMA 2HTME 3I4MG 5DPWA 2DJFC 4FF4A 3IT4B 2QW7A 3S16H 4K2KA 3TP5A 2LFIA 2KQSA 5C3EG 3C3LA 3QOLA 2BGFA 1C78A 1YZ6A 3QCAA 5IGEA 3B2FA 1KHIA 1BQQT 2WXGA 1WGDA 1PH8A 1FMAD 5CBAE 2NBFA 3CU7A 4DV7L 1JWAD 1EOVA 2BOSA 2BKFA 5H92C 4EVOA 1Q12A 1N34L 5EKKA 4KHPL 1GUNA 3TZUA 3MJWA 3OJ4B 5FO8B 1MJEA 3FILB 2WV6D 3AV8A 5GXGB 3A55A 2F52A 1YHBA 1MFWA 2D11A 1QOAA 4U68A 3RZWC 4RM8A 5KNCA 2V1YA 3IRBA 3TP8A 4ZUIA 3L17A 4RKBA 3GTPH 3FP9A 3DBHI 1G8ZD 2REXA 2KXJA 3I4MB 1PV4A 2VQEQ 1IBXB 4KKIA 2KVMA 2R92G 1YD8U 2BH2A 1I4HA 4RA8A 1NVID 1O7YA 1IBML 1SEBD 5K5PA 1VQ8A 4F7ZA 1V8QA 2B3AA 2R61A 2WQYB 4ANWA 3PCOB 1Q82C 3FHWA 2K28A 4OO1I 2A5HA 3AM9A 3QWZB 4LWCA 1VDZA 3SEBA 3H6MA 1WVLA 4LMQD 1HNWQ 3E3XA 1NMGA 5GAHC 2IPKD 3AECB 3NENA 2EYPA 4P16A 2RVLA 1DONA 2MH7A 3GV6A 3GTKB 4JL9A 4C7ZA 3J81j 5IGBA 1TGZB 3CF5A 3PRPB 3MXNA 4XDXA 4HK2A 4XIGS 2WU5B 2JQOA 3P4RB 4WQOB 4BBSG 2IT1A 1EY0A 3HKZE 3S1NB 2KJHB 2R2QA 3VR6A 2YLMA 5C4XG 1BO0A 5CV6A 4BVUC 5EPLA 4DFAA 3I3CA 2J0KA 3WANA 4RGNA 1QWYA 1HTPA 2HQLA 2JN4A 4OELB 4WJWA 4U673 4HMIA 5C0XH 1K8RB 2MBHA 1KLGD 2PPHA 2UUBL 4DXFA 1N6ZA 4A6QA 3KDFA 2V4LA 3DHIC 1IPGA 1GG3A 2L0FA 5AFWA 1GUGA 1U4PA 4KHVA 2J0TD 3N9YC 5GROA 3RLFA 2VUMH 3W5VB 1RL2A 5BN4A 3K0XA 4JWSC 1W2BA 3PT2B 1JOOA 1JQYD 4C3JH 1YJWA 2IGDA 2C35B 4ZRJA 2K75A 1KNAA 4MN3A 2AQ1B 1L0VB 2EY2A 5L37A 2ICIA 5DLQE 4LF5Q 1WTHA 4BBSB 2D3CA 4JC0A 5C4XB 2CS4A 4P1BC 1CKNB 1EM7A 5MPOA 4A3JG 5KRUA 2GRIA 1NMFA 1HUNA 2E8GA 4YTPB 1Q8KA 3AEVA 4R4QA 5I2YA 1EOTA 4I65A 1SR3A 1AYFA 1UGMA 2JYEA 1CZWA 1PXUA 4N9TA 4QGUA 4L23A 4HJKA 1ISNA 3FRPB 1GC7A 1VCIA 3MXUA 3PUZA 2L0CA 3GTMH 2EQSA 5JJZA 1WMHA 4QB4A 3IAM1 1FCLA 2K8CA 2K4KA 2NUCA 5LL6S 4EZKA 1HR0W 2A5UA 2LUEA 2WXOA 2WP8J 4A3GH 3VYSA 2B2TC 3HS0C 2L1AA 2MO1A 1H95A 1I4GA 1F2RI 1HZAA 3T56B 3ICEA 5E6PA 3Q2AC 3FKIH 3BIID 5K36G 2EPBA 3RNFC 3DDCB 4DNIA 5I6YA 2Z0SA 1WGHA 4B95A 4KD4A 2WKDA 3L54A 4MIUA 1V86A 4W9LA 3VH4B 1EZ6A 2H1EA 4AYBE 2JA8H 2BH8A 2IGHA 2B29A 2NVYH 4NXMQ 2B2TA 2WLBA 1Y1VG 2EJGC 1KH0A 2AMCB 3CCJA 2D9UA 3N1XC 1E90A 2F0KA 4N59A 3D31A 4B3MQ 2I1KA 2MP2B 3OW7A 1XCQL 3BZDB 4MHEA 2JYTA 2PQAB 4EQNA 3LYYA 2WYQA 2DAJA 3EUB2 2AYOB 3CCLA 1QUQA 2FXQA 1YEZA 4IFDG 1EY5A 2SAKA 4RAUC 1HQRD 3SR1A 1WRIA 1KRSA 4NZLB 2XN9C 4JI6Q 3G6EA 2L05A 1XO3A 2JEBI 1Y1VB 5FK9C 3DWMA 1N36L 3V61A 4A8XC 1QZGA 3A9JB 2KACA 2MBBB 2RPQA 5J3BA 3VTVA 2YTVA 2WB1B 2LMCB 3F2DA 5AEKB 2O2VA 4IUUA 4ZYNA 3EGRA 3KUDB 1G6JA 3V2TA 4X62Q 5FLXL 3GOEA 2KVRA 5D2MB 1E0ZA 4IN3A 3NS8A 4IM0A 2K5WA 4X66Q 3K58A 4GN3B 4JX1C 2DYOA 1Y69U 3QAQA 2PNRC 5HGQA 2NPTA 3B2GA 3M4PA 1HPCA 2PZWA 2Y0SG 3P4SB 4A3KG 1CA6A 3EFCA 3RN5A 4JYAL 2R3ZA 4C1NK 4GLXA 3RUIB 1XJVA 4CJ0B 4F8MA 3P2BA 4GDKB 3A7AB 4XWTA 4GOPC 2MW5A 2F0QA 4K2LA 3S17B 1SE9A 2N9PC 3H3VC 2RCFA 2DZJA 3P42A 4PS3A 1FGUA 1X3PA 4KIKA 1YN5A 4RGOS 2JZ3B 2ZTDA 3SE0A 3HGBA 1FNVA 3QQ8B 1JCKB 3S2HB 4BY1B 4GNXC 4A3CG 4DDGD 5J22A 4A93H 1RDPD 1VQHA 4LF8L 2GBJA 2HD5B 3N3KB 5M9OA 1ZXIA 1I42A 1PYWD 3I3TB 4GOPA 2MRPA 3ZRCA 4ODGA 3TEHB 1XD3B 4W9DA 4MJSA 5GADC 2Y0SB 1VJKA 2IY1B 1WYWB 3QIAA 4FVMA 4GKJL 3J81i 2KANA 3U4VA 3ENEA 2E2DC 2YEPB 5IE8A 1SAPA 4I6PA 3A9KA 4OIJA 1IUEA 2IJ0A 2X69A 4F88A 2UUCL 1G6PA 2V3PA 2INPE 3A4RA 2IX3A 2MPMA 2LXJA 1E6EB 5J18A 3TP7A 1L6UA 2CVRA 1BUIC 1CI3M 1DOXA 3CCSA 2OCEA 4HEA1 2F0MA 1BMLC 3L08A 2UWQA 1RIPA 1W3SA 2VW9A 1XYIA 1SBBB 2MSED 3KDFB 4ZKBB 4AWJA 3EHVA 1X3EA 3TN2A 3P1MA 2Z9HA 3GV3A 1OEYJ 1Y8OB 3PZ7A 2ZJDA 1JRPA 2HCCA 3S1MH 1XCTL 3HKSA 1FFUA 1AN8A 1O7LA 5FLMG 1JWBD 1E7UA 1Z6HA 3RMKC 2IL8A 5ELEA 2PZTA 5J17A 3MTSA 4MZ9A 3BY4B 1WM2A 2MBEA 3S1RB 2LZ6A 3ECIA 4ABNA 4W9HA 2VQFQ 3TBLD 4A3EH 1QNUA 2JT4B 1VQIA 3U7DA 2J4XA 1EF5A 1HA5A 4WURA 1SYBA 1MJCA 4POFA 4C2MB 1A70A 4KJNA 5JEAH 3ND9A 2KCMA 5IYBH 2ON8A 4EQPA 4AQYQ 4ZRQA 2OQKA 4ZCKA 1YBYA 4RHSA 3NY5A 4JI7Q 3Q8CA 4LFBQ 2GBNA 1TKEA 5BMHA 3K7AB 3HOZB 1J19A 4C3HB 1L0XB 4LFAL 1ROEA 4UAIA 4TUUA 3KQ4A 2UXBQ 3QR8A 1KRHA 4LF7L 2KEDA 3ERSX 1WCMG 1N33L 1R4NI 1R7SA 4KGRA 2MWSB 1JJ2A 3GP7A 2M0XA 2RDBC 1HNZL 1ZXHA 3Q3JA 4LF6L 1D7QA 5COYA 1D2BA 1HH2P 2K3UA 3C1FA 2BA0A 5IO9A 2F1MA 3UIPB 4TQ0A 1SMYD 2QCPX 3S2DH 3M7NA 3IG3A 3KLRA 3AXCA 1SNDA 2GI9A 4K81A 3WA0A 2QEJC 4YXDB 3I8ZA 4JI2Q 4IDIA 2JA7H 1IW7D 3ZXVA 3Q3MC 1R4MB 3LWUA 4CJ2C 2N0SB 4M0WA 4KTAA 2W9NA 1VMCA 4M8MA 3AMUA 4JE3B 3IAYA 4A3FH 2ONQA 2MA9B 3ZNID 3U8ZA 2E3TA 3K81C 2O2LD 1BT0A 4HKZE 2KECA 2SOBA 1B7YB 2ZW1A 3H94A 4EOYA 2FAZA 4NJ7A 3SR6A 2N9EB 5M3MB 1SNPA 4P73A 2GOWA 2RCNA 1WE7A 2SNMA 5IYCH 1XTCD 3WAMA 1WY8A 1WRDB 1L4DB 3EC8A 1U4RA 4YWMA 4DAMA 2V3NA 4B0EA 2F4IA 2JX5A 1ESRA 4OWXB 1L2FA 1E8WA 4FP5D 4A3DG 2NCNA 4WJ3M 2LVQA 2KHWB 2WGSA 3L13A 4B9KA 3K8AA 1SYGA 1DOKA 1GUTA 1SYDA 3PRMB 1HTLD 2PW7A 4YHHQ 1I6HB 3QB3A 1G2SA 3VA5A 1SYCA 1YX6B 4QAYA 4GDLA 4DQOC 3LGJA 4JK1C 3DBRB 3KK7A 3MC8A 1RD9D 3Q3NC 1R4PB 3I4MH 5C23A 2YEPF 2XNAC 4IUVA 1LACA 1NSNS 2CWPA 5DM63 1FRRA 2L76A 1UE5A 4OW0A 3VYUA 1VZ7A 1D5ZC 4YIJA 5C44G 3J7A5 2MHJA 2D2CC 1XMQQ 1UZXB 4A3DB 1HZ9A 1YJNA 1TJEA 2ZCBA 3F8TA 3I7FA 1H9JA 1D1KA 3O65B 4NP5A 2CJOA 2KQ4X 3ZJUA 2EYMA 2DYBA 4IOAA 3B0AA 5T1IA 2ZTCA 3TQYA 3UDXA 1ML0D 2F03A 3FEWX 1UNSA 3GTKH 2IO3B 4WJPA 2KYWA 2WDTB 2KBNA 1TXYA 2I07B 4J15A 3KUPA 3CIRB 4K7WA 3NZSA 2V0GA 3S1NH 4AS1A 5A2QE 2DZIA 4N58A 2HDLA 2B3GA 4YWGG 4GMVA 4DK5A 1HNXL 3VDYA 2A19A 4G4KA 5ELBA 4Y52H 2WU2B 1M1KC 2UUAQ 1AE3A 4GNXB 1OGWA 2A6EC 2WB1E 1SE4A 1HFGA 1OQRA 2MLBA 3A9KB 3W1BA 1WI0A 4NXNQ 3GO5A 1EU3A 3KYDD 2CHBD 2PVGC 3AI5A 5IP9G 1P16A 2JSVX 3SK8A 3BDOA 4H13C 4YY3Q 1O7ZA 2PE9A 2C7NB 1YJ1A 2VZAA 4C4VA 1EY7A 3HP3A 4BS9A 5C4ZA 3GTLB 3K9OB 4HWIB 3MAQA 2FJ2A 3PUYA 4CQNA 1I5FA 2MNAA 4A3IG 4BBSH 4LLGM 2VL6A 5C4XH 2NS5A 2NVXB 3UE0A 1H9SB 4DV4Q 2JA6G 4BBNC 4OVZA 3IT6B 3CRLC 2VY3A 2OEDA 4TV3A 1SNMA 1G291 3Q8FA 4CKBA 4LK0M 1C7YA 4ZRKA 5IT9c 2N3SA 1SNOA 3ZXRA 5AJ3Q 1WYDA 3X23A 4IOCA 3H15A 2MJ8A 1RHPA 4B08A 2CH4W 4JI0Q 1QLBB 4XQNA 4KVGB 4C3IB 1RODA 1AE2A 4GGQA 3VXWA 1IBKQ 3S2AA 4YTMB 1PH1A 4ZHPA 2HQEA 2JU6X 3SD5A 1L5PA 1E0BA 1A6XA 4A3IB 5IT9L 5D3IB 3PIPA 1XPUA 1YQ4B 5H8YE 2Y0SE 1TKWB 2PYKA 3E9IA 3ULJA 3UIOB 1DZ1A 4DV2Q 4DV1L 2O5JC 1IGCA 2VH2A 3RFZB 1NR4A 3OW2A 2SDFA 5E4XA 1I4PA 4DU9A 5GMVA 1H8CA 1EF1A 2JZZA 1JICA 3OTOQ 4DV5Q 3KOJA 3GZNB 2B63G 2MJEA 1EEFD 3DM3A 3PZDA 3PV1A 5LMUQ 3RNAC 1TS2A 5EGTA 3MHBA 2PKOA 4N6EB 4KGSA 3HKZB 1EFID 4IUTA 3EJIA 1V6EA 5DEHA 5IP7G 1IBLL 1V1QA 2I38A 4YWLA 2K8BA 1ZDXA 5KYLA 2MQHA 3RLNA 1EY9A 1WTXA 2AL6A 1X56A 4K6LA 4ASWC 1UGJA 1DD2A 1DM0B 2E2JH 5J1ZA 3L2PA 1YNND 2RKSA 1C9FA 3VYTA 4REZA 3UI3A 2AL3A 3AU5A 2N4FA 3VUYA 4RWSC 1LO5D 2EMTA 1YHAA 2FCSA 2MJDA 1B70B 2A69D 2LGXA 2WDRB 3CPWA 1Y1VH 1B4OA 2AQ3B 1ZE3D 1CHQD 1C76A 2KENA 1IBXA 2Q2HA 3ZYYX 3GTJB 3C46A 1PGAA 3PS6A 1TWGB 4IZ8A 5M5XB 4K5VA 1GB4A 4HDOA 1WIAA 1S5BD 2J53A 3GD7A 2WWZA 1ZXTA 2DY7A 3AYHB 4LFCQ 1I50B 3P7JA 1LTBD 3FDTA 3RUZA 1WYGA 4EZJA 1WOCA 3A7LA 4KLKA 4HJ7A 1CT1D 1VQ4A 4XXEA 3U7ZA 3PO0A 4IFDH 3IVFA 2J42A 1CM9A 1N9WA 2KCCA 5FO7B 1K52A 1WXQA 2VS1A 3LX0A 4NNJB 4US8A 2CHWA 2JVCA 5EPJA 3DUZA 1L0YB 1JQ4A 3J9CA 4KKSA 3D0FA 4UDUC 1EQTA 4LNNA 2NBWB 3EROA 3S17H 1UE7A 3HOWG 1ENCA 2NN6H 1Q5WB 1BBUA 1G91A 2KTRB 2ZT9C 2HT1A 3C8YA 1G2TA 2MX2A 2D0PA 1WGRA 1WXMA 3S2HH 1L0WA 4BY1H 2NYZD 1WH3A 1PH2A 2E75C 1FJGL 2IDYA 5KIXA 5LMNW 2BS2B 3BJUA 4LJOB 4LNQA 1QOBA 3U52E 3CMEA 2UXCQ 1FYCA 2SEBD 4MH0E 3DMUA 4HN7A 3H9DA 4FXCA 1A5RA 5E4WC 4GN1A 5AUKA 5BR8L 4N9F4 1STHA 1WI5A 1KDCA 2WHIA 3AE9B 1GC6A 2VZKB 3PPAA 4M8NA 4JI4Q 3E5SA 1PFBA 3HOWB 1CKNA 1ESFA 2O4XA 3QG1A 3VTUA 2IYDB 3WOEA 4TSSA 2KWCA 1K0SA 4XYQA 1MI2A 4NQKE 3VUXA 4YWKA 3W2DA 1WTPA 2TSSA 3AFPA 4UP8A 5DPRA 1ZW7A 1K3RA 1QB5D 1B2TA 4MTKA 1FXAA 1XLNA 3TUOA 2A8VA 3HRZC 3KF8B 5JJLA 3M3YB 1BKBA 4MDKE 3VR9B 3ZO5B 1T5EA 1J7CA 1N5WA 1T5XD 4JI5L 1F1HA 5D3DA 1RTOA 1BCPC 4B3TL 1MJDA 2EKEC 1Q3LA 2F0OA 4NDXA 2AUJD 3DXJC 1V5TA 3GQBA 2N55A 1SJED 2LVOA 1K0RA 5E7NA 1K9MC 2KHIA 2CKZB 2F3IA 4IPCA 1H9RA 3S1RH 3TMPB 1ICWA 4DR2Q 2KDFB 2MFIA 4BKGA 2KDBA 3D4RA 3NELA 1GHKA 2INCC 3CC7A 1S1QB 4GXBA 3AFQA 4P74A 3LDZE 2LD9A 1YVCA 4MGYE 4C2MH 2WDQB 1PFSA 4GLVB 3H8HA 5LHY1 2OTJA 5H1SE 3RLOA 4I6NB 5G2NA 1EUVB 1IHZA 3I70A 4DR3Q 1EY6A 3NXWA 3HOVG 1UWMA 2WXNA 1PH6A 3W1SA 4YCWA 3DEPA 4IM3A 4KJOA 3K7AH 1HUMA 5FLMH 3HOZH 4C3HH 2MP2A 4FXDA 4QJFA 4QCLA 2L55A 2EIFA 2G9DA 3A5ZB 2K5DA 4EGVA 2WX1A 5EE9A 4X65Q 2HHHL 3ULPA 4B0MA 3BVMA 2Z1CA 3Q8EA 2Y5PA 2K50A 3G6JB 5C4HA 2WXKA 4J8QA 1HFNA 2DJGC 3NHEB 1WSPA 1LTAD 1EUJA 3BVZA 2CQOA 2PO4A 4F8CB 5CV5A 4X6AH 4BZAA 1Q81C 1KIXA 4W9EA 3W5OA 4MM3B 1D8LA 4JI3Q 2L52A 3A9JA 3MHZA 4MGZE 4YL8A 4KHZA 3N1ZC 5D94A 3HOVB 2LMCA 4ZKCB 3CXCA 2HDEA 2M2LA 3H7PB 3I9V1 3N20C 4ME5A 3GTQB 2ZTEA 4R4CA 4KMUC 4OO1G 1MHXA 3TIXA 1K73C 1T0QC 4DA2A 4A9AA 1E2ZA 2H4OA 3W1GA 4KHPQ 3FMCA 4GSWA 3D32A 4CDCC 4WJNA 3ZW3A 1P9DU 1YHQA 4JI8L 1E3PA 4OVUA 2G9HD 3R3OA 5HURA 2I0QA 1YOVB 4YT0B 3X3MA 4JOIC 3JW0X 3OG5A 2AKWB 3ONSA 4PV1C 5M3MH 1STNA 1M8AA 2BE5C 4GDKA 1WTRA 2IGGA 1NBWA 3T1HL 1RM6C 5CHVC 3Q8BA 2QGQA 2QJLA 1Q1EA 2F0FA 2FE8A 1AH9A 1WR6E 1MSHA 2CFMA 4QQBX 3A33B 4TMAB 2DLBA 2J0MA 3DWGC 4FF2A 2HIXA 1TT5B 5C3EB 2BYEA 2H88B 2GVAA 1TS5A 2FBWB 1TT2A 2KO3A 2LRUA 4K7SA 4JOIA 5FJ8H 2CHXA 4WAFA 2N7DA 3A74A 5HY6A 1MPEA 3DVGX 3H0GG 4BAXA 3I4OA 1I6HH 5E6OA 4GN5A 4J1MA 4FXKC 1JB7A 1A3UA 4PMBA 2L00B 1JE5A 3I73A 4B3RQ 4DR1Q 2GN5A 1TIID 2WXIA 2VB3X 1PA6A 2G45B 2K03A 1P0RA 4P7IA 1A3TA 2PEAA 3HG9A 2BW2A 2IHFA 1UE6A 3STBD 1TY2A 4DWFA 1N5XA 4DR5L 2K6DB 1VQKA 3V3XA 1E2WA 2AHOB 5CV7A 3A0JA 4X64Q 2EZVA 4AH6A 4L5SA 2R92B 3UGBB 3CCVA 3SK4A 2BS4B 4A3DH 1XLQA 2K6AA 3JAMi 4XYCA 2JWZA 3MJ5A 3NVWA 1VS0A 3TEXA 3FPUB 1BVSA 2MP1A 1IKMA 2M56B 4JPSA 4YSZB 4MSMB 2Z6BA 3VFKA 1J8IA 4I7ZC 2ZZPB 3VQIA 3RD4A 2QKIC 1HNWL 3R66C 2R7DA 2OTLA 2WDVB 1SE2A 5DAUA 1LABA 2RBMA 2UXDQ 1V81A 3NK9A 1X3GA 4LNIA 2INDC 3H3VH 1NDDA 2YVCA 1WXAA 1HQMC 4QY7A 4CDFC 1SIFA 2JA5G 3U9SA 3EIVA 2MGSA 1E9MA 1E1OA 1TQOA 3WDNA 5BN3A 3GDEA 4HAEA 1ZUD2 1VQ5A 1S3SG 2WXHA 4HVBA 2M0AA 4PZ8A 4LAAA 4DHZB 3ND8A 3ML9A 1C4PA 1KD1C 5EKIA 1XNQL 5LMNQ 5M3FG 1PH5A 2DAFA 1A2TA 1LLRD 4DV6Q 1PHJA 4BBNF 1Z47A 4QL5A 3GTLH 1NR2A 2J7QB 1C8CA 3AB5A 4K0KQ 2RDHA 3NQIA 1FD7D 2XK5B 2WIIB 1K8MA 1P98A 4UHVA 4ME3A 2NVXH 1JJCB 3CD6A 2WS3B 1XF5L 4AJWA 2JA9A 2KJ6A 1NJIC 4BY7G 4CDDC 4XDCA 2R7ZG 4LF5L 2DENB 2B2YC 1B9NA 4OX9Q 1JB3A 4A3JB 4XGAB 2BPSA 2F0NA 3AH7A 3PVLA 1ACCA 4ARIA 1YNJC 5F2DA 2HIVA 5BO4B 4R3DA 1CHPD 2YYZA 1SFOB 4C3IH 4K1RB 4P71A 5M3FB 1BCPB 2NVQB 1Y14B 2DGYA 1WE6A 3AU4A 3IL8A 1BUVT 2K5PA 4NQLB 4IURA 3RZDB 4PMWA 2I2YA 4CHTB 2ZXOA 1PGBA 4A3IH 2EY5A 3SDLC 2WXRA 1X1MA 1KDBA 2CU3A 1PH4A
chains in the Genus database with same CATH topology
1RJTA 2L4NA 3R2TA 1PZJD 1SSOA 2E2JB 1PFNA 2L83A 2WXQA 4E6IA 4S3SA 3GTGB 2IX0A 3Q23A 1STEA 4OIKA 4LTUA 1S4ZA 2K7VA 2F3WA 4TQUS 3QJYA 3OSOA 3S9WA 1HHVA 2DBYA 1JR0D 3CWIA 3OHXC 2Y5CA 1K53A 2R6GA 2RA4A 3CRKC 3KWVA 3N6RA 1OO9B 3JAME 5LL6X 1UUPA 2EYLA 1FFVA 4IKGA 5CORA 1RYJA 1CQFA 4PMCA 1KTKA 4WORA 5J39A 3DEOA 4HSVA 3MWYW 4X3KA 1EEID 3QO2A 4HJGE 1B9MA 3T13A 1UAPA 2FFKB 4QF4A 3P20A 4G7HC 2JZPA 3KBGA 4A3KB 4QUFA 1C4CA 5A2QL 3BK2A 1MVKA 3BG3A 4CGYB 5NUCA 1PRTB 1JOQA 1IKLA 4WWMA 2W82A 2JQRB 4KX6B 1TKGA 2NN6I 3ABVB 3L3OC 1MD2D 2ZXPA 1SYFA 5JXVA 4AQ7A 3W3AA 3AEGB 3U2SC 3NRZA 1TS3A 1EY4A 1H9SA 4KN4C 2BT6A 2JXMB 1WTWA 1VR9A 1AP0A 2B8GA 1A3VA 1NUCA 3T53B 5G5HA 1HXYD 1BCPF 2VZKD 3BDCA 2K0PA 3SVMA 1TWHB 5EQ0A 5DM73 5M5YB 3PO2B 2W54A 4LJZC 1II3A 4OGQC 1I7HA 2X6GA 5I6WA 3O13A 1CZGA 2DNEA 3L9AX 3NP8A 2ACZB 2QSDA 4IUQA 3W5UB 2PW9A 1STGA 1SXTA 2KUMA 2F0DA 3EQLC 2BB6A 1OQQA 1HRJA 1I3QB 4K14A 2A6ED 4KI0A 2KAJA 3I57A 2PQEA 1EQVA 4C80A 1B50A 1WTVA 5ELDA 2M9VA 3KLSA 4IUNA 4XYOA 3TBIB 4FNFA 1C79A 1KAAA 5EPKA 1C77A 1F9RA 1QJOA 2B2WC 3IKJA 1Q10A 2WXFA 4XDDA 3M4OB 1WCMB 1PUTA 3ZJTA 1NCVA 2D5GA 2QILA 1B1ZA 1LT3D 3Q24A 4L8JA 5C6AA 4KN7C 5BYQA 3NPPA 5E1FA 2L12A 1QQRA 3OIPA 3NUCA 1YJJA 4MH8A 3UI2A 1XLPA 1OXSC 3SFDB 4TRDA 5HHDG 2A74C 3D4DA 1YJIA 4KGTA 1AFPA 4L6TB 1TWAB 2WNMA 1RCVD 2E6XA 3FC4A 3VR8B 1PRTF 3J81E 5G3LF 3KWLA 2BYTA 2N9LA 1OXUA 1H9MA 1SDFA 2L32A 4OO1H 3RPFC 3PUXA 2WAQB 5C3XA 5BYSA 1S5CD 2KWDA 2B39A 1JOKA 4FF1A 4O1NA 4ZLTF 3SDZA 3I72A 1PLFA 2WXLA 2JYOA 3D6WA 1IGDA 3E9SA 2FINB 1XX8A 1GJXA 3T3NA 4HSPA 2K9XA 2PMVA 5IGDA 2W3SA 5JEAJ 2EY1A 5JPNC 1UEAB 3NVZA 4F87A 4KKJA 3M7GA 1YQ3B 3K59A 2PPBC 1N63A 1U4MA 1JWMD 1F9SA 5C44B 1CK1A 3KF8A 1Z7TA 2Z4HA 4USAA 3E6ZX 3S1QB 1CJEA 1KNEA 1WGKA 2K05A 1QT9A 3TP6A 4R8IA 1QNKA 1V1PB 5C0XI 3K5OA 5AUIA 3ONAB 2JEAI 1GAQB 5CBEE 1C4AA 4HR7B 5E6JA 1QOGA 4RNAA 5BYRA 3MXGA 1CA5A 3GTOB 2AX5A 3LB8C 3KBXA 3M85A 5EE1A 2DN8A 1PTOB 1DCZA 2I46A 1TKYA 1ZDVA 5C3WA 1K50A 4B9WA 3OMCA 1B9RA 2CJNA 5FR3A 3PIO3 1F2MA 2L9HA 5IGFA 1VF5C 2B2UC 1JE4A 4L63B 4M8AA 3OWEB 2EE1A 2A6HC 1DOMA 5EE3A 2JA6B 2WXPA 3TSSA 4EE2A 2XIWA 2KJXA 3AMZA 3MA2B 3N52A 2F0PA 2JE6I 1ILQA 4KD3A 3NWSA 3HVZA 4KY7A 1VZ8A 2B2UA 1GPXA 1BBXC 1DGJA 3C2PA 2OEOA 3DWAA 5IGGA 1GHJA 4HRSA 4DK1A 1BCPD 4KKUA 3AE5B 2C5CA 3WOFA 5K36H 4NJCA 2A73B 3AEBB 2LEKA 5JPMC 4Y7NB 4WFN3 1TZOA 3NE5B 3OPOA 5D14A 2B63B 3ZGZA 1CZPA 4IOIE 3T51B 4M1UB 5HI1A 3HOUB 5JVG3 4XE0A 3KLSX 1DOLA 4NAWB 1EU4A 1STBA 3S15B 3D4WA 4ZQ3A 2QMTA 3MVVA 4GZYC 4OZBA 3PUWA 3Q8AA 4TQ1A 1BR9A 2EYOA 4K8JA 4G7ZC 1AW7A 5CYUA 4A3MB 2YU9B 3M4YA 3HEJA 4ZAIA 4ZUJA 1WWTA 3VR3A 2E2IB 3Q22A 4MACA 1FGBD 1TYGB 3MP9A 1QOHA 1TWFB 4QIWB 2NTSA 4QUCA 1SNCA 1B44D 1DJRD 3CKIB 1VLBA 2KA7A 1O78A 2RQXA 2IWHA 1SIJA 3AEAB 1HZ5A 2KQ3A 5G5GA 3VR5A 1DOYA 1F2RC 2BE5D 1HCZA 2EYJA 1PTOF 1BF4A 3WCQA 2L5TA 1L4ZB 1XXGA 5CV8A 3T4AC 1K83B 1W6JA 2LKVA 1MHHE 1VF7A 2MEKA 1E2VA 1PRTD 1T3QA 5G3LD 5CR3A 3NS1A 2F0EA 3CQZB 1RKNA 1P7EA 2AWOA 5D7GA 2F0HA 1GXDC 5JEAG 4YTNB 1I4RA 2K32A 1ZPSA 2IX1A 3R8BA 3Q0AA 2B2VC 4ULLA 4HMJA 5JOBA 2ZW0A 2R93B 1XLOA 1PMRA 1R9TB 1Y56A 1QILA 4ZHOA 2N7JA 3NWTA 1EIGA 5LNK1 2KEEA 1F0ZA 4CJ1B 3AN1A 1TS4A 3SK5A 3SK6A 5KGUA 1TR5A 1NEKB 3S14B 1MI0A 2INNE 4K6DA 4H7BA 4L1BA 1PGXA 2EOTA 1VRAB 4IFDJ 1LTRD 3ZJVA 3AE6B 1FNWA 4NW2A 2F0GA 3PMFA 3P63A 5BN5A 4X3SA 4IQZA 3HUIA 4CBVA 4KK7A 5E3FA 3IAS1 4Q0FA 1LTID 1F77A 3NQTA 4G7OC 1YNJD 5EE0A 1S5ED 3L4PA 1D6EC 3PV0A 4DN4M 4OZCA 3JAML 2NWGA 3MZ5A 3J7AF 4ARCA 1WD0A 1FM0D 1PRTC 3DWPA 4J6HA 2OXPA 1KLUD 3TZDA 1Q90A 1QKZA 4RKLA 2B76B 2AWNA 2Z8LA 1N62A 1OXXK 3I4LA 5TSSA 4C7YA 2Q5WD 2C9OA 4KY5A 1SJHD 1K8OA 2O5IC 1WTOA 3VRBB 1EYCA 3SFEB 4Q5VA 3H09A 4YSYB 1F9QA 2WINB 1F2LA 2LUMA 1F2YA 1C4QA 4A90A 4HROA 2WXMA 1F2ZA 3SXHA 4MT5A 3AEDB 4X3UA 4A55A 3H0GB 3RZOB 2NZ1D 3D3RA 1QCBD 4L2YA 1WTQA 2G1EA 1NI3A 2BBCA 1YMHE 3Q69A 4H0LC 2H89B 4IUPA 1VZ6A 2VXWA 1JROA 5CMDA 4FYDA 1X3QA 1N60A 1IL8A 3DM1A 1S5FD 4KY6A 2E2HB 4R9WA 3ERQA 1FO4A 2CQAA 2MUYA 4RH6A 1LV9A 2K5QA 1OXTA 2BTEA 2XVSA 2NMQA 4X3TA 4XT3B 4C56C 2RPVA 1ILPA 2JA5B 1TWCB 1PTOH 2E74C 2F0LA 5IIFA 3HOXB 1JW9D 1EIHA 1FEHA 1SF0A 1SYEA 1FXIA 2PMZB 1FCCC 1EYAA 4DAYA 1CQVA 1PTOD 1Q8IA 4XWWA 2V4DA 2X6LA 4DNRB 2B2YA 2W55A 1RF2D 1U9RA 4O42A 1ENFA 4BY7B 2BCOA 3K5LA 2R7ZB 3OIQA 4P6VF 2F0UA 5ELFA 4DGZA 1Y1WB 4OZAA 1NYQA 1D4BA 5IODA 1JWUD 1YN3A 2M00A 3MFGA 2ENBA 2F3VA 4XQJA 4ZK9B 4BWGB 1D1IA 5KYIA 3AE4B 5EBDA 3AEEB 2GB1A 2JP1A 1LTTD 3P4PB 4J3OD 1QF6A 5IGCA 2NVTB 2BA1A 1JMLA 5C0XJ 3HOYB 4DXGA 3J81L 2PVOD 3AE3B 2XRSD 1UWXA 4IALA 2NN6G 1ZOYB 1CTMA 3LNNA 1PFDA 3TEZA 5C4JB 3NTHA 1ENAA 2KOLA 3W9CB 5C2TB 2LHDA 4G57A 1AEXA 1U4LA 3U9OA 4IFDI 1XWEA 4F7XA 5M5WB 2RDGA 1EWCA 2ID0A 1EYDA 4FO2A 4P2CB 3MFYA 3BK1A 2K1BA 3BYYB 2QF7A 1J7AA 2Y3AA 1SE3A 3EVQA 2GA4B 2N9KA 2RSNA 1PTOC 1V1PA 1MGSA 3BDLA 1E7PB 3U4EG 1D5XC 2PZUA 1S5DD 1GB1A 2F0IA 4WIPA 3NTIA 5I4DA 2HUGA 1JORA 2F0JA 2DNCA 1STYA 2SNSA 2EDGA 4RCNA 3P1HA 2CW0D 2XWJB 4XQQA 4CKCA 5C5LA 2WKCA 5FOBB 1HA6A 4DNTB 1R4QB 2XRQD 2VNUD 1A2UA 3PZ8A 4OHJA 2RMMA 3AEFB 3BWUD 1B53A 3T3OA 1SB3C 5JAVA 4C3HG 1EWHA 1PFMA 2FHTA 5C3JB 1AZQA 2Q8IB 1FIQA 2B8FA 4EQOA 1ZEQX 1LTGD 4Q2JA 1LT6D 4HKQA 1KABA 4A3BB 3AE1B 1EZ8A 3GS2A 3MEHA 1BNZA 4DK0A 1G6ZA 1W6KA 3BYTB 1FR3A 3VA7A 4WH4A 3PO3B 3AE7B 3MC0B 2PCFB 1QG7A 2MHVA 4BBRB 1TY0A 1Y8PB 1J7BA 1ZYRD 2PLPA 2K01A 5EJWA 1QE6A 3A54A 3R2IA 3I4NB 3QOJA 2PTLA 3AE8B 3E0JA 3NBIA 3HZXA 3NUHB 4NAMA 1TU2B 2KMMA 3K57A 2B2WA 2Q8TA 3A8IE 3ETRA 1WD1A 2LGIA 3S16B 2BB5A 4DAVA 2RSOA 4RCOA 1I4XA 1MBYA 3Q6SA 3P4QB 1KDAA 2A6HD 5ISRA 4ZYSA 1Y8NB 1NYRA 1OFFA 3GB1A 2AQ2B 3GTPB 3T16A 3I91A 2K22A 1NENB 2TMPA 4DAPA 2CW0C 4ZRZA 5EKLA 2F0WA 1V97A 5ELCA 3K5MA 2FUG1 5FLXE 2LY7A 1TVXA 5CC4A 1YNTE 5C0XG 4B9XA 3A8KE 1PZKD 1N61A 2EXZA 3J7AV 4WRDA 1LT5D 2EY6A 4RGMA 3IXSA 5BMGA 4C3JG 1RTNA 1AWDA 1IYVA 3SHLA 1HEZE 3C1EA 4YSXB 4BA2I 5EBCA 3NVVA 1BOSA 2Q8RE 1FD6A 3PUVA 2WP9B 2JXTA 2HDMA 4K8IA 2BDNA 4PT5A 2AUKA 5FO9B 2EELA 1NAPA 1GUOA 2PIAA 2VUMB 3NZ3A 2NB0A 4ID6A 5CV9A 2J7ZA 2JSOA 3EFXD 4FXGC 5I2XA 2A68D 3NBHA 1IYUA 1OXVA 4C3JB 3IFTA 2XSCA 3H91A 3A8JE 3RMHA 5HGTA 3L7ZC 1MSGA 3URYA 5I9OA 1ZYRC 1T6BX 1V1OA 1L6VA 1H9KA 1ET6A 1X32A 1SMYC 2ICEC 4TKOB 3J80L 2IW3A 3QWNA 1BDOA 4C3IG 3OOCA 3VRAB 2EKIA 4RGTA 1A15A 1F9PA 1IW7C 1FRDA 3K0YA 3GTMB 3BS1A 3NVYA 1K51A 1FNUA 3PIP3 3I90A 4A3GB 5BMIA 4ILWA 1EL0A 3FKIB 3TEYA 2OHFA 3R93A 2ZXRA 3AU7A 1SNQA 3HRDD 2BDOA 4GLSC 2JA8B 2D5DA 2D62A 2NVYB 1PDXA 4HCSA 2KN4A 2LS01 1C48A 4XTCS 1LT4D 2FMCA 5HG2A 1EY8A 4C1NI 3HVDA 5JVH3 2NTTA 2OF1A 1KF6B 2QDBA 3X3NA 2RDFA 1DOIA 3DHQA 1VMPA 4RF0A 3IFDA 5C5MA 4OL7A 1CFMA 5CGKA 1AZPA 4BA1I 3CHBD 3TMEA 4WQMA 1GUSA 2EYHA 3TEWA 4KV6A 3NHHA 5T1GA 4CKEA 4ITKA 1I4QA 4HCEA 3FILA 4JWUC 4V190 5CV4A 5FKAC 1V43A 3FVQA 4NMZA 1LTSD 4N9PA 2F0SA 5T8IA 2A68C 1O80A 2X38A 3G7LA 1BXTA 2QIEB 4K5WA 1ZP0B 3K5NA 3A56A 2W3RA 3MXPA 3TDQA 1DXMA 2EYFA 3VR2A 2KDMA 2N88A 3FAHA 4XT1B 2L1BA 1SSNA 1YN4A 2L11A 1D5MC 4A93B 1GUWA 4ZOHC 1ET9A 3ZQ4A 1P7FA 4GDLB 2E76C 4QMGA 3V05A 2BS3B 3AE2B 4HEDA 1GOZA 2DY8A 4Z9CB 4LK1C 1RFKA 4AYBB 1JALA 3OMGA 1JC7A 3LWEA 2EJMA 2VB2X 5HFYA 2F0VA 2HCIA 1M4VA 2PW5A 3B9JA 2J52A 3P75A 2K04A 2LJIA 2LHEA 2EJFC 4RHRA 2LFNA 3LXFA 4JBWA 3NTKA 1ONLA 4HTHA 1PZID 3F2UA 1B3AA 3S1MB 2KHSA 1RWSA 1Q1BA 1XEEA 4D2KA 3BVGA 3OWFA 2MJ3A 3VYRA 3D8GA 1V8CA 1E10A 1STAA 2EVBA 4ZRPA 1VDVA 5KEEA 3J7YW 1EWYC 4A3EB 1KFYB 2DWQA 4R8NA 3E56A 3J80E 2KCNA 2DYMA 2WACA 1QOFA 2M19A 4H44C 2V4IB 2B2VA 1YNNC 4RFBA 5KNDA 1ZKOA 4PQXA 2Z4IA 4PNYA 1J9OA 5IOCA 4DF7A 2A69C 4FF3A 4K5XA 1HZ6A 4RF1A 5KNBA 3DWQA 1JWSD 2K33A 1DYQA 3ITPA 3V96A 5I9PA 2JWUA 3NSWA 4NKLA 3S2DB 2WXJA 3D6CA 1PDQA 2JA7B 3K6OA 5IT9E 3VR4A 4KKTA 3EA6A 3FPPA 4H2AA 3AB9A 4A3FB 2OT2A 5A35A 4V0BA 2F0TA 5D65A 4US9A 1I6VC 2XWBB 5DNFA 2HTME 2FMMA 4FF4A 3IT4B 4K2KA 3TP5A 2LFIA 3C3LA 3QOLA 1C78A 5IGEA 3B2FA 1BQQT 2WXGA 1FMAD 5CBAE 2NBFA 3CU7A 1JWAD 2BOSA 5H92C 4EVOA 1Q12A 5EKKA 1GUNA 3TZUA 5FO8B 3FILB 2WV6D 3AV8A 5GXGB 3A55A 1QOAA 4U68A 5KNCA 3TP8A 4ZUIA 4RKBA 1G8ZD 3I4MB 1IBXB 4KKIA 2KVMA 1I4HA 4RA8A 1NVID 1O7YA 1SEBD 5K5PA 1V8QA 2R61A 2WQYB 4OO1I 2K28A 3AM9A 2A5HA 1VDZA 3SEBA 3H6MA 1WVLA 4LMQD 2IPKD 3AECB 2EYPA 4P16A 2RVLA 1DONA 2MH7A 3GV6A 3GTKB 4C7ZA 5IGBA 3MXNA 4XDXA 4XIGS 2WU5B 3P4RB 2IT1A 1EY0A 3S1NB 3VR6A 1BO0A 5CV6A 5EPLA 4DFAA 3I3CA 4RGNA 1QWYA 1HTPA 4WJWA 4U673 5C0XH 4HMIA 1KLGD 4A6QA 4DXFA 5AFWA 1GUGA 1U4PA 4KHVA 2J0TD 3N9YC 3RLFA 3W5VB 5BN4A 4JWSC 1JOOA 1JQYD 2IGDA 1KNAA 4MN3A 2AQ1B 1L0VB 2EY2A 2ICIA 4BBSB 5C4XB 1EM7A 5MPOA 5KRUA 2GRIA 1HUNA 4YTPB 5I2YA 1EOTA 4I65A 1AYFA 2JYEA 1CZWA 1PXUA 4N9TA 4L23A 3FRPB 1VCIA 3MXUA 3PUZA 2L0CA 5JJZA 4QB4A 3IAM1 1FCLA 2NUCA 5LL6S 2WXOA 2WP8J 3VYSA 2B2TC 3HS0C 2L1AA 1I4GA 1F2RI 3T56B 3BIID 5K36G 2EPBA 5I6YA 4KD4A 2WKDA 4MIUA 1EZ6A 2H1EA 2IGHA 2B2TA 2WLBA 2EJGC 1KH0A 2D9UA 2F0KA 4N59A 3D31A 3OW7A 1XCQL 3BZDB 4MHEA 2JYTA 4EQNA 3LYYA 3EUB2 2SAKA 4IFDG 1EY5A 4RAUC 1HQRD 3SR1A 1WRIA 4NZLB 2XN9C 1XO3A 2JEBI 1Y1VB 5FK9C 3DWMA 4A8XC 2KACA 2WB1B 2LMCB 4IUUA 3EGRA 3V2TA 5FLXL 1E0ZA 4IN3A 2K5WA 3K58A 4JX1C 2DYOA 1Y69U 2PNRC 3B2GA 1HPCA 2PZWA 3P4SB 1CA6A 2R3ZA 4C1NK 4CJ0B 4F8MA 4GDKB 4XWTA 3A7AB 2F0QA 4K2LA 3S17B 3H3VC 3P42A 1X3PA 1YN5A 4RGOS 3SE0A 3HGBA 1FNVA 1JCKB 3S2HB 4BY1B 5J22A 1RDPD 5M9OA 1ZXIA 1PYWD 4ODGA 2Y0SB 1VJKA 3QIAA 4FVMA 2E2DC 2YEPB 1SAPA 4OIJA 1IUEA 2IJ0A 2X69A 4F88A 2V3PA 2INPE 2IX3A 2MPMA 1E6EB 3TP7A 1L6UA 2CVRA 1BUIC 1CI3M 1DOXA 4HEA1 2F0MA 1BMLC 1XYIA 1SBBB 4ZKBB 3TN2A 3P1MA 3GV3A 1Y8OB 3PZ7A 1JRPA 2HCCA 1XCTL 1FFUA 1AN8A 1O7LA 1JWBD 1Z6HA 2IL8A 5ELEA 2PZTA 3MTSA 3S1RB 4ABNA 1QNUA 2J4XA 1HA5A 4WURA 1SYBA 4C2MB 1A70A 4KJNA 5JEAH 3ND9A 2ON8A 4EQPA 4ZRQA 4RHSA 3Q8CA 5BMHA 1TKEA 3K7AB 3HOZB 4C3HB 1L0XB 1ROEA 4UAIA 3KQ4A 1KRHA 2KEDA 1R7SA 4KGRA 3GP7A 1ZXHA 5COYA 1D2BA 2K3UA 3C1FA 2BA0A 2F1MA 4TQ0A 1SMYD 2QCPX 3M7NA 3KLRA 1SNDA 2GI9A 4YXDB 2QEJC 3I8ZA 4IDIA 1IW7D 3LWUA 4CJ2C 2N0SB 4M0WA 4KTAA 1VMCA 3AMUA 4JE3B 3IAYA 2ONQA 2E3TA 2O2LD 4HKZE 2KECA 2SOBA 2ZW1A 3H94A 3SR6A 5M3MB 1SNPA 2SNMA 1XTCD 1L4DB 1U4RA 2V3NA 4B0EA 2F4IA 2JX5A 1ESRA 4FP5D 1SYGA 1SYDA 1DOKA 1GUTA 1HTLD 2PW7A 1I6HB 3QB3A 1G2SA 3VA5A 1SYCA 4DQOC 4JK1C 3KK7A 1RD9D 1R4PB 2YEPF 2XNAC 4IUVA 1LACA 1NSNS 5DM63 1FRRA 4OW0A 3VYUA 1VZ7A 1D5ZC 4YIJA 2D2CC 4A3DB 1TJEA 1H9JA 1D1KA 4NP5A 2CJOA 2KQ4X 3ZJUA 2EYMA 5T1IA 2F03A 1ML0D 3FEWX 1UNSA 2I07B 3CIRB 2V0GA 3KUPA 4AS1A 5A2QE 4N58A 2HDLA 4YWGG 4G4KA 5ELBA 2WU2B 2A6EC 1SE4A 1HFGA 1OQRA 3GO5A 1EU3A 2CHBD 2PVGC 2JSVX 3SK8A 3BDOA 4H13C 1O7ZA 1EY7A 3HP3A 4BS9A 5C4ZA 3GTLB 3MAQA 2FJ2A 3PUYA 4CQNA 4LLGM 2NVXB 1H9SB 4OVZA 3IT6B 3CRLC 2OEDA 1SNMA 1G291 3Q8FA 4CKBA 4LK0M 1SNOA 2MJ8A 1RHPA 4B08A 1QLBB 4XQNA 4C3IB 1RODA 4YTMB 4ZHPA 2HQEA 2JU6X 1L5PA 1E0BA 1A6XA 4A3IB 5IT9L 5D3IB 1YQ4B 5H8YE 1TKWB 2PYKA 1DZ1A 2O5JC 1IGCA 3RFZB 1NR4A 2SDFA 5E4XA 1I4PA 4DU9A 1JICA 2MJEA 1EEFD 1TS2A 5EGTA 3MHBA 2PKOA 4N6EB 4KGSA 3HKZB 1EFID 4IUTA 3EJIA 5DEHA 2I38A 1ZDXA 5KYLA 1EY9A 1WTXA 4K6LA 1UGJA 1DD2A 1DM0B 5J1ZA 1YNND 2RKSA 1C9FA 3VYTA 4REZA 3UI3A 4RWSC 1LO5D 2MJDA 2WDRB 2A69D 1B4OA 2AQ3B 1ZE3D 1CHQD 1C76A 1IBXA 3GTJB 3ZYYX 3C46A 1PGAA 1TWGB 4IZ8A 5M5XB 4K5VA 1GB4A 1S5BD 2J53A 3GD7A 1ZXTA 2DY7A 1I50B 3P7JA 1LTBD 3FDTA 3RUZA 1WYGA 3A7LA 3U7ZA 1CT1D 4XXEA 3PO0A 4IFDH 2J42A 1CM9A 2KCCA 5FO7B 1K52A 1WXQA 3LX0A 4US8A 5EPJA 3DUZA 1L0YB 1JQ4A 3J9CA 4KKSA 4UDUC 1EQTA 3EROA 1ENCA 2NN6H 1G91A 3C8YA 2ZT9C 1G2TA 2NYZD 2E75C 2IDYA 5KIXA 2BS2B 1QOBA 3U52E 1FYCA 2SEBD 3DMUA 4HN7A 4FXCA 5E4WC 5AUKA 1STHA 1KDCA 3AE9B 2VZKB 3E5SA 1PFBA 3HOWB 2O4XA 1ESFA 3QG1A 3WOEA 4TSSA 4XYQA 1MI2A 3W2DA 1WTPA 2TSSA 1QB5D 1B2TA 1FXAA 1XLNA 3TUOA 3HRZC 3M3YB 3VR9B 1T5EA 1J7CA 1N5WA 1T5XD 5D3DA 1RTOA 1BCPC 1Q3LA 2F0OA 4NDXA 2AUJD 3DXJC 3GQBA 2N55A 1SJED 1H9RA 1ICWA 3D4RA 1GHKA 2WDQB 3H8HA 5LHY1 1IHZA 3I70A 1EY6A 3NXWA 1UWMA 2WXNA 3W1SA 3DEPA 4KJOA 1HUMA 4FXDA 4QCLA 2L55A 2G9DA 4EGVA 2K5DA 5EE9A 4B0MA 3BVMA 2Z1CA 3Q8EA 2Y5PA 5C4HA 3G6JB 2WXKA 4J8QA 1HFNA 1WSPA 1LTAD 3BVZA 2PO4A 5CV5A 4MM3B 2L52A 3MHZA 4KHZA 3HOVB 2LMCA 4ZKCB 2HDEA 2M2LA 3I9V1 4ME5A 3GTQB 1MHXA 4KMUC 4OO1G 4DA2A 4A9AA 1E2ZA 2H4OA 3FMCA 2G9HD 3R3OA 5HURA 4YT0B 3X3MA 4PV1C 1STNA 1M8AA 2BE5C 1WTRA 2IGGA 1RM6C 3Q8BA 2QJLA 1Q1EA 2F0FA 2FE8A 1MSHA 4TMAB 2DLBA 3DWGC 4FF2A 5C3EB 2H88B 1TS5A 2FBWB 1TT2A 4WAFA 1MPEA 4J1MA 4FXKC 1A3UA 4PMBA 3I73A 1TIID 2WXIA 2VB3X 2K03A 1A3TA 3HG9A 2BW2A 1TY2A 1N5XA 3V3XA 1E2WA 5CV7A 2R92B 2EZVA 3SK4A 2BS4B 1XLQA 2K6AA 3MJ5A 3TEXA 3NVWA 3FPUB 2MP1A 1IKMA 2M56B 4JPSA 4YSZB 1J8IA 4I7ZC 3VQIA 3RD4A