2NTSA

Crystal structure of sek-hvb5.1
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
217
structure length
217
Chain Sequence
QGDIGIDNLRNFYTKKDFVDLKDVKDNDTPIANQLQFSNESYDLISESKDFNKFSNFKGKKLDVFGISYNGQSNTKYIYGGVTATNEYLDKSRNIPINIWINGNHKTISTNKVSTNKKFVTAQEIDVKLRKYLQEEYNIYGHNGTKKGEEYGHKSKFYSGFNIGKVTFHLNNNDTFSYDLFYTGDDGLPKSFLKIYEDNKTVESEKFHLDVDISYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel loop domain in superantigens extends their T cell receptor recognition site
pubmed doi rcsb
source organism Homo sapiens
molecule tags Toxin/immune system
molecule keywords TRBC1 protein
total genus 66
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ntsA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ntsA01
1I4HA 3BYYB 1JQYD 2XRSD 2XNAC 3MC0B 2R61A 1LTGD 1LTID 1XTCD 4O1NA 3EA6A 1SE3A 1SEBD 4L63B 1PRTD 4UDUC 4DXFA 2TSSA 4C56C 5ELEA 5TSSA 2AQ2B 1FNWA 1LT5D 1CHPD 2G9HD 1ET9A 4NZLB 1HTLD 1AW7A 1TY0A 4L6TB 2QEJC 1T5XD 1YN5A 2J4XA 1BCPC 3SEBA 1I4GA 2AQ1B 1LT3D 1CHQD 2RDGA 3V05A 2CHBD 2AQ3B 4BWGB 1DYQA 1HXYD 1QILA 1TS4A 1PZJD 1JR0D 3W2DA 1EWCA 1D5MC 1FNUA 1S5DD 3R2IA 2NTTA 1EEFD 1D5XC 5D3DA 1PRTC 1LTAD 1CT1D 1V1PA 2QILA 1MD2D 3DWQA 1LT6D 1L0XB 1B44D 2WV6D 1JWUD 3TSSA 4RGOS 1BCPF 1DJRD 3DWAA 1AN8A 4Z9CB 3KLSX 3BVGA 3OWEB 1XXGA 3DWPA 3URYA 1RF2D 1GOZA 1ESFA 1EEID 1S5BD 1SJED 1KLUD 1KTKA 3GP7A 5ELFA 1I4PA 2Z8LA 1PRTF 5D3IB 3BZDB 5ELBA 1PTOC 1S5CD 1STEA 3MFGA 1YN3A 1FD7D 1BCPB 3R8BA 2XRQD 4RHSA 5FKAC 4TSSA 1LO5D 1JWMD 1SBBB 1ENFA 1S5ED 1SXTA 1V1OA 2RDHA 1RCVD 1RDPD 2SEBD 3EFXD 4OHJA 5ELCA 1PTOH 1M4VA 1V1PB 1PRTB 1CQVA 1LT4D 1BCPD 1TS5A 2ICIA 1D6EC 1EU4A 1PTOB 1PTOD 4DXGA 1EFID 4RCOA 2O2LD 4ZYSA 3BYTB 1YN4A 1D5ZC 1BXTA 1S5FD 1TY2A 1PZKD 1RD9D 2NTSA 5FK9C 1I4RA 1FGBD 5I4DA 1G8ZD 2IPKD 4RGMA 1I4QA 1JCKB 1HA5A 3BVMA 4RGTA 1SE2A 1UUPA 1CK1A 1EU3A 1LTRD 1PTOF 1F77A 1UNSA 4RFBA 1LTSD 4RHRA 1LLRD 4K6LA 1B1ZA 4RGNA 3CHBD 1TS3A 1I4XA 1JWSD 3O13A 1TS2A 1SE4A 1PYWD 1ET6A 1KLGD 4RH6A 1LTBD 2XN9C 5ELDA 3BVZA 1FNVA 2IJ0A 1L0YB 3R2TA 1HQRD 1LTTD 1PZID 1SJHD
chains in the Genus database with same CATH superfamily
2E2IB 1G6PA 5T8IA 2IX1A 3A4SC 3K58A 5IIFA 3GE3C 2BE5C 4DV4L 2WXIA 3Q0AA 4OX9L 1P3QU 4A93G 3SU8X 3S1NH 2JSVX 2GLSA 4WJPA 2RCNA 5C3EG 2PCFB 4CO7A 4GIVA 3FHWA 3L54A 2HJ8A 4YWLA 1D8LA 4H13C 4PT5A 3JAMc 1G291 2F1MA 4QB4A 1GC7A 3TS0A 2MBHA 3HM3A 4FJZA 3NY5A 1C4PA 1XMQL 2D3AA 2XWBB 3C1EA 2LY7A 4FJVB 1WCMG 1EIGA 4FF1A 2D3GA 3A9KB 4AYBG 2V0GA 1STGA 3I9V1 3NVYA 1HQMC 5ELNA 5M5WB 2KDMA 4IWPA 4WWOA 2FNJB 3SK4A 1MBYA 2D10A 1QLBB 2HCIA 2OTLA 4NJ7A 1O7LA 2F3WA 2NZHA 2WV6D 4XE0A 3TSSA 5DCNA 4L23A 2K33A 3CC4A 3V61A 3OG5A 3IG3A 3TEWA 5JEAG 1XWEA 4B3TQ 1EYGA 1LYLA 3M63B 3PZ7A 5JVG3 4G50A 4RMAA 3U7DA 4J3OD 5CBEE 1XLNA 4M01A 4DV1Q 3EGRA 1ZKHA 4W9CA 2JA8B 3S2HH 1IBXA 2N7EA 3RLOA 2M2LA 4WQOB 2ZJPA 2BB5A 4BKTA 1N36Q 2W55A 5T1GA 1L6VA 4ABNA 1V2YA 3EN2A 3N6RA 3PQIA 1UZXB 4DN4M 2O2VB 1BVSA 2IO1B 4ZRZA 4JPSA 1Q81C 2FCQA 3A8JE 2WNMA 3DWMA 4GZYC 3Q8EA 4QAYA 1ONLA 2R2QA 3CSTA 4ANUA 2E2HB 1TS5A 3HKZB 3NRZA 3GTMB 1Q10A 1QKZA 2DBYA 4K81A 1UELA 4P74A 1EY5A 2MBQA 2LXJA 1A2TA 4ZUIA 5A2QE 4DUZL 1W2BA 1ROEA 2J7QB 3GOEA 5G3LD 4A4IA 4C3JB 2B2WA 1I3QB 2NTSA 2CCZA 2BS2B 4MM3B 1B9MA 3PS6A 2R7FA 3RNFC 4BBRB 2AX5A 2M17A 1JW9D 4KIKB 3R93A 2I38A 3K9OB 3TMPB 2OQ0A 3EFCA 5NUCA 1OXSC 1UAPA 2B2YA 4KY7A 3TP7A 1KHIA 2R7ZG 1E90A 2PPHA 2MHVA 3ZRCA 4RGNA 3VAWA 3AMUA 3I4MG 3A74A 4MDKE 1BF4A 2ZJDA 3IL8A 2MP1A 3CCLA 3IBEA 2YYZA 3D4WA 1TWHH 3MXGA 3V6EB 3ZNHB 3SFEB 2FHTA 3ERSX 4OEMB 2N1WA 1L0YB 3E9IA 4FXGC 5IE8A 1BNZA 1MJCA 4WJWA 4CGYB 2C60A 2L7RA 3DQVA 5IP7H 1WXMA 1EF5A 4GDLA 4N59A 4ZRJA 2MBEA 2JZ3B 3HG9A 2JXXA 3S2DB 3RNCC 3GTLB 1EY9A 3QHTA 5IP4D 2A19A 4B9WA 3K7AH 4GOPC 1WXQA 1WI5A 3IRBA 3CD6A 4NXML 4FHKA 3ZTDA 4FA6A 5BYQA 2HCCA 5G55A 5LXIB 5LMUQ 3CCRA 3K7AB 1AW7A 2YEPF 4NQLB 1YEZA 4UAIA 1K0RA 4L2YA 4MGKE 1YNXA 4LFCQ 1SB3C 1KC8C 3TEXA 1YHBA 2R93G 4J15A 1U9RA 4GLXA 3R66C 1G6ZA 3RD4A 3CRLC 3EJIA 2B3AA 5C0XI 4N9TA 2H89B 2WXHA 4EFOA 4GNXB 2UUAQ 4LF5L 1P7FA 5CV9A 1WZ0A 1P7EA 1A63A 3DWQA 3N1ZC 1GPXA 3Q8DA 1SLJA 2LKVA 2SDFA 3A8IE 4LUZA 3RN2A 1EIYB 4DR4Q 1WTWA 1E9MA 3ZJVA 4LF6L 2EKIA 4A3LH 1C7YA 2V3SA 3BK2A 4DR2L 4MSMB 2O2VA 1GOZA 2JYOA 4U673 4H7BA 4RCNA 4C3HB 5C0XJ 2QEXA 1PRTF 3FMCA 3A1QA 1QVFA 4G57A 3GTQH 2QIEB 4RKBA 3K81C 4K0KQ 3PGEA 1SNCA 1J7AA 4NAMA 1YNND 2EXZA 2O5IC 4B9XA 4B08A 2EVBA 3CW2C 3OMGA 4K2LA 2D2CC 4YY3L 2IO2B 3CCSA 3U9OA 3DHGC 3HOUG 3L16A 4QQBX 4OO1I 4YTMB 3HKSA 3CP0A 1Z9FA 1QQRA 4P72A 4YCVA 1F2RC 1S1QB 2BBCA 2K0PA 1BCPD 2YLMA 4WWMA 4AJWA 1F2RI 1SN8A 3ZIMA 1D6EC 1XCTL 5BN3A 1QZGA 3HOYB 4FNFA 2BWFA 1Y8NB 4C80A 1Y1WB 4OVVA 3QR8A 5D6JB 3NELA 2L1AA 4B3TL 3LB8C 3VFKA 4DR2Q 2PIAA 4GN1A 3CSFA 2KEEA 4JI7L 3SDZA 2F0TA 1GD7A 4OO1G 4MGIE 1VDZA 3KYCD 3E0JA 1HEZE 2GBJA 2L83A 1IBLQ 4H02A 1N36L 3M4OH 3PSEB 2Z59B 1PHJA 4S17A 2KO3A 4A3GH 2BYEA 2ASBA 4RF0A 1MG8A 1VR9A 3HOUB 5JEAJ 4WJNA 1GG3A 3NTKA 4MNOA 4DFAA 3JYUA 1A5RA 2KJHB 5AUKA 5BYRA 3AM9A 3BY4B 2LXKA 1BBXC 1Q8KA 2FCMA 3AU4A 3ULLA 5LMUL 3J80L 2JWUA 2NBWB 5EDSA 3DVNV 4YWKA 2K5VA 4GMVA 4R4TA 2K3UA 2MSED 3H1UA 3HOWB 1TQOA 1Y1VG 3PUWA 3ZYYX 4DDGD 1N8RC 1TIFA 2M0XA 4HIOA 2CKZB 2CH4A 4DV3Q 3ONAB 4KY6A 3TMEA 4ALPA 1DOXA 2VB2X 2CHWA 1EL0A 4J6HA 1FCCC 4MJSA 5BMHA 4ITKA 1BUIC 1YI2A 2KHWB 2WHIA 5IGFA 1AFPA 4A3IG 1J19A 2EIFA 4JI0L 5I2YA 4WAAA 2M56B 3J9CA 1HA6A 4EE2A 1X56A 5M5XH 1X55A 4WIPA 1JWBD 2BYFA 3HOXH 4LNIA 1HRJA 1V81A 1DM0B 3T56B 3V05A 1XNQQ 2Z0DB 4KSLC 2PYKA 5M5XB 3TN2A 2ES2A 2GVBA 5E6PA 1QILA 1KD1C 3TJPA 1JR0D 4MSQB 1SROA 1H95A 1NI3A 4GXBA 1IUEA 1XO3A 1AWDA 3H9DA 3PMFA 1JJCB 2JE6I 3A9JA 1YQ4B 1T5EA 1NAPA 4DUYQ 5CV6A 1JWUD 5JPMC 1R7SA 2QDFA 1SNQA 1UEBA 1DJRD 3DWAA 1XPOA 5MPOA 4IKGA 1O7IA 5EKKA 2R7ZH 1X32A 2NUCA 2KHIA 1EOVA 4A55A 2DY7A 1E8WA 3K80C 2ALYB 2EMSA 3GTGB 3LXFA 2Z8LA 2CHZA 1C4AA 3TS2A 2D0OA 2RGFA 1DOLA 5JJZA 1YQBA 2LVQA 3FKIH 1AH9A 3FEWX 5CTRC 1PYSB 3R8BA 1JT8A 1FRDA 2GBNA 2A69C 1B9RA 3BG3A 2WIIB 2SOBA 2N0SB 3M4QA 1V5TA 2K5DA 3C3LA 5DPTA 1ZEQX 4HCEA 3ABVB 2UUBL 1FFUA 2R2OA 2DYBA 2KZRA 1K83H 5HKHA 1OO9B 1CKNB 5IYDH 1ILPA 1ZE3D 4GN3B 5E4XA 1VF5C 4KTAA 1PTOB 1F9QA 3GTJH 3MA2B 2WDVB 1VQ8A 1I5FA 1HUMA 3IAS1 1UH6A 3HFZB 4KV2A 5AZHA 1UWMA 2DYOA 4GDKB 2UU9L 3FPPA 2F0EA 2L12A 2A6EC 1UGMA 4HR7B 1M90C 2MJEA 3BDOA 1QOFA 3A5UA 2E74C 4A3MG 2G45B 1H9SA 5CV8A 1T6BX 3ICEA 3OTOL 5BR8L 1B2TA 2KYWA 3L17A 3VYUA 4II2B 3AQQA 2EELA 4FVMA 1IYJB 4IO9A 4L5SA 1OGWA 2RDBC 5JOBA 4JIOU 4V190 5T1IA 5LNK1 2BT6A 4G7OC 1FRRA 2MLBA 1G2SA 1TS3A 3MAQA 1SIFA 3TL5A 5COYA 1F52A 2ZCBA 1XMOQ 1XD3B 3L2PA 2IZVB 4IUNA 2ATWA 2W3SA 1PYWD 1C48A 2VB3X 2OT2A 1EWIA 2ZTDA 2EYLA 1KL9A 2KFJA 3NENA 2XN9C 3A4RA 3K9PB 4TKNA 5AUIA 5J18A 4DUYL 3DEPA 3EQLC 1Q1EA 3DVGY 1EYDA 4DR5Q 1FXTB 4NY0A 3GTLH 4N8FA 5C23A 4RM9A 2HDMA 3I70A 1QOAA 1JROA 1V97A 2CU3A 3IFWB 3MC0B 4US8A 4URKA 5KHQA 1LTID 1O80A 3AB9A 4X3UA 4O1NA 5IGGA 3EROA 3I4NG 3PPAA 3EA6A 3U4ZA 2V3PA 1XNQL 4W9FA 2I2YA 4XQQA 3KUPA 4A93B 2CJOA 3U8ZA 1EFWA 4XT1B 1L0WA 2AEHA 5TSSA 4Y7NH 3S1NB 2OJWA 1SNOA 4OVUA 5JZEB 1ET9A 4NZLB 2IW3A 4A93H 4HIMA 3SGIA 1RIPA 3J81L 3I5JC 1P9DU 3SK8A 4XX5A 3N30A 2X6LA 1DGSA 1T5XD 4IUPA 5I9PA 3GS2A 3M3YB 2KLGA 1L7YA 2LD9A 4FP5D 1YJNA 1P0RA 1OXVA 1ZXHA 4O2DA 3K8AA 4IZ8A 3DXJC 2G3QB 1S5DD 3HVZA 2G4SA 3L4PA 3VUXA 2IHFA 4A3BH 3DUZA 2F0JA 2F4VQ 1I6HB 5JJIA 1LTAD 4JWUC 1PH3A 2DN8A 4LAAA 2IDYA 2RA4A 4FO2A 5CMDA 1LT6D 1SYDA 2UUCQ 4BKSD 4DDID 1PFSA 1AN8A 2HHHL 3KLSX 3KFUA 1HTPA 5JH5C 2Y0SG 3ENEA 2ZW0A 2NVQB 1WYGA 1W3SA 3PRZA 2NVQH 3ALBA 5D3IB 4HJ5A 4ZKBB 5E4WC 1ZDXA 1P8LA 3APDA 4B0EA 2WDQB 3J7YW 3K0YA 3MFGA 4A3DG 4UP9A 1CA5A 4A3FH 5GXGB 1XTDA 3AEDB 4JWSC 4RG1A 4ANWA 1QVCA 2PZTA 4LJZC 1VQKA 3S15B 4A3IH 2PW7A 1Y1WG 1L1OB 3K7UC 1RL2A 2F03A 2MEKA 3Q8FA 2EMTA 5KNCA 3RMKC 2F0IA 1IBMQ 4L5TA 1C78A 4M8MA 1JB7A 2V9HA 2UXDQ 1GUSA 2JA9A 3IKJA 4C3IG 3PLUA 3VYTA 1CKNA 1CZWA 4DKAC 4GKKQ 1I3QH 3TZDA 3UGBB 1YN4A 3VRBB 1I50H 2ON8A 4USAA 3BJUA 3BZCA 3UDGA 2H88B 3ML9A 3QWZB 4EZJA 2Z4IA 4NB3A 4GLSC 1I50B 1F9RA 1FGBD 1U4RA 5FLXE 4ASWC 4JOIA 4X3KA 4BXXG 4DNRB 1EM7A 5C4XB 3L08A 3PT2B 3W1SA 4B3RL 4R4IA 1HZ6A 1W6JA 3TP8A 4HSVA 1WR6E 3UDXA 1PGXA 4NXNQ 2NB0A 1HNZQ 4BBRG 1U4PA 2ZVOA 1KAAA 3CHBD 3ZW3A 4AQYL 1AZPA 3DEOA 3H7PA 1HNWQ 3MWYW 2XVSA 4ZUJA 1QVGA 3IHPC 4IJLA 1EIHA 3N9YC 4IALA 2F0FA 2MHJA 1RKNA 3DBRB 4B9KA 4IM2A 4I65A 2NVTB 4EX5A 3STBC 1CZPA 1YOVB 3AULA 3T51B 4BBSH 4KZ0A 4WAFA 2UUAL 4HJ8A 4LNKA 2RBMA 1FMAD 4RNAA 1VQ6A 5C6AA 1G51A 3T9LA 5C4HA 1N34Q 1SEBD 4KI0A 4NQKE 3L0WB 2VQEL 5M9OA 2MJ8A 5ELEA 4DGZA 3N20C 4G3XB 5LLIA 2BKRB 1HTLD 1TYGB 3S1QH 1TY0A 4DR7L 1GC6A 3HOVH 4KSKC 5IGDA 1HZBA 3AXCA 2RF4A 2WXFA 1JJGA 2K14A 1OTCA 2AL6A 1EYCA 1PXUA 4TQUS 3A5ZB 4JK1C 3HOVB 4B6WA 2PQAB 3ZGZA 4DR3L 2AQ3B 2DZKA 2BDNA 4F7ZA 4YL8A 3VR5A 3NK9A 4JW0A 3KOJA 2YU9B 5E6OA 1HZAA 3A0JA 3QC8B 2NVYH 5CHVC 2FIFA 1MSHA 3AYHB 1U0LA 3K5MA 2JU6X 4BS9A 2GBMA 1TWCH 3KLRA 3D8GA 3ETRA 4FADA 2AWTA 3JAME 1R4NB 1V5OA 1PH1A 4Z9CB 3CF6E 5IGBA 2R92B 3PZDA 2X8XX 2K1BA 3DLLA 2B76B 1ESFA 5J2RA 1UE6A 4X3SA 1JOKA 1A70A 1BBUA 2GVAA 1GHKA 4A3LG 5E3FA 2RMMA 1YHAA 2ZXPA 5E6JA 4DR6L 4KDIC 2EZVA 3OLMD 1ZXTA 1N32Q 5IYBG 2FMMA 4TSSA 4DAYB 4DV0L 2C9WB 2D3BA 4CJ2C 5D7GA 1S5ED 5ELCA 2H4OA 2EOTA 3S1RB 1PTOH 4H0LC 3VDYA 1PRTB 1EO6A 2PI2E 4ZQ3A 3OJ3A 3RCZA 4AYBE 5DLQE 2KEDA 4KJOA 4A3EG 4EKUA 1KH0A 2IBIB 3H0GH 2NVXH 1YMHE 4EZLA 1SE9A 2B2TC 1RLFA 3J7A5 2F0QA 1VRAB 2LXAA 1YBYA 2YV5A 3ITPA 1VQOA 1G2TA 3QJZA 1MHWC 3PIP3 1CTMA 2LMCB 4MGYE 2A4ZA 1SE2A 3VH3B 2KX0A 2BVCA 3PIPA 1XPRA 3CU7A 4DR6Q 3H3VH 3ZTCA 3OIPA 3MXNA 4C3HG 3FP9A 1UNSA 4K0KL 2W9NA 3UQAA 2CW0C 4LF5Q 3D3RA 2N7JA 4CBVA 4IG7B 3M4OB 1PA6A 4N58A 3B6YA 3ZUNA 5M5YH 1SAPA 4I6PA 3AEGB 1VQ5A 2YEPB 5M5YB 4BVUC 1WVLA 1T9HA 2I1JA 1M8AA 2VZAA 2NMQA 2WU2B 4LK0M 1JQ4A 5IYCG 2F0MA 3M4YA 2WU5B 3CIRB 2K01A 5JAVA 4DAVA 1II3A 3EBEA 1U4LA 1Q1OA 4J8QA 3LGJA 2MQJA 3VR3A 1R9TB 5BYSA 4JQWC 2P5ZX 4HROA 3VQIA 1E7ZA 4KKUA 2LXCA 4HPPA 1ZYRD 1I7HA 4A9AA 5LL6S 2XNAC 2L32A 5AZGA 4TKOB 3HS0C 2K50A 2Q2TA 4CYEA 2RD0A 2W82A 4MH0E 2JJQA 3DOWA 2MO1A 4HCSA 4JYAL 3H8HA 1YNJC 1FNWA 1ZGUB 3AE8B 3KH0A 4GU2A 1VZ6A 1P1AA 1SR3A 3L7ZC 2GN5A 4GNXC 2B63B 1YN5A 3H15A 4GNXA 1UE7A 4UHVA 4FXKC 1WTQA 2BYTA 4LJPB 1C76A 3UINB 2PMZE 2LS01 2MCNB 5EPKA 3HKZG 3OWFA 3TIXA 1YVCA 1GAQB 2INDC 1H9JA 1KRHA 3CAMA 1D5XC 5L83A 3A54A 1LUZA 4PZ6A 2E6XA 1YJ9A 3HVDA 4JI3L 3WA0A 2Z6KA 1C8CA 2B29A 1L4ZB 1WZ3A 5G5HA 1EZ8A 2V3NA 4JLCA 4HMIA 1GUWA 1XLOA 2Q2UA 1NMFA 1ICFB 3NS1A 3G7LA 2ENBA 4P75A 5JXVA 5K36G 2CJNA 1NMGA 5GAHC 3KF6A 1S4ZA 1KTKA 1F9SA 3AU7A 3HOWG 3X3MA 1CSQA 2ZPYA 1HNZL 1QNKA 5G5GA 3U4VA 1K3BC 3TP5A 4NXNL 3T16A 2Y3AA 3EIVA 3TP6A 5KNBA 2KOLA 3M3JA 1SRUA 2KWUB 2D5GA 1B4OA 1NBWA 1R4NI 2ZEQA 3TCAA 1WJ6A 3HRZC 1NY4A 2G1EA 5TR5A 1K28A 3U2SC 4WURA 2FMCA 1SXTA 4A3KH 3GV3A 1V1QA 3QWNA 2Q2HA 1YJIA 3SE0A 4GKJL 2AWNA 5CX3A 1QF6A 1N62A 4OELB 2L4NA 1K8AC 4AP4C 5IKCM 2F0PA 1FGUA 3IAYA 3S16H 1PGAA 5GAEC 5JEAH 3AFPA 4KHVA 4G7ZC 4A3KG 5LL6X 1RHPA 1PDXA 2KDEB 1EFID 3Q3FA 4YT0B 4DXAB 2F0GA 3MHBA 5EJWA 1PH2A 2Z9HA 2OXPA 3A9KA 5FR6A 3GTMH 1X3PA 2VRRB 1C4CA 1OEYA 4DNIA 1TY2A 2CS4A 4JI6L 1T0QC 1I4RA 4MELA 1TWFB 1XF5L 2RHSB 2OTJA 3G6JB 5E6NA 2RSOA 2SNSA 1EZ6A 2OF1A 4LF9Q 2QGQA 4IM3A 3CXCA 1TWFH 1PTOF 3GTKB 4TRDA 2IY5B 1JORA 3ML8A 1HFGA 1XYIA 2PNRC 1YX5B 1FEHA 2QDBA 3GTKH 1H9MA 4Y52H 4YWMA 1B1ZA 1NTGA 1VQJA 2VZKB 3B1LX 4JI5Q 1TWHB 2B2VC 3DVNU 3VVWB 1C3TA 1L1OA 2JK8A 2E76C 2I0QA 4DV6Q 5HFYA 1KOTA 1OXUA 2N4FA 4P7IA 3HOXG 1WX7A 3QIJA 3PO0A 1KLGD 2L0TA 4P2CB 1LTBD 3LYYA 3T1HL 1QUQB 3NXWA 1RFKA 3S17B 4OZCA 2L1BA 4QUFA 2LVPA 4GGQA 2QC8A 3TBLD 1F9PA 3R2TA 1KF6B 3U52E 4JI2Q 1LTTD 4B3SQ 4G7HC 3GZNI 2WFWA 3V2TA 2KMCA 1OQRA 4LNFA 2V4DA 5GADC 1E6EB 2CHXA 1Q12A 1VQ4A 3CQZH 4OIKA 2A5HA 4A3JG 3RZOB 5KNDA 4LUVA 4NMZA 1SE3A 4DBGA 2WXGA 4AOFA 3I4NB 2A6HC 4CKCA 2RDFA 4B3SL 1H9SB 1VQGA 4JI2L 3RULA 3PF4A 1VQNA 4PQXA 1GXDC 4JI8L 4FBJB 4C4VB 3PV0A 4JI0Q 4Y7NB 3H6MA 1GJZA 5GROA 1XJVA 2MBOA 3Q8BA 1EQRA 3VTWA 1CFMA 5J3BA 2BA1A 2CWAA 4DAMA 2MP2B 4X65Q 3JW0X 4L5RC 1DONA 1CKOA 2DAJA 1PZJD 3UI3A 4DV3L 3SR1A 2O6VD 2NTTA 4DHJD 1CA6A 5D3DA 1EY8A 4PYUA 1A3VA 3RPFC 3VXWA 3OMCA 2CH4W 4HEA1 4F1SA 1V1PA 3AE1B 1MD2D 4X62L 1WWTA 3L10B 1C79A 1WE6A 1Z5SB 1MFWA 2K8CA 3H91A 2ACZB 2VUMB 4HJGE 1WF9A 2JX5A 1Q3LA 3QB3A 1NNXA 5C3EH 4HWIB 1KNAA 1D1IA 4IM0A 4JOIC 1OXTA 3GV6A 1T0SC 1F2MA 1WFYA 1J0GA 1SJED 3GP7A 1KLUD 2YTVA 2Y0SB 3PZ8A 2MWSB 3CF5A 4DK0A 1TKGA 3ZNZB 3H09A 1I94L 5ELBA 3E0EA 3RLNA 5L37A 4LUOA 4DU9A 3S9WA 4P73A 1NENB 1QUQA 3NSWA 4FHJA 1IBLL 2WKDA 4CHTB 4UP7A 2JQOA 2CKHB 2IGGA 3RZWC 2DNFA 5DM63 3GB1A 5DPSA 2LVOA 1ENFA 3V62A 3M7NA 4OHJA 4OWTB 1WJNA 2ASQA 3R7RA 1ESRA 4IDIA 1CQVA 3K6OA 4F8MA 2KVZA 5IN7A 1O78A 2Q8TA 2ZJQA 4HVBA 4G11A 1Y1WH 3ZVVA 3M9BA 3I90A 4YSYB 2V4LA 2WB1B 4RCOA 2DAFA 5ISRA 1R4MI 2K8HA 3HP3A 2QJLA 2WXQA 4HDQA 4W9EA 2BS4B 2F52A 3P42A 2NWGA 2E8GA 3MFYA 1B50A 4CQNA 3P4SB 3P1HA 4KKIA 3VTVA 5FK9C 2JZZA 3TUOA 1V8QA 4LNOA 3G48A 1TKEA 4QGUA 1IKLA 3VYSA 1J8IA 2FAZA 1JWAD 2I5HA 1AE3A 5EE3A 1T3QA 4YWGG 4ZDVA 3KQ4A 1QOHA 3ECIA 3MTNB 1VQ7A 4GB9A 3MEFA 3F2DA 4P71A 1EY0A 1TWAB 3AFQA 4RHRA 3VYRA 5IO9A 1FO4A 2MBBB 2XIWA 1PVOA 4DF7A 3DCGA 2PEAA 4YTPB 3F1ZA 3PUZA 3U58A 1DGJA 2N7DA 2NR2A 2N9PC 4M8NA 3P7JA 4JG2A 5J1ZA 2B2WC 2VW9A 1Q7YC 4JI8Q 1WTVA 1NR2A 4PZ7A 4F8CB 2B63G 1IXRA 2RSNA 1XPUA 2KQ7A 3A33B 3QQ8B 4PS7A 1YJJA 5KYLA 3PSIA 3RNUA 1NJIC 4XZ4A 4EGVA 4QF4A 1WTRA 2ZVNA 4K3BA 1TT2A 3Q3MC 1L4DB 1KDBA 4E6IA 1E24A 2B2UA 4BBSB 2JF5A 4X64Q 1OXXK 1TU2B 4IJHA 2IGHA 4ICUA 4A3MB 5JHAA 4R9WA 2DENB 3P1MA 2HE7A 3S1QB 2E2DC 3GDEA 4DXFA 2HTME 2AKWB 2LGYA 4YCWA 2INPE 4POGA 5H8YE 3ZKJC 1UF0A 2IY1B 1WCMH 4LF8Q 1Q46A 2L0CA 4KX6B 3GZNB 4ZHOA 3MVVA 1HZCA 2QW7A 3PCOB 4P16A 1SIJA 3U4EG 5KGUA 4KD3A 4DV6L 1B3AA 3A9JB 2YU9H 2XK5A 1WOCA 4LDTB 2NVYB 3I72A 1FFVA 1TS4A 4OIJA 1MI0A 3W2DA 2M4NA 4AQ7A 2BKFA 2LZ6A 4ZYNA 4BY1H 4PV1C 3VDZA 4G4KA 4K5XA 4FULA 3VA7A 4BY1G 1XNRQ 5KYIA 4BY1B 5CHWA 3DMUA 5J39A 5G2NA 5AZFA 4A6QA 3I91A 4OVZA 2EXDA 1PYBA 4DK6C 5C3XA 2LFIA 2LUMA 4KZCA 1ZDVA 3I63C 3OWEB 4W9DA 1FYCA 1TTNA 2Q8RE 1EEID 3KDFA 2SAKA 2C5CA 5ELFA 2EY1A 2WP8J 1A15A 1VQEA 2BWES 2NN6I 1QG7A 1JB3A 4CDFC 3GTGH 2VS1A 2LGXA 1VLBA 4EZKA 1IBKQ 2K9XA 4P1BC 2KWVB 2F3VA 2ZTCA 3LJ3A 2LRUA 3BDCA 4A3KB 3FKIB 2K5PA 2KECA 1RTNA 2PZUA 3K5LA 1K83B 4WFN3 2LHEA 3C19A 4NJCA 4MH8A 4WQMA 4A20A 4F87A 4DV0Q 2RDHA 4HIDA 5IYBH 1H8CA 2DHZA 4WORA 3IAM1 2K28A 4MHEA 1YZ6A 5C5LA 3C2PA 4IFDG 1N33Q 4UY8C 1NEKB 2NS5A 1N63A 5EKLA 2N9XA 1MG4A 1SFOB 2QCPX 2DZMA 2KCTA 3K59A 2JRHA 3I3CA 2AHOB 1J7CA 2X6GA 1E8ZA 2ZXRA 3AE2B 3DHHC 4KKSA 2F0LA 4NAWA 1BXTA 3U30A 3B0AA 3ULJA 3S24A 4RWSC 4II3B 5CYUA 5BN4A 5D2MB 2JQRB 3VR2A 3H0GB 3KYHC 2PI2A 5A35A 4LF6Q 2NVXB 1Y8RC 1FD6A 4XYOA 4X6AH 1JCKB 4RGTA 1WTXA 3E3XA 1AARA 1CUKA 1UUPA 5GQOA 2ZJRA 1YJ1A 4LLGM 1LTRD 4M1UB 2J42A 4F88A 1CI3M 3Q3OC 3H7PB 1EY4A 5I2XA 4K2KA 2BE5D 1BKBA 3LWEA 4KN4C 4DV1L 4WH4A 2AUJD 5EBCA 2WX1A 1ZOYB 4TV3A 3KWLA 3AECB 2BDOA 3UE0A 1WGGA 2HT1A 1W6KA 3NE5B 1PH6A 3MXPA 1DXMA 4OO1H 1F2YA 1SE4A 3MEHA 4A3BG 1GUAB 2NPTA 2JXMB 4BOZB 1XLQA 3N1XC 1TXYA 5IYDG 4LF8L 4XDDA 4ANVA 1Z7TA 2KANA 2K75A 1J8CA 1SYGA 5HY6A 2K8BA 4NAWB 1HQRD 3EC8A 1PZID 2IY0B 2KJRA 2Q8IB 3RZOH 2A68C 1JQYD 1R9TH 2WINB 3PO2B 2XRSD 3AB5A 1LTGD 1ZP0B 2XSCA 1XTCD 3NTHA 1IZ6A 3T53B 4B3ML 1ZPSA 2MO0A 2NVUI 5C4XG 3FRPB 4DV7L 2EY6A 4C56C 4OXPA 1D4BA 3A7LA 3SFDB 1G6JA 2NYZD 2DGYA 5CBAE 1YHQA 2K25A 4GLVB 2L5TA 4L6TB 2JA8G 2WDTB 3KUCB 5EBDA 3HOZH 4NXMQ 2JEAI 2AQ1B 1KIXA 3MC9A 3KK7A 5I6WA 1WD0A 4J1MA 2K5QA 4X64L 3EVQA 4A3BB 4EQNA 4OX9Q 2RPQA 4HJKA 1I6HH 3CC2A 3KUDB 3AEVA 4HSPA 3NVZA 2B8FA 2VXWA 4EQ5A 3J81E 2XK5B 2K52A 1K8OA 2L55A 3NZ3A 4C2MB 3DBHI 2MJ3A 4KGSA 4TQ0A 1JMCA 3SD5A 3GO5A 2K1FA 1Q8IA 4C2MH 5CV5A 4BXXH 5FJ8G 1OQYA 2BCOA 3RI7C 3L3OC 4HEDA 3BDLA 3NBHB 4IUUA 1S5BD 3CRKC 3F2BA 4A3DB 1HNWL 4OWWB 1KFYB 4W9KA 3W1SC 2C9OA 4X66Q 2G4DB 4DWFA 2EJMA 2V4IB 2WAQE 5K36H 5C1ZA 1HUNA 2KQSA 1F2ZA 4QIWE 1K73C 4G0NB 3KJPA 2I1KA 5EQ0A 2AMCB 3J81c 3CCEA 3SDLC 4OWXB 1E0ZA 3I57A 3PIOA 4ZAIA 1X65A 1IL2A 2UYZB 1QT9A 1UD7A 3OYYA 3JAMi 2ZCCA 3NS8A 3RNBC 1WFQA 2MFIA 3J80i 1F0ZA 3S15H 3DHQA 1Q82C 1TT5B 3K0XA 3C1FA 3TQYA 1GHJA 3CPWA 4HDOA 3MHSD 2VL6A 4GKKL 1Y56A 4MGZE 5C4JB 1TWGB 1X3QA 5IP7G 3QJYA 2E2HH 4JBWA 4ZYSA 5IT9E 3GTJB 1VQLA 3RNAC 2BPSA 1V9JA 1YNNC 4GDLB 4JL9A 3PGZA 1STNA 4EVOA 3UIPB 2W54A 2O4XA 4X57B 5EAYA 4JBJA 1ISNA 1X1MA 5I4DA 3KBXA 4C3JH 1X54A 1JRUA 1VQIA 2XEWA 2UUCL 1HA5A 3ZNGC 1HCZA 5EGTA 2KC2A 1Y8OB 2K6AA 1UGJA 4WJ4A 2WAQG 1LM0A 3CCUA 5C4XH 4K7SA 3WAMA 1LGRA 2R93H 2KFKA 1C4QA 3FPUB 3OHXC 4XDXA 5C0XH 2E75C 4K6LA 3RN5A 1NDDA 1KDAA 4HTHA 1RAXA 1L1OC 1SSNA 4A8XC 4OZBA 3P4PB 1I4XA 2KCCA 2LGIA 2O5JC 3KW5B 4LJOB 2K04A 2MPMA 2A6HD 4LF4L 2IX0A 1X3FA 3S17H 2NZ1D 2K6DB 4BKSA 1Y1VH 4RH6A 5AEKB 2L3ZA 1GO3E 5ELDA 2Y0SE 2FXQA 3HRDD 2CWPA 4OL7A 4IUVA 2IX3A 5HGQA 4O0AA 2PE9A 3GD7A 3RR5A 3BZKA 2IO0B 2MGSA 4RMFA 3QCAA 1I42A 2PNHA 1Z47A 2A73B 4X65L 4RKLA 4KGRA 4KVGB 3N32A 4JI4Q 1WIAA 2IYDB 3CQZB 2TSSA 3WALA 4WWPA 5EE1A 1LT5D 1MKHA 2G9HD 1PFNA 1I35A 2RPVA 2WXRA 2PVGC 2DZJA 3HKZE 2N55A 3W1BA 3X3NA 1ML0D 2VY3A 3NVVA 1L0VB 2KKCA 3AU5A 4QY7A 2HIVA 4HN7A 2K4KA 1IKMA 4A75A 2JA6H 2UXBQ 1V6EA 4CHKA 5IT9c 3M3YH 1EWYC 2JA6G 2WXMA 3I73A 1D5MC 1FNUA 1TWCB 2DZIA 4ME3A 2WQYB 3TEZA 4XT3B 1M1KC 5HURA 5BN5A 4XYQA 1HTQA 2ZM6L 2VUMH 1KRTA 4LK1C 1X6OA 5C3EB 1Q0WB 3QX1A 3P20A 4FXCA 4LF9L 3H6NA 1WGDA 2QCZA 4L5QA 1C9OA 5C44G 1N6ZA 1J5EQ 1STAA 2WXKA 2UU9Q 2F0SA 4C3HH 1XMOL 3N3KB 3AMZA 3W1YA 1JICA 1BR9A 4HCPB 3SK6A 2DNEA 4YCUA 1VS0A 1WM3A 3NUCA 4LWCA 1K50A 1KABA 4A3JB 2WXLA 1GB4A 3HGBA 1HR0W 1B3QA 2QKIC 3OW2A 5DEHA 1WGRA 2FUG1 5M3MG 1R4PB 2KCNA 4K8IA 2UUBQ 4QCLA 1UBIA 3UQBA 2QHOA 4A3FB 4KD4A 2F0DA 4B95A 1V1OA 4HMJA 2SEBD 1TKWB 1BUVT 2RHQB 3H7SA 3WDNA 4BY7B 1KRSA 5C3WA 3HOYH 4PMWA 1IW7D 4LTUA 2LHDA 3OSOA 4KHZA 1PTOD 3G6EA 4LNNA 1FVIA 4KKJA 3ND8A 2O2LD 1L2NA 2K7VA 4JBMA 3DWGC 3HHMA 1JE4A 4HCNB 1HH2P 4ZK9B 2KCMA 3RYTA 2JP1A 1F2LA 5E1FA 4ZKCB 2ONQA 3OAWA 4TQ1A 4WJOA 1SMXA 1XX8A 3QAQA 3I2ZA 3I8ZA 2BOSA 3E6ZX 1ENCA 4NNJB 4P1CC 3UIOB 2BQQA 4DHJB 1I4QA 1WI0A 3LNNA 1WYWB 2YTXA 3V96A 4YSZB 4ARIA 3HOUH 4DV2L 2ZM6Q 3ER0A 4FXDA 2KX3A 3CCMA 2JA7B 3FDTA 1JRPA 1XEEA 2EQSA 4C1NK 4KKTA 1D3ZA 4BBNF 3AEBB 1LTLA 4A3EH 3O13A 4DV5L 4REZA 4IWOA 3RZDB 2Z6KC 2PKOA 2A69D 1SYCA 1WSPA 2G5DA 2L76A 4ANXA 1GUOA 3I4MH 1R4MB 2C7HA 3BVZA 1VQ9A 4MACA 1IYUA 4HXDA 4A90A 4W9IA 4KJNA 1NSNS 4JI3Q 3P75A 3PTFC 2XTIA 4E3CA 4JVZA 3W3AA 1Z6HA 2Z0SA 5C2TB 4FF3A 2JUOA 2FINB 4LMQD 3A55A 4NKLA 4BA1I 3KF6B 1WXSA 3PF5A 3L0OA 5CV4A 1K53A 4D2KA 2UXBL 1G91A 4R8NA 4GOCA 4AUQC 4UDUC 1WTPA 1BMLC 1E1OA 2HQLA 3GTPB 4LFBL 3RFZB 3HOZB 2JA5G 4QJFA 1NYRA 2LFNA 2F0UA 3Q6SA 4FLHA 3UDFA 1E22A 3GTPH 2PW9A 2OQKA 2J4XA 5LMNQ 1LT3D 3DVGX 3T1YQ 3HOXB 1ZW7A 1PH8A 1WYDA 4CKEA 2IO3B 3A8KE 5IYCH 2N49A 5A2QL 1PRTC 2KLCA 4AJYB 4WJ3M 1S3SG 5DNFA 1PGBA 4LW1A 4JPBW 1VQMA 1N5WA 1SYEA 2Q5WD 3RMHA 4S3SA 4W9JA 2FFKB 2KTFA 2E3TA 3RUIB 4OONA 5FOBB 2JZPA 1WGYA 3DWPA 2RQXA 2EY2A 3EECA 1RF2D 4ZCKA 1X9NA 2R92H 1RTOA 1O7ZA 2D2QA 1K3RA 2KFKB 1KXLA 2BH8A 1V9PA 3GTOB 4PZ8A 3M4PA 1F9JA 2KK8A 5M3FB 1STEA 1L5PA 2DNCA 4PS3A 1WX8A 1FD7D 1FPYA 1E1TA 3H3VI 1STHA 3V3XA 1VQAA 4R4QA 4QIWB 1TGZB 1CQFA 2I46A 1S40A 4JI7Q 1WJUA 5IP9G 3LWUA 4FDBA 4IFDH 2OJRA 3PUXA 4K7WA 4PK1A 3VR8B 1N32L 1CMXB 2KENA 1J6QA 2HD5B 1AZQA 1E7VA 4XWWA 4B0MA 2KD0A 4US9A 3SXHA 3BYTB 2LSSA 3NEMA 2KJXA 2ZTEA 3WWVA 4BBRH 2DWQA 4YHHQ 2KDFB 3QG1A 1PZKD 1RD9D 2LMCA 1IL8A 1TIID 2CFMA 4RGMA 3I55A 3B2FA 4IURA 4IUQA 3KYDD 3BVMA 4HLEA 1TBEA 3TDQA 3Q69A 1X3GA 3NHHA 1VMPA 5CORA 1WH3A 4L8JA 3SR6A 1F77A 4RFBA 2Z1CA 2K5WA 3J7AF 1YQ3B 2A68D 2OEOA 2PPBC 5JVH3 1VZ7A 1FJGL 2JVCA 1TJEA 5F2DA 2PVOD 4U68A 3M7GA 2V1CC 3NBIA 1HNXQ 4X66L 3MXUA 1Q5WB 3ZXVA 2UXCL 4DR3Q 3W9CB 2D07B 4W9LA 2JYTA 5I9OA 2PQAA 2JT4B 3IVFA 4RAUC 1DD2A 2INNE 2MX2A 1EUJA 3D4RA 2DJFC 4E74A 2M00A 2DUDA 1LQBA 1XNRL 3B08A 1IGCA 2H1EA 4MIUA 1WTOA 3CC7A 2NPTB 2EYPA 3DM1A 3BYYB 1TR5A 2KWCA 2KWDA 3M62B 1TKYA 3K57A 1WRDB 5CGKA 4E71A 4YSXB 4KHPL 2PZWA 4A3FG 5JJLA 1RRBA 3T1YL 4L63B 3U7ZA 1HZ9A 2AL3A 4LDTD 5AJ3Q 1LACA 4IQZA 2IL8A 4KIKA 3GQBA 4DHZB 5IGCA 2J0JA 2HD3A 3PVLA 3J80c 2MQHA 3IFDA 4LFBQ 1WX9A 2JYEA 2L0FA 1QOBA 2WS3B 4DV7Q 3SEBA 2GA4B 1NBFC 3RT3B 1S72A 1PH4A 1CHQD 2YTYA 3TZUA 5M5WH 1N34L 2CHBD 1OEYJ 3IT6B 5IY0A 3NG0A 2CQAA 2F0HA 1RODA 3SHLA 3CPFA 2CW0D 1D2BA 2K05A 1IBXB 1FJGQ 4O42A 1E10A 1VCIA 3PRMB 4C3IH 1KLVA 2M19A 2MH7A 3RZFA 5FLMH 4EQPA 2M8SA 3KDFB 4IUMB 4N6EB 1L0XB 2EPBA 2C5LC 1EYAA 3ZXRA 1CKMA 4C3IB 3HZXA 2WACA 2K5HA 2L11A 4K5WA 4XQNA 1Q86C 5IGEA 2WXPA 3DDCB 1A62A 3D6WA 5FJ8H 4BY7G 2LJ5A 3ZLZA 3OW7A 4C1NI 3GE8C 4JI1L 4YTNB 1HNXL 3KJOA 3H0GG 1MJDA 3LX0A 1EF1A 5E7NA 2Z0EB 3FKYA 5I6YA 4NPNA 1PTOC 1GJXA 1EIFA 4K5VA 2UXDL 1V86A 2K39A 5IOCA 3Q22A 1VD2A 4HRSA 2YVCA 2EJFC 1WGHA 1LXDA 4KK7A 1N60A 2NZOA 2AYOB 3MHZA 1GVPA 4RF1A 5FR3A 3OPOA 1SGHA 4A76A 4R1JA 4WWNA 4BY7H 1EOTA 3HK0A 3J7AV 1JWMD 1SBBB 1RDPD 4R4OA 4YHHL 2VH2A 1HJPA 1KM7A 1HE8A 4FJYA 1H9KA 5EKIA 3U9SA 3W5OA 1WD1A 1A0IA 1QZHA 1RFAA 1VQBA 4AYBB 4XQJA 1EU4A 2IT1A 3L13A 2B2VA 4LCDE 2RVLA 3HM6X 2EYFA 1N33L 1I6VC 1P16A 3H3VC 4FYDA 1K51A 2JA5H 1EUVB 1PQSA 2A5UA 3Q14C 4NJ6A 4N8X1 2K03A 5K5PA 2JA5B 2OCEA 3A7AB 2BTEA 2JSOA 2HHHQ 3H94A 1G8ZD 1E8XA 1YD8U 3CMMB 4WJQA 3V6CB 5KIXA 3F8TA 2F0WA 2PMZB 1T0RC 4K14A 2JA7H 1WGKA 4ZLTF 4Q2JA 4FF2A 4R3DA 4WRDA 1QE6A 1FXIA 2M9VA 1YIJA 3VA5A 4JBKA 1N9WA 3NZSA 1U5KA 1HR0L 4PS8A 3PIO3 4KV6A 3WOFA 5EPLA 4BFRA 2L00B 3I4MB 5IAAC 1SF0A 1E7UA 3CMAA 1J5EL 1XMQQ 1VQCA 4A3PA 5C4ZA 1WM2A 2NVTH 2KT7A 3VR6A 1TVXA 2JEBI 1D7QA 4JGHB 4XXEA 3AEAB 4X62Q 3FAHA 5IP9H 2L9HA 4LFAL 3A1QB 2WYQA 4GDKA 3RNEC 3WAPA 2FJ2A 2R7DA 3QK0A 4XC2A 2EE1A 2HIXA 4GS3A 1M94A 2J52A 5FLMG 2R92G 3FILB 4V0BA 3ZO5B 3AEEB 4HK2A 4HKQA 4K8JA 1K8MA 1PRTD 3J81i 2WDRB 2GB1A 2VNUD 2RCFA 1CHPD 3NHEB 1SE8A 3I4NH 2N88A 3R3OA 4ID6A 2B39A 3T1HQ 1JMLA 1XT9B 3QA8A 5HHDG 2D0PA 4GN4B 2VH1A 3EFUA 1DCZA 2K6QA 3ZJUA 3STBD 1C9FA 2J0TD 2N9LA 3Q2AC 5BMGA 2D62A 5GAGC 1MVKA 3UF8A 2AWOA 2KHSA 3D31A 2DJGC 2LJIA 3BIID 2PQEA 2XWJB 4XTCS 3UE1A 4DV4Q 4A3CH 2FE8A 2PTLA 1PFMA 4I7AA 3PREA 1ENAA 4Q5VA 1WMHA 5ELOA 1PH9A 4DK5A 2X69A 3G4SA 3NQTA 2LASA 1RJTA 2AUKA 1ZUD2 2KOXA 4FN2A 5D65A 2I5LX 3KLWA 1DZ1A 1U4AA 1NYQA 2KACA 1NVID 3NVWA 5IWAQ 1LM8B 3CKIB 1BBWA 3RUZA 4LF7L 2DX5B 4DUZQ 3APCA 1A3TA 1PFBA 4OZAA 1ZYRC 1BO0A 3M85A 3Q8CA 1JC7A 2A74C 1HPCA 4PNYA 2ZNVB 2J7ZA 3NQIA 3KF8B 4IOAA 2KVRA 1PFDA 4HJ9A 3GTQB 3AE9B 4S0RA 2XRQD 3N52A 2KA7A 1L6UA 3A56A 3FVQA 4BBNC 1HTOA 2LGDA 1LV9A 3KBGA 4QUCA 4UP8A 3P4QB 1RCVD 2XBBC 3DBLB 1Y69U 3QIAA 3ULPA 1KDCA 1SFOH 5DAUA 4AWJA 2PW5A 3VR4A 5JHBA 2ICIA 3S1RH 2KMMA 3E5SA 2FUHB 4DXGA 5IODA 2PMVA 5M3MH 3AE4B 4UPAA 2X38A 3Q24A 4HPLB 3D0FA 2PLPA 1ASYA 2O6VA 2WWZA 4DR1Q 3P2BA 1S5FD 3NPPA 3BS1A 3JAML 4GKJQ 4EOYA 3ZDMC 3PO3B 3DHIC 5IA7A 2L05A 2GI9A 2F0KA 2RSUA 2BF8B 3RLFA 2Z6BA 1IYFA 1PH5A 1UE5A 3KF8A 1CK1A 1N61A 1ACCA 2KHJA 1ZKOA 2BW2A 2M0AA 3N1YC 3DBRI 2NN6H 2F4VL 1F1HA 3NJTA 3VTUA 2G9DA 3VHTC 3MJ5A 3C46A 1MI2A 5EPJA 1C0AA 4ZRQA 2REXA 4A3GB 2D9UA 1IPGA 4TMAB 1JE5A 4HJ7A 2E2JB 5EE9A 1GB1A 2B8GA 3FILA 1EY7A 2KBNA 2FIDA 1DOIA 4JCVE 4IFDJ 2F0VA 1VQPA 2KAJA 3MJWA 4C00A 4F7XA 3KLSA 1OTRB 2MNAA 3DM3A 4A3EB 3T3OA 1T0YA 1EQVA 2WXJA 1FNVA 2TMPA 1UWVA 1PUTA 4JI4L 2Y5PA 4MTKA 3UDIA 1TZ1A 3OOCA 4KGTA 5C44B 2R61A 3HOWH 1SNMA 2J0KA 4K7UA 1PDQA 2WX0A 1PMRA 3J80E 4NPSA 2C7MB 1UBQA 3APFA 5JPNC 2GOWA 2QMTA 2EYMA 5C44H 1SYFA 5CHFA 2BYVE 2Q2IA 2WB1G 2B63H 2K32A 4RM8A 3ZNID 3AE3B 4MT5A 4RA8A 3TBIB 2VQFL 4OW0A 4MN3A 5D14A 4JYAQ 2Z4HA 1BCPC 1WCMB 1I4GA 3I4LA 1J7BA 1V49A 4MZ9A 4DPGA 1PH7A 2N78A 4B3MQ 3PUVA 1KJTA 1EQQA 2I07B 3RNGC 3NZUA 4Q0FA 5LHY1 3S14B 1Y14B 3R3MA 3PRPB 4QL5A 3SVMA 3DPDA 5HI1A 4LFAQ 1WE7A 4ZHPA 2B2UC 2QILA 5IOIA 4IUTA 3S14H 1MHHE 2JXTA 4W9HA 5AFWA 1UEAB 3HOYG 1VJKA 2KDIA 3Q23A 3CWIA 1MJEA 3LDZE 3BVGA 1NUCA 3K5OA 4JI6Q 2N9EB 2LEKA 2EKEC 2KN5A 4ACFA 1CM9A 1JOOA 1DOYA 4KN7C 5FO8B 3GTOH 2UXCQ 4MJSB 2D5DA 1HR0Q 1A2UA 5M3FH 2QA4A 2V1YA 2WAQB 1C77A 2J53A 4A3DH 1S5CD 4ULLA 2B2TA 1B53A 5KEEA 1ASZA 1E7PB 1YN3A 5FO7B 1IHZA 1Q1BA 4GOPA 5CV7A 4A3IB 4NDXA 1KQSA 4FF4A 2JA8H 5LMNW 3S2HB 2OEDA 1SMYC 2BS3B 4ICVA 5FKAC 3T4AC 3P63A 1E2VA 2L15A 1KAWA 1LO5D 3MZ5A 3VUYA 1CZGA 3S16B 2QSDA 2GBKA 1QJOA 2OOBB 3P4RB 1AEXA 1WTHA 3ZJYC 4DAYA 1TWGH 2N3SA 2L8JA 3Q3NC 4M0WA 4C7ZA 2F4IA 1EY6A 2KQ3A 3TEHB 3HIZA 3V60A 4LNQA 3MXNB 4L1BA 4I6NB 3VR9B 3ND9A 2NBFA 4HAEA 1QZEA 2KTRB 2IWHA 4JI1Q 2JN4A 3BINA 4NW2A 5GMVA 2N8NA 4N9PA 3B2GA 4DAPA 1J9OA 4APVA 5FO9B 4DA2A 3VRAB 3S1MH 1E5WA 1YX6B 4YY3Q 2H5XA 4KMUC 2R3ZA 4TVAB 4XIGS 2ZZPB 4HKZE 1V80A 3S1MB 2I5MX 4A3CG 5H92C 2R93B 3NWSA 1B8AA 1H4RA 1XQQA 1K9MC 3AN1A 1GNUA 4J6IA 1EWHA 3D6CA 1O7YA 1GM5A 1B70B 5KHOA 3VH4B 2ZT9C 1LLRD 1OQQA 1MPEA 4CJ0B 5EE0A 2Y5BB 5HG2A 2KXJA 2INCC 3PHXB 1YJWA 2D11A 2NBVB 4MEMA 4N9F4 2WKCA 1TS2A 4CDEC 5FLXc 3E56A 1QCBD 2ID0A 4X3TA 2HDEA 1DOMA 3BK1A 4IW0A 4XDCA 4DR7Q 3QO2A 2FCNA 4BZAA 3DBHB 2A8VA 5C5MA 1ICWA 5AJ3L 2E5LL 1LFDA 1Q90A 2ZW1A 2GMIC 2ICEC 4R4CA 3CCQA 1CJEA 2M1MA 2VQEQ 1HHVA 3FKIG 4BKGA 2LRWA 2PO4A 2KUMA 4M02A 1IW7C 4K6DA 3F2CA 4GSWA 4KHPQ 2B3GA 2E2IH 2KMAA 2VUMG 2EJGC 1PLFA 1MSGA 5HGTA 3SK5A 1VCBA 1WXAA 3C8YA 3PO2H 1CSPA 5C0XG 3ZDTA 3S2DH 1WJ4A 2MRPA 2L52A 4LFCL 3D4DA 4M0WB 3I4OA 2CU1A 1FXAA 3B9JA 2JA6B 3IFTA 2QEJC 4CDCC 4DK1A 2BB6A 4MM3A 4BOSC 3D32A 2KJ6A 1FL0A 4KDLB 3ZQ4A 1C1YB 2RDGA 1HFNA 2W3RA 2C7NB 4BWGB 2KTRA 4DK3C 2HTHA 4YXDB 3CCJA 1DYQA 3JVZX 1GUNA 2KC1A 3CMEA 3RD2A 3NP8A 4IPCA 4EUTA 4ARCA 2J0MA 2MW5A 1CT1D 4B3RQ 2EYJA 2E5LQ 1GKHA 3TREA 1MGSA 1NE3A 1H9RA 2LI5A 1VQHA 1B44D 2EDGA 1SNDA 2MUYA 3AV8A 3I3TB 4RGOS 3PHWB 1BCPF 2CVRA 1P98A 2EYHA 1XLPA 1Z2MA 5DPWA 2UU7A 3L9AX 3E9SA 1MIUA 2VZKD 2QDLA 2NN6G 2EY5A 3I56A 4ME5A 4JV5L 4AQYQ 3AE6B 4A3OA 4DQOC 1SSOA 4A3JH 3EHVA 4IC7B 1I4PA 2PJHA 3PLVA 1D1KA 1NR4A 1YITA 4K1RB 1NCVA 1RWSA 3BZDB 2JWZA 3T8MA 1YNTE 2LWPA 3X0WA 1S3OA 1N5XA 2JPHA 4ZRKA 2F0NA 4POFA 3WCQA 1JOQA 5CC4A 2QF7A 2R6GA 3F2UA 4M00A 3SHQA 3CCVA 1A3UA 1V8CA 3EFXD 3AE7B 3AH7A 1E2WA 3EUB2 1E2ZA 4ZRPA 1M4VA 4NP5A 1QB5D 2NCNA 1LT4D 3O65B 1OFFA 3MP9A 1RM6C 2Y5CA 4A3GG 2PE6B 2N9KA 5L95C 1FCLA 4JX1C 5C4JH 1YNJD 3KVFB 4JV5Q 2HDLA 1GUGA 3UI2A 2WLBA 3NUHB 3WIMA 1IP9A 1E0BA 5G3LF 2CR5A 3DBSA 2JA7G 4DR4L 4GOPB 1VF7A 2OHFA 2DYMA 5DM73 2EYOA 1STYA 1IBKL 1IGDA 3KWVA 3QOLA 4PG3A 1IYVA 3BU2A 3TRZA 3PO2G 4ZRIA 3ZRFA 4C3JG 4HPMB 1LTSD 2B2YC 4GLAC 4YIJA 1QNUA 1I94Q 1GUTA 1Y8PB 3PUYA 1X3EA 3RZDH 2KNBA 2RR9A 1QWYA 1SDFA 1VDVA 1JWSD 1TWAH 4AS1A 5KRUA 4KY5A 3K5NA 3C0RB 1SMYD 2A6ED 4P6VF 3OJ4B 1AP0A 2VQFQ 2D3CA 1VZ8A 3M95A 3HEJA 2IJ0A 1E3PA 1Y1VB 4C4VA 4DNTB 1EQTA 1SJHD 3IXSA 4CKBA 3S2AA 1I4HA 3HOZG 3AE5B 4A3MH 1MHXA 2XGTA 1U4MA 2ZNVC 5M3FG 2FBWB 1K52A 1WJJA 5C3JB 3QOJA 4CDDC 1B7YB 5LMNL 2C35B 3U50C 4BAXA 2AQ2B 1TZOA 1WR1A 1XCQL 1A8VA 1FR3A 4PMBA 3I7FA 2DLBA 3AI5A 3T13A 3W5UB 4OGQC 2SNMA 3MC8A 3WAOA 2KQ4X 3TEYA 2IGDA 1KNEA 1ILQA 2K5NA 4DV5Q 4ILWA 5FLXL 2WB1E 4I7ZC 1UE1A 1LABA 2MJDA 1E8YA 2A1AA 4PYZA 1HXYD 4PMCA 3RN9C 2WXOA 3WOEA 2O6VB 1EWCA 3R2IA 2RKSA 3JC66 1EEFD 4ZOHC 3JSVB 5J22A 5IT9L 3OTOQ 4DR5L 3AEFB 3KUZA 4AH6A 1AE2A 2R7ZB 3ERQA 1UWXA 1STBA 3R7QA 2F3IA 4H2AA 4BBSG 2GRIA 3Q8AA 1XXGA 2HJ1A 3ZJTA 1NI2A 4LF4Q 4IWQA 1BOSA 2F0OA 3URYA 1R4QB 1WMHB 4DR1L 5BMIA 4IN3A 4JI5L 4MTNA 5CR3A 3T3NA 2GBRA 3J7ZC 3NTIA 1HZ5A 3WANA 2JY6A 4XYCA 2WGSA 4DV2Q 3W5VB 5BR8Q 2JRIB 1BQQT 2KDBA 2FCSA 2MP2A 1BCPB 4BA2I 3NOBA 4RHSA 5BO4B 3JSVA 2WXNA 4KLKA 2WP9B 1VMCA 1YIWA 3NBHA 4I6LB 1WXVA 3BWUD 2IHEA 4EQOA 1JJ2A 3HOVG 3Q6BA 4IOIE 4HIKA 4R8IA 3VUWA 2MA9B 3NWTA 5DPRA 1V1PB 2HQEA 2ZXOA 5D94A 2BGFA 1SYBA 1VQFA 2CQOA 2BA0A 2LGSA 4AIMA 1FM0D 4M8AA 1A6XA 4XGAB 1JALA 1QOGA 1IBML 1D5ZC 3MTSA 2KN4A 4TUUA 1WRIA 3W1GA 4IOCA 3QARA 1VQDA 5IWAL 1SNPA 5M3MB 4GN5A 5H1SE 1K0SA 1BT0A 2KVMA 2OWOA 1V43A 4JE3B 2IPKD 2DY8A 5J17A 3PO3H 1AYFA 3J81j 4W9GA 1ZXIA 4HJAA 1EU3A 3IT4B 3X23A 3FC4A 3PO3G 4C7YA 2HUGA 2E2JH 1K8RB 1B9NA 4CJ1B 3E9HA 1PV4A 1K8GA 2UWQA 4DHZE 5LXHA 4K3CA 3DBLI 4LF7Q 2BH2A 1FIQA 2NBUA 3Q3JA 3OIQA 5JJKA 2LUEA 2K22A 1ET6A 4IPHA 3ONSA 4ODGA 1DOKA 1L2FA 4IPGA 2ZPNA 1WY8A 3PV1A 4JC0A 4IFDI 4IPDA 1BDOA 4XWTA 4H44C 3HUIA 2N1VA 4EEWA 4QMGA 1RYJA 3G71A
chains in the Genus database with same CATH topology
2E2IB 5T8IA 2IX1A 3K58A 5IIFA 2BE5C 2WXIA 3Q0AA 2JSVX 2PCFB 4PT5A 4H13C 1G291 2F1MA 4QB4A 1C4PA 2XWBB 3C1EA 2LY7A 1EIGA 4FF1A 2V0GA 1STGA 3I9V1 3NVYA 1HQMC 5M5WB 2KDMA 3SK4A 1MBYA 1QLBB 2HCIA 1O7LA 2F3WA 2WV6D 4XE0A 3TSSA 4L23A 2K33A 3TEWA 5JEAG 1XWEA 3PZ7A 5JVG3 4J3OD 5CBEE 1XLNA 3EGRA 2JA8B 1IBXA 2M2LA 2BB5A 2W55A 5T1GA 1L6VA 4ABNA 3N6RA 4DN4M 4ZRZA 4JPSA 3DWMA 3A8JE 2WNMA 3Q8EA 4GZYC 1ONLA 2E2HB 1TS5A 3HKZB 3NRZA 3GTMB 1Q10A 1QKZA 2DBYA 1EY5A 1A2TA 4ZUIA 5A2QE 1ROEA 5G3LD 4C3JB 2B2WA 1I3QB 2NTSA 2BS2B 4MM3B 1B9MA 4BBRB 2AX5A 1JW9D 3R93A 2I38A 5NUCA 1OXSC 1UAPA 2B2YA 4KY7A 3TP7A 2MHVA 4RGNA 3AMUA 1BF4A 3IL8A 2MP1A 2YYZA 3D4WA 3MXGA 3SFEB 2FHTA 1L0YB 4FXGC 1BNZA 4XDCA 4WJWA 4CGYB 4N59A 3HG9A 3S2DB 3GTLB 1EY9A 4B9WA 1WXQA 5BYQA 2HCCA 3K7AB 1AW7A 2YEPF 4UAIA 4L2YA 1SB3C 3TEXA 1U9RA 1G6ZA 3RD4A 3CRLC 3EJIA 5C0XI 4N9TA 2H89B 2WXHA 1P7FA 5CV9A 1P7EA 3DWQA 1GPXA 2SDFA 2LKVA 3A8IE 1WTWA 1E9MA 3ZJVA 2EKIA 3BK2A 1GOZA 2JYOA 4U673 4H7BA 4RCNA 4C3HB 5C0XJ 1PRTF 3FMCA 4G57A 2QIEB 4RKBA 1SNCA 1J7AA 4NAMA 1YNND 2EXZA 2O5IC 4B9XA 4B08A 2EVBA 3OMGA 4K2LA 2D2CC 3U9OA 4YTMB 4OO1I 1QQRA 2BBCA 1F2RC 2K0PA 1BCPD 4WWMA 1F2RI 1D6EC 1XCTL 5BN3A 3HOYB 4FNFA 4C80A 1Y8NB 1Y1WB 2L1AA 3LB8C 2PIAA 2KEEA 3SDZA 2F0TA 4OO1G 1VDZA 3E0JA 1HEZE 2L83A 4RF0A 1VR9A 3HOUB 5JEAJ 3NTKA 4DFAA 5AUKA 5BYRA 3AM9A 1BBXC 3J80L 2JWUA 2K3UA 3HOWB 1TQOA 3PUWA 3ZYYX 3ONAB 4KY6A 3TMEA 2VB2X 1EL0A 4J6HA 1FCCC 5BMHA 4ITKA 1BUIC 5IGFA 1AFPA 5I2YA 2M56B 3J9CA 1HA6A 4EE2A 4WIPA 1JWBD 1HRJA 1DM0B 3T56B 3V05A 2PYKA 5M5XB 3TN2A 1QILA 1JR0D 1NI3A 1IUEA 1XO3A 1AWDA 3PMFA 2JE6I 1YQ4B 1T5EA 1NAPA 5CV6A 1JWUD 5JPMC 1R7SA 1SNQA 1DJRD 3DWAA 5MPOA 4IKGA 5EKKA 1X32A 2NUCA 4A55A 2DY7A 3GTGB 3LXFA 2Z8LA 1C4AA 1DOLA 5JJZA 3FEWX 3R8BA 1FRDA 2A69C 1B9RA 3BG3A 2WIIB 2SOBA 2N0SB 2K5DA 3C3LA 1ZEQX 4HCEA 3ABVB 1FFUA 1OO9B 1ILPA 1ZE3D 5E4XA 1VF5C 4KTAA 1PTOB 1F9QA 3MA2B 2WDVB 3IAS1 1HUMA 1UWMA 2DYOA 4GDKB 3FPPA 2F0EA 2L12A 2A6EC 4HR7B 2MJEA 3BDOA 1QOFA 2E74C 1H9SA 5CV8A 1T6BX 1B2TA 1DOXA 3VYUA 2EELA 4FVMA 5JOBA 4V190 5T1IA 5LNK1 2BT6A 4G7OC 1FRRA 1G2SA 1TS3A 3MAQA 5COYA 4IUNA 2W3SA 1PYWD 1C48A 2VB3X 2OT2A 2EYLA 2XN9C 5AUIA 3DEPA 1Q1EA 3EQLC 1EYDA 2HDMA 3I70A 1QOAA 1JROA 1V97A 2CU3A 4US8A 3MC0B 1LTID 1O80A 3AB9A 4X3UA 4O1NA 5IGGA 3EROA 3EA6A 2V3PA 2I2YA 4XQQA 3KUPA 4A93B 2CJOA 4XT1B 5TSSA 3S1NB 1SNOA 1ET9A 4NZLB 2IW3A 3J81L 3SK8A 2X6LA 1T5XD 4IUPA 5I9PA 3GS2A 3M3YB 4FP5D 1OXVA 1ZXHA 4IZ8A 3DXJC 3HVZA 1S5DD 3L4PA 3DUZA 2F0JA 1I6HB 1LTAD 4JWUC 2IDYA 2DN8A 4LAAA 2RA4A 4FO2A 5CMDA 1SYDA 1LT6D 1AN8A 3KLSX 1HTPA 2ZW0A 2NVQB 1WYGA 5D3IB 4ZKBB 5E4WC 1ZDXA 4B0EA 2WDQB 3J7YW 3K0YA 3MFGA 1CA5A 5GXGB 3AEDB 4JWSC 4LJZC 2PZTA 3S15B 2PW7A 3Q8FA 2F03A 2MEKA 5KNCA 2F0IA 1C78A 1GUSA 3IKJA 4C3IG 3VYTA 1CZWA 3TZDA 1YN4A 3VRBB 2ON8A 4USAA 2H88B 2Z4IA 4GLSC 1I50B 1F9RA 1FGBD 1U4RA 5FLXE 4X3KA 1EM7A 4DNRB 3W1SA 5C4XB 1HZ6A 1W6JA 3TP8A 4HSVA 1PGXA 2NB0A 1U4PA 1KAAA 3CHBD 1AZPA 3DEOA 3MWYW 2XVSA 4ZUJA 1EIHA 3N9YC 4IALA 2F0FA 1RKNA 4I65A 2NVTB 1CZPA 3T51B 4WAFA 2RBMA 1FMAD 4RNAA 5C6AA 5C4HA 1SEBD 4KI0A 5M9OA 2MJ8A 5ELEA 4DGZA 1HTLD 1TYGB 1TY0A 5IGDA 2WXFA 1EYCA 1PXUA 4TQUS 4JK1C 3HOVB 3ZGZA 2AQ3B 2BDNA 3VR5A 3NK9A 2YU9B 1MSHA 2JU6X 3K5MA 4BS9A 3KLRA 3ETRA 3D8GA 3JAME 4Z9CB 5IGBA 2R92B 2K1BA 2B76B 1ESFA 4X3SA 1JOKA 1A70A 1GHKA 5E3FA 2RMMA 2ZXPA 5E6JA 2EZVA 1ZXTA 2FMMA 4TSSA 4CJ2C 5D7GA 1S5ED 5ELCA 2H4OA 2EOTA 3S1RB 1PTOH 4H0LC 1PRTB 4ZQ3A 2KEDA 4KJOA 1KH0A 1YMHE 2B2TC 2F0QA 1VRAB 1G2TA 3ITPA 3PIP3 1CTMA 2LMCB 1SE2A 3CU7A 3OIPA 3MXNA 4C3HG 1UNSA 2CW0C 3D3RA 2N7JA 4CBVA 3M4OB 4N58A 1SAPA 3AEGB 2YEPB 5M5YB 1WVLA 2WU2B 4LK0M 1M8AA 2NMQA 1JQ4A 2F0MA 3M4YA 2WU5B 3CIRB 2K01A 5JAVA 4DAVA 1II3A 1U4LA 4J8QA 3VR3A 1R9TB 5BYSA 4HROA 3VQIA 4KKUA 1ZYRD 1I7HA 4A9AA 5LL6S 2XNAC 2L32A 4TKOB 3HS0C 2W82A 4HCSA 3H8HA 1YNJC 1FNWA 3AE8B 1VZ6A 3L7ZC 2B63B 1YN5A 1WTQA 4FXKC 2BYTA 1C76A 2LS01 5EPKA 3OWFA 1GAQB 1H9JA 1KRHA 1D5XC 3A54A 2E6XA 3HVDA 1C8CA 5G5HA 1L4ZB 1EZ8A 2V3NA 4HMIA 1GUWA 1XLOA 3NS1A 3G7LA 2ENBA 5JXVA 5K36G 2CJNA 1S4ZA 1KTKA 1F9SA 3AU7A 3X3MA 5G5GA 1QNKA 3TP5A 3T16A 2Y3AA 3TP6A 5KNBA 2KOLA 2D5GA 1B4OA 3HRZC 2G1EA 3U2SC 4WURA 2FMCA 1SXTA 3GV3A 1YJIA 3QWNA 1QF6A 3SE0A 2AWNA 1N62A 2L4NA 2F0PA 3IAYA 1PGAA 5JEAH 4G7ZC 4KHVA 5LL6X 1RHPA 1PDXA 1EFID 4YT0B 2F0GA 3MHBA 5EJWA 2OXPA 1X3PA 1C4CA 1TY2A 1I4RA 1TWFB 1XF5L 3G6JB 2RSOA 2SNSA 1EZ6A 2OF1A 1PTOF 3GTKB 4TRDA 1JORA 1HFGA 1XYIA 2PNRC 1FEHA 2QDBA 1H9MA 1B1ZA 2VZKB 1TWHB 2B2VC 2E76C 5HFYA 1OXUA 3PO0A 1KLGD 4P2CB 1LTBD 3LYYA 1RFKA 3NXWA 4OZCA 3S17B 2L1BA 4QUFA 1F9PA 3R2TA 1KF6B 3U52E 1LTTD 4G7HC 3V2TA 1OQRA 2V4DA 1E6EB 1Q12A 4OIKA 2A5HA 3RZOB 5KNDA 4NMZA 1SE3A 2WXGA 3I4NB 2A6HC 4CKCA 2RDFA 1H9SB 4PQXA 1GXDC 3PV0A 4Y7NB 3H6MA 3Q8BA 1CFMA 2BA1A 1DONA 3UI3A 1PZJD 3SR1A 2NTTA 1CA6A 5D3DA 1EY8A 1A3VA 3RPFC 3OMCA 4HEA1 1V1PA 3AE1B 1MD2D 1WWTA 1C79A 3H91A 2ACZB 2VUMB 4HJGE 2JX5A 1Q3LA 3QB3A 1KNAA 1D1IA 1OXTA 3GV6A 1F2MA 1SJED 1KLUD 3GP7A 3PZ8A 2Y0SB 4DK0A 1TKGA 3H09A 5ELBA 1NENB 4DU9A 3S9WA 3NSWA 2WKDA 4CHTB 2IGGA 5DM63 3GB1A 1ENFA 3M7NA 4OHJA 1ESRA 4IDIA 1CQVA 3K6OA 4F8MA 1O78A 2Q8TA 4YSYB 3I90A 2WB1B 4RCOA 5ISRA 3HP3A 2QJLA 2WXQA 2BS4B 3P42A 2NWGA 3MFYA 1B50A 4CQNA 3P4SB 3P1HA 4KKIA 5FK9C 3TUOA 1V8QA 1TKEA 1IKLA 3VYSA 1J8IA 1JWAD 5EE3A 4YWGG 1T3QA 3KQ4A 1QOHA 1EY0A 1TWAB 4RHRA 3VYRA 1FO4A 2XIWA 4DF7A 4YTPB 3PUZA 1DGJA 3P7JA 5J1ZA 2B2WC 1WTVA 1NR2A 2RSNA 1YJJA 5KYLA 4EGVA 4QF4A 1WTRA 1TT2A 1L4DB 4E6IA 1KDBA 4BBSB 2B2UA 1OXXK 1TU2B 2IGHA 4A3MB 4R9WA 3P1MA 3S1QB 2E2DC 4DXFA 2HTME 5H8YE 2INPE 2L0CA 4KX6B 4ZHOA 3MVVA 3U4EG 4P16A 1SIJA 5KGUA 4KD3A 1B3AA 2NVYB 3I72A 1FFVA 1TS4A 4OIJA 1MI0A 3W2DA 4AQ7A 4PV1C 4G4KA 4K5XA 3VA7A 5KYIA 4BY1B 5J39A 3DMUA 3I91A 4OVZA 2LFIA 2LUMA 5C3XA 1ZDVA 3OWEB 1FYCA 2Q8RE 1EEID 2SAKA 2C5CA 5ELFA 2EY1A 2WP8J 1A15A 2NN6I 1QG7A 1JB3A 1VLBA 2K9XA 2F3VA 3BDCA 4A3KB 3FKIB 2K5PA 2KECA 1RTNA 2PZUA 3K5LA 1K83B 4WFN3 2LHEA 4NJCA 4MH8A 4WQMA 4F87A 2RDHA 4WORA 3IAM1 2K28A 4MHEA 5C5LA 3C2PA 4IFDG 1NEKB 1N63A 5EKLA 1SFOB 2QCPX 3K59A 3I3CA 1J7CA 2X6GA 3AE2B 2ZXRA 4KKSA 2F0LA 1BXTA 4RWSC 5CYUA 5BN4A 2JQRB 3VR2A 3H0GB 5A35A 2NVXB 1FD6A 4XYOA 1JCKB 4RGTA 1WTXA 4LLGM 1UUPA 1LTRD 4M1UB 2J42A 4F88A 1CI3M 1EY4A 5I2XA 4K2KA 2BE5D 3LWEA 4KN4C 4WH4A 2AUJD 5EBCA 1ZOYB 3KWLA 3AECB 2BDOA 1W6KA 3NE5B 3MXPA 1DXMA 4OO1H 1F2YA 1SE4A 3MEHA 2JXMB 1XLQA 4XDDA 1Z7TA 1SYGA 4NAWB 1HQRD 1PZID 2Q8IB 2A68C 1JQYD 2WINB 3PO2B 2XRSD 3AB5A 1LTGD 1ZP0B 2XSCA 1XTCD 3NTHA 1ZPSA 3T53B 3FRPB 2EY6A 4C56C 1D4BA 3A7LA 3SFDB 2NYZD 5CBAE 2L5TA 4L6TB 5EBDA 2JEAI 2AQ1B 3KK7A 5I6WA 1WD0A 4J1MA 2K5QA 3EVQA 4A3BB 4EQNA 3NVZA 4HSPA 2B8FA 2VXWA 3NZ3A 3J81E 1K8OA 2L55A 4C2MB 2MJ3A 4KGSA 4TQ0A 3GO5A 1Q8IA 5CV5A 2BCOA 3L3OC 4HEDA 3BDLA 4IUUA 4A3DB 1S5BD 3CRKC 1KFYB 2C9OA 2EJMA 2V4IB 5K36H 1HUNA 1F2ZA 5EQ0A 1E0ZA 3I57A 4ZAIA 1QT9A 1F0ZA 3DHQA 3C1FA 1GHJA 1Y56A 5C4JB 1TWGB 1X3QA 3QJYA 4JBWA 4ZYSA 5IT9E 3GTJB 1YNNC 4GDLB 1STNA 4EVOA 2W54A 2O4XA 5I4DA 3KBXA 1HA5A 1HCZA 5EGTA 1Y8OB 2K6AA 1UGJA 1C4QA 3FPUB 3OHXC 4XDXA 5C0XH 2E75C 4K6LA 1SSNA 1KDAA 4HTHA 4A8XC 4OZBA 3P4PB 1I4XA 2KCCA 2LGIA 2O5JC 2K04A 2MPMA 2A6HD 2IX0A 2NZ1D 4RH6A 5ELDA 3HRDD 4OL7A 4IUVA 2IX3A 3GD7A 2MGSA 1Z47A 2A73B 4RKLA 4KGRA 3CQZB 2TSSA 5EE1A 1LT5D 2G9HD 1PFNA 2RPVA 2WXRA 2PVGC 2N55A 3X3NA 1ML0D 3NVVA 1L0VB 4HN7A 1IKMA 1EWYC 2WXMA 3I73A 1D5MC 1FNUA 1TWCB 2WQYB 3TEZA 4XT3B 5HURA 5BN5A 4XYQA 4LK1C 5C3EB 3P20A 4FXCA 2WXKA 1STAA 2F0SA 3AMZA 1JICA 1BR9A 3SK6A 2DNEA 3NUCA 1K50A 1KABA 4A3JB 2WXLA 1GB4A 3HGBA 2QKIC 5DEHA 2FUG1 1R4PB 2KCNA 4K8IA 4QCLA 4A3FB 4KD4A 2F0DA 1V1OA 4HMJA 2SEBD 1TKWB 1BUVT 3WDNA 4BY7B 5C3WA 4PMWA 1IW7D 4LTUA 2LHDA 3OSOA 4KHZA 1PTOD 4KKJA 3ND8A 2O2LD 2K7VA 3DWGC 1JE4A 4ZK9B 2JP1A 1F2LA 5E1FA 4ZKCB 2ONQA 4A6QA 4TQ1A 1XX8A 3I8ZA 2BOSA 3E6ZX 1ENCA 1I4QA 3LNNA 4YSZB 3V96A 4ARIA 4FXDA 2JA7B 3FDTA 1JRPA 1XEEA 4C1NK 4KKTA 3AEBB 3O13A 4REZA 3RZDB 2PKOA 2A69D 1SYCA 1WSPA 1GUOA 3BVZA 4MACA 1IYUA 4A90A 4KJNA 1NSNS 3P75A 3W3AA 1Z6HA 5C2TB 4FF3A 2FINB 4LMQD 3A55A 4NKLA 4BA1I 5CV4A 1K53A 4D2KA 1G91A 4R8NA 4UDUC 1WTPA 1BMLC 3GTPB 3RFZB 3HOZB 1NYRA 2LFNA 2F0UA 3Q6SA 2PW9A 2J4XA 1LT3D 3HOXB 4CKEA 3A8KE 5A2QL 1PRTC 5DNFA 1PGBA 1N5WA 1SYEA 2Q5WD 3RMHA 4S3SA 2FFKB 2E3TA 5FOBB 2JZPA 3DWPA 2EY2A 2RQXA 1RF2D 1RTOA 1O7ZA 3GTOB 5M3FB 1STEA 1L5PA 2DNCA 1FD7D 1STHA 3V3XA 4QIWB 1CQFA 2I46A 3LWUA 4IFDH 3PUXA 3VR8B 1AZQA 4XWWA 4B0MA 4US9A 3SXHA 3BYTB 2KJXA 2DWQA 3QG1A 1PZKD 1RD9D 2LMCA 1IL8A 1TIID 4RGMA 3B2FA 4IURA 4IUQA 3BVMA 3TDQA 3Q69A 3SR6A 3NHHA 1VMPA 5CORA 4L8JA 1F77A 4RFBA 2Z1CA 2K5WA 3J7AF 1YQ3B 2A68D 2OEOA 2PPBC 5JVH3 1VZ7A 1TJEA 5F2DA 2PVOD 4U68A 3M7GA 3NBIA 3MXUA 3W9CB 2JYTA 5I9OA 4RAUC 1DD2A 2INNE 3D4RA 2M00A 1IGCA 2H1EA 4MIUA 1WTOA 2EYPA 3DM1A 3BYYB 1TR5A 2KWDA 1TKYA 3K57A 5CGKA 4YSXB 2PZWA 3U7ZA 4L63B 1LACA 4IQZA 2IL8A 3GQBA 5IGCA 3IFDA 2JYEA 1QOBA 2WS3B 3SEBA 2GA4B 1CHQD 3TZUA 2CHBD 3IT6B 2CQAA 2F0HA 1RODA 3SHLA 2CW0D 1D2BA 2K05A 1IBXB 4O42A 1E10A 1VCIA 2M19A 2MH7A 4EQPA 4N6EB 1L0XB 2EPBA 1EYAA 4C3IB 3HZXA 2WACA 2L11A 4K5WA 4XQNA 2WXPA 5IGEA 3D6WA 3OW7A 4C1NI 4YTNB 3LX0A 5I6YA 1PTOC 1GJXA 4K5VA 4HRSA 5IOCA 3Q22A 2EJFC 4KK7A 1N60A 3MHZA 4RF1A 5FR3A 3OPOA 1EOTA 3J7AV 1JWMD 1SBBB 1RDPD 1H9KA 5EKIA 3U9SA 1WD1A 4XQJA 4AYBB 1EU4A 2IT1A 2B2VA 2RVLA 2EYFA 3H3VC 1I6VC 1K51A 4FYDA 2K03A 5K5PA 2JA5B 3A7AB 2BTEA 2JSOA 3H94A 1G8ZD 5KIXA 2F0WA 2PMZB 4K14A 1WGKA 4ZLTF 4Q2JA 4FF2A 4R3DA 4WRDA 1QE6A 1FXIA 2M9VA 3VA5A 3PIO3 4KV6A 3WOFA 5EPLA 3I4MB 1SF0A 5C4ZA 3VR6A 1TVXA 2JEBI 4XXEA 3AEAB 3FAHA 2L9HA 2FJ2A 2EE1A 2J52A 3FILB 4V0BA 3AEEB 4HKQA 4K8JA 1K8MA 1PRTD 2WDRB 2GB1A 2VNUD 1CHPD 2N88A 3R3OA 4ID6A 2B39A 1JMLA 5HHDG 1DCZA 3ZJUA 1C9FA 2J0TD 2N9LA 5BMGA 2D62A 1MVKA 2AWOA 2KHSA 3D31A 2LJIA 3BIID 2PQEA 2XWJB 4XTCS 2FE8A 2PTLA 1PFMA 1ENAA 4Q5VA 2X69A 3NQTA 1RJTA 2AUKA 1ZUD2 5D65A 1DZ1A 1NYQA 2KACA 1NVID 3NVWA 3CKIB 3RUZA 1A3TA 1PFBA 4OZAA 1ZYRC 1BO0A 3M85A 3Q8CA 1JC7A 2A74C 1HPCA 4PNYA 2J7ZA 3NQIA 1PFDA 3GTQB 3AE9B 2XRQD 3N52A 2KA7A 1L6UA 3A56A 3FVQA 1LV9A 3KBGA 4QUCA 3P4QB 1RCVD 1Y69U 3QIAA 1KDCA 5DAUA 2PW5A 3VR4A 2ICIA 2KMMA 3E5SA 4DXGA 5IODA 2PMVA 3AE4B 2X38A 3Q24A 2PLPA 1S5FD 3NPPA 3BS1A 3JAML 3PO3B 2GI9A 2F0KA 3RLFA 3KF8A 1CK1A 1N61A 1ACCA 2BW2A 1ZKOA 2M0AA 2NN6H 2G9DA 3MJ5A 3C46A 1MI2A 5EPJA 4ZRQA 4A3GB 2D9UA 4TMAB 1GB1A 5EE9A 2E2JB 2B8GA 3FILA 1EY7A 1DOIA 2KAJA 4IFDJ 2F0VA 4F7XA 3KLSA 4A3EB 3T3OA 1EQVA 2WXJA 1FNVA 2TMPA 1PUTA 2Y5PA 3OOCA 4KGTA 5C44B 2R61A 1SNMA 1PDQA 1PMRA 3J80E 5JPNC 2QMTA 2EYMA 1SYFA 2K32A 3AE3B 4MT5A 4RA8A 3TBIB 4OW0A 4MN3A 5D14A 2Z4HA 1BCPC 1WCMB 1I4GA 3I4LA 1J7BA 3PUVA 2I07B 4Q0FA 5LHY1 3S14B 3SVMA 5HI1A 4ZHPA 2B2UC 2QILA 4IUTA 1MHHE 2JXTA 5AFWA 1UEAB 1VJKA 3Q23A 3CWIA 3BVGA 1NUCA 3K5OA 2LEKA 1CM9A 1JOOA 1DOYA 4KN7C 5FO8B 2D5DA 1A2UA 2WAQB 1C77A 2J53A 1S5CD 4ULLA 2B2TA 1B53A 5KEEA 1E7PB 1YN3A 5FO7B 1IHZA 1Q1BA 5CV7A 4A3IB 4NDXA 4FF4A 3S2HB 2OEDA 1SMYC 2BS3B 5FKAC 3T4AC 3P63A 1E2VA 1LO5D 3MZ5A 1CZGA 3S16B 2QSDA 1QJOA 3P4RB 1AEXA 4M0WA 4C7ZA 4DAYA 2F4IA 1EY6A 2KQ3A 4L1BA 3VR9B 3ND9A 2NBFA 4HAEA 2IWHA 4NW2A 4N9PA 3B2GA 4DAPA 1J9OA 5FO9B 4DA2A 3VRAB 4KMUC 2R3ZA 4XIGS 4HKZE 3S1MB 5H92C 2R93B 3NWSA 3AN1A 1EWHA 3D6CA 1O7YA 2ZT9C 1LLRD 1OQQA 1MPEA 4CJ0B 5EE0A 5HG2A 2WKCA 1TS2A 3E56A 1QCBD 2ID0A 4X3TA 2HDEA 1DOMA 3BK1A 3QO2A 5C5MA 1ICWA 1Q90A 2ZW1A 2ICEC 1CJEA 1HHVA 2PO4A 2KUMA 1IW7C 4K6DA 2EJGC 1PLFA 1MSGA 5HGTA 3SK5A 3C8YA 5C0XG 2L52A 3D4DA 1FXAA 3B9JA 2JA6B 3IFTA 2QEJC 4DK1A 2BB6A 3ZQ4A 2RDGA 1HFNA 2W3RA 4BWGB 4YXDB 1DYQA 1GUNA 3NP8A 4ARCA 1CT1D 2EYJA 1MGSA 1H9RA 3AV8A 1B44D 2EDGA 1SNDA 2MUYA 4RGOS 1BCPF 2CVRA 2EYHA 1XLPA 3L9AX 3E9SA 2VZKD 2NN6G 2EY5A 4ME5A 3AE6B 4DQOC 1SSOA 1I4PA 1D1KA 1NR4A 1NCVA 1RWSA 3BZDB 1YNTE 1N5XA 2F0NA 3WCQA 1JOQA 5CC4A 2QF7A 2R6GA 3F2UA 1A3UA 1V8CA 3EFXD 3AE7B 3AH7A 1E2WA 3EUB2 1E2ZA 4ZRPA 1M4VA 4NP5A 1QB5D 1LT4D 1OFFA 3MP9A 1RM6C 2Y5CA 2N9KA 1FCLA 4JX1C 1YNJD 2HDLA 1GUGA 3UI2A 2WLBA 3NUHB 1E0BA 5G3LF 1VF7A 2OHFA 2DYMA 5DM73 2EYOA 1STYA 1IGDA 3KWVA 3QOLA 1IYVA 4C3JG 1LTSD 2B2YC 4YIJA 1QNUA 1GUTA 1Y8PB 3PUYA 1QWYA 1SDFA 1VDVA 1JWSD 4AS1A 5KRUA 4KY5A 3K5NA 1SMYD 2A6ED 4P6VF 1AP0A 1VZ8A 2IJ0A 3HEJA 1Y1VB 4DNTB 1EQTA 1SJHD 3IXSA 4CKBA 1I4HA 3AE5B 1MHXA 1U4MA 2FBWB 1K52A 5C3JB 3QOJA 2AQ2B 1TZOA 1XCQL 1FR3A 4PMBA 2DLBA 3W5UB 3T13A 4OGQC 2SNMA 2KQ4X 3TEYA 2IGDA 1KNEA 1ILQA 4ILWA 5FLXL 4I7ZC 1LABA 2MJDA 4PMCA 1HXYD 2WXOA 3WOEA 1EWCA 3R2IA 2RKSA 1EEFD 4ZOHC 5J22A 5IT9L 3AEFB 2R7ZB 3ERQA 1UWXA 1STBA 4H2AA 2GRIA 3Q8AA 1XXGA 3ZJTA