2NTSA

Crystal structure of sek-hvb5.1
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
217
structure length
217
Chain Sequence
QGDIGIDNLRNFYTKKDFVDLKDVKDNDTPIANQLQFSNESYDLISESKDFNKFSNFKGKKLDVFGISYNGQSNTKYIYGGVTATNEYLDKSRNIPINIWINGNHKTISTNKVSTNKKFVTAQEIDVKLRKYLQEEYNIYGHNGTKKGEEYGHKSKFYSGFNIGKVTFHLNNNDTFSYDLFYTGDDGLPKSFLKIYEDNKTVESEKFHLDVDISYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/immune system
molecule keywords TRBC1 protein
publication title A novel loop domain in superantigens extends their T cell receptor recognition site
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ntsA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ntsA01
1PYWD 1RD9D 1CHPD 1F77A 1AW7A 1I4RA 2CHBD 1V1OA 1LLRD 1ENFA 2G9HD 1EFID 3BYYB 1I4PA 1SJHD 4RGMA 1UNSA 4TSSA 4RHRA 1STEA 3URYA 1T5XD 1MD2D 4DXFA 1PTOH 2QEJC 1HQRD 3GP7A 1I4GA 1S5FD 4BWGB 4ZYSA 2O2LD 5I4DA 1SJED 4DXGA 2XN9C 1RDPD 5D3DA 1M4VA 5ELFA 1B44D 1JWMD 5ELBA 1PZJD 4UDUC 2RDGA 2SEBD 1TY0A 4RCOA 1LTID 1BCPC 1JWUD 1S5ED 1LO5D 1V1PA 1KLUD 1EU4A 1TY2A 1RCVD 1PTOD 4Z9CB 1UUPA 1FGBD 3BYTB 3DWQA 1JR0D 5TSSA 3BVGA 1FNVA 3O13A 1PRTB 1PRTF 1CQVA 1PRTC 3MFGA 1LT3D 1FD7D 2AQ3B 1YN3A 1CK1A 1D6EC 1S5CD 2WV6D 3MC0B 1L0XB 1L0YB 1LTTD 1RF2D 1SEBD 2NTSA 2XRQD 3EFXD 1D5XC 1BXTA 3DWPA 5ELEA 2NTTA 1BCPB 1BCPF 1XTCD 2AQ2B 5FKAC 4C56C 3V05A 1S5DD 2Z8LA 2XNAC 1TS5A 4RGTA 1QILA 1TS4A 1JWSD 1B1ZA 4K6LA 1PTOC 2IPKD 1EEFD 1SE3A 1HA5A 4RH6A 1HXYD 1SE4A 4RGOS 1I4QA 4L63B 1EU3A 1HTLD 1LTAD 3R2TA 1SE2A 1I4XA 1LT6D 1EEID 1SBBB 2J4XA 1YN5A 1CT1D 1SXTA 2TSSA 4L6TB 1TS3A 5ELCA 2QILA 3CHBD 4O1NA 2RDHA 1ET9A 1LTRD 3R8BA 1YN4A 1LTBD 1LT5D 1FNWA 1AN8A 1S5BD 1D5MC 1JQYD 1KTKA 1ESFA 1D5ZC 3EA6A 4NZLB 3R2IA 1I4HA 1KLGD 1LT4D 1EWCA 1LTGD 5D3IB 1DJRD 1PZKD 1G8ZD 3TSSA 2AQ1B 2ICIA 3BVZA 3W2DA 1PTOB 1PTOF 3BVMA 4RFBA 1TS2A 1CHQD 4RGNA 1PRTD 3SEBA 2R61A 5FK9C 1XXGA 3BZDB 1DYQA 1LTSD 3KLSX 2IJ0A 4RHSA 1ET6A 5ELDA 2XRSD 3OWEB 1FNUA 1JCKB 1BCPD 3DWAA 4OHJA 1GOZA 1V1PB 1PZID
chains in the Genus database with same CATH superfamily
3PIO3 4JWSC 3GO5A 3CCMA 1AW7A 3PIOA 3GTOH 1IYVA 1N9WA 1UGJA 1EFID 2M56B 2MX2A 1B50A 1X3EA 4N6EB 3VYSA 4TSSA 4MZ9A 4NAWA 1TWCB 1TQOA 3FC4A 1CFMA 2EYHA 2CR5A 5A35A 4A55A 1N36Q 1UWVA 2EYJA 1C4CA 3MP9A 1XYIA 4XE0A 4A75A 4WRDA 3QHTA 4HJKA 5E4WC 3DHHC 2ES2A 2BH2A 1NAPA 1YD8U 1TKEA 1PMRA 1SMXA 1CKNB 5GMVA 3MVVA 1VZ7A 1DOLA 1EIFA 5LHY1 2L5TA 4LNFA 4OO1I 1V9PA 4RKLA 2LXCA 4LAAA 2EZVA 2BDNA 4IJLA 4XYOA 4IUTA 2IBIB 2MLBA 4CGYB 2RD0A 4TV3A 5C4JB 1J5EL 1RLFA 5ELNA 4YHHQ 5GAEC 1F2YA 4JC0A 3ENEA 3M3YB 3NVZA 3A5ZB 1PH1A 1PGXA 2ACZB 4H0LC 3RNAC 2UU9Q 2I5HA 2N9KA 3VYUA 5DM73 4JI0Q 4EQ5A 2VQEL 1CM9A 4J6HA 5I9PA 1E5WA 2DAJA 3KLWA 2M8SA 2ONQA 3CIRB 3FP9A 3DQVA 4PMCA 5IGDA 2PYKA 4BY1H 1L0YB 5IP4D 4QGUA 2F0TA 3ALBA 4AS1A 1LTTD 2N78A 2OJRA 4C3IH 2OJWA 4YY3L 2NVYB 4WJWA 2OHFA 3S1NH 2D3GA 2K6QA 4HWIB 2ZJDA 4EQNA 4WJNA 1ZEQX 4IQZA 3NENA 2B2WC 1L0VB 1JWSD 3BY4B 3FILB 1JB3A 4LF5L 4QIWE 2HDEA 3LJ3A 1V8QA 4IM0A 3GTQH 2DNCA 3HOZB 1P7EA 1TJEA 1X1MA 4GMVA 2NPTB 1SE4A 4L63B 4IPCA 4QL5A 1P9DU 3M62B 2PJHA 1JW9D 5EE9A 1TWHH 4KY6A 1EEID 1YJJA 4GIVA 2PZUA 3P4RB 4N8FA 1YEZA 2TSSA 4HIDA 4BOZB 5ELCA 3IXSA 2N9EB 1JOOA 4A3KG 2GB1A 3NG0A 3VAWA 3LB8C 2V4DA 3RR5A 2GBRA 4IG7B 4F88A 4US9A 2EYPA 1JMCA 3A8JE 3NBIA 4B3RQ 1HUNA 1EOVA 3ULPA 3M4YA 1MFWA 2K01A 2LXJA 1JB7A 1MI0A 1ZXTA 3IT6B 4HXDA 3S14H 2CW0C 1TS2A 5DPWA 3OWFA 2DWQA 5FLMH 1P1AA 2F0WA 2MBHA 4CDFC 1K9MC 1MVKA 2D3BA 3K9PB 2Z6KA 2O6VA 4ICUA 3DDCB 4WWOA 2R7ZB 1II3A 3NVWA 1FEHA 4MSQB 2KVMA 3Q69A 3LNNA 1MHWC 1P98A 1QUQB 3DWAA 2B3AA 3IBEA 1J8CA 1J0GA 2NWGA 3QJYA 1OQQA 3KUDB 2C60A 2M00A 2PW5A 5COYA 5H1SE 3ECIA 3QWZB 4NY0A 2MP2A 3UIPB 3S2HH 2QW7A 2EE1A 2WAQG 1SSOA 2Z4IA 4RGMA 4WJ3M 3PUXA 1PH5A 4A6QA 4WJPA 1D7QA 1FO4A 5C44G 4RMFA 1MJDA 3HOUG 1IBXA 1MD2D 2K33A 4AH6A 3NE5B 1UE5A 1GUTA 1GKHA 2ZXPA 4IFDH 3AE9B 4OVUA 3SXHA 1ZDXA 3DM1A 3L3OC 1Q81C 1IBMQ 2PI2A 3P42A 4YCWA 1EY8A 1E7ZA 2B63H 2KAJA 3A9KB 3ZRCA 4EE2A 5JEAJ 4GKJQ 2EVBA 3OJ3A 5D14A 5EGTA 3D0FA 2RGFA 4W9FA 1B44D 4IOAA 3QOLA 4JI5L 1PZJD 1NCVA 2RMMA 4G7ZC 2CH4W 4DFAA 2NBFA 3FVQA 4KKSA 4TRDA 4WORA 1N34L 1VZ8A 5IY0A 3MHSD 5E6JA 1JWUD 3NEMA 3U30A 1MKHA 4QMGA 1F9SA 3RD2A 1C9OA 3IVFA 3J81i 3PO3G 2L00B 3SVMA 3UDXA 1K8RB 3CCEA 3OLMD 2HCCA 4LF4Q 2XEWA 1Q90A 5JOBA 4NDXA 3TEHB 4E6IA 4NXMQ 4BXXH 4C4VB 1EUVB 1ENCA 2GVBA 3CRLC 1OGWA 3FHWA 4US8A 1PFDA 3HFZB 1WYGA 4A4IA 5H92C 4OXPA 4PQXA 3J80L 3TRZA 2TMPA 2M4NA 1Y1VG 3GTKB 1WXAA 1TYGB 2PE9A 1H95A 4M8NA 4P6VF 2DYMA 1SEBD 4R4QA 4IWOA 5KHOA 1SROA 3H0GG 5EKIA 2JA7H 4KD4A 4CJ2C 1KJTA 3KQ4A 2AQ2B 1TT2A 1JALA 1JORA 4ITKA 4DR6Q 2H1EA 5M3FH 1PH2A 2QF7A 2A68C 1B1ZA 4QUCA 4R8IA 3KUZA 4YSXB 1E0ZA 3KYHC 3C1FA 1SE3A 4L23A 3A4RA 3RZOB 1JJGA 2DJGC 2B29A 3X3MA 5AJ3L 1OQRA 3ZJYC 4FULA 4DK1A 1I4XA 1LT6D 4HDOA 2RHSB 1SBBB 4CKCA 1NBWA 2J4XA 3DHQA 1BUIC 2RQXA 1R7SA 1SXTA 3P4SB 1D2BA 4E3CA 4RM8A 1DM0B 1ET9A 1CUKA 4LNIA 4Q5VA 4DAMA 2A6HC 2WDQB 2PEAA 3T9LA 1GAQB 2JXMB 1U4LA 4A3DH 3UIOB 4B0EA 4KKIA 1RTNA 5GROA 3M7GA 1HNZQ 1K8OA 2V1CC 2N7DA 3MXPA 4DR4L 1K8GA 3WA0A 4TUUA 1LTGD 2YTYA 4DK5A 4GGQA 1HRJA 4GLXA 4J3OD 3RZWC 2WQYB 4FP5D 3ZJUA 1N62A 4A3JB 2PZWA 2NBVB 4DV3Q 2CHXA 3MJ5A 3AU7A 4DR2L 2BB5A 4IALA 2KKCA 1RJTA 1KFYB 1MPEA 2CU3A 3NS8A 1YNJD 2YTXA 2IX0A 1WI5A 3FKYA 5EQ0A 4C2MH 1PZID 1PYWD 4OIKA 4GN5A 4KKTA 4DU9A 4FF2A 1I4RA 1DCZA 1SR3A 3IAYA 4YWKA 2PI2E 5M5WH 1EF5A 1ZGUB 2XTIA 2HUGA 2K5QA 4KN7C 4JK1C 3H7PB 1JOKA 1HNWL 1J7BA 1A5RA 1UZXB 5CMDA 4DXFA 1PHJA 2DENB 4J8QA 1PTOH 2YV5A 3FDTA 3KW5B 3GP7A 3HKZB 2F0UA 4FYDA 2F3WA 4GSWA 4ODGA 4K7WA 3CW2C 4A3IG 3CC4A 3OG5A 1E7PB 3PHXB 4ME3A 5IYBH 2KX3A 3OHXC 5IKCM 3PCOB 1A62A 3PUZA 4XYQA 4DR1Q 3PLUA 3OTOL 4EGVA 2AX5A 2NS5A 1WGGA 1FPYA 1V5OA 1NEKB 5KNBA 1QB5D 1U4RA 1XO3A 3T1YQ 1B9NA 1EY9A 2R93G 3VVWB 3SDLC 5AZHA 1V1QA 1WJ4A 2QSDA 4UP7A 1U5KA 5T8IA 5E6OA 3I4OA 3RD4A 1VZ6A 3C1EA 1K73C 4P73A 4XXEA 5KHQA 1EY5A 2SNMA 5GQOA 3ETRA 3U7ZA 3GTPB 2N7EA 2Y3AA 3D32A 4V0BA 1AZPA 2E2JB 1R9TH 1HFNA 4DWFA 2E2HB 3ZJVA 2WLBA 5C3EB 2MHJA 2XBBC 4CKEA 2WV6D 3TQYA 1AP0A 4NPSA 1C7YA 2WXJA 5DEHA 2HCIA 3RLFA 3SR1A 3GB1A 4M8MA 1Y56A 1CKNA 1MGSA 3DXJC 2IDYA 2KFKB 2DZJA 2G9DA 4OWWB 4OIJA 4KK7A 5E7NA 4HJ9A 4DR3Q 2GMIC 5HGTA 4GLVB 2A4ZA 3VFKA 4B3SL 4JE3B 1QOAA 1VCIA 1QILA 5IGGA 5JPMC 3ZLZA 2Y0SE 3H3VC 4W9EA 1B9RA 1ZKHA 5M9OA 1N33L 1CSQA 3PMFA 3Q6SA 4JWUC 1HZ9A 4DR7Q 1EL0A 3L4PA 2VS1A 3Q8FA 2EPBA 4OGQC 2K0PA 2LJIA 4ANWA 4JI2L 3WWVA 4ULLA 5CHWA 2EY2A 3APCA 2BVCA 3L0WB 5BMIA 4BBNF 2NN6G 3S24A 2OXPA 1EO6A 2IO2B 1UE7A 5EE1A 4JI4Q 5KGUA 4B3MQ 3QQ8B 2DAFA 5L37A 3ERSX 1SSNA 1KRSA 2WXMA 2FCNA 3NRZA 2C35B 3MXUA 3AE5B 2VUMH 1ESFA 1I3QH 3PTFC 1V49A 1T0SC 4XC2A 4UHVA 1EOTA 1ASYA 1N8RC 1PZKD 3DVNU 2AQ1B 3H6NA 3CQZH 2I07B 5EPLA 1F0ZA 2BT6A 3AE6B 1BBWA 5CORA 3FILA 3RZDB 2MO0A 4JI6L 2F1MA 1LM8B 1HTOA 3HIZA 4QUFA 5IYCG 3QIJA 2LHDA 1DYQA 4H2AA 2RF4A 4C3HH 3KJOA 2IWHA 2NPTA 4LF8Q 2CFMA 1GHKA 3SK4A 2UUCQ 4XQQA 3RCZA 3G71A 1MHXA 3Q8CA 4ANVA 1YNNC 2R7FA 3DLLA 5FR3A 2K9XA 4WQMA 3VA5A 2J0KA 3HUIA 1O7ZA 3DVGY 3STBC 2EYLA 4I6NB 5JAVA 1VQEA 3EVQA 2ZJPA 1WZ3A 5A2QE 2CH4A 3D31A 5J18A 1E8WA 1VQNA 5GAHC 2AUKA 2A6ED 4K0KL 5HKHA 2ZJRA 2B76B 3FKIG 1QF6A 2ZTCA 1UEBA 1BO0A 4RHRA 1LYLA 2WAQB 5IE8A 3KBGA 4IUUA 4PZ8A 1HR0Q 4N9F4 3ZJTA 4FXGC 4PS7A 1TBEA 2WB1G 2QEJC 5IP7G 2LXAA 4JI3L 4JBJA 4ZRZA 1OTRB 1Q10A 1HFGA 3S1MH 4ANUA 4WWMA 3I90A 3I4MH 1Q1EA 1LM0A 3J9CA 2XN9C 4A3GH 4ZUIA 3K5LA 3J7AF 2KWCA 2MSED 3OOCA 3IAM1 4W9LA 5LLIA 4G7OC 2VRRB 1TZOA 3L08A 1WJNA 4FBJB 3Q23A 2EYFA 3ZGZA 3CAMA 1G91A 4FXKC 2F0VA 1GUGA 3DBRB 1QUQA 4TVAB 2F3IA 3IAS1 3WANA 1J9OA 4D2KA 3UE1A 3ND8A 3UI2A 4KJOA 4IN3A 4YHHL 3K81C 1WRIA 2E3TA 3R3MA 1FMAD 5LMUQ 1VQKA 3NXWA 3K5MA 1VQ7A 2UU9L 2F0GA 2Q8IB 3PT2B 5TSSA 4JI0L 1FNVA 1PUTA 4LTUA 1IBLL 2AEHA 3JAMi 4BAXA 4YT0B 3KF8B 2K03A 4E74A 1RM6C 1G2SA 1SMYC 4URKA 3T3OA 3TN2A 3I4NG 1WGKA 2JRIB 1GHJA 2KACA 1TWFH 3SE0A 3A9KA 1Q12A 3IG3A 5KEEA 2JA6H 1Y1VB 2KCMA 1CKOA 5FLXE 4S3SA 1VF5C 1FIQA 2NN6I 2XIWA 2L12A 3PQIA 2PQEA 2K39A 2LFIA 2PMVA 5CX3A 4MDKE 2ZW0A 5E4XA 4XZ4A 4LFAQ 5G55A 2KDBA 1EFWA 1VDZA 1D1KA 2KN4A 2Z0EB 5CBAE 4L2YA 1GD7A 3S1QB 4F87A 3BZCA 1Q7YC 5K36G 2N0SB 3W3AA 2XK5B 4BBSG 1TKYA 1EWIA 1WGYA 3ZDTA 4C4VA 3RMHA 2BTEA 3V3XA 3ITPA 4P71A 3HOWG 3FPPA 3RN9C 3E56A 3NOBA 4QY7A 2Q2UA 4MH0E 5GXGB 3TBLD 4KKUA 3VUWA 2WACA 3FRPB 1F2LA 3S1RH 3PO2G 4L5TA 1V43A 2KMCA 4DR5Q 1RODA 2D2CC 4NJ7A 4MIUA 1WM3A 2IGDA 4IKGA 5CR3A 2V9HA 1B70B 4A3BH 2VXWA 3PRZA 2D0OA 2ZTEA 1PTOF 1MG8A 3U7DA 2AYOB 1E2ZA 3GTMB 2HD5B 2WDRB 4MT5A 3L54A 2VZKD 3NQIA 2NVQH 1EQTA 3KLSX 3L16A 4BKSA 2PTLA 4BBRB 1VQOA 4Y52H 2DZMA 4IM2A 4IM3A 1MBYA 3FKIH 2KBNA 5IT9E 1GB1A 2Y5BB 1C9FA 4G11A 2AHOB 4EVOA 1KQSA 3RT3B 3VTWA 3VTUA 5LL6S 3EN2A 1FYCA 2K25A 2YLMA 1V1PB 1RD9D 5BYQA 1Q8KA 1F77A 1L4DB 2BWFA 4HIKA 3VA7A 1VQ8A 2K75A 2M1MA 1DOYA 1SJHD 4U68A 2KQSA 4RMAA 1L5PA 5C3JB 3PPAA 2PNHA 3TJPA 3QK0A 1T5XD 1Q82C 3J7A5 2JZZA 5D2MB 2NZ1D 4O2DA 2N3SA 3S17H 4WWPA 4MACA 3GTJB 1B8AA 1VR9A 2INPE 1VQLA 2NCNA 2KA7A 2UXCQ 4LFBQ 3M4OH 4A93G 4P7IA 1JWMD 4JI8L 3PZDA 1A2TA 5DAUA 2KFJA 1LACA 3AEVA 3UGBB 3PF5A 3HOXG 1LFDA 3EGRA 5CV7A 1PH9A 3GZNI 1VQDA 2CW0D 4HSPA 3KUPA 4KGRA 1VF7A 3I57A 1J6QA 5IGBA 2R93B 4Z9CB 1HEZE 3UDFA 1HNXL 4WURA 4WWNA 1TIID 3NTIA 2DNFA 1AE3A 4FADA 3H7PA 1BR9A 4ZOHC 3W5UB 3E9IA 2UXBQ 1PRTB 4KSLC 1CQVA 1GM5A 3W1SA 2HD3A 1LT3D 2AQ3B 3AFQA 3KBXA 1S40A 4BS9A 3CC2A 4HJ5A 2AWTA 2LVQA 4OVVA 2JWUA 4AYBG 1OTCA 3AE7B 1VQ9A 4XDCA 2LI5A 5D6JB 2XRQD 3QJZA 4S17A 3CF6E 5JJIA 1Y8RC 3A7LA 3ZYYX 2E5LL 1XNRL 2NTTA 3EROA 3VUYA 3TCAA 1RAXA 4DR6L 2FAZA 5F2DA 1F2ZA 5D7GA 3IRBA 3K7AB 4A3EH 1WTQA 2BH8A 1E2WA 4GS3A 2IX1A 5AUKA 5C4JH 2OWOA 3SGIA 1JRPA 1WJUA 4LNOA 3M3YH 5JEAH 3ZNHB 2HQEA 1HA5A 4A3OA 4RH6A 2Z6KC 3PZ8A 5A2QL 3U4EG 3VUXA 2J7ZA 4UPAA 3K9OB 1A15A 4NB3A 1Z2MA 2R2OA 1ASZA 4L6TB 3HZXA 4NMZA 2LVPA 1SYGA 5C6AA 5JVH3 4MGYE 1VQPA 4KDIC 3F2UA 4G3XB 2NZOA 2KFKA 1HNZL 2KTFA 4F1SA 1FNWA 1JQYD 3H6MA 4II2B 5EJWA 1DZ1A 4IUPA 1PFBA 2R92B 1NUCA 1SF0A 2FXQA 3BVZA 1I50B 3AM9A 4F8CB 1XPUA 5JJZA 1I7HA 4BY1G 3CCRA 2LJ5A 1M8AA 2D9UA 5NUCA 4C3IG 4DV3L 2HT1A 4RHSA 2PCFB 2ZPNA 3I2ZA 3ZQ4A 4EZKA 3N9YC 2NBUA 4HCPB 2C9OA 4B9WA 4C1NK 5BO4B 1LV9A 3PV0A 3UF8A 4AP4C 3CCSA 1XCQL 2F03A 1NY4A 2OF1A 3HRDD 5C0XJ 3H15A 1OQYA 1NR4A 1TT5B 1RIPA 4B0MA 3ZTDA 3U8ZA 2Z6BA 1WM2A 3P4QB 2R7DA 4K8JA 2A68D 1GUOA 2CHBD 2RA4A 2GRIA 1QT9A 4DN4M 5E1FA 2EKEC 2HJ1A 4K3BA 1AZQA 2MGSA 1L6UA 5FLXL 2WP8J 2N1VA 4F7XA 4WFN3 4CYEA 2KJXA 5DCNA 3KF6B 1S4ZA 4QCLA 2K50A 2BQQA 1VCBA 1WOCA 1A6XA 4YTMB 2BB6A 3HOVB 1YITA 5D3DA 4B9KA 2F3VA 1O80A 1O7LA 4POGA 2WHIA 1D4BA 2JQRB 4LJOB 4MN3A 4BA2I 1Q0WB 1U4AA 4WAAA 3C19A 4HMJA 2IX3A 2FCQA 2K5PA 4HPMB 3VQIA 5FLMG 1EM7A 1ISNA 1I5FA 2MA9B 4RF0A 4JCVE 3NJTA 1RCVD 4AIMA 2DN8A 1QVFA 5L83A 2BDOA 3HKZE 2D10A 4P1BC 1PH7A 1SIFA 1IBKQ 1OXXK 4PMBA 1WXSA 2KANA 1STAA 2O2VB 4JI1Q 4K7UA 3PF4A 1QVGA 1QWYA 1B7YB 3GTGB 4KHPQ 1FGUA 2KZRA 5IYDH 2YEPB 3TEZA 1Y8PB 2YVCA 3P75A 2LKVA 1I6HB 4K81A 1Z47A 2CU1A 3HGBA 4X62L 3KDFA 3PUVA 3HVZA 2A69C 2SAKA 1WXMA 4ACFA 2CHZA 2EYMA 3ZVVA 4DR3L 1IZ6A 1BCPB 3W1BA 5IT9L 2ICEC 2K5DA 2Z8LA 4DV0Q 1X32A 4IFDG 1TS5A 4K3CA 5MPOA 1NJIC 1YVCA 1STHA 3DEOA 3SK6A 1QJOA 2WDVB 2Y5PA 4A9AA 3PSIA 2B63G 5IWAQ 3OW7A 4ICVA 1EZ6A 4DR7L 3UQAA 2UYZB 3DHIC 1EY7A 3QO2A 3S16B 1HQMC 5BMGA 3H7SA 1OEYJ 4GOPB 3JAME 5C4HA 1Q8IA 1HUMA 1CT1D 3KF8A 4DA2A 5J1ZA 4JI4L 2HE7A 2KDIA 4B3ML 4LNNA 4MGKE 4EKUA 2QILA 4KI0A 4GZYC 1TIFA 1A63A 1B3AA 1LTBD 1UWXA 1FRRA 1IGCA 3BIID 4BXXG 5BYSA 1PFSA 2PO4A 1AFPA 4Y7NB 1WH3A 1Y69U 2PIAA 3R2IA 1I4HA 4A3FH 4JV5Q 4PS3A 3J81c 4PT5A 5G5GA 3PO2B 2ICIA 3TMPB 4FA6A 1FXAA 2KXJA 1BDOA 3AB9A 5KIXA 1CZPA 1XQQA 5FK9C 4FXCA 4I7ZC 4OZAA 2AUJD 3DM3A 1K50A 2GN5A 4KMUC 3RZOH 2GBMA 2BE5C 2JA7G 4ZHOA 3T13A 4LF8L 4LMQD 2K22A 4DHJD 1ROEA 1GJZA 2UUCL 1WJJA 2ZXRA 3KFUA 3A1QB 4W9DA 5FR6A 1MG4A 4O42A 3OWEB 5M3FG 2CS4A 2JUOA 1ENAA 3TL5A 1A70A 3AH7A 2KUMA 3DMUA 4CO7A 1DXMA 3E0JA 1OXVA 1K0SA 1HZBA 2G9HD 2MJ3A 3K58A 2MPMA 3DWMA 1K3RA 3OPOA 4XX5A 4DV5Q 5FJ8H 3URYA 4YTNB 3H3VH 1HR0L 3VR2A 5IOCA 2J7QB 4EX5A 5CV4A 2VQFQ 3DBHI 1N5XA 1R4NI 4CHTB 2OQ0A 4F7ZA 1I4GA 1JMLA 1G6JA 4A3DG 1SGHA 2NVXH 4A3JH 2JA5B 1WMHA 2PPHA 2NVUI 3M95A 5IT9c 3APFA 1GPXA 3RNEC 3PV1A 5ELFA 4CDCC 1NR2A 2KECA 1F2RC 2PW9A 4LW1A 2YU9B 1E7VA 4K1RB 3ER0A 3P1HA 1JWAD 1BCPC 3RN5A 3MFYA 4CJ0B 4GNXB 1GNUA 2WAQE 3MEHA 2KJRA 5E3FA 1HH2P 1V1PA 3MXNB 4N9TA 4OONA 5J2RA 1KLUD 3BG3A 2M0XA 1L1OB 5LMUL 4FN2A 2KEDA 1QOBA 2KDFB 4YXDB 3BU2A 5LXIB 1CQFA 1KH0A 4AJWA 3A8KE 5HY6A 1EWHA 2GBJA 4K2LA 4I6LB 4IFDI 3BVGA 4RG1A 1WFQA 1EYAA 1SYFA 2ON8A 2WXNA 3NSWA 3R3OA 1YNND 1SNDA 1X55A 1YJNA 1Q46A 3CKIB 3NTKA 2K7VA 1C48A 2NTSA 2BKRB 2LRUA 4DV7Q 5JXVA 3RLNA 1D5XC 1MSHA 1GXDC 4AQYQ 4A3PA 4DDGD 4GB9A 2NB0A 5ELEA 1M94A 4OZCA 1K3BC 1TKGA 1EQQA 4XDDA 4XGAB 3RI7C 2E2DC 2XNAC 4LFAL 1ILQA 2KHSA 2HHHQ 2JF5A 1YJIA 5IYBG 4DV1Q 4KDLB 1H9SA 3LX0A 4ZAIA 4REZA 1NTGA 1IYJB 5M3MH 1F9JA 3W5VB 3GTPH 1B53A 1Y8NB 2E2JH 3I63C 2BYTA 5KYLA 1I94Q 4KIKB 4OEMB 1WYWB 4IOIE 4L5QA 5C3EH 2WINB 2QJLA 2WNMA 1N32Q 1GJXA 3GV6A 5C4XH 3HOYB 2DY7A 1D5MC 2N1WA 2L0FA 3M4PA 4TQUS 2WU5B 1H9KA 4JI7Q 5J17A 3AXCA 1CHQD 2MUYA 4JOIC 3DPDA 3NWSA 1SMYD 3T51B 1EQVA 2I5LX 3PS6A 2ASQA 4DV4L 1UH6A 3ZNID 5JZEB 2WKDA 2KLCA 4C3IB 4L5RC 1E7UA 1X3PA 2JZPA 4GN3B 3U50C 4BY7B 1T6BX 4K5WA 4NXNQ 3WALA 3EQLC 4K5VA 3HK0A 2KTRB 1TVXA 3MA2B 4IUVA 2BW2A 4PK1A 3H91A 1C76A 1Z7TA 4DUZQ 2REXA 1MSGA 1OXUA 2CHWA 1E8ZA 1A2UA 3AV8A 5EE0A 1L1OC 4X65Q 2KO3A 2PMZB 1HR0W 2W3RA 1XTDA 2KNBA 4DNRB 1FJGL 3LGJA 2K04A 3IFDA 3OMGA 2LSSA 1N6ZA 1WE6A 3LYYA 3RNGC 3ZTCA 4BFRA 4IUQA 4PZ6A 1FM0D 1K53A 1CJEA 3F2DA 2BYEA 5C23A 3DOWA 2I2YA 2PKOA 2VUMG 2UXCL 4LFBL 2ZNVB 1EYDA 1WYDA 3NS1A 2IW3A 1WIAA 3G48A 5HGQA 2L55A 2MO1A 2G3QB 1QZGA 1WGHA 3JAML 1X3FA 1R4MI 4WIPA 4C80A 1WXQA 2QCPX 2B8GA 3S14B 3CXCA 3U4VA 1SYBA 1Y1WH 3Q3OC 1PTOD 2K5WA 1XPRA 1OO9B 1NYRA 1KDCA 4C3HG 3DBHB 5LL6X 1JC7A 3ULJA 4MGZE 2Y5CA 3OIPA 3J80c 2DLBA 2IZVB 2WYQA 4EOYA 1VMCA 3UI3A 1KXLA 4ZDVA 3K59A 2M0AA 2KMAA 3KF6A 1SE8A 4KHZA 5I6WA 4TKNA 4M1UB 3AECB 2G45B 3AE8B 1YN3A 4LF9Q 2L3ZA 3E3XA 1WRDB 4DV6Q 2PW7A 1YQBA 1RF2D 1T5EA 2EY1A 1X3QA 3EFXD 2AWOA 4JBKA 2IO3B 3EHVA 4CDEC 2I1JA 4IPHA 3PIP3 1YHBA 3HM6X 4C56C 3V05A 1SRUA 2F4VL 3PIPA 4GKKQ 5BN3A 4BKGA 2OTLA 1YJ9A 1C1YB 1QQRA 2J0JA 2ZXOA 4HKZE 2HQLA 2KDEB 1K51A 3QIAA 4W9HA 3I4MG 3S15B 5L95C 3CF5A 4A3GG 4OW0A 2FHTA 2NBWB 4XYCA 2F0LA 3K6OA 2F0SA 2OEDA 2KN5A 2J42A 2KWUB 2O2VA 4JL9A 4HEA1 5HURA 1XWEA 1GUNA 2K52A 2UUAL 2MBEA 3VXWA 3KH0A 5CV8A 2C5CA 4Q0FA 1SDFA 4K2KA 3MZ5A 4XWWA 4MTNA 2QMTA 2CCZA 1VQFA 4IUNA 3EECA 2ZCCA 3R8BA 4KGSA 2WXIA 3KLSA 3U4ZA 2X8XX 4HKQA 2IHFA 2I0QA 4XWTA 3NBHB 1ESRA 2WWZA 1I35A 3CPFA 1AN8A 4C3JH 1JOQA 3R7RA 4DV2L 2F0PA 4DK3C 2F0FA 3PSEB 2E76C 3A4SC 4X66L 2BOSA 1N61A 1XLOA 1G8ZD 3TSSA 2FUG1 1JJ2A 3LWEA 2B8FA 2Z0SA 3NPPA 5KNCA 2RBMA 5CV6A 1PA6A 4OL7A 4OX9Q 2G4DB 5BR8Q 2RPQA 1WTPA 3RYTA 1NVID 1SFOB 3S1QH 4AUQC 2JA6G 4DDID 2V0GA 1LTSD 1D8LA 5CV5A 3JAMc 2E74C 5C5MA 5ELDA 1J7AA 3MXGA 4NNJB 4ZRKA 3SD5A 3BS1A 3AFPA 3D4DA 1KAWA 2INNE 2Z1CA 4LDTD 1X6OA 4GOPA 4L1BA 3TIXA 1WCMH 1FCCC 2KYWA 3W1YA 4OHJA 2JA8H 3T8MA 2L4NA 1CHPD 5IGCA 3DVNV 3B9JA 3E9SA 1H8CA 4A3KB 4A3LH 1J5EQ 3H9DA 4OELB 5JHAA 2DY8A 1UNSA 4L5SA 1MJEA 2Y0SG 2GI9A 4EQPA 3ICEA 1VQGA 2BS3B 2O6VD 2F0HA 1EIHA 4F8MA 1XLNA 1MJCA 1RKNA 5CV9A 3CCLA 1N60A 3D4RA 3DUZA 2IL8A 3GTMH 3AEDB 2KHJA 1YJWA 1NMFA 2VL6A 4Q2JA 4X57B 3UINB 1O78A 5KNDA 4BBRH 2KT7A 5IGEA 3AN1A 4YL8A 1W3SA 4HSVA 4YY3Q 4IO9A 2I38A 1K28A 3A1QA 1X9NA 4C00A 4A3BG 4RCOA 2VW9A 2N9XA 3HVDA 4YCVA 1T0RC 3T1HQ 1EU4A 1TY2A 3A56A 4TKOB 5JVG3 2N9LA 3B08A 5LNK1 4PV1C 2BBCA 3AU5A 3RUZA 4WQOB 1DONA 5G5HA 3W5OA 2MQJA 2MNAA 1IYUA 1PH4A 4JI1L 1N36L 3OJ4B 3O13A 3OMCA 5C44B 2WDTB 4JOIA 5C0XH 3S2AA 3HOUB 4IUMB 1UE6A 3NK9A 1VMPA 3P63A 3GTJH 3S2DH 4C2MB 3KLRA 2A74C 2EXDA 3MHZA 1DD2A 1OXTA 3V6CB 1S72A 4APVA 1IPGA 5JHBA 5IP9G 3QAQA 4DUYQ 3VDZA 1FVIA 1IW7C 4DV0L 3DBSA 2YTVA 4YIJA 4R1JA 3ZDMC 1E1OA 3PVLA 3MTNB 4GNXA 2CJOA 2NVTB 2FIFA 1GUAB 3MXNA 2CWPA 1C77A 2B3GA 5IWAL 1NBFC 5BN5A 1L1OA 3PO3B 4QF4A 2V1YA 4FF1A 3BINA 5M5YB 4HCNB 3G4SA 1M1KC 1YHQA 4AWJA 3VR6A 3FAHA 4LK0M 2RCFA 1DGJA 3PGEA 2FMMA 4R4IA 3P2BA 1GC6A 1YN5A 1L2FA 3U9OA 1N63A 2M9VA 4JGHB 5J3BA 3CHBD 3WCQA 1YBYA 3E0EA 3RUIB 4KJNA 5LMNQ 3KJPA 5M5XB 3PZ7A 4ME5A 2UXDQ 1F9QA 2V3PA 2RDBC 3H0GB 1FFUA 4JV5L 2B2YA 2MRPA 4A3MH 3T56B 4ZYNA 2E2IB 3ZRFA 4LLGM 3GTLH 1SNQA 2PVOD 1XMQQ 3K7AH 5H8YE 4RGNA 3T4AC 3CMAA 4DHZB 2K05A 3PLVA 3W1SC 2JVCA 2PNRC 4KD3A 2JU6X 3E9HA 1K83H 3K7UC 1Q1BA 2FCSA 1EYGA 2A8VA 2L0CA 3B1LX 4JBWA 4HIMA 2BGFA 1AARA 1X65A 2A69D 4ZRPA 3C46A 1ZUD2 2D62A 2XRSD 1Y14B 1E1TA 4KN4C 1VQ4A 4JI5Q 2ASBA 1V5TA 4A3EG 2MJDA 2RPVA 4KIKA 1L0WA 1GOZA 1Z9FA 2IY0B 2WP9B 5JEAG 5ISRA 4ZHPA 1BT0A 3L0OA 2KX0A 1AH9A 1I6VC 1XJVA 2ENBA 2RSNA 3BYYB 4B3RL 1S3OA 4ALPA 1EIYB 4DV5L 2LUEA 4ILWA 2R92H 1XF5L 1STEA 1K0RA 2LXKA 2E8GA 3F8TA 4HAEA 1CMXB 1WF9A 2KHIA 2QDFA 1ZYRC 4V190 1XMOQ 5D94A 4MM3B 1DOXA 1RFAA 1WD1A 2HJ8A 2KLGA 2QDLA 1JJCB 2FFKB 3M63B 3AMZA 4JIOU 1UE1A 1XD3B 2FBWB 2KJHB 5IN7A 4MHEA 4OVZA 3D6CA 2Q2HA 1GC7A 2VUMB 3NUCA 3QOJA 4H02A 5T1IA 2OEOA 1B9MA 1QZEA 4WAFA 4CHKA 2EQSA 3Q3FA 3VR9B 1EWYC 3A33B 1E2VA 2MH7A 2KTRA 4DGZA 3BK1A 2ATWA 1QCBD 4MSMB 1KRTA 3ZIMA 1KL9A 3CP0A 5IP9H 4TQ0A 1UWMA 5EDSA 2BE5D 3L2PA 2E75C 5AJ3Q 5CHVC 3W1GA 2B2VC 1TZ1A 3N1XC 3HKSA 3HRZC 1IBML 1FD7D 4R8NA 1L4ZB 2HIVA 3EIVA 5JPNC 1TWGH 2L83A 4JPSA 4GKJL 4A3IB 3HOVH 4X3SA 4NQKE 4YSYB 1YX5B 3ZXRA 2X69A 2WFWA 3X3NA 5C4ZA 3V61A 3T3NA 1RL2A 4IW0A 1PQSA 4GDLB 1BBUA 4HJGE 5FKAC 4KHVA 3N30A 4ANXA 4DKAC 1YI2A 4R4CA 3CCQA 2HHHL 1Q86C 5E6PA 3SK5A 1QOFA 2ZM6Q 4DV1L 4LF4L 3ZW3A 1XEEA 2LY7A 4NXML 1TWCH 3G6EA 3I4MB 4G50A 1KABA 4DR2Q 3W9CB 3M7NA 1E3PA 1IYFA 5JJLA 4UP9A 3GTGH 1I94L 1XLQA 3C0RB 2KC2A 4N9PA 2NMQA 3V96A 2QCZA 1I6HH 1PGAA 3HHMA 2K5NA 3HP3A 4DAYB 1N32L 1QKZA 2F0MA 2ALYB 1GB4A 2LEKA 2VH1A 1NNXA 2WS3B 2Z0DB 5BN4A 2BYVE 4JYAQ 4WH4A 3VRBB 1Q3LA 4W9GA 2EJGC 2F0NA 1IXRA 1KTKA 4X64Q 5IO9A 3RNFC 1KLGD 2LGXA 5IYDG 5D3IB 3PRPB 4GXBA 4JI7L 4YSZB 1IL8A 4WJQA 4FDBA 4ZRJA 4LFCQ 3TUOA 1TWAB 2N9PC 3IFWB 3SFDB 4FO2A 2VZAA 1TWFB 1CZWA 1C4QA 3TS2A 1FXTB 3TZUA 2WXOA 3H09A 1J7CA 2JA6B 2RKSA 3S16H 1HA6A 1YQ4B 1Z5SB 3OTOQ 1EUJA 5GAGC 2BKFA 4USAA 2K4KA 2VB2X 4UY8C 1JCKB 2Q8TA 4NXNL 1HE8A 4IWQA 1SNPA 4UAIA 3AE3B 1LGRA 3N1ZC 2OOBB 2NVYH 2O4XA 3S9WA 5KRUA 4DUZL 2EIFA 2LWPA 3EBEA 3NBHA 3AEBB 2WXLA 2WU2B 4X65L 4EEWA 4Y7NH 3MTSA 5EPJA 1J8IA 1AYFA 2JPHA 4FJYA 4HMIA 4A76A 3CU7A 1C0AA 3A55A 2ZTDA 1PV4A 3PUWA 1LUZA 1ZXIA 3N3KB 1ZXHA 5CTRC 3AMUA 1N5WA 3TP6A 2QKIC 2NUCA 3QR8A 3HOZH 2RDFA 3B2GA 1C3TA 1QVCA 2PQAB 1U9RA 4NJ6A 1WWTA 3I91A 4KVGB 3EC8A 2F0EA 1A3VA 3RULA 4A3FG 5ELBA 3TEXA 1IP9A 4POFA 2RDGA 4JVZA 1PFMA 2R2QA 3S1RB 4EUTA 4DK0A 4RNAA 2PMZE 1IKMA 3NVVA 2J0TD 2DGYA 2WKCA 4A3BB 3GOEA 3M3JA 4MJSB 4A3CH 4FJVB 2EDGA 4LF7Q 2JY6A 1N33Q 2LGDA 1TTNA 1BKBA 2K28A 4K5XA 4KTAA 1YMHE 4P74A 2DX5B 5HFYA 2M19A 3DWQA 3GS2A 1WE7A 3FMCA 4XT3B 2X6GA 3FKIB 1RYJA 1PRTF 1QOGA 1PRTC 1HJPA 3DEPA 2AL3A 1VQIA 4B08A 3CCVA 2VZKB 1NE3A 2WB1B 2D0PA 3MC0B 1V8CA 5D65A 2LZ6A 4R3DA 2JA5H 2L1AA 2N8NA 5HHDG 3Q22A 2A6HD 4DV6L 4DR1L 2R7ZH 2OTJA 2JSVX 1T9HA 3LDZE 4C7ZA 3DWPA 2X38A 5FJ8G 1JE4A 1GVPA 2YU9H 1FFVA 1PFNA 3T1YL 4GKKL 2BA1A 1DGSA 4RGTA 3N52A 2JEBI 1TS4A 2KOXA 4XQNA 1JROA 1OXSC 3TREA 4I6PA 4A3JG 2DYOA 5CYUA 5CHFA 4HR7B 2PPBC 4UP8A 2JEAI 2KDMA 3B0AA 3NHEB 4DBGA 2MJEA 5C2TB 1LTAD 3M4OB 2FINB 2NYZD 1PDXA 4M0WB 3JSVB 3CC7A 2BPSA 4X3UA 1WY8A 1DOIA 1KLVA 3TZDA 2FE8A 3FEWX 3I4NB 3BDOA 3GZNB 2LASA 3KVFB 1S5BD 4ZLTF 2N55A 3KYCD 4K0KQ 2K32A 3ERQA 2KWVB 4BVUC 4LUVA 3HKZG 2JE6I 3W2DA 2EMTA 3Q3NC 5IA7A 1T0QC 2LGYA 3TDQA 2WXHA 2HDLA 3KK7A 5BR8L 2Q2TA 4OX9L 1NI3A 4JI3Q 1A0IA 2ZCBA 4KZ0A 1SE9A 2DHZA 3QWNA 2H88B 3A74A 4BBSB 1WX7A 3BJUA 4DNIA 2EKIA 2B2VA 4FHKA 1Z6HA 3TBIB 4H13C 2W82A 5IGFA 2GBKA 3MHBA 4OO1H 1WVLA 1QZHA 4HK2A 4HJAA 4MTKA 3VDYA 3GTKH 5FLXc 3HOWB 3BVMA 4A3EB 3I55A 3DVGX 3HOYH 1FR3A 4A90A 1LLRD 2J53A 2MW5A 3Q0AA 2D3AA 5M3MG 2BYFA 2LFNA 2C9WB 1ZDVA 1P0RA 4BKSD 3VR5A 1B4OA 1LABA 5C3EG 2CVRA 1E90A 3IT4B 1IBLQ 4PNYA 1HHVA 4BWGB 1S5FD 3NWTA 1W2BA 2HTME 5C4XG 2M2LA 2L9HA 4IPDA 2LVOA 3I4LA 5DPRA 1ICFB 3SR6A 1U4PA 2WIIB 2XK5A 2JK8A 1KDBA 4MELA 1PH6A 2KQ3A 3RZFA 3P1MA 1S1QB 3OYYA 1M90C 3QARA 5CGKA 1EYCA 1LTLA 4GLAC 2WXRA 3L17A 1LTID 2MP1A 4BY7H 1V6EA 4FF4A 1D1IA 1DOKA 3RNCC 1YOVB 3N6RA 1LO5D 1G6ZA 1STYA 2VY3A 3T1HL 2AKWB 5G2NA 2KVZA 4LNKA 3IFTA 1FGBD 2F52A 1A8VA 1OFFA 2F0DA 2JXXA 5EE3A 3OSOA 3H3VI 2CKZB 2P5ZX 2I1KA 4QQBX 2MHVA 3SHLA 3J7YW 4GU2A 4PZ7A 3D8GA 3T16A 1K52A 2YEPF 2W3SA 4LUOA 3AEFB 5AZFA 2LUMA 3AI5A 4MM3A 3Q14C 3ZO5B 1WTHA 2JP1A 2V4LA 2X6LA 1G2TA 1FL0A 3BZKA 1WTWA 2N88A 4PG3A 1QNUA 3EJIA 3RLOA 4HVBA 3OIQA 4DUYL 2R6GA 4A93B 2KVRA 2PVGC 1BCPF 5TR5A 3NY5A 3CD6A 2AL6A 3VH4B 2D07B 3QB3A 3HS0C 3RFZB 3TP5A 3HOXB 4ABNA 1U4MA 3D3RA 4ZK9B 4K8IA 3NZ3A 4LNQA 4GLSC 1NENB 4J6IA 1S3SG 2UUBQ 2RHQB 1YJ1A 4MEMA 2H5XA 2DZKA 4H7BA 2F0KA 2K1BA 3I9V1 3TP8A 1AWDA 1PXUA 2B2UC 4GOPC 2KJ6A 3I5JC 3A8IE 3GE3C 1SYCA 3K80C 1Y1WG 2RDHA 3STBD 1LTRD 1VQCA 2XGTA 4YWMA 2YYZA 3WAMA 1YN4A 5LMNL 1RTOA 4AYBB 3RNUA 3VYRA 4YCUA 4JG2A 3GTOB 1JRUA 1VJKA 2I46A 1WR6E 5DPSA 2UXDL 1D5ZC 4NZLB 3LXFA 2B2TC 2KK8A 1V86A 1CZGA 4GDLA 3RMKC 1EWCA 3MWYW 1P16A 1WTOA 2I5MX 1DJRD 3Q8DA 4DAPA 4U673 2C7HA 4JLCA 1XMQL 3C3LA 2D2QA 1KNAA 4B95A 4RFBA 4CBVA 4KX6B 4CKBA 4WJOA 3S15H 2GBNA 4DQOC 1HTQA 1V81A 1E8XA 1MHHE 3H1UA 3JVZX 1SNMA 2JYOA 3L13A 1MIUA 3K0YA 4HRSA 4RA8A 3GE8C 3NZSA 5EBDA 2E2HH 4HPPA 4JI8Q 2UWQA 1UBIA 4RAUC 3MC8A 2HTHA 1XPOA 1UAPA 1IW7D 2V3SA 2K5HA 3KWVA 2EY5A 4DF7A 1VLBA 2A5UA 5IAAC 3I72A 4P1CC 5AEKB 4DAYA 3ABVB 4DHZE 2F0IA 4HIOA 1V1OA 1ZKOA 2VB3X 4EFOA 3N20C 1CKMA 5CBEE 4DR5L 1C79A 4FVMA 1HNXQ 1O7IA 3MAQA 4GOCA 2G4SA 5G3LD 1KOTA 4KY5A 3ML9A 3NZUA 1PVOA 1KNEA 1YZ6A 1STNA 3QCAA 3V6EB 1XMOL 4ZYSA 3TEWA 4XTCS 2DUDA 1PYBA 3I3CA 4YWLA 2O2LD 1V9JA 2FNJB 5I2XA 3U52E 2EXZA 4B3TQ 3J7ZC 1SFOH 4BY1B 2QIEB 2RSUA 4G0NB 3SK8A 4E71A 1J19A 4LUZA 4C3JG 5C3WA 1UELA 4CQNA 1ML0D 2BF8B 3X0WA 1BMLC 3S1NB 3K5OA 1PLFA 1KHIA 3IHPC 2E5LQ 1XNRQ 1TY0A 1BOSA 1H9RA 1CA6A 4A3FB 1FRDA 1WJ6A 1VD2A 1EIGA 2KQ4X 1S5ED 4JW0A 2A5HA 4IURA 4GNXC 2F4IA 2ZJQA 5BMHA 3P7JA 4A3KH 4HCEA 3GTQB 4EZLA 1UUPA 3MC9A 3I73A 1OEYA 2W54A 3RPFC 1WCMG 1TWHB 1YIWA 3APDA 2JA8G 1SLJA 5I2YA 3RZDH 1YNTE 1LQBA 4IZ8A 3A9JB 3QC8B 1WXVA 3Q6BA 4IPGA 1CK1A 1D6EC 1S5CD 3RN2A 5C1ZA 4A3LG 2VNUD 1KRHA 2PQAA 3CSTA 4DHJB 4HJ8A 2O5IC 2J52A 1A3TA 2LGSA 3CWIA 4HDQA 4ZKCB 3AB5A 2V4IB 1F9PA 3UDIA 1WFYA 3D4WA 2VH2A 3DHGC 3V2TA 4LF6Q 2B2YC 1UGMA 2C7MB 1X56A 2BS4B 3VHTC 3PRMB 2K8HA 1A3UA 3I8ZA 4MNOA 3A5UA 2C7NB 2ZM6L 1ZYRD 4TMAB 4MJSA 1R4NB 4CDDC 4BBRG 2L7RA 2NVXB 1PH3A 1Q5WB 1KF6B 5AUIA 1YQ3B 3R93A 3D6WA 4DK6C 2L05A 4RGOS 1QOHA 2BA0A 3ONAB 3EFUA 4M02A 1EU3A 2FMCA 1SAPA 2MJ8A 1EY6A 3AYHB 4P2CB 2UXBL 4HROA 3DCGA 1QNKA 4R4OA 5C44H 2HDMA 3HOUH 4KSKC 2JZ3B 5IIFA 2XWJB 2EY6A 1VRAB 4O1NA 4CJ1B 5LMNW 1RRBA 1E6EB 4JYAL 2WXGA 3S2HB 4KZCA 4LCDE 3NQTA 4X64L 1NYQA 3DBRI 3H8HA 4G57A 4FXDA 1LT4D 5C0XG 2E6XA 2B2WA 3Q24A 4HJ7A 2LRWA 1T0YA 4GDKB 2NVTH 4LFCL 4N8X1 2BS2B 3SEBA 3DWGC 4C7YA 1UD7A 4NP5A 4R4TA 2EELA 1AE2A 1SN8A 2KCTA 3M4QA 2K6AA 5FO7B 2B63B 3PO3H 2MCNB 2IJ0A 1JQ4A 1YIJA 1P8LA 5M5YH 1UEAB 1UF0A 1VQAA 3QX1A 2L8JA 3A0JA 4KLKA 4EQOA 1XNQQ 1LXDA 2ID0A 1W6JA 4QB4A 2K8CA 1F1HA 2B39A 3PGZA 4M0WA 2IO1B 3JSVA 1PDQA 4G7HC 4JBMA 3R7QA 1Y1VH 2G1EA 5EKLA 1FD6A 2N7JA 3NP8A 5M5XH 1I4PA 4R9WA 3DBLI 2WXFA 3WAPA 4A20A 3TEYA 3H0GH 3GDEA 3WIMA 1F52A 5M3MB 2E2IH 2EMSA 3N32A 4ARIA 1E10A 4BA1I 3BDLA 3NTHA 1Q1OA 3PO0A 1QLBB 3GD7A 1SJED 3AQQA 3E6ZX 5EBCA 5FO9B 2ZW1A 5C4XB 1WR1A 1M4VA 4X62Q 4DAVA 1TKWB 3A54A 1BQQT 3K57A 1EZ8A 1ACCA 2ZNVC 2B2UA 2JA7B 1W6KA 1NMGA 2GOWA 2MBOA 3LWUA 4P72A 2ZVNA 4A3MG 1GUWA 2KCCA 4DNTB 2RR9A 3CSFA 1YHAA 2KQ7A 5M3FB 2EJFC 1R4PB 3SFEB 4LJZC 2XWBB 2JYTA 4MGIE 3K0XA 3KYDD 4FJZA 3G7LA 4LF7L 1VQBA 2LMCB 1FCLA 2UU7A 2WX0A 3AU4A 2B2TA 1CA5A 2QHOA 1JWBD 4IWPA 4PS8A 4HPLB 1BBXC 2VQEQ 1G51A 2L1BA 1VDVA 2WXPA 3MFGA 1ICWA 5J39A 3CPWA 4QIWB 3M85A 3N1YC 4BBNC 3V62A 2JQOA 1GO3E 2KCNA 3VR3A 2IYDB 4KKJA 2FIDA 1EY0A 2RSOA 2ZZPB 3U9SA 1L0XB 4ASWC 1WTRA 2Z4HA 5EAYA 4A3DB 2Q5WD 5I9OA 2BWES 1BUVT 4XIGS 4C1NI 1BF4A 1U0LA 2R92G 4ZRQA 2K8BA 1TR5A 4S0RA 1D3ZA 1XTCD 1SIJA 2D5GA 3MJWA 4A8XC 3ML8A 2K3UA 4X3KA 1VQ6A 3J80i 3GQBA 5ELOA 3U58A 4LF5Q 2O5JC 5DNFA 1IBKL 2LGIA 5AFWA 2WB1E 4QAYA 2N4FA 3BDCA 4J1MA 1XT9B 1TXYA 4XT1B 3K5NA 3L10B 1KDAA 2SOBA 3L7ZC 4KHPL 1FXIA 5C0XI 4YWGG 4B6WA 2EYOA 4EZJA 2JYEA 3C2PA 2LD9A 5LXHA 4IFDJ 2Q8RE 3PUYA 1BVSA 1RHPA 1R4MB 2KC1A 2ZVOA 1YX6B 2JXTA 2L32A 4RF1A 4AQ7A 4A3IH 2Q2IA 2CQAA 1JT8A 3NVYA 1Y1WB 2QA4A 1KAAA 1LT5D 4TQ1A 1E22A 3ND9A 5M5WB 1HZAA 4NAWB 4DXAB 1SNCA 2W55A 2JJQA 3JYUA 3V60A 2KWDA 1ZW7A 1ZOYB 1PTOB 1HPCA 2QDBA 3CCJA 1KIXA 2R93H 1PRTD 1WI0A 3AEAB 1XXGA 3HOVG 1WSPA 3Q2AC 5G3LF 4QJFA 1ET6A 4P75A 1VQHA 3KDFB 2D3CA 2KD0A 1HZCA 4FHJA 4N58A 2ZT9C 4JPBW 4N59A 1G291 4JX1C 3WOEA 3J81j 3UQBA 3AE1B 3EUB2 4HN7A 3BK2A 5EPKA 1ZE3D 3J7AV 4PYZA 1C8CA 2GA4B 5E6NA 4BZAA 1H9JA 2PE6B 1ENFA 1QG7A 2IHEA 2JRHA 3Q8BA 3VRAB 3I7FA 3ONSA 4W9KA 4KV6A 1C4AA 2MQHA 1NDDA 4NW2A 3AEGB 2F0OA 2R3ZA 1CSPA 1R9TB 2INCC 1PYSB 3HG9A 4LJPB 2IGHA 1WGRA 3A7AB 4ZQ3A 5JJKA 1L7YA 4OZBA 3ZUNA 1T3QA 2PLPA 1TWAH 3TP7A 1DOMA 3WAOA 3BWUD 5FO8B 5T1GA 4IC7B 3P4PB 4PYUA 3CRKC 2H4OA 1NI2A 3G6JB 4OWTB 1L6VA 4K6DA 2FJ2A 4C3JB 2CKHB 1N34Q 2QC8A 3SU8X 1I42A 3DBLB 2LS01 2JWZA 2NN6H 4W9IA 1VQMA 4W9CA 1IL2A 1V80A 5DPTA 2JX5A 5DM63 3J81E 3CCUA 3H94A 3B6YA 3BYTB 2IO0B 1E0BA 2GVAA 2V3NA 1P3QU 2A19A 1WD0A 2VQFL 1I50H 3Q3JA 2XSCA 4B9XA 2L11A 3WOFA 2SDFA 3F2CA 3ZNZB 1WCMB 4M00A 2JN4A 2JA8B 1C78A 3O65B 5J22A 4NKLA 1C4PA 5IYCH 1WX9A 4LDTB 3NELA 4FNFA 4NQLB 2IT1A 2K6DB 1BXTA 2JA9A 4IJHA 4LWCA 1WZ0A 1I3QB 1YNJC 5HG2A 3Q8EA 1HTPA 4BOSC 4AJYB 1S5DD 2J0MA 1KC8C 3AULA 3CQZB 1X3GA 4RKBA 4OWXB 2Z59B 3ZXVA 1X54A 3HOZG 2IY1B 5AZGA 1XX8A 1PTOC 4M8AA 1K8AC 2DNEA 2IPKD 2KENA 1EEFD 3F1ZA 3VR4A 3MEFA 2UUBL 2DZIA 1WMHB 3VYTA 2O6VB 4C3HB 1HXYD 3UE0A 3HM3A 1I4QA 3JW0X 4GN4B 1AEXA 1HTLD 3R2TA 4DV4Q 4P16A 4HCSA 1E24A 1SE2A 2H89B 3ZKJC 1E8YA 2EOTA 2G5DA 4W9JA 5DLQE 1HZ5A 3A9JA 1TS3A 1P7FA 1RFKA 5IODA 2DYBA 2KOLA 2MFIA 5IP7H 1WTXA 4A3CG 3I3TB 4RM9A 4DV7L 4HEDA 3GV3A 5KYIA 4AQYL 1PGBA 2MP2B 1HCZA 1VS0A 2W9NA 2FCMA 1ONLA 4M01A 1VQ5A 2BCOA 2IY5B 4K7SA 3ULLA 5K5PA 2PZTA 4DR4Q 2L52A 1XLPA 5HI1A 1IBXB 2ZEQA 1F9RA 1FJGQ 4JQWC 1VQJA 2JA5G 1V97A 3IL8A 2R61A 2SNSA 3WDNA 2F0JA 3S1MB 2R7ZG 2GLSA 2WGSA 4NPNA 5C3XA 4PMWA 2WXQA 4A3GB 3ZNGC 3KWLA 3S2DB 3VR8B 2NZHA 1E9MA 3AEEB 4I7AA 4KY7A 5CC4A 1QE6A 2OCEA 1IKLA 4AYBE 5FOBB 3RNBC 2K1FA 5GADC 1IUEA 1BCPD 4O0AA 4ZRIA 1ZP0B 2OT2A 3CMMB 4BKTA 4IOCA 1F2RI 2EJMA 3I4NH 1EF1A 3I56A 3QG1A 1F2MA 1H9SB 1MI2A 2JSOA 2A73B 2KMMA 2K14A 1GUSA 1H4RA 2CWAA 1HNWQ 5EKKA 3QA8A 1WGDA 1YNXA 1HQRD 4GDKA 1R4QB 1EY4A 2C5LC 2L15A 1SYDA 5I4DA 4B3TL 2XVSA 4DXGA 3NUHB 3AE2B 5I6YA 3UDGA 1RDPD 4AOFA 1G6PA 3VTVA 5K36H 1SNOA 4ZCKA 4KV2A 3F2BA 4BBSH 1WX8A 2NR2A 4UDUC 2SEBD 4XQJA 4HTHA 1B3QA 2KHWB 4KGTA 2F4VQ 4A3MB 1V2YA 2D5DA 3JC66 3HOWH 3GTLB 4IDIA 1K83B 1EQRA 2K5VA 4NJCA 3SDZA 5IOIA 1JR0D 1JICA 2Y0SB 3PO2H 3KUCB 2QGQA 4OO1G 3PREA 3Q8AA 1JE5A 1SB3C 4K14A 4I65A 2UUAQ 4II3B 4RWSC 4WJ4A 2LHEA 3PHWB 3X23A 2KEEA 2AWNA 5JH5C 2MBQA 3HOYG 2DJFC 2MEKA 4NAMA 4DPGA 4ZUJA 3L9AX 1O7YA 1Y8OB 1UBQA 4FLHA 3NHHA 2AMCB 2N49A 1IGDA 2RCNA 3C8YA 3R66C 3TMEA 2M17A 4LF6L 4B3SQ 1ZPSA 4DV2Q 2D11A 3IKJA 1RWSA 1SYEA 4X66Q 4J15A 1KM7A 1HZ6A 3OAWA 4H44C 4K6LA 1GG3A 2WX1A 1PH8A 4YTPB 1XCTL 2A6EC 2LMCA 2NVQB 2WXKA 2ZPYA 4ARCA 3I70A 2F0QA 4JI2Q 1TGZB 4G4KA 1K8MA 4BY7G 3U2SC 4XDXA 1STBA 1STGA 4X6AH 4LF9L 2CJNA 2IGGA 2OQKA 4LK1C 3EFCA 3FPUB 3K8AA 2A1AA 2FUHB 2HIXA 5C5LA 3M9BA 2QEXA 4RCNA 3OW2A 4L8JA 1IHZA 3EA6A 4A93H 4X3TA 1NSNS 1CTMA 3AE4B 3CMEA 3B2FA 1BNZA 5BYRA 3SHQA 2MWSB 1TU2B 3J80E 3HOXH 3P20A 3TS0A 4JI6Q 3S17B 1H9MA 3BZDB 3E5SA 3Q3MC 4ID6A 1KD1C 1ILPA 3J81L 4FF3A 1TWGB 4MH8A 1L2NA 3T53B 4GN1A 3HEJA 2MBBB 2CQOA 1XNQL 2L76A 4HLEA 2RVLA 2JT4B 1FNUA 2L0TA 1B2TA 4ZKBB 2Z9HA 2DBYA 1CI3M 1WTVA 3VH3B 2INDC 3KOJA
chains in the Genus database with same CATH topology
3PIO3 4JWSC 3GO5A 1AW7A 1IYVA 1UGJA 1EFID 2M56B 1B50A 4N6EB 3VYSA 4TSSA 1TWCB 1TQOA 3FC4A 1CFMA 2EYHA 5A35A 4A55A 2EYJA 4XE0A 1C4CA 3MP9A 1XYIA 4WRDA 5E4WC 1NAPA 1TKEA 1PMRA 3MVVA 1VZ7A 1DOLA 5LHY1 2L5TA 4OO1I 4RKLA 4LAAA 2EZVA 2BDNA 4XYOA 4IUTA 4CGYB 5C4JB 1F2YA 3NVZA 3M3YB 1PGXA 2ACZB 4H0LC 2N9KA 3VYUA 5DM73 1CM9A 4J6HA 5I9PA 2ONQA 3CIRB 4PMCA 5IGDA 2PYKA 1L0YB 2F0TA 4AS1A 1LTTD 2NVYB 4WJWA 2OHFA 4EQNA 1ZEQX 4IQZA 2B2WC 1L0VB 1JWSD 3FILB 1JB3A 2HDEA 1V8QA 2DNCA 3HOZB 1P7EA 1TJEA 1SE4A 4L63B 1JW9D 5EE9A 4KY6A 1EEID 1YJJA 2PZUA 3P4RB 2TSSA 5ELCA 3IXSA 1JOOA 2GB1A 3LB8C 2V4DA 4F88A 4US9A 2EYPA 3A8JE 3NBIA 1HUNA 3M4YA 2K01A 1MI0A 3IT6B 1ZXTA 2CW0C 1TS2A 3OWFA 2DWQA 2F0WA 1MVKA 2R7ZB 1II3A 3NVWA 1FEHA 2KVMA 3Q69A 3LNNA 3DWAA 2NWGA 3QJYA 1OQQA 2M00A 2PW5A 5COYA 4RGMA 2EE1A 2Z4IA 1SSOA 3PUXA 4A6QA 1FO4A 1IBXA 1MD2D 2K33A 3NE5B 2ZXPA 1GUTA 4IFDH 3AE9B 3SXHA 1ZDXA 3DM1A 3L3OC 3P42A 2KAJA 1EY8A 4EE2A 5JEAJ 2EVBA 5D14A 5EGTA 1B44D 3QOLA 1PZJD 1NCVA 2RMMA 4G7ZC 4DFAA 2NBFA 3FVQA 4KKSA 4TRDA 4WORA 1VZ8A 5E6JA 1JWUD 4QMGA 1F9SA 3SVMA 2HCCA 1Q90A 5JOBA 4NDXA 4E6IA 1ENCA 3CRLC 4US8A 1PFDA 1WYGA 5H92C 4PQXA 3J80L 2TMPA 3GTKB 1TYGB 4P6VF 2DYMA 1SEBD 5EKIA 4KD4A 4CJ2C 3KQ4A 2AQ2B 1TT2A 1JALA 1JORA 4ITKA 2H1EA 2QF7A 2A68C 1B1ZA 4QUCA 4R8IA 4YSXB 1E0ZA 3C1FA 1SE3A 4L23A 3RZOB 3X3MA 1OQRA 4DK1A 1I4XA 1LT6D 1SBBB 4CKCA 1BUIC 2J4XA 3DHQA 2RQXA 1R7SA 1SXTA 3P4SB 1D2BA 1DM0B 1ET9A 4Q5VA 2A6HC 2WDQB 1GAQB 2JXMB 1U4LA 4B0EA 4KKIA 1RTNA 3M7GA 1K8OA 3MXPA 1LTGD 1HRJA 4J3OD 2WQYB 4FP5D 3ZJUA 1N62A 4A3JB 2PZWA 3MJ5A 3AU7A 2BB5A 4IALA 1RJTA 1KFYB 1MPEA 2CU3A 1YNJD 2IX0A 5EQ0A 1PZID 1PYWD 4OIKA 4FF2A 4KKTA 4DU9A 1I4RA 1DCZA 3IAYA 2HUGA 2K5QA 4KN7C 4JK1C 1JOKA 1J7BA 5CMDA 4DXFA 4J8QA 1PTOH 3FDTA 3GP7A 3HKZB 2F0UA 4FYDA 2F3WA 4ODGA 1E7PB 3OHXC 3PUZA 4XYQA 4EGVA 2AX5A 1NEKB 5KNBA 1QB5D 1U4RA 1XO3A 1B9NA 1EY9A 2QSDA 5T8IA 3RD4A 1VZ6A 3C1EA 4XXEA 1EY5A 2SNMA 3ETRA 3U7ZA 3GTPB 2Y3AA 4V0BA 1AZPA 2E2JB 1HFNA 2E2HB 3ZJVA 2WLBA 5C3EB 4CKEA 2WV6D 1AP0A 2WXJA 5DEHA 2HCIA 3RLFA 3SR1A 3GB1A 1Y56A 1MGSA 3DXJC 2IDYA 2G9DA 4OIJA 4KK7A 5HGTA 4JE3B 1QOAA 1VCIA 1QILA 5IGGA 5JPMC 3H3VC 1B9RA 5M9OA 3PMFA 3Q6SA 4JWUC 1EL0A 3L4PA 3Q8FA 2EPBA 4OGQC 2K0PA 2LJIA 4ULLA 2EY2A 5BMIA 2NN6G 2OXPA 5EE1A 5KGUA 1SSNA 2WXMA 3NRZA 3MXUA 3AE5B 1ESFA 1EOTA 1PZKD 2AQ1B 2I07B 5EPLA 1F0ZA 2BT6A 3AE6B 5CORA 3FILA 3RZDB 2F1MA 4QUFA 2LHDA 1DYQA 4H2AA 2IWHA 1GHKA 3SK4A 4XQQA 1MHXA 3Q8CA 1YNNC 5FR3A 2K9XA 4WQMA 3VA5A 3HUIA 1O7ZA 2EYLA 5JAVA 3EVQA 5A2QE 3D31A 2AUKA 2A6ED 2B76B 1QF6A 4RHRA 1BO0A 3ZJTA 2WAQB 3KBGA 4IUUA 4FXGC 2QEJC 4ZRZA 1Q10A 1HFGA 4WWMA 3I90A 1Q1EA 3J9CA 2XN9C 3IAM1 4ZUIA 3K5LA 3J7AF 3OOCA 4G7OC 1TZOA 3Q23A 2EYFA 3ZGZA 1G91A 4FXKC 2F0VA 1GUGA 3IAS1 1J9OA 4D2KA 3ND8A 3UI2A 4KJOA 4IN3A 1WRIA 2E3TA 1FMAD 3NXWA 3K5MA 2F0GA 2Q8IB 5TSSA 4LTUA 1FNVA 1PUTA 4YT0B 2K03A 1RM6C 1G2SA 1SMYC 3T3OA 3TN2A 1WGKA 1GHJA 2KACA 3SE0A 1Q12A 5KEEA 1Y1VB 5FLXE 4S3SA 1VF5C 1FIQA 2NN6I 2XIWA 2L12A 2PQEA 2LFIA 2PMVA 2ZW0A 5E4XA 1VDZA 1D1KA 2KN4A 5CBAE 4L2YA 3S1QB 4F87A 5K36G 2N0SB 3W3AA 1TKYA 3RMHA 2BTEA 3V3XA 3ITPA 3FPPA 3E56A 5GXGB 4KKUA 2WACA 3FRPB 1F2LA 1V43A 1RODA 2D2CC 4MIUA 2IGDA 4IKGA 5CR3A 2VXWA 1PTOF 1E2ZA 3GTMB 4MT5A 2WDRB 2VZKD 3NQIA 1EQTA 3KLSX 2PTLA 4BBRB 1MBYA 5IT9E 1GB1A 1C9FA 4EVOA 5LL6S 1FYCA 1V1PB 1RD9D 5BYQA 1L4DB 1F77A 3VA7A 1DOYA 1SJHD 4U68A 1L5PA 5C3JB 1T5XD 2NZ1D 4MACA 3GTJB 1VR9A 2INPE 2KA7A 1JWMD 1A2TA 5DAUA 1LACA 3EGRA 5CV7A 2CW0D 4KGRA 4HSPA 3KUPA 1VF7A 3I57A 5IGBA 2R93B 4Z9CB 1HEZE 4WURA 1TIID 3NTIA 1BR9A 4ZOHC 3W5UB 1PRTB 1CQVA 3W1SA 1LT3D 2AQ3B 3KBXA 4BS9A 2JWUA 3AE7B 4XDCA 2XRQD 3A7LA 3ZYYX 2NTTA 3EROA 5F2DA 1F2ZA 5D7GA 3K7AB 1WTQA 1E2WA 2IX1A 5AUKA 1JRPA 5JEAH 2HQEA 1HA5A 4RH6A 3U4EG 3PZ8A 5A2QL 2J7ZA 1A15A 4L6TB 3HZXA 4NMZA 1SYGA 5C6AA 5JVH3 3F2UA 1FNWA 1JQYD 3H6MA 5EJWA 1DZ1A 4IUPA 1PFBA 2R92B 1NUCA 1SF0A 3BVZA 1I50B 3AM9A 5JJZA 1I7HA 1M8AA 2D9UA 5NUCA 4C3IG 4RHSA 2PCFB 3ZQ4A 3N9YC 2C9OA 4B9WA 4C1NK 1LV9A 3PV0A 1XCQL 2F03A 2OF1A 3HRDD 5C0XJ 1NR4A 4B0MA 3P4QB 4K8JA 2A68D 1GUOA 2CHBD 2RA4A 2GRIA 1QT9A 4DN4M 5E1FA 1AZQA 2MGSA 1L6UA 5FLXL 2WP8J 4F7XA 4WFN3 2KJXA 1S4ZA 4QCLA 1A6XA 4YTMB 2BB6A 3HOVB 5D3DA 2F3VA 1O80A 1O7LA 1D4BA 2JQRB 4MN3A 4BA2I 4HMJA 2IX3A 2K5PA 3VQIA 1EM7A 4RF0A 1RCVD 2DN8A 2BDOA 1OXXK 4PMBA 1STAA 1QWYA 3GTGB 2YEPB 3TEZA 1Y8PB 3P75A 2LKVA 1I6HB 1Z47A 3HGBA 3HVZA 3PUVA 2A69C 2SAKA 2EYMA 1BCPB 5IT9L 2ICEC 2K5DA 2Z8LA 4IFDG 1X32A 1TS5A 5MPOA 1STHA 3DEOA 3SK6A 1QJOA 2WDVB 2Y5PA 4A9AA 3OW7A 1EZ6A 1EY7A 3QO2A 3S16B 1HQMC 5BMGA 3JAME 5C4HA 1Q8IA 1HUMA 1CT1D 3KF8A 4DA2A 5J1ZA 2QILA 4KI0A 4GZYC 1B3AA 1LTBD 1UWXA 1FRRA 1IGCA 3BIID 5BYSA 2PO4A 1AFPA 4Y7NB 1Y69U 2PIAA 3R2IA 1I4HA 4PT5A 5G5GA 3PO2B 2ICIA 1FXAA 1BDOA 3AB9A 5KIXA 1CZPA 4FXCA 5FK9C 4I7ZC 4OZAA 2AUJD 1K50A 4KMUC 2BE5C 4ZHOA 3T13A 4LMQD 2K22A 1ROEA 2ZXRA 4O42A 3OWEB 1ENAA 1A70A 3AH7A 2KUMA 3DMUA 1DXMA 3E0JA 1OXVA 2MJ3A 2G9HD 3K58A 2MPMA 3DWMA 3OPOA 3URYA 4YTNB 3VR2A 5IOCA 5CV4A 1N5XA 4CHTB 1I4GA 1JMLA 2JA5B 1GPXA 5ELFA 1NR2A 2KECA 1F2RC 2PW9A 2YU9B 3P1HA 1JWAD 1BCPC 3MFYA 4CJ0B 3MEHA 5E3FA 1V1PA 4N9TA 1KLUD 3BG3A 4YXDB 2KEDA 1QOBA 1CQFA 1KH0A 3A8KE 1EWHA 4K2LA 4IFDI 3BVGA 1EYAA 1SYFA 2ON8A 2WXNA 3NSWA 3R3OA 1YNND 1SNDA 3CKIB 3NTKA 2K7VA 1C48A 2NTSA 1D5XC 1MSHA 1GXDC 2NB0A 5ELEA 4OZCA 1TKGA 4XDDA 2E2DC 2XNAC 1ILQA 2KHSA 1YJIA 1H9SA 3LX0A 4ZAIA 4REZA 3W5VB 1B53A 1Y8NB 2BYTA 5KYLA 4IOIE 2WINB 2QJLA 2WNMA 1GJXA 3GV6A 3HOYB 2DY7A 1D5MC 4TQUS 2WU5B 1H9KA 1CHQD 2MUYA 3NWSA 1SMYD 3T51B 1EQVA 2WKDA 4C3IB 1X3PA 2JZPA 4BY7B 1T6BX 4K5WA 3EQLC 4K5VA 1TVXA 3MA2B 4IUVA 2BW2A 3H91A 1C76A 1Z7TA 1MSGA 1OXUA 1A2UA 3AV8A 5EE0A 2PMZB 2W3RA 4DNRB 2K04A 3IFDA 3OMGA 3LYYA 4IUQA 1FM0D 1K53A 1CJEA 2I2YA 2PKOA 1EYDA 3NS1A 2IW3A 2L55A 4WIPA 3JAML 4C80A 1WXQA 2QCPX 2B8GA 3S14B 1SYBA 1PTOD 2K5WA 1NYRA 1OO9B 1KDCA 4C3HG 5LL6X 1JC7A 2Y5CA 3OIPA 2DLBA 1VMCA 3UI3A 3K59A 2M0AA 4KHZA 5I6WA 4M1UB 3AECB 3AE8B 1YN3A 2PW7A 1RF2D 1T5EA 2EY1A 1X3QA 2AWOA 3EFXD 3PIP3 4C56C 3V05A 5BN3A 1QQRA 2ZXOA 4HKZE 1K51A 3QIAA 3S15B 4OW0A 2FHTA 2F0LA 3K6OA 2F0SA 2OEDA 2J42A 4HEA1 5HURA 1XWEA 1GUNA 5CV8A 2C5CA 4Q0FA 1SDFA 4K2KA 3MZ5A 4XWWA 2QMTA 4IUNA 4KGSA 3R8BA 2WXIA 3KLSA 4HKQA 4XWTA 1ESRA 1AN8A 1JOQA 2F0PA 2F0FA 2E76C 2BOSA 1N61A 1XLOA 1G8ZD 3TSSA 2FUG1 3LWEA 2B8FA 3NPPA 5JXVA 5KNCA 2RBMA 5CV6A 4ZRQA 4OL7A 1WTPA 1NVID 1SFOB 2V0GA 1LTSD 5CV5A 2E74C 5C5MA 5ELDA 1J7AA 3MXGA 3BS1A 2INNE 3D4DA 4L1BA 2Z1CA 1FCCC 4OHJA 2L4NA 1CHPD 5IGCA 3E9SA 3B9JA 4A3KB 2DY8A 1UNSA 2GI9A 4EQPA 2BS3B 2F0HA 1EIHA 4F8MA 1XLNA 1RKNA 5CV9A 1N60A 3D4RA 3DUZA 2IL8A 3AEDB 4Q2JA 1O78A 5KNDA 3AN1A 5IGEA 4HSVA 2I38A 4RCOA 3HVDA 1EU4A 1TY2A 3A56A 4TKOB 5JVG3 2N9LA 5LNK1 4PV1C 2BBCA 3RUZA 1DONA 5G5HA 1IYUA 3O13A 3OMCA 5C44B 5C0XH 3HOUB 3NK9A 1VMPA 3P63A 4C2MB 3KLRA 2A74C 3MHZA 1DD2A 1OXTA 1IW7C 4YIJA 2CJOA 2NVTB 3MXNA 1C77A 5BN5A 3PO3B 4QF4A 4FF1A 5M5YB 3VR6A 3FAHA 4LK0M 1DGJA 2FMMA 1YN5A 1N63A 3U9OA 2M9VA 3CHBD 3WCQA 4KJNA 5M5XB 3PZ7A 4ME5A 2V3PA 1F9QA 3H0GB 1FFUA 2B2YA 3T56B 2E2IB 4LLGM 1SNQA 2PVOD 5H8YE 4RGNA 3T4AC 2K05A 2PNRC 4KD3A 2JU6X 1Q1BA 2L0CA 4JBWA 4ZRPA 2A69D 3C46A 1ZUD2 2D62A 2XRSD 4KN4C 2RPVA 2MJDA 1GOZA 2WP9B 5JEAG 5ISRA 4ZHPA 1I6VC 2ENBA 2RSNA 3BYYB 4ILWA 1XF5L 1STEA 4HAEA 1ZYRC 4V190 4MM3B 1DOXA 1WD1A 2FFKB 3AMZA 2FBWB 4MHEA 4OVZA 3D6CA 2VUMB 3NUCA 3QOJA 5T1IA 2OEOA 1B9MA 4WAFA 3VR9B 1EWYC 1E2VA 2MH7A 4DGZA 3BK1A 1QCBD 4TQ0A 1UWMA 2BE5D 2E75C 2B2VC 3HRZC 1FD7D 4R8NA 1L4ZB 5JPNC 2L83A 4JPSA 4A3IB 4YSYB 4X3SA 2X69A 3X3NA 5C4ZA 3T3NA 4GDLB 4HJGE 5FKAC 4KHVA 3SK5A 1QOFA 1XEEA 2LY7A 3I4MB 1KABA 3W9CB 3M7NA 1XLQA 4N9PA 2NMQA 3V96A 1PGAA 3HP3A 1QKZA 1GB4A 2F0MA 2LEKA 2WS3B 5BN4A 3VRBB 4WH4A 1Q3LA 2EJGC 2F0NA 1KTKA 1KLGD 5D3IB 4YSZB 1IL8A 3TUOA 1TWAB 3SFDB 4FO2A 1TWFB 1CZWA 1C4QA 2WXOA 3TZUA 3H09A 1J7CA 2JA6B 2RKSA 1HA6A 1YQ4B 4USAA 2VB2X 1JCKB 2Q8TA 1SNPA 4UAIA 3AE3B 3AEBB 2O4XA 3S9WA 5KRUA 3NBHA 2WXLA 2WU2B 3MTSA 5EPJA 1J8IA 1AYFA 4HMIA 3CU7A 3A55A 3PUWA 1ZXIA 1ZXHA 3AMUA 1N5WA 3TP6A 2QKIC 2NUCA 3B2GA 2RDFA 1U9RA 1WWTA 3I91A 2F0EA 1A3VA 5ELBA 3TEXA 2RDGA 1PFMA 3S1RB 4DK0A 4RNAA 1IKMA 3NVVA 2J0TD 2WKCA 4A3BB 2EDGA 2K28A 4K5XA 4KTAA 1YMHE 5HFYA 2M19A 3DWQA 3GS2A 3FMCA 4XT3B 2X6GA 3FKIB 1RYJA 1PRTF 1QOGA 1PRTC 3DEPA 4B08A 2VZKB 2WB1B 3MC0B 1V8CA 5D65A 4R3DA 2L1AA 5HHDG 3Q22A 2A6HD 2JSVX 4C7ZA 3DWPA 2X38A 1JE4A 1FFVA 1PFNA 2BA1A 4RGTA 3N52A 2JEBI 1TS4A 4XQNA 1JROA 1OXSC 2DYOA 5CYUA 4HR7B 2PPBC 2JEAI 2KDMA 2MJEA 5C2TB 1LTAD 3M4OB 2FINB 2NYZD 1PDXA 4X3UA 1DOIA 3TZDA 2FE8A 3FEWX 3I4NB 3BDOA 1S5BD 4ZLTF 2N55A 2K32A 3ERQA 2JE6I 3W2DA 3TDQA 2WXHA 2HDLA 3KK7A 1NI3A 3QWNA 2H88B 4BBSB 2EKIA 2B2VA 1Z6HA 3TBIB 4H13C 2W82A 5IGFA 3MHBA 4OO1H 1WVLA 3HOWB 3BVMA 4A3EB 1FR3A 4A90A 1LLRD 2J53A 3Q0AA 2LFNA 1ZDVA 3VR5A 1B4OA 1LABA 2CVRA 3IT4B 1HHVA 4PNYA 4BWGB 1S5FD 3NWTA 2HTME 2M2LA 2L9HA 3I4LA 3SR6A 1U4PA 2WIIB 1KDBA 2KQ3A 3P1MA 5CGKA 1EYCA 2WXRA 1LTID 2MP1A 4FF4A 1D1IA 1DOKA 3N6RA 1LO5D 1G6ZA 1STYA 3IFTA 1FGBD 5EE3A 1OFFA 2F0DA 3OSOA 2MHVA 3SHLA 3J7YW 3D8GA 3T16A 1K52A 2YEPF 2W3SA 3AEFB 2LUMA 2JP1A 2X6LA 1G2TA 1WTWA 2N88A 1QNUA 3EJIA 3OIQA 2R6GA 4A93B 2PVGC 1BCPF 3QB3A 3HS0C 3RFZB 3TP5A 3HOXB 4ABNA 1U4MA 3D3RA 4ZK9B 4K8IA 3NZ3A 4GLSC 1NENB 4H7BA 2F0KA 2K1BA 3I9V1 3TP8A 1AWDA 1PXUA 2B2UC 3A8IE 1SYCA 2RDHA 1LTRD 2YYZA 1YN4A 1RTOA 4AYBB 3GTOB 3VYRA 1VJKA 2I46A 1D5ZC 4NZLB 3LXFA 2B2TC 1CZGA 1EWCA 3MWYW 1WTOA 1DJRD 4DAPA 4U673 3C3LA 1KNAA 4RFBA 4CBVA 4KX6B 4CKBA 4DQOC 1MHHE 1SNMA 2JYOA 3K0YA 4HRSA 4RA8A 5EBDA 4RAUC 1UAPA 1IW7D 3KWVA 2EY5A 4DF7A 1VLBA 3I72A 4DAYA 3ABVB 2F0IA 1V1OA 1ZKOA 2VB3X 5CBEE 1C79A 4FVMA 3MAQA 5G3LD 4KY5A 1KNEA 1STNA 4ZYSA 3TEWA 4XTCS 3I3CA 2O2LD 3U52E 5I2XA 2EXZA 4BY1B 2QIEB 3SK8A 4C3JG 5C3WA 4CQNA 1ML0D 1BMLC 3S1NB 3K5OA 1PLFA 1TY0A 1BOSA 1H9RA 1CA6A 4A3FB 1FRDA 1EIGA 2KQ4X 1S5ED 2A5HA 4IURA 2F4IA 5BMHA 3P7JA 4HCEA 3GTQB 1UUPA 3I73A 2W54A 3RPFC 1TWHB 5I2YA 1YNTE 4IZ8A 1CK1A 1D6EC 1S5CD 2VNUD 1KRHA 2O5IC 2J52A 1A3TA 3CWIA 4ZKCB 3AB5A 2V4IB 1F9PA 3D4WA 3V2TA 2B2YC 2BS4B 1A3UA 3I8ZA 4TMAB 1ZYRD 2NVXB 1KF6B 5AUIA 1YQ3B 3R93A 3D6WA 4RGOS 1QOHA 2BA0A 3ONAB 1EU3A 2FMCA 1SAPA 2MJ8A 1EY6A 4P2CB 4HROA 1QNKA 2HDMA 5IIFA 2XWJB 2EY6A 1VRAB 4O1NA 4CJ1B 1E6EB 2WXGA 3S2HB 3NQTA 1NYQA 3H8HA 4G57A 4FXDA 1LT4D 5C0XG 2E6XA 2B2WA 3Q24A 4GDKB 2BS2B 3SEBA 3DWGC 4C7YA 4NP5A 2EELA 2B63B 2K6AA 5FO7B 2IJ0A 1JQ4A 1UEAB 4EQOA 2ID0A 1W6JA 4QB4A 2B39A 4M0WA 1PDQA 4G7HC 2G1EA 5EKLA 1FD6A 2N7JA 3NP8A 1I4PA 4R9WA 2WXFA 5M3MB 4ARIA 1E10A 4BA1I 3BDLA 3NTHA 3PO0A 1QLBB 3GD7A 1SJED 3E6ZX 5EBCA 5FO9B 2ZW1A 5C4XB 1M4VA 4DAVA 1TKWB 3A54A 1BQQT 3K57A 1EZ8A 1ACCA 2B2UA 2JA7B 1W6KA 3LWUA 1GUWA 2KCCA 4DNTB 5M3FB 2EJFC 1R4PB 3SFEB 4LJZC 2XWBB 2JYTA 3G7LA 2LMCB 1FCLA 2B2TA 1CA5A 1JWBD 1BBXC 1VDVA 2L1BA 2WXPA 3MFGA 1ICWA 5J39A 4QIWB 3M85A 2KCNA 4KKJA 3VR3A 1EY0A 2RSOA 3U9SA 1L0XB 1WTRA 2Z4HA 4A3DB 2Q5WD 5I9OA 1BUVT 4XIGS 4C1NI 1BF4A 1TR5A 1XTCD 1SIJA 2D5GA 4A8XC 2K3UA 4X3KA 3GQBA 2O5JC 5DNFA 2LGIA 5AFWA 3BDCA 4J1MA 3TEYA 4XT1B 3K5NA 4YWGG 1KDAA 2SOBA 3L7ZC 1FXIA 5C0XI 2EYOA 2JYEA 3C2PA 4IFDJ 2Q8RE 3PUYA 4RF1A 1RHPA 2JXTA 2L32A 4AQ7A 3NVYA 2CQAA 1Y1WB 1KAAA 1LT5D 4TQ1A 3ND9A 5M5WB 4NAWB 1SNCA 2W55A 2KWDA 1ZOYB 1PTOB 1HPCA 2QDBA 1PRTD 3AEAB 1XXGA 1WSPA 5G3LF 1ET6A 4N58A 2ZT9C 4N59A 1G291 4JX1C 3WOEA 3AE1B 3EUB2 4HN7A 3BK2A 5EPKA 1ZE3D 3J7AV 1C8CA 2GA4B 1H9JA 1ENFA 1QG7A 3Q8BA 3VRAB 4KV6A 1C4AA 3AEGB 4NW2A 2F0OA 2R3ZA 1R9TB 3HG9A 2IGHA 3A7AB 4ZQ3A 4OZBA 1T3QA 2PLPA 3TP7A 1DOMA 3BWUD 5FO8B 5T1GA 3P4PB 3CRKC 2H4OA 3G6JB 1L6VA 4K6DA 2FJ2A 4C3JB 2LS01 2NN6H 2JX5A 5DM63 3J81E 3H94A 3BYTB 1E0BA 2V3NA 1WD0A 2XSCA 4B9XA 2L11A 3WOFA 2SDFA 1WCMB 1C78A 2JA8B 5J22A 4NKLA 1C4PA 4FNFA 2IT1A 1BXTA 1I3QB 1YNJC 5HG2A 3Q8EA 1HTPA 1S5DD 3CQZB 4RKBA 1XX8A 1PTOC 4M8AA 2DNEA 2IPKD 3VR4A 1EEFD 3VYTA 4C3HB 1HXYD 1I4QA 1AEXA 1HTLD 3R2TA 4P16A 4HCSA 1SE2A 2H89B 2EOTA 1HZ5A 1TS3A 1P7FA 1RFKA 5IODA 2KOLA 1WTXA 4HEDA 3GV3A 5KYIA 1PGBA 1HCZA 1ONLA 2BCOA 5K5PA 2PZTA 2L52A 1XLPA 5HI1A 1IBXB 1F9RA 1V97A 3IL8A 2R61A 2SNSA 3WDNA 2F0JA 3S1MB 5C3XA 4PMWA 2WXQA 4A3GB 3KWLA 3S2DB 3VR8B 3AEEB 1E9MA 4KY7A 5CC4A 1QE6A 1IKLA 5FOBB 1IUEA 1BCPD 1ZP0B 2OT2A 1F2RI 2EJMA 3QG1A 1F2MA 1H9SB 1MI2A 2JSOA 2A73B 2KMMA 1GUSA 5EKKA 1HQRD 1R4QB 1EY4A 1SYDA 5I4DA 2XVSA 4DXGA 3NUHB 3AE2B 5I6YA 1RDPD 5K36H 1SNOA 4UDUC 2SEBD 4XQJA 4HTHA 4KGTA 4A3MB 2D5DA 3GTLB 4IDIA 1K83B 4NJCA 3SDZA 1JR0D 1JICA 2Y0SB 4OO1G 3Q8AA 1SB3C 4K14A 4I65A 4RWSC 2LHEA 2KEEA 2AWNA 2MEKA 4NAMA 4ZUJA