2NTSA

Crystal structure of sek-hvb5.1
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
217
structure length
217
Chain Sequence
QGDIGIDNLRNFYTKKDFVDLKDVKDNDTPIANQLQFSNESYDLISESKDFNKFSNFKGKKLDVFGISYNGQSNTKYIYGGVTATNEYLDKSRNIPINIWINGNHKTISTNKVSTNKKFVTAQEIDVKLRKYLQEEYNIYGHNGTKKGEEYGHKSKFYSGFNIGKVTFHLNNNDTFSYDLFYTGDDGLPKSFLKIYEDNKTVESEKFHLDVDISYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel loop domain in superantigens extends their T cell receptor recognition site
pubmed doi rcsb
source organism Homo sapiens
molecule tags Toxin/immune system
molecule keywords TRBC1 protein
total genus 66
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ntsA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ntsA01
1CHPD 2O2LD 3BVZA 1SJHD 3DWAA 4OHJA 1LT3D 1AN8A 2G9HD 1ET6A 1F77A 1KLUD 1LO5D 5D3DA 1D5XC 1SJED 1LLRD 1LTSD 2XNAC 3TSSA 1S5BD 3CHBD 3O13A 1FNUA 1PTOH 4Z9CB 1KTKA 4RCOA 1L0XB 1SE3A 1LT4D 1PZID 1V1PA 1LTID 1PRTC 1XXGA 1PTOB 1JWSD 3MFGA 1V1OA 1B1ZA 1SXTA 2XRSD 1EU4A 1EWCA 1PTOD 2R61A 4RGMA 1LT5D 3EFXD 1BCPC 4BWGB 1SBBB 3BVGA 1HA5A 3W2DA 1HTLD 3KLSX 1AW7A 1D6EC 2AQ1B 1BCPF 1I4GA 1RD9D 1RF2D 2IPKD 5ELCA 4NZLB 1JCKB 1YN3A 1TS3A 3BYTB 5FKAC 1LTAD 4RGTA 2NTTA 3R2IA 1B44D 1EU3A 3DWPA 1YN4A 1UUPA 4TSSA 1TS2A 1V1PB 1CT1D 1LT6D 1HQRD 1FD7D 1GOZA 4K6LA 1LTTD 2CHBD 2XRQD 1YN5A 4RGOS 1ESFA 1BCPB 4L63B 5D3IB 1JWMD 2WV6D 1PYWD 1BCPD 3BYYB 1S5FD 1FNVA 1L0YB 1LTGD 5ELEA 3SEBA 2XN9C 1EEFD 3MC0B 4RGNA 1S5CD 1CQVA 1PRTB 1PTOF 2IJ0A 1FGBD 1XTCD 1BXTA 1RDPD 4DXFA 1D5ZC 3BVMA 2Z8LA 1G8ZD 1I4RA 4RHSA 1LTRD 1ET9A 1TS4A 1JQYD 1CHQD 1TY2A 2J4XA 1ENFA 1I4PA 4ZYSA 1MD2D 2RDGA 1PRTD 1CK1A 1S5DD 2AQ3B 3GP7A 1FNWA 4RFBA 5I4DA 5ELDA 1HXYD 1SE2A 3R8BA 1EEID 4C56C 1PTOC 1PZKD 3OWEB 1D5MC 1TS5A 1UNSA 3R2TA 1I4XA 2TSSA 3URYA 4L6TB 2ICIA 1EFID 1RCVD 1T5XD 1JR0D 1JWUD 5ELFA 1I4HA 1SE4A 1S5ED 5TSSA 4RH6A 1I4QA 3DWQA 2AQ2B 2RDHA 2QILA 4RHRA 3BZDB 1DJRD 1TY0A 1KLGD 1PRTF 3EA6A 4O1NA 1PZJD 1M4VA 1LTBD 2QEJC 4UDUC 1STEA 1DYQA 5ELBA 2NTSA 1SEBD 4DXGA 1QILA 5FK9C 3V05A 2SEBD
chains in the Genus database with same CATH superfamily
2AX5A 4HVBA 2BYTA 3DWAA 2K6DB 4JC0A 2DAFA 1V9PA 1PH2A 2MBOA 4K8JA 2KFJA 3F2DA 1V81A 1X9NA 3IT6B 1EY7A 4WRDA 4DR4L 2AHOB 1HFNA 2FBWB 3CSFA 1J7AA 2INPE 1L0VB 2KMAA 1JJCB 4ALPA 3M85A 2WB1G 5J17A 1VQLA 1SXTA 2QCPX 3CRLC 1EWCA 1EIYB 2CR5A 3ZIMA 3DBRB 1NMGA 2IL8A 2JEBI 3NBHB 2LXJA 1L1OB 3TS2A 1E2VA 2KTRA 5JAVA 3S2AA 3APDA 1WJNA 4A3LG 4EZJA 2K28A 3ZKJC 3AEGB 4FF3A 1AW7A 4R4QA 5IYCH 3W3AA 3AH7A 2DZMA 3KBXA 1HTQA 3Q3FA 3HOXB 3PV1A 2IWHA 3HVDA 3J7YW 1VJKA 5JEAJ 1OTRB 3U4VA 1F0ZA 2O6VA 4HMJA 2FCNA 1SDFA 4NW2A 5CMDA 2BH2A 3DWPA 4IFDJ 3L3OC 4DV6L 2KX0A 2KCTA 3RZOH 3C1FA 1T0RC 1FFVA 1NR4A 2BYVE 4K6LA 1L4DB 2XRQD 4MGZE 1E22A 4L63B 1C0AA 4DV0L 1KLVA 3HOZH 2BS4B 3AE9B 5LL6S 2K1BA 3X3NA 2JXXA 3NZSA 5C5LA 1I6HB 4F1SA 5M3MG 2JUOA 4LNQA 3NK9A 5I2XA 3LNNA 2N9XA 1VQEA 4EVOA 2N9PC 4AJWA 2JU6X 4QIWB 3PUWA 1PH5A 4PMCA 4H13C 3MJWA 2F0NA 4OO1G 3H3VH 1RFKA 1GB4A 2VQFQ 1G8ZD 1ASYA 2L12A 2X6GA 2ZXPA 4RKLA 1RHPA 3W1YA 1OQQA 4LFCQ 2XSCA 1KC8C 4XQQA 1TWGB 3M9BA 1QF6A 4DKAC 1QUQB 2DX5B 2N4FA 3AEBB 2KN5A 3IFWB 2K33A 2L76A 2GVBA 2PZUA 2NWGA 3K0XA 2L9HA 4QGUA 3IAYA 5DPTA 1XEEA 1SYBA 4PS8A 3P4QB 4N8X1 3NPPA 2A6HC 3FKIB 4U673 1PQSA 4LK1C 3MEFA 3H9DA 4C56C 2AWTA 3CP0A 4C4VA 3UI2A 3H0GH 3PIO3 1PVOA 1PGBA 2ICIA 2MBQA 1I3QB 3SK6A 4HKZE 2E76C 4A93H 3STBC 4XWWA 1YITA 3I57A 2CHWA 3M95A 1EY0A 2C7NB 1KAWA 4JI1Q 4BBNC 2B2TA 2ATWA 4EFOA 4A55A 4D2KA 1NEKB 2GMIC 4R9WA 1YJIA 3LWUA 1A6XA 2EJGC 1ASZA 5FLMG 1UGJA 1XMQL 4KJNA 3F8TA 3ZW3A 3E9IA 1SROA 1PRTF 2I0QA 3ML8A 2F0TA 3JAML 1XLNA 2FAZA 1EZ6A 2WB1B 1LTBD 2LHDA 2FUHB 4BKGA 1YJJA 3QCAA 3R7RA 2L32A 1G6JA 4JCVE 1UE6A 2ZNVB 4A3DG 1AN8A 1JOOA 4NQKE 1OXVA 3SGIA 2BB6A 3BJUA 4F7XA 4FULA 3QOLA 1QZGA 4UP9A 1RODA 4BAXA 4IUUA 2F3VA 4HTHA 4HR7B 2F0OA 5K36G 1U0LA 4NXNQ 1KD1C 1P7FA 2V3SA 4KGTA 1L0XB 3BS1A 2I07B 4M01A 4MGYE 3OAWA 2PPHA 2LZ6A 3A74A 2D10A 1JW9D 3PF5A 4ODGA 2LJ5A 3L0OA 4LLGM 1RIPA 1EU4A 2R61A 3E0EA 1E1TA 4X65Q 2AEHA 1TKEA 1VQ9A 2BYFA 2OF1A 1KNEA 3RN2A 1L2FA 4XT3B 1A2UA 1FXIA 3FHWA 3HOWH 1NENB 2AQ1B 1H4RA 2K3UA 3T3NA 1CSPA 4UY8C 3AE3B 5KHQA 2WX0A 1E9MA 1Z5SB 1X3PA 2QF7A 4RGTA 3B6YA 5H1SE 2IO2B 3SHLA 4GXBA 5IT9E 2AKWB 4CKCA 1N36L 1HR0W 1EM7A 3L0WB 4A3BG 1Z9FA 3NVYA 4LNKA 3V61A 4DDGD 1ZGUB 3Q22A 1TKYA 4ZRQA 3NTIA 3RUZA 3IT4B 1TWFB 3DOWA 4X62L 1C77A 4AJYB 3HKZG 2CJNA 1RM6C 4HCPB 3RI7C 5IA7A 4A3IH 3AE6B 2V1CC 4B0EA 3DBSA 4YWLA 2AMCB 3HS0C 3W5VB 4A3FG 3FEWX 1WTOA 2C7HA 1L0YB 5ELEA 3ZTDA 4ANUA 5LXIB 5M3FH 1SRUA 1EEFD 3VYUA 5FJ8G 1O80A 4OGQC 5IGFA 1Q1OA 2VQFL 1V80A 5GROA 4P73A 2BDOA 2ZJPA 3NS1A 3SR6A 2JSOA 4XXEA 5IOCA 4DR7Q 3IBEA 3ONAB 3KVFB 1K52A 5KYIA 3UGBB 5IGBA 1X65A 1B50A 3RT3B 5DEHA 4AYBB 3OG5A 4HKQA 1S5DD 4DAYA 1K50A 3Q8DA 3M62B 4K2LA 2K5WA 2PO4A 1E8XA 5CBAE 2D5GA 3K7AH 5ELDA 1HXYD 4FXKC 4IALA 4IO9A 4CBVA 4FN2A 4HLEA 5J2RA 1WGKA 1HA6A 2CQAA 2MQJA 5G5HA 4XE0A 1UWXA 1DM0B 4L5QA 5IP7G 1T0QC 3ML9A 2MCNB 2JYOA 3GTMB 2F3WA 3NXWA 1BT0A 2PMZB 1RCVD 4K2KA 2BWFA 3HM6X 4WJNA 4IJHA 4NAWA 1HCZA 1Y1VH 3R93A 2JX5A 2KDBA 1KRTA 1GC7A 2DZIA 3HGBA 2LGYA 1HR0Q 5C4JH 4NQLB 3VA7A 3VH4B 1N5WA 4DR4Q 1PLFA 1HNZL 5KGUA 1NAPA 1VQAA 4IOAA 2AL3A 2F0DA 3KWLA 3MTSA 2JYTA 3NOBA 3BZKA 4YCUA 3I4MH 1TZOA 2K6AA 1KLGD 3FKIG 4FF2A 2BE5C 4QUFA 4KN4C 5H8YE 2PIAA 4A20A 3ZLZA 2QEJC 3U50C 2W54A 4CQNA 4B9KA 2R93G 2KO3A 2I5HA 3CC4A 1K0RA 3Q3JA 5FK9C 1Z2MA 1CHPD 1J8IA 4K7UA 4OHJA 3S2HB 1N60A 2QHOA 4HWIB 2EZVA 1KLUD 2F1MA 2VS1A 3IRBA 1UF0A 3KF8A 4BOZB 3OSOA 4A3EB 3IL8A 1JICA 4WQMA 3CHBD 2O6VB 4XGAB 1PDQA 1HQMC 2V4IB 1VMPA 4Z9CB 2NVQH 4JIOU 4RMFA 2BPSA 4JWSC 4Y7NH 2HIVA 4YWMA 3I56A 2OCEA 5IP7H 5IGCA 3RPFC 2O4XA 2Z59B 4KY6A 5KIXA 1SGHA 2CWPA 2L0FA 3ZUNA 1FFUA 1WR6E 3NQIA 4O0AA 2NVTH 3L16A 5A2QE 1G51A 5AUKA 1STNA 4MNOA 2CCZA 1VQDA 1SBBB 1C9OA 4B3RQ 2FFKB 3K0YA 3RLOA 5C3EB 4A3GH 4PS7A 2YTXA 4BA2I 3ZXVA 2DNCA 3EVQA 4FVMA 3QJZA 3PRMB 2R6GA 2L15A 3CC2A 4AUQC 3AM9A 1TS3A 2MGSA 3CCSA 3AI5A 4IWPA 4YL8A 1TR5A 1XYIA 4I7AA 4JBMA 5C4XH 3T1HQ 1CI3M 3I91A 1WRDB 3STBD 4IURA 3RMHA 1YJWA 2UUCL 2ZZPB 3Q6BA 3CMEA 1YN4A 4I6NB 3E5SA 1WYWB 5D6JB 1E2ZA 1VCIA 4F7ZA 1FD7D 1GOZA 3I4NG 2A19A 2H4OA 1N34L 2JZPA 5J39A 1JWMD 4DR5Q 3BIID 3UIOB 1VS0A 1VZ6A 2WXOA 1PYWD 2ID0A 2K5VA 3L10B 5CGKA 2NBUA 3Q8EA 5BMIA 2F0LA 1XMQQ 3GTGH 3MAQA 5M5YB 4XQNA 3HOXG 1XQQA 2HTHA 4JX1C 3C1EA 4A3BH 2HDMA 1GUWA 3J81E 1S5CD 2X69A 1PRTB 3PO0A 4C4VB 3OMCA 1HZ9A 4CDDC 5LMUQ 4MHEA 3VUWA 1SE9A 3L13A 1SNQA 2N1VA 3CQZB 1HZ6A 3Q3NC 1XF5L 2E2JH 1E7ZA 1JRUA 4X3KA 1JQYD 1WD0A 1F9JA 1GUAB 1JE5A 3PPAA 1SSNA 1OXSC 5JPMC 4B3SL 1IYJB 4DK6C 4K7WA 2JA8H 2FMCA 3A1QA 2ZXOA 4UPAA 1C4QA 1D1IA 1M1KC 1E7UA 1N33Q 2HTME 2C9OA 2KLCA 2I46A 1EY9A 4C1NK 2JF5A 3GOEA 3GD7A 4K0KQ 1PTOC 3EFCA 2Y5BB 2PPBC 1L7YA 3H94A 1U9RA 1I4XA 1VDZA 4NXML 1R4QB 1X3EA 3QARA 4KDIC 4LFCL 3NG0A 4W9DA 2KAJA 1EYDA 2LXKA 1A5RA 3K81C 5TSSA 2RD0A 2G1EA 2F0EA 3D0FA 2CWAA 4EQ5A 3AB5A 1R4MI 5IOIA 1WTHA 2DUDA 4RHRA 3W5OA 1SF0A 1O7YA 3IFDA 1JQ4A 3LWEA 1VQ8A 1N32Q 2JA5B 1K51A 1DJRD 2P5ZX 2I1KA 3AU4A 4Q2JA 4XC2A 4JI7L 3AEVA 4IUTA 4MTKA 5M5WH 3KDFA 3S17B 1VZ7A 2WWZA 4QCLA 2BCOA 3J80c 2PVGC 2CU3A 2QIEB 2Y5CA 1QLBB 3GE8C 3EIVA 2GOWA 3M3YB 3E6ZX 3DHQA 5C3XA 3ALBA 4ILWA 3PO3G 3VDZA 4TQ0A 1DZ1A 3QJYA 3S2DH 1NYRA 2FCQA 2E2HH 3Q8FA 3ND8A 1J6QA 3RN5A 1K53A 1V6EA 2HJ1A 4G7HC 1SE3A 3NY5A 4NMZA 3GTJH 2EY1A 2RF4A 2PW7A 4ZOHC 1XXGA 2IHEA 1ZW7A 1HTPA 2K8HA 2ZPNA 3MJ5A 1XMOQ 3OWFA 3EFXD 4IPGA 5LHY1 1WD1A 4ANWA 2F0IA 2K6QA 1L6UA 4DR1Q 2XGTA 4HMIA 4A3EG 4R8IA 5IYDG 3Q14C 2KNBA 3DEPA 2DJFC 3G48A 1AH9A 4KKJA 4CJ1B 2IYDB 4QJFA 2KTRB 2LI5A 2F0QA 3ICEA 5IODA 1PMRA 1JROA 4BFRA 3CCJA 2WS3B 2ZVNA 4BY7H 2KEDA 1G91A 3ENEA 1Y1WB 1FRDA 3OJ4B 1WYDA 1LT6D 2FMMA 4JV5L 1AE2A 1HQRD 4MEMA 1FM0D 2I1JA 4A3DH 1ESFA 1DOXA 3I3TB 3RUIB 2WV6D 1L1OC 4CKBA 2UXDL 1WYGA 2LJIA 2NBVB 5C4XG 4LJOB 4YSXB 4K14A 2G4DB 3WAPA 3S9WA 3N20C 4NNJB 3MC0B 3VQIA 3TN2A 3ZTCA 4OIKA 3N9YC 5IY0A 5IYCG 3T16A 2VY3A 2B3AA 4NJCA 1IBMQ 2Z4HA 4A3GG 1UAPA 4FA6A 2O6VD 5E7NA 2F0SA 2MQHA 3A7LA 4RG1A 1WE6A 1MG4A 2KX3A 4UP8A 2LFNA 3QAQA 1H9SA 3IFTA 2JA6B 3M3JA 2X6LA 4C3IB 4URKA 4RF0A 3VR2A 2SNMA 3I3CA 2WFWA 3D6WA 1FO4A 4EGVA 2N7DA 4GS3A 4GOCA 3VVWB 4JBWA 3R7QA 3RYTA 1VQJA 3TEXA 1D2BA 3FMCA 2LASA 3S14H 3TL5A 3G71A 4DR6L 5MPOA 3EC8A 2F0FA 4L6TB 2NN6G 1KNAA 3S24A 1T6BX 1ZE3D 3KWVA 4US9A 3QR8A 2W3SA 3NP8A 3KLSA 4ZRZA 3D32A 5DNFA 4L5TA 4DUYQ 4P7IA 4EEWA 3PO3B 4DU9A 4KN7C 2V9HA 1OGWA 4KV6A 4EOYA 2HHHL 4APVA 2B63B 1V97A 4JI0L 5J22A 2R7FA 1K28A 1IP9A 4DV5Q 4XYCA 3OJ3A 1UEBA 3EHVA 4XDXA 2VB2X 4HCSA 4CDFC 3BY4B 4JPSA 2H88B 2GBNA 5FR3A 1X32A 4IPCA 1I50H 4DXGA 1EQQA 4A3CH 4MACA 2SEBD 5KNCA 1HNXQ 2WQYB 5IWAQ 2MJ8A 3TRZA 4YTPB 4HEA1 4A90A 4KSKC 1JWBD 4HROA 2N88A 3S1MB 2XNAC 2QDLA 4NXMQ 1FXAA 3Q8CA 4E74A 3I63C 1EO6A 5CTRC 4PZ6A 1WOCA 4K0KL 1EL0A 4KZCA 4KY7A 1G2SA 5EJWA 1EOVA 2CW0D 3PO2B 1NCVA 1OEYA 3SDLC 1YNJD 3MXGA 1JWSD 3HEJA 1AZPA 3CCVA 2KQ7A 5CHFA 4CJ2C 3ULJA 3T56B 4HDOA 4IOCA 3WALA 2DYOA 2ENBA 3WAMA 1W6KA 4BBSH 3H7SA 2F4VL 5T1GA 4BY1H 2KEEA 1P8LA 4DN4M 3ZNID 1Y8PB 2EYFA 2JJQA 5C44G 1UE1A 1I4GA 4B08A 1RD9D 2IPKD 4GDLA 4REZA 1K8MA 1C7YA 2M9VA 4IFDH 3CWIA 3RLNA 3O65B 1Y8NB 5FKAC 5EQ0A 1LTAD 4IWOA 2GBMA 1Q82C 1SFOH 5E6JA 4DR6Q 2PCFB 1A0IA 2JZ3B 1UUPA 5M3FG 1MJCA 1WX7A 1B3AA 3FP9A 3U9OA 4HJ9A 2J42A 4DR5L 3AE7B 3S1RH 3VR9B 3GTPB 2R92B 2W3RA 3I2ZA 3S1QB 4WURA 1DD2A 4IZ8A 2QW7A 4XQJA 1EIHA 3CCEA 2WXRA 4XYOA 2OQKA 4IJLA 3K57A 4A8XC 4A3KG 2NBWB 2ZJRA 1FNVA 2UUAQ 4RMAA 3OIQA 2BBCA 3KFUA 4ABNA 1JT8A 4X64Q 1I5FA 4DV3Q 4GOPC 2UXBL 1VQIA 1E8ZA 2M19A 3RCZA 3CF5A 3BG3A 1WMHA 2L0TA 2MJEA 2JY6A 3RZDB 2A5HA 4EUTA 1PFBA 2CQOA 1LTRD 1GPXA 3EN2A 4UP7A 5EE1A 2LFIA 1U4AA 1DOLA 1IYUA 4KKUA 4S0RA 1GUGA 5G3LF 1E10A 3L4PA 3TEZA 1NJIC 1F2ZA 1VR9A 1L2NA 1JB3A 2MBBB 4HJ7A 3VRAB 3AYHB 3ZVVA 2K01A 2VW9A 1SNOA 4DNTB 1G6ZA 1Y1WH 1SSOA 1BF4A 1RL2A 4IUVA 3WA0A 2WXQA 1FJGL 2BGFA 1KFYB 5JZEB 5BN3A 1WVLA 5C3JB 1M8AA 3CD6A 2OXPA 2WXMA 2KLGA 3ZJTA 5HI1A 4BKTA 2J0JA 2PEAA 4HCEA 2KQ4X 2JXMB 5CC4A 3PIPA 5CYUA 2H1EA 2KWCA 3GS2A 1V1QA 2VZAA 3HHMA 1IZ6A 4YWGG 2W82A 4Q0FA 1BMLC 2CS4A 2L83A 1TY0A 1QNUA 3DDCB 3UINB 3ITPA 4CHKA 3RNEC 4LF7L 4K8IA 4LF9L 1KDAA 1M4VA 3ZJUA 2B8FA 4OWWB 5K5PA 1PH9A 4WFN3 3GTJB 4YCWA 3NHHA 4DV4L 2WDTB 3NTKA 1PYBA 3KUDB 1H9MA 3UDXA 4R4OA 1PH6A 2OHFA 2E2HB 2M4NA 4K7SA 3U7DA 3EQLC 3S2DB 4LFBQ 1DGJA 1LTSD 1WXVA 3D4WA 3DVGX 4JI8Q 1CKOA 5EKIA 1E3PA 1PTOH 1WTRA 3HVZA 3PRPB 3I4OA 3RZFA 2MX2A 3NVVA 3ZRFA 3TMPB 2PLPA 1BO0A 2JRIB 1MIUA 1KXLA 5M5WB 2L05A 2PTLA 5HGTA 4HSVA 3MP9A 4OONA 4UAIA 3G6EA 3EFUA 3UE0A 1MKHA 2F4VQ 1GNUA 1GUNA 4A3FB 1EF1A 2YEPB 1O7LA 3LXFA 5BYQA 2YV5A 1LACA 3Q69A 3T1YL 1NDDA 3A4RA 4W9LA 2O2VA 1J7CA 1OEYJ 4ZKBB 2WXGA 5IT9c 5AFWA 3HKZB 3AFQA 3KLSX 4KKSA 4PMWA 4DR7L 2KWUB 3L17A 4XTCS 4GB9A 1TT2A 4ANXA 1IW7C 4RM8A 1IPGA 1JCKB 2LKVA 3GTOH 1TBEA 4M0WA 5E4WC 1TWCH 3EUB2 1I7HA 5IAAC 1ICWA 3A55A 4KJOA 3KLRA 5HG2A 2YYZA 1VQ4A 2EXDA 4P71A 1V1PB 1Q8IA 4MJSA 2DAJA 2JA8B 1F2MA 3W1SC 5I9PA 4RGOS 4FF4A 1K83H 2FHTA 2MEKA 2NVUI 2KHSA 4GKKQ 2NB0A 1GKHA 4HEDA 4R4CA 1VQNA 2KDFB 2A6EC 3HOUH 2KZRA 3HK0A 4PYUA 3J80E 3CQZH 2KT7A 3UI3A 2MP1A 1EOTA 2F03A 4GN5A 4GOPA 3DQVA 3Q6SA 4B95A 5LMUL 2F0KA 4OWTB 1SNDA 4ZKCB 1QOAA 3J81j 2KTFA 2YTVA 4V190 2KYWA 3BVMA 1B2TA 2Z8LA 3KF6A 3VAWA 1NBWA 4X62Q 4XYQA 1Y1VG 4WQOB 1SMYC 4G4KA 2ZXRA 5M5YH 1ET9A 3SU8X 5JVH3 3QO2A 1E90A 4B3SQ 3NZ3A 3RNGC 4JI2L 2X8XX 4R3DA 1C48A 4A3MG 1MD2D 3BINA 3K5MA 3T9LA 1Z47A 5T8IA 2C5LC 3TEYA 4R1JA 2IY5B 2KA7A 2JPHA 4MSMB 3ETRA 3JAMi 1YD8U 3R8BA 1J5EL 1SYDA 4JGHB 1F2RC 5JHAA 1IGCA 3UQAA 2UUCQ 1FPYA 5C4XB 2LMCB 4NJ7A 1RTOA 5M3MB 2MLBA 4JI5L 4OX9Q 1T0YA 5ELFA 3HZXA 4HK2A 4DNRB 1S5ED 2JA6G 5FLXE 2R3ZA 3Q8BA 4M0WB 3T3OA 3BDCA 1OQYA 1ZDVA 1HTOA 4A3GB 5C3EH 4JOIA 4B3RL 5GAHC 1MHWC 4YIJA 2V1YA 1WI5A 2K0PA 1RAXA 5M3MH 1A62A 1Q1BA 1SMYD 4O1NA 4PG3A 3C0RB 1WXQA 5CHWA 1DYQA 3NBIA 3KYDD 4C3IH 3NVWA 1HZCA 2N78A 5IGDA 2KKCA 4S17A 2LXAA 3V05A 1F9RA 1TYGB 2BKRB 2NVQB 1HFGA 1D1KA 3UDIA 1YX6B 1LO5D 3F2BA 3A33B 2EY2A 2QSDA 1EWIA 5L37A 2EYPA 1Q12A 2V3PA 2LRUA 1NUCA 3M7NA 1Q0WB 3E3XA 2V4LA 3FC4A 1LT4D 5C5MA 3ERSX 1VF7A 1BR9A 3H3VC 3PVLA 3CCRA 2X38A 3HUIA 2K7VA 2R7ZG 4GSWA 1MJDA 4LFAL 3I4MB 3B2GA 2KHIA 1BBUA 3X23A 1HEZE 3MXNA 3PUXA 2DBYA 4LK0M 4X66Q 1G6PA 3CF6E 4O2DA 4CDCC 3HOUB 5IYDH 1BCPF 1HR0L 1WE7A 3PZ8A 1QJOA 2G45B 1WJJA 2RSOA 1A3VA 3AXCA 5ELCA 2SAKA 1K83B 3PGZA 3HKZE 2GRIA 3TBIB 2NYZD 1WCMG 4OO1H 5G2NA 3TP8A 3J7AF 3X0WA 1H8CA 5DAUA 2K32A 4A76A 3MHBA 3WDNA 4HJAA 5FOBB 2W55A 4KI0A 3QWZB 4TUUA 3H15A 2WXHA 2RCNA 2XK5B 2XK5A 1TWCB 2PI2A 1HPCA 4DV7L 1M90C 1JB7A 4DHZB 5AJ3Q 4LF6L 2B2UA 1BCPD 5JEAG 2EPBA 3BYYB 3MVVA 4DGZA 4TKNA 5JH5C 5I9OA 1N61A 1S5FD 1CA6A 3N1XC 1N32L 2PNRC 4JYAL 1QT9A 4IFDG 1ZDXA 5EDSA 3PIP3 3CRKC 4JLCA 1ZYRC 2EOTA 4DXFA 1D5ZC 4QQBX 3DBHB 3PREA 4IOIE 2J0MA 3CKIB 2WXPA 2EY6A 1QOGA 5IE8A 2N9EB 5BYRA 2LD9A 1TY2A 3A54A 4ZHPA 4ITKA 1IGDA 4ZYSA 3JW0X 1SLJA 2KVZA 2J7ZA 4R8NA 4LAAA 5IYBH 2QJLA 4ARIA 1EQRA 4NAWB 1X3QA 3C2PA 2KMMA 3TP5A 3NRZA 4H2AA 4DK3C 1WXAA 1FRRA 4TV3A 4W9IA 3T8MA 3Q0AA 2A4ZA 4GDLB 4BKSA 2RVLA 3MXUA 2KVRA 3APCA 3P1MA 2DY7A 4P74A 1TIID 3HIZA 1GG3A 3OLMD 1F9QA 5CHVC 4DFAA 5HHDG 1JR0D 1JWUD 3FDTA 4H44C 2PYKA 2VNUD 2J0KA 1D3ZA 1QOHA 2WU5B 3J7ZC 4HIMA 2NCNA 2PMZE 2F0MA 2Z0DB 4HPPA 2AQ2B 3A7AB 3A9JA 3A9KA 3I4MG 2EXZA 4JVZA 3A4SC 3I8ZA 4LWCA 1EWYC 1V86A 2PQEA 2ZVOA 5DLQE 2RSUA 2NMQA 2DY8A 3AU7A 1N34Q 1Q5WB 2E2JB 3N1YC 4LF9Q 3QHTA 3E9HA 2O2LD 1VQMA 2UU9Q 4B3MQ 1YJ9A 4OVUA 3D6CA 2MWSB 4HIOA 1HZAA 4MIUA 2IX1A 1YHAA 1Y1WG 4NKLA 2K50A 1K9MC 4A3BB 2NS5A 3TQYA 3NVZA 4KZ0A 1P7EA 2L7RA 1GUSA 4WJQA 1NI2A 1SNMA 2RPQA 2AWNA 2KQ3A 3MZ5A 1Y56A 3ULPA 3H7PA 4DAVA 2CVRA 3QX1A 4ZHOA 1QNKA 1QZHA 4DR2Q 4WJWA 3MFYA 4RGMA 3DM1A 3DWMA 1H9RA 5I2YA 1AYFA 1PA6A 1XNRQ 1YX5B 5DPWA 1K8AC 3ZDTA 4GU2A 1QKZA 1HE8A 5EBDA 1XCQL 5HURA 3DMUA 1EUJA 1MSGA 3AE5B 2JT4B 3P42A 4NJ6A 3RFZB 4MM3B 2LY7A 2B76B 1QE6A 2UU9L 3J81c 1UBIA 1I3QH 1CKNB 4ZRPA 4AQYL 2WU2B 2R92H 3GTPH 5JOBA 3S1RB 4EE2A 1IXRA 1YEZA 1IHZA 1P1AA 3SK4A 2K5PA 3ECIA 1EU3A 2KANA 1EUVB 4TQ1A 4ZRJA 3MC9A 4DPGA 3L2PA 2OQ0A 4GN4B 2JQOA 1WGGA 2REXA 4MGKE 4DQOC 1X1MA 4ANVA 3PS6A 2NVTB 4K1RB 1PH8A 1GJZA 3T51B 3FRPB 2HDEA 4B0MA 1SN8A 2K52A 4QIWE 4M8NA 4KHZA 4BY1B 1LTGD 1VCBA 3AULA 3VFKA 4DHZE 5EKLA 1B70B 2M00A 4OIJA 1CQVA 2Q8RE 3J7A5 3NSWA 2OWOA 4FXCA 3I4LA 4RNAA 4DHJB 1LV9A 4JI2Q 5H92C 1WTQA 2LGDA 2Y0SE 1X3FA 4HSPA 3QIAA 4KIKA 5AZHA 3PO2H 2A69D 2LS01 3A1QB 1RLFA 2KC1A 3IG3A 1A63A 1B8AA 2WINB 2N49A 2NPTB 4MSQB 2DHZA 4PZ7A 1RWSA 1LXDA 2OOBB 3AEFB 3HOZB 3IHPC 1UGMA 2MBHA 3VUYA 4WWPA 2PMVA 2AQ3B 1GUOA 3S1MH 3SE0A 3K5LA 1N8RC 4K5VA 1ACCA 4IUNA 3IAS1 4TMAB 4IUMB 4USAA 1A70A 1ENCA 3ZO5B 1WRIA 3QIJA 3L08A 5C4JB 1TKGA 4HXDA 1SB3C 1UNSA 4GKKL 2TSSA 3ND9A 1JMCA 1GB1A 1L0WA 1S1QB 4M00A 4H7BA 1IBKQ 3KOJA 4WWMA 1MI0A 4FXGC 2K5DA 2MO1A 1L5PA 5IN7A 3IXSA 2IBIB 3NELA 2HD5B 2B2TC 2E5LQ 2Q8TA 3RNBC 2FCSA 3E56A 3BZDB 4GLVB 4JI4Q 1CFMA 3CPFA 5C0XJ 4P1BC 2K22A 2IO3B 3GTOB 3PGEA 2Y0SG 5A35A 1FCCC 1AEXA 4C3JG 2KUMA 1ZYRD 4NAMA 3NJTA 2V4DA 1SE8A 3BVZA 2DNEA 4QMGA 5LMNQ 4YY3Q 3KQ4A 1FD6A 2BYEA 2I2YA 4A3FH 1XO3A 1G291 4YXDB 4OEMB 4ME3A 5EE0A 5FR6A 1LGRA 3AE2B 1IBXA 4P72A 5M3FB 2UU7A 2ZPYA 2RGFA 4DUYL 2OJRA 2IX3A 1X6OA 3GZNB 2KCNA 1PTOB 3D4RA 1LTLA 3D8GA 1V1OA 2SOBA 1STAA 3K80C 1T9HA 3VR8B 1IL8A 1M94A 2L4NA 1C1YB 2EY5A 3NTHA 4DV4Q 4KHPQ 4JBKA 4AWJA 4A6QA 4LDTB 3KF8B 4WJ4A 5JJLA 3GO5A 1I94L 1X3GA 2M0XA 3NHEB 4BS9A 3HOWG 3DXJC 1QOFA 1RF2D 3FVQA 4EQOA 2FINB 4A3DB 3AV8A 2NR2A 2HIXA 3KK7A 4Y52H 3I5JC 3I90A 3U58A 4HN7A 3HOZG 5CV4A 4EQNA 1IKMA 1YJ1A 1STGA 4AH6A 3AMZA 4TSSA 2RKSA 3F2CA 3UIPB 3I72A 1WH3A 4X6AH 4GDKA 2DYMA 3RD4A 2MW5A 1GHKA 3GTKH 5CV7A 4KKTA 2G4SA 4PT5A 3T53B 2UUBL 1AE3A 2ZTCA 4JI3Q 5IP4D 1HUMA 4FBJB 5FO7B 3P75A 2UXDQ 2MNAA 1K8GA 1JOQA 2VB3X 2JE6I 2F0JA 4JI5Q 4OX9L 1FMAD 4JI6L 5FLMH 2UUAL 4HAEA 3TUOA 5ELNA 4OELB 2AL6A 2PQAB 4WWNA 2OTJA 2WX1A 3RMKC 1TQOA 1XPOA 5G3LD 4DR3Q 4KLKA 2KJHB 1VQBA 1BUIC 2UWQA 2VH2A 3KJPA 2Q2UA 4KGSA 1K8RB 3NWSA 4GNXB 3RZDH 5CBEE 1VRAB 3JYUA 2NN6H 4US8A 1I4PA 4OWXB 2IHFA 3H0GG 1WM2A 3MXNB 2NUCA 2K8CA 1W2BA 1BUVT 4RFBA 1LQBA 4JG2A 2JA5G 4BXXH 2M56B 3GDEA 3M4PA 1IW7D 1VQ7A 3JAME 2K25A 1PZKD 1OQRA 3S17H 2JWUA 3R2TA 4CJ0B 3URYA 1OO9B 4DA2A 5FO9B 4A93B 3IAM1 4LF8Q 3VTUA 3TZDA 3S1QH 1XPUA 2XVSA 2JA5H 5LMNL 3ABVB 5E6NA 5LL6X 2F4IA 1SYEA 1L4ZB 3BWUD 5D94A 4FP5D 2IO1B 3FKIH 3Q8AA 1SFOB 3VR3A 1YNXA 1SR3A 1HHVA 2L1AA 3NUHB 2MFIA 3CW2C 2E6XA 2KJ6A 1W3SA 1O7IA 4BBRB 4F88A 3AE8B 2EQSA 2GBJA 1SYGA 5HGQA 1STEA 5ELBA 1SEBD 2IZVB 3WIMA 2B2WA 3G7LA 4MH8A 2EJMA 4WAAA 5FJ8H 1EIGA 4BBSB 4IFDI 2G9HD 1IBKL 1DOMA 5D3DA 5GQOA 1D5XC 3MHZA 2WHIA 2KVMA 3VYSA 3GB1A 2Z6BA 3ZRCA 4A9AA 4ZDVA 3U2SC 1IUEA 1NR2A 1ZXTA 2G5DA 1I6HH 1UWVA 3GE3C 1WTXA 1TKWB 3EJIA 4R4TA 1OTCA 4FADA 2IX0A 4C2MB 1OFFA 2N3SA 4GMVA 2C35B 1K3RA 2B63G 1H9SB 1E2WA 2TMPA 1PTOD 5E1FA 1SMXA 2ZT9C 4A3LH 5G5GA 2K75A 5C4ZA 2ASQA 2H5XA 3OYYA 4BWGB 2GVAA 1HZ5A 2F0GA 5J1ZA 1JALA 3KH0A 4JK1C 3ZQ4A 1HTLD 3HM3A 3A8KE 2L5TA 1I50B 3MWYW 4LFBL 4FHKA 1UZXB 2OEOA 1WXSA 3CCLA 1C3TA 5C0XI 3UE1A 1LM0A 2NN6I 3KYHC 3LGJA 3T1YQ 3HG9A 3R3OA 1WJ6A 2FE8A 4JBJA 2N7EA 1YNND 5TR5A 2JP1A 3HOXH 2WAQG 4LNFA 1JMLA 2UXCL 2B63H 5C3WA 4PZ8A 1B44D 5EPLA 1LFDA 1E0BA 3PO3H 2WP9B 3B1LX 4LNNA 4B6WA 1SNPA 3ER0A 3JSVB 3NWTA 1BNZA 4TVAB 3VUXA 1I6VC 1SAPA 2KCCA 3U4EG 2INNE 4ID6A 3RNFC 4NP5A 3GQBA 5K36H 2F0PA 4FLHA 4MDKE 1STBA 2WYQA 4PMBA 1SNCA 4JI3L 1CKMA 5DM63 3S14B 2VZKB 3CSTA 3KUZA 1Q1EA 4MELA 1YHQA 3JSVA 1YI2A 3SEBA 2XN9C 4MT5A 1YZ6A 1WJUA 3TZUA 1KOTA 4RGNA 1CZPA 3J80L 5AZFA 5DM73 5IP9G 1FCLA 1VZ8A 1Y8OB 4LUVA 4MH0E 2F0WA 4J3OD 1GAQB 4KGRA 1WGYA 2JA6H 4Y7NB 2KJRA 3A5ZB 4JV5Q 1TXYA 1ENFA 4XIGS 1JWAD 1YQBA 1P9DU 2MBEA 1A3UA 1PRTD 1XLOA 3A56A 1CK1A 2ASBA 3U7ZA 4HIDA 1VF5C 5BN5A 3AU5A 1NYQA 3SR1A 4KHPL 3K9OB 4H02A 3J80i 5CX3A 1MJEA 4BBRG 1K8OA 2ZCBA 3TP6A 1EEID 3RLFA 3UDGA 1NTGA 3OWEB 2D07B 1V5TA 4IC7B 5F2DA 4J15A 5CV6A 1EFID 2WKDA 2O5JC 1VQGA 3VDYA 2KCMA 1I4HA 3K9PB 2JK8A 2K39A 4BA1I 4EZKA 4BY7B 3KLWA 3U4ZA 1WY8A 3NS8A 4QAYA 1Y1VB 4FYDA 1TIFA 2Z4IA 4A3CG 3VXWA 1ZUD2 3PO2G 2WDVB 3HOVG 5LLIA 4RA8A 2HQEA 5COYA 3GTLH 1IBLQ 1S3OA 2WGSA 2B2YC 2B8GA 2ZEQA 1UH6A 5JJIA 4U68A 2C9WB 4F8CB 4GNXC 3K7AB 1MGSA 1TVXA 4CGYB 2HD3A 2M17A 1EYCA 4C1NI 3A8IE 4M1UB 5CV8A 1SJED 1ZKOA 1CSQA 3SK8A 1FNUA 3L9AX 2RPVA 4K3BA 5KEEA 1CM9A 1PH1A 4YY3L 3DM3A 1PZID 4GZYC 4CYEA 1J0GA 1AZQA 4RCNA 3AFPA 3J81L 2KD0A 4DV1Q 3V6EB 4C80A 3I70A 2Z6KC 3K58A 2LXCA 4BBNF 3PUVA 3D3RA 5NUCA 3M3YH 2OJWA 1J8CA 2RMMA 5LXHA 4JI4L 1WMHB 3SFEB 1KH0A 2C7MB 1DONA 3FKYA 2E2IB 1E1OA 1OXTA 3P7JA 1R4NI 4H0LC 4A3IB 1WTVA 1E8WA 1NMFA 1STYA 3W1BA 2IDYA 3H6MA 2HJ8A 4IPHA 5HY6A 2BF8B 1XWEA 1ONLA 1KHIA 4TKOB 2JA7G 4OZAA 4KTAA 3S15B 4JYAQ 2XBBC 2HCIA 2K14A 4DUZL 1KDCA 3AB9A 4DK5A 4ARCA 1PFDA 5G55A 2PKOA 2YU9B 2PE6B 4KSLC 4S3SA 1ZEQX 3PQIA 3GTQB 4NB3A 1NBFC 4G7OC 2HE7A 3K6OA 4OXPA 2EMTA 2RQXA 2DZKA 4R4IA 2WLBA 2WAQE 4RWSC 2IW3A 5GAGC 3DHHC 3H1UA 3NEMA 1VQCA 2BTEA 2LWPA 3VH3B 5A2QL 5C1ZA 1CKNA 5I6YA 3S1NH 3TP7A 2KOXA 2VZKD 4K81A 2LGIA 3P63A 3TJPA 3ZJVA 3OOCA 1HUNA 3MHSD 4LF5L 3KBGA 4A75A 1XTCD 3N3KB 1Q90A 5BR8Q 2FXQA 1WCMH 2PI2E 5FLXc 2UYZB 3P1HA 2DNFA 4HDQA 1CQFA 4RHSA 5E6OA 4LF8L 3RD2A 4HJ5A 4LF4L 1TS4A 4DR3L 1CHQD 1KABA 5C44H 2J4XA 3WAOA 3HOYG 2C60A 1AARA 1KIXA 5IIFA 3Q23A 1S72A 1C8CA 1GXDC 3N1ZC 4TRDA 2KN4A 2Z6KA 4C3HH 3B2FA 1MFWA 1LUZA 3GP7A 5M5XH 2N9KA 3M4YA 2KMCA 4YHHL 3GTGB 1P98A 1IBML 1A15A 1KAAA 2R2OA 1D5MC 2M2LA 5C2TB 5KYLA 3G4SA 3K5NA 3P4SB 1YIWA 1STHA 3ZYYX 1ESRA 3Q24A 4GN1A 1E6EB 4K6DA 4C3JH 4C3IG 1JJ2A 3QA8A 4OL7A 2OTLA 1TU2B 3QOJA 2GN5A 5EPKA 2NBFA 2LGXA 1I4QA 3V2TA 3T1HL 2JXTA 1A8VA 4POGA 2KXJA 2BOSA 4AQ7A 3PZ7A 4ICUA 5EE3A 4ZAIA 2IO0B 1YQ4B 4AOFA 3KDFB 4PK1A 2UUBQ 5BYSA 1YNNC 3H0GB 4B3TL 1E7VA 1NSNS 1GVPA 5KHOA 3PLVA 5HFYA 1PXUA 3CPWA 1I42A 2DWQA 1GHJA 1GJXA 1D4BA 2N8NA 1VQHA 2CU1A 1WR1A 3O13A 4A93G 4JI1L 3B0AA 2A5UA 3Q3OC 1TWGH 2F0VA 3EECA 2QA4A 1CZWA 4F87A 2FUG1 3LDZE 4G50A 4C3HG 1U4PA 3VR5A 3A9JB 3A9KB 3H8HA 4W9HA 2ZTEA 2WACA 2RR9A 3PMFA 4M8AA 4LJZC 4A3EH 2D2QA 4W9EA 2RDFA 4BY1G 3V96A 2NVXH 4XZ4A 2R92G 4BBSG 3S2HH 2KFKA 4BOSC 1WX8A 4ASWC 1ILPA 3NE5B 5GADC 3PHXB 2YLMA 3HP3A 4RKBA 1TGZB 1FIQA 4J1MA 1HRJA 2ZM6Q 1HJPA 3PHWB 1SYCA 1YIJA 4KIKB 2HCCA 3RZOB 3DUZA 2E5LL 2VUMG 3ZNGC 3MA2B 4RF1A 4DF7A 3I55A 1JC7A 2KACA 1JJGA 2AUJD 3PF4A 4V0BA 1WFQA 1QVFA 2W9NA 4JI7Q 4X57B 1QB5D 4XDCA 5AEKB 2BVCA 1LABA 1U4RA 4YSZB 5D3IB 1YOVB 3V62A 1XLQA 5BN4A 2IY0B 3GTMH 2WIIB 1V8CA 2A1AA 2Z0EB 2ZJDA 1KDBA 3APFA 3PUYA 1EQTA 1N6ZA 5AJ3L 2Z0SA 2L3ZA 1R9TB 3RNAC 3U52E 3VYRA 2A73B 2D3CA 4DDID 2WAQB 4KD4A 5EAYA 2Y5PA 4MM3A 3AEAB 2KWDA 1EWHA 2ICEC 1GD7A 1B4OA 1PTOF 1YQ3B 4L1BA 2WXJA 3U8ZA 2E74C 1SYFA 3PSIA 2LHEA 2PE9A 2RBMA 2WXFA 2BH8A 4PQXA 1CA5A 4GKJQ 1F9SA 2FCMA 3AQQA 1E8YA 2WXNA 4KMUC 4DAMA 5HKHA 3H6NA 4HJ8A 2BS3B 3F2UA 1ZPSA 3S16H 1JOKA 3W5UB 4LF6Q 1XX8A 1H95A 1C4AA 2ACZB 2R2QA 4Q5VA 1HNWL 3N6RA 4OW0A 2JSVX 5ISRA 3DHIC 4IPDA 1PFNA 2SDFA 3WOEA 3ERQA 2KK8A 2F0UA 3QB3A 2Y0SB 3RN9C 1QOBA 2D62A 2D5DA 2PQAA 1AP0A 2GA4B 2PW9A 4JI8L 4EKUA 2WXKA 2YEPF 1TZ1A 5GAEC 1T5XD 2H89B 1TWFH 2JWZA 3M63B 4J8QA 3A0JA 3ONSA 4M8MA 4G0NB 2E2DC 1PH4A 4L8JA 3L7ZC 1EY6A 4X65L 4DK0A 3ZNHB 3HOVH 5LNK1 1CTMA 2JYEA 1O78A 4X3SA 2D2CC 2NPTA 3QC8B 4AQYQ 2RA4A 1WSPA 3VA5A 1RJTA 3OTOQ 4EZLA 4HRSA 5IGEA 3G6JB 2INCC 2NZHA 3A5UA 4B3ML 2K05A 3KW5B 4JI6Q 1PV4A 3HOWB 3R66C 1V5OA 2LRWA 3PT2B 2LVQA 2QCZA 3JC66 1OXUA 4W9CA 4AS1A 2D11A 1TWAB 1L6VA 1WZ0A 1GUTA 4HJGE 4HCNB 4KV2A 4NPNA 4FF1A 2WNMA 2KHJA 1WFYA 1KQSA 1X54A 1T0SC 1LLRD 3DVGY 2DN8A 1U4LA 4DNIA 4CDEC 4O42A 2N55A 3EROA 5DCNA 3MXPA 1F2LA 1TWAH 2EYJA 3SVMA 2ZCCA 4N58A 3FPPA 1WXMA 1ENAA 3KJOA 4E3CA 2B39A 4J6HA 4IQZA 4NXNL 3C3LA 4IKGA 1MI2A 3QWNA 4HJKA 2KHWB 1EY8A 5C23A 2A68D 1H9KA 3DBRI 2XRSD 5CORA 3VRBB 4IW0A 4LUOA 4ZLTF 1KM7A 4AP4C 3OTOL 2MUYA 1R4PB 3HFZB 1LT5D 1VQ5A 1QZEA 3B08A 4W9GA 2Y3AA 3TREA 4I6LB 2ALYB 3W2DA 4DAYB 1WZ3A 1N63A 1Y14B 3VYTA 2DZJA 3HOYH 3E0JA 5BR8L 1J19A 4NZLB 3Q2AC 2NVYH 2KENA 1XJVA 1CUKA 3DWGC 1E7PB 3BYTB 2G3QB 5JJKA 2EDGA 1YBYA 1EYGA 4N6EB 1GM5A 4OVVA 2VQEL 4FJVB 4GLSC 1TTNA 2RDBC 3RZWC 1FYCA 1VQPA 5M9OA 3V3XA 2Z9HA 1SIFA 2L52A 2BA1A 1JRPA 2CHBD 1A3TA 1YN5A 1FEHA 4FDBA 4ZYNA 4PYZA 2RHSB 3S16B 3LJ3A 1NE3A 4ULLA 1CMXB 2KBNA 3ZGZA 1PYSB 4B9WA 1V8QA 1WIAA 3C8YA 1KL9A 2B2YA 4OO1I 3TEHB 1V43A 1YNJC 1V9JA 3P4RB 4FJYA 5DPRA 4ZRIA 3NQTA 2K1FA 2Q2HA 4LW1A 1EFWA 4KD3A 4RAUC 2WKCA 3BDLA 4CKEA 4E6IA 3J7AV 2JA7B 5C0XG 1V49A 3TBLD 1WI0A 1JE4A 3E9SA 1RDPD 1QWYA 2G9DA 3I7FA 4MN3A 1DOYA 3TS0A 2BE5D 3CMAA 5J3BA 2ZTDA 3FILB 3VHTC 3I4NB 1F52A 1MPEA 2K8BA 4YTNB 4HPMB 2GB1A 2C5CA 4GLAC 4LCDE 4DV6Q 2M0AA 2EMSA 2JVCA 2EJFC 2F3IA 5ELOA 4WWOA 4ZK9B 1TT5B 1FNWA 1PGXA 1F2RI 3U9SA 1O7ZA 1E5WA 2D9UA 4LMQD 3H3VI 2E3TA 2VL6A 4B9XA 1TS5A 3TDQA 3CCUA 3OMGA 4FJZA 3OW2A 2WB1E 1OXXK 4KHVA 3B9JA 4XX5A 2CHZA 1HNXL 2EIFA 4IUPA 5EKKA 3KF6B 1B9MA 3ZNZB 2DENB 5IKCM 1Y69U 1A2TA 4ZCKA 5LMNW 4KKIA 4LUZA 4CHTB 2QILA 1IBLL 4J6IA 1C4PA 4ZQ3A 1FL0A 1FVIA 4IN3A 3OHXC 4M02A 4IDIA 1C9FA 1TWHB 4W9FA 3RULA 4YTMB 1F1HA 3WCQA 1ZXHA 4IG7B 3EA6A 1WTPA 3CCMA 4JI0Q 3CU7A 4DV7Q 5DPSA 1IYFA 5D65A 1Q8KA 1UE7A 2KECA 4W9JA 5BO4B 4DAPA 2PVOD 2WXLA 4GOPB 4LF7Q 1D7QA 3OIPA 1LT3D 3BK1A 4FHJA 4LFAQ 1KRSA 4DHJD 4A3KH 1VQKA 3BK2A 3TSSA 4ZUIA 3QG1A 1S5BD 2WP8J 3ZXRA 1ICFB 4LNIA 2V0GA 2KDEB 4BXXG 1L1OA 4RCOA 2BQQA 3NZUA 1MHHE 4A3JB 1XNQQ 4WH4A 3DLLA 3FPUB 2LMCA 1PRTC 4B3TQ 4X66L 3DPDA 4OVZA 1B1ZA 1FJGQ 1QG7A 4I6PA 4KDLB 4IUQA 2K04A 2D0PA 5JPNC 1EY4A 3NBHA 5EGTA 2CH4W 4ZRKA 2A74C 4WORA 1HA5A 1AFPA 1VDVA 2Q2IA 4GIVA 4JQWC 4W9KA 5AUIA 2MP2A 1D6EC 3V60A 2MH7A 1I35A 1WGDA 4C3JB 2ZW0A 1ZOYB 3QQ8B 2A6HD 3DCGA 1XNRL 1R4NB 1C78A 1X55A 1YN3A 2NVYB 3M4OH 2QDBA 5IP9H 3HOYB 5E6PA 5I6WA 3A8JE 4NDXA 3R2IA 3BU2A 4DV3L 4AYBG 2UXBQ 2LEKA 4YHHQ 1CT1D 3ULLA 2QEXA 3SFDB 3X3MA 1YHBA 5M5XB 4MJSB 1KRHA 2LGSA 4C7ZA 2MRPA 1LTTD 2LUEA 3RNCC 3ZJYC 1BCPB 1YJNA 3NENA 4MTNA 1BQQT 1EIFA 1WWTA 1MVKA 1YMHE 1UBQA 1J9OA 4ICVA 4JL9A 3WWVA 3IVFA 4C7YA 2R93H 2R7ZB 1J5EQ 2GBRA 3OW7A 4YWKA 1E24A 2HDLA 2JQRB 2KDIA 5JHBA 2GBKA 4WAFA 2GI9A 2DJGC 4FO2A 4PV1C 1WCMB 2D0OA 4KY5A 4UHVA 4A4IA 2VUMB 3KUCB 3SXHA 3R3MA 1FGBD 4P16A 1NVID 1KJTA 2XIWA 3NUCA 3AEEB 4G11A 1I4RA 4L5RC 4OZCA 4YSYB 4A3OA 3S1NB 2I5LX 2K5HA 2A68C 2IY1B 3P4PB 3K7UC 1UEAB 3IKJA 2N1WA 2K03A 1B3QA 3AE4B 4L5SA 4BVUC 1QUQA 2Q2TA 1XTDA 1LM8B 1P16A 2WXIA 3GTQH 2B2VC 4WJ3M 4KK7A 1P0RA 4N59A 2YU9H 2B3GA 2A6ED 2K5QA 1HNWQ 1G2TA 3GZNI 3HOVB 3CIRB 3PSEB 3HKSA 2MPMA 4LF5Q 2ZNVC 3J9CA 2A8VA 4GKJL 2KWVB 4DV2Q 1E0ZA 2KC2A 3UQBA 3GV6A 1N62A 1YVCA 1GC6A 2JRHA 2KQSA 4PS3A 2SNSA 4XDDA 3EBEA 1N9WA 2E2IH 4XT1B 4DV0Q 4RH6A 2RDHA 4YCVA 3H91A 2J0TD 2MP2B 4PNYA 3AN1A 2QDFA 4A3JG 3PUZA 4DBGA 4DWFA 4ACFA 3LYYA 1PZJD 3DEOA 1P3QU 1II3A 5JEAH 2KOLA 4A3IG 2L8JA 1WM3A 1WTWA 4WJPA 2E8GA 2HQLA 1DOKA 2XTIA 3H09A 3J81i 4II2B 1T3QA 1XT9B 2IGDA 3BZCA 1CJEA 3SD5A 2AWOA 2EVBA 2J53A 2HHHQ 1UD7A 2KDMA 2BA0A 5T1IA 1X56A 5D2MB 1Q86C 1NY4A 4P6VF 4L23A 1QCBD 5D14A 1Q3LA 2OT2A 2ZM6L 5IWAL 1PH7A 2AYOB 3ZDMC 1R9TH 2JA8G 4K3CA 2N9LA 5FO8B 3K59A 1V1PA 2CKZB 4DV2L 1LTID 2Q8IB 4DV1L 1C79A 2QC8A 5EBCA 2BWES 3GTLB 3DHGC 5L95C 5GMVA 1HH2P 2VUMH 1IKLA 4DV5L 1F2YA 1EYAA 1RKNA 1BCPC 1RFAA 4WJOA 3UDFA 3DBHI 2EYLA 3W1GA 3PLUA 2L0CA 1RYJA 4LNOA 2R7ZH 2R93B 2LSSA 2EE1A 3N30A 1NI3A 3RNUA 4N8FA 2GLSA 4RM9A 4K5WA 4YT0B 3K8AA 1VLBA 4QUCA 1WX9A 2EYOA 5JVG3 1N5XA 2IGHA 5BMGA 4WIPA 3M4QA 2D3GA 1W6JA 4N9TA 2NTTA 3SHQA 1IBXB 1MHXA 3TMEA 3PV0A 1K3BC 3PZDA 1TS2A 4ME5A 2NVXB 1C76A 1XCTL 4G7ZC 2VH1A 2ZJQA 2MHJA 2ZW1A 3VTWA 1Y8RC 4MGIE 4QF4A 1WF9A 4GGQA 1BVSA 1T5EA 5KRUA 5KNDA 1Q7YC 4A3MB 5C4HA 1MBYA 3JVZX 1D8LA 5CR3A 4IM3A 2EYMA 1GO3E 3H7PB 1RTNA 5GXGB 1QVGA 3I73A 1JORA 3CC7A 1ML0D 2HT1A 2XWJB 4QL5A 4P2CB 1I94Q 3MTNB 1VD2A 2NZOA 5E3FA 4A3JH 3FAHA 4P1CC 3JAMc 1EQVA 3D31A 4POFA 1QQRA 2B2VA 1HZBA 4A3KB 3BDOA 1VQ6A 1KF6B 1Q10A 1S3SG 1EF5A 1K73C 2CHXA 4I7ZC 2FNJB 4N9F4 1BKBA 2D3AA 4EQPA 5I4DA 3MEHA 2EKEC 4CO7A 4E71A 2PZWA 2Z1CA 3EGRA 2M1MA 4N9PA 4AYBE 1PDXA 2N0SB 3MC8A 2EELA 3HRZC 4AIMA 2J52A 1V2YA 4A3MH 2UXCQ 4LF4Q 3AEDB 4X3UA 2MO0A 2E75C 1MG8A 1TWHH 1Z6HA 1ZKHA 2F0HA 1SE4A 4IM0A 2MSED 4XWTA 1ILQA 4X64L 2WDQB 1BBWA 2BDNA 3WOFA 3DWQA 2RHQB 1XPRA 5JJZA 2M8SA 2RCFA 3GV3A 4JW0A 4BKSD 4C3HB 4NY0A 1FGUA 1XMOL 2QGQA 4A3PA 2I5MX 4QB4A 2L55A 4F8MA 3WANA 4C2MH 2F52A 5AZGA 1HNZQ 2KFKB 5C44B 4OZBA 1QILA 3C19A 2K4KA 1TJEA 4MZ9A 1SJHD 1PHJA 4HPLB 2QMTA 2FJ2A 1ET6A 1F77A 3AMUA 4EX5A 2MJ3A 3U30A 3SDZA 1Q46A 4DUZQ 1Q81C 1K0SA 2V3NA 1YNTE 2AUKA 3HOUG 2K9XA 5CV5A 3QK0A 3FILA 1UWMA 1B7YB 1WGRA 3I9V1 3PIOA 1KTKA 2INDC 1PFSA 1EY5A 3I4NH 3P2BA 4GDKB 4FXDA 5IO9A 3PTFC 3L54A 3VR4A 2LVOA 3DBLI 2HUGA 2KJXA 3M7GA 4QY7A 4JOIC 3MFGA 2A69C 3DBLB 4IWQA 4BY7G 3F1ZA 4BBRH 4LTUA 1R7SA 1VQFA 1XLPA 1BOSA 2JA7H 1ROEA 3DVNV 2ONQA 3TCAA 2PW5A 5IYBG 4TQUS 4L2YA 3BVGA 2JEAI 1R4MB 1Z7TA 2BW2A 2J7QB 4P75A 2EYHA 2EKIA 1U4MA 4IM2A 3S15H 1FR3A 1S4ZA 5L83A 4GLXA 2CKHB 3V6CB 3OPOA 1QVCA 5KNBA 4JPBW 5CV9A 3RR5A 2DLBA 3LX0A 1PH3A 5J18A 2CH4A 5C0XH 3TEWA 3AECB 4G57A 2DYBA 2ON8A 4JE3B 1J7BA 2YTYA 2IT1A 1N33L 1BDOA 4ZUJA 3SK5A 1NNXA 2PNHA 1PGAA 2FIDA 2JZZA 2PJHA 4G3XB 1WGHA 2VRRB 3W1SA 1B9NA 4DXAB 2MA9B 3K5OA 2CFMA 1N36Q 1ZXIA 1H9JA 2XWBB 3C46A 4II3B 1ISNA 4DK1A 1RRBA 1BBXC 2JN4A 2LUMA 5D7GA 1LYLA 4NPSA 5IGGA 2N7JA 4X3TA 2B29A 2IJ0A 1VMCA 2CW0C 2ES2A 1BXTA 3D4DA 3N32A 2VQEQ 4KVGB 3P20A 5E4XA 2NZ1D 1VQOA 3T13A 3T4AC 2B2WC 2L11A 3VR6A 1DXMA 3KUPA 1WJ4A 2PZTA 2BT6A 3TIXA 2BS2B 1B53A 3PCOB 3AE1B 5JXVA 1ZP0B 1DCZA 2RDGA 1DOIA 1IL2A 1XD3B 5EPJA 1UELA 2O2VB 3GTKB 2Q5WD 1U5KA 1SIJA 3KYCD 1PUTA 2DGYA 2IGGA 2CJOA 2L1BA 3PRZA 2VXWA 5FLXL 3LB8C 1SE2A 1F9PA 2BB5A 4BZAA 4LDTD 2BKFA 2QKIC 2R7DA 1PFMA 1C4CA 4GN3B 4LJPB 4C00A 2D3BA 3Q3MC 5C6AA 2B2UC 4JWUC 5BMHA 1S40A 4DR2L 1IYVA 4K5XA 2JA9A 1EZ8A 3VTVA 2FIFA 1FXTB 1UE5A 3CMMB 2MJDA 2XEWA 1DGSA 3DVNU 2LVPA 3CXCA 4GNXA 3M4OB 3W9CB 2L00B 3UF8A 1AWDA 3CCQA 1XNQL 4KX6B 3HRDD 2RSNA 2I38A 5IT9L 5C3EG 4UDUC 5EE9A 4FNFA 3N52A 2K5NA 2MHVA 2NTSA 1CZGA 4HIKA 1MSHA 4DR1L 2YVCA 1B9RA 2WDRB 2O5IC 3CAMA 4I65A 2OEDA
chains in the Genus database with same CATH topology
2AX5A 2BYTA 3DWAA 4K8JA 3IT6B 1EY7A 4WRDA 1HFNA 2FBWB 1J7AA 2INPE 1L0VB 3M85A 1SXTA 2QCPX 3CRLC 1EWCA 2IL8A 2JEBI 1E2VA 5JAVA 2K28A 3AEGB 4FF3A 1AW7A 3W3AA 3AH7A 3KBXA 3HOXB 2IWHA 3HVDA 3J7YW 1VJKA 5JEAJ 1F0ZA 4HMJA 1SDFA 4NW2A 5CMDA 4IFDJ 3DWPA 3L3OC 3C1FA 1FFVA 1NR4A 4K6LA 1L4DB 2XRQD 4L63B 2BS4B 3AE9B 5LL6S 2K1BA 3X3NA 5C5LA 1I6HB 3NK9A 5I2XA 3LNNA 4EVOA 2JU6X 4QIWB 3PUWA 4PMCA 4H13C 2F0NA 4OO1G 1RFKA 1G8ZD 2L12A 2X6GA 2ZXPA 4RKLA 1RHPA 1OQQA 2XSCA 4XQQA 1TWGB 1QF6A 3AEBB 2K33A 2PZUA 2NWGA 3IAYA 2L9HA 1XEEA 1SYBA 3P4QB 3NPPA 2A6HC 3FKIB 4U673 4LK1C 4C56C 3UI2A 3PIO3 1PGBA 2ICIA 1I3QB 3SK6A 4HKZE 2E76C 4XWWA 3I57A 1EY0A 2B2TA 4A55A 4D2KA 1NEKB 4R9WA 1YJIA 3LWUA 1A6XA 2EJGC 1UGJA 4KJNA 1PRTF 2F0TA 3JAML 1XLNA 1EZ6A 2WB1B 1LTBD 2LHDA 1YJJA 2L32A 1AN8A 1JOOA 1OXVA 2BB6A 4F7XA 3QOLA 1RODA 4IUUA 2F3VA 4HTHA 4HR7B 2F0OA 5K36G 1P7FA 4KGTA 1L0XB 3BS1A 2I07B 1JW9D 4ODGA 4LLGM 1EU4A 2R61A 1TKEA 2OF1A 1KNEA 4XT3B 1A2UA 1FXIA 1NENB 2AQ1B 2K3UA 3T3NA 3AE3B 1E9MA 1X3PA 2QF7A 4RGTA 3SHLA 5IT9E 4CKCA 1EM7A 3NVYA 4ZRQA 3Q22A 1TKYA 3NTIA 3RUZA 3IT4B 1TWFB 1C77A 2CJNA 1RM6C 3AE6B 4B0EA 3HS0C 3W5VB 3FEWX 1WTOA 1L0YB 5ELEA 3VYUA 1EEFD 1O80A 4OGQC 5IGFA 2BDOA 3NS1A 3SR6A 2JSOA 4XXEA 5IOCA 3ONAB 1K52A 5KYIA 5IGBA 1B50A 5DEHA 4AYBB 4HKQA 1S5DD 4DAYA 1K50A 4K2LA 2K5WA 2PO4A 5CBAE 2D5GA 5ELDA 1HXYD 4FXKC 4IALA 4CBVA 1WGKA 1HA6A 2CQAA 5G5HA 4XE0A 1UWXA 1DM0B 2JYOA 3GTMB 2F3WA 3NXWA 2PMZB 1RCVD 4K2KA 1HCZA 3R93A 2JX5A 3HGBA 3VA7A 1N5WA 1PLFA 5KGUA 1NAPA 2F0DA 3KWLA 3MTSA 2JYTA 1TZOA 2K6AA 1KLGD 4FF2A 2BE5C 4QUFA 4KN4C 5H8YE 2PIAA 2QEJC 4CQNA 2W54A 5FK9C 1CHPD 1J8IA 4OHJA 3S2HB 1N60A 2EZVA 1KLUD 2F1MA 3KF8A 3OSOA 4A3EB 3IL8A 1JICA 4WQMA 3CHBD 1PDQA 1HQMC 2V4IB 1VMPA 4Z9CB 4JWSC 5IGCA 3RPFC 2O4XA 4KY6A 5KIXA 1FFUA 3NQIA 5A2QE 5AUKA 1STNA 1SBBB 2FFKB 3K0YA 5C3EB 4BA2I 2DNCA 3EVQA 4FVMA 2R6GA 3AM9A 1TS3A 2MGSA 1TR5A 1XYIA 1CI3M 3I91A 4IURA 3RMHA 1YN4A 3E5SA 1E2ZA 1VCIA 1FD7D 1GOZA 2H4OA 2JZPA 5J39A 1JWMD 3BIID 1VZ6A 2WXOA 1PYWD 2ID0A 5BMIA 5CGKA 3Q8EA 2F0LA 4JX1C 3MAQA 5M5YB 4XQNA 3C1EA 2HDMA 1GUWA 3J81E 1S5CD 2X69A 1PRTB 3PO0A 3OMCA 4MHEA 1SNQA 3CQZB 1HZ6A 1XF5L 4X3KA 1JQYD 1WD0A 1SSNA 1OXSC 5JPMC 2FMCA 2ZXOA 1C4QA 1D1IA 2HTME 2C9OA 2I46A 1EY9A 4C1NK 3GD7A 1PTOC 2PPBC 3H94A 1U9RA 1I4XA 1VDZA 1R4QB 2KAJA 1EYDA 5TSSA 2G1EA 2F0EA 3AB5A 4RHRA 1SF0A 1O7YA 3IFDA 1JQ4A 3LWEA 2JA5B 1K51A 1DJRD 4Q2JA 4IUTA 3S17B 1VZ7A 4QCLA 2BCOA 2PVGC 2CU3A 2QIEB 2Y5CA 1QLBB 3M3YB 3E6ZX 3DHQA 5C3XA 4TQ0A 4ILWA 1DZ1A 3QJYA 1NYRA 3Q8FA 3ND8A 1K53A 4G7HC 1SE3A 4NMZA 2EY1A 2PW7A 4ZOHC 1XXGA 1HTPA 3MJ5A 3OWFA 3EFXD 5LHY1 1WD1A 2F0IA 1L6UA 4HMIA 4R8IA 3DEPA 4KKJA 4CJ1B 2F0QA 5IODA 1PMRA 1JROA 2WS3B 2KEDA 1G91A 1Y1WB 1FRDA 1LT6D 2FMMA 1HQRD 1FM0D 1ESFA 1DOXA 2WV6D 4CKBA 1WYGA 2LJIA 4YSXB 4K14A 3S9WA 3MC0B 3VQIA 3TN2A 4OIKA 3N9YC 3T16A 4NJCA 2Z4HA 1UAPA 2F0SA 3A7LA 2LFNA 1H9SA 3IFTA 2JA6B 2X6LA 4C3IB 4RF0A 3VR2A 2SNMA 3I3CA 3D6WA 1FO4A 4EGVA 4JBWA 3TEXA 1D2BA 3FMCA 5MPOA 2F0FA 4L6TB 2NN6G 1KNAA 1T6BX 1ZE3D 4US9A 3KWVA 2W3SA 3NP8A 3KLSA 4ZRZA 5DNFA 3PO3B 4DU9A 4KN7C 4KV6A 2B63B 1V97A 5J22A 4XDXA 2VB2X 4HCSA 4JPSA 2H88B 5FR3A 1X32A 4DXGA 4MACA 2SEBD 5KNCA 2WQYB 4YTPB 2MJ8A 4HEA1 4A90A 1JWBD 4HROA 2N88A 3S1MB 2XNAC 3Q8CA 1FXAA 1EL0A 4KY7A 1G2SA 5EJWA 2CW0D 3PO2B 1NCVA 1YNJD 3MXGA 1JWSD 3HEJA 1AZPA 4CJ2C 3T56B 2DYOA 2ENBA 1W6KA 5T1GA 2KEEA 4DN4M 1Y8PB 2EYFA 1I4GA 4B08A 1RD9D 2IPKD 4REZA 1K8MA 2M9VA 4IFDH 3CWIA 1Y8NB 5FKAC 5EQ0A 1LTAD 5E6JA 2PCFB 2N7JA 1UUPA 2J42A 1GB4A 1B3AA 3U9OA 3AE7B 3VR9B 3GTPB 2R92B 2W3RA 3S1QB 4WURA 1DD2A 4IZ8A 4XQJA 1EIHA 2WXRA 4XYOA 3K57A 4A8XC 1FNVA 3OIQA 2BBCA 4ABNA 2M19A 3BG3A 2MJEA 3RZDB 2A5HA 1PFBA 1LTRD 1GPXA 5EE1A 2LFIA 1DOLA 1IYUA 4KKUA 1GUGA 5G3LF 1E10A 3L4PA 3TEZA 1F2ZA 1VR9A 1JB3A 3VRAB 2K01A 1SNOA 4DNTB 1G6ZA 1SSOA 1BF4A 4IUVA 2WXQA 1KFYB 5BN3A 1WVLA 5C3JB 1M8AA 2OXPA 2WXMA 3ZJTA 5HI1A 4HCEA 2KQ4X 2JXMB 5CC4A 5CYUA 2H1EA 3GS2A 4YWGG 2W82A 4Q0FA 1BMLC 2L83A 1TY0A 1QNUA 3ITPA 4K8IA 1KDAA 1M4VA 3ZJUA 2B8FA 5K5PA 4WFN3 3GTJB 3NHHA 3NTKA 1H9MA 2OHFA 2E2HB 3EQLC 3S2DB 1DGJA 1LTSD 3D4WA 5EKIA 1PTOH 1WTRA 3HVZA 3NVVA 2PLPA 1BO0A 5M5WB 2PTLA 5HGTA 4HSVA 3MP9A 4UAIA 1GUNA 4A3FB 2YEPB 1O7LA 3LXFA 5BYQA 1LACA 3Q69A 1J7CA 4ZKBB 2WXGA 5AFWA 3HKZB 4PMWA 4KKSA 3KLSX 4XTCS 1TT2A 1IW7C 1JCKB 2LKVA 4M0WA 5E4WC 3EUB2 1I7HA 1ICWA 3A55A 4KJOA 3KLRA 5HG2A 2YYZA 1V1PB 1Q8IA 2JA8B 1F2MA 5I9PA 4RGOS 4FF4A 2FHTA 2MEKA 2KHSA 2NB0A 4HEDA 2A6EC 3J80E 3UI3A 2MP1A 1EOTA 2F03A 3Q6SA 2F0KA 1SNDA 4ZKCB 1QOAA 4V190 3BVMA 1B2TA 2Z8LA 4XYQA 1SMYC 4G4KA 2ZXRA 1ET9A 5JVH3 3QO2A 3NZ3A 4R3DA 1C48A 1MD2D 3K5MA 1Z47A 5T8IA 3TEYA 2KA7A 3ETRA 3R8BA 1SYDA 1F2RC 1IGCA 5C4XB 2LMCB 1RTOA 5M3MB 5ELFA 3HZXA 4DNRB 1S5ED 5FLXE 2R3ZA 3Q8BA 3T3OA 3BDCA 1ZDVA 4A3GB 4YIJA 2K0PA 4O1NA 1Q1BA 1SMYD 1WXQA 1DYQA 3NBIA 3NVWA 5IGDA 3V05A 1F9RA 1TYGB 2NVQB 1HFGA 1D1KA 1LO5D 2EY2A 2QSDA 2EYPA 1Q12A 2V3PA 1NUCA 3M7NA 3FC4A 1LT4D 5C5MA 1VF7A 1BR9A 3H3VC 2X38A 3HUIA 2K7VA 3I4MB 3B2GA 1HEZE 3MXNA 3PUXA 2DBYA 4LK0M 3HOUB 1BCPF 3PZ8A 1QJOA 2RSOA 1A3VA 5ELCA 2SAKA 1K83B 2GRIA 3TBIB 2NYZD 4OO1H 3TP8A 3J7AF 5DAUA 2K32A 2W55A 3MHBA 3WDNA 5FOBB 4KI0A 2WXHA 1TWCB 1HPCA 2B2UA 5JEAG 1BCPD 2EPBA 3BYYB 3MVVA 4DGZA 5I9OA 1N61A 1S5FD 1CA6A 1QT9A 2PNRC 1ZDXA 4IFDG 3PIP3 3CRKC 1ZYRC 2EOTA 4DXFA 1D5ZC 4IOIE 3CKIB 2WXPA 2EY6A 1QOGA 5BYRA 1TY2A 3A54A 4ZHPA 4ITKA 1IGDA 4ZYSA 2J7ZA 4R8NA 4LAAA 2QJLA 4ARIA 4NAWB 1X3QA 3C2PA 2KMMA 3TP5A 3NRZA 4H2AA 1FRRA 3Q0AA 4GDLB 2RVLA 3MXUA 3P1MA 2DY7A 1TIID 1F9QA 4DFAA 5HHDG 1JR0D 1JWUD 3FDTA 4H44C 2PYKA 2VNUD 1QOHA 2WU5B 2F0MA 2AQ2B 3A7AB 2EXZA 3I8ZA 1EWYC 2PQEA 2NMQA 2DY8A 3AU7A 2E2JB 2O2LD 3D6CA 4MIUA 2IX1A 4NKLA 4A3BB 3NVZA 1P7EA 1GUSA 1SNMA 2AWNA 2KQ3A 3MZ5A 1Y56A 4DAVA 2CVRA 4ZHOA 1QNKA 4WJWA 3MFYA 4RGMA 3DM1A 3DWMA 1H9RA 5I2YA 1AYFA 1QKZA 5EBDA 1XCQL 5HURA 3DMUA 3P42A 1MSGA 3AE5B 3RFZB 4MM3B 2LY7A 2B76B 1QE6A 4ZRPA 2WU2B 5JOBA 3S1RB 4EE2A 1IHZA 3SK4A 2K5PA 1EU3A 4TQ1A 4DQOC 2NVTB 3T51B 3FRPB 2HDEA 4B0MA 4KHZA 4BY1B 1LTGD 5EKLA 2M00A 4OIJA 1CQVA 2Q8RE 4FXCA 3NSWA 4RNAA 3I4LA 1LV9A 5H92C 1WTQA 4HSPA 3QIAA 2A69D 2LS01 2WINB 3AEFB 1RWSA 3HOZB 2PMVA 2AQ3B 1GUOA 3SE0A 3K5LA 4K5VA 1ACCA 4IUNA 3IAS1 4TMAB 4USAA 1A70A 1ENCA 1WRIA 5C4JB 1TKGA 1SB3C 1UNSA 2TSSA 3ND9A 1GB1A 4H7BA 4WWMA 1MI0A 4FXGC 2K5DA 1L5PA 3IXSA 2B2TC 2Q8TA 3E56A 3BZDB 1CFMA 5C0XJ 2K22A 3GTOB 5A35A 1FCCC 1AEXA 4C3JG 2KUMA 1ZYRD 4NAMA 2V4DA 3BVZA 2DNEA 4QMGA 3KQ4A 1FD6A 2I2YA 1XO3A 1G291 4YXDB 5EE0A 1IBXA 3AE2B 5M3FB 2IX3A 2KCNA 1PTOB 3D4RA 3D8GA 1V1OA 2SOBA 1STAA 3VR8B 1IL8A 2L4NA 2EY5A 3NTHA 4A6QA 3GO5A 4BS9A 1QOFA 3DXJC 1RF2D 3FVQA 4EQOA 2FINB 4A3DB 3AV8A 3KK7A 3I90A 4HN7A 5CV4A 4EQNA 1IKMA 1STGA 3AMZA 4TSSA 2RKSA 3I72A 2DYMA 3RD4A 1GHKA 5CV7A 4KKTA 4PT5A 3T53B 1HUMA 5FO7B 3P75A 1JOQA 2VB3X 2JE6I 2F0JA 1FMAD 4HAEA 3TUOA 1TQOA 5G3LD 1BUIC 4KGSA 3NWSA 4US8A 5CBEE 1VRAB 2NN6H 1I4PA 2NUCA 1BUVT 4RFBA 2M56B 1IW7D 3JAME 1PZKD 1OQRA 2JWUA 3R2TA 4CJ0B 3URYA 1OO9B 4DA2A 5FO9B 4A93B 3IAM1 3TZDA 2XVSA 3ABVB 5LL6X 2F4IA 1SYEA 1L4ZB 3BWUD 4FP5D 3Q8AA 1SFOB 3VR3A 3NUHB 1HHVA 2L1AA 2E6XA 4BBRB 4F88A 3AE8B 1SYGA 1STEA 5ELBA 1SEBD 2B2WA 3G7LA 4MH8A 2EJMA 1EIGA 4BBSB 4IFDI 2G9HD 1DOMA 5D3DA 1D5XC 3MHZA 2KVMA 3VYSA 3GB1A 4A9AA 3U2SC 1IUEA 1NR2A 1ZXTA 1WTXA 1TKWB 3EJIA 2IX0A 4C2MB 1OFFA 1H9SB 1E2WA 2TMPA 1PTOD 5E1FA 2ZT9C 5G5GA 5C4ZA 4BWGB 1HZ5A 2F0GA 5J1ZA 1JALA 4JK1C 3ZQ4A 1HTLD 3A8KE 2L5TA 1I50B 3MWYW 2OEOA 5C0XI 2NN6I 2FE8A 3HG9A 3R3OA 1YNND 2JP1A 1JMLA 5C3WA 1B44D 5EPLA 1E0BA 2WP9B 1SNPA 3NWTA 1BNZA 1I6VC 1SAPA 2KCCA 3U4EG 2INNE 4ID6A 4NP5A 3GQBA 5K36H 2F0PA 1STBA 4PMBA 1SNCA 5DM63 3S14B 2VZKB 1Q1EA 3SEBA 2XN9C 4MT5A 3TZUA 4RGNA 1CZPA 3J80L 5DM73 1FCLA 1VZ8A 1Y8OB 2F0WA 4J3OD 1GAQB 4KGRA 4Y7NB 1ENFA 4XIGS 1JWAD 1A3UA 1PRTD 1XLOA 3A56A 1CK1A 3U7ZA 1VF5C 5BN5A 1NYQA 3SR1A 1K8OA 3TP6A 1EEID 3RLFA 3OWEB 5F2DA 5CV6A 1EFID 2WKDA 2O5JC 1I4HA 4BA1I 4BY7B 1Y1VB 4FYDA 2Z4IA 1ZUD2 2WDVB 4RA8A 2HQEA 5COYA 2B2YC 2B8GA 4U68A 3K7AB 1MGSA 1TVXA 4CGYB 4C1NI 1EYCA 3A8IE 4M1UB 5CV8A 1SJED 1ZKOA 3SK8A 1FNUA 3L9AX 2RPVA 5KEEA 1CM9A 1PZID 4GZYC 1AZQA 4RCNA 3J81L 4C80A 3I70A 3K58A 3PUVA 3D3RA 5NUCA 2RMMA 3SFEB 1KH0A 1DONA 2E2IB 1OXTA 3P7JA 4H0LC 4A3IB 1WTVA 1STYA 2IDYA 3H6MA 1XWEA 1ONLA 4TKOB 4OZAA 4KTAA 3S15B 2HCIA 1KDCA 3AB9A 4ARCA 1PFDA 2PKOA 2YU9B 4S3SA 1ZEQX 3GTQB 4G7OC 3K6OA 2RQXA 2WLBA 4RWSC 2IW3A 2BTEA 5A2QL 5I6YA 3TP7A 2VZKD 3ZJVA 2LGIA 3P63A 3OOCA 1HUNA 3KBGA 1XTCD 1Q90A 3P1HA 1CQFA 4RHSA 1TS4A 1CHQD 1KABA 2J4XA 5IIFA 3Q23A 1C8CA 1GXDC 4TRDA 2KN4A 3B2FA 3GP7A 2N9KA 3M4YA 3GTGB 1A15A 1KAAA 1D5MC 2M2LA 5C2TB 5KYLA 3K5NA 3P4SB 1STHA 3ZYYX 1ESRA 3Q24A 1E6EB 4K6DA 4C3IG 4OL7A 1TU2B 3QOJA 5EPKA 2NBFA 1I4QA 3V2TA 2JXTA 2BOSA 4AQ7A 3PZ7A 5EE3A 4ZAIA 1YQ4B 5BYSA 1YNNC 3H0GB 1NSNS 5HFYA 1PXUA 2DWQA 1GHJA 1GJXA 1D4BA 3O13A 2F0VA 1CZWA 4F87A 2FUG1 4C3HG 1U4PA 3VR5A 3H8HA 2WACA 3PMFA 4M8AA 4LJZC 2RDFA 3V96A 1ILPA 3NE5B 3HP3A 4RKBA 1FIQA 4J1MA 1HRJA 1SYCA 2HCCA 3RZOB 3DUZA 3MA2B 4RF1A 4DF7A 1JC7A 2KACA 2AUJD 4V0BA 4XDCA 1QB5D 1LABA 1U4RA 4YSZB 5D3IB 1XLQA 5BN4A 2WIIB 1V8CA 1KDBA 3PUYA 1EQTA 1R9TB 3U52E 3VYRA 2A73B 2WAQB 4KD4A 2Y5PA 3AEAB 2KWDA 1EWHA 2ICEC 1PTOF 1B4OA 4L1BA 1YQ3B 2WXJA 2E74C 1SYFA 2LHEA 2RBMA 2WXFA 4PQXA 1CA5A 1F9SA 2WXNA 4KMUC 2BS3B 3W5UB 3F2UA 1ZPSA 1JOKA 1XX8A 2ACZB 1C4AA 4OW0A 4Q5VA 3N6RA 2JSVX 5ISRA 1PFNA 2SDFA 3WOEA 3ERQA 2F0UA 3QB3A 2Y0SB 1QOBA 2D62A 2D5DA 1AP0A 2GA4B 2PW9A 2WXKA 2YEPF 1T5XD 2H89B 4J8QA 2E2DC 4L8JA 3L7ZC 1EY6A 4DK0A 5LNK1 1CTMA 2JYEA 1O78A 4X3SA 2D2CC 2RA4A 1WSPA 3VA5A 1RJTA 4HRSA 5IGEA 3G6JB 2K05A 3HOWB 1OXUA 4AS1A 4HJGE 1TWAB 1L6VA 1GUTA 4FF1A 2WNMA 1LLRD 2DN8A 1U4LA 4O42A 2N55A 3EROA 3MXPA 1F2LA 2EYJA 3SVMA 4N58A 3FPPA 1ENAA 2B39A 4J6HA 4IQZA 3C3LA 4IKGA 1MI2A 3QWNA 1EY8A 2A68D 1H9KA 2XRSD 5CORA 3VRBB 4ZLTF 2MUYA 1R4PB 1LT5D 2Y3AA 3W2DA 1N63A 3VYTA 3E0JA 4NZLB 3DWGC 1E7PB 3BYTB 2EDGA 4N6EB 4GLSC 1FYCA 3V3XA 5M9OA 2L52A 2BA1A 1JRPA 2CHBD 1A3TA 1YN5A 1FEHA 3S16B 4ULLA 4B9WA 1V8QA 3C8YA 2B2YA 4OO1I 3P4RB 1V43A 1YNJC 3NQTA 4KD3A 4RAUC 2WKCA 3BDLA 4CKEA 4E6IA 3J7AV 2JA7B 5C0XG 1JE4A 3E9SA 1RDPD 1QWYA 2G9DA 4MN3A 1DOYA 2BE5D 3FILB 3I4NB 4YTNB 1MPEA 2GB1A 2C5CA 2M0AA 2EJFC 4ZK9B 1FNWA 1PGXA 1F2RI 3U9SA 1O7ZA 2D9UA 4LMQD 2E3TA 4B9XA 1TS5A 3TDQA 3OMGA 1OXXK 4KHVA 3B9JA 4IUPA 5EKKA 1B9MA 1Y69U 1A2TA 4KKIA 4CHTB 2QILA 1C4PA 4ZQ3A 4IN3A 3OHXC 4IDIA 1C9FA 1TWHB 4YTMB 3WCQA 1ZXHA 1WTPA 3EA6A 3CU7A 5D65A 2KECA 4DAPA 2PVOD 2WXLA 3OIPA 1LT3D 3BK1A 3BK2A 3TSSA 4ZUIA 3QG1A 1S5BD 2WP8J 2V0GA 4RCOA 1MHHE 4A3JB 4WH4A 3FPUB 2LMCA 1PRTC 4OVZA 1B1ZA 1QG7A 4IUQA 2K04A 5JPNC 1EY4A 3NBHA 5EGTA 2A74C 4WORA 1HA5A 1AFPA 1VDVA 5AUIA 1D6EC 2MH7A 4C3JB 2ZW0A 1ZOYB 2A6HD 1C78A 1YN3A 2NVYB 2QDBA 3HOYB 5I6WA 3A8JE 4NDXA 3R2IA 2LEKA 1CT1D 3SFDB 3X3MA 5M5XB 4C7ZA 1KRHA 1LTTD 1BCPB 1BQQT 1WWTA 1YMHE 1MVKA 1J9OA 4C7YA 2R7ZB 3OW7A 2HDLA 2JQRB 4WAFA 2GI9A 4FO2A 4PV1C 1WCMB 4KY5A 2VUMB 3SXHA 1FGBD 4P16A 1NVID 2XIWA 3NUCA 3AEEB 1I4RA 4OZCA 4YSYB 3S1NB 2A68C 3P4PB 1UEAB 3IKJA 2K03A 3AE4B 2WXIA 2B2VC 4KK7A 4N59A 2A6ED 2K5QA 1G2TA 3HOVB 3CIRB 2MPMA 3J9CA 1E0ZA 3GV6A 1N62A 2SNSA 4XDDA 4XT1B 4RH6A 2RDHA 3H91A 2J0TD 4PNYA 3AN1A 3PUZA 3LYYA 1PZJD 3DEOA 1II3A 5JEAH 2KOLA 1WTWA 1DOKA 3H09A 1T3QA 2IGDA 1CJEA 2AWOA 2EVBA 2J53A 2KDMA 2BA0A 5T1IA 4P6VF 4L23A 1QCBD 5D14A 1Q3LA 2OT2A 2N9LA 5FO8B 3K59A 1V1PA 1LTID 2Q8IB 1C79A 5EBCA 3GTLB 1IKLA 1F2YA 1EYAA 1RKNA 1BCPC 2EYLA 2L0CA 1RYJA 2R93B 2EE1A 1NI3A 4K5WA 4YT0B 1VLBA 4QUCA 2EYOA 5JVG3 1N5XA 2IGHA 5BMGA 4WIPA 1W6JA 4N9TA 2NTTA 1IBXB 1MHXA 3TMEA 3PV0A 1TS2A 4ME5A 2NVXB 1C76A 1XCTL 4G7ZC 2ZW1A 4QF4A 1T5EA 5KRUA 5KNDA 4A3MB 5C4HA 1MBYA 5CR3A 2EYMA 1RTNA 5GXGB 3I73A 1JORA 1ML0D 2XWJB 4P2CB 5E3FA 3FAHA 1EQVA 3D31A 1QQRA 2B2VA 4A3KB 3BDOA 1KF6B 1Q10A 4I7ZC 4EQPA 5I4DA 3MEHA 2PZWA 2Z1CA 3EGRA 4N9PA 1PDXA 2N0SB 2EELA 3HRZC 2J52A 3AEDB 4X3UA 2E75C 1Z6HA 2F0HA 1SE4A 4XWTA 1ILQA 2WDQB 2BDNA 3WOFA 3DWQA 5JJZA 3GV3A 4C3HB 4QB4A 2L55A 4F8MA 5C44B 4OZBA 1QILA 1TJEA 1SJHD 2QMTA 2FJ2A 1ET6A 1F77A 3AMUA 2MJ3A 3SDZA 2V3NA 1YNTE 2AUKA 2K9XA 5CV5A 3FILA 1UWMA 3I9V1 1KTKA 1EY5A 4GDKB 4FXDA 3VR4A 2HUGA 2KJXA 3M7GA 3MFGA 2A69C 4LTUA 1R7SA 1XLPA 1BOSA 1ROEA 2ONQA 2PW5A 4TQUS 4L2YA 3BVGA 2JEAI 1Z7TA 2BW2A 2EKIA 2EYHA 1U4MA 1FR3A 1S4ZA 3OPOA 5KNBA 5CV9A 2DLBA 3LX0A 5C0XH 3TEWA 3AECB 4G57A 2ON8A 4JE3B 1J7BA 2IT1A 1PGAA 1BDOA 4ZUJA 3SK5A 3W1SA 1B9NA 3K5OA 1ZXIA 1H9JA 2XWBB 3C46A 4DK1A 1BBXC 2LUMA 5D7GA 5IGGA 4X3TA 2IJ0A 1VMCA 2CW0C 1BXTA 3D4DA