1SXTA

Staphylococcal enterotoxin type a (sea) co-crystallised with zinc
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
224
structure length
224
Chain Sequence
KDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN TYPE A
publication title The Co-crystal structure of staphylococcal enterotoxin type A with Zn2+ at 2.7 A resolution. Implications for major histocompatibility complex class II binding.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Superantigen
total genus 61
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sxtA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sxtA02
1LTRD 1SXTA 1EEID 2G9HD 1PYWD 3TSSA 1I4XA 2IJ0A 4NZLB 1HTLD 3R2TA 2NTTA 1L0YB 2R61A 1D5XC 1L0XB 2QILA 1SEBD 4L63B 3R8BA 1KLGD 3BVMA 1CK1A 3SEBA 4L6TB 1V1PB 3KLSX 1YN5A 1JWMD 1D5MC 1FNWA 2J4XA 1FNVA 1TS5A 1EWCA 5D3IB 3W2DA 2AQ3B 2AQ2B 1PRTF 1UUPA 1PRTC 3R2IA 3CHBD 1S5FD 1AW7A 1D6EC 1PTOF 5ELFA 1KLUD 1HA5A 4Z9CB 1CHPD 1ENFA 1I4GA 1LTID 1FNUA 3BVZA 1CT1D 2RDHA 1EFID 1HXYD 1JCKB 1PRTD 1UNSA 1JWSD 1PZKD 1XXGA 2CHBD 4RCOA 4RGNA 4RGOS 1BCPF 2TSSA 1I4RA 3OWEB 5D3DA 4ZYSA 1FD7D 1PRTB 3O13A 1EU4A 1SE4A 1I4QA 4DXFA 1KTKA 1F77A 1M4VA 1D5ZC 3DWAA 2XRSD 1S5CD 1MD2D 2QEJC 1ET6A 1LLRD 1SE3A 5ELEA 1PZJD 1LTAD 2XN9C 1EEFD 1CHQD 1CQVA 5ELDA 1STEA 1ESFA 1LTTD 1PTOC 3MC0B 1FGBD 1T5XD 2SEBD 4RGMA 3BZDB 1RCVD 1YN3A 1AN8A 1RDPD 5TSSA 1GOZA 1PTOH 1JQYD 1TS2A 1TY0A 1SJED 1JR0D 1LTSD 1JWUD 2AQ1B 1DJRD 2RDGA 3GP7A 5I4DA 3EA6A 4RHRA 5ELBA 1PTOD 3BYTB 1LT3D 1BCPC 1LT4D 5ELCA 1TS3A 3EFXD 1SE2A 2WV6D 1I4HA 2ICIA 4UDUC 1S5DD 4TSSA 1G8ZD 3DWPA 1LT5D 1RD9D 4RGTA 3V05A 1YN4A 1PTOB 2Z8LA 1LTGD 1PZID 4RH6A 4DXGA 1HQRD 4RFBA 1LTBD 1SJHD 4OHJA 1BCPD 1I4PA 1RF2D 1S5ED 1SBBB 5FKAC 1QILA 4BWGB 3DWQA 1S5BD 1LO5D 1V1OA 2O2LD 3MFGA 4C56C 1XTCD 1LT6D 1TY2A 1ET9A 2XNAC 1B1ZA 1B44D 1BXTA 2XRQD 3BYYB 5FK9C 1DYQA 1TS4A 4RHSA 1BCPB 2IPKD 1EU3A 1V1PA 3BVGA 2NTSA 4O1NA 3URYA 4K6LA
chains in the Genus database with same CATH superfamily
1L7YA 5AZFA 1EYGA 4YY3L 3E9SA 4FULA 4TKNA 5LMNQ 4WORA 1I4XA 2NTTA 1VLBA 1K52A 3MJWA 1SEBD 2R3ZA 3OMGA 1V6EA 1VZ7A 2DWQA 2WINB 4QF4A 2JY6A 2WU5B 3D6CA 5TR5A 2K39A 4J3OD 4EKUA 1AWDA 3Q3JA 4EEWA 4MM3B 2CCZA 2F0PA 3KLSX 2PMZB 1I94Q 3M4OH 1HFGA 2XEWA 2NMQA 3TP6A 3GV3A 2B63H 3MJ5A 4B3SL 1D2BA 2QJLA 3NZUA 1WXSA 2I38A 1Y1VG 3Q3NC 3R3MA 3ITPA 1VZ8A 5AFWA 3LJ3A 4POFA 2UU9Q 2WQYB 2B2TC 2B2WC 3A7LA 2A68C 1C8CA 1IUEA 3PRPB 3KDFA 5GQOA 2QCZA 3OIQA 5EJWA 4GNXA 3OLMD 3T1YQ 3NRZA 3CP0A 4ZUJA 2A1AA 2F4VQ 2JPHA 1WTQA 5IWAL 4C3JG 2IHEA 5C2TB 3OTOL 2X6LA 1VMPA 3FILB 4LNKA 1XNRQ 1HTQA 5BYQA 3M4YA 2R93H 2JP1A 3DLLA 2X69A 4BBNC 4M01A 3E3XA 3V62A 1PZKD 1JB3A 3CMAA 3CIRB 3P2BA 1BBXC 2V3NA 4BY1G 4ZDVA 2KWVB 2CQAA 4UP9A 1BCPF 1IHZA 3HOWB 5M3MB 5M5YB 4K7UA 4OX9L 1SR3A 1SNDA 3K59A 1I4QA 1X9NA 1K50A 1KTKA 3G6JB 5C44H 2IX1A 3SDLC 2B3GA 3HZXA 4CDFC 3HOXB 1E5WA 3MHSD 2NWGA 1S5CD 3FRPB 4DV5L 1WZ0A 2RR9A 1Q8KA 4WQOB 1B3QA 2GBKA 1K3BC 4LW1A 5M9OA 3W1BA 2FNJB 1GUTA 5DEHA 1WTHA 5JEAJ 3PIO3 3M3YB 3Q8BA 1TXYA 3PO3B 1BNZA 3SK5A 2GN5A 3MC0B 4DK1A 3J7ZC 1FGBD 4RGMA 5LL6S 1YN3A 2XK5B 3NVWA 2PJHA 3LWUA 5C0XI 2E2JB 1WCMB 1V9PA 2IBIB 2Z6KA 4R3DA 1YJJA 4OO1I 4NPSA 4JYAL 1RYJA 3L13A 1STAA 4C3HG 4NAWB 3M4PA 4X65L 1QNKA 2X6GA 3RYTA 3UDFA 4HPPA 4L2YA 1N33Q 1FO4A 4EZLA 4KKSA 4UDUC 3VR9B 2E6XA 3DBHI 2LKVA 4IFDH 2NYZD 4K2LA 3KW5B 2FFKB 1CA5A 1Y69U 1EY9A 1OQRA 3W5VB 5IIFA 5BYSA 4DXGA 3B2FA 1VQ5A 1HZ5A 4A3DB 1BUVT 1HTPA 5C4XG 4NY0A 3GS2A 5KHOA 4NXNQ 1JOKA 3C8YA 5M5WH 2PW7A 2ZTCA 1GB1A 3L17A 1Q1BA 1E7VA 4A3CH 2IPKD 3FMCA 4IPGA 4DDGD 1XPOA 1ZPSA 3E0EA 1N32L 4IWOA 2AHOB 3B0AA 3RD4A 5CHFA 3WANA 3TSSA 2DX5B 4RM8A 4ZHPA 2OXPA 3S15B 1Q46A 3ZNGC 2PZUA 2OQ0A 3IL8A 2O2VB 2QILA 1HNXQ 2W54A 1R4NI 1V86A 5AUKA 3RNAC 4JI1Q 3VHTC 5IGEA 2KC2A 1N60A 4S17A 1KLGD 1TWGH 1XNQQ 4DFAA 4LFCQ 2NN6I 3SHLA 1PH3A 2WXLA 4PK1A 1X3FA 4MHEA 2JJQA 1PHJA 1PGAA 4YWGG 2I2YA 2XVSA 1FNWA 1N34L 4N9PA 1QOGA 3LWEA 3ZRCA 3GV6A 1FRRA 4GLVB 2NVUI 4HXDA 4HSPA 2SNSA 4YXDB 4XYOA 1UE1A 4GNXC 1E10A 3CU7A 3KYCD 4CQNA 2E3TA 1VQAA 1WTRA 1YIWA 3GTMH 1HUMA 3QB3A 4NJCA 3U4EG 2K28A 3OSOA 4NW2A 2KANA 4RM9A 4JVZA 1JE4A 1I4GA 5I9OA 3L7ZC 2KAJA 3U9OA 4HVBA 2JXXA 2MA9B 2D2QA 2KD0A 3OIPA 5IP9G 3NHHA 2F1MA 2RCFA 3TZUA 2KZRA 4DV3L 3KF6B 3I3CA 1Q5WB 1XO3A 3HGBA 2AMCB 2KENA 3DHQA 4NQLB 2RHSB 4JG2A 3JAME 1K53A 2R7DA 2TMPA 5D3DA 5LMNL 3H9DA 3U4ZA 3HOUH 1E7PB 2WACA 4L8JA 1EOTA 1X6OA 1SMYC 2F0HA 5KYLA 4O2DA 3H15A 4LFBQ 3KH0A 2L5TA 4QL5A 2PQAA 3AECB 1F77A 3MEFA 1P98A 3AFQA 3CF6E 4OGQC 2ZNVC 5IGCA 4LF8Q 3TEZA 1V8QA 4AQ7A 4LNQA 1P3QU 4KZCA 5IA7A 4R1JA 1I94L 4IALA 4A3KH 2WB1B 4BS9A 1JWBD 4C2MH 3ZNZB 1CHQD 2QIEB 4E3CA 2R92H 1IZ6A 2LXAA 2N7JA 1ESFA 3MAQA 1PTOC 2UU9L 5A2QE 3TJPA 4ARCA 1A8VA 3CMMB 1RCVD 5JH5C 5T1GA 1AEXA 1YX6B 2KMCA 4N9F4 2Z6KC 1FR3A 2PZWA 2F03A 4HCSA 3I8ZA 3T1YL 4KGTA 5DPRA 2F4VL 2KCNA 2B3AA 3GP7A 1YMHE 2B29A 3NVVA 2JA8H 1S3SG 2JT4B 2X8XX 2FUG1 3NQTA 3KK7A 3LB8C 1WJNA 1AH9A 3K6OA 2WV6D 4HPMB 3NUHB 3V05A 1HTOA 4KY7A 3EN2A 2KLGA 1IBXB 4F8MA 2VUMH 2ACZB 1VCIA 2IY5B 4RH6A 5I6WA 2BYFA 2CVRA 4IUUA 4RFBA 4DPGA 1NE3A 3OAWA 1BCPD 5DPWA 2Z6BA 3SK6A 2O2LD 3S1MH 1TWFB 5GXGB 4FN2A 3HEJA 4GOPC 1VF5C 2FMCA 4G7HC 2WAQG 2JEAI 2BW2A 1TS4A 2RPQA 3HUIA 4OVVA 4JOIA 1EU3A 5IP7G 4V190 1LABA 3I4NB 3DHHC 2KFKB 4M8AA 4PZ6A 4LFAQ 2XTIA 4GOCA 1LV9A 2ALYB 2BE5D 3HS0C 2JA6G 3OJ4B 3FKIB 5EQ0A 3WOFA 5LL6X 1K83H 1B53A 3PLVA 2LGYA 4GN4B 3BZCA 1XYIA 1C4CA 2R6GA 3OPOA 2VRRB 2MFIA 1YN5A 4JWUC 4DHJB 2J0TD 2CFMA 4EZKA 1D5MC 4YIJA 4LNFA 1HZCA 2O5IC 1B3AA 3KQ4A 3HVDA 1F2YA 1B7YB 1YNJC 3K8AA 3S1RB 4A3FG 1S40A 4CBVA 1RM6C 1V80A 1N33L 2B2UA 1A15A 2KCTA 1EZ6A 4GB9A 3PO2G 1IYVA 4PG3A 3GTQB 1NMGA 3NUCA 4DV0Q 2A69C 4DNRB 3F2CA 5JVG3 1FVIA 3PTFC 1PH6A 1K3RA 4BBRH 5H1SE 1CKOA 2YTVA 2SOBA 4EQ5A 4HCEA 1RTNA 3STBD 1AW7A 4KTAA 4WJWA 4OZAA 4C3IB 3J81c 3CCUA 2A8VA 1J19A 3JVZX 3F2UA 4ZUIA 3DM3A 2R2OA 4YWKA 1MJEA 5IT9E 3NP8A 3L16A 1C7YA 3OG5A 5M3FG 3F1ZA 1KM7A 1QOFA 2VZKD 3C2PA 4LJZC 3TRZA 1PRTD 2LMCB 4LF5Q 3DWGC 1XXGA 1WX8A 1J7BA 2M9VA 2K8HA 3WWVA 3GZNB 2OEDA 1I4RA 4W9GA 3KJPA 1FD7D 4GDLB 3S16H 3AB5A 3EVQA 2WX0A 2ZJQA 1HNXL 3E0JA 3CC7A 1UELA 2RPVA 2WLBA 4MSQB 4JI1L 4GKKL 4KVGB 1G2SA 2I1KA 3IAS1 4P75A 4C4VB 1XNQL 1CSPA 4IUVA 4LFCL 3VDZA 2VS1A 1WXVA 3J80E 2WXQA 3S17H 3VUWA 4JI2Q 1K8RB 3ULJA 4KN7C 1LTAD 3F2DA 2O6VB 3A9JA 2KEDA 4K0KQ 2B63G 3M62B 4ZKBB 4DR1Q 5IYCH 2EOTA 3APDA 2Y0SG 3L10B 1U4AA 3RNUA 1NJIC 1X1MA 5C23A 1C78A 4ZRJA 4X3SA 1YNTE 1U4MA 1U9RA 2AQ1B 1OTRB 4MGKE 4KY5A 2K6DB 5DPTA 3D4WA 1GB4A 4GLSC 4CYEA 4AOFA 1WYGA 1SYDA 1X54A 3MXGA 5LXIB 2IGHA 3PZ7A 4AUQC 1NMFA 2K33A 3KUZA 1JQ4A 1A6XA 1TBEA 5CV4A 3H7SA 1LT5D 2F0OA 4DA2A 2G45B 4US9A 3PIP3 2R93G 4B0EA 1OXUA 2MBQA 3V6EB 4DV6Q 2L1AA 2QEXA 1TWAH 1BT0A 3VR4A 3A9KB 4JLCA 2MJDA 1SJHD 1F2LA 3MC8A 2KJRA 4QAYA 3S1QH 1YJWA 2KJ6A 3VTVA 3PF4A 4LFBL 4DAYA 1OFFA 2SNMA 4JOIC 1B1ZA 2E5LQ 1P16A 3NWSA 4JBMA 1GUAB 2PO4A 1AE2A 4CJ1B 4WFN3 4R9WA 3JAMi 1SGHA 2WXOA 1V1PA 3HP3A 3BVGA 1CSQA 3K0YA 5C44G 4LF8L 4F1SA 1EQVA 1MFWA 5EKLA 1DD2A 4JWSC 2XWJB 1PVOA 3PIOA 1PYWD 2NN6G 4TVAB 3RN2A 4JPBW 1HTLD 3U9SA 2JQRB 1B9RA 1VQEA 1EL0A 1H9MA 3H0GH 1VCBA 2LSSA 2PVGC 3TMEA 1EWYC 1X32A 3A4SC 2IGDA 2ZXOA 4KHPQ 1KAWA 4OELB 4FXCA 3QO2A 1XTDA 4C3JH 1G2TA 3Q3FA 5LNK1 4H13C 1A3UA 1SYEA 4KD4A 3AE4B 4YWLA 1QQRA 2J4XA 1ICFB 5D3IB 2FJ2A 2EVBA 5FO7B 4GN3B 3HOYH 1GJZA 1W6KA 2F0VA 3PZ8A 4FF2A 4MELA 2AQ3B 4POGA 3ICEA 3JYUA 3Q8AA 3M9BA 2FIFA 2L11A 1WR1A 5C5LA 1EIYB 1CTMA 1VQ9A 2KTFA 3MXNA 3AEFB 3J80L 4A55A 1C9FA 1L4DB 1KNAA 3VA5A 1UE7A 1FFUA 3VTWA 1FNUA 1F9JA 3IT6B 3PGEA 1GNUA 1V5TA 3WIMA 3ZUNA 1BKBA 4USAA 1C9OA 3TP5A 3U7ZA 5KGUA 2N88A 4RAUC 3UGBB 2N7EA 1Q82C 5EE1A 3S14H 1O7ZA 3C1FA 4AQYQ 2K05A 1EF5A 1IP9A 1YQ4B 3M85A 4A3CG 2Y5BB 2Q2IA 4A3MB 3NHEB 1X55A 4ME3A 3I2ZA 1SNPA 3MA2B 2JXTA 5LLIA 1TWHB 3CQZB 3C19A 4RG1A 5JHAA 4FXGC 4X3UA 3H91A 3T4AC 1ASYA 4GIVA 3DWAA 2EJFC 2K1BA 1DGSA 3UI3A 1JMLA 3BK2A 5JOBA 3EBEA 1SE3A 2EY1A 2VY3A 2JX5A 2BQQA 3OHXC 1PZJD 4Q0FA 1B2TA 3AE9B 2HUGA 3HIZA 1YJNA 1P7FA 3GZNI 1SAPA 3CCQA 4WWNA 2GMIC 1XD3B 4HIKA 4MH8A 1LUZA 3WCQA 3E5SA 3NTKA 4IUTA 1W2BA 2DAJA 1NYQA 2D0OA 2VXWA 5IGBA 1F9RA 2ES2A 3VR8B 1D1KA 2DNCA 3ZLZA 2N1VA 3PO3G 4DV0L 3CSFA 1Z6HA 3PUYA 2WXMA 2KWCA 4F7ZA 3CWIA 2Z4HA 3NTHA 1F2ZA 1LTSD 1JWUD 4YL8A 3SXHA 3X23A 1MVKA 3AFPA 4JW0A 1VDVA 2DZMA 2GBRA 2Y5PA 3E56A 1QE6A 3H94A 4P1CC 5ELCA 4A3IB 1SSOA 2C9WB 4DR6Q 4P74A 3VR5A 4IPHA 2NBUA 4JK1C 3LDZE 2R7ZG 2BS3B 4LF5L 1KDCA 1WMHB 3I4MH 4X3TA 1PFMA 2KEEA 5FLMH 3P75A 2JA5H 2J42A 3KVFB 4GN1A 5KNBA 2IO0B 4ZRZA 2FCNA 4XIGS 1NNXA 3DWQA 1LYLA 2AUJD 1K51A 1FFVA 2V9HA 4M0WA 5BYRA 1ZKHA 3DEPA 1B44D 2PZTA 3H6NA 4HIDA 3HOVB 2K32A 2NVXB 2KHSA 2KDIA 4EZJA 2O4XA 4A3JH 2K6QA 2WXHA 5CMDA 1PMRA 1S4ZA 4ZOHC 3AE7B 3VAWA 2VNUD 4K0KL 5AJ3Q 3AEDB 2L32A 2JRIB 3DWMA 4US8A 4A3KG 2NVTB 1MI2A 2VW9A 1GM5A 1PYBA 1P0RA 2DAFA 3J80i 2JA7B 3C0RB 4L1BA 5D94A 5H8YE 2F0UA 4UP8A 2R92G 4ANUA 4MJSA 3R8BA 1EWIA 3SEBA 3HOZG 3KF8A 3OMCA 2NZ1D 1PH7A 2BS2B 1KAAA 1DOMA 2EPBA 3I4LA 1UGMA 2W55A 2ZPYA 4LF9Q 1EYAA 3I56A 2JXMB 2JU6X 4GLAC 4YCUA 3RLOA 1WGYA 1WFYA 4NJ7A 2E2DC 2JA8G 3A7AB 2GBJA 3DBSA 4BKGA 3HVZA 3CCMA 3UDXA 4APVA 2MGSA 3K5MA 2NS5A 4DV6L 1PH2A 3S24A 5D6JB 4C7ZA 2K8CA 4JI3Q 1ZUD2 4A8XC 3VRBB 2JSVX 3CW2C 1CT1D 1J7AA 2MQHA 1VD2A 1WXMA 2BS4B 3ZKJC 2E5LL 2BWFA 3QJZA 2ZW0A 1SMXA 4CKEA 2CHXA 2AL3A 1EWHA 4ARIA 3SFDB 5EPJA 4X57B 3EGRA 2Q8RE 1AZPA 4LAAA 1IKMA 3H3VH 2AYOB 2HTME 5JVH3 3APCA 2HIXA 1K8AC 1PFDA 3DBLB 1I6HH 4GDKA 3WAMA 5HFYA 2NVQB 2C5LC 4LMQD 3BINA 4KHPL 3OYYA 2QEJC 2JN4A 1A63A 4F87A 2D3GA 4IUNA 3PUWA 1Y8NB 3OJ3A 4LK0M 2KFJA 4N59A 2MEKA 1QZHA 3RPFC 2K03A 5C3EB 4WWMA 3PSIA 2K5PA 4DKAC 1A62A 4XWWA 2KECA 1LGRA 5HGTA 3GTPB 4V0BA 1WJ4A 3K9PB 3NS8A 1VQOA 4UAIA 3RNFC 3AH7A 3ZIMA 1KXLA 2IWHA 5KNCA 4XZ4A 2N9EB 4J8QA 2YVCA 3NTIA 2C9OA 1EF1A 2EMSA 2EXZA 2V4LA 5J18A 4RKLA 3N1XC 3TP8A 1F9QA 1LM0A 4KKJA 1EOVA 1Q86C 1Y1WH 3TS0A 4RHRA 4BBRG 2B76B 2B39A 4RWSC 1IBLQ 4A93H 5LMUQ 3J7AV 3FEWX 5HG2A 4N6EB 3G7LA 1GUOA 4BA1I 5M5XH 3DQVA 1RFAA 1PZID 1YHBA 1TWCH 4ZQ3A 4WJ4A 1SFOB 4GOPB 5IGGA 3D6WA 4NJ6A 4JV5Q 2WAQE 2FXQA 3A55A 2IO2B 2WDRB 2M00A 4YTNB 3WAOA 5MPOA 4TMAB 4NKLA 2VQEQ 1V81A 2XRQD 2WIIB 1TR5A 1QKZA 3RUIB 2G1EA 2EIFA 4N8FA 4O1NA 3URYA 4LJPB 3VRAB 5ELDA 3TIXA 4L5SA 1X3QA 5KEEA 3Q8FA 3AEAB 4A3GB 3R2TA 5CV5A 1NCVA 2YU9B 1HFNA 4DHJD 5AZGA 1SE9A 2DJFC 2WKCA 3Q23A 5HI1A 4J1MA 2GVAA 1W3SA 1GC7A 1E1OA 4II2B 1H9JA 3PUVA 5DAUA 5IYCG 2N9PC 5KNDA 1SDFA 2WYQA 2F3WA 1IW7C 2JUOA 1W6JA 2D3CA 3T53B 4NXML 2J0KA 4OEMB 2JSOA 3DMUA 4DNTB 2MJEA 5C3JB 1GHKA 4A3BB 1PA6A 3HRDD 1T0YA 1JRUA 3AEGB 4DR6L 4O0AA 3HRZC 4RNAA 4DWFA 1HZ6A 1MHWC 3GE3C 3JAMc 1L1OB 2B2VA 2PW9A 3IXSA 2I07B 3NSWA 1IYUA 3QA8A 2RQXA 2K4KA 1JT8A 2WX1A 5EE9A 1JC7A 2V4DA 3N1YC 1E8ZA 2PE9A 3R93A 4DR7Q 3UE1A 4ZLTF 2BKRB 3QWZB 4RF1A 3NG0A 1IGDA 1GO3E 4WJNA 4ZRQA 2NBWB 5C0XH 1CKNB 1ISNA 2E2IH 4WAFA 4LNOA 1Q1EA 1CI3M 3TBIB 3DPDA 4OO1H 3GTJB 2MLBA 1V5OA 4DAMA 5IY0A 1J5EL 3CPFA 4HIMA 2XWBB 3OWEB 4WWPA 2WXGA 3M4QA 3S1NB 4DV7Q 5CC4A 3U4VA 3HKZG 4XDXA 1H9SB 4II3B 4K1RB 1PGBA 3NXWA 2DNEA 2MUYA 4B9WA 3IAYA 3H0GG 2O6VD 4KDIC 2PPBC 4R4TA 4R4OA 1XEEA 2W9NA 2K5WA 3QR8A 4K3CA 4URKA 2D5GA 4XWTA 2M56B 2BWES 3MC9A 1I3QH 1SNOA 4CJ2C 4WJ3M 1VQLA 3DVGX 4LF9L 1E7ZA 2ATWA 1FRDA 3V60A 2FHTA 5HHDG 1STEA 2Y0SE 3DBLI 4IZ8A 3HOYG 1NSNS 4JI5Q 1OTCA 4RCNA 4C7YA 5TSSA 4CDEC 2N1WA 2Q8TA 1IGCA 4HJ9A 4JBWA 3DCGA 2M17A 2D9UA 3RZOH 3S2DH 3PV0A 3MHZA 2I5LX 4YSXB 4JI3L 4JI4Q 2KMMA 4R8NA 3KLWA 4AIMA 5KYIA 2HDEA 3AXCA 2H5XA 1LT3D 2OF1A 4EQPA 3RCZA 3ZYYX 5FO9B 4YCVA 3CD6A 4PMCA 4HROA 1B8AA 1TS3A 1FL0A 1R4MB 4A6QA 2NN6H 2K14A 4PS8A 1K0RA 4QQBX 4CHKA 3ZDTA 2EY5A 1SF0A 1S5ED 5FKAC 1SBBB 1KH0A 2FCSA 1ZXTA 1UWVA 5I9PA 4HCPB 3PRMB 3BDLA 2ZTDA 2HHHL 1EY5A 1PLFA 4IUQA 1ZE3D 1HPCA 1FCLA 2L0CA 2VB2X 5I2XA 3BYYB 2V1YA 1DYQA 4GN5A 2NR2A 1QZGA 4JPSA 2KYWA 1RRBA 1NAPA 3AB9A 3H09A 2DBYA 2CHWA 2G9HD 3NWTA 1YD8U 4LLGM 4EVOA 2F0DA 1WJUA 1B9MA 2HD3A 4FVMA 1YHQA 5C1ZA 5FJ8H 3ZJUA 1QUQB 4N8X1 4BZAA 1WJ6A 3S2HB 2A68D 2O5JC 1R9TB 4DK0A 3JW0X 1CK1A 1VQ4A 2DJGC 3VH3B 1STNA 2AWOA 4OIJA 3ZXRA 3UQAA 4A4IA 4ICUA 1S1QB 1DCZA 1GVPA 2CQOA 1FM0D 3A8KE 3UI2A 2EJMA 4LF7Q 1TIID 4AS1A 1WTWA 3KJOA 1IBLL 1SB3C 2DZJA 2LGSA 1NUCA 4MN3A 1PRTF 5LMUL 3QJYA 2HTHA 4DR2Q 1CJEA 4GXBA 4A9AA 2B2VC 2F0EA 4MNOA 4GMVA 3KUPA 3GTKB 5D65A 1M94A 4KIKA 1KDBA 2BT6A 1ASZA 2GBNA 3TBLD 4FADA 1VQ8A 1WYDA 1SRUA 1VMCA 2EZVA 1EM7A 2LXKA 4JI0Q 3ECIA 3K80C 2I46A 3I4MG 2HDMA 5M5YH 5M3MH 3HOWH 3HOUB 4JV5L 4QCLA 2DYOA 5FLMG 3HFZB 4UHVA 1H4RA 2JA5G 4FLHA 1HCZA 1K0SA 1UBIA 2VQEL 2QDLA 1B70B 4KKUA 4FF4A 1WM2A 3HOXH 4MH0E 4QB4A 4B3TQ 3V96A 4K5XA 1DXMA 3BU2A 1VZ6A 4LCDE 4MSMB 3W1SA 3H3VC 4RGOS 1WE7A 2GLSA 3KWVA 4G57A 3N9YC 4F8CB 4DAVA 5D2MB 3EROA 3M3YH 1UEBA 1E0BA 5CV7A 4A3JG 2E2HB 3PO3H 3BG3A 1UWMA 2QC8A 1P7EA 3A9JB 2MX2A 2K01A 2K52A 4DV4Q 4OXPA 2IDYA 3RD2A 1CQFA 1WGGA 3AE2B 1WD1A 2E2JH 4ZYNA 1WCMH 3T13A 2Z1CA 2KCMA 5C4JB 3L0WB 3FDTA 2KWDA 4I6PA 3P63A 2BVCA 3WOEA 3JSVB 2R7ZH 1SYFA 3FKYA 1X3PA 1VRAB 4A75A 3MTSA 4EGVA 5GAGC 1OGWA 4XE0A 4OIKA 1V2YA 1Q12A 2NPTB 2PQEA 1AN8A 2F0LA 3RMKC 3A54A 4I6LB 1D4BA 1JOOA 2BCOA 5CV6A 3GB1A 2A6ED 3P42A 1LXDA 2UUCQ 3I9V1 1WSPA 2IO1B 2RDGA 5E7NA 2ZEQA 4A3DH 4P73A 1HEZE 2K9XA 3SK8A 2KVMA 1N62A 1OQQA 1I6VC 4J6IA 4DR7L 3GE8C 3U7DA 1BCPC 1TYGB 4E6IA 3EFXD 4BA2I 4JGHB 4KGRA 3UIPB 2KTRA 1KJTA 1LTGD 2F3VA 3L54A 3GQBA 3L0OA 3NELA 4QMGA 3WA0A 1EY8A 4LF4Q 2WHIA 3P4QB 3UQBA 3RZDB 3KWLA 2M2LA 5HY6A 4X62Q 4DV7L 2K5QA 4EQNA 4B08A 3S15H 1HE8A 2FIDA 2G3QB 1LFDA 5DCNA 2HCIA 4BVUC 3HOZH 1BXTA 3PF5A 1RODA 5E4XA 5AUIA 3FPPA 5JHBA 4P1BC 1R4MI 1FXIA 3A1QA 1K9MC 2BKFA 4U673 2L8JA 3CRLC 2KX0A 3PHWB 4IG7B 4K81A 1E24A 4R4CA 5FLXL 1DOKA 2XIWA 2NUCA 1EQQA 2D0PA 2R61A 1MIUA 2MJ8A 4Q5VA 5ISRA 1XNRL 4BBSB 1ZYRC 5KRUA 1Q3LA 1MSHA 1IYJB 3EQLC 4BXXH 3CF5A 3H1UA 4JI5L 3G48A 3GTLB 3ZDMC 1UE5A 2EMTA 4FXKC 1KC8C 2MP2A 3QQ8B 4JI4L 1EIHA 2Q2UA 3QX1A 1WI5A 5D14A 3FILA 3TN2A 3W2DA 5EKIA 2M8SA 3VYSA 1Y1WG 3AE6B 2NB0A 1RHPA 1RKNA 1RWSA 1VS0A 2KKCA 3D32A 3U30A 1KDAA 2KT7A 1JB7A 2IHFA 4A93G 1C0AA 2K75A 5BN5A 3AQQA 3ND9A 2HT1A 1PRTC 2K5DA 2QKIC 1BUIC 4AJYB 4KSLC 1L2NA 1S5FD 1E8YA 3PREA 1ZP0B 3ZRFA 2OOBB 3MXUA 3RMHA 5BMGA 4XXEA 3LXFA 3Q2AC 2N8NA 3W1SC 4K7WA 5T1IA 2CHZA 1WX7A 2CJNA 1VQBA 5C5MA 1XJVA 2INCC 2PTLA 1KQSA 2K25A 1MG8A 4GU2A 1JJGA 4KKTA 2Q2HA 4MZ9A 4DR4Q 2INNE 1FGUA 1LTLA 4OONA 3GTOB 4BY7B 3NOBA 1O78A 1C77A 2N3SA 2Y3AA 2YEPB 3T1HQ 1WGHA 4M02A 5E6OA 4W9JA 1X65A 3RULA 4K6DA 2N7DA 4A3LH 5LHY1 3D0FA 2UXBQ 2NCNA 2CH4A 3W5UB 4XYQA 2CJOA 1TKYA 1MBYA 1YNND 1ILPA 4NAWA 2PYKA 3AEVA 1BVSA 4NXNL 2HJ1A 4DF7A 3SFEB 2EKEC 4LF7L 4NP5A 2Z59B 1LTTD 3AU5A 3NBHB 4DR2L 1PH1A 1RAXA 2X38A 4XT3B 1PH9A 4R4IA 4KMUC 3Q0AA 1NVID 3W1GA 2D07B 2J53A 3EC8A 3M95A 1D3ZA 5EBCA 2C35B 1V43A 4EE2A 2L3ZA 1LQBA 3ZW3A 3BYTB 3CCVA 4W9IA 2B8FA 3RN5A 4L5QA 3ONAB 4REZA 1E2ZA 1V97A 1TWFH 3ALBA 4G7OC 1JICA 3B2GA 1HR0Q 1Y8RC 3MHBA 4GS3A 1JRPA 3J7A5 2GRIA 1KD1C 4B3TL 1T0SC 4G11A 5C0XG 4JL9A 4CKBA 3I4NH 1Y1VB 2LZ6A 1TZ1A 1GKHA 2MSED 4OO1G 1SNQA 4B9KA 4AYBG 1U4PA 5IYBH 4P72A 1WTVA 1V1OA 2KLCA 2XGTA 1BDOA 1TY2A 1Z7TA 3FKIH 1ZOYB 2KX3A 1CUKA 3QOJA 3P20A 4RHSA 3QHTA 2NTSA 4FO2A 2WP8J 1WJJA 4C3JB 1LTRD 1Q90A 1HZAA 4LUOA 1JOQA 2FCMA 4B3RQ 3KF8B 5JPMC 4LNIA 2MQJA 4ZK9B 2KOXA 3K58A 2DGYA 2ENBA 3S1RH 2BGFA 4WIPA 3SR1A 2IGGA 3VUXA 4MIUA 4BY1B 5IAAC 2KHIA 1VQDA 3GTQH 2A69D 1NI3A 1PQSA 4TKOB 4ZHOA 4LTUA 4JQWC 1K8OA 4NPNA 1I50B 5LMNW 2NBVB 2CWPA 3A8JE 1OXXK 3KBXA 4C3IH 4XQQA 2K50A 2KWUB 5G2NA 4QGUA 2RKSA 1F2MA 1SYBA 4CO7A 3KF6A 3RFZB 3N6RA 4MT5A 1TJEA 2A6HD 1CZGA 2E75C 5DLQE 3SHQA 4LF4L 3R2IA 4KN4C 3TREA 2RCNA 3N52A 2JE6I 3T8MA 4X62L 4KY6A 1KFYB 2WXJA 2F0JA 1SSNA 2C7HA 2KUMA 3IRBA 3L08A 3T3NA 1FD6A 1XCTL 4C3HB 4A3EB 1E8WA 2BA0A 4BOSC 4PZ7A 2LASA 2IZVB 2ZCBA 3B08A 3HKZE 2CR5A 5DM73 1CFMA 4MTKA 2B2UC 1BMLC 5FO8B 4ICVA 2BA1A 2UXCQ 1ROEA 2BBCA 2Z9HA 1MHHE 4H44C 2INPE 5FJ8G 3ZVVA 2XRSD 1Q8IA 1STHA 1U5KA 3B9JA 1YZ6A 1G6ZA 3TMPB 5C4XB 4HAEA 1U0LA 2ZJRA 1LLRD 5ELEA 4KHZA 1PV4A 3I91A 3IVFA 1CQVA 3IFWB 2WGSA 2R2QA 1DOIA 2EYMA 5CTRC 2MO1A 1GUGA 3PVLA 3LYYA 4NNJB 5C3XA 2MPMA 4GKJQ 1Z5SB 4R8IA 5CX3A 4ILWA 2GB1A 4IOCA 1TT5B 2H89B 3V2TA 2WU2B 1IBXA 1GXDC 3T9LA 5L37A 5JZEB 1SYGA 4LFAL 1TS2A 2QMTA 3K7AB 2CW0C 2A5HA 5I4DA 3DBRB 5J3BA 4S0RA 2E74C 3TEXA 3KUCB 2ASQA 3EECA 4DK6C 3W9CB 1JW9D 3QCAA 1WM3A 1HZ9A 3HOWG 5M3MG 3ZTDA 3T51B 4TQ0A 2DN8A 4TSSA 1A2TA 1YN4A 1V9JA 1RD9D 1VDZA 2KFKA 4QIWE 4XTCS 1BF4A 3U52E 1TKWB 4NDXA 3HOXG 2KQ4X 1UGJA 1WVLA 1QOHA 4OHJA 1K28A 4KV6A 3FHWA 2VH2A 2WXIA 3F2BA 2K1FA 4IPCA 3T1HL 2AEHA 1TU2B 3TEWA 3MFYA 4J6HA 5FK9C 5GROA 3BWUD 4KV2A 1WWTA 4PS3A 2EDGA 2B8GA 2EE1A 2UXBL 3P1MA 4GLXA 2YEPF 1J6QA 3PMFA 1WTXA 1ZXIA 4CHTB 3E9HA 1TKGA 5DPSA 2F0QA 2K22A 4XX5A 1FCCC 2J52A 4MGZE 1WCMG 2I1JA 3PZDA 4B9XA 1L0YB 4HEDA 4JCVE 3EIVA 2DZKA 2L00B 4PMWA 1VQPA 4L63B 2N78A 1QG7A 1Q81C 1XLOA 5L95C 5JAVA 3AN1A 1FXTB 3PGZA 3CSTA 3PUXA 1F2RI 4A90A 1X3GA 3Q24A 1NY4A 3K0XA 4G0NB 3WAPA 1L4ZB 1RFKA 3EJIA 4Y7NB 4NAMA 5CHVC 5C6AA 2ASBA 5IGFA 1ZKOA 4X64Q 4KD3A 2ZJPA 1YX5B 2A5UA 4A3DG 1KNEA 4CDCC 4IM3A 4JBJA 3MP9A 3TEYA 1HR0L 2CS4A 2LMCA 3J81E 1DGJA 3TL5A 4HJKA 1KABA 2IT1A 2OTLA 1PH5A 2HQLA 1WGKA 4JI2L 2L52A 4LDTB 4LK1C 1X56A 3CHBD 4A3MH 4GDLA 2LVQA 2HD5B 4DNIA 3K5OA 1HA5A 3MZ5A 2A4ZA 1LTID 1TWHH 2MHVA 3CQZH 3I72A 1Y8OB 3BVZA 2N49A 4J15A 1UEAB 4KJNA 5NUCA 4DR1L 1DONA 1G6PA 2J7QB 2OQKA 2FE8A 4C4VA 1T6BX 4G50A 3QOLA 2Z0EB 1NYRA 2N9XA 1GC6A 5BN3A 3MTNB 3KDFB 4RKBA 3FPUB 2KQ7A 1C4AA 4GNXB 1WF9A 5JJZA 1NR4A 4HMJA 1TGZB 2O6VA 2TSSA 4IWQA 1SLJA 3GTGH 2KTRB 2PKOA 2BF8B 2LJ5A 3VXWA 2F0GA 3VYTA 5CR3A 2HDLA 5C0XJ 5EAYA 4HKQA 5IN7A 1D5ZC 2RSOA 2MBBB 1YVCA 3AE5B 4WJPA 5COYA 2LGIA 3RLNA 3R7QA 4P2CB 3RR5A 4BXXG 2LHEA 1SE8A 2RBMA 2N9LA 1EYDA 3PS6A 2GA4B 3T56B 1I42A 4F88A 2VQFQ 3J9CA 2WAQB 2QF7A 4EFOA 1Q10A 2MJ3A 2L55A 1HHVA 3Q8DA 3SD5A 3U2SC 3IFTA 2KA7A 3Q3MC 1YITA 5EPLA 2EYPA 4IUMB 4FJVB 1GOZA 2LXCA 1D1IA 3SE0A 2K3UA 2ZNVB 4OW0A 4M00A 4XC2A 4BKSD 2JA6B 3ZO5B 4P6VF 4K2KA 2BYVE 3EA6A 5BR8Q 2DZIA 2UYZB 2L9HA 4K5VA 1XMQQ 1AP0A 3P4RB 2EKIA 3M7GA 1YOVB 4HK2A 3RNCC 3AYHB 1EY0A 1FIQA 1G8ZD 1VQHA 3KUDB 1S3OA 1PTOB 3OW7A 2NVXH 4DV5Q 3HOVH 2B2YA 1WOCA 4K8IA 2DYMA 4A3FB 3FVQA 3TQYA 1L2FA 1LTBD 1YQ3B 3M63B 3CCJA 2IO3B 4GSWA 1QWYA 3PO2B 2W3SA 5IOIA 5J22A 3DBRI 3IHPC 1XTCD 1GAQB 4P7IA 2WB1G 2NVTH 1K8GA 1H9RA 2JA7H 4S3SA 1H8CA 4OL7A 1FYCA 4ME5A 4K5WA 1Q7YC 2KHJA 5EPKA 4A3LG 2WWZA 2UU7A 3J81L 1YIJA 2LUMA 4OWTB 2FUHB 4QJFA 2LHDA 5BO4B 1TTNA 4C00A 5M3FB 2JWUA 4BBNF 2PI2A 1YJ1A 4X65Q 1GUWA 1HUNA 2PEAA 3D4DA 3WALA 2NVYB 3HG9A 4GKJL 1A70A 4AQYL 4LNNA 3BVMA 1C4PA 2EELA 2PE6B 4KIKB 1FNVA 1TS5A 3P4SB 2KQSA 1YJIA 2H4OA 3DVNU 4PT5A 5K36H 3DUZA 1VQIA 1OO9B 2KDFB 4YT0B 2LVPA 1JWAD 3D3RA 3P4PB 2RD0A 2JRHA 1KRHA 4YTPB 3M4OB 4GGQA 3R66C 1G291 2B63B 1P1AA 2M0XA 2QDFA 1VQGA 5G55A 4AJWA 4IM2A 1CA6A 3I4NG 5EE3A 1KLUD 1UAPA 4HDQA 1F52A 1CHPD 4WAAA 2Y0SB 3N3KB 5H92C 1K73C 1WXQA 2K5HA 2NVQH 5IYBG 2IW3A 4A76A 1V1QA 2MH7A 3PT2B 4U68A 3FKIG 2KO3A 4FF3A 2DYBA 4YSYB 1E3PA 1WR6E 2J7ZA 3ENEA 2I5HA 2ZZPB 1N36Q 5C3EH 3CCEA 2BPSA 5E6JA 3I73A 3I57A 3DXJC 2M19A 3DM1A 4PS7A 2FCQA 3A5UA 4DXFA 3PIPA 3ZQ4A 4ACFA 2R93B 2PIAA 2FBWB 2G5DA 3GTPH 3BK1A 1G6JA 1MD2D 1EQRA 3I55A 1EY4A 1QLBB 4KX6B 2D3BA 3X3MA 4YHHQ 2G4SA 2ZM6Q 3NPPA 1GG3A 3MVVA 2K04A 4HTHA 1IBKQ 3KFUA 2ZVOA 3BJUA 4G3XB 2CWAA 2EJGC 1CM9A 2HQEA 3C1EA 4X64L 1E8XA 2QGQA 5C44B 3PSEB 4OZCA 3BS1A 2EY6A 4C3IG 2LWPA 2PQAB 3BZDB 1OEYA 1WE6A 3PPAA 3H6MA 4WQMA 4ANWA 3ZJVA 4MACA 2W82A 1PXUA 1X3EA 2Z0DB 4DV3Q 1WXAA 3D31A 4NB3A 3OOCA 3CMEA 1SFOH 3RZWC 3IFDA 1WTPA 2VZAA 5KIXA 1DJRD 5GADC 5AJ3L 1TZOA 3MXPA 2MNAA 5F2DA 2G4DB 2JVCA 1YHAA 3J81i 4HJ7A 3CC2A 1T0RC 5G5HA 4DV4L 2Z4IA 1KOTA 1N5XA 1Y14B 2B2YC 4Y52H 2FINB 2F0MA 2Z0SA 4OWXB 4AH6A 4AYBE 2J0MA 3I3TB 3A1QB 2LEKA 1SIFA 4XDDA 1DOYA 4A3GH 2QHOA 3QG1A 3A0JA 1HRJA 1S5BD 2YU9H 3N1ZC 5D7GA 4B3MQ 1GUNA 1A3TA 2KBNA 3PRZA 4WWOA 1PGXA 3LNNA 3OW2A 4WH4A 2MCNB 2L0FA 3N32A 4FHKA 1IW7D 2IX0A 3G71A 4FJZA 1MPEA 4NZLB 2VQFL 1ACCA 1O80A 4RA8A 4JI8Q 2MP2B 5M5WB 1E90A 1SROA 2H1EA 4A3BH 2EYJA 5BN4A 1MKHA 1L0WA 4FBJB 4JE3B 1CKMA 2DENB 2K5NA 1G51A 1AARA 1U4RA 4PYZA 4I65A 1Q1OA 3N20C 3ZGZA 5C4ZA 2WS3B 4LUVA 4XQNA 4C1NK 5BR8L 4DBGA 1QOBA 1XMQL 4O42A 1XLQA 1PUTA 3QAQA 1CMXB 1C76A 2AQ2B 3ERSX 3SDZA 2M0AA 1S72A 1IXRA 3NS1A 4DHZE 3KYDD 3ONSA 1MJCA 1TWGB 1BBWA 2WXFA 3ZTCA 2JYEA 1CZWA 3GTJH 1VQKA 1U4LA 5AZHA 3FC4A 3VQIA 1D6EC 1R7SA 1PTOF 5ELFA 3S1NH 3H7PA 1E1TA 1ONLA 2OWOA 1KLVA 1ENFA 1UBQA 2UUBQ 4H02A 2KMAA 3BY4B 3J7AF 4H2AA 1JCKB 2REXA 1TKEA 3GTMB 4OVUA 3ER0A 4WJOA 1WI0A 5IT9c 2PMZE 4HEA1 2AWNA 1IL8A 4A3EG 3LX0A 4IKGA 3NK9A 1KL9A 2R7ZB 1VQJA 1M4VA 3A5ZB 4WRDA 2MO0A 1MI0A 5FLXE 4CGYB 3UDGA 1VJKA 2KNBA 1YEZA 2MWSB 1V8CA 3RLFA 2HIVA 3CKIB 4EUTA 1WGRA 2A6EC 2XN9C 1XT9B 2V4IB 3DVGY 1C48A 3ULLA 2NZHA 1VQCA 1HJPA 3N30A 3J80c 2D5DA 2UUAQ 1J7CA 1XLNA 1YQBA 2L12A 2N9KA 4IURA 1JORA 1F9SA 1NI2A 2H88B 2HE7A 2HJ8A 1JQYD 4GOPA 2V0GA 3H8HA 2KK8A 2DHZA 3W5OA 2OJWA 1SNCA 3QWNA 5DNFA 1XX8A 1SJED 3I4OA 4A3KB 3K9OB 4C2MB 1I5FA 1BOSA 2R92B 2L76A 1QOAA 4K14A 2V3SA 4H0LC 4XDCA 4A3MG 1A2UA 2KN4A 1ML0D 2YYZA 5J2RA 3TCAA 3TP7A 3HOZB 2ICIA 2WP9B 1S5DD 4DUYQ 4XQJA 1UD7A 4GKKQ 2MBHA 3ABVB 4HPLB 2YTXA 1NBWA 2A19A 2M4NA 2KOLA 4NMZA 4FNFA 2KJHB 4PYUA 1JALA 3VR3A 2OCEA 1HQRD 2MW5A 4IJHA 1RF2D 1N36L 2JA8B 3U8ZA 2LGDA 2AUKA 4DV2Q 3V61A 3BDCA 3Q3OC 1C1YB 3S2HH 4ASWC 2KN5A 1R9TH 2VUMB 4W9HA 1C4QA 2BTEA 3I90A 4K6LA 3GO5A 1EEID 1VQNA 3PLUA 4YHHL 2JWZA 4M8NA 2IJ0A 2ZM6L 1QVFA 2JZ3B 3OWFA 2BYEA 3C3LA 1F0ZA 1IBKL 3S1MB 4HDOA 2IL8A 1D5XC 1L0XB 1O7YA 4ALPA 3Q6SA 3Q6BA 3UINB 4DAYB 1WIAA 1L1OA 4LJOB 3A33B 4A3IG 2EYLA 4L6TB 1V1PB 3GTKH 4IFDI 4CDDC 1NDDA 2RSUA 5GAEC 5G3LD 4L5RC 1JWMD 1YJ9A 3ZXVA 3HM6X 4DU9A 3NE5B 4DUZQ 3NY5A 5I2YA 4YTMB 2BE5C 3CAMA 4LDTD 1QNUA 1CKNA 1K83B 2LFNA 3BDOA 4RMFA 1WZ3A 2GVBA 3APFA 4MM3A 2A74C 2BB5A 4EOYA 2WNMA 1N8RC 1TVXA 4HRSA 4KDLB 2RVLA 2MBOA 3QIJA 3A8IE 4X66Q 3AEEB 3MWYW 4QUCA 2AWTA 1F9PA 3AU7A 5IGDA 1NTGA 2JYOA 2ZPNA 3HOVG 3SGIA 5CBEE 5I6YA 1VQ6A 5HKHA 2EQSA 4HWIB 4DV1Q 1RIPA 1H9SA 4W9DA 3VDYA 2E2HH 2LVOA 2D3AA 4DK5A 1STYA 4B3ML 2DY8A 2BOSA 1EFID 4KJOA 5C3WA 2ZXRA 1MGSA 3P1HA 1STGA 4P71A 2W3RA 3ZNHB 4I6NB 1JWSD 2JA7G 3L3OC 4BBRB 4RGNA 4ZRKA 1J8IA 2L15A 5C4JH 3STBC 5JEAH 4ANXA 3MXNB 4HIOA 1YNNC 2D10A 4JI8L 1FJGQ 1QF6A 5CV8A 1XMOQ 5E4WC 4HSVA 4PMBA 2I0QA 1I7HA 3V6CB 1P9DU 5E3FA 3VA7A 5CBAE 1RTOA 4D2KA 4A20A 5L83A 1QZEA 3DEOA 2E8GA 1O7IA 4ID6A 2K8BA 1RJTA 2WXKA 1SMYD 3KLSA 1GD7A 3S16B 3CPWA 2RGFA 1FMAD 2HCCA 2DNFA 4DR5Q 2WDTB 4DGZA 1VR9A 1T5XD 3PQIA 4LF6Q 1N61A 3RUZA 1O7LA 4N58A 3BZKA 2LRWA 2ON8A 5K36G 3QARA 3S17B 4HN7A 4KGSA 3AE8B 4FA6A 2G9DA 1LM8B 3RZDH 2ZT9C 5EKKA 5ELBA 1PTOD 2F52A 2XK5A 3A56A 2JZZA 3AM9A 3RNBC 2UUBL 1LT4D 1LACA 1T3QA 3IKJA 2PLPA 1HNZQ 2YLMA 1WRDB 4CJ0B 2ZVNA 2C7MB 1IL2A 3ZJTA 5FOBB 2FMMA 3RNEC 4ANVA 3K5NA 4IN3A 2K5VA 2YTYA 1OXTA 3J81j 4G7ZC 2WB1E 2BB6A 1F1HA 1QILA 1QUQA 4W9FA 1ZYRD 1LT6D 4PV1C 1JJCB 1OXVA 3JAML 5C3EG 4JBKA 2SDFA 4BBSH 4B6WA 3A4RA 4OZBA 2IYDB 2D2CC 4KKIA 5E6PA 3G6EA 2SAKA 2V1CC 1QVCA 1VQMA 1VQ7A 5JJLA 5IOCA 1OQYA 1GPXA 1E0ZA 3GTLH 1TWAB 2Q8IB 1DOLA 2OT2A 3SK4A 1R4QB 2INDC 1HQMC 3IBEA 5LXHA 4GZYC 2MP1A 3X0WA 1E9MA 3HHMA 1D7QA 3S1QB 3KBGA 5IYDG 3EHVA 4RF0A 2UUAL 4XYCA 1K8MA 1L1OC 2C7NB 4M0WB 3WDNA 3QC8B 3F8TA 1IKLA 1E2VA 5CHWA 1FPYA 2QSDA 3Q8CA 5A2QL 2KDBA 4F7XA 3HKZB 3K57A 4JIOU 1HNWQ 2A6HC 2O2VA 3GDEA 2V3PA 5JJIA 4IPDA 1MJDA 4HR7B 3H0GB 2CU3A 2F0FA 4X3KA 4DAPA 4ITKA 4FDBA 3R7RA 1XLPA 4L5TA 4DUYL 2PMVA 1RL2A 4IUPA 5CGKA 2L7RA 3I63C 4MJSB 1N6ZA 3Q8EA 4HJ8A 4FYDA 4B95A 4AP4C 3NVYA 1ICWA 3NEMA 2WXPA 1H9KA 1E2WA 1YNJD 3AU4A 5EBDA 4NQKE 4HJAA 3GTOH 3HOYB 4BY7H 2ONQA 4Z9CB 3NZSA 1SN8A 4YSZB 1B9NA 2DY7A 3Q69A 4FHJA 1A0IA 1EQTA 2Q5WD 5C4HA 4JI7Q 4A3GG 4TV3A 2F0KA 4LUZA 4DV2L 1ZEQX 2R7FA 4P16A 5GAHC 3I5JC 2NZOA 2LS01 4KLKA 1UNSA 3T16A 1IBMQ 2OJRA 4HCNB 2YV5A 2UUCL 2JEBI 4OWWB 4JI6Q 4MDKE 5EDSA 3B1LX 1E22A 3GOEA 4DR3Q 4DN4M 3JSVA 4ZYSA 3O13A 1UE6A 2MRPA 1XQQA 5IKCM 2GBMA 2LJIA 2Y5CA 3FAHA 4I7ZC 2NPTA 1JE5A 3IT4B 3ZNID 5BMIA 4A3BG 4QIWB 3S14B 2AL6A 3W1YA 4UP7A 4FF1A 3UE0A 1T5EA 1XWEA 5CORA 2D62A 4C1NI 2P5ZX 4DUZL 1EEFD 2QW7A 3VUYA 3ERQA 4GDKB 4BKSA 4LWCA 1ZW7A 1ENCA 3CCLA 2CKZB 4XGAB 1TT2A 1WFQA 1IPGA 1PDXA 4X66L 1AFPA 5J1ZA 2LUEA 1L6VA 1Y1VH 1TY0A 2FAZA 4K3BA 1JR0D 3ZJYC 2JK8A 1G91A 5BMHA 4DV1L 2RMMA 1WTOA 4W9KA 3LGJA 5CYUA 4CKCA 1GJXA 2ZCCA 1I4HA 1VF7A 2N55A 3S2AA 1EYCA 2EYFA 4JI0L 3ULPA 3DWPA 1DOXA 4RGTA 1I35A 1OEYJ 3PV1A 5E6NA 1AYFA 1H95A 4Q2JA 5IT9L 3L2PA 4IC7B 4AWJA 3I70A 1PDQA 2KCCA 4UPAA 1C79A 1I4PA 4BWGB 4PNYA 4BKTA 3NZ3A 3D4RA 1LO5D 3TZDA 1FJGL 1E7UA 1XMOL 4K8JA 3DHIC 2LD9A 2NBFA 5IODA 4B0MA 4BY1H 1B50A 4QY7A 3I4MB 4ABNA 2F0TA 2UXDQ 2N0SB 1Z2MA 3E6ZX 3B6YA 4HMIA 2JA5B 1FXAA 4HJGE 5JJKA 1HA6A 4IFDG 1I50H 5T8IA 1ZDXA 1SYCA 2IX3A 2LI5A 1L5PA 3CC4A 3VR2A 1BQQT 1C3TA 5AEKB 3G4SA 2LXJA 4DR5L 1WGDA 4FP5D 3VR6A 3SVMA 3EFCA 4BOZB 3UF8A 3DDCB 1J9OA 4LF6L 2LY7A 3MEHA 3W3AA 4A3OA 4DR4L 3L9AX 4L23A 1ENAA 2IY0B 2JYTA 4ZKCB 4A3JB 1QCBD 4IJLA 3TEHB 1STBA 1SIJA 1AZQA 2BDNA 3ND8A 2GI9A 3AV8A 1M90C 1BBUA 1CZPA 1B4OA 4FXDA 2EY2A 1NEKB 2ZW1A 1TIFA 1ZDVA 2PNHA 1EUJA 4DK3C 4IOAA 1JROA 2WXRA 2EYOA 3Q22A 2CH4W 4MGYE 1PFBA 2K7VA 2MHJA 4DQOC 1HNZL 3U50C 4PQXA 1YNXA 4IM0A 1J8CA 2BYTA 4C3HH 1HZBA 4A3EH 4KK7A 1ESRA 3U58A 2QA4A 1A5RA 3EFUA 2AX5A 4FJYA 4IWPA 2K0PA 1UF0A 3RZFA 1Q0WB 3GTGB 2N4FA 4M8MA 2ZTEA 4ZCKA 1KF6B 2GOWA 2BH8A 4WURA 3C46A 2F0NA 2RDHA 2C60A 1M1KC 2ZJDA 1BO0A 1HXYD 2UWQA 5IE8A 2KJXA 2BH2A 3Q14C 5C4XH 5HURA 2WDVB 3R3OA 2A73B 1XPUA 1T0QC 2JZPA 2RDBC 4KZ0A 5GMVA 1MHXA 1Y56A 4NXMQ 3CRKC 3FP9A 3NVZA 1EY7A 1L0VB 3NBHA 1SE4A 5HGQA 4ZAIA 1VQFA 3VYUA 3X3NA 2PI2E 1EUVB 3VYRA 3QK0A 4JX1C 3CXCA 1IYFA 1PH8A 2EXDA 4YCWA 1ILQA 1N9WA 1ET6A 4RMAA 3SR6A 2CW0D 2VL6A 4YY3Q 4EQOA 3K7AH 5A35A 3TS2A 1HNWL 2CKHB 3RI7C 2PW5A 1KRSA 3UDIA 3PHXB 3D8GA 1I6HB 2VB3X 1UH6A 4IDIA 1GHJA 3I7FA 2SEBD 2PVOD 2M1MA 1YBYA 2F0SA 3HOUG 2WFWA 1Z47A 1RDPD 4IW0A 4R4QA 2J0JA 3VTUA 2Q2TA 2BDOA 1WX9A 1A3VA 1ZXHA 4B3RL 3NENA 2KVZA 4I7AA 3P7JA 4PZ8A 2MBEA 1J5EQ 4B3SQ 1UZXB 3QIAA 1XF5L 4W9LA 2C5CA 2RF4A 4DDID 3TDQA 4WJQA 5JPNC 2L1BA 3M7NA 1UWXA 1V49A 3AEBB 3JC66 4EX5A 3NQIA 4JI7L 4A3PA 1SE2A 5K5PA 3RT3B 1JMCA 3AULA 1IBML 5EE0A 4E74A 2F0WA 1N5WA 4JI6L 5KHQA 3A74A 2ICEC 1PFSA 1Y1WB 5E1FA 2F4IA 5IWAQ 4DR3L 5IO9A 4TRDA 2WKDA 3OTOQ 3K5LA 5IP9H 3MFGA 4A93B 4A3IH 4C56C 1EO6A 5JEAG 2RDFA 4ODGA 4BAXA 2LFIA 1Z9FA 5M5XB 3DHGC 1BCPB 4C80A 3A9KA 1TWCB 2D11A 4ZRPA 2XSCA 2JQOA 1SXTA 1R4PB 1II3A 2VUMG 4YWMA 1NR2A 4Y7NH 4OX9Q 1PYSB 2KDEB 4W9EA 3K7UC 1WH3A 1FEHA 1NENB 4M1UB 3AI5A 2OEOA 4W9CA 2IY1B 4IOIE 3KOJA 4IO9A 4HKZE 2OTJA 2E76C 1PH4A 2KC1A 5FR3A 3SU8X 3ML8A 2EYHA 1KHIA 4G4KA 4MEMA 4TUUA 2WDQB 2KVRA 3ML9A 1TQOA 1JJ2A 2UXCL 2LGXA 5DM63 1PFNA 1EWCA 4HJ5A 2JF5A 2KHWB 1Y8PB 2ZXPA 4MTNA 3GD7A 3H7PB 3VH4B 2HHHQ 3HM3A 1T9HA 1XPRA 2B2TA 3AMUA 1UUPA 2B2WA 3ETRA 1QJOA 2CU1A 3DOWA 4JYAQ 1KIXA 4H7BA 1NBFC 3K81C 4JC0A 4UY8C 5IP4D 3HKSA 4TQUS 5J39A 5ELOA 5FLXc 2KDMA 1P8LA 3VVWB 1WYWB 3O65B 2F3IA 4BBSG 3AMZA 2L4NA 3PCOB 2KXJA 1QVGA 1WY8A 2UXDL 1EY6A 1AE3A 2CHBD 4RCOA 3CCRA 1QT9A 2KACA 2OHFA 4OVZA 1L6UA 1XCQL 2VZKB 1DM0B 3NBIA 1PRTB 4ULLA 3AE3B 3RNGC 1EU4A 2VH1A 1ZGUB 3NJTA 4HLEA 2WXNA 5IP7H 1WRIA 2L0TA 4KI0A 2JA9A 3S9WA 2E2IB 2RSNA 3VFKA 1SNMA 1EIFA 4TQ1A 5CV9A 3M3JA 4AYBB 2RA4A 1N32Q 3CCSA 1J0GA 2JA6H 4DXAB 1EZ8A 3HK0A 1QB5D 3IG3A 3L4PA 5G5GA 4QUFA 3DBHB 2L05A 3PO0A 1MG4A 1OXSC 3UIOB 1N63A 1YI2A 3PUZA 2QDBA 3V3XA 1M8AA 2AKWB 2F0IA 1PTOH 4E71A 4IFDJ 3TUOA 5J17A 2LRUA 4ZRIA 3DVNV 1I3QB 4KHVA 3EUB2 3KYHC 2PCFB 3J7YW 4A3FH 1E6EB 1N34Q 2PNRC 3PO2H 1F2RC 3H3VI 3KLRA 3RN9C 4XT1B 4BFRA 4BY7G 2PPHA 1HH2P 2XBBC 2DUDA 2Z8LA 5EGTA 1EIGA 2ID0A 5IYDH 3RZOB 2L83A 3S2DB 1BR9A 5ELNA 2K6AA 1EFWA 3BIID 3IAM1 5FR6A 2I5MX 2DLBA 4KSKC 4X6AH 4K7SA 2RHQB 1R4NB 5M3FH 2QCPX 1DZ1A 5JXVA 3E9IA 1RLFA 1ET9A 2XNAC 4DHZB 1HR0W 1D8LA 2NVYH 1WMHA 4N9TA 3AE1B 1WD0A 4MGIE 3T3OA 1GUSA 5G3LF 4IQZA 1MSGA 1KRTA 2KQ3A
chains in the Genus database with same CATH topology
3E9SA 4WORA 1I4XA 2NTTA 1VLBA 1K52A 1SEBD 2R3ZA 3OMGA 1VZ7A 2DWQA 2WU5B 2WINB 4QF4A 3D6CA 4J3OD 1AWDA 4MM3B 2F0PA 3KLSX 2PMZB 3MJ5A 1HFGA 2NMQA 3TP6A 3GV3A 1D2BA 2QJLA 2I38A 3ITPA 1VZ8A 5AFWA 2WQYB 2B2TC 2B2WC 3A7LA 2A68C 1C8CA 1IUEA 3OIQA 5EJWA 3NRZA 4ZUJA 1WTQA 4C3JG 5C2TB 2X6LA 1VMPA 3FILB 5BYQA 3M4YA 2JP1A 2X69A 1PZKD 1JB3A 3CIRB 1BBXC 2V3NA 2CQAA 1BCPF 1IHZA 3HOWB 5M3MB 5M5YB 1SNDA 3K59A 1I4QA 1K50A 1KTKA 3G6JB 2IX1A 3HZXA 3HOXB 2NWGA 1S5CD 3FRPB 5M9OA 1GUTA 5DEHA 5JEAJ 3PIO3 3M3YB 3Q8BA 3PO3B 1BNZA 3SK5A 3MC0B 4DK1A 1FGBD 4RGMA 5LL6S 1YN3A 3NVWA 3LWUA 5C0XI 2E2JB 1WCMB 4R3DA 1YJJA 4OO1I 1RYJA 1STAA 4C3HG 4NAWB 1QNKA 2X6GA 4L2YA 1FO4A 4KKSA 4UDUC 3VR9B 2E6XA 2LKVA 4IFDH 2NYZD 4K2LA 2FFKB 1CA5A 1Y69U 1EY9A 1OQRA 3W5VB 5IIFA 5BYSA 4DXGA 3B2FA 1HZ5A 4A3DB 1BUVT 1HTPA 3GS2A 1JOKA 3C8YA 2PW7A 1GB1A 1Q1BA 2IPKD 3FMCA 1ZPSA 3RD4A 3TSSA 4ZHPA 2OXPA 3S15B 2PZUA 3IL8A 2QILA 2W54A 5AUKA 5IGEA 1N60A 1KLGD 4DFAA 2NN6I 3SHLA 2WXLA 4MHEA 1PGAA 4YWGG 2I2YA 2XVSA 1FNWA 4N9PA 1QOGA 3LWEA 3GV6A 1FRRA 4HSPA 2SNSA 4YXDB 4XYOA 1E10A 3CU7A 4CQNA 2E3TA 1WTRA 1HUMA 3QB3A 4NJCA 3U4EG 2K28A 3OSOA 4NW2A 1JE4A 1I4GA 5I9OA 3L7ZC 2KAJA 3U9OA 3OIPA 3NHHA 2F1MA 3TZUA 3I3CA 1XO3A 3HGBA 3DHQA 3JAME 1K53A 2TMPA 5D3DA 1E7PB 2WACA 4L8JA 1EOTA 5KYLA 1SMYC 2F0HA 2L5TA 3AECB 1F77A 4OGQC 5IGCA 3TEZA 4AQ7A 1V8QA 4IALA 2WB1B 4BS9A 1JWBD 1CHQD 2QIEB 2N7JA 1ESFA 3MAQA 1PTOC 4ARCA 5A2QE 1RCVD 5T1GA 1AEXA 1FR3A 2PZWA 2F03A 4HCSA 3I8ZA 4KGTA 2KCNA 3GP7A 1YMHE 3NVVA 2FUG1 3NQTA 3KK7A 3LB8C 3K6OA 2WV6D 3NUHB 3V05A 4KY7A 1IBXB 4F8MA 2ACZB 1VCIA 4RH6A 5I6WA 2CVRA 4IUUA 4RFBA 1BCPD 3SK6A 2O2LD 1TWFB 5GXGB 3HEJA 1VF5C 2FMCA 4G7HC 2JEAI 2BW2A 1TS4A 3HUIA 1EU3A 4V190 1LABA 3I4NB 4M8AA 1LV9A 2BE5D 3HS0C 3FKIB 5EQ0A 3WOFA 5LL6X 1B53A 1XYIA 1C4CA 2R6GA 3OPOA 1YN5A 4JWUC 2J0TD 1D5MC 4YIJA 2O5IC 1B3AA 3KQ4A 3HVDA 1F2YA 1YNJC 3S1RB 1RM6C 4CBVA 2B2UA 1A15A 1EZ6A 1IYVA 3GTQB 3NUCA 2A69C 4DNRB 5JVG3 2SOBA 4HCEA 1RTNA 1AW7A 4KTAA 4WJWA 4OZAA 4C3IB 3F2UA 4ZUIA 5IT9E 3NP8A 1QOFA 2VZKD 3C2PA 4LJZC 1PRTD 2LMCB 3DWGC 1XXGA 1J7BA 2M9VA 2OEDA 1I4RA 1FD7D 4GDLB 3AB5A 3EVQA 3E0JA 2RPVA 2WLBA 1G2SA 3IAS1 4IUVA 3J80E 2WXQA 4KN7C 1LTAD 2KEDA 4ZKBB 2EOTA 1C78A 4X3SA 1YNTE 1U4MA 1U9RA 2AQ1B 4KY5A 3D4WA 1GB4A 4GLSC 1WYGA 1SYDA 3MXGA 2IGHA 3PZ7A 2K33A 1JQ4A 1A6XA 5CV4A 1LT5D 2F0OA 4DA2A 4US9A 3PIP3 4B0EA 1OXUA 2L1AA 3VR4A 2MJDA 1SJHD 1F2LA 4DAYA 1OFFA 2SNMA 1B1ZA 3NWSA 2WXOA 2PO4A 4CJ1B 4WFN3 4R9WA 1V1PA 3HP3A 3BVGA 3K0YA 1EQVA 4JWSC 5EKLA 1DD2A 2XWJB 1PYWD 2NN6G 1HTLD 3U9SA 2JQRB 1B9RA 1EL0A 1H9MA 2PVGC 3TMEA 1EWYC 1X32A 2IGDA 2ZXOA 4FXCA 3QO2A 1G2TA 5LNK1 4H13C 1A3UA 1SYEA 4KD4A 3AE4B 1QQRA 2J4XA 5D3IB 2FJ2A 2EVBA 5FO7B 1W6KA 2F0VA 3PZ8A 4FF2A 2AQ3B 3Q8AA 2L11A 5C5LA 1CTMA 3MXNA 3AEFB 3J80L 4A55A 1C9FA 1L4DB 1KNAA 3VA5A 1FFUA 1FNUA 3IT6B 4USAA 3TP5A 3U7ZA 5KGUA 2N88A 4RAUC 5EE1A 1O7ZA 3C1FA 2K05A 1YQ4B 3M85A 4A3MB 3MA2B 1SNPA 2JXTA 1TWHB 3CQZB 4FXGC 4X3UA 3H91A 3T4AC 3DWAA 2EJFC 2K1BA 3UI3A 1JMLA 3BK2A 5JOBA 1SE3A 2EY1A 2JX5A 3OHXC 1PZJD 4Q0FA 1B2TA 3AE9B 2HUGA 1P7FA 1SAPA 4MH8A 3WCQA 3E5SA 3NTKA 4IUTA 1NYQA 2VXWA 5IGBA 1F9RA 1D1KA 2DNCA 1Z6HA 3PUYA 2WXMA 3CWIA 2Z4HA 3NTHA 1F2ZA 1LTSD 1JWUD 3SXHA 1MVKA 1VDVA 2Y5PA 3E56A 1QE6A 3H94A 5ELCA 4A3IB 1SSOA 3VR5A 4JK1C 2BS3B 1KDCA 4X3TA 1PFMA 2KEEA 2J42A 3P75A 5KNBA 4ZRZA 4XIGS 3DWQA 2AUJD 1K51A 1FFVA 4M0WA 5BYRA 3DEPA 1B44D 2PZTA 3HOVB 2K32A 2NVXB 2KHSA 2O4XA 2WXHA 5CMDA 1PMRA 1S4ZA 4ZOHC 3AE7B 2VNUD 3DWMA 3AEDB 2L32A 4US8A 3T3OA 2NVTB 1MI2A 4L1BA 5H8YE 2JA7B 2F0UA 3R8BA 3SEBA 3KF8A 3OMCA 2NZ1D 2BS2B 1KAAA 1DOMA 2EPBA 3I4LA 2W55A 1EYAA 2JXMB 2JU6X 2E2DC 3A7AB 3HVZA 3K5MA 2MGSA 4C7ZA 1ZUD2 4A8XC 3VRBB 2JSVX 2BS4B 1CT1D 1J7AA 2ZW0A 4CKEA 1EWHA 4ARIA 3SFDB 5EPJA 3EGRA 2Q8RE 1AZPA 4LAAA 1IKMA 2HTME 5JVH3 5HFYA 1PFDA 2NVQB 4LMQD 2QEJC 4F87A 4IUNA 3PUWA 1Y8NB 4LK0M 4N59A 2MEKA 3RPFC 2K03A 5C3EB 4WWMA 2K5PA 4XWWA 2KECA 5HGTA 3GTPB 4V0BA 4UAIA 3AH7A 2IWHA 5KNCA 4J8QA 3NTIA 2C9OA 2EXZA 4RKLA 3TP8A 1F9QA 4KKJA 4RHRA 2B76B 2B39A 4RWSC 3J7AV 3FEWX 5HG2A 4N6EB 3G7LA 1GUOA 4BA1I 1PZID 4ZQ3A 1SFOB 5IGGA 3D6WA 3A55A 2WDRB 2M00A 4YTNB 5MPOA 4TMAB 4NKLA 2XRQD 2WIIB 1TR5A 1QKZA 2G1EA 4O1NA 3URYA 3VRAB 5ELDA 1X3QA 5KEEA 3Q8FA 3AEAB 4A3GB 3R2TA 5CV5A 1NCVA 2YU9B 1HFNA 2WKCA 3Q23A 5HI1A 4J1MA 1H9JA 3PUVA 5DAUA 5KNDA 1SDFA 2F3WA 1IW7C 1W6JA 3T53B 2MJEA 2JSOA 3DMUA 4DNTB 5C3JB 1GHKA 4A3BB 3HRDD 3AEGB 4RNAA 3HRZC 1HZ6A 2B2VA 2PW9A 3IXSA 2I07B 3NSWA 1IYUA 2RQXA 5EE9A 1JC7A 2V4DA 3R93A 4ZLTF 4RF1A 1IGDA 4ZRQA 5C0XH 4WAFA 1Q1EA 1CI3M 3TBIB 4OO1H 3GTJB 2XWBB 3OWEB 2WXGA 3S1NB 5CC4A 4XDXA 1H9SB 1PGBA 3NXWA 2DNEA 2MUYA 4B9WA 3IAYA 2PPBC 1XEEA 2K5WA 2D5GA 4XWTA 2M56B 1SNOA 4CJ2C 1FRDA 2FHTA 5HHDG 1STEA 4IZ8A 1NSNS 4RCNA 4C7YA 5TSSA 2Q8TA 1IGCA 4JBWA 2D9UA 3PV0A 3MHZA 4YSXB 2KMMA 4R8NA 2HDEA 5KYIA 1LT3D 2OF1A 4EQPA 3ZYYX 5FO9B 4PMCA 4HROA 1TS3A 4A6QA 2NN6H 2EY5A 1SF0A 1S5ED 5FKAC 1SBBB 1KH0A 1ZXTA 5I9PA 3BDLA 1EY5A 1PLFA 4IUQA 1ZE3D 1HPCA 1FCLA 2L0CA 2VB2X 5I2XA 3BYYB 1DYQA 4JPSA 2DBYA 1NAPA 3AB9A 3H09A 2G9HD 3NWTA 4LLGM 4EVOA 2F0DA 1B9MA 4FVMA 3ZJUA 3S2HB 2A68D 2O5JC 1R9TB 4DK0A 1CK1A 1STNA 2AWOA 4OIJA 1DCZA 1FM0D 3A8KE 3UI2A 2EJMA 4AS1A 1TIID 1WTWA 1SB3C 1NUCA 4MN3A 1PRTF 3QJYA 1CJEA 4A9AA 2B2VC 2F0EA 3KUPA 3GTKB 5D65A 1KDBA 2BT6A 1VMCA 2EZVA 1EM7A 2I46A 2HDMA 4QCLA 3HOUB 2DYOA 1HCZA 4KKUA 4FF4A 3VR8B 4QB4A 3V96A 4K5XA 1DXMA 1VZ6A 3W1SA 3H3VC 4RGOS 3KWVA 4G57A 3N9YC 4DAVA 3EROA 1UWMA 5CV7A 1E0BA 2E2HB 3BG3A 1P7EA 2K01A 2IDYA 1CQFA 3AE2B 1WD1A 3T13A 2Z1CA 5C4JB 3FDTA 2KWDA 3P63A 3WOEA 1SYFA 1X3PA 1VRAB 3MTSA 4EGVA 4XE0A 4OIKA 1Q12A 2PQEA 1AN8A 2F0LA 3A54A 1D4BA 1JOOA 2BCOA 5CV6A 3GB1A 2A6ED 3P42A 3I9V1 1WSPA 2RDGA 1HEZE 2K9XA 3SK8A 2KVMA 1N62A 1OQQA 1I6VC 1BCPC 1TYGB 4E6IA 3EFXD 4BA2I 4KGRA 1LTGD 2F3VA 3GQBA 4QMGA 1EY8A 3P4QB 3RZDB 3KWLA 2M2LA 2K5QA 4EQNA 4B08A 2HCIA 1BXTA 1RODA 5E4XA 5AUIA 3FPPA 1FXIA 4U673 3CRLC 5FLXL 1DOKA 2XIWA 2NUCA 2R61A 2MJ8A 4Q5VA 4BBSB 5ISRA 1ZYRC 5KRUA 1Q3LA 1MSHA 3EQLC 3GTLB 4FXKC 1EIHA 5D14A 3FILA 3TN2A 3W2DA 5EKIA 3VYSA 3AE6B 2NB0A 1RHPA 1RKNA 1RWSA 1KDAA 5BN5A 3ND9A 1PRTC 2K5DA 2QKIC 1BUIC 1S5FD 1ZP0B 3MXUA 3RMHA 5BMGA 4XXEA 3LXFA 5T1IA 2CJNA 5C5MA 2PTLA 4KKTA 2INNE 3GTOB 4BY7B 1O78A 1C77A 2Y3AA 2YEPB 4K6DA 5LHY1 3W5UB 4XYQA 2CJOA 1TKYA 1MBYA 1YNND 1ILPA 2PYKA 4DF7A 3SFEB 4NP5A 1LTTD 2X38A 4XT3B 1NVID 3Q0AA 4KMUC 2J53A 5EBCA 1V43A 4EE2A 3BYTB 2B8FA 4REZA 3ONAB 1E2ZA 1V97A 4G7OC 1JICA 3B2GA 3MHBA 1JRPA 2GRIA 5C0XG 4CKBA 1Y1VB 4OO1G 1SNQA 1U4PA 1WTVA 1V1OA 1BDOA 1TY2A 1Z7TA 1ZOYB 3QOJA 3P20A 4RHSA 2NTSA 4FO2A 2WP8J 4C3JB 1LTRD 1Q90A 1JOQA 5JPMC 4ZK9B 3K58A 2ENBA 4WIPA 3SR1A 2IGGA 4MIUA 4BY1B 1NI3A 2A69D 4TKOB 4ZHOA 4LTUA 1K8OA 1I50B 3A8JE 1OXXK 3KBXA 4XQQA 2RKSA 1F2MA 1SYBA 3RFZB 3N6RA 4MT5A 1TJEA 2A6HD 1CZGA 2E75C 3R2IA 4KN4C 3N52A 2JE6I 4KY6A 1KFYB 2WXJA 2F0JA 1SSNA 3T3NA 2KUMA 1FD6A 1XCTL 4C3HB 4A3EB 2BA0A 5DM73 1CFMA 2B2UC 1BMLC 5FO8B 2BA1A 1ROEA 2BBCA 1MHHE 4H44C 2INPE 2XRSD 1Q8IA 1STHA 3B9JA 1G6ZA 5C4XB 4HAEA 1LLRD 5ELEA 4KHZA 3I91A 1CQVA 1DOIA 2EYMA 1GUGA 3LYYA 5C3XA 2MPMA 4R8IA 1IBXA 4ILWA 2GB1A 2WU2B 2H89B 3V2TA 1GXDC 1SYGA 1TS2A 2QMTA 3K7AB 2CW0C 2A5HA 5I4DA 2E74C 3TEXA 3W9CB 1JW9D 3T51B 4TQ0A 2DN8A 4TSSA 1A2TA 1YN4A 1RD9D 1VDZA 4XTCS 1BF4A 3U52E 1TKWB 4NDXA 2KQ4X 1UGJA 1WVLA 1QOHA 4OHJA 4KV6A 2WXIA 1TU2B 3TEWA 3MFYA 4J6HA 5FK9C 3BWUD 1WWTA 2EDGA 2B8GA 2EE1A 3P1MA 2YEPF 3PMFA 1WTXA 1ZXIA 4CHTB 1TKGA 2F0QA 2K22A 1FCCC 2J52A 4B9XA 1L0YB 4HEDA 4PMWA 4L63B 1QG7A 1XLOA 5JAVA 3AN1A 3PUXA 1F2RI 4A90A 3Q24A 1L4ZB 1RFKA 3EJIA 4Y7NB 4NAMA 5C6AA 5IGFA 1ZKOA 4KD3A 1KNEA 3TEYA 3MP9A 2LMCA 3J81E 1DGJA 1KABA 2IT1A 1WGKA 2L52A 4LK1C 3CHBD 3K5OA 1HA5A 3MZ5A 1LTID 3BVZA 2MHVA 3I72A 1Y8OB 4KJNA 1UEAB 5NUCA 1DONA 2FE8A 1T6BX 3QOLA 1NYRA 5BN3A 4RKBA 3FPUB 1C4AA 5JJZA 1NR4A 4HMJA 2TSSA 2PKOA 2F0GA 3VYTA 5CR3A 2HDLA 5C0XJ 4HKQA 1D5ZC 2RSOA 3AE5B 5COYA 2LGIA 4P2CB 2LHEA 2RBMA 2N9LA 1EYDA 2GA4B 3T56B 4F88A 3J9CA 2WAQB 2QF7A 1Q10A 2MJ3A 2L55A 1HHVA 3U2SC 3IFTA 2KA7A 5EPLA 2EYPA 1GOZA 1D1IA 3SE0A 2K3UA 4OW0A 2JA6B 4P6VF 4K2KA 3EA6A 2L9HA 4K5VA 1AP0A 3P4RB 2EKIA 3M7GA 1EY0A 1FIQA 1G8ZD 1PTOB 3OW7A 2B2YA 4K8IA 2DYMA 4A3FB 3FVQA 1LTBD 1YQ3B 1QWYA 3PO2B 2W3SA 5J22A 1XTCD 1GAQB 1H9RA 4S3SA 4OL7A 1FYCA 4ME5A 4K5WA 5EPKA 3J81L 2LUMA 2LHDA 5M3FB 2JWUA 1GUWA 1HUNA 3D4DA 2NVYB 3HG9A 1A70A 3BVMA 1C4PA 2EELA 1FNVA 1TS5A 3P4SB 1YJIA 2H4OA 4PT5A 5K36H 3DUZA 4YT0B 1OO9B 1JWAD 3D3RA 3P4PB 4YTPB 1KRHA 3M4OB 1G291 2B63B 1CA6A 5EE3A 1KLUD 1UAPA 1CHPD 2Y0SB 5H92C 1WXQA 2IW3A 2MH7A 4U68A 4FF3A 4YSYB 2J7ZA 5E6JA 3I73A 3I57A 3DXJC 2M19A 3DM1A 4DXFA 3ZQ4A 2R93B 2PIAA 2FBWB 3BK1A 1MD2D 1EY4A 1QLBB 4KX6B 3X3MA 3NPPA 3MVVA 2K04A 4HTHA 2EJGC 2HQEA 1CM9A 3C1EA 4OZCA 5C44B 3BS1A 2EY6A 4C3IG 3BZDB 3H6MA 4WQMA 3ZJVA 4MACA 2W82A 1PXUA 3D31A 3OOCA 3IFDA 1WTPA 5KIXA 1DJRD 1TZOA 3MXPA 5F2DA 5G5HA 2Z4IA 1N5XA 2B2YC 2FINB 2F0MA 2LEKA 4XDDA 1DOYA 3QG1A 1HRJA 1S5BD 5D7GA 1GUNA 1A3TA 1PGXA 3LNNA 4WH4A 1IW7D 2IX0A 1MPEA 4NZLB 1ACCA 1O80A 4RA8A 5M5WB 2H1EA 2EYJA 5BN4A 4JE3B 1U4RA 4I65A 3ZGZA 5C4ZA 2WS3B 4XQNA 4C1NK 1QOBA 4O42A 1XLQA 1PUTA 1C76A 2AQ2B 3SDZA 2M0AA 3NS1A 1TWGB 2WXFA 2JYEA 1CZWA 1U4LA 3FC4A 3VQIA 1D6EC 1R7SA 1PTOF 5ELFA 1ONLA 1ENFA 3J7AF 4H2AA 1JCKB 1TKEA 3GTMB 4HEA1 2AWNA 1IL8A 3LX0A 4IKGA 3NK9A 2R7ZB 1M4VA 4WRDA 1MI0A 5FLXE 4CGYB 1VJKA 1V8CA 3RLFA 3CKIB 2A6EC 2XN9C 2V4IB 1C48A 1XLNA 2D5DA 1J7CA 2L12A 2N9KA 4IURA 1JORA 1F9SA 2H88B 1JQYD 2V0GA 3H8HA 1SNCA 3QWNA 5DNFA 1XX8A 1SJED 4A3KB 4C2MB 1BOSA 2R92B 1QOAA 4K14A 4H0LC 4XDCA 1A2UA 2KN4A 1ML0D 2YYZA 3TP7A 3HOZB 2ICIA 2WP9B 1S5DD 4XQJA 3ABVB 2KOLA 4NMZA 4FNFA 1JALA 3VR3A 1HQRD 1RF2D 2JA8B 2AUKA 3BDCA 2VUMB 1C4QA 2BTEA 4K6LA 3I90A 3GO5A 1EEID 2IJ0A 3OWFA 3C3LA 1F0ZA 3S1MB 2IL8A 1D5XC 1L0XB 1O7YA 3Q6SA 2EYLA 4L6TB 1V1PB 4IFDI 5G3LD 1JWMD 4DU9A 3NE5B 5I2YA 4YTMB 2BE5C 1QNUA 1K83B 2LFNA 3BDOA 2A74C 2BB5A 2WNMA 4HRSA 1TVXA 2RVLA 3A8IE 3AEEB 3MWYW 4QUCA 1F9PA 3AU7A 5IGDA 2JYOA 5CBEE 5I6YA 1H9SA 1STYA 2DY8A 2BOSA 1EFID 4KJOA 5C3WA 2ZXRA 1MGSA 3P1HA 1STGA 2W3RA 1JWSD 3L3OC 4BBRB 4RGNA 1J8IA 5JEAH 1YNNC 1QF6A 5CV8A 1I7HA 5E4WC 4HSVA 4PMBA 5E3FA 3VA7A 5CBAE 1RTOA 4D2KA 3DEOA 4ID6A 1RJTA 2WXKA 1SMYD 3KLSA 3S16B 1FMAD 2HCCA 4DGZA 1VR9A 1T5XD 1N61A 3RUZA 1O7LA 4N58A 2ON8A 5K36G 3S17B 4HN7A 4KGSA 3AE8B 2G9DA 2ZT9C 5EKKA 5ELBA 1PTOD 3A56A 3AM9A 1LT4D 1LACA 1T3QA 3IKJA 2PLPA 4CJ0B 3ZJTA 5FOBB 2FMMA 3K5NA 4IN3A 1OXTA 4G7ZC 2BB6A 1QILA 1ZYRD 1LT6D 4PV1C 1OXVA 3JAML 2SDFA 4OZBA 4KKIA 2D2CC 2SAKA 1GPXA 5IOCA 1E0ZA 1TWAB 2Q8IB 1DOLA 2OT2A 3SK4A 1R4QB 1HQMC 4GZYC 2MP1A 1E9MA 3S1QB 3KBGA 4RF0A 1K8MA 3WDNA 1IKLA 1E2VA 2QSDA 3Q8CA 5A2QL 4F7XA 3HKZB 3K57A 2A6HC 2V3PA 4HR7B 3H0GB 2CU3A 2F0FA 4X3KA 4DAPA 4ITKA 1XLPA 2PMVA 4IUPA 5CGKA 3Q8EA 4FYDA 3NVYA 1ICWA 2WXPA 1H9KA 1E2WA 1YNJD 5EBDA 3HOYB 2ONQA 4Z9CB 4YSZB 1B9NA 2DY7A 3Q69A 2Q5WD 1EQTA 5C4HA 2F0KA 1ZEQX 4P16A 2LS01 3T16A 1UNSA 2JEBI 4DN4M 4ZYSA 3O13A 2LJIA 2Y5CA 3FAHA 4I7ZC 3IT4B 5BMIA 4QIWB 3S14B 4FF1A 1T5EA 1XWEA 5CORA 2D62A 4C1NI 1EEFD 3ERQA 4GDKB 1ENCA 1TT2A 1PDXA 1AFPA 5J1ZA 1L6VA 1TY0A 1JR0D 1G91A 5BMHA 2RMMA 1WTOA 5CYUA 4CKCA 1GJXA 1I4HA 1VF7A 2N55A 1EYCA 2EYFA 1DOXA 3DWPA 4RGTA 1AYFA 4Q2JA 5IT9L 3I70A 1PDQA 2KCCA 1C79A 1I4PA 4BWGB 4PNYA 3NZ3A 1LO5D 3D4RA 3TZDA 4K8JA 2NBFA 5IODA 4B0MA 1B50A 3I4MB 4ABNA 2F0TA 2N0SB 3E6ZX 4HMIA 2JA5B 1FXAA 4HJGE 1HA6A 4IFDG 5T8IA 1ZDXA 1SYCA 2IX3A 1L5PA 3VR2A 1BQQT 4FP5D 3VR6A 3SVMA 1J9OA 2LY7A 3MEHA 3W3AA 3L9AX 4L23A 1ENAA 2JYTA 4ZKCB 4A3JB 1QCBD 2GI9A 1STBA 1SIJA 1AZQA 2BDNA 3ND8A 3AV8A 1CZPA 1B4OA 4FXDA 2EY2A 1NEKB 2ZW1A 1ZDVA 1JROA 2WXRA 2EYOA 3Q22A 1PFBA 2K7VA 4DQOC 4PQXA 2BYTA 4KK7A 1ESRA 2AX5A 2K0PA 3GTGB 1KF6B 4WURA 3C46A 2F0NA 2RDHA 1BO0A 1HXYD 2KJXA 5HURA 2WDVB 3R3OA 2A73B 2JZPA 1MHXA 1Y56A 3NVZA 3CRKC 1EY7A 1L0VB 3NBHA 1SE4A 4ZAIA 3VYUA 3X3NA 4JX1C 3VYRA 1ILQA 1ET6A 3SR6A 2CW0D 4EQOA 5A35A 2PW5A 3D8GA 1I6HB 2VB3X 4IDIA 1GHJA 2SEBD 2PVOD 2F0SA 1Z47A 1RDPD 2BDOA 1A3VA 1ZXHA 3P7JA 1XF5L 3QIAA 2C5CA 3TDQA 5JPNC 2L1BA 3M7NA 1UWXA 3AEBB 3NQIA 1SE2A 5K5PA 5EE0A 2F0WA 1N5WA 2ICEC 1Y1WB 5E1FA 2F4IA 4TRDA 2WKDA 3K5LA 3MFGA 4A93B 4C56C 5JEAG 2RDFA 4ODGA 2LFIA 5M5XB 4C80A 1BCPB 1TWCB 4ZRPA 2XSCA 1SXTA 1R4PB 1II3A 1NR2A 1FEHA 1NENB 4M1UB 2OEOA 4IOIE 4HKZE 2E76C 5FR3A 2EYHA 4G4KA 2WDQB 1TQOA 5DM63 1PFNA 1EWCA 1Y8PB 2ZXPA 3GD7A 2B2TA 3AMUA 1UUPA 2B2WA 3ETRA 1QJOA 4H7BA 4TQUS 5J39A 2KDMA 3AMZA 2L4NA 1QT9A 1EY6A 2CHBD 4RCOA 2OHFA 4OVZA 2KACA