1SXTA

Staphylococcal enterotoxin type a (sea) co-crystallised with zinc
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
224
structure length
224
Chain Sequence
KDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN TYPE A
publication title The Co-crystal structure of staphylococcal enterotoxin type A with Zn2+ at 2.7 A resolution. Implications for major histocompatibility complex class II binding.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Superantigen
total genus 61
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sxtA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sxtA02
1RCVD 2R61A 1S5FD 1DYQA 5TSSA 1CK1A 3BYYB 1PTOD 1EU3A 1KLGD 2G9HD 1I4GA 1PYWD 2XN9C 2NTSA 3DWQA 1FNWA 1BXTA 4BWGB 1LTGD 1SBBB 1EEID 3BYTB 1AN8A 1PTOF 5D3IB 4K6LA 4RGNA 1KLUD 3DWAA 1PZID 2XNAC 1LTAD 1PRTF 3W2DA 4TSSA 1QILA 1D5ZC 5FK9C 1HQRD 1B1ZA 1AW7A 1LT3D 1SEBD 3CHBD 1ENFA 4L6TB 1CT1D 1S5BD 3R2TA 1PTOC 1SE2A 2WV6D 4UDUC 4DXGA 4DXFA 1FD7D 1LLRD 1TY2A 4NZLB 1PRTC 3KLSX 1KTKA 1JWUD 4RFBA 1M4VA 4RGTA 1G8ZD 2IJ0A 1XTCD 3EFXD 1EWCA 1I4PA 1PRTD 1STEA 1DJRD 4C56C 1HTLD 3BVZA 1LTTD 4OHJA 1TS4A 1I4XA 1PZJD 1TS5A 2J4XA 5ELDA 1UNSA 1S5ED 1I4HA 1HA5A 1CQVA 1BCPF 2AQ2B 1HXYD 2XRQD 3BVMA 1JR0D 1JWMD 1RD9D 5ELCA 1TS2A 1FNVA 1LT4D 1FNUA 5I4DA 1JCKB 1YN5A 1V1PA 1L0XB 1LTBD 1TY0A 3BVGA 2IPKD 1PTOH 3BZDB 1ESFA 1T5XD 1PTOB 1TS3A 3O13A 3MFGA 1BCPC 1ET6A 1LT5D 1SJHD 3R8BA 2XRSD 2CHBD 1MD2D 2Z8LA 2QILA 1D5MC 1SXTA 1V1OA 1EEFD 1BCPD 3OWEB 4RCOA 2ICIA 5FKAC 3URYA 1V1PB 2RDHA 3MC0B 4Z9CB 1LT6D 1RF2D 2QEJC 3SEBA 1I4QA 3EA6A 4RHSA 3R2IA 2TSSA 1SE3A 4RGMA 1PZKD 2AQ3B 3TSSA 1ET9A 2O2LD 4RH6A 1EU4A 1B44D 1L0YB 5ELBA 1JWSD 1CHQD 4ZYSA 1LTID 4L63B 1YN4A 3DWPA 4O1NA 1S5DD 3V05A 3GP7A 2AQ1B 1D6EC 1EFID 1PRTB 5ELFA 1I4RA 1UUPA 1YN3A 1FGBD 1CHPD 1RDPD 1LTSD 1GOZA 1S5CD 2RDGA 1SE4A 1LO5D 4RGOS 2SEBD 1BCPB 1LTRD 5ELEA 1XXGA 1D5XC 2NTTA 4RHRA 1JQYD 1F77A 5D3DA 1SJED
chains in the Genus database with same CATH superfamily
1NR4A 4NP5A 5IT9E 3D3RA 1HUNA 1Q1BA 3M4QA 5M3FB 1KLGD 2B2WA 3ZGZA 1GHJA 2BYEA 1CJEA 3IT4B 1SFOH 3AXCA 4DNRB 2PO4A 2WS3B 4JE3B 2K1BA 4LAAA 4PZ6A 2D9UA 1WGGA 4KY7A 1PTOF 3S24A 1WD1A 3PF5A 4BBNF 1X56A 4CHTB 2N55A 1DOKA 3A4RA 5FJ8G 3HOUB 2MJEA 4F88A 4DV3L 1R4MI 2K6AA 3F2UA 5FK9C 4MACA 1WXQA 1N36L 2AWOA 2B2YA 5C0XG 2ZT9C 1CZGA 2NVQB 2DN8A 2QCZA 4LWCA 2EYOA 5C0XJ 3GTLH 5LLIA 3T1YL 1CT1D 2MGSA 2RHSB 1WXVA 1PTOC 3H7SA 3UINB 4BBNC 3M3JA 3RNAC 4B3TL 4DR3L 2RPVA 3VH3B 2ALYB 3H94A 2O5IC 1SNOA 1XJVA 2L0TA 1YD8U 3M62B 2VY3A 1GG3A 2UXDQ 3JAMi 1FR3A 2K8HA 2N9KA 5C4ZA 3VR5A 1YI2A 3BVZA 3GZNI 1TKYA 3TMPB 4C4VA 2ASBA 1EQRA 3AECB 3GS2A 4EE2A 1K83B 5CHVC 1KL9A 4HTHA 3LJ3A 3TJPA 1TTNA 4A3EH 1S5ED 5NUCA 3TEHB 5JXVA 3WANA 3RULA 4FJYA 1HXYD 3K7AB 1EUJA 3V2TA 4DAYB 5KYLA 2KENA 1C77A 2DZIA 1XMOQ 2HE7A 3W5VB 4PNYA 4ZCKA 1FNUA 4LF6L 4US9A 4HJ7A 2J0TD 4DR5Q 1ASZA 1AARA 3MJ5A 4EOYA 2O6VD 1Z6HA 2H4OA 3OOCA 4N9TA 1WTPA 1HR0Q 1WRIA 2IO0B 4CKCA 1XLOA 4PMBA 3DDCB 3G71A 1PH3A 3QK0A 2KVZA 1UD7A 3PV0A 2CH4A 3R7QA 3K0XA 3R8BA 2NBVB 4MN3A 2RR9A 1V1OA 3H09A 1KDBA 2PW9A 3DBRB 4C3JG 4JC0A 3URYA 4M0WA 3P4RB 2DY7A 2JP1A 3HOVB 2G1EA 4HPLB 4BBSB 1K50A 2MSED 5FLXE 4GLSC 3SD5A 1Y1WG 4MHEA 2VZKD 1HZCA 4IPCA 1EIYB 2EMSA 2KC2A 3PTFC 4BY1G 2JA6G 1E6EB 1IBMQ 5C1ZA 2B2UC 2CHWA 2PVGC 4AQ7A 4K14A 3CPFA 4LF9Q 3HOWB 2C60A 3KH0A 3MEFA 2LVPA 3KJPA 2R7ZG 2NZ1D 3VTUA 2VXWA 2DYOA 4B6WA 4GLVB 5JEAG 4A6QA 2IYDB 4FXCA 2YTYA 3B6YA 3SFDB 1T9HA 2KHSA 3PIOA 2PQAB 5D65A 1QWYA 2SDFA 2OWOA 3FVQA 2KKCA 1UUPA 4DR7L 4MGYE 1OTRB 1E10A 3MA2B 4HCSA 1HNWQ 1RDPD 4NNJB 2HD3A 3KUDB 1LO5D 3DCGA 5DPRA 4UAIA 3UF8A 1K53A 4JLCA 4B08A 5IWAQ 1B9MA 2K03A 4BY7H 4LF4L 2KMMA 2YEPB 5JZEB 3C46A 1ML0D 1I4GA 4NQLB 5HGQA 4A55A 1N33L 2IW3A 4XIGS 3J80E 4A3FH 1GUGA 2K5NA 4NKLA 3S2DB 2MJ8A 2R6GA 1J7BA 4QJFA 1CI3M 5FO9B 4DR1L 5EGTA 1W3SA 2UXBQ 1AH9A 3Q8BA 4I6LB 4TMAB 2JZPA 2MBBB 2K6QA 3N52A 2YLMA 3BDLA 3AB5A 2KWDA 5IKCM 1IZ6A 1I50B 1LM0A 2MP1A 1XPUA 3RZOH 5D14A 3M4OH 1L6VA 2IGHA 3S1RB 2W55A 3ZNHB 3V6EB 2QKIC 2G4SA 3ZIMA 1SE2A 4FYDA 2AWTA 4EFOA 3KJOA 2MRPA 3KF8A 5IE8A 5IY0A 1LV9A 3KOJA 2KA7A 1K51A 3P1HA 2I38A 1L2FA 3ND9A 2HHHQ 1G91A 2K0PA 4MTNA 2MCNB 5HHDG 4C56C 2C5CA 5BMIA 4OO1G 3EN2A 1VZ8A 2K5HA 1A0IA 4HJ9A 3KUPA 1ISNA 4HJ8A 3OWFA 1TT2A 2FCSA 4S3SA 2L5TA 2R92B 2WXIA 3NK9A 2NZHA 4OVZA 2WFWA 4E6IA 1TS2A 1DOYA 2K5VA 1PH1A 4JBMA 1B53A 3TEZA 2YU9B 5I4DA 4J8QA 4JI7Q 3QB3A 3X3MA 4DR6L 2D5DA 1L7YA 4BOZB 3OW7A 2WNMA 3UQAA 1Q81C 3S16H 5JH5C 3MHSD 1KC8C 1Z47A 4ANVA 3ZLZA 4PZ8A 3ZJTA 3NTHA 3QO2A 1SYBA 2UU9L 1ZUD2 5CV5A 3NUHB 1STBA 1WFQA 1FCCC 2JUOA 3AU5A 2UUCL 2MBOA 1E7ZA 1BCPD 4R1JA 1WCMB 2WXPA 1C4PA 3KUCB 1PQSA 2OOBB 3GTMH 4IN3A 4AH6A 3M85A 1N34L 4WWMA 5I9OA 3DVNU 3DMUA 5BO4B 2AWNA 2Q5WD 2RDBC 1AEXA 1WE7A 4HSPA 2INDC 1ET9A 1QT9A 5CV6A 2DGYA 4KSKC 1OXVA 4XDXA 2KHIA 3T16A 1XF5L 3DWGC 2WX0A 1E0ZA 1TVXA 3H0GG 2QEXA 1B7YB 1WJ4A 2NN6I 1UEBA 1V8QA 4ARIA 1FL0A 4HRSA 3V05A 4WIPA 1PRTB 1EFID 4EQOA 1TT5B 4IWPA 1LABA 3TP7A 3UGBB 4RF0A 3AEAB 1JE4A 1L1OB 3VDYA 1CZWA 3X23A 1XLNA 2SEBD 1XXGA 4R4TA 3RFZB 1QOBA 3CD6A 4ZKCB 1EIFA 4GLAC 1NAPA 1SB3C 2HQLA 4BAXA 3TP5A 2JRHA 2L3ZA 2B2YC 2B2VA 3AE9B 2GI9A 1WGDA 2OJWA 2A6HD 1VQAA 3J81L 1AYFA 2A19A 5EBCA 2MP2B 4BWGB 2RPQA 3M7GA 2ACZB 3L17A 5D94A 4IUUA 4GLXA 3UDIA 2PW7A 2X8XX 3C19A 2KMCA 1SN8A 4EGVA 3VRBB 2F0QA 2QMTA 1OXXK 1SYGA 1T5EA 1LXDA 2N0SB 1F2ZA 4WQMA 3EFUA 1V97A 1KABA 2EPBA 1E22A 3A5ZB 5CR3A 4QCLA 2JXTA 2F0UA 1BKBA 1CUKA 4EQNA 1B2TA 3DBSA 1BUIC 2EMTA 4X3SA 3D32A 4L2YA 1HZ5A 4RAUC 1ONLA 4LK0M 2LXJA 1IBLL 1WSPA 2WIIB 2D3AA 2DWQA 2KACA 1X3QA 4DAVA 4M02A 4MSQB 2WXJA 1JJGA 1WMHA 4KKIA 1I6VC 1WYDA 5LL6X 1C0AA 2LMCA 1LACA 1G2TA 3QQ8B 4MELA 3KF6A 4HCEA 4KKSA 1JRPA 4HJ5A 3WAMA 3HIZA 1DJRD 3NEMA 5EBDA 4XXEA 2UUAQ 1QOAA 1C48A 3VYRA 4PMCA 5KRUA 1GUSA 3HOZH 2JXMB 1BO0A 3QR8A 1VQKA 2EE1A 2PQEA 4KTAA 1E24A 2XWJB 3C1EA 1A3UA 2BS2B 2JA8G 2BH2A 2Q8IB 5TR5A 2HIXA 3BVMA 4A93G 1A70A 1DGJA 2OJRA 4IQZA 3CIRB 3J81c 3KBXA 1SE8A 3G6EA 1VCIA 1HQMC 4GZYC 3BVGA 2AX5A 2L7RA 3AM9A 1YITA 3A9JB 2F0MA 1Q12A 2PTLA 3HOXB 4P73A 2EY2A 1HZ6A 5JHAA 3PO3H 4QUCA 3O13A 3MFGA 1DOIA 3QWNA 4NAWA 4OL7A 4ULLA 2Z8LA 5CV9A 3JAME 1SXTA 1X54A 2O6VA 2MPMA 4YWGG 3SVMA 1BBUA 4JI4Q 2V3PA 2KCCA 1N60A 3KVFB 1YZ6A 2EY1A 2IX0A 1J6QA 5CHFA 1RF2D 3QC8B 5C44H 1YHAA 5IGDA 4YY3L 4DV1L 4A3IG 1TR5A 3EECA 2KMAA 1H9MA 1A2TA 4X57B 4JW0A 2BTEA 5E6OA 3ZTDA 4RGMA 2JA7H 5M9OA 1WOCA 3S17H 1UGJA 2DAFA 3EFCA 3NOBA 4NQKE 2BE5D 2LXKA 4LTUA 1K52A 1PDQA 2F0IA 3E0EA 4W9DA 2CKZB 5E7NA 3H7PA 5KHOA 1QUQA 3U9OA 1GO3E 3AYHB 4LFAQ 4DK3C 1XMQL 3IHPC 1GPXA 2ZZPB 2BDOA 2KX0A 1E1TA 3OIPA 2C7HA 2A6EC 3H3VC 4EZJA 3NTKA 1E7PB 2CCZA 2KFKA 1RHPA 1TWGH 2I5HA 3MFYA 4JI5L 5FLMH 2D07B 2WGSA 2RF4A 3FRPB 2FCQA 2BYVE 1SR3A 1JQYD 3GTPB 5J3BA 1MJEA 3HGBA 1W6JA 1E1OA 4LFBL 2RCNA 2KAJA 1ESRA 1V8CA 3PPAA 4HIMA 4CYEA 4WJQA 4Y7NB 3I4MB 3S2HB 3DM3A 4OEMB 2KN5A 1WFYA 5HI1A 1NBWA 4GN1A 1II3A 4ICUA 2FFKB 2Z4HA 3SHLA 3I4OA 2E2HB 5G2NA 2F0NA 2NN6H 3ERQA 1E7UA 1OQQA 2IGDA 1V43A 4XDDA 1A63A 2OXPA 1J19A 2XBBC 3E9SA 3CU7A 4NB3A 3NWTA 1LT3D 1XPRA 2MBHA 2OCEA 3P2BA 4HIOA 4X65Q 3LNNA 4MH0E 4CQNA 1C76A 3JSVB 3BK1A 3W1GA 1EY4A 1K9MC 1I6HH 4HJGE 1LTLA 1PXUA 3MXGA 2WKCA 3ABVB 1G8ZD 2BWES 1N36Q 2LGXA 3VVWB 3I72A 3CCEA 1XTCD 2L1AA 4O42A 1WY8A 2IDYA 3M7NA 1G51A 4K3CA 4IURA 1A5RA 4OX9L 2JF5A 4LUVA 1G6JA 2DHZA 4L5SA 3MXNA 1YX5B 2BYTA 1X3PA 1R4NB 2PI2A 3PSIA 2CHXA 4BFRA 4IUVA 3Q23A 3MVVA 3DVGY 3FHWA 4YHHL 3TS0A 2KFJA 4M01A 1MHHE 2QJLA 2QDBA 4JI2L 1YBYA 4OVUA 2CWAA 2A8VA 1FXIA 1WZ0A 4BZAA 5BYSA 2UUBQ 2AUJD 3H15A 2F3WA 3P7JA 2WU5B 4JI1L 1AE3A 1TZ1A 4CJ0B 4POGA 1FCLA 1R9TH 1CA6A 5KHQA 1NENB 4A3EG 1TWFH 1JT8A 3MEHA 4M8AA 3K58A 2R7DA 4YTMB 2NVXB 1GJXA 1F9JA 4Q5VA 3FKIH 1F9RA 3Q3NC 1KNEA 2QIEB 2IPKD 2OQ0A 4KHPL 1EWHA 1GD7A 4A3JB 1X65A 4A3CG 2JWZA 1PTOB 3AE8B 4DKAC 4KN7C 3AE4B 1DOMA 1YMHE 2L1BA 2AHOB 2FBWB 4LF6Q 1OGWA 4LNNA 1EEFD 1LUZA 3K5OA 1FXTB 1F9SA 4DV6Q 3CW2C 1HRJA 2WDQB 1D1IA 1T0YA 5IOIA 1PYSB 1V1PB 1WTHA 1K73C 2XK5B 2F0HA 3K9OB 3WAPA 1TQOA 4X64L 1VF7A 1Y1VB 2HDLA 4MZ9A 1VR9A 1L4DB 2JZZA 3RMKC 1I3QH 1T0QC 3UQBA 1NTGA 4W9GA 3NHHA 2PNHA 2KNBA 5C5MA 2D2CC 2VL6A 4BVUC 3WCQA 4DNIA 2BCOA 1IBKQ 1CKOA 1NDDA 2NBFA 1VDVA 3KYDD 2WINB 3PLUA 2V3NA 4YCVA 5C3XA 4WQOB 2AUKA 4C2MH 3SXHA 1WYWB 4P7IA 1E2VA 2IY5B 3B2GA 4N8X1 2L00B 2BYFA 2UWQA 2KEEA 4PG3A 4RGOS 2F4VL 5A2QL 1YQ3B 4MM3A 4ME3A 5CYUA 2LUEA 4EUTA 4A4IA 1EWIA 3HKZB 5D3DA 5JJLA 3CRKC 1SYCA 4JIOU 2HQEA 1M90C 3FMCA 5M3FH 5TSSA 2JT4B 2DAJA 2E2DC 4X3UA 1GUNA 4GB9A 1NCVA 1OXTA 4JVZA 5G5HA 4PK1A 4DR7Q 2KCTA 2M17A 1NYRA 3LB8C 3ZNGC 4OWWB 2K33A 2H5XA 4L23A 1NY4A 1HNZL 3NZUA 2HJ1A 2AL6A 2O2VB 3W1YA 4ZKBB 4ZHOA 3M9BA 3NQIA 1SBBB 2FHTA 2B39A 4BY7G 2BS3B 2D10A 2KTRA 2B63B 4N59A 4JI6L 1S4ZA 1SNPA 3HOUH 4FP5D 3DWAA 1PZID 4LF4Q 1Q5WB 4EZKA 2IHFA 4K2KA 2DUDA 2WXLA 1JICA 4A3FG 2NVQH 3HRDD 5AZHA 4LNOA 1JMCA 1N33Q 4G3XB 4JYAL 3VQIA 3KK7A 2REXA 2LEKA 5GADC 3ER0A 1MPEA 2X38A 2V1CC 3R2TA 4ZQ3A 4X6AH 4DXFA 3DUZA 3T51B 3N1XC 1J5EL 2WAQB 1X3EA 2ZJRA 2NVUI 3B2FA 3UIPB 1JWUD 1CKNA 2KOLA 1WE6A 2BT6A 2F3VA 2KDEB 3ETRA 5M3MB 1EOTA 4A3PA 3VUXA 1TIID 1M1KC 1JORA 3HM3A 3MP9A 4LFCQ 1YHQA 3KW5B 3FEWX 3MC9A 1H9KA 1U5KA 3AEBB 1K83H 2IY1B 3WOEA 4W9KA 5GAHC 5IGEA 1PZJD 1Y1WB 4NJCA 4B95A 2INNE 4IOAA 3GQBA 3CCQA 1HUMA 3K7AH 1VS0A 5C4XB 4JI3L 2K75A 1RD9D 3RD4A 4AQYL 2V4IB 3G48A 4P6VF 1FNVA 3ZXRA 3ZQ4A 2MHVA 1SF0A 3ZKJC 4XDCA 4REZA 2F0PA 2J52A 2K7VA 4HEA1 1L2NA 1N6ZA 3VYSA 4J3OD 4DWFA 1T5XD 4OVVA 2VH1A 3AE5B 3L08A 2NBWB 4QL5A 4TVAB 1Y8RC 1A3TA 3S15B 1N5XA 3UDFA 1XNRQ 4ME5A 2LASA 1BF4A 4A3DB 3MJWA 2OF1A 3EROA 1RLFA 4AS1A 4DR6Q 5FO8B 2KCMA 3HOVH 5DM73 2XTIA 5BN4A 5H1SE 4BBSH 3TZDA 1UZXB 4PS8A 4A20A 4UP8A 4DV5Q 2HCCA 4C3IB 1EYDA 4K0KL 4XTCS 2I2YA 3SEBA 5IGFA 3AEVA 1V86A 4YT0B 2UUCQ 3HOWH 4FADA 3R7RA 3TSSA 4GSWA 1KRSA 3RLNA 1WJNA 2VS1A 1WTOA 3PUZA 2MUYA 2ZTEA 3KDFB 3SE0A 1F2MA 1JWSD 1C4AA 3NXWA 1N34Q 3Q3JA 4H0LC 1EY5A 4DNTB 4ZYSA 5H8YE 2LHEA 1G6ZA 3CRLC 4LDTB 4ZUIA 2K5DA 4LF5Q 3P4QB 1FGBD 2FJ2A 2B76B 3ZDMC 2K6DB 4DDID 1QLBB 4B3RL 3C3LA 1KAWA 4KKUA 3U7DA 1B9RA 3ERSX 4XYOA 4W9CA 2PKOA 2KC1A 4DUZQ 2AYOB 1O80A 2CVRA 3EBEA 5HFYA 5EE3A 2F4IA 2ZXRA 2F0GA 4Q0FA 3K0YA 3OSOA 1STHA 3S2DH 1BXTA 1AZPA 5BMGA 2JJQA 3OJ3A 5EAYA 3WIMA 1YQ4B 3QCAA 3DEPA 3VTWA 3WDNA 5ELOA 4GDKB 2GVBA 2XNAC 1GM5A 3DBHI 3ZO5B 5FLXL 3OIQA 2RCFA 1HQRD 1I50H 4A3MH 1Y56A 2UU7A 3PSEB 3VH4B 3OMGA 3S1RH 2N88A 1XWEA 1ENFA 1PMRA 1G291 5EPLA 1EF1A 4JQWC 1IBXB 2RKSA 3A1QA 1K8OA 2M56B 3BY4B 2LS01 4DXGA 1N5WA 4YSZB 3TIXA 2LJ5A 3ZJYC 4A3GB 2PMZB 2EKIA 2BA1A 2WB1G 4BBRB 4P75A 3J7AV 2MBQA 2X69A 4A76A 2RMMA 1PDXA 5DAUA 5H92C 2QCPX 1IYJB 3AE6B 1TKGA 5AJ3Q 1PRTD 1SDFA 4UHVA 3SGIA 2GBJA 4APVA 4TQ1A 3FPPA 1IBLQ 1CZPA 1CKMA 1KIXA 5IYBH 4ZRIA 3DBLB 1CSPA 1TS4A 4OHJA 5IIFA 1B3AA 1CMXB 1NYQA 3FC4A 3VHTC 3S9WA 5IGBA 3ZVVA 2YYZA 3D4DA 4EVOA 1O7IA 4GN5A 4JK1C 3L54A 1HFGA 4IUMB 1J7CA 5C3WA 1ACCA 2XSCA 3BDCA 4L5QA 1BCPF 3HOZG 4AYBE 2XRQD 4IWOA 3CCSA 3EC8A 4IPHA 2YU9H 1MSGA 4I7AA 2R2OA 1WD0A 2NPTA 3J80L 1LTBD 3K9PB 2EJGC 1XEEA 3NUCA 4X66L 4N6EB 2KWUB 3U4VA 5BMHA 2F1MA 4P71A 2IO3B 2M4NA 3SDZA 3A4SC 3HG9A 1A2UA 2LVOA 1BCPC 1AFPA 1KRHA 1KFYB 1VDZA 5KGUA 1L0WA 5FLXc 4GMVA 4FNFA 2EVBA 4GNXC 4GN4B 5EDSA 1WCMH 3VRAB 3PO3G 1BUVT 4TQ0A 4U673 1TWCB 3ENEA 4DR2Q 2WDTB 3Q8CA 4B9XA 2GA4B 2V1YA 1HZAA 4K8JA 1XX8A 1VQHA 3VA7A 1LT6D 4LF7Q 3HK0A 1VQGA 1VF5C 1WI5A 2W3RA 1UE7A 1QZEA 4W9LA 2QDLA 3RLFA 4K81A 1T0SC 1DZ1A 4DR4L 5C44G 2K04A 4MEMA 4KI0A 1EQQA 1N32L 2NZOA 4JCVE 1U4AA 1D1KA 4P2CB 2CQOA 4OZAA 3BINA 5LXHA 2JA7G 3E6ZX 1LTID 2ZEQA 3QJZA 5E4XA 4HVBA 2E76C 3NBHB 3J7YW 4MSMB 4NXNL 4DV7L 1S5CD 1BVSA 4KDIC 1LTRD 3ULPA 4RHRA 4F87A 4OZCA 3J80c 2QA4A 1XMQQ 1OEYA 3VR4A 1GHKA 1WH3A 4KZCA 4USAA 3VDZA 4F8CB 4CJ2C 3S14B 1TXYA 2K5WA 1NNXA 2DZJA 5FLMG 1JOKA 1YIWA 3V60A 2E5LL 4DAYA 2GRIA 2F0OA 3OHXC 1R4NI 1SIJA 1Q1EA 4WJ3M 4GKJL 3IFTA 1WIAA 2RSOA 1KQSA 1Y8NB 3ONAB 1IP9A 2D11A 5JEAJ 1QQRA 4IUTA 1I42A 4ZUJA 4PMWA 4KGSA 1J9OA 4WWOA 4POFA 4DBGA 1VQ5A 5C23A 2JSVX 2FMCA 2Z6BA 3G7LA 4EQPA 4Q2JA 2QF7A 1AW7A 2RA4A 3U58A 2PPHA 2M8SA 1SEBD 4KJOA 2NN6G 3JYUA 2SNMA 4UDUC 3HVZA 4JX1C 1XTDA 3TL5A 2BW2A 1FM0D 4NY0A 1FD7D 3D6WA 4AWJA 2HD5B 3PO2B 4IPGA 1SRUA 4AYBB 2K1FA 3J7A5 2PE9A 1HR0W 2ZNVB 4YSYB 2BQQA 4M8NA 2EY5A 4DV4L 3SR1A 3EFXD 1TKEA 3OLMD 2RDFA 4MGKE 4JI8Q 4EKUA 4WWPA 1EO6A 4XT1B 4ZRPA 3GTGB 4K8IA 1BBWA 1PFSA 5C4JB 4IFDH 4DHJB 4A3IB 1GB4A 1UBIA 2PQAA 2H1EA 1XNQL 1WTVA 1F2RI 2K22A 5IO9A 4ANUA 2KCNA 1LYLA 5AUIA 1P16A 1JR0D 2LJIA 1ZPSA 3FDTA 3L9AX 2RBMA 1ZXIA 4BKSD 4P16A 1YX6B 1RKNA 4MT5A 2C9OA 1ZYRD 4BXXH 3HOXH 4YIJA 1QVCA 2X6LA 1V9PA 3AFPA 5CV7A 5JPNC 5BR8L 1TJEA 2L4NA 1XCTL 3QA8A 3RZDB 1TS3A 5C3EB 3CC7A 5LMNL 1K28A 1YJJA 2ZW1A 3K57A 1E0BA 4JBWA 1V5OA 1KHIA 2NUCA 1MI0A 2CW0D 5LNK1 4B9WA 2QILA 1PH5A 5K36H 2ON8A 4HDQA 2CFMA 5DPTA 2M00A 3CQZB 4HMJA 5I6YA 2ZTCA 1PFNA 1RTOA 1VQ8A 3A8KE 3CC2A 4KHPQ 4ZDVA 2WP9B 5AEKB 1EQVA 2QW7A 2RDHA 1YOVB 4HR7B 4I7ZC 1SGHA 4C7ZA 2FCNA 3I8ZA 3NVWA 3QJYA 2BE5C 4H13C 4B3SL 2LRUA 2ZPYA 2EYHA 1EY0A 3TUOA 1E3PA 3TS2A 3A0JA 1Q10A 3QAQA 1PYBA 4CHKA 2EZVA 1E8WA 3DOWA 2F0FA 4XYQA 5C6AA 3MHZA 2F0EA 3HOYB 3UI3A 1ENAA 5ELBA 1CM9A 4Y52H 1T3QA 5LHY1 3GO5A 1U9RA 1BT0A 2FINB 2MEKA 1HA6A 4JWUC 3DWPA 4O1NA 4X64Q 1J7AA 1P0RA 5JVH3 2WXRA 4ASWC 2HTME 5IGGA 3RNUA 1SROA 1I94L 2LFIA 1PFBA 1IHZA 5D6JB 1LTSD 5EQ0A 2QHOA 1SE4A 3GD7A 3STBD 3GTPH 3N1ZC 4W9EA 2JRIB 3F1ZA 3CCVA 3P63A 2ZJQA 4Y7NH 1TGZB 3I4MH 2K32A 3S2HH 2E2JB 4ANWA 4FJZA 1PTOD 4LUZA 1VQNA 4LJZC 2XN9C 4KN4C 4DV0Q 1YNND 2BB5A 3NS8A 1PGAA 3GOEA 3DHQA 1GUAB 5M3FG 4P1CC 3JAML 2UXCL 2FXQA 1Q82C 4P72A 2E2HH 5D3IB 1PH4A 3PT2B 2B2WC 1YEZA 4H7BA 1BNZA 2JA5H 1HFNA 3CSFA 5GMVA 5E1FA 4K5XA 2NWGA 4MGIE 4JI0Q 3Q22A 2SAKA 5DNFA 2X6GA 1YJWA 2RQXA 4R8IA 1EL0A 3HOUG 1GXDC 1HHVA 4KVGB 4HROA 4L6TB 2E3TA 2NVYB 2KDBA 3P42A 4TV3A 1ZKOA 3IAS1 2NVTB 1LLRD 1YJIA 3W1BA 4B3ML 2EY6A 4IZ8A 5JPMC 1MBYA 4DDGD 3TEYA 1WRDB 2EKEC 1PH9A 1T0RC 4JYAQ 1X3GA 2O5JC 3EJIA 3NTIA 3K6OA 5BN3A 2V3SA 1TU2B 3PUVA 3JVZX 2JYOA 2LHDA 3ZXVA 2LVQA 2HT1A 1S1QB 4QIWE 1F0ZA 4G7OC 4DAPA 1WTXA 3BWUD 2D3CA 4D2KA 2ZXPA 5GXGB 4XQJA 1K0SA 2KLGA 1UNSA 3QARA 1I35A 1VQIA 3CKIB 5DLQE 5JJKA 3OG5A 2WXKA 1VMCA 3FPUB 3QIAA 3QIJA 1L1OA 4OXPA 1RFKA 2I5LX 2K28A 5I2XA 2NVXH 2OTJA 2B8GA 1KDCA 2OQKA 4KIKB 3VAWA 4A3LH 2A74C 4JOIA 4WJNA 2I07B 4B0MA 3PLVA 3JAMc 2ES2A 4A3JH 2RSNA 4DK5A 1UWMA 1LFDA 1PFMA 1PTOH 1AP0A 4A75A 4ID6A 2ATWA 2H88B 2NS5A 2VUMH 4JI3Q 3ONSA 2GBNA 5M5XB 2MP2A 1TKWB 5IP4D 1H9RA 3DQVA 2IT1A 4WJ4A 1ZKHA 5EE9A 3OWEB 5J2RA 2E74C 3LXFA 5G5GA 3SFEB 1ILQA 5FKAC 1MHXA 4RF1A 4XWTA 4IG7B 1MFWA 4IUPA 3MC0B 3UIOB 2IGGA 4X62Q 2YTXA 5J39A 4NAMA 3IL8A 3I4NB 3KQ4A 1Y1VH 4RNAA 4IUQA 2M0XA 1I5FA 3HOVG 3K5MA 4BBSG 3M63B 2WP8J 3I70A 4N58A 1X1MA 4KMUC 2JK8A 4JWSC 3RUZA 3S1QB 4A3KG 2Z9HA 5EPKA 1HE8A 1V81A 4WJPA 2LI5A 5BYQA 3HOWG 1Q86C 4K0KQ 1STAA 1P7EA 4OWTB 2MJDA 2W82A 3CSTA 3I56A 4ODGA 1F2LA 3WOFA 2KYWA 5CHWA 3C8YA 2JEAI 2M0AA 3BIID 1PH8A 1UBQA 2J7QB 3I9V1 5JOBA 2UXDL 1BBXC 3M4OB 2XGTA 2V4LA 4MH8A 5T1IA 3M3YB 2F03A 2A68D 5JJZA 2VQFQ 1SJED 1WR6E 1ZGUB 2PNRC 2KJRA 1CK1A 2VZKB 1EU3A 4JBKA 4GDLB 5FR6A 3MXUA 1DOLA 4W9FA 1QZHA 2K50A 4B3RQ 2Y0SB 1B9NA 1LQBA 4KY5A 3AEGB 4HCPB 2V0GA 1EY9A 2A69D 5CORA 2B63H 4H2AA 3BYTB 4JPSA 1AN8A 1GUOA 4GOPB 3A9JA 2VB2X 2EYPA 4PYZA 1B3QA 3CP0A 3RCZA 1KLUD 5M5YB 4FDBA 4DR5L 1LTAD 2R93B 3D0FA 3A5UA 1IW7D 1FJGQ 1QILA 3QHTA 4QY7A 1QOHA 1XLQA 4FULA 1HR0L 3S2AA 1Q8IA 4QIWB 2HCIA 4ABNA 2IWHA 3D6CA 3PVLA 3ZNID 1TZOA 2F52A 4A3BB 4EZLA 4WAFA 2JY6A 3K8AA 2LKVA 3B0AA 3QOJA 2JSOA 4A3MG 3OMCA 4G57A 1IKLA 1PA6A 4FF1A 2E8GA 3PZ7A 5M3MH 2INPE 5IN7A 2VNUD 1H9SB 5DEHA 4LNIA 2JE6I 4YTNB 1RRBA 2KVRA 2MQJA 3TCAA 3NHEB 3TP8A 1VQ4A 3HS0C 2JA9A 1ICWA 4DK1A 3BS1A 1IBML 2PZUA 1RM6C 1TYGB 1IXRA 3NY5A 4LF9L 3RZFA 4ZAIA 4RKBA 3ICEA 2HUGA 1HCZA 3GZNB 3NVVA 1Y8PB 3HKZE 5C4XH 1M94A 4M1UB 5L37A 1SE9A 4TQUS 2CR5A 5IYDH 2Z6KA 5IYBG 3SK4A 3GTMB 2J42A 2N1VA 4LNFA 5J17A 4IOIE 1Y14B 1WYGA 2JWUA 1FD6A 1JCKB 1V1QA 1YJ1A 1L0XB 3ML8A 1HNWL 2Y5PA 2WHIA 4DV3Q 2NB0A 5COYA 1B8AA 1UWVA 3V96A 1F52A 1ESFA 1QE6A 3S1MB 3TZUA 3HM6X 5IWAL 3S15H 3T1YQ 2D5GA 1UAPA 3PHWB 4XWWA 2M9VA 4A3DH 3DBRI 1ASYA 3M95A 1VZ7A 2K5PA 4BKSA 4YCWA 4B3TQ 2PVOD 1D5MC 4DR3Q 4F7ZA 5AFWA 3QX1A 4FJVB 4IW0A 4FF4A 1X55A 2PCFB 5KYIA 4X66Q 3HRZC 3ZJVA 4C3IH 3R3MA 4C1NK 1MHWC 3P4PB 2WX1A 3Q8FA 3VFKA 3H8HA 1KAAA 2PIAA 1FGUA 1WCMG 1HZBA 2WAQE 4C3HB 3AMUA 1I4QA 4RHSA 2UXBL 1WGHA 2B8FA 4MJSB 2NYZD 4KDLB 2TMPA 3E9IA 4FF3A 2HDMA 3JSVA 3L4PA 1UE5A 3TBIB 5HGTA 1VQFA 2KJHB 4LW1A 5GQOA 3LWEA 5DM63 2PJHA 2WXQA 1UF0A 3A74A 2JXXA 1JWBD 4MNOA 5ELNA 1U4LA 3DHIC 1Q3LA 5A35A 1LGRA 1S3SG 1PV4A 1L4ZB 1KJTA 1FRRA 3DVNV 2E2IB 4R8NA 2FNJB 1BCPB 1K8GA 4ZRJA 3A33B 4RM9A 2CWPA 2Z0EB 3BG3A 3NQTA 3L2PA 4GNXB 2R61A 4KZ0A 1DYQA 3AH7A 1UELA 2B3GA 4KV2A 3MXPA 3KBGA 4IDIA 4L1BA 3RLOA 2Q8RE 3Q3OC 1YNJC 3ULJA 4KKTA 2D3GA 4PYUA 1EF5A 5IODA 5JAVA 3TBLD 2B2VC 2LRWA 2J0MA 1QVGA 1AZQA 2GOWA 1PRTF 4LUOA 3PRMB 2Q2TA 2DLBA 4EX5A 4GKJQ 1WR1A 2FIDA 3GV6A 3AE7B 1Q90A 2Q2HA 2A1AA 4I65A 3F2DA 1X6OA 3D4RA 3LWUA 3GE8C 4A3GH 3P4SB 5G55A 1YHBA 4BBRH 2BDNA 1XCQL 3VR8B 4IC7B 4NZLB 3RYTA 1PRTC 3KLSX 2KWCA 1L1OC 3EQLC 4PV1C 5CBEE 4DV2L 2MLBA 3AN1A 3VR6A 3MC8A 2Q8TA 4AP4C 2KQ3A 3ND8A 3PRPB 4UY8C 2JX5A 4JOIC 2F0JA 2F0DA 4FLHA 4PS3A 2WQYB 4IJLA 3U2SC 3L0WB 5T8IA 1L0VB 3JW0X 4DPGA 1RL2A 2MBEA 2L76A 2GBRA 1YNXA 3GE3C 2WXMA 4J1MA 4DV4Q 3NWSA 3Q3FA 3I3CA 1JWMD 3C1FA 1BDOA 4IFDG 1UGMA 2BWFA 3KWVA 4KD3A 2EELA 4KGTA 4S0RA 3QOLA 4DR1Q 1YN5A 3A7LA 2Y3AA 4GOCA 4IM2A 3IAYA 3GTJB 1MG4A 2NCNA 4C00A 5EPJA 3FILB 1SJHD 3I7FA 2FCMA 1SLJA 4C3JB 4UPAA 4R4OA 3HOXG 4HMIA 4BXXG 1LM8B 1MJDA 2O2VA 4A9AA 1WVLA 3DVGX 3N6RA 1TWCH 3BK2A 3N32A 1HTQA 4E3CA 2B2UA 3L7ZC 3SK8A 4RCOA 5GAEC 5BR8Q 3CPWA 4BY1B 2JA6B 3TN2A 3SK6A 1E90A 5LMNQ 1V5TA 2K25A 1KXLA 3R3OA 4FA6A 2PMZE 1JE5A 2R7ZB 4XZ4A 1X9NA 1SNDA 2PZTA 4G4KA 2FUHB 1VQ9A 3B08A 2Z4IA 2GBKA 2KZRA 3PZ8A 3E9HA 1FEHA 3ZW3A 3NENA 4OZBA 1VQJA 3CXCA 4J6HA 1CHQD 2BKFA 2K3UA 3Q14C 4KHZA 2KUMA 4C80A 4LF8L 3MAQA 2BH8A 2VZAA 1OXSC 1WTQA 4ICVA 3CAMA 2VB3X 1IYFA 2ZM6L 1IL2A 4J6IA 2SNSA 4NXML 2LUMA 3Q24A 2VH2A 2MQHA 3NG0A 2UUAL 2ZVNA 4H44C 3S14H 1STGA 2G4DB 4MDKE 1RCVD 2UU9Q 3I63C 1XPOA 1TBEA 4BKGA 4R4QA 5K5PA 2ZPNA 4YXDB 3U7ZA 4J15A 4DAMA 1HTOA 3I4MG 1E8XA 1YJ9A 1TWAB 1C8CA 5MPOA 4RGNA 3SHQA 3X3NA 4WJOA 5HKHA 2ZJDA 2A73B 5CMDA 5KNCA 4QMGA 5IYCH 2F0SA 3H6MA 4XGAB 4XE0A 1WX7A 1R4QB 2XIWA 1O78A 3K80C 1SMXA 2L32A 2L8JA 2R2QA 3H3VH 2CJOA 2JA5G 1T6BX 4HEDA 2UXCQ 1MSHA 4P74A 1XT9B 4DA2A 3PO2H 1MJCA 3Q8DA 1FRDA 3GV3A 2Z6KC 2IX1A 4QAYA 4JI4L 4GKKL 1M4VA 3KLSA 1KOTA 1F1HA 3ML9A 2C5LC 1M8AA 2IL8A 3NE5B 3PUYA 4BS9A 1OQYA 2J53A 2F0LA 1VQ7A 5E3FA 1STEA 3ZNZB 2GLSA 2MA9B 1EZ6A 3GTGH 1U4PA 2FMMA 3KDFA 5M5WB 2OEDA 3S1NB 4HCNB 5C4JH 4L8JA 4IFDI 1GUTA 3A9KB 4WJWA 2N3SA 3HHMA 2L05A 1TS5A 4DHZB 1C4QA 2C9WB 2DZMA 3EHVA 1I4HA 4G0NB 1HA5A 3PMFA 4LK1C 3HVDA 3R66C 4LFAL 2ID0A 5ELCA 2KOXA 1ZYRC 2YV5A 2R7FA 2KN4A 2WLBA 4IALA 1ZDVA 2WKDA 1YVCA 4G11A 1SYFA 1WTRA 3RZDH 2EDGA 4ZLTF 1QNUA 5C3EH 2CW0C 3GB1A 4AJYB 2XWBB 4ZK9B 1WX9A 3QWZB 2MHJA 3FAHA 1V49A 2D0PA 1LT5D 1X3FA 1N62A 2Z59B 1XO3A 4A3JG 3VUWA 5KEEA 2VQEL 2XRSD 3OYYA 1MD2D 3CQZH 3D4WA 2KDFB 1EYCA 3KLRA 1MI2A 1Z2MA 4IWQA 2VUMG 2IHEA 1HZ9A 4HAEA 3UDXA 1Q0WB 1RODA 4FVMA 4GDKA 5IAAC 2R92H 2NPTB 2KJ6A 3X0WA 1BQQT 2G45B 2KEDA 3PRZA 4P1BC 4PQXA 2E6XA 1WJ6A 4CO7A 4MGZE 3K59A 3H0GB 1IBXA 5J22A 2LGIA 3HOYH 4M00A 1VQLA 4C4VB 1Y1VG 3EVQA 4X65L 4A90A 2C35B 3K7UC 1D3ZA 4PS7A 3CMMB 3KLWA 1ZW7A 3RN5A 1D4BA 3STBC 1RWSA 5ELFA 3P1MA 1I4RA 3L0OA 3G4SA 1HNXL 4DK6C 1S3OA 3C2PA 5HG2A 4YWKA 1FIQA 4K1RB 3U8ZA 1NI3A 2NTTA 3L10B 1D7QA 2WXOA 2GB1A 3AI5A 5AUKA 2L83A 4ARCA 1RAXA 2E2JH 1YNNC 1RYJA 2CHZA 5C4HA 4NW2A 3IFDA 3AB9A 2W3SA 3RI7C 5DCNA 1KH0A 1SMYD 2DYMA 1VQ6A 3HKZG 1QJOA 2K9XA 4HWIB 3V6CB 1WGKA 3VYTA 3B1LX 2UUBL 3PREA 2BB6A 2NMQA 1E2WA 3T13A 4DUYL 3HP3A 5I2YA 3NPPA 3GTOB 2GMIC 4RMFA 1W6KA 4YY3Q 1A3VA 2OT2A 3GTKB 4DV1Q 2KX3A 4GIVA 1F2RC 4M0WB 2B63G 3NSWA 4TKNA 2I0QA 2KTFA 3VUYA 4IM0A 3CCMA 2G3QB 2WDRB 4XYCA 4CKBA 5CC4A 1B1ZA 1P8LA 1NMGA 2EXZA 3RNEC 2NVYH 3CHBD 1F2YA 2JN4A 2QC8A 1IGCA 4PZ7A 4OWXB 1EFWA 4A3CH 3MTNB 2NVTH 1J0GA 4TKOB 1MVKA 2A6HC 4CDFC 2JYTA 2N8NA 3TMEA 5LL6S 1TY2A 3PGZA 4DV6L 3MZ5A 1YQBA 2DNFA 1KTKA 4QQBX 3J81i 5CBAE 4RGTA 2I1JA 1STNA 4JI5Q 4KY6A 4I6PA 2WAQG 1H4RA 4K7WA 2EOTA 2BGFA 4DN4M 1FMAD 3JC66 5M3MG 4RCNA 4LFBQ 1VZ6A 4WORA 3CCLA 2INCC 4WRDA 4F1SA 2JA8B 4HIKA 4A93B 4G7HC 3DHGC 2Q2UA 3CCRA 2W54A 3NVZA 1O7ZA 4EEWA 2L55A 3NBHA 1IBKL 3T4AC 1QOGA 2PPBC 4DU9A 4FF2A 3GTQB 3TRZA 2ICEC 4A3KB 3W9CB 5C4XG 1IPGA 1B4OA 1PHJA 5IYDG 4HLEA 2DYBA 3OJ4B 2N9XA 1D8LA 5JHBA 1KRTA 3BZDB 3W3AA 3LX0A 2JYEA 2J0JA 5IP9H 5M5XH 4YL8A 2NBUA 2ZCBA 3CMAA 4C7YA 4V190 1WXAA 3VR3A 3TREA 4FN2A 2BOSA 1QZGA 1V9JA 2WXFA 1H8CA 4DK0A 1J8CA 1FXAA 2C7MB 1TIFA 1GVPA 1CA5A 3GDEA 2NR2A 1GAQB 4W9HA 4A3DG 3KF8B 2J7ZA 3AE2B 1S72A 3I4NH 2D62A 4G7ZC 3CC4A 4OX9Q 3VR2A 3O65B 1JALA 3SDLC 3PUWA 5DPWA 1IKMA 5G3LD 2TSSA 3H91A 4C3IG 2HIVA 2EYMA 2D2QA 2LSSA 1WJJA 4OGQC 3S1QH 2O2LD 3OPOA 3PIPA 2N9EB 4YHHQ 3AQQA 4ILWA 1F9PA 4JI2Q 5GROA 1EZ8A 5C0XI 3TEXA 3F2BA 1E5WA 4OIKA 3OTOL 2LGYA 3PHXB 5D7GA 4JI1Q 2JVCA 1N9WA 3DEOA 3FKIG 4CJ1B 4RA8A 5L95C 5JVG3 1YN3A 1WGRA 2N7JA 2BBCA 4HN7A 5LMUL 3AE3B 2A68C 1JC7A 4LLGM 4A3MB 5FO7B 1P7FA 3D31A 5EE0A 4LFCL 5ELEA 3M3YH 1JMLA 1D5XC 2DZKA 4QGUA 2VW9A 1HH2P 2MWSB 1F77A 2MW5A 4KSLC 1TWHB 2KQ7A 1YNTE 2A69C 4K5WA 4JV5L 5EKKA 2IBIB 1EY8A 3A56A 3RD2A 4GU2A 2F0KA 2KDIA 2KBNA 1NEKB 4FXGC 1SFOB 2IO2B 1WGYA 2LZ6A 4GGQA 1EEID 3AEEB 4AJWA 4ZRQA 3L3OC 1IW7C 2K39A 1EYAA 3N20C 1MGSA 5E4WC 5M5YH 3Q3MC 3IRBA 3RPFC 2E75C 5J18A 2N78A 2R93H 4NMZA 2BPSA 1AE2A 1EYGA 1PH6A 1Z7TA 4IPDA 2B2TA 1CQFA 1EUVB 2IY0B 4JGHB 5DPSA 4A3BH 3W1SA 4HKZE 1U4RA 2EIFA 4WH4A 2LXCA 3PS6A 3GTLB 2YVCA 5F2DA 1XNRL 3PO0A 1JB3A 2LGSA 1O7YA 4RFBA 3U9SA 5I9PA 3APDA 3NZ3A 2LXAA 3IG3A 1Q7YC 4DV5L 4A3GG 1SNMA 2F4VQ 2W9NA 4IO9A 4BBRG 1IUEA 1I4PA 1VMPA 3PQIA 3TDQA 4AIMA 2MJ3A 2Z0DB 1KLVA 3VR9B 2P5ZX 4OW0A 2K4KA 1LTTD 3RNBC 3U4EG 2KXJA 3KWLA 5E6NA 1SYEA 3MHBA 2B3AA 2F0WA 4DV2Q 4A3EB 2M2LA 4HIDA 1HTPA 1HNZQ 1CQVA 1L6UA 2BS4B 1NE3A 2J0KA 2JQRB 3E56A 4R3DA 5CV8A 4RM8A 1P9DU 4WWNA 4YSXB 2OEOA 2I46A 3QG1A 4CDCC 4JI6Q 3Q2AC 4TRDA 3T3NA 2L52A 4II3B 1VRAB 2Y0SE 2PEAA 4LF5L 5E6PA 4ACFA 4W9JA 1TY0A 5EE1A 1JWAD 2AL3A 2EYJA 3S1MH 3T56B 3IAM1 4N8FA 1RIPA 5LXIB 1ROEA 1IL8A 1STYA 2DNCA 4DGZA 2EYLA 4DUZL 1D2BA 4BKTA 3RZWC 1ET6A 4XQQA 3APCA 3AE1B 1EY6A 4R4IA 4LMQD 1J5EQ 4EQ5A 5IP7H 2PZWA 1N8RC 1VQMA 2CJNA 1QF6A 3NZSA 4BA2I 1E8YA 1SNCA 3T53B 4C3HH 3T1HL 1QVFA 2GBMA 4K6DA 1WMHB 1N63A 2A5UA 2MX2A 2LMCB 3R2IA 4IJHA 1VQOA 1OEYJ 4JL9A 3RN9C 3PIO3 5L83A 1SNQA 3ZYYX 2H89B 3KF6B 2LGDA 1RFAA 2M19A 3FP9A 3DHHC 4IOCA 2G5DA 3MTSA 3W5UB 2CH4W 1C9OA 1PGXA 2MH7A 2I5MX 3AEDB 4ANXA 3VA5A 3ECIA 1C78A 1YN4A 4ZRZA 3OW2A 2HJ8A 2KWVB 4AQYQ 4HSVA 3NS1A 3IT6B 4K3BA 3GP7A 3Q0AA 5BYRA 1NUCA 2E2IH 2JU6X 3I90A 2WYQA 3I5JC 3LDZE 2ZVOA 2RDGA 4LJOB 3RMHA 5AJ3L 3PIP3 2ONQA 3ZDTA 2BVCA 2K14A 4KK7A 2ENBA 3AFQA 4LF8Q 3C0RB 5C5LA 2SOBA 1A62A 1H9JA 1S5FD 2L11A 4K2LA 2PI2E 3U4ZA 4OO1I 1KF6B 1WX8A 4RKLA 4BY7B 2G9HD 1XLPA 2WU2B 3N30A 2ZM6Q 1PYWD 2RGFA 1HEZE 4JBJA 2UYZB 4XC2A 3FKYA 5D2MB 4NXMQ 2FAZA 4KIKA 2G9DA 5FJ8H 4NAWB 1NVID 4ITKA 3RT3B 1C3TA 2KDMA 4A3FB 2LD9A 1DD2A 2O6VB 5C0XH 1F9QA 2KD0A 4GN3B 3WA0A 4XQNA 1PFDA 3CCUA 1C9FA 3PZDA 1R7SA 2RD0A 3IFWB 1RJTA 3ZJUA 2QDFA 2PYKA 1PGBA 1N61A 3V3XA 1QNKA 3D8GA 1UWXA 3DBHB 5HY6A 3T3OA 4CKEA 3RZOB 5IYCG 3NRZA 2ZW0A 2KECA 1SIFA 2LWPA 3H9DA 4S17A 1BOSA 1V6EA 1WWTA 1V2YA 1WI0A 2DBYA 1E9MA 4X3TA 1QUQB 3H7PB 4DR2L 1SYDA 4JPBW 1L5PA 2Z1CA 4BA1I 4LF7L 3N3KB 3CF5A 3PO2G 1Q1OA 2KO3A 4WURA 4YWLA 3DBLI 2QGQA 2K05A 4AYBG 1A6XA 2KFKB 3I4LA 1XMOL 4A3OA 4O2DA 4II2B 2L15A 4E71A 1I4XA 2L12A 2WB1E 1ZDXA 5ELDA 5FOBB 4GKKQ 2RVLA 4FXDA 4GS3A 3DLLA 1FVIA 2EQSA 1VJKA 1J8IA 1K8MA 1NBFC 1R4MB 4LCDE 1PUTA 3Q69A 1ILPA 1Y8OB 2L0CA 1QKZA 1HJPA 3UI2A 4NDXA 2RSUA 1V80A 2YEPF 1UE6A 4F7XA 4DFAA 2EXDA 4UP9A 3GTJH 1ZXHA 3I91A 2CS4A 2PE6B 3NJTA 1KNAA 2LFNA 4I6NB 3S16B 4GDLA 1SAPA 1CFMA 4K7UA 2MO0A 4C3JH 3J81E 4LDTD 3WAOA 2CKHB 4YCUA 5C3EG 2ZJPA 2FIFA 4HJKA 4GOPA 3W5OA 1Y1WH 2K5QA 3L16A 4O0AA 1C7YA 3AV8A 4BY1H 2JA6H 2MO1A 2YTVA 2ZNVC 4R9WA 2KLCA 4Z9CB 2R7ZH 5EKLA 1UE1A 5EKIA 1DCZA 4KKJA 3UE0A 3EA6A 3IBEA 3RNGC 4ALPA 2VQEQ 5JEAH 4N9PA 5J1ZA 4KGRA 1JB7A 2RHQB 1VCBA 1EQTA 2AQ3B 2R92G 3Q8AA 2IO1B 3U52E 1EU4A 2F0VA 3ITPA 3MXNB 1B70B 3NELA 2AEHA 2K8CA 2N49A 1ENCA 4CBVA 2L9HA 4QUFA 4ZRKA 1H9SA 4R4CA 2Y5CA 1K8AC 3HOYG 4UP7A 1QCBD 3T9LA 4HDOA 4ZYNA 3T8MA 2JA5B 3ZRCA 4MTKA 2XEWA 5CV4A 3L13A 3RNCC 1XD3B 1GOZA 3DWMA 1XYIA 4WFN3 4KHVA 3UDGA 1P1AA 4JI8L 2PMVA 3LYYA 4KX6B 3MWYW 2WXNA 3K81C 2AMCB 1FO4A 3W1SC 2B2TC 2IZVB 1JQ4A 3BYYB 1HNXQ 5GAGC 3DWQA 3K5NA 2DENB 2KQSA 1KDAA 2B29A 3K5LA 2DY8A 2WXHA 3CWIA 1LTGD 3Q8EA 3A8IE 1TWAH 1FYCA 2K52A 1HPCA 2PW5A 3ZRFA 1VQBA 1PH7A 4HKQA 1WJUA 1EIHA 2KT7A 1OO9B 1ZE3D 4HPMB 4AOFA 3R93A 2WACA 3W2DA 3SU8X 1JRUA 3AULA 1DONA 2HTHA 1D5ZC 5CX3A 4URKA 4DR4Q 3H3VI 1A8VA 3A8JE 2FUG1 4XT3B 2HHHL 4DUYQ 1N32Q 1AWDA 4K7SA 1GNUA 1GC7A 4IKGA 2WB1B 1JJ2A 1DOXA 1X32A 2WV6D 5IGCA 4OIJA 4IM3A 1BR9A 2N7EA 2OHFA 4FHKA 1C1YB 4LNKA 3WALA 1GJZA 4CDEC 2L0FA 2N7DA 3V62A 4ZHPA 4OO1H 1WTWA 4NXNQ 4DV7Q 5AZGA 2WXGA 2IJ0A 1NJIC 4FHJA 3P75A 4MJSA 2F3IA 3CMEA 2VUMB 1EWYC 1MG8A 5M5WH 2CU1A 3S1NH 2A5HA 1VQEA 3I2ZA 4L5RC 4K5VA 3VTVA 5CGKA 4JI7L 4KJNA 4MM3B 2O4XA 2MFIA 3HOZB 5E6JA 1NR2A 2D0OA 4MIUA 2E5LQ 3G6JB 4W9IA 3A54A 1NI2A 3PCOB 2KHWB 2DX5B 2DJFC 5EJWA 4WAAA 4QF4A 2GN5A 4AUQC 1CTMA 3DPDA 4RMAA 1ZXTA 3ZUNA 4A8XC 3J9CA 2KTRB 1V1PA 2JQOA 3HFZB 3ULLA 3IXSA 3TP6A 4GNXA 2XK5A 1QB5D 2CQAA 1B50A 2EJMA 3DM1A 4FXKC 2QSDA 4DF7A 1NSNS 4HK2A 2DNEA 3PO3B 3AU4A 3NBIA 3PV1A 2AKWB 1DXMA 4FO2A 2EYFA 1K3BC 3BZKA 4F8MA 3E5SA 1RTNA 4DV0L 2V4DA 1ICFB 4US8A 5IP9G 2KJXA 1QG7A 3HEJA 2N9PC 1A15A 1UEAB 1VD2A 1EOVA 1E2ZA 3IKJA 4L5TA 4NJ7A 2ZXOA 5IA7A 4DQOC 2N4FA 1E8ZA 2QEJC 1CKNB 1GKHA 3A55A 5C44B 2K01A 3RN2A 1P3QU 1IYVA 1MIUA 2KVMA 3H0GH 1G6PA 3J80i 4IFDJ 2KANA 1PZKD 1VQCA 4JI0L 4GXBA 2XVSA 5KNBA 3I4NG 3VYUA 4RH6A 3S17B 2JA7B 3EIVA 4NPSA 4X3KA 1XNQQ 4NPNA 1JOQA 3VXWA 5KIXA 1BMLC 2KK8A 2HDEA 1WF9A 4DHZE 1EY7A 1O7LA 3F2CA 2AQ1B 1D6EC 2GVAA 3LGJA 1CHPD 3F8TA 4B9KA 2A6ED 1C4CA 3OAWA 1WZ3A 3EGRA 1Z9FA 1TWGB 1JOOA 3CF6E 2Y5BB 3OTOQ 3KUZA 4RWSC 1SMYC 5I6WA 5K36G 3RNFC 4H02A 1DM0B 3BZCA 1YJNA 3I57A 1QOFA 3V61A 5LMUQ 2NTSA 3RR5A 4B0EA 3H6NA 1FNWA 3PF4A 1Z5SB 4HPPA 4TUUA 3BDOA 1ZEQX 3GTOH 1IGDA 2A4ZA 3GTKH 2Y0SG 1K8RB 4K6LA 4DHJD 3J7ZC 4B3SQ 3H1UA 2KHJA 4TSSA 4JV5Q 3FILA 1OFFA 1GC6A 2ZTDA 5IT9L 2WWZA 1I7HA 1Q46A 2R93G 4YWMA 1ZOYB 2VRRB 1XQQA 4XX5A 4M8MA 3N9YC 5T1GA 1S5BD 3E3XA 4C1NI 4YTPB 4BOSC 1U4MA 3TQYA 1P98A 3I73A 4A3BG 3RUIB 1SSOA 3KYHC 1I6HB 3HZXA 3PGEA 3APFA 1I94Q 1H95A 4KV6A 2OTLA 3AMZA 2M1MA 4X62L 1EWCA 4NJ6A 1PH2A 4QB4A 2Q2IA 1HTLD 3PUXA 1ZP0B 2JA8H 5KNDA 2BKRB 3U30A 1PLFA 2D3BA 2KQ4X 4A93H 2V9HA 2CU3A 3EUB2 2J4XA 1WM2A 1EM7A 1G2SA 2I1KA 1KM7A 3WWVA 2WDVB 4KLKA 5C3JB 5LMNW 3J7AF 1YIJA 3Q6BA 5FR3A 3GTQH 2AQ2B 4A3KH 4GOPC 3HKSA 3IVFA 2K8BA 5A2QE 1LT4D 1JJCB 1R9TB 4RG1A 1TWFB 2EJFC 1GUWA 3TEWA 3BJUA 2F0TA 1UH6A 2BA0A 5ISRA 1VQDA 3FKIB 2ZCCA 2DJGC 5C2TB 1PVOA 2FE8A 1K3RA 5G3LF 5JJIA 3ZTCA 5AZFA 2PLPA 4N9F4 2VQFL 1WM3A 3KYCD 2N9LA 3I3TB 4OELB 3A7AB 3CCJA 1C79A 4V0BA 2C7NB 4U68A 1SSNA 5IT9c 2CHBD 1OTCA 4LJPB 3NVYA 3U50C 3J81j 5BN5A 4DXAB 3E0JA 1WXSA 4B3MQ 4A3IH 3A1QB 2ICIA 4LNQA 2BF8B 4FBJB 3B9JA 4HXDA 3M4PA 5IOCA 5HURA 2LY7A 3SK5A 1EIGA 5IP7G 1W2BA 3DXJC 4CDDC 4CGYB 1DGSA 1K0RA 1U0LA 1JW9D 2ASQA 3SR6A 1R4PB 3M4YA 2IX3A 1FJGL 1SE3A 3BU2A 1E7VA 3Q6SA 4C3HG 1WXMA 2JPHA 4ZOHC 3KFUA 1B44D 1NMFA 2Z0SA 1I3QB 1L0YB 4OONA 5CTRC 4E74A 1FPYA 4HJAA 3T1HQ 2R3ZA 3P20A 4KD4A 3AEFB 1GB1A 4A3LG 4L63B 2N1WA 1FFUA 1IYUA 1Q8KA 2MNAA 1S5DD 1YNJD 1KD1C 3N1YC 1OQRA 3HUIA 4JG2A 3UE1A 2JZ3B 3ALBA 3NP8A 1CSQA 4C2MB 4G50A 1MKHA 2JEBI 3AU7A 4IUNA 3I55A 1JROA 1VLBA 1FFVA 1Y69U 3A9KA 1OXUA 1S40A 1TWHH 1VQPA 4PT5A
chains in the Genus database with same CATH topology
1NR4A 4NP5A 5IT9E 3D3RA 1HUNA 1Q1BA 5M3FB 1KLGD 2B2WA 3ZGZA 1GHJA 1CJEA 3IT4B 4DNRB 2PO4A 2WS3B 4JE3B 2K1BA 4LAAA 2D9UA 4KY7A 1PTOF 1WD1A 4CHTB 2N55A 1DOKA 3HOUB 2MJEA 4F88A 2K6AA 3F2UA 5FK9C 4MACA 1WXQA 2AWOA 2B2YA 5C0XG 2ZT9C 1CZGA 2NVQB 2DN8A 2EYOA 5C0XJ 1CT1D 2MGSA 1PTOC 2RPVA 2O5IC 3H94A 1SNOA 1FR3A 2N9KA 5C4ZA 3VR5A 3BVZA 1TKYA 3AECB 3GS2A 4EE2A 1K83B 4HTHA 1S5ED 5NUCA 5JXVA 1HXYD 3K7AB 3V2TA 1C77A 5KYLA 3W5VB 4PNYA 1FNUA 2J0TD 3MJ5A 1Z6HA 2H4OA 3OOCA 4N9TA 1WTPA 1WRIA 4CKCA 1XLOA 4PMBA 3PV0A 3R8BA 4MN3A 1V1OA 3H09A 1KDBA 2PW9A 4C3JG 3URYA 4M0WA 3P4RB 2DY7A 2JP1A 3HOVB 2G1EA 4BBSB 1K50A 5FLXE 4GLSC 2VZKD 4MHEA 1E6EB 2B2UC 2PVGC 4AQ7A 4K14A 3HOWB 2NZ1D 2VXWA 2DYOA 5JEAG 4A6QA 4FXCA 3SFDB 2KHSA 5D65A 1QWYA 2SDFA 3FVQA 1UUPA 1E10A 3MA2B 4HCSA 1RDPD 1LO5D 4UAIA 1K53A 4B08A 1B9MA 2K03A 2KMMA 2YEPB 3C46A 1ML0D 1I4GA 4A55A 2IW3A 4XIGS 3J80E 1GUGA 4NKLA 3S2DB 2MJ8A 2R6GA 1J7BA 1CI3M 5FO9B 5EGTA 3Q8BA 4TMAB 2JZPA 3N52A 3BDLA 3AB5A 2KWDA 2IGHA 1I50B 2MP1A 2W55A 3GB1A 5D14A 1L6VA 3S1RB 2QKIC 1SE2A 4FYDA 3KF8A 1LV9A 2KA7A 1K51A 3P1HA 2I38A 3ND9A 1G91A 2K0PA 5HHDG 4C56C 2C5CA 5BMIA 4OO1G 1VZ8A 3KUPA 3OWFA 1TT2A 4S3SA 2L5TA 2R92B 2WXIA 3NK9A 4OVZA 4E6IA 1TS2A 1DOYA 3TEZA 1B53A 2YU9B 5I4DA 4J8QA 3QB3A 3X3MA 2D5DA 3OW7A 2WNMA 1Z47A 3ZJTA 3NTHA 3QO2A 1SYBA 1ZUD2 3NUHB 5CV5A 1STBA 1FCCC 1BCPD 1WCMB 2WXPA 1C4PA 4IN3A 3M85A 4WWMA 5I9OA 3DMUA 2AWNA 2Q5WD 1AEXA 4HSPA 1ET9A 1QT9A 5CV6A 1OXVA 4XDXA 3T16A 1XF5L 3DWGC 1E0ZA 1TVXA 2NN6I 1V8QA 4ARIA 4HRSA 3V05A 4WIPA 1PRTB 1EFID 4EQOA 1LABA 3TP7A 4RF0A 3AEAB 1JE4A 1CZWA 1XLNA 2SEBD 1XXGA 3RFZB 1QOBA 4ZKCB 1SB3C 1NAPA 3TP5A 2B2YC 2B2VA 3AE9B 2GI9A 2A6HD 3J81L 1AYFA 5EBCA 4BWGB 3M7GA 2ACZB 4IUUA 2PW7A 4EGVA 3VRBB 2F0QA 2QMTA 1OXXK 1SYGA 1T5EA 2N0SB 1F2ZA 4WQMA 1V97A 1KABA 2EPBA 5CR3A 4QCLA 2JXTA 2F0UA 1B2TA 4EQNA 4L2YA 1BUIC 4X3SA 1HZ5A 4RAUC 1ONLA 4LK0M 1WSPA 2WIIB 2DWQA 2KACA 1X3QA 4DAVA 2WXJA 4KKIA 1I6VC 5LL6X 2LMCA 1LACA 1G2TA 4HCEA 1JRPA 4KKSA 1DJRD 5EBDA 4XXEA 1QOAA 1C48A 3VYRA 4PMCA 5KRUA 1GUSA 2JXMB 1BO0A 2EE1A 2PQEA 4KTAA 2XWJB 3C1EA 1A3UA 2BS2B 2Q8IB 3BVMA 1A70A 1DGJA 4IQZA 3CIRB 3KBXA 1VCIA 1HQMC 4GZYC 3BVGA 2AX5A 3AM9A 2F0MA 1Q12A 2PTLA 3HOXB 1HZ6A 2EY2A 4QUCA 3O13A 3MFGA 1DOIA 3QWNA 4OL7A 4ULLA 2Z8LA 5CV9A 3JAME 1SXTA 2MPMA 4YWGG 3SVMA 2V3PA 2KCCA 1N60A 2EY1A 2IX0A 1RF2D 5IGDA 1TR5A 1H9MA 1A2TA 2BTEA 4RGMA 5M9OA 1UGJA 2BE5D 4LTUA 1K52A 1PDQA 2F0IA 3U9OA 1GPXA 2BDOA 3OIPA 2A6EC 3H3VC 3NTKA 1E7PB 1RHPA 3MFYA 3FRPB 1JQYD 3GTPB 3HGBA 1W6JA 2KAJA 1ESRA 1V8CA 4Y7NB 3I4MB 3S2HB 5HI1A 1II3A 2FFKB 2Z4HA 3SHLA 2E2HB 2F0NA 2NN6H 3ERQA 1OQQA 2IGDA 1V43A 4XDDA 2OXPA 3E9SA 3CU7A 3NWTA 1LT3D 3LNNA 4CQNA 1C76A 3BK1A 1EY4A 4HJGE 1PXUA 3MXGA 2WKCA 3ABVB 1G8ZD 3I72A 1XTCD 2L1AA 4O42A 2IDYA 3M7NA 4IURA 3MXNA 2BYTA 1X3PA 4IUVA 3Q23A 3MVVA 1MHHE 2QJLA 2QDBA 1FXIA 5BYSA 2AUJD 2F3WA 3P7JA 2WU5B 1FCLA 4CJ0B 1CA6A 1NENB 3MEHA 4M8AA 3K58A 4YTMB 2NVXB 1GJXA 4Q5VA 1F9RA 1KNEA 2QIEB 2IPKD 1EWHA 4A3JB 1PTOB 3AE8B 3AE4B 4KN7C 1DOMA 1YMHE 2L1BA 2FBWB 1EEFD 3K5OA 1F9SA 1HRJA 2WDQB 1D1IA 1V1PB 2F0HA 1TQOA 1VF7A 1Y1VB 2HDLA 1VR9A 1L4DB 3NHHA 5C5MA 2D2CC 3WCQA 2BCOA 2NBFA 1VDVA 2WINB 2V3NA 5C3XA 2AUKA 3SXHA 1E2VA 3B2GA 2KEEA 4RGOS 5A2QL 1YQ3B 5CYUA 5D3DA 3HKZB 3CRKC 1SYCA 2HQEA 3FMCA 5TSSA 5G5HA 2E2DC 4X3UA 1GUNA 1NCVA 1OXTA 3LB8C 1NYRA 2K33A 4L23A 4ZHOA 4ZKBB 3NQIA 1SBBB 2FHTA 2B39A 2BS3B 2B63B 4N59A 1S4ZA 1SNPA 4FP5D 3DWAA 1PZID 4K2KA 2WXLA 1JICA 3HRDD 3VQIA 3KK7A 2LEKA 1MPEA 2X38A 3R2TA 4ZQ3A 4DXFA 3DUZA 3T51B 2WAQB 3B2FA 1JWUD 2KOLA 2BT6A 2F3VA 3ETRA 5M3MB 1EOTA 1TIID 1JORA 3MP9A 3FEWX 1H9KA 3AEBB 3WOEA 5IGEA 1PZJD 1Y1WB 4NJCA 2INNE 3GQBA 1HUMA 5C4XB 1RD9D 3RD4A 2V4IB 4P6VF 1FNVA 3ZQ4A 2MHVA 1SF0A 4XDCA 4REZA 2F0PA 2J52A 2K7VA 4HEA1 3VYSA 4J3OD 1T5XD 3AE5B 1A3TA 3S15B 1N5XA 4ME5A 1BF4A 4A3DB 2OF1A 3EROA 4AS1A 5FO8B 5DM73 5BN4A 3TZDA 2HCCA 4C3IB 1EYDA 2I2YA 4XTCS 3SEBA 5IGFA 4YT0B 3TSSA 1WTOA 3PUZA 2MUYA 3SE0A 1F2MA 1JWSD 1C4AA 3NXWA 4H0LC 1EY5A 4DNTB 4ZYSA 5H8YE 2LHEA 1G6ZA 3CRLC 4ZUIA 2K5DA 3P4QB 1FGBD 2FJ2A 2B76B 1QLBB 3C3LA 4KKUA 1B9RA 4XYOA 2PKOA 1O80A 2CVRA 5HFYA 5EE3A 2F4IA 2ZXRA 2F0GA 4Q0FA 3K0YA 3OSOA 1STHA 1BXTA 1AZPA 5BMGA 1YQ4B 3DEPA 3WDNA 4GDKB 2XNAC 5FLXL 3OIQA 1HQRD 1Y56A 3OMGA 2N88A 1XWEA 1ENFA 1PMRA 1G291 5EPLA 1IBXB 2RKSA 1K8OA 2M56B 4YSZB 2LS01 4DXGA 1N5WA 4A3GB 2PMZB 2EKIA 2BA1A 4BBRB 3J7AV 2X69A 2RMMA 1PDXA 5DAUA 5H92C 2QCPX 3AE6B 1TKGA 1PRTD 1SDFA 4TQ1A 3FPPA 1CZPA 4OHJA 1TS4A 5IIFA 3FC4A 1B3AA 1NYQA 3S9WA 5IGBA 2YYZA 3D4DA 4EVOA 4JK1C 1HFGA 1J7CA 5C3WA 1ACCA 2XSCA 3BDCA 1BCPF 2XRQD 1MSGA 1WD0A 3J80L 1LTBD 2EJGC 1XEEA 3NUCA 4N6EB 5BMHA 2F1MA 3SDZA 3HG9A 1A2UA 1BCPC 1AFPA 1KRHA 1KFYB 1VDZA 5KGUA 4FNFA 2EVBA 3VRAB 4TQ0A 1BUVT 4U673 1TWCB 3Q8CA 4B9XA 2GA4B 4K8JA 1XX8A 3VA7A 1LT6D 2W3RA 1VF5C 3RLFA 1DZ1A 2K04A 4KI0A 1D1KA 4P2CB 4OZAA 3E6ZX 1LTID 5E4XA 2E76C 3J7YW 1S5CD 1LTRD 4RHRA 4F87A 4OZCA 3VR4A 1GHKA 4USAA 4CJ2C 3S14B 2K5WA 1JOKA 4DAYA 2GRIA 2F0OA 3OHXC 1SIJA 1Q1EA 3IFTA 2RSOA 1Y8NB 3ONAB 5JEAJ 1QQRA 4IUTA 4ZUJA 4PMWA 4KGSA 1J9OA 2JSVX 2FMCA 3G7LA 4EQPA 4Q2JA 2QF7A 1AW7A 2RA4A 1SEBD 4KJOA 2NN6G 2SNMA 4UDUC 3HVZA 4JX1C 2BW2A 1FM0D 1FD7D 3D6WA 3PO2B 4AYBB 4YSYB 2EY5A 1TKEA 3SR1A 3EFXD 2RDFA 4ZRPA 4XT1B 3GTGB 4K8IA 5C4JB 4IFDH 4A3IB 1GB4A 2H1EA 1F2RI 1WTVA 2K22A 2KCNA 5AUIA 1JR0D 2LJIA 1ZPSA 3FDTA 3L9AX 2RBMA 1ZXIA 4P16A 1RKNA 4MT5A 2C9OA 1ZYRD 1TJEA 4YIJA 2X6LA 5CV7A 5JPNC 1XCTL 2L4NA 3RZDB 1TS3A 5C3EB 1YJJA 2ZW1A 3K57A 1E0BA 4JBWA 1MI0A 2NUCA 2CW0D 5LNK1 4B9WA 2QILA 5K36H 2ON8A 2M00A 3CQZB 4HMJA 5I6YA 1PFNA 1RTOA 3A8KE 2WP9B 1EQVA 2RDHA 4HR7B 4I7ZC 4C7ZA 3I8ZA 3NVWA 3QJYA 2BE5C 4H13C 3TUOA 2EYHA 1EY0A 1Q10A 2EZVA 2F0FA 4XYQA 5C6AA 3MHZA 2F0EA 3HOYB 3UI3A 1ENAA 5ELBA 1CM9A 1T3QA 5LHY1 3GO5A 1U9RA 2FINB 2MEKA 1HA6A 4JWUC 3DWPA 4O1NA 1J7AA 2WXRA 5JVH3 2HTME 5IGGA 2LFIA 1PFBA 1IHZA 1LTSD 5EQ0A 1SE4A 3GD7A 3P63A 2K32A 2E2JB 1PTOD 4LJZC 2XN9C 4KN4C 1YNND 2BB5A 1PGAA 3DHQA 3JAML 5D3IB 2B2WC 4H7BA 1BNZA 1HFNA 5E1FA 4K5XA 2NWGA 3Q22A 2SAKA 5DNFA 2X6GA 2RQXA 4R8IA 1EL0A 1GXDC 1HHVA 4HROA 4L6TB 2E3TA 2NVYB 3P42A 1ZKOA 3IAS1 2NVTB 1LLRD 1YJIA 2EY6A 4IZ8A 5JPMC 1MBYA 3TEYA 2O5JC 3EJIA 3NTIA 3K6OA 5BN3A 1TU2B 3PUVA 2JYOA 2LHDA 1F0ZA 4G7OC 4DAPA 1WTXA 3BWUD 4D2KA 2ZXPA 5GXGB 4XQJA 1UNSA 3CKIB 2WXKA 1VMCA 3FPUB 3QIAA 1RFKA 2K28A 5I2XA 2B8GA 1KDCA 2A74C 2I07B 4B0MA 2RSNA 1UWMA 1PFMA 1PTOH 1AP0A 2H88B 4ID6A 5M5XB 1TKWB 1H9RA 2IT1A 5EE9A 3OWEB 2E74C 3LXFA 5G5GA 3SFEB 1ILQA 5FKAC 1MHXA 4RF1A 4XWTA 4IUPA 3MC0B 2IGGA 5J39A 4NAMA 3IL8A 3I4NB 3KQ4A 4RNAA 4IUQA 3K5MA 2WP8J 3I70A 4N58A 4KMUC 4JWSC 3RUZA 3S1QB 5EPKA 5BYQA 2MJDA 1STAA 1P7EA 2W82A 4ODGA 1F2LA 3WOFA 3C8YA 2JEAI 2M0AA 3BIID 3I9V1 5JOBA 1BBXC 3M4OB 4MH8A 5T1IA 3M3YB 2F03A 2A68D 5JJZA 1SJED 2PNRC 1CK1A 2VZKB 1EU3A 4GDLB 3MXUA 1DOLA 2Y0SB 1B9NA 2V0GA 4KY5A 3AEGB 1EY9A 2A69D 5CORA 4H2AA 3BYTB 4JPSA 1AN8A 1GUOA 2VB2X 2EYPA 1KLUD 5M5YB 1LTAD 2R93B 1IW7D 1QILA 1QOHA 1XLQA 1Q8IA 4QIWB 2HCIA 4ABNA 2IWHA 3D6CA 1TZOA 4A3BB 4WAFA 2LKVA 3QOJA 2JSOA 3OMCA 4G57A 1IKLA 4FF1A 3PZ7A 2INPE 2VNUD 1H9SB 5DEHA 2JE6I 4YTNB 3TP8A 3HS0C 4DK1A 1ICWA 3BS1A 1RM6C 1TYGB 2PZUA 4ZAIA 4RKBA 2HUGA 1HCZA 3NVVA 1Y8PB 4M1UB 4TQUS 3GTMB 3SK4A 2J42A 4IOIE 1WYGA 2JWUA 1FD6A 1JCKB 1L0XB 2Y5PA 2NB0A 5COYA 3V96A 1ESFA 1QE6A 3S1MB 3TZUA 2D5GA 1UAPA 4XWWA 2M9VA 1VZ7A 2K5PA 2PVOD 1D5MC 5AFWA 4FF4A 2PCFB 5KYIA 3HRZC 3ZJVA 4C1NK 3P4PB 3Q8FA 3H8HA 1KAAA 2PIAA 4C3HB 3AMUA 1I4QA 4RHSA 2B8FA 2NYZD 2TMPA 4FF3A 2HDMA 3L4PA 3TBIB 5HGTA 3LWEA 5DM63 2WXQA 1JWBD 1U4LA 1Q3LA 5A35A 1L4ZB 1FRRA 2E2IB 4R8NA 1BCPB 3BG3A 3NQTA 2R61A 1DYQA 3AH7A 3MXPA 3KBGA 4IDIA 4L1BA 2Q8RE 1YNJC 4KKTA 5IODA 5JAVA 2B2VC 1AZQA 1PRTF 2DLBA 3AE7B 3GV6A 1Q90A 4I65A 3D4RA 3LWUA 3P4SB 2BDNA 1XCQL 3VR8B 4NZLB 1PRTC 3KLSX 4PV1C 3EQLC 5CBEE 3AN1A 3VR6A 2Q8TA 2KQ3A 3ND8A 2JX5A 2F0JA 2F0DA 2WQYB 3U2SC 5T8IA 1L0VB 2WXMA 4J1MA 3NWSA 3I3CA 1JWMD 3C1FA 1BDOA 4IFDG 3KWVA 4KD3A 2EELA 4KGTA 3QOLA 1YN5A 3A7LA 2Y3AA 3IAYA 3GTJB 5EPJA 3FILB 1SJHD 4C3JB 4HMIA 4A9AA 1WVLA 3N6RA 3BK2A 2B2UA 3L7ZC 3SK8A 4RCOA 4BY1B 2JA6B 3TN2A 3SK6A 3R3OA 2R7ZB 1SNDA 2PZTA 4G4KA 2Z4IA 3PZ8A 1FEHA 4OZBA 4J6HA 1CHQD 2K3UA 4KHZA 2KUMA 4C80A 3MAQA 1OXSC 1WTQA 2VB3X 2SNSA 2LUMA 3Q24A 4H44C 1STGA 1RCVD 5K5PA 4YXDB 3U7ZA 1TWAB 1C8CA 5MPOA 4RGNA 3X3NA 2A73B 5CMDA 5KNCA 4QMGA 2F0SA 3H6MA 4XE0A 1R4QB 2XIWA 1O78A 2L32A 2CJOA 1T6BX 4HEDA 1MSHA 4DA2A 1FRDA 3GV3A 2IX1A 1M4VA 3KLSA 1M8AA 2IL8A 3NE5B 3PUYA 4BS9A 2J53A 2F0LA 5E3FA 1STEA 1EZ6A 1U4PA 2FMMA 2OEDA 5M5WB 3S1NB 4IFDI 4L8JA 1GUTA 4WJWA 1TS5A 1C4QA 1I4HA 1HA5A 3PMFA 4LK1C 3HVDA 2ID0A 5ELCA 1ZYRC 2KN4A 2WLBA 4IALA 1ZDVA 2WKDA 1SYFA 1WTRA 2EDGA 4ZLTF 1QNUA 2CW0C 2XWBB 4ZK9B 3FAHA 1LT5D 1N62A 1XO3A 5KEEA 2XRSD 1MD2D 3D4WA 1EYCA 1MI2A 3KLRA 4HAEA 1RODA 4FVMA 1BQQT 2KEDA 4PQXA 2E6XA 3K59A 3H0GB 1IBXA 5J22A 2LGIA 3EVQA 4A90A 1D4BA 1RWSA 5ELFA 3P1MA 1I4RA 3C2PA 5HG2A 1FIQA 1NI3A 2NTTA 2GB1A 5AUKA 2L83A 4ARCA 1YNNC 1RYJA 5C4HA 4NW2A 3IFDA 3AB9A 2W3SA 1KH0A 1SMYD 2DYMA 2K9XA 1QJOA 1WGKA 3VYTA 2BB6A 2NMQA 1E2WA 3T13A 3HP3A 5I2YA 3NPPA 3GTOB 1W6KA 1A3VA 2OT2A 3GTKB 1F2RC 3NSWA 2WDRB 4CKBA 5CC4A 1B1ZA 2EXZA 3CHBD 1F2YA 1IGCA 4TKOB 1MVKA 2A6HC 2JYTA 3TMEA 5LL6S 1TY2A 3MZ5A 1KTKA 5CBAE 4RGTA 1STNA 4KY6A 2EOTA 4DN4M 1FMAD 4RCNA 1VZ6A 4WORA 4WRDA 2JA8B 4A93B 4G7HC 2W54A 3NVZA 1O7ZA 2L55A 3NBHA 3T4AC 1QOGA 2PPBC 4DU9A 4FF2A 3GTQB 2ICEC 4A3KB 1B4OA 3BZDB 3W3AA 3LX0A 2JYEA 4C7YA 4V190 3VR3A 2BOSA 2WXFA 4DK0A 1FXAA 1CA5A 1GAQB 2J7ZA 3AE2B 2D62A 4G7ZC 3VR2A 1JALA 3PUWA 1IKMA 5G3LD 2TSSA 4C3IG 3H91A 2EYMA 4OGQC 2O2LD 3OPOA 4ILWA 1F9PA 5C0XI 1EZ8A 3TEXA 4OIKA 5D7GA 3DEOA 4CJ1B 4RA8A 5JVG3 1YN3A 2N7JA 2BBCA 4HN7A 3AE3B 2A68C 1JC7A 4LLGM 4A3MB 5FO7B 1P7FA 3D31A 5EE0A 5ELEA 1JMLA 1D5XC 1F77A 1TWHB 1YNTE 2A69C 4K5WA 5EKKA 1EY8A 3A56A 2F0KA 1NEKB 4FXGC 1SFOB 1EEID 3AEEB 4ZRQA 3L3OC 1IW7C 1EYAA 1MGSA 5E4WC 3RPFC 2E75C 4NMZA 1Z7TA 3W1SA 2B2TA 1CQFA 4HKZE 1U4RA 4WH4A 3GTLB 5F2DA 3PO0A 1JB3A 1O7YA 4RFBA 3U9SA 5I9PA 3NZ3A 1SNMA 1IUEA 1I4PA 1VMPA 3TDQA 2MJ3A 3VR9B 4OW0A 1LTTD 3U4EG 3KWLA 1SYEA 3MHBA 2F0WA 4A3EB 2M2LA 1HTPA 1L6UA 1CQVA 2BS4B 2JQRB 3E56A 4R3DA 5CV8A 4YSXB 2OEOA 2I46A 3QG1A 4TRDA 3T3NA 2L52A 1VRAB 1TY0A 5EE1A 1JWAD 2EYJA 3T56B 3IAM1 1ROEA 1IL8A 1STYA 2DNCA 4DGZA 2EYLA 1D2BA 1ET6A 4XQQA 3AE1B 1EY6A 4LMQD 2PZWA 1QF6A 2CJNA 4BA2I 1SNCA 3T53B 4K6DA 1N63A 2LMCB 3R2IA 3PIO3 1SNQA 3ZYYX 2H89B 2M19A 3MTSA 3W5UB 3AEDB 1PGXA 2MH7A 3VA5A 1C78A 1YN4A 4ZRZA 4HSVA 3NS1A 3IT6B 3GP7A 3Q0AA 5BYRA 1NUCA 2JU6X 3I90A 2RDGA 3RMHA 3PIP3 2ONQA 4KK7A 2ENBA 5C5LA 2SOBA 4OO1I 1H9JA 1S5FD 2L11A 4K2LA 2WXOA 1KF6B 1XLPA 4US9A 3W9CB 4RKLA 4BY7B 2G9HD 2WU2B 1PYWD 1HEZE 2G9DA 4NAWB 1NVID 4ITKA 2KDMA 4A3FB 1DD2A 5C0XH 1F9QA 4XQNA 1PFDA 1C9FA 1R7SA 1RJTA 3ZJUA 2PYKA 1PGBA 1N61A 3V3XA 1QNKA 3D8GA 1UWXA 3T3OA 4CKEA 3RZOB 3NRZA 2ZW0A 2KECA 1BOSA 1WWTA 2DBYA 1E9MA 4X3TA 1SYDA 1L5PA 2Z1CA 4BA1I 4WURA 2K05A 1A6XA 3I4LA 1I4XA 2L12A 1ZDXA 5ELDA 5FOBB 4FXDA 2RVLA 1VJKA 1J8IA 1K8MA 1PUTA 3Q69A 1ILPA 1Y8OB 2L0CA 1QKZA 3UI2A 4NDXA 2YEPF 4F7XA 4DFAA 1ZXHA 3I91A 1KNAA 2LFNA 3S16B 1SAPA 1CFMA 3J81E 2K5QA 3AV8A 4R9WA 4Z9CB 5EKLA 5EKIA 1DCZA 4KKJA 3EA6A 5JEAH 4N9PA 5J1ZA 4KGRA 3Q8AA 1EQTA 2AQ3B 3U52E 1EU4A 2F0VA 3ITPA 1ENCA 4CBVA 2L9HA 4QUFA 1H9SA 2Y5CA 1QCBD 2JA5B 5CV4A 1GOZA 3DWMA 1XYIA 4WFN3 4KHVA 2PMVA 3LYYA 4KX6B 3MWYW 2WXNA 1FO4A 2B2TC 1JQ4A 3BYYB 3K5NA 3DWQA 1KDAA 3K5LA 2DY8A 2WXHA 3CWIA 1LTGD 3Q8EA 3A8IE 1FYCA 1HPCA 2PW5A 4HKQA 1EIHA 1OO9B 1ZE3D 3R93A 2WACA 3W2DA 1DONA 1D5ZC 3A8JE 2FUG1 4XT3B 1AWDA 4IKGA 2WB1B 1DOXA 1X32A 2WV6D 5IGCA 4OIJA 1BR9A 2OHFA 4ZHPA 4OO1H 1WTWA 2WXGA 2IJ0A 3P75A 2VUMB 1EWYC 2A5HA 4K5VA 5CGKA 4KJNA 4MM3B 2O4XA 3HOZB 5E6JA 1NR2A 4MIUA 3G6JB 3A54A 5EJWA 4QF4A 1CTMA 1ZXTA 4A8XC 3J9CA 1V1PA 3IXSA 3TP6A 1QB5D 2CQAA 1B50A 2EJMA 3DM1A 4FXKC 2QSDA 4DF7A 1NSNS 2DNEA 3PO3B 3NBIA 1DXMA 4FO2A 2EYFA 4F8MA 1RTNA 3E5SA 2V4DA 4US8A 2KJXA 1QG7A 3HEJA 1A15A 1UEAB 1E2ZA 3IKJA 2ZXOA 4DQOC 2QEJC 3A55A 5C44B 2K01A 1IYVA 2KVMA 4IFDJ 1PZKD 2XVSA 5KNBA 3VYUA 4RH6A 3S17B 2JA7B 4X3KA 1JOQA 5KIXA 1BMLC 2HDEA 1EY7A 1O7LA 2AQ1B 1D6EC 1CHPD 2A6ED 1C4CA 3EGRA 1TWGB 1JOOA 4RWSC 1SMYC 5I6WA 5K36G 1DM0B 3I57A 1QOFA 2NTSA 4B0EA 1FNWA 3BDOA 1ZEQX 1IGDA 4K6LA 4TSSA 3FILA 1OFFA 5IT9L 1I7HA 1ZOYB 3N9YC 5T1GA 1S5BD 4C1NI 4YTPB 1U4MA 3I73A 1SSOA 1I6HB 3HZXA 4KV6A 3AMZA 1EWCA 4QB4A 3PUXA 1HTLD 1ZP0B 5KNDA 1PLFA 2KQ4X 2CU3A 3EUB2 2J4XA 1EM7A 1G2SA 2WDVB 5C3JB 3J7AF