1SXTA

Staphylococcal enterotoxin type a (sea) co-crystallised with zinc
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
224
structure length
224
Chain Sequence
KDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Superantigen
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN TYPE A
publication title The Co-crystal structure of staphylococcal enterotoxin type A with Zn2+ at 2.7 A resolution. Implications for major histocompatibility complex class II binding.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 61
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sxtA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sxtA02
4TSSA 1TS5A 1RCVD 2QILA 4RGNA 3EA6A 3GP7A 5D3DA 1YN3A 1PZJD 1RDPD 1T5XD 1S5DD 2IPKD 4ZYSA 1TS2A 4RGOS 4RCOA 4UDUC 1AW7A 5D3IB 1PRTF 3W2DA 2SEBD 2XNAC 2TSSA 1S5ED 3MFGA 1LO5D 1EWCA 2IJ0A 2G9HD 3R2TA 4RGTA 4C56C 1FGBD 1CHQD 1BCPB 1L0XB 1KTKA 3R2IA 4RHRA 1JCKB 1LT4D 1S5BD 1PTOB 1BCPF 1LTBD 1D5XC 1LLRD 1I4RA 1LTGD 3SEBA 1JWMD 1YN4A 3BVGA 1PTOF 1LTSD 1TY2A 1V1OA 4OHJA 5FKAC 4O1NA 1F77A 2R61A 5ELDA 1I4XA 1DYQA 1KLUD 4K6LA 1PRTD 4RGMA 1S5CD 3BYYB 3BVZA 1LTAD 1SJHD 5ELEA 2NTTA 1DJRD 1ESFA 2AQ2B 1JWSD 1RD9D 1RF2D 1EEID 1SEBD 1LT5D 1SJED 1L0YB 3DWQA 2XRSD 3DWAA 3BYTB 5I4DA 2J4XA 5ELFA 1B1ZA 1D5ZC 1SE2A 3DWPA 4L63B 1QILA 2RDHA 1STEA 1TS4A 2CHBD 3V05A 2AQ3B 1M4VA 4L6TB 1CK1A 1TY0A 1LTID 1PRTC 1B44D 1HXYD 1MD2D 3EFXD 1S5FD 3TSSA 2RDGA 1I4HA 1EEFD 1PTOH 1FNVA 2Z8LA 1HA5A 1PZID 1JQYD 1AN8A 3BVMA 2O2LD 1UUPA 3O13A 4NZLB 4RH6A 1EU3A 1BCPC 4DXFA 3MC0B 1BCPD 1FD7D 2XRQD 2ICIA 1UNSA 1HQRD 1XTCD 1PTOC 1ENFA 1ET9A 1HTLD 1G8ZD 1LTRD 1PTOD 2NTSA 1CT1D 1JR0D 1SE4A 1EFID 5ELCA 1PRTB 1XXGA 1LTTD 3KLSX 3CHBD 2XN9C 1BXTA 1I4PA 1PYWD 2AQ1B 1SBBB 2WV6D 1V1PA 3R8BA 1YN5A 3BZDB 1SXTA 5TSSA 1FNUA 1D6EC 4RHSA 5FK9C 3OWEB 1SE3A 1FNWA 1D5MC 1LT3D 1TS3A 1V1PB 4BWGB 1LT6D 5ELBA 4RFBA 1PZKD 1ET6A 1I4QA 2QEJC 1CHPD 1CQVA 1JWUD 1KLGD 4Z9CB 4DXGA 1I4GA 3URYA 1EU4A 1GOZA
chains in the Genus database with same CATH superfamily
1AEXA 2D3GA 2WP8J 3L54A 1EY7A 4YXDB 3S1RH 3RFZB 2JEAI 4EQNA 1QG7A 1WJ4A 2KFKA 1HNWQ 1YZ6A 3W2DA 2K14A 3DM3A 1TBEA 4JI0L 4C3JG 2D3BA 2MQJA 2O2VB 2ZW1A 3I9V1 1Q81C 4HRSA 5GMVA 1GB4A 4KD3A 2JA8H 4IWPA 4A90A 3EHVA 1V8QA 4JI8Q 3K5NA 1E6EB 2JWUA 3AECB 3DHIC 5C4ZA 3VR5A 4GXBA 2BKFA 3S14H 1V80A 1GC7A 4RHRA 3HOYH 2IGDA 3Q3JA 5EPKA 2BS3B 1VMCA 3P4QB 4MT5A 4US8A 1E9MA 2E2DC 2F52A 4IKGA 4LF4L 1EYDA 2VQFQ 1R9TH 4S17A 1V1OA 2FFKB 3ZXVA 5EQ0A 2C5LC 2FBWB 1RYJA 2JQRB 3IAM1 1E22A 4QL5A 4XT1B 3T1YQ 3IFWB 5BMIA 3SGIA 1HFGA 4DV5Q 2KECA 2ZPYA 1FCCC 4YHHQ 2JSOA 2MUYA 3PUWA 1RF2D 1EEID 1X3EA 2SDFA 2HTME 2SNSA 3HOUB 2N7DA 4EGVA 2B76B 3OW2A 1GB1A 2BE5C 4P71A 4DR6L 1EFWA 4IUVA 5I4DA 1A15A 1ZXTA 3T1HL 3D3RA 3RR5A 4A3JH 1SNPA 2JRHA 1WR1A 5LMNW 2A4ZA 1SE2A 2NVTH 3DWPA 1RAXA 3EFCA 3T3NA 1NTGA 1NE3A 2JE6I 2I5MX 3J7YW 2GBJA 3ZRFA 4XC2A 4BBNC 4ME5A 1OTRB 3BK1A 3JVZX 4BS9A 2Z59B 4NPSA 2WXQA 2MJ8A 3TP5A 2WAQG 1HXYD 4JI4Q 2KTRA 2Z0DB 3C8YA 1I5FA 2FCSA 4JGHB 2KHJA 2XGTA 3EQLC 4IUNA 5CR3A 1EY9A 4YWKA 3ZUNA 3T53B 4LF6Q 2QKIC 3MC9A 2Y0SB 3TEXA 3ZTCA 3SK8A 1WX9A 2ZXRA 2ZEQA 1CA5A 1N8RC 5IP9G 2EZVA 3M63B 5BYQA 4M0WA 3PUVA 2CW0C 4YY3Q 1QQRA 4G7ZC 4NXML 1XO3A 2GVAA 4OGQC 3X23A 2M0XA 3PS6A 3AN1A 1YD8U 3CQZB 3NZ3A 1NR4A 2CR5A 2ZVOA 4KZ0A 4D2KA 2RF4A 1FJGQ 3N1XC 1X65A 3AE8B 4UP9A 2UUBQ 3S2HB 3A56A 2DY8A 3CCJA 2Z0EB 4J15A 3VTWA 1W2BA 3EGRA 1G6ZA 1QKZA 4B3ML 1FO4A 4EEWA 2NS5A 3CF5A 4X6AH 3ERQA 2E3TA 1SNMA 1GKHA 3RUIB 2NVQH 3N30A 5KIXA 1WWTA 2PTLA 3KYCD 2KQ3A 4G3XB 5IKCM 5IP4D 4KI0A 2EXDA 2NR2A 1MI0A 4Y52H 2HD5B 1BMLC 3HHMA 4JI1L 2UU7A 2HTHA 4J8QA 4GLAC 3OWFA 2KQ7A 5IOIA 2QEJC 2A6EC 2KLGA 5JHBA 4YCVA 1FPYA 1EU4A 3AV8A 4GU2A 1I6VC 1BDOA 3EJIA 1XMOL 4DFAA 1Q1EA 3NTKA 4JYAQ 4OX9L 3Q3NC 3AFQA 1J7AA 2LXAA 1LYLA 1JJ2A 3APDA 4U68A 3P75A 5E1FA 1T5EA 3UQAA 1FFVA 2XK5A 2L1AA 4NY0A 4CDCC 4MM3A 4HJ5A 2G1EA 4WWMA 1SYGA 2ES2A 3AULA 4BBSB 4UPAA 4OO1H 1L0XB 2HT1A 3NBHA 1WXAA 5DLQE 1J9OA 2ID0A 4RNAA 2D3CA 1C77A 1VQEA 3I4OA 2FJ2A 2JA5B 2KOLA 1C1YB 1LQBA 3UF8A 1TWAH 4M00A 4B6WA 1ONLA 5KYIA 3SD5A 1PRTD 1IYJB 2IO1B 4A20A 2C9OA 4G11A 3K0XA 3TMEA 1FFUA 4BXXG 1FL0A 5EBCA 3W1SC 4C4VA 4J1MA 1YBYA 3MC8A 2CKHB 1SJED 4XZ4A 1UE6A 1LGRA 4IFDH 2CHXA 5C3WA 4WQOB 1UBIA 1PFSA 5JJLA 3V3XA 4P75A 1K8AC 3VR2A 2RKSA 2JXXA 3QK0A 1XJVA 4BY7B 5J39A 4L63B 4UAIA 2ZJRA 5C3EH 4IOIE 4E71A 2Z0SA 4FXGC 2F0UA 4LF5Q 2H4OA 2CU1A 5AUIA 5C0XI 4LF8L 1FXAA 3K7AH 4UP8A 2YU9H 4ZRZA 5AZFA 4KKUA 2MBBB 3AEEB 1PQSA 1RFAA 2D2CC 4B3RL 2NN6G 1U5KA 2ZNVC 4A3GH 3P7JA 2R2QA 4BOSC 4HPPA 1L2NA 2AL3A 4NKLA 2PMZE 3WANA 4IC7B 5KYLA 3ZVVA 4MH8A 2GI9A 2Z4IA 4BA1I 3L4PA 2NVYH 4DR3L 2YVCA 2J0JA 2DWQA 4O42A 3A9JA 3TN2A 1G6JA 3W1SA 1NBFC 3CC2A 3TCAA 2AYOB 2PW7A 1UAPA 5BN5A 2JA8G 1C9OA 2F0KA 2C5CA 4DV0Q 3HOYG 2A69D 1VQAA 2REXA 3Q23A 4AYBG 1YNTE 3C46A 3HOXG 1B7YB 2L32A 4RHSA 4DNRB 1RTNA 1GUGA 1C4CA 1EO6A 4DDGD 1E2WA 1EWHA 2IWHA 2F1MA 1DZ1A 4ZHPA 4DDID 2MWSB 4IO9A 1UE5A 5J1ZA 1GPXA 4DV6L 3RT3B 1YIJA 3JSVB 2V3PA 5ELOA 1L1OC 4OVVA 1S4ZA 4WJWA 5BR8Q 4OWTB 1VQPA 1NDDA 1H9RA 1ZDXA 2CQOA 4S3SA 1GC6A 3GTKH 2EYFA 1AW7A 4HLEA 1STHA 3G7LA 4MJSA 5CHWA 1A5RA 4X3KA 2D5DA 1SDFA 4YCUA 5LHY1 1X9NA 4HPMB 1OFFA 4P1BC 3NELA 4C3IH 2B63H 4C00A 1HNWL 4NAWB 1H4RA 2EIFA 3R7RA 3UE1A 2JWZA 4HDOA 2YEPB 2JYTA 2KQ4X 1S5BD 3QQ8B 4JI8L 4QF4A 2K6DB 4W9LA 1A8VA 4NDXA 3P42A 4JG2A 3PRZA 4B0MA 3HP3A 1WMHB 3I55A 3FMCA 2BYFA 2B29A 4G57A 4CHTB 2WB1G 1K73C 1EUJA 4HCNB 3A8JE 1DYQA 2AWOA 1LABA 2VQFL 4N6EB 1LACA 4J6HA 3JAMi 3F2DA 2O6VD 4LLGM 1BKBA 3PUZA 3MXUA 2IGHA 2LGYA 2V9HA 2JZPA 1E7ZA 1L1OA 4IOAA 1B53A 4IURA 3T1YL 2ZXOA 1RHPA 1SYFA 5LNK1 4DV5L 3DWAA 4LCDE 4YHHL 2DYBA 2GN5A 1TT2A 5A2QE 2C7HA 2OJRA 1Z47A 4O2DA 1NI3A 3BY4B 2GBKA 3MXNA 1TWCB 1EY5A 2F0WA 3K9PB 3RNAC 1B1ZA 3AYHB 3GTOB 1JWAD 3VDZA 2PQEA 3I4MB 1QILA 3D32A 3Q3FA 1JT8A 4A4IA 2WHIA 1QNKA 3AE5B 3L10B 3E9HA 3VR3A 3JW0X 1XEEA 3PSIA 3MEFA 4FP5D 1YJNA 1HA6A 2I07B 5D2MB 4K8IA 4JK1C 2Q2UA 4DK5A 4GMVA 2WKCA 4I6PA 2ASQA 1SYEA 1LM8B 2EKEC 1PTOH 3WAPA 4JI4L 3DBLB 3DBSA 3PRMB 4H2AA 3BVMA 1PHJA 1X6OA 2EY2A 4LF6L 4OWXB 2D07B 2G9DA 2MP1A 3S16B 4B3TQ 3H7PB 1VQBA 1YITA 2MSED 1G8ZD 2C9WB 3Q8FA 4EOYA 3PQIA 1P98A 3D6CA 2CFMA 2YTXA 2GB1A 1KOTA 2XN9C 4MGYE 2NVXH 2A69C 4LK0M 1YN5A 1FJGL 1V43A 2E6XA 1S3SG 2ZNVB 1B3QA 1XQQA 2D2QA 2EXZA 4K6DA 1X3QA 4C80A 5TSSA 4IW0A 2UUBL 3KJPA 3TZDA 2FIFA 3FRPB 3K81C 3GB1A 2QW7A 5C6AA 1QOBA 3VUWA 1CZGA 1LT3D 4N8X1 3VXWA 3RZDH 2VH1A 3RPFC 5ELBA 2NBUA 4LUVA 2ZTDA 1DGSA 1KNAA 3D4RA 5DM63 1CQVA 3AE1B 3HIZA 1YN3A 1TZ1A 1NBWA 2PQAB 3TBIB 3J81c 2ON8A 3A4SC 2EMSA 4PK1A 2GMIC 1VQNA 1V86A 4IUUA 4WORA 1Y1VH 3S1NH 1T5XD 4OW0A 3WIMA 4ZKCB 2JPHA 1M8AA 2AKWB 1D3ZA 4UDUC 3LXFA 3KF6B 4W9EA 1D7QA 3MFGA 1C8CA 4JYAL 3GTGH 1EWIA 4RM9A 3STBD 1SYDA 5AZHA 4L2YA 4C3HH 5EPLA 1N32Q 2QF7A 1KQSA 1JW9D 3OSOA 5GXGB 3F2CA 2KMCA 4AYBE 2BB5A 4C2MB 1VLBA 2DZMA 1B9RA 2L12A 4R1JA 1HHVA 5CYUA 5IP7G 2YYZA 2BWES 3FPPA 2N9KA 4FXDA 4A3DB 2F0VA 1CZPA 1ROEA 1WFYA 4LFBQ 2GVBA 1LM0A 4IZ8A 4C1NK 2BGFA 2G4DB 3U7DA 1QVCA 2KYWA 3K5LA 3RN9C 5F2DA 3PMFA 3DBRB 5IGDA 5EKLA 4F87A 2WIIB 1JWSD 1QF6A 2R93H 2A1AA 4IUMB 4LJZC 1MSGA 3WALA 4AJWA 5BO4B 3V96A 4DK3C 3E0EA 1WXVA 3DUZA 3CF6E 4MACA 3NEMA 3EN2A 1H9SB 1IBKQ 1JMLA 3DVNV 4KGSA 5EPJA 5I6YA 3H7SA 4MEMA 3UQBA 1J7BA 1D5ZC 4MN3A 3H91A 2A73B 2RD0A 1RM6C 4GDKA 3G71A 2F0NA 4JI6L 3DBLI 3MXPA 1XWEA 5EGTA 3H8HA 4LTUA 2IY1B 5C4XH 4CBVA 3FKIG 2W54A 4AWJA 3PGZA 3HZXA 2FE8A 4GN4B 2RPQA 4DN4M 4L5SA 1VJKA 4A3OA 2JZZA 4P74A 1PDXA 4LF5L 2Y3AA 3J81L 4TKOB 1IGCA 2MNAA 4HIDA 3V6CB 2GA4B 4I65A 2JZ3B 1WTQA 3T1HQ 3KDFA 3S2DH 5J3BA 1E7VA 4A3CH 1KJTA 3LX0A 2W9NA 3NS1A 1B3AA 1F2LA 2WFWA 5C3XA 1Y1WB 4BY1B 4BZAA 4YTPB 4C7ZA 4IPCA 4FO2A 2E2IB 4C3JH 4NXNQ 3V6EB 1IBMQ 1S3OA 2LMCA 3HM6X 1AWDA 2H88B 4XYCA 1IZ6A 2ATWA 2D0PA 2ZT9C 3CHBD 4DV1Q 1VS0A 4C3IG 4GB9A 5DPWA 4NB3A 2IO0B 1ENAA 2B39A 1WXSA 2IY0B 1V1PA 1KM7A 4DHZE 1ZXIA 3Q8CA 1Q10A 4F1SA 2KANA 4TQUS 3UDXA 2AL6A 4NXMQ 1J0GA 4POFA 2K75A 4G50A 4B3SQ 2JYEA 4DV0L 2KVZA 3I4LA 2LFNA 2EQSA 2OF1A 1J7CA 4ZK9B 1UGMA 2CKZB 2F03A 3OG5A 2K28A 2KVMA 4ULLA 2M00A 1DOIA 4GSWA 5T1GA 4TSSA 3KOJA 3KUCB 2ZM6Q 2HIXA 2RHSB 1B9MA 4LDTD 5M5XB 2K25A 4GOPC 3HOZH 1OQYA 2MRPA 3M4OB 2D11A 4MZ9A 2LVQA 2VZKD 3AE4B 3JAMc 3TS2A 1KRSA 2KA7A 5BR8L 2J7QB 4Q5VA 1J19A 1S5ED 1NENB 1TZOA 4RF0A 3UE0A 1WTWA 4C56C 3IFDA 3HOWB 1NNXA 4JVZA 3KH0A 4GGQA 3RLNA 3STBC 4RM8A 1H8CA 1QZHA 2IBIB 2KWCA 1YNND 2N88A 1IP9A 1P16A 1NAPA 1WTRA 3TRZA 3K58A 5C23A 4OZBA 3S17B 5DPRA 2WAQB 4DBGA 2L0CA 3BVGA 3I73A 2LXJA 3V2TA 5IP9H 1N63A 3A9KB 4QUCA 1PGBA 2R7ZH 3U4VA 1IL2A 4KK7A 3Q8EA 4B9XA 1H9KA 1SFOH 3BVZA 4HIMA 5I9PA 2QGQA 3ML9A 4ZUIA 3AU4A 5HY6A 3IAYA 1A63A 1F2RI 3FKYA 1R4NB 2N9LA 1WM3A 2N55A 4QIWB 3TDQA 3OJ4B 4PNYA 1GJXA 2K0PA 1VQ6A 3NZSA 2DBYA 1PYSB 1A70A 1MHWC 3GTPH 4XE0A 4PMCA 2ACZB 3FDTA 4GOPA 3I57A 1QNUA 3Q8AA 4NP5A 1K0RA 4JW0A 3IKJA 5C0XJ 4HMJA 2INPE 5GQOA 3CPWA 3WOFA 3TS0A 1V2YA 4LJPB 2L55A 1YQ3B 3QA8A 4ZOHC 3KDFB 2V3SA 3B1LX 1I3QH 1WOCA 2L5TA 1TWGH 3V05A 1CUKA 5DPSA 5GROA 2PI2E 4M1UB 2O6VB 4LW1A 5DM73 2MO0A 3VUYA 3CMEA 2M19A 4DHJD 1WH3A 1HJPA 3N52A 2RDGA 4KHPQ 3FEWX 1C79A 1HZ5A 2Z9HA 1WXMA 2NYZD 1N6ZA 2RDFA 1SMXA 2LZ6A 1YJ1A 4WWOA 1T0SC 3CRLC 4N9F4 1JJCB 1PH8A 1Y1VG 1BF4A 1PGAA 4PZ8A 1EF1A 4MNOA 2OOBB 2KOXA 3U52E 4APVA 4TVAB 1HQRD 3EC8A 2VB2X 1XNQQ 1YX6B 4ACFA 4XIGS 3W5OA 3Q24A 3LDZE 2IX3A 2D3AA 3HOVB 3N32A 2IGGA 4L1BA 4YT0B 1N36Q 4PG3A 3W1BA 4B3TL 3VTUA 1XMQQ 4KIKB 4C3HG 5H1SE 2ZVNA 1A62A 2KWUB 3CC7A 3PV0A 1PFDA 1S72A 1JJGA 4MGIE 4EUTA 3I4NH 4K14A 1WCMH 1I94L 2NZ1D 2HIVA 4HN7A 4OVUA 4DR3Q 1N5WA 3AEFB 3PSEB 3NS8A 5CV6A 1JRPA 3U30A 1B70B 5T8IA 2L76A 4KSLC 3NBIA 1LT6D 2HCCA 3AE3B 2F3WA 1TWFH 1HPCA 4XWTA 3NPPA 3VYUA 4DXGA 1KLGD 4DAYA 1X32A 1KABA 3URYA 1I6HH 5FLXL 1PH2A 2R93G 1ENCA 4R4OA 3UDIA 4EQ5A 2C7NB 2V4LA 4FJZA 2W3SA 1K83H 3R7QA 3S15H 3LNNA 4ZYSA 4DWFA 5I6WA 4KV2A 4JBKA 3A7AB 3AH7A 2SEBD 3N3KB 3L17A 1EWCA 3B2GA 3D31A 4ANWA 2M8SA 4Q0FA 2W3RA 4LUZA 3OLMD 1P8LA 2Z4HA 1YNNC 3JYUA 2WDTB 1KDAA 2LRWA 5C4XG 3PF4A 2KDFB 1QZEA 1FVIA 3B6YA 1N34Q 1PGXA 1K8MA 2K6QA 4A3FH 1G291 5DAUA 2MP2A 4X64Q 3NUCA 3W5VB 2TMPA 1N32L 1G6PA 3PF5A 2N8NA 5G3LF 3QB3A 3VYRA 3GTJB 1VQGA 4KLKA 1VZ6A 3L0WB 1WE6A 5DEHA 4A3CG 4R4TA 3Q0AA 5LMUQ 4XQQA 3K59A 3AEDB 3U58A 2F0QA 4YSYB 4PZ7A 1GHKA 5M5WB 4LFBL 1QT9A 4CJ1B 4AP4C 3OYYA 3NVWA 3GTMH 2DENB 3KW5B 1ZP0B 1SIFA 3C0RB 1RLFA 1HZ9A 3RZOB 3RNCC 1YJJA 1X56A 1UZXB 2OQ0A 2OT2A 4L8JA 1EQRA 2KX3A 2L83A 2WU5B 2JA8B 1WYGA 2Y5PA 4B9KA 2X6LA 5E7NA 4A3MB 1L6UA 3M3YB 1PMRA 3HOXH 4P1CC 1X3FA 2K04A 4DR4Q 5K5PA 1IBKL 2ALYB 3A33B 2X38A 2RPVA 4MIUA 3HGBA 4P73A 3ZJUA 4K5WA 3H9DA 3ND8A 1TGZB 2QEXA 4WIPA 2X6GA 2NBWB 5E6NA 3DVGY 1II3A 1PH3A 3VH4B 2MPMA 2FCQA 1BO0A 4X62Q 4GOCA 5LL6X 1M1KC 3DWGC 3I3CA 3H3VI 1HA5A 3H0GB 1N60A 3ZXRA 3NRZA 2NZOA 4IPGA 4JI2Q 2FMMA 5FOBB 4IUQA 4W9IA 3SK5A 5E6JA 1PLFA 3M7GA 4QUFA 3IFTA 2P5ZX 3HOZG 2IDYA 4GKKQ 3OTOQ 3NP8A 1F9QA 1T3QA 5M3MB 1PTOD 4G7HC 2K6AA 2FUHB 1DOXA 5LXHA 4ID6A 4KSKC 1ACCA 1WTHA 5IYDG 4A3JB 4K3BA 1LTTD 2CJNA 4NXNL 3O65B 4K7UA 1IBML 2B2VA 2QA4A 1ZDVA 5KRUA 4EX5A 2WXPA 1EYAA 2B2WC 4X65Q 5CV9A 1EIFA 1MIUA 1YJWA 3R8BA 3HOUH 1WTOA 3Q6BA 3ZKJC 1C3TA 5AUKA 1STYA 2DJGC 1XPUA 3WAMA 2X69A 4DV1L 3X3NA 1FNUA 2L3ZA 3ZIMA 2FXQA 3DVGX 4FF2A 1WXQA 3ITPA 2BF8B 3S2AA 1B4OA 5HGTA 1N62A 3Q2AC 4WURA 1D5MC 3LWUA 1PVOA 2R7ZG 1IBXB 4CDFC 5ELNA 1CKMA 1OEYA 4A3IB 1EZ8A 1U4PA 2WXFA 2ZTEA 4RFBA 4B3SL 4GZYC 1GJZA 1V97A 2UXCQ 3ZLZA 2KVRA 3M3JA 2D9UA 4GNXA 5L95C 4KDIC 4R4CA 2ZXPA 2ENBA 1DOLA 3K57A 3NVVA 1P3QU 1L4ZB 1EOTA 2QHOA 4QGUA 2RCFA 1JOKA 3A5UA 4MTNA 4PS7A 2ZM6L 1P7EA 5C0XH 4BBRG 3CRKC 2ZW0A 3ECIA 4ZKBB 2H89B 1L6VA 2BVCA 3CCRA 3C1FA 4GLSC 1D4BA 5HKHA 3VA5A 1EQVA 2A74C 3NQTA 1X1MA 3RMKC 1SRUA 1P7FA 2KFKB 2B2WA 4QQBX 5BMGA 2CWAA 4US9A 1WE7A 4HMIA 3HKZB 2WLBA 4DK0A 3CMAA 1U4RA 2Q2HA 3G6EA 1ILQA 3A8IE 2MJ3A 4LNOA 5FR3A 2D62A 3J7AF 4M8AA 2V0GA 3B0AA 3P20A 3J81E 1GNUA 5ELDA 1AZPA 1TTNA 4KVGB 1ASYA 4DV7Q 1PH5A 1ICFB 4JWSC 4GN5A 3VYTA 1EQTA 3E9IA 2GLSA 4ITKA 3VRBB 2EJMA 1Q8IA 2RSNA 2V1CC 1LFDA 1WGDA 1A3TA 2JA6G 5KNCA 2K8HA 3D6WA 2LI5A 4WJOA 1O7YA 1K50A 1MG4A 2X8XX 1PYBA 2DYMA 4K7SA 4TRDA 2CU3A 3APFA 2EY1A 4KZCA 1D1IA 1Q12A 2W82A 3MJWA 1IL8A 1Z2MA 5CTRC 4LUOA 4EVOA 2R3ZA 3FILA 4A3KG 5EE0A 1B9NA 3SK4A 2E2JB 2F0EA 4WJ3M 2LHEA 2KEDA 4MTKA 3J80E 3I4NG 2E5LQ 1WCMG 2AQ3B 2XTIA 5EAYA 5IGFA 2ICEC 4JBJA 1V5OA 2BTEA 1OXXK 2F0JA 4BBSH 3X0WA 4LF9L 4EZLA 4YWLA 2CS4A 5CHFA 5COYA 1EEFD 3BZCA 5CC4A 1MHXA 1TKGA 2K1FA 2LVOA 2FAZA 4LNNA 3PO3B 4CDEC 2NBVB 2FINB 3AMUA 3O13A 3N6RA 4KHPL 3J7ZC 2KTRB 2JA5H 4JI6Q 3M4QA 4CJ0B 2LXCA 1BCPD 2LUMA 2H1EA 2F3IA 1E1TA 2VH2A 1DOMA 5C1ZA 1RWSA 1XTCD 1KD1C 4JV5Q 3FAHA 1QCBD 1PTOC 3U8ZA 1ET9A 4FA6A 4ARCA 2K4KA 4M0WB 4W9CA 1SE4A 3DQVA 3CXCA 1MHHE 1E2ZA 4ICUA 3IXSA 1JMCA 1SAPA 2A5UA 4HTHA 3NHEB 4NW2A 2XWJB 2G45B 3NWSA 1XNQL 1E8XA 5C3EB 1VQKA 3SR1A 1FM0D 2BKRB 3CSTA 4F8CB 1ASZA 1BBWA 2JJQA 1HRJA 1LV9A 5KGUA 2PVOD 2PE9A 3R3MA 4FXCA 5AZGA 3BG3A 1GUNA 4P2CB 5IP7H 1HTPA 1N36L 4A3FG 1XMQL 5M5YB 1L5PA 5E3FA 1Z6HA 3MZ5A 1Y8RC 3ZNGC 3GV6A 5IT9E 3F2UA 3KUPA 4IQZA 2IO3B 3I70A 1PH6A 2QJLA 1TQOA 4CJ2C 4LFAL 4A3GB 3CC4A 2K3UA 5D6JB 4Z9CB 2PYKA 3A0JA 1ZGUB 5T1IA 3S1QB 2CWPA 1WGYA 2HDMA 5G55A 1WD1A 3BDLA 5D3DA 2M56B 4OXPA 4PS3A 5E4XA 4L5RC 5M3FB 1Q86C 2MBHA 1AARA 2RR9A 4LWCA 3UI3A 2INDC 2DLBA 4PT5A 3NJTA 3J9CA 4FXKC 2A6HD 2KAJA 4OL7A 2LGSA 2WX1A 4WJ4A 3GS2A 2PW5A 1TXYA 1TIFA 3U4EG 4RA8A 2BH8A 3FKIH 1ISNA 2RDBC 3IHPC 3P4PB 2KJRA 3ULJA 4WJQA 1Y8PB 3I5JC 2KK8A 3EBEA 2SNMA 4QB4A 1LT4D 3L3OC 4KV6A 1N61A 1VRAB 4BVUC 2XK5B 4PYZA 2NPTA 1K53A 4MM3B 1JWMD 2HD3A 5J22A 2IZVB 1LTSD 2EY5A 2ZPNA 1QVGA 1E7PB 4FF1A 1N34L 1NYRA 1K0SA 3NBHB 3TEWA 3QWZB 1C78A 4X64L 5JHAA 3M85A 1UELA 1VQJA 1NI2A 5ELEA 2QCZA 2INNE 2KMMA 2CVRA 2UWQA 4OWWB 1WYDA 5FO7B 2EYOA 1A2UA 1IXRA 1ZE3D 4DF7A 1QLBB 4XT3B 5LMUL 1OQQA 5FJ8H 3T8MA 2QDBA 2R7FA 2Q8IB 1UF0A 2DX5B 2F0FA 1U4AA 4HPLB 2N9EB 3OAWA 2N7EA 3NOBA 4U673 2B63B 1BUVT 2F0HA 3HOUG 2PNRC 2BWFA 5H92C 3NENA 4C4VB 4P72A 2LKVA 3GV3A 1H9JA 3AEVA 1JWBD 3A5ZB 4FJVB 2PMVA 2K05A 1KC8C 4II2B 4YSZB 4KKIA 1WR6E 1Y56A 1IHZA 3RI7C 4QIWE 4X57B 4UP7A 3H6MA 2I1KA 1PRTC 3GTQB 1B50A 2AWTA 4LNFA 1U9RA 3BS1A 4DR4L 4II3B 2SOBA 1KF6B 2JRIB 4DV2Q 2JY6A 2WGSA 1PZID 1QUQA 2N4FA 1L0WA 4DR7L 3UDGA 4HKQA 1KH0A 4C7YA 1EU3A 2Y0SG 1BCPC 3A8KE 4ZQ3A 4X62L 5FLXE 1VQDA 2L1BA 1HFNA 1HTOA 3K9OB 1HZCA 3W1YA 1RL2A 1T0RC 1IYFA 4R8IA 4JI2L 3TL5A 4PYUA 5ISRA 5C0XG 1F2RC 4TQ0A 2Q8RE 2I5LX 3AFPA 4EZJA 4DXAB 4GKKL 4X3TA 3OTOL 1B8AA 4DR2Q 3VQIA 4K7WA 1BNZA 4JWUC 3KBGA 3LJ3A 3HS0C 2PPBC 5FO8B 2EY6A 3U9SA 3A9JB 3CCLA 4LNIA 3AQQA 2KXJA 2WXRA 1EIYB 3PUXA 3BZDB 4GDLA 4FBJB 1SXTA 2R92B 2IY5B 2MHJA 4ABNA 1TWCH 4HIOA 4W9KA 4X65L 3OWEB 5HI1A 3GTOH 1UWVA 2JXMB 3QG1A 1PUTA 1QE6A 5G2NA 1FXIA 3RULA 4TV3A 2F0SA 5IWAQ 1VQLA 1ML0D 1CZWA 1KAAA 3QIAA 4PS8A 2JP1A 3RNBC 4DUYQ 1NSNS 4DV4Q 3L08A 3DMUA 4K8JA 1WX8A 4JIOU 4A93B 2KX0A 2N7JA 3M7NA 2FCNA 2FNJB 2HHHQ 1CKNA 2UXCL 2IW3A 1ZKHA 1I94Q 1C48A 3IT6B 3PV1A 2OQKA 1F1HA 1EM7A 1IW7D 3J7A5 1OXVA 1FR3A 2PPHA 2A6HC 3D4WA 1WJ6A 4FULA 4UHVA 4ZDVA 2KZRA 1JOOA 2NVXB 3S16H 4AOFA 2FUG1 1YHBA 4G0NB 1QB5D 4CO7A 5KNDA 2DZJA 3UIPB 1KTKA 1DONA 1QJOA 2F4IA 5EKKA 1HZ6A 4TUUA 4YTMB 4MJSB 4EQPA 1L7YA 1FYCA 5DCNA 3R3OA 4BBSG 2PW9A 2K39A 3K8AA 2JUOA 1TY2A 3NUHB 4A3BB 5JAVA 3Q3MC 1YNJD 2F0GA 1HR0Q 2AUKA 4NMZA 5HGQA 1H95A 1E8ZA 1SIJA 3PT2B 2QDLA 1XTDA 4W9FA 3PO2B 4WAFA 4RKBA 3SK6A 4Y7NB 2JA5G 1HE8A 1EZ6A 3C1EA 1TVXA 1WTXA 1ESFA 1LXDA 2QC8A 1WIAA 4KGRA 4DV7L 3DVNU 2K03A 4X3SA 2RQXA 1F9SA 1SB3C 2F3VA 4WFN3 1SSOA 4K1RB 4QJFA 3CU7A 1ILPA 1L1OB 3KYHC 1F52A 2WS3B 1SROA 3L7ZC 1IYUA 5JPNC 1K8OA 3HUIA 3PRPB 1C9FA 1STEA 1WX7A 2L15A 3MHBA 1EIHA 1WSPA 1XCTL 1ZXHA 1OXTA 4JI5Q 2KJ6A 4L6TB 2MFIA 1BT0A 1TY0A 4K3CA 3MXNB 1WRDB 4TQ1A 4FADA 1D8LA 1ZPSA 5CBAE 4OELB 2E5LL 2VUMB 4AJYB 1HUNA 2NCNA 4XWWA 5IIFA 1FRDA 2KNBA 3AM9A 4BKSD 4EFOA 4IWOA 3VAWA 1M90C 3VA7A 4C2MH 2PCFB 1AN8A 4DV3Q 2ZJQA 4A3DH 3TIXA 3HM3A 2D10A 3GTLB 3QAQA 3K6OA 4B9WA 3EROA 4HSVA 3NG0A 2N49A 1QWYA 1L0VB 2L8JA 2OEDA 1AE2A 2DJFC 5IYCH 1JR0D 1E7UA 4FNFA 1WY8A 3RYTA 1AP0A 4FF3A 2JA7B 5ELCA 1PRTB 2PO4A 2M17A 1C4PA 3I63C 1J8CA 4JV5L 4EQOA 2XSCA 3RZWC 4ANUA 1YJIA 1EWYC 3U50C 3MAQA 2EMTA 3BU2A 4KN7C 4IN3A 2E2HB 1VCIA 1WI0A 2G3QB 2KWVB 1J5EQ 3U2SC 1RRBA 5JH5C 2LRUA 1D6EC 5FK9C 5JZEB 4KX6B 2DAJA 2DAFA 1FNWA 1Q3LA 2A5HA 4PQXA 2WXHA 5M9OA 3ZNID 3AU5A 3VTVA 1YI2A 4H44C 5DPTA 2CQAA 3M95A 5KEEA 2HUGA 2RGFA 1OO9B 1VQFA 5JJIA 5FO9B 3PIOA 3SDLC 2SAKA 2LVPA 3EA6A 2F0PA 3PIPA 1YNXA 4L5QA 1ESRA 2B2TA 4C3JB 2OWOA 1TKYA 4MSQB 1EOVA 2Y0SE 5FJ8G 3I72A 1AH9A 2L4NA 2MLBA 3ENEA 5HG2A 3ER0A 1IW7C 4BOZB 3NXWA 5KHOA 4BY1H 3QWNA 2OTJA 3M62B 1LO5D 3VH3B 4G7OC 1T0YA 2E2IH 1FEHA 3Q8BA 2PZWA 3OW7A 1SE8A 3DPDA 3GZNB 5CBEE 4RWSC 2KQSA 4HJGE 1DGJA 3QCAA 3GO5A 4V0BA 1BQQT 1XCQL 3L2PA 2ASBA 1SNQA 4KJOA 1DXMA 2G5DA 1PFNA 4CYEA 3QARA 2KCCA 2PMZB 3FHWA 3L9AX 4IOCA 2NWGA 3DXJC 2Z6KC 1AZQA 1UH6A 4MELA 2AX5A 1YNJC 4A6QA 2RSUA 1KFYB 3GQBA 3KWLA 2V4DA 3DHGC 1E10A 4QMGA 4JI3Q 1YHAA 3Q8DA 2JF5A 4BBNF 3ZJVA 4HXDA 5FR6A 1WF9A 2NTTA 3NTHA 4KY5A 4XTCS 5AFWA 2WXNA 1FD6A 1KHIA 2IHFA 2JEBI 5E6OA 3DHHC 1RODA 4K5XA 1V9JA 2L0FA 3HKZE 5IYDH 5C4JB 4V190 2KD0A 1I50B 2BDOA 4KDLB 5EE3A 4AS1A 2ZCBA 3DBRI 2BCOA 1GUSA 2LASA 4W9DA 3Q6SA 2KLCA 3A1QA 4DQOC 1G91A 3AB9A 4X66Q 3M4OH 3HVDA 1EY0A 2E74C 1YHQA 4WH4A 1XF5L 4PMWA 1KDBA 4CDDC 2G4SA 5EKIA 1TT5B 1IBLQ 5CGKA 3I4MG 2WDRB 1NVID 3IL8A 3EFXD 3NY5A 2R7ZB 4GDKB 1PA6A 1PH7A 1LTLA 3LYYA 3ZRCA 4HJKA 2Z6KA 1FNVA 1SFOB 1WJJA 1NEKB 3IAS1 4Q2JA 3HFZB 5I2YA 3S17H 4QCLA 5JXVA 4ILWA 4WJPA 1F0ZA 4DV2L 1CI3M 1ZYRD 4HIKA 2XRQD 2VL6A 2HDEA 4BBRH 2WXLA 1MI2A 4MSMB 3KLSA 4YCWA 2J0TD 1F2YA 4HCSA 1G2SA 5C2TB 2KDIA 3VR6A 2KN4A 4URKA 3PLVA 2LJIA 2WXGA 2PVGC 4JPSA 4LF9Q 2PE6B 2UXBQ 1K3RA 2EPBA 3A54A 2EELA 1FCLA 4YIJA 1HUMA 1G2TA 1TWGB 3ZYYX 2LMCB 4OONA 1N5XA 4IJLA 2KJHB 2O5IC 2MQHA 2KN5A 4DR2L 4ZAIA 2N9XA 5K36H 1KRTA 3N20C 3N9YC 3QX1A 1SE3A 3V62A 1MBYA 3S24A 1XX8A 1V1PB 3JAML 4DR5Q 1JQ4A 1U4LA 4FDBA 2QCPX 3W5UB 2XWBB 2DUDA 1K52A 3AU7A 1ET6A 2ZTCA 2JA6H 4BKSA 4DR1Q 1Q1OA 3G6JB 2O2VA 1GXDC 1W6JA 3K7UC 5IWAL 5C44H 3ZTDA 3GP7A 2CJOA 1X55A 1WM2A 1RDPD 2KUMA 3PHXB 3VR9B 4DUYL 3LB8C 2MO1A 2Z1CA 4RGOS 4DV4L 4POGA 2GBRA 5IAAC 2N78A 5D3IB 4BAXA 3AE2B 4ALPA 4A3KH 1SNCA 4DK1A 2HHHL 4ZHOA 4LFAQ 5JJZA 2M9VA 3D4DA 3I91A 1WFQA 4ZUJA 2K8BA 1R4MB 1HTQA 3VVWB 1LUZA 1YEZA 3I4NB 3QIJA 3T56B 5CV4A 3HOVH 4LJOB 3H3VH 1I4RA 1SYBA 3CAMA 3QOJA 1UE1A 2K1BA 3SEBA 1JB7A 4ICVA 1E3PA 2FIDA 2DZIA 1PTOF 1UD7A 4OHJA 1GUTA 5J17A 3S1MB 5IY0A 2VNUD 2MJDA 1TWFB 1EYGA 1Q0WB 2ZCCA 1UE7A 1JICA 1HZBA 1GUAB 2BW2A 3PHWB 1MSHA 3S9WA 2K52A 3ZDMC 4A3DG 3PO0A 2YLMA 1T0QC 1HR0L 1TWHH 2AQ2B 5LXIB 3MTNB 2IYDB 4ARIA 4KKJA 3FPUB 2KC1A 5J18A 4N59A 3CKIB 1E0BA 4HJ8A 2HQEA 2I5HA 5IYCG 4XQJA 1PFBA 3SVMA 1Q5WB 1IKLA 2I46A 2WINB 3OIPA 3FC4A 1Y8NB 2YTVA 1A6XA 1CMXB 1R4NI 4W9GA 3DBHB 5LMNQ 4HROA 4H02A 3KBXA 1SE9A 4L23A 1FRRA 4MDKE 4A3EH 2M2LA 4GOPB 1E90A 1QOGA 3MFYA 3MA2B 1I35A 2WACA 5LL6S 2DHZA 2MH7A 5FLMG 3I7FA 1BBXC 1P0RA 1KIXA 5JVH3 1DD2A 4CHKA 1Q7YC 2YV5A 1UWXA 1I4HA 4RMAA 1GD7A 4JI5L 2LUEA 4JX1C 1VR9A 4HAEA 3G48A 3S1RB 1NMFA 5HHDG 1OXUA 3ULLA 4IALA 3IBEA 4KD4A 1PH9A 1ZYRC 2B2VC 1FD7D 3GTMB 1VDVA 1EY8A 2BYEA 4IG7B 2EYHA 1CQFA 2AHOB 4RMFA 4DV3L 4BY1G 1Y1WG 3S14B 3BINA 2AUJD 3HOYB 1C4QA 4RKLA 5M5WH 4AYBB 3RN5A 2HQLA 3KLSX 4QAYA 1G51A 1PYWD 2AQ1B 4A76A 3HOXB 2KJXA 2BA1A 1R9TB 3ZNHB 4ZYNA 4UY8C 3RZOH 3MTSA 4WWPA 3KVFB 4DR7Q 4A3MH 4WAAA 2MEKA 4B08A 1NR2A 3M3YH 3WCQA 3OJ3A 4GNXC 4BKTA 1J5EL 3WAOA 4AIMA 5C4HA 3RCZA 2XIWA 2B8GA 2KHIA 3TUOA 1X3PA 1R4MI 3ZGZA 1TS5A 1RCVD 4WRDA 4HWIB 3WWVA 2E76C 1R4PB 3BWUD 2IPKD 2QDFA 2WX0A 4KJNA 3H0GH 2NVTB 3SHLA 4J6IA 1PRTF 3T4AC 4DAYB 1SYCA 4OIKA 2A19A 3HEJA 3R2TA 1SLJA 2K5VA 3E9SA 2OEOA 1BVSA 5M3MH 1WRIA 3ZO5B 4XDDA 4E6IA 4W9HA 1GVPA 3H09A 2Q2IA 2KACA 3IG3A 3HOWG 2HE7A 3ZJTA 1BCPF 1E1OA 1LTBD 2WB1B 4NNJB 4TKNA 1WVLA 1LTGD 5IOCA 3KK7A 3D0FA 1HNXQ 1HZAA 3A55A 1A2TA 2JQOA 2PI2A 5GADC 4A75A 1OXSC 2PIAA 3TEHB 3RUZA 3ULPA 1C4AA 5EJWA 3CD6A 3PZ7A 1R7SA 5KNBA 1H9MA 3U9OA 2JSVX 1O80A 3BYYB 3DBHI 1LTAD 3PZDA 2MP2B 2WXIA 4HR7B 4DU9A 2J0KA 1R4QB 3Q3OC 5IO9A 3ONSA 3QJYA 2MW5A 3BDCA 4A3IH 4HCPB 4YWGG 1NY4A 3ZQ4A 1CM9A 4JI3L 5JEAH 4DHZB 4MGZE 4FHJA 2NN6I 1VQOA 1Z9FA 3CQZH 4DNTB 1V6EA 2O5JC 1E24A 4IJHA 2YTYA 2NMQA 2UYZB 2UUCL 1UWMA 3A7LA 4MH0E 1V9PA 1CKOA 4N9PA 3RNGC 2AWNA 2EYLA 5G3LD 3G4SA 2NVQB 4RAUC 2XVSA 3S2HH 2K32A 3BZKA 1GM5A 1JALA 2M4NA 4LDTB 4S0RA 5JVG3 2R7DA 4RCNA 3AXCA 1K51A 4FN2A 5K36G 2VZKB 1M4VA 4HEDA 4H13C 4X66L 5CV7A 1XPOA 1XLQA 3NVZA 3SU8X 1XNRQ 5E4WC 2UXDQ 3TQYA 2KCMA 1HNZL 1XYIA 2IT1A 5AJ3Q 4MHEA 4M8NA 2KT7A 1OGWA 1Z5SB 3I56A 2MA9B 1IBLL 2VS1A 5NUCA 4K2LA 1GHJA 2BH2A 2JK8A 2K5PA 4OIJA 4REZA 5C44G 1MGSA 2O2LD 4XQNA 2MJEA 4ZRJA 2UUAQ 1SGHA 1QOHA 3KFUA 1VQ8A 2VQEQ 3T3OA 4YSXB 1UNSA 1HH2P 5BN4A 4K0KQ 3RMHA 5LLIA 5CHVC 2F0LA 2VB3X 3RN2A 3GE3C 4PV1C 1ZEQX 2K5DA 1CT1D 4F88A 1S40A 1MPEA 4NJCA 3K5OA 3AE9B 3MJ5A 2R2OA 4AQYQ 4NJ7A 1BOSA 3M4YA 2JXTA 2XBBC 1I4PA 4DKAC 3SR6A 2INCC 3QO2A 4A55A 3HOVG 1F9JA 1QOAA 1TWAB 3GD7A 1K8GA 2UXBL 3MWYW 3NSWA 3SFEB 1VQ7A 3U7ZA 4R3DA 4ANXA 3JSVA 4JOIC 2L9HA 3KLWA 4OEMB 2MGSA 4XGAB 2E2JH 4GKJL 3DLLA 1Y8OB 2WYQA 1SNDA 1TU2B 1C7YA 2OCEA 1YIWA 2N1WA 2J7ZA 2CCZA 4LFCQ 3P2BA 4DNIA 4AH6A 2BT6A 2EYPA 4WWNA 3J81i 5DNFA 3PTFC 4DR5L 2D5GA 2R6GA 2NB0A 3OPOA 1J6QA 1GOZA 4RGNA 5IN7A 3KYDD 3P1MA 1PZJD 1XD3B 4N58A 4NAWA 2KEEA 3EUB2 3PO3H 4DR1L 2KCTA 2B3AA 4M8MA 3OMCA 3U4ZA 3H1UA 2TSSA 3B2FA 4HKZE 2IJ0A 3MXGA 4GNXB 4HEA1 4NQKE 5IGBA 3K7AB 3OHXC 4RGTA 2YU9B 2B8FA 1E8WA 4DUZQ 1WMHA 3NZUA 4KMUC 2VY3A 1FGBD 1V5TA 1YOVB 4A3EG 4BY7H 4H7BA 2LSSA 2WU2B 5I9OA 3PLUA 3R93A 4FVMA 3RNFC 2PNHA 2BYTA 4A3LH 5BMHA 1D5XC 4A8XC 1Q90A 3J80i 4HJ9A 2K5HA 3APCA 1TKEA 3SHQA 4E3CA 5G5HA 3CP0A 1VCBA 5D14A 2PZTA 4JOIA 3LGJA 2L00B 1HCZA 4R8NA 1F77A 2R61A 4GLVB 3W1GA 2NVYB 5L37A 4XYOA 2Q2TA 1PH4A 3HK0A 5M5YH 1QZGA 1CSQA 3R66C 2WNMA 3CWIA 1WTPA 2PJHA 4I7ZC 5TR5A 2JA9A 4GS3A 3HKSA 1STAA 1JB3A 2LWPA 2KFJA 3ALBA 2KHSA 2KDBA 1QVFA 1LT5D 3DWQA 2KDEB 2XRSD 3ML8A 3QC8B 4ZRKA 3QR8A 4B0EA 3S1QH 3DWMA 3DOWA 1WI5A 3J81j 3SXHA 1IKMA 4BFRA 1KXLA 1SR3A 5GAHC 2K7VA 1YQ4B 3FKIB 5M3FH 3C2PA 1VDZA 3P63A 2IL8A 3EFUA 1JROA 4HDQA 1PH1A 4ODGA 4DA2A 1UEAB 3RLFA 5IGCA 5JOBA 1AE3A 4A3MG 1Y69U 2JX5A 1E2VA 2KKCA 2WP9B 5LMNL 4LF7Q 1LTID 5EBDA 5IODA 1MD2D 3FILB 4JE3B 3CW2C 2EE1A 3TSSA 5BN3A 3CCSA 4OO1I 1E8YA 1XT9B 2E75C 3HRDD 4P7IA 4F7XA 3JAME 3RD4A 3ABVB 3H7PA 1SNOA 5KHQA 4JC0A 4IUTA 3GTKB 1X3GA 2JU6X 1UUPA 2WAQE 4DAMA 1NMGA 2MBEA 4DHJB 3MC0B 1JOQA 3MHSD 2XEWA 1NCVA 3H0GG 2K5WA 1TIID 1SF0A 2I1JA 4C3IB 1ENFA 1X54A 4TMAB 2LGXA 5CV8A 2N3SA 1A0IA 3VHTC 1UBQA 1KNEA 2EJFC 2EVBA 3SE0A 1MFWA 5M3MG 1WYWB 4HK2A 2F0DA 2OXPA 4A3JG 2QMTA 1EIGA 4IFDI 3SFDB 3I90A 1TR5A 1GG3A 3ERSX 3KWVA 2KHWB 1PDQA 4CQNA 4XXEA 3AMZA 4IDIA 2PQAA 2BYVE 1WGHA 2C60A 1Q46A 2MX2A 4WQMA 3PREA 3NK9A 1N9WA 1NYQA 4BWGB 2DNFA 1FIQA 3QHTA 3EVQA 1IPGA 2F4VQ 4IWQA 5H8YE 1I4QA 2Y5CA 3KF6A 4FLHA 1JWUD 1C0AA 4FF4A 3GTQH 1JORA 4KHVA 3Q14C 1T9HA 4A3IG 4HCEA 5JEAG 3AEAB 1S5DD 2HDLA 1N33Q 1J8IA 4NJ6A 3WA0A 3BDOA 4A3PA 1JC7A 2DY7A 5EDSA 5IGEA 4DPGA 2L0TA 1RFKA 2XNAC 2Z6BA 1TJEA 2WXKA 1KAWA 1FMAD 4KKSA 3QJZA 3RNEC 4XDCA 2IX0A 3KF8A 3L0OA 2J53A 1VF5C 5C3JB 1T6BX 5IA7A 4JBMA 3I4MH 1SSNA 2RSOA 3R2IA 5GAGC 5G5GA 3CCUA 1JCKB 3M9BA 1EQQA 2OJWA 1PTOB 1KL9A 1ZW7A 3I3TB 1UGJA 4B95A 2N9PC 1OQRA 4EKUA 2BDNA 2KMAA 2RBMA 2K22A 1YX5B 2LFIA 2RMMA 1W3SA 5FKAC 3NWTA 2L11A 2C7MB 3QOLA 3ETRA 3HKZG 3HVZA 1O78A 1STGA 4R4QA 2R92H 4BA2I 3BK2A 4EE2A 2LS01 3RD2A 1HNXL 3AI5A 1WGRA 2NPTB 2MBOA 4AUQC 2K8CA 4LAAA 1H9SA 2Q5WD 3F2BA 5CV5A 2K9XA 1CA6A 1BBUA 4K5VA 3RNUA 3GOEA 4OZAA 1E5WA 1RD9D 2KENA 2CH4W 3I8ZA 4OVZA 2F0IA 1P9DU 1Q82C 3AE6B 1VQ5A 4A93H 2FCMA 4CKCA 3TMPB 3IT4B 4HJ7A 3OMGA 2LGIA 4YY3L 2BBCA 2HJ1A 3ND9A 2KO3A 4BKGA 3K80C 1VMPA 4JPBW 2CHBD 3RZDB 1I7HA 4P6VF 3B08A 3ZJYC 3N1ZC 1P1AA 3ICEA 1IUEA 3NHHA 4KTAA 2UU9Q 4OO1G 3P4RB 1CK1A 4K81A 1B44D 3PUYA 2BQQA 3J7AV 1XLPA 1EY6A 4ZRPA 4JBWA 1WZ3A 2CH4A 1BR9A 4IPDA 1Y1VB 3S1NB 2K5NA 2M0AA 3DHQA 1XNRL 4GIVA 2UXDL 2JT4B 2M1MA 2RVLA 3K5MA 1Y14B 2GBNA 4CKBA 5AJ3L 4A3BH 2BPSA 4F7ZA 1UEBA 2WDQB 2LXKA 3T16A 2QIEB 3GTGB 4MGKE 3PO3G 3AEBB 3PO2H 2VRRB 1HTLD 3A4RA 1CJEA 1LTRD 2I38A 2AMCB 1QUQB 4C3HB 3TP7A 4Y7NH 2GBMA 4K2KA 2A8VA 5J2RA 2UUAL 2IX1A 1STBA 1D1KA 1EFID 2VQEL 4NAMA 1KLVA 1NJIC 1MJEA 2BS2B 1V8CA 4K0KL 1DOYA 1BXTA 3PVLA 4IFDG 4HJAA 4BY7G 1WJUA 3AB5A 1NUCA 2PZUA 3T51B 4JL9A 4G4KA 4CGYB 1M94A 4JI7Q 1IYVA 4EZKA 4A3LG 2NBFA 4R9WA 4AQYL 2OTLA 1YJ9A 3NTIA 4ANVA 1O7IA 3DEOA 2FMCA 1V1QA 5C3EG 1RKNA 2O4XA 3MVVA 1WTVA 5IYBH 3Q22A 2B2TC 2RA4A 4CKEA 2A68D 4LNQA 2R93B 4GDLB 4DK6C 3TEYA 2OHFA 3KF8B 1K28A 1KRHA 1YQBA 3J80c 2WXOA 1CHPD 3DDCB 5E6PA 4USAA 3OIQA 1MKHA 4PMBA 2LEKA 3IVFA 1PV4A 4A3GG 2NUCA 1OTCA 4JI0Q 2VUMH 4LFCL 1PXUA 3ONAB 4M02A 3V60A 3E5SA 2LD9A 4RCOA 3B9JA 1KDCA 4RF1A 5IE8A 2MCNB 1EYCA 3DEPA 2CHZA 3V61A 2EYJA 1ICWA 4N8FA 2I0QA 5C4XB 5M3FG 3AEGB 3GTLH 3CSFA 2KBNA 3W3AA 2IHEA 5BYRA 3VUXA 4LF4Q 1CKNB 1HQMC 3A9KA 4HSPA 3CPFA 4NPNA 1BCPB 4ZRIA 3UGBB 5FLMH 3I2ZA 3TP8A 4GN1A 1FGUA 2JA7H 2D0OA 2WDVB 5EE1A 4DUZL 1WD0A 1XLOA 1LLRD 3S2DB 5D7GA 3A74A 1YN4A 5AEKB 2K01A 3KLRA 3CCVA 1HR0W 3TP6A 4O1NA 2E2HH 3CIRB 2H5XA 1AYFA 1KLUD 3C3LA 4RGMA 3H3VC 1MG8A 1WJNA 1SJHD 3WOEA 2AEHA 4I6NB 2V4IB 4P16A 2B2YC 4DR6Q 2DGYA 4IPHA 3VYSA 1Y1WH 2KDMA 2DZKA 2K5QA 5IT9c 1SEBD 3VR8B 2HJ8A 2WB1E 1F2ZA 1L2FA 1L0YB 1S1QB 1I42A 2PEAA 1F9RA 2B2UC 3L16A 3BJUA 4I7AA 4YWMA 3DCGA 2O6VA 2FHTA 1HEZE 2GOWA 4OZCA 3CMMB 5C5LA 3Q69A 1SMYD 3MEHA 3H94A 2J42A 2C35B 2B63G 2BS4B 3T13A 2V1YA 2EDGA 3J80L 1VF7A 3NE5B 2WWZA 3WDNA 4WJNA 1F2MA 3P1HA 2UUCQ 2BA0A 2KC2A 2N1VA 1VQ9A 4LF7L 3HOZB 1VQIA 3KUDB 2K50A 1PFMA 2I2YA 2PKOA 1K3BC 4M01A 1XLNA 3EECA 4KY7A 2IO2B 1GAQB 1VZ7A 5BYSA 2F0OA 3K0YA 2Q8TA 2GRIA 4KIKA 3PIO3 2ICIA 4DAVA 2B2YA 5D65A 5M5XH 4KGTA 3PIP3 1DM0B 2NTSA 3CCMA 2MHVA 2ZZPB 1QOFA 4KN4C 2VW9A 5A35A 1HNZQ 4B3MQ 2B2UA 1D2BA 3ZDTA 4AQ7A 3F8TA 4KKTA 2J52A 2L52A 2WV6D 3HOWH 2WXMA 4W9JA 5C4JH 1W6KA 3DM1A 3TEZA 1I50H 3MP9A 3CCEA 4ASWC 1A3VA 4F8MA 2DNCA 5I2XA 4YL8A 1DOKA 1U0LA 2JN4A 4JI1Q 3P4SB 4DAPA 3RLOA 3T9LA 3UIOB 2Y5BB 1TS3A 3LWEA 2A68C 2R92G 1VQMA 2LY7A 1XMOQ 2VXWA 1PZKD 1O7LA 3VRAB 5IT9L 5C5MA 4OX9Q 2BB6A 4E74A 4JLCA 2LGDA 3GTPB 2L05A 2QSDA 3E6ZX 5JEAJ 5GAEC 3CCQA 5MPOA 3GDEA 2QILA 2KWDA 2ZJDA 1F9PA 2E8GA 2F0MA 4BBRB 2F4VL 1EUVB 3GE8C 1CTMA 2RCNA 4HVBA 1C76A 1TS2A 4J3OD 3KQ4A 4C1NI 4A93G 1I3QB 3HRZC 4IM2A 1VQHA 4JCVE 3PZ8A 3FP9A 4ZCKA 2G9HD 3H15A 4GKJQ 3H6NA 1N33L 5D94A 3IRBA 3ZW3A 4H0LC 2N0SB 1VQCA 1RJTA 1CHQD 1STNA 5FLXc 1K8RB 3PPAA 2L7RA 2W55A 4LNKA 4ZLTF 4GLXA 2EKIA 3VFKA 3RZFA 5CORA 1IGDA 3VR4A 4LK1C 1V49A 1MJDA 2WQYB 2YEPF 4ZRQA 1U4MA 2HCIA 4GN3B 4YTNB 3TREA 3GZNI 2WKDA 3KJOA 3F1ZA 1ZOYB 3EIVA 3PGEA 1I4XA 3E56A 1A3UA 1JE4A 2EJGC 2JA6B 1YVCA 4K6LA 1S5CD 4JQWC 1MJCA 4XYQA 4A3BG 2ZJPA 1AFPA 1Q1BA 5C44B 4X3UA 1VD2A 1DJRD 1WGGA 1EY4A 1V81A 4LMQD 3ZNZB 4I6LB 2JVCA 5JPMC 3E3XA 3PO2G 2JYOA 1K9MC 2NVUI 3VDYA 3NQIA 2WXJA 3TJPA 2DNEA 3JC66 4R4IA 4A3KB 2KTFA 2BE5D 3BYTB 1CFMA 3UDFA 1RIPA 2DN8A 4O0AA 4LF8Q 1WCMB 4FJYA 2EOTA 2J4XA 1Z7TA 5ELFA 1SMYC 2V3NA 3SDZA 2K33A 2MBQA 1JE5A 3FVQA 4PZ6A 3M4PA 3TZUA 5HURA 2RDHA 1TS4A 1XPRA 1YMHE 2PLPA 3MHZA 1E0ZA 4B3RQ 5EE9A 3NVYA 4QY7A 3A1QB 1TKWB 5IYBG 1FXTB 3C19A 4DGZA 1JRUA 1S5FD 1I6HB 1TYGB 1VQ4A 3TBLD 3PCOB 1K83B 3UI2A 2UU9L 1GO3E 3S15B 3UINB 2Z8LA 3D8GA 3E0JA 1JQYD 4IUPA 4NQLB 2ONQA 2KCNA 2NZHA 1TWHB 3OOCA 2CW0D 4NZLB 2VUMG 2CHWA 5L83A 4RH6A 4N9TA 5CMDA 3S1MH 4DXFA 1B2TA 4BXXH 1EL0A 2J0MA 4IM0A 4IM3A 3HG9A 4A9AA 1WGKA 5A2QL 2LJ5A 1SN8A 5CX3A 4IFDJ 1CSPA 5HFYA 1XXGA 4L5TA 4KY6A 3L13A 1EF5A 4A3FB 1BUIC 1OEYJ 1SBBB 3X3MA 1VZ8A 4FYDA 1IBXA 2F0TA 4A3EB 2JA7G 5IGGA 2LHDA 2VZAA 1ZKOA 4FHKA 1GUWA 3BIID 3W9CB 1Q8KA 4XDXA 5JJKA 2DYOA 2BOSA 2EYMA 2B3GA 4DV6Q 1MVKA 3AE7B 4JI7L 1GUOA 3KUZA 1L4DB 1DCZA 3GTJH 1O7ZA 4KHZA 1RTOA 4ME3A 4XX5A 2NN6H 1WZ0A 3N1YC 2RHQB 1ZUD2 2A6ED 4RG1A 1I4GA
chains in the Genus database with same CATH topology
1AEXA 2WP8J 1EY7A 4YXDB 3RFZB 2JEAI 4EQNA 1QG7A 3W2DA 4C3JG 2ZW1A 3I9V1 4HRSA 1GB4A 4KD3A 4A90A 1V8QA 3K5NA 1E6EB 3AECB 2JWUA 5C4ZA 3VR5A 2IGDA 4RHRA 5EPKA 2BS3B 1VMCA 3P4QB 4MT5A 4US8A 1E9MA 2E2DC 4IKGA 1EYDA 1V1OA 2FFKB 5EQ0A 2FBWB 1RYJA 2JQRB 3IAM1 4XT1B 5BMIA 1HFGA 2KECA 1FCCC 2JSOA 2MUYA 3PUWA 1RF2D 1EEID 2SDFA 2HTME 2SNSA 3HOUB 4EGVA 2B76B 1GB1A 2BE5C 4IUVA 5I4DA 1A15A 1ZXTA 3D3RA 1SNPA 1SE2A 3DWPA 3T3NA 2JE6I 3J7YW 4ME5A 3BK1A 4BS9A 2WXQA 2MJ8A 3TP5A 1HXYD 3C8YA 3EQLC 4IUNA 5CR3A 1EY9A 3T53B 2QKIC 3TEXA 2Y0SB 3SK8A 2ZXRA 1CA5A 2EZVA 5BYQA 4M0WA 3PUVA 2CW0C 1QQRA 4G7ZC 1XO3A 4OGQC 3AN1A 3CQZB 3NZ3A 1NR4A 4D2KA 3AE8B 3S2HB 3A56A 2DY8A 3EGRA 1G6ZA 1QKZA 1FO4A 3ERQA 2E3TA 1SNMA 5KIXA 1WWTA 2PTLA 2KQ3A 4KI0A 1MI0A 1BMLC 4J8QA 3OWFA 2QEJC 2A6EC 1EU4A 3AV8A 1I6VC 1BDOA 3EJIA 4DFAA 1Q1EA 3NTKA 1J7AA 4U68A 3P75A 5E1FA 1T5EA 1FFVA 2L1AA 2G1EA 4WWMA 1SYGA 4BBSB 4OO1H 1L0XB 3NBHA 1J9OA 2ID0A 4RNAA 1C77A 2FJ2A 2JA5B 2KOLA 1ONLA 5KYIA 1PRTD 2C9OA 3TMEA 1FFUA 5EBCA 4J1MA 1SJED 4IFDH 5C3WA 3V3XA 3VR2A 2RKSA 4BY7B 5J39A 4L63B 4UAIA 4IOIE 4FXGC 2F0UA 2H4OA 5AUIA 5C0XI 1FXAA 4ZRZA 4KKUA 3AEEB 2D2CC 2NN6G 3P7JA 4NKLA 5KYLA 4MH8A 2GI9A 2Z4IA 4BA1I 3L4PA 2DWQA 4O42A 3TN2A 3W1SA 2PW7A 1UAPA 5BN5A 2F0KA 2C5CA 2A69D 3Q23A 1YNTE 3C46A 2L32A 4RHSA 4DNRB 1RTNA 1GUGA 1C4CA 1E2WA 1EWHA 2IWHA 2F1MA 1DZ1A 4ZHPA 5J1ZA 1GPXA 2V3PA 1S4ZA 4WJWA 1H9RA 1ZDXA 4S3SA 2EYFA 1AW7A 1STHA 3G7LA 4X3KA 2D5DA 1SDFA 5LHY1 1OFFA 4NAWB 2YEPB 2JYTA 2KQ4X 1S5BD 4QF4A 4NDXA 3P42A 4B0MA 3HP3A 3FMCA 4G57A 4CHTB 3A8JE 1DYQA 2AWOA 1LABA 4N6EB 1LACA 4J6HA 4LLGM 3PUZA 3MXUA 2IGHA 2JZPA 1B53A 4IURA 2ZXOA 1RHPA 1SYFA 5LNK1 3DWAA 1TT2A 5A2QE 1Z47A 1NI3A 3MXNA 1TWCB 1EY5A 2F0WA 1B1ZA 3GTOB 1JWAD 2PQEA 3I4MB 1QILA 1QNKA 3AE5B 3VR3A 1XEEA 4FP5D 1HA6A 2I07B 4K8IA 4JK1C 2WKCA 1SYEA 1PTOH 4H2AA 3BVMA 2EY2A 2G9DA 2MP1A 3S16B 1G8ZD 3Q8FA 3D6CA 2GB1A 2XN9C 2A69C 4LK0M 1YN5A 1V43A 2E6XA 2EXZA 4K6DA 1X3QA 4C80A 5TSSA 3TZDA 3FRPB 3GB1A 5C6AA 1QOBA 1CZGA 1LT3D 3RPFC 5ELBA 1KNAA 3D4RA 5DM63 1CQVA 3AE1B 1YN3A 3TBIB 2ON8A 4IUUA 4WORA 1T5XD 4OW0A 4ZKCB 1M8AA 4UDUC 3LXFA 3MFGA 1C8CA 1SYDA 4L2YA 5EPLA 2QF7A 1JW9D 5GXGB 3OSOA 2BB5A 4C2MB 1VLBA 1B9RA 2L12A 1HHVA 5CYUA 2YYZA 2N9KA 3FPPA 4FXDA 4A3DB 2F0VA 1CZPA 1ROEA 4C1NK 4IZ8A 3K5LA 5F2DA 3PMFA 5IGDA 5EKLA 4F87A 2WIIB 1JWSD 1QF6A 4LJZC 1MSGA 3V96A 3DUZA 4MACA 1JMLA 1H9SB 4KGSA 5EPJA 5I6YA 1J7BA 1D5ZC 4MN3A 2A73B 3H91A 1RM6C 2F0NA 3MXPA 1XWEA 5EGTA 3H8HA 4LTUA 4CBVA 2W54A 3HZXA 2FE8A 4DN4M 1VJKA 2Y3AA 1PDXA 3J81L 4TKOB 1IGCA 2GA4B 4I65A 1WTQA 3LX0A 3NS1A 1B3AA 1F2LA 1Y1WB 5C3XA 4BY1B 4YTPB 4C7ZA 4FO2A 2E2IB 2LMCA 1AWDA 2H88B 2ZT9C 3CHBD 4C3IG 1ENAA 2B39A 1V1PA 1ZXIA 3Q8CA 1Q10A 4TQUS 2JYEA 3I4LA 2LFNA 2OF1A 1J7CA 4ZK9B 2F03A 2K28A 2KVMA 4ULLA 2M00A 1DOIA 5T1GA 4TSSA 1B9MA 5M5XB 3M4OB 2VZKD 3AE4B 2KA7A 4Q5VA 1S5ED 1NENB 1TZOA 4RF0A 1WTWA 4C56C 3IFDA 3HOWB 1YNND 2N88A 1NAPA 1WTRA 3K58A 4OZBA 3S17B 2WAQB 2L0CA 3BVGA 3I73A 3V2TA 1N63A 4QUCA 1PGBA 4KK7A 3Q8EA 4B9XA 1H9KA 3BVZA 5I9PA 4ZUIA 3IAYA 1F2RI 2N9LA 2N55A 4QIWB 3TDQA 4PNYA 1GJXA 2K0PA 4XE0A 2DBYA 1A70A 4PMCA 2ACZB 3FDTA 3I57A 1QNUA 3Q8AA 4NP5A 3IKJA 5C0XJ 4HMJA 2INPE 3WOFA 2L55A 1YQ3B 4ZOHC 2L5TA 3V05A 4M1UB 5DM73 2M19A 3N52A 2RDGA 1C79A 3FEWX 1HZ5A 2NYZD 2RDFA 3CRLC 1BF4A 1PGAA 1HQRD 2VB2X 4XIGS 3Q24A 2IX3A 3HOVB 2IGGA 4L1BA 4YT0B 4C3HG 3PV0A 1PFDA 4K14A 2NZ1D 4HN7A 1N5WA 3AEFB 5CV6A 1JRPA 5T8IA 3NBIA 1LT6D 2HCCA 3AE3B 2F3WA 1HPCA 4XWTA 3NPPA 3VYUA 4DXGA 1KLGD 4DAYA 1X32A 1KABA 3URYA 5FLXL 1ENCA 2W3SA 3LNNA 4ZYSA 5I6WA 3A7AB 3AH7A 2SEBD 1EWCA 3B2GA 3D31A 4Q0FA 2W3RA 2Z4HA 1YNNC 1KDAA 1PGXA 1K8MA 1G291 5DAUA 3NUCA 3W5VB 2TMPA 5G3LF 3QB3A 3VYRA 3GTJB 1VZ6A 5DEHA 3Q0AA 3AEDB 4XQQA 3K59A 4YSYB 2F0QA 1GHKA 5M5WB 1QT9A 4CJ1B 3NVWA 1ZP0B 3RZOB 1YJJA 2L83A 2WU5B 2OT2A 4L8JA 2Y5PA 2JA8B 1WYGA 2X6LA 1L6UA 4A3MB 3M3YB 1PMRA 2K04A 5K5PA 2X38A 2RPVA 4MIUA 3HGBA 3ZJUA 4K5WA 3ND8A 4WIPA 2X6GA 1II3A 2MPMA 1BO0A 5LL6X 3DWGC 3I3CA 1N60A 1HA5A 3H0GB 3NRZA 2FMMA 5FOBB 4IUQA 5E6JA 3SK5A 1PLFA 3M7GA 4QUFA 3IFTA 2IDYA 3NP8A 1F9QA 1T3QA 5M3MB 1PTOD 4G7HC 2K6AA 1DOXA 4ID6A 1ACCA 4A3JB 1LTTD 2CJNA 2B2VA 1ZDVA 5KRUA 2WXPA 3U52E 1EYAA 2B2WC 5CV9A 3R8BA 1WTOA 5AUKA 1STYA 2X69A 3X3NA 1FNUA 4FF2A 1WXQA 3ITPA 1B4OA 5HGTA 1N62A 4WURA 1D5MC 3LWUA 1IBXB 4A3IB 1EZ8A 1U4PA 2WXFA 4RFBA 4GZYC 1V97A 2D9UA 2ZXPA 2ENBA 1DOLA 3K57A 3NVVA 1L4ZB 1EOTA 1JOKA 1P7EA 5C0XH 2ZW0A 3CRKC 4ZKBB 2H89B 1L6VA 3C1FA 4GLSC 1D4BA 3VA5A 1EQVA 2A74C 3NQTA 1P7FA 2B2WA 5BMGA 4US9A 4HMIA 3HKZB 2WLBA 4DK0A 1U4RA 5FR3A 1ILQA 3A8IE 2MJ3A 2D62A 3J7AF 4M8AA 2V0GA 3P20A 3J81E 5ELDA 1AZPA 4JWSC 3VRBB 3VYTA 1EQTA 4ITKA 2EJMA 1Q8IA 2RSNA 1A3TA 5KNCA 3D6WA 1O7YA 1K50A 2DYMA 4TRDA 2CU3A 2EY1A 1D1IA 1Q12A 2W82A 1IL8A 4EVOA 2R3ZA 3FILA 5EE0A 1B9NA 3SK4A 2E2JB 2F0EA 2LHEA 2KEDA 3J80E 2AQ3B 5IGFA 2ICEC 2BTEA 1OXXK 2F0JA 5COYA 1EEFD 5CC4A 1MHXA 1TKGA 3PO3B 2FINB 3AMUA 3O13A 3N6RA 4CJ0B 1BCPD 2LUMA 2H1EA 1DOMA 1RWSA 1XTCD 3FAHA 1QCBD 1PTOC 1ET9A 4ARCA 1SE4A 1MHHE 1E2ZA 3IXSA 1SAPA 4HTHA 4NW2A 2XWJB 3NWSA 5C3EB 3SR1A 1FM0D 4FXCA 1HRJA 1LV9A 5KGUA 2PVOD 3BG3A 1GUNA 4P2CB 1HTPA 5M5YB 1L5PA 5E3FA 1Z6HA 3MZ5A 3GV6A 5IT9E 3F2UA 3KUPA 4IQZA 3I70A 2QJLA 1TQOA 4CJ2C 4A3GB 2K3UA 4Z9CB 2PYKA 5T1IA 3S1QB 2HDMA 1WD1A 3BDLA 5D3DA 2M56B 5E4XA 5M3FB 3UI3A 2DLBA 4PT5A 3J9CA 4FXKC 2A6HD 2KAJA 4OL7A 3GS2A 2PW5A 3U4EG 4RA8A 3P4PB 1Y8PB 2SNMA 4QB4A 1LT4D 3L3OC 4KV6A 1N61A 1VRAB 1K53A 4MM3B 1JWMD 5J22A 1LTSD 2EY5A 1E7PB 4FF1A 1NYRA 3TEWA 1C78A 3M85A 5ELEA 2INNE 2KMMA 2CVRA 5FO7B 2EYOA 1A2UA 1ZE3D 4DF7A 1QLBB 4XT3B 1OQQA 2QDBA 2Q8IB 2F0FA 5H92C 4U673 2B63B 1BUVT 2F0HA 2PNRC 2LKVA 3GV3A 1H9JA 1JWBD 2PMVA 2K05A 4YSZB 4KKIA 1Y56A 1IHZA 3H6MA 1PRTC 3GTQB 1B50A 1U9RA 3BS1A 2SOBA 1KF6B 1PZID 4HKQA 1KH0A 4C7YA 1EU3A 3A8KE 1BCPC 4ZQ3A 5FLXE 2L1BA 1HFNA 4R8IA 5ISRA 5C0XG 1F2RC 4TQ0A 2Q8RE 4X3TA 3VQIA 1BNZA 4JWUC 3KBGA 3HS0C 2PPBC 5FO8B 2EY6A 3U9SA 2WXRA 3PUXA 3BZDB 1SXTA 2R92B 4ABNA 3OWEB 5HI1A 2JXMB 3QG1A 1PUTA 1QE6A 1FXIA 2F0SA 1ML0D 1CZWA 1KAAA 3QIAA 2JP1A 1NSNS 3DMUA 4K8JA 4A93B 2N7JA 3M7NA 2IW3A 1C48A 3IT6B 1EM7A 1IW7D 1OXVA 1FR3A 2A6HC 3D4WA 1JOOA 2NVXB 2FUG1 1QB5D 5KNDA 1KTKA 1DONA 1QJOA 2F4IA 5EKKA 1HZ6A 4YTMB 4EQPA 1FYCA 3R3OA 2PW9A 1TY2A 3NUHB 4A3BB 5JAVA 1YNJD 2F0GA 2AUKA 4NMZA 1SIJA 3PO2B 4WAFA 4RKBA 3SK6A 4Y7NB 1EZ6A 3C1EA 1TVXA 1WTXA 1ESFA 4KGRA 2K03A 4X3SA 2RQXA 1F9SA 1SB3C 2F3VA 4WFN3 1SSOA 3CU7A 1ILPA 2WS3B 3HUIA 3L7ZC 1IYUA 5JPNC 1K8OA 1C9FA 1STEA 3MHBA 1WSPA 1EIHA 1XCTL 1ZXHA 1OXTA 4L6TB 1TY0A 4TQ1A 1ZPSA 5CBAE 2VUMB 1HUNA 4XWWA 5IIFA 1FRDA 3AM9A 3VA7A 2PCFB 1AN8A 3GTLB 3K6OA 4B9WA 3EROA 4HSVA 1QWYA 1L0VB 2OEDA 1JR0D 4FNFA 1AP0A 4FF3A 2JA7B 5ELCA 1PRTB 2PO4A 1C4PA 4EQOA 2XSCA 1YJIA 1EWYC 3MAQA 4KN7C 4IN3A 2E2HB 1VCIA 3U2SC 1D6EC 5FK9C 4KX6B 1FNWA 1Q3LA 2A5HA 4PQXA 2WXHA 5M9OA 4H44C 2CQAA 5KEEA 2HUGA 1OO9B 5FO9B 2SAKA 3EA6A 2F0PA 1ESRA 2B2TA 4C3JB 1TKYA 3I72A 2L4NA 5HG2A 1IW7C 3NXWA 3QWNA 1LO5D 4G7OC 1FEHA 3Q8BA 2PZWA 3OW7A 5CBEE 4RWSC 4HJGE 1DGJA 3GO5A 4V0BA 1BQQT 1XCQL 1SNQA 4KJOA 1DXMA 1PFNA 2KCCA 2PMZB 3L9AX 2NWGA 3DXJC 1AZQA 2AX5A 1YNJC 4A6QA 1KFYB 3GQBA 3KWLA 2V4DA 1E10A 4QMGA 3ZJVA 2NTTA 3NTHA 4KY5A 4XTCS 5AFWA 2WXNA 1FD6A 2JEBI 1RODA 4K5XA 5C4JB 4V190 1I50B 2BDOA 5EE3A 4AS1A 2BCOA 1GUSA 3Q6SA 4DQOC 1G91A 3AB9A 3HVDA 1EY0A 2E74C 4WH4A 1XF5L 4PMWA 1KDBA 5EKIA 5CGKA 2WDRB 1NVID 3IL8A 3EFXD 2R7ZB 4GDKB 3LYYA 4Q2JA 1FNVA 1SFOB 3IAS1 1NEKB 5I2YA 4QCLA 5JXVA 4ILWA 1F0ZA 1CI3M 1ZYRD 2XRQD 2HDEA 2WXLA 1MI2A 3KLSA 2J0TD 1F2YA 4HCSA 1G2SA 5C2TB 3VR6A 2KN4A 2LJIA 2WXGA 2PVGC 4JPSA 2EELA 2EPBA 3A54A 1FCLA 4YIJA 1HUMA 1G2TA 1TWGB 3ZYYX 2LMCB 1N5XA 2O5IC 4ZAIA 5K36H 3N9YC 1SE3A 1MBYA 1XX8A 1V1PB 3JAML 1JQ4A 1U4LA 2QCPX 3W5UB 2XWBB 1K52A 3AU7A 1ET6A 3G6JB 1GXDC 1W6JA 3GP7A 2CJOA 1RDPD 2KUMA 3VR9B 3LB8C 2Z1CA 4RGOS 5D3IB 3AE2B 1SNCA 4DK1A 4ZHOA 5JJZA 2M9VA 3D4DA 3I91A 4ZUJA 3I4NB 3T56B 5CV4A 1I4RA 1SYBA 2K1BA 3QOJA 3SEBA 1PTOF 4OHJA 1GUTA 3S1MB 2VNUD 2MJDA 1TWFB 1JICA 2BW2A 1MSHA 3S9WA 3PO0A 2AQ2B 4ARIA 4KKJA 3FPUB 4N59A 3CKIB 1E0BA 2HQEA 4XQJA 1PFBA 3SVMA 1IKLA 2I46A 2WINB 3OIPA 3FC4A 1Y8NB 1A6XA 4HROA 4L23A 3KBXA 1FRRA 2M2LA 1QOGA 3MFYA 3MA2B 2WACA 5LL6S 2MH7A 1BBXC 5JVH3 1DD2A 1UWXA 1I4HA 4JX1C 1VR9A 4HAEA 3S1RB 5HHDG 1OXUA 4IALA 4KD4A 1ZYRC 2B2VC 1FD7D 3GTMB 1VDVA 1EY8A 2EYHA 1CQFA 3S14B 2AUJD 3HOYB 1C4QA 4RKLA 4AYBB 3KLSX 1PYWD 3HOXB 2AQ1B 2KJXA 2BA1A 1R9TB 3MTSA 2MEKA 4B08A 1NR2A 3WCQA 5C4HA 2XIWA 2B8GA 3TUOA 1X3PA 3ZGZA 1TS5A 1RCVD 4WRDA 2E76C 1R4PB 3BWUD 2IPKD 4KJNA 2NVTB 3SHLA 1PRTF 3T4AC 1SYCA 4OIKA 3HEJA 3R2TA 3E9SA 2OEOA 1WRIA 4XDDA 4E6IA 3H09A 2KACA 3ZJTA 1BCPF 1LTBD 2WB1B 1WVLA 1LTGD 5IOCA 3KK7A 1A2TA 3A55A 2PIAA 1OXSC 3RUZA 1C4AA 5EJWA 3PZ7A 1R7SA 5KNBA 1H9MA 3U9OA 2JSVX 1O80A 3BYYB 1LTAD 2WXIA 4HR7B 4DU9A 1R4QB 3QJYA 3BDCA 4YWGG 3ZQ4A 1CM9A 5JEAH 2NN6I 4DNTB 2O5JC 2NMQA 1UWMA 3A7LA 4N9PA 2AWNA 2EYLA 5G3LD 2NVQB 4RAUC 2XVSA 1JALA 2K32A 5JVG3 4RCNA 1K51A 5K36G 2VZKB 1M4VA 4HEDA 4H13C 1XLQA 5CV7A 3NVZA 5E4WC 1XYIA 2IT1A 4MHEA 5NUCA 4K2LA 1GHJA 2K5PA 4OIJA 4REZA 1MGSA 2O2LD 4XQNA 2MJEA 1QOHA 3T3OA 4YSXB 1UNSA 5BN4A 3RMHA 2F0LA 2VB3X 4PV1C 1ZEQX 2K5DA 1CT1D 4F88A 1MPEA 4NJCA 3K5OA 3AE9B 3MJ5A 1BOSA 3M4YA 2JXTA 1I4PA 3SR6A 3QO2A 4A55A 1QOAA 1TWAB 3GD7A 3SFEB 3MWYW 3NSWA 3U7ZA 4R3DA 2L9HA 2MGSA 1Y8OB 1SNDA 1TU2B 2J7ZA 2BT6A 2EYPA 5DNFA 2D5GA 2R6GA 2NB0A 3OPOA 1GOZA 4RGNA 3P1MA 1PZJD 4N58A 2KEEA 3EUB2 3OMCA 2TSSA 3B2FA 4HKZE 2IJ0A 3MXGA 4HEA1 5IGBA 3K7AB 3OHXC 4RGTA 2YU9B 2B8FA 4KMUC 1FGBD 4H7BA 2WU2B 5I9OA 3R93A 4FVMA 2BYTA 5BMHA 1D5XC 4A8XC 1Q90A 1TKEA 5G5HA 5D14A 2PZTA 1HCZA 4R8NA 1F77A 2R61A 2NVYB 4XYOA 2WNMA 3CWIA 1WTPA 4I7ZC 1STAA 1JB3A 2KHSA 1LT5D 3DWQA 2XRSD 4B0EA 3DWMA 3SXHA 1IKMA 2K7VA 1YQ4B 3FKIB 3C2PA 1VDZA 3P63A 2IL8A 1JROA 4ODGA 4DA2A 1UEAB 3RLFA 5IGCA 5JOBA 1Y69U 2JX5A 2WP9B 1E2VA 1LTID 5EBDA 5IODA 1MD2D 3FILB 4JE3B 2EE1A 3TSSA 5BN3A 4OO1I 3HRDD 2E75C 4F7XA 3JAME 3RD4A 3ABVB 1SNOA 4IUTA 3GTKB 2JU6X 1UUPA 3MC0B 1JOQA 1NCVA 2K5WA 1TIID 1SF0A 4C3IB 1ENFA 4TMAB 5CV8A 1KNEA 2EJFC 2EVBA 3SE0A 2F0DA 2OXPA 2QMTA 1EIGA 4IFDI 3SFDB 3I90A 1TR5A 3KWVA 4CQNA 1PDQA 4XXEA 3AMZA 4IDIA 4WQMA 3NK9A 1NYQA 4BWGB 1FIQA 3EVQA 5H8YE 1I4QA 2Y5CA 1JWUD 4FF4A 1JORA 4KHVA 4HCEA 5JEAG 3AEAB 1S5DD 2HDLA 1J8IA 3BDOA 1JC7A 2DY7A 5IGEA 1RFKA 2XNAC 1TJEA 2WXKA 1FMAD 4KKSA 4XDCA 2IX0A 3KF8A 2J53A 1VF5C 5C3JB 1T6BX 5G5GA 1SSNA 2RSOA 3R2IA 1JCKB 1PTOB 1UGJA 1OQRA 2BDNA 2RBMA 2K22A 2RMMA 2LFIA 5FKAC 3NWTA 2L11A 3HVZA 3QOLA 3ETRA 1O78A 1STGA 4BA2I 3BK2A 4EE2A 2LS01 4LAAA 1H9SA 2Q5WD 5CV5A 2K9XA 1CA6A 4K5VA 4OZAA 1RD9D 3I8ZA 4OVZA 2F0IA 3AE6B 4CKCA 3IT4B 3OMGA 2LGIA 2BBCA 3ND9A 1VMPA 1I7HA 2CHBD 3RZDB 4P6VF 3P4RB 1IUEA 3NHHA 4KTAA 4OO1G 1CK1A 1B44D 3PUYA 3J7AV 1XLPA 1EY6A 4ZRPA 4JBWA 1BR9A 1Y1VB 3S1NB 2M0AA 3DHQA 2RVLA 3K5MA 4CKBA 2WDQB 3T16A 2QIEB 3GTGB 3AEBB 1HTLD 1CJEA 1LTRD 2I38A 4C3HB 3TP7A 4K2KA 2IX1A 1STBA 1D1KA 1EFID 4NAMA 2BS2B 1V8CA 1DOYA 1BXTA 4IFDG 3AB5A 1NUCA 2PZUA 3T51B 4G4KA 4CGYB 1IYVA 2NBFA 4R9WA 3NTIA 3DEOA 2FMCA 1RKNA 2O4XA 3MVVA 1WTVA 3Q22A 2B2TC 2RA4A 4CKEA 2A68D 2R93B 4GDLB 3TEYA 2OHFA 1KRHA 2WXOA 1CHPD 4USAA 3OIQA 4PMBA 2LEKA 2NUCA 1PXUA 3ONAB 3E5SA 4RCOA 3B9JA 1KDCA 4RF1A 1EYCA 3DEPA 2EYJA 1ICWA 5C4XB 3AEGB 5BYRA 3W3AA 1HQMC 4HSPA 1BCPB 3TP8A 2WDVB 5EE1A 1WD0A 1XLOA 1LLRD 3S2DB 5D7GA 1YN4A 2K01A 3KLRA 3TP6A 4O1NA 3CIRB 1AYFA 1KLUD 3C3LA 4RGMA 3H3VC 1SJHD 3WOEA 2V4IB 4P16A 2B2YC 3VYSA 2KDMA 2K5QA 1SEBD 3VR8B 1F2ZA 1L0YB 1F9RA 2B2UC 2FHTA 1HEZE 4OZCA 5C5LA 3Q69A 1SMYD 3MEHA 3H94A 2J42A 2BS4B 3T13A 2EDGA 3J80L 1VF7A 3NE5B 3WDNA 1F2MA 3P1HA 2BA0A 3HOZB 1PFMA 2I2YA 2PKOA 1XLNA 4KY7A 1GAQB 1VZ7A 5BYSA 2F0OA 3K0YA 2Q8TA 2GRIA 3PIO3 2ICIA 4DAVA 2B2YA 5D65A 4KGTA 3PIP3 1DM0B 2NTSA 2MHVA 1QOFA 4KN4C 5A35A 2B2UA 1D2BA 4AQ7A 4KKTA 2J52A 2L52A 2WV6D 2WXMA 1W6KA 3DM1A 3TEZA 3MP9A 1A3VA 4F8MA 2DNCA 5I2XA 1DOKA 3P4SB 4DAPA 1TS3A 3LWEA 2A68C 2LY7A 2VXWA 1PZKD 1O7LA 3VRAB 5IT9L 5C5MA 2BB6A 3GTPB 2QSDA 3E6ZX 5JEAJ 5MPOA 2QILA 2KWDA 1F9PA 2F0MA 4BBRB 1CTMA 1C76A 1TS2A 4J3OD 3KQ4A 4C1NI 1I3QB 3HRZC 3PZ8A 2G9HD 4H0LC 2N0SB 1RJTA 1CHQD 1STNA 2W55A 4ZLTF 2EKIA 5CORA 1IGDA 3VR4A 4LK1C 2YEPF 2WQYB 4ZRQA 1U4MA 2HCIA 4YTNB 2WKDA 1ZOYB 1I4XA 3E56A 1A3UA 1JE4A 2EJGC 2JA6B 4K6LA 1S5CD 4XYQA 1AFPA 1Q1BA 5C44B 4X3UA 1DJRD 1EY4A 4LMQD 5JPMC 2JYOA 2WXJA 3NQIA 2DNEA 4A3KB 2BE5D 3BYTB 1CFMA 2DN8A 1WCMB 2EOTA 2J4XA 1Z7TA 5ELFA 1SMYC 2V3NA 3SDZA 2K33A 3FVQA 3TZUA 5HURA 2RDHA