1SXTA

Staphylococcal enterotoxin type a (sea) co-crystallised with zinc
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
224
structure length
224
Chain Sequence
b'KDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN TYPE A
publication title The Co-crystal structure of staphylococcal enterotoxin type A with Zn2+ at 2.7 A resolution. Implications for major histocompatibility complex class II binding.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Superantigen
total genus 61
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sxtA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sxtA02
3R2IA 2XRSD 5ELEA 4C56C 4RHRA 2RDHA 1JR0D 1MD2D 3BVZA 5D3DA 1CT1D 1PZID 1D6EC 3EFXD 1BCPD 1LTTD 1JWUD 1SE4A 1STEA 2O2LD 4RGMA 2XRQD 1BCPB 1ET9A 1D5MC 1AW7A 1JWSD 1LT3D 1RDPD 4L6TB 1BCPC 1EU3A 1CQVA 1PRTD 1TY2A 2CHBD 4L63B 1SEBD 5FK9C 1LLRD 1LTBD 1LT4D 1PRTB 3BVGA 2WV6D 1B1ZA 4RFBA 1FGBD 4RHSA 1HA5A 3R8BA 5I4DA 1D5XC 1SJHD 3W2DA 1YN3A 1I4XA 1LTGD 1T5XD 1V1PA 1V1PB 1EU4A 2RDGA 1DYQA 1RD9D 5ELCA 1FNUA 1DJRD 1SE2A 2NTSA 4NZLB 1TS5A 1BXTA 2Z8LA 1KLUD 1ESFA 1CHPD 1PTOF 5ELDA 1PTOH 1LTID 2R61A 3BYTB 1BCPF 1LTAD 1LO5D 1QILA 2QILA 1I4HA 3EA6A 3TSSA 1XTCD 1G8ZD 1SJED 1LTRD 4TSSA 2SEBD 3DWAA 1PRTF 3R2TA 4RGNA 1S5BD 4BWGB 1EFID 3CHBD 2IPKD 4OHJA 1GOZA 3BZDB 1JCKB 1I4QA 1L0YB 3URYA 4RGTA 3OWEB 1V1OA 1FNVA 2AQ1B 3O13A 1AN8A 1I4GA 3SEBA 1D5ZC 1HXYD 1S5CD 2ICIA 1YN5A 3KLSX 2AQ3B 1KLGD 1PYWD 1S5DD 4ZYSA 1LT5D 2J4XA 1PZKD 4UDUC 2AQ2B 3DWQA 4O1NA 2NTTA 1KTKA 2IJ0A 2TSSA 5FKAC 1FNWA 1S5ED 1L0XB 1PZJD 1SE3A 1JQYD 3GP7A 1LT6D 1ENFA 1RCVD 1FD7D 1XXGA 4RCOA 2QEJC 4RGOS 4DXGA 3V05A 5ELFA 1M4VA 4RH6A 1TS3A 1SBBB 1JWMD 3BYYB 1PTOD 1B44D 1PTOB 1EWCA 3MFGA 1CHQD 1HQRD 1S5FD 1I4PA 3MC0B 1PTOC 1HTLD 5D3IB 4DXFA 5ELBA 2G9HD 1UNSA 1SXTA 1TS2A 1I4RA 1TY0A 1EEFD 1F77A 2XNAC 1LTSD 4Z9CB 1TS4A 1CK1A 1PRTC 3BVMA 1YN4A 2XN9C 1UUPA 5TSSA 1EEID 1RF2D 3DWPA 1ET6A 4K6LA
chains in the Genus database with same CATH superfamily
3JSVB 2N88A 1PHJA 2G45B 4RHRA 4YWLA 4IQZA 5D3DA 3Q0AA 1WD1A 4MGIE 4JBWA 4OWTB 1VQOA 2E2IH 4LF6Q 1ZW7A 3N32A 2WAQG 5D14A 2L12A 4HDOA 1P0RA 4PS7A 3HOXB 2WXOA 1SE4A 3ZTCA 2PNRC 4XXEA 4G7ZC 1NEKB 2C7HA 2V4DA 1B70B 5E6JA 1EZ8A 1PH4A 3KUCB 1P9DU 1J5EL 2LGIA 1LLRD 4W9LA 2A1AA 5CYUA 2WV6D 1PGXA 4IUTA 1HA5A 1AARA 4B3TQ 1AH9A 2LZ6A 1CQFA 3B6YA 3GTMB 3KF6A 4JWUC 4KHPQ 2D3GA 2BQQA 2EOTA 1ZYRC 2EYOA 1ZPSA 2LASA 2GBNA 1Y1WB 3S2DB 2L76A 3VQIA 3NZ3A 2PZUA 1E5WA 1TWCH 2IO1B 5EPJA 4DR6Q 2OEDA 2WX0A 1PFSA 4PZ6A 5IT9L 3VR6A 2KO3A 3L13A 4A3MG 3W1YA 2IBIB 3R93A 2NBFA 2IHFA 4G4KA 5IP7G 2L00B 3A5ZB 1IYUA 2HD5B 3ALBA 4NXMQ 3HOZB 5DAUA 4LF7Q 1K8RB 2V3SA 3V60A 1J6QA 2VNUD 3K9PB 4UPAA 3CCEA 1N34L 3M63B 4IPCA 1WZ0A 3PREA 4EOYA 1G6JA 1YNJC 1L5PA 3AEEB 1TWAB 2AQ1B 3O65B 2KN5A 2KFKA 1IW7D 3V61A 4A76A 5KYIA 2EKIA 1GHKA 3IT6B 3L16A 1Y1WG 1NE3A 1ZP0B 4HIDA 4IOIE 4I6NB 1ICWA 3FKIB 1VQHA 2R93B 3DWQA 1WX9A 3VFKA 3NUCA 3PUVA 4J8QA 1G91A 3RLOA 2WGSA 4USAA 4IM0A 1EO6A 3HOXH 4WAFA 3RZDB 3T3OA 3HOZG 1VQKA 2IY0B 2I5LX 2AUKA 5C0XJ 4UP9A 1I50B 1SROA 1ENFA 3QIAA 5IP7H 4A3MH 4QB4A 3FP9A 2R92B 3VDYA 1GKHA 1T0YA 2SAKA 3E0EA 2FJ2A 1VQPA 1KF6B 2L1AA 2RSUA 3TBIB 3D6WA 5IT9E 1XT9B 3F2BA 5A35A 3PO3B 4A3BG 2UYZB 3GTMH 3NS1A 4DK0A 2HDLA 2Z1CA 2E3TA 3Q6SA 2X69A 3A4SC 3PSEB 4A3LG 4II2B 1Y14B 4U68A 1H9SB 5FO7B 2C5LC 2W82A 1Y1WH 1CKNA 2ZTDA 2UUAL 4L5RC 1UEAB 1VQBA 5IE8A 3S2DH 4K3CA 4A93G 4WJQA 2ATWA 2CH4A 2D0PA 4JI4L 2IO3B 1WZ3A 1EEFD 4KY6A 4JK1C 1RTOA 1E22A 3CC4A 4FLHA 2IX1A 2R92G 3HOZH 1TS4A 1IBLQ 1SYGA 1EYGA 1CK1A 3S16B 3GTOH 2ONQA 2N7JA 2ASBA 2Y3AA 5EKKA 1STHA 1VZ8A 1XD3B 2BBCA 2JY6A 3ML8A 4KKJA 1UUPA 1WGHA 3PO3G 2KQSA 5TSSA 4DV4L 4PT5A 5IKCM 2K01A 2MLBA 4POFA 1HTOA 1G6PA 1WVLA 2K9XA 1B9RA 1Q1OA 3A54A 3R2IA 3VXWA 1VCIA 2PMZB 1X3GA 5G5HA 3CPWA 5I2YA 4QGUA 2ZTEA 3WALA 4C2MB 2CVRA 3Q6BA 2R93H 4YY3L 4B3ML 3KUDB 2VH1A 2LKVA 1YEZA 3M7GA 3RZDH 3D0FA 2XWBB 5I6WA 1BVSA 1I50H 4A3KG 3QAQA 4GDKA 2KNBA 4QIWE 2LD9A 1MI2A 2R92H 1B3QA 4ZLTF 2BPSA 4KSKC 3L0OA 3P4QB 2RBMA 5J39A 1WH3A 1WR1A 5FLMH 3BK2A 3RULA 5C0XI 2BT6A 4OZBA 4L23A 5LNK1 5CV9A 3M7NA 1L2NA 1FPYA 3H9DA 2MFIA 1CKMA 1NCVA 2F0QA 2ZJQA 2HCIA 4KJNA 3PO3H 1FNUA 1NYRA 2HJ8A 2FCNA 1R4MB 5KGUA 3U4VA 1VQ7A 4K0KL 1UBIA 3GB1A 3K59A 3RNUA 1HRJA 3SD5A 1B9NA 4NDXA 2EY2A 3RLFA 5C6AA 2UXDL 4WJ3M 1YJ1A 2DJFC 2M4NA 3AM9A 1EF1A 3QQ8B 4WWPA 1X3QA 4XWWA 3DBSA 1E3PA 3U8ZA 3D32A 2IDYA 1NUCA 4QL5A 4ME5A 3NY5A 2EE1A 4HEA1 1D4BA 2GB1A 1YNJD 3FPUB 4W9HA 4ZDVA 1W6KA 2SDFA 4RCNA 4CKEA 3DHHC 4DFAA 3SFEB 1EFID 4YT0B 3CC7A 4FDBA 2WKDA 2CW0C 3S16H 2N7EA 5AJ3L 1YMHE 2KWDA 1FNVA 4KI0A 5JPNC 1YQBA 4DKAC 2KHSA 2K8BA 3M3JA 3BU2A 4DR5L 3J7YW 4KGSA 3VA7A 4TVAB 2F0LA 4JW0A 3NZUA 4B3SL 1W6JA 3TEHB 1N61A 1IGCA 1HFNA 3VUYA 2BKRB 3ZUNA 3KDFA 1HNWQ 2LVQA 4HPPA 4O1NA 1SNMA 2ZW0A 3I4MG 3M3YH 3ZNGC 4L5SA 3GTLB 3TL5A 2RVLA 1L0XB 2ZPNA 1A2TA 1M1KC 3CP0A 3CF5A 2XBBC 3P1MA 2DHZA 1FR3A 5J22A 2E5LQ 1EWYC 1IKMA 2F0TA 2PW7A 2CKZB 4DBGA 4FVMA 5BN4A 4DNIA 4AYBB 4XT3B 2L0FA 1SB3C 5FLXc 3FMCA 4BZAA 2EMSA 4RH6A 3DMUA 4JOIC 4E74A 3MC8A 1GVPA 1D1IA 3QHTA 3ULLA 1HFGA 4HIMA 1SIFA 1C0AA 2W9NA 3RNBC 4KY5A 2KAJA 4GZYC 3FKYA 2OTLA 4ZUJA 4EQPA 3I4NB 2K32A 1SXTA 4X3UA 2O2VA 3EUB2 2KOLA 1VQCA 4IWQA 3W5UB 5L95C 1VQIA 4AYBG 2W55A 2N55A 1PRTC 3A9KB 2R6GA 1PH7A 3N1YC 2EELA 3VR9B 3Q8BA 5EPKA 4BKGA 5EKLA 3K5LA 1PDQA 1PUTA 4XWTA 4I65A 5C3EB 4KZ0A 4IC7B 5T1IA 1WJUA 4IPHA 3WCQA 1D8LA 1NI2A 2O4XA 1JMCA 5H8YE 1Z2MA 4MSMB 4B3TL 4XQJA 4MNOA 3PGZA 4JPSA 2QA4A 3BIID 4EGVA 1UBQA 3BG3A 3EJIA 3C46A 4NJCA 3GTLH 1CQVA 1SNPA 1LABA 1E9MA 1Q0WB 2F0OA 5LMUQ 4DR6L 1NMFA 2B2WC 4GS3A 2KN4A 4GIVA 2JA5G 3ZLZA 3HG9A 4GLAC 1B3AA 5C3EG 1G2TA 1YX5B 1SJHD 1SRUA 5JEAH 1R9TB 1WX7A 5KNCA 3I57A 4ZK9B 1V1PB 3L4PA 2KWVB 3B9JA 2F0JA 1WCMG 1A3VA 3HIZA 3CWIA 4AUQC 3BINA 2JN4A 2K5QA 3EBEA 1HZCA 1VQAA 4IFDJ 2KHWB 3WA0A 4OVUA 3ENEA 4C3IB 1QVGA 2F0GA 3QB3A 3WOEA 1K28A 2M8SA 3GDEA 2IGHA 2KQ7A 4KMUC 4JI0L 2LRUA 1WJJA 1SJED 4HCSA 3ER0A 1JRPA 2CW0D 2MQJA 4EEWA 3PIOA 2L05A 4R4CA 2LFIA 2N49A 2UUBQ 1I42A 1WE6A 2JWUA 2WXIA 1GD7A 1I6VC 1X3FA 1YNTE 1U4RA 2KVMA 4A3JB 1OXVA 2JF5A 3N3KB 3CU7A 2JA5H 2DX5B 2W3SA 3UQBA 1HXYD 4HK2A 4ACFA 5C3EH 5BR8L 2DWQA 1XJVA 3K81C 1WSPA 2WIIB 4DHZB 1LGRA 3NK9A 3IFDA 3RR5A 3NQTA 5GAEC 2C7NB 1WCMH 2INNE 2K5VA 4KIKB 2J4XA 1E2ZA 2LMCB 1V43A 3AE8B 2K14A 3Q2AC 1YJIA 4URKA 2ES2A 2I07B 2PE9A 4RAUC 3GS2A 1STNA 3Q24A 2WXQA 3ZNZB 2K6AA 1SNOA 3Q69A 3NS8A 2K1BA 4OW0A 2QKIC 1IL2A 3RCZA 2Y0SE 4NAWA 4LK0M 4NJ6A 4GNXC 1XXGA 3RUZA 2F0IA 3OMGA 2QEJC 3NHEB 3ZNHB 1CZWA 1Y69U 1OQQA 1K52A 1II3A 2LWPA 4NKLA 1HJPA 4B9KA 5MPOA 5IGGA 2OTJA 1M4VA 3KUZA 3GD7A 2IL8A 3L08A 4GN1A 3DBRB 5FOBB 1R9TH 1HNZQ 4JI2Q 2PYKA 2PO4A 3I2ZA 4LFAQ 2MSED 1YNNC 1NJIC 1FFUA 2V4LA 4GOCA 1RJTA 2MP2A 1GB4A 2M0AA 3A56A 1YZ6A 4P75A 4ZYNA 2QIEB 2KLGA 2Z0DB 3J80i 4DAYA 4LWCA 2Z4HA 4IFDI 1U5KA 4DR2Q 5A2QE 1WTHA 3NWSA 1A2UA 5F2DA 1L4ZB 2YEPF 1WYGA 4I7ZC 3UDIA 2X6LA 5CORA 2R7ZB 3MJ5A 5DPRA 3Q3OC 4KHZA 3KF6B 4A3JH 1E8XA 3ZVVA 4B9XA 1EQVA 2KDEB 3QK0A 5M3MG 4BBNC 1T3QA 2LGSA 4DK5A 1YNXA 1A5RA 2WB1G 3U2SC 1E7VA 2SOBA 1S3OA 2G4DB 4LF8L 3D8GA 3HRZC 5LXHA 1FCLA 4GN4B 3A7AB 1K8OA 2FAZA 2ZEQA 4JLCA 2A73B 1DONA 4YSXB 4LFBL 3OLMD 5C0XG 1KOTA 3LWEA 4MJSB 3I73A 4GN5A 2FIFA 1T9HA 2KDBA 1V1QA 1ISNA 1IKLA 3RPFC 2A5UA 1LTLA 1NY4A 1V8CA 1XO3A 3GV6A 2WX1A 1Q86C 3UI2A 3QARA 5IN7A 1SE8A 3G6EA 3HKZB 1LTGD 2K6DB 2UWQA 1QUQA 3MEFA 2EYLA 1STAA 4P6VF 4DGZA 1NBWA 2WINB 5COYA 1C76A 3UGBB 4KJOA 4PMCA 3ML9A 5CBEE 2HTHA 2R7FA 1WTOA 1KDCA 4GOPB 1J19A 5M3FB 1BO0A 2KDFB 4R8NA 2PMVA 5JJKA 1FXTB 3KVFB 3DQVA 3UE1A 3CW2C 4DUYL 4HJ9A 5C0XH 3HFZB 1SLJA 3MTNB 3CCRA 3DVGX 5I9OA 1VQ6A 2IPKD 2RHSB 5AZGA 1ONLA 3BZDB 2D2CC 1RIPA 3HGBA 3T53B 2C7MB 4CKBA 2CCZA 2JX5A 2LS01 1LV9A 5IWAL 2L0CA 3AQQA 2JPHA 1KLGD 2GRIA 1Y8OB 2RPVA 3S2HB 4M0WA 1PYWD 1S5DD 1XTDA 1ZUD2 1R4NI 1CUKA 3HM6X 5T8IA 1CA5A 4FYDA 1KXLA 2KCTA 5CHFA 5ISRA 2F4VQ 2DNEA 2AQ2B 3PHXB 4K14A 4A3GG 4K81A 2G1EA 2RDFA 1GJZA 4M00A 4NW2A 1HZ9A 2KEEA 4YWKA 2PEAA 1XNRQ 4ARCA 4U673 4BOZB 4TQ1A 1OXTA 2M00A 2WNMA 1TIID 1QZHA 3ZO5B 1WFQA 3S1NB 1ILPA 1TYGB 5HGTA 1YNND 4HEDA 1UH6A 1TS3A 1F2MA 4OONA 1BF4A 2WDQB 2CS4A 1TU2B 1QOFA 2KC2A 2KVZA 3RT3B 4K2LA 1O7LA 3CD6A 1OEYJ 3MFGA 1EWCA 1XEEA 4JI5L 3VHTC 2CU3A 4US8A 4JV5Q 2LSSA 3Q8FA 2UUCL 1E1TA 1PH6A 3M4YA 1TS2A 4N8X1 4BVUC 4RA8A 3PO0A 4DDGD 1I7HA 2KTRB 2P5ZX 3MXGA 4GDKB 4W9IA 5EQ0A 3J81j 4HCEA 2HHHL 3M4OB 4A55A 1Q90A 5C3JB 1K8AC 2NVQB 1SIJA 5IT9c 2EJGC 3ZJUA 2L0TA 3RMKC 1N63A 1XPUA 1FGUA 5LMUL 4QMGA 3T9LA 3TCAA 2PKOA 2PTLA 2GBJA 4NNJB 2B29A 4ME3A 3S2HH 1PZID 1D6EC 3ULJA 2QCZA 3D31A 2RGFA 2YLMA 3VTUA 4QAYA 2KCMA 1AZQA 2BDNA 1ASZA 3ND8A 3V2TA 2IGDA 1HH2P 2D2QA 5BO4B 2QEXA 1BCPB 2GBRA 5J2RA 1VF7A 2J0TD 3LDZE 1TY2A 4WWOA 1JJ2A 2LI5A 1SEBD 1F52A 2DZMA 1DOMA 1A70A 3ABVB 2K4KA 4LJZC 1PH3A 4ITKA 3R7RA 4US9A 1U4AA 2FBWB 1JOOA 2C5CA 2WP9B 1VZ6A 1LFDA 2KC1A 3S1NH 4WORA 2JXXA 4PZ8A 3ULPA 3KF8B 3QO2A 1UGJA 2KWCA 3L3OC 2M17A 2MW5A 3RZOB 1MKHA 1RD9D 2NWGA 1FO4A 2JVCA 2MH7A 5J17A 4LJPB 2JJQA 1DOLA 1WTWA 2K5WA 4JIOU 1PTOF 3FAHA 2HDMA 2PPBC 4AQYQ 2BWFA 5BMGA 4C7YA 2K1FA 3TSSA 2MRPA 2ASQA 3AE7B 1IZ6A 3ZYYX 3A55A 4KD4A 1UZXB 5H92C 3C1FA 2B2YA 2N78A 2OOBB 3OWFA 2JSVX 4TSSA 2REXA 5G5GA 1XQQA 4KD3A 1Q7YC 3T3NA 2EPBA 1JCKB 3DLLA 4I6PA 2CH4W 3VRAB 5G3LD 3RN5A 3OWEB 2F3WA 1SDFA 2NVQH 5JHBA 1UD7A 4WJNA 1JORA 3B1LX 5C44G 1XLPA 1YN5A 1BDOA 1NDDA 3SHQA 2NMQA 1DOYA 5ELNA 3SGIA 1VQMA 2BS2B 1YD8U 1HZBA 4K6DA 4GDLA 3UINB 1H9RA 2RMMA 1T0QC 1KM7A 2DYBA 3W5VB 1SMYC 3G7LA 3K7UC 5EBCA 3H6MA 1YJWA 4LFAL 4OWWB 2B63B 1S72A 1RM6C 1PGAA 4NAMA 2EKEC 1EQTA 4YCUA 2BYVE 3W1SA 3I7FA 3TDQA 4HPMB 3FRPB 2Z59B 3I56A 5AUKA 3NBHB 4M01A 2Z6KC 2Q8RE 3DM3A 2A6HC 5JEAJ 3KUPA 5DM63 2Q2UA 2KLCA 3GE8C 4DR2L 1ZGUB 3ZIMA 3ONAB 1P7EA 1SBBB 2D9UA 4GMVA 3NTIA 2O6VA 4H7BA 3RZOH 4IFDG 2B3AA 3DCGA 1H8CA 1P7FA 3MXPA 4GLSC 4LCDE 1TT5B 1STGA 3DBLB 4K1RB 4FHJA 1J7BA 4W9FA 5LMNQ 4YHHQ 1JB3A 3VYUA 4LFCQ 1IPGA 3R7QA 2KD0A 3MXNA 4EQOA 4ANWA 4V190 2IZVB 3MEHA 4WQOB 1R4MI 1JC7A 1XNQQ 3A8KE 4HJAA 5KHOA 3IG3A 4G57A 2AX5A 3SK4A 2D5GA 1FCCC 3T56B 3PSIA 4UP7A 5JJZA 1ICFB 4DV7L 3T1HQ 1K50A 4CYEA 4ICUA 5K5PA 2L4NA 3HM3A 5FO8B 2J53A 1H9KA 2K6QA 1N5WA 3PV0A 4ZRKA 2BA0A 4MHEA 1WYWB 5CHVC 2VS1A 2N7DA 5DCNA 4S17A 3C1EA 1EYDA 2NR2A 3MHBA 1N32L 3BJUA 2DZIA 4L1BA 1KHIA 3AE1B 3TS2A 1H95A 1VQLA 4C3JB 4H13C 2UXCL 4F87A 1K0RA 1D2BA 1P1AA 1LT3D 5AEKB 2B63H 2R7DA 3AE4B 2NZOA 1SF0A 3CCJA 1PRTB 4BY7G 4LJOB 2J7ZA 1C48A 2KMCA 2BB6A 2NPTA 4JI6Q 1T0SC 2Q5WD 4RFBA 2QJLA 4LDTB 3P2BA 5H1SE 3UF8A 1KAAA 2PZWA 4X3SA 5E7NA 1XMQL 1E8WA 1QVCA 2L5TA 5BN3A 4JI8Q 2PPHA 3ZW3A 3GV3A 1TS5A 4M8AA 3VR2A 2VQFQ 3N1XC 2Z8LA 5E6PA 3WAMA 4ANXA 1F1HA 5ELDA 2KOXA 1Q82C 4C3JG 4LF4Q 4KGTA 1LXDA 3HS0C 5DM73 2HQEA 5GAGC 5C4ZA 2I1JA 4HKZE 1HZ6A 4FHKA 1MHWC 4GOPC 1BMLC 4AWJA 1B53A 2JXMB 2HE7A 3LGJA 3NWTA 3CCLA 2VRRB 2MA9B 1PH2A 4KK7A 1RAXA 4NAWB 4A8XC 2VB2X 4OHJA 4BAXA 1I4QA 1FVIA 4BY7H 4MELA 5GAHC 3SHLA 4GB9A 4CO7A 1SYEA 3DEPA 4E71A 5EE3A 1XNRL 4KV2A 5IGFA 3AEFB 3NENA 4BBSB 2Z6BA 3QJYA 3KJOA 4A75A 4BBRB 1FJGL 3AECB 2KVRA 1SMYD 4A6QA 4OX9L 1TBEA 4G0NB 1NAPA 1K9MC 4G7OC 3AE5B 5IAAC 1UE1A 3HOXG 2FIDA 2WXHA 2IJ0A 3A1QA 4TUUA 1BKBA 4C3JH 1AZPA 4A3EB 4K3BA 1SSOA 4WH4A 4QY7A 3OIPA 4Y7NB 2A6HD 4DV0L 4IOAA 4JV5L 2WDVB 3RMHA 4HJ7A 2FUG1 2Q8TA 1V2YA 2N1VA 3U9SA 4HJ8A 2F1MA 1PH1A 1YQ4B 2JQRB 2WXPA 5E1FA 3ICEA 3S2AA 5D94A 2H89B 4X64L 3QX1A 1ENCA 2FMMA 4BBRG 1QOGA 4PNYA 2ID0A 3G4SA 1EYCA 1UWXA 4K5VA 2K3UA 4KX6B 1S5FD 1WIAA 4DR3Q 4ZUIA 3AB9A 4DXFA 3IT4B 1YJ9A 5IODA 4A3EG 1YI2A 2HJ1A 4HJKA 1N6ZA 1CMXB 4JGHB 4MH8A 1UF0A 4GNXB 4A90A 1A8VA 2MBOA 1H4RA 4ZQ3A 5JJIA 3MAQA 5JVH3 5IOIA 4PYUA 4LK1C 3Q22A 2GLSA 3B2FA 2F0NA 2WFWA 4H0LC 2XIWA 3VR3A 1YIJA 2OWOA 3GTQB 2V3NA 3M95A 4R9WA 1XF5L 2XRSD 1YJNA 4BBSH 2RDHA 3UDFA 2UU9L 1F2RC 4EFOA 3FKIG 4BBRH 3IL8A 2BH8A 1K73C 4I6LB 3E6ZX 2R93G 4TKNA 3OG5A 2N0SB 2IX0A 5HY6A 2B76B 1QOBA 1STBA 1TKWB 2R2QA 4C00A 1ML0D 4BY1B 3E5SA 1BCPC 1EU3A 1EWHA 2CHBD 2NUCA 4A3EH 3I91A 1WXQA 2WXLA 4DR1L 1GAQB 1AWDA 1NI3A 4MEMA 2KMAA 5EKIA 2WU5B 3PS6A 5FLMG 4Y7NH 2HDEA 2QF7A 4R8IA 5KIXA 4XE0A 3JYUA 2H5XA 4EQNA 2XK5B 2D07B 4FJYA 1TWAH 1EU4A 3AE2B 1ACCA 1IHZA 4OELB 1IBXB 2RCFA 2Z9HA 4DDID 2VZAA 3U30A 4DU9A 4ZRPA 3OJ3A 3AULA 3FDTA 4A3DB 1XLQA 2EYHA 4TQUS 4HJ5A 3S1RB 4MH0E 4DA2A 3DBRI 3FKIH 3AEAB 2A8VA 3NXWA 3TP5A 2KQ3A 4JX1C 1SSNA 1FL0A 4X62Q 3K5MA 2B2TA 3NVWA 3DWAA 2YEPB 3NTHA 3CHBD 1TWHB 2OEOA 1WJ4A 3T1YL 4ZKBB 1PVOA 5EPLA 4IJHA 3VYRA 3A9JA 5M5YB 1U9RA 4DNTB 1C7YA 3QA8A 3NBIA 1ZYRD 3IAM1 5TR5A 2GVAA 2PW9A 2EYFA 4UHVA 2E6XA 4KTAA 3GTQH 3G71A 1PQSA 2MBHA 2V0GA 2MPMA 2FCMA 4WWMA 2KCNA 1A3TA 4BOSC 1K8GA 4RWSC 1MFWA 3VUXA 1E10A 2JK8A 1KC8C 2OT2A 3Q3NC 3RFZB 3P75A 4H02A 1ZDXA 4GLXA 1UELA 1EY8A 2CHWA 3Q23A 3CCVA 1PZJD 3F1ZA 1C4CA 2WU2B 4P16A 4L5QA 1X9NA 4EE2A 1B9MA 4A3OA 1FD7D 4J6IA 3KK7A 4ARIA 4JYAQ 3K5OA 5LMNL 4LFCL 4YHHL 3UDXA 1E8ZA 2AYOB 5EAYA 3MZ5A 3NSWA 3ZQ4A 4C3HB 1XNQL 3WANA 5EDSA 4GXBA 4X57B 3ZDTA 3LNNA 4IKGA 1QB5D 4UP8A 1WXSA 1EY5A 3GTJB 1V86A 3Q3JA 1GXDC 1DOXA 3UIOB 4C4VA 2DZJA 1HQRD 4LW1A 3DWMA 1GHJA 1MG8A 3ZGZA 1GUGA 3S1RH 4LNFA 2MQHA 4C2MH 1OGWA 4KLKA 1A6XA 2AUJD 3JW0X 4ANVA 4MIUA 4X6AH 3FPPA 2IGGA 2PE6B 4QIWB 4NPNA 4WRDA 3C3LA 4DR7Q 4LUOA 1WXAA 2L83A 1HR0W 1YN4A 1I35A 1TWHH 1WE7A 2N9XA 4WQMA 4RMAA 2BW2A 5M5YH 2E2HB 3X0WA 2JA9A 2CHXA 5HGQA 2LUEA 3RYTA 2KQ4X 4HXDA 1CT1D 1UGMA 1P8LA 3VTWA 2LJ5A 4GU2A 5DPWA 1BCPD 2AHOB 2E74C 1A0IA 1STEA 2INCC 3CRLC 3H7PB 1N5XA 2N4FA 1PA6A 4JI3Q 3VH3B 1V9JA 1QE6A 5K36H 1FXIA 1QQRA 5HHDG 1JRUA 2BH2A 1IYJB 4LF6L 1XYIA 1PLFA 2KXJA 2ACZB 2PNHA 1CA6A 4HCNB 1IP9A 1RHPA 1FRRA 3V62A 5JEAG 1V81A 1BBXC 5CMDA 4B3RQ 3H0GB 1MJEA 2F0MA 3FVQA 4C3HH 2H1EA 4A3FB 2PQEA 2MNAA 1C78A 3ZXRA 3I72A 3BZCA 1N33Q 5C3WA 1X56A 2EXDA 3OSOA 1JJGA 4XDCA 3EVQA 3STBC 3GTJH 2OJWA 1EOTA 3IKJA 4P73A 5DNFA 4GDLB 1TGZB 2RPQA 4KY7A 2A68C 1SFOB 1FFVA 2Q2TA 3I4NG 1BOSA 4G11A 4KHPL 2PI2A 4KHVA 5BYRA 3BYTB 1QNUA 3T8MA 2DNFA 4FNFA 2EMTA 2VUMB 1G8ZD 1GUSA 2J52A 3G48A 3R2TA 4AP4C 4X3TA 1S5BD 2MUYA 5LXIB 5EE0A 1NENB 5DEHA 1HEZE 3M62B 3O13A 3NRZA 3TZDA 4ZRQA 3RNGC 3W5OA 4NXML 3UDGA 5DPSA 2O6VB 4LF7L 4A3CG 3H7SA 2UXBQ 4FJZA 1I94Q 2L32A 4EUTA 2R3ZA 4DK1A 2HCCA 2MO1A 1HZAA 1TWGB 1VQEA 1CKOA 1XWEA 2BCOA 4IALA 3OTOQ 4N9F4 4GGQA 4Q2JA 3PZ7A 1LM0A 1Q8IA 2I0QA 1F2RI 2D5DA 4ZKCB 2I1KA 4P2CB 3I4NH 1EY7A 1KABA 2L55A 2FCQA 2K33A 1ZE3D 4OL7A 4DR3L 1OXUA 4JBKA 3TEYA 2Q2HA 3VVWB 4N9TA 1RL2A 3AYHB 4RGOS 3MWYW 4N9PA 2BWES 4F7XA 5ELFA 3H8HA 2VQEQ 1VQ9A 4DV2Q 5GADC 3FEWX 1EL0A 3BYYB 1N9WA 4DPGA 3AI5A 4AQ7A 3GE3C 1AE2A 1E1OA 4DV3Q 1PTOB 3D6CA 5CC4A 2HUGA 4A3CH 2F0KA 3PZDA 4C3IG 3BDOA 3C2PA 3PHWB 3J7AF 2V4IB 3OJ4B 1SFOH 1E7ZA 1UNSA 3IAS1 1EY4A 4DK3C 1K51A 1DM0B 1KAWA 2PVGC 2E2DC 2WDTB 2WS3B 2VUMH 1Z7TA 1L0WA 4JG2A 3K58A 1SNCA 2F3VA 1TT2A 3GTGB 2B2VA 4A3JG 4EKUA 3HHMA 1WRDB 1GC6A 3VTVA 4EZLA 4NXNQ 1RF2D 1WF9A 2INPE 3N30A 1QF6A 3GOEA 1WMHA 2IT1A 3CCMA 4MM3A 1HNXQ 1IBLL 3JSVA 3Q8AA 1VQNA 3PUXA 1LYLA 1MBYA 1KDBA 3ZJVA 3EFXD 1TWGH 2NVYB 1WM3A 3NJTA 4XX5A 3CSTA 3CC2A 1EIYB 4HLEA 5AFWA 4XYOA 2XSCA 4R4IA 2MBEA 4LUZA 3J7AV 4C3IH 5JPMC 3Q8CA 1RDPD 4BS9A 2D11A 1PRTD 5G2NA 4PQXA 2B2WA 4LDTD 3GTKB 4WJWA 4WIPA 4FULA 5I2XA 1ZXHA 4HPLB 2EY1A 1PFDA 2PQAA 4X62L 2H4OA 2JA7B 2DGYA 2LXKA 3STBD 2XVSA 3F2DA 5HFYA 1WTVA 2YTYA 1DJRD 5E3FA 1WFYA 1C9FA 1STYA 1UE7A 1SE9A 4X65Q 1WGYA 1HUMA 3G6JB 3QOLA 2YU9B 1ZKHA 2QMTA 2ZXOA 4F7ZA 2NBUA 1PTOH 2VXWA 4UY8C 2LHDA 1NNXA 2LGXA 4RM8A 1F9QA 3NE5B 3EA6A 4DXAB 4DR4Q 3RLNA 3ONSA 2N9KA 4JC0A 3AV8A 2Y0SB 1M8AA 3AB5A 3DBLI 4BKSD 1C8CA 3TN2A 1X1MA 1L1OA 2F0PA 4IUQA 5D65A 2R7ZG 1VS0A 2LY7A 4MZ9A 1UWMA 2JT4B 5D2MB 4B95A 3PPAA 4REZA 2YTVA 1FYCA 3GTGH 3HK0A 3I63C 2KFKB 1C3TA 1LACA 1VCBA 2QSDA 5KHQA 4JYAL 3H91A 1CTMA 3DXJC 2QDFA 2K52A 3D4WA 3CMEA 2RDBC 1ZOYB 3ZTDA 4K8IA 3E9HA 4F8MA 4FXDA 1LT5D 2BKFA 4P72A 3EECA 3GTPB 1IYVA 2NVYH 2IO2B 3CPFA 3CIRB 2PVOD 4IG7B 5FKAC 2PIAA 4CJ2C 5BYQA 1B2TA 2NB0A 5CV6A 1JOQA 3HP3A 3PF4A 2FFKB 1E24A 2PLPA 5AZFA 2WXMA 1HNWL 3TREA 3KLRA 3AEBB 1SGHA 4O0AA 2K5PA 5AUIA 1FD6A 3GTKH 2MBQA 3IHPC 4WAAA 1E6EB 2RR9A 1A3UA 3MTSA 2A6EC 3JAML 2ZPYA 3HKZG 2R7ZH 4OZAA 4OIKA 1MHHE 5C5LA 3NZSA 2A69C 1N36Q 2GMIC 2E5LL 1GNUA 1FIQA 1YBYA 4ULLA 4DR7L 1WRIA 2B8GA 1HCZA 2RHQB 1OEYA 1H9SA 1CKNB 2YU9H 5FLXL 1CSQA 3I55A 5M3FG 1HR0Q 2IO0B 3V96A 3N1ZC 1TKGA 3CSFA 1KJTA 1Q46A 2E75C 3FHWA 2BS3B 5JAVA 1QZGA 3IFWB 3PV1A 4K7WA 3VDZA 4HVBA 1T0RC 2F0UA 2Z0SA 2XNAC 4XIGS 4PYZA 3WIMA 1BBWA 1G51A 5BMHA 4APVA 3CQZB 2CQOA 1T6BX 4ZAIA 3NPPA 4KN7C 3CXCA 2I5HA 3PO2B 2NVUI 1YX6B 1OQYA 4GSWA 3QCAA 2BYFA 2IWHA 4S0RA 4C1NI 5FJ8G 2L11A 1MI0A 2DAJA 3HEJA 2CWPA 1GJXA 3KWVA 3BK1A 3TBLD 3TRZA 1J5EQ 1SAPA 1ASYA 2NVXB 4MTNA 2KBNA 3K9OB 2L52A 4R3DA 3CRKC 4DQOC 5J3BA 1LTTD 3LWUA 3KJPA 2BVCA 2LVOA 3GTPH 5CV5A 1K8MA 4DV6Q 2NVTB 4L5TA 1ET9A 3JAME 1N33L 1IBKQ 3NG0A 5M3FH 3AEVA 5M9OA 2MJDA 4XGAB 1B7YB 4KSLC 2NN6H 2HD3A 3R3OA 2KA7A 2RSNA 2EIFA 3S17B 1N60A 1WGDA 1BQQT 3NP8A 1FGBD 1EUVB 2AL3A 2D3AA 1LM8B 3J7A5 4J6HA 5CV7A 2EYJA 5FLXE 1CFMA 1KRTA 1YN3A 3T16A 1W2BA 4HSPA 5NUCA 4Y52H 3GZNB 4XZ4A 2XWJB 5FJ8H 5EE1A 2JU6X 1N34Q 1YVCA 3P42A 3OOCA 4N59A 3ZXVA 2W3RA 2UXBL 1LTAD 2QILA 4HTHA 1F9PA 1TZOA 2BGFA 3AEGB 4PMWA 4PS3A 4Q5VA 1ENAA 2B2UA 4XT1B 4IZ8A 2F03A 3AU5A 3A7LA 1PGBA 3OTOL 2MJ8A 1JJCB 4JVZA 3AMZA 2F0VA 3W1SC 4RKLA 2KEDA 1V49A 2L7RA 1V1OA 1AE3A 5E4XA 4DNRB 4IWOA 3N52A 2L9HA 1HTPA 3PO2H 1XPOA 5C4XB 4FF2A 3K0XA 3KLSX 2F52A 4CGYB 2UUBL 5JXVA 4FADA 4ZYSA 3IVFA 2Q8IB 4KN4C 2BYTA 3KDFB 4YXDB 2NVXH 1KDAA 3JC66 1UEBA 4YCWA 2DAFA 1FNWA 1UWVA 2PI2E 2NVTH 4MTKA 4HDQA 1JQYD 2EQSA 2BB5A 3A4RA 3B2GA 2NYZD 1Q1BA 5LL6X 3C8YA 3OW2A 2A6ED 1XX8A 4IWPA 4LLGM 3ZJTA 3S17H 2A69D 3KQ4A 4AS1A 1EY6A 2XGTA 3M4OH 2OHFA 3IBEA 4FF4A 4JI4Q 2DBYA 2K5NA 1PYBA 1PH8A 1JWMD 2F4IA 3EC8A 2KDIA 1MVKA 1EYAA 2JA6B 3A33B 1WTPA 1O7YA 3IFTA 1PTOC 1E90A 2WXKA 3KW5B 4A3IB 1BNZA 2BE5C 5IGBA 1X65A 3P63A 4K5XA 4YCVA 1HNZL 4G50A 3BDCA 4JI2L 4NQLB 2O2VB 1IL8A 1L6VA 1F77A 1P98A 3I3CA 4C1NK 4BKTA 2ENBA 4IN3A 3HOYB 1IBMQ 1RRBA 4LTUA 3J9CA 2GBMA 5JVG3 3PQIA 2WP8J 4RG1A 4IW0A 2JXTA 1VQ8A 1E7PB 4M02A 3I5JC 1PH5A 5JHAA 3HOUB 4GKJQ 4IDIA 4N6EB 5CX3A 1YHBA 5E6NA 2N9PC 4YY3Q 3MC9A 3QG1A 2BTEA 4HIOA 3RZWC 1ET6A 1EQQA 2M1MA 1GUOA 4GN3B 2NZ1D 4ZRZA 3F2CA 3BVZA 2LJIA 3KFUA 1PMRA 2A74C 3SR6A 1L7YA 3BY4B 1HTQA 4RGMA 2B63G 2XRQD 2WAQE 1V97A 4MSQB 1AW7A 1JWSD 1D7QA 4HMIA 2ZZPB 2I5MX 4C80A 4H2AA 1TIFA 3VUWA 3BVGA 3Q8DA 4II3B 4K0KQ 3HOUG 2RCNA 2WQYB 3TJPA 1JROA 5I4DA 4DR4L 2W54A 3APFA 3U7DA 1J9OA 1I4XA 1T5XD 2RDGA 1V1PA 4LNQA 1L6UA 5C2TB 3DHGC 3VR5A 1EFWA 4NZLB 2ALYB 3CCSA 4FXCA 2LEKA 3QIJA 1CZGA 2J42A 4DV5Q 1NYQA 3RNEC 3RNFC 2NS5A 1KLUD 4A20A 1TTNA 4K2KA 2JA6H 1JE4A 2NZHA 2D0OA 1VMPA 5IA7A 1A63A 1QILA 4EX5A 3C0RB 1I4HA 2WACA 4GKKQ 4MGKE 1AP0A 4AJWA 5KNBA 1SNDA 4EVOA 4DR5Q 4LF9Q 4UAIA 4BWGB 3QJZA 4W9GA 3HOYH 1Z47A 2JE6I 2ZCCA 1B50A 2KANA 1HHVA 2MCNB 1GM5A 3Q3MC 2QC8A 3HRDD 1V5OA 2FE8A 4IUUA 1QJOA 2VB3X 3HOUH 2O6VD 1S4ZA 2KJ6A 4MGZE 4WJPA 1DZ1A 2F0DA 4DHJB 3K57A 1DGJA 4MN3A 2D3CA 3WWVA 3OAWA 1TWCB 4J3OD 2QW7A 1WTQA 2VY3A 3WOFA 3DEOA 5IIFA 4KIKA 3S9WA 4HRSA 2LMCA 1PZKD 2DY7A 4LNKA 2WAQB 3DPDA 4PG3A 3CMMB 1TKYA 2VW9A 2HQLA 2PW5A 2TSSA 3DM1A 4J15A 5C1ZA 3V3XA 4W9JA 1WTXA 2EJMA 2AWTA 3VA5A 4XDDA 1A15A 1WXMA 4G7HC 4L2YA 2Z6KA 4ID6A 1C79A 2F4VL 2QDBA 2G4SA 2WKCA 2GI9A 4YSZB 4HR7B 3NEMA 3PUYA 1FRDA 1SYFA 1CSPA 2X38A 4WJ4A 3DBHB 1SYDA 2ZNVB 4MM3B 2OQKA 1Q81C 5IP9G 1PTOD 1MGSA 2F0EA 2ZM6Q 1N62A 2BE5D 2MP2B 2WXJA 1VJKA 3D4RA 1WWTA 3RNAC 3TEXA 3ZRCA 4ZHOA 1M94A 2LXCA 3EFUA 3TUOA 1TXYA 2K8HA 2G9HD 3HVDA 1I3QB 1YITA 4DAYB 4A3MB 3U50C 3KWLA 2RQXA 1KD1C 2BF8B 3EN2A 4O42A 2M56B 3VYSA 5HKHA 3X3MA 2IYDB 2QHOA 2IY5B 3SFDB 4ANUA 5C23A 1XCQL 2VZKB 5L83A 4DV6L 3KLSA 2PQAB 1HUNA 4B6WA 1IBKL 2VH2A 2X6GA 1XCTL 3N6RA 4M1UB 3KOJA 4QUFA 3ERSX 4BBSG 1F2YA 2KENA 1RLFA 4ICVA 5CV8A 3E9SA 4I7AA 3AEDB 3IXSA 3AE9B 4P71A 4JBMA 4FF1A 4JCVE 2EYMA 1EOVA 1Z5SB 4DAVA 1DD2A 1HQMC 1WXVA 2F0FA 4NMZA 4WJOA 5IP9H 4CQNA 4W9DA 3U7ZA 2ZJRA 4ZHPA 2O2LD 3SE0A 2BDOA 5J1ZA 1SYCA 2N8NA 3VYTA 1H9MA 4MJSA 2SNMA 1F0ZA 4N58A 3GTOB 5J18A 4POGA 2WXRA 4AH6A 1MSHA 4YSYB 2B2TC 1L1OB 1DGSA 5GROA 2KYWA 3ZRFA 4RHSA 2K5HA 2CWAA 4YWGG 3S1MB 3MHSD 1WX8A 3RD2A 4A3PA 1HPCA 3W2DA 4A3BB 1QUQB 4ODGA 3OHXC 4JI0Q 1SE2A 3RZFA 1Q5WB 3S14B 4IPGA 3GO5A 1C77A 1ZEQX 2PMZE 3EFCA 2ZTCA 1J0GA 2LXAA 2TMPA 5E6OA 3ECIA 3R3MA 4GOPA 4A93B 3AE3B 1LTID 3CAMA 4IOCA 3RN9C 3V6CB 3TMEA 1BCPF 2KACA 1I3QH 3KBGA 2QDLA 1RODA 1F2LA 1LTRD 1Z9FA 3AE6B 3AU4A 2EY5A 2F0WA 1ZKOA 5BR8Q 1C1YB 2X8XX 2XEWA 3HUIA 1GPXA 5JZEB 1NR2A 3W3AA 3URYA 1L0YB 2LRWA 5C5MA 4AQYL 2JRHA 3Q3FA 4HCPB 3SK8A 4RKBA 2C9OA 3P4PB 2DUDA 2OQ0A 2ICEC 1I4GA 3ND9A 3SEBA 2RA4A 3J81L 1X6OA 4KV6A 4R1JA 4XQNA 2MO0A 1XMOQ 4M0WB 3SR1A 3DUZA 1OTRB 3CCQA 3E0JA 4PMBA 3CKIB 2DENB 4UDUC 3W1BA 2OJRA 2JZ3B 2EY6A 5ELOA 5GMVA 4BY1G 2K22A 3U58A 1QNKA 2Q2IA 1VQGA 3GP7A 4CJ0B 3H3VC 3KH0A 5L37A 1E2VA 3NOBA 3VR8B 4A3KB 5C4HA 1I6HB 1L0VB 2F0SA 2M9VA 3B0AA 3V05A 3SXHA 2N3SA 1YHQA 1ILQA 3S1MH 4ZRJA 2J0KA 4MGYE 3IAYA 1PFNA 2ZJPA 1E8YA 1IBML 4LF5Q 1QCBD 3MXUA 2CHZA 4A3BH 1M90C 1WGGA 1IYFA 1MHXA 1C9OA 5DLQE 3S14H 4GKJL 4OO1I 4A3DG 3SU8X 5IY0A 3M3YB 4RM9A 4A3LH 1EZ6A 4BXXG 2FCSA 5D6JB 2AKWB 1J7AA 1K0SA 1CI3M 1GUNA 4A93H 4FA6A 1I4RA 1TY0A 4DWFA 3LJ3A 2XTIA 3TP8A 1OFFA 3S1QB 1YHAA 2FUHB 2HIXA 4BY1H 3J81E 2KTRA 2WWZA 4JWSC 3WAOA 4WWNA 3NVZA 2B39A 1SYBA 3FILA 2K05A 3TQYA 2PZTA 1S1QB 4AYBE 4LF8Q 4XC2A 1UE5A 3DDCB 4KVGB 4LFBQ 2DYMA 1K3BC 1EM7A 3QWNA 3AN1A 2KT7A 2ZCBA 1K3RA 3T1HL 2Y5CA 4X66Q 2UU7A 3PT2B 1I5FA 3EQLC 3K80C 3L0WB 4A3DH 3I4MB 5K36G 4KKUA 1P16A 1EIHA 3U4EG 1Q8KA 4BXXH 2K8CA 1Q1EA 4DV5L 3AFQA 1WI0A 5FK9C 1LTBD 1JE5A 3J80L 1SR3A 4NQKE 4A3KH 5FR6A 1I6HH 4C3HG 1YQ3B 1F2ZA 4GKKL 2RF4A 1Y56A 3KF8A 2K39A 2N9LA 2NN6I 2NBWB 4LF9L 1O80A 2JA8B 2DLBA 5ELCA 3ZJYC 5IYDG 2NTSA 3DVNV 5CHWA 1IXRA 4JI6L 4TV3A 5IYBG 4DUYQ 2NBVB 1C4AA 1ESFA 1CHPD 1W3SA 1J8IA 5T1GA 3JAMc 4KDIC 1BT0A 4EQ5A 4CDEC 1RKNA 4AOFA 3MHZA 4JI8L 2LGDA 5IWAQ 1OQRA 4XYCA 3S1QH 3A0JA 2VQFL 1PRTF 4RGNA 4QCLA 2JZZA 4LF4L 5CV4A 3D4DA 1VR9A 3PRZA 2JA8G 2ZJDA 3K6OA 1G6ZA 1QVFA 2KX3A 1D5ZC 4LNNA 2JYEA 2ICIA 2CFMA 5CGKA 5I9PA 2DY8A 1H9JA 1PH9A 1ROEA 2CU1A 3Q8EA 3P4RB 1ZDVA 4E3CA 4P1CC 5IYDH 2YVCA 2K04A 4NPSA 3J80E 4N8FA 3QR8A 5IYBH 2RD0A 2H88B 4MT5A 2NTTA 1BUIC 1KTKA 3E56A 3I4OA 1XPRA 1KRHA 1S5ED 4X3KA 3I4MH 1JOKA 1SE3A 2DNCA 2ZXPA 4E6IA 3M85A 1O78A 3VR4A 2ZM6L 1QT9A 4PK1A 1RCVD 3T51B 4ABNA 3KYDD 3UI3A 2SNSA 1OO9B 1DCZA 2G5DA 4RCOA 1YIWA 1QZEA 4LUVA 1KL9A 4PZ7A 3NBHA 4DXGA 4JI5Q 2JA5B 2V9HA 2WYQA 2B2VC 4FP5D 3H0GG 1Z6HA 1DOIA 1MIUA 1RFKA 4P7IA 5G55A 2INDC 1U4LA 4A3FG 2UUCQ 2WDRB 5IP4D 3C19A 1A62A 1EWIA 2Z4IA 2GVBA 1HE8A 4XYQA 2JA8H 2CQAA 3DOWA 2E2HH 3NELA 1WCMB 2ZNVC 1PDXA 1B44D 4HKQA 2KHJA 4DHZE 1D3ZA 5EJWA 3K0YA 1I4PA 2HHHQ 1R4PB 3MC0B 5D3IB 1MSGA 1RTNA 3MXNB 4FXKC 3DVGY 1YOVB 1SN8A 5IGCA 4KZCA 1O7IA 2B3GA 4GLVB 2VUMG 3PLUA 5CR3A 2IY1B 3GZNI 3PCOB 2K0PA 4TQ0A 2GOWA 1LTSD 4JI7Q 3J81i 3PVLA 3A74A 4DF7A 4CDCC 4HMJA 2KCCA 2CJNA 3UE0A 1BBUA 2K03A 3S15B 2YV5A 1XLNA 4KGRA 3TMPB 2K5DA 4JOIA 1MG4A 2HT1A 3H09A 2MHVA 4LNOA 3DWPA 3H0GH 3PUWA 4OWXB 5LL6S 3LX0A 1UAPA 3LYYA 4A3FH 1Q10A 2WXGA 1K83B 2QCPX 3BDLA 2HTME 2Y5BB 2F0HA 4W9CA 1JW9D 2KFJA 1OXSC 2WB1E 1VRAB 1E7UA 4PV1C 4O2DA 2M19A 1PYSB 4OXPA 3M4PA 4ZCKA 2R2OA 4LNIA 3AFPA 1VMCA 4OIJA 3NTKA 1LQBA 4CDFC 2OCEA 1LT4D 2DJGC 4IUNA 4OEMB 5JJLA 2MHJA 1PFBA 4JI1Q 3PIO3 2NPTB 4BA1I 2JEAI 1L1OC 3R8BA 2KJRA 3RNCC 3UQAA 3H3VI 1J7CA 4KKSA 2JUOA 1Y8PB 5A2QL 2AWOA 1DYQA 2BYEA 1BR9A 4FJVB 1HZ5A 2WHIA 5BYSA 4NP5A 1Y1VB 4TKOB 5AZHA 1BXTA 4RF0A 1ZXTA 2KHIA 2C9WB 4DV1Q 1QWYA 1E0ZA 2DN8A 3F2UA 3T13A 2CKHB 5EE9A 2I2YA 5M5WB 1FM0D 4FN2A 2A19A 5FR3A 4D2KA 4TMAB 2BA1A 1YJJA 1XMOL 2JRIB 1GO3E 3P7JA 1TZ1A 3DWGC 1JQ4A 5HG2A 2SEBD 3OIQA 1S3SG 3SDLC 3ZDMC 1JICA 1OXXK 1U4PA 2K50A 3L2PA 4BKSA 2A5HA 1CM9A 4RGTA 5I6YA 2K28A 3PRPB 3D3RA 1OTCA 1AN8A 1EIFA 2E76C 2JSOA 4BBNF 2MJEA 4DHJD 3S15H 3HKZE 4K5WA 1SNQA 1Y1VG 3HKSA 4JPBW 5M3MB 2KJHB 3LB8C 2BS4B 4JQWC 1PXUA 2A68D 1AEXA 2GN5A 2WB1B 3QC8B 1WI5A 1K83H 3M9BA 3CCUA 3N9YC 4DUZQ 1GUAB 2PCFB 3AXCA 2RKSA 4LAAA 4LF5L 4WURA 3EROA 3A1QB 1E0BA 3HVZA 2ZXRA 2C60A 2KMMA 5C4JB 1VLBA 1Y8RC 1VDZA 3SDZA 1WTRA 5LMNW 5M5XB 1U4MA 4BA2I 3OW7A 1RYJA 1VDVA 4OO1G 4JBJA 4K7UA 1V9PA 4HIKA 3MFYA 2JA7G 1WR6E 3W1GA 1C4PA 1U0LA 5HURA 2JYTA 5CBAE 2LVPA 4B0MA 2C35B 4AIMA 3PUZA 1DXMA 3EHVA 5EGTA 2OF1A 2KWUB 3R66C 5GXGB 4OVZA 3VRBB 3T4AC 4CBVA 4OVVA 1Y1VH 3X3NA 2WXFA 5IO9A 4DV7Q 1MJDA 2A4ZA 4YTNB 5M5WH 3BWUD 1TR5A 4L8JA 4FXGC 1QOAA 2Y0SG 1EQRA 3U52E 4BFRA 4X66L 4GNXA 4JE3B 2VZKD 2Z0EB 4XQQA 3H15A 3ITPA 2KECA 1V6EA 3BVMA 2QGQA 4IUPA 3WDNA 1N32Q 1G291 1AYFA 1JMLA 3APCA 3RN2A 4KKIA 4HJGE 4CKCA 1VD2A 5G3LF 4OO1H 2UXCQ 3EIVA 1X3PA 1KFYB 3DHIC 4B0EA 2JA7H 4K6LA 3S24A 1VQ4A 5ELEA 3MVVA 3P1HA 4C56C 5BN5A 5M3MH 2WXNA 3ETRA 1WY8A 1JR0D 1MD2D 1TJEA 3K5NA 1NTGA 5DPTA 1P3QU 1J8CA 1NR4A 3UIPB 2GA4B 1EY9A 1GUWA 2EZVA 1JWUD 4HWIB 4A3GB 1N8RC 1PV4A 4F1SA 3QOJA 1D5MC 4DN4M 1EIGA 2NN6G 3A5UA 1XMQQ 2VL6A 3TP7A 3A8IE 1QG7A 4RMFA 5KNDA 2IX3A 3HOWB 3L7ZC 2B2UC 2MWSB 3N20C 3PTFC 5C4JH 2MBBB 1B1ZA 3Q14C 3AMUA 5M5XH 1KH0A 2KJXA 1QLBB 3CF6E 2O5IC 4JI3L 1QKZA 2XK5A 3KYCD 2JZPA 5KRUA 4MACA 5IYCG 2E8GA 3RI7C 2L15A 2K7VA 5KYLA 3L9AX 3OYYA 3TS0A 3OMCA 5D7GA 5LLIA 2KZRA 1IBXA 4CJ1B 2JQOA 4H44C 1Q12A 4ILWA 1HA6A 3W9CB 1VQ5A 5IOCA 3PMFA 1QOHA 1VF5C 4B3RL 3JVZX 3TZUA 1K53A 2LHEA 2R61A 3DBHI 3NQIA 3DVNU 4C7ZA 4ZRIA 4IPDA 3B08A 2ZW1A 3HOWG 4K8JA 4S3SA 1V80A 1LUZA 1EY0A 4R4OA 3P4SB 4ZOHC 2B2YC 1L2FA 4WFN3 1FJGQ 1Y8NB 1GOZA 4OX9Q 2LXJA 3PO2G 3ZNID 2Y5PA 4IURA 3A9JB 1DOKA 4YL8A 1F9JA 4EZKA 4B08A 1CZPA 1BUVT 3H6NA 2AQ3B 3RD4A 3CMAA 2FHTA 5IYCH 2LFNA 1TKEA 3MJWA 3E9IA 3HOVB 3AU7A 1JALA 1KNEA 2YTXA 4DV0Q 4M8MA 3PIPA 1V5TA 2EXZA 3BZKA 1GC7A 4R4TA 3PIP3 5IGEA 2AL6A 3QWZB 4IM3A 4A3GH 2L1BA 1I94L 1EUJA 1ESRA 3SVMA 1IGDA 3H1UA 4X64Q 1CJEA 3I9V1 2ON8A 1X32A 4YTMB 1Q3LA 5C3XA 3K8AA 1L4DB 1TWFB 3HOWH 3L17A 2KDMA 2KTFA 4B9WA 3FILB 4ASWC 1IUEA 3CQZH 3HZXA 3APDA 3LXFA 4CDDC 4OZCA 2IW3A 3U4ZA 3DHQA 3M4QA 4CHTB 3X23A 3NHHA 4JI7L 1G2SA 2J0JA 5E4WC 3HOVG 4F8CB 2ZVNA 4C4VB 2IHEA 5FO9B 1JT8A 3PRMB 4NB3A 4ALPA 2WLBA 4JL9A 1FEHA 1T5EA 2MX2A 3L10B 2KUMA 3KLWA 5ELBA 2VQEL 1MPEA 4DV2L 4G3XB 3VH4B 1R4QB 4OGQC 3SK5A 4DV3L 3TEWA 1TQOA 2MP1A 3K7AB 2UU9Q 2KK8A 2MEKA 4YTPB 2FMCA 2XN9C 2AMCB 2UUAQ 5C4XG 1EEID 5GQOA 1O7ZA 2LUMA 2JWZA 2EVBA 3TEZA 2D10A 5C44B 4CHKA 4JI1L 1F9SA 4KDLB 3FC4A 1WD0A 4DR1Q 1XLOA 2E2JB 1VQDA 3PF5A 3HOVH 1B8AA 2N9EB 4J1MA 4IJLA 1KIXA 4YWMA 3A8JE 3KBXA 3PGEA 3H7PA 4NXNL 1X55A 4RNAA 3KYHC 4V0BA 3I3TB 1KRSA 2D3BA 3VAWA 1C4QA 2V1CC 4L6TB 3J81c 4DV4Q 1HNXL 3WAPA 4L63B 4FBJB 4DV1L 1X3EA 1V8QA 3GQBA 1WJ6A 2AEHA 1TWFH 4LMQD 1VZ7A 3A9KA 3NVYA 4IUVA 5LHY1 1D5XC 3J7ZC 4XDXA 4QJFA 4M8NA 4RF1A 1WOCA 4B3MQ 3PLVA 4AJYB 5EBDA 5C4XH 4TRDA 4QF4A 2J7QB 2JA6G 3I70A 4YIJA 4NY0A 2JEBI 3RUIB 4DAMA 3I8ZA 2CR5A 4A3IG 1GUTA 1FXAA 1WYDA 1JB7A 1ZXIA 3T1YQ 4P1BC 2DZKA 2BOSA 5HI1A 4EZJA 2ZT9C 1GB1A 1LO5D 1X54A 1B4OA 1SMXA 1XTCD 1WJNA 1KQSA 3HOYG 5BMIA 4X65L 5KEEA 3JAMi 3H3VH 4DUZL 4FO2A 1GG3A 1KNAA 1WM2A 1NSNS 3H94A 1EF5A 1NVID 1S40A 1JWAD 2YYZA 3K7AH 3L54A 2V1YA 3V6EB 2UXDQ 3NUHB 4A4IA 2EYPA 2GBKA 3MP9A 1S5CD 1TVXA 4PS8A 1KLVA 4NJ7A 2M0XA 1IW7C 3I4LA 5C44H 3P20A 2E2IB 4IM2A 2O5JC 1E2WA 2FXQA 1NBFC 2KX0A 2E2JH 3OPOA 5CTRC 4DAPA 2MJ3A 4P74A 1VQJA 2J0MA 2LGYA 5AJ3Q 4A3IH 1F9RA 3EGRA 1D1KA 4A9AA 1LT6D 3MA2B 2G9DA 2HIVA 2ZVOA 2K25A 3ZKJC 2I38A 2KKCA 4F88A 3ERQA 4BY7B 4HROA 2M2LA 4IUMB 4B3SQ 5IGDA 1VQFA 2EDGA 4IO9A 2B8FA 2DYOA 2V3PA 3I90A 4R4QA 3IRBA 1RFAA 4K7SA 2F3IA 2AWNA 2D62A 2EJFC 2FINB 4KKTA 2N1WA 3SK6A 1WGKA 1R7SA 3J80c 1PFMA 2CJOA 2RSOA 4W9EA 1CHQD 1WGRA 4FF3A 4IFDH 2FNJB 1NMGA 2L8JA 2G3QB 3NVVA 4Q0FA 1HTLD 1FMAD 4HN7A 2JP1A 1N36L 4QUCA 2MGSA 3F8TA 4HSVA 1AFPA 4QQBX 3TIXA 2K75A 4Z9CB 5JH5C 5JOBA 4DK6C 4MDKE 1HR0L 2PJHA 2OXPA 1R4NB 1RWSA 1JWBD 3BS1A 2I46A 3U9OA 3E3XA 2NCNA 3TP6A 1UE6A 3PZ8A 2L3ZA 4XTCS 4HAEA 3AH7A 4W9KA 1MJCA 1WMHB 2JYOA
chains in the Genus database with same CATH topology
2N88A 4RHRA 4IQZA 5D3DA 3Q0AA 1WD1A 4JBWA 5D14A 2L12A 3HOXB 2WXOA 1SE4A 2PNRC 4XXEA 4G7ZC 1NEKB 2V4DA 5E6JA 1EZ8A 2LGIA 1LLRD 5CYUA 2WV6D 1PGXA 4IUTA 1HA5A 1CQFA 3GTMB 4JWUC 2EOTA 1ZYRC 2EYOA 1ZPSA 1Y1WB 3S2DB 3VQIA 3NZ3A 2PZUA 5EPJA 2OEDA 5IT9L 3VR6A 3R93A 2NBFA 4G4KA 1IYUA 3HOZB 5DAUA 2VNUD 1YNJC 1L5PA 3AEEB 1TWAB 2AQ1B 1IW7D 5KYIA 2EKIA 1GHKA 3IT6B 1ZP0B 4IOIE 1ICWA 3FKIB 2R93B 3DWQA 3NUCA 3PUVA 4J8QA 1G91A 4USAA 4WAFA 3RZDB 3T3OA 2AUKA 5C0XJ 1I50B 1ENFA 3QIAA 4QB4A 2R92B 2SAKA 2FJ2A 1KF6B 2L1AA 3TBIB 3D6WA 5IT9E 5A35A 3PO3B 3NS1A 4DK0A 2HDLA 2Z1CA 2E3TA 3Q6SA 2X69A 4U68A 1H9SB 5FO7B 2W82A 1UEAB 1EEFD 4KY6A 4JK1C 1RTOA 2IX1A 1TS4A 1SYGA 1CK1A 3S16B 2ONQA 2N7JA 2Y3AA 5EKKA 1STHA 1VZ8A 2BBCA 4KKJA 1UUPA 4PT5A 5TSSA 2K01A 1WVLA 2K9XA 1B9RA 3A54A 3R2IA 1VCIA 2PMZB 5I2YA 4C2MB 2CVRA 2LKVA 3M7GA 2XWBB 5I6WA 1MI2A 4ZLTF 3P4QB 2RBMA 5J39A 3BK2A 5LNK1 5C0XI 2BT6A 4OZBA 4L23A 5CV9A 3M7NA 1NCVA 2F0QA 2HCIA 4KJNA 1NYRA 1FNUA 5KGUA 3GB1A 3K59A 1HRJA 1B9NA 4NDXA 2EY2A 3RLFA 5C6AA 3AM9A 4XWWA 1X3QA 2IDYA 1NUCA 4HEA1 4ME5A 2EE1A 1D4BA 2GB1A 1YNJD 3FPUB 1W6KA 2SDFA 4RCNA 4CKEA 4DFAA 3SFEB 1EFID 4YT0B 2WKDA 2CW0C 1YMHE 2KWDA 1FNVA 4KI0A 5JPNC 2KHSA 4KGSA 3J7YW 3VA7A 2F0LA 1W6JA 1N61A 1IGCA 1HFNA 4O1NA 1SNMA 2ZW0A 3GTLB 2RVLA 1L0XB 1A2TA 3P1MA 1FR3A 5J22A 1EWYC 1IKMA 2F0TA 2PW7A 4FVMA 5BN4A 4AYBB 4XT3B 1SB3C 3FMCA 4RH6A 3DMUA 1D1IA 1HFGA 4KY5A 2KAJA 4GZYC 4ZUJA 4EQPA 3I4NB 2K32A 1SXTA 4X3UA 3EUB2 2KOLA 3W5UB 2W55A 2N55A 1PRTC 2R6GA 2EELA 3VR9B 3Q8BA 5EPKA 5EKLA 3K5LA 1PDQA 1PUTA 4XWTA 4I65A 5C3EB 5T1IA 3WCQA 2O4XA 5H8YE 4XQJA 4JPSA 3BIID 4EGVA 3BG3A 3EJIA 3C46A 4NJCA 1CQVA 1SNPA 1LABA 1E9MA 2F0OA 2B2WC 2KN4A 3HG9A 1B3AA 1G2TA 1SJHD 5JEAH 3L4PA 1R9TB 3I57A 5KNCA 4ZK9B 1V1PB 3B9JA 2F0JA 1A3VA 3CWIA 2K5QA 4IFDJ 4C3IB 2F0GA 3QB3A 3WOEA 2IGHA 4KMUC 1SJED 4HCSA 1JRPA 2CW0D 2LFIA 2JWUA 2WXIA 1I6VC 1YNTE 1U4RA 2KVMA 4A3JB 1OXVA 3CU7A 2W3SA 1HXYD 2DWQA 1WSPA 2WIIB 3IFDA 3NK9A 3NQTA 2INNE 2J4XA 1E2ZA 2LMCB 1V43A 3AE8B 1YJIA 2I07B 4RAUC 3GS2A 1STNA 3Q24A 2WXQA 2K6AA 1SNOA 3Q69A 2K1BA 4OW0A 2QKIC 4LK0M 1XXGA 3RUZA 2F0IA 3OMGA 2QEJC 1CZWA 1Y69U 1OQQA 1K52A 1II3A 4NKLA 5MPOA 5IGGA 1M4VA 3GD7A 2IL8A 5FOBB 2PYKA 2PO4A 1YNNC 1FFUA 1RJTA 1GB4A 2M0AA 3A56A 2QIEB 4DAYA 2Z4HA 4IFDI 5A2QE 3NWSA 1A2UA 5F2DA 1L4ZB 2YEPF 1WYGA 4I7ZC 2R7ZB 2X6LA 5CORA 3MJ5A 4KHZA 4B9XA 1EQVA 1T3QA 3U2SC 2SOBA 1FCLA 3D8GA 3HRZC 3A7AB 1K8OA 2A73B 1DONA 4YSXB 5C0XG 3LWEA 3I73A 1IKLA 3RPFC 1V8CA 1XO3A 3GV6A 3UI2A 3HKZB 1LTGD 2EYLA 1STAA 4P6VF 4DGZA 2WINB 5COYA 1C76A 4KJOA 4PMCA 5CBEE 1WTOA 1KDCA 5M3FB 1BO0A 4R8NA 2PMVA 5C0XH 5I9OA 2IPKD 1ONLA 3BZDB 2D2CC 3HGBA 3T53B 4CKBA 2JX5A 2LS01 1LV9A 2L0CA 1KLGD 2GRIA 1Y8OB 2RPVA 3S2HB 4M0WA 1PYWD 1S5DD 1ZUD2 5T8IA 1CA5A 4FYDA 5ISRA 2DNEA 2AQ2B 4K14A 2G1EA 2RDFA 4NW2A 2KEEA 4ARCA 4U673 4TQ1A 1OXTA 2M00A 2WNMA 1TIID 3S1NB 1ILPA 1TYGB 5HGTA 1YNND 4HEDA 1TS3A 1F2MA 1BF4A 2WDQB 1TU2B 1QOFA 4K2LA 1O7LA 3MFGA 1EWCA 1XEEA 2CU3A 4US8A 3Q8FA 3M4YA 1TS2A 4RA8A 3PO0A 1I7HA 3MXGA 4GDKB 5EQ0A 4HCEA 3M4OB 4A55A 1Q90A 5C3JB 2NVQB 1SIJA 2EJGC 3ZJUA 1N63A 4QMGA 2PKOA 2PTLA 1PZID 1D6EC 3D31A 1AZQA 2BDNA 3ND8A 3V2TA 2IGDA 1BCPB 1VF7A 2J0TD 1TY2A 1SEBD 1DOMA 1A70A 3ABVB 4LJZC 4ITKA 4US9A 2FBWB 1JOOA 2C5CA 2WP9B 1VZ6A 4WORA 3QO2A 1UGJA 3L3OC 3RZOB 1RD9D 2NWGA 1FO4A 2MH7A 1DOLA 1WTWA 2K5WA 1PTOF 3FAHA 2HDMA 2PPBC 5BMGA 4C7YA 3TSSA 3AE7B 3ZYYX 3A55A 4KD4A 5H92C 3C1FA 2B2YA 3OWFA 2JSVX 4TSSA 5G5GA 4KD3A 3T3NA 2EPBA 1JCKB 3VRAB 5G3LD 3OWEB 2F3WA 1SDFA 1JORA 1XLPA 1YN5A 1BDOA 2NMQA 1DOYA 2BS2B 4K6DA 1H9RA 2RMMA 3W5VB 1SMYC 3G7LA 5EBCA 3H6MA 2B63B 1RM6C 4NAMA 1PGAA 1EQTA 3W1SA 3TDQA 3FRPB 5AUKA 2Q8RE 2A6HC 5JEAJ 3KUPA 5DM63 3ONAB 1P7EA 1SBBB 2D9UA 3NTIA 4H7BA 4IFDG 1P7FA 3MXPA 4GLSC 1STGA 1J7BA 1JB3A 3VYUA 3MXNA 4EQOA 4V190 3MEHA 1JC7A 3A8KE 4G57A 2AX5A 3SK4A 2D5GA 1FCCC 3T56B 5JJZA 1K50A 5K5PA 2L4NA 5FO8B 2J53A 1H9KA 1N5WA 3PV0A 2BA0A 4MHEA 3C1EA 1EYDA 3MHBA 4L1BA 3AE1B 4C3JB 4H13C 4F87A 1D2BA 1LT3D 3AE4B 1SF0A 1PRTB 4A90A 2J7ZA 1C48A 2Q5WD 2BB6A 4RFBA 2QJLA 1KAAA 2PZWA 4X3SA 2L5TA 5BN3A 3GV3A 1TS5A 4M8AA 3VR2A 2Z8LA 5ELDA 4C3JG 4KGTA 3HS0C 5DM73 2HQEA 5C4ZA 4HKZE 1HZ6A 1BMLC 1B53A 2JXMB 3NWTA 4KK7A 4NAWB 4A8XC 2VB2X 4OHJA 1I4QA 3SHLA 1SYEA 3DEPA 5EE3A 5IGFA 3AEFB 4BBSB 3QJYA 4BBRB 3AECB 1SMYD 4A6QA 1NAPA 4G7OC 3AE5B 2WXHA 2IJ0A 1AZPA 4A3EB 1SSOA 4WH4A 2WDVB 3OIPA 4Y7NB 2A6HD 3RMHA 2FUG1 2Q8TA 3U9SA 2WXPA 2F1MA 1YQ4B 2JQRB 5E1FA 2H89B 1ENCA 2FMMA 1QOGA 4PNYA 2ID0A 1EYCA 1UWXA 4K5VA 2K3UA 4KX6B 1S5FD 4ZUIA 3AB9A 4DXFA 3IT4B 5IODA 4MH8A 4ZQ3A 3MAQA 5JVH3 4LK1C 3Q22A 3B2FA 2F0NA 4H0LC 2XIWA 3VR3A 3GTQB 2V3NA 4R9WA 1XF5L 2XRSD 2RDHA 1F2RC 3IL8A 3E6ZX 2N0SB 2IX0A 2B76B 1QOBA 1STBA 1TKWB 1ML0D 4BY1B 3E5SA 1BCPC 1EU3A 1EWHA 2CHBD 2NUCA 2WXLA 3I91A 1WXQA 1GAQB 1AWDA 1NI3A 5EKIA 2WU5B 2HDEA 2QF7A 4R8IA 5KIXA 4XE0A 4EQNA 1EU4A 3AE2B 1ACCA 1IHZA 1IBXB 4DU9A 4ZRPA 3FDTA 4A3DB 1XLQA 2EYHA 4TQUS 3S1RB 4DA2A 3AEAB 3NXWA 3TP5A 2KQ3A 4JX1C 1SSNA 3K5MA 2B2TA 3NVWA 3DWAA 2YEPB 3NTHA 3CHBD 1TWHB 2OEOA 4ZKBB 5EPLA 3VYRA 5M5YB 1U9RA 4DNTB 3NBIA 1ZYRD 3IAM1 2PW9A 2EYFA 2E6XA 4KTAA 2V0GA 2MPMA 4WWMA 2KCNA 1A3TA 4RWSC 1E10A 2OT2A 3RFZB 3P75A 1ZDXA 1EY8A 3Q23A 4P16A 1PZJD 1C4CA 2WU2B 4EE2A 1B9MA 1FD7D 4ARIA 3KK7A 3K5OA 3MZ5A 3NSWA 3ZQ4A 4C3HB 3LNNA 4IKGA 1QB5D 1EY5A 3GTJB 1GXDC 1DOXA 1HQRD 3DWMA 1GHJA 3ZGZA 1GUGA 1A6XA 2AUJD 4MIUA 3FPPA 2IGGA 4QIWB 4WRDA 3C3LA 2L83A 1YN4A 4WQMA 2BW2A 2E2HB 2KQ4X 1CT1D 1BCPD 2E74C 1STEA 3CRLC 1N5XA 1QE6A 5K36H 1FXIA 1QQRA 5HHDG 1XYIA 1PLFA 2ACZB 1CA6A 1RHPA 1FRRA 5JEAG 1BBXC 5CMDA 3H0GB 2F0MA 3FVQA 4A3FB 2H1EA 2PQEA 1C78A 3I72A 5C3WA 3OSOA 4XDCA 3EVQA 1EOTA 3IKJA 5DNFA 4GDLB 4KY7A 2A68C 1SFOB 1FFVA 1BOSA 4KHVA 5BYRA 3BYTB 1QNUA 4FNFA 2VUMB 1G8ZD 1GUSA 2J52A 3R2TA 4X3TA 1S5BD 2MUYA 5EE0A 5DEHA 1HEZE 3O13A 3NRZA 3TZDA 4ZRQA 2L32A 2R3ZA 4DK1A 2HCCA 1TWGB 2BCOA 1XWEA 4IALA 4Q2JA 3PZ7A 1Q8IA 1F2RI 2D5DA 4ZKCB 4P2CB 1EY7A 1KABA 2L55A 2K33A 1ZE3D 4OL7A 1OXUA 3TEYA 4N9TA 4RGOS 3MWYW 4N9PA 4F7XA 5ELFA 3H8HA 3FEWX 1EL0A 3BYYB 4AQ7A 1PTOB 3D6CA 5CC4A 2HUGA 2F0KA 4C3IG 3BDOA 3C2PA 3J7AF 2V4IB 1UNSA 3IAS1 1EY4A 1K51A 1DM0B 2PVGC 2E2DC 2WS3B 1Z7TA 3K58A 1SNCA 2F3VA 1TT2A 3GTGB 2B2VA 2INPE 1RF2D 1QF6A 2IT1A 3Q8AA 3PUXA 1MBYA 1KDBA 3ZJVA 3EFXD 2NVYB 5AFWA 4XYOA 2XSCA 3J7AV 5JPMC 3Q8CA 1RDPD 4BS9A 1PRTD 4PQXA 2B2WA 3GTKB 4WJWA 4WIPA 5I2XA 1ZXHA 2EY1A 1PFDA 2H4OA 2JA7B 2XVSA 5HFYA 1WTVA 1DJRD 5E3FA 1C9FA 1STYA 2QMTA 1HUMA 3G6JB 3QOLA 2YU9B 2ZXOA 1PTOH 2VXWA 2LHDA 1F9QA 3NE5B 3EA6A 2N9KA 3AV8A 2Y0SB 1M8AA 3AB5A 1C8CA 3TN2A 4IUQA 2F0PA 5D65A 2LY7A 1UWMA 4REZA 1FYCA 1LACA 2QSDA 3H91A 1CTMA 3DXJC 3D4WA 1ZOYB 4K8IA 4FXDA 4F8MA 1LT5D 3GTPB 1IYVA 3CIRB 2PVOD 5FKAC 2PIAA 4CJ2C 5BYQA 1B2TA 2NB0A 5CV6A 1JOQA 3HP3A 2PLPA 2FFKB 2WXMA 3KLRA 3AEBB 2K5PA 5AUIA 1FD6A 1E6EB 1A3UA 2A6EC 3MTSA 3JAML 4OZAA 4OIKA 1MHHE 5C5LA 2A69C 1FIQA 4ULLA 1WRIA 2B8GA 1HCZA 1H9SA 5FLXL 3V96A 1TKGA 2E75C 2BS3B 5JAVA 2F0UA 5BMHA 2XNAC 4XIGS 3CQZB 1T6BX 4ZAIA 3NPPA 4KN7C 3PO2B 2IWHA 4C1NI 2L11A 1MI0A 3HEJA 1GJXA 3KWVA 3BK1A 1SAPA 2NVXB 2L52A 4R3DA 3CRKC 4DQOC 1LTTD 3LWUA 5CV5A 1K8MA 2NVTB 3JAME 1ET9A 5M9OA 2MJDA 2NN6H 1N60A 2KA7A 2RSNA 3R3OA 3S17B 1BQQT 3NP8A 1FGBD 4J6HA 5CV7A 2EYJA 5FLXE 1CFMA 1YN3A 3T16A 4HSPA 5NUCA 2XWJB 5EE1A 2JU6X 3P42A 3OOCA 4N59A 2W3RA 1LTAD 2QILA 4HTHA 1F9PA 1TZOA 3AEGB 4PMWA 4YTMB 4Q5VA 1ENAA 2B2UA 4XT1B 4IZ8A 2F03A 3A7LA 1PGBA 2MJ8A 3AMZA 2F0VA 4RKLA 2KEDA 1V1OA 5E4XA 4DNRB 3N52A 2L9HA 1HTPA 5C4XB 4FF2A 3KLSX 4CGYB 5JXVA 4ZYSA 2Q8IB 4KN4C 2BYTA 4YXDB 1KDAA 1FNWA 1JQYD 2BB5A 3B2GA 2NYZD 1Q1BA 5LL6X 3C8YA 2A6ED 1XX8A 4LLGM 3ZJTA 2A69D 3KQ4A 4AS1A 1EY6A 2OHFA 4FF4A 2DBYA 1JWMD 2F4IA 1MVKA 1EYAA 2JA6B 1WTPA 1O7YA 3IFTA 1PTOC 2WXKA 4A3IB 1BNZA 2BE5C 5IGBA 3P63A 4K5XA 3BDCA 1IL8A 1L6VA 1F77A 3I3CA 4C1NK 2ENBA 4IN3A 3HOYB 4LTUA 3J9CA 5JVG3 2WP8J 2JXTA 1E7PB 3HOUB 4IDIA 4N6EB 3QG1A 2BTEA 1ET6A 1GUOA 2NZ1D 4ZRZA 3BVZA 2LJIA 1PMRA 2A74C 3SR6A 4RGMA 1V97A 2XRQD 1AW7A 1JWSD 4HMIA 4C80A 4H2AA 3BVGA 2WQYB 1JROA 5I4DA 2W54A 1J9OA 1I4XA 1T5XD 2RDGA 1V1PA 1L6UA 5C2TB 3VR5A 4NZLB 4FXCA 2LEKA 1CZGA 2J42A 1NYQA 1KLUD 4K2KA 1JE4A 1VMPA 1QILA 1I4HA 2WACA 1AP0A 5KNBA 1SNDA 4EVOA 4UAIA 4BWGB 1Z47A 2JE6I 1B50A 1HHVA 3HRDD 2FE8A 4IUUA 1QJOA 2VB3X 1S4ZA 1DZ1A 2F0DA 3K57A 1DGJA 4MN3A 4J3OD 1TWCB 1WTQA 3WOFA 3DEOA 5IIFA 3S9WA 4HRSA 2LMCA 1PZKD 2DY7A 2WAQB 1TKYA 2PW5A 2TSSA 3DM1A 3V3XA 1WTXA 2EJMA 3VA5A 4XDDA 1A15A 4G7HC 4L2YA 4ID6A 1C79A 2QDBA 2WKCA 2GI9A 4YSZB 4HR7B 3PUYA 1FRDA 1SYFA 2X38A 1SYDA 4MM3B 1PTOD 1MGSA 2F0EA 1N62A 2BE5D 2WXJA 1VJKA 3D4RA 1WWTA 4ZHOA 3TEXA 3TUOA 2G9HD 3HVDA 1I3QB 4A3MB 3KWLA 2RQXA 4O42A 2M56B 3VYSA 3X3MA 3SFDB 1XCQL 2VZKB 3KLSA 1HUNA 2X6GA 1XCTL 3N6RA 4M1UB 4QUFA 1F2YA 5CV8A 3E9SA 3AEDB 3IXSA 3AE9B 4FF1A 2EYMA 4DAVA 1DD2A 1HQMC 2F0FA 4NMZA 4CQNA 3U7ZA 4ZHPA 2O2LD 3SE0A 2BDOA 5J1ZA 1SYCA 3VYTA 1H9MA 2SNMA 1F0ZA 4N58A 3GTOB 2WXRA 1MSHA 4YSYB 2B2TC 4RHSA 4YWGG 3S1MB 1HPCA 3W2DA 4A3BB 4ODGA 3OHXC 1SE2A 3S14B 1C77A 3GO5A 1ZEQX 2TMPA 4A93B 3AE3B 1LTID 3TMEA 1BCPF 2KACA 3KBGA 1RODA 1F2LA 1LTRD 3AE6B 3HUIA 2EY5A 2F0WA 1ZKOA 1GPXA 1NR2A 3W3AA 3URYA 1L0YB 5C5MA 3SK8A 4RKBA 2C9OA 3P4PB 2ICEC 1I4GA 3ND9A 3SEBA 2RA4A 3J81L 4KV6A 4XQNA 3SR1A 3DUZA 3E0JA 4PMBA 3CKIB 4UDUC 2EY6A 2K22A 1QNKA 3GP7A 4CJ0B 3H3VC 1E2VA 3VR8B 4A3KB 5C4HA 1I6HB 1L0VB 2F0SA 2M9VA 3V05A 3SXHA 1ILQA 3IAYA 1PFNA 1QCBD 3MXUA 1MHXA 4OO1I 3M3YB 1EZ6A 1J7AA 1CI3M 1GUNA 1I4RA 1TY0A 3TP8A 1OFFA 3S1QB 3J81E 4JWSC 3NVZA 2B39A 1SYBA 3FILA 2K05A 2PZTA 2DYMA 1EM7A 3QWNA 3AN1A 2Y5CA 3EQLC 3I4MB 5K36G 4KKUA 1EIHA 3U4EG 1Q1EA 5FK9C 1LTBD 3J80L 4C3HG 1YQ3B 1F2ZA 1Y56A 3KF8A 2N9LA 2NN6I 1O80A 2JA8B 2DLBA 5ELCA 2NTSA 1C4AA 1ESFA 1CHPD 1J8IA 5T1GA 1RKNA 3MHZA 1OQRA 1PRTF 4RGNA 4QCLA 5CV4A 3D4DA 1VR9A 3K6OA 1G6ZA 1D5ZC 2JYEA 2ICIA 5CGKA 5I9PA 2DY8A 1H9JA 1ROEA 3Q8EA 3P4RB 1ZDVA 2K04A 3J80E 2H88B 4MT5A 2NTTA 1BUIC 1KTKA 3E56A 1KRHA 1S5ED 4X3KA 1JOKA 1SE3A 2DNCA 2ZXPA 4E6IA 3M85A 1O78A 3VR4A 1QT9A 1RCVD 3T51B 4ABNA 3UI3A 2SNSA 1OO9B 1DCZA 4RCOA 3NBHA 4DXGA 2JA5B 2B2VC 4FP5D 1Z6HA 1DOIA 1RFKA 1U4LA 2WDRB 2Z4IA 4XYQA 2CQAA 1WCMB 1PDXA 1B44D 4HKQA 5EJWA 3K0YA 1I4PA 1R4PB 3MC0B 5D3IB 1MSGA 1RTNA 4FXKC 5IGCA 5CR3A 2K0PA 4TQ0A 1LTSD 4DF7A 4HMJA 2KCCA 2CJNA 2K03A 3S15B 1XLNA 4KGRA 2K5DA 3H09A 2MHVA 3DWPA 3PUWA 5LL6S 3LX0A 1UAPA 3LYYA 1Q10A 2WXGA 1K83B 2QCPX 3BDLA 2HTME 2F0HA 1JW9D 1OXSC 1VRAB 4PV1C 2M19A 1VMCA 4OIJA 3NTKA 1LT4D 4IUNA 1PFBA 3PIO3 4BA1I 2JEAI 3R8BA 1J7CA 4KKSA 1Y8PB 5A2QL 2AWOA 1DYQA 1BR9A 1HZ5A 5BYSA 4NP5A 1Y1VB 4TKOB 1BXTA 4RF0A 1ZXTA 1QWYA 1E0ZA 2DN8A 3F2UA 3T13A 2I2YA 5EE9A 5M5WB 1FM0D 5FR3A 4D2KA 4TMAB 2BA1A 1YJJA 3P7JA 3DWGC 1JQ4A 5HG2A 2SEBD 3OIQA 1JICA 1OXXK 1U4PA 2A5HA 1CM9A 4RGTA 5I6YA 2K28A 3D3RA 1AN8A 2JSOA 2E76C 2MJEA 4K5WA 1SNQA 3LB8C 5M3MB 2BS4B 1PXUA 2A68D 1AEXA 2WB1B 3N9YC 2PCFB 2RKSA 4LAAA 4WURA 3EROA 1E0BA 3HVZA 2ZXRA 2KMMA 5C4JB 1VLBA 1VDZA 3SDZA 1WTRA 5M5XB 4BA2I 1U4MA 1RYJA 3OW7A 1VDVA 4OO1G 3MFYA 4B0MA 2JYTA 1C4PA 5HURA 5CBAE 3PUZA 1DXMA 5EGTA 2OF1A 5GXGB 3VRBB 4OVZA 3T4AC 4CBVA 3X3NA 2WXFA 4YTNB 3BWUD 1TR5A 4L8JA 4FXGC 1QOAA 3U52E 4JE3B 2VZKD 4XQQA 3ITPA 2KECA 3BVMA 4IUPA 3WDNA 1JMLA 4KKIA 1G291 1AYFA 4HJGE 4CKCA 5G3LF 4OO1H 1X3PA 1KFYB 4B0EA 1NENB 4K6LA 5BN5A 3MVVA 3P1HA 5ELEA 4C56C 2WXNA 3ETRA 1JR0D 1MD2D 1TJEA 3K5NA 1NR4A 2GA4B 1EY9A 1GUWA 2EZVA 1JWUD 4A3GB 3QOJA 1D5MC 4DN4M 1EIGA 2NN6G 5G5HA 2IX3A 3TP7A 5KNDA 1QG7A 3A8IE 3HOWB 3L7ZC 2B2UC 1B1ZA 3AMUA 1KH0A 2KJXA 1QLBB 2O5IC 4MACA 1QKZA 2JZPA 5KRUA 2K7VA 5KYLA 3L9AX 3OMCA 5D7GA 1IBXA 4CJ1B 4H44C 1Q12A 4ILWA 1HA6A 3W9CB 5IOCA 3PMFA 1QOHA 1VF5C 3TZUA 1K53A 2LHEA 2R61A 3NQIA 4C7ZA 2ZW1A 4K8JA 4S3SA 1EY0A 3P4SB 4ZOHC 2B2YC 4WFN3 1Y8NB 1GOZA 2Y5PA 4IURA 1DOKA 4B08A 1CZPA 1BUVT 2AQ3B 3RD4A 2FHTA 2LFNA 1TKEA 3HOVB 3AU7A 1JALA 1KNEA 2EXZA 3PIP3 5IGEA 2L1BA 3SVMA 1ESRA 1IGDA 1CJEA 3I9V1 2ON8A 1X32A 1Q3LA 5C3XA 1L4DB 1TWFB 2KDMA 3FILB 4B9WA 1IUEA 3HZXA 3LXFA 4OZCA 2IW3A 3DHQA 4CHTB 3NHHA 1G2SA 5E4WC 5FO9B 2WLBA 1FEHA 1T5EA 2KUMA 5ELBA 1MPEA 1R4QB 4OGQC 3SK5A 3TEWA 1TQOA 2MP1A 3K7AB 2MEKA 4YTPB 2FMCA 2XN9C 1EEID 1O7ZA 2LUMA 2EVBA 3TEZA 5C44B 1F9SA 3FC4A 1WD0A 1XLOA 2E2JB 4J1MA 3A8JE 3KBXA 4RNAA 4V0BA 1C4QA 4L6TB 4L63B 1V8QA 3GQBA 4LMQD 1VZ7A 3NVYA 4IUVA 5LHY1 1D5XC 4XDXA 4RF1A 5EBDA 4TRDA 4QF4A 3I70A 4YIJA 2JEBI 3I8ZA 1ZXIA 1GUTA 1FXAA 5HI1A 2BOSA 2ZT9C 1GB1A 1LO5D 1B4OA 1XTCD 5BMIA 5KEEA 4FO2A 1KNAA 1NSNS 3H94A 1NVID 1JWAD 2YYZA