1SXTA

Staphylococcal enterotoxin type a (sea) co-crystallised with zinc
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
224
structure length
224
Chain Sequence
KDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Co-crystal structure of staphylococcal enterotoxin type A with Zn2+ at 2.7 A resolution. Implications for major histocompatibility complex class II binding.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Superantigen
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN TYPE A
total genus 61
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sxtA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sxtA02
1FNWA 1I4QA 2XRSD 3BVMA 4DXFA 1TS4A 4C56C 1FD7D 1S5FD 4K6LA 1LTTD 1L0YB 5ELCA 1PZJD 5FK9C 1LTRD 3TSSA 5D3DA 4ZYSA 1JQYD 1KTKA 2RDHA 1KLGD 1JCKB 1I4HA 1EEID 3SEBA 3R8BA 1CK1A 1DJRD 1LTAD 4RGNA 4RHSA 1D5XC 4RFBA 1PRTD 2AQ2B 1I4GA 1LTSD 1T5XD 2O2LD 3BVGA 2AQ3B 2IPKD 1PTOC 1QILA 1LTBD 3KLSX 1B1ZA 1XXGA 1CQVA 1DYQA 1HQRD 1UUPA 4TSSA 3CHBD 4RGMA 1YN5A 1TS3A 1EFID 3BZDB 1BCPB 1TS2A 2QILA 1SXTA 1LO5D 1PTOB 1ET9A 1V1PB 2TSSA 3EFXD 5D3IB 1JWUD 5ELFA 2XNAC 1I4XA 4RGTA 5ELBA 1PZKD 1S5ED 2IJ0A 1BCPF 1FGBD 5ELDA 1KLUD 1BCPC 1BCPD 1CHQD 1RD9D 1LLRD 1SEBD 1D6EC 2XN9C 1JWSD 3DWQA 5ELEA 1EWCA 3BVZA 1EU4A 3URYA 5I4DA 2ICIA 3BYYB 1FNVA 1SJED 3R2IA 4RGOS 3MC0B 1SE4A 3V05A 4L63B 1SBBB 4RH6A 1TY2A 1V1OA 1HA5A 2R61A 3EA6A 1V1PA 1D5MC 1RDPD 1AN8A 1PRTC 1LTID 3DWPA 1EU3A 1PTOF 3OWEB 1PRTF 3MFGA 4RCOA 1S5DD 4Z9CB 4RHRA 2QEJC 2CHBD 1F77A 3DWAA 5TSSA 1JR0D 3GP7A 5FKAC 1L0XB 1PTOD 1TS5A 2AQ1B 1LT6D 4OHJA 1EEFD 1LT3D 1I4PA 1BXTA 1PZID 2NTSA 1YN3A 1PYWD 2J4XA 2Z8LA 2NTTA 1CT1D 1FNUA 1D5ZC 1GOZA 1HXYD 1LT4D 1M4VA 2WV6D 4DXGA 1TY0A 1LT5D 4BWGB 4UDUC 2G9HD 3R2TA 1I4RA 1G8ZD 2SEBD 1STEA 1HTLD 2RDGA 1SJHD 4L6TB 4NZLB 1ET6A 1AW7A 1PRTB 1SE3A 1S5BD 3O13A 1LTGD 1S5CD 1CHPD 1UNSA 1YN4A 1ESFA 4O1NA 2XRQD 3W2DA 1JWMD 1XTCD 1ENFA 1RCVD 3BYTB 1RF2D 1PTOH 1MD2D 1SE2A 1B44D
chains in the Genus database with same CATH superfamily
1IXRA 4YCWA 5G5GA 1UWMA 4JWUC 3ZJYC 4YCVA 3AFQA 1PHJA 1NEKB 2QSDA 3L10B 1TWGH 2F0IA 1EQRA 4JL9A 3I56A 4LK1C 2BB6A 4ZYSA 4YSYB 1I50B 2UXDL 2MBEA 4FHJA 2Y5CA 3EN2A 4XIGS 1Y8RC 2XGTA 2LS01 3S1QB 1X3FA 2UYZB 4EQNA 1MSGA 4HJAA 3IFDA 2K28A 3JAMc 2DGYA 2HD5B 2NVXH 2IBIB 1UEAB 3HK0A 2CR5A 1F9SA 1MIUA 3V60A 1HTQA 1LTSD 4C3JG 2Q8IB 3OIPA 4RF1A 2AQ3B 2LGIA 2L9HA 5C4XH 4X3TA 4BOZB 1P0RA 2B2WC 1FGUA 2KQ7A 1XD3B 4MGYE 4DDID 1EF1A 3BY4B 1VQ8A 1ZOYB 1B9NA 2KOXA 3HUIA 2KWCA 4TKOB 1OQYA 3LDZE 4L5QA 2D3GA 5C3EG 3NPPA 1SXTA 3EFXD 5D14A 4A3KB 2CFMA 3I63C 3NUHB 3U9OA 1I4XA 1WTHA 1K50A 3RNEC 4UP8A 4A3MH 3S2DH 1STGA 3SK8A 2JZ3B 4MGIE 3W5VB 2KENA 1SYGA 1VDVA 3PO0A 1LQBA 2JSOA 4XC2A 1L1OB 2B2WA 1M1KC 4QL5A 3VR6A 1LACA 4ZKBB 3EVQA 3RNFC 2LGSA 3K7AH 1HQMC 3VRAB 3T4AC 1WMHA 3VVWB 4NXNQ 1FJGQ 2K33A 5C0XG 4DWFA 3HOZG 2RDBC 5EDSA 2EYFA 2Y0SB 3KLWA 5CR3A 3HOXH 4QUFA 4RG1A 1EU3A 1Z2MA 5AZHA 1PRTF 1QVCA 1Z6HA 1SYEA 3L0OA 4KHZA 1I5FA 4IUPA 4X65Q 3U7DA 2VY3A 2NBVB 2INPE 3PSIA 3CQZB 2IY5B 4OWWB 3I9V1 4GXBA 1RRBA 1WXAA 1CKNB 3R66C 1QVGA 4GOPC 1EIGA 3GTJB 4GKJQ 3M3YB 1L0XB 4EE2A 2OQ0A 4DAVA 1PLFA 4KVGB 4EEWA 3JW0X 1WSPA 1QOFA 4K0KL 2R93H 1KFYB 3CMAA 1PGAA 1VZ7A 2XTIA 2L00B 2N4FA 4W9GA 2NTTA 1HXYD 2ICEC 2WV6D 5CX3A 4NJ6A 2NB0A 4HIKA 1UBIA 4QUCA 3Q2AC 2Z6KA 1XWEA 3QOJA 4DV1L 4BBSB 2EKIA 3GTPH 1J7BA 3PHXB 4OW0A 4IOAA 1F2LA 3MTNB 4YL8A 4A3KG 2JXMB 5IODA 2IDYA 3IAS1 1Q1BA 3TIXA 1WFYA 2JA8B 1PFMA 2IT1A 1V97A 1ONLA 2IX1A 3NVZA 4LF7Q 3O13A 4APVA 1LXDA 1NSNS 1N6ZA 3STBC 2HE7A 3DXJC 4ZRQA 3W2DA 1FCCC 4GDLB 4NMZA 3SVMA 1VQFA 1D3ZA 1C3TA 4W9KA 1K28A 2M0XA 3TEZA 3MVVA 5ISRA 5C4JB 3EA6A 2WXMA 4A3PA 2K52A 3BDCA 3VUWA 4FBJB 4DXFA 1QJOA 4PS7A 1AE2A 1KABA 3U2SC 1WJ6A 4WJNA 2BYFA 4C7YA 1RHPA 3NP8A 1IBML 2WXHA 3RNGC 1V8CA 3HP3A 2N7JA 4WJWA 1PDXA 1XLQA 3NK9A 1QB5D 4QJFA 2KEEA 2O5JC 2D10A 1B4OA 5EBCA 4I6PA 3GDEA 2KX0A 4RFBA 3HEJA 1VQNA 3K59A 2Y3AA 3LJ3A 3KBGA 1WTOA 3GV6A 5FLXL 2IPKD 3BK1A 4HPMB 5EKLA 4DR6Q 1R4MI 1JWAD 4ZDVA 5IGFA 4GS3A 2UU9L 4W9FA 2Z4HA 5ELNA 1L4DB 3AE2B 1LM8B 3T3OA 1BCPB 1G6PA 1FXIA 2ENBA 1GNUA 1WRIA 5GAGC 5D3IB 1WD0A 1SNCA 1J6QA 5ELFA 4HIDA 5IN7A 1JORA 1RLFA 2IJ0A 3TCAA 3LGJA 3HOXB 4KN7C 2BTEA 4WJPA 2XWJB 4NPSA 2LFNA 5KGUA 2F4VQ 1K0SA 5NUCA 3H1UA 4YWKA 3OAWA 2KCTA 4ZKCB 5M3MH 3NQTA 1VMPA 3URYA 3CCVA 1EM7A 5HKHA 3SFEB 4R8NA 3MC0B 4CBVA 2O5IC 1PMRA 2WNMA 1N34Q 4LK0M 1CM9A 5ELOA 3V05A 1FM0D 3CD6A 1U0LA 5C6AA 4JX1C 4K3BA 1YX6B 4GOPA 1T9HA 3NWTA 3RMKC 3R3MA 4DR4L 2A74C 1Y1VH 2F0QA 2K5VA 4A3IH 1E2ZA 1RAXA 1BQQT 5M3MG 3JVZX 2NVTB 5EGTA 3P1MA 2R92G 1PRTC 2M00A 3UDIA 3PO3B 3Q3NC 5J2RA 2KDFB 2CQAA 2MPMA 2NMQA 4JI4L 4GN3B 1VDZA 3FKIG 2QEJC 5FLXE 4JOIC 2X8XX 1T5EA 3Q3JA 4G50A 3S24A 5EQ0A 4DV0Q 1K8RB 4DUZL 1A8VA 2Q8TA 4MHEA 1B2TA 2N9LA 4YWGG 2VUMB 4OXPA 1C8CA 1XNRL 2IO1B 3CCJA 4HVBA 2GLSA 2KNBA 1C1YB 3EBEA 1V6EA 1YJ1A 1KIXA 1WTRA 4LF6L 2VB2X 2KDBA 3R7QA 1K8OA 2NTSA 2F3IA 3PT2B 2OF1A 1H95A 1PYWD 2WFWA 3UQBA 3S1QH 3VHTC 1J7AA 4DR5L 1UZXB 3RD4A 4DN4M 3NTKA 3F2DA 4WAFA 1F9PA 3D6WA 3AEEB 2MA9B 3P20A 1ZXIA 3DDCB 2EELA 2AL6A 1O7LA 1XT9B 1SJHD 1P1AA 2D2CC 3PVLA 1KAAA 4DK1A 3GD7A 3X3MA 4MN3A 2WXGA 1GVPA 1V8QA 3QOLA 2N0SB 2PJHA 1EIHA 2NVTH 3WAOA 3VUXA 2EJMA 2ZTDA 2N1WA 1HZAA 2K3UA 4DNIA 1PH2A 1BR9A 1MD2D 2KQ3A 1TWAB 3A1QA 3TP6A 3GE3C 1XMOL 4C3HG 4ZK9B 2XRSD 2K5HA 1WH3A 3C19A 1VR9A 1VQCA 1FD7D 5CHFA 5COYA 3M3YH 2D5DA 2DWQA 2L55A 1JQYD 2M4NA 3SK4A 5IT9c 1WM3A 4DF7A 4Q2JA 1JCKB 4IDIA 2WGSA 1Q8KA 4X66Q 2WXPA 1WJNA 4I7AA 4A3FB 3FAHA 2J53A 4KD3A 2Z0DB 3A0JA 2K75A 1HZ9A 5E4WC 5J39A 2ZTEA 3TEHB 4ZRJA 2K6QA 4BKTA 4KDLB 2LVPA 1TS3A 1WI5A 2ZW1A 3BJUA 2BS2B 4MM3B 3AMZA 1Q10A 4FULA 4YTNB 3M63B 2CVRA 1IKLA 3M62B 3ZJUA 1A63A 1HR0L 4IC7B 3EROA 2KXJA 3SK5A 2D2QA 3J81c 1X32A 2JXXA 3B1LX 1C4PA 3MC9A 3A5ZB 1NNXA 4HJ7A 2PMZB 3BYYB 4JI2L 5CV7A 3AEBB 5IOCA 3I4NH 1NAPA 2IY1B 4NAWB 2LRWA 1QQRA 2K7VA 1E0BA 3M4YA 2LXAA 4LF5L 4OEMB 4GKJL 4GLSC 4KKUA 3J81j 3AV8A 5BYSA 4I6NB 1SIJA 2ZJPA 3SDLC 2HUGA 1JQ4A 3NENA 1E7PB 4LFAQ 5DNFA 5AZGA 1GJZA 3LWEA 4DAMA 1YX5B 1TKGA 3Q8BA 3AE1B 2VUMG 2KMAA 4XE0A 1NE3A 2JJQA 4OX9Q 2PMVA 4A3MG 4C7ZA 1Y8PB 3NS1A 3L3OC 1VQ4A 1R4MB 2LUMA 1GUOA 2R2QA 4IJLA 3NVYA 4HROA 3A54A 4XZ4A 4DR7L 4ARCA 5JVH3 3ULJA 4DV3Q 5T8IA 1WGHA 2INDC 1I42A 3I73A 1ML0D 1SSNA 2Z0EB 1I4PA 4EQPA 4IWPA 3D4RA 5GAHC 2N55A 1WGKA 4FJYA 2BDNA 4B9XA 4O2DA 4H2AA 2MJDA 1HCZA 3AEGB 3MAQA 3OMGA 3I4MG 4BBSG 2GBRA 2ZTCA 4PNYA 1P9DU 2IYDB 1TY0A 5M5YH 2IO2B 4LMQD 4XDXA 3HOWG 4BZAA 2SEBD 2QJLA 1EYDA 2ZEQA 3J7A5 1MJEA 5D65A 4UP9A 5G3LF 4NZLB 2JN4A 3MWYW 4AYBG 1Z7TA 1IYFA 2I2YA 3H15A 5C0XI 5LXIB 1YN4A 3ZNID 1CTMA 3HFZB 5KHOA 2UXCQ 2F0FA 3DHQA 2L76A 4A3FG 4IM2A 2LSSA 1BBXC 4IPHA 1JW9D 2WDQB 1KDBA 5BMHA 2YEPF 2RF4A 4HSVA 1Q81C 4X57B 1LTTD 3BK2A 4CDFC 1II3A 4LUZA 3HOZB 2J7ZA 2INCC 2V3PA 2AUJD 2F0HA 4HRSA 1OXVA 1WJ4A 5FJ8H 5I9PA 2KO3A 2VRRB 4LF7L 5JOBA 3S15H 2PMZE 1WR1A 1EEID 2EY6A 2KCMA 1CK1A 2NN6G 2RBMA 2Z1CA 3HRZC 4F87A 2MSED 2QMTA 3PV1A 3T16A 1F9RA 1F9QA 1G2SA 3TP8A 1WX7A 3FC4A 4JI1L 4H7BA 3I4MH 1TU2B 3BVGA 4WQMA 1ZYRC 2BYEA 5G5HA 1NJIC 3S14B 2UXCL 1DYQA 2N88A 4A3DH 3CHBD 2CHXA 3PUWA 2V3NA 3BZDB 2HIXA 3GTLB 2KUMA 2NYZD 1NBFC 3VR9B 3TBIB 2AWOA 4GLXA 4NB3A 4KHPL 2KFJA 2G3QB 4W9HA 4B0EA 1A3UA 3VR4A 4A3EB 3WCQA 2XK5B 5IGEA 4NQKE 1VD2A 5JVG3 2N1VA 5C3EB 2MP2A 1HRJA 4Q0FA 3GTMB 2ZM6Q 1F2RI 2D0OA 1AZPA 4BOSC 1WM2A 1B70B 3QB3A 5D94A 1CHQD 3DWQA 1U9RA 2MHVA 1JWSD 1J9OA 2F0GA 3J80L 1ZKHA 2KC2A 3GB1A 1YNXA 2BPSA 4DDGD 1XF5L 1XQQA 4NP5A 4US9A 4GDLA 1EWIA 3LX0A 3S2AA 1E7VA 1V9PA 4IFDH 4EX5A 1B8AA 1IL8A 3D4DA 2RHQB 1NMFA 2KX3A 3I4NG 1JOKA 1G51A 3HS0C 2K32A 3M4QA 4IG7B 3M85A 4LAAA 1E2WA 2F0TA 1QLBB 4M8NA 4FYDA 2MO1A 1NR4A 1D8LA 1X65A 2L0CA 2C60A 3PTFC 5J17A 3ERSX 3OWEB 5J3BA 4JYAL 4KZ0A 5JH5C 1FXAA 1S5DD 2XSCA 4A3KH 1WOCA 1F2RC 2CHBD 1F77A 2ZXPA 1HUMA 2FNJB 1ZE3D 2ZJDA 4J6IA 2K5QA 2NVQB 3TUOA 3X3NA 1SYBA 3WDNA 1R4QB 4JIOU 1VRAB 5CTRC 2KA7A 1L2FA 1BOSA 1PYBA 4FXGC 3OTOL 4OL7A 4X3SA 4DR4Q 2RR9A 2YU9H 4B08A 1I3QH 4G57A 1XYIA 1DOLA 4LFCL 2AUKA 2J4XA 1V9JA 3NRZA 4ME3A 2KVRA 3MEFA 4EZJA 3NZUA 2A6HC 1KQSA 3FILB 3I72A 3N3KB 2AWNA 3I4NB 3B08A 3GTGB 4JYAQ 1HFNA 4S17A 3AM9A 2SOBA 1TJEA 1JT8A 2DYOA 5LHY1 2DYMA 4NXNL 2WXOA 2BDOA 2NZOA 1JJGA 2W55A 1QNUA 1SGHA 5JAVA 2EKEC 1EO6A 4MDKE 1EOVA 4DR3Q 4KKSA 3MC8A 5DPTA 4P16A 1RCVD 4B9WA 1LABA 1E9MA 1OEYJ 1EY6A 4Y52H 2NUCA 4V0BA 1FNWA 2L0FA 3ZJTA 1CSPA 1I6HB 1Q12A 1L0WA 1TZ1A 3ZYYX 5FO7B 5KNBA 1WYGA 3BWUD 3QARA 4ZCKA 3UF8A 3TREA 4C2MH 3P42A 1WZ3A 2Q2HA 4KIKA 4DNTB 4R8IA 1JE5A 2K5DA 2A6EC 3A1QB 2FFKB 1EWYC 2LHEA 3PZ8A 5LL6X 2KCCA 4HMIA 3A55A 3MTSA 4MTKA 2UUBQ 5C3EH 2JUOA 2KLCA 4FN2A 1WTWA 3S1NH 3C8YA 3UIOB 1MI0A 3KLSX 1LTBD 1T0RC 2V4DA 2AX5A 4JI2Q 3LWUA 3QG1A 3T1HQ 1TIFA 1LGRA 4PYUA 4YHHQ 3APFA 2R2OA 2QILA 1WF9A 3C0RB 2KECA 1ZW7A 4C3JH 4LF5Q 1SROA 4BY7H 3NBHA 1E1OA 4DA2A 1IL2A 4DR3L 1DZ1A 4GLVB 1I7HA 2DLBA 4WIPA 3G48A 1N33L 1BCPF 1VZ6A 4B3SL 3RUIB 5EE9A 3FKIH 3B2GA 1BCPD 2B63B 3AB5A 3GZNI 2JQOA 3PLUA 2XN9C 1GG3A 3HOUH 3SDZA 3AMUA 4HEA1 3U4ZA 4KMUC 3BVZA 4R9WA 3VR8B 4NKLA 2F52A 2BVCA 3ALBA 3GZNB 1JE4A 3HHMA 4TKNA 3HKSA 3TS2A 4K8JA 5IYBH 2C7MB 3TMPB 1SSOA 3IRBA 4USAA 3VA5A 3FKYA 5IWAQ 2L12A 3RD2A 3AEVA 1G291 4RH6A 2V0GA 1GB1A 4YHHL 2B8GA 3HOWB 3ND9A 1GD7A 1UWVA 2JXTA 2K8BA 2L32A 3HKZE 2MBQA 1AN8A 2KKCA 1O7IA 4B6WA 5IGCA 3K8AA 4YCUA 2NVUI 4LTUA 2NN6I 4ILWA 2P5ZX 3GV3A 1SFOH 4FXCA 1SNQA 2ZPNA 1P7FA 3K9OB 2OOBB 4WWNA 1YNNC 2PKOA 4FF3A 3M95A 2PZTA 4BXXH 3A9KB 4DAYA 1J8CA 2G45B 1PTOD 3U4VA 1BDOA 2AQ1B 3S16H 2G1EA 3DBHB 4ITKA 1R4NI 4JPBW 3LB8C 1F2ZA 3SHQA 1STAA 1E8WA 2HIVA 4RMFA 2Q2TA 1EZ6A 2LVQA 1M4VA 3HG9A 4FF1A 4FJZA 1CQFA 1EQTA 3W1YA 2OJWA 2DHZA 3DBRI 1Q7YC 2JA5B 3OG5A 1EYAA 4FXDA 1MBYA 3NUCA 1C9OA 1R4NB 3NOBA 5DCNA 4IWQA 4JI0Q 4H13C 2FE8A 4DHJD 1ZKOA 3NBHB 2DJGC 3PO3G 4JBJA 2RDGA 1LFDA 4L6TB 4E6IA 3G4SA 4HSPA 1UD7A 4W9IA 3X23A 1TBEA 4PG3A 2RQXA 1WIAA 4KKJA 1L5PA 5JEAH 1J5EL 2OXPA 3A56A 1PA6A 1QUQB 1HNXQ 2L1BA 4CDEC 3RPFC 2KANA 4F1SA 4RM9A 4O42A 4ULLA 4JI8Q 2F3WA 1RF2D 1O7ZA 3U52E 1G6JA 4MACA 1EY9A 1QNKA 4OVUA 3D0FA 3P1HA 4A90A 4OWXB 2JEAI 3CCUA 2L3ZA 1ZXHA 1A0IA 3Q8AA 3NJTA 3FVQA 2KHIA 4DV1Q 1GAQB 3PUZA 4ME5A 2F0SA 2DY7A 3MZ5A 3CC2A 3PO3H 1K52A 1I35A 4HJ8A 4ICVA 4YSXB 1EY4A 1ZXTA 1KOTA 1EY5A 2MWSB 2K01A 5GROA 3KLSA 3ZRFA 3I90A 4IWOA 1XNQQ 3L17A 1O78A 1EYCA 2UU7A 2ZCBA 4J6HA 1XXGA 4CJ1B 1HQRD 3RYTA 4DR1L 1X55A 4WJQA 2CH4W 4B3ML 3O65B 1EYGA 3ML8A 4DK3C 3W1BA 2IW3A 2UUAL 2WDRB 4GDKB 1A62A 4DK0A 5M9OA 4U673 3TEWA 4XWWA 3NZSA 3H0GH 2ZT9C 4C3HB 2R7ZB 1YJIA 4A3BH 1YJJA 4QIWB 3STBD 5C4XB 4GOCA 2LMCB 4NDXA 1A70A 4P74A 2CWAA 3OPOA 3DPDA 3JYUA 1D6EC 1YHAA 1SLJA 1DXMA 1I6VC 2B2YC 2FJ2A 2DNFA 4NPNA 2QF7A 5CHWA 1PH3A 4E74A 1G91A 2ZVNA 1JJ2A 3EFCA 4OZBA 1Y1VG 3DVNV 1KH0A 3F2BA 2N49A 1RWSA 2JA5H 2ACZB 1SE4A 5IP7G 4JI5L 1DD2A 1H4RA 2EXZA 4L63B 2KHWB 4L23A 4JG2A 2BKFA 2KJHB 1EUJA 2MLBA 3U9SA 4PMWA 5BYQA 1HPCA 4DUYQ 4R4OA 3Q3OC 3RFZB 3EGRA 4A3JB 3OMCA 3OSOA 3K57A 1WTXA 4REZA 1PTOF 1Y8NB 4GNXA 2V3SA 3AEFB 4L5RC 2Z9HA 2OQKA 4RHRA 5I2XA 3RNCC 2N7EA 5HURA 4R1JA 2UUAQ 1NTGA 2X6LA 4A93B 3M9BA 1HNZQ 4KV6A 2W3RA 2IY0B 5H92C 5FR3A 1LT6D 3DEOA 2RCFA 4HTHA 1LT3D 3NEMA 1Y56A 1BXTA 1TT2A 2NWGA 1B9RA 2IX3A 1JRUA 4IUUA 4A75A 3GTKB 1B50A 1RJTA 1EL0A 3HOYH 3S17H 2D62A 2INNE 3QJYA 3AE5B 1RL2A 5E7NA 1ZP0B 2EPBA 3K7AB 3NTIA 2EZVA 1JRPA 1WGDA 2G9DA 2VQFQ 1AFPA 4DAYB 4CJ0B 5LMUQ 3VYSA 3ERQA 3VYTA 2MNAA 2HDMA 4FHKA 3RN5A 4LJZC 4WQOB 1K73C 4URKA 2JY6A 1I94Q 2OCEA 3TBLD 1R7SA 2F0NA 4MH0E 1NDDA 3K58A 2O2VA 3RZDB 3IG3A 3J80E 1ENFA 3I4OA 4D2KA 2V4IB 4YTPB 2OT2A 2QW7A 1YNJC 1P98A 5IP7H 4K1RB 3KYHC 1DOXA 2FMCA 1XPUA 2JYTA 4C00A 1STNA 5C3WA 2QGQA 1WMHB 3GTOH 2DAJA 3GO5A 4KLKA 2LEKA 5D6JB 4OIKA 4K6LA 3H94A 4DV3L 1YD8U 2KWDA 3I3CA 1H9KA 4BA1I 2KHSA 5DM73 5M3MB 4ALPA 3RI7C 5CMDA 3NZ3A 3ENEA 3QO2A 1YJNA 1J7CA 1OFFA 4KKTA 1QVFA 4NJCA 2K05A 5IGGA 1D5XC 4X65L 3CF5A 2WB1E 3SR1A 1HZ6A 4AYBE 2L8JA 4HLEA 1VMCA 2GB1A 2RSNA 3E0JA 2GBJA 2M1MA 1STHA 2MP1A 2PQAA 4EGVA 4MJSA 2DN8A 2F0JA 4OO1I 2RD0A 3J7AF 3HIZA 3HOVH 4NY0A 2O6VD 5DPSA 1OXUA 3I57A 2KYWA 4ZLTF 1F2MA 1WXVA 4HIMA 1PTOB 1ET9A 3MA2B 1B9MA 4L2YA 1MGSA 3GTPB 1TWHB 1F0ZA 4JE3B 4IFDI 1SYCA 5CV9A 1TKEA 1S5ED 3QX1A 2YTYA 4KY7A 3TS0A 2KFKB 3OLMD 4UY8C 5A2QE 1V5TA 1RD9D 3DLLA 1SEBD 1IBXA 3GTQH 1JC7A 1SMXA 1UWXA 1MG8A 1T0SC 3N30A 3AQQA 2D3AA 2FIFA 2L0TA 3MXPA 2CW0C 5EJWA 1N9WA 5T1GA 2ICIA 1TWFH 4HEDA 3S16B 1KRHA 1XCQL 3B6YA 4JBMA 2X69A 2M0AA 1E5WA 1YQ4B 1E22A 1JB7A 1WCMH 1HA5A 3AFPA 2CQOA 4TVAB 3KUZA 2UUCL 2J42A 3RZWC 3WIMA 4FADA 2B3GA 3OTOQ 4IFDG 1QKZA 2DBYA 2E3TA 4WURA 3FILA 5I2YA 1B53A 3ICEA 3CCEA 2K50A 2KVZA 4PMBA 4B3RL 3OJ4B 4KX6B 4ARIA 4A93G 2FCSA 2Z6BA 1W6KA 1PH7A 4N8X1 4G11A 4ZQ3A 1WJJA 5CV6A 3A4SC 3L2PA 5HY6A 4HKQA 3QA8A 4A3LH 1IBKL 4C3IG 3RNBC 3L13A 4IUNA 3D32A 2WLBA 1C0AA 3DBSA 2F0OA 3B0AA 3MXNB 5M3FH 3RN9C 1WX8A 2M8SA 1YNJD 2JU6X 2KD0A 2PEAA 3A8JE 1I6HH 1X3PA 1HNXL 1DOKA 2PE6B 4LNIA 4CKBA 2ES2A 2WQYB 1TWCB 1A15A 1O80A 4B3TQ 4L5TA 5DPRA 2CWPA 3KF8A 1H9SA 3K5LA 1FRDA 5JHAA 1UH6A 1EQVA 2GRIA 3APDA 2DAFA 2WP9B 1YJ9A 2PZWA 3IFWB 3Q22A 2E2IH 4J15A 1DGJA 1J0GA 2PPHA 5C4JH 4X62Q 1MKHA 3FP9A 4AIMA 4II2B 2B2UA 4L5SA 3VUYA 1EQQA 2LRUA 2B2TC 3JSVA 5GMVA 1BMLC 4NQLB 1Q86C 4B9KA 2SNMA 2JWUA 4OO1H 1U4LA 1GKHA 2QDFA 4N6EB 2OEDA 1UE1A 4HMJA 2WKDA 3DOWA 4S3SA 1VQKA 2WB1G 2ZNVB 1P16A 1K3RA 3P7JA 4YIJA 1XMQL 1ZPSA 4R3DA 1WCMB 3HRDD 1PH4A 1CFMA 1TS4A 2KOLA 4UPAA 3E5SA 1C48A 2A8VA 5C5LA 2EDGA 2A1AA 2K6AA 3DBRB 2MBBB 3IVFA 3WAPA 4G7HC 1FXTB 4AQ7A 3FDTA 1P8LA 5IT9L 2A69D 3G6EA 4KSLC 4XX5A 3IL8A 3ZW3A 4KJNA 4XWTA 1X3QA 1WVLA 3L54A 3DQVA 3Q23A 5KHQA 1VQEA 4RGNA 2JQRB 1PRTD 3NWSA 4X64L 4A3MB 1U4AA 2RVLA 3N1XC 4EZKA 5G2NA 1SMYC 3RZFA 2K22A 2JA6B 4M02A 4PZ7A 5M3FB 1MSHA 3ER0A 4QQBX 1QWYA 2D9UA 4EUTA 1XNRQ 4ZRZA 2PPBC 1HNWL 2I1JA 2ATWA 2MQJA 4KKIA 2H89B 3CP0A 2TSSA 1V1PB 1ZUD2 3NY5A 4JI5Q 3D4WA 1E8XA 1MHHE 4XDDA 3EHVA 1GC6A 2K6DB 2RPQA 3NVVA 5ELBA 4DPGA 1K8GA 1N5WA 4EFOA 1FL0A 5C5MA 4XXEA 3CSTA 4II3B 1GUWA 3IT6B 1D4BA 1C4QA 4P2CB 3AE6B 1I3QB 2EQSA 2DY8A 2LXCA 2PQEA 5EPKA 4R4CA 3R2IA 1HFGA 1OGWA 1A2TA 1HTOA 5JEAJ 1NR2A 3A9JA 2Z0SA 5IP9H 4NXML 2IZVB 2KAJA 1VZ8A 2NVQH 3KWVA 4J3OD 1HNZL 1L1OA 1VQ7A 1TYGB 1YHQA 2DZKA 1HNWQ 2WXNA 4GIVA 3ZJVA 2MX2A 1S3SG 2KWUB 4BBRB 2Z59B 1IBXB 2E5LQ 2KTRA 1V1QA 3UIPB 1NUCA 1LTID 4JV5Q 1X1MA 3E9IA 2XWBB 3PGZA 2ZM6L 2Q2UA 1XLPA 5FR6A 1IZ6A 4BY7B 3JAME 3VDZA 5JHBA 3TJPA 2RCNA 2ZZPB 3MXUA 2LGXA 2SDFA 3CPWA 3DM1A 4HCEA 3DEPA 3V6EB 1LM0A 5EAYA 4QCLA 2FCNA 2XBBC 5TSSA 2QKIC 2IGDA 3AI5A 3CCQA 3OHXC 1YQBA 3FRPB 1N36L 2N8NA 3E9SA 1E7UA 1I94L 1U4PA 4LUVA 3PF5A 4LNQA 1UELA 3DVGX 4ZHPA 1JALA 1RTOA 3ZKJC 2ONQA 3GE8C 5AJ3Q 1CT1D 3P75A 5K5PA 4B0MA 2Z4IA 5G3LD 3FHWA 4EQOA 3A9JB 2EIFA 4BWGB 4HCSA 4C3IH 4ID6A 3KOJA 2EYOA 1VQIA 2O6VB 5BYRA 2K5WA 2PI2A 4KHVA 5DM63 1A6XA 4DHZE 2JA7B 2CKHB 2C5CA 1HTLD 2KQ4X 4A93H 2A68C 4LF8L 2KT7A 3EUB2 1PH1A 2DUDA 1SE3A 5HGQA 1FPYA 3DHGC 3IT4B 5IAAC 4JI3Q 3PSEB 4JV5L 2LFIA 1UNSA 2N9KA 3AULA 3W1GA 1RODA 2BBCA 1X6OA 2WXFA 1WCMG 4W9JA 5E3FA 4BBNC 3IAM1 1BVSA 5I6WA 3MHSD 1KRSA 4ANVA 2WDVB 4F88A 4ZYNA 2R7FA 1KHIA 2A5HA 2D3BA 2DZJA 4YTMB 2F0WA 1Q46A 5LMUL 3U50C 3VTUA 4KI0A 3W5UB 1X3GA 2KBNA 1EIYB 2L83A 3APCA 1LTRD 1MFWA 3H7SA 4K7SA 3RCZA 2JPHA 2RKSA 1J8IA 2KQSA 2N9XA 2ZW0A 4JWSC 3ZIMA 3AU5A 1VQJA 2JP1A 5E6OA 3C1FA 5CHVC 1WY8A 3RNAC 4WH4A 1LTAD 2IHFA 1S3OA 4RCNA 2WAQB 2GBKA 3TEXA 3A74A 1QG7A 1KXLA 1XTDA 4DV2L 4GLAC 5CV5A 1PTOC 4FLHA 1K83B 1QILA 4A3BB 4MTNA 3SD5A 2FHTA 2MBHA 3Q0AA 2L52A 3NG0A 2PNHA 4BA2I 1FFVA 1V5OA 3QQ8B 4NAMA 1PQSA 4DU9A 1JICA 1WE6A 1WRDB 2G4SA 1BO0A 3OOCA 4ZUIA 1VQOA 2PLPA 4MIUA 4P7IA 2UXBL 4XQNA 2K39A 2GA4B 2K9XA 4GN1A 1VS0A 4AP4C 4QMGA 3T8MA 5ELEA 4B95A 4LWCA 3OYYA 2BT6A 3PS6A 1EWCA 1E90A 4JC0A 4QY7A 4KJOA 1EU4A 1JMCA 1AZQA 2QIEB 2HQEA 2EY1A 2F0LA 2VQEL 1SJED 3VTWA 1L4ZB 5C1ZA 2JYEA 4LF4L 4WJ4A 1WX9A 1ICFB 3TZDA 1SBBB 1YNTE 5HHDG 3U58A 4DR7Q 1FJGL 4R4TA 5KNCA 2F1MA 1SNOA 3UDFA 2YLMA 4K14A 1V1PA 1QOBA 4K2LA 1QCBD 3ONAB 4A4IA 3S1MH 1G6ZA 1IPGA 3AE9B 3H6NA 5HFYA 4XT1B 5FLXc 1S40A 1E8ZA 2N9PC 3HOUG 3KQ4A 4DHJB 4RCOA 3PIO3 5C4HA 2PI2E 3S2HH 2EJGC 3DM3A 3I70A 1VQPA 2YVCA 2JK8A 4XDCA 4B3MQ 4Y7NB 1QOGA 2IX0A 2BS3B 1Y1WH 1TWAH 1XLOA 1IKMA 2JT4B 1FFUA 1OXXK 4BY7G 5H1SE 1A5RA 3KBXA 1QZHA 3S14H 4IKGA 3HOYG 5FKAC 2JYOA 4C1NI 4FDBA 4UP7A 3RZDH 4BY1B 3CAMA 2I5HA 3GTOB 1PZID 5IE8A 4I65A 1ZDVA 3T51B 2HJ1A 5E6PA 2VZKD 3SHLA 1EF5A 1E7ZA 3WOFA 2KCNA 1D2BA 2PNRC 4BS9A 5CGKA 2R7ZG 3QR8A 1UGJA 3HKZG 2KJRA 4DXGA 2NZ1D 3AECB 3KWLA 1CKOA 1Z47A 2KFKA 4DV2Q 2OEOA 5LMNL 1C78A 2KVMA 2HJ8A 2KC1A 4M01A 4MEMA 3CCRA 1HR0W 1I4RA 1G8ZD 3VDYA 1IBKQ 1JOQA 3DWMA 2Q2IA 1FCLA 1TR5A 1VQ9A 3KW5B 3VQIA 3H8HA 1Y1WB 1S5BD 1K8AC 1WTQA 1MG4A 4DK6C 5AEKB 1NMGA 2W3SA 1PFBA 2M17A 1X56A 2MP2B 1XPOA 5IGBA 4L1BA 2Q5WD 5IGDA 2GMIC 4JQWC 4XYCA 3ZUNA 2K8CA 4LNNA 1HTPA 3C1EA 1SE2A 1PV4A 5C3XA 2NR2A 5EPJA 5BN3A 1EOTA 2JA8H 1HHVA 3CRKC 3D31A 4C56C 4JI7Q 1TT5B 4G4KA 4LF9Q 2LJIA 2OJRA 1VJKA 2F0DA 2NBFA 1E24A 1G2TA 2GOWA 2Y5PA 3PGEA 3OW7A 5J1ZA 2K14A 1TWCH 1NVID 1OTRB 1PUTA 1WWTA 1B7YB 4DXAB 1K3BC 2HHHQ 2FCQA 3TRZA 2MHJA 3I8ZA 2L1AA 3UE0A 2AQ2B 1BUVT 3I91A 1XPRA 2B63H 4IUMB 2EOTA 3E0EA 1XEEA 3HGBA 4OVVA 2D11A 4DR6L 1Z9FA 1XMQQ 2DX5B 3J7YW 2B2UC 1SRUA 3PIP3 4EZLA 4JCVE 2LVOA 2E75C 5L37A 4R4QA 3TN2A 4GZYC 2X6GA 1XCTL 2H88B 4IO9A 2OHFA 1QZEA 1GUSA 3QAQA 3UINB 4MH8A 4ANXA 3V61A 2C9OA 4RGTA 4GNXB 1WE7A 1STBA 2K04A 3AU4A 3LXFA 4WRDA 2CHWA 4ZRPA 4N8FA 1P3QU 2MFIA 1V49A 4CKCA 4G7ZC 1LLRD 4TV3A 1XX8A 3PO2G 3JC66 1AYFA 5C2TB 1AEXA 3AXCA 4FXKC 2IL8A 5E4XA 1FNVA 2E2HB 3WALA 4A76A 4C3HH 3TL5A 1I50H 3ZTCA 4DV4Q 1NI3A 4GU2A 1ZEQX 2RMMA 1KF6B 3SU8X 2KHJA 4DR1Q 3RUZA 2I07B 3CF6E 1V81A 3JAMi 4RNAA 4HN7A 3M7GA 3CMEA 2M19A 1XNQL 4POFA 1JB3A 4MT5A 1AARA 3WANA 4WWMA 1VF7A 4BY1H 1PFDA 5LNK1 3PIOA 2V1CC 2HTME 2O4XA 3RLFA 1NCVA 4FF2A 2MO0A 1C77A 5JPMC 1CZWA 1KDCA 2B39A 3W5OA 2MQHA 4DUZQ 4KK7A 4A3CH 1EUVB 4IM0A 3HOVB 2EMTA 2G5DA 3H91A 2JA7H 4K5XA 3S2HB 5FOBB 3WAMA 5BN4A 3J7AV 1XLNA 2NVYB 4DV7Q 3ZNZB 4EOYA 4UAIA 3S1MB 3HOYB 3S17B 5IP4D 2K4KA 3M4OH 3I3TB 2MEKA 4JI6Q 4Z9CB 3J80c 4IPCA 3T1HL 1OQQA 1YIJA 1RYJA 4XQQA 3U30A 1Y1WG 4DV4L 1IYJB 4EVOA 3R2TA 2E74C 1XO3A 2B2YA 4K3CA 3VH4B 4PQXA 2MH7A 1EY0A 1J19A 2L7RA 3PUVA 4P73A 3AE7B 3V2TA 3WOEA 1AW7A 1CUKA 1PRTB 4KDIC 2BW2A 1SE8A 2QEXA 3U8ZA 4W9DA 1IYVA 2R93B 1WXSA 3L0WB 1D7QA 1ESFA 5I9OA 1L7YA 2ALYB 1C4CA 1EWHA 2VZAA 3GTJH 3K81C 3AU7A 1TGZB 4G7OC 2B76B 2C7NB 2A73B 3AH7A 2PW5A 2GI9A 4US8A 4JI1Q 1BUIC 1XMOQ 1C7YA 1TZOA 3AE3B 4K7WA 4CGYB 4Y7NH 1I4QA 1S1QB 1HJPA 2LI5A 3T9LA 3M4PA 4LFBQ 2QCPX 1L0YB 2BCOA 5ELCA 5FO9B 3BS1A 1PZJD 5FK9C 2E2HH 5D3DA 1KTKA 3UGBB 3A8IE 2M2LA 2XVSA 4C80A 1KLGD 1WYDA 4A3GG 3L08A 4K8IA 1SNDA 3NXWA 3PMFA 3GTKH 4DAPA 4DKAC 4HPLB 4OVZA 2PVGC 2AHOB 3T53B 4B3TL 2HTHA 4RHSA 1SIFA 2UXBQ 4HDQA 4CJ2C 1T5XD 1D1IA 2O2LD 3AB9A 1EZ8A 1FR3A 1PH6A 1ISNA 3TP7A 1N60A 2HDLA 4GN5A 2O2VB 3CCSA 2I5MX 2I5LX 4TSSA 1GUGA 2R3ZA 2EE1A 4TRDA 3PZDA 3E3XA 3I55A 1MVKA 1V43A 3S9WA 1HZBA 2E2DC 3CW2C 2NS5A 2D5GA 3K9PB 2XNAC 5A35A 5C4ZA 2IGHA 1FMAD 2B8FA 2C35B 3EC8A 2FXQA 2AKWB 3RNUA 1VQ5A 2EYJA 5AUIA 3L9AX 2GBNA 4FP5D 1GUTA 3MXGA 5LL6S 5C0XJ 1CJEA 3F2CA 3NE5B 1C4AA 2WACA 2C9WB 4RAUC 1IUEA 1SR3A 1F1HA 2X38A 3N52A 1WTVA 3ZTDA 3ECIA 3AN1A 3Q3MC 1J5EQ 1PDQA 4A3EG 1KD1C 3B2FA 4OIJA 3TMEA 3J81i 1SE9A 2NVXB 5MPOA 3HM3A 4EQ5A 3PUYA 3KVFB 2Y5BB 4CDCC 1A3TA 5JXVA 1R4PB 2E76C 3E9HA 4KTAA 3K6OA 2NBUA 3ULLA 1PYSB 1FEHA 3RN2A 1B3AA 2A69C 2DYBA 1TKWB 4OX9L 3E6ZX 1GM5A 2AYOB 2WXRA 1GB4A 2JF5A 3IBEA 1F2YA 3DWAA 4ZAIA 2K25A 5CORA 2BYTA 3M3JA 4AQYL 3DCGA 1TS5A 4ABNA 3SR6A 3FPPA 1Q1OA 1UGMA 4QIWE 4IW0A 5L95C 3TP5A 2BS4B 1FVIA 3BDOA 1Q0WB 1T3QA 2RSUA 1F52A 3CC7A 3SGIA 1N5XA 2PW7A 2B29A 4BBRH 2FAZA 2MRPA 4N9PA 4ODGA 4X3KA 1HA6A 2KDMA 3DWGC 4JGHB 2L15A 4A3CG 4BAXA 3KF8B 3MHBA 2QC8A 3S1RB 5E1FA 3PF4A 3CKIB 1YQ3B 2V1YA 4OGQC 4LF9L 1V80A 3ZDMC 1S4ZA 3OJ3A 3CQZH 4X62L 4YY3Q 2UUCQ 4WJOA 4YWLA 1KRTA 3HOXG 1T0YA 3Q8FA 2ZPYA 1YZ6A 3W9CB 4PMCA 3RZOB 4ANWA 1JOOA 2WDTB 4C4VB 3VH3B 1IGCA 2DENB 4A3JG 4XT3B 5E6NA 1BT0A 3P63A 1UF0A 3KFUA 2A68D 2YTXA 2WXKA 1IP9A 3X0WA 2JA9A 4A3GB 5JEAG 1MHWC 5GXGB 5HG2A 5H8YE 3SFDB 5IA7A 4P1BC 2IWHA 2F3VA 2EY5A 4GB9A 2BGFA 1TWFB 2ON8A 1YVCA 4LDTB 4A8XC 2IO3B 1U4RA 4JW0A 1N61A 3MJWA 5AJ3L 1H9MA 2KTFA 3Q3FA 4Q5VA 4JI4Q 1VCIA 4PS3A 4K0KQ 4AYBB 4PT5A 2MUYA 2LZ6A 4BKSD 3PPAA 2W54A 1GXDC 2TMPA 2B2TA 2O6VA 1TWHH 2MCNB 3RT3B 3WA0A 2VQEQ 4HAEA 1YN5A 3EECA 1SB3C 5IOIA 4DV6L 2OWOA 2CU3A 2KTRB 1GUNA 4IUTA 2WHIA 1LO5D 2A19A 2EVBA 3K80C 5IWAL 3NTHA 3AE4B 3CU7A 1ZGUB 2NN6H 2VW9A 3BU2A 3S1NB 5HGTA 2A4ZA 2GVBA 3KK7A 4M00A 1FGBD 5ELDA 3BG3A 4P72A 4X6AH 3GS2A 3VRBB 2SNSA 2FUHB 3QHTA 2WXJA 3PLVA 3KYDD 1E8YA 1W2BA 3GTLH 2KJ6A 1TIID 1JWBD 1WGRA 2LHDA 1VF5C 1Q90A 2LUEA 1GHKA 3ZNHB 4AWJA 3A7AB 4RGOS 1E1TA 4C2MB 3KJPA 3QWZB 1X54A 2PW9A 3Q8CA 1EIFA 1K53A 2BA0A 1YMHE 2J0JA 2VH1A 3WWVA 1TY2A 2LY7A 1YITA 1CMXB 1YIWA 3W1SA 3PIPA 4DV6Q 3I5JC 1PGBA 2RA4A 2CH4A 3Q8DA 1F9JA 1L6VA 2CU1A 2A6HD 3F2UA 4TQ0A 5FLMH 1PXUA 5IY0A 1SDFA 5F2DA 4IJHA 4DR2L 5LXHA 2PYKA 4IUVA 4IOCA 2JVCA 5EKKA 4F8MA 2QDBA 4RWSC 3VTVA 1TVXA 3ULPA 1ILPA 3QK0A 5CV4A 1YHBA 4JI0L 3ZXRA 2VNUD 3TZUA 3PQIA 4KY6A 2IO0B 3UQAA 2WB1B 3H6MA 2A5UA 2AEHA 1CKMA 4JVZA 1H9RA 4LJOB 4IZ8A 2JSVX 4PYZA 4HJGE 2WP8J 2YYZA 3PCOB 2KN4A 1UBQA 5M3FG 1HH2P 2Z8LA 3CPFA 1OEYA 1RIPA 3BINA 5D7GA 4MNOA 1LT5D 1ROEA 2K0PA 1N32Q 3HZXA 1M8AA 5JJLA 4OZCA 3KYCD 2H1EA 1K9MC 1JMLA 2UXDQ 2DZMA 4N9TA 2H5XA 3H3VI 4H02A 4RA8A 4JI7L 3LYYA 3Q8EA 4C4VA 4MGZE 4LFBL 2PTLA 3JSVB 2ZJRA 5IO9A 4M8AA 4CHTB 1DCZA 1LTGD 1WD1A 2K5PA 3S1RH 2E6XA 4W9CA 2K1BA 4DV7L 1U4MA 1S5CD 1CHPD 1NY4A 4ZUJA 4O1NA 1L1OC 2BF8B 2ZCCA 4LNKA 2NPTA 3EFUA 1JWMD 4ZOHC 3ZNGC 4ASWC 5M5YB 3D3RA 2HCCA 1PH5A 4A3JH 5M5XB 5J22A 4HXDA 3MEHA 4F7XA 1M90C 1RFAA 1E6EB 4K2KA 4QGUA 1UE5A 3R93A 2F0UA 4EKUA 3GTGH 2MJEA 2V9HA 3PO2H 2VXWA 4C3IB 3DMUA 3TSSA 1AWDA 1R9TH 1OQRA 3BDLA 2RDHA 1QT9A 3DUZA 3DHHC 2J0KA 4HPPA 4LW1A 2PIAA 1ZDXA 4FJVB 1IYUA 3R8BA 4BKSA 3OIQA 1ENAA 3V3XA 5C23A 4CO7A 1ENCA 2E2JB 2NVYH 3NVWA 1LV9A 4FO2A 1HZ5A 1Q1EA 1OXTA 4JBWA 1CQVA 4A3DG 1VLBA 4PZ8A 2EYMA 4GN4B 1X3EA 4RGMA 1L0VB 4RM8A 4WAAA 3AEDB 4F7ZA 4XQJA 3ZVVA 4KGTA 1YBYA 2QHOA 5LMNW 4K7UA 4ZHOA 3D6CA 3FEWX 4JPSA 1STYA 3KDFA 2N9EB 4RKLA 1N33Q 3A5UA 3M7NA 2BOSA 4RMAA 1TQOA 3QIJA 1KLUD 2B2VA 5DPWA 4IN3A 5L83A 4DV5L 4HJKA 1Y1VB 2JA6G 4LLGM 3TQYA 3S15B 4AS1A 3PZ7A 4AOFA 2WU2B 2EMSA 4UHVA 2EJFC 4CKEA 4KIKB 2EYHA 3HOZH 2D0PA 1Q5WB 1QF6A 1QZGA 3K7UC 3K5NA 3QIAA 3K5OA 1TXYA 4DNRB 3UI3A 4A3FH 5IP9G 3EJIA 3VXWA 2WINB 2L5TA 2R61A 2MJ3A 4A6QA 3N6RA 3M4OB 1D5MC 2LASA 1RDPD 4M0WB 3QC8B 2EXDA 1BF4A 2JZZA 3Q24A 2MGSA 2H4OA 3OW2A 3T1YQ 4GMVA 4XGAB 2N78A 5DAUA 3T56B 2DJFC 2FBWB 2ZJQA 1SYDA 5I6YA 2CCZA 1MJDA 1NENB 5KRUA 1FYCA 4DV5Q 3RULA 1DGSA 5LLIA 4MM3A 1C79A 4A3DB 1PGXA 4GGQA 4IOIE 2CW0D 2LD9A 2WXQA 4W9LA 2L4NA 2UWQA 1N63A 4I7ZC 1BBWA 1YEZA 2EYLA 4JLCA 3R7RA 4ICUA 4LDTD 2JE6I 3G7LA 4LF4Q 1E10A 1EEFD 2HCIA 3PUXA 3BIID 4YXDB 1DONA 4DGZA 2YEPB 2G4DB 2FUG1 3VR5A 1QOHA 1JJCB 4KN4C 1NI2A 5A2QL 3HM6X 4PV1C 5IIFA 1D5ZC 1WR6E 1LT4D 2B63G 4J8QA 4BXXG 2B3AA 2J0MA 1EY7A 2BYVE 2PE9A 3IXSA 4QF4A 1PH9A 4MELA 2G9HD 3NSWA 4M1UB 3J81E 1CA5A 5HI1A 2VS1A 4YWMA 3HVDA 4A3GH 2ID0A 1VQHA 4AJYB 3SXHA 3DVGY 3HVZA 1ET6A 2HQLA 1AE3A 4GKKL 5FLMG 4KD4A 3KUDB 4MSQB 3Q14C 2MW5A 2JA8G 1LUZA 3D8GA 3CCMA 1XTCD 2KMMA 1XJVA 3L16A 2NCNA 3CWIA 1BNZA 2WAQG 1WJUA 4WFN3 3DBLI 4P6VF 2JA5G 3DVNU 3VFKA 1WI0A 4OWTB 5GAEC 4HCNB 2WKCA 2PZUA 2F4VL 4RF0A 1Z5SB 2L11A 2DNEA 4GNXC 1DOMA 4A9AA 4QB4A 2GVAA 1MPEA 2ZNVC 3NQIA 2F4IA 1IBMQ 2I1KA 3EQLC 3V62A 4AJWA 1ASYA 1I4HA 1KM7A 3KF6B 2HHHL 4AUQC 3SEBA 4GSWA 3ITPA 3H0GG 1C76A 1JROA 2K5NA 4HIOA 5JJIA 2JEBI 1MJCA 4JOIA 1Y8OB 5TR5A 3CRLC 5EPLA 5KNDA 5LMNQ 2WU5B 1FO4A 2KACA 1PFNA 2BWFA 3KDFB 2J0TD 5C44B 5M5WB 1N34L 4BFRA 1GUAB 2KK8A 2IHEA 3NS8A 1EFID 3TDQA 1TS2A 3ML9A 1BBUA 3A8KE 1W3SA 3KLRA 4HJ5A 1VQ6A 2JA7G 2DZIA 4NXMQ 3ND8A 2OTJA 2PQAB 4MJSB 1E0ZA 2LKVA 2M9VA 2ASQA 5BN5A 1WXMA 4DBGA 4NJ7A 4BVUC 3PRMB 4LUOA 1X9NA 1UAPA 3JAML 2E2JH 2E5LL 5IYDH 4E71A 2F03A 2BA1A 4PZ6A 1ILQA 1FD6A 4P71A 4XYOA 5I4DA 3P4SB 4HJ9A 3N32A 5DLQE 2PCFB 3K0YA 5M5WH 4M8MA 3ZGZA 5BR8Q 2KMCA 2WXLA 2PO4A 5AFWA 1UEBA 5CYUA 2F0MA 3K5MA 1KLVA 3GTQB 2NBWB 3Q6SA 1GHJA 4NW2A 1T6BX 5AUKA 4GKKQ 4K5WA 1Q8IA 3F8TA 4C1NK 4ACFA 1QE6A 1IW7D 1U5KA 3IKJA 3RMHA 5IYCH 4AH6A 1L2NA 4L8JA 4I6LB 2C7HA 1HE8A 1RTNA 4OZAA 1UE7A 3A9KA 4U68A 4KSKC 3W3AA 3R3OA 2KLGA 1RFKA 1KL9A 4C3JB 5CC4A 2B2VC 3VYUA 4PK1A 1AH9A 4HK2A 4A55A 4YSZB 2F0VA 4KZCA 1IBLL 1Q82C 3PREA 4ZRKA 3I7FA 4DHZB 3ABVB 2CS4A 3KUCB 5BR8L 2R93G 2GBMA 1OO9B 5C3JB 3NBIA 1VQMA 3AEAB 2YTVA 1YOVB 4HR7B 2XK5A 3AE8B 3KF6A 1FNUA 4HCPB 4WJ3M 2ZXOA 4ZRIA 2JWZA 4UDUC 1E2VA 2VQFL 3C46A 2BQQA 3G6JB 3VAWA 1VQGA 1CZGA 1STEA 3CXCA 3C3LA 4IUQA 2AMCB 1P7EA 4DFAA 5IKCM 3K0XA 4TMAB 4B3SQ 4NAWA 2EY2A 5IYCG 3UDXA 4JK1C 1CSQA 1LYLA 1RKNA 2NZHA 5C44H 3PRZA 2BH2A 3CSFA 1KC8C 5EE1A 2YV5A 5JPNC 3N1YC 1SAPA 2JRIB 3FPUB 1PVOA 4LCDE 4X64Q 3A7LA 4XTCS 3CC4A 1A3VA 3L4PA 4LNFA 2ZVOA 5E6JA 2W82A 1B44D 4TQUS 2VL6A 4WORA 3NELA 4A20A 1S5FD 3VYRA 3H3VC 2BWES 3DBHI 2HT1A 3N9YC 1K83H 3C2PA 1TKYA 1Y69U 4IURA 3RLNA 2CJOA 3ZRCA 5JJKA 4KY5A 3MFYA 4JI6L 1ESRA 2ZXRA 1TTNA 4CDDC 4HDOA 1IHZA 3UE1A 1VQBA 3UI2A 3IFTA 5DEHA 1ICWA 1SFOB 1SF0A 1I4GA 2HDEA 4BBNF 1V2YA 4LFAL 3H0GB 2R7ZH 2CJNA 2K8HA 4N59A 3PO2B 1B1ZA 1KNAA 2LXJA 2MJ8A 3T13A 4F8CB 1UUPA 2DNCA 1HZCA 4POGA 4KV2A 3KJOA 3NHEB 3QWNA 2FIDA 4LNOA 4DV0L 5C4XG 2SAKA 1GC7A 3GQBA 1K8MA 4BKGA 3UDGA 1UE6A 3S2DB 5JZEB 3KH0A 1AP0A 2UUBL 1W6JA 3J81L 3N20C 4K81A 5EE0A 4A3IB 3T1YL 1KNEA 2BE5D 2XIWA 2QA4A 2KN5A 3SE0A 2NPTB 3Q6BA 4CHKA 5KYIA 3PHWB 1N62A 1KJTA 1YNND 2J7QB 3H9DA 1WXQA 4IM3A 3CIRB 1DOIA 1YI2A 5J18A 3IAYA 2BE5C 1V1OA 2CHZA 1WGGA 4HWIB 4GDKA 3PV0A 2C5LC 2IGGA 3OWFA 3LNNA 3ZLZA 3A33B 1HUNA 1GPXA 2OTLA 4G3XB 4DK5A 2I0QA 4H0LC 4IALA 2AWTA 1MHXA 5IT9E 4MZ9A 4B3RQ 5K36H 3MFGA 3J7ZC 1NYRA 2WX1A 2E8GA 1N8RC 1ASZA 1N32L 4NNJB 3HOWH 4DQOC 5CBEE 3U4EG 4FNFA 5M5XH 1O7YA 4OELB 3FMCA 4BBSH 2WXIA 3RR5A 3GP7A 1WFQA 4OHJA 1WZ0A 1LTLA 2I38A 3H7PA 2XEWA 4JI3L 2JRHA 4HKZE 3HOUB 3J9CA 4GOPB 4X66L 3Q69A 4JBKA 2GN5A 4A3LG 3GOEA 2REXA 3HKZB 4IFDJ 3BZKA 3CCLA 5JJZA 5EBDA 5EE3A 4YY3L 3P2BA 3P4RB 3ZXVA 1FRRA 4A3OA 4IQZA 2RDFA 1KDAA 3VR2A 3G71A 5CV8A 4BY1G 3DBLB 1MI2A 2KEDA 2CKZB 4S0RA 1NYQA 4XYQA 1WGYA 5BO4B 2R7DA 5C0XH 2QCZA 3E56A 3AYHB 1HR0Q 4R4IA 2A6ED 4O0AA 1WYWB 2PVOD 4RKBA 2W9NA 1SNPA 2VB3X 2L05A 2WYQA 2EYPA 3H09A 1RM6C 3BVMA 3V6CB 5C44G 2WIIB 3MJ5A 2WX0A 4P75A 4AQYQ 2D07B 3MHZA 1SYFA 1EFWA 5GADC 2JA6H 2D3CA 1SMYD 5AZFA 4TQ1A 1TWGB 4G0NB 3ETRA 3H3VH 4A3BG 4KGSA 3QJZA 3N1ZC 3CMMB 1DJRD 4PS8A 1H9JA 1Q3LA 1IW7C 3IHPC 1BKBA 2RPVA 4X3UA 3L7ZC 1A2UA 1E3PA 4BBRG 2KDEB 4OONA 1OXSC 2FCMA 2J52A 3B9JA 4CQNA 3HOVG 5D2MB 2N7DA 4YT0B 2VZKB 2F0PA 4K6DA 1VCBA 2KJXA 4V190 2ASBA 1FIQA 1JWUD 3ZDTA 4CYEA 4J1MA 2Y0SE 3PRPB 1H8CA 3W1SC 1PZKD 5KYLA 1KAWA 1BCPC 2Q8RE 1OTCA 5FJ8G 2MBOA 1H9SB 3P4PB 4KGRA 1L6UA 2AL3A 2LJ5A 4IPDA 1CI3M 1T0QC 2UU9Q 4JI8L 4ANUA 2K1FA 4A3IG 2BB5A 1GJXA 1V86A 2I46A 3KUPA 4H44C 2JX5A 4A3EH 3ONSA 3DHIC 1C9FA 1HEZE 1IBLQ 1NBWA 1CKNA 2N3SA 5FO8B 4LFCQ 1SN8A 1CZPA 1VQDA 5KIXA 4QAYA 1B3QA 3SK6A 1EY8A 3BZCA 4FVMA 3FKIB 3J80i 2JZPA 2RGFA 4P1CC 2BKRB 1SNMA 2KDIA 4E3CA 3NHHA 2QDLA 2LXKA 2RSOA 3DWPA 3MXNA 4DR2Q 1VQAA 1PFSA 2F0EA 5IYDG 3EIVA 2R92B 3F1ZA 2LGYA 3MP9A 2F0KA 4LJPB 1WTPA 1VQLA 4TUUA 3P4QB 1PH8A 2HD3A 3U7ZA 1M94A 4MSMB 3ZQ4A 1QUQA 2K03A 4N9F4 1JR0D 1ZYRD 2M56B 5G55A 2R6GA 2WAQE 1DM0B 1N36Q 4DUYL 2V4LA 2KWVB 2LWPA 5BMIA 2RHSB 3RZOH 1K0RA 3I4LA 5KEEA 1QOAA 4WWPA 3ZO5B 1YN3A 4WWOA 2YU9B 2BH8A 1GOZA 4K5VA 4W9EA 3VA7A 1R9TB 3GTMH 4IPGA 2LMCA 3RLOA 5BMGA 4FA6A 1YJWA 3A4RA 1GO3E 2WS3B 1CA6A 2LGDA 1ACCA 2VH2A 5CBAE 2VUMH 2WWZA 5GQOA 5K36G 3T3NA 3H7PB 1D1KA 4MGKE 1S72A 4LF8Q 4FF4A 2E2IB 1Y14B 4KHPQ 1K51A 3QCAA 3I2ZA 2R92H 5EKIA 4LF6Q 2XRQD 3I4MB 1DOYA 2FMMA 3V96A 3VR3A 4DR5Q 1IGDA 3BYTB 2Y0SG 4M0WA 2KZRA 3TEYA 2FINB 2Z6KC 5T1IA 1PTOH 4OO1G 4N58A 5IYBG
chains in the Genus database with same CATH topology
5G5GA 1UWMA 4JWUC 1NEKB 2QSDA 2F0IA 4LK1C 2BB6A 4ZYSA 4YSYB 1I50B 2Y5CA 4XIGS 2LS01 3S1QB 4EQNA 1MSGA 3IFDA 2K28A 1UEAB 1F9SA 1LTSD 4C3JG 2Q8IB 3OIPA 4RF1A 2AQ3B 2LGIA 2L9HA 4X3TA 2B2WC 1ZOYB 1B9NA 3HUIA 4TKOB 3NPPA 1SXTA 3EFXD 5D14A 4A3KB 3NUHB 3U9OA 1I4XA 1K50A 1STGA 3SK8A 3W5VB 1SYGA 1VDVA 3PO0A 2JSOA 2B2WA 3VR6A 1LACA 4ZKBB 3EVQA 1HQMC 3VRAB 3T4AC 2K33A 5C0XG 2EYFA 2Y0SB 5CR3A 4QUFA 1EU3A 1PRTF 1Z6HA 1SYEA 4KHZA 4IUPA 2INPE 3CQZB 3I9V1 1EIGA 3GTJB 3M3YB 1L0XB 4EE2A 4DAVA 1PLFA 1WSPA 1QOFA 1KFYB 1PGAA 1VZ7A 2NTTA 1HXYD 2ICEC 2WV6D 2NB0A 4QUCA 2EKIA 1XWEA 3QOJA 4BBSB 4OW0A 1J7BA 1F2LA 2IDYA 2JXMB 5IODA 3IAS1 1Q1BA 2JA8B 1PFMA 2IT1A 1V97A 1ONLA 2IX1A 3NVZA 3O13A 1NSNS 3DXJC 4ZRQA 3W2DA 1FCCC 4GDLB 4NMZA 3SVMA 3TEZA 3MVVA 5ISRA 5C4JB 3EA6A 2WXMA 3BDCA 4DXFA 1QJOA 1KABA 3U2SC 4C7YA 1RHPA 3NP8A 2WXHA 1V8CA 3HP3A 2N7JA 4WJWA 1PDXA 1XLQA 3NK9A 1QB5D 2O5JC 2KEEA 1B4OA 5EBCA 4RFBA 3HEJA 2Y3AA 3K59A 3KBGA 1WTOA 3GV6A 5FLXL 2IPKD 3BK1A 5EKLA 1JWAD 5IGFA 2Z4HA 3AE2B 1L4DB 3T3OA 1BCPB 1FXIA 2ENBA 1WRIA 5D3IB 1WD0A 1SNCA 5ELFA 1JORA 2IJ0A 3HOXB 4KN7C 2BTEA 2XWJB 2LFNA 5KGUA 5NUCA 4ZKCB 3NQTA 1VMPA 3URYA 1EM7A 3SFEB 4R8NA 3MC0B 4CBVA 2O5IC 1PMRA 2WNMA 4LK0M 1CM9A 3V05A 1FM0D 4JX1C 5C6AA 3NWTA 2A74C 2F0QA 1E2ZA 1BQQT 3P1MA 2NVTB 5EGTA 1PRTC 2M00A 3PO3B 2CQAA 2MPMA 2NMQA 1VDZA 5FLXE 2QEJC 1T5EA 5EQ0A 2Q8TA 1B2TA 4MHEA 2N9LA 4YWGG 2VUMB 1C8CA 1WTRA 2VB2X 1K8OA 2NTSA 2OF1A 1PYWD 1J7AA 3RD4A 4DN4M 3NTKA 4WAFA 1F9PA 3D6WA 3AEEB 3P20A 1ZXIA 2EELA 1O7LA 1SJHD 2D2CC 1KAAA 4DK1A 3GD7A 3X3MA 4MN3A 2WXGA 1V8QA 3QOLA 2N0SB 1EIHA 2EJMA 2K3UA 1BR9A 1MD2D 2KQ3A 1TWAB 3TP6A 4C3HG 4ZK9B 2XRSD 1VR9A 1FD7D 5COYA 2D5DA 2DWQA 2L55A 1JQYD 3SK4A 4DF7A 4Q2JA 1JCKB 4IDIA 2WXPA 4A3FB 3FAHA 2J53A 4KD3A 5E4WC 5J39A 1TS3A 2ZW1A 4MM3B 2BS2B 3AMZA 1Q10A 4YTNB 2CVRA 1IKLA 3ZJUA 3EROA 3SK5A 1X32A 1C4PA 2PMZB 3BYYB 5CV7A 3AEBB 5IOCA 4NAWB 1NAPA 1QQRA 2K7VA 1E0BA 3M4YA 4GLSC 4KKUA 3AV8A 5BYSA 1SIJA 2HUGA 1JQ4A 1E7PB 5DNFA 3LWEA 1TKGA 3Q8BA 3AE1B 4XE0A 2PMVA 4C7ZA 1Y8PB 3NS1A 3L3OC 2LUMA 1GUOA 3NVYA 4HROA 3A54A 4ARCA 5JVH3 5T8IA 3I73A 1ML0D 1SSNA 1I4PA 4EQPA 3D4RA 1WGKA 2N55A 2BDNA 4B9XA 4H2AA 2MJDA 1HCZA 3AEGB 3MAQA 3OMGA 4PNYA 1TY0A 4LMQD 4XDXA 2SEBD 2QJLA 1EYDA 5D65A 5G3LF 4NZLB 3MWYW 1Z7TA 2I2YA 5C0XI 1YN4A 1CTMA 2F0FA 3DHQA 1BBXC 1JW9D 2WDQB 1KDBA 5BMHA 2YEPF 4HSVA 1LTTD 3BK2A 1II3A 3HOZB 2J7ZA 2V3PA 2AUJD 2F0HA 4HRSA 1OXVA 5I9PA 5JOBA 1EEID 2EY6A 1CK1A 2NN6G 2RBMA 2Z1CA 3HRZC 4F87A 2QMTA 3T16A 1F9RA 1F9QA 1G2SA 3TP8A 3FC4A 4H7BA 4WQMA 1TU2B 3BVGA 1ZYRC 5G5HA 3S14B 1DYQA 2N88A 3CHBD 3PUWA 2V3NA 3BZDB 3GTLB 2KUMA 2NYZD 3VR9B 3TBIB 2AWOA 4B0EA 1A3UA 3VR4A 4A3EB 3WCQA 5IGEA 5JVG3 5C3EB 1HRJA 4Q0FA 3GTMB 1F2RI 1AZPA 3QB3A 1CHQD 3DWQA 1U9RA 2MHVA 1JWSD 1J9OA 2F0GA 3J80L 3GB1A 1XF5L 4NP5A 4US9A 3LX0A 4IFDH 1IL8A 3D4DA 1JOKA 3HS0C 2K32A 3M85A 1E2WA 2F0TA 4LAAA 1QLBB 4FYDA 1NR4A 2L0CA 3OWEB 1FXAA 1S5DD 2XSCA 1F2RC 2CHBD 1F77A 2ZXPA 1HUMA 1ZE3D 2K5QA 2NVQB 3TUOA 3X3NA 1SYBA 3WDNA 1R4QB 1VRAB 2KA7A 1BOSA 4FXGC 4OL7A 4X3SA 4B08A 4G57A 1XYIA 1DOLA 2AUKA 2J4XA 3NRZA 2A6HC 3FILB 3I72A 2AWNA 3I4NB 3GTGB 1HFNA 3AM9A 2SOBA 1TJEA 2DYOA 5LHY1 2DYMA 2WXOA 2BDOA 2W55A 1QNUA 5JAVA 4KKSA 4P16A 1RCVD 4B9WA 1LABA 1E9MA 1EY6A 2NUCA 4V0BA 1FNWA 3ZJTA 1I6HB 1Q12A 3ZYYX 5FO7B 5KNBA 1WYGA 3BWUD 3P42A 4DNTB 4R8IA 2K5DA 2A6EC 2FFKB 1EWYC 2LHEA 3PZ8A 5LL6X 2KCCA 4HMIA 3A55A 3MTSA 1WTWA 3C8YA 1MI0A 3KLSX 1LTBD 2V4DA 2AX5A 3LWUA 3QG1A 2QILA 2KECA 3NBHA 4DA2A 1DZ1A 1I7HA 2DLBA 4WIPA 1VZ6A 1BCPF 5EE9A 3B2GA 1BCPD 2B63B 3AB5A 2XN9C 3SDZA 3AMUA 4HEA1 4KMUC 3BVZA 4R9WA 3VR8B 4NKLA 1JE4A 4K8JA 1SSOA 4USAA 3VA5A 2L12A 1G291 4RH6A 2V0GA 1GB1A 2B8GA 3HOWB 3ND9A 2JXTA 2L32A 1AN8A 5IGCA 4LTUA 2NN6I 3GV3A 4ILWA 4FXCA 1SNQA 1P7FA 1YNNC 2PKOA 4FF3A 2PZTA 4DAYA 1PTOD 1BDOA 2AQ1B 2G1EA 4ITKA 3LB8C 1F2ZA 1STAA 1EZ6A 1M4VA 3HG9A 4FF1A 1CQFA 1EQTA 2JA5B 1EYAA 4FXDA 1MBYA 3NUCA 2FE8A 4H13C 1ZKOA 2RDGA 4L6TB 4E6IA 4HSPA 2RQXA 4KKJA 1L5PA 5JEAH 2OXPA 3A56A 3RPFC 2L1BA 4O42A 4ULLA 2F3WA 1RF2D 1O7ZA 3U52E 4MACA 1EY9A 1QNKA 3P1HA 4A90A 2JEAI 1ZXHA 3Q8AA 3FVQA 1GAQB 3PUZA 4ME5A 2F0SA 2DY7A 3MZ5A 1K52A 4YSXB 1EY4A 1ZXTA 1EY5A 2K01A 3KLSA 3I90A 1O78A 1EYCA 4J6HA 1XXGA 4CJ1B 1HQRD 2IW3A 2WDRB 4GDKB 5M9OA 4DK0A 4U673 3TEWA 4XWWA 2R7ZB 2ZT9C 4C3HB 1YJIA 1YJJA 4QIWB 5C4XB 2LMCB 4NDXA 1A70A 3OPOA 1D6EC 1DXMA 1I6VC 2B2YC 2FJ2A 2QF7A 1G91A 4OZBA 1KH0A 1RWSA 2ACZB 1SE4A 1DD2A 4L23A 2EXZA 4L63B 3U9SA 4PMWA 5BYQA 1HPCA 3RFZB 3EGRA 4A3JB 3OMCA 3OSOA 3K57A 1WTXA 4REZA 1PTOF 1Y8NB 3AEFB 4RHRA 5I2XA 5HURA 2X6LA 4A93B 4KV6A 2W3RA 5H92C 5FR3A 1LT6D 3DEOA 4HTHA 1Y56A 1LT3D 1BXTA 1TT2A 2NWGA 1B9RA 2IX3A 4IUUA 3GTKB 1B50A 1RJTA 1EL0A 2D62A 2INNE 3QJYA 3AE5B 1ZP0B 2EPBA 3K7AB 3NTIA 2EZVA 1JRPA 2G9DA 1AFPA 4CJ0B 3VYSA 3ERQA 3VYTA 2HDMA 4LJZC 1R7SA 2F0NA 3K58A 3RZDB 3J80E 1ENFA 4D2KA 2V4IB 4YTPB 2OT2A 1YNJC 1DOXA 2FMCA 2JYTA 1STNA 5C3WA 3GO5A 2LEKA 4OIKA 4K6LA 3H94A 2KWDA 3I3CA 1H9KA 4BA1I 2KHSA 5DM73 5M3MB 5CMDA 3NZ3A 3QO2A 4NJCA 1J7CA 1OFFA 4KKTA 2K05A 5IGGA 1D5XC 1HZ6A 3SR1A 1VMCA 2GB1A 2RSNA 3E0JA 1STHA 2MP1A 4EGVA 2DN8A 2F0JA 4OO1I 3J7AF 1OXUA 3I57A 4ZLTF 1F2MA 1PTOB 1ET9A 3MA2B 1B9MA 4L2YA 1MGSA 3GTPB 1TWHB 1F0ZA 4JE3B 4IFDI 1SYCA 5CV9A 1TKEA 1S5ED 4KY7A 5A2QE 1RD9D 1SEBD 1IBXA 1JC7A 1UWXA 3MXPA 2CW0C 5EJWA 5T1GA 2ICIA 4HEDA 3S16B 1KRHA 1XCQL 2X69A 2M0AA 1YQ4B 1HA5A 2J42A 4IFDG 2E3TA 1QKZA 2DBYA 4WURA 3FILA 5I2YA 1B53A 4PMBA 4KX6B 4ARIA 1W6KA 4ZQ3A 5CV6A 4HKQA 4C3IG 4IUNA 2WLBA 2F0OA 1YNJD 2JU6X 3A8JE 1X3PA 1DOKA 4CKBA 2WQYB 1TWCB 1A15A 1O80A 3KF8A 1H9SA 3K5LA 1FRDA 1EQVA 2GRIA 2WP9B 2PZWA 3Q22A 1DGJA 2B2UA 2B2TC 1BMLC 2SNMA 2JWUA 4OO1H 1U4LA 4N6EB 2OEDA 4HMJA 2WKDA 4S3SA 3P7JA 4YIJA 1ZPSA 4R3DA 1WCMB 3HRDD 1CFMA 1TS4A 2KOLA 3E5SA 1C48A 5C5LA 2EDGA 2K6AA 4G7HC 4AQ7A 3FDTA 5IT9L 2A69D 3IL8A 4KJNA 4XWTA 1X3QA 1WVLA 3Q23A 4RGNA 2JQRB 1PRTD 3NWSA 4A3MB 2RVLA 1SMYC 2K22A 2JA6B 5M3FB 1MSHA 1QWYA 2D9UA 4ZRZA 2PPBC 4KKIA 2H89B 2TSSA 1V1PB 1ZUD2 3D4WA 1MHHE 4XDDA 3NVVA 5ELBA 1N5WA 5C5MA 4XXEA 1GUWA 3IT6B 1D4BA 1C4QA 4P2CB 3AE6B 1I3QB 2DY8A 2PQEA 5EPKA 3R2IA 1HFGA 1A2TA 5JEAJ 1NR2A 2KAJA 1VZ8A 3KWVA 4J3OD 1TYGB 2WXNA 3ZJVA 4BBRB 1IBXB 1NUCA 1LTID 2XWBB 1XLPA 4BY7B 3JAME 3MXUA 2SDFA 3DM1A 4HCEA 3DEPA 4QCLA 5TSSA 2QKIC 2IGDA 3OHXC 3FRPB 3E9SA 1U4PA 4ZHPA 1JALA 1RTOA 2ONQA 1CT1D 3P75A 5K5PA 4B0MA 2Z4IA 5G3LD 4EQOA 4BWGB 4HCSA 4ID6A 2EYOA 5BYRA 2K5WA 1A6XA 4KHVA 5DM63 2JA7B 2C5CA 1HTLD 2KQ4X 2A68C 3EUB2 1SE3A 3IT4B 2LFIA 1UNSA 2N9KA 2BBCA 1RODA 2WXFA 5E3FA 3IAM1 5I6WA 2WDVB 4F88A 2A5HA 4YTMB 2F0WA 4KI0A 3W5UB 2L83A 1LTRD 2RKSA 1J8IA 2ZW0A 4JWSC 2JP1A 3C1FA 4WH4A 1LTAD 4RCNA 2WAQB 3TEXA 1QG7A 5CV5A 1PTOC 1K83B 1QILA 4A3BB 2FHTA 3Q0AA 2L52A 4BA2I 1FFVA 4NAMA 4DU9A 1JICA 1BO0A 3OOCA 4ZUIA 2PLPA 4MIUA 4XQNA 2GA4B 2K9XA 4QMGA 5ELEA 2BT6A 1EWCA 4KJOA 1EU4A 2QIEB 1AZQA 2HQEA 2EY1A 2F0LA 1SJED 1L4ZB 2JYEA 3TZDA 1SBBB 1YNTE 5HHDG 5KNCA 2F1MA 1SNOA 4K14A 1V1PA 1QOBA 4K2LA 1QCBD 3ONAB 3AE9B 1G6ZA 5HFYA 4XT1B 3KQ4A 3PIO3 4RCOA 5C4HA 2EJGC 3I70A 4XDCA 4Y7NB 1QOGA 2IX0A 2BS3B 1XLOA 1IKMA 1FFUA 1OXXK 3KBXA 4IKGA 5FKAC 2JYOA 4C1NI 4BY1B 3GTOB 1PZID 1ZDVA 4I65A 3T51B 2VZKD 3SHLA 3WOFA 2KCNA 1D2BA 2PNRC 4BS9A 5CGKA 1UGJA 4DXGA 2NZ1D 3AECB 3KWLA 1Z47A 2OEOA 1C78A 2KVMA 1I4RA 1G8ZD 1JOQA 3DWMA 1FCLA 1TR5A 3VQIA 3H8HA 1Y1WB 1S5BD 1WTQA 2W3SA 1PFBA 5IGBA 4L1BA 2Q5WD 5IGDA 1HTPA 3C1EA 1SE2A 5C3XA 5EPJA 5BN3A 1EOTA 1HHVA 3CRKC 3D31A 4C56C 4G4KA 2LJIA 1VJKA 2F0DA 2NBFA 1G2TA 2Y5PA 3OW7A 5J1ZA 1NVID 1PUTA 1WWTA 3I8ZA 2L1AA 2AQ2B 1BUVT 3I91A 2EOTA 1XEEA 3HGBA 3J7YW 2B2UC 3PIP3 2E75C 3TN2A 4GZYC 2X6GA 1XCTL 2H88B 2OHFA 1GUSA 4MH8A 2C9OA 4RGTA 3LXFA 1STBA 2K04A 4WRDA 4ZRPA 4CKCA 4G7ZC 1LLRD 1XX8A 1AYFA 5C2TB 1AEXA 4FXKC 2IL8A 5E4XA 1FNVA 2E2HB 1NI3A 1ZEQX 2RMMA 1KF6B 3RUZA 2I07B 4RNAA 4HN7A 3M7GA 2M19A 4MT5A 1JB3A 4WWMA 1VF7A 1PFDA 5LNK1 2HTME 2O4XA 3RLFA 1NCVA 4FF2A 1C77A 5JPMC 1CZWA 1KDCA 2B39A 4KK7A 3HOVB 3H91A 4K5XA 3S2HB 5FOBB 5BN4A 3J7AV 1XLNA 2NVYB 4UAIA 3S1MB 3HOYB 3S17B 2MEKA 4Z9CB 1OQQA 1RYJA 4XQQA 4EVOA 3R2TA 2E74C 1XO3A 2B2YA 4PQXA 2MH7A 1EY0A 3PUVA 3AE7B 3V2TA 3WOEA 1AW7A 1PRTB 2BW2A 1IYVA 2R93B 1ESFA 5I9OA 1C4CA 1EWHA 3AU7A 4G7OC 2B76B 3AH7A 2A73B 4US8A 2PW5A 2GI9A 1BUIC 1TZOA 3AE3B 4CGYB 1I4QA 2QCPX 5FO9B 1L0YB 2BCOA 5ELCA 3BS1A 1PZJD 5FK9C 5D3DA 1KTKA 3A8IE 2M2LA 2XVSA 4C80A 1KLGD 4K8IA 1SNDA 3NXWA 3PMFA 4DAPA 4OVZA 2PVGC 3T53B 4RHSA 4CJ2C 1T5XD 1D1IA 2O2LD 3AB9A 1EZ8A 1FR3A 3TP7A 1N60A 2HDLA 4TSSA 1GUGA 2R3ZA 2EE1A 4TRDA 1MVKA 1V43A 3S9WA 2E2DC 2D5GA 2XNAC 5A35A 5C4ZA 2IGHA 1FMAD 2B8FA 2EYJA 5AUIA 3L9AX 4FP5D 1GUTA 3MXGA 5LL6S 5C0XJ 1CJEA 3NE5B 1C4AA 2WACA 4RAUC 1IUEA 2X38A 3N52A 1WTVA 3AN1A 1PDQA 3B2FA 4OIJA 3TMEA 2NVXB 5MPOA 3PUYA 1A3TA 5JXVA 1R4PB 2E76C 4KTAA 3K6OA 1FEHA 1B3AA 2A69C 1TKWB 3E6ZX 2WXRA 1GB4A 1F2YA 3DWAA 4ZAIA 5CORA 2BYTA 1TS5A 4ABNA 3SR6A 3FPPA 3TP5A 2BS4B 3BDOA 1T3QA 1N5XA 2PW7A 4N9PA 4ODGA 4X3KA 1HA6A 2KDMA 3DWGC 3MHBA 3S1RB 5E1FA 3CKIB 1YQ3B 4OGQC 1S4ZA 3Q8FA 3W9CB 4PMCA 3RZOB 1JOOA 1IGCA 4XT3B 3P63A 2A68D 2WXKA 4A3GB 5JEAG 5GXGB 5HG2A 5H8YE 3SFDB 2IWHA 2F3VA 2EY5A 1TWFB 2ON8A 4A8XC 1U4RA 1N61A 1H9MA 4Q5VA 1VCIA 4AYBB 4PT5A 2MUYA 2W54A 1GXDC 2TMPA 2B2TA 4HAEA 1YN5A 1SB3C 2CU3A 1GUNA 4IUTA 1LO5D 2EVBA 3NTHA 3AE4B 3CU7A 2NN6H 3S1NB 5HGTA 3KK7A 1FGBD 5ELDA 3BG3A 3GS2A 3VRBB 2SNSA 2WXJA 1TIID 1JWBD 2LHDA 1VF5C 1Q90A 1GHKA 3A7AB 4RGOS 4C2MB 2PW9A 3Q8CA 1K53A 2BA0A 1YMHE 1TY2A 2LY7A 3W1SA 1PGBA 2RA4A 1L6VA 2A6HD 3F2UA 4TQ0A 1PXUA 1SDFA 5F2DA 2PYKA 4IUVA 5EKKA 4F8MA 2QDBA 4RWSC 1TVXA 1ILPA 5CV4A 2VNUD 3TZUA 4KY6A 2WB1B 3H6MA 1H9RA 4IZ8A 2JSVX 4HJGE 2WP8J 2YYZA 2KN4A 2Z8LA 5D7GA 1LT5D 1ROEA 2K0PA 3HZXA 1M8AA 4OZCA 2H1EA 1JMLA 4N9TA 4RA8A 3LYYA 3Q8EA 2PTLA 4M8AA 4CHTB 1DCZA 1LTGD 1WD1A 2K5PA 2E6XA 2K1BA 1U4MA 1S5CD 1CHPD 4ZUJA 4O1NA 4ZOHC 1JWMD 5M5YB 3D3RA 2HCCA 5M5XB 5J22A 3MEHA 4F7XA 1E6EB 4K2KA 3R93A 2F0UA 2MJEA 2VXWA 4C3IB 3DMUA 3TSSA 1AWDA 1OQRA 3BDLA 2RDHA 1QT9A 3DUZA 2PIAA 1ZDXA 1IYUA 3R8BA 3OIQA 1ENAA 3V3XA 1ENCA 2E2JB 3NVWA 1LV9A 4FO2A 1HZ5A 1Q1EA 1OXTA 4JBWA 1CQVA 1VLBA 2EYMA 4RGMA 1L0VB 3AEDB 4XQJA 4KGTA 4ZHOA 3D6CA 3FEWX 4JPSA 1STYA 4RKLA 3M7NA 2BOSA 1TQOA 1KLUD 2B2VA 4IN3A 1Y1VB 4LLGM 3S15B 4AS1A 3PZ7A 2WU2B 4CKEA 2EJFC 2EYHA 1QF6A 3K5NA 3QIAA 3K5OA 4DNRB 3UI3A 3EJIA 2WINB 2L5TA 2R61A 2MJ3A 4A6QA 3N6RA 3M4OB 1D5MC 1RDPD 1BF4A 3Q24A 2MGSA 2H4OA 5DAUA 3T56B 2FBWB 1SYDA 5I6YA 1NENB 5KRUA 1FYCA 1C79A 4A3DB 1PGXA 4IOIE 2CW0D 2WXQA 2L4NA 1N63A 4I7ZC 2EYLA 1E10A 2JE6I 3G7LA 1EEFD 2HCIA 3PUXA 3BIID 4YXDB 1DONA 4DGZA 2YEPB 2FUG1 3VR5A 1QOHA 4KN4C 5A2QL 4PV1C 5IIFA 1D5ZC 1LT4D 4J8QA 3IXSA 1EY7A 4QF4A 2G9HD 3NSWA 4M1UB 3J81E 1CA5A 5HI1A 3HVDA 2ID0A 3SXHA 3HVZA 1ET6A 4KD4A 3D8GA 1XTCD 2KMMA 3CWIA 1BNZA 4WFN3 4P6VF 4RF0A 2WKCA 2PZUA 2L11A 2DNEA 1DOMA 4A9AA 4QB4A 1MPEA 3NQIA 2F4IA 3EQLC 1I4HA 3SEBA 3ITPA 1C76A 1JROA 2JEBI 1Y8OB 3CRLC 5EPLA 5KNDA 2WU5B 1FO4A 2KACA 1PFNA 2J0TD 5C44B 5M5WB 1EFID 3TDQA 1TS2A 3A8KE 3KLRA 3ND8A 1E0ZA 2LKVA 2M9VA 5BN5A 1UAPA 3JAML 2F03A 2BA1A 1ILQA 1FD6A 4XYOA 5I4DA 3P4SB 2PCFB 3K0YA 3ZGZA 2WXLA 2PO4A 5AFWA 5CYUA 2F0MA 3K5MA 3GTQB 3Q6SA 1GHJA 4NW2A 1T6BX 5AUKA 4K5WA 1Q8IA 4C1NK 1QE6A 1IW7D 3IKJA 3RMHA 4L8JA 1RTNA 4OZAA 4U68A 3W3AA 3R3OA 1RFKA 4C3JB 5CC4A 2B2VC 3VYUA 4A55A 4YSZB 2F0VA 3ABVB 1OO9B 5C3JB 3NBIA 3AEAB 4HR7B 3AE8B 1FNUA 2ZXOA 4UDUC 1E2VA 3C46A 3G6JB 1CZGA 1STEA 3C3LA 4IUQA 1P7EA 4DFAA 4TMAB 2EY2A 4JK1C 1RKNA 5EE1A 5JPNC 1SAPA 3FPUB 3A7LA 4XTCS 3L4PA 1A3VA 5E6JA 2W82A 1B44D 4TQUS 4WORA 1S5FD 3VYRA 3H3VC 3N9YC 3C2PA 1TKYA 1Y69U 4IURA 2CJOA 4KY5A 3MFYA 1ESRA 2ZXRA 1IHZA 3UI2A 1SF0A 3IFTA 5DEHA 1ICWA 1SFOB 2HDEA 1I4GA 3H0GB 2CJNA 4N59A 3PO2B 1B1ZA 1KNAA 2MJ8A 3T13A 1UUPA 2DNCA 3QWNA 2SAKA 3GQBA 1K8MA 3S2DB 1AP0A 1W6JA 3J81L 5EE0A 4A3IB 1KNEA 2BE5D 2XIWA 3SE0A 5KYIA 1N62A 1YNND 1WXQA 3CIRB 1DOIA 3IAYA 2BE5C 1V1OA 3PV0A 2IGGA 3OWFA 3LNNA 1GPXA 1HUNA 4H0LC 4IALA 1MHXA 5IT9E 5K36H 1NYRA 3MFGA 4DQOC 5CBEE 3U4EG 4FNFA 1O7YA 3FMCA 2WXIA 3GP7A 4OHJA 2I38A 4HKZE 3HOUB 3J9CA 3Q69A 3HKZB 4IFDJ 5JJZA 5EBDA 5EE3A 3P4RB 1FRRA 4IQZA 2RDFA 1KDAA 3VR2A 5CV8A 1MI2A 2KEDA 1NYQA 4XYQA 5C0XH 3E56A 2A6ED 2PVOD 4RKBA 1SNPA 2VB3X 2EYPA 3H09A 1RM6C 3BVMA 2WIIB 3MJ5A 3MHZA 1SYFA 1SMYD 4TQ1A 1TWGB 3ETRA 4KGSA 1DJRD 1H9JA 1Q3LA 1IW7C 2RPVA 4X3UA 3L7ZC 1A2UA 1OXSC 2J52A 3B9JA 4CQNA 4YT0B 2VZKB 2F0PA 4K6DA 2KJXA 4V190 1FIQA 1JWUD 4J1MA 1PZKD 5KYLA 1BCPC 2Q8RE 1H9SB 3P4PB 4KGRA 1L6UA 1CI3M 2BB5A 1GJXA