1QOAA

Ferredoxin mutation c49s
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTSAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN
publication title Iron-sulfur cluster cysteine-to-serine mutants of Anabaena -2Fe-2S- ferredoxin exhibit unexpected redox properties and are competent in electron transfer to ferredoxin:NADP+ reductase.
pubmed doi rcsb
source organism Nostoc sp.
total genus 25
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qoaA00
1NEKB 1JROA 1FM0D 3NVYA 2QJLA 2JQRB 2H89B 1J7BA 3AE3B 2BT6A 3HRDD 1YJIA 1N60A 2DWQA 1CZPA 2WU2B 4C7ZA 2WP9B 3EUB2 3AEDB 1L6UA 1E7PB 2WS3B 4YTPB 1I7HA 1QLBB 3VRBB 1QOBA 1NYQA 3FC4A 3NVWA 1NYRA 1FO4A 2M56B 3DWGC 4YT0B 1RYJA 4A9AA 1T3QA 1WWTA 1YJJA 2CU3A 3AB5A 1RFKA 2BS2B 3CIRB 1V8CA 1VDVA 3VR8B 1AYFA 1NVID 1EWYC 3SFEB 3WCQA 2WDQB 2E3TA 1TKYA 2PVOD 1XLQA 1OQRA 2PVGC 1TJEA 2Q5WD 1WXQA 3AEFB 3NS1A 4ITKA 5EE1A 2BS3B 1ZOYB 4JWSC 4KX6B 1L5PA 5EE9A 1N62A 3PO0A 1ZP0B 1YQ4B 3NVVA 3ETRA 4HRSA 4JWUC 2CJNA 3RPFC 3AEBB 3AE7B 3HUIA 1IUEA 1OFFA 4IDIA 1YQ3B 4WQMA 1WRIA 1N63A 1NENB 1VLBA 1WGKA 3B2FA 1FRDA 1DOYA 2BS4B 1DOIA 1FXAA 1N61A 2W55A 5H8YE 3SR6A 1CJEA 1WYGA 3AE1B 4US8A 1FMAD 1DOXA 1KF6B 2MH7A 3AE6B 3P4SB 3P4RB 5EE0A 3VRAB 1XLOA 1V97A 1RWSA 2PKOA 5G5GA 2W3RA 4FXCA 2K22A 1TYGB 2MJDA 2K5PA 3AEEB 3AE4B 3DWMA 3FAHA 2ACZB 4YSYB 1XO3A 3AE2B 1J7AA 4N59A 3P4PB 2B76B 2M19A 1TKEA 2G1EA 3AEGB 1N5XA 2WLBA 2Y5CA 2MJEA 1TKGA 1JW9D 1SIJA 1ZUD2 4N6EB 1GPXA 3P63A 3CWIA 3LB8C 2HTME 1E10A 3SFDB 1FXIA 1N5WA 3AE5B 1QOGA 4LTUA 5C2TB 2PIAA 1KFYB 1FFVA 3B2GA 4ZOHC 1QF6A 1JALA 4YTNB 5C3JB 4ZHOA 2WDVB 2N0SB 2DBYA 1OQQA 1XLPA 3AEAB 1AWDA 2AX5A 1SF0A 3P1MA 4YTMB 4N58A 1ROEA 3BIID 1RM6C 2WQYB 1GAQB 2EKIA 2W54A 4YXDB 3AMZA 3AH7A 1FIQA 2LEKA 4US9A 4ZHPA 1PFDA 1XLNA 1ZXIA 1QOFA 1E6EB 3AE9B 3HVZA 1JWBD 1SB3C 2L52A 2L83A 5MPOA 1JRPA 2K9XA 2KAJA 2JX5A 3B9JA 4WWMA 3ABVB 2W3SA 3AV8A 5EE3A 2OHFA 1JWAD 4C7YA 1FFUA 1L0VB 1QOAA 1PDXA 3AM9A 3NVZA 2CJOA 3VR9B 1PUTA 3AE8B 2QIEB 5H92C 3W5VB 1E0ZA 1B9RA 4YSXB 1QT9A 5AUIA 4YSZB 3P4QB 3AN1A 1DGJA 3L4PA 5AUKA 1NI3A 4HROA 2MJ3A 4P6VF 1FRRA 3AECB 1KRHA 2KMMA 3NRZA 4USAA 1VJKA 2WDRB 1R7SA 4JX1C 5GXGB 5G5HA 3LXFA 3KWLA 1E9MA 2WU5B 1F0ZA 2FBWB 4C80A 2H88B 1JQ4A 3ZYYX 3W5UB 1UWMA 1J7CA 3W9CB 1A70A 1L6VA
chains in the Genus database with same CATH superfamily
1ZE3D 4H2AA 3B1LX 4IWQA 4NZLB 3IAS1 2G3QB 4M8NA 1L6UA 4EFOA 1C9FA 4CQNA 1K51A 3IVFA 2KD0A 2KFKA 2PVOD 2PVGC 2LGYA 2AQ3B 3V60A 5BYSA 3QJZA 2LJIA 2M17A 3ZNZB 4JWUC 4BKSD 1VRAB 4HDQA 1H4RA 4IDIA 3FKYA 1D5ZC 5DPRA 1WE7A 1SJED 3AE1B 1FNVA 3RUIB 2J4XA 3L16A 1TY0A 2IO3B 2N1VA 2KANA 4FXCA 1XCTL 3AE4B 5AZGA 2L0FA 3HM6X 3N20C 3NZ3A 1EWCA 4KSLC 4FHKA 1QOGA 2WXOA 5HKHA 4L1BA 2J0MA 3RNFC 3VH4B 1IBXB 2YVCA 2EKIA 5AZHA 4HLEA 4ZHPA 2C7NB 2HJ8A 2M8SA 3L13A 2JY6A 4AWJA 1SBBB 3W1SA 1OGWA 1L0VB 2G45B 4BKSA 1MHXA 2LD9A 4WH4A 3M95A 1ACCA 2AEHA 1UNSA 1ET6A 3CMMB 2MJ3A 4AJWA 4W9CA 3KWVA 3ML8A 4HPLB 4E3CA 4AP4C 2L1AA 1JQ4A 4KKIA 1NEKB 3HRDD 3IG3A 3PLVA 3W2DA 2WS3B 2WXPA 4FLHA 2AQ1B 1UWXA 3NVWA 4KSKC 3U8ZA 4C00A 3DWGC 4ARCA 3MFGA 3RN9C 4FULA 3PRMB 2RDGA 3ML9A 3TJPA 5LLIA 1SE9A 2JZZA 4K1RB 1BUIC 3I57A 1L5PA 3LJ3A 1YQ4B 4WWPA 1YQ3B 4HXDA 1N63A 2DYOA 4JQWC 4YL8A 4GXBA 4ZRQA 3WA0A 2XBBC 2W55A 2IY0B 2MSED 3CSTA 2QCZA 2L3ZA 2IDYA 3BWUD 3T8MA 2M0XA 3C19A 3PGEA 2LMCA 4RGNA 3DBLI 1J0GA 2LASA 1IGDA 5HG2A 3M3JA 1N5XA 3QIJA 3CWIA 1FXIA 5G55A 1FFVA 1NDDA 2J42A 2QHOA 3PLUA 4A3PA 4ZRPA 2NPTA 2C7MB 3X0WA 2LZ6A 1OQQA 4JIOU 3M63B 2MRPA 2YEPB 3AH7A 1KOTA 1EM7A 1ZXIA 3ZUNA 1V81A 1UD7A 3HVZA 2KQ4X 1D4BA 2WXIA 1V1OA 2WX1A 4EZLA 1OEYJ 3JVZX 3ZDTA 3N9YC 2V3PA 2CJOA 4IOIE 4KGTA 1HTQA 5JZEB 4EEWA 1R7SA 5GXGB 4BOZB 1GB4A 4OHJA 3UGBB 1UWMA 1MJDA 4QAYA 2JWUA 1JROA 2KLCA 2BGFA 5TSSA 1WH3A 2V3NA 1VZ6A 2JF5A 4BBNC 2KTRA 2ZNVB 1WX7A 1ZKHA 3I63C 4LCDE 3TUOA 1ESFA 1T3QA 3W1YA 2IO0B 1AARA 3TSSA 3ZRCA 1TT5B 1UBIA 4DK5A 2INCC 2MWSB 2RDHA 1WXQA 2I2YA 4HDOA 4P1BC 3EGRA 3PZDA 1KLGD 3V6CB 3A9JB 1SGHA 4MDKE 1DOYA 2BBCA 2BS4B 3DHHC 4GDLA 4A90A 1CJEA 1P0RA 4C4VA 2ZNVC 1XLOA 2W3RA 2LUEA 4Q2JA 2MP2B 1XO3A 3GZNB 1JMLA 2GBKA 1UGMA 2CR5A 2TSSA 4DHZB 3P2BA 1E10A 2V4LA 2EKEC 1GG3A 2I1KA 2UU7A 3TEZA 1FCCC 3ZO5B 4ARIA 1MG4A 4I6NB 4K7SA 2DBYA 1WI0A 2GLSA 3L08A 2AX5A 3O65B 1L7YA 1A5RA 1T0YA 2PW9A 2BQQA 4US9A 3AE9B 3OAWA 5MPOA 1LQBA 4FJZA 1PQSA 2W3SA 2VZKD 3WANA 3AI5A 3WAMA 1R4MB 1E8ZA 4MGZE 1EU3A 1QZEA 2DYBA 3A9KB 3P4QB 1TZ1A 4B0EA 2QILA 3DOWA 1KRHA 3DCGA 1V6EA 4GDKB 5D7GA 2HDEA 2K3UA 1E7PB 1WGYA 1WR1A 1N60A 1SJHD 2LGIA 1VZ8A 4XWWA 4ACFA 1NYRA 2V1YA 4ZRIA 1TS2A 2N9LA 1I4GA 4LNOA 3WAPA 1VCBA 3U2SC 2ZVNA 2C7HA 2ASQA 1GC7A 1L4ZB 2BS3B 4JWSC 2SEBD 4WWOA 3RPFC 1VD2A 3H1UA 2J52A 2BWFA 3QWZB 2FAZA 1WYGA 1FEHA 4JPSA 3V05A 2GB1A 4B6WA 3RNAC 2B76B 4N6EB 3ZVVA 1GPXA 4TSSA 3SFDB 3Q3MC 3L10B 4N9F4 2O6VA 2GBJA 3RYTA 4RF0A 1WRDB 3RZWC 4BZAA 1WGDA 1SF0A 3P1MA 1BT0A 2KVRA 1U4AA 1S1QB 3PSEB 3BVMA 4J6IA 1PFDA 1YQBA 2JYEA 2K9XA 1HE8A 1WYWB 3QA8A 1GOZA 1DYQA 1WMHA 3U52E 2KYWA 1KJTA 2BKRB 1FRRA 3VTVA 3NZUA 1ZXHA 4MSMB 4S0RA 5G5HA 1F77A 4MH0E 4BKTA 3W5UB 2MA9B 3VFKA 3E56A 3EFUA 3DQVA 1QKZA 2E6XA 4DQOC 5TR5A 2D3AA 3RULA 1NYQA 3KUZA 4AS1A 3GZNI 2RD0A 1FO4A 2WX0A 1RYJA 4A9AA 1YJJA 1MFWA 3AB5A 3MHSD 3SDLC 3PZ7A 1AYFA 3ZDMC 2BF8B 4BKGA 1XLQA 2RSUA 4KX6B 3H7PB 2M4NA 4GLSC 3GE3C 2D10A 2CJNA 2KXJA 2DAFA 2KN5A 2D3BA 3Q8FA 2LVQA 1G6JA 2IBIB 2MH7A 2UYZB 4RGOS 4NNJB 2K8CA 3RNEC 3RNGC 2FIDA 2FCMA 3DWMA 1R4MI 5CTRC 3PPAA 2KLGA 3ZJVA 4HCPB 5D6JB 4YTNB 4WIPA 2KHWB 2N1WA 1I4QA 3APFA 4LLGM 1ROEA 1F1HA 3BIID 4XGAB 2KFKB 3QX1A 1JWBD 2L83A 2L52A 1WGGA 1WY8A 4A20A 1TBEA 1V80A 2OHFA 1V1PA 4BBNF 5CX3A 1RAXA 2QIEB 5H92C 2DNFA 2YLMA 2DX5B 2K0PA 2BB6A 5IA7A 2WDRB 1MPEA 3ZGZA 2WXKA 1LFDA 3N30A 4IWPA 1K52A 3IHPC 2V0GA 2QJLA 5CHVC 4F1SA 1YJIA 2DWQA 2WGSA 3EUB2 4ZYNA 4MSQB 5D3IB 3HHMA 1KH0A 2V4IB 3APCA 3VH3B 3PHWB 5BMHA 4ZRJA 4KVGB 1OQRA 3EECA 1F2RC 4M01A 4HKQA 1T0QC 3ETRA 1OFFA 3IT6B 3OJ4B 3O13A 2XK5A 3R8BA 1M94A 1T0SC 3VDZA 1N61A 2FNJB 3DVNU 1LM8B 3VRAB 2NBVB 4NAMA 1WXVA 3K9OB 1WGHA 4G0NB 2K5PA 1WM3A 3AU5A 2ACZB 3NOBA 4YWGG 4RGTA 2M19A 3NZSA 4LNNA 4S17A 4ANWA 2MJEA 1TKGA 4HCNB 3T9LA 2MHJA 3VXWA 2IYDB 5FK9C 1WE6A 4XYCA 2NVUI 2K8BA 3W1SC 1MHHE 1MI0A 3PT2B 4LNKA 4WJPA 2DZKA 1EUVB 1XLPA 2R2OA 2WXFA 2JSVX 5E6NA 3ZTDA 3Q3JA 3TEXA 2FUHB 2LXCA 1Z2MA 2KACA 5DPSA 2KWDA 4P16A 3ZLZA 1UBQA 4IUMB 3PVLA 1E8YA 1PDXA 1RRBA 4NPNA 2CU1A 2K1FA 2FE8A 3PTFC 1B9RA 1HZ5A 1L0XB 3PRPB 1GUAB 2IJ0A 5G2NA 2L7RA 5JH5C 1E9MA 2IGGA 4M00A 1XD3B 3NVYA 3Q2AC 2G4SA 2BTEA 2J53A 2ZEQA 4J3OD 5FR3A 3BVGA 3U7DA 3KLSX 4XE0A 1QQRA 4II2B 3NHEB 4R3DA 1YN5A 2WXQA 4NQKE 2I1JA 2ONQA 2LRUA 5EE9A 3UIPB 5CHFA 4HJGE 2BPSA 3AE7B 4IM3A 2LVOA 2B3AA 2D3GA 4PYUA 5T8IA 2IZVB 2IO1B 1B1ZA 1DOXA 1TZOA 3AE6B 3P4RB 2JUOA 1V5TA 4NJ6A 4PS8A 1C4AA 3FAHA 3VVWB 3AE2B 3BK1A 1VZ7A 3EA6A 2FCQA 2WLBA 1L0YB 3AEGB 1JRUA 1JW9D 4WJQA 3SEBA 2CHZA 4ANUA 1HXYD 1F2RI 2KTRB 2PIAA 3NUHB 2WDVB 2N9XA 2CHXA 4BOSC 1CMXB 4L2YA 1GAQB 2JZPA 2LEKA 4DHJD 1XLNA 2D5GA 3IXSA 4OZAA 3K9PB 4WJOA 1JWAD 3MHZA 2ZW0A 1E7VA 1E90A 1PUTA 4A8XC 4FA6A 3ZRFA 3DBHB 4C4VB 4LK0M 3J9CA 1RLFA 4NJ7A 2C9WB 3T3OA 2N9PC 2N7DA 1WXAA 2WYQA 3NJTA 3KW5B 3PRZA 2PPHA 1X1MA 1J7BA 1V9JA 4KDLB 2KJHB 3UI3A 3FC4A 3MJ5A 1HZ6A 1R4NB 3CIRB 2CU3A 1RFKA 2K6DB 1L4DB 3QHTA 2AL3A 2KQSA 3R66C 3NS1A 2KK8A 2JYTA 4KIKA 1WF9A 2NCNA 2ZCCA 2OOBB 1WFYA 4WQMA 1ZW7A 3B2FA 2O2VA 1QILA 4IC7B 4HKZE 1J19A 1V97A 2PKOA 3UQBA 2K22A 3EC8A 2NTSA 2KT7A 1P7EA 4KV2A 5JXVA 1P7FA 3MJWA 2BB5A 1JCKB 3ZXRA 3X23A 1ZUD2 2J0KA 1WIAA 2DYMA 2KDIA 2OJWA 1OTRB 2FCNA 2EELA 2PTLA 2KMCA 1MG8A 3CSFA 2KOXA 1TTNA 3CF6E 2Y3AA 1TS3A 1WX9A 3KUCB 2GMIC 2W54A 4MM3A 1Q1OA 3FILA 2K8HA 3TCAA 4XZ4A 3MC9A 1FFUA 3DHIC 3MTNB 1D5XC 4ZRKA 1E0ZA 2LHDA 3BK2A 1P9DU 1WJUA 4A3OA 1N6ZA 2KMMA 2K6QA 2LGXA 2WWZA 4MJSA 5CHWA 3KWLA 4C80A 2JPHA 1GB1A 5FR6A 3R2IA 5GMVA 2IPKD 3PV1A 1QLBB 1LGRA 4K3BA 2O6VB 1WZ0A 4FHJA 2N9EB 1YJ1A 4DWFA 4RMAA 4TMAB 1ISNA 3SFEB 1BXTA 3WCQA 2MBOA 1XCQL 1TJEA 3AEFB 1KTKA 4W9EA 1FXTB 4W9IA 3NVVA 3KUDB 4B9KA 2G4DB 2GBNA 1SIFA 3KYDD 4RM8A 5C23A 5DCNA 1FCLA 1FXAA 2G9HD 4MEMA 2QSDA 2Z0DB 3RCZA 3I3TB 2RR9A 4M02A 4WQOB 1T0RC 1D3ZA 2QEJC 1NI2A 3DBHI 3RMKC 4E74A 3OG5A 2EMSA 4GMVA 1SE4A 2GRIA 1UUPA 4CO7A 4EOYA 3UIOB 3APDA 4YTMB 4LNIA 3AMZA 3Q69A 1MVKA 2QC8A 2DLBA 1PGAA 3H8HA 1R4NI 1XT9B 4PK1A 1WJNA 1J8CA 2FUG1 2JRHA 2C5LC 3A1QA 3IAM1 4X57B 3ZTCA 4IW0A 2M0AA 2KC1A 4NY0A 2VH2A 1PYWD 4JE3B 1Q10A 3UINB 5D94A 4JX1C 4TUUA 2KWCA 3ZYYX 3OWEB 1FM0D 2JQRB 1C4PA 1WR6E 2LUMA 4IG7B 4G3XB 1WX8A 3ECIA 2DHZA 4EUTA 3N1YC 2N7JA 1N62A 1ZP0B 1XQQA 2L00B 4OVZA 4A55A 4WJNA 4XX5A 3VUXA 1IUEA 3Q8BA 1TS5A 1OEYA 1WRIA 5AZFA 1FRDA 3RD2A 1Z5SB 1Y8RC 2MBHA 5EE0A 4P7IA 1TYGB 1YD8U 3B08A 3QK0A 4OZCA 3U30A 1J7AA 3ZW3A 3LYYA 4G50A 1TKEA 4HJKA 3U7ZA 1SE3A 1V5OA 3TBLD 3LB8C 5AEKB 2DAJA 2UWQA 4LTUA 1SXTA 3B2GA 2WNMA 2LXAA 1FNWA 3ZNGC 1YNTE 1ET9A 2MBBB 4W9DA 1M4VA 4ZHOA 2N0SB 2LWPA 2GBMA 4CHKA 3NS8A 4KKJA 3ONSA 3ENEA 4M0WB 2JRIB 3JSVA 2WQYB 1YOVB 4FADA 4YXDB 2WXHA 1FIQA 2RPVA 4M8MA 3WAOA 1JWSD 1IYFA 1SB3C 3EFCA 5E6JA 3VTWA 3H9DA 3R7QA 1I4HA 4DDID 3P42A 1XF5L 2XK5B 3AE8B 3Q14C 2DENB 5L83A 1SSNA 1HEZE 2KO3A 5AUIA 3E9SA 4F7ZA 1WXSA 2Y5BB 2ZZPB 3AN1A 4XDCA 5AUKA 2KDEB 1CK1A 2MX2A 3QC8B 4HVBA 2Z8LA 1J7CA 3W9CB 4F8CB 4D2KA 4AOFA 1BMLC 2AL6A 4HPMB 2R61A 2ICIA 2YEPF 2ZPNA 2CKHB 4I6PA 3DBRB 2GBRA 1WGRA 4RNAA 2MEKA 3VR8B 4K7WA 2VRRB 3C0RB 2LHEA 2KX0A 1WZ3A 1WJ6A 2HE7A 2WDTB 2WHIA 3BY4B 1SE2A 3Q8EA 4GGQA 3GOEA 3TIXA 1L2NA 3I9V1 2KVZA 1FNUA 1P1AA 2C60A 5KHQA 1YX6B 2CHWA 2KDMA 3WALA 1UF0A 2KJ6A 1OQYA 3I5JC 3RNBC 4DXAB 4HWIB 2BVCA 1GC6A 1YIWA 3R7RA 2K25A 4NAWA 1E5WA 4RF1A 2EMTA 3KYCD 1P3QU 5D3DA 3V62A 4ZOHC 4BAXA 4LDTD 4XC2A 2PEAA 2WXLA 5HFYA 3GS2A 3KVFB 4W9LA 1TGZB 2DZIA 1T6BX 2X8XX 2LVPA 4G11A 3QQ8B 2BYTA 4FJVB 1UELA 4FBJB 2QMTA 3VUWA 5DPTA 4C7YA 1QOAA 2J0JA 3URYA 3NVZA 4BFRA 2HJ1A 2JU6X 4MGIE 2NBUA 3BZDB 3ZNHB 3DVNV 2N9KA 3GP7A 2W9NA 3PS6A 3WIMA 2R2QA 4USAA 1I4RA 3DVGY 1V2YA 4DBGA 2RDBC 2LRWA 1EO6A 2FCSA 1L6VA 2KTFA 5LXIB 4OVUA 1P98A 3AE3B 2BWES 1KM7A 4ICUA 1T5XD 4YTPB 1I7HA 3VRBB 4GIVA 5HI1A 2LI5A 3R2TA 2PLPA 1ZDXA 2HTHA 3TEYA 4IKGA 4ZYSA 1PGBA 3SD5A 4IWOA 2BYEA 4KGSA 5JHAA 3RZFA 2MBQA 4ANXA 1Y56A 1VLBA 5H8YE 1TS4A 4DXGA 2NPTB 2ZVOA 3MC8A 4ASWC 1AN8A 2REXA 1STEA 2LGSA 2JXTA 3L17A 4YSYB 4PYZA 2INNE 3DHGC 2DZJA 1RFAA 5IAAC 4XDDA 5BYRA 4B0MA 1QF6A 1ZDVA 3B0AA 3AEAB 2ZPYA 2AWTA 1RM6C 2IO2B 4TV3A 3DBRI 4W9KA 3ZXVA 2KWUB 2JWZA 4KIKB 2NBWB 4MT5A 3AU4A 3B9JA 1FPYA 4WWMA 3VHTC 2BKFA 2WXMA 2D3CA 4DHJB 4DDGD 1Q0WB 2JT4B 2DZMA 3W5VB 4LJPB 2O2VB 3PZ8A 4DHZE 5FKAC 4YSZB 2N7EA 3BINA 3AXCA 1EF1A 3IFWB 1E8XA 3NRZA 4WAAA 5J18A 2WU5B 2WXGA 4MELA 1GJZA 4XWTA 2BT6A 4C7ZA 2WP9B 1YN3A 2JVCA 1CQVA 2KNBA 4RGMA 1I35A 2WXJA 2I38A 4GDLB 3L0WB 1HQRD 2BS2B 1IBXA 2KZRA 5HHDG 3T3NA 4MM3B 2E3TA 1TKYA 2Q5WD 3FILB 5EE1A 4RCOA 2GOWA 4LNFA 3U4EG 2WXNA 4HK2A 4IM2A 4GOCA 4RM9A 1D5MC 1F9JA 3H7SA 4JL9A 1NENB 1WGKA 4ZDVA 1DOIA 3SR6A 4US8A 3GB1A 1FMAD 3JW0X 3IT4B 3P4SB 5C1ZA 2IY1B 3BYYB 4MH8A 4UDUC 3AEEB 4K7UA 4MJSB 3MC0B 2X38A 2Y5CA 1GNUA 3H6NA 3MP9A 3N32A 1KFYB 1V49A 3IBEA 1JALA 1EF5A 4K81A 1LO5D 3KQ4A 3RFZB 1AWDA 2ON8A 3HIZA 1E8WA 3N3KB 5IO9A 3V61A 2NS5A 2XEWA 3JYUA 3ALBA 4BVUC 2WXRA 1HA5A 1JRPA 2KAJA 4JGHB 1C1YB 3ABVB 2Z0EB 2N4FA 4KZ0A 1XXGA 4ICVA 3VR9B 2SAKA 1DGJA 3DPDA 3Q8AA 3Q6BA 2RPQA 1JWUD 1K53A 4AUQC 3V6EB 2BYVE 4JLCA 1I4XA 2MLBA 3NG0A 3ZIMA 3TMPB 3QCAA 1CZPA 3VQIA 3AEDB 4PS7A 5IN7A 2NTTA 1YMHE 3VUYA 1QOBA 3UQAA 2AQ2B 4HPPA 2VZKB 2W82A 3LDZE 3RT3B 1ZPSA 2GI9A 2VH1A 4GSWA 1HTOA 4K3CA 2NMQA 2L8JA 1NVID 1EWYC 3M62B 4MGYE 1PGXA 4URKA 1LXDA 4AQ7A 3GE8C 4AJYB 4EZKA 2PE9A 2XNAC 4PT5A 5BO4B 4A6QA 4CYEA 1TIFA 3A1QB 2LGDA 5KHOA 1WSPA 3UF8A 4MACA 1JWMD 3HK0A 3PHXB 3S2AA 1RWSA 1UH6A 5G5GA 3QARA 1I42A 3OLMD 3P4PB 3R3MA 3RI7C 4EE2A 4C56C 3P63A 4TKNA 2ZCBA 5L95C 1WMHB 3Q3OC 3TL5A 1XEEA 2OJRA 3BYTB 1NBFC 4N58A 2V3SA 3RNCC 2J7QB 3D32A 3QAQA 3VAWA 1SEBD 3N1ZC 2O6VD 3A9JA 2PMVA 2KQ7A 2RGFA 4YSXB 1D6EC 1QT9A 3V3XA 3L54A 3Q3NC 1WJ4A 3L4PA 4HROA 4P6VF 2MP2A 5J17A 5DPWA 4O1NA 1F0ZA 1UZXB 2L32A 5IOIA 4GN1A 4I6LB 4W9JA 5LXHA 1EU4A 5BMGA 2L76A 2K39A 5E6PA 4W9HA 3Q8CA 5LNK1 4FJYA 1UGJA 4GB9A 3DDCB 5I4DA 1YX5B 4YT0B 1AW7A 2XN9C 2MQJA 1C3TA 4FN2A 4EKUA 4EZJA 3JSVB 1TY2A 3A33B 2NR2A 4KGRA 1ZOYB 2FIFA 4W9GA 4HRSA 3AEBB 4OW0A 1S3SG 3DVGX 1F52A 1VR9A 2KMAA 3A9KA 3ZJUA 2L05A 2Z59B 4TQ0A 4OVVA 2KDFB 5JHBA 3HM3A 4DXFA 4GDKA 4N59A 2KKCA 2RMMA 2G1EA 2KN4A 2OEDA 4NQLB 4W9FA 1C76A 4NJCA 1N5WA 1KLVA 5C2TB 1V1PB 4II3B 2PE6B 4RH6A 3A4SC 3KH0A 4KZCA 2BYFA 2ZJDA 2V9HA 5BMIA 1FD6A 2D07B 3ZKJC 2JXXA 1WXMA 1C79A 1H8CA 1E6EB 1QOFA 1C77A 2JX5A 5D2MB 2Y5PA 3AM9A 3DBSA 4WWNA 1K50A 3C8YA 1Q5WB 1YN4A 5BYQA 2A5UA 4P1CC 1VJKA 1E7UA 3LXFA 2FBWB 2LJ5A 3ZNID 2KFJA 1V86A 2H89B 4NAWB 3Q3FA 2KDBA 4E71A 4TQ1A 2WU2B 3ZQ4A 2KX3A 3EHVA 2IGHA 2INPE 3N1XC 4RFBA 5EDSA 2M56B 1IGCA 1ENFA 1WWTA 2KJRA 1V8CA 1VDVA 4MGKE 2PJHA 3SHQA 2WDQB 2ZW1A 3HVDA 4ITKA 2IGDA 1C4CA 4OZBA 3PO0A 4GU2A 3ZJTA 3BVZA 3PREA 2QDFA 4HEA1 3HUIA 2MBEA 4REZA 2CS4A 2BW2A 4LJOB 1KF6B 3VTUA 1K8RB 1KLUD 3NY5A 4KDIC 1IPGA 2LFIA 2A4ZA 3OJ3A 2M1MA 1SIJA 5IP4D 4WAFA 2HTME 3AE5B 3AULA 1ZGUB 5J2RA 5C3JB 2MCNB 4L23A 1WM2A 2HD5B 4LDTB 4PS3A 5E6OA 4IM0A 2MW5A 1I4PA 2INDC 3H7PA 3A4RA 2D11A 1C78A 1IP9A 3AV8A 5EE3A 3SU8X 4ANVA 2KC2A 3DBLB 4B95A 3TEWA 2JZ3B 2KWVB 2AYOB 1NI3A 2D2QA 4M0WA 2L0TA 3AECB 4WURA 2H88B 2MJDA 5IKCM 1A70A
chains in the Genus database with same CATH topology
1ZE3D 4H2AA 4NZLB 3E56A 3R2IA 4XWTA 2BT6A 1QKZA 2E6XA 3IAS1 4C7ZA 2IPKD 2WP9B 4DQOC 1L6UA 1YN3A 1QLBB 1C9FA 1CQVA 1NYQA 4RGMA 4AS1A 2WXJA 2I38A 4GDLB 1FO4A 1HQRD 1RYJA 4A9AA 4CQNA 1YJJA 3AB5A 2BS2B 1K51A 1IBXA 4TMAB 3PZ7A 1AYFA 5HHDG 1BXTA 4MM3B 3SFEB 3WCQA 2E3TA 3T3NA 1TKYA 1XCQL 1XLQA 2PVGC 2PVOD 1TJEA 2Q5WD 3AEFB 3FILB 2AQ3B 5EE1A 1KTKA 5BYSA 4KX6B 4RCOA 3U4EG 2LJIA 4GLSC 2WXNA 3NVVA 4JWUC 2CJNA 1VRAB 1D5MC 4IDIA 1NENB 1WGKA 3Q8FA 1D5ZC 1FCLA 1DOIA 1FXAA 1SJED 3SR6A 3AE1B 1FNVA 4US8A 2G9HD 1FMAD 2J4XA 3GB1A 2MH7A 3IT4B 3P4SB 4RGOS 2QSDA 1TY0A 3BYYB 4FXCA 1XCTL 4MH8A 4UDUC 3AEEB 3AE4B 3DWMA 3MC0B 2QEJC 2X38A 2Y5CA 3NZ3A 1SE4A 1EWCA 2GRIA 3MP9A 1QOGA 1UUPA 2WXOA 1KFYB 3ZJVA 1JALA 4YTNB 4WIPA 4L1BA 1LO5D 1I4QA 3KQ4A 3RFZB 1AWDA 4LLGM 2ON8A 1IBXB 4YTMB 1ROEA 3BIID 2EKIA 3AMZA 3Q69A 4ZHPA 1MVKA 2DLBA 1PGAA 1JWBD 2L83A 2L52A 1HA5A 2WXRA 1JRPA 2KAJA 3H8HA 1SBBB 3W1SA 3ABVB 2OHFA 1L0VB 1V1PA 2FUG1 1XXGA 3VR9B 2QIEB 5H92C 1MHXA 3IAM1 2SAKA 4WH4A 1ACCA 2M0AA 1DGJA 1ET6A 1UNSA 2K0PA 3Q8AA 2BB6A 1PYWD 1JWUD 1K53A 4JE3B 2MJ3A 1Q10A 3KWVA 2WDRB 4JX1C 1MPEA 3ZGZA 2WXKA 2L1AA 1K52A 1I4XA 3ZYYX 1JQ4A 3OWEB 2V0GA 4KKIA 1NEKB 1FM0D 2QJLA 2JQRB 3HRDD 1YJIA 2DWQA 1CZPA 3EUB2 3VQIA 3AEDB 3W2DA 1C4PA 2NTTA 2WS3B 1YMHE 2WXPA 1QOBA 2AQ1B 2AQ2B 1UWXA 2LUMA 3NVWA 2VZKB 2W82A 5D3IB 3DWGC 1ZPSA 4ARCA 3MFGA 2GI9A 1KH0A 2V4IB 2NMQA 2RDGA 1NVID 1EWYC 5BMHA 1OQRA 1BUIC 1F2RC 3I57A 4HKQA 2N7JA 1L5PA 1PGXA 1N62A 1ZP0B 1YQ4B 4OVZA 3ETRA 4A55A 4AQ7A 1IUEA 1OFFA 1TS5A 1YQ3B 2XNAC 1WRIA 3IT6B 3Q8BA 4PT5A 3O13A 1N63A 4A6QA 2DYOA 3R8BA 1FRDA 4ZRQA 1N61A 2W55A 1WSPA 4MACA 1JWMD 3VRAB 4NAMA 5EE0A 1RWSA 2IDYA 3BWUD 5G5GA 1TYGB 2K5PA 4OZCA 2LMCA 4RGNA 2ACZB 4YWGG 1J7AA 1IGDA 5HG2A 4RGTA 3LYYA 3P4PB 2M19A 1TKEA 1N5XA 2MJEA 1TKGA 3U7ZA 1SE3A 4EE2A 4C56C 3P63A 3CWIA 3LB8C 5FK9C 1FXIA 4LTUA 1FFVA 1SXTA 3B2GA 2J42A 4ZRPA 2WNMA 1FNWA 1MI0A 1MHHE 1YNTE 1ET9A 1M4VA 1XEEA 4ZHOA 2N0SB 1OQQA 1XLPA 4KKJA 2WXFA 2JSVX 3BYTB 4N58A 2WQYB 2YEPB 4YXDB 3TEXA 2WXHA 3AH7A 1FIQA 2RPVA 1EM7A 1ZXIA 2KACA 1JWSD 3HVZA 1SB3C 1SEBD 2KQ4X 1D4BA 5E6JA 2KWDA 4P16A 2WXIA 1V1OA 1I4HA 2PMVA 1PDXA 1XF5L 3N9YC 3P42A 2V3PA 2CJOA 2FE8A 4IOIE 3AE8B 1SSNA 1B9RA 1HEZE 4YSXB 4KGTA 1D6EC 1QT9A 5AUIA 3E9SA 3V3XA 3AN1A 1HZ5A 3L4PA 4XDCA 5AUKA 1L0XB 4HROA 4P6VF 1CK1A 2IJ0A 1R7SA 5GXGB 1GB4A 4O1NA 1E9MA 1F0ZA 4OHJA 2L32A 2IGGA 1UWMA 2Z8LA 1J7CA 3W9CB 4D2KA 1BMLC 1EU4A 1JROA 2JWUA 3NVYA 5BMGA 5TSSA 2V3NA 2R61A 2ICIA 2YEPF 1VZ6A 2BTEA 2J53A 4J3OD 5FR3A 3Q8CA 5LNK1 3BVGA 1UGJA 3KLSX 5I4DA 3TUOA 4YT0B 1AW7A 1ESFA 2XN9C 4RNAA 4XE0A 1T3QA 1QQRA 3TSSA 2MEKA 3VR8B 4R3DA 1YN5A 1TY2A 2WXQA 2RDHA 1WXQA 2LHEA 4KGRA 2I2YA 1ZOYB 2ONQA 5EE9A 3EGRA 1KLGD 4HRSA 4HJGE 3AEBB 1SE2A 3Q8EA 3AE7B 4OW0A 5T8IA 1DOYA 2BBCA 3I9V1 1FNUA 2BS4B 1VR9A 1B1ZA 4A90A 1CJEA 1DOXA 1TZOA 3ZJUA 3AE6B 2KDMA 3P4RB 1XLOA 4TQ0A 2W3RA 4Q2JA 1C4AA 3FAHA 1XO3A 4DXFA 3AE2B 3BK1A 1JMLA 4N59A 2RMMA 1VZ7A 2G1EA 3EA6A 3AEGB 2KN4A 1L0YB 2WLBA 2OEDA 1JW9D 1C76A 2TSSA 4NJCA 1E10A 3SEBA 1N5WA 1HXYD 1F2RI 4RF1A 5C2TB 1V1PB 2PIAA 3TEZA 1FCCC 4RH6A 5D3DA 4ZOHC 3NUHB 2WXLA 5HFYA 4ARIA 2WDVB 3GS2A 2DBYA 5BMIA 1FD6A 2AX5A 1T6BX 4L2YA 1GAQB 2PW9A 2BYTA 2JZPA 2LEKA 4US9A 1C79A 1XLNA 3AE9B 1E6EB 1QOFA 1C77A 2D5GA 3IXSA 4OZAA 5MPOA 2QMTA 2JX5A 2W3SA 2VZKD 1JWAD 4C7YA 1QOAA 3MHZA 3URYA 2ZW0A 2Y5PA 3AM9A 3NVZA 1PUTA 4A8XC 2JU6X 1EU3A 1K50A 3C8YA 3BZDB 4LK0M 3P4QB 3J9CA 4B0EA 2N9KA 3GP7A 2QILA 3T3OA 1YN4A 5BYQA 1KRHA 4USAA 1I4RA 1VJKA 3LXFA 4GDKB 5D7GA 2FBWB 2HDEA 2K3UA 1E7PB 1L6VA 2H89B 1J7BA 3AE3B 4NAWB 1N60A 1SJHD 4TQ1A 2WU2B 2LGIA 3ZQ4A 1T5XD 1VZ8A 4YTPB 1I7HA 3VRBB 2IGHA 2INPE 4XWWA 3UI3A 3FC4A 3MJ5A 1HZ6A 1NYRA 4RFBA 1TS2A 2M56B 2N9LA 1I4GA 1IGCA 1ENFA 1WWTA 2CU3A 3CIRB 3R2TA 1RFKA 5HI1A 3U2SC 1V8CA 1VDVA 1ZDXA 2PLPA 1L4DB 3TEYA 4IKGA 2WDQB 4ZYSA 2ZW1A 1L4ZB 1PGBA 3HVDA 4ITKA 3NS1A 2BS3B 2IGDA 4JWSC 2SEBD 1C4CA 2JYTA 4OZBA 3PO0A 3ZJTA 4KGSA 3RPFC 3BVZA 4HEA1 3HUIA 1Y56A 4WQMA 4REZA 1VLBA 2J52A 3B2FA 1QILA 5H8YE 1TS4A 4HKZE 4DXGA 1WYGA 2BW2A 1FEHA 1KF6B 4JPSA 3V05A 1V97A 2PKOA 2GB1A 1AN8A 1KLUD 2K22A 1STEA 2JXTA 2NTSA 1P7EA 4YSYB 2LFIA 2B76B 5JXVA 1P7FA 2BB5A 2INNE 1JCKB 1SIJA 4N6EB 1ZUD2 1GPXA 4TSSA 4WAFA 2HTME 2DYMA 3SFDB 3AE5B 5BYRA 4XDDA 4B0MA 2EELA 2PTLA 1QF6A 5C3JB 1ZDVA 4L23A 4RF0A 3AEAB 2Y3AA 1SF0A 3P1MA 1TS3A 1RM6C 2W54A 1I4PA 3BVMA 3FILA 1PFDA 4MT5A 2JYEA 3B9JA 2K9XA 4WWMA 1C78A 2WXMA 3AV8A 5EE3A 1FFUA 1GOZA 1D5XC 1DYQA 3TEWA 3U52E 3W5VB 1E0ZA 2LHDA 3BK2A 3PZ8A 5FKAC 4YSZB 1NI3A 4M0WA 1FRRA 3AECB 2KMMA 3NRZA 4WURA 1ZXHA 5G5HA 1F77A 3KWLA 2WU5B 2WXGA 4C80A 2H88B 3W5UB 2MJDA 1GB1A 1A70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEK B;  1JRO A;  1FM0 D;  3NVY A;  2QJL A;  2JQR B;  2H89 B;  1J7B A;  3AE3 B;  2BT6 A;  3HRD D;  1YJI A;  1N60 A;  2DWQ A;  1CZP A;  2WU2 B;  4C7Z A;  2WP9 B;  3EUB 2;  3AED B;  1L6U A;  1E7P B;  2WS3 B;  4YTP B;  1I7H A;  1QLB B;  3VRB B;  1QOB A;  1NYQ A;  3FC4 A;  3NVW A;  1NYR A;  1FO4 A;  2M56 B;  3DWG C;  4YT0 B;  1RYJ A;  4A9A A;  1T3Q A;  1WWT A;  1YJJ A;  2CU3 A;  3AB5 A;  1RFK A;  2BS2 B;  3CIR B;  1V8C A;  1VDV A;  3VR8 B;  1AYF A;  1NVI D;  1EWY C;  3SFE B;  3WCQ A;  2WDQ B;  2E3T A;  1TKY A;  2PVO D;  1XLQ A;  1OQR A;  2PVG C;  1TJE A;  2Q5W D;  1WXQ A;  3AEF B;  3NS1 A;  4ITK A;  5EE1 A;  2BS3 B;  1ZOY B;  4JWS C;  4KX6 B;  1L5P A;  5EE9 A;  1N62 A;  3PO0 A;  1ZP0 B;  1YQ4 B;  3NVV A;  3ETR A;  4HRS A;  4JWU C;  2CJN A;  3RPF C;  3AEB B;  3AE7 B;  3HUI A;  1IUE A;  1OFF A;  4IDI A;  1YQ3 B;  4WQM A;  1WRI A;  1N63 A;  1NEN B;  1VLB A;  1WGK A;  3B2F A;  1FRD A;  1DOY A;  2BS4 B;  1DOI A;  1FXA A;  1N61 A;  2W55 A;  5H8Y E;  3SR6 A;  1CJE A;  1WYG A;  3AE1 B;  4US8 A;  1FMA D;  1DOX A;  1KF6 B;  2MH7 A;  3AE6 B;  3P4S B;  3P4R B;  5EE0 A;  3VRA B;  1XLO A;  1V97 A;  1RWS A;  2PKO A;  5G5G A;  2W3R A;  4FXC A;  2K22 A;  1TYG B;  2MJD A;  2K5P A;  3AEE B;  3AE4 B;  3DWM A;  3FAH A;  2ACZ B;  4YSY B;  1XO3 A;  3AE2 B;  1J7A A;  4N59 A;  3P4P B;  2B76 B;  2M19 A;  1TKE A;  2G1E A;  3AEG B;  1N5X A;  2WLB A;  2Y5C A;  2MJE A;  1TKG A;  1JW9 D;  1SIJ A;  1ZUD 2;  4N6E B;  1GPX A;  3P63 A;  3CWI A;  3LB8 C;  2HTM E;  1E10 A;  3SFD B;  1FXI A;  1N5W A;  3AE5 B;  1QOG A;  4LTU A;  5C2T B;  2PIA A;  1KFY B;  1FFV A;  3B2G A;  4ZOH C;  1QF6 A;  1JAL A;  4YTN B;  5C3J B;  4ZHO A;  2WDV B;  2N0S B;  2DBY A;  1OQQ A;  1XLP A;  3AEA B;  1AWD A;  2AX5 A;  1SF0 A;  3P1M A;  4YTM B;  4N58 A;  1ROE A;  3BII D;  1RM6 C;  2WQY B;  1GAQ B;  2EKI A;  2W54 A;  4YXD B;  3AMZ A;  3AH7 A;  1FIQ A;  2LEK A;  4US9 A;  4ZHP A;  1PFD A;  1XLN A;  1ZXI A;  1QOF A;  1E6E B;  3AE9 B;  3HVZ A;  1JWB D;  1SB3 C;  2L52 A;  2L83 A;  5MPO A;  1JRP A;  2K9X A;  2KAJ A;  2JX5 A;  3B9J A;  4WWM A;  3ABV B;  2W3S A;  3AV8 A;  5EE3 A;  2OHF A;  1JWA D;  4C7Y A;  1FFU A;  1L0V B;  1QOA A;  1PDX A;  3AM9 A;  3NVZ A;  2CJO A;  3VR9 B;  1PUT A;  3AE8 B;  2QIE B;  5H92 C;  3W5V B;  1E0Z A;  1B9R A;  4YSX B;  1QT9 A;  5AUI A;  4YSZ B;  3P4Q B;  3AN1 A;  1DGJ A;  3L4P A;  5AUK A;  1NI3 A;  4HRO A;  2MJ3 A;  4P6V F;  1FRR A;  3AEC B;  1KRH A;  2KMM A;  3NRZ A;  4USA A;  1VJK A;  2WDR B;  1R7S A;  4JX1 C;  5GXG B;  5G5H A;  3LXF A;  3KWL A;  1E9M A;  2WU5 B;  1F0Z A;  2FBW B;  4C80 A;  2H88 B;  1JQ4 A;  3ZYY X;  3W5U B;  1UWM A;  1J7C A;  3W9C B;  1A70 A;  1L6V A; 
#chains in the Genus database with same CATH topology
 1ZE3 D;  4H2A A;  3B1L X;  4IWQ A;  4NZL B;  3IAS 1;  2G3Q B;  4M8N A;  1L6U A;  4EFO A;  1C9F A;  4CQN A;  1K51 A;  3IVF A;  2KD0 A;  2KFK A;  2PVO D;  2PVG C;  2LGY A;  2AQ3 B;  3V60 A;  5BYS A;  3QJZ A;  2LJI A;  2M17 A;  3ZNZ B;  4JWU C;  4BKS D;  1VRA B;  4HDQ A;  1H4R A;  4IDI A;  3FKY A;  1D5Z C;  5DPR A;  1WE7 A;  1SJE D;  3AE1 B;  1FNV A;  3RUI B;  2J4X A;  3L16 A;  1TY0 A;  2IO3 B;  2N1V A;  2KAN A;  4FXC A;  1XCT L;  3AE4 B;  5AZG A;  2L0F A;  3HM6 X;  3N20 C;  3NZ3 A;  1EWC A;  4KSL C;  4FHK A;  1QOG A;  2WXO A;  5HKH A;  4L1B A;  2J0M A;  3RNF C;  3VH4 B;  1IBX B;  2YVC A;  2EKI A;  5AZH A;  4HLE A;  4ZHP A;  2C7N B;  2HJ8 A;  2M8S A;  3L13 A;  2JY6 A;  4AWJ A;  1SBB B;  3W1S A;  1OGW A;  1L0V B;  2G45 B;  4BKS A;  1MHX A;  2LD9 A;  4WH4 A;  3M95 A;  1ACC A;  2AEH A;  1UNS A;  1ET6 A;  3CMM B;  2MJ3 A;  4AJW A;  4W9C A;  3KWV A;  3ML8 A;  4HPL B;  4E3C A;  4AP4 C;  2L1A A;  1JQ4 A;  4KKI A;  1NEK B;  3HRD D;  3IG3 A;  3PLV A;  3W2D A;  2WS3 B;  2WXP A;  4FLH A;  2AQ1 B;  1UWX A;  3NVW A;  4KSK C;  3U8Z A;  4C00 A;  3DWG C;  4ARC A;  3MFG A;  3RN9 C;  4FUL A;  3PRM B;  2RDG A;  3ML9 A;  3TJP A;  5LLI A;  1SE9 A;  2JZZ A;  4K1R B;  1BUI C;  3I57 A;  1L5P A;  3LJ3 A;  1YQ4 B;  4WWP A;  1YQ3 B;  4HXD A;  1N63 A;  2DYO A;  4JQW C;  4YL8 A;  4GXB A;  4ZRQ A;  3WA0 A;  2XBB C;  2W55 A;  2IY0 B;  2MSE D;  3CST A;  2QCZ A;  2L3Z A;  2IDY A;  3BWU D;  3T8M A;  2M0X A;  3C19 A;  3PGE A;  2LMC A;  4RGN A;  3DBL I;  1J0G A;  2LAS A;  1IGD A;  5HG2 A;  3M3J A;  1N5X A;  3QIJ A;  3CWI A;  1FXI A;  5G55 A;  1FFV A;  1NDD A;  2J42 A;  2QHO A;  3PLU A;  4A3P A;  4ZRP A;  2NPT A;  2C7M B;  3X0W A;  2LZ6 A;  1OQQ A;  4JIO U;  3M63 B;  2MRP A;  2YEP B;  3AH7 A;  1KOT A;  1EM7 A;  1ZXI A;  3ZUN A;  1V81 A;  1UD7 A;  3HVZ A;  2KQ4 X;  1D4B A;  2WXI A;  1V1O A;  2WX1 A;  4EZL A;  1OEY J;  3JVZ X;  3ZDT A;  3N9Y C;  2V3P A;  2CJO A;  4IOI E;  4KGT A;  1HTQ A;  5JZE B;  4EEW A;  1R7S A;  5GXG B;  4BOZ B;  1GB4 A;  4OHJ A;  3UGB B;  1UWM A;  1MJD A;  4QAY A;  2JWU A;  1JRO A;  2KLC A;  2BGF A;  5TSS A;  1WH3 A;  2V3N A;  1VZ6 A;  2JF5 A;  4BBN C;  2KTR A;  2ZNV B;  1WX7 A;  1ZKH A;  3I63 C;  4LCD E;  3TUO A;  1ESF A;  1T3Q A;  3W1Y A;  2IO0 B;  1AAR A;  3TSS A;  3ZRC A;  1TT5 B;  1UBI A;  4DK5 A;  2INC C;  2MWS B;  2RDH A;  1WXQ A;  2I2Y A;  4HDO A;  4P1B C;  3EGR A;  3PZD A;  1KLG D;  3V6C B;  3A9J B;  1SGH A;  4MDK E;  1DOY A;  2BBC A;  2BS4 B;  3DHH C;  4GDL A;  4A90 A;  1CJE A;  1P0R A;  4C4V A;  2ZNV C;  1XLO A;  2W3R A;  2LUE A;  4Q2J A;  2MP2 B;  1XO3 A;  3GZN B;  1JML A;  2GBK A;  1UGM A;  2CR5 A;  2TSS A;  4DHZ B;  3P2B A;  1E10 A;  2V4L A;  2EKE C;  1GG3 A;  2I1K A;  2UU7 A;  3TEZ A;  1FCC C;  3ZO5 B;  4ARI A;  1MG4 A;  4I6N B;  4K7S A;  2DBY A;  1WI0 A;  2GLS A;  3L08 A;  2AX5 A;  3O65 B;  1L7Y A;  1A5R A;  1T0Y A;  2PW9 A;  2BQQ A;  4US9 A;  3AE9 B;  3OAW A;  5MPO A;  1LQB A;  4FJZ A;  1PQS A;  2W3S A;  2VZK D;  3WAN A;  3AI5 A;  3WAM A;  1R4M B;  1E8Z A;  4MGZ E;  1EU3 A;  1QZE A;  2DYB A;  3A9K B;  3P4Q B;  1TZ1 A;  4B0E A;  2QIL A;  3DOW A;  1KRH A;  3DCG A;  1V6E A;  4GDK B;  5D7G A;  2HDE A;  2K3U A;  1E7P B;  1WGY A;  1WR1 A;  1N60 A;  1SJH D;  2LGI A;  1VZ8 A;  4XWW A;  4ACF A;  1NYR A;  2V1Y A;  4ZRI A;  1TS2 A;  2N9L A;  1I4G A;  4LNO A;  3WAP A;  1VCB A;  3U2S C;  2ZVN A;  2C7H A;  2ASQ A;  1GC7 A;  1L4Z B;  2BS3 B;  4JWS C;  2SEB D;  4WWO A;  3RPF C;  1VD2 A;  3H1U A;  2J52 A;  2BWF A;  3QWZ B;  2FAZ A;  1WYG A;  1FEH A;  4JPS A;  3V05 A;  2GB1 A;  4B6W A;  3RNA C;  2B76 B;  4N6E B;  3ZVV A;  1GPX A;  4TSS A;  3SFD B;  3Q3M C;  3L10 B;  4N9F 4;  2O6V A;  2GBJ A;  3RYT A;  4RF0 A;  1WRD B;  3RZW C;  4BZA A;  1WGD A;  1SF0 A;  3P1M A;  1BT0 A;  2KVR A;  1U4A A;  1S1Q B;  3PSE B;  3BVM A;  4J6I A;  1PFD A;  1YQB A;  2JYE A;  2K9X A;  1HE8 A;  1WYW B;  3QA8 A;  1GOZ A;  1DYQ A;  1WMH A;  3U52 E;  2KYW A;  1KJT A;  2BKR B;  1FRR A;  3VTV A;  3NZU A;  1ZXH A;  4MSM B;  4S0R A;  5G5H A;  1F77 A;  4MH0 E;  4BKT A;  3W5U B;  2MA9 B;  3VFK A;  3E56 A;  3EFU A;  3DQV A;  1QKZ A;  2E6X A;  4DQO C;  5TR5 A;  2D3A A;  3RUL A;  1NYQ A;  3KUZ A;  4AS1 A;  3GZN I;  2RD0 A;  1FO4 A;  2WX0 A;  1RYJ A;  4A9A A;  1YJJ A;  1MFW A;  3AB5 A;  3MHS D;  3SDL C;  3PZ7 A;  1AYF A;  3ZDM C;  2BF8 B;  4BKG A;  1XLQ A;  2RSU A;  4KX6 B;  3H7P B;  2M4N A;  4GLS C;  3GE3 C;  2D10 A;  2CJN A;  2KXJ A;  2DAF A;  2KN5 A;  2D3B A;  3Q8F A;  2LVQ A;  1G6J A;  2IBI B;  2MH7 A;  2UYZ B;  4RGO S;  4NNJ B;  2K8C A;  3RNE C;  3RNG C;  2FID A;  2FCM A;  3DWM A;  1R4M I;  5CTR C;  3PPA A;  2KLG A;  3ZJV A;  4HCP B;  5D6J B;  4YTN B;  4WIP A;  2KHW B;  2N1W A;  1I4Q A;  3APF A;  4LLG M;  1ROE A;  1F1H A;  3BII D;  4XGA B;  2KFK B;  3QX1 A;  1JWB D;  2L83 A;  2L52 A;  1WGG A;  1WY8 A;  4A20 A;  1TBE A;  1V80 A;  2OHF A;  1V1P A;  4BBN F;  5CX3 A;  1RAX A;  2QIE B;  5H92 C;  2DNF A;  2YLM A;  2DX5 B;  2K0P A;  2BB6 A;  5IA7 A;  2WDR B;  1MPE A;  3ZGZ A;  2WXK A;  1LFD A;  3N30 A;  4IWP A;  1K52 A;  3IHP C;  2V0G A;  2QJL A;  5CHV C;  4F1S A;  1YJI A;  2DWQ A;  2WGS A;  3EUB 2;  4ZYN A;  4MSQ B;  5D3I B;  3HHM A;  1KH0 A;  2V4I B;  3APC A;  3VH3 B;  3PHW B;  5BMH A;  4ZRJ A;  4KVG B;  1OQR A;  3EEC A;  1F2R C;  4M01 A;  4HKQ A;  1T0Q C;  3ETR A;  1OFF A;  3IT6 B;  3OJ4 B;  3O13 A;  2XK5 A;  3R8B A;  1M94 A;  1T0S C;  3VDZ A;  1N61 A;  2FNJ B;  3DVN U;  1LM8 B;  3VRA B;  2NBV B;  4NAM A;  1WXV A;  3K9O B;  1WGH A;  4G0N B;  2K5P A;  1WM3 A;  3AU5 A;  2ACZ B;  3NOB A;  4YWG G;  4RGT A;  2M19 A;  3NZS A;  4LNN A;  4S17 A;  4ANW A;  2MJE A;  1TKG A;  4HCN B;  3T9L A;  2MHJ A;  3VXW A;  2IYD B;  5FK9 C;  1WE6 A;  4XYC A;  2NVU I;  2K8B A;  3W1S C;  1MHH E;  1MI0 A;  3PT2 B;  4LNK A;  4WJP A;  2DZK A;  1EUV B;  1XLP A;  2R2O A;  2WXF A;  2JSV X;  5E6N A;  3ZTD A;  3Q3J A;  3TEX A;  2FUH B;  2LXC A;  1Z2M A;  2KAC A;  5DPS A;  2KWD A;  4P16 A;  3ZLZ A;  1UBQ A;  4IUM B;  3PVL A;  1E8Y A;  1PDX A;  1RRB A;  4NPN A;  2CU1 A;  2K1F A;  2FE8 A;  3PTF C;  1B9R A;  1HZ5 A;  1L0X B;  3PRP B;  1GUA B;  2IJ0 A;  5G2N A;  2L7R A;  5JH5 C;  1E9M A;  2IGG A;  4M00 A;  1XD3 B;  3NVY A;  3Q2A C;  2G4S A;  2BTE A;  2J53 A;  2ZEQ A;  4J3O D;  5FR3 A;  3BVG A;  3U7D A;  3KLS X;  4XE0 A;  1QQR A;  4II2 B;  3NHE B;  4R3D A;  1YN5 A;  2WXQ A;  4NQK E;  2I1J A;  2ONQ A;  2LRU A;  5EE9 A;  3UIP B;  5CHF A;  4HJG E;  2BPS A;  3AE7 B;  4IM3 A;  2LVO A;  2B3A A;  2D3G A;  4PYU A;  5T8I A;  2IZV B;  2IO1 B;  1B1Z A;  1DOX A;  1TZO A;  3AE6 B;  3P4R B;  2JUO A;  1V5T A;  4NJ6 A;  4PS8 A;  1C4A A;  3FAH A;  3VVW B;  3AE2 B;  3BK1 A;  1VZ7 A;  3EA6 A;  2FCQ A;  2WLB A;  1L0Y B;  3AEG B;  1JRU A;  1JW9 D;  4WJQ A;  3SEB A;  2CHZ A;  4ANU A;  1HXY D;  1F2R I;  2KTR B;  2PIA A;  3NUH B;  2WDV B;  2N9X A;  2CHX A;  4BOS C;  1CMX B;  4L2Y A;  1GAQ B;  2JZP A;  2LEK A;  4DHJ D;  1XLN A;  2D5G A;  3IXS A;  4OZA A;  3K9P B;  4WJO A;  1JWA D;  3MHZ A;  2ZW0 A;  1E7V A;  1E90 A;  1PUT A;  4A8X C;  4FA6 A;  3ZRF A;  3DBH B;  4C4V B;  4LK0 M;  3J9C A;  1RLF A;  4NJ7 A;  2C9W B;  3T3O A;  2N9P C;  2N7D A;  1WXA A;  2WYQ A;  3NJT A;  3KW5 B;  3PRZ A;  2PPH A;  1X1M A;  1J7B A;  1V9J A;  4KDL B;  2KJH B;  3UI3 A;  3FC4 A;  3MJ5 A;  1HZ6 A;  1R4N B;  3CIR B;  2CU3 A;  1RFK A;  2K6D B;  1L4D B;  3QHT A;  2AL3 A;  2KQS A;  3R66 C;  3NS1 A;  2KK8 A;  2JYT A;  4KIK A;  1WF9 A;  2NCN A;  2ZCC A;  2OOB B;  1WFY A;  4WQM A;  1ZW7 A;  3B2F A;  2O2V A;  1QIL A;  4IC7 B;  4HKZ E;  1J19 A;  1V97 A;  2PKO A;  3UQB A;  2K22 A;  3EC8 A;  2NTS A;  2KT7 A;  1P7E A;  4KV2 A;  5JXV A;  1P7F A;  3MJW A;  2BB5 A;  1JCK B;  3ZXR A;  3X23 A;  1ZUD 2;  2J0K A;  1WIA A;  2DYM A;  2KDI A;  2OJW A;  1OTR B;  2FCN A;  2EEL A;  2PTL A;  2KMC A;  1MG8 A;  3CSF A;  2KOX A;  1TTN A;  3CF6 E;  2Y3A A;  1TS3 A;  1WX9 A;  3KUC B;  2GMI C;  2W54 A;  4MM3 A;  1Q1O A;  3FIL A;  2K8H A;  3TCA A;  4XZ4 A;  3MC9 A;  1FFU A;  3DHI C;  3MTN B;  1D5X C;  4ZRK A;  1E0Z A;  2LHD A;  3BK2 A;  1P9D U;  1WJU A;  4A3O A;  1N6Z A;  2KMM A;  2K6Q A;  2LGX A;  2WWZ A;  4MJS A;  5CHW A;  3KWL A;  4C80 A;  2JPH A;  1GB1 A;  5FR6 A;  3R2I A;  5GMV A;  2IPK D;  3PV1 A;  1QLB B;  1LGR A;  4K3B A;  2O6V B;  1WZ0 A;  4FHJ A;  2N9E B;  1YJ1 A;  4DWF A;  4RMA A;  4TMA B;  1ISN A;  3SFE B;  1BXT A;  3WCQ A;  2MBO A;  1XCQ L;  1TJE A;  3AEF B;  1KTK A;  4W9E A;  1FXT B;  4W9I A;  3NVV A;  3KUD B;  4B9K A;  2G4D B;  2GBN A;  1SIF A;  3KYD D;  4RM8 A;  5C23 A;  5DCN A;  1FCL A;  1FXA A;  2G9H D;  4MEM A;  2QSD A;  2Z0D B;  3RCZ A;  3I3T B;  2RR9 A;  4M02 A;  4WQO B;  1T0R C;  1D3Z A;  2QEJ C;  1NI2 A;  3DBH I;  3RMK C;  4E74 A;  3OG5 A;  2EMS A;  4GMV A;  1SE4 A;  2GRI A;  1UUP A;  4CO7 A;  4EOY A;  3UIO B;  3APD A;  4YTM B;  4LNI A;  3AMZ A;  3Q69 A;  1MVK A;  2QC8 A;  2DLB A;  1PGA A;  3H8H A;  1R4N I;  1XT9 B;  4PK1 A;  1WJN A;  1J8C A;  2FUG 1;  2JRH A;  2C5L C;  3A1Q A;  3IAM 1;  4X57 B;  3ZTC A;  4IW0 A;  2M0A A;  2KC1 A;  4NY0 A;  2VH2 A;  1PYW D;  4JE3 B;  1Q10 A;  3UIN B;  5D94 A;  4JX1 C;  4TUU A;  2KWC A;  3ZYY X;  3OWE B;  1FM0 D;  2JQR B;  1C4P A;  1WR6 E;  2LUM A;  4IG7 B;  4G3X B;  1WX8 A;  3ECI A;  2DHZ A;  4EUT A;  3N1Y C;  2N7J A;  1N62 A;  1ZP0 B;  1XQQ A;  2L00 B;  4OVZ A;  4A55 A;  4WJN A;  4XX5 A;  3VUX A;  1IUE A;  3Q8B A;  1TS5 A;  1OEY A;  1WRI A;  5AZF A;  1FRD A;  3RD2 A;  1Z5S B;  1Y8R C;  2MBH A;  5EE0 A;  4P7I A;  1TYG B;  1YD8 U;  3B08 A;  3QK0 A;  4OZC A;  3U30 A;  1J7A A;  3ZW3 A;  3LYY A;  4G50 A;  1TKE A;  4HJK A;  3U7Z A;  1SE3 A;  1V5O A;  3TBL D;  3LB8 C;  5AEK B;  2DAJ A;  2UWQ A;  4LTU A;  1SXT A;  3B2G A;  2WNM A;  2LXA A;  1FNW A;  3ZNG C;  1YNT E;  1ET9 A;  2MBB B;  4W9D A;  1M4V A;  4ZHO A;  2N0S B;  2LWP A;  2GBM A;  4CHK A;  3NS8 A;  4KKJ A;  3ONS A;  3ENE A;  4M0W B;  2JRI B;  3JSV A;  2WQY B;  1YOV B;  4FAD A;  4YXD B;  2WXH A;  1FIQ A;  2RPV A;  4M8M A;  3WAO A;  1JWS D;  1IYF A;  1SB3 C;  3EFC A;  5E6J A;  3VTW A;  3H9D A;  3R7Q A;  1I4H A;  4DDI D;  3P42 A;  1XF5 L;  2XK5 B;  3AE8 B;  3Q14 C;  2DEN B;  5L83 A;  1SSN A;  1HEZ E;  2KO3 A;  5AUI A;  3E9S A;  4F7Z A;  1WXS A;  2Y5B B;  2ZZP B;  3AN1 A;  4XDC A;  5AUK A;  2KDE B;  1CK1 A;  2MX2 A;  3QC8 B;  4HVB A;  2Z8L A;  1J7C A;  3W9C B;  4F8C B;  4D2K A;  4AOF A;  1BML C;  2AL6 A;  4HPM B;  2R61 A;  2ICI A;  2YEP F;  2ZPN A;  2CKH B;  4I6P A;  3DBR B;  2GBR A;  1WGR A;  4RNA A;  2MEK A;  3VR8 B;  4K7W A;  2VRR B;  3C0R B;  2LHE A;  2KX0 A;  1WZ3 A;  1WJ6 A;  2HE7 A;  2WDT B;  2WHI A;  3BY4 B;  1SE2 A;  3Q8E A;  4GGQ A;  3GOE A;  3TIX A;  1L2N A;  3I9V 1;  2KVZ A;  1FNU A;  1P1A A;  2C60 A;  5KHQ A;  1YX6 B;  2CHW A;  2KDM A;  3WAL A;  1UF0 A;  2KJ6 A;  1OQY A;  3I5J C;  3RNB C;  4DXA B;  4HWI B;  2BVC A;  1GC6 A;  1YIW A;  3R7R A;  2K25 A;  4NAW A;  1E5W A;  4RF1 A;  2EMT A;  3KYC D;  1P3Q U;  5D3D A;  3V62 A;  4ZOH C;  4BAX A;  4LDT D;  4XC2 A;  2PEA A;  2WXL A;  5HFY A;  3GS2 A;  3KVF B;  4W9L A;  1TGZ B;  2DZI A;  1T6B X;  2X8X X;  2LVP A;  4G11 A;  3QQ8 B;  2BYT A;  4FJV B;  1UEL A;  4FBJ B;  2QMT A;  3VUW A;  5DPT A;  4C7Y A;  1QOA A;  2J0J A;  3URY A;  3NVZ A;  4BFR A;  2HJ1 A;  2JU6 X;  4MGI E;  2NBU A;  3BZD B;  3ZNH B;  3DVN V;  2N9K A;  3GP7 A;  2W9N A;  3PS6 A;  3WIM A;  2R2Q A;  4USA A;  1I4R A;  3DVG Y;  1V2Y A;  4DBG A;  2RDB C;  2LRW A;  1EO6 A;  2FCS A;  1L6V A;  2KTF A;  5LXI B;  4OVU A;  1P98 A;  3AE3 B;  2BWE S;  1KM7 A;  4ICU A;  1T5X D;  4YTP B;  1I7H A;  3VRB B;  4GIV A;  5HI1 A;  2LI5 A;  3R2T A;  2PLP A;  1ZDX A;  2HTH A;  3TEY A;  4IKG A;  4ZYS A;  1PGB A;  3SD5 A;  4IWO A;  2BYE A;  4KGS A;  5JHA A;  3RZF A;  2MBQ A;  4ANX A;  1Y56 A;  1VLB A;  5H8Y E;  1TS4 A;  4DXG A;  2NPT B;  2ZVO A;  3MC8 A;  4ASW C;  1AN8 A;  2REX A;  1STE A;  2LGS A;  2JXT A;  3L17 A;  4YSY B;  4PYZ A;  2INN E;  3DHG C;  2DZJ A;  1RFA A;  5IAA C;  4XDD A;  5BYR A;  4B0M A;  1QF6 A;  1ZDV A;  3B0A A;  3AEA B;  2ZPY A;  2AWT A;  1RM6 C;  2IO2 B;  4TV3 A;  3DBR I;  4W9K A;  3ZXV A;  2KWU B;  2JWZ A;  4KIK B;  2NBW B;  4MT5 A;  3AU4 A;  3B9J A;  1FPY A;  4WWM A;  3VHT C;  2BKF A;  2WXM A;  2D3C A;  4DHJ B;  4DDG D;  1Q0W B;  2JT4 B;  2DZM A;  3W5V B;  4LJP B;  2O2V B;  3PZ8 A;  4DHZ E;  5FKA C;  4YSZ B;  2N7E A;  3BIN A;  3AXC A;  1EF1 A;  3IFW B;  1E8X A;  3NRZ A;  4WAA A;  5J18 A;  2WU5 B;  2WXG A;  4MEL A;  1GJZ A;  4XWT A;  2BT6 A;  4C7Z A;  2WP9 B;  1YN3 A;  2JVC A;  1CQV A;  2KNB A;  4RGM A;  1I35 A;  2WXJ A;  2I38 A;  4GDL B;  3L0W B;  1HQR D;  2BS2 B;  1IBX A;  2KZR A;  5HHD G;  3T3N A;  4MM3 B;  2E3T A;  1TKY A;  2Q5W D;  3FIL B;  5EE1 A;  4RCO A;  2GOW A;  4LNF A;  3U4E G;  2WXN A;  4HK2 A;  4IM2 A;  4GOC A;  4RM9 A;  1D5M C;  1F9J A;  3H7S A;  4JL9 A;  1NEN B;  1WGK A;  4ZDV A;  1DOI A;  3SR6 A;  4US8 A;  3GB1 A;  1FMA D;  3JW0 X;  3IT4 B;  3P4S B;  5C1Z A;  2IY1 B;  3BYY B;  4MH8 A;  4UDU C;  3AEE B;  4K7U A;  4MJS B;  3MC0 B;  2X38 A;  2Y5C A;  1GNU A;  3H6N A;  3MP9 A;  3N32 A;  1KFY B;  1V49 A;  3IBE A;  1JAL A;  1EF5 A;  4K81 A;  1LO5 D;  3KQ4 A;  3RFZ B;  1AWD A;  2ON8 A;  3HIZ A;  1E8W A;  3N3K B;  5IO9 A;  3V61 A;  2NS5 A;  2XEW A;  3JYU A;  3ALB A;  4BVU C;  2WXR A;  1HA5 A;  1JRP A;  2KAJ A;  4JGH B;  1C1Y B;  3ABV B;  2Z0E B;  2N4F A;  4KZ0 A;  1XXG A;  4ICV A;  3VR9 B;  2SAK A;  1DGJ A;  3DPD A;  3Q8A A;  3Q6B A;  2RPQ A;  1JWU D;  1K53 A;  4AUQ C;  3V6E B;  2BYV E;  4JLC A;  1I4X A;  2MLB A;  3NG0 A;  3ZIM A;  3TMP B;  3QCA A;  1CZP A;  3VQI A;  3AED B;  4PS7 A;  5IN7 A;  2NTT A;  1YMH E;  3VUY A;  1QOB A;  3UQA A;  2AQ2 B;  4HPP A;  2VZK B;  2W82 A;  3LDZ E;  3RT3 B;  1ZPS A;  2GI9 A;  2VH1 A;  4GSW A;  1HTO A;  4K3C A;  2NMQ A;  2L8J A;  1NVI D;  1EWY C;  3M62 B;  4MGY E;  1PGX A;  4URK A;  1LXD A;  4AQ7 A;  3GE8 C;  4AJY B;  4EZK A;  2PE9 A;  2XNA C;  4PT5 A;  5BO4 B;  4A6Q A;  4CYE A;  1TIF A;  3A1Q B;  2LGD A;  5KHO A;  1WSP A;  3UF8 A;  4MAC A;  1JWM D;  3HK0 A;  3PHX B;  3S2A A;  1RWS A;  1UH6 A;  5G5G A;  3QAR A;  1I42 A;  3OLM D;  3P4P B;  3R3M A;  3RI7 C;  4EE2 A;  4C56 C;  3P63 A;  4TKN A;  2ZCB A;  5L95 C;  1WMH B;  3Q3O C;  3TL5 A;  1XEE A;  2OJR A;  3BYT B;  1NBF C;  4N58 A;  2V3S A;  3RNC C;  2J7Q B;  3D32 A;  3QAQ A;  3VAW A;  1SEB D;  3N1Z C;  2O6V D;  3A9J A;  2PMV A;  2KQ7 A;  2RGF A;  4YSX B;  1D6E C;  1QT9 A;  3V3X A;  3L54 A;  3Q3N C;  1WJ4 A;  3L4P A;  4HRO A;  4P6V F;  2MP2 A;  5J17 A;  5DPW A;  4O1N A;  1F0Z A;  1UZX B;  2L32 A;  5IOI A;  4GN1 A;  4I6L B;  4W9J A;  5LXH A;  1EU4 A;  5BMG A;  2L76 A;  2K39 A;  5E6P A;  4W9H A;  3Q8C A;  5LNK 1;  4FJY A;  1UGJ A;  4GB9 A;  3DDC B;  5I4D A;  1YX5 B;  4YT0 B;  1AW7 A;  2XN9 C;  2MQJ A;  1C3T A;  4FN2 A;  4EKU A;  4EZJ A;  3JSV B;  1TY2 A;  3A33 B;  2NR2 A;  4KGR A;  1ZOY B;  2FIF A;  4W9G A;  4HRS A;  3AEB B;  4OW0 A;  1S3S G;  3DVG X;  1F52 A;  1VR9 A;  2KMA A;  3A9K A;  3ZJU A;  2L05 A;  2Z59 B;  4TQ0 A;  4OVV A;  2KDF B;  5JHB A;  3HM3 A;  4DXF A;  4GDK A;  4N59 A;  2KKC A;  2RMM A;  2G1E A;  2KN4 A;  2OED A;  4NQL B;  4W9F A;  1C76 A;  4NJC A;  1N5W A;  1KLV A;  5C2T B;  1V1P B;  4II3 B;  2PE6 B;  4RH6 A;  3A4S C;  3KH0 A;  4KZC A;  2BYF A;  2ZJD A;  2V9H A;  5BMI A;  1FD6 A;  2D07 B;  3ZKJ C;  2JXX A;  1WXM A;  1C79 A;  1H8C A;  1E6E B;  1QOF A;  1C77 A;  2JX5 A;  5D2M B;  2Y5P A;  3AM9 A;  3DBS A;  4WWN A;  1K50 A;  3C8Y A;  1Q5W B;  1YN4 A;  5BYQ A;  2A5U A;  4P1C C;  1VJK A;  1E7U A;  3LXF A;  2FBW B;  2LJ5 A;  3ZNI D;  2KFJ A;  1V86 A;  2H89 B;  4NAW B;  3Q3F A;  2KDB A;  4E71 A;  4TQ1 A;  2WU2 B;  3ZQ4 A;  2KX3 A;  3EHV A;  2IGH A;  2INP E;  3N1X C;  4RFB A;  5EDS A;  2M56 B;  1IGC A;  1ENF A;  1WWT A;  2KJR A;  1V8C A;  1VDV A;  4MGK E;  2PJH A;  3SHQ A;  2WDQ B;  2ZW1 A;  3HVD A;  4ITK A;  2IGD A;  1C4C A;  4OZB A;  3PO0 A;  4GU2 A;  3ZJT A;  3BVZ A;  3PRE A;  2QDF A;  4HEA 1;  3HUI A;  2MBE A;  4REZ A;  2CS4 A;  2BW2 A;  4LJO B;  1KF6 B;  3VTU A;  1K8R B;  1KLU D;  3NY5 A;  4KDI C;  1IPG A;  2LFI A;  2A4Z A;  3OJ3 A;  2M1M A;  1SIJ A;  5IP4 D;  4WAF A;  2HTM E;  3AE5 B;  3AUL A;  1ZGU B;  5J2R A;  5C3J B;  2MCN B;  4L23 A;  1WM2 A;  2HD5 B;  4LDT B;  4PS3 A;  5E6O A;  4IM0 A;  2MW5 A;  1I4P A;  2IND C;  3H7P A;  3A4R A;  2D11 A;  1C78 A;  1IP9 A;  3AV8 A;  5EE3 A;  3SU8 X;  4ANV A;  2KC2 A;  3DBL B;  4B95 A;  3TEW A;  2JZ3 B;  2KWV B;  2AYO B;  1NI3 A;  2D2Q A;  4M0W A;  2L0T A;  3AEC B;  4WUR A;  2H88 B;  2MJD A;  5IKC M;  1A70 A; 
#chains in the Genus database with same CATH homology
 1ZE3 D;  4H2A A;  4NZL B;  3E56 A;  3R2I A;  4XWT A;  2BT6 A;  1QKZ A;  2E6X A;  3IAS 1;  4C7Z A;  2IPK D;  2WP9 B;  4DQO C;  1L6U A;  1YN3 A;  1QLB B;  1C9F A;  1CQV A;  1NYQ A;  4RGM A;  4AS1 A;  2WXJ A;  2I38 A;  4GDL B;  1FO4 A;  1HQR D;  1RYJ A;  4A9A A;  4CQN A;  1YJJ A;  3AB5 A;  2BS2 B;  1K51 A;  1IBX A;  4TMA B;  3PZ7 A;  1AYF A;  5HHD G;  1BXT A;  4MM3 B;  3SFE B;  3WCQ A;  2E3T A;  3T3N A;  1TKY A;  1XCQ L;  1XLQ A;  2PVG C;  2PVO D;  1TJE A;  2Q5W D;  3AEF B;  3FIL B;  2AQ3 B;  5EE1 A;  1KTK A;  5BYS A;  4KX6 B;  4RCO A;  3U4E G;  2LJI A;  4GLS C;  2WXN A;  3NVV A;  4JWU C;  2CJN A;  1VRA B;  1D5M C;  4IDI A;  1NEN B;  1WGK A;  3Q8F A;  1D5Z C;  1FCL A;  1DOI A;  1FXA A;  1SJE D;  3SR6 A;  3AE1 B;  1FNV A;  4US8 A;  2G9H D;  1FMA D;  2J4X A;  3GB1 A;  2MH7 A;  3IT4 B;  3P4S B;  4RGO S;  2QSD A;  1TY0 A;  3BYY B;  4FXC A;  1XCT L;  4MH8 A;  4UDU C;  3AEE B;  3AE4 B;  3DWM A;  3MC0 B;  2QEJ C;  2X38 A;  2Y5C A;  3NZ3 A;  1SE4 A;  1EWC A;  2GRI A;  3MP9 A;  1QOG A;  1UUP A;  2WXO A;  1KFY B;  3ZJV A;  1JAL A;  4YTN B;  4WIP A;  4L1B A;  1LO5 D;  1I4Q A;  3KQ4 A;  3RFZ B;  1AWD A;  4LLG M;  2ON8 A;  1IBX B;  4YTM B;  1ROE A;  3BII D;  2EKI A;  3AMZ A;  3Q69 A;  4ZHP A;  1MVK A;  2DLB A;  1PGA A;  1JWB D;  2L83 A;  2L52 A;  1HA5 A;  2WXR A;  1JRP A;  2KAJ A;  3H8H A;  1SBB B;  3W1S A;  3ABV B;  2OHF A;  1L0V B;  1V1P A;  2FUG 1;  1XXG A;  3VR9 B;  2QIE B;  5H92 C;  1MHX A;  3IAM 1;  2SAK A;  4WH4 A;  1ACC A;  2M0A A;  1DGJ A;  1ET6 A;  1UNS A;  2K0P A;  3Q8A A;  2BB6 A;  1PYW D;  1JWU D;  1K53 A;  4JE3 B;  2MJ3 A;  1Q10 A;  3KWV A;  2WDR B;  4JX1 C;  1MPE A;  3ZGZ A;  2WXK A;  2L1A A;  1K52 A;  1I4X A;  3ZYY X;  1JQ4 A;  3OWE B;  2V0G A;  4KKI A;  1NEK B;  1FM0 D;  2QJL A;  2JQR B;  3HRD D;  1YJI A;  2DWQ A;  1CZP A;  3EUB 2;  3VQI A;  3AED B;  3W2D A;  1C4P A;  2NTT A;  2WS3 B;  1YMH E;  2WXP A;  1QOB A;  2AQ1 B;  2AQ2 B;  1UWX A;  2LUM A;  3NVW A;  2VZK B;  2W82 A;  5D3I B;  3DWG C;  1ZPS A;  4ARC A;  3MFG A;  2GI9 A;  1KH0 A;  2V4I B;  2NMQ A;  2RDG A;  1NVI D;  1EWY C;  5BMH A;  1OQR A;  1BUI C;  1F2R C;  3I57 A;  4HKQ A;  2N7J A;  1L5P A;  1PGX A;  1N62 A;  1ZP0 B;  1YQ4 B;  4OVZ A;  3ETR A;  4A55 A;  4AQ7 A;  1IUE A;  1OFF A;  1TS5 A;  1YQ3 B;  2XNA C;  1WRI A;  3IT6 B;  3Q8B A;  4PT5 A;  3O13 A;  1N63 A;  4A6Q A;  2DYO A;  3R8B A;  1FRD A;  4ZRQ A;  1N61 A;  2W55 A;  1WSP A;  4MAC A;  1JWM D;  3VRA B;  4NAM A;  5EE0 A;  1RWS A;  2IDY A;  3BWU D;  5G5G A;  1TYG B;  2K5P A;  4OZC A;  2LMC A;  4RGN A;  2ACZ B;  4YWG G;  1J7A A;  1IGD A;  5HG2 A;  4RGT A;  3LYY A;  3P4P B;  2M19 A;  1TKE A;  1N5X A;  2MJE A;  1TKG A;  3U7Z A;  1SE3 A;  4EE2 A;  4C56 C;  3P63 A;  3CWI A;  3LB8 C;  5FK9 C;  1FXI A;  4LTU A;  1FFV A;  1SXT A;  3B2G A;  2J42 A;  4ZRP A;  2WNM A;  1FNW A;  1MI0 A;  1MHH E;  1YNT E;  1ET9 A;  1M4V A;  1XEE A;  4ZHO A;  2N0S B;  1OQQ A;  1XLP A;  4KKJ A;  2WXF A;  2JSV X;  3BYT B;  4N58 A;  2WQY B;  2YEP B;  4YXD B;  3TEX A;  2WXH A;  3AH7 A;  1FIQ A;  2RPV A;  1EM7 A;  1ZXI A;  2KAC A;  1JWS D;  3HVZ A;  1SB3 C;  1SEB D;  2KQ4 X;  1D4B A;  5E6J A;  2KWD A;  4P16 A;  2WXI A;  1V1O A;  1I4H A;  2PMV A;  1PDX A;  1XF5 L;  3N9Y C;  3P42 A;  2V3P A;  2CJO A;  2FE8 A;  4IOI E;  3AE8 B;  1SSN A;  1B9R A;  1HEZ E;  4YSX B;  4KGT A;  1D6E C;  1QT9 A;  5AUI A;  3E9S A;  3V3X A;  3AN1 A;  1HZ5 A;  3L4P A;  4XDC A;  5AUK A;  1L0X B;  4HRO A;  4P6V F;  1CK1 A;  2IJ0 A;  1R7S A;  5GXG B;  1GB4 A;  4O1N A;  1E9M A;  1F0Z A;  4OHJ A;  2L32 A;  2IGG A;  1UWM A;  2Z8L A;  1J7C A;  3W9C B;  4D2K A;  1BML C;  1EU4 A;  1JRO A;  2JWU A;  3NVY A;  5BMG A;  5TSS A;  2V3N A;  2R61 A;  2ICI A;  2YEP F;  1VZ6 A;  2BTE A;  2J53 A;  4J3O D;  5FR3 A;  3Q8C A;  5LNK 1;  3BVG A;  1UGJ A;  3KLS X;  5I4D A;  3TUO A;  4YT0 B;  1AW7 A;  1ESF A;  2XN9 C;  4RNA A;  4XE0 A;  1T3Q A;  1QQR A;  3TSS A;  2MEK A;  3VR8 B;  4R3D A;  1YN5 A;  1TY2 A;  2WXQ A;  2RDH A;  1WXQ A;  2LHE A;  4KGR A;  2I2Y A;  1ZOY B;  2ONQ A;  5EE9 A;  3EGR A;  1KLG D;  4HRS A;  4HJG E;  3AEB B;  1SE2 A;  3Q8E A;  3AE7 B;  4OW0 A;  5T8I A;  1DOY A;  2BBC A;  3I9V 1;  1FNU A;  2BS4 B;  1VR9 A;  1B1Z A;  4A90 A;  1CJE A;  1DOX A;  1TZO A;  3ZJU A;  3AE6 B;  2KDM A;  3P4R B;  1XLO A;  4TQ0 A;  2W3R A;  4Q2J A;  1C4A A;  3FAH A;  1XO3 A;  4DXF A;  3AE2 B;  3BK1 A;  1JML A;  4N59 A;  2RMM A;  1VZ7 A;  2G1E A;  3EA6 A;  3AEG B;  2KN4 A;  1L0Y B;  2WLB A;  2OED A;  1JW9 D;  1C76 A;  2TSS A;  4NJC A;  1E10 A;  3SEB A;  1N5W A;  1HXY D;  1F2R I;  4RF1 A;  5C2T B;  1V1P B;  2PIA A;  3TEZ A;  1FCC C;  4RH6 A;  5D3D A;  4ZOH C;  3NUH B;  2WXL A;  5HFY A;  4ARI A;  2WDV B;  3GS2 A;  2DBY A;  5BMI A;  1FD6 A;  2AX5 A;  1T6B X;  4L2Y A;  1GAQ B;  2PW9 A;  2BYT A;  2JZP A;  2LEK A;  4US9 A;  1C79 A;  1XLN A;  3AE9 B;  1E6E B;  1QOF A;  1C77 A;  2D5G A;  3IXS A;  4OZA A;  5MPO A;  2QMT A;  2JX5 A;  2W3S A;  2VZK D;  1JWA D;  4C7Y A;  1QOA A;  3MHZ A;  3URY A;  2ZW0 A;  2Y5P A;  3AM9 A;  3NVZ A;  1PUT A;  4A8X C;  2JU6 X;  1EU3 A;  1K50 A;  3C8Y A;  3BZD B;  4LK0 M;  3P4Q B;  3J9C A;  4B0E A;  2N9K A;  3GP7 A;  2QIL A;  3T3O A;  1YN4 A;  5BYQ A;  1KRH A;  4USA A;  1I4R A;  1VJK A;  3LXF A;  4GDK B;  5D7G A;  2FBW B;  2HDE A;  2K3U A;  1E7P B;  1L6V A;  2H89 B;  1J7B A;  3AE3 B;  4NAW B;  1N60 A;  1SJH D;  4TQ1 A;  2WU2 B;  2LGI A;  3ZQ4 A;  1T5X D;  1VZ8 A;  4YTP B;  1I7H A;  3VRB B;  2IGH A;  2INP E;  4XWW A;  3UI3 A;  3FC4 A;  3MJ5 A;  1HZ6 A;  1NYR A;  4RFB A;  1TS2 A;  2M56 B;  2N9L A;  1I4G A;  1IGC A;  1ENF A;  1WWT A;  2CU3 A;  3CIR B;  3R2T A;  1RFK A;  5HI1 A;  3U2S C;  1V8C A;  1VDV A;  1ZDX A;  2PLP A;  1L4D B;  3TEY A;  4IKG A;  2WDQ B;  4ZYS A;  2ZW1 A;  1L4Z B;  1PGB A;  3HVD A;  4ITK A;  3NS1 A;  2BS3 B;  2IGD A;  4JWS C;  2SEB D;  1C4C A;  2JYT A;  4OZB A;  3PO0 A;  3ZJT A;  4KGS A;  3RPF C;  3BVZ A;  4HEA 1;  3HUI A;  1Y56 A;  4WQM A;  4REZ A;  1VLB A;  2J52 A;  3B2F A;  1QIL A;  5H8Y E;  1TS4 A;  4HKZ E;  4DXG A;  1WYG A;  2BW2 A;  1FEH A;  1KF6 B;  4JPS A;  3V05 A;  1V97 A;  2PKO A;  2GB1 A;  1AN8 A;  1KLU D;  2K22 A;  1STE A;  2JXT A;  2NTS A;  1P7E A;  4YSY B;  2LFI A;  2B76 B;  5JXV A;  1P7F A;  2BB5 A;  2INN E;  1JCK B;  1SIJ A;  4N6E B;  1ZUD 2;  1GPX A;  4TSS A;  4WAF A;  2HTM E;  2DYM A;  3SFD B;  3AE5 B;  5BYR A;  4XDD A;  4B0M A;  2EEL A;  2PTL A;  1QF6 A;  5C3J B;  1ZDV A;  4L23 A;  4RF0 A;  3AEA B;  2Y3A A;  1SF0 A;  3P1M A;  1TS3 A;  1RM6 C;  2W54 A;  1I4P A;  3BVM A;  3FIL A;  1PFD A;  4MT5 A;  2JYE A;  3B9J A;  2K9X A;  4WWM A;  1C78 A;  2WXM A;  3AV8 A;  5EE3 A;  1FFU A;  1GOZ A;  1D5X C;  1DYQ A;  3TEW A;  3U52 E;  3W5V B;  1E0Z A;  2LHD A;  3BK2 A;  3PZ8 A;  5FKA C;  4YSZ B;  1NI3 A;  4M0W A;  1FRR A;  3AEC B;  2KMM A;  3NRZ A;  4WUR A;  1ZXH A;  5G5H A;  1F77 A;  3KWL A;  2WU5 B;  2WXG A;  4C80 A;  2H88 B;  3W5U B;  2MJD A;  1GB1 A;  1A70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...