1QOAA

Ferredoxin mutation c49s
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
b'ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTSAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Iron-sulfur cluster cysteine-to-serine mutants of Anabaena -2Fe-2S- ferredoxin exhibit unexpected redox properties and are competent in electron transfer to ferredoxin:NADP+ reductase.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
total genus 25
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qoaA00
1FFUA 3AEEB 4KX6B 3W5VB 1QOAA 3FAHA 1N61A 3NVVA 3PO0A 2JQRB 5H92C 1PDXA 3AE2B 1GPXA 1VLBA 1WWTA 1UWMA 2MH7A 3DWGC 5GXGB 2EKIA 2WU5B 2WLBA 1OQQA 1ZP0B 1AYFA 4JWSC 2QJLA 2PKOA 2ACZB 3AH7A 3B2FA 4JX1C 1ZUD2 2BS2B 3AN1A 1TKYA 1QOFA 1JW9D 1NI3A 4ZHOA 1JROA 3VRBB 1OQRA 3CIRB 1VDVA 1RYJA 3W9CB 1TYGB 3AE3B 1QLBB 1DOIA 3AE6B 1SF0A 1RM6C 2OHFA 1F0ZA 1SB3C 2K22A 4ITKA 4ZOHC 2K9XA 3B9JA 1YJJA 1N60A 3KWLA 1FRRA 2PVGC 1FIQA 5AUKA 4YXDB 1DOYA 3AE7B 5C2TB 3HVZA 1JRPA 3P4PB 2B76B 1EWYC 1TKGA 3HUIA 3ABVB 2PIAA 5C3JB 2M19A 2HTME 1J7BA 3AEGB 3LB8C 3B2GA 1GAQB 1QOBA 1QOGA 2PVOD 1XO3A 2BT6A 5G5HA 3NRZA 3VR8B 2G1EA 4WWMA 4ZHPA 3VR9B 3ZYYX 1QF6A 1N62A 1TKEA 1NYQA 1L6UA 1WXQA 4A9AA 2H88B 3SFDB 2L52A 1FXAA 1NYRA 1NENB 2WU2B 3P1MA 1V8CA 4LTUA 2WS3B 3AEDB 3P4RB 3AEBB 1CZPA 1J7CA 4C80A 4N58A 3AM9A 1YJIA 4FXCA 2KAJA 2MJEA 3AECB 1XLOA 3AE5B 1AWDA 1L5PA 4YTMB 3AE9B 1I7HA 1R7SA 2L83A 2WDQB 2LEKA 3DWMA 4WQMA 1SIJA 1FMAD 3SFEB 2KMMA 2BS4B 3FC4A 1WRIA 1N5XA 1ZOYB 3L4PA 2H89B 3CWIA 4C7ZA 4YT0B 4YSXB 1VJKA 1V97A 2Q5WD 2CJOA 3HRDD 4C7YA 3EUB2 1ZXIA 4YTNB 4P6VF 4YSYB 3AV8A 1L0VB 5G5GA 1WGKA 2DBYA 1B9RA 2CJNA 1JALA 3P4SB 3AE1B 2QIEB 3ETRA 1E0ZA 1JWBD 2CU3A 2MJDA 1N63A 1YQ3B 3AB5A 3BIID 3LXFA 3P4QB 1RWSA 4US9A 1FRDA 1KFYB 2WQYB 4HRSA 2Y5CA 1XLQA 4HROA 4USAA 3WCQA 5EE3A 1N5WA 1RFKA 2W3RA 5EE1A 1E7PB 1WYGA 1NVID 2K5PA 1JQ4A 1JWAD 1ROEA 3AEAB 2AX5A 3W5UB 4N59A 3RPFC 1XLPA 1E10A 1E6EB 1DGJA 1QT9A 1FFVA 2BS3B 2N0SB 3AE8B 3AMZA 5AUIA 3SR6A 4YSZB 1T3QA 1TJEA 3NVZA 5EE0A 1OFFA 3VRAB 1FXIA 2DWQA 2FBWB 2W54A 1FM0D 1IUEA 2MJ3A 1CJEA 2WDVB 4US8A 3AE4B 1PFDA 1YQ4B 1KF6B 1E9MA 2WDRB 5EE9A 2W55A 3AEFB 3P63A 4YTPB 3NS1A 1DOXA 3NVYA 1KRHA 4JWUC 1XLNA 2WP9B 4N6EB 5H8YE 1A70A 1NEKB 5MPOA 1FO4A 1PUTA 1L6VA 3NVWA 4IDIA 2E3TA 2M56B 1J7AA 2JX5A 2W3SA
chains in the Genus database with same CATH superfamily
2K6QA 3OAWA 2KMAA 4KZ0A 2X8XX 5L95C 2N1WA 4MACA 4DXAB 2WU5B 4RF0A 4ARIA 4AJYB 4WH4A 1J8CA 1JW9D 4FHKA 1RYJA 1OEYA 4B0EA 2KYWA 2KWCA 3FILA 1C77A 2I38A 2IGGA 3H7SA 4G3XB 3DOWA 3BYYB 4BOZB 1E7VA 3KH0A 2RDBC 3VH4B 1Z5SB 1ENFA 1WR6E 2CU1A 1J7BA 2INCC 3LB8C 2ZNVB 4GGQA 2KJHB 4WWMA 3RCZA 4Q2JA 1NENB 3X23A 3TEXA 1YJIA 2MRPA 3U8ZA 1R7SA 3Q14C 1T0YA 2KMMA 2N4FA 3HHMA 1E8YA 4M0WB 2CJOA 4AS1A 3DVNU 1YIWA 3IBEA 3P4SB 2WXQA 3MJWA 3TEYA 4HROA 2LGDA 1Z2MA 4WJOA 2YEPB 1JWUD 2JXXA 4ZYSA 2LJ5A 2LRUA 1J0GA 4L23A 4MJSB 2M0XA 1XXGA 2KTRB 4FA6A 3WANA 4EOYA 2KZRA 3P63A 2VH2A 3NS1A 4OHJA 2ONQA 3NVWA 2E3TA 5LLIA 2PVOD 2KTFA 2MP2A 4KX6B 4PS8A 1N61A 5G2NA 2DYMA 2DZMA 4DK5A 5JXVA 4FLHA 4LNKA 5HKHA 4IG7B 4IM2A 4NPNA 1WGHA 4MGKE 5LXIB 1YJJA 5C2TB 3HVZA 2JSVX 2B76B 3ZIMA 3TCAA 1X1MA 4PT5A 1LXDA 2HJ1A 2EMSA 4P16A 5G5HA 3UIPB 1I4QA 3TIXA 4S0RA 4XC2A 1WGDA 3GE3C 4ZHPA 2WHIA 4GIVA 4HVBA 1XD3B 3ZO5B 2JY6A 1E5WA 3MC8A 3L10B 3V62A 4W9DA 2KDBA 2JUOA 4FJYA 4IUMB 2KAJA 2FCSA 1QILA 3U2SC 1AWDA 2L83A 2Z0DB 4WQMA 4RF1A 1EU4A 2IYDB 2KO3A 3L54A 2ON8A 2H89B 4B9KA 2HTHA 4XDDA 3LXFA 3EFCA 3PTFC 3SU8X 1I4HA 4J3OD 1GC7A 3DVGY 3SD5A 1Y8RC 1E10A 2BF8B 1WSPA 1KLGD 2GBRA 3RFZB 2DZJA 1FXIA 2DLBA 2KOXA 1E9MA 3WAMA 3AEFB 1SE4A 2XBBC 2L3ZA 2REXA 1R4NI 5D7GA 4K1RB 1H4RA 1FFUA 1EO6A 1AN8A 2C9WB 3BK2A 3NG0A 2BYEA 3AH7A 3AU5A 1QQRA 2MBBB 1GUAB 2KANA 4DWFA 3A9JB 1QLBB 1F0ZA 2WX1A 4WAAA 2K22A 3B9JA 3JSVB 3IXSA 3KWLA 4LDTB 4K81A 5AZHA 4RGTA 1C1YB 2KLGA 4WJNA 3B2GA 1E8ZA 3VH3B 2LD9A 1V2YA 4LCDE 2FIFA 2KNBA 5J2RA 3VR9B 1WGRA 2KQ7A 2CR5A 5DPTA 4BBNC 2WU2B 3JW0X 4ICVA 4A6QA 1DYQA 3N32A 4G50A 1KM7A 2WXOA 3VVWB 1FMAD 3T9LA 1OEYJ 4DXGA 5BMHA 1L4ZB 3PT2B 1C4AA 1NI2A 3L4PA 3VQIA 4NAMA 4YT0B 5JHAA 3VUYA 2D3BA 1XT9B 2KC1A 2CJNA 4A55A 5FK9C 3VUXA 2JU6X 1N63A 3BIID 2LVPA 3IAM1 4R3DA 1SXTA 4NJCA 1ESFA 3WCQA 1SE9A 1N5WA 1WYGA 1LM8B 2N7EA 1JWAD 4N59A 4YWGG 4M02A 1QT9A 3DBLB 4YSZB 4NAWB 3NVZA 2EKEC 3ZNID 1SBBB 2NS5A 2M8SA 1KF6B 3H8HA 1DOXA 4MH8A 1TY2A 2DYOA 2JZPA 2OOBB 3TSSA 5MPOA 1SIFA 3AE9B 3SFEB 3O13A 4XZ4A 3FAHA 5H92C 3Q2AC 2CHWA 2ZPYA 4E74A 4JWSC 2MCNB 3AN1A 2JYTA 4ZRQA 2KJRA 1E90A 2DYBA 5KHOA 3U52E 1MG4A 4E71A 3WA0A 1DOIA 3PRZA 3RNCC 4I6LB 4P1BC 2K9XA 2O6VD 4NQKE 5CHVC 2MHJA 3RD2A 3AE7B 1BXTA 3H7PA 1EWYC 3HUIA 3N1ZC 4TQ0A 3CF6E 2PIAA 4HKQA 1XQQA 3M62B 4MDKE 1GAQB 5IA7A 4LNFA 3HIZA 4GOCA 1UZXB 4B95A 2BGFA 2KLCA 5DPSA 4C4VB 4GU2A 4HPLB 2WXJA 4MELA 3SEBA 1D5MC 2Y3AA 3ZDMC 2G9HD 3CMMB 3GOEA 1PGXA 1EWCA 1UGMA 2XK5A 1N5XA 4KSKC 2L05A 3HRDD 2BWFA 1V6EA 3RULA 3P2BA 3ZJVA 4ZRJA 1V1PA 2C5LC 4XE0A 4II2B 2I1KA 3T8MA 2GB1A 4XX5A 2PE9A 4ANXA 4URKA 1RFKA 2EMTA 1ROEA 1RLFA 3BWUD 3U30A 4KIKB 1ET6A 1E6EB 3SR6A 1WX8A 3ML9A 1D5ZC 2RSUA 2MWSB 2DWQA 3QC8B 3QJZA 1YQ4B 4M00A 1GC6A 3HM6X 2BYVE 3RI7C 2J0JA 1MG8A 1FNWA 3W5VB 4W9KA 4KKJA 1IBXB 3RN9C 3MHZA 3IVFA 3Q3NC 2KDEB 1V5TA 1QOFA 2D3GA 3RNGC 4EZKA 3DBSA 4EFOA 4WURA 5C23A 2WWZA 1GG3A 2IO2B 2UYZB 4XWWA 1I4RA 1JRPA 1ZKHA 3ABVB 3R8BA 2HDEA 5BO4B 3HK0A 4OVZA 2BYFA 4HPPA 3OG5A 5IOIA 5CHWA 3SFDB 1WF9A 1TS4A 3IFWB 3N20C 2JT4B 1D6EC 5GMVA 1CZPA 1J7CA 2I2YA 3AM9A 2FNJB 2KX3A 4K7WA 2N9PC 2KT7A 2WXFA 2VZKD 4UDUC 1WXVA 2WDQB 2YEPF 3L17A 4WQOB 3J9CA 2BPSA 2IJ0A 2DNFA 4KV2A 1L7YA 3N1XC 1ZXIA 2KVRA 3ML8A 4MSMB 4NNJB 5I4DA 1CQVA 3RZWC 2O2VA 2DAJA 5JZEB 1SE2A 2FUHB 4WAFA 5D2MB 2AQ1B 3RPFC 2LGIA 3NOBA 2XNAC 2W82A 1DGJA 3U7ZA 4HCPB 1TJEA 3A1QA 1FM0D 1WFYA 2BKRB 2A5UA 2WDRB 2X38A 2MBOA 4JWUC 1JWSD 2KK8A 1L6VA 4XDCA 3R3MA 4EZLA 2JX5A 2W3SA 4DHJB 5TR5A 4D2KA 3VFKA 1UWMA 3DWGC 1P9DU 2EKIA 4FULA 4I6NB 4NJ7A 3K9PB 4GN1A 2GRIA 4I6PA 4JX1C 2YLMA 4RGMA 3EFUA 2KFKB 1P0RA 3IT6B 3IHPC 1UNSA 4M8MA 3QK0A 3RYTA 1C79A 2FIDA 4LDTD 5KHQA 3KWVA 1N60A 3GB1A 3B08A 3PRMB 4MT5A 3A4SC 2L32A 3RUIB 2WX0A 3BVGA 1MHHE 1E8XA 4K3BA 2ZVNA 1YMHE 2LZ6A 4JIOU 1FCLA 2CHZA 2RDGA 3PHWB 2O6VB 1MI0A 5T8IA 4A3PA 2AQ2B 2KWUB 5E6PA 1YN4A 2A4ZA 2N7JA 2ASQA 1QKZA 5AZFA 5G5GA 2MJDA 1FRDA 1KFYB 3B0AA 1TGZB 2ZPNA 2K5PA 4XYCA 3ZTCA 1ZPSA 2K25A 2AX5A 1FD6A 3T3NA 4GB9A 5AUIA 1PYWD 4NY0A 2IO3B 1K52A 2C7NB 1XCTL 3AE4B 1V86A 1TY0A 1GOZA 3V05A 2VRRB 1C4CA 1A70A 4P7IA 1K8RB 2FUG1 4YSYB 5LNK1 3QX1A 5HI1A 3EHVA 1VLBA 4MSQB 1C4PA 4LNOA 1SSNA 3ZJTA 2QJLA 1WRDB 4O1NA 3GE8C 1IGDA 4LK0M 1M4VA 2RPVA 1YD8U 1TS3A 1HQRD 3AE6B 3H7PB 2KMCA 1FCCC 4AWJA 2IY0B 3WALA 5IN7A 3GS2A 2HTME 3DVGX 3L16A 2E6XA 1VRAB 2JYEA 3BK1A 5BYQA 1QOBA 3TJPA 1I4GA 4A3OA 1SE3A 2MW5A 2D3AA 3ZQ4A 3UIOB 4W9EA 2L52A 2MSED 1FXAA 3A4RA 1SJED 4NQLB 4OW0A 4LTUA 4NZLB 3PZ7A 4KVGB 1HZ6A 3Q8BA 2RR9A 3Q3FA 3OJ4B 3R2TA 2BS4B 2LMCA 2PTLA 3KUCB 2Q5WD 3MC9A 1V5OA 1RAXA 4K7UA 1T0SC 3AE1B 1VZ6A 4HRSA 2KHWB 1WIAA 1YX5B 2LHEA 1E7PB 4WIPA 4TV3A 3CSFA 2GOWA 4GDKA 2JWUA 1EM7A 1WMHA 2AWTA 3D32A 2KDMA 3AI5A 3AMZA 2VZKB 1J19A 4II3B 3Q3JA 3DBRI 4DDID 1IUEA 3I3TB 2GBJA 2WXHA 3I63C 1B1ZA 4DBGA 3NVYA 5HG2A 3GP7A 2QCZA 1UWXA 3BINA 1LGRA 3PO0A 2ZW0A 1ZXHA 3EC8A 5CTRC 2D10A 3KYCD 3L13A 3NJTA 1T0RC 4RM8A 4OZCA 1HE8A 4OVUA 4F7ZA 2ZCBA 2WXMA 4IWPA 3TMPB 1ZE3D 1RM6C 2J42A 4WWNA 2V3SA 3MJ5A 3H1UA 4GSWA 3BYTB 4TUUA 4W9LA 3MP9A 2ZEQA 2M19A 2IPKD 4RH6A 1JRUA 3TBLD 2RMMA 4MM3B 5E6NA 4W9GA 1P1AA 1UUPA 3BY4B 1V8CA 4GDLB 4EKUA 3CSTA 4FJZA 3APCA 4HXDA 1I7HA 3C8YA 3IAS1 1SIJA 1UBQA 1L0YB 4JGHB 3VDZA 3ENEA 4C7ZA 1TZOA 2RGFA 1L2NA 2O2VB 1JALA 2LWPA 5L83A 4USAA 3ZXVA 1XLQA 4F1SA 2V4LA 5FR3A 5JH5C 3Q8CA 3ZTDA 3A1QB 1WH3A 3ZNGC 3W5UB 4AOFA 1L4DB 3KQ4A 4BKSD 1T3QA 3E56A 2V4IB 3M63B 2MBHA 5EE0A 4PYZA 4KKIA 2FBWB 3ZNHB 1CJEA 2LI5A 4EEWA 2K39A 2R61A 4DHJD 2WP9B 1F52A 1GB4A 1QOAA 1GPXA 4KGRA 4EE2A 2LGXA 3DVNV 4OVVA 2JZZA 1EU3A 1JWMD 3TUOA 2LJIA 2JZ3B 1NI3A 1YQBA 3NY5A 5LXHA 1I4XA 1TBEA 1T5XD 3HM3A 1TYGB 3AE3B 2KVZA 5D3DA 1FEHA 2PLPA 1YX6B 2EELA 2W9NA 3R2IA 1E8WA 3N9YC 2MBQA 1D3ZA 1LO5D 3C19A 1WXSA 3JYUA 1QOGA 1MPEA 3SHQA 3UF8A 4AJWA 3DBHI 1UBIA 3FILB 1NYRA 2J52A 4M0WA 1WM2A 2WXNA 2L8JA 4PK1A 3AECB 4EUTA 2ZCCA 2BB6A 5D94A 2G45B 4GXBA 3CWIA 4IC7B 4W9HA 4ARCA 4C7YA 3E9SA 1FNVA 1WGKA 1TS2A 3C0RB 4MJSA 3VHTC 3ETRA 2KTRA 2CU3A 3V6CB 3AB5A 1RWSA 3LJ3A 3FKYA 3ECIA 4FJVB 2V9HA 2KQ4X 1MHXA 4PYUA 1R4MI 2DZKA 1Q1OA 1MFWA 4LJPB 1I35A 3UINB 4JL9A 3N30A 1QZEA 2LGSA 1OFFA 2WXLA 1PGBA 3KUZA 3ZW3A 2MLBA 5EDSA 2D3CA 1ZDVA 1BMLC 2KQSA 2KWVB 4JPSA 2AQ3B 4XGAB 5H8YE 3KVFB 2IZVB 2NBWB 4DDGD 3RNFC 4KGTA 3H9DA 2K8HA 3HVDA 4EZJA 2MH7A 5GXGB 4FHJA 4PS7A 2G4SA 1AARA 3B2FA 2WXIA 2BS2B 5BMGA 2INDC 1R4NB 2OEDA 1OQRA 4W9CA 2AYOB 2LXCA 2MP2B 3ZLZA 5DPWA 1Q5WB 2L0TA 1K50A 2FCQA 5AEKB 2NMQA 1WXAA 4YXDB 1BUIC 2MEKA 3X0WA 2ZNVC 3PS6A 1WX9A 1HTQA 4ZRPA 2IBIB 4F8CB 5CX3A 2PPHA 3VR8B 1QF6A 1VR9A 2ZW1A 1VD2A 1WZ3A 2H88B 3PHXB 4FN2A 3LYYA 2N1VA 3PVLA 2UWQA 4KDIC 4JQWC 5AZGA 2IDYA 4N58A 4FXCA 2MJEA 5J17A 2NPTA 2G3QB 4L1BA 1S1QB 4YTMB 4GMVA 1ZOYB 1V1OA 4DQOC 1N6ZA 4BKGA 2JRIB 2LRWA 2JVCA 4WWPA 4RNAA 2KDIA 2IY1B 3DHHC 3R7QA 1WM3A 3OJ3A 1ZGUB 3APDA 1WJNA 1JQ4A 2V3NA 4CYEA 4ZYNA 1P3QU 1FFVA 3QAQA 4KGSA 2PW9A 3QCAA 3VRAB 2WDVB 1HZ5A 1EF5A 2IGHA 4WWOA 2QEJC 3OWEB 4BFRA 3A9JA 2NR2A 1V49A 2M0AA 4HPMB 3NVVA 2K8BA 1PDXA 2HE7A 3AE2B 2KFJA 2Z0EB 1P7FA 2V3PA 3JSVA 2D2QA 3EECA 3RNBC 2L0FA 1I4PA 1YN3A 2RDHA 3EGRA 3CIRB 1VDVA 4M01A 2J53A 3IT4B 4G0NB 4ITKA 2JRHA 3DPDA 1FIQA 3Q3MC 1JMLA 3M3JA 4IOIE 2QMTA 2JPHA 1F1HA 2G4DB 1WI0A 1N62A 1TKEA 1WXQA 1L6UA 4A9AA 2Z8LA 3RZFA 3PZDA 2GLSA 3AEDB 3AEBB 3VTWA 1C78A 3NS8A 2IO0B 3ZDTA 2M1MA 3V6EB 5IKCM 2LFIA 3EUB2 4IWOA 3ONSA 1UH6A 2GBNA 2L7RA 4NAWA 1JWBD 1WGGA 4RGOS 1YQ3B 2Y5CA 5BYRA 1WE6A 4C00A 4KSLC 1KH0A 2NBVB 1XLPA 1UD7A 3AE8B 4C56C 1WE7A 3Q6BA 1HA5A 3BZDB 3MC0B 4G11A 1UELA 2SEBD 5DCNA 5EE9A 3R7RA 1ZW7A 3LDZE 4KZCA 1XLNA 3AULA 4K7SA 2OJRA 3TL5A 1J7AA 4BAXA 3AEEB 3KUDB 3OLMD 1OQQA 4ZDVA 1K51A 2V1YA 1TKYA 2KDFB 3UI3A 1SB3C 2RPQA 4ZOHC 1T0QC 4C4VA 5AUKA 2D11A 4N9F4 4PS3A 1TT5B 2FCNA 4HWIB 1XF5L 2INPE 1XO3A 3DHIC 1KJTA 3ZYYX 2QHOA 2D07B 2WS3B 4M8NA 1YJ1A 1IYFA 4ANVA 4MGZE 2N9KA 2R2OA 2BWES 4X57B 1WRIA 2YVCA 5E6JA 1LQBA 2HJ8A 2KXJA 2L76A 4TSSA 4KIKA 3PREA 3AXCA 2XN9C 3DBLI 2BTEA 1E0ZA 2FE8A 3ZUNA 4US9A 4HKZE 4A90A 3MFGA 1A5RA 2XK5B 5EE1A 3PGEA 3A33B 3ZKJC 2PE6B 4BKTA 3V3XA 2QILA 1NDDA 4ZRIA 3PLUA 1V1PB 3EA6A 4IM3A 1ZDXA 1IBXA 4XWTA 3DDCB 3P42A 5BYSA 2HD5B 4K3CA 4DHZE 1RFAA 1UGJA 1CK1A 3APFA 4CO7A 1MVKA 1M94A 4WJQA 5IAAC 4OZBA 1PGAA 4AQ7A 3NZ3A 3UQAA 3PLVA 1WWTA 3NZUA 4TKNA 2C60A 1WX7A 1BT0A 3GZNI 4MGIE 1WZ0A 3O65B 1ISNA 3ZNZB 2K6DB 2MBEA 3A9KA 3VRBB 4CHKA 2DX5B 2XEWA 1SEBD 1SF0A 3ZVVA 3DHGC 1WJUA 5CHFA 3MTNB 4B6WA 4REZA 3PPAA 2M17A 3V60A 3PRPB 2WDTB 3P4PB 2PMVA 2Y5BB 3AEGB 3VXWA 3W1YA 2BKFA 1F9JA 2BYTA 1WYWB 2NPTB 2QSDA 1OGWA 2K1FA 2DZIA 2NBUA 4C80A 2MQJA 1XLOA 2QDFA 1CMXB 1YN5A 2BVCA 1C9FA 2BBCA 2JXTA 3DWMA 4B0MA 1WY8A 1KOTA 2M4NA 4BOSC 1C3TA 2I1JA 3RNEC 1HTOA 1PQSA 4P6VF 4AP4C 2DBYA 3QA8A 4HK2A 3P4QB 1Q0WB 4BKSA 4A8XC 4HLEA 2B3AA 4J6IA 1NVID 4YL8A 2WNMA 1IP9A 1JCKB 3W1SA 2N0SB 2RD0A 2LUEA 1ET9A 3QARA 5D3IB 2Z59B 2WXRA 2N9EB 5TSSA 1XEEA 1GJZA 2KFKA 1L0XB 1PUTA 1E7UA 2L00B 2MX2A 3TEZA 2LXAA 3VTVA 2GI9A 1HEZE 2WLBA 2DHZA 1ZUD2 4DXFA 4BVUC 2NTSA 3W9CB 5JHBA 2KACA 3TEWA 2OHFA 3PV1A 3I5JC 4BBNF 4CQNA 3B1LX 3L0WB 1FRRA 1YOVB 2GBMA 2PEAA 4L2YA 3ZXRA 2KN4A 2PJHA 3Q8FA 2WYQA 4WJPA 4LNNA 2O6VA 4HDQA 2R2QA 2G1EA 2D5GA 4MH0E 5FR6A 2TSSA 1EF1A 1Y56A 4ANUA 3WAOA 4JLCA 5FKAC 1G6JA 3W2DA 4YSXB 3VUWA 1V97A 2J7QB 1L0VB 4RCOA 1OQYA 3URYA 2KD0A 2WQYB 2AL6A 2NTTA 4NJ6A 2K3UA 4LLGM 3ZRFA 2JWZA 4FBJB 5DPRA 3AEAB 2QC8A 3WIMA 4HCNB 2BS3B 4TMAB 3ZGZA 1EUVB 1U4AA 3QQ8B 3UQBA 3BVZA 3NHEB 1D5XC 5G55A 2W54A 2WXGA 5J18A 2KKCA 3KW5B 2WXPA 2INNE 4YTPB 1WJ4A 3W1SC 1KRHA 1STEA 3GZNB 2M56B 4BZAA 3DQVA 4P1CC 4IKGA 3DBRB 1F2RI 1XCQL 1NBFC 1P7EA 1AYFA 2PKOA 4ACFA 3MHSD 3R66C 4KDLB 4W9JA 3KLSX 3N1YC 1V80A 1F2RC 3VTUA 3M95A 2LVQA 1WXMA 1VZ8A 1MJDA 4AUQC 3U4EG 2PVGC 4RM9A 3RMKC 3S2AA 1KTKA 3DCGA 1TTNA 4H2AA 2BT6A 1NYQA 3UGBB 3Q3OC 2ZJDA 3P1MA 1IGCA 2K8CA 1AW7A 3V61A 2WXKA 2IGDA 5IP4D 1RRBA 1C76A 3VAWA 1F77A 2LUMA 1L5PA 1TZ1A 2CKHB 2LEKA 3FC4A 3ZJUA 1IPGA 2KX0A 4JE3B 4LNIA 3QIJA 2C7MB 2C7HA 2UU7A 3I57A 3RT3B 1HXYD 1SGHA 4ZRKA 4IW0A 1UF0A 4IWQA 2LVOA 2WGSA 2GBKA 2LHDA 3NZSA 2SAKA 1KLUD 2ICIA 2Y5PA 2NVUI 1P98A 1YNTE 2CS4A 1WR1A 4ASWC 1WJ6A 4E3CA 1GNUA 4HDOA 4ANWA 5IO9A 2VH1A 1PFDA 2W55A 3Q8EA 5HFYA 4N6EB 1NEKB 1T6BX 2FAZA 4GDKB 5D6JB 1S3SG 1WMHB 4GLSC 4RMAA 4S17A 2CHXA 1H8CA 3H6NA 2JQRB 4W9FA 3A9KB 2DAFA 2KWDA 1ZP0B 2ACZB 4MEMA 4ZHOA 1TIFA 1JROA 3QWZB 1V9JA 5E6OA 4RGNA 4ICUA 3I9V1 1VZ7A 5C1ZA 4MGYE 4TQ1A 3K9OB 3NUHB 4MM3A 2BW2A 3RNAC 2KJ6A 4QAYA 2AEHA 1DOYA 1LFDA 4RFBA 3BVMA 4HJKA 1TKGA 1ACCA 1FNUA 4GDLA 1FXTB 5C3JB 2BQQA 2L1AA 3JVZX 4FADA 5HHDG 3NRZA 1V81A 1VCBA 1Q10A 2KN5A 1WGYA 2V0GA 1D4BA 2J4XA 3ZRCA 4W9IA 2BB5A 2OJWA 3P4RB 4HEA1 2J0KA 1I42A 4DHZB 5BMIA 2N9XA 3AE5B 2FCMA 3QHTA 2MA9B 2GMIC 3PZ8A 3DBHB 4A20A 3N3KB 2LGYA 3AU4A 1VJKA 2KC2A 4YTNB 1GB1A 3AV8A 1K53A 2NCNA 1B9RA 2QIEB 2N7DA 1SJHD 2J0MA 1OTRB 5EE3A 3U7DA 2W3RA 2IO1B 1KLVA 2ZVOA 2ZZPB 3L08A 3ALBA 4IM0A 1TS5A 4HJGE 3WAPA 3Q69A 3T3OA 2LASA 3Q8AA 2MJ3A 3SDLC 4US8A 2AL3A 1R4MB 2N9LA 2DENB 4OZAA 3IG3A 1FPYA 3KYDD 2K0PA 4LJOB 2JF5A 1FO4A 4IDIA 3PSEB
chains in the Genus database with same CATH topology
1FNWA 3NZ3A 3W5VB 1QOAA 1GPXA 4KGRA 4MACA 4EE2A 4KKJA 1IBXB 1WWTA 3MHZA 2WU5B 1EU3A 1JWMD 4RF0A 4ARIA 3TUOA 4WH4A 2LJIA 1QOFA 1JW9D 1NI3A 3VRBB 1I4XA 1RYJA 1T5XD 1TYGB 3AE3B 1SEBD 5D3DA 1SF0A 1FEHA 4B0EA 2PLPA 4WURA 2EELA 3FILA 1C77A 2I38A 4REZA 4XWWA 2IGGA 1I4RA 3R2IA 3BYYB 1JRPA 3N9YC 3P4PB 3ABVB 1ENFA 1LO5D 3R8BA 2PMVA 1J7BA 3AEGB 3LB8C 2HDEA 1QOGA 4OVZA 1MPEA 4WWMA 4Q2JA 3FILB 3SFDB 2BYTA 1NYRA 2J52A 2QSDA 1NENB 4M0WA 1TS4A 1D6EC 1CZPA 2WXNA 1J7CA 3TEXA 4C80A 2I2YA 3AM9A 1YJIA 3AECB 1XLOA 1YN5A 1C9FA 2WXFA 2VZKD 1R7SA 2BBCA 4UDUC 2JXTA 2WDQB 2YEPF 3DWMA 2BB6A 2KMMA 4B0MA 3J9CA 3CWIA 2IJ0A 4ARCA 2CJOA 4C7YA 3E9SA 4AS1A 1ZXIA 4P6VF 1FNVA 1WGKA 2DBYA 1TS2A 3P4SB 2WXQA 3ETRA 2CU3A 3P4QB 3AB5A 3TEYA 1RWSA 4A8XC 5I4DA 4HROA 1CQVA 2KQ4X 1MHXA 1SE2A 1NVID 2YEPB 1JWUD 4WAFA 2AQ1B 2WNMA 4ZYSA 3RPFC 2LGIA 2XNAC 2W82A 1DGJA 1JCKB 4L23A 3W1SA 2N0SB 3U7ZA 1XXGA 1TJEA 1ET9A 1OFFA 2WXLA 1PGBA 5D3IB 1FM0D 2WXRA 1ZDVA 5TSSA 1XEEA 1BMLC 2WDRB 2X38A 3P63A 3NS1A 4JPSA 2AQ3B 4JWUC 4OHJA 1L0XB 5H8YE 1JWSD 1PUTA 1L6VA 2ONQA 3NVWA 4XDCA 2E3TA 2JX5A 2PVOD 2W3SA 4KGTA 4KX6B 3TEZA 1N61A 4D2KA 3HVDA 2GI9A 1HEZE 1UWMA 2MH7A 3DWGC 5GXGB 2EKIA 2DYMA 2WLBA 2GRIA 4JX1C 3B2FA 2WXIA 1ZUD2 2BS2B 5JXVA 4RGMA 5BMGA 4DXFA 2OEDA 1OQRA 3IT6B 2NTSA 3W9CB 2KACA 3TEWA 1UNSA 2OHFA 1C79A 1K50A 1YJJA 2NMQA 3KWVA 1N60A 3GB1A 4CQNA 1FRRA 4YXDB 1BUIC 2MEKA 4L2YA 5C2TB 3HVZA 2JSVX 2B76B 2KN4A 3Q8FA 4MT5A 4ZRPA 4PT5A 2L32A 3BVGA 4P16A 5G5HA 1I4QA 1MHHE 3VR8B 2G1EA 1VR9A 4ZHPA 1QF6A 1YMHE 2ZW1A 2H88B 2D5GA 3LYYA 2IDYA 2TSSA 4N58A 4FXCA 1FCLA 2KAJA 2MJEA 1Y56A 1QILA 4L1BA 3U2SC 1AWDA 2RDGA 4YTMB 2L83A 4WQMA 5FKAC 4RF1A 1MI0A 1EU4A 5T8IA 2AQ2B 1YN4A 2N7JA 2ON8A 1ZOYB 2H89B 3W2DA 4YSXB 1V1OA 1V97A 4XDDA 4DQOC 1QKZA 1L0VB 5G5GA 4RCOA 4RNAA 2MJDA 3LXFA 3URYA 1FRDA 1KFYB 2WQYB 2NTTA 1I4HA 4J3OD 2K3UA 2K5PA 4LLGM 1JQ4A 1ZPSA 2V3NA 3AEAB 2AX5A 1FD6A 1E10A 3T3NA 2BS3B 1FFVA 1WSPA 4TMAB 5AUIA 4KGSA 3ZGZA 2PW9A 1KLGD 1PYWD 3RFZB 3BVZA 3VRAB 1FXIA 1D5XC 1K52A 2W54A 2DLBA 1XCTL 2WDVB 1HZ5A 2WXGA 3AE4B 2WXPA 1E9MA 1TY0A 2IGHA 2INNE 3AEFB 4YTPB 1SE4A 1GOZA 3V05A 2QEJC 3OWEB 1KRHA 1C4CA 1A70A 1STEA 5D7GA 2FUG1 2M56B 4YSYB 5LNK1 2M0AA 5HI1A 1FFUA 4IKGA 3NVVA 1PDXA 3AE2B 1VLBA 1F2RI 1P7FA 1AN8A 1XCQL 2V3PA 1C4PA 1P7EA 1SSNA 3BK2A 3ZJTA 1AYFA 2QJLA 2PKOA 3AH7A 4O1NA 1IGDA 1I4PA 1YN3A 2RDHA 4LK0M 1QQRA 3KLSX 1M4VA 3EGRA 3CIRB 1VDVA 2RPVA 1F2RC 1TS3A 1HQRD 2J53A 3IT4B 1QLBB 3AE6B 1F0ZA 1VZ8A 2K22A 4ITKA 3B9JA 1FCCC 3IXSA 3KWLA 3U4EG 2PVGC 1FIQA 1JMLA 1KTKA 4IOIE 2QMTA 4RGTA 3GS2A 2HTME 2E6XA 1VRAB 2JYEA 3B2GA 3BK1A 1QOBA 4H2AA 1I4GA 5BYQA 2BT6A 1SE3A 3VR9B 3ZQ4A 1N62A 1TKEA 1NYQA 1L6UA 1WXQA 4A9AA 2Z8LA 2L52A 1FXAA 2WU2B 1SJED 1IGCA 3P1MA 1AW7A 4LTUA 4OW0A 3AEDB 4NZLB 3AEBB 2WXKA 2IGDA 1C78A 1C76A 4A6QA 3PZ7A 1F77A 2LUMA 1DYQA 1HZ6A 1L5PA 3Q8BA 2WXOA 2LEKA 3R2TA 1FMAD 2BS4B 2LMCA 2PTLA 3FC4A 1L4ZB 4DXGA 5BMHA 3ZJUA 4JE3B 1C4AA 3L4PA 3VQIA 4NAMA 4YT0B 2Q5WD 2LFIA 3EUB2 3I57A 1HXYD 2CJNA 3AE1B 4A55A 5FK9C 1JWBD 2JU6X 4RGOS 1N63A 1VZ6A 1YQ3B 3BIID 3IAM1 4R3DA 1SXTA 4NJCA 1ESFA 2Y5CA 4HRSA 3WCQA 5BYRA 1N5WA 2LHEA 1E7PB 1WYGA 4WIPA 2LHDA 1KH0A 2SAKA 1KLUD 2ICIA 2Y5PA 1JWAD 2JWUA 4N59A 4YWGG 1EM7A 1XLPA 2KDMA 1QT9A 3AE8B 2VZKB 3AMZA 1YNTE 4C56C 4YSZB 4NAWB 3NVZA 1HA5A 1IUEA 3BZDB 3MC0B 1SBBB 1PFDA 1KF6B 2SEBD 2WXHA 3H8HA 5EE9A 1B1ZA 2W55A 3Q8EA 1DOXA 3NVYA 4MH8A 1TY2A 5HG2A 3GP7A 2DYOA 2JZPA 1XLNA 5HFYA 4N6EB 3TSSA 1NEKB 5MPOA 1T6BX 4GDKB 1UWXA 3AE9B 3SFEB 1J7AA 4GLSC 3O13A 3AEEB 3FAHA 3PO0A 5H92C 2JQRB 2ZW0A 1ZXHA 2KWDA 1OQQA 1ZP0B 1K51A 4JWSC 2ACZB 4OZCA 3AN1A 2JYTA 1TKYA 2WXMA 4ZRQA 1JROA 4ZHOA 4RGNA 3I9V1 3U52E 1VZ7A 3UI3A 4TQ1A 1DOIA 1ZE3D 1RM6C 1SB3C 3NUHB 4ZOHC 2J42A 2K9XA 2BW2A 3MJ5A 5AUKA 1DOYA 3AE7B 1BXTA 4RFBA 3BYTB 3BVMA 1EWYC 1TKGA 1ACCA 1FNUA 1XF5L 3HUIA 3MP9A 4TQ0A 2PIAA 4HKQA 5C3JB 2INPE 2M19A 2IPKD 1GAQB 2L1AA 4RH6A 5HHDG 1XO3A 3NRZA 2RMMA 3ZYYX 1Q10A 4MM3B 2V0GA 1D4BA 2J4XA 1UUPA 1V8CA 2BB5A 2WXJA 2WS3B 3P4RB 4HEA1 3SEBA 2N9KA 4GDLB 5BMIA 1D5MC 2Y3AA 3AE5B 2G9HD 3C8YA 1I7HA 3PZ8A 3IAS1 1PGXA 1SIJA 1EWCA 1WRIA 1N5XA 5E6JA 1L0YB 4C7ZA 1VJKA 3HRDD 1TZOA 4TSSA 4YTNB 1GB1A 3AV8A 3ZJVA 1K53A 1V1PA 4XE0A 1B9RA 1E0ZA 1JALA 2XN9C 2BTEA 2QIEB 1SJHD 2FE8A 4US9A 4HKZE 4A90A 2GB1A 3MFGA 4USAA 1XLQA 5EE3A 5FR3A 1RFKA 2W3RA 5EE1A 3Q8CA 3V3XA 2QILA 1ROEA 3W5UB 3BWUD 1ET6A 1L4DB 1E6EB 1V1PB 3EA6A 1TS5A 3KQ4A 4HJGE 3SR6A 3Q69A 1T3QA 3E56A 1D5ZC 2V4IB 1ZDXA 1IBXA 4XWTA 5EE0A 3T3OA 2DWQA 4KKIA 2FBWB 3Q8AA 2MJ3A 3P42A 5BYSA 1CJEA 4US8A 1YQ4B 2N9LA 1UGJA 4OZAA 1CK1A 2R61A 1MVKA 2WP9B 2K0PA 1GB4A 1FO4A 4IDIA 4OZBA 1PGAA 4AQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FFU A;  3AEE B;  4KX6 B;  3W5V B;  1QOA A;  3FAH A;  1N61 A;  3NVV A;  3PO0 A;  2JQR B;  5H92 C;  1PDX A;  3AE2 B;  1GPX A;  1VLB A;  1WWT A;  1UWM A;  2MH7 A;  3DWG C;  5GXG B;  2EKI A;  2WU5 B;  2WLB A;  1OQQ A;  1ZP0 B;  1AYF A;  4JWS C;  2QJL A;  2PKO A;  2ACZ B;  3AH7 A;  3B2F A;  4JX1 C;  1ZUD 2;  2BS2 B;  3AN1 A;  1TKY A;  1QOF A;  1JW9 D;  1NI3 A;  4ZHO A;  1JRO A;  3VRB B;  1OQR A;  3CIR B;  1VDV A;  1RYJ A;  3W9C B;  1TYG B;  3AE3 B;  1QLB B;  1DOI A;  3AE6 B;  1SF0 A;  1RM6 C;  2OHF A;  1F0Z A;  1SB3 C;  2K22 A;  4ITK A;  4ZOH C;  2K9X A;  3B9J A;  1YJJ A;  1N60 A;  3KWL A;  1FRR A;  2PVG C;  1FIQ A;  5AUK A;  4YXD B;  1DOY A;  3AE7 B;  5C2T B;  3HVZ A;  1JRP A;  3P4P B;  2B76 B;  1EWY C;  1TKG A;  3HUI A;  3ABV B;  2PIA A;  5C3J B;  2M19 A;  2HTM E;  1J7B A;  3AEG B;  3LB8 C;  3B2G A;  1GAQ B;  1QOB A;  1QOG A;  2PVO D;  1XO3 A;  2BT6 A;  5G5H A;  3NRZ A;  3VR8 B;  2G1E A;  4WWM A;  4ZHP A;  3VR9 B;  3ZYY X;  1QF6 A;  1N62 A;  1TKE A;  1NYQ A;  1L6U A;  1WXQ A;  4A9A A;  2H88 B;  3SFD B;  2L52 A;  1FXA A;  1NYR A;  1NEN B;  2WU2 B;  3P1M A;  1V8C A;  4LTU A;  2WS3 B;  3AED B;  3P4R B;  3AEB B;  1CZP A;  1J7C A;  4C80 A;  4N58 A;  3AM9 A;  1YJI A;  4FXC A;  2KAJ A;  2MJE A;  3AEC B;  1XLO A;  3AE5 B;  1AWD A;  1L5P A;  4YTM B;  3AE9 B;  1I7H A;  1R7S A;  2L83 A;  2WDQ B;  2LEK A;  3DWM A;  4WQM A;  1SIJ A;  1FMA D;  3SFE B;  2KMM A;  2BS4 B;  3FC4 A;  1WRI A;  1N5X A;  1ZOY B;  3L4P A;  2H89 B;  3CWI A;  4C7Z A;  4YT0 B;  4YSX B;  1VJK A;  1V97 A;  2Q5W D;  2CJO A;  3HRD D;  4C7Y A;  3EUB 2;  1ZXI A;  4YTN B;  4P6V F;  4YSY B;  3AV8 A;  1L0V B;  5G5G A;  1WGK A;  2DBY A;  1B9R A;  2CJN A;  1JAL A;  3P4S B;  3AE1 B;  2QIE B;  3ETR A;  1E0Z A;  1JWB D;  2CU3 A;  2MJD A;  1N63 A;  1YQ3 B;  3AB5 A;  3BII D;  3LXF A;  3P4Q B;  1RWS A;  4US9 A;  1FRD A;  1KFY B;  2WQY B;  4HRS A;  2Y5C A;  1XLQ A;  4HRO A;  4USA A;  3WCQ A;  5EE3 A;  1N5W A;  1RFK A;  2W3R A;  5EE1 A;  1E7P B;  1WYG A;  1NVI D;  2K5P A;  1JQ4 A;  1JWA D;  1ROE A;  3AEA B;  2AX5 A;  3W5U B;  4N59 A;  3RPF C;  1XLP A;  1E10 A;  1E6E B;  1DGJ A;  1QT9 A;  1FFV A;  2BS3 B;  2N0S B;  3AE8 B;  3AMZ A;  5AUI A;  3SR6 A;  4YSZ B;  1T3Q A;  1TJE A;  3NVZ A;  5EE0 A;  1OFF A;  3VRA B;  1FXI A;  2DWQ A;  2FBW B;  2W54 A;  1FM0 D;  1IUE A;  2MJ3 A;  1CJE A;  2WDV B;  4US8 A;  3AE4 B;  1PFD A;  1YQ4 B;  1KF6 B;  1E9M A;  2WDR B;  5EE9 A;  2W55 A;  3AEF B;  3P63 A;  4YTP B;  3NS1 A;  1DOX A;  3NVY A;  1KRH A;  4JWU C;  1XLN A;  2WP9 B;  4N6E B;  5H8Y E;  1A70 A;  1NEK B;  5MPO A;  1FO4 A;  1PUT A;  1L6V A;  3NVW A;  4IDI A;  2E3T A;  2M56 B;  1J7A A;  2JX5 A;  2W3S A; 
#chains in the Genus database with same CATH topology
 2K6Q A;  3OAW A;  2KMA A;  4KZ0 A;  2X8X X;  5L95 C;  2N1W A;  4MAC A;  4DXA B;  2WU5 B;  4RF0 A;  4ARI A;  4AJY B;  4WH4 A;  1J8C A;  1JW9 D;  4FHK A;  1RYJ A;  1OEY A;  4B0E A;  2KYW A;  2KWC A;  3FIL A;  1C77 A;  2I38 A;  2IGG A;  3H7S A;  4G3X B;  3DOW A;  3BYY B;  4BOZ B;  1E7V A;  3KH0 A;  2RDB C;  3VH4 B;  1Z5S B;  1ENF A;  1WR6 E;  2CU1 A;  1J7B A;  2INC C;  3LB8 C;  2ZNV B;  4GGQ A;  2KJH B;  4WWM A;  3RCZ A;  4Q2J A;  1NEN B;  3X23 A;  3TEX A;  1YJI A;  2MRP A;  3U8Z A;  1R7S A;  3Q14 C;  1T0Y A;  2KMM A;  2N4F A;  3HHM A;  1E8Y A;  4M0W B;  2CJO A;  4AS1 A;  3DVN U;  1YIW A;  3IBE A;  3P4S B;  2WXQ A;  3MJW A;  3TEY A;  4HRO A;  2LGD A;  1Z2M A;  4WJO A;  2YEP B;  1JWU D;  2JXX A;  4ZYS A;  2LJ5 A;  2LRU A;  1J0G A;  4L23 A;  4MJS B;  2M0X A;  1XXG A;  2KTR B;  4FA6 A;  3WAN A;  4EOY A;  2KZR A;  3P63 A;  2VH2 A;  3NS1 A;  4OHJ A;  2ONQ A;  3NVW A;  2E3T A;  5LLI A;  2PVO D;  2KTF A;  2MP2 A;  4KX6 B;  4PS8 A;  1N61 A;  5G2N A;  2DYM A;  2DZM A;  4DK5 A;  5JXV A;  4FLH A;  4LNK A;  5HKH A;  4IG7 B;  4IM2 A;  4NPN A;  1WGH A;  4MGK E;  5LXI B;  1YJJ A;  5C2T B;  3HVZ A;  2JSV X;  2B76 B;  3ZIM A;  3TCA A;  1X1M A;  4PT5 A;  1LXD A;  2HJ1 A;  2EMS A;  4P16 A;  5G5H A;  3UIP B;  1I4Q A;  3TIX A;  4S0R A;  4XC2 A;  1WGD A;  3GE3 C;  4ZHP A;  2WHI A;  4GIV A;  4HVB A;  1XD3 B;  3ZO5 B;  2JY6 A;  1E5W A;  3MC8 A;  3L10 B;  3V62 A;  4W9D A;  2KDB A;  2JUO A;  4FJY A;  4IUM B;  2KAJ A;  2FCS A;  1QIL A;  3U2S C;  1AWD A;  2L83 A;  2Z0D B;  4WQM A;  4RF1 A;  1EU4 A;  2IYD B;  2KO3 A;  3L54 A;  2ON8 A;  2H89 B;  4B9K A;  2HTH A;  4XDD A;  3LXF A;  3EFC A;  3PTF C;  3SU8 X;  1I4H A;  4J3O D;  1GC7 A;  3DVG Y;  3SD5 A;  1Y8R C;  1E10 A;  2BF8 B;  1WSP A;  1KLG D;  2GBR A;  3RFZ B;  2DZJ A;  1FXI A;  2DLB A;  2KOX A;  1E9M A;  3WAM A;  3AEF B;  1SE4 A;  2XBB C;  2L3Z A;  2REX A;  1R4N I;  5D7G A;  4K1R B;  1H4R A;  1FFU A;  1EO6 A;  1AN8 A;  2C9W B;  3BK2 A;  3NG0 A;  2BYE A;  3AH7 A;  3AU5 A;  1QQR A;  2MBB B;  1GUA B;  2KAN A;  4DWF A;  3A9J B;  1QLB B;  1F0Z A;  2WX1 A;  4WAA A;  2K22 A;  3B9J A;  3JSV B;  3IXS A;  3KWL A;  4LDT B;  4K81 A;  5AZH A;  4RGT A;  1C1Y B;  2KLG A;  4WJN A;  3B2G A;  1E8Z A;  3VH3 B;  2LD9 A;  1V2Y A;  4LCD E;  2FIF A;  2KNB A;  5J2R A;  3VR9 B;  1WGR A;  2KQ7 A;  2CR5 A;  5DPT A;  4BBN C;  2WU2 B;  3JW0 X;  4ICV A;  4A6Q A;  1DYQ A;  3N32 A;  4G50 A;  1KM7 A;  2WXO A;  3VVW B;  1FMA D;  3T9L A;  1OEY J;  4DXG A;  5BMH A;  1L4Z B;  3PT2 B;  1C4A A;  1NI2 A;  3L4P A;  3VQI A;  4NAM A;  4YT0 B;  5JHA A;  3VUY A;  2D3B A;  1XT9 B;  2KC1 A;  2CJN A;  4A55 A;  5FK9 C;  3VUX A;  2JU6 X;  1N63 A;  3BII D;  2LVP A;  3IAM 1;  4R3D A;  1SXT A;  4NJC A;  1ESF A;  3WCQ A;  1SE9 A;  1N5W A;  1WYG A;  1LM8 B;  2N7E A;  1JWA D;  4N59 A;  4YWG G;  4M02 A;  1QT9 A;  3DBL B;  4YSZ B;  4NAW B;  3NVZ A;  2EKE C;  3ZNI D;  1SBB B;  2NS5 A;  2M8S A;  1KF6 B;  3H8H A;  1DOX A;  4MH8 A;  1TY2 A;  2DYO A;  2JZP A;  2OOB B;  3TSS A;  5MPO A;  1SIF A;  3AE9 B;  3SFE B;  3O13 A;  4XZ4 A;  3FAH A;  5H92 C;  3Q2A C;  2CHW A;  2ZPY A;  4E74 A;  4JWS C;  2MCN B;  3AN1 A;  2JYT A;  4ZRQ A;  2KJR A;  1E90 A;  2DYB A;  5KHO A;  3U52 E;  1MG4 A;  4E71 A;  3WA0 A;  1DOI A;  3PRZ A;  3RNC C;  4I6L B;  4P1B C;  2K9X A;  2O6V D;  4NQK E;  5CHV C;  2MHJ A;  3RD2 A;  3AE7 B;  1BXT A;  3H7P A;  1EWY C;  3HUI A;  3N1Z C;  4TQ0 A;  3CF6 E;  2PIA A;  4HKQ A;  1XQQ A;  3M62 B;  4MDK E;  1GAQ B;  5IA7 A;  4LNF A;  3HIZ A;  4GOC A;  1UZX B;  4B95 A;  2BGF A;  2KLC A;  5DPS A;  4C4V B;  4GU2 A;  4HPL B;  2WXJ A;  4MEL A;  3SEB A;  1D5M C;  2Y3A A;  3ZDM C;  2G9H D;  3CMM B;  3GOE A;  1PGX A;  1EWC A;  1UGM A;  2XK5 A;  1N5X A;  4KSK C;  2L05 A;  3HRD D;  2BWF A;  1V6E A;  3RUL A;  3P2B A;  3ZJV A;  4ZRJ A;  1V1P A;  2C5L C;  4XE0 A;  4II2 B;  2I1K A;  3T8M A;  2GB1 A;  4XX5 A;  2PE9 A;  4ANX A;  4URK A;  1RFK A;  2EMT A;  1ROE A;  1RLF A;  3BWU D;  3U30 A;  4KIK B;  1ET6 A;  1E6E B;  3SR6 A;  1WX8 A;  3ML9 A;  1D5Z C;  2RSU A;  2MWS B;  2DWQ A;  3QC8 B;  3QJZ A;  1YQ4 B;  4M00 A;  1GC6 A;  3HM6 X;  2BYV E;  3RI7 C;  2J0J A;  1MG8 A;  1FNW A;  3W5V B;  4W9K A;  4KKJ A;  1IBX B;  3RN9 C;  3MHZ A;  3IVF A;  3Q3N C;  2KDE B;  1V5T A;  1QOF A;  2D3G A;  3RNG C;  4EZK A;  3DBS A;  4EFO A;  4WUR A;  5C23 A;  2WWZ A;  1GG3 A;  2IO2 B;  2UYZ B;  4XWW A;  1I4R A;  1JRP A;  1ZKH A;  3ABV B;  3R8B A;  2HDE A;  5BO4 B;  3HK0 A;  4OVZ A;  2BYF A;  4HPP A;  3OG5 A;  5IOI A;  5CHW A;  3SFD B;  1WF9 A;  1TS4 A;  3IFW B;  3N20 C;  2JT4 B;  1D6E C;  5GMV A;  1CZP A;  1J7C A;  2I2Y A;  3AM9 A;  2FNJ B;  2KX3 A;  4K7W A;  2N9P C;  2KT7 A;  2WXF A;  2VZK D;  4UDU C;  1WXV A;  2WDQ B;  2YEP F;  3L17 A;  4WQO B;  3J9C A;  2BPS A;  2IJ0 A;  2DNF A;  4KV2 A;  1L7Y A;  3N1X C;  1ZXI A;  2KVR A;  3ML8 A;  4MSM B;  4NNJ B;  5I4D A;  1CQV A;  3RZW C;  2O2V A;  2DAJ A;  5JZE B;  1SE2 A;  2FUH B;  4WAF A;  5D2M B;  2AQ1 B;  3RPF C;  2LGI A;  3NOB A;  2XNA C;  2W82 A;  1DGJ A;  3U7Z A;  4HCP B;  1TJE A;  3A1Q A;  1FM0 D;  1WFY A;  2BKR B;  2A5U A;  2WDR B;  2X38 A;  2MBO A;  4JWU C;  1JWS D;  2KK8 A;  1L6V A;  4XDC A;  3R3M A;  4EZL A;  2JX5 A;  2W3S A;  4DHJ B;  5TR5 A;  4D2K A;  3VFK A;  1UWM A;  3DWG C;  1P9D U;  2EKI A;  4FUL A;  4I6N B;  4NJ7 A;  3K9P B;  4GN1 A;  2GRI A;  4I6P A;  4JX1 C;  2YLM A;  4RGM A;  3EFU A;  2KFK B;  1P0R A;  3IT6 B;  3IHP C;  1UNS A;  4M8M A;  3QK0 A;  3RYT A;  1C79 A;  2FID A;  4LDT D;  5KHQ A;  3KWV A;  1N60 A;  3GB1 A;  3B08 A;  3PRM B;  4MT5 A;  3A4S C;  2L32 A;  3RUI B;  2WX0 A;  3BVG A;  1MHH E;  1E8X A;  4K3B A;  2ZVN A;  1YMH E;  2LZ6 A;  4JIO U;  1FCL A;  2CHZ A;  2RDG A;  3PHW B;  2O6V B;  1MI0 A;  5T8I A;  4A3P A;  2AQ2 B;  2KWU B;  5E6P A;  1YN4 A;  2A4Z A;  2N7J A;  2ASQ A;  1QKZ A;  5AZF A;  5G5G A;  2MJD A;  1FRD A;  1KFY B;  3B0A A;  1TGZ B;  2ZPN A;  2K5P A;  4XYC A;  3ZTC A;  1ZPS A;  2K25 A;  2AX5 A;  1FD6 A;  3T3N A;  4GB9 A;  5AUI A;  1PYW D;  4NY0 A;  2IO3 B;  1K52 A;  2C7N B;  1XCT L;  3AE4 B;  1V86 A;  1TY0 A;  1GOZ A;  3V05 A;  2VRR B;  1C4C A;  1A70 A;  4P7I A;  1K8R B;  2FUG 1;  4YSY B;  5LNK 1;  3QX1 A;  5HI1 A;  3EHV A;  1VLB A;  4MSQ B;  1C4P A;  4LNO A;  1SSN A;  3ZJT A;  2QJL A;  1WRD B;  4O1N A;  3GE8 C;  1IGD A;  4LK0 M;  1M4V A;  2RPV A;  1YD8 U;  1TS3 A;  1HQR D;  3AE6 B;  3H7P B;  2KMC A;  1FCC C;  4AWJ A;  2IY0 B;  3WAL A;  5IN7 A;  3GS2 A;  2HTM E;  3DVG X;  3L16 A;  2E6X A;  1VRA B;  2JYE A;  3BK1 A;  5BYQ A;  1QOB A;  3TJP A;  1I4G A;  4A3O A;  1SE3 A;  2MW5 A;  2D3A A;  3ZQ4 A;  3UIO B;  4W9E A;  2L52 A;  2MSE D;  1FXA A;  3A4R A;  1SJE D;  4NQL B;  4OW0 A;  4LTU A;  4NZL B;  3PZ7 A;  4KVG B;  1HZ6 A;  3Q8B A;  2RR9 A;  3Q3F A;  3OJ4 B;  3R2T A;  2BS4 B;  2LMC A;  2PTL A;  3KUC B;  2Q5W D;  3MC9 A;  1V5O A;  1RAX A;  4K7U A;  1T0S C;  3AE1 B;  1VZ6 A;  4HRS A;  2KHW B;  1WIA A;  1YX5 B;  2LHE A;  1E7P B;  4WIP A;  4TV3 A;  3CSF A;  2GOW A;  4GDK A;  2JWU A;  1EM7 A;  1WMH A;  2AWT A;  3D32 A;  2KDM A;  3AI5 A;  3AMZ A;  2VZK B;  1J19 A;  4II3 B;  3Q3J A;  3DBR I;  4DDI D;  1IUE A;  3I3T B;  2GBJ A;  2WXH A;  3I63 C;  1B1Z A;  4DBG A;  3NVY A;  5HG2 A;  3GP7 A;  2QCZ A;  1UWX A;  3BIN A;  1LGR A;  3PO0 A;  2ZW0 A;  1ZXH A;  3EC8 A;  5CTR C;  2D10 A;  3KYC D;  3L13 A;  3NJT A;  1T0R C;  4RM8 A;  4OZC A;  1HE8 A;  4OVU A;  4F7Z A;  2ZCB A;  2WXM A;  4IWP A;  3TMP B;  1ZE3 D;  1RM6 C;  2J42 A;  4WWN A;  2V3S A;  3MJ5 A;  3H1U A;  4GSW A;  3BYT B;  4TUU A;  4W9L A;  3MP9 A;  2ZEQ A;  2M19 A;  2IPK D;  4RH6 A;  1JRU A;  3TBL D;  2RMM A;  4MM3 B;  5E6N A;  4W9G A;  1P1A A;  1UUP A;  3BY4 B;  1V8C A;  4GDL B;  4EKU A;  3CST A;  4FJZ A;  3APC A;  4HXD A;  1I7H A;  3C8Y A;  3IAS 1;  1SIJ A;  1UBQ A;  1L0Y B;  4JGH B;  3VDZ A;  3ENE A;  4C7Z A;  1TZO A;  2RGF A;  1L2N A;  2O2V B;  1JAL A;  2LWP A;  5L83 A;  4USA A;  3ZXV A;  1XLQ A;  4F1S A;  2V4L A;  5FR3 A;  5JH5 C;  3Q8C A;  3ZTD A;  3A1Q B;  1WH3 A;  3ZNG C;  3W5U B;  4AOF A;  1L4D B;  3KQ4 A;  4BKS D;  1T3Q A;  3E56 A;  2V4I B;  3M63 B;  2MBH A;  5EE0 A;  4PYZ A;  4KKI A;  2FBW B;  3ZNH B;  1CJE A;  2LI5 A;  4EEW A;  2K39 A;  2R61 A;  4DHJ D;  2WP9 B;  1F52 A;  1GB4 A;  1QOA A;  1GPX A;  4KGR A;  4EE2 A;  2LGX A;  3DVN V;  4OVV A;  2JZZ A;  1EU3 A;  1JWM D;  3TUO A;  2LJI A;  2JZ3 B;  1NI3 A;  1YQB A;  3NY5 A;  5LXH A;  1I4X A;  1TBE A;  1T5X D;  3HM3 A;  1TYG B;  3AE3 B;  2KVZ A;  5D3D A;  1FEH A;  2PLP A;  1YX6 B;  2EEL A;  2W9N A;  3R2I A;  1E8W A;  3N9Y C;  2MBQ A;  1D3Z A;  1LO5 D;  3C19 A;  1WXS A;  3JYU A;  1QOG A;  1MPE A;  3SHQ A;  3UF8 A;  4AJW A;  3DBH I;  1UBI A;  3FIL B;  1NYR A;  2J52 A;  4M0W A;  1WM2 A;  2WXN A;  2L8J A;  4PK1 A;  3AEC B;  4EUT A;  2ZCC A;  2BB6 A;  5D94 A;  2G45 B;  4GXB A;  3CWI A;  4IC7 B;  4W9H A;  4ARC A;  4C7Y A;  3E9S A;  1FNV A;  1WGK A;  1TS2 A;  3C0R B;  4MJS A;  3VHT C;  3ETR A;  2KTR A;  2CU3 A;  3V6C B;  3AB5 A;  1RWS A;  3LJ3 A;  3FKY A;  3ECI A;  4FJV B;  2V9H A;  2KQ4 X;  1MHX A;  4PYU A;  1R4M I;  2DZK A;  1Q1O A;  1MFW A;  4LJP B;  1I35 A;  3UIN B;  4JL9 A;  3N30 A;  1QZE A;  2LGS A;  1OFF A;  2WXL A;  1PGB A;  3KUZ A;  3ZW3 A;  2MLB A;  5EDS A;  2D3C A;  1ZDV A;  1BML C;  2KQS A;  2KWV B;  4JPS A;  2AQ3 B;  4XGA B;  5H8Y E;  3KVF B;  2IZV B;  2NBW B;  4DDG D;  3RNF C;  4KGT A;  3H9D A;  2K8H A;  3HVD A;  4EZJ A;  2MH7 A;  5GXG B;  4FHJ A;  4PS7 A;  2G4S A;  1AAR A;  3B2F A;  2WXI A;  2BS2 B;  5BMG A;  2IND C;  1R4N B;  2OED A;  1OQR A;  4W9C A;  2AYO B;  2LXC A;  2MP2 B;  3ZLZ A;  5DPW A;  1Q5W B;  2L0T A;  1K50 A;  2FCQ A;  5AEK B;  2NMQ A;  1WXA A;  4YXD B;  1BUI C;  2MEK A;  3X0W A;  2ZNV C;  3PS6 A;  1WX9 A;  1HTQ A;  4ZRP A;  2IBI B;  4F8C B;  5CX3 A;  2PPH A;  3VR8 B;  1QF6 A;  1VR9 A;  2ZW1 A;  1VD2 A;  1WZ3 A;  2H88 B;  3PHX B;  4FN2 A;  3LYY A;  2N1V A;  3PVL A;  2UWQ A;  4KDI C;  4JQW C;  5AZG A;  2IDY A;  4N58 A;  4FXC A;  2MJE A;  5J17 A;  2NPT A;  2G3Q B;  4L1B A;  1S1Q B;  4YTM B;  4GMV A;  1ZOY B;  1V1O A;  4DQO C;  1N6Z A;  4BKG A;  2JRI B;  2LRW A;  2JVC A;  4WWP A;  4RNA A;  2KDI A;  2IY1 B;  3DHH C;  3R7Q A;  1WM3 A;  3OJ3 A;  1ZGU B;  3APD A;  1WJN A;  1JQ4 A;  2V3N A;  4CYE A;  4ZYN A;  1P3Q U;  1FFV A;  3QAQ A;  4KGS A;  2PW9 A;  3QCA A;  3VRA B;  2WDV B;  1HZ5 A;  1EF5 A;  2IGH A;  4WWO A;  2QEJ C;  3OWE B;  4BFR A;  3A9J A;  2NR2 A;  1V49 A;  2M0A A;  4HPM B;  3NVV A;  2K8B A;  1PDX A;  2HE7 A;  3AE2 B;  2KFJ A;  2Z0E B;  1P7F A;  2V3P A;  3JSV A;  2D2Q A;  3EEC A;  3RNB C;  2L0F A;  1I4P A;  1YN3 A;  2RDH A;  3EGR A;  3CIR B;  1VDV A;  4M01 A;  2J53 A;  3IT4 B;  4G0N B;  4ITK A;  2JRH A;  3DPD A;  1FIQ A;  3Q3M C;  1JML A;  3M3J A;  4IOI E;  2QMT A;  2JPH A;  1F1H A;  2G4D B;  1WI0 A;  1N62 A;  1TKE A;  1WXQ A;  1L6U A;  4A9A A;  2Z8L A;  3RZF A;  3PZD A;  2GLS A;  3AED B;  3AEB B;  3VTW A;  1C78 A;  3NS8 A;  2IO0 B;  3ZDT A;  2M1M A;  3V6E B;  5IKC M;  2LFI A;  3EUB 2;  4IWO A;  3ONS A;  1UH6 A;  2GBN A;  2L7R A;  4NAW A;  1JWB D;  1WGG A;  4RGO S;  1YQ3 B;  2Y5C A;  5BYR A;  1WE6 A;  4C00 A;  4KSL C;  1KH0 A;  2NBV B;  1XLP A;  1UD7 A;  3AE8 B;  4C56 C;  1WE7 A;  3Q6B A;  1HA5 A;  3BZD B;  3MC0 B;  4G11 A;  1UEL A;  2SEB D;  5DCN A;  5EE9 A;  3R7R A;  1ZW7 A;  3LDZ E;  4KZC A;  1XLN A;  3AUL A;  4K7S A;  2OJR A;  3TL5 A;  1J7A A;  4BAX A;  3AEE B;  3KUD B;  3OLM D;  1OQQ A;  4ZDV A;  1K51 A;  2V1Y A;  1TKY A;  2KDF B;  3UI3 A;  1SB3 C;  2RPQ A;  4ZOH C;  1T0Q C;  4C4V A;  5AUK A;  2D11 A;  4N9F 4;  4PS3 A;  1TT5 B;  2FCN A;  4HWI B;  1XF5 L;  2INP E;  1XO3 A;  3DHI C;  1KJT A;  3ZYY X;  2QHO A;  2D07 B;  2WS3 B;  4M8N A;  1YJ1 A;  1IYF A;  4ANV A;  4MGZ E;  2N9K A;  2R2O A;  2BWE S;  4X57 B;  1WRI A;  2YVC A;  5E6J A;  1LQB A;  2HJ8 A;  2KXJ A;  2L76 A;  4TSS A;  4KIK A;  3PRE A;  3AXC A;  2XN9 C;  3DBL I;  2BTE A;  1E0Z A;  2FE8 A;  3ZUN A;  4US9 A;  4HKZ E;  4A90 A;  3MFG A;  1A5R A;  2XK5 B;  5EE1 A;  3PGE A;  3A33 B;  3ZKJ C;  2PE6 B;  4BKT A;  3V3X A;  2QIL A;  1NDD A;  4ZRI A;  3PLU A;  1V1P B;  3EA6 A;  4IM3 A;  1ZDX A;  1IBX A;  4XWT A;  3DDC B;  3P42 A;  5BYS A;  2HD5 B;  4K3C A;  4DHZ E;  1RFA A;  1UGJ A;  1CK1 A;  3APF A;  4CO7 A;  1MVK A;  1M94 A;  4WJQ A;  5IAA C;  4OZB A;  1PGA A;  4AQ7 A;  3NZ3 A;  3UQA A;  3PLV A;  1WWT A;  3NZU A;  4TKN A;  2C60 A;  1WX7 A;  1BT0 A;  3GZN I;  4MGI E;  1WZ0 A;  3O65 B;  1ISN A;  3ZNZ B;  2K6D B;  2MBE A;  3A9K A;  3VRB B;  4CHK A;  2DX5 B;  2XEW A;  1SEB D;  1SF0 A;  3ZVV A;  3DHG C;  1WJU A;  5CHF A;  3MTN B;  4B6W A;  4REZ A;  3PPA A;  2M17 A;  3V60 A;  3PRP B;  2WDT B;  3P4P B;  2PMV A;  2Y5B B;  3AEG B;  3VXW A;  3W1Y A;  2BKF A;  1F9J A;  2BYT A;  1WYW B;  2NPT B;  2QSD A;  1OGW A;  2K1F A;  2DZI A;  2NBU A;  4C80 A;  2MQJ A;  1XLO A;  2QDF A;  1CMX B;  1YN5 A;  2BVC A;  1C9F A;  2BBC A;  2JXT A;  3DWM A;  4B0M A;  1WY8 A;  1KOT A;  2M4N A;  4BOS C;  1C3T A;  2I1J A;  3RNE C;  1HTO A;  1PQS A;  4P6V F;  4AP4 C;  2DBY A;  3QA8 A;  4HK2 A;  3P4Q B;  1Q0W B;  4BKS A;  4A8X C;  4HLE A;  2B3A A;  4J6I A;  1NVI D;  4YL8 A;  2WNM A;  1IP9 A;  1JCK B;  3W1S A;  2N0S B;  2RD0 A;  2LUE A;  1ET9 A;  3QAR A;  5D3I B;  2Z59 B;  2WXR A;  2N9E B;  5TSS A;  1XEE A;  1GJZ A;  2KFK A;  1L0X B;  1PUT A;  1E7U A;  2L00 B;  2MX2 A;  3TEZ A;  2LXA A;  3VTV A;  2GI9 A;  1HEZ E;  2WLB A;  2DHZ A;  1ZUD 2;  4DXF A;  4BVU C;  2NTS A;  3W9C B;  5JHB A;  2KAC A;  3TEW A;  2OHF A;  3PV1 A;  3I5J C;  4BBN F;  4CQN A;  3B1L X;  3L0W B;  1FRR A;  1YOV B;  2GBM A;  2PEA A;  4L2Y A;  3ZXR A;  2KN4 A;  2PJH A;  3Q8F A;  2WYQ A;  4WJP A;  4LNN A;  2O6V A;  4HDQ A;  2R2Q A;  2G1E A;  2D5G A;  4MH0 E;  5FR6 A;  2TSS A;  1EF1 A;  1Y56 A;  4ANU A;  3WAO A;  4JLC A;  5FKA C;  1G6J A;  3W2D A;  4YSX B;  3VUW A;  1V97 A;  2J7Q B;  1L0V B;  4RCO A;  1OQY A;  3URY A;  2KD0 A;  2WQY B;  2AL6 A;  2NTT A;  4NJ6 A;  2K3U A;  4LLG M;  3ZRF A;  2JWZ A;  4FBJ B;  5DPR A;  3AEA B;  2QC8 A;  3WIM A;  4HCN B;  2BS3 B;  4TMA B;  3ZGZ A;  1EUV B;  1U4A A;  3QQ8 B;  3UQB A;  3BVZ A;  3NHE B;  1D5X C;  5G55 A;  2W54 A;  2WXG A;  5J18 A;  2KKC A;  3KW5 B;  2WXP A;  2INN E;  4YTP B;  1WJ4 A;  3W1S C;  1KRH A;  1STE A;  3GZN B;  2M56 B;  4BZA A;  3DQV A;  4P1C C;  4IKG A;  3DBR B;  1F2R I;  1XCQ L;  1NBF C;  1P7E A;  1AYF A;  2PKO A;  4ACF A;  3MHS D;  3R66 C;  4KDL B;  4W9J A;  3KLS X;  3N1Y C;  1V80 A;  1F2R C;  3VTU A;  3M95 A;  2LVQ A;  1WXM A;  1VZ8 A;  1MJD A;  4AUQ C;  3U4E G;  2PVG C;  4RM9 A;  3RMK C;  3S2A A;  1KTK A;  3DCG A;  1TTN A;  4H2A A;  2BT6 A;  1NYQ A;  3UGB B;  3Q3O C;  2ZJD A;  3P1M A;  1IGC A;  2K8C A;  1AW7 A;  3V61 A;  2WXK A;  2IGD A;  5IP4 D;  1RRB A;  1C76 A;  3VAW A;  1F77 A;  2LUM A;  1L5P A;  1TZ1 A;  2CKH B;  2LEK A;  3FC4 A;  3ZJU A;  1IPG A;  2KX0 A;  4JE3 B;  4LNI A;  3QIJ A;  2C7M B;  2C7H A;  2UU7 A;  3I57 A;  3RT3 B;  1HXY D;  1SGH A;  4ZRK A;  4IW0 A;  1UF0 A;  4IWQ A;  2LVO A;  2WGS A;  2GBK A;  2LHD A;  3NZS A;  2SAK A;  1KLU D;  2ICI A;  2Y5P A;  2NVU I;  1P98 A;  1YNT E;  2CS4 A;  1WR1 A;  4ASW C;  1WJ6 A;  4E3C A;  1GNU A;  4HDO A;  4ANW A;  5IO9 A;  2VH1 A;  1PFD A;  2W55 A;  3Q8E A;  5HFY A;  4N6E B;  1NEK B;  1T6B X;  2FAZ A;  4GDK B;  5D6J B;  1S3S G;  1WMH B;  4GLS C;  4RMA A;  4S17 A;  2CHX A;  1H8C A;  3H6N A;  2JQR B;  4W9F A;  3A9K B;  2DAF A;  2KWD A;  1ZP0 B;  2ACZ B;  4MEM A;  4ZHO A;  1TIF A;  1JRO A;  3QWZ B;  1V9J A;  5E6O A;  4RGN A;  4ICU A;  3I9V 1;  1VZ7 A;  5C1Z A;  4MGY E;  4TQ1 A;  3K9O B;  3NUH B;  4MM3 A;  2BW2 A;  3RNA C;  2KJ6 A;  4QAY A;  2AEH A;  1DOY A;  1LFD A;  4RFB A;  3BVM A;  4HJK A;  1TKG A;  1ACC A;  1FNU A;  4GDL A;  1FXT B;  5C3J B;  2BQQ A;  2L1A A;  3JVZ X;  4FAD A;  5HHD G;  3NRZ A;  1V81 A;  1VCB A;  1Q10 A;  2KN5 A;  1WGY A;  2V0G A;  1D4B A;  2J4X A;  3ZRC A;  4W9I A;  2BB5 A;  2OJW A;  3P4R B;  4HEA 1;  2J0K A;  1I42 A;  4DHZ B;  5BMI A;  2N9X A;  3AE5 B;  2FCM A;  3QHT A;  2MA9 B;  2GMI C;  3PZ8 A;  3DBH B;  4A20 A;  3N3K B;  2LGY A;  3AU4 A;  1VJK A;  2KC2 A;  4YTN B;  1GB1 A;  3AV8 A;  1K53 A;  2NCN A;  1B9R A;  2QIE B;  2N7D A;  1SJH D;  2J0M A;  1OTR B;  5EE3 A;  3U7D A;  2W3R A;  2IO1 B;  1KLV A;  2ZVO A;  2ZZP B;  3L08 A;  3ALB A;  4IM0 A;  1TS5 A;  4HJG E;  3WAP A;  3Q69 A;  3T3O A;  2LAS A;  3Q8A A;  2MJ3 A;  3SDL C;  4US8 A;  2AL3 A;  1R4M B;  2N9L A;  2DEN B;  4OZA A;  3IG3 A;  1FPY A;  3KYD D;  2K0P A;  4LJO B;  2JF5 A;  1FO4 A;  4IDI A;  3PSE B; 
#chains in the Genus database with same CATH homology
 1FNW A;  3NZ3 A;  3W5V B;  1QOA A;  1GPX A;  4KGR A;  4MAC A;  4EE2 A;  4KKJ A;  1IBX B;  1WWT A;  3MHZ A;  2WU5 B;  1EU3 A;  1JWM D;  4RF0 A;  4ARI A;  3TUO A;  4WH4 A;  2LJI A;  1QOF A;  1JW9 D;  1NI3 A;  3VRB B;  1I4X A;  1RYJ A;  1T5X D;  1TYG B;  3AE3 B;  1SEB D;  5D3D A;  1SF0 A;  1FEH A;  4B0E A;  2PLP A;  4WUR A;  2EEL A;  3FIL A;  1C77 A;  2I38 A;  4REZ A;  4XWW A;  2IGG A;  1I4R A;  3R2I A;  3BYY B;  1JRP A;  3N9Y C;  3P4P B;  3ABV B;  1ENF A;  1LO5 D;  3R8B A;  2PMV A;  1J7B A;  3AEG B;  3LB8 C;  2HDE A;  1QOG A;  4OVZ A;  1MPE A;  4WWM A;  4Q2J A;  3FIL B;  3SFD B;  2BYT A;  1NYR A;  2J52 A;  2QSD A;  1NEN B;  4M0W A;  1TS4 A;  1D6E C;  1CZP A;  2WXN A;  1J7C A;  3TEX A;  4C80 A;  2I2Y A;  3AM9 A;  1YJI A;  3AEC B;  1XLO A;  1YN5 A;  1C9F A;  2WXF A;  2VZK D;  1R7S A;  2BBC A;  4UDU C;  2JXT A;  2WDQ B;  2YEP F;  3DWM A;  2BB6 A;  2KMM A;  4B0M A;  3J9C A;  3CWI A;  2IJ0 A;  4ARC A;  2CJO A;  4C7Y A;  3E9S A;  4AS1 A;  1ZXI A;  4P6V F;  1FNV A;  1WGK A;  2DBY A;  1TS2 A;  3P4S B;  2WXQ A;  3ETR A;  2CU3 A;  3P4Q B;  3AB5 A;  3TEY A;  1RWS A;  4A8X C;  5I4D A;  4HRO A;  1CQV A;  2KQ4 X;  1MHX A;  1SE2 A;  1NVI D;  2YEP B;  1JWU D;  4WAF A;  2AQ1 B;  2WNM A;  4ZYS A;  3RPF C;  2LGI A;  2XNA C;  2W82 A;  1DGJ A;  1JCK B;  4L23 A;  3W1S A;  2N0S B;  3U7Z A;  1XXG A;  1TJE A;  1ET9 A;  1OFF A;  2WXL A;  1PGB A;  5D3I B;  1FM0 D;  2WXR A;  1ZDV A;  5TSS A;  1XEE A;  1BML C;  2WDR B;  2X38 A;  3P63 A;  3NS1 A;  4JPS A;  2AQ3 B;  4JWU C;  4OHJ A;  1L0X B;  5H8Y E;  1JWS D;  1PUT A;  1L6V A;  2ONQ A;  3NVW A;  4XDC A;  2E3T A;  2JX5 A;  2PVO D;  2W3S A;  4KGT A;  4KX6 B;  3TEZ A;  1N61 A;  4D2K A;  3HVD A;  2GI9 A;  1HEZ E;  1UWM A;  2MH7 A;  3DWG C;  5GXG B;  2EKI A;  2DYM A;  2WLB A;  2GRI A;  4JX1 C;  3B2F A;  2WXI A;  1ZUD 2;  2BS2 B;  5JXV A;  4RGM A;  5BMG A;  4DXF A;  2OED A;  1OQR A;  3IT6 B;  2NTS A;  3W9C B;  2KAC A;  3TEW A;  1UNS A;  2OHF A;  1C79 A;  1K50 A;  1YJJ A;  2NMQ A;  3KWV A;  1N60 A;  3GB1 A;  4CQN A;  1FRR A;  4YXD B;  1BUI C;  2MEK A;  4L2Y A;  5C2T B;  3HVZ A;  2JSV X;  2B76 B;  2KN4 A;  3Q8F A;  4MT5 A;  4ZRP A;  4PT5 A;  2L32 A;  3BVG A;  4P16 A;  5G5H A;  1I4Q A;  1MHH E;  3VR8 B;  2G1E A;  1VR9 A;  4ZHP A;  1QF6 A;  1YMH E;  2ZW1 A;  2H88 B;  2D5G A;  3LYY A;  2IDY A;  2TSS A;  4N58 A;  4FXC A;  1FCL A;  2KAJ A;  2MJE A;  1Y56 A;  1QIL A;  4L1B A;  3U2S C;  1AWD A;  2RDG A;  4YTM B;  2L83 A;  4WQM A;  5FKA C;  4RF1 A;  1MI0 A;  1EU4 A;  5T8I A;  2AQ2 B;  1YN4 A;  2N7J A;  2ON8 A;  1ZOY B;  2H89 B;  3W2D A;  4YSX B;  1V1O A;  1V97 A;  4XDD A;  4DQO C;  1QKZ A;  1L0V B;  5G5G A;  4RCO A;  4RNA A;  2MJD A;  3LXF A;  3URY A;  1FRD A;  1KFY B;  2WQY B;  2NTT A;  1I4H A;  4J3O D;  2K3U A;  2K5P A;  4LLG M;  1JQ4 A;  1ZPS A;  2V3N A;  3AEA B;  2AX5 A;  1FD6 A;  1E10 A;  3T3N A;  2BS3 B;  1FFV A;  1WSP A;  4TMA B;  5AUI A;  4KGS A;  3ZGZ A;  2PW9 A;  1KLG D;  1PYW D;  3RFZ B;  3BVZ A;  3VRA B;  1FXI A;  1D5X C;  1K52 A;  2W54 A;  2DLB A;  1XCT L;  2WDV B;  1HZ5 A;  2WXG A;  3AE4 B;  2WXP A;  1E9M A;  1TY0 A;  2IGH A;  2INN E;  3AEF B;  4YTP B;  1SE4 A;  1GOZ A;  3V05 A;  2QEJ C;  3OWE B;  1KRH A;  1C4C A;  1A70 A;  1STE A;  5D7G A;  2FUG 1;  2M56 B;  4YSY B;  5LNK 1;  2M0A A;  5HI1 A;  1FFU A;  4IKG A;  3NVV A;  1PDX A;  3AE2 B;  1VLB A;  1F2R I;  1P7F A;  1AN8 A;  1XCQ L;  2V3P A;  1C4P A;  1P7E A;  1SSN A;  3BK2 A;  3ZJT A;  1AYF A;  2QJL A;  2PKO A;  3AH7 A;  4O1N A;  1IGD A;  1I4P A;  1YN3 A;  2RDH A;  4LK0 M;  1QQR A;  3KLS X;  1M4V A;  3EGR A;  3CIR B;  1VDV A;  2RPV A;  1F2R C;  1TS3 A;  1HQR D;  2J53 A;  3IT4 B;  1QLB B;  3AE6 B;  1F0Z A;  1VZ8 A;  2K22 A;  4ITK A;  3B9J A;  1FCC C;  3IXS A;  3KWL A;  3U4E G;  2PVG C;  1FIQ A;  1JML A;  1KTK A;  4IOI E;  2QMT A;  4RGT A;  3GS2 A;  2HTM E;  2E6X A;  1VRA B;  2JYE A;  3B2G A;  3BK1 A;  1QOB A;  4H2A A;  1I4G A;  5BYQ A;  2BT6 A;  1SE3 A;  3VR9 B;  3ZQ4 A;  1N62 A;  1TKE A;  1NYQ A;  1L6U A;  1WXQ A;  4A9A A;  2Z8L A;  2L52 A;  1FXA A;  2WU2 B;  1SJE D;  1IGC A;  3P1M A;  1AW7 A;  4LTU A;  4OW0 A;  3AED B;  4NZL B;  3AEB B;  2WXK A;  2IGD A;  1C78 A;  1C76 A;  4A6Q A;  3PZ7 A;  1F77 A;  2LUM A;  1DYQ A;  1HZ6 A;  1L5P A;  3Q8B A;  2WXO A;  2LEK A;  3R2T A;  1FMA D;  2BS4 B;  2LMC A;  2PTL A;  3FC4 A;  1L4Z B;  4DXG A;  5BMH A;  3ZJU A;  4JE3 B;  1C4A A;  3L4P A;  3VQI A;  4NAM A;  4YT0 B;  2Q5W D;  2LFI A;  3EUB 2;  3I57 A;  1HXY D;  2CJN A;  3AE1 B;  4A55 A;  5FK9 C;  1JWB D;  2JU6 X;  4RGO S;  1N63 A;  1VZ6 A;  1YQ3 B;  3BII D;  3IAM 1;  4R3D A;  1SXT A;  4NJC A;  1ESF A;  2Y5C A;  4HRS A;  3WCQ A;  5BYR A;  1N5W A;  2LHE A;  1E7P B;  1WYG A;  4WIP A;  2LHD A;  1KH0 A;  2SAK A;  1KLU D;  2ICI A;  2Y5P A;  1JWA D;  2JWU A;  4N59 A;  4YWG G;  1EM7 A;  1XLP A;  2KDM A;  1QT9 A;  3AE8 B;  2VZK B;  3AMZ A;  1YNT E;  4C56 C;  4YSZ B;  4NAW B;  3NVZ A;  1HA5 A;  1IUE A;  3BZD B;  3MC0 B;  1SBB B;  1PFD A;  1KF6 B;  2SEB D;  2WXH A;  3H8H A;  5EE9 A;  1B1Z A;  2W55 A;  3Q8E A;  1DOX A;  3NVY A;  4MH8 A;  1TY2 A;  5HG2 A;  3GP7 A;  2DYO A;  2JZP A;  1XLN A;  5HFY A;  4N6E B;  3TSS A;  1NEK B;  5MPO A;  1T6B X;  4GDK B;  1UWX A;  3AE9 B;  3SFE B;  1J7A A;  4GLS C;  3O13 A;  3AEE B;  3FAH A;  3PO0 A;  5H92 C;  2JQR B;  2ZW0 A;  1ZXH A;  2KWD A;  1OQQ A;  1ZP0 B;  1K51 A;  4JWS C;  2ACZ B;  4OZC A;  3AN1 A;  2JYT A;  1TKY A;  2WXM A;  4ZRQ A;  1JRO A;  4ZHO A;  4RGN A;  3I9V 1;  3U52 E;  1VZ7 A;  3UI3 A;  4TQ1 A;  1DOI A;  1ZE3 D;  1RM6 C;  1SB3 C;  3NUH B;  4ZOH C;  2J42 A;  2K9X A;  2BW2 A;  3MJ5 A;  5AUK A;  1DOY A;  3AE7 B;  1BXT A;  4RFB A;  3BYT B;  3BVM A;  1EWY C;  1TKG A;  1ACC A;  1FNU A;  1XF5 L;  3HUI A;  3MP9 A;  4TQ0 A;  2PIA A;  4HKQ A;  5C3J B;  2INP E;  2M19 A;  2IPK D;  1GAQ B;  2L1A A;  4RH6 A;  5HHD G;  1XO3 A;  3NRZ A;  2RMM A;  3ZYY X;  1Q10 A;  4MM3 B;  2V0G A;  1D4B A;  2J4X A;  1UUP A;  1V8C A;  2BB5 A;  2WXJ A;  2WS3 B;  3P4R B;  4HEA 1;  3SEB A;  2N9K A;  4GDL B;  5BMI A;  1D5M C;  2Y3A A;  3AE5 B;  2G9H D;  3C8Y A;  1I7H A;  3PZ8 A;  3IAS 1;  1PGX A;  1SIJ A;  1EWC A;  1WRI A;  1N5X A;  5E6J A;  1L0Y B;  4C7Z A;  1VJK A;  3HRD D;  1TZO A;  4TSS A;  4YTN B;  1GB1 A;  3AV8 A;  3ZJV A;  1K53 A;  1V1P A;  4XE0 A;  1B9R A;  1E0Z A;  1JAL A;  2XN9 C;  2BTE A;  2QIE B;  1SJH D;  2FE8 A;  4US9 A;  4HKZ E;  4A90 A;  2GB1 A;  3MFG A;  4USA A;  1XLQ A;  5EE3 A;  5FR3 A;  1RFK A;  2W3R A;  5EE1 A;  3Q8C A;  3V3X A;  2QIL A;  1ROE A;  3W5U B;  3BWU D;  1ET6 A;  1L4D B;  1E6E B;  1V1P B;  3EA6 A;  1TS5 A;  3KQ4 A;  4HJG E;  3SR6 A;  3Q69 A;  1T3Q A;  3E56 A;  1D5Z C;  2V4I B;  1ZDX A;  1IBX A;  4XWT A;  5EE0 A;  3T3O A;  2DWQ A;  4KKI A;  2FBW B;  3Q8A A;  2MJ3 A;  3P42 A;  5BYS A;  1CJE A;  4US8 A;  1YQ4 B;  2N9L A;  1UGJ A;  4OZA A;  1CK1 A;  2R61 A;  1MVK A;  2WP9 B;  2K0P A;  1GB4 A;  1FO4 A;  4IDI A;  4OZB A;  1PGA A;  4AQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...