1QOAA

Ferredoxin mutation c49s
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTSAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Iron-sulfur cluster cysteine-to-serine mutants of Anabaena -2Fe-2S- ferredoxin exhibit unexpected redox properties and are competent in electron transfer to ferredoxin:NADP+ reductase.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
molecule keywords FERREDOXIN
total genus 25
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qoaA00
1FRRA 1RWSA 1VDVA 1SB3C 2WDRB 3ETRA 3NVZA 1E6EB 1JQ4A 3AE3B 2MH7A 2KMMA 3B9JA 2PIAA 3AEDB 4C7YA 1OFFA 1YQ3B 2AX5A 1FXIA 3W5VB 4JX1C 3RPFC 1XLOA 1N61A 2KAJA 5EE9A 3AE2B 1WYGA 1JWBD 4N59A 3DWMA 1JRPA 4JWUC 3L4PA 5AUIA 1NEKB 1WGKA 2MJEA 1XLPA 3P4QB 1B9RA 1RFKA 1NYRA 2WLBA 4YSXB 3AE4B 1TYGB 4US9A 1UWMA 1DOYA 1TJEA 3PO0A 2WU5B 5MPOA 3KWLA 3NS1A 1ZP0B 1OQQA 1FIQA 1V8CA 1WRIA 3AE5B 3VR8B 1E0ZA 4KX6B 2W54A 1I7HA 1YJIA 1QLBB 2ACZB 5H8YE 1IUEA 1XO3A 2WQYB 1TKGA 4FXCA 2H88B 4ZHPA 4WQMA 2W3SA 1N5WA 3AB5A 3AEGB 5G5GA 1J7BA 4C80A 3HVZA 1JWAD 4YTMB 1N5XA 2M56B 4N58A 4JWSC 2H89B 1QOFA 5H92C 5C2TB 1QF6A 3HRDD 1R7SA 1CJEA 1N62A 2CU3A 4HROA 4US8A 2LEKA 4IDIA 2CJOA 1L5PA 1EWYC 1QOAA 3AEFB 4YSZB 2EKIA 1J7CA 1FFUA 3LB8C 4WWMA 4YT0B 3AE7B 1NVID 3LXFA 1QOBA 2QJLA 3AH7A 1VJKA 1GAQB 1E7PB 2K22A 3VR9B 4USAA 1YJJA 1XLNA 1V97A 2JX5A 3AEEB 1XLQA 1NYQA 3P63A 2L52A 2Y5CA 1OQRA 3DWGC 3SFDB 4A9AA 2FBWB 4YXDB 1L6UA 2E3TA 1FO4A 1N60A 2WDQB 1JW9D 4N6EB 1FXAA 3FAHA 1PFDA 1WXQA 3CIRB 1A70A 3P1MA 5AUKA 3HUIA 1L0VB 3P4SB 2BS3B 2WU2B 1AYFA 2MJDA 1CZPA 5EE0A 1DGJA 2BT6A 3AE6B 3AM9A 3AN1A 1L6VA 1FM0D 1KRHA 3EUB2 2DBYA 1NENB 1E10A 3AV8A 1YQ4B 1GPXA 2PVOD 1QOGA 3AE9B 1VLBA 1FFVA 1ZXIA 2L83A 4HRSA 2OHFA 4ZOHC 1TKYA 2WP9B 1NI3A 1RM6C 1E9MA 3NVYA 5EE1A 1QT9A 2HTME 3AECB 1SIJA 1ROEA 2CJNA 2JQRB 2WS3B 3AEBB 3B2FA 4P6VF 2WDVB 3SR6A 3ZYYX 2DWQA 1DOXA 1F0ZA 1N63A 2B76B 2MJ3A 3BIID 3AE1B 4ITKA 5G5HA 1RYJA 1DOIA 2BS2B 2QIEB 3P4PB 3FC4A 3WCQA 1SF0A 2K9XA 3NVVA 3VRAB 1ZUD2 1WWTA 2W3RA 3SFEB 1JALA 1KFYB 2Q5WD 3CWIA 3P4RB 2PVGC 3AE8B 3NVWA 4YSYB 1FMAD 2BS4B 2N0SB 2W55A 3ABVB 5GXGB 4LTUA 5EE3A 3B2GA 3AMZA 1FRDA 1KF6B 1ZOYB 4C7ZA 4YTPB 2PKOA 2K5PA 4YTNB 1T3QA 2G1EA 3VRBB 3W5UB 3AEAB 5C3JB 1TKEA 1JROA 3NRZA 4ZHOA 1AWDA 2M19A 1PUTA 1PDXA 3W9CB 1J7AA
chains in the Genus database with same CATH superfamily
1K51A 2WX1A 2LUEA 4W9IA 4C7YA 2M8SA 1OFFA 5AZFA 2IPKD 2KDFB 1IP9A 2W9NA 4W9CA 2LRUA 1PGXA 2V3NA 4AJWA 4K7SA 4LK0M 4HVBA 4HPPA 4EFOA 1H8CA 1ZDVA 3ZJUA 1SSNA 3A9KA 3T3NA 2K25A 2O6VA 4WJQA 1D4BA 4EZKA 3WAMA 5AZHA 4C56C 1MG4A 2KNBA 5JZEB 1V97A 1TY0A 2LD9A 3DHIC 4HPLB 1FXAA 1ZW7A 3HUIA 2QDFA 1E8YA 1I4PA 4HLEA 3QWZB 1EF5A 3VUWA 1L0YB 2LGXA 1J0GA 3RD2A 3HK0A 1FM0D 2Y5BB 4AP4C 4MEMA 1I42A 2D3CA 3Q3NC 3OG5A 3V05A 3N30A 5EE1A 1QT9A 2GBKA 1SIJA 3IFWB 4P6VF 3RULA 3HM6X 3EECA 4W9KA 1QZEA 2KVZA 2RGFA 1JALA 2N7DA 2K8CA 1XCTL 3AMZA 2Z0EB 1F77A 3ENEA 2B3AA 5BO4B 2MCNB 1TY2A 1PUTA 1J7AA 2FCMA 1L4DB 2GRIA 1JMLA 4BBNF 2RPVA 2CHXA 2WXKA 4A90A 3H7SA 1N61A 3JYUA 1WZ3A 4JWUC 2D11A 1WGKA 2C9WB 2MJEA 3CMMB 4RH6A 3A9JB 4EKUA 3RNBC 2BTEA 4US9A 3PZ8A 2X38A 5E6PA 1WMHA 3RN9C 4TQ1A 2DYOA 4MGYE 3VFKA 2ACZB 1TKGA 1VCBA 1FCLA 3PRMB 2IDYA 1R4MI 3KH0A 3KW5B 1TBEA 2JXXA 2JT4B 2R2QA 4W9EA 2WXMA 4IM3A 4EZJA 3RNCC 1C9FA 2AL3A 1NVID 1V49A 1RRBA 3ZO5B 2IO3B 2LWPA 2JRHA 2WYQA 3KQ4A 3VR9B 5DPSA 2KVRA 3V60A 3SFDB 1YN3A 1TS3A 4KGTA 5AUKA 4LNNA 2KC1A 4A3PA 4FJZA 1SJED 4HWIB 1R4NI 1WYWB 5C1ZA 5J18A 3AN1A 1NBFC 1YMHE 3ZDTA 2WXIA 3U4EG 2NBUA 2LJ5A 4MDKE 4DXFA 4OZCA 5BYSA 3AEBB 1SJHD 2IO2B 3T3OA 5IKCM 3P4PB 3AU4A 2KWUB 1ZUD2 3SFEB 1UELA 1FMAD 1D5XC 3DVGX 2KFJA 3AXCA 3QA8A 1I4XA 4C00A 3KVFB 1CMXB 4GN1A 2G3QB 4BVUC 1EF1A 2AWTA 3AEAB 4KGSA 1TKEA 1L4ZB 3MJ5A 1V5TA 2IO1B 1WM3A 5JH5C 2CS4A 3NVZA 3AE3B 1EWCA 4FA6A 1K53A 2V1YA 4DQOC 2L05A 2RD0A 1GOZA 4W9JA 2XN9C 2KT7A 1TYGB 1WR1A 1IGDA 5J17A 2WX0A 3TEXA 2JVCA 4FXCA 5TR5A 2A5UA 3Q8EA 3NOBA 3PV1A 2LXAA 2MA9B 1WJNA 3D32A 2V3SA 1EU4A 3EFUA 3VHTC 3AI5A 1F2RI 1VD2A 3KUDB 2ICIA 3N1ZC 1JRUA 3U52E 3L0WB 2C5LC 4ZRPA 3DOWA 2CHZA 3CIRB 4KKIA 4PS7A 1L0VB 2BS3B 3WAPA 1WGRA 2KC2A 2RMMA 1ZKHA 1DGJA 5JHAA 1HTQA 3NG0A 4W9GA 4ZDVA 2MLBA 1ZXIA 2KN4A 2OHFA 2XK5B 2K6QA 3APDA 4PS8A 5G2NA 4RCOA 1DOIA 3UINB 3A9KB 3S2AA 1L2NA 4XC2A 1KFYB 2K6DB 4ANUA 2KANA 1I4HA 3IVFA 3RNFC 3DHHC 4FHJA 2HJ8A 5FR3A 3N3KB 4HJGE 2G1EA 2NS5A 4HJKA 2C7MB 3Q69A 4ANWA 4BOSC 1GC7A 1BUIC 2PIAA 2ZZPB 1E5WA 2L76A 3AE2B 1SE3A 2LVPA 1WYGA 2JYEA 1Z5SB 3DQVA 5IN7A 4WWPA 2ONQA 1B9RA 1NYRA 2N1VA 1ZP0B 3DVGY 1TZOA 1E0ZA 5D2MB 1WGGA 2IYDB 3V6EB 1J8CA 2UWQA 3GB1A 3AB5A 4HDOA 1KM7A 3N9YC 1R7SA 3DBRI 4RM9A 4OW0A 3MC9A 1QOAA 3TMPB 1FFUA 4FULA 4WWMA 1V1PB 3AE7B 2DLBA 4RGMA 3RI7C 3ZLZA 1C78A 1E7PB 3I9V1 2IO0B 2HD5B 3AEEB 4GOCA 3QHTA 2Y5CA 1HQRD 3M63B 4OVUA 3KUZA 1PFDA 4M00A 2KMCA 2BKRB 3AM9A 1WXMA 3ZXVA 1YQ4B 3W1SA 1MI0A 1UWXA 3AE9B 3Q3FA 2SEBD 1FFVA 4AQ7A 2KKCA 4P7IA 3UQBA 4KDLB 1WJUA 4MSMB 3Q3OC 4WAFA 5BMHA 3ZYYX 3DBHB 4O1NA 4LNOA 3Q8BA 3PREA 3WCQA 4GDLA 1P3QU 1D6EC 3ZGZA 2TSSA 3IG3A 3AE8B 3L08A 1WF9A 2K8BA 2ZPYA 2CKHB 3IHPC 4JPSA 4F1SA 1F2RC 5JXVA 2N1WA 1OGWA 3LJ3A 2KMMA 2JU6X 1FXIA 3PS6A 4P1CC 1L0XB 3I57A 3PGEA 2NBVB 2J53A 4M8NA 3TUOA 3AE4B 1QILA 3PVLA 3NS1A 1C3TA 2AQ2B 3ZXRA 2KDBA 3AEGB 2BYTA 1N5XA 3Q3JA 1Q5WB 1GNUA 3JW0X 2H89B 4GMVA 4Q2JA 1N62A 3MFGA 4US8A 3GZNI 4D2KA 1EWYC 4YT0B 2BB5A 3LXFA 3UI3A 1VJKA 2WXOA 2JX5A 3P63A 1XXGA 3R7QA 4C4VA 2G9HD 4YWGG 3MP9A 3N20C 5L83A 3VUYA 1HZ6A 1XF5L 3OJ4B 2DHZA 1YN5A 1MHXA 3J9CA 4NQLB 5GMVA 4GSWA 2XEWA 5EDSA 2BYVE 2M0AA 4KZCA 2WP9B 1I4QA 4K81A 3I5JC 2C60A 3E9SA 1N63A 2B76B 2I2YA 3AE1B 4PT5A 4FJVB 2DAFA 3KYDD 3H6NA 1VZ8A 1B1ZA 4RNAA 3ZW3A 3NZUA 3NVWA 3Q2AC 2KWCA 4QAYA 4HDQA 1ZOYB 2VH2A 1C79A 4LJPB 1TIFA 3W5UB 4IWOA 3CSTA 2KJRA 1AWDA 3JSVB 1FD6A 1EUVB 2MQJA 4A8XC 5D6JB 4A6QA 1TGZB 1XLOA 1F1HA 3PTFC 2INNE 1AN8A 2IGDA 4NNJB 2YEPF 1PQSA 3DPDA 2IBIB 2ZNVC 4YL8A 5CX3A 2BQQA 1T5XD 1V5OA 3WANA 4OVVA 3UQAA 1J19A 2ZPNA 4DXGA 4J6IA 3KLSX 4HKZE 1YX5B 4YSZB 4WJPA 2LI5A 4K3BA 2ZW1A 1WGDA 4GDLB 1OTRB 4ASWC 4P16A 1UBQA 2KACA 3SHQA 2J0JA 1YD8U 1AYFA 1R4MB 2BT6A 4TV3A 2ZCBA 1NENB 1GB1A 4JIOU 1ET9A 4RGTA 4A20A 1WM2A 4KV2A 1K50A 1YIWA 2FIDA 4FJYA 4ITKA 1SE9A 3U7ZA 2L8JA 4ANXA 4KIKB 2V4IB 3VTUA 5IA7A 2INPE 2YEPB 2REXA 5BMIA 3R7RA 4HPMB 4XWWA 1UGJA 4YSYB 3PRPB 5GXGB 4B6WA 3NUHB 3B2GA 1KF6B 2KN5A 2K39A 5DPTA 4AUQC 2L32A 3VRBB 4M8MA 2M1MA 3B08A 5AZGA 3VQIA 1FRRA 2N7JA 1V2YA 3O13A 4UDUC 2RSUA 4B0EA 4OHJA 1TT5B 1TZ1A 4WWOA 3KWVA 2KQSA 3PO0A 1V81A 2JZ3B 2WHIA 2GI9A 3VVWB 1V8CA 2MEKA 4MJSB 1YJIA 2WQYB 4GU2A 1LO5D 3IAS1 5G5GA 3HHMA 5DPWA 1WXVA 3RZWC 3T8MA 5C2TB 2J7QB 3GOEA 5H92C 3TCAA 2HE7A 2LEKA 4IOIE 4RF0A 1WJ4A 3SU8X 4JGHB 3RUIB 1FXTB 1GJZA 4LLGM 2AQ1B 2M0XA 2KLCA 4YXDB 3BVMA 1E90A 3HVDA 2WXGA 1Y8RC 3H9DA 1CZPA 2LGYA 1WH3A 1KRHA 2ZVNA 4KSKC 3V3XA 4ZYSA 2GOWA 2KK8A 3Q3MC 4HCPB 2NBWB 3L13A 5IO9A 1M4VA 1OQYA 1KTKA 3IBEA 1VZ7A 1F0ZA 2MX2A 3PPAA 3DBHI 1SF0A 4G0NB 2PTLA 1R4NB 3ONSA 4TKNA 2D10A 2DYBA 2NMQA 3PLUA 4RGNA 2KQ7A 3A4SC 3ZUNA 4WJOA 2ZNVB 2K5PA 2MBHA 4I6LB 5D7GA 2N9KA 4B0MA 1E6EB 3A1QB 2HJ1A 1NI2A 1YQ3B 2AX5A 2GB1A 3DDCB 2ZJDA 1ZDXA 1NEKB 1SE2A 2UYZB 2V0GA 5AEKB 2BWFA 2LHDA 3QC8B 5E6OA 1P0RA 2E6XA 2OJRA 2MP2B 3Q8CA 1N5WA 2LFIA 2EELA 4E71A 2IGHA 4JWSC 3HRDD 3NJTA 3VUXA 2K0PA 2BYEA 2JUOA 2JSVX 1IBXB 4ZYNA 4IDIA 2QMTA 3BK2A 4FLHA 2CHWA 3NZ3A 2WNMA 5FR6A 1QKZA 2LVOA 2WDTB 1C4PA 2KJHB 2GBNA 2DZIA 4IKGA 5IOIA 3W1SC 2WU2B 1WSPA 3BVGA 4IM2A 1HA5A 1V1OA 1P7EA 4G3XB 2KDIA 1WGYA 1TKYA 3A4RA 3N1YC 1NI3A 3ZNHB 1C4AA 4CHKA 3N32A 2LASA 2WDVB 4EOYA 2BPSA 3L10B 3QQ8B 1ISNA 2XBBC 1HZ5A 2BYFA 2KDEB 2ZCCA 2J0KA 3PHXB 2N9LA 2Z0DB 2FCSA 3EA6A 5E6NA 2K8HA 1P98A 1T3QA 2D07B 2RR9A 1F52A 2WDRB 1VDVA 4FHKA 3RNGC 2DZMA 4ZRJA 3B9JA 1MVKA 4BBNC 4DXAB 4RMAA 2PEAA 5EE9A 3SDLC 3H7PA 1JWBD 4ZRKA 2PLPA 3DBSA 4LCDE 4M02A 2VZKB 4BOZB 1RFKA 4WWNA 5MPOA 1OQQA 2LGDA 3AE5B 3B1LX 2MW5A 1HTOA 1QLBB 1KOTA 2KMAA 2JWUA 4IM0A 4WQMA 3P2BA 3U30A 3I3TB 1JWAD 2BGFA 4N58A 1Y56A 4F7ZA 4RF1A 2DZJA 2CU3A 4PYZA 1YQBA 3LB8C 4W9FA 2BKFA 1QOBA 3AH7A 4ICVA 1N6ZA 4ZRIA 2L52A 5CTRC 2LGIA 1TS5A 4K1RB 1T0SC 3AULA 5D3DA 4KZ0A 1D5MC 3QCAA 2L3ZA 4DWFA 4TSSA 1S3SG 5L95C 5E6JA 4ARCA 3DCGA 1KLVA 4L2YA 3GS2A 3I63C 1E9MA 2HTME 3ZTDA 2MSED 1Q1OA 3AU5A 1KLGD 2MBOA 3WALA 2W3RA 3P4RB 1E8XA 2KFKA 2VRRB 3PZ7A 2BW2A 2WXNA 5EE3A 2J0MA 1FRDA 4MGIE 1ZPSA 2QSDA 2NCNA 4IW0A 2KWDA 3NZSA 1SXTA 1EU3A 2MWSB 2QCZA 1ACCA 2JF5A 3L54A 4I6PA 3SD5A 1RWSA 1SB3C 2KOXA 1WX8A 1XD3B 3AEDB 3ZIMA 3TL5A 2EKEC 1T0YA 5AUIA 2K1FA 1L7YA 2EMSA 2NR2A 2L00B 1DOYA 3N1XC 1UD7A 2I1JA 5CHWA 4II2B 4WIPA 4KX6B 2J42A 1RFAA 4M01A 1XO3A 1E7VA 4LJOB 3C0RB 1UF0A 3K9PB 2KTRA 2GMIC 4HCNB 5HFYA 3GE8C 1QF6A 4X57B 4IC7B 4NZLB 2R61A 4HROA 4NQKE 2WXLA 3ZJTA 1MHHE 3LYYA 4BFRA 3A1QA 2BWES 2QJLA 4WJNA 4HK2A 1YJJA 1JWMD 4XDDA 2V3PA 4MSQB 1WR6E 3APFA 4CQNA 4JQWC 2E3TA 2WDQB 4NJCA 1HE8A 2PW9A 4IWPA 2UU7A 3W2DA 3OAWA 5C23A 1K52A 3MHSD 2BVCA 4L23A 2G4DB 1DYQA 1RM6C 1D3ZA 3L16A 3T9LA 1ROEA 3MTNB 2IJ0A 5IP4D 5FK9C 2DWQA 3RFZB 4RM8A 1DOXA 2JXTA 3UF8A 2IY0B 4GXBA 4HXDA 3PRZA 4NJ6A 4DHJD 3C8YA 2BS4B 2JWZA 4CYEA 4XWTA 4RFBA 1FNUA 3DBLI 2G45B 4XGAB 2GLSA 3NRZA 2M19A 2XNAC 4JL9A 1PDXA 4MM3B 1SEBD 1YOVB 2V9HA 2K3UA 3O65B 1WE7A 1FCCC 3W5VB 3RPFC 1K8RB 5DCNA 4MJSA 3L4PA 4CO7A 4GLSC 2D3BA 4E3CA 1UWMA 1TJEA 4XYCA 1E8ZA 4GDKA 4BKGA 2FE8A 3URYA 4N9F4 5H8YE 2H88B 1C1YB 2KLGA 2LJIA 3ZKJC 3X23A 4YTMB 4EE2A 1WX7A 3EHVA 4W9HA 4AWJA 2Y5PA 3VXWA 5KHOA 1WY8A 4USAA 1WXSA 1XLNA 4MM3A 5HKHA 3RMKC 4B9KA 2LHEA 1EO6A 1RLFA 3Q6BA 4WH4A 4DHZB 4N6EB 4KIKA 2CU1A 4C4VB 3ZQ4A 3CSFA 3U7DA 1I4GA 3TBLD 1AARA 3MHZA 2FNJB 3BZDB 1C76A 4ZOHC 3JVZX 3ECIA 4TQ0A 1I35A 1PGBA 3BINA 3Q14C 4NJ7A 4J3OD 2G4SA 2MJ3A 4B95A 2QEJC 2WXQA 2ASQA 3QX1A 1T0QC 2BS2B 4W9LA 3ML9A 2D3GA 2K9XA 3RNEC 2FUHB 4GIVA 1WWTA 1V80A 2KFKB 2J52A 2Q5WD 1XCQL 4P1BC 1KLUD 1ET6A 2YLMA 1WGHA 1I4RA 2AEHA 1CQVA 4KDIC 4IUMB 4YTPB 2RPQA 5KHQA 2PKOA 1QQRA 1SBBB 4G50A 4OVZA 4MH0E 1JQ4A 1LXDA 3GE3C 1E8WA 2HDEA 1T6BX 3PT2B 4W9DA 3A9JA 3H1UA 2KTRB 2WLBA 2Z8LA 2PE9A 3DBRB 3FILB 3KWLA 4MGZE 4TUUA 1WX9A 1I7HA 2W54A 4AOFA 4R3DA 3MC8A 1SE4A 3TEZA 2LMCA 2LGSA 3WIMA 4C80A 2WGSA 1QOFA 3QIJA 2ZEQA 3ZDMC 2I38A 2DENB 4ICUA 1FNVA 4KKJA 3FILA 2GBMA 1XLQA 2D2QA 2OEDA 4DDID 2VZKD 4BZAA 2FBWB 4S17A 1N60A 1FO4A 1U4AA 2NTSA 3HM3A 2KX3A 5G55A 5I4DA 2MJDA 3ZJVA 4FN2A 1L6VA 1UUPA 4MACA 2M17A 4AJYB 3DBLB 1IGCA 4ZRQA 3ML8A 2GBJA 3AECB 1JWSD 2CJNA 2WS3B 3SR6A 2I1KA 2L7RA 1MFWA 4BAXA 1FNWA 5DPRA 2X8XX 5G5HA 1WFYA 3FC4A 3VRAB 4LNFA 3TJPA 2EMTA 1C77A 2FCQA 1IPGA 1CK1A 2FUG1 2OOBB 2R2OA 3HIZA 1EM7A 2C7HA 3JSVA 5C3JB 1V9JA 4MT5A 3VTVA 2NPTB 2IZVB 2JZPA 5HI1A 5IAAC 3GZNB 4A3OA 1S1QB 5J2RA 3ZNID 3V61A 2N4FA 4JX1C 3QK0A 1LFDA 4EZLA 4F8CB 4N59A 3DWMA 2D3AA 3P4QB 1ZE3D 1WIAA 4ANVA 1ZGUB 4G11A 2D5GA 2N9XA 2N7EA 1AW7A 5JHBA 4GGQA 2QHOA 2O2VB 4ZHPA 3DVNU 4PK1A 2LZ6A 1J7BA 2YVCA 2OJWA 2M56B 3IAM1 3OWEB 3PZDA 1KH0A 3ZNZB 4HKQA 3AEFB 4NPNA 2BF8B 2L1AA 1LQBA 4K7WA 1D5ZC 2K22A 3BVZA 3UIPB 3VH3B 2MRPA 1NYQA 3VH4B 3UIOB 3QJZA 1JW9D 4KGRA 2KD0A 3P1MA 1UBIA 5BYRA 1HXYD 1GG3A 3BYYB 3AE6B 2KDMA 2MBQA 2CR5A 2MP2A 3AV8A 2PVOD 1SGHA 1QOGA 3K9OB 4DHJB 4BKSA 4E74A 2GBRA 2AYOB 4MH8A 1XQQA 3WA0A 3WAOA 2LVQA 1LM8B 3B2FA 2INDC 2FIFA 2ZW0A 2M4NA 4DK5A 3V62A 1Q0WB 2AQ3B 4XX5A 3H7PB 4WAAA 3R8BA 3ALBA 2N0SB 3ABVB 2PJHA 4LTUA 3MC0B 4M0WB 3V6CB 1C4CA 5HHDG 1ENFA 1JROA 3IT4B 3APCA 3U2SC 2LRWA 3ZTCA 3ZRFA 4EUTA 3ETRA 2VH1A 4FBJB 5HG2A 1V1PA 2KAJA 4KSLC 1M94A 3EGRA 4YSXB 2RDBC 3BK1A 1FIQA 1WRIA 2RDHA 4II3B 3M3JA 1GB4A 1P9DU 4URKA 4DDGD 2MHJA 3GP7A 4RGOS 1IYFA 1IUEA 4WQOB 2KQ4X 2WXRA 1WI0A 5D94A 4LNKA 5LXIB 2KX0A 1UH6A 4XZ4A 1WXAA 1TS2A 1CJEA 1ZXHA 3X0WA 1IBXA 4TMAB 1L5PA 5LXHA 2EKIA 2KTFA 3NS8A 4LDTD 3L17A 1VR9A 5LNK1 4GDKB 1OQRA 3IXSA 4K7UA 4A9AA 3U8ZA 1L6UA 3KYCD 1A70A 3BY4B 2KZRA 3RT3B 3R66C 1Z2MA 1RAXA 2DBYA 5TSSA 4HRSA 4DBGA 3R3MA 2FAZA 3OLMD 2JQRB 2N9PC 1YNTE 3LDZE 4JE3B 1WJ6A 3M95A 4GB9A 3NVVA 4LDTB 1LGRA 3B0AA 3UGBB 2KYWA 1BT0A 2WXPA 5FKAC 2C7NB 3ZRCA 4XDCA 2PE6B 1MJDA 4ZHOA 1UNSA 5BYQA 4M0WA 2PPHA 2MH7A 1WRDB 1WMHB 3NY5A 3SEBA 2HTHA 1TTNA 1WE6A 1XLPA 1OEYA 4MELA 1UGMA 1G6JA 2NTTA 2WU5B 2JRIB 1PGAA 1E7UA 3VR8B 2KO3A 5BMGA 4MGKE 1GC6A 2QC8A 2L0FA 2A4ZA 2DYMA 1YJ1A 4IG7B 2DZKA 1STEA 2LXCA 2BB6A 1YN4A 3Q8FA 3R2IA 1SIFA 2CJOA 2J4XA 3PSEB 1GAQB 2O6VB 2KXJA 1VZ6A 3Q8AA 4OZAA 4OZBA 3EC8A 1V6EA 3MJWA 3FAHA 1UZXB 4PYUA 4JLCA 5EE0A 2WXFA 3TEYA 1MPEA 2KJ6A 5CHVC 1YX6B 1V86A 3DVNV 2Z59B 3TEWA 2Y3AA 3NHEB 2O2VA 2L83A 2SAKA 4NAWA 4HEA1 1FPYA 3A33B 1KJTA 2JY6A 2N9EB 4H2AA 1RYJA 3CF6E 4KVGB 2QIEB 2O6VD 2XK5A 3TIXA 1BXTA 2AL6A 2PVGC 3PHWB 1PYWD 3RCZA 3FKYA 2W55A 3C19A 3VAWA 2JYTA 2WXHA 5D3IB 1WZ0A 2QILA 1T0RC 1F9JA 4YTNB 3RYTA 2DX5B 2WWZA 3KUCB 3IT6B 2W82A 3R2TA 4ACFA 1X1MA 3ZVVA 1JRPA 1P1AA 4NAWB 2RDGA 4S0RA 3H8HA 2DNFA 4BKSD 1TS4A 2IGGA 5CHFA 5T8IA 2NPTA 4AS1A 1P7FA 1BMLC 1OEYJ 2DAJA 2W3SA 3BYTB 3VDZA 4BKTA 1GUAB 3PLVA 3HVZA 4XE0A 3VTWA 3DHGC 2KWVB 3QARA 1ESFA 2MBEA 2LUMA 4FADA 1J7CA 4LNIA 2FCNA 4A55A 4I6NB 1HEZE 1A5RA 3E56A 3DWGC 2ZVOA 1FEHA 1JWUD 3BWUD 2JPHA 1WXQA 4L1BA 3P4SB 3TSSA 4K3CA 1VRAB 1XEEA 5LLIA 1NDDA 3EUB2 1E10A 1GPXA 3W1YA 1VLBA 1H4RA 4DHZE 3NVYA 2MBBB 4EEWA 2BBCA 2KHWB 2WXJA 2L0TA 3EFCA 3RNAC 2NVUI 1XT9B 2V4LA 3BIID 3QAQA 3OJ3A 4NAMA 2JZZA 4IWQA 4ARIA 2IY1B 3ZNGC 2INCC 1MG8A 3CWIA 4PS3A 1Q10A 3M62B 4WURA 2ON8A 3P42A 1JCKB 4C7ZA 4REZA 3RZFA 2PMVA 3W9CB 4NY0A
chains in the Genus database with same CATH topology
5HI1A 2WDRB 1VDVA 1K51A 2KMMA 3B9JA 1MVKA 4C7YA 1OFFA 2JU6X 1FXIA 4JX1C 2IPKD 1L0XB 5EE9A 3I57A 1JWBD 4N59A 3DWMA 2PLPA 2J53A 2VZKB 3TUOA 3P4QB 1RFKA 1ZE3D 3AE4B 1QILA 5MPOA 3NS1A 1OQQA 1PGXA 2D5GA 2V3NA 3AE5B 1AW7A 4LK0M 2AQ2B 1QLBB 2JWUA 1ZDVA 4ZHPA 3ZJUA 1SSNA 4WQMA 3AEGB 3T3NA 1J7BA 2BYTA 1JWAD 1N5XA 2M56B 3IAM1 1Y56A 4N58A 2H89B 3OWEB 4Q2JA 1N62A 4RF1A 1KH0A 2CU3A 3MFGA 4US8A 4D2KA 4HKQA 1D4BA 3AEFB 1EWYC 3LB8C 4YT0B 2BB5A 3LXFA 2L1AA 1QOBA 4C56C 3AH7A 3UI3A 1VJKA 1D5ZC 2K22A 2WXOA 3BVZA 1V97A 2JX5A 3P63A 1NYQA 2L52A 1TY0A 2LGIA 1XXGA 1TS5A 1JW9D 1FXAA 2G9HD 4YWGG 4KGRA 3P1MA 3MP9A 5BYRA 3HUIA 5D3DA 1HXYD 1I4PA 1D5MC 1HZ6A 1XF5L 3BYYB 4TSSA 3AE6B 1L0YB 2KDMA 1YN5A 1FM0D 1MHXA 5E6JA 3AV8A 3J9CA 4ARCA 2PVOD 3V05A 1QOGA 4L2YA 3GS2A 2M0AA 2WP9B 1I4QA 1E9MA 5EE1A 1QT9A 2HTME 1SIJA 4MH8A 3B2FA 4P6VF 3E9SA 1N63A 2B76B 2ZW0A 2I2YA 3AE1B 4PT5A 1KLGD 2W3RA 2AQ3B 1JALA 1VZ8A 1B1ZA 3P4RB 4RNAA 3R8BA 3NVWA 3PZ7A 1XCTL 2N0SB 2BW2A 2WXNA 3ABVB 4LTUA 5EE3A 3AMZA 1FRDA 3MC0B 1ZOYB 1F77A 1ZPSA 1C79A 2QSDA 1C4CA 5HHDG 3W5UB 1ENFA 1JROA 2KWDA 3IT4B 1TY2A 1AWDA 1SXTA 1PUTA 3U2SC 1FD6A 1J7AA 1EU3A 1ACCA 1RWSA 4A8XC 1SB3C 1L4DB 3ETRA 4A6QA 2GRIA 1JMLA 5HG2A 1V1PA 2RPVA 3AEDB 2WXKA 4A90A 1XLOA 1N61A 2KAJA 5AUIA 4JWUC 2INNE 1AN8A 2IGDA 1WGKA 2MJEA 3EGRA 2YEPF 4RH6A 4YSXB 2BTEA 4US9A 1DOYA 3PZ8A 2X38A 3BK1A 1FIQA 1WRIA 2RDHA 1GB4A 4TQ1A 4WIPA 2DYOA 4KX6B 2J42A 3GP7A 4RGOS 2ACZB 1T5XD 1IUEA 1XO3A 1TKGA 2KQ4X 2WXRA 1FCLA 2IDYA 5HFYA 4DXGA 1QF6A 1TS2A 4NZLB 1CJEA 2R61A 2WXMA 1ZXHA 4HROA 1IBXA 2WXLA 1L5PA 4TMAB 3KLSX 4HKZE 3ZJTA 1MHHE 2EKIA 4YSZB 3LYYA 1C9FA 1NVID 2QJLA 2ZW1A 3KQ4A 4GDLB 3VR9B 1YJJA 1VR9A 5LNK1 1JWMD 4P16A 2V3PA 4GDKB 4XDDA 1OQRA 3IXSA 4CQNA 3SFDB 4A9AA 1YN3A 1L6UA 2E3TA 2KACA 1TS3A 4KGTA 2WDQB 5AUKA 1A70A 4NJCA 1SJED 1AYFA 2PW9A 3W2DA 3AN1A 2BT6A 5JXVA 2DBYA 1NENB 1K52A 1YMHE 5TSSA 2WXIA 3U4EG 1GB1A 4L23A 1DYQA 4DXFA 4HRSA 4RGTA 1ET9A 4OZCA 1RM6C 1ROEA 2JQRB 2IJ0A 1YNTE 5FK9C 5BYSA 3AEBB 2DWQA 1K50A 3RFZB 1DOXA 4JE3B 2JXTA 1SJHD 4ITKA 3T3OA 3U7ZA 3P4PB 2V4IB 2INPE 3NVVA 1ZUD2 3SFEB 2YEPB 5BMIA 4XWWA 3C8YA 1UGJA 4YSYB 1FMAD 2BS4B 1D5XC 5GXGB 2WXPA 5FKAC 3NUHB 1I4XA 3B2GA 4XWTA 1KF6B 4XDCA 4RFBA 2L32A 3VRBB 1FNUA 4KGSA 3AEAB 1TKEA 3NRZA 1L4ZB 2M19A 2XNAC 3MJ5A 4ZHOA 1PDXA 4MM3B 1UNSA 1SEBD 3VQIA 1FRRA 2N7JA 5BYQA 3NVZA 4M0WA 2K3UA 3AE3B 2MH7A 3O13A 1FCCC 4UDUC 3SEBA 1EWCA 3W5VB 3RPFC 4B0EA 1K53A 4DQOC 4OHJA 3L4PA 4GLSC 1GOZA 1XLPA 2XN9C 3KWVA 1TYGB 1UWMA 2NTTA 1TJEA 3PO0A 2WU5B 1IGDA 1PGAA 2GI9A 1V8CA 3VR8B 2MEKA 2FE8A 5BMGA 3URYA 1YJIA 5H8YE 3TEXA 2WQYB 4FXCA 2H88B 2DYMA 1LO5D 3IAS1 3Q8EA 5G5GA 2LJIA 1STEA 2BB6A 4EE2A 4YTMB 1YN4A 3Q8FA 3R2IA 5H92C 5C2TB 1EU4A 2LEKA 2CJOA 2J4XA 4IOIE 4RF0A 2Y5PA 1F2RI 1GAQB 4USAA 1XLNA 1VZ6A 2ICIA 4LLGM 2AQ1B 3Q8AA 4OZAA 4OZBA 2LHEA 3U52E 4YXDB 4WH4A 3BVMA 4ZRPA 4N6EB 3FAHA 3CIRB 4KKIA 3ZQ4A 3HVDA 1L0VB 2BS3B 1I4GA 2WXGA 1CZPA 2RMMA 5EE0A 1DGJA 2WXFA 3TEYA 1MPEA 1KRHA 3MHZA 3TEWA 3V3XA 4ZYSA 2Y3AA 3BZDB 1C76A 1ZXIA 2KN4A 2L83A 2OHFA 2SAKA 4ZOHC 4HEA1 4TQ0A 1M4VA 1KTKA 1PGBA 4J3OD 1VZ7A 1F0ZA 2MJ3A 4RCOA 2QEJC 4H2AA 2WXQA 1RYJA 1DOIA 2BS2B 2QIEB 1SF0A 2K9XA 1WWTA 2PTLA 1KFYB 2J52A 2Q5WD 1BXTA 1XCQL 2PVGC 1KLUD 1PYWD 1ET6A 2W55A 2NMQA 1I4HA 1I4RA 4RGNA 2JYTA 2WXHA 5D3IB 1CQVA 5FR3A 4YTPB 2QILA 2PKOA 2K5PA 4HJGE 4YTNB 2G1EA 5D7GA 3Q69A 2N9KA 1QQRA 1SBBB 4OVZA 1BUIC 1JQ4A 4B0MA 1E6EB 3IT6B 2PIAA 2W82A 1YQ3B 2AX5A 2GB1A 3R2TA 2HDEA 1T6BX 3AE2B 1SE3A 1WYGA 1JRPA 2JYEA 1ZDXA 1NEKB 1SE2A 2ONQA 2V0GA 1B9RA 1NYRA 2WLBA 2Z8LA 4NAWB 3FILB 3KWLA 2RDGA 1ZP0B 3H8HA 1TZOA 2LHDA 1E0ZA 1TS4A 2W54A 1I7HA 2E6XA 3Q8CA 2IGGA 5T8IA 4AS1A 1P7FA 1BMLC 4R3DA 2W3SA 3GB1A 1N5WA 2LFIA 3AB5A 3BYTB 1SE4A 3TEZA 2EELA 2LMCA 4C80A 2IGHA 3HVZA 4XE0A 4JWSC 1QOFA 3N9YC 3HRDD 1R7SA 2K0PA 2JSVX 4OW0A 1IBXB 1ESFA 4IDIA 2LUMA 1QOAA 2QMTA 3BK2A 1J7CA 1FFUA 4WWMA 1V1PB 2I38A 2DLBA 3AE7B 4RGMA 1C78A 4A55A 1FNVA 3NZ3A 2WNMA 1E7PB 3I9V1 4KKJA 1QKZA 3FILA 1HEZE 3AEEB 1XLQA 3E56A 2Y5CA 1HQRD 2OEDA 3DWGC 1C4PA 2VZKD 1FEHA 1JWUD 2FBWB 3BWUD 1FO4A 1N60A 1PFDA 1WXQA 2NTSA 4IKGA 3P4SB 4L1BA 2WU2B 5I4DA 2MJDA 3TSSA 3ZJVA 1VRAB 1WSPA 1XEEA 3BVGA 3AM9A 1L6VA 1UUPA 3EUB2 1HA5A 1E10A 1GPXA 1YQ4B 4MACA 3W1SA 1V1OA 1MI0A 1P7EA 1UWXA 3AE9B 1VLBA 1FFVA 2SEBD 4AQ7A 1IGCA 1TKYA 4ZRQA 3NVYA 1NI3A 3AECB 1JWSD 1C4AA 2CJNA 2BBCA 2WS3B 2WXJA 4WAFA 3SR6A 2WDVB 3ZYYX 5BMHA 4O1NA 1FNWA 3BIID 5G5HA 1HZ5A 3Q8BA 4NAMA 4ARIA 3FC4A 3WCQA 3VRAB 1D6EC 3ZGZA 3CWIA 2TSSA 3AE8B 1C77A 1Q10A 1CK1A 4WURA 2ON8A 2FUG1 2N9LA 1EM7A 3EA6A 3P42A 1JCKB 4C7ZA 4JPSA 4REZA 2PMVA 1T3QA 5C3JB 4MT5A 3W9CB 1F2RC 2JZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FRR A;  1RWS A;  1VDV A;  1SB3 C;  2WDR B;  3ETR A;  3NVZ A;  1E6E B;  1JQ4 A;  3AE3 B;  2MH7 A;  2KMM A;  3B9J A;  2PIA A;  3AED B;  4C7Y A;  1OFF A;  1YQ3 B;  2AX5 A;  1FXI A;  3W5V B;  4JX1 C;  3RPF C;  1XLO A;  1N61 A;  2KAJ A;  5EE9 A;  3AE2 B;  1WYG A;  1JWB D;  4N59 A;  3DWM A;  1JRP A;  4JWU C;  3L4P A;  5AUI A;  1NEK B;  1WGK A;  2MJE A;  1XLP A;  3P4Q B;  1B9R A;  1RFK A;  1NYR A;  2WLB A;  4YSX B;  3AE4 B;  1TYG B;  4US9 A;  1UWM A;  1DOY A;  1TJE A;  3PO0 A;  2WU5 B;  5MPO A;  3KWL A;  3NS1 A;  1ZP0 B;  1OQQ A;  1FIQ A;  1V8C A;  1WRI A;  3AE5 B;  3VR8 B;  1E0Z A;  4KX6 B;  2W54 A;  1I7H A;  1YJI A;  1QLB B;  2ACZ B;  5H8Y E;  1IUE A;  1XO3 A;  2WQY B;  1TKG A;  4FXC A;  2H88 B;  4ZHP A;  4WQM A;  2W3S A;  1N5W A;  3AB5 A;  3AEG B;  5G5G A;  1J7B A;  4C80 A;  3HVZ A;  1JWA D;  4YTM B;  1N5X A;  2M56 B;  4N58 A;  4JWS C;  2H89 B;  1QOF A;  5H92 C;  5C2T B;  1QF6 A;  3HRD D;  1R7S A;  1CJE A;  1N62 A;  2CU3 A;  4HRO A;  4US8 A;  2LEK A;  4IDI A;  2CJO A;  1L5P A;  1EWY C;  1QOA A;  3AEF B;  4YSZ B;  2EKI A;  1J7C A;  1FFU A;  3LB8 C;  4WWM A;  4YT0 B;  3AE7 B;  1NVI D;  3LXF A;  1QOB A;  2QJL A;  3AH7 A;  1VJK A;  1GAQ B;  1E7P B;  2K22 A;  3VR9 B;  4USA A;  1YJJ A;  1XLN A;  1V97 A;  2JX5 A;  3AEE B;  1XLQ A;  1NYQ A;  3P63 A;  2L52 A;  2Y5C A;  1OQR A;  3DWG C;  3SFD B;  4A9A A;  2FBW B;  4YXD B;  1L6U A;  2E3T A;  1FO4 A;  1N60 A;  2WDQ B;  1JW9 D;  4N6E B;  1FXA A;  3FAH A;  1PFD A;  1WXQ A;  3CIR B;  1A70 A;  3P1M A;  5AUK A;  3HUI A;  1L0V B;  3P4S B;  2BS3 B;  2WU2 B;  1AYF A;  2MJD A;  1CZP A;  5EE0 A;  1DGJ A;  2BT6 A;  3AE6 B;  3AM9 A;  3AN1 A;  1L6V A;  1FM0 D;  1KRH A;  3EUB 2;  2DBY A;  1NEN B;  1E10 A;  3AV8 A;  1YQ4 B;  1GPX A;  2PVO D;  1QOG A;  3AE9 B;  1VLB A;  1FFV A;  1ZXI A;  2L83 A;  4HRS A;  2OHF A;  4ZOH C;  1TKY A;  2WP9 B;  1NI3 A;  1RM6 C;  1E9M A;  3NVY A;  5EE1 A;  1QT9 A;  2HTM E;  3AEC B;  1SIJ A;  1ROE A;  2CJN A;  2JQR B;  2WS3 B;  3AEB B;  3B2F A;  4P6V F;  2WDV B;  3SR6 A;  3ZYY X;  2DWQ A;  1DOX A;  1F0Z A;  1N63 A;  2B76 B;  2MJ3 A;  3BII D;  3AE1 B;  4ITK A;  5G5H A;  1RYJ A;  1DOI A;  2BS2 B;  2QIE B;  3P4P B;  3FC4 A;  3WCQ A;  1SF0 A;  2K9X A;  3NVV A;  3VRA B;  1ZUD 2;  1WWT A;  2W3R A;  3SFE B;  1JAL A;  1KFY B;  2Q5W D;  3CWI A;  3P4R B;  2PVG C;  3AE8 B;  3NVW A;  4YSY B;  1FMA D;  2BS4 B;  2N0S B;  2W55 A;  3ABV B;  5GXG B;  4LTU A;  5EE3 A;  3B2G A;  3AMZ A;  1FRD A;  1KF6 B;  1ZOY B;  4C7Z A;  4YTP B;  2PKO A;  2K5P A;  4YTN B;  1T3Q A;  2G1E A;  3VRB B;  3W5U B;  3AEA B;  5C3J B;  1TKE A;  1JRO A;  3NRZ A;  4ZHO A;  1AWD A;  2M19 A;  1PUT A;  1PDX A;  3W9C B;  1J7A A; 
#chains in the Genus database with same CATH topology
 1K51 A;  2WX1 A;  2LUE A;  4W9I A;  4C7Y A;  2M8S A;  1OFF A;  5AZF A;  2IPK D;  2KDF B;  1IP9 A;  2W9N A;  4W9C A;  2LRU A;  1PGX A;  2V3N A;  4AJW A;  4K7S A;  4LK0 M;  4HVB A;  4HPP A;  4EFO A;  1H8C A;  1ZDV A;  3ZJU A;  1SSN A;  3A9K A;  3T3N A;  2K25 A;  2O6V A;  4WJQ A;  1D4B A;  4EZK A;  3WAM A;  5AZH A;  4C56 C;  1MG4 A;  2KNB A;  5JZE B;  1V97 A;  1TY0 A;  2LD9 A;  3DHI C;  4HPL B;  1FXA A;  1ZW7 A;  3HUI A;  2QDF A;  1E8Y A;  1I4P A;  4HLE A;  3QWZ B;  1EF5 A;  3VUW A;  1L0Y B;  2LGX A;  1J0G A;  3RD2 A;  3HK0 A;  1FM0 D;  2Y5B B;  4AP4 C;  4MEM A;  1I42 A;  2D3C A;  3Q3N C;  3OG5 A;  3V05 A;  3N30 A;  5EE1 A;  1QT9 A;  2GBK A;  1SIJ A;  3IFW B;  4P6V F;  3RUL A;  3HM6 X;  3EEC A;  4W9K A;  1QZE A;  2KVZ A;  2RGF A;  1JAL A;  2N7D A;  2K8C A;  1XCT L;  3AMZ A;  2Z0E B;  1F77 A;  3ENE A;  2B3A A;  5BO4 B;  2MCN B;  1TY2 A;  1PUT A;  1J7A A;  2FCM A;  1L4D B;  2GRI A;  1JML A;  4BBN F;  2RPV A;  2CHX A;  2WXK A;  4A90 A;  3H7S A;  1N61 A;  3JYU A;  1WZ3 A;  4JWU C;  2D11 A;  1WGK A;  2C9W B;  2MJE A;  3CMM B;  4RH6 A;  3A9J B;  4EKU A;  3RNB C;  2BTE A;  4US9 A;  3PZ8 A;  2X38 A;  5E6P A;  1WMH A;  3RN9 C;  4TQ1 A;  2DYO A;  4MGY E;  3VFK A;  2ACZ B;  1TKG A;  1VCB A;  1FCL A;  3PRM B;  2IDY A;  1R4M I;  3KH0 A;  3KW5 B;  1TBE A;  2JXX A;  2JT4 B;  2R2Q A;  4W9E A;  2WXM A;  4IM3 A;  4EZJ A;  3RNC C;  1C9F A;  2AL3 A;  1NVI D;  1V49 A;  1RRB A;  3ZO5 B;  2IO3 B;  2LWP A;  2JRH A;  2WYQ A;  3KQ4 A;  3VR9 B;  5DPS A;  2KVR A;  3V60 A;  3SFD B;  1YN3 A;  1TS3 A;  4KGT A;  5AUK A;  4LNN A;  2KC1 A;  4A3P A;  4FJZ A;  1SJE D;  4HWI B;  1R4N I;  1WYW B;  5C1Z A;  5J18 A;  3AN1 A;  1NBF C;  1YMH E;  3ZDT A;  2WXI A;  3U4E G;  2NBU A;  2LJ5 A;  4MDK E;  4DXF A;  4OZC A;  5BYS A;  3AEB B;  1SJH D;  2IO2 B;  3T3O A;  5IKC M;  3P4P B;  3AU4 A;  2KWU B;  1ZUD 2;  3SFE B;  1UEL A;  1FMA D;  1D5X C;  3DVG X;  2KFJ A;  3AXC A;  3QA8 A;  1I4X A;  4C00 A;  3KVF B;  1CMX B;  4GN1 A;  2G3Q B;  4BVU C;  1EF1 A;  2AWT A;  3AEA B;  4KGS A;  1TKE A;  1L4Z B;  3MJ5 A;  1V5T A;  2IO1 B;  1WM3 A;  5JH5 C;  2CS4 A;  3NVZ A;  3AE3 B;  1EWC A;  4FA6 A;  1K53 A;  2V1Y A;  4DQO C;  2L05 A;  2RD0 A;  1GOZ A;  4W9J A;  2XN9 C;  2KT7 A;  1TYG B;  1WR1 A;  1IGD A;  5J17 A;  2WX0 A;  3TEX A;  2JVC A;  4FXC A;  5TR5 A;  2A5U A;  3Q8E A;  3NOB A;  3PV1 A;  2LXA A;  2MA9 B;  1WJN A;  3D32 A;  2V3S A;  1EU4 A;  3EFU A;  3VHT C;  3AI5 A;  1F2R I;  1VD2 A;  3KUD B;  2ICI A;  3N1Z C;  1JRU A;  3U52 E;  3L0W B;  2C5L C;  4ZRP A;  3DOW A;  2CHZ A;  3CIR B;  4KKI A;  4PS7 A;  1L0V B;  2BS3 B;  3WAP A;  1WGR A;  2KC2 A;  2RMM A;  1ZKH A;  1DGJ A;  5JHA A;  1HTQ A;  3NG0 A;  4W9G A;  4ZDV A;  2MLB A;  1ZXI A;  2KN4 A;  2OHF A;  2XK5 B;  2K6Q A;  3APD A;  4PS8 A;  5G2N A;  4RCO A;  1DOI A;  3UIN B;  3A9K B;  3S2A A;  1L2N A;  4XC2 A;  1KFY B;  2K6D B;  4ANU A;  2KAN A;  1I4H A;  3IVF A;  3RNF C;  3DHH C;  4FHJ A;  2HJ8 A;  5FR3 A;  3N3K B;  4HJG E;  2G1E A;  2NS5 A;  4HJK A;  2C7M B;  3Q69 A;  4ANW A;  4BOS C;  1GC7 A;  1BUI C;  2PIA A;  2ZZP B;  1E5W A;  2L76 A;  3AE2 B;  1SE3 A;  2LVP A;  1WYG A;  2JYE A;  1Z5S B;  3DQV A;  5IN7 A;  4WWP A;  2ONQ A;  1B9R A;  1NYR A;  2N1V A;  1ZP0 B;  3DVG Y;  1TZO A;  1E0Z A;  5D2M B;  1WGG A;  2IYD B;  3V6E B;  1J8C A;  2UWQ A;  3GB1 A;  3AB5 A;  4HDO A;  1KM7 A;  3N9Y C;  1R7S A;  3DBR I;  4RM9 A;  4OW0 A;  3MC9 A;  1QOA A;  3TMP B;  1FFU A;  4FUL A;  4WWM A;  1V1P B;  3AE7 B;  2DLB A;  4RGM A;  3RI7 C;  3ZLZ A;  1C78 A;  1E7P B;  3I9V 1;  2IO0 B;  2HD5 B;  3AEE B;  4GOC A;  3QHT A;  2Y5C A;  1HQR D;  3M63 B;  4OVU A;  3KUZ A;  1PFD A;  4M00 A;  2KMC A;  2BKR B;  3AM9 A;  1WXM A;  3ZXV A;  1YQ4 B;  3W1S A;  1MI0 A;  1UWX A;  3AE9 B;  3Q3F A;  2SEB D;  1FFV A;  4AQ7 A;  2KKC A;  4P7I A;  3UQB A;  4KDL B;  1WJU A;  4MSM B;  3Q3O C;  4WAF A;  5BMH A;  3ZYY X;  3DBH B;  4O1N A;  4LNO A;  3Q8B A;  3PRE A;  3WCQ A;  4GDL A;  1P3Q U;  1D6E C;  3ZGZ A;  2TSS A;  3IG3 A;  3AE8 B;  3L08 A;  1WF9 A;  2K8B A;  2ZPY A;  2CKH B;  3IHP C;  4JPS A;  4F1S A;  1F2R C;  5JXV A;  2N1W A;  1OGW A;  3LJ3 A;  2KMM A;  2JU6 X;  1FXI A;  3PS6 A;  4P1C C;  1L0X B;  3I57 A;  3PGE A;  2NBV B;  2J53 A;  4M8N A;  3TUO A;  3AE4 B;  1QIL A;  3PVL A;  3NS1 A;  1C3T A;  2AQ2 B;  3ZXR A;  2KDB A;  3AEG B;  2BYT A;  1N5X A;  3Q3J A;  1Q5W B;  1GNU A;  3JW0 X;  2H89 B;  4GMV A;  4Q2J A;  1N62 A;  3MFG A;  4US8 A;  3GZN I;  4D2K A;  1EWY C;  4YT0 B;  2BB5 A;  3LXF A;  3UI3 A;  1VJK A;  2WXO A;  2JX5 A;  3P63 A;  1XXG A;  3R7Q A;  4C4V A;  2G9H D;  4YWG G;  3MP9 A;  3N20 C;  5L83 A;  3VUY A;  1HZ6 A;  1XF5 L;  3OJ4 B;  2DHZ A;  1YN5 A;  1MHX A;  3J9C A;  4NQL B;  5GMV A;  4GSW A;  2XEW A;  5EDS A;  2BYV E;  2M0A A;  4KZC A;  2WP9 B;  1I4Q A;  4K81 A;  3I5J C;  2C60 A;  3E9S A;  1N63 A;  2B76 B;  2I2Y A;  3AE1 B;  4PT5 A;  4FJV B;  2DAF A;  3KYD D;  3H6N A;  1VZ8 A;  1B1Z A;  4RNA A;  3ZW3 A;  3NZU A;  3NVW A;  3Q2A C;  2KWC A;  4QAY A;  4HDQ A;  1ZOY B;  2VH2 A;  1C79 A;  4LJP B;  1TIF A;  3W5U B;  4IWO A;  3CST A;  2KJR A;  1AWD A;  3JSV B;  1FD6 A;  1EUV B;  2MQJ A;  4A8X C;  5D6J B;  4A6Q A;  1TGZ B;  1XLO A;  1F1H A;  3PTF C;  2INN E;  1AN8 A;  2IGD A;  4NNJ B;  2YEP F;  1PQS A;  3DPD A;  2IBI B;  2ZNV C;  4YL8 A;  5CX3 A;  2BQQ A;  1T5X D;  1V5O A;  3WAN A;  4OVV A;  3UQA A;  1J19 A;  2ZPN A;  4DXG A;  4J6I A;  3KLS X;  4HKZ E;  1YX5 B;  4YSZ B;  4WJP A;  2LI5 A;  4K3B A;  2ZW1 A;  1WGD A;  4GDL B;  1OTR B;  4ASW C;  4P16 A;  1UBQ A;  2KAC A;  3SHQ A;  2J0J A;  1YD8 U;  1AYF A;  1R4M B;  2BT6 A;  4TV3 A;  2ZCB A;  1NEN B;  1GB1 A;  4JIO U;  1ET9 A;  4RGT A;  4A20 A;  1WM2 A;  4KV2 A;  1K50 A;  1YIW A;  2FID A;  4FJY A;  4ITK A;  1SE9 A;  3U7Z A;  2L8J A;  4ANX A;  4KIK B;  2V4I B;  3VTU A;  5IA7 A;  2INP E;  2YEP B;  2REX A;  5BMI A;  3R7R A;  4HPM B;  4XWW A;  1UGJ A;  4YSY B;  3PRP B;  5GXG B;  4B6W A;  3NUH B;  3B2G A;  1KF6 B;  2KN5 A;  2K39 A;  5DPT A;  4AUQ C;  2L32 A;  3VRB B;  4M8M A;  2M1M A;  3B08 A;  5AZG A;  3VQI A;  1FRR A;  2N7J A;  1V2Y A;  3O13 A;  4UDU C;  2RSU A;  4B0E A;  4OHJ A;  1TT5 B;  1TZ1 A;  4WWO A;  3KWV A;  2KQS A;  3PO0 A;  1V81 A;  2JZ3 B;  2WHI A;  2GI9 A;  3VVW B;  1V8C A;  2MEK A;  4MJS B;  1YJI A;  2WQY B;  4GU2 A;  1LO5 D;  3IAS 1;  5G5G A;  3HHM A;  5DPW A;  1WXV A;  3RZW C;  3T8M A;  5C2T B;  2J7Q B;  3GOE A;  5H92 C;  3TCA A;  2HE7 A;  2LEK A;  4IOI E;  4RF0 A;  1WJ4 A;  3SU8 X;  4JGH B;  3RUI B;  1FXT B;  1GJZ A;  4LLG M;  2AQ1 B;  2M0X A;  2KLC A;  4YXD B;  3BVM A;  1E90 A;  3HVD A;  2WXG A;  1Y8R C;  3H9D A;  1CZP A;  2LGY A;  1WH3 A;  1KRH A;  2ZVN A;  4KSK C;  3V3X A;  4ZYS A;  2GOW A;  2KK8 A;  3Q3M C;  4HCP B;  2NBW B;  3L13 A;  5IO9 A;  1M4V A;  1OQY A;  1KTK A;  3IBE A;  1VZ7 A;  1F0Z A;  2MX2 A;  3PPA A;  3DBH I;  1SF0 A;  4G0N B;  2PTL A;  1R4N B;  3ONS A;  4TKN A;  2D10 A;  2DYB A;  2NMQ A;  3PLU A;  4RGN A;  2KQ7 A;  3A4S C;  3ZUN A;  4WJO A;  2ZNV B;  2K5P A;  2MBH A;  4I6L B;  5D7G A;  2N9K A;  4B0M A;  1E6E B;  3A1Q B;  2HJ1 A;  1NI2 A;  1YQ3 B;  2AX5 A;  2GB1 A;  3DDC B;  2ZJD A;  1ZDX A;  1NEK B;  1SE2 A;  2UYZ B;  2V0G A;  5AEK B;  2BWF A;  2LHD A;  3QC8 B;  5E6O A;  1P0R A;  2E6X A;  2OJR A;  2MP2 B;  3Q8C A;  1N5W A;  2LFI A;  2EEL A;  4E71 A;  2IGH A;  4JWS C;  3HRD D;  3NJT A;  3VUX A;  2K0P A;  2BYE A;  2JUO A;  2JSV X;  1IBX B;  4ZYN A;  4IDI A;  2QMT A;  3BK2 A;  4FLH A;  2CHW A;  3NZ3 A;  2WNM A;  5FR6 A;  1QKZ A;  2LVO A;  2WDT B;  1C4P A;  2KJH B;  2GBN A;  2DZI A;  4IKG A;  5IOI A;  3W1S C;  2WU2 B;  1WSP A;  3BVG A;  4IM2 A;  1HA5 A;  1V1O A;  1P7E A;  4G3X B;  2KDI A;  1WGY A;  1TKY A;  3A4R A;  3N1Y C;  1NI3 A;  3ZNH B;  1C4A A;  4CHK A;  3N32 A;  2LAS A;  2WDV B;  4EOY A;  2BPS A;  3L10 B;  3QQ8 B;  1ISN A;  2XBB C;  1HZ5 A;  2BYF A;  2KDE B;  2ZCC A;  2J0K A;  3PHX B;  2N9L A;  2Z0D B;  2FCS A;  3EA6 A;  5E6N A;  2K8H A;  1P98 A;  1T3Q A;  2D07 B;  2RR9 A;  1F52 A;  2WDR B;  1VDV A;  4FHK A;  3RNG C;  2DZM A;  4ZRJ A;  3B9J A;  1MVK A;  4BBN C;  4DXA B;  4RMA A;  2PEA A;  5EE9 A;  3SDL C;  3H7P A;  1JWB D;  4ZRK A;  2PLP A;  3DBS A;  4LCD E;  4M02 A;  2VZK B;  4BOZ B;  1RFK A;  4WWN A;  5MPO A;  1OQQ A;  2LGD A;  3AE5 B;  3B1L X;  2MW5 A;  1HTO A;  1QLB B;  1KOT A;  2KMA A;  2JWU A;  4IM0 A;  4WQM A;  3P2B A;  3U30 A;  3I3T B;  1JWA D;  2BGF A;  4N58 A;  1Y56 A;  4F7Z A;  4RF1 A;  2DZJ A;  2CU3 A;  4PYZ A;  1YQB A;  3LB8 C;  4W9F A;  2BKF A;  1QOB A;  3AH7 A;  4ICV A;  1N6Z A;  4ZRI A;  2L52 A;  5CTR C;  2LGI A;  1TS5 A;  4K1R B;  1T0S C;  3AUL A;  5D3D A;  4KZ0 A;  1D5M C;  3QCA A;  2L3Z A;  4DWF A;  4TSS A;  1S3S G;  5L95 C;  5E6J A;  4ARC A;  3DCG A;  1KLV A;  4L2Y A;  3GS2 A;  3I63 C;  1E9M A;  2HTM E;  3ZTD A;  2MSE D;  1Q1O A;  3AU5 A;  1KLG D;  2MBO A;  3WAL A;  2W3R A;  3P4R B;  1E8X A;  2KFK A;  2VRR B;  3PZ7 A;  2BW2 A;  2WXN A;  5EE3 A;  2J0M A;  1FRD A;  4MGI E;  1ZPS A;  2QSD A;  2NCN A;  4IW0 A;  2KWD A;  3NZS A;  1SXT A;  1EU3 A;  2MWS B;  2QCZ A;  1ACC A;  2JF5 A;  3L54 A;  4I6P A;  3SD5 A;  1RWS A;  1SB3 C;  2KOX A;  1WX8 A;  1XD3 B;  3AED B;  3ZIM A;  3TL5 A;  2EKE C;  1T0Y A;  5AUI A;  2K1F A;  1L7Y A;  2EMS A;  2NR2 A;  2L00 B;  1DOY A;  3N1X C;  1UD7 A;  2I1J A;  5CHW A;  4II2 B;  4WIP A;  4KX6 B;  2J42 A;  1RFA A;  4M01 A;  1XO3 A;  1E7V A;  4LJO B;  3C0R B;  1UF0 A;  3K9P B;  2KTR A;  2GMI C;  4HCN B;  5HFY A;  3GE8 C;  1QF6 A;  4X57 B;  4IC7 B;  4NZL B;  2R61 A;  4HRO A;  4NQK E;  2WXL A;  3ZJT A;  1MHH E;  3LYY A;  4BFR A;  3A1Q A;  2BWE S;  2QJL A;  4WJN A;  4HK2 A;  1YJJ A;  1JWM D;  4XDD A;  2V3P A;  4MSQ B;  1WR6 E;  3APF A;  4CQN A;  4JQW C;  2E3T A;  2WDQ B;  4NJC A;  1HE8 A;  2PW9 A;  4IWP A;  2UU7 A;  3W2D A;  3OAW A;  5C23 A;  1K52 A;  3MHS D;  2BVC A;  4L23 A;  2G4D B;  1DYQ A;  1RM6 C;  1D3Z A;  3L16 A;  3T9L A;  1ROE A;  3MTN B;  2IJ0 A;  5IP4 D;  5FK9 C;  2DWQ A;  3RFZ B;  4RM8 A;  1DOX A;  2JXT A;  3UF8 A;  2IY0 B;  4GXB A;  4HXD A;  3PRZ A;  4NJ6 A;  4DHJ D;  3C8Y A;  2BS4 B;  2JWZ A;  4CYE A;  4XWT A;  4RFB A;  1FNU A;  3DBL I;  2G45 B;  4XGA B;  2GLS A;  3NRZ A;  2M19 A;  2XNA C;  4JL9 A;  1PDX A;  4MM3 B;  1SEB D;  1YOV B;  2V9H A;  2K3U A;  3O65 B;  1WE7 A;  1FCC C;  3W5V B;  3RPF C;  1K8R B;  5DCN A;  4MJS A;  3L4P A;  4CO7 A;  4GLS C;  2D3B A;  4E3C A;  1UWM A;  1TJE A;  4XYC A;  1E8Z A;  4GDK A;  4BKG A;  2FE8 A;  3URY A;  4N9F 4;  5H8Y E;  2H88 B;  1C1Y B;  2KLG A;  2LJI A;  3ZKJ C;  3X23 A;  4YTM B;  4EE2 A;  1WX7 A;  3EHV A;  4W9H A;  4AWJ A;  2Y5P A;  3VXW A;  5KHO A;  1WY8 A;  4USA A;  1WXS A;  1XLN A;  4MM3 A;  5HKH A;  3RMK C;  4B9K A;  2LHE A;  1EO6 A;  1RLF A;  3Q6B A;  4WH4 A;  4DHZ B;  4N6E B;  4KIK A;  2CU1 A;  4C4V B;  3ZQ4 A;  3CSF A;  3U7D A;  1I4G A;  3TBL D;  1AAR A;  3MHZ A;  2FNJ B;  3BZD B;  1C76 A;  4ZOH C;  3JVZ X;  3ECI A;  4TQ0 A;  1I35 A;  1PGB A;  3BIN A;  3Q14 C;  4NJ7 A;  4J3O D;  2G4S A;  2MJ3 A;  4B95 A;  2QEJ C;  2WXQ A;  2ASQ A;  3QX1 A;  1T0Q C;  2BS2 B;  4W9L A;  3ML9 A;  2D3G A;  2K9X A;  3RNE C;  2FUH B;  4GIV A;  1WWT A;  1V80 A;  2KFK B;  2J52 A;  2Q5W D;  1XCQ L;  4P1B C;  1KLU D;  1ET6 A;  2YLM A;  1WGH A;  1I4R A;  2AEH A;  1CQV A;  4KDI C;  4IUM B;  4YTP B;  2RPQ A;  5KHQ A;  2PKO A;  1QQR A;  1SBB B;  4G50 A;  4OVZ A;  4MH0 E;  1JQ4 A;  1LXD A;  3GE3 C;  1E8W A;  2HDE A;  1T6B X;  3PT2 B;  4W9D A;  3A9J A;  3H1U A;  2KTR B;  2WLB A;  2Z8L A;  2PE9 A;  3DBR B;  3FIL B;  3KWL A;  4MGZ E;  4TUU A;  1WX9 A;  1I7H A;  2W54 A;  4AOF A;  4R3D A;  3MC8 A;  1SE4 A;  3TEZ A;  2LMC A;  2LGS A;  3WIM A;  4C80 A;  2WGS A;  1QOF A;  3QIJ A;  2ZEQ A;  3ZDM C;  2I38 A;  2DEN B;  4ICU A;  1FNV A;  4KKJ A;  3FIL A;  2GBM A;  1XLQ A;  2D2Q A;  2OED A;  4DDI D;  2VZK D;  4BZA A;  2FBW B;  4S17 A;  1N60 A;  1FO4 A;  1U4A A;  2NTS A;  3HM3 A;  2KX3 A;  5G55 A;  5I4D A;  2MJD A;  3ZJV A;  4FN2 A;  1L6V A;  1UUP A;  4MAC A;  2M17 A;  4AJY B;  3DBL B;  1IGC A;  4ZRQ A;  3ML8 A;  2GBJ A;  3AEC B;  1JWS D;  2CJN A;  2WS3 B;  3SR6 A;  2I1K A;  2L7R A;  1MFW A;  4BAX A;  1FNW A;  5DPR A;  2X8X X;  5G5H A;  1WFY A;  3FC4 A;  3VRA B;  4LNF A;  3TJP A;  2EMT A;  1C77 A;  2FCQ A;  1IPG A;  1CK1 A;  2FUG 1;  2OOB B;  2R2O A;  3HIZ A;  1EM7 A;  2C7H A;  3JSV A;  5C3J B;  1V9J A;  4MT5 A;  3VTV A;  2NPT B;  2IZV B;  2JZP A;  5HI1 A;  5IAA C;  3GZN B;  4A3O A;  1S1Q B;  5J2R A;  3ZNI D;  3V61 A;  2N4F A;  4JX1 C;  3QK0 A;  1LFD A;  4EZL A;  4F8C B;  4N59 A;  3DWM A;  2D3A A;  3P4Q B;  1ZE3 D;  1WIA A;  4ANV A;  1ZGU B;  4G11 A;  2D5G A;  2N9X A;  2N7E A;  1AW7 A;  5JHB A;  4GGQ A;  2QHO A;  2O2V B;  4ZHP A;  3DVN U;  4PK1 A;  2LZ6 A;  1J7B A;  2YVC A;  2OJW A;  2M56 B;  3IAM 1;  3OWE B;  3PZD A;  1KH0 A;  3ZNZ B;  4HKQ A;  3AEF B;  4NPN A;  2BF8 B;  2L1A A;  1LQB A;  4K7W A;  1D5Z C;  2K22 A;  3BVZ A;  3UIP B;  3VH3 B;  2MRP A;  1NYQ A;  3VH4 B;  3UIO B;  3QJZ A;  1JW9 D;  4KGR A;  2KD0 A;  3P1M A;  1UBI A;  5BYR A;  1HXY D;  1GG3 A;  3BYY B;  3AE6 B;  2KDM A;  2MBQ A;  2CR5 A;  2MP2 A;  3AV8 A;  2PVO D;  1SGH A;  1QOG A;  3K9O B;  4DHJ B;  4BKS A;  4E74 A;  2GBR A;  2AYO B;  4MH8 A;  1XQQ A;  3WA0 A;  3WAO A;  2LVQ A;  1LM8 B;  3B2F A;  2IND C;  2FIF A;  2ZW0 A;  2M4N A;  4DK5 A;  3V62 A;  1Q0W B;  2AQ3 B;  4XX5 A;  3H7P B;  4WAA A;  3R8B A;  3ALB A;  2N0S B;  3ABV B;  2PJH A;  4LTU A;  3MC0 B;  4M0W B;  3V6C B;  1C4C A;  5HHD G;  1ENF A;  1JRO A;  3IT4 B;  3APC A;  3U2S C;  2LRW A;  3ZTC A;  3ZRF A;  4EUT A;  3ETR A;  2VH1 A;  4FBJ B;  5HG2 A;  1V1P A;  2KAJ A;  4KSL C;  1M94 A;  3EGR A;  4YSX B;  2RDB C;  3BK1 A;  1FIQ A;  1WRI A;  2RDH A;  4II3 B;  3M3J A;  1GB4 A;  1P9D U;  4URK A;  4DDG D;  2MHJ A;  3GP7 A;  4RGO S;  1IYF A;  1IUE A;  4WQO B;  2KQ4 X;  2WXR A;  1WI0 A;  5D94 A;  4LNK A;  5LXI B;  2KX0 A;  1UH6 A;  4XZ4 A;  1WXA A;  1TS2 A;  1CJE A;  1ZXH A;  3X0W A;  1IBX A;  4TMA B;  1L5P A;  5LXH A;  2EKI A;  2KTF A;  3NS8 A;  4LDT D;  3L17 A;  1VR9 A;  5LNK 1;  4GDK B;  1OQR A;  3IXS A;  4K7U A;  4A9A A;  3U8Z A;  1L6U A;  3KYC D;  1A70 A;  3BY4 B;  2KZR A;  3RT3 B;  3R66 C;  1Z2M A;  1RAX A;  2DBY A;  5TSS A;  4HRS A;  4DBG A;  3R3M A;  2FAZ A;  3OLM D;  2JQR B;  2N9P C;  1YNT E;  3LDZ E;  4JE3 B;  1WJ6 A;  3M95 A;  4GB9 A;  3NVV A;  4LDT B;  1LGR A;  3B0A A;  3UGB B;  2KYW A;  1BT0 A;  2WXP A;  5FKA C;  2C7N B;  3ZRC A;  4XDC A;  2PE6 B;  1MJD A;  4ZHO A;  1UNS A;  5BYQ A;  4M0W A;  2PPH A;  2MH7 A;  1WRD B;  1WMH B;  3NY5 A;  3SEB A;  2HTH A;  1TTN A;  1WE6 A;  1XLP A;  1OEY A;  4MEL A;  1UGM A;  1G6J A;  2NTT A;  2WU5 B;  2JRI B;  1PGA A;  1E7U A;  3VR8 B;  2KO3 A;  5BMG A;  4MGK E;  1GC6 A;  2QC8 A;  2L0F A;  2A4Z A;  2DYM A;  1YJ1 A;  4IG7 B;  2DZK A;  1STE A;  2LXC A;  2BB6 A;  1YN4 A;  3Q8F A;  3R2I A;  1SIF A;  2CJO A;  2J4X A;  3PSE B;  1GAQ B;  2O6V B;  2KXJ A;  1VZ6 A;  3Q8A A;  4OZA A;  4OZB A;  3EC8 A;  1V6E A;  3MJW A;  3FAH A;  1UZX B;  4PYU A;  4JLC A;  5EE0 A;  2WXF A;  3TEY A;  1MPE A;  2KJ6 A;  5CHV C;  1YX6 B;  1V86 A;  3DVN V;  2Z59 B;  3TEW A;  2Y3A A;  3NHE B;  2O2V A;  2L83 A;  2SAK A;  4NAW A;  4HEA 1;  1FPY A;  3A33 B;  1KJT A;  2JY6 A;  2N9E B;  4H2A A;  1RYJ A;  3CF6 E;  4KVG B;  2QIE B;  2O6V D;  2XK5 A;  3TIX A;  1BXT A;  2AL6 A;  2PVG C;  3PHW B;  1PYW D;  3RCZ A;  3FKY A;  2W55 A;  3C19 A;  3VAW A;  2JYT A;  2WXH A;  5D3I B;  1WZ0 A;  2QIL A;  1T0R C;  1F9J A;  4YTN B;  3RYT A;  2DX5 B;  2WWZ A;  3KUC B;  3IT6 B;  2W82 A;  3R2T A;  4ACF A;  1X1M A;  3ZVV A;  1JRP A;  1P1A A;  4NAW B;  2RDG A;  4S0R A;  3H8H A;  2DNF A;  4BKS D;  1TS4 A;  2IGG A;  5CHF A;  5T8I A;  2NPT A;  4AS1 A;  1P7F A;  1BML C;  1OEY J;  2DAJ A;  2W3S A;  3BYT B;  3VDZ A;  4BKT A;  1GUA B;  3PLV A;  3HVZ A;  4XE0 A;  3VTW A;  3DHG C;  2KWV B;  3QAR A;  1ESF A;  2MBE A;  2LUM A;  4FAD A;  1J7C A;  4LNI A;  2FCN A;  4A55 A;  4I6N B;  1HEZ E;  1A5R A;  3E56 A;  3DWG C;  2ZVO A;  1FEH A;  1JWU D;  3BWU D;  2JPH A;  1WXQ A;  4L1B A;  3P4S B;  3TSS A;  4K3C A;  1VRA B;  1XEE A;  5LLI A;  1NDD A;  3EUB 2;  1E10 A;  1GPX A;  3W1Y A;  1VLB A;  1H4R A;  4DHZ E;  3NVY A;  2MBB B;  4EEW A;  2BBC A;  2KHW B;  2WXJ A;  2L0T A;  3EFC A;  3RNA C;  2NVU I;  1XT9 B;  2V4L A;  3BII D;  3QAQ A;  3OJ3 A;  4NAM A;  2JZZ A;  4IWQ A;  4ARI A;  2IY1 B;  3ZNG C;  2INC C;  1MG8 A;  3CWI A;  4PS3 A;  1Q10 A;  3M62 B;  4WUR A;  2ON8 A;  3P42 A;  1JCK B;  4C7Z A;  4REZ A;  3RZF A;  2PMV A;  3W9C B;  4NY0 A; 
#chains in the Genus database with same CATH homology
 5HI1 A;  2WDR B;  1VDV A;  1K51 A;  2KMM A;  3B9J A;  1MVK A;  4C7Y A;  1OFF A;  2JU6 X;  1FXI A;  4JX1 C;  2IPK D;  1L0X B;  5EE9 A;  3I57 A;  1JWB D;  4N59 A;  3DWM A;  2PLP A;  2J53 A;  2VZK B;  3TUO A;  3P4Q B;  1RFK A;  1ZE3 D;  3AE4 B;  1QIL A;  5MPO A;  3NS1 A;  1OQQ A;  1PGX A;  2D5G A;  2V3N A;  3AE5 B;  1AW7 A;  4LK0 M;  2AQ2 B;  1QLB B;  2JWU A;  1ZDV A;  4ZHP A;  3ZJU A;  1SSN A;  4WQM A;  3AEG B;  3T3N A;  1J7B A;  2BYT A;  1JWA D;  1N5X A;  2M56 B;  3IAM 1;  1Y56 A;  4N58 A;  2H89 B;  3OWE B;  4Q2J A;  1N62 A;  4RF1 A;  1KH0 A;  2CU3 A;  3MFG A;  4US8 A;  4D2K A;  4HKQ A;  1D4B A;  3AEF B;  1EWY C;  3LB8 C;  4YT0 B;  2BB5 A;  3LXF A;  2L1A A;  1QOB A;  4C56 C;  3AH7 A;  3UI3 A;  1VJK A;  1D5Z C;  2K22 A;  2WXO A;  3BVZ A;  1V97 A;  2JX5 A;  3P63 A;  1NYQ A;  2L52 A;  1TY0 A;  2LGI A;  1XXG A;  1TS5 A;  1JW9 D;  1FXA A;  2G9H D;  4YWG G;  4KGR A;  3P1M A;  3MP9 A;  5BYR A;  3HUI A;  5D3D A;  1HXY D;  1I4P A;  1D5M C;  1HZ6 A;  1XF5 L;  3BYY B;  4TSS A;  3AE6 B;  1L0Y B;  2KDM A;  1YN5 A;  1FM0 D;  1MHX A;  5E6J A;  3AV8 A;  3J9C A;  4ARC A;  2PVO D;  3V05 A;  1QOG A;  4L2Y A;  3GS2 A;  2M0A A;  2WP9 B;  1I4Q A;  1E9M A;  5EE1 A;  1QT9 A;  2HTM E;  1SIJ A;  4MH8 A;  3B2F A;  4P6V F;  3E9S A;  1N63 A;  2B76 B;  2ZW0 A;  2I2Y A;  3AE1 B;  4PT5 A;  1KLG D;  2W3R A;  2AQ3 B;  1JAL A;  1VZ8 A;  1B1Z A;  3P4R B;  4RNA A;  3R8B A;  3NVW A;  3PZ7 A;  1XCT L;  2N0S B;  2BW2 A;  2WXN A;  3ABV B;  4LTU A;  5EE3 A;  3AMZ A;  1FRD A;  3MC0 B;  1ZOY B;  1F77 A;  1ZPS A;  1C79 A;  2QSD A;  1C4C A;  5HHD G;  3W5U B;  1ENF A;  1JRO A;  2KWD A;  3IT4 B;  1TY2 A;  1AWD A;  1SXT A;  1PUT A;  3U2S C;  1FD6 A;  1J7A A;  1EU3 A;  1ACC A;  1RWS A;  4A8X C;  1SB3 C;  1L4D B;  3ETR A;  4A6Q A;  2GRI A;  1JML A;  5HG2 A;  1V1P A;  2RPV A;  3AED B;  2WXK A;  4A90 A;  1XLO A;  1N61 A;  2KAJ A;  5AUI A;  4JWU C;  2INN E;  1AN8 A;  2IGD A;  1WGK A;  2MJE A;  3EGR A;  2YEP F;  4RH6 A;  4YSX B;  2BTE A;  4US9 A;  1DOY A;  3PZ8 A;  2X38 A;  3BK1 A;  1FIQ A;  1WRI A;  2RDH A;  1GB4 A;  4TQ1 A;  4WIP A;  2DYO A;  4KX6 B;  2J42 A;  3GP7 A;  4RGO S;  2ACZ B;  1T5X D;  1IUE A;  1XO3 A;  1TKG A;  2KQ4 X;  2WXR A;  1FCL A;  2IDY A;  5HFY A;  4DXG A;  1QF6 A;  1TS2 A;  4NZL B;  1CJE A;  2R61 A;  2WXM A;  1ZXH A;  4HRO A;  1IBX A;  2WXL A;  1L5P A;  4TMA B;  3KLS X;  4HKZ E;  3ZJT A;  1MHH E;  2EKI A;  4YSZ B;  3LYY A;  1C9F A;  1NVI D;  2QJL A;  2ZW1 A;  3KQ4 A;  4GDL B;  3VR9 B;  1YJJ A;  1VR9 A;  5LNK 1;  1JWM D;  4P16 A;  2V3P A;  4GDK B;  4XDD A;  1OQR A;  3IXS A;  4CQN A;  3SFD B;  4A9A A;  1YN3 A;  1L6U A;  2E3T A;  2KAC A;  1TS3 A;  4KGT A;  2WDQ B;  5AUK A;  1A70 A;  4NJC A;  1SJE D;  1AYF A;  2PW9 A;  3W2D A;  3AN1 A;  2BT6 A;  5JXV A;  2DBY A;  1NEN B;  1K52 A;  1YMH E;  5TSS A;  2WXI A;  3U4E G;  1GB1 A;  4L23 A;  1DYQ A;  4DXF A;  4HRS A;  4RGT A;  1ET9 A;  4OZC A;  1RM6 C;  1ROE A;  2JQR B;  2IJ0 A;  1YNT E;  5FK9 C;  5BYS A;  3AEB B;  2DWQ A;  1K50 A;  3RFZ B;  1DOX A;  4JE3 B;  2JXT A;  1SJH D;  4ITK A;  3T3O A;  3U7Z A;  3P4P B;  2V4I B;  2INP E;  3NVV A;  1ZUD 2;  3SFE B;  2YEP B;  5BMI A;  4XWW A;  3C8Y A;  1UGJ A;  4YSY B;  1FMA D;  2BS4 B;  1D5X C;  5GXG B;  2WXP A;  5FKA C;  3NUH B;  1I4X A;  3B2G A;  4XWT A;  1KF6 B;  4XDC A;  4RFB A;  2L32 A;  3VRB B;  1FNU A;  4KGS A;  3AEA B;  1TKE A;  3NRZ A;  1L4Z B;  2M19 A;  2XNA C;  3MJ5 A;  4ZHO A;  1PDX A;  4MM3 B;  1UNS A;  1SEB D;  3VQI A;  1FRR A;  2N7J A;  5BYQ A;  3NVZ A;  4M0W A;  2K3U A;  3AE3 B;  2MH7 A;  3O13 A;  1FCC C;  4UDU C;  3SEB A;  1EWC A;  3W5V B;  3RPF C;  4B0E A;  1K53 A;  4DQO C;  4OHJ A;  3L4P A;  4GLS C;  1GOZ A;  1XLP A;  2XN9 C;  3KWV A;  1TYG B;  1UWM A;  2NTT A;  1TJE A;  3PO0 A;  2WU5 B;  1IGD A;  1PGA A;  2GI9 A;  1V8C A;  3VR8 B;  2MEK A;  2FE8 A;  5BMG A;  3URY A;  1YJI A;  5H8Y E;  3TEX A;  2WQY B;  4FXC A;  2H88 B;  2DYM A;  1LO5 D;  3IAS 1;  3Q8E A;  5G5G A;  2LJI A;  1STE A;  2BB6 A;  4EE2 A;  4YTM B;  1YN4 A;  3Q8F A;  3R2I A;  5H92 C;  5C2T B;  1EU4 A;  2LEK A;  2CJO A;  2J4X A;  4IOI E;  4RF0 A;  2Y5P A;  1F2R I;  1GAQ B;  4USA A;  1XLN A;  1VZ6 A;  2ICI A;  4LLG M;  2AQ1 B;  3Q8A A;  4OZA A;  4OZB A;  2LHE A;  3U52 E;  4YXD B;  4WH4 A;  3BVM A;  4ZRP A;  4N6E B;  3FAH A;  3CIR B;  4KKI A;  3ZQ4 A;  3HVD A;  1L0V B;  2BS3 B;  1I4G A;  2WXG A;  1CZP A;  2RMM A;  5EE0 A;  1DGJ A;  2WXF A;  3TEY A;  1MPE A;  1KRH A;  3MHZ A;  3TEW A;  3V3X A;  4ZYS A;  2Y3A A;  3BZD B;  1C76 A;  1ZXI A;  2KN4 A;  2L83 A;  2OHF A;  2SAK A;  4ZOH C;  4HEA 1;  4TQ0 A;  1M4V A;  1KTK A;  1PGB A;  4J3O D;  1VZ7 A;  1F0Z A;  2MJ3 A;  4RCO A;  2QEJ C;  4H2A A;  2WXQ A;  1RYJ A;  1DOI A;  2BS2 B;  2QIE B;  1SF0 A;  2K9X A;  1WWT A;  2PTL A;  1KFY B;  2J52 A;  2Q5W D;  1BXT A;  1XCQ L;  2PVG C;  1KLU D;  1PYW D;  1ET6 A;  2W55 A;  2NMQ A;  1I4H A;  1I4R A;  4RGN A;  2JYT A;  2WXH A;  5D3I B;  1CQV A;  5FR3 A;  4YTP B;  2QIL A;  2PKO A;  2K5P A;  4HJG E;  4YTN B;  2G1E A;  5D7G A;  3Q69 A;  2N9K A;  1QQR A;  1SBB B;  4OVZ A;  1BUI C;  1JQ4 A;  4B0M A;  1E6E B;  3IT6 B;  2PIA A;  2W82 A;  1YQ3 B;  2AX5 A;  2GB1 A;  3R2T A;  2HDE A;  1T6B X;  3AE2 B;  1SE3 A;  1WYG A;  1JRP A;  2JYE A;  1ZDX A;  1NEK B;  1SE2 A;  2ONQ A;  2V0G A;  1B9R A;  1NYR A;  2WLB A;  2Z8L A;  4NAW B;  3FIL B;  3KWL A;  2RDG A;  1ZP0 B;  3H8H A;  1TZO A;  2LHD A;  1E0Z A;  1TS4 A;  2W54 A;  1I7H A;  2E6X A;  3Q8C A;  2IGG A;  5T8I A;  4AS1 A;  1P7F A;  1BML C;  4R3D A;  2W3S A;  3GB1 A;  1N5W A;  2LFI A;  3AB5 A;  3BYT B;  1SE4 A;  3TEZ A;  2EEL A;  2LMC A;  4C80 A;  2IGH A;  3HVZ A;  4XE0 A;  4JWS C;  1QOF A;  3N9Y C;  3HRD D;  1R7S A;  2K0P A;  2JSV X;  4OW0 A;  1IBX B;  1ESF A;  4IDI A;  2LUM A;  1QOA A;  2QMT A;  3BK2 A;  1J7C A;  1FFU A;  4WWM A;  1V1P B;  2I38 A;  2DLB A;  3AE7 B;  4RGM A;  1C78 A;  4A55 A;  1FNV A;  3NZ3 A;  2WNM A;  1E7P B;  3I9V 1;  4KKJ A;  1QKZ A;  3FIL A;  1HEZ E;  3AEE B;  1XLQ A;  3E56 A;  2Y5C A;  1HQR D;  2OED A;  3DWG C;  1C4P A;  2VZK D;  1FEH A;  1JWU D;  2FBW B;  3BWU D;  1FO4 A;  1N60 A;  1PFD A;  1WXQ A;  2NTS A;  4IKG A;  3P4S B;  4L1B A;  2WU2 B;  5I4D A;  2MJD A;  3TSS A;  3ZJV A;  1VRA B;  1WSP A;  1XEE A;  3BVG A;  3AM9 A;  1L6V A;  1UUP A;  3EUB 2;  1HA5 A;  1E10 A;  1GPX A;  1YQ4 B;  4MAC A;  3W1S A;  1V1O A;  1MI0 A;  1P7E A;  1UWX A;  3AE9 B;  1VLB A;  1FFV A;  2SEB D;  4AQ7 A;  1IGC A;  1TKY A;  4ZRQ A;  3NVY A;  1NI3 A;  3AEC B;  1JWS D;  1C4A A;  2CJN A;  2BBC A;  2WS3 B;  2WXJ A;  4WAF A;  3SR6 A;  2WDV B;  3ZYY X;  5BMH A;  4O1N A;  1FNW A;  3BII D;  5G5H A;  1HZ5 A;  3Q8B A;  4NAM A;  4ARI A;  3FC4 A;  3WCQ A;  3VRA B;  1D6E C;  3ZGZ A;  3CWI A;  2TSS A;  3AE8 B;  1C77 A;  1Q10 A;  1CK1 A;  4WUR A;  2ON8 A;  2FUG 1;  2N9L A;  1EM7 A;  3EA6 A;  3P42 A;  1JCK B;  4C7Z A;  4JPS A;  4REZ A;  2PMV A;  1T3Q A;  5C3J B;  4MT5 A;  3W9C B;  1F2R C;  2JZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...