1I4GA

Crystal structure of staphylococcal enterotoxin a mutant h187a with reduced zn2+ affinity
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
224
structure length
224
Chain Sequence
KDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFATSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN TYPE A
publication title Cooperative zinc binding in a staphylococcal enterotoxin A mutant mimics the SEA-MHC class II interaction
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 64
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4gA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4gA02
1FNVA 3DWAA 1SE4A 3MFGA 3CHBD 4ZYSA 1JQYD 1CT1D 1T5XD 1LO5D 1S5DD 2AQ3B 1F77A 3EA6A 1STEA 1TS5A 1FD7D 1LTRD 2AQ1B 2NTSA 1MD2D 4TSSA 1D5ZC 1M4VA 2R61A 1BCPD 1PZID 1S5FD 2RDHA 1EWCA 4OHJA 2O2LD 4RGMA 1LT4D 1RF2D 3BYYB 1PTOH 4RGNA 1I4PA 2QEJC 1XXGA 1BXTA 1SEBD 1S5BD 3DWPA 1EU4A 1CHQD 3BVGA 1PYWD 1L0XB 1S5CD 1ET9A 1SBBB 3MC0B 4RH6A 2SEBD 5TSSA 1HTLD 1CQVA 1LLRD 1SE2A 1I4XA 1EEFD 3BZDB 4RGOS 1PRTD 1G8ZD 1LTGD 3GP7A 1D5MC 2AQ2B 4K6LA 1SJED 1HQRD 1B44D 1RDPD 1PTOB 1V1PB 3W2DA 1JCKB 1FNWA 2QILA 1YN4A 4C56C 3SEBA 3R2IA 1TY2A 1PTOF 3O13A 4O1NA 1KLGD 1PTOC 1AN8A 1B1ZA 1EU3A 1LT5D 1LT6D 1UNSA 2XN9C 2Z8LA 1I4GA 2CHBD 3BVMA 3BYTB 4L63B 1KLUD 5ELBA 5FK9C 1JWSD 3TSSA 1PZKD 1L0YB 1SE3A 1DYQA 1I4RA 1JR0D 3OWEB 1TS2A 1TY0A 1YN3A 3URYA 4NZLB 2XRQD 4RHRA 3R8BA 1LTSD 1V1PA 3EFXD 1FGBD 4DXGA 3BVZA 5D3DA 1SJHD 1JWMD 1EFID 1V1OA 4RCOA 1DJRD 5ELCA 1TS4A 2G9HD 1LTID 2J4XA 3KLSX 4RGTA 3V05A 1YN5A 2IJ0A 1D6EC 1KTKA 1LTTD 1XTCD 2ICIA 2IPKD 1QILA 5D3IB 4Z9CB 1RCVD 4RFBA 1HA5A 1ENFA 1TS3A 4DXFA 1CK1A 5FKAC 1LTBD 2WV6D 1D5XC 1JWUD 1GOZA 1PTOD 1ESFA 1PRTB 1FNUA 1ET6A 4UDUC 5ELFA 1LTAD 4RHSA 2TSSA 2XNAC 1EEID 1PRTF 1BCPB 1I4QA 1PRTC 5I4DA 1S5ED 1PZJD 4BWGB 1LT3D 1UUPA 2NTTA 3R2TA 2RDGA 3DWQA 2XRSD 1I4HA 1BCPF 1CHPD 4L6TB 1SXTA 1AW7A 1RD9D 1BCPC 5ELEA 5ELDA 1HXYD
chains in the Genus database with same CATH superfamily
3FC4A 1SE4A 2OQ0A 2JF5A 3OTOL 4A93H 2NVTB 2GRIA 1JQYD 1P1AA 4JCVE 4IJLA 5JOBA 4V190 4FF4A 3J81j 4X65L 2YU9H 4JI3Q 3KQ4A 2AQ1B 2EOTA 2A19A 1J19A 3FILB 1QVGA 1K28A 2JEBI 1P9DU 3AU7A 3CCJA 3P4PB 4XYQA 1EWCA 3DVGX 4HJ7A 2KCNA 5GQOA 2PPBC 1QOGA 1SMYC 2KACA 4HK2A 4F1SA 4GGQA 1I4PA 3OJ3A 1CUKA 2H5XA 4FHKA 3MAQA 3D4DA 2J7ZA 2WKCA 3DWPA 4E6IA 4BVUC 2QGQA 1E2WA 1B9RA 4BOZB 4MNOA 4DUZQ 1ZGUB 5AZGA 5GADC 1CM9A 4A3MH 3ZNZB 4WJQA 2Y0SE 5KNCA 1U4LA 3DHQA 4LF6L 4LUZA 1FRDA 1H9KA 1LXDA 1L4ZB 4PMCA 3S2DH 3T3OA 2MQHA 3CQZB 5C5LA 3IBEA 4AWJA 1VQKA 1EY7A 4GB9A 2VB2X 3S1RH 5C23A 1LUZA 1EO6A 4K6LA 3KOJA 3A33B 3VAWA 2JP1A 4AYBE 4EFOA 4XDDA 2LVQA 3I63C 4LJOB 4IOIE 5IYBH 4PZ7A 2SNSA 4C3JG 2NZOA 5C6AA 4DR2L 3IHPC 4A3MB 2MBEA 4L1BA 1V80A 1CSPA 1B1ZA 5JPMC 2WHIA 5IKCM 1WM3A 1SIJA 4KVGB 1TIFA 2Z8LA 5DPSA 4MM3B 1I4GA 3NP8A 1L2NA 3NWTA 1DOIA 4I6PA 4ZCKA 2IGGA 3BINA 2B8GA 4QIWB 1I4RA 4JI3L 1NCVA 1N61A 4EZLA 1UZXB 3G48A 3CCQA 3PUZA 3KF8B 1MJEA 2SDFA 2KD0A 3VTWA 5G2NA 1YNTE 1V1PA 2OEDA 2JA6H 5E7NA 2KECA 3PIOA 3L54A 1HQMC 1Z6HA 3H3VI 2L0CA 3NENA 3VR4A 5TR5A 4JK1C 4L8JA 1IXRA 3HOUG 2BT6A 3ML8A 3DBSA 4YTMB 1STAA 3TP8A 3CF5A 1EIYB 4HIMA 2KCMA 4RGTA 4XTCS 2UUAQ 2BBCA 2DZKA 5CHVC 4DUZL 2BTEA 2OXPA 4MN3A 5DM63 2Q8RE 1FXAA 4L5SA 1OGWA 1PH6A 5D3IB 3TP5A 3QO2A 4K0KQ 4RWSC 4UY8C 3CCLA 3RZOH 4W9FA 1MI0A 4IKGA 1PH2A 1Q5WB 2K28A 2K33A 3HHMA 5FLXL 1ESFA 2DZMA 1P16A 2N49A 3PV1A 1X3FA 3C19A 1ET6A 3NJTA 4WURA 3VR5A 3NHHA 1Y1WH 1KJTA 3NS8A 5M5YH 2FXQA 4IUQA 4Q0FA 4KHPQ 2N9LA 3GE3C 2MCNB 2Z59B 1BBWA 1E8YA 4HIDA 2R92H 5M5XB 5CC4A 1K83B 1L1OA 2EDGA 1L0VB 3DWGC 2UUBQ 3RZOB 1RM6C 4IWQA 2ZVNA 4OVUA 2AL6A 2RSNA 1Y1VG 3TEWA 3DWAA 1VZ8A 2MLBA 1QB5D 5BYQA 3GTKH 1C9FA 1IZ6A 2ZTDA 1ISNA 4URKA 1Y1WB 2LVPA 3A55A 4JWUC 3ULJA 2QCPX 1ZXHA 2R7DA 2K6DB 1D5ZC 5HY6A 1IPGA 3ALBA 3HKZG 4DGZA 2KTRB 3Q8CA 1WTRA 2KWCA 2E3TA 2O2LD 1XLPA 2WXIA 2N9PC 4YSZB 2FMMA 1XPOA 3NE5B 2KAJA 4NJ6A 4I7AA 4IPDA 1Q7YC 3DVNV 4S17A 2UUAL 3L0WB 1C3TA 1IP9A 2PO4A 3BY4B 1Y8PB 3P4RB 5KRUA 4N9TA 4H13C 1IGDA 3AE7B 2FCSA 1NBFC 3TBLD 1ZUD2 3EC8A 4K0KL 4DV7Q 4HRSA 3KLRA 5CBAE 2INDC 4JOIC 3GTQH 1S3SG 4BS9A 2X6GA 3ULLA 1K0SA 1WJNA 1WCMG 3GTLH 4I6NB 3UI3A 2NB0A 1NI3A 3A8JE 3A7LA 1WGHA 4KHPL 1TYGB 1WJ4A 2LASA 3NQIA 4JYAQ 4DV0Q 4KK7A 1QF6A 3AFPA 4HMJA 4A3KB 1CMXB 4K3BA 2AHOB 2OHFA 1WFYA 1MSGA 3PREA 2D3GA 1SYBA 1J7BA 3AXCA 5HI1A 4B3MQ 1SE8A 2UUBL 1DM0B 4GOPA 4JLCA 3KUDB 3NVZA 2ZPNA 4B9WA 1SLJA 4LNNA 2C7NB 3KF6B 1Q86C 2LGXA 2PPHA 1IKLA 1VQBA 1EZ8A 4AQ7A 2KOXA 3NTIA 2K04A 4HVBA 3ZTDA 3U7ZA 1TY0A 4DAVA 1WGYA 2KDMA 3VYSA 3C1FA 3FDTA 2J0TD 1JE4A 3K59A 2Y5BB 3CCRA 2M4NA 1Z47A 2MGSA 4POFA 2RSOA 2BS3B 2D10A 3X0WA 3E9IA 1T0SC 4P7IA 4DR5Q 1TS4A 3GZNI 3J9CA 1NY4A 1GUGA 2WGSA 1MPEA 3DVNU 4V0BA 1M1KC 2XTIA 2ZXPA 3HOWH 2OOBB 3TEYA 4LWCA 1KL9A 2NN6H 4DV7L 2C9OA 1U4PA 1XTCD 1YX5B 2WX1A 2WFWA 3S2AA 1EL0A 4FULA 4KGRA 1V81A 3PZ7A 5EE3A 1KRTA 2JE6I 2XK5A 4MJSB 3VTVA 5DEHA 1VR9A 1IKMA 1FXIA 2Y5PA 1M90C 2A68D 1VDZA 2RDFA 4IOAA 2LWPA 1TIID 2F0VA 1PH5A 2R2OA 2DUDA 2C5CA 1RLFA 3FAHA 1F2ZA 2BPSA 4RHSA 2KT7A 4JYAL 4DV0L 2LXKA 3PVLA 3HOWB 2IO3B 4B3ML 4FXGC 1MKHA 3PIPA 1LT3D 5J39A 1GG3A 1OTCA 1I4HA 1JWBD 2Z6BA 3IVFA 4LNIA 4L6TB 1TT5B 1SB3C 2ZJQA 2I1KA 3C0RB 4N8FA 1HPCA 5ELEA 4BBRG 3ZXRA 1HR0Q 1MGSA 4LAAA 3VR8B 1EY8A 4CGYB 3C1EA 1XNRQ 3W5VB 1Y56A 3W9CB 1WH3A 1Q8KA 3I91A 1XYIA 5FR6A 2ASBA 1WXSA 1MBYA 4EX5A 4HN7A 4TSSA 5IP9H 3NY5A 4QF4A 4KKIA 5GROA 4IALA 2UUCQ 2K14A 5J17A 2BVCA 1HZCA 3EUB2 1QZHA 5GMVA 2VZKB 1ILPA 2FJ2A 4DR5L 4N9PA 4GN1A 1LM8B 1QOFA 2YTVA 3NUCA 4QCLA 3K5LA 4ZRQA 4FNFA 3AE9B 1ESRA 4FADA 1JJ2A 2B2YC 4WJWA 5K5PA 2BH2A 2INPE 4IUTA 2VL6A 1ZXIA 4WWMA 2KN5A 1VQ5A 1C1YB 1EEFD 2VUMB 1L6VA 3D0FA 1JT8A 3S16H 4H44C 1V8CA 3RYTA 3S15H 4S0RA 1L4DB 1QVFA 1PH9A 3CWIA 3GTJH 2JT4B 1KFYB 1V1PB 4B9XA 4C80A 2KHWB 3Q8FA 2GBJA 3TRZA 3TEZA 4DV2Q 2IYDB 3OLMD 4A93G 4J3OD 1I6HH 2I2YA 1WTOA 1NYRA 3MZ5A 1WXQA 1RJTA 2CJNA 1C48A 1KLGD 3VA7A 4TMAB 4KHVA 3P1MA 3JAML 2CR5A 4BBSH 1SRUA 4QGUA 3L3OC 3N6RA 3TSSA 3AI5A 1HR0L 3S16B 2KK8A 4KV2A 1HFGA 2IHFA 1KDAA 1XNRL 1MHHE 1NEKB 2FCQA 4PG3A 1BBUA 3VDYA 1JB7A 3EECA 1PXUA 4U673 1DYQA 2M2LA 4FXDA 4O2DA 4HLEA 4HSPA 4LNFA 5JEAJ 1O78A 2UUCL 1VQLA 2OCEA 1I6HB 2KMMA 2ZPYA 4DWFA 2B2VC 4A3MG 1CTMA 2PMVA 1PDXA 1G51A 1ZYRD 4NDXA 4HIKA 2NVXH 1Q10A 3PS6A 1V1OA 2XWBB 4OELB 1BUIC 4JI2Q 1CKMA 1OQQA 4A4IA 4MGZE 1E0ZA 3FKIH 4XC2A 4J8QA 4BBSB 3RZDB 2JEAI 4IZ8A 1FEHA 2Q2TA 1FPYA 3GQBA 1KTKA 3LDZE 2UU7A 2FHTA 2A6ED 1WTVA 4GZYC 3SFEB 3PPAA 5C0XJ 1EY4A 4KKJA 4K8IA 1WVLA 5IYBG 1TS3A 2WYQA 3H0GH 1UEBA 4WWNA 1K3RA 1T0QC 2YEPF 4XX5A 4M02A 1WXMA 2K5QA 4YTNB 2RSUA 1M8AA 1GB1A 4NW2A 3HOZB 2NVXB 1QZEA 2MW5A 2NBUA 3N1YC 3Q8EA 3VR3A 3RUIB 3HOXB 3HM6X 2BA0A 2KENA 4LMQD 3DEPA 3M3YH 3FKIB 4DV2L 1IBKQ 3DBLI 1Q3LA 4DR1Q 4P16A 5AEKB 5IODA 3PF5A 5AZFA 1VCBA 3RLNA 2MWSB 3PMFA 1EWYC 1R7SA 1IYVA 2CWAA 1RAXA 1A3VA 4MH0E 1S40A 1LM0A 2JA6G 1VQ8A 3JSVA 2L00B 1BCPC 1TWAB 3H0GB 4HR7B 3TP7A 1V97A 3M63B 2PEAA 2MBOA 1EIHA 3A1QA 3M4OH 2BW2A 4KDLB 4WJOA 2BH8A 3EIVA 1YJ9A 4IG7B 1I7HA 2C7HA 3EA6A 2MH7A 3ENEA 1UWVA 3QHTA 1E3PA 1A62A 3U4VA 5EJWA 5M3MH 1WWTA 4L5RC 3OIQA 2PMZE 1Y69U 4B9KA 1E7PB 3K7AB 4JI2L 2V4DA 5JJKA 1GNUA 4UPAA 2LRUA 4OVVA 4DHJD 3KYHC 2EYPA 3PQIA 4EEWA 5M3FB 2L52A 3PLUA 1S5BD 3CPFA 5E6NA 5CV5A 4US9A 4CBVA 1NMGA 4GOPB 4RH6A 2JA9A 3KLSA 1Y1WG 4JIOU 4EE2A 2R2QA 2INNE 3AECB 1GUAB 1SE2A 3AB9A 2RGFA 5T8IA 3M95A 4OZAA 3WAOA 2R92G 2AYOB 4X3UA 1N6ZA 1YNNC 2K0PA 1WGGA 4KDIC 1MFWA 1IBKL 1XCQL 1VJKA 1QE6A 4DR1L 4KZ0A 2EE1A 2WKDA 4JG2A 1IBXA 2ALYB 2CQOA 2F3VA 3FP9A 3SGIA 1XWEA 1R4QB 1YQ3B 1T6BX 1X55A 3FKYA 3I3CA 4FBJB 5BN4A 4A3EH 1KRSA 2NBFA 1N8RC 3RCZA 1HTOA 3H3VC 3PHWB 4P1BC 1TQOA 3MC8A 4RMFA 2WX0A 1XLNA 4KY6A 2JU6X 1QJOA 4Q2JA 1F2YA 2IX0A 2ZEQA 3RNBC 4C3JB 3CCMA 1CA5A 1I35A 2AWOA 2F0EA 1YJWA 3J7A5 4JBJA 3OWEB 3X3NA 1L5PA 4TQ1A 4BBNF 1SFOB 1VRAB 1FFVA 2R7FA 1QOHA 3S24A 3Q14C 4NJCA 4B95A 4OZCA 3FILA 3R8BA 4LUOA 5HGQA 3RNGC 2EYJA 4DXGA 1WR1A 2VZKD 2DY8A 4M8NA 5D3DA 1C4CA 4YT0B 1JWMD 4B3RQ 5IGEA 3D4WA 3Q3NC 1DJRD 4X66Q 4WH4A 2DY7A 1R4PB 5EKLA 5LMUQ 2F03A 4DNTB 5L37A 3A5UA 3K5OA 4DAPA 3HUIA 4K7WA 4US8A 2FINB 4DDID 3R3OA 5H1SE 4NQLB 4CHKA 2EXDA 1B2TA 2RBMA 3QX1A 5C3WA 1UGJA 1TWGH 4P2CB 3J81L 3A5ZB 4MTNA 3HOUB 1ZDXA 4NB3A 3M85A 1A70A 2B3AA 2FIDA 5JXVA 2JUOA 1OXTA 2B39A 4K5VA 1RODA 3GTMH 3SDLC 3HKSA 3N32A 4U68A 3MEFA 4A3FH 3E0JA 4HJ9A 2WXKA 3IT4B 2W3SA 5M9OA 2CW0D 1JJGA 5T1IA 1QG7A 4ZRPA 3VYTA 2DYBA 4QB4A 2QSDA 2UXCQ 2R7ZH 1ACCA 5I4DA 3QAQA 3PO2H 4HKZE 1ROEA 2XWJB 1CJEA 4JV5Q 1WTXA 2KX3A 4EZJA 1TWGB 4ID6A 5A2QL 3DWQA 2FAZA 1CI3M 4GLXA 1VQ7A 1XLOA 4KJNA 2ICEC 1UBIA 1FCCC 2Y3AA 2K5DA 3I57A 1UEAB 4OEMB 3I3TB 4A3FB 2DNEA 1NSNS 1WXVA 5J2RA 3OW7A 3HP3A 3G4SA 2OWOA 4XYCA 1GJZA 1I94Q 2JX5A 1RRBA 1FD7D 3HOWG 2NN6G 5BMHA 2OJRA 1M4VA 1EY5A 3NTHA 2ZCBA 3PO2B 4B3RL 4ZQ3A 3MWYW 4X66L 1SYCA 5A35A 4QIWE 5LMUL 5AFWA 1PHJA 4HEDA 2NBVB 4BAXA 4QUFA 2WXMA 3SHLA 1BF4A 3CXCA 1NR4A 2HDLA 1CHQD 3VRAB 3HKZB 1SROA 1WGRA 2GI9A 2MUYA 4OGQC 2WXHA 1L0XB 4M00A 5CX3A 2RCNA 1SBBB 1R4MB 3I72A 3AE2B 5IN7A 3V96A 1BNZA 3EHVA 4DK1A 1IYUA 1N34Q 1A63A 4R8IA 4BOSC 3BZDB 3EQLC 1SYDA 2G45B 1N62A 2KVRA 3Q24A 1WI0A 2ENBA 3MJ5A 1JALA 2LXJA 3OMCA 3TIXA 1SMXA 4IPGA 2BWES 1B3QA 2QDFA 1F9PA 1DOLA 2B3GA 1YN4A 4AQYL 1YHQA 2EKIA 5C2TB 1SNOA 4I7ZC 1KNEA 3J7ZC 3DHHC 4C3IH 4JV5L 2AL3A 3BZCA 5IP9G 2VUMG 4LJZC 3BYTB 3AV8A 4L63B 1VQAA 1A8VA 1E5WA 3OPOA 2AWNA 2O5JC 4DV4Q 2PZWA 3IKJA 2D62A 1PDQA 3NZ3A 3WWVA 1I94L 1I3QH 4HCNB 1B8AA 4APVA 2WP9B 3IAS1 3NZSA 2FE8A 3BK1A 2I0QA 3PF4A 5EDSA 4XQJA 2YYZA 3MXUA 3KWLA 2K39A 3JC66 1H4RA 2WDQB 2K5VA 2BKRB 3VXWA 3PRZA 1VS0A 3KLSX 2VNUD 2H88B 1XMOQ 3K80C 3F2DA 2L1BA 2K01A 4MTKA 4HCPB 3TQYA 3CAMA 3C2PA 4ANVA 3TS2A 1NENB 1AARA 1GC7A 4CJ2C 4XDXA 2KDIA 3JSVB 1QILA 1TKYA 4R4CA 1N34L 2KQ3A 2JSVX 1I42A 3NQTA 3AEGB 3U2SC 1SR3A 1EFWA 3A1QB 5KNBA 3QJYA 3AB5A 4IM2A 3STBD 2JA7H 4OIJA 1MSHA 4M1UB 1D5XC 3BDLA 3RZFA 2LUMA 1PH4A 1ASYA 4A20A 2ZT9C 4BBSG 4WAFA 1C79A 4X3SA 2N9XA 3LJ3A 1LTAD 2B63H 3GS2A 1EEID 1PRTF 3R93A 1NUCA 3T9LA 2K5NA 1HZAA 3JAMi 1VQ6A 1GUWA 2N1VA 4MELA 1JWAD 4BWGB 4RM9A 5E6PA 3H7SA 4A3OA 1G291 2RDGA 3P7JA 3A0JA 4R4QA 3ETRA 4GN3B 4GIVA 4RNAA 2EYHA 4ZYNA 1X9NA 4KN4C 3HOZG 4DV4L 2PE6B 4L5TA 3HOXG 1K52A 3KUZA 4BKSD 5LMNQ 2WP8J 1JOQA 3FKIG 4ZOHC 1S5DD 2Q8IB 1TS5A 3K57A 4BY1H 3SK5A 2KDFB 3SU8X 2B63B 4ICVA 3VDZA 3HOVH 1I6VC 1BUVT 2IO1B 1FMAD 1IBXB 4OXPA 5CV6A 5E1FA 2BE5D 4DNIA 1JROA 4K1RB 1QKZA 4A3PA 2D2CC 1WE7A 1QZGA 3H0GG 3GE8C 5DCNA 3M7NA 1LTLA 2JYOA 5D65A 1HH2P 1XMOL 4ZUIA 2NN6I 3AEBB 5IT9E 2K4KA 1QLBB 3NHEB 3WCQA 5I9PA 1FO4A 5TSSA 2E2HH 4K2LA 1B7YB 1HTLD 3HZXA 1GHKA 2JZPA 4M8AA 2F0FA 1KHIA 2QDBA 4BY1B 1MVKA 2RKSA 1L2FA 4MJSA 2VS1A 3LNNA 3HG9A 3MFYA 3U7DA 5L95C 3P2BA 4ODGA 3HK0A 4A8XC 3KBGA 5M3FG 1WTWA 4X6AH 3TUOA 4HKQA 3W5OA 1GVPA 1STHA 4XT1B 5KHQA 4NPSA 2NBWB 1IBMQ 3Q6SA 3D31A 4O42A 2ZTCA 4UAIA 4DUYQ 1PH3A 3QA8A 4NJ7A 3NG0A 3IFDA 1NNXA 5JEAG 2E5LQ 2WXPA 4KSLC 1SYGA 1Z7TA 1E22A 4HCEA 1CFMA 3O13A 1WYGA 3Q3FA 1HE8A 1UD7A 1CKOA 3PSEB 2LEKA 5M3MG 2XN9C 4GNXC 4BY7H 3SE0A 4A93B 2IBIB 5GAEC 1KLUD 4PS3A 2F4VQ 1E8XA 2M56B 3DCGA 2PW7A 5LMNL 1PVOA 4ME5A 3I4MH 2Z0DB 3KVFB 2YU9B 1DOKA 3TP6A 3VH4B 2KVMA 1V9JA 1WX7A 1KLVA 2WXNA 4X64Q 1NI2A 2AMCB 3J80c 3URYA 2HIXA 2K7VA 1LTSD 4JBWA 5C0XG 2E2JH 3E3XA 5CR3A 2FNJB 3Q2AC 2ZNVC 4R3DA 5L83A 1OTRB 3P42A 5G3LF 1E90A 1Q90A 3OOCA 2QF7A 3LYYA 4K81A 2CU3A 3BIID 3OW2A 4BY7B 5G5GA 3BWUD 1S72A 2KJ6A 1HHVA 4JI5Q 4DV1Q 4K2KA 3UDGA 3I4MB 2B2WA 1RHPA 2VQEQ 1YX6B 2P5ZX 3S2DB 1D1KA 3U50C 4WRDA 1E6EB 4GKJQ 1F52A 1UE1A 2BYVE 3O65B 4A76A 4A3EG 3S1RB 1E2VA 1LTBD 4WORA 3CMAA 2HE7A 1HFNA 2E2JB 4PT5A 3PSIA 2E75C 2MO1A 2KXJA 1IW7D 3ZRFA 2J52A 4OO1I 1FM0D 4EKUA 4ARIA 2X6LA 4UDUC 3VFKA 1IBML 2X69A 3GOEA 4DUYL 3EFUA 2TSSA 5FR3A 5IGFA 1VQPA 1FXTB 3DBRB 3UQAA 3TBIB 2E5LL 2HQEA 3I7FA 3QB3A 1TWHH 1JRUA 1PH7A 3UE0A 1ENCA 3V6EB 1K8MA 2BS4B 2F0LA 4FP5D 3TDQA 1X54A 3A8IE 1C4PA 3APFA 4IWPA 3A7AB 2F4VL 1AW7A 1YQBA 2Z4HA 5LNK1 2DZIA 2D0OA 1YQ4B 2EYFA 1VQJA 2VW9A 1YZ6A 4X64L 2Q8TA 2AQ3B 4JBMA 2DNFA 5IGGA 2JA6B 2CJOA 1J9OA 4ARCA 1VD2A 3VR9B 3ONSA 3T1YQ 3SK6A 3VTUA 2EELA 1TWHB 1PZID 3RZWC 1A5RA 4IUMB 1HZBA 2ASQA 4RGMA 3B9JA 3SK8A 5ISRA 3P4SB 4W9LA 3EVQA 4LNOA 5IP4D 2GBNA 4JI5L 3AMUA 4DV1L 4A3FG 3VRBB 4A3GH 3S1QH 3J81i 2LRWA 2Z0EB 1Q1EA 4LF5Q 2K6QA 2LSSA 2VQEL 2N1WA 2RA4A 1XD3B 4GKJL 4I6LB 1U0LA 4PMBA 2RQXA 2Z9HA 2KQ7A 2R7ZG 3ZRCA 2A74C 1Q0WB 3PO2G 2VB3X 1PH8A 4KV6A 1Z2MA 1GO3E 2F0UA 5KYIA 1J8IA 1VQHA 1I50H 4IFDH 1G2TA 1UH6A 2C9WB 4W9IA 3QC8B 5M5YB 3H8HA 3L16A 1OXSC 4RM8A 2MHVA 3W1BA 1D3ZA 3MJWA 2LKVA 1VF7A 1UGMA 4DK5A 2KYWA 5LHY1 4DV5Q 2M9VA 2QKIC 3R2IA 1K9MC 2AKWB 3I8ZA 3S1QB 2R92B 3PUWA 4CKEA 3CKIB 2RR9A 2A68C 5EKKA 4NMZA 1BKBA 4YTPB 3TN2A 2I5HA 4X62Q 1EF5A 1LT5D 1G91A 3A74A 3GTKB 1PZKD 1YBYA 4NAMA 2C7MB 3E9HA 5KNDA 3AEDB 2HHHQ 4HPLB 4BKGA 2K75A 5EKIA 4K5XA 4MZ9A 1I50B 1YNXA 3MTSA 2KFKB 2JWZA 4EUTA 4JPBW 3CRKC 1C9OA 1HEZE 4POGA 2MO0A 2XRQD 3T1YL 4Q5VA 5AJ3Q 4IC7B 3F8TA 1WIAA 2N7EA 2F0SA 1A0IA 4RCOA 4OONA 3R7QA 3QIAA 1IL2A 1WZ0A 3K9OB 4GOCA 3ICEA 5C0XI 1AYFA 2BWFA 1HJPA 1N5WA 2DX5B 4MEMA 1TBEA 5AUIA 4LF5L 2EIFA 1NE3A 1HZ6A 3GTQB 2ZJPA 2O6VA 1LYLA 1B50A 1STGA 1VQDA 5FJ8H 1X6OA 1UWMA 4TV3A 4C00A 1STNA 4IPHA 3U9OA 3IAYA 2E2IH 4DXFA 4LF9Q 3GTLB 3GV6A 4UP7A 1TWCH 3NSWA 3ITPA 2WV6D 4TRDA 1KXLA 5J18A 1V1QA 3NPPA 1D7QA 4E74A 4R4TA 1RKNA 4P73A 1PRTB 4IO9A 1FNUA 1WYWB 2JVCA 3RLFA 1Q82C 1AWDA 1QQRA 1VQ9A 1UELA 1WD0A 2M17A 1W6JA 4DV5L 3CMEA 4CDFC 3CRLC 1GC6A 4II3B 3Q8BA 4DR4Q 1SYFA 3Q6BA 4BXXH 3ZVVA 2M1MA 4C4VB 3V61A 2YLMA 3TMPB 4HROA 4DHJB 4X62L 1NDDA 1AE3A 2NS5A 2LGYA 3V60A 4KJOA 5CV9A 1VQFA 4LCDE 5IO9A 1TWCB 2HHHL 3EGRA 4GXBA 3C46A 1WXAA 3K7UC 1PFMA 1ZOYB 1X65A 2KMAA 5EAYA 1ZW7A 3WDNA 5KHOA 4LFBQ 4C7ZA 1E1TA 1HR0W 2AUJD 1TJEA 4BKSA 2D3BA 2NTSA 1MD2D 2DZJA 5AJ3L 2GMIC 2DAFA 3H9DA 2MBQA 4YSYB 3ZNGC 2KWDA 3RUZA 1ZEQX 2D0PA 4H02A 1IBLQ 2AEHA 3AN1A 1PFNA 3I73A 4NAWA 3I56A 3U52E 4A6QA 3NELA 2K50A 1Z9FA 4OX9Q 4NY0A 2QEJC 4NQKE 1JICA 2K03A 4DK3C 1UWXA 2L0TA 1VF5C 3OMGA 1K8RB 1HRJA 4EQPA 1C78A 1O7LA 1NR2A 1ET9A 5C4HA 1FVIA 1MG8A 5BYSA 3AEAB 2B63G 3S2HH 4CDCC 4X3TA 4LF9L 1GD7A 1LV9A 2RD0A 1ZP0B 1C8CA 2JN4A 1X1MA 4KI0A 1XT9B 3U30A 2LJIA 5JJLA 4FJZA 3T53B 2ON8A 3LWEA 2EY1A 3RR5A 2F0IA 2G9DA 3KJOA 4PMWA 2QJLA 1VDVA 4KKTA 1VQOA 3W2DA 3B2GA 2KQSA 1R4NB 5AUKA 4C56C 4GDLA 5IWAQ 4DR4L 2NMQA 5LL6X 3Q23A 2SAKA 2UXDQ 2KFJA 3KH0A 1PTOF 4BY1G 3MHSD 3RI7C 4I65A 3CP0A 1DCZA 3F2CA 3IRBA 4IUUA 4DAMA 1EWIA 4QL5A 1NJIC 4JI0Q 1WI5A 5J3BA 4GDKB 1PQSA 2D5GA 3X23A 4MH8A 1FJGQ 1J6QA 3E0EA 1QT9A 3NBHA 1BOSA 2KQ4X 4J6IA 2J0KA 4LFBL 1NYQA 3SHQA 3T13A 1UAPA 3DM3A 4KMUC 4C2MH 1J7CA 3N1ZC 5H92C 1U5KA 3JYUA 4REZA 4K7SA 1FFUA 4HDQA 2IW3A 2H4OA 4LF7Q 3DXJC 1RYJA 2LHEA 2LJ5A 1H8CA 2NZ1D 3L2PA 2I5MX 2EJMA 4AIMA 5I9OA 1IBLL 2HTHA 2CCZA 2LMCA 3A4RA 3PHXB 4A75A 1WRDB 2Z6KA 3OG5A 1P3QU 4OX9L 2OTJA 1YD8U 4BA1I 1F9QA 1E24A 4JI8L 3U4ZA 1GHJA 1STBA 3G6EA 3K58A 5JJIA 1PGAA 5CTRC 3CCSA 3BJUA 1T3QA 2JWUA 1XF5L 3AMZA 3DHGC 2B2TA 3QOLA 4C2MB 3M62B 4HTHA 3S15B 1CK1A 3ZDMC 2KN4A 2F0HA 2K6AA 3GTJB 3VUXA 4MSMB 2JYTA 4A90A 2WB1B 3HKZE 3K6OA 4H0LC 4BY7G 5LL6S 1YJJA 1OFFA 2KWVB 4ICUA 4CDDC 1WX8A 2DGYA 1TWFH 5FLMH 5CBEE 2PIAA 2EJGC 2XNAC 5IWAL 3J80E 2F0GA 2XVSA 3I4MG 2PVGC 3AEEB 2UXDL 3GD7A 5M5WH 3WAPA 2A73B 3OSOA 3T1HQ 4JI6Q 1PZJD 3WOEA 1YHAA 3AULA 2Q2UA 4L23A 2JQOA 2EY6A 4NXML 4ZK9B 3S14H 4JI0L 1X3EA 1FJGL 2CKHB 1HXYD 3A9JB 2ATWA 1SNPA 3BU2A 4G4KA 5FO9B 1KOTA 2K22A 3BG3A 3RD2A 2E8GA 1GM5A 4YCUA 4PNYA 1TWFB 2DYOA 4LF7L 1E2ZA 4IWOA 1IGCA 3WANA 4A3JH 2KEEA 5M5WB 4WJNA 1XX8A 2PYKA 2MJ3A 5IT9c 3L10B 2K5PA 2WACA 3SXHA 3HM3A 1ZKOA 2DYMA 3WOFA 3S14B 4HJKA 1PH1A 1N36Q 2RVLA 4W9HA 3M9BA 1PV4A 2OF1A 3UDXA 3BVGA 4HPMB 2NR2A 4LDTD 1S5CD 4P1CC 1TVXA 1DOMA 4USAA 2I46A 2EY5A 2CVRA 1JOKA 5EPKA 3RNUA 5E6OA 1K0RA 3G7LA 4FXKC 3U9SA 5CHWA 5D94A 3PO3H 3ZUNA 4P74A 3FEWX 1PRTD 2BB6A 4KD3A 1UF0A 2L76A 1XLQA 1EIFA 3HVDA 3M3YB 1KM7A 4DN4M 2JPHA 4XWWA 5JVH3 2E2DC 3SFDB 3SVMA 1JQ4A 1WTPA 1A6XA 4ZRIA 2NVQH 2LS01 2G1EA 1J0GA 2VY3A 2KCTA 4JI6L 3T1HL 1TY2A 4YCVA 4WQOB 1A3UA 2LHDA 4F8MA 1HNZL 3BZKA 5F2DA 3MEHA 5CMDA 2ZM6Q 1SF0A 3N1XC 2CW0C 3PZ8A 3P20A 4EQNA 2MHJA 4GU2A 3M4OB 3PO3B 2O6VB 2J0MA 4XWTA 5BN5A 4DPGA 1JR0D 4P6VF 5M3MB 1YN3A 5DNFA 2R6GA 3WALA 2G3QB 1GPXA 4LFCQ 2K5HA 3EFXD 3W1YA 3MP9A 2ZXOA 4OWXB 4BZAA 3TS0A 2UXBQ 2F1MA 2KHIA 4GLAC 1N36L 2DBYA 4CKCA 1IYFA 2IWHA 1X3PA 1S1QB 2PQEA 3RN2A 2CU1A 1W6KA 4IFDG 1J8CA 2A69D 4X3KA 2EMTA 3MXNB 2TMPA 2IPKD 2PNHA 2UU9Q 2IO0B 1HTPA 1YJIA 4H7BA 2DENB 3T51B 5EE0A 4K3CA 4FF2A 3MC9A 1L1OC 4XXEA 3M4YA 1LGRA 2MA9B 2IGHA 1EQRA 4B3SQ 2FBWB 4OZBA 4G3XB 3AU4A 3PO0A 3A56A 5ELFA 3CC4A 1DZ1A 2KCCA 2ID0A 4DV6Q 1Q1OA 2XEWA 4NP5A 4KGTA 4J6HA 4A3EB 4LNKA 5FOBB 3FRPB 1H9JA 4NAWB 1C0AA 2WAQB 2PNRC 1S5ED 3GTPH 4EVOA 1BMLC 2L3ZA 1A2UA 1UUPA 5IY0A 2ZM6L 2WS3B 3R2TA 3L08A 4G0NB 1SNMA 1EIGA 2QHOA 2M00A 4EOYA 3AE5B 4IW0A 2I5LX 1TR5A 5CV4A 3RMHA 1EOVA 4EQ5A 2AWTA 4XDCA 3CHBD 4ILWA 2KOLA 3PGZA 4MGYE 5G3LD 1HZ5A 1O7YA 1GUSA 2L0FA 3L0OA 2XBBC 4QQBX 4CQNA 3GTOH 1GKHA 4JQWC 1YNJC 4BKTA 3N52A 4LFCL 5JJZA 4KKSA 2LXCA 5EBCA 4K8JA 3I4NH 1BCPD 3ZO5B 3HOYH 5FJ8G 2K52A 3L9AX 2UXBL 2CHZA 1OXXK 3DBRI 4GDLB 1PTOH 1V43A 4DK0A 4E3CA 4AQYQ 1E7ZA 5COYA 4RCNA 1SEBD 1JRPA 1E1OA 3SDZA 2L32A 2REXA 1HNWQ 3GDEA 2UU9L 4CYEA 2LY7A 2WINB 1WGKA 2WXQA 2MP2A 3BK2A 4RKBA 3GTMB 2LGSA 3MA2B 5E6JA 3D3RA 3NBHB 1PUTA 3VH3B 4ITKA 1E7UA 4BXXG 3QARA 1DOYA 4GOPC 2JA8H 1VZ7A 1KH0A 4B3SL 1PA6A 3HOYB 3W5UB 4F88A 2WWZA 1SAPA 2GBKA 1MHXA 4DV6L 1PTOB 5FLXc 2NUCA 2R7ZB 3L13A 1FNWA 3A9KA 2LMCB 4QY7A 3KDFA 1HNXQ 2ONQA 2UWQA 3STBC 4JOIA 2IDYA 3ND9A 3CSFA 2NPTA 4M0WA 1V86A 1G6PA 2QCZA 4K5WA 2IL8A 1HTQA 4LLGM 3ERSX 1O7ZA 3BVMA 3IFWB 2CHBD 3GTGH 1WE6A 1N5XA 1UBQA 3FHWA 4L2YA 2JA8B 4GLVB 2IT1A 5JH5C 3UE1A 1WM2A 2PTLA 4HDOA 3SR6A 1HZ9A 4IN3A 5C4XH 2L7RA 4HAEA 5A2QE 4QUCA 1DXMA 5BR8Q 4DR3Q 1MG4A 1MHWC 4E71A 4NZLB 1WX9A 2N7JA 3HGBA 1QCBD 1YJNA 3GO5A 3AE3B 4WIPA 5G55A 4WJPA 1P7FA 4G50A 4WFN3 3D6WA 3I5JC 1BDOA 2F0MA 2AX5A 2FMCA 2OTLA 2M0AA 1WR6E 4YSXB 1LTID 2KHJA 3VYUA 3GTGB 5KGUA 3TZDA 3V6CB 4YWMA 1NTGA 2IJ0A 4MHEA 3T16A 1HNWL 2FUG1 1SN8A 1B70B 2BE5C 4Z9CB 3CU7A 5CORA 5C4XB 2K8BA 2Z4IA 3H1UA 2F0OA 1PFBA 2FCNA 5C4JH 2ZVOA 4PK1A 5IP7H 1Y8RC 1BQQT 5HKHA 2CKZB 3AFQA 1F9RA 4TQUS 3UDFA 2BDOA 4IOCA 1TGZB 2YTXA 4B6WA 2HD3A 1JMCA 5IIFA 1HNXL 1WTHA 4C3IB 5BO4B 1E8ZA 4RAUC 3AEVA 2RHQB 5HG2A 4ACFA 2V9HA 4YY3Q 2KBNA 3ZYYX 2O6VD 2N3SA 3APDA 1GXDC 3E56A 2ZJRA 1KABA 2YEPB 4DFAA 4N58A 1F2MA 1I3QB 2WB1G 2LFNA 2SOBA 3NBIA 2ZTEA 4GLSC 2KFKA 1LO5D 2KUMA 4W9KA 3CC2A 5BR8L 2D07B 2DWQA 4DR3L 2RPQA 3NTKA 1QUQA 5IA7A 2LXAA 5LMNW 3EFCA 2D5DA 3KYCD 2GLSA 2L4NA 2NWGA 5HURA 2I07B 3D32A 4IURA 4GNXB 1QOAA 2BQQA 3TREA 3ZQ4A 2OT2A 3IL8A 3D8GA 1M94A 3G71A 3IXSA 3EBEA 4S3SA 2QC8A 3HRDD 3LXFA 4GSWA 4ASWC 4XYOA 4HIOA 3VQIA 4YCWA 4MDKE 4RMAA 1Q1BA 4WWPA 2Z6KC 3DMUA 1JORA 1Q81C 5FLMG 3V3XA 3X3MA 3NUHB 2L9HA 2JA7B 1LLRD 4C3HH 2QEXA 3AE4B 4WAAA 5GAHC 4LUVA 3NZUA 3ZXVA 1H95A 1K51A 1CQFA 1QVCA 2N8NA 4K14A 3RD4A 3UI2A 4ZLTF 1D5MC 2B2TC 4M8MA 2N0SB 2GN5A 1YITA 2A1AA 3MVVA 3NOBA 2AQ2B 4K7UA 1B3AA 2XSCA 5CGKA 1PFDA 1JCKB 1CKNA 2I1JA 3RNCC 2B2YA 2HQLA 2RPVA 2W3RA 4B0MA 3FPPA 3FPUB 1OO9B 3QJZA 4C4VA 3F1ZA 5C4ZA 2X38A 1SNCA 1QWYA 2Q2IA 1AN8A 1Y8OB 1L0WA 4YY3L 2BB5A 2WXFA 4EZKA 3ZGZA 1XMQQ 4MIUA 4C3HB 2A5UA 1UNSA 4A3JG 4ME3A 2L15A 4GKKQ 3KLWA 1YIJA 5HHDG 1YJ1A 4ZUJA 4C1NK 3WIMA 5DPTA 1H9RA 2HJ8A 4GN5A 2WDVB 3UIOB 1YHBA 3HOVB 3NEMA 2NVTH 1PGXA 1ONLA 2JXXA 3T3NA 4PYZA 5I2XA 5IE8A 2N7DA 3C3LA 2D3AA 4OVZA 4PS7A 1J5EQ 3H09A 2JXTA 4XZ4A 1ZPSA 2F52A 2MBHA 1R4NI 4DBGA 3W3AA 3PO3G 1DONA 1FD6A 2KDBA 3NS1A 3A8KE 4P71A 1WMHA 1S4ZA 2IGDA 1D6EC 1VQGA 2E2HB 3AE1B 2NVYH 3L4PA 2A6HD 2G5DA 1YMHE 3PLVA 5G5HA 2IX1A 5C1ZA 1C77A 1N32Q 2B2VA 2V0GA 2KLCA 5DM73 2F0JA 3T8MA 1ENFA 1VQMA 3B08A 4NNJB 5JVG3 1ASZA 1AP0A 2KX0A 2PKOA 4ZKBB 1JWUD 3KYDD 4W9GA 1PTOD 1N60A 1OQRA 3ZLZA 3CQZH 3ECIA 5JPNC 1K8GA 1A15A 2L11A 2N4FA 3QWZB 2JZZA 1K8OA 3NXWA 1SSOA 5E3FA 3KBXA 2V3SA 4FJYA 1XPUA 2HJ1A 2N9EB 4A3BH 2G4SA 1I4QA 3K5NA 4IPCA 4TVAB 2NVYB 4B08A 2PW5A 3BDOA 2XGTA 1XMQL 4N9F4 1WD1A 2XIWA 3DHIC 3V62A 1XEEA 3CIRB 2B76B 1BCPF 1BR9A 4GKKL 2QDLA 4GDKA 2KA7A 2BCOA 1XPRA 1P7EA 3JAMc 2JJQA 2MP2B 3H15A 1AZQA 3QG1A 3EROA 4LF4Q 2R93H 1KAWA 1J5EL 2WAQG 1T9HA 2GVBA 1EOTA 3M4QA 4R4OA 4A3BB 5IYDH 2CS4A 2IY0B 2NVUI 3ZTCA 4G11A 2RDHA 4IFDJ 3AE8B 2HD5B 3N3KB 1PLFA 1TZOA 3A9KB 2C60A 3BYYB 3KDFB 1Y14B 2O4XA 1XXGA 2NPTB 3H7PA 4M0WB 5EE1A 2PW9A 1AFPA 1BBXC 1FR3A 3DEOA 1TU2B 3MC0B 1B9MA 2OQKA 1N33Q 2BYFA 2B2UA 1N32L 5EE9A 2R93B 1I4XA 2LFIA 1STYA 5C3JB 2GB1A 4KKUA 4B0EA 3Q8DA 4JVZA 2GA4B 3ZJTA 1V5OA 3FMCA 1TZ1A 3TEXA 1XJVA 2DAJA 2MSED 4PZ8A 4ZKCB 1R9TH 3JW0X 1EUJA 2N88A 3OIPA 4A3LH 2L1AA 4FLHA 3TEHB 4RKLA 1DD2A 4XE0A 1X32A 4NKLA 1CZWA 1JJCB 2WXRA 2WB1E 5M5XH 1K83H 5FK9C 3I4NG 2E6XA 2VRRB 3ZDTA 3HOYG 2GBRA 4FF3A 4JBKA 3I9V1 1L0YB 4MT5A 5BMGA 5MPOA 3ZW3A 3A9JA 3W1SA 1DOXA 3PZDA 5FO7B 1VQNA 1EY0A 3OAWA 3ZNID 4LF4L 1SMYD 3K5MA 2IO2B 1TS2A 5IYCH 3KUPA 1R9TB 4C7YA 4BBNC 4PV1C 2PVOD 2N78A 3AU5A 2WQYB 2WXOA 3ML9A 2PJHA 2IX3A 3Q8AA 1RTOA 4NXNQ 5CYUA 2QA4A 2PCFB 2HIVA 2B8FA 2W54A 1JMLA 2MJEA 3UINB 1WYDA 2O2VA 4A3GB 2RCFA 2JA8G 5FLXE 4KLKA 1ZKHA 1II3A 4KGSA 1SGHA 4CKBA 1X3GA 3RT3B 3UF8A 3P75A 1N33L 3GV3A 4RA8A 2BYTA 1S3OA 1RL2A 4QJFA 5IOCA 3KFUA 1SNDA 2FFKB 2EPBA 1X3QA 1EYCA 4DR6Q 5HFYA 2KNBA 1O80A 4FYDA 1UE7A 3TCAA 3RN9C 2KZRA 1QUQB 2WU5B 1WJ6A 1D8LA 1U9RA 3NVYA 1ENAA 1A2TA 2ZZPB 2D9UA 5KIXA 2DJFC 4DF7A 1NAPA 2HCCA 1KF6B 3W1GA 4OIKA 2PZTA 4CO7A 3A54A 5C4XG 3IFTA 2V3NA 3CCEA 2JA5H 4A3KH 2AUKA 1RWSA 3L7ZC 4IM3A 3I55A 1E0BA 3NRZA 4RF0A 3RULA 4HSVA 3D4RA 1SXTA 4ZRKA 4TKOB 2KJXA 3HRZC 1F9SA 1SDFA 3RNAC 4LDTB 2L8JA 1PFSA 1T0RC 3P63A 1F77A 4C3IG 4LJPB 5C3XA 2MPMA 2YTYA 4FHJA 4NXNL 4W9EA 4P75A 2JA5B 4F87A 1CKNB 1LT4D 1SE9A 1TT2A 1RF2D 4PYUA 1DGSA 4RGNA 3S9WA 4A3DH 1V5TA 5EGTA 5D14A 5IP7G 1BXTA 2KMCA 2MFIA 3I90A 1OEYA 4X57B 1V6EA 2HT1A 3J7AV 1NVID 1CSQA 4XQNA 1PYWD 2F0WA 3NVVA 3MXNA 2GVAA 3Q22A 3Q3OC 5IGDA 2E2IB 4DU9A 1LQBA 1BT0A 2M8SA 2PQAA 1MI2A 3MHBA 4DR6L 1PMRA 1EYGA 4OL7A 3NK9A 3J81c 1PGBA 3RLOA 2LGIA 2CHWA 4AS1A 3DUZA 3NWSA 4GN4B 4PQXA 2LUEA 1WFQA 1YVCA 5IOIA 1WSPA 2DJGC 1B44D 1IUEA 4A3DB 4KX6B 4N8X1 4FF1A 4DKAC 2BKFA 2QILA 4AUQC 5JHBA 3DM1A 3SEBA 2EZVA 4IUVA 1LFDA 4O1NA 2JA7G 3HVZA 1KDCA 5I6YA 1V2YA 1WMHB 3LB8C 3ZJVA 4JI8Q 1EU3A 1WJUA 1U4AA 1LT6D 3RN5A 5ELBA 2W82A 3DQVA 4KSKC 3DBHB 4LW1A 1JWSD 4KHZA 1ZYRC 4JI4Q 1E10A 1SE3A 1KQSA 1Q12A 1C76A 3ZIMA 4A3IH 4AJWA 4D2KA 1KAAA 3CSTA 3R3MA 1VZ6A 2WAQE 1WOCA 4FO2A 4IM0A 2EYLA 4WJ3M 2LZ6A 2OJWA 2RMMA 2WXLA 2PLPA 2LD9A 2FIFA 4WJ4A 2RHSB 2A6EC 1FGBD 1F2RI 2Y0SB 3EJIA 3BS1A 3I4LA 4R1JA 4MGIE 5IGCA 4C3HG 1TKGA 3CCVA 5D2MB 1H9SA 1XQQA 2G9HD 1GUNA 5LXHA 2M0XA 4FDBA 1RFAA 4A9AA 4IUPA 1IYJB 2CHXA 2MX2A 3QR8A 3CC7A 3Q3MC 1YOVB 3HOVG 3S2HB 4DV3Q 4A3IB 1P98A 1LTTD 4ZHOA 2JQRB 4AYBB 1CZGA 2JRIB 4HXDA 1HUNA 1R4MI 3G6JB 2HCIA 4A3CH 1Q46A 1B9NA 4AOFA 1A3TA 4H2AA 5JAVA 1P0RA 2ZW0A 2WIIB 2VUMH 1XTDA 4YIJA 4YWLA 3UGBB 2F3IA 2QW7A 4Y7NH 2ACZB 5C5MA 5DLQE 4XGAB 1FYCA 5I6WA 1TTNA 2ES2A 4HJ5A 3KW5B 4QAYA 3WA0A 4GMVA 1BCPB 3K81C 3OYYA 1PRTC 4LF8Q 1KRHA 3M3JA 4W9JA 4BFRA 2EVBA 4CDEC 3E6ZX 1QOBA 3PRMB 1EZ6A 5KEEA 3H7PB 2JY6A 5LLIA 1PYSB 1CHPD 1I5FA 1K50A 3NVWA 4TUUA 4JI4L 3RNFC 3TL5A 3RPFC 1GB4A 4ZAIA 1SNQA 2DN8A 2L55A 1G6ZA 4XIGS 2KC1A 2KJRA 2WDTB 3B1LX 3J80L 4UP9A 4ZYSA 1CT1D 3SR1A 2BGFA 2I38A 2L83A 3OHXC 4Y7NB 1E9MA 1STEA 4Y52H 4KD4A 5C3EH 4W9CA 4O0AA 4NXMQ 5JZEB 1VMCA 1WTQA 3ZKJC 2EJFC 4R4IA 2R61A 4OO1H 1KIXA 4DHZE 4HJ8A 2KANA 4LK0M 5EBDA 1S5FD 4OHJA 3R7RA 2CQAA 3CPWA 1ZE3D 3LGJA 3DDCB 4W9DA 3U4EG 1P8LA 4LK1C 3H3VH 2D2QA 1Q8IA 3B6YA 2A8VA 1OQYA 4L5QA 5DPRA 1EU4A 2HDEA 3VVWB 2KKCA 3KK7A 4DV3L 3RZDH 2C35B 2WXGA 1HNZQ 3N20C 4HCSA 1GUTA 2SEBD 2IY1B 3L17A 5CHFA 3QQ8B 1TXYA 4ALPA 1T5EA 1YIWA 5AZHA 3BDCA 5C3EB 3TJPA 4A3BG 1OEYJ 3AH7A 4F7XA 4RGOS 4BA2I 1LTGD 4P72A 2Q5WD 3JAME 2Y5CA 3N9YC 2IY5B 2A69C 5IAAC 2WU2B 2MNAA 1SJED 2DNCA 1HQRD 5K36H 1OXUA 1RDPD 3HOZH 2D3CA 4ZHPA 4MSQB 2BS2B 3HOXH 3CW2C 4JW0A 1V9PA 2F0QA 1L7YA 1MJDA 3ZNHB 3K8AA 4YL8A 4CJ0B 4LF8L 3DVGY 4ANWA 5C44H 2JSOA 2R93G 5EQ0A 2O2VB 4ANXA 1GAQB 5CV7A 1L1OB 1UE6A 3T56B 4HPPA 5EPJA 5IYDG 1QNKA 5KYLA 2K9XA 1AEXA 1UE5A 3JVZX 3CF6E 2CH4W 4HEA1 1TWAH 3ERQA 2LVOA 4N6EB 4FXCA 3PTFC 1BO0A 3H6MA 4IJHA 3PIO3 2B2WC 2F4IA 4ZRZA 4AH6A 5BN3A 4A3JB 2HTME 2J42A 2V1YA 4RHRA 2W9NA 2ZJDA 3OJ4B 3KUCB 5C44B 3PCOB 1SIFA 1F0ZA 4JC0A 1SJHD 4GNXA 1K53A 2NCNA 1EFID 3E9SA 4LNQA 3K7AH 1ZDVA 2Q2HA 2Z1CA 2KTFA 4G7HC 1F1HA 1ZXTA 2V4LA 4KN7C 2DLBA 2QMTA 3AQQA 1YN5A 5M3FH 3PUYA 4UHVA 3UIPB 1VQIA 1ILQA 1B4OA 3J7YW 3AM9A 2PI2A 3HFZB 3E5SA 4AP4C 4A55A 2ZXRA 4DNRB 4A3LG 1GJXA 4KY7A 4UP8A 5JEAH 1L6UA 4ANUA 2X8XX 2BA1A 5DAUA 3KWVA 3APCA 3VUYA 2B2UC 2F0DA 5E4XA 1U4MA 3QWNA 2JK8A 2K5WA 4A3GG 3M7GA 2NVQB 3S1MH 3W1SC 2PI2E 1AH9A 1RTNA 4LFAQ 1X56A 3F2UA 1EY6A 4GS3A 1VQEA 5IYCG 3DOWA 5JHAA 5BYRA 3Q0AA 1DGJA 1HUMA 2L12A 2XRSD 5C0XH 3RMKC 2KHSA 4J1MA 3B2FA 3QK0A 1RD9D 2PE9A 1WY8A 2VXWA 5ELDA 5GXGB 3MFGA 3T4AC 2K25A 2Z0SA 4KY5A 4MACA 2PQAB 1EY9A 4C3JH 2K8HA 4DK6C 3S1MB 4JI1Q 1N9WA 1LTRD 5H8YE 3UQBA 1TKWB 4XT3B 1CZPA 2MBBB 4DQOC 1SFOH 3OWFA 5FO8B 4JI7Q 1MJCA 2KLGA 2EXZA 1XO3A 3ZJYC 2J53A 1C4AA 4FVMA 3K0YA 2V4IB 1VQCA 3ER0A 3SD5A 2K1BA 4B3TQ 2J7QB 4FJVB 1FCLA 1C7YA 4ABNA 1JB3A 2GOWA 3TZUA 4F7ZA 2F0TA 3UDIA 4KIKA 1JW9D 1JOOA 4DAYA 4JGHB 2INCC 3LWUA 1EUVB 4PS8A 2NYZD 1KDBA 1LACA 2A5HA 2MP1A 3QCAA 3H6NA 2EKEC 3I70A 3HOUH 4R8NA 4ULLA 4C1NI 4DA2A 2XK5B 3R66C 1U4RA 3RFZB 5J1ZA 3HS0C 2JA5G 4A3KG 3GP7A 4LTUA 2EY2A 2KJHB 4F8CB 3FVQA 1SSNA 3DPDA 1FGUA 4FA6A 2LI5A 1EYAA 1YEZA 4WWOA 4LFAL 3GTPB 3GZNB 1EYDA 2K32A 2R3ZA 1D2BA 4N59A 4OW0A 1H9SB 2CH4A 2OEOA 1T0YA 4YWGG 2NZHA 2K8CA 3TMEA 1AZPA 3U8ZA 2JRHA 4XQQA 4G7ZC 1GUOA 3Q69A 4NPNA 3M4PA 1FRRA 1TKEA 4HWIB 1W2BA 3CMMB 4A3DG 3GTOB 2MQJA 3F2BA 4JI1L 4JL9A 2HDMA 2L5TA 1D1IA 2PZUA 3MTNB 1H9MA 4RG1A 2VH2A 4HJGE 3I4NB 3ZJUA 4JI7L 4EQOA 3N30A 4R9WA 1EWHA 1G2SA 3H91A 3J81E 3J7AF 1Y1VH 4B3TL 4DR7Q 3MHZA 1AE2A 1V8QA 1N63A 4JX1C 2MRPA 4OWWB 5ELNA 5EPLA 3V05A 4CHTB 2RDBC 4OWTB 1VLBA 4RF1A 3I4OA 3HEJA 1YNND 1WF9A 4MM3A 2N9KA 4DHZB 3K9PB 3AE6B 2WDRB 3ABVB 4HJAA 3A4SC 3IG3A 1HA5A 2Y0SG 4HMIA 2K1FA 2W55A 1MIUA 4PZ6A 3KF8A 1WZ3A 3EN2A 3I2ZA 3HIZA 1Y1VB 2WLBA 4WQMA 3IT6B 3VUWA 3QOJA 4AJYB 2VQFQ 1XCTL 3PIP3 4A3IG 4IUNA 4AYBG 1EF1A 1LABA 1PYBA 1WCMH 2EMSA 5ELOA 1VQ4A 4IDIA 1YI2A 4YHHQ 3QIJA 3KJPA 1G6JA 2VZAA 1FNVA 3SK4A 2G4DB 2IZVB 1E7VA 2HUGA 1XNQQ 3ONAB 1ICFB 2F3WA 4G7OC 1T5XD 1V49A 2KWUB 2H1EA 5I2YA 4IFDI 1ML0D 3LX0A 3K0XA 2J0JA 3PRPB 2CWPA 2GBMA 4JE3B 2UXCL 2KEDA 4DR7L 1WCMB 4ZRJA 2F0PA 4A3CG 2O5IC 1NMFA 1EQQA 4YWKA 2JZ3B 1KD1C 5LXIB 1YNJD 1F2LA 1NBWA 3PUVA 3P4QB 4TQ0A 1K3BC 2F0NA 5GAGC 1Z5SB 5D6JB 2K05A 5C4JB 1CQVA 4EGVA 3S17H 1WJJA 1G8ZD 4YXDB 1K8AC 2A6HC 3H94A 2JYEA 2N55A 2LGDA 1OXVA 2VQFL 2KTRA 5DPWA 2RF4A 2ZW1A 5IGBA 2BYEA 3PGEA 2E74C 2B29A 3B0AA 2F0KA 4KTAA 3C8YA 4FN2A 4KZCA 3ND8A 4K6DA 2A4ZA 1F2RC 3P1HA 4CJ1B 5J22A 4DXAB 3S1NH 1PTOC 5C3EG 4JWSC 4MGKE 4YHHL 1KC8C 1K73C 1C4QA 1EQVA 4QMGA 4OO1G 2PMZB 3J80i 2BF8B 5D7GA 3S17B 2L05A 1E8WA 1ICWA 1QNUA 1XNQL 2FUHB 2WNMA 3VHTC 3D6CA 3OTOQ 2QIEB 5NUCA 2ZNVB 3PT2B 2FCMA 1CA6A 1VMPA 1KNAA 2EYMA 5HGTA 3VR2A 4X65Q 4II2B 2WXJA 1IHZA 1B53A 5IT9L 2KDEB 3GB1A 2V3PA 3U58A 2M19A 3CD6A 3DBLB 4M01A 1D4BA 3BVZA 3VA5A 4BBRH 1RFKA 2KVZA 2JXMB 2D11A 3S1NB 1SYEA 1FL0A 2E76C 5ELCA 2MEKA 2V1CC 3VYRA 4DDGD 1O7IA 1W3SA 2J4XA 2ZCCA 1IW7C 1EQTA 2C5LC 1HA6A 3IAM1 1BVSA 2EYOA 3CCUA 5K36G 3KF6A 4IQZA 5T1GA 2ICIA 1RIPA 3AYHB 3DBHI 5E4WC 1RCVD 3PV0A 2EQSA 4RFBA 1JC7A 2CFMA 4LF6Q 1Y8NB 5C44G 5BMIA 5FKAC 2DHZA 2MJDA 2VH1A 2BDNA 4G57A 2BOSA 1F9JA 1GOZA 4BBRB 4JPSA 2MJ8A 1FIQA 2K3UA 2IHEA 1IL8A 5CV8A 1WRIA 1JE5A 2SNMA 3MXGA 4J15A 2KC2A 2YV5A 3WAMA 3V2TA 1J7AA 3PUXA 2H89B 4TKNA 3Q3JA 4ZDVA 4DR2Q 2NTTA 1EM7A 3RNEC 3MXPA 3DLLA 3VR6A 3ULPA 2YVCA 4KIKB 1WGDA 2UYZB 1VCIA 3AEFB 4DAYB 1HCZA 3DWMA 2KO3A
chains in the Genus database with same CATH topology
3FC4A 1SE4A 2NVTB 2GRIA 1JQYD 5JOBA 4V190 4FF4A 3KQ4A 2AQ1B 2EOTA 3FILB 2JEBI 3AU7A 3P4PB 4XYQA 1EWCA 2KCNA 2PPBC 1QOGA 2KACA 1SMYC 1I4PA 3MAQA 3D4DA 2J7ZA 2WKCA 3DWPA 4E6IA 1B9RA 1E2WA 1CM9A 5KNCA 1U4LA 3DHQA 1FRDA 1H9KA 1L4ZB 4PMCA 3T3OA 3CQZB 5C5LA 1EY7A 2VB2X 4K6LA 2JP1A 4XDDA 4IOIE 2SNSA 4C3JG 5C6AA 4A3MB 4L1BA 5JPMC 1B1ZA 1SIJA 2Z8LA 4MM3B 1I4GA 3NP8A 3NWTA 1DOIA 2IGGA 2B8GA 4QIWB 1I4RA 1NCVA 1N61A 3PUZA 2SDFA 1YNTE 1V1PA 2OEDA 2KECA 1HQMC 1Z6HA 2L0CA 3VR4A 4JK1C 4L8JA 2BT6A 4YTMB 1STAA 3TP8A 4RGTA 4XTCS 2BBCA 2BTEA 2OXPA 4MN3A 5DM63 2Q8RE 1FXAA 5D3IB 3TP5A 3QO2A 4RWSC 1MI0A 4IKGA 2K28A 2K33A 5FLXL 1ESFA 1ET6A 4WURA 3VR5A 3NHHA 4IUQA 4Q0FA 2N9LA 5M5XB 5CC4A 1K83B 3DWGC 2EDGA 1L0VB 3RZOB 1RM6C 2RSNA 3TEWA 3DWAA 1VZ8A 1QB5D 5BYQA 1C9FA 1Y1WB 3A55A 4JWUC 2QCPX 1ZXHA 1D5ZC 4DGZA 3Q8CA 1WTRA 2E3TA 2WXIA 2O2LD 1XLPA 4YSZB 2FMMA 3NE5B 2KAJA 2PO4A 1Y8PB 3P4RB 5KRUA 4N9TA 4H13C 1IGDA 3AE7B 1ZUD2 4HRSA 3KLRA 5CBAE 4BS9A 2X6GA 3UI3A 2NB0A 1NI3A 3A8JE 3A7LA 1TYGB 3NQIA 4KK7A 1QF6A 4HMJA 4A3KB 5HI1A 2OHFA 1MSGA 1SYBA 1J7BA 1DM0B 3NVZA 4B9WA 1IKLA 1EZ8A 4AQ7A 3NTIA 2K04A 1TY0A 4DAVA 2KDMA 3VYSA 3C1FA 3FDTA 2J0TD 1JE4A 3K59A 1Z47A 2MGSA 2RSOA 2BS3B 1TS4A 3J9CA 1GUGA 1MPEA 4V0BA 2ZXPA 3TEYA 2NN6H 2C9OA 1U4PA 1XTCD 1EL0A 4KGRA 3PZ7A 5EE3A 2JE6I 5DEHA 1VR9A 1IKMA 1FXIA 2Y5PA 2A68D 1VDZA 2RDFA 1TIID 2F0VA 2C5CA 3FAHA 1F2ZA 4RHSA 3HOWB 4FXGC 1LT3D 5J39A 1JWBD 1I4HA 4L6TB 1SB3C 1HPCA 5ELEA 1MGSA 4LAAA 3VR8B 1EY8A 4CGYB 3C1EA 3W5VB 1Y56A 3W9CB 3I91A 1XYIA 1MBYA 4HN7A 4TSSA 4QF4A 4KKIA 4IALA 3EUB2 2VZKB 1ILPA 2FJ2A 4N9PA 1QOFA 3NUCA 4QCLA 3K5LA 4ZRQA 4FNFA 3AE9B 1ESRA 2B2YC 4WJWA 5K5PA 2INPE 4IUTA 1ZXIA 4WWMA 1EEFD 2VUMB 1L6VA 1V8CA 4H44C 1L4DB 3CWIA 1KFYB 1V1PB 4B9XA 4C80A 3Q8FA 3TEZA 4J3OD 2I2YA 1WTOA 1NYRA 3MZ5A 1WXQA 1RJTA 2CJNA 1C48A 1KLGD 3VA7A 4TMAB 4KHVA 3P1MA 3JAML 3L3OC 3N6RA 3TSSA 3S16B 1HFGA 1KDAA 1NEKB 1MHHE 1PXUA 4U673 1DYQA 2M2LA 4FXDA 4HSPA 5JEAJ 1O78A 2KMMA 1I6HB 2B2VC 1CTMA 2PMVA 1PDXA 4NDXA 1ZYRD 1Q10A 1V1OA 2XWBB 1BUIC 1OQQA 1E0ZA 4J8QA 4BBSB 3RZDB 2JEAI 4IZ8A 1FEHA 3GQBA 1KTKA 2FHTA 2A6ED 1WTVA 4GZYC 3SFEB 5C0XJ 1EY4A 4KKJA 4K8IA 1WVLA 1TS3A 2YEPF 2K5QA 4YTNB 1GB1A 1M8AA 4NW2A 3HOZB 2NVXB 3Q8EA 3VR3A 3HOXB 2BA0A 4LMQD 3DEPA 3FKIB 4P16A 1Q3LA 5IODA 3PMFA 1EWYC 1R7SA 1IYVA 1A3VA 1BCPC 1TWAB 3H0GB 4HR7B 3TP7A 1V97A 1EIHA 2BW2A 1I7HA 3EA6A 2MH7A 5EJWA 1WWTA 3OIQA 1Y69U 1E7PB 3K7AB 2V4DA 2EYPA 5M3FB 2L52A 1S5BD 5CV5A 4US9A 4CBVA 4RH6A 3KLSA 4EE2A 2INNE 3AECB 1SE2A 3AB9A 5T8IA 4OZAA 4X3UA 1YNNC 2K0PA 1XCQL 1IBXA 1VJKA 1QE6A 2EE1A 2WKDA 2F3VA 1YQ3B 1XWEA 1R4QB 1T6BX 3I3CA 5BN4A 2NBFA 3H3VC 1TQOA 1XLNA 4KY6A 2JU6X 1QJOA 4Q2JA 1F2YA 2IX0A 4C3JB 1CA5A 2AWOA 2F0EA 4TQ1A 3OWEB 3X3NA 1L5PA 1SFOB 1VRAB 1FFVA 1QOHA 4NJCA 4OZCA 3FILA 3R8BA 2EYJA 4DXGA 2VZKD 2DY8A 4YT0B 5D3DA 1C4CA 1JWMD 5IGEA 3D4WA 1DJRD 4WH4A 2DY7A 1R4PB 5EKLA 2F03A 4DNTB 3K5OA 4DAPA 3HUIA 4US8A 2FINB 3R3OA 1B2TA 2RBMA 5C3WA 1UGJA 4P2CB 3J81L 3HOUB 1ZDXA 3M85A 1A70A 5JXVA 1OXTA 2B39A 4K5VA 1RODA 4U68A 3E0JA 2WXKA 3IT4B 2W3SA 5M9OA 2CW0D 5T1IA 1QG7A 4ZRPA 3VYTA 4QB4A 2QSDA 1ACCA 5I4DA 4HKZE 1ROEA 2XWJB 1CJEA 1WTXA 1TWGB 4ID6A 5A2QL 3DWQA 1CI3M 1XLOA 4KJNA 2ICEC 1FCCC 2Y3AA 2K5DA 3I57A 1UEAB 4A3FB 2DNEA 1NSNS 3OW7A 3HP3A 2JX5A 1FD7D 2NN6G 5BMHA 1M4VA 1EY5A 3NTHA 3PO2B 4ZQ3A 3MWYW 1SYCA 5A35A 5AFWA 4HEDA 4QUFA 2WXMA 3SHLA 1BF4A 1NR4A 2HDLA 1CHQD 3VRAB 3HKZB 2GI9A 2WXHA 2MUYA 4OGQC 1L0XB 1SBBB 3I72A 3AE2B 3V96A 1BNZA 4DK1A 1IYUA 4R8IA 3BZDB 3EQLC 1SYDA 1N62A 3Q24A 2ENBA 3MJ5A 1JALA 3OMCA 1F9PA 1DOLA 1YN4A 2EKIA 5C2TB 1SNOA 4I7ZC 1KNEA 4LJZC 3BYTB 3AV8A 4L63B 3OPOA 2AWNA 2O5JC 2PZWA 3IKJA 2D62A 1PDQA 3NZ3A 2WP9B 3IAS1 2FE8A 3BK1A 4XQJA 2YYZA 3MXUA 3KWLA 2WDQB 3KLSX 2VNUD 2H88B 2L1BA 2K01A 3C2PA 1NENB 4CJ2C 4XDXA 1QILA 1TKYA 2KQ3A 2JSVX 3NQTA 3AEGB 3U2SC 5KNBA 3QJYA 3AB5A 4OIJA 1MSHA 4M1UB 1D5XC 3BDLA 2LUMA 2ZT9C 4WAFA 1C79A 4X3SA 1LTAD 3GS2A 1EEID 1PRTF 3R93A 1NUCA 1GUWA 1JWAD 4BWGB 1G291 2RDGA 3P7JA 3ETRA 4RNAA 2EYHA 4KN4C 1K52A 2WP8J 1JOQA 4ZOHC 1S5DD 2Q8IB 1TS5A 3K57A 3SK5A 2B63B 1I6VC 1BUVT 1FMAD 1IBXB 5CV6A 5E1FA 2BE5D 1JROA 1QKZA 2D2CC 3M7NA 5D65A 2JYOA 4ZUIA 2NN6I 3AEBB 5IT9E 1QLBB 3WCQA 5I9PA 1FO4A 5TSSA 4K2LA 1HTLD 3HZXA 1GHKA 2JZPA 4M8AA 2F0FA 2QDBA 4BY1B 1MVKA 2RKSA 3LNNA 3HG9A 3MFYA 4ODGA 4A8XC 3KBGA 1WTWA 4HKQA 3TUOA 1STHA 4XT1B 3Q6SA 3D31A 4O42A 4UAIA 4ARCA 3IFDA 5JEAG 2WXPA 1SYGA 1Z7TA 4HCEA 1CFMA 3O13A 1WYGA 2LEKA 2XN9C 3SE0A 4A93B 1KLUD 2M56B 2PW7A 4ME5A 2YU9B 1DOKA 3TP6A 2KVMA 2WXNA 3URYA 2K7VA 1LTSD 4JBWA 5C0XG 5CR3A 4R3DA 3P42A 5G3LF 1Q90A 3OOCA 2QF7A 3LYYA 2CU3A 3BIID 4BY7B 5G5GA 3BWUD 1HHVA 4K2KA 3I4MB 2B2WA 1RHPA 3S2DB 1D1KA 4WRDA 1E6EB 3S1RB 1E2VA 1LTBD 4WORA 4PT5A 1HFNA 2E2JB 2E75C 1IW7D 2J52A 4OO1I 1FM0D 4ARIA 2X6LA 4UDUC 2X69A 2TSSA 5FR3A 5IGFA 3TBIB 2HQEA 3QB3A 1ENCA 1K8MA 2BS4B 2F0LA 4FP5D 3TDQA 3A8IE 1C4PA 3A7AB 1AW7A 5LNK1 2Z4HA 1YQ4B 2EYFA 2Q8TA 2AQ3B 5IGGA 2JA6B 2CJOA 1J9OA 3VR9B 3SK6A 2EELA 1TWHB 1PZID 4RGMA 3B9JA 3SK8A 5ISRA 3P4SB 3EVQA 3AMUA 3VRBB 1Q1EA 2RA4A 4PMBA 2RQXA 2A74C 2VB3X 4KV6A 2F0UA 5KYIA 1J8IA 4IFDH 1G2TA 5M5YB 3H8HA 1OXSC 2MHVA 2LKVA 1VF7A 5LHY1 2M9VA 2QKIC 3R2IA 2R92B 3I8ZA 3S1QB 3PUWA 4CKEA 3CKIB 2A68C 5EKKA 4NMZA 4YTPB 3TN2A 1LT5D 1G91A 3GTKB 1PZKD 4NAMA 3AEDB 5KNDA 5EKIA 4K5XA 1I50B 3MTSA 3CRKC 1HEZE 2XRQD 4Q5VA 2F0SA 4RCOA 3QIAA 5AUIA 5C0XI 1AYFA 1N5WA 1HZ6A 3GTQB 1B50A 1STGA 1UWMA 1STNA 3U9OA 3IAYA 4DXFA 3GTLB 3GV6A 3NSWA 4TRDA 3ITPA 2WV6D 3NPPA 1RKNA 1PRTB 1FNUA 3RLFA 1AWDA 1QQRA 1WD0A 1W6JA 3CRLC 3Q8BA 1SYFA 4HROA 4KJOA 5CV9A 1TWCB 3EGRA 3C46A 1PFMA 1ZOYB 3WDNA 4C7ZA 1TJEA 2AUJD 2NTSA 1MD2D 4YSYB 2KWDA 3RUZA 1ZEQX 3AN1A 1PFNA 3I73A 3U52E 4A6QA 2QEJC 1JICA 2K03A 1UWXA 1VF5C 3OMGA 1HRJA 4EQPA 1C78A 1O7LA 1NR2A 1ET9A 5C4HA 5BYSA 3AEAB 4X3TA 1LV9A 1ZP0B 1C8CA 4KI0A 2LJIA 3T53B 2ON8A 3LWEA 2EY1A 2F0IA 2G9DA 2QJLA 4PMWA 1VDVA 4KKTA 3W2DA 3B2GA 5AUKA 4C56C 2NMQA 5LL6X 3Q23A 2SAKA 1PTOF 4I65A 1DCZA 4IUUA 4GDKB 2D5GA 4MH8A 1QT9A 3NBHA 1BOSA 2KQ4X 1NYQA 3T13A 1UAPA 4KMUC 1J7CA 5H92C 4REZA 1FFUA 2IW3A 2H4OA 3DXJC 1RYJA 2LHEA 2NZ1D 2EJMA 5I9OA 2LMCA 4BA1I 1F9QA 1GHJA 1STBA 3K58A 1PGAA 1T3QA 2JWUA 1XF5L 3AMZA 2B2TA 3QOLA 4C2MB 4HTHA 3S15B 1CK1A 2KN4A 2F0HA 2K6AA 3GTJB 2JYTA 4A90A 2WB1B 4H0LC 3K6OA 1YJJA 5LL6S 1OFFA 5CBEE 2PIAA 2EJGC 2XNAC 3J80E 2PVGC 2F0GA 2XVSA 3AEEB 3E9SA 3GD7A 2A73B 3OSOA 1PZJD 3WOEA 4L23A 2EY6A 4ZK9B 1HXYD 1SNPA 4G4KA 5FO9B 2K22A 3BG3A 4PNYA 1TWFB 2DYOA 1E2ZA 1IGCA 2KEEA 5M5WB 1XX8A 2PYKA 2MJ3A 2K5PA 2WACA 3SXHA 1ZKOA 2DYMA 3WOFA 3S14B 2RVLA 2OF1A 3BVGA 1S5CD 1TVXA 1DOMA 4USAA 2I46A 2EY5A 2CVRA 1JOKA 5EPKA 3G7LA 4FXKC 3U9SA 3FEWX 1PRTD 2BB6A 4KD3A 1XLQA 3HVDA 3M3YB 4DN4M 4XWWA 5JVH3 2E2DC 3SFDB 3SVMA 1JQ4A 1WTPA 1A6XA 2LS01 2G1EA 1TY2A 1A3UA 2LHDA 4F8MA 5F2DA 3MEHA 5CMDA 1SF0A 2CW0C 3PZ8A 3P20A 4EQNA 3M4OB 3PO3B 4XWTA 5BN5A 1JR0D 4P6VF 5M3MB 1YN3A 5DNFA 2R6GA 1GPXA 3EFXD 3MP9A 2ZXOA 2F1MA 2DBYA 4CKCA 2IWHA 1X3PA 2PQEA 1W6KA 4IFDG 2A69D 4X3KA 2TMPA 2IPKD 1HTPA 1YJIA 4H7BA 3T51B 5EE0A 4FF2A 4XXEA 3M4YA 2IGHA 2FBWB 4OZBA 3PO0A 3A56A 5ELFA 1DZ1A 3U7ZA 2KCCA 2ID0A 4KGTA 4NP5A 4J6HA 4A3EB 5FOBB 3FRPB 1H9JA 4NAWB 2WAQB 2PNRC 1S5ED 4EVOA 1BMLC 1A2UA 1UUPA 2WS3B 3R2TA 1SNMA 1EIGA 2M00A 3AE5B 5CV4A 1TR5A 3RMHA 4XDCA 3CHBD 4ILWA 2KOLA 5G3LD 1HZ5A 1O7YA 1GUSA 4CQNA 1YNJC 3N52A 5JJZA 4KKSA 5EBCA 4K8JA 1BCPD 3L9AX 1OXXK 4GDLB 1PTOH 1V43A 4DK0A 5COYA 4RCNA 1SEBD 1JRPA 3SDZA 2L32A 2LY7A 2WINB 1WGKA 2WXQA 3BK2A 4RKBA 3GTMB 3MA2B 5E6JA 3D3RA 1PUTA 4ITKA 1DOYA 1VZ7A 1KH0A 3HOYB 3W5UB 4F88A 1SAPA 1MHXA 1PTOB 2NUCA 2R7ZB 1FNWA 2LMCB 2ONQA 2IDYA 3ND9A 4M0WA 4K5WA 2IL8A 4LLGM 1O7ZA 3BVMA 2CHBD 1N5XA 4L2YA 2JA8B 2IT1A 3SR6A 2PTLA 4IN3A 4HAEA 5A2QE 4QUCA 1DXMA 4NZLB 2N7JA 3HGBA 1QCBD 3GO5A 3AE3B 4WIPA 1P7FA 4WFN3 3D6WA 1BDOA 2F0MA 2AX5A 2FMCA 2M0AA 4YSXB 1LTID 3VYUA 3GTGB 5KGUA 3TZDA 2IJ0A 4MHEA 3T16A 2FUG1 2BE5C 4Z9CB 3CU7A 5CORA 5C4XB 2Z4IA 2F0OA 1PFBA 1BQQT 1F9RA 4TQUS 2BDOA 5IIFA 4C3IB 4RAUC 5HG2A 3ZYYX 1GXDC 3E56A 1KABA 2YEPB 4DFAA 4N58A 1F2MA 1I3QB 2LFNA 2SOBA 3NBIA 4GLSC 1LO5D 2KUMA 2DWQA 3NTKA 2D5DA 2L4NA 2NWGA 5HURA 2I07B 4IURA 1QOAA 3ZQ4A 2OT2A 3IL8A 3D8GA 3IXSA 3LXFA 4S3SA 3HRDD 4XYOA 3VQIA 1Q1BA 3DMUA 1JORA 3V3XA 3X3MA 3NUHB 2L9HA 2JA7B 1LLRD 3AE4B 1K51A 1CQFA 4K14A 3RD4A 3UI2A 4ZLTF 1D5MC 2B2TC 2N0SB 3MVVA 2AQ2B 1B3AA 2XSCA 5CGKA 1PFDA 1JCKB 2B2YA 2RPVA 2W3RA 4B0MA 3FPPA 3FPUB 1OO9B 5C4ZA 2X38A 1SNCA 1QWYA 2BB5A 1AN8A 1Y8OB 2WXFA 3ZGZA 4MIUA 4C3HB 1UNSA 5HHDG 4ZUJA 4C1NK 1H9RA 2WDVB 3HOVB 1PGXA 1ONLA 3T3NA 5I2XA 3C3LA 4OVZA 3H09A 2JXTA 1ZPSA 3W3AA 1FD6A 1DONA 3NS1A 3A8KE 1S4ZA 2IGDA 1D6EC 2E2HB 3AE1B 3L4PA 2A6HD 1YMHE 5G5HA 2IX1A 1C77A 2B2VA 2V0GA 5DM73 2F0JA 1ENFA 5JVG3 1AP0A 2PKOA 4ZKBB 1JWUD 1PTOD 1N60A 1OQRA 5JPNC 1A15A 2L11A 1K8OA 3NXWA 1SSOA 5E3FA 3KBXA 1I4QA 3K5NA 2NVYB 4B08A 2PW5A 3BDOA 1WD1A 2XIWA 1XEEA 3CIRB 2B76B 1BCPF 1BR9A 2KA7A 2BCOA 1P7EA 1AZQA 3QG1A 3EROA 1EOTA 4A3BB 2RDHA 4IFDJ 3AE8B 1PLFA 1TZOA 3BYYB 2O4XA 1XXGA 5EE1A 2PW9A 1AFPA 1BBXC 1FR3A 3DEOA 1TU2B 3MC0B 1B9MA 2B2UA 5EE9A 2R93B 1I4XA 2LFIA 1STYA 5C3JB 2GB1A 4KKUA 4B0EA 2GA4B 3ZJTA 3FMCA 3TEXA 4ZKCB 2N88A 3OIPA 2L1AA 4RKLA 1DD2A 4XE0A 1X32A 4NKLA 1CZWA 2WXRA 5FK9C 2E6XA 4MT5A 4FF3A 3I9V1 5BMGA 1L0YB 5MPOA 1DOXA 3W1SA 5FO7B 1EY0A 1SMYD 3K5MA 1TS2A 1R9TB 3KUPA 4C7YA 4PV1C 2PVOD 2WQYB 2WXOA 2IX3A 3Q8AA 1RTOA 5CYUA 2PCFB 2B8FA 2W54A 1JMLA 2MJEA 4A3GB 5FLXE 4KGSA 1II3A 4CKBA 3P75A 3GV3A 4RA8A 2BYTA 5IOCA 1SNDA 2FFKB 2EPBA 1X3QA 1EYCA 5HFYA 1O80A 4FYDA 2WU5B 1U9RA 3NVYA 1ENAA 1A2TA 2D9UA 5KIXA 4DF7A 1NAPA 2HCCA 1KF6B 4OIKA 2PZTA 3A54A 3IFTA 2V3NA 2AUKA 1RWSA 3L7ZC 1E0BA 3NRZA 4RF0A 4HSVA 3D4RA 1SXTA 4TKOB 2KJXA 3HRZC 1F9SA 1SDFA 3P63A 1F77A 4C3IG 5C3XA 2MPMA 2JA5B 4F87A 1LT4D 1TT2A 1RF2D 4RGNA 3S9WA 5EGTA 5D14A 1BXTA 3I90A 3J7AV 1NVID 4XQNA 1PYWD 2F0WA 3NVVA 3MXNA 3Q22A 5IGDA 2E2IB 4DU9A 1MI2A 3MHBA 1PMRA 4OL7A 3NK9A 1PGBA 2LGIA 4AS1A 3DUZA 3NWSA 4PQXA 1WSPA 1B44D 1IUEA 4A3DB 4KX6B 4FF1A 2QILA 3DM1A 3SEBA 2EZVA 4IUVA 4O1NA 3HVZA 1KDCA 5I6YA 3LB8C 3ZJVA 1EU3A 1LT6D 5ELBA 2W82A 1JWSD 4KHZA 1ZYRC 1E10A 1SE3A 1Q12A 1C76A 4D2KA 1KAAA 1VZ6A 4FO2A 2EYLA 2RMMA 2WXLA 2PLPA 2A6EC 1FGBD 1F2RI 2Y0SB 3EJIA 3BS1A 3I4LA 5IGCA 4C3HG 1TKGA 1H9SA 2G9HD 1GUNA 4A9AA 4IUPA 3S2HB 4A3IB 4ZHOA 1LTTD 2JQRB 4AYBB 1CZGA 1HUNA 3G6JB 2HCIA 1B9NA 1A3TA 4H2AA 5JAVA 2ZW0A 2WIIB 4YIJA 2ACZB 5C5MA 1FYCA 5I6WA 1BCPB 1PRTC 1KRHA 2EVBA 3E6ZX 1QOBA 1EZ6A 5KEEA 1CHPD 1GB4A 1K50A 3NVWA 3RPFC 4ZAIA 1SNQA 2DN8A 2L55A 1G6ZA 4XIGS 3J80L 4ZYSA 1CT1D 3SR1A 2I38A 2L83A 3OHXC 4Y7NB 1E9MA 1STEA 4KD4A 1VMCA 1WTQA 2EJFC 2R61A 4OO1H 4LK0M 5EBDA 1S5FD 4OHJA 2CQAA 1ZE3D 3U4EG 4LK1C 1Q8IA 1EU4A 2HDEA 3KK7A 2WXGA 4HCSA 1GUTA 2SEBD 1T5EA 3BDCA 5C3EB 3AH7A 4F7XA 4RGOS 4BA2I 1LTGD 2Q5WD 3JAME 2Y5CA 3N9YC 2A69C 2WU2B 1SJED 2DNCA 1HQRD 5K36H 1OXUA 1RDPD 4ZHPA 2BS2B 2F0QA 4CJ0B 2JSOA 5EQ0A 1GAQB 5CV7A 3T56B 5EPJA 1QNKA 5KYLA 2K9XA 1AEXA 4HEA1 3ERQA 4N6EB 4FXCA 1BO0A 3H6MA 3PIO3 2B2WC 2F4IA 4ZRZA 5BN3A 4A3JB 2HTME 2J42A 4RHRA 5C44B 1F0ZA 1SJHD 1K53A 1EFID 1ZDVA 2Z1CA 4G7HC 1ZXTA 4KN7C 2DLBA 2QMTA 1YN5A 3PUYA 1ILQA 1B4OA 3J7YW 3AM9A 3E5SA 4A55A 2ZXRA 4DNRB 1GJXA 4KY7A 5JEAH 1L6UA 2BA1A 5DAUA 3KWVA 5E4XA 2B2UC 2F0DA 1U4MA 3QWNA 2K5WA 3M7GA 2NVQB 1RTNA 3F2UA 1EY6A 5BYRA 3Q0AA 1DGJA 1HUMA 2L12A 2XRSD 5C0XH 2KHSA 4J1MA 3B2FA 1RD9D 2VXWA 5ELDA 5GXGB 3MFGA 3T4AC 4KY5A 4MACA 1EY9A 3S1MB 1LTRD 5H8YE 1TKWB 4XT3B 1CZPA 4DQOC 3OWFA 5FO8B 2EXZA 1XO3A 2J53A 1C4AA 4FVMA 3K0YA 2V4IB 1FCLA 2K1BA 4ABNA 1JB3A 3TZUA 2F0TA 1JW9D 1JOOA 4DAYA 3LWUA 2NYZD 1KDBA 1LACA 2A5HA 2MP1A 3I70A 4R8NA 4ULLA 4C1NI 4DA2A 1U4RA 3RFZB 5J1ZA 3HS0C 3GP7A 4LTUA 2EY2A 3FVQA 1SSNA 1EYAA 3GTPB 1EYDA 2K32A 2R3ZA 1D2BA 4N59A 4OW0A 1H9SB 2OEOA 4YWGG 3TMEA 1AZPA 4XQQA 4G7ZC 1GUOA 3Q69A 1FRRA 1TKEA 3GTOB 2HDMA 2L5TA 1D1IA 2PZUA 1H9MA 4HJGE 3I4NB 3ZJUA 4EQOA 4R9WA 1EWHA 1G2SA 3H91A 3J81E 3J7AF 3MHZA 1V8QA 1N63A 4JX1C 5EPLA 3V05A 4CHTB 4RF1A 1VLBA 1YNND 3HEJA 2N9KA 3AE6B 2WDRB 3ABVB 1HA5A 4HMIA 2W55A 3KF8A 1Y1VB 2WLBA 4WQMA 3IT6B 3QOJA 1XCTL 3PIP3 4IUNA 1LABA 4IDIA 1FNVA 3SK4A 2HUGA 3ONAB 2F3WA 4G7OC 1T5XD 2H1EA 5I2YA 4IFDI 1ML0D 3LX0A 4JE3B 2KEDA 1WCMB 2F0PA 2O5IC 1YNJD 1F2LA 3PUVA 3P4QB 4TQ0A 2F0NA 2K05A 5C4JB 1CQVA 4EGVA 1G8ZD 4YXDB 2A6HC 3H94A 2JYEA 2N55A 1OXVA 2ZW1A 5IGBA 2E74C 2F0KA 4KTAA 3C8YA 3ND8A 4K6DA 1F2RC 3P1HA 4CJ1B 5J22A 1PTOC 4JWSC 1C4QA 1EQVA 4QMGA 4OO1G 2PMZB 5D7GA 3S17B 1ICWA 1QNUA 2WNMA 3D6CA