1I4GA

Crystal structure of staphylococcal enterotoxin a mutant h187a with reduced zn2+ affinity
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
224
structure length
224
Chain Sequence
KDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFATSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN TYPE A
publication title Cooperative zinc binding in a staphylococcal enterotoxin A mutant mimics the SEA-MHC class II interaction
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 64
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4gA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4gA02
1SE4A 1LTBD 1FNUA 4C56C 2ICIA 1SBBB 3MFGA 4L63B 1EU4A 3R8BA 4RGTA 1SEBD 1CK1A 5ELFA 1CHQD 1BCPC 1LT4D 1PTOH 4DXFA 1PZJD 3KLSX 4RGOS 1D5XC 2J4XA 3R2IA 5FKAC 1FGBD 1B44D 1LTTD 1TY2A 1S5ED 5D3IB 4UDUC 1KLUD 1LT3D 1TS2A 4TSSA 1JCKB 1S5CD 1D5MC 1AN8A 1SE2A 1V1PA 3EFXD 1V1OA 4BWGB 4Z9CB 1ENFA 1I4XA 1BCPF 3V05A 1LO5D 2WV6D 4RH6A 2AQ2B 1B1ZA 1KLGD 2NTTA 1SJED 1BCPD 2AQ1B 1RCVD 1HXYD 3BVGA 1LTAD 2TSSA 4DXGA 1ESFA 1HQRD 3DWPA 1LLRD 1FNWA 1LT5D 1S5FD 3SEBA 5I4DA 1PTOB 1PRTB 1SXTA 2O2LD 1TS5A 4RGNA 1I4GA 2RDGA 1LTGD 3DWQA 5ELBA 1SE3A 3BYYB 1TS3A 2QEJC 1CHPD 5ELCA 3EA6A 1DJRD 1TS4A 1SJHD 1PYWD 3BYTB 1JWSD 2RDHA 2Z8LA 2IJ0A 1I4RA 1D5ZC 1LT6D 2G9HD 4O1NA 4ZYSA 3DWAA 1ET6A 1RDPD 4L6TB 1YN4A 4OHJA 1FD7D 1MD2D 1XXGA 4RGMA 2SEBD 5FK9C 2XRQD 3MC0B 1M4VA 1LTSD 1UNSA 1TY0A 1EWCA 1S5DD 1LTRD 1EFID 1G8ZD 1S5BD 5ELDA 5TSSA 1RD9D 1YN5A 1DYQA 1PRTF 1EU3A 2R61A 5ELEA 4NZLB 3BZDB 3BVMA 1EEFD 1PRTD 1I4QA 1UUPA 3CHBD 4K6LA 4RCOA 2XN9C 1STEA 1YN3A 1RF2D 1D6EC 2IPKD 4RHSA 3BVZA 1CT1D 1FNVA 3TSSA 1XTCD 1EEID 1F77A 1CQVA 1I4HA 1PZKD 2NTSA 1PTOC 2XNAC 1PRTC 1GOZA 2AQ3B 1LTID 3GP7A 3OWEB 1JQYD 2XRSD 3O13A 1ET9A 1HTLD 2QILA 1JR0D 2CHBD 1BCPB 4RHRA 1PTOF 5D3DA 1BXTA 1I4PA 1L0YB 1T5XD 1PTOD 1QILA 1PZID 1JWMD 4RFBA 3URYA 3R2TA 1L0XB 1HA5A 3W2DA 1V1PB 1KTKA 1JWUD 1AW7A
chains in the Genus database with same CATH superfamily
4CHTB 2PE6B 1LTBD 3PV0A 4FHJA 4DK5A 4HRSA 1YX5B 3PO2B 1BOSA 5KEEA 3PRZA 4BBRG 3HM6X 1TWHH 3CMAA 4WURA 2KDFB 4IWPA 5E6OA 1H9JA 2F0UA 5IP9G 4XQJA 1XT9B 5JAVA 2JA8G 1QF6A 2VH2A 3N1XC 4AWJA 2L4NA 2NVYH 1XO3A 2QHOA 4IWQA 4JPSA 1YNXA 5C3EG 1KF6B 4K81A 2A1AA 4CYEA 3ERQA 1C9OA 1XF5L 2V3SA 1IBLQ 4A3FB 1J19A 2JE6I 4A9AA 2KOLA 3IAM1 4OO1G 3UDXA 4B3TL 3QB3A 1WJUA 5IT9c 1SNDA 2EYOA 4KDIC 5BO4B 4A3KG 1WFQA 4HJ9A 4JI0Q 4WORA 4A3DB 3R3MA 4K5WA 1YNNC 4BS9A 1G6ZA 2RD0A 1HNXQ 1W3SA 3P1MA 1M1KC 3DQVA 5M3FG 4CDFC 3KYHC 2IO2B 1UEAB 1FNWA 1WXAA 3A5ZB 5I4DA 2CWAA 4A8XC 3VR5A 1V5OA 2K04A 4YHHQ 1MGSA 4ZRKA 2RDGA 1SYEA 1SRUA 2VZAA 2PPHA 3I91A 1FRDA 2KDIA 2K8BA 2KTRB 4WWNA 3RNGC 5G2NA 2QEJC 4JOIA 1E8YA 3PS6A 4GXBA 4ZRPA 4RMAA 4UP7A 2V4IB 2BF8B 2VB2X 2ZJDA 3KWLA 3PO2H 3AI5A 3D6WA 5BR8L 1FR3A 4MELA 1YVCA 4K5XA 3JSVA 4O1NA 1JMCA 1WYWB 2KX0A 4MH8A 3HKSA 1RDPD 3CPFA 1SN8A 4LF6L 1SGHA 1NY4A 2W54A 4A3FH 1R4NB 2F0MA 2XRQD 3PO3G 1UNSA 3NBIA 1UWXA 3RFZB 1N5WA 3RZOB 4BKSD 2A68D 3ULPA 3FAHA 3W1GA 4C80A 3S2HB 2N4FA 2KENA 1RM6C 2CQAA 1EEFD 1PRTD 1I4QA 5KNBA 4X3KA 3J7AF 4N6EB 4E3CA 4J15A 3AE6B 4ABNA 2D3BA 3I3CA 1X9NA 4UAIA 1CQVA 1F77A 1O80A 1V80A 2F52A 1HZ9A 1N60A 5G3LD 2JPHA 1BBUA 1PRTC 1VQJA 4JBWA 2KFKA 2R6GA 2LZ6A 2NCNA 3BK1A 2D2QA 4W9HA 4I7AA 2F0HA 3VDZA 4XTCS 2PEAA 1QOHA 4PMBA 5IYCG 3RMKC 1C9FA 3IAYA 1K28A 1V97A 1AARA 5IWAQ 3VA7A 1HR0W 2Z1CA 1CA5A 4HDQA 3DEOA 3CU7A 4IALA 2K5QA 3P63A 2FCMA 2ZEQA 3U7ZA 4JI3L 2XTIA 5J17A 3PUXA 2OHFA 2XBBC 4OELB 4DV7Q 4A3BB 5LMNW 1SNQA 1FXAA 4NPNA 1L0XB 4YTMB 5C3XA 1WJNA 3OTOQ 3U30A 1IYJB 4LNFA 2AMCB 2MHVA 3RZOH 1XLNA 2MWSB 3CF6E 1K73C 1VQDA 5FO7B 3S2HH 2N1WA 5C0XI 2H4OA 2CQOA 1EQVA 3P4QB 2AX5A 3E9IA 2V1YA 2PQEA 4ME3A 3PT2B 1IKLA 1JOOA 1XPRA 4US9A 3ZGZA 2ZW0A 4AJWA 4DUYL 2J7QB 3IT6B 4I65A 5FO8B 1LT3D 2RF4A 3I7FA 4MGZE 2WNMA 5NUCA 4IFDG 3I8ZA 1S72A 1EM7A 4P74A 3DHQA 4KI0A 2FHTA 2Y0SB 5E6PA 2RKSA 1ILQA 4A3GB 1VQ6A 2K3UA 2BW2A 1EY0A 2XWJB 2YU9B 5T8IA 2NWGA 2MBEA 2MHJA 3GTJB 2KCMA 3A55A 2WAQG 2YV5A 3GB1A 1OO9B 2WYQA 5JEAH 3NP8A 3EGRA 3TMPB 3RN9C 4HJ8A 3U8ZA 1CKNA 1RFKA 2Y5BB 1BDOA 4A3BH 1GXDC 1EWHA 2O2LD 3AEEB 2CJOA 1HPCA 3HRZC 4BY7G 2G45B 4OVUA 3ENEA 1IW7C 3QR8A 3CCRA 2I46A 3HGBA 2EZVA 3CPWA 1Q12A 3K5OA 2LHDA 3DBLB 4MSQB 2LGIA 2Y5PA 2JA9A 2UU7A 3QCAA 5C0XJ 3UQAA 3FP9A 2K25A 4IOAA 1SYDA 3PRMB 2LSSA 2NBWB 4OXPA 3AV8A 4PK1A 3GTOB 2HIVA 2KJ6A 3CRLC 3WDNA 5CV5A 2BPSA 3U4EG 2JA5B 3RZDB 1QQRA 2A6ED 5HGQA 3DVNU 3VR4A 1WD0A 4URKA 2K8CA 1Y8RC 1PVOA 2LFIA 2ZXRA 1A3TA 4C1NK 1M4VA 2RBMA 4POFA 4ZKBB 1AE3A 2VZKD 3SDZA 3W1SC 3JC66 3L0OA 1VQPA 3CCEA 2IY0B 4YCWA 3VFKA 4DHJB 2IGDA 4HJKA 1NR2A 2A6EC 3GTJH 3ZNGC 3D31A 1F1HA 2G4DB 3M3JA 3I3TB 3L7ZC 4DV0Q 2NZ1D 1IBLL 2KHSA 3TP5A 2IW3A 1KL9A 3SR6A 2FFKB 2C35B 1F2RC 2IPKD 2RA4A 2I0QA 1Q10A 3BINA 1CT1D 3W5OA 3TSSA 2KVMA 4BAXA 3K58A 1F2RI 4GOCA 4KK7A 5K5PA 4R8NA 4JI0L 4LFBQ 2FUHB 3NQTA 4CDDC 3D4WA 4NP5A 1HNXL 1ISNA 3ZVVA 2HDEA 4ZK9B 3ERSX 5H1SE 1ET9A 3CF5A 2G1EA 1PDQA 3A8KE 4XX5A 4YHHL 1DGSA 4GOPB 1TZ1A 4RM8A 2CHBD 4J3OD 3GTOH 2MJ8A 3AEAB 3IKJA 1PA6A 2JA5H 3RMHA 3RZDH 4LF8Q 4OWTB 3KVFB 1LGRA 4A93H 3W1YA 3URYA 3I4NG 2LI5A 3KW5B 3MA2B 1V9JA 1KTKA 5IGDA 3GTMB 1UE7A 1OEYJ 1WE6A 2VZKB 3QWZB 1PH5A 3N52A 2K6AA 4F7ZA 4K7UA 5DPWA 4EGVA 3BG3A 5EBCA 4U673 4TQUS 2VUMG 2M8SA 2XK5B 1NDDA 2K01A 2AHOB 1K8MA 2JZ3B 5M3MG 3I55A 2IZVB 1WRDB 2REXA 5ELNA 4ASWC 3I5JC 1HR0Q 2QDFA 2JYEA 1AN8A 3WIMA 3AEVA 3VA5A 3UE0A 2N49A 1DM0B 1LO5D 5IODA 2O2VB 3EIVA 1RCVD 4MN3A 2ZVNA 5LMNQ 4LUVA 2MP2B 1IZ6A 4M8AA 2KHJA 4M02A 3A9KB 2XSCA 4EZLA 4JW0A 4X62L 1NVID 1SYBA 4C3IG 1TYGB 4HN7A 4JVZA 3RZWC 3AB5A 4ANVA 1OQRA 3MFYA 3GTGB 1C78A 1KJTA 1VQIA 2Y5CA 3ZXRA 2OJWA 1HQMC 3GTMH 3AEFB 3SHQA 4FYDA 4PS8A 1F52A 3IHPC 4PZ6A 2EKIA 2INNE 4MEMA 1RFAA 3H0GB 1TXYA 3PUZA 3I4LA 1SJHD 3VTVA 4DV7L 1UAPA 2RDHA 2M19A 5I2XA 2LXJA 2L05A 3OYYA 3K59A 1YIWA 1WXSA 3OTOL 4WWMA 3TZUA 3K57A 2K5PA 5MPOA 3HKZG 4ZCKA 3TUOA 3L54A 4LUOA 4G11A 2X6LA 4HLEA 2F4VL 1KLVA 1JICA 2BQQA 1B9MA 3WAOA 3PIO3 1MFWA 5A2QL 1VQOA 2KWCA 2R7ZB 3B6YA 5JPNC 4A3EB 1V5TA 4NJCA 2K52A 2JRIB 3H91A 2E2IB 4JE3B 4N9F4 1ACCA 4PS3A 1JRUA 2MO1A 1AH9A 5C3WA 1C7YA 2B2VC 1RL2A 2HIXA 3AE3B 5BYQA 1TT5B 2JSOA 4EVOA 4HJ7A 4HK2A 4YCUA 2EY5A 3C1EA 1AFPA 1JOQA 4B9XA 2UU9Q 4K5VA 4ODGA 1N34Q 1YX6B 4YSXB 1BNZA 3H0GH 5EE0A 4WJPA 3CCQA 4L5QA 3M3YH 1R4QB 3NG0A 1QE6A 1YEZA 3PO2G 1U4LA 1F9JA 1JB7A 4F1SA 1R4MI 5JPMC 4M0WB 4R4TA 2LEKA 3V61A 1TWCB 2LFNA 2PMVA 2BKRB 4YTNB 1R9TH 4W9EA 3W2DA 4OZAA 4AIMA 1E2WA 1VQFA 4A3FG 3L16A 1FNUA 4LK1C 3S1MB 2EMSA 1WOCA 2KDMA 1MI2A 3KF6B 1ZUD2 2R7ZH 4XC2A 1VQ8A 4A55A 4A3EH 2O4XA 4ACFA 4A3OA 1DXMA 2RPVA 1EIYB 3P7JA 3KLSX 2D11A 2C5LC 4LDTD 3JAME 2LGXA 3GE8C 3NXWA 2MFIA 4GNXC 1JCKB 1HA6A 1GAQB 3GDEA 3RD4A 4TV3A 1D5MC 1V1PA 1KD1C 4KKTA 3S17B 4XDDA 5C2TB 1YQ3B 3ZJUA 4DV0L 3QARA 1LABA 3AFPA 4JWSC 2LUMA 5FLXc 3KUZA 3BVGA 4F87A 1GC6A 1WI5A 1T0SC 1N63A 1WGYA 4KKIA 4LFBL 1ESFA 2CHXA 3IBEA 2GBMA 2JRHA 1PUTA 5AZFA 1TKEA 3A74A 1YBYA 2I1KA 5I6YA 1YNJC 2DUDA 2MJEA 1BQQT 1TWCH 5LMUL 1AYFA 2K1FA 4RGNA 4CGYB 4FJZA 2KMCA 1UGJA 2Z4HA 2AWTA 1XTDA 1C4PA 4ICUA 3S1MH 1Z9FA 4KJOA 1CHPD 2EYLA 1N8RC 4R4OA 1J9OA 2VQEQ 4JBMA 1BMLC 1YOVB 5T1GA 3K8AA 3ZQ4A 4R9WA 1G291 2XIWA 2FIDA 3N3KB 5CHFA 2QW7A 4LF8L 2C60A 3MHZA 5J39A 2B76B 4H2AA 2YTXA 1FGUA 3H15A 5GMVA 2R2QA 4LNOA 4X3SA 3HM3A 3HP3A 1Y1WB 2B2YC 2F0GA 4IFDI 2NPTB 1GHKA 1X3EA 2F0WA 4A3JB 1XCQL 2DZKA 4YXDB 4KY7A 1I42A 4LNKA 3TRZA 3FILB 1UWMA 3S17H 1ZXIA 1F9PA 3MTNB 2JYTA 1EO6A 2EXZA 2M1MA 1LUZA 4KX6B 4EOYA 1BVSA 3STBC 1E0ZA 1U0LA 1RTOA 2I5MX 2E5LQ 1NJIC 2WXIA 1EU3A 3DVGY 2Q8RE 3SDLC 1S4ZA 2O2VA 1VDVA 1HR0L 4BBSB 3SHLA 5CGKA 1D6EC 4IURA 2BH8A 2MP2A 4RHSA 4ILWA 2V0GA 2KN4A 1LM0A 3HOZH 2G9DA 5JEAG 2LXCA 2DBYA 3G7LA 5M5YB 1FXIA 4ZKCB 1TBEA 5LMNL 2KNBA 4A3BG 2WB1B 4Q2JA 4EQ5A 3R7RA 3KK7A 1VQLA 2EQSA 1JOKA 2ZZPB 3ONSA 1WR6E 1E9MA 1Q86C 2B8GA 3I2ZA 3J81c 1WTQA 3QHTA 3PV1A 5COYA 1VQ5A 1NI3A 2EJFC 3LNNA 3NUCA 3CMMB 2B2TC 4BXXH 3UF8A 4DR3Q 3AM9A 4AQYQ 4X3UA 3U4VA 2KQ7A 2WDRB 3J80c 3Q14C 3KDFA 5L83A 5GAHC 1Y1WH 3U9SA 1N36Q 1T5XD 3U4ZA 4IFDJ 3JYUA 1DOXA 4A3JH 1GB1A 2QDBA 4ME5A 5IE8A 5HG2A 5JJIA 2D10A 1CMXB 4DR2Q 1VF5C 2Z4IA 5EKLA 1PTOH 5FLMH 1B9RA 1FCLA 2Y0SG 1OFFA 2ICIA 1U5KA 1OXTA 4L63B 1VLBA 2ZNVC 4B3SQ 3PRPB 2NZOA 1X3QA 1LT4D 4B08A 4BBSH 4JGHB 1D5XC 5CBEE 2Z9HA 3Q8EA 3ULJA 3A4RA 4A75A 4A3IB 1E8WA 4MIUA 4KLKA 1VMPA 4R4CA 4M00A 3GS2A 2H5XA 4PZ8A 4Y7NB 5M5YH 1EIHA 3ML8A 4FXGC 4YY3Q 1GHJA 2D62A 1F2ZA 1ZP0B 4YT0B 4B6WA 3TDQA 4II2B 2WV6D 2GBNA 3TEYA 2OJRA 4OL7A 1WF9A 3ZRFA 1C4AA 1VQKA 1NR4A 2LVPA 2OCEA 1WTRA 1V81A 5D65A 2Q8TA 3C19A 4DDID 1JE5A 3OIPA 3FVQA 1A3UA 4H02A 4DXGA 2BVCA 1I35A 3GZNI 3NZ3A 5CC4A 2OF1A 3HK0A 5DNFA 3NZUA 3EFUA 2KLCA 3JSVB 1EOTA 2UU9L 4FJVB 1N34L 1BT0A 3DBHB 4HEDA 2JA5G 2E3TA 4M0WA 3HIZA 4TKOB 4A93G 1CKMA 4KGTA 3DM1A 3W9CB 2ID0A 4TQ0A 5LL6X 2ASBA 4LWCA 3EA6A 1DJRD 1TS4A 4RWSC 1B4OA 1IGDA 2KJHB 3AE5B 4C2MB 4IM0A 3KF6A 1ZEQX 3V60A 3BK2A 3Q69A 2NVQB 4A3IH 5HFYA 4W9JA 3DWAA 3NY5A 4HIDA 3JW0X 1I94L 1WX9A 3V96A 1JJGA 1GO3E 4F88A 2LVQA 4CHKA 1Q46A 2O5JC 4YCVA 2FAZA 2KEDA 4FXKC 2K5DA 3H6MA 2KHIA 2X8XX 2KFKB 3MJWA 2WU5B 5EQ0A 5JVG3 1PH1A 1EWCA 3FKIB 1KDAA 1KDCA 1S5DD 5L37A 4TMAB 1NTGA 3N20C 4IUQA 2PJHA 4NZLB 3ALBA 5IAAC 4KD3A 3HOUB 5JOBA 2LY7A 3NENA 3MXPA 1ENAA 3BIID 4GIVA 3RNAC 3OG5A 1UUPA 5IO9A 1A2TA 4MTNA 1WI0A 3PZDA 5E3FA 1YJNA 4KSKC 4P72A 1I5FA 3D32A 4WIPA 4RA8A 4XYOA 1P1AA 2LGSA 2JY6A 1NAPA 2UXDQ 1Y56A 3ER0A 4ZRQA 1GOZA 4FHKA 1A8VA 1Z6HA 4P1BC 4KTAA 2Q2TA 4GKJL 2PNRC 2HCCA 3A5UA 1QOGA 2NUCA 2ASQA 5EE1A 4WJ4A 2JXTA 1C4QA 3A8JE 2GI9A 1L0VB 4NNJB 3P75A 4GNXA 2KMMA 2NVQH 1VCIA 4KY6A 1MHWC 2QIEB 4KN4C 3F2CA 4KZCA 1Q90A 2MQJA 2KJXA 4R3DA 2VQEL 4GB9A 1WCMB 2VQFQ 3PF5A 2BH2A 3R2TA 1O7LA 1QVFA 4N8X1 3I72A 2NPTA 4IDIA 1DGJA 5C4ZA 2B3GA 1TWAB 3FILA 2EXDA 3FKIH 1T0RC 4C56C 4DV4Q 1WMHA 5AEKB 2OWOA 3T8MA 3K0XA 2MJ3A 3AE1B 3FMCA 2FE8A 1BCPC 3VRBB 1XNQQ 4ULLA 1PZJD 3G71A 4MTKA 4MGYE 1TWFH 2M0AA 1JJCB 1LTTD 1CFMA 4HVBA 1YMHE 1K0RA 1SNOA 4DV5Q 4TSSA 1VS0A 2Z0EB 5CBAE 2JUOA 2E5LL 1CKNB 2L0TA 3T3NA 4XGAB 2J0TD 3CC4A 3UI2A 1PH2A 4DU9A 2KYWA 2IO3B 3ECIA 3IFWB 4WQMA 1YITA 3H0GG 2DGYA 2EPBA 2BDOA 3DWPA 3R7QA 4C3JB 4OVVA 3ZNID 1J8CA 1LT5D 2LGYA 1J8IA 1VR9A 4LFAQ 2PW9A 3DBRI 1SXTA 3ICEA 4YWGG 4DQOC 1Q8KA 4BOZB 3CCUA 5AZHA 2K7VA 4DR3L 4S3SA 4CQNA 1QLBB 1Q1BA 4JC0A 1VRAB 2Z0SA 3D8GA 2B39A 1XQQA 2WXFA 3ZNZB 1OQQA 3CD6A 2QCZA 1YNND 2YEPF 4K3CA 1W6JA 2RHQB 1N36L 3KLWA 2HD3A 2MGSA 3TP8A 1PH4A 2ZJQA 1JWAD 3Q8FA 2KN5A 3NTIA 3W5UB 1STNA 3SK5A 2V1CC 2Z8LA 2R7ZG 4A3EG 1UE1A 1JT8A 1WX7A 4L1BA 4RKBA 3G4SA 2R2OA 1KOTA 5E6JA 3VUYA 4DAYB 2K5VA 4JI1Q 3MEHA 1SYGA 4XQQA 4L6TB 3VR6A 1PH8A 1G6PA 3E56A 5IN7A 1FD7D 4XT3B 2WDQB 1XXGA 4B3SL 1VD2A 1WXVA 2A4ZA 2WU2B 5GXGB 5JXVA 1VQNA 4IQZA 1VQEA 2LJ5A 2JEAI 1V2YA 4ZYNA 3P1HA 5IGEA 3EECA 1J7AA 2DZMA 2O5IC 4PYUA 2ZPNA 1A62A 1X55A 1UGMA 2KWUB 4RCOA 2D3GA 5CV9A 4YY3L 5GADC 4C3JH 1RF2D 2OOBB 4HSVA 4RNAA 1FNVA 5D6JB 1SSOA 4H44C 1EEID 2KC2A 3NJTA 4GMVA 2Z6KC 1I4HA 2DNCA 3FPUB 2WHIA 2RQXA 2JX5A 2AUJD 4OIKA 5CTRC 2UUBL 4JIOU 3Q6SA 4KHPQ 1C0AA 1LXDA 2KVZA 4A20A 4RCNA 2MPMA 2K9XA 1X54A 2A8VA 1NMGA 3EC8A 2EYPA 1E8XA 2FCQA 4KHZA 3I73A 3TEZA 2A5HA 2NVTB 1XNRQ 4IUTA 2BTEA 4A3DH 1WFYA 2HUGA 4G3XB 3J7AV 1ASZA 2WINB 1FRRA 3RR5A 3NELA 2NVXB 5I6WA 1ROEA 4CJ2C 1OGWA 2IO1B 1A70A 4UPAA 4DR1L 4ZUJA 4C3HB 1JWUD 3A54A 4WJNA 1PXUA 2V4DA 3JAMi 1F2LA 2NN6H 2O6VD 4IWOA 4BFRA 4B9WA 3RNEC 4PMWA 2E74C 1CK1A 3S1QB 2D2CC 2K03A 1E5WA 4NJ7A 1O7YA 3HOXG 2PO4A 4RAUC 2RSNA 4REZA 5D3IB 3N9YC 2K5WA 3PREA 2F0TA 5EPLA 1E3PA 1HNZQ 4Y52H 4BA2I 5C4HA 2OEDA 4YL8A 4BA1I 3HOZG 4DV6Q 3Q24A 4DV1Q 1QJOA 4II3B 1KC8C 1U4PA 1KRTA 4CJ1B 2IX1A 1Y14B 3PO0A 2E8GA 4A3LH 1FIQA 3TIXA 2FXQA 3RZFA 1KLGD 4R4IA 2KLGA 1KNAA 3N30A 1YZ6A 4IG7B 5FJ8H 4GLXA 1B7YB 2VNUD 1EQQA 2QMTA 2M2LA 3TL5A 2AWOA 3T1HQ 1HUNA 2NVTH 1WYGA 5IA7A 2UXDL 4BXXG 3CWIA 4M8MA 4DAPA 4PNYA 1LLRD 5AJ3Q 3HVZA 3PZ8A 5G55A 2NVXH 2L32A 3DDCB 2GA4B 1PRTB 1TIID 1ZDVA 2XGTA 5HURA 3TREA 1Y1WG 1ONLA 4POGA 4AS1A 2UXCQ 3AE2B 3VTUA 4NXNL 4C3HH 4IM3A 2KA7A 1TS3A 1A0IA 2Z0DB 5FLMG 4MT5A 4GLSC 1D7QA 1P7EA 1XEEA 3S1QH 1PYWD 3BYTB 4I7ZC 3VR2A 2WDTB 2VQFL 3N1YC 2X6GA 1XLPA 4P16A 4BY1B 1DOYA 4HXDA 1WZ0A 5JEAJ 3L17A 4BBSG 1TKWB 1HH2P 1EFWA 2WXOA 3IFDA 3S2DB 4LLGM 4DV4L 1WR1A 4RGMA 1IW7D 2BE5D 2HQLA 5LXHA 4XE0A 3MC0B 1E2ZA 1XNQL 1ZPSA 4EQNA 5GAGC 5DAUA 2BGFA 2D0OA 4AYBE 2MBBB 4LK0M 1G8ZD 1S5BD 5E4XA 1GG3A 3AH7A 3R66C 1IYVA 2L52A 2BE5C 1H9SB 1EF5A 1V8CA 1IBKQ 5K36H 5EPKA 1J7CA 1VJKA 3V62A 5AUIA 2KHWB 1AE2A 1E7VA 4XXEA 5G5GA 3BVZA 1VQ7A 4WJOA 4NKLA 1NYRA 4BOSC 1QZEA 1U4MA 3NQIA 1IBXA 4ZLTF 3W1BA 1XYIA 4G7ZC 3MJ5A 3RUIB 1CSPA 3ZXVA 4LF7Q 4A3MB 1XMQQ 1JQYD 4YIJA 3QJZA 2J53A 4HAEA 2K39A 2KUMA 1TIFA 4A3GH 3KYDD 3H7PA 2PQAA 4DAMA 2YU9H 4G4KA 4BY1H 2ZXOA 2KJRA 3DWGC 1XJVA 4RHRA 1AEXA 1EYGA 5BMIA 3U50C 1H95A 3E3XA 1L0YB 2FNJB 3S2DH 4A3IG 3AE9B 1KH0A 3NK9A 3M4YA 4P2CB 3VVWB 4IPGA 4GU2A 3S2AA 4DAYA 1D8LA 1V1PB 4WJWA 1F9QA 2MUYA 4IJHA 3ABVB 3NTKA 3K0YA 4N9TA 4DF7A 3U2SC 4JI1L 3Q6BA 3K7AB 2YTVA 2LVOA 5D2MB 3KF8A 1GUGA 4A3CH 4BKTA 4V0BA 2EIFA 4HCNB 2MH7A 3I90A 5EPJA 3JVZX 2RVLA 2IY5B 2IO0B 2KAJA 3DVGX 4D2KA 1U4RA 4ZRIA 2F0QA 1CKOA 4ANWA 4Q5VA 2B2UC 1XLOA 2LJIA 3DM3A 2MA9B 1V1OA 2RGFA 4A3MH 2DY8A 1ENFA 1SMYD 1BCPF 3Q3FA 4RH6A 1SMXA 3K7UC 2NTTA 1P0RA 4APVA 1P16A 3KJPA 2Q5WD 1J0GA 3P2BA 3GQBA 3JAML 4WJQA 3S14B 2FCSA 5C44B 3NZSA 4GSWA 3ULLA 3VAWA 4DDGD 1SMYC 3NE5B 1HQRD 1EYDA 3MXNB 1YHQA 4RF1A 4MDKE 2ZT9C 4WH4A 2WXQA 3V3XA 1PH9A 1Y69U 3T13A 1B8AA 4OIJA 4KV6A 3RN5A 1E90A 1K83B 3OHXC 5HY6A 1I7HA 1S1QB 3T3OA 1I4GA 3DWQA 1L4ZB 2H88B 4PS7A 2GB1A 4K2KA 1Q3LA 2ZTDA 3AEDB 3FKIG 3K7AH 2GRIA 2L0FA 4P1CC 3AYHB 3VQIA 1FD6A 1VZ6A 4MSMB 3ZTCA 1KXLA 1EWYC 2QJLA 1K52A 1E7PB 1Q0WB 1UF0A 1ENCA 1VMCA 1PGXA 1LT6D 1SROA 2G9HD 5DPTA 5J18A 2WXHA 1GUTA 1H9KA 4YWLA 1K3BC 4P6VF 1OXVA 3SGIA 2A6HC 1RKNA 4EZJA 1B3AA 2IWHA 3EFCA 4FBJB 5M5WB 1YD8U 1GD7A 3EROA 1DOKA 1AWDA 3GE3C 1LTSD 3J81j 2W3RA 2AUKA 1PFDA 3TN2A 1CI3M 4GN1A 5IWAL 2JA7B 1PH7A 4C1NI 2R61A 1HTOA 4GDLB 3VUWA 3S14H 5C44H 3ZKJC 1Q1EA 1X65A 4FLHA 4X66Q 4DV6L 2K0PA 3L4PA 2VB3X 4DV1L 4HPLB 5D94A 3D0FA 2EYFA 3GO5A 2NB0A 3KDFB 3B0AA 4BKSA 1IYUA 5T1IA 1M94A 2CHZA 1K83H 3QIAA 2D9UA 2L83A 3TMEA 5IY0A 3M4PA 2K22A 2F4IA 3LDZE 1EY5A 1I50B 3T1HL 2ICEC 2PPBC 2OQKA 2HT1A 1STYA 1K8GA 5HGTA 4JBJA 5C5MA 4OO1I 5AJ3L 4B0MA 5I9OA 1STBA 2BWES 1JR0D 3L2PA 1O78A 4N9PA 4DR5Q 4B9KA 4DA2A 2DNFA 1JQ4A 2IHEA 3UDGA 2UXCL 3T1YQ 3Q23A 1MHXA 4ICVA 1WM2A 1HRJA 2PZUA 1MIUA 4X64Q 1N62A 2ZTCA 2PE9A 3M85A 3AECB 1DZ1A 4US8A 5F2DA 1PFMA 5M5WH 1D2BA 4HJGE 3V6EB 2WP8J 2CW0C 4NB3A 2L00B 5I9PA 5ISRA 1Q82C 1P7FA 2HTME 3GTGH 1EF1A 1QNKA 4JG2A 1TVXA 3OIQA 1UD7A 3UQBA 1QG7A 2JA7H 3E5SA 4KGSA 2BBCA 4FULA 1L4DB 1QKZA 3LB8C 4A90A 1RHPA 2V9HA 3HZXA 1WTPA 1L6UA 2DLBA 4IUNA 4O42A 4RGOS 1KIXA 3GTPB 2N88A 3MZ5A 2WXJA 3P42A 1B44D 1H9SA 2DWQA 4HEA1 3PLUA 1P9DU 1C3TA 5KRUA 2ZM6Q 1PFBA 4UDUC 1Y8PB 4A3KB 1KRHA 4C3JG 1M8AA 4DV2Q 2M4NA 1NNXA 5IT9E 4L2YA 1I50H 4K8JA 2DYOA 1T9HA 1IBKL 2BOSA 2N55A 3D3RA 5M3FB 1L2FA 2L8JA 1HTQA 5JHAA 3DCGA 3LXFA 3KOJA 3QOLA 1JROA 3ZW3A 4QY7A 2PMZE 2M0XA 1LTAD 1E8ZA 2TSSA 3KH0A 4PQXA 1I6VC 1V1QA 1IL2A 4IW0A 4HPPA 1LACA 4GN5A 2EJMA 1II3A 1GM5A 1FYCA 4LF7L 2B2WC 1XMQL 3S16B 1FCCC 1Z47A 2ZXPA 4AH6A 1SYCA 2EY6A 2E2IH 3KFUA 3QIJA 3DHHC 4MZ9A 1M90C 4A3DG 4K3BA 4LF9Q 3GTLB 4BKGA 1SE8A 3AULA 5ELBA 1CUKA 1HNWQ 2CHWA 1JWBD 3L0WB 3R3OA 1SIJA 3RNBC 1EUJA 3I57A 3MEFA 4JCVE 2ZVOA 4NQLB 2F0SA 5J2RA 5D14A 3AU4A 2LMCB 3AU7A 5EGTA 5ELCA 3S1RB 2R3ZA 2G5DA 2KECA 4KIKB 4C4VB 3NWTA 1R4MB 5EE9A 1W2BA 2NN6G 2JF5A 3GTPH 1HUMA 2K6DB 2INPE 3GV3A 1YNJD 2MLBA 3CCJA 1ML0D 1PH6A 3E0EA 5ELOA 4OEMB 1Q1OA 3OMGA 3DMUA 3APDA 1N33Q 5FOBB 3NS8A 4FJYA 1DOLA 2WXRA 4IOIE 4WQOB 4CBVA 1AZQA 2D3CA 2PLPA 1K9MC 4X3TA 3E6ZX 1OEYA 4DR6Q 1GJXA 1SB3C 1WZ3A 2K75A 1YIJA 4NXMQ 3M4QA 1A3VA 2DHZA 3OW2A 3W1SA 4LF5Q 1MPEA 1C48A 4P73A 1EFID 4C7ZA 5TSSA 2EE1A 4A3LG 1J5EQ 1LTLA 2R93B 4ID6A 1W6KA 2BS4B 2CR5A 1L1OC 1QZHA 5JVH3 4MM3A 4BVUC 3EUB2 5FJ8G 1ZW7A 2LD9A 1WGKA 4TQ1A 1UE6A 4GNXB 3S16H 2UXBQ 1EQRA 5CHWA 3QJYA 3KJOA 2CCZA 4LJPB 1L6VA 2QGQA 3MXNA 2GBRA 4IO9A 4XYCA 2DENB 2KWVB 4LDTB 1PTOC 3KUCB 4DUZQ 2IT1A 3STBD 3PIP3 1N32Q 1IUEA 3OWEB 1PV4A 3S1RH 4C3HG 3DUZA 4NMZA 3DEPA 2N9LA 1CQFA 4F8CB 1WMHB 5HKHA 2CFMA 2WXMA 1VQGA 2KCTA 1I3QB 4RMFA 2E6XA 2KK8A 3RPFC 5EJWA 2HHHQ 1KNEA 3QG1A 4HROA 4I6NB 4JL9A 3CAMA 2Q8IB 2MBOA 3QC8B 5D3DA 1E22A 1J7BA 4K0KQ 2GVAA 1SYFA 3HOWB 1DOMA 3A33B 5C5LA 2Q2UA 4EEWA 2F1MA 4RFBA 5JJKA 2WXPA 4BBNC 2L7RA 1B2TA 4IJLA 1IYFA 1PFSA 2ZTEA 2Y3AA 1STHA 3ZUNA 1YHAA 2F3IA 1VZ8A 1LYLA 4OGQC 1K3RA 3UDIA 1B50A 4ZRJA 1YJ9A 2R93H 1BF4A 1YJ1A 4OX9Q 3AMUA 4AOFA 4PZ7A 1AZPA 1F0ZA 1NCVA 2XVSA 1B9NA 4GDLA 2N8NA 1WH3A 3VH3B 2FIFA 4DHZE 2D5GA 5IGGA 2J52A 1KDBA 4J8QA 5K36G 1A6XA 2JSVX 3S15B 3VUXA 4L5TA 2NR2A 3TZDA 2HJ8A 3L08A 3CSFA 1LFDA 2IGHA 5CORA 3T9LA 5IIFA 1V43A 2IL8A 1PYSB 1SFOB 5DPRA 4X66L 2OXPA 2KMAA 3PPAA 4A3PA 1EY7A 5CMDA 4QIWE 2LHEA 3VYRA 1V8QA 4JQWC 2KOXA 4ARIA 5KYIA 1I3QH 2WIIB 1Y8OB 2KANA 2JQOA 3ONAB 1OTCA 1PDXA 4WJ3M 3U7DA 1H9MA 4A3GG 4LF4Q 1C4CA 4UHVA 4MACA 1WRIA 2CH4A 4QJFA 4BY1G 3CP0A 3PUVA 3SEBA 5J22A 3HOWH 4TUUA 1E10A 3S24A 1ZDXA 1MJDA 1BUIC 4IPCA 5J3BA 3ITPA 1VZ7A 1GUSA 4DR5L 4HR7B 4JOIC 5AUKA 3T1YL 3F2DA 3E9SA 4X64L 4M01A 2BA1A 2AEHA 3H1UA 2KD0A 3HS0C 4OWXB 2IJ0A 3ZJYC 1I4RA 3MC8A 1X3GA 4XT1B 3G6EA 3BJUA 2OQ0A 3S15H 4A3CG 4OHJA 1WE7A 3WAPA 2Q2IA 4PG3A 2L11A 4W9GA 1C1YB 4LTUA 1SFOH 1R7SA 2ZNVB 5BMHA 4FP5D 5KHOA 3CCMA 1YJWA 2ATWA 2MJDA 3BDOA 2KWDA 4CO7A 3ZTDA 2PNHA 3D6CA 4NDXA 2ZM6L 2V4LA 3VR3A 2PIAA 1P3QU 2I2YA 3GOEA 3M7GA 1XPOA 3PHWB 3FRPB 3WOEA 2NBVB 1TZOA 1YN3A 3ZYYX 3OPOA 3GTQB 2KCNA 2OEOA 2MQHA 2B2VA 5CV4A 3SVMA 2KXJA 3PTFC 3MC9A 4QUCA 1T0QC 3A0JA 3HOVB 3WAMA 1OQYA 3RLOA 4P7IA 4Y7NH 5EAYA 3BS1A 3I4MB 1RRBA 3GZNB 2XRSD 5IYDH 3IG3A 2DAFA 4XDXA 1VF7A 2MW5A 4RG1A 4J6IA 4LJZC 2QILA 2QKIC 2WX1A 3IRBA 4WWOA 2LMCA 4LF9L 2ZCCA 4C4VA 4KIKA 1HNWL 1K8OA 1E7UA 3AE8B 3G6JB 3LWEA 2LRWA 1XLQA 3I9V1 4H0LC 4U68A 3H09A 2JWUA 2BS3B 2KZRA 2C7NB 3AE4B 1TU2B 5C4JB 1BKBA 2VUMB 2MX2A 4NQKE 5CYUA 5GAEC 1WTWA 4EKUA 3CQZB 1GUAB 2UYZB 2MCNB 1BUVT 3I63C 2I5HA 5M3MB 3E0JA 4IKGA 3C0RB 1EWIA 3R8BA 5H92C 1WY8A 4AJYB 2FJ2A 3SK8A 4DNIA 3NVYA 2W9NA 4YTPB 3NUHB 3BZKA 2JWZA 2JXMB 3Q3MC 4JK1C 5C44G 4DR6L 1QUQA 2AKWB 1F9SA 4IN3A 3KBXA 4LMQD 4Q0FA 4C2MH 3W3AA 4NXML 1WJJA 2WXNA 3AU5A 4LF5L 4DXAB 1FJGQ 4JLCA 4UP8A 1KFYB 3HOVH 3A4SC 3EFXD 2RCFA 3EN2A 1WWTA 4GN4B 4LFCQ 4DR4Q 3I4MH 2KC1A 4CDEC 1ZXHA 2V3PA 2AL3A 1B1ZA 4X6AH 1KHIA 1UELA 1SJED 4C3IB 4J1MA 1BCPD 2UXBL 2FMCA 3U9OA 1HXYD 1KQSA 1Y1VB 1T0YA 3DHIC 4BZAA 4YSZB 3IT4B 5JH5C 1MKHA 2BYFA 2VY3A 1Y8NB 5DM63 4DUZL 1N32L 3HOUH 4QUFA 1DOIA 1QVCA 3H3VH 1S5FD 3B9JA 4DKAC 3VDYA 4DUYQ 1XPUA 5BN4A 2TMPA 1TQOA 3K80C 3GTKB 4ZDVA 2UUCQ 1LV9A 2ZJPA 2CKZB 4HCEA 4DK3C 2KKCA 2RDFA 2IYDB 4HKZE 1JRPA 1HZ6A 3K5NA 1L1OA 4G57A 1EY6A 1PLFA 1NI2A 1UEBA 2F0OA 1U4AA 1TWHB 2I1JA 1P8LA 1WTHA 3FEWX 3KUDB 2EDGA 1SDFA 2GN5A 3OW7A 4FF2A 4K0KL 2LKVA 2IDYA 2C9WB 2KQSA 4N59A 5CHVC 3CIRB 3T56B 5HI1A 2JA7G 5LXIB 1IHZA 2JJQA 1QT9A 2WAQE 1V9PA 2CH4W 4ZYSA 5IP7H 2K6QA 2R92B 2WWZA 3Q8DA 4DBGA 3RLNA 2B2YA 1NBFC 5E4WC 4AYBB 3QO2A 2LXKA 5FK9C 4LAAA 3P4RB 5AZGA 5JZEB 4OX9L 1IBXB 1I6HB 4NAWA 2K5NA 1CJEA 4IZ8A 2HTHA 1WCMH 4C3IH 3IXSA 5LLIA 5ELDA 3A1QA 1RD9D 2K32A 2F0IA 1VQCA 1DYQA 1Y1VH 2FMMA 1WTVA 2JVCA 2ZW1A 4AQYL 1EIGA 1TWAH 3X3MA 3ETRA 1TT2A 2P5ZX 3H7PB 2PYKA 1CZWA 2PQAB 2EKEC 3X0WA 3UIPB 4TVAB 3NSWA 2EVBA 5IYBH 1PQSA 1HJPA 1VQ9A 3GTKH 2MO0A 2GOWA 3F2BA 2E75C 3J7ZC 2NTSA 4DR2L 1RLFA 5KHQA 4XYQA 4KMUC 2N7JA 3ZO5B 1LTID 3M7NA 2WKDA 1NMFA 4LF4L 1V86A 2JA6B 2PTLA 3D4RA 4WWPA 3ZIMA 1FXTB 1E6EB 2JP1A 2NN6I 4NPSA 3NHEB 2B2TA 3DBRB 1PHJA 2PKOA 1GB4A 2X69A 4WRDA 1WSPA 3KF8B 4QGUA 3RT3B 2SOBA 1PTOF 2R92H 4K14A 3FPPA 3DVNV 1GUOA 2FUG1 2CVRA 1WYDA 2F0PA 1TWGB 1O7ZA 4ZHOA 1VQAA 5E1FA 1IBMQ 1SSNA 1P98A 2KVRA 3DBSA 3A56A 2BB5A 1VQHA 1I6HH 3W5VB 4HKQA 3TEXA 4OONA 5FR6A 2RSUA 3VHTC 1AW7A 4JI8Q 2WX0A 3BDCA 4HJAA 2DZJA 2Z6BA 5E6NA 2QDLA 2WGSA 2JZZA 1RYJA 1R4NI 4CKBA 1JORA 4G7OC 1WM3A 4MGKE 4A4IA 4LUZA 5BN5A 1E2VA 4BBNF 1FGBD 4KHVA 1S5ED 4N58A 3DXJC 4E74A 4W9LA 4W9KA 5KIXA 3Q3JA 4RF0A 4QF4A 1EZ8A 5M5XB 2C5CA 3JAMc 1G2SA 1HCZA 1S40A 5EE3A 3ZDMC 1B53A 1NE3A 1T5EA 3WOFA 1J6QA 4Z9CB 4BWGB 5FLXE 1FMAD 2LGDA 2JA6H 2DN8A 2N78A 1Z7TA 2AQ2B 1X1MA 4XWTA 3RI7C 1FVIA 1PYBA 2AQ1B 2JN4A 3ND9A 2C7HA 3HEJA 4QMGA 2JK8A 2WXKA 4YWKA 3WA0A 5BN3A 1VCBA 4YWMA 3SD5A 4FXDA 3NWSA 3OJ4B 2WACA 5CR3A 1FPYA 2PVGC 1JW9D 3NPPA 2LRUA 3CXCA 1TWGH 2D07B 3Q2AC 4FADA 2ZJRA 4G50A 2JT4B 1D1IA 2L1BA 2RDBC 1VQ4A 3C3LA 3FDTA 3AN1A 3MXGA 5C3JB 1VQBA 2H1EA 4C7YA 2L9HA 4C00A 1EY8A 4HCSA 3HFZB 1GJZA 2N3SA 1EZ6A 3U52E 3SXHA 4KZ0A 5BYSA 1D3ZA 2A68C 3AQQA 3R93A 2R93G 3H9DA 3L10B 3NRZA 3ND8A 2BB6A 4TRDA 2SDFA 2VRRB 1QCBD 4X62Q 1XMOQ 2CU1A 1WTOA 3SK4A 1UBQA 4DNRB 5M5XH 4ZHPA 3ML9A 2LXAA 3VR9B 1BO0A 2SEBD 4HIOA 1HZCA 2KQ3A 3Q3OC 2XEWA 4IUVA 1HZBA 3G48A 1PGAA 1IGCA 4B3RQ 4A3JG 4YSYB 2EELA 3N1ZC 2K33A 1ZE3D 3HOYB 4G7HC 1FJGL 2JXXA 1PFNA 2HQEA 3BDLA 4K6LA 3SR1A 3TP6A 2O6VB 2BKFA 5KYLA 2W3SA 2BYEA 3WCQA 4LFCL 4DR4L 2LWPA 3KYCD 2I07B 2YTYA 1CA6A 3C2PA 2PW5A 1S3SG 3TEWA 1G6JA 2BS2B 3HOWG 3HKZE 3J81E 1E24A 2EYJA 1K53A 1NYQA 3MVVA 3A9JB 1O7IA 3DHGC 3MHSD 3CKIB 2YYZA 2B63B 2F4VQ 4K7SA 5L95C 3L13A 2K8HA 4UP9A 3O13A 3FKYA 1FO4A 3J80E 2PCFB 1FFUA 4EE2A 5CX3A 1ASYA 3HVDA 1C79A 2WB1G 2ENBA 3TS0A 2UUCL 2RR9A 3DBLI 4ZAIA 1FM0D 3TCAA 4DPGA 4GKKQ 2HD5B 4DV5L 2L76A 1N9WA 3T4AC 2K1BA 4MHEA 2B8FA 5LL6S 1HFNA 2G3QB 3OSOA 4PV1C 2OTLA 4DAVA 2L15A 2EY2A 3UGBB 1QOAA 1SNCA 1C77A 4FF3A 4DHJD 2ON8A 4GDKB 4A76A 4W9DA 2HDMA 2NVUI 2BWFA 1EY9A 1EIFA 1SBBB 3K9PB 1L0WA 4ALPA 3C1FA 1KAAA 4CDCC 1TKGA 3HOYH 3B1LX 4HPMB 4L5SA 1JALA 2F0KA 2J4XA 4CKEA 5DEHA 2FCNA 1F2YA 1C76A 5GQOA 5GROA 3PIOA 3GV6A 2NS5A 3QQ8B 4LFAL 1F9RA 1CZPA 1TS2A 4JPBW 2KTFA 4JX1C 3Q0AA 2KDBA 4OZBA 3BY4B 4FN2A 2QCPX 3VYUA 3RD2A 1SE2A 1MSHA 1PMRA 4P71A 4UY8C 2J42A 1X32A 1PH3A 2B63H 3HUIA 2PMZB 3NBHB 1I4XA 4PMCA 5EKIA 5DM73 4FF1A 3SFEB 3M4OB 3CW2C 2IY1B 1EOVA 2CWPA 2DJFC 3K9OB 1BBWA 5C0XH 4K7WA 2SNSA 2CS4A 1GVPA 2IBIB 4XQNA 5IYDG 2LASA 3TBLD 1BR9A 2A69D 2CU3A 2A19A 1DONA 1V6EA 2Q2HA 4O2DA 1IL8A 4MNOA 5IT9L 2QEXA 1UZXB 4A93B 3Q8BA 4GOPC 2N9EB 1WXQA 1E1OA 1B3QA 1N5XA 4HMIA 2EMTA 4W9IA 2A69C 3PLVA 3LWUA 3OAWA 2INDC 4HMJA 2BCOA 3CCVA 2GVBA 4EQPA 5C4XB 1SE9A 2QC8A 5DPSA 5IP4D 1TKYA 3MTSA 4IPDA 3TEHB 3PMFA 2L12A 2F0LA 1IBML 1MG4A 3C8YA 1MI0A 1Q7YC 2KBNA 3M63B 4OVZA 4H7BA 4MM3B 1HTPA 2CJNA 3NS1A 2F0NA 2C7MB 2AWNA 3TP7A 4JYAQ 2UWQA 4JI8L 1ET6A 3AXCA 2KEEA 1OXSC 5LMUQ 4LNNA 5C1ZA 2KTRA 1F2MA 2NBFA 4XIGS 4KHPL 3HOVG 1TY0A 2SNMA 3LGJA 3M4OH 2KFJA 3UI3A 1H9RA 4QCLA 3AEBB 5LNK1 3I4MG 3Q8AA 3BZDB 3PCOB 3CCSA 2KT7A 3A7LA 1XNRL 4X57B 3KWVA 2XN9C 1JC7A 1L7YA 2A5UA 2AL6A 4IM2A 2A6HD 3I4OA 4R4QA 3AMZA 4JI6Q 2EY1A 3U58A 3HOUG 1G2TA 1Q8IA 2F0EA 3F1ZA 3TQYA 4JI4Q 1STGA 2Z6KA 5IGCA 4OZCA 3SFDB 1RWSA 3I56A 4FXCA 3GP7A 4W9FA 4HIKA 3H7SA 3VRAB 5C4XH 5D7GA 1MHHE 1ZOYB 1UWVA 3DLLA 4IOCA 5IOCA 2H89B 1E7ZA 3B08A 5DLQE 2M56B 2PZWA 2RSOA 1N61A 2IX0A 1I4PA 4PT5A 4L5RC 5CV8A 1HNZL 4NJ6A 3K6OA 5IP7G 3PSIA 1HHVA 4EX5A 4HWIB 4N8FA 1WGDA 1R4PB 2MSED 3RLFA 3NHHA 1TTNA 1HA5A 2E76C 3CCLA 3B2GA 2FINB 3PQIA 1K51A 1RJTA 1SE4A 4DNTB 3TS2A 2B3AA 2SAKA 3BZCA 3PIPA 5TR5A 3MFGA 1EU4A 4I6PA 4DHZB 1XMOL 1WCMG 4M8NA 1KRSA 5ELFA 4QB4A 4EZKA 3Q3NC 2PZTA 1TGZB 2WQYB 1XX8A 1Y1VG 3CRKC 4ANUA 3NTHA 1D1KA 4V190 4DWFA 3OOCA 4KD4A 1TJEA 2QSDA 2F3VA 1KLUD 2O6VA 2CW0D 4B3RL 1S5CD 1Z5SB 5IYBG 3Q22A 2MEKA 4QIWB 4LJOB 2MBQA 5BMGA 4W9CA 3M3YB 2YVCA 2QA4A 3A9JA 2Y0SE 4E71A 1JB3A 4BBRB 1DCZA 2EOTA 4O0AA 4FDBA 4MJSA 4NY0A 1EYAA 3NEMA 4FNFA 2JA8B 2I5LX 2D5DA 1LQBA 5C3EB 3IVFA 1R9TB 2BYTA 4IPHA 2IGGA 1L5PA 1FL0A 4KV2A 2R92G 4OWWB 3I70A 4KKUA 1GUNA 3M62B 4AYBG 1SE3A 4R8IA 4DV3Q 2AYOB 3TJPA 3OLMD 3H6NA 1HEZE 4K1RB 3BYYB 1YHBA 2X38A 4L23A 4QAYA 4GKKL 1CSQA 2I38A 4DGZA 4GDKA 4JI2Q 2XWBB 4B3MQ 1JWSD 1ICWA 2VW9A 2K5HA 5G5HA 3EVQA 2VS1A 1GUWA 4JI5Q 5IGBA 3TBIB 3P4SB 3MP9A 1EYCA 2RCNA 5AFWA 1QB5D 2MRPA 2ONQA 3PSEB 3IL8A 4R1JA 2E2JB 1WX8A 3T51B 1IKMA 4OW0A 4DR7Q 2WKCA 2DX5B 3APFA 4IC7B 2DZIA 4KKJA 1FEHA 5E7NA 3NBHA 2JA6G 1VQMA 4BBRH 2E2DC 1PRTF 2J0KA 3N32A 2R7DA 5IP9H 2JA8H 1XCTL 4HDOA 5KGUA 4JV5Q 3EHVA 2QF7A 5C3EH 5LHY1 2BA0A 1FFVA 5FO9B 4PYZA 1WXMA 1WGGA 5G3LF 3E9HA 1XTCD 1I94Q 3PO3B 4OO1H 1WGHA 1JJ2A 3PF4A 3VTWA 3ZDTA 4A3KH 4CJ0B 2INCC 2MBHA 1RIPA 2C9OA 2GLSA 3UE1A 3S9WA 1KAWA 1T3QA 1ZGUB 1X3FA 2F03A 1HTLD 2CKHB 1SNMA 2L0CA 2JU6X 2W82A 5M3FH 2DYMA 3UIOB 3P4PB 1SNPA 1QOFA 3EBEA 2HDLA 4JBKA 3DPDA 4GGQA 1IP9A 2KACA 1MSGA 4F7XA 4XWWA 1QUQB 2E2JH 3K5LA 1PTOD 1PZID 4X65Q 2IHFA 4K2LA 1HE8A 1V49A 4MH0E 5IKCM 1IXRA 5C6AA 2K4KA 1Q81C 3HOXB 3X3NA 4RM9A 1A5RA 1L2NA 3AEGB 4GLAC 2UUAQ 2D0PA 2M9VA 4DK0A 3GTLH 4KJNA 4QL5A 3QX1A 4GKJQ 2B29A 4JYAL 4RGTA 3VR8B 1ILPA 3ZLZA 1WIAA 4GOPA 1CHQD 2R7FA 2JQRB 5FR3A 1YI2A 4DXFA 3HOZB 2NMQA 4TKNA 1EY4A 4M1UB 2BT6A 3APCA 2WXLA 2F0VA 3HG9A 2YEPB 1GC7A 3PO3H 1LM8B 1XWEA 1OTRB 2N9KA 4K8IA 3RUZA 4RKLA 2B2UA 3IFTA 3M9BA 3O65B 3RNCC 4JI7Q 1HZ5A 3V05A 1QWYA 4KVGB 2ACZB 3AFQA 3WANA 1L1OB 1U9RA 2WFWA 4JI6L 1K8AC 5IGFA 2DAJA 3PZ7A 3PVLA 2XK5A 2KO3A 3DWMA 3MHBA 4JI4L 3K81C 1JE4A 1D4BA 2W55A 3PUYA 3HRDD 1NEKB 1PTOB 2RMMA 1E1TA 2V3NA 3B2FA 3HOXH 1LTGD 2F0DA 1RODA 2J7ZA 5IYCH 3NVVA 4NAWB 1X3PA 2E2HB 1EL0A 5IOIA 1CM9A 2WAQB 2J0MA 3VYSA 3A1QB 3AE7B 5CV6A 4B95A 3QA8A 2JYOA 3A9KA 3HHMA 1YJJA 2DYBA 5A2QE 3HOYG 1WGRA 4FVMA 5A35A 4LNIA 2GBJA 2ZCBA 4GN3B 3FHWA 3OWFA 1WJ6A 2PVOD 3P20A 1RAXA 4QQBX 5J1ZA 5EBDA 5EKKA 2MP1A 1X6OA 4BY7B 2N7DA 4S0RA 3RULA 4GS3A 3NOBA 2GMIC 4MGIE 4A6QA 2K50A 2DNEA 3H94A 3WWVA 4JWUC 3D4DA 2VL6A 3J7YW 3NVWA 2VH1A 1UH6A 4ZUIA 1ZXTA 2B63G 4LW1A 2N0SB 3DOWA 1YN5A 3FC4A 2RPQA 4G0NB 2KQ4X 3OJ3A 3BVMA 5C0XG 2EJGC 3J81i 3CHBD 3A7AB 4B3TQ 1G91A 3LYYA 1YQBA 3VXWA 2F0FA 3QWNA 4LNQA 2K14A 1UBIA 2WXGA 4IFDH 1G51A 2A73B 1AP0A 4AUQC 1H8CA 4HIMA 2N1VA 1QZGA 3BWUD 3J80i 1MVKA 1PZKD 4KY5A 4KN7C 1GNUA 5JHBA 2XNAC 2PW7A 2BYVE 4DK1A 4KKSA 1E0BA 1UE5A 2E2HH 3ZJVA 1A63A 3QOJA 4E6IA 3DBHI 1EUVB 4H13C 1SF0A 3T16A 3KLRA 3SK6A 4WAAA 1MG8A 3VYTA 4FF4A 4A3MG 2KCCA 2PI2E 3AB9A 3KQ4A 5EDSA 4DV3L 4ZOHC 1WD1A 3EQLC 4GLVB 1K8RB 4J6HA 2LS01 5JJZA 4DV2L 1QILA 4BY7H 1JWMD 5BR8Q 4IUUA 4JI2L 4NAMA 1KM7A 4B3ML 2D3AA 5M9OA 4HTHA 4WFN3 1MJCA 2UUBQ 4JI5L 2PI2A 4FO2A 2WLBA 1OXUA 2FBWB 3RN2A 3CSTA 2A74C 2OTJA 1YNTE 4LF6Q 3BU2A 1SEBD 5JJLA 1PGBA 3QK0A 3V6CB 2YLMA 4EFOA 1SLJA 3H8HA 5FKAC 3R2IA 1QVGA 1H4RA 3H3VC 3K5MA 3ZNHB 1HFGA 1TY2A 2EYMA 4DR7L 1JMLA 3QAQA 3A8IE 3RNUA 2L1AA 1HZAA 1TR5A 1KABA 3H3VI 3UINB 3RCZA 3LX0A 3MWYW 4EQOA 3N6RA 1NSNS 2ES2A 3I4NB 3IAS1 5HHDG 4XZ4A 3X23A 1RTNA 2NZHA 1CTMA 2RHSB 3CC7A 2N7EA 4K6DA 1DD2A 4DR1Q 4JV5L 3ZRCA 1QOBA 2GBKA 2L3ZA 3M95A 3C46A 2KX3A 5C4XG 1ZKHA 5KNCA 5CV7A 3CMEA 1C8CA 3PGEA 1QNUA 1T6BX 1N33L 1ICFB 2DY7A 2B2WA 1MBYA 1K0SA 5FLXL 2VXWA 3KUPA 4CKCA 3PGZA 1TS5A 3CC2A 1CZGA 3KBGA 3UDFA 1XD3B 3V2TA 2LUEA 4KSLC 3T53B 4JI3Q 3GTQH 4XDCA 3ZJTA 3PUWA 4DK6C 5I2YA 2MNAA 3RYTA 4I6LB 1S3OA 1GKHA 1J5EL 2L55A 3KLSA 1TWFB 3PHXB 3GD7A 4X65L 1WVLA 3NVZA 2IX3A 1Z2MA 1D5ZC 2M00A 2DJGC 4KDLB 4B0EA 2NYZD 4F8MA 1VDZA 2UUAL 4EUTA 4ITKA 2BDNA 2OT2A 5C23A 1YN4A 2NBUA 3S1NB 2WDVB 3I4NH 2Z59B 1BBXC 1MD2D 1K50A 4DFAA 4HJ5A 2JZPA 3SU8X 2ALYB 4ZRZA 4NXNQ 1A15A 3L3OC 2M17A 1LTRD 1NBWA 3F8TA 4NW2A 4DN4M 5KNDA 5C4JH 2VUMH 2WP9B 4IUMB 4LCDE 3L9AX 5ELEA 3CQZH 3Q8CA 2K05A 4IUPA 4HCPB 2HHHL 1YQ4B 1A2UA 2HCIA 1ZKOA 5M3MH 2F3WA 1STAA 2JEBI 2HE7A 2J0JA 3LJ3A 2WS3B 1STEA 3HKZB 1SIFA 4JI7L 1GPXA 1SAPA 5H8YE 2NVYB 1SR3A 1X56A 3VH4B 4P75A 1YJIA 2L5TA 2AQ3B 4FA6A 5DCNA 4GZYC 4WAFA 2HJ1A 4L8JA 1WTXA 2K28A 3J7A5 4ZQ3A 1MJEA 5BYRA 2WB1E 3MAQA 2N9XA 1ESRA 4KGRA 4AQ7A 3SE0A 4ARCA 4S17A 1EQTA 1ZYRD 2F0JA 1N6ZA 2ZPYA 1NUCA 3J9CA 4AP4C 1BCPB 1Q5WB 2EYHA 4ANXA 4USAA 3J81L 1BXTA 1B70B 3S1NH 1OXXK 1NENB 2KDEB 3WALA 2G4SA 3EJIA 1ZYRC 3MXUA 1IPGA 2N9PC 3F2UA 3RNFC 4HSPA 3J80L 3OMCA 1WJ4A 4MJSB
chains in the Genus database with same CATH topology
4CHTB 1LTBD 3PV0A 4HRSA 3PO2B 1BOSA 5KEEA 4WURA 1H9JA 2F0UA 4XQJA 5JAVA 1QF6A 2L4NA 1XO3A 4JPSA 1KF6B 3ERQA 1XF5L 4A3FB 4A9AA 2JE6I 2KOLA 3IAM1 4OO1G 3QB3A 1SNDA 2EYOA 4WORA 4A3DB 4K5WA 1YNNC 4BS9A 1G6ZA 3P1MA 1UEAB 1FNWA 5I4DA 4A8XC 3VR5A 2K04A 1MGSA 2RDGA 1SYEA 3I91A 1FRDA 2QEJC 4ZRPA 2V4IB 2VB2X 3KWLA 3D6WA 1FR3A 4K5XA 4O1NA 4MH8A 1RDPD 2W54A 2F0MA 2XRQD 1UNSA 3NBIA 1UWXA 3RFZB 1N5WA 3RZOB 2A68D 3FAHA 4C80A 3S2HB 1RM6C 2CQAA 1EEFD 1PRTD 1I4QA 5KNBA 4X3KA 3J7AF 4N6EB 3AE6B 4ABNA 3I3CA 4UAIA 1CQVA 1F77A 1O80A 1N60A 5G3LD 3BK1A 1PRTC 4JBWA 2R6GA 2F0HA 4XTCS 1QOHA 4PMBA 1C9FA 3IAYA 1V97A 3VA7A 2Z1CA 1CA5A 3DEOA 3CU7A 4IALA 2K5QA 3P63A 3U7ZA 3PUXA 2OHFA 4A3BB 1SNQA 1FXAA 1L0XB 4YTMB 5C3XA 1XLNA 2MHVA 5FO7B 5C0XI 2H4OA 1EQVA 3P4QB 2AX5A 2PQEA 1IKLA 1JOOA 4US9A 3ZGZA 2ZW0A 3IT6B 4I65A 5FO8B 1LT3D 2WNMA 5NUCA 4IFDG 3I8ZA 1EM7A 3DHQA 4KI0A 2FHTA 2Y0SB 2RKSA 1ILQA 4A3GB 2K3UA 2BW2A 1EY0A 2XWJB 2YU9B 5T8IA 2NWGA 3GTJB 3A55A 3GB1A 1OO9B 5JEAH 3NP8A 3EGRA 1RFKA 3AEEB 1BDOA 1GXDC 1EWHA 2O2LD 2CJOA 1HPCA 3HRZC 1IW7C 2I46A 3HGBA 2EZVA 1Q12A 3K5OA 2LHDA 2LGIA 2Y5PA 5C0XJ 1SYDA 3AV8A 3GTOB 3WDNA 3CRLC 5CV5A 3U4EG 2JA5B 3RZDB 1QQRA 2A6ED 3VR4A 1WD0A 2LFIA 2ZXRA 1A3TA 4C1NK 1M4VA 2RBMA 4ZKBB 2VZKD 3SDZA 2IGDA 1NR2A 2A6EC 3D31A 3L7ZC 2NZ1D 2KHSA 3TP5A 2IW3A 3SR6A 2FFKB 1F2RC 2IPKD 2RA4A 1Q10A 1CT1D 3TSSA 2KVMA 4YSZB 3K58A 1F2RI 4KK7A 5K5PA 4R8NA 3NQTA 3D4WA 4NP5A 2HDEA 4ZK9B 1ET9A 2G1EA 1PDQA 3A8KE 2CHBD 4J3OD 2MJ8A 3AEAB 3IKJA 3RMHA 3URYA 3MA2B 1KTKA 5IGDA 3GTMB 2VZKB 3N52A 2K6AA 4EGVA 3BG3A 5EBCA 4U673 4TQUS 2K01A 1K8MA 2JYEA 1AN8A 3VA5A 1DM0B 1LO5D 5IODA 1RCVD 4MN3A 4M8AA 2XSCA 1NVID 1SYBA 4C3IG 1TYGB 4HN7A 3AB5A 1OQRA 3MFYA 3GTGB 1C78A 2Y5CA 1HQMC 3AEFB 4FYDA 2EKIA 2INNE 3H0GB 3PUZA 3I4LA 1SJHD 1UAPA 2RDHA 2M19A 5I2XA 3K59A 4WWMA 3TZUA 3K57A 2K5PA 5MPOA 3TUOA 2X6LA 1JICA 1B9MA 3PIO3 5A2QL 2R7ZB 5JPNC 4A3EB 4NJCA 3H91A 2E2IB 4JE3B 1ACCA 5C3WA 2B2VC 3AE3B 5BYQA 2JSOA 4EVOA 2EY5A 3C1EA 1AFPA 1JOQA 4B9XA 4YSXB 4K5VA 4ODGA 1BNZA 5EE0A 1R4QB 1QE6A 1U4LA 5JPMC 2LEKA 1TWCB 2LFNA 2PMVA 4YTNB 3W2DA 4OZAA 1E2WA 1FNUA 4LK1C 3S1MB 2KDMA 1MI2A 1ZUD2 4A55A 2O4XA 1DXMA 2RPVA 3P7JA 3KLSX 3JAME 3NXWA 1HA6A 1JCKB 1GAQB 3RD4A 1D5MC 1V1PA 4KKTA 3S17B 4XDDA 5C2TB 1YQ3B 3ZJUA 1LABA 4JWSC 2LUMA 3BVGA 4F87A 1N63A 4KKIA 1ESFA 1PUTA 1TKEA 5I6YA 1YNJC 2MJEA 1BQQT 1AYFA 4RGNA 4CGYB 1UGJA 2Z4HA 1C4PA 4KJOA 1CHPD 2EYLA 1J9OA 1BMLC 5T1GA 3ZQ4A 4R9WA 1G291 2XIWA 3MHZA 5J39A 2B76B 4H2AA 4X3SA 3HP3A 1Y1WB 2B2YC 2F0GA 4IFDI 1GHKA 2F0WA 4A3JB 1XCQL 4YXDB 4KY7A 3FILB 1UWMA 1ZXIA 1F9PA 2JYTA 2EXZA 4KX6B 1E0ZA 1RTOA 2WXIA 1EU3A 2Q8RE 1S4ZA 1VDVA 4BBSB 3SHLA 5CGKA 1D6EC 4IURA 2V0GA 4RHSA 4ILWA 2KN4A 2G9DA 5JEAG 2DBYA 3G7LA 5M5YB 1FXIA 4ZKCB 4Q2JA 2WB1B 3KK7A 1JOKA 1E9MA 2B8GA 1WTQA 5COYA 1NI3A 2EJFC 3LNNA 3NUCA 2B2TC 3AM9A 4X3UA 2WDRB 4IFDJ 3U9SA 1DOXA 1T5XD 1GB1A 2QDBA 4ME5A 5HG2A 1VF5C 5EKLA 2Z4IA 1PTOH 1B9RA 1FCLA 1OFFA 2ICIA 1OXTA 4L63B 1VLBA 1X3QA 1LT4D 4B08A 1D5XC 5CBEE 3Q8EA 4A3IB 4MIUA 1VMPA 3GS2A 4Y7NB 1EIHA 4FXGC 1ZP0B 1GHJA 2D62A 1F2ZA 4YT0B 3TDQA 2WV6D 3TEYA 4OL7A 1C4AA 1NR4A 1WTRA 5D65A 2Q8TA 3OIPA 3FVQA 1A3UA 4DXGA 3NZ3A 5CC4A 2OF1A 5DNFA 1EOTA 4HEDA 2E3TA 4M0WA 4TKOB 4KGTA 3DM1A 3W9CB 2ID0A 4TQ0A 5LL6X 3EA6A 1DJRD 1TS4A 4RWSC 1B4OA 1IGDA 3AE5B 4C2MB 1ZEQX 3BK2A 3Q69A 2NVQB 5HFYA 3DWAA 3V96A 4F88A 2O5JC 2KEDA 4FXKC 2K5DA 3H6MA 2WU5B 5EQ0A 5JVG3 1EWCA 3FKIB 1KDAA 1KDCA 1S5DD 4TMAB 4IUQA 4NZLB 4KD3A 3HOUB 5JOBA 2LY7A 3MXPA 1ENAA 3BIID 1UUPA 1A2TA 5E3FA 4WIPA 4RA8A 4XYOA 1NAPA 1Y56A 4ZRQA 1GOZA 1Z6HA 4KTAA 2PNRC 2HCCA 1QOGA 2NUCA 5EE1A 2JXTA 1C4QA 3A8JE 2GI9A 1L0VB 3P75A 2KMMA 2QIEB 1VCIA 4KY6A 4KN4C 1Q90A 2KJXA 4R3DA 1WCMB 3R2TA 1O7LA 3I72A 4IDIA 1DGJA 5C4ZA 1TWAB 3FILA 4C56C 2MJ3A 3AE1B 3FMCA 2FE8A 1BCPC 3VRBB 4ULLA 1PZJD 2M0AA 1LTTD 1CFMA 1YMHE 1SNOA 4TSSA 5CBAE 3T3NA 2J0TD 3UI2A 4DU9A 4WQMA 2EPBA 2BDOA 3DWPA 4C3JB 1LT5D 1J8IA 1VR9A 2PW9A 1SXTA 4YWGG 4DQOC 2K7VA 4S3SA 4CQNA 1QLBB 1Q1BA 1VRAB 2WXFA 3D8GA 2B39A 1OQQA 1YNND 2YEPF 1W6JA 1JWAD 3TP8A 2MGSA 3Q8FA 3W5UB 3NTIA 1STNA 3SK5A 2Z8LA 4L1BA 4RKBA 5E6JA 4XQQA 3MEHA 1SYGA 3VR6A 4L6TB 3E56A 1FD7D 4XT3B 2WDQB 1XXGA 5GXGB 5JXVA 2WU2B 4IQZA 2JEAI 3P1HA 5IGEA 1J7AA 2O5IC 4RCOA 5CV9A 1RF2D 4HSVA 4RNAA 1FNVA 1SSOA 4H44C 1EEID 1I4HA 2DNCA 3FPUB 2RQXA 2JX5A 2AUJD 4OIKA 3Q6SA 4RCNA 2MPMA 2K9XA 2EYPA 4KHZA 3I73A 3TEZA 2A5HA 2NVTB 4IUTA 2BTEA 2HUGA 3J7AV 2WINB 1FRRA 2NVXB 5I6WA 1ROEA 4CJ2C 1A70A 4ZUJA 4C3HB 1JWUD 3A54A 1PXUA 2V4DA 1F2LA 2NN6H 4B9WA 4PMWA 2E74C 1CK1A 3S1QB 2D2CC 2K03A 1O7YA 2PO4A 4RAUC 2RSNA 4REZA 5D3IB 3N9YC 2K5WA 2F0TA 5EPLA 4BA2I 5C4HA 2OEDA 4BA1I 3Q24A 1QJOA 1U4PA 4CJ1B 2IX1A 3PO0A 1FIQA 1KLGD 1KNAA 2QMTA 2VNUD 2M2LA 2AWOA 1HUNA 1WYGA 3CWIA 4DAPA 4PNYA 1LLRD 3HVZA 3PZ8A 2L32A 2GA4B 1PRTB 1TIID 1ZDVA 5HURA 1ONLA 4AS1A 3AE2B 2KA7A 1TS3A 4MT5A 4GLSC 1P7EA 1XEEA 1PYWD 3BYTB 4I7ZC 3VR2A 4P16A 2X6GA 1XLPA 4BY1B 1DOYA 5JEAJ 1TKWB 4LLGM 2WXOA 3IFDA 3S2DB 4RGMA 1IW7D 2BE5D 4XE0A 3MC0B 1E2ZA 1ZPSA 4EQNA 5DAUA 4LK0M 1G8ZD 1S5BD 5E4XA 3AH7A 1IYVA 2L52A 2BE5C 1H9SB 1V8CA 5K36H 5EPKA 1J7CA 1VJKA 5AUIA 4XXEA 5G5GA 3BVZA 4NKLA 1NYRA 1U4MA 3NQIA 1IBXA 4ZLTF 1XYIA 4G7ZC 3MJ5A 4A3MB 1JQYD 4YIJA 2J53A 4HAEA 2KUMA 4G4KA 2ZXOA 3DWGC 4RHRA 1AEXA 5BMIA 1L0YB 3AE9B 1KH0A 3NK9A 3M4YA 4P2CB 4DAYA 1V1PB 4WJWA 1F9QA 2MUYA 3ABVB 3NTKA 3K0YA 4N9TA 4DF7A 3U2SC 3K7AB 3KF8A 1GUGA 4V0BA 2MH7A 3I90A 5EPJA 2RVLA 2KAJA 4D2KA 1U4RA 2F0QA 4Q5VA 2B2UC 1XLOA 2LJIA 1V1OA 2DY8A 1ENFA 1SMYD 1BCPF 4RH6A 2NTTA 2Q5WD 3GQBA 3JAML 3S14B 5C44B 1SMYC 3NE5B 1HQRD 1EYDA 4WH4A 4RF1A 3V3XA 2ZT9C 2WXQA 1Y69U 3T13A 4OIJA 4KV6A 3T3OA 1K83B 3OHXC 1I7HA 1I4GA 3DWQA 1L4ZB 2H88B 2GB1A 4K2KA 1Q3LA 3AEDB 2GRIA 1FD6A 3VQIA 1VZ6A 1EWYC 2QJLA 1K52A 1E7PB 1ENCA 1VMCA 1PGXA 1LT6D 2G9HD 2WXHA 1GUTA 1H9KA 4P6VF 1OXVA 2A6HC 1RKNA 1B3AA 2IWHA 5M5WB 3EROA 1DOKA 1AWDA 1LTSD 2W3RA 2AUKA 1PFDA 3TN2A 1CI3M 2JA7B 4C1NI 2R61A 4GDLB 1Q1EA 2K0PA 3L4PA 2VB3X 2EYFA 3GO5A 2NB0A 1IYUA 5T1IA 3QIAA 2D9UA 2L83A 3TMEA 2K22A 2F4IA 1EY5A 1I50B 2ICEC 2PPBC 1STYA 5HGTA 5C5MA 4OO1I 4B0MA 5I9OA 1STBA 1JR0D 1O78A 4N9PA 4DA2A 1JQ4A 1MHXA 3Q23A 1HRJA 2PZUA 1N62A 3M85A 3AECB 1DZ1A 4US8A 5F2DA 1PFMA 1D2BA 4HJGE 2WP8J 2CW0C 5I9PA 5ISRA 1P7FA 2HTME 1QNKA 1TVXA 3OIQA 1QG7A 4KGSA 3E5SA 2BBCA 1L4DB 1QKZA 3LB8C 4A90A 1RHPA 3HZXA 1WTPA 1L6UA 2DLBA 4IUNA 4O42A 4RGOS 3GTPB 2WXJA 2N88A 3MZ5A 3P42A 1B44D 1H9SA 2DWQA 4HEA1 5KRUA 1PFBA 4UDUC 1Y8PB 4A3KB 1KRHA 4C3JG 1M8AA 5IT9E 4L2YA 4K8JA 2DYOA 2BOSA 2N55A 3D3RA 5M3FB 3LXFA 1JROA 3QOLA 1LTAD 2TSSA 4PQXA 1I6VC 1LACA 2EJMA 1II3A 1FYCA 2B2WC 3S16B 1FCCC 1Z47A 2ZXPA 1SYCA 2EY6A 3GTLB 5ELBA 1JWBD 3R3OA 1SIJA 3I57A 2F0SA 5D14A 2LMCB 3AU7A 5EGTA 5ELCA 3S1RB 2R3ZA 2KECA 3NWTA 5EE9A 2NN6G 1HUMA 2INPE 3GV3A 1YNJD 1ML0D 3OMGA 3DMUA 5FOBB 1DOLA 2WXRA 4IOIE 4CBVA 1AZQA 2PLPA 4X3TA 3E6ZX 1GJXA 1SB3C 1A3VA 3W1SA 1MPEA 1C48A 4C7ZA 1EFID 5TSSA 2EE1A 2R93B 4ID6A 1W6KA 2BS4B 5JVH3 3EUB2 1WGKA 4TQ1A 3QJYA 1L6VA 3MXNA 1PTOC 2IT1A 3PIP3 1IUEA 3OWEB 4C3HG 3DUZA 4NMZA 3DEPA 2N9LA 1CQFA 2WXMA 3RPFC 1I3QB 2E6XA 5EJWA 1KNEA 3QG1A 4HROA 2Q8IB 5D3DA 1J7BA 1SYFA 3HOWB 1DOMA 5C5LA 2F1MA 4RFBA 2WXPA 1B2TA 2Y3AA 1STHA 1VZ8A 4OGQC 1B50A 1BF4A 3AMUA 1AZPA 1F0ZA 1NCVA 2XVSA 1B9NA 2D5GA 5IGGA 2J52A 1KDBA 4J8QA 5K36G 1A6XA 2JSVX 3S15B 3TZDA 2IGHA 5CORA 5IIFA 1V43A 2IL8A 1SFOB 2OXPA 1EY7A 5CMDA 2LHEA 3VYRA 1V8QA 4ARIA 5KYIA 2WIIB 1Y8OB 3ONAB 1PDXA 1H9MA 1C4CA 4MACA 1WRIA 3PUVA 3SEBA 5J22A 1E10A 1ZDXA 1BUIC 3ITPA 1VZ7A 1GUSA 4HR7B 5AUKA 3E9SA 2BA1A 3HS0C 2IJ0A 1I4RA 4XT1B 4OHJA 2L11A 4LTUA 1R7SA 5BMHA 4FP5D 2MJDA 3BDOA 2KWDA 3D6CA 4NDXA 3VR3A 2PIAA 2I2YA 3M7GA 3FRPB 3WOEA 1TZOA 1YN3A 3ZYYX 3OPOA 3GTQB 2KCNA 2OEOA 5CV4A 2B2VA 3SVMA 4QUCA 3HOVB 3BS1A 3I4MB 2XRSD 4XDXA 1VF7A 4LJZC 2QILA 2QKIC 2LMCA 1K8OA 3AE8B 3G6JB 3LWEA 1XLQA 3I9V1 4H0LC 4U68A 3H09A 2JWUA 2BS3B 3AE4B 1TU2B 5C4JB 2VUMB 5CYUA 1WTWA 3CQZB 1BUVT 5M3MB 3E0JA 4IKGA 3R8BA 5H92C 2FJ2A 3SK8A 3NVYA 4YTPB 3NUHB 2JXMB 4JK1C 1F9SA 4IN3A 3KBXA 4LMQD 4Q0FA 3W3AA 2WXNA 1KFYB 3EFXD 1WWTA 1ZXHA 2V3PA 1B1ZA 1SJED 4C3IB 4J1MA 1BCPD 2FMCA 3U9OA 1HXYD 1Y1VB 3IT4B 1Y8NB 5DM63 4QUFA 1DOIA 1S5FD 3B9JA 5BN4A 2TMPA 1TQOA 3GTKB 1LV9A 4HCEA 4HKZE 2RDFA 1JRPA 1HZ6A 3K5NA 4G57A 1EY6A 1PLFA 2F0OA 1TWHB 3FEWX 2EDGA 1SDFA 3OW7A 4N59A 4FF2A 2IDYA 2LKVA 3CIRB 3T56B 5HI1A 1IHZA 1QT9A 4ZYSA 2R92B 2B2YA 5E4WC 4AYBB 3QO2A 5FK9C 4LAAA 3P4RB 1IBXB 1I6HB 1CJEA 4IZ8A 3IXSA 5ELDA 1RD9D 2K32A 2F0IA 1WTVA 1DYQA 2FMMA 2ZW1A 1EIGA 3X3MA 3ETRA 1TT2A 2PYKA 1CZWA 3NSWA 2EVBA 2E75C 2NTSA 4XYQA 4KMUC 2N7JA 1LTID 3M7NA 2WKDA 2JA6B 2PTLA 3D4RA 1E6EB 2JP1A 2NN6I 2B2TA 2PKOA 1GB4A 2X69A 4WRDA 1WSPA 2SOBA 1PTOF 4K14A 3FPPA 1GUOA 2FUG1 2CVRA 2F0PA 4ZHOA 1TWGB 1O7ZA 5E1FA 1SSNA 3A56A 2BB5A 4HKQA 3W5VB 3TEXA 1AW7A 3BDCA 1RYJA 4CKBA 1JORA 4G7OC 5BN5A 1E2VA 1FGBD 4KHVA 1S5ED 4N58A 3DXJC 5KIXA 4RF0A 4QF4A 1EZ8A 5M5XB 2C5CA 1G2SA 1HCZA 5EE3A 1B53A 1T5EA 3WOFA 4Z9CB 4BWGB 5FLXE 1FMAD 2DN8A 1Z7TA 2AQ2B 4XWTA 2AQ1B 3ND9A 3HEJA 4QMGA 2WXKA 5BN3A 4FXDA 3NWSA 2WACA 5CR3A 2PVGC 1JW9D 3NPPA 1D1IA 2L1BA 3C3LA 3FDTA 3AN1A 3MXGA 5C3JB 2H1EA 4C7YA 2L9HA 1EY8A 4HCSA 1EZ6A 3U52E 3SXHA 5BYSA 2A68C 3R93A 3NRZA 3ND8A 2BB6A 4TRDA 2SDFA 1QCBD 1WTOA 3SK4A 4DNRB 4ZHPA 3VR9B 1BO0A 2SEBD 2KQ3A 4IUVA 1PGAA 1IGCA 4YSYB 2EELA 2K33A 1ZE3D 3HOYB 4G7HC 1PFNA 2HQEA 3BDLA 4K6LA 3SR1A 3TP6A 5KYLA 2W3SA 3WCQA 2I07B 1CA6A 3C2PA 3TEWA 2PW5A 2BS2B 3J81E 2EYJA 1K53A 1NYQA 3MVVA 3CKIB 2YYZA 2B63B 3O13A 1FO4A 3J80E 2PCFB 1FFUA 4EE2A 3HVDA 1C79A 2ENBA 4ZAIA 1FM0D 3T4AC 1HFNA 2K1BA 4MHEA 2B8FA 5LL6S 3OSOA 4PV1C 4DAVA 2EY2A 1QOAA 1SNCA 1C77A 4FF3A 2ON8A 4GDKB 2HDMA 1EY9A 1SBBB 1TKGA 3C1FA 1KAAA 1JALA 2F0KA 2J4XA 4CKEA 5DEHA 1F2YA 1C76A 3GV6A 1F9RA 1CZPA 1TS2A 4JX1C 3Q0AA 4OZBA 2QCPX 3VYUA 1SE2A 1MSHA 1PMRA 2J42A 1X32A 3HUIA 2PMZB 4PMCA 1I4XA 5EKIA 5DM73 4FF1A 3SFEB 3M4OB 5C0XH 2SNSA 4XQNA 1BR9A 2A69D 2CU3A 1DONA 3Q8BA 1IL8A 5IT9L 4A93B 1WXQA 1N5XA 4HMIA 2A69C 3LWUA 4HMJA 2BCOA 4EQPA 5C4XB 1TKYA 3MTSA 3PMFA 2L12A 2F0LA 3C8YA 4OVZA 1MI0A 4H7BA 4MM3B 1HTPA 2CJNA 3NS1A 2F0NA 2AWNA 3TP7A 1ET6A 2KEEA 1OXSC 1F2MA 2NBFA 4XIGS 1TY0A 2SNMA 3UI3A 1H9RA 4QCLA 3AEBB 5LNK1 3Q8AA 3BZDB 3A7LA 3KWVA 2XN9C 1JC7A 2A6HD 3AMZA 2EY1A 1G2TA 1Q8IA 2F0EA 3SFDB 1STGA 5IGCA 4OZCA 1RWSA 4FXCA 3GP7A 3VRAB 5D7GA 1MHHE 1ZOYB 5IOCA 2H89B 2M56B 2PZWA 2RSOA 1N61A 2IX0A 1I4PA 4PT5A 5CV8A 3K6OA 1HHVA 1R4PB 3RLFA 3NHHA 1HA5A 2E76C 3B2GA 2FINB 1K51A 1RJTA 1SE4A 4DNTB 2SAKA 3MFGA 1EU4A 5ELFA 4QB4A 2PZTA 2WQYB 1XX8A 3CRKC 3NTHA 1D1KA 4V190 3OOCA 4KD4A 1TJEA 2QSDA 2F3VA 1KLUD 2CW0D 1S5CD 3Q22A 2MEKA 4QIWB 5BMGA 3M3YB 1JB3A 4BBRB 1DCZA 2EOTA 1EYAA 4FNFA 2JA8B 2D5DA 5C3EB 1R9TB 2BYTA 2IGGA 1L5PA 3I70A 4KKUA 1GUNA 4R8IA 1SE3A 1HEZE 3BYYB 2X38A 4L23A 2I38A 4DGZA 2XWBB 1JWSD 1ICWA 5G5HA 3EVQA 1GUWA 5IGBA 3TBIB 3P4SB 3MP9A 1EYCA 5AFWA 1QB5D 2ONQA 3IL8A 2E2JB 3T51B 1IKMA 4OW0A 2WKCA 4KKJA 1FEHA 3NBHA 2E2DC 1PRTF 1XCTL 5KGUA 2QF7A 5LHY1 2BA0A 1FFVA 5FO9B 5G3LF 1XTCD 3PO3B 4OO1H 4CJ0B 2C9OA 3S9WA 1T3QA 2F03A 1HTLD 1SNMA 2L0CA 2JU6X 2W82A 2DYMA 3P4PB 1SNPA 1QOFA 2HDLA 2KACA 1MSGA 4F7XA 4XWWA 3K5LA 1PTOD 1PZID 4K2LA 5C6AA 3HOXB 3X3NA 3AEGB 2M9VA 4DK0A 4KJNA 4RGTA 3VR8B 1ILPA 2JQRB 1CHQD 5FR3A 4DXFA 3HOZB 2NMQA 1EY4A 4M1UB 2BT6A 2WXLA 2F0VA 3HG9A 2YEPB 1XWEA 2N9KA 4K8IA 3RUZA 4RKLA 2B2UA 3IFTA 1HZ5A 3V05A 1QWYA 2ACZB 1U9RA 3PZ7A 5IGFA 3DWMA 3MHBA 1JE4A 1D4BA 2W55A 3PUYA 3HRDD 1NEKB 1PTOB 2RMMA 2V3NA 3B2FA 1LTGD 2F0DA 1RODA 2J7ZA 3NVVA 4NAWB 1X3PA 2E2HB 1EL0A 1CM9A 2WAQB 3VYSA 3AE7B 5CV6A 2JYOA 1YJJA 5A2QE 4FVMA 5A35A 3OWFA 2PVOD 3P20A 4BY7B 5J1ZA 5EBDA 5EKKA 2MP1A 4A6QA 2DNEA 3H94A 4JWUC 3D4DA 3J7YW 3NVWA 4ZUIA 1ZXTA 2N0SB 1YN5A 3FC4A 2KQ4X 3BVMA 5C0XG 2EJGC 1G91A 3CHBD 3A7AB 3LYYA 2F0FA 3QWNA 2WXGA 4IFDH 2A73B 1AP0A 3BWUD 1MVKA 1PZKD 4KY5A 4KN7C 2XNAC 2PW7A 4DK1A 4KKSA 1E0BA 3ZJVA 3QOJA 4E6IA 4H13C 1SF0A 3T16A 3KLRA 3SK6A 3VYTA 4FF4A 2KCCA 3AB9A 3KQ4A 4ZOHC 1WD1A 3EQLC 4J6HA 2LS01 5JJZA 1QILA 1JWMD 4IUUA 4NAMA 5M9OA 4HTHA 4WFN3 4FO2A 2WLBA 1OXUA 2FBWB 2A74C 1YNTE 1SEBD 1PGBA 3H8HA 5FKAC 3R2IA 3H3VC 3K5MA 1HFGA 1TY2A 2EYMA 1JMLA 3A8IE 2L1AA 1TR5A 1KABA 3LX0A 3MWYW 4EQOA 3N6RA 1NSNS 3I4NB 3IAS1 5HHDG 1RTNA 1CTMA 4K6DA 1DD2A 1QOBA 3C46A 5KNCA 5CV7A 1C8CA 1QNUA 1T6BX 2DY7A 2B2WA 1MBYA 5FLXL 2VXWA 3KUPA 4CKCA 1TS5A 1CZGA 3KBGA 3V2TA 4XDCA 3T53B 3ZJTA 3PUWA 5I2YA 2L55A 3KLSA 1TWFB 3GD7A 1WVLA 3NVZA 2IX3A 1D5ZC 2M00A 4B0EA 2NYZD 4F8MA 1VDZA 4ITKA 2BDNA