1I4GA

Crystal structure of staphylococcal enterotoxin a mutant h187a with reduced zn2+ affinity
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
224
structure length
224
Chain Sequence
KDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFATSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords ENTEROTOXIN TYPE A
publication title Cooperative zinc binding in a staphylococcal enterotoxin A mutant mimics the SEA-MHC class II interaction
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 64
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4gA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4gA02
3EA6A 3SEBA 1EEID 1LTID 1LT6D 5D3DA 1YN3A 5D3IB 1HA5A 4Z9CB 2AQ3B 1EEFD 1CT1D 1B1ZA 1PRTC 1SEBD 1FGBD 3O13A 4OHJA 1MD2D 1EFID 1TS4A 1PZJD 1D5ZC 3V05A 1TS3A 3DWPA 1TS5A 2QILA 3MFGA 3CHBD 1DJRD 1EU3A 3EFXD 1I4GA 4L6TB 5ELCA 4O1NA 1UUPA 1V1PB 1L0XB 1RD9D 4TSSA 1STEA 1PTOB 5FKAC 4RGOS 1RDPD 5ELBA 3BZDB 4RGNA 1EU4A 1JCKB 1UNSA 5ELDA 1YN4A 1PTOC 1T5XD 1AN8A 1JR0D 1YN5A 4RGMA 5ELEA 3OWEB 4RFBA 1BCPC 4RH6A 4C56C 1PRTB 1XTCD 2AQ2B 1LO5D 1CHQD 1XXGA 3R8BA 2XNAC 1S5BD 3KLSX 3TSSA 1ENFA 4ZYSA 1LT4D 1S5FD 2O2LD 2RDHA 3DWAA 1LT5D 5I4DA 1SE4A 1LTTD 1BXTA 1CK1A 1EWCA 4DXGA 1CQVA 1RCVD 2WV6D 1TY2A 1B44D 1G8ZD 1SJED 1FNVA 5TSSA 1V1PA 4RHSA 1LTAD 1DYQA 5FK9C 1S5ED 2TSSA 1KLUD 3R2IA 1BCPB 2QEJC 1ET9A 2XRSD 1PTOH 4UDUC 2RDGA 1LTBD 2NTTA 1KTKA 4DXFA 1M4VA 1ET6A 1V1OA 4RCOA 4BWGB 3BYYB 2XN9C 1PZKD 1D5MC 2AQ1B 2XRQD 1PTOD 4RHRA 1SE3A 1TS2A 1RF2D 1LTSD 3BVGA 1BCPD 1LLRD 1LTRD 1TY0A 2CHBD 1QILA 1SJHD 1CHPD 1GOZA 1PRTD 4K6LA 3W2DA 1PZID 2SEBD 3MC0B 2IJ0A 1FNUA 2NTSA 1ESFA 1LTGD 2G9HD 1I4XA 1SE2A 3DWQA 4RGTA 1HQRD 1SXTA 3BYTB 1SBBB 1FD7D 2Z8LA 1I4RA 1S5DD 3URYA 1D5XC 1JQYD 1KLGD 1HXYD 3BVMA 1I4QA 1JWUD 1PTOF 2ICIA 5ELFA 1I4PA 1FNWA 1LT3D 2IPKD 1JWSD 2R61A 3BVZA 1PYWD 4NZLB 1BCPF 1S5CD 4L63B 1F77A 3R2TA 1JWMD 1I4HA 1PRTF 1D6EC 3GP7A 1HTLD 1AW7A 1L0YB 2J4XA
chains in the Genus database with same CATH superfamily
3RZDB 1GM5A 5D3DA 4HK2A 3UINB 2R7ZG 4DK1A 1N32L 1WR1A 3D32A 2FAZA 1XLOA 1SEBD 3CPWA 4LF4L 4LDTD 2YTVA 4BBRH 2EIFA 1I6VC 4A3BH 1E9MA 1YI2A 4FJZA 4GMVA 4A3FB 1CI3M 1D5ZC 5MPOA 2KHWB 5CX3A 1Y69U 4WJNA 1VF5C 3DBLI 1VQHA 2DHZA 2JX5A 3KW5B 1L5PA 2K25A 2MJEA 3D31A 4QB4A 5I9PA 2X38A 3N30A 4XT1B 1TT2A 1Y1VB 1N5XA 2BYEA 4DR3Q 4GN5A 1PTOB 4XWTA 4CDCC 4U673 1ZXHA 2JYTA 1DOIA 3U9OA 1XNQL 2PW9A 1YHQA 1CMXB 1RJTA 5IP7H 4KVGB 4DAVA 4HJKA 3NTKA 3S24A 1HNWQ 1P3QU 2LGYA 1OXUA 1F2RC 1CA5A 1WGYA 2Q8IB 3NS1A 2PZUA 1TXYA 3SK8A 1HTQA 2UUCQ 4BOSC 2L1AA 1SYDA 5C4XG 4CDDC 5IP9H 3UI2A 1OQRA 3VH4B 4PMBA 1XNRQ 3CSFA 2A6EC 4PZ7A 1CSQA 2NWGA 2RSUA 1GVPA 3GTJH 4HRSA 4MGZE 3M7NA 4DXGA 2AWTA 1WJNA 4G11A 3A5UA 2CQOA 4DV6Q 2DZIA 2L11A 4R8NA 4MDKE 4RMAA 1GJZA 4QGUA 4ILWA 1WF9A 4UY8C 4II3B 1N60A 3CQZB 4MJSB 2KCMA 3KYDD 1CA6A 2SOBA 2LWPA 4EEWA 3MTSA 5K36H 1TR5A 3WIMA 1RTOA 4B3TQ 2C5LC 4W9LA 1U4PA 3TP6A 2YTXA 3NWSA 3T16A 1N34Q 4JPBW 1JALA 1FRDA 2XN9C 4ZRJA 2QEXA 3FRPB 4KSKC 2AQ1B 5I6WA 2B2WA 1FM0D 1FD6A 4IW0A 4A93H 1GB4A 3ITPA 4DV4L 2H88B 4JI0Q 1XCTL 1G6ZA 3ABVB 3F2UA 1WZ0A 3H3VH 4A3GB 1BCPD 2KJRA 3S1MH 3FKIH 4DNTB 3AI5A 2PQEA 1SN8A 2K01A 1TIFA 1S72A 1P7EA 2YEPF 3HEJA 3S15B 2ZPYA 5LXHA 1PRTD 4C3IB 5M3MH 2Q2IA 2SEBD 4OL7A 4LF5L 3MC0B 1PDQA 3KJOA 3AECB 4C3HG 3T9LA 1WD0A 3PUYA 3ZDMC 2YLMA 2BDNA 3DWMA 1JJCB 2ZCBA 2RVLA 4CDFC 5CC4A 1OQQA 2EKIA 2R2QA 5T1IA 4GNXB 2XTIA 4JG2A 4HVBA 2K50A 3GOEA 2EXZA 2H1EA 4A3IB 2E2JB 1F2RI 4JI1L 2UUBL 1SNDA 3MXUA 1Q90A 3GE3C 4F88A 1AE3A 3E9HA 2K14A 3VFKA 1TQOA 4DR2Q 4JBKA 1EY5A 4DDID 3PF5A 4WJ3M 3NVZA 4FXKC 4RAUC 3PRZA 4RF1A 3R2TA 3M4QA 1PH1A 1EWHA 4AH6A 5BR8L 1QJOA 3H7SA 2LJ5A 2NPTB 1L0YB 1MG8A 3ZLZA 1CZGA 1EEID 1KRTA 4L2YA 1K8MA 4GS3A 1V43A 2JRIB 1XLQA 3R7QA 1GNUA 5J2RA 3P4RB 1S3OA 1CT1D 3BWUD 1OFFA 3PIPA 4K5WA 2JA5G 3HOVG 3A8JE 3Q8FA 3W3AA 1E1TA 2E5LL 3PSIA 1B50A 1XMQQ 3C3LA 2VRRB 3DWPA 2MO1A 3MHSD 3VVWB 4O42A 1IBXA 3TP5A 1YEZA 2OT2A 3KDFB 1WCMB 3GDEA 4DV7L 1G2TA 2UU9L 2M8SA 1IKLA 3AEEB 2Q5WD 1Q1OA 3N1ZC 3RNGC 4OEMB 3TBLD 1IP9A 1SYFA 2GVBA 2NN6H 4KK7A 4GLSC 1ISNA 3LB8C 3N6RA 1B9MA 3MEFA 3OW2A 4B0EA 3AE8B 4IOIE 5D65A 5FJ8G 1ZE3D 2K6QA 1JW9D 1RWSA 2F3VA 2A5UA 1PRTB 3GTQB 4KN4C 1VR9A 2PPHA 4C3JG 1O78A 1U4LA 2INNE 2O2VB 3NP8A 4M0WA 4IUQA 1PQSA 4R4TA 1Y1WH 3Q8CA 1EQRA 2R7DA 2KXJA 2ZNVC 4J1MA 5EKKA 2QHOA 2GI9A 4K7SA 1D3ZA 3ZNZB 4I6NB 5T1GA 3S2HH 4GOPB 4L5QA 1GC7A 1WTQA 3T51B 3N3KB 5I4DA 3JW0X 3T56B 3U4EG 3L7ZC 1F1HA 2KWUB 1BMLC 3M7GA 2J0KA 4W9CA 2Z0DB 4IDIA 5EGTA 3B9JA 4Y7NH 1XD3B 2M56B 4GXBA 1JOKA 5LL6S 3KUCB 2TSSA 5GQOA 1WM3A 1VQCA 2JT4B 3CCRA 3HKSA 2KJXA 2DYMA 4DV5L 1GO3E 2NVTB 1NVID 1XLNA 4CHTB 4KD3A 4EZJA 2BDOA 4P72A 4NXML 1PZKD 1F2LA 4BA2I 1WRIA 2L7RA 2XBBC 4PS8A 5AUIA 1SMYD 2NUCA 4P1BC 1IPGA 5C5MA 2BBCA 4RHRA 1BBXC 2EJFC 3FHWA 3H7PB 4GOCA 3W9CB 1SE3A 2BH8A 1L6UA 1I5FA 3GV3A 1QOGA 2WS3B 2KYWA 3IVFA 4XX5A 3GV6A 2J42A 2EZVA 2EYJA 3H9DA 5IGGA 1OTRB 1I4XA 2QGQA 4GSWA 3CW2C 1HR0L 1NI3A 4HMJA 3ZRCA 1QUQA 3PO3H 4ZHPA 1ACCA 1SNPA 1EY7A 2N7JA 2IY1B 2GVAA 1D5XC 1UEBA 4XTCS 1WYGA 1KLGD 4KKIA 4KSLC 5HFYA 5C44G 4C2MH 2BKFA 4LUVA 2V4IB 1YNXA 1ICWA 3PIP3 2RCNA 1FNWA 1LT3D 2CU3A 4TQ0A 1VQPA 3LJ3A 3NJTA 3U7ZA 1I3QH 1RFAA 1EY4A 2RPVA 1M8AA 4DF7A 2V4DA 5C0XI 3WALA 1QG7A 5J39A 4NQLB 1BKBA 1E24A 4OO1I 1QVGA 2UUAQ 3S14H 5EDSA 1ZDXA 1F9PA 1A15A 2NZ1D 4I65A 1VDVA 3TQYA 3PGZA 2KQSA 1Q7YC 1C7YA 2LY7A 3TEWA 3PRPB 4AS1A 2CJNA 3HM6X 4X66L 2WP9B 4UP9A 1E2VA 1IXRA 2XVSA 3I4MB 1XF5L 1B1ZA 3MXGA 4HIKA 3MVVA 3SHQA 4CQNA 2F0IA 2A6HC 4DKAC 1TS4A 2HD3A 1I7HA 4YWMA 2WFWA 5E7NA 4HPLB 3V05A 3H1UA 3LWEA 2MA9B 4AJWA 2BYFA 2N9XA 5EE9A 3A9JA 5JJIA 1DJRD 3HG9A 4IM3A 3EFXD 1I4GA 1WE7A 2KDFB 2PI2A 4QY7A 4O1NA 3N9YC 1HZ9A 1UZXB 4F8MA 4FHKA 4IOAA 3A56A 4HIDA 4HJ9A 3ZNHB 4C1NI 1IKMA 2VUMH 3HOUB 1JORA 2FMMA 1PVOA 1N62A 1T5XD 1WM2A 1K8AC 3UE1A 1AN8A 1IGCA 2Y5BB 2E8GA 3MHBA 1P1AA 4PZ6A 4LK0M 4RH6A 3NG0A 3OTOQ 5EE1A 2Z0SA 4B08A 1LYLA 4UP8A 2KEEA 1ENFA 1JC7A 1G6PA 4A3DH 2KX3A 2KCCA 1TKEA 2PPBC 2OHFA 4JI3L 1MPEA 1S5FD 1GUSA 1YNND 4EX5A 2YTYA 2WXLA 1JOQA 3ZVVA 1LT5D 2B2YA 1X3GA 1CK1A 1N5WA 1EWCA 1STAA 1D8LA 2R7FA 4MGIE 4OVUA 3PUWA 4XYOA 2ICEC 1GUNA 2Z6BA 3K7AH 1W2BA 1UBQA 1WXMA 2WXMA 1WGDA 3GTKH 2X69A 1B53A 2F0SA 2D3GA 3CC2A 2IGHA 2K22A 4OWTB 2WU2B 3GZNI 4NAMA 3NEMA 4BKGA 4GKKL 2D5DA 4YCWA 2DUDA 1PH3A 4DUYL 1IL8A 3VR8B 4YWKA 2NVYH 5C3WA 4MH0E 3BU2A 4BY1H 5KRUA 4LFAQ 2KQ7A 2HHHL 2LHDA 2FE8A 2KWCA 2BS3B 1VDZA 1XYIA 1N61A 2NVUI 3PGEA 4GZYC 1OEYA 1XLPA 1QILA 3DBRI 3Q24A 2EDGA 2K4KA 1J7CA 4LJPB 5G5HA 3HGBA 1EWYC 1RFKA 3DOWA 3VR4A 1FEHA 3AULA 5C5LA 3NELA 3QOLA 1IBLQ 4K0KQ 1E7ZA 4TUUA 2IHFA 4HJ8A 1B8AA 4H02A 1LXDA 3RNCC 1AE2A 3BYTB 2BA1A 2FIFA 3D4DA 2R2OA 1IYFA 2YV5A 2FJ2A 3HOYH 1JB3A 2KWVB 1EF5A 1GC6A 3I57A 2ICIA 5ELFA 3D3RA 1CTMA 3G71A 3GTGB 1YNJD 1YJ1A 2K5VA 2M00A 1AZPA 4DV0L 1E1OA 3C1EA 2OJWA 4ZRIA 1FO4A 1FFVA 2R92B 4YXDB 1DOXA 3ER0A 3I4OA 4KD4A 2DNFA 5AEKB 4YSZB 2I5HA 1Q82C 1BUVT 2C7HA 1TVXA 3L9AX 1SROA 3DUZA 4A3EG 2KVRA 1TWAH 5A35A 2YEPB 3TEHB 1HA5A 3RNEC 4FN2A 1I35A 2JA8G 3MXNB 2OOBB 3DVNV 3RUZA 4A3LH 2QDBA 3F2DA 2FUG1 3WA0A 4HIOA 3AMUA 1TS5A 1V49A 3ONAB 4DR1Q 2K32A 5IY0A 4DK0A 4DR5L 1V1PB 2MBHA 4ZKBB 2R7ZB 3A9KB 2F0HA 4JE3B 2CVRA 4OX9L 4PMWA 1HZBA 2CR5A 2KFKB 3CP0A 3SFEB 4RGNA 5ELDA 3WAOA 2KNBA 1VMCA 2KDEB 3FILB 2RDFA 3J7YW 2LASA 2Q2UA 3DVNU 2RHSB 3Q2AC 1FIQA 3HRDD 1K28A 2Z4IA 3ICEA 1P98A 2F0OA 5M5YH 2MSED 1JQ4A 5M3FG 2FFKB 3AYHB 5J1ZA 3H15A 2CW0C 1WD1A 2F0EA 1AWDA 2B2WC 4EFOA 4ZYSA 1YQ3B 3T8MA 2L83A 4ABNA 3H3VC 5ELOA 3CCVA 3DWAA 1JJGA 3I9V1 1SAPA 2V0GA 5GAGC 1JWAD 2FCSA 1D4BA 2A69C 2E6XA 2JU6X 2A73B 4JI6Q 5GAEC 3P42A 4II2B 2W3SA 1E0ZA 3CPFA 1SJED 5GMVA 4JOIA 3T1YQ 2A4ZA 2G4SA 1OXVA 3CXCA 1JWBD 4YY3Q 3J80c 4OZBA 4GKJQ 1CKMA 3RZOB 2BE5D 2CHXA 5DNFA 1WE6A 3HFZB 5C4XB 4RCNA 1LABA 4KHPQ 2JWUA 1VQ9A 1ZGUB 4RCOA 3D0FA 5IGBA 1X3QA 3CQZH 2VNUD 1TWHB 4DGZA 1AFPA 1O7IA 2WKDA 3D6CA 5EPLA 4CKCA 1CUKA 4DR4L 4FJVB 4A8XC 4MNOA 3P20A 1ENAA 1MFWA 3B08A 3MA2B 2DGYA 4ANVA 3S1RB 1T6BX 2L3ZA 1CKNB 1TS2A 2KEDA 4K2LA 1SYCA 4W9DA 4B3SL 2KMAA 1WGRA 2J0JA 4JI5L 1B9RA 3AB9A 1P9DU 2VZKD 3KLSA 2WGSA 3C0RB 3W1SA 1SYGA 4IUNA 4A3GH 5D2MB 1PFNA 4X3UA 4AJYB 5CV7A 1FNUA 3S15H 2LI5A 4C3IH 3NBHA 1HEZE 4JGHB 2KAJA 4IWPA 1TWFH 4B9XA 1ZKOA 2LS01 1PLFA 2EOTA 3J7ZC 5JHBA 4KKTA 5BN3A 3QWNA 4NJCA 2RMMA 4KN7C 1N6ZA 2RD0A 4E3CA 1GKHA 1ZEQX 2NZOA 2QDLA 3H3VI 4QAYA 1A6XA 1UGMA 3K59A 4C3HB 1JWSD 2E2JH 3VRBB 3KH0A 3PCOB 3S17B 1JRUA 4M1UB 1KRHA 3BDCA 1IUEA 2QJLA 2B8FA 5C0XH 3I56A 1D6EC 5D6JB 3AEGB 1KHIA 4OO1H 2E74C 2CCZA 4DQOC 2N78A 2W55A 4ZRKA 3X3MA 5C3EH 1S1QB 4X57B 4XDDA 2OTLA 4R4OA 4TRDA 1PMRA 3GTOB 1SIJA 2KFJA 4HKZE 5BYRA 3HRZC 3APFA 5G5GA 4EOYA 3R3OA 1QT9A 4OGQC 4NQKE 1PZJD 2W3RA 3C1FA 4PG3A 3PO2H 4PYZA 2W54A 2QILA 1GB1A 1GPXA 4X64L 3KVFB 1WJ4A 3CWIA 1R4PB 1WJJA 4A3CH 1ASZA 3KDFA 3GE8C 2K6DB 3DCGA 5ELBA 1V1QA 4ID6A 1YJJA 2JA5B 2G45B 3HOVB 5GADC 4HXDA 5AJ3Q 3DVGY 4IPGA 1WTHA 1EOTA 1YN5A 1GD7A 3AXCA 4RGMA 1YHAA 2KMCA 4P16A 4DV3L 4A3JG 1YJWA 3X0WA 4DU9A 1V9JA 5IGFA 1VZ6A 4ZK9B 4JVZA 1EOVA 3NS8A 5M5XB 1E8WA 2PJHA 2MFIA 3GTQH 2Y5CA 1E22A 2JQOA 4MTKA 4JCVE 2IW3A 1K53A 2LUMA 1WJ6A 3AM9A 2DWQA 4FYDA 4JW0A 4G7OC 2WXRA 3AU5A 4GOPA 2VQEQ 2FNJB 1A2TA 1TY2A 4FA6A 5IOIA 2PYKA 4K7WA 4N9F4 3CCLA 1STBA 1IYJB 1SFOH 3B1LX 4F1SA 3G4SA 2RDGA 1AEXA 5IT9E 4EUTA 4O0AA 1UE6A 2XWBB 1NMFA 2PZWA 5LL6X 1DGJA 2IO0B 3H91A 3HZXA 4R8IA 1TIID 2I46A 4CKEA 3GTMH 4ZUIA 1VJKA 5BYQA 1VF7A 1D5MC 2K75A 2HCCA 4A3BG 5LHY1 1WI5A 1SRUA 5FO9B 3U58A 2NVTH 3DHIC 1HE8A 3OIPA 2N88A 2XK5B 3TP7A 4KV2A 3SDLC 4KY5A 1MJCA 1I6HH 5CYUA 2C7MB 2CQAA 1JB7A 2OJRA 2CHBD 2WDRB 3JSVB 2AL3A 4DAMA 4J15A 2INPE 1WFQA 2CKHB 4LK1C 3UQAA 3J7AF 3S2DH 2L8JA 1MSGA 3VUXA 4GN1A 4TQUS 1QZHA 3CAMA 2MUYA 4LF6L 2C9WB 2KJ6A 4MELA 1L0WA 4IJLA 2QKIC 2LXAA 3K80C 3K58A 3PLVA 4AQYQ 5DM73 4RGTA 3M4OB 2ON8A 2A6ED 4IALA 5IP7G 1AYFA 3E56A 1IBMQ 1ZYRC 4URKA 3URYA 3RZFA 3KF6A 5CR3A 5JJZA 2WXOA 3H0GG 3KJPA 5TR5A 1HXYD 2EYFA 2BS2B 3L16A 4EQNA 1IYVA 4B95A 3I4NH 4OVVA 5IP9G 5IN7A 1UWMA 3GTLH 2WDVB 3NQTA 4FLHA 1WX7A 4EKUA 3DM3A 1XMOL 2E2IB 2OQ0A 2Z9HA 4BY7G 3OYYA 3TRZA 1I4HA 4JI4Q 4YT0B 3DHGC 2C5CA 2GMIC 1Y8NB 4TKNA 1SIFA 1U9RA 4EGVA 2PQAB 1G291 3DM1A 1LTID 3M4PA 1ZXTA 4KKUA 1UE7A 2VQFL 3GTPB 4DV2Q 3PRMB 3L3OC 3A4RA 1XX8A 5BMHA 4OELB 4DK3C 2R92G 5K36G 1ILPA 1YJIA 2GBRA 2BF8B 2KN5A 4OHJA 2V3PA 3SD5A 3QX1A 3Q3JA 1VRAB 1TBEA 4J6IA 5H8YE 5KYLA 5IYBH 3ML8A 1XWEA 3OAWA 2GB1A 5EPJA 1Q86C 4POFA 1EYDA 1T3QA 1RRBA 2B2YC 3ZJVA 4ARIA 1N36L 2F4VQ 3W1GA 1DOMA 1AP0A 2HJ8A 5CBEE 3DBHI 2K28A 3L2PA 3VRAB 1STEA 4K6DA 2EXDA 3VR2A 4RGOS 3T1HQ 2FUHB 4ANUA 1EU4A 4KY7A 3CMAA 1KDAA 5M3MG 2JEBI 2GN5A 5M5WB 3TS0A 4JI2L 2ZW1A 1PH8A 4HCPB 1NY4A 1IBKQ 1I94Q 2AUKA 2AQ2B 2H4OA 4JV5L 1B3AA 5L83A 1TWGH 1NYRA 3A74A 4BBNC 3R3MA 2NBVB 2RKSA 2AWNA 3ERQA 4NJ7A 2MP2B 4AOFA 3VH3B 1P16A 1RYJA 1U4MA 4PT5A 1EY6A 1PFBA 4DHZB 1A0IA 1CSPA 4A3KH 1SE4A 5CV4A 2KLCA 3Q8AA 1ILQA 3D6WA 4WQMA 2O4XA 3VYSA 3CMEA 2F0NA 3BDLA 1FNVA 4HJGE 1WMHB 2O5IC 5IAAC 2LRUA 4YTNB 1WX9A 2M9VA 1QKZA 4MT5A 2K5WA 1O7YA 4KHZA 1E7PB 3HOZH 1WH3A 2QEJC 2XRSD 3PHWB 4UDUC 2KDBA 2HTME 4DNIA 1GUWA 2IO2B 3A33B 1KTKA 4KZCA 1M4VA 1ET6A 1TU2B 5JOBA 3M95A 4K5XA 5EKIA 1ZOYB 2SNSA 1C4PA 4FF2A 4YWLA 4DAYA 3QC8B 5LLIA 2M4NA 1HHVA 4JIOU 1YBYA 3RFZB 1R4NB 3GB1A 5BMGA 4NB3A 1BR9A 3G48A 3L13A 1KNAA 2IL8A 2V3NA 2Z0EB 5FLXc 1WXSA 3AE7B 1IYUA 1K83B 1EQTA 3ULJA 1OEYJ 1L2FA 3K7UC 4X6AH 1UBIA 2ZVOA 2NN6G 3KFUA 2LEKA 1PFDA 4IFDI 2OEOA 4NDXA 1CZPA 4IPHA 2K5NA 2L0TA 2NTSA 2ZCCA 4M02A 4S0RA 4MTNA 2UXBL 5E4XA 1U5KA 2K04A 2B76B 3AN1A 5JHAA 1VQAA 4YIJA 1RHPA 1ZPSA 5DCNA 1WGGA 1K3BC 2WIIB 1I4RA 5LMNL 3UDGA 1RL2A 1MVKA 2JXMB 3I70A 1MGSA 1UD7A 4WJ4A 2F03A 1JQYD 3PUXA 1Y1WG 4JC0A 1KOTA 3OMGA 1R4QB 4IUPA 3TBIB 4DHZE 5CTRC 2R61A 3VHTC 4LDTB 3NBIA 5HKHA 4DFAA 1KLVA 2X6LA 2M2LA 1X65A 5GAHC 3NHEB 1V9PA 1JMCA 4H2AA 4OXPA 4KIKB 4NXNL 2RDBC 1T0SC 3BINA 3Q3MC 4K7UA 2EYHA 1HTLD 4KKSA 3FKYA 1Z6HA 1WXQA 2ASBA 5FLMH 3ND8A 3J7A5 1NDDA 2QW7A 1YN3A 1C77A 2F0TA 1J8CA 4K8IA 1FCCC 3Q14C 3AFPA 2D62A 3M9BA 2BB6A 2DX5B 4AQ7A 2BTEA 3S1NB 2JE6I 2UXDL 4LF8Q 2JA6H 2CU1A 4FXCA 4EVOA 4XYQA 1KF6B 1C3TA 4MIUA 1YQ4B 2FBWB 4J3OD 4AYBE 2A8VA 3K0YA 1EU3A 3SVMA 1MHWC 4BZAA 1ENCA 4A3EB 2WAQE 2KO3A 3WCQA 4BBSH 1S3SG 4L23A 3TREA 1I42A 2JA8B 4JOIC 4RG1A 2PE9A 3Q22A 2R93G 2L4NA 3K8AA 4DR7Q 2AMCB 1HQMC 1LTLA 4UP7A 2YU9B 1JICA 1C4QA 4A75A 2KFKA 3AU4A 4DV1L 1Y8PB 2M17A 1E6EB 4GB9A 3RYTA 1SE9A 4HMIA 5G55A 3AB5A 2VS1A 3ERSX 4B3MQ 2B8GA 1UH6A 2ZM6Q 1V81A 5CHFA 4CYEA 1LUZA 1XPOA 2G1EA 3BK1A 3PO3G 1NYQA 3WAMA 2WXGA 3IKJA 2P5ZX 3QG1A 1STNA 2N9PC 3L10B 4CDEC 1X56A 2OCEA 2B63B 1HUMA 2B2TA 4R4IA 2EVBA 3NVYA 2CH4W 3OJ4B 1LTTD 1NBWA 1HCZA 3P4QB 2ZT9C 5TSSA 4CJ2C 2CJOA 2Z59B 2HUGA 4MGKE 5M3FB 1KDBA 1K8OA 2AYOB 3W1SC 3SR1A 1L7YA 1Q0WB 2F0FA 5CV8A 5FK9C 1SB3C 1S5ED 2N8NA 4QQBX 2JYEA 1R9TH 4H13C 1BCPB 4A3MH 3STBC 1PHJA 3AMZA 4DXFA 2KANA 4FP5D 4GLXA 2JP1A 4XXEA 1XQQA 3DXJC 1N9WA 4CGYB 2JZ3B 4WWPA 4GNXC 4DUZQ 3RLNA 2HT1A 4J8QA 2V1YA 2EY2A 2L12A 3CU7A 1TWHH 1G2SA 1T9HA 2E2HB 1MBYA 4YSXB 1PH7A 4MEMA 1RF2D 3BVGA 4REZA 1VZ7A 4K8JA 3TIXA 2INDC 2CHZA 1MI2A 2EQSA 3H8HA 3S1RH 5IYDH 4NKLA 4WIPA 2CWPA 2ENBA 3PT2B 2VUMG 1FRRA 4X64Q 5DPRA 1J5EL 2HIXA 2JWZA 4LUZA 2KTRA 4LAAA 2JK8A 2UWQA 3IFWB 3M4YA 1LFDA 1T0RC 3NPPA 4IQZA 4I7ZC 3ND9A 2ZPNA 3IBEA 3VAWA 3IXSA 1E90A 3TDQA 1F2YA 4X65L 4DA2A 1TKWB 1QLBB 4US9A 5DPWA 4X62Q 1EO6A 1WYWB 1NR4A 2D2CC 3FPUB 4A3DG 1HNXL 3U9SA 4F87A 2HTHA 1YOVB 5CV6A 4NP5A 1FCLA 1VQFA 3H6MA 2NYZD 3BK2A 3VQIA 1WJUA 4P74A 4XT3B 1XT9B 2LJIA 2ZTDA 4XDXA 1SSNA 4NNJB 4RM8A 2KDIA 5E6PA 2K1FA 2H5XA 5C0XJ 4GDLB 1ROEA 4C80A 3X3NA 3HP3A 1J0GA 3MC9A 2AQ3B 1BQQT 3EBEA 1EEFD 3SK5A 3FMCA 4KGSA 3UIOB 1ONLA 4XDCA 1PRTC 4FF1A 3SU8X 4ASWC 2JXTA 3SGIA 3VYUA 4LF9L 2NVXB 2UXCL 1HH2P 4OVZA 3SFDB 2INCC 5L95C 4GIVA 5FOBB 2VH1A 3GTOH 3M3YB 2JEAI 3ZJUA 1RTNA 2HE7A 2LMCB 3RMKC 3CHBD 3KWLA 4BY1G 1Q81C 3U50C 3F1ZA 4GOPC 5FO7B 2KN4A 3RLOA 1JROA 4TSSA 1E8XA 5KEEA 4M8MA 1TKGA 4DK5A 1RIPA 4ZKCB 1YN4A 3MJWA 3FVQA 1VQNA 1U0LA 4FULA 5AZGA 4HAEA 4TVAB 4ZHOA 4XQJA 1EY8A 2IT1A 4GLVB 2L05A 3U7DA 4Q5VA 5ELEA 2GOWA 1XTCD 2JA5H 1II3A 1A70A 2KC1A 3R8BA 1SNOA 4JI8Q 5ELNA 1C4AA 3VA5A 2KJHB 4ZDVA 1QCBD 5IYCH 4JYAL 5CORA 1VCIA 3LX0A 2L55A 3HOYG 4TMAB 2XIWA 2WACA 2DN8A 1K73C 1DZ1A 1WSPA 5JVG3 1VQMA 3SXHA 4A3JB 4JWSC 1LACA 2F0VA 5HGTA 3C8YA 1YQBA 5EE3A 4FADA 4RNAA 5IA7A 3HVZA 3OW7A 5FJ8H 3MHZA 4QJFA 4XQQA 1N33Q 1Z5SB 4BKSA 2FHTA 1KLUD 2B2UC 2JA7H 5LMUL 3PLUA 5CHWA 4C3JH 4QMGA 4B3RQ 4JPSA 2O6VA 2NTTA 3WWVA 2BYTA 2MQJA 1MKHA 3S16B 2MWSB 4C4VB 4NMZA 3I2ZA 1F9JA 3W5VB 3WANA 1QZGA 3KQ4A 1EUJA 3PQIA 1WTVA 2KHSA 1AZQA 3KLRA 3W1YA 2KENA 3T4AC 5IGEA 2ALYB 2A74C 3J81j 2LGXA 3AE1B 3PIOA 2XK5A 3NZSA 3ZXVA 3NZ3A 3VYTA 1PH6A 4PK1A 1UEAB 3AE4B 1HTPA 2N0SB 3AEBB 4LF7Q 1WFYA 3EC8A 1D7QA 1C1YB 1NEKB 1HNZL 1KH0A 2CW0D 4LJZC 1VQ7A 2HDEA 4BS9A 1PFMA 1A5RA 5JEAH 4AYBG 2CH4A 1X1MA 4A3BB 1O7LA 3NQIA 4NY0A 1ESFA 2G9HD 1A3TA 4DR6Q 2WAQG 2EMSA 4IFDH 3VTVA 1SXTA 2FXQA 4L5SA 1E7UA 1JE5A 3HOXG 2GLSA 3RCZA 4N9PA 2MRPA 2NB0A 2A5HA 3MJ5A 3VA7A 3HK0A 3M4OH 2F0KA 1VQKA 2A1AA 2IBIB 4EQPA 3VR6A 4LNNA 1I4PA 5F2DA 3T3OA 4HJ5A 1TTNA 1N32Q 5IWAL 5C4JH 4JI7L 1Z2MA 1WZ3A 3QWZB 2G3QB 5EBDA 4RWSC 4LF4Q 4ULLA 1NENB 4YTPB 1VQOA 1WTOA 4ZOHC 2QCZA 1SNMA 2D9UA 1QOFA 2K8BA 4BBNF 1HTOA 4LNQA 4IM0A 1IGDA 3H0GB 1SE8A 2KVMA 3CRLC 1XPUA 2SNMA 4ZAIA 2PQAA 1AARA 3P7JA 4MACA 4AUQC 4D2KA 3EECA 4US8A 1MD2D 1K50A 1EFID 1O80A 1KDCA 5C44H 3GTJB 3GTPH 4LFBL 3M3JA 3AFQA 4H7BA 4BY7B 3E9SA 1I50H 1PA6A 2SAKA 1XNQQ 3HS0C 4EZLA 1EYGA 1PH4A 2M19A 1D1KA 1TZ1A 1B70B 1B2TA 4GDKA 3HOWG 3AEFB 3KK7A 5C3JB 2MPMA 4ME3A 3A0JA 1L6VA 3AEDB 4JBJA 2ZXRA 3ZJYC 3UF8A 1H9SA 2JQRB 2LZ6A 1Q46A 4L1BA 3CCUA 4TV3A 3OWEB 4E71A 4E6IA 4RFBA 3ML9A 4K3CA 1LM8B 4A93B 2K52A 1QOHA 1XXGA 3KYHC 3B2FA 4DR3L 2DZJA 2PMZE 5IGCA 4IC7B 2LFNA 1DGSA 4CKBA 4TKOB 3RZDH 3QK0A 5CHVC 1QZEA 2QSDA 4S17A 3S1MB 3ZQ4A 1LT4D 3DMUA 3ENEA 4WAAA 1L0VB 3ZJTA 5M3MB 1YVCA 3VR5A 3FDTA 4A6QA 2LD9A 2YVCA 1BXTA 2PO4A 1R4MB 3PREA 4A3FH 5I2XA 4M00A 3TZDA 1HNWL 4P2CB 3KBGA 1ZKHA 3HKZB 3VXWA 3PIO3 4IWOA 3P1MA 5C0XG 2B63G 1WMHA 1Y1VH 1PDXA 4OO1G 4DV4Q 2GBKA 1PTOH 3F8TA 1E5WA 5C3EG 1GHKA 3HVDA 4LLGM 2MGSA 2AUJD 5BYSA 5D14A 4DV6L 3CCJA 4NXNQ 1BUIC 4A90A 1PYSB 2ZVNA 3LXFA 1HFNA 2HQLA 3L0OA 4LF5Q 3ZIMA 2B2VA 3PO2G 1FGUA 2F0QA 3IFDA 2FINB 1JJ2A 2ATWA 3QB3A 2HJ1A 4J6HA 2JZPA 4B3TL 2Y5PA 2QCPX 1DCZA 1Y8OB 1N34L 4A3CG 1Z7TA 2K39A 3P2BA 1CHPD 4KZ0A 5T8IA 1V97A 4ICUA 4WH4A 1PZID 3P1HA 4A76A 3G6EA 1YNNC 4R4CA 4IPCA 4JI1Q 3J81c 2UUBQ 1T0YA 2BGFA 4CBVA 1K83H 2KCNA 4JI0L 5JJLA 2LGIA 1HR0W 1WTRA 5K5PA 4MJSA 2E75C 2C9OA 4PQXA 4OW0A 3U52E 3K9PB 1XPRA 1VD2A 1YHBA 1EYAA 5IIFA 4B6WA 4ARCA 5BR8Q 5KGUA 5NUCA 4M01A 3PMFA 5BO4B 3JAMc 2N55A 2WXPA 2PCFB 2QMTA 1KJTA 3BJUA 3ZO5B 4JBWA 2N9KA 3C2PA 4KMUC 3N52A 2Z1CA 1YITA 1A3VA 3HKZE 1QOBA 2ZJPA 3K81C 2TMPA 5EJWA 1YIWA 4R1JA 2E5LQ 1K0SA 1TZOA 1FXTB 3FC4A 4DR2L 5FR3A 1Y1WB 1DXMA 3DEPA 1IW7C 2WDTB 2X8XX 3MTNB 1P7FA 4KLKA 4DV7Q 2UU9Q 2QIEB 3S2HB 5E3FA 3Q3OC 3O13A 3O65B 4RMFA 3L4PA 2OXPA 2J7ZA 3AE2B 4A55A 3N1YC 1VQ5A 3PZ8A 1QNUA 2B2TC 4GNXA 2IX3A 2KDMA 5CV9A 4WRDA 4X3SA 2ZZPB 1EYCA 4HCSA 3I72A 3VUYA 1E8YA 4A3IH 3PV1A 1SLJA 1RODA 2NZHA 1RLFA 3AV8A 4IUVA 3BZDB 1UNSA 1XMQL 3DEOA 1N8RC 3J9CA 2BT6A 4EQOA 5A2QL 1KQSA 1YNJC 2JA8H 2MH7A 5C23A 4A3PA 5LNK1 5DPSA 2LVOA 4HLEA 2NPTA 5C2TB 2F0UA 1NJIC 1F52A 2PVOD 4UHVA 3FAHA 4K81A 2CFMA 1S5BD 2N49A 2WDQB 2JUOA 5DPTA 2R93B 2IHEA 3PUZA 4WJOA 2RDHA 1V8CA 2JSVX 1BBWA 1C76A 1Y14B 4L5RC 1KRSA 3I4NG 2K8CA 2EY1A 1JMLA 3SR6A 4DV5Q 3ZTCA 3K5OA 1PH9A 2YYZA 1YJ9A 3IAYA 4Y52H 1WIAA 1WXAA 2MLBA 2BOSA 4NXMQ 4RHSA 1TWCB 3PO3B 4PS7A 3RNFC 1WCMH 2DNEA 3FP9A 3QIJA 1F0ZA 3KYCD 5J18A 2GRIA 1A62A 2IZVB 3ZGZA 1OO9B 2LXJA 2ID0A 2DYOA 1LTBD 3IL8A 4C2MB 2VZKB 1RM6C 4ZRZA 3P63A 5IP4D 3Q3NC 1HJPA 1A3UA 2EYOA 4Q0FA 4RKLA 1PH2A 1I3QB 1L1OB 1QVFA 1Q5WB 4HKQA 4AIMA 4FF3A 4KTAA 2O2VA 3V60A 1FYCA 5IYBG 3PO0A 4HJAA 4CHKA 2V9HA 1XTDA 5J22A 4C7ZA 3S14B 5IE8A 1G6JA 1B9NA 3MFYA 4PZ8A 2MHVA 1HR0Q 4BAXA 4EQ5A 3J80L 3WDNA 3NUCA 2DYBA 2IYDB 1W3SA 1E2ZA 1PYBA 2Q8TA 5HHDG 3ZNGC 1K3RA 3OOCA 2M0XA 3ZXRA 2IJ0A 4W9GA 5A2QE 4XC2A 1VQLA 2FIDA 2K8HA 2JXXA 2FCMA 2KX0A 3CIRB 4W9IA 3F2CA 4OONA 1DONA 1ML0D 1E3PA 4LJOB 1L4ZB 2EKEC 5D94A 3DBLB 2JY6A 2BE5C 4BBRG 1UE1A 3BS1A 1OTCA 2E2DC 1TYGB 2LHEA 1HZCA 3QR8A 5C6AA 2VUMB 2I2YA 1L2NA 3E9IA 2IO3B 4X66Q 1Y8RC 4A3KG 3J80i 4NZLB 2JA9A 2KOLA 5E6NA 3H7PA 5JZEB 4R9WA 2IO1B 5IODA 2KWDA 3KLWA 3HHMA 1AW7A 2WWZA 1J7AA 2J4XA 2NBFA 2Q8RE 3NWTA 2OF1A 3SE0A 5E4WC 4A3DB 1HZAA 4O2DA 4Z9CB 4B9WA 2B2UA 3HOZG 1PV4A 1H9RA 3Q8BA 5FR6A 2KD0A 5JAVA 3DVGX 2ASQA 1BO0A 2GBMA 3UDIA 1T0QC 1HFGA 2UUAL 4B9KA 3EFUA 2WP8J 4IM2A 1STHA 5LMUQ 2KBNA 3QJYA 3K7AB 2AEHA 5JH5C 1U4AA 3GTKB 4IWQA 1WYDA 1MJEA 1X54A 2J0MA 2OEDA 1RD9D 1KABA 4FBJB 4W9KA 3J80E 4K1RB 1KIXA 2A68C 3OSOA 4IG7B 3P4PB 2MHJA 4JI3Q 4W9EA 2WB1G 2ZEQA 4JL9A 5DEHA 3C19A 2NVYB 1IHZA 4GN3B 3UDXA 3DHQA 2DZKA 4JBMA 2VB2X 4BY1B 3QA8A 2JVCA 1OXSC 5C4HA 2I0QA 3KUZA 2N3SA 1KXLA 2PVGC 3LYYA 3TSSA 2DENB 3NXWA 2PI2E 2C7NB 3I4MH 1QWYA 1UWVA 1ZW7A 1QOAA 2G9DA 1JE4A 2DAJA 4A93G 1F2MA 1JT8A 2MBBB 4L5TA 4CO7A 3OTOL 1ZDVA 2D0PA 3KBXA 2WV6D 4GKKQ 1HZ5A 2WHIA 1B44D 3R7RA 4DUYQ 1HUNA 4APVA 3FKIG 3A8IE 4HCEA 1LTAD 5COYA 3VR3A 3OWFA 1MSHA 2BKRB 3D4RA 3VDYA 4KGRA 4A3JH 1K8GA 2HHHQ 1SDFA 1N63A 4WFN3 4KDLB 4M8AA 3HOYB 2OWOA 4OZCA 2C35B 4BWGB 3HOUH 2PTLA 1H95A 4HPMB 3KF8B 3HKZG 3PF4A 2QA4A 1NCVA 4KGTA 1STGA 4L8JA 3T53B 4C4VA 2Z6KA 2JA6G 2PKOA 3I91A 1J9OA 2F3WA 1KC8C 2RGFA 3I3CA 3OG5A 3S16H 4BXXH 2L52A 4W9JA 3TMPB 3A5ZB 2WLBA 4POGA 4MM3B 1EIGA 4PV1C 2B3GA 4GN4B 3MAQA 3LWUA 3V2TA 2AKWB 1E7VA 3V6EB 4N8FA 2KT7A 1Q3LA 1TWAB 5IGDA 4BBSG 4KHVA 3HM3A 4H0LC 4N6EB 2MCNB 5G3LF 3RI7C 5KHOA 2JPHA 3D8GA 1WTPA 5JEAJ 3ZDTA 3W5UB 4LFAL 3L0WB 2PZTA 4M8NA 5AFWA 2D3AA 1ZXIA 4PNYA 4IFDJ 3RNUA 4DV0Q 1GUAB 3QO2A 2ES2A 1UGJA 1S5DD 2OTJA 2ACZB 3L08A 4YSYB 2I5LX 3TEXA 3QQ8B 3E6ZX 4DAPA 4OIKA 1OXTA 2FCNA 4MZ9A 3V96A 4IKGA 1NMGA 1WGHA 2BS4B 2WQYB 3AH7A 4K0KL 4ZQ3A 4AYBB 1IBLL 2LGSA 1EY9A 1QQRA 1V86A 5FO8B 2IGGA 2BQQA 3STBD 2JRHA 3PZDA 3OHXC 2WAQB 2RA4A 2WXQA 2Q2HA 2RSOA 4ZRPA 4KY6A 3ZRFA 3HOXB 1ZUD2 5M5YB 3U8ZA 4XIGS 2BWES 2MJDA 4LNIA 3KOJA 4YL8A 4BVUC 2ZTEA 2JZZA 1VQ4A 3BDOA 2VXWA 1YNTE 4K2KA 2DY7A 1QVCA 4A3MG 2MNAA 4DR5Q 2KKCA 1GJXA 1QF6A 3H0GH 1GHJA 4OX9Q 1EUVB 1M90C 2GBJA 4ZUJA 2EYMA 3LNNA 3G7LA 3V61A 4G57A 3UIPB 2UYZB 4BY7H 1G91A 3NE5B 4I7AA 1L0XB 4A3OA 3T3NA 3R93A 5FKAC 4BA1I 1A63A 4IOCA 1JCKB 1X3EA 3GTGH 3GS2A 4GLAC 1PTOC 5IYDG 1C0AA 3N1XC 1JRPA 3VR9B 3GO5A 2RCFA 1JR0D 2F0DA 1DOKA 3A55A 1C9FA 4DR1L 5AZFA 1SYBA 2R92H 4I6LB 4ZLTF 4C56C 3APCA 2HIVA 5ISRA 2KCTA 2RHQB 4N58A 1ESRA 4JX1C 5D7GA 3NUHB 2QDFA 3HOWB 4RM9A 3ONSA 2Y0SG 3MXNA 1YMHE 2B2VC 2AWOA 3ULPA 3AE5B 1EF1A 5C4ZA 1VQ6A 2PLPA 2EJMA 4ITKA 5CV5A 1Z47A 1FMAD 2BA0A 2IX1A 3RLFA 3RMHA 2L15A 3RT3B 4XZ4A 2BCOA 1RCVD 1UF0A 3A7LA 2J7QB 2MBQA 1H9JA 1V1PA 3A9KA 1TWFB 2I07B 3NBHB 4DR4Q 1X6OA 1FPYA 3L17A 3TEYA 1F2ZA 2R7ZH 4NJ6A 1FL0A 1E10A 1ET9A 2B29A 1QB5D 3E5SA 3TJPA 3CCSA 3FILA 1DM0B 4JI6L 1ZP0B 2KLGA 1ICFB 3W5OA 1K9MC 2MP1A 5KNBA 4B3SQ 4JI5Q 1VCBA 3QARA 5H92C 4IPDA 3TUOA 3T1YL 2LVPA 2FMCA 5EAYA 4QUFA 4FF4A 4YY3L 1XO3A 2ZNVB 4XWWA 1J19A 4FXDA 1F9RA 4GKJL 2KTFA 3S2AA 3Q69A 4ZRQA 3ZW3A 4KHPL 3MP9A 1E8ZA 1LTSD 4K5VA 3EQLC 2CS4A 1SYEA 1H9KA 3ETRA 5C3EB 4QIWB 1GOZA 3EGRA 4KKJA 3W2DA 2B39A 4XYCA 2D11A 2A6HD 4NW2A 2AHOB 4LFCL 1SR3A 4C7YA 1SF0A 1CKOA 2EYLA 1LTGD 5E6OA 3PO2B 3Q0AA 4HR7B 4LNFA 2RBMA 1HQRD 2VH2A 3X23A 3C46A 4BFRA 4FXGC 3RZOH 4DDGD 1SGHA 4LNOA 5C4XH 1SNQA 1O7ZA 5IYCG 1D1IA 1J7BA 3BVMA 4WJQA 2K03A 5HY6A 3UDFA 5FLXL 4R4QA 3DPDA 3T13A 3UI3A 3BVZA 3Q8EA 2D5GA 4DWFA 2LSSA 2MJ8A 2MO0A 1R4NI 1X32A 4L63B 2BH2A 2LUEA 3NY5A 1C78A 4W9HA 1JWMD 1CKNA 2WXNA 1MI0A 1J8IA 3BIID 3U4VA 1VZ8A 5IO9A 2XNAC 4V190 3SEBA 3I8ZA 4YHHL 1C8CA 4ICVA 2JA7G 3QHTA 3RN5A 1KNEA 5JVH3 3SK6A 5IOCA 3AQQA 5KNCA 2B3AA 3CCEA 3FEWX 4CJ0B 3PUVA 4HEDA 2PNHA 4KJOA 4WJPA 1J6QA 5KNDA 2KQ4X 1PXUA 3S1QB 1D2BA 3TL5A 4DBGA 5JXVA 4L6TB 3GQBA 5ELCA 4DV3Q 1AH9A 1KAAA 1RKNA 1SFOB 3PS6A 4QIWE 3CF6E 1Z9FA 1C79A 4C3HH 2D3CA 3GZNB 3OJ3A 5J17A 2G5DA 3S17H 4NPSA 5JEAG 2JJQA 5CBAE 2JYOA 3GTMB 1H4RA 2WX0A 3L54A 4HDQA 3V6CB 1BCPC 3UQBA 4OWXB 1LO5D 4IFDG 2RPQA 3RD4A 1WY8A 1OGWA 1BBUA 1Q1BA 2DAFA 1I6HB 3KLSX 3RUIB 3DLLA 2WXKA 1FJGL 5AJ3L 4WORA 4QL5A 1TKYA 3APDA 3HUIA 3S2DB 5HG2A 2L0CA 5KHQA 3DBRB 4HSPA 5FLXE 2NBWB 3ZNID 2R93H 2RF4A 4NAWB 2PW5A 5BN5A 1G8ZD 5G3LD 4MGYE 2K05A 2L1BA 3M62B 3UE0A 2KA7A 2F0LA 3VUWA 4S3SA 1TWCH 1NR2A 1VLBA 3KF6B 2VQEL 3PTFC 3HOVH 2F0WA 3I4NB 3K0XA 3M85A 1VQJA 3GTLB 4PYUA 1VQEA 4P73A 4BKTA 1L1OA 4LF6Q 3TEZA 4LNKA 4IURA 2D07B 1FFUA 1Q8IA 2D10A 5M5XH 4YWGG 4R3DA 2BPSA 4HSVA 3AEVA 2FCQA 3KUPA 2A19A 5DM63 4K14A 4X3KA 4DPGA 2N4FA 4ALPA 2CKZB 2I1JA 1WTWA 3ZTDA 1YX5B 1LV9A 1SBBB 5LMNW 2F4IA 2J0TD 1XMOQ 1DD2A 3WAPA 2JF5A 2JN4A 2EPBA 3S9WA 3K5NA 2NVQB 2IY0B 2K33A 3BZKA 4A3LG 1B4OA 4KI0A 2MJ3A 4P75A 3ECIA 3NTIA 1S40A 2KK8A 2I38A 4IUTA 2N9LA 1MG4A 2V1CC 5GROA 4AQYL 3A1QB 2VQFQ 2K6AA 5LXIB 1IBML 5HURA 1R7SA 4A3FG 2ZTCA 3I4LA 2CHWA 5EPKA 3GP7A 3NENA 3JSVA 3N32A 1TWGB 4JLCA 3EA6A 1PUTA 4BBRB 5E6JA 4C1NK 2NMQA 1LGRA 1OXXK 1Y1VG 4IZ8A 1N36Q 4UAIA 1WOCA 2DJGC 4OWWB 2IGDA 3H6NA 1CFMA 3CCMA 3NRZA 2A69D 1B7YB 2RQXA 3OPOA 4AWJA 4A3KB 2PMZB 3SDZA 4JI4L 2KUMA 1V80A 4KDIC 3K9OB 3E0JA 3SHLA 1TS3A 3QIAA 2VY3A 4HROA 5I6YA 1P8LA 2V3SA 3MFGA 4P7IA 3IG3A 1IZ6A 4JI2Q 3TN2A 4EE2A 4HJ7A 1EL0A 3KWVA 3PSEB 2MQHA 3OMCA 4DV2L 4JV5Q 2J53A 3HOZB 4YCUA 1WTXA 1F9SA 4A4IA 1HA6A 4G4KA 2L76A 3JC66 5C3XA 3B6YA 4DHJD 1EFWA 3A8KE 1SMYC 3W1BA 3K57A 1K51A 3LGJA 3RR5A 1Q1EA 4IUMB 2E2IH 2KMMA 4W9FA 2ZXOA 2F4VL 2DLBA 1BDOA 4GGQA 1FR3A 1OQYA 4ME5A 4ZYNA 4DAYB 1CHQD 1C48A 3DQVA 4G0NB 1EWIA 4XGAB 4QUCA 3T1HL 2F3IA 4AP4C 1BOSA 2Z6KC 3JYUA 2E76C 2O5JC 3DHHC 1UELA 4P6VF 4KX6B 3RD2A 2XSCA 5BN4A 3CSTA 4DK6C 1IBKL 5C1ZA 1I94L 5DAUA 1UWXA 2WB1B 1IW7D 1EIFA 4WJWA 1NI2A 3LDZE 4HEA1 1CQVA 2Z4HA 1PGAA 5EQ0A 3VTWA 1EM7A 3NSWA 1V6EA 3EFCA 4K3BA 1KL9A 5JPNC 3ULLA 1SNCA 1WVLA 3VYRA 4LTUA 3R2IA 2OQKA 4A3GG 1LM0A 3MXPA 4I6PA 3NVVA 1HZ6A 4FDBA 4JK1C 4C3IG 4WURA 5DLQE 2F0MA 3MWYW 5M5WH 3AE9B 1MIUA 5AUKA 4GU2A 2KZRA 3KF8A 1C4CA 2WXJA 1EZ8A 3FKIB 2N7DA 1SSOA 2Y3AA 2EMTA 3U30A 3A54A 2XGTA 2LKVA 3I73A 2K5PA 2JSOA 2KC2A 4H44C 3TZUA 2L0FA 1Q8KA 4EZKA 2UXBQ 2PIAA 5L37A 3A4SC 2BW2A 1L4DB 4MM3A 2MP2A 1LLRD 3CD6A 5I2YA 2E3TA 1X3PA 3PPAA 2KHJA 4A3IG 3RNBC 1IL2A 4WWOA 2REXA 5LMNQ 2I5MX 1KM7A 2I1KA 2N7EA 2H89B 4LMQD 2UUCL 2PE6B 2JA6B 2EELA 1H9MA 2ZJRA 1YIJA 4DNRB 1XNRL 3RN9C 3CC7A 3I3TB 4DHJB 2K3UA 2NR2A 2ZJDA 4F7ZA 1B3QA 1GAQB 5IT9c 2WINB 4G3XB 2F52A 2HD5B 4E74A 4BBSB 1WX8A 3E3XA 2F1MA 4RA8A 1NUCA 4OZAA 2VW9A 1V5OA 1S4ZA 1PTOF 2F0JA 2L9HA 3WOFA 4BOZB 2QF7A 2WB1E 3NVWA 3N20C 1VQBA 2KQ3A 4KJNA 2N1WA 1S5CD 2M0AA 2DNCA 3I90A 4HDOA 2UXDQ 3IAS1 4V0BA 4B0MA 1EQVA 2MBEA 1E0BA 3CCQA 4P71A 3ZYYX 3TP8A 2LVQA 1WCMG 1LT6D 3VDZA 5D3IB 3HOXH 2AX5A 2IDYA 1EY0A 1T5EA 3K6OA 3I5JC 1FGBD 4C00A 2LXKA 2D3BA 1V5TA 3H94A 1IBXB 3Q8DA 4DV1Q 4CJ1B 1EIYB 5GXGB 2M1MA 3JVZX 1UUPA 4A20A 1GUGA 1PH5A 1R9TB 4A3MB 3DDCB 4LF8L 3B2GA 3RNAC 3EJIA 1HPCA 1RDPD 1W6JA 5EE0A 2D0OA 1GUTA 4KIKA 2K5QA 3P75A 2L5TA 1TJEA 2NCNA 4LW1A 4TQ1A 4WQOB 4WWNA 2AL6A 4IUUA 3EHVA 5AZHA 4M0WB 5G2NA 1X55A 3EROA 3NK9A 3MEHA 2EY5A 1FVIA 1WWTA 5M9OA 1DOYA 1KAWA 2ZW0A 4FHJA 4DR7L 3UGBB 2VL6A 4LFCQ 3RULA 1U4RA 3AEAB 3S1NH 3HOWH 1M94A 2MX2A 4Y7NB 2IY5B 3CMMB 2WXHA 4B3ML 1K52A 5KYIA 3Q6BA 2ZM6L 1F9QA 3TS2A 2W82A 1QE6A 1NTGA 1EQQA 2KHIA 4YCVA 4FO2A 2KTRB 2UU7A 2V4LA 2WXIA 1K0RA 1DYQA 1ZYRD 3OLMD 4A3EH 3U2SC 4IO9A 5BMIA 2Y0SB 4ODGA 4LUOA 2LRWA 3DWGC 3R66C 2K7VA 4PMCA 3J7AV 2QC8A 4G7ZC 2N9EB 1V1OA 1V2YA 3RN2A 2YU9H 1WGKA 3MZ5A 2LGDA 3NHHA 4HWIB 4IN3A 4BKSD 2XRQD 2A68D 3NOBA 1WI0A 2K1BA 4YHHQ 4Q2JA 1VS0A 3NTHA 1W6KA 1J5EQ 3Q3FA 2WYQA 2O6VD 2WU5B 1XEEA 3NZUA 1X9NA 3V62A 3CC4A 5EKLA 2GBNA 2B63H 1R4MI 4DUZL 3B0AA 4P1CC 4X65Q 4N9TA 1WRDB 3P4SB 2RR9A 2MW5A 4JWUC 5IT9L 3CF5A 1H8CA 1HNXQ 2SDFA 2NS5A 5HI1A 4MH8A 2EY6A 1QUQB 1GXDC 1SE2A 3GD7A 5EBCA 1NBFC 1BF4A 2EYPA 5M3FH 2K5HA 4ACFA 5KIXA 1VMPA 3IFTA 1VQ8A 1Q10A 2MBOA 3RPFC 2IWHA 1BVSA 3Q6SA 4ANXA 1UAPA 3WOEA 1VQIA 1BT0A 3D4WA 1XJVA 1I4QA 3DBHB 2XWJB 3I4MG 2IPKD 2X6GA 5CMDA 4A9AA 3TMEA 3AE3B 3IHPC 3RZWC 1YJNA 2K9XA 4USAA 3J81L 1BCPF 4IJHA 1XCQL 3U4ZA 4LF9Q 5H1SE 2UXCQ 4HTHA 2W9NA 1PRTF 4X62L 5I9OA 2E2HH 4HIMA 4QF4A 1FJGQ 3TCAA 1Q12A 1X3FA 1Y56A 1DOLA 2R6GA 4QCLA 2Y0SE 4NPNA 4MSMB 2N1VA 4ANWA 2RSNA 4DN4M 2G4DB 3VTUA 3BG3A 2VB3X 4N59A 1G51A 2K5DA 2VZAA 2J52A 2ONQA 1QNKA 3HOUG 3H09A 4U68A 1YD8U 4WAFA 3EVQA 3JAML 2HDMA 1HRJA 3A9JB 1NNXA 2ZJQA 3EUB2 2HDLA 3EN2A 1YZ6A 3QCAA 4BXXG 1GG3A 5JJKA 5J3BA 3ZUNA 2KECA 2BVCA 1FXAA 2NN6I 3J81i 2JA7B 1CZWA 1JOOA 4KV6A 2HCIA 1A2UA 4C3JB 3E0EA 3S1QH 3IAM1 3Q23A 3PVLA 3G6JB 3ZKJC 2DZMA 3QJZA 4JYAQ 3FPPA 2DJFC 2O6VB 2PNRC 1EIHA 3AE6B 2KOXA 4GDLA 1VQDA 3KUDB 3SK4A 3BZCA 1MHXA 3I63C 5HGQA 2DBYA 3OIQA 1K8RB 3JAMi 1E2WA 1PGXA 2F0GA 2CWAA 1L1OC 3I7FA 5CGKA 2Q2TA 1CM9A 3DBSA 2O2LD 1WXVA 2BYVE 4XQNA 3HIZA 1ASYA 2NVXH 4YTMB 1NE3A 1MHHE 4ZCKA 2LMCA 3M3YH 4UPAA 4JI8L 2WNMA 3J81E 3EIVA 4NAWA 1FXIA 1NAPA 4RKBA 3IRBA 1CJEA 4HPPA 4FNFA 1EZ6A 4FVMA 1M1KC 2L32A 4G7HC 2WXFA 3QAQA 1UE5A 2KACA 1STYA 1TT5B 4MSQB 4PS3A 3BYYB 1TGZB 3I55A 2XEWA 4G50A 1HNZQ 3A7AB 5C4JB 3JAME 3ALBA 2WKCA 1GUOA 1N33L 2PMVA 1PTOD 2F0PA 4X3TA 1KFYB 5E1FA 5JPMC 2PEAA 4WWMA 2EE1A 4B3RL 2R3ZA 3AU7A 3V3XA 1LTRD 1TY0A 4MHEA 2GA4B 2K0PA 2L00B 3IT6B 3M63B 4F8CB 1NSNS 1SJHD 4LWCA 1PGBA 1MJDA 2WX1A 4K6LA 3CRKC 2C60A 4F7XA 3PV0A 2NBUA 4HN7A 4MN3A 2LXCA 3PZ7A 1RAXA 4OIJA 5C44B 4FJYA 5IKCM 2EJGC 3DWQA 2IX0A 1WR6E 5FLMG 1CQFA 1LQBA 3K5LA 1I50B 2ZXPA 2KVZA 5IWAQ 4HCNB 4JI7Q 1FD7D 4LF7L 2Z8LA 1P0RA 1PFSA 3CKIB 4XE0A 4N8X1 2LFIA 4LCDE 2BWFA 2MEKA 3QOJA 1BNZA 3BY4B 4GDKB 1A8VA 1JWUD 3F2BA 4DXAB 3K5MA 3MC8A 4DR6L 4RF0A 2NVQH 3IT4B 2DY8A 2PW7A 1PYWD 1C9OA 1KD1C 1SMXA 1YX6B 2D2QA 3A1QA 1VQGA 1F77A 1H9SB 2BB5A 1V8QA 3PHXB 2HQEA 4LFBQ 4JQWC
chains in the Genus database with same CATH topology
3RZDB 5D3DA 4DK1A 1XLOA 1SEBD 1I6VC 1E9MA 4A3FB 1CI3M 1D5ZC 5MPOA 1Y69U 1VF5C 2JX5A 1L5PA 2MJEA 3D31A 4QB4A 5I9PA 2X38A 4XT1B 1TT2A 1Y1VB 1N5XA 1PTOB 4XWTA 4U673 1ZXHA 2JYTA 1DOIA 3U9OA 2PW9A 1RJTA 4DAVA 3NTKA 1OXUA 1F2RC 1CA5A 2Q8IB 3NS1A 2PZUA 3SK8A 2L1AA 1SYDA 3UI2A 1OQRA 4PMBA 2A6EC 2NWGA 4HRSA 3M7NA 4DXGA 2L11A 4R8NA 4ILWA 1N60A 3CQZB 1CA6A 2SOBA 3MTSA 5K36H 1TR5A 1RTOA 1U4PA 3TP6A 3NWSA 3T16A 1JALA 1FRDA 2XN9C 3FRPB 2AQ1B 5I6WA 2B2WA 1FM0D 1FD6A 1GB4A 3ITPA 2H88B 1XCTL 1G6ZA 3ABVB 3F2UA 4A3GB 1BCPD 4DNTB 2PQEA 2K01A 2YEPF 1P7EA 3HEJA 3S15B 1PRTD 4C3IB 2SEBD 4OL7A 3MC0B 1PDQA 3AECB 4C3HG 1WD0A 3PUYA 3DWMA 2BDNA 2RVLA 5CC4A 1OQQA 2EKIA 5T1IA 2EXZA 2H1EA 4A3IB 2E2JB 1F2RI 1SNDA 3MXUA 1Q90A 4F88A 1TQOA 1EY5A 3NVZA 4FXKC 4RAUC 4RF1A 3R2TA 1EWHA 1QJOA 1L0YB 1CZGA 1EEID 4L2YA 1K8MA 1V43A 1XLQA 3P4RB 1CT1D 3BWUD 1OFFA 4K5WA 3Q8FA 3A8JE 3W3AA 1B50A 3C3LA 3DWPA 4O42A 1IBXA 3TP5A 2OT2A 1G2TA 1WCMB 3AEEB 1IKLA 2Q5WD 1SYFA 2NN6H 4KK7A 4GLSC 3LB8C 3N6RA 1B9MA 4B0EA 3AE8B 4IOIE 5D65A 1ZE3D 1JW9D 1RWSA 2F3VA 1PRTB 3GTQB 4KN4C 1VR9A 4C3JG 1O78A 1U4LA 2INNE 3NP8A 4M0WA 4IUQA 3Q8CA 4J1MA 5EKKA 2GI9A 5T1GA 1WTQA 3T51B 3U4EG 5I4DA 3T56B 3L7ZC 1BMLC 3M7GA 4IDIA 5EGTA 3B9JA 2M56B 1JOKA 5LL6S 2TSSA 2KJXA 2DYMA 2NVTB 1NVID 1XLNA 4CHTB 4KD3A 2BDOA 4BA2I 1WRIA 1PZKD 1F2LA 5AUIA 1SMYD 2NUCA 5C5MA 2BBCA 4RHRA 1BBXC 2EJFC 3W9CB 1SE3A 1L6UA 3GV3A 1QOGA 2WS3B 3GV6A 2J42A 2EZVA 2EYJA 5IGGA 1I4XA 1NI3A 4HMJA 4ZHPA 1ACCA 1SNPA 1EY7A 2N7JA 1D5XC 1WYGA 4XTCS 4KKIA 1KLGD 5HFYA 2V4IB 1ICWA 3PIP3 1FNWA 1LT3D 2CU3A 4TQ0A 3U7ZA 1EY4A 2RPVA 1M8AA 4DF7A 2V4DA 5C0XI 1QG7A 5J39A 4OO1I 1ZDXA 1F9PA 1A15A 2NZ1D 4I65A 1VDVA 2LY7A 3TEWA 4AS1A 2CJNA 2WP9B 1E2VA 2XVSA 1XF5L 3I4MB 1B1ZA 3MXGA 3MVVA 4CQNA 2F0IA 2A6HC 1TS4A 1I7HA 3V05A 3LWEA 5EE9A 1DJRD 3HG9A 3EFXD 1I4GA 4O1NA 3N9YC 4F8MA 3A56A 4C1NI 1IKMA 3HOUB 1JORA 2FMMA 1N62A 1T5XD 1IGCA 1AN8A 3MHBA 4LK0M 4RH6A 5EE1A 4B08A 2KEEA 1ENFA 1JC7A 2KCCA 1TKEA 2PPBC 2OHFA 1MPEA 1S5FD 1GUSA 1YNND 2WXLA 1JOQA 1LT5D 2B2YA 1CK1A 1N5WA 1EWCA 1STAA 3PUWA 4XYOA 2ICEC 1GUNA 2WXMA 2X69A 1B53A 2F0SA 2IGHA 2K22A 2WU2B 4NAMA 2D5DA 1IL8A 3VR8B 5C3WA 5KRUA 2LHDA 2FE8A 2BS3B 1VDZA 1XYIA 1N61A 4GZYC 1XLPA 1QILA 3Q24A 2EDGA 1J7CA 5G5HA 3HGBA 1EWYC 1RFKA 3VR4A 1FEHA 5C5LA 3QOLA 3BYTB 2BA1A 3D4DA 2FJ2A 1JB3A 3I57A 2ICIA 5ELFA 3D3RA 1CTMA 3GTGB 1YNJD 2M00A 1AZPA 3C1EA 1FO4A 1FFVA 2R92B 4YXDB 1DOXA 4KD4A 4YSZB 1BUVT 1TVXA 3L9AX 3DUZA 2YEPB 5A35A 1HA5A 3RUZA 2QDBA 2FUG1 3AMUA 1TS5A 3ONAB 2K32A 4DK0A 1V1PB 4ZKBB 2R7ZB 2F0HA 4JE3B 2CVRA 4PMWA 3SFEB 4RGNA 5ELDA 1VMCA 3FILB 2RDFA 3J7YW 1FIQA 3HRDD 2Z4IA 2F0OA 1JQ4A 2FFKB 1AWDA 5J1ZA 1WD1A 2CW0C 2F0EA 2B2WC 4ZYSA 1YQ3B 2L83A 4ABNA 3H3VC 3DWAA 3I9V1 1SAPA 2V0GA 1JWAD 1D4BA 2A69C 2E6XA 2JU6X 2A73B 3P42A 2W3SA 1E0ZA 1SJED 1OXVA 1JWBD 4OZBA 3RZOB 2BE5D 5DNFA 5C4XB 4RCNA 1LABA 2JWUA 4RCOA 5IGBA 1X3QA 2VNUD 1TWHB 4DGZA 1AFPA 2WKDA 3D6CA 5EPLA 4CKCA 4A8XC 3P20A 1ENAA 3MA2B 3S1RB 1T6BX 1TS2A 2KEDA 4K2LA 1SYCA 1B9RA 3AB9A 2VZKD 3KLSA 3W1SA 1SYGA 4IUNA 1PFNA 4X3UA 5CV7A 1FNUA 3NBHA 1HEZE 2KAJA 4B9XA 1ZKOA 2LS01 1PLFA 2EOTA 4KKTA 5BN3A 3QWNA 4NJCA 2RMMA 4KN7C 1ZEQX 1A6XA 3K59A 4C3HB 1JWSD 3VRBB 3S17B 4M1UB 1KRHA 3BDCA 1IUEA 2QJLA 2B8FA 5C0XH 1D6EC 3AEGB 4OO1H 2E74C 4DQOC 2W55A 3X3MA 4XDDA 4TRDA 3GTOB 1PMRA 4HKZE 1SIJA 5BYRA 3HRZC 5G5GA 3R3OA 1QT9A 4OGQC 1PZJD 2W3RA 3C1FA 2W54A 2QILA 1GB1A 1GPXA 3CWIA 1R4PB 5ELBA 4ID6A 1YJJA 2JA5B 3HOVB 1EOTA 1YN5A 4RGMA 4P16A 4DU9A 1VZ6A 5IGFA 4ZK9B 5M5XB 2Y5CA 2IW3A 1K53A 2LUMA 3AM9A 2DWQA 4FYDA 4G7OC 2WXRA 1A2TA 1TY2A 2PYKA 1STBA 2RDGA 1AEXA 5IT9E 2XWBB 5LL6X 2PZWA 1DGJA 3H91A 3HZXA 4R8IA 1TIID 2I46A 4CKEA 1VJKA 4ZUIA 5BYQA 1VF7A 1D5MC 2HCCA 5LHY1 5FO9B 3OIPA 2N88A 3TP7A 4KY5A 5CYUA 2WDRB 2CQAA 2CHBD 2INPE 4LK1C 3J7AF 1MSGA 4TQUS 2MUYA 2QKIC 3K58A 5DM73 4RGTA 3M4OB 2ON8A 2A6ED 4IALA 1AYFA 3E56A 1ZYRC 3URYA 5CR3A 5JJZA 2WXOA 1HXYD 2EYFA 2BS2B 4EQNA 1IYVA 1UWMA 2WDVB 3NQTA 2E2IB 1I4HA 4YT0B 2C5CA 1Y8NB 1U9RA 4EGVA 1G291 3DM1A 1LTID 1ZXTA 4KKUA 3GTPB 3L3OC 5BMHA 1XX8A 1YJIA 5K36G 1ILPA 4OHJA 2V3PA 1VRAB 5H8YE 5KYLA 1XWEA 2GB1A 5EPJA 1EYDA 1T3QA 2B2YC 3ZJVA 4ARIA 1DOMA 1AP0A 5CBEE 2K28A 3VRAB 1STEA 4K6DA 3VR2A 4RGOS 1EU4A 4KY7A 1KDAA 2JEBI 5M5WB 2ZW1A 2AUKA 2AQ2B 2H4OA 1B3AA 1NYRA 2RKSA 2AWNA 3ERQA 1RYJA 1U4MA 4PT5A 1EY6A 1PFBA 1SE4A 5CV4A 3Q8AA 1ILQA 3D6WA 4WQMA 2O4XA 3VYSA 2F0NA 3BDLA 1FNVA 4HJGE 2O5IC 4YTNB 2M9VA 1QKZA 4MT5A 2K5WA 1O7YA 4KHZA 1E7PB 2QEJC 2XRSD 4UDUC 2HTME 1GUWA 1KTKA 1M4VA 1ET6A 1TU2B 5JOBA 4K5XA 5EKIA 1ZOYB 2SNSA 1C4PA 4FF2A 4DAYA 1HHVA 3RFZB 3GB1A 5BMGA 1BR9A 1KNAA 2IL8A 2V3NA 3AE7B 1IYUA 1K83B 1EQTA 2NN6G 2LEKA 1PFDA 4IFDI 2OEOA 4NDXA 1CZPA 2NTSA 5E4XA 2K04A 2B76B 3AN1A 4YIJA 1RHPA 1ZPSA 2WIIB 1I4RA 1MVKA 2JXMB 3I70A 1MGSA 2F03A 1JQYD 3PUXA 3OMGA 1R4QB 4IUPA 3TBIB 2R61A 3NBIA 4DFAA 2X6LA 2M2LA 4H2AA 2EYHA 1HTLD 4KKSA 1Z6HA 1WXQA 3ND8A 1YN3A 1C77A 2F0TA 4K8IA 1FCCC 2D62A 2BB6A 4AQ7A 2BTEA 3S1NB 2JE6I 4FXCA 4EVOA 4XYQA 1KF6B 4MIUA 1YQ4B 2FBWB 4J3OD 3K0YA 1EU3A 3SVMA 1ENCA 4A3EB 3WCQA 4L23A 2JA8B 3Q22A 2L4NA 1HQMC 2YU9B 1JICA 1C4QA 1Y8PB 1E6EB 4HMIA 3AB5A 2B8GA 2G1EA 3BK1A 1NYQA 2WXGA 3IKJA 3QG1A 1STNA 2B63B 1HUMA 2B2TA 2EVBA 3NVYA 1LTTD 1HCZA 3P4QB 2ZT9C 5TSSA 4CJ2C 2CJOA 2HUGA 5M3FB 1KDBA 1K8OA 3SR1A 2F0FA 5CV8A 5FK9C 1SB3C 1S5ED 2JYEA 4H13C 1BCPB 3AMZA 4DXFA 4FP5D 2JP1A 4XXEA 3DXJC 4CGYB 4J8QA 2EY2A 2L12A 3CU7A 1G2SA 2E2HB 1MBYA 4YSXB 1RF2D 3BVGA 4REZA 1VZ7A 4K8JA 1MI2A 3H8HA 4NKLA 4WIPA 2ENBA 1FRRA 4LAAA 3M4YA 3NPPA 4IQZA 4I7ZC 3ND9A 3IXSA 3TDQA 1F2YA 1QLBB 4DA2A 1TKWB 4US9A 1NR4A 2D2CC 3FPUB 3U9SA 4F87A 5CV6A 4NP5A 1FCLA 3H6MA 3VQIA 2NYZD 3BK2A 4XT3B 2LJIA 1SSNA 4XDXA 5C0XJ 4GDLB 1ROEA 4C80A 3X3NA 3HP3A 2AQ3B 1BQQT 3SK5A 1EEFD 3FMCA 4KGSA 1ONLA 4XDCA 1PRTC 4FF1A 2JXTA 3VYUA 2NVXB 4OVZA 3SFDB 5FOBB 3M3YB 2JEAI 3ZJUA 1RTNA 2LMCB 3CHBD 3KWLA 5FO7B 2KN4A 1JROA 4TSSA 5KEEA 1TKGA 4ZKCB 1YN4A 3FVQA 4HAEA 4ZHOA 4XQJA 1EY8A 2IT1A 4Q5VA 5ELEA 1XTCD 1II3A 1A70A 3R8BA 1SNOA 1C4AA 3VA5A 1QCBD 5CORA 1VCIA 3LX0A 2L55A 4TMAB 2XIWA 2WACA 2DN8A 1DZ1A 1WSPA 5JVG3 3SXHA 4A3JB 4JWSC 1LACA 2F0VA 5HGTA 3C8YA 5EE3A 4RNAA 3HVZA 3OW7A 3MHZA 4XQQA 2FHTA 1KLUD 2B2UC 4QMGA 4JPSA 2NTTA 2BYTA 3S16B 4NMZA 3W5VB 3KQ4A 1WTVA 2KHSA 1AZQA 3KLRA 3T4AC 5IGEA 2A74C 3AE1B 3NZ3A 3VYTA 1UEAB 3AE4B 1HTPA 2N0SB 3AEBB 1NEKB 1KH0A 2CW0D 4LJZC 2HDEA 4BS9A 1PFMA 5JEAH 4A3BB 1O7LA 3NQIA 1ESFA 2G9HD 1A3TA 4IFDH 1SXTA 4N9PA 2NB0A 2A5HA 3MJ5A 3VA7A 2F0KA 4EQPA 3VR6A 1I4PA 5F2DA 3T3OA 5EBDA 4RWSC 4ULLA 1NENB 4YTPB 4ZOHC 1WTOA 1SNMA 2D9UA 1QOFA 1IGDA 3H0GB 2KVMA 3CRLC 2SNMA 4ZAIA 3P7JA 4MACA 4D2KA 4US8A 1MD2D 1K50A 1EFID 1O80A 1KDCA 3GTJB 4H7BA 4BY7B 3E9SA 2SAKA 3HS0C 2M19A 1D1KA 1B2TA 3AEFB 3KK7A 5C3JB 2MPMA 1L6VA 3AEDB 2ZXRA 1H9SA 2JQRB 4L1BA 3OWEB 4E6IA 4RFBA 4A93B 1QOHA 1XXGA 3B2FA 5IGCA 2LFNA 4CKBA 4TKOB 2QSDA 3S1MB 3ZQ4A 1LT4D 3DMUA 1L0VB 3ZJTA 5M3MB 3VR5A 3FDTA 4A6QA 1BXTA 2PO4A 5I2XA 3TZDA 4P2CB 3KBGA 3HKZB 3PIO3 3P1MA 5C0XG 1PDXA 4OO1G 1PTOH 3HVDA 4LLGM 1GHKA 2MGSA 2AUJD 5BYSA 5D14A 1BUIC 4A90A 3LXFA 1HFNA 2B2VA 2F0QA 3IFDA 2FINB 3QB3A 4J6HA 2JZPA 2Y5PA 2QCPX 1DCZA 1Y8OB 1Z7TA 1CHPD 5T8IA 1V97A 4WH4A 1PZID 3P1HA 1YNNC 4CBVA 2KCNA 2LGIA 1WTRA 5K5PA 2E75C 2C9OA 4PQXA 4OW0A 3U52E 5IIFA 1EYAA 4ARCA 5KGUA 5NUCA 3PMFA 2N55A 2WXPA 2PCFB 2QMTA 4JBWA 2N9KA 3C2PA 4KMUC 3N52A 2Z1CA 1A3VA 1QOBA 2TMPA 5EJWA 1TZOA 3FC4A 5FR3A 1Y1WB 1DXMA 3DEPA 1IW7C 1P7FA 2QIEB 3S2HB 5E3FA 3O13A 3L4PA 2OXPA 2J7ZA 3AE2B 4A55A 3PZ8A 1QNUA 2B2TC 2IX3A 2KDMA 5CV9A 4WRDA 4X3SA 1EYCA 4HCSA 3I72A 1RODA 3AV8A 4IUVA 3BZDB 1UNSA 3DEOA 3J9CA 2BT6A 4EQOA 5A2QL 1YNJC 2MH7A 5LNK1 5C2TB 2F0UA 2PVOD 3FAHA 1S5BD 2WDQB 2R93B 3PUZA 2RDHA 1V8CA 2JSVX 1C76A 3SR6A 2EY1A 1JMLA 3K5OA 3IAYA 2YYZA 2BOSA 4RHSA 1TWCB 3PO3B 2DNEA 1F0ZA 2GRIA 3ZGZA 1OO9B 2ID0A 2DYOA 1LTBD 3IL8A 4C2MB 2VZKB 1RM6C 4ZRZA 3P63A 4Q0FA 1A3UA 2EYOA 4RKLA 1I3QB 4HKQA 4FF3A 4KTAA 1FYCA 3PO0A 5J22A 4C7ZA 3S14B 1B9NA 3MFYA 2MHVA 3J80L 3WDNA 3NUCA 1E2ZA 2Q8TA 5HHDG 3OOCA 2IJ0A 5A2QE 3CIRB 1DONA 1ML0D 1L4ZB 2BE5C 3BS1A 2LHEA 1TYGB 2E2DC 5C6AA 2VUMB 2I2YA 4NZLB 2KOLA 4R9WA 5IODA 2KWDA 1AW7A 1J7AA 2J4XA 2NBFA 2Q8RE 3NWTA 2OF1A 3SE0A 5E4WC 4A3DB 4Z9CB 4B9WA 2B2UA 3Q8BA 1H9RA 5JAVA 1BO0A 1HFGA 2WP8J 1STHA 3QJYA 3K7AB 3GTKB 2OEDA 1RD9D 1KABA 3J80E 2A68C 3OSOA 3P4PB 5DEHA 2NVYB 1IHZA 3DHQA 2VB2X 4BY1B 1OXSC 5C4HA 2PVGC 3LYYA 3TSSA 3NXWA 1QWYA 1QOAA 2G9DA 1JE4A 1F2MA 1ZDVA 3KBXA 2WV6D 1HZ5A 1B44D 1HUNA 3VR3A 3A8IE 1LTAD 4HCEA 5COYA 3OWFA 1MSHA 3D4RA 4KGRA 1SDFA 1N63A 4WFN3 4M8AA 3HOYB 4OZCA 4BWGB 2PTLA 1NCVA 4KGTA 1STGA 4L8JA 3T53B 2PKOA 3I91A 1J9OA 2F3WA 3I3CA 2L52A 4MM3B 2WLBA 1EIGA 4PV1C 3MAQA 3LWUA 3V2TA 1Q3LA 1TWAB 5IGDA 4KHVA 4H0LC 4N6EB 5G3LF 3D8GA 1WTPA 5JEAJ 3W5UB 2PZTA 5AFWA 1ZXIA 4PNYA 4IFDJ 3QO2A 1UGJA 2ACZB 1S5DD 4YSYB 3TEXA 3E6ZX 4DAPA 4OIKA 1OXTA 3V96A 4IKGA 2BS4B 2WQYB 3AH7A 4ZQ3A 4AYBB 1EY9A 1QQRA 2IGGA 5FO8B 3OHXC 2WAQB 2RA4A 2WXQA 2RSOA 4ZRPA 4KY6A 3HOXB 1ZUD2 5M5YB 4XIGS 2MJDA 1YNTE 3BDOA 2VXWA 4K2KA 2DY7A 1GJXA 1QF6A 1GHJA 4ZUJA 2EYMA 3LNNA 3G7LA 4G57A 1G91A 3NE5B 1L0XB 3T3NA 3R93A 5FKAC 4BA1I 1JCKB 3GS2A 3VR9B 1PTOC 1JRPA 3GO5A 1JR0D 2F0DA 1DOKA 3A55A 1C9FA 1SYBA 4ZLTF 4C56C 5ISRA 4N58A 1ESRA 4JX1C 5D7GA 3NUHB 3HOWB 3MXNA 1YMHE 2B2VC 2AWOA 3AE5B 5C4ZA 2PLPA 2EJMA 4ITKA 5CV5A 1Z47A 1FMAD 2BA0A 2IX1A 3RLFA 3RMHA 2BCOA 1RCVD 3A7LA 1H9JA 1V1PA 1TWFB 2I07B 3TEYA 1F2ZA 1E10A 1ET9A 1QB5D 3E5SA 3FILA 1DM0B 1ZP0B 2MP1A 5KNBA 3TUOA 2FMCA 4QUFA 4FF4A 1XO3A 4XWWA 4FXDA 1F9RA 3Q69A 4ZRQA 3MP9A 1LTSD 4K5VA 3EQLC 1SYEA 1H9KA 3ETRA 5C3EB 4QIWB 1GOZA 3EGRA 4KKJA 3W2DA 2B39A 2A6HD 4NW2A 4C7YA 1SF0A 2EYLA 1LTGD 3PO2B 3Q0AA 4HR7B 2RBMA 1HQRD 3C46A 4FXGC 1SNQA 1O7ZA 1D1IA 1J7BA 3BVMA 2K03A 5FLXL 3UI3A 3T13A 3BVZA 3Q8EA 2D5GA 2MJ8A 1X32A 4L63B 1C78A 1JWMD 2WXNA 1MI0A 1J8IA 3BIID 1VZ8A 2XNAC 4V190 3SEBA 3I8ZA 1C8CA 1KNEA 5JVH3 3SK6A 5IOCA 5KNCA 3FEWX 4CJ0B 3PUVA 4HEDA 4KJOA 5KNDA 2KQ4X 1PXUA 3S1QB 1D2BA 5JXVA 4L6TB 3GQBA 5ELCA 1KAAA 1RKNA 1SFOB 1C79A 5JEAG 5CBAE 2JYOA 3GTMB 1BCPC 1LO5D 4IFDG 3RD4A 1Q1BA 1I6HB 3KLSX 2WXKA 4WORA 1TKYA 3HUIA 5HG2A 3S2DB 2L0CA 4HSPA 5FLXE 4NAWB 2PW5A 5BN5A 1G8ZD 5G3LD 2K05A 2L1BA 2KA7A 2F0LA 4S3SA 1NR2A 1VLBA 2F0WA 3I4NB 3M85A 3GTLB 3TEZA 4IURA 1FFUA 1Q8IA 4YWGG 4R3DA 4HSVA 3KUPA 5DM63 4K14A 4X3KA 1WTWA 1LV9A 1SBBB 1DD2A 2F4IA 2J0TD 2EPBA 3S9WA 3K5NA 2NVQB 2MJ3A 2K33A 1B4OA 4KI0A 3NTIA 2I38A 4IUTA 2N9LA 2K6AA 1R7SA 5HURA 3I4LA 5EPKA 3GP7A 1TWGB 3EA6A 1PUTA 4BBRB 5E6JA 4C1NK 2NMQA 1OXXK 4IZ8A 2IGDA 5H92C 4UAIA 3NRZA 1CFMA 2A69D 2RQXA 3OPOA 4A3KB 2PMZB 3SDZA 2KUMA 3E0JA 3SHLA 1TS3A 3QIAA 4HROA 5I6YA 3MFGA 3TN2A 4EE2A 1EL0A 3KWVA 3OMCA 2J53A 3HOZB 1WTXA 1F9SA 1HA6A 4G4KA 5C3XA 3A8KE 1SMYC 3K57A 1K51A 1Q1EA 2KMMA 2ZXOA 2DLBA 1BDOA 1FR3A 4ME5A 1CHQD 1C48A 4QUCA 1BOSA 2E76C 2O5JC 4P6VF 4KX6B 2XSCA 5BN4A 5DAUA 1UWXA 2WB1B 1IW7D 4WJWA 4HEA1 1CQVA 2Z4HA 1PGAA 5EQ0A 1EM7A 3NSWA 5JPNC 1SNCA 1WVLA 3VYRA 4LTUA 3R2IA 3MXPA 3NVVA 1HZ6A 4JK1C 4C3IG 4WURA 2F0MA 3MWYW 3AE9B 5AUKA 3KF8A 1C4CA 2WXJA 1EZ8A 3FKIB 2Y3AA 1SSOA 3A54A 2LKVA 3I73A 2K5PA 2JSOA 4H44C 3TZUA 2PIAA 2BW2A 1L4DB 1LLRD 5I2YA 2E3TA 1X3PA 2H89B 4LMQD 2JA6B 2EELA 1H9MA 4DNRB 2K3UA 1GAQB 2WINB 4BBSB 2F1MA 4RA8A 1NUCA 4OZAA 1S4ZA 1PTOF 2F0JA 2L9HA 3WOFA 2QF7A 3NVWA 4KJNA 2KQ3A 1S5CD 2M0AA 2DNCA 3I90A 3IAS1 4B0MA 4V0BA 1EQVA 1E0BA 3ZYYX 3TP8A 1LT6D 5D3IB 2AX5A 2IDYA 1EY0A 1T5EA 3K6OA 1FGBD 3H94A 1IBXB 4CJ1B 5GXGB 1UUPA 1GUGA 1R9TB 4A3MB 3B2GA 3EJIA 1HPCA 1RDPD 1W6JA 5EE0A 1GUTA 2K5QA 3P75A 2L5TA 1TJEA 4TQ1A 4IUUA 3EROA 3NK9A 3MEHA 2EY5A 1WWTA 5M9OA 1DOYA 2ZW0A 1U4RA 3AEAB 4Y7NB 2WXHA 1K52A 5KYIA 1F9QA 2W82A 1QE6A 2WXIA 4FO2A 1DYQA 1ZYRD 3U2SC 5BMIA 2Y0SB 4ODGA 3DWGC 2K7VA 4PMCA 3J7AV 4G7ZC 1V1OA 1WGKA 3MZ5A 3NHHA 4IN3A 2XRQD 2A68D 2K1BA 4Q2JA 3NTHA 1W6KA 2WU5B 1XEEA 5EKLA 4N9TA 3P4SB 4JWUC 5IT9L 2SDFA 5HI1A 4MH8A 2EY6A 1GXDC 1SE2A 3GD7A 5EBCA 1BF4A 2EYPA 5KIXA 1VMPA 3IFTA 1Q10A 3RPFC 2IWHA 3Q6SA 1UAPA 3WOEA 3D4WA 1I4QA 2XWJB 2IPKD 2X6GA 5CMDA 4A9AA 3TMEA 3AE3B 2K9XA 4USAA 3J81L 1BCPF 1XCQL 4HTHA 1PRTF 5I9OA 4QF4A 1Q12A 1Y56A 1DOLA 2R6GA 4QCLA 2RSNA 4DN4M 3BG3A 2VB3X 4N59A 2K5DA 2J52A 2ONQA 1QNKA 4WAFA 3H09A 4U68A 3EVQA 3JAML 2HDMA 1HRJA 3EUB2 2HDLA 2KECA 1FXAA 2NN6I 2JA7B 1CZWA 1JOOA 4KV6A 2HCIA 1A2UA 4C3JB 3IAM1 3Q23A 3G6JB 3FPPA 2PNRC 1EIHA 3AE6B 3SK4A 1MHXA 2DBYA 3OIQA 1E2WA 1PGXA 2F0GA 5CGKA 1CM9A 2O2LD 4XQNA 4YTMB 1MHHE 2LMCA 2WNMA 3J81E 1FXIA 1NAPA 4RKBA 1CJEA 4FNFA