3QHTA

Crystal structure of the monobody ysmb-1 bound to yeast sumo
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
KPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Isoform-specific monobody inhibitors of small ubiquitin-related modifiers engineered using structure-guided library design.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags De novo protein
molecule keywords Ubiquitin-like protein SMT3
total genus 20
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3qhtA00
4GXBA 1V86A 2KLGA 3PZDA 3DQVA 4DHZB 2NPTB 1XQQA 2KQSA 2NS5A 4FADA 4IW0A 3EECA 4PS8A 5IAAC 2MBBB 2DENB 2MBEA 2J0MA 2MCNB 2M4NA 3WIMA 2ZEQA 4KV2A 4BBNC 1V5OA 4KDLB 2AL6A 2CKHB 2KZRA 2WX1A 3M95A 4M8NA 5JHAA 1EUVB 2IO0B 2JRHA 2D3GA 2L76A 3L0WB 4GGQA 2KWCA 4DDGD 3JSVB 2LWPA 1E7VA 2DHZA 2JVCA 2N9PC 3A1QA 4NPNA 2AWTA 4GDKB 1YX5B 2LD9A 2KX3A 5GMVA 2WDTB 2PEAA 3ZW3A 1OQYA 1G6JA 2KFKB 3W1SA 3IBEA 2ZCCA 4JLCA 4EOYA 5D7GA 4OVUA 4BOSC 1YD8U 2A4ZA 1J8CA 4ZDVA 5KHQA 4DHZE 2I1JA 2JY6A 3KUCB 4ANVA 5E6NA 3ZO5B 3HK0A 3KUDB 3SD5A 1C3TA 1R4MI 2V1YA 4WJNA 1ZW7A 4CHKA 3VXWA 3JW0X 3PPAA 1WGRA 3I3TB 1FXTB 4WQOB 3R66C 1LQBA 2KDBA 3PGEA 4GIVA 4I6PA 3GZNI 1WR6E 2LRUA 2REXA 4XX5A 3M63B 3ZUNA 2K8BA 1UZXB 2KX0A 3TCAA 5C23A 1WZ3A 4I6LB 5DPSA 4TUUA 1WI0A 2V4LA 3AU4A 3IFWB 1E7UA 4W9CA 4K1RB 2MBOA 4GOCA 3BINA 3P2BA 5TR5A 3QAQA 1JRUA 2DZJA 4NAWA 2XK5B 3R7QA 1AARA 5DPRA 2RPQA 4FBJB 1E8XA 3B0AA 3ZLZA 5CHVC 1GC6A 4EZLA 1Y8RC 3OJ4B 1ZGUB 3MTNB 4NY0A 3VVWB 3VTUA 4G50A 3NZSA 4IC7B 4LJPB 4GSWA 2N1WA 2CHXA 2JZZA 2KLCA 1SGHA 2LASA 3RCZA 2ASQA 1RFAA 1WJNA 2FCSA 3SDLC 2Y5BB 4A20A 2LVPA 2PE6B 2JXXA 4W9DA 3AULA 3ZIMA 4HDQA 4W9JA 2DYOA 2MLBA 3VH4B 2XK5A 2D11A 2MX2A 4MGKE 5KHOA 1OTRB 1WE6A 2K1FA 3V62A 2BPSA 2M8SA 4W9GA 2FCMA 3LDZE 2DX5B 1M94A 5J18A 4KZCA 2J0JA 1TBEA 1WE7A 4FULA 4MH0E 2WWZA 2BKRB 2BYFA 3APDA 4EKUA 4TQ1A 4MM3A 2C60A 2FNJB 2Z0DB 2JWZA 3VDZA 2IO3B 1QZEA 3K9PB 4FHKA 1H8CA 1IYFA 2EMSA 4TKNA 3JYUA 2IZVB 2L05A 3T9LA 2KO3A 3QQ8B 2K6DB 4K81A 4B9KA 2DZKA 1KLVA 4KSKC 2FCQA 3QCAA 2EKEC 4RM9A 4MELA 5E6OA 3ZNID 3NOBA 3PRMB 1RLFA 2NBWB 2DYBA 2K6QA 3PTFC 4B95A 1YQBA 3VQIA 3QC8B 4KIKA 2B3AA 2LVOA 4NNJB 3X0WA 3DBHI 1I42A 2GBNA 2K39A 2DAFA 3QARA 2LXAA 5L95C 4CO7A 1V6EA 3A9JA 3ONSA 2DYMA 4M8MA 2L8JA 4BOZB 3U7DA 3PSEB 3A1QB 2BF8B 2JZ3B 4WAAA 1UELA 3RUIB 4DHJD 4X57B 4K7WA 2NBUA 3LJ3A 3WA0A 1VD2A 1SE9A 3PHWB 5IA7A 3B1LX 2HE7A 3DPDA 2K8CA 4AUQC 3PT2B 4W9IA 3TL5A 4ASWC 4HJKA 1WXVA 3QJZA 4AP4C 1WXMA 3K9OB 4W9HA 4AJYB 2C7MB 3UINB 2MP2A 3ZTDA 1K8RB 3KW5B 3TIXA 2MW5A 1E5WA 4MDKE 2LGXA 1XD3B 1EO6A 2GBJA 2MA9B 2WYQA 3Q3JA 1WGYA 2G45B 3HHMA 2ZNVB 3NHEB 4HCNB 3A9KA 4ICUA 3TJPA 4GN1A 4W9LA 4G0NB 2LZ6A 2ZZPB 4J6IA 4W9FA 5JH5C 3PV1A 1UBQA 1WFYA 1WM2A 3IHPC 1WYWB 3PHXB 2BYVE 2FCNA 1WF9A 3H9DA 1LM8B 4DXAB 3A33B 3A9JB 2KN5A 2MQJA 4B6WA 4PS7A 3VUYA 4IUMB 3ZRCA 3UIOB 4KZ0A 3B08A 3JSVA 3PRPB 3Q3FA 4HPMB 3U8ZA 4K7SA 3V60A 1IP9A 4A3OA 1V81A 2FAZA 4IWOA 2BWES 2DZIA 1EF5A 4IWPA 2KWVB 3KUZA 4N9F4 2ZVOA 4FLHA 3PREA 2IY0B 2K25A 3A4RA 3ENEA 2JT4B 4JIOU 4TQ0A 4ANWA 1WJ6A 4A3PA 4WWPA 3DBRI 4HDOA 2GBMA 2N7DA 3RD2A 4IM3A 1LXDA 3IVFA 3EFUA 4BKTA 2LGYA 3A9KB 3ALBA 1ZKHA 3ECIA 4OVVA 3HM6X 1WXSA 2CHWA 2KJHB 2C5LC 4MGZE 1UGMA 3N30A 1U4AA 1WMHA 3O65B 1J0GA 3OAWA 1R4NI 3L17A 1GUAB 2G3QB 1H4RA 2O2VA 3UF8A 4II3B 4KVGB 2W9NA 2NCNA 4EZJA 5LXHA 1VCBA 2CU1A 3UQBA 3DBSA 1KOTA 2LI5A 5HKHA 1I35A 3RZWC 3ZNZB 5CX3A 3KYCD 4DBGA 2ZPNA 4PYUA 3TMPB 3NZUA 3QX1A 4FJZA 1P0RA 1T0YA 4ZRJA 3TBLD 2AL3A 4GB9A 2HTHA 5LXIB 1OEYJ 1Q0WB 5G55A 2RD0A 3QWZB 4MJSA 4LCDE 5BO4B 3VTWA 2MBHA 2R2QA 2KJRA 2UYZB 3CSFA 3APFA 3BY4B 2J7QB 3H7PA 3H6NA 3JVZX 2KD0A 3WAOA 5J17A 3NS8A 5DPWA 1NBFC 3CF6E 1P1AA 4MJSB 3QK0A 3ZTCA 4I6NB 2KJ6A 4IM0A 3ZVVA 2IBIB 3H1UA 3N32A 4BFRA 4EEWA 3IG3A 2AEHA 1KJTA 3KYDD 1WM3A 1C1YB 3H7SA 3PVLA 2CHZA 3SHQA 1E8YA 3HM3A 3KH0A 2NBVB 2KTRB 2NVUI 4YL8A 3V6EB 2KTFA 2FIDA 2C7NB 3PLVA 2O2VB 1GG3A 4F8CB 2IO2B 4WWNA 4DDID 2LVQA 3M3JA 2JF5A 2KNBA 2OJRA 2LJ5A 3L08A 2UWQA 3VTVA 4ANUA 1X1MA 1P3QU 2GBRA 2GBKA 2YVCA 2HD5B 5FR6A 4IWQA 3ZNHB 2M1MA 2IY1B 4PS3A 2OOBB 4BVUC 3RULA 1WMHB 4K7UA 3VUWA 3ZRFA 2KFKA 4HCPB 2KTRA 4NJ7A 2PJHA 2RGFA 4HK2A 4HWIB 3KVFB 2AYOB 2O6VD 1UD7A 4JL9A 2O6VA 4F1SA 1V2YA 5D6JB 1NI2A 2DZMA 3AXCA 4TV3A 3DBLI 5CHFA 4KSLC 4KDIC 2KMAA 3APCA 4HPLB 3ML8A 5AZFA 3ZNGC 3MJWA 5AZGA 5JHBA 1WX7A 1S3SG 3W1SC 2KKCA 3N3KB 1P98A 1WJ4A 4DWFA 4KIKB 2V3SA 2ZVNA 3UIPB 1WH3A 2G4SA 2C7HA 1WIAA 3AI5A 2HJ8A 3GOEA 4URKA 4F7ZA 2MSED 1UBIA 4II2B 4CYEA 2JUOA 2KC1A 4NQLB 1WRDB 2FUHB 3RZFA 3SU8X 2L0FA 3PLUA 3L13A 4XZ4A 3CMMB 2ZPYA 1TTNA 3C0RB 3R3MA 1MG8A 4BKSA 2L0TA 3WAMA 1PQSA 2D07B 2N7EA 3QA8A 4BKSD 2XBBC 1A5RA 2CS4A 1WXAA 4MGYE 3DVNV 5D94A 2IYDB 2EMTA 4FJVB 1E8WA 4WWOA 1Z2MA 2KMCA 5AZHA 3RYTA 1E90A 2LRWA 1F9JA 3U30A 2LGDA 3L10B 3OJ3A 3CSTA 4FJYA 3V6CB 1Q1OA 5AEKB 3HIZA 1LFDA 5E6PA 4ANXA 4DHJB 2C9WB 3T8MA 2KDEB 2KVRA 1L2NA 4HVBA 1WJUA 2Z59B 2ZJDA 3EC8A 2N1VA 1V80A 2L3ZA 1ISNA 3M62B 3VH3B 5CHWA 4AWJA 2A5UA 4AJWA 2ZNVC 3DVNU 2KHWB 4BBNF 1RRBA 4IM2A 2LUEA 2NR2A 2M0XA 4MEMA 1L7YA 4RMAA 3ZDMC 3VAWA 1TGZB 1Z5SB 4ICVA 1V49A 1BT0A 5J2RA 5LLIA 1EF1A 3S2AA 4BKGA 1YX6B 4ZYNA 3WANA 1KM7A 3D32A 2DAJA 2KANA 2L7RA 1IPGA 5G2NA 2LXCA 4WJOA 4E3CA 3VHTC 4DK5A 2KOXA 1V5TA 2BGFA 2CR5A 2Z0EB 4GMVA 3R7RA 2BKFA 4G11A 2QHOA 2N4FA 1TZ1A 2PPHA 2L00B 3DCGA 2ZCBA 4HXDA 1YIWA 2PE9A 3WALA 4GU2A 4FA6A 2KDFB 3EHVA 4MSQB 5DPTA 1OEYA 4ZRKA 1J19A 1WR1A 1XT9B 2KC2A 4GDLB 1WGHA 3UGBB 2KDIA 5EDSA 5JZEB 4G3XB 4NJ6A 1RAXA 1WGGA 2BWFA 2D2QA 4PYZA 5CTRC 3V61A 2MBQA 4P7IA 2G4DB 3QHTA 3L16A 1OGWA 4EUTA 1WZ0A 2KK8A 2K8HA 4FHJA 4WJQA 3OLMD 1UH6A 4IG7B 1CMXB 1GC7A 3VUXA 2JRIB 1Q5WB 2FIFA 2GMIC 2M17A 4M0WB 3VFKA 1WGDA 2J0KA 5DCNA 4FN2A 2JPHA 3H7PB 2KFJA 4LDTD 2R2OA 4HLEA 3AU5A 3DDCB 3DVGY 2IO1B 1V9JA 4LDTB 3WAPA 2MWSB 4GDKA 1D3ZA 1WX8A 2KXJA 4XC2A 3ML9A 1NDDA 3PRZA 2KWUB 2O6VB 4LJOB 3L54A 1SIFA 4ZRIA 3DVGX 3A4SC 2RR9A 4MSMB 1GNUA 3RT3B 3UQAA 3MHSD 3NY5A 2D10A 3ZDTA 3PS6A 4EFOA 2I1KA 2RSUA 2N9EB 4RM8A 1P9DU 2MRPA 2YLMA 1YJ1A 4AOFA 2GOWA 4NAWB 2VRRB 1HE8A 1WY8A 4NQKE 5L83A 3QIJA 2N9XA 4W9KA 1GJZA 4E71A 4EZKA 4W9EA 5D2MB 3W1YA 5C1ZA 3X23A 2NPTA 4GDLA 1E8ZA 4JQWC 1S1QB 2KQ7A 4WJPA 3DOWA 4E74A 4MGIE 1WX9A 2MP2B 3ZKJC 2XEWA 4JGHB 2BYEA 2WX0A
chains in the Genus database with same CATH superfamily
1UWXA 1XLNA 3DQVA 3DWGC 2NS5A 1XQQA 4L23A 3B9JA 2NTSA 5IAAC 1V5OA 3M95A 3L0WB 1PGAA 1WSPA 3N1XC 2LWPA 3ZYYX 2VH2A 2DHZA 3A1QA 2AWTA 4OW0A 1QLBB 2GRIA 2PEAA 1PFDA 4M0WA 5IKCM 4ITKA 1VZ7A 3UI3A 1J8CA 3SEBA 3Q6BA 1DYQA 1HZ5A 3O13A 4IOIE 4CHKA 1WGRA 3I3TB 1FXTB 3BIID 4I6PA 2LMCA 1WR6E 2REXA 3ZUNA 1E6EB 5C23A 1WZ3A 1E7UA 4WQMA 2QIEB 4GOCA 3BINA 1L0YB 4NAWA 2XK5B 1HTQA 1AARA 4HEA1 3FILA 3B0AA 1FCLA 5CHVC 2Y5CA 4NY0A 3VVWB 1MVKA 4IC7B 4A55A 3BYYB 2CHXA 2JZZA 1N5WA 3NVYA 1SGHA 3RCZA 1TKGA 2QSDA 4DQOC 2BS4B 2QC8A 3AULA 3ZIMA 2D11A 5KHOA 3FKYA 1QOAA 3LDZE 5J18A 1M94A 2KAJA 4EKUA 4TQ1A 2K5PA 1QZEA 4FHKA 1H8CA 2DBYA 4FXCA 4MELA 3ZNID 1VZ8A 3PRMB 1I4GA 1D5MC 1KLUD 4O1NA 1JWSD 1XLPA 2KVZA 3I63C 4KIKA 2JZPA 3X0WA 3DBHI 2LFIA 3AH7A 2LXAA 5L95C 1R4MB 2PMVA 1YN5A 3PSEB 2PTLA 4K7WA 2NBUA 1JCKB 3BVGA 5IA7A 3DPDA 2HE7A 2N9KA 4AUQC 4WAFA 4PK1A 1SXTA 1WXVA 2J42A 3QJZA 1NVID 3K9OB 1YJJA 2M0AA 3UINB 2GBJA 2MA9B 2G45B 3HHMA 2HJ1A 3H8HA 4ICUA 3TJPA 2ZZPB 4W9FA 4J6IA 3PV1A 1UBQA 3PHXB 4OZBA 1KTKA 3Q14C 4DXAB 3EFCA 2BTEA 1JWUD 2LHEA 1IP9A 2INDC 2FAZA 4IWOA 3FILB 2DZIA 2KWVB 1JWAD 4TQ0A 4ANWA 4A3PA 4WWPA 4HDOA 2GBMA 4IM3A 4KKIA 2MHJA 2LGYA 3ALBA 5HG2A 5C2TB 3T3NA 2KACA 2V4IB 2L32A 4TMAB 1PGBA 2VZKD 3AB5A 1J0GA 2GI9A 3BK2A 4C7ZA 1E0ZA 4II3B 4M00A 1VCBA 1HXYD 4N58A 2LI5A 1M4VA 5HKHA 1TY0A 3KYCD 1XXGA 4FJZA 2JXTA 4ZRJA 1TIFA 2AL3A 4GB9A 5G55A 4MJSA 1C76A 4HKZE 3VTWA 2UYZB 2KJRA 2I2YA 1AWDA 3Q8CA 4Q2JA 5J17A 1KH0A 3ZTCA 3N32A 3H1UA 1C79A 1C77A 1WM3A 3PZ7A 3AEAB 3DHIC 2SEBD 1C4PA 3HM3A 3V6EB 2KTFA 2FIDA 4OZCA 2WHIA 1ZP0B 2IO2B 4WWNA 1TY2A 2LVQA 3M3JA 2KNBA 2UWQA 4ZYSA 4ANUA 1FMAD 1X1MA 2GBKA 2YVCA 3AECB 3R2TA 3VUWA 2KTRA 2O6VA 1NI2A 3AXCA 4TV3A 3TSSA 1SE4A 4WIPA 3ZNGC 5AZGA 4LNKA 4WH4A 3W5UB 2V3SA 2ZVNA 2QEJC 5EE1A 1UBIA 2KC1A 3RZFA 4XZ4A 3R3MA 1MG8A 2N7EA 3KLSX 2BVCA 2XBBC 2UU7A 4MGYE 2LJIA 4WWOA 1KFYB 2R61A 1F9JA 4YTNB 3ETRA 1Q1OA 2Z8LA 3HIZA 1LFDA 5E6PA 1P7EA 3V6CB 1L4ZB 4ANXA 3IAS1 2KVRA 2WDVB 3AE9B 4GLSC 1LGRA 2A5UA 4JWUC 2ZNVC 2LUEA 3VAWA 3RNBC 4C7YA 2NMQA 1V49A 1BT0A 5J2RA 1EF1A 3WANA 5IN7A 3D32A 1VRAB 2KANA 2L7RA 1IPGA 2XNAC 2MH7A 3AE2B 5C3JB 4XYCA 3TEZA 3I5JC 2QHOA 4K3CA 1TZ1A 2ZCBA 4MSQB 3CIRB 4ZRKA 2BYTA 1XT9B 2KC2A 4GDLB 1A70A 5JZEB 3P1MA 2WU5B 5CTRC 2L83A 3V61A 1IGDA 1OGWA 3FC4A 1WZ0A 4N6EB 1RYJA 4B0MA 3OLMD 1GC7A 5FKAC 1J7BA 3I57A 1T0RC 5DCNA 2KFJA 4HLEA 3AU5A 2JSVX 1DOXA 3DVGY 1V9JA 4LDTB 1XF5L 4YSXB 1NDDA 4ZRIA 4NZLB 3NY5A 3ZDTA 3PS6A 4KGRA 4EFOA 1FD6A 1PYWD 4RM8A 2MRPA 1N63A 1YJ1A 2ZW1A 3U2SC 1WY8A 3QIJA 2N9XA 4S0RA 4LNFA 4YTPB 4YTMB 1V1PA 2J52A 3KWLA 1C4CA 1N62A 2OEDA 3C19A 3SR6A 4MGIE 1WX9A 3L10B 3PZDA 4IW0A 3EECA 4PS8A 4ZRQA 2MBBB 2DENB 2MBEA 2MCNB 3WIMA 4KDLB 1JALA 2WX1A 1D4BA 2JRHA 4GGQA 2V3NA 1QOGA 1MPEA 2D3BA 2JVCA 2N9PC 4NPNA 4DXGA 4GDKB 1YX5B 2LD9A 1YN3A 1K51A 3ZW3A 3E56A 2CU3A 3CWIA 2KFKB 3FAHA 3W1SA 4JLCA 2CJOA 2LUMA 2PLPA 1PDXA 2A4ZA 4ZDVA 2IGDA 2I1JA 4ANVA 5BYQA 4A8XC 1R4MI 1ZW7A 3Q3OC 3PPAA 4WQOB 2K8BA 3TCAA 2JYTA 3MC8A 1WI0A 2V4LA 1F77A 1IGCA 3AU4A 4TUUA 1N60A 2MBOA 2RDBC 3P2BA 4C00A 1E8XA 1RWSA 1GC6A 1JRPA 4EZLA 2KDMA 3HUIA 4M02A 3OJ4B 1ZGUB 3VTUA 2D5GA 4LJPB 3NJTA 3BWUD 2LASA 4RCOA 1WJNA 2FUG1 3SDLC 2Y5BB 1CZPA 4W9DA 2MLBA 2EKIA 2N7JA 1D5ZC 2K1FA 2BPSA 2M8SA 4W9GA 2FCMA 1WE7A 4FULA 4MH0E 2WWZA 5HI1A 1TS4A 3APDA 2C60A 1IBXA 2IO3B 3K9PB 1IYFA 2EMSA 1I4HA 1GB1A 4TKNA 3T9LA 2KO3A 3QQ8B 2K6DB 2WLBA 2DZKA 4B9KA 4YWGG 4B0EA 1ACCA 2EKEC 3NOBA 1RLFA 1OFFA 1RM6C 4OHJA 1DGJA 4B95A 3QC8B 2LVOA 1JW9D 2GBNA 3AMZA 1QF6A 4CO7A 1V6EA 4WWMA 5IOIA 2L8JA 3RPFC 3U7DA 4WAAA 4DHJD 4X57B 2L52A 3WA0A 1VD2A 5G5GA 3B1LX 2K8CA 3MJ5A 3PT2B 5AUIA 4ASWC 1WXMA 2JU6X 1MHXA 2MP2A 3ZTDA 1K8RB 3KW5B 4KX6B 1L0VB 1VDVA 2LGXA 3RNAC 1XD3B 1EO6A 3Q3JA 1WGYA 4HCNB 2PVOD 4G0NB 2LZ6A 3LXFA 1SSNA 3AE6B 3P63A 3AE7B 2KN5A 1TT5B 2BW2A 1I4PA 5IO9A 4IUMB 3UIOB 4KZ0A 1ROEA 2RDGA 3PRPB 3V60A 4K7SA 2EELA 2BWES 4N9F4 4RFBA 2TSSA 4FLHA 3PREA 3ENEA 2JT4B 1I4XA 1WJ6A 2WP9B 2AQ3B 3AE3B 1IBXB 1LXDA 3IVFA 4KGSA 1XLOA 3A9KB 4OVVA 1WXSA 2CHWA 3U4EG 2C5LC 5HFYA 2WDQB 3O65B 3L17A 1GUAB 3GS2A 4KVGB 2WQYB 3DBSA 1KOTA 1WXQA 3ZNZB 2CJNA 4PYUA 3NZUA 1HEZE 3RNFC 1P0RA 2WXQA 3IAM1 1T0YA 3TBLD 3V05A 2GLSA 1T6BX 3H7PA 3W2DA 1KLGD 3WAOA 3CF6E 4MJSB 1YOVB 3ZVVA 3KYDD 2KWDA 1C1YB 3H7SA 3PVLA 1UWMA 4XDDA 2NVUI 2PKOA 2C7NB 3PLVA 1GG3A 2M19A 2JF5A 2OJRA 1UNSA 2LHDA 1NEKB 1JROA 3ZJTA 5FR6A 2IY1B 1WMHB 4K7UA 2KFKA 4BAXA 4HPPA 4S17A 2RGFA 1JQ4A 2AYOB 2O6VD 4ZRPA 1UD7A 2ZW0A 4JL9A 5D6JB 4KDIC 2QILA 2AQ2B 5JHBA 4HRSA 1SBBB 2WNMA 2HJ8A 5D3IB 2W82A 2MSED 4II2B 4NQLB 3SU8X 1SB3C 3L13A 3Q8FA 4RGMA 1B9RA 2ICIA 2ZPYA 3C0RB 1PQSA 1VJKA 1A5RA 4FJVB 5BYRA 5AZHA 5TSSA 3DWMA 1D5XC 3CSTA 3AE1B 2LEKA 2GB1A 3T8MA 4HVBA 2Z59B 2ZJDA 1TS3A 2IJ0A 2L3ZA 1ISNA 1QT9A 5CHWA 3V3XA 4AWJA 2KHWB 2BQQA 2SAKA 4IM2A 3MC0B 1L7YA 1BUIC 4ICVA 3GE8C 1WGKA 2KMMA 2JX5A 1KM7A 5G2NA 2LXCA 1SF0A 4E3CA 4DK5A 1V5TA 2BGFA 1NENB 3R7RA 2L00B 3NUHB 3WALA 2PE9A 3IT6B 4REZA 2KDFB 1OEYA 2IPKD 1WR1A 3I9V1 1FIQA 3P4RB 1WGHA 3UGBB 2H88B 1ZXHA 5EDSA 4G3XB 1RAXA 2BWFA 3Q3MC 4IKGA 3ZJVA 3RNEC 2KK8A 3AEEB 4IG7B 1CMXB 3VUXA 1Q5WB 2M17A 2JPHA 1HQRD 3AEFB 4ZHOA 1D3ZA 1FCCC 3B2GA 1F2RC 3ML9A 4LJOB 3UQAA 3A4SC 3RT3B 2D10A 2Q5WD 2YEPB 1ZDXA 1T0QC 4ZHPA 2GOWA 4NQKE 1WWTA 5L83A 4EZKA 4W9EA 3NRZA 4NJCA 3W1YA 3X23A 2NPTA 1ENFA 1S1QB 4WJPA 3DOWA 4YSZB 4JGHB 1K52A 2NPTB 2KQSA 2J0MA 2M4NA 1Y56A 2JQRB 4US9A 2CKHB 5T8IA 1GB4A 3BVMA 1L6UA 2KWCA 4DDGD 3JSVB 1E7VA 2N0SB 2BS3B 1OQYA 4EOYA 2WDRB 5D7GA 1L6VA 4A6QA 2G1EA 2V9HA 3URYA 1I4RA 5GXGB 2JY6A 3R8BA 5E6NA 2WXHA 3HK0A 3KUDB 4WJNA 3JW0X 3ZXVA 3R66C 1LQBA 2KDBA 4P16A 2LRUA 4LLGM 2JYEA 4I6LB 5DPSA 4A90A 4W9CA 5TR5A 1EU4A 1JRUA 1MI0A 2DZJA 4LNOA 3R7QA 4QAYA 4FBJB 1QOBA 3VR9B 3MTNB 2IGGA 4G50A 2WXFA 4RNAA 2KLCA 4AQ7A 2ASQA 1TJEA 2FCSA 1WYGA 2LVPA 2PE6B 2JXXA 4W9JA 4MM3B 2MX2A 4MGKE 1T5XD 3U7ZA 1OTRB 1WE6A 3V62A 1J7CA 2HTME 1FNWA 2J0JA 2X38A 4RF0A 2IGHA 4JE3B 4MM3A 4UDUC 2FNJB 3VDZA 2JWZA 1V1PB 1JMLA 2L05A 5E6OA 4RM9A 3DHHC 1C4AA 2NBWB 2WS3B 3RNGC 5MPOA 3VR8B 2IDYA 3EGRA 1C78A 3VQIA 2NTTA 2B3AA 4NNJB 3ONSA 2DYMA 4M8MA 3PO0A 5JXVA 4M01A 3J9CA 1UELA 3GE3C 4NAMA 1SE9A 3PHWB 1AW7A 3L4PA 1TKYA 3U52E 1YNTE 4LTUA 2K22A 4W9IA 1SIJA 4HJKA 4C4VA 3ABVB 1EWCA 2D3CA 4XWWA 5HHDG 3TIXA 4HKQA 1E5WA 4PT5A 2KN4A 3AN1A 4JPSA 1RFKA 2MJEA 3A9KA 4GN1A 1EU3A 4W9LA 3LYYA 3Q69A 5JH5C 1WFYA 3IHPC 2BYVE 2WXKA 1WF9A 3A33B 4JX1C 3VUYA 2PW9A 1VZ6A 2E6XA 3JSVA 3Q3FA 4HPMB 1FNUA 4IDIA 3U8ZA 4A3OA 2QJLA 1V81A 3BVZA 3N20C 3KUZA 2ZVOA 3A4RA 2K25A 3RN9C 3DBRI 4H2AA 2N7DA 2MEKA 4BKTA 3ECIA 1ZKHA 5BMGA 3EA6A 4MGZE 4OZAA 3N30A 1WMHA 1MHHE 3OAWA 4XE0A 1IUEA 2G3QB 3P4PB 1SE3A 2O2VA 2WXJA 4P6VF 2W9NA 2NCNA 3N1ZC 2CU1A 3UQBA 3NZ3A 2K3UA 2BB5A 1I35A 1ZPSA 3RZWC 5CX3A 2ZPNA 2PVGC 3QX1A 1NYQA 3B2FA 2HTHA 3KQ4A 2LGIA 3QWZB 4LCDE 1R4NB 4CQNA 3CSFA 3APFA 3BY4B 2J7QB 3H6NA 3JVZX 1N5XA 2QDFA 2W3SA 3NS8A 5DPWA 1NBFC 1P1AA 3QK0A 4IM0A 1XLQA 1FRDA 3OWEB 1TKEA 3IG3A 2AEHA 3SHQA 4N59A 1B1ZA 3KH0A 1BXTA 2KTRB 4RH6A 3KWVA 4XWTA 1TZOA 1K50A 1CQVA 2LJ5A 3L08A 1K53A 1FXAA 3Q2AC 1N61A 4IWQA 3ZNHB 4D2KA 2M1MA 4PS3A 3RULA 2M56B 3ZRFA 2HDEA 4HCPB 1HZ6A 4NJ7A 2PJHA 4HWIB 4LNIA 4C56C 2BS2B 1N6ZA 5CHFA 2KMAA 4HPLB 3ML8A 5AZFA 1VR9A 2BB6A 2I38A 1S3SG 4YSYB 1P98A 1FO4A 1PUTA 4WURA 1WH3A 3T3OA 1WIAA 3AI5A 2KT7A 2L1AA 2JUOA 1WRDB 1NI3A 1OQRA 1V97A 2L0FA 4C80A 1GPXA 2RMMA 3CMMB 1ET6A 5AUKA 3AEDB 3WAMA 3QA8A 3AE5B 4BKSD 3MFGA 1E7PB 2CS4A 1WXAA 5D94A 2EMTA 1E8WA 5EE0A 2KMCA 1J7AA 2DLBA 5LNK1 3RYTA 2LRWA 3U30A 3MHZA 5AEKB 3RI7C 4DHJB 2C9WB 1D6EC 2KDEB 1L2NA 1WJUA 3P4SB 2AX5A 1V80A 1V8CA 4AJWA 3DVNU 2W55A 4RGOS 3IT4B 4RMAA 3ZDMC 1Z5SB 1Q10A 2INPE 3S2AA 4BKGA 5FR3A 2KOXA 1FRRA 2CR5A 2Z0EB 4GMVA 1I7HA 2N4FA 4HXDA 1YIWA 1EWYC 5H92C 3PZ8A 5DPTA 3OG5A 1J19A 2WXNA 3GB1A 3MC9A 1FFVA 4NJ6A 2D2QA 1GAQB 4AS1A 2K0PA 2VZKB 2MBQA 4P7IA 1OQQA 2G4DB 2H89B 2K8HA 2WXRA 4WJQA 1UH6A 3GZNB 2JRIB 2GMIC 3VFKA 1WGDA 1FXIA 4FN2A 3H7PB 3NVZA 4LDTD 2R2OA 2IO1B 4GDKA 3PRZA 1SJHD 1SIFA 4OVZA 1JWMD 2RR9A 1GNUA 3C8YA 4MSMB 3MHSD 2VH1A 2I1KA 2RSUA 1AYFA 1FNVA 5E6JA 2YLMA 2OHFA 3BK1A 1GJZA 4W9KA 3TEYA 4E71A 1L0XB 1XEEA 5D2MB 2J4XA 4GDLA 4JQWC 2DWQA 2KQ7A 4E74A 2WXMA 1ZUD2 3WCQA 3ZKJC 4HROA 3P4QB 2WX0A 4L1BA 4GXBA 1V86A 2KLGA 4DHZB 4FADA 3N9YC 4BBNC 2D3AA 2ZEQA 4KV2A 3RFZB 3IXSA 2AL6A 2KZRA 4KGTA 4M8NA 2QCZA 5JHAA 1EUVB 4XGAB 2IO0B 2D3GA 2L76A 3NVWA 2INCC 2J53A 4HJGE 1F2RI 2KX3A 4EE2A 5GMVA 1YJIA 2WDTB 1EM7A 5D3DA 1G6JA 3LB8C 3IBEA 2ZCCA 4MH8A 4OVUA 4BOSC 4ARCA 1L5PA 2WXLA 1SJED 1YD8U 5KHQA 4RGTA 4DHZE 4MT5A 1T3QA 1HA5A 3KUCB 3HVZA 3ZO5B 3SD5A 1C3TA 2LGSA 2G9HD 2V1YA 1WRIA 3VXWA 2AQ1B 2WXOA 3PGEA 4GIVA 3GZNI 4XX5A 3M63B 1UZXB 2JWUA 2KX0A 3SFDB 3IFWB 3BYTB 4K1RB 3QAQA 1HTOA 5DPRA 2RPQA 3ZLZA 4L2YA 1Y8RC 1E9MA 3Q8AA 3NZSA 4GSWA 2N1WA 1RFAA 4A20A 3ZJUA 4HDQA 2DYOA 3VH4B 2XK5A 4R3DA 3AV8A 4YT0B 2DX5B 5IP4D 1PGXA 1E10A 4KZCA 3VRAB 1TBEA 2WU2B 2BKRB 2BYFA 2Z0DB 3JYUA 2IZVB 4K81A 1XO3A 1KLVA 4KSKC 2FCQA 3QCAA 1STEA 1ZOYB 1QILA 1QKZA 2DYBA 4P1BC 3W5VB 2K6QA 2ACZB 2RPVA 4US8A 3PTFC 1YQBA 2RDHA 4JWSC 4XDCA 3EUB2 1I42A 2BBCA 1QOFA 2DAFA 2K39A 3QARA 3A9JA 5I4DA 1LO5D 4BOZB 1JWBD 1SE2A 4RF1A 3A1QB 2BF8B 2JZ3B 3RUIB 3LJ3A 3TL5A 4AP4C 4W9HA 4AJYB 2C7MB 2B76B 1ZE3D 2MW5A 1ESFA 4MDKE 3SFEB 4TSSA 2WYQA 3P42A 2ZNVB 3NHEB 2FBWB 4J3OD 1L4DB 2KYWA 5G5HA 1TYGB 1WM2A 1WYWB 2FCNA 3H9DA 2Y5PA 1LM8B 1FEHA 3A9JB 1FM0D 1UGJA 1ZXIA 2MQJA 4B6WA 4PS7A 1BMLC 3Q3NC 3ZRCA 1YN4A 3B08A 1FFUA 4YXDB 5BMIA 4ACFA 1VLBA 3RMKC 1GOZA 4ARIA 1EF5A 2Y3AA 4IWPA 1R7SA 2IY0B 4JIOU 3DHGC 1DOYA 3RD2A 4P1CC 3EFUA 1YMHE 1P7FA 3HM6X 2KJHB 1UGMA 1U4AA 4DXFA 2BT6A 3TEXA 1R4NI 3AE8B 1H4RA 1CK1A 1DOIA 3UF8A 2K9XA 4EZJA 3ZGZA 5LXHA 3AEBB 5H8YE 1FPYA 5EE3A 3TEWA 4DBGA 3TMPB 2V3PA 5LXIB 1OEYJ 1Q0WB 5BO4B 2RD0A 1CJEA 2MBHA 2R2QA 2KD0A 3NVVA 4I6NB 3AE4B 2KJ6A 3E9SA 2IBIB 4BFRA 4EEWA 4KKJA 1KJTA 3DBRB 2E3TA 2CHZA 2WXPA 1E8YA 2NBVB 4YL8A 4LK0M 3VRBB 2O2VB 4F8CB 4DDID 2ONQA 1I4QA 2INNE 3VTVA 4C4VB 3NG0A 1P3QU 2GBRA 1ZDVA 2HD5B 3BZDB 1F0ZA 2OOBB 4BVUC 1TS5A 4A9AA 5BMHA 1C9FA 4HK2A 2N9LA 3KVFB 4F1SA 1V2YA 2DZMA 3DBLI 4MACA 4KSLC 3TUOA 3APCA 3MJWA 1WX7A 1XCTL 2FE8A 1YQ4B 3GP7A 3W1SC 2KKCA 3N3KB 1WJ4A 4DWFA 4KIKB 3MP9A 4USAA 3UIPB 2G4SA 2C7HA 3GOEA 4URKA 4F7ZA 1F1HA 4CYEA 2ON8A 2FUHB 3PLUA 2W54A 2DNFA 3AEGB 3HVDA 1TTNA 4BKSA 2L0TA 3DBHB 2MJDA 2D07B 1KF6B 3AM9A 5EE9A 3DVNV 2IYDB 1Z2MA 3Q8BA 3ZQ4A 1E90A 1MFWA 2YEPF 2LGDA 3OJ3A 4FJYA 1AN8A 2XN9C 1T0SC 1V1OA 2WXIA 1F52A 3EC8A 2N1VA 3M62B 2OJWA 4RGNA 3VH3B 3R2IA 4BBNF 1RRBA 2NR2A 4MEMA 2M0XA 3Q8EA 1TGZB 5LLIA 1YX6B 4ZYNA 3N1YC 2DAJA 2X8XX 4WJOA 3VHTC 1QQRA 2KQ4X 2BKFA 4G11A 2PPHA 3DCGA 1MJDA 3ZXRA 2PIAA 4GU2A 4ZOHC 4FA6A 3EHVA 2W3RA 1MG4A 1SEBD 1XCQL 2KDIA 1YQ3B 1WGGA 4PYZA 4LNNA 1UF0A 3QHTA 3L16A 2WXGA 4EUTA 1NYRA 4FHJA 2QMTA 2FIFA 4M0WB 2J0KA 1TS2A 3DDCB 5BYSA 3WAPA 2MWSB 3RNCC 3HRDD 4K3BA 1WX8A 2KXJA 4XC2A 3W9CB 2KWUB 2O6VB 3L54A 3DBLB 2WGSA 3DVGX 2N9EB 1UUPA 1P9DU 5FK9C 1ET9A 4AOFA 2V0GA 4NAWB 3NS1A 2VRRB 4BZAA 1HE8A 2MJ3A 5C1ZA 1E8ZA 1KRHA 2MP2B 2XEWA 2BYEA
chains in the Genus database with same CATH topology
4GXBA 1V86A 2KLGA 3PZDA 3DQVA 4DHZB 2NPTB 1XQQA 2KQSA 2NS5A 4FADA 4IW0A 3EECA 4PS8A 5IAAC 2MBBB 2DENB 2MBEA 2J0MA 2MCNB 2M4NA 3WIMA 2ZEQA 4KV2A 4BBNC 1V5OA 4KDLB 2AL6A 2CKHB 2KZRA 2WX1A 3M95A 4M8NA 5JHAA 1EUVB 2IO0B 2JRHA 2D3GA 2L76A 3L0WB 4GGQA 2KWCA 4DDGD 3JSVB 2LWPA 1E7VA 2DHZA 2JVCA 2N9PC 3A1QA 4NPNA 2AWTA 4GDKB 1YX5B 2LD9A 2KX3A 5GMVA 2WDTB 2PEAA 3ZW3A 1OQYA 1G6JA 2KFKB 3W1SA 3IBEA 2ZCCA 4JLCA 4EOYA 5D7GA 4OVUA 4BOSC 1YD8U 2A4ZA 1J8CA 4ZDVA 5KHQA 4DHZE 2I1JA 2JY6A 3KUCB 4ANVA 5E6NA 3ZO5B 3HK0A 3KUDB 3SD5A 1C3TA 1R4MI 2V1YA 4WJNA 1ZW7A 4CHKA 3VXWA 3JW0X 3PPAA 1WGRA 3I3TB 1FXTB 4WQOB 3R66C 1LQBA 2KDBA 3PGEA 4GIVA 4I6PA 3GZNI 1WR6E 2LRUA 2REXA 4XX5A 3M63B 3ZUNA 2K8BA 1UZXB 2KX0A 3TCAA 5C23A 1WZ3A 4I6LB 5DPSA 4TUUA 1WI0A 2V4LA 3AU4A 3IFWB 1E7UA 4W9CA 4K1RB 2MBOA 4GOCA 3BINA 3P2BA 5TR5A 3QAQA 1JRUA 2DZJA 4NAWA 2XK5B 3R7QA 1AARA 5DPRA 2RPQA 4FBJB 1E8XA 3B0AA 3ZLZA 5CHVC 1GC6A 4EZLA 1Y8RC 3OJ4B 1ZGUB 3MTNB 4NY0A 3VVWB 3VTUA 4G50A 3NZSA 4IC7B 4LJPB 4GSWA 2N1WA 2CHXA 2JZZA 2KLCA 1SGHA 2LASA 3RCZA 2ASQA 1RFAA 1WJNA 2FCSA 3SDLC 2Y5BB 4A20A 2LVPA 2PE6B 2JXXA 4W9DA 3AULA 3ZIMA 4HDQA 4W9JA 2DYOA 2MLBA 3VH4B 2XK5A 2D11A 2MX2A 4MGKE 5KHOA 1OTRB 1WE6A 2K1FA 3V62A 2BPSA 2M8SA 4W9GA 2FCMA 3LDZE 2DX5B 1M94A 5J18A 4KZCA 2J0JA 1TBEA 1WE7A 4FULA 4MH0E 2WWZA 2BKRB 2BYFA 3APDA 4EKUA 4TQ1A 4MM3A 2C60A 2FNJB 2Z0DB 2JWZA 3VDZA 2IO3B 1QZEA 3K9PB 4FHKA 1H8CA 1IYFA 2EMSA 4TKNA 3JYUA 2IZVB 2L05A 3T9LA 2KO3A 3QQ8B 2K6DB 4K81A 4B9KA 2DZKA 1KLVA 4KSKC 2FCQA 3QCAA 2EKEC 4RM9A 4MELA 5E6OA 3ZNID 3NOBA 3PRMB 1RLFA 2NBWB 2DYBA 2K6QA 3PTFC 4B95A 1YQBA 3VQIA 3QC8B 4KIKA 2B3AA 2LVOA 4NNJB 3X0WA 3DBHI 1I42A 2GBNA 2K39A 2DAFA 3QARA 2LXAA 5L95C 4CO7A 1V6EA 3A9JA 3ONSA 2DYMA 4M8MA 2L8JA 4BOZB 3U7DA 3PSEB 3A1QB 2BF8B 2JZ3B 4WAAA 1UELA 3RUIB 4DHJD 4X57B 4K7WA 2NBUA 3LJ3A 3WA0A 1VD2A 1SE9A 3PHWB 5IA7A 3B1LX 2HE7A 3DPDA 2K8CA 4AUQC 3PT2B 4W9IA 3TL5A 4ASWC 4HJKA 1WXVA 3QJZA 4AP4C 1WXMA 3K9OB 4W9HA 4AJYB 2C7MB 3UINB 2MP2A 3ZTDA 1K8RB 3KW5B 3TIXA 2MW5A 1E5WA 4MDKE 2LGXA 1XD3B 1EO6A 2GBJA 2MA9B 2WYQA 3Q3JA 1WGYA 2G45B 3HHMA 2ZNVB 3NHEB 4HCNB 3A9KA 4ICUA 3TJPA 4GN1A 4W9LA 4G0NB 2LZ6A 2ZZPB 4J6IA 4W9FA 5JH5C 3PV1A 1UBQA 1WFYA 1WM2A 3IHPC 1WYWB 3PHXB 2BYVE 2FCNA 1WF9A 3H9DA 1LM8B 4DXAB 3A33B 3A9JB 2KN5A 2MQJA 4B6WA 4PS7A 3VUYA 4IUMB 3ZRCA 3UIOB 4KZ0A 3B08A 3JSVA 3PRPB 3Q3FA 4HPMB 3U8ZA 4K7SA 3V60A 1IP9A 4A3OA 1V81A 2FAZA 4IWOA 2BWES 2DZIA 1EF5A 4IWPA 2KWVB 3KUZA 4N9F4 2ZVOA 4FLHA 3PREA 2IY0B 2K25A 3A4RA 3ENEA 2JT4B 4JIOU 4TQ0A 4ANWA 1WJ6A 4A3PA 4WWPA 3DBRI 4HDOA 2GBMA 2N7DA 3RD2A 4IM3A 1LXDA 3IVFA 3EFUA 4BKTA 2LGYA 3A9KB 3ALBA 1ZKHA 3ECIA 4OVVA 3HM6X 1WXSA 2CHWA 2KJHB 2C5LC 4MGZE 1UGMA 3N30A 1U4AA 1WMHA 3O65B 1J0GA 3OAWA 1R4NI 3L17A 1GUAB 2G3QB 1H4RA 2O2VA 3UF8A 4II3B 4KVGB 2W9NA 2NCNA 4EZJA 5LXHA 1VCBA 2CU1A 3UQBA 3DBSA 1KOTA 2LI5A 5HKHA 1I35A 3RZWC 3ZNZB 5CX3A 3KYCD 4DBGA 2ZPNA 4PYUA 3TMPB 3NZUA 3QX1A 4FJZA 1P0RA 1T0YA 4ZRJA 3TBLD 2AL3A 4GB9A 2HTHA 5LXIB 1OEYJ 1Q0WB 5G55A 2RD0A 3QWZB 4MJSA 4LCDE 5BO4B 3VTWA 2MBHA 2R2QA 2KJRA 2UYZB 3CSFA 3APFA 3BY4B 2J7QB 3H7PA 3H6NA 3JVZX 2KD0A 3WAOA 5J17A 3NS8A 5DPWA 1NBFC 3CF6E 1P1AA 4MJSB 3QK0A 3ZTCA 4I6NB 2KJ6A 4IM0A 3ZVVA 2IBIB 3H1UA 3N32A 4BFRA 4EEWA 3IG3A 2AEHA 1KJTA 3KYDD 1WM3A 1C1YB 3H7SA 3PVLA 2CHZA 3SHQA 1E8YA 3HM3A 3KH0A 2NBVB 2KTRB 2NVUI 4YL8A 3V6EB 2KTFA 2FIDA 2C7NB 3PLVA 2O2VB 1GG3A 4F8CB 2IO2B 4WWNA 4DDID 2LVQA 3M3JA 2JF5A 2KNBA 2OJRA 2LJ5A 3L08A 2UWQA 3VTVA 4ANUA 1X1MA 1P3QU 2GBRA 2GBKA 2YVCA 2HD5B 5FR6A 4IWQA 3ZNHB 2M1MA 2IY1B 4PS3A 2OOBB 4BVUC 3RULA 1WMHB 4K7UA 3VUWA 3ZRFA 2KFKA 4HCPB 2KTRA 4NJ7A 2PJHA 2RGFA 4HK2A 4HWIB 3KVFB 2AYOB 2O6VD 1UD7A 4JL9A 2O6VA 4F1SA 1V2YA 5D6JB 1NI2A 2DZMA 3AXCA 4TV3A 3DBLI 5CHFA 4KSLC 4KDIC 2KMAA 3APCA 4HPLB 3ML8A 5AZFA 3ZNGC 3MJWA 5AZGA 5JHBA 1WX7A 1S3SG 3W1SC 2KKCA 3N3KB 1P98A 1WJ4A 4DWFA 4KIKB 2V3SA 2ZVNA 3UIPB 1WH3A 2G4SA 2C7HA 1WIAA 3AI5A 2HJ8A 3GOEA 4URKA 4F7ZA 2MSED 1UBIA 4II2B 4CYEA 2JUOA 2KC1A 4NQLB 1WRDB 2FUHB 3RZFA 3SU8X 2L0FA 3PLUA 3L13A 4XZ4A 3CMMB 2ZPYA 1TTNA 3C0RB 3R3MA 1MG8A 4BKSA 2L0TA 3WAMA 1PQSA 2D07B 2N7EA 3QA8A 4BKSD 2XBBC 1A5RA 2CS4A 1WXAA 4MGYE 3DVNV 5D94A 2IYDB 2EMTA 4FJVB 1E8WA 4WWOA 1Z2MA 2KMCA 5AZHA 3RYTA 1E90A 2LRWA 1F9JA 3U30A 2LGDA 3L10B 3OJ3A 3CSTA 4FJYA 3V6CB 1Q1OA 5AEKB 3HIZA 1LFDA 5E6PA 4ANXA 4DHJB 2C9WB 3T8MA 2KDEB 2KVRA 1L2NA 4HVBA 1WJUA 2Z59B 2ZJDA 3EC8A 2N1VA 1V80A 2L3ZA 1ISNA 3M62B 3VH3B 5CHWA 4AWJA 2A5UA 4AJWA 2ZNVC 3DVNU 2KHWB 4BBNF 1RRBA 4IM2A 2LUEA 2NR2A 2M0XA 4MEMA 1L7YA 4RMAA 3ZDMC 3VAWA 1TGZB 1Z5SB 4ICVA 1V49A 1BT0A 5J2RA 5LLIA 1EF1A 3S2AA 4BKGA 1YX6B 4ZYNA 3WANA 1KM7A 3D32A 2DAJA 2KANA 2L7RA 1IPGA 5G2NA 2LXCA 4WJOA 4E3CA 3VHTC 4DK5A 2KOXA 1V5TA 2BGFA 2CR5A 2Z0EB 4GMVA 3R7RA 2BKFA 4G11A 2QHOA 2N4FA 1TZ1A 2PPHA 2L00B 3DCGA 2ZCBA 4HXDA 1YIWA 2PE9A 3WALA 4GU2A 4FA6A 2KDFB 3EHVA 4MSQB 5DPTA 1OEYA 4ZRKA 1J19A 1WR1A 1XT9B 2KC2A 4GDLB 1WGHA 3UGBB 2KDIA 5EDSA 5JZEB 4G3XB 4NJ6A 1RAXA 1WGGA 2BWFA 2D2QA 4PYZA 5CTRC 3V61A 2MBQA 4P7IA 2G4DB 3QHTA 3L16A 1OGWA 4EUTA 1WZ0A 2KK8A 2K8HA 4FHJA 4WJQA 3OLMD 1UH6A 4IG7B 1CMXB 1GC7A 3VUXA 2JRIB 1Q5WB 2FIFA 2GMIC 2M17A 4M0WB 3VFKA 1WGDA 2J0KA 5DCNA 4FN2A 2JPHA 3H7PB 2KFJA 4LDTD 2R2OA 4HLEA 3AU5A 3DDCB 3DVGY 2IO1B 1V9JA 4LDTB 3WAPA 2MWSB 4GDKA 1D3ZA 1WX8A 2KXJA 4XC2A 3ML9A 1NDDA 3PRZA 2KWUB 2O6VB 4LJOB 3L54A 1SIFA 4ZRIA 3DVGX 3A4SC 2RR9A 4MSMB 1GNUA 3RT3B 3UQAA 3MHSD 3NY5A 2D10A 3ZDTA 3PS6A 4EFOA 2I1KA 2RSUA 2N9EB 4RM8A 1P9DU 2MRPA 2YLMA 1YJ1A 4AOFA 2GOWA 4NAWB 2VRRB 1HE8A 1WY8A 4NQKE 5L83A 3QIJA 2N9XA 4W9KA 1GJZA 4E71A 4EZKA 4W9EA 5D2MB 3W1YA 5C1ZA 3X23A 2NPTA 4GDLA 1E8ZA 4JQWC 1S1QB 2KQ7A 4WJPA 3DOWA 4E74A 4MGIE 1WX9A 2MP2B 3ZKJC 2XEWA 4JGHB 2BYEA 2WX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GXB A;  1V86 A;  2KLG A;  3PZD A;  3DQV A;  4DHZ B;  2NPT B;  1XQQ A;  2KQS A;  2NS5 A;  4FAD A;  4IW0 A;  3EEC A;  4PS8 A;  5IAA C;  2MBB B;  2DEN B;  2MBE A;  2J0M A;  2MCN B;  2M4N A;  3WIM A;  2ZEQ A;  4KV2 A;  4BBN C;  1V5O A;  4KDL B;  2AL6 A;  2CKH B;  2KZR A;  2WX1 A;  3M95 A;  4M8N A;  5JHA A;  1EUV B;  2IO0 B;  2JRH A;  2D3G A;  2L76 A;  3L0W B;  4GGQ A;  2KWC A;  4DDG D;  3JSV B;  2LWP A;  1E7V A;  2DHZ A;  2JVC A;  2N9P C;  3A1Q A;  4NPN A;  2AWT A;  4GDK B;  1YX5 B;  2LD9 A;  2KX3 A;  5GMV A;  2WDT B;  2PEA A;  3ZW3 A;  1OQY A;  1G6J A;  2KFK B;  3W1S A;  3IBE A;  2ZCC A;  4JLC A;  4EOY A;  5D7G A;  4OVU A;  4BOS C;  1YD8 U;  2A4Z A;  1J8C A;  4ZDV A;  5KHQ A;  4DHZ E;  2I1J A;  2JY6 A;  3KUC B;  4ANV A;  5E6N A;  3ZO5 B;  3HK0 A;  3KUD B;  3SD5 A;  1C3T A;  1R4M I;  2V1Y A;  4WJN A;  1ZW7 A;  4CHK A;  3VXW A;  3JW0 X;  3PPA A;  1WGR A;  3I3T B;  1FXT B;  4WQO B;  3R66 C;  1LQB A;  2KDB A;  3PGE A;  4GIV A;  4I6P A;  3GZN I;  1WR6 E;  2LRU A;  2REX A;  4XX5 A;  3M63 B;  3ZUN A;  2K8B A;  1UZX B;  2KX0 A;  3TCA A;  5C23 A;  1WZ3 A;  4I6L B;  5DPS A;  4TUU A;  1WI0 A;  2V4L A;  3AU4 A;  3IFW B;  1E7U A;  4W9C A;  4K1R B;  2MBO A;  4GOC A;  3BIN A;  3P2B A;  5TR5 A;  3QAQ A;  1JRU A;  2DZJ A;  4NAW A;  2XK5 B;  3R7Q A;  1AAR A;  5DPR A;  2RPQ A;  4FBJ B;  1E8X A;  3B0A A;  3ZLZ A;  5CHV C;  1GC6 A;  4EZL A;  1Y8R C;  3OJ4 B;  1ZGU B;  3MTN B;  4NY0 A;  3VVW B;  3VTU A;  4G50 A;  3NZS A;  4IC7 B;  4LJP B;  4GSW A;  2N1W A;  2CHX A;  2JZZ A;  2KLC A;  1SGH A;  2LAS A;  3RCZ A;  2ASQ A;  1RFA A;  1WJN A;  2FCS A;  3SDL C;  2Y5B B;  4A20 A;  2LVP A;  2PE6 B;  2JXX A;  4W9D A;  3AUL A;  3ZIM A;  4HDQ A;  4W9J A;  2DYO A;  2MLB A;  3VH4 B;  2XK5 A;  2D11 A;  2MX2 A;  4MGK E;  5KHO A;  1OTR B;  1WE6 A;  2K1F A;  3V62 A;  2BPS A;  2M8S A;  4W9G A;  2FCM A;  3LDZ E;  2DX5 B;  1M94 A;  5J18 A;  4KZC A;  2J0J A;  1TBE A;  1WE7 A;  4FUL A;  4MH0 E;  2WWZ A;  2BKR B;  2BYF A;  3APD A;  4EKU A;  4TQ1 A;  4MM3 A;  2C60 A;  2FNJ B;  2Z0D B;  2JWZ A;  3VDZ A;  2IO3 B;  1QZE A;  3K9P B;  4FHK A;  1H8C A;  1IYF A;  2EMS A;  4TKN A;  3JYU A;  2IZV B;  2L05 A;  3T9L A;  2KO3 A;  3QQ8 B;  2K6D B;  4K81 A;  4B9K A;  2DZK A;  1KLV A;  4KSK C;  2FCQ A;  3QCA A;  2EKE C;  4RM9 A;  4MEL A;  5E6O A;  3ZNI D;  3NOB A;  3PRM B;  1RLF A;  2NBW B;  2DYB A;  2K6Q A;  3PTF C;  4B95 A;  1YQB A;  3VQI A;  3QC8 B;  4KIK A;  2B3A A;  2LVO A;  4NNJ B;  3X0W A;  3DBH I;  1I42 A;  2GBN A;  2K39 A;  2DAF A;  3QAR A;  2LXA A;  5L95 C;  4CO7 A;  1V6E A;  3A9J A;  3ONS A;  2DYM A;  4M8M A;  2L8J A;  4BOZ B;  3U7D A;  3PSE B;  3A1Q B;  2BF8 B;  2JZ3 B;  4WAA A;  1UEL A;  3RUI B;  4DHJ D;  4X57 B;  4K7W A;  2NBU A;  3LJ3 A;  3WA0 A;  1VD2 A;  1SE9 A;  3PHW B;  5IA7 A;  3B1L X;  2HE7 A;  3DPD A;  2K8C A;  4AUQ C;  3PT2 B;  4W9I A;  3TL5 A;  4ASW C;  4HJK A;  1WXV A;  3QJZ A;  4AP4 C;  1WXM A;  3K9O B;  4W9H A;  4AJY B;  2C7M B;  3UIN B;  2MP2 A;  3ZTD A;  1K8R B;  3KW5 B;  3TIX A;  2MW5 A;  1E5W A;  4MDK E;  2LGX A;  1XD3 B;  1EO6 A;  2GBJ A;  2MA9 B;  2WYQ A;  3Q3J A;  1WGY A;  2G45 B;  3HHM A;  2ZNV B;  3NHE B;  4HCN B;  3A9K A;  4ICU A;  3TJP A;  4GN1 A;  4W9L A;  4G0N B;  2LZ6 A;  2ZZP B;  4J6I A;  4W9F A;  5JH5 C;  3PV1 A;  1UBQ A;  1WFY A;  1WM2 A;  3IHP C;  1WYW B;  3PHX B;  2BYV E;  2FCN A;  1WF9 A;  3H9D A;  1LM8 B;  4DXA B;  3A33 B;  3A9J B;  2KN5 A;  2MQJ A;  4B6W A;  4PS7 A;  3VUY A;  4IUM B;  3ZRC A;  3UIO B;  4KZ0 A;  3B08 A;  3JSV A;  3PRP B;  3Q3F A;  4HPM B;  3U8Z A;  4K7S A;  3V60 A;  1IP9 A;  4A3O A;  1V81 A;  2FAZ A;  4IWO A;  2BWE S;  2DZI A;  1EF5 A;  4IWP A;  2KWV B;  3KUZ A;  4N9F 4;  2ZVO A;  4FLH A;  3PRE A;  2IY0 B;  2K25 A;  3A4R A;  3ENE A;  2JT4 B;  4JIO U;  4TQ0 A;  4ANW A;  1WJ6 A;  4A3P A;  4WWP A;  3DBR I;  4HDO A;  2GBM A;  2N7D A;  3RD2 A;  4IM3 A;  1LXD A;  3IVF A;  3EFU A;  4BKT A;  2LGY A;  3A9K B;  3ALB A;  1ZKH A;  3ECI A;  4OVV A;  3HM6 X;  1WXS A;  2CHW A;  2KJH B;  2C5L C;  4MGZ E;  1UGM A;  3N30 A;  1U4A A;  1WMH A;  3O65 B;  1J0G A;  3OAW A;  1R4N I;  3L17 A;  1GUA B;  2G3Q B;  1H4R A;  2O2V A;  3UF8 A;  4II3 B;  4KVG B;  2W9N A;  2NCN A;  4EZJ A;  5LXH A;  1VCB A;  2CU1 A;  3UQB A;  3DBS A;  1KOT A;  2LI5 A;  5HKH A;  1I35 A;  3RZW C;  3ZNZ B;  5CX3 A;  3KYC D;  4DBG A;  2ZPN A;  4PYU A;  3TMP B;  3NZU A;  3QX1 A;  4FJZ A;  1P0R A;  1T0Y A;  4ZRJ A;  3TBL D;  2AL3 A;  4GB9 A;  2HTH A;  5LXI B;  1OEY J;  1Q0W B;  5G55 A;  2RD0 A;  3QWZ B;  4MJS A;  4LCD E;  5BO4 B;  3VTW A;  2MBH A;  2R2Q A;  2KJR A;  2UYZ B;  3CSF A;  3APF A;  3BY4 B;  2J7Q B;  3H7P A;  3H6N A;  3JVZ X;  2KD0 A;  3WAO A;  5J17 A;  3NS8 A;  5DPW A;  1NBF C;  3CF6 E;  1P1A A;  4MJS B;  3QK0 A;  3ZTC A;  4I6N B;  2KJ6 A;  4IM0 A;  3ZVV A;  2IBI B;  3H1U A;  3N32 A;  4BFR A;  4EEW A;  3IG3 A;  2AEH A;  1KJT A;  3KYD D;  1WM3 A;  1C1Y B;  3H7S A;  3PVL A;  2CHZ A;  3SHQ A;  1E8Y A;  3HM3 A;  3KH0 A;  2NBV B;  2KTR B;  2NVU I;  4YL8 A;  3V6E B;  2KTF A;  2FID A;  2C7N B;  3PLV A;  2O2V B;  1GG3 A;  4F8C B;  2IO2 B;  4WWN A;  4DDI D;  2LVQ A;  3M3J A;  2JF5 A;  2KNB A;  2OJR A;  2LJ5 A;  3L08 A;  2UWQ A;  3VTV A;  4ANU A;  1X1M A;  1P3Q U;  2GBR A;  2GBK A;  2YVC A;  2HD5 B;  5FR6 A;  4IWQ A;  3ZNH B;  2M1M A;  2IY1 B;  4PS3 A;  2OOB B;  4BVU C;  3RUL A;  1WMH B;  4K7U A;  3VUW A;  3ZRF A;  2KFK A;  4HCP B;  2KTR A;  4NJ7 A;  2PJH A;  2RGF A;  4HK2 A;  4HWI B;  3KVF B;  2AYO B;  2O6V D;  1UD7 A;  4JL9 A;  2O6V A;  4F1S A;  1V2Y A;  5D6J B;  1NI2 A;  2DZM A;  3AXC A;  4TV3 A;  3DBL I;  5CHF A;  4KSL C;  4KDI C;  2KMA A;  3APC A;  4HPL B;  3ML8 A;  5AZF A;  3ZNG C;  3MJW A;  5AZG A;  5JHB A;  1WX7 A;  1S3S G;  3W1S C;  2KKC A;  3N3K B;  1P98 A;  1WJ4 A;  4DWF A;  4KIK B;  2V3S A;  2ZVN A;  3UIP B;  1WH3 A;  2G4S A;  2C7H A;  1WIA A;  3AI5 A;  2HJ8 A;  3GOE A;  4URK A;  4F7Z A;  2MSE D;  1UBI A;  4II2 B;  4CYE A;  2JUO A;  2KC1 A;  4NQL B;  1WRD B;  2FUH B;  3RZF A;  3SU8 X;  2L0F A;  3PLU A;  3L13 A;  4XZ4 A;  3CMM B;  2ZPY A;  1TTN A;  3C0R B;  3R3M A;  1MG8 A;  4BKS A;  2L0T A;  3WAM A;  1PQS A;  2D07 B;  2N7E A;  3QA8 A;  4BKS D;  2XBB C;  1A5R A;  2CS4 A;  1WXA A;  4MGY E;  3DVN V;  5D94 A;  2IYD B;  2EMT A;  4FJV B;  1E8W A;  4WWO A;  1Z2M A;  2KMC A;  5AZH A;  3RYT A;  1E90 A;  2LRW A;  1F9J A;  3U30 A;  2LGD A;  3L10 B;  3OJ3 A;  3CST A;  4FJY A;  3V6C B;  1Q1O A;  5AEK B;  3HIZ A;  1LFD A;  5E6P A;  4ANX A;  4DHJ B;  2C9W B;  3T8M A;  2KDE B;  2KVR A;  1L2N A;  4HVB A;  1WJU A;  2Z59 B;  2ZJD A;  3EC8 A;  2N1V A;  1V80 A;  2L3Z A;  1ISN A;  3M62 B;  3VH3 B;  5CHW A;  4AWJ A;  2A5U A;  4AJW A;  2ZNV C;  3DVN U;  2KHW B;  4BBN F;  1RRB A;  4IM2 A;  2LUE A;  2NR2 A;  2M0X A;  4MEM A;  1L7Y A;  4RMA A;  3ZDM C;  3VAW A;  1TGZ B;  1Z5S B;  4ICV A;  1V49 A;  1BT0 A;  5J2R A;  5LLI A;  1EF1 A;  3S2A A;  4BKG A;  1YX6 B;  4ZYN A;  3WAN A;  1KM7 A;  3D32 A;  2DAJ A;  2KAN A;  2L7R A;  1IPG A;  5G2N A;  2LXC A;  4WJO A;  4E3C A;  3VHT C;  4DK5 A;  2KOX A;  1V5T A;  2BGF A;  2CR5 A;  2Z0E B;  4GMV A;  3R7R A;  2BKF A;  4G11 A;  2QHO A;  2N4F A;  1TZ1 A;  2PPH A;  2L00 B;  3DCG A;  2ZCB A;  4HXD A;  1YIW A;  2PE9 A;  3WAL A;  4GU2 A;  4FA6 A;  2KDF B;  3EHV A;  4MSQ B;  5DPT A;  1OEY A;  4ZRK A;  1J19 A;  1WR1 A;  1XT9 B;  2KC2 A;  4GDL B;  1WGH A;  3UGB B;  2KDI A;  5EDS A;  5JZE B;  4G3X B;  4NJ6 A;  1RAX A;  1WGG A;  2BWF A;  2D2Q A;  4PYZ A;  5CTR C;  3V61 A;  2MBQ A;  4P7I A;  2G4D B;  3QHT A;  3L16 A;  1OGW A;  4EUT A;  1WZ0 A;  2KK8 A;  2K8H A;  4FHJ A;  4WJQ A;  3OLM D;  1UH6 A;  4IG7 B;  1CMX B;  1GC7 A;  3VUX A;  2JRI B;  1Q5W B;  2FIF A;  2GMI C;  2M17 A;  4M0W B;  3VFK A;  1WGD A;  2J0K A;  5DCN A;  4FN2 A;  2JPH A;  3H7P B;  2KFJ A;  4LDT D;  2R2O A;  4HLE A;  3AU5 A;  3DDC B;  3DVG Y;  2IO1 B;  1V9J A;  4LDT B;  3WAP A;  2MWS B;  4GDK A;  1D3Z A;  1WX8 A;  2KXJ A;  4XC2 A;  3ML9 A;  1NDD A;  3PRZ A;  2KWU B;  2O6V B;  4LJO B;  3L54 A;  1SIF A;  4ZRI A;  3DVG X;  3A4S C;  2RR9 A;  4MSM B;  1GNU A;  3RT3 B;  3UQA A;  3MHS D;  3NY5 A;  2D10 A;  3ZDT A;  3PS6 A;  4EFO A;  2I1K A;  2RSU A;  2N9E B;  4RM8 A;  1P9D U;  2MRP A;  2YLM A;  1YJ1 A;  4AOF A;  2GOW A;  4NAW B;  2VRR B;  1HE8 A;  1WY8 A;  4NQK E;  5L83 A;  3QIJ A;  2N9X A;  4W9K A;  1GJZ A;  4E71 A;  4EZK A;  4W9E A;  5D2M B;  3W1Y A;  5C1Z A;  3X23 A;  2NPT A;  4GDL A;  1E8Z A;  4JQW C;  1S1Q B;  2KQ7 A;  4WJP A;  3DOW A;  4E74 A;  4MGI E;  1WX9 A;  2MP2 B;  3ZKJ C;  2XEW A;  4JGH B;  2BYE A;  2WX0 A; 
#chains in the Genus database with same CATH topology
 1UWX A;  1XLN A;  3DQV A;  3DWG C;  2NS5 A;  1XQQ A;  4L23 A;  3B9J A;  2NTS A;  5IAA C;  1V5O A;  3M95 A;  3L0W B;  1PGA A;  1WSP A;  3N1X C;  2LWP A;  3ZYY X;  2VH2 A;  2DHZ A;  3A1Q A;  2AWT A;  4OW0 A;  1QLB B;  2GRI A;  2PEA A;  1PFD A;  4M0W A;  5IKC M;  4ITK A;  1VZ7 A;  3UI3 A;  1J8C A;  3SEB A;  3Q6B A;  1DYQ A;  1HZ5 A;  3O13 A;  4IOI E;  4CHK A;  1WGR A;  3I3T B;  1FXT B;  3BII D;  4I6P A;  2LMC A;  1WR6 E;  2REX A;  3ZUN A;  1E6E B;  5C23 A;  1WZ3 A;  1E7U A;  4WQM A;  2QIE B;  4GOC A;  3BIN A;  1L0Y B;  4NAW A;  2XK5 B;  1HTQ A;  1AAR A;  4HEA 1;  3FIL A;  3B0A A;  1FCL A;  5CHV C;  2Y5C A;  4NY0 A;  3VVW B;  1MVK A;  4IC7 B;  4A55 A;  3BYY B;  2CHX A;  2JZZ A;  1N5W A;  3NVY A;  1SGH A;  3RCZ A;  1TKG A;  2QSD A;  4DQO C;  2BS4 B;  2QC8 A;  3AUL A;  3ZIM A;  2D11 A;  5KHO A;  3FKY A;  1QOA A;  3LDZ E;  5J18 A;  1M94 A;  2KAJ A;  4EKU A;  4TQ1 A;  2K5P A;  1QZE A;  4FHK A;  1H8C A;  2DBY A;  4FXC A;  4MEL A;  3ZNI D;  1VZ8 A;  3PRM B;  1I4G A;  1D5M C;  1KLU D;  4O1N A;  1JWS D;  1XLP A;  2KVZ A;  3I63 C;  4KIK A;  2JZP A;  3X0W A;  3DBH I;  2LFI A;  3AH7 A;  2LXA A;  5L95 C;  1R4M B;  2PMV A;  1YN5 A;  3PSE B;  2PTL A;  4K7W A;  2NBU A;  1JCK B;  3BVG A;  5IA7 A;  3DPD A;  2HE7 A;  2N9K A;  4AUQ C;  4WAF A;  4PK1 A;  1SXT A;  1WXV A;  2J42 A;  3QJZ A;  1NVI D;  3K9O B;  1YJJ A;  2M0A A;  3UIN B;  2GBJ A;  2MA9 B;  2G45 B;  3HHM A;  2HJ1 A;  3H8H A;  4ICU A;  3TJP A;  2ZZP B;  4W9F A;  4J6I A;  3PV1 A;  1UBQ A;  3PHX B;  4OZB A;  1KTK A;  3Q14 C;  4DXA B;  3EFC A;  2BTE A;  1JWU D;  2LHE A;  1IP9 A;  2IND C;  2FAZ A;  4IWO A;  3FIL B;  2DZI A;  2KWV B;  1JWA D;  4TQ0 A;  4ANW A;  4A3P A;  4WWP A;  4HDO A;  2GBM A;  4IM3 A;  4KKI A;  2MHJ A;  2LGY A;  3ALB A;  5HG2 A;  5C2T B;  3T3N A;  2KAC A;  2V4I B;  2L32 A;  4TMA B;  1PGB A;  2VZK D;  3AB5 A;  1J0G A;  2GI9 A;  3BK2 A;  4C7Z A;  1E0Z A;  4II3 B;  4M00 A;  1VCB A;  1HXY D;  4N58 A;  2LI5 A;  1M4V A;  5HKH A;  1TY0 A;  3KYC D;  1XXG A;  4FJZ A;  2JXT A;  4ZRJ A;  1TIF A;  2AL3 A;  4GB9 A;  5G55 A;  4MJS A;  1C76 A;  4HKZ E;  3VTW A;  2UYZ B;  2KJR A;  2I2Y A;  1AWD A;  3Q8C A;  4Q2J A;  5J17 A;  1KH0 A;  3ZTC A;  3N32 A;  3H1U A;  1C79 A;  1C77 A;  1WM3 A;  3PZ7 A;  3AEA B;  3DHI C;  2SEB D;  1C4P A;  3HM3 A;  3V6E B;  2KTF A;  2FID A;  4OZC A;  2WHI A;  1ZP0 B;  2IO2 B;  4WWN A;  1TY2 A;  2LVQ A;  3M3J A;  2KNB A;  2UWQ A;  4ZYS A;  4ANU A;  1FMA D;  1X1M A;  2GBK A;  2YVC A;  3AEC B;  3R2T A;  3VUW A;  2KTR A;  2O6V A;  1NI2 A;  3AXC A;  4TV3 A;  3TSS A;  1SE4 A;  4WIP A;  3ZNG C;  5AZG A;  4LNK A;  4WH4 A;  3W5U B;  2V3S A;  2ZVN A;  2QEJ C;  5EE1 A;  1UBI A;  2KC1 A;  3RZF A;  4XZ4 A;  3R3M A;  1MG8 A;  2N7E A;  3KLS X;  2BVC A;  2XBB C;  2UU7 A;  4MGY E;  2LJI A;  4WWO A;  1KFY B;  2R61 A;  1F9J A;  4YTN B;  3ETR A;  1Q1O A;  2Z8L A;  3HIZ A;  1LFD A;  5E6P A;  1P7E A;  3V6C B;  1L4Z B;  4ANX A;  3IAS 1;  2KVR A;  2WDV B;  3AE9 B;  4GLS C;  1LGR A;  2A5U A;  4JWU C;  2ZNV C;  2LUE A;  3VAW A;  3RNB C;  4C7Y A;  2NMQ A;  1V49 A;  1BT0 A;  5J2R A;  1EF1 A;  3WAN A;  5IN7 A;  3D32 A;  1VRA B;  2KAN A;  2L7R A;  1IPG A;  2XNA C;  2MH7 A;  3AE2 B;  5C3J B;  4XYC A;  3TEZ A;  3I5J C;  2QHO A;  4K3C A;  1TZ1 A;  2ZCB A;  4MSQ B;  3CIR B;  4ZRK A;  2BYT A;  1XT9 B;  2KC2 A;  4GDL B;  1A70 A;  5JZE B;  3P1M A;  2WU5 B;  5CTR C;  2L83 A;  3V61 A;  1IGD A;  1OGW A;  3FC4 A;  1WZ0 A;  4N6E B;  1RYJ A;  4B0M A;  3OLM D;  1GC7 A;  5FKA C;  1J7B A;  3I57 A;  1T0R C;  5DCN A;  2KFJ A;  4HLE A;  3AU5 A;  2JSV X;  1DOX A;  3DVG Y;  1V9J A;  4LDT B;  1XF5 L;  4YSX B;  1NDD A;  4ZRI A;  4NZL B;  3NY5 A;  3ZDT A;  3PS6 A;  4KGR A;  4EFO A;  1FD6 A;  1PYW D;  4RM8 A;  2MRP A;  1N63 A;  1YJ1 A;  2ZW1 A;  3U2S C;  1WY8 A;  3QIJ A;  2N9X A;  4S0R A;  4LNF A;  4YTP B;  4YTM B;  1V1P A;  2J52 A;  3KWL A;  1C4C A;  1N62 A;  2OED A;  3C19 A;  3SR6 A;  4MGI E;  1WX9 A;  3L10 B;  3PZD A;  4IW0 A;  3EEC A;  4PS8 A;  4ZRQ A;  2MBB B;  2DEN B;  2MBE A;  2MCN B;  3WIM A;  4KDL B;  1JAL A;  2WX1 A;  1D4B A;  2JRH A;  4GGQ A;  2V3N A;  1QOG A;  1MPE A;  2D3B A;  2JVC A;  2N9P C;  4NPN A;  4DXG A;  4GDK B;  1YX5 B;  2LD9 A;  1YN3 A;  1K51 A;  3ZW3 A;  3E56 A;  2CU3 A;  3CWI A;  2KFK B;  3FAH A;  3W1S A;  4JLC A;  2CJO A;  2LUM A;  2PLP A;  1PDX A;  2A4Z A;  4ZDV A;  2IGD A;  2I1J A;  4ANV A;  5BYQ A;  4A8X C;  1R4M I;  1ZW7 A;  3Q3O C;  3PPA A;  4WQO B;  2K8B A;  3TCA A;  2JYT A;  3MC8 A;  1WI0 A;  2V4L A;  1F77 A;  1IGC A;  3AU4 A;  4TUU A;  1N60 A;  2MBO A;  2RDB C;  3P2B A;  4C00 A;  1E8X A;  1RWS A;  1GC6 A;  1JRP A;  4EZL A;  2KDM A;  3HUI A;  4M02 A;  3OJ4 B;  1ZGU B;  3VTU A;  2D5G A;  4LJP B;  3NJT A;  3BWU D;  2LAS A;  4RCO A;  1WJN A;  2FUG 1;  3SDL C;  2Y5B B;  1CZP A;  4W9D A;  2MLB A;  2EKI A;  2N7J A;  1D5Z C;  2K1F A;  2BPS A;  2M8S A;  4W9G A;  2FCM A;  1WE7 A;  4FUL A;  4MH0 E;  2WWZ A;  5HI1 A;  1TS4 A;  3APD A;  2C60 A;  1IBX A;  2IO3 B;  3K9P B;  1IYF A;  2EMS A;  1I4H A;  1GB1 A;  4TKN A;  3T9L A;  2KO3 A;  3QQ8 B;  2K6D B;  2WLB A;  2DZK A;  4B9K A;  4YWG G;  4B0E A;  1ACC A;  2EKE C;  3NOB A;  1RLF A;  1OFF A;  1RM6 C;  4OHJ A;  1DGJ A;  4B95 A;  3QC8 B;  2LVO A;  1JW9 D;  2GBN A;  3AMZ A;  1QF6 A;  4CO7 A;  1V6E A;  4WWM A;  5IOI A;  2L8J A;  3RPF C;  3U7D A;  4WAA A;  4DHJ D;  4X57 B;  2L52 A;  3WA0 A;  1VD2 A;  5G5G A;  3B1L X;  2K8C A;  3MJ5 A;  3PT2 B;  5AUI A;  4ASW C;  1WXM A;  2JU6 X;  1MHX A;  2MP2 A;  3ZTD A;  1K8R B;  3KW5 B;  4KX6 B;  1L0V B;  1VDV A;  2LGX A;  3RNA C;  1XD3 B;  1EO6 A;  3Q3J A;  1WGY A;  4HCN B;  2PVO D;  4G0N B;  2LZ6 A;  3LXF A;  1SSN A;  3AE6 B;  3P63 A;  3AE7 B;  2KN5 A;  1TT5 B;  2BW2 A;  1I4P A;  5IO9 A;  4IUM B;  3UIO B;  4KZ0 A;  1ROE A;  2RDG A;  3PRP B;  3V60 A;  4K7S A;  2EEL A;  2BWE S;  4N9F 4;  4RFB A;  2TSS A;  4FLH A;  3PRE A;  3ENE A;  2JT4 B;  1I4X A;  1WJ6 A;  2WP9 B;  2AQ3 B;  3AE3 B;  1IBX B;  1LXD A;  3IVF A;  4KGS A;  1XLO A;  3A9K B;  4OVV A;  1WXS A;  2CHW A;  3U4E G;  2C5L C;  5HFY A;  2WDQ B;  3O65 B;  3L17 A;  1GUA B;  3GS2 A;  4KVG B;  2WQY B;  3DBS A;  1KOT A;  1WXQ A;  3ZNZ B;  2CJN A;  4PYU A;  3NZU A;  1HEZ E;  3RNF C;  1P0R A;  2WXQ A;  3IAM 1;  1T0Y A;  3TBL D;  3V05 A;  2GLS A;  1T6B X;  3H7P A;  3W2D A;  1KLG D;  3WAO A;  3CF6 E;  4MJS B;  1YOV B;  3ZVV A;  3KYD D;  2KWD A;  1C1Y B;  3H7S A;  3PVL A;  1UWM A;  4XDD A;  2NVU I;  2PKO A;  2C7N B;  3PLV A;  1GG3 A;  2M19 A;  2JF5 A;  2OJR A;  1UNS A;  2LHD A;  1NEK B;  1JRO A;  3ZJT A;  5FR6 A;  2IY1 B;  1WMH B;  4K7U A;  2KFK A;  4BAX A;  4HPP A;  4S17 A;  2RGF A;  1JQ4 A;  2AYO B;  2O6V D;  4ZRP A;  1UD7 A;  2ZW0 A;  4JL9 A;  5D6J B;  4KDI C;  2QIL A;  2AQ2 B;  5JHB A;  4HRS A;  1SBB B;  2WNM A;  2HJ8 A;  5D3I B;  2W82 A;  2MSE D;  4II2 B;  4NQL B;  3SU8 X;  1SB3 C;  3L13 A;  3Q8F A;  4RGM A;  1B9R A;  2ICI A;  2ZPY A;  3C0R B;  1PQS A;  1VJK A;  1A5R A;  4FJV B;  5BYR A;  5AZH A;  5TSS A;  3DWM A;  1D5X C;  3CST A;  3AE1 B;  2LEK A;  2GB1 A;  3T8M A;  4HVB A;  2Z59 B;  2ZJD A;  1TS3 A;  2IJ0 A;  2L3Z A;  1ISN A;  1QT9 A;  5CHW A;  3V3X A;  4AWJ A;  2KHW B;  2BQQ A;  2SAK A;  4IM2 A;  3MC0 B;  1L7Y A;  1BUI C;  4ICV A;  3GE8 C;  1WGK A;  2KMM A;  2JX5 A;  1KM7 A;  5G2N A;  2LXC A;  1SF0 A;  4E3C A;  4DK5 A;  1V5T A;  2BGF A;  1NEN B;  3R7R A;  2L00 B;  3NUH B;  3WAL A;  2PE9 A;  3IT6 B;  4REZ A;  2KDF B;  1OEY A;  2IPK D;  1WR1 A;  3I9V 1;  1FIQ A;  3P4R B;  1WGH A;  3UGB B;  2H88 B;  1ZXH A;  5EDS A;  4G3X B;  1RAX A;  2BWF A;  3Q3M C;  4IKG A;  3ZJV A;  3RNE C;  2KK8 A;  3AEE B;  4IG7 B;  1CMX B;  3VUX A;  1Q5W B;  2M17 A;  2JPH A;  1HQR D;  3AEF B;  4ZHO A;  1D3Z A;  1FCC C;  3B2G A;  1F2R C;  3ML9 A;  4LJO B;  3UQA A;  3A4S C;  3RT3 B;  2D10 A;  2Q5W D;  2YEP B;  1ZDX A;  1T0Q C;  4ZHP A;  2GOW A;  4NQK E;  1WWT A;  5L83 A;  4EZK A;  4W9E A;  3NRZ A;  4NJC A;  3W1Y A;  3X23 A;  2NPT A;  1ENF A;  1S1Q B;  4WJP A;  3DOW A;  4YSZ B;  4JGH B;  1K52 A;  2NPT B;  2KQS A;  2J0M A;  2M4N A;  1Y56 A;  2JQR B;  4US9 A;  2CKH B;  5T8I A;  1GB4 A;  3BVM A;  1L6U A;  2KWC A;  4DDG D;  3JSV B;  1E7V A;  2N0S B;  2BS3 B;  1OQY A;  4EOY A;  2WDR B;  5D7G A;  1L6V A;  4A6Q A;  2G1E A;  2V9H A;  3URY A;  1I4R A;  5GXG B;  2JY6 A;  3R8B A;  5E6N A;  2WXH A;  3HK0 A;  3KUD B;  4WJN A;  3JW0 X;  3ZXV A;  3R66 C;  1LQB A;  2KDB A;  4P16 A;  2LRU A;  4LLG M;  2JYE A;  4I6L B;  5DPS A;  4A90 A;  4W9C A;  5TR5 A;  1EU4 A;  1JRU A;  1MI0 A;  2DZJ A;  4LNO A;  3R7Q A;  4QAY A;  4FBJ B;  1QOB A;  3VR9 B;  3MTN B;  2IGG A;  4G50 A;  2WXF A;  4RNA A;  2KLC A;  4AQ7 A;  2ASQ A;  1TJE A;  2FCS A;  1WYG A;  2LVP A;  2PE6 B;  2JXX A;  4W9J A;  4MM3 B;  2MX2 A;  4MGK E;  1T5X D;  3U7Z A;  1OTR B;  1WE6 A;  3V62 A;  1J7C A;  2HTM E;  1FNW A;  2J0J A;  2X38 A;  4RF0 A;  2IGH A;  4JE3 B;  4MM3 A;  4UDU C;  2FNJ B;  3VDZ A;  2JWZ A;  1V1P B;  1JML A;  2L05 A;  5E6O A;  4RM9 A;  3DHH C;  1C4A A;  2NBW B;  2WS3 B;  3RNG C;  5MPO A;  3VR8 B;  2IDY A;  3EGR A;  1C78 A;  3VQI A;  2NTT A;  2B3A A;  4NNJ B;  3ONS A;  2DYM A;  4M8M A;  3PO0 A;  5JXV A;  4M01 A;  3J9C A;  1UEL A;  3GE3 C;  4NAM A;  1SE9 A;  3PHW B;  1AW7 A;  3L4P A;  1TKY A;  3U52 E;  1YNT E;  4LTU A;  2K22 A;  4W9I A;  1SIJ A;  4HJK A;  4C4V A;  3ABV B;  1EWC A;  2D3C A;  4XWW A;  5HHD G;  3TIX A;  4HKQ A;  1E5W A;  4PT5 A;  2KN4 A;  3AN1 A;  4JPS A;  1RFK A;  2MJE A;  3A9K A;  4GN1 A;  1EU3 A;  4W9L A;  3LYY A;  3Q69 A;  5JH5 C;  1WFY A;  3IHP C;  2BYV E;  2WXK A;  1WF9 A;  3A33 B;  4JX1 C;  3VUY A;  2PW9 A;  1VZ6 A;  2E6X A;  3JSV A;  3Q3F A;  4HPM B;  1FNU A;  4IDI A;  3U8Z A;  4A3O A;  2QJL A;  1V81 A;  3BVZ A;  3N20 C;  3KUZ A;  2ZVO A;  3A4R A;  2K25 A;  3RN9 C;  3DBR I;  4H2A A;  2N7D A;  2MEK A;  4BKT A;  3ECI A;  1ZKH A;  5BMG A;  3EA6 A;  4MGZ E;  4OZA A;  3N30 A;  1WMH A;  1MHH E;  3OAW A;  4XE0 A;  1IUE A;  2G3Q B;  3P4P B;  1SE3 A;  2O2V A;  2WXJ A;  4P6V F;  2W9N A;  2NCN A;  3N1Z C;  2CU1 A;  3UQB A;  3NZ3 A;  2K3U A;  2BB5 A;  1I35 A;  1ZPS A;  3RZW C;  5CX3 A;  2ZPN A;  2PVG C;  3QX1 A;  1NYQ A;  3B2F A;  2HTH A;  3KQ4 A;  2LGI A;  3QWZ B;  4LCD E;  1R4N B;  4CQN A;  3CSF A;  3APF A;  3BY4 B;  2J7Q B;  3H6N A;  3JVZ X;  1N5X A;  2QDF A;  2W3S A;  3NS8 A;  5DPW A;  1NBF C;  1P1A A;  3QK0 A;  4IM0 A;  1XLQ A;  1FRD A;  3OWE B;  1TKE A;  3IG3 A;  2AEH A;  3SHQ A;  4N59 A;  1B1Z A;  3KH0 A;  1BXT A;  2KTR B;  4RH6 A;  3KWV A;  4XWT A;  1TZO A;  1K50 A;  1CQV A;  2LJ5 A;  3L08 A;  1K53 A;  1FXA A;  3Q2A C;  1N61 A;  4IWQ A;  3ZNH B;  4D2K A;  2M1M A;  4PS3 A;  3RUL A;  2M56 B;  3ZRF A;  2HDE A;  4HCP B;  1HZ6 A;  4NJ7 A;  2PJH A;  4HWI B;  4LNI A;  4C56 C;  2BS2 B;  1N6Z A;  5CHF A;  2KMA A;  4HPL B;  3ML8 A;  5AZF A;  1VR9 A;  2BB6 A;  2I38 A;  1S3S G;  4YSY B;  1P98 A;  1FO4 A;  1PUT A;  4WUR A;  1WH3 A;  3T3O A;  1WIA A;  3AI5 A;  2KT7 A;  2L1A A;  2JUO A;  1WRD B;  1NI3 A;  1OQR A;  1V97 A;  2L0F A;  4C80 A;  1GPX A;  2RMM A;  3CMM B;  1ET6 A;  5AUK A;  3AED B;  3WAM A;  3QA8 A;  3AE5 B;  4BKS D;  3MFG A;  1E7P B;  2CS4 A;  1WXA A;  5D94 A;  2EMT A;  1E8W A;  5EE0 A;  2KMC A;  1J7A A;  2DLB A;  5LNK 1;  3RYT A;  2LRW A;  3U30 A;  3MHZ A;  5AEK B;  3RI7 C;  4DHJ B;  2C9W B;  1D6E C;  2KDE B;  1L2N A;  1WJU A;  3P4S B;  2AX5 A;  1V80 A;  1V8C A;  4AJW A;  3DVN U;  2W55 A;  4RGO S;  3IT4 B;  4RMA A;  3ZDM C;  1Z5S B;  1Q10 A;  2INP E;  3S2A A;  4BKG A;  5FR3 A;  2KOX A;  1FRR A;  2CR5 A;  2Z0E B;  4GMV A;  1I7H A;  2N4F A;  4HXD A;  1YIW A;  1EWY C;  5H92 C;  3PZ8 A;  5DPT A;  3OG5 A;  1J19 A;  2WXN A;  3GB1 A;  3MC9 A;  1FFV A;  4NJ6 A;  2D2Q A;  1GAQ B;  4AS1 A;  2K0P A;  2VZK B;  2MBQ A;  4P7I A;  1OQQ A;  2G4D B;  2H89 B;  2K8H A;  2WXR A;  4WJQ A;  1UH6 A;  3GZN B;  2JRI B;  2GMI C;  3VFK A;  1WGD A;  1FXI A;  4FN2 A;  3H7P B;  3NVZ A;  4LDT D;  2R2O A;  2IO1 B;  4GDK A;  3PRZ A;  1SJH D;  1SIF A;  4OVZ A;  1JWM D;  2RR9 A;  1GNU A;  3C8Y A;  4MSM B;  3MHS D;  2VH1 A;  2I1K A;  2RSU A;  1AYF A;  1FNV A;  5E6J A;  2YLM A;  2OHF A;  3BK1 A;  1GJZ A;  4W9K A;  3TEY A;  4E71 A;  1L0X B;  1XEE A;  5D2M B;  2J4X A;  4GDL A;  4JQW C;  2DWQ A;  2KQ7 A;  4E74 A;  2WXM A;  1ZUD 2;  3WCQ A;  3ZKJ C;  4HRO A;  3P4Q B;  2WX0 A;  4L1B A;  4GXB A;  1V86 A;  2KLG A;  4DHZ B;  4FAD A;  3N9Y C;  4BBN C;  2D3A A;  2ZEQ A;  4KV2 A;  3RFZ B;  3IXS A;  2AL6 A;  2KZR A;  4KGT A;  4M8N A;  2QCZ A;  5JHA A;  1EUV B;  4XGA B;  2IO0 B;  2D3G A;  2L76 A;  3NVW A;  2INC C;  2J53 A;  4HJG E;  1F2R I;  2KX3 A;  4EE2 A;  5GMV A;  1YJI A;  2WDT B;  1EM7 A;  5D3D A;  1G6J A;  3LB8 C;  3IBE A;  2ZCC A;  4MH8 A;  4OVU A;  4BOS C;  4ARC A;  1L5P A;  2WXL A;  1SJE D;  1YD8 U;  5KHQ A;  4RGT A;  4DHZ E;  4MT5 A;  1T3Q A;  1HA5 A;  3KUC B;  3HVZ A;  3ZO5 B;  3SD5 A;  1C3T A;  2LGS A;  2G9H D;  2V1Y A;  1WRI A;  3VXW A;  2AQ1 B;  2WXO A;  3PGE A;  4GIV A;  3GZN I;  4XX5 A;  3M63 B;  1UZX B;  2JWU A;  2KX0 A;  3SFD B;  3IFW B;  3BYT B;  4K1R B;  3QAQ A;  1HTO A;  5DPR A;  2RPQ A;  3ZLZ A;  4L2Y A;  1Y8R C;  1E9M A;  3Q8A A;  3NZS A;  4GSW A;  2N1W A;  1RFA A;  4A20 A;  3ZJU A;  4HDQ A;  2DYO A;  3VH4 B;  2XK5 A;  4R3D A;  3AV8 A;  4YT0 B;  2DX5 B;  5IP4 D;  1PGX A;  1E10 A;  4KZC A;  3VRA B;  1TBE A;  2WU2 B;  2BKR B;  2BYF A;  2Z0D B;  3JYU A;  2IZV B;  4K81 A;  1XO3 A;  1KLV A;  4KSK C;  2FCQ A;  3QCA A;  1STE A;  1ZOY B;  1QIL A;  1QKZ A;  2DYB A;  4P1B C;  3W5V B;  2K6Q A;  2ACZ B;  2RPV A;  4US8 A;  3PTF C;  1YQB A;  2RDH A;  4JWS C;  4XDC A;  3EUB 2;  1I42 A;  2BBC A;  1QOF A;  2DAF A;  2K39 A;  3QAR A;  3A9J A;  5I4D A;  1LO5 D;  4BOZ B;  1JWB D;  1SE2 A;  4RF1 A;  3A1Q B;  2BF8 B;  2JZ3 B;  3RUI B;  3LJ3 A;  3TL5 A;  4AP4 C;  4W9H A;  4AJY B;  2C7M B;  2B76 B;  1ZE3 D;  2MW5 A;  1ESF A;  4MDK E;  3SFE B;  4TSS A;  2WYQ A;  3P42 A;  2ZNV B;  3NHE B;  2FBW B;  4J3O D;  1L4D B;  2KYW A;  5G5H A;  1TYG B;  1WM2 A;  1WYW B;  2FCN A;  3H9D A;  2Y5P A;  1LM8 B;  1FEH A;  3A9J B;  1FM0 D;  1UGJ A;  1ZXI A;  2MQJ A;  4B6W A;  4PS7 A;  1BML C;  3Q3N C;  3ZRC A;  1YN4 A;  3B08 A;  1FFU A;  4YXD B;  5BMI A;  4ACF A;  1VLB A;  3RMK C;  1GOZ A;  4ARI A;  1EF5 A;  2Y3A A;  4IWP A;  1R7S A;  2IY0 B;  4JIO U;  3DHG C;  1DOY A;  3RD2 A;  4P1C C;  3EFU A;  1YMH E;  1P7F A;  3HM6 X;  2KJH B;  1UGM A;  1U4A A;  4DXF A;  2BT6 A;  3TEX A;  1R4N I;  3AE8 B;  1H4R A;  1CK1 A;  1DOI A;  3UF8 A;  2K9X A;  4EZJ A;  3ZGZ A;  5LXH A;  3AEB B;  5H8Y E;  1FPY A;  5EE3 A;  3TEW A;  4DBG A;  3TMP B;  2V3P A;  5LXI B;  1OEY J;  1Q0W B;  5BO4 B;  2RD0 A;  1CJE A;  2MBH A;  2R2Q A;  2KD0 A;  3NVV A;  4I6N B;  3AE4 B;  2KJ6 A;  3E9S A;  2IBI B;  4BFR A;  4EEW A;  4KKJ A;  1KJT A;  3DBR B;  2E3T A;  2CHZ A;  2WXP A;  1E8Y A;  2NBV B;  4YL8 A;  4LK0 M;  3VRB B;  2O2V B;  4F8C B;  4DDI D;  2ONQ A;  1I4Q A;  2INN E;  3VTV A;  4C4V B;  3NG0 A;  1P3Q U;  2GBR A;  1ZDV A;  2HD5 B;  3BZD B;  1F0Z A;  2OOB B;  4BVU C;  1TS5 A;  4A9A A;  5BMH A;  1C9F A;  4HK2 A;  2N9L A;  3KVF B;  4F1S A;  1V2Y A;  2DZM A;  3DBL I;  4MAC A;  4KSL C;  3TUO A;  3APC A;  3MJW A;  1WX7 A;  1XCT L;  2FE8 A;  1YQ4 B;  3GP7 A;  3W1S C;  2KKC A;  3N3K B;  1WJ4 A;  4DWF A;  4KIK B;  3MP9 A;  4USA A;  3UIP B;  2G4S A;  2C7H A;  3GOE A;  4URK A;  4F7Z A;  1F1H A;  4CYE A;  2ON8 A;  2FUH B;  3PLU A;  2W54 A;  2DNF A;  3AEG B;  3HVD A;  1TTN A;  4BKS A;  2L0T A;  3DBH B;  2MJD A;  2D07 B;  1KF6 B;  3AM9 A;  5EE9 A;  3DVN V;  2IYD B;  1Z2M A;  3Q8B A;  3ZQ4 A;  1E90 A;  1MFW A;  2YEP F;  2LGD A;  3OJ3 A;  4FJY A;  1AN8 A;  2XN9 C;  1T0S C;  1V1O A;  2WXI A;  1F52 A;  3EC8 A;  2N1V A;  3M62 B;  2OJW A;  4RGN A;  3VH3 B;  3R2I A;  4BBN F;  1RRB A;  2NR2 A;  4MEM A;  2M0X A;  3Q8E A;  1TGZ B;  5LLI A;  1YX6 B;  4ZYN A;  3N1Y C;  2DAJ A;  2X8X X;  4WJO A;  3VHT C;  1QQR A;  2KQ4 X;  2BKF A;  4G11 A;  2PPH A;  3DCG A;  1MJD A;  3ZXR A;  2PIA A;  4GU2 A;  4ZOH C;  4FA6 A;  3EHV A;  2W3R A;  1MG4 A;  1SEB D;  1XCQ L;  2KDI A;  1YQ3 B;  1WGG A;  4PYZ A;  4LNN A;  1UF0 A;  3QHT A;  3L16 A;  2WXG A;  4EUT A;  1NYR A;  4FHJ A;  2QMT A;  2FIF A;  4M0W B;  2J0K A;  1TS2 A;  3DDC B;  5BYS A;  3WAP A;  2MWS B;  3RNC C;  3HRD D;  4K3B A;  1WX8 A;  2KXJ A;  4XC2 A;  3W9C B;  2KWU B;  2O6V B;  3L54 A;  3DBL B;  2WGS A;  3DVG X;  2N9E B;  1UUP A;  1P9D U;  5FK9 C;  1ET9 A;  4AOF A;  2V0G A;  4NAW B;  3NS1 A;  2VRR B;  4BZA A;  1HE8 A;  2MJ3 A;  5C1Z A;  1E8Z A;  1KRH A;  2MP2 B;  2XEW A;  2BYE A; 
#chains in the Genus database with same CATH homology
 4GXB A;  1V86 A;  2KLG A;  3PZD A;  3DQV A;  4DHZ B;  2NPT B;  1XQQ A;  2KQS A;  2NS5 A;  4FAD A;  4IW0 A;  3EEC A;  4PS8 A;  5IAA C;  2MBB B;  2DEN B;  2MBE A;  2J0M A;  2MCN B;  2M4N A;  3WIM A;  2ZEQ A;  4KV2 A;  4BBN C;  1V5O A;  4KDL B;  2AL6 A;  2CKH B;  2KZR A;  2WX1 A;  3M95 A;  4M8N A;  5JHA A;  1EUV B;  2IO0 B;  2JRH A;  2D3G A;  2L76 A;  3L0W B;  4GGQ A;  2KWC A;  4DDG D;  3JSV B;  2LWP A;  1E7V A;  2DHZ A;  2JVC A;  2N9P C;  3A1Q A;  4NPN A;  2AWT A;  4GDK B;  1YX5 B;  2LD9 A;  2KX3 A;  5GMV A;  2WDT B;  2PEA A;  3ZW3 A;  1OQY A;  1G6J A;  2KFK B;  3W1S A;  3IBE A;  2ZCC A;  4JLC A;  4EOY A;  5D7G A;  4OVU A;  4BOS C;  1YD8 U;  2A4Z A;  1J8C A;  4ZDV A;  5KHQ A;  4DHZ E;  2I1J A;  2JY6 A;  3KUC B;  4ANV A;  5E6N A;  3ZO5 B;  3HK0 A;  3KUD B;  3SD5 A;  1C3T A;  1R4M I;  2V1Y A;  4WJN A;  1ZW7 A;  4CHK A;  3VXW A;  3JW0 X;  3PPA A;  1WGR A;  3I3T B;  1FXT B;  4WQO B;  3R66 C;  1LQB A;  2KDB A;  3PGE A;  4GIV A;  4I6P A;  3GZN I;  1WR6 E;  2LRU A;  2REX A;  4XX5 A;  3M63 B;  3ZUN A;  2K8B A;  1UZX B;  2KX0 A;  3TCA A;  5C23 A;  1WZ3 A;  4I6L B;  5DPS A;  4TUU A;  1WI0 A;  2V4L A;  3AU4 A;  3IFW B;  1E7U A;  4W9C A;  4K1R B;  2MBO A;  4GOC A;  3BIN A;  3P2B A;  5TR5 A;  3QAQ A;  1JRU A;  2DZJ A;  4NAW A;  2XK5 B;  3R7Q A;  1AAR A;  5DPR A;  2RPQ A;  4FBJ B;  1E8X A;  3B0A A;  3ZLZ A;  5CHV C;  1GC6 A;  4EZL A;  1Y8R C;  3OJ4 B;  1ZGU B;  3MTN B;  4NY0 A;  3VVW B;  3VTU A;  4G50 A;  3NZS A;  4IC7 B;  4LJP B;  4GSW A;  2N1W A;  2CHX A;  2JZZ A;  2KLC A;  1SGH A;  2LAS A;  3RCZ A;  2ASQ A;  1RFA A;  1WJN A;  2FCS A;  3SDL C;  2Y5B B;  4A20 A;  2LVP A;  2PE6 B;  2JXX A;  4W9D A;  3AUL A;  3ZIM A;  4HDQ A;  4W9J A;  2DYO A;  2MLB A;  3VH4 B;  2XK5 A;  2D11 A;  2MX2 A;  4MGK E;  5KHO A;  1OTR B;  1WE6 A;  2K1F A;  3V62 A;  2BPS A;  2M8S A;  4W9G A;  2FCM A;  3LDZ E;  2DX5 B;  1M94 A;  5J18 A;  4KZC A;  2J0J A;  1TBE A;  1WE7 A;  4FUL A;  4MH0 E;  2WWZ A;  2BKR B;  2BYF A;  3APD A;  4EKU A;  4TQ1 A;  4MM3 A;  2C60 A;  2FNJ B;  2Z0D B;  2JWZ A;  3VDZ A;  2IO3 B;  1QZE A;  3K9P B;  4FHK A;  1H8C A;  1IYF A;  2EMS A;  4TKN A;  3JYU A;  2IZV B;  2L05 A;  3T9L A;  2KO3 A;  3QQ8 B;  2K6D B;  4K81 A;  4B9K A;  2DZK A;  1KLV A;  4KSK C;  2FCQ A;  3QCA A;  2EKE C;  4RM9 A;  4MEL A;  5E6O A;  3ZNI D;  3NOB A;  3PRM B;  1RLF A;  2NBW B;  2DYB A;  2K6Q A;  3PTF C;  4B95 A;  1YQB A;  3VQI A;  3QC8 B;  4KIK A;  2B3A A;  2LVO A;  4NNJ B;  3X0W A;  3DBH I;  1I42 A;  2GBN A;  2K39 A;  2DAF A;  3QAR A;  2LXA A;  5L95 C;  4CO7 A;  1V6E A;  3A9J A;  3ONS A;  2DYM A;  4M8M A;  2L8J A;  4BOZ B;  3U7D A;  3PSE B;  3A1Q B;  2BF8 B;  2JZ3 B;  4WAA A;  1UEL A;  3RUI B;  4DHJ D;  4X57 B;  4K7W A;  2NBU A;  3LJ3 A;  3WA0 A;  1VD2 A;  1SE9 A;  3PHW B;  5IA7 A;  3B1L X;  2HE7 A;  3DPD A;  2K8C A;  4AUQ C;  3PT2 B;  4W9I A;  3TL5 A;  4ASW C;  4HJK A;  1WXV A;  3QJZ A;  4AP4 C;  1WXM A;  3K9O B;  4W9H A;  4AJY B;  2C7M B;  3UIN B;  2MP2 A;  3ZTD A;  1K8R B;  3KW5 B;  3TIX A;  2MW5 A;  1E5W A;  4MDK E;  2LGX A;  1XD3 B;  1EO6 A;  2GBJ A;  2MA9 B;  2WYQ A;  3Q3J A;  1WGY A;  2G45 B;  3HHM A;  2ZNV B;  3NHE B;  4HCN B;  3A9K A;  4ICU A;  3TJP A;  4GN1 A;  4W9L A;  4G0N B;  2LZ6 A;  2ZZP B;  4J6I A;  4W9F A;  5JH5 C;  3PV1 A;  1UBQ A;  1WFY A;  1WM2 A;  3IHP C;  1WYW B;  3PHX B;  2BYV E;  2FCN A;  1WF9 A;  3H9D A;  1LM8 B;  4DXA B;  3A33 B;  3A9J B;  2KN5 A;  2MQJ A;  4B6W A;  4PS7 A;  3VUY A;  4IUM B;  3ZRC A;  3UIO B;  4KZ0 A;  3B08 A;  3JSV A;  3PRP B;  3Q3F A;  4HPM B;  3U8Z A;  4K7S A;  3V60 A;  1IP9 A;  4A3O A;  1V81 A;  2FAZ A;  4IWO A;  2BWE S;  2DZI A;  1EF5 A;  4IWP A;  2KWV B;  3KUZ A;  4N9F 4;  2ZVO A;  4FLH A;  3PRE A;  2IY0 B;  2K25 A;  3A4R A;  3ENE A;  2JT4 B;  4JIO U;  4TQ0 A;  4ANW A;  1WJ6 A;  4A3P A;  4WWP A;  3DBR I;  4HDO A;  2GBM A;  2N7D A;  3RD2 A;  4IM3 A;  1LXD A;  3IVF A;  3EFU A;  4BKT A;  2LGY A;  3A9K B;  3ALB A;  1ZKH A;  3ECI A;  4OVV A;  3HM6 X;  1WXS A;  2CHW A;  2KJH B;  2C5L C;  4MGZ E;  1UGM A;  3N30 A;  1U4A A;  1WMH A;  3O65 B;  1J0G A;  3OAW A;  1R4N I;  3L17 A;  1GUA B;  2G3Q B;  1H4R A;  2O2V A;  3UF8 A;  4II3 B;  4KVG B;  2W9N A;  2NCN A;  4EZJ A;  5LXH A;  1VCB A;  2CU1 A;  3UQB A;  3DBS A;  1KOT A;  2LI5 A;  5HKH A;  1I35 A;  3RZW C;  3ZNZ B;  5CX3 A;  3KYC D;  4DBG A;  2ZPN A;  4PYU A;  3TMP B;  3NZU A;  3QX1 A;  4FJZ A;  1P0R A;  1T0Y A;  4ZRJ A;  3TBL D;  2AL3 A;  4GB9 A;  2HTH A;  5LXI B;  1OEY J;  1Q0W B;  5G55 A;  2RD0 A;  3QWZ B;  4MJS A;  4LCD E;  5BO4 B;  3VTW A;  2MBH A;  2R2Q A;  2KJR A;  2UYZ B;  3CSF A;  3APF A;  3BY4 B;  2J7Q B;  3H7P A;  3H6N A;  3JVZ X;  2KD0 A;  3WAO A;  5J17 A;  3NS8 A;  5DPW A;  1NBF C;  3CF6 E;  1P1A A;  4MJS B;  3QK0 A;  3ZTC A;  4I6N B;  2KJ6 A;  4IM0 A;  3ZVV A;  2IBI B;  3H1U A;  3N32 A;  4BFR A;  4EEW A;  3IG3 A;  2AEH A;  1KJT A;  3KYD D;  1WM3 A;  1C1Y B;  3H7S A;  3PVL A;  2CHZ A;  3SHQ A;  1E8Y A;  3HM3 A;  3KH0 A;  2NBV B;  2KTR B;  2NVU I;  4YL8 A;  3V6E B;  2KTF A;  2FID A;  2C7N B;  3PLV A;  2O2V B;  1GG3 A;  4F8C B;  2IO2 B;  4WWN A;  4DDI D;  2LVQ A;  3M3J A;  2JF5 A;  2KNB A;  2OJR A;  2LJ5 A;  3L08 A;  2UWQ A;  3VTV A;  4ANU A;  1X1M A;  1P3Q U;  2GBR A;  2GBK A;  2YVC A;  2HD5 B;  5FR6 A;  4IWQ A;  3ZNH B;  2M1M A;  2IY1 B;  4PS3 A;  2OOB B;  4BVU C;  3RUL A;  1WMH B;  4K7U A;  3VUW A;  3ZRF A;  2KFK A;  4HCP B;  2KTR A;  4NJ7 A;  2PJH A;  2RGF A;  4HK2 A;  4HWI B;  3KVF B;  2AYO B;  2O6V D;  1UD7 A;  4JL9 A;  2O6V A;  4F1S A;  1V2Y A;  5D6J B;  1NI2 A;  2DZM A;  3AXC A;  4TV3 A;  3DBL I;  5CHF A;  4KSL C;  4KDI C;  2KMA A;  3APC A;  4HPL B;  3ML8 A;  5AZF A;  3ZNG C;  3MJW A;  5AZG A;  5JHB A;  1WX7 A;  1S3S G;  3W1S C;  2KKC A;  3N3K B;  1P98 A;  1WJ4 A;  4DWF A;  4KIK B;  2V3S A;  2ZVN A;  3UIP B;  1WH3 A;  2G4S A;  2C7H A;  1WIA A;  3AI5 A;  2HJ8 A;  3GOE A;  4URK A;  4F7Z A;  2MSE D;  1UBI A;  4II2 B;  4CYE A;  2JUO A;  2KC1 A;  4NQL B;  1WRD B;  2FUH B;  3RZF A;  3SU8 X;  2L0F A;  3PLU A;  3L13 A;  4XZ4 A;  3CMM B;  2ZPY A;  1TTN A;  3C0R B;  3R3M A;  1MG8 A;  4BKS A;  2L0T A;  3WAM A;  1PQS A;  2D07 B;  2N7E A;  3QA8 A;  4BKS D;  2XBB C;  1A5R A;  2CS4 A;  1WXA A;  4MGY E;  3DVN V;  5D94 A;  2IYD B;  2EMT A;  4FJV B;  1E8W A;  4WWO A;  1Z2M A;  2KMC A;  5AZH A;  3RYT A;  1E90 A;  2LRW A;  1F9J A;  3U30 A;  2LGD A;  3L10 B;  3OJ3 A;  3CST A;  4FJY A;  3V6C B;  1Q1O A;  5AEK B;  3HIZ A;  1LFD A;  5E6P A;  4ANX A;  4DHJ B;  2C9W B;  3T8M A;  2KDE B;  2KVR A;  1L2N A;  4HVB A;  1WJU A;  2Z59 B;  2ZJD A;  3EC8 A;  2N1V A;  1V80 A;  2L3Z A;  1ISN A;  3M62 B;  3VH3 B;  5CHW A;  4AWJ A;  2A5U A;  4AJW A;  2ZNV C;  3DVN U;  2KHW B;  4BBN F;  1RRB A;  4IM2 A;  2LUE A;  2NR2 A;  2M0X A;  4MEM A;  1L7Y A;  4RMA A;  3ZDM C;  3VAW A;  1TGZ B;  1Z5S B;  4ICV A;  1V49 A;  1BT0 A;  5J2R A;  5LLI A;  1EF1 A;  3S2A A;  4BKG A;  1YX6 B;  4ZYN A;  3WAN A;  1KM7 A;  3D32 A;  2DAJ A;  2KAN A;  2L7R A;  1IPG A;  5G2N A;  2LXC A;  4WJO A;  4E3C A;  3VHT C;  4DK5 A;  2KOX A;  1V5T A;  2BGF A;  2CR5 A;  2Z0E B;  4GMV A;  3R7R A;  2BKF A;  4G11 A;  2QHO A;  2N4F A;  1TZ1 A;  2PPH A;  2L00 B;  3DCG A;  2ZCB A;  4HXD A;  1YIW A;  2PE9 A;  3WAL A;  4GU2 A;  4FA6 A;  2KDF B;  3EHV A;  4MSQ B;  5DPT A;  1OEY A;  4ZRK A;  1J19 A;  1WR1 A;  1XT9 B;  2KC2 A;  4GDL B;  1WGH A;  3UGB B;  2KDI A;  5EDS A;  5JZE B;  4G3X B;  4NJ6 A;  1RAX A;  1WGG A;  2BWF A;  2D2Q A;  4PYZ A;  5CTR C;  3V61 A;  2MBQ A;  4P7I A;  2G4D B;  3QHT A;  3L16 A;  1OGW A;  4EUT A;  1WZ0 A;  2KK8 A;  2K8H A;  4FHJ A;  4WJQ A;  3OLM D;  1UH6 A;  4IG7 B;  1CMX B;  1GC7 A;  3VUX A;  2JRI B;  1Q5W B;  2FIF A;  2GMI C;  2M17 A;  4M0W B;  3VFK A;  1WGD A;  2J0K A;  5DCN A;  4FN2 A;  2JPH A;  3H7P B;  2KFJ A;  4LDT D;  2R2O A;  4HLE A;  3AU5 A;  3DDC B;  3DVG Y;  2IO1 B;  1V9J A;  4LDT B;  3WAP A;  2MWS B;  4GDK A;  1D3Z A;  1WX8 A;  2KXJ A;  4XC2 A;  3ML9 A;  1NDD A;  3PRZ A;  2KWU B;  2O6V B;  4LJO B;  3L54 A;  1SIF A;  4ZRI A;  3DVG X;  3A4S C;  2RR9 A;  4MSM B;  1GNU A;  3RT3 B;  3UQA A;  3MHS D;  3NY5 A;  2D10 A;  3ZDT A;  3PS6 A;  4EFO A;  2I1K A;  2RSU A;  2N9E B;  4RM8 A;  1P9D U;  2MRP A;  2YLM A;  1YJ1 A;  4AOF A;  2GOW A;  4NAW B;  2VRR B;  1HE8 A;  1WY8 A;  4NQK E;  5L83 A;  3QIJ A;  2N9X A;  4W9K A;  1GJZ A;  4E71 A;  4EZK A;  4W9E A;  5D2M B;  3W1Y A;  5C1Z A;  3X23 A;  2NPT A;  4GDL A;  1E8Z A;  4JQW C;  1S1Q B;  2KQ7 A;  4WJP A;  3DOW A;  4E74 A;  4MGI E;  1WX9 A;  2MP2 B;  3ZKJ C;  2XEW A;  4JGH B;  2BYE A;  2WX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...