3QHTA

Crystal structure of the monobody ysmb-1 bound to yeast sumo
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
KPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Isoform-specific monobody inhibitors of small ubiquitin-related modifiers engineered using structure-guided library design.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags De novo protein
molecule keywords Ubiquitin-like protein SMT3
total genus 20
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3qhtA00
2JRHA 2R2OA 1QZEA 3PS6A 3PRPB 2RR9A 3KUZA 2ZVOA 3HIZA 3ZDTA 2C7NB 3IHPC 4LDTD 2LGXA 2KJ6A 4PS7A 2IO3B 2GBKA 4I6PA 3QARA 3CSTA 2J0KA 4IM0A 1WE6A 1WZ0A 1WRDB 2O6VB 2A4ZA 2NPTB 3DVNU 3VTWA 2O2VB 3ZNID 1EF5A 2ZNVB 4W9HA 1WXVA 3R7RA 2KNBA 2CHWA 3LJ3A 4IM3A 4NJ7A 2NBWB 1WI0A 3A33B 2NCNA 4WAAA 3TJPA 3TBLD 2YVCA 3M63B 2KDBA 3VXWA 4CHKA 2M8SA 1WZ3A 4K1RB 2LRWA 1LXDA 2ZCBA 3VUYA 3PREA 1TGZB 1LQBA 1SIFA 1R4MI 2L00B 1GNUA 3H6NA 3VVWB 2KTRA 2ZEQA 3AI5A 3R7QA 1YX5B 3SDLC 2JF5A 2AWTA 3MTNB 3ECIA 4IWQA 3OJ4B 2L7RA 2DX5B 1ZGUB 2ZJDA 4MSQB 5C23A 3AULA 3ZNZB 2DENB 3UGBB 1SE9A 2G4DB 4GOCA 3JYUA 1IYFA 2KFKA 3WAOA 2KQSA 4ASWC 3WIMA 2JY6A 2LI5A 5DPWA 2KDIA 4II2B 1WFYA 1UBQA 3LDZE 4GDKA 5D6JB 1VCBA 5IAAC 1KJTA 3AU4A 3DOWA 4WJPA 5LXHA 4CYEA 1S1QB 3EHVA 2KMAA 4N9F4 1WGRA 2KWUB 1WMHB 2K8BA 3ZVVA 4URKA 2DZIA 1GJZA 1G6JA 1WF9A 2JVCA 1UZXB 4BKGA 3VUXA 4TQ0A 2YLMA 3KYDD 3RULA 2KJRA 1E8XA 1OEYA 5L95C 3MHSD 2KTFA 4FA6A 2KFJA 3H7SA 1Y8RC 2MBBB 3HM3A 4MGKE 3Q3FA 4G3XB 5TR5A 4FBJB 3K9OB 1NDDA 4BKSD 2ZNVC 2KZRA 3BY4B 1E90A 3APFA 2AL3A 3A9KB 2LGDA 3U30A 4EZKA 4KZ0A 3KUCB 3JSVB 4WJQA 4WJNA 4ZRKA 2DYOA 1NI2A 1WJUA 5JZEB 1E7UA 1WGGA 3B0AA 3H1UA 5L83A 1M94A 4HJKA 4OVVA 3DDCB 2LXAA 3JW0X 4LCDE 5E6NA 1YIWA 1UD7A 2FCMA 2LWPA 1TBEA 2RD0A 1K8RB 2RGFA 4F1SA 1V80A 3A9KA 2V4LA 5JHBA 1I35A 3K9PB 3GZNI 4HCNB 4DK5A 2PEAA 2L05A 4AP4C 1GG3A 4DHZE 3VH3B 4X57B 1H8CA 2EMTA 2FAZA 1VD2A 1YQBA 2MSED 3KVFB 2VRRB 3ZRCA 2HTHA 4KVGB 2GBJA 4W9LA 3KUDB 2MP2B 1WGYA 1KLVA 3ZNHB 2MRPA 4HVBA 2CS4A 3AXCA 4HK2A 4FLHA 3ML8A 2M17A 4BKTA 3WA0A 2LVOA 2Z0DB 4WQOB 2LASA 3QK0A 4EOYA 4GGQA 4KDIC 4G11A 4IW0A 4DHJD 2KDEB 4KSLC 1H4RA 2D3GA 2FUHB 1XQQA 2OJRA 3H7PA 2N1VA 3RZFA 2I1KA 3I3TB 4ICVA 1MG8A 4ANWA 4M0WB 4G0NB 1J8CA 4EUTA 2BYFA 3ONSA 3A4SC 4BFRA 2NPTA 4W9IA 5DCNA 2BWFA 3QWZB 3VFKA 2C5LC 2MA9B 2WX1A 4BVUC 4A20A 2K8CA 2G45B 2JXXA 1R4NI 4GSWA 4DDGD 5JHAA 4RMAA 4I6NB 4WWNA 3NOBA 3PTFC 1A5RA 5G55A 2KDFB 2EKEC 1WM2A 4PS3A 4K7SA 1YX6B 5E6PA 2KWCA 1OTRB 2MQJA 4WJOA 3VDZA 4IC7B 1UGMA 4MM3A 1E8ZA 3L13A 4BBNF 4HLEA 3DVGX 1D3ZA 4GB9A 4PS8A 3ZTCA 4HXDA 3ZUNA 4XC2A 3VHTC 5FR6A 4EZJA 1ISNA 4GDKB 1V49A 4K7WA 5AEKB 2D2QA 5LLIA 4ZYNA 4EEWA 2BKFA 2M4NA 2MBHA 4W9EA 2GBRA 2MCNB 1KOTA 4KIKA 3L10B 2KWVB 5GMVA 5BO4B 2R2QA 4OVUA 1AARA 2WYQA 1CMXB 4MSMB 4ICUA 2FNJB 2BKRB 2RPQA 1UH6A 2KKCA 2KC1A 1T0YA 2ZPNA 3QJZA 4NQLB 4W9KA 2JZ3B 3W1SA 2KO3A 5LXIB 5DPRA 1S3SG 3QC8B 4ZRIA 4ANXA 4AUQC 4EFOA 2IO2B 2WWZA 2V1YA 3ZRFA 1V81A 4K7UA 3SHQA 2HJ8A 2PE6B 2DAJA 3ZIMA 3QCAA 1Q1OA 2JPHA 4AWJA 2LXCA 1U4AA 4PYUA 2AEHA 2G4SA 3V6CB 3BINA 1J0GA 3ALBA 2IZVB 4NJ6A 3EECA 3WANA 3TL5A 2CHZA 4AJWA 2IYDB 4E71A 3PT2B 1LM8B 4ZRJA 1WJ6A 3QQ8B 4ANUA 4IWOA 4BKSA 1ZKHA 3C0RB 3N3KB 3QX1A 3VAWA 3EFUA 4MGIE 4P7IA 3UIOB 2G3QB 2JUOA 3JVZX 3NZSA 2XK5B 4DDID 2O6VD 3TCAA 4K81A 4GMVA 4W9GA 4HPMB 3DBLI 2K6QA 4IWPA 1L7YA 3DCGA 1V5OA 4WWPA 1V2YA 1OQYA 5CHFA 4F8CB 2KVRA 3PGEA 3WALA 3VQIA 2JZZA 4LJOB 1WY8A 2MBEA 3A9JA 3PHWB 4FHJA 4XX5A 3W1YA 3QAQA 3PHXB 2KC2A 2MP2A 2BWES 2LUEA 3RD2A 1YJ1A 5J17A 1RLFA 3T8MA 4NY0A 2MW5A 1LFDA 2O2VA 1WX8A 2CKHB 4M8NA 1E8YA 4MJSA 4DHZB 1TZ1A 2KLGA 2K6DB 2KD0A 1WR1A 2IY1B 1WX7A 2DZMA 2B3AA 4PYZA 1E7VA 4LJPB 3RUIB 3U7DA 4BBNC 4KDLB 4EZLA 1NBFC 4I6LB 4B6WA 3R66C 2XBBC 5JH5C 3PSEB 3ENEA 2LZ6A 3TIXA 1JRUA 4HDOA 4W9JA 4E74A 4RM9A 3UF8A 1EO6A 2L3ZA 2D10A 1L2NA 5C1ZA 3KYCD 2M1MA 1XD3B 1PQSA 3OLMD 4NNJB 4A3PA 4E3CA 4MELA 4CO7A 2K1FA 4IG7B 4FJVB 3V62A 4HCPB 4YL8A 2L8JA 4AJYB 2ZZPB 3L17A 1HE8A 2NBVB 4DBGA 4MEMA 5KHQA 3VTUA 3JSVA 4ZDVA 2UWQA 2KMCA 5E6OA 2GOWA 3APCA 2N1WA 4GDLA 5G2NA 1UELA 1WJNA 3IBEA 1IP9A 4FJZA 4MDKE 2KANA 3L54A 1EF1A 2QHOA 2MBOA 4FULA 4BOZB 3ZTDA 3QIJA 2C9WB 2Y5BB 3RCZA 2BYEA 3B08A 4JIOU 5D7GA 2REXA 3QA8A 5CHVC 3VTVA 3ZO5B 3M62B 2FIDA 3NHEB 4FADA 1WGDA 3AU5A 1XT9B 2J0JA 4KIKB 2DZJA 2L76A 2C60A 1GC6A 2WX0A 2EMSA 3PLVA 1IPGA 1KM7A 2K8HA 3PPAA 2WDTB 3NZUA 2AYOB 3CSFA 2NS5A 3PV1A 5CHWA 2PE9A 3HK0A 5EDSA 1RFAA 5J2RA 3L08A 4LDTB 2ZCCA 2IO1B 2NBUA 3IFWB 4FN2A 2MLBA 5AZGA 5HKHA 4W9CA 1C3TA 3V61A 3KH0A 2M0XA 2OOBB 2FCNA 2W9NA 3O65B 3WAMA 1F9JA 3V60A 3GOEA 5CX3A 3ZW3A 1X1MA 4RM8A 4GU2A 5J18A 1OEYJ 2Z0EB 2MBQA 2C7MB 3PRMB 3ZLZA 2ZVNA 1Z5SB 2KK8A 1E8WA 1V9JA 4HDQA 1P1AA 4B9KA 2GMIC 1OGWA 3M3JA 5DPTA 2XK5A 2D11A 3V6EB 2DHZA 2IY0B 2L0FA 2UYZB 4KSKC 4TUUA 4BOSC 2AL6A 3WAPA 2CR5A 2O6VA 4HPLB 3NY5A 4A3OA 1GUAB 2FCQA 4TQ1A 2LVPA 3PLUA 3DQVA 4JQWC 2CU1A 4IUMB 2KFKB 1Q0WB 4JLCA 4KV2A 4MGYE 3KW5B 2PPHA 3EC8A 3NS8A 2KJHB 2DYMA 1P3QU 2K39A 2LVQA 3PZDA 3DBSA 4FJYA 4GIVA 1GC7A 3DPDA 4MJSB 3RYTA 5AZHA 2MWSB 1YD8U 1V86A 2RSUA 2PJHA 3DVGY 3H7PB 2KTRB 2ASQA 2XEWA 4HWIB 4JGHB 4W9DA 2DZKA 2KLCA 2KN5A 1RAXA 2HE7A 1J19A 3SU8X 2LGYA 3A9JB 5D94A 2Z59B 3MJWA 2JWZA 1WR6E 2L0TA 3HM6X 3RT3B 1FXTB 4NQKE 3ZNGC 4ANVA 4DXAB 2NR2A 3UIPB 5DPSA 1EUVB 3PVLA 1C1YB 5AZFA 2N9XA 2ZPYA 2MX2A 1V6EA 4NAWA 3IVFA 1Q5WB 1P98A 3P2BA 3DVNV 5D2MB 4FHKA 3UINB 3ZDMC 2KX0A 3PRZA 1TTNA 3U8ZA 4NAWB 1WIAA 1WXAA 3W1SC 1V5TA 2FCSA 2D07B 2BYVE 3A4RA 3CMMB 2C7HA 4GDLB 3ML9A 3VUWA 3X0WA 4EKUA 2V3SA 4M8MA 2N4FA 4NPNA 2N7DA 4W9FA 3R3MA 2J0MA 1WJ4A 2DAFA 1P9DU 1WM3A 1Z2MA 2KHWB 2KXJA 4GN1A 4MGZE 3A1QA 4IM2A 4KZCA 1WE7A 2KX3A 2LRUA 3IG3A 2FIFA 3T9LA 1ZW7A 2NVUI 1BT0A 1WMHA 1WGHA 2DYBA 4F7ZA 3N30A 2LD9A 3H9DA 2HD5B 3N32A 2CHXA 5CTRC 4B95A 4DWFA 2A5UA 1WH3A 2J7QB 2KQ7A 3RZWC 3HHMA 4II3B 2BPSA 3SD5A 4XZ4A 2N7EA 3TMPB 3Q3JA 3X23A 1P0RA 1E5WA 5KHOA 2N9EB 3OJ3A 3L0WB 4GXBA 1RRBA 2JRIB 4TKNA 3CF6E 5IA7A 3B1LX 1UBIA 4TV3A 2GBMA 4G50A 3ZKJC 1SGHA 2I1JA 4WWOA 2GBNA 3S2AA 2BGFA 1I42A 1WYWB 3L16A 2IBIB 2K25A 2KOXA 1WX9A 4JL9A 3VH4B 3D32A 3DBRI 3UQBA 3A1QB 4MH0E 2IO0B 1WXMA 2JT4B 3APDA 2N9PC 2LJ5A 3M95A 3OAWA 4J6IA 4DHJB 3QHTA 1WXSA 3DBHI 3UQAA 2BF8B 4AOFA
chains in the Genus database with same CATH superfamily
1CZPA 3Q6BA 1QZEA 3PS6A 4P16A 2KDMA 2RR9A 1DOYA 1JALA 2GBKA 3QARA 2J0KA 1WRDB 3DVNU 2A4ZA 3SFEB 5T8IA 1EF5A 3R7RA 2WU5B 4IM3A 4NJ7A 3A33B 5C3JB 1N60A 2YVCA 3M63B 4R3DA 3Q3MC 2KDBA 3VXWA 1WZ3A 1LXDA 3BYTB 3PREA 1JQ4A 1TGZB 1LQBA 2LHEA 4B0EA 3I63C 3H6NA 2ON8A 3AI5A 2KACA 4IKGA 3AEFB 3ECIA 4IWQA 2JWUA 1B9RA 1QLBB 4C00A 2L7RA 2ZW0A 3TEZA 1SE9A 4GOCA 4KGTA 1IYFA 2KQSA 2JY6A 2LI5A 5DPWA 4II2B 1VCBA 3DHGC 4WURA 4WJPA 3EHVA 1PYWD 1WMHB 1DGJA 1T0RC 1J7CA 4URKA 4KGRA 1ENFA 1IGDA 2EKIA 3N1YC 4TQ0A 3RULA 1D4BA 2KFJA 3I9V1 2WGSA 2MBBB 2J52A 4G3XB 2G1EA 1FNUA 2ZNVC 3BY4B 2AL3A 1QQRA 3V05A 4ZRKA 4UDUC 4C7ZA 1WJUA 1E7UA 3H1UA 1M94A 1N5XA 2BS4B 1BXTA 1NYRA 2FCMA 1MFWA 2E6XA 1GB4A 4LK0M 2RGFA 1I4PA 3AN1A 1I35A 4HCNB 4DHZE 4AP4C 2LFIA 1I7HA 1YQBA 3KVFB 2LGIA 3ZRCA 3KUDB 2MP2B 1KLVA 3ZNHB 4HVBA 2XN9C 3C8YA 3ML8A 4HROA 4WQOB 1I4HA 2WXLA 4KDIC 1XQQA 3RZFA 2N1VA 4OVZA 2OHFA 3I3TB 2YEPB 1J8CA 4RCOA 2X38A 3Q8CA 2WX1A 3AV8A 4A20A 2K8CA 3E56A 2G45B 4GSWA 4I6NB 2EKEC 2KWCA 3I57A 4IC7B 4BBNF 1C9FA 1D3ZA 3ZTCA 1R4MB 1TT5B 4HXDA 1TIFA 4IDIA 3RFZB 3NVYA 5FR6A 5AEKB 2D2QA 2L83A 5LLIA 1SB3C 3L4PA 2BW2A 2TSSA 2KWVB 3W5UB 1KFYB 2R2QA 1AARA 2WYQA 4XWTA 3QJZA 1T0YA 3W1SA 4XE0A 1S3SG 3E9SA 1LGRA 3ZRFA 1V81A 4M01A 3SHQA 2Q5WD 1XO3A 2E3TA 3ZIMA 1Q1OA 4AWJA 2LXCA 1U4AA 2G4SA 1J0GA 1F0ZA 4NJ6A 2Y5PA 3WANA 3Q3OC 4YTNB 3QQ8B 2NTSA 4WAFA 1YOVB 1FXIA 1E7PB 3C0RB 1HTQA 4K3CA 3EFUA 4MGIE 3UIOB 2G3QB 4DDID 3U4EG 2RDGA 4K81A 4GMVA 4W9GA 3NG0A 4IWPA 5FR3A 2INDC 2W55A 4F8CB 3WALA 1CK1A 4L1BA 2AQ3B 3ABVB 4KKIA 2IPKD 3EUB2 4RF1A 3P63A 3QAQA 2KC2A 1VRAB 2MP2A 1ZPSA 2LUEA 5J17A 1YJ1A 1RLFA 3T8MA 4ARCA 2GB1A 1E8YA 1M4VA 2K6DB 3TUOA 2DZMA 2B3AA 1E7VA 3RUIB 2ZW1A 4EZLA 1T3QA 4I6LB 1JWBD 5EE3A 4B6WA 1IGCA 3TIXA 1JRUA 4W9JA 3UF8A 1EO6A 1L2NA 2LJIA 3KYCD 1XEEA 4NNJB 4L23A 4KGSA 1L5PA 3L17A 2NBVB 4US8A 5KHQA 1HEZE 3VTUA 4ZDVA 2KMCA 4BZAA 4GDLA 3VR9B 2KANA 2QHOA 3GS2A 4BOZB 3ZTDA 3QA8A 3ZO5B 2IGHA 3M62B 4ITKA 3NHEB 1K53A 4B0MA 1XT9B 3RI7C 2DZJA 3P4QB 2C60A 1GC6A 2EMSA 2JSVX 4HKZE 1C4AA 1IPGA 2K8HA 2INNE 1I4RA 3NZUA 1F2RC 2AYOB 4CQNA 4C80A 2NS5A 5CHWA 2AQ1B 5EDSA 2Z8LA 4LDTB 1D5ZC 2PIAA 1C3TA 3O65B 4C4VB 1RWSA 3ETRA 3GOEA 2YEPF 3ZW3A 1XLQA 4RM8A 2D5GA 4GU2A 5J18A 4OHJA 2Z0EB 2H89B 1ZXHA 2HJ1A 2PMVA 3MJ5A 3Q14C 1OGWA 2XK5A 1L0XB 2DHZA 4KSKC 4BOSC 3AEEB 3AMZA 2CR5A 4A3OA 1D5XC 3BWUD 4IUMB 1Q0WB 2I38A 1F1HA 4KV2A 1XCQL 2KJHB 1P3QU 1SIJA 1KRHA 1ZUD2 3AEAB 3DPDA 3RYTA 1JROA 1FEHA 1IBXB 2PJHA 3H7PB 4XDDA 4HWIB 1K51A 2DZKA 2KN5A 3CIRB 4N6EB 4RH6A 1SE3A 3MJWA 3BYYB 2L0TA 1FXTB 3Q3NC 4LLGM 5DPSA 2MJDA 1C1YB 3N1ZC 1KF6B 1MI0A 2WXIA 2MX2A 3IVFA 3P2BA 3DVNV 5D2MB 4FHKA 2KX0A 3U8ZA 3AEGB 1WIAA 1WSPA 3W1SC 2BYVE 3ML9A 2N4FA 4BAXA 2DAFA 2KHWB 2KXJA 4GN1A 1UWMA 4IM2A 4MM3B 2W3RA 2LRUA 2FIFA 3AH7A 3DBRB 1WMHA 4F7ZA 2JX5A 5CTRC 3AE2B 3HHMA 4XZ4A 3TMPB 3Q3JA 3X23A 5KHOA 3OJ3A 4GXBA 5IA7A 1TYGB 4TV3A 2GBNA 1YJJA 1DYQA 2BGFA 3T3NA 2BS2B 2IBIB 2K25A 1WX9A 5BMHA 1NYQA 3A1QB 4MH0E 2BF8B 2OEDA 2JQRB 3U7ZA 2JRHA 2KMMA 2R2OA 1CJEA 4YTMB 3PRPB 4XYCA 3ZDTA 2LGXA 3SFDB 2WXHA 4JX1C 3CSTA 4IM0A 2NPTB 3VTWA 2ZNVB 4W9HA 2KNBA 2CHWA 2NBWB 2G9HD 1YQ4B 3TBLD 2H88B 2QCZA 1RFKA 1L4DB 2WP9B 2ZCBA 3W2DA 3NS1A 2L00B 1FNWA 2KTRA 2ZEQA 1YX5B 3EA6A 2JF5A 5AUKA 3SDLC 2RMMA 3HVZA 1ZGUB 2ZJDA 5C23A 1YNTE 3AULA 1QOGA 1JCKB 2G4DB 3WAOA 1WFYA 1UBQA 4GDKA 1XLOA 1VZ6A 3DOWA 2FUG1 1S1QB 1I4XA 2KWUB 3ZVVA 1G6JA 1P7EA 3VR8B 1ET9A 1N6ZA 1SF0A 4JWUC 4HKQA 2KJRA 5L95C 2KTFA 3H7SA 2ICIA 1Y8RC 4MGKE 3RNGC 3K9OB 1NDDA 2QMTA 2KZRA 1V1PB 3A9KB 3KUCB 1NI2A 1K52A 1TS5A 5L83A 4HJKA 4OVVA 3NVVA 4ARIA 1ROEA 5E6NA 1AYFA 2LWPA 1XLPA 1PUTA 4ZRQA 1QOFA 3VRAB 2BB6A 3ZXVA 3GZNI 4DK5A 2PEAA 1GG3A 1H8CA 2HTHA 4W9LA 4J3OD 1TKEA 3Q2AC 2ACZB 1GOZA 3NJTA 3AXCA 4HK2A 3MC9A 4FLHA 2M56B 1AWDA 1GB1A 2M0AA 2LVOA 1CQVA 4G11A 4IW0A 1VR9A 2OJRA 2LMCA 3GP7A 3NVZA 3MFGA 4G0NB 2PTLA 1BMLC 3ONSA 2NPTA 3QWZB 2D3CA 3VFKA 2WQYB 1OQQA 2MA9B 3P4SB 4Q2JA 3BVGA 2JXXA 5IOIA 4RMAA 1TKGA 4WWNA 5G55A 4PS3A 1WM2A 1XLNA 5E6PA 5EE1A 1OTRB 3P4RB 3VDZA 2WXMA 1UGMA 1E8ZA 2CJNA 4GB9A 4PS8A 4YWGG 4EZJA 1V49A 4K7WA 2MBHA 2GBRA 1R4NB 1KOTA 4KIKA 5H8YE 2RDHA 3AE9B 3L10B 5GMVA 2KQ4X 1R7SA 1CMXB 4ICUA 2FNJB 2BKRB 2KKCA 2KC1A 1ZDVA 4W9KA 2JZ3B 1Q10A 5DPRA 4EFOA 2IO2B 1FNVA 2WWZA 3AEBB 5D3DA 2WXRA 4P1CC 1MVKA 1XCTL 2PE6B 2N0SB 2DAJA 3QCAA 1UWXA 3ALBA 3EECA 1LM8B 2K0PA 4MT5A 4ZRJA 3ZXRA 3QX1A 3N3KB 2JUOA 2M19A 3NZSA 2O6VD 3TCAA 1ZE3D 2BQQA 1FFUA 3C19A 2KVRA 1C79A 3VQIA 2JZZA 5BYQA 4YSYB 4LJOB 2MBEA 2BWES 2MW5A 3FAHA 1LFDA 2CKHB 4LNFA 3N9YC 2KLGA 4BBNC 4LJPB 4KDLB 4LNIA 2KYWA 2X8XX 2LHDA 2D10A 3OWEB 1XD3B 1PQSA 3OLMD 2K1FA 1UNSA 3RNAC 1TZOA 3V62A 1VJKA 4AJYB 2ZZPB 4KX6B 2VH2A 4DXGA 3JSVA 4WQMA 2UWQA 1YN5A 1TKYA 2BYTA 4FJZA 4FULA 2Y5BB 5D7GA 2REXA 5CHVC 1F77A 2FIDA 1L0VB 1P7FA 1F52A 2J0JA 2PW9A 2L76A 2WX0A 3EFCA 1PDXA 2WDTB 5MPOA 3CSFA 3PV1A 2LGSA 1RFAA 3URYA 2IO1B 5AZGA 1WWTA 3KH0A 2M0XA 5TSSA 1JWAD 3V60A 5HG2A 1KH0A 3GZNB 3ZJVA 4USAA 2ZVNA 1Z5SB 1E8WA 4HDQA 2IDYA 4B9KA 2GMIC 4RNAA 1C78A 1BUIC 1YN4A 1GUAB 2K9XA 4TQ1A 3PLUA 4JQWC 2KFKB 3RNEC 3KW5B 3NS8A 3EC8A 3SR6A 2VH1A 4GIVA 4FJYA 5AZHA 1YD8U 1OQRA 2KVZA 4W9DA 2XEWA 1AW7A 1E0ZA 2DWQA 1SE4A 4LNKA 1GAQB 2HE7A 3SU8X 2LGYA 2EELA 5D94A 2Z59B 4TSSA 2WU2B 3UIPB 1TY2A 1EUVB 1N5WA 5AZFA 2BVCA 5LNK1 1V6EA 4P6VF 1P98A 4HEA1 3ZDMC 3IT4B 3P4PB 4YSZB 1HXYD 3GB1A 3VUWA 4ZHPA 3X0WA 2W54A 1UF0A 4NPNA 4W9FA 2J0MA 1P9DU 1Z2MA 1ZP0B 2D3BA 4KZCA 1E6EB 1WE7A 2KX3A 3T9LA 4ACFA 1NVID 2DYBA 3N30A 3N32A 4RF0A 3RZWC 4II3B 1E5WA 5C2TB 3ZGZA 3AE7B 4YTPB 3CF6E 2GBMA 4WWOA 2KOXA 4US9A 3U2SC 2IO0B 1WXMA 4J6IA 4DHJB 4JWSC 3B2GA 1UGJA 4K3BA 2RDBC 2K5PA 3AECB 2VZKB 4QAYA 1FXAA 3Q69A 3HIZA 2C7NB 4LDTD 4PK1A 2IGGA 3FILA 2J42A 3AEDB 1WXVA 5I4DA 3LJ3A 3P42A 1HZ5A 4XWWA 2ONQA 3TJPA 3O13A 2N7JA 2M8SA 4M00A 2LRWA 1J7AA 2PVGC 1SIFA 2NTTA 1R4MI 3NUHB 3VVWB 3R7QA 3MTNB 3OJ4B 1WXQA 2DX5B 2J4XA 2DENB 3UGBB 2KDIA 4S17A 5D3IB 1QT9A 3AU4A 2PLPA 4N9F4 1WGRA 3Q8EA 2K8BA 5JXVA 2DZIA 1KLUD 1GJZA 2JVCA 5GXGB 5HI1A 3VUXA 2YLMA 3KYDD 3BIID 3R8BA 3Q8AA 4LNNA 3DHIC 5TR5A 4FBJB 4BKSD 1E90A 3APFA 2N9KA 4EZKA 3LYYA 4KZ0A 2DYOA 1WGGA 3B0AA 2V3PA 2JU6X 3AB5A 1I4GA 2LXAA 3DDCB 3JW0X 3EGRA 3GE3C 1YIWA 4YXDB 2RD0A 1K8RB 2BTEA 4IOIE 1V80A 2V4LA 3K9PB 2L05A 3VH3B 3ZYYX 4X57B 3IAS1 2EMTA 2FAZA 2MSED 5G5GA 1SEBD 2VRRB 1XF5L 2GBJA 4ZYSA 3SEBA 1WGYA 3B9JA 2N9LA 3WA0A 2WXFA 2BB5A 2LASA 3QK0A 4GGQA 3DWGC 2KDEB 2D3GA 2I1KA 3IXSA 2FBWB 4ANWA 4RGMA 4M0WB 3A4SC 4W9IA 5DCNA 4BVUC 1R4NI 2Y5CA 3NOBA 5IO9A 4K7SA 1QOAA 5AUIA 4WJOA 4MACA 3MC8A 4HLEA 1FCCC 3N20C 3ZUNA 4XGAB 1ISNA 1D6EC 1HA5A 4ZYNA 2BKFA 4L2YA 1YQ3B 5BO4B 4OVUA 3VRBB 2JXTA 4NAMA 2ZPNA 4NQLB 1SXTA 2KO3A 3KLSX 2XNAC 4ANXA 2V1YA 4K7UA 1TS3A 3V3XA 3ZJTA 2QIEB 5FKAC 1JRPA 2CHZA 4AJWA 2IYDB 2FE8A 2LEKA 2W3SA 1WJ6A 4LNOA 4ANUA 3DHHC 1ZKHA 1L0YB 4P7IA 3JVZX 4A6QA 4HPMB 4AS1A 1SBBB 3DCGA 1V5OA 2NMQA 4WWPA 3TSSA 1OQYA 3PGEA 4REZA 3W1YA 3PHXB 3RD2A 4YT0B 4DQOC 1WX8A 5JHAA 4MJSA 1TZ1A 2BT6A 3U7DA 1DOXA 3R66C 3AE3B 3ENEA 4DXFA 2WXKA 2L3ZA 2MJ3A 1EWCA 4A3PA 2DBYA 5HHDG 4CO7A 1E10A 2L8JA 2IJ0A 1ZDXA 2L1AA 4DBGA 5FK9C 4MEMA 5E6OA 3APCA 2N1WA 1WGKA 1UELA 1FCLA 1IP9A 4MDKE 2K22A 2WXJA 3L54A 4ZOHC 1EF1A 5EE0A 3FKYA 1V8CA 2C9WB 1JMLA 2AX5A 2BYEA 3B08A 4JIOU 2GLSA 3VTVA 2B76B 4FADA 2JYTA 3PLVA 5IN7A 2QDFA 3PPAA 3RMKC 1FRRA 3TEWA 5J2RA 3L08A 2ZCCA 2NBUA 4FN2A 1JWSD 5HKHA 4W9CA 4OZCA 2FCNA 1FM0D 1HTOA 2W9NA 1F9JA 3AE5B 3Q8BA 1T5XD 2UU7A 1MG4A 3PRMB 1T6BX 3ZLZA 1V1OA 2KK8A 1UUPA 1P1AA 4N58A 1V97A 3M3JA 3RNBC 1EWYC 2D11A 3V6EB 2L0FA 2UYZB 4A8XC 3AE6B 2AL6A 2O6VA 4LTUA 4WH4A 2FCQA 3DQVA 4JLCA 4MGYE 2PPHA 1QILA 2K39A 2LVQA 3PZDA 3DBSA 1NI3A 3ZJUA 4JPSA 2MWSB 3P1MA 2RSUA 1SSNA 2ASQA 4JGHB 1RAXA 1J19A 1KTKA 2SEBD 2V4IB 3A9JB 1ZOYB 2IGDA 2JWZA 2HDEA 3HM6X 3ZNGC 4NQKE 1TS4A 4DXAB 2INCC 3PVLA 1E9MA 3RNCC 2N9XA 2JZPA 3BVMA 2ZPYA 1A70A 3ZQ4A 4NAWA 1Q5WB 3RPFC 4HRSA 3PRZA 1TTNA 1V5TA 2FCSA 3A4RA 3CMMB 4GDLB 2WXGA 4M8MA 4RGOS 2N7DA 4MH8A 1WJ4A 3DBLB 1FMAD 3IG3A 1VDVA 3AE4B 4GLSC 1N61A 2WDQB 2LD9A 1FRDA 2V3NA 4OW0A 2CHXA 3BZDB 2A5UA 2J7QB 2KQ7A 3T3OA 2CU3A 2BPSA 2N7EA 2JYEA 4M02A 1P0RA 3L0WB 1RRBA 2JRIB 4TKNA 1UBIA 2BS3B 2I1JA 1SJHD 3IAM1 1I42A 1WYWB 4JL9A 3UQBA 3OAWA 3M95A 3APDA 2DNFA 3QHTA 4NJCA 1WXSA 3HUIA 4AOFA 1VLBA 1SJED 4OZBA 3FILB 2V0GA 3KUZA 2ZVOA 3IHPC 3LXFA 2KJ6A 3KWVA 2IO3B 4PS7A 3W5VB 5E6JA 4I6PA 1B1ZA 1WE6A 1WZ0A 2O6VB 4RGTA 3ZNID 2O2VB 1K50A 1I4QA 2WXQA 1WI0A 2NCNA 4WAAA 2KWDA 2KN4A 4AQ7A 4CHKA 4K1RB 3FC4A 4NZLB 3VUYA 2PVOD 1GNUA 1IBXA 1JW9D 1N62A 3PZ8A 2AWTA 1DOIA 4M0WA 4MSQB 2INPE 2LUMA 3ZNZB 3IT6B 3JYUA 2WS3B 2KFKA 1FO4A 4ASWC 3WIMA 4WIPA 4XDCA 3LDZE 5D6JB 5IAAC 1KJTA 5LXHA 4JE3B 4CYEA 2KMAA 3TEYA 1OFFA 3DWMA 1WF9A 2L32A 1UZXB 4BKGA 1GPXA 3UI3A 3AE1B 1E8XA 1OEYA 5IKCM 1ZXIA 3MHSD 4FA6A 2WXPA 1C4PA 3HM3A 3Q3FA 2WLBA 1ACCA 2WNMA 2DLBA 2MEKA 2LGDA 3U30A 2QC8A 3JSVB 4WJQA 4WJNA 2PKOA 1HQRD 2MHJA 2MJEA 2V9HA 4LCDE 1UD7A 1TBEA 1LO5D 4F1SA 3DBHB 3A9KA 2R61A 4N59A 4EE2A 2WDRB 2WXOA 1QOBA 4RGNA 5JHBA 1VD2A 3WCQA 1VZ7A 4KVGB 4WWMA 2MRPA 2CS4A 1TJEA 2M17A 2SAKA 4BKTA 3KWLA 4HPPA 2Z0DB 4EOYA 3MHZA 4DHJD 1IUEA 4KSLC 1H4RA 2FUHB 3H7PA 1PGXA 3CWIA 4ICVA 1MG8A 3KQ4A 4EUTA 2BYFA 4BFRA 2BWFA 4P1BC 1VZ8A 2C5LC 1PGBA 4DDGD 3B2FA 1RYJA 3J9CA 3PTFC 1A5RA 2KDFB 1YX6B 3I5JC 2QEJC 3BVZA 2MQJA 3BK2A 4MM3A 3L13A 3DVGX 1EM7A 5BYRA 2I2YA 3W9CB 1ET6A 3PZ7A 4XC2A 3VHTC 1L6UA 4GDKB 4EEWA 2WXNA 2M4NA 1C76A 5BMIA 4W9EA 5BMGA 3HVDA 2MCNB 4TMAB 4MSMB 3Q8FA 2RPQA 1UH6A 2D3AA 1PFDA 5LXIB 2AQ2B 3QC8B 4ZRIA 2KT7A 1T0SC 4AUQC 1MJDA 3NZ3A 2HJ8A 5H92C 1ESFA 1D5MC 2JPHA 4PYUA 2AEHA 3V6CB 3BINA 1F2RI 3PO0A 2IZVB 2KAJA 2RPVA 3TL5A 4E71A 3PT2B 4IWOA 4BKSA 3OG5A 3AE8B 3VAWA 1STEA 1FIQA 2XK5B 1Y56A 2WDVB 2W82A 4A90A 1N63A 1AN8A 2K6QA 1L7YA 3DBLI 3RN9C 1V2YA 4KKJA 5CHFA 2L52A 2K3UA 1WY8A 3A9JA 3PHWB 1JWUD 4FHJA 4PT5A 4XX5A 2QILA 1L6VA 1MPEA 4NY0A 2O2VA 4M8NA 4DHZB 2KD0A 1WR1A 2IY1B 1WX7A 4PYZA 1NBFC 3MP9A 2XBBC 5JH5C 3PSEB 2LZ6A 4HDOA 4E74A 4RM9A 1PGAA 5C1ZA 2M1MA 4E3CA 4MELA 1QF6A 2GRIA 4IG7B 4FJVB 4HCPB 4YL8A 1HE8A 1V1PA 1XXGA 3RNFC 4D2KA 2GOWA 5G2NA 1WJNA 3IBEA 1FD6A 2Y3AA 4YSXB 2MBOA 3QIJA 3RCZA 1YMHE 1C77A 2CJOA 1WGDA 3AU5A 2QSDA 4KIKB 4S0RA 1HZ6A 1YJIA 1KM7A 3GE8C 1MHXA 2PE9A 3HK0A 3R2TA 1J7BA 2VZKD 1MHHE 3IFWB 4ZHOA 2MLBA 3V61A 1JWMD 2OOBB 1EU3A 3WAMA 3AM9A 2QJLA 5CX3A 1X1MA 1OEYJ 2MBQA 2C7MB 1V9JA 4H2AA 5EE9A 5DPTA 3NRZA 2IY0B 4TUUA 3WAPA 4HPLB 4RFBA 3NY5A 4C4VA 1RM6C 2LVPA 4FXCA 2CU1A 1FPYA 1WYGA 5HFYA 2HTME 2GI9A 2DYMA 1QKZA 1GC7A 2J53A 4MJSB 1V86A 1EU4A 4O1NA 3DVGY 2KTRB 2KLCA 5G5HA 1T0QC 1WR6E 1C4CA 3RT3B 4ANVA 3MC0B 2NR2A 1YN3A 3N1XC 2WHIA 3UINB 2OJWA 4NAWB 1WXAA 1KLGD 4HJGE 4A9AA 2D07B 1NENB 2C7HA 4EKUA 2V3SA 1TS2A 1TY0A 3R3MA 4A55A 1WM3A 4ZRPA 4MGZE 3A1QA 3BK1A 3R2IA 3NVWA 5BYSA 3LB8C 1ZW7A 2NVUI 1BT0A 1WGHA 4C56C 3H9DA 2HD5B 1NEKB 4B95A 2BBCA 4DWFA 1FFVA 1WH3A 1SE2A 3SD5A 2N9EB 3U52E 3B1LX 4C7YA 2MH7A 3ZKJC 1WRIA 4G50A 1SGHA 3HRDD 3S2AA 4OZAA 5IP4D 3L16A 3VH4B 3D32A 3DBRI 1L4ZB 2JT4B 5JZEB 2N9PC 2LJ5A 3UQAA 3H8HA 3TEXA 3DBHI
chains in the Genus database with same CATH topology
2JRHA 2R2OA 1QZEA 3PS6A 3PRPB 2RR9A 3KUZA 2ZVOA 3HIZA 3ZDTA 2C7NB 3IHPC 4LDTD 2LGXA 2KJ6A 4PS7A 2IO3B 2GBKA 4I6PA 3QARA 3CSTA 2J0KA 4IM0A 1WE6A 1WZ0A 1WRDB 2O6VB 2A4ZA 2NPTB 3DVNU 3VTWA 2O2VB 3ZNID 1EF5A 2ZNVB 4W9HA 1WXVA 3R7RA 2KNBA 2CHWA 3LJ3A 4IM3A 4NJ7A 2NBWB 1WI0A 3A33B 2NCNA 4WAAA 3TJPA 3TBLD 2YVCA 3M63B 2KDBA 3VXWA 4CHKA 2M8SA 1WZ3A 4K1RB 2LRWA 1LXDA 2ZCBA 3VUYA 3PREA 1TGZB 1LQBA 1SIFA 1R4MI 2L00B 1GNUA 3H6NA 3VVWB 2KTRA 2ZEQA 3AI5A 3R7QA 1YX5B 3SDLC 2JF5A 2AWTA 3MTNB 3ECIA 4IWQA 3OJ4B 2L7RA 2DX5B 1ZGUB 2ZJDA 4MSQB 5C23A 3AULA 3ZNZB 2DENB 3UGBB 1SE9A 2G4DB 4GOCA 3JYUA 1IYFA 2KFKA 3WAOA 2KQSA 4ASWC 3WIMA 2JY6A 2LI5A 5DPWA 2KDIA 4II2B 1WFYA 1UBQA 3LDZE 4GDKA 5D6JB 1VCBA 5IAAC 1KJTA 3AU4A 3DOWA 4WJPA 5LXHA 4CYEA 1S1QB 3EHVA 2KMAA 4N9F4 1WGRA 2KWUB 1WMHB 2K8BA 3ZVVA 4URKA 2DZIA 1GJZA 1G6JA 1WF9A 2JVCA 1UZXB 4BKGA 3VUXA 4TQ0A 2YLMA 3KYDD 3RULA 2KJRA 1E8XA 1OEYA 5L95C 3MHSD 2KTFA 4FA6A 2KFJA 3H7SA 1Y8RC 2MBBB 3HM3A 4MGKE 3Q3FA 4G3XB 5TR5A 4FBJB 3K9OB 1NDDA 4BKSD 2ZNVC 2KZRA 3BY4B 1E90A 3APFA 2AL3A 3A9KB 2LGDA 3U30A 4EZKA 4KZ0A 3KUCB 3JSVB 4WJQA 4WJNA 4ZRKA 2DYOA 1NI2A 1WJUA 5JZEB 1E7UA 1WGGA 3B0AA 3H1UA 5L83A 1M94A 4HJKA 4OVVA 3DDCB 2LXAA 3JW0X 4LCDE 5E6NA 1YIWA 1UD7A 2FCMA 2LWPA 1TBEA 2RD0A 1K8RB 2RGFA 4F1SA 1V80A 3A9KA 2V4LA 5JHBA 1I35A 3K9PB 3GZNI 4HCNB 4DK5A 2PEAA 2L05A 4AP4C 1GG3A 4DHZE 3VH3B 4X57B 1H8CA 2EMTA 2FAZA 1VD2A 1YQBA 2MSED 3KVFB 2VRRB 3ZRCA 2HTHA 4KVGB 2GBJA 4W9LA 3KUDB 2MP2B 1WGYA 1KLVA 3ZNHB 2MRPA 4HVBA 2CS4A 3AXCA 4HK2A 4FLHA 3ML8A 2M17A 4BKTA 3WA0A 2LVOA 2Z0DB 4WQOB 2LASA 3QK0A 4EOYA 4GGQA 4KDIC 4G11A 4IW0A 4DHJD 2KDEB 4KSLC 1H4RA 2D3GA 2FUHB 1XQQA 2OJRA 3H7PA 2N1VA 3RZFA 2I1KA 3I3TB 4ICVA 1MG8A 4ANWA 4M0WB 4G0NB 1J8CA 4EUTA 2BYFA 3ONSA 3A4SC 4BFRA 2NPTA 4W9IA 5DCNA 2BWFA 3QWZB 3VFKA 2C5LC 2MA9B 2WX1A 4BVUC 4A20A 2K8CA 2G45B 2JXXA 1R4NI 4GSWA 4DDGD 5JHAA 4RMAA 4I6NB 4WWNA 3NOBA 3PTFC 1A5RA 5G55A 2KDFB 2EKEC 1WM2A 4PS3A 4K7SA 1YX6B 5E6PA 2KWCA 1OTRB 2MQJA 4WJOA 3VDZA 4IC7B 1UGMA 4MM3A 1E8ZA 3L13A 4BBNF 4HLEA 3DVGX 1D3ZA 4GB9A 4PS8A 3ZTCA 4HXDA 3ZUNA 4XC2A 3VHTC 5FR6A 4EZJA 1ISNA 4GDKB 1V49A 4K7WA 5AEKB 2D2QA 5LLIA 4ZYNA 4EEWA 2BKFA 2M4NA 2MBHA 4W9EA 2GBRA 2MCNB 1KOTA 4KIKA 3L10B 2KWVB 5GMVA 5BO4B 2R2QA 4OVUA 1AARA 2WYQA 1CMXB 4MSMB 4ICUA 2FNJB 2BKRB 2RPQA 1UH6A 2KKCA 2KC1A 1T0YA 2ZPNA 3QJZA 4NQLB 4W9KA 2JZ3B 3W1SA 2KO3A 5LXIB 5DPRA 1S3SG 3QC8B 4ZRIA 4ANXA 4AUQC 4EFOA 2IO2B 2WWZA 2V1YA 3ZRFA 1V81A 4K7UA 3SHQA 2HJ8A 2PE6B 2DAJA 3ZIMA 3QCAA 1Q1OA 2JPHA 4AWJA 2LXCA 1U4AA 4PYUA 2AEHA 2G4SA 3V6CB 3BINA 1J0GA 3ALBA 2IZVB 4NJ6A 3EECA 3WANA 3TL5A 2CHZA 4AJWA 2IYDB 4E71A 3PT2B 1LM8B 4ZRJA 1WJ6A 3QQ8B 4ANUA 4IWOA 4BKSA 1ZKHA 3C0RB 3N3KB 3QX1A 3VAWA 3EFUA 4MGIE 4P7IA 3UIOB 2G3QB 2JUOA 3JVZX 3NZSA 2XK5B 4DDID 2O6VD 3TCAA 4K81A 4GMVA 4W9GA 4HPMB 3DBLI 2K6QA 4IWPA 1L7YA 3DCGA 1V5OA 4WWPA 1V2YA 1OQYA 5CHFA 4F8CB 2KVRA 3PGEA 3WALA 3VQIA 2JZZA 4LJOB 1WY8A 2MBEA 3A9JA 3PHWB 4FHJA 4XX5A 3W1YA 3QAQA 3PHXB 2KC2A 2MP2A 2BWES 2LUEA 3RD2A 1YJ1A 5J17A 1RLFA 3T8MA 4NY0A 2MW5A 1LFDA 2O2VA 1WX8A 2CKHB 4M8NA 1E8YA 4MJSA 4DHZB 1TZ1A 2KLGA 2K6DB 2KD0A 1WR1A 2IY1B 1WX7A 2DZMA 2B3AA 4PYZA 1E7VA 4LJPB 3RUIB 3U7DA 4BBNC 4KDLB 4EZLA 1NBFC 4I6LB 4B6WA 3R66C 2XBBC 5JH5C 3PSEB 3ENEA 2LZ6A 3TIXA 1JRUA 4HDOA 4W9JA 4E74A 4RM9A 3UF8A 1EO6A 2L3ZA 2D10A 1L2NA 5C1ZA 3KYCD 2M1MA 1XD3B 1PQSA 3OLMD 4NNJB 4A3PA 4E3CA 4MELA 4CO7A 2K1FA 4IG7B 4FJVB 3V62A 4HCPB 4YL8A 2L8JA 4AJYB 2ZZPB 3L17A 1HE8A 2NBVB 4DBGA 4MEMA 5KHQA 3VTUA 3JSVA 4ZDVA 2UWQA 2KMCA 5E6OA 2GOWA 3APCA 2N1WA 4GDLA 5G2NA 1UELA 1WJNA 3IBEA 1IP9A 4FJZA 4MDKE 2KANA 3L54A 1EF1A 2QHOA 2MBOA 4FULA 4BOZB 3ZTDA 3QIJA 2C9WB 2Y5BB 3RCZA 2BYEA 3B08A 4JIOU 5D7GA 2REXA 3QA8A 5CHVC 3VTVA 3ZO5B 3M62B 2FIDA 3NHEB 4FADA 1WGDA 3AU5A 1XT9B 2J0JA 4KIKB 2DZJA 2L76A 2C60A 1GC6A 2WX0A 2EMSA 3PLVA 1IPGA 1KM7A 2K8HA 3PPAA 2WDTB 3NZUA 2AYOB 3CSFA 2NS5A 3PV1A 5CHWA 2PE9A 3HK0A 5EDSA 1RFAA 5J2RA 3L08A 4LDTB 2ZCCA 2IO1B 2NBUA 3IFWB 4FN2A 2MLBA 5AZGA 5HKHA 4W9CA 1C3TA 3V61A 3KH0A 2M0XA 2OOBB 2FCNA 2W9NA 3O65B 3WAMA 1F9JA 3V60A 3GOEA 5CX3A 3ZW3A 1X1MA 4RM8A 4GU2A 5J18A 1OEYJ 2Z0EB 2MBQA 2C7MB 3PRMB 3ZLZA 2ZVNA 1Z5SB 2KK8A 1E8WA 1V9JA 4HDQA 1P1AA 4B9KA 2GMIC 1OGWA 3M3JA 5DPTA 2XK5A 2D11A 3V6EB 2DHZA 2IY0B 2L0FA 2UYZB 4KSKC 4TUUA 4BOSC 2AL6A 3WAPA 2CR5A 2O6VA 4HPLB 3NY5A 4A3OA 1GUAB 2FCQA 4TQ1A 2LVPA 3PLUA 3DQVA 4JQWC 2CU1A 4IUMB 2KFKB 1Q0WB 4JLCA 4KV2A 4MGYE 3KW5B 2PPHA 3EC8A 3NS8A 2KJHB 2DYMA 1P3QU 2K39A 2LVQA 3PZDA 3DBSA 4FJYA 4GIVA 1GC7A 3DPDA 4MJSB 3RYTA 5AZHA 2MWSB 1YD8U 1V86A 2RSUA 2PJHA 3DVGY 3H7PB 2KTRB 2ASQA 2XEWA 4HWIB 4JGHB 4W9DA 2DZKA 2KLCA 2KN5A 1RAXA 2HE7A 1J19A 3SU8X 2LGYA 3A9JB 5D94A 2Z59B 3MJWA 2JWZA 1WR6E 2L0TA 3HM6X 3RT3B 1FXTB 4NQKE 3ZNGC 4ANVA 4DXAB 2NR2A 3UIPB 5DPSA 1EUVB 3PVLA 1C1YB 5AZFA 2N9XA 2ZPYA 2MX2A 1V6EA 4NAWA 3IVFA 1Q5WB 1P98A 3P2BA 3DVNV 5D2MB 4FHKA 3UINB 3ZDMC 2KX0A 3PRZA 1TTNA 3U8ZA 4NAWB 1WIAA 1WXAA 3W1SC 1V5TA 2FCSA 2D07B 2BYVE 3A4RA 3CMMB 2C7HA 4GDLB 3ML9A 3VUWA 3X0WA 4EKUA 2V3SA 4M8MA 2N4FA 4NPNA 2N7DA 4W9FA 3R3MA 2J0MA 1WJ4A 2DAFA 1P9DU 1WM3A 1Z2MA 2KHWB 2KXJA 4GN1A 4MGZE 3A1QA 4IM2A 4KZCA 1WE7A 2KX3A 2LRUA 3IG3A 2FIFA 3T9LA 1ZW7A 2NVUI 1BT0A 1WMHA 1WGHA 2DYBA 4F7ZA 3N30A 2LD9A 3H9DA 2HD5B 3N32A 2CHXA 5CTRC 4B95A 4DWFA 2A5UA 1WH3A 2J7QB 2KQ7A 3RZWC 3HHMA 4II3B 2BPSA 3SD5A 4XZ4A 2N7EA 3TMPB 3Q3JA 3X23A 1P0RA 1E5WA 5KHOA 2N9EB 3OJ3A 3L0WB 4GXBA 1RRBA 2JRIB 4TKNA 3CF6E 5IA7A 3B1LX 1UBIA 4TV3A 2GBMA 4G50A 3ZKJC 1SGHA 2I1JA 4WWOA 2GBNA 3S2AA 2BGFA 1I42A 1WYWB 3L16A 2IBIB 2K25A 2KOXA 1WX9A 4JL9A 3VH4B 3D32A 3DBRI 3UQBA 3A1QB 4MH0E 2IO0B 1WXMA 2JT4B 3APDA 2N9PC 2LJ5A 3M95A 3OAWA 4J6IA 4DHJB 3QHTA 1WXSA 3DBHI 3UQAA 2BF8B 4AOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRH A;  2R2O A;  1QZE A;  3PS6 A;  3PRP B;  2RR9 A;  3KUZ A;  2ZVO A;  3HIZ A;  3ZDT A;  2C7N B;  3IHP C;  4LDT D;  2LGX A;  2KJ6 A;  4PS7 A;  2IO3 B;  2GBK A;  4I6P A;  3QAR A;  3CST A;  2J0K A;  4IM0 A;  1WE6 A;  1WZ0 A;  1WRD B;  2O6V B;  2A4Z A;  2NPT B;  3DVN U;  3VTW A;  2O2V B;  3ZNI D;  1EF5 A;  2ZNV B;  4W9H A;  1WXV A;  3R7R A;  2KNB A;  2CHW A;  3LJ3 A;  4IM3 A;  4NJ7 A;  2NBW B;  1WI0 A;  3A33 B;  2NCN A;  4WAA A;  3TJP A;  3TBL D;  2YVC A;  3M63 B;  2KDB A;  3VXW A;  4CHK A;  2M8S A;  1WZ3 A;  4K1R B;  2LRW A;  1LXD A;  2ZCB A;  3VUY A;  3PRE A;  1TGZ B;  1LQB A;  1SIF A;  1R4M I;  2L00 B;  1GNU A;  3H6N A;  3VVW B;  2KTR A;  2ZEQ A;  3AI5 A;  3R7Q A;  1YX5 B;  3SDL C;  2JF5 A;  2AWT A;  3MTN B;  3ECI A;  4IWQ A;  3OJ4 B;  2L7R A;  2DX5 B;  1ZGU B;  2ZJD A;  4MSQ B;  5C23 A;  3AUL A;  3ZNZ B;  2DEN B;  3UGB B;  1SE9 A;  2G4D B;  4GOC A;  3JYU A;  1IYF A;  2KFK A;  3WAO A;  2KQS A;  4ASW C;  3WIM A;  2JY6 A;  2LI5 A;  5DPW A;  2KDI A;  4II2 B;  1WFY A;  1UBQ A;  3LDZ E;  4GDK A;  5D6J B;  1VCB A;  5IAA C;  1KJT A;  3AU4 A;  3DOW A;  4WJP A;  5LXH A;  4CYE A;  1S1Q B;  3EHV A;  2KMA A;  4N9F 4;  1WGR A;  2KWU B;  1WMH B;  2K8B A;  3ZVV A;  4URK A;  2DZI A;  1GJZ A;  1G6J A;  1WF9 A;  2JVC A;  1UZX B;  4BKG A;  3VUX A;  4TQ0 A;  2YLM A;  3KYD D;  3RUL A;  2KJR A;  1E8X A;  1OEY A;  5L95 C;  3MHS D;  2KTF A;  4FA6 A;  2KFJ A;  3H7S A;  1Y8R C;  2MBB B;  3HM3 A;  4MGK E;  3Q3F A;  4G3X B;  5TR5 A;  4FBJ B;  3K9O B;  1NDD A;  4BKS D;  2ZNV C;  2KZR A;  3BY4 B;  1E90 A;  3APF A;  2AL3 A;  3A9K B;  2LGD A;  3U30 A;  4EZK A;  4KZ0 A;  3KUC B;  3JSV B;  4WJQ A;  4WJN A;  4ZRK A;  2DYO A;  1NI2 A;  1WJU A;  5JZE B;  1E7U A;  1WGG A;  3B0A A;  3H1U A;  5L83 A;  1M94 A;  4HJK A;  4OVV A;  3DDC B;  2LXA A;  3JW0 X;  4LCD E;  5E6N A;  1YIW A;  1UD7 A;  2FCM A;  2LWP A;  1TBE A;  2RD0 A;  1K8R B;  2RGF A;  4F1S A;  1V80 A;  3A9K A;  2V4L A;  5JHB A;  1I35 A;  3K9P B;  3GZN I;  4HCN B;  4DK5 A;  2PEA A;  2L05 A;  4AP4 C;  1GG3 A;  4DHZ E;  3VH3 B;  4X57 B;  1H8C A;  2EMT A;  2FAZ A;  1VD2 A;  1YQB A;  2MSE D;  3KVF B;  2VRR B;  3ZRC A;  2HTH A;  4KVG B;  2GBJ A;  4W9L A;  3KUD B;  2MP2 B;  1WGY A;  1KLV A;  3ZNH B;  2MRP A;  4HVB A;  2CS4 A;  3AXC A;  4HK2 A;  4FLH A;  3ML8 A;  2M17 A;  4BKT A;  3WA0 A;  2LVO A;  2Z0D B;  4WQO B;  2LAS A;  3QK0 A;  4EOY A;  4GGQ A;  4KDI C;  4G11 A;  4IW0 A;  4DHJ D;  2KDE B;  4KSL C;  1H4R A;  2D3G A;  2FUH B;  1XQQ A;  2OJR A;  3H7P A;  2N1V A;  3RZF A;  2I1K A;  3I3T B;  4ICV A;  1MG8 A;  4ANW A;  4M0W B;  4G0N B;  1J8C A;  4EUT A;  2BYF A;  3ONS A;  3A4S C;  4BFR A;  2NPT A;  4W9I A;  5DCN A;  2BWF A;  3QWZ B;  3VFK A;  2C5L C;  2MA9 B;  2WX1 A;  4BVU C;  4A20 A;  2K8C A;  2G45 B;  2JXX A;  1R4N I;  4GSW A;  4DDG D;  5JHA A;  4RMA A;  4I6N B;  4WWN A;  3NOB A;  3PTF C;  1A5R A;  5G55 A;  2KDF B;  2EKE C;  1WM2 A;  4PS3 A;  4K7S A;  1YX6 B;  5E6P A;  2KWC A;  1OTR B;  2MQJ A;  4WJO A;  3VDZ A;  4IC7 B;  1UGM A;  4MM3 A;  1E8Z A;  3L13 A;  4BBN F;  4HLE A;  3DVG X;  1D3Z A;  4GB9 A;  4PS8 A;  3ZTC A;  4HXD A;  3ZUN A;  4XC2 A;  3VHT C;  5FR6 A;  4EZJ A;  1ISN A;  4GDK B;  1V49 A;  4K7W A;  5AEK B;  2D2Q A;  5LLI A;  4ZYN A;  4EEW A;  2BKF A;  2M4N A;  2MBH A;  4W9E A;  2GBR A;  2MCN B;  1KOT A;  4KIK A;  3L10 B;  2KWV B;  5GMV A;  5BO4 B;  2R2Q A;  4OVU A;  1AAR A;  2WYQ A;  1CMX B;  4MSM B;  4ICU A;  2FNJ B;  2BKR B;  2RPQ A;  1UH6 A;  2KKC A;  2KC1 A;  1T0Y A;  2ZPN A;  3QJZ A;  4NQL B;  4W9K A;  2JZ3 B;  3W1S A;  2KO3 A;  5LXI B;  5DPR A;  1S3S G;  3QC8 B;  4ZRI A;  4ANX A;  4AUQ C;  4EFO A;  2IO2 B;  2WWZ A;  2V1Y A;  3ZRF A;  1V81 A;  4K7U A;  3SHQ A;  2HJ8 A;  2PE6 B;  2DAJ A;  3ZIM A;  3QCA A;  1Q1O A;  2JPH A;  4AWJ A;  2LXC A;  1U4A A;  4PYU A;  2AEH A;  2G4S A;  3V6C B;  3BIN A;  1J0G A;  3ALB A;  2IZV B;  4NJ6 A;  3EEC A;  3WAN A;  3TL5 A;  2CHZ A;  4AJW A;  2IYD B;  4E71 A;  3PT2 B;  1LM8 B;  4ZRJ A;  1WJ6 A;  3QQ8 B;  4ANU A;  4IWO A;  4BKS A;  1ZKH A;  3C0R B;  3N3K B;  3QX1 A;  3VAW A;  3EFU A;  4MGI E;  4P7I A;  3UIO B;  2G3Q B;  2JUO A;  3JVZ X;  3NZS A;  2XK5 B;  4DDI D;  2O6V D;  3TCA A;  4K81 A;  4GMV A;  4W9G A;  4HPM B;  3DBL I;  2K6Q A;  4IWP A;  1L7Y A;  3DCG A;  1V5O A;  4WWP A;  1V2Y A;  1OQY A;  5CHF A;  4F8C B;  2KVR A;  3PGE A;  3WAL A;  3VQI A;  2JZZ A;  4LJO B;  1WY8 A;  2MBE A;  3A9J A;  3PHW B;  4FHJ A;  4XX5 A;  3W1Y A;  3QAQ A;  3PHX B;  2KC2 A;  2MP2 A;  2BWE S;  2LUE A;  3RD2 A;  1YJ1 A;  5J17 A;  1RLF A;  3T8M A;  4NY0 A;  2MW5 A;  1LFD A;  2O2V A;  1WX8 A;  2CKH B;  4M8N A;  1E8Y A;  4MJS A;  4DHZ B;  1TZ1 A;  2KLG A;  2K6D B;  2KD0 A;  1WR1 A;  2IY1 B;  1WX7 A;  2DZM A;  2B3A A;  4PYZ A;  1E7V A;  4LJP B;  3RUI B;  3U7D A;  4BBN C;  4KDL B;  4EZL A;  1NBF C;  4I6L B;  4B6W A;  3R66 C;  2XBB C;  5JH5 C;  3PSE B;  3ENE A;  2LZ6 A;  3TIX A;  1JRU A;  4HDO A;  4W9J A;  4E74 A;  4RM9 A;  3UF8 A;  1EO6 A;  2L3Z A;  2D10 A;  1L2N A;  5C1Z A;  3KYC D;  2M1M A;  1XD3 B;  1PQS A;  3OLM D;  4NNJ B;  4A3P A;  4E3C A;  4MEL A;  4CO7 A;  2K1F A;  4IG7 B;  4FJV B;  3V62 A;  4HCP B;  4YL8 A;  2L8J A;  4AJY B;  2ZZP B;  3L17 A;  1HE8 A;  2NBV B;  4DBG A;  4MEM A;  5KHQ A;  3VTU A;  3JSV A;  4ZDV A;  2UWQ A;  2KMC A;  5E6O A;  2GOW A;  3APC A;  2N1W A;  4GDL A;  5G2N A;  1UEL A;  1WJN A;  3IBE A;  1IP9 A;  4FJZ A;  4MDK E;  2KAN A;  3L54 A;  1EF1 A;  2QHO A;  2MBO A;  4FUL A;  4BOZ B;  3ZTD A;  3QIJ A;  2C9W B;  2Y5B B;  3RCZ A;  2BYE A;  3B08 A;  4JIO U;  5D7G A;  2REX A;  3QA8 A;  5CHV C;  3VTV A;  3ZO5 B;  3M62 B;  2FID A;  3NHE B;  4FAD A;  1WGD A;  3AU5 A;  1XT9 B;  2J0J A;  4KIK B;  2DZJ A;  2L76 A;  2C60 A;  1GC6 A;  2WX0 A;  2EMS A;  3PLV A;  1IPG A;  1KM7 A;  2K8H A;  3PPA A;  2WDT B;  3NZU A;  2AYO B;  3CSF A;  2NS5 A;  3PV1 A;  5CHW A;  2PE9 A;  3HK0 A;  5EDS A;  1RFA A;  5J2R A;  3L08 A;  4LDT B;  2ZCC A;  2IO1 B;  2NBU A;  3IFW B;  4FN2 A;  2MLB A;  5AZG A;  5HKH A;  4W9C A;  1C3T A;  3V61 A;  3KH0 A;  2M0X A;  2OOB B;  2FCN A;  2W9N A;  3O65 B;  3WAM A;  1F9J A;  3V60 A;  3GOE A;  5CX3 A;  3ZW3 A;  1X1M A;  4RM8 A;  4GU2 A;  5J18 A;  1OEY J;  2Z0E B;  2MBQ A;  2C7M B;  3PRM B;  3ZLZ A;  2ZVN A;  1Z5S B;  2KK8 A;  1E8W A;  1V9J A;  4HDQ A;  1P1A A;  4B9K A;  2GMI C;  1OGW A;  3M3J A;  5DPT A;  2XK5 A;  2D11 A;  3V6E B;  2DHZ A;  2IY0 B;  2L0F A;  2UYZ B;  4KSK C;  4TUU A;  4BOS C;  2AL6 A;  3WAP A;  2CR5 A;  2O6V A;  4HPL B;  3NY5 A;  4A3O A;  1GUA B;  2FCQ A;  4TQ1 A;  2LVP A;  3PLU A;  3DQV A;  4JQW C;  2CU1 A;  4IUM B;  2KFK B;  1Q0W B;  4JLC A;  4KV2 A;  4MGY E;  3KW5 B;  2PPH A;  3EC8 A;  3NS8 A;  2KJH B;  2DYM A;  1P3Q U;  2K39 A;  2LVQ A;  3PZD A;  3DBS A;  4FJY A;  4GIV A;  1GC7 A;  3DPD A;  4MJS B;  3RYT A;  5AZH A;  2MWS B;  1YD8 U;  1V86 A;  2RSU A;  2PJH A;  3DVG Y;  3H7P B;  2KTR B;  2ASQ A;  2XEW A;  4HWI B;  4JGH B;  4W9D A;  2DZK A;  2KLC A;  2KN5 A;  1RAX A;  2HE7 A;  1J19 A;  3SU8 X;  2LGY A;  3A9J B;  5D94 A;  2Z59 B;  3MJW A;  2JWZ A;  1WR6 E;  2L0T A;  3HM6 X;  3RT3 B;  1FXT B;  4NQK E;  3ZNG C;  4ANV A;  4DXA B;  2NR2 A;  3UIP B;  5DPS A;  1EUV B;  3PVL A;  1C1Y B;  5AZF A;  2N9X A;  2ZPY A;  2MX2 A;  1V6E A;  4NAW A;  3IVF A;  1Q5W B;  1P98 A;  3P2B A;  3DVN V;  5D2M B;  4FHK A;  3UIN B;  3ZDM C;  2KX0 A;  3PRZ A;  1TTN A;  3U8Z A;  4NAW B;  1WIA A;  1WXA A;  3W1S C;  1V5T A;  2FCS A;  2D07 B;  2BYV E;  3A4R A;  3CMM B;  2C7H A;  4GDL B;  3ML9 A;  3VUW A;  3X0W A;  4EKU A;  2V3S A;  4M8M A;  2N4F A;  4NPN A;  2N7D A;  4W9F A;  3R3M A;  2J0M A;  1WJ4 A;  2DAF A;  1P9D U;  1WM3 A;  1Z2M A;  2KHW B;  2KXJ A;  4GN1 A;  4MGZ E;  3A1Q A;  4IM2 A;  4KZC A;  1WE7 A;  2KX3 A;  2LRU A;  3IG3 A;  2FIF A;  3T9L A;  1ZW7 A;  2NVU I;  1BT0 A;  1WMH A;  1WGH A;  2DYB A;  4F7Z A;  3N30 A;  2LD9 A;  3H9D A;  2HD5 B;  3N32 A;  2CHX A;  5CTR C;  4B95 A;  4DWF A;  2A5U A;  1WH3 A;  2J7Q B;  2KQ7 A;  3RZW C;  3HHM A;  4II3 B;  2BPS A;  3SD5 A;  4XZ4 A;  2N7E A;  3TMP B;  3Q3J A;  3X23 A;  1P0R A;  1E5W A;  5KHO A;  2N9E B;  3OJ3 A;  3L0W B;  4GXB A;  1RRB A;  2JRI B;  4TKN A;  3CF6 E;  5IA7 A;  3B1L X;  1UBI A;  4TV3 A;  2GBM A;  4G50 A;  3ZKJ C;  1SGH A;  2I1J A;  4WWO A;  2GBN A;  3S2A A;  2BGF A;  1I42 A;  1WYW B;  3L16 A;  2IBI B;  2K25 A;  2KOX A;  1WX9 A;  4JL9 A;  3VH4 B;  3D32 A;  3DBR I;  3UQB A;  3A1Q B;  4MH0 E;  2IO0 B;  1WXM A;  2JT4 B;  3APD A;  2N9P C;  2LJ5 A;  3M95 A;  3OAW A;  4J6I A;  4DHJ B;  3QHT A;  1WXS A;  3DBH I;  3UQA A;  2BF8 B;  4AOF A; 
#chains in the Genus database with same CATH topology
 1CZP A;  3Q6B A;  1QZE A;  3PS6 A;  4P16 A;  2KDM A;  2RR9 A;  1DOY A;  1JAL A;  2GBK A;  3QAR A;  2J0K A;  1WRD B;  3DVN U;  2A4Z A;  3SFE B;  5T8I A;  1EF5 A;  3R7R A;  2WU5 B;  4IM3 A;  4NJ7 A;  3A33 B;  5C3J B;  1N60 A;  2YVC A;  3M63 B;  4R3D A;  3Q3M C;  2KDB A;  3VXW A;  1WZ3 A;  1LXD A;  3BYT B;  3PRE A;  1JQ4 A;  1TGZ B;  1LQB A;  2LHE A;  4B0E A;  3I63 C;  3H6N A;  2ON8 A;  3AI5 A;  2KAC A;  4IKG A;  3AEF B;  3ECI A;  4IWQ A;  2JWU A;  1B9R A;  1QLB B;  4C00 A;  2L7R A;  2ZW0 A;  3TEZ A;  1SE9 A;  4GOC A;  4KGT A;  1IYF A;  2KQS A;  2JY6 A;  2LI5 A;  5DPW A;  4II2 B;  1VCB A;  3DHG C;  4WUR A;  4WJP A;  3EHV A;  1PYW D;  1WMH B;  1DGJ A;  1T0R C;  1J7C A;  4URK A;  4KGR A;  1ENF A;  1IGD A;  2EKI A;  3N1Y C;  4TQ0 A;  3RUL A;  1D4B A;  2KFJ A;  3I9V 1;  2WGS A;  2MBB B;  2J52 A;  4G3X B;  2G1E A;  1FNU A;  2ZNV C;  3BY4 B;  2AL3 A;  1QQR A;  3V05 A;  4ZRK A;  4UDU C;  4C7Z A;  1WJU A;  1E7U A;  3H1U A;  1M94 A;  1N5X A;  2BS4 B;  1BXT A;  1NYR A;  2FCM A;  1MFW A;  2E6X A;  1GB4 A;  4LK0 M;  2RGF A;  1I4P A;  3AN1 A;  1I35 A;  4HCN B;  4DHZ E;  4AP4 C;  2LFI A;  1I7H A;  1YQB A;  3KVF B;  2LGI A;  3ZRC A;  3KUD B;  2MP2 B;  1KLV A;  3ZNH B;  4HVB A;  2XN9 C;  3C8Y A;  3ML8 A;  4HRO A;  4WQO B;  1I4H A;  2WXL A;  4KDI C;  1XQQ A;  3RZF A;  2N1V A;  4OVZ A;  2OHF A;  3I3T B;  2YEP B;  1J8C A;  4RCO A;  2X38 A;  3Q8C A;  2WX1 A;  3AV8 A;  4A20 A;  2K8C A;  3E56 A;  2G45 B;  4GSW A;  4I6N B;  2EKE C;  2KWC A;  3I57 A;  4IC7 B;  4BBN F;  1C9F A;  1D3Z A;  3ZTC A;  1R4M B;  1TT5 B;  4HXD A;  1TIF A;  4IDI A;  3RFZ B;  3NVY A;  5FR6 A;  5AEK B;  2D2Q A;  2L83 A;  5LLI A;  1SB3 C;  3L4P A;  2BW2 A;  2TSS A;  2KWV B;  3W5U B;  1KFY B;  2R2Q A;  1AAR A;  2WYQ A;  4XWT A;  3QJZ A;  1T0Y A;  3W1S A;  4XE0 A;  1S3S G;  3E9S A;  1LGR A;  3ZRF A;  1V81 A;  4M01 A;  3SHQ A;  2Q5W D;  1XO3 A;  2E3T A;  3ZIM A;  1Q1O A;  4AWJ A;  2LXC A;  1U4A A;  2G4S A;  1J0G A;  1F0Z A;  4NJ6 A;  2Y5P A;  3WAN A;  3Q3O C;  4YTN B;  3QQ8 B;  2NTS A;  4WAF A;  1YOV B;  1FXI A;  1E7P B;  3C0R B;  1HTQ A;  4K3C A;  3EFU A;  4MGI E;  3UIO B;  2G3Q B;  4DDI D;  3U4E G;  2RDG A;  4K81 A;  4GMV A;  4W9G A;  3NG0 A;  4IWP A;  5FR3 A;  2IND C;  2W55 A;  4F8C B;  3WAL A;  1CK1 A;  4L1B A;  2AQ3 B;  3ABV B;  4KKI A;  2IPK D;  3EUB 2;  4RF1 A;  3P63 A;  3QAQ A;  2KC2 A;  1VRA B;  2MP2 A;  1ZPS A;  2LUE A;  5J17 A;  1YJ1 A;  1RLF A;  3T8M A;  4ARC A;  2GB1 A;  1E8Y A;  1M4V A;  2K6D B;  3TUO A;  2DZM A;  2B3A A;  1E7V A;  3RUI B;  2ZW1 A;  4EZL A;  1T3Q A;  4I6L B;  1JWB D;  5EE3 A;  4B6W A;  1IGC A;  3TIX A;  1JRU A;  4W9J A;  3UF8 A;  1EO6 A;  1L2N A;  2LJI A;  3KYC D;  1XEE A;  4NNJ B;  4L23 A;  4KGS A;  1L5P A;  3L17 A;  2NBV B;  4US8 A;  5KHQ A;  1HEZ E;  3VTU A;  4ZDV A;  2KMC A;  4BZA A;  4GDL A;  3VR9 B;  2KAN A;  2QHO A;  3GS2 A;  4BOZ B;  3ZTD A;  3QA8 A;  3ZO5 B;  2IGH A;  3M62 B;  4ITK A;  3NHE B;  1K53 A;  4B0M A;  1XT9 B;  3RI7 C;  2DZJ A;  3P4Q B;  2C60 A;  1GC6 A;  2EMS A;  2JSV X;  4HKZ E;  1C4A A;  1IPG A;  2K8H A;  2INN E;  1I4R A;  3NZU A;  1F2R C;  2AYO B;  4CQN A;  4C80 A;  2NS5 A;  5CHW A;  2AQ1 B;  5EDS A;  2Z8L A;  4LDT B;  1D5Z C;  2PIA A;  1C3T A;  3O65 B;  4C4V B;  1RWS A;  3ETR A;  3GOE A;  2YEP F;  3ZW3 A;  1XLQ A;  4RM8 A;  2D5G A;  4GU2 A;  5J18 A;  4OHJ A;  2Z0E B;  2H89 B;  1ZXH A;  2HJ1 A;  2PMV A;  3MJ5 A;  3Q14 C;  1OGW A;  2XK5 A;  1L0X B;  2DHZ A;  4KSK C;  4BOS C;  3AEE B;  3AMZ A;  2CR5 A;  4A3O A;  1D5X C;  3BWU D;  4IUM B;  1Q0W B;  2I38 A;  1F1H A;  4KV2 A;  1XCQ L;  2KJH B;  1P3Q U;  1SIJ A;  1KRH A;  1ZUD 2;  3AEA B;  3DPD A;  3RYT A;  1JRO A;  1FEH A;  1IBX B;  2PJH A;  3H7P B;  4XDD A;  4HWI B;  1K51 A;  2DZK A;  2KN5 A;  3CIR B;  4N6E B;  4RH6 A;  1SE3 A;  3MJW A;  3BYY B;  2L0T A;  1FXT B;  3Q3N C;  4LLG M;  5DPS A;  2MJD A;  1C1Y B;  3N1Z C;  1KF6 B;  1MI0 A;  2WXI A;  2MX2 A;  3IVF A;  3P2B A;  3DVN V;  5D2M B;  4FHK A;  2KX0 A;  3U8Z A;  3AEG B;  1WIA A;  1WSP A;  3W1S C;  2BYV E;  3ML9 A;  2N4F A;  4BAX A;  2DAF A;  2KHW B;  2KXJ A;  4GN1 A;  1UWM A;  4IM2 A;  4MM3 B;  2W3R A;  2LRU A;  2FIF A;  3AH7 A;  3DBR B;  1WMH A;  4F7Z A;  2JX5 A;  5CTR C;  3AE2 B;  3HHM A;  4XZ4 A;  3TMP B;  3Q3J A;  3X23 A;  5KHO A;  3OJ3 A;  4GXB A;  5IA7 A;  1TYG B;  4TV3 A;  2GBN A;  1YJJ A;  1DYQ A;  2BGF A;  3T3N A;  2BS2 B;  2IBI B;  2K25 A;  1WX9 A;  5BMH A;  1NYQ A;  3A1Q B;  4MH0 E;  2BF8 B;  2OED A;  2JQR B;  3U7Z A;  2JRH A;  2KMM A;  2R2O A;  1CJE A;  4YTM B;  3PRP B;  4XYC A;  3ZDT A;  2LGX A;  3SFD B;  2WXH A;  4JX1 C;  3CST A;  4IM0 A;  2NPT B;  3VTW A;  2ZNV B;  4W9H A;  2KNB A;  2CHW A;  2NBW B;  2G9H D;  1YQ4 B;  3TBL D;  2H88 B;  2QCZ A;  1RFK A;  1L4D B;  2WP9 B;  2ZCB A;  3W2D A;  3NS1 A;  2L00 B;  1FNW A;  2KTR A;  2ZEQ A;  1YX5 B;  3EA6 A;  2JF5 A;  5AUK A;  3SDL C;  2RMM A;  3HVZ A;  1ZGU B;  2ZJD A;  5C23 A;  1YNT E;  3AUL A;  1QOG A;  1JCK B;  2G4D B;  3WAO A;  1WFY A;  1UBQ A;  4GDK A;  1XLO A;  1VZ6 A;  3DOW A;  2FUG 1;  1S1Q B;  1I4X A;  2KWU B;  3ZVV A;  1G6J A;  1P7E A;  3VR8 B;  1ET9 A;  1N6Z A;  1SF0 A;  4JWU C;  4HKQ A;  2KJR A;  5L95 C;  2KTF A;  3H7S A;  2ICI A;  1Y8R C;  4MGK E;  3RNG C;  3K9O B;  1NDD A;  2QMT A;  2KZR A;  1V1P B;  3A9K B;  3KUC B;  1NI2 A;  1K52 A;  1TS5 A;  5L83 A;  4HJK A;  4OVV A;  3NVV A;  4ARI A;  1ROE A;  5E6N A;  1AYF A;  2LWP A;  1XLP A;  1PUT A;  4ZRQ A;  1QOF A;  3VRA B;  2BB6 A;  3ZXV A;  3GZN I;  4DK5 A;  2PEA A;  1GG3 A;  1H8C A;  2HTH A;  4W9L A;  4J3O D;  1TKE A;  3Q2A C;  2ACZ B;  1GOZ A;  3NJT A;  3AXC A;  4HK2 A;  3MC9 A;  4FLH A;  2M56 B;  1AWD A;  1GB1 A;  2M0A A;  2LVO A;  1CQV A;  4G11 A;  4IW0 A;  1VR9 A;  2OJR A;  2LMC A;  3GP7 A;  3NVZ A;  3MFG A;  4G0N B;  2PTL A;  1BML C;  3ONS A;  2NPT A;  3QWZ B;  2D3C A;  3VFK A;  2WQY B;  1OQQ A;  2MA9 B;  3P4S B;  4Q2J A;  3BVG A;  2JXX A;  5IOI A;  4RMA A;  1TKG A;  4WWN A;  5G55 A;  4PS3 A;  1WM2 A;  1XLN A;  5E6P A;  5EE1 A;  1OTR B;  3P4R B;  3VDZ A;  2WXM A;  1UGM A;  1E8Z A;  2CJN A;  4GB9 A;  4PS8 A;  4YWG G;  4EZJ A;  1V49 A;  4K7W A;  2MBH A;  2GBR A;  1R4N B;  1KOT A;  4KIK A;  5H8Y E;  2RDH A;  3AE9 B;  3L10 B;  5GMV A;  2KQ4 X;  1R7S A;  1CMX B;  4ICU A;  2FNJ B;  2BKR B;  2KKC A;  2KC1 A;  1ZDV A;  4W9K A;  2JZ3 B;  1Q10 A;  5DPR A;  4EFO A;  2IO2 B;  1FNV A;  2WWZ A;  3AEB B;  5D3D A;  2WXR A;  4P1C C;  1MVK A;  1XCT L;  2PE6 B;  2N0S B;  2DAJ A;  3QCA A;  1UWX A;  3ALB A;  3EEC A;  1LM8 B;  2K0P A;  4MT5 A;  4ZRJ A;  3ZXR A;  3QX1 A;  3N3K B;  2JUO A;  2M19 A;  3NZS A;  2O6V D;  3TCA A;  1ZE3 D;  2BQQ A;  1FFU A;  3C19 A;  2KVR A;  1C79 A;  3VQI A;  2JZZ A;  5BYQ A;  4YSY B;  4LJO B;  2MBE A;  2BWE S;  2MW5 A;  3FAH A;  1LFD A;  2CKH B;  4LNF A;  3N9Y C;  2KLG A;  4BBN C;  4LJP B;  4KDL B;  4LNI A;  2KYW A;  2X8X X;  2LHD A;  2D10 A;  3OWE B;  1XD3 B;  1PQS A;  3OLM D;  2K1F A;  1UNS A;  3RNA C;  1TZO A;  3V62 A;  1VJK A;  4AJY B;  2ZZP B;  4KX6 B;  2VH2 A;  4DXG A;  3JSV A;  4WQM A;  2UWQ A;  1YN5 A;  1TKY A;  2BYT A;  4FJZ A;  4FUL A;  2Y5B B;  5D7G A;  2REX A;  5CHV C;  1F77 A;  2FID A;  1L0V B;  1P7F A;  1F52 A;  2J0J A;  2PW9 A;  2L76 A;  2WX0 A;  3EFC A;  1PDX A;  2WDT B;  5MPO A;  3CSF A;  3PV1 A;  2LGS A;  1RFA A;  3URY A;  2IO1 B;  5AZG A;  1WWT A;  3KH0 A;  2M0X A;  5TSS A;  1JWA D;  3V60 A;  5HG2 A;  1KH0 A;  3GZN B;  3ZJV A;  4USA A;  2ZVN A;  1Z5S B;  1E8W A;  4HDQ A;  2IDY A;  4B9K A;  2GMI C;  4RNA A;  1C78 A;  1BUI C;  1YN4 A;  1GUA B;  2K9X A;  4TQ1 A;  3PLU A;  4JQW C;  2KFK B;  3RNE C;  3KW5 B;  3NS8 A;  3EC8 A;  3SR6 A;  2VH1 A;  4GIV A;  4FJY A;  5AZH A;  1YD8 U;  1OQR A;  2KVZ A;  4W9D A;  2XEW A;  1AW7 A;  1E0Z A;  2DWQ A;  1SE4 A;  4LNK A;  1GAQ B;  2HE7 A;  3SU8 X;  2LGY A;  2EEL A;  5D94 A;  2Z59 B;  4TSS A;  2WU2 B;  3UIP B;  1TY2 A;  1EUV B;  1N5W A;  5AZF A;  2BVC A;  5LNK 1;  1V6E A;  4P6V F;  1P98 A;  4HEA 1;  3ZDM C;  3IT4 B;  3P4P B;  4YSZ B;  1HXY D;  3GB1 A;  3VUW A;  4ZHP A;  3X0W A;  2W54 A;  1UF0 A;  4NPN A;  4W9F A;  2J0M A;  1P9D U;  1Z2M A;  1ZP0 B;  2D3B A;  4KZC A;  1E6E B;  1WE7 A;  2KX3 A;  3T9L A;  4ACF A;  1NVI D;  2DYB A;  3N30 A;  3N32 A;  4RF0 A;  3RZW C;  4II3 B;  1E5W A;  5C2T B;  3ZGZ A;  3AE7 B;  4YTP B;  3CF6 E;  2GBM A;  4WWO A;  2KOX A;  4US9 A;  3U2S C;  2IO0 B;  1WXM A;  4J6I A;  4DHJ B;  4JWS C;  3B2G A;  1UGJ A;  4K3B A;  2RDB C;  2K5P A;  3AEC B;  2VZK B;  4QAY A;  1FXA A;  3Q69 A;  3HIZ A;  2C7N B;  4LDT D;  4PK1 A;  2IGG A;  3FIL A;  2J42 A;  3AED B;  1WXV A;  5I4D A;  3LJ3 A;  3P42 A;  1HZ5 A;  4XWW A;  2ONQ A;  3TJP A;  3O13 A;  2N7J A;  2M8S A;  4M00 A;  2LRW A;  1J7A A;  2PVG C;  1SIF A;  2NTT A;  1R4M I;  3NUH B;  3VVW B;  3R7Q A;  3MTN B;  3OJ4 B;  1WXQ A;  2DX5 B;  2J4X A;  2DEN B;  3UGB B;  2KDI A;  4S17 A;  5D3I B;  1QT9 A;  3AU4 A;  2PLP A;  4N9F 4;  1WGR A;  3Q8E A;  2K8B A;  5JXV A;  2DZI A;  1KLU D;  1GJZ A;  2JVC A;  5GXG B;  5HI1 A;  3VUX A;  2YLM A;  3KYD D;  3BII D;  3R8B A;  3Q8A A;  4LNN A;  3DHI C;  5TR5 A;  4FBJ B;  4BKS D;  1E90 A;  3APF A;  2N9K A;  4EZK A;  3LYY A;  4KZ0 A;  2DYO A;  1WGG A;  3B0A A;  2V3P A;  2JU6 X;  3AB5 A;  1I4G A;  2LXA A;  3DDC B;  3JW0 X;  3EGR A;  3GE3 C;  1YIW A;  4YXD B;  2RD0 A;  1K8R B;  2BTE A;  4IOI E;  1V80 A;  2V4L A;  3K9P B;  2L05 A;  3VH3 B;  3ZYY X;  4X57 B;  3IAS 1;  2EMT A;  2FAZ A;  2MSE D;  5G5G A;  1SEB D;  2VRR B;  1XF5 L;  2GBJ A;  4ZYS A;  3SEB A;  1WGY A;  3B9J A;  2N9L A;  3WA0 A;  2WXF A;  2BB5 A;  2LAS A;  3QK0 A;  4GGQ A;  3DWG C;  2KDE B;  2D3G A;  2I1K A;  3IXS A;  2FBW B;  4ANW A;  4RGM A;  4M0W B;  3A4S C;  4W9I A;  5DCN A;  4BVU C;  1R4N I;  2Y5C A;  3NOB A;  5IO9 A;  4K7S A;  1QOA A;  5AUI A;  4WJO A;  4MAC A;  3MC8 A;  4HLE A;  1FCC C;  3N20 C;  3ZUN A;  4XGA B;  1ISN A;  1D6E C;  1HA5 A;  4ZYN A;  2BKF A;  4L2Y A;  1YQ3 B;  5BO4 B;  4OVU A;  3VRB B;  2JXT A;  4NAM A;  2ZPN A;  4NQL B;  1SXT A;  2KO3 A;  3KLS X;  2XNA C;  4ANX A;  2V1Y A;  4K7U A;  1TS3 A;  3V3X A;  3ZJT A;  2QIE B;  5FKA C;  1JRP A;  2CHZ A;  4AJW A;  2IYD B;  2FE8 A;  2LEK A;  2W3S A;  1WJ6 A;  4LNO A;  4ANU A;  3DHH C;  1ZKH A;  1L0Y B;  4P7I A;  3JVZ X;  4A6Q A;  4HPM B;  4AS1 A;  1SBB B;  3DCG A;  1V5O A;  2NMQ A;  4WWP A;  3TSS A;  1OQY A;  3PGE A;  4REZ A;  3W1Y A;  3PHX B;  3RD2 A;  4YT0 B;  4DQO C;  1WX8 A;  5JHA A;  4MJS A;  1TZ1 A;  2BT6 A;  3U7D A;  1DOX A;  3R66 C;  3AE3 B;  3ENE A;  4DXF A;  2WXK A;  2L3Z A;  2MJ3 A;  1EWC A;  4A3P A;  2DBY A;  5HHD G;  4CO7 A;  1E10 A;  2L8J A;  2IJ0 A;  1ZDX A;  2L1A A;  4DBG A;  5FK9 C;  4MEM A;  5E6O A;  3APC A;  2N1W A;  1WGK A;  1UEL A;  1FCL A;  1IP9 A;  4MDK E;  2K22 A;  2WXJ A;  3L54 A;  4ZOH C;  1EF1 A;  5EE0 A;  3FKY A;  1V8C A;  2C9W B;  1JML A;  2AX5 A;  2BYE A;  3B08 A;  4JIO U;  2GLS A;  3VTV A;  2B76 B;  4FAD A;  2JYT A;  3PLV A;  5IN7 A;  2QDF A;  3PPA A;  3RMK C;  1FRR A;  3TEW A;  5J2R A;  3L08 A;  2ZCC A;  2NBU A;  4FN2 A;  1JWS D;  5HKH A;  4W9C A;  4OZC A;  2FCN A;  1FM0 D;  1HTO A;  2W9N A;  1F9J A;  3AE5 B;  3Q8B A;  1T5X D;  2UU7 A;  1MG4 A;  3PRM B;  1T6B X;  3ZLZ A;  1V1O A;  2KK8 A;  1UUP A;  1P1A A;  4N58 A;  1V97 A;  3M3J A;  3RNB C;  1EWY C;  2D11 A;  3V6E B;  2L0F A;  2UYZ B;  4A8X C;  3AE6 B;  2AL6 A;  2O6V A;  4LTU A;  4WH4 A;  2FCQ A;  3DQV A;  4JLC A;  4MGY E;  2PPH A;  1QIL A;  2K39 A;  2LVQ A;  3PZD A;  3DBS A;  1NI3 A;  3ZJU A;  4JPS A;  2MWS B;  3P1M A;  2RSU A;  1SSN A;  2ASQ A;  4JGH B;  1RAX A;  1J19 A;  1KTK A;  2SEB D;  2V4I B;  3A9J B;  1ZOY B;  2IGD A;  2JWZ A;  2HDE A;  3HM6 X;  3ZNG C;  4NQK E;  1TS4 A;  4DXA B;  2INC C;  3PVL A;  1E9M A;  3RNC C;  2N9X A;  2JZP A;  3BVM A;  2ZPY A;  1A70 A;  3ZQ4 A;  4NAW A;  1Q5W B;  3RPF C;  4HRS A;  3PRZ A;  1TTN A;  1V5T A;  2FCS A;  3A4R A;  3CMM B;  4GDL B;  2WXG A;  4M8M A;  4RGO S;  2N7D A;  4MH8 A;  1WJ4 A;  3DBL B;  1FMA D;  3IG3 A;  1VDV A;  3AE4 B;  4GLS C;  1N61 A;  2WDQ B;  2LD9 A;  1FRD A;  2V3N A;  4OW0 A;  2CHX A;  3BZD B;  2A5U A;  2J7Q B;  2KQ7 A;  3T3O A;  2CU3 A;  2BPS A;  2N7E A;  2JYE A;  4M02 A;  1P0R A;  3L0W B;  1RRB A;  2JRI B;  4TKN A;  1UBI A;  2BS3 B;  2I1J A;  1SJH D;  3IAM 1;  1I42 A;  1WYW B;  4JL9 A;  3UQB A;  3OAW A;  3M95 A;  3APD A;  2DNF A;  3QHT A;  4NJC A;  1WXS A;  3HUI A;  4AOF A;  1VLB A;  1SJE D;  4OZB A;  3FIL B;  2V0G A;  3KUZ A;  2ZVO A;  3IHP C;  3LXF A;  2KJ6 A;  3KWV A;  2IO3 B;  4PS7 A;  3W5V B;  5E6J A;  4I6P A;  1B1Z A;  1WE6 A;  1WZ0 A;  2O6V B;  4RGT A;  3ZNI D;  2O2V B;  1K50 A;  1I4Q A;  2WXQ A;  1WI0 A;  2NCN A;  4WAA A;  2KWD A;  2KN4 A;  4AQ7 A;  4CHK A;  4K1R B;  3FC4 A;  4NZL B;  3VUY A;  2PVO D;  1GNU A;  1IBX A;  1JW9 D;  1N62 A;  3PZ8 A;  2AWT A;  1DOI A;  4M0W A;  4MSQ B;  2INP E;  2LUM A;  3ZNZ B;  3IT6 B;  3JYU A;  2WS3 B;  2KFK A;  1FO4 A;  4ASW C;  3WIM A;  4WIP A;  4XDC A;  3LDZ E;  5D6J B;  5IAA C;  1KJT A;  5LXH A;  4JE3 B;  4CYE A;  2KMA A;  3TEY A;  1OFF A;  3DWM A;  1WF9 A;  2L32 A;  1UZX B;  4BKG A;  1GPX A;  3UI3 A;  3AE1 B;  1E8X A;  1OEY A;  5IKC M;  1ZXI A;  3MHS D;  4FA6 A;  2WXP A;  1C4P A;  3HM3 A;  3Q3F A;  2WLB A;  1ACC A;  2WNM A;  2DLB A;  2MEK A;  2LGD A;  3U30 A;  2QC8 A;  3JSV B;  4WJQ A;  4WJN A;  2PKO A;  1HQR D;  2MHJ A;  2MJE A;  2V9H A;  4LCD E;  1UD7 A;  1TBE A;  1LO5 D;  4F1S A;  3DBH B;  3A9K A;  2R61 A;  4N59 A;  4EE2 A;  2WDR B;  2WXO A;  1QOB A;  4RGN A;  5JHB A;  1VD2 A;  3WCQ A;  1VZ7 A;  4KVG B;  4WWM A;  2MRP A;  2CS4 A;  1TJE A;  2M17 A;  2SAK A;  4BKT A;  3KWL A;  4HPP A;  2Z0D B;  4EOY A;  3MHZ A;  4DHJ D;  1IUE A;  4KSL C;  1H4R A;  2FUH B;  3H7P A;  1PGX A;  3CWI A;  4ICV A;  1MG8 A;  3KQ4 A;  4EUT A;  2BYF A;  4BFR A;  2BWF A;  4P1B C;  1VZ8 A;  2C5L C;  1PGB A;  4DDG D;  3B2F A;  1RYJ A;  3J9C A;  3PTF C;  1A5R A;  2KDF B;  1YX6 B;  3I5J C;  2QEJ C;  3BVZ A;  2MQJ A;  3BK2 A;  4MM3 A;  3L13 A;  3DVG X;  1EM7 A;  5BYR A;  2I2Y A;  3W9C B;  1ET6 A;  3PZ7 A;  4XC2 A;  3VHT C;  1L6U A;  4GDK B;  4EEW A;  2WXN A;  2M4N A;  1C76 A;  5BMI A;  4W9E A;  5BMG A;  3HVD A;  2MCN B;  4TMA B;  4MSM B;  3Q8F A;  2RPQ A;  1UH6 A;  2D3A A;  1PFD A;  5LXI B;  2AQ2 B;  3QC8 B;  4ZRI A;  2KT7 A;  1T0S C;  4AUQ C;  1MJD A;  3NZ3 A;  2HJ8 A;  5H92 C;  1ESF A;  1D5M C;  2JPH A;  4PYU A;  2AEH A;  3V6C B;  3BIN A;  1F2R I;  3PO0 A;  2IZV B;  2KAJ A;  2RPV A;  3TL5 A;  4E71 A;  3PT2 B;  4IWO A;  4BKS A;  3OG5 A;  3AE8 B;  3VAW A;  1STE A;  1FIQ A;  2XK5 B;  1Y56 A;  2WDV B;  2W82 A;  4A90 A;  1N63 A;  1AN8 A;  2K6Q A;  1L7Y A;  3DBL I;  3RN9 C;  1V2Y A;  4KKJ A;  5CHF A;  2L52 A;  2K3U A;  1WY8 A;  3A9J A;  3PHW B;  1JWU D;  4FHJ A;  4PT5 A;  4XX5 A;  2QIL A;  1L6V A;  1MPE A;  4NY0 A;  2O2V A;  4M8N A;  4DHZ B;  2KD0 A;  1WR1 A;  2IY1 B;  1WX7 A;  4PYZ A;  1NBF C;  3MP9 A;  2XBB C;  5JH5 C;  3PSE B;  2LZ6 A;  4HDO A;  4E74 A;  4RM9 A;  1PGA A;  5C1Z A;  2M1M A;  4E3C A;  4MEL A;  1QF6 A;  2GRI A;  4IG7 B;  4FJV B;  4HCP B;  4YL8 A;  1HE8 A;  1V1P A;  1XXG A;  3RNF C;  4D2K A;  2GOW A;  5G2N A;  1WJN A;  3IBE A;  1FD6 A;  2Y3A A;  4YSX B;  2MBO A;  3QIJ A;  3RCZ A;  1YMH E;  1C77 A;  2CJO A;  1WGD A;  3AU5 A;  2QSD A;  4KIK B;  4S0R A;  1HZ6 A;  1YJI A;  1KM7 A;  3GE8 C;  1MHX A;  2PE9 A;  3HK0 A;  3R2T A;  1J7B A;  2VZK D;  1MHH E;  3IFW B;  4ZHO A;  2MLB A;  3V61 A;  1JWM D;  2OOB B;  1EU3 A;  3WAM A;  3AM9 A;  2QJL A;  5CX3 A;  1X1M A;  1OEY J;  2MBQ A;  2C7M B;  1V9J A;  4H2A A;  5EE9 A;  5DPT A;  3NRZ A;  2IY0 B;  4TUU A;  3WAP A;  4HPL B;  4RFB A;  3NY5 A;  4C4V A;  1RM6 C;  2LVP A;  4FXC A;  2CU1 A;  1FPY A;  1WYG A;  5HFY A;  2HTM E;  2GI9 A;  2DYM A;  1QKZ A;  1GC7 A;  2J53 A;  4MJS B;  1V86 A;  1EU4 A;  4O1N A;  3DVG Y;  2KTR B;  2KLC A;  5G5H A;  1T0Q C;  1WR6 E;  1C4C A;  3RT3 B;  4ANV A;  3MC0 B;  2NR2 A;  1YN3 A;  3N1X C;  2WHI A;  3UIN B;  2OJW A;  4NAW B;  1WXA A;  1KLG D;  4HJG E;  4A9A A;  2D07 B;  1NEN B;  2C7H A;  4EKU A;  2V3S A;  1TS2 A;  1TY0 A;  3R3M A;  4A55 A;  1WM3 A;  4ZRP A;  4MGZ E;  3A1Q A;  3BK1 A;  3R2I A;  3NVW A;  5BYS A;  3LB8 C;  1ZW7 A;  2NVU I;  1BT0 A;  1WGH A;  4C56 C;  3H9D A;  2HD5 B;  1NEK B;  4B95 A;  2BBC A;  4DWF A;  1FFV A;  1WH3 A;  1SE2 A;  3SD5 A;  2N9E B;  3U52 E;  3B1L X;  4C7Y A;  2MH7 A;  3ZKJ C;  1WRI A;  4G50 A;  1SGH A;  3HRD D;  3S2A A;  4OZA A;  5IP4 D;  3L16 A;  3VH4 B;  3D32 A;  3DBR I;  1L4Z B;  2JT4 B;  5JZE B;  2N9P C;  2LJ5 A;  3UQA A;  3H8H A;  3TEX A;  3DBH I; 
#chains in the Genus database with same CATH homology
 2JRH A;  2R2O A;  1QZE A;  3PS6 A;  3PRP B;  2RR9 A;  3KUZ A;  2ZVO A;  3HIZ A;  3ZDT A;  2C7N B;  3IHP C;  4LDT D;  2LGX A;  2KJ6 A;  4PS7 A;  2IO3 B;  2GBK A;  4I6P A;  3QAR A;  3CST A;  2J0K A;  4IM0 A;  1WE6 A;  1WZ0 A;  1WRD B;  2O6V B;  2A4Z A;  2NPT B;  3DVN U;  3VTW A;  2O2V B;  3ZNI D;  1EF5 A;  2ZNV B;  4W9H A;  1WXV A;  3R7R A;  2KNB A;  2CHW A;  3LJ3 A;  4IM3 A;  4NJ7 A;  2NBW B;  1WI0 A;  3A33 B;  2NCN A;  4WAA A;  3TJP A;  3TBL D;  2YVC A;  3M63 B;  2KDB A;  3VXW A;  4CHK A;  2M8S A;  1WZ3 A;  4K1R B;  2LRW A;  1LXD A;  2ZCB A;  3VUY A;  3PRE A;  1TGZ B;  1LQB A;  1SIF A;  1R4M I;  2L00 B;  1GNU A;  3H6N A;  3VVW B;  2KTR A;  2ZEQ A;  3AI5 A;  3R7Q A;  1YX5 B;  3SDL C;  2JF5 A;  2AWT A;  3MTN B;  3ECI A;  4IWQ A;  3OJ4 B;  2L7R A;  2DX5 B;  1ZGU B;  2ZJD A;  4MSQ B;  5C23 A;  3AUL A;  3ZNZ B;  2DEN B;  3UGB B;  1SE9 A;  2G4D B;  4GOC A;  3JYU A;  1IYF A;  2KFK A;  3WAO A;  2KQS A;  4ASW C;  3WIM A;  2JY6 A;  2LI5 A;  5DPW A;  2KDI A;  4II2 B;  1WFY A;  1UBQ A;  3LDZ E;  4GDK A;  5D6J B;  1VCB A;  5IAA C;  1KJT A;  3AU4 A;  3DOW A;  4WJP A;  5LXH A;  4CYE A;  1S1Q B;  3EHV A;  2KMA A;  4N9F 4;  1WGR A;  2KWU B;  1WMH B;  2K8B A;  3ZVV A;  4URK A;  2DZI A;  1GJZ A;  1G6J A;  1WF9 A;  2JVC A;  1UZX B;  4BKG A;  3VUX A;  4TQ0 A;  2YLM A;  3KYD D;  3RUL A;  2KJR A;  1E8X A;  1OEY A;  5L95 C;  3MHS D;  2KTF A;  4FA6 A;  2KFJ A;  3H7S A;  1Y8R C;  2MBB B;  3HM3 A;  4MGK E;  3Q3F A;  4G3X B;  5TR5 A;  4FBJ B;  3K9O B;  1NDD A;  4BKS D;  2ZNV C;  2KZR A;  3BY4 B;  1E90 A;  3APF A;  2AL3 A;  3A9K B;  2LGD A;  3U30 A;  4EZK A;  4KZ0 A;  3KUC B;  3JSV B;  4WJQ A;  4WJN A;  4ZRK A;  2DYO A;  1NI2 A;  1WJU A;  5JZE B;  1E7U A;  1WGG A;  3B0A A;  3H1U A;  5L83 A;  1M94 A;  4HJK A;  4OVV A;  3DDC B;  2LXA A;  3JW0 X;  4LCD E;  5E6N A;  1YIW A;  1UD7 A;  2FCM A;  2LWP A;  1TBE A;  2RD0 A;  1K8R B;  2RGF A;  4F1S A;  1V80 A;  3A9K A;  2V4L A;  5JHB A;  1I35 A;  3K9P B;  3GZN I;  4HCN B;  4DK5 A;  2PEA A;  2L05 A;  4AP4 C;  1GG3 A;  4DHZ E;  3VH3 B;  4X57 B;  1H8C A;  2EMT A;  2FAZ A;  1VD2 A;  1YQB A;  2MSE D;  3KVF B;  2VRR B;  3ZRC A;  2HTH A;  4KVG B;  2GBJ A;  4W9L A;  3KUD B;  2MP2 B;  1WGY A;  1KLV A;  3ZNH B;  2MRP A;  4HVB A;  2CS4 A;  3AXC A;  4HK2 A;  4FLH A;  3ML8 A;  2M17 A;  4BKT A;  3WA0 A;  2LVO A;  2Z0D B;  4WQO B;  2LAS A;  3QK0 A;  4EOY A;  4GGQ A;  4KDI C;  4G11 A;  4IW0 A;  4DHJ D;  2KDE B;  4KSL C;  1H4R A;  2D3G A;  2FUH B;  1XQQ A;  2OJR A;  3H7P A;  2N1V A;  3RZF A;  2I1K A;  3I3T B;  4ICV A;  1MG8 A;  4ANW A;  4M0W B;  4G0N B;  1J8C A;  4EUT A;  2BYF A;  3ONS A;  3A4S C;  4BFR A;  2NPT A;  4W9I A;  5DCN A;  2BWF A;  3QWZ B;  3VFK A;  2C5L C;  2MA9 B;  2WX1 A;  4BVU C;  4A20 A;  2K8C A;  2G45 B;  2JXX A;  1R4N I;  4GSW A;  4DDG D;  5JHA A;  4RMA A;  4I6N B;  4WWN A;  3NOB A;  3PTF C;  1A5R A;  5G55 A;  2KDF B;  2EKE C;  1WM2 A;  4PS3 A;  4K7S A;  1YX6 B;  5E6P A;  2KWC A;  1OTR B;  2MQJ A;  4WJO A;  3VDZ A;  4IC7 B;  1UGM A;  4MM3 A;  1E8Z A;  3L13 A;  4BBN F;  4HLE A;  3DVG X;  1D3Z A;  4GB9 A;  4PS8 A;  3ZTC A;  4HXD A;  3ZUN A;  4XC2 A;  3VHT C;  5FR6 A;  4EZJ A;  1ISN A;  4GDK B;  1V49 A;  4K7W A;  5AEK B;  2D2Q A;  5LLI A;  4ZYN A;  4EEW A;  2BKF A;  2M4N A;  2MBH A;  4W9E A;  2GBR A;  2MCN B;  1KOT A;  4KIK A;  3L10 B;  2KWV B;  5GMV A;  5BO4 B;  2R2Q A;  4OVU A;  1AAR A;  2WYQ A;  1CMX B;  4MSM B;  4ICU A;  2FNJ B;  2BKR B;  2RPQ A;  1UH6 A;  2KKC A;  2KC1 A;  1T0Y A;  2ZPN A;  3QJZ A;  4NQL B;  4W9K A;  2JZ3 B;  3W1S A;  2KO3 A;  5LXI B;  5DPR A;  1S3S G;  3QC8 B;  4ZRI A;  4ANX A;  4AUQ C;  4EFO A;  2IO2 B;  2WWZ A;  2V1Y A;  3ZRF A;  1V81 A;  4K7U A;  3SHQ A;  2HJ8 A;  2PE6 B;  2DAJ A;  3ZIM A;  3QCA A;  1Q1O A;  2JPH A;  4AWJ A;  2LXC A;  1U4A A;  4PYU A;  2AEH A;  2G4S A;  3V6C B;  3BIN A;  1J0G A;  3ALB A;  2IZV B;  4NJ6 A;  3EEC A;  3WAN A;  3TL5 A;  2CHZ A;  4AJW A;  2IYD B;  4E71 A;  3PT2 B;  1LM8 B;  4ZRJ A;  1WJ6 A;  3QQ8 B;  4ANU A;  4IWO A;  4BKS A;  1ZKH A;  3C0R B;  3N3K B;  3QX1 A;  3VAW A;  3EFU A;  4MGI E;  4P7I A;  3UIO B;  2G3Q B;  2JUO A;  3JVZ X;  3NZS A;  2XK5 B;  4DDI D;  2O6V D;  3TCA A;  4K81 A;  4GMV A;  4W9G A;  4HPM B;  3DBL I;  2K6Q A;  4IWP A;  1L7Y A;  3DCG A;  1V5O A;  4WWP A;  1V2Y A;  1OQY A;  5CHF A;  4F8C B;  2KVR A;  3PGE A;  3WAL A;  3VQI A;  2JZZ A;  4LJO B;  1WY8 A;  2MBE A;  3A9J A;  3PHW B;  4FHJ A;  4XX5 A;  3W1Y A;  3QAQ A;  3PHX B;  2KC2 A;  2MP2 A;  2BWE S;  2LUE A;  3RD2 A;  1YJ1 A;  5J17 A;  1RLF A;  3T8M A;  4NY0 A;  2MW5 A;  1LFD A;  2O2V A;  1WX8 A;  2CKH B;  4M8N A;  1E8Y A;  4MJS A;  4DHZ B;  1TZ1 A;  2KLG A;  2K6D B;  2KD0 A;  1WR1 A;  2IY1 B;  1WX7 A;  2DZM A;  2B3A A;  4PYZ A;  1E7V A;  4LJP B;  3RUI B;  3U7D A;  4BBN C;  4KDL B;  4EZL A;  1NBF C;  4I6L B;  4B6W A;  3R66 C;  2XBB C;  5JH5 C;  3PSE B;  3ENE A;  2LZ6 A;  3TIX A;  1JRU A;  4HDO A;  4W9J A;  4E74 A;  4RM9 A;  3UF8 A;  1EO6 A;  2L3Z A;  2D10 A;  1L2N A;  5C1Z A;  3KYC D;  2M1M A;  1XD3 B;  1PQS A;  3OLM D;  4NNJ B;  4A3P A;  4E3C A;  4MEL A;  4CO7 A;  2K1F A;  4IG7 B;  4FJV B;  3V62 A;  4HCP B;  4YL8 A;  2L8J A;  4AJY B;  2ZZP B;  3L17 A;  1HE8 A;  2NBV B;  4DBG A;  4MEM A;  5KHQ A;  3VTU A;  3JSV A;  4ZDV A;  2UWQ A;  2KMC A;  5E6O A;  2GOW A;  3APC A;  2N1W A;  4GDL A;  5G2N A;  1UEL A;  1WJN A;  3IBE A;  1IP9 A;  4FJZ A;  4MDK E;  2KAN A;  3L54 A;  1EF1 A;  2QHO A;  2MBO A;  4FUL A;  4BOZ B;  3ZTD A;  3QIJ A;  2C9W B;  2Y5B B;  3RCZ A;  2BYE A;  3B08 A;  4JIO U;  5D7G A;  2REX A;  3QA8 A;  5CHV C;  3VTV A;  3ZO5 B;  3M62 B;  2FID A;  3NHE B;  4FAD A;  1WGD A;  3AU5 A;  1XT9 B;  2J0J A;  4KIK B;  2DZJ A;  2L76 A;  2C60 A;  1GC6 A;  2WX0 A;  2EMS A;  3PLV A;  1IPG A;  1KM7 A;  2K8H A;  3PPA A;  2WDT B;  3NZU A;  2AYO B;  3CSF A;  2NS5 A;  3PV1 A;  5CHW A;  2PE9 A;  3HK0 A;  5EDS A;  1RFA A;  5J2R A;  3L08 A;  4LDT B;  2ZCC A;  2IO1 B;  2NBU A;  3IFW B;  4FN2 A;  2MLB A;  5AZG A;  5HKH A;  4W9C A;  1C3T A;  3V61 A;  3KH0 A;  2M0X A;  2OOB B;  2FCN A;  2W9N A;  3O65 B;  3WAM A;  1F9J A;  3V60 A;  3GOE A;  5CX3 A;  3ZW3 A;  1X1M A;  4RM8 A;  4GU2 A;  5J18 A;  1OEY J;  2Z0E B;  2MBQ A;  2C7M B;  3PRM B;  3ZLZ A;  2ZVN A;  1Z5S B;  2KK8 A;  1E8W A;  1V9J A;  4HDQ A;  1P1A A;  4B9K A;  2GMI C;  1OGW A;  3M3J A;  5DPT A;  2XK5 A;  2D11 A;  3V6E B;  2DHZ A;  2IY0 B;  2L0F A;  2UYZ B;  4KSK C;  4TUU A;  4BOS C;  2AL6 A;  3WAP A;  2CR5 A;  2O6V A;  4HPL B;  3NY5 A;  4A3O A;  1GUA B;  2FCQ A;  4TQ1 A;  2LVP A;  3PLU A;  3DQV A;  4JQW C;  2CU1 A;  4IUM B;  2KFK B;  1Q0W B;  4JLC A;  4KV2 A;  4MGY E;  3KW5 B;  2PPH A;  3EC8 A;  3NS8 A;  2KJH B;  2DYM A;  1P3Q U;  2K39 A;  2LVQ A;  3PZD A;  3DBS A;  4FJY A;  4GIV A;  1GC7 A;  3DPD A;  4MJS B;  3RYT A;  5AZH A;  2MWS B;  1YD8 U;  1V86 A;  2RSU A;  2PJH A;  3DVG Y;  3H7P B;  2KTR B;  2ASQ A;  2XEW A;  4HWI B;  4JGH B;  4W9D A;  2DZK A;  2KLC A;  2KN5 A;  1RAX A;  2HE7 A;  1J19 A;  3SU8 X;  2LGY A;  3A9J B;  5D94 A;  2Z59 B;  3MJW A;  2JWZ A;  1WR6 E;  2L0T A;  3HM6 X;  3RT3 B;  1FXT B;  4NQK E;  3ZNG C;  4ANV A;  4DXA B;  2NR2 A;  3UIP B;  5DPS A;  1EUV B;  3PVL A;  1C1Y B;  5AZF A;  2N9X A;  2ZPY A;  2MX2 A;  1V6E A;  4NAW A;  3IVF A;  1Q5W B;  1P98 A;  3P2B A;  3DVN V;  5D2M B;  4FHK A;  3UIN B;  3ZDM C;  2KX0 A;  3PRZ A;  1TTN A;  3U8Z A;  4NAW B;  1WIA A;  1WXA A;  3W1S C;  1V5T A;  2FCS A;  2D07 B;  2BYV E;  3A4R A;  3CMM B;  2C7H A;  4GDL B;  3ML9 A;  3VUW A;  3X0W A;  4EKU A;  2V3S A;  4M8M A;  2N4F A;  4NPN A;  2N7D A;  4W9F A;  3R3M A;  2J0M A;  1WJ4 A;  2DAF A;  1P9D U;  1WM3 A;  1Z2M A;  2KHW B;  2KXJ A;  4GN1 A;  4MGZ E;  3A1Q A;  4IM2 A;  4KZC A;  1WE7 A;  2KX3 A;  2LRU A;  3IG3 A;  2FIF A;  3T9L A;  1ZW7 A;  2NVU I;  1BT0 A;  1WMH A;  1WGH A;  2DYB A;  4F7Z A;  3N30 A;  2LD9 A;  3H9D A;  2HD5 B;  3N32 A;  2CHX A;  5CTR C;  4B95 A;  4DWF A;  2A5U A;  1WH3 A;  2J7Q B;  2KQ7 A;  3RZW C;  3HHM A;  4II3 B;  2BPS A;  3SD5 A;  4XZ4 A;  2N7E A;  3TMP B;  3Q3J A;  3X23 A;  1P0R A;  1E5W A;  5KHO A;  2N9E B;  3OJ3 A;  3L0W B;  4GXB A;  1RRB A;  2JRI B;  4TKN A;  3CF6 E;  5IA7 A;  3B1L X;  1UBI A;  4TV3 A;  2GBM A;  4G50 A;  3ZKJ C;  1SGH A;  2I1J A;  4WWO A;  2GBN A;  3S2A A;  2BGF A;  1I42 A;  1WYW B;  3L16 A;  2IBI B;  2K25 A;  2KOX A;  1WX9 A;  4JL9 A;  3VH4 B;  3D32 A;  3DBR I;  3UQB A;  3A1Q B;  4MH0 E;  2IO0 B;  1WXM A;  2JT4 B;  3APD A;  2N9P C;  2LJ5 A;  3M95 A;  3OAW A;  4J6I A;  4DHJ B;  3QHT A;  1WXS A;  3DBH I;  3UQA A;  2BF8 B;  4AOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...