3QHTA

Crystal structure of the monobody ysmb-1 bound to yeast sumo
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
KPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3
publication title Isoform-specific monobody inhibitors of small ubiquitin-related modifiers engineered using structure-guided library design.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags De novo protein
total genus 20
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3qhtA00
2J0JA 2DHZA 1E90A 2KC1A 4A3PA 4DHZE 3A4RA 4KVGB 1Z2MA 1AARA 2KFJA 2BYFA 3QK0A 4FHKA 4JGHB 1WRDB 4BFRA 4F8CB 2G3QB 4TQ1A 3TCAA 2KDEB 3PLUA 1WJNA 4MELA 4IWOA 3TMPB 2O6VB 3PREA 3TJPA 3ML8A 2LVOA 3A1QA 3IFWB 1BT0A 4GOCA 1E8XA 2DAFA 2OJRA 3T8MA 1D3ZA 1LQBA 4NNJB 2LUEA 4IM3A 4TUUA 1LFDA 3VTUA 3VUXA 2WX0A 3ZUNA 3UINB 2FCQA 1OTRB 4LDTB 1WM2A 2AEHA 2L8JA 3OJ3A 3VTVA 2O2VA 1WGYA 2KZRA 4NY0A 2KJRA 2MP2B 3RUIB 4FULA 5C1ZA 2JWZA 5G55A 5KHQA 3PRMB 3APCA 3MTNB 2G4DB 2FAZA 3K9OB 4GU2A 4FLHA 1V9JA 4GB9A 2JZZA 4MGYE 4PS8A 2MSED 1J8CA 2IYDB 2LI5A 3PRZA 3AU4A 4NJ6A 3IVFA 1GG3A 1KLVA 3D32A 4WJPA 1UGMA 2GBNA 5JH5C 2LZ6A 2LWPA 1WY8A 3ZNID 2DZMA 3PS6A 2DYBA 1SGHA 3CMMB 3B0AA 3QCAA 3PPAA 4BKSD 1UZXB 1KJTA 5DPRA 2WWZA 2AWTA 2KTFA 1WH3A 2KJ6A 4N9F4 2W9NA 3P2BA 2KN5A 4BVUC 1MG8A 1PQSA 3ZTCA 3QAQA 2DZJA 3JYUA 3EHVA 3L08A 3V60A 2L3ZA 4FHJA 3W1SC 2D2QA 3A1QB 2N9PC 2GBJA 3SD5A 2DZIA 4WAAA 3ZO5B 3V62A 3M63B 4ASWC 4CYEA 4LJPB 4DK5A 3ALBA 1F9JA 2KLCA 1SE9A 3S2AA 1WMHB 4MGZE 1XD3B 2M0XA 4I6LB 2JRIB 1V81A 3M3JA 3BINA 5CTRC 1WZ3A 5E6NA 2MWSB 2M4NA 1P0RA 3OJ4B 3DPDA 3EFUA 3TBLD 1WX7A 1H4RA 2PEAA 3DVGY 3SU8X 4TQ0A 2MCNB 5EDSA 4AUQC 3ZRCA 2N7DA 2M8SA 1L7YA 4ZRIA 2L76A 4TKNA 1WF9A 3JSVB 4F1SA 1GC7A 3UGBB 2I1JA 3APFA 3ENEA 1GC6A 4ICVA 4IM2A 2BGFA 4M0WB 1YX5B 2EKEC 4IW0A 2FCNA 4EOYA 4URKA 1E8ZA 3IG3A 1TTNA 1Z5SB 4WWPA 3PVLA 2Z0EB 4LCDE 4AP4C 2JZ3B 3DVGX 3VH3B 2K6DB 2MBHA 3H6NA 4W9KA 3PHWB 1C3TA 4YL8A 4W9IA 2N4FA 2RSUA 4KDLB 4ANWA 2BWES 3PHXB 2KC2A 3JVZX 1V5OA 4EZKA 2BKRB 1IPGA 3A4SC 3DBHI 1FXTB 2ZPYA 4RM9A 3H7PA 2G4SA 3IHPC 2RGFA 3OLMD 2CKHB 2C60A 3QC8B 4KZCA 4DBGA 3KUZA 2C9WB 1WIAA 1L2NA 1Q0WB 4HPLB 3SDLC 3ZIMA 3LDZE 2KVRA 1Q5WB 2KDBA 1EO6A 1V80A 1WGRA 2Z59B 4FJVB 3WANA 3V61A 4K7WA 2LRWA 2IY0B 4J6IA 4W9JA 3RZFA 3HM6X 4IM0A 3VFKA 4EUTA 5G2NA 4MJSB 4E3CA 1E8YA 2KANA 2KFKA 3PGEA 4KZ0A 4XX5A 1WGHA 1M94A 4MM3A 2HD5B 4XZ4A 4ZRKA 3VTWA 3ECIA 4E74A 4AOFA 1V6EA 1EF5A 1WE7A 4GMVA 1YIWA 3O65B 3L0WB 4WJOA 3A33B 2KWVB 1YD8U 4ANXA 2R2OA 1R4NI 4NQKE 2LVQA 3QIJA 4K7SA 3K9PB 2DAJA 2KKCA 3H1UA 2BKFA 5CX3A 3PSEB 4AWJA 1A5RA 3V6CB 1WGGA 2MBEA 3DDCB 5LLIA 1V2YA 4K81A 4EEWA 3UQBA 4GDLA 3M95A 1E8WA 2K39A 5J2RA 3QQ8B 1WX8A 2A4ZA 2IZVB 2CHZA 3WALA 2WX1A 1WXVA 2KQ7A 5GMVA 2I1KA 3H9DA 3KH0A 3R3MA 2KO3A 2AL3A 3RULA 2EMTA 1WJ4A 2C7MB 4HLEA 3BY4B 2XK5B 1WX9A 4PS7A 3ONSA 2KQSA 4GIVA 4GN1A 1UD7A 2N9EB 4P7IA 2V1YA 2LGYA 5IA7A 2LD9A 4M8MA 1WI0A 5D7GA 4GDKA 4FN2A 1NDDA 1RFAA 4NAWA 1Y8RC 1S1QB 4LJOB 3ZNZB 1RAXA 3EC8A 4G50A 4DWFA 2KWCA 5DPSA 3L17A 3KYDD 3L13A 2JUOA 4ICUA 4M8NA 5DPWA 1G6JA 2NPTA 2MX2A 4FBJB 4B9KA 2KX0A 2REXA 2D11A 2NCNA 2K6QA 4JIOU 3VAWA 2KFKB 5J18A 4HWIB 3NS8A 1K8RB 4FJYA 4PYUA 2NBVB 3SHQA 1P3QU 2WYQA 2R2QA 3ML9A 2AL6A 3AULA 2BYVE 2JF5A 3ZNHB 2KWUB 4CO7A 4XC2A 3MHSD 3HHMA 4GGQA 4K7UA 2O2VB 2PE9A 4PYZA 2M17A 3RZWC 5D2MB 2HTHA 3TIXA 3ZDTA 4GDLB 4RMAA 1LXDA 3VUYA 4OVVA 2J0KA 2OOBB 4KV2A 2NBUA 1V86A 2DYOA 3Q3JA 1NI2A 3A9KA 4NJ7A 3KW5B 5TR5A 1WGDA 2ZPNA 1X1MA 4FJZA 4WJNA 1WE6A 3VQIA 5CHVC 3DCGA 3RYTA 1NBFC 1GUAB 3RT3B 3ZDMC 4B95A 3U7DA 3KUDB 1VCBA 1WJ6A 4FADA 1UH6A 4AJYB 5JHBA 2ZZPB 2MBOA 3KVFB 3Q3FA 4DDGD 3L10B 4MEMA 2KHWB 3QARA 3UF8A 3UIPB 2KX3A 5CHWA 2KMAA 3QWZB 4WQOB 4CHKA 2N1WA 2PPHA 4ANVA 4ANUA 4MGIE 4TV3A 3ZLZA 4DHJD 4NAWB 3VVWB 3NZSA 2K8HA 2LXAA 3QA8A 5D6JB 4GSWA 2GOWA 3DVNV 2O6VA 4IWQA 4HVBA 2N7EA 5DPTA 5LXHA 3L16A 2FIDA 1T0YA 1WXMA 4W9GA 5E6OA 4EZJA 1P9DU 1WR1A 3A9JA 4G11A 4W9CA 3PT2B 2JPHA 1OGWA 3IBEA 3PRPB 3VHTC 3DOWA 2NBWB 2WDTB 1V49A 5D94A 5AZFA 3T9LA 2MP2A 4BBNC 3U8ZA 2CR5A 2MBQA 5LXIB 2MA9B 1HE8A 2IO1B 2IBIB 1WXAA 3VH4B 3U30A 3ZVVA 2CHWA 3TL5A 4HCNB 2FCMA 2IO2B 4IUMB 2CHXA 4RM8A 1KOTA 4DXAB 3DVNU 5FR6A 3CSTA 3HIZA 2IY1B 3NOBA 1EF1A 2K8CA 2LRUA 1U4AA 5DCNA 4F7ZA 3AXCA 2KD0A 4X57B 2KOXA 4HXDA 1CMXB 2C5LC 2DYMA 3WAMA 3DBRI 2ZEQA 2BF8B 2ZCCA 3QJZA 3RD2A 1IP9A 2D3GA 3N30A 2GMIC 3N32A 1ZGUB 3NZUA 3B08A 2KJHB 2KMCA 4W9FA 4A3OA 2A5UA 3X0WA 3WIMA 1UBQA 4KSLC 2V3SA 3RCZA 5C23A 3ZRFA 2V4LA 3AI5A 4BBNF 1GJZA 1WM3A 1J0GA 3I3TB 4HJKA 1KM7A 2K25A 1WR6E 1RLFA 3NY5A 4G0NB 3ZKJC 1C1YB 1IYFA 1OQYA 2XEWA 4ZYNA 5L83A 1WMHA 2D10A 3H7PB 3JW0X 3WAOA 2C7HA 3UQAA 1TZ1A 3HM3A 3A9JB 3LJ3A 2N1VA 4EZLA 2QHOA 3VXWA 2JXXA 2GBRA 4B6WA 5J17A 1ISNA 2Y5BB 3OAWA 3R7QA 1UBIA 4KIKA 2NVUI 2L0TA 3ZTDA 2PE6B 2BWFA 2VRRB 2ZJDA 4DHJB 1WXSA 4OVUA 2GBMA 2HJ8A 4MSMB 3W1SA 3H7SA 2KTRA 2MLBA 3JSVA 2HE7A 4MH0E 4DDID 2N9XA 2UYZB 1XT9B 2YLMA 4IWPA 5KHOA 2FCSA 5AZGA 1E5WA 2G45B 3PLVA 3VDZA 2MRPA 2KNBA 3KYCD 2AYOB 3APDA 3CSFA 3ZNGC 2KXJA 4HPMB 2KLGA 5L95C 2LASA 4NPNA 1OEYA 3GOEA 3QHTA 3KUCB 4BKTA 2J0MA 2RR9A 4BOZB 1WZ0A 1Q1OA 4W9EA 5E6PA 3C0RB 4HCPB 4W9HA 2ZNVC 3N3KB 2C7NB 3ZW3A 2GBKA 4I6PA 3X23A 3M62B 2YVCA 4W9DA 1VD2A 2D07B 2L7RA 4II2B 3DBSA 1ZW7A 1E7VA 2O6VD 3CF6E 3GZNI 2ASQA 1P98A 5CHFA 3HK0A 2RD0A 4GXBA 3V6EB 4DHZB 2LGDA 5BO4B 1TGZB 2CU1A 2ZNVB 3WA0A 1V5TA 1RRBA 4LDTD 4MDKE 1H8CA 1I42A 4KSKC 1J19A 4HDQA 1I35A 3UIOB 3PV1A 2EMSA 3QX1A 4I6NB 2MQJA 2J7QB 2DENB 2B3AA 4HK2A 4KIKB 5IAAC 1YJ1A 4BKSA 4BOSC 4FA6A 1JRUA 1WJUA 4PS3A 2XBBC 2LVPA 2UWQA 4GDKB 1GNUA 1TBEA 2K8BA 2KDIA 2KTRB 1S3SG 3MJWA 3PZDA 4JLCA 4MJSA 4E71A 5AEKB 5HKHA 2NPTB 1XQQA 1LM8B 2KDFB 3PTFC 2JRHA 1E7UA 3NHEB 4WJQA 4A20A 4JQWC 2LGXA 4EFOA 4II3B 4JL9A 2L0FA 2ZVOA 2JY6A 2RPQA 4WWNA 4MSQB 2JVCA 3WAPA 4HDOA 3DBLI 2BYEA 4K1RB 2CS4A 4MGKE 3AU5A 4NQLB 1ZKHA 3EECA 5JHAA 2MW5A 1P1AA 4KDIC 2JT4B 2BPSA 1SIFA 2Z0DB 2FIFA 4WWOA 1UELA 2LJ5A 2IO0B 3R7RA 1QZEA 2DZKA 2FUHB 2L00B 2M1MA 2NR2A 1YX6B 2ZVNA 3L54A 1WYWB 2IO3B 2DX5B 2FNJB 2PJHA 3A9KB 1YQBA 5AZHA 1EUVB 2L05A 3DQVA 4G3XB 4W9LA 2KK8A 4ZDVA 3VUWA 2NS5A 1OEYJ 1WFYA 1R4MI 4AJWA 2K1FA 2MBBB 2XK5A 4BKGA 4EKUA 3R66C 4IC7B 2LXCA 3B1LX 5JZEB 4ZRJA 2ZCBA 4IG7B 3W1YA
chains in the Genus database with same CATH superfamily
2KC1A 3B2GA 3KQ4A 1WRDB 4F8CB 1TS3A 3Q3OC 3TMPB 4YTNB 3TJPA 3U2SC 3IFWB 3RMKC 1LQBA 4NNJB 4IM3A 3VTUA 2WX0A 2FCQA 1OTRB 2VH2A 1FMAD 1WGYA 2KZRA 1N6ZA 4RGNA 5KHQA 1BUIC 3MTNB 2FAZA 3K9OB 4GU2A 4GB9A 4MGYE 3HUIA 4PS8A 1DOYA 2MSED 2LHEA 2IYDB 2LI5A 3E56A 1GG3A 1FXIA 4WJPA 4PT5A 2LWPA 4N59A 3ZNID 2MJ3A 3PS6A 3CMMB 3B0AA 3QCAA 1KJTA 2WWZA 1KRHA 2N7JA 1PQSA 1FNWA 2E3TA 3L08A 1L6UA 1QT9A 3A1QB 4IOIE 2DZIA 2JYEA 3ZO5B 3M63B 1L0XB 1VZ6A 1BXTA 3NRZA 1WMHB 1XLNA 1N61A 3NG0A 1VR9A 2M4NA 4WIPA 3OJ4B 4KGTA 3EFUA 3TBLD 5EDSA 2Q5WD 3AE2B 1WF9A 1DOXA 2VH1A 1MJDA 3PZ7A 3UGBB 4L1BA 2AQ3B 2WHIA 3APFA 2RDGA 2EKEC 1UNSA 4URKA 5EE9A 4S17A 2JZ3B 1BMLC 2MBHA 1T0SC 1F0ZA 4CQNA 4LNIA 1C3TA 2KC2A 2BKRB 2LUMA 3H7PA 1TYGB 2C60A 3RI7C 1T6BX 4DBGA 2D3BA 1D5ZC 1TS4A 1WSPA 3LDZE 1V80A 2QCZA 3IT4B 2M0AA 4EUTA 1EWYC 4E3CA 1YN4A 1WGHA 3ZXVA 4XZ4A 1IGDA 1SIJA 2WXJA 4WJOA 2R2OA 1R4NI 2KYWA 3K9PB 5CX3A 2G9HD 1A5RA 3ZGZA 2MBEA 4K81A 3UQBA 3TEXA 2HDEA 3BK2A 2GB1A 1B1ZA 3BWUD 5J2RA 2VZKD 3QQ8B 5HFYA 1HZ6A 3WALA 1PGBA 3O13A 3B2FA 3NVVA 3ONSA 4R3DA 2KQSA 1UD7A 2LGYA 2LD9A 5D7GA 3RFZB 1RFAA 1ZOYB 1Y8RC 1S1QB 1N62A 3BVZA 1RAXA 4LJOB 3BVMA 4M8NA 1FNVA 1KLUD 4FBJB 4B9KA 5J18A 3VAWA 4MM3B 2M56B 4PYUA 1MVKA 4XGAB 2WYQA 3ML9A 2R2QA 1MI0A 3AULA 3MHSD 1V97A 3HHMA 1LXDA 2OOBB 2AX5A 2Y5PA 2DYOA 3Q3JA 5IP4D 3KW5B 5TR5A 2JU6X 1FXAA 1WE6A 5C2TB 3DCGA 3RYTA 3RT3B 3KUDB 1VCBA 4NAMA 1QOGA 4M02A 4AJYB 2KWDA 2JXTA 2KX3A 1PGXA 3TEZA 4DHJD 4FXCA 4ANVA 3ZLZA 2K8HA 5D6JB 3RNCC 2E6XA 3Q8AA 4YSYB 1WXMA 1P9DU 4G11A 4TMAB 1HXYD 3DOWA 2NBWB 1LO5D 5D94A 1I7HA 1PGAA 3VH4B 3U30A 4HCNB 4IUMB 1C79A 3AEGB 4B0EA 2GLSA 3DVNU 2RDHA 1QKZA 5FK9C 2IGGA 2K8CA 3AXCA 5BMHA 2BYTA 3AE6B 3N20C 2WXRA 1A70A 3AE9B 2ZEQA 2ZCCA 2D3GA 3N30A 4US9A 3NZUA 3B08A 2KMCA 4JWUC 4W9FA 4A3OA 3N1YC 1RYJA 4KSLC 3ZRFA 2KT7A 4YT0B 1KM7A 3LYYA 2K25A 1WR6E 1RLFA 1C1YB 1WGKA 1ROEA 5L83A 1WMHA 1TZ1A 3A9JB 4B6WA 2Y5BB 1D5XC 1C4CA 2L0TA 2INDC 2MHJA 2BWFA 2KMMA 4AS1A 2MLBA 2HE7A 2N9XA 2UYZB 3PLVA 3VDZA 3P4QB 3AE7B 2BQQA 1I4PA 2KXJA 3MFGA 4NPNA 4UDUC 1ESFA 2WNMA 4W9EA 5E6PA 4A6QA 2PLPA 3PO0A 1UWXA 5EE3A 1UGJA 3DBHB 3X23A 3M62B 1QLBB 3MC8A 2D07B 5HHDG 4II2B 3DBSA 3CF6E 1FFVA 5CHFA 3HK0A 5D3DA 3LB8C 1XO3A 2BTEA 1TGZB 4MDKE 1H8CA 1JRPA 3HVZA 1PFDA 1TJEA 3PV1A 1SE4A 2MQJA 5IAAC 4BKSA 4FA6A 1JRUA 1E7PB 4GDKB 3NVYA 1GNUA 1WWTA 1S3SG 4JLCA 5AEKB 3SR6A 2M19A 3NHEB 1TZOA 3RNBC 4II3B 4JL9A 2L0FA 2ZVOA 1CZPA 2JY6A 3DBLI 2CS4A 3W5VB 1NEKB 3EECA 3FAHA 4REZA 2MW5A 2BPSA 4WWOA 1VRAB 1FCCC 3N1XC 3DWMA 2ZVNA 2FNJB 1D6EC 5BYQA 1TIFA 1WFYA 3AEFB 1ZDXA 2MBBB 4BKGA 3R8BA 2LXCA 3B1LX 3GB1A 3IAM1 1E90A 4K3BA 1L0VB 4OHJA 4DHZE 1I4RA 3P4PB 1Z2MA 1PDXA 3BYYB 3QK0A 3AE8B 4TQ1A 3TCAA 1JWBD 1WJNA 1F2RC 1XXGA 2WXHA 1V1PA 1BT0A 4GOCA 1D3ZA 2DAFA 2OJRA 4XWWA 2LUEA 1VLBA 1WM2A 2L8JA 3NJTA 1L0YB 3VRAB 4JWSC 2OEDA 2B76B 2MP2B 4FULA 4DXFA 2QJLA 2JZZA 1J8CA 1HTOA 2G1EA 2BS4B 3AU4A 3VRBB 3RNFC 2WDRB 1WY8A 2DZMA 2LFIA 4BKSD 1UZXB 1ZDVA 1WH3A 2KJ6A 4LLGM 2DZJA 1FM0D 1QOFA 3OG5A 2L3ZA 4FHJA 3W1SC 5D3IB 2N9PC 1JCKB 3SD5A 3EUB2 4WAAA 1SE9A 3S2AA 1C78A 3BINA 5CTRC 3IXSA 2MWSB 1OFFA 3AB5A 3DPDA 3SFEB 1R4MB 1WX7A 1H4RA 2PEAA 3DVGY 4IDIA 1XLPA 4AUQC 5LNK1 2M8SA 1L7YA 4TKNA 4F1SA 1DGJA 4IM2A 2BGFA 4M0WB 4IW0A 1QOAA 1T3QA 2BB5A 3NS1A 4LCDE 4AP4C 3H6NA 3BVGA 4ZYSA 3IT6B 4B0MA 3PHXB 1PYWD 2WQYB 1VZ8A 1DYQA 1UF0A 3AEEB 3DBHI 4KGSA 3OLMD 2CKHB 1IUEA 2QDFA 3KUZA 2C9WB 1L2NA 1XCTL 4XDCA 1Q0WB 3MP9A 4LNNA 2KDBA 2Z59B 1WGRA 3I57A 4FJVB 4MACA 3WANA 1YJIA 4J6IA 4XDDA 2IY0B 3RZFA 1E8YA 4CYEA 2QSDA 3VTWA 4E74A 1XLOA 3ZQ4A 2INNE 2QEJC 3O65B 3L0WB 2KWVB 1YD8U 4K7SA 3PSEB 4AWJA 3V6CB 1WGGA 4LTUA 5LLIA 2RDBC 1D4BA 4GDLA 5TSSA 1XEEA 2HTME 3DWGC 2WXKA 2K39A 2LJIA 2A4ZA 1WXVA 2KQ7A 2I1KA 3H9DA 1EU4A 3KH0A 1SJED 2KO3A 2MH7A 1WX9A 3NVZA 2IGDA 2BBCA 2V1YA 1J7CA 1FNUA 4C7YA 1WI0A 2L52A 4MT5A 1D5MC 4GDKA 1NDDA 4NAWA 3EC8A 2JUOA 4ICUA 2K6QA 2KFKB 1JW9D 1K8RB 1LGRA 2NBVB 4RF1A 3DHGC 3AM9A 1F1HA 1E0ZA 1T5XD 2KWUB 2GRIA 4OW0A 3N9YC 2M17A 2DWQA 4RGMA 5D2MB 2HTHA 2NTSA 4BAXA 5IOIA 3VUYA 1IGCA 3P4SB 1V86A 2PTLA 2BW2A 2K9XA 3VQIA 2BVCA 5CHVC 1NBFC 1WJ6A 3AEBB 5JXVA 2ZZPB 2LEKA 2MBOA 4MEMA 2KHWB 3QARA 3UIPB 1HEZE 1ET6A 5CHWA 2KMAA 3QWZB 4WQOB 5EE1A 2W82A 4MGIE 4ANUA 2GI9A 3NZSA 1GPXA 2LXAA 1GOZA 2JSVX 3Q8EA 4IWQA 3VR9B 1TKEA 5LXHA 3L16A 4EZJA 3KLSX 3Q69A 2H89B 3IBEA 1JALA 3PRPB 4WURA 2PVGC 2MP2A 3U8ZA 1GAQB 2MA9B 2WP9B 4RH6A 1TT5B 2L1AA 3VR8B 2CHWA 4NJCA 2FCMA 2CHXA 3PZ8A 1QQRA 4P16A 3HIZA 3NOBA 1U4AA 2KD0A 3C8YA 2KOXA 2LHDA 2MJEA 1CMXB 1JWMD 2GMIC 3N32A 3ZJUA 4N58A 2Y3AA 1UBQA 4HRSA 3Q14C 3AI5A 3NZ3A 4BBNF 1GJZA 3I63C 3I3TB 4HJKA 1OQYA 2D10A 3WAOA 3UQAA 3RNAC 2N1VA 2ZW0A 3VXWA 2JXXA 3R7QA 2NVUI 1FEHA 3MHZA 2VRRB 2PE6B 1Q10A 2V3PA 2ZJDA 1KTKA 2GBMA 3H7SA 4DDID 2MEKA 4IWPA 3DHHC 5KHOA 3KWLA 5AZGA 1E5WA 2MRPA 4C00A 2KNBA 2KLGA 4M0WA 3GOEA 1TS5A 2RR9A 1Q1OA 3C0RB 3TUOA 4M01A 3RN9C 2DLBA 3I5JC 4I6PA 3Q3MC 4USAA 3AN1A 2WXGA 4DHZB 2LGDA 1J7AA 3WA0A 1V5TA 4KSKC 5MPOA 1C9FA 4HDQA 1V8CA 1K53A 3UIOB 3QX1A 4I6NB 4KIKB 4PS3A 1YOVB 2KDIA 2KTRB 3MJWA 4ARIA 5HKHA 2NPTB 3PTFC 1LM8B 2KDFB 2WS3B 3DBRB 3HRDD 2IJ0A 1E7UA 4LNOA 4JQWC 4EFOA 4KX6B 4OZAA 2RPQA 3WAPA 4NQLB 4YSZB 1FPYA 4YXDB 2Z0DB 2LJ5A 1EWCA 2FBWB 2QMTA 3R7RA 2FUHB 5EE0A 1YX6B 2WXLA 2PJHA 2DX5B 3A9KB 4ZDVA 3VUWA 2JWUA 1C77A 4A9AA 2J52A 3AV8A 3R66C 3W1YA 2J0JA 3EA6A 4A3PA 3FILB 3A4RA 1AARA 2KFJA 2BYFA 2JYTA 4QAYA 4JGHB 4BFRA 2J42A 2KDEB 3PLUA 4MELA 4IWOA 4KGRA 2W54A 2O6VB 2J53A 3PREA 1TS2A 2L83A 2LVOA 3A1QA 3T8MA 4TUUA 1LFDA 3CWIA 1K50A 2KN4A 5BMGA 4LDTB 4WWMA 2KAJA 2AEHA 3OJ3A 3GZNB 4YTMB 5G5HA 4NY0A 2KJRA 3RUIB 3MC0B 2JWZA 2LMCA 1I4GA 3ZXRA 1KH0A 1B9RA 1GB1A 4KKJA 2N9KA 3PRZA 1KLVA 2GBNA 5JH5C 2LZ6A 2DYBA 1SGHA 3PPAA 2KTFA 2W9NA 2D3CA 4BVUC 1MG8A 4ZRPA 3ZTCA 3QAQA 3V60A 4WH4A 3V62A 4ASWC 4DK5A 2WXOA 4I6LB 2JRIB 3M3JA 1WZ3A 2JZPA 1P0RA 2WDVB 2FUG1 3SU8X 2KQ4X 3P1MA 2MCNB 1NENB 3ZRCA 2N7DA 1E6EB 3E9SA 1GC7A 2I1JA 2NMQA 2DNFA 4P1CC 3ENEA 1YX5B 3B9JA 2FCNA 1TTNA 4IKGA 4WWPA 2Z0EB 1AW7A 4W9KA 3PHWB 2PIAA 4YL8A 1FIQA 4W9IA 3BZDB 2N4FA 2RSUA 4O1NA 4KDLB 3Q2AC 3Q8BA 1V5OA 3AE3B 3J9CA 1FXTB 2ZPYA 2G4SA 3IHPC 2RMMA 1K51A 5BMIA 3QC8B 4KZCA 2WXQA 5GXGB 1ZXIA 1WIAA 3L4PA 3SDLC 3ZIMA 1EO6A 1YNTE 3V61A 4W9JA 1L5PA 4AQ7A 1EU3A 4C4VB 3PGEA 4KZ0A 4MM3A 2HD5B 2FE8A 1V6EA 1EF5A 3BYTB 4ZHPA 1YIWA 4ANXA 3H1UA 3DDCB 1V2YA 4EEWA 5E6JA 5FR3A 1GB4A 1DOIA 1MHHE 1AWDA 1QF6A 1YQ4B 2WX1A 3RNGC 3TEWA 5GMVA 1NVID 2SEBD 3R3MA 2AL3A 2EMTA 4HLEA 1CJEA 1STEA 3AEDB 3BY4B 2XK5B 4DXGA 4GIVA 4GN1A 4P7IA 2LGSA 2XN9C 4K3CA 4FN2A 5H8YE 4OVZA 3ZNZB 4DWFA 5DPSA 3L13A 5DPWA 1G6JA 2NPTA 2MX2A 4KKIA 3SFDB 2NCNA 4EE2A 3N1ZC 4HWIB 4RCOA 3FC4A 2YEPF 1ET9A 4RGOS 2KVZA 5I4DA 2K0PA 3RPFC 3SHQA 1P3QU 2AL6A 3U52E 1RM6C 2I2YA 5HG2A 1XCQL 1VJKA 4GGQA 4K7UA 2O2VB 4PYZA 3RZWC 3AE1B 3ZDTA 1HA5A 2W3SA 2J0KA 1TKYA 3A9KA 2WGSA 2ZPNA 1F2RI 1ZE3D 4FJZA 4WJNA 1E10A 3ZDMC 2V0GA 3U7DA 4FADA 2JQRB 1UH6A 5JHBA 3Q3FA 3UF8A 2RPVA 5C3JB 4CHKA 1N5XA 4GSWA 2GOWA 2ON8A 2O6VA 3RNEC 2N7EA 5DPTA 4RNAA 2FIDA 5E6OA 2WXMA 1WR1A 3A9JA 3PT2B 3AE5B 1ACCA 2JPHA 4YTPB 3VHTC 2WDTB 3ETRA 4BBNC 2KDMA 2CR5A 2KACA 3BK1A 5LXIB 1HE8A 2IO1B 2IBIB 1WXAA 1FRRA 3TL5A 2IO2B 1KOTA 1CK1A 2LRUA 1SF0A 4X57B 1VZ7A 2DYMA 3C19A 3WAMA 5FKAC 2BF8B 2D3AA 1IP9A 1XF5L 1ZGUB 1JWUD 3T3NA 1MFWA 2A5UA 1TKGA 4LK0M 3WIMA 3LXFA 2V3SA 5C23A 2V4LA 1MPEA 1J0GA 2H88B 4XE0A 2XEWA 4P6VF 1MHXA 3JW0X 3HM3A 5J17A 5IKCM 2SAKA 1TY0A 3OAWA 1V1OA 1I4HA 3ZTDA 1SBBB 2EELA 1WXSA 1SSNA 3W1SA 4MSMB 2HJ8A 4MH0E 2FCSA 2G45B 3Q6BA 1YN5A 3CSFA 3AH7A 5L95C 2LASA 3TEYA 2OHFA 1OEYA 1SE2A 2PW9A 3KUCB 1UWMA 3ZJTA 4BOZB 4HCPB 4W9HA 2ZNVC 3I9V1 3ZW3A 2N0SB 1RWSA 2GBKA 1FCLA 4W9DA 1VD2A 2L7RA 3W9CB 2O6VD 5T8IA 4RF0A 1P98A 1I4XA 2AQ2B 2RD0A 2INCC 4GXBA 2K3UA 2PKOA 4ACFA 2QC8A 5BYRA 2DBYA 2CJOA 1RRBA 4LDTD 2IPKD 1J19A 3WCQA 2EMSA 2Y5CA 1PUTA 4US8A 1WJUA 2LVPA 1TBEA 4C4VA 3T3OA 3AEAB 4BZAA 4C7ZA 1C4AA 4YSXB 4WJQA 2WXIA 4L23A 4JX1C 3FKYA 4WWNA 4A8XC 4MSQB 2K5PA 1YQ3B 2JVCA 2NTTA 4D2KA 2X38A 4MGKE 3AU5A 1ZKHA 4WAFA 5JHAA 1P1AA 4KDIC 2JT4B 2FIFA 1IBXB 4ZRQA 3KWVA 1QZEA 2IDYA 2NR2A 3L54A 1WYWB 5AZHA 1EUVB 2L05A 3DQVA 1ZP0B 1OEYJ 1R4MI 4TSSA 4AJWA 1N60A 2XK5A 4H2AA 4IC7B 5JZEB 2CU3A 4ZRJA 2ZCBA 4IG7B 2DHZA 4MH8A 2PVOD 2EKIA 4KVGB 1VDVA 4FHKA 4J3OD 3P42A 2G3QB 1JQ4A 2W3RA 1L6VA 2R61A 1KLGD 4A90A 3ML8A 1RFKA 2OJWA 1E8XA 1SJHD 5H92C 4NZLB 3VUXA 3ZUNA 3UINB 3VTVA 1CQVA 2BS3B 2O2VA 1F52A 5C1ZA 1KFYB 5G55A 3PRMB 3APCA 1SXTA 2X8XX 2G4DB 2L32A 1SEBD 1NI3A 1YN3A 4FLHA 1V9JA 1SB3C 4NJ6A 2QILA 3IVFA 3D32A 1UGMA 3GE8C 4HKZE 4ZOHC 5DPRA 2YEPB 2AWTA 4N9F4 3P2BA 2KN5A 1Y56A 3DHIC 3JYUA 3EHVA 3DBLB 3GP7A 2D2QA 1V1PB 2GBJA 1QILA 2J4XA 4LJPB 3ALBA 1F9JA 2KLCA 4MGZE 1XD3B 2M0XA 1V81A 5E6NA 1FD6A 1YMHE 4RFBA 1UUPA 3GS2A 3H8HA 2ACZB 4ITKA 1M4VA 2BS2B 4TQ0A 4ZRIA 2L76A 3JSVB 2V4IB 2UU7A 2WXFA 1HTQA 1GC6A 4ICVA 1NYRA 3EGRA 3R2TA 4EOYA 1E8ZA 3IG3A 1Z5SB 1C76A 1ZPSA 3PVLA 3DVGX 3VH3B 2K6DB 4OZBA 1ZXHA 5AUIA 4OZCA 3HVDA 4LNFA 4ANWA 2BWES 1SE3A 3JVZX 4EZKA 5HI1A 3AMZA 1IPGA 3A4SC 1JMLA 4RM9A 2RGFA 3P4RB 3U4EG 4HPLB 3UI3A 2KVRA 1NYQA 4LNKA 1Q5WB 3SEBA 4K7WA 2LRWA 3HM6X 4IM0A 3VFKA 3MJ5A 4MJSB 3V3XA 2KANA 2XNAC 2KFKA 1P7EA 4XX5A 4ZRKA 1M94A 3ECIA 4AOFA 1WE7A 1ZUD2 3P63A 4GMVA 4HKQA 2WU2B 5IN7A 3U7ZA 2BT6A 3A33B 3URYA 4NQKE 2LVQA 3QIJA 2WU5B 2DAJA 2KKCA 2BKFA 1N5WA 1F77A 2D5GA 3M95A 1E8WA 1E9MA 1WX8A 2IZVB 2CHZA 3EFCA 2PMVA 4P1BC 3RULA 1WJ4A 2C7MB 4PS7A 4HROA 2N9EB 1FRDA 5IA7A 4M8MA 2WXPA 4G50A 2KWCA 3L17A 3KYDD 2IGHA 4WQMA 2KX0A 2REXA 2D11A 4JIOU 2I38A 1FO4A 3NS8A 1KF6B 4FJYA 2BYVE 2JF5A 4N6EB 3ZNHB 4CO7A 4XC2A 2PE9A 1JWAD 1IBXA 3TIXA 1OQRA 4GDLB 4RMAA 3IAS1 5AUKA 4OVVA 4XWTA 4KV2A 3Q3NC 2NBUA 4NJ7A 1NI2A 2Z8LA 1WGDA 1X1MA 4HJGE 3V05A 4HPPA 1GUAB 4B95A 1AN8A 4C80A 3KVFB 1JROA 4DDGD 3L10B 3ZJVA 2N1WA 2PPHA 4TV3A 3TSSA 4NAWB 3VVWB 2AQ1B 3QA8A 5IO9A 2WDQB 3DVNV 4HVBA 2VZKB 1WRIA 1T0YA 4ARCA 4W9GA 3W2DA 3R2IA 4W9CA 1L4ZB 1OGWA 1V49A 5AZFA 3T9LA 1L4DB 3ABVB 2MBQA 4C56C 2INPE 4HEA1 3Q8CA 3ZVVA 4RM8A 2ICIA 4Q2JA 4JPSA 2ZW1A 4DXAB 5FR6A 3CSTA 2IY1B 1EF1A 5DCNA 4F7ZA 3GE3C 4HXDA 2C5LC 2ONQA 3DBRI 3QJZA 3RD2A 2KJHB 2QIEB 3X0WA 1N63A 2K22A 3RCZA 1WM3A 3MC9A 1P7FA 3NY5A 3ZKJC 4G0NB 1IYFA 1MG4A 3AECB 4ZYNA 3H7PB 2C7HA 3LJ3A 4EZLA 2QHOA 2GBRA 1C4PA 1ISNA 1UBIA 4KIKA 4DHJB 1K52A 1EM7A 4OVUA 2KTRA 3JSVA 1XT9B 2YLMA 2HJ1A 2TSSA 3KYCD 2AYOB 3APDA 3ZNGC 2JX5A 4HPMB 4ZHOA 2V3NA 3QHTA 4YWGG 4BKTA 2J0MA 3W5UB 2N9LA 1WZ0A 3NVWA 1OQQA 1R7SA 3N3KB 1HQRD 4XYCA 2C7NB 1T0QC 1QOBA 2YVCA 1J7BA 4M00A 4GLSC 1ENFA 1I4QA 1E7VA 1ZW7A 5G5GA 3GZNI 3ZYYX 2ASQA 1JWSD 3V6EB 1AYFA 3Q8FA 5BO4B 2CU1A 2ZNVB 4S0RA 3BIID 1I35A 3FILA 4HK2A 2J7QB 2DENB 2B3AA 2WLBA 1YJ1A 4BOSC 3CIRB 3NUHB 2XBBC 2UWQA 2V9HA 2K8BA 2WXNA 3PZDA 4E71A 4MJSA 2MJDA 3OWEB 1XQQA 5BYSA 1R4NB 2JRHA 4A20A 2LGXA 2CJNA 2LGIA 4JE3B 2BB6A 4HDOA 1WXQA 2BYEA 4K1RB 2W55A 1HZ5A 1SIFA 1WYGA 1UELA 2IO0B 4L2YA 2DZKA 1TY2A 2L00B 2M1MA 5G2NA 2IO3B 1T0RC 1YQBA 3AE4B 4W9LA 1FFUA 4G3XB 2KK8A 2NS5A 4RGTA 1XLQA 1YJJA 2K1FA 4A55A 4EKUA 4DQOC 4PK1A 1I42A
chains in the Genus database with same CATH topology
2J0JA 2DHZA 1E90A 2KC1A 4A3PA 4DHZE 3A4RA 4KVGB 1Z2MA 1AARA 2KFJA 2BYFA 3QK0A 4FHKA 4JGHB 1WRDB 4BFRA 4F8CB 2G3QB 4TQ1A 3TCAA 2KDEB 3PLUA 1WJNA 4MELA 4IWOA 3TMPB 2O6VB 3PREA 3TJPA 3ML8A 2LVOA 3A1QA 3IFWB 1BT0A 4GOCA 1E8XA 2DAFA 2OJRA 3T8MA 1D3ZA 1LQBA 4NNJB 2LUEA 4IM3A 4TUUA 1LFDA 3VTUA 3VUXA 2WX0A 3ZUNA 3UINB 2FCQA 1OTRB 4LDTB 1WM2A 2AEHA 2L8JA 3OJ3A 3VTVA 2O2VA 1WGYA 2KZRA 4NY0A 2KJRA 2MP2B 3RUIB 4FULA 5C1ZA 2JWZA 5G55A 5KHQA 3PRMB 3APCA 3MTNB 2G4DB 2FAZA 3K9OB 4GU2A 4FLHA 1V9JA 4GB9A 2JZZA 4MGYE 4PS8A 2MSED 1J8CA 2IYDB 2LI5A 3PRZA 3AU4A 4NJ6A 3IVFA 1GG3A 1KLVA 3D32A 4WJPA 1UGMA 2GBNA 5JH5C 2LZ6A 2LWPA 1WY8A 3ZNID 2DZMA 3PS6A 2DYBA 1SGHA 3CMMB 3B0AA 3QCAA 3PPAA 4BKSD 1UZXB 1KJTA 5DPRA 2WWZA 2AWTA 2KTFA 1WH3A 2KJ6A 4N9F4 2W9NA 3P2BA 2KN5A 4BVUC 1MG8A 1PQSA 3ZTCA 3QAQA 2DZJA 3JYUA 3EHVA 3L08A 3V60A 2L3ZA 4FHJA 3W1SC 2D2QA 3A1QB 2N9PC 2GBJA 3SD5A 2DZIA 4WAAA 3ZO5B 3V62A 3M63B 4ASWC 4CYEA 4LJPB 4DK5A 3ALBA 1F9JA 2KLCA 1SE9A 3S2AA 1WMHB 4MGZE 1XD3B 2M0XA 4I6LB 2JRIB 1V81A 3M3JA 3BINA 5CTRC 1WZ3A 5E6NA 2MWSB 2M4NA 1P0RA 3OJ4B 3DPDA 3EFUA 3TBLD 1WX7A 1H4RA 2PEAA 3DVGY 3SU8X 4TQ0A 2MCNB 5EDSA 4AUQC 3ZRCA 2N7DA 2M8SA 1L7YA 4ZRIA 2L76A 4TKNA 1WF9A 3JSVB 4F1SA 1GC7A 3UGBB 2I1JA 3APFA 3ENEA 1GC6A 4ICVA 4IM2A 2BGFA 4M0WB 1YX5B 2EKEC 4IW0A 2FCNA 4EOYA 4URKA 1E8ZA 3IG3A 1TTNA 1Z5SB 4WWPA 3PVLA 2Z0EB 4LCDE 4AP4C 2JZ3B 3DVGX 3VH3B 2K6DB 2MBHA 3H6NA 4W9KA 3PHWB 1C3TA 4YL8A 4W9IA 2N4FA 2RSUA 4KDLB 4ANWA 2BWES 3PHXB 2KC2A 3JVZX 1V5OA 4EZKA 2BKRB 1IPGA 3A4SC 3DBHI 1FXTB 2ZPYA 4RM9A 3H7PA 2G4SA 3IHPC 2RGFA 3OLMD 2CKHB 2C60A 3QC8B 4KZCA 4DBGA 3KUZA 2C9WB 1WIAA 1L2NA 1Q0WB 4HPLB 3SDLC 3ZIMA 3LDZE 2KVRA 1Q5WB 2KDBA 1EO6A 1V80A 1WGRA 2Z59B 4FJVB 3WANA 3V61A 4K7WA 2LRWA 2IY0B 4J6IA 4W9JA 3RZFA 3HM6X 4IM0A 3VFKA 4EUTA 5G2NA 4MJSB 4E3CA 1E8YA 2KANA 2KFKA 3PGEA 4KZ0A 4XX5A 1WGHA 1M94A 4MM3A 2HD5B 4XZ4A 4ZRKA 3VTWA 3ECIA 4E74A 4AOFA 1V6EA 1EF5A 1WE7A 4GMVA 1YIWA 3O65B 3L0WB 4WJOA 3A33B 2KWVB 1YD8U 4ANXA 2R2OA 1R4NI 4NQKE 2LVQA 3QIJA 4K7SA 3K9PB 2DAJA 2KKCA 3H1UA 2BKFA 5CX3A 3PSEB 4AWJA 1A5RA 3V6CB 1WGGA 2MBEA 3DDCB 5LLIA 1V2YA 4K81A 4EEWA 3UQBA 4GDLA 3M95A 1E8WA 2K39A 5J2RA 3QQ8B 1WX8A 2A4ZA 2IZVB 2CHZA 3WALA 2WX1A 1WXVA 2KQ7A 5GMVA 2I1KA 3H9DA 3KH0A 3R3MA 2KO3A 2AL3A 3RULA 2EMTA 1WJ4A 2C7MB 4HLEA 3BY4B 2XK5B 1WX9A 4PS7A 3ONSA 2KQSA 4GIVA 4GN1A 1UD7A 2N9EB 4P7IA 2V1YA 2LGYA 5IA7A 2LD9A 4M8MA 1WI0A 5D7GA 4GDKA 4FN2A 1NDDA 1RFAA 4NAWA 1Y8RC 1S1QB 4LJOB 3ZNZB 1RAXA 3EC8A 4G50A 4DWFA 2KWCA 5DPSA 3L17A 3KYDD 3L13A 2JUOA 4ICUA 4M8NA 5DPWA 1G6JA 2NPTA 2MX2A 4FBJB 4B9KA 2KX0A 2REXA 2D11A 2NCNA 2K6QA 4JIOU 3VAWA 2KFKB 5J18A 4HWIB 3NS8A 1K8RB 4FJYA 4PYUA 2NBVB 3SHQA 1P3QU 2WYQA 2R2QA 3ML9A 2AL6A 3AULA 2BYVE 2JF5A 3ZNHB 2KWUB 4CO7A 4XC2A 3MHSD 3HHMA 4GGQA 4K7UA 2O2VB 2PE9A 4PYZA 2M17A 3RZWC 5D2MB 2HTHA 3TIXA 3ZDTA 4GDLB 4RMAA 1LXDA 3VUYA 4OVVA 2J0KA 2OOBB 4KV2A 2NBUA 1V86A 2DYOA 3Q3JA 1NI2A 3A9KA 4NJ7A 3KW5B 5TR5A 1WGDA 2ZPNA 1X1MA 4FJZA 4WJNA 1WE6A 3VQIA 5CHVC 3DCGA 3RYTA 1NBFC 1GUAB 3RT3B 3ZDMC 4B95A 3U7DA 3KUDB 1VCBA 1WJ6A 4FADA 1UH6A 4AJYB 5JHBA 2ZZPB 2MBOA 3KVFB 3Q3FA 4DDGD 3L10B 4MEMA 2KHWB 3QARA 3UF8A 3UIPB 2KX3A 5CHWA 2KMAA 3QWZB 4WQOB 4CHKA 2N1WA 2PPHA 4ANVA 4ANUA 4MGIE 4TV3A 3ZLZA 4DHJD 4NAWB 3VVWB 3NZSA 2K8HA 2LXAA 3QA8A 5D6JB 4GSWA 2GOWA 3DVNV 2O6VA 4IWQA 4HVBA 2N7EA 5DPTA 5LXHA 3L16A 2FIDA 1T0YA 1WXMA 4W9GA 5E6OA 4EZJA 1P9DU 1WR1A 3A9JA 4G11A 4W9CA 3PT2B 2JPHA 1OGWA 3IBEA 3PRPB 3VHTC 3DOWA 2NBWB 2WDTB 1V49A 5D94A 5AZFA 3T9LA 2MP2A 4BBNC 3U8ZA 2CR5A 2MBQA 5LXIB 2MA9B 1HE8A 2IO1B 2IBIB 1WXAA 3VH4B 3U30A 3ZVVA 2CHWA 3TL5A 4HCNB 2FCMA 2IO2B 4IUMB 2CHXA 4RM8A 1KOTA 4DXAB 3DVNU 5FR6A 3CSTA 3HIZA 2IY1B 3NOBA 1EF1A 2K8CA 2LRUA 1U4AA 5DCNA 4F7ZA 3AXCA 2KD0A 4X57B 2KOXA 4HXDA 1CMXB 2C5LC 2DYMA 3WAMA 3DBRI 2ZEQA 2BF8B 2ZCCA 3QJZA 3RD2A 1IP9A 2D3GA 3N30A 2GMIC 3N32A 1ZGUB 3NZUA 3B08A 2KJHB 2KMCA 4W9FA 4A3OA 2A5UA 3X0WA 3WIMA 1UBQA 4KSLC 2V3SA 3RCZA 5C23A 3ZRFA 2V4LA 3AI5A 4BBNF 1GJZA 1WM3A 1J0GA 3I3TB 4HJKA 1KM7A 2K25A 1WR6E 1RLFA 3NY5A 4G0NB 3ZKJC 1C1YB 1IYFA 1OQYA 2XEWA 4ZYNA 5L83A 1WMHA 2D10A 3H7PB 3JW0X 3WAOA 2C7HA 3UQAA 1TZ1A 3HM3A 3A9JB 3LJ3A 2N1VA 4EZLA 2QHOA 3VXWA 2JXXA 2GBRA 4B6WA 5J17A 1ISNA 2Y5BB 3OAWA 3R7QA 1UBIA 4KIKA 2NVUI 2L0TA 3ZTDA 2PE6B 2BWFA 2VRRB 2ZJDA 4DHJB 1WXSA 4OVUA 2GBMA 2HJ8A 4MSMB 3W1SA 3H7SA 2KTRA 2MLBA 3JSVA 2HE7A 4MH0E 4DDID 2N9XA 2UYZB 1XT9B 2YLMA 4IWPA 5KHOA 2FCSA 5AZGA 1E5WA 2G45B 3PLVA 3VDZA 2MRPA 2KNBA 3KYCD 2AYOB 3APDA 3CSFA 3ZNGC 2KXJA 4HPMB 2KLGA 5L95C 2LASA 4NPNA 1OEYA 3GOEA 3QHTA 3KUCB 4BKTA 2J0MA 2RR9A 4BOZB 1WZ0A 1Q1OA 4W9EA 5E6PA 3C0RB 4HCPB 4W9HA 2ZNVC 3N3KB 2C7NB 3ZW3A 2GBKA 4I6PA 3X23A 3M62B 2YVCA 4W9DA 1VD2A 2D07B 2L7RA 4II2B 3DBSA 1ZW7A 1E7VA 2O6VD 3CF6E 3GZNI 2ASQA 1P98A 5CHFA 3HK0A 2RD0A 4GXBA 3V6EB 4DHZB 2LGDA 5BO4B 1TGZB 2CU1A 2ZNVB 3WA0A 1V5TA 1RRBA 4LDTD 4MDKE 1H8CA 1I42A 4KSKC 1J19A 4HDQA 1I35A 3UIOB 3PV1A 2EMSA 3QX1A 4I6NB 2MQJA 2J7QB 2DENB 2B3AA 4HK2A 4KIKB 5IAAC 1YJ1A 4BKSA 4BOSC 4FA6A 1JRUA 1WJUA 4PS3A 2XBBC 2LVPA 2UWQA 4GDKB 1GNUA 1TBEA 2K8BA 2KDIA 2KTRB 1S3SG 3MJWA 3PZDA 4JLCA 4MJSA 4E71A 5AEKB 5HKHA 2NPTB 1XQQA 1LM8B 2KDFB 3PTFC 2JRHA 1E7UA 3NHEB 4WJQA 4A20A 4JQWC 2LGXA 4EFOA 4II3B 4JL9A 2L0FA 2ZVOA 2JY6A 2RPQA 4WWNA 4MSQB 2JVCA 3WAPA 4HDOA 3DBLI 2BYEA 4K1RB 2CS4A 4MGKE 3AU5A 4NQLB 1ZKHA 3EECA 5JHAA 2MW5A 1P1AA 4KDIC 2JT4B 2BPSA 1SIFA 2Z0DB 2FIFA 4WWOA 1UELA 2LJ5A 2IO0B 3R7RA 1QZEA 2DZKA 2FUHB 2L00B 2M1MA 2NR2A 1YX6B 2ZVNA 3L54A 1WYWB 2IO3B 2DX5B 2FNJB 2PJHA 3A9KB 1YQBA 5AZHA 1EUVB 2L05A 3DQVA 4G3XB 4W9LA 2KK8A 4ZDVA 3VUWA 2NS5A 1OEYJ 1WFYA 1R4MI 4AJWA 2K1FA 2MBBB 2XK5A 4BKGA 4EKUA 3R66C 4IC7B 2LXCA 3B1LX 5JZEB 4ZRJA 2ZCBA 4IG7B 3W1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0J A;  2DHZ A;  1E90 A;  2KC1 A;  4A3P A;  4DHZ E;  3A4R A;  4KVG B;  1Z2M A;  1AAR A;  2KFJ A;  2BYF A;  3QK0 A;  4FHK A;  4JGH B;  1WRD B;  4BFR A;  4F8C B;  2G3Q B;  4TQ1 A;  3TCA A;  2KDE B;  3PLU A;  1WJN A;  4MEL A;  4IWO A;  3TMP B;  2O6V B;  3PRE A;  3TJP A;  3ML8 A;  2LVO A;  3A1Q A;  3IFW B;  1BT0 A;  4GOC A;  1E8X A;  2DAF A;  2OJR A;  3T8M A;  1D3Z A;  1LQB A;  4NNJ B;  2LUE A;  4IM3 A;  4TUU A;  1LFD A;  3VTU A;  3VUX A;  2WX0 A;  3ZUN A;  3UIN B;  2FCQ A;  1OTR B;  4LDT B;  1WM2 A;  2AEH A;  2L8J A;  3OJ3 A;  3VTV A;  2O2V A;  1WGY A;  2KZR A;  4NY0 A;  2KJR A;  2MP2 B;  3RUI B;  4FUL A;  5C1Z A;  2JWZ A;  5G55 A;  5KHQ A;  3PRM B;  3APC A;  3MTN B;  2G4D B;  2FAZ A;  3K9O B;  4GU2 A;  4FLH A;  1V9J A;  4GB9 A;  2JZZ A;  4MGY E;  4PS8 A;  2MSE D;  1J8C A;  2IYD B;  2LI5 A;  3PRZ A;  3AU4 A;  4NJ6 A;  3IVF A;  1GG3 A;  1KLV A;  3D32 A;  4WJP A;  1UGM A;  2GBN A;  5JH5 C;  2LZ6 A;  2LWP A;  1WY8 A;  3ZNI D;  2DZM A;  3PS6 A;  2DYB A;  1SGH A;  3CMM B;  3B0A A;  3QCA A;  3PPA A;  4BKS D;  1UZX B;  1KJT A;  5DPR A;  2WWZ A;  2AWT A;  2KTF A;  1WH3 A;  2KJ6 A;  4N9F 4;  2W9N A;  3P2B A;  2KN5 A;  4BVU C;  1MG8 A;  1PQS A;  3ZTC A;  3QAQ A;  2DZJ A;  3JYU A;  3EHV A;  3L08 A;  3V60 A;  2L3Z A;  4FHJ A;  3W1S C;  2D2Q A;  3A1Q B;  2N9P C;  2GBJ A;  3SD5 A;  2DZI A;  4WAA A;  3ZO5 B;  3V62 A;  3M63 B;  4ASW C;  4CYE A;  4LJP B;  4DK5 A;  3ALB A;  1F9J A;  2KLC A;  1SE9 A;  3S2A A;  1WMH B;  4MGZ E;  1XD3 B;  2M0X A;  4I6L B;  2JRI B;  1V81 A;  3M3J A;  3BIN A;  5CTR C;  1WZ3 A;  5E6N A;  2MWS B;  2M4N A;  1P0R A;  3OJ4 B;  3DPD A;  3EFU A;  3TBL D;  1WX7 A;  1H4R A;  2PEA A;  3DVG Y;  3SU8 X;  4TQ0 A;  2MCN B;  5EDS A;  4AUQ C;  3ZRC A;  2N7D A;  2M8S A;  1L7Y A;  4ZRI A;  2L76 A;  4TKN A;  1WF9 A;  3JSV B;  4F1S A;  1GC7 A;  3UGB B;  2I1J A;  3APF A;  3ENE A;  1GC6 A;  4ICV A;  4IM2 A;  2BGF A;  4M0W B;  1YX5 B;  2EKE C;  4IW0 A;  2FCN A;  4EOY A;  4URK A;  1E8Z A;  3IG3 A;  1TTN A;  1Z5S B;  4WWP A;  3PVL A;  2Z0E B;  4LCD E;  4AP4 C;  2JZ3 B;  3DVG X;  3VH3 B;  2K6D B;  2MBH A;  3H6N A;  4W9K A;  3PHW B;  1C3T A;  4YL8 A;  4W9I A;  2N4F A;  2RSU A;  4KDL B;  4ANW A;  2BWE S;  3PHX B;  2KC2 A;  3JVZ X;  1V5O A;  4EZK A;  2BKR B;  1IPG A;  3A4S C;  3DBH I;  1FXT B;  2ZPY A;  4RM9 A;  3H7P A;  2G4S A;  3IHP C;  2RGF A;  3OLM D;  2CKH B;  2C60 A;  3QC8 B;  4KZC A;  4DBG A;  3KUZ A;  2C9W B;  1WIA A;  1L2N A;  1Q0W B;  4HPL B;  3SDL C;  3ZIM A;  3LDZ E;  2KVR A;  1Q5W B;  2KDB A;  1EO6 A;  1V80 A;  1WGR A;  2Z59 B;  4FJV B;  3WAN A;  3V61 A;  4K7W A;  2LRW A;  2IY0 B;  4J6I A;  4W9J A;  3RZF A;  3HM6 X;  4IM0 A;  3VFK A;  4EUT A;  5G2N A;  4MJS B;  4E3C A;  1E8Y A;  2KAN A;  2KFK A;  3PGE A;  4KZ0 A;  4XX5 A;  1WGH A;  1M94 A;  4MM3 A;  2HD5 B;  4XZ4 A;  4ZRK A;  3VTW A;  3ECI A;  4E74 A;  4AOF A;  1V6E A;  1EF5 A;  1WE7 A;  4GMV A;  1YIW A;  3O65 B;  3L0W B;  4WJO A;  3A33 B;  2KWV B;  1YD8 U;  4ANX A;  2R2O A;  1R4N I;  4NQK E;  2LVQ A;  3QIJ A;  4K7S A;  3K9P B;  2DAJ A;  2KKC A;  3H1U A;  2BKF A;  5CX3 A;  3PSE B;  4AWJ A;  1A5R A;  3V6C B;  1WGG A;  2MBE A;  3DDC B;  5LLI A;  1V2Y A;  4K81 A;  4EEW A;  3UQB A;  4GDL A;  3M95 A;  1E8W A;  2K39 A;  5J2R A;  3QQ8 B;  1WX8 A;  2A4Z A;  2IZV B;  2CHZ A;  3WAL A;  2WX1 A;  1WXV A;  2KQ7 A;  5GMV A;  2I1K A;  3H9D A;  3KH0 A;  3R3M A;  2KO3 A;  2AL3 A;  3RUL A;  2EMT A;  1WJ4 A;  2C7M B;  4HLE A;  3BY4 B;  2XK5 B;  1WX9 A;  4PS7 A;  3ONS A;  2KQS A;  4GIV A;  4GN1 A;  1UD7 A;  2N9E B;  4P7I A;  2V1Y A;  2LGY A;  5IA7 A;  2LD9 A;  4M8M A;  1WI0 A;  5D7G A;  4GDK A;  4FN2 A;  1NDD A;  1RFA A;  4NAW A;  1Y8R C;  1S1Q B;  4LJO B;  3ZNZ B;  1RAX A;  3EC8 A;  4G50 A;  4DWF A;  2KWC A;  5DPS A;  3L17 A;  3KYD D;  3L13 A;  2JUO A;  4ICU A;  4M8N A;  5DPW A;  1G6J A;  2NPT A;  2MX2 A;  4FBJ B;  4B9K A;  2KX0 A;  2REX A;  2D11 A;  2NCN A;  2K6Q A;  4JIO U;  3VAW A;  2KFK B;  5J18 A;  4HWI B;  3NS8 A;  1K8R B;  4FJY A;  4PYU A;  2NBV B;  3SHQ A;  1P3Q U;  2WYQ A;  2R2Q A;  3ML9 A;  2AL6 A;  3AUL A;  2BYV E;  2JF5 A;  3ZNH B;  2KWU B;  4CO7 A;  4XC2 A;  3MHS D;  3HHM A;  4GGQ A;  4K7U A;  2O2V B;  2PE9 A;  4PYZ A;  2M17 A;  3RZW C;  5D2M B;  2HTH A;  3TIX A;  3ZDT A;  4GDL B;  4RMA A;  1LXD A;  3VUY A;  4OVV A;  2J0K A;  2OOB B;  4KV2 A;  2NBU A;  1V86 A;  2DYO A;  3Q3J A;  1NI2 A;  3A9K A;  4NJ7 A;  3KW5 B;  5TR5 A;  1WGD A;  2ZPN A;  1X1M A;  4FJZ A;  4WJN A;  1WE6 A;  3VQI A;  5CHV C;  3DCG A;  3RYT A;  1NBF C;  1GUA B;  3RT3 B;  3ZDM C;  4B95 A;  3U7D A;  3KUD B;  1VCB A;  1WJ6 A;  4FAD A;  1UH6 A;  4AJY B;  5JHB A;  2ZZP B;  2MBO A;  3KVF B;  3Q3F A;  4DDG D;  3L10 B;  4MEM A;  2KHW B;  3QAR A;  3UF8 A;  3UIP B;  2KX3 A;  5CHW A;  2KMA A;  3QWZ B;  4WQO B;  4CHK A;  2N1W A;  2PPH A;  4ANV A;  4ANU A;  4MGI E;  4TV3 A;  3ZLZ A;  4DHJ D;  4NAW B;  3VVW B;  3NZS A;  2K8H A;  2LXA A;  3QA8 A;  5D6J B;  4GSW A;  2GOW A;  3DVN V;  2O6V A;  4IWQ A;  4HVB A;  2N7E A;  5DPT A;  5LXH A;  3L16 A;  2FID A;  1T0Y A;  1WXM A;  4W9G A;  5E6O A;  4EZJ A;  1P9D U;  1WR1 A;  3A9J A;  4G11 A;  4W9C A;  3PT2 B;  2JPH A;  1OGW A;  3IBE A;  3PRP B;  3VHT C;  3DOW A;  2NBW B;  2WDT B;  1V49 A;  5D94 A;  5AZF A;  3T9L A;  2MP2 A;  4BBN C;  3U8Z A;  2CR5 A;  2MBQ A;  5LXI B;  2MA9 B;  1HE8 A;  2IO1 B;  2IBI B;  1WXA A;  3VH4 B;  3U30 A;  3ZVV A;  2CHW A;  3TL5 A;  4HCN B;  2FCM A;  2IO2 B;  4IUM B;  2CHX A;  4RM8 A;  1KOT A;  4DXA B;  3DVN U;  5FR6 A;  3CST A;  3HIZ A;  2IY1 B;  3NOB A;  1EF1 A;  2K8C A;  2LRU A;  1U4A A;  5DCN A;  4F7Z A;  3AXC A;  2KD0 A;  4X57 B;  2KOX A;  4HXD A;  1CMX B;  2C5L C;  2DYM A;  3WAM A;  3DBR I;  2ZEQ A;  2BF8 B;  2ZCC A;  3QJZ A;  3RD2 A;  1IP9 A;  2D3G A;  3N30 A;  2GMI C;  3N32 A;  1ZGU B;  3NZU A;  3B08 A;  2KJH B;  2KMC A;  4W9F A;  4A3O A;  2A5U A;  3X0W A;  3WIM A;  1UBQ A;  4KSL C;  2V3S A;  3RCZ A;  5C23 A;  3ZRF A;  2V4L A;  3AI5 A;  4BBN F;  1GJZ A;  1WM3 A;  1J0G A;  3I3T B;  4HJK A;  1KM7 A;  2K25 A;  1WR6 E;  1RLF A;  3NY5 A;  4G0N B;  3ZKJ C;  1C1Y B;  1IYF A;  1OQY A;  2XEW A;  4ZYN A;  5L83 A;  1WMH A;  2D10 A;  3H7P B;  3JW0 X;  3WAO A;  2C7H A;  3UQA A;  1TZ1 A;  3HM3 A;  3A9J B;  3LJ3 A;  2N1V A;  4EZL A;  2QHO A;  3VXW A;  2JXX A;  2GBR A;  4B6W A;  5J17 A;  1ISN A;  2Y5B B;  3OAW A;  3R7Q A;  1UBI A;  4KIK A;  2NVU I;  2L0T A;  3ZTD A;  2PE6 B;  2BWF A;  2VRR B;  2ZJD A;  4DHJ B;  1WXS A;  4OVU A;  2GBM A;  2HJ8 A;  4MSM B;  3W1S A;  3H7S A;  2KTR A;  2MLB A;  3JSV A;  2HE7 A;  4MH0 E;  4DDI D;  2N9X A;  2UYZ B;  1XT9 B;  2YLM A;  4IWP A;  5KHO A;  2FCS A;  5AZG A;  1E5W A;  2G45 B;  3PLV A;  3VDZ A;  2MRP A;  2KNB A;  3KYC D;  2AYO B;  3APD A;  3CSF A;  3ZNG C;  2KXJ A;  4HPM B;  2KLG A;  5L95 C;  2LAS A;  4NPN A;  1OEY A;  3GOE A;  3QHT A;  3KUC B;  4BKT A;  2J0M A;  2RR9 A;  4BOZ B;  1WZ0 A;  1Q1O A;  4W9E A;  5E6P A;  3C0R B;  4HCP B;  4W9H A;  2ZNV C;  3N3K B;  2C7N B;  3ZW3 A;  2GBK A;  4I6P A;  3X23 A;  3M62 B;  2YVC A;  4W9D A;  1VD2 A;  2D07 B;  2L7R A;  4II2 B;  3DBS A;  1ZW7 A;  1E7V A;  2O6V D;  3CF6 E;  3GZN I;  2ASQ A;  1P98 A;  5CHF A;  3HK0 A;  2RD0 A;  4GXB A;  3V6E B;  4DHZ B;  2LGD A;  5BO4 B;  1TGZ B;  2CU1 A;  2ZNV B;  3WA0 A;  1V5T A;  1RRB A;  4LDT D;  4MDK E;  1H8C A;  1I42 A;  4KSK C;  1J19 A;  4HDQ A;  1I35 A;  3UIO B;  3PV1 A;  2EMS A;  3QX1 A;  4I6N B;  2MQJ A;  2J7Q B;  2DEN B;  2B3A A;  4HK2 A;  4KIK B;  5IAA C;  1YJ1 A;  4BKS A;  4BOS C;  4FA6 A;  1JRU A;  1WJU A;  4PS3 A;  2XBB C;  2LVP A;  2UWQ A;  4GDK B;  1GNU A;  1TBE A;  2K8B A;  2KDI A;  2KTR B;  1S3S G;  3MJW A;  3PZD A;  4JLC A;  4MJS A;  4E71 A;  5AEK B;  5HKH A;  2NPT B;  1XQQ A;  1LM8 B;  2KDF B;  3PTF C;  2JRH A;  1E7U A;  3NHE B;  4WJQ A;  4A20 A;  4JQW C;  2LGX A;  4EFO A;  4II3 B;  4JL9 A;  2L0F A;  2ZVO A;  2JY6 A;  2RPQ A;  4WWN A;  4MSQ B;  2JVC A;  3WAP A;  4HDO A;  3DBL I;  2BYE A;  4K1R B;  2CS4 A;  4MGK E;  3AU5 A;  4NQL B;  1ZKH A;  3EEC A;  5JHA A;  2MW5 A;  1P1A A;  4KDI C;  2JT4 B;  2BPS A;  1SIF A;  2Z0D B;  2FIF A;  4WWO A;  1UEL A;  2LJ5 A;  2IO0 B;  3R7R A;  1QZE A;  2DZK A;  2FUH B;  2L00 B;  2M1M A;  2NR2 A;  1YX6 B;  2ZVN A;  3L54 A;  1WYW B;  2IO3 B;  2DX5 B;  2FNJ B;  2PJH A;  3A9K B;  1YQB A;  5AZH A;  1EUV B;  2L05 A;  3DQV A;  4G3X B;  4W9L A;  2KK8 A;  4ZDV A;  3VUW A;  2NS5 A;  1OEY J;  1WFY A;  1R4M I;  4AJW A;  2K1F A;  2MBB B;  2XK5 A;  4BKG A;  4EKU A;  3R66 C;  4IC7 B;  2LXC A;  3B1L X;  5JZE B;  4ZRJ A;  2ZCB A;  4IG7 B;  3W1Y A; 
#chains in the Genus database with same CATH topology
 2KC1 A;  3B2G A;  3KQ4 A;  1WRD B;  4F8C B;  1TS3 A;  3Q3O C;  3TMP B;  4YTN B;  3TJP A;  3U2S C;  3IFW B;  3RMK C;  1LQB A;  4NNJ B;  4IM3 A;  3VTU A;  2WX0 A;  2FCQ A;  1OTR B;  2VH2 A;  1FMA D;  1WGY A;  2KZR A;  1N6Z A;  4RGN A;  5KHQ A;  1BUI C;  3MTN B;  2FAZ A;  3K9O B;  4GU2 A;  4GB9 A;  4MGY E;  3HUI A;  4PS8 A;  1DOY A;  2MSE D;  2LHE A;  2IYD B;  2LI5 A;  3E56 A;  1GG3 A;  1FXI A;  4WJP A;  4PT5 A;  2LWP A;  4N59 A;  3ZNI D;  2MJ3 A;  3PS6 A;  3CMM B;  3B0A A;  3QCA A;  1KJT A;  2WWZ A;  1KRH A;  2N7J A;  1PQS A;  1FNW A;  2E3T A;  3L08 A;  1L6U A;  1QT9 A;  3A1Q B;  4IOI E;  2DZI A;  2JYE A;  3ZO5 B;  3M63 B;  1L0X B;  1VZ6 A;  1BXT A;  3NRZ A;  1WMH B;  1XLN A;  1N61 A;  3NG0 A;  1VR9 A;  2M4N A;  4WIP A;  3OJ4 B;  4KGT A;  3EFU A;  3TBL D;  5EDS A;  2Q5W D;  3AE2 B;  1WF9 A;  1DOX A;  2VH1 A;  1MJD A;  3PZ7 A;  3UGB B;  4L1B A;  2AQ3 B;  2WHI A;  3APF A;  2RDG A;  2EKE C;  1UNS A;  4URK A;  5EE9 A;  4S17 A;  2JZ3 B;  1BML C;  2MBH A;  1T0S C;  1F0Z A;  4CQN A;  4LNI A;  1C3T A;  2KC2 A;  2BKR B;  2LUM A;  3H7P A;  1TYG B;  2C60 A;  3RI7 C;  1T6B X;  4DBG A;  2D3B A;  1D5Z C;  1TS4 A;  1WSP A;  3LDZ E;  1V80 A;  2QCZ A;  3IT4 B;  2M0A A;  4EUT A;  1EWY C;  4E3C A;  1YN4 A;  1WGH A;  3ZXV A;  4XZ4 A;  1IGD A;  1SIJ A;  2WXJ A;  4WJO A;  2R2O A;  1R4N I;  2KYW A;  3K9P B;  5CX3 A;  2G9H D;  1A5R A;  3ZGZ A;  2MBE A;  4K81 A;  3UQB A;  3TEX A;  2HDE A;  3BK2 A;  2GB1 A;  1B1Z A;  3BWU D;  5J2R A;  2VZK D;  3QQ8 B;  5HFY A;  1HZ6 A;  3WAL A;  1PGB A;  3O13 A;  3B2F A;  3NVV A;  3ONS A;  4R3D A;  2KQS A;  1UD7 A;  2LGY A;  2LD9 A;  5D7G A;  3RFZ B;  1RFA A;  1ZOY B;  1Y8R C;  1S1Q B;  1N62 A;  3BVZ A;  1RAX A;  4LJO B;  3BVM A;  4M8N A;  1FNV A;  1KLU D;  4FBJ B;  4B9K A;  5J18 A;  3VAW A;  4MM3 B;  2M56 B;  4PYU A;  1MVK A;  4XGA B;  2WYQ A;  3ML9 A;  2R2Q A;  1MI0 A;  3AUL A;  3MHS D;  1V97 A;  3HHM A;  1LXD A;  2OOB B;  2AX5 A;  2Y5P A;  2DYO A;  3Q3J A;  5IP4 D;  3KW5 B;  5TR5 A;  2JU6 X;  1FXA A;  1WE6 A;  5C2T B;  3DCG A;  3RYT A;  3RT3 B;  3KUD B;  1VCB A;  4NAM A;  1QOG A;  4M02 A;  4AJY B;  2KWD A;  2JXT A;  2KX3 A;  1PGX A;  3TEZ A;  4DHJ D;  4FXC A;  4ANV A;  3ZLZ A;  2K8H A;  5D6J B;  3RNC C;  2E6X A;  3Q8A A;  4YSY B;  1WXM A;  1P9D U;  4G11 A;  4TMA B;  1HXY D;  3DOW A;  2NBW B;  1LO5 D;  5D94 A;  1I7H A;  1PGA A;  3VH4 B;  3U30 A;  4HCN B;  4IUM B;  1C79 A;  3AEG B;  4B0E A;  2GLS A;  3DVN U;  2RDH A;  1QKZ A;  5FK9 C;  2IGG A;  2K8C A;  3AXC A;  5BMH A;  2BYT A;  3AE6 B;  3N20 C;  2WXR A;  1A70 A;  3AE9 B;  2ZEQ A;  2ZCC A;  2D3G A;  3N30 A;  4US9 A;  3NZU A;  3B08 A;  2KMC A;  4JWU C;  4W9F A;  4A3O A;  3N1Y C;  1RYJ A;  4KSL C;  3ZRF A;  2KT7 A;  4YT0 B;  1KM7 A;  3LYY A;  2K25 A;  1WR6 E;  1RLF A;  1C1Y B;  1WGK A;  1ROE A;  5L83 A;  1WMH A;  1TZ1 A;  3A9J B;  4B6W A;  2Y5B B;  1D5X C;  1C4C A;  2L0T A;  2IND C;  2MHJ A;  2BWF A;  2KMM A;  4AS1 A;  2MLB A;  2HE7 A;  2N9X A;  2UYZ B;  3PLV A;  3VDZ A;  3P4Q B;  3AE7 B;  2BQQ A;  1I4P A;  2KXJ A;  3MFG A;  4NPN A;  4UDU C;  1ESF A;  2WNM A;  4W9E A;  5E6P A;  4A6Q A;  2PLP A;  3PO0 A;  1UWX A;  5EE3 A;  1UGJ A;  3DBH B;  3X23 A;  3M62 B;  1QLB B;  3MC8 A;  2D07 B;  5HHD G;  4II2 B;  3DBS A;  3CF6 E;  1FFV A;  5CHF A;  3HK0 A;  5D3D A;  3LB8 C;  1XO3 A;  2BTE A;  1TGZ B;  4MDK E;  1H8C A;  1JRP A;  3HVZ A;  1PFD A;  1TJE A;  3PV1 A;  1SE4 A;  2MQJ A;  5IAA C;  4BKS A;  4FA6 A;  1JRU A;  1E7P B;  4GDK B;  3NVY A;  1GNU A;  1WWT A;  1S3S G;  4JLC A;  5AEK B;  3SR6 A;  2M19 A;  3NHE B;  1TZO A;  3RNB C;  4II3 B;  4JL9 A;  2L0F A;  2ZVO A;  1CZP A;  2JY6 A;  3DBL I;  2CS4 A;  3W5V B;  1NEK B;  3EEC A;  3FAH A;  4REZ A;  2MW5 A;  2BPS A;  4WWO A;  1VRA B;  1FCC C;  3N1X C;  3DWM A;  2ZVN A;  2FNJ B;  1D6E C;  5BYQ A;  1TIF A;  1WFY A;  3AEF B;  1ZDX A;  2MBB B;  4BKG A;  3R8B A;  2LXC A;  3B1L X;  3GB1 A;  3IAM 1;  1E90 A;  4K3B A;  1L0V B;  4OHJ A;  4DHZ E;  1I4R A;  3P4P B;  1Z2M A;  1PDX A;  3BYY B;  3QK0 A;  3AE8 B;  4TQ1 A;  3TCA A;  1JWB D;  1WJN A;  1F2R C;  1XXG A;  2WXH A;  1V1P A;  1BT0 A;  4GOC A;  1D3Z A;  2DAF A;  2OJR A;  4XWW A;  2LUE A;  1VLB A;  1WM2 A;  2L8J A;  3NJT A;  1L0Y B;  3VRA B;  4JWS C;  2OED A;  2B76 B;  2MP2 B;  4FUL A;  4DXF A;  2QJL A;  2JZZ A;  1J8C A;  1HTO A;  2G1E A;  2BS4 B;  3AU4 A;  3VRB B;  3RNF C;  2WDR B;  1WY8 A;  2DZM A;  2LFI A;  4BKS D;  1UZX B;  1ZDV A;  1WH3 A;  2KJ6 A;  4LLG M;  2DZJ A;  1FM0 D;  1QOF A;  3OG5 A;  2L3Z A;  4FHJ A;  3W1S C;  5D3I B;  2N9P C;  1JCK B;  3SD5 A;  3EUB 2;  4WAA A;  1SE9 A;  3S2A A;  1C78 A;  3BIN A;  5CTR C;  3IXS A;  2MWS B;  1OFF A;  3AB5 A;  3DPD A;  3SFE B;  1R4M B;  1WX7 A;  1H4R A;  2PEA A;  3DVG Y;  4IDI A;  1XLP A;  4AUQ C;  5LNK 1;  2M8S A;  1L7Y A;  4TKN A;  4F1S A;  1DGJ A;  4IM2 A;  2BGF A;  4M0W B;  4IW0 A;  1QOA A;  1T3Q A;  2BB5 A;  3NS1 A;  4LCD E;  4AP4 C;  3H6N A;  3BVG A;  4ZYS A;  3IT6 B;  4B0M A;  3PHX B;  1PYW D;  2WQY B;  1VZ8 A;  1DYQ A;  1UF0 A;  3AEE B;  3DBH I;  4KGS A;  3OLM D;  2CKH B;  1IUE A;  2QDF A;  3KUZ A;  2C9W B;  1L2N A;  1XCT L;  4XDC A;  1Q0W B;  3MP9 A;  4LNN A;  2KDB A;  2Z59 B;  1WGR A;  3I57 A;  4FJV B;  4MAC A;  3WAN A;  1YJI A;  4J6I A;  4XDD A;  2IY0 B;  3RZF A;  1E8Y A;  4CYE A;  2QSD A;  3VTW A;  4E74 A;  1XLO A;  3ZQ4 A;  2INN E;  2QEJ C;  3O65 B;  3L0W B;  2KWV B;  1YD8 U;  4K7S A;  3PSE B;  4AWJ A;  3V6C B;  1WGG A;  4LTU A;  5LLI A;  2RDB C;  1D4B A;  4GDL A;  5TSS A;  1XEE A;  2HTM E;  3DWG C;  2WXK A;  2K39 A;  2LJI A;  2A4Z A;  1WXV A;  2KQ7 A;  2I1K A;  3H9D A;  1EU4 A;  3KH0 A;  1SJE D;  2KO3 A;  2MH7 A;  1WX9 A;  3NVZ A;  2IGD A;  2BBC A;  2V1Y A;  1J7C A;  1FNU A;  4C7Y A;  1WI0 A;  2L52 A;  4MT5 A;  1D5M C;  4GDK A;  1NDD A;  4NAW A;  3EC8 A;  2JUO A;  4ICU A;  2K6Q A;  2KFK B;  1JW9 D;  1K8R B;  1LGR A;  2NBV B;  4RF1 A;  3DHG C;  3AM9 A;  1F1H A;  1E0Z A;  1T5X D;  2KWU B;  2GRI A;  4OW0 A;  3N9Y C;  2M17 A;  2DWQ A;  4RGM A;  5D2M B;  2HTH A;  2NTS A;  4BAX A;  5IOI A;  3VUY A;  1IGC A;  3P4S B;  1V86 A;  2PTL A;  2BW2 A;  2K9X A;  3VQI A;  2BVC A;  5CHV C;  1NBF C;  1WJ6 A;  3AEB B;  5JXV A;  2ZZP B;  2LEK A;  2MBO A;  4MEM A;  2KHW B;  3QAR A;  3UIP B;  1HEZ E;  1ET6 A;  5CHW A;  2KMA A;  3QWZ B;  4WQO B;  5EE1 A;  2W82 A;  4MGI E;  4ANU A;  2GI9 A;  3NZS A;  1GPX A;  2LXA A;  1GOZ A;  2JSV X;  3Q8E A;  4IWQ A;  3VR9 B;  1TKE A;  5LXH A;  3L16 A;  4EZJ A;  3KLS X;  3Q69 A;  2H89 B;  3IBE A;  1JAL A;  3PRP B;  4WUR A;  2PVG C;  2MP2 A;  3U8Z A;  1GAQ B;  2MA9 B;  2WP9 B;  4RH6 A;  1TT5 B;  2L1A A;  3VR8 B;  2CHW A;  4NJC A;  2FCM A;  2CHX A;  3PZ8 A;  1QQR A;  4P16 A;  3HIZ A;  3NOB A;  1U4A A;  2KD0 A;  3C8Y A;  2KOX A;  2LHD A;  2MJE A;  1CMX B;  1JWM D;  2GMI C;  3N32 A;  3ZJU A;  4N58 A;  2Y3A A;  1UBQ A;  4HRS A;  3Q14 C;  3AI5 A;  3NZ3 A;  4BBN F;  1GJZ A;  3I63 C;  3I3T B;  4HJK A;  1OQY A;  2D10 A;  3WAO A;  3UQA A;  3RNA C;  2N1V A;  2ZW0 A;  3VXW A;  2JXX A;  3R7Q A;  2NVU I;  1FEH A;  3MHZ A;  2VRR B;  2PE6 B;  1Q10 A;  2V3P A;  2ZJD A;  1KTK A;  2GBM A;  3H7S A;  4DDI D;  2MEK A;  4IWP A;  3DHH C;  5KHO A;  3KWL A;  5AZG A;  1E5W A;  2MRP A;  4C00 A;  2KNB A;  2KLG A;  4M0W A;  3GOE A;  1TS5 A;  2RR9 A;  1Q1O A;  3C0R B;  3TUO A;  4M01 A;  3RN9 C;  2DLB A;  3I5J C;  4I6P A;  3Q3M C;  4USA A;  3AN1 A;  2WXG A;  4DHZ B;  2LGD A;  1J7A A;  3WA0 A;  1V5T A;  4KSK C;  5MPO A;  1C9F A;  4HDQ A;  1V8C A;  1K53 A;  3UIO B;  3QX1 A;  4I6N B;  4KIK B;  4PS3 A;  1YOV B;  2KDI A;  2KTR B;  3MJW A;  4ARI A;  5HKH A;  2NPT B;  3PTF C;  1LM8 B;  2KDF B;  2WS3 B;  3DBR B;  3HRD D;  2IJ0 A;  1E7U A;  4LNO A;  4JQW C;  4EFO A;  4KX6 B;  4OZA A;  2RPQ A;  3WAP A;  4NQL B;  4YSZ B;  1FPY A;  4YXD B;  2Z0D B;  2LJ5 A;  1EWC A;  2FBW B;  2QMT A;  3R7R A;  2FUH B;  5EE0 A;  1YX6 B;  2WXL A;  2PJH A;  2DX5 B;  3A9K B;  4ZDV A;  3VUW A;  2JWU A;  1C77 A;  4A9A A;  2J52 A;  3AV8 A;  3R66 C;  3W1Y A;  2J0J A;  3EA6 A;  4A3P A;  3FIL B;  3A4R A;  1AAR A;  2KFJ A;  2BYF A;  2JYT A;  4QAY A;  4JGH B;  4BFR A;  2J42 A;  2KDE B;  3PLU A;  4MEL A;  4IWO A;  4KGR A;  2W54 A;  2O6V B;  2J53 A;  3PRE A;  1TS2 A;  2L83 A;  2LVO A;  3A1Q A;  3T8M A;  4TUU A;  1LFD A;  3CWI A;  1K50 A;  2KN4 A;  5BMG A;  4LDT B;  4WWM A;  2KAJ A;  2AEH A;  3OJ3 A;  3GZN B;  4YTM B;  5G5H A;  4NY0 A;  2KJR A;  3RUI B;  3MC0 B;  2JWZ A;  2LMC A;  1I4G A;  3ZXR A;  1KH0 A;  1B9R A;  1GB1 A;  4KKJ A;  2N9K A;  3PRZ A;  1KLV A;  2GBN A;  5JH5 C;  2LZ6 A;  2DYB A;  1SGH A;  3PPA A;  2KTF A;  2W9N A;  2D3C A;  4BVU C;  1MG8 A;  4ZRP A;  3ZTC A;  3QAQ A;  3V60 A;  4WH4 A;  3V62 A;  4ASW C;  4DK5 A;  2WXO A;  4I6L B;  2JRI B;  3M3J A;  1WZ3 A;  2JZP A;  1P0R A;  2WDV B;  2FUG 1;  3SU8 X;  2KQ4 X;  3P1M A;  2MCN B;  1NEN B;  3ZRC A;  2N7D A;  1E6E B;  3E9S A;  1GC7 A;  2I1J A;  2NMQ A;  2DNF A;  4P1C C;  3ENE A;  1YX5 B;  3B9J A;  2FCN A;  1TTN A;  4IKG A;  4WWP A;  2Z0E B;  1AW7 A;  4W9K A;  3PHW B;  2PIA A;  4YL8 A;  1FIQ A;  4W9I A;  3BZD B;  2N4F A;  2RSU A;  4O1N A;  4KDL B;  3Q2A C;  3Q8B A;  1V5O A;  3AE3 B;  3J9C A;  1FXT B;  2ZPY A;  2G4S A;  3IHP C;  2RMM A;  1K51 A;  5BMI A;  3QC8 B;  4KZC A;  2WXQ A;  5GXG B;  1ZXI A;  1WIA A;  3L4P A;  3SDL C;  3ZIM A;  1EO6 A;  1YNT E;  3V61 A;  4W9J A;  1L5P A;  4AQ7 A;  1EU3 A;  4C4V B;  3PGE A;  4KZ0 A;  4MM3 A;  2HD5 B;  2FE8 A;  1V6E A;  1EF5 A;  3BYT B;  4ZHP A;  1YIW A;  4ANX A;  3H1U A;  3DDC B;  1V2Y A;  4EEW A;  5E6J A;  5FR3 A;  1GB4 A;  1DOI A;  1MHH E;  1AWD A;  1QF6 A;  1YQ4 B;  2WX1 A;  3RNG C;  3TEW A;  5GMV A;  1NVI D;  2SEB D;  3R3M A;  2AL3 A;  2EMT A;  4HLE A;  1CJE A;  1STE A;  3AED B;  3BY4 B;  2XK5 B;  4DXG A;  4GIV A;  4GN1 A;  4P7I A;  2LGS A;  2XN9 C;  4K3C A;  4FN2 A;  5H8Y E;  4OVZ A;  3ZNZ B;  4DWF A;  5DPS A;  3L13 A;  5DPW A;  1G6J A;  2NPT A;  2MX2 A;  4KKI A;  3SFD B;  2NCN A;  4EE2 A;  3N1Z C;  4HWI B;  4RCO A;  3FC4 A;  2YEP F;  1ET9 A;  4RGO S;  2KVZ A;  5I4D A;  2K0P A;  3RPF C;  3SHQ A;  1P3Q U;  2AL6 A;  3U52 E;  1RM6 C;  2I2Y A;  5HG2 A;  1XCQ L;  1VJK A;  4GGQ A;  4K7U A;  2O2V B;  4PYZ A;  3RZW C;  3AE1 B;  3ZDT A;  1HA5 A;  2W3S A;  2J0K A;  1TKY A;  3A9K A;  2WGS A;  2ZPN A;  1F2R I;  1ZE3 D;  4FJZ A;  4WJN A;  1E10 A;  3ZDM C;  2V0G A;  3U7D A;  4FAD A;  2JQR B;  1UH6 A;  5JHB A;  3Q3F A;  3UF8 A;  2RPV A;  5C3J B;  4CHK A;  1N5X A;  4GSW A;  2GOW A;  2ON8 A;  2O6V A;  3RNE C;  2N7E A;  5DPT A;  4RNA A;  2FID A;  5E6O A;  2WXM A;  1WR1 A;  3A9J A;  3PT2 B;  3AE5 B;  1ACC A;  2JPH A;  4YTP B;  3VHT C;  2WDT B;  3ETR A;  4BBN C;  2KDM A;  2CR5 A;  2KAC A;  3BK1 A;  5LXI B;  1HE8 A;  2IO1 B;  2IBI B;  1WXA A;  1FRR A;  3TL5 A;  2IO2 B;  1KOT A;  1CK1 A;  2LRU A;  1SF0 A;  4X57 B;  1VZ7 A;  2DYM A;  3C19 A;  3WAM A;  5FKA C;  2BF8 B;  2D3A A;  1IP9 A;  1XF5 L;  1ZGU B;  1JWU D;  3T3N A;  1MFW A;  2A5U A;  1TKG A;  4LK0 M;  3WIM A;  3LXF A;  2V3S A;  5C23 A;  2V4L A;  1MPE A;  1J0G A;  2H88 B;  4XE0 A;  2XEW A;  4P6V F;  1MHX A;  3JW0 X;  3HM3 A;  5J17 A;  5IKC M;  2SAK A;  1TY0 A;  3OAW A;  1V1O A;  1I4H A;  3ZTD A;  1SBB B;  2EEL A;  1WXS A;  1SSN A;  3W1S A;  4MSM B;  2HJ8 A;  4MH0 E;  2FCS A;  2G45 B;  3Q6B A;  1YN5 A;  3CSF A;  3AH7 A;  5L95 C;  2LAS A;  3TEY A;  2OHF A;  1OEY A;  1SE2 A;  2PW9 A;  3KUC B;  1UWM A;  3ZJT A;  4BOZ B;  4HCP B;  4W9H A;  2ZNV C;  3I9V 1;  3ZW3 A;  2N0S B;  1RWS A;  2GBK A;  1FCL A;  4W9D A;  1VD2 A;  2L7R A;  3W9C B;  2O6V D;  5T8I A;  4RF0 A;  1P98 A;  1I4X A;  2AQ2 B;  2RD0 A;  2INC C;  4GXB A;  2K3U A;  2PKO A;  4ACF A;  2QC8 A;  5BYR A;  2DBY A;  2CJO A;  1RRB A;  4LDT D;  2IPK D;  1J19 A;  3WCQ A;  2EMS A;  2Y5C A;  1PUT A;  4US8 A;  1WJU A;  2LVP A;  1TBE A;  4C4V A;  3T3O A;  3AEA B;  4BZA A;  4C7Z A;  1C4A A;  4YSX B;  4WJQ A;  2WXI A;  4L23 A;  4JX1 C;  3FKY A;  4WWN A;  4A8X C;  4MSQ B;  2K5P A;  1YQ3 B;  2JVC A;  2NTT A;  4D2K A;  2X38 A;  4MGK E;  3AU5 A;  1ZKH A;  4WAF A;  5JHA A;  1P1A A;  4KDI C;  2JT4 B;  2FIF A;  1IBX B;  4ZRQ A;  3KWV A;  1QZE A;  2IDY A;  2NR2 A;  3L54 A;  1WYW B;  5AZH A;  1EUV B;  2L05 A;  3DQV A;  1ZP0 B;  1OEY J;  1R4M I;  4TSS A;  4AJW A;  1N60 A;  2XK5 A;  4H2A A;  4IC7 B;  5JZE B;  2CU3 A;  4ZRJ A;  2ZCB A;  4IG7 B;  2DHZ A;  4MH8 A;  2PVO D;  2EKI A;  4KVG B;  1VDV A;  4FHK A;  4J3O D;  3P42 A;  2G3Q B;  1JQ4 A;  2W3R A;  1L6V A;  2R61 A;  1KLG D;  4A90 A;  3ML8 A;  1RFK A;  2OJW A;  1E8X A;  1SJH D;  5H92 C;  4NZL B;  3VUX A;  3ZUN A;  3UIN B;  3VTV A;  1CQV A;  2BS3 B;  2O2V A;  1F52 A;  5C1Z A;  1KFY B;  5G55 A;  3PRM B;  3APC A;  1SXT A;  2X8X X;  2G4D B;  2L32 A;  1SEB D;  1NI3 A;  1YN3 A;  4FLH A;  1V9J A;  1SB3 C;  4NJ6 A;  2QIL A;  3IVF A;  3D32 A;  1UGM A;  3GE8 C;  4HKZ E;  4ZOH C;  5DPR A;  2YEP B;  2AWT A;  4N9F 4;  3P2B A;  2KN5 A;  1Y56 A;  3DHI C;  3JYU A;  3EHV A;  3DBL B;  3GP7 A;  2D2Q A;  1V1P B;  2GBJ A;  1QIL A;  2J4X A;  4LJP B;  3ALB A;  1F9J A;  2KLC A;  4MGZ E;  1XD3 B;  2M0X A;  1V81 A;  5E6N A;  1FD6 A;  1YMH E;  4RFB A;  1UUP A;  3GS2 A;  3H8H A;  2ACZ B;  4ITK A;  1M4V A;  2BS2 B;  4TQ0 A;  4ZRI A;  2L76 A;  3JSV B;  2V4I B;  2UU7 A;  2WXF A;  1HTQ A;  1GC6 A;  4ICV A;  1NYR A;  3EGR A;  3R2T A;  4EOY A;  1E8Z A;  3IG3 A;  1Z5S B;  1C76 A;  1ZPS A;  3PVL A;  3DVG X;  3VH3 B;  2K6D B;  4OZB A;  1ZXH A;  5AUI A;  4OZC A;  3HVD A;  4LNF A;  4ANW A;  2BWE S;  1SE3 A;  3JVZ X;  4EZK A;  5HI1 A;  3AMZ A;  1IPG A;  3A4S C;  1JML A;  4RM9 A;  2RGF A;  3P4R B;  3U4E G;  4HPL B;  3UI3 A;  2KVR A;  1NYQ A;  4LNK A;  1Q5W B;  3SEB A;  4K7W A;  2LRW A;  3HM6 X;  4IM0 A;  3VFK A;  3MJ5 A;  4MJS B;  3V3X A;  2KAN A;  2XNA C;  2KFK A;  1P7E A;  4XX5 A;  4ZRK A;  1M94 A;  3ECI A;  4AOF A;  1WE7 A;  1ZUD 2;  3P63 A;  4GMV A;  4HKQ A;  2WU2 B;  5IN7 A;  3U7Z A;  2BT6 A;  3A33 B;  3URY A;  4NQK E;  2LVQ A;  3QIJ A;  2WU5 B;  2DAJ A;  2KKC A;  2BKF A;  1N5W A;  1F77 A;  2D5G A;  3M95 A;  1E8W A;  1E9M A;  1WX8 A;  2IZV B;  2CHZ A;  3EFC A;  2PMV A;  4P1B C;  3RUL A;  1WJ4 A;  2C7M B;  4PS7 A;  4HRO A;  2N9E B;  1FRD A;  5IA7 A;  4M8M A;  2WXP A;  4G50 A;  2KWC A;  3L17 A;  3KYD D;  2IGH A;  4WQM A;  2KX0 A;  2REX A;  2D11 A;  4JIO U;  2I38 A;  1FO4 A;  3NS8 A;  1KF6 B;  4FJY A;  2BYV E;  2JF5 A;  4N6E B;  3ZNH B;  4CO7 A;  4XC2 A;  2PE9 A;  1JWA D;  1IBX A;  3TIX A;  1OQR A;  4GDL B;  4RMA A;  3IAS 1;  5AUK A;  4OVV A;  4XWT A;  4KV2 A;  3Q3N C;  2NBU A;  4NJ7 A;  1NI2 A;  2Z8L A;  1WGD A;  1X1M A;  4HJG E;  3V05 A;  4HPP A;  1GUA B;  4B95 A;  1AN8 A;  4C80 A;  3KVF B;  1JRO A;  4DDG D;  3L10 B;  3ZJV A;  2N1W A;  2PPH A;  4TV3 A;  3TSS A;  4NAW B;  3VVW B;  2AQ1 B;  3QA8 A;  5IO9 A;  2WDQ B;  3DVN V;  4HVB A;  2VZK B;  1WRI A;  1T0Y A;  4ARC A;  4W9G A;  3W2D A;  3R2I A;  4W9C A;  1L4Z B;  1OGW A;  1V49 A;  5AZF A;  3T9L A;  1L4D B;  3ABV B;  2MBQ A;  4C56 C;  2INP E;  4HEA 1;  3Q8C A;  3ZVV A;  4RM8 A;  2ICI A;  4Q2J A;  4JPS A;  2ZW1 A;  4DXA B;  5FR6 A;  3CST A;  2IY1 B;  1EF1 A;  5DCN A;  4F7Z A;  3GE3 C;  4HXD A;  2C5L C;  2ONQ A;  3DBR I;  3QJZ A;  3RD2 A;  2KJH B;  2QIE B;  3X0W A;  1N63 A;  2K22 A;  3RCZ A;  1WM3 A;  3MC9 A;  1P7F A;  3NY5 A;  3ZKJ C;  4G0N B;  1IYF A;  1MG4 A;  3AEC B;  4ZYN A;  3H7P B;  2C7H A;  3LJ3 A;  4EZL A;  2QHO A;  2GBR A;  1C4P A;  1ISN A;  1UBI A;  4KIK A;  4DHJ B;  1K52 A;  1EM7 A;  4OVU A;  2KTR A;  3JSV A;  1XT9 B;  2YLM A;  2HJ1 A;  2TSS A;  3KYC D;  2AYO B;  3APD A;  3ZNG C;  2JX5 A;  4HPM B;  4ZHO A;  2V3N A;  3QHT A;  4YWG G;  4BKT A;  2J0M A;  3W5U B;  2N9L A;  1WZ0 A;  3NVW A;  1OQQ A;  1R7S A;  3N3K B;  1HQR D;  4XYC A;  2C7N B;  1T0Q C;  1QOB A;  2YVC A;  1J7B A;  4M00 A;  4GLS C;  1ENF A;  1I4Q A;  1E7V A;  1ZW7 A;  5G5G A;  3GZN I;  3ZYY X;  2ASQ A;  1JWS D;  3V6E B;  1AYF A;  3Q8F A;  5BO4 B;  2CU1 A;  2ZNV B;  4S0R A;  3BII D;  1I35 A;  3FIL A;  4HK2 A;  2J7Q B;  2DEN B;  2B3A A;  2WLB A;  1YJ1 A;  4BOS C;  3CIR B;  3NUH B;  2XBB C;  2UWQ A;  2V9H A;  2K8B A;  2WXN A;  3PZD A;  4E71 A;  4MJS A;  2MJD A;  3OWE B;  1XQQ A;  5BYS A;  1R4N B;  2JRH A;  4A20 A;  2LGX A;  2CJN A;  2LGI A;  4JE3 B;  2BB6 A;  4HDO A;  1WXQ A;  2BYE A;  4K1R B;  2W55 A;  1HZ5 A;  1SIF A;  1WYG A;  1UEL A;  2IO0 B;  4L2Y A;  2DZK A;  1TY2 A;  2L00 B;  2M1M A;  5G2N A;  2IO3 B;  1T0R C;  1YQB A;  3AE4 B;  4W9L A;  1FFU A;  4G3X B;  2KK8 A;  2NS5 A;  4RGT A;  1XLQ A;  1YJJ A;  2K1F A;  4A55 A;  4EKU A;  4DQO C;  4PK1 A;  1I42 A; 
#chains in the Genus database with same CATH homology
 2J0J A;  2DHZ A;  1E90 A;  2KC1 A;  4A3P A;  4DHZ E;  3A4R A;  4KVG B;  1Z2M A;  1AAR A;  2KFJ A;  2BYF A;  3QK0 A;  4FHK A;  4JGH B;  1WRD B;  4BFR A;  4F8C B;  2G3Q B;  4TQ1 A;  3TCA A;  2KDE B;  3PLU A;  1WJN A;  4MEL A;  4IWO A;  3TMP B;  2O6V B;  3PRE A;  3TJP A;  3ML8 A;  2LVO A;  3A1Q A;  3IFW B;  1BT0 A;  4GOC A;  1E8X A;  2DAF A;  2OJR A;  3T8M A;  1D3Z A;  1LQB A;  4NNJ B;  2LUE A;  4IM3 A;  4TUU A;  1LFD A;  3VTU A;  3VUX A;  2WX0 A;  3ZUN A;  3UIN B;  2FCQ A;  1OTR B;  4LDT B;  1WM2 A;  2AEH A;  2L8J A;  3OJ3 A;  3VTV A;  2O2V A;  1WGY A;  2KZR A;  4NY0 A;  2KJR A;  2MP2 B;  3RUI B;  4FUL A;  5C1Z A;  2JWZ A;  5G55 A;  5KHQ A;  3PRM B;  3APC A;  3MTN B;  2G4D B;  2FAZ A;  3K9O B;  4GU2 A;  4FLH A;  1V9J A;  4GB9 A;  2JZZ A;  4MGY E;  4PS8 A;  2MSE D;  1J8C A;  2IYD B;  2LI5 A;  3PRZ A;  3AU4 A;  4NJ6 A;  3IVF A;  1GG3 A;  1KLV A;  3D32 A;  4WJP A;  1UGM A;  2GBN A;  5JH5 C;  2LZ6 A;  2LWP A;  1WY8 A;  3ZNI D;  2DZM A;  3PS6 A;  2DYB A;  1SGH A;  3CMM B;  3B0A A;  3QCA A;  3PPA A;  4BKS D;  1UZX B;  1KJT A;  5DPR A;  2WWZ A;  2AWT A;  2KTF A;  1WH3 A;  2KJ6 A;  4N9F 4;  2W9N A;  3P2B A;  2KN5 A;  4BVU C;  1MG8 A;  1PQS A;  3ZTC A;  3QAQ A;  2DZJ A;  3JYU A;  3EHV A;  3L08 A;  3V60 A;  2L3Z A;  4FHJ A;  3W1S C;  2D2Q A;  3A1Q B;  2N9P C;  2GBJ A;  3SD5 A;  2DZI A;  4WAA A;  3ZO5 B;  3V62 A;  3M63 B;  4ASW C;  4CYE A;  4LJP B;  4DK5 A;  3ALB A;  1F9J A;  2KLC A;  1SE9 A;  3S2A A;  1WMH B;  4MGZ E;  1XD3 B;  2M0X A;  4I6L B;  2JRI B;  1V81 A;  3M3J A;  3BIN A;  5CTR C;  1WZ3 A;  5E6N A;  2MWS B;  2M4N A;  1P0R A;  3OJ4 B;  3DPD A;  3EFU A;  3TBL D;  1WX7 A;  1H4R A;  2PEA A;  3DVG Y;  3SU8 X;  4TQ0 A;  2MCN B;  5EDS A;  4AUQ C;  3ZRC A;  2N7D A;  2M8S A;  1L7Y A;  4ZRI A;  2L76 A;  4TKN A;  1WF9 A;  3JSV B;  4F1S A;  1GC7 A;  3UGB B;  2I1J A;  3APF A;  3ENE A;  1GC6 A;  4ICV A;  4IM2 A;  2BGF A;  4M0W B;  1YX5 B;  2EKE C;  4IW0 A;  2FCN A;  4EOY A;  4URK A;  1E8Z A;  3IG3 A;  1TTN A;  1Z5S B;  4WWP A;  3PVL A;  2Z0E B;  4LCD E;  4AP4 C;  2JZ3 B;  3DVG X;  3VH3 B;  2K6D B;  2MBH A;  3H6N A;  4W9K A;  3PHW B;  1C3T A;  4YL8 A;  4W9I A;  2N4F A;  2RSU A;  4KDL B;  4ANW A;  2BWE S;  3PHX B;  2KC2 A;  3JVZ X;  1V5O A;  4EZK A;  2BKR B;  1IPG A;  3A4S C;  3DBH I;  1FXT B;  2ZPY A;  4RM9 A;  3H7P A;  2G4S A;  3IHP C;  2RGF A;  3OLM D;  2CKH B;  2C60 A;  3QC8 B;  4KZC A;  4DBG A;  3KUZ A;  2C9W B;  1WIA A;  1L2N A;  1Q0W B;  4HPL B;  3SDL C;  3ZIM A;  3LDZ E;  2KVR A;  1Q5W B;  2KDB A;  1EO6 A;  1V80 A;  1WGR A;  2Z59 B;  4FJV B;  3WAN A;  3V61 A;  4K7W A;  2LRW A;  2IY0 B;  4J6I A;  4W9J A;  3RZF A;  3HM6 X;  4IM0 A;  3VFK A;  4EUT A;  5G2N A;  4MJS B;  4E3C A;  1E8Y A;  2KAN A;  2KFK A;  3PGE A;  4KZ0 A;  4XX5 A;  1WGH A;  1M94 A;  4MM3 A;  2HD5 B;  4XZ4 A;  4ZRK A;  3VTW A;  3ECI A;  4E74 A;  4AOF A;  1V6E A;  1EF5 A;  1WE7 A;  4GMV A;  1YIW A;  3O65 B;  3L0W B;  4WJO A;  3A33 B;  2KWV B;  1YD8 U;  4ANX A;  2R2O A;  1R4N I;  4NQK E;  2LVQ A;  3QIJ A;  4K7S A;  3K9P B;  2DAJ A;  2KKC A;  3H1U A;  2BKF A;  5CX3 A;  3PSE B;  4AWJ A;  1A5R A;  3V6C B;  1WGG A;  2MBE A;  3DDC B;  5LLI A;  1V2Y A;  4K81 A;  4EEW A;  3UQB A;  4GDL A;  3M95 A;  1E8W A;  2K39 A;  5J2R A;  3QQ8 B;  1WX8 A;  2A4Z A;  2IZV B;  2CHZ A;  3WAL A;  2WX1 A;  1WXV A;  2KQ7 A;  5GMV A;  2I1K A;  3H9D A;  3KH0 A;  3R3M A;  2KO3 A;  2AL3 A;  3RUL A;  2EMT A;  1WJ4 A;  2C7M B;  4HLE A;  3BY4 B;  2XK5 B;  1WX9 A;  4PS7 A;  3ONS A;  2KQS A;  4GIV A;  4GN1 A;  1UD7 A;  2N9E B;  4P7I A;  2V1Y A;  2LGY A;  5IA7 A;  2LD9 A;  4M8M A;  1WI0 A;  5D7G A;  4GDK A;  4FN2 A;  1NDD A;  1RFA A;  4NAW A;  1Y8R C;  1S1Q B;  4LJO B;  3ZNZ B;  1RAX A;  3EC8 A;  4G50 A;  4DWF A;  2KWC A;  5DPS A;  3L17 A;  3KYD D;  3L13 A;  2JUO A;  4ICU A;  4M8N A;  5DPW A;  1G6J A;  2NPT A;  2MX2 A;  4FBJ B;  4B9K A;  2KX0 A;  2REX A;  2D11 A;  2NCN A;  2K6Q A;  4JIO U;  3VAW A;  2KFK B;  5J18 A;  4HWI B;  3NS8 A;  1K8R B;  4FJY A;  4PYU A;  2NBV B;  3SHQ A;  1P3Q U;  2WYQ A;  2R2Q A;  3ML9 A;  2AL6 A;  3AUL A;  2BYV E;  2JF5 A;  3ZNH B;  2KWU B;  4CO7 A;  4XC2 A;  3MHS D;  3HHM A;  4GGQ A;  4K7U A;  2O2V B;  2PE9 A;  4PYZ A;  2M17 A;  3RZW C;  5D2M B;  2HTH A;  3TIX A;  3ZDT A;  4GDL B;  4RMA A;  1LXD A;  3VUY A;  4OVV A;  2J0K A;  2OOB B;  4KV2 A;  2NBU A;  1V86 A;  2DYO A;  3Q3J A;  1NI2 A;  3A9K A;  4NJ7 A;  3KW5 B;  5TR5 A;  1WGD A;  2ZPN A;  1X1M A;  4FJZ A;  4WJN A;  1WE6 A;  3VQI A;  5CHV C;  3DCG A;  3RYT A;  1NBF C;  1GUA B;  3RT3 B;  3ZDM C;  4B95 A;  3U7D A;  3KUD B;  1VCB A;  1WJ6 A;  4FAD A;  1UH6 A;  4AJY B;  5JHB A;  2ZZP B;  2MBO A;  3KVF B;  3Q3F A;  4DDG D;  3L10 B;  4MEM A;  2KHW B;  3QAR A;  3UF8 A;  3UIP B;  2KX3 A;  5CHW A;  2KMA A;  3QWZ B;  4WQO B;  4CHK A;  2N1W A;  2PPH A;  4ANV A;  4ANU A;  4MGI E;  4TV3 A;  3ZLZ A;  4DHJ D;  4NAW B;  3VVW B;  3NZS A;  2K8H A;  2LXA A;  3QA8 A;  5D6J B;  4GSW A;  2GOW A;  3DVN V;  2O6V A;  4IWQ A;  4HVB A;  2N7E A;  5DPT A;  5LXH A;  3L16 A;  2FID A;  1T0Y A;  1WXM A;  4W9G A;  5E6O A;  4EZJ A;  1P9D U;  1WR1 A;  3A9J A;  4G11 A;  4W9C A;  3PT2 B;  2JPH A;  1OGW A;  3IBE A;  3PRP B;  3VHT C;  3DOW A;  2NBW B;  2WDT B;  1V49 A;  5D94 A;  5AZF A;  3T9L A;  2MP2 A;  4BBN C;  3U8Z A;  2CR5 A;  2MBQ A;  5LXI B;  2MA9 B;  1HE8 A;  2IO1 B;  2IBI B;  1WXA A;  3VH4 B;  3U30 A;  3ZVV A;  2CHW A;  3TL5 A;  4HCN B;  2FCM A;  2IO2 B;  4IUM B;  2CHX A;  4RM8 A;  1KOT A;  4DXA B;  3DVN U;  5FR6 A;  3CST A;  3HIZ A;  2IY1 B;  3NOB A;  1EF1 A;  2K8C A;  2LRU A;  1U4A A;  5DCN A;  4F7Z A;  3AXC A;  2KD0 A;  4X57 B;  2KOX A;  4HXD A;  1CMX B;  2C5L C;  2DYM A;  3WAM A;  3DBR I;  2ZEQ A;  2BF8 B;  2ZCC A;  3QJZ A;  3RD2 A;  1IP9 A;  2D3G A;  3N30 A;  2GMI C;  3N32 A;  1ZGU B;  3NZU A;  3B08 A;  2KJH B;  2KMC A;  4W9F A;  4A3O A;  2A5U A;  3X0W A;  3WIM A;  1UBQ A;  4KSL C;  2V3S A;  3RCZ A;  5C23 A;  3ZRF A;  2V4L A;  3AI5 A;  4BBN F;  1GJZ A;  1WM3 A;  1J0G A;  3I3T B;  4HJK A;  1KM7 A;  2K25 A;  1WR6 E;  1RLF A;  3NY5 A;  4G0N B;  3ZKJ C;  1C1Y B;  1IYF A;  1OQY A;  2XEW A;  4ZYN A;  5L83 A;  1WMH A;  2D10 A;  3H7P B;  3JW0 X;  3WAO A;  2C7H A;  3UQA A;  1TZ1 A;  3HM3 A;  3A9J B;  3LJ3 A;  2N1V A;  4EZL A;  2QHO A;  3VXW A;  2JXX A;  2GBR A;  4B6W A;  5J17 A;  1ISN A;  2Y5B B;  3OAW A;  3R7Q A;  1UBI A;  4KIK A;  2NVU I;  2L0T A;  3ZTD A;  2PE6 B;  2BWF A;  2VRR B;  2ZJD A;  4DHJ B;  1WXS A;  4OVU A;  2GBM A;  2HJ8 A;  4MSM B;  3W1S A;  3H7S A;  2KTR A;  2MLB A;  3JSV A;  2HE7 A;  4MH0 E;  4DDI D;  2N9X A;  2UYZ B;  1XT9 B;  2YLM A;  4IWP A;  5KHO A;  2FCS A;  5AZG A;  1E5W A;  2G45 B;  3PLV A;  3VDZ A;  2MRP A;  2KNB A;  3KYC D;  2AYO B;  3APD A;  3CSF A;  3ZNG C;  2KXJ A;  4HPM B;  2KLG A;  5L95 C;  2LAS A;  4NPN A;  1OEY A;  3GOE A;  3QHT A;  3KUC B;  4BKT A;  2J0M A;  2RR9 A;  4BOZ B;  1WZ0 A;  1Q1O A;  4W9E A;  5E6P A;  3C0R B;  4HCP B;  4W9H A;  2ZNV C;  3N3K B;  2C7N B;  3ZW3 A;  2GBK A;  4I6P A;  3X23 A;  3M62 B;  2YVC A;  4W9D A;  1VD2 A;  2D07 B;  2L7R A;  4II2 B;  3DBS A;  1ZW7 A;  1E7V A;  2O6V D;  3CF6 E;  3GZN I;  2ASQ A;  1P98 A;  5CHF A;  3HK0 A;  2RD0 A;  4GXB A;  3V6E B;  4DHZ B;  2LGD A;  5BO4 B;  1TGZ B;  2CU1 A;  2ZNV B;  3WA0 A;  1V5T A;  1RRB A;  4LDT D;  4MDK E;  1H8C A;  1I42 A;  4KSK C;  1J19 A;  4HDQ A;  1I35 A;  3UIO B;  3PV1 A;  2EMS A;  3QX1 A;  4I6N B;  2MQJ A;  2J7Q B;  2DEN B;  2B3A A;  4HK2 A;  4KIK B;  5IAA C;  1YJ1 A;  4BKS A;  4BOS C;  4FA6 A;  1JRU A;  1WJU A;  4PS3 A;  2XBB C;  2LVP A;  2UWQ A;  4GDK B;  1GNU A;  1TBE A;  2K8B A;  2KDI A;  2KTR B;  1S3S G;  3MJW A;  3PZD A;  4JLC A;  4MJS A;  4E71 A;  5AEK B;  5HKH A;  2NPT B;  1XQQ A;  1LM8 B;  2KDF B;  3PTF C;  2JRH A;  1E7U A;  3NHE B;  4WJQ A;  4A20 A;  4JQW C;  2LGX A;  4EFO A;  4II3 B;  4JL9 A;  2L0F A;  2ZVO A;  2JY6 A;  2RPQ A;  4WWN A;  4MSQ B;  2JVC A;  3WAP A;  4HDO A;  3DBL I;  2BYE A;  4K1R B;  2CS4 A;  4MGK E;  3AU5 A;  4NQL B;  1ZKH A;  3EEC A;  5JHA A;  2MW5 A;  1P1A A;  4KDI C;  2JT4 B;  2BPS A;  1SIF A;  2Z0D B;  2FIF A;  4WWO A;  1UEL A;  2LJ5 A;  2IO0 B;  3R7R A;  1QZE A;  2DZK A;  2FUH B;  2L00 B;  2M1M A;  2NR2 A;  1YX6 B;  2ZVN A;  3L54 A;  1WYW B;  2IO3 B;  2DX5 B;  2FNJ B;  2PJH A;  3A9K B;  1YQB A;  5AZH A;  1EUV B;  2L05 A;  3DQV A;  4G3X B;  4W9L A;  2KK8 A;  4ZDV A;  3VUW A;  2NS5 A;  1OEY J;  1WFY A;  1R4M I;  4AJW A;  2K1F A;  2MBB B;  2XK5 A;  4BKG A;  4EKU A;  3R66 C;  4IC7 B;  2LXC A;  3B1L X;  5JZE B;  4ZRJ A;  2ZCB A;  4IG7 B;  3W1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...