3QHTA

Crystal structure of the monobody ysmb-1 bound to yeast sumo
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
KPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Ubiquitin-like protein SMT3
publication title Isoform-specific monobody inhibitors of small ubiquitin-related modifiers engineered using structure-guided library design.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 20
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3qhtA00
1LXDA 3QHTA 2WX1A 2G4DB 3CSTA 2R2OA 4WQOB 3M62B 3QARA 3VUXA 1D3ZA 2CHXA 4BKTA 3N30A 4ANVA 2XK5A 1WX8A 2ZJDA 4CYEA 4TQ1A 1UELA 4W9EA 2LASA 2XK5B 1E8YA 2KJHB 2M1MA 2W9NA 1WGYA 3CSFA 2FCMA 2KO3A 3PREA 4WJNA 4NJ6A 4AP4C 2RSUA 4EUTA 2LGXA 2KN5A 4B95A 4HK2A 5L83A 1WGHA 2M4NA 3LJ3A 2KMAA 3L08A 3QIJA 2CKHB 3RZFA 5CTRC 4JL9A 3GZNI 3PSEB 4NQLB 3PT2B 4CHKA 3RCZA 5AZGA 3UIPB 2KC1A 3X0WA 2Z0DB 1WZ3A 1SE9A 3JVZX 1C1YB 3WA0A 2KQ7A 1WJNA 3ZNHB 4IWQA 1P9DU 1WX7A 2WWZA 3WIMA 3VTVA 2I1JA 1OGWA 2PJHA 4X57B 3PHWB 5DPWA 3K9PB 5D7GA 3VTWA 1RRBA 3ZKJC 3MJWA 3JSVA 2NR2A 2R2QA 4IWPA 3QK0A 4MGZE 2N9XA 3ZRCA 3A4SC 4BBNC 3RZWC 1X1MA 1R4NI 2PEAA 4BKGA 3X23A 1RAXA 1WE6A 2ZPYA 4MDKE 3VHTC 2LI5A 1MG8A 2JZZA 3WALA 4K7SA 3SU8X 3KYCD 3BY4B 3OAWA 4HXDA 4HLEA 4GXBA 1WM2A 2KVRA 2L0FA 3MTNB 3ENEA 2NBWB 2V1YA 2DX5B 4KZCA 5CX3A 2LWPA 4PYZA 1SIFA 3TJPA 2MA9B 2MBHA 1WMHB 1K8RB 1LM8B 3NHEB 2MCNB 2O2VA 2L3ZA 4W9LA 2RPQA 3KH0A 3IBEA 2KHWB 2NPTA 3MHSD 2KTRA 2LUEA 4NAWA 3SDLC 2O2VB 1E7UA 4FN2A 2CHZA 2KTRB 2N7EA 4NAWB 3V6EB 4KSLC 1KM7A 2L76A 2CS4A 4MEMA 3H9DA 2KDFB 5LXHA 1FXTB 4G11A 1CMXB 2C60A 1A5RA 2JT4B 2D2QA 5DCNA 3ZNZB 2LJ5A 1OEYA 3QJZA 3APDA 4IM0A 3ML8A 3V61A 2EMTA 3ZO5B 2BWES 2IZVB 1UBIA 2WYQA 2B3AA 2BF8B 3DOWA 2EMSA 3R66C 3VTUA 3P2BA 4HVBA 4NQKE 4IM2A 1NBFC 2KOXA 1KJTA 3N32A 1L7YA 4FJVB 5AEKB 3DVGY 3ZVVA 2RGFA 2G45B 4KV2A 2DZJA 3DCGA 3U30A 1YQBA 4EKUA 2CR5A 2GBJA 5CHWA 2FCNA 4M8MA 4PS7A 2MBQA 2LZ6A 4LDTB 3SD5A 3ZLZA 1J0GA 1EO6A 1LQBA 4DK5A 2KNBA 4NNJB 2C5LC 4B6WA 2ZCBA 1ZW7A 4GDKA 1H8CA 4URKA 1I42A 4WJPA 4K7WA 2J7QB 4N9F4 4GIVA 2D10A 2IO3B 2LRUA 2C7NB 2YVCA 2FAZA 4GDLA 2JY6A 4G0NB 3HM3A 2KX3A 2MBBB 5DPRA 3JW0X 4G50A 2FCQA 4TQ0A 2K8HA 3EHVA 2GBKA 1Y8RC 2JXXA 2MLBA 3ONSA 3PGEA 3ZUNA 2RD0A 3VDZA 1P0RA 4RM9A 3DBHI 4BKSA 1UBQA 2OJRA 4KZ0A 3QC8B 3PTFC 5L95C 4ANUA 2ZNVC 4MSQB 1Z2MA 2L8JA 2JVCA 2LXCA 3PZDA 3AU4A 3AXCA 4A20A 2LRWA 3DBLI 3SHQA 3TBLD 2KKCA 3VH3B 3DDCB 2MSED 4CO7A 2AYOB 2KXJA 1NDDA 3AI5A 3IVFA 3UF8A 2FUHB 3B1LX 3PLUA 3DVGX 3H6NA 2M8SA 1RLFA 2LVPA 2L05A 4BBNF 2LD9A 3PV1A 4RMAA 3A4RA 2IO2B 4BVUC 2FNJB 1WGDA 2BKFA 2K8CA 4ASWC 3AU5A 3R7QA 3VUWA 4II3B 1TGZB 1E7VA 2OOBB 1P3QU 4MGIE 4WWOA 5IAAC 4FHJA 1KLVA 2XEWA 4II2B 3VUYA 4JIOU 3W1SC 3H7SA 2K1FA 1C3TA 4HCNB 2HD5B 5E6PA 1H4RA 4WWNA 1BT0A 3A9KA 5JHAA 3L13A 2PPHA 2IO0B 4TV3A 2J0KA 4W9JA 4FLHA 3A9KB 3CF6E 2UYZB 4MJSA 5CHVC 3QA8A 1V2YA 2VRRB 1UD7A 1OQYA 4XC2A 3U8ZA 4BKSD 4MJSB 2KMCA 2NVUI 1XD3B 1YX5B 2C7HA 2REXA 3PVLA 4KVGB 4PS8A 3PRPB 2MWSB 2ZVOA 3Q3FA 1WXAA 2JUOA 1G6JA 1GC6A 3ZRFA 1ISNA 3DVNV 2GBMA 4DHJB 1WIAA 3DPDA 3ZDMC 2BWFA 4KIKB 1WXMA 3RULA 2KANA 5JHBA 4OVVA 5LXIB 4IM3A 3QX1A 1OTRB 3ZDTA 5DPSA 4W9DA 3ZIMA 3UIOB 2KK8A 3ZW3A 3H1UA 3KYDD 4DDID 3TMPB 4HPMB 4A3OA 4GB9A 3NOBA 3O65B 1P1AA 1WMHA 2FIFA 2CHWA 1S3SG 5D94A 1J19A 1WM3A 3RUIB 4JLCA 3EECA 1SGHA 4FHKA 2ZPNA 2N7DA 1M94A 3EC8A 2EKEC 3NZSA 2KC2A 2L0TA 5KHOA 3W1YA 4AUQC 2KX0A 3APCA 4F8CB 4HWIB 3NY5A 1WJ4A 3VH4B 4EZJA 3ZTDA 4HDOA 5KHQA 2K6QA 2CU1A 2KFKB 2J0JA 2RR9A 3KUDB 3Q3JA 4FJZA 1V9JA 1V6EA 1Q0WB 1UZXB 4IUMB 4XX5A 1WY8A 3EFUA 4FADA 1E8ZA 2ZZPB 2ASQA 4DHJD 4AWJA 2AL6A 4JGHB 4MH0E 1S1QB 4TUUA 4G3XB 2MBEA 4EZKA 4DXAB 1JRUA 2K25A 5J18A 4W9HA 3H7PA 2ZNVB 3OJ4B 3VVWB 3N3KB 3PS6A 2G4SA 3H7PB 2KQSA 2N9PC 5IA7A 4PS3A 3T9LA 4I6PA 2BPSA 3PPAA 1I35A 2DYMA 2MQJA 4HJKA 1E8XA 1QZEA 4DHZE 4WJQA 5CHFA 4GU2A 2DZIA 2BGFA 4GN1A 2DZKA 3K9OB 2LXAA 4BFRA 3IFWB 4W9CA 2KWVB 4ICVA 1WFYA 2D3GA 1Q5WB 4E71A 3DBRI 2PE9A 2D11A 3LDZE 4ZRJA 4OVUA 1EUVB 1TTNA 2HTHA 2ZVNA 1OEYJ 4GSWA 3VQIA 1Z5SB 3V62A 4WJOA 2WDTB 3S2AA 1VCBA 2N1WA 4K7UA 5E6OA 3VXWA 3KW5B 1YD8U 3UQBA 4LJPB 4B9KA 4W9KA 4BOZB 4EZLA 3M63B 4ICUA 1UH6A 2AWTA 3L10B 2KJRA 3CMMB 3UGBB 2QHOA 3QWZB 4DBGA 3IHPC 4LDTD 2KD0A 2KLGA 4F7ZA 3PLVA 1XT9B 4DDGD 1WJUA 1J8CA 5AZFA 3V60A 3AULA 4BOSC 2IO1B 3TCAA 2KJ6A 3B0AA 2AEHA 2IBIB 4F1SA 1WJ6A 2LVQA 3I3TB 4FJYA 4K1RB 2BYVE 2KDEB 2M17A 4LJOB 3R3MA 3VAWA 1EF5A 5AZHA 3M95A 4PYUA 3PRMB 3TL5A 3UINB 2GBNA 2DHZA 3L54A 4W9GA 4WAAA 4FA6A 3L0WB 3L16A 2JRIB 2HJ8A 2N4FA 4EFOA 5JZEB 2V4LA 1WYWB 4MSMB 2D07B 4GOCA 4DWFA 4KDLB 2DAFA 2N9EB 3HK0A 4RM8A 2KFJA 4KIKA 2I1KA 1WI0A 3UQAA 1YIWA 2K8BA 4IG7B 2G3QB 4AJWA 1V5TA 3KUCB 5JH5C 2GBRA 1HE8A 2K6DB 2MBOA 4LCDE 1WE7A 3HIZA 1GJZA 2JRHA 1PQSA 2JF5A 3TIXA 3RYTA 5G2NA 5TR5A 2UWQA 5D6JB 2MP2A 2GOWA 2MRPA 5BO4B 2L7RA 1VD2A 4A3PA 2A5UA 1T0YA 2MP2B 2Z59B 4ZRIA 1V81A 3NS8A 3DVNU 2C7MB 2MW5A 2BYFA 2DENB 3ML9A 3WAOA 3DBSA 3ALBA 4NY0A 5G55A 3JSVB 4I6LB 3KUZA 2KTFA 2L00B 4AJYB 1WRDB 1RFAA 5E6NA 1E5WA 2DZMA 4MGKE 3T8MA 4JQWC 1TBEA 4MM3A 4M8NA 4IW0A 2KFKA 4GMVA 3WAMA 2XBBC 5D2MB 4KDIC 4MGYE 2AL3A 4HCPB 2LGYA 1EF1A 2LVOA 1UGMA 2BYEA 4HPLB 4M0WB 4NPNA 4FULA 4TKNA 2GMIC 4E3CA 1E90A 3A9JA 4YL8A 2KLCA 1KOTA 2NPTB 2O6VA 4ANXA 1NI2A 4AOFA 1WGGA 3A9JB 1TZ1A 3IG3A 1IYFA 3DQVA 1WF9A 2O6VB 1P98A 4K81A 2K39A 2ZEQA 1WX9A 1ZKHA 1GNUA 4IC7B 3JYUA 4E74A 3BINA 1F9JA 4W9FA 3R7RA 1AARA 1V5OA 5FR6A 5J17A 3WAPA 3PHXB 2KDBA 2A4ZA 2NCNA 3VFKA 2Y5BB 3QQ8B 1Q1OA 4P7IA 1V49A 2NS5A 4ZRKA 2M0XA 3ECIA 4KSKC 4EEWA 3ZNGC 3OJ3A 3A1QA 3PRZA 4XZ4A 1GC7A 2KWUB 3ZTCA 2C9WB 4IWOA 3KVFB 2NBUA 3A1QB 5C23A 2JZ3B 1IPGA 1V80A 2YLMA 2BKRB 2NBVB 3W1SA 2N1VA 4FBJB 2IY1B 5J2RA 5LLIA 5HKHA 3B08A 2LGDA 1R4MI 4NJ7A 1WXVA 4WWPA 2HE7A 3QCAA 1L2NA 4EOYA 1WR1A 3V6CB 3L17A 2JPHA 3OLMD 2V3SA 5DPTA 4ZYNA 2WX0A 1E8WA 4GDKB 4J6IA 3QAQA 1WGRA 1LFDA 3ZNID 2JWZA 1WH3A 2KZRA 1WXSA 2DAJA 3D32A 1IP9A 1V86A 1WZ0A 4GDLB 2MX2A 4MELA 2IY0B 3M3JA 3HHMA 1YJ1A 4HDQA 3RT3B 2KWCA 5C1ZA 1YX6B 2O6VD 3HM6X 3WANA 2IYDB 4ANWA 5GMVA 3C0RB 2KDIA 5EDSA 4GGQA 3RD2A 2DYBA 2Z0EB 1ZGUB 4DHZB 3NZUA 1WR6E 4ZDVA 2FCSA 3A33B 2ZCCA 3APFA 3GOEA 1U4AA 2J0MA 2PE6B 3U7DA 4I6NB 1XQQA 2FIDA 1GUAB 4W9IA 2DYOA 1GG3A
chains in the Genus database with same CATH superfamily
1ESFA 2W3RA 2G4DB 3CSTA 3M62B 3QARA 3GP7A 2VZKB 1WX8A 2WXFA 1YN4A 1UELA 1E8YA 2M1MA 5H92C 5JXVA 2WXQA 2KN4A 3NRZA 3AM9A 5L83A 2M4NA 1T6BX 3QIJA 1D5MC 5CTRC 3PT2B 1E0ZA 3RCZA 5AZGA 3UIPB 2KC1A 3X0WA 2Z0DB 1WZ3A 2WXGA 3EUB2 3JVZX 2RDBC 1E10A 4TSSA 2KQ7A 1MVKA 2KT7A 1NYRA 3PHWB 3BWUD 2QILA 5D7GA 3UI3A 1RRBA 3ZKJC 4OHJA 4YT0B 2WNMA 3L4PA 1X1MA 4R3DA 2D3CA 2WDRB 3X23A 1RAXA 1FIQA 1SSNA 4XYCA 3NVWA 3KYCD 3BY4B 4GXBA 1ZP0B 3ZJVA 2NBWB 2V1YA 4KZCA 1YMHE 1ET6A 1C4CA 2MA9B 5IKCM 1YN3A 3U7ZA 3MJ5A 2O2VA 1R4NB 3IBEA 3MHSD 1TZOA 4NAWA 1OQQA 2KTRB 4YSZB 2N7EA 4KSLC 2MJEA 1DOIA 5LXHA 2KDFB 1FXTB 2D2QA 1JWSD 3ZNZB 3APDA 2IZVB 2WYQA 1QOAA 3Q69A 4HVBA 3ZJUA 4NQKE 4C4VA 2KOXA 5LNK1 1KJTA 2LEKA 1L7YA 1SB3C 3ZVVA 3MC8A 3TEXA 3U30A 1YQBA 2CR5A 2FCNA 2MBQA 3ZLZA 1HTOA 4DK5A 2KNBA 4GDKA 4K7WA 3TEZA 3VRAB 2JYTA 2RD0A 4D2KA 4BKSA 4HKQA 1UBQA 2OJRA 4A20A 4ZHOA 2PMVA 2MSED 5AUKA 2FUHB 3PO0A 2WS3B 2QMTA 3AEDB 4YSXB 4BBNF 3PV1A 1YQ4B 2KACA 2WGSA 2K8CA 4QAYA 1E7VA 2KAJA 2X38A 1P7EA 2M56B 2K1FA 4HCNB 4WWNA 4KKJA 2QCZA 3A9KA 3VRBB 4C7YA 5BMHA 3L13A 2PPHA 1QOGA 4FLHA 2N0SB 1V2YA 1TIFA 2VRRB 3N20C 4BKSD 3MP9A 2NVUI 1XD3B 2C7HA 2REXA 3E9SA 3PRPB 3Q3FA 3ZRFA 1ISNA 2GBMA 3B9JA 3FKYA 2KANA 5LXIB 1K50A 2IPKD 3ZDTA 5DPSA 5HFYA 1TS5A 1E7PB 3KYDD 3TMPB 1L0VB 1YQ3B 3RUIB 5D94A 1VZ6A 1M94A 1MFWA 2KC2A 1D5XC 2L0TA 5KHOA 3W1YA 4EZJA 5C3JB 3R2TA 2WXLA 2KFKB 2RR9A 1V9JA 4FADA 2RPVA 2ZZPB 3RNAC 4MH0E 3SEBA 2MBEA 4DXAB 2K25A 5J18A 2NMQA 3H7PA 1TS3A 2G4SA 2BS4B 2KQSA 2MQJA 2PTLA 4DHZE 4WJQA 2IGGA 2E3TA 1VLBA 1N60A 2D3GA 1Q5WB 1V1PB 2TSSA 4WH4A 2QDFA 3AEFB 4OVUA 1EUVB 2HTHA 4GSWA 4WJOA 2WDTB 2L52A 5E6OA 4K7UA 3VXWA 2ONQA 3KW5B 4CQNA 3W5VB 3RMKC 4B9KA 4BOZB 4C7ZA 4REZA 2ON8A 4ICUA 3L10B 2W55A 1SBBB 2IO1B 3TCAA 3O13A 1WJ6A 1XLNA 2BYVE 2E6XA 2M17A 4AS1A 3L54A 4W9GA 4WAAA 1ZE3D 2N4FA 4LNNA 2DBYA 4GOCA 1MHXA 1SEBD 1XLQA 1WI0A 3UQAA 2K8BA 4AJWA 1V5TA 3DWMA 1ZXHA 4LCDE 2OHFA 3ETRA 1GB4A 1PQSA 5TR5A 2MRPA 1EU3A 1VR9A 2M19A 3BYYB 1V81A 3DVNU 2D3AA 1L6UA 2C7MB 2MW5A 2BYFA 1JALA 2WXRA 1RFAA 3AH7A 3R2IA 2OJWA 2KFKA 3WAMA 1I4GA 2XBBC 5D2MB 2K0PA 3NUHB 3I63C 4RF1A 1I4HA 4M0WB 3AV8A 1UUPA 2HTME 2L32A 1K51A 1NI2A 3V05A 1TZ1A 1I4PA 1IYFA 2FBWB 3DQVA 1WF9A 2ZEQA 3IAM1 1GNUA 2BB6A 4IC7B 1F2RC 3WAPA 2A4ZA 2NCNA 1FFVA 2Y5BB 1Q1OA 3FILB 5FK9C 3T3NA 2VH2A 1PDXA 1XO3A 3W1SA 2CJOA 4YTPB 2IY1B 5IOIA 4M02A 2QIEB 1WXVA 4WWPA 2HE7A 3ZXRA 3L17A 2JPHA 3OLMD 3ABVB 4J6IA 3HHMA 2KDMA 1YJ1A 3U52E 1R4MB 3AE2B 4GGQA 1XF5L 1MJDA 4DHZB 1F0ZA 1F77A 4ZHPA 2PE6B 3U7DA 1T0YA 1GUAB 1GG3A 1EWYC 2CHXA 2XK5A 2ZJDA 4CYEA 2W54A 2WU2B 1GJZA 3CSFA 2KJHB 2W9NA 2FCMA 1VJKA 2KO3A 3VR9B 4NJ6A 1WGKA 2RSUA 4AP4C 2KN5A 1ACCA 1WYGA 1WGHA 5EE9A 3LJ3A 2KMAA 4RH6A 1PUTA 2K5PA 4JL9A 4NQLB 4ZRPA 1SE9A 1D4BA 3ZNHB 2FE8A 4IWQA 1JCKB 1F2RI 3GS2A 5DPWA 3VTWA 2LHDA 2H89B 2R2QA 3QK0A 4P1CC 3P4RB 1PGXA 2ICIA 4OZBA 2ZPYA 4MDKE 3AEGB 1XEEA 3OAWA 1ENFA 2YEPF 1WM2A 4WIPA 2NTTA 2KVRA 2L0FA 2YEPB 4M0WA 3ENEA 1J7CA 1PFDA 2LWPA 3TJPA 2MBHA 1WMHB 3NVZA 1K8RB 1TYGB 4LLGM 3SDLC 2LUEA 3HUIA 2O2VB 4FN2A 3R8BA 2ACZB 4NAWB 3WCQA 3V6EB 3BK1A 4N6EB 2JT4B 1Y56A 1OEYA 3QJZA 5FKAC 3ML8A 2SAKA 4HKZE 2BWES 1DOYA 3R66C 4US8A 4OVZA 3RNFC 4MH8A 3DVGY 4C4VB 2G45B 2KQ4X 4KV2A 2GBJA 4LDTB 1J0GA 1EO6A 4J3OD 1UGJA 2JQRB 2ZCBA 3LYYA 1ZW7A 4URKA 3H8HA 2FAZA 3N1XC 2JY6A 1JWMD 2HJ1A 4G0NB 2KX3A 2MBBB 1K52A 4G50A 1AWDA 3I57A 2K8HA 2EKIA 2GBKA 1SE3A 2MLBA 3ONSA 4H2AA 1C9FA 3PGEA 4RGOS 2WHIA 4XE0A 4RM9A 1VDVA 3DBHI 4KZ0A 5L95C 1PYWD 4ANUA 2ZNVC 4RGTA 3PZDA 3AXCA 2LRWA 3DBLI 5GXGB 2JWUA 2MHJA 2KXJA 3CIRB 1NDDA 3B1LX 2I2YA 2AQ1B 1TKEA 2LD9A 4RMAA 4BVUC 2J42A 3A4RA 4HPPA 3PZ7A 4ASWC 2WXNA 4MGIE 5EE3A 3W2DA 2XEWA 3VUYA 2PW9A 1C3TA 4WQMA 2HD5B 5E6PA 3AE5B 1C4AA 4W9JA 3A9KB 2OEDA 2UYZB 4MJSA 5CHVC 1FD6A 1UD7A 3U8ZA 3PVLA 1DYQA 1D6EC 1YOVB 2ZVOA 2JUOA 1GC6A 1KRHA 3DVNV 1FMAD 1A70A 5JHBA 1AW7A 1ZDXA 3QX1A 3SFEB 3ZIMA 3ZW3A 3HVDA 1IGCA 1WMHA 1SGHA 2ZPNA 4ZRQA 2EKEC 4AUQC 3APCA 4P16A 3J9CA 3AECB 1J7AA 2WXHA 3VH4B 1QT9A 1B1ZA 3KUDB 3Q3JA 1FPYA 4IKGA 5G5HA 4XX5A 1E8ZA 4JGHB 1B9RA 1UF0A 1S1QB 4TUUA 3FAHA 4EZKA 3FC4A 3OJ4B 3VVWB 3N3KB 3BVMA 3PS6A 3H7PB 3TEWA 5IA7A 5D3IB 4I6PA 2J4XA 2INCC 3GE8C 1I35A 1YJIA 2J52A 4GN1A 2KWVB 1DOXA 2JZPA 1NYQA 4IDIA 3BK2A 1TTNA 3MC9A 2HDEA 3V62A 3RNEC 5D3DA 3AE4B 1VCBA 1T3QA 1ZXIA 2LMCA 3ZJTA 3M63B 3DHGC 2AWTA 3UGBB 2QHOA 4PT5A 4LDTD 2K9XA 2KLGA 4F7ZA 1XT9B 3RNCC 1SF0A 1XLOA 3V60A 3BYTB 1FRDA 3B0AA 1D5ZC 4K1RB 4FJYA 4JWSC 1EF5A 5AZHA 2D3BA 1T0RC 2GBNA 2DHZA 4FA6A 4C00A 3BVGA 4KDLB 2WP9B 3KWLA 3HK0A 4RM8A 1RYJA 1DGJA 1YIWA 4YWGG 5JH5C 2GBRA 1HE8A 2ZW0A 3HIZA 1ET9A 2JRHA 5D6JB 2GOWA 5H8YE 1EM7A 3NS8A 2DENB 4XGAB 4NY0A 5G55A 3JSVB 2KTFA 2L00B 1EU4A 5E6NA 3I9V1 4MGKE 3T8MA 4JQWC 4PK1A 2Z8LA 1ZDVA 4GMVA 2M0AA 2LGYA 3AE6B 2R61A 4HPLB 1T0SC 4EE2A 4P6VF 2JSVX 4US9A 4E3CA 2NPTB 2WXIA 3IG3A 2JXTA 3N1YC 1P98A 1SJED 4OZAA 4E74A 3BINA 3R7RA 1EWCA 3PHXB 2KDBA 2PKOA 4P7IA 1FO4A 1V49A 2M0XA 2XNAC 3AN1A 4EEWA 3A1QA 1TS2A 1AYFA 3Q8AA 3ZTCA 2C9WB 5C23A 1V1OA 2JZ3B 2EELA 2NBVB 4FBJB 3U4EG 5LLIA 3B08A 3P42A 2UU7A 2Y3AA 4NJ7A 4JWUC 3V6CB 3U2SC 2W82A 5DPTA 1Q10A 3RN9C 2INPE 1E8WA 3NVVA 1LFDA 3TUOA 1WH3A 2AX5A 2KZRA 3TEYA 1WZ0A 4GDLB 3NS1A 3M3JA 3CWIA 2AQ2B 2KWCA 5C1ZA 2IYDB 5GMVA 3C0RB 3KLSX 4MT5A 2DYBA 3URYA 2Z0EB 1ZGUB 1YJJA 4ZDVA 2FCSA 4XDCA 2N9KA 3IXSA 2MJDA 3AE1B 1XQQA 2FIDA 3GZNI 2DYOA 2N9LA 3QHTA 2WX1A 3VUXA 2R2OA 4BKTA 4ANVA 4TQ1A 1QKZA 4W9EA 2LASA 2XK5B 3PREA 4YSYB 4WJNA 4EUTA 2CU3A 4M01A 4HK2A 2N7JA 1XCQL 5BYQA 3RZFA 1KFYB 1FCCC 4CHKA 1HZ5A 1C1YB 2NTSA 2WWZA 3WIMA 2I1JA 2CJNA 4LNKA 3K9PB 2H88B 3JSVA 4MGZE 3ZRCA 2RMMA 3A4SC 4JX1C 4RGMA 4S0RA 3RZWC 3MFGA 2GLSA 4BKGA 1WE6A 3Q2AC 2WLBA 3WALA 4K7SA 3SU8X 4KGTA 4A9AA 2BBCA 1RFKA 1UWXA 5T8IA 5CX3A 2WXKA 3Q8EA 1LM8B 2W3SA 3NHEB 2MCNB 2L3ZA 3NZ3A 2RPQA 2NPTA 4ACFA 1TY0A 1KM7A 2L76A 4MEMA 1JWUD 3H9DA 1UNSA 4G11A 2LJ5A 1OFFA 4IM0A 1T0QC 3ZYYX 2EMTA 3DOWA 4ITKA 2B3AA 2BF8B 4O1NA 4BAXA 1QILA 3VTUA 3P2BA 1VZ8A 1E9MA 4YTNB 1JW9D 4LNIA 3NVYA 3N32A 4FJVB 2DZJA 3DCGA 4PS7A 2LZ6A 3SD5A 1LQBA 4B6WA 1H8CA 1C77A 2J7QB 4N9F4 2D10A 4GDLA 2LRUA 2C7NB 4RCOA 1HQRD 3JW0X 4HRSA 2FCQA 3HVZA 4TQ0A 1Y8RC 2XN9C 5G5GA 1P0RA 3P63A 3QC8B 2LJIA 2L8JA 4K3CA 2LXCA 4NZLB 1L5PA 3AU4A 4DXGA 3SHQA 2KKCA 3VH3B 3DDCB 4CO7A 1TS4A 1T5XD 4HEA1 3UF8A 3PLUA 3DVGX 3DBHB 3Q8BA 3V3XA 1YN5A 2B76B 2FNJB 2BKFA 4II3B 3DBLB 1LGRA 2OOBB 1WSPA 1P3QU 5IAAC 4WWOA 1VZ7A 4N59A 3PZ8A 3SR6A 4ARIA 2GB1A 1H4RA 1BT0A 3ZGZA 2IO0B 2IGDA 4RGNA 4TV3A 1L6VA 2BS3B 3CF6E 3NG0A 3QA8A 1OQYA 1L4DB 4MJSB 4PS8A 4KVGB 2MWSB 4ZOHC 1C79A 1WXAA 1G6JA 1RWSA 1WIAA 1QLBB 2BWFA 4KIKB 1WXMA 3RULA 1GB1A 1TJEA 3P4QB 2BB5A 4IM3A 1ZOYB 3LXFA 4W9DA 3UIOB 4JPSA 4HPMB 2WDVB 1OQRA 2LHEA 4GB9A 3NOBA 3OG5A 1P1AA 4WWMA 1J19A 1WM3A 4JLCA 1HTQA 2N7DA 2Q5WD 3EC8A 4F1SA 2X8XX 2KX0A 1WJ4A 4HDOA 5BYRA 2L1AA 5E6JA 2CU1A 2IDYA 2J0JA 5C2TB 1UZXB 4IUMB 3EFUA 4DHJD 1XCTL 1JRUA 4W9HA 2ZNVB 1KTKA 4PS3A 3T9LA 1FEHA 2BPSA 2DYMA 1E8XA 1QZEA 1MPEA 5CHFA 2DZIA 2BGFA 4BFRA 4UDUC 3IFWB 4W9CA 4N58A 1WFYA 1LO5D 4KX6B 2LGSA 1BXTA 4E71A 3DBRI 3AEEB 3LDZE 2LGIA 2ZVNA 3AEBB 1OEYJ 3VQIA 1Z5SB 3T3OA 4RFBA 2AQ3B 3S2AA 2D5GA 1J7BA 1YD8U 3P4SB 3UQBA 4LJPB 1FXAA 3RFZB 4W9KA 1XLPA 1FCLA 2KJRA 4DBGA 3QWZB 1N63A 3IHPC 2SEBD 3NJTA 1J8CA 3AULA 3KQ4A 1MHHE 2KJ6A 2AEHA 2IBIB 2LVQA 3VAWA 4LJOB 3R3MA 4PYUA 2FUG1 4WURA 4MACA 3L0WB 2HJ8A 4EFOA 5JZEB 1K53A 2V4LA 4MSMB 2QC8A 4RF0A 2PLPA 2MJ3A 3DWGC 2KFJA 1HXYD 1HA5A 4KIKA 3C19A 2G9HD 3KUCB 3RNBC 4ARCA 2K6DB 1WE7A 3TIXA 1P7FA 3RYTA 2MH7A 5G2NA 2MP2A 5BO4B 2L7RA 5BMIA 1VD2A 2V3NA 1L0XB 2A5UA 2WU5B 4ZRIA 2KYWA 3Q3MC 5IO9A 3ML9A 3WAOA 3BZDB 3DBSA 3Q8FA 2KVZA 4I6LB 3DHIC 1V8CA 1WRDB 1E5WA 1TBEA 1GOZA 1TT5B 4C56C 1YNTE 2QSDA 2AL3A 1KH0A 1UGMA 2JX5A 1STEA 4FULA 4TKNA 2GMIC 1E90A 3A9JA 4YL8A 2KLCA 2O6VA 4HROA 1WGGA 1QQRA 4K81A 2K39A 1WX9A 1ZKHA 1F9JA 4W9FA 5MPOA 1AARA 5J17A 3N9YC 1V97A 2V4IB 1JWBD 4ZRKA 3BVZA 4KSKC 1SXTA 3AMZA 4IWOA 3AEAB 2NBUA 3A1QB 1V80A 3RNGC 2BKRB 5J2RA 1N61A 5HKHA 3KWVA 4M00A 2DLBA 4OZCA 1WR1A 2BW2A 2PVGC 2V3SA 2WX0A 3Q8CA 3QAQA 1WGRA 4RNAA 4XWTA 2JWZA 2DAJA 1IBXA 2MX2A 4MELA 3RT3B 1JROA 1YX6B 2O6VD 3WANA 4ANWA 4A55A 2BT6A 1KLGD 2KDIA 5EDSA 2INNE 4DQOC 1WR6E 1AN8A 3A33B 1C4PA 2ZCCA 3GOEA 1KF6B 1ZPSA 1EF1A 5FR3A 1LXDA 1D3ZA 1ROEA 4WQOB 4BZAA 3N30A 5IP4D 1RM6C 4IOIE 5IN7A 1L2NA 1TY2A 1WGYA 1KLUD 3MHZA 3BIID 2LGXA 4B95A 2KMMA 2IGHA 5HHDG 4ZYSA 3GZNB 3L08A 2CKHB 2LUMA 4WAFA 3PSEB 1N5WA 1CQVA 3WA0A 3W5UB 1WJNA 1FFUA 1JMLA 4A6QA 1P9DU 1C76A 1WX7A 3RI7C 1BMLC 3VTVA 1OGWA 2PJHA 4X57B 1SIJA 3MJWA 2NR2A 4IWPA 2N9XA 1JWAD 4XWWA 4BBNC 1TKGA 2VZKD 3Q3NC 1R4NI 1FNWA 2MEKA 2GI9A 2PEAA 3VHTC 2LI5A 1MG8A 2JZZA 1PGAA 4HXDA 4HLEA 1CJEA 2Y5CA 2K3UA 3MTNB 4LTUA 2DX5B 4P1BC 4PYZA 1SIFA 2WDQB 4W9LA 3KH0A 2KHWB 2KTRA 1E7UA 3Q14C 2CHZA 2WQYB 2CS4A 3MC0B 1CMXB 1L0YB 2C60A 1A5RA 5DCNA 3V61A 3ZO5B 1UBIA 1MG4A 2EMSA 3LB8C 4IM2A 1NBFC 5AEKB 2RGFA 4EKUA 2IJ0A 5EE0A 1QOFA 3I5JC 4M8MA 5CHWA 4A8XC 1CZPA 3EFCA 4NNJB 4W9IA 2C5LC 3HRDD 1M4VA 1HZ6A 1I42A 4KGRA 4WJPA 2PIAA 4GIVA 2IO3B 2YVCA 1FXIA 3HM3A 5DPRA 3EHVA 2JXXA 3ZUNA 1C78A 2BYTA 3VDZA 1N6ZA 2WXOA 3PTFC 2WXJA 4AQ7A 1XXGA 3EA6A 4MSQB 1Z2MA 4Q2JA 2JVCA 1UWMA 2BQQA 3TBLD 1GPXA 2AYOB 3AI5A 3IVFA 3C8YA 2M8SA 1RLFA 3H6NA 2LVPA 5EE1A 2L05A 2IO2B 2K22A 1WGDA 3AU5A 2KWDA 3R7QA 3VUWA 1TGZB 3AE7B 3AE9B 4FHJA 4S17A 1KLVA 1VRAB 3W1SC 1SE4A 4II2B 4JIOU 3H7SA 5JHAA 2J0KA 1F1HA 1E6EB 4XC2A 2KMCA 1N5XA 1YX5B 1SJHD 4XDDA 5AUIA 1TKYA 4DHJB 1NI3A 3ZDMC 3DPDA 4OVVA 2QJLA 3EGRA 1OTRB 2KK8A 3H1UA 4DDID 2ZW1A 4L23A 2V0GA 4B0MA 4A3OA 3O65B 2FIFA 1SE2A 5TSSA 2CHWA 1S3SG 3EECA 4FHKA 4C80A 3DHHC 3NZSA 4F8CB 2JU6X 4HWIB 3NY5A 3ZTDA 4KKIA 5KHQA 4LNFA 4MM3B 1GAQB 2K6QA 1I4RA 4NJCA 4FJZA 1V6EA 1Q0WB 1JRPA 1WY8A 2ASQA 4AWJA 3RPFC 2AL6A 3IT4B 4NAMA 1QOBA 4G3XB 2WXMA 4HJGE 1IGDA 2RDGA 1I7HA 4B0EA 1FM0D 1R7SA 3SFDB 1NVID 2N9PC 4A90A 3PPAA 3AE3B 4HJKA 3AE8B 4GU2A 3VR8B 2PVOD 2DZKA 3K9OB 2LXAA 1V1PA 2GRIA 3N1ZC 4ICVA 1MI0A 4LNOA 2PE9A 2D11A 4ZRJA 1JQ4A 2L83A 3ZQ4A 5BMGA 1WWTA 3P4PB 2N1WA 4L2YA 2V9HA 1ZUD2 1F52A 1I4XA 4EZLA 3DBRB 3AB5A 1UH6A 3CMMB 2KD0A 3PLVA 4DDGD 1WJUA 4K3BA 5AZFA 2VH1A 4BOSC 4KGSA 1WRIA 4YTMB 3I3TB 2KDEB 2QEJC 3M95A 3TL5A 3PRMB 3UINB 4JE3B 3L16A 2JRIB 3Q6BA 5BYSA 1WYWB 2D07B 4DWFA 2RDHA 2LFIA 2DAFA 2N9EB 4LK0M 1I4QA 2I1KA 3GE3C 4OW0A 4IG7B 2G3QB 1WXQA 4DXFA 2MBOA 2JYEA 1FNVA 2JF5A 2UWQA 4A3PA 4FXCA 2MP2B 2Z59B 1IUEA 3IT6B 3W9CB 3ALBA 3KUZA 5I4DA 1PGBA 4AJYB 2Y5PA 4YXDB 2DZMA 4MM3A 4M8NA 1FNUA 4IW0A 4KDIC 4MGYE 4HCPB 3OWEB 2LVOA 3ZXVA 2BYEA 4NPNA 3IAS1 4L1BA 1KOTA 4USAA 4ANXA 4AOFA 1CK1A 3A9JB 2V3PA 1QF6A 2O6VB 3GB1A 3P1MA 3B2FA 3JYUA 2BVCA 3FILA 1V5OA 5FR6A 1FRRA 3VFKA 2I38A 1HEZE 3E56A 3QQ8B 2NS5A 3ECIA 3ZNGC 3OJ3A 4XZ4A 3PRZA 1GC7A 2KWUB 3KVFB 2BS2B 2DNFA 4GLSC 2DWQA 1IPGA 2YLMA 2N1VA 1L4ZB 2LGDA 2J53A 1R4MI 3Q3OC 3QCAA 1NENB 4EOYA 3B2GA 4ZYNA 4GDKB 5HG2A 3ZNID 1WXSA 3D32A 1IP9A 1V86A 2WXPA 1NEKB 2IY0B 4TMAB 2BTEA 4HDQA 1IBXB 5HI1A 3HM6X 3RD2A 1N62A 3NZUA 3TSSA 3APFA 1U4AA 2J0MA 4I6NB 1BUIC 2G1EA 2INDC
chains in the Genus database with same CATH topology
1LXDA 3QHTA 2WX1A 2G4DB 3CSTA 2R2OA 4WQOB 3M62B 3QARA 3VUXA 1D3ZA 2CHXA 4BKTA 3N30A 4ANVA 2XK5A 1WX8A 2ZJDA 4CYEA 4TQ1A 1UELA 4W9EA 2LASA 2XK5B 1E8YA 2KJHB 2M1MA 2W9NA 1WGYA 3CSFA 2FCMA 2KO3A 3PREA 4WJNA 4NJ6A 4AP4C 2RSUA 4EUTA 2LGXA 2KN5A 4B95A 4HK2A 5L83A 1WGHA 2M4NA 3LJ3A 2KMAA 3L08A 3QIJA 2CKHB 3RZFA 5CTRC 4JL9A 3GZNI 3PSEB 4NQLB 3PT2B 4CHKA 3RCZA 5AZGA 3UIPB 2KC1A 3X0WA 2Z0DB 1WZ3A 1SE9A 3JVZX 1C1YB 3WA0A 2KQ7A 1WJNA 3ZNHB 4IWQA 1P9DU 1WX7A 2WWZA 3WIMA 3VTVA 2I1JA 1OGWA 2PJHA 4X57B 3PHWB 5DPWA 3K9PB 5D7GA 3VTWA 1RRBA 3ZKJC 3MJWA 3JSVA 2NR2A 2R2QA 4IWPA 3QK0A 4MGZE 2N9XA 3ZRCA 3A4SC 4BBNC 3RZWC 1X1MA 1R4NI 2PEAA 4BKGA 3X23A 1RAXA 1WE6A 2ZPYA 4MDKE 3VHTC 2LI5A 1MG8A 2JZZA 3WALA 4K7SA 3SU8X 3KYCD 3BY4B 3OAWA 4HXDA 4HLEA 4GXBA 1WM2A 2KVRA 2L0FA 3MTNB 3ENEA 2NBWB 2V1YA 2DX5B 4KZCA 5CX3A 2LWPA 4PYZA 1SIFA 3TJPA 2MA9B 2MBHA 1WMHB 1K8RB 1LM8B 3NHEB 2MCNB 2O2VA 2L3ZA 4W9LA 2RPQA 3KH0A 3IBEA 2KHWB 2NPTA 3MHSD 2KTRA 2LUEA 4NAWA 3SDLC 2O2VB 1E7UA 4FN2A 2CHZA 2KTRB 2N7EA 4NAWB 3V6EB 4KSLC 1KM7A 2L76A 2CS4A 4MEMA 3H9DA 2KDFB 5LXHA 1FXTB 4G11A 1CMXB 2C60A 1A5RA 2JT4B 2D2QA 5DCNA 3ZNZB 2LJ5A 1OEYA 3QJZA 3APDA 4IM0A 3ML8A 3V61A 2EMTA 3ZO5B 2BWES 2IZVB 1UBIA 2WYQA 2B3AA 2BF8B 3DOWA 2EMSA 3R66C 3VTUA 3P2BA 4HVBA 4NQKE 4IM2A 1NBFC 2KOXA 1KJTA 3N32A 1L7YA 4FJVB 5AEKB 3DVGY 3ZVVA 2RGFA 2G45B 4KV2A 2DZJA 3DCGA 3U30A 1YQBA 4EKUA 2CR5A 2GBJA 5CHWA 2FCNA 4M8MA 4PS7A 2MBQA 2LZ6A 4LDTB 3SD5A 3ZLZA 1J0GA 1EO6A 1LQBA 4DK5A 2KNBA 4NNJB 2C5LC 4B6WA 2ZCBA 1ZW7A 4GDKA 1H8CA 4URKA 1I42A 4WJPA 4K7WA 2J7QB 4N9F4 4GIVA 2D10A 2IO3B 2LRUA 2C7NB 2YVCA 2FAZA 4GDLA 2JY6A 4G0NB 3HM3A 2KX3A 2MBBB 5DPRA 3JW0X 4G50A 2FCQA 4TQ0A 2K8HA 3EHVA 2GBKA 1Y8RC 2JXXA 2MLBA 3ONSA 3PGEA 3ZUNA 2RD0A 3VDZA 1P0RA 4RM9A 3DBHI 4BKSA 1UBQA 2OJRA 4KZ0A 3QC8B 3PTFC 5L95C 4ANUA 2ZNVC 4MSQB 1Z2MA 2L8JA 2JVCA 2LXCA 3PZDA 3AU4A 3AXCA 4A20A 2LRWA 3DBLI 3SHQA 3TBLD 2KKCA 3VH3B 3DDCB 2MSED 4CO7A 2AYOB 2KXJA 1NDDA 3AI5A 3IVFA 3UF8A 2FUHB 3B1LX 3PLUA 3DVGX 3H6NA 2M8SA 1RLFA 2LVPA 2L05A 4BBNF 2LD9A 3PV1A 4RMAA 3A4RA 2IO2B 4BVUC 2FNJB 1WGDA 2BKFA 2K8CA 4ASWC 3AU5A 3R7QA 3VUWA 4II3B 1TGZB 1E7VA 2OOBB 1P3QU 4MGIE 4WWOA 5IAAC 4FHJA 1KLVA 2XEWA 4II2B 3VUYA 4JIOU 3W1SC 3H7SA 2K1FA 1C3TA 4HCNB 2HD5B 5E6PA 1H4RA 4WWNA 1BT0A 3A9KA 5JHAA 3L13A 2PPHA 2IO0B 4TV3A 2J0KA 4W9JA 4FLHA 3A9KB 3CF6E 2UYZB 4MJSA 5CHVC 3QA8A 1V2YA 2VRRB 1UD7A 1OQYA 4XC2A 3U8ZA 4BKSD 4MJSB 2KMCA 2NVUI 1XD3B 1YX5B 2C7HA 2REXA 3PVLA 4KVGB 4PS8A 3PRPB 2MWSB 2ZVOA 3Q3FA 1WXAA 2JUOA 1G6JA 1GC6A 3ZRFA 1ISNA 3DVNV 2GBMA 4DHJB 1WIAA 3DPDA 3ZDMC 2BWFA 4KIKB 1WXMA 3RULA 2KANA 5JHBA 4OVVA 5LXIB 4IM3A 3QX1A 1OTRB 3ZDTA 5DPSA 4W9DA 3ZIMA 3UIOB 2KK8A 3ZW3A 3H1UA 3KYDD 4DDID 3TMPB 4HPMB 4A3OA 4GB9A 3NOBA 3O65B 1P1AA 1WMHA 2FIFA 2CHWA 1S3SG 5D94A 1J19A 1WM3A 3RUIB 4JLCA 3EECA 1SGHA 4FHKA 2ZPNA 2N7DA 1M94A 3EC8A 2EKEC 3NZSA 2KC2A 2L0TA 5KHOA 3W1YA 4AUQC 2KX0A 3APCA 4F8CB 4HWIB 3NY5A 1WJ4A 3VH4B 4EZJA 3ZTDA 4HDOA 5KHQA 2K6QA 2CU1A 2KFKB 2J0JA 2RR9A 3KUDB 3Q3JA 4FJZA 1V9JA 1V6EA 1Q0WB 1UZXB 4IUMB 4XX5A 1WY8A 3EFUA 4FADA 1E8ZA 2ZZPB 2ASQA 4DHJD 4AWJA 2AL6A 4JGHB 4MH0E 1S1QB 4TUUA 4G3XB 2MBEA 4EZKA 4DXAB 1JRUA 2K25A 5J18A 4W9HA 3H7PA 2ZNVB 3OJ4B 3VVWB 3N3KB 3PS6A 2G4SA 3H7PB 2KQSA 2N9PC 5IA7A 4PS3A 3T9LA 4I6PA 2BPSA 3PPAA 1I35A 2DYMA 2MQJA 4HJKA 1E8XA 1QZEA 4DHZE 4WJQA 5CHFA 4GU2A 2DZIA 2BGFA 4GN1A 2DZKA 3K9OB 2LXAA 4BFRA 3IFWB 4W9CA 2KWVB 4ICVA 1WFYA 2D3GA 1Q5WB 4E71A 3DBRI 2PE9A 2D11A 3LDZE 4ZRJA 4OVUA 1EUVB 1TTNA 2HTHA 2ZVNA 1OEYJ 4GSWA 3VQIA 1Z5SB 3V62A 4WJOA 2WDTB 3S2AA 1VCBA 2N1WA 4K7UA 5E6OA 3VXWA 3KW5B 1YD8U 3UQBA 4LJPB 4B9KA 4W9KA 4BOZB 4EZLA 3M63B 4ICUA 1UH6A 2AWTA 3L10B 2KJRA 3CMMB 3UGBB 2QHOA 3QWZB 4DBGA 3IHPC 4LDTD 2KD0A 2KLGA 4F7ZA 3PLVA 1XT9B 4DDGD 1WJUA 1J8CA 5AZFA 3V60A 3AULA 4BOSC 2IO1B 3TCAA 2KJ6A 3B0AA 2AEHA 2IBIB 4F1SA 1WJ6A 2LVQA 3I3TB 4FJYA 4K1RB 2BYVE 2KDEB 2M17A 4LJOB 3R3MA 3VAWA 1EF5A 5AZHA 3M95A 4PYUA 3PRMB 3TL5A 3UINB 2GBNA 2DHZA 3L54A 4W9GA 4WAAA 4FA6A 3L0WB 3L16A 2JRIB 2HJ8A 2N4FA 4EFOA 5JZEB 2V4LA 1WYWB 4MSMB 2D07B 4GOCA 4DWFA 4KDLB 2DAFA 2N9EB 3HK0A 4RM8A 2KFJA 4KIKA 2I1KA 1WI0A 3UQAA 1YIWA 2K8BA 4IG7B 2G3QB 4AJWA 1V5TA 3KUCB 5JH5C 2GBRA 1HE8A 2K6DB 2MBOA 4LCDE 1WE7A 3HIZA 1GJZA 2JRHA 1PQSA 2JF5A 3TIXA 3RYTA 5G2NA 5TR5A 2UWQA 5D6JB 2MP2A 2GOWA 2MRPA 5BO4B 2L7RA 1VD2A 4A3PA 2A5UA 1T0YA 2MP2B 2Z59B 4ZRIA 1V81A 3NS8A 3DVNU 2C7MB 2MW5A 2BYFA 2DENB 3ML9A 3WAOA 3DBSA 3ALBA 4NY0A 5G55A 3JSVB 4I6LB 3KUZA 2KTFA 2L00B 4AJYB 1WRDB 1RFAA 5E6NA 1E5WA 2DZMA 4MGKE 3T8MA 4JQWC 1TBEA 4MM3A 4M8NA 4IW0A 2KFKA 4GMVA 3WAMA 2XBBC 5D2MB 4KDIC 4MGYE 2AL3A 4HCPB 2LGYA 1EF1A 2LVOA 1UGMA 2BYEA 4HPLB 4M0WB 4NPNA 4FULA 4TKNA 2GMIC 4E3CA 1E90A 3A9JA 4YL8A 2KLCA 1KOTA 2NPTB 2O6VA 4ANXA 1NI2A 4AOFA 1WGGA 3A9JB 1TZ1A 3IG3A 1IYFA 3DQVA 1WF9A 2O6VB 1P98A 4K81A 2K39A 2ZEQA 1WX9A 1ZKHA 1GNUA 4IC7B 3JYUA 4E74A 3BINA 1F9JA 4W9FA 3R7RA 1AARA 1V5OA 5FR6A 5J17A 3WAPA 3PHXB 2KDBA 2A4ZA 2NCNA 3VFKA 2Y5BB 3QQ8B 1Q1OA 4P7IA 1V49A 2NS5A 4ZRKA 2M0XA 3ECIA 4KSKC 4EEWA 3ZNGC 3OJ3A 3A1QA 3PRZA 4XZ4A 1GC7A 2KWUB 3ZTCA 2C9WB 4IWOA 3KVFB 2NBUA 3A1QB 5C23A 2JZ3B 1IPGA 1V80A 2YLMA 2BKRB 2NBVB 3W1SA 2N1VA 4FBJB 2IY1B 5J2RA 5LLIA 5HKHA 3B08A 2LGDA 1R4MI 4NJ7A 1WXVA 4WWPA 2HE7A 3QCAA 1L2NA 4EOYA 1WR1A 3V6CB 3L17A 2JPHA 3OLMD 2V3SA 5DPTA 4ZYNA 2WX0A 1E8WA 4GDKB 4J6IA 3QAQA 1WGRA 1LFDA 3ZNID 2JWZA 1WH3A 2KZRA 1WXSA 2DAJA 3D32A 1IP9A 1V86A 1WZ0A 4GDLB 2MX2A 4MELA 2IY0B 3M3JA 3HHMA 1YJ1A 4HDQA 3RT3B 2KWCA 5C1ZA 1YX6B 2O6VD 3HM6X 3WANA 2IYDB 4ANWA 5GMVA 3C0RB 2KDIA 5EDSA 4GGQA 3RD2A 2DYBA 2Z0EB 1ZGUB 4DHZB 3NZUA 1WR6E 4ZDVA 2FCSA 3A33B 2ZCCA 3APFA 3GOEA 1U4AA 2J0MA 2PE6B 3U7DA 4I6NB 1XQQA 2FIDA 1GUAB 4W9IA 2DYOA 1GG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LXD A;  3QHT A;  2WX1 A;  2G4D B;  3CST A;  2R2O A;  4WQO B;  3M62 B;  3QAR A;  3VUX A;  1D3Z A;  2CHX A;  4BKT A;  3N30 A;  4ANV A;  2XK5 A;  1WX8 A;  2ZJD A;  4CYE A;  4TQ1 A;  1UEL A;  4W9E A;  2LAS A;  2XK5 B;  1E8Y A;  2KJH B;  2M1M A;  2W9N A;  1WGY A;  3CSF A;  2FCM A;  2KO3 A;  3PRE A;  4WJN A;  4NJ6 A;  4AP4 C;  2RSU A;  4EUT A;  2LGX A;  2KN5 A;  4B95 A;  4HK2 A;  5L83 A;  1WGH A;  2M4N A;  3LJ3 A;  2KMA A;  3L08 A;  3QIJ A;  2CKH B;  3RZF A;  5CTR C;  4JL9 A;  3GZN I;  3PSE B;  4NQL B;  3PT2 B;  4CHK A;  3RCZ A;  5AZG A;  3UIP B;  2KC1 A;  3X0W A;  2Z0D B;  1WZ3 A;  1SE9 A;  3JVZ X;  1C1Y B;  3WA0 A;  2KQ7 A;  1WJN A;  3ZNH B;  4IWQ A;  1P9D U;  1WX7 A;  2WWZ A;  3WIM A;  3VTV A;  2I1J A;  1OGW A;  2PJH A;  4X57 B;  3PHW B;  5DPW A;  3K9P B;  5D7G A;  3VTW A;  1RRB A;  3ZKJ C;  3MJW A;  3JSV A;  2NR2 A;  2R2Q A;  4IWP A;  3QK0 A;  4MGZ E;  2N9X A;  3ZRC A;  3A4S C;  4BBN C;  3RZW C;  1X1M A;  1R4N I;  2PEA A;  4BKG A;  3X23 A;  1RAX A;  1WE6 A;  2ZPY A;  4MDK E;  3VHT C;  2LI5 A;  1MG8 A;  2JZZ A;  3WAL A;  4K7S A;  3SU8 X;  3KYC D;  3BY4 B;  3OAW A;  4HXD A;  4HLE A;  4GXB A;  1WM2 A;  2KVR A;  2L0F A;  3MTN B;  3ENE A;  2NBW B;  2V1Y A;  2DX5 B;  4KZC A;  5CX3 A;  2LWP A;  4PYZ A;  1SIF A;  3TJP A;  2MA9 B;  2MBH A;  1WMH B;  1K8R B;  1LM8 B;  3NHE B;  2MCN B;  2O2V A;  2L3Z A;  4W9L A;  2RPQ A;  3KH0 A;  3IBE A;  2KHW B;  2NPT A;  3MHS D;  2KTR A;  2LUE A;  4NAW A;  3SDL C;  2O2V B;  1E7U A;  4FN2 A;  2CHZ A;  2KTR B;  2N7E A;  4NAW B;  3V6E B;  4KSL C;  1KM7 A;  2L76 A;  2CS4 A;  4MEM A;  3H9D A;  2KDF B;  5LXH A;  1FXT B;  4G11 A;  1CMX B;  2C60 A;  1A5R A;  2JT4 B;  2D2Q A;  5DCN A;  3ZNZ B;  2LJ5 A;  1OEY A;  3QJZ A;  3APD A;  4IM0 A;  3ML8 A;  3V61 A;  2EMT A;  3ZO5 B;  2BWE S;  2IZV B;  1UBI A;  2WYQ A;  2B3A A;  2BF8 B;  3DOW A;  2EMS A;  3R66 C;  3VTU A;  3P2B A;  4HVB A;  4NQK E;  4IM2 A;  1NBF C;  2KOX A;  1KJT A;  3N32 A;  1L7Y A;  4FJV B;  5AEK B;  3DVG Y;  3ZVV A;  2RGF A;  2G45 B;  4KV2 A;  2DZJ A;  3DCG A;  3U30 A;  1YQB A;  4EKU A;  2CR5 A;  2GBJ A;  5CHW A;  2FCN A;  4M8M A;  4PS7 A;  2MBQ A;  2LZ6 A;  4LDT B;  3SD5 A;  3ZLZ A;  1J0G A;  1EO6 A;  1LQB A;  4DK5 A;  2KNB A;  4NNJ B;  2C5L C;  4B6W A;  2ZCB A;  1ZW7 A;  4GDK A;  1H8C A;  4URK A;  1I42 A;  4WJP A;  4K7W A;  2J7Q B;  4N9F 4;  4GIV A;  2D10 A;  2IO3 B;  2LRU A;  2C7N B;  2YVC A;  2FAZ A;  4GDL A;  2JY6 A;  4G0N B;  3HM3 A;  2KX3 A;  2MBB B;  5DPR A;  3JW0 X;  4G50 A;  2FCQ A;  4TQ0 A;  2K8H A;  3EHV A;  2GBK A;  1Y8R C;  2JXX A;  2MLB A;  3ONS A;  3PGE A;  3ZUN A;  2RD0 A;  3VDZ A;  1P0R A;  4RM9 A;  3DBH I;  4BKS A;  1UBQ A;  2OJR A;  4KZ0 A;  3QC8 B;  3PTF C;  5L95 C;  4ANU A;  2ZNV C;  4MSQ B;  1Z2M A;  2L8J A;  2JVC A;  2LXC A;  3PZD A;  3AU4 A;  3AXC A;  4A20 A;  2LRW A;  3DBL I;  3SHQ A;  3TBL D;  2KKC A;  3VH3 B;  3DDC B;  2MSE D;  4CO7 A;  2AYO B;  2KXJ A;  1NDD A;  3AI5 A;  3IVF A;  3UF8 A;  2FUH B;  3B1L X;  3PLU A;  3DVG X;  3H6N A;  2M8S A;  1RLF A;  2LVP A;  2L05 A;  4BBN F;  2LD9 A;  3PV1 A;  4RMA A;  3A4R A;  2IO2 B;  4BVU C;  2FNJ B;  1WGD A;  2BKF A;  2K8C A;  4ASW C;  3AU5 A;  3R7Q A;  3VUW A;  4II3 B;  1TGZ B;  1E7V A;  2OOB B;  1P3Q U;  4MGI E;  4WWO A;  5IAA C;  4FHJ A;  1KLV A;  2XEW A;  4II2 B;  3VUY A;  4JIO U;  3W1S C;  3H7S A;  2K1F A;  1C3T A;  4HCN B;  2HD5 B;  5E6P A;  1H4R A;  4WWN A;  1BT0 A;  3A9K A;  5JHA A;  3L13 A;  2PPH A;  2IO0 B;  4TV3 A;  2J0K A;  4W9J A;  4FLH A;  3A9K B;  3CF6 E;  2UYZ B;  4MJS A;  5CHV C;  3QA8 A;  1V2Y A;  2VRR B;  1UD7 A;  1OQY A;  4XC2 A;  3U8Z A;  4BKS D;  4MJS B;  2KMC A;  2NVU I;  1XD3 B;  1YX5 B;  2C7H A;  2REX A;  3PVL A;  4KVG B;  4PS8 A;  3PRP B;  2MWS B;  2ZVO A;  3Q3F A;  1WXA A;  2JUO A;  1G6J A;  1GC6 A;  3ZRF A;  1ISN A;  3DVN V;  2GBM A;  4DHJ B;  1WIA A;  3DPD A;  3ZDM C;  2BWF A;  4KIK B;  1WXM A;  3RUL A;  2KAN A;  5JHB A;  4OVV A;  5LXI B;  4IM3 A;  3QX1 A;  1OTR B;  3ZDT A;  5DPS A;  4W9D A;  3ZIM A;  3UIO B;  2KK8 A;  3ZW3 A;  3H1U A;  3KYD D;  4DDI D;  3TMP B;  4HPM B;  4A3O A;  4GB9 A;  3NOB A;  3O65 B;  1P1A A;  1WMH A;  2FIF A;  2CHW A;  1S3S G;  5D94 A;  1J19 A;  1WM3 A;  3RUI B;  4JLC A;  3EEC A;  1SGH A;  4FHK A;  2ZPN A;  2N7D A;  1M94 A;  3EC8 A;  2EKE C;  3NZS A;  2KC2 A;  2L0T A;  5KHO A;  3W1Y A;  4AUQ C;  2KX0 A;  3APC A;  4F8C B;  4HWI B;  3NY5 A;  1WJ4 A;  3VH4 B;  4EZJ A;  3ZTD A;  4HDO A;  5KHQ A;  2K6Q A;  2CU1 A;  2KFK B;  2J0J A;  2RR9 A;  3KUD B;  3Q3J A;  4FJZ A;  1V9J A;  1V6E A;  1Q0W B;  1UZX B;  4IUM B;  4XX5 A;  1WY8 A;  3EFU A;  4FAD A;  1E8Z A;  2ZZP B;  2ASQ A;  4DHJ D;  4AWJ A;  2AL6 A;  4JGH B;  4MH0 E;  1S1Q B;  4TUU A;  4G3X B;  2MBE A;  4EZK A;  4DXA B;  1JRU A;  2K25 A;  5J18 A;  4W9H A;  3H7P A;  2ZNV B;  3OJ4 B;  3VVW B;  3N3K B;  3PS6 A;  2G4S A;  3H7P B;  2KQS A;  2N9P C;  5IA7 A;  4PS3 A;  3T9L A;  4I6P A;  2BPS A;  3PPA A;  1I35 A;  2DYM A;  2MQJ A;  4HJK A;  1E8X A;  1QZE A;  4DHZ E;  4WJQ A;  5CHF A;  4GU2 A;  2DZI A;  2BGF A;  4GN1 A;  2DZK A;  3K9O B;  2LXA A;  4BFR A;  3IFW B;  4W9C A;  2KWV B;  4ICV A;  1WFY A;  2D3G A;  1Q5W B;  4E71 A;  3DBR I;  2PE9 A;  2D11 A;  3LDZ E;  4ZRJ A;  4OVU A;  1EUV B;  1TTN A;  2HTH A;  2ZVN A;  1OEY J;  4GSW A;  3VQI A;  1Z5S B;  3V62 A;  4WJO A;  2WDT B;  3S2A A;  1VCB A;  2N1W A;  4K7U A;  5E6O A;  3VXW A;  3KW5 B;  1YD8 U;  3UQB A;  4LJP B;  4B9K A;  4W9K A;  4BOZ B;  4EZL A;  3M63 B;  4ICU A;  1UH6 A;  2AWT A;  3L10 B;  2KJR A;  3CMM B;  3UGB B;  2QHO A;  3QWZ B;  4DBG A;  3IHP C;  4LDT D;  2KD0 A;  2KLG A;  4F7Z A;  3PLV A;  1XT9 B;  4DDG D;  1WJU A;  1J8C A;  5AZF A;  3V60 A;  3AUL A;  4BOS C;  2IO1 B;  3TCA A;  2KJ6 A;  3B0A A;  2AEH A;  2IBI B;  4F1S A;  1WJ6 A;  2LVQ A;  3I3T B;  4FJY A;  4K1R B;  2BYV E;  2KDE B;  2M17 A;  4LJO B;  3R3M A;  3VAW A;  1EF5 A;  5AZH A;  3M95 A;  4PYU A;  3PRM B;  3TL5 A;  3UIN B;  2GBN A;  2DHZ A;  3L54 A;  4W9G A;  4WAA A;  4FA6 A;  3L0W B;  3L16 A;  2JRI B;  2HJ8 A;  2N4F A;  4EFO A;  5JZE B;  2V4L A;  1WYW B;  4MSM B;  2D07 B;  4GOC A;  4DWF A;  4KDL B;  2DAF A;  2N9E B;  3HK0 A;  4RM8 A;  2KFJ A;  4KIK A;  2I1K A;  1WI0 A;  3UQA A;  1YIW A;  2K8B A;  4IG7 B;  2G3Q B;  4AJW A;  1V5T A;  3KUC B;  5JH5 C;  2GBR A;  1HE8 A;  2K6D B;  2MBO A;  4LCD E;  1WE7 A;  3HIZ A;  1GJZ A;  2JRH A;  1PQS A;  2JF5 A;  3TIX A;  3RYT A;  5G2N A;  5TR5 A;  2UWQ A;  5D6J B;  2MP2 A;  2GOW A;  2MRP A;  5BO4 B;  2L7R A;  1VD2 A;  4A3P A;  2A5U A;  1T0Y A;  2MP2 B;  2Z59 B;  4ZRI A;  1V81 A;  3NS8 A;  3DVN U;  2C7M B;  2MW5 A;  2BYF A;  2DEN B;  3ML9 A;  3WAO A;  3DBS A;  3ALB A;  4NY0 A;  5G55 A;  3JSV B;  4I6L B;  3KUZ A;  2KTF A;  2L00 B;  4AJY B;  1WRD B;  1RFA A;  5E6N A;  1E5W A;  2DZM A;  4MGK E;  3T8M A;  4JQW C;  1TBE A;  4MM3 A;  4M8N A;  4IW0 A;  2KFK A;  4GMV A;  3WAM A;  2XBB C;  5D2M B;  4KDI C;  4MGY E;  2AL3 A;  4HCP B;  2LGY A;  1EF1 A;  2LVO A;  1UGM A;  2BYE A;  4HPL B;  4M0W B;  4NPN A;  4FUL A;  4TKN A;  2GMI C;  4E3C A;  1E90 A;  3A9J A;  4YL8 A;  2KLC A;  1KOT A;  2NPT B;  2O6V A;  4ANX A;  1NI2 A;  4AOF A;  1WGG A;  3A9J B;  1TZ1 A;  3IG3 A;  1IYF A;  3DQV A;  1WF9 A;  2O6V B;  1P98 A;  4K81 A;  2K39 A;  2ZEQ A;  1WX9 A;  1ZKH A;  1GNU A;  4IC7 B;  3JYU A;  4E74 A;  3BIN A;  1F9J A;  4W9F A;  3R7R A;  1AAR A;  1V5O A;  5FR6 A;  5J17 A;  3WAP A;  3PHX B;  2KDB A;  2A4Z A;  2NCN A;  3VFK A;  2Y5B B;  3QQ8 B;  1Q1O A;  4P7I A;  1V49 A;  2NS5 A;  4ZRK A;  2M0X A;  3ECI A;  4KSK C;  4EEW A;  3ZNG C;  3OJ3 A;  3A1Q A;  3PRZ A;  4XZ4 A;  1GC7 A;  2KWU B;  3ZTC A;  2C9W B;  4IWO A;  3KVF B;  2NBU A;  3A1Q B;  5C23 A;  2JZ3 B;  1IPG A;  1V80 A;  2YLM A;  2BKR B;  2NBV B;  3W1S A;  2N1V A;  4FBJ B;  2IY1 B;  5J2R A;  5LLI A;  5HKH A;  3B08 A;  2LGD A;  1R4M I;  4NJ7 A;  1WXV A;  4WWP A;  2HE7 A;  3QCA A;  1L2N A;  4EOY A;  1WR1 A;  3V6C B;  3L17 A;  2JPH A;  3OLM D;  2V3S A;  5DPT A;  4ZYN A;  2WX0 A;  1E8W A;  4GDK B;  4J6I A;  3QAQ A;  1WGR A;  1LFD A;  3ZNI D;  2JWZ A;  1WH3 A;  2KZR A;  1WXS A;  2DAJ A;  3D32 A;  1IP9 A;  1V86 A;  1WZ0 A;  4GDL B;  2MX2 A;  4MEL A;  2IY0 B;  3M3J A;  3HHM A;  1YJ1 A;  4HDQ A;  3RT3 B;  2KWC A;  5C1Z A;  1YX6 B;  2O6V D;  3HM6 X;  3WAN A;  2IYD B;  4ANW A;  5GMV A;  3C0R B;  2KDI A;  5EDS A;  4GGQ A;  3RD2 A;  2DYB A;  2Z0E B;  1ZGU B;  4DHZ B;  3NZU A;  1WR6 E;  4ZDV A;  2FCS A;  3A33 B;  2ZCC A;  3APF A;  3GOE A;  1U4A A;  2J0M A;  2PE6 B;  3U7D A;  4I6N B;  1XQQ A;  2FID A;  1GUA B;  4W9I A;  2DYO A;  1GG3 A; 
#chains in the Genus database with same CATH topology
 1ESF A;  2W3R A;  2G4D B;  3CST A;  3M62 B;  3QAR A;  3GP7 A;  2VZK B;  1WX8 A;  2WXF A;  1YN4 A;  1UEL A;  1E8Y A;  2M1M A;  5H92 C;  5JXV A;  2WXQ A;  2KN4 A;  3NRZ A;  3AM9 A;  5L83 A;  2M4N A;  1T6B X;  3QIJ A;  1D5M C;  5CTR C;  3PT2 B;  1E0Z A;  3RCZ A;  5AZG A;  3UIP B;  2KC1 A;  3X0W A;  2Z0D B;  1WZ3 A;  2WXG A;  3EUB 2;  3JVZ X;  2RDB C;  1E10 A;  4TSS A;  2KQ7 A;  1MVK A;  2KT7 A;  1NYR A;  3PHW B;  3BWU D;  2QIL A;  5D7G A;  3UI3 A;  1RRB A;  3ZKJ C;  4OHJ A;  4YT0 B;  2WNM A;  3L4P A;  1X1M A;  4R3D A;  2D3C A;  2WDR B;  3X23 A;  1RAX A;  1FIQ A;  1SSN A;  4XYC A;  3NVW A;  3KYC D;  3BY4 B;  4GXB A;  1ZP0 B;  3ZJV A;  2NBW B;  2V1Y A;  4KZC A;  1YMH E;  1ET6 A;  1C4C A;  2MA9 B;  5IKC M;  1YN3 A;  3U7Z A;  3MJ5 A;  2O2V A;  1R4N B;  3IBE A;  3MHS D;  1TZO A;  4NAW A;  1OQQ A;  2KTR B;  4YSZ B;  2N7E A;  4KSL C;  2MJE A;  1DOI A;  5LXH A;  2KDF B;  1FXT B;  2D2Q A;  1JWS D;  3ZNZ B;  3APD A;  2IZV B;  2WYQ A;  1QOA A;  3Q69 A;  4HVB A;  3ZJU A;  4NQK E;  4C4V A;  2KOX A;  5LNK 1;  1KJT A;  2LEK A;  1L7Y A;  1SB3 C;  3ZVV A;  3MC8 A;  3TEX A;  3U30 A;  1YQB A;  2CR5 A;  2FCN A;  2MBQ A;  3ZLZ A;  1HTO A;  4DK5 A;  2KNB A;  4GDK A;  4K7W A;  3TEZ A;  3VRA B;  2JYT A;  2RD0 A;  4D2K A;  4BKS A;  4HKQ A;  1UBQ A;  2OJR A;  4A20 A;  4ZHO A;  2PMV A;  2MSE D;  5AUK A;  2FUH B;  3PO0 A;  2WS3 B;  2QMT A;  3AED B;  4YSX B;  4BBN F;  3PV1 A;  1YQ4 B;  2KAC A;  2WGS A;  2K8C A;  4QAY A;  1E7V A;  2KAJ A;  2X38 A;  1P7E A;  2M56 B;  2K1F A;  4HCN B;  4WWN A;  4KKJ A;  2QCZ A;  3A9K A;  3VRB B;  4C7Y A;  5BMH A;  3L13 A;  2PPH A;  1QOG A;  4FLH A;  2N0S B;  1V2Y A;  1TIF A;  2VRR B;  3N20 C;  4BKS D;  3MP9 A;  2NVU I;  1XD3 B;  2C7H A;  2REX A;  3E9S A;  3PRP B;  3Q3F A;  3ZRF A;  1ISN A;  2GBM A;  3B9J A;  3FKY A;  2KAN A;  5LXI B;  1K50 A;  2IPK D;  3ZDT A;  5DPS A;  5HFY A;  1TS5 A;  1E7P B;  3KYD D;  3TMP B;  1L0V B;  1YQ3 B;  3RUI B;  5D94 A;  1VZ6 A;  1M94 A;  1MFW A;  2KC2 A;  1D5X C;  2L0T A;  5KHO A;  3W1Y A;  4EZJ A;  5C3J B;  3R2T A;  2WXL A;  2KFK B;  2RR9 A;  1V9J A;  4FAD A;  2RPV A;  2ZZP B;  3RNA C;  4MH0 E;  3SEB A;  2MBE A;  4DXA B;  2K25 A;  5J18 A;  2NMQ A;  3H7P A;  1TS3 A;  2G4S A;  2BS4 B;  2KQS A;  2MQJ A;  2PTL A;  4DHZ E;  4WJQ A;  2IGG A;  2E3T A;  1VLB A;  1N60 A;  2D3G A;  1Q5W B;  1V1P B;  2TSS A;  4WH4 A;  2QDF A;  3AEF B;  4OVU A;  1EUV B;  2HTH A;  4GSW A;  4WJO A;  2WDT B;  2L52 A;  5E6O A;  4K7U A;  3VXW A;  2ONQ A;  3KW5 B;  4CQN A;  3W5V B;  3RMK C;  4B9K A;  4BOZ B;  4C7Z A;  4REZ A;  2ON8 A;  4ICU A;  3L10 B;  2W55 A;  1SBB B;  2IO1 B;  3TCA A;  3O13 A;  1WJ6 A;  1XLN A;  2BYV E;  2E6X A;  2M17 A;  4AS1 A;  3L54 A;  4W9G A;  4WAA A;  1ZE3 D;  2N4F A;  4LNN A;  2DBY A;  4GOC A;  1MHX A;  1SEB D;  1XLQ A;  1WI0 A;  3UQA A;  2K8B A;  4AJW A;  1V5T A;  3DWM A;  1ZXH A;  4LCD E;  2OHF A;  3ETR A;  1GB4 A;  1PQS A;  5TR5 A;  2MRP A;  1EU3 A;  1VR9 A;  2M19 A;  3BYY B;  1V81 A;  3DVN U;  2D3A A;  1L6U A;  2C7M B;  2MW5 A;  2BYF A;  1JAL A;  2WXR A;  1RFA A;  3AH7 A;  3R2I A;  2OJW A;  2KFK A;  3WAM A;  1I4G A;  2XBB C;  5D2M B;  2K0P A;  3NUH B;  3I63 C;  4RF1 A;  1I4H A;  4M0W B;  3AV8 A;  1UUP A;  2HTM E;  2L32 A;  1K51 A;  1NI2 A;  3V05 A;  1TZ1 A;  1I4P A;  1IYF A;  2FBW B;  3DQV A;  1WF9 A;  2ZEQ A;  3IAM 1;  1GNU A;  2BB6 A;  4IC7 B;  1F2R C;  3WAP A;  2A4Z A;  2NCN A;  1FFV A;  2Y5B B;  1Q1O A;  3FIL B;  5FK9 C;  3T3N A;  2VH2 A;  1PDX A;  1XO3 A;  3W1S A;  2CJO A;  4YTP B;  2IY1 B;  5IOI A;  4M02 A;  2QIE B;  1WXV A;  4WWP A;  2HE7 A;  3ZXR A;  3L17 A;  2JPH A;  3OLM D;  3ABV B;  4J6I A;  3HHM A;  2KDM A;  1YJ1 A;  3U52 E;  1R4M B;  3AE2 B;  4GGQ A;  1XF5 L;  1MJD A;  4DHZ B;  1F0Z A;  1F77 A;  4ZHP A;  2PE6 B;  3U7D A;  1T0Y A;  1GUA B;  1GG3 A;  1EWY C;  2CHX A;  2XK5 A;  2ZJD A;  4CYE A;  2W54 A;  2WU2 B;  1GJZ A;  3CSF A;  2KJH B;  2W9N A;  2FCM A;  1VJK A;  2KO3 A;  3VR9 B;  4NJ6 A;  1WGK A;  2RSU A;  4AP4 C;  2KN5 A;  1ACC A;  1WYG A;  1WGH A;  5EE9 A;  3LJ3 A;  2KMA A;  4RH6 A;  1PUT A;  2K5P A;  4JL9 A;  4NQL B;  4ZRP A;  1SE9 A;  1D4B A;  3ZNH B;  2FE8 A;  4IWQ A;  1JCK B;  1F2R I;  3GS2 A;  5DPW A;  3VTW A;  2LHD A;  2H89 B;  2R2Q A;  3QK0 A;  4P1C C;  3P4R B;  1PGX A;  2ICI A;  4OZB A;  2ZPY A;  4MDK E;  3AEG B;  1XEE A;  3OAW A;  1ENF A;  2YEP F;  1WM2 A;  4WIP A;  2NTT A;  2KVR A;  2L0F A;  2YEP B;  4M0W A;  3ENE A;  1J7C A;  1PFD A;  2LWP A;  3TJP A;  2MBH A;  1WMH B;  3NVZ A;  1K8R B;  1TYG B;  4LLG M;  3SDL C;  2LUE A;  3HUI A;  2O2V B;  4FN2 A;  3R8B A;  2ACZ B;  4NAW B;  3WCQ A;  3V6E B;  3BK1 A;  4N6E B;  2JT4 B;  1Y56 A;  1OEY A;  3QJZ A;  5FKA C;  3ML8 A;  2SAK A;  4HKZ E;  2BWE S;  1DOY A;  3R66 C;  4US8 A;  4OVZ A;  3RNF C;  4MH8 A;  3DVG Y;  4C4V B;  2G45 B;  2KQ4 X;  4KV2 A;  2GBJ A;  4LDT B;  1J0G A;  1EO6 A;  4J3O D;  1UGJ A;  2JQR B;  2ZCB A;  3LYY A;  1ZW7 A;  4URK A;  3H8H A;  2FAZ A;  3N1X C;  2JY6 A;  1JWM D;  2HJ1 A;  4G0N B;  2KX3 A;  2MBB B;  1K52 A;  4G50 A;  1AWD A;  3I57 A;  2K8H A;  2EKI A;  2GBK A;  1SE3 A;  2MLB A;  3ONS A;  4H2A A;  1C9F A;  3PGE A;  4RGO S;  2WHI A;  4XE0 A;  4RM9 A;  1VDV A;  3DBH I;  4KZ0 A;  5L95 C;  1PYW D;  4ANU A;  2ZNV C;  4RGT A;  3PZD A;  3AXC A;  2LRW A;  3DBL I;  5GXG B;  2JWU A;  2MHJ A;  2KXJ A;  3CIR B;  1NDD A;  3B1L X;  2I2Y A;  2AQ1 B;  1TKE A;  2LD9 A;  4RMA A;  4BVU C;  2J42 A;  3A4R A;  4HPP A;  3PZ7 A;  4ASW C;  2WXN A;  4MGI E;  5EE3 A;  3W2D A;  2XEW A;  3VUY A;  2PW9 A;  1C3T A;  4WQM A;  2HD5 B;  5E6P A;  3AE5 B;  1C4A A;  4W9J A;  3A9K B;  2OED A;  2UYZ B;  4MJS A;  5CHV C;  1FD6 A;  1UD7 A;  3U8Z A;  3PVL A;  1DYQ A;  1D6E C;  1YOV B;  2ZVO A;  2JUO A;  1GC6 A;  1KRH A;  3DVN V;  1FMA D;  1A70 A;  5JHB A;  1AW7 A;  1ZDX A;  3QX1 A;  3SFE B;  3ZIM A;  3ZW3 A;  3HVD A;  1IGC A;  1WMH A;  1SGH A;  2ZPN A;  4ZRQ A;  2EKE C;  4AUQ C;  3APC A;  4P16 A;  3J9C A;  3AEC B;  1J7A A;  2WXH A;  3VH4 B;  1QT9 A;  1B1Z A;  3KUD B;  3Q3J A;  1FPY A;  4IKG A;  5G5H A;  4XX5 A;  1E8Z A;  4JGH B;  1B9R A;  1UF0 A;  1S1Q B;  4TUU A;  3FAH A;  4EZK A;  3FC4 A;  3OJ4 B;  3VVW B;  3N3K B;  3BVM A;  3PS6 A;  3H7P B;  3TEW A;  5IA7 A;  5D3I B;  4I6P A;  2J4X A;  2INC C;  3GE8 C;  1I35 A;  1YJI A;  2J52 A;  4GN1 A;  2KWV B;  1DOX A;  2JZP A;  1NYQ A;  4IDI A;  3BK2 A;  1TTN A;  3MC9 A;  2HDE A;  3V62 A;  3RNE C;  5D3D A;  3AE4 B;  1VCB A;  1T3Q A;  1ZXI A;  2LMC A;  3ZJT A;  3M63 B;  3DHG C;  2AWT A;  3UGB B;  2QHO A;  4PT5 A;  4LDT D;  2K9X A;  2KLG A;  4F7Z A;  1XT9 B;  3RNC C;  1SF0 A;  1XLO A;  3V60 A;  3BYT B;  1FRD A;  3B0A A;  1D5Z C;  4K1R B;  4FJY A;  4JWS C;  1EF5 A;  5AZH A;  2D3B A;  1T0R C;  2GBN A;  2DHZ A;  4FA6 A;  4C00 A;  3BVG A;  4KDL B;  2WP9 B;  3KWL A;  3HK0 A;  4RM8 A;  1RYJ A;  1DGJ A;  1YIW A;  4YWG G;  5JH5 C;  2GBR A;  1HE8 A;  2ZW0 A;  3HIZ A;  1ET9 A;  2JRH A;  5D6J B;  2GOW A;  5H8Y E;  1EM7 A;  3NS8 A;  2DEN B;  4XGA B;  4NY0 A;  5G55 A;  3JSV B;  2KTF A;  2L00 B;  1EU4 A;  5E6N A;  3I9V 1;  4MGK E;  3T8M A;  4JQW C;  4PK1 A;  2Z8L A;  1ZDV A;  4GMV A;  2M0A A;  2LGY A;  3AE6 B;  2R61 A;  4HPL B;  1T0S C;  4EE2 A;  4P6V F;  2JSV X;  4US9 A;  4E3C A;  2NPT B;  2WXI A;  3IG3 A;  2JXT A;  3N1Y C;  1P98 A;  1SJE D;  4OZA A;  4E74 A;  3BIN A;  3R7R A;  1EWC A;  3PHX B;  2KDB A;  2PKO A;  4P7I A;  1FO4 A;  1V49 A;  2M0X A;  2XNA C;  3AN1 A;  4EEW A;  3A1Q A;  1TS2 A;  1AYF A;  3Q8A A;  3ZTC A;  2C9W B;  5C23 A;  1V1O A;  2JZ3 B;  2EEL A;  2NBV B;  4FBJ B;  3U4E G;  5LLI A;  3B08 A;  3P42 A;  2UU7 A;  2Y3A A;  4NJ7 A;  4JWU C;  3V6C B;  3U2S C;  2W82 A;  5DPT A;  1Q10 A;  3RN9 C;  2INP E;  1E8W A;  3NVV A;  1LFD A;  3TUO A;  1WH3 A;  2AX5 A;  2KZR A;  3TEY A;  1WZ0 A;  4GDL B;  3NS1 A;  3M3J A;  3CWI A;  2AQ2 B;  2KWC A;  5C1Z A;  2IYD B;  5GMV A;  3C0R B;  3KLS X;  4MT5 A;  2DYB A;  3URY A;  2Z0E B;  1ZGU B;  1YJJ A;  4ZDV A;  2FCS A;  4XDC A;  2N9K A;  3IXS A;  2MJD A;  3AE1 B;  1XQQ A;  2FID A;  3GZN I;  2DYO A;  2N9L A;  3QHT A;  2WX1 A;  3VUX A;  2R2O A;  4BKT A;  4ANV A;  4TQ1 A;  1QKZ A;  4W9E A;  2LAS A;  2XK5 B;  3PRE A;  4YSY B;  4WJN A;  4EUT A;  2CU3 A;  4M01 A;  4HK2 A;  2N7J A;  1XCQ L;  5BYQ A;  3RZF A;  1KFY B;  1FCC C;  4CHK A;  1HZ5 A;  1C1Y B;  2NTS A;  2WWZ A;  3WIM A;  2I1J A;  2CJN A;  4LNK A;  3K9P B;  2H88 B;  3JSV A;  4MGZ E;  3ZRC A;  2RMM A;  3A4S C;  4JX1 C;  4RGM A;  4S0R A;  3RZW C;  3MFG A;  2GLS A;  4BKG A;  1WE6 A;  3Q2A C;  2WLB A;  3WAL A;  4K7S A;  3SU8 X;  4KGT A;  4A9A A;  2BBC A;  1RFK A;  1UWX A;  5T8I A;  5CX3 A;  2WXK A;  3Q8E A;  1LM8 B;  2W3S A;  3NHE B;  2MCN B;  2L3Z A;  3NZ3 A;  2RPQ A;  2NPT A;  4ACF A;  1TY0 A;  1KM7 A;  2L76 A;  4MEM A;  1JWU D;  3H9D A;  1UNS A;  4G11 A;  2LJ5 A;  1OFF A;  4IM0 A;  1T0Q C;  3ZYY X;  2EMT A;  3DOW A;  4ITK A;  2B3A A;  2BF8 B;  4O1N A;  4BAX A;  1QIL A;  3VTU A;  3P2B A;  1VZ8 A;  1E9M A;  4YTN B;  1JW9 D;  4LNI A;  3NVY A;  3N32 A;  4FJV B;  2DZJ A;  3DCG A;  4PS7 A;  2LZ6 A;  3SD5 A;  1LQB A;  4B6W A;  1H8C A;  1C77 A;  2J7Q B;  4N9F 4;  2D10 A;  4GDL A;  2LRU A;  2C7N B;  4RCO A;  1HQR D;  3JW0 X;  4HRS A;  2FCQ A;  3HVZ A;  4TQ0 A;  1Y8R C;  2XN9 C;  5G5G A;  1P0R A;  3P63 A;  3QC8 B;  2LJI A;  2L8J A;  4K3C A;  2LXC A;  4NZL B;  1L5P A;  3AU4 A;  4DXG A;  3SHQ A;  2KKC A;  3VH3 B;  3DDC B;  4CO7 A;  1TS4 A;  1T5X D;  4HEA 1;  3UF8 A;  3PLU A;  3DVG X;  3DBH B;  3Q8B A;  3V3X A;  1YN5 A;  2B76 B;  2FNJ B;  2BKF A;  4II3 B;  3DBL B;  1LGR A;  2OOB B;  1WSP A;  1P3Q U;  5IAA C;  4WWO A;  1VZ7 A;  4N59 A;  3PZ8 A;  3SR6 A;  4ARI A;  2GB1 A;  1H4R A;  1BT0 A;  3ZGZ A;  2IO0 B;  2IGD A;  4RGN A;  4TV3 A;  1L6V A;  2BS3 B;  3CF6 E;  3NG0 A;  3QA8 A;  1OQY A;  1L4D B;  4MJS B;  4PS8 A;  4KVG B;  2MWS B;  4ZOH C;  1C79 A;  1WXA A;  1G6J A;  1RWS A;  1WIA A;  1QLB B;  2BWF A;  4KIK B;  1WXM A;  3RUL A;  1GB1 A;  1TJE A;  3P4Q B;  2BB5 A;  4IM3 A;  1ZOY B;  3LXF A;  4W9D A;  3UIO B;  4JPS A;  4HPM B;  2WDV B;  1OQR A;  2LHE A;  4GB9 A;  3NOB A;  3OG5 A;  1P1A A;  4WWM A;  1J19 A;  1WM3 A;  4JLC A;  1HTQ A;  2N7D A;  2Q5W D;  3EC8 A;  4F1S A;  2X8X X;  2KX0 A;  1WJ4 A;  4HDO A;  5BYR A;  2L1A A;  5E6J A;  2CU1 A;  2IDY A;  2J0J A;  5C2T B;  1UZX B;  4IUM B;  3EFU A;  4DHJ D;  1XCT L;  1JRU A;  4W9H A;  2ZNV B;  1KTK A;  4PS3 A;  3T9L A;  1FEH A;  2BPS A;  2DYM A;  1E8X A;  1QZE A;  1MPE A;  5CHF A;  2DZI A;  2BGF A;  4BFR A;  4UDU C;  3IFW B;  4W9C A;  4N58 A;  1WFY A;  1LO5 D;  4KX6 B;  2LGS A;  1BXT A;  4E71 A;  3DBR I;  3AEE B;  3LDZ E;  2LGI A;  2ZVN A;  3AEB B;  1OEY J;  3VQI A;  1Z5S B;  3T3O A;  4RFB A;  2AQ3 B;  3S2A A;  2D5G A;  1J7B A;  1YD8 U;  3P4S B;  3UQB A;  4LJP B;  1FXA A;  3RFZ B;  4W9K A;  1XLP A;  1FCL A;  2KJR A;  4DBG A;  3QWZ B;  1N63 A;  3IHP C;  2SEB D;  3NJT A;  1J8C A;  3AUL A;  3KQ4 A;  1MHH E;  2KJ6 A;  2AEH A;  2IBI B;  2LVQ A;  3VAW A;  4LJO B;  3R3M A;  4PYU A;  2FUG 1;  4WUR A;  4MAC A;  3L0W B;  2HJ8 A;  4EFO A;  5JZE B;  1K53 A;  2V4L A;  4MSM B;  2QC8 A;  4RF0 A;  2PLP A;  2MJ3 A;  3DWG C;  2KFJ A;  1HXY D;  1HA5 A;  4KIK A;  3C19 A;  2G9H D;  3KUC B;  3RNB C;  4ARC A;  2K6D B;  1WE7 A;  3TIX A;  1P7F A;  3RYT A;  2MH7 A;  5G2N A;  2MP2 A;  5BO4 B;  2L7R A;  5BMI A;  1VD2 A;  2V3N A;  1L0X B;  2A5U A;  2WU5 B;  4ZRI A;  2KYW A;  3Q3M C;  5IO9 A;  3ML9 A;  3WAO A;  3BZD B;  3DBS A;  3Q8F A;  2KVZ A;  4I6L B;  3DHI C;  1V8C A;  1WRD B;  1E5W A;  1TBE A;  1GOZ A;  1TT5 B;  4C56 C;  1YNT E;  2QSD A;  2AL3 A;  1KH0 A;  1UGM A;  2JX5 A;  1STE A;  4FUL A;  4TKN A;  2GMI C;  1E90 A;  3A9J A;  4YL8 A;  2KLC A;  2O6V A;  4HRO A;  1WGG A;  1QQR A;  4K81 A;  2K39 A;  1WX9 A;  1ZKH A;  1F9J A;  4W9F A;  5MPO A;  1AAR A;  5J17 A;  3N9Y C;  1V97 A;  2V4I B;  1JWB D;  4ZRK A;  3BVZ A;  4KSK C;  1SXT A;  3AMZ A;  4IWO A;  3AEA B;  2NBU A;  3A1Q B;  1V80 A;  3RNG C;  2BKR B;  5J2R A;  1N61 A;  5HKH A;  3KWV A;  4M00 A;  2DLB A;  4OZC A;  1WR1 A;  2BW2 A;  2PVG C;  2V3S A;  2WX0 A;  3Q8C A;  3QAQ A;  1WGR A;  4RNA A;  4XWT A;  2JWZ A;  2DAJ A;  1IBX A;  2MX2 A;  4MEL A;  3RT3 B;  1JRO A;  1YX6 B;  2O6V D;  3WAN A;  4ANW A;  4A55 A;  2BT6 A;  1KLG D;  2KDI A;  5EDS A;  2INN E;  4DQO C;  1WR6 E;  1AN8 A;  3A33 B;  1C4P A;  2ZCC A;  3GOE A;  1KF6 B;  1ZPS A;  1EF1 A;  5FR3 A;  1LXD A;  1D3Z A;  1ROE A;  4WQO B;  4BZA A;  3N30 A;  5IP4 D;  1RM6 C;  4IOI E;  5IN7 A;  1L2N A;  1TY2 A;  1WGY A;  1KLU D;  3MHZ A;  3BII D;  2LGX A;  4B95 A;  2KMM A;  2IGH A;  5HHD G;  4ZYS A;  3GZN B;  3L08 A;  2CKH B;  2LUM A;  4WAF A;  3PSE B;  1N5W A;  1CQV A;  3WA0 A;  3W5U B;  1WJN A;  1FFU A;  1JML A;  4A6Q A;  1P9D U;  1C76 A;  1WX7 A;  3RI7 C;  1BML C;  3VTV A;  1OGW A;  2PJH A;  4X57 B;  1SIJ A;  3MJW A;  2NR2 A;  4IWP A;  2N9X A;  1JWA D;  4XWW A;  4BBN C;  1TKG A;  2VZK D;  3Q3N C;  1R4N I;  1FNW A;  2MEK A;  2GI9 A;  2PEA A;  3VHT C;  2LI5 A;  1MG8 A;  2JZZ A;  1PGA A;  4HXD A;  4HLE A;  1CJE A;  2Y5C A;  2K3U A;  3MTN B;  4LTU A;  2DX5 B;  4P1B C;  4PYZ A;  1SIF A;  2WDQ B;  4W9L A;  3KH0 A;  2KHW B;  2KTR A;  1E7U A;  3Q14 C;  2CHZ A;  2WQY B;  2CS4 A;  3MC0 B;  1CMX B;  1L0Y B;  2C60 A;  1A5R A;  5DCN A;  3V61 A;  3ZO5 B;  1UBI A;  1MG4 A;  2EMS A;  3LB8 C;  4IM2 A;  1NBF C;  5AEK B;  2RGF A;  4EKU A;  2IJ0 A;  5EE0 A;  1QOF A;  3I5J C;  4M8M A;  5CHW A;  4A8X C;  1CZP A;  3EFC A;  4NNJ B;  4W9I A;  2C5L C;  3HRD D;  1M4V A;  1HZ6 A;  1I42 A;  4KGR A;  4WJP A;  2PIA A;  4GIV A;  2IO3 B;  2YVC A;  1FXI A;  3HM3 A;  5DPR A;  3EHV A;  2JXX A;  3ZUN A;  1C78 A;  2BYT A;  3VDZ A;  1N6Z A;  2WXO A;  3PTF C;  2WXJ A;  4AQ7 A;  1XXG A;  3EA6 A;  4MSQ B;  1Z2M A;  4Q2J A;  2JVC A;  1UWM A;  2BQQ A;  3TBL D;  1GPX A;  2AYO B;  3AI5 A;  3IVF A;  3C8Y A;  2M8S A;  1RLF A;  3H6N A;  2LVP A;  5EE1 A;  2L05 A;  2IO2 B;  2K22 A;  1WGD A;  3AU5 A;  2KWD A;  3R7Q A;  3VUW A;  1TGZ B;  3AE7 B;  3AE9 B;  4FHJ A;  4S17 A;  1KLV A;  1VRA B;  3W1S C;  1SE4 A;  4II2 B;  4JIO U;  3H7S A;  5JHA A;  2J0K A;  1F1H A;  1E6E B;  4XC2 A;  2KMC A;  1N5X A;  1YX5 B;  1SJH D;  4XDD A;  5AUI A;  1TKY A;  4DHJ B;  1NI3 A;  3ZDM C;  3DPD A;  4OVV A;  2QJL A;  3EGR A;  1OTR B;  2KK8 A;  3H1U A;  4DDI D;  2ZW1 A;  4L23 A;  2V0G A;  4B0M A;  4A3O A;  3O65 B;  2FIF A;  1SE2 A;  5TSS A;  2CHW A;  1S3S G;  3EEC A;  4FHK A;  4C80 A;  3DHH C;  3NZS A;  4F8C B;  2JU6 X;  4HWI B;  3NY5 A;  3ZTD A;  4KKI A;  5KHQ A;  4LNF A;  4MM3 B;  1GAQ B;  2K6Q A;  1I4R A;  4NJC A;  4FJZ A;  1V6E A;  1Q0W B;  1JRP A;  1WY8 A;  2ASQ A;  4AWJ A;  3RPF C;  2AL6 A;  3IT4 B;  4NAM A;  1QOB A;  4G3X B;  2WXM A;  4HJG E;  1IGD A;  2RDG A;  1I7H A;  4B0E A;  1FM0 D;  1R7S A;  3SFD B;  1NVI D;  2N9P C;  4A90 A;  3PPA A;  3AE3 B;  4HJK A;  3AE8 B;  4GU2 A;  3VR8 B;  2PVO D;  2DZK A;  3K9O B;  2LXA A;  1V1P A;  2GRI A;  3N1Z C;  4ICV A;  1MI0 A;  4LNO A;  2PE9 A;  2D11 A;  4ZRJ A;  1JQ4 A;  2L83 A;  3ZQ4 A;  5BMG A;  1WWT A;  3P4P B;  2N1W A;  4L2Y A;  2V9H A;  1ZUD 2;  1F52 A;  1I4X A;  4EZL A;  3DBR B;  3AB5 A;  1UH6 A;  3CMM B;  2KD0 A;  3PLV A;  4DDG D;  1WJU A;  4K3B A;  5AZF A;  2VH1 A;  4BOS C;  4KGS A;  1WRI A;  4YTM B;  3I3T B;  2KDE B;  2QEJ C;  3M95 A;  3TL5 A;  3PRM B;  3UIN B;  4JE3 B;  3L16 A;  2JRI B;  3Q6B A;  5BYS A;  1WYW B;  2D07 B;  4DWF A;  2RDH A;  2LFI A;  2DAF A;  2N9E B;  4LK0 M;  1I4Q A;  2I1K A;  3GE3 C;  4OW0 A;  4IG7 B;  2G3Q B;  1WXQ A;  4DXF A;  2MBO A;  2JYE A;  1FNV A;  2JF5 A;  2UWQ A;  4A3P A;  4FXC A;  2MP2 B;  2Z59 B;  1IUE A;  3IT6 B;  3W9C B;  3ALB A;  3KUZ A;  5I4D A;  1PGB A;  4AJY B;  2Y5P A;  4YXD B;  2DZM A;  4MM3 A;  4M8N A;  1FNU A;  4IW0 A;  4KDI C;  4MGY E;  4HCP B;  3OWE B;  2LVO A;  3ZXV A;  2BYE A;  4NPN A;  3IAS 1;  4L1B A;  1KOT A;  4USA A;  4ANX A;  4AOF A;  1CK1 A;  3A9J B;  2V3P A;  1QF6 A;  2O6V B;  3GB1 A;  3P1M A;  3B2F A;  3JYU A;  2BVC A;  3FIL A;  1V5O A;  5FR6 A;  1FRR A;  3VFK A;  2I38 A;  1HEZ E;  3E56 A;  3QQ8 B;  2NS5 A;  3ECI A;  3ZNG C;  3OJ3 A;  4XZ4 A;  3PRZ A;  1GC7 A;  2KWU B;  3KVF B;  2BS2 B;  2DNF A;  4GLS C;  2DWQ A;  1IPG A;  2YLM A;  2N1V A;  1L4Z B;  2LGD A;  2J53 A;  1R4M I;  3Q3O C;  3QCA A;  1NEN B;  4EOY A;  3B2G A;  4ZYN A;  4GDK B;  5HG2 A;  3ZNI D;  1WXS A;  3D32 A;  1IP9 A;  1V86 A;  2WXP A;  1NEK B;  2IY0 B;  4TMA B;  2BTE A;  4HDQ A;  1IBX B;  5HI1 A;  3HM6 X;  3RD2 A;  1N62 A;  3NZU A;  3TSS A;  3APF A;  1U4A A;  2J0M A;  4I6N B;  1BUI C;  2G1E A;  2IND C; 
#chains in the Genus database with same CATH homology
 1LXD A;  3QHT A;  2WX1 A;  2G4D B;  3CST A;  2R2O A;  4WQO B;  3M62 B;  3QAR A;  3VUX A;  1D3Z A;  2CHX A;  4BKT A;  3N30 A;  4ANV A;  2XK5 A;  1WX8 A;  2ZJD A;  4CYE A;  4TQ1 A;  1UEL A;  4W9E A;  2LAS A;  2XK5 B;  1E8Y A;  2KJH B;  2M1M A;  2W9N A;  1WGY A;  3CSF A;  2FCM A;  2KO3 A;  3PRE A;  4WJN A;  4NJ6 A;  4AP4 C;  2RSU A;  4EUT A;  2LGX A;  2KN5 A;  4B95 A;  4HK2 A;  5L83 A;  1WGH A;  2M4N A;  3LJ3 A;  2KMA A;  3L08 A;  3QIJ A;  2CKH B;  3RZF A;  5CTR C;  4JL9 A;  3GZN I;  3PSE B;  4NQL B;  3PT2 B;  4CHK A;  3RCZ A;  5AZG A;  3UIP B;  2KC1 A;  3X0W A;  2Z0D B;  1WZ3 A;  1SE9 A;  3JVZ X;  1C1Y B;  3WA0 A;  2KQ7 A;  1WJN A;  3ZNH B;  4IWQ A;  1P9D U;  1WX7 A;  2WWZ A;  3WIM A;  3VTV A;  2I1J A;  1OGW A;  2PJH A;  4X57 B;  3PHW B;  5DPW A;  3K9P B;  5D7G A;  3VTW A;  1RRB A;  3ZKJ C;  3MJW A;  3JSV A;  2NR2 A;  2R2Q A;  4IWP A;  3QK0 A;  4MGZ E;  2N9X A;  3ZRC A;  3A4S C;  4BBN C;  3RZW C;  1X1M A;  1R4N I;  2PEA A;  4BKG A;  3X23 A;  1RAX A;  1WE6 A;  2ZPY A;  4MDK E;  3VHT C;  2LI5 A;  1MG8 A;  2JZZ A;  3WAL A;  4K7S A;  3SU8 X;  3KYC D;  3BY4 B;  3OAW A;  4HXD A;  4HLE A;  4GXB A;  1WM2 A;  2KVR A;  2L0F A;  3MTN B;  3ENE A;  2NBW B;  2V1Y A;  2DX5 B;  4KZC A;  5CX3 A;  2LWP A;  4PYZ A;  1SIF A;  3TJP A;  2MA9 B;  2MBH A;  1WMH B;  1K8R B;  1LM8 B;  3NHE B;  2MCN B;  2O2V A;  2L3Z A;  4W9L A;  2RPQ A;  3KH0 A;  3IBE A;  2KHW B;  2NPT A;  3MHS D;  2KTR A;  2LUE A;  4NAW A;  3SDL C;  2O2V B;  1E7U A;  4FN2 A;  2CHZ A;  2KTR B;  2N7E A;  4NAW B;  3V6E B;  4KSL C;  1KM7 A;  2L76 A;  2CS4 A;  4MEM A;  3H9D A;  2KDF B;  5LXH A;  1FXT B;  4G11 A;  1CMX B;  2C60 A;  1A5R A;  2JT4 B;  2D2Q A;  5DCN A;  3ZNZ B;  2LJ5 A;  1OEY A;  3QJZ A;  3APD A;  4IM0 A;  3ML8 A;  3V61 A;  2EMT A;  3ZO5 B;  2BWE S;  2IZV B;  1UBI A;  2WYQ A;  2B3A A;  2BF8 B;  3DOW A;  2EMS A;  3R66 C;  3VTU A;  3P2B A;  4HVB A;  4NQK E;  4IM2 A;  1NBF C;  2KOX A;  1KJT A;  3N32 A;  1L7Y A;  4FJV B;  5AEK B;  3DVG Y;  3ZVV A;  2RGF A;  2G45 B;  4KV2 A;  2DZJ A;  3DCG A;  3U30 A;  1YQB A;  4EKU A;  2CR5 A;  2GBJ A;  5CHW A;  2FCN A;  4M8M A;  4PS7 A;  2MBQ A;  2LZ6 A;  4LDT B;  3SD5 A;  3ZLZ A;  1J0G A;  1EO6 A;  1LQB A;  4DK5 A;  2KNB A;  4NNJ B;  2C5L C;  4B6W A;  2ZCB A;  1ZW7 A;  4GDK A;  1H8C A;  4URK A;  1I42 A;  4WJP A;  4K7W A;  2J7Q B;  4N9F 4;  4GIV A;  2D10 A;  2IO3 B;  2LRU A;  2C7N B;  2YVC A;  2FAZ A;  4GDL A;  2JY6 A;  4G0N B;  3HM3 A;  2KX3 A;  2MBB B;  5DPR A;  3JW0 X;  4G50 A;  2FCQ A;  4TQ0 A;  2K8H A;  3EHV A;  2GBK A;  1Y8R C;  2JXX A;  2MLB A;  3ONS A;  3PGE A;  3ZUN A;  2RD0 A;  3VDZ A;  1P0R A;  4RM9 A;  3DBH I;  4BKS A;  1UBQ A;  2OJR A;  4KZ0 A;  3QC8 B;  3PTF C;  5L95 C;  4ANU A;  2ZNV C;  4MSQ B;  1Z2M A;  2L8J A;  2JVC A;  2LXC A;  3PZD A;  3AU4 A;  3AXC A;  4A20 A;  2LRW A;  3DBL I;  3SHQ A;  3TBL D;  2KKC A;  3VH3 B;  3DDC B;  2MSE D;  4CO7 A;  2AYO B;  2KXJ A;  1NDD A;  3AI5 A;  3IVF A;  3UF8 A;  2FUH B;  3B1L X;  3PLU A;  3DVG X;  3H6N A;  2M8S A;  1RLF A;  2LVP A;  2L05 A;  4BBN F;  2LD9 A;  3PV1 A;  4RMA A;  3A4R A;  2IO2 B;  4BVU C;  2FNJ B;  1WGD A;  2BKF A;  2K8C A;  4ASW C;  3AU5 A;  3R7Q A;  3VUW A;  4II3 B;  1TGZ B;  1E7V A;  2OOB B;  1P3Q U;  4MGI E;  4WWO A;  5IAA C;  4FHJ A;  1KLV A;  2XEW A;  4II2 B;  3VUY A;  4JIO U;  3W1S C;  3H7S A;  2K1F A;  1C3T A;  4HCN B;  2HD5 B;  5E6P A;  1H4R A;  4WWN A;  1BT0 A;  3A9K A;  5JHA A;  3L13 A;  2PPH A;  2IO0 B;  4TV3 A;  2J0K A;  4W9J A;  4FLH A;  3A9K B;  3CF6 E;  2UYZ B;  4MJS A;  5CHV C;  3QA8 A;  1V2Y A;  2VRR B;  1UD7 A;  1OQY A;  4XC2 A;  3U8Z A;  4BKS D;  4MJS B;  2KMC A;  2NVU I;  1XD3 B;  1YX5 B;  2C7H A;  2REX A;  3PVL A;  4KVG B;  4PS8 A;  3PRP B;  2MWS B;  2ZVO A;  3Q3F A;  1WXA A;  2JUO A;  1G6J A;  1GC6 A;  3ZRF A;  1ISN A;  3DVN V;  2GBM A;  4DHJ B;  1WIA A;  3DPD A;  3ZDM C;  2BWF A;  4KIK B;  1WXM A;  3RUL A;  2KAN A;  5JHB A;  4OVV A;  5LXI B;  4IM3 A;  3QX1 A;  1OTR B;  3ZDT A;  5DPS A;  4W9D A;  3ZIM A;  3UIO B;  2KK8 A;  3ZW3 A;  3H1U A;  3KYD D;  4DDI D;  3TMP B;  4HPM B;  4A3O A;  4GB9 A;  3NOB A;  3O65 B;  1P1A A;  1WMH A;  2FIF A;  2CHW A;  1S3S G;  5D94 A;  1J19 A;  1WM3 A;  3RUI B;  4JLC A;  3EEC A;  1SGH A;  4FHK A;  2ZPN A;  2N7D A;  1M94 A;  3EC8 A;  2EKE C;  3NZS A;  2KC2 A;  2L0T A;  5KHO A;  3W1Y A;  4AUQ C;  2KX0 A;  3APC A;  4F8C B;  4HWI B;  3NY5 A;  1WJ4 A;  3VH4 B;  4EZJ A;  3ZTD A;  4HDO A;  5KHQ A;  2K6Q A;  2CU1 A;  2KFK B;  2J0J A;  2RR9 A;  3KUD B;  3Q3J A;  4FJZ A;  1V9J A;  1V6E A;  1Q0W B;  1UZX B;  4IUM B;  4XX5 A;  1WY8 A;  3EFU A;  4FAD A;  1E8Z A;  2ZZP B;  2ASQ A;  4DHJ D;  4AWJ A;  2AL6 A;  4JGH B;  4MH0 E;  1S1Q B;  4TUU A;  4G3X B;  2MBE A;  4EZK A;  4DXA B;  1JRU A;  2K25 A;  5J18 A;  4W9H A;  3H7P A;  2ZNV B;  3OJ4 B;  3VVW B;  3N3K B;  3PS6 A;  2G4S A;  3H7P B;  2KQS A;  2N9P C;  5IA7 A;  4PS3 A;  3T9L A;  4I6P A;  2BPS A;  3PPA A;  1I35 A;  2DYM A;  2MQJ A;  4HJK A;  1E8X A;  1QZE A;  4DHZ E;  4WJQ A;  5CHF A;  4GU2 A;  2DZI A;  2BGF A;  4GN1 A;  2DZK A;  3K9O B;  2LXA A;  4BFR A;  3IFW B;  4W9C A;  2KWV B;  4ICV A;  1WFY A;  2D3G A;  1Q5W B;  4E71 A;  3DBR I;  2PE9 A;  2D11 A;  3LDZ E;  4ZRJ A;  4OVU A;  1EUV B;  1TTN A;  2HTH A;  2ZVN A;  1OEY J;  4GSW A;  3VQI A;  1Z5S B;  3V62 A;  4WJO A;  2WDT B;  3S2A A;  1VCB A;  2N1W A;  4K7U A;  5E6O A;  3VXW A;  3KW5 B;  1YD8 U;  3UQB A;  4LJP B;  4B9K A;  4W9K A;  4BOZ B;  4EZL A;  3M63 B;  4ICU A;  1UH6 A;  2AWT A;  3L10 B;  2KJR A;  3CMM B;  3UGB B;  2QHO A;  3QWZ B;  4DBG A;  3IHP C;  4LDT D;  2KD0 A;  2KLG A;  4F7Z A;  3PLV A;  1XT9 B;  4DDG D;  1WJU A;  1J8C A;  5AZF A;  3V60 A;  3AUL A;  4BOS C;  2IO1 B;  3TCA A;  2KJ6 A;  3B0A A;  2AEH A;  2IBI B;  4F1S A;  1WJ6 A;  2LVQ A;  3I3T B;  4FJY A;  4K1R B;  2BYV E;  2KDE B;  2M17 A;  4LJO B;  3R3M A;  3VAW A;  1EF5 A;  5AZH A;  3M95 A;  4PYU A;  3PRM B;  3TL5 A;  3UIN B;  2GBN A;  2DHZ A;  3L54 A;  4W9G A;  4WAA A;  4FA6 A;  3L0W B;  3L16 A;  2JRI B;  2HJ8 A;  2N4F A;  4EFO A;  5JZE B;  2V4L A;  1WYW B;  4MSM B;  2D07 B;  4GOC A;  4DWF A;  4KDL B;  2DAF A;  2N9E B;  3HK0 A;  4RM8 A;  2KFJ A;  4KIK A;  2I1K A;  1WI0 A;  3UQA A;  1YIW A;  2K8B A;  4IG7 B;  2G3Q B;  4AJW A;  1V5T A;  3KUC B;  5JH5 C;  2GBR A;  1HE8 A;  2K6D B;  2MBO A;  4LCD E;  1WE7 A;  3HIZ A;  1GJZ A;  2JRH A;  1PQS A;  2JF5 A;  3TIX A;  3RYT A;  5G2N A;  5TR5 A;  2UWQ A;  5D6J B;  2MP2 A;  2GOW A;  2MRP A;  5BO4 B;  2L7R A;  1VD2 A;  4A3P A;  2A5U A;  1T0Y A;  2MP2 B;  2Z59 B;  4ZRI A;  1V81 A;  3NS8 A;  3DVN U;  2C7M B;  2MW5 A;  2BYF A;  2DEN B;  3ML9 A;  3WAO A;  3DBS A;  3ALB A;  4NY0 A;  5G55 A;  3JSV B;  4I6L B;  3KUZ A;  2KTF A;  2L00 B;  4AJY B;  1WRD B;  1RFA A;  5E6N A;  1E5W A;  2DZM A;  4MGK E;  3T8M A;  4JQW C;  1TBE A;  4MM3 A;  4M8N A;  4IW0 A;  2KFK A;  4GMV A;  3WAM A;  2XBB C;  5D2M B;  4KDI C;  4MGY E;  2AL3 A;  4HCP B;  2LGY A;  1EF1 A;  2LVO A;  1UGM A;  2BYE A;  4HPL B;  4M0W B;  4NPN A;  4FUL A;  4TKN A;  2GMI C;  4E3C A;  1E90 A;  3A9J A;  4YL8 A;  2KLC A;  1KOT A;  2NPT B;  2O6V A;  4ANX A;  1NI2 A;  4AOF A;  1WGG A;  3A9J B;  1TZ1 A;  3IG3 A;  1IYF A;  3DQV A;  1WF9 A;  2O6V B;  1P98 A;  4K81 A;  2K39 A;  2ZEQ A;  1WX9 A;  1ZKH A;  1GNU A;  4IC7 B;  3JYU A;  4E74 A;  3BIN A;  1F9J A;  4W9F A;  3R7R A;  1AAR A;  1V5O A;  5FR6 A;  5J17 A;  3WAP A;  3PHX B;  2KDB A;  2A4Z A;  2NCN A;  3VFK A;  2Y5B B;  3QQ8 B;  1Q1O A;  4P7I A;  1V49 A;  2NS5 A;  4ZRK A;  2M0X A;  3ECI A;  4KSK C;  4EEW A;  3ZNG C;  3OJ3 A;  3A1Q A;  3PRZ A;  4XZ4 A;  1GC7 A;  2KWU B;  3ZTC A;  2C9W B;  4IWO A;  3KVF B;  2NBU A;  3A1Q B;  5C23 A;  2JZ3 B;  1IPG A;  1V80 A;  2YLM A;  2BKR B;  2NBV B;  3W1S A;  2N1V A;  4FBJ B;  2IY1 B;  5J2R A;  5LLI A;  5HKH A;  3B08 A;  2LGD A;  1R4M I;  4NJ7 A;  1WXV A;  4WWP A;  2HE7 A;  3QCA A;  1L2N A;  4EOY A;  1WR1 A;  3V6C B;  3L17 A;  2JPH A;  3OLM D;  2V3S A;  5DPT A;  4ZYN A;  2WX0 A;  1E8W A;  4GDK B;  4J6I A;  3QAQ A;  1WGR A;  1LFD A;  3ZNI D;  2JWZ A;  1WH3 A;  2KZR A;  1WXS A;  2DAJ A;  3D32 A;  1IP9 A;  1V86 A;  1WZ0 A;  4GDL B;  2MX2 A;  4MEL A;  2IY0 B;  3M3J A;  3HHM A;  1YJ1 A;  4HDQ A;  3RT3 B;  2KWC A;  5C1Z A;  1YX6 B;  2O6V D;  3HM6 X;  3WAN A;  2IYD B;  4ANW A;  5GMV A;  3C0R B;  2KDI A;  5EDS A;  4GGQ A;  3RD2 A;  2DYB A;  2Z0E B;  1ZGU B;  4DHZ B;  3NZU A;  1WR6 E;  4ZDV A;  2FCS A;  3A33 B;  2ZCC A;  3APF A;  3GOE A;  1U4A A;  2J0M A;  2PE6 B;  3U7D A;  4I6N B;  1XQQ A;  2FID A;  1GUA B;  4W9I A;  2DYO A;  1GG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...