3QHTA

Crystal structure of the monobody ysmb-1 bound to yeast sumo
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
KPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Isoform-specific monobody inhibitors of small ubiquitin-related modifiers engineered using structure-guided library design.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags De novo protein
molecule keywords Ubiquitin-like protein SMT3
total genus 20
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3qhtA00
3PZDA 1WGRA 5L83A 1Z2MA 3P2BA 4WJNA 3O65B 1ISNA 4ZDVA 5CTRC 2N9XA 2BYEA 1WMHA 5FR6A 5AEKB 3RYTA 3DOWA 2LVQA 3WAMA 2WX0A 3H6NA 2RD0A 1SE9A 3A4SC 2WWZA 4KV2A 4DHZB 2G4SA 1V49A 3CF6E 2KDIA 2KQSA 2L0FA 5E6OA 4GOCA 2CHWA 3SU8X 3HIZA 2KJ6A 1WFYA 2BWFA 2CS4A 3ZNGC 1WJNA 4LJPB 1UBQA 5AZFA 2KC1A 1MG8A 4HVBA 1E8WA 1M94A 3HM6X 4GGQA 2O6VB 2LXCA 4KSKC 1P9DU 4I6NB 4AWJA 1WJUA 1EUVB 5CHFA 2LWPA 3WALA 3OAWA 2LVPA 4FHJA 1OGWA 2D10A 1A5RA 3V62A 2KANA 4ZYNA 2KX3A 4WJPA 1WZ3A 2O6VD 2MX2A 3ML8A 3PPAA 4FHKA 4ZRIA 4DXAB 4MJSA 3JYUA 2ZPYA 1Q1OA 4FULA 1UD7A 1TBEA 4F7ZA 2MBEA 2K1FA 3MJWA 1OEYJ 4J6IA 2KFJA 2PE6B 4PS8A 1WZ0A 2CU1A 2MP2B 3PGEA 3T8MA 1WXSA 2PPHA 1PQSA 2JRHA 3DVGX 1NDDA 2IO3B 3PSEB 2C7NB 2FUHB 3VQIA 3ZRCA 3JW0X 1WX7A 2RR9A 3ZRFA 4FADA 3IHPC 3ENEA 2PE9A 3K9PB 2JF5A 3ZIMA 3VUWA 2KXJA 5IAAC 2KOXA 4PS3A 2KWVB 4EZLA 1LFDA 3H9DA 3LJ3A 1GNUA 3UF8A 2IY0B 4IM0A 1TZ1A 2KJRA 3APFA 1VD2A 2LXAA 2ZJDA 2KD0A 1E7VA 4CHKA 2OJRA 4EZKA 2G4DB 3APCA 1ZGUB 2NVUI 2RSUA 3EECA 3U7DA 3VTWA 2DZKA 4NQKE 3APDA 4FA6A 2KLCA 1WMHB 1RAXA 2N7DA 4NAWA 2M4NA 4HDOA 4FJZA 2L3ZA 5JHBA 5DCNA 3KUDB 2JWZA 5IA7A 1YD8U 3PT2B 3KW5B 4EZJA 2GOWA 4K81A 1WF9A 2CHXA 3PVLA 2O6VA 3OJ4B 3PRZA 2KO3A 3C0RB 4HXDA 2GBRA 3QHTA 2NBVB 5G2NA 2XK5B 2QHOA 3WAPA 4FBJB 1JRUA 1GG3A 2K6DB 2LASA 2W9NA 4GMVA 3WA0A 5D7GA 3QA8A 1E8ZA 3PRMB 3WIMA 4FLHA 3ZO5B 2KJHB 2LI5A 3L08A 4W9LA 3W1YA 2KK8A 5E6NA 2K8BA 2L8JA 4HCPB 4W9DA 4IWPA 2ZNVB 2NR2A 4MM3A 4EOYA 3VFKA 3A9KB 4GB9A 4M8MA 1WGHA 1ZW7A 3UQBA 5KHQA 1YQBA 3ZNID 4WWNA 3IVFA 2ZPNA 3VUYA 2HJ8A 4G0NB 2AL6A 2REXA 3IBEA 2IZVB 4MGYE 4W9KA 3HM3A 2JRIB 2N1VA 4JGHB 5L95C 2KDFB 2LZ6A 2XEWA 4IM2A 4K7SA 2ZNVC 2KHWB 3NY5A 2ZVNA 4GSWA 2KMAA 2JT4B 2M8SA 3RZFA 1XQQA 4F1SA 3SDLC 3JSVA 4BKGA 3Q3JA 1WRDB 1KJTA 3NZUA 5BO4B 3JVZX 1YJ1A 3VH3B 4NAWB 3BY4B 3R66C 3U8ZA 3PV1A 3N3KB 2MW5A 4B6WA 2LVOA 3AULA 3ZDMC 1WX8A 2DX5B 1YX5B 2NS5A 2B3AA 3A4RA 2AYOB 2IO2B 1WH3A 2EMSA 1VCBA 2A5UA 4A3PA 4XZ4A 1CMXB 3V61A 4FN2A 4IW0A 2NCNA 3AXCA 3TIXA 5J2RA 3ZLZA 2KQ7A 2MBOA 2KDEB 2XK5A 3M95A 2JUOA 4HDQA 2BWES 2L00B 3B08A 2MLBA 4ZRKA 1WYWB 2D2QA 4P7IA 3A1QA 3QJZA 1XD3B 2M0XA 3ALBA 3D32A 3K9OB 2MCNB 5DPWA 1IP9A 1KM7A 4NNJB 3TMPB 1X1MA 4FJVB 4RMAA 2D07B 2GBKA 1T0YA 4WQOB 3DVNU 3ZDTA 3RZWC 3R7RA 5D6JB 4NJ6A 1WXAA 5J17A 3PLUA 4TQ0A 4B95A 1WGGA 2KVRA 2KTFA 2R2OA 2KFKB 4FJYA 5D94A 3UIOB 2JY6A 4IWOA 2UWQA 3R7QA 2HD5B 3A9KA 2MRPA 4LDTD 4X57B 4YL8A 3RUIB 4W9HA 4K7UA 2FCQA 2Z59B 3UINB 4URKA 2A4ZA 2KZRA 3N30A 1C1YB 3VH4B 4IC7B 4MGKE 2LUEA 1E8YA 2C60A 1Z5SB 2LD9A 1V81A 3TJPA 4DDID 3QK0A 3VVWB 1S3SG 2AL3A 4KZ0A 5JH5C 3U30A 4E74A 3ZNZB 3I3TB 2L05A 1LQBA 3GZNI 3UGBB 1J8CA 1P1AA 2ZZPB 3ECIA 2ASQA 3QC8B 2D3GA 4HWIB 3QWZB 2MQJA 2KMCA 2LRWA 3T9LA 4WWPA 1J0GA 3QARA 5CX3A 4AJWA 4WJOA 1LM8B 4HJKA 2MBHA 3Q3FA 3NOBA 4I6LB 3PLVA 1J19A 3ONSA 4GDKA 2LGXA 3GOEA 3H1UA 4K7WA 1EO6A 2DAFA 3WANA 2GMIC 3V6CB 1WI0A 3DVNV 3NS8A 4KDLB 3KUZA 3X23A 2EKEC 2JVCA 4BKSD 4BFRA 2PEAA 5E6PA 1KOTA 2KNBA 3DVGY 4HLEA 2V4LA 2DZJA 3B1LX 1WR6E 3QCAA 4AJYB 3MHSD 5LLIA 2IY1B 2WX1A 2N9EB 4AP4C 4II2B 1NBFC 2WDTB 3S2AA 2BYVE 3DQVA 4II3B 4MSMB 1R4NI 4EFOA 5AZHA 1WXMA 2DENB 2KX0A 2NBUA 4NJ7A 1WJ4A 4BKTA 1V9JA 4HPMB 5AZGA 2LJ5A 4HCNB 4WWOA 1P3QU 4W9FA 3EFUA 2NPTB 3RD2A 1WGDA 2JZ3B 2CKHB 3DBSA 1GC7A 2K6QA 2VRRB 2KFKA 4GDLA 2LRUA 1RRBA 4W9CA 2DZMA 2KTRA 2XBBC 2ZEQA 4DHZE 1H8CA 1WIAA 4GN1A 3VTUA 3AU4A 4WJQA 4IWQA 4GU2A 4MDKE 3PS6A 5D2MB 4RM9A 4N9F4 2JXXA 4DBGA 1V6EA 2DHZA 3PHWB 3VXWA 4B9KA 4F8CB 2BF8B 3TL5A 5KHOA 4G11A 2KC2A 2FIDA 4MEMA 1EF5A 3A9JB 3HK0A 3L54A 2AEHA 1WY8A 3DDCB 2YVCA 4DHJD 2KLGA 4KZCA 2I1KA 5TR5A 3H7PA 5LXIB 5C1ZA 5DPSA 2Z0EB 2BGFA 4NPNA 3UIPB 2DYMA 1WX9A 3VTVA 2C7MB 3PRPB 4ANVA 1GJZA 3DPDA 4ICVA 2LGDA 5JZEB 2FCMA 2BKRB 4BKSA 4GDKB 3AU5A 3RCZA 1V86A 2L76A 2K8CA 1UH6A 4PYUA 4W9JA 2L7RA 1E7UA 4G3XB 2N7EA 3R3MA 2KWCA 1GUAB 3OLMD 1R4MI 3WAOA 2J0MA 3L13A 3JSVB 2R2QA 3L17A 4DK5A 4IM3A 4XX5A 3MTNB 5DPTA 1I35A 2UYZB 1QZEA 3M62B 4M0WB 5GMVA 4IG7B 1D3ZA 1OQYA 4W9GA 2RGFA 1HE8A 1P0RA 1Q5WB 2C5LC 2C9WB 2FCNA 4KVGB 2KDBA 2NBWB 4ZRJA 2IBIB 4W9IA 3KUCB 2WYQA 5HKHA 3L10B 1YX6B 3X0WA 4CO7A 1BT0A 2J7QB 4K1RB 1ZKHA 4TUUA 1IPGA 1UZXB 1P98A 1TTNA 1V2YA 2IO1B 2NPTA 2BPSA 4MGIE 4ASWC 3ZNHB 2DYBA 3PTFC 4JQWC 3BINA 1L2NA 4GDLB 2K8HA 2L0TA 3A1QB 3KVFB 4PS7A 2K25A 1K8RB 4EEWA 2HE7A 4AUQC 4MJSB 3ZVVA 1WR1A 3DBHI 4MH0E 4I6PA 3CSTA 2DAJA 2ZVOA 2G3QB 4G50A 1V5TA 5J18A 2LGYA 4MELA 1UGMA 2Y5BB 3ML9A 3LDZE 5JHAA 2KN5A 2JZZA 3V6EB 1C3TA 5C23A 2N9PC 2HTHA 3L0WB 4E71A 2KWUB 4OVUA 2MSED 1RLFA 2M1MA 4KDIC 5G55A 4A3OA 1OEYA 1WXVA 4HPLB 1WGYA 1IYFA 3QQ8B 4M8NA 4EUTA 2MBQA 4XC2A 2DZIA 4BBNF 3EHVA 3N32A 2N4FA 4BVUC 2JPHA 4ANUA 3VAWA 3B0AA 2FIFA 2GBMA 1FXTB 1UBIA 3UQAA 4JLCA 1E8XA 4ANWA 4GXBA 2EMTA 2M17A 3KYDD 4A20A 1Y8RC 4DWFA 3M63B 4CYEA 1U4AA 3NZSA 4RM8A 2O2VA 2YLMA 5CHWA 1S1QB 2GBJA 4BBNC 4HK2A 1V5OA 4DHJB 1NI2A 4KIKA 3VDZA 3IG3A 1SIFA 3M3JA 3HHMA 3RT3B 3SHQA 4OVVA 1RFAA 1WM2A 4E3CA 5LXHA 3ZTCA 3W1SC 3VUXA 2G45B 3H7SA 2FNJB 3QIJA 4TKNA 1I42A 3VHTC 1SGHA 4DDGD 4IUMB 2MBBB 3A33B 3TBLD 2IO0B 1E5WA 2MWSB 1L7YA 1WM3A 1XT9B 2RPQA 5CHVC 3W1SA 3DBLI 3QAQA 2FCSA 2CHZA 4LCDE 4WAAA 4W9EA 2BKFA 1EF1A 4LDTB 2V3SA 4BOZB 2FAZA 1H4RA 3IFWB 2Z0DB 4LJOB 3SD5A 1AARA 4JIOU 3ZKJC 3CMMB 3PHXB 2KKCA 2AWTA 1WE6A 2GBNA 2KTRB 2V1YA 4MSQB 3NHEB 4TV3A 1F9JA 2N1WA 1YIWA 3DCGA 3KH0A 1LXDA 3CSFA 4GIVA 4MGZE 2K39A 2C7HA 1UELA 2J0JA 2D11A 2OOBB 3ZUNA 4NQLB 3DBRI 2IYDB 2MP2A 3L16A 4ANXA 1V80A 4BOSC 4NY0A 3ZW3A 2PJHA 4EKUA 1E90A 2CR5A 3A9JA 3KYCD 3OJ3A 3EC8A 2BYFA 3V60A 4KSLC 4PYZA 1TGZB 1KLVA 1WJ6A 5EDSA 3H7PB 1OTRB 2DYOA 1GC6A 2O2VB 5DPRA 3AI5A 4AOFA 1Q0WB 2MA9B 3TCAA 1G6JA 3RULA 2J0KA 3ZTDA 2ZCCA 4JL9A 4KIKB 1WE7A 4TQ1A 2ZCBA 4ICUA 3PREA 2I1JA 3QX1A
chains in the Genus database with same CATH superfamily
1WGRA 2KAJA 4WJNA 2BS2B 4LLGM 3O65B 1QOBA 2WX0A 2IGDA 4A90A 4DHZB 1ACCA 2L0FA 4L1BA 5E6OA 2CS4A 5AZFA 2KC1A 1E8WA 3HM6X 1FIQA 2AX5A 2YEPF 3WALA 2LWPA 1VJKA 2KANA 1WZ3A 1TS5A 4DXAB 4MJSA 3RNBC 2ZPYA 4FULA 1TBEA 4RGTA 1OEYJ 3KWLA 1IUEA 4DQOC 4CQNA 2L83A 2CU1A 2PPHA 1PQSA 3AMZA 4S0RA 3NVWA 4M00A 2V9HA 3ZRCA 3ZRFA 3ZIMA 2KXJA 2Y3AA 3R8BA 1VLBA 2WXFA 4PS3A 4EZLA 1LFDA 1XCTL 1GNUA 4IM0A 1TZ1A 1L0YB 1VD2A 3AEAB 2OJRA 4CHKA 4EZKA 2RDBC 3U7DA 1K53A 2DZKA 4NQKE 2VH2A 2KQ4X 2N7DA 4NAWA 4HDOA 4FJZA 5DCNA 4RH6A 2JWZA 3TUOA 2K3UA 3KW5B 2Z8LA 3I9V1 3N20C 1SB3C 4NJCA 3BZDB 1XLPA 2KDMA 2NBVB 2XK5B 1AYFA 4FBJB 1YOVB 4OVZA 2LASA 4FLHA 2LI5A 2KK8A 3MC9A 1DOIA 2L8JA 2WU5B 5H92C 2NR2A 4JPSA 1ZW7A 3UQBA 2PIAA 4ZHOA 4H2AA 1YQBA 4UDUC 2ZPNA 3IBEA 3HM3A 1R7SA 3RN9C 4EE2A 3GS2A 4K7SA 2WXMA 2KHWB 2K0PA 3SDLC 4BKGA 5G5HA 2KT7A 4NAWB 4KKJA 3R66C 2WLBA 3IAS1 2E6XA 3N3KB 4K3BA 3ZDMC 4C80A 2DX5B 1AW7A 2MEKA 2NS5A 3KLSX 2EMSA 3RNFC 2OHFA 2KQ7A 4JWSC 2WP9B 2L52A 3M95A 5FKAC 4US8A 3QJZA 3ALBA 5DPWA 3PZ7A 4RMAA 2GBKA 1EWCA 5D6JB 4NJ6A 1WXAA 1FD6A 2SAKA 3UIOB 4JX1C 3R7QA 4YL8A 3Q69A 4K7UA 4URKA 1YQ4B 2AQ1B 2KZRA 3VH4B 5TSSA 4MGKE 1S3SG 1YQ3B 4YWGG 3MP9A 1CQVA 1J8CA 1LQBA 2V0GA 1P1AA 5LNK1 3ECIA 2J52A 3Q3MC 3QC8B 1L4ZB 1J0GA 2HJ1A 5CX3A 4WJOA 1TJEA 1PUTA 2INNE 4RF0A 1D5ZC 1TIFA 3RNEC 3NOBA 4I6LB 3PLVA 1LGRA 1OQRA 2LGSA 1J19A 2DAFA 3V6CB 2VZKB 2JVCA 5FR3A 2KNBA 4HLEA 1WR6E 3DHHC 1Y56A 2NTTA 4C4VA 2K9XA 3S2AA 3AV8A 4II3B 1QLBB 5AZHA 2KX0A 2NBUA 3AEGB 5I4DA 2BS4B 4HPMB 3ZJUA 2KACA 3RD2A 5BYSA 1RYJA 3MHZA 1RRBA 2DZMA 2KTRA 1HTQA 1GB1A 3ZYYX 1TY2A 4IWQA 4GU2A 2K22A 1NEKB 4N9F4 4B9KA 3BYYB 3TL5A 1YN4A 3A9JB 3HK0A 1E10A 2AEHA 1WY8A 2YVCA 2KLGA 2I1KA 5LXIB 3UIPB 1WX9A 2G1EA 3AB5A 5JZEB 3AU5A 2WXJA 2IDYA 4N59A 1V86A 1E7UA 3R3MA 1GUAB 3BK1A 1N62A 1R4MI 1AWDA 4DK5A 4IM3A 4XX5A 3HVZA 3AEDB 5GMVA 1D3ZA 1OQYA 1HE8A 1P0RA 2C5LC 4KVGB 4MH8A 4LNNA 4RNAA 1QOAA 4W9IA 2L1AA 1ZKHA 1IPGA 1UZXB 2QDFA 4ASWC 2BPSA 3ZNHB 3Q2AC 4WIPA 3BINA 1QILA 4GDLB 1WSPA 1WRIA 1ZP0B 1WR1A 3DBHI 2CJNA 4HPPA 2ZVOA 4G50A 1V5TA 5J18A 4NAMA 3ML9A 2KN5A 1UF0A 2HTHA 2MSED 5G55A 4A3OA 1OEYA 1WXVA 1IYFA 4EUTA 4BBNF 2QCZA 1UBIA 3U4EG 4DWFA 3NVVA 4CYEA 3NZSA 4RM8A 2YLMA 1LO5D 2BBCA 5EE1A 4M0WA 1NI2A 4C7ZA 3IG3A 2K5PA 1FMAD 3RT3B 1UGJA 4E3CA 2PVOD 4TKNA 2IO0B 3BYTB 1WM3A 2RPQA 1MVKA 2WXQA 1K50A 4LCDE 4B0MA 4WAAA 4ACFA 4BOZB 2FAZA 1H4RA 2Z0DB 2GB1A 2AWTA 2OJWA 3BK2A 5HHDG 3RNCC 1F9JA 2QC8A 1YIWA 1EM7A 4GIVA 1HEZE 2W55A 3ZUNA 3DBRI 2FE8A 4C7YA 1V80A 4NY0A 1I4XA 2PJHA 1E90A 3OJ3A 3EC8A 2BYFA 5BYRA 1KLVA 5EDSA 4KGRA 1OTRB 4A8XC 1V97A 4AOFA 3TCAA 1YJIA 4JL9A 4KIKB 3W5VB 2ZCBA 1SE2A 1QKZA 3B2FA 4ZOHC 3QX1A 3PZDA 1Z2MA 3P2BA 1C4CA 2N9XA 5FR6A 5AEKB 4P1CC 3WAMA 3H6NA 1SE9A 3A4SC 1UWMA 1V49A 2G4SA 2N7JA 3HIZA 3B9JA 3ZNGC 1WJNA 4LJPB 1MG8A 2WXPA 1L4DB 2LHEA 2LXCA 4KSKC 1FNUA 1P9DU 1WYGA 2X8XX 5CHFA 4R3DA 1VZ7A 4REZA 2GLSA 3GE8C 2O6VD 3IXSA 4FHKA 4HKZE 1MHXA 3JYUA 1TT5B 1UD7A 4F7ZA 4ITKA 5EE0A 4J6IA 2KFJA 2PE6B 2WXRA 5C3JB 2IGGA 2JRHA 3Q8CA 1NDDA 1RFKA 3VRBB 2IO3B 2C7NB 3VQIA 2W54A 1WX7A 3JW0X 3K9PB 4L23A 3VUWA 5IAAC 2KOXA 4L2YA 5EE9A 3LJ3A 1E0ZA 2RMMA 2KJRA 2PLPA 1E7VA 1YN5A 1JW9D 1KTKA 3EECA 3APDA 3Q3NC 1TKEA 2N9KA 2W3SA 1RAXA 3KUDB 1FEHA 5IA7A 2N0SB 4K81A 3IT6B 3FILA 4HXDA 3QHTA 5G2NA 2IJ0A 3W5UB 5D7GA 3AM9A 1E8ZA 3ZO5B 3L08A 2K8BA 3MC0B 5MPOA 3A9KB 5KHQA 3ZNID 1TS4A 2HJ8A 2WHIA 2REXA 2VH1A 3AE8B 4OZAA 2KDFB 2JQRB 3RI7C 4ARIA 2KMAA 4LNIA 3LXFA 3Q8FA 2EKIA 3Q3JA 3Q8EA 1KJTA 4HJGE 3U8ZA 2KYWA 1I4PA 2MW5A 2I2YA 2G9HD 2B3AA 1R4NB 3E56A 4A9AA 1A70A 3TIXA 3ZLZA 1ZE3D 2MBOA 2KDEB 1WXQA 4HDQA 2MLBA 4ZRKA 3URYA 4LNOA 2D2QA 2D3BA 2M0XA 3D32A 1KM7A 3R2TA 2VZKD 1I7HA 1T0YA 1VRAB 5J17A 5BMGA 2KTFA 2R2OA 4FJYA 5D94A 1EU4A 2UWQA 4RCOA 1PYWD 2HD5B 2MRPA 3A9KA 4X57B 3RUIB 4W9HA 2Z59B 1V1PA 3N30A 1Z5SB 1V81A 3QK0A 2AL3A 4KZ0A 5JH5C 3CIRB 1FO4A 5IP4D 3ZNZB 2L05A 1TKYA 1IBXB 2QMTA 2D3GA 4HWIB 3ZXVA 2KMCA 2KN4A 3RNGC 4RFBA 3UI3A 2MBHA 4LNKA 1JWAD 1L6VA 3H1UA 3NRZA 1EO6A 1GOZA 1Q10A 3WANA 3DBRB 1WI0A 4USAA 3X23A 4P16A 4M02A 4BFRA 2PEAA 1C79A 2V4LA 3NJTA 3AE4B 4AJYB 5LLIA 2IY1B 1FPYA 2N9EB 1NBFC 3DQVA 2Q5WD 4EFOA 4NJ7A 3DHGC 4BKTA 3BIID 2LJ5A 1ZPSA 1DYQA 2BQQA 2JZ3B 3P42A 1GC7A 3E9SA 1I4RA 4GDLA 2ZEQA 1B1ZA 4MDKE 3PS6A 4RM9A 3PHWB 4F8CB 2FIDA 3SFDB 1T5XD 4AQ7A 4DHJD 5TR5A 1XCQL 2BGFA 2DYMA 2C7MB 1GJZA 1FRRA 4ICVA 2FCMA 4BKSA 4ZRPA 5FK9C 3RCZA 4XE0A 1BMLC 3IT4B 4TSSA 2J0MA 3L17A 3JSVB 1F2RC 4M0WB 1JMLA 1Q5WB 1N5WA 2C9WB 2KDBA 4ZRJA 3EUB2 4YSXB 2WYQA 5JXVA 3L10B 1MI0A 1YX6B 3X0WA 4CO7A 2J7QB 4K1RB 4BZAA 2WXNA 1D5XC 1P98A 1SBBB 1GAQB 1NYQA 4AS1A 4HEA1 2IPKD 1L2NA 4WQMA 2L0TA 5HI1A 2JSVX 2K25A 3OWEB 2HE7A 2KVZA 4MJSB 3ZVVA 2AQ3B 1TY0A 4MT5A 2G3QB 2PW9A 5BMIA 5JHAA 2LMCA 2JZZA 3NUHB 3T3NA 2MJDA 1RLFA 4KDIC 3NG0A 5C2TB 1CZPA 1WGYA 2V3PA 3QQ8B 1MHHE 3EHVA 1FRDA 4ANUA 1FXAA 3B0AA 2FIFA 1FXTB 1K52A 3U52E 1JCKB 1TKGA 3VR8B 3MFGA 4GXBA 2EMTA 2M17A 4KGTA 5GXGB 1C77A 1ZXIA 1L0XB 4KIKA 3NVYA 3VRAB 1RFAA 1N63A 3L4PA 1BUIC 1P7FA 2ACZB 2G45B 3H7SA 1I42A 3VHTC 1SGHA 4DDGD 2MBBB 1XT9B 3TEZA 3BWUD 2CHZA 1KLUD 1EF1A 2BB5A 3ZKJC 4JIOU 3CMMB 3PHXB 1WE6A 2BB6A 2KTRB 4N58A 4TV3A 3KH0A 2J42A 1LXDA 3TSSA 2K39A 1B9RA 3AE7B 4NQLB 3J9CA 2MP2A 4BOSC 2BVCA 1QT9A 3V60A 4KSLC 2IGHA 4GLSC 4YXDB 1TGZB 1WJ6A 2DYOA 3RNAC 1GC6A 3AEFB 5DPRA 1Q0WB 1YNTE 1G6JA 2RDHA 4HROA 1XLOA 3ZTDA 1SIJA 1HA5A 1WE7A 1L0VB 1ROEA 5L83A 1QOFA 1ISNA 4ZDVA 5CTRC 1DOXA 2RD0A 1SXTA 4KV2A 1HZ6A 3CF6E 2KJ6A 2BWFA 4OHJA 4PT5A 1JROA 2HTME 3HVDA 3AE1B 1EUVB 3OAWA 2LVPA 2V3NA 4FHJA 1OGWA 2D10A 1A5RA 4OW0A 4LTUA 3ML8A 1HQRD 4ZRIA 2MBEA 2K1FA 3MJWA 1N60A 1STEA 1YMHE 3C8YA 2DWQA 2MP2B 3T8MA 1WXSA 1GB4A 3DVGX 2FUHB 3ABVB 2RR9A 3IHPC 2PE9A 1XLQA 2JF5A 2YEPB 2PKOA 5IN7A 3V05A 2GI9A 1UWXA 2KWVB 3H9DA 4KX6B 1DOYA 2IY0B 3APFA 1T0SC 2DLBA 1ET9A 1ENFA 4OZCA 1ZGUB 2NVUI 2RSUA 2DNFA 3AE3B 3AN1A 2M4NA 2L3ZA 1QQRA 3PT2B 3HUIA 4EZJA 2GOWA 1WF9A 3ZGZA 2CHXA 1SEBD 3PVLA 2O6VA 3OJ4B 2INPE 3BVZA 2PTLA 2QHOA 3WAPA 2K6DB 2W9NA 4GMVA 3QA8A 4W9LA 4IDIA 2LEKA 5E6NA 3LB8C 4IWPA 4MM3A 3VFKA 4GB9A 4M8MA 1RM6C 2INDC 4IKGA 4G0NB 4WH4A 2QIEB 4W9KA 1MPEA 2JRIB 2N1VA 4JGHB 5L95C 2XEWA 2LZ6A 4IM2A 2ZNVC 2WU2B 2ZVNA 4GSWA 2JT4B 2M8SA 3HRDD 2RDGA 2WXIA 3JVZX 1YJ1A 2L32A 2BTEA 3PV1A 4B6WA 1WX8A 4Q2JA 2DBYA 2WXGA 2IO2B 1WH3A 2A5UA 1FCLA 1CMXB 5BMHA 2D3CA 4IW0A 2NCNA 3I63C 3AXCA 5J2RA 1ZUD2 3ZJVA 2BWES 2L00B 3B08A 1WYWB 4P7IA 3A1QA 1XD3B 4YSYB 3AE6B 2MCNB 1IP9A 3GP7A 4NNJB 1X1MA 1VZ8A 2D07B 4WQOB 3ZDTA 3VR9B 1E9MA 4B95A 2KFKB 4MM3B 2ON8A 2JY6A 2QJLA 4JE3B 3UINB 1JRPA 1C1YB 4IC7B 4YSZB 2LUEA 1E8YA 2LD9A 1ZOYB 1J7AA 4DDID 1HXYD 4RGMA 2ICIA 3ZJTA 2FUG1 3U30A 1XEEA 3I3TB 3GZNI 3UGBB 2ZZPB 3QWZB 2MQJA 3T9LA 1QOGA 4WWPA 4AJWA 1LM8B 3Q3OC 3RFZB 4QAYA 1FFUA 2W3RA 3Q3FA 4RGOS 2GRIA 2LGXA 4K7WA 2GMIC 1KFYB 3DVNV 3AH7A 5E6PA 3DVGY 3B1LX 2WDRB 4AP4C 4II2B 4MSMB 1R4NI 1WXMA 2DENB 3W9CB 2H88B 1WJ4A 1V9JA 1KH0A 3DBLB 1P3QU 4W9FA 5E6JA 2INCC 2HDEA 2CKHB 5D3DA 2VRRB 2KFKA 2LRUA 4DHZE 1JWMD 2XBBC 1T0QC 1WIAA 4GN1A 4ZYSA 2KWDA 2WGSA 3I57A 5D2MB 1V6EA 3VXWA 3DHIC 1JQ4A 1PGXA 1FNVA 2KC2A 4G11A 1EF5A 2MJ3A 3L54A 3NZ3A 4YTPB 1ESFA 3EGRA 4KZCA 3H7PA 2Z0EB 3AECB 4M01A 3VTVA 4ANVA 1C76A 3FC4A 2LGDA 2BKRB 2K8CA 2WXOA 2N7EA 2KWCA 3OLMD 5IKCM 2R2QA 3N9YC 5AUIA 1FM0D 1I35A 2UYZB 1QZEA 3M62B 5T8IA 3P4RB 3ZQ4A 2RGFA 2RPVA 2FCNA 2NBWB 2IBIB 1T0RC 3W2DA 2H89B 2WXKA 2ZW1A 2AQ2B 1TTNA 2NPTA 2IO1B 2R61A 2JU6X 4DXGA 3PTFC 4JQWC 1JWBD 2MHJA 2K8HA 4EEWA 4ARCA 1D4BA 2V4IB 3BVGA 2WXLA 3CSTA 3NS1A 1NYRA 2DAJA 1UGMA 2LGIA 4J3OD 4A55A 2M0AA 3V6EB 1C3TA 5C23A 2N9PC 3L0WB 2E3TA 4E71A 2KWUB 2FBWB 1N61A 1V1PB 3P4PB 2BS3B 4HPLB 1PFDA 2NMQA 1T3QA 3N32A 2N4FA 3VAWA 1E7PB 1E6EB 4JLCA 1IGDA 3KYDD 3M63B 2O2VA 2GBJA 4BBNC 1OFFA 2J4XA 3N1ZC 4HK2A 3VDZA 1SIFA 3M3JA 3HHMA 3BVMA 4OVVA 1FFVA 4P6VF 3ZTCA 3W1SC 1SE4A 2FNJB 2KMMA 3FILB 1YN3A 3A33B 1CJEA 2MWSB 3AEBB 1L7YA 2JZPA 3DBLI 3DWMA 1JALA 2FCSA 3QAQA 2EELA 4W9EA 2BKFA 2X38A 4LDTB 4LJOB 1F52A 1N5XA 2GBNA 1TZOA 2V1YA 2LUMA 4MSQB 3NHEB 1VZ6A 2N1WA 3CSFA 4MGZE 1UELA 3FKYA 2D11A 2OOBB 3C19A 3TEXA 3R2IA 1XO3A 5BYQA 3L16A 3FAHA 4RF1A 1I4GA 3GB1A 3ZW3A 4LK0M 2W82A 2CR5A 2CU3A 3A9JA 3KYCD 4PYZA 1I4QA 1J7CA 2PVGC 2O2VB 2MA9B 3GZNB 4XWTA 5HG2A 1WGKA 4TQ1A 3N1XC 3T3OA 3PREA 2I1JA 3SFEB 4EKUA 2J53A 1GPXA 2BYEA 1WMHA 1SE3A 3RYTA 3DOWA 2LVQA 3MC8A 2WWZA 1R4MB 1ZDXA 2KDIA 3OG5A 2KQSA 4GOCA 2CHWA 3SU8X 1WFYA 1UBQA 2N9LA 4HVBA 3O13A 1M94A 3AE5B 4GGQA 2O6VB 4LNFA 1SF0A 4I6NB 4AWJA 1WJUA 5IOIA 3V62A 3P1MA 4ZYNA 4MACA 2KX3A 1NENB 4WJPA 3PPAA 2MX2A 3DWGC 1Q1OA 2M56B 4XYCA 1EU3A 4PS8A 1WZ0A 3PGEA 1IGCA 3I5JC 3P63A 3PSEB 1F77A 1KF6B 4FADA 3ENEA 1J7BA 1HTOA 2XN9C 2QSDA 3UF8A 4B0EA 2UU7A 4WAFA 3TEYA 2LXAA 2ZJDA 2KD0A 3IAM1 2JXTA 2G4DB 3APCA 3VTWA 4FA6A 3Q8BA 2KLCA 1WMHB 3EFCA 2I38A 5JHBA 1TS2A 2NTSA 1FXIA 1YD8U 4C4VB 1K51A 1MG4A 4S17A 2BYTA 3PRZA 2KO3A 3C0RB 3AEEB 2GBRA 2MH7A 3TEWA 4A6QA 1JRUA 1GG3A 1UUPA 3WA0A 3PRMB 3WIMA 3N1YC 2KJHB 2JYEA 3W1YA 2WDQB 4OZBA 4HCPB 4W9DA 3WCQA 2ZNVB 3CWIA 4EOYA 1V8CA 1WGHA 2CJOA 1F2RI 1FNWA 1TYGB 4WWNA 3IVFA 1CK1A 3VUYA 2WNMA 4MGYE 4DXFA 2AL6A 2IZVB 3Q14C 4HKQA 3NY5A 3RZFA 5AUKA 2BT6A 4N6EB 1XQQA 4F1SA 3JSVA 1WRDB 3NZUA 5BO4B 3SEBA 3VH3B 3AE9B 3BY4B 4JWUC 1YJJA 2LVOA 3AULA 1MJDA 3RMKC 1YX5B 3PZ8A 2Y5PA 1L6UA 1D6EC 3A4RA 2AYOB 1VCBA 4A3PA 4XZ4A 5EE3A 3V61A 4FN2A 5IO9A 2BW2A 3GE3C 3P4QB 2XK5A 2JUOA 1F1HA 1ZXHA 2D5GA 5D3IB 3K9OB 3TMPB 4FJVB 4BAXA 4NZLB 3DVNU 4C56C 1TS3A 3R7RA 3RZWC 3PLUA 4TQ0A 1WGGA 2KVRA 1RWSA 4IWOA 4LDTD 2FCQA 2A4ZA 4YTMB 2C60A 3TJPA 5HFYA 3VVWB 1FCCC 4E74A 3P4SB 5G5GA 2ASQA 1XXGA 2LRWA 2LFIA 3QARA 4HJKA 2LHDA 2JWUA 3PO0A 4GDKA 3ONSA 3GOEA 2M19A 1OQQA 1WWTA 3NVZA 4WURA 1KLGD 2WQYB 3NS8A 4KDLB 3KUZA 2EKEC 4TMAB 4BKSD 1ET6A 1KOTA 3V3XA 4PK1A 2DZJA 3QCAA 3MHSD 2WX1A 1SJHD 2WDVB 2WDTB 2BYVE 1C4AA 2Y5CA 1NI3A 5AZGA 4K3CA 4HCNB 4WWOA 4IOIE 1DGJA 2NPTB 3EFUA 1C9FA 1WGDA 3DBSA 3LYYA 4W9CA 2K6QA 4YTNB 1JWUD 3H8HA 2LJIA 1H8CA 3AE2B 3Q6BA 3VTUA 3AU4A 4WJQA 3ETRA 2JXXA 1HZ5A 4DBGA 2DHZA 2XNAC 2BF8B 5KHOA 1JWSD 4MEMA 1XLNA 2B76B 3DDCB 1KRHA 4D2KA 4YT0B 5C1ZA 5DPSA 4NPNA 1L5PA 3PRPB 1ZDVA 3DPDA 4P1BC 2WXHA 4GDKB 1D5MC 4WWMA 4ZRQA 2L76A 1UH6A 4PYUA 4W9JA 2L7RA 4G3XB 1PGBA 3WAOA 3L13A 1NVID 2ZW0A 2JX5A 3KWVA 3MTNB 3SR6A 5DPTA 4IG7B 3Q8AA 4W9GA 4O1NA 1F0ZA 3KUCB 1V1OA 5HKHA 1N6ZA 1BXTA 1BT0A 4TUUA 3KQ4A 1V2YA 4MGIE 1QF6A 2DYBA 4US9A 3KVFB 3A1QB 4PS7A 1K8RB 1C78A 4AUQC 4MH0E 4I6PA 2LGYA 4MELA 2TSSA 1SSNA 1VR9A 4XDCA 4KGSA 2Y5BB 3LDZE 4FXCA 4XGAB 4ZHPA 4OVUA 1AN8A 2M1MA 3EA6A 4RGNA 4M8NA 4C00A 2MBQA 4XC2A 2DZIA 4BVUC 2JPHA 2GBMA 1IBXA 3UQAA 5H8YE 1E8XA 1SJED 4A20A 4ANWA 1Y8RC 3MJ5A 1U4AA 2D3AA 1UNSA 5CHWA 1S1QB 1V5OA 1P7EA 1XF5L 4DHJB 1PDXA 3U7ZA 3SHQA 1WM2A 5LXHA 3VUXA 4HRSA 3QIJA 4IUMB 3TBLD 4KKIA 1E5WA 4XDDA 2QILA 3U2SC 5CHVC 2WS3B 3W1SA 2OEDA 2V3SA 2ONQA 3IFWB 3SD5A 1AARA 3ZXRA 1EWYC 2KKCA 4XWWA 1I4HA 2MJEA 1C4PA 1M4VA 2SEBD 3DCGA 3B2GA 2C7HA 2J0JA 2PMVA 2IYDB 3RPFC 4ANXA 1T6BX 3DBHB 1MFWA 2JYTA 3H7PB 2QEJC 3AI5A 3RULA 2J0KA 2ZCCA 4ICUA 1PGAA 1VDVA
chains in the Genus database with same CATH topology
3PZDA 1WGRA 5L83A 1Z2MA 3P2BA 4WJNA 3O65B 1ISNA 4ZDVA 5CTRC 2N9XA 2BYEA 1WMHA 5FR6A 5AEKB 3RYTA 3DOWA 2LVQA 3WAMA 2WX0A 3H6NA 2RD0A 1SE9A 3A4SC 2WWZA 4KV2A 4DHZB 2G4SA 1V49A 3CF6E 2KDIA 2KQSA 2L0FA 5E6OA 4GOCA 2CHWA 3SU8X 3HIZA 2KJ6A 1WFYA 2BWFA 2CS4A 3ZNGC 1WJNA 4LJPB 1UBQA 5AZFA 2KC1A 1MG8A 4HVBA 1E8WA 1M94A 3HM6X 4GGQA 2O6VB 2LXCA 4KSKC 1P9DU 4I6NB 4AWJA 1WJUA 1EUVB 5CHFA 2LWPA 3WALA 3OAWA 2LVPA 4FHJA 1OGWA 2D10A 1A5RA 3V62A 2KANA 4ZYNA 2KX3A 4WJPA 1WZ3A 2O6VD 2MX2A 3ML8A 3PPAA 4FHKA 4ZRIA 4DXAB 4MJSA 3JYUA 2ZPYA 1Q1OA 4FULA 1UD7A 1TBEA 4F7ZA 2MBEA 2K1FA 3MJWA 1OEYJ 4J6IA 2KFJA 2PE6B 4PS8A 1WZ0A 2CU1A 2MP2B 3PGEA 3T8MA 1WXSA 2PPHA 1PQSA 2JRHA 3DVGX 1NDDA 2IO3B 3PSEB 2C7NB 2FUHB 3VQIA 3ZRCA 3JW0X 1WX7A 2RR9A 3ZRFA 4FADA 3IHPC 3ENEA 2PE9A 3K9PB 2JF5A 3ZIMA 3VUWA 2KXJA 5IAAC 2KOXA 4PS3A 2KWVB 4EZLA 1LFDA 3H9DA 3LJ3A 1GNUA 3UF8A 2IY0B 4IM0A 1TZ1A 2KJRA 3APFA 1VD2A 2LXAA 2ZJDA 2KD0A 1E7VA 4CHKA 2OJRA 4EZKA 2G4DB 3APCA 1ZGUB 2NVUI 2RSUA 3EECA 3U7DA 3VTWA 2DZKA 4NQKE 3APDA 4FA6A 2KLCA 1WMHB 1RAXA 2N7DA 4NAWA 2M4NA 4HDOA 4FJZA 2L3ZA 5JHBA 5DCNA 3KUDB 2JWZA 5IA7A 1YD8U 3PT2B 3KW5B 4EZJA 2GOWA 4K81A 1WF9A 2CHXA 3PVLA 2O6VA 3OJ4B 3PRZA 2KO3A 3C0RB 4HXDA 2GBRA 3QHTA 2NBVB 5G2NA 2XK5B 2QHOA 3WAPA 4FBJB 1JRUA 1GG3A 2K6DB 2LASA 2W9NA 4GMVA 3WA0A 5D7GA 3QA8A 1E8ZA 3PRMB 3WIMA 4FLHA 3ZO5B 2KJHB 2LI5A 3L08A 4W9LA 3W1YA 2KK8A 5E6NA 2K8BA 2L8JA 4HCPB 4W9DA 4IWPA 2ZNVB 2NR2A 4MM3A 4EOYA 3VFKA 3A9KB 4GB9A 4M8MA 1WGHA 1ZW7A 3UQBA 5KHQA 1YQBA 3ZNID 4WWNA 3IVFA 2ZPNA 3VUYA 2HJ8A 4G0NB 2AL6A 2REXA 3IBEA 2IZVB 4MGYE 4W9KA 3HM3A 2JRIB 2N1VA 4JGHB 5L95C 2KDFB 2LZ6A 2XEWA 4IM2A 4K7SA 2ZNVC 2KHWB 3NY5A 2ZVNA 4GSWA 2KMAA 2JT4B 2M8SA 3RZFA 1XQQA 4F1SA 3SDLC 3JSVA 4BKGA 3Q3JA 1WRDB 1KJTA 3NZUA 5BO4B 3JVZX 1YJ1A 3VH3B 4NAWB 3BY4B 3R66C 3U8ZA 3PV1A 3N3KB 2MW5A 4B6WA 2LVOA 3AULA 3ZDMC 1WX8A 2DX5B 1YX5B 2NS5A 2B3AA 3A4RA 2AYOB 2IO2B 1WH3A 2EMSA 1VCBA 2A5UA 4A3PA 4XZ4A 1CMXB 3V61A 4FN2A 4IW0A 2NCNA 3AXCA 3TIXA 5J2RA 3ZLZA 2KQ7A 2MBOA 2KDEB 2XK5A 3M95A 2JUOA 4HDQA 2BWES 2L00B 3B08A 2MLBA 4ZRKA 1WYWB 2D2QA 4P7IA 3A1QA 3QJZA 1XD3B 2M0XA 3ALBA 3D32A 3K9OB 2MCNB 5DPWA 1IP9A 1KM7A 4NNJB 3TMPB 1X1MA 4FJVB 4RMAA 2D07B 2GBKA 1T0YA 4WQOB 3DVNU 3ZDTA 3RZWC 3R7RA 5D6JB 4NJ6A 1WXAA 5J17A 3PLUA 4TQ0A 4B95A 1WGGA 2KVRA 2KTFA 2R2OA 2KFKB 4FJYA 5D94A 3UIOB 2JY6A 4IWOA 2UWQA 3R7QA 2HD5B 3A9KA 2MRPA 4LDTD 4X57B 4YL8A 3RUIB 4W9HA 4K7UA 2FCQA 2Z59B 3UINB 4URKA 2A4ZA 2KZRA 3N30A 1C1YB 3VH4B 4IC7B 4MGKE 2LUEA 1E8YA 2C60A 1Z5SB 2LD9A 1V81A 3TJPA 4DDID 3QK0A 3VVWB 1S3SG 2AL3A 4KZ0A 5JH5C 3U30A 4E74A 3ZNZB 3I3TB 2L05A 1LQBA 3GZNI 3UGBB 1J8CA 1P1AA 2ZZPB 3ECIA 2ASQA 3QC8B 2D3GA 4HWIB 3QWZB 2MQJA 2KMCA 2LRWA 3T9LA 4WWPA 1J0GA 3QARA 5CX3A 4AJWA 4WJOA 1LM8B 4HJKA 2MBHA 3Q3FA 3NOBA 4I6LB 3PLVA 1J19A 3ONSA 4GDKA 2LGXA 3GOEA 3H1UA 4K7WA 1EO6A 2DAFA 3WANA 2GMIC 3V6CB 1WI0A 3DVNV 3NS8A 4KDLB 3KUZA 3X23A 2EKEC 2JVCA 4BKSD 4BFRA 2PEAA 5E6PA 1KOTA 2KNBA 3DVGY 4HLEA 2V4LA 2DZJA 3B1LX 1WR6E 3QCAA 4AJYB 3MHSD 5LLIA 2IY1B 2WX1A 2N9EB 4AP4C 4II2B 1NBFC 2WDTB 3S2AA 2BYVE 3DQVA 4II3B 4MSMB 1R4NI 4EFOA 5AZHA 1WXMA 2DENB 2KX0A 2NBUA 4NJ7A 1WJ4A 4BKTA 1V9JA 4HPMB 5AZGA 2LJ5A 4HCNB 4WWOA 1P3QU 4W9FA 3EFUA 2NPTB 3RD2A 1WGDA 2JZ3B 2CKHB 3DBSA 1GC7A 2K6QA 2VRRB 2KFKA 4GDLA 2LRUA 1RRBA 4W9CA 2DZMA 2KTRA 2XBBC 2ZEQA 4DHZE 1H8CA 1WIAA 4GN1A 3VTUA 3AU4A 4WJQA 4IWQA 4GU2A 4MDKE 3PS6A 5D2MB 4RM9A 4N9F4 2JXXA 4DBGA 1V6EA 2DHZA 3PHWB 3VXWA 4B9KA 4F8CB 2BF8B 3TL5A 5KHOA 4G11A 2KC2A 2FIDA 4MEMA 1EF5A 3A9JB 3HK0A 3L54A 2AEHA 1WY8A 3DDCB 2YVCA 4DHJD 2KLGA 4KZCA 2I1KA 5TR5A 3H7PA 5LXIB 5C1ZA 5DPSA 2Z0EB 2BGFA 4NPNA 3UIPB 2DYMA 1WX9A 3VTVA 2C7MB 3PRPB 4ANVA 1GJZA 3DPDA 4ICVA 2LGDA 5JZEB 2FCMA 2BKRB 4BKSA 4GDKB 3AU5A 3RCZA 1V86A 2L76A 2K8CA 1UH6A 4PYUA 4W9JA 2L7RA 1E7UA 4G3XB 2N7EA 3R3MA 2KWCA 1GUAB 3OLMD 1R4MI 3WAOA 2J0MA 3L13A 3JSVB 2R2QA 3L17A 4DK5A 4IM3A 4XX5A 3MTNB 5DPTA 1I35A 2UYZB 1QZEA 3M62B 4M0WB 5GMVA 4IG7B 1D3ZA 1OQYA 4W9GA 2RGFA 1HE8A 1P0RA 1Q5WB 2C5LC 2C9WB 2FCNA 4KVGB 2KDBA 2NBWB 4ZRJA 2IBIB 4W9IA 3KUCB 2WYQA 5HKHA 3L10B 1YX6B 3X0WA 4CO7A 1BT0A 2J7QB 4K1RB 1ZKHA 4TUUA 1IPGA 1UZXB 1P98A 1TTNA 1V2YA 2IO1B 2NPTA 2BPSA 4MGIE 4ASWC 3ZNHB 2DYBA 3PTFC 4JQWC 3BINA 1L2NA 4GDLB 2K8HA 2L0TA 3A1QB 3KVFB 4PS7A 2K25A 1K8RB 4EEWA 2HE7A 4AUQC 4MJSB 3ZVVA 1WR1A 3DBHI 4MH0E 4I6PA 3CSTA 2DAJA 2ZVOA 2G3QB 4G50A 1V5TA 5J18A 2LGYA 4MELA 1UGMA 2Y5BB 3ML9A 3LDZE 5JHAA 2KN5A 2JZZA 3V6EB 1C3TA 5C23A 2N9PC 2HTHA 3L0WB 4E71A 2KWUB 4OVUA 2MSED 1RLFA 2M1MA 4KDIC 5G55A 4A3OA 1OEYA 1WXVA 4HPLB 1WGYA 1IYFA 3QQ8B 4M8NA 4EUTA 2MBQA 4XC2A 2DZIA 4BBNF 3EHVA 3N32A 2N4FA 4BVUC 2JPHA 4ANUA 3VAWA 3B0AA 2FIFA 2GBMA 1FXTB 1UBIA 3UQAA 4JLCA 1E8XA 4ANWA 4GXBA 2EMTA 2M17A 3KYDD 4A20A 1Y8RC 4DWFA 3M63B 4CYEA 1U4AA 3NZSA 4RM8A 2O2VA 2YLMA 5CHWA 1S1QB 2GBJA 4BBNC 4HK2A 1V5OA 4DHJB 1NI2A 4KIKA 3VDZA 3IG3A 1SIFA 3M3JA 3HHMA 3RT3B 3SHQA 4OVVA 1RFAA 1WM2A 4E3CA 5LXHA 3ZTCA 3W1SC 3VUXA 2G45B 3H7SA 2FNJB 3QIJA 4TKNA 1I42A 3VHTC 1SGHA 4DDGD 4IUMB 2MBBB 3A33B 3TBLD 2IO0B 1E5WA 2MWSB 1L7YA 1WM3A 1XT9B 2RPQA 5CHVC 3W1SA 3DBLI 3QAQA 2FCSA 2CHZA 4LCDE 4WAAA 4W9EA 2BKFA 1EF1A 4LDTB 2V3SA 4BOZB 2FAZA 1H4RA 3IFWB 2Z0DB 4LJOB 3SD5A 1AARA 4JIOU 3ZKJC 3CMMB 3PHXB 2KKCA 2AWTA 1WE6A 2GBNA 2KTRB 2V1YA 4MSQB 3NHEB 4TV3A 1F9JA 2N1WA 1YIWA 3DCGA 3KH0A 1LXDA 3CSFA 4GIVA 4MGZE 2K39A 2C7HA 1UELA 2J0JA 2D11A 2OOBB 3ZUNA 4NQLB 3DBRI 2IYDB 2MP2A 3L16A 4ANXA 1V80A 4BOSC 4NY0A 3ZW3A 2PJHA 4EKUA 1E90A 2CR5A 3A9JA 3KYCD 3OJ3A 3EC8A 2BYFA 3V60A 4KSLC 4PYZA 1TGZB 1KLVA 1WJ6A 5EDSA 3H7PB 1OTRB 2DYOA 1GC6A 2O2VB 5DPRA 3AI5A 4AOFA 1Q0WB 2MA9B 3TCAA 1G6JA 3RULA 2J0KA 3ZTDA 2ZCCA 4JL9A 4KIKB 1WE7A 4TQ1A 2ZCBA 4ICUA 3PREA 2I1JA 3QX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZD A;  1WGR A;  5L83 A;  1Z2M A;  3P2B A;  4WJN A;  3O65 B;  1ISN A;  4ZDV A;  5CTR C;  2N9X A;  2BYE A;  1WMH A;  5FR6 A;  5AEK B;  3RYT A;  3DOW A;  2LVQ A;  3WAM A;  2WX0 A;  3H6N A;  2RD0 A;  1SE9 A;  3A4S C;  2WWZ A;  4KV2 A;  4DHZ B;  2G4S A;  1V49 A;  3CF6 E;  2KDI A;  2KQS A;  2L0F A;  5E6O A;  4GOC A;  2CHW A;  3SU8 X;  3HIZ A;  2KJ6 A;  1WFY A;  2BWF A;  2CS4 A;  3ZNG C;  1WJN A;  4LJP B;  1UBQ A;  5AZF A;  2KC1 A;  1MG8 A;  4HVB A;  1E8W A;  1M94 A;  3HM6 X;  4GGQ A;  2O6V B;  2LXC A;  4KSK C;  1P9D U;  4I6N B;  4AWJ A;  1WJU A;  1EUV B;  5CHF A;  2LWP A;  3WAL A;  3OAW A;  2LVP A;  4FHJ A;  1OGW A;  2D10 A;  1A5R A;  3V62 A;  2KAN A;  4ZYN A;  2KX3 A;  4WJP A;  1WZ3 A;  2O6V D;  2MX2 A;  3ML8 A;  3PPA A;  4FHK A;  4ZRI A;  4DXA B;  4MJS A;  3JYU A;  2ZPY A;  1Q1O A;  4FUL A;  1UD7 A;  1TBE A;  4F7Z A;  2MBE A;  2K1F A;  3MJW A;  1OEY J;  4J6I A;  2KFJ A;  2PE6 B;  4PS8 A;  1WZ0 A;  2CU1 A;  2MP2 B;  3PGE A;  3T8M A;  1WXS A;  2PPH A;  1PQS A;  2JRH A;  3DVG X;  1NDD A;  2IO3 B;  3PSE B;  2C7N B;  2FUH B;  3VQI A;  3ZRC A;  3JW0 X;  1WX7 A;  2RR9 A;  3ZRF A;  4FAD A;  3IHP C;  3ENE A;  2PE9 A;  3K9P B;  2JF5 A;  3ZIM A;  3VUW A;  2KXJ A;  5IAA C;  2KOX A;  4PS3 A;  2KWV B;  4EZL A;  1LFD A;  3H9D A;  3LJ3 A;  1GNU A;  3UF8 A;  2IY0 B;  4IM0 A;  1TZ1 A;  2KJR A;  3APF A;  1VD2 A;  2LXA A;  2ZJD A;  2KD0 A;  1E7V A;  4CHK A;  2OJR A;  4EZK A;  2G4D B;  3APC A;  1ZGU B;  2NVU I;  2RSU A;  3EEC A;  3U7D A;  3VTW A;  2DZK A;  4NQK E;  3APD A;  4FA6 A;  2KLC A;  1WMH B;  1RAX A;  2N7D A;  4NAW A;  2M4N A;  4HDO A;  4FJZ A;  2L3Z A;  5JHB A;  5DCN A;  3KUD B;  2JWZ A;  5IA7 A;  1YD8 U;  3PT2 B;  3KW5 B;  4EZJ A;  2GOW A;  4K81 A;  1WF9 A;  2CHX A;  3PVL A;  2O6V A;  3OJ4 B;  3PRZ A;  2KO3 A;  3C0R B;  4HXD A;  2GBR A;  3QHT A;  2NBV B;  5G2N A;  2XK5 B;  2QHO A;  3WAP A;  4FBJ B;  1JRU A;  1GG3 A;  2K6D B;  2LAS A;  2W9N A;  4GMV A;  3WA0 A;  5D7G A;  3QA8 A;  1E8Z A;  3PRM B;  3WIM A;  4FLH A;  3ZO5 B;  2KJH B;  2LI5 A;  3L08 A;  4W9L A;  3W1Y A;  2KK8 A;  5E6N A;  2K8B A;  2L8J A;  4HCP B;  4W9D A;  4IWP A;  2ZNV B;  2NR2 A;  4MM3 A;  4EOY A;  3VFK A;  3A9K B;  4GB9 A;  4M8M A;  1WGH A;  1ZW7 A;  3UQB A;  5KHQ A;  1YQB A;  3ZNI D;  4WWN A;  3IVF A;  2ZPN A;  3VUY A;  2HJ8 A;  4G0N B;  2AL6 A;  2REX A;  3IBE A;  2IZV B;  4MGY E;  4W9K A;  3HM3 A;  2JRI B;  2N1V A;  4JGH B;  5L95 C;  2KDF B;  2LZ6 A;  2XEW A;  4IM2 A;  4K7S A;  2ZNV C;  2KHW B;  3NY5 A;  2ZVN A;  4GSW A;  2KMA A;  2JT4 B;  2M8S A;  3RZF A;  1XQQ A;  4F1S A;  3SDL C;  3JSV A;  4BKG A;  3Q3J A;  1WRD B;  1KJT A;  3NZU A;  5BO4 B;  3JVZ X;  1YJ1 A;  3VH3 B;  4NAW B;  3BY4 B;  3R66 C;  3U8Z A;  3PV1 A;  3N3K B;  2MW5 A;  4B6W A;  2LVO A;  3AUL A;  3ZDM C;  1WX8 A;  2DX5 B;  1YX5 B;  2NS5 A;  2B3A A;  3A4R A;  2AYO B;  2IO2 B;  1WH3 A;  2EMS A;  1VCB A;  2A5U A;  4A3P A;  4XZ4 A;  1CMX B;  3V61 A;  4FN2 A;  4IW0 A;  2NCN A;  3AXC A;  3TIX A;  5J2R A;  3ZLZ A;  2KQ7 A;  2MBO A;  2KDE B;  2XK5 A;  3M95 A;  2JUO A;  4HDQ A;  2BWE S;  2L00 B;  3B08 A;  2MLB A;  4ZRK A;  1WYW B;  2D2Q A;  4P7I A;  3A1Q A;  3QJZ A;  1XD3 B;  2M0X A;  3ALB A;  3D32 A;  3K9O B;  2MCN B;  5DPW A;  1IP9 A;  1KM7 A;  4NNJ B;  3TMP B;  1X1M A;  4FJV B;  4RMA A;  2D07 B;  2GBK A;  1T0Y A;  4WQO B;  3DVN U;  3ZDT A;  3RZW C;  3R7R A;  5D6J B;  4NJ6 A;  1WXA A;  5J17 A;  3PLU A;  4TQ0 A;  4B95 A;  1WGG A;  2KVR A;  2KTF A;  2R2O A;  2KFK B;  4FJY A;  5D94 A;  3UIO B;  2JY6 A;  4IWO A;  2UWQ A;  3R7Q A;  2HD5 B;  3A9K A;  2MRP A;  4LDT D;  4X57 B;  4YL8 A;  3RUI B;  4W9H A;  4K7U A;  2FCQ A;  2Z59 B;  3UIN B;  4URK A;  2A4Z A;  2KZR A;  3N30 A;  1C1Y B;  3VH4 B;  4IC7 B;  4MGK E;  2LUE A;  1E8Y A;  2C60 A;  1Z5S B;  2LD9 A;  1V81 A;  3TJP A;  4DDI D;  3QK0 A;  3VVW B;  1S3S G;  2AL3 A;  4KZ0 A;  5JH5 C;  3U30 A;  4E74 A;  3ZNZ B;  3I3T B;  2L05 A;  1LQB A;  3GZN I;  3UGB B;  1J8C A;  1P1A A;  2ZZP B;  3ECI A;  2ASQ A;  3QC8 B;  2D3G A;  4HWI B;  3QWZ B;  2MQJ A;  2KMC A;  2LRW A;  3T9L A;  4WWP A;  1J0G A;  3QAR A;  5CX3 A;  4AJW A;  4WJO A;  1LM8 B;  4HJK A;  2MBH A;  3Q3F A;  3NOB A;  4I6L B;  3PLV A;  1J19 A;  3ONS A;  4GDK A;  2LGX A;  3GOE A;  3H1U A;  4K7W A;  1EO6 A;  2DAF A;  3WAN A;  2GMI C;  3V6C B;  1WI0 A;  3DVN V;  3NS8 A;  4KDL B;  3KUZ A;  3X23 A;  2EKE C;  2JVC A;  4BKS D;  4BFR A;  2PEA A;  5E6P A;  1KOT A;  2KNB A;  3DVG Y;  4HLE A;  2V4L A;  2DZJ A;  3B1L X;  1WR6 E;  3QCA A;  4AJY B;  3MHS D;  5LLI A;  2IY1 B;  2WX1 A;  2N9E B;  4AP4 C;  4II2 B;  1NBF C;  2WDT B;  3S2A A;  2BYV E;  3DQV A;  4II3 B;  4MSM B;  1R4N I;  4EFO A;  5AZH A;  1WXM A;  2DEN B;  2KX0 A;  2NBU A;  4NJ7 A;  1WJ4 A;  4BKT A;  1V9J A;  4HPM B;  5AZG A;  2LJ5 A;  4HCN B;  4WWO A;  1P3Q U;  4W9F A;  3EFU A;  2NPT B;  3RD2 A;  1WGD A;  2JZ3 B;  2CKH B;  3DBS A;  1GC7 A;  2K6Q A;  2VRR B;  2KFK A;  4GDL A;  2LRU A;  1RRB A;  4W9C A;  2DZM A;  2KTR A;  2XBB C;  2ZEQ A;  4DHZ E;  1H8C A;  1WIA A;  4GN1 A;  3VTU A;  3AU4 A;  4WJQ A;  4IWQ A;  4GU2 A;  4MDK E;  3PS6 A;  5D2M B;  4RM9 A;  4N9F 4;  2JXX A;  4DBG A;  1V6E A;  2DHZ A;  3PHW B;  3VXW A;  4B9K A;  4F8C B;  2BF8 B;  3TL5 A;  5KHO A;  4G11 A;  2KC2 A;  2FID A;  4MEM A;  1EF5 A;  3A9J B;  3HK0 A;  3L54 A;  2AEH A;  1WY8 A;  3DDC B;  2YVC A;  4DHJ D;  2KLG A;  4KZC A;  2I1K A;  5TR5 A;  3H7P A;  5LXI B;  5C1Z A;  5DPS A;  2Z0E B;  2BGF A;  4NPN A;  3UIP B;  2DYM A;  1WX9 A;  3VTV A;  2C7M B;  3PRP B;  4ANV A;  1GJZ A;  3DPD A;  4ICV A;  2LGD A;  5JZE B;  2FCM A;  2BKR B;  4BKS A;  4GDK B;  3AU5 A;  3RCZ A;  1V86 A;  2L76 A;  2K8C A;  1UH6 A;  4PYU A;  4W9J A;  2L7R A;  1E7U A;  4G3X B;  2N7E A;  3R3M A;  2KWC A;  1GUA B;  3OLM D;  1R4M I;  3WAO A;  2J0M A;  3L13 A;  3JSV B;  2R2Q A;  3L17 A;  4DK5 A;  4IM3 A;  4XX5 A;  3MTN B;  5DPT A;  1I35 A;  2UYZ B;  1QZE A;  3M62 B;  4M0W B;  5GMV A;  4IG7 B;  1D3Z A;  1OQY A;  4W9G A;  2RGF A;  1HE8 A;  1P0R A;  1Q5W B;  2C5L C;  2C9W B;  2FCN A;  4KVG B;  2KDB A;  2NBW B;  4ZRJ A;  2IBI B;  4W9I A;  3KUC B;  2WYQ A;  5HKH A;  3L10 B;  1YX6 B;  3X0W A;  4CO7 A;  1BT0 A;  2J7Q B;  4K1R B;  1ZKH A;  4TUU A;  1IPG A;  1UZX B;  1P98 A;  1TTN A;  1V2Y A;  2IO1 B;  2NPT A;  2BPS A;  4MGI E;  4ASW C;  3ZNH B;  2DYB A;  3PTF C;  4JQW C;  3BIN A;  1L2N A;  4GDL B;  2K8H A;  2L0T A;  3A1Q B;  3KVF B;  4PS7 A;  2K25 A;  1K8R B;  4EEW A;  2HE7 A;  4AUQ C;  4MJS B;  3ZVV A;  1WR1 A;  3DBH I;  4MH0 E;  4I6P A;  3CST A;  2DAJ A;  2ZVO A;  2G3Q B;  4G50 A;  1V5T A;  5J18 A;  2LGY A;  4MEL A;  1UGM A;  2Y5B B;  3ML9 A;  3LDZ E;  5JHA A;  2KN5 A;  2JZZ A;  3V6E B;  1C3T A;  5C23 A;  2N9P C;  2HTH A;  3L0W B;  4E71 A;  2KWU B;  4OVU A;  2MSE D;  1RLF A;  2M1M A;  4KDI C;  5G55 A;  4A3O A;  1OEY A;  1WXV A;  4HPL B;  1WGY A;  1IYF A;  3QQ8 B;  4M8N A;  4EUT A;  2MBQ A;  4XC2 A;  2DZI A;  4BBN F;  3EHV A;  3N32 A;  2N4F A;  4BVU C;  2JPH A;  4ANU A;  3VAW A;  3B0A A;  2FIF A;  2GBM A;  1FXT B;  1UBI A;  3UQA A;  4JLC A;  1E8X A;  4ANW A;  4GXB A;  2EMT A;  2M17 A;  3KYD D;  4A20 A;  1Y8R C;  4DWF A;  3M63 B;  4CYE A;  1U4A A;  3NZS A;  4RM8 A;  2O2V A;  2YLM A;  5CHW A;  1S1Q B;  2GBJ A;  4BBN C;  4HK2 A;  1V5O A;  4DHJ B;  1NI2 A;  4KIK A;  3VDZ A;  3IG3 A;  1SIF A;  3M3J A;  3HHM A;  3RT3 B;  3SHQ A;  4OVV A;  1RFA A;  1WM2 A;  4E3C A;  5LXH A;  3ZTC A;  3W1S C;  3VUX A;  2G45 B;  3H7S A;  2FNJ B;  3QIJ A;  4TKN A;  1I42 A;  3VHT C;  1SGH A;  4DDG D;  4IUM B;  2MBB B;  3A33 B;  3TBL D;  2IO0 B;  1E5W A;  2MWS B;  1L7Y A;  1WM3 A;  1XT9 B;  2RPQ A;  5CHV C;  3W1S A;  3DBL I;  3QAQ A;  2FCS A;  2CHZ A;  4LCD E;  4WAA A;  4W9E A;  2BKF A;  1EF1 A;  4LDT B;  2V3S A;  4BOZ B;  2FAZ A;  1H4R A;  3IFW B;  2Z0D B;  4LJO B;  3SD5 A;  1AAR A;  4JIO U;  3ZKJ C;  3CMM B;  3PHX B;  2KKC A;  2AWT A;  1WE6 A;  2GBN A;  2KTR B;  2V1Y A;  4MSQ B;  3NHE B;  4TV3 A;  1F9J A;  2N1W A;  1YIW A;  3DCG A;  3KH0 A;  1LXD A;  3CSF A;  4GIV A;  4MGZ E;  2K39 A;  2C7H A;  1UEL A;  2J0J A;  2D11 A;  2OOB B;  3ZUN A;  4NQL B;  3DBR I;  2IYD B;  2MP2 A;  3L16 A;  4ANX A;  1V80 A;  4BOS C;  4NY0 A;  3ZW3 A;  2PJH A;  4EKU A;  1E90 A;  2CR5 A;  3A9J A;  3KYC D;  3OJ3 A;  3EC8 A;  2BYF A;  3V60 A;  4KSL C;  4PYZ A;  1TGZ B;  1KLV A;  1WJ6 A;  5EDS A;  3H7P B;  1OTR B;  2DYO A;  1GC6 A;  2O2V B;  5DPR A;  3AI5 A;  4AOF A;  1Q0W B;  2MA9 B;  3TCA A;  1G6J A;  3RUL A;  2J0K A;  3ZTD A;  2ZCC A;  4JL9 A;  4KIK B;  1WE7 A;  4TQ1 A;  2ZCB A;  4ICU A;  3PRE A;  2I1J A;  3QX1 A; 
#chains in the Genus database with same CATH topology
 1WGR A;  2KAJ A;  4WJN A;  2BS2 B;  4LLG M;  3O65 B;  1QOB A;  2WX0 A;  2IGD A;  4A90 A;  4DHZ B;  1ACC A;  2L0F A;  4L1B A;  5E6O A;  2CS4 A;  5AZF A;  2KC1 A;  1E8W A;  3HM6 X;  1FIQ A;  2AX5 A;  2YEP F;  3WAL A;  2LWP A;  1VJK A;  2KAN A;  1WZ3 A;  1TS5 A;  4DXA B;  4MJS A;  3RNB C;  2ZPY A;  4FUL A;  1TBE A;  4RGT A;  1OEY J;  3KWL A;  1IUE A;  4DQO C;  4CQN A;  2L83 A;  2CU1 A;  2PPH A;  1PQS A;  3AMZ A;  4S0R A;  3NVW A;  4M00 A;  2V9H A;  3ZRC A;  3ZRF A;  3ZIM A;  2KXJ A;  2Y3A A;  3R8B A;  1VLB A;  2WXF A;  4PS3 A;  4EZL A;  1LFD A;  1XCT L;  1GNU A;  4IM0 A;  1TZ1 A;  1L0Y B;  1VD2 A;  3AEA B;  2OJR A;  4CHK A;  4EZK A;  2RDB C;  3U7D A;  1K53 A;  2DZK A;  4NQK E;  2VH2 A;  2KQ4 X;  2N7D A;  4NAW A;  4HDO A;  4FJZ A;  5DCN A;  4RH6 A;  2JWZ A;  3TUO A;  2K3U A;  3KW5 B;  2Z8L A;  3I9V 1;  3N20 C;  1SB3 C;  4NJC A;  3BZD B;  1XLP A;  2KDM A;  2NBV B;  2XK5 B;  1AYF A;  4FBJ B;  1YOV B;  4OVZ A;  2LAS A;  4FLH A;  2LI5 A;  2KK8 A;  3MC9 A;  1DOI A;  2L8J A;  2WU5 B;  5H92 C;  2NR2 A;  4JPS A;  1ZW7 A;  3UQB A;  2PIA A;  4ZHO A;  4H2A A;  1YQB A;  4UDU C;  2ZPN A;  3IBE A;  3HM3 A;  1R7S A;  3RN9 C;  4EE2 A;  3GS2 A;  4K7S A;  2WXM A;  2KHW B;  2K0P A;  3SDL C;  4BKG A;  5G5H A;  2KT7 A;  4NAW B;  4KKJ A;  3R66 C;  2WLB A;  3IAS 1;  2E6X A;  3N3K B;  4K3B A;  3ZDM C;  4C80 A;  2DX5 B;  1AW7 A;  2MEK A;  2NS5 A;  3KLS X;  2EMS A;  3RNF C;  2OHF A;  2KQ7 A;  4JWS C;  2WP9 B;  2L52 A;  3M95 A;  5FKA C;  4US8 A;  3QJZ A;  3ALB A;  5DPW A;  3PZ7 A;  4RMA A;  2GBK A;  1EWC A;  5D6J B;  4NJ6 A;  1WXA A;  1FD6 A;  2SAK A;  3UIO B;  4JX1 C;  3R7Q A;  4YL8 A;  3Q69 A;  4K7U A;  4URK A;  1YQ4 B;  2AQ1 B;  2KZR A;  3VH4 B;  5TSS A;  4MGK E;  1S3S G;  1YQ3 B;  4YWG G;  3MP9 A;  1CQV A;  1J8C A;  1LQB A;  2V0G A;  1P1A A;  5LNK 1;  3ECI A;  2J52 A;  3Q3M C;  3QC8 B;  1L4Z B;  1J0G A;  2HJ1 A;  5CX3 A;  4WJO A;  1TJE A;  1PUT A;  2INN E;  4RF0 A;  1D5Z C;  1TIF A;  3RNE C;  3NOB A;  4I6L B;  3PLV A;  1LGR A;  1OQR A;  2LGS A;  1J19 A;  2DAF A;  3V6C B;  2VZK B;  2JVC A;  5FR3 A;  2KNB A;  4HLE A;  1WR6 E;  3DHH C;  1Y56 A;  2NTT A;  4C4V A;  2K9X A;  3S2A A;  3AV8 A;  4II3 B;  1QLB B;  5AZH A;  2KX0 A;  2NBU A;  3AEG B;  5I4D A;  2BS4 B;  4HPM B;  3ZJU A;  2KAC A;  3RD2 A;  5BYS A;  1RYJ A;  3MHZ A;  1RRB A;  2DZM A;  2KTR A;  1HTQ A;  1GB1 A;  3ZYY X;  1TY2 A;  4IWQ A;  4GU2 A;  2K22 A;  1NEK B;  4N9F 4;  4B9K A;  3BYY B;  3TL5 A;  1YN4 A;  3A9J B;  3HK0 A;  1E10 A;  2AEH A;  1WY8 A;  2YVC A;  2KLG A;  2I1K A;  5LXI B;  3UIP B;  1WX9 A;  2G1E A;  3AB5 A;  5JZE B;  3AU5 A;  2WXJ A;  2IDY A;  4N59 A;  1V86 A;  1E7U A;  3R3M A;  1GUA B;  3BK1 A;  1N62 A;  1R4M I;  1AWD A;  4DK5 A;  4IM3 A;  4XX5 A;  3HVZ A;  3AED B;  5GMV A;  1D3Z A;  1OQY A;  1HE8 A;  1P0R A;  2C5L C;  4KVG B;  4MH8 A;  4LNN A;  4RNA A;  1QOA A;  4W9I A;  2L1A A;  1ZKH A;  1IPG A;  1UZX B;  2QDF A;  4ASW C;  2BPS A;  3ZNH B;  3Q2A C;  4WIP A;  3BIN A;  1QIL A;  4GDL B;  1WSP A;  1WRI A;  1ZP0 B;  1WR1 A;  3DBH I;  2CJN A;  4HPP A;  2ZVO A;  4G50 A;  1V5T A;  5J18 A;  4NAM A;  3ML9 A;  2KN5 A;  1UF0 A;  2HTH A;  2MSE D;  5G55 A;  4A3O A;  1OEY A;  1WXV A;  1IYF A;  4EUT A;  4BBN F;  2QCZ A;  1UBI A;  3U4E G;  4DWF A;  3NVV A;  4CYE A;  3NZS A;  4RM8 A;  2YLM A;  1LO5 D;  2BBC A;  5EE1 A;  4M0W A;  1NI2 A;  4C7Z A;  3IG3 A;  2K5P A;  1FMA D;  3RT3 B;  1UGJ A;  4E3C A;  2PVO D;  4TKN A;  2IO0 B;  3BYT B;  1WM3 A;  2RPQ A;  1MVK A;  2WXQ A;  1K50 A;  4LCD E;  4B0M A;  4WAA A;  4ACF A;  4BOZ B;  2FAZ A;  1H4R A;  2Z0D B;  2GB1 A;  2AWT A;  2OJW A;  3BK2 A;  5HHD G;  3RNC C;  1F9J A;  2QC8 A;  1YIW A;  1EM7 A;  4GIV A;  1HEZ E;  2W55 A;  3ZUN A;  3DBR I;  2FE8 A;  4C7Y A;  1V80 A;  4NY0 A;  1I4X A;  2PJH A;  1E90 A;  3OJ3 A;  3EC8 A;  2BYF A;  5BYR A;  1KLV A;  5EDS A;  4KGR A;  1OTR B;  4A8X C;  1V97 A;  4AOF A;  3TCA A;  1YJI A;  4JL9 A;  4KIK B;  3W5V B;  2ZCB A;  1SE2 A;  1QKZ A;  3B2F A;  4ZOH C;  3QX1 A;  3PZD A;  1Z2M A;  3P2B A;  1C4C A;  2N9X A;  5FR6 A;  5AEK B;  4P1C C;  3WAM A;  3H6N A;  1SE9 A;  3A4S C;  1UWM A;  1V49 A;  2G4S A;  2N7J A;  3HIZ A;  3B9J A;  3ZNG C;  1WJN A;  4LJP B;  1MG8 A;  2WXP A;  1L4D B;  2LHE A;  2LXC A;  4KSK C;  1FNU A;  1P9D U;  1WYG A;  2X8X X;  5CHF A;  4R3D A;  1VZ7 A;  4REZ A;  2GLS A;  3GE8 C;  2O6V D;  3IXS A;  4FHK A;  4HKZ E;  1MHX A;  3JYU A;  1TT5 B;  1UD7 A;  4F7Z A;  4ITK A;  5EE0 A;  4J6I A;  2KFJ A;  2PE6 B;  2WXR A;  5C3J B;  2IGG A;  2JRH A;  3Q8C A;  1NDD A;  1RFK A;  3VRB B;  2IO3 B;  2C7N B;  3VQI A;  2W54 A;  1WX7 A;  3JW0 X;  3K9P B;  4L23 A;  3VUW A;  5IAA C;  2KOX A;  4L2Y A;  5EE9 A;  3LJ3 A;  1E0Z A;  2RMM A;  2KJR A;  2PLP A;  1E7V A;  1YN5 A;  1JW9 D;  1KTK A;  3EEC A;  3APD A;  3Q3N C;  1TKE A;  2N9K A;  2W3S A;  1RAX A;  3KUD B;  1FEH A;  5IA7 A;  2N0S B;  4K81 A;  3IT6 B;  3FIL A;  4HXD A;  3QHT A;  5G2N A;  2IJ0 A;  3W5U B;  5D7G A;  3AM9 A;  1E8Z A;  3ZO5 B;  3L08 A;  2K8B A;  3MC0 B;  5MPO A;  3A9K B;  5KHQ A;  3ZNI D;  1TS4 A;  2HJ8 A;  2WHI A;  2REX A;  2VH1 A;  3AE8 B;  4OZA A;  2KDF B;  2JQR B;  3RI7 C;  4ARI A;  2KMA A;  4LNI A;  3LXF A;  3Q8F A;  2EKI A;  3Q3J A;  3Q8E A;  1KJT A;  4HJG E;  3U8Z A;  2KYW A;  1I4P A;  2MW5 A;  2I2Y A;  2G9H D;  2B3A A;  1R4N B;  3E56 A;  4A9A A;  1A70 A;  3TIX A;  3ZLZ A;  1ZE3 D;  2MBO A;  2KDE B;  1WXQ A;  4HDQ A;  2MLB A;  4ZRK A;  3URY A;  4LNO A;  2D2Q A;  2D3B A;  2M0X A;  3D32 A;  1KM7 A;  3R2T A;  2VZK D;  1I7H A;  1T0Y A;  1VRA B;  5J17 A;  5BMG A;  2KTF A;  2R2O A;  4FJY A;  5D94 A;  1EU4 A;  2UWQ A;  4RCO A;  1PYW D;  2HD5 B;  2MRP A;  3A9K A;  4X57 B;  3RUI B;  4W9H A;  2Z59 B;  1V1P A;  3N30 A;  1Z5S B;  1V81 A;  3QK0 A;  2AL3 A;  4KZ0 A;  5JH5 C;  3CIR B;  1FO4 A;  5IP4 D;  3ZNZ B;  2L05 A;  1TKY A;  1IBX B;  2QMT A;  2D3G A;  4HWI B;  3ZXV A;  2KMC A;  2KN4 A;  3RNG C;  4RFB A;  3UI3 A;  2MBH A;  4LNK A;  1JWA D;  1L6V A;  3H1U A;  3NRZ A;  1EO6 A;  1GOZ A;  1Q10 A;  3WAN A;  3DBR B;  1WI0 A;  4USA A;  3X23 A;  4P16 A;  4M02 A;  4BFR A;  2PEA A;  1C79 A;  2V4L A;  3NJT A;  3AE4 B;  4AJY B;  5LLI A;  2IY1 B;  1FPY A;  2N9E B;  1NBF C;  3DQV A;  2Q5W D;  4EFO A;  4NJ7 A;  3DHG C;  4BKT A;  3BII D;  2LJ5 A;  1ZPS A;  1DYQ A;  2BQQ A;  2JZ3 B;  3P42 A;  1GC7 A;  3E9S A;  1I4R A;  4GDL A;  2ZEQ A;  1B1Z A;  4MDK E;  3PS6 A;  4RM9 A;  3PHW B;  4F8C B;  2FID A;  3SFD B;  1T5X D;  4AQ7 A;  4DHJ D;  5TR5 A;  1XCQ L;  2BGF A;  2DYM A;  2C7M B;  1GJZ A;  1FRR A;  4ICV A;  2FCM A;  4BKS A;  4ZRP A;  5FK9 C;  3RCZ A;  4XE0 A;  1BML C;  3IT4 B;  4TSS A;  2J0M A;  3L17 A;  3JSV B;  1F2R C;  4M0W B;  1JML A;  1Q5W B;  1N5W A;  2C9W B;  2KDB A;  4ZRJ A;  3EUB 2;  4YSX B;  2WYQ A;  5JXV A;  3L10 B;  1MI0 A;  1YX6 B;  3X0W A;  4CO7 A;  2J7Q B;  4K1R B;  4BZA A;  2WXN A;  1D5X C;  1P98 A;  1SBB B;  1GAQ B;  1NYQ A;  4AS1 A;  4HEA 1;  2IPK D;  1L2N A;  4WQM A;  2L0T A;  5HI1 A;  2JSV X;  2K25 A;  3OWE B;  2HE7 A;  2KVZ A;  4MJS B;  3ZVV A;  2AQ3 B;  1TY0 A;  4MT5 A;  2G3Q B;  2PW9 A;  5BMI A;  5JHA A;  2LMC A;  2JZZ A;  3NUH B;  3T3N A;  2MJD A;  1RLF A;  4KDI C;  3NG0 A;  5C2T B;  1CZP A;  1WGY A;  2V3P A;  3QQ8 B;  1MHH E;  3EHV A;  1FRD A;  4ANU A;  1FXA A;  3B0A A;  2FIF A;  1FXT B;  1K52 A;  3U52 E;  1JCK B;  1TKG A;  3VR8 B;  3MFG A;  4GXB A;  2EMT A;  2M17 A;  4KGT A;  5GXG B;  1C77 A;  1ZXI A;  1L0X B;  4KIK A;  3NVY A;  3VRA B;  1RFA A;  1N63 A;  3L4P A;  1BUI C;  1P7F A;  2ACZ B;  2G45 B;  3H7S A;  1I42 A;  3VHT C;  1SGH A;  4DDG D;  2MBB B;  1XT9 B;  3TEZ A;  3BWU D;  2CHZ A;  1KLU D;  1EF1 A;  2BB5 A;  3ZKJ C;  4JIO U;  3CMM B;  3PHX B;  1WE6 A;  2BB6 A;  2KTR B;  4N58 A;  4TV3 A;  3KH0 A;  2J42 A;  1LXD A;  3TSS A;  2K39 A;  1B9R A;  3AE7 B;  4NQL B;  3J9C A;  2MP2 A;  4BOS C;  2BVC A;  1QT9 A;  3V60 A;  4KSL C;  2IGH A;  4GLS C;  4YXD B;  1TGZ B;  1WJ6 A;  2DYO A;  3RNA C;  1GC6 A;  3AEF B;  5DPR A;  1Q0W B;  1YNT E;  1G6J A;  2RDH A;  4HRO A;  1XLO A;  3ZTD A;  1SIJ A;  1HA5 A;  1WE7 A;  1L0V B;  1ROE A;  5L83 A;  1QOF A;  1ISN A;  4ZDV A;  5CTR C;  1DOX A;  2RD0 A;  1SXT A;  4KV2 A;  1HZ6 A;  3CF6 E;  2KJ6 A;  2BWF A;  4OHJ A;  4PT5 A;  1JRO A;  2HTM E;  3HVD A;  3AE1 B;  1EUV B;  3OAW A;  2LVP A;  2V3N A;  4FHJ A;  1OGW A;  2D10 A;  1A5R A;  4OW0 A;  4LTU A;  3ML8 A;  1HQR D;  4ZRI A;  2MBE A;  2K1F A;  3MJW A;  1N60 A;  1STE A;  1YMH E;  3C8Y A;  2DWQ A;  2MP2 B;  3T8M A;  1WXS A;  1GB4 A;  3DVG X;  2FUH B;  3ABV B;  2RR9 A;  3IHP C;  2PE9 A;  1XLQ A;  2JF5 A;  2YEP B;  2PKO A;  5IN7 A;  3V05 A;  2GI9 A;  1UWX A;  2KWV B;  3H9D A;  4KX6 B;  1DOY A;  2IY0 B;  3APF A;  1T0S C;  2DLB A;  1ET9 A;  1ENF A;  4OZC A;  1ZGU B;  2NVU I;  2RSU A;  2DNF A;  3AE3 B;  3AN1 A;  2M4N A;  2L3Z A;  1QQR A;  3PT2 B;  3HUI A;  4EZJ A;  2GOW A;  1WF9 A;  3ZGZ A;  2CHX A;  1SEB D;  3PVL A;  2O6V A;  3OJ4 B;  2INP E;  3BVZ A;  2PTL A;  2QHO A;  3WAP A;  2K6D B;  2W9N A;  4GMV A;  3QA8 A;  4W9L A;  4IDI A;  2LEK A;  5E6N A;  3LB8 C;  4IWP A;  4MM3 A;  3VFK A;  4GB9 A;  4M8M A;  1RM6 C;  2IND C;  4IKG A;  4G0N B;  4WH4 A;  2QIE B;  4W9K A;  1MPE A;  2JRI B;  2N1V A;  4JGH B;  5L95 C;  2XEW A;  2LZ6 A;  4IM2 A;  2ZNV C;  2WU2 B;  2ZVN A;  4GSW A;  2JT4 B;  2M8S A;  3HRD D;  2RDG A;  2WXI A;  3JVZ X;  1YJ1 A;  2L32 A;  2BTE A;  3PV1 A;  4B6W A;  1WX8 A;  4Q2J A;  2DBY A;  2WXG A;  2IO2 B;  1WH3 A;  2A5U A;  1FCL A;  1CMX B;  5BMH A;  2D3C A;  4IW0 A;  2NCN A;  3I63 C;  3AXC A;  5J2R A;  1ZUD 2;  3ZJV A;  2BWE S;  2L00 B;  3B08 A;  1WYW B;  4P7I A;  3A1Q A;  1XD3 B;  4YSY B;  3AE6 B;  2MCN B;  1IP9 A;  3GP7 A;  4NNJ B;  1X1M A;  1VZ8 A;  2D07 B;  4WQO B;  3ZDT A;  3VR9 B;  1E9M A;  4B95 A;  2KFK B;  4MM3 B;  2ON8 A;  2JY6 A;  2QJL A;  4JE3 B;  3UIN B;  1JRP A;  1C1Y B;  4IC7 B;  4YSZ B;  2LUE A;  1E8Y A;  2LD9 A;  1ZOY B;  1J7A A;  4DDI D;  1HXY D;  4RGM A;  2ICI A;  3ZJT A;  2FUG 1;  3U30 A;  1XEE A;  3I3T B;  3GZN I;  3UGB B;  2ZZP B;  3QWZ B;  2MQJ A;  3T9L A;  1QOG A;  4WWP A;  4AJW A;  1LM8 B;  3Q3O C;  3RFZ B;  4QAY A;  1FFU A;  2W3R A;  3Q3F A;  4RGO S;  2GRI A;  2LGX A;  4K7W A;  2GMI C;  1KFY B;  3DVN V;  3AH7 A;  5E6P A;  3DVG Y;  3B1L X;  2WDR B;  4AP4 C;  4II2 B;  4MSM B;  1R4N I;  1WXM A;  2DEN B;  3W9C B;  2H88 B;  1WJ4 A;  1V9J A;  1KH0 A;  3DBL B;  1P3Q U;  4W9F A;  5E6J A;  2INC C;  2HDE A;  2CKH B;  5D3D A;  2VRR B;  2KFK A;  2LRU A;  4DHZ E;  1JWM D;  2XBB C;  1T0Q C;  1WIA A;  4GN1 A;  4ZYS A;  2KWD A;  2WGS A;  3I57 A;  5D2M B;  1V6E A;  3VXW A;  3DHI C;  1JQ4 A;  1PGX A;  1FNV A;  2KC2 A;  4G11 A;  1EF5 A;  2MJ3 A;  3L54 A;  3NZ3 A;  4YTP B;  1ESF A;  3EGR A;  4KZC A;  3H7P A;  2Z0E B;  3AEC B;  4M01 A;  3VTV A;  4ANV A;  1C76 A;  3FC4 A;  2LGD A;  2BKR B;  2K8C A;  2WXO A;  2N7E A;  2KWC A;  3OLM D;  5IKC M;  2R2Q A;  3N9Y C;  5AUI A;  1FM0 D;  1I35 A;  2UYZ B;  1QZE A;  3M62 B;  5T8I A;  3P4R B;  3ZQ4 A;  2RGF A;  2RPV A;  2FCN A;  2NBW B;  2IBI B;  1T0R C;  3W2D A;  2H89 B;  2WXK A;  2ZW1 A;  2AQ2 B;  1TTN A;  2NPT A;  2IO1 B;  2R61 A;  2JU6 X;  4DXG A;  3PTF C;  4JQW C;  1JWB D;  2MHJ A;  2K8H A;  4EEW A;  4ARC A;  1D4B A;  2V4I B;  3BVG A;  2WXL A;  3CST A;  3NS1 A;  1NYR A;  2DAJ A;  1UGM A;  2LGI A;  4J3O D;  4A55 A;  2M0A A;  3V6E B;  1C3T A;  5C23 A;  2N9P C;  3L0W B;  2E3T A;  4E71 A;  2KWU B;  2FBW B;  1N61 A;  1V1P B;  3P4P B;  2BS3 B;  4HPL B;  1PFD A;  2NMQ A;  1T3Q A;  3N32 A;  2N4F A;  3VAW A;  1E7P B;  1E6E B;  4JLC A;  1IGD A;  3KYD D;  3M63 B;  2O2V A;  2GBJ A;  4BBN C;  1OFF A;  2J4X A;  3N1Z C;  4HK2 A;  3VDZ A;  1SIF A;  3M3J A;  3HHM A;  3BVM A;  4OVV A;  1FFV A;  4P6V F;  3ZTC A;  3W1S C;  1SE4 A;  2FNJ B;  2KMM A;  3FIL B;  1YN3 A;  3A33 B;  1CJE A;  2MWS B;  3AEB B;  1L7Y A;  2JZP A;  3DBL I;  3DWM A;  1JAL A;  2FCS A;  3QAQ A;  2EEL A;  4W9E A;  2BKF A;  2X38 A;  4LDT B;  4LJO B;  1F52 A;  1N5X A;  2GBN A;  1TZO A;  2V1Y A;  2LUM A;  4MSQ B;  3NHE B;  1VZ6 A;  2N1W A;  3CSF A;  4MGZ E;  1UEL A;  3FKY A;  2D11 A;  2OOB B;  3C19 A;  3TEX A;  3R2I A;  1XO3 A;  5BYQ A;  3L16 A;  3FAH A;  4RF1 A;  1I4G A;  3GB1 A;  3ZW3 A;  4LK0 M;  2W82 A;  2CR5 A;  2CU3 A;  3A9J A;  3KYC D;  4PYZ A;  1I4Q A;  1J7C A;  2PVG C;  2O2V B;  2MA9 B;  3GZN B;  4XWT A;  5HG2 A;  1WGK A;  4TQ1 A;  3N1X C;  3T3O A;  3PRE A;  2I1J A;  3SFE B;  4EKU A;  2J53 A;  1GPX A;  2BYE A;  1WMH A;  1SE3 A;  3RYT A;  3DOW A;  2LVQ A;  3MC8 A;  2WWZ A;  1R4M B;  1ZDX A;  2KDI A;  3OG5 A;  2KQS A;  4GOC A;  2CHW A;  3SU8 X;  1WFY A;  1UBQ A;  2N9L A;  4HVB A;  3O13 A;  1M94 A;  3AE5 B;  4GGQ A;  2O6V B;  4LNF A;  1SF0 A;  4I6N B;  4AWJ A;  1WJU A;  5IOI A;  3V62 A;  3P1M A;  4ZYN A;  4MAC A;  2KX3 A;  1NEN B;  4WJP A;  3PPA A;  2MX2 A;  3DWG C;  1Q1O A;  2M56 B;  4XYC A;  1EU3 A;  4PS8 A;  1WZ0 A;  3PGE A;  1IGC A;  3I5J C;  3P63 A;  3PSE B;  1F77 A;  1KF6 B;  4FAD A;  3ENE A;  1J7B A;  1HTO A;  2XN9 C;  2QSD A;  3UF8 A;  4B0E A;  2UU7 A;  4WAF A;  3TEY A;  2LXA A;  2ZJD A;  2KD0 A;  3IAM 1;  2JXT A;  2G4D B;  3APC A;  3VTW A;  4FA6 A;  3Q8B A;  2KLC A;  1WMH B;  3EFC A;  2I38 A;  5JHB A;  1TS2 A;  2NTS A;  1FXI A;  1YD8 U;  4C4V B;  1K51 A;  1MG4 A;  4S17 A;  2BYT A;  3PRZ A;  2KO3 A;  3C0R B;  3AEE B;  2GBR A;  2MH7 A;  3TEW A;  4A6Q A;  1JRU A;  1GG3 A;  1UUP A;  3WA0 A;  3PRM B;  3WIM A;  3N1Y C;  2KJH B;  2JYE A;  3W1Y A;  2WDQ B;  4OZB A;  4HCP B;  4W9D A;  3WCQ A;  2ZNV B;  3CWI A;  4EOY A;  1V8C A;  1WGH A;  2CJO A;  1F2R I;  1FNW A;  1TYG B;  4WWN A;  3IVF A;  1CK1 A;  3VUY A;  2WNM A;  4MGY E;  4DXF A;  2AL6 A;  2IZV B;  3Q14 C;  4HKQ A;  3NY5 A;  3RZF A;  5AUK A;  2BT6 A;  4N6E B;  1XQQ A;  4F1S A;  3JSV A;  1WRD B;  3NZU A;  5BO4 B;  3SEB A;  3VH3 B;  3AE9 B;  3BY4 B;  4JWU C;  1YJJ A;  2LVO A;  3AUL A;  1MJD A;  3RMK C;  1YX5 B;  3PZ8 A;  2Y5P A;  1L6U A;  1D6E C;  3A4R A;  2AYO B;  1VCB A;  4A3P A;  4XZ4 A;  5EE3 A;  3V61 A;  4FN2 A;  5IO9 A;  2BW2 A;  3GE3 C;  3P4Q B;  2XK5 A;  2JUO A;  1F1H A;  1ZXH A;  2D5G A;  5D3I B;  3K9O B;  3TMP B;  4FJV B;  4BAX A;  4NZL B;  3DVN U;  4C56 C;  1TS3 A;  3R7R A;  3RZW C;  3PLU A;  4TQ0 A;  1WGG A;  2KVR A;  1RWS A;  4IWO A;  4LDT D;  2FCQ A;  2A4Z A;  4YTM B;  2C60 A;  3TJP A;  5HFY A;  3VVW B;  1FCC C;  4E74 A;  3P4S B;  5G5G A;  2ASQ A;  1XXG A;  2LRW A;  2LFI A;  3QAR A;  4HJK A;  2LHD A;  2JWU A;  3PO0 A;  4GDK A;  3ONS A;  3GOE A;  2M19 A;  1OQQ A;  1WWT A;  3NVZ A;  4WUR A;  1KLG D;  2WQY B;  3NS8 A;  4KDL B;  3KUZ A;  2EKE C;  4TMA B;  4BKS D;  1ET6 A;  1KOT A;  3V3X A;  4PK1 A;  2DZJ A;  3QCA A;  3MHS D;  2WX1 A;  1SJH D;  2WDV B;  2WDT B;  2BYV E;  1C4A A;  2Y5C A;  1NI3 A;  5AZG A;  4K3C A;  4HCN B;  4WWO A;  4IOI E;  1DGJ A;  2NPT B;  3EFU A;  1C9F A;  1WGD A;  3DBS A;  3LYY A;  4W9C A;  2K6Q A;  4YTN B;  1JWU D;  3H8H A;  2LJI A;  1H8C A;  3AE2 B;  3Q6B A;  3VTU A;  3AU4 A;  4WJQ A;  3ETR A;  2JXX A;  1HZ5 A;  4DBG A;  2DHZ A;  2XNA C;  2BF8 B;  5KHO A;  1JWS D;  4MEM A;  1XLN A;  2B76 B;  3DDC B;  1KRH A;  4D2K A;  4YT0 B;  5C1Z A;  5DPS A;  4NPN A;  1L5P A;  3PRP B;  1ZDV A;  3DPD A;  4P1B C;  2WXH A;  4GDK B;  1D5M C;  4WWM A;  4ZRQ A;  2L76 A;  1UH6 A;  4PYU A;  4W9J A;  2L7R A;  4G3X B;  1PGB A;  3WAO A;  3L13 A;  1NVI D;  2ZW0 A;  2JX5 A;  3KWV A;  3MTN B;  3SR6 A;  5DPT A;  4IG7 B;  3Q8A A;  4W9G A;  4O1N A;  1F0Z A;  3KUC B;  1V1O A;  5HKH A;  1N6Z A;  1BXT A;  1BT0 A;  4TUU A;  3KQ4 A;  1V2Y A;  4MGI E;  1QF6 A;  2DYB A;  4US9 A;  3KVF B;  3A1Q B;  4PS7 A;  1K8R B;  1C78 A;  4AUQ C;  4MH0 E;  4I6P A;  2LGY A;  4MEL A;  2TSS A;  1SSN A;  1VR9 A;  4XDC A;  4KGS A;  2Y5B B;  3LDZ E;  4FXC A;  4XGA B;  4ZHP A;  4OVU A;  1AN8 A;  2M1M A;  3EA6 A;  4RGN A;  4M8N A;  4C00 A;  2MBQ A;  4XC2 A;  2DZI A;  4BVU C;  2JPH A;  2GBM A;  1IBX A;  3UQA A;  5H8Y E;  1E8X A;  1SJE D;  4A20 A;  4ANW A;  1Y8R C;  3MJ5 A;  1U4A A;  2D3A A;  1UNS A;  5CHW A;  1S1Q B;  1V5O A;  1P7E A;  1XF5 L;  4DHJ B;  1PDX A;  3U7Z A;  3SHQ A;  1WM2 A;  5LXH A;  3VUX A;  4HRS A;  3QIJ A;  4IUM B;  3TBL D;  4KKI A;  1E5W A;  4XDD A;  2QIL A;  3U2S C;  5CHV C;  2WS3 B;  3W1S A;  2OED A;  2V3S A;  2ONQ A;  3IFW B;  3SD5 A;  1AAR A;  3ZXR A;  1EWY C;  2KKC A;  4XWW A;  1I4H A;  2MJE A;  1C4P A;  1M4V A;  2SEB D;  3DCG A;  3B2G A;  2C7H A;  2J0J A;  2PMV A;  2IYD B;  3RPF C;  4ANX A;  1T6B X;  3DBH B;  1MFW A;  2JYT A;  3H7P B;  2QEJ C;  3AI5 A;  3RUL A;  2J0K A;  2ZCC A;  4ICU A;  1PGA A;  1VDV A; 
#chains in the Genus database with same CATH homology
 3PZD A;  1WGR A;  5L83 A;  1Z2M A;  3P2B A;  4WJN A;  3O65 B;  1ISN A;  4ZDV A;  5CTR C;  2N9X A;  2BYE A;  1WMH A;  5FR6 A;  5AEK B;  3RYT A;  3DOW A;  2LVQ A;  3WAM A;  2WX0 A;  3H6N A;  2RD0 A;  1SE9 A;  3A4S C;  2WWZ A;  4KV2 A;  4DHZ B;  2G4S A;  1V49 A;  3CF6 E;  2KDI A;  2KQS A;  2L0F A;  5E6O A;  4GOC A;  2CHW A;  3SU8 X;  3HIZ A;  2KJ6 A;  1WFY A;  2BWF A;  2CS4 A;  3ZNG C;  1WJN A;  4LJP B;  1UBQ A;  5AZF A;  2KC1 A;  1MG8 A;  4HVB A;  1E8W A;  1M94 A;  3HM6 X;  4GGQ A;  2O6V B;  2LXC A;  4KSK C;  1P9D U;  4I6N B;  4AWJ A;  1WJU A;  1EUV B;  5CHF A;  2LWP A;  3WAL A;  3OAW A;  2LVP A;  4FHJ A;  1OGW A;  2D10 A;  1A5R A;  3V62 A;  2KAN A;  4ZYN A;  2KX3 A;  4WJP A;  1WZ3 A;  2O6V D;  2MX2 A;  3ML8 A;  3PPA A;  4FHK A;  4ZRI A;  4DXA B;  4MJS A;  3JYU A;  2ZPY A;  1Q1O A;  4FUL A;  1UD7 A;  1TBE A;  4F7Z A;  2MBE A;  2K1F A;  3MJW A;  1OEY J;  4J6I A;  2KFJ A;  2PE6 B;  4PS8 A;  1WZ0 A;  2CU1 A;  2MP2 B;  3PGE A;  3T8M A;  1WXS A;  2PPH A;  1PQS A;  2JRH A;  3DVG X;  1NDD A;  2IO3 B;  3PSE B;  2C7N B;  2FUH B;  3VQI A;  3ZRC A;  3JW0 X;  1WX7 A;  2RR9 A;  3ZRF A;  4FAD A;  3IHP C;  3ENE A;  2PE9 A;  3K9P B;  2JF5 A;  3ZIM A;  3VUW A;  2KXJ A;  5IAA C;  2KOX A;  4PS3 A;  2KWV B;  4EZL A;  1LFD A;  3H9D A;  3LJ3 A;  1GNU A;  3UF8 A;  2IY0 B;  4IM0 A;  1TZ1 A;  2KJR A;  3APF A;  1VD2 A;  2LXA A;  2ZJD A;  2KD0 A;  1E7V A;  4CHK A;  2OJR A;  4EZK A;  2G4D B;  3APC A;  1ZGU B;  2NVU I;  2RSU A;  3EEC A;  3U7D A;  3VTW A;  2DZK A;  4NQK E;  3APD A;  4FA6 A;  2KLC A;  1WMH B;  1RAX A;  2N7D A;  4NAW A;  2M4N A;  4HDO A;  4FJZ A;  2L3Z A;  5JHB A;  5DCN A;  3KUD B;  2JWZ A;  5IA7 A;  1YD8 U;  3PT2 B;  3KW5 B;  4EZJ A;  2GOW A;  4K81 A;  1WF9 A;  2CHX A;  3PVL A;  2O6V A;  3OJ4 B;  3PRZ A;  2KO3 A;  3C0R B;  4HXD A;  2GBR A;  3QHT A;  2NBV B;  5G2N A;  2XK5 B;  2QHO A;  3WAP A;  4FBJ B;  1JRU A;  1GG3 A;  2K6D B;  2LAS A;  2W9N A;  4GMV A;  3WA0 A;  5D7G A;  3QA8 A;  1E8Z A;  3PRM B;  3WIM A;  4FLH A;  3ZO5 B;  2KJH B;  2LI5 A;  3L08 A;  4W9L A;  3W1Y A;  2KK8 A;  5E6N A;  2K8B A;  2L8J A;  4HCP B;  4W9D A;  4IWP A;  2ZNV B;  2NR2 A;  4MM3 A;  4EOY A;  3VFK A;  3A9K B;  4GB9 A;  4M8M A;  1WGH A;  1ZW7 A;  3UQB A;  5KHQ A;  1YQB A;  3ZNI D;  4WWN A;  3IVF A;  2ZPN A;  3VUY A;  2HJ8 A;  4G0N B;  2AL6 A;  2REX A;  3IBE A;  2IZV B;  4MGY E;  4W9K A;  3HM3 A;  2JRI B;  2N1V A;  4JGH B;  5L95 C;  2KDF B;  2LZ6 A;  2XEW A;  4IM2 A;  4K7S A;  2ZNV C;  2KHW B;  3NY5 A;  2ZVN A;  4GSW A;  2KMA A;  2JT4 B;  2M8S A;  3RZF A;  1XQQ A;  4F1S A;  3SDL C;  3JSV A;  4BKG A;  3Q3J A;  1WRD B;  1KJT A;  3NZU A;  5BO4 B;  3JVZ X;  1YJ1 A;  3VH3 B;  4NAW B;  3BY4 B;  3R66 C;  3U8Z A;  3PV1 A;  3N3K B;  2MW5 A;  4B6W A;  2LVO A;  3AUL A;  3ZDM C;  1WX8 A;  2DX5 B;  1YX5 B;  2NS5 A;  2B3A A;  3A4R A;  2AYO B;  2IO2 B;  1WH3 A;  2EMS A;  1VCB A;  2A5U A;  4A3P A;  4XZ4 A;  1CMX B;  3V61 A;  4FN2 A;  4IW0 A;  2NCN A;  3AXC A;  3TIX A;  5J2R A;  3ZLZ A;  2KQ7 A;  2MBO A;  2KDE B;  2XK5 A;  3M95 A;  2JUO A;  4HDQ A;  2BWE S;  2L00 B;  3B08 A;  2MLB A;  4ZRK A;  1WYW B;  2D2Q A;  4P7I A;  3A1Q A;  3QJZ A;  1XD3 B;  2M0X A;  3ALB A;  3D32 A;  3K9O B;  2MCN B;  5DPW A;  1IP9 A;  1KM7 A;  4NNJ B;  3TMP B;  1X1M A;  4FJV B;  4RMA A;  2D07 B;  2GBK A;  1T0Y A;  4WQO B;  3DVN U;  3ZDT A;  3RZW C;  3R7R A;  5D6J B;  4NJ6 A;  1WXA A;  5J17 A;  3PLU A;  4TQ0 A;  4B95 A;  1WGG A;  2KVR A;  2KTF A;  2R2O A;  2KFK B;  4FJY A;  5D94 A;  3UIO B;  2JY6 A;  4IWO A;  2UWQ A;  3R7Q A;  2HD5 B;  3A9K A;  2MRP A;  4LDT D;  4X57 B;  4YL8 A;  3RUI B;  4W9H A;  4K7U A;  2FCQ A;  2Z59 B;  3UIN B;  4URK A;  2A4Z A;  2KZR A;  3N30 A;  1C1Y B;  3VH4 B;  4IC7 B;  4MGK E;  2LUE A;  1E8Y A;  2C60 A;  1Z5S B;  2LD9 A;  1V81 A;  3TJP A;  4DDI D;  3QK0 A;  3VVW B;  1S3S G;  2AL3 A;  4KZ0 A;  5JH5 C;  3U30 A;  4E74 A;  3ZNZ B;  3I3T B;  2L05 A;  1LQB A;  3GZN I;  3UGB B;  1J8C A;  1P1A A;  2ZZP B;  3ECI A;  2ASQ A;  3QC8 B;  2D3G A;  4HWI B;  3QWZ B;  2MQJ A;  2KMC A;  2LRW A;  3T9L A;  4WWP A;  1J0G A;  3QAR A;  5CX3 A;  4AJW A;  4WJO A;  1LM8 B;  4HJK A;  2MBH A;  3Q3F A;  3NOB A;  4I6L B;  3PLV A;  1J19 A;  3ONS A;  4GDK A;  2LGX A;  3GOE A;  3H1U A;  4K7W A;  1EO6 A;  2DAF A;  3WAN A;  2GMI C;  3V6C B;  1WI0 A;  3DVN V;  3NS8 A;  4KDL B;  3KUZ A;  3X23 A;  2EKE C;  2JVC A;  4BKS D;  4BFR A;  2PEA A;  5E6P A;  1KOT A;  2KNB A;  3DVG Y;  4HLE A;  2V4L A;  2DZJ A;  3B1L X;  1WR6 E;  3QCA A;  4AJY B;  3MHS D;  5LLI A;  2IY1 B;  2WX1 A;  2N9E B;  4AP4 C;  4II2 B;  1NBF C;  2WDT B;  3S2A A;  2BYV E;  3DQV A;  4II3 B;  4MSM B;  1R4N I;  4EFO A;  5AZH A;  1WXM A;  2DEN B;  2KX0 A;  2NBU A;  4NJ7 A;  1WJ4 A;  4BKT A;  1V9J A;  4HPM B;  5AZG A;  2LJ5 A;  4HCN B;  4WWO A;  1P3Q U;  4W9F A;  3EFU A;  2NPT B;  3RD2 A;  1WGD A;  2JZ3 B;  2CKH B;  3DBS A;  1GC7 A;  2K6Q A;  2VRR B;  2KFK A;  4GDL A;  2LRU A;  1RRB A;  4W9C A;  2DZM A;  2KTR A;  2XBB C;  2ZEQ A;  4DHZ E;  1H8C A;  1WIA A;  4GN1 A;  3VTU A;  3AU4 A;  4WJQ A;  4IWQ A;  4GU2 A;  4MDK E;  3PS6 A;  5D2M B;  4RM9 A;  4N9F 4;  2JXX A;  4DBG A;  1V6E A;  2DHZ A;  3PHW B;  3VXW A;  4B9K A;  4F8C B;  2BF8 B;  3TL5 A;  5KHO A;  4G11 A;  2KC2 A;  2FID A;  4MEM A;  1EF5 A;  3A9J B;  3HK0 A;  3L54 A;  2AEH A;  1WY8 A;  3DDC B;  2YVC A;  4DHJ D;  2KLG A;  4KZC A;  2I1K A;  5TR5 A;  3H7P A;  5LXI B;  5C1Z A;  5DPS A;  2Z0E B;  2BGF A;  4NPN A;  3UIP B;  2DYM A;  1WX9 A;  3VTV A;  2C7M B;  3PRP B;  4ANV A;  1GJZ A;  3DPD A;  4ICV A;  2LGD A;  5JZE B;  2FCM A;  2BKR B;  4BKS A;  4GDK B;  3AU5 A;  3RCZ A;  1V86 A;  2L76 A;  2K8C A;  1UH6 A;  4PYU A;  4W9J A;  2L7R A;  1E7U A;  4G3X B;  2N7E A;  3R3M A;  2KWC A;  1GUA B;  3OLM D;  1R4M I;  3WAO A;  2J0M A;  3L13 A;  3JSV B;  2R2Q A;  3L17 A;  4DK5 A;  4IM3 A;  4XX5 A;  3MTN B;  5DPT A;  1I35 A;  2UYZ B;  1QZE A;  3M62 B;  4M0W B;  5GMV A;  4IG7 B;  1D3Z A;  1OQY A;  4W9G A;  2RGF A;  1HE8 A;  1P0R A;  1Q5W B;  2C5L C;  2C9W B;  2FCN A;  4KVG B;  2KDB A;  2NBW B;  4ZRJ A;  2IBI B;  4W9I A;  3KUC B;  2WYQ A;  5HKH A;  3L10 B;  1YX6 B;  3X0W A;  4CO7 A;  1BT0 A;  2J7Q B;  4K1R B;  1ZKH A;  4TUU A;  1IPG A;  1UZX B;  1P98 A;  1TTN A;  1V2Y A;  2IO1 B;  2NPT A;  2BPS A;  4MGI E;  4ASW C;  3ZNH B;  2DYB A;  3PTF C;  4JQW C;  3BIN A;  1L2N A;  4GDL B;  2K8H A;  2L0T A;  3A1Q B;  3KVF B;  4PS7 A;  2K25 A;  1K8R B;  4EEW A;  2HE7 A;  4AUQ C;  4MJS B;  3ZVV A;  1WR1 A;  3DBH I;  4MH0 E;  4I6P A;  3CST A;  2DAJ A;  2ZVO A;  2G3Q B;  4G50 A;  1V5T A;  5J18 A;  2LGY A;  4MEL A;  1UGM A;  2Y5B B;  3ML9 A;  3LDZ E;  5JHA A;  2KN5 A;  2JZZ A;  3V6E B;  1C3T A;  5C23 A;  2N9P C;  2HTH A;  3L0W B;  4E71 A;  2KWU B;  4OVU A;  2MSE D;  1RLF A;  2M1M A;  4KDI C;  5G55 A;  4A3O A;  1OEY A;  1WXV A;  4HPL B;  1WGY A;  1IYF A;  3QQ8 B;  4M8N A;  4EUT A;  2MBQ A;  4XC2 A;  2DZI A;  4BBN F;  3EHV A;  3N32 A;  2N4F A;  4BVU C;  2JPH A;  4ANU A;  3VAW A;  3B0A A;  2FIF A;  2GBM A;  1FXT B;  1UBI A;  3UQA A;  4JLC A;  1E8X A;  4ANW A;  4GXB A;  2EMT A;  2M17 A;  3KYD D;  4A20 A;  1Y8R C;  4DWF A;  3M63 B;  4CYE A;  1U4A A;  3NZS A;  4RM8 A;  2O2V A;  2YLM A;  5CHW A;  1S1Q B;  2GBJ A;  4BBN C;  4HK2 A;  1V5O A;  4DHJ B;  1NI2 A;  4KIK A;  3VDZ A;  3IG3 A;  1SIF A;  3M3J A;  3HHM A;  3RT3 B;  3SHQ A;  4OVV A;  1RFA A;  1WM2 A;  4E3C A;  5LXH A;  3ZTC A;  3W1S C;  3VUX A;  2G45 B;  3H7S A;  2FNJ B;  3QIJ A;  4TKN A;  1I42 A;  3VHT C;  1SGH A;  4DDG D;  4IUM B;  2MBB B;  3A33 B;  3TBL D;  2IO0 B;  1E5W A;  2MWS B;  1L7Y A;  1WM3 A;  1XT9 B;  2RPQ A;  5CHV C;  3W1S A;  3DBL I;  3QAQ A;  2FCS A;  2CHZ A;  4LCD E;  4WAA A;  4W9E A;  2BKF A;  1EF1 A;  4LDT B;  2V3S A;  4BOZ B;  2FAZ A;  1H4R A;  3IFW B;  2Z0D B;  4LJO B;  3SD5 A;  1AAR A;  4JIO U;  3ZKJ C;  3CMM B;  3PHX B;  2KKC A;  2AWT A;  1WE6 A;  2GBN A;  2KTR B;  2V1Y A;  4MSQ B;  3NHE B;  4TV3 A;  1F9J A;  2N1W A;  1YIW A;  3DCG A;  3KH0 A;  1LXD A;  3CSF A;  4GIV A;  4MGZ E;  2K39 A;  2C7H A;  1UEL A;  2J0J A;  2D11 A;  2OOB B;  3ZUN A;  4NQL B;  3DBR I;  2IYD B;  2MP2 A;  3L16 A;  4ANX A;  1V80 A;  4BOS C;  4NY0 A;  3ZW3 A;  2PJH A;  4EKU A;  1E90 A;  2CR5 A;  3A9J A;  3KYC D;  3OJ3 A;  3EC8 A;  2BYF A;  3V60 A;  4KSL C;  4PYZ A;  1TGZ B;  1KLV A;  1WJ6 A;  5EDS A;  3H7P B;  1OTR B;  2DYO A;  1GC6 A;  2O2V B;  5DPR A;  3AI5 A;  4AOF A;  1Q0W B;  2MA9 B;  3TCA A;  1G6J A;  3RUL A;  2J0K A;  3ZTD A;  2ZCC A;  4JL9 A;  4KIK B;  1WE7 A;  4TQ1 A;  2ZCB A;  4ICU A;  3PRE A;  2I1J A;  3QX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...