3QHTA

Crystal structure of the monobody ysmb-1 bound to yeast sumo
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
KPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3
publication title Isoform-specific monobody inhibitors of small ubiquitin-related modifiers engineered using structure-guided library design.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags De novo protein
total genus 20
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3qhtA00
3QK0A 4MSQB 2M0XA 4GDKA 5GMVA 4K81A 5D2MB 4MH0E 3ML9A 4HPLB 1IP9A 4W9CA 4DDGD 4W9IA 3ZUNA 2KJ6A 2D10A 2KK8A 4MEMA 4AOFA 2BF8B 2G4SA 4BBNC 1IYFA 1Q5WB 2GBKA 3NOBA 4BKSD 4LCDE 3UQBA 4ZRJA 4BOZB 2KWUB 1EF1A 1ZGUB 2L7RA 4NNJB 3WAOA 3KUDB 2JY6A 4BKGA 4TV3A 3RYTA 3VUXA 3LDZE 3UINB 2CHWA 1WIAA 4HLEA 2LRWA 3A9JB 1E7UA 2EMSA 4K1RB 3SU8X 3BINA 3L0WB 1E5WA 5E6PA 4HCPB 4BFRA 5LXIB 1V6EA 5D6JB 4GXBA 5DPSA 3R7RA 4F7ZA 3KUZA 2KX0A 4LDTB 5G55A 3M63B 5JHBA 4OVVA 4NJ7A 4BVUC 1WXMA 4DWFA 2NR2A 1E8YA 2MA9B 1H8CA 2KFKB 4J6IA 3N32A 4RMAA 4AJYB 1XT9B 3AU4A 2L3ZA 3VH3B 2WWZA 5DCNA 4AJWA 1UGMA 2GMIC 2NBWB 2V4LA 3PV1A 3PS6A 4HPMB 4W9HA 3ZTCA 4GDLB 2KMCA 2KMAA 5AZHA 4DHJB 1AARA 2KQSA 3X0WA 2CKHB 1ZKHA 4I6PA 4P7IA 1Z2MA 1C1YB 3ECIA 3DCGA 5DPRA 1MG8A 1WMHB 3CSTA 2UWQA 4NY0A 3RULA 4IM3A 3ZKJC 4KV2A 1WGYA 4HDOA 3SD5A 2RPQA 2KWVB 4MDKE 3WAMA 1S3SG 4PYUA 2CHXA 1UZXB 2M1MA 2AL3A 4MM3A 2C7MB 2NPTB 3Q3FA 5J18A 2J7QB 3IBEA 3A9JA 2Y5BB 1WR1A 1YX6B 2A5UA 2WDTB 2LXAA 3PZDA 3UF8A 4DHZE 5AEKB 1WX9A 4G3XB 4ZRKA 1UBIA 3L16A 2KDBA 1WH3A 2KN5A 5C1ZA 4ICVA 4B9KA 1I35A 4FBJB 2NBUA 3KYCD 2KC1A 4IWPA 2O2VB 2IO3B 2R2QA 2LXCA 5CX3A 2IZVB 1J8CA 2KFKA 2ZEQA 3AULA 4AP4C 2MBOA 3ONSA 5KHOA 3WANA 1BT0A 2HTHA 1L7YA 1UBQA 3A4RA 2IY1B 4ZYNA 4ZDVA 2ZVNA 3DBSA 4IW0A 2N1WA 1WJ4A 2KLCA 4AUQC 4GDLA 4EZLA 1KLVA 3DQVA 4ANUA 1WJ6A 4IM0A 1RRBA 3L13A 2AWTA 5G2NA 4RM8A 4GOCA 4NQKE 3QAQA 2MWSB 3V61A 1P0RA 1WMHA 2KTRB 3AI5A 4G50A 3QC8B 4KDLB 4WAAA 1YIWA 3D32A 4ANVA 2NPTA 1C3TA 5L95C 2BYFA 3DBLI 3PPAA 4FJYA 4GSWA 4MGZE 5JHAA 2ZNVC 3ZVVA 1LM8B 4IUMB 2MBBB 4K7UA 3QQ8B 1OQYA 2I1KA 4W9FA 3VHTC 3ZNZB 2K39A 3M3JA 4MGKE 3TBLD 5D7GA 2J0KA 3B08A 1OEYJ 2PE6B 4MGIE 2BPSA 3NY5A 1YJ1A 1TTNA 2KKCA 2O2VA 1A5RA 3IHPC 2D11A 3DBRI 3UGBB 3B0AA 3H6NA 1PQSA 1S1QB 1RFAA 1P1AA 1E7VA 3W1YA 3R66C 4FA6A 3DVGX 3ZRFA 2G3QB 3PREA 3EFUA 4M0WB 3U30A 1WXVA 2JVCA 2GBMA 3QCAA 2FCMA 1E8XA 2KC2A 1WJNA 2MBQA 4WJQA 2BYVE 3O65B 4TKNA 1WZ3A 2KFJA 4XX5A 2GBRA 3QJZA 5DPWA 2JPHA 4E71A 2K1FA 3DVNV 3KYDD 1WE7A 2DZKA 2XBBC 3SDLC 1R4NI 3IG3A 4WWPA 3H7SA 4ANXA 5CTRC 1WXAA 1TZ1A 2D3GA 2KTRA 2NBVB 3WA0A 1WE6A 3V6EB 3QHTA 3S2AA 1WX7A 3DBHI 3QA8A 4W9KA 2N1VA 3AU5A 1J19A 3BY4B 2WYQA 3HM6X 3PSEB 1WGDA 4ZRIA 2D2QA 3ENEA 3M62B 5FR6A 2WX1A 2QHOA 3N30A 2JXXA 4HXDA 3QIJA 3V62A 1D3ZA 4IWOA 4FLHA 4HK2A 2AL6A 2J0MA 2Z59B 2I1JA 2LI5A 1WM3A 1Z5SB 2JRIB 3LJ3A 3NZSA 3KVFB 3L54A 2LZ6A 4GGQA 2DYOA 4KSKC 4FADA 4HCNB 3TJPA 5E6OA 3OJ4B 1GG3A 2N9EB 2KJHB 3OJ3A 2AEHA 2AYOB 1WGRA 4GMVA 2KHWB 4BOSC 4LJOB 1V86A 4F1SA 4K7WA 3VTWA 1VD2A 2ZZPB 1WXSA 3VAWA 1GC7A 2DENB 1HE8A 1RLFA 3MJWA 2VRRB 2KJRA 1V2YA 2A4ZA 2K6QA 5DPTA 4FULA 2DHZA 4II3B 2JZZA 4CO7A 4XC2A 1E90A 3NZUA 3QARA 3ZNHB 2L0TA 2DAFA 2MBEA 4W9LA 1TBEA 1JRUA 1GNUA 2EKEC 4E74A 1UD7A 4PS8A 4TUUA 5HKHA 5IA7A 2FIFA 1OGWA 2O6VB 1ISNA 2NS5A 2G45B 3PRZA 4MSMB 1EUVB 2KNBA 2MP2B 4WJOA 2CHZA 3V6CB 4AWJA 1R4MI 4NJ6A 2FUHB 1WGGA 1P3QU 2GOWA 2N9XA 3JSVB 4XZ4A 3B1LX 1P98A 1Y8RC 4GU2A 1E8ZA 4WQOB 3RZWC 2BKRB 3V60A 4HJKA 2PE9A 4WWNA 4M8NA 3R7QA 4WJPA 2K8CA 2FCNA 2KXJA 2K8BA 1V5OA 2HJ8A 2KTFA 2LD9A 2OJRA 3TIXA 3VQIA 3A1QB 3ML8A 3L08A 2DZMA 3UIPB 2C60A 3ZDMC 3PHXB 4DK5A 3HHMA 2NVUI 3H9DA 2M4NA 2RD0A 1CMXB 2RSUA 2MQJA 4F8CB 3VH4B 4JLCA 4NPNA 3PGEA 5LLIA 4EFOA 2MBHA 4GN1A 2KZRA 3EECA 3TCAA 3TMPB 2FCQA 4LDTD 1E8WA 3UQAA 3HIZA 3JW0X 3VFKA 3APDA 1WFYA 3L17A 3RCZA 3OLMD 4G11A 2O6VA 2RR9A 4A20A 2DX5B 1WZ0A 4W9JA 2MP2A 4DHJD 2R2OA 3A9KB 4ANWA 4IG7B 4FHJA 3QX1A 1V49A 3JSVA 4IM2A 1KOTA 5TR5A 1NDDA 1SGHA 3RUIB 2ZPNA 2MLBA 2N7EA 2PPHA 1V5TA 3RT3B 3PLUA 2LASA 1OTRB 3MTNB 1GUAB 1NBFC 4GIVA 4PS7A 3NS8A 4BKSA 1K8RB 4X57B 2V3SA 1Q0WB 4PS3A 3DPDA 1NI2A 5AZGA 2JZ3B 3A1QA 2KANA 4MGYE 2C9WB 1P9DU 3EC8A 2KDIA 2M17A 2W9NA 1WF9A 2BWFA 2PJHA 1LXDA 2LWPA 2FNJB 2KVRA 3HM3A 4JQWC 4EOYA 3ZLZA 3TL5A 3CMMB 1XQQA 3PRMB 1WGHA 3ZNID 3EHVA 3CSFA 2Z0DB 3IFWB 4TQ1A 3VUYA 2HE7A 5J17A 1KJTA 2C5LC 3HK0A 5KHQA 5D94A 5EDSA 4RM9A 2DYMA 4HDQA 1YX5B 4A3PA 4FHKA 2JF5A 4NQLB 5CHFA 2LGXA 3ALBA 4PYZA 4MELA 4KZ0A 4EEWA 2L0FA 3N3KB 3WALA 4BBNF 2V1YA 2J0JA 2ZJDA 4G0NB 2N7DA 3ZO5B 3ZRCA 3GZNI 4NAWB 3RD2A 1XD3B 3VDZA 3A9KA 4FJZA 1F9JA 2K25A 2UYZB 5CHVC 2IYDB 2JRHA 3P2BA 5IAAC 4EZJA 3UIOB 2OOBB 2KQ7A 3SHQA 4B6WA 1V9JA 3DVNU 4KZCA 3PTFC 3ZIMA 3PT2B 1WYWB 2CR5A 1I42A 1J0GA 2LGDA 1LQBA 1WY8A 2MX2A 4KDIC 2KLGA 4CYEA 2JUOA 4WWOA 3A33B 3A4SC 1L2NA 2YLMA 3PLVA 4K7SA 2BWES 2JT4B 3WAPA 1EF5A 4EKUA 2K6DB 4W9EA 3IVFA 2KDFB 1WI0A 2FIDA 4WJNA 2BYEA 4YL8A 2DYBA 4N9F4 4I6NB 3KH0A 3KW5B 4KIKB 1UELA 2MCNB 3VUWA 4FN2A 2XEWA 3U8ZA 1LFDA 3APCA 2ASQA 3QWZB 1VCBA 3I3TB 2D07B 2CS4A 3JVZX 2KO3A 2C7HA 2DAJA 2ZVOA 4NAWA 2LRUA 1WM2A 3R3MA 4JGHB 2RGFA 3W1SA 2DZJA 2GBJA 2MRPA 5JZEB 3U7DA 2L05A 3ZNGC 4ASWC 2L76A 3VXWA 1WR6E 4MJSB 2PEAA 2EMTA 2MSED 1FXTB 3K9PB 1YD8U 4EUTA 2FAZA 4M8MA 2MW5A 4FJVB 4DHZB 4W9DA 2LVOA 2B3AA 2REXA 3X23A 2M8SA 5JH5C 1ZW7A 3RZFA 3H7PB 4W9GA 4KSLC 5BO4B 2IO0B 3OAWA 3WIMA 4IWQA 3T9LA 3CF6E 2LVPA 3VTVA 1X1MA 3APFA 4EZKA 1UH6A 2KDEB 2C7NB 2LGYA 2N9PC 4IC7B 4HVBA 4I6LB 3DOWA 2BKFA 1M94A 4KIKA 2XK5B 5L83A 2KD0A 1V80A 1V81A 2IBIB 2L00B 3DDCB 4GDKB 2ZPYA 3ZW3A 3VTUA 2HD5B 5C23A 2IO2B 3Q3JA 1TGZB 4DXAB 2DZIA 4DBGA 1WJUA 4ICUA 3ZDTA 3PVLA 5AZFA 3JYUA 4E3CA 3H1UA 3GOEA 4HWIB 4JL9A 4MJSA 4URKA 3DVGY 1YQBA 1T0YA 2LVQA 3C0RB 1SE9A 1EO6A 2G4DB 3AXCA 5J2RA 2BGFA 3K9OB 3VVWB 2N4FA 4LJPB 4II2B 4TQ0A 1Q1OA 4GB9A 4OVUA 1KM7A 1QZEA 2LUEA 3NHEB 5CHWA 2LJ5A 2CU1A 3M95A 2KOXA 2WX0A 3PRPB 1IPGA 3T8MA 2NCNA 5LXHA 2YVCA 2Z0EB 3L10B 2K8HA 3H7PA 2ZCCA 3W1SC 2FCSA 2IO1B 3PHWB 4JIOU 3ZTDA 2JWZA 1H4RA 4B95A 1U4AA 1RAXA 4A3OA 2IY0B 2GBNA 2O6VD 5E6NA 2ZCBA 4BKTA 2KWCA 1WX8A 2L8JA 1G6JA 3MHSD 3KUCB 2ZNVB 1SIFA 1WRDB 2KX3A 2XK5A 4CHKA 1OEYA 4DDID 1GJZA 4KVGB 1GC6A
chains in the Genus database with same CATH superfamily
3QK0A 4MSQB 2J53A 4K81A 2IGGA 3U4EG 5D2MB 4TMAB 1T0QC 4W9IA 4DDGD 2KK8A 4MEMA 4AOFA 2BF8B 1IYFA 1L6UA 3UQBA 4ZRJA 2KWUB 1EU3A 3CWIA 1ZGUB 4MM3B 1FNUA 3RYTA 1I4XA 4A90A 4HLEA 2JXTA 2NMQA 2D3BA 3Q6BA 1E5WA 2AX5A 5G5HA 1V6EA 5JHBA 1WXMA 2NR2A 1E8YA 3L4PA 2KFKB 3N32A 2GRIA 3Q8EA 1SB3C 5BYRA 1ZKHA 2DNFA 2PKOA 3J9CA 4YXDB 4P7IA 1KLGD 5DPRA 1MG8A 1WMHB 2UWQA 1WGYA 4HDOA 3SD5A 1S3SG 1UZXB 2M1MA 2AL3A 2C7MB 2NPTB 4ITKA 1SF0A 3A9JA 1WR1A 2WDVB 2LXAA 3PZDA 2KDBA 2KN5A 4ICVA 4P6VF 1XLPA 2O2VB 1N61A 3N1XC 1YOVB 3AE6B 1HZ6A 3AULA 4FXCA 3WANA 4BZAA 4DQOC 2IY1B 5FKAC 3DBSA 3NRZA 2JQRB 4GDLA 1KLVA 1TKGA 3L13A 5G2NA 3QAQA 2LFIA 4REZA 1MG4A 1BXTA 3QC8B 4KDLB 1UGJA 1CK1A 4WAAA 1IBXA 1C3TA 5L95C 4MGZE 5HI1A 5JHAA 1LM8B 2WU2B 2PIAA 3VHTC 4A9AA 2K39A 3M3JA 5D7GA 3B08A 3IAS1 1TIFA 1JWBD 1YJ1A 2KKCA 1A5RA 2D11A 3DBRI 1SIJA 3DVGX 3ZRFA 4M0WB 1TZOA 3O65B 3O13A 1WZ3A 4XX5A 2WU5B 2L52A 4E71A 1DOIA 1YN3A 1WE7A 2DZKA 1R4NI 2RDBC 2KTRA 1N5WA 2NBVB 3WA0A 1XF5L 3ZXVA 2W82A 3QA8A 4W9KA 1J19A 3BY4B 2WNMA 1SJHD 1WGDA 4YTNB 2WS3B 4ZRIA 2UU7A 3M62B 1L5PA 2JYTA 2QHOA 3N30A 2JXXA 4IWOA 2AL6A 1C76A 2I1JA 2JRIB 1Z5SB 3P4PB 3L54A 4WQMA 3RNGC 2NTTA 3OJ3A 2EELA 4LNOA 4BOSC 1HEZE 1QKZA 2ZZPB 1WXSA 1GC7A 5H8YE 2VRRB 1V2YA 2QEJC 5C3JB 4FULA 2N9KA 4CO7A 1E90A 3AEGB 3FILA 4W9LA 1F2RI 4MACA 1GNUA 1FO4A 4PS8A 4TUUA 3DBRB 4XWTA 2V4IB 1ISNA 2ICIA 2MHJA 2G45B 1XEEA 2WXJA 3V6CB 3RI7C 3P63A 1P3QU 3AE4B 3P1MA 3B1LX 4WQOB 3RZWC 1N5XA 2D5GA 2WP9B 2XNAC 2BW2A 3R7QA 1R4NB 4WJPA 3N9YC 5D3IB 2KXJA 2K8BA 1V5OA 2HJ8A 3SFEB 2SAKA 5IOIA 2DZMA 3PHXB 3KWLA 4N6EB 2RD0A 1T6BX 4F8CB 3VH4B 4JLCA 1C79A 4JPSA 4LDTD 2SEBD 3HIZA 4O1NA 4GLSC 3KQ4A 4G11A 2PMVA 4ZRPA 4C00A 4M02A 4DHJD 3A9KB 3QX1A 2Y3AA 2N7EA 1V5TA 5EE9A 3RT3B 2LASA 2EKIA 1GUAB 4GIVA 2QC8A 3CIRB 5AZGA 1V8CA 2BS4B 2J4XA 1NENB 4PK1A 1AWDA 3U52E 3RN9C 2BWFA 3HM3A 3CMMB 1XQQA 4WURA 1WGHA 3EHVA 1YQ4B 2RDGA 3HK0A 5EDSA 1JMLA 4A3PA 2JF5A 5CHFA 3N3KB 3TUOA 1MFWA 2V1YA 4NAWB 3NS1A 4KKJA 2B76B 2K25A 3BVGA 2IYDB 2JRHA 3P2BA 5IAAC 3SHQA 2QILA 3PTFC 2JU6X 4M00A 3PT2B 1WYWB 2CR5A 2RDHA 1I42A 2LGDA 2MX2A 5D3DA 3A33B 4LLGM 1L2NA 2YLMA 1TS5A 3Q3NC 3TEWA 2QMTA 2KQ4X 4YL8A 1EWYC 4N9F4 4I6NB 1UELA 3VUWA 4FN2A 1YJJA 1TYGB 3APCA 1JW9D 3DHIC 2Z8LA 1KH0A 2C7HA 3W1SA 3R3MA 2MRPA 1YJIA 3ZNGC 2KMMA 4YTPB 3RNCC 2L76A 3VXWA 1XXGA 3PO0A 1L6VA 1FXTB 4RF1A 1YD8U 2JYEA 2WDQB 1XO3A 4DHZB 3ZGZA 4L23A 2M8SA 4P1CC 5JH5C 1ZW7A 3H7PB 2ACZB 1K50A 2N7JA 4J3OD 4IWQA 1J7BA 4KKIA 1UH6A 4USAA 2C7NB 3LXFA 3GS2A 3RFZB 2IBIB 2L00B 3DDCB 1FCLA 3ZW3A 2NTSA 2K0PA 3VTUA 2HD5B 2R61A 2WXHA 1D6EC 4DBGA 1WJUA 1VDVA 2INDC 3ZDTA 5AZFA 4E3CA 2VH1A 1TY0A 4MJSA 4JL9A 3AECB 1ZUD2 2LVQA 1VJKA 3C0RB 2KDMA 3VVWB 4TQ0A 2CJNA 2BQQA 2LJ5A 3M95A 3I57A 3T8MA 5LXHA 2ZCCA 3W2DA 2IDYA 2IY0B 1N6ZA 5E6NA 1ENFA 4C4VA 1WX8A 1N62A 3MHSD 1FRDA 2ZNVB 4DDID 1K52A 4IUMB 2DWQA 2GB1A 1GAQB 1GC6A 1DGJA 4GDKA 4MH0E 4HPLB 1IP9A 3MC9A 2KJ6A 3BK1A 3ZUNA 2MJDA 2GBKA 3NOBA 2BB5A 2V9HA 4HPPA 4LCDE 4NNJB 4MT5A 4ZOHC 1STEA 4YSXB 1PFDA 1E7UA 4K1RB 4RGMA 4BFRA 2LMCA 4GXBA 4US9A 3R7RA 1SE4A 4OVVA 4NJ7A 4BVUC 3WCQA 2MA9B 4RMAA 1XT9B 3AEEB 4ARCA 3VH3B 1UGMA 4M01A 2KMCA 2KMAA 4DXGA 1AARA 2K3UA 2KQSA 3X0WA 2CKHB 1YN5A 2I2YA 1Z2MA 1C1YB 3DCGA 3ZQ4A 3CSTA 1TKYA 3RULA 3WAMA 1P7EA 4YWGG 2BBCA 5GXGB 2DBYA 2ZW1A 2J7QB 1YX6B 4ZRKA 5C1ZA 3NVVA 5FR3A 4FBJB 1UWXA 2NBUA 4IWPA 2R2QA 2W3RA 4EE2A 2IZVB 2ZEQA 2MBOA 1UNSA 3A4RA 3N1YC 2AWTA 4UDUC 4RM8A 3ETRA 3V61A 4N58A 3BK2A 1WSPA 1I4HA 4ANVA 2BYFA 3PPAA 2ZNVC 3ZVVA 1KF6B 2MBBB 4K7UA 3QQ8B 2BTEA 1OQYA 2I1KA 4W9FA 2WXQA 3TBLD 1L0XB 1TTNA 4XGAB 3B0AA 3R2IA 1E7VA 3R66C 3EFCA 3EFUA 2E3TA 2JVCA 2GBMA 4ARIA 2LGSA 3SEBA 1RWSA 1WJNA 3I9V1 1T0SC 2KFJA 3QJZA 4ACFA 2KACA 3KYDD 1QLBB 2X38A 3SDLC 4WWPA 4YSYB 4ANXA 5CTRC 1TZ1A 2LEKA 2N9LA 1I4QA 1K51A 3V6EB 2JWUA 3V3XA 1QOBA 2N0SB 1QOGA 3HM6X 3AV8A 1VZ7A 2AQ3B 5IO9A 4HXDA 3QIJA 1VZ6A 2Z59B 2LI5A 1PGAA 2LZ6A 5HHDG 3TJPA 3NUHB 5E6OA 3VRAB 4OZBA 2KJHB 1C78A 1D5MC 1NVID 1WGRA 2KHWB 3VAWA 2DENB 1HE8A 2KJRA 2A4ZA 2K6QA 5DPTA 2JZZA 2KVZA 2PW9A 3QARA 3ZNHB 3AEFB 2FIFA 1F77A 2NS5A 3MC8A 3RNFC 3PRZA 4MSMB 2KNBA 4WJOA 3N20C 4AWJA 4NJ6A 2KYWA 1FRRA 3JSVB 1LO5D 4GU2A 1P98A 1E8ZA 2BKRB 3V60A 2V0GA 3BWUD 2K8CA 4LNFA 1MJDA 2OJRA 5IN7A 3ZDMC 2C60A 5EE0A 4LTUA 3KWVA 3H9DA 1CMXB 2RSUA 5BYSA 3BVMA 3R8BA 3PGEA 1V1OA 5LLIA 4EFOA 4GN1A 5AUIA 3MP9A 4LK0M 2FCQA 1HZ5A 3BVZA 1GPXA 1I4GA 3APDA 1SEBD 4HJGE 3ZYYX 3L17A 3RCZA 4A20A 2O6VA 2DX5B 4S0RA 2V3PA 1F1HA 1Q10A 2MP2A 2R2OA 4FHJA 3AMZA 4RGNA 1KOTA 2H89B 1JWAD 1CJEA 1SGHA 1ROEA 3RUIB 2MLBA 2PPHA 1UUPA 1BUIC 3AEBB 3NVWA 3RNEC 3PLUA 1N63A 1PYWD 4PS7A 4X57B 3T3NA 2V3SA 4IOIE 3NVYA 4PS3A 1NI2A 3A1QA 3NZ3A 3DHHC 1WF9A 3GE8C 4A6QA 3TSSA 4LNKA 3ZLZA 3TL5A 1PGXA 3PRMB 3ZNID 3CSFA 4AQ7A 3TEXA 2Z0DB 3LYYA 4LNIA 3TEZA 5KHQA 5D94A 2J52A 2DYMA 4HDQA 1YX5B 3ALBA 3VRBB 4MELA 1FD6A 1E7PB 4EEWA 3WALA 2YEPF 3P4SB 2N7DA 3GZNI 2QCZA 3ABVB 1MHXA 3OG5A 1C4CA 4EZJA 3FKYA 2OOBB 1MHHE 2KQ7A 4B6WA 4KZCA 1OFFA 1J0GA 1WY8A 4CYEA 2KLGA 3W5UB 2JUOA 4WWOA 1V1PB 2Y5PA 2YEPB 3OWEB 1EF5A 4XDCA 2K6DB 3SFDB 4W9EA 2WXGA 1WI0A 4WJNA 1WYGA 2BYEA 3AE2B 2DYBA 3KH0A 2MCNB 2XEWA 3U8ZA 1D4BA 1LFDA 2KO3A 1PUTA 1WM2A 2IPKD 4A55A 2D3CA 2M0AA 3SR6A 5JZEB 2K9XA 2L05A 1IUEA 2QSDA 1HXYD 2WXNA 4M8MA 2MW5A 2IGDA 2B3AA 4H2AA 4P16A 3EUB2 2INPE 1CZPA 4OW0A 2KDEB 2LGYA 2WQYB 4IC7B 2BKFA 1M94A 1NI3A 4KIKA 2XK5B 3C8YA 2KD0A 3AM9A 3GZNB 1EM7A 1LGRA 2ZPYA 4NAMA 2E6XA 5C23A 5TSSA 2OEDA 4DXAB 3H1UA 4URKA 1JRPA 4R3DA 1T0YA 1KLUD 1WGKA 1EO6A 5J2RA 4P1BC 3NJTA 1Q1OA 4OVUA 2W55A 3NHEB 4YT0B 4CQNA 2BS2B 2KOXA 3VR8B 3PRPB 1IPGA 4WWMA 2YVCA 2Z0EB 3L10B 2K8HA 5HG2A 2FCSA 4JIOU 3Q8BA 1H4RA 4B95A 1U4AA 2GBNA 2O6VD 2L8JA 1G6JA 3AB5A 3KUCB 1WRDB 2KX3A 4CHKA 1GJZA 4KVGB 4L1BA 5GMVA 3ML9A 2AQ2B 4RH6A 2Y5CA 1ET6A 4D2KA 4RGOS 4WIPA 2G4SA 3BZDB 3P42A 1L4DB 2JSVX 1EF1A 3WAOA 3KUDB 2JY6A 1L0YB 4BKGA 3VUXA 3LDZE 2CHWA 1WIAA 3RMKC 2LRWA 2OJWA 3A9JB 2EMSA 2WDRB 1M4VA 4A8XC 1ZP0B 1VZ8A 3BINA 3L0WB 4JWUC 1WWTA 1KRHA 5D6JB 5DPSA 3KUZA 2WXFA 2KX0A 4LDTB 5G55A 5EE3A 3HRDD 4DWFA 1TS2A 4J6IA 1H8CA 4AJYB 2L3ZA 2FUG1 2WXRA 3BIID 2GMIC 3B2GA 4AJWA 1QOAA 1E10A 3PS6A 4GDLB 4DHJB 1JWUD 5G5GA 4I6PA 1JWMD 5JXVA 2HDEA 5E6JA 1C77A 3ZKJC 4IM3A 4KV2A 4MDKE 4PYUA 1IBXB 2CHXA 1FXIA 4MM3A 3Q3FA 5J18A 3IBEA 2Y5BB 2WDTB 2A5UA 3AE5B 3UF8A 4DHZE 4G3XB 1UBIA 3L16A 1WH3A 4MH8A 5EE1A 4B9KA 1I35A 2IO3B 5CX3A 1HA5A 1J8CA 2KFKA 3ONSA 1FNVA 5KHOA 4RFBA 4ZYNA 4ZDVA 3MHZA 4IW0A 2N1WA 3V05A 1WJ4A 3ZJUA 4ZHOA 4EZLA 3DQVA 2INNE 3R2TA 4GOCA 3U7ZA 2MWSB 1WMHA 1F2RC 2KTRB 4HEA1 3AI5A 4G50A 3ZXRA 4RCOA 4BAXA 2NPTA 1KTKA 2WXPA 1FM0D 2VZKD 1YMHE 1OEYJ 2PE6B 4PT5A 4XWWA 3IAM1 2BPSA 3NY5A 5BMIA 2O2VA 3UGBB 1S1QB 1RFAA 1P1AA 1DYQA 3W1YA 4FA6A 2G3QB 3PREA 1UWMA 4ZRQA 5C2TB 2LHDA 1RFKA 2JX5A 2FCMA 1E8XA 2KC2A 2BYVE 2KN4A 4TKNA 1JROA 2GBRA 2Q5WD 2K1FA 3DVNV 4S17A 2K22A 2AQ1B 3H7SA 2D3GA 4HRSA 1ESFA 3TEYA 4B0EA 2XN9C 3QHTA 1ET9A 3FILB 1FNWA 1WX7A 4OZCA 2N1VA 3AU5A 4RNAA 4LNNA 4JX1C 2QJLA 3DHGC 2WX1A 1UF0A 3V62A 1D3ZA 4HK2A 2J0MA 1ACCA 1WM3A 3LJ3A 4M0WA 3Q8CA 3NZSA 2MJEA 4K3CA 4FADA 3AE7B 3OJ4B 1GG3A 5LNK1 3GB1A 2AEHA 4C80A 3MC0B 4LJOB 1V86A 1I7HA 3MJWA 1A70A 1B9RA 3NZUA 2MBEA 2L32A 4US8A 2EKEC 1TS3A 3ZJTA 5HKHA 4DXFA 4JE3B 1JWSD 2PVOD 1DOXA 3Q14C 4XE0A 1EUVB 2CHZA 1T3QA 1WGGA 2JZPA 2N9XA 1Y8RC 2PE9A 1K53A 4WWNA 4M8NA 2KTFA 2LD9A 3VQIA 3ML8A 3UIPB 4DK5A 5IKCM 3HHMA 2NVUI 2M4NA 2MQJA 2DLBA 4NPNA 2MBHA 2CJOA 2KZRA 3TMPB 3JW0X 3VFKA 1CQVA 1WFYA 4NJCA 3OLMD 2RR9A 1VR9A 2BB6A 4OZAA 2IGHA 4Q2JA 4N59A 4JWSC 1TJEA 1V49A 3RNBC 2LUMA 2ZPNA 1OTRB 3MTNB 1NBFC 3NS8A 4BKSA 3Q8AA 3IT4B 2KWDA 5T8IA 4KGSA 4C56C 2JZ3B 2KANA 3IXSA 1FCCC 2C9WB 2H88B 4L2YA 2W9NA 3AH7A 2PJHA 2LWPA 2FNJB 2WHIA 4JQWC 4EOYA 1FIQA 2LHEA 3AE9B 4TQ1A 3VUYA 2HE7A 2C5LC 1ZDXA 2MEKA 1SSNA 4NQLB 1OQQA 3EGRA 4BBNF 2ZJDA 3ZO5B 3ZRCA 1XD3B 3A9KA 1F9JA 3PZ8A 2UYZB 4KX6B 3DWMA 3UIOB 1F0ZA 1T5XD 3DVNU 3ZIMA 1QOFA 1DOYA 1VRAB 3PLVA 4RF0A 2JT4B 1C4PA 3BYTB 3IVFA 2KDFB 3W5VB 4C7ZA 1L4ZB 2RMMA 2ASQA 3QWZB 1VCBA 3PZ7A 1PDXA 1FEHA 2ZVOA 4NAWA 4JGHB 2RGFA 2GBJA 1FXAA 2QIEB 3Q69A 4MJSB 2QDFA 2CU3A 4EUTA 2FAZA 4FJVB 3URYA 3RZFA 2MJ3A 2OHFA 2LJIA 3CF6E 4EZKA 4HVBA 2N9PC 4C4VB 4I6LB 1C9FA 3KLSX 5L83A 1V81A 4GDKB 1HTQA 3Q3JA 1TGZB 5IP4D 3MFGA 2WXIA 2DZIA 1RM6C 4XYCA 3JYUA 4HWIB 1YQBA 3H8HA 2PTLA 1HQRD 2BGFA 1TT5B 3K9OB 4LJPB 4GB9A 1QZEA 2LUEA 2M56B 1MPEA 2WX0A 3U2SC 3H7PA 3W1SC 2IO1B 3PHWB 3ZTDA 2JWZA 4KGRA 3BYYB 3E56A 2BVCA 3NG0A 1OEYA 1FMAD 1XLOA 2M0XA 3GP7A 1L0VB 2WXMA 4W9CA 1PGBA 2D10A 4BBNC 1Q5WB 3P4RB 4BKSD 4ZHPA 1JALA 1P7FA 2L7RA 4TV3A 3UINB 1I4RA 1EU4A 3SU8X 2ONQA 4HCPB 5E6PA 5LXIB 4RGTA 4F7ZA 1SXTA 3Q8FA 3M63B 2TSSA 1V97A 3AU4A 4IKGA 1ZE3D 1N60A 2WWZA 5DCNA 2NBWB 3P4QB 2V4LA 5MPOA 3PV1A 4HPMB 4W9HA 3ZTCA 5AZHA 3Q3MC 4WAFA 1WXQA 2ON8A 3ECIA 4NY0A 2RPQA 2KWVB 1YN4A 1QF6A 1NYRA 1JCKB 1R7SA 4QAYA 2GI9A 5AEKB 1WX9A 3I5JC 1ZPSA 3KYCD 2KC1A 2W54A 2LXCA 4AP4C 4BOZB 1BT0A 2HTHA 1L7YA 1UBQA 3AN1A 1J7CA 2ZVNA 3FAHA 4AUQC 2KLCA 1AYFA 3HUIA 4ANUA 1WJ6A 4IM0A 1RRBA 2L83A 2PLPA 1NYQA 4NQKE 3LB8C 1P0RA 2BYTA 5HFYA 1XLQA 1HTOA 1YIWA 3D32A 1IGCA 2WXLA 3DBLI 4GSWA 4FJYA 1VLBA 3E9SA 1XCTL 4KGTA 4ZYSA 3ZNZB 1TY2A 4MGKE 2J0KA 4MGIE 3IHPC 3C19A 3H6NA 1PQSA 3U30A 1WXVA 4NZLB 1MVKA 1SJED 1IGDA 3QCAA 2MBQA 4WJQA 2RPVA 5DPWA 2G9HD 2JPHA 2WXOA 1EWCA 3UI3A 2XBBC 3IG3A 1JQ4A 1WXAA 5AUKA 3MJ5A 3ZJVA 2WGSA 1WE6A 3S2AA 3DBHI 3Q2AC 2I38A 3VR9B 2WYQA 3PSEB 2D2QA 3ENEA 2KAJA 5FR6A 1FPYA 4FLHA 1ZOYB 3KVFB 4GGQA 2KT7A 2DYOA 4KSKC 5BMGA 5I4DA 4HCNB 2N9EB 2VH2A 2AYOB 4HROA 4GMVA 1YNTE 4F1SA 2BS3B 4K7WA 3VTWA 1VD2A 1RLFA 3DBLB 1BMLC 1C4AA 2DHZA 4II3B 4XC2A 2L0TA 2DAFA 1TBEA 1JRUA 4E74A 2K5PA 1UD7A 4TSSA 1FFVA 1Y56A 5IA7A 1OGWA 4C7YA 2O6VB 4WH4A 2MP2B 1R4MI 2FUHB 2GOWA 4OHJA 4XZ4A 5BMHA 2J42A 4HJKA 2V3NA 1E6EB 3W9CB 2FCNA 3HVZA 3TIXA 3A1QB 3L08A 3AEAB 3FC4A 3DBHB 1ZXHA 3Q3OC 3EECA 3TCAA 1TKEA 1E8WA 3UQAA 4XDDA 1I4PA 2IJ0A 3GE3C 1WRIA 1WZ0A 4W9JA 1SE2A 3N1ZC 2BT6A 1QT9A 3HVDA 4ANWA 1NEKB 2HJ1A 4IG7B 4IM2A 3JSVA 5TR5A 1NDDA 4HKZE 1XCQL 3DWGC 1FFUA 1K8RB 1Q0WB 2LGIA 3DPDA 4MGYE 1P9DU 4OVZA 3EC8A 2KDIA 2M17A 1OQRA 1LXDA 2KVRA 1ZXIA 1GB4A 1TS4A 1SE3A 3IFWB 1F52A 5J17A 4HKQA 1KJTA 1GB1A 3EA6A 4RM9A 3I63C 4FHKA 2LGXA 4PYZA 4YSZB 1R4MB 3NVZA 4KZ0A 2FBWB 2L0FA 2J0JA 4G0NB 1SBBB 4K3BA 3T3OA 3RD2A 1D5XC 3VDZA 2WXKA 4IDIA 4FJZA 5CHVC 2G1EA 2M19A 1XLNA 1V9JA 1QILA 1LQBA 5H92C 4KDIC 1RYJA 3A4SC 4K7SA 3IT6B 2BWES 4YTMB 3WAPA 4EKUA 2VZKB 2FIDA 2HTME 1D5ZC 1MI0A 3KW5B 4KIKB 3AE3B 3RNAC 3AEDB 3I3TB 1J7AA 2D07B 2CS4A 2D3AA 3JVZX 2DAJA 2GLSA 2LRUA 2DZJA 2W3SA 3U7DA 4ASWC 1WR6E 2PEAA 2EMTA 2MSED 3K9PB 2X8XX 4W9DA 1V1PA 2LVOA 2REXA 1AW7A 3X23A 1ZDVA 4W9GA 4KSLC 5BO4B 2IO0B 3OAWA 3WIMA 2WLBA 3T9LA 2LVPA 3VTVA 1X1MA 3APFA 2INCC 3RPFC 3DOWA 1B1ZA 2MH7A 4B0MA 1V80A 1AN8A 1T0RC 1E0ZA 4AS1A 1E9MA 2IO2B 2PVGC 4ICUA 3PVLA 1QQRA 2L1AA 1GOZA 3GOEA 2ZW0A 3DVGY 1KFYB 1SE9A 3AXCA 2G4DB 5BYQA 2N4FA 4II2B 5CHWA 3B9JA 1KM7A 5FK9C 2CU1A 2NCNA 1YQ3B 3AE1B 3AE8B 1RAXA 4A3OA 2ZCBA 4BKTA 2KWCA 2FE8A 3B2FA 1SIFA 2XK5A
chains in the Genus database with same CATH topology
3QK0A 4MSQB 2M0XA 4GDKA 5GMVA 4K81A 5D2MB 4MH0E 3ML9A 4HPLB 1IP9A 4W9CA 4DDGD 4W9IA 3ZUNA 2KJ6A 2D10A 2KK8A 4MEMA 4AOFA 2BF8B 2G4SA 4BBNC 1IYFA 1Q5WB 2GBKA 3NOBA 4BKSD 4LCDE 3UQBA 4ZRJA 4BOZB 2KWUB 1EF1A 1ZGUB 2L7RA 4NNJB 3WAOA 3KUDB 2JY6A 4BKGA 4TV3A 3RYTA 3VUXA 3LDZE 3UINB 2CHWA 1WIAA 4HLEA 2LRWA 3A9JB 1E7UA 2EMSA 4K1RB 3SU8X 3BINA 3L0WB 1E5WA 5E6PA 4HCPB 4BFRA 5LXIB 1V6EA 5D6JB 4GXBA 5DPSA 3R7RA 4F7ZA 3KUZA 2KX0A 4LDTB 5G55A 3M63B 5JHBA 4OVVA 4NJ7A 4BVUC 1WXMA 4DWFA 2NR2A 1E8YA 2MA9B 1H8CA 2KFKB 4J6IA 3N32A 4RMAA 4AJYB 1XT9B 3AU4A 2L3ZA 3VH3B 2WWZA 5DCNA 4AJWA 1UGMA 2GMIC 2NBWB 2V4LA 3PV1A 3PS6A 4HPMB 4W9HA 3ZTCA 4GDLB 2KMCA 2KMAA 5AZHA 4DHJB 1AARA 2KQSA 3X0WA 2CKHB 1ZKHA 4I6PA 4P7IA 1Z2MA 1C1YB 3ECIA 3DCGA 5DPRA 1MG8A 1WMHB 3CSTA 2UWQA 4NY0A 3RULA 4IM3A 3ZKJC 4KV2A 1WGYA 4HDOA 3SD5A 2RPQA 2KWVB 4MDKE 3WAMA 1S3SG 4PYUA 2CHXA 1UZXB 2M1MA 2AL3A 4MM3A 2C7MB 2NPTB 3Q3FA 5J18A 2J7QB 3IBEA 3A9JA 2Y5BB 1WR1A 1YX6B 2A5UA 2WDTB 2LXAA 3PZDA 3UF8A 4DHZE 5AEKB 1WX9A 4G3XB 4ZRKA 1UBIA 3L16A 2KDBA 1WH3A 2KN5A 5C1ZA 4ICVA 4B9KA 1I35A 4FBJB 2NBUA 3KYCD 2KC1A 4IWPA 2O2VB 2IO3B 2R2QA 2LXCA 5CX3A 2IZVB 1J8CA 2KFKA 2ZEQA 3AULA 4AP4C 2MBOA 3ONSA 5KHOA 3WANA 1BT0A 2HTHA 1L7YA 1UBQA 3A4RA 2IY1B 4ZYNA 4ZDVA 2ZVNA 3DBSA 4IW0A 2N1WA 1WJ4A 2KLCA 4AUQC 4GDLA 4EZLA 1KLVA 3DQVA 4ANUA 1WJ6A 4IM0A 1RRBA 3L13A 2AWTA 5G2NA 4RM8A 4GOCA 4NQKE 3QAQA 2MWSB 3V61A 1P0RA 1WMHA 2KTRB 3AI5A 4G50A 3QC8B 4KDLB 4WAAA 1YIWA 3D32A 4ANVA 2NPTA 1C3TA 5L95C 2BYFA 3DBLI 3PPAA 4FJYA 4GSWA 4MGZE 5JHAA 2ZNVC 3ZVVA 1LM8B 4IUMB 2MBBB 4K7UA 3QQ8B 1OQYA 2I1KA 4W9FA 3VHTC 3ZNZB 2K39A 3M3JA 4MGKE 3TBLD 5D7GA 2J0KA 3B08A 1OEYJ 2PE6B 4MGIE 2BPSA 3NY5A 1YJ1A 1TTNA 2KKCA 2O2VA 1A5RA 3IHPC 2D11A 3DBRI 3UGBB 3B0AA 3H6NA 1PQSA 1S1QB 1RFAA 1P1AA 1E7VA 3W1YA 3R66C 4FA6A 3DVGX 3ZRFA 2G3QB 3PREA 3EFUA 4M0WB 3U30A 1WXVA 2JVCA 2GBMA 3QCAA 2FCMA 1E8XA 2KC2A 1WJNA 2MBQA 4WJQA 2BYVE 3O65B 4TKNA 1WZ3A 2KFJA 4XX5A 2GBRA 3QJZA 5DPWA 2JPHA 4E71A 2K1FA 3DVNV 3KYDD 1WE7A 2DZKA 2XBBC 3SDLC 1R4NI 3IG3A 4WWPA 3H7SA 4ANXA 5CTRC 1WXAA 1TZ1A 2D3GA 2KTRA 2NBVB 3WA0A 1WE6A 3V6EB 3QHTA 3S2AA 1WX7A 3DBHI 3QA8A 4W9KA 2N1VA 3AU5A 1J19A 3BY4B 2WYQA 3HM6X 3PSEB 1WGDA 4ZRIA 2D2QA 3ENEA 3M62B 5FR6A 2WX1A 2QHOA 3N30A 2JXXA 4HXDA 3QIJA 3V62A 1D3ZA 4IWOA 4FLHA 4HK2A 2AL6A 2J0MA 2Z59B 2I1JA 2LI5A 1WM3A 1Z5SB 2JRIB 3LJ3A 3NZSA 3KVFB 3L54A 2LZ6A 4GGQA 2DYOA 4KSKC 4FADA 4HCNB 3TJPA 5E6OA 3OJ4B 1GG3A 2N9EB 2KJHB 3OJ3A 2AEHA 2AYOB 1WGRA 4GMVA 2KHWB 4BOSC 4LJOB 1V86A 4F1SA 4K7WA 3VTWA 1VD2A 2ZZPB 1WXSA 3VAWA 1GC7A 2DENB 1HE8A 1RLFA 3MJWA 2VRRB 2KJRA 1V2YA 2A4ZA 2K6QA 5DPTA 4FULA 2DHZA 4II3B 2JZZA 4CO7A 4XC2A 1E90A 3NZUA 3QARA 3ZNHB 2L0TA 2DAFA 2MBEA 4W9LA 1TBEA 1JRUA 1GNUA 2EKEC 4E74A 1UD7A 4PS8A 4TUUA 5HKHA 5IA7A 2FIFA 1OGWA 2O6VB 1ISNA 2NS5A 2G45B 3PRZA 4MSMB 1EUVB 2KNBA 2MP2B 4WJOA 2CHZA 3V6CB 4AWJA 1R4MI 4NJ6A 2FUHB 1WGGA 1P3QU 2GOWA 2N9XA 3JSVB 4XZ4A 3B1LX 1P98A 1Y8RC 4GU2A 1E8ZA 4WQOB 3RZWC 2BKRB 3V60A 4HJKA 2PE9A 4WWNA 4M8NA 3R7QA 4WJPA 2K8CA 2FCNA 2KXJA 2K8BA 1V5OA 2HJ8A 2KTFA 2LD9A 2OJRA 3TIXA 3VQIA 3A1QB 3ML8A 3L08A 2DZMA 3UIPB 2C60A 3ZDMC 3PHXB 4DK5A 3HHMA 2NVUI 3H9DA 2M4NA 2RD0A 1CMXB 2RSUA 2MQJA 4F8CB 3VH4B 4JLCA 4NPNA 3PGEA 5LLIA 4EFOA 2MBHA 4GN1A 2KZRA 3EECA 3TCAA 3TMPB 2FCQA 4LDTD 1E8WA 3UQAA 3HIZA 3JW0X 3VFKA 3APDA 1WFYA 3L17A 3RCZA 3OLMD 4G11A 2O6VA 2RR9A 4A20A 2DX5B 1WZ0A 4W9JA 2MP2A 4DHJD 2R2OA 3A9KB 4ANWA 4IG7B 4FHJA 3QX1A 1V49A 3JSVA 4IM2A 1KOTA 5TR5A 1NDDA 1SGHA 3RUIB 2ZPNA 2MLBA 2N7EA 2PPHA 1V5TA 3RT3B 3PLUA 2LASA 1OTRB 3MTNB 1GUAB 1NBFC 4GIVA 4PS7A 3NS8A 4BKSA 1K8RB 4X57B 2V3SA 1Q0WB 4PS3A 3DPDA 1NI2A 5AZGA 2JZ3B 3A1QA 2KANA 4MGYE 2C9WB 1P9DU 3EC8A 2KDIA 2M17A 2W9NA 1WF9A 2BWFA 2PJHA 1LXDA 2LWPA 2FNJB 2KVRA 3HM3A 4JQWC 4EOYA 3ZLZA 3TL5A 3CMMB 1XQQA 3PRMB 1WGHA 3ZNID 3EHVA 3CSFA 2Z0DB 3IFWB 4TQ1A 3VUYA 2HE7A 5J17A 1KJTA 2C5LC 3HK0A 5KHQA 5D94A 5EDSA 4RM9A 2DYMA 4HDQA 1YX5B 4A3PA 4FHKA 2JF5A 4NQLB 5CHFA 2LGXA 3ALBA 4PYZA 4MELA 4KZ0A 4EEWA 2L0FA 3N3KB 3WALA 4BBNF 2V1YA 2J0JA 2ZJDA 4G0NB 2N7DA 3ZO5B 3ZRCA 3GZNI 4NAWB 3RD2A 1XD3B 3VDZA 3A9KA 4FJZA 1F9JA 2K25A 2UYZB 5CHVC 2IYDB 2JRHA 3P2BA 5IAAC 4EZJA 3UIOB 2OOBB 2KQ7A 3SHQA 4B6WA 1V9JA 3DVNU 4KZCA 3PTFC 3ZIMA 3PT2B 1WYWB 2CR5A 1I42A 1J0GA 2LGDA 1LQBA 1WY8A 2MX2A 4KDIC 2KLGA 4CYEA 2JUOA 4WWOA 3A33B 3A4SC 1L2NA 2YLMA 3PLVA 4K7SA 2BWES 2JT4B 3WAPA 1EF5A 4EKUA 2K6DB 4W9EA 3IVFA 2KDFB 1WI0A 2FIDA 4WJNA 2BYEA 4YL8A 2DYBA 4N9F4 4I6NB 3KH0A 3KW5B 4KIKB 1UELA 2MCNB 3VUWA 4FN2A 2XEWA 3U8ZA 1LFDA 3APCA 2ASQA 3QWZB 1VCBA 3I3TB 2D07B 2CS4A 3JVZX 2KO3A 2C7HA 2DAJA 2ZVOA 4NAWA 2LRUA 1WM2A 3R3MA 4JGHB 2RGFA 3W1SA 2DZJA 2GBJA 2MRPA 5JZEB 3U7DA 2L05A 3ZNGC 4ASWC 2L76A 3VXWA 1WR6E 4MJSB 2PEAA 2EMTA 2MSED 1FXTB 3K9PB 1YD8U 4EUTA 2FAZA 4M8MA 2MW5A 4FJVB 4DHZB 4W9DA 2LVOA 2B3AA 2REXA 3X23A 2M8SA 5JH5C 1ZW7A 3RZFA 3H7PB 4W9GA 4KSLC 5BO4B 2IO0B 3OAWA 3WIMA 4IWQA 3T9LA 3CF6E 2LVPA 3VTVA 1X1MA 3APFA 4EZKA 1UH6A 2KDEB 2C7NB 2LGYA 2N9PC 4IC7B 4HVBA 4I6LB 3DOWA 2BKFA 1M94A 4KIKA 2XK5B 5L83A 2KD0A 1V80A 1V81A 2IBIB 2L00B 3DDCB 4GDKB 2ZPYA 3ZW3A 3VTUA 2HD5B 5C23A 2IO2B 3Q3JA 1TGZB 4DXAB 2DZIA 4DBGA 1WJUA 4ICUA 3ZDTA 3PVLA 5AZFA 3JYUA 4E3CA 3H1UA 3GOEA 4HWIB 4JL9A 4MJSA 4URKA 3DVGY 1YQBA 1T0YA 2LVQA 3C0RB 1SE9A 1EO6A 2G4DB 3AXCA 5J2RA 2BGFA 3K9OB 3VVWB 2N4FA 4LJPB 4II2B 4TQ0A 1Q1OA 4GB9A 4OVUA 1KM7A 1QZEA 2LUEA 3NHEB 5CHWA 2LJ5A 2CU1A 3M95A 2KOXA 2WX0A 3PRPB 1IPGA 3T8MA 2NCNA 5LXHA 2YVCA 2Z0EB 3L10B 2K8HA 3H7PA 2ZCCA 3W1SC 2FCSA 2IO1B 3PHWB 4JIOU 3ZTDA 2JWZA 1H4RA 4B95A 1U4AA 1RAXA 4A3OA 2IY0B 2GBNA 2O6VD 5E6NA 2ZCBA 4BKTA 2KWCA 1WX8A 2L8JA 1G6JA 3MHSD 3KUCB 2ZNVB 1SIFA 1WRDB 2KX3A 2XK5A 4CHKA 1OEYA 4DDID 1GJZA 4KVGB 1GC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QK0 A;  4MSQ B;  2M0X A;  4GDK A;  5GMV A;  4K81 A;  5D2M B;  4MH0 E;  3ML9 A;  4HPL B;  1IP9 A;  4W9C A;  4DDG D;  4W9I A;  3ZUN A;  2KJ6 A;  2D10 A;  2KK8 A;  4MEM A;  4AOF A;  2BF8 B;  2G4S A;  4BBN C;  1IYF A;  1Q5W B;  2GBK A;  3NOB A;  4BKS D;  4LCD E;  3UQB A;  4ZRJ A;  4BOZ B;  2KWU B;  1EF1 A;  1ZGU B;  2L7R A;  4NNJ B;  3WAO A;  3KUD B;  2JY6 A;  4BKG A;  4TV3 A;  3RYT A;  3VUX A;  3LDZ E;  3UIN B;  2CHW A;  1WIA A;  4HLE A;  2LRW A;  3A9J B;  1E7U A;  2EMS A;  4K1R B;  3SU8 X;  3BIN A;  3L0W B;  1E5W A;  5E6P A;  4HCP B;  4BFR A;  5LXI B;  1V6E A;  5D6J B;  4GXB A;  5DPS A;  3R7R A;  4F7Z A;  3KUZ A;  2KX0 A;  4LDT B;  5G55 A;  3M63 B;  5JHB A;  4OVV A;  4NJ7 A;  4BVU C;  1WXM A;  4DWF A;  2NR2 A;  1E8Y A;  2MA9 B;  1H8C A;  2KFK B;  4J6I A;  3N32 A;  4RMA A;  4AJY B;  1XT9 B;  3AU4 A;  2L3Z A;  3VH3 B;  2WWZ A;  5DCN A;  4AJW A;  1UGM A;  2GMI C;  2NBW B;  2V4L A;  3PV1 A;  3PS6 A;  4HPM B;  4W9H A;  3ZTC A;  4GDL B;  2KMC A;  2KMA A;  5AZH A;  4DHJ B;  1AAR A;  2KQS A;  3X0W A;  2CKH B;  1ZKH A;  4I6P A;  4P7I A;  1Z2M A;  1C1Y B;  3ECI A;  3DCG A;  5DPR A;  1MG8 A;  1WMH B;  3CST A;  2UWQ A;  4NY0 A;  3RUL A;  4IM3 A;  3ZKJ C;  4KV2 A;  1WGY A;  4HDO A;  3SD5 A;  2RPQ A;  2KWV B;  4MDK E;  3WAM A;  1S3S G;  4PYU A;  2CHX A;  1UZX B;  2M1M A;  2AL3 A;  4MM3 A;  2C7M B;  2NPT B;  3Q3F A;  5J18 A;  2J7Q B;  3IBE A;  3A9J A;  2Y5B B;  1WR1 A;  1YX6 B;  2A5U A;  2WDT B;  2LXA A;  3PZD A;  3UF8 A;  4DHZ E;  5AEK B;  1WX9 A;  4G3X B;  4ZRK A;  1UBI A;  3L16 A;  2KDB A;  1WH3 A;  2KN5 A;  5C1Z A;  4ICV A;  4B9K A;  1I35 A;  4FBJ B;  2NBU A;  3KYC D;  2KC1 A;  4IWP A;  2O2V B;  2IO3 B;  2R2Q A;  2LXC A;  5CX3 A;  2IZV B;  1J8C A;  2KFK A;  2ZEQ A;  3AUL A;  4AP4 C;  2MBO A;  3ONS A;  5KHO A;  3WAN A;  1BT0 A;  2HTH A;  1L7Y A;  1UBQ A;  3A4R A;  2IY1 B;  4ZYN A;  4ZDV A;  2ZVN A;  3DBS A;  4IW0 A;  2N1W A;  1WJ4 A;  2KLC A;  4AUQ C;  4GDL A;  4EZL A;  1KLV A;  3DQV A;  4ANU A;  1WJ6 A;  4IM0 A;  1RRB A;  3L13 A;  2AWT A;  5G2N A;  4RM8 A;  4GOC A;  4NQK E;  3QAQ A;  2MWS B;  3V61 A;  1P0R A;  1WMH A;  2KTR B;  3AI5 A;  4G50 A;  3QC8 B;  4KDL B;  4WAA A;  1YIW A;  3D32 A;  4ANV A;  2NPT A;  1C3T A;  5L95 C;  2BYF A;  3DBL I;  3PPA A;  4FJY A;  4GSW A;  4MGZ E;  5JHA A;  2ZNV C;  3ZVV A;  1LM8 B;  4IUM B;  2MBB B;  4K7U A;  3QQ8 B;  1OQY A;  2I1K A;  4W9F A;  3VHT C;  3ZNZ B;  2K39 A;  3M3J A;  4MGK E;  3TBL D;  5D7G A;  2J0K A;  3B08 A;  1OEY J;  2PE6 B;  4MGI E;  2BPS A;  3NY5 A;  1YJ1 A;  1TTN A;  2KKC A;  2O2V A;  1A5R A;  3IHP C;  2D11 A;  3DBR I;  3UGB B;  3B0A A;  3H6N A;  1PQS A;  1S1Q B;  1RFA A;  1P1A A;  1E7V A;  3W1Y A;  3R66 C;  4FA6 A;  3DVG X;  3ZRF A;  2G3Q B;  3PRE A;  3EFU A;  4M0W B;  3U30 A;  1WXV A;  2JVC A;  2GBM A;  3QCA A;  2FCM A;  1E8X A;  2KC2 A;  1WJN A;  2MBQ A;  4WJQ A;  2BYV E;  3O65 B;  4TKN A;  1WZ3 A;  2KFJ A;  4XX5 A;  2GBR A;  3QJZ A;  5DPW A;  2JPH A;  4E71 A;  2K1F A;  3DVN V;  3KYD D;  1WE7 A;  2DZK A;  2XBB C;  3SDL C;  1R4N I;  3IG3 A;  4WWP A;  3H7S A;  4ANX A;  5CTR C;  1WXA A;  1TZ1 A;  2D3G A;  2KTR A;  2NBV B;  3WA0 A;  1WE6 A;  3V6E B;  3QHT A;  3S2A A;  1WX7 A;  3DBH I;  3QA8 A;  4W9K A;  2N1V A;  3AU5 A;  1J19 A;  3BY4 B;  2WYQ A;  3HM6 X;  3PSE B;  1WGD A;  4ZRI A;  2D2Q A;  3ENE A;  3M62 B;  5FR6 A;  2WX1 A;  2QHO A;  3N30 A;  2JXX A;  4HXD A;  3QIJ A;  3V62 A;  1D3Z A;  4IWO A;  4FLH A;  4HK2 A;  2AL6 A;  2J0M A;  2Z59 B;  2I1J A;  2LI5 A;  1WM3 A;  1Z5S B;  2JRI B;  3LJ3 A;  3NZS A;  3KVF B;  3L54 A;  2LZ6 A;  4GGQ A;  2DYO A;  4KSK C;  4FAD A;  4HCN B;  3TJP A;  5E6O A;  3OJ4 B;  1GG3 A;  2N9E B;  2KJH B;  3OJ3 A;  2AEH A;  2AYO B;  1WGR A;  4GMV A;  2KHW B;  4BOS C;  4LJO B;  1V86 A;  4F1S A;  4K7W A;  3VTW A;  1VD2 A;  2ZZP B;  1WXS A;  3VAW A;  1GC7 A;  2DEN B;  1HE8 A;  1RLF A;  3MJW A;  2VRR B;  2KJR A;  1V2Y A;  2A4Z A;  2K6Q A;  5DPT A;  4FUL A;  2DHZ A;  4II3 B;  2JZZ A;  4CO7 A;  4XC2 A;  1E90 A;  3NZU A;  3QAR A;  3ZNH B;  2L0T A;  2DAF A;  2MBE A;  4W9L A;  1TBE A;  1JRU A;  1GNU A;  2EKE C;  4E74 A;  1UD7 A;  4PS8 A;  4TUU A;  5HKH A;  5IA7 A;  2FIF A;  1OGW A;  2O6V B;  1ISN A;  2NS5 A;  2G45 B;  3PRZ A;  4MSM B;  1EUV B;  2KNB A;  2MP2 B;  4WJO A;  2CHZ A;  3V6C B;  4AWJ A;  1R4M I;  4NJ6 A;  2FUH B;  1WGG A;  1P3Q U;  2GOW A;  2N9X A;  3JSV B;  4XZ4 A;  3B1L X;  1P98 A;  1Y8R C;  4GU2 A;  1E8Z A;  4WQO B;  3RZW C;  2BKR B;  3V60 A;  4HJK A;  2PE9 A;  4WWN A;  4M8N A;  3R7Q A;  4WJP A;  2K8C A;  2FCN A;  2KXJ A;  2K8B A;  1V5O A;  2HJ8 A;  2KTF A;  2LD9 A;  2OJR A;  3TIX A;  3VQI A;  3A1Q B;  3ML8 A;  3L08 A;  2DZM A;  3UIP B;  2C60 A;  3ZDM C;  3PHX B;  4DK5 A;  3HHM A;  2NVU I;  3H9D A;  2M4N A;  2RD0 A;  1CMX B;  2RSU A;  2MQJ A;  4F8C B;  3VH4 B;  4JLC A;  4NPN A;  3PGE A;  5LLI A;  4EFO A;  2MBH A;  4GN1 A;  2KZR A;  3EEC A;  3TCA A;  3TMP B;  2FCQ A;  4LDT D;  1E8W A;  3UQA A;  3HIZ A;  3JW0 X;  3VFK A;  3APD A;  1WFY A;  3L17 A;  3RCZ A;  3OLM D;  4G11 A;  2O6V A;  2RR9 A;  4A20 A;  2DX5 B;  1WZ0 A;  4W9J A;  2MP2 A;  4DHJ D;  2R2O A;  3A9K B;  4ANW A;  4IG7 B;  4FHJ A;  3QX1 A;  1V49 A;  3JSV A;  4IM2 A;  1KOT A;  5TR5 A;  1NDD A;  1SGH A;  3RUI B;  2ZPN A;  2MLB A;  2N7E A;  2PPH A;  1V5T A;  3RT3 B;  3PLU A;  2LAS A;  1OTR B;  3MTN B;  1GUA B;  1NBF C;  4GIV A;  4PS7 A;  3NS8 A;  4BKS A;  1K8R B;  4X57 B;  2V3S A;  1Q0W B;  4PS3 A;  3DPD A;  1NI2 A;  5AZG A;  2JZ3 B;  3A1Q A;  2KAN A;  4MGY E;  2C9W B;  1P9D U;  3EC8 A;  2KDI A;  2M17 A;  2W9N A;  1WF9 A;  2BWF A;  2PJH A;  1LXD A;  2LWP A;  2FNJ B;  2KVR A;  3HM3 A;  4JQW C;  4EOY A;  3ZLZ A;  3TL5 A;  3CMM B;  1XQQ A;  3PRM B;  1WGH A;  3ZNI D;  3EHV A;  3CSF A;  2Z0D B;  3IFW B;  4TQ1 A;  3VUY A;  2HE7 A;  5J17 A;  1KJT A;  2C5L C;  3HK0 A;  5KHQ A;  5D94 A;  5EDS A;  4RM9 A;  2DYM A;  4HDQ A;  1YX5 B;  4A3P A;  4FHK A;  2JF5 A;  4NQL B;  5CHF A;  2LGX A;  3ALB A;  4PYZ A;  4MEL A;  4KZ0 A;  4EEW A;  2L0F A;  3N3K B;  3WAL A;  4BBN F;  2V1Y A;  2J0J A;  2ZJD A;  4G0N B;  2N7D A;  3ZO5 B;  3ZRC A;  3GZN I;  4NAW B;  3RD2 A;  1XD3 B;  3VDZ A;  3A9K A;  4FJZ A;  1F9J A;  2K25 A;  2UYZ B;  5CHV C;  2IYD B;  2JRH A;  3P2B A;  5IAA C;  4EZJ A;  3UIO B;  2OOB B;  2KQ7 A;  3SHQ A;  4B6W A;  1V9J A;  3DVN U;  4KZC A;  3PTF C;  3ZIM A;  3PT2 B;  1WYW B;  2CR5 A;  1I42 A;  1J0G A;  2LGD A;  1LQB A;  1WY8 A;  2MX2 A;  4KDI C;  2KLG A;  4CYE A;  2JUO A;  4WWO A;  3A33 B;  3A4S C;  1L2N A;  2YLM A;  3PLV A;  4K7S A;  2BWE S;  2JT4 B;  3WAP A;  1EF5 A;  4EKU A;  2K6D B;  4W9E A;  3IVF A;  2KDF B;  1WI0 A;  2FID A;  4WJN A;  2BYE A;  4YL8 A;  2DYB A;  4N9F 4;  4I6N B;  3KH0 A;  3KW5 B;  4KIK B;  1UEL A;  2MCN B;  3VUW A;  4FN2 A;  2XEW A;  3U8Z A;  1LFD A;  3APC A;  2ASQ A;  3QWZ B;  1VCB A;  3I3T B;  2D07 B;  2CS4 A;  3JVZ X;  2KO3 A;  2C7H A;  2DAJ A;  2ZVO A;  4NAW A;  2LRU A;  1WM2 A;  3R3M A;  4JGH B;  2RGF A;  3W1S A;  2DZJ A;  2GBJ A;  2MRP A;  5JZE B;  3U7D A;  2L05 A;  3ZNG C;  4ASW C;  2L76 A;  3VXW A;  1WR6 E;  4MJS B;  2PEA A;  2EMT A;  2MSE D;  1FXT B;  3K9P B;  1YD8 U;  4EUT A;  2FAZ A;  4M8M A;  2MW5 A;  4FJV B;  4DHZ B;  4W9D A;  2LVO A;  2B3A A;  2REX A;  3X23 A;  2M8S A;  5JH5 C;  1ZW7 A;  3RZF A;  3H7P B;  4W9G A;  4KSL C;  5BO4 B;  2IO0 B;  3OAW A;  3WIM A;  4IWQ A;  3T9L A;  3CF6 E;  2LVP A;  3VTV A;  1X1M A;  3APF A;  4EZK A;  1UH6 A;  2KDE B;  2C7N B;  2LGY A;  2N9P C;  4IC7 B;  4HVB A;  4I6L B;  3DOW A;  2BKF A;  1M94 A;  4KIK A;  2XK5 B;  5L83 A;  2KD0 A;  1V80 A;  1V81 A;  2IBI B;  2L00 B;  3DDC B;  4GDK B;  2ZPY A;  3ZW3 A;  3VTU A;  2HD5 B;  5C23 A;  2IO2 B;  3Q3J A;  1TGZ B;  4DXA B;  2DZI A;  4DBG A;  1WJU A;  4ICU A;  3ZDT A;  3PVL A;  5AZF A;  3JYU A;  4E3C A;  3H1U A;  3GOE A;  4HWI B;  4JL9 A;  4MJS A;  4URK A;  3DVG Y;  1YQB A;  1T0Y A;  2LVQ A;  3C0R B;  1SE9 A;  1EO6 A;  2G4D B;  3AXC A;  5J2R A;  2BGF A;  3K9O B;  3VVW B;  2N4F A;  4LJP B;  4II2 B;  4TQ0 A;  1Q1O A;  4GB9 A;  4OVU A;  1KM7 A;  1QZE A;  2LUE A;  3NHE B;  5CHW A;  2LJ5 A;  2CU1 A;  3M95 A;  2KOX A;  2WX0 A;  3PRP B;  1IPG A;  3T8M A;  2NCN A;  5LXH A;  2YVC A;  2Z0E B;  3L10 B;  2K8H A;  3H7P A;  2ZCC A;  3W1S C;  2FCS A;  2IO1 B;  3PHW B;  4JIO U;  3ZTD A;  2JWZ A;  1H4R A;  4B95 A;  1U4A A;  1RAX A;  4A3O A;  2IY0 B;  2GBN A;  2O6V D;  5E6N A;  2ZCB A;  4BKT A;  2KWC A;  1WX8 A;  2L8J A;  1G6J A;  3MHS D;  3KUC B;  2ZNV B;  1SIF A;  1WRD B;  2KX3 A;  2XK5 A;  4CHK A;  1OEY A;  4DDI D;  1GJZ A;  4KVG B;  1GC6 A; 
#chains in the Genus database with same CATH topology
 3QK0 A;  4MSQ B;  2J53 A;  4K81 A;  2IGG A;  3U4E G;  5D2M B;  4TMA B;  1T0Q C;  4W9I A;  4DDG D;  2KK8 A;  4MEM A;  4AOF A;  2BF8 B;  1IYF A;  1L6U A;  3UQB A;  4ZRJ A;  2KWU B;  1EU3 A;  3CWI A;  1ZGU B;  4MM3 B;  1FNU A;  3RYT A;  1I4X A;  4A90 A;  4HLE A;  2JXT A;  2NMQ A;  2D3B A;  3Q6B A;  1E5W A;  2AX5 A;  5G5H A;  1V6E A;  5JHB A;  1WXM A;  2NR2 A;  1E8Y A;  3L4P A;  2KFK B;  3N32 A;  2GRI A;  3Q8E A;  1SB3 C;  5BYR A;  1ZKH A;  2DNF A;  2PKO A;  3J9C A;  4YXD B;  4P7I A;  1KLG D;  5DPR A;  1MG8 A;  1WMH B;  2UWQ A;  1WGY A;  4HDO A;  3SD5 A;  1S3S G;  1UZX B;  2M1M A;  2AL3 A;  2C7M B;  2NPT B;  4ITK A;  1SF0 A;  3A9J A;  1WR1 A;  2WDV B;  2LXA A;  3PZD A;  2KDB A;  2KN5 A;  4ICV A;  4P6V F;  1XLP A;  2O2V B;  1N61 A;  3N1X C;  1YOV B;  3AE6 B;  1HZ6 A;  3AUL A;  4FXC A;  3WAN A;  4BZA A;  4DQO C;  2IY1 B;  5FKA C;  3DBS A;  3NRZ A;  2JQR B;  4GDL A;  1KLV A;  1TKG A;  3L13 A;  5G2N A;  3QAQ A;  2LFI A;  4REZ A;  1MG4 A;  1BXT A;  3QC8 B;  4KDL B;  1UGJ A;  1CK1 A;  4WAA A;  1IBX A;  1C3T A;  5L95 C;  4MGZ E;  5HI1 A;  5JHA A;  1LM8 B;  2WU2 B;  2PIA A;  3VHT C;  4A9A A;  2K39 A;  3M3J A;  5D7G A;  3B08 A;  3IAS 1;  1TIF A;  1JWB D;  1YJ1 A;  2KKC A;  1A5R A;  2D11 A;  3DBR I;  1SIJ A;  3DVG X;  3ZRF A;  4M0W B;  1TZO A;  3O65 B;  3O13 A;  1WZ3 A;  4XX5 A;  2WU5 B;  2L52 A;  4E71 A;  1DOI A;  1YN3 A;  1WE7 A;  2DZK A;  1R4N I;  2RDB C;  2KTR A;  1N5W A;  2NBV B;  3WA0 A;  1XF5 L;  3ZXV A;  2W82 A;  3QA8 A;  4W9K A;  1J19 A;  3BY4 B;  2WNM A;  1SJH D;  1WGD A;  4YTN B;  2WS3 B;  4ZRI A;  2UU7 A;  3M62 B;  1L5P A;  2JYT A;  2QHO A;  3N30 A;  2JXX A;  4IWO A;  2AL6 A;  1C76 A;  2I1J A;  2JRI B;  1Z5S B;  3P4P B;  3L54 A;  4WQM A;  3RNG C;  2NTT A;  3OJ3 A;  2EEL A;  4LNO A;  4BOS C;  1HEZ E;  1QKZ A;  2ZZP B;  1WXS A;  1GC7 A;  5H8Y E;  2VRR B;  1V2Y A;  2QEJ C;  5C3J B;  4FUL A;  2N9K A;  4CO7 A;  1E90 A;  3AEG B;  3FIL A;  4W9L A;  1F2R I;  4MAC A;  1GNU A;  1FO4 A;  4PS8 A;  4TUU A;  3DBR B;  4XWT A;  2V4I B;  1ISN A;  2ICI A;  2MHJ A;  2G45 B;  1XEE A;  2WXJ A;  3V6C B;  3RI7 C;  3P63 A;  1P3Q U;  3AE4 B;  3P1M A;  3B1L X;  4WQO B;  3RZW C;  1N5X A;  2D5G A;  2WP9 B;  2XNA C;  2BW2 A;  3R7Q A;  1R4N B;  4WJP A;  3N9Y C;  5D3I B;  2KXJ A;  2K8B A;  1V5O A;  2HJ8 A;  3SFE B;  2SAK A;  5IOI A;  2DZM A;  3PHX B;  3KWL A;  4N6E B;  2RD0 A;  1T6B X;  4F8C B;  3VH4 B;  4JLC A;  1C79 A;  4JPS A;  4LDT D;  2SEB D;  3HIZ A;  4O1N A;  4GLS C;  3KQ4 A;  4G11 A;  2PMV A;  4ZRP A;  4C00 A;  4M02 A;  4DHJ D;  3A9K B;  3QX1 A;  2Y3A A;  2N7E A;  1V5T A;  5EE9 A;  3RT3 B;  2LAS A;  2EKI A;  1GUA B;  4GIV A;  2QC8 A;  3CIR B;  5AZG A;  1V8C A;  2BS4 B;  2J4X A;  1NEN B;  4PK1 A;  1AWD A;  3U52 E;  3RN9 C;  2BWF A;  3HM3 A;  3CMM B;  1XQQ A;  4WUR A;  1WGH A;  3EHV A;  1YQ4 B;  2RDG A;  3HK0 A;  5EDS A;  1JML A;  4A3P A;  2JF5 A;  5CHF A;  3N3K B;  3TUO A;  1MFW A;  2V1Y A;  4NAW B;  3NS1 A;  4KKJ A;  2B76 B;  2K25 A;  3BVG A;  2IYD B;  2JRH A;  3P2B A;  5IAA C;  3SHQ A;  2QIL A;  3PTF C;  2JU6 X;  4M00 A;  3PT2 B;  1WYW B;  2CR5 A;  2RDH A;  1I42 A;  2LGD A;  2MX2 A;  5D3D A;  3A33 B;  4LLG M;  1L2N A;  2YLM A;  1TS5 A;  3Q3N C;  3TEW A;  2QMT A;  2KQ4 X;  4YL8 A;  1EWY C;  4N9F 4;  4I6N B;  1UEL A;  3VUW A;  4FN2 A;  1YJJ A;  1TYG B;  3APC A;  1JW9 D;  3DHI C;  2Z8L A;  1KH0 A;  2C7H A;  3W1S A;  3R3M A;  2MRP A;  1YJI A;  3ZNG C;  2KMM A;  4YTP B;  3RNC C;  2L76 A;  3VXW A;  1XXG A;  3PO0 A;  1L6V A;  1FXT B;  4RF1 A;  1YD8 U;  2JYE A;  2WDQ B;  1XO3 A;  4DHZ B;  3ZGZ A;  4L23 A;  2M8S A;  4P1C C;  5JH5 C;  1ZW7 A;  3H7P B;  2ACZ B;  1K50 A;  2N7J A;  4J3O D;  4IWQ A;  1J7B A;  4KKI A;  1UH6 A;  4USA A;  2C7N B;  3LXF A;  3GS2 A;  3RFZ B;  2IBI B;  2L00 B;  3DDC B;  1FCL A;  3ZW3 A;  2NTS A;  2K0P A;  3VTU A;  2HD5 B;  2R61 A;  2WXH A;  1D6E C;  4DBG A;  1WJU A;  1VDV A;  2IND C;  3ZDT A;  5AZF A;  4E3C A;  2VH1 A;  1TY0 A;  4MJS A;  4JL9 A;  3AEC B;  1ZUD 2;  2LVQ A;  1VJK A;  3C0R B;  2KDM A;  3VVW B;  4TQ0 A;  2CJN A;  2BQQ A;  2LJ5 A;  3M95 A;  3I57 A;  3T8M A;  5LXH A;  2ZCC A;  3W2D A;  2IDY A;  2IY0 B;  1N6Z A;  5E6N A;  1ENF A;  4C4V A;  1WX8 A;  1N62 A;  3MHS D;  1FRD A;  2ZNV B;  4DDI D;  1K52 A;  4IUM B;  2DWQ A;  2GB1 A;  1GAQ B;  1GC6 A;  1DGJ A;  4GDK A;  4MH0 E;  4HPL B;  1IP9 A;  3MC9 A;  2KJ6 A;  3BK1 A;  3ZUN A;  2MJD A;  2GBK A;  3NOB A;  2BB5 A;  2V9H A;  4HPP A;  4LCD E;  4NNJ B;  4MT5 A;  4ZOH C;  1STE A;  4YSX B;  1PFD A;  1E7U A;  4K1R B;  4RGM A;  4BFR A;  2LMC A;  4GXB A;  4US9 A;  3R7R A;  1SE4 A;  4OVV A;  4NJ7 A;  4BVU C;  3WCQ A;  2MA9 B;  4RMA A;  1XT9 B;  3AEE B;  4ARC A;  3VH3 B;  1UGM A;  4M01 A;  2KMC A;  2KMA A;  4DXG A;  1AAR A;  2K3U A;  2KQS A;  3X0W A;  2CKH B;  1YN5 A;  2I2Y A;  1Z2M A;  1C1Y B;  3DCG A;  3ZQ4 A;  3CST A;  1TKY A;  3RUL A;  3WAM A;  1P7E A;  4YWG G;  2BBC A;  5GXG B;  2DBY A;  2ZW1 A;  2J7Q B;  1YX6 B;  4ZRK A;  5C1Z A;  3NVV A;  5FR3 A;  4FBJ B;  1UWX A;  2NBU A;  4IWP A;  2R2Q A;  2W3R A;  4EE2 A;  2IZV B;  2ZEQ A;  2MBO A;  1UNS A;  3A4R A;  3N1Y C;  2AWT A;  4UDU C;  4RM8 A;  3ETR A;  3V61 A;  4N58 A;  3BK2 A;  1WSP A;  1I4H A;  4ANV A;  2BYF A;  3PPA A;  2ZNV C;  3ZVV A;  1KF6 B;  2MBB B;  4K7U A;  3QQ8 B;  2BTE A;  1OQY A;  2I1K A;  4W9F A;  2WXQ A;  3TBL D;  1L0X B;  1TTN A;  4XGA B;  3B0A A;  3R2I A;  1E7V A;  3R66 C;  3EFC A;  3EFU A;  2E3T A;  2JVC A;  2GBM A;  4ARI A;  2LGS A;  3SEB A;  1RWS A;  1WJN A;  3I9V 1;  1T0S C;  2KFJ A;  3QJZ A;  4ACF A;  2KAC A;  3KYD D;  1QLB B;  2X38 A;  3SDL C;  4WWP A;  4YSY B;  4ANX A;  5CTR C;  1TZ1 A;  2LEK A;  2N9L A;  1I4Q A;  1K51 A;  3V6E B;  2JWU A;  3V3X A;  1QOB A;  2N0S B;  1QOG A;  3HM6 X;  3AV8 A;  1VZ7 A;  2AQ3 B;  5IO9 A;  4HXD A;  3QIJ A;  1VZ6 A;  2Z59 B;  2LI5 A;  1PGA A;  2LZ6 A;  5HHD G;  3TJP A;  3NUH B;  5E6O A;  3VRA B;  4OZB A;  2KJH B;  1C78 A;  1D5M C;  1NVI D;  1WGR A;  2KHW B;  3VAW A;  2DEN B;  1HE8 A;  2KJR A;  2A4Z A;  2K6Q A;  5DPT A;  2JZZ A;  2KVZ A;  2PW9 A;  3QAR A;  3ZNH B;  3AEF B;  2FIF A;  1F77 A;  2NS5 A;  3MC8 A;  3RNF C;  3PRZ A;  4MSM B;  2KNB A;  4WJO A;  3N20 C;  4AWJ A;  4NJ6 A;  2KYW A;  1FRR A;  3JSV B;  1LO5 D;  4GU2 A;  1P98 A;  1E8Z A;  2BKR B;  3V60 A;  2V0G A;  3BWU D;  2K8C A;  4LNF A;  1MJD A;  2OJR A;  5IN7 A;  3ZDM C;  2C60 A;  5EE0 A;  4LTU A;  3KWV A;  3H9D A;  1CMX B;  2RSU A;  5BYS A;  3BVM A;  3R8B A;  3PGE A;  1V1O A;  5LLI A;  4EFO A;  4GN1 A;  5AUI A;  3MP9 A;  4LK0 M;  2FCQ A;  1HZ5 A;  3BVZ A;  1GPX A;  1I4G A;  3APD A;  1SEB D;  4HJG E;  3ZYY X;  3L17 A;  3RCZ A;  4A20 A;  2O6V A;  2DX5 B;  4S0R A;  2V3P A;  1F1H A;  1Q10 A;  2MP2 A;  2R2O A;  4FHJ A;  3AMZ A;  4RGN A;  1KOT A;  2H89 B;  1JWA D;  1CJE A;  1SGH A;  1ROE A;  3RUI B;  2MLB A;  2PPH A;  1UUP A;  1BUI C;  3AEB B;  3NVW A;  3RNE C;  3PLU A;  1N63 A;  1PYW D;  4PS7 A;  4X57 B;  3T3N A;  2V3S A;  4IOI E;  3NVY A;  4PS3 A;  1NI2 A;  3A1Q A;  3NZ3 A;  3DHH C;  1WF9 A;  3GE8 C;  4A6Q A;  3TSS A;  4LNK A;  3ZLZ A;  3TL5 A;  1PGX A;  3PRM B;  3ZNI D;  3CSF A;  4AQ7 A;  3TEX A;  2Z0D B;  3LYY A;  4LNI A;  3TEZ A;  5KHQ A;  5D94 A;  2J52 A;  2DYM A;  4HDQ A;  1YX5 B;  3ALB A;  3VRB B;  4MEL A;  1FD6 A;  1E7P B;  4EEW A;  3WAL A;  2YEP F;  3P4S B;  2N7D A;  3GZN I;  2QCZ A;  3ABV B;  1MHX A;  3OG5 A;  1C4C A;  4EZJ A;  3FKY A;  2OOB B;  1MHH E;  2KQ7 A;  4B6W A;  4KZC A;  1OFF A;  1J0G A;  1WY8 A;  4CYE A;  2KLG A;  3W5U B;  2JUO A;  4WWO A;  1V1P B;  2Y5P A;  2YEP B;  3OWE B;  1EF5 A;  4XDC A;  2K6D B;  3SFD B;  4W9E A;  2WXG A;  1WI0 A;  4WJN A;  1WYG A;  2BYE A;  3AE2 B;  2DYB A;  3KH0 A;  2MCN B;  2XEW A;  3U8Z A;  1D4B A;  1LFD A;  2KO3 A;  1PUT A;  1WM2 A;  2IPK D;  4A55 A;  2D3C A;  2M0A A;  3SR6 A;  5JZE B;  2K9X A;  2L05 A;  1IUE A;  2QSD A;  1HXY D;  2WXN A;  4M8M A;  2MW5 A;  2IGD A;  2B3A A;  4H2A A;  4P16 A;  3EUB 2;  2INP E;  1CZP A;  4OW0 A;  2KDE B;  2LGY A;  2WQY B;  4IC7 B;  2BKF A;  1M94 A;  1NI3 A;  4KIK A;  2XK5 B;  3C8Y A;  2KD0 A;  3AM9 A;  3GZN B;  1EM7 A;  1LGR A;  2ZPY A;  4NAM A;  2E6X A;  5C23 A;  5TSS A;  2OED A;  4DXA B;  3H1U A;  4URK A;  1JRP A;  4R3D A;  1T0Y A;  1KLU D;  1WGK A;  1EO6 A;  5J2R A;  4P1B C;  3NJT A;  1Q1O A;  4OVU A;  2W55 A;  3NHE B;  4YT0 B;  4CQN A;  2BS2 B;  2KOX A;  3VR8 B;  3PRP B;  1IPG A;  4WWM A;  2YVC A;  2Z0E B;  3L10 B;  2K8H A;  5HG2 A;  2FCS A;  4JIO U;  3Q8B A;  1H4R A;  4B95 A;  1U4A A;  2GBN A;  2O6V D;  2L8J A;  1G6J A;  3AB5 A;  3KUC B;  1WRD B;  2KX3 A;  4CHK A;  1GJZ A;  4KVG B;  4L1B A;  5GMV A;  3ML9 A;  2AQ2 B;  4RH6 A;  2Y5C A;  1ET6 A;  4D2K A;  4RGO S;  4WIP A;  2G4S A;  3BZD B;  3P42 A;  1L4D B;  2JSV X;  1EF1 A;  3WAO A;  3KUD B;  2JY6 A;  1L0Y B;  4BKG A;  3VUX A;  3LDZ E;  2CHW A;  1WIA A;  3RMK C;  2LRW A;  2OJW A;  3A9J B;  2EMS A;  2WDR B;  1M4V A;  4A8X C;  1ZP0 B;  1VZ8 A;  3BIN A;  3L0W B;  4JWU C;  1WWT A;  1KRH A;  5D6J B;  5DPS A;  3KUZ A;  2WXF A;  2KX0 A;  4LDT B;  5G55 A;  5EE3 A;  3HRD D;  4DWF A;  1TS2 A;  4J6I A;  1H8C A;  4AJY B;  2L3Z A;  2FUG 1;  2WXR A;  3BII D;  2GMI C;  3B2G A;  4AJW A;  1QOA A;  1E10 A;  3PS6 A;  4GDL B;  4DHJ B;  1JWU D;  5G5G A;  4I6P A;  1JWM D;  5JXV A;  2HDE A;  5E6J A;  1C77 A;  3ZKJ C;  4IM3 A;  4KV2 A;  4MDK E;  4PYU A;  1IBX B;  2CHX A;  1FXI A;  4MM3 A;  3Q3F A;  5J18 A;  3IBE A;  2Y5B B;  2WDT B;  2A5U A;  3AE5 B;  3UF8 A;  4DHZ E;  4G3X B;  1UBI A;  3L16 A;  1WH3 A;  4MH8 A;  5EE1 A;  4B9K A;  1I35 A;  2IO3 B;  5CX3 A;  1HA5 A;  1J8C A;  2KFK A;  3ONS A;  1FNV A;  5KHO A;  4RFB A;  4ZYN A;  4ZDV A;  3MHZ A;  4IW0 A;  2N1W A;  3V05 A;  1WJ4 A;  3ZJU A;  4ZHO A;  4EZL A;  3DQV A;  2INN E;  3R2T A;  4GOC A;  3U7Z A;  2MWS B;  1WMH A;  1F2R C;  2KTR B;  4HEA 1;  3AI5 A;  4G50 A;  3ZXR A;  4RCO A;  4BAX A;  2NPT A;  1KTK A;  2WXP A;  1FM0 D;  2VZK D;  1YMH E;  1OEY J;  2PE6 B;  4PT5 A;  4XWW A;  3IAM 1;  2BPS A;  3NY5 A;  5BMI A;  2O2V A;  3UGB B;  1S1Q B;  1RFA A;  1P1A A;  1DYQ A;  3W1Y A;  4FA6 A;  2G3Q B;  3PRE A;  1UWM A;  4ZRQ A;  5C2T B;  2LHD A;  1RFK A;  2JX5 A;  2FCM A;  1E8X A;  2KC2 A;  2BYV E;  2KN4 A;  4TKN A;  1JRO A;  2GBR A;  2Q5W D;  2K1F A;  3DVN V;  4S17 A;  2K22 A;  2AQ1 B;  3H7S A;  2D3G A;  4HRS A;  1ESF A;  3TEY A;  4B0E A;  2XN9 C;  3QHT A;  1ET9 A;  3FIL B;  1FNW A;  1WX7 A;  4OZC A;  2N1V A;  3AU5 A;  4RNA A;  4LNN A;  4JX1 C;  2QJL A;  3DHG C;  2WX1 A;  1UF0 A;  3V62 A;  1D3Z A;  4HK2 A;  2J0M A;  1ACC A;  1WM3 A;  3LJ3 A;  4M0W A;  3Q8C A;  3NZS A;  2MJE A;  4K3C A;  4FAD A;  3AE7 B;  3OJ4 B;  1GG3 A;  5LNK 1;  3GB1 A;  2AEH A;  4C80 A;  3MC0 B;  4LJO B;  1V86 A;  1I7H A;  3MJW A;  1A70 A;  1B9R A;  3NZU A;  2MBE A;  2L32 A;  4US8 A;  2EKE C;  1TS3 A;  3ZJT A;  5HKH A;  4DXF A;  4JE3 B;  1JWS D;  2PVO D;  1DOX A;  3Q14 C;  4XE0 A;  1EUV B;  2CHZ A;  1T3Q A;  1WGG A;  2JZP A;  2N9X A;  1Y8R C;  2PE9 A;  1K53 A;  4WWN A;  4M8N A;  2KTF A;  2LD9 A;  3VQI A;  3ML8 A;  3UIP B;  4DK5 A;  5IKC M;  3HHM A;  2NVU I;  2M4N A;  2MQJ A;  2DLB A;  4NPN A;  2MBH A;  2CJO A;  2KZR A;  3TMP B;  3JW0 X;  3VFK A;  1CQV A;  1WFY A;  4NJC A;  3OLM D;  2RR9 A;  1VR9 A;  2BB6 A;  4OZA A;  2IGH A;  4Q2J A;  4N59 A;  4JWS C;  1TJE A;  1V49 A;  3RNB C;  2LUM A;  2ZPN A;  1OTR B;  3MTN B;  1NBF C;  3NS8 A;  4BKS A;  3Q8A A;  3IT4 B;  2KWD A;  5T8I A;  4KGS A;  4C56 C;  2JZ3 B;  2KAN A;  3IXS A;  1FCC C;  2C9W B;  2H88 B;  4L2Y A;  2W9N A;  3AH7 A;  2PJH A;  2LWP A;  2FNJ B;  2WHI A;  4JQW C;  4EOY A;  1FIQ A;  2LHE A;  3AE9 B;  4TQ1 A;  3VUY A;  2HE7 A;  2C5L C;  1ZDX A;  2MEK A;  1SSN A;  4NQL B;  1OQQ A;  3EGR A;  4BBN F;  2ZJD A;  3ZO5 B;  3ZRC A;  1XD3 B;  3A9K A;  1F9J A;  3PZ8 A;  2UYZ B;  4KX6 B;  3DWM A;  3UIO B;  1F0Z A;  1T5X D;  3DVN U;  3ZIM A;  1QOF A;  1DOY A;  1VRA B;  3PLV A;  4RF0 A;  2JT4 B;  1C4P A;  3BYT B;  3IVF A;  2KDF B;  3W5V B;  4C7Z A;  1L4Z B;  2RMM A;  2ASQ A;  3QWZ B;  1VCB A;  3PZ7 A;  1PDX A;  1FEH A;  2ZVO A;  4NAW A;  4JGH B;  2RGF A;  2GBJ A;  1FXA A;  2QIE B;  3Q69 A;  4MJS B;  2QDF A;  2CU3 A;  4EUT A;  2FAZ A;  4FJV B;  3URY A;  3RZF A;  2MJ3 A;  2OHF A;  2LJI A;  3CF6 E;  4EZK A;  4HVB A;  2N9P C;  4C4V B;  4I6L B;  1C9F A;  3KLS X;  5L83 A;  1V81 A;  4GDK B;  1HTQ A;  3Q3J A;  1TGZ B;  5IP4 D;  3MFG A;  2WXI A;  2DZI A;  1RM6 C;  4XYC A;  3JYU A;  4HWI B;  1YQB A;  3H8H A;  2PTL A;  1HQR D;  2BGF A;  1TT5 B;  3K9O B;  4LJP B;  4GB9 A;  1QZE A;  2LUE A;  2M56 B;  1MPE A;  2WX0 A;  3U2S C;  3H7P A;  3W1S C;  2IO1 B;  3PHW B;  3ZTD A;  2JWZ A;  4KGR A;  3BYY B;  3E56 A;  2BVC A;  3NG0 A;  1OEY A;  1FMA D;  1XLO A;  2M0X A;  3GP7 A;  1L0V B;  2WXM A;  4W9C A;  1PGB A;  2D10 A;  4BBN C;  1Q5W B;  3P4R B;  4BKS D;  4ZHP A;  1JAL A;  1P7F A;  2L7R A;  4TV3 A;  3UIN B;  1I4R A;  1EU4 A;  3SU8 X;  2ONQ A;  4HCP B;  5E6P A;  5LXI B;  4RGT A;  4F7Z A;  1SXT A;  3Q8F A;  3M63 B;  2TSS A;  1V97 A;  3AU4 A;  4IKG A;  1ZE3 D;  1N60 A;  2WWZ A;  5DCN A;  2NBW B;  3P4Q B;  2V4L A;  5MPO A;  3PV1 A;  4HPM B;  4W9H A;  3ZTC A;  5AZH A;  3Q3M C;  4WAF A;  1WXQ A;  2ON8 A;  3ECI A;  4NY0 A;  2RPQ A;  2KWV B;  1YN4 A;  1QF6 A;  1NYR A;  1JCK B;  1R7S A;  4QAY A;  2GI9 A;  5AEK B;  1WX9 A;  3I5J C;  1ZPS A;  3KYC D;  2KC1 A;  2W54 A;  2LXC A;  4AP4 C;  4BOZ B;  1BT0 A;  2HTH A;  1L7Y A;  1UBQ A;  3AN1 A;  1J7C A;  2ZVN A;  3FAH A;  4AUQ C;  2KLC A;  1AYF A;  3HUI A;  4ANU A;  1WJ6 A;  4IM0 A;  1RRB A;  2L83 A;  2PLP A;  1NYQ A;  4NQK E;  3LB8 C;  1P0R A;  2BYT A;  5HFY A;  1XLQ A;  1HTO A;  1YIW A;  3D32 A;  1IGC A;  2WXL A;  3DBL I;  4GSW A;  4FJY A;  1VLB A;  3E9S A;  1XCT L;  4KGT A;  4ZYS A;  3ZNZ B;  1TY2 A;  4MGK E;  2J0K A;  4MGI E;  3IHP C;  3C19 A;  3H6N A;  1PQS A;  3U30 A;  1WXV A;  4NZL B;  1MVK A;  1SJE D;  1IGD A;  3QCA A;  2MBQ A;  4WJQ A;  2RPV A;  5DPW A;  2G9H D;  2JPH A;  2WXO A;  1EWC A;  3UI3 A;  2XBB C;  3IG3 A;  1JQ4 A;  1WXA A;  5AUK A;  3MJ5 A;  3ZJV A;  2WGS A;  1WE6 A;  3S2A A;  3DBH I;  3Q2A C;  2I38 A;  3VR9 B;  2WYQ A;  3PSE B;  2D2Q A;  3ENE A;  2KAJ A;  5FR6 A;  1FPY A;  4FLH A;  1ZOY B;  3KVF B;  4GGQ A;  2KT7 A;  2DYO A;  4KSK C;  5BMG A;  5I4D A;  4HCN B;  2N9E B;  2VH2 A;  2AYO B;  4HRO A;  4GMV A;  1YNT E;  4F1S A;  2BS3 B;  4K7W A;  3VTW A;  1VD2 A;  1RLF A;  3DBL B;  1BML C;  1C4A A;  2DHZ A;  4II3 B;  4XC2 A;  2L0T A;  2DAF A;  1TBE A;  1JRU A;  4E74 A;  2K5P A;  1UD7 A;  4TSS A;  1FFV A;  1Y56 A;  5IA7 A;  1OGW A;  4C7Y A;  2O6V B;  4WH4 A;  2MP2 B;  1R4M I;  2FUH B;  2GOW A;  4OHJ A;  4XZ4 A;  5BMH A;  2J42 A;  4HJK A;  2V3N A;  1E6E B;  3W9C B;  2FCN A;  3HVZ A;  3TIX A;  3A1Q B;  3L08 A;  3AEA B;  3FC4 A;  3DBH B;  1ZXH A;  3Q3O C;  3EEC A;  3TCA A;  1TKE A;  1E8W A;  3UQA A;  4XDD A;  1I4P A;  2IJ0 A;  3GE3 C;  1WRI A;  1WZ0 A;  4W9J A;  1SE2 A;  3N1Z C;  2BT6 A;  1QT9 A;  3HVD A;  4ANW A;  1NEK B;  2HJ1 A;  4IG7 B;  4IM2 A;  3JSV A;  5TR5 A;  1NDD A;  4HKZ E;  1XCQ L;  3DWG C;  1FFU A;  1K8R B;  1Q0W B;  2LGI A;  3DPD A;  4MGY E;  1P9D U;  4OVZ A;  3EC8 A;  2KDI A;  2M17 A;  1OQR A;  1LXD A;  2KVR A;  1ZXI A;  1GB4 A;  1TS4 A;  1SE3 A;  3IFW B;  1F52 A;  5J17 A;  4HKQ A;  1KJT A;  1GB1 A;  3EA6 A;  4RM9 A;  3I63 C;  4FHK A;  2LGX A;  4PYZ A;  4YSZ B;  1R4M B;  3NVZ A;  4KZ0 A;  2FBW B;  2L0F A;  2J0J A;  4G0N B;  1SBB B;  4K3B A;  3T3O A;  3RD2 A;  1D5X C;  3VDZ A;  2WXK A;  4IDI A;  4FJZ A;  5CHV C;  2G1E A;  2M19 A;  1XLN A;  1V9J A;  1QIL A;  1LQB A;  5H92 C;  4KDI C;  1RYJ A;  3A4S C;  4K7S A;  3IT6 B;  2BWE S;  4YTM B;  3WAP A;  4EKU A;  2VZK B;  2FID A;  2HTM E;  1D5Z C;  1MI0 A;  3KW5 B;  4KIK B;  3AE3 B;  3RNA C;  3AED B;  3I3T B;  1J7A A;  2D07 B;  2CS4 A;  2D3A A;  3JVZ X;  2DAJ A;  2GLS A;  2LRU A;  2DZJ A;  2W3S A;  3U7D A;  4ASW C;  1WR6 E;  2PEA A;  2EMT A;  2MSE D;  3K9P B;  2X8X X;  4W9D A;  1V1P A;  2LVO A;  2REX A;  1AW7 A;  3X23 A;  1ZDV A;  4W9G A;  4KSL C;  5BO4 B;  2IO0 B;  3OAW A;  3WIM A;  2WLB A;  3T9L A;  2LVP A;  3VTV A;  1X1M A;  3APF A;  2INC C;  3RPF C;  3DOW A;  1B1Z A;  2MH7 A;  4B0M A;  1V80 A;  1AN8 A;  1T0R C;  1E0Z A;  4AS1 A;  1E9M A;  2IO2 B;  2PVG C;  4ICU A;  3PVL A;  1QQR A;  2L1A A;  1GOZ A;  3GOE A;  2ZW0 A;  3DVG Y;  1KFY B;  1SE9 A;  3AXC A;  2G4D B;  5BYQ A;  2N4F A;  4II2 B;  5CHW A;  3B9J A;  1KM7 A;  5FK9 C;  2CU1 A;  2NCN A;  1YQ3 B;  3AE1 B;  3AE8 B;  1RAX A;  4A3O A;  2ZCB A;  4BKT A;  2KWC A;  2FE8 A;  3B2F A;  1SIF A;  2XK5 A; 
#chains in the Genus database with same CATH homology
 3QK0 A;  4MSQ B;  2M0X A;  4GDK A;  5GMV A;  4K81 A;  5D2M B;  4MH0 E;  3ML9 A;  4HPL B;  1IP9 A;  4W9C A;  4DDG D;  4W9I A;  3ZUN A;  2KJ6 A;  2D10 A;  2KK8 A;  4MEM A;  4AOF A;  2BF8 B;  2G4S A;  4BBN C;  1IYF A;  1Q5W B;  2GBK A;  3NOB A;  4BKS D;  4LCD E;  3UQB A;  4ZRJ A;  4BOZ B;  2KWU B;  1EF1 A;  1ZGU B;  2L7R A;  4NNJ B;  3WAO A;  3KUD B;  2JY6 A;  4BKG A;  4TV3 A;  3RYT A;  3VUX A;  3LDZ E;  3UIN B;  2CHW A;  1WIA A;  4HLE A;  2LRW A;  3A9J B;  1E7U A;  2EMS A;  4K1R B;  3SU8 X;  3BIN A;  3L0W B;  1E5W A;  5E6P A;  4HCP B;  4BFR A;  5LXI B;  1V6E A;  5D6J B;  4GXB A;  5DPS A;  3R7R A;  4F7Z A;  3KUZ A;  2KX0 A;  4LDT B;  5G55 A;  3M63 B;  5JHB A;  4OVV A;  4NJ7 A;  4BVU C;  1WXM A;  4DWF A;  2NR2 A;  1E8Y A;  2MA9 B;  1H8C A;  2KFK B;  4J6I A;  3N32 A;  4RMA A;  4AJY B;  1XT9 B;  3AU4 A;  2L3Z A;  3VH3 B;  2WWZ A;  5DCN A;  4AJW A;  1UGM A;  2GMI C;  2NBW B;  2V4L A;  3PV1 A;  3PS6 A;  4HPM B;  4W9H A;  3ZTC A;  4GDL B;  2KMC A;  2KMA A;  5AZH A;  4DHJ B;  1AAR A;  2KQS A;  3X0W A;  2CKH B;  1ZKH A;  4I6P A;  4P7I A;  1Z2M A;  1C1Y B;  3ECI A;  3DCG A;  5DPR A;  1MG8 A;  1WMH B;  3CST A;  2UWQ A;  4NY0 A;  3RUL A;  4IM3 A;  3ZKJ C;  4KV2 A;  1WGY A;  4HDO A;  3SD5 A;  2RPQ A;  2KWV B;  4MDK E;  3WAM A;  1S3S G;  4PYU A;  2CHX A;  1UZX B;  2M1M A;  2AL3 A;  4MM3 A;  2C7M B;  2NPT B;  3Q3F A;  5J18 A;  2J7Q B;  3IBE A;  3A9J A;  2Y5B B;  1WR1 A;  1YX6 B;  2A5U A;  2WDT B;  2LXA A;  3PZD A;  3UF8 A;  4DHZ E;  5AEK B;  1WX9 A;  4G3X B;  4ZRK A;  1UBI A;  3L16 A;  2KDB A;  1WH3 A;  2KN5 A;  5C1Z A;  4ICV A;  4B9K A;  1I35 A;  4FBJ B;  2NBU A;  3KYC D;  2KC1 A;  4IWP A;  2O2V B;  2IO3 B;  2R2Q A;  2LXC A;  5CX3 A;  2IZV B;  1J8C A;  2KFK A;  2ZEQ A;  3AUL A;  4AP4 C;  2MBO A;  3ONS A;  5KHO A;  3WAN A;  1BT0 A;  2HTH A;  1L7Y A;  1UBQ A;  3A4R A;  2IY1 B;  4ZYN A;  4ZDV A;  2ZVN A;  3DBS A;  4IW0 A;  2N1W A;  1WJ4 A;  2KLC A;  4AUQ C;  4GDL A;  4EZL A;  1KLV A;  3DQV A;  4ANU A;  1WJ6 A;  4IM0 A;  1RRB A;  3L13 A;  2AWT A;  5G2N A;  4RM8 A;  4GOC A;  4NQK E;  3QAQ A;  2MWS B;  3V61 A;  1P0R A;  1WMH A;  2KTR B;  3AI5 A;  4G50 A;  3QC8 B;  4KDL B;  4WAA A;  1YIW A;  3D32 A;  4ANV A;  2NPT A;  1C3T A;  5L95 C;  2BYF A;  3DBL I;  3PPA A;  4FJY A;  4GSW A;  4MGZ E;  5JHA A;  2ZNV C;  3ZVV A;  1LM8 B;  4IUM B;  2MBB B;  4K7U A;  3QQ8 B;  1OQY A;  2I1K A;  4W9F A;  3VHT C;  3ZNZ B;  2K39 A;  3M3J A;  4MGK E;  3TBL D;  5D7G A;  2J0K A;  3B08 A;  1OEY J;  2PE6 B;  4MGI E;  2BPS A;  3NY5 A;  1YJ1 A;  1TTN A;  2KKC A;  2O2V A;  1A5R A;  3IHP C;  2D11 A;  3DBR I;  3UGB B;  3B0A A;  3H6N A;  1PQS A;  1S1Q B;  1RFA A;  1P1A A;  1E7V A;  3W1Y A;  3R66 C;  4FA6 A;  3DVG X;  3ZRF A;  2G3Q B;  3PRE A;  3EFU A;  4M0W B;  3U30 A;  1WXV A;  2JVC A;  2GBM A;  3QCA A;  2FCM A;  1E8X A;  2KC2 A;  1WJN A;  2MBQ A;  4WJQ A;  2BYV E;  3O65 B;  4TKN A;  1WZ3 A;  2KFJ A;  4XX5 A;  2GBR A;  3QJZ A;  5DPW A;  2JPH A;  4E71 A;  2K1F A;  3DVN V;  3KYD D;  1WE7 A;  2DZK A;  2XBB C;  3SDL C;  1R4N I;  3IG3 A;  4WWP A;  3H7S A;  4ANX A;  5CTR C;  1WXA A;  1TZ1 A;  2D3G A;  2KTR A;  2NBV B;  3WA0 A;  1WE6 A;  3V6E B;  3QHT A;  3S2A A;  1WX7 A;  3DBH I;  3QA8 A;  4W9K A;  2N1V A;  3AU5 A;  1J19 A;  3BY4 B;  2WYQ A;  3HM6 X;  3PSE B;  1WGD A;  4ZRI A;  2D2Q A;  3ENE A;  3M62 B;  5FR6 A;  2WX1 A;  2QHO A;  3N30 A;  2JXX A;  4HXD A;  3QIJ A;  3V62 A;  1D3Z A;  4IWO A;  4FLH A;  4HK2 A;  2AL6 A;  2J0M A;  2Z59 B;  2I1J A;  2LI5 A;  1WM3 A;  1Z5S B;  2JRI B;  3LJ3 A;  3NZS A;  3KVF B;  3L54 A;  2LZ6 A;  4GGQ A;  2DYO A;  4KSK C;  4FAD A;  4HCN B;  3TJP A;  5E6O A;  3OJ4 B;  1GG3 A;  2N9E B;  2KJH B;  3OJ3 A;  2AEH A;  2AYO B;  1WGR A;  4GMV A;  2KHW B;  4BOS C;  4LJO B;  1V86 A;  4F1S A;  4K7W A;  3VTW A;  1VD2 A;  2ZZP B;  1WXS A;  3VAW A;  1GC7 A;  2DEN B;  1HE8 A;  1RLF A;  3MJW A;  2VRR B;  2KJR A;  1V2Y A;  2A4Z A;  2K6Q A;  5DPT A;  4FUL A;  2DHZ A;  4II3 B;  2JZZ A;  4CO7 A;  4XC2 A;  1E90 A;  3NZU A;  3QAR A;  3ZNH B;  2L0T A;  2DAF A;  2MBE A;  4W9L A;  1TBE A;  1JRU A;  1GNU A;  2EKE C;  4E74 A;  1UD7 A;  4PS8 A;  4TUU A;  5HKH A;  5IA7 A;  2FIF A;  1OGW A;  2O6V B;  1ISN A;  2NS5 A;  2G45 B;  3PRZ A;  4MSM B;  1EUV B;  2KNB A;  2MP2 B;  4WJO A;  2CHZ A;  3V6C B;  4AWJ A;  1R4M I;  4NJ6 A;  2FUH B;  1WGG A;  1P3Q U;  2GOW A;  2N9X A;  3JSV B;  4XZ4 A;  3B1L X;  1P98 A;  1Y8R C;  4GU2 A;  1E8Z A;  4WQO B;  3RZW C;  2BKR B;  3V60 A;  4HJK A;  2PE9 A;  4WWN A;  4M8N A;  3R7Q A;  4WJP A;  2K8C A;  2FCN A;  2KXJ A;  2K8B A;  1V5O A;  2HJ8 A;  2KTF A;  2LD9 A;  2OJR A;  3TIX A;  3VQI A;  3A1Q B;  3ML8 A;  3L08 A;  2DZM A;  3UIP B;  2C60 A;  3ZDM C;  3PHX B;  4DK5 A;  3HHM A;  2NVU I;  3H9D A;  2M4N A;  2RD0 A;  1CMX B;  2RSU A;  2MQJ A;  4F8C B;  3VH4 B;  4JLC A;  4NPN A;  3PGE A;  5LLI A;  4EFO A;  2MBH A;  4GN1 A;  2KZR A;  3EEC A;  3TCA A;  3TMP B;  2FCQ A;  4LDT D;  1E8W A;  3UQA A;  3HIZ A;  3JW0 X;  3VFK A;  3APD A;  1WFY A;  3L17 A;  3RCZ A;  3OLM D;  4G11 A;  2O6V A;  2RR9 A;  4A20 A;  2DX5 B;  1WZ0 A;  4W9J A;  2MP2 A;  4DHJ D;  2R2O A;  3A9K B;  4ANW A;  4IG7 B;  4FHJ A;  3QX1 A;  1V49 A;  3JSV A;  4IM2 A;  1KOT A;  5TR5 A;  1NDD A;  1SGH A;  3RUI B;  2ZPN A;  2MLB A;  2N7E A;  2PPH A;  1V5T A;  3RT3 B;  3PLU A;  2LAS A;  1OTR B;  3MTN B;  1GUA B;  1NBF C;  4GIV A;  4PS7 A;  3NS8 A;  4BKS A;  1K8R B;  4X57 B;  2V3S A;  1Q0W B;  4PS3 A;  3DPD A;  1NI2 A;  5AZG A;  2JZ3 B;  3A1Q A;  2KAN A;  4MGY E;  2C9W B;  1P9D U;  3EC8 A;  2KDI A;  2M17 A;  2W9N A;  1WF9 A;  2BWF A;  2PJH A;  1LXD A;  2LWP A;  2FNJ B;  2KVR A;  3HM3 A;  4JQW C;  4EOY A;  3ZLZ A;  3TL5 A;  3CMM B;  1XQQ A;  3PRM B;  1WGH A;  3ZNI D;  3EHV A;  3CSF A;  2Z0D B;  3IFW B;  4TQ1 A;  3VUY A;  2HE7 A;  5J17 A;  1KJT A;  2C5L C;  3HK0 A;  5KHQ A;  5D94 A;  5EDS A;  4RM9 A;  2DYM A;  4HDQ A;  1YX5 B;  4A3P A;  4FHK A;  2JF5 A;  4NQL B;  5CHF A;  2LGX A;  3ALB A;  4PYZ A;  4MEL A;  4KZ0 A;  4EEW A;  2L0F A;  3N3K B;  3WAL A;  4BBN F;  2V1Y A;  2J0J A;  2ZJD A;  4G0N B;  2N7D A;  3ZO5 B;  3ZRC A;  3GZN I;  4NAW B;  3RD2 A;  1XD3 B;  3VDZ A;  3A9K A;  4FJZ A;  1F9J A;  2K25 A;  2UYZ B;  5CHV C;  2IYD B;  2JRH A;  3P2B A;  5IAA C;  4EZJ A;  3UIO B;  2OOB B;  2KQ7 A;  3SHQ A;  4B6W A;  1V9J A;  3DVN U;  4KZC A;  3PTF C;  3ZIM A;  3PT2 B;  1WYW B;  2CR5 A;  1I42 A;  1J0G A;  2LGD A;  1LQB A;  1WY8 A;  2MX2 A;  4KDI C;  2KLG A;  4CYE A;  2JUO A;  4WWO A;  3A33 B;  3A4S C;  1L2N A;  2YLM A;  3PLV A;  4K7S A;  2BWE S;  2JT4 B;  3WAP A;  1EF5 A;  4EKU A;  2K6D B;  4W9E A;  3IVF A;  2KDF B;  1WI0 A;  2FID A;  4WJN A;  2BYE A;  4YL8 A;  2DYB A;  4N9F 4;  4I6N B;  3KH0 A;  3KW5 B;  4KIK B;  1UEL A;  2MCN B;  3VUW A;  4FN2 A;  2XEW A;  3U8Z A;  1LFD A;  3APC A;  2ASQ A;  3QWZ B;  1VCB A;  3I3T B;  2D07 B;  2CS4 A;  3JVZ X;  2KO3 A;  2C7H A;  2DAJ A;  2ZVO A;  4NAW A;  2LRU A;  1WM2 A;  3R3M A;  4JGH B;  2RGF A;  3W1S A;  2DZJ A;  2GBJ A;  2MRP A;  5JZE B;  3U7D A;  2L05 A;  3ZNG C;  4ASW C;  2L76 A;  3VXW A;  1WR6 E;  4MJS B;  2PEA A;  2EMT A;  2MSE D;  1FXT B;  3K9P B;  1YD8 U;  4EUT A;  2FAZ A;  4M8M A;  2MW5 A;  4FJV B;  4DHZ B;  4W9D A;  2LVO A;  2B3A A;  2REX A;  3X23 A;  2M8S A;  5JH5 C;  1ZW7 A;  3RZF A;  3H7P B;  4W9G A;  4KSL C;  5BO4 B;  2IO0 B;  3OAW A;  3WIM A;  4IWQ A;  3T9L A;  3CF6 E;  2LVP A;  3VTV A;  1X1M A;  3APF A;  4EZK A;  1UH6 A;  2KDE B;  2C7N B;  2LGY A;  2N9P C;  4IC7 B;  4HVB A;  4I6L B;  3DOW A;  2BKF A;  1M94 A;  4KIK A;  2XK5 B;  5L83 A;  2KD0 A;  1V80 A;  1V81 A;  2IBI B;  2L00 B;  3DDC B;  4GDK B;  2ZPY A;  3ZW3 A;  3VTU A;  2HD5 B;  5C23 A;  2IO2 B;  3Q3J A;  1TGZ B;  4DXA B;  2DZI A;  4DBG A;  1WJU A;  4ICU A;  3ZDT A;  3PVL A;  5AZF A;  3JYU A;  4E3C A;  3H1U A;  3GOE A;  4HWI B;  4JL9 A;  4MJS A;  4URK A;  3DVG Y;  1YQB A;  1T0Y A;  2LVQ A;  3C0R B;  1SE9 A;  1EO6 A;  2G4D B;  3AXC A;  5J2R A;  2BGF A;  3K9O B;  3VVW B;  2N4F A;  4LJP B;  4II2 B;  4TQ0 A;  1Q1O A;  4GB9 A;  4OVU A;  1KM7 A;  1QZE A;  2LUE A;  3NHE B;  5CHW A;  2LJ5 A;  2CU1 A;  3M95 A;  2KOX A;  2WX0 A;  3PRP B;  1IPG A;  3T8M A;  2NCN A;  5LXH A;  2YVC A;  2Z0E B;  3L10 B;  2K8H A;  3H7P A;  2ZCC A;  3W1S C;  2FCS A;  2IO1 B;  3PHW B;  4JIO U;  3ZTD A;  2JWZ A;  1H4R A;  4B95 A;  1U4A A;  1RAX A;  4A3O A;  2IY0 B;  2GBN A;  2O6V D;  5E6N A;  2ZCB A;  4BKT A;  2KWC A;  1WX8 A;  2L8J A;  1G6J A;  3MHS D;  3KUC B;  2ZNV B;  1SIF A;  1WRD B;  2KX3 A;  2XK5 A;  4CHK A;  1OEY A;  4DDI D;  1GJZ A;  4KVG B;  1GC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...