3VH4B

Crystal structure of atg7ctd-atg8-mgatp complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
TFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein/protein transport
molecule keywords Ubiquitin-like modifier-activating enzyme ATG7
publication title Structural basis of Atg8 activation by a homodimeric E1, Atg7.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 29
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3vh4B00
2RSUA 2A4ZA 1Z5SB 2L7RA 3QQ8B 4DHJD 3V6CB 2BGFA 2J0JA 2G4SA 1KOTA 3K9OB 1YIWA 2J0KA 3SHQA 4TKNA 5L95C 2MP2A 2O2VA 2R2QA 4GXBA 2XK5A 3JYUA 3MJWA 3ZNZB 3JW0X 2L05A 1WI0A 3UQBA 1RAXA 3OJ4B 1XQQA 1V2YA 4WJNA 2KDEB 2MP2B 3IVFA 5IA7A 1GC7A 4A20A 4EOYA 3KH0A 4KIKB 2PE6B 1LQBA 2C7NB 3OLMD 4IW0A 3ZTCA 5D2MB 1WGYA 1WGDA 3A4RA 3B1LX 2GBJA 1NDDA 1WZ0A 3C0RB 3VTWA 1V49A 5LXIB 1WZ3A 1EF1A 2BWES 2KJHB 3ENEA 2MLBA 2JXXA 2A5UA 1WX7A 2WX1A 3B0AA 2AWTA 2ZPYA 5E6PA 1WXVA 4EZKA 1OTRB 4ANUA 1A5RA 3APDA 4MGIE 2I1JA 2WDTB 2GBKA 1WX8A 1E8ZA 2KTRB 3PRZA 3D32A 4ANXA 3A33B 3MTNB 1E8YA 1C1YB 4BFRA 2V4LA 5IAAC 4KV2A 1J19A 2KMAA 3NY5A 3WIMA 4GDLB 2REXA 4MGYE 3IG3A 1JRUA 2JF5A 3DPDA 1MG8A 3NZSA 4EUTA 4GU2A 2D11A 2ZVNA 3GZNI 3PREA 1LXDA 3VUYA 3VH3B 2IYDB 1AARA 1WX9A 2KFJA 2KDBA 4FULA 2N7DA 1V5OA 4ICVA 1WXAA 2BYVE 4IC7B 2KJRA 4NQKE 3KW5B 1IYFA 3VTUA 3H7SA 3DQVA 4MSQB 4F8CB 1S1QB 3DCGA 3U8ZA 2KVRA 2NBVB 5DPTA 2DENB 3VVWB 4PS8A 3PHWB 1WJNA 2M0XA 3V6EB 4IM2A 1WJUA 1WXSA 4MJSB 2DAJA 1P0RA 4GB9A 4E74A 1R4MI 2K6DB 3PTFC 4M0WB 3VUXA 3OAWA 5HKHA 3N3KB 4OVUA 4E3CA 2FCMA 2ZEQA 3DVNV 2LZ6A 4G50A 3RZWC 1YX6B 2AL6A 2BKFA 1EO6A 4KZCA 3V61A 3QA8A 2YLMA 3PZDA 3AI5A 2N1VA 3H1UA 2NCNA 4K7SA 1UZXB 1ZKHA 2CU1A 2KX0A 2KWVB 3LDZE 3QC8B 4DBGA 2CHZA 5DPSA 2JZ3B 1WR1A 1P9DU 4MM3A 3WA0A 1P1AA 2EMTA 4W9FA 3T9LA 3ML8A 3VFKA 2JWZA 2NPTB 2KO3A 4IM3A 3ZIMA 1WIAA 2HTHA 3PLVA 3PVLA 4MH0E 5L83A 4DHJB 2Z59B 3DBHI 4AOFA 5D7GA 3Q3FA 1WH3A 2MBHA 4WAAA 2IO3B 4GGQA 4W9IA 3SDLC 3ML9A 2LWPA 1TTNA 1WGGA 4TUUA 2KC2A 2BKRB 2DZKA 2UYZB 2MBEA 3EC8A 4NNJB 2KHWB 3R7RA 3NS8A 2KDIA 4JL9A 4WWOA 3A1QA 4FADA 3ZVVA 1V6EA 4FJYA 3ZRCA 2OJRA 2KN5A 4J6IA 2OOBB 3H7PA 4EFOA 2KXJA 3I3TB 2DYMA 1P98A 1U4AA 4IWPA 4PS3A 4W9JA 3JVZX 5KHQA 3WALA 4IWOA 1OEYJ 1E7UA 3A1QB 4NQLB 3A9KA 2MQJA 3LJ3A 2LASA 4KDIC 3T8MA 3WAPA 2RPQA 2FCQA 3VDZA 4B95A 3APFA 4JGHB 2O2VB 1WYWB 1WMHA 2L3ZA 2XK5B 2G45B 2MBBB 2ZZPB 2KWUB 4FN2A 4GDKA 4HWIB 3HM6X 4W9GA 2IY1B 5D6JB 2B3AA 3VTVA 3ZKJC 3PT2B 1WMHB 3M3JA 2CR5A 3RD2A 1WGRA 2ZVOA 2FAZA 2LGYA 1YJ1A 2LXCA 3QHTA 3O65B 3QIJA 4KSLC 5E6NA 3KYCD 4E71A 5JH5C 2C9WB 1ZGUB 2KD0A 3ZDTA 2GBRA 3ZTDA 1WJ4A 4YL8A 5GMVA 3VUWA 3U7DA 3M62B 2DAFA 4FBJB 3WANA 5J2RA 1ISNA 1RFAA 1WE7A 2JRHA 2ZNVC 2LI5A 1VD2A 1WXMA 3CF6E 4M8NA 4M8MA 1Q0WB 4ANVA 2KLCA 2L8JA 2KANA 2FUHB 4DDGD 3ZUNA 2BYEA 4K1RB 2C60A 4ASWC 3DDCB 1WR6E 3UINB 4HCPB 4W9KA 5JHAA 4TV3A 2IZVB 3DOWA 4FLHA 2LGDA 2FCNA 2KNBA 4W9EA 4FA6A 1VCBA 3P2BA 1KLVA 2RR9A 2LRWA 5G55A 4XC2A 1OGWA 2MWSB 2D10A 3H9DA 1KJTA 3L54A 4FHJA 1NBFC 3DBLI 2JVCA 5D94A 2K8CA 3MHSD 4IG7B 3L08A 1GG3A 4P7IA 5AZHA 3L13A 2M17A 4JIOU 1E5WA 5DCNA 1UH6A 2MX2A 4MDKE 3UIPB 4BKGA 4LJPB 3L16A 4G3XB 4GMVA 2IO0B 4ZRJA 4TQ1A 4AJYB 4MEMA 4CHKA 4HVBA 3QAQA 2XBBC 3EFUA 2MRPA 3SU8X 3W1SC 1Z2MA 4N9F4 4X57B 3QK0A 1CMXB 1OQYA 2DHZA 3R3MA 3SD5A 3TBLD 2ZCCA 3U30A 3CSTA 2LVOA 3L17A 4FJVB 3M95A 3AULA 2FIFA 3N32A 3RULA 4AP4C 5EDSA 2EKEC 2D2QA 4MELA 4JLCA 4NJ6A 2RGFA 3RT3B 2K1FA 4PYUA 3VQIA 2N9PC 3RZFA 5CTRC 4B9KA 2JUOA 3EECA 4ZYNA 3DBSA 3W1SA 4RM8A 3UIOB 2ZPNA 2O6VA 3BINA 3H6NA 1H4RA 2MSED 3EHVA 1P3QU 2DX5B 2HD5B 1WE6A 3UF8A 2DYOA 2KX3A 1J8CA 3QARA 5AZGA 4LDTD 5LLIA 1EUVB 4GOCA 2N9XA 2GOWA 4W9LA 2NBWB 3JSVA 2DZMA 2DYBA 2KQ7A 5KHOA 3S2AA 3KYDD 1S3SG 4A3PA 2MBQA 1YQBA 3KUDB 2K8HA 2M1MA 2KC1A 3A9JA 1L2NA 2KFKA 2FIDA 3HHMA 4DK5A 2K25A 4DHZE 2ASQA 1GJZA 3CSFA 2IO2B 1WM2A 2IY0B 2G4DB 2CHXA 3TCAA 4MSMB 4URKA 1LM8B 4ZRIA 1WGHA 3A9JB 3OJ3A 4RM9A 1I42A 4B6WA 2KDFB 3ALBA 4IUMB 4W9CA 5CHFA 4AJWA 1BT0A 4HXDA 3L0WB 2O6VD 2J0MA 1SE9A 2R2OA 3HM3A 2V1YA 3PLUA 4HK2A 4ANWA 4LCDE 4WWPA 4HLEA 4FJZA 5BO4B 3KUZA 2D07B 2L76A 3HIZA 4GN1A 3VAWA 3RUIB 3RCZA 4IWQA 3PRMB 3AU4A 1IP9A 2NVUI 5JHBA 4HPLB 2NS5A 3V62A 3PV1A 3QJZA 4TQ0A 2KKCA 2D3GA 4II2B 2LUEA 4W9DA 5C23A 3H7PB 5J17A 3RYTA 2JZZA 3ZLZA 3KVFB 4LJOB 1LFDA 3NOBA 3VH4B 2K39A 4PS7A 4HDOA 2ZCBA 2CHWA 4II3B 3W1YA 2K8BA 3A9KB 1XT9B 3DVNU 4RMAA 2IBIB 3IFWB 2GBMA 2PE9A 2CS4A 1PQSA 2KOXA 3R7QA 3ZNHB 1V9JA 2AEHA 1GNUA 2MBOA 4MGZE 2KMCA 2CKHB 2M8SA 4K7UA 4BOZB 4FHKA 3TIXA 2WWZA 5DPRA 4KVGB 4BKTA 4DWFA 4AUQC 1Y8RC 2JY6A 2ZJDA 4GDKB 1G6JA 4WJPA 2BYFA 2Z0EB 2IO1B 4KIKA 2JPHA 4IM0A 1GUAB 2GBNA 3UGBB 1K8RB 3BY4B 5LXHA 3N30A 5AEKB 3KUCB 4K7WA 4ZRKA 4KZ0A 3A4SC 3DVGX 2N7EA 5G2NA 4BVUC 2UWQA 2PEAA 4JQWC 1E7VA 2G3QB 4K81A 3UQAA 3WAMA 1Q1OA 2C5LC 1HE8A 2BWFA 2N1WA 2FCSA 2EMSA 1E8WA 2KJ6A 1V5TA 4W9HA 1J0GA 2GMIC 1T0YA 2KTRA 2LVPA 2KK8A 2QHOA 3IHPC 3NZUA 3PSEB 1E90A 1QZEA 2DZIA 1TGZB 2JT4B 4BBNF 2AYOB 4F7ZA 1SGHA 4GDLA 3NHEB 4EZJA 5J18A 3TJPA 2KLGA 2ZNVB 3DVGY 3R66C 2LJ5A 5CHWA 3ZNGC 2RD0A 3QCAA 2Y5BB 2HJ8A 3Q3JA 2C7MB 4HJKA 4LDTB 4WWNA 1ZW7A 3ZNID 3HK0A 3V60A 1RRBA 2C7HA 2LVQA 2XEWA 2I1KA 1V86A 4OVVA 1TZ1A 4XX5A 4WJQA 4GSWA 3ZW3A 2V3SA 2M4NA 5FR6A 3TMPB 1WRDB 3X23A 2KZRA 5JZEB 2MA9B 1E8XA 4F1SA 1WJ6A 2KTFA 1V81A 2BPSA 4G11A 2J7QB 2LRUA 4I6LB 4NAWA 2NBUA 5TR5A 3ONSA 5C1ZA 1UGMA 5AZFA 2LXAA 1YX5B 2JRIB 5E6OA 3M63B 1TBEA 1WY8A 2HE7A 4MJSA 1UD7A 1L7YA 4GIVA 2NR2A 4WJOA 5CX3A 4DHZB 2KWCA 1Q5WB 1SIFA 3IBEA 4NAWB 1D3ZA 1FXTB 1XD3B 4XZ4A 2O6VB 3DBRI 3K9PB 5DPWA 4BOSC 4EZLA 1V80A 4PYZA 3B08A 3CMMB 3JSVB 4BKSA 4NJ7A 2PPHA 2WX0A 5CHVC 2KQSA 2N9EB 3VXWA 4ZDVA 4A3OA 1RLFA 1UBIA 3AU5A 2BF8B 2N4FA 1WFYA 4NPNA 1I35A 2L0FA 4EEWA 1M94A 2AL3A 2NPTA 2KFKB 2YVCA 4G0NB 1YD8U 4EKUA 3PRPB 3PHXB 4I6NB 4HPMB 1F9JA 3PPAA 3QX1A 3PS6A 3AXCA 3L10B 3WAOA 4HCNB 3TL5A 4CO7A 4DXAB 2MCNB 4BBNC 4CYEA 1EF5A 1R4NI 2LD9A 3APCA 3PGEA 4DDID 1X1MA 1WF9A 2L00B 4HDQA 2K6QA 4NY0A 3X0WA 3QWZB 4AWJA 3GOEA 2Z0DB 1UELA 2W9NA 4ICUA 3ZDMC 4KDLB 2L0TA 2FNJB 1GC6A 1H8CA 4I6PA 3VHTC 2WYQA 2DZJA 4MGKE 4BKSD 3ZO5B 2MW5A 1OEYA 2VRRB 4WQOB 2LGXA 2PJHA 1C3TA 3ZRFA 1IPGA 1WM3A 1UBQA 1NI2A 3ECIA 1KM7A 4KSKC
chains in the Genus database with same CATH superfamily
1QOFA 4K3CA 1KOTA 3K9OB 1SJHD 3DHGC 4TKNA 3MC9A 2MP2A 4NZLB 4GXBA 2XK5A 3JYUA 3MJWA 3TEWA 2L05A 3N1ZC 1XQQA 1V2YA 1E0ZA 4RH6A 1FO4A 1GC7A 2Y5CA 1PGAA 5BYRA 4EOYA 3PO0A 1LQBA 1R4MB 1T0RC 1QOGA 2GBJA 1V49A 1WZ3A 1EF1A 2KJHB 1ZXIA 2AWTA 2ZPYA 1WXVA 4YSXB 2X38A 4M01A 1A5RA 2GBKA 4BAXA 1BXTA 3MTNB 1MI0A 1ZUD2 2H88B 4US9A 4XWTA 1KFYB 3AH7A 4DXFA 2HDEA 2WXOA 3DBHB 5E6JA 4MGYE 1MG4A 1TS3A 1E10A 1JRUA 2JF5A 2OJWA 2IGDA 2K9XA 2ZVNA 1LXDA 4JWUC 4C4VB 1NI3A 1WXAA 1ZDXA 2BYVE 2I2YA 3H7SA 1S1QB 1QQRA 3P1MA 3U8ZA 2KN4A 2WXHA 1YN3A 3AMZA 3VVWB 4PS8A 3PHWB 2BVCA 3AE7B 3BWUD 5FK9C 1WXSA 4MJSB 2DAJA 1PGXA 4GB9A 3RNEC 1R4MI 2K6DB 3VUXA 2FCMA 3DVNV 4G50A 1CQVA 2K3UA 2AL6A 4KZCA 3V61A 2NCNA 1ZKHA 3LDZE 3QC8B 4MM3A 2EMTA 2PVGC 3T9LA 1QILA 3VFKA 1UGJA 4IM3A 1WIAA 2HTHA 3PLVA 2NTTA 1PUTA 3DBHI 4AOFA 3Q8CA 4JX1C 2XN9C 4GGQA 2LWPA 2JXTA 4TUUA 3MHZA 2MBEA 3EC8A 2DLBA 1WYGA 5BMHA 1N5XA 1NYQA 4J6IA 3Q8EA 3I3TB 1U4AA 2QSDA 2XNAC 5AUIA 3A9KA 5C2TB 3T8MA 2RPQA 4US8A 2H89B 2O2VB 1WMHA 4QAYA 2MBBB 3P63A 3HM6X 1AYFA 5D6JB 2K22A 5BMIA 3VTVA 3PT2B 3M3JA 3RD2A 2LGYA 2LXCA 4XGAB 1SB3C 1ZGUB 2V3NA 1F77A 5GMVA 3M62B 2M19A 4FBJB 1ISNA 1RFAA 1WXMA 2FUHB 2BYEA 4K1RB 2J52A 3DDCB 4W9KA 3BIID 4S0RA 2PMVA 3I5JC 4FLHA 5HHDG 1TIFA 3EGRA 2MWSB 3H9DA 1KJTA 4IG7B 4P7IA 2QDFA 1QLBB 4JIOU 1YJJA 3UIPB 1STEA 4MDKE 4LJPB 1FPYA 4ZRJA 4TQ1A 3HVDA 4CHKA 4HVBA 1VJKA 2MRPA 3W1SC 1NEKB 3QK0A 1OQYA 2DHZA 3R3MA 3Q69A 2LVOA 2AQ1B 3RULA 3N9YC 4AP4C 2EKEC 2RGFA 3RT3B 2K1FA 3RZFA 1XCTL 4YSYB 4ZYNA 4L2YA 2AQ3B 4RM8A 3UIOB 1E6EB 3BINA 1H4RA 2HD5B 2WP9B 4LDTD 1EUVB 2G1EA 2N9XA 2GOWA 4W9LA 3W2DA 2IDYA 2DZMA 2DYBA 5KHOA 3S2AA 4A3PA 2JX5A 3GE3C 2M1MA 3AE3B 2KFKA 3NRZA 1SEBD 2K25A 5I4DA 3LYYA 2IO2B 1WM2A 4LNOA 3TCAA 4ZRIA 1WGHA 1SJED 4RM9A 2KDFB 1YOVB 2WQYB 4W9CA 5IOIA 1UNSA 4LNNA 5IN7A 3HM3A 2V1YA 4HK2A 1EWCA 4HLEA 3HIZA 1EM7A 4HKZE 3TEXA 3RCZA 2WXLA 2NVUI 2BB5A 4HPLB 5EE9A 2NS5A 1K52A 3PV1A 2WHIA 2KKCA 2D3GA 3H7PB 3BVZA 4LJOB 1LFDA 2K39A 3W9CB 1KLUD 2W55A 3W5UB 2CHWA 3W1YA 2IBIB 2GBMA 3AN1A 2PE9A 3ZNHB 1PQSA 2AEHA 4MGZE 2JSVX 3ZJTA 2KMCA 5GXGB 2M8SA 4FHKA 2WWZA 2JY6A 4GDKB 2JPHA 4IM0A 1HXYD 3KLSX 2GBNA 3BY4B 4RFBA 4KZ0A 3A4SC 5G2NA 2PEAA 1E7VA 1VZ8A 4HEA1 1TKYA 4ZHPA 1QOBA 2BWFA 2FCSA 3J9CA 1RFKA 3IHPC 2DZIA 1JW9D 1TGZB 3L4PA 4OZBA 1JWUD 2JT4B 4GDLA 3NHEB 2M0AA 2KLGA 3R66C 2LJ5A 2RMMA 2RD0A 1GPXA 3ZNID 3HK0A 2RDGA 3NVZA 4XX5A 1V86A 2V3SA 2BYTA 1L6VA 1I4QA 4XDCA 2PKOA 1HA5A 2ZW0A 3RFZB 3LB8C 1FMAD 3ONSA 4J3OD 1UGMA 1CZPA 4RNAA 1YX5B 2M56B 5E6OA 3M63B 1UD7A 2KWCA 2L32A 3IBEA 2WLBA 2JQRB 2O6VB 3DBRI 4PYZA 4EE2A 3B08A 3JSVB 4N6EB 2N9EB 1RLFA 1I35A 4HJGE 2Q5WD 2AL3A 2YVCA 4EKUA 5HG2A 1B9RA 1F9JA 3QX1A 1JALA 4RCOA 3AXCA 3RN9C 1C77A 3NS1A 3VR8B 1KH0A 1X1MA 2K6QA 4NY0A 5H8YE 4AWJA 1KTKA 2ON8A 1UELA 4KGRA 3VHTC 2WYQA 4A90A 1XXGA 4TMAB 1C3TA 4LNKA 1IPGA 1EU4A 1UBQA 2RSUA 4DHJD 2BGFA 3RNFC 1XF5L 2J0KA 3SHQA 5L95C 2R2QA 3HUIA 3ZNZB 2SEBD 2WXRA 4RGNA 2PW9A 2MP2B 4M00A 4A20A 3KH0A 2IPKD 1MVKA 1WGYA 3AEFB 1WGDA 1FCCC 1K53A 4KGTA 3C0RB 3VTWA 4H2AA 3ENEA 3EA6A 2JXXA 4YXDB 1WX7A 2SAKA 3N1XC 1Q10A 1XCQL 2I1JA 2WDTB 1K50A 4ANXA 3BK1A 4HPPA 3A33B 1QOAA 1E8YA 2V4LA 3TUOA 1ET6A 1VDVA 2KMAA 1AWDA 3IG3A 2G9HD 4EUTA 3Q2AC 3GZNI 3PREA 3VUYA 2IYDB 2V0GA 4IC7B 4NQKE 3KW5B 1IYFA 2WXIA 4F8CB 2KVRA 5DPTA 2MJ3A 1IBXA 2DENB 2EKIA 2YEPB 3V6EB 3AEGB 3PTFC 4M0WB 2N0SB 5TSSA 3N3KB 4E3CA 3N20C 1YN5A 1L0YB 1YX6B 2BKFA 1C79A 1EO6A 2YLMA 1OQQA 3UI3A 2BT6A 2KWVB 5DPSA 2JZ3B 3ML8A 2D3AA 4M02A 2NPTB 2N9KA 3PVLA 4HROA 4MM3B 3CWIA 3NUHB 1AW7A 4W9IA 1NYRA 2D5GA 4DQOC 1TS4A 2W3SA 4RF1A 3R7RA 4WWOA 2N7JA 1L4ZB 3SEBA 4W9JA 3SR6A 1E7UA 3VDZA 3Q8AA 1R7SA 3TEZA 4ZRQA 1TS5A 2LHEA 2L3ZA 1I4HA 1Y56A 4HWIB 2IY1B 2B3AA 3B2GA 1SSNA 1WMHB 1GAQB 2CR5A 1WGRA 2I38A 5E6NA 2C9WB 3ZDTA 4XWWA 1EWYC 4YL8A 3VUWA 2DAFA 5J2RA 1WE7A 2PLPA 4M8MA 1Q0WB 3P4SB 1FXAA 2KLCA 2KANA 1J7BA 3ZUNA 2C60A 4ASWC 4YSZB 2MJDA 2IZVB 2FCNA 3P2BA 2LRWA 4XC2A 3L54A 4FHJA 4B0MA 3DBLI 1V1OA 3P4PB 1E5WA 1UH6A 4BKGA 2GI9A 1FEHA 4YTPB 2IO0B 3AB5A 3E9SA 3QAQA 3SU8X 1FXIA 2WXGA 1F1HA 4FJVB 1PDXA 3AULA 5EDSA 4MELA 4NJ6A 2LEKA 4PYUA 3VQIA 1T6BX 4P1BC 4KKIA 2WXFA 3H6NA 2MSED 2ACZB 1WE6A 1J8CA 2KX3A 2Y5PA 1FNVA 1VRAB 3NVVA 1C4PA 4DK5A 3O13A 3CSFA 2IY0B 2G4DB 1QF6A 3MFGA 1LM8B 1I42A 4B6WA 3ALBA 1I4RA 5CHFA 4JE3B 3RMKC 1WGKA 3L0WB 2R2OA 1SE9A 2INNE 3IXSA 2E6XA 4ZRPA 3RI7C 4IKGA 3VAWA 3RUIB 1N61A 4JPSA 4P16A 3I57A 5JHBA 2CU3A 3V62A 4II2B 3U2SC 2IGGA 3RYTA 2JZZA 3KVFB 3VH4B 1V1PB 4PS7A 4HDOA 2AQ2B 2ZCBA 2K8BA 2INPE 1VR9A 3IFWB 3GB1A 3RNGC 2MBOA 4K7UA 4BOZB 4YT0B 3TIXA 4BKTA 5DPRA 4KVGB 3WCQA 2Z0EB 1GUAB 3UGBB 1K8RB 5FR3A 5LXHA 1F2RI 4ZOHC 1FRDA 3KUCB 4K7WA 4BVUC 4JQWC 3FILB 3WAMA 1L0XB 1J0GA 4W9HA 2Z8LA 2QMTA 5G5HA 2LVPA 2QHOA 3MC8A 1UWXA 3GE8C 2WXKA 4Q2JA 2AYOB 4F7ZA 3SFEB 4EZJA 3TJPA 1IUEA 3ZNGC 4ACFA 4HJKA 2HJ8A 1FFUA 2ICIA 2VH2A 2ZW1A 3V60A 1RRBA 3Q8BA 4C4VA 2XEWA 3ZW3A 4GSWA 1WRDB 2KZRA 2MA9B 1E8XA 3RNAC 2KTFA 1GB1A 2LRUA 4NAWA 5TR5A 5AZFA 2LXAA 1TJEA 2JRIB 4O1NA 1TBEA 2HE7A 4MJSA 4REZA 4GIVA 2NR2A 2VZKB 3KQ4A 1SIFA 1D3ZA 1HTQA 4XZ4A 4YWGG 1C4CA 3VRBB 1V80A 1HTOA 3CMMB 1N6ZA 2NMQA 2PPHA 2WX0A 3VXWA 2KQSA 1UBIA 2L0FA 4L23A 4EEWA 1M94A 2BBCA 3B9JA 1OFFA 3PPAA 4HCNB 1UUPA 2JYEA 1TT5B 5EE3A 4CYEA 1EF5A 3MC0B 3PZ7A 3BVMA 4D2KA 3QWZB 3MP9A 3TSSA 4ICUA 1H8CA 2FNJB 4MGKE 1OEYA 2LGXA 4C80A 1QT9A 4KSKC 2A4ZA 1Z5SB 1UF0A 3P4QB 3AE8B 2J0JA 2G4SA 2O2VA 1BMLC 2QILA 2WU5B 3IT6B 1WI0A 1RAXA 3OJ4B 2VH1A 4WJNA 1D5XC 2CJOA 3KWLA 3P42A 1YJIA 4KIKB 2B76B 2D3BA 1XLQA 3OLMD 5D2MB 2AX5A 3A4RA 3B1LX 1NDDA 2BS2B 2QJLA 5LXIB 2BWES 3Q3OC 1WWTA 2MLBA 4A6QA 2WX1A 1I4GA 1IGCA 3R2IA 4EZKA 1OTRB 4ANUA 4MGIE 4S17A 1V8CA 3DHHC 3NVYA 1E8ZA 2KTRB 1MHXA 4OZAA 3D32A 1C1YB 4BFRA 5IAAC 4KV2A 2J4XA 3WIMA 2JYTA 4ZYSA 4HRSA 3NZSA 2D11A 4MACA 3VH3B 1AARA 1WX9A 2WU2B 2KFJA 4FULA 1V5OA 1DYQA 2L1AA 4N58A 1FM0D 3DQVA 4MH8A 4MSQB 3DCGA 2KAJA 2LUMA 1DGJA 1SXTA 2M0XA 2RPVA 1TKEA 2FUG1 4P6VF 1C4AA 3OAWA 2BB6A 2JWUA 2MH7A 3RZWC 4R3DA 3HRDD 3QA8A 3AI5A 2N1VA 3H1UA 2QCZA 1UZXB 2KX0A 4XDDA 2CHZA 4YTMB 3WA0A 1ENFA 4W9FA 1N62A 5EE1A 2JWZA 2KO3A 2WDRB 3ZXRA 4DXGA 2HJ1A 3BVGA 1JWAD 2EELA 3Q3FA 2IGHA 2PVOD 2MBHA 2VZKD 1N5WA 3T3OA 4UDUC 2KQ4X 1FNUA 2DZKA 4NNJB 2INDC 2KDIA 3NS8A 4JL9A 3A1QA 4FADA 3ZVVA 1V6EA 4FJYA 3ZRCA 2OOBB 3H7PA 4EFOA 1XLPA 4A9AA 3JVZX 3WALA 1IGDA 1OEYJ 4NQLB 2MQJA 3LJ3A 2LASA 4KDIC 3WAPA 4B95A 3DHIC 4JGHB 1WYWB 2XK5B 2G45B 1LGRA 2KWUB 4GDKA 4ZHOA 2LGSA 1ZPSA 4PT5A 3QIJA 2KD0A 4HKQA 2WGSA 3ZTDA 1WJ4A 1PGBA 4KKJA 3ZYYX 2JRHA 2ZNVC 1VD2A 3CF6E 1C9FA 2L8JA 4DDGD 2QC8A 3UINB 1NVID 2WXNA 5JHAA 1WSPA 3DOWA 4W9EA 2RR9A 5BMGA 5G55A 1HZ5A 2D10A 5D94A 1NBFC 3BK2A 1P7FA 2K8CA 3L08A 1TYGB 3L13A 2M17A 4AS1A 3I9V1 2DWQA 5DCNA 2MX2A 3L16A 1ROEA 2XBBC 1R4NB 1Z2MA 1ET9A 1YNTE 4WURA 1WXQA 1GOZA 3TBLD 2ZCCA 3CSTA 1ESFA 5JXVA 3L17A 1L0VB 3EFCA 5C3JB 2ONQA 1F0ZA 1WRIA 3C8YA 3EECA 2ZPNA 2O6VA 3EHVA 3IAS1 3UF8A 3QARA 5LLIA 2K5PA 3JSVA 1S3SG 2INCC 4LLGM 3KUDB 1FD6A 2K8HA 3A9JA 1YN4A 2FIDA 4TSSA 1SF0A 4DHZE 2ASQA 4MSMB 4URKA 1SE4A 3Q14C 4HXDA 2O6VD 2J0MA 3PLUA 3BZDB 4FJZA 1ZP0B 2D07B 3ZJUA 1XEEA 3E56A 5IP4D 3ETRA 4YTNB 4TQ0A 1AN8A 2LUEA 4W9DA 5C23A 5J17A 1I7HA 3EUB2 4II3B 5IKCM 3A9KB 4RMAA 3R7QA 1V9JA 3VR9B 1MFWA 1JROA 3T3NA 2WDQB 1Y8RC 1N63A 2ZJDA 2WXMA 1G6JA 4WJPA 2BYFA 2IO1B 3R2TA 3RNBC 1DOYA 3N30A 4OZCA 4ZRKA 1JQ4A 3DVGX 2E3TA 2N7EA 2UWQA 4K81A 1HZ6A 1Q1OA 3R8BA 2C5LC 2KT7A 1HE8A 2N1WA 1KRHA 4WQMA 4KGSA 1XLNA 1ZE3D 1GB4A 2GMIC 4ARIA 2KK8A 3PSEB 3NZUA 2FBWB 4ARCA 1QZEA 1L6UA 1FNWA 1C76A 1SGHA 5J18A 3ZJVA 2QEJC 2Y5BB 4LDTB 3Q3JA 2KACA 1RYJA 1ZW7A 2DBYA 2KDMA 2C7HA 2LVQA 4OVZA 4OVVA 1TZ1A 4WJQA 2M4NA 3X23A 5JZEB 4F1SA 1WJ6A 3V3XA 1V81A 2BPSA 4XE0A 4IOIE 4WWMA 2J53A 4DHZB 5CX3A 4WJOA 1F2RC 4M0WA 1YMHE 4NAWB 1XD3B 3K9PB 5DPWA 2WNMA 2D3CA 3AE1B 4NAMA 4NJ7A 1YQ3B 4ZDVA 3AU5A 2BF8B 2N4FA 1WFYA 4NPNA 2NPTA 2GLSA 2KFKB 4G0NB 1YD8U 2J42A 3PHXB 4USAA 2QIEB 4HPMB 3WAOA 5JH5C 4DXAB 3PS6A 3L10B 4WIPA 4C00A 2MCNB 2L52A 5HFYA 1D4BA 2LD9A 2V9HA 4C7YA 1JWSD 1FIQA 3PGEA 2L00B 4HDQA 2W9NA 1TS2A 3RNCC 3I63C 1GC6A 4I6PA 1K51A 1F52A 2DZJA 2Y3AA 3ZO5B 2MW5A 1DOXA 1E9MA 2PJHA 3ZRFA 1WM3A 1NI2A 3ECIA 1KM7A 2L7RA 3QQ8B 3V6CB 3HVZA 2WXPA 1YIWA 4ITKA 3JW0X 3UQBA 1JCKB 2KDEB 2IJ0A 2MJEA 3IVFA 4LNIA 5IA7A 3IAM1 2PE6B 4RGTA 2C7NB 2L83A 4IW0A 3ZTCA 3NJTA 1WZ0A 2W54A 1RM6C 2PIAA 2A5UA 3B0AA 2KMMA 5E6PA 2BQQA 3VRAB 1FRRA 3APDA 1ZXHA 1WX8A 4OW0A 3PRZA 1J19A 4C7ZA 3NY5A 4GDLB 1L4DB 2REXA 3DPDA 1MG8A 4GU2A 1D6EC 1LO5D 4CQNA 5D3DA 1HQRD 2KDBA 4LK0M 2N7DA 3AE5B 1MHHE 4ICVA 4KX6B 1J7CA 2KJRA 2LGIA 3VTUA 1VZ6A 4IDIA 2JU6X 2NBVB 2LJIA 1WJNA 4IM2A 1WJUA 1C78A 1P0RA 2W3RA 4E74A 3NZ3A 4LTUA 5HKHA 5G5GA 3FAHA 4OVUA 3U4EG 2ZEQA 2LZ6A 3PZDA 4K7SA 2CU1A 3TEYA 3BYYB 4DBGA 1WR1A 1P9DU 1P1AA 4L1BA 3ZIMA 5L83A 4MH0E 4DHJB 1JMLA 3RPFC 3N1YC 2Z59B 5D7GA 1WH3A 1B1ZA 3SDLC 4WAAA 2IO3B 1XO3A 3ML9A 5EE0A 2KYWA 1TTNA 1L5PA 1WGGA 2KC2A 2BKRB 1T0SC 2UYZB 2N9LA 2KHWB 2LFIA 2OJRA 2KN5A 3AEAB 1TY2A 4K3BA 2KXJA 4IWPA 2DYMA 1P98A 1V1PA 4PS3A 5KHQA 4IWOA 3A1QB 2FCQA 4BZAA 3APFA 1M4VA 3AEDB 2NTSA 3H8HA 2ZZPB 4FN2A 4W9GA 3AV8A 3ZKJC 2ZVOA 2FAZA 3IT4B 1YJ1A 3QHTA 3O65B 4KSLC 4E71A 1KLGD 3KYCD 4AQ7A 3FILA 2GBRA 1DOIA 4PK1A 3OG5A 2PTLA 3U7DA 3DBRB 1CJEA 3WANA 3MJ5A 1P7EA 2LI5A 4M8NA 4ANVA 1XLOA 2CJNA 2TSSA 5BYQA 4B0EA 1WR6E 4HCPB 4TV3A 2LGDA 4FA6A 2KNBA 3AE4B 1KLVA 1VCBA 2MHJA 3AM9A 1OGWA 1CK1A 3P4RB 2JVCA 1FFVA 3MHSD 5AUKA 5AZHA 1GG3A 5LNK1 4G3XB 1ZOYB 4GMVA 3ZGZA 2V3PA 1UWMA 4AJYB 4MEMA 4GLSC 3EFUA 4N9F4 4X57B 3OWEB 1CMXB 3SD5A 5D3IB 3U30A 2HTME 3M95A 2FIFA 3N32A 2D2QA 4JLCA 3C19A 3NG0A 3Q3NC 1IBXB 2N9PC 2WS3B 5CTRC 2RDHA 4B9KA 2JUOA 1SE3A 3W1SA 3DBSA 3GP7A 3DWGC 3DWMA 4XYCA 3U52E 5T8IA 1MPEA 2GB1A 1P3QU 2DX5B 3LXFA 2DYOA 1VZ7A 1I4XA 5AZGA 4GOCA 2NBWB 1T5XD 1E7PB 2KQ7A 3KYDD 2MBQA 1SE2A 1I4PA 1YQBA 1JWMD 4WAFA 2KC1A 1L2NA 3NVWA 3HHMA 3AEBB 5HI1A 1GJZA 1OQRA 2CHXA 4RGMA 3A9JB 3OJ3A 3GS2A 1SBBB 4IUMB 4AJWA 1BT0A 2OEDA 4ANWA 4LCDE 1TKGA 1RWSA 4WWPA 1V97A 5BO4B 2X8XX 3KUZA 4A55A 2L76A 2YEPF 4GN1A 4IWQA 3PRMB 3AU4A 1IP9A 2JZPA 3QJZA 3W5VB 4RF0A 4OHJA 3ZLZA 2W82A 3NOBA 3CIRB 2BW2A 3URYA 5FKAC 3GZNB 2DNFA 1XT9B 3DVNU 1TY0A 2CS4A 2KOXA 1T3QA 1GNUA 2CKHB 3Q6BA 1N60A 4DWFA 4AUQC 3FKYA 4KIKA 2WXJA 5IO9A 4JWSC 2BS4B 3ZQ4A 5AEKB 4MT5A 2RDBC 2KVZA 3BYTB 3AE6B 3Q3MC 3UQAA 2G3QB 2WDVB 2LHDA 2V4IB 5BYSA 1KF6B 3U7ZA 2GRIA 1SIJA 1D5MC 2EMSA 1E8WA 2KJ6A 1V5TA 1TZOA 1T0YA 2KTRA 4NJCA 1E90A 3PZ8A 1A70A 1ACCA 1ZDVA 4BBNF 3AECB 4A8XC 2ZNVB 3DVGY 2K0PA 5CHWA 3QCAA 4WWNA 2C7MB 1EU3A 4RGOS 5MPOA 1QKZA 3AEEB 3B2FA 3ZXVA 4LNFA 2I1KA 3AE9B 2KWDA 4FXCA 5FR6A 3TMPB 4N59A 2R61A 1MJDA 1VLBA 4G11A 1J7AA 2J7QB 4I6LB 2NBUA 5C1ZA 1WY8A 1PYWD 1L7YA 2BS3B 3ABVB 1Q5WB 1FXTB 4BOSC 4EZLA 4P1CC 2BTEA 4BKSA 2WXQA 1PFDA 3AE2B 5CHVC 4A3OA 1JRPA 1HEZE 2OHFA 2UU7A 3PRPB 1BUIC 1T0QC 4I6NB 1D5ZC 1JWBD 4WH4A 4CO7A 2FE8A 4C56C 3TL5A 1YQ4B 3Q8FA 4BBNC 1R4NI 5H92C 3APCA 4DDID 1WF9A 3X0WA 3GOEA 2Z0DB 3FC4A 3V05A 2MEKA 2L0TA 4KDLB 3ZDMC 3KWVA 4BKSD 1FCLA 3DBLB 2LMCA 1NENB 2VRRB 4WQOB 3SFDB
chains in the Genus database with same CATH topology
2RSUA 2A4ZA 1Z5SB 2L7RA 3QQ8B 4DHJD 3V6CB 2BGFA 2J0JA 2G4SA 1KOTA 3K9OB 1YIWA 2J0KA 3SHQA 4TKNA 5L95C 2MP2A 2O2VA 2R2QA 4GXBA 2XK5A 3JYUA 3MJWA 3ZNZB 3JW0X 2L05A 1WI0A 3UQBA 1RAXA 3OJ4B 1XQQA 1V2YA 4WJNA 2KDEB 2MP2B 3IVFA 5IA7A 1GC7A 4A20A 4EOYA 3KH0A 4KIKB 2PE6B 1LQBA 2C7NB 3OLMD 4IW0A 3ZTCA 5D2MB 1WGYA 1WGDA 3A4RA 3B1LX 2GBJA 1NDDA 1WZ0A 3C0RB 3VTWA 1V49A 5LXIB 1WZ3A 1EF1A 2BWES 2KJHB 3ENEA 2MLBA 2JXXA 2A5UA 1WX7A 2WX1A 3B0AA 2AWTA 2ZPYA 5E6PA 1WXVA 4EZKA 1OTRB 4ANUA 1A5RA 3APDA 4MGIE 2I1JA 2WDTB 2GBKA 1WX8A 1E8ZA 2KTRB 3PRZA 3D32A 4ANXA 3A33B 3MTNB 1E8YA 1C1YB 4BFRA 2V4LA 5IAAC 4KV2A 1J19A 2KMAA 3NY5A 3WIMA 4GDLB 2REXA 4MGYE 3IG3A 1JRUA 2JF5A 3DPDA 1MG8A 3NZSA 4EUTA 4GU2A 2D11A 2ZVNA 3GZNI 3PREA 1LXDA 3VUYA 3VH3B 2IYDB 1AARA 1WX9A 2KFJA 2KDBA 4FULA 2N7DA 1V5OA 4ICVA 1WXAA 2BYVE 4IC7B 2KJRA 4NQKE 3KW5B 1IYFA 3VTUA 3H7SA 3DQVA 4MSQB 4F8CB 1S1QB 3DCGA 3U8ZA 2KVRA 2NBVB 5DPTA 2DENB 3VVWB 4PS8A 3PHWB 1WJNA 2M0XA 3V6EB 4IM2A 1WJUA 1WXSA 4MJSB 2DAJA 1P0RA 4GB9A 4E74A 1R4MI 2K6DB 3PTFC 4M0WB 3VUXA 3OAWA 5HKHA 3N3KB 4OVUA 4E3CA 2FCMA 2ZEQA 3DVNV 2LZ6A 4G50A 3RZWC 1YX6B 2AL6A 2BKFA 1EO6A 4KZCA 3V61A 3QA8A 2YLMA 3PZDA 3AI5A 2N1VA 3H1UA 2NCNA 4K7SA 1UZXB 1ZKHA 2CU1A 2KX0A 2KWVB 3LDZE 3QC8B 4DBGA 2CHZA 5DPSA 2JZ3B 1WR1A 1P9DU 4MM3A 3WA0A 1P1AA 2EMTA 4W9FA 3T9LA 3ML8A 3VFKA 2JWZA 2NPTB 2KO3A 4IM3A 3ZIMA 1WIAA 2HTHA 3PLVA 3PVLA 4MH0E 5L83A 4DHJB 2Z59B 3DBHI 4AOFA 5D7GA 3Q3FA 1WH3A 2MBHA 4WAAA 2IO3B 4GGQA 4W9IA 3SDLC 3ML9A 2LWPA 1TTNA 1WGGA 4TUUA 2KC2A 2BKRB 2DZKA 2UYZB 2MBEA 3EC8A 4NNJB 2KHWB 3R7RA 3NS8A 2KDIA 4JL9A 4WWOA 3A1QA 4FADA 3ZVVA 1V6EA 4FJYA 3ZRCA 2OJRA 2KN5A 4J6IA 2OOBB 3H7PA 4EFOA 2KXJA 3I3TB 2DYMA 1P98A 1U4AA 4IWPA 4PS3A 4W9JA 3JVZX 5KHQA 3WALA 4IWOA 1OEYJ 1E7UA 3A1QB 4NQLB 3A9KA 2MQJA 3LJ3A 2LASA 4KDIC 3T8MA 3WAPA 2RPQA 2FCQA 3VDZA 4B95A 3APFA 4JGHB 2O2VB 1WYWB 1WMHA 2L3ZA 2XK5B 2G45B 2MBBB 2ZZPB 2KWUB 4FN2A 4GDKA 4HWIB 3HM6X 4W9GA 2IY1B 5D6JB 2B3AA 3VTVA 3ZKJC 3PT2B 1WMHB 3M3JA 2CR5A 3RD2A 1WGRA 2ZVOA 2FAZA 2LGYA 1YJ1A 2LXCA 3QHTA 3O65B 3QIJA 4KSLC 5E6NA 3KYCD 4E71A 5JH5C 2C9WB 1ZGUB 2KD0A 3ZDTA 2GBRA 3ZTDA 1WJ4A 4YL8A 5GMVA 3VUWA 3U7DA 3M62B 2DAFA 4FBJB 3WANA 5J2RA 1ISNA 1RFAA 1WE7A 2JRHA 2ZNVC 2LI5A 1VD2A 1WXMA 3CF6E 4M8NA 4M8MA 1Q0WB 4ANVA 2KLCA 2L8JA 2KANA 2FUHB 4DDGD 3ZUNA 2BYEA 4K1RB 2C60A 4ASWC 3DDCB 1WR6E 3UINB 4HCPB 4W9KA 5JHAA 4TV3A 2IZVB 3DOWA 4FLHA 2LGDA 2FCNA 2KNBA 4W9EA 4FA6A 1VCBA 3P2BA 1KLVA 2RR9A 2LRWA 5G55A 4XC2A 1OGWA 2MWSB 2D10A 3H9DA 1KJTA 3L54A 4FHJA 1NBFC 3DBLI 2JVCA 5D94A 2K8CA 3MHSD 4IG7B 3L08A 1GG3A 4P7IA 5AZHA 3L13A 2M17A 4JIOU 1E5WA 5DCNA 1UH6A 2MX2A 4MDKE 3UIPB 4BKGA 4LJPB 3L16A 4G3XB 4GMVA 2IO0B 4ZRJA 4TQ1A 4AJYB 4MEMA 4CHKA 4HVBA 3QAQA 2XBBC 3EFUA 2MRPA 3SU8X 3W1SC 1Z2MA 4N9F4 4X57B 3QK0A 1CMXB 1OQYA 2DHZA 3R3MA 3SD5A 3TBLD 2ZCCA 3U30A 3CSTA 2LVOA 3L17A 4FJVB 3M95A 3AULA 2FIFA 3N32A 3RULA 4AP4C 5EDSA 2EKEC 2D2QA 4MELA 4JLCA 4NJ6A 2RGFA 3RT3B 2K1FA 4PYUA 3VQIA 2N9PC 3RZFA 5CTRC 4B9KA 2JUOA 3EECA 4ZYNA 3DBSA 3W1SA 4RM8A 3UIOB 2ZPNA 2O6VA 3BINA 3H6NA 1H4RA 2MSED 3EHVA 1P3QU 2DX5B 2HD5B 1WE6A 3UF8A 2DYOA 2KX3A 1J8CA 3QARA 5AZGA 4LDTD 5LLIA 1EUVB 4GOCA 2N9XA 2GOWA 4W9LA 2NBWB 3JSVA 2DZMA 2DYBA 2KQ7A 5KHOA 3S2AA 3KYDD 1S3SG 4A3PA 2MBQA 1YQBA 3KUDB 2K8HA 2M1MA 2KC1A 3A9JA 1L2NA 2KFKA 2FIDA 3HHMA 4DK5A 2K25A 4DHZE 2ASQA 1GJZA 3CSFA 2IO2B 1WM2A 2IY0B 2G4DB 2CHXA 3TCAA 4MSMB 4URKA 1LM8B 4ZRIA 1WGHA 3A9JB 3OJ3A 4RM9A 1I42A 4B6WA 2KDFB 3ALBA 4IUMB 4W9CA 5CHFA 4AJWA 1BT0A 4HXDA 3L0WB 2O6VD 2J0MA 1SE9A 2R2OA 3HM3A 2V1YA 3PLUA 4HK2A 4ANWA 4LCDE 4WWPA 4HLEA 4FJZA 5BO4B 3KUZA 2D07B 2L76A 3HIZA 4GN1A 3VAWA 3RUIB 3RCZA 4IWQA 3PRMB 3AU4A 1IP9A 2NVUI 5JHBA 4HPLB 2NS5A 3V62A 3PV1A 3QJZA 4TQ0A 2KKCA 2D3GA 4II2B 2LUEA 4W9DA 5C23A 3H7PB 5J17A 3RYTA 2JZZA 3ZLZA 3KVFB 4LJOB 1LFDA 3NOBA 3VH4B 2K39A 4PS7A 4HDOA 2ZCBA 2CHWA 4II3B 3W1YA 2K8BA 3A9KB 1XT9B 3DVNU 4RMAA 2IBIB 3IFWB 2GBMA 2PE9A 2CS4A 1PQSA 2KOXA 3R7QA 3ZNHB 1V9JA 2AEHA 1GNUA 2MBOA 4MGZE 2KMCA 2CKHB 2M8SA 4K7UA 4BOZB 4FHKA 3TIXA 2WWZA 5DPRA 4KVGB 4BKTA 4DWFA 4AUQC 1Y8RC 2JY6A 2ZJDA 4GDKB 1G6JA 4WJPA 2BYFA 2Z0EB 2IO1B 4KIKA 2JPHA 4IM0A 1GUAB 2GBNA 3UGBB 1K8RB 3BY4B 5LXHA 3N30A 5AEKB 3KUCB 4K7WA 4ZRKA 4KZ0A 3A4SC 3DVGX 2N7EA 5G2NA 4BVUC 2UWQA 2PEAA 4JQWC 1E7VA 2G3QB 4K81A 3UQAA 3WAMA 1Q1OA 2C5LC 1HE8A 2BWFA 2N1WA 2FCSA 2EMSA 1E8WA 2KJ6A 1V5TA 4W9HA 1J0GA 2GMIC 1T0YA 2KTRA 2LVPA 2KK8A 2QHOA 3IHPC 3NZUA 3PSEB 1E90A 1QZEA 2DZIA 1TGZB 2JT4B 4BBNF 2AYOB 4F7ZA 1SGHA 4GDLA 3NHEB 4EZJA 5J18A 3TJPA 2KLGA 2ZNVB 3DVGY 3R66C 2LJ5A 5CHWA 3ZNGC 2RD0A 3QCAA 2Y5BB 2HJ8A 3Q3JA 2C7MB 4HJKA 4LDTB 4WWNA 1ZW7A 3ZNID 3HK0A 3V60A 1RRBA 2C7HA 2LVQA 2XEWA 2I1KA 1V86A 4OVVA 1TZ1A 4XX5A 4WJQA 4GSWA 3ZW3A 2V3SA 2M4NA 5FR6A 3TMPB 1WRDB 3X23A 2KZRA 5JZEB 2MA9B 1E8XA 4F1SA 1WJ6A 2KTFA 1V81A 2BPSA 4G11A 2J7QB 2LRUA 4I6LB 4NAWA 2NBUA 5TR5A 3ONSA 5C1ZA 1UGMA 5AZFA 2LXAA 1YX5B 2JRIB 5E6OA 3M63B 1TBEA 1WY8A 2HE7A 4MJSA 1UD7A 1L7YA 4GIVA 2NR2A 4WJOA 5CX3A 4DHZB 2KWCA 1Q5WB 1SIFA 3IBEA 4NAWB 1D3ZA 1FXTB 1XD3B 4XZ4A 2O6VB 3DBRI 3K9PB 5DPWA 4BOSC 4EZLA 1V80A 4PYZA 3B08A 3CMMB 3JSVB 4BKSA 4NJ7A 2PPHA 2WX0A 5CHVC 2KQSA 2N9EB 3VXWA 4ZDVA 4A3OA 1RLFA 1UBIA 3AU5A 2BF8B 2N4FA 1WFYA 4NPNA 1I35A 2L0FA 4EEWA 1M94A 2AL3A 2NPTA 2KFKB 2YVCA 4G0NB 1YD8U 4EKUA 3PRPB 3PHXB 4I6NB 4HPMB 1F9JA 3PPAA 3QX1A 3PS6A 3AXCA 3L10B 3WAOA 4HCNB 3TL5A 4CO7A 4DXAB 2MCNB 4BBNC 4CYEA 1EF5A 1R4NI 2LD9A 3APCA 3PGEA 4DDID 1X1MA 1WF9A 2L00B 4HDQA 2K6QA 4NY0A 3X0WA 3QWZB 4AWJA 3GOEA 2Z0DB 1UELA 2W9NA 4ICUA 3ZDMC 4KDLB 2L0TA 2FNJB 1GC6A 1H8CA 4I6PA 3VHTC 2WYQA 2DZJA 4MGKE 4BKSD 3ZO5B 2MW5A 1OEYA 2VRRB 4WQOB 2LGXA 2PJHA 1C3TA 3ZRFA 1IPGA 1WM3A 1UBQA 1NI2A 3ECIA 1KM7A 4KSKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSU A;  2A4Z A;  1Z5S B;  2L7R A;  3QQ8 B;  4DHJ D;  3V6C B;  2BGF A;  2J0J A;  2G4S A;  1KOT A;  3K9O B;  1YIW A;  2J0K A;  3SHQ A;  4TKN A;  5L95 C;  2MP2 A;  2O2V A;  2R2Q A;  4GXB A;  2XK5 A;  3JYU A;  3MJW A;  3ZNZ B;  3JW0 X;  2L05 A;  1WI0 A;  3UQB A;  1RAX A;  3OJ4 B;  1XQQ A;  1V2Y A;  4WJN A;  2KDE B;  2MP2 B;  3IVF A;  5IA7 A;  1GC7 A;  4A20 A;  4EOY A;  3KH0 A;  4KIK B;  2PE6 B;  1LQB A;  2C7N B;  3OLM D;  4IW0 A;  3ZTC A;  5D2M B;  1WGY A;  1WGD A;  3A4R A;  3B1L X;  2GBJ A;  1NDD A;  1WZ0 A;  3C0R B;  3VTW A;  1V49 A;  5LXI B;  1WZ3 A;  1EF1 A;  2BWE S;  2KJH B;  3ENE A;  2MLB A;  2JXX A;  2A5U A;  1WX7 A;  2WX1 A;  3B0A A;  2AWT A;  2ZPY A;  5E6P A;  1WXV A;  4EZK A;  1OTR B;  4ANU A;  1A5R A;  3APD A;  4MGI E;  2I1J A;  2WDT B;  2GBK A;  1WX8 A;  1E8Z A;  2KTR B;  3PRZ A;  3D32 A;  4ANX A;  3A33 B;  3MTN B;  1E8Y A;  1C1Y B;  4BFR A;  2V4L A;  5IAA C;  4KV2 A;  1J19 A;  2KMA A;  3NY5 A;  3WIM A;  4GDL B;  2REX A;  4MGY E;  3IG3 A;  1JRU A;  2JF5 A;  3DPD A;  1MG8 A;  3NZS A;  4EUT A;  4GU2 A;  2D11 A;  2ZVN A;  3GZN I;  3PRE A;  1LXD A;  3VUY A;  3VH3 B;  2IYD B;  1AAR A;  1WX9 A;  2KFJ A;  2KDB A;  4FUL A;  2N7D A;  1V5O A;  4ICV A;  1WXA A;  2BYV E;  4IC7 B;  2KJR A;  4NQK E;  3KW5 B;  1IYF A;  3VTU A;  3H7S A;  3DQV A;  4MSQ B;  4F8C B;  1S1Q B;  3DCG A;  3U8Z A;  2KVR A;  2NBV B;  5DPT A;  2DEN B;  3VVW B;  4PS8 A;  3PHW B;  1WJN A;  2M0X A;  3V6E B;  4IM2 A;  1WJU A;  1WXS A;  4MJS B;  2DAJ A;  1P0R A;  4GB9 A;  4E74 A;  1R4M I;  2K6D B;  3PTF C;  4M0W B;  3VUX A;  3OAW A;  5HKH A;  3N3K B;  4OVU A;  4E3C A;  2FCM A;  2ZEQ A;  3DVN V;  2LZ6 A;  4G50 A;  3RZW C;  1YX6 B;  2AL6 A;  2BKF A;  1EO6 A;  4KZC A;  3V61 A;  3QA8 A;  2YLM A;  3PZD A;  3AI5 A;  2N1V A;  3H1U A;  2NCN A;  4K7S A;  1UZX B;  1ZKH A;  2CU1 A;  2KX0 A;  2KWV B;  3LDZ E;  3QC8 B;  4DBG A;  2CHZ A;  5DPS A;  2JZ3 B;  1WR1 A;  1P9D U;  4MM3 A;  3WA0 A;  1P1A A;  2EMT A;  4W9F A;  3T9L A;  3ML8 A;  3VFK A;  2JWZ A;  2NPT B;  2KO3 A;  4IM3 A;  3ZIM A;  1WIA A;  2HTH A;  3PLV A;  3PVL A;  4MH0 E;  5L83 A;  4DHJ B;  2Z59 B;  3DBH I;  4AOF A;  5D7G A;  3Q3F A;  1WH3 A;  2MBH A;  4WAA A;  2IO3 B;  4GGQ A;  4W9I A;  3SDL C;  3ML9 A;  2LWP A;  1TTN A;  1WGG A;  4TUU A;  2KC2 A;  2BKR B;  2DZK A;  2UYZ B;  2MBE A;  3EC8 A;  4NNJ B;  2KHW B;  3R7R A;  3NS8 A;  2KDI A;  4JL9 A;  4WWO A;  3A1Q A;  4FAD A;  3ZVV A;  1V6E A;  4FJY A;  3ZRC A;  2OJR A;  2KN5 A;  4J6I A;  2OOB B;  3H7P A;  4EFO A;  2KXJ A;  3I3T B;  2DYM A;  1P98 A;  1U4A A;  4IWP A;  4PS3 A;  4W9J A;  3JVZ X;  5KHQ A;  3WAL A;  4IWO A;  1OEY J;  1E7U A;  3A1Q B;  4NQL B;  3A9K A;  2MQJ A;  3LJ3 A;  2LAS A;  4KDI C;  3T8M A;  3WAP A;  2RPQ A;  2FCQ A;  3VDZ A;  4B95 A;  3APF A;  4JGH B;  2O2V B;  1WYW B;  1WMH A;  2L3Z A;  2XK5 B;  2G45 B;  2MBB B;  2ZZP B;  2KWU B;  4FN2 A;  4GDK A;  4HWI B;  3HM6 X;  4W9G A;  2IY1 B;  5D6J B;  2B3A A;  3VTV A;  3ZKJ C;  3PT2 B;  1WMH B;  3M3J A;  2CR5 A;  3RD2 A;  1WGR A;  2ZVO A;  2FAZ A;  2LGY A;  1YJ1 A;  2LXC A;  3QHT A;  3O65 B;  3QIJ A;  4KSL C;  5E6N A;  3KYC D;  4E71 A;  5JH5 C;  2C9W B;  1ZGU B;  2KD0 A;  3ZDT A;  2GBR A;  3ZTD A;  1WJ4 A;  4YL8 A;  5GMV A;  3VUW A;  3U7D A;  3M62 B;  2DAF A;  4FBJ B;  3WAN A;  5J2R A;  1ISN A;  1RFA A;  1WE7 A;  2JRH A;  2ZNV C;  2LI5 A;  1VD2 A;  1WXM A;  3CF6 E;  4M8N A;  4M8M A;  1Q0W B;  4ANV A;  2KLC A;  2L8J A;  2KAN A;  2FUH B;  4DDG D;  3ZUN A;  2BYE A;  4K1R B;  2C60 A;  4ASW C;  3DDC B;  1WR6 E;  3UIN B;  4HCP B;  4W9K A;  5JHA A;  4TV3 A;  2IZV B;  3DOW A;  4FLH A;  2LGD A;  2FCN A;  2KNB A;  4W9E A;  4FA6 A;  1VCB A;  3P2B A;  1KLV A;  2RR9 A;  2LRW A;  5G55 A;  4XC2 A;  1OGW A;  2MWS B;  2D10 A;  3H9D A;  1KJT A;  3L54 A;  4FHJ A;  1NBF C;  3DBL I;  2JVC A;  5D94 A;  2K8C A;  3MHS D;  4IG7 B;  3L08 A;  1GG3 A;  4P7I A;  5AZH A;  3L13 A;  2M17 A;  4JIO U;  1E5W A;  5DCN A;  1UH6 A;  2MX2 A;  4MDK E;  3UIP B;  4BKG A;  4LJP B;  3L16 A;  4G3X B;  4GMV A;  2IO0 B;  4ZRJ A;  4TQ1 A;  4AJY B;  4MEM A;  4CHK A;  4HVB A;  3QAQ A;  2XBB C;  3EFU A;  2MRP A;  3SU8 X;  3W1S C;  1Z2M A;  4N9F 4;  4X57 B;  3QK0 A;  1CMX B;  1OQY A;  2DHZ A;  3R3M A;  3SD5 A;  3TBL D;  2ZCC A;  3U30 A;  3CST A;  2LVO A;  3L17 A;  4FJV B;  3M95 A;  3AUL A;  2FIF A;  3N32 A;  3RUL A;  4AP4 C;  5EDS A;  2EKE C;  2D2Q A;  4MEL A;  4JLC A;  4NJ6 A;  2RGF A;  3RT3 B;  2K1F A;  4PYU A;  3VQI A;  2N9P C;  3RZF A;  5CTR C;  4B9K A;  2JUO A;  3EEC A;  4ZYN A;  3DBS A;  3W1S A;  4RM8 A;  3UIO B;  2ZPN A;  2O6V A;  3BIN A;  3H6N A;  1H4R A;  2MSE D;  3EHV A;  1P3Q U;  2DX5 B;  2HD5 B;  1WE6 A;  3UF8 A;  2DYO A;  2KX3 A;  1J8C A;  3QAR A;  5AZG A;  4LDT D;  5LLI A;  1EUV B;  4GOC A;  2N9X A;  2GOW A;  4W9L A;  2NBW B;  3JSV A;  2DZM A;  2DYB A;  2KQ7 A;  5KHO A;  3S2A A;  3KYD D;  1S3S G;  4A3P A;  2MBQ A;  1YQB A;  3KUD B;  2K8H A;  2M1M A;  2KC1 A;  3A9J A;  1L2N A;  2KFK A;  2FID A;  3HHM A;  4DK5 A;  2K25 A;  4DHZ E;  2ASQ A;  1GJZ A;  3CSF A;  2IO2 B;  1WM2 A;  2IY0 B;  2G4D B;  2CHX A;  3TCA A;  4MSM B;  4URK A;  1LM8 B;  4ZRI A;  1WGH A;  3A9J B;  3OJ3 A;  4RM9 A;  1I42 A;  4B6W A;  2KDF B;  3ALB A;  4IUM B;  4W9C A;  5CHF A;  4AJW A;  1BT0 A;  4HXD A;  3L0W B;  2O6V D;  2J0M A;  1SE9 A;  2R2O A;  3HM3 A;  2V1Y A;  3PLU A;  4HK2 A;  4ANW A;  4LCD E;  4WWP A;  4HLE A;  4FJZ A;  5BO4 B;  3KUZ A;  2D07 B;  2L76 A;  3HIZ A;  4GN1 A;  3VAW A;  3RUI B;  3RCZ A;  4IWQ A;  3PRM B;  3AU4 A;  1IP9 A;  2NVU I;  5JHB A;  4HPL B;  2NS5 A;  3V62 A;  3PV1 A;  3QJZ A;  4TQ0 A;  2KKC A;  2D3G A;  4II2 B;  2LUE A;  4W9D A;  5C23 A;  3H7P B;  5J17 A;  3RYT A;  2JZZ A;  3ZLZ A;  3KVF B;  4LJO B;  1LFD A;  3NOB A;  3VH4 B;  2K39 A;  4PS7 A;  4HDO A;  2ZCB A;  2CHW A;  4II3 B;  3W1Y A;  2K8B A;  3A9K B;  1XT9 B;  3DVN U;  4RMA A;  2IBI B;  3IFW B;  2GBM A;  2PE9 A;  2CS4 A;  1PQS A;  2KOX A;  3R7Q A;  3ZNH B;  1V9J A;  2AEH A;  1GNU A;  2MBO A;  4MGZ E;  2KMC A;  2CKH B;  2M8S A;  4K7U A;  4BOZ B;  4FHK A;  3TIX A;  2WWZ A;  5DPR A;  4KVG B;  4BKT A;  4DWF A;  4AUQ C;  1Y8R C;  2JY6 A;  2ZJD A;  4GDK B;  1G6J A;  4WJP A;  2BYF A;  2Z0E B;  2IO1 B;  4KIK A;  2JPH A;  4IM0 A;  1GUA B;  2GBN A;  3UGB B;  1K8R B;  3BY4 B;  5LXH A;  3N30 A;  5AEK B;  3KUC B;  4K7W A;  4ZRK A;  4KZ0 A;  3A4S C;  3DVG X;  2N7E A;  5G2N A;  4BVU C;  2UWQ A;  2PEA A;  4JQW C;  1E7V A;  2G3Q B;  4K81 A;  3UQA A;  3WAM A;  1Q1O A;  2C5L C;  1HE8 A;  2BWF A;  2N1W A;  2FCS A;  2EMS A;  1E8W A;  2KJ6 A;  1V5T A;  4W9H A;  1J0G A;  2GMI C;  1T0Y A;  2KTR A;  2LVP A;  2KK8 A;  2QHO A;  3IHP C;  3NZU A;  3PSE B;  1E90 A;  1QZE A;  2DZI A;  1TGZ B;  2JT4 B;  4BBN F;  2AYO B;  4F7Z A;  1SGH A;  4GDL A;  3NHE B;  4EZJ A;  5J18 A;  3TJP A;  2KLG A;  2ZNV B;  3DVG Y;  3R66 C;  2LJ5 A;  5CHW A;  3ZNG C;  2RD0 A;  3QCA A;  2Y5B B;  2HJ8 A;  3Q3J A;  2C7M B;  4HJK A;  4LDT B;  4WWN A;  1ZW7 A;  3ZNI D;  3HK0 A;  3V60 A;  1RRB A;  2C7H A;  2LVQ A;  2XEW A;  2I1K A;  1V86 A;  4OVV A;  1TZ1 A;  4XX5 A;  4WJQ A;  4GSW A;  3ZW3 A;  2V3S A;  2M4N A;  5FR6 A;  3TMP B;  1WRD B;  3X23 A;  2KZR A;  5JZE B;  2MA9 B;  1E8X A;  4F1S A;  1WJ6 A;  2KTF A;  1V81 A;  2BPS A;  4G11 A;  2J7Q B;  2LRU A;  4I6L B;  4NAW A;  2NBU A;  5TR5 A;  3ONS A;  5C1Z A;  1UGM A;  5AZF A;  2LXA A;  1YX5 B;  2JRI B;  5E6O A;  3M63 B;  1TBE A;  1WY8 A;  2HE7 A;  4MJS A;  1UD7 A;  1L7Y A;  4GIV A;  2NR2 A;  4WJO A;  5CX3 A;  4DHZ B;  2KWC A;  1Q5W B;  1SIF A;  3IBE A;  4NAW B;  1D3Z A;  1FXT B;  1XD3 B;  4XZ4 A;  2O6V B;  3DBR I;  3K9P B;  5DPW A;  4BOS C;  4EZL A;  1V80 A;  4PYZ A;  3B08 A;  3CMM B;  3JSV B;  4BKS A;  4NJ7 A;  2PPH A;  2WX0 A;  5CHV C;  2KQS A;  2N9E B;  3VXW A;  4ZDV A;  4A3O A;  1RLF A;  1UBI A;  3AU5 A;  2BF8 B;  2N4F A;  1WFY A;  4NPN A;  1I35 A;  2L0F A;  4EEW A;  1M94 A;  2AL3 A;  2NPT A;  2KFK B;  2YVC A;  4G0N B;  1YD8 U;  4EKU A;  3PRP B;  3PHX B;  4I6N B;  4HPM B;  1F9J A;  3PPA A;  3QX1 A;  3PS6 A;  3AXC A;  3L10 B;  3WAO A;  4HCN B;  3TL5 A;  4CO7 A;  4DXA B;  2MCN B;  4BBN C;  4CYE A;  1EF5 A;  1R4N I;  2LD9 A;  3APC A;  3PGE A;  4DDI D;  1X1M A;  1WF9 A;  2L00 B;  4HDQ A;  2K6Q A;  4NY0 A;  3X0W A;  3QWZ B;  4AWJ A;  3GOE A;  2Z0D B;  1UEL A;  2W9N A;  4ICU A;  3ZDM C;  4KDL B;  2L0T A;  2FNJ B;  1GC6 A;  1H8C A;  4I6P A;  3VHT C;  2WYQ A;  2DZJ A;  4MGK E;  4BKS D;  3ZO5 B;  2MW5 A;  1OEY A;  2VRR B;  4WQO B;  2LGX A;  2PJH A;  1C3T A;  3ZRF A;  1IPG A;  1WM3 A;  1UBQ A;  1NI2 A;  3ECI A;  1KM7 A;  4KSK C; 
#chains in the Genus database with same CATH topology
 1QOF A;  4K3C A;  1KOT A;  3K9O B;  1SJH D;  3DHG C;  4TKN A;  3MC9 A;  2MP2 A;  4NZL B;  4GXB A;  2XK5 A;  3JYU A;  3MJW A;  3TEW A;  2L05 A;  3N1Z C;  1XQQ A;  1V2Y A;  1E0Z A;  4RH6 A;  1FO4 A;  1GC7 A;  2Y5C A;  1PGA A;  5BYR A;  4EOY A;  3PO0 A;  1LQB A;  1R4M B;  1T0R C;  1QOG A;  2GBJ A;  1V49 A;  1WZ3 A;  1EF1 A;  2KJH B;  1ZXI A;  2AWT A;  2ZPY A;  1WXV A;  4YSX B;  2X38 A;  4M01 A;  1A5R A;  2GBK A;  4BAX A;  1BXT A;  3MTN B;  1MI0 A;  1ZUD 2;  2H88 B;  4US9 A;  4XWT A;  1KFY B;  3AH7 A;  4DXF A;  2HDE A;  2WXO A;  3DBH B;  5E6J A;  4MGY E;  1MG4 A;  1TS3 A;  1E10 A;  1JRU A;  2JF5 A;  2OJW A;  2IGD A;  2K9X A;  2ZVN A;  1LXD A;  4JWU C;  4C4V B;  1NI3 A;  1WXA A;  1ZDX A;  2BYV E;  2I2Y A;  3H7S A;  1S1Q B;  1QQR A;  3P1M A;  3U8Z A;  2KN4 A;  2WXH A;  1YN3 A;  3AMZ A;  3VVW B;  4PS8 A;  3PHW B;  2BVC A;  3AE7 B;  3BWU D;  5FK9 C;  1WXS A;  4MJS B;  2DAJ A;  1PGX A;  4GB9 A;  3RNE C;  1R4M I;  2K6D B;  3VUX A;  2FCM A;  3DVN V;  4G50 A;  1CQV A;  2K3U A;  2AL6 A;  4KZC A;  3V61 A;  2NCN A;  1ZKH A;  3LDZ E;  3QC8 B;  4MM3 A;  2EMT A;  2PVG C;  3T9L A;  1QIL A;  3VFK A;  1UGJ A;  4IM3 A;  1WIA A;  2HTH A;  3PLV A;  2NTT A;  1PUT A;  3DBH I;  4AOF A;  3Q8C A;  4JX1 C;  2XN9 C;  4GGQ A;  2LWP A;  2JXT A;  4TUU A;  3MHZ A;  2MBE A;  3EC8 A;  2DLB A;  1WYG A;  5BMH A;  1N5X A;  1NYQ A;  4J6I A;  3Q8E A;  3I3T B;  1U4A A;  2QSD A;  2XNA C;  5AUI A;  3A9K A;  5C2T B;  3T8M A;  2RPQ A;  4US8 A;  2H89 B;  2O2V B;  1WMH A;  4QAY A;  2MBB B;  3P63 A;  3HM6 X;  1AYF A;  5D6J B;  2K22 A;  5BMI A;  3VTV A;  3PT2 B;  3M3J A;  3RD2 A;  2LGY A;  2LXC A;  4XGA B;  1SB3 C;  1ZGU B;  2V3N A;  1F77 A;  5GMV A;  3M62 B;  2M19 A;  4FBJ B;  1ISN A;  1RFA A;  1WXM A;  2FUH B;  2BYE A;  4K1R B;  2J52 A;  3DDC B;  4W9K A;  3BII D;  4S0R A;  2PMV A;  3I5J C;  4FLH A;  5HHD G;  1TIF A;  3EGR A;  2MWS B;  3H9D A;  1KJT A;  4IG7 B;  4P7I A;  2QDF A;  1QLB B;  4JIO U;  1YJJ A;  3UIP B;  1STE A;  4MDK E;  4LJP B;  1FPY A;  4ZRJ A;  4TQ1 A;  3HVD A;  4CHK A;  4HVB A;  1VJK A;  2MRP A;  3W1S C;  1NEK B;  3QK0 A;  1OQY A;  2DHZ A;  3R3M A;  3Q69 A;  2LVO A;  2AQ1 B;  3RUL A;  3N9Y C;  4AP4 C;  2EKE C;  2RGF A;  3RT3 B;  2K1F A;  3RZF A;  1XCT L;  4YSY B;  4ZYN A;  4L2Y A;  2AQ3 B;  4RM8 A;  3UIO B;  1E6E B;  3BIN A;  1H4R A;  2HD5 B;  2WP9 B;  4LDT D;  1EUV B;  2G1E A;  2N9X A;  2GOW A;  4W9L A;  3W2D A;  2IDY A;  2DZM A;  2DYB A;  5KHO A;  3S2A A;  4A3P A;  2JX5 A;  3GE3 C;  2M1M A;  3AE3 B;  2KFK A;  3NRZ A;  1SEB D;  2K25 A;  5I4D A;  3LYY A;  2IO2 B;  1WM2 A;  4LNO A;  3TCA A;  4ZRI A;  1WGH A;  1SJE D;  4RM9 A;  2KDF B;  1YOV B;  2WQY B;  4W9C A;  5IOI A;  1UNS A;  4LNN A;  5IN7 A;  3HM3 A;  2V1Y A;  4HK2 A;  1EWC A;  4HLE A;  3HIZ A;  1EM7 A;  4HKZ E;  3TEX A;  3RCZ A;  2WXL A;  2NVU I;  2BB5 A;  4HPL B;  5EE9 A;  2NS5 A;  1K52 A;  3PV1 A;  2WHI A;  2KKC A;  2D3G A;  3H7P B;  3BVZ A;  4LJO B;  1LFD A;  2K39 A;  3W9C B;  1KLU D;  2W55 A;  3W5U B;  2CHW A;  3W1Y A;  2IBI B;  2GBM A;  3AN1 A;  2PE9 A;  3ZNH B;  1PQS A;  2AEH A;  4MGZ E;  2JSV X;  3ZJT A;  2KMC A;  5GXG B;  2M8S A;  4FHK A;  2WWZ A;  2JY6 A;  4GDK B;  2JPH A;  4IM0 A;  1HXY D;  3KLS X;  2GBN A;  3BY4 B;  4RFB A;  4KZ0 A;  3A4S C;  5G2N A;  2PEA A;  1E7V A;  1VZ8 A;  4HEA 1;  1TKY A;  4ZHP A;  1QOB A;  2BWF A;  2FCS A;  3J9C A;  1RFK A;  3IHP C;  2DZI A;  1JW9 D;  1TGZ B;  3L4P A;  4OZB A;  1JWU D;  2JT4 B;  4GDL A;  3NHE B;  2M0A A;  2KLG A;  3R66 C;  2LJ5 A;  2RMM A;  2RD0 A;  1GPX A;  3ZNI D;  3HK0 A;  2RDG A;  3NVZ A;  4XX5 A;  1V86 A;  2V3S A;  2BYT A;  1L6V A;  1I4Q A;  4XDC A;  2PKO A;  1HA5 A;  2ZW0 A;  3RFZ B;  3LB8 C;  1FMA D;  3ONS A;  4J3O D;  1UGM A;  1CZP A;  4RNA A;  1YX5 B;  2M56 B;  5E6O A;  3M63 B;  1UD7 A;  2KWC A;  2L32 A;  3IBE A;  2WLB A;  2JQR B;  2O6V B;  3DBR I;  4PYZ A;  4EE2 A;  3B08 A;  3JSV B;  4N6E B;  2N9E B;  1RLF A;  1I35 A;  4HJG E;  2Q5W D;  2AL3 A;  2YVC A;  4EKU A;  5HG2 A;  1B9R A;  1F9J A;  3QX1 A;  1JAL A;  4RCO A;  3AXC A;  3RN9 C;  1C77 A;  3NS1 A;  3VR8 B;  1KH0 A;  1X1M A;  2K6Q A;  4NY0 A;  5H8Y E;  4AWJ A;  1KTK A;  2ON8 A;  1UEL A;  4KGR A;  3VHT C;  2WYQ A;  4A90 A;  1XXG A;  4TMA B;  1C3T A;  4LNK A;  1IPG A;  1EU4 A;  1UBQ A;  2RSU A;  4DHJ D;  2BGF A;  3RNF C;  1XF5 L;  2J0K A;  3SHQ A;  5L95 C;  2R2Q A;  3HUI A;  3ZNZ B;  2SEB D;  2WXR A;  4RGN A;  2PW9 A;  2MP2 B;  4M00 A;  4A20 A;  3KH0 A;  2IPK D;  1MVK A;  1WGY A;  3AEF B;  1WGD A;  1FCC C;  1K53 A;  4KGT A;  3C0R B;  3VTW A;  4H2A A;  3ENE A;  3EA6 A;  2JXX A;  4YXD B;  1WX7 A;  2SAK A;  3N1X C;  1Q10 A;  1XCQ L;  2I1J A;  2WDT B;  1K50 A;  4ANX A;  3BK1 A;  4HPP A;  3A33 B;  1QOA A;  1E8Y A;  2V4L A;  3TUO A;  1ET6 A;  1VDV A;  2KMA A;  1AWD A;  3IG3 A;  2G9H D;  4EUT A;  3Q2A C;  3GZN I;  3PRE A;  3VUY A;  2IYD B;  2V0G A;  4IC7 B;  4NQK E;  3KW5 B;  1IYF A;  2WXI A;  4F8C B;  2KVR A;  5DPT A;  2MJ3 A;  1IBX A;  2DEN B;  2EKI A;  2YEP B;  3V6E B;  3AEG B;  3PTF C;  4M0W B;  2N0S B;  5TSS A;  3N3K B;  4E3C A;  3N20 C;  1YN5 A;  1L0Y B;  1YX6 B;  2BKF A;  1C79 A;  1EO6 A;  2YLM A;  1OQQ A;  3UI3 A;  2BT6 A;  2KWV B;  5DPS A;  2JZ3 B;  3ML8 A;  2D3A A;  4M02 A;  2NPT B;  2N9K A;  3PVL A;  4HRO A;  4MM3 B;  3CWI A;  3NUH B;  1AW7 A;  4W9I A;  1NYR A;  2D5G A;  4DQO C;  1TS4 A;  2W3S A;  4RF1 A;  3R7R A;  4WWO A;  2N7J A;  1L4Z B;  3SEB A;  4W9J A;  3SR6 A;  1E7U A;  3VDZ A;  3Q8A A;  1R7S A;  3TEZ A;  4ZRQ A;  1TS5 A;  2LHE A;  2L3Z A;  1I4H A;  1Y56 A;  4HWI B;  2IY1 B;  2B3A A;  3B2G A;  1SSN A;  1WMH B;  1GAQ B;  2CR5 A;  1WGR A;  2I38 A;  5E6N A;  2C9W B;  3ZDT A;  4XWW A;  1EWY C;  4YL8 A;  3VUW A;  2DAF A;  5J2R A;  1WE7 A;  2PLP A;  4M8M A;  1Q0W B;  3P4S B;  1FXA A;  2KLC A;  2KAN A;  1J7B A;  3ZUN A;  2C60 A;  4ASW C;  4YSZ B;  2MJD A;  2IZV B;  2FCN A;  3P2B A;  2LRW A;  4XC2 A;  3L54 A;  4FHJ A;  4B0M A;  3DBL I;  1V1O A;  3P4P B;  1E5W A;  1UH6 A;  4BKG A;  2GI9 A;  1FEH A;  4YTP B;  2IO0 B;  3AB5 A;  3E9S A;  3QAQ A;  3SU8 X;  1FXI A;  2WXG A;  1F1H A;  4FJV B;  1PDX A;  3AUL A;  5EDS A;  4MEL A;  4NJ6 A;  2LEK A;  4PYU A;  3VQI A;  1T6B X;  4P1B C;  4KKI A;  2WXF A;  3H6N A;  2MSE D;  2ACZ B;  1WE6 A;  1J8C A;  2KX3 A;  2Y5P A;  1FNV A;  1VRA B;  3NVV A;  1C4P A;  4DK5 A;  3O13 A;  3CSF A;  2IY0 B;  2G4D B;  1QF6 A;  3MFG A;  1LM8 B;  1I42 A;  4B6W A;  3ALB A;  1I4R A;  5CHF A;  4JE3 B;  3RMK C;  1WGK A;  3L0W B;  2R2O A;  1SE9 A;  2INN E;  3IXS A;  2E6X A;  4ZRP A;  3RI7 C;  4IKG A;  3VAW A;  3RUI B;  1N61 A;  4JPS A;  4P16 A;  3I57 A;  5JHB A;  2CU3 A;  3V62 A;  4II2 B;  3U2S C;  2IGG A;  3RYT A;  2JZZ A;  3KVF B;  3VH4 B;  1V1P B;  4PS7 A;  4HDO A;  2AQ2 B;  2ZCB A;  2K8B A;  2INP E;  1VR9 A;  3IFW B;  3GB1 A;  3RNG C;  2MBO A;  4K7U A;  4BOZ B;  4YT0 B;  3TIX A;  4BKT A;  5DPR A;  4KVG B;  3WCQ A;  2Z0E B;  1GUA B;  3UGB B;  1K8R B;  5FR3 A;  5LXH A;  1F2R I;  4ZOH C;  1FRD A;  3KUC B;  4K7W A;  4BVU C;  4JQW C;  3FIL B;  3WAM A;  1L0X B;  1J0G A;  4W9H A;  2Z8L A;  2QMT A;  5G5H A;  2LVP A;  2QHO A;  3MC8 A;  1UWX A;  3GE8 C;  2WXK A;  4Q2J A;  2AYO B;  4F7Z A;  3SFE B;  4EZJ A;  3TJP A;  1IUE A;  3ZNG C;  4ACF A;  4HJK A;  2HJ8 A;  1FFU A;  2ICI A;  2VH2 A;  2ZW1 A;  3V60 A;  1RRB A;  3Q8B A;  4C4V A;  2XEW A;  3ZW3 A;  4GSW A;  1WRD B;  2KZR A;  2MA9 B;  1E8X A;  3RNA C;  2KTF A;  1GB1 A;  2LRU A;  4NAW A;  5TR5 A;  5AZF A;  2LXA A;  1TJE A;  2JRI B;  4O1N A;  1TBE A;  2HE7 A;  4MJS A;  4REZ A;  4GIV A;  2NR2 A;  2VZK B;  3KQ4 A;  1SIF A;  1D3Z A;  1HTQ A;  4XZ4 A;  4YWG G;  1C4C A;  3VRB B;  1V80 A;  1HTO A;  3CMM B;  1N6Z A;  2NMQ A;  2PPH A;  2WX0 A;  3VXW A;  2KQS A;  1UBI A;  2L0F A;  4L23 A;  4EEW A;  1M94 A;  2BBC A;  3B9J A;  1OFF A;  3PPA A;  4HCN B;  1UUP A;  2JYE A;  1TT5 B;  5EE3 A;  4CYE A;  1EF5 A;  3MC0 B;  3PZ7 A;  3BVM A;  4D2K A;  3QWZ B;  3MP9 A;  3TSS A;  4ICU A;  1H8C A;  2FNJ B;  4MGK E;  1OEY A;  2LGX A;  4C80 A;  1QT9 A;  4KSK C;  2A4Z A;  1Z5S B;  1UF0 A;  3P4Q B;  3AE8 B;  2J0J A;  2G4S A;  2O2V A;  1BML C;  2QIL A;  2WU5 B;  3IT6 B;  1WI0 A;  1RAX A;  3OJ4 B;  2VH1 A;  4WJN A;  1D5X C;  2CJO A;  3KWL A;  3P42 A;  1YJI A;  4KIK B;  2B76 B;  2D3B A;  1XLQ A;  3OLM D;  5D2M B;  2AX5 A;  3A4R A;  3B1L X;  1NDD A;  2BS2 B;  2QJL A;  5LXI B;  2BWE S;  3Q3O C;  1WWT A;  2MLB A;  4A6Q A;  2WX1 A;  1I4G A;  1IGC A;  3R2I A;  4EZK A;  1OTR B;  4ANU A;  4MGI E;  4S17 A;  1V8C A;  3DHH C;  3NVY A;  1E8Z A;  2KTR B;  1MHX A;  4OZA A;  3D32 A;  1C1Y B;  4BFR A;  5IAA C;  4KV2 A;  2J4X A;  3WIM A;  2JYT A;  4ZYS A;  4HRS A;  3NZS A;  2D11 A;  4MAC A;  3VH3 B;  1AAR A;  1WX9 A;  2WU2 B;  2KFJ A;  4FUL A;  1V5O A;  1DYQ A;  2L1A A;  4N58 A;  1FM0 D;  3DQV A;  4MH8 A;  4MSQ B;  3DCG A;  2KAJ A;  2LUM A;  1DGJ A;  1SXT A;  2M0X A;  2RPV A;  1TKE A;  2FUG 1;  4P6V F;  1C4A A;  3OAW A;  2BB6 A;  2JWU A;  2MH7 A;  3RZW C;  4R3D A;  3HRD D;  3QA8 A;  3AI5 A;  2N1V A;  3H1U A;  2QCZ A;  1UZX B;  2KX0 A;  4XDD A;  2CHZ A;  4YTM B;  3WA0 A;  1ENF A;  4W9F A;  1N62 A;  5EE1 A;  2JWZ A;  2KO3 A;  2WDR B;  3ZXR A;  4DXG A;  2HJ1 A;  3BVG A;  1JWA D;  2EEL A;  3Q3F A;  2IGH A;  2PVO D;  2MBH A;  2VZK D;  1N5W A;  3T3O A;  4UDU C;  2KQ4 X;  1FNU A;  2DZK A;  4NNJ B;  2IND C;  2KDI A;  3NS8 A;  4JL9 A;  3A1Q A;  4FAD A;  3ZVV A;  1V6E A;  4FJY A;  3ZRC A;  2OOB B;  3H7P A;  4EFO A;  1XLP A;  4A9A A;  3JVZ X;  3WAL A;  1IGD A;  1OEY J;  4NQL B;  2MQJ A;  3LJ3 A;  2LAS A;  4KDI C;  3WAP A;  4B95 A;  3DHI C;  4JGH B;  1WYW B;  2XK5 B;  2G45 B;  1LGR A;  2KWU B;  4GDK A;  4ZHO A;  2LGS A;  1ZPS A;  4PT5 A;  3QIJ A;  2KD0 A;  4HKQ A;  2WGS A;  3ZTD A;  1WJ4 A;  1PGB A;  4KKJ A;  3ZYY X;  2JRH A;  2ZNV C;  1VD2 A;  3CF6 E;  1C9F A;  2L8J A;  4DDG D;  2QC8 A;  3UIN B;  1NVI D;  2WXN A;  5JHA A;  1WSP A;  3DOW A;  4W9E A;  2RR9 A;  5BMG A;  5G55 A;  1HZ5 A;  2D10 A;  5D94 A;  1NBF C;  3BK2 A;  1P7F A;  2K8C A;  3L08 A;  1TYG B;  3L13 A;  2M17 A;  4AS1 A;  3I9V 1;  2DWQ A;  5DCN A;  2MX2 A;  3L16 A;  1ROE A;  2XBB C;  1R4N B;  1Z2M A;  1ET9 A;  1YNT E;  4WUR A;  1WXQ A;  1GOZ A;  3TBL D;  2ZCC A;  3CST A;  1ESF A;  5JXV A;  3L17 A;  1L0V B;  3EFC A;  5C3J B;  2ONQ A;  1F0Z A;  1WRI A;  3C8Y A;  3EEC A;  2ZPN A;  2O6V A;  3EHV A;  3IAS 1;  3UF8 A;  3QAR A;  5LLI A;  2K5P A;  3JSV A;  1S3S G;  2INC C;  4LLG M;  3KUD B;  1FD6 A;  2K8H A;  3A9J A;  1YN4 A;  2FID A;  4TSS A;  1SF0 A;  4DHZ E;  2ASQ A;  4MSM B;  4URK A;  1SE4 A;  3Q14 C;  4HXD A;  2O6V D;  2J0M A;  3PLU A;  3BZD B;  4FJZ A;  1ZP0 B;  2D07 B;  3ZJU A;  1XEE A;  3E56 A;  5IP4 D;  3ETR A;  4YTN B;  4TQ0 A;  1AN8 A;  2LUE A;  4W9D A;  5C23 A;  5J17 A;  1I7H A;  3EUB 2;  4II3 B;  5IKC M;  3A9K B;  4RMA A;  3R7Q A;  1V9J A;  3VR9 B;  1MFW A;  1JRO A;  3T3N A;  2WDQ B;  1Y8R C;  1N63 A;  2ZJD A;  2WXM A;  1G6J A;  4WJP A;  2BYF A;  2IO1 B;  3R2T A;  3RNB C;  1DOY A;  3N30 A;  4OZC A;  4ZRK A;  1JQ4 A;  3DVG X;  2E3T A;  2N7E A;  2UWQ A;  4K81 A;  1HZ6 A;  1Q1O A;  3R8B A;  2C5L C;  2KT7 A;  1HE8 A;  2N1W A;  1KRH A;  4WQM A;  4KGS A;  1XLN A;  1ZE3 D;  1GB4 A;  2GMI C;  4ARI A;  2KK8 A;  3PSE B;  3NZU A;  2FBW B;  4ARC A;  1QZE A;  1L6U A;  1FNW A;  1C76 A;  1SGH A;  5J18 A;  3ZJV A;  2QEJ C;  2Y5B B;  4LDT B;  3Q3J A;  2KAC A;  1RYJ A;  1ZW7 A;  2DBY A;  2KDM A;  2C7H A;  2LVQ A;  4OVZ A;  4OVV A;  1TZ1 A;  4WJQ A;  2M4N A;  3X23 A;  5JZE B;  4F1S A;  1WJ6 A;  3V3X A;  1V81 A;  2BPS A;  4XE0 A;  4IOI E;  4WWM A;  2J53 A;  4DHZ B;  5CX3 A;  4WJO A;  1F2R C;  4M0W A;  1YMH E;  4NAW B;  1XD3 B;  3K9P B;  5DPW A;  2WNM A;  2D3C A;  3AE1 B;  4NAM A;  4NJ7 A;  1YQ3 B;  4ZDV A;  3AU5 A;  2BF8 B;  2N4F A;  1WFY A;  4NPN A;  2NPT A;  2GLS A;  2KFK B;  4G0N B;  1YD8 U;  2J42 A;  3PHX B;  4USA A;  2QIE B;  4HPM B;  3WAO A;  5JH5 C;  4DXA B;  3PS6 A;  3L10 B;  4WIP A;  4C00 A;  2MCN B;  2L52 A;  5HFY A;  1D4B A;  2LD9 A;  2V9H A;  4C7Y A;  1JWS D;  1FIQ A;  3PGE A;  2L00 B;  4HDQ A;  2W9N A;  1TS2 A;  3RNC C;  3I63 C;  1GC6 A;  4I6P A;  1K51 A;  1F52 A;  2DZJ A;  2Y3A A;  3ZO5 B;  2MW5 A;  1DOX A;  1E9M A;  2PJH A;  3ZRF A;  1WM3 A;  1NI2 A;  3ECI A;  1KM7 A;  2L7R A;  3QQ8 B;  3V6C B;  3HVZ A;  2WXP A;  1YIW A;  4ITK A;  3JW0 X;  3UQB A;  1JCK B;  2KDE B;  2IJ0 A;  2MJE A;  3IVF A;  4LNI A;  5IA7 A;  3IAM 1;  2PE6 B;  4RGT A;  2C7N B;  2L83 A;  4IW0 A;  3ZTC A;  3NJT A;  1WZ0 A;  2W54 A;  1RM6 C;  2PIA A;  2A5U A;  3B0A A;  2KMM A;  5E6P A;  2BQQ A;  3VRA B;  1FRR A;  3APD A;  1ZXH A;  1WX8 A;  4OW0 A;  3PRZ A;  1J19 A;  4C7Z A;  3NY5 A;  4GDL B;  1L4D B;  2REX A;  3DPD A;  1MG8 A;  4GU2 A;  1D6E C;  1LO5 D;  4CQN A;  5D3D A;  1HQR D;  2KDB A;  4LK0 M;  2N7D A;  3AE5 B;  1MHH E;  4ICV A;  4KX6 B;  1J7C A;  2KJR A;  2LGI A;  3VTU A;  1VZ6 A;  4IDI A;  2JU6 X;  2NBV B;  2LJI A;  1WJN A;  4IM2 A;  1WJU A;  1C78 A;  1P0R A;  2W3R A;  4E74 A;  3NZ3 A;  4LTU A;  5HKH A;  5G5G A;  3FAH A;  4OVU A;  3U4E G;  2ZEQ A;  2LZ6 A;  3PZD A;  4K7S A;  2CU1 A;  3TEY A;  3BYY B;  4DBG A;  1WR1 A;  1P9D U;  1P1A A;  4L1B A;  3ZIM A;  5L83 A;  4MH0 E;  4DHJ B;  1JML A;  3RPF C;  3N1Y C;  2Z59 B;  5D7G A;  1WH3 A;  1B1Z A;  3SDL C;  4WAA A;  2IO3 B;  1XO3 A;  3ML9 A;  5EE0 A;  2KYW A;  1TTN A;  1L5P A;  1WGG A;  2KC2 A;  2BKR B;  1T0S C;  2UYZ B;  2N9L A;  2KHW B;  2LFI A;  2OJR A;  2KN5 A;  3AEA B;  1TY2 A;  4K3B A;  2KXJ A;  4IWP A;  2DYM A;  1P98 A;  1V1P A;  4PS3 A;  5KHQ A;  4IWO A;  3A1Q B;  2FCQ A;  4BZA A;  3APF A;  1M4V A;  3AED B;  2NTS A;  3H8H A;  2ZZP B;  4FN2 A;  4W9G A;  3AV8 A;  3ZKJ C;  2ZVO A;  2FAZ A;  3IT4 B;  1YJ1 A;  3QHT A;  3O65 B;  4KSL C;  4E71 A;  1KLG D;  3KYC D;  4AQ7 A;  3FIL A;  2GBR A;  1DOI A;  4PK1 A;  3OG5 A;  2PTL A;  3U7D A;  3DBR B;  1CJE A;  3WAN A;  3MJ5 A;  1P7E A;  2LI5 A;  4M8N A;  4ANV A;  1XLO A;  2CJN A;  2TSS A;  5BYQ A;  4B0E A;  1WR6 E;  4HCP B;  4TV3 A;  2LGD A;  4FA6 A;  2KNB A;  3AE4 B;  1KLV A;  1VCB A;  2MHJ A;  3AM9 A;  1OGW A;  1CK1 A;  3P4R B;  2JVC A;  1FFV A;  3MHS D;  5AUK A;  5AZH A;  1GG3 A;  5LNK 1;  4G3X B;  1ZOY B;  4GMV A;  3ZGZ A;  2V3P A;  1UWM A;  4AJY B;  4MEM A;  4GLS C;  3EFU A;  4N9F 4;  4X57 B;  3OWE B;  1CMX B;  3SD5 A;  5D3I B;  3U30 A;  2HTM E;  3M95 A;  2FIF A;  3N32 A;  2D2Q A;  4JLC A;  3C19 A;  3NG0 A;  3Q3N C;  1IBX B;  2N9P C;  2WS3 B;  5CTR C;  2RDH A;  4B9K A;  2JUO A;  1SE3 A;  3W1S A;  3DBS A;  3GP7 A;  3DWG C;  3DWM A;  4XYC A;  3U52 E;  5T8I A;  1MPE A;  2GB1 A;  1P3Q U;  2DX5 B;  3LXF A;  2DYO A;  1VZ7 A;  1I4X A;  5AZG A;  4GOC A;  2NBW B;  1T5X D;  1E7P B;  2KQ7 A;  3KYD D;  2MBQ A;  1SE2 A;  1I4P A;  1YQB A;  1JWM D;  4WAF A;  2KC1 A;  1L2N A;  3NVW A;  3HHM A;  3AEB B;  5HI1 A;  1GJZ A;  1OQR A;  2CHX A;  4RGM A;  3A9J B;  3OJ3 A;  3GS2 A;  1SBB B;  4IUM B;  4AJW A;  1BT0 A;  2OED A;  4ANW A;  4LCD E;  1TKG A;  1RWS A;  4WWP A;  1V97 A;  5BO4 B;  2X8X X;  3KUZ A;  4A55 A;  2L76 A;  2YEP F;  4GN1 A;  4IWQ A;  3PRM B;  3AU4 A;  1IP9 A;  2JZP A;  3QJZ A;  3W5V B;  4RF0 A;  4OHJ A;  3ZLZ A;  2W82 A;  3NOB A;  3CIR B;  2BW2 A;  3URY A;  5FKA C;  3GZN B;  2DNF A;  1XT9 B;  3DVN U;  1TY0 A;  2CS4 A;  2KOX A;  1T3Q A;  1GNU A;  2CKH B;  3Q6B A;  1N60 A;  4DWF A;  4AUQ C;  3FKY A;  4KIK A;  2WXJ A;  5IO9 A;  4JWS C;  2BS4 B;  3ZQ4 A;  5AEK B;  4MT5 A;  2RDB C;  2KVZ A;  3BYT B;  3AE6 B;  3Q3M C;  3UQA A;  2G3Q B;  2WDV B;  2LHD A;  2V4I B;  5BYS A;  1KF6 B;  3U7Z A;  2GRI A;  1SIJ A;  1D5M C;  2EMS A;  1E8W A;  2KJ6 A;  1V5T A;  1TZO A;  1T0Y A;  2KTR A;  4NJC A;  1E90 A;  3PZ8 A;  1A70 A;  1ACC A;  1ZDV A;  4BBN F;  3AEC B;  4A8X C;  2ZNV B;  3DVG Y;  2K0P A;  5CHW A;  3QCA A;  4WWN A;  2C7M B;  1EU3 A;  4RGO S;  5MPO A;  1QKZ A;  3AEE B;  3B2F A;  3ZXV A;  4LNF A;  2I1K A;  3AE9 B;  2KWD A;  4FXC A;  5FR6 A;  3TMP B;  4N59 A;  2R61 A;  1MJD A;  1VLB A;  4G11 A;  1J7A A;  2J7Q B;  4I6L B;  2NBU A;  5C1Z A;  1WY8 A;  1PYW D;  1L7Y A;  2BS3 B;  3ABV B;  1Q5W B;  1FXT B;  4BOS C;  4EZL A;  4P1C C;  2BTE A;  4BKS A;  2WXQ A;  1PFD A;  3AE2 B;  5CHV C;  4A3O A;  1JRP A;  1HEZ E;  2OHF A;  2UU7 A;  3PRP B;  1BUI C;  1T0Q C;  4I6N B;  1D5Z C;  1JWB D;  4WH4 A;  4CO7 A;  2FE8 A;  4C56 C;  3TL5 A;  1YQ4 B;  3Q8F A;  4BBN C;  1R4N I;  5H92 C;  3APC A;  4DDI D;  1WF9 A;  3X0W A;  3GOE A;  2Z0D B;  3FC4 A;  3V05 A;  2MEK A;  2L0T A;  4KDL B;  3ZDM C;  3KWV A;  4BKS D;  1FCL A;  3DBL B;  2LMC A;  1NEN B;  2VRR B;  4WQO B;  3SFD B; 
#chains in the Genus database with same CATH homology
 2RSU A;  2A4Z A;  1Z5S B;  2L7R A;  3QQ8 B;  4DHJ D;  3V6C B;  2BGF A;  2J0J A;  2G4S A;  1KOT A;  3K9O B;  1YIW A;  2J0K A;  3SHQ A;  4TKN A;  5L95 C;  2MP2 A;  2O2V A;  2R2Q A;  4GXB A;  2XK5 A;  3JYU A;  3MJW A;  3ZNZ B;  3JW0 X;  2L05 A;  1WI0 A;  3UQB A;  1RAX A;  3OJ4 B;  1XQQ A;  1V2Y A;  4WJN A;  2KDE B;  2MP2 B;  3IVF A;  5IA7 A;  1GC7 A;  4A20 A;  4EOY A;  3KH0 A;  4KIK B;  2PE6 B;  1LQB A;  2C7N B;  3OLM D;  4IW0 A;  3ZTC A;  5D2M B;  1WGY A;  1WGD A;  3A4R A;  3B1L X;  2GBJ A;  1NDD A;  1WZ0 A;  3C0R B;  3VTW A;  1V49 A;  5LXI B;  1WZ3 A;  1EF1 A;  2BWE S;  2KJH B;  3ENE A;  2MLB A;  2JXX A;  2A5U A;  1WX7 A;  2WX1 A;  3B0A A;  2AWT A;  2ZPY A;  5E6P A;  1WXV A;  4EZK A;  1OTR B;  4ANU A;  1A5R A;  3APD A;  4MGI E;  2I1J A;  2WDT B;  2GBK A;  1WX8 A;  1E8Z A;  2KTR B;  3PRZ A;  3D32 A;  4ANX A;  3A33 B;  3MTN B;  1E8Y A;  1C1Y B;  4BFR A;  2V4L A;  5IAA C;  4KV2 A;  1J19 A;  2KMA A;  3NY5 A;  3WIM A;  4GDL B;  2REX A;  4MGY E;  3IG3 A;  1JRU A;  2JF5 A;  3DPD A;  1MG8 A;  3NZS A;  4EUT A;  4GU2 A;  2D11 A;  2ZVN A;  3GZN I;  3PRE A;  1LXD A;  3VUY A;  3VH3 B;  2IYD B;  1AAR A;  1WX9 A;  2KFJ A;  2KDB A;  4FUL A;  2N7D A;  1V5O A;  4ICV A;  1WXA A;  2BYV E;  4IC7 B;  2KJR A;  4NQK E;  3KW5 B;  1IYF A;  3VTU A;  3H7S A;  3DQV A;  4MSQ B;  4F8C B;  1S1Q B;  3DCG A;  3U8Z A;  2KVR A;  2NBV B;  5DPT A;  2DEN B;  3VVW B;  4PS8 A;  3PHW B;  1WJN A;  2M0X A;  3V6E B;  4IM2 A;  1WJU A;  1WXS A;  4MJS B;  2DAJ A;  1P0R A;  4GB9 A;  4E74 A;  1R4M I;  2K6D B;  3PTF C;  4M0W B;  3VUX A;  3OAW A;  5HKH A;  3N3K B;  4OVU A;  4E3C A;  2FCM A;  2ZEQ A;  3DVN V;  2LZ6 A;  4G50 A;  3RZW C;  1YX6 B;  2AL6 A;  2BKF A;  1EO6 A;  4KZC A;  3V61 A;  3QA8 A;  2YLM A;  3PZD A;  3AI5 A;  2N1V A;  3H1U A;  2NCN A;  4K7S A;  1UZX B;  1ZKH A;  2CU1 A;  2KX0 A;  2KWV B;  3LDZ E;  3QC8 B;  4DBG A;  2CHZ A;  5DPS A;  2JZ3 B;  1WR1 A;  1P9D U;  4MM3 A;  3WA0 A;  1P1A A;  2EMT A;  4W9F A;  3T9L A;  3ML8 A;  3VFK A;  2JWZ A;  2NPT B;  2KO3 A;  4IM3 A;  3ZIM A;  1WIA A;  2HTH A;  3PLV A;  3PVL A;  4MH0 E;  5L83 A;  4DHJ B;  2Z59 B;  3DBH I;  4AOF A;  5D7G A;  3Q3F A;  1WH3 A;  2MBH A;  4WAA A;  2IO3 B;  4GGQ A;  4W9I A;  3SDL C;  3ML9 A;  2LWP A;  1TTN A;  1WGG A;  4TUU A;  2KC2 A;  2BKR B;  2DZK A;  2UYZ B;  2MBE A;  3EC8 A;  4NNJ B;  2KHW B;  3R7R A;  3NS8 A;  2KDI A;  4JL9 A;  4WWO A;  3A1Q A;  4FAD A;  3ZVV A;  1V6E A;  4FJY A;  3ZRC A;  2OJR A;  2KN5 A;  4J6I A;  2OOB B;  3H7P A;  4EFO A;  2KXJ A;  3I3T B;  2DYM A;  1P98 A;  1U4A A;  4IWP A;  4PS3 A;  4W9J A;  3JVZ X;  5KHQ A;  3WAL A;  4IWO A;  1OEY J;  1E7U A;  3A1Q B;  4NQL B;  3A9K A;  2MQJ A;  3LJ3 A;  2LAS A;  4KDI C;  3T8M A;  3WAP A;  2RPQ A;  2FCQ A;  3VDZ A;  4B95 A;  3APF A;  4JGH B;  2O2V B;  1WYW B;  1WMH A;  2L3Z A;  2XK5 B;  2G45 B;  2MBB B;  2ZZP B;  2KWU B;  4FN2 A;  4GDK A;  4HWI B;  3HM6 X;  4W9G A;  2IY1 B;  5D6J B;  2B3A A;  3VTV A;  3ZKJ C;  3PT2 B;  1WMH B;  3M3J A;  2CR5 A;  3RD2 A;  1WGR A;  2ZVO A;  2FAZ A;  2LGY A;  1YJ1 A;  2LXC A;  3QHT A;  3O65 B;  3QIJ A;  4KSL C;  5E6N A;  3KYC D;  4E71 A;  5JH5 C;  2C9W B;  1ZGU B;  2KD0 A;  3ZDT A;  2GBR A;  3ZTD A;  1WJ4 A;  4YL8 A;  5GMV A;  3VUW A;  3U7D A;  3M62 B;  2DAF A;  4FBJ B;  3WAN A;  5J2R A;  1ISN A;  1RFA A;  1WE7 A;  2JRH A;  2ZNV C;  2LI5 A;  1VD2 A;  1WXM A;  3CF6 E;  4M8N A;  4M8M A;  1Q0W B;  4ANV A;  2KLC A;  2L8J A;  2KAN A;  2FUH B;  4DDG D;  3ZUN A;  2BYE A;  4K1R B;  2C60 A;  4ASW C;  3DDC B;  1WR6 E;  3UIN B;  4HCP B;  4W9K A;  5JHA A;  4TV3 A;  2IZV B;  3DOW A;  4FLH A;  2LGD A;  2FCN A;  2KNB A;  4W9E A;  4FA6 A;  1VCB A;  3P2B A;  1KLV A;  2RR9 A;  2LRW A;  5G55 A;  4XC2 A;  1OGW A;  2MWS B;  2D10 A;  3H9D A;  1KJT A;  3L54 A;  4FHJ A;  1NBF C;  3DBL I;  2JVC A;  5D94 A;  2K8C A;  3MHS D;  4IG7 B;  3L08 A;  1GG3 A;  4P7I A;  5AZH A;  3L13 A;  2M17 A;  4JIO U;  1E5W A;  5DCN A;  1UH6 A;  2MX2 A;  4MDK E;  3UIP B;  4BKG A;  4LJP B;  3L16 A;  4G3X B;  4GMV A;  2IO0 B;  4ZRJ A;  4TQ1 A;  4AJY B;  4MEM A;  4CHK A;  4HVB A;  3QAQ A;  2XBB C;  3EFU A;  2MRP A;  3SU8 X;  3W1S C;  1Z2M A;  4N9F 4;  4X57 B;  3QK0 A;  1CMX B;  1OQY A;  2DHZ A;  3R3M A;  3SD5 A;  3TBL D;  2ZCC A;  3U30 A;  3CST A;  2LVO A;  3L17 A;  4FJV B;  3M95 A;  3AUL A;  2FIF A;  3N32 A;  3RUL A;  4AP4 C;  5EDS A;  2EKE C;  2D2Q A;  4MEL A;  4JLC A;  4NJ6 A;  2RGF A;  3RT3 B;  2K1F A;  4PYU A;  3VQI A;  2N9P C;  3RZF A;  5CTR C;  4B9K A;  2JUO A;  3EEC A;  4ZYN A;  3DBS A;  3W1S A;  4RM8 A;  3UIO B;  2ZPN A;  2O6V A;  3BIN A;  3H6N A;  1H4R A;  2MSE D;  3EHV A;  1P3Q U;  2DX5 B;  2HD5 B;  1WE6 A;  3UF8 A;  2DYO A;  2KX3 A;  1J8C A;  3QAR A;  5AZG A;  4LDT D;  5LLI A;  1EUV B;  4GOC A;  2N9X A;  2GOW A;  4W9L A;  2NBW B;  3JSV A;  2DZM A;  2DYB A;  2KQ7 A;  5KHO A;  3S2A A;  3KYD D;  1S3S G;  4A3P A;  2MBQ A;  1YQB A;  3KUD B;  2K8H A;  2M1M A;  2KC1 A;  3A9J A;  1L2N A;  2KFK A;  2FID A;  3HHM A;  4DK5 A;  2K25 A;  4DHZ E;  2ASQ A;  1GJZ A;  3CSF A;  2IO2 B;  1WM2 A;  2IY0 B;  2G4D B;  2CHX A;  3TCA A;  4MSM B;  4URK A;  1LM8 B;  4ZRI A;  1WGH A;  3A9J B;  3OJ3 A;  4RM9 A;  1I42 A;  4B6W A;  2KDF B;  3ALB A;  4IUM B;  4W9C A;  5CHF A;  4AJW A;  1BT0 A;  4HXD A;  3L0W B;  2O6V D;  2J0M A;  1SE9 A;  2R2O A;  3HM3 A;  2V1Y A;  3PLU A;  4HK2 A;  4ANW A;  4LCD E;  4WWP A;  4HLE A;  4FJZ A;  5BO4 B;  3KUZ A;  2D07 B;  2L76 A;  3HIZ A;  4GN1 A;  3VAW A;  3RUI B;  3RCZ A;  4IWQ A;  3PRM B;  3AU4 A;  1IP9 A;  2NVU I;  5JHB A;  4HPL B;  2NS5 A;  3V62 A;  3PV1 A;  3QJZ A;  4TQ0 A;  2KKC A;  2D3G A;  4II2 B;  2LUE A;  4W9D A;  5C23 A;  3H7P B;  5J17 A;  3RYT A;  2JZZ A;  3ZLZ A;  3KVF B;  4LJO B;  1LFD A;  3NOB A;  3VH4 B;  2K39 A;  4PS7 A;  4HDO A;  2ZCB A;  2CHW A;  4II3 B;  3W1Y A;  2K8B A;  3A9K B;  1XT9 B;  3DVN U;  4RMA A;  2IBI B;  3IFW B;  2GBM A;  2PE9 A;  2CS4 A;  1PQS A;  2KOX A;  3R7Q A;  3ZNH B;  1V9J A;  2AEH A;  1GNU A;  2MBO A;  4MGZ E;  2KMC A;  2CKH B;  2M8S A;  4K7U A;  4BOZ B;  4FHK A;  3TIX A;  2WWZ A;  5DPR A;  4KVG B;  4BKT A;  4DWF A;  4AUQ C;  1Y8R C;  2JY6 A;  2ZJD A;  4GDK B;  1G6J A;  4WJP A;  2BYF A;  2Z0E B;  2IO1 B;  4KIK A;  2JPH A;  4IM0 A;  1GUA B;  2GBN A;  3UGB B;  1K8R B;  3BY4 B;  5LXH A;  3N30 A;  5AEK B;  3KUC B;  4K7W A;  4ZRK A;  4KZ0 A;  3A4S C;  3DVG X;  2N7E A;  5G2N A;  4BVU C;  2UWQ A;  2PEA A;  4JQW C;  1E7V A;  2G3Q B;  4K81 A;  3UQA A;  3WAM A;  1Q1O A;  2C5L C;  1HE8 A;  2BWF A;  2N1W A;  2FCS A;  2EMS A;  1E8W A;  2KJ6 A;  1V5T A;  4W9H A;  1J0G A;  2GMI C;  1T0Y A;  2KTR A;  2LVP A;  2KK8 A;  2QHO A;  3IHP C;  3NZU A;  3PSE B;  1E90 A;  1QZE A;  2DZI A;  1TGZ B;  2JT4 B;  4BBN F;  2AYO B;  4F7Z A;  1SGH A;  4GDL A;  3NHE B;  4EZJ A;  5J18 A;  3TJP A;  2KLG A;  2ZNV B;  3DVG Y;  3R66 C;  2LJ5 A;  5CHW A;  3ZNG C;  2RD0 A;  3QCA A;  2Y5B B;  2HJ8 A;  3Q3J A;  2C7M B;  4HJK A;  4LDT B;  4WWN A;  1ZW7 A;  3ZNI D;  3HK0 A;  3V60 A;  1RRB A;  2C7H A;  2LVQ A;  2XEW A;  2I1K A;  1V86 A;  4OVV A;  1TZ1 A;  4XX5 A;  4WJQ A;  4GSW A;  3ZW3 A;  2V3S A;  2M4N A;  5FR6 A;  3TMP B;  1WRD B;  3X23 A;  2KZR A;  5JZE B;  2MA9 B;  1E8X A;  4F1S A;  1WJ6 A;  2KTF A;  1V81 A;  2BPS A;  4G11 A;  2J7Q B;  2LRU A;  4I6L B;  4NAW A;  2NBU A;  5TR5 A;  3ONS A;  5C1Z A;  1UGM A;  5AZF A;  2LXA A;  1YX5 B;  2JRI B;  5E6O A;  3M63 B;  1TBE A;  1WY8 A;  2HE7 A;  4MJS A;  1UD7 A;  1L7Y A;  4GIV A;  2NR2 A;  4WJO A;  5CX3 A;  4DHZ B;  2KWC A;  1Q5W B;  1SIF A;  3IBE A;  4NAW B;  1D3Z A;  1FXT B;  1XD3 B;  4XZ4 A;  2O6V B;  3DBR I;  3K9P B;  5DPW A;  4BOS C;  4EZL A;  1V80 A;  4PYZ A;  3B08 A;  3CMM B;  3JSV B;  4BKS A;  4NJ7 A;  2PPH A;  2WX0 A;  5CHV C;  2KQS A;  2N9E B;  3VXW A;  4ZDV A;  4A3O A;  1RLF A;  1UBI A;  3AU5 A;  2BF8 B;  2N4F A;  1WFY A;  4NPN A;  1I35 A;  2L0F A;  4EEW A;  1M94 A;  2AL3 A;  2NPT A;  2KFK B;  2YVC A;  4G0N B;  1YD8 U;  4EKU A;  3PRP B;  3PHX B;  4I6N B;  4HPM B;  1F9J A;  3PPA A;  3QX1 A;  3PS6 A;  3AXC A;  3L10 B;  3WAO A;  4HCN B;  3TL5 A;  4CO7 A;  4DXA B;  2MCN B;  4BBN C;  4CYE A;  1EF5 A;  1R4N I;  2LD9 A;  3APC A;  3PGE A;  4DDI D;  1X1M A;  1WF9 A;  2L00 B;  4HDQ A;  2K6Q A;  4NY0 A;  3X0W A;  3QWZ B;  4AWJ A;  3GOE A;  2Z0D B;  1UEL A;  2W9N A;  4ICU A;  3ZDM C;  4KDL B;  2L0T A;  2FNJ B;  1GC6 A;  1H8C A;  4I6P A;  3VHT C;  2WYQ A;  2DZJ A;  4MGK E;  4BKS D;  3ZO5 B;  2MW5 A;  1OEY A;  2VRR B;  4WQO B;  2LGX A;  2PJH A;  1C3T A;  3ZRF A;  1IPG A;  1WM3 A;  1UBQ A;  1NI2 A;  3ECI A;  1KM7 A;  4KSK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...