3VH4B

Crystal structure of atg7ctd-atg8-mgatp complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
TFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of Atg8 activation by a homodimeric E1, Atg7.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal binding protein/protein transport
molecule keywords Ubiquitin-like modifier-activating enzyme ATG7
total genus 29
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3vh4B00
1WZ3A 4TQ0A 4II2B 4A3OA 2K8CA 4WWPA 2I1KA 1UZXB 3ZNHB 4DHZE 1NI2A 3ZDMC 3MHSD 4GMVA 4MGIE 1XT9B 1ZGUB 4FADA 1SGHA 3HK0A 1GNUA 2C9WB 2KDEB 3KUZA 3DVGX 1Q1OA 2LGDA 3QQ8B 2LXCA 3EC8A 2BGFA 2V1YA 1V9JA 1WF9A 2PE6B 3AU5A 3PHXB 4LJPB 1R4MI 4HDOA 2D2QA 2FCNA 2JRHA 2K8BA 2KN5A 2BKRB 2R2OA 4BKSA 2KTRB 2FIDA 2CHXA 4IUMB 3NOBA 2DZJA 2V4LA 3DVNV 1LXDA 3O65B 4GU2A 5G2NA 1R4NI 2L76A 3NZSA 4EFOA 4ASWC 5DCNA 1YQBA 2CU1A 2J0JA 2KQ7A 2O6VB 2BYFA 1K8RB 1VCBA 4MGYE 4IM2A 2YLMA 4WJQA 2V3SA 1U4AA 4JLCA 3EECA 3JSVB 2RR9A 5DPTA 5C23A 2KHWB 2KVRA 3PSEB 4E3CA 1XQQA 2C7HA 5TR5A 2IYDB 4M8MA 4DDID 3UIOB 2KLCA 4BOSC 3L0WB 5D6JB 1OTRB 2C7MB 1ISNA 2RPQA 1RLFA 2IO2B 1GUAB 3MTNB 3U7DA 3VTVA 2DZIA 4CYEA 4EUTA 3ZO5B 3V60A 4IWOA 3KVFB 4LJOB 2DYBA 4AJYB 1YIWA 1HE8A 1UD7A 2NBVB 1BT0A 2JF5A 4HWIB 3PHWB 5AZHA 3OAWA 5CX3A 2L8JA 5DPRA 4ANXA 1IP9A 3AU4A 1UBIA 1Q0WB 4GDLB 5AZGA 4EZLA 1V2YA 1WGHA 3B1LX 1J0GA 1WY8A 1WXVA 2L0TA 3CSFA 3VUXA 1V5OA 4F1SA 1V81A 2K6DB 2KC2A 3WAOA 1LM8B 2RD0A 3A1QB 3NHEB 2G3QB 4BVUC 3RT3B 1S1QB 3TMPB 4AUQC 4W9KA 4LDTD 4FBJB 2L7RA 4HDQA 3ENEA 2FCQA 2CHWA 2LVOA 2N4FA 2MRPA 2KWCA 2HD5B 2Z0EB 3PREA 1J19A 3H1UA 3IG3A 4FN2A 1GJZA 2KJRA 3VDZA 1I35A 1YJ1A 2IO1B 2JY6A 1E8ZA 2LGXA 2N7EA 2ZPNA 4CHKA 5J2RA 2L0FA 4KSKC 1X1MA 3S2AA 2KO3A 4GDKA 2C60A 3AXCA 3QC8B 3W1SC 1GC6A 3PGEA 2KXJA 3ML8A 1NBFC 1EF5A 4KZ0A 4NJ7A 5DPWA 3GOEA 1MG8A 4MSQB 4RMAA 3PV1A 1A5RA 4WQOB 2N7DA 3NY5A 3M62B 2NBUA 3Q3FA 2ZPYA 2KD0A 2HE7A 4A3PA 4HPLB 2JT4B 3QAQA 4DHJB 3IBEA 3M3JA 1UH6A 1QZEA 4YL8A 2KTFA 1I42A 3JSVA 2DAFA 1E5WA 1JRUA 2LD9A 2KJHB 4JIOU 3UGBB 3ZDTA 5FR6A 2MSED 4MJSA 1KOTA 4KVGB 3ZNID 2YVCA 4IWPA 2JUOA 2MBQA 3A9KB 3SU8X 1UELA 3L17A 4KIKB 4DDGD 5AEKB 5LXIB 3ZLZA 3ZNGC 4FLHA 5JZEB 4I6LB 4EZJA 3DPDA 3VHTC 2I1JA 3UQBA 3NS8A 2K39A 5J17A 5KHQA 4K1RB 3L10B 2LVQA 2WX1A 1PQSA 2RSUA 4N9F4 3SHQA 2L3ZA 2CR5A 5JH5C 5D2MB 2LASA 4IC7B 2LUEA 1OGWA 5CHFA 3DBLI 3L54A 2A4ZA 1YX5B 1H8CA 3V62A 1WXSA 4AP4C 1NDDA 5IAAC 4PS3A 2W9NA 4IM3A 5GMVA 3APDA 2KDFB 2KKCA 3VH4B 1P0RA 1WIAA 1WR1A 1E8XA 3RYTA 2D11A 4MEMA 3I3TB 2KDIA 3OJ3A 5D94A 4BKSD 4WWOA 1WX8A 1GG3A 1WXAA 3ZIMA 2CHZA 2NCNA 3B0AA 2Y5BB 2O6VD 4NPNA 3VUYA 3WIMA 4DHJD 4WAAA 4ZYNA 1FXTB 1WX9A 3RCZA 2KK8A 4PYUA 2XK5B 3DCGA 4B9KA 2K8HA 4GIVA 4MSMB 2BWFA 2FCSA 2M1MA 3A4SC 2A5UA 4I6NB 4IWQA 4PS7A 3QIJA 3T8MA 2N1WA 4MJSB 3VAWA 4K81A 4EOYA 1IPGA 2C7NB 1E8WA 3L16A 1WMHA 3AI5A 3VFKA 1TTNA 3A1QA 4LCDE 4KIKA 2DZMA 4GB9A 2LXAA 3R7QA 3A9KA 3ZRCA 4ICVA 2PPHA 2KJ6A 4HCPB 4HJKA 4MELA 3UIPB 5IA7A 1Q5WB 5AZFA 2JVCA 2O2VB 1UBQA 2MBBB 3HM3A 4RM8A 4DWFA 3V61A 3L13A 1E90A 4FHJA 3C0RB 2K25A 1TBEA 4XX5A 2XEWA 3VUWA 2M4NA 1ZW7A 1EO6A 2WX0A 3UF8A 2R2QA 1KM7A 2MA9B 1V86A 2ZJDA 2N9XA 3DOWA 2KOXA 3HIZA 2B3AA 4W9EA 4WJPA 2JRIB 2LGYA 3K9PB 2AWTA 1WGGA 2WYQA 1WXMA 4EKUA 3WANA 5BO4B 1WMHB 1D3ZA 3VTUA 3B08A 2DX5B 2BKFA 1V80A 2MBEA 3CSTA 2KWVB 1TGZB 4PS8A 2MCNB 3ZW3A 2Z0DB 2EMSA 4NNJB 4TQ1A 2FNJB 2NPTB 3QX1A 4XZ4A 2BWES 4IG7B 2N9PC 2M8SA 2KTRA 1SE9A 4KDLB 1LQBA 4OVUA 4W9CA 3PS6A 4FJZA 2PEAA 2WDTB 3ALBA 3APCA 1WGRA 1J8CA 3OLMD 4W9DA 4HVBA 2IY0B 2Z59B 1RAXA 2KMCA 2J0MA 3M95A 4W9JA 1VD2A 3H7PB 3RUIB 3H7PA 4ZRJA 3QHTA 4TUUA 2KX3A 2N1VA 2XK5A 4FA6A 1F9JA 4NJ6A 2HTHA 3PPAA 4MGZE 3PZDA 4XC2A 2JXXA 3PLVA 5CHVC 3WAMA 3W1YA 4NAWA 3BY4B 1UGMA 1KLVA 3KYCD 3H7SA 1V6EA 2OOBB 3K9OB 5C1ZA 3MJWA 4JL9A 2BYEA 2AEHA 2GBKA 4PYZA 4ZDVA 3SD5A 5JHBA 4NY0A 1L2NA 2AL6A 2IBIB 2WWZA 4DHZB 1V5TA 1EF1A 3CMMB 3ONSA 4ZRIA 2LZ6A 1GC7A 4GOCA 2M17A 3DDCB 2ZZPB 3X23A 3ZUNA 1OEYJ 4HLEA 1E8YA 3M63B 2PE9A 3IHPC 5J18A 3P2BA 3ZTCA 4WJNA 4EEWA 4W9FA 4W9IA 1OEYA 4OVVA 3NZUA 3U30A 2QHOA 3JVZX 3KUCB 4MH0E 2ASQA 4HXDA 1EUVB 1XD3B 3A33B 2BF8B 4KZCA 1P3QU 3EHVA 1Z2MA 2JPHA 3RZFA 3TL5A 1KJTA 4KSLC 2GMIC 2KQSA 1WM3A 2KWUB 3IFWB 4CO7A 2J0KA 4W9LA 4X57B 4KV2A 2GBNA 2ZNVC 3R3MA 3A9JA 5LLIA 3L08A 2FUHB 3PRMB 1M94A 1WGYA 3PRPB 4AWJA 3HM6X 2ZNVB 3LDZE 3H9DA 3ZNZB 2N9EB 4FULA 4F8CB 2UYZB 2NBWB 4GSWA 4IM0A 2CS4A 2BPSA 2JZZA 1H4RA 3Q3JA 3RD2A 2KMAA 4E71A 4K7WA 4I6PA 5E6NA 3QK0A 3HHMA 2BYVE 4RM9A 1WYWB 2L00B 4AOFA 4DXAB 2GBRA 2REXA 2ZCCA 4MGKE 3V6CB 3X0WA 2AL3A 2KFJA 1L7YA 2RGFA 4HK2A 4URKA 4G50A 1T0YA 2ZCBA 3ZVVA 1RRBA 1WJ4A 2OJRA 4FJVB 3ML9A 4WWNA 4ANUA 1S3SG 3QCAA 2GBJA 5G55A 1AARA 3WALA 3A9JB 5KHOA 1TZ1A 2MW5A 2FCMA 2NR2A 3DBRI 2KZRA 2MLBA 1E7VA 3KUDB 3PLUA 1YD8U 4M0WB 4TV3A 4W9GA 3PRZA 5DPSA 3UINB 3VQIA 2DYMA 2LRUA 3PTFC 4BBNC 2MWSB 4LDTB 3TIXA 2GBMA 1SIFA 2CKHB 3KYDD 3RZWC 5L95C 2LWPA 2JZ3B 2K6QA 4HCNB 3N3KB 4GGQA 2UWQA 4K7UA 2FAZA 2XBBC 2MP2B 4KDIC 1WI0A 3N30A 3IVFA 2ZVOA 5CTRC 1ZKHA 2MBOA 2ZEQA 4TKNA 5L83A 2K1FA 3T9LA 2MQJA 1OQYA 2J7QB 2G45B 3GZNI 4ZRKA 3AULA 4J6IA 3RULA 5LXHA 3TCAA 1YX6B 2AYOB 3VH3B 1WR6E 4BKTA 3QJZA 5EDSA 4G11A 4G3XB 4HPMB 1V49A 3PT2B 1WE6A 4JQWC 4MDKE 1LFDA 2JWZA 3ZRFA 1WFYA 2EKEC 1WE7A 2O6VA 3N32A 5JHAA 3DQVA 2KLGA 2LVPA 3DVNU 2KX0A 2KDBA 2MP2A 3H6NA 1Y8RC 4JGHB 4NAWB 4W9HA 4BFRA 2G4DB 1Z5SB 2D3GA 4B95A 3D32A 3EFUA 2IY1B 1RFAA 3JW0X 4E74A 2PJHA 2LJ5A 4GXBA 4AJWA 1IYFA 3BINA 2LI5A 1WRDB 3QWZB 3A4RA 2KFKA 5CHWA 3TJPA 4NQLB 3ECIA 3WAPA 1WJNA 2IO3B 1WJ6A 4M8NA 4BBNF 3DBSA 5E6OA 2KNBA 2FIFA 3DBHI 2G4SA 3VTWA 4EZKA 3V6EB 3U8ZA 4B6WA 2VRRB 2LRWA 2MX2A 4G0NB 3SDLC 4NQKE 2NVUI 3UQAA 5D7GA 3CF6E 4P7IA 1WH3A 3VVWB 3OJ4B 3R66C 5E6PA 4ANVA 1C1YB 2HJ8A 3R7RA 4DK5A 1WGDA 2EMTA 2M0XA 3KH0A 4II3B 4A20A 2DAJA 2ZVNA 3QA8A 1P98A 4ANWA 4FJYA 4WJOA 3ZTDA 4BOZB 3WA0A 2KC1A 3ZKJC 1WM2A 1G6JA 2KFKB 1WJUA 2DYOA 4ICUA 2DZKA 1C3TA 3LJ3A 4F7ZA 1WX7A 3PVLA 4MM3A 2DHZA 2GOWA 2DENB 2D10A 2L05A 4FHKA 3APFA 2O2VA 1P1AA 3QARA 4GN1A 1P9DU 4IW0A 2IO0B 2MBHA 1WZ0A 2KANA 3JYUA 4GDKB 2NPTA 4DBGA 3DVGY 3KW5B 4K7SA 2C5LC 3TBLD 1E7UA 2IZVB 4BKGA 5HKHA 3W1SA 1CMXB 2D07B 3VXWA 4GDLA 2NS5A
chains in the Genus database with same CATH superfamily
4II2B 4A3OA 3GE8C 4REZA 2I1KA 3Q2AC 4RF1A 3ZDMC 3MHSD 1FFUA 3DVGX 2MEKA 3PHXB 2PE6B 1WF9A 3AU5A 4LJPB 2K5PA 4HDOA 4WWMA 4ZRPA 2R2OA 4IUMB 2DZJA 5G2NA 1AYFA 1YQBA 2CU1A 2KQ7A 4MGYE 3PZ8A 2BYFA 4JLCA 3JSVB 2KHWB 1RYJA 2KVRA 1KFYB 2C7HA 5TR5A 1HTOA 1VZ8A 2KLCA 4BOSC 4NZLB 3L0WB 5D6JB 2C7MB 1ISNA 2KN4A 2RPQA 3RFZB 2IGHA 3KVFB 1HE8A 2J4XA 2NBVB 1K51A 2W3SA 5AZHA 3OAWA 5CX3A 1TYGB 1IP9A 1UBIA 1GPXA 3RNCC 1WY8A 2MH7A 2K6DB 4XDCA 4LNOA 1S1QB 1SE2A 2CHWA 2N4FA 5AUKA 4FXCA 2JY6A 1E8ZA 2N7EA 4PT5A 1X1MA 3S2AA 2KO3A 4GDKA 2C60A 1NBFC 4NJ7A 1C78A 1MG8A 4MSQB 4RGOS 3UI3A 1KH0A 3Q3FA 2ZPYA 2KD0A 4A3PA 1IGCA 3W2DA 3HRDD 4YL8A 1NYRA 3TSSA 2KTFA 3MFGA 2H89B 1I42A 2DAFA 3FILB 1D5XC 2LD9A 3UGBB 3R8BA 1TS5A 2MSED 1SXTA 4ARCA 1FXAA 3ZNID 1STEA 2N9KA 2JUOA 1UELA 3ZLZA 3AEFB 3U2SC 1R4NB 4HPPA 3VHTC 1NI3A 3UQBA 3EA6A 1PQSA 2ONQA 4HKZE 4AQ7A 1I4RA 1E9MA 1JWAD 4MACA 3SFDB 2DNFA 5JH5C 5G5HA 2N0SB 5CHFA 1JWBD 1R7SA 1LO5D 2V3PA 2HDEA 4RFBA 3BZDB 1NDDA 4D2KA 2W9NA 5GMVA 2KDMA 1FMAD 2KDFB 2KKCA 1WIAA 2BS3B 4HJGE 2INNE 4R3DA 3NS1A 2KDIA 2WU5B 1WX8A 1GG3A 4WAAA 1N5WA 4ZYNA 2WLBA 3NVZA 1WX9A 3VR8B 2BWFA 2FCSA 2M1MA 4IWQA 3ZGZA 4EOYA 3E56A 3N1YC 4K81A 3AV8A 2C7NB 1E8WA 3L16A 1WMHA 1FNVA 4HROA 1QF6A 3AE1B 4HJKA 5IA7A 5AZFA 2WS3B 1TBEA 5EE3A 1YN3A 3PO0A 1ZW7A 3MC8A 4RGTA 2MA9B 2ZJDA 2B3AA 5C3JB 2L83A 1ZOYB 2ZW0A 4LLGM 2RPVA 3K9PB 1WXMA 3IXSA 3WANA 5BO4B 1SJED 2BKFA 1V80A 3CSTA 2EMSA 3AEGB 4TQ1A 2FNJB 2NPTB 3QX1A 4XWWA 4KDLB 4OVUA 5J17A 4OZBA 4FJZA 2PEAA 1WGRA 3MP9A 2B76B 4YXDB 2WDQB 4W9JA 3H7PB 2MHJA 4ITKA 4ZRJA 4FA6A 3NVWA 2HTHA 1PGXA 2LUMA 1UF0A 3BY4B 1JWSD 1BUIC 3H7SA 2OOBB 3K9OB 1IUEA 5JHBA 4NY0A 1TS4A 2RDGA 1B9RA 2IBIB 1TS2A 3ONSA 4ZRIA 4K3CA 2M17A 2ZZPB 3X23A 5BYQA 1OEYJ 4ZOHC 3IHPC 5J18A 3P2BA 3ZTCA 1V1PB 1FRRA 4C4VA 4W9FA 2PTLA 3R2TA 4OVVA 3W5UB 3U30A 1N5XA 4MH0E 2ASQA 4HXDA 2BF8B 3RNAC 4KZCA 3P42A 3EHVA 1Z2MA 4KSLC 2PKOA 4CO7A 4W9LA 2KMMA 1N63A 3A9JA 4RGMA 2FUHB 1M94A 3NVVA 1RFKA 4F8CB 2UYZB 3AEDB 2BPSA 2JWUA 1L4DB 4K7WA 4YSZB 3QK0A 3HHMA 4XYCA 1FNWA 4MGKE 1D5ZC 3Q8FA 3V6CB 2KFJA 1L7YA 3I57A 1HQRD 5EE1A 4G50A 1T0YA 3ZVVA 2BTEA 4FJVB 3ML9A 4WWNA 4ANUA 2GBJA 1AARA 2KACA 2NR2A 4BKTA 4W9GA 3DHIC 1VZ7A 2LHDA 1CK1A 2CKHB 5L95C 4HCNB 4QAYA 3AEBB 3N3KB 2XBBC 1FXIA 4KDIC 1VZ6A 2CJNA 1E0ZA 2ZVOA 4RF0A 2LEKA 2CU3A 4WAFA 2MQJA 2J7QB 3P4PB 3RN9C 4ZRKA 2OJWA 1PFDA 3AULA 4USAA 4OZCA 4G3XB 3RMKC 1LFDA 3FKYA 1WFYA 2W3RA 3N32A 3WCQA 3T3OA 3DQVA 2KLGA 3DVNU 2MP2A 1Y8RC 4JGHB 4W9HA 2W82A 2D3GA 3EFUA 4E74A 4KGTA 1IYFA 1MHXA 3A4RA 4NQLB 1WJNA 1WJ6A 3DBSA 4DQOC 2DBYA 3VTWA 4EZKA 2LRWA 2QIEB 1DOXA 2MX2A 4YT0B 2NVUI 3BYTB 5GXGB 3PZ7A 3W5VB 2HJ8A 4ACFA 2DAJA 1T0QC 2OHFA 1SB3C 3GP7A 4BOZB 2KC1A 1B1ZA 3ZKJC 1N6ZA 2DHZA 2D10A 3GE3C 2O2VA 3TEYA 1P1AA 4GN1A 1P9DU 4B0MA 2WXOA 3H8HA 1WZ0A 1OQQA 4HEA1 4JWUC 3DVGY 1E7UA 2IZVB 4BKGA 3BVGA 3DWMA 1SBBB 1CMXB 3OG5A 3HVDA 2NS5A 1RM6C 2LMCA 2K8CA 4WWPA 1V97A 5G5GA 3ZNHB 1T0SC 1QOFA 1ZGUB 3HK0A 3CIRB 1GNUA 1K50A 4IKGA 2LXCA 2BGFA 2V1YA 1R4MI 2SEBD 2JRHA 2KN5A 3ZXRA 2KTRB 2FIDA 2CHXA 2IGDA 2V4LA 1LXDA 3DVNV 3ZJTA 4GU2A 1XF5L 2L76A 4EFOA 2I2YA 2JYTA 2YLMA 3EECA 1YNTE 5BMIA 2M0AA 1SE3A 1F1HA 2IYDB 1TKGA 3VTVA 2IO2B 1VDVA 4EUTA 4O1NA 1XCTL 2DYBA 4LJOB 1I4PA 1YIWA 4AJYB 1E10A 1BT0A 4P1BC 3PHWB 2L8JA 3DBRB 2D3CA 1V2YA 1WGHA 3C19A 2L0TA 1V81A 5AUIA 3NHEB 3N1XC 4L1BA 2G3QB 4BVUC 3RT3B 4RGNA 3T3NA 4LDTD 2L7RA 4FN2A 2MRPA 2KWCA 2GI9A 3IG3A 2IDYA 1C4PA 2LGXA 1J7AA 4LNNA 4KZ0A 3GOEA 3BK2A 5E6JA 1V1PA 3B2FA 3Q8AA 4MT5A 3M3JA 3W9CB 1QZEA 1E5WA 2JXTA 4JIOU 3ZDTA 4P6VF 5FR6A 4KVGB 4IWPA 2MBQA 4DDGD 4KIKB 5AEKB 5LXIB 2KAJA 3ZNGC 4K3BA 2QEJC 3NS8A 1ZXIA 3L10B 3LYYA 2BB5A 3MHZA 1OGWA 3DBLI 1E6EB 2A4ZA 4JWSC 3V62A 2RMMA 5IAAC 4IM3A 5FK9C 3Q3NC 3BVMA 2WDRB 3VH4B 2KWDA 4HKQA 1CJEA 3OJ3A 4WWOA 4A8XC 3GZNB 2NCNA 2GLSA 3B0AA 2D3AA 4NPNA 2K22A 2VZKD 3RCZA 2KK8A 4PYUA 3DCGA 2K8HA 4GIVA 2QMTA 5EDSA 2J53A 4I6NB 2LHEA 3T8MA 5IN7A 1CZPA 4M02A 3A1QA 2DZMA 3R7QA 3ZRCA 3AB5A 3UIPB 1UGJA 2JVCA 1UBQA 3HM3A 4DWFA 1ESFA 1D6EC 3P63A 4XX5A 2XEWA 2WXPA 4US9A 3BIID 1EO6A 2R2QA 1KM7A 3Q8BA 4WJPA 1NYQA 3B9JA 2BB6A 1P7EA 2JRIB 4Q2JA 1DGJA 2AWTA 1D4BA 4EKUA 1WMHB 1D3ZA 3VTUA 1TGZB 3DBHB 2Z0DB 1I4GA 2HTME 2N9PC 2BS2B 2M8SA 4W9CA 1F77A 1J8CA 3APCA 4ZYSA 4W9DA 2Z59B 2KMCA 2J0MA 3M95A 3RUIB 3QHTA 2KX3A 2N1VA 3AN1A 4NJ6A 4MGZE 4YTPB 2JXXA 4WQMA 2QC8A 2GRIA 4MH8A 1UGMA 2WXJA 3KYCD 1V6EA 5C1ZA 3MJWA 4PYZA 1MJDA 3ZXVA 1V5TA 1GC7A 2XNAC 4HLEA 5BMGA 2PE9A 4WJNA 4EEWA 1OEYA 3NZUA 5HHDG 2Q5WD 2FBWB 3RZFA 2JPHA 5D3IB 1P7FA 4KGSA 1WM3A 3IFWB 5FKAC 2J0KA 2K9XA 1ET9A 2GBNA 3R3MA 2DWQA 5LLIA 1XCQL 1WGYA 5JXVA 3HM6X 2JU6X 2ZNVB 3ZNZB 2OEDA 2N9EB 2WDVB 2NBWB 4GSWA 4A55A 2JZZA 3Q3JA 3RD2A 2KMAA 4M00A 3GS2A 5E6NA 2BT6A 2BYVE 1OQRA 2L00B 4DXAB 1PUTA 2ZCCA 3X0WA 3AMZA 1IGDA 4HK2A 2E6XA 2KYWA 1RRBA 4ZHPA 2WXIA 2K3UA 4S17A 2WNMA 5G55A 1Q10A 4P1CC 3A9JB 5KHOA 1TZ1A 2FCMA 3DBRI 2KZRA 2MLBA 1E7VA 3KUDB 3PLUA 2W54A 2DYMA 1JWMD 4BBNC 1SIJA 1ZUD2 2GBMA 3KYDD 2JZ3B 4C4VB 5LNK1 4K7UA 2AQ1B 2WXRA 2MP2B 1PDXA 3N30A 2MBOA 2K1FA 1OQYA 2JYEA 1CQVA 3RULA 5LXHA 3TCAA 1YMHE 3AEEB 4G11A 4OHJA 1TY2A 4MDKE 2G1EA 4L2YA 1WE7A 2O6VA 1A70A 4LK0M 2KX0A 4BFRA 4NAWB 4C56C 4B95A 1TS3A 1F2RI 5T8IA 3ZYYX 4C7ZA 2PJHA 2FUG1 3RPFC 3BINA 3QWZB 2PLPA 1SJHD 3WAPA 4C80A 4M8NA 2BW2A 2WXKA 5E6OA 2FIFA 3DBHI 3V3XA 3IT6B 4B6WA 4BAXA 4NQKE 1PYWD 2WXGA 1WH3A 3OJ4B 3EUB2 3KH0A 2LGSA 4WJOA 3ZTDA 1ET6A 3MJ5A 3N20C 2CJOA 1G6JA 1WJUA 2DYOA 3NJTA 5IOIA 1MVKA 1C3TA 2X38A 3LJ3A 3FC4A 1N60A 2DENB 2L05A 4FHKA 1SF0A 3LB8C 2MBHA 2KANA 2NPTA 2C5LC 4EE2A 1TY0A 2D07B 4GDLA 5TSSA 2KQ4X 4TQ0A 1K52A 1UZXB 3AE4B 3EGRA 1DOIA 4LTUA 2ON8A 1V8CA 1SGHA 1ZE3D 2KDEB 3KUZA 3KWLA 3AE2B 1ACCA 4YTNB 3QQ8B 3EC8A 1V9JA 1WWTA 1FO4A 3OWEB 1MFWA 2K8BA 4BKSA 1YN5A 3Q8CA 1KTKA 1R4NI 3NZSA 2O6VB 1MI0A 1K8RB 1VCBA 2MJEA 4IM2A 3Q6BA 5DPTA 2WU2B 1XQQA 4XDDA 4M8MA 4DDID 3ZJVA 1YOVB 3U7DA 4JX1C 1V1OA 1GUAB 3MTNB 4YWGG 3ZO5B 3V60A 1C76A 3VRAB 1T5XD 1BMLC 5DPRA 4ANXA 3AU4A 1FIQA 1J0GA 3Q69A 1XLPA 2VH2A 1WXVA 3CSFA 1V5OA 4OW0A 2GB1A 2D3BA 3I9V1 3ZQ4A 4TMAB 4W9KA 4HDQA 3ENEA 2LVOA 2Z0EB 3PREA 3H1UA 1GJZA 1I35A 3VDZA 3IAS1 2ZPNA 5J2RA 2L0FA 4N58A 1QQRA 1XXGA 3W1SC 3QC8B 4HRSA 2KXJA 3ML8A 3RNFC 1EF5A 1L0XB 2BYTA 3TUOA 3TEWA 1I4XA 3PV1A 1A5RA 1VRAB 3M62B 1AWDA 1WGKA 4HPLB 3N1ZC 2JT4B 1UH6A 1YQ3B 3JSVA 1JRUA 2KJHB 4MJSA 1MHHE 3J9CA 3A9KB 2H88B 3P4RB 3RI7C 3SU8X 3L17A 5JZEB 5FR3A 4EZJA 4YSXB 3NRZA 1SE4A 5KHQA 5EE9A 3U7ZA 1ENFA 2LVQA 1NEKB 2RSUA 1KLGD 3SHQA 2WXNA 2L3ZA 2LASA 4IC7B 3KWVA 2LUEA 2JZPA 3L54A 1UUPA 1XLNA 4YSYB 1SSNA 1P0RA 1WR1A 4MEMA 2WGSA 1J7BA 5D94A 1EM7A 4BKSD 2I38A 2WXLA 2CHZA 2QJLA 3VUYA 1GB4A 1WYGA 1TZOA 2XK5B 1JMLA 4B9KA 4MSMB 2N1WA 1IPGA 1XO3A 3VFKA 2TSSA 1TTNA 1MG4A 4LCDE 4GB9A 2LXAA 4ICVA 2PPHA 4HCPB 2JQRB 4P16A 2O2VB 4RM8A 1GOZA 3BWUD 1C4AA 4WIPA 2N9LA 1QKZA 1E90A 4FHJA 1E7PB 2Y3AA 3C0RB 3AE3B 2K25A 2L1AA 5D3DA 3VUWA 2M4NA 3UF8A 1QOGA 3V05A 1V86A 3DOWA 2KOXA 1VJKA 2INPE 3HIZA 1ZXHA 2X8XX 4W9EA 1WRIA 1J7CA 1VLBA 1JW9D 2KVZA 2LGYA 2WYQA 2INCC 1JQ4A 1FPYA 2DX5B 4NNJB 3Q14C 2JSVX 4A90A 2KTRA 1QILA 3PS6A 1FNUA 1EWYC 1OFFA 4TUUA 4XC2A 3LXFA 3KLSX 3WAMA 3W1YA 3NVYA 3RNGC 4US8A 1KLVA 2NTSA 4JL9A 2GBKA 4ZDVA 3SD5A 2AL6A 2WWZA 2R61A 1EF1A 3CMMB 4ZHOA 3DDCB 1E8YA 3M63B 3GB1A 2BBCA 3SFEB 2QHOA 3JVZX 3KUCB 1XD3B 3A33B 2NMQA 3TEZA 4RNAA 3URYA 3TL5A 2GMIC 3U52E 4X57B 1ROEA 2ZNVC 4TSSA 3L08A 3PRMB 2ZW1A 4AWJA 1QLBB 3LDZE 3H9DA 3MC0B 3DWGC 1QOAA 4E71A 4I6PA 2ICIA 3BYYB 1F0ZA 2GBRA 2FE8A 2REXA 4RCOA 5MPOA 1K53A 4JPSA 2ZCBA 4XWTA 4DXGA 1WJ4A 1FD6A 2V4IB 1S3SG 1EWCA 3QCAA 2BQQA 3WALA 2PIAA 4M0WB 4S0RA 3VQIA 4NAMA 1XEEA 3PTFC 2MWSB 4M01A 3TIXA 1SIFA 2LWPA 2K6QA 1N62A 2FAZA 1WI0A 3AE8B 2DLBA 1ZKHA 2WP9B 1EU4A 1TKEA 4TKNA 5L83A 2V3NA 2INDC 1AN8A 4J6IA 2AYOB 3P4QB 1DOYA 4HPMB 1T6BX 1I7HA 2JWZA 3AE7B 3O13A 1TIFA 1Z5SB 3D32A 2IY1B 1VR9A 4GXBA 4AJWA 2IGGA 2LI5A 4DXFA 3V6EB 1JCKB 3SDLC 3UQAA 5D7GA 3CF6E 4P7IA 3B2GA 3VVWB 3AE5B 3R66C 5E6PA 5HI1A 4ANVA 1C1YB 4DK5A 2EMTA 4II3B 4A20A 2ZVNA 3QA8A 1P98A 4ANWA 3FILA 3WA0A 1UWMA 4ICUA 2DZKA 2L52A 3PVLA 2YEPB 2GOWA 1HTQA 3APFA 5H92C 2IO0B 3JYUA 4DBGA 3KW5B 3TBLD 4XE0A 4M0WA 5HKHA 2QILA 3W1SA 4J3OD 3VXWA 3U4EG 1L6UA 1WZ3A 3KQ4A 2YEPF 2RDHA 1HXYD 4DHZE 1NI2A 4GMVA 4MGIE 4BZAA 1XT9B 2IPKD 4UDUC 4FADA 2C9WB 3RNEC 3AE6B 1Q1OA 2LGDA 1T3QA 2QCZA 2D2QA 2FCNA 2BKRB 1F2RC 3NOBA 3O65B 2N7JA 4ASWC 5DCNA 2J0JA 3Q3MC 4WURA 3P4SB 4WJQA 2V3SA 3RNBC 1U4AA 5BYRA 3BK1A 2RR9A 5C23A 1C77A 3PSEB 4E3CA 4A6QA 1TJEA 3UIOB 2BVCA 1OTRB 2WXQA 1RLFA 2DZIA 4CYEA 2M19A 1FCCC 2J52A 1QT9A 4IWOA 1UD7A 1NENB 5IKCM 2JF5A 4HWIB 2M56B 1Q0WB 4GDLB 1WSPA 5AZGA 4EZLA 3B1LX 1YQ4B 1ZDVA 3VUXA 4F1SA 2KC2A 3WAOA 1LM8B 2RD0A 3A1QB 1GAQB 4AUQC 3TMPB 1N61A 1YJJA 4FBJB 1FRDA 2FCQA 4GGQA 2HD5B 1J19A 2MJ3A 4MM3B 2KJRA 1YJ1A 2IO1B 4CHKA 4KSKC 3R2IA 3AXCA 1GC6A 3PGEA 1LGRA 5DPWA 4PK1A 4RMAA 3ETRA 4WQOB 2N7DA 3NY5A 3BVZA 2NBUA 2SAKA 2HE7A 3QAQA 4DHJB 3IBEA 1KF6B 1JALA 3P1MA 4NJCA 4KKJA 1KOTA 2WQYB 2YVCA 4IDIA 4FLHA 4I6LB 3DPDA 1YJIA 2I1JA 1C9FA 2K39A 4K1RB 2WX1A 3ZJUA 1HA5A 2PVOD 4N9F4 3DHHC 2CR5A 5D2MB 3E9SA 3I5JC 1H8CA 1YX5B 4OVZA 3N9YC 2VZKB 1WXSA 4AP4C 4PS3A 3APDA 3SR6A 4KX6B 4IOIE 1E8XA 1UNSA 4LNFA 2D11A 3RYTA 3VRBB 3AE9B 3I3TB 1T0RC 4XGAB 1WXAA 3ZIMA 1F52A 2Y5BB 2O6VD 3IT4B 3NUHB 3WIMA 4DHJD 1FXTB 2EELA 1KRHA 2LGIA 2WXMA 3A4SC 2A5UA 4PS7A 3VAWA 3QIJA 4MJSB 1C4CA 2LJIA 3AI5A 2UU7A 4LNKA 1C79A 4KIKA 3A9KA 1I4QA 2KJ6A 4MELA 2V0GA 1Q5WB 1JRPA 1IBXB 2MBBB 1HZ5A 1NVID 3V61A 3L13A 4RH6A 4N6EB 2WX0A 1L0VB 1UWXA 2J42A 2N9XA 3IAM1 2KT7A 4LNIA 2RDBC 1FM0D 4WH4A 4ZRQA 1WGGA 1QOBA 1IBXA 3B08A 2MBEA 2L32A 2KWVB 4PS8A 3FAHA 2MCNB 3ZW3A 2G9HD 4XZ4A 2BWES 2IJ0A 4IG7B 2E3TA 1XLOA 1SE9A 1LQBA 2WXFA 3TEXA 2WDTB 3ALBA 3NZ3A 1FEHA 3OLMD 1FCLA 4HVBA 2IY0B 1RAXA 1VD2A 1ZPSA 3H7PA 2XK5A 3CWIA 1F9JA 1RWSA 3HUIA 3PPAA 3PZDA 3PLVA 5CHVC 3Q3OC 3DHGC 2NTTA 4NAWA 2BYEA 4KKIA 2AEHA 1DYQA 1L6VA 1L2NA 4DHZB 3AEAB 2LZ6A 4GOCA 3ZUNA 2EKIA 4W9IA 1HZ6A 5IO9A 1EUVB 1TKYA 4C00A 3Q8EA 1P3QU 2V9HA 1KJTA 2QDFA 2KQSA 2KWUB 5EE0A 4KV2A 2AQ3B 1YN4A 1Y56A 2AX5A 3PRPB 4FULA 4IM0A 2CS4A 4JE3B 1JWUD 4A9AA 1H4RA 3EFCA 2LFIA 3HVZA 4RM9A 1HEZE 1WYWB 4AOFA 4H2AA 5IP4D 2AL3A 2RGFA 5I4DA 4URKA 3DBLB 1ZDXA 1GB1A 2OJRA 2MJDA 3MC9A 2MW5A 4TV3A 5DPSA 2PW9A 1L0YB 1YD8U 3UINB 4ARIA 3PRZA 1MPEA 2LRUA 2Z8LA 4LDTB 3RZWC 1FFVA 2UWQA 2Y5PA 5HFYA 3IVFA 1L5PA 3C8YA 5H8YE 2K0PA 5CTRC 2HJ1A 5BMHA 2ZEQA 1ZP0B 1BXTA 3T9LA 3AM9A 4KGRA 2G45B 3GZNI 1I4HA 1XLQA 3AH7A 1D5MC 1YX6B 2D5GA 3VH3B 4YTMB 1WR6E 3QJZA 2QSDA 1V49A 3PT2B 1TT5B 5BYSA 1WE6A 4JQWC 3I63C 1JROA 2PMVA 3ZRFA 4AS1A 2EKEC 1R4MB 5JHAA 2Y5CA 2LVPA 2KDBA 3H6NA 3ABVB 2G4DB 4OZAA 3NG0A 2ACZB 1RFAA 3JW0X 2LJ5A 5C2TB 5HG2A 1WRDB 2KFKA 5CHWA 3TJPA 3ECIA 2IO3B 3L4PA 4BBNF 2KNBA 2G4SA 1EU3A 2WXHA 3U8ZA 2VRRB 2AQ2B 4G0NB 1PGAA 1L4ZB 1KLUD 2PVGC 4C7YA 1PGBA 1AW7A 3R7RA 1WGDA 1M4VA 2WHIA 2M0XA 3AECB 1WXQA 4B0EA 4FJYA 1SEBD 2JX5A 2XN9C 1WM2A 2VH1A 2KFKB 4L23A 3VR9B 2W55A 4F7ZA 1WX7A 4MM3A 4N59A 4GLSC 3QARA 4IW0A 4GDKB 4CQNA 2BS4B 3SEBA 4K7SA
chains in the Genus database with same CATH topology
1WZ3A 4TQ0A 4II2B 4A3OA 2K8CA 4WWPA 2I1KA 1UZXB 3ZNHB 4DHZE 1NI2A 3ZDMC 3MHSD 4GMVA 4MGIE 1XT9B 1ZGUB 4FADA 1SGHA 3HK0A 1GNUA 2C9WB 2KDEB 3KUZA 3DVGX 1Q1OA 2LGDA 3QQ8B 2LXCA 3EC8A 2BGFA 2V1YA 1V9JA 1WF9A 2PE6B 3AU5A 3PHXB 4LJPB 1R4MI 4HDOA 2D2QA 2FCNA 2JRHA 2K8BA 2KN5A 2BKRB 2R2OA 4BKSA 2KTRB 2FIDA 2CHXA 4IUMB 3NOBA 2DZJA 2V4LA 3DVNV 1LXDA 3O65B 4GU2A 5G2NA 1R4NI 2L76A 3NZSA 4EFOA 4ASWC 5DCNA 1YQBA 2CU1A 2J0JA 2KQ7A 2O6VB 2BYFA 1K8RB 1VCBA 4MGYE 4IM2A 2YLMA 4WJQA 2V3SA 1U4AA 4JLCA 3EECA 3JSVB 2RR9A 5DPTA 5C23A 2KHWB 2KVRA 3PSEB 4E3CA 1XQQA 2C7HA 5TR5A 2IYDB 4M8MA 4DDID 3UIOB 2KLCA 4BOSC 3L0WB 5D6JB 1OTRB 2C7MB 1ISNA 2RPQA 1RLFA 2IO2B 1GUAB 3MTNB 3U7DA 3VTVA 2DZIA 4CYEA 4EUTA 3ZO5B 3V60A 4IWOA 3KVFB 4LJOB 2DYBA 4AJYB 1YIWA 1HE8A 1UD7A 2NBVB 1BT0A 2JF5A 4HWIB 3PHWB 5AZHA 3OAWA 5CX3A 2L8JA 5DPRA 4ANXA 1IP9A 3AU4A 1UBIA 1Q0WB 4GDLB 5AZGA 4EZLA 1V2YA 1WGHA 3B1LX 1J0GA 1WY8A 1WXVA 2L0TA 3CSFA 3VUXA 1V5OA 4F1SA 1V81A 2K6DB 2KC2A 3WAOA 1LM8B 2RD0A 3A1QB 3NHEB 2G3QB 4BVUC 3RT3B 1S1QB 3TMPB 4AUQC 4W9KA 4LDTD 4FBJB 2L7RA 4HDQA 3ENEA 2FCQA 2CHWA 2LVOA 2N4FA 2MRPA 2KWCA 2HD5B 2Z0EB 3PREA 1J19A 3H1UA 3IG3A 4FN2A 1GJZA 2KJRA 3VDZA 1I35A 1YJ1A 2IO1B 2JY6A 1E8ZA 2LGXA 2N7EA 2ZPNA 4CHKA 5J2RA 2L0FA 4KSKC 1X1MA 3S2AA 2KO3A 4GDKA 2C60A 3AXCA 3QC8B 3W1SC 1GC6A 3PGEA 2KXJA 3ML8A 1NBFC 1EF5A 4KZ0A 4NJ7A 5DPWA 3GOEA 1MG8A 4MSQB 4RMAA 3PV1A 1A5RA 4WQOB 2N7DA 3NY5A 3M62B 2NBUA 3Q3FA 2ZPYA 2KD0A 2HE7A 4A3PA 4HPLB 2JT4B 3QAQA 4DHJB 3IBEA 3M3JA 1UH6A 1QZEA 4YL8A 2KTFA 1I42A 3JSVA 2DAFA 1E5WA 1JRUA 2LD9A 2KJHB 4JIOU 3UGBB 3ZDTA 5FR6A 2MSED 4MJSA 1KOTA 4KVGB 3ZNID 2YVCA 4IWPA 2JUOA 2MBQA 3A9KB 3SU8X 1UELA 3L17A 4KIKB 4DDGD 5AEKB 5LXIB 3ZLZA 3ZNGC 4FLHA 5JZEB 4I6LB 4EZJA 3DPDA 3VHTC 2I1JA 3UQBA 3NS8A 2K39A 5J17A 5KHQA 4K1RB 3L10B 2LVQA 2WX1A 1PQSA 2RSUA 4N9F4 3SHQA 2L3ZA 2CR5A 5JH5C 5D2MB 2LASA 4IC7B 2LUEA 1OGWA 5CHFA 3DBLI 3L54A 2A4ZA 1YX5B 1H8CA 3V62A 1WXSA 4AP4C 1NDDA 5IAAC 4PS3A 2W9NA 4IM3A 5GMVA 3APDA 2KDFB 2KKCA 3VH4B 1P0RA 1WIAA 1WR1A 1E8XA 3RYTA 2D11A 4MEMA 3I3TB 2KDIA 3OJ3A 5D94A 4BKSD 4WWOA 1WX8A 1GG3A 1WXAA 3ZIMA 2CHZA 2NCNA 3B0AA 2Y5BB 2O6VD 4NPNA 3VUYA 3WIMA 4DHJD 4WAAA 4ZYNA 1FXTB 1WX9A 3RCZA 2KK8A 4PYUA 2XK5B 3DCGA 4B9KA 2K8HA 4GIVA 4MSMB 2BWFA 2FCSA 2M1MA 3A4SC 2A5UA 4I6NB 4IWQA 4PS7A 3QIJA 3T8MA 2N1WA 4MJSB 3VAWA 4K81A 4EOYA 1IPGA 2C7NB 1E8WA 3L16A 1WMHA 3AI5A 3VFKA 1TTNA 3A1QA 4LCDE 4KIKA 2DZMA 4GB9A 2LXAA 3R7QA 3A9KA 3ZRCA 4ICVA 2PPHA 2KJ6A 4HCPB 4HJKA 4MELA 3UIPB 5IA7A 1Q5WB 5AZFA 2JVCA 2O2VB 1UBQA 2MBBB 3HM3A 4RM8A 4DWFA 3V61A 3L13A 1E90A 4FHJA 3C0RB 2K25A 1TBEA 4XX5A 2XEWA 3VUWA 2M4NA 1ZW7A 1EO6A 2WX0A 3UF8A 2R2QA 1KM7A 2MA9B 1V86A 2ZJDA 2N9XA 3DOWA 2KOXA 3HIZA 2B3AA 4W9EA 4WJPA 2JRIB 2LGYA 3K9PB 2AWTA 1WGGA 2WYQA 1WXMA 4EKUA 3WANA 5BO4B 1WMHB 1D3ZA 3VTUA 3B08A 2DX5B 2BKFA 1V80A 2MBEA 3CSTA 2KWVB 1TGZB 4PS8A 2MCNB 3ZW3A 2Z0DB 2EMSA 4NNJB 4TQ1A 2FNJB 2NPTB 3QX1A 4XZ4A 2BWES 4IG7B 2N9PC 2M8SA 2KTRA 1SE9A 4KDLB 1LQBA 4OVUA 4W9CA 3PS6A 4FJZA 2PEAA 2WDTB 3ALBA 3APCA 1WGRA 1J8CA 3OLMD 4W9DA 4HVBA 2IY0B 2Z59B 1RAXA 2KMCA 2J0MA 3M95A 4W9JA 1VD2A 3H7PB 3RUIB 3H7PA 4ZRJA 3QHTA 4TUUA 2KX3A 2N1VA 2XK5A 4FA6A 1F9JA 4NJ6A 2HTHA 3PPAA 4MGZE 3PZDA 4XC2A 2JXXA 3PLVA 5CHVC 3WAMA 3W1YA 4NAWA 3BY4B 1UGMA 1KLVA 3KYCD 3H7SA 1V6EA 2OOBB 3K9OB 5C1ZA 3MJWA 4JL9A 2BYEA 2AEHA 2GBKA 4PYZA 4ZDVA 3SD5A 5JHBA 4NY0A 1L2NA 2AL6A 2IBIB 2WWZA 4DHZB 1V5TA 1EF1A 3CMMB 3ONSA 4ZRIA 2LZ6A 1GC7A 4GOCA 2M17A 3DDCB 2ZZPB 3X23A 3ZUNA 1OEYJ 4HLEA 1E8YA 3M63B 2PE9A 3IHPC 5J18A 3P2BA 3ZTCA 4WJNA 4EEWA 4W9FA 4W9IA 1OEYA 4OVVA 3NZUA 3U30A 2QHOA 3JVZX 3KUCB 4MH0E 2ASQA 4HXDA 1EUVB 1XD3B 3A33B 2BF8B 4KZCA 1P3QU 3EHVA 1Z2MA 2JPHA 3RZFA 3TL5A 1KJTA 4KSLC 2GMIC 2KQSA 1WM3A 2KWUB 3IFWB 4CO7A 2J0KA 4W9LA 4X57B 4KV2A 2GBNA 2ZNVC 3R3MA 3A9JA 5LLIA 3L08A 2FUHB 3PRMB 1M94A 1WGYA 3PRPB 4AWJA 3HM6X 2ZNVB 3LDZE 3H9DA 3ZNZB 2N9EB 4FULA 4F8CB 2UYZB 2NBWB 4GSWA 4IM0A 2CS4A 2BPSA 2JZZA 1H4RA 3Q3JA 3RD2A 2KMAA 4E71A 4K7WA 4I6PA 5E6NA 3QK0A 3HHMA 2BYVE 4RM9A 1WYWB 2L00B 4AOFA 4DXAB 2GBRA 2REXA 2ZCCA 4MGKE 3V6CB 3X0WA 2AL3A 2KFJA 1L7YA 2RGFA 4HK2A 4URKA 4G50A 1T0YA 2ZCBA 3ZVVA 1RRBA 1WJ4A 2OJRA 4FJVB 3ML9A 4WWNA 4ANUA 1S3SG 3QCAA 2GBJA 5G55A 1AARA 3WALA 3A9JB 5KHOA 1TZ1A 2MW5A 2FCMA 2NR2A 3DBRI 2KZRA 2MLBA 1E7VA 3KUDB 3PLUA 1YD8U 4M0WB 4TV3A 4W9GA 3PRZA 5DPSA 3UINB 3VQIA 2DYMA 2LRUA 3PTFC 4BBNC 2MWSB 4LDTB 3TIXA 2GBMA 1SIFA 2CKHB 3KYDD 3RZWC 5L95C 2LWPA 2JZ3B 2K6QA 4HCNB 3N3KB 4GGQA 2UWQA 4K7UA 2FAZA 2XBBC 2MP2B 4KDIC 1WI0A 3N30A 3IVFA 2ZVOA 5CTRC 1ZKHA 2MBOA 2ZEQA 4TKNA 5L83A 2K1FA 3T9LA 2MQJA 1OQYA 2J7QB 2G45B 3GZNI 4ZRKA 3AULA 4J6IA 3RULA 5LXHA 3TCAA 1YX6B 2AYOB 3VH3B 1WR6E 4BKTA 3QJZA 5EDSA 4G11A 4G3XB 4HPMB 1V49A 3PT2B 1WE6A 4JQWC 4MDKE 1LFDA 2JWZA 3ZRFA 1WFYA 2EKEC 1WE7A 2O6VA 3N32A 5JHAA 3DQVA 2KLGA 2LVPA 3DVNU 2KX0A 2KDBA 2MP2A 3H6NA 1Y8RC 4JGHB 4NAWB 4W9HA 4BFRA 2G4DB 1Z5SB 2D3GA 4B95A 3D32A 3EFUA 2IY1B 1RFAA 3JW0X 4E74A 2PJHA 2LJ5A 4GXBA 4AJWA 1IYFA 3BINA 2LI5A 1WRDB 3QWZB 3A4RA 2KFKA 5CHWA 3TJPA 4NQLB 3ECIA 3WAPA 1WJNA 2IO3B 1WJ6A 4M8NA 4BBNF 3DBSA 5E6OA 2KNBA 2FIFA 3DBHI 2G4SA 3VTWA 4EZKA 3V6EB 3U8ZA 4B6WA 2VRRB 2LRWA 2MX2A 4G0NB 3SDLC 4NQKE 2NVUI 3UQAA 5D7GA 3CF6E 4P7IA 1WH3A 3VVWB 3OJ4B 3R66C 5E6PA 4ANVA 1C1YB 2HJ8A 3R7RA 4DK5A 1WGDA 2EMTA 2M0XA 3KH0A 4II3B 4A20A 2DAJA 2ZVNA 3QA8A 1P98A 4ANWA 4FJYA 4WJOA 3ZTDA 4BOZB 3WA0A 2KC1A 3ZKJC 1WM2A 1G6JA 2KFKB 1WJUA 2DYOA 4ICUA 2DZKA 1C3TA 3LJ3A 4F7ZA 1WX7A 3PVLA 4MM3A 2DHZA 2GOWA 2DENB 2D10A 2L05A 4FHKA 3APFA 2O2VA 1P1AA 3QARA 4GN1A 1P9DU 4IW0A 2IO0B 2MBHA 1WZ0A 2KANA 3JYUA 4GDKB 2NPTA 4DBGA 3DVGY 3KW5B 4K7SA 2C5LC 3TBLD 1E7UA 2IZVB 4BKGA 5HKHA 3W1SA 1CMXB 2D07B 3VXWA 4GDLA 2NS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WZ3 A;  4TQ0 A;  4II2 B;  4A3O A;  2K8C A;  4WWP A;  2I1K A;  1UZX B;  3ZNH B;  4DHZ E;  1NI2 A;  3ZDM C;  3MHS D;  4GMV A;  4MGI E;  1XT9 B;  1ZGU B;  4FAD A;  1SGH A;  3HK0 A;  1GNU A;  2C9W B;  2KDE B;  3KUZ A;  3DVG X;  1Q1O A;  2LGD A;  3QQ8 B;  2LXC A;  3EC8 A;  2BGF A;  2V1Y A;  1V9J A;  1WF9 A;  2PE6 B;  3AU5 A;  3PHX B;  4LJP B;  1R4M I;  4HDO A;  2D2Q A;  2FCN A;  2JRH A;  2K8B A;  2KN5 A;  2BKR B;  2R2O A;  4BKS A;  2KTR B;  2FID A;  2CHX A;  4IUM B;  3NOB A;  2DZJ A;  2V4L A;  3DVN V;  1LXD A;  3O65 B;  4GU2 A;  5G2N A;  1R4N I;  2L76 A;  3NZS A;  4EFO A;  4ASW C;  5DCN A;  1YQB A;  2CU1 A;  2J0J A;  2KQ7 A;  2O6V B;  2BYF A;  1K8R B;  1VCB A;  4MGY E;  4IM2 A;  2YLM A;  4WJQ A;  2V3S A;  1U4A A;  4JLC A;  3EEC A;  3JSV B;  2RR9 A;  5DPT A;  5C23 A;  2KHW B;  2KVR A;  3PSE B;  4E3C A;  1XQQ A;  2C7H A;  5TR5 A;  2IYD B;  4M8M A;  4DDI D;  3UIO B;  2KLC A;  4BOS C;  3L0W B;  5D6J B;  1OTR B;  2C7M B;  1ISN A;  2RPQ A;  1RLF A;  2IO2 B;  1GUA B;  3MTN B;  3U7D A;  3VTV A;  2DZI A;  4CYE A;  4EUT A;  3ZO5 B;  3V60 A;  4IWO A;  3KVF B;  4LJO B;  2DYB A;  4AJY B;  1YIW A;  1HE8 A;  1UD7 A;  2NBV B;  1BT0 A;  2JF5 A;  4HWI B;  3PHW B;  5AZH A;  3OAW A;  5CX3 A;  2L8J A;  5DPR A;  4ANX A;  1IP9 A;  3AU4 A;  1UBI A;  1Q0W B;  4GDL B;  5AZG A;  4EZL A;  1V2Y A;  1WGH A;  3B1L X;  1J0G A;  1WY8 A;  1WXV A;  2L0T A;  3CSF A;  3VUX A;  1V5O A;  4F1S A;  1V81 A;  2K6D B;  2KC2 A;  3WAO A;  1LM8 B;  2RD0 A;  3A1Q B;  3NHE B;  2G3Q B;  4BVU C;  3RT3 B;  1S1Q B;  3TMP B;  4AUQ C;  4W9K A;  4LDT D;  4FBJ B;  2L7R A;  4HDQ A;  3ENE A;  2FCQ A;  2CHW A;  2LVO A;  2N4F A;  2MRP A;  2KWC A;  2HD5 B;  2Z0E B;  3PRE A;  1J19 A;  3H1U A;  3IG3 A;  4FN2 A;  1GJZ A;  2KJR A;  3VDZ A;  1I35 A;  1YJ1 A;  2IO1 B;  2JY6 A;  1E8Z A;  2LGX A;  2N7E A;  2ZPN A;  4CHK A;  5J2R A;  2L0F A;  4KSK C;  1X1M A;  3S2A A;  2KO3 A;  4GDK A;  2C60 A;  3AXC A;  3QC8 B;  3W1S C;  1GC6 A;  3PGE A;  2KXJ A;  3ML8 A;  1NBF C;  1EF5 A;  4KZ0 A;  4NJ7 A;  5DPW A;  3GOE A;  1MG8 A;  4MSQ B;  4RMA A;  3PV1 A;  1A5R A;  4WQO B;  2N7D A;  3NY5 A;  3M62 B;  2NBU A;  3Q3F A;  2ZPY A;  2KD0 A;  2HE7 A;  4A3P A;  4HPL B;  2JT4 B;  3QAQ A;  4DHJ B;  3IBE A;  3M3J A;  1UH6 A;  1QZE A;  4YL8 A;  2KTF A;  1I42 A;  3JSV A;  2DAF A;  1E5W A;  1JRU A;  2LD9 A;  2KJH B;  4JIO U;  3UGB B;  3ZDT A;  5FR6 A;  2MSE D;  4MJS A;  1KOT A;  4KVG B;  3ZNI D;  2YVC A;  4IWP A;  2JUO A;  2MBQ A;  3A9K B;  3SU8 X;  1UEL A;  3L17 A;  4KIK B;  4DDG D;  5AEK B;  5LXI B;  3ZLZ A;  3ZNG C;  4FLH A;  5JZE B;  4I6L B;  4EZJ A;  3DPD A;  3VHT C;  2I1J A;  3UQB A;  3NS8 A;  2K39 A;  5J17 A;  5KHQ A;  4K1R B;  3L10 B;  2LVQ A;  2WX1 A;  1PQS A;  2RSU A;  4N9F 4;  3SHQ A;  2L3Z A;  2CR5 A;  5JH5 C;  5D2M B;  2LAS A;  4IC7 B;  2LUE A;  1OGW A;  5CHF A;  3DBL I;  3L54 A;  2A4Z A;  1YX5 B;  1H8C A;  3V62 A;  1WXS A;  4AP4 C;  1NDD A;  5IAA C;  4PS3 A;  2W9N A;  4IM3 A;  5GMV A;  3APD A;  2KDF B;  2KKC A;  3VH4 B;  1P0R A;  1WIA A;  1WR1 A;  1E8X A;  3RYT A;  2D11 A;  4MEM A;  3I3T B;  2KDI A;  3OJ3 A;  5D94 A;  4BKS D;  4WWO A;  1WX8 A;  1GG3 A;  1WXA A;  3ZIM A;  2CHZ A;  2NCN A;  3B0A A;  2Y5B B;  2O6V D;  4NPN A;  3VUY A;  3WIM A;  4DHJ D;  4WAA A;  4ZYN A;  1FXT B;  1WX9 A;  3RCZ A;  2KK8 A;  4PYU A;  2XK5 B;  3DCG A;  4B9K A;  2K8H A;  4GIV A;  4MSM B;  2BWF A;  2FCS A;  2M1M A;  3A4S C;  2A5U A;  4I6N B;  4IWQ A;  4PS7 A;  3QIJ A;  3T8M A;  2N1W A;  4MJS B;  3VAW A;  4K81 A;  4EOY A;  1IPG A;  2C7N B;  1E8W A;  3L16 A;  1WMH A;  3AI5 A;  3VFK A;  1TTN A;  3A1Q A;  4LCD E;  4KIK A;  2DZM A;  4GB9 A;  2LXA A;  3R7Q A;  3A9K A;  3ZRC A;  4ICV A;  2PPH A;  2KJ6 A;  4HCP B;  4HJK A;  4MEL A;  3UIP B;  5IA7 A;  1Q5W B;  5AZF A;  2JVC A;  2O2V B;  1UBQ A;  2MBB B;  3HM3 A;  4RM8 A;  4DWF A;  3V61 A;  3L13 A;  1E90 A;  4FHJ A;  3C0R B;  2K25 A;  1TBE A;  4XX5 A;  2XEW A;  3VUW A;  2M4N A;  1ZW7 A;  1EO6 A;  2WX0 A;  3UF8 A;  2R2Q A;  1KM7 A;  2MA9 B;  1V86 A;  2ZJD A;  2N9X A;  3DOW A;  2KOX A;  3HIZ A;  2B3A A;  4W9E A;  4WJP A;  2JRI B;  2LGY A;  3K9P B;  2AWT A;  1WGG A;  2WYQ A;  1WXM A;  4EKU A;  3WAN A;  5BO4 B;  1WMH B;  1D3Z A;  3VTU A;  3B08 A;  2DX5 B;  2BKF A;  1V80 A;  2MBE A;  3CST A;  2KWV B;  1TGZ B;  4PS8 A;  2MCN B;  3ZW3 A;  2Z0D B;  2EMS A;  4NNJ B;  4TQ1 A;  2FNJ B;  2NPT B;  3QX1 A;  4XZ4 A;  2BWE S;  4IG7 B;  2N9P C;  2M8S A;  2KTR A;  1SE9 A;  4KDL B;  1LQB A;  4OVU A;  4W9C A;  3PS6 A;  4FJZ A;  2PEA A;  2WDT B;  3ALB A;  3APC A;  1WGR A;  1J8C A;  3OLM D;  4W9D A;  4HVB A;  2IY0 B;  2Z59 B;  1RAX A;  2KMC A;  2J0M A;  3M95 A;  4W9J A;  1VD2 A;  3H7P B;  3RUI B;  3H7P A;  4ZRJ A;  3QHT A;  4TUU A;  2KX3 A;  2N1V A;  2XK5 A;  4FA6 A;  1F9J A;  4NJ6 A;  2HTH A;  3PPA A;  4MGZ E;  3PZD A;  4XC2 A;  2JXX A;  3PLV A;  5CHV C;  3WAM A;  3W1Y A;  4NAW A;  3BY4 B;  1UGM A;  1KLV A;  3KYC D;  3H7S A;  1V6E A;  2OOB B;  3K9O B;  5C1Z A;  3MJW A;  4JL9 A;  2BYE A;  2AEH A;  2GBK A;  4PYZ A;  4ZDV A;  3SD5 A;  5JHB A;  4NY0 A;  1L2N A;  2AL6 A;  2IBI B;  2WWZ A;  4DHZ B;  1V5T A;  1EF1 A;  3CMM B;  3ONS A;  4ZRI A;  2LZ6 A;  1GC7 A;  4GOC A;  2M17 A;  3DDC B;  2ZZP B;  3X23 A;  3ZUN A;  1OEY J;  4HLE A;  1E8Y A;  3M63 B;  2PE9 A;  3IHP C;  5J18 A;  3P2B A;  3ZTC A;  4WJN A;  4EEW A;  4W9F A;  4W9I A;  1OEY A;  4OVV A;  3NZU A;  3U30 A;  2QHO A;  3JVZ X;  3KUC B;  4MH0 E;  2ASQ A;  4HXD A;  1EUV B;  1XD3 B;  3A33 B;  2BF8 B;  4KZC A;  1P3Q U;  3EHV A;  1Z2M A;  2JPH A;  3RZF A;  3TL5 A;  1KJT A;  4KSL C;  2GMI C;  2KQS A;  1WM3 A;  2KWU B;  3IFW B;  4CO7 A;  2J0K A;  4W9L A;  4X57 B;  4KV2 A;  2GBN A;  2ZNV C;  3R3M A;  3A9J A;  5LLI A;  3L08 A;  2FUH B;  3PRM B;  1M94 A;  1WGY A;  3PRP B;  4AWJ A;  3HM6 X;  2ZNV B;  3LDZ E;  3H9D A;  3ZNZ B;  2N9E B;  4FUL A;  4F8C B;  2UYZ B;  2NBW B;  4GSW A;  4IM0 A;  2CS4 A;  2BPS A;  2JZZ A;  1H4R A;  3Q3J A;  3RD2 A;  2KMA A;  4E71 A;  4K7W A;  4I6P A;  5E6N A;  3QK0 A;  3HHM A;  2BYV E;  4RM9 A;  1WYW B;  2L00 B;  4AOF A;  4DXA B;  2GBR A;  2REX A;  2ZCC A;  4MGK E;  3V6C B;  3X0W A;  2AL3 A;  2KFJ A;  1L7Y A;  2RGF A;  4HK2 A;  4URK A;  4G50 A;  1T0Y A;  2ZCB A;  3ZVV A;  1RRB A;  1WJ4 A;  2OJR A;  4FJV B;  3ML9 A;  4WWN A;  4ANU A;  1S3S G;  3QCA A;  2GBJ A;  5G55 A;  1AAR A;  3WAL A;  3A9J B;  5KHO A;  1TZ1 A;  2MW5 A;  2FCM A;  2NR2 A;  3DBR I;  2KZR A;  2MLB A;  1E7V A;  3KUD B;  3PLU A;  1YD8 U;  4M0W B;  4TV3 A;  4W9G A;  3PRZ A;  5DPS A;  3UIN B;  3VQI A;  2DYM A;  2LRU A;  3PTF C;  4BBN C;  2MWS B;  4LDT B;  3TIX A;  2GBM A;  1SIF A;  2CKH B;  3KYD D;  3RZW C;  5L95 C;  2LWP A;  2JZ3 B;  2K6Q A;  4HCN B;  3N3K B;  4GGQ A;  2UWQ A;  4K7U A;  2FAZ A;  2XBB C;  2MP2 B;  4KDI C;  1WI0 A;  3N30 A;  3IVF A;  2ZVO A;  5CTR C;  1ZKH A;  2MBO A;  2ZEQ A;  4TKN A;  5L83 A;  2K1F A;  3T9L A;  2MQJ A;  1OQY A;  2J7Q B;  2G45 B;  3GZN I;  4ZRK A;  3AUL A;  4J6I A;  3RUL A;  5LXH A;  3TCA A;  1YX6 B;  2AYO B;  3VH3 B;  1WR6 E;  4BKT A;  3QJZ A;  5EDS A;  4G11 A;  4G3X B;  4HPM B;  1V49 A;  3PT2 B;  1WE6 A;  4JQW C;  4MDK E;  1LFD A;  2JWZ A;  3ZRF A;  1WFY A;  2EKE C;  1WE7 A;  2O6V A;  3N32 A;  5JHA A;  3DQV A;  2KLG A;  2LVP A;  3DVN U;  2KX0 A;  2KDB A;  2MP2 A;  3H6N A;  1Y8R C;  4JGH B;  4NAW B;  4W9H A;  4BFR A;  2G4D B;  1Z5S B;  2D3G A;  4B95 A;  3D32 A;  3EFU A;  2IY1 B;  1RFA A;  3JW0 X;  4E74 A;  2PJH A;  2LJ5 A;  4GXB A;  4AJW A;  1IYF A;  3BIN A;  2LI5 A;  1WRD B;  3QWZ B;  3A4R A;  2KFK A;  5CHW A;  3TJP A;  4NQL B;  3ECI A;  3WAP A;  1WJN A;  2IO3 B;  1WJ6 A;  4M8N A;  4BBN F;  3DBS A;  5E6O A;  2KNB A;  2FIF A;  3DBH I;  2G4S A;  3VTW A;  4EZK A;  3V6E B;  3U8Z A;  4B6W A;  2VRR B;  2LRW A;  2MX2 A;  4G0N B;  3SDL C;  4NQK E;  2NVU I;  3UQA A;  5D7G A;  3CF6 E;  4P7I A;  1WH3 A;  3VVW B;  3OJ4 B;  3R66 C;  5E6P A;  4ANV A;  1C1Y B;  2HJ8 A;  3R7R A;  4DK5 A;  1WGD A;  2EMT A;  2M0X A;  3KH0 A;  4II3 B;  4A20 A;  2DAJ A;  2ZVN A;  3QA8 A;  1P98 A;  4ANW A;  4FJY A;  4WJO A;  3ZTD A;  4BOZ B;  3WA0 A;  2KC1 A;  3ZKJ C;  1WM2 A;  1G6J A;  2KFK B;  1WJU A;  2DYO A;  4ICU A;  2DZK A;  1C3T A;  3LJ3 A;  4F7Z A;  1WX7 A;  3PVL A;  4MM3 A;  2DHZ A;  2GOW A;  2DEN B;  2D10 A;  2L05 A;  4FHK A;  3APF A;  2O2V A;  1P1A A;  3QAR A;  4GN1 A;  1P9D U;  4IW0 A;  2IO0 B;  2MBH A;  1WZ0 A;  2KAN A;  3JYU A;  4GDK B;  2NPT A;  4DBG A;  3DVG Y;  3KW5 B;  4K7S A;  2C5L C;  3TBL D;  1E7U A;  2IZV B;  4BKG A;  5HKH A;  3W1S A;  1CMX B;  2D07 B;  3VXW A;  4GDL A;  2NS5 A; 
#chains in the Genus database with same CATH topology
 4II2 B;  4A3O A;  3GE8 C;  4REZ A;  2I1K A;  3Q2A C;  4RF1 A;  3ZDM C;  3MHS D;  1FFU A;  3DVG X;  2MEK A;  3PHX B;  2PE6 B;  1WF9 A;  3AU5 A;  4LJP B;  2K5P A;  4HDO A;  4WWM A;  4ZRP A;  2R2O A;  4IUM B;  2DZJ A;  5G2N A;  1AYF A;  1YQB A;  2CU1 A;  2KQ7 A;  4MGY E;  3PZ8 A;  2BYF A;  4JLC A;  3JSV B;  2KHW B;  1RYJ A;  2KVR A;  1KFY B;  2C7H A;  5TR5 A;  1HTO A;  1VZ8 A;  2KLC A;  4BOS C;  4NZL B;  3L0W B;  5D6J B;  2C7M B;  1ISN A;  2KN4 A;  2RPQ A;  3RFZ B;  2IGH A;  3KVF B;  1HE8 A;  2J4X A;  2NBV B;  1K51 A;  2W3S A;  5AZH A;  3OAW A;  5CX3 A;  1TYG B;  1IP9 A;  1UBI A;  1GPX A;  3RNC C;  1WY8 A;  2MH7 A;  2K6D B;  4XDC A;  4LNO A;  1S1Q B;  1SE2 A;  2CHW A;  2N4F A;  5AUK A;  4FXC A;  2JY6 A;  1E8Z A;  2N7E A;  4PT5 A;  1X1M A;  3S2A A;  2KO3 A;  4GDK A;  2C60 A;  1NBF C;  4NJ7 A;  1C78 A;  1MG8 A;  4MSQ B;  4RGO S;  3UI3 A;  1KH0 A;  3Q3F A;  2ZPY A;  2KD0 A;  4A3P A;  1IGC A;  3W2D A;  3HRD D;  4YL8 A;  1NYR A;  3TSS A;  2KTF A;  3MFG A;  2H89 B;  1I42 A;  2DAF A;  3FIL B;  1D5X C;  2LD9 A;  3UGB B;  3R8B A;  1TS5 A;  2MSE D;  1SXT A;  4ARC A;  1FXA A;  3ZNI D;  1STE A;  2N9K A;  2JUO A;  1UEL A;  3ZLZ A;  3AEF B;  3U2S C;  1R4N B;  4HPP A;  3VHT C;  1NI3 A;  3UQB A;  3EA6 A;  1PQS A;  2ONQ A;  4HKZ E;  4AQ7 A;  1I4R A;  1E9M A;  1JWA D;  4MAC A;  3SFD B;  2DNF A;  5JH5 C;  5G5H A;  2N0S B;  5CHF A;  1JWB D;  1R7S A;  1LO5 D;  2V3P A;  2HDE A;  4RFB A;  3BZD B;  1NDD A;  4D2K A;  2W9N A;  5GMV A;  2KDM A;  1FMA D;  2KDF B;  2KKC A;  1WIA A;  2BS3 B;  4HJG E;  2INN E;  4R3D A;  3NS1 A;  2KDI A;  2WU5 B;  1WX8 A;  1GG3 A;  4WAA A;  1N5W A;  4ZYN A;  2WLB A;  3NVZ A;  1WX9 A;  3VR8 B;  2BWF A;  2FCS A;  2M1M A;  4IWQ A;  3ZGZ A;  4EOY A;  3E56 A;  3N1Y C;  4K81 A;  3AV8 A;  2C7N B;  1E8W A;  3L16 A;  1WMH A;  1FNV A;  4HRO A;  1QF6 A;  3AE1 B;  4HJK A;  5IA7 A;  5AZF A;  2WS3 B;  1TBE A;  5EE3 A;  1YN3 A;  3PO0 A;  1ZW7 A;  3MC8 A;  4RGT A;  2MA9 B;  2ZJD A;  2B3A A;  5C3J B;  2L83 A;  1ZOY B;  2ZW0 A;  4LLG M;  2RPV A;  3K9P B;  1WXM A;  3IXS A;  3WAN A;  5BO4 B;  1SJE D;  2BKF A;  1V80 A;  3CST A;  2EMS A;  3AEG B;  4TQ1 A;  2FNJ B;  2NPT B;  3QX1 A;  4XWW A;  4KDL B;  4OVU A;  5J17 A;  4OZB A;  4FJZ A;  2PEA A;  1WGR A;  3MP9 A;  2B76 B;  4YXD B;  2WDQ B;  4W9J A;  3H7P B;  2MHJ A;  4ITK A;  4ZRJ A;  4FA6 A;  3NVW A;  2HTH A;  1PGX A;  2LUM A;  1UF0 A;  3BY4 B;  1JWS D;  1BUI C;  3H7S A;  2OOB B;  3K9O B;  1IUE A;  5JHB A;  4NY0 A;  1TS4 A;  2RDG A;  1B9R A;  2IBI B;  1TS2 A;  3ONS A;  4ZRI A;  4K3C A;  2M17 A;  2ZZP B;  3X23 A;  5BYQ A;  1OEY J;  4ZOH C;  3IHP C;  5J18 A;  3P2B A;  3ZTC A;  1V1P B;  1FRR A;  4C4V A;  4W9F A;  2PTL A;  3R2T A;  4OVV A;  3W5U B;  3U30 A;  1N5X A;  4MH0 E;  2ASQ A;  4HXD A;  2BF8 B;  3RNA C;  4KZC A;  3P42 A;  3EHV A;  1Z2M A;  4KSL C;  2PKO A;  4CO7 A;  4W9L A;  2KMM A;  1N63 A;  3A9J A;  4RGM A;  2FUH B;  1M94 A;  3NVV A;  1RFK A;  4F8C B;  2UYZ B;  3AED B;  2BPS A;  2JWU A;  1L4D B;  4K7W A;  4YSZ B;  3QK0 A;  3HHM A;  4XYC A;  1FNW A;  4MGK E;  1D5Z C;  3Q8F A;  3V6C B;  2KFJ A;  1L7Y A;  3I57 A;  1HQR D;  5EE1 A;  4G50 A;  1T0Y A;  3ZVV A;  2BTE A;  4FJV B;  3ML9 A;  4WWN A;  4ANU A;  2GBJ A;  1AAR A;  2KAC A;  2NR2 A;  4BKT A;  4W9G A;  3DHI C;  1VZ7 A;  2LHD A;  1CK1 A;  2CKH B;  5L95 C;  4HCN B;  4QAY A;  3AEB B;  3N3K B;  2XBB C;  1FXI A;  4KDI C;  1VZ6 A;  2CJN A;  1E0Z A;  2ZVO A;  4RF0 A;  2LEK A;  2CU3 A;  4WAF A;  2MQJ A;  2J7Q B;  3P4P B;  3RN9 C;  4ZRK A;  2OJW A;  1PFD A;  3AUL A;  4USA A;  4OZC A;  4G3X B;  3RMK C;  1LFD A;  3FKY A;  1WFY A;  2W3R A;  3N32 A;  3WCQ A;  3T3O A;  3DQV A;  2KLG A;  3DVN U;  2MP2 A;  1Y8R C;  4JGH B;  4W9H A;  2W82 A;  2D3G A;  3EFU A;  4E74 A;  4KGT A;  1IYF A;  1MHX A;  3A4R A;  4NQL B;  1WJN A;  1WJ6 A;  3DBS A;  4DQO C;  2DBY A;  3VTW A;  4EZK A;  2LRW A;  2QIE B;  1DOX A;  2MX2 A;  4YT0 B;  2NVU I;  3BYT B;  5GXG B;  3PZ7 A;  3W5V B;  2HJ8 A;  4ACF A;  2DAJ A;  1T0Q C;  2OHF A;  1SB3 C;  3GP7 A;  4BOZ B;  2KC1 A;  1B1Z A;  3ZKJ C;  1N6Z A;  2DHZ A;  2D10 A;  3GE3 C;  2O2V A;  3TEY A;  1P1A A;  4GN1 A;  1P9D U;  4B0M A;  2WXO A;  3H8H A;  1WZ0 A;  1OQQ A;  4HEA 1;  4JWU C;  3DVG Y;  1E7U A;  2IZV B;  4BKG A;  3BVG A;  3DWM A;  1SBB B;  1CMX B;  3OG5 A;  3HVD A;  2NS5 A;  1RM6 C;  2LMC A;  2K8C A;  4WWP A;  1V97 A;  5G5G A;  3ZNH B;  1T0S C;  1QOF A;  1ZGU B;  3HK0 A;  3CIR B;  1GNU A;  1K50 A;  4IKG A;  2LXC A;  2BGF A;  2V1Y A;  1R4M I;  2SEB D;  2JRH A;  2KN5 A;  3ZXR A;  2KTR B;  2FID A;  2CHX A;  2IGD A;  2V4L A;  1LXD A;  3DVN V;  3ZJT A;  4GU2 A;  1XF5 L;  2L76 A;  4EFO A;  2I2Y A;  2JYT A;  2YLM A;  3EEC A;  1YNT E;  5BMI A;  2M0A A;  1SE3 A;  1F1H A;  2IYD B;  1TKG A;  3VTV A;  2IO2 B;  1VDV A;  4EUT A;  4O1N A;  1XCT L;  2DYB A;  4LJO B;  1I4P A;  1YIW A;  4AJY B;  1E10 A;  1BT0 A;  4P1B C;  3PHW B;  2L8J A;  3DBR B;  2D3C A;  1V2Y A;  1WGH A;  3C19 A;  2L0T A;  1V81 A;  5AUI A;  3NHE B;  3N1X C;  4L1B A;  2G3Q B;  4BVU C;  3RT3 B;  4RGN A;  3T3N A;  4LDT D;  2L7R A;  4FN2 A;  2MRP A;  2KWC A;  2GI9 A;  3IG3 A;  2IDY A;  1C4P A;  2LGX A;  1J7A A;  4LNN A;  4KZ0 A;  3GOE A;  3BK2 A;  5E6J A;  1V1P A;  3B2F A;  3Q8A A;  4MT5 A;  3M3J A;  3W9C B;  1QZE A;  1E5W A;  2JXT A;  4JIO U;  3ZDT A;  4P6V F;  5FR6 A;  4KVG B;  4IWP A;  2MBQ A;  4DDG D;  4KIK B;  5AEK B;  5LXI B;  2KAJ A;  3ZNG C;  4K3B A;  2QEJ C;  3NS8 A;  1ZXI A;  3L10 B;  3LYY A;  2BB5 A;  3MHZ A;  1OGW A;  3DBL I;  1E6E B;  2A4Z A;  4JWS C;  3V62 A;  2RMM A;  5IAA C;  4IM3 A;  5FK9 C;  3Q3N C;  3BVM A;  2WDR B;  3VH4 B;  2KWD A;  4HKQ A;  1CJE A;  3OJ3 A;  4WWO A;  4A8X C;  3GZN B;  2NCN A;  2GLS A;  3B0A A;  2D3A A;  4NPN A;  2K22 A;  2VZK D;  3RCZ A;  2KK8 A;  4PYU A;  3DCG A;  2K8H A;  4GIV A;  2QMT A;  5EDS A;  2J53 A;  4I6N B;  2LHE A;  3T8M A;  5IN7 A;  1CZP A;  4M02 A;  3A1Q A;  2DZM A;  3R7Q A;  3ZRC A;  3AB5 A;  3UIP B;  1UGJ A;  2JVC A;  1UBQ A;  3HM3 A;  4DWF A;  1ESF A;  1D6E C;  3P63 A;  4XX5 A;  2XEW A;  2WXP A;  4US9 A;  3BII D;  1EO6 A;  2R2Q A;  1KM7 A;  3Q8B A;  4WJP A;  1NYQ A;  3B9J A;  2BB6 A;  1P7E A;  2JRI B;  4Q2J A;  1DGJ A;  2AWT A;  1D4B A;  4EKU A;  1WMH B;  1D3Z A;  3VTU A;  1TGZ B;  3DBH B;  2Z0D B;  1I4G A;  2HTM E;  2N9P C;  2BS2 B;  2M8S A;  4W9C A;  1F77 A;  1J8C A;  3APC A;  4ZYS A;  4W9D A;  2Z59 B;  2KMC A;  2J0M A;  3M95 A;  3RUI B;  3QHT A;  2KX3 A;  2N1V A;  3AN1 A;  4NJ6 A;  4MGZ E;  4YTP B;  2JXX A;  4WQM A;  2QC8 A;  2GRI A;  4MH8 A;  1UGM A;  2WXJ A;  3KYC D;  1V6E A;  5C1Z A;  3MJW A;  4PYZ A;  1MJD A;  3ZXV A;  1V5T A;  1GC7 A;  2XNA C;  4HLE A;  5BMG A;  2PE9 A;  4WJN A;  4EEW A;  1OEY A;  3NZU A;  5HHD G;  2Q5W D;  2FBW B;  3RZF A;  2JPH A;  5D3I B;  1P7F A;  4KGS A;  1WM3 A;  3IFW B;  5FKA C;  2J0K A;  2K9X A;  1ET9 A;  2GBN A;  3R3M A;  2DWQ A;  5LLI A;  1XCQ L;  1WGY A;  5JXV A;  3HM6 X;  2JU6 X;  2ZNV B;  3ZNZ B;  2OED A;  2N9E B;  2WDV B;  2NBW B;  4GSW A;  4A55 A;  2JZZ A;  3Q3J A;  3RD2 A;  2KMA A;  4M00 A;  3GS2 A;  5E6N A;  2BT6 A;  2BYV E;  1OQR A;  2L00 B;  4DXA B;  1PUT A;  2ZCC A;  3X0W A;  3AMZ A;  1IGD A;  4HK2 A;  2E6X A;  2KYW A;  1RRB A;  4ZHP A;  2WXI A;  2K3U A;  4S17 A;  2WNM A;  5G55 A;  1Q10 A;  4P1C C;  3A9J B;  5KHO A;  1TZ1 A;  2FCM A;  3DBR I;  2KZR A;  2MLB A;  1E7V A;  3KUD B;  3PLU A;  2W54 A;  2DYM A;  1JWM D;  4BBN C;  1SIJ A;  1ZUD 2;  2GBM A;  3KYD D;  2JZ3 B;  4C4V B;  5LNK 1;  4K7U A;  2AQ1 B;  2WXR A;  2MP2 B;  1PDX A;  3N30 A;  2MBO A;  2K1F A;  1OQY A;  2JYE A;  1CQV A;  3RUL A;  5LXH A;  3TCA A;  1YMH E;  3AEE B;  4G11 A;  4OHJ A;  1TY2 A;  4MDK E;  2G1E A;  4L2Y A;  1WE7 A;  2O6V A;  1A70 A;  4LK0 M;  2KX0 A;  4BFR A;  4NAW B;  4C56 C;  4B95 A;  1TS3 A;  1F2R I;  5T8I A;  3ZYY X;  4C7Z A;  2PJH A;  2FUG 1;  3RPF C;  3BIN A;  3QWZ B;  2PLP A;  1SJH D;  3WAP A;  4C80 A;  4M8N A;  2BW2 A;  2WXK A;  5E6O A;  2FIF A;  3DBH I;  3V3X A;  3IT6 B;  4B6W A;  4BAX A;  4NQK E;  1PYW D;  2WXG A;  1WH3 A;  3OJ4 B;  3EUB 2;  3KH0 A;  2LGS A;  4WJO A;  3ZTD A;  1ET6 A;  3MJ5 A;  3N20 C;  2CJO A;  1G6J A;  1WJU A;  2DYO A;  3NJT A;  5IOI A;  1MVK A;  1C3T A;  2X38 A;  3LJ3 A;  3FC4 A;  1N60 A;  2DEN B;  2L05 A;  4FHK A;  1SF0 A;  3LB8 C;  2MBH A;  2KAN A;  2NPT A;  2C5L C;  4EE2 A;  1TY0 A;  2D07 B;  4GDL A;  5TSS A;  2KQ4 X;  4TQ0 A;  1K52 A;  1UZX B;  3AE4 B;  3EGR A;  1DOI A;  4LTU A;  2ON8 A;  1V8C A;  1SGH A;  1ZE3 D;  2KDE B;  3KUZ A;  3KWL A;  3AE2 B;  1ACC A;  4YTN B;  3QQ8 B;  3EC8 A;  1V9J A;  1WWT A;  1FO4 A;  3OWE B;  1MFW A;  2K8B A;  4BKS A;  1YN5 A;  3Q8C A;  1KTK A;  1R4N I;  3NZS A;  2O6V B;  1MI0 A;  1K8R B;  1VCB A;  2MJE A;  4IM2 A;  3Q6B A;  5DPT A;  2WU2 B;  1XQQ A;  4XDD A;  4M8M A;  4DDI D;  3ZJV A;  1YOV B;  3U7D A;  4JX1 C;  1V1O A;  1GUA B;  3MTN B;  4YWG G;  3ZO5 B;  3V60 A;  1C76 A;  3VRA B;  1T5X D;  1BML C;  5DPR A;  4ANX A;  3AU4 A;  1FIQ A;  1J0G A;  3Q69 A;  1XLP A;  2VH2 A;  1WXV A;  3CSF A;  1V5O A;  4OW0 A;  2GB1 A;  2D3B A;  3I9V 1;  3ZQ4 A;  4TMA B;  4W9K A;  4HDQ A;  3ENE A;  2LVO A;  2Z0E B;  3PRE A;  3H1U A;  1GJZ A;  1I35 A;  3VDZ A;  3IAS 1;  2ZPN A;  5J2R A;  2L0F A;  4N58 A;  1QQR A;  1XXG A;  3W1S C;  3QC8 B;  4HRS A;  2KXJ A;  3ML8 A;  3RNF C;  1EF5 A;  1L0X B;  2BYT A;  3TUO A;  3TEW A;  1I4X A;  3PV1 A;  1A5R A;  1VRA B;  3M62 B;  1AWD A;  1WGK A;  4HPL B;  3N1Z C;  2JT4 B;  1UH6 A;  1YQ3 B;  3JSV A;  1JRU A;  2KJH B;  4MJS A;  1MHH E;  3J9C A;  3A9K B;  2H88 B;  3P4R B;  3RI7 C;  3SU8 X;  3L17 A;  5JZE B;  5FR3 A;  4EZJ A;  4YSX B;  3NRZ A;  1SE4 A;  5KHQ A;  5EE9 A;  3U7Z A;  1ENF A;  2LVQ A;  1NEK B;  2RSU A;  1KLG D;  3SHQ A;  2WXN A;  2L3Z A;  2LAS A;  4IC7 B;  3KWV A;  2LUE A;  2JZP A;  3L54 A;  1UUP A;  1XLN A;  4YSY B;  1SSN A;  1P0R A;  1WR1 A;  4MEM A;  2WGS A;  1J7B A;  5D94 A;  1EM7 A;  4BKS D;  2I38 A;  2WXL A;  2CHZ A;  2QJL A;  3VUY A;  1GB4 A;  1WYG A;  1TZO A;  2XK5 B;  1JML A;  4B9K A;  4MSM B;  2N1W A;  1IPG A;  1XO3 A;  3VFK A;  2TSS A;  1TTN A;  1MG4 A;  4LCD E;  4GB9 A;  2LXA A;  4ICV A;  2PPH A;  4HCP B;  2JQR B;  4P16 A;  2O2V B;  4RM8 A;  1GOZ A;  3BWU D;  1C4A A;  4WIP A;  2N9L A;  1QKZ A;  1E90 A;  4FHJ A;  1E7P B;  2Y3A A;  3C0R B;  3AE3 B;  2K25 A;  2L1A A;  5D3D A;  3VUW A;  2M4N A;  3UF8 A;  1QOG A;  3V05 A;  1V86 A;  3DOW A;  2KOX A;  1VJK A;  2INP E;  3HIZ A;  1ZXH A;  2X8X X;  4W9E A;  1WRI A;  1J7C A;  1VLB A;  1JW9 D;  2KVZ A;  2LGY A;  2WYQ A;  2INC C;  1JQ4 A;  1FPY A;  2DX5 B;  4NNJ B;  3Q14 C;  2JSV X;  4A90 A;  2KTR A;  1QIL A;  3PS6 A;  1FNU A;  1EWY C;  1OFF A;  4TUU A;  4XC2 A;  3LXF A;  3KLS X;  3WAM A;  3W1Y A;  3NVY A;  3RNG C;  4US8 A;  1KLV A;  2NTS A;  4JL9 A;  2GBK A;  4ZDV A;  3SD5 A;  2AL6 A;  2WWZ A;  2R61 A;  1EF1 A;  3CMM B;  4ZHO A;  3DDC B;  1E8Y A;  3M63 B;  3GB1 A;  2BBC A;  3SFE B;  2QHO A;  3JVZ X;  3KUC B;  1XD3 B;  3A33 B;  2NMQ A;  3TEZ A;  4RNA A;  3URY A;  3TL5 A;  2GMI C;  3U52 E;  4X57 B;  1ROE A;  2ZNV C;  4TSS A;  3L08 A;  3PRM B;  2ZW1 A;  4AWJ A;  1QLB B;  3LDZ E;  3H9D A;  3MC0 B;  3DWG C;  1QOA A;  4E71 A;  4I6P A;  2ICI A;  3BYY B;  1F0Z A;  2GBR A;  2FE8 A;  2REX A;  4RCO A;  5MPO A;  1K53 A;  4JPS A;  2ZCB A;  4XWT A;  4DXG A;  1WJ4 A;  1FD6 A;  2V4I B;  1S3S G;  1EWC A;  3QCA A;  2BQQ A;  3WAL A;  2PIA A;  4M0W B;  4S0R A;  3VQI A;  4NAM A;  1XEE A;  3PTF C;  2MWS B;  4M01 A;  3TIX A;  1SIF A;  2LWP A;  2K6Q A;  1N62 A;  2FAZ A;  1WI0 A;  3AE8 B;  2DLB A;  1ZKH A;  2WP9 B;  1EU4 A;  1TKE A;  4TKN A;  5L83 A;  2V3N A;  2IND C;  1AN8 A;  4J6I A;  2AYO B;  3P4Q B;  1DOY A;  4HPM B;  1T6B X;  1I7H A;  2JWZ A;  3AE7 B;  3O13 A;  1TIF A;  1Z5S B;  3D32 A;  2IY1 B;  1VR9 A;  4GXB A;  4AJW A;  2IGG A;  2LI5 A;  4DXF A;  3V6E B;  1JCK B;  3SDL C;  3UQA A;  5D7G A;  3CF6 E;  4P7I A;  3B2G A;  3VVW B;  3AE5 B;  3R66 C;  5E6P A;  5HI1 A;  4ANV A;  1C1Y B;  4DK5 A;  2EMT A;  4II3 B;  4A20 A;  2ZVN A;  3QA8 A;  1P98 A;  4ANW A;  3FIL A;  3WA0 A;  1UWM A;  4ICU A;  2DZK A;  2L52 A;  3PVL A;  2YEP B;  2GOW A;  1HTQ A;  3APF A;  5H92 C;  2IO0 B;  3JYU A;  4DBG A;  3KW5 B;  3TBL D;  4XE0 A;  4M0W A;  5HKH A;  2QIL A;  3W1S A;  4J3O D;  3VXW A;  3U4E G;  1L6U A;  1WZ3 A;  3KQ4 A;  2YEP F;  2RDH A;  1HXY D;  4DHZ E;  1NI2 A;  4GMV A;  4MGI E;  4BZA A;  1XT9 B;  2IPK D;  4UDU C;  4FAD A;  2C9W B;  3RNE C;  3AE6 B;  1Q1O A;  2LGD A;  1T3Q A;  2QCZ A;  2D2Q A;  2FCN A;  2BKR B;  1F2R C;  3NOB A;  3O65 B;  2N7J A;  4ASW C;  5DCN A;  2J0J A;  3Q3M C;  4WUR A;  3P4S B;  4WJQ A;  2V3S A;  3RNB C;  1U4A A;  5BYR A;  3BK1 A;  2RR9 A;  5C23 A;  1C77 A;  3PSE B;  4E3C A;  4A6Q A;  1TJE A;  3UIO B;  2BVC A;  1OTR B;  2WXQ A;  1RLF A;  2DZI A;  4CYE A;  2M19 A;  1FCC C;  2J52 A;  1QT9 A;  4IWO A;  1UD7 A;  1NEN B;  5IKC M;  2JF5 A;  4HWI B;  2M56 B;  1Q0W B;  4GDL B;  1WSP A;  5AZG A;  4EZL A;  3B1L X;  1YQ4 B;  1ZDV A;  3VUX A;  4F1S A;  2KC2 A;  3WAO A;  1LM8 B;  2RD0 A;  3A1Q B;  1GAQ B;  4AUQ C;  3TMP B;  1N61 A;  1YJJ A;  4FBJ B;  1FRD A;  2FCQ A;  4GGQ A;  2HD5 B;  1J19 A;  2MJ3 A;  4MM3 B;  2KJR A;  1YJ1 A;  2IO1 B;  4CHK A;  4KSK C;  3R2I A;  3AXC A;  1GC6 A;  3PGE A;  1LGR A;  5DPW A;  4PK1 A;  4RMA A;  3ETR A;  4WQO B;  2N7D A;  3NY5 A;  3BVZ A;  2NBU A;  2SAK A;  2HE7 A;  3QAQ A;  4DHJ B;  3IBE A;  1KF6 B;  1JAL A;  3P1M A;  4NJC A;  4KKJ A;  1KOT A;  2WQY B;  2YVC A;  4IDI A;  4FLH A;  4I6L B;  3DPD A;  1YJI A;  2I1J A;  1C9F A;  2K39 A;  4K1R B;  2WX1 A;  3ZJU A;  1HA5 A;  2PVO D;  4N9F 4;  3DHH C;  2CR5 A;  5D2M B;  3E9S A;  3I5J C;  1H8C A;  1YX5 B;  4OVZ A;  3N9Y C;  2VZK B;  1WXS A;  4AP4 C;  4PS3 A;  3APD A;  3SR6 A;  4KX6 B;  4IOI E;  1E8X A;  1UNS A;  4LNF A;  2D11 A;  3RYT A;  3VRB B;  3AE9 B;  3I3T B;  1T0R C;  4XGA B;  1WXA A;  3ZIM A;  1F52 A;  2Y5B B;  2O6V D;  3IT4 B;  3NUH B;  3WIM A;  4DHJ D;  1FXT B;  2EEL A;  1KRH A;  2LGI A;  2WXM A;  3A4S C;  2A5U A;  4PS7 A;  3VAW A;  3QIJ A;  4MJS B;  1C4C A;  2LJI A;  3AI5 A;  2UU7 A;  4LNK A;  1C79 A;  4KIK A;  3A9K A;  1I4Q A;  2KJ6 A;  4MEL A;  2V0G A;  1Q5W B;  1JRP A;  1IBX B;  2MBB B;  1HZ5 A;  1NVI D;  3V61 A;  3L13 A;  4RH6 A;  4N6E B;  2WX0 A;  1L0V B;  1UWX A;  2J42 A;  2N9X A;  3IAM 1;  2KT7 A;  4LNI A;  2RDB C;  1FM0 D;  4WH4 A;  4ZRQ A;  1WGG A;  1QOB A;  1IBX A;  3B08 A;  2MBE A;  2L32 A;  2KWV B;  4PS8 A;  3FAH A;  2MCN B;  3ZW3 A;  2G9H D;  4XZ4 A;  2BWE S;  2IJ0 A;  4IG7 B;  2E3T A;  1XLO A;  1SE9 A;  1LQB A;  2WXF A;  3TEX A;  2WDT B;  3ALB A;  3NZ3 A;  1FEH A;  3OLM D;  1FCL A;  4HVB A;  2IY0 B;  1RAX A;  1VD2 A;  1ZPS A;  3H7P A;  2XK5 A;  3CWI A;  1F9J A;  1RWS A;  3HUI A;  3PPA A;  3PZD A;  3PLV A;  5CHV C;  3Q3O C;  3DHG C;  2NTT A;  4NAW A;  2BYE A;  4KKI A;  2AEH A;  1DYQ A;  1L6V A;  1L2N A;  4DHZ B;  3AEA B;  2LZ6 A;  4GOC A;  3ZUN A;  2EKI A;  4W9I A;  1HZ6 A;  5IO9 A;  1EUV B;  1TKY A;  4C00 A;  3Q8E A;  1P3Q U;  2V9H A;  1KJT A;  2QDF A;  2KQS A;  2KWU B;  5EE0 A;  4KV2 A;  2AQ3 B;  1YN4 A;  1Y56 A;  2AX5 A;  3PRP B;  4FUL A;  4IM0 A;  2CS4 A;  4JE3 B;  1JWU D;  4A9A A;  1H4R A;  3EFC A;  2LFI A;  3HVZ A;  4RM9 A;  1HEZ E;  1WYW B;  4AOF A;  4H2A A;  5IP4 D;  2AL3 A;  2RGF A;  5I4D A;  4URK A;  3DBL B;  1ZDX A;  1GB1 A;  2OJR A;  2MJD A;  3MC9 A;  2MW5 A;  4TV3 A;  5DPS A;  2PW9 A;  1L0Y B;  1YD8 U;  3UIN B;  4ARI A;  3PRZ A;  1MPE A;  2LRU A;  2Z8L A;  4LDT B;  3RZW C;  1FFV A;  2UWQ A;  2Y5P A;  5HFY A;  3IVF A;  1L5P A;  3C8Y A;  5H8Y E;  2K0P A;  5CTR C;  2HJ1 A;  5BMH A;  2ZEQ A;  1ZP0 B;  1BXT A;  3T9L A;  3AM9 A;  4KGR A;  2G45 B;  3GZN I;  1I4H A;  1XLQ A;  3AH7 A;  1D5M C;  1YX6 B;  2D5G A;  3VH3 B;  4YTM B;  1WR6 E;  3QJZ A;  2QSD A;  1V49 A;  3PT2 B;  1TT5 B;  5BYS A;  1WE6 A;  4JQW C;  3I63 C;  1JRO A;  2PMV A;  3ZRF A;  4AS1 A;  2EKE C;  1R4M B;  5JHA A;  2Y5C A;  2LVP A;  2KDB A;  3H6N A;  3ABV B;  2G4D B;  4OZA A;  3NG0 A;  2ACZ B;  1RFA A;  3JW0 X;  2LJ5 A;  5C2T B;  5HG2 A;  1WRD B;  2KFK A;  5CHW A;  3TJP A;  3ECI A;  2IO3 B;  3L4P A;  4BBN F;  2KNB A;  2G4S A;  1EU3 A;  2WXH A;  3U8Z A;  2VRR B;  2AQ2 B;  4G0N B;  1PGA A;  1L4Z B;  1KLU D;  2PVG C;  4C7Y A;  1PGB A;  1AW7 A;  3R7R A;  1WGD A;  1M4V A;  2WHI A;  2M0X A;  3AEC B;  1WXQ A;  4B0E A;  4FJY A;  1SEB D;  2JX5 A;  2XN9 C;  1WM2 A;  2VH1 A;  2KFK B;  4L23 A;  3VR9 B;  2W55 A;  4F7Z A;  1WX7 A;  4MM3 A;  4N59 A;  4GLS C;  3QAR A;  4IW0 A;  4GDK B;  4CQN A;  2BS4 B;  3SEB A;  4K7S A; 
#chains in the Genus database with same CATH homology
 1WZ3 A;  4TQ0 A;  4II2 B;  4A3O A;  2K8C A;  4WWP A;  2I1K A;  1UZX B;  3ZNH B;  4DHZ E;  1NI2 A;  3ZDM C;  3MHS D;  4GMV A;  4MGI E;  1XT9 B;  1ZGU B;  4FAD A;  1SGH A;  3HK0 A;  1GNU A;  2C9W B;  2KDE B;  3KUZ A;  3DVG X;  1Q1O A;  2LGD A;  3QQ8 B;  2LXC A;  3EC8 A;  2BGF A;  2V1Y A;  1V9J A;  1WF9 A;  2PE6 B;  3AU5 A;  3PHX B;  4LJP B;  1R4M I;  4HDO A;  2D2Q A;  2FCN A;  2JRH A;  2K8B A;  2KN5 A;  2BKR B;  2R2O A;  4BKS A;  2KTR B;  2FID A;  2CHX A;  4IUM B;  3NOB A;  2DZJ A;  2V4L A;  3DVN V;  1LXD A;  3O65 B;  4GU2 A;  5G2N A;  1R4N I;  2L76 A;  3NZS A;  4EFO A;  4ASW C;  5DCN A;  1YQB A;  2CU1 A;  2J0J A;  2KQ7 A;  2O6V B;  2BYF A;  1K8R B;  1VCB A;  4MGY E;  4IM2 A;  2YLM A;  4WJQ A;  2V3S A;  1U4A A;  4JLC A;  3EEC A;  3JSV B;  2RR9 A;  5DPT A;  5C23 A;  2KHW B;  2KVR A;  3PSE B;  4E3C A;  1XQQ A;  2C7H A;  5TR5 A;  2IYD B;  4M8M A;  4DDI D;  3UIO B;  2KLC A;  4BOS C;  3L0W B;  5D6J B;  1OTR B;  2C7M B;  1ISN A;  2RPQ A;  1RLF A;  2IO2 B;  1GUA B;  3MTN B;  3U7D A;  3VTV A;  2DZI A;  4CYE A;  4EUT A;  3ZO5 B;  3V60 A;  4IWO A;  3KVF B;  4LJO B;  2DYB A;  4AJY B;  1YIW A;  1HE8 A;  1UD7 A;  2NBV B;  1BT0 A;  2JF5 A;  4HWI B;  3PHW B;  5AZH A;  3OAW A;  5CX3 A;  2L8J A;  5DPR A;  4ANX A;  1IP9 A;  3AU4 A;  1UBI A;  1Q0W B;  4GDL B;  5AZG A;  4EZL A;  1V2Y A;  1WGH A;  3B1L X;  1J0G A;  1WY8 A;  1WXV A;  2L0T A;  3CSF A;  3VUX A;  1V5O A;  4F1S A;  1V81 A;  2K6D B;  2KC2 A;  3WAO A;  1LM8 B;  2RD0 A;  3A1Q B;  3NHE B;  2G3Q B;  4BVU C;  3RT3 B;  1S1Q B;  3TMP B;  4AUQ C;  4W9K A;  4LDT D;  4FBJ B;  2L7R A;  4HDQ A;  3ENE A;  2FCQ A;  2CHW A;  2LVO A;  2N4F A;  2MRP A;  2KWC A;  2HD5 B;  2Z0E B;  3PRE A;  1J19 A;  3H1U A;  3IG3 A;  4FN2 A;  1GJZ A;  2KJR A;  3VDZ A;  1I35 A;  1YJ1 A;  2IO1 B;  2JY6 A;  1E8Z A;  2LGX A;  2N7E A;  2ZPN A;  4CHK A;  5J2R A;  2L0F A;  4KSK C;  1X1M A;  3S2A A;  2KO3 A;  4GDK A;  2C60 A;  3AXC A;  3QC8 B;  3W1S C;  1GC6 A;  3PGE A;  2KXJ A;  3ML8 A;  1NBF C;  1EF5 A;  4KZ0 A;  4NJ7 A;  5DPW A;  3GOE A;  1MG8 A;  4MSQ B;  4RMA A;  3PV1 A;  1A5R A;  4WQO B;  2N7D A;  3NY5 A;  3M62 B;  2NBU A;  3Q3F A;  2ZPY A;  2KD0 A;  2HE7 A;  4A3P A;  4HPL B;  2JT4 B;  3QAQ A;  4DHJ B;  3IBE A;  3M3J A;  1UH6 A;  1QZE A;  4YL8 A;  2KTF A;  1I42 A;  3JSV A;  2DAF A;  1E5W A;  1JRU A;  2LD9 A;  2KJH B;  4JIO U;  3UGB B;  3ZDT A;  5FR6 A;  2MSE D;  4MJS A;  1KOT A;  4KVG B;  3ZNI D;  2YVC A;  4IWP A;  2JUO A;  2MBQ A;  3A9K B;  3SU8 X;  1UEL A;  3L17 A;  4KIK B;  4DDG D;  5AEK B;  5LXI B;  3ZLZ A;  3ZNG C;  4FLH A;  5JZE B;  4I6L B;  4EZJ A;  3DPD A;  3VHT C;  2I1J A;  3UQB A;  3NS8 A;  2K39 A;  5J17 A;  5KHQ A;  4K1R B;  3L10 B;  2LVQ A;  2WX1 A;  1PQS A;  2RSU A;  4N9F 4;  3SHQ A;  2L3Z A;  2CR5 A;  5JH5 C;  5D2M B;  2LAS A;  4IC7 B;  2LUE A;  1OGW A;  5CHF A;  3DBL I;  3L54 A;  2A4Z A;  1YX5 B;  1H8C A;  3V62 A;  1WXS A;  4AP4 C;  1NDD A;  5IAA C;  4PS3 A;  2W9N A;  4IM3 A;  5GMV A;  3APD A;  2KDF B;  2KKC A;  3VH4 B;  1P0R A;  1WIA A;  1WR1 A;  1E8X A;  3RYT A;  2D11 A;  4MEM A;  3I3T B;  2KDI A;  3OJ3 A;  5D94 A;  4BKS D;  4WWO A;  1WX8 A;  1GG3 A;  1WXA A;  3ZIM A;  2CHZ A;  2NCN A;  3B0A A;  2Y5B B;  2O6V D;  4NPN A;  3VUY A;  3WIM A;  4DHJ D;  4WAA A;  4ZYN A;  1FXT B;  1WX9 A;  3RCZ A;  2KK8 A;  4PYU A;  2XK5 B;  3DCG A;  4B9K A;  2K8H A;  4GIV A;  4MSM B;  2BWF A;  2FCS A;  2M1M A;  3A4S C;  2A5U A;  4I6N B;  4IWQ A;  4PS7 A;  3QIJ A;  3T8M A;  2N1W A;  4MJS B;  3VAW A;  4K81 A;  4EOY A;  1IPG A;  2C7N B;  1E8W A;  3L16 A;  1WMH A;  3AI5 A;  3VFK A;  1TTN A;  3A1Q A;  4LCD E;  4KIK A;  2DZM A;  4GB9 A;  2LXA A;  3R7Q A;  3A9K A;  3ZRC A;  4ICV A;  2PPH A;  2KJ6 A;  4HCP B;  4HJK A;  4MEL A;  3UIP B;  5IA7 A;  1Q5W B;  5AZF A;  2JVC A;  2O2V B;  1UBQ A;  2MBB B;  3HM3 A;  4RM8 A;  4DWF A;  3V61 A;  3L13 A;  1E90 A;  4FHJ A;  3C0R B;  2K25 A;  1TBE A;  4XX5 A;  2XEW A;  3VUW A;  2M4N A;  1ZW7 A;  1EO6 A;  2WX0 A;  3UF8 A;  2R2Q A;  1KM7 A;  2MA9 B;  1V86 A;  2ZJD A;  2N9X A;  3DOW A;  2KOX A;  3HIZ A;  2B3A A;  4W9E A;  4WJP A;  2JRI B;  2LGY A;  3K9P B;  2AWT A;  1WGG A;  2WYQ A;  1WXM A;  4EKU A;  3WAN A;  5BO4 B;  1WMH B;  1D3Z A;  3VTU A;  3B08 A;  2DX5 B;  2BKF A;  1V80 A;  2MBE A;  3CST A;  2KWV B;  1TGZ B;  4PS8 A;  2MCN B;  3ZW3 A;  2Z0D B;  2EMS A;  4NNJ B;  4TQ1 A;  2FNJ B;  2NPT B;  3QX1 A;  4XZ4 A;  2BWE S;  4IG7 B;  2N9P C;  2M8S A;  2KTR A;  1SE9 A;  4KDL B;  1LQB A;  4OVU A;  4W9C A;  3PS6 A;  4FJZ A;  2PEA A;  2WDT B;  3ALB A;  3APC A;  1WGR A;  1J8C A;  3OLM D;  4W9D A;  4HVB A;  2IY0 B;  2Z59 B;  1RAX A;  2KMC A;  2J0M A;  3M95 A;  4W9J A;  1VD2 A;  3H7P B;  3RUI B;  3H7P A;  4ZRJ A;  3QHT A;  4TUU A;  2KX3 A;  2N1V A;  2XK5 A;  4FA6 A;  1F9J A;  4NJ6 A;  2HTH A;  3PPA A;  4MGZ E;  3PZD A;  4XC2 A;  2JXX A;  3PLV A;  5CHV C;  3WAM A;  3W1Y A;  4NAW A;  3BY4 B;  1UGM A;  1KLV A;  3KYC D;  3H7S A;  1V6E A;  2OOB B;  3K9O B;  5C1Z A;  3MJW A;  4JL9 A;  2BYE A;  2AEH A;  2GBK A;  4PYZ A;  4ZDV A;  3SD5 A;  5JHB A;  4NY0 A;  1L2N A;  2AL6 A;  2IBI B;  2WWZ A;  4DHZ B;  1V5T A;  1EF1 A;  3CMM B;  3ONS A;  4ZRI A;  2LZ6 A;  1GC7 A;  4GOC A;  2M17 A;  3DDC B;  2ZZP B;  3X23 A;  3ZUN A;  1OEY J;  4HLE A;  1E8Y A;  3M63 B;  2PE9 A;  3IHP C;  5J18 A;  3P2B A;  3ZTC A;  4WJN A;  4EEW A;  4W9F A;  4W9I A;  1OEY A;  4OVV A;  3NZU A;  3U30 A;  2QHO A;  3JVZ X;  3KUC B;  4MH0 E;  2ASQ A;  4HXD A;  1EUV B;  1XD3 B;  3A33 B;  2BF8 B;  4KZC A;  1P3Q U;  3EHV A;  1Z2M A;  2JPH A;  3RZF A;  3TL5 A;  1KJT A;  4KSL C;  2GMI C;  2KQS A;  1WM3 A;  2KWU B;  3IFW B;  4CO7 A;  2J0K A;  4W9L A;  4X57 B;  4KV2 A;  2GBN A;  2ZNV C;  3R3M A;  3A9J A;  5LLI A;  3L08 A;  2FUH B;  3PRM B;  1M94 A;  1WGY A;  3PRP B;  4AWJ A;  3HM6 X;  2ZNV B;  3LDZ E;  3H9D A;  3ZNZ B;  2N9E B;  4FUL A;  4F8C B;  2UYZ B;  2NBW B;  4GSW A;  4IM0 A;  2CS4 A;  2BPS A;  2JZZ A;  1H4R A;  3Q3J A;  3RD2 A;  2KMA A;  4E71 A;  4K7W A;  4I6P A;  5E6N A;  3QK0 A;  3HHM A;  2BYV E;  4RM9 A;  1WYW B;  2L00 B;  4AOF A;  4DXA B;  2GBR A;  2REX A;  2ZCC A;  4MGK E;  3V6C B;  3X0W A;  2AL3 A;  2KFJ A;  1L7Y A;  2RGF A;  4HK2 A;  4URK A;  4G50 A;  1T0Y A;  2ZCB A;  3ZVV A;  1RRB A;  1WJ4 A;  2OJR A;  4FJV B;  3ML9 A;  4WWN A;  4ANU A;  1S3S G;  3QCA A;  2GBJ A;  5G55 A;  1AAR A;  3WAL A;  3A9J B;  5KHO A;  1TZ1 A;  2MW5 A;  2FCM A;  2NR2 A;  3DBR I;  2KZR A;  2MLB A;  1E7V A;  3KUD B;  3PLU A;  1YD8 U;  4M0W B;  4TV3 A;  4W9G A;  3PRZ A;  5DPS A;  3UIN B;  3VQI A;  2DYM A;  2LRU A;  3PTF C;  4BBN C;  2MWS B;  4LDT B;  3TIX A;  2GBM A;  1SIF A;  2CKH B;  3KYD D;  3RZW C;  5L95 C;  2LWP A;  2JZ3 B;  2K6Q A;  4HCN B;  3N3K B;  4GGQ A;  2UWQ A;  4K7U A;  2FAZ A;  2XBB C;  2MP2 B;  4KDI C;  1WI0 A;  3N30 A;  3IVF A;  2ZVO A;  5CTR C;  1ZKH A;  2MBO A;  2ZEQ A;  4TKN A;  5L83 A;  2K1F A;  3T9L A;  2MQJ A;  1OQY A;  2J7Q B;  2G45 B;  3GZN I;  4ZRK A;  3AUL A;  4J6I A;  3RUL A;  5LXH A;  3TCA A;  1YX6 B;  2AYO B;  3VH3 B;  1WR6 E;  4BKT A;  3QJZ A;  5EDS A;  4G11 A;  4G3X B;  4HPM B;  1V49 A;  3PT2 B;  1WE6 A;  4JQW C;  4MDK E;  1LFD A;  2JWZ A;  3ZRF A;  1WFY A;  2EKE C;  1WE7 A;  2O6V A;  3N32 A;  5JHA A;  3DQV A;  2KLG A;  2LVP A;  3DVN U;  2KX0 A;  2KDB A;  2MP2 A;  3H6N A;  1Y8R C;  4JGH B;  4NAW B;  4W9H A;  4BFR A;  2G4D B;  1Z5S B;  2D3G A;  4B95 A;  3D32 A;  3EFU A;  2IY1 B;  1RFA A;  3JW0 X;  4E74 A;  2PJH A;  2LJ5 A;  4GXB A;  4AJW A;  1IYF A;  3BIN A;  2LI5 A;  1WRD B;  3QWZ B;  3A4R A;  2KFK A;  5CHW A;  3TJP A;  4NQL B;  3ECI A;  3WAP A;  1WJN A;  2IO3 B;  1WJ6 A;  4M8N A;  4BBN F;  3DBS A;  5E6O A;  2KNB A;  2FIF A;  3DBH I;  2G4S A;  3VTW A;  4EZK A;  3V6E B;  3U8Z A;  4B6W A;  2VRR B;  2LRW A;  2MX2 A;  4G0N B;  3SDL C;  4NQK E;  2NVU I;  3UQA A;  5D7G A;  3CF6 E;  4P7I A;  1WH3 A;  3VVW B;  3OJ4 B;  3R66 C;  5E6P A;  4ANV A;  1C1Y B;  2HJ8 A;  3R7R A;  4DK5 A;  1WGD A;  2EMT A;  2M0X A;  3KH0 A;  4II3 B;  4A20 A;  2DAJ A;  2ZVN A;  3QA8 A;  1P98 A;  4ANW A;  4FJY A;  4WJO A;  3ZTD A;  4BOZ B;  3WA0 A;  2KC1 A;  3ZKJ C;  1WM2 A;  1G6J A;  2KFK B;  1WJU A;  2DYO A;  4ICU A;  2DZK A;  1C3T A;  3LJ3 A;  4F7Z A;  1WX7 A;  3PVL A;  4MM3 A;  2DHZ A;  2GOW A;  2DEN B;  2D10 A;  2L05 A;  4FHK A;  3APF A;  2O2V A;  1P1A A;  3QAR A;  4GN1 A;  1P9D U;  4IW0 A;  2IO0 B;  2MBH A;  1WZ0 A;  2KAN A;  3JYU A;  4GDK B;  2NPT A;  4DBG A;  3DVG Y;  3KW5 B;  4K7S A;  2C5L C;  3TBL D;  1E7U A;  2IZV B;  4BKG A;  5HKH A;  3W1S A;  1CMX B;  2D07 B;  3VXW A;  4GDL A;  2NS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...