3VH4B

Crystal structure of atg7ctd-atg8-mgatp complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
b'TFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like modifier-activating enzyme ATG7
publication title Structural basis of Atg8 activation by a homodimeric E1, Atg7.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal binding protein/protein transport
total genus 29
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3vh4B00
4ICVA 1E8ZA 3ENEA 4TV3A 3H7PA 4A3PA 3OAWA 4BVUC 2NPTB 2J0MA 4K7WA 3VTUA 3APCA 5AEKB 2C9WB 3JYUA 1A5RA 2J0KA 2Z59B 4NJ6A 2L00B 4ASWC 4B6WA 4XX5A 2RSUA 2RPQA 3L0WB 2K6QA 2KDEB 5CX3A 4KDIC 4I6LB 4TQ1A 4MGIE 3RD2A 3VH4B 5KHQA 2DAFA 2PE6B 3LDZE 4M8MA 4E74A 1WJNA 1RFAA 4PS3A 2O2VB 2KWCA 4WJOA 2BYEA 2KNBA 1CMXB 3DBHI 3UGBB 4G3XB 2K39A 2N7EA 3NY5A 2JT4B 2ZVOA 4AP4C 4FHKA 1NDDA 2PJHA 4PS7A 1I42A 1KLVA 2UYZB 1R4MI 2R2OA 3DVNU 2EMSA 2D3GA 3V62A 4W9LA 3Q3JA 3ZUNA 3ZNZB 5AZFA 4F8CB 3ZDTA 3R7QA 3DCGA 2L8JA 1WJUA 3ALBA 3AULA 4ANUA 3PRMB 2ZZPB 1NBFC 3VVWB 5AZHA 2ZCCA 4GGQA 2N9EB 4JL9A 2MBEA 4W9JA 2PPHA 4CO7A 4K1RB 4BFRA 2NR2A 3QWZB 4LDTB 1H8CA 4NQKE 2MBQA 4TKNA 1SGHA 2IYDB 2J7QB 2GBMA 4WJPA 3OLMD 4XZ4A 2RD0A 2DHZA 4IM0A 1P9DU 1VCBA 4HVBA 2K6DB 2C7HA 2HD5B 3PLUA 3Q3FA 1WX8A 3DQVA 3KUCB 3WA0A 3PHWB 5D2MB 2EKEC 2JPHA 5IAAC 1F9JA 2GBRA 2KJRA 4BKTA 2R2QA 3M95A 2GBNA 1ZW7A 1GC6A 1WZ3A 2NBWB 3A9KB 1OTRB 4W9CA 4F1SA 4CYEA 3CSTA 3A1QA 1HE8A 3V61A 3A4SC 2KMAA 2K1FA 3IHPC 4LJPB 4IWOA 2B3AA 1YX5B 2KC2A 2MWSB 3B08A 4FBJB 3ZNHB 1TGZB 4A3OA 3ML9A 2MW5A 1GNUA 1WX7A 2J0JA 3JW0X 1V80A 3QA8A 4WJNA 4FA6A 3UQAA 5BO4B 5CHVC 1WE6A 1EO6A 1WYWB 4FULA 4X57B 3CSFA 3RULA 1FXTB 3UIOB 1LQBA 4FJYA 2KDBA 4EOYA 4DXAB 1NI2A 2CHXA 4JIOU 5JH5C 2CR5A 2WDTB 4GB9A 4KZ0A 2BKFA 5FR6A 3UINB 3PHXB 1UZXB 2JUOA 2KVRA 2WWZA 2Z0DB 2KFJA 3APDA 1R4NI 3PVLA 3QCAA 3KW5B 1WX9A 2KTRA 2CS4A 1WMHA 3ZNGC 3IBEA 1WIAA 2IY0B 2L7RA 3M63B 2BWES 4FJVB 4B9KA 2C60A 1WZ0A 4EFOA 4K7SA 4II3B 1WR1A 3EFUA 1V81A 5E6PA 2V3SA 4AWJA 2N9PC 1QZEA 4FJZA 2MP2B 1GJZA 4N9F4 5L83A 1X1MA 4HCPB 3NZUA 2A4ZA 2IO3B 5D94A 3VTVA 3ZO5B 2KFKB 2DZMA 4AJYB 1D3ZA 1C3TA 2KTFA 4AJWA 2JVCA 3AXCA 1E5WA 1YJ1A 2XK5B 5DPSA 4MSQB 3GOEA 2KLCA 4BKSD 2MBBB 4GXBA 3DDCB 4K7UA 3GZNI 2DZIA 2MCNB 4HDQA 4MSMB 4OVVA 5J17A 4NAWB 4K81A 3IG3A 2NPTA 4JLCA 4E3CA 5DPTA 3QX1A 2BWFA 2FIFA 2ZEQA 2KANA 3DVGY 2JF5A 2NVUI 1J8CA 1ISNA 4KDLB 3VAWA 4AOFA 4IM2A 2C5LC 3VUWA 4BBNF 3AU5A 2FUHB 4FLHA 2ASQA 4M8NA 3KH0A 2YVCA 3U8ZA 4BKSA 4W9KA 4GSWA 4MH0E 2OJRA 4KSKC 4I6PA 4EEWA 1AARA 3T9LA 2MBOA 1RAXA 2LJ5A 2MA9B 4LDTD 2HE7A 3QHTA 2N7DA 3HHMA 3M62B 5LLIA 5TR5A 2DAJA 3HM3A 4KIKA 3KUDB 3AI5A 2ZPYA 2KWVB 3R66C 1V49A 3PV1A 3R3MA 2GMIC 4W9EA 3W1SC 1ZGUB 4IUMB 3DVNV 4GMVA 3KYCD 4MM3A 4W9IA 2FAZA 5D7GA 4FADA 3UIPB 4NNJB 5LXHA 1P1AA 1UGMA 2KMCA 2A5UA 2MBHA 3QC8B 5EDSA 3VQIA 2EMTA 4WWOA 2L0FA 2CU1A 2LGDA 2CHZA 2XBBC 4MEMA 4WWNA 2C7MB 4W9HA 4DWFA 4IW0A 4B95A 2AL6A 2CKHB 3TL5A 2Y5BB 2FCQA 1WM2A 1EF5A 4WQOB 3R7RA 3SD5A 1BT0A 1WXMA 2V1YA 2G3QB 3EHVA 1WJ6A 1KM7A 2JWZA 3V60A 3A33B 2LRWA 3DPDA 3PREA 4HLEA 2C7NB 2KKCA 4ZDVA 4RMAA 3B1LX 1Q1OA 3CF6E 4FN2A 3ONSA 1TZ1A 3WANA 3QIJA 4MJSB 1IP9A 2M0XA 4MDKE 1WE7A 5IA7A 3H1UA 2G45B 2KHWB 3NOBA 3PZDA 1C1YB 4HWIB 2Z0EB 4IWPA 1XD3B 1ZKHA 1UH6A 3UF8A 4DBGA 5CHFA 4ANXA 1E8XA 5AZGA 3C0RB 2HJ8A 1I35A 2WX0A 5GMVA 1EUVB 2G4DB 2BF8B 3QJZA 3RZWC 1T0YA 1WJ4A 4BBNC 3WAMA 2DZKA 3P2BA 3TCAA 4KZCA 4IM3A 3EECA 1GUAB 1Z2MA 2V4LA 3RT3B 1V9JA 2IBIB 3PTFC 4W9GA 2NBUA 2LWPA 4EKUA 3KUZA 1RLFA 1V5TA 3VUXA 2GOWA 2AWTA 4RM8A 5J18A 2NBVB 5C1ZA 3L10B 2KK8A 2KQ7A 3PGEA 1WI0A 3JVZX 3WIMA 3KVFB 2MLBA 2MSED 2ZVNA 1PQSA 4G0NB 1UELA 4GOCA 2D2QA 1G6JA 3A4RA 1P3QU 2IO0B 3TIXA 1J19A 1JRUA 2QHOA 3ZRFA 3MHSD 4MGKE 3DVGX 3SU8X 2O6VB 2PEAA 5DPWA 1EF1A 3NS8A 1YD8U 2RR9A 2UWQA 4J6IA 3ZDMC 3W1YA 4RM9A 4XC2A 3L13A 2FNJB 2LGXA 2D11A 1Z5SB 2IZVB 2MP2A 4HXDA 2KX3A 3PSEB 2BKRB 5L95C 1WM3A 4M0WB 2KFKA 2LZ6A 1WRDB 2LASA 1E7UA 1LXDA 2MQJA 3ECIA 2XK5A 2ZNVB 2LI5A 3RCZA 2JRIB 3SDLC 1IYFA 1S3SG 3V6CB 1WMHB 4NPNA 4KV2A 1TTNA 1GG3A 1WGGA 3WAPA 4NAWA 1E8YA 2JZZA 4EUTA 1Q0WB 4MELA 3ZTCA 3L16A 4W9DA 4GDLB 3A9JB 1VD2A 3VFKA 1KOTA 1LFDA 4EZLA 4DHJB 3TMPB 4HPLB 1V5OA 3N30A 2KN5A 2YLMA 3T8MA 2DYMA 2LVQA 4GDKB 2KDIA 2M1MA 3NZSA 1U4AA 3ZLZA 1LM8B 1YQBA 4DHZB 3H7SA 4ZRJA 3N32A 2AYOB 3L17A 3APFA 3K9PB 2KJHB 3SHQA 2N1VA 3K9OB 3PLVA 5JHBA 1P98A 3VDZA 1V6EA 4A20A 2O2VA 1XT9B 1S1QB 4GN1A 3JSVB 1H4RA 3NHEB 1P0RA 2NCNA 3KYDD 1M94A 1L2NA 3ZW3A 3QQ8B 5KHOA 3H7PB 2MRPA 3BINA 3IVFA 1WXSA 4F7ZA 2KLGA 2JRHA 5CTRC 3B0AA 4LCDE 3RZFA 3H6NA 4WJQA 2KZRA 2M8SA 2REXA 3PPAA 4PYUA 1E90A 4NQLB 4HDOA 2GBJA 4JGHB 3M3JA 5G2NA 4BOSC 2AL3A 1RRBA 2IO1B 2KC1A 4DK5A 4PYZA 2KJ6A 3VHTC 3H9DA 3I3TB 3OJ4B 4ICUA 4GIVA 4LJOB 2WYQA 1WGYA 1SE9A 3PRZA 3PS6A 2L05A 3UQBA 4KIKB 3VH3B 4WWPA 4OVUA 1WY8A 5DCNA 2KXJA 4II2B 2W9NA 3X0WA 1GC7A 2LUEA 1WGHA 5D6JB 1UD7A 3TBLD 4IG7B 4MJSA 3O65B 5JZEB 1SIFA 3HK0A 1WR6E 1Q5WB 3PT2B 4ZRIA 3HIZA 3W1SA 2FCNA 4WAAA 3MJWA 1KJTA 3A9KA 3PRPB 4ANVA 4W9FA 2IY1B 2XEWA 4HJKA 3DBRI 2D07B 2KX0A 3MTNB 4HK2A 2N4FA 4HCNB 4PS8A 4TUUA 1WGDA 3HM6X 2GBKA 2DYOA 5G55A 1WF9A 5HKHA 4DDID 4JQWC 3S2AA 2I1KA 2K25A 2O6VD 3TJPA 3ZNID 5E6OA 2M4NA 1WXAA 2IO2B 2BYFA 4EZKA 4IC7B 5JHAA 3EC8A 2PE9A 5E6NA 4ANWA 4YL8A 2NS5A 2ZNVC 2LVOA 4DDGD 3DBSA 3ZIMA 2OOBB 2KD0A 2JXXA 1XQQA 2HTHA 2CHWA 2K8CA 4TQ0A 3QARA 2KDFB 3A1QB 4MGZE 3X23A 3ZRCA 4BKGA 1WFYA 5C23A 2K8BA 3U7DA 2L76A 5LXIB 5J2RA 3RUIB 3ML8A 2K8HA 2KOXA 2M17A 3L08A 2O6VA 2DENB 3CMMB 3VTWA 4CHKA 4KSLC 3RYTA 4URKA 2KWUB 4AUQC 2VRRB 3QK0A 2L3ZA 4EZJA 4DHJD 5CHWA 1WH3A 2LD9A 2MX2A 1J0GA 2FCMA 2L0TA 4G50A 2BGFA 3VXWA 3LJ3A 4GU2A 1WXVA 2ZPNA 3AU4A 3WAOA 3D32A 1YIWA 1UBIA 2LRUA 2ZCBA 4DHZE 2N9XA 3DBLI 4MGYE 2G4SA 4ZRKA 1IPGA 1UBQA 1V86A 3WALA 1E7VA 1OEYA 2LXAA 3N3KB 2I1JA 1V2YA 3QAQA 1OQYA 1WGRA 2KTRB 4E71A 1YX6B 5DPRA 4BOZB 1L7YA 2BYVE 3L54A 2D10A 4GDLA 3A9JA 2BPSA 2LGYA 4P7IA 2N1WA 1E8WA 4NJ7A 2ZJDA 4KVGB 3V6EB 2DX5B 2RGFA 2KO3A 1OEYJ 3ZTDA 2DYBA 2FIDA 4GDKA 3IFWB 4ZYNA 2WX1A 4IWQA 3VUYA 3ZVVA 4G11A 4NY0A 3ZKJC 1Y8RC 3OJ3A 3BY4B 2JZ3B 2JY6A 2LVPA 2DZJA 1TBEA 2LXCA 2AEHA 1OGWA 3DOWA 1MG8A 2KQSA 4I6NB 3U30A 1K8RB 2FCSA 3JSVA 4FHJA 4HPMB
chains in the Genus database with same CATH superfamily
4REZA 4TV3A 3OAWA 2ICIA 5AEKB 3VTUA 4P1CC 4LNFA 4XX5A 2PIAA 1TJEA 3AE9B 5CX3A 4KDIC 2PW9A 3RD2A 1GAQB 2PE6B 4IKGA 4E74A 4RGNA 1RFAA 4UDUC 2O2VB 4WJOA 2BYEA 3DBHI 2K39A 3NY5A 1YOVB 3AE5B 2BB6A 1D5ZC 4PS7A 2VZKB 5G5HA 2D3GA 1VLBA 2ZW0A 3R7QA 3AULA 1NBFC 5AZHA 2V4IB 4A90A 2HJ1A 1ZE3D 2NR2A 4N59A 4NQKE 4WJPA 1UUPA 4IM0A 1VCBA 2K6DB 2HD5B 1WX8A 3AM9A 3PHWB 5BMGA 1F9JA 3SFEB 2R2QA 3M95A 2VH1A 1ZW7A 3A9KB 3I5JC 3P1MA 1FNUA 3CSTA 1F2RC 1DOYA 4LJPB 3GB1A 4ARCA 1TGZB 1XO3A 4A3OA 1FCLA 2J0JA 1V80A 3NVYA 1V8CA 1WE6A 2IPKD 4HPPA 4X57B 4OZBA 3CSFA 3MC0B 2KYWA 1FXTB 3UIOB 1UNSA 1LQBA 5IP4D 3TEXA 4FJYA 2M19A 2WXHA 4GB9A 5FR6A 3BZDB 2JUOA 3PVLA 1BMLC 1R4NI 2IJ0A 3RI7C 2KTRA 1WMHA 3IBEA 2LMCA 2BWES 2C60A 1HZ6A 1TKEA 1WZ0A 4RH6A 1VR9A 5L83A 2IO3B 2L32A 2KFKB 1C3TA 2KTFA 4AJWA 3AXCA 3GZNB 3GOEA 2N9KA 3IXSA 2DZIA 2INCC 1ESFA 2Y3AA 4MSMB 5J17A 4K81A 4M01A 2ZW1A 2BWFA 2FIFA 2ZEQA 2JF5A 2NVUI 1ISNA 1SSNA 4RFBA 3VAWA 4BBNF 3AU5A 4FLHA 3KH0A 3AEBB 1D4BA 4W9KA 2WXRA 2PTLA 2OJRA 2WDQB 1F52A 3T9LA 2UU7A 3M62B 4RF1A 4KIKA 3KUDB 2BB5A 3PV1A 4W9EA 3W1SC 2WXFA 3UIPB 4FXCA 3R2TA 2BYTA 3QC8B 1MVKA 2XBBC 1L0YB 4WWNA 3H8HA 2E3TA 5LNK1 2Y5BB 1WM2A 3SD5A 4WQOB 1TIFA 1BT0A 2V1YA 1QF6A 3A33B 2DBYA 2ACZB 2XNAC 1K50A 1GB4A 2KKCA 2RDHA 4FN2A 1FO4A 4RGTA 4MJSB 1IP9A 2BQQA 1WE7A 5IA7A 3H1UA 3NOBA 2H89B 2JXTA 4IWPA 1L4DB 5CHFA 4ANXA 1KRHA 5GMVA 2BF8B 1ZUD2 3AB5A 3WAMA 1WRIA 3BIID 1GUAB 3Q3NC 1V97A 4W9GA 2V9HA 1OQRA 3VUXA 1ACCA 4RM8A 2NBVB 1SE3A 3WIMA 2MLBA 2NMQA 4G0NB 1UELA 2CJNA 4OZAA 2WNMA 2IO0B 1J19A 3ZRFA 3C8YA 5BMIA 3SU8X 2PEAA 1HEZE 5H8YE 2EELA 2FNJB 4XYCA 2MP2A 4DXFA 5L95C 2JZPA 1V1PB 1VJKA 2LASA 3ECIA 2XK5A 3V6CB 1E7PB 2G9HD 3FILB 3WAPA 1E8YA 2W3RA 1Q0WB 3L16A 4W9DA 3VFKA 4EZLA 4DHJB 2YLMA 2LVQA 2M1MA 3ZLZA 5HFYA 1YQBA 3W5VB 2IDYA 2AYOB 2KJHB 3K9OB 2MEKA 3VDZA 2O2VA 1S1QB 3BK2A 4GN1A 4MH8A 2NCNA 1L2NA 3QQ8B 4TMAB 2MRPA 3IVFA 4LCDE 3H6NA 2KZRA 1LGRA 3VRAB 2GBJA 3M3JA 5G2NA 3AEDB 1ENFA 5BYSA 1T0QC 4GIVA 4LJOB 3UQBA 1TS4A 1GC7A 3NVZA 5I4DA 3TBLD 4JX1C 5HHDG 3HIZA 3DBRB 1KJTA 3A9KA 4ANVA 1I4QA 2D07B 2KX0A 3MTNB 4HK2A 4TUUA 2GBKA 1WF9A 4Q2JA 2I1KA 1PGAA 2O6VD 2W82A 1JWBD 4HROA 2BYFA 5JHAA 2KAJA 4DXGA 4YL8A 2RDBC 2ZNVC 2LVOA 3ZIMA 1PFDA 1XLQA 1XQQA 2CHWA 1WWTA 2INPE 1JALA 2K8CA 4TQ0A 3X23A 2WXNA 1WFYA 5LXIB 3NUHB 3SFDB 4RGOS 1L5PA 2WXQA 2O6VA 2DENB 4KSLC 3U4EG 1XLOA 3RYTA 4RGMA 2VRRB 3QK0A 2MX2A 2JWUA 1J0GA 2FCMA 3LJ3A 3WAOA 3N1XC 2ZPNA 1B9RA 4EE2A 2LRUA 2ZCBA 2INNE 2N9XA 3DBLI 1UBQA 1V86A 4XDCA 1OEYA 1EM7A 2KTRB 4E71A 3ZJUA 1GPXA 1L7YA 2D10A 2BPSA 2LGYA 2X8XX 2RGFA 1N5XA 1BXTA 1OEYJ 1V1OA 2FIDA 4GDKA 4G11A 5D3IB 4NY0A 3ZKJC 1SXTA 2JY6A 1TBEA 1RFKA 2LXCA 3DOWA 2LFIA 4IOIE 3U30A 1K8RB 4B0MA 1SF0A 1HTQA 4FHJA 1MJDA 1HA5A 1YN4A 2J0MA 3APCA 2MJDA 1A5RA 2K6QA 4XWWA 4OVZA 1YNTE 4I6LB 4TQ1A 3MJ5A 3DBHB 3LDZE 4M8MA 3T3OA 4PS3A 2KNBA 3TUOA 1CMXB 1T0SC 3P4QB 5AUKA 4AP4C 1KLVA 2UYZB 1R4MI 2R2OA 2JX5A 2EMSA 1IBXA 1NYQA 3SEBA 2BTEA 4W9LA 3Q3JA 3ZUNA 4F8CB 3ZDTA 3BK1A 2L8JA 1WJUA 3VVWB 2B76B 2JU6X 4GGQA 3PZ8A 2N9EB 4S17A 4K1RB 4BFRA 4PK1A 3QWZB 1H8CA 2E6XA 4TKNA 2MBQA 1QOAA 2GBMA 3OLMD 2DHZA 4H2AA 2C7HA 1C4CA 2WHIA 5D2MB 2EKEC 2JPHA 1JWAD 2GBNA 1GC6A 2SAKA 1NEKB 1OTRB 3V61A 1HE8A 3B9JA 3A4SC 2KMAA 3IHPC 3ZJTA 5FKAC 2KN4A 1UWXA 1YX5B 1JW9D 4M02A 3B08A 1C9FA 5HG2A 2MHJA 2QIEB 3TEYA 1EO6A 1WYWB 4FULA 4EOYA 5AUIA 3BVGA 2CHXA 4ZHPA 1R4NB 2BBCA 1VZ7A 4L2YA 2XN9C 3HVZA 3APDA 3ZNGC 3M63B 4FJVB 4EFOA 3I63C 5FK9C 3P63A 5E6PA 2MP2B 1GJZA 1X1MA 5D94A 3ZO5B 1D3ZA 2N7JA 1AN8A 4XGAB 2JVCA 2DLBA 1E5WA 1YJ1A 2XK5B 5DPSA 4MSQB 2KLCA 3NRZA 4GXBA 4K7UA 1J7AA 3B2GA 4ZRQA 2KMMA 3Q2AC 2QC8A 3IG3A 4JLCA 2KANA 2WDRB 1KLUD 1XEEA 1XLPA 3NS1A 2ASQA 4M8NA 2GRIA 1E10A 3B2FA 4GSWA 4MH0E 3NJTA 4I6PA 5FR3A 1GOZA 1RAXA 2MA9B 5LLIA 2HE7A 3L4PA 3AI5A 3AECB 3R3MA 3DVNV 3OG5A 4GMVA 4P6VF 4R3DA 1P1AA 2KMCA 2D3CA 4DWFA 1TY2A 4IW0A 4B95A 1IGCA 2AL6A 1SB3C 3E56A 4PT5A 3RN9C 2KDMA 1TYGB 1VRAB 3DHHC 2QEJC 3RPFC 2C7NB 1TKGA 1VDVA 2Y5PA 4ZDVA 5BYRA 3ONSA 3TSSA 4KKIA 3FKYA 1KF6B 1WSPA 2M0XA 4MDKE 4BAXA 2G45B 4MACA 3PZDA 4US9A 3UF8A 1E8XA 2BT6A 1JCKB 3AEEB 3AEGB 4RF0A 4C4VA 2RPVA 1I35A 2WX0A 2G4DB 1L6VA 4LNKA 2DZKA 4XWTA 3EECA 2V4LA 1V9JA 3PTFC 2WDVB 1VZ8A 2NBUA 4EKUA 3KUZA 2GOWA 2AWTA 1UGJA 1ZXIA 5C1ZA 3L10B 3KVFB 1OQQA 2ZVNA 4B0EA 2LGSA 2D2QA 2WXOA 3P4PB 1WGKA 1JRUA 2QHOA 2MH7A 3MHSD 2O6VB 3NS8A 4XC2A 3L13A 4C7ZA 2LGXA 5IN7A 1FPYA 1K53A 5GXGB 2N9LA 1SE2A 2BKRB 2LZ6A 2V3PA 2ZNVB 2JRIB 4NPNA 4KV2A 2PVOD 1WGGA 4MT5A 4EUTA 1MG4A 1VD2A 1ET6A 1LFDA 2W55A 2DYMA 4GDKB 2KDIA 1C77A 3NZSA 2BS2B 3SR6A 1YJIA 3V05A 2N1VA 1AW7A 1V6EA 1T3QA 2WLBA 2ON8A 5KHOA 4KKJA 3BINA 4F7ZA 2KLGA 3AE1B 5CTRC 3B0AA 3VR9B 1TS5A 3RZFA 4ARIA 2REXA 3MC9A 4JGHB 4M00A 2KC1A 3H9DA 4QAYA 3I3TB 4CQNA 1K51A 2D5GA 1SE9A 3GP7A 4OVUA 5DCNA 1NVID 4II2B 1FCCC 2LUEA 1IBXB 4IG7B 1EWYC 3HK0A 3PT2B 3W1SA 4JPSA 4C7YA 4RCOA 2IY1B 2XEWA 4OZCA 3O13A 5G55A 2LEKA 1I4RA 3RNCC 5HKHA 5E6OA 1WXAA 2M0AA 2PE9A 1N5WA 5E6NA 4ANWA 2LGIA 2OOBB 2KD0A 1GB1A 2JXXA 1NENB 1FD6A 3QARA 2KDFB 2K8BA 3RUIB 3L08A 2M17A 2KOXA 3VTWA 1RYJA 4DQOC 2KWUB 3Q69A 3DBLB 3AEAB 4G50A 3KWLA 2I38A 4M0WA 3AU4A 1YIWA 1UBIA 4DHZE 4YSZB 2LXAA 3N3KB 1V2YA 3QAQA 4JWSC 1OQYA 1WGRA 2BVCA 1YX6B 5IKCM 2W54A 5TSSA 1I4HA 4GDLA 2K0PA 1HTOA 2N1WA 1E8WA 2ZJDA 1YQ3B 4C56C 4WURA 3MP9A 3ZTDA 3E9SA 2LJIA 2DNFA 2TSSA 5BMHA 3ZVVA 3LXFA 1Y8RC 3BY4B 2JZ3B 1OFFA 2DZJA 1P7FA 1K52A 1CJEA 2FCSA 3JSVA 2KVZA 4ICVA 3ENEA 3H7PA 2SEBD 2Z59B 3CWIA 2J4XA 4NJ6A 2RSUA 3L0WB 2KDEB 3Q8FA 2JYEA 4HJGE 1CK1A 3HUIA 2LHEA 2DAFA 4LNIA 4J3OD 2KWCA 1A70A 3KLSX 3UGBB 4G3XB 2ZVOA 1R4MB 2FE8A 2PJHA 1I42A 3DVNU 5IOIA 1XLNA 3VRBB 1C78A 2JQRB 4ANUA 3ALBA 2ZZPB 3AV8A 1TY0A 4JL9A 2MBEA 3Q8EA 1SGHA 2IYDB 2J7QB 4YSYB 1KLGD 2PKOA 1P9DU 4HVBA 3PLUA 4ZOHC 1PYWD 1FRRA 1C4AA 5IAAC 2GBRA 2KJRA 4BKTA 1PUTA 1E9MA 2NBWB 1FRDA 1EU3A 1EWCA 2INDC 4YTPB 4W9CA 4F1SA 4YSXB 4N6EB 4C4VB 2B3AA 2KC2A 3P4SB 3ZNHB 2MW5A 1WX7A 3JW0X 3QA8A 4FA6A 3Q6BA 3GE3C 1VZ6A 3AN1A 5T8IA 2KDBA 4DXAB 1QKZA 4JIOU 5JH5C 2CR5A 2WDTB 4ZRPA 1UF0A 2BKFA 3UINB 3PHXB 1UZXB 4YWGG 2Z0DB 2KFJA 3QCAA 3RNBC 1WX9A 1WIAA 2IY0B 2L7RA 4A9AA 1JWMD 4B9KA 3VR8B 4K7SA 1FMAD 4II3B 3Q8BA 1WR1A 1FNVA 4AWJA 2V3SA 2N9PC 4AS1A 1ZDVA 4A6QA 4WIPA 1N60A 1JRPA 2QSDA 1XCQL 1TKYA 2MBBB 3BVZA 2OEDA 4O1NA 1HXYD 2D3BA 2K9XA 2NPTA 5DPTA 1C76A 3QX1A 1SE4A 4KDLB 1FM0D 4YTNB 1L0VB 3W9CB 4IM2A 4A55A 3AE6B 2OJWA 2IGDA 1F77A 4KSKC 1M4VA 3AE3B 4LDTD 2AQ1B 2N7DA 2DAJA 3KWVA 2ZPYA 2KWVB 3ABVB 3R8BA 1ZGUB 4MM3A 4W9IA 2FAZA 4FADA 1T6BX 4K3CA 1T5XD 1FIQA 1YQ4B 3MHZA 3VQIA 4OW0A 4WWOA 2L0FA 4MEMA 4W9HA 2GLSA 1XXGA 1KTKA 3TL5A 3UI3A 1PDXA 1WXMA 3ZGZA 2G3QB 3EHVA 2PLPA 2JWZA 3V60A 3PZ7A 2LRWA 3J9CA 3N1YC 4HLEA 1AWDA 3B1LX 1Q1OA 1TZ1A 3WANA 4ITKA 4NAMA 4KGTA 3QIJA 2WU5B 1C1YB 1I4PA 2YEPB 2Z0EB 1XD3B 5AZGA 2IGGA 3AE4B 1I7HA 2HJ8A 3QJZA 1T0YA 1WJ4A 3ZQ4A 3U52E 3P2BA 3KQ4A 3TCAA 2R61A 1Z2MA 2IBIB 1V5TA 2JSVX 2KK8A 2KQ7A 4LLGM 2GB1A 4WWMA 4AQ7A 3DHGC 2YEPF 3RNFC 4OHJA 2L83A 2WQYB 2OHFA 2QJLA 5DPWA 3RNGC 2PMVA 1EF1A 3U2SC 2K5PA 3AE8B 1CZPA 2UWQA 3GS2A 1WXQA 2D11A 4YXDB 1SBBB 4HXDA 3PSEB 4C00A 1IGDA 2Y5CA 2H88B 1SJHD 4M0WB 3FAHA 2MQJA 2WGSA 3RCZA 2LI5A 3SDLC 1IYFA 3DWGC 1S3SG 2J52A 2QDFA 1GG3A 4NAWA 5MPOA 2BW2A 4MELA 1FNWA 4GDLB 1KOTA 3RFZB 4LK0M 4HPLB 1LO5D 1V5OA 2KN5A 3NZ3A 1DGJA 4XE0A 1LM8B 4XDDA 3N32A 2J42A 3IAM1 5JHBA 3PLVA 3NVVA 1P98A 1Y56A 4C80A 4BZAA 3JSVB 1H4RA 4LNOA 1P0RA 1RWSA 2G1EA 1ZP0B 2PVGC 3ZYYX 2NTSA 3H7PB 2VH2A 1WXSA 4WJQA 3Q3MC 1YN3A 2M8SA 1HQRD 3PPAA 4KGSA 1E90A 1N63A 4HDOA 4NQLB 1JMLA 1RRBA 4KX6B 3VHTC 5C2TB 3OJ4B 2MJ3A 2WYQA 1WGYA 3PS6A 2L05A 2M56B 2Q5WD 5H92C 2W9NA 3X0WA 1UD7A 3O65B 1SIFA 1WR6E 1Q5WB 2WXGA 4YT0B 2FCNA 2L1AA 4WAAA 3MJWA 4W9FA 2WXLA 4HJKA 1E0ZA 1L6UA 4HCNB 4P16A 1WGDA 3EUB2 2NTTA 4L1BA 4JQWC 3S2AA 1D6EC 1YMHE 5EE3A 3TJPA 3EGRA 4EZKA 4IC7B 3EC8A 3HVDA 3NVWA 4LNNA 2NS5A 2KACA 4DDGD 3DBSA 2HTHA 2RMMA 1NYRA 1CQVA 3ZRCA 2HDEA 1P7EA 5C23A 2L76A 5J2RA 3N1ZC 3Q8AA 3ML8A 2K8HA 3CMMB 4AUQC 2L3ZA 4EZJA 1PGBA 5CHWA 1WH3A 1ZDXA 1F0ZA 2L0TA 3VXWA 2BGFA 3LB8C 1WXVA 3D32A 4MGYE 4ZRKA 2G4SA 1ROEA 3WALA 1E7VA 2I1JA 4JWUC 5E6JA 2K3UA 1HZ5A 3Q8CA 1J7CA 3A9JA 4P7IA 1N62A 3Q14C 4KVGB 2V3NA 2W3SA 2DX5B 2DYBA 1SJED 1TZOA 3IFWB 2WX1A 1PGXA 3BWUD 2AEHA 1OGWA 4I6NB 4NJCA 1MHXA 1E8ZA 3MFGA 2KT7A 4A3PA 4BVUC 2NPTB 4K7WA 1N6ZA 3WCQA 2C9WB 3JYUA 2J0KA 1XCTL 2L00B 4ASWC 4ACFA 4B6WA 2RPQA 2KQ4X 3ZJVA 4MGIE 3VH4B 2CU3A 3ZXRA 5KHQA 1WJNA 2WP9B 1F1HA 2N7EA 4HKQA 2JT4B 4FHKA 4KGRA 1NDDA 2WS3B 1N61A 3IAS1 4MM3B 3IT6B 3MC8A 3V62A 1FEHA 2K22A 5AZFA 3ZNZB 5G5GA 3DCGA 3PRMB 2AQ3B 2ZCCA 4HKZE 3OWEB 4W9JA 2PPHA 4CO7A 2J53A 4NZLB 1C79A 4LDTB 4XZ4A 2RD0A 2EKIA 1FFUA 3Q3FA 3DQVA 3KUCB 2JYTA 3WA0A 1STEA 3AH7A 1R7SA 1WZ3A 1YJJA 4CYEA 1KFYB 3A1QA 1EU4A 3P42A 2K1FA 4IWOA 5EE1A 2QMTA 2MWSB 4FBJB 1KH0A 4D2KA 3ML9A 1GNUA 2KWDA 4WJNA 2X38A 3UQAA 5BO4B 5CHVC 3Q3OC 3RULA 5EE0A 1NI2A 2DWQA 3DHIC 4KZ0A 2KVRA 2WWZA 2QILA 4WH4A 3KW5B 2CS4A 5HI1A 1JWSD 3W2DA 3EFUA 1V81A 4L23A 4S0RA 1I4GA 1QZEA 4FJZA 4N9F4 4HCPB 3NZUA 2A4ZA 3EA6A 3VTVA 2DZMA 4AJYB 3CIRB 4BKSD 3DDCB 3GZNI 2MCNB 4HDQA 4OVVA 4NAWB 3BYTB 4E3CA 2VZKD 3DVGY 3T3NA 3PO0A 4YTMB 1J8CA 4AOFA 3RNEC 2C5LC 3VUWA 2FUHB 2YVCA 3U8ZA 4BKSA 4EEWA 1AARA 2MBOA 2LJ5A 3QHTA 3HHMA 5TR5A 1MI0A 3HM3A 3R66C 1V49A 2GMIC 1YN5A 4IUMB 3KYCD 1QT9A 5D7GA 2GI9A 5LXHA 4NNJB 4HRSA 1UGMA 2A5UA 2MBHA 5EDSA 1T0RC 2EMTA 1QOFA 2CU1A 2LGDA 2CHZA 2C7MB 2CKHB 3BYYB 2FCQA 5JXVA 1EF5A 3R7RA 2LUMA 1WJ6A 1KM7A 2AQ2B 3DPDA 3PREA 1IUEA 1MPEA 1D5MC 4RMAA 3CF6E 2KHWB 4HWIB 1ZKHA 1UH6A 4DBGA 3C0RB 1EUVB 3RZWC 4BBNC 1ZOYB 3AEFB 4KZCA 4IM3A 3RT3B 1FFVA 2QCZA 4WAFA 2LWPA 1RLFA 5J18A 1QOBA 3PGEA 1WI0A 3JVZX 3R2IA 2MSED 1PQSA 4GOCA 3P4RB 4GLSC 1G6JA 3A4RA 4K3BA 1P3QU 3TIXA 3AE2B 4MGKE 3DVGX 3FC4A 1YD8U 2RR9A 1ZXHA 2WXPA 4J6IA 3ETRA 3ZDMC 3N20C 3W1YA 4RM9A 1Q10A 2CJOA 1JROA 5IO9A 1Z5SB 2IZVB 2KX3A 1WM3A 2KFKA 4RNAA 4A8XC 1WRDB 1E7UA 1LXDA 1ZPSA 2RDGA 2WXMA 3AMZA 1WMHB 1TTNA 1I4XA 2JZZA 3BVMA 1L4ZB 3ZTCA 1B1ZA 1DOIA 3A9JB 3C19A 3TMPB 5EE9A 4WQMA 3N30A 3T8MA 2FBWB 3DWMA 1U4AA 2HTME 3H7SA 4ZRJA 4DHZB 3TEZA 1QILA 1TT5B 3L17A 3EFCA 3APFA 3K9PB 1FXAA 3SHQA 4A20A 2WXKA 1FXIA 1XT9B 3GE8C 1XF5L 1MHHE 3NHEB 1QLBB 2IGHA 1M94A 3KYDD 3ZW3A 2JRHA 5C3JB 2WU2B 1D5XC 3LYYA 4PYUA 2ONQA 1WYGA 4BOSC 2AL3A 3AE7B 4TSSA 2IO1B 4DK5A 4PYZA 2KJ6A 4ICUA 3PRZA 4KIKB 2WXJA 3URYA 1QQRA 4WWPA 3VH3B 4ZHOA 1WY8A 2KXJA 1DOXA 1WGHA 1RM6C 5D6JB 3RNAC 4MJSA 5JZEB 1TS2A 1DYQA 4ZRIA 5BYQA 1E6EB 2AX5A 3PRPB 1JQ4A 1UWMA 3DBRI 4PS8A 2N4FA 1AYFA 3V3XA 3HM6X 3NG0A 2DYOA 3U7ZA 4P1BC 1BUIC 4DDID 2WXIA 2K25A 3TEWA 3ZNID 2M4NA 2IO2B 2Z8LA 4ZYSA 2D3AA 2BS3B 4MGZE 3A1QB 4JE3B 4BKGA 2BS4B 3U7DA 2V0GA 1SEBD 3I57A 3IT4B 1ET9A 4CHKA 1MFWA 4URKA 3RMKC 2L52A 2I2YA 4N58A 4DHJD 2LD9A 5D3DA 4IDIA 4GU2A 2FUG1 1V1PA 1L0XB 1IPGA 1SIJA 1JWUD 3FILA 4US8A 5DPRA 3I9V1 4BOZB 2BYVE 3L54A 1J7BA 1NI3A 4USAA 1F2RI 4NJ7A 4HEA1 3V6EB 2KO3A 3HRDD 4ZYNA 4IWQA 2LHDA 2N0SB 3VUYA 1QOGA 2MJEA 3ZXVA 3OJ3A 2LVPA 3N9YC 1TS3A 1MG8A 2KQSA 3W5UB 4LTUA 1C4PA 4HPMB
chains in the Genus database with same CATH topology
4ICVA 1E8ZA 3ENEA 4TV3A 3H7PA 4A3PA 3OAWA 4BVUC 2NPTB 2J0MA 4K7WA 3VTUA 3APCA 5AEKB 2C9WB 3JYUA 1A5RA 2J0KA 2Z59B 4NJ6A 2L00B 4ASWC 4B6WA 4XX5A 2RSUA 2RPQA 3L0WB 2K6QA 2KDEB 5CX3A 4KDIC 4I6LB 4TQ1A 4MGIE 3RD2A 3VH4B 5KHQA 2DAFA 2PE6B 3LDZE 4M8MA 4E74A 1WJNA 1RFAA 4PS3A 2O2VB 2KWCA 4WJOA 2BYEA 2KNBA 1CMXB 3DBHI 3UGBB 4G3XB 2K39A 2N7EA 3NY5A 2JT4B 2ZVOA 4AP4C 4FHKA 1NDDA 2PJHA 4PS7A 1I42A 1KLVA 2UYZB 1R4MI 2R2OA 3DVNU 2EMSA 2D3GA 3V62A 4W9LA 3Q3JA 3ZUNA 3ZNZB 5AZFA 4F8CB 3ZDTA 3R7QA 3DCGA 2L8JA 1WJUA 3ALBA 3AULA 4ANUA 3PRMB 2ZZPB 1NBFC 3VVWB 5AZHA 2ZCCA 4GGQA 2N9EB 4JL9A 2MBEA 4W9JA 2PPHA 4CO7A 4K1RB 4BFRA 2NR2A 3QWZB 4LDTB 1H8CA 4NQKE 2MBQA 4TKNA 1SGHA 2IYDB 2J7QB 2GBMA 4WJPA 3OLMD 4XZ4A 2RD0A 2DHZA 4IM0A 1P9DU 1VCBA 4HVBA 2K6DB 2C7HA 2HD5B 3PLUA 3Q3FA 1WX8A 3DQVA 3KUCB 3WA0A 3PHWB 5D2MB 2EKEC 2JPHA 5IAAC 1F9JA 2GBRA 2KJRA 4BKTA 2R2QA 3M95A 2GBNA 1ZW7A 1GC6A 1WZ3A 2NBWB 3A9KB 1OTRB 4W9CA 4F1SA 4CYEA 3CSTA 3A1QA 1HE8A 3V61A 3A4SC 2KMAA 2K1FA 3IHPC 4LJPB 4IWOA 2B3AA 1YX5B 2KC2A 2MWSB 3B08A 4FBJB 3ZNHB 1TGZB 4A3OA 3ML9A 2MW5A 1GNUA 1WX7A 2J0JA 3JW0X 1V80A 3QA8A 4WJNA 4FA6A 3UQAA 5BO4B 5CHVC 1WE6A 1EO6A 1WYWB 4FULA 4X57B 3CSFA 3RULA 1FXTB 3UIOB 1LQBA 4FJYA 2KDBA 4EOYA 4DXAB 1NI2A 2CHXA 4JIOU 5JH5C 2CR5A 2WDTB 4GB9A 4KZ0A 2BKFA 5FR6A 3UINB 3PHXB 1UZXB 2JUOA 2KVRA 2WWZA 2Z0DB 2KFJA 3APDA 1R4NI 3PVLA 3QCAA 3KW5B 1WX9A 2KTRA 2CS4A 1WMHA 3ZNGC 3IBEA 1WIAA 2IY0B 2L7RA 3M63B 2BWES 4FJVB 4B9KA 2C60A 1WZ0A 4EFOA 4K7SA 4II3B 1WR1A 3EFUA 1V81A 5E6PA 2V3SA 4AWJA 2N9PC 1QZEA 4FJZA 2MP2B 1GJZA 4N9F4 5L83A 1X1MA 4HCPB 3NZUA 2A4ZA 2IO3B 5D94A 3VTVA 3ZO5B 2KFKB 2DZMA 4AJYB 1D3ZA 1C3TA 2KTFA 4AJWA 2JVCA 3AXCA 1E5WA 1YJ1A 2XK5B 5DPSA 4MSQB 3GOEA 2KLCA 4BKSD 2MBBB 4GXBA 3DDCB 4K7UA 3GZNI 2DZIA 2MCNB 4HDQA 4MSMB 4OVVA 5J17A 4NAWB 4K81A 3IG3A 2NPTA 4JLCA 4E3CA 5DPTA 3QX1A 2BWFA 2FIFA 2ZEQA 2KANA 3DVGY 2JF5A 2NVUI 1J8CA 1ISNA 4KDLB 3VAWA 4AOFA 4IM2A 2C5LC 3VUWA 4BBNF 3AU5A 2FUHB 4FLHA 2ASQA 4M8NA 3KH0A 2YVCA 3U8ZA 4BKSA 4W9KA 4GSWA 4MH0E 2OJRA 4KSKC 4I6PA 4EEWA 1AARA 3T9LA 2MBOA 1RAXA 2LJ5A 2MA9B 4LDTD 2HE7A 3QHTA 2N7DA 3HHMA 3M62B 5LLIA 5TR5A 2DAJA 3HM3A 4KIKA 3KUDB 3AI5A 2ZPYA 2KWVB 3R66C 1V49A 3PV1A 3R3MA 2GMIC 4W9EA 3W1SC 1ZGUB 4IUMB 3DVNV 4GMVA 3KYCD 4MM3A 4W9IA 2FAZA 5D7GA 4FADA 3UIPB 4NNJB 5LXHA 1P1AA 1UGMA 2KMCA 2A5UA 2MBHA 3QC8B 5EDSA 3VQIA 2EMTA 4WWOA 2L0FA 2CU1A 2LGDA 2CHZA 2XBBC 4MEMA 4WWNA 2C7MB 4W9HA 4DWFA 4IW0A 4B95A 2AL6A 2CKHB 3TL5A 2Y5BB 2FCQA 1WM2A 1EF5A 4WQOB 3R7RA 3SD5A 1BT0A 1WXMA 2V1YA 2G3QB 3EHVA 1WJ6A 1KM7A 2JWZA 3V60A 3A33B 2LRWA 3DPDA 3PREA 4HLEA 2C7NB 2KKCA 4ZDVA 4RMAA 3B1LX 1Q1OA 3CF6E 4FN2A 3ONSA 1TZ1A 3WANA 3QIJA 4MJSB 1IP9A 2M0XA 4MDKE 1WE7A 5IA7A 3H1UA 2G45B 2KHWB 3NOBA 3PZDA 1C1YB 4HWIB 2Z0EB 4IWPA 1XD3B 1ZKHA 1UH6A 3UF8A 4DBGA 5CHFA 4ANXA 1E8XA 5AZGA 3C0RB 2HJ8A 1I35A 2WX0A 5GMVA 1EUVB 2G4DB 2BF8B 3QJZA 3RZWC 1T0YA 1WJ4A 4BBNC 3WAMA 2DZKA 3P2BA 3TCAA 4KZCA 4IM3A 3EECA 1GUAB 1Z2MA 2V4LA 3RT3B 1V9JA 2IBIB 3PTFC 4W9GA 2NBUA 2LWPA 4EKUA 3KUZA 1RLFA 1V5TA 3VUXA 2GOWA 2AWTA 4RM8A 5J18A 2NBVB 5C1ZA 3L10B 2KK8A 2KQ7A 3PGEA 1WI0A 3JVZX 3WIMA 3KVFB 2MLBA 2MSED 2ZVNA 1PQSA 4G0NB 1UELA 4GOCA 2D2QA 1G6JA 3A4RA 1P3QU 2IO0B 3TIXA 1J19A 1JRUA 2QHOA 3ZRFA 3MHSD 4MGKE 3DVGX 3SU8X 2O6VB 2PEAA 5DPWA 1EF1A 3NS8A 1YD8U 2RR9A 2UWQA 4J6IA 3ZDMC 3W1YA 4RM9A 4XC2A 3L13A 2FNJB 2LGXA 2D11A 1Z5SB 2IZVB 2MP2A 4HXDA 2KX3A 3PSEB 2BKRB 5L95C 1WM3A 4M0WB 2KFKA 2LZ6A 1WRDB 2LASA 1E7UA 1LXDA 2MQJA 3ECIA 2XK5A 2ZNVB 2LI5A 3RCZA 2JRIB 3SDLC 1IYFA 1S3SG 3V6CB 1WMHB 4NPNA 4KV2A 1TTNA 1GG3A 1WGGA 3WAPA 4NAWA 1E8YA 2JZZA 4EUTA 1Q0WB 4MELA 3ZTCA 3L16A 4W9DA 4GDLB 3A9JB 1VD2A 3VFKA 1KOTA 1LFDA 4EZLA 4DHJB 3TMPB 4HPLB 1V5OA 3N30A 2KN5A 2YLMA 3T8MA 2DYMA 2LVQA 4GDKB 2KDIA 2M1MA 3NZSA 1U4AA 3ZLZA 1LM8B 1YQBA 4DHZB 3H7SA 4ZRJA 3N32A 2AYOB 3L17A 3APFA 3K9PB 2KJHB 3SHQA 2N1VA 3K9OB 3PLVA 5JHBA 1P98A 3VDZA 1V6EA 4A20A 2O2VA 1XT9B 1S1QB 4GN1A 3JSVB 1H4RA 3NHEB 1P0RA 2NCNA 3KYDD 1M94A 1L2NA 3ZW3A 3QQ8B 5KHOA 3H7PB 2MRPA 3BINA 3IVFA 1WXSA 4F7ZA 2KLGA 2JRHA 5CTRC 3B0AA 4LCDE 3RZFA 3H6NA 4WJQA 2KZRA 2M8SA 2REXA 3PPAA 4PYUA 1E90A 4NQLB 4HDOA 2GBJA 4JGHB 3M3JA 5G2NA 4BOSC 2AL3A 1RRBA 2IO1B 2KC1A 4DK5A 4PYZA 2KJ6A 3VHTC 3H9DA 3I3TB 3OJ4B 4ICUA 4GIVA 4LJOB 2WYQA 1WGYA 1SE9A 3PRZA 3PS6A 2L05A 3UQBA 4KIKB 3VH3B 4WWPA 4OVUA 1WY8A 5DCNA 2KXJA 4II2B 2W9NA 3X0WA 1GC7A 2LUEA 1WGHA 5D6JB 1UD7A 3TBLD 4IG7B 4MJSA 3O65B 5JZEB 1SIFA 3HK0A 1WR6E 1Q5WB 3PT2B 4ZRIA 3HIZA 3W1SA 2FCNA 4WAAA 3MJWA 1KJTA 3A9KA 3PRPB 4ANVA 4W9FA 2IY1B 2XEWA 4HJKA 3DBRI 2D07B 2KX0A 3MTNB 4HK2A 2N4FA 4HCNB 4PS8A 4TUUA 1WGDA 3HM6X 2GBKA 2DYOA 5G55A 1WF9A 5HKHA 4DDID 4JQWC 3S2AA 2I1KA 2K25A 2O6VD 3TJPA 3ZNID 5E6OA 2M4NA 1WXAA 2IO2B 2BYFA 4EZKA 4IC7B 5JHAA 3EC8A 2PE9A 5E6NA 4ANWA 4YL8A 2NS5A 2ZNVC 2LVOA 4DDGD 3DBSA 3ZIMA 2OOBB 2KD0A 2JXXA 1XQQA 2HTHA 2CHWA 2K8CA 4TQ0A 3QARA 2KDFB 3A1QB 4MGZE 3X23A 3ZRCA 4BKGA 1WFYA 5C23A 2K8BA 3U7DA 2L76A 5LXIB 5J2RA 3RUIB 3ML8A 2K8HA 2KOXA 2M17A 3L08A 2O6VA 2DENB 3CMMB 3VTWA 4CHKA 4KSLC 3RYTA 4URKA 2KWUB 4AUQC 2VRRB 3QK0A 2L3ZA 4EZJA 4DHJD 5CHWA 1WH3A 2LD9A 2MX2A 1J0GA 2FCMA 2L0TA 4G50A 2BGFA 3VXWA 3LJ3A 4GU2A 1WXVA 2ZPNA 3AU4A 3WAOA 3D32A 1YIWA 1UBIA 2LRUA 2ZCBA 4DHZE 2N9XA 3DBLI 4MGYE 2G4SA 4ZRKA 1IPGA 1UBQA 1V86A 3WALA 1E7VA 1OEYA 2LXAA 3N3KB 2I1JA 1V2YA 3QAQA 1OQYA 1WGRA 2KTRB 4E71A 1YX6B 5DPRA 4BOZB 1L7YA 2BYVE 3L54A 2D10A 4GDLA 3A9JA 2BPSA 2LGYA 4P7IA 2N1WA 1E8WA 4NJ7A 2ZJDA 4KVGB 3V6EB 2DX5B 2RGFA 2KO3A 1OEYJ 3ZTDA 2DYBA 2FIDA 4GDKA 3IFWB 4ZYNA 2WX1A 4IWQA 3VUYA 3ZVVA 4G11A 4NY0A 3ZKJC 1Y8RC 3OJ3A 3BY4B 2JZ3B 2JY6A 2LVPA 2DZJA 1TBEA 2LXCA 2AEHA 1OGWA 3DOWA 1MG8A 2KQSA 4I6NB 3U30A 1K8RB 2FCSA 3JSVA 4FHJA 4HPMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ICV A;  1E8Z A;  3ENE A;  4TV3 A;  3H7P A;  4A3P A;  3OAW A;  4BVU C;  2NPT B;  2J0M A;  4K7W A;  3VTU A;  3APC A;  5AEK B;  2C9W B;  3JYU A;  1A5R A;  2J0K A;  2Z59 B;  4NJ6 A;  2L00 B;  4ASW C;  4B6W A;  4XX5 A;  2RSU A;  2RPQ A;  3L0W B;  2K6Q A;  2KDE B;  5CX3 A;  4KDI C;  4I6L B;  4TQ1 A;  4MGI E;  3RD2 A;  3VH4 B;  5KHQ A;  2DAF A;  2PE6 B;  3LDZ E;  4M8M A;  4E74 A;  1WJN A;  1RFA A;  4PS3 A;  2O2V B;  2KWC A;  4WJO A;  2BYE A;  2KNB A;  1CMX B;  3DBH I;  3UGB B;  4G3X B;  2K39 A;  2N7E A;  3NY5 A;  2JT4 B;  2ZVO A;  4AP4 C;  4FHK A;  1NDD A;  2PJH A;  4PS7 A;  1I42 A;  1KLV A;  2UYZ B;  1R4M I;  2R2O A;  3DVN U;  2EMS A;  2D3G A;  3V62 A;  4W9L A;  3Q3J A;  3ZUN A;  3ZNZ B;  5AZF A;  4F8C B;  3ZDT A;  3R7Q A;  3DCG A;  2L8J A;  1WJU A;  3ALB A;  3AUL A;  4ANU A;  3PRM B;  2ZZP B;  1NBF C;  3VVW B;  5AZH A;  2ZCC A;  4GGQ A;  2N9E B;  4JL9 A;  2MBE A;  4W9J A;  2PPH A;  4CO7 A;  4K1R B;  4BFR A;  2NR2 A;  3QWZ B;  4LDT B;  1H8C A;  4NQK E;  2MBQ A;  4TKN A;  1SGH A;  2IYD B;  2J7Q B;  2GBM A;  4WJP A;  3OLM D;  4XZ4 A;  2RD0 A;  2DHZ A;  4IM0 A;  1P9D U;  1VCB A;  4HVB A;  2K6D B;  2C7H A;  2HD5 B;  3PLU A;  3Q3F A;  1WX8 A;  3DQV A;  3KUC B;  3WA0 A;  3PHW B;  5D2M B;  2EKE C;  2JPH A;  5IAA C;  1F9J A;  2GBR A;  2KJR A;  4BKT A;  2R2Q A;  3M95 A;  2GBN A;  1ZW7 A;  1GC6 A;  1WZ3 A;  2NBW B;  3A9K B;  1OTR B;  4W9C A;  4F1S A;  4CYE A;  3CST A;  3A1Q A;  1HE8 A;  3V61 A;  3A4S C;  2KMA A;  2K1F A;  3IHP C;  4LJP B;  4IWO A;  2B3A A;  1YX5 B;  2KC2 A;  2MWS B;  3B08 A;  4FBJ B;  3ZNH B;  1TGZ B;  4A3O A;  3ML9 A;  2MW5 A;  1GNU A;  1WX7 A;  2J0J A;  3JW0 X;  1V80 A;  3QA8 A;  4WJN A;  4FA6 A;  3UQA A;  5BO4 B;  5CHV C;  1WE6 A;  1EO6 A;  1WYW B;  4FUL A;  4X57 B;  3CSF A;  3RUL A;  1FXT B;  3UIO B;  1LQB A;  4FJY A;  2KDB A;  4EOY A;  4DXA B;  1NI2 A;  2CHX A;  4JIO U;  5JH5 C;  2CR5 A;  2WDT B;  4GB9 A;  4KZ0 A;  2BKF A;  5FR6 A;  3UIN B;  3PHX B;  1UZX B;  2JUO A;  2KVR A;  2WWZ A;  2Z0D B;  2KFJ A;  3APD A;  1R4N I;  3PVL A;  3QCA A;  3KW5 B;  1WX9 A;  2KTR A;  2CS4 A;  1WMH A;  3ZNG C;  3IBE A;  1WIA A;  2IY0 B;  2L7R A;  3M63 B;  2BWE S;  4FJV B;  4B9K A;  2C60 A;  1WZ0 A;  4EFO A;  4K7S A;  4II3 B;  1WR1 A;  3EFU A;  1V81 A;  5E6P A;  2V3S A;  4AWJ A;  2N9P C;  1QZE A;  4FJZ A;  2MP2 B;  1GJZ A;  4N9F 4;  5L83 A;  1X1M A;  4HCP B;  3NZU A;  2A4Z A;  2IO3 B;  5D94 A;  3VTV A;  3ZO5 B;  2KFK B;  2DZM A;  4AJY B;  1D3Z A;  1C3T A;  2KTF A;  4AJW A;  2JVC A;  3AXC A;  1E5W A;  1YJ1 A;  2XK5 B;  5DPS A;  4MSQ B;  3GOE A;  2KLC A;  4BKS D;  2MBB B;  4GXB A;  3DDC B;  4K7U A;  3GZN I;  2DZI A;  2MCN B;  4HDQ A;  4MSM B;  4OVV A;  5J17 A;  4NAW B;  4K81 A;  3IG3 A;  2NPT A;  4JLC A;  4E3C A;  5DPT A;  3QX1 A;  2BWF A;  2FIF A;  2ZEQ A;  2KAN A;  3DVG Y;  2JF5 A;  2NVU I;  1J8C A;  1ISN A;  4KDL B;  3VAW A;  4AOF A;  4IM2 A;  2C5L C;  3VUW A;  4BBN F;  3AU5 A;  2FUH B;  4FLH A;  2ASQ A;  4M8N A;  3KH0 A;  2YVC A;  3U8Z A;  4BKS A;  4W9K A;  4GSW A;  4MH0 E;  2OJR A;  4KSK C;  4I6P A;  4EEW A;  1AAR A;  3T9L A;  2MBO A;  1RAX A;  2LJ5 A;  2MA9 B;  4LDT D;  2HE7 A;  3QHT A;  2N7D A;  3HHM A;  3M62 B;  5LLI A;  5TR5 A;  2DAJ A;  3HM3 A;  4KIK A;  3KUD B;  3AI5 A;  2ZPY A;  2KWV B;  3R66 C;  1V49 A;  3PV1 A;  3R3M A;  2GMI C;  4W9E A;  3W1S C;  1ZGU B;  4IUM B;  3DVN V;  4GMV A;  3KYC D;  4MM3 A;  4W9I A;  2FAZ A;  5D7G A;  4FAD A;  3UIP B;  4NNJ B;  5LXH A;  1P1A A;  1UGM A;  2KMC A;  2A5U A;  2MBH A;  3QC8 B;  5EDS A;  3VQI A;  2EMT A;  4WWO A;  2L0F A;  2CU1 A;  2LGD A;  2CHZ A;  2XBB C;  4MEM A;  4WWN A;  2C7M B;  4W9H A;  4DWF A;  4IW0 A;  4B95 A;  2AL6 A;  2CKH B;  3TL5 A;  2Y5B B;  2FCQ A;  1WM2 A;  1EF5 A;  4WQO B;  3R7R A;  3SD5 A;  1BT0 A;  1WXM A;  2V1Y A;  2G3Q B;  3EHV A;  1WJ6 A;  1KM7 A;  2JWZ A;  3V60 A;  3A33 B;  2LRW A;  3DPD A;  3PRE A;  4HLE A;  2C7N B;  2KKC A;  4ZDV A;  4RMA A;  3B1L X;  1Q1O A;  3CF6 E;  4FN2 A;  3ONS A;  1TZ1 A;  3WAN A;  3QIJ A;  4MJS B;  1IP9 A;  2M0X A;  4MDK E;  1WE7 A;  5IA7 A;  3H1U A;  2G45 B;  2KHW B;  3NOB A;  3PZD A;  1C1Y B;  4HWI B;  2Z0E B;  4IWP A;  1XD3 B;  1ZKH A;  1UH6 A;  3UF8 A;  4DBG A;  5CHF A;  4ANX A;  1E8X A;  5AZG A;  3C0R B;  2HJ8 A;  1I35 A;  2WX0 A;  5GMV A;  1EUV B;  2G4D B;  2BF8 B;  3QJZ A;  3RZW C;  1T0Y A;  1WJ4 A;  4BBN C;  3WAM A;  2DZK A;  3P2B A;  3TCA A;  4KZC A;  4IM3 A;  3EEC A;  1GUA B;  1Z2M A;  2V4L A;  3RT3 B;  1V9J A;  2IBI B;  3PTF C;  4W9G A;  2NBU A;  2LWP A;  4EKU A;  3KUZ A;  1RLF A;  1V5T A;  3VUX A;  2GOW A;  2AWT A;  4RM8 A;  5J18 A;  2NBV B;  5C1Z A;  3L10 B;  2KK8 A;  2KQ7 A;  3PGE A;  1WI0 A;  3JVZ X;  3WIM A;  3KVF B;  2MLB A;  2MSE D;  2ZVN A;  1PQS A;  4G0N B;  1UEL A;  4GOC A;  2D2Q A;  1G6J A;  3A4R A;  1P3Q U;  2IO0 B;  3TIX A;  1J19 A;  1JRU A;  2QHO A;  3ZRF A;  3MHS D;  4MGK E;  3DVG X;  3SU8 X;  2O6V B;  2PEA A;  5DPW A;  1EF1 A;  3NS8 A;  1YD8 U;  2RR9 A;  2UWQ A;  4J6I A;  3ZDM C;  3W1Y A;  4RM9 A;  4XC2 A;  3L13 A;  2FNJ B;  2LGX A;  2D11 A;  1Z5S B;  2IZV B;  2MP2 A;  4HXD A;  2KX3 A;  3PSE B;  2BKR B;  5L95 C;  1WM3 A;  4M0W B;  2KFK A;  2LZ6 A;  1WRD B;  2LAS A;  1E7U A;  1LXD A;  2MQJ A;  3ECI A;  2XK5 A;  2ZNV B;  2LI5 A;  3RCZ A;  2JRI B;  3SDL C;  1IYF A;  1S3S G;  3V6C B;  1WMH B;  4NPN A;  4KV2 A;  1TTN A;  1GG3 A;  1WGG A;  3WAP A;  4NAW A;  1E8Y A;  2JZZ A;  4EUT A;  1Q0W B;  4MEL A;  3ZTC A;  3L16 A;  4W9D A;  4GDL B;  3A9J B;  1VD2 A;  3VFK A;  1KOT A;  1LFD A;  4EZL A;  4DHJ B;  3TMP B;  4HPL B;  1V5O A;  3N30 A;  2KN5 A;  2YLM A;  3T8M A;  2DYM A;  2LVQ A;  4GDK B;  2KDI A;  2M1M A;  3NZS A;  1U4A A;  3ZLZ A;  1LM8 B;  1YQB A;  4DHZ B;  3H7S A;  4ZRJ A;  3N32 A;  2AYO B;  3L17 A;  3APF A;  3K9P B;  2KJH B;  3SHQ A;  2N1V A;  3K9O B;  3PLV A;  5JHB A;  1P98 A;  3VDZ A;  1V6E A;  4A20 A;  2O2V A;  1XT9 B;  1S1Q B;  4GN1 A;  3JSV B;  1H4R A;  3NHE B;  1P0R A;  2NCN A;  3KYD D;  1M94 A;  1L2N A;  3ZW3 A;  3QQ8 B;  5KHO A;  3H7P B;  2MRP A;  3BIN A;  3IVF A;  1WXS A;  4F7Z A;  2KLG A;  2JRH A;  5CTR C;  3B0A A;  4LCD E;  3RZF A;  3H6N A;  4WJQ A;  2KZR A;  2M8S A;  2REX A;  3PPA A;  4PYU A;  1E90 A;  4NQL B;  4HDO A;  2GBJ A;  4JGH B;  3M3J A;  5G2N A;  4BOS C;  2AL3 A;  1RRB A;  2IO1 B;  2KC1 A;  4DK5 A;  4PYZ A;  2KJ6 A;  3VHT C;  3H9D A;  3I3T B;  3OJ4 B;  4ICU A;  4GIV A;  4LJO B;  2WYQ A;  1WGY A;  1SE9 A;  3PRZ A;  3PS6 A;  2L05 A;  3UQB A;  4KIK B;  3VH3 B;  4WWP A;  4OVU A;  1WY8 A;  5DCN A;  2KXJ A;  4II2 B;  2W9N A;  3X0W A;  1GC7 A;  2LUE A;  1WGH A;  5D6J B;  1UD7 A;  3TBL D;  4IG7 B;  4MJS A;  3O65 B;  5JZE B;  1SIF A;  3HK0 A;  1WR6 E;  1Q5W B;  3PT2 B;  4ZRI A;  3HIZ A;  3W1S A;  2FCN A;  4WAA A;  3MJW A;  1KJT A;  3A9K A;  3PRP B;  4ANV A;  4W9F A;  2IY1 B;  2XEW A;  4HJK A;  3DBR I;  2D07 B;  2KX0 A;  3MTN B;  4HK2 A;  2N4F A;  4HCN B;  4PS8 A;  4TUU A;  1WGD A;  3HM6 X;  2GBK A;  2DYO A;  5G55 A;  1WF9 A;  5HKH A;  4DDI D;  4JQW C;  3S2A A;  2I1K A;  2K25 A;  2O6V D;  3TJP A;  3ZNI D;  5E6O A;  2M4N A;  1WXA A;  2IO2 B;  2BYF A;  4EZK A;  4IC7 B;  5JHA A;  3EC8 A;  2PE9 A;  5E6N A;  4ANW A;  4YL8 A;  2NS5 A;  2ZNV C;  2LVO A;  4DDG D;  3DBS A;  3ZIM A;  2OOB B;  2KD0 A;  2JXX A;  1XQQ A;  2HTH A;  2CHW A;  2K8C A;  4TQ0 A;  3QAR A;  2KDF B;  3A1Q B;  4MGZ E;  3X23 A;  3ZRC A;  4BKG A;  1WFY A;  5C23 A;  2K8B A;  3U7D A;  2L76 A;  5LXI B;  5J2R A;  3RUI B;  3ML8 A;  2K8H A;  2KOX A;  2M17 A;  3L08 A;  2O6V A;  2DEN B;  3CMM B;  3VTW A;  4CHK A;  4KSL C;  3RYT A;  4URK A;  2KWU B;  4AUQ C;  2VRR B;  3QK0 A;  2L3Z A;  4EZJ A;  4DHJ D;  5CHW A;  1WH3 A;  2LD9 A;  2MX2 A;  1J0G A;  2FCM A;  2L0T A;  4G50 A;  2BGF A;  3VXW A;  3LJ3 A;  4GU2 A;  1WXV A;  2ZPN A;  3AU4 A;  3WAO A;  3D32 A;  1YIW A;  1UBI A;  2LRU A;  2ZCB A;  4DHZ E;  2N9X A;  3DBL I;  4MGY E;  2G4S A;  4ZRK A;  1IPG A;  1UBQ A;  1V86 A;  3WAL A;  1E7V A;  1OEY A;  2LXA A;  3N3K B;  2I1J A;  1V2Y A;  3QAQ A;  1OQY A;  1WGR A;  2KTR B;  4E71 A;  1YX6 B;  5DPR A;  4BOZ B;  1L7Y A;  2BYV E;  3L54 A;  2D10 A;  4GDL A;  3A9J A;  2BPS A;  2LGY A;  4P7I A;  2N1W A;  1E8W A;  4NJ7 A;  2ZJD A;  4KVG B;  3V6E B;  2DX5 B;  2RGF A;  2KO3 A;  1OEY J;  3ZTD A;  2DYB A;  2FID A;  4GDK A;  3IFW B;  4ZYN A;  2WX1 A;  4IWQ A;  3VUY A;  3ZVV A;  4G11 A;  4NY0 A;  3ZKJ C;  1Y8R C;  3OJ3 A;  3BY4 B;  2JZ3 B;  2JY6 A;  2LVP A;  2DZJ A;  1TBE A;  2LXC A;  2AEH A;  1OGW A;  3DOW A;  1MG8 A;  2KQS A;  4I6N B;  3U30 A;  1K8R B;  2FCS A;  3JSV A;  4FHJ A;  4HPM B; 
#chains in the Genus database with same CATH topology
 4REZ A;  4TV3 A;  3OAW A;  2ICI A;  5AEK B;  3VTU A;  4P1C C;  4LNF A;  4XX5 A;  2PIA A;  1TJE A;  3AE9 B;  5CX3 A;  4KDI C;  2PW9 A;  3RD2 A;  1GAQ B;  2PE6 B;  4IKG A;  4E74 A;  4RGN A;  1RFA A;  4UDU C;  2O2V B;  4WJO A;  2BYE A;  3DBH I;  2K39 A;  3NY5 A;  1YOV B;  3AE5 B;  2BB6 A;  1D5Z C;  4PS7 A;  2VZK B;  5G5H A;  2D3G A;  1VLB A;  2ZW0 A;  3R7Q A;  3AUL A;  1NBF C;  5AZH A;  2V4I B;  4A90 A;  2HJ1 A;  1ZE3 D;  2NR2 A;  4N59 A;  4NQK E;  4WJP A;  1UUP A;  4IM0 A;  1VCB A;  2K6D B;  2HD5 B;  1WX8 A;  3AM9 A;  3PHW B;  5BMG A;  1F9J A;  3SFE B;  2R2Q A;  3M95 A;  2VH1 A;  1ZW7 A;  3A9K B;  3I5J C;  3P1M A;  1FNU A;  3CST A;  1F2R C;  1DOY A;  4LJP B;  3GB1 A;  4ARC A;  1TGZ B;  1XO3 A;  4A3O A;  1FCL A;  2J0J A;  1V80 A;  3NVY A;  1V8C A;  1WE6 A;  2IPK D;  4HPP A;  4X57 B;  4OZB A;  3CSF A;  3MC0 B;  2KYW A;  1FXT B;  3UIO B;  1UNS A;  1LQB A;  5IP4 D;  3TEX A;  4FJY A;  2M19 A;  2WXH A;  4GB9 A;  5FR6 A;  3BZD B;  2JUO A;  3PVL A;  1BML C;  1R4N I;  2IJ0 A;  3RI7 C;  2KTR A;  1WMH A;  3IBE A;  2LMC A;  2BWE S;  2C60 A;  1HZ6 A;  1TKE A;  1WZ0 A;  4RH6 A;  1VR9 A;  5L83 A;  2IO3 B;  2L32 A;  2KFK B;  1C3T A;  2KTF A;  4AJW A;  3AXC A;  3GZN B;  3GOE A;  2N9K A;  3IXS A;  2DZI A;  2INC C;  1ESF A;  2Y3A A;  4MSM B;  5J17 A;  4K81 A;  4M01 A;  2ZW1 A;  2BWF A;  2FIF A;  2ZEQ A;  2JF5 A;  2NVU I;  1ISN A;  1SSN A;  4RFB A;  3VAW A;  4BBN F;  3AU5 A;  4FLH A;  3KH0 A;  3AEB B;  1D4B A;  4W9K A;  2WXR A;  2PTL A;  2OJR A;  2WDQ B;  1F52 A;  3T9L A;  2UU7 A;  3M62 B;  4RF1 A;  4KIK A;  3KUD B;  2BB5 A;  3PV1 A;  4W9E A;  3W1S C;  2WXF A;  3UIP B;  4FXC A;  3R2T A;  2BYT A;  3QC8 B;  1MVK A;  2XBB C;  1L0Y B;  4WWN A;  3H8H A;  2E3T A;  5LNK 1;  2Y5B B;  1WM2 A;  3SD5 A;  4WQO B;  1TIF A;  1BT0 A;  2V1Y A;  1QF6 A;  3A33 B;  2DBY A;  2ACZ B;  2XNA C;  1K50 A;  1GB4 A;  2KKC A;  2RDH A;  4FN2 A;  1FO4 A;  4RGT A;  4MJS B;  1IP9 A;  2BQQ A;  1WE7 A;  5IA7 A;  3H1U A;  3NOB A;  2H89 B;  2JXT A;  4IWP A;  1L4D B;  5CHF A;  4ANX A;  1KRH A;  5GMV A;  2BF8 B;  1ZUD 2;  3AB5 A;  3WAM A;  1WRI A;  3BII D;  1GUA B;  3Q3N C;  1V97 A;  4W9G A;  2V9H A;  1OQR A;  3VUX A;  1ACC A;  4RM8 A;  2NBV B;  1SE3 A;  3WIM A;  2MLB A;  2NMQ A;  4G0N B;  1UEL A;  2CJN A;  4OZA A;  2WNM A;  2IO0 B;  1J19 A;  3ZRF A;  3C8Y A;  5BMI A;  3SU8 X;  2PEA A;  1HEZ E;  5H8Y E;  2EEL A;  2FNJ B;  4XYC A;  2MP2 A;  4DXF A;  5L95 C;  2JZP A;  1V1P B;  1VJK A;  2LAS A;  3ECI A;  2XK5 A;  3V6C B;  1E7P B;  2G9H D;  3FIL B;  3WAP A;  1E8Y A;  2W3R A;  1Q0W B;  3L16 A;  4W9D A;  3VFK A;  4EZL A;  4DHJ B;  2YLM A;  2LVQ A;  2M1M A;  3ZLZ A;  5HFY A;  1YQB A;  3W5V B;  2IDY A;  2AYO B;  2KJH B;  3K9O B;  2MEK A;  3VDZ A;  2O2V A;  1S1Q B;  3BK2 A;  4GN1 A;  4MH8 A;  2NCN A;  1L2N A;  3QQ8 B;  4TMA B;  2MRP A;  3IVF A;  4LCD E;  3H6N A;  2KZR A;  1LGR A;  3VRA B;  2GBJ A;  3M3J A;  5G2N A;  3AED B;  1ENF A;  5BYS A;  1T0Q C;  4GIV A;  4LJO B;  3UQB A;  1TS4 A;  1GC7 A;  3NVZ A;  5I4D A;  3TBL D;  4JX1 C;  5HHD G;  3HIZ A;  3DBR B;  1KJT A;  3A9K A;  4ANV A;  1I4Q A;  2D07 B;  2KX0 A;  3MTN B;  4HK2 A;  4TUU A;  2GBK A;  1WF9 A;  4Q2J A;  2I1K A;  1PGA A;  2O6V D;  2W82 A;  1JWB D;  4HRO A;  2BYF A;  5JHA A;  2KAJ A;  4DXG A;  4YL8 A;  2RDB C;  2ZNV C;  2LVO A;  3ZIM A;  1PFD A;  1XLQ A;  1XQQ A;  2CHW A;  1WWT A;  2INP E;  1JAL A;  2K8C A;  4TQ0 A;  3X23 A;  2WXN A;  1WFY A;  5LXI B;  3NUH B;  3SFD B;  4RGO S;  1L5P A;  2WXQ A;  2O6V A;  2DEN B;  4KSL C;  3U4E G;  1XLO A;  3RYT A;  4RGM A;  2VRR B;  3QK0 A;  2MX2 A;  2JWU A;  1J0G A;  2FCM A;  3LJ3 A;  3WAO A;  3N1X C;  2ZPN A;  1B9R A;  4EE2 A;  2LRU A;  2ZCB A;  2INN E;  2N9X A;  3DBL I;  1UBQ A;  1V86 A;  4XDC A;  1OEY A;  1EM7 A;  2KTR B;  4E71 A;  3ZJU A;  1GPX A;  1L7Y A;  2D10 A;  2BPS A;  2LGY A;  2X8X X;  2RGF A;  1N5X A;  1BXT A;  1OEY J;  1V1O A;  2FID A;  4GDK A;  4G11 A;  5D3I B;  4NY0 A;  3ZKJ C;  1SXT A;  2JY6 A;  1TBE A;  1RFK A;  2LXC A;  3DOW A;  2LFI A;  4IOI E;  3U30 A;  1K8R B;  4B0M A;  1SF0 A;  1HTQ A;  4FHJ A;  1MJD A;  1HA5 A;  1YN4 A;  2J0M A;  3APC A;  2MJD A;  1A5R A;  2K6Q A;  4XWW A;  4OVZ A;  1YNT E;  4I6L B;  4TQ1 A;  3MJ5 A;  3DBH B;  3LDZ E;  4M8M A;  3T3O A;  4PS3 A;  2KNB A;  3TUO A;  1CMX B;  1T0S C;  3P4Q B;  5AUK A;  4AP4 C;  1KLV A;  2UYZ B;  1R4M I;  2R2O A;  2JX5 A;  2EMS A;  1IBX A;  1NYQ A;  3SEB A;  2BTE A;  4W9L A;  3Q3J A;  3ZUN A;  4F8C B;  3ZDT A;  3BK1 A;  2L8J A;  1WJU A;  3VVW B;  2B76 B;  2JU6 X;  4GGQ A;  3PZ8 A;  2N9E B;  4S17 A;  4K1R B;  4BFR A;  4PK1 A;  3QWZ B;  1H8C A;  2E6X A;  4TKN A;  2MBQ A;  1QOA A;  2GBM A;  3OLM D;  2DHZ A;  4H2A A;  2C7H A;  1C4C A;  2WHI A;  5D2M B;  2EKE C;  2JPH A;  1JWA D;  2GBN A;  1GC6 A;  2SAK A;  1NEK B;  1OTR B;  3V61 A;  1HE8 A;  3B9J A;  3A4S C;  2KMA A;  3IHP C;  3ZJT A;  5FKA C;  2KN4 A;  1UWX A;  1YX5 B;  1JW9 D;  4M02 A;  3B08 A;  1C9F A;  5HG2 A;  2MHJ A;  2QIE B;  3TEY A;  1EO6 A;  1WYW B;  4FUL A;  4EOY A;  5AUI A;  3BVG A;  2CHX A;  4ZHP A;  1R4N B;  2BBC A;  1VZ7 A;  4L2Y A;  2XN9 C;  3HVZ A;  3APD A;  3ZNG C;  3M63 B;  4FJV B;  4EFO A;  3I63 C;  5FK9 C;  3P63 A;  5E6P A;  2MP2 B;  1GJZ A;  1X1M A;  5D94 A;  3ZO5 B;  1D3Z A;  2N7J A;  1AN8 A;  4XGA B;  2JVC A;  2DLB A;  1E5W A;  1YJ1 A;  2XK5 B;  5DPS A;  4MSQ B;  2KLC A;  3NRZ A;  4GXB A;  4K7U A;  1J7A A;  3B2G A;  4ZRQ A;  2KMM A;  3Q2A C;  2QC8 A;  3IG3 A;  4JLC A;  2KAN A;  2WDR B;  1KLU D;  1XEE A;  1XLP A;  3NS1 A;  2ASQ A;  4M8N A;  2GRI A;  1E10 A;  3B2F A;  4GSW A;  4MH0 E;  3NJT A;  4I6P A;  5FR3 A;  1GOZ A;  1RAX A;  2MA9 B;  5LLI A;  2HE7 A;  3L4P A;  3AI5 A;  3AEC B;  3R3M A;  3DVN V;  3OG5 A;  4GMV A;  4P6V F;  4R3D A;  1P1A A;  2KMC A;  2D3C A;  4DWF A;  1TY2 A;  4IW0 A;  4B95 A;  1IGC A;  2AL6 A;  1SB3 C;  3E56 A;  4PT5 A;  3RN9 C;  2KDM A;  1TYG B;  1VRA B;  3DHH C;  2QEJ C;  3RPF C;  2C7N B;  1TKG A;  1VDV A;  2Y5P A;  4ZDV A;  5BYR A;  3ONS A;  3TSS A;  4KKI A;  3FKY A;  1KF6 B;  1WSP A;  2M0X A;  4MDK E;  4BAX A;  2G45 B;  4MAC A;  3PZD A;  4US9 A;  3UF8 A;  1E8X A;  2BT6 A;  1JCK B;  3AEE B;  3AEG B;  4RF0 A;  4C4V A;  2RPV A;  1I35 A;  2WX0 A;  2G4D B;  1L6V A;  4LNK A;  2DZK A;  4XWT A;  3EEC A;  2V4L A;  1V9J A;  3PTF C;  2WDV B;  1VZ8 A;  2NBU A;  4EKU A;  3KUZ A;  2GOW A;  2AWT A;  1UGJ A;  1ZXI A;  5C1Z A;  3L10 B;  3KVF B;  1OQQ A;  2ZVN A;  4B0E A;  2LGS A;  2D2Q A;  2WXO A;  3P4P B;  1WGK A;  1JRU A;  2QHO A;  2MH7 A;  3MHS D;  2O6V B;  3NS8 A;  4XC2 A;  3L13 A;  4C7Z A;  2LGX A;  5IN7 A;  1FPY A;  1K53 A;  5GXG B;  2N9L A;  1SE2 A;  2BKR B;  2LZ6 A;  2V3P A;  2ZNV B;  2JRI B;  4NPN A;  4KV2 A;  2PVO D;  1WGG A;  4MT5 A;  4EUT A;  1MG4 A;  1VD2 A;  1ET6 A;  1LFD A;  2W55 A;  2DYM A;  4GDK B;  2KDI A;  1C77 A;  3NZS A;  2BS2 B;  3SR6 A;  1YJI A;  3V05 A;  2N1V A;  1AW7 A;  1V6E A;  1T3Q A;  2WLB A;  2ON8 A;  5KHO A;  4KKJ A;  3BIN A;  4F7Z A;  2KLG A;  3AE1 B;  5CTR C;  3B0A A;  3VR9 B;  1TS5 A;  3RZF A;  4ARI A;  2REX A;  3MC9 A;  4JGH B;  4M00 A;  2KC1 A;  3H9D A;  4QAY A;  3I3T B;  4CQN A;  1K51 A;  2D5G A;  1SE9 A;  3GP7 A;  4OVU A;  5DCN A;  1NVI D;  4II2 B;  1FCC C;  2LUE A;  1IBX B;  4IG7 B;  1EWY C;  3HK0 A;  3PT2 B;  3W1S A;  4JPS A;  4C7Y A;  4RCO A;  2IY1 B;  2XEW A;  4OZC A;  3O13 A;  5G55 A;  2LEK A;  1I4R A;  3RNC C;  5HKH A;  5E6O A;  1WXA A;  2M0A A;  2PE9 A;  1N5W A;  5E6N A;  4ANW A;  2LGI A;  2OOB B;  2KD0 A;  1GB1 A;  2JXX A;  1NEN B;  1FD6 A;  3QAR A;  2KDF B;  2K8B A;  3RUI B;  3L08 A;  2M17 A;  2KOX A;  3VTW A;  1RYJ A;  4DQO C;  2KWU B;  3Q69 A;  3DBL B;  3AEA B;  4G50 A;  3KWL A;  2I38 A;  4M0W A;  3AU4 A;  1YIW A;  1UBI A;  4DHZ E;  4YSZ B;  2LXA A;  3N3K B;  1V2Y A;  3QAQ A;  4JWS C;  1OQY A;  1WGR A;  2BVC A;  1YX6 B;  5IKC M;  2W54 A;  5TSS A;  1I4H A;  4GDL A;  2K0P A;  1HTO A;  2N1W A;  1E8W A;  2ZJD A;  1YQ3 B;  4C56 C;  4WUR A;  3MP9 A;  3ZTD A;  3E9S A;  2LJI A;  2DNF A;  2TSS A;  5BMH A;  3ZVV A;  3LXF A;  1Y8R C;  3BY4 B;  2JZ3 B;  1OFF A;  2DZJ A;  1P7F A;  1K52 A;  1CJE A;  2FCS A;  3JSV A;  2KVZ A;  4ICV A;  3ENE A;  3H7P A;  2SEB D;  2Z59 B;  3CWI A;  2J4X A;  4NJ6 A;  2RSU A;  3L0W B;  2KDE B;  3Q8F A;  2JYE A;  4HJG E;  1CK1 A;  3HUI A;  2LHE A;  2DAF A;  4LNI A;  4J3O D;  2KWC A;  1A70 A;  3KLS X;  3UGB B;  4G3X B;  2ZVO A;  1R4M B;  2FE8 A;  2PJH A;  1I42 A;  3DVN U;  5IOI A;  1XLN A;  3VRB B;  1C78 A;  2JQR B;  4ANU A;  3ALB A;  2ZZP B;  3AV8 A;  1TY0 A;  4JL9 A;  2MBE A;  3Q8E A;  1SGH A;  2IYD B;  2J7Q B;  4YSY B;  1KLG D;  2PKO A;  1P9D U;  4HVB A;  3PLU A;  4ZOH C;  1PYW D;  1FRR A;  1C4A A;  5IAA C;  2GBR A;  2KJR A;  4BKT A;  1PUT A;  1E9M A;  2NBW B;  1FRD A;  1EU3 A;  1EWC A;  2IND C;  4YTP B;  4W9C A;  4F1S A;  4YSX B;  4N6E B;  4C4V B;  2B3A A;  2KC2 A;  3P4S B;  3ZNH B;  2MW5 A;  1WX7 A;  3JW0 X;  3QA8 A;  4FA6 A;  3Q6B A;  3GE3 C;  1VZ6 A;  3AN1 A;  5T8I A;  2KDB A;  4DXA B;  1QKZ A;  4JIO U;  5JH5 C;  2CR5 A;  2WDT B;  4ZRP A;  1UF0 A;  2BKF A;  3UIN B;  3PHX B;  1UZX B;  4YWG G;  2Z0D B;  2KFJ A;  3QCA A;  3RNB C;  1WX9 A;  1WIA A;  2IY0 B;  2L7R A;  4A9A A;  1JWM D;  4B9K A;  3VR8 B;  4K7S A;  1FMA D;  4II3 B;  3Q8B A;  1WR1 A;  1FNV A;  4AWJ A;  2V3S A;  2N9P C;  4AS1 A;  1ZDV A;  4A6Q A;  4WIP A;  1N60 A;  1JRP A;  2QSD A;  1XCQ L;  1TKY A;  2MBB B;  3BVZ A;  2OED A;  4O1N A;  1HXY D;  2D3B A;  2K9X A;  2NPT A;  5DPT A;  1C76 A;  3QX1 A;  1SE4 A;  4KDL B;  1FM0 D;  4YTN B;  1L0V B;  3W9C B;  4IM2 A;  4A55 A;  3AE6 B;  2OJW A;  2IGD A;  1F77 A;  4KSK C;  1M4V A;  3AE3 B;  4LDT D;  2AQ1 B;  2N7D A;  2DAJ A;  3KWV A;  2ZPY A;  2KWV B;  3ABV B;  3R8B A;  1ZGU B;  4MM3 A;  4W9I A;  2FAZ A;  4FAD A;  1T6B X;  4K3C A;  1T5X D;  1FIQ A;  1YQ4 B;  3MHZ A;  3VQI A;  4OW0 A;  4WWO A;  2L0F A;  4MEM A;  4W9H A;  2GLS A;  1XXG A;  1KTK A;  3TL5 A;  3UI3 A;  1PDX A;  1WXM A;  3ZGZ A;  2G3Q B;  3EHV A;  2PLP A;  2JWZ A;  3V60 A;  3PZ7 A;  2LRW A;  3J9C A;  3N1Y C;  4HLE A;  1AWD A;  3B1L X;  1Q1O A;  1TZ1 A;  3WAN A;  4ITK A;  4NAM A;  4KGT A;  3QIJ A;  2WU5 B;  1C1Y B;  1I4P A;  2YEP B;  2Z0E B;  1XD3 B;  5AZG A;  2IGG A;  3AE4 B;  1I7H A;  2HJ8 A;  3QJZ A;  1T0Y A;  1WJ4 A;  3ZQ4 A;  3U52 E;  3P2B A;  3KQ4 A;  3TCA A;  2R61 A;  1Z2M A;  2IBI B;  1V5T A;  2JSV X;  2KK8 A;  2KQ7 A;  4LLG M;  2GB1 A;  4WWM A;  4AQ7 A;  3DHG C;  2YEP F;  3RNF C;  4OHJ A;  2L83 A;  2WQY B;  2OHF A;  2QJL A;  5DPW A;  3RNG C;  2PMV A;  1EF1 A;  3U2S C;  2K5P A;  3AE8 B;  1CZP A;  2UWQ A;  3GS2 A;  1WXQ A;  2D11 A;  4YXD B;  1SBB B;  4HXD A;  3PSE B;  4C00 A;  1IGD A;  2Y5C A;  2H88 B;  1SJH D;  4M0W B;  3FAH A;  2MQJ A;  2WGS A;  3RCZ A;  2LI5 A;  3SDL C;  1IYF A;  3DWG C;  1S3S G;  2J52 A;  2QDF A;  1GG3 A;  4NAW A;  5MPO A;  2BW2 A;  4MEL A;  1FNW A;  4GDL B;  1KOT A;  3RFZ B;  4LK0 M;  4HPL B;  1LO5 D;  1V5O A;  2KN5 A;  3NZ3 A;  1DGJ A;  4XE0 A;  1LM8 B;  4XDD A;  3N32 A;  2J42 A;  3IAM 1;  5JHB A;  3PLV A;  3NVV A;  1P98 A;  1Y56 A;  4C80 A;  4BZA A;  3JSV B;  1H4R A;  4LNO A;  1P0R A;  1RWS A;  2G1E A;  1ZP0 B;  2PVG C;  3ZYY X;  2NTS A;  3H7P B;  2VH2 A;  1WXS A;  4WJQ A;  3Q3M C;  1YN3 A;  2M8S A;  1HQR D;  3PPA A;  4KGS A;  1E90 A;  1N63 A;  4HDO A;  4NQL B;  1JML A;  1RRB A;  4KX6 B;  3VHT C;  5C2T B;  3OJ4 B;  2MJ3 A;  2WYQ A;  1WGY A;  3PS6 A;  2L05 A;  2M56 B;  2Q5W D;  5H92 C;  2W9N A;  3X0W A;  1UD7 A;  3O65 B;  1SIF A;  1WR6 E;  1Q5W B;  2WXG A;  4YT0 B;  2FCN A;  2L1A A;  4WAA A;  3MJW A;  4W9F A;  2WXL A;  4HJK A;  1E0Z A;  1L6U A;  4HCN B;  4P16 A;  1WGD A;  3EUB 2;  2NTT A;  4L1B A;  4JQW C;  3S2A A;  1D6E C;  1YMH E;  5EE3 A;  3TJP A;  3EGR A;  4EZK A;  4IC7 B;  3EC8 A;  3HVD A;  3NVW A;  4LNN A;  2NS5 A;  2KAC A;  4DDG D;  3DBS A;  2HTH A;  2RMM A;  1NYR A;  1CQV A;  3ZRC A;  2HDE A;  1P7E A;  5C23 A;  2L76 A;  5J2R A;  3N1Z C;  3Q8A A;  3ML8 A;  2K8H A;  3CMM B;  4AUQ C;  2L3Z A;  4EZJ A;  1PGB A;  5CHW A;  1WH3 A;  1ZDX A;  1F0Z A;  2L0T A;  3VXW A;  2BGF A;  3LB8 C;  1WXV A;  3D32 A;  4MGY E;  4ZRK A;  2G4S A;  1ROE A;  3WAL A;  1E7V A;  2I1J A;  4JWU C;  5E6J A;  2K3U A;  1HZ5 A;  3Q8C A;  1J7C A;  3A9J A;  4P7I A;  1N62 A;  3Q14 C;  4KVG B;  2V3N A;  2W3S A;  2DX5 B;  2DYB A;  1SJE D;  1TZO A;  3IFW B;  2WX1 A;  1PGX A;  3BWU D;  2AEH A;  1OGW A;  4I6N B;  4NJC A;  1MHX A;  1E8Z A;  3MFG A;  2KT7 A;  4A3P A;  4BVU C;  2NPT B;  4K7W A;  1N6Z A;  3WCQ A;  2C9W B;  3JYU A;  2J0K A;  1XCT L;  2L00 B;  4ASW C;  4ACF A;  4B6W A;  2RPQ A;  2KQ4 X;  3ZJV A;  4MGI E;  3VH4 B;  2CU3 A;  3ZXR A;  5KHQ A;  1WJN A;  2WP9 B;  1F1H A;  2N7E A;  4HKQ A;  2JT4 B;  4FHK A;  4KGR A;  1NDD A;  2WS3 B;  1N61 A;  3IAS 1;  4MM3 B;  3IT6 B;  3MC8 A;  3V62 A;  1FEH A;  2K22 A;  5AZF A;  3ZNZ B;  5G5G A;  3DCG A;  3PRM B;  2AQ3 B;  2ZCC A;  4HKZ E;  3OWE B;  4W9J A;  2PPH A;  4CO7 A;  2J53 A;  4NZL B;  1C79 A;  4LDT B;  4XZ4 A;  2RD0 A;  2EKI A;  1FFU A;  3Q3F A;  3DQV A;  3KUC B;  2JYT A;  3WA0 A;  1STE A;  3AH7 A;  1R7S A;  1WZ3 A;  1YJJ A;  4CYE A;  1KFY B;  3A1Q A;  1EU4 A;  3P42 A;  2K1F A;  4IWO A;  5EE1 A;  2QMT A;  2MWS B;  4FBJ B;  1KH0 A;  4D2K A;  3ML9 A;  1GNU A;  2KWD A;  4WJN A;  2X38 A;  3UQA A;  5BO4 B;  5CHV C;  3Q3O C;  3RUL A;  5EE0 A;  1NI2 A;  2DWQ A;  3DHI C;  4KZ0 A;  2KVR A;  2WWZ A;  2QIL A;  4WH4 A;  3KW5 B;  2CS4 A;  5HI1 A;  1JWS D;  3W2D A;  3EFU A;  1V81 A;  4L23 A;  4S0R A;  1I4G A;  1QZE A;  4FJZ A;  4N9F 4;  4HCP B;  3NZU A;  2A4Z A;  3EA6 A;  3VTV A;  2DZM A;  4AJY B;  3CIR B;  4BKS D;  3DDC B;  3GZN I;  2MCN B;  4HDQ A;  4OVV A;  4NAW B;  3BYT B;  4E3C A;  2VZK D;  3DVG Y;  3T3N A;  3PO0 A;  4YTM B;  1J8C A;  4AOF A;  3RNE C;  2C5L C;  3VUW A;  2FUH B;  2YVC A;  3U8Z A;  4BKS A;  4EEW A;  1AAR A;  2MBO A;  2LJ5 A;  3QHT A;  3HHM A;  5TR5 A;  1MI0 A;  3HM3 A;  3R66 C;  1V49 A;  2GMI C;  1YN5 A;  4IUM B;  3KYC D;  1QT9 A;  5D7G A;  2GI9 A;  5LXH A;  4NNJ B;  4HRS A;  1UGM A;  2A5U A;  2MBH A;  5EDS A;  1T0R C;  2EMT A;  1QOF A;  2CU1 A;  2LGD A;  2CHZ A;  2C7M B;  2CKH B;  3BYY B;  2FCQ A;  5JXV A;  1EF5 A;  3R7R A;  2LUM A;  1WJ6 A;  1KM7 A;  2AQ2 B;  3DPD A;  3PRE A;  1IUE A;  1MPE A;  1D5M C;  4RMA A;  3CF6 E;  2KHW B;  4HWI B;  1ZKH A;  1UH6 A;  4DBG A;  3C0R B;  1EUV B;  3RZW C;  4BBN C;  1ZOY B;  3AEF B;  4KZC A;  4IM3 A;  3RT3 B;  1FFV A;  2QCZ A;  4WAF A;  2LWP A;  1RLF A;  5J18 A;  1QOB A;  3PGE A;  1WI0 A;  3JVZ X;  3R2I A;  2MSE D;  1PQS A;  4GOC A;  3P4R B;  4GLS C;  1G6J A;  3A4R A;  4K3B A;  1P3Q U;  3TIX A;  3AE2 B;  4MGK E;  3DVG X;  3FC4 A;  1YD8 U;  2RR9 A;  1ZXH A;  2WXP A;  4J6I A;  3ETR A;  3ZDM C;  3N20 C;  3W1Y A;  4RM9 A;  1Q10 A;  2CJO A;  1JRO A;  5IO9 A;  1Z5S B;  2IZV B;  2KX3 A;  1WM3 A;  2KFK A;  4RNA A;  4A8X C;  1WRD B;  1E7U A;  1LXD A;  1ZPS A;  2RDG A;  2WXM A;  3AMZ A;  1WMH B;  1TTN A;  1I4X A;  2JZZ A;  3BVM A;  1L4Z B;  3ZTC A;  1B1Z A;  1DOI A;  3A9J B;  3C19 A;  3TMP B;  5EE9 A;  4WQM A;  3N30 A;  3T8M A;  2FBW B;  3DWM A;  1U4A A;  2HTM E;  3H7S A;  4ZRJ A;  4DHZ B;  3TEZ A;  1QIL A;  1TT5 B;  3L17 A;  3EFC A;  3APF A;  3K9P B;  1FXA A;  3SHQ A;  4A20 A;  2WXK A;  1FXI A;  1XT9 B;  3GE8 C;  1XF5 L;  1MHH E;  3NHE B;  1QLB B;  2IGH A;  1M94 A;  3KYD D;  3ZW3 A;  2JRH A;  5C3J B;  2WU2 B;  1D5X C;  3LYY A;  4PYU A;  2ONQ A;  1WYG A;  4BOS C;  2AL3 A;  3AE7 B;  4TSS A;  2IO1 B;  4DK5 A;  4PYZ A;  2KJ6 A;  4ICU A;  3PRZ A;  4KIK B;  2WXJ A;  3URY A;  1QQR A;  4WWP A;  3VH3 B;  4ZHO A;  1WY8 A;  2KXJ A;  1DOX A;  1WGH A;  1RM6 C;  5D6J B;  3RNA C;  4MJS A;  5JZE B;  1TS2 A;  1DYQ A;  4ZRI A;  5BYQ A;  1E6E B;  2AX5 A;  3PRP B;  1JQ4 A;  1UWM A;  3DBR I;  4PS8 A;  2N4F A;  1AYF A;  3V3X A;  3HM6 X;  3NG0 A;  2DYO A;  3U7Z A;  4P1B C;  1BUI C;  4DDI D;  2WXI A;  2K25 A;  3TEW A;  3ZNI D;  2M4N A;  2IO2 B;  2Z8L A;  4ZYS A;  2D3A A;  2BS3 B;  4MGZ E;  3A1Q B;  4JE3 B;  4BKG A;  2BS4 B;  3U7D A;  2V0G A;  1SEB D;  3I57 A;  3IT4 B;  1ET9 A;  4CHK A;  1MFW A;  4URK A;  3RMK C;  2L52 A;  2I2Y A;  4N58 A;  4DHJ D;  2LD9 A;  5D3D A;  4IDI A;  4GU2 A;  2FUG 1;  1V1P A;  1L0X B;  1IPG A;  1SIJ A;  1JWU D;  3FIL A;  4US8 A;  5DPR A;  3I9V 1;  4BOZ B;  2BYV E;  3L54 A;  1J7B A;  1NI3 A;  4USA A;  1F2R I;  4NJ7 A;  4HEA 1;  3V6E B;  2KO3 A;  3HRD D;  4ZYN A;  4IWQ A;  2LHD A;  2N0S B;  3VUY A;  1QOG A;  2MJE A;  3ZXV A;  3OJ3 A;  2LVP A;  3N9Y C;  1TS3 A;  1MG8 A;  2KQS A;  3W5U B;  4LTU A;  1C4P A;  4HPM B; 
#chains in the Genus database with same CATH homology
 4ICV A;  1E8Z A;  3ENE A;  4TV3 A;  3H7P A;  4A3P A;  3OAW A;  4BVU C;  2NPT B;  2J0M A;  4K7W A;  3VTU A;  3APC A;  5AEK B;  2C9W B;  3JYU A;  1A5R A;  2J0K A;  2Z59 B;  4NJ6 A;  2L00 B;  4ASW C;  4B6W A;  4XX5 A;  2RSU A;  2RPQ A;  3L0W B;  2K6Q A;  2KDE B;  5CX3 A;  4KDI C;  4I6L B;  4TQ1 A;  4MGI E;  3RD2 A;  3VH4 B;  5KHQ A;  2DAF A;  2PE6 B;  3LDZ E;  4M8M A;  4E74 A;  1WJN A;  1RFA A;  4PS3 A;  2O2V B;  2KWC A;  4WJO A;  2BYE A;  2KNB A;  1CMX B;  3DBH I;  3UGB B;  4G3X B;  2K39 A;  2N7E A;  3NY5 A;  2JT4 B;  2ZVO A;  4AP4 C;  4FHK A;  1NDD A;  2PJH A;  4PS7 A;  1I42 A;  1KLV A;  2UYZ B;  1R4M I;  2R2O A;  3DVN U;  2EMS A;  2D3G A;  3V62 A;  4W9L A;  3Q3J A;  3ZUN A;  3ZNZ B;  5AZF A;  4F8C B;  3ZDT A;  3R7Q A;  3DCG A;  2L8J A;  1WJU A;  3ALB A;  3AUL A;  4ANU A;  3PRM B;  2ZZP B;  1NBF C;  3VVW B;  5AZH A;  2ZCC A;  4GGQ A;  2N9E B;  4JL9 A;  2MBE A;  4W9J A;  2PPH A;  4CO7 A;  4K1R B;  4BFR A;  2NR2 A;  3QWZ B;  4LDT B;  1H8C A;  4NQK E;  2MBQ A;  4TKN A;  1SGH A;  2IYD B;  2J7Q B;  2GBM A;  4WJP A;  3OLM D;  4XZ4 A;  2RD0 A;  2DHZ A;  4IM0 A;  1P9D U;  1VCB A;  4HVB A;  2K6D B;  2C7H A;  2HD5 B;  3PLU A;  3Q3F A;  1WX8 A;  3DQV A;  3KUC B;  3WA0 A;  3PHW B;  5D2M B;  2EKE C;  2JPH A;  5IAA C;  1F9J A;  2GBR A;  2KJR A;  4BKT A;  2R2Q A;  3M95 A;  2GBN A;  1ZW7 A;  1GC6 A;  1WZ3 A;  2NBW B;  3A9K B;  1OTR B;  4W9C A;  4F1S A;  4CYE A;  3CST A;  3A1Q A;  1HE8 A;  3V61 A;  3A4S C;  2KMA A;  2K1F A;  3IHP C;  4LJP B;  4IWO A;  2B3A A;  1YX5 B;  2KC2 A;  2MWS B;  3B08 A;  4FBJ B;  3ZNH B;  1TGZ B;  4A3O A;  3ML9 A;  2MW5 A;  1GNU A;  1WX7 A;  2J0J A;  3JW0 X;  1V80 A;  3QA8 A;  4WJN A;  4FA6 A;  3UQA A;  5BO4 B;  5CHV C;  1WE6 A;  1EO6 A;  1WYW B;  4FUL A;  4X57 B;  3CSF A;  3RUL A;  1FXT B;  3UIO B;  1LQB A;  4FJY A;  2KDB A;  4EOY A;  4DXA B;  1NI2 A;  2CHX A;  4JIO U;  5JH5 C;  2CR5 A;  2WDT B;  4GB9 A;  4KZ0 A;  2BKF A;  5FR6 A;  3UIN B;  3PHX B;  1UZX B;  2JUO A;  2KVR A;  2WWZ A;  2Z0D B;  2KFJ A;  3APD A;  1R4N I;  3PVL A;  3QCA A;  3KW5 B;  1WX9 A;  2KTR A;  2CS4 A;  1WMH A;  3ZNG C;  3IBE A;  1WIA A;  2IY0 B;  2L7R A;  3M63 B;  2BWE S;  4FJV B;  4B9K A;  2C60 A;  1WZ0 A;  4EFO A;  4K7S A;  4II3 B;  1WR1 A;  3EFU A;  1V81 A;  5E6P A;  2V3S A;  4AWJ A;  2N9P C;  1QZE A;  4FJZ A;  2MP2 B;  1GJZ A;  4N9F 4;  5L83 A;  1X1M A;  4HCP B;  3NZU A;  2A4Z A;  2IO3 B;  5D94 A;  3VTV A;  3ZO5 B;  2KFK B;  2DZM A;  4AJY B;  1D3Z A;  1C3T A;  2KTF A;  4AJW A;  2JVC A;  3AXC A;  1E5W A;  1YJ1 A;  2XK5 B;  5DPS A;  4MSQ B;  3GOE A;  2KLC A;  4BKS D;  2MBB B;  4GXB A;  3DDC B;  4K7U A;  3GZN I;  2DZI A;  2MCN B;  4HDQ A;  4MSM B;  4OVV A;  5J17 A;  4NAW B;  4K81 A;  3IG3 A;  2NPT A;  4JLC A;  4E3C A;  5DPT A;  3QX1 A;  2BWF A;  2FIF A;  2ZEQ A;  2KAN A;  3DVG Y;  2JF5 A;  2NVU I;  1J8C A;  1ISN A;  4KDL B;  3VAW A;  4AOF A;  4IM2 A;  2C5L C;  3VUW A;  4BBN F;  3AU5 A;  2FUH B;  4FLH A;  2ASQ A;  4M8N A;  3KH0 A;  2YVC A;  3U8Z A;  4BKS A;  4W9K A;  4GSW A;  4MH0 E;  2OJR A;  4KSK C;  4I6P A;  4EEW A;  1AAR A;  3T9L A;  2MBO A;  1RAX A;  2LJ5 A;  2MA9 B;  4LDT D;  2HE7 A;  3QHT A;  2N7D A;  3HHM A;  3M62 B;  5LLI A;  5TR5 A;  2DAJ A;  3HM3 A;  4KIK A;  3KUD B;  3AI5 A;  2ZPY A;  2KWV B;  3R66 C;  1V49 A;  3PV1 A;  3R3M A;  2GMI C;  4W9E A;  3W1S C;  1ZGU B;  4IUM B;  3DVN V;  4GMV A;  3KYC D;  4MM3 A;  4W9I A;  2FAZ A;  5D7G A;  4FAD A;  3UIP B;  4NNJ B;  5LXH A;  1P1A A;  1UGM A;  2KMC A;  2A5U A;  2MBH A;  3QC8 B;  5EDS A;  3VQI A;  2EMT A;  4WWO A;  2L0F A;  2CU1 A;  2LGD A;  2CHZ A;  2XBB C;  4MEM A;  4WWN A;  2C7M B;  4W9H A;  4DWF A;  4IW0 A;  4B95 A;  2AL6 A;  2CKH B;  3TL5 A;  2Y5B B;  2FCQ A;  1WM2 A;  1EF5 A;  4WQO B;  3R7R A;  3SD5 A;  1BT0 A;  1WXM A;  2V1Y A;  2G3Q B;  3EHV A;  1WJ6 A;  1KM7 A;  2JWZ A;  3V60 A;  3A33 B;  2LRW A;  3DPD A;  3PRE A;  4HLE A;  2C7N B;  2KKC A;  4ZDV A;  4RMA A;  3B1L X;  1Q1O A;  3CF6 E;  4FN2 A;  3ONS A;  1TZ1 A;  3WAN A;  3QIJ A;  4MJS B;  1IP9 A;  2M0X A;  4MDK E;  1WE7 A;  5IA7 A;  3H1U A;  2G45 B;  2KHW B;  3NOB A;  3PZD A;  1C1Y B;  4HWI B;  2Z0E B;  4IWP A;  1XD3 B;  1ZKH A;  1UH6 A;  3UF8 A;  4DBG A;  5CHF A;  4ANX A;  1E8X A;  5AZG A;  3C0R B;  2HJ8 A;  1I35 A;  2WX0 A;  5GMV A;  1EUV B;  2G4D B;  2BF8 B;  3QJZ A;  3RZW C;  1T0Y A;  1WJ4 A;  4BBN C;  3WAM A;  2DZK A;  3P2B A;  3TCA A;  4KZC A;  4IM3 A;  3EEC A;  1GUA B;  1Z2M A;  2V4L A;  3RT3 B;  1V9J A;  2IBI B;  3PTF C;  4W9G A;  2NBU A;  2LWP A;  4EKU A;  3KUZ A;  1RLF A;  1V5T A;  3VUX A;  2GOW A;  2AWT A;  4RM8 A;  5J18 A;  2NBV B;  5C1Z A;  3L10 B;  2KK8 A;  2KQ7 A;  3PGE A;  1WI0 A;  3JVZ X;  3WIM A;  3KVF B;  2MLB A;  2MSE D;  2ZVN A;  1PQS A;  4G0N B;  1UEL A;  4GOC A;  2D2Q A;  1G6J A;  3A4R A;  1P3Q U;  2IO0 B;  3TIX A;  1J19 A;  1JRU A;  2QHO A;  3ZRF A;  3MHS D;  4MGK E;  3DVG X;  3SU8 X;  2O6V B;  2PEA A;  5DPW A;  1EF1 A;  3NS8 A;  1YD8 U;  2RR9 A;  2UWQ A;  4J6I A;  3ZDM C;  3W1Y A;  4RM9 A;  4XC2 A;  3L13 A;  2FNJ B;  2LGX A;  2D11 A;  1Z5S B;  2IZV B;  2MP2 A;  4HXD A;  2KX3 A;  3PSE B;  2BKR B;  5L95 C;  1WM3 A;  4M0W B;  2KFK A;  2LZ6 A;  1WRD B;  2LAS A;  1E7U A;  1LXD A;  2MQJ A;  3ECI A;  2XK5 A;  2ZNV B;  2LI5 A;  3RCZ A;  2JRI B;  3SDL C;  1IYF A;  1S3S G;  3V6C B;  1WMH B;  4NPN A;  4KV2 A;  1TTN A;  1GG3 A;  1WGG A;  3WAP A;  4NAW A;  1E8Y A;  2JZZ A;  4EUT A;  1Q0W B;  4MEL A;  3ZTC A;  3L16 A;  4W9D A;  4GDL B;  3A9J B;  1VD2 A;  3VFK A;  1KOT A;  1LFD A;  4EZL A;  4DHJ B;  3TMP B;  4HPL B;  1V5O A;  3N30 A;  2KN5 A;  2YLM A;  3T8M A;  2DYM A;  2LVQ A;  4GDK B;  2KDI A;  2M1M A;  3NZS A;  1U4A A;  3ZLZ A;  1LM8 B;  1YQB A;  4DHZ B;  3H7S A;  4ZRJ A;  3N32 A;  2AYO B;  3L17 A;  3APF A;  3K9P B;  2KJH B;  3SHQ A;  2N1V A;  3K9O B;  3PLV A;  5JHB A;  1P98 A;  3VDZ A;  1V6E A;  4A20 A;  2O2V A;  1XT9 B;  1S1Q B;  4GN1 A;  3JSV B;  1H4R A;  3NHE B;  1P0R A;  2NCN A;  3KYD D;  1M94 A;  1L2N A;  3ZW3 A;  3QQ8 B;  5KHO A;  3H7P B;  2MRP A;  3BIN A;  3IVF A;  1WXS A;  4F7Z A;  2KLG A;  2JRH A;  5CTR C;  3B0A A;  4LCD E;  3RZF A;  3H6N A;  4WJQ A;  2KZR A;  2M8S A;  2REX A;  3PPA A;  4PYU A;  1E90 A;  4NQL B;  4HDO A;  2GBJ A;  4JGH B;  3M3J A;  5G2N A;  4BOS C;  2AL3 A;  1RRB A;  2IO1 B;  2KC1 A;  4DK5 A;  4PYZ A;  2KJ6 A;  3VHT C;  3H9D A;  3I3T B;  3OJ4 B;  4ICU A;  4GIV A;  4LJO B;  2WYQ A;  1WGY A;  1SE9 A;  3PRZ A;  3PS6 A;  2L05 A;  3UQB A;  4KIK B;  3VH3 B;  4WWP A;  4OVU A;  1WY8 A;  5DCN A;  2KXJ A;  4II2 B;  2W9N A;  3X0W A;  1GC7 A;  2LUE A;  1WGH A;  5D6J B;  1UD7 A;  3TBL D;  4IG7 B;  4MJS A;  3O65 B;  5JZE B;  1SIF A;  3HK0 A;  1WR6 E;  1Q5W B;  3PT2 B;  4ZRI A;  3HIZ A;  3W1S A;  2FCN A;  4WAA A;  3MJW A;  1KJT A;  3A9K A;  3PRP B;  4ANV A;  4W9F A;  2IY1 B;  2XEW A;  4HJK A;  3DBR I;  2D07 B;  2KX0 A;  3MTN B;  4HK2 A;  2N4F A;  4HCN B;  4PS8 A;  4TUU A;  1WGD A;  3HM6 X;  2GBK A;  2DYO A;  5G55 A;  1WF9 A;  5HKH A;  4DDI D;  4JQW C;  3S2A A;  2I1K A;  2K25 A;  2O6V D;  3TJP A;  3ZNI D;  5E6O A;  2M4N A;  1WXA A;  2IO2 B;  2BYF A;  4EZK A;  4IC7 B;  5JHA A;  3EC8 A;  2PE9 A;  5E6N A;  4ANW A;  4YL8 A;  2NS5 A;  2ZNV C;  2LVO A;  4DDG D;  3DBS A;  3ZIM A;  2OOB B;  2KD0 A;  2JXX A;  1XQQ A;  2HTH A;  2CHW A;  2K8C A;  4TQ0 A;  3QAR A;  2KDF B;  3A1Q B;  4MGZ E;  3X23 A;  3ZRC A;  4BKG A;  1WFY A;  5C23 A;  2K8B A;  3U7D A;  2L76 A;  5LXI B;  5J2R A;  3RUI B;  3ML8 A;  2K8H A;  2KOX A;  2M17 A;  3L08 A;  2O6V A;  2DEN B;  3CMM B;  3VTW A;  4CHK A;  4KSL C;  3RYT A;  4URK A;  2KWU B;  4AUQ C;  2VRR B;  3QK0 A;  2L3Z A;  4EZJ A;  4DHJ D;  5CHW A;  1WH3 A;  2LD9 A;  2MX2 A;  1J0G A;  2FCM A;  2L0T A;  4G50 A;  2BGF A;  3VXW A;  3LJ3 A;  4GU2 A;  1WXV A;  2ZPN A;  3AU4 A;  3WAO A;  3D32 A;  1YIW A;  1UBI A;  2LRU A;  2ZCB A;  4DHZ E;  2N9X A;  3DBL I;  4MGY E;  2G4S A;  4ZRK A;  1IPG A;  1UBQ A;  1V86 A;  3WAL A;  1E7V A;  1OEY A;  2LXA A;  3N3K B;  2I1J A;  1V2Y A;  3QAQ A;  1OQY A;  1WGR A;  2KTR B;  4E71 A;  1YX6 B;  5DPR A;  4BOZ B;  1L7Y A;  2BYV E;  3L54 A;  2D10 A;  4GDL A;  3A9J A;  2BPS A;  2LGY A;  4P7I A;  2N1W A;  1E8W A;  4NJ7 A;  2ZJD A;  4KVG B;  3V6E B;  2DX5 B;  2RGF A;  2KO3 A;  1OEY J;  3ZTD A;  2DYB A;  2FID A;  4GDK A;  3IFW B;  4ZYN A;  2WX1 A;  4IWQ A;  3VUY A;  3ZVV A;  4G11 A;  4NY0 A;  3ZKJ C;  1Y8R C;  3OJ3 A;  3BY4 B;  2JZ3 B;  2JY6 A;  2LVP A;  2DZJ A;  1TBE A;  2LXC A;  2AEH A;  1OGW A;  3DOW A;  1MG8 A;  2KQS A;  4I6N B;  3U30 A;  1K8R B;  2FCS A;  3JSV A;  4FHJ A;  4HPM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...