3VH4B

Crystal structure of atg7ctd-atg8-mgatp complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
TFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of Atg8 activation by a homodimeric E1, Atg7.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal binding protein/protein transport
molecule keywords Ubiquitin-like modifier-activating enzyme ATG7
total genus 29
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3vh4B00
3KYDD 4G50A 2CU1A 2OJRA 4LDTD 3VDZA 4II3B 2KTRB 2V3SA 2KVRA 3ECIA 3ZO5B 5LXIB 1WM2A 4WJNA 1E8ZA 3AI5A 2LJ5A 3QHTA 1WJ4A 1WXAA 4MGZE 3CSFA 2L05A 4MJSB 3DPDA 3EC8A 2FCSA 2K6QA 2L0TA 4M8MA 3RUIB 3JSVB 5J17A 2KDIA 4JL9A 1WY8A 1JRUA 2NCNA 2ZPNA 3A9KB 2KX3A 2FCQA 3WALA 2RR9A 4HDQA 4E71A 4HXDA 3UQBA 2DHZA 1ZGUB 1WGDA 2N7EA 3H7SA 4GDLA 2LZ6A 4EUTA 2D10A 3Q3JA 4X57B 2EMSA 2XEWA 4LDTB 1YX5B 3KH0A 2EKEC 1YQBA 3QK0A 2D11A 2NVUI 4RM8A 4N9F4 1E90A 2Y5BB 2KOXA 2WX0A 2ZZPB 3VTVA 2O6VD 2UWQA 4NQKE 5FR6A 3U8ZA 2KDFB 1WE7A 2MBQA 5E6OA 1V5TA 2BPSA 1S3SG 1WIAA 3JYUA 4AUQC 2AL3A 2LD9A 4M0WB 3KVFB 1OQYA 3A9JB 3PZDA 4KIKB 2CHZA 4FLHA 3KUCB 4EZKA 3A4SC 1WJUA 2MW5A 2YLMA 3NS8A 3HK0A 3VH3B 1V6EA 3S2AA 2MX2A 5D94A 3TJPA 3L54A 5IA7A 3ZUNA 4HPMB 4KSKC 2MP2B 4TV3A 4HVBA 4HLEA 3ZTCA 3PLUA 2KD0A 5DPTA 1YIWA 1IP9A 4ANVA 4TQ1A 2QHOA 4B6WA 4BBNF 4A20A 1V9JA 2HE7A 2KN5A 1GC7A 4KV2A 2DYMA 3ZIMA 2B3AA 1WXSA 4G11A 2DAJA 3L08A 4W9GA 1E7UA 1I42A 3BINA 4GMVA 1LM8B 3L0WB 1NDDA 2DYBA 3A4RA 3A9KA 3DBLI 1WXVA 2KHWB 1WR1A 2MA9B 2RD0A 3K9OB 3ZNID 4ANWA 2C60A 2LGDA 2KTRA 2M8SA 3QWZB 5J2RA 2EMTA 2M17A 2JT4B 2BWFA 3KW5B 1KM7A 2DZIA 2V4LA 5KHOA 5C23A 4IC7B 3VXWA 1P3QU 4KDIC 1QZEA 5LLIA 4G3XB 3X0WA 5E6PA 2ASQA 3SDLC 1UELA 2N9XA 4CYEA 4HK2A 3AU4A 1GJZA 2ZVOA 3TBLD 2PPHA 2L76A 4MSMB 4K1RB 5DPRA 4WJOA 1UH6A 1I35A 2IO0B 1ZW7A 2REXA 2HD5B 1P9DU 2HTHA 2MBEA 1WMHA 2CHXA 1RFAA 1L7YA 3PHXB 4NJ6A 2DENB 1YX6B 2LVOA 1UZXB 4ICUA 2JXXA 3EFUA 3N3KB 4PS3A 2IO1B 2JVCA 3R7RA 5CX3A 4ANUA 5LXHA 1V2YA 3QIJA 3HIZA 1NI2A 3EHVA 4HWIB 1X1MA 4BVUC 4JIOU 2DZKA 3IG3A 4XC2A 2K8CA 2K8HA 1KLVA 1P0RA 4HCPB 4HCNB 4MGIE 1WGHA 2CKHB 3D32A 2LI5A 2LGXA 3KUZA 3T9LA 1E8YA 2I1KA 4IUMB 4ZRJA 2KKCA 3RCZA 3A1QA 2BYFA 3MJWA 4NQLB 1AARA 2MCNB 2J0JA 3T8MA 1Q1OA 5CHFA 3RZWC 2KDBA 2V1YA 2WYQA 1XD3B 2DX5B 3R66C 3TL5A 4DBGA 3HHMA 3ZLZA 2PJHA 4KSLC 4B95A 2IO2B 3WIMA 1WX8A 2K6DB 2LXCA 3EECA 3DVGX 2XK5B 1PQSA 1Z2MA 4GOCA 5EDSA 3P2BA 2WWZA 2KFKA 2D3GA 4FJYA 2KWVB 4BFRA 3LJ3A 3OJ3A 1S1QB 3VUXA 4EZJA 1WZ0A 3NZSA 3QCAA 2JPHA 4PS8A 1H4RA 5AZGA 1WGRA 4ZYNA 4TQ0A 3KYCD 4NNJB 4FJZA 3JVZX 3PREA 4W9LA 1E5WA 2LVQA 4KZ0A 3ZRFA 3C0RB 4WAAA 4TKNA 3UGBB 2L3ZA 1RLFA 3K9PB 2WX1A 1WRDB 4IG7B 4DK5A 3ALBA 2PEAA 1TGZB 3LDZE 3W1SC 4CHKA 2C7NB 2M4NA 2O6VB 4I6LB 3ZTDA 5G2NA 2KLCA 5IAAC 3OJ4B 2I1JA 1UBIA 2M0XA 2KX0A 3WAOA 2FCNA 4W9HA 2NBWB 3GZNI 4KDLB 3Q3FA 1Q5WB 3W1SA 4A3PA 1HE8A 3RT3B 4IWPA 1BT0A 1Q0WB 4NY0A 5DPWA 2C5LC 3ZDTA 3NY5A 2ZJDA 3H7PB 1J8CA 3PSEB 3ZNGC 1ISNA 1V81A 3N32A 3L16A 1WE6A 4WWPA 1KOTA 1T0YA 1KJTA 4II2B 1WXMA 4ZRIA 4MH0E 5JZEB 2ZVNA 2A4ZA 3VUWA 2KWUB 2IYDB 4EEWA 1R4NI 2JF5A 4IW0A 3V6CB 3AULA 2O2VB 2MSED 2ZEQA 2MLBA 2G3QB 4ICVA 4F7ZA 2NPTB 3PS6A 4IWQA 2NBUA 4NJ7A 1WMHB 2G4SA 1CMXB 2IY1B 2JRIB 2KANA 5TR5A 3H7PA 3PLVA 2KK8A 4CO7A 4NPNA 1IPGA 3APCA 2LWPA 3VFKA 2LRWA 5DCNA 2KDEB 5CTRC 3WA0A 3PRZA 3DDCB 2AYOB 1WZ3A 1VCBA 4PYUA 3RZFA 2BWES 2JZZA 1EF5A 4NAWA 1RRBA 3NHEB 5G55A 2L00B 2FIFA 2J0MA 2GBJA 3ENEA 3V62A 4MGKE 1WJNA 3L13A 2ZNVB 3GOEA 1U4AA 4XX5A 1LFDA 2JRHA 2D07B 4M8NA 1J0GA 2KMCA 5D2MB 2WDTB 1OGWA 3VAWA 3SU8X 3IFWB 3ZDMC 2Z59B 4BKGA 3V60A 2L7RA 3PGEA 3VH4B 4W9DA 1WYWB 1UD7A 2FCMA 4GDKA 4LCDE 2MBBB 3VQIA 2KTFA 4MSQB 3PHWB 2NPTA 1SE9A 2KQ7A 2K25A 3JSVA 3PRPB 4W9FA 2K8BA 3U30A 3ZRCA 2ZPYA 2D2QA 3L10B 2BF8B 4AOFA 1J19A 3VTUA 2UYZB 4FHJA 2JWZA 2MBOA 1FXTB 2KLGA 4LJOB 3APDA 4ASWC 2RPQA 2IY0B 2N1WA 3R7QA 4DHJD 3PT2B 1WH3A 3H6NA 2IBIB 1C1YB 1Z5SB 4MM3A 2BYVE 5JHBA 3PVLA 4OVVA 3UIPB 1EO6A 3ML9A 1YJ1A 4JQWC 2KJHB 1GNUA 3DVNU 2PE9A 5KHQA 3DBHI 3TCAA 1K8RB 1WJ6A 1SGHA 4GN1A 3VVWB 2LUEA 3B0AA 2XK5A 1WR6E 1WFYA 1OEYA 2BKFA 3CF6E 3DBSA 3UINB 4FN2A 4FA6A 4GDLB 4BKSA 3M3JA 2R2QA 2RSUA 1M94A 1V86A 2CS4A 3IVFA 2LRUA 4WQOB 4F8CB 2DZMA 4GDKB 2CHWA 3MHSD 3R3MA 1A5RA 3OLMD 3QX1A 2N4FA 4JLCA 3CMMB 4XZ4A 2ZCBA 4WJPA 3OAWA 1UBQA 2GBNA 2MWSB 2R2OA 2Z0EB 3QJZA 2AEHA 4GU2A 2PE6B 4G0NB 1LQBA 4WWNA 4K7WA 4FHKA 3U7DA 3QAQA 2ZNVC 4W9EA 4IM3A 1V80A 3RULA 1SIFA 1D3ZA 3V61A 3PRMB 1E8XA 2LGYA 4PS7A 4MELA 1IYFA 4W9KA 4IWOA 2FNJB 2M1MA 3SD5A 4F1SA 4DHZB 3ML8A 3HM6X 3QA8A 3DQVA 4DHJB 4I6PA 3RD2A 4DWFA 3WANA 2J0KA 2KC1A 3APFA 2KNBA 2DYOA 3X23A 3IHPC 3ZVVA 4OVUA 2N9EB 4P7IA 2KC2A 3ZKJC 1MG8A 3TIXA 2FUHB 3VTWA 1EF1A 1GC6A 2L8JA 3ZNHB 3UIOB 4BKSD 2MP2A 2ZCCA 4DDGD 4MJSA 3H1UA 2LVPA 4K7SA 2L0FA 2HJ8A 4JGHB 3AXCA 3QC8B 2G45B 3B1LX 4EOYA 3PPAA 3MTNB 3PV1A 1WM3A 2GOWA 3H9DA 2KJRA 4E74A 4NAWB 4DDID 3L17A 4MEMA 3M63B 4AP4C 2K39A 2AL6A 2N1VA 4KZCA 3TMPB 2N7DA 3A33B 3UF8A 2RGFA 4K7UA 4AWJA 2IZVB 1Y8RC 2K1FA 2Z0DB 4MGYE 2KJ6A 4DXAB 2GBRA 3JW0X 3SHQA 3DVNV 4IM2A 5DPSA 1V49A 1WF9A 5L83A 4E3CA 5AZFA 2NR2A 4EKUA 2BKRB 5CHVC 1R4MI 2W9NA 2JY6A 2MBHA 2VRRB 3M95A 4FADA 1WX7A 1YD8U 1P98A 5L95C 1TZ1A 1XQQA 1GUAB 1ZKHA 4BOSC 4ANXA 4BBNC 2DZJA 3DBRI 3AU5A 5GMVA 3IBEA 3ONSA 2MRPA 1V5OA 4TUUA 1TBEA 1EUVB 3QQ8B 4KIKA 3RYTA 3WAMA 5HKHA 3PTFC 2N9PC 4PYZA 2IO3B 3N30A 2KO3A 2FAZA 4DHZE 4URKA 5AZHA 4EZLA 2XBBC 2KQSA 4K81A 1P1AA 1GG3A 3QARA 3BY4B 4HDOA 4W9IA 1G6JA 4GSWA 4W9CA 3A9JA 4EFOA 2C9WB 3O65B 5D7GA 4HPLB 2KFKB 1XT9B 3DOWA 2KFJA 1E7VA 4A3OA 2CR5A 2JUOA 5AEKB 2FIDA 2DAFA 4BKTA 3VUYA 3ZNZB 1OEYJ 3B08A 4W9JA 4RMAA 5BO4B 5JH5C 4BOZB 2LXAA 1NBFC 4FULA 2KMAA 4FJVB 1OTRB 2GBKA 2GBMA 3CSTA 4IM0A 4YL8A 2JZ3B 4I6NB 1F9JA 3V6EB 3VHTC 4WWOA 4WJQA 3WAPA 2KXJA 3A1QB 1C3TA 4AJYB 5C1ZA 2LASA 5E6NA 3ZW3A 4KVGB 4RM9A 4GGQA 4GXBA 4ZRKA 4J6IA 3UQAA 2KWCA 2NBVB 1LXDA 1L2NA 4GIVA 4LJPB 3DVGY 3NZUA 4HJKA 4ZDVA 3M62B 1WGYA 5J18A 2OOBB 1WI0A 3HM3A 1UGMA 2NS5A 2O2VA 2C7HA 2G4DB 4GB9A 2GMIC 3W1YA 1RAXA 1WX9A 2MQJA 1VD2A 1WGGA 2KZRA 3DCGA 5D6JB 4B9KA 2AWTA 5CHWA 4FBJB 2J7QB 5JHAA 2C7MB 2A5UA 3KUDB 2BGFA 4MDKE 1E8WA 2YVCA 4AJWA 1H8CA 2O6VA 1TTNA 2BYEA 3NOBA 3I3TB
chains in the Genus database with same CATH superfamily
1DGJA 3KYDD 3KWLA 3TUOA 1YJJA 4II3B 2KVRA 2YEPF 2PTLA 3ECIA 5LXIB 1E8ZA 3AI5A 1XCTL 4MGZE 2W3RA 3DPDA 2BB5A 2FCSA 3EC8A 4KKJA 2K6QA 4PT5A 1D5ZC 3RUIB 3U4EG 3PO0A 3A9KB 4LNIA 2BYTA 2RDGA 4O1NA 4E71A 4A8XC 2N7EA 1WGDA 1N60A 4ITKA 5H8YE 1YQBA 3AEEB 4RF0A 1VZ8A 1MFWA 4BZAA 1E90A 2KOXA 3VTVA 1KTKA 5FR6A 3EA6A 2L1AA 2N0SB 1SIJA 2Y3AA 3HUIA 3JYUA 3KVFB 3TSSA 4EE2A 3KUCB 3A4SC 1Y56A 1YQ4B 1C79A 3NS8A 5C2TB 2MX2A 1HZ5A 5IA7A 2LUMA 2WXQA 2TSSA 4KKIA 1YIWA 1QQRA 1ESFA 5EE0A 3Q8AA 2JZPA 1XXGA 2B3AA 3O13A 3B2FA 1A70A 1E7UA 2K22A 3MC0B 4JWUC 3BINA 1NDDA 3A4RA 2RD0A 2C60A 3QWZB 1FFVA 5KHOA 3VXWA 1P3QU 4G3XB 2RDBC 5E6PA 2ASQA 3SDLC 1N61A 1HXYD 1GB1A 2XN9C 2PPHA 2Z8LA 2YEPB 4WJOA 1UH6A 2IO0B 2I2YA 2REXA 2HD5B 2HTHA 3ZGZA 3NVZA 2CHXA 3T3NA 3AE6B 1RFAA 3MC9A 4NJ6A 3U7ZA 2LVOA 2IO1B 2JVCA 1QF6A 1X1MA 3ETRA 4BVUC 2FUG1 3NUHB 4XC2A 2K8HA 3D32A 1HEZE 2LI5A 3T9LA 2Q5WD 3RCZA 3RMKC 3A1QA 1KFYB 2JYTA 3DBHB 3BK1A 1AARA 3BZDB 3NRZA 3T8MA 3TL5A 3CWIA 3ZLZA 5I4DA 3AEAB 2LEKA 3WIMA 1PQSA 3FILA 2KFKA 4FJYA 4EZJA 1PGXA 3GP7A 3H8HA 3AMZA 2ONQA 3QCAA 4PS8A 1H4RA 4FJZA 4KZ0A 1JQ4A 3C0RB 3W5VB 1UUPA 1STEA 1RLFA 1WRDB 4JWSC 1D5MC 3RNBC 2C7NB 2O6VB 3W1SC 4CHKA 2G1EA 4KGTA 5G2NA 2KLCA 3OJ4B 1L4DB 1UBIA 2M0XA 3GZNI 3P4RB 4KDLB 4A3PA 1HE8A 1BT0A 2M56B 2ZJDA 1J8CA 1V81A 3Q6BA 2R61A 3FILB 4MH0E 5JZEB 2KDMA 1TS2A 4YT0B 4IW0A 2O2VB 2MSED 1XLNA 2G3QB 4JX1C 3E56A 2IDYA 2G4SA 4H2AA 1IGCA 1QLBB 2INDC 3H7PA 2LFIA 4BAXA 2KK8A 1IPGA 3APCA 4YWGG 1TKEA 1BXTA 5DCNA 2BS4B 1V97A 1WZ3A 4PYUA 1LGRA 3RZFA 4NAWA 3NHEB 3R2TA 2MJDA 2L00B 5G55A 2J0MA 2PIAA 1U4AA 1LFDA 2D3CA 1ZXHA 2VZKD 3VAWA 3AE7B 4W9DA 2H89B 1TKGA 1UD7A 1K53A 4LCDE 3IT4B 1J7AA 2MBBB 1FRDA 3KWVA 3PHWB 2WQYB 4W9FA 1SXTA 3U30A 3ZRCA 1CJEA 5EE3A 2BF8B 1J19A 4FHJA 2MBOA 1FXTB 2KLGA 3OWEB 4LJOB 4ASWC 2RPQA 2N1WA 3VRAB 3HVDA 2IBIB 1C1YB 1Z5SB 2MJ3A 3RFZB 4REZA 2OEDA 3PVLA 3UIPB 1YJ1A 3VR8B 2PE9A 2KYWA 3DBHI 3VVWB 1CQVA 1IGDA 3UINB 4FN2A 1C77A 3NG0A 1HTOA 4ZOHC 4F8CB 2LRUA 2CHWA 3R3MA 1A5RA 4RFBA 3CMMB 1EU4A 2R2OA 3QJZA 4K7WA 1F52A 4W9EA 1AN8A 4HPPA 3V61A 3RPFC 3AEDB 3PRMB 2LGYA 2J4XA 3RNCC 2KMMA 1N6ZA 2FNJB 4C56C 3QA8A 2PVOD 3P4SB 3WANA 5BYQA 1R4MB 4C7YA 3IHPC 3ZVVA 4OVUA 2KC2A 3VTWA 5EE9A 2L8JA 2ZCCA 1TS4A 4MJSA 5IO9A 3SR6A 3AXCA 4EOYA 3PPAA 3PV1A 1BUIC 2KJRA 2RDHA 4NAWB 4DDID 3L17A 4MEMA 3UF8A 4K7UA 2IZVB 2WXMA 5IN7A 1V49A 5L83A 4E3CA 2M19A 2NR2A 2BTEA 2X38A 2LHEA 1L6VA 2W9NA 2J53A 4ARCA 3M95A 2LGSA 1P98A 5L95C 2AQ1B 2CJNA 4ANXA 3AB5A 3ONSA 3ZQ4A 2MRPA 1P7FA 1EUVB 3WAMA 1TIFA 4HJGE 4URKA 2KQSA 4K81A 2WXKA 3QARA 3BY4B 3A9JA 3VRBB 1SE3A 2JU6X 5D7GA 2WXIA 2KFJA 2JUOA 4NAMA 1RFKA 3ZNZB 5BO4B 2KMAA 4FJVB 2GBMA 4IM0A 4I6NB 3N1ZC 3VHTC 4WJQA 3A1QB 4RH6A 1C3TA 2D3BA 3ZW3A 1NEKB 2FE8A 4GIVA 4LJPB 3HM3A 2N9LA 3DWGC 4B9KA 5D6JB 3DCGA 5JHAA 4FBJB 2J7QB 1SEBD 2WXGA 1E8WA 3RI7C 1TTNA 2CU1A 2OJRA 4M01A 4L2YA 3VDZA 2KTRB 1F2RC 1D6EC 1WM2A 3QHTA 1WXAA 3BK2A 4PK1A 1OQRA 4MJSB 3AEBB 4M8MA 3JSVB 4JL9A 2ZPNA 2LGIA 2JX5A 4JPSA 2RR9A 4HDQA 4HXDA 1ZGUB 3Q3JA 2EMSA 1IBXA 3QK0A 3NS1A 3V05A 2DLBA 2K9XA 2O6VD 2UWQA 1HTQA 1WE7A 2MBQA 1V5TA 2HJ1A 1I4XA 4AUQC 2AL3A 2LD9A 4M0WB 4LNNA 3IAM1 1SE2A 4EZKA 4FLHA 2QEJC 3P1MA 3L54A 4HPMB 3AEGB 4TV3A 3ZTCA 1WWTA 3MJ5A 3PLUA 1PUTA 1JW9D 5DPTA 2QHOA 3BVZA 1JWUD 1GC7A 2DYMA 1F77A 3DBRB 4G11A 2DAJA 1I42A 2K0PA 3I57A 3ZNID 2LHDA 4MACA 4AS1A 2JT4B 1N62A 5LLIA 3X0WA 1ROEA 2N9XA 2INPE 3AU4A 1GJZA 4K1RB 1I35A 1FXIA 1L0YB 1UZXB 4FXCA 2KQ4X 3N3KB 4ANUA 1L0VB 3EHVA 1SSNA 4JIOU 2OHFA 1R7SA 1KLVA 1P0RA 1ET6A 4A6QA 3T3OA 4IUMB 2MCNB 5CHFA 2KDBA 4KSLC 1C4AA 4LNFA 4NJCA 1FCLA 1WX8A 3EECA 3DWMA 1Z2MA 5EDSA 3P2BA 4N58A 2D3GA 1QOFA 4S17A 1YJIA 4IDIA 2JPHA 4ZYNA 4TQ0A 3AE4B 1SJHD 4NNJB 3JVZX 5BYRA 3PREA 1E6EB 2E6XA 3UI3A 1ZPSA 4TKNA 2WU2B 2FBWB 1QKZA 2WXPA 1TYGB 4IG7B 4DK5A 1V1PB 1FEHA 3ALBA 5HFYA 3MFGA 1AYFA 2BB6A 3IAS1 2I1JA 3WAOA 1YN3A 1Q5WB 3J9CA 4YTNB 3PSEB 4WWPA 5D3IB 4RCOA 1WXMA 2ZVNA 3VUWA 1XEEA 2KWUB 1VZ6A 3BIID 4HROA 5T8IA 2NPTB 1FFUA 1PYWD 3PS6A 1WMHB 1MJDA 1WYGA 1TS3A 3NZ3A 2LWPA 2LRWA 3P63A 3DDCB 2AYOB 3N1XC 1JWBD 3GZNB 4MGKE 3GOEA 4TMAB 5LNK1 4XX5A 4R3DA 5E6JA 1OGWA 3IFWB 3ZDMC 1QILA 4BKGA 5IOIA 3V60A 2AQ3B 3BYTB 3VQIA 3BVMA 2WP9B 4MM3B 2NPTA 1E10A 1SE9A 3PRPB 2K25A 3JSVA 3NVWA 4WIPA 2D2QA 4AOFA 3VTUA 2D5GA 2IY0B 1HQRD 3PT2B 2QJLA 4WURA 1FIQA 4RGMA 1XF5L 4OVVA 1OFFA 2KJHB 1GNUA 3DVNU 1K51A 1SF0A 3I63C 1WJ6A 2V0GA 1WR6E 3DHHC 1OEYA 1D4BA 4FA6A 1FO4A 2R2QA 1M94A 2CS4A 1KH0A 2G9HD 3OLMD 3IT6B 2N4FA 3QX1A 1I4QA 1GB4A 4XZ4A 2ZCBA 4TSSA 1UBQA 3B2GA 4WH4A 4GU2A 2MH7A 4WWNA 1TS5A 3U52E 5HG2A 1XLPA 3U7DA 4IM3A 2NTSA 1C76A 4MH8A 3RULA 1D3ZA 1V1OA 1E8XA 2QIEB 3N9YC 3GE3C 4F1SA 1VDVA 4DHJB 1ZP0B 3APFA 4P7IA 3ZKJC 1EF1A 3R2IA 5H92C 2MP2A 4DDGD 3H1UA 4K7SA 4JGHB 3B1LX 3P42A 2GOWA 3H9DA 4E74A 3RNGC 2JSVX 5HI1A 5MPOA 2WU5B 2AL6A 2N1VA 2N7DA 2RGFA 4MGYE 1Q10A 3SHQA 5AZFA 3FAHA 3GS2A 2MBHA 4FADA 1GOZA 4YXDB 1AW7A 5D3DA 4BBNC 2BBCA 2DZJA 2WXFA 1F2RI 5FR3A 3IBEA 4TUUA 5TSSA 3ZXRA 2IO3B 2XNAC 3EFCA 4DHZE 2K3UA 2XBBC 2QCZA 4W9IA 4GSWA 5G5GA 2N7JA 1CK1A 4HPLB 2L52A 1J7BA 3DOWA 2INNE 2CR5A 5AEKB 2DAFA 4BKTA 3B08A 5JH5C 2LXAA 1NBFC 2JZ3B 3V6EB 4WWOA 2KXJA 1PDXA 1UNSA 2LASA 2GI9A 2SAKA 2KWCA 2NBVB 1FM0D 1L4ZB 4KX6B 4D2KA 5J18A 1UGMA 3W1YA 1WX9A 2K5PA 1FMAD 2C7MB 4MDKE 2BGFA 4AJWA 1H8CA 2RPVA 1QT9A 4OW0A 3FC4A 4XWWA 2GRIA 4UDUC 4LDTD 1EU3A 2WXNA 1JRPA 3ZO5B 4HKQA 4WJNA 5HHDG 1YOVB 1WJ4A 3CSFA 1F1HA 2KAJA 4S0RA 2INCC 1JRUA 3I9V1 4LK0M 2FCQA 1PFDA 2IGGA 1KLUD 3UQBA 2DHZA 4K3BA 4GDLA 4EUTA 2IGHA 2D10A 4X57B 2XEWA 1T5XD 3KH0A 2EKEC 3W9CB 4RGNA 1IBXB 2WX0A 4P6VF 2Y5PA 4NQKE 5E6OA 2BPSA 1VZ7A 4P16A 4XE0A 3PZDA 1FCCC 1RYJA 2CHZA 4M02A 1WJUA 2BS3B 1VR9A 2GLSA 2YLMA 1FRRA 4LLGM 3TJPA 3HRDD 4KSKC 3SFDB 4HLEA 1E0ZA 1FNUA 1IP9A 4TQ1A 4BBNF 2HE7A 4Q2JA 4KV2A 3ZIMA 4C00A 5IP4D 4W9GA 1LM8B 3L0WB 1DOYA 2DYBA 3DBLI 1WXVA 2MA9B 1WR1A 3K9OB 2LGDA 2EMTA 2KACA 3KW5B 2V4LA 1WXQA 1TY0A 4IC7B 4KDIC 5C23A 2HDEA 3BYYB 2WNMA 4MSMB 5DPRA 1MVKA 3NJTA 1P9DU 3R8BA 2MBEA 4US8A 1L7YA 3PHXB 1MHHE 2DENB 2JXXA 3EFUA 4PS3A 5LXHA 3QIJA 3HIZA 1NI2A 4HWIB 3MC8A 2DZKA 1XLOA 1FNWA 3IG3A 2QSDA 2H88B 3LXFA 4OZBA 4HCPB 4RGOS 4HCNB 1JMLA 1J7CA 1C78A 4ZRJA 2KKCA 1NYRA 4NQLB 3Q8EA 2J0JA 1Q1OA 3RZWC 2DNFA 2V1YA 2WYQA 4P1BC 4DBGA 2IO2B 1VLBA 2PW9A 2K6DB 3C19A 1JWSD 1L6UA 2QILA 2LXCA 3DVGX 4GOCA 2WWZA 3B9JA 3BWUD 3VUXA 1S1QB 1T6BX 5AZGA 4W9LA 4L23A 1E5WA 2LVQA 1UWXA 2D3AA 3P4QB 3UGBB 1T0QC 5FK9C 4LNOA 1IUEA 2WX1A 3RNFC 3ZJVA 1I4PA 2NTTA 4I6LB 3ZTDA 5IAAC 1UF0A 2KX0A 2DWQA 2KWDA 2QC8A 3LB8C 2J42A 4RNAA 3W1SA 3Q3FA 4IWPA 4NY0A 3NY5A 3ZNGC 4XDCA 3L16A 3IXSA 1WE6A 1KOTA 4II2B 1KJTA 2LMCA 1VJKA 2A4ZA 1MHXA 5BMGA 2IYDB 1R4NI 2JF5A 5FKAC 1NENB 2N9KA 1C4PA 2ZEQA 2MLBA 2ZW0A 4ICVA 4IWQA 2NBUA 1OQQA 2IY1B 1JCKB 2JRIB 2KANA 3PLVA 1JWMD 1YN4A 4CO7A 4NPNA 1DYQA 3VFKA 2KDEB 1DOIA 5CTRC 3WA0A 1FXAA 1ET9A 2JQRB 1VCBA 2BWES 1EF5A 1RRBA 3L4PA 3ENEA 2GBJA 4XWTA 2BQQA 4LNKA 2J52A 2D07B 4M8NA 2KMCA 5D2MB 2KN4A 2WDTB 3SU8X 3Q8BA 1JALA 1I7HA 3TEYA 2ACZB 2L7RA 3AH7A 3NVVA 3PGEA 3VH4B 1WSPA 4GDKA 2WDQB 4MSQB 1TKYA 3RNEC 2KQ7A 2JXTA 2K8BA 2ZPYA 4XDDA 2UYZB 4A90A 3APDA 4WWMA 2IGDA 1SJED 3R7QA 4DHJD 1HZ6A 3EGRA 2WGSA 3H6NA 4C7ZA 2BYVE 1EO6A 5KHQA 2WXLA 1K8RB 4AQ7A 4GN1A 2LUEA 3B0AA 2XK5A 2BKFA 4RGTA 3CF6E 3DBSA 4ZHOA 4BKSA 3M3JA 1V86A 4MT5A 3IVFA 2DZMA 4GDKB 3MHSD 1PGBA 2AQ2B 4YTPB 4WJPA 1YMHE 2VH1A 4G0NB 1LQBA 1KRHA 3QAQA 4ZYSA 2ZNVC 4M0WA 1V80A 4B0EA 4M00A 1SIFA 3W5UB 1IYFA 4PS7A 1P7EA 4W9KA 1I4RA 2L83A 2M1MA 3SD5A 1LO5D 3ML8A 1QOBA 5GXGB 4WAFA 2L32A 2KC1A 1FNVA 3X23A 2N9EB 3KQ4A 3TIXA 2FUHB 1GC6A 4DXFA 4N6EB 3DBLB 3ABVB 2HJ8A 2G45B 3MTNB 1TJEA 2K39A 3TMPB 4KZCA 4J3OD 4K3CA 2GBRA 2QDFA 2ZW1A 3DVNV 1M4VA 1EWCA 5DPSA 4EKUA 2BKRB 1KLGD 3Q8FA 5CHVC 3AE1B 2JY6A 2ON8A 2VRRB 1WX7A 1YD8U 3I5JC 1TZ1A 1XQQA 1GUAB 2WXHA 3DBRI 3AU5A 5GMVA 4HKZE 1ZDXA 1TBEA 4KIKA 3QQ8B 3RYTA 5HKHA 4OVZA 3PTFC 3URYA 4PYZA 3BVGA 5AZHA 4EZLA 1K50A 3Q14C 1P1AA 4HDOA 2C9WB 1ZXIA 5G5HA 2KFKB 3U2SC 2W54A 1XT9B 1GAQB 1E7VA 2FIDA 3ZYYX 1FPYA 1F9JA 5JXVA 3WAPA 2QMTA 4AJYB 4WQMA 1ZUD2 5C1ZA 1HA5A 4KVGB 4ZRKA 3FKYA 1L0XB 4GGQA 1LXDA 1JROA 1NYQA 4HJKA 4ZDVA 3AV8A 2KVZA 2OOBB 3TEZA 3AE9B 4CQNA 2PVGC 4B0MA 2V4IB 1RAXA 3PZ7A 1WGGA 2KZRA 3DHGC 1D5XC 1WRIA 3KUDB 2YVCA 2O6VA 1SBBB 3NOBA 3I3TB 4G50A 2PKOA 4L1BA 2V3SA 3GB1A 5C3JB 2CU3A 2LJ5A 2WXRA 3C8YA 2L05A 2W55A 2L0TA 5J17A 2KDIA 4DXGA 1WY8A 2NCNA 5EE1A 2KX3A 4YSXB 1E9MA 3WALA 3H7SA 2LZ6A 2B76B 4LDTB 1YX5B 1EWYC 2D11A 2NVUI 4RM8A 4N9F4 2Y5BB 1XO3A 2ZZPB 1L5PA 2WLBA 3U8ZA 2KDFB 1K52A 1R4NB 1S3SG 1C9FA 1WIAA 1OQYA 3A9JB 4KIKB 1F0ZA 2BT6A 3AE3B 1YQ3B 4HRSA 2MW5A 2I38A 4RF1A 3HK0A 3AM9A 2WS3B 3VH3B 1V6EA 3S2AA 5D94A 1CZPA 2W82A 3ZUNA 4YSZB 2MP2B 4HVBA 5BMHA 2KD0A 4ANVA 3Q3OC 4B6WA 1JWAD 4A20A 1V9JA 2KN5A 2M0AA 1WXSA 3L08A 4NZLB 3AE2B 4GMVA 3A9KA 1MPEA 2KHWB 4ANWA 2KTRA 2M8SA 4A9AA 5J2RA 2M17A 2MEKA 2BWFA 1KM7A 2DZIA 1QZEA 1BMLC 2BS2B 1UELA 4CYEA 4HK2A 2ZVOA 4N59A 3TBLD 2L76A 4US9A 1ZW7A 1WMHA 1YX6B 3AE5B 4OHJA 4ICUA 1G6JA 3R7RA 5CX3A 4OZAA 1V2YA 2WHIA 3RNAC 5AUKA 2GB1A 4ARIA 2NMQA 2K8CA 2V3NA 4MGIE 2BVCA 1WGHA 2CKHB 3P4PB 2LGXA 3KUZA 1QOGA 1E8YA 2I1KA 1FD6A 1TT5B 2BYFA 3MJWA 1N5XA 3DHIC 1XD3B 2DX5B 3R66C 3HHMA 2PJHA 4B95A 1XCQL 2V9HA 3SEBA 3EUB2 4YTMB 2OJWA 1QOAA 2XK5B 3Q69A 4HEA1 2KWVB 4BFRA 3LJ3A 3OJ3A 3RN9C 4C4VB 1RWSA 1WZ0A 3NZSA 1WGRA 1WGKA 3KYCD 1TY2A 3ZRFA 2EELA 4WAAA 2L3ZA 3OG5A 5BMIA 3K9PB 1ACCA 2WXOA 2EKIA 2PEAA 1TGZB 3LDZE 3MP9A 2M4NA 4IKGA 3SFEB 3AEFB 2ICIA 1NI3A 2FCNA 2DBYA 4W9HA 2NBWB 3VR9B 3RT3B 1Q0WB 5DPWA 2C5LC 3ZDTA 3H7PB 1ISNA 3N32A 2PLPA 1T0YA 3HVZA 4ZRIA 3ZJUA 4C4VA 4EEWA 3V6CB 3Q2AC 3AULA 1C4CA 3MHZA 1B1ZA 4F7ZA 3NVYA 4NJ7A 2X8XX 4LTUA 1CMXB 5TR5A 3WCQA 1T0RC 2BW2A 2IPKD 4KGSA 3PRZA 2MJEA 1I4HA 1B9RA 2JZZA 3N1YC 2PMVA 3AECB 2FIFA 1DOXA 3V62A 1WJNA 3L13A 2ZNVB 1T3QA 2HTME 1XLQA 2JRHA 1J0GA 1NVID 1N63A 3GE8C 1EM7A 1T0SC 2Z59B 4KGRA 1N5WA 4ZRQA 4P1CC 2V3PA 1WYWB 2FCMA 3AE8B 1TZOA 2KTFA 4JE3B 4A55A 4OZCA 3L10B 2JWZA 4ZRPA 1ENFA 1MG4A 1WH3A 4MM3A 1SE4A 5JHBA 3ML9A 4JQWC 1UWMA 3TCAA 2WDVB 1SGHA 2WDRB 4C80A 1WFYA 4GDLB 2E3TA 1YNTE 4XYCA 3LYYA 2RSUA 4ZHPA 2CJOA 4WQOB 1KF6B 4JLCA 5BYSA 3OAWA 4QAYA 2GBNA 2MWSB 2Z0EB 2AEHA 2PE6B 3W2DA 4FHKA 4ACFA 3TEWA 4MELA 3E9SA 4DQOC 4IWOA 4DHZB 3HM6X 3DQVA 1VRAB 4I6PA 1MI0A 3RD2A 1RM6C 4DWFA 2J0KA 2KNBA 2DYOA 1MG8A 4XGAB 2JYEA 3ZNHB 3UIOB 4BKSD 2LVPA 2L0FA 3QC8B 3N20C 1V8CA 1WM3A 3CIRB 4AP4C 3M63B 3Q3MC 3A33B 2VZKB 4AWJA 1Y8RC 2K1FA 2Z0DB 2KJ6A 4DXAB 3JW0X 4IOIE 2IJ0A 4IM2A 2Y5CA 1WF9A 2VH2A 1R4MI 2JWUA 3ZJTA 2MHJA 1SB3C 5AUIA 1ZKHA 4BOSC 1ZDVA 2W3SA 1V5OA 3Q8CA 1PGAA 4YSYB 2N9PC 4GLSC 3N30A 2KO3A 1E7PB 2FAZA 2LJIA 3AN1A 3V3XA 1GG3A 3TEXA 1I4GA 4W9CA 4EFOA 1UGJA 3O65B 2UU7A 4A3OA 3VUYA 1YN5A 1OEYJ 4W9JA 4RMAA 4BOZB 4FULA 1OTRB 2GBKA 3CSTA 2RMMA 4YL8A 2SEBD 4USAA 2AX5A 5E6NA 4RM9A 4GXBA 3UQAA 4J6IA 3ZXVA 3Q3NC 1L2NA 2KT7A 3DVGY 3NZUA 1ZOYB 3M62B 1WGYA 5IKCM 1WI0A 1AWDA 2WXJA 2NS5A 2O2VA 2C7HA 2G4DB 3KLSX 4GB9A 2GMIC 2MQJA 1VD2A 1ZE3D 3PZ8A 1V1PA 2AWTA 5CHWA 1GPXA 2A5UA 2BYEA
chains in the Genus database with same CATH topology
3KYDD 4G50A 2CU1A 2OJRA 4LDTD 3VDZA 4II3B 2KTRB 2V3SA 2KVRA 3ECIA 3ZO5B 5LXIB 1WM2A 4WJNA 1E8ZA 3AI5A 2LJ5A 3QHTA 1WJ4A 1WXAA 4MGZE 3CSFA 2L05A 4MJSB 3DPDA 3EC8A 2FCSA 2K6QA 2L0TA 4M8MA 3RUIB 3JSVB 5J17A 2KDIA 4JL9A 1WY8A 1JRUA 2NCNA 2ZPNA 3A9KB 2KX3A 2FCQA 3WALA 2RR9A 4HDQA 4E71A 4HXDA 3UQBA 2DHZA 1ZGUB 1WGDA 2N7EA 3H7SA 4GDLA 2LZ6A 4EUTA 2D10A 3Q3JA 4X57B 2EMSA 2XEWA 4LDTB 1YX5B 3KH0A 2EKEC 1YQBA 3QK0A 2D11A 2NVUI 4RM8A 4N9F4 1E90A 2Y5BB 2KOXA 2WX0A 2ZZPB 3VTVA 2O6VD 2UWQA 4NQKE 5FR6A 3U8ZA 2KDFB 1WE7A 2MBQA 5E6OA 1V5TA 2BPSA 1S3SG 1WIAA 3JYUA 4AUQC 2AL3A 2LD9A 4M0WB 3KVFB 1OQYA 3A9JB 3PZDA 4KIKB 2CHZA 4FLHA 3KUCB 4EZKA 3A4SC 1WJUA 2MW5A 2YLMA 3NS8A 3HK0A 3VH3B 1V6EA 3S2AA 2MX2A 5D94A 3TJPA 3L54A 5IA7A 3ZUNA 4HPMB 4KSKC 2MP2B 4TV3A 4HVBA 4HLEA 3ZTCA 3PLUA 2KD0A 5DPTA 1YIWA 1IP9A 4ANVA 4TQ1A 2QHOA 4B6WA 4BBNF 4A20A 1V9JA 2HE7A 2KN5A 1GC7A 4KV2A 2DYMA 3ZIMA 2B3AA 1WXSA 4G11A 2DAJA 3L08A 4W9GA 1E7UA 1I42A 3BINA 4GMVA 1LM8B 3L0WB 1NDDA 2DYBA 3A4RA 3A9KA 3DBLI 1WXVA 2KHWB 1WR1A 2MA9B 2RD0A 3K9OB 3ZNID 4ANWA 2C60A 2LGDA 2KTRA 2M8SA 3QWZB 5J2RA 2EMTA 2M17A 2JT4B 2BWFA 3KW5B 1KM7A 2DZIA 2V4LA 5KHOA 5C23A 4IC7B 3VXWA 1P3QU 4KDIC 1QZEA 5LLIA 4G3XB 3X0WA 5E6PA 2ASQA 3SDLC 1UELA 2N9XA 4CYEA 4HK2A 3AU4A 1GJZA 2ZVOA 3TBLD 2PPHA 2L76A 4MSMB 4K1RB 5DPRA 4WJOA 1UH6A 1I35A 2IO0B 1ZW7A 2REXA 2HD5B 1P9DU 2HTHA 2MBEA 1WMHA 2CHXA 1RFAA 1L7YA 3PHXB 4NJ6A 2DENB 1YX6B 2LVOA 1UZXB 4ICUA 2JXXA 3EFUA 3N3KB 4PS3A 2IO1B 2JVCA 3R7RA 5CX3A 4ANUA 5LXHA 1V2YA 3QIJA 3HIZA 1NI2A 3EHVA 4HWIB 1X1MA 4BVUC 4JIOU 2DZKA 3IG3A 4XC2A 2K8CA 2K8HA 1KLVA 1P0RA 4HCPB 4HCNB 4MGIE 1WGHA 2CKHB 3D32A 2LI5A 2LGXA 3KUZA 3T9LA 1E8YA 2I1KA 4IUMB 4ZRJA 2KKCA 3RCZA 3A1QA 2BYFA 3MJWA 4NQLB 1AARA 2MCNB 2J0JA 3T8MA 1Q1OA 5CHFA 3RZWC 2KDBA 2V1YA 2WYQA 1XD3B 2DX5B 3R66C 3TL5A 4DBGA 3HHMA 3ZLZA 2PJHA 4KSLC 4B95A 2IO2B 3WIMA 1WX8A 2K6DB 2LXCA 3EECA 3DVGX 2XK5B 1PQSA 1Z2MA 4GOCA 5EDSA 3P2BA 2WWZA 2KFKA 2D3GA 4FJYA 2KWVB 4BFRA 3LJ3A 3OJ3A 1S1QB 3VUXA 4EZJA 1WZ0A 3NZSA 3QCAA 2JPHA 4PS8A 1H4RA 5AZGA 1WGRA 4ZYNA 4TQ0A 3KYCD 4NNJB 4FJZA 3JVZX 3PREA 4W9LA 1E5WA 2LVQA 4KZ0A 3ZRFA 3C0RB 4WAAA 4TKNA 3UGBB 2L3ZA 1RLFA 3K9PB 2WX1A 1WRDB 4IG7B 4DK5A 3ALBA 2PEAA 1TGZB 3LDZE 3W1SC 4CHKA 2C7NB 2M4NA 2O6VB 4I6LB 3ZTDA 5G2NA 2KLCA 5IAAC 3OJ4B 2I1JA 1UBIA 2M0XA 2KX0A 3WAOA 2FCNA 4W9HA 2NBWB 3GZNI 4KDLB 3Q3FA 1Q5WB 3W1SA 4A3PA 1HE8A 3RT3B 4IWPA 1BT0A 1Q0WB 4NY0A 5DPWA 2C5LC 3ZDTA 3NY5A 2ZJDA 3H7PB 1J8CA 3PSEB 3ZNGC 1ISNA 1V81A 3N32A 3L16A 1WE6A 4WWPA 1KOTA 1T0YA 1KJTA 4II2B 1WXMA 4ZRIA 4MH0E 5JZEB 2ZVNA 2A4ZA 3VUWA 2KWUB 2IYDB 4EEWA 1R4NI 2JF5A 4IW0A 3V6CB 3AULA 2O2VB 2MSED 2ZEQA 2MLBA 2G3QB 4ICVA 4F7ZA 2NPTB 3PS6A 4IWQA 2NBUA 4NJ7A 1WMHB 2G4SA 1CMXB 2IY1B 2JRIB 2KANA 5TR5A 3H7PA 3PLVA 2KK8A 4CO7A 4NPNA 1IPGA 3APCA 2LWPA 3VFKA 2LRWA 5DCNA 2KDEB 5CTRC 3WA0A 3PRZA 3DDCB 2AYOB 1WZ3A 1VCBA 4PYUA 3RZFA 2BWES 2JZZA 1EF5A 4NAWA 1RRBA 3NHEB 5G55A 2L00B 2FIFA 2J0MA 2GBJA 3ENEA 3V62A 4MGKE 1WJNA 3L13A 2ZNVB 3GOEA 1U4AA 4XX5A 1LFDA 2JRHA 2D07B 4M8NA 1J0GA 2KMCA 5D2MB 2WDTB 1OGWA 3VAWA 3SU8X 3IFWB 3ZDMC 2Z59B 4BKGA 3V60A 2L7RA 3PGEA 3VH4B 4W9DA 1WYWB 1UD7A 2FCMA 4GDKA 4LCDE 2MBBB 3VQIA 2KTFA 4MSQB 3PHWB 2NPTA 1SE9A 2KQ7A 2K25A 3JSVA 3PRPB 4W9FA 2K8BA 3U30A 3ZRCA 2ZPYA 2D2QA 3L10B 2BF8B 4AOFA 1J19A 3VTUA 2UYZB 4FHJA 2JWZA 2MBOA 1FXTB 2KLGA 4LJOB 3APDA 4ASWC 2RPQA 2IY0B 2N1WA 3R7QA 4DHJD 3PT2B 1WH3A 3H6NA 2IBIB 1C1YB 1Z5SB 4MM3A 2BYVE 5JHBA 3PVLA 4OVVA 3UIPB 1EO6A 3ML9A 1YJ1A 4JQWC 2KJHB 1GNUA 3DVNU 2PE9A 5KHQA 3DBHI 3TCAA 1K8RB 1WJ6A 1SGHA 4GN1A 3VVWB 2LUEA 3B0AA 2XK5A 1WR6E 1WFYA 1OEYA 2BKFA 3CF6E 3DBSA 3UINB 4FN2A 4FA6A 4GDLB 4BKSA 3M3JA 2R2QA 2RSUA 1M94A 1V86A 2CS4A 3IVFA 2LRUA 4WQOB 4F8CB 2DZMA 4GDKB 2CHWA 3MHSD 3R3MA 1A5RA 3OLMD 3QX1A 2N4FA 4JLCA 3CMMB 4XZ4A 2ZCBA 4WJPA 3OAWA 1UBQA 2GBNA 2MWSB 2R2OA 2Z0EB 3QJZA 2AEHA 4GU2A 2PE6B 4G0NB 1LQBA 4WWNA 4K7WA 4FHKA 3U7DA 3QAQA 2ZNVC 4W9EA 4IM3A 1V80A 3RULA 1SIFA 1D3ZA 3V61A 3PRMB 1E8XA 2LGYA 4PS7A 4MELA 1IYFA 4W9KA 4IWOA 2FNJB 2M1MA 3SD5A 4F1SA 4DHZB 3ML8A 3HM6X 3QA8A 3DQVA 4DHJB 4I6PA 3RD2A 4DWFA 3WANA 2J0KA 2KC1A 3APFA 2KNBA 2DYOA 3X23A 3IHPC 3ZVVA 4OVUA 2N9EB 4P7IA 2KC2A 3ZKJC 1MG8A 3TIXA 2FUHB 3VTWA 1EF1A 1GC6A 2L8JA 3ZNHB 3UIOB 4BKSD 2MP2A 2ZCCA 4DDGD 4MJSA 3H1UA 2LVPA 4K7SA 2L0FA 2HJ8A 4JGHB 3AXCA 3QC8B 2G45B 3B1LX 4EOYA 3PPAA 3MTNB 3PV1A 1WM3A 2GOWA 3H9DA 2KJRA 4E74A 4NAWB 4DDID 3L17A 4MEMA 3M63B 4AP4C 2K39A 2AL6A 2N1VA 4KZCA 3TMPB 2N7DA 3A33B 3UF8A 2RGFA 4K7UA 4AWJA 2IZVB 1Y8RC 2K1FA 2Z0DB 4MGYE 2KJ6A 4DXAB 2GBRA 3JW0X 3SHQA 3DVNV 4IM2A 5DPSA 1V49A 1WF9A 5L83A 4E3CA 5AZFA 2NR2A 4EKUA 2BKRB 5CHVC 1R4MI 2W9NA 2JY6A 2MBHA 2VRRB 3M95A 4FADA 1WX7A 1YD8U 1P98A 5L95C 1TZ1A 1XQQA 1GUAB 1ZKHA 4BOSC 4ANXA 4BBNC 2DZJA 3DBRI 3AU5A 5GMVA 3IBEA 3ONSA 2MRPA 1V5OA 4TUUA 1TBEA 1EUVB 3QQ8B 4KIKA 3RYTA 3WAMA 5HKHA 3PTFC 2N9PC 4PYZA 2IO3B 3N30A 2KO3A 2FAZA 4DHZE 4URKA 5AZHA 4EZLA 2XBBC 2KQSA 4K81A 1P1AA 1GG3A 3QARA 3BY4B 4HDOA 4W9IA 1G6JA 4GSWA 4W9CA 3A9JA 4EFOA 2C9WB 3O65B 5D7GA 4HPLB 2KFKB 1XT9B 3DOWA 2KFJA 1E7VA 4A3OA 2CR5A 2JUOA 5AEKB 2FIDA 2DAFA 4BKTA 3VUYA 3ZNZB 1OEYJ 3B08A 4W9JA 4RMAA 5BO4B 5JH5C 4BOZB 2LXAA 1NBFC 4FULA 2KMAA 4FJVB 1OTRB 2GBKA 2GBMA 3CSTA 4IM0A 4YL8A 2JZ3B 4I6NB 1F9JA 3V6EB 3VHTC 4WWOA 4WJQA 3WAPA 2KXJA 3A1QB 1C3TA 4AJYB 5C1ZA 2LASA 5E6NA 3ZW3A 4KVGB 4RM9A 4GGQA 4GXBA 4ZRKA 4J6IA 3UQAA 2KWCA 2NBVB 1LXDA 1L2NA 4GIVA 4LJPB 3DVGY 3NZUA 4HJKA 4ZDVA 3M62B 1WGYA 5J18A 2OOBB 1WI0A 3HM3A 1UGMA 2NS5A 2O2VA 2C7HA 2G4DB 4GB9A 2GMIC 3W1YA 1RAXA 1WX9A 2MQJA 1VD2A 1WGGA 2KZRA 3DCGA 5D6JB 4B9KA 2AWTA 5CHWA 4FBJB 2J7QB 5JHAA 2C7MB 2A5UA 3KUDB 2BGFA 4MDKE 1E8WA 2YVCA 4AJWA 1H8CA 2O6VA 1TTNA 2BYEA 3NOBA 3I3TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KYD D;  4G50 A;  2CU1 A;  2OJR A;  4LDT D;  3VDZ A;  4II3 B;  2KTR B;  2V3S A;  2KVR A;  3ECI A;  3ZO5 B;  5LXI B;  1WM2 A;  4WJN A;  1E8Z A;  3AI5 A;  2LJ5 A;  3QHT A;  1WJ4 A;  1WXA A;  4MGZ E;  3CSF A;  2L05 A;  4MJS B;  3DPD A;  3EC8 A;  2FCS A;  2K6Q A;  2L0T A;  4M8M A;  3RUI B;  3JSV B;  5J17 A;  2KDI A;  4JL9 A;  1WY8 A;  1JRU A;  2NCN A;  2ZPN A;  3A9K B;  2KX3 A;  2FCQ A;  3WAL A;  2RR9 A;  4HDQ A;  4E71 A;  4HXD A;  3UQB A;  2DHZ A;  1ZGU B;  1WGD A;  2N7E A;  3H7S A;  4GDL A;  2LZ6 A;  4EUT A;  2D10 A;  3Q3J A;  4X57 B;  2EMS A;  2XEW A;  4LDT B;  1YX5 B;  3KH0 A;  2EKE C;  1YQB A;  3QK0 A;  2D11 A;  2NVU I;  4RM8 A;  4N9F 4;  1E90 A;  2Y5B B;  2KOX A;  2WX0 A;  2ZZP B;  3VTV A;  2O6V D;  2UWQ A;  4NQK E;  5FR6 A;  3U8Z A;  2KDF B;  1WE7 A;  2MBQ A;  5E6O A;  1V5T A;  2BPS A;  1S3S G;  1WIA A;  3JYU A;  4AUQ C;  2AL3 A;  2LD9 A;  4M0W B;  3KVF B;  1OQY A;  3A9J B;  3PZD A;  4KIK B;  2CHZ A;  4FLH A;  3KUC B;  4EZK A;  3A4S C;  1WJU A;  2MW5 A;  2YLM A;  3NS8 A;  3HK0 A;  3VH3 B;  1V6E A;  3S2A A;  2MX2 A;  5D94 A;  3TJP A;  3L54 A;  5IA7 A;  3ZUN A;  4HPM B;  4KSK C;  2MP2 B;  4TV3 A;  4HVB A;  4HLE A;  3ZTC A;  3PLU A;  2KD0 A;  5DPT A;  1YIW A;  1IP9 A;  4ANV A;  4TQ1 A;  2QHO A;  4B6W A;  4BBN F;  4A20 A;  1V9J A;  2HE7 A;  2KN5 A;  1GC7 A;  4KV2 A;  2DYM A;  3ZIM A;  2B3A A;  1WXS A;  4G11 A;  2DAJ A;  3L08 A;  4W9G A;  1E7U A;  1I42 A;  3BIN A;  4GMV A;  1LM8 B;  3L0W B;  1NDD A;  2DYB A;  3A4R A;  3A9K A;  3DBL I;  1WXV A;  2KHW B;  1WR1 A;  2MA9 B;  2RD0 A;  3K9O B;  3ZNI D;  4ANW A;  2C60 A;  2LGD A;  2KTR A;  2M8S A;  3QWZ B;  5J2R A;  2EMT A;  2M17 A;  2JT4 B;  2BWF A;  3KW5 B;  1KM7 A;  2DZI A;  2V4L A;  5KHO A;  5C23 A;  4IC7 B;  3VXW A;  1P3Q U;  4KDI C;  1QZE A;  5LLI A;  4G3X B;  3X0W A;  5E6P A;  2ASQ A;  3SDL C;  1UEL A;  2N9X A;  4CYE A;  4HK2 A;  3AU4 A;  1GJZ A;  2ZVO A;  3TBL D;  2PPH A;  2L76 A;  4MSM B;  4K1R B;  5DPR A;  4WJO A;  1UH6 A;  1I35 A;  2IO0 B;  1ZW7 A;  2REX A;  2HD5 B;  1P9D U;  2HTH A;  2MBE A;  1WMH A;  2CHX A;  1RFA A;  1L7Y A;  3PHX B;  4NJ6 A;  2DEN B;  1YX6 B;  2LVO A;  1UZX B;  4ICU A;  2JXX A;  3EFU A;  3N3K B;  4PS3 A;  2IO1 B;  2JVC A;  3R7R A;  5CX3 A;  4ANU A;  5LXH A;  1V2Y A;  3QIJ A;  3HIZ A;  1NI2 A;  3EHV A;  4HWI B;  1X1M A;  4BVU C;  4JIO U;  2DZK A;  3IG3 A;  4XC2 A;  2K8C A;  2K8H A;  1KLV A;  1P0R A;  4HCP B;  4HCN B;  4MGI E;  1WGH A;  2CKH B;  3D32 A;  2LI5 A;  2LGX A;  3KUZ A;  3T9L A;  1E8Y A;  2I1K A;  4IUM B;  4ZRJ A;  2KKC A;  3RCZ A;  3A1Q A;  2BYF A;  3MJW A;  4NQL B;  1AAR A;  2MCN B;  2J0J A;  3T8M A;  1Q1O A;  5CHF A;  3RZW C;  2KDB A;  2V1Y A;  2WYQ A;  1XD3 B;  2DX5 B;  3R66 C;  3TL5 A;  4DBG A;  3HHM A;  3ZLZ A;  2PJH A;  4KSL C;  4B95 A;  2IO2 B;  3WIM A;  1WX8 A;  2K6D B;  2LXC A;  3EEC A;  3DVG X;  2XK5 B;  1PQS A;  1Z2M A;  4GOC A;  5EDS A;  3P2B A;  2WWZ A;  2KFK A;  2D3G A;  4FJY A;  2KWV B;  4BFR A;  3LJ3 A;  3OJ3 A;  1S1Q B;  3VUX A;  4EZJ A;  1WZ0 A;  3NZS A;  3QCA A;  2JPH A;  4PS8 A;  1H4R A;  5AZG A;  1WGR A;  4ZYN A;  4TQ0 A;  3KYC D;  4NNJ B;  4FJZ A;  3JVZ X;  3PRE A;  4W9L A;  1E5W A;  2LVQ A;  4KZ0 A;  3ZRF A;  3C0R B;  4WAA A;  4TKN A;  3UGB B;  2L3Z A;  1RLF A;  3K9P B;  2WX1 A;  1WRD B;  4IG7 B;  4DK5 A;  3ALB A;  2PEA A;  1TGZ B;  3LDZ E;  3W1S C;  4CHK A;  2C7N B;  2M4N A;  2O6V B;  4I6L B;  3ZTD A;  5G2N A;  2KLC A;  5IAA C;  3OJ4 B;  2I1J A;  1UBI A;  2M0X A;  2KX0 A;  3WAO A;  2FCN A;  4W9H A;  2NBW B;  3GZN I;  4KDL B;  3Q3F A;  1Q5W B;  3W1S A;  4A3P A;  1HE8 A;  3RT3 B;  4IWP A;  1BT0 A;  1Q0W B;  4NY0 A;  5DPW A;  2C5L C;  3ZDT A;  3NY5 A;  2ZJD A;  3H7P B;  1J8C A;  3PSE B;  3ZNG C;  1ISN A;  1V81 A;  3N32 A;  3L16 A;  1WE6 A;  4WWP A;  1KOT A;  1T0Y A;  1KJT A;  4II2 B;  1WXM A;  4ZRI A;  4MH0 E;  5JZE B;  2ZVN A;  2A4Z A;  3VUW A;  2KWU B;  2IYD B;  4EEW A;  1R4N I;  2JF5 A;  4IW0 A;  3V6C B;  3AUL A;  2O2V B;  2MSE D;  2ZEQ A;  2MLB A;  2G3Q B;  4ICV A;  4F7Z A;  2NPT B;  3PS6 A;  4IWQ A;  2NBU A;  4NJ7 A;  1WMH B;  2G4S A;  1CMX B;  2IY1 B;  2JRI B;  2KAN A;  5TR5 A;  3H7P A;  3PLV A;  2KK8 A;  4CO7 A;  4NPN A;  1IPG A;  3APC A;  2LWP A;  3VFK A;  2LRW A;  5DCN A;  2KDE B;  5CTR C;  3WA0 A;  3PRZ A;  3DDC B;  2AYO B;  1WZ3 A;  1VCB A;  4PYU A;  3RZF A;  2BWE S;  2JZZ A;  1EF5 A;  4NAW A;  1RRB A;  3NHE B;  5G55 A;  2L00 B;  2FIF A;  2J0M A;  2GBJ A;  3ENE A;  3V62 A;  4MGK E;  1WJN A;  3L13 A;  2ZNV B;  3GOE A;  1U4A A;  4XX5 A;  1LFD A;  2JRH A;  2D07 B;  4M8N A;  1J0G A;  2KMC A;  5D2M B;  2WDT B;  1OGW A;  3VAW A;  3SU8 X;  3IFW B;  3ZDM C;  2Z59 B;  4BKG A;  3V60 A;  2L7R A;  3PGE A;  3VH4 B;  4W9D A;  1WYW B;  1UD7 A;  2FCM A;  4GDK A;  4LCD E;  2MBB B;  3VQI A;  2KTF A;  4MSQ B;  3PHW B;  2NPT A;  1SE9 A;  2KQ7 A;  2K25 A;  3JSV A;  3PRP B;  4W9F A;  2K8B A;  3U30 A;  3ZRC A;  2ZPY A;  2D2Q A;  3L10 B;  2BF8 B;  4AOF A;  1J19 A;  3VTU A;  2UYZ B;  4FHJ A;  2JWZ A;  2MBO A;  1FXT B;  2KLG A;  4LJO B;  3APD A;  4ASW C;  2RPQ A;  2IY0 B;  2N1W A;  3R7Q A;  4DHJ D;  3PT2 B;  1WH3 A;  3H6N A;  2IBI B;  1C1Y B;  1Z5S B;  4MM3 A;  2BYV E;  5JHB A;  3PVL A;  4OVV A;  3UIP B;  1EO6 A;  3ML9 A;  1YJ1 A;  4JQW C;  2KJH B;  1GNU A;  3DVN U;  2PE9 A;  5KHQ A;  3DBH I;  3TCA A;  1K8R B;  1WJ6 A;  1SGH A;  4GN1 A;  3VVW B;  2LUE A;  3B0A A;  2XK5 A;  1WR6 E;  1WFY A;  1OEY A;  2BKF A;  3CF6 E;  3DBS A;  3UIN B;  4FN2 A;  4FA6 A;  4GDL B;  4BKS A;  3M3J A;  2R2Q A;  2RSU A;  1M94 A;  1V86 A;  2CS4 A;  3IVF A;  2LRU A;  4WQO B;  4F8C B;  2DZM A;  4GDK B;  2CHW A;  3MHS D;  3R3M A;  1A5R A;  3OLM D;  3QX1 A;  2N4F A;  4JLC A;  3CMM B;  4XZ4 A;  2ZCB A;  4WJP A;  3OAW A;  1UBQ A;  2GBN A;  2MWS B;  2R2O A;  2Z0E B;  3QJZ A;  2AEH A;  4GU2 A;  2PE6 B;  4G0N B;  1LQB A;  4WWN A;  4K7W A;  4FHK A;  3U7D A;  3QAQ A;  2ZNV C;  4W9E A;  4IM3 A;  1V80 A;  3RUL A;  1SIF A;  1D3Z A;  3V61 A;  3PRM B;  1E8X A;  2LGY A;  4PS7 A;  4MEL A;  1IYF A;  4W9K A;  4IWO A;  2FNJ B;  2M1M A;  3SD5 A;  4F1S A;  4DHZ B;  3ML8 A;  3HM6 X;  3QA8 A;  3DQV A;  4DHJ B;  4I6P A;  3RD2 A;  4DWF A;  3WAN A;  2J0K A;  2KC1 A;  3APF A;  2KNB A;  2DYO A;  3X23 A;  3IHP C;  3ZVV A;  4OVU A;  2N9E B;  4P7I A;  2KC2 A;  3ZKJ C;  1MG8 A;  3TIX A;  2FUH B;  3VTW A;  1EF1 A;  1GC6 A;  2L8J A;  3ZNH B;  3UIO B;  4BKS D;  2MP2 A;  2ZCC A;  4DDG D;  4MJS A;  3H1U A;  2LVP A;  4K7S A;  2L0F A;  2HJ8 A;  4JGH B;  3AXC A;  3QC8 B;  2G45 B;  3B1L X;  4EOY A;  3PPA A;  3MTN B;  3PV1 A;  1WM3 A;  2GOW A;  3H9D A;  2KJR A;  4E74 A;  4NAW B;  4DDI D;  3L17 A;  4MEM A;  3M63 B;  4AP4 C;  2K39 A;  2AL6 A;  2N1V A;  4KZC A;  3TMP B;  2N7D A;  3A33 B;  3UF8 A;  2RGF A;  4K7U A;  4AWJ A;  2IZV B;  1Y8R C;  2K1F A;  2Z0D B;  4MGY E;  2KJ6 A;  4DXA B;  2GBR A;  3JW0 X;  3SHQ A;  3DVN V;  4IM2 A;  5DPS A;  1V49 A;  1WF9 A;  5L83 A;  4E3C A;  5AZF A;  2NR2 A;  4EKU A;  2BKR B;  5CHV C;  1R4M I;  2W9N A;  2JY6 A;  2MBH A;  2VRR B;  3M95 A;  4FAD A;  1WX7 A;  1YD8 U;  1P98 A;  5L95 C;  1TZ1 A;  1XQQ A;  1GUA B;  1ZKH A;  4BOS C;  4ANX A;  4BBN C;  2DZJ A;  3DBR I;  3AU5 A;  5GMV A;  3IBE A;  3ONS A;  2MRP A;  1V5O A;  4TUU A;  1TBE A;  1EUV B;  3QQ8 B;  4KIK A;  3RYT A;  3WAM A;  5HKH A;  3PTF C;  2N9P C;  4PYZ A;  2IO3 B;  3N30 A;  2KO3 A;  2FAZ A;  4DHZ E;  4URK A;  5AZH A;  4EZL A;  2XBB C;  2KQS A;  4K81 A;  1P1A A;  1GG3 A;  3QAR A;  3BY4 B;  4HDO A;  4W9I A;  1G6J A;  4GSW A;  4W9C A;  3A9J A;  4EFO A;  2C9W B;  3O65 B;  5D7G A;  4HPL B;  2KFK B;  1XT9 B;  3DOW A;  2KFJ A;  1E7V A;  4A3O A;  2CR5 A;  2JUO A;  5AEK B;  2FID A;  2DAF A;  4BKT A;  3VUY A;  3ZNZ B;  1OEY J;  3B08 A;  4W9J A;  4RMA A;  5BO4 B;  5JH5 C;  4BOZ B;  2LXA A;  1NBF C;  4FUL A;  2KMA A;  4FJV B;  1OTR B;  2GBK A;  2GBM A;  3CST A;  4IM0 A;  4YL8 A;  2JZ3 B;  4I6N B;  1F9J A;  3V6E B;  3VHT C;  4WWO A;  4WJQ A;  3WAP A;  2KXJ A;  3A1Q B;  1C3T A;  4AJY B;  5C1Z A;  2LAS A;  5E6N A;  3ZW3 A;  4KVG B;  4RM9 A;  4GGQ A;  4GXB A;  4ZRK A;  4J6I A;  3UQA A;  2KWC A;  2NBV B;  1LXD A;  1L2N A;  4GIV A;  4LJP B;  3DVG Y;  3NZU A;  4HJK A;  4ZDV A;  3M62 B;  1WGY A;  5J18 A;  2OOB B;  1WI0 A;  3HM3 A;  1UGM A;  2NS5 A;  2O2V A;  2C7H A;  2G4D B;  4GB9 A;  2GMI C;  3W1Y A;  1RAX A;  1WX9 A;  2MQJ A;  1VD2 A;  1WGG A;  2KZR A;  3DCG A;  5D6J B;  4B9K A;  2AWT A;  5CHW A;  4FBJ B;  2J7Q B;  5JHA A;  2C7M B;  2A5U A;  3KUD B;  2BGF A;  4MDK E;  1E8W A;  2YVC A;  4AJW A;  1H8C A;  2O6V A;  1TTN A;  2BYE A;  3NOB A;  3I3T B; 
#chains in the Genus database with same CATH topology
 1DGJ A;  3KYD D;  3KWL A;  3TUO A;  1YJJ A;  4II3 B;  2KVR A;  2YEP F;  2PTL A;  3ECI A;  5LXI B;  1E8Z A;  3AI5 A;  1XCT L;  4MGZ E;  2W3R A;  3DPD A;  2BB5 A;  2FCS A;  3EC8 A;  4KKJ A;  2K6Q A;  4PT5 A;  1D5Z C;  3RUI B;  3U4E G;  3PO0 A;  3A9K B;  4LNI A;  2BYT A;  2RDG A;  4O1N A;  4E71 A;  4A8X C;  2N7E A;  1WGD A;  1N60 A;  4ITK A;  5H8Y E;  1YQB A;  3AEE B;  4RF0 A;  1VZ8 A;  1MFW A;  4BZA A;  1E90 A;  2KOX A;  3VTV A;  1KTK A;  5FR6 A;  3EA6 A;  2L1A A;  2N0S B;  1SIJ A;  2Y3A A;  3HUI A;  3JYU A;  3KVF B;  3TSS A;  4EE2 A;  3KUC B;  3A4S C;  1Y56 A;  1YQ4 B;  1C79 A;  3NS8 A;  5C2T B;  2MX2 A;  1HZ5 A;  5IA7 A;  2LUM A;  2WXQ A;  2TSS A;  4KKI A;  1YIW A;  1QQR A;  1ESF A;  5EE0 A;  3Q8A A;  2JZP A;  1XXG A;  2B3A A;  3O13 A;  3B2F A;  1A70 A;  1E7U A;  2K22 A;  3MC0 B;  4JWU C;  3BIN A;  1NDD A;  3A4R A;  2RD0 A;  2C60 A;  3QWZ B;  1FFV A;  5KHO A;  3VXW A;  1P3Q U;  4G3X B;  2RDB C;  5E6P A;  2ASQ A;  3SDL C;  1N61 A;  1HXY D;  1GB1 A;  2XN9 C;  2PPH A;  2Z8L A;  2YEP B;  4WJO A;  1UH6 A;  2IO0 B;  2I2Y A;  2REX A;  2HD5 B;  2HTH A;  3ZGZ A;  3NVZ A;  2CHX A;  3T3N A;  3AE6 B;  1RFA A;  3MC9 A;  4NJ6 A;  3U7Z A;  2LVO A;  2IO1 B;  2JVC A;  1QF6 A;  1X1M A;  3ETR A;  4BVU C;  2FUG 1;  3NUH B;  4XC2 A;  2K8H A;  3D32 A;  1HEZ E;  2LI5 A;  3T9L A;  2Q5W D;  3RCZ A;  3RMK C;  3A1Q A;  1KFY B;  2JYT A;  3DBH B;  3BK1 A;  1AAR A;  3BZD B;  3NRZ A;  3T8M A;  3TL5 A;  3CWI A;  3ZLZ A;  5I4D A;  3AEA B;  2LEK A;  3WIM A;  1PQS A;  3FIL A;  2KFK A;  4FJY A;  4EZJ A;  1PGX A;  3GP7 A;  3H8H A;  3AMZ A;  2ONQ A;  3QCA A;  4PS8 A;  1H4R A;  4FJZ A;  4KZ0 A;  1JQ4 A;  3C0R B;  3W5V B;  1UUP A;  1STE A;  1RLF A;  1WRD B;  4JWS C;  1D5M C;  3RNB C;  2C7N B;  2O6V B;  3W1S C;  4CHK A;  2G1E A;  4KGT A;  5G2N A;  2KLC A;  3OJ4 B;  1L4D B;  1UBI A;  2M0X A;  3GZN I;  3P4R B;  4KDL B;  4A3P A;  1HE8 A;  1BT0 A;  2M56 B;  2ZJD A;  1J8C A;  1V81 A;  3Q6B A;  2R61 A;  3FIL B;  4MH0 E;  5JZE B;  2KDM A;  1TS2 A;  4YT0 B;  4IW0 A;  2O2V B;  2MSE D;  1XLN A;  2G3Q B;  4JX1 C;  3E56 A;  2IDY A;  2G4S A;  4H2A A;  1IGC A;  1QLB B;  2IND C;  3H7P A;  2LFI A;  4BAX A;  2KK8 A;  1IPG A;  3APC A;  4YWG G;  1TKE A;  1BXT A;  5DCN A;  2BS4 B;  1V97 A;  1WZ3 A;  4PYU A;  1LGR A;  3RZF A;  4NAW A;  3NHE B;  3R2T A;  2MJD A;  2L00 B;  5G55 A;  2J0M A;  2PIA A;  1U4A A;  1LFD A;  2D3C A;  1ZXH A;  2VZK D;  3VAW A;  3AE7 B;  4W9D A;  2H89 B;  1TKG A;  1UD7 A;  1K53 A;  4LCD E;  3IT4 B;  1J7A A;  2MBB B;  1FRD A;  3KWV A;  3PHW B;  2WQY B;  4W9F A;  1SXT A;  3U30 A;  3ZRC A;  1CJE A;  5EE3 A;  2BF8 B;  1J19 A;  4FHJ A;  2MBO A;  1FXT B;  2KLG A;  3OWE B;  4LJO B;  4ASW C;  2RPQ A;  2N1W A;  3VRA B;  3HVD A;  2IBI B;  1C1Y B;  1Z5S B;  2MJ3 A;  3RFZ B;  4REZ A;  2OED A;  3PVL A;  3UIP B;  1YJ1 A;  3VR8 B;  2PE9 A;  2KYW A;  3DBH I;  3VVW B;  1CQV A;  1IGD A;  3UIN B;  4FN2 A;  1C77 A;  3NG0 A;  1HTO A;  4ZOH C;  4F8C B;  2LRU A;  2CHW A;  3R3M A;  1A5R A;  4RFB A;  3CMM B;  1EU4 A;  2R2O A;  3QJZ A;  4K7W A;  1F52 A;  4W9E A;  1AN8 A;  4HPP A;  3V61 A;  3RPF C;  3AED B;  3PRM B;  2LGY A;  2J4X A;  3RNC C;  2KMM A;  1N6Z A;  2FNJ B;  4C56 C;  3QA8 A;  2PVO D;  3P4S B;  3WAN A;  5BYQ A;  1R4M B;  4C7Y A;  3IHP C;  3ZVV A;  4OVU A;  2KC2 A;  3VTW A;  5EE9 A;  2L8J A;  2ZCC A;  1TS4 A;  4MJS A;  5IO9 A;  3SR6 A;  3AXC A;  4EOY A;  3PPA A;  3PV1 A;  1BUI C;  2KJR A;  2RDH A;  4NAW B;  4DDI D;  3L17 A;  4MEM A;  3UF8 A;  4K7U A;  2IZV B;  2WXM A;  5IN7 A;  1V49 A;  5L83 A;  4E3C A;  2M19 A;  2NR2 A;  2BTE A;  2X38 A;  2LHE A;  1L6V A;  2W9N A;  2J53 A;  4ARC A;  3M95 A;  2LGS A;  1P98 A;  5L95 C;  2AQ1 B;  2CJN A;  4ANX A;  3AB5 A;  3ONS A;  3ZQ4 A;  2MRP A;  1P7F A;  1EUV B;  3WAM A;  1TIF A;  4HJG E;  4URK A;  2KQS A;  4K81 A;  2WXK A;  3QAR A;  3BY4 B;  3A9J A;  3VRB B;  1SE3 A;  2JU6 X;  5D7G A;  2WXI A;  2KFJ A;  2JUO A;  4NAM A;  1RFK A;  3ZNZ B;  5BO4 B;  2KMA A;  4FJV B;  2GBM A;  4IM0 A;  4I6N B;  3N1Z C;  3VHT C;  4WJQ A;  3A1Q B;  4RH6 A;  1C3T A;  2D3B A;  3ZW3 A;  1NEK B;  2FE8 A;  4GIV A;  4LJP B;  3HM3 A;  2N9L A;  3DWG C;  4B9K A;  5D6J B;  3DCG A;  5JHA A;  4FBJ B;  2J7Q B;  1SEB D;  2WXG A;  1E8W A;  3RI7 C;  1TTN A;  2CU1 A;  2OJR A;  4M01 A;  4L2Y A;  3VDZ A;  2KTR B;  1F2R C;  1D6E C;  1WM2 A;  3QHT A;  1WXA A;  3BK2 A;  4PK1 A;  1OQR A;  4MJS B;  3AEB B;  4M8M A;  3JSV B;  4JL9 A;  2ZPN A;  2LGI A;  2JX5 A;  4JPS A;  2RR9 A;  4HDQ A;  4HXD A;  1ZGU B;  3Q3J A;  2EMS A;  1IBX A;  3QK0 A;  3NS1 A;  3V05 A;  2DLB A;  2K9X A;  2O6V D;  2UWQ A;  1HTQ A;  1WE7 A;  2MBQ A;  1V5T A;  2HJ1 A;  1I4X A;  4AUQ C;  2AL3 A;  2LD9 A;  4M0W B;  4LNN A;  3IAM 1;  1SE2 A;  4EZK A;  4FLH A;  2QEJ C;  3P1M A;  3L54 A;  4HPM B;  3AEG B;  4TV3 A;  3ZTC A;  1WWT A;  3MJ5 A;  3PLU A;  1PUT A;  1JW9 D;  5DPT A;  2QHO A;  3BVZ A;  1JWU D;  1GC7 A;  2DYM A;  1F77 A;  3DBR B;  4G11 A;  2DAJ A;  1I42 A;  2K0P A;  3I57 A;  3ZNI D;  2LHD A;  4MAC A;  4AS1 A;  2JT4 B;  1N62 A;  5LLI A;  3X0W A;  1ROE A;  2N9X A;  2INP E;  3AU4 A;  1GJZ A;  4K1R B;  1I35 A;  1FXI A;  1L0Y B;  1UZX B;  4FXC A;  2KQ4 X;  3N3K B;  4ANU A;  1L0V B;  3EHV A;  1SSN A;  4JIO U;  2OHF A;  1R7S A;  1KLV A;  1P0R A;  1ET6 A;  4A6Q A;  3T3O A;  4IUM B;  2MCN B;  5CHF A;  2KDB A;  4KSL C;  1C4A A;  4LNF A;  4NJC A;  1FCL A;  1WX8 A;  3EEC A;  3DWM A;  1Z2M A;  5EDS A;  3P2B A;  4N58 A;  2D3G A;  1QOF A;  4S17 A;  1YJI A;  4IDI A;  2JPH A;  4ZYN A;  4TQ0 A;  3AE4 B;  1SJH D;  4NNJ B;  3JVZ X;  5BYR A;  3PRE A;  1E6E B;  2E6X A;  3UI3 A;  1ZPS A;  4TKN A;  2WU2 B;  2FBW B;  1QKZ A;  2WXP A;  1TYG B;  4IG7 B;  4DK5 A;  1V1P B;  1FEH A;  3ALB A;  5HFY A;  3MFG A;  1AYF A;  2BB6 A;  3IAS 1;  2I1J A;  3WAO A;  1YN3 A;  1Q5W B;  3J9C A;  4YTN B;  3PSE B;  4WWP A;  5D3I B;  4RCO A;  1WXM A;  2ZVN A;  3VUW A;  1XEE A;  2KWU B;  1VZ6 A;  3BII D;  4HRO A;  5T8I A;  2NPT B;  1FFU A;  1PYW D;  3PS6 A;  1WMH B;  1MJD A;  1WYG A;  1TS3 A;  3NZ3 A;  2LWP A;  2LRW A;  3P63 A;  3DDC B;  2AYO B;  3N1X C;  1JWB D;  3GZN B;  4MGK E;  3GOE A;  4TMA B;  5LNK 1;  4XX5 A;  4R3D A;  5E6J A;  1OGW A;  3IFW B;  3ZDM C;  1QIL A;  4BKG A;  5IOI A;  3V60 A;  2AQ3 B;  3BYT B;  3VQI A;  3BVM A;  2WP9 B;  4MM3 B;  2NPT A;  1E10 A;  1SE9 A;  3PRP B;  2K25 A;  3JSV A;  3NVW A;  4WIP A;  2D2Q A;  4AOF A;  3VTU A;  2D5G A;  2IY0 B;  1HQR D;  3PT2 B;  2QJL A;  4WUR A;  1FIQ A;  4RGM A;  1XF5 L;  4OVV A;  1OFF A;  2KJH B;  1GNU A;  3DVN U;  1K51 A;  1SF0 A;  3I63 C;  1WJ6 A;  2V0G A;  1WR6 E;  3DHH C;  1OEY A;  1D4B A;  4FA6 A;  1FO4 A;  2R2Q A;  1M94 A;  2CS4 A;  1KH0 A;  2G9H D;  3OLM D;  3IT6 B;  2N4F A;  3QX1 A;  1I4Q A;  1GB4 A;  4XZ4 A;  2ZCB A;  4TSS A;  1UBQ A;  3B2G A;  4WH4 A;  4GU2 A;  2MH7 A;  4WWN A;  1TS5 A;  3U52 E;  5HG2 A;  1XLP A;  3U7D A;  4IM3 A;  2NTS A;  1C76 A;  4MH8 A;  3RUL A;  1D3Z A;  1V1O A;  1E8X A;  2QIE B;  3N9Y C;  3GE3 C;  4F1S A;  1VDV A;  4DHJ B;  1ZP0 B;  3APF A;  4P7I A;  3ZKJ C;  1EF1 A;  3R2I A;  5H92 C;  2MP2 A;  4DDG D;  3H1U A;  4K7S A;  4JGH B;  3B1L X;  3P42 A;  2GOW A;  3H9D A;  4E74 A;  3RNG C;  2JSV X;  5HI1 A;  5MPO A;  2WU5 B;  2AL6 A;  2N1V A;  2N7D A;  2RGF A;  4MGY E;  1Q10 A;  3SHQ A;  5AZF A;  3FAH A;  3GS2 A;  2MBH A;  4FAD A;  1GOZ A;  4YXD B;  1AW7 A;  5D3D A;  4BBN C;  2BBC A;  2DZJ A;  2WXF A;  1F2R I;  5FR3 A;  3IBE A;  4TUU A;  5TSS A;  3ZXR A;  2IO3 B;  2XNA C;  3EFC A;  4DHZ E;  2K3U A;  2XBB C;  2QCZ A;  4W9I A;  4GSW A;  5G5G A;  2N7J A;  1CK1 A;  4HPL B;  2L52 A;  1J7B A;  3DOW A;  2INN E;  2CR5 A;  5AEK B;  2DAF A;  4BKT A;  3B08 A;  5JH5 C;  2LXA A;  1NBF C;  2JZ3 B;  3V6E B;  4WWO A;  2KXJ A;  1PDX A;  1UNS A;  2LAS A;  2GI9 A;  2SAK A;  2KWC A;  2NBV B;  1FM0 D;  1L4Z B;  4KX6 B;  4D2K A;  5J18 A;  1UGM A;  3W1Y A;  1WX9 A;  2K5P A;  1FMA D;  2C7M B;  4MDK E;  2BGF A;  4AJW A;  1H8C A;  2RPV A;  1QT9 A;  4OW0 A;  3FC4 A;  4XWW A;  2GRI A;  4UDU C;  4LDT D;  1EU3 A;  2WXN A;  1JRP A;  3ZO5 B;  4HKQ A;  4WJN A;  5HHD G;  1YOV B;  1WJ4 A;  3CSF A;  1F1H A;  2KAJ A;  4S0R A;  2INC C;  1JRU A;  3I9V 1;  4LK0 M;  2FCQ A;  1PFD A;  2IGG A;  1KLU D;  3UQB A;  2DHZ A;  4K3B A;  4GDL A;  4EUT A;  2IGH A;  2D10 A;  4X57 B;  2XEW A;  1T5X D;  3KH0 A;  2EKE C;  3W9C B;  4RGN A;  1IBX B;  2WX0 A;  4P6V F;  2Y5P A;  4NQK E;  5E6O A;  2BPS A;  1VZ7 A;  4P16 A;  4XE0 A;  3PZD A;  1FCC C;  1RYJ A;  2CHZ A;  4M02 A;  1WJU A;  2BS3 B;  1VR9 A;  2GLS A;  2YLM A;  1FRR A;  4LLG M;  3TJP A;  3HRD D;  4KSK C;  3SFD B;  4HLE A;  1E0Z A;  1FNU A;  1IP9 A;  4TQ1 A;  4BBN F;  2HE7 A;  4Q2J A;  4KV2 A;  3ZIM A;  4C00 A;  5IP4 D;  4W9G A;  1LM8 B;  3L0W B;  1DOY A;  2DYB A;  3DBL I;  1WXV A;  2MA9 B;  1WR1 A;  3K9O B;  2LGD A;  2EMT A;  2KAC A;  3KW5 B;  2V4L A;  1WXQ A;  1TY0 A;  4IC7 B;  4KDI C;  5C23 A;  2HDE A;  3BYY B;  2WNM A;  4MSM B;  5DPR A;  1MVK A;  3NJT A;  1P9D U;  3R8B A;  2MBE A;  4US8 A;  1L7Y A;  3PHX B;  1MHH E;  2DEN B;  2JXX A;  3EFU A;  4PS3 A;  5LXH A;  3QIJ A;  3HIZ A;  1NI2 A;  4HWI B;  3MC8 A;  2DZK A;  1XLO A;  1FNW A;  3IG3 A;  2QSD A;  2H88 B;  3LXF A;  4OZB A;  4HCP B;  4RGO S;  4HCN B;  1JML A;  1J7C A;  1C78 A;  4ZRJ A;  2KKC A;  1NYR A;  4NQL B;  3Q8E A;  2J0J A;  1Q1O A;  3RZW C;  2DNF A;  2V1Y A;  2WYQ A;  4P1B C;  4DBG A;  2IO2 B;  1VLB A;  2PW9 A;  2K6D B;  3C19 A;  1JWS D;  1L6U A;  2QIL A;  2LXC A;  3DVG X;  4GOC A;  2WWZ A;  3B9J A;  3BWU D;  3VUX A;  1S1Q B;  1T6B X;  5AZG A;  4W9L A;  4L23 A;  1E5W A;  2LVQ A;  1UWX A;  2D3A A;  3P4Q B;  3UGB B;  1T0Q C;  5FK9 C;  4LNO A;  1IUE A;  2WX1 A;  3RNF C;  3ZJV A;  1I4P A;  2NTT A;  4I6L B;  3ZTD A;  5IAA C;  1UF0 A;  2KX0 A;  2DWQ A;  2KWD A;  2QC8 A;  3LB8 C;  2J42 A;  4RNA A;  3W1S A;  3Q3F A;  4IWP A;  4NY0 A;  3NY5 A;  3ZNG C;  4XDC A;  3L16 A;  3IXS A;  1WE6 A;  1KOT A;  4II2 B;  1KJT A;  2LMC A;  1VJK A;  2A4Z A;  1MHX A;  5BMG A;  2IYD B;  1R4N I;  2JF5 A;  5FKA C;  1NEN B;  2N9K A;  1C4P A;  2ZEQ A;  2MLB A;  2ZW0 A;  4ICV A;  4IWQ A;  2NBU A;  1OQQ A;  2IY1 B;  1JCK B;  2JRI B;  2KAN A;  3PLV A;  1JWM D;  1YN4 A;  4CO7 A;  4NPN A;  1DYQ A;  3VFK A;  2KDE B;  1DOI A;  5CTR C;  3WA0 A;  1FXA A;  1ET9 A;  2JQR B;  1VCB A;  2BWE S;  1EF5 A;  1RRB A;  3L4P A;  3ENE A;  2GBJ A;  4XWT A;  2BQQ A;  4LNK A;  2J52 A;  2D07 B;  4M8N A;  2KMC A;  5D2M B;  2KN4 A;  2WDT B;  3SU8 X;  3Q8B A;  1JAL A;  1I7H A;  3TEY A;  2ACZ B;  2L7R A;  3AH7 A;  3NVV A;  3PGE A;  3VH4 B;  1WSP A;  4GDK A;  2WDQ B;  4MSQ B;  1TKY A;  3RNE C;  2KQ7 A;  2JXT A;  2K8B A;  2ZPY A;  4XDD A;  2UYZ B;  4A90 A;  3APD A;  4WWM A;  2IGD A;  1SJE D;  3R7Q A;  4DHJ D;  1HZ6 A;  3EGR A;  2WGS A;  3H6N A;  4C7Z A;  2BYV E;  1EO6 A;  5KHQ A;  2WXL A;  1K8R B;  4AQ7 A;  4GN1 A;  2LUE A;  3B0A A;  2XK5 A;  2BKF A;  4RGT A;  3CF6 E;  3DBS A;  4ZHO A;  4BKS A;  3M3J A;  1V86 A;  4MT5 A;  3IVF A;  2DZM A;  4GDK B;  3MHS D;  1PGB A;  2AQ2 B;  4YTP B;  4WJP A;  1YMH E;  2VH1 A;  4G0N B;  1LQB A;  1KRH A;  3QAQ A;  4ZYS A;  2ZNV C;  4M0W A;  1V80 A;  4B0E A;  4M00 A;  1SIF A;  3W5U B;  1IYF A;  4PS7 A;  1P7E A;  4W9K A;  1I4R A;  2L83 A;  2M1M A;  3SD5 A;  1LO5 D;  3ML8 A;  1QOB A;  5GXG B;  4WAF A;  2L32 A;  2KC1 A;  1FNV A;  3X23 A;  2N9E B;  3KQ4 A;  3TIX A;  2FUH B;  1GC6 A;  4DXF A;  4N6E B;  3DBL B;  3ABV B;  2HJ8 A;  2G45 B;  3MTN B;  1TJE A;  2K39 A;  3TMP B;  4KZC A;  4J3O D;  4K3C A;  2GBR A;  2QDF A;  2ZW1 A;  3DVN V;  1M4V A;  1EWC A;  5DPS A;  4EKU A;  2BKR B;  1KLG D;  3Q8F A;  5CHV C;  3AE1 B;  2JY6 A;  2ON8 A;  2VRR B;  1WX7 A;  1YD8 U;  3I5J C;  1TZ1 A;  1XQQ A;  1GUA B;  2WXH A;  3DBR I;  3AU5 A;  5GMV A;  4HKZ E;  1ZDX A;  1TBE A;  4KIK A;  3QQ8 B;  3RYT A;  5HKH A;  4OVZ A;  3PTF C;  3URY A;  4PYZ A;  3BVG A;  5AZH A;  4EZL A;  1K50 A;  3Q14 C;  1P1A A;  4HDO A;  2C9W B;  1ZXI A;  5G5H A;  2KFK B;  3U2S C;  2W54 A;  1XT9 B;  1GAQ B;  1E7V A;  2FID A;  3ZYY X;  1FPY A;  1F9J A;  5JXV A;  3WAP A;  2QMT A;  4AJY B;  4WQM A;  1ZUD 2;  5C1Z A;  1HA5 A;  4KVG B;  4ZRK A;  3FKY A;  1L0X B;  4GGQ A;  1LXD A;  1JRO A;  1NYQ A;  4HJK A;  4ZDV A;  3AV8 A;  2KVZ A;  2OOB B;  3TEZ A;  3AE9 B;  4CQN A;  2PVG C;  4B0M A;  2V4I B;  1RAX A;  3PZ7 A;  1WGG A;  2KZR A;  3DHG C;  1D5X C;  1WRI A;  3KUD B;  2YVC A;  2O6V A;  1SBB B;  3NOB A;  3I3T B;  4G50 A;  2PKO A;  4L1B A;  2V3S A;  3GB1 A;  5C3J B;  2CU3 A;  2LJ5 A;  2WXR A;  3C8Y A;  2L05 A;  2W55 A;  2L0T A;  5J17 A;  2KDI A;  4DXG A;  1WY8 A;  2NCN A;  5EE1 A;  2KX3 A;  4YSX B;  1E9M A;  3WAL A;  3H7S A;  2LZ6 A;  2B76 B;  4LDT B;  1YX5 B;  1EWY C;  2D11 A;  2NVU I;  4RM8 A;  4N9F 4;  2Y5B B;  1XO3 A;  2ZZP B;  1L5P A;  2WLB A;  3U8Z A;  2KDF B;  1K52 A;  1R4N B;  1S3S G;  1C9F A;  1WIA A;  1OQY A;  3A9J B;  4KIK B;  1F0Z A;  2BT6 A;  3AE3 B;  1YQ3 B;  4HRS A;  2MW5 A;  2I38 A;  4RF1 A;  3HK0 A;  3AM9 A;  2WS3 B;  3VH3 B;  1V6E A;  3S2A A;  5D94 A;  1CZP A;  2W82 A;  3ZUN A;  4YSZ B;  2MP2 B;  4HVB A;  5BMH A;  2KD0 A;  4ANV A;  3Q3O C;  4B6W A;  1JWA D;  4A20 A;  1V9J A;  2KN5 A;  2M0A A;  1WXS A;  3L08 A;  4NZL B;  3AE2 B;  4GMV A;  3A9K A;  1MPE A;  2KHW B;  4ANW A;  2KTR A;  2M8S A;  4A9A A;  5J2R A;  2M17 A;  2MEK A;  2BWF A;  1KM7 A;  2DZI A;  1QZE A;  1BML C;  2BS2 B;  1UEL A;  4CYE A;  4HK2 A;  2ZVO A;  4N59 A;  3TBL D;  2L76 A;  4US9 A;  1ZW7 A;  1WMH A;  1YX6 B;  3AE5 B;  4OHJ A;  4ICU A;  1G6J A;  3R7R A;  5CX3 A;  4OZA A;  1V2Y A;  2WHI A;  3RNA C;  5AUK A;  2GB1 A;  4ARI A;  2NMQ A;  2K8C A;  2V3N A;  4MGI E;  2BVC A;  1WGH A;  2CKH B;  3P4P B;  2LGX A;  3KUZ A;  1QOG A;  1E8Y A;  2I1K A;  1FD6 A;  1TT5 B;  2BYF A;  3MJW A;  1N5X A;  3DHI C;  1XD3 B;  2DX5 B;  3R66 C;  3HHM A;  2PJH A;  4B95 A;  1XCQ L;  2V9H A;  3SEB A;  3EUB 2;  4YTM B;  2OJW A;  1QOA A;  2XK5 B;  3Q69 A;  4HEA 1;  2KWV B;  4BFR A;  3LJ3 A;  3OJ3 A;  3RN9 C;  4C4V B;  1RWS A;  1WZ0 A;  3NZS A;  1WGR A;  1WGK A;  3KYC D;  1TY2 A;  3ZRF A;  2EEL A;  4WAA A;  2L3Z A;  3OG5 A;  5BMI A;  3K9P B;  1ACC A;  2WXO A;  2EKI A;  2PEA A;  1TGZ B;  3LDZ E;  3MP9 A;  2M4N A;  4IKG A;  3SFE B;  3AEF B;  2ICI A;  1NI3 A;  2FCN A;  2DBY A;  4W9H A;  2NBW B;  3VR9 B;  3RT3 B;  1Q0W B;  5DPW A;  2C5L C;  3ZDT A;  3H7P B;  1ISN A;  3N32 A;  2PLP A;  1T0Y A;  3HVZ A;  4ZRI A;  3ZJU A;  4C4V A;  4EEW A;  3V6C B;  3Q2A C;  3AUL A;  1C4C A;  3MHZ A;  1B1Z A;  4F7Z A;  3NVY A;  4NJ7 A;  2X8X X;  4LTU A;  1CMX B;  5TR5 A;  3WCQ A;  1T0R C;  2BW2 A;  2IPK D;  4KGS A;  3PRZ A;  2MJE A;  1I4H A;  1B9R A;  2JZZ A;  3N1Y C;  2PMV A;  3AEC B;  2FIF A;  1DOX A;  3V62 A;  1WJN A;  3L13 A;  2ZNV B;  1T3Q A;  2HTM E;  1XLQ A;  2JRH A;  1J0G A;  1NVI D;  1N63 A;  3GE8 C;  1EM7 A;  1T0S C;  2Z59 B;  4KGR A;  1N5W A;  4ZRQ A;  4P1C C;  2V3P A;  1WYW B;  2FCM A;  3AE8 B;  1TZO A;  2KTF A;  4JE3 B;  4A55 A;  4OZC A;  3L10 B;  2JWZ A;  4ZRP A;  1ENF A;  1MG4 A;  1WH3 A;  4MM3 A;  1SE4 A;  5JHB A;  3ML9 A;  4JQW C;  1UWM A;  3TCA A;  2WDV B;  1SGH A;  2WDR B;  4C80 A;  1WFY A;  4GDL B;  2E3T A;  1YNT E;  4XYC A;  3LYY A;  2RSU A;  4ZHP A;  2CJO A;  4WQO B;  1KF6 B;  4JLC A;  5BYS A;  3OAW A;  4QAY A;  2GBN A;  2MWS B;  2Z0E B;  2AEH A;  2PE6 B;  3W2D A;  4FHK A;  4ACF A;  3TEW A;  4MEL A;  3E9S A;  4DQO C;  4IWO A;  4DHZ B;  3HM6 X;  3DQV A;  1VRA B;  4I6P A;  1MI0 A;  3RD2 A;  1RM6 C;  4DWF A;  2J0K A;  2KNB A;  2DYO A;  1MG8 A;  4XGA B;  2JYE A;  3ZNH B;  3UIO B;  4BKS D;  2LVP A;  2L0F A;  3QC8 B;  3N20 C;  1V8C A;  1WM3 A;  3CIR B;  4AP4 C;  3M63 B;  3Q3M C;  3A33 B;  2VZK B;  4AWJ A;  1Y8R C;  2K1F A;  2Z0D B;  2KJ6 A;  4DXA B;  3JW0 X;  4IOI E;  2IJ0 A;  4IM2 A;  2Y5C A;  1WF9 A;  2VH2 A;  1R4M I;  2JWU A;  3ZJT A;  2MHJ A;  1SB3 C;  5AUI A;  1ZKH A;  4BOS C;  1ZDV A;  2W3S A;  1V5O A;  3Q8C A;  1PGA A;  4YSY B;  2N9P C;  4GLS C;  3N30 A;  2KO3 A;  1E7P B;  2FAZ A;  2LJI A;  3AN1 A;  3V3X A;  1GG3 A;  3TEX A;  1I4G A;  4W9C A;  4EFO A;  1UGJ A;  3O65 B;  2UU7 A;  4A3O A;  3VUY A;  1YN5 A;  1OEY J;  4W9J A;  4RMA A;  4BOZ B;  4FUL A;  1OTR B;  2GBK A;  3CST A;  2RMM A;  4YL8 A;  2SEB D;  4USA A;  2AX5 A;  5E6N A;  4RM9 A;  4GXB A;  3UQA A;  4J6I A;  3ZXV A;  3Q3N C;  1L2N A;  2KT7 A;  3DVG Y;  3NZU A;  1ZOY B;  3M62 B;  1WGY A;  5IKC M;  1WI0 A;  1AWD A;  2WXJ A;  2NS5 A;  2O2V A;  2C7H A;  2G4D B;  3KLS X;  4GB9 A;  2GMI C;  2MQJ A;  1VD2 A;  1ZE3 D;  3PZ8 A;  1V1P A;  2AWT A;  5CHW A;  1GPX A;  2A5U A;  2BYE A; 
#chains in the Genus database with same CATH homology
 3KYD D;  4G50 A;  2CU1 A;  2OJR A;  4LDT D;  3VDZ A;  4II3 B;  2KTR B;  2V3S A;  2KVR A;  3ECI A;  3ZO5 B;  5LXI B;  1WM2 A;  4WJN A;  1E8Z A;  3AI5 A;  2LJ5 A;  3QHT A;  1WJ4 A;  1WXA A;  4MGZ E;  3CSF A;  2L05 A;  4MJS B;  3DPD A;  3EC8 A;  2FCS A;  2K6Q A;  2L0T A;  4M8M A;  3RUI B;  3JSV B;  5J17 A;  2KDI A;  4JL9 A;  1WY8 A;  1JRU A;  2NCN A;  2ZPN A;  3A9K B;  2KX3 A;  2FCQ A;  3WAL A;  2RR9 A;  4HDQ A;  4E71 A;  4HXD A;  3UQB A;  2DHZ A;  1ZGU B;  1WGD A;  2N7E A;  3H7S A;  4GDL A;  2LZ6 A;  4EUT A;  2D10 A;  3Q3J A;  4X57 B;  2EMS A;  2XEW A;  4LDT B;  1YX5 B;  3KH0 A;  2EKE C;  1YQB A;  3QK0 A;  2D11 A;  2NVU I;  4RM8 A;  4N9F 4;  1E90 A;  2Y5B B;  2KOX A;  2WX0 A;  2ZZP B;  3VTV A;  2O6V D;  2UWQ A;  4NQK E;  5FR6 A;  3U8Z A;  2KDF B;  1WE7 A;  2MBQ A;  5E6O A;  1V5T A;  2BPS A;  1S3S G;  1WIA A;  3JYU A;  4AUQ C;  2AL3 A;  2LD9 A;  4M0W B;  3KVF B;  1OQY A;  3A9J B;  3PZD A;  4KIK B;  2CHZ A;  4FLH A;  3KUC B;  4EZK A;  3A4S C;  1WJU A;  2MW5 A;  2YLM A;  3NS8 A;  3HK0 A;  3VH3 B;  1V6E A;  3S2A A;  2MX2 A;  5D94 A;  3TJP A;  3L54 A;  5IA7 A;  3ZUN A;  4HPM B;  4KSK C;  2MP2 B;  4TV3 A;  4HVB A;  4HLE A;  3ZTC A;  3PLU A;  2KD0 A;  5DPT A;  1YIW A;  1IP9 A;  4ANV A;  4TQ1 A;  2QHO A;  4B6W A;  4BBN F;  4A20 A;  1V9J A;  2HE7 A;  2KN5 A;  1GC7 A;  4KV2 A;  2DYM A;  3ZIM A;  2B3A A;  1WXS A;  4G11 A;  2DAJ A;  3L08 A;  4W9G A;  1E7U A;  1I42 A;  3BIN A;  4GMV A;  1LM8 B;  3L0W B;  1NDD A;  2DYB A;  3A4R A;  3A9K A;  3DBL I;  1WXV A;  2KHW B;  1WR1 A;  2MA9 B;  2RD0 A;  3K9O B;  3ZNI D;  4ANW A;  2C60 A;  2LGD A;  2KTR A;  2M8S A;  3QWZ B;  5J2R A;  2EMT A;  2M17 A;  2JT4 B;  2BWF A;  3KW5 B;  1KM7 A;  2DZI A;  2V4L A;  5KHO A;  5C23 A;  4IC7 B;  3VXW A;  1P3Q U;  4KDI C;  1QZE A;  5LLI A;  4G3X B;  3X0W A;  5E6P A;  2ASQ A;  3SDL C;  1UEL A;  2N9X A;  4CYE A;  4HK2 A;  3AU4 A;  1GJZ A;  2ZVO A;  3TBL D;  2PPH A;  2L76 A;  4MSM B;  4K1R B;  5DPR A;  4WJO A;  1UH6 A;  1I35 A;  2IO0 B;  1ZW7 A;  2REX A;  2HD5 B;  1P9D U;  2HTH A;  2MBE A;  1WMH A;  2CHX A;  1RFA A;  1L7Y A;  3PHX B;  4NJ6 A;  2DEN B;  1YX6 B;  2LVO A;  1UZX B;  4ICU A;  2JXX A;  3EFU A;  3N3K B;  4PS3 A;  2IO1 B;  2JVC A;  3R7R A;  5CX3 A;  4ANU A;  5LXH A;  1V2Y A;  3QIJ A;  3HIZ A;  1NI2 A;  3EHV A;  4HWI B;  1X1M A;  4BVU C;  4JIO U;  2DZK A;  3IG3 A;  4XC2 A;  2K8C A;  2K8H A;  1KLV A;  1P0R A;  4HCP B;  4HCN B;  4MGI E;  1WGH A;  2CKH B;  3D32 A;  2LI5 A;  2LGX A;  3KUZ A;  3T9L A;  1E8Y A;  2I1K A;  4IUM B;  4ZRJ A;  2KKC A;  3RCZ A;  3A1Q A;  2BYF A;  3MJW A;  4NQL B;  1AAR A;  2MCN B;  2J0J A;  3T8M A;  1Q1O A;  5CHF A;  3RZW C;  2KDB A;  2V1Y A;  2WYQ A;  1XD3 B;  2DX5 B;  3R66 C;  3TL5 A;  4DBG A;  3HHM A;  3ZLZ A;  2PJH A;  4KSL C;  4B95 A;  2IO2 B;  3WIM A;  1WX8 A;  2K6D B;  2LXC A;  3EEC A;  3DVG X;  2XK5 B;  1PQS A;  1Z2M A;  4GOC A;  5EDS A;  3P2B A;  2WWZ A;  2KFK A;  2D3G A;  4FJY A;  2KWV B;  4BFR A;  3LJ3 A;  3OJ3 A;  1S1Q B;  3VUX A;  4EZJ A;  1WZ0 A;  3NZS A;  3QCA A;  2JPH A;  4PS8 A;  1H4R A;  5AZG A;  1WGR A;  4ZYN A;  4TQ0 A;  3KYC D;  4NNJ B;  4FJZ A;  3JVZ X;  3PRE A;  4W9L A;  1E5W A;  2LVQ A;  4KZ0 A;  3ZRF A;  3C0R B;  4WAA A;  4TKN A;  3UGB B;  2L3Z A;  1RLF A;  3K9P B;  2WX1 A;  1WRD B;  4IG7 B;  4DK5 A;  3ALB A;  2PEA A;  1TGZ B;  3LDZ E;  3W1S C;  4CHK A;  2C7N B;  2M4N A;  2O6V B;  4I6L B;  3ZTD A;  5G2N A;  2KLC A;  5IAA C;  3OJ4 B;  2I1J A;  1UBI A;  2M0X A;  2KX0 A;  3WAO A;  2FCN A;  4W9H A;  2NBW B;  3GZN I;  4KDL B;  3Q3F A;  1Q5W B;  3W1S A;  4A3P A;  1HE8 A;  3RT3 B;  4IWP A;  1BT0 A;  1Q0W B;  4NY0 A;  5DPW A;  2C5L C;  3ZDT A;  3NY5 A;  2ZJD A;  3H7P B;  1J8C A;  3PSE B;  3ZNG C;  1ISN A;  1V81 A;  3N32 A;  3L16 A;  1WE6 A;  4WWP A;  1KOT A;  1T0Y A;  1KJT A;  4II2 B;  1WXM A;  4ZRI A;  4MH0 E;  5JZE B;  2ZVN A;  2A4Z A;  3VUW A;  2KWU B;  2IYD B;  4EEW A;  1R4N I;  2JF5 A;  4IW0 A;  3V6C B;  3AUL A;  2O2V B;  2MSE D;  2ZEQ A;  2MLB A;  2G3Q B;  4ICV A;  4F7Z A;  2NPT B;  3PS6 A;  4IWQ A;  2NBU A;  4NJ7 A;  1WMH B;  2G4S A;  1CMX B;  2IY1 B;  2JRI B;  2KAN A;  5TR5 A;  3H7P A;  3PLV A;  2KK8 A;  4CO7 A;  4NPN A;  1IPG A;  3APC A;  2LWP A;  3VFK A;  2LRW A;  5DCN A;  2KDE B;  5CTR C;  3WA0 A;  3PRZ A;  3DDC B;  2AYO B;  1WZ3 A;  1VCB A;  4PYU A;  3RZF A;  2BWE S;  2JZZ A;  1EF5 A;  4NAW A;  1RRB A;  3NHE B;  5G55 A;  2L00 B;  2FIF A;  2J0M A;  2GBJ A;  3ENE A;  3V62 A;  4MGK E;  1WJN A;  3L13 A;  2ZNV B;  3GOE A;  1U4A A;  4XX5 A;  1LFD A;  2JRH A;  2D07 B;  4M8N A;  1J0G A;  2KMC A;  5D2M B;  2WDT B;  1OGW A;  3VAW A;  3SU8 X;  3IFW B;  3ZDM C;  2Z59 B;  4BKG A;  3V60 A;  2L7R A;  3PGE A;  3VH4 B;  4W9D A;  1WYW B;  1UD7 A;  2FCM A;  4GDK A;  4LCD E;  2MBB B;  3VQI A;  2KTF A;  4MSQ B;  3PHW B;  2NPT A;  1SE9 A;  2KQ7 A;  2K25 A;  3JSV A;  3PRP B;  4W9F A;  2K8B A;  3U30 A;  3ZRC A;  2ZPY A;  2D2Q A;  3L10 B;  2BF8 B;  4AOF A;  1J19 A;  3VTU A;  2UYZ B;  4FHJ A;  2JWZ A;  2MBO A;  1FXT B;  2KLG A;  4LJO B;  3APD A;  4ASW C;  2RPQ A;  2IY0 B;  2N1W A;  3R7Q A;  4DHJ D;  3PT2 B;  1WH3 A;  3H6N A;  2IBI B;  1C1Y B;  1Z5S B;  4MM3 A;  2BYV E;  5JHB A;  3PVL A;  4OVV A;  3UIP B;  1EO6 A;  3ML9 A;  1YJ1 A;  4JQW C;  2KJH B;  1GNU A;  3DVN U;  2PE9 A;  5KHQ A;  3DBH I;  3TCA A;  1K8R B;  1WJ6 A;  1SGH A;  4GN1 A;  3VVW B;  2LUE A;  3B0A A;  2XK5 A;  1WR6 E;  1WFY A;  1OEY A;  2BKF A;  3CF6 E;  3DBS A;  3UIN B;  4FN2 A;  4FA6 A;  4GDL B;  4BKS A;  3M3J A;  2R2Q A;  2RSU A;  1M94 A;  1V86 A;  2CS4 A;  3IVF A;  2LRU A;  4WQO B;  4F8C B;  2DZM A;  4GDK B;  2CHW A;  3MHS D;  3R3M A;  1A5R A;  3OLM D;  3QX1 A;  2N4F A;  4JLC A;  3CMM B;  4XZ4 A;  2ZCB A;  4WJP A;  3OAW A;  1UBQ A;  2GBN A;  2MWS B;  2R2O A;  2Z0E B;  3QJZ A;  2AEH A;  4GU2 A;  2PE6 B;  4G0N B;  1LQB A;  4WWN A;  4K7W A;  4FHK A;  3U7D A;  3QAQ A;  2ZNV C;  4W9E A;  4IM3 A;  1V80 A;  3RUL A;  1SIF A;  1D3Z A;  3V61 A;  3PRM B;  1E8X A;  2LGY A;  4PS7 A;  4MEL A;  1IYF A;  4W9K A;  4IWO A;  2FNJ B;  2M1M A;  3SD5 A;  4F1S A;  4DHZ B;  3ML8 A;  3HM6 X;  3QA8 A;  3DQV A;  4DHJ B;  4I6P A;  3RD2 A;  4DWF A;  3WAN A;  2J0K A;  2KC1 A;  3APF A;  2KNB A;  2DYO A;  3X23 A;  3IHP C;  3ZVV A;  4OVU A;  2N9E B;  4P7I A;  2KC2 A;  3ZKJ C;  1MG8 A;  3TIX A;  2FUH B;  3VTW A;  1EF1 A;  1GC6 A;  2L8J A;  3ZNH B;  3UIO B;  4BKS D;  2MP2 A;  2ZCC A;  4DDG D;  4MJS A;  3H1U A;  2LVP A;  4K7S A;  2L0F A;  2HJ8 A;  4JGH B;  3AXC A;  3QC8 B;  2G45 B;  3B1L X;  4EOY A;  3PPA A;  3MTN B;  3PV1 A;  1WM3 A;  2GOW A;  3H9D A;  2KJR A;  4E74 A;  4NAW B;  4DDI D;  3L17 A;  4MEM A;  3M63 B;  4AP4 C;  2K39 A;  2AL6 A;  2N1V A;  4KZC A;  3TMP B;  2N7D A;  3A33 B;  3UF8 A;  2RGF A;  4K7U A;  4AWJ A;  2IZV B;  1Y8R C;  2K1F A;  2Z0D B;  4MGY E;  2KJ6 A;  4DXA B;  2GBR A;  3JW0 X;  3SHQ A;  3DVN V;  4IM2 A;  5DPS A;  1V49 A;  1WF9 A;  5L83 A;  4E3C A;  5AZF A;  2NR2 A;  4EKU A;  2BKR B;  5CHV C;  1R4M I;  2W9N A;  2JY6 A;  2MBH A;  2VRR B;  3M95 A;  4FAD A;  1WX7 A;  1YD8 U;  1P98 A;  5L95 C;  1TZ1 A;  1XQQ A;  1GUA B;  1ZKH A;  4BOS C;  4ANX A;  4BBN C;  2DZJ A;  3DBR I;  3AU5 A;  5GMV A;  3IBE A;  3ONS A;  2MRP A;  1V5O A;  4TUU A;  1TBE A;  1EUV B;  3QQ8 B;  4KIK A;  3RYT A;  3WAM A;  5HKH A;  3PTF C;  2N9P C;  4PYZ A;  2IO3 B;  3N30 A;  2KO3 A;  2FAZ A;  4DHZ E;  4URK A;  5AZH A;  4EZL A;  2XBB C;  2KQS A;  4K81 A;  1P1A A;  1GG3 A;  3QAR A;  3BY4 B;  4HDO A;  4W9I A;  1G6J A;  4GSW A;  4W9C A;  3A9J A;  4EFO A;  2C9W B;  3O65 B;  5D7G A;  4HPL B;  2KFK B;  1XT9 B;  3DOW A;  2KFJ A;  1E7V A;  4A3O A;  2CR5 A;  2JUO A;  5AEK B;  2FID A;  2DAF A;  4BKT A;  3VUY A;  3ZNZ B;  1OEY J;  3B08 A;  4W9J A;  4RMA A;  5BO4 B;  5JH5 C;  4BOZ B;  2LXA A;  1NBF C;  4FUL A;  2KMA A;  4FJV B;  1OTR B;  2GBK A;  2GBM A;  3CST A;  4IM0 A;  4YL8 A;  2JZ3 B;  4I6N B;  1F9J A;  3V6E B;  3VHT C;  4WWO A;  4WJQ A;  3WAP A;  2KXJ A;  3A1Q B;  1C3T A;  4AJY B;  5C1Z A;  2LAS A;  5E6N A;  3ZW3 A;  4KVG B;  4RM9 A;  4GGQ A;  4GXB A;  4ZRK A;  4J6I A;  3UQA A;  2KWC A;  2NBV B;  1LXD A;  1L2N A;  4GIV A;  4LJP B;  3DVG Y;  3NZU A;  4HJK A;  4ZDV A;  3M62 B;  1WGY A;  5J18 A;  2OOB B;  1WI0 A;  3HM3 A;  1UGM A;  2NS5 A;  2O2V A;  2C7H A;  2G4D B;  4GB9 A;  2GMI C;  3W1Y A;  1RAX A;  1WX9 A;  2MQJ A;  1VD2 A;  1WGG A;  2KZR A;  3DCG A;  5D6J B;  4B9K A;  2AWT A;  5CHW A;  4FBJ B;  2J7Q B;  5JHA A;  2C7M B;  2A5U A;  3KUD B;  2BGF A;  4MDK E;  1E8W A;  2YVC A;  4AJW A;  1H8C A;  2O6V A;  1TTN A;  2BYE A;  3NOB A;  3I3T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...