3VH4B

Crystal structure of atg7ctd-atg8-mgatp complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
TFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like modifier-activating enzyme ATG7
publication title Structural basis of Atg8 activation by a homodimeric E1, Atg7.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal binding protein/protein transport
total genus 29
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3vh4B00
3UQBA 4HJKA 2L00B 3EC8A 3VFKA 1V6EA 3TIXA 2IBIB 4DBGA 2LGYA 3O65B 4IC7B 2PE6B 4IM0A 1GG3A 2IO3B 3ZNHB 3BINA 4TUUA 4IM3A 5D2MB 1X1MA 1EO6A 3W1SC 4HK2A 4NPNA 3JSVA 4TKNA 3ZNZB 2C9WB 4URKA 5LXHA 4TV3A 1UGMA 5G55A 2IYDB 4EZJA 3D32A 4I6LB 4TQ0A 3MTNB 3VH3B 1XQQA 1E8YA 1RFAA 3PS6A 3JSVB 3V62A 2LJ5A 2M1MA 2KJRA 3AU5A 4A20A 1G6JA 2KFKB 4DHJB 2C7HA 1TBEA 3B0AA 1EUVB 2K8BA 2PJHA 4W9GA 4KDIC 2JWZA 1WE7A 2KDEB 3MHSD 3QQ8B 5IAAC 3L10B 5LLIA 2JZZA 4MH0E 4PYZA 2GBKA 2AL6A 4WWOA 1E8WA 2KHWB 3JVZX 2I1JA 2CU1A 2LZ6A 4KVGB 1IP9A 5CX3A 4B6WA 1WX7A 2DZJA 1C3TA 4MEMA 2KANA 2KMCA 2WX0A 3U7DA 2LD9A 4PYUA 3DBRI 1WGHA 2JUOA 4BBNF 1OEYA 3N32A 2D3GA 2PE9A 3RT3B 3TL5A 5HKHA 4IWQA 5CTRC 4GDLA 4GDKB 5AZHA 2HJ8A 4WWNA 5L95C 3L08A 4XX5A 1NI2A 3WAOA 5D94A 3DDCB 4MGZE 4AJYB 1BT0A 2L0FA 3KVFB 1GNUA 4A3OA 2PEAA 4ICVA 1A5RA 2ZVNA 4GDLB 4WJNA 2KLGA 3PLVA 5DPSA 1SIFA 1YX5B 3KYDD 4CO7A 2JVCA 4MM3A 3V6CB 1VD2A 1OEYJ 2DZKA 2MBEA 1OQYA 5FR6A 5AZGA 1GC7A 1S1QB 1WMHA 2C7MB 3VH4B 2J0KA 2MBOA 3AU4A 4FJYA 1WZ3A 2MSED 4AJWA 2G3QB 1WGGA 4KZ0A 3APCA 5JZEB 1SE9A 3H6NA 2UYZB 2L05A 4NY0A 4XC2A 1V86A 2KWUB 3CF6E 5D6JB 1WYWB 2GBNA 4A3PA 3ZKJC 4HCPB 1U4AA 1WRDB 4LCDE 2LRUA 2O2VB 3QCAA 4ZRIA 2A5UA 3VTWA 3R3MA 3VVWB 2NBWB 2CS4A 1HE8A 1WXMA 3GZNI 3DPDA 2ZPYA 4ZRJA 3VUWA 2KDBA 4IG7B 4E3CA 3DBLI 4M0WB 3H9DA 1J0GA 4II3B 2DHZA 3VUYA 3VDZA 1V2YA 4YL8A 2D11A 4W9LA 4K7UA 3OJ3A 1LFDA 2KJHB 1Q1OA 2A4ZA 5KHQA 2W9NA 2KTRB 4HLEA 2PPHA 3QC8B 4FADA 3P2BA 3C0RB 4LDTD 3WA0A 3KUZA 3RUIB 1I35A 4RM9A 3KUCB 1M94A 4W9DA 3IG3A 2BYFA 3VHTC 2LVPA 2KKCA 4W9IA 5J2RA 3APFA 2LI5A 2LUEA 2KTFA 3RZWC 3ZTDA 4KSLC 2NR2A 4PS7A 3M3JA 4G11A 4HDQA 4XZ4A 4BBNC 2KN5A 2MQJA 2DZMA 1EF5A 3HIZA 2KQSA 3NS8A 1RAXA 2YVCA 4OVVA 3RYTA 2D07B 3ML8A 1P0RA 1Z2MA 4K81A 1WM3A 5JHBA 1KJTA 4GSWA 4FHKA 2DYBA 4HVBA 1KOTA 3UIOB 2Z0DB 2BGFA 3QJZA 3ZIMA 2ZJDA 4FHJA 4JL9A 3V6EB 2G4DB 4IWPA 1EF1A 2XK5B 2LASA 3PPAA 1P9DU 2KQ7A 2N4FA 5GMVA 3R7QA 2YLMA 3BY4B 2KDIA 1ZGUB 4F1SA 2JPHA 3WIMA 2K6QA 2ASQA 2Z0EB 2ZCBA 3H1UA 5KHOA 1LQBA 4E71A 1E8XA 4F8CB 4W9KA 3KH0A 2C60A 2GBJA 5DCNA 4FA6A 1Z5SB 1S3SG 1QZEA 3SHQA 2LGXA 4NJ6A 3TCAA 1P1AA 2Z59B 1TGZB 3KYCD 2K6DB 1WI0A 2KWVB 2VRRB 2MA9B 4MELA 3KUDB 3NY5A 2KFKA 2J0JA 1GJZA 2B3AA 1L2NA 1ZKHA 2KO3A 3QIJA 3A4SC 4WAAA 3WAMA 1Y8RC 1CMXB 1L7YA 1D3ZA 1GUAB 2IO2B 2RR9A 3PGEA 3IHPC 4P7IA 2DAJA 4HPLB 1WGYA 3EHVA 3U8ZA 3ENEA 2N7EA 4MSQB 2BKRB 1WR1A 3ECIA 4WWPA 4EOYA 1NDDA 2LVQA 3AULA 4KIKB 2N9EB 1WJ4A 2IO1B 2ZNVB 3B08A 4HDOA 2LGDA 4JLCA 4KV2A 3UQAA 2LXCA 2N9PC 1WX9A 2KWCA 2MCNB 2FNJB 2OJRA 1T0YA 1WX8A 2WYQA 2K39A 3DVGY 4DXAB 3X0WA 3PTFC 5AEKB 2CKHB 2CHXA 2MRPA 3EFUA 4I6PA 4DHZB 3A4RA 2JZ3B 1YX6B 4MSMB 4GXBA 4GDKA 5E6OA 3AXCA 2FIDA 2BWES 1GC6A 1E8ZA 4LDTB 3DBSA 3VXWA 4ANWA 3SU8X 2KMAA 1P3QU 2BYVE 3DOWA 4G50A 4BKSD 5LXIB 4ICUA 5J18A 4G3XB 5D7GA 2JXXA 3LJ3A 4E74A 3IVFA 2G4SA 1UBQA 1MG8A 2I1KA 3A9KA 2KXJA 3WAPA 4DWFA 3U30A 2IY0B 4BVUC 2ZCCA 3UGBB 2KDFB 1UBIA 1WXSA 4ANVA 3ZUNA 3DBHI 3W1SA 3ZDTA 2O6VD 5E6PA 4MGKE 3PSEB 2WWZA 3A9KB 1IPGA 1OGWA 1I42A 1V49A 5JH5C 1V5OA 4ZRKA 2KX0A 3N3KB 3CSTA 2N1WA 1R4MI 2O2VA 3K9PB 1UELA 2ZZPB 4HWIB 4MGIE 4AWJA 1E7VA 5TR5A 2NVUI 3VAWA 4WJQA 2K25A 2JY6A 4AUQC 2R2QA 4NNJB 4IM2A 4FBJB 1WJUA 3IFWB 2KTRA 2KC2A 2L8JA 5CHWA 3A33B 2KD0A 2MWSB 4JQWC 1C1YB 1WE6A 3V60A 2N9XA 2IO0B 3ZO5B 1WM2A 3PRMB 2IZVB 1LXDA 3APDA 2HD5B 2DAFA 4DHZE 4TQ1A 4ASWC 2J0MA 2KJ6A 1OTRB 4DDID 2MBBB 2DZIA 4W9HA 3RCZA 1R4NI 1WIAA 3HM6X 4W9CA 3RZFA 4JIOU 4NQKE 2GBRA 3UINB 3QK0A 2MBHA 4GMVA 4WJPA 3X23A 3VTVA 5DPWA 2CHWA 4NAWB 4EZLA 3V61A 4PS3A 5J17A 3M63B 1WXAA 2NPTB 1UZXB 1RLFA 3ONSA 3DCGA 2AYOB 2REXA 3OAWA 3LDZE 4M8MA 3DVNV 4HPMB 1IYFA 4LJPB 2XK5A 3RULA 2MBQA 3CSFA 4IWOA 2OOBB 2L76A 3N30A 2NCNA 4ZYNA 3OJ4B 3L54A 4M8NA 1H4RA 4N9F4 4FJZA 2BWFA 1F9JA 3TBLD 4GN1A 2K1FA 3NZUA 4BKTA 1FXTB 2FCQA 3DQVA 3L13A 3PHXB 4FULA 4F7ZA 1H8CA 3ZTCA 1WH3A 1WJNA 1WFYA 4MGYE 3M95A 3RD2A 2AEHA 2O6VB 1SGHA 2RGFA 3GOEA 4HXDA 4NQLB 2FCSA 1E7UA 5JHAA 1UH6A 3PZDA 3R7RA 2HE7A 1V5TA 2L7RA 2DYOA 2LVOA 2KC1A 2J7QB 3T9LA 1WGRA 2EMTA 2D2QA 2GMIC 4AOFA 4KIKA 1ZW7A 2BYEA 2C5LC 1E5WA 2MW5A 3DVNU 3H7SA 3NHEB 2M0XA 4MJSA 3QHTA 2BF8B 2LXAA 1WJ6A 4BOSC 2DENB 5CHVC 3PVLA 2LWPA 3QA8A 3ML9A 1P98A 3ZVVA 1V80A 1WR6E 2KX3A 4GB9A 3CMMB 2DYMA 4W9JA 4MJSB 1RRBA 1XD3B 2V4LA 3PLUA 3IBEA 5IA7A 2DX5B 5DPTA 1YD8U 2EKEC 5BO4B 4CYEA 3B1LX 3WALA 2GBMA 4B95A 2JRIB 3TMPB 1K8RB 3QWZB 4K7SA 1WF9A 3UF8A 3JW0X 5DPRA 3VUXA 2MX2A 5EDSA 2K8HA 3OLMD 4KSKC 3W1YA 4EUTA 3KW5B 4GIVA 3JYUA 4EFOA 3ZLZA 2D10A 3DVGX 4W9FA 3SDLC 4X57B 4KDLB 2C7NB 3PT2B 3L16A 4RMAA 2K8CA 3H7PA 3PV1A 3ZNGC 1LM8B 3WANA 1WZ0A 4RM8A 2GOWA 1KLVA 2CHZA 2FAZA 5C23A 4PS8A 4K7WA 2L3ZA 1TTNA 2KFJA 2ZEQA 3H7PB 3L17A 4ANUA 1Q0WB 4II2B 2JT4B 2QHOA 2HTHA 4FN2A 1VCBA 2JRHA 2KZRA 3NOBA 3NZSA 2M8SA 1JRUA 4ANXA 2Y5BB 1E90A 2G45B 3L0WB 2V3SA 4BKGA 2CR5A 4GGQA 2KLCA 2KVRA 4W9EA 2KOXA 2M4NA 3K9OB 3T8MA 4NJ7A 2WDTB 1ISNA 2XEWA 5E6NA 4IUMB 1NBFC 2NS5A 4JGHB 2JF5A 3S2AA 4CHKA 2BPSA 3ZW3A 1AARA 2RPQA 2NBVB 4B9KA 4BOZB 1WGDA 2R2OA 3ZRFA 3Q3FA 5CHFA 3QAQA 2KNBA 4J6IA 3PRZA 1PQSA 2NBUA 2MP2A 2UWQA 3AI5A 2M17A 1TZ1A 4MDKE 5L83A 4DK5A 3SD5A 4KZCA 3A9JA 4FJVB 4NAWA 1WMHB 4DHJD 3A1QA 3ZDMC 2AWTA 2N1VA 4WQOB 3M62B 1KM7A 3VTUA 2RSUA 2FCNA 2NPTA 2MLBA 2MP2B 4LJOB 1YIWA 2EMSA 4EEWA 2WX1A 2AL3A 3PHWB 3PREA 4DDGD 1V81A 2BKFA 3EECA 2LRWA 2IY1B 3A9JB 4FLHA 4WJOA 2V1YA 3PRPB 3A1QB 2FCMA 3QX1A 4ZDVA 2FUHB 3ALBA 1V9JA 2L0TA 2ZPNA 4K1RB 3VQIA 2ZNVC 4BKSA 3MJWA 3I3TB 3HHMA 3ZNID 1J19A 4OVUA 4BFRA 4GU2A 4EKUA 2KK8A 1UD7A 3QARA 2ZVOA 3Q3JA 5G2NA 3HM3A 1WY8A 4G0NB 3ZRCA 5C1ZA 3R66C 1XT9B 2FIFA 2XBBC 3UIPB 4EZKA 2O6VA 2RD0A 1WXVA 4HCNB 3TJPA 4I6NB 1Q5WB 2N7DA 5AZFA 4GOCA 1J8CA 4IW0A 1YQBA 3HK0A 1YJ1A 4AP4C
chains in the Genus database with same CATH superfamily
2WDRB 4A55A 4HJKA 3VFKA 1V6EA 4DBGA 2LGYA 4IC7B 2PE6B 4IM0A 4XYCA 4K3BA 2IO3B 1SBBB 2I2YA 3VR8B 1X1MA 1XCTL 2BVCA 2ZW0A 1D5XC 4TKNA 1HXYD 5G55A 3LB8C 4EZJA 4I6LB 3PS6A 1L0VB 2M1MA 2WS3B 4DHJB 2PJHA 4W9GA 4KDIC 1I7HA 1WE7A 2KDEB 4YTNB 2GBKA 4HRSA 2KHWB 2CU1A 1IP9A 4WIPA 5CX3A 3TEXA 1WX7A 3SEBA 4MEMA 3W5UB 3Q69A 2RMMA 1T0SC 3TL5A 4L2YA 2HJ8A 1JWMD 5AUIA 4AJYB 1BT0A 1V8CA 3AH7A 1KH0A 4N6EB 2L0FA 1FXAA 1UWXA 4WJNA 2CJOA 5DPSA 1VD2A 2MBEA 5FK9C 3VH4B 1XLNA 1QILA 3AU4A 4AJWA 4KZ0A 1SE9A 4DXGA 2UYZB 4NY0A 2KWUB 1L4DB 3R8BA 4HCPB 3B9JA 2BQQA 3C19A 3QCAA 3R3MA 3VVWB 1C77A 2D3BA 2V9HA 3BYYB 3DBLI 4M0WB 1HZ6A 4II3B 2DHZA 4YL8A 1NYQA 4M00A 5BMIA 2KJHB 1TS5A 1Q1OA 4FADA 3AE6B 3WA0A 1I35A 2BYFA 3VHTC 2LVPA 1SSNA 5MPOA 2LI5A 5T8IA 2RDBC 1CK1A 3HIZA 2MQJA 5H8YE 2KQSA 1C76A 3FC4A 1Z2MA 4K81A 2DYBA 2KAJA 2KYWA 1SE3A 3UIOB 2Z0DB 2BGFA 1V1PB 2WXGA 4JL9A 3V6EB 2N9KA 1E7PB 2LASA 2N4FA 2WGSA 3R7QA 1ZOYB 3WIMA 3I5JC 5IOIA 2WQYB 1C79A 1RM6C 2WXHA 2LGXA 1FRRA 1P1AA 2Z59B 1WI0A 1PGBA 2VRRB 2QIEB 1GJZA 2KO3A 1FM0D 3ZXRA 5HFYA 4WURA 3AECB 4MSQB 4XGAB 2WXMA 1N5XA 5DCNA 2LGDA 4JLCA 3NVVA 2OJRA 4DXAB 4PK1A 2SAKA 3X0WA 4BZAA 1SB3C 1YN3A 2ONQA 4MSMB 2GI9A 1SE4A 4GDKA 3W2DA 3AXCA 4OVZA 2BWES 4ANWA 3RFZB 3E9SA 2HDEA 4BKSD 4G3XB 1F2RI 2JXXA 3LJ3A 3TSSA 2INDC 2KXJA 4DWFA 1QLBB 1UUPA 2W82A 2KDFB 2NTTA 3ZDTA 2O6VD 5E6PA 4MGKE 4OZBA 2WWZA 2QCZA 2PW9A 3N3KB 1R4MI 2QDFA 3VAWA 1SXTA 4WJQA 2WXFA 1C9FA 2JY6A 4AUQC 4NNJB 4HPPA 2L52A 2L8JA 2KC2A 2R61A 3A33B 1C1YB 3BWUD 3EA6A 2N9XA 2W3RA 2WXOA 3V60A 1LXDA 5EE1A 4DHZE 1N5WA 4ASWC 2J0MA 2KJ6A 1OTRB 4IDIA 3HVZA 2MBBB 3MJ5A 4ZOHC 1R4NI 2V0GA 3AE9B 1MJDA 1LGRA 1DOYA 4EZLA 1VR9A 5LNK1 2NPTB 1RLFA 2REXA 3NS1A 3T3NA 2K22A 2XK5A 5EE3A 1SJED 4ZHOA 3R2TA 3LXFA 3ABVB 2Q5WD 4ZYNA 1I4PA 2BS3B 1ZPSA 4FJZA 2K1FA 4ZYSA 3ZTCA 2D5GA 3RD2A 3DHGC 4JE3B 1T3QA 1SGHA 2RGFA 4L23A 3VRAB 2FCSA 4HKQA 2D3CA 3FKYA 2GLSA 3T9LA 1ZW7A 3NHEB 2LXAA 1D5MC 1TJEA 1WJ6A 2DENB 5CHVC 4BOSC 2LWPA 1K50A 2JSVX 1V80A 1IUEA 1K53A 4GB9A 2D3AA 1XD3B 4YSZB 3PLUA 3IBEA 2DX5B 5BO4B 2EKEC 2LHDA 3TMPB 3VUXA 2MX2A 3OLMD 4EUTA 3KW5B 1XLQA 3JYUA 3ZLZA 2D10A 2OEDA 4X57B 1V1OA 4RGTA 3L16A 2K8CA 3WANA 2JZPA 2OHFA 4LNKA 2FAZA 4WAFA 2MJ3A 3AN1A 1TTNA 2KFJA 2FUG1 4YTMB 3RI7C 2Y3AA 2CR5A 1J7CA 2QEJC 3NVWA 4W9EA 2M4NA 1M4VA 3GB1A 2NS5A 4JGHB 2AQ1B 4MH8A 1AARA 1WGDA 2R2OA 1EWYC 3AM9A 1GOZA 4OW0A 1T6BX 3NVYA 3A9JA 4FJVB 1QOAA 1KM7A 2RSUA 2MLBA 2EMSA 2AL3A 3PHWB 3A9JB 4FLHA 1D5ZC 1TY2A 1ENFA 3ALBA 2L0TA 4K1RB 3VQIA 4BFRA 4GU2A 2VH1A 4EKUA 4ARCA 1JQ4A 3HM3A 1WY8A 4EZKA 3RMKC 4JX1C 3TJPA 1I4RA 5AZFA 1XLOA 1F52A 3UQBA 3EC8A 1DYQA 1OQQA 4LTUA 1QOFA 2IBIB 3AE3B 1I4HA 4NAMA 3ZJUA 2WDQB 3RNBC 2MHJA 2WU5B 3DBLB 1Q10A 5D2MB 3RNGC 1Y56A 3W1SC 4HK2A 3RNCC 1J7BA 2IYDB 1C4AA 1IBXB 5IO9A 1E8YA 1RFAA 3AE1B 3V62A 1SEBD 2LJ5A 2KJRA 4A20A 4P6VF 2N9LA 2V3PA 2K8BA 3AB5A 2JWZA 2CJNA 3MHSD 5LLIA 5IAAC 2H88B 2JZZA 1E8WA 1QF6A 3JVZX 1N61A 2I1JA 4C7YA 1HEZE 1BMLC 2KMCA 4PYUA 3DBRI 3RT3B 2PE9A 4IWQA 5CTRC 4GDLA 3MC0B 1HQRD 4KKJA 2QSDA 1NI2A 5D94A 3DDCB 4RGNA 4USAA 4ICVA 1A5RA 4GDLB 1WGKA 2KLGA 3IT4B 1YX5B 4CO7A 3AV8A 1OEYJ 2DZKA 3O13A 3GE8C 1GC7A 1WMHA 2MBOA 2MEKA 1KTKA 1AWDA 3APCA 1F1HA 3H6NA 2AX5A 2L05A 4XC2A 4J3OD 2RPVA 5D6JB 1WYWB 4A3PA 4LCDE 2KMMA 2LRUA 2DLBA 4DQOC 1FXIA 2A5UA 3BVZA 3VTWA 2NBWB 2CS4A 1HE8A 2NMQA 1YMHE 2ZPYA 4ZRJA 2KDBA 1PGAA 3RNEC 3KWVA 4OZCA 1UGJA 1MG4A 2JYTA 2L1AA 4W9LA 4K7UA 1LFDA 1JRPA 2A4ZA 2KVZA 4XDDA 4HLEA 2PPHA 3QC8B 2DNFA 4RM9A 4W9DA 2JXTA 4W9IA 1KRHA 4ZRPA 1YNTE 2KTFA 3RZWC 3ZTDA 4KSLC 2NR2A 4G11A 2B76B 4BBNC 5BMHA 2DZMA 1EF5A 3NS8A 4OVVA 2L32A 3ML8A 5GXGB 1P0RA 1R4MB 5JHBA 2J52A 1TKEA 2INCC 4FHKA 5BMGA 3N1YC 4RGOS 3ZIMA 4TMAB 2G4DB 4C7ZA 3PPAA 1GPXA 4F1SA 1E8XA 2PMVA 4LNFA 4S0RA 1BXTA 2FE8A 2JWUA 4K3CA 3KYCD 4MELA 2K6DB 2KWVB 5IN7A 3KUDB 2TSSA 2J0JA 2B3AA 3QIJA 1FIQA 1GB1A 1SIJA 1Y8RC 1CMXB 1R4NB 1GUAB 3J9CA 4P7IA 3U8ZA 3ENEA 2MJDA 3ECIA 4WWPA 4EOYA 1NDDA 2LVQA 4KIKB 2ZNVB 1D3ZA 2IO1B 1TZOA 2LXCA 2ZW1A 1UWMA 4P16A 5AEKB 1FPYA 2CHXA 3EFUA 1AW7A 3DHIC 4GXBA 1YN4A 3OWEB 1GC6A 1E8ZA 4LDTB 1R7SA 5LXIB 5J18A 5D7GA 1N60A 2DWQA 1FFVA 4YTPB 4BVUC 3UGBB 1WXSA 3IAS1 1CJEA 1J7AA 1IPGA 1GAQB 1OGWA 1V5OA 3AMZA 2N1WA 3ZXVA 4MGIE 4B0EA 1E7VA 5TR5A 2NVUI 4M0WA 2K25A 2R2QA 1PFDA 2FBWB 4IM2A 5CHWA 1E9MA 2KD0A 1WE6A 3R2IA 3ZO5B 1FCCC 1WM2A 3PRMB 3APDA 2DAFA 4EE2A 2X8XX 2DZIA 4W9HA 3HM6X 3RZFA 4JIOU 4NQKE 3UINB 3QK0A 1B1ZA 4GMVA 3X23A 2CHWA 3DBHB 4NAWB 3AEBB 1V1PA 4ZHPA 2AYOB 3Q2AC 4HPMB 1E0ZA 1TKGA 3RULA 4IWOA 2L76A 2W54A 3L54A 4KGTA 4N9F4 3AEDB 2IJ0A 1FXTB 2FCQA 1H8CA 4FULA 1WH3A 1TT5B 3P42A 1WFYA 3GOEA 3GS2A 1UH6A 2HE7A 3AE2B 2J7QB 2BYEA 2MW5A 1E5WA 2M0XA 4MJSA 2BF8B 2VZKB 3PVLA 1VLBA 2KX3A 1JALA 2DYMA 4MJSB 5IA7A 1YD8U 1YJIA 3U4EG 3WALA 2JRIB 3E56A 4NJCA 1L0XB 2IGGA 5EDSA 2K8HA 3BK1A 1WWTA 1FNUA 3BZDB 4W9FA 3SDLC 1C4CA 4RMAA 1WZ0A 4RM8A 4PS8A 4K7WA 3I63C 3SR6A 2JT4B 2JRHA 2WXPA 3NVZA 4FXCA 1E90A 2IGDA 2G45B 1L6VA 2V3SA 3L0WB 3W5VB 4BKGA 4GGQA 3Q3NC 2KLCA 1MPEA 3Q8BA 2KVRA 3T8MA 3V05A 4IUMB 2I38A 5EE0A 2JF5A 4CHKA 3N1XC 3ZW3A 3ZRFA 3Q3FA 5G5GA 4J6IA 5JXVA 2UWQA 3AI5A 4MM3B 2M17A 1TZ1A 4A9AA 5L83A 4DK5A 4DHJD 1C78A 4YSYB 2AWTA 3UI3A 2E6XA 4WQOB 2FCNA 2NPTA 4JWUC 4LJOB 1EU3A 3MP9A 1V81A 2MJEA 3EECA 2LRWA 2IY1B 3QX1A 4D2KA 5BYSA 4ZDVA 2FUHB 3DBRB 1V9JA 3T3OA 3Q8FA 1A70A 3I3TB 3HHMA 3ZNID 4OVUA 2KK8A 4DXFA 3FAHA 1FO4A 5G2NA 1VZ6A 1PUTA 4G0NB 1XT9B 1TY0A 2XBBC 3UIPB 2RD0A 2HJ1A 3LYYA 1YQBA 3HK0A 1YJ1A 1VRAB 2L00B 4RF1A 1C4PA 5H92C 1GB4A 3FILA 3O65B 3DWMA 3BINA 3V3XA 4HEA1 3GP7A 3FILB 1EO6A 2KT7A 3ZNZB 2C9WB 4URKA 5LXHA 2LUMA 4C4VA 1MHHE 3D32A 5C2TB 3U7ZA 3Q8CA 1VZ8A 4C4VB 3AU5A 1G6JA 2KFKB 3B0AA 1VZ7A 1EUVB 4LK0M 3QQ8B 3L4PA 3VR9B 5HHDG 4M01A 4MH0E 2JQRB 2AL6A 4WWOA 1FNVA 1QKZA 2LZ6A 2J42A 4KVGB 5E6JA 3MC9A 3RN9C 4B6WA 2DZJA 2YEPF 2WX0A 1I4XA 2LD9A 2JUOA 2QMTA 3PZ7A 1OEYA 1XO3A 2D3GA 4WWNA 5L95C 3L08A 3HRDD 3WAOA 4MGZE 4L1BA 3BYTB 3N20C 4A3OA 2PEAA 3C8YA 3PLVA 3KYDD 3V6CB 2WHIA 3Q3OC 2SEBD 2QILA 1OQYA 2H89B 2WXKA 2J0KA 1QQRA 1FCLA 5JZEB 3TEYA 2K9XA 4QAYA 3PZ8A 3CF6E 2GBNA 1WRDB 1SF0A 2W55A 2O2VB 4ZRIA 3ZJVA 3AE8B 1RWSA 4MACA 1WXMA 3GZNI 3VUWA 4E3CA 1J0GA 3VDZA 5D3DA 2IDYA 4C80A 1YOVB 2D11A 5IKCM 5KHQA 1AN8A 2KTRB 1JWAD 3P2BA 3C0RB 1QT9A 3KUCB 4R3DA 1M94A 3IG3A 2W3SA 1HA5A 3AEGB 3TEZA 2KKCA 2LUEA 4YSXB 1JWBD 4PS7A 4XZ4A 2KN5A 3H8HA 1L4ZB 2ACZB 2IPKD 3RYTA 2D07B 4OHJA 4LNIA 1KJTA 4RH6A 4HVBA 2G1EA 2VH2A 3QJZA 3I57A 2ZJDA 4FHJA 2LMCA 4IWPA 1TS3A 1EF1A 5GMVA 1ESFA 1P9DU 5FR3A 2YLMA 1ZGUB 2JPHA 1EU4A 2Z0EB 5DPWA 5KHOA 4F8CB 1IBXA 3KH0A 2GBJA 4JWSC 3VRBB 2JYEA 1Z5SB 1QZEA 2IGHA 3W9CB 1TGZB 2DBYA 1XCQL 3CIRB 1K52A 1AYFA 1L2NA 1NVID 4WAAA 1N62A 1L7YA 1D4BA 2DAJA 4REZA 3EHVA 2N7EA 3AULA 2N9EB 3B08A 4HDOA 3UQAA 2N9PC 1MI0A 1WX9A 2MCNB 1KLUD 2FNJB 1T0YA 2CKHB 2MRPA 4I6PA 3TEWA 2JZ3B 1YX6B 5E6OA 2FIDA 3SU8X 1V97A 2KMAA 1P3QU 1ET6A 2BYVE 2WXLA 3BK2A 4ICUA 2LEKA 4P1BC 2PVGC 4E74A 2G4SA 1UBQA 1MG8A 3A9KA 3HUIA 2ZCCA 1UBIA 3ZUNA 2KACA 3PSEB 3A9KB 1I42A 3AEAB 2XN9C 2K0PA 4Q2JA 1XF5L 2KX0A 3CSTA 3N9YC 1UELA 2ZZPB 3AE7B 1I4GA 1IGDA 2NTSA 4A90A 3DWGC 4AQ7A 4M02A 1NENB 2WU2B 1WJUA 2MWSB 4JQWC 2IO0B 2RDHA 5I4DA 1CZPA 2WNMA 2WLBA 4DDID 1WIAA 4W9CA 5G5HA 2GBRA 2MBHA 4WJPA 3AEEB 3RPFC 3V61A 5J17A 3M63B 2GRIA 1WXAA 3ONSA 3DCGA 3P4RB 3OAWA 1IYFA 4LJPB 3AE5B 1TKYA 2MBQA 2OOBB 2WXJA 4ITKA 4O1NA 2NCNA 3OJ4B 1ZXIA 2BWFA 3TBLD 4GN1A 4US9A 2V3NA 4BKTA 3N1ZC 2BYTA 3DQVA 3L13A 3PHXB 3IXSA 5BYQA 3IAM1 2AQ2B 4MGYE 2O6VB 4RFBA 5JHAA 1ACCA 3PZDA 3R7RA 2XNAC 3Q6BA 2PVOD 3OG5A 1ZDVA 4AOFA 4XWWA 1WGRA 2EMTA 2N0SB 4KIKA 3DVNU 4ZRQA 3H7SA 2ICIA 3ZVVA 2K5PA 3CMMB 3NG0A 4W9JA 1RRBA 2UU7A 3NUHB 1WRIA 5DPTA 2E3TA 3HVDA 5AUKA 3B1LX 2GBMA 3EUB2 4AS1A 1K8RB 4K7SA 5DPRA 1NI3A 1K51A 2YEPB 3P4PB 4KSKC 2X38A 1NYRA 2EELA 1DOIA 4KDLB 1TS2A 2C7NB 4B0MA 4S17A 1HZ5A 2JX5A 4C56C 1MHXA 3PV1A 3ZNGC 1F2RC 2GOWA 2L3ZA 4ANUA 1Q0WB 4II2B 2QHOA 2HTHA 2KZRA 3NOBA 2M8SA 4ANXA 4KGSA 2LGSA 1ET9A 4IKGA 3B2FA 3SFEB 1FNWA 2KOXA 3K9OB 2WDTB 1NBFC 3S2AA 2LJIA 2BPSA 2NBVB 3Q14C 4TSSA 2EKIA 2JU6X 3PRZA 1PQSA 2MP2A 5D3IB 3SD5A 4KZCA 2N7JA 4NAWA 3A1QA 3ZDMC 3VTUA 2MP2B 3GE3C 3EGRA 1YIWA 2WX1A 2BKFA 1IGCA 1PDXA 2V1YA 3U2SC 3PRPB 3A1QB 1CQVA 3P4SB 2ZPNA 3MC8A 2ZNVC 3MJWA 4RCOA 1J19A 1KF6B 1UD7A 4LNNA 2KN4A 2Z8LA 3KQ4A 3ZRCA 3R66C 2FIFA 1ROEA 4HCNB 4I6NB 1Q5WB 2N7DA 1J8CA 4IW0A 4RF0A 4ARIA 2PTLA 1FFUA 4IOIE 3TIXA 4US8A 1GG3A 3ZNHB 3GZNB 4TUUA 4IM3A 1QOGA 4HKZE 1N6ZA 4NPNA 3JSVA 2KWDA 4TV3A 1UGMA 4WWMA 2WXIA 2BBCA 1L0YB 4TQ0A 1P7FA 3MTNB 3VH3B 1YN5A 1XQQA 4MT5A 2L83A 3JSVB 2WXNA 4YXDB 2C7HA 1TBEA 2WXQA 4YWGG 1ZE3D 3L10B 2INPE 4PYZA 5TSSA 1E6EB 2BW2A 2QC8A 2WDVB 3NJTA 1C3TA 2V4IB 2KANA 3KWLA 3U7DA 1WGHA 3I9V1 1KLGD 4BBNF 3N32A 5HKHA 1HTQA 1BUIC 4GDKB 5AZHA 1E10A 4XX5A 3AEFB 1JROA 1TIFA 3KVFB 1GNUA 1T0QC 2ZVNA 1DOXA 1SIFA 3ZGZA 1PGXA 2JVCA 4MM3A 2BS4B 1MFWA 5FR6A 5AZGA 1S1QB 2C7MB 4FJYA 1WZ3A 3IT6B 2MSED 1UNSA 2G3QB 1WGGA 1SE2A 1TS4A 1V86A 3P4QB 3ZKJC 4A8XC 1U4AA 4LLGM 3DPDA 2INNE 4IG7B 3H9DA 4HROA 2LGIA 3U52E 1FEHA 3VUYA 4BAXA 1V2YA 3OJ3A 2BTEA 3B2GA 2W9NA 4LDTD 3KUZA 3RUIB 5EE9A 2G9HD 5FKAC 3RNFC 5J2RA 3APFA 2CU3A 3M3JA 4HDQA 1WSPA 3EFCA 1RAXA 2YVCA 1WM3A 4GSWA 1QOBA 4HJGE 3P63A 3SFDB 1KOTA 1KFYB 3ZJTA 5IP4D 2BB6A 2XK5B 1PYWD 2KQ7A 1ZUD2 1D6EC 3AE4B 3BY4B 2KDIA 2K6QA 2ASQA 4E71A 2ZCBA 3H1UA 1LQBA 4FA6A 3NZ3A 4W9KA 2C60A 2ON8A 1S3SG 3SHQA 1YQ4B 4NJ6A 3TCAA 1RYJA 4ACFA 2MA9B 1B9RA 3NY5A 2KFKA 4N58A 1ZKHA 3A4SC 3WAMA 1FRDA 4KGRA 3DHHC 1DGJA 2BB5A 2IO2B 2RR9A 3PGEA 3IHPC 1UF0A 1WGYA 4HPLB 1WXQA 1ZXHA 2BKRB 1WR1A 2KQ4X 4RGMA 2Y5PA 1WJ4A 4KV2A 2WXRA 2KWCA 1WX8A 3DVGY 2WYQA 2K39A 1FD6A 3PTFC 4DHZB 1EM7A 3A4RA 1XXGA 4OZAA 3VXWA 3DBSA 3TUOA 3KLSX 2M19A 3DOWA 1RFKA 4G50A 4A6QA 3IVFA 2I1KA 3MFGA 3WAPA 3ZYYX 3U30A 2IY0B 4ANVA 3ZQ4A 3DBHI 3W1SA 1V49A 5JH5C 4ZRKA 3Q8EA 1I4QA 2O2VA 3K9PB 1L6UA 4HWIB 4AWJA 2PKOA 2VZKD 4RNAA 4N59A 4FBJB 3IFWB 2KTRA 2WP9B 1F77A 2IZVB 2HD5B 1YJJA 4TQ1A 4KKIA 3BVMA 3RCZA 1JMLA 2BT6A 1T5XD 1MVKA 2KDMA 1NEKB 3VTVA 2K3UA 4PS3A 2J53A 1UZXB 3Q8AA 1F0ZA 1JWUD 3LDZE 4M8MA 2HTME 3DVNV 1YQ3B 3CSFA 1LO5D 1P7EA 3N30A 4M8NA 1JCKB 1H4RA 1XEEA 1F9JA 4JPSA 3NZUA 1STEA 3NRZA 4F7ZA 2LFIA 3BIID 3BVGA 1WJNA 3M95A 2M56B 2AEHA 4NQLB 5BYRA 4HXDA 2M0AA 1E7UA 1V5TA 2L7RA 2DYOA 2LVOA 2AQ3B 2KC1A 2D2QA 2GMIC 2C5LC 1ZDXA 1JWSD 5C3JB 1EWCA 3QHTA 4UDUC 1VJKA 3QA8A 3ML9A 1P98A 5HI1A 1WR6E 1HTOA 2V4LA 4XWTA 4CYEA 4B95A 3QWZB 1VDVA 1WF9A 3UF8A 3JW0X 3W1YA 2QJLA 4NZLB 4GIVA 4EFOA 3DVGX 1OQRA 3CWIA 3PT2B 3H7PA 2LHEA 1LM8B 1KLVA 1FMAD 1JW9D 2BS2B 2CHZA 1L5PA 5C23A 2ZEQA 3H7PB 3L17A 3P1MA 4LNOA 2J4XA 2GB1A 4FN2A 1VCBA 3NZSA 1JRUA 2Y5BB 3MHZA 4C00A 1N63A 3PO0A 4NJ7A 1ISNA 2XEWA 5E6NA 2RPQA 4B9KA 4BOZB 5CHFA 3QAQA 2KNBA 2NBUA 2Y5CA 4P1CC 4XE0A 4MDKE 4PT5A 2RDGA 2PIAA 1ZP0B 1WMHB 4H2AA 2N1VA 3M62B 3URYA 4EEWA 1WYGA 3PREA 4DDGD 4WJOA 2FCMA 4YT0B 4KX6B 4WH4A 3Q3MC 3ETRA 4BKSA 2OJWA 2MH7A 1XLPA 3QARA 5HG2A 2ZVOA 2PLPA 3Q3JA 4CQNA 1SJHD 5C1ZA 3WCQA 4WQMA 2O6VA 4GLSC 1T0RC 1WXVA 1OFFA 1TYGB 3RNAC 4GOCA 4XDCA 4AP4C
chains in the Genus database with same CATH topology
3UQBA 4HJKA 2L00B 3EC8A 3VFKA 1V6EA 3TIXA 2IBIB 4DBGA 2LGYA 3O65B 4IC7B 2PE6B 4IM0A 1GG3A 2IO3B 3ZNHB 3BINA 4TUUA 4IM3A 5D2MB 1X1MA 1EO6A 3W1SC 4HK2A 4NPNA 3JSVA 4TKNA 3ZNZB 2C9WB 4URKA 5LXHA 4TV3A 1UGMA 5G55A 2IYDB 4EZJA 3D32A 4I6LB 4TQ0A 3MTNB 3VH3B 1XQQA 1E8YA 1RFAA 3PS6A 3JSVB 3V62A 2LJ5A 2M1MA 2KJRA 3AU5A 4A20A 1G6JA 2KFKB 4DHJB 2C7HA 1TBEA 3B0AA 1EUVB 2K8BA 2PJHA 4W9GA 4KDIC 2JWZA 1WE7A 2KDEB 3MHSD 3QQ8B 5IAAC 3L10B 5LLIA 2JZZA 4MH0E 4PYZA 2GBKA 2AL6A 4WWOA 1E8WA 2KHWB 3JVZX 2I1JA 2CU1A 2LZ6A 4KVGB 1IP9A 5CX3A 4B6WA 1WX7A 2DZJA 1C3TA 4MEMA 2KANA 2KMCA 2WX0A 3U7DA 2LD9A 4PYUA 3DBRI 1WGHA 2JUOA 4BBNF 1OEYA 3N32A 2D3GA 2PE9A 3RT3B 3TL5A 5HKHA 4IWQA 5CTRC 4GDLA 4GDKB 5AZHA 2HJ8A 4WWNA 5L95C 3L08A 4XX5A 1NI2A 3WAOA 5D94A 3DDCB 4MGZE 4AJYB 1BT0A 2L0FA 3KVFB 1GNUA 4A3OA 2PEAA 4ICVA 1A5RA 2ZVNA 4GDLB 4WJNA 2KLGA 3PLVA 5DPSA 1SIFA 1YX5B 3KYDD 4CO7A 2JVCA 4MM3A 3V6CB 1VD2A 1OEYJ 2DZKA 2MBEA 1OQYA 5FR6A 5AZGA 1GC7A 1S1QB 1WMHA 2C7MB 3VH4B 2J0KA 2MBOA 3AU4A 4FJYA 1WZ3A 2MSED 4AJWA 2G3QB 1WGGA 4KZ0A 3APCA 5JZEB 1SE9A 3H6NA 2UYZB 2L05A 4NY0A 4XC2A 1V86A 2KWUB 3CF6E 5D6JB 1WYWB 2GBNA 4A3PA 3ZKJC 4HCPB 1U4AA 1WRDB 4LCDE 2LRUA 2O2VB 3QCAA 4ZRIA 2A5UA 3VTWA 3R3MA 3VVWB 2NBWB 2CS4A 1HE8A 1WXMA 3GZNI 3DPDA 2ZPYA 4ZRJA 3VUWA 2KDBA 4IG7B 4E3CA 3DBLI 4M0WB 3H9DA 1J0GA 4II3B 2DHZA 3VUYA 3VDZA 1V2YA 4YL8A 2D11A 4W9LA 4K7UA 3OJ3A 1LFDA 2KJHB 1Q1OA 2A4ZA 5KHQA 2W9NA 2KTRB 4HLEA 2PPHA 3QC8B 4FADA 3P2BA 3C0RB 4LDTD 3WA0A 3KUZA 3RUIB 1I35A 4RM9A 3KUCB 1M94A 4W9DA 3IG3A 2BYFA 3VHTC 2LVPA 2KKCA 4W9IA 5J2RA 3APFA 2LI5A 2LUEA 2KTFA 3RZWC 3ZTDA 4KSLC 2NR2A 4PS7A 3M3JA 4G11A 4HDQA 4XZ4A 4BBNC 2KN5A 2MQJA 2DZMA 1EF5A 3HIZA 2KQSA 3NS8A 1RAXA 2YVCA 4OVVA 3RYTA 2D07B 3ML8A 1P0RA 1Z2MA 4K81A 1WM3A 5JHBA 1KJTA 4GSWA 4FHKA 2DYBA 4HVBA 1KOTA 3UIOB 2Z0DB 2BGFA 3QJZA 3ZIMA 2ZJDA 4FHJA 4JL9A 3V6EB 2G4DB 4IWPA 1EF1A 2XK5B 2LASA 3PPAA 1P9DU 2KQ7A 2N4FA 5GMVA 3R7QA 2YLMA 3BY4B 2KDIA 1ZGUB 4F1SA 2JPHA 3WIMA 2K6QA 2ASQA 2Z0EB 2ZCBA 3H1UA 5KHOA 1LQBA 4E71A 1E8XA 4F8CB 4W9KA 3KH0A 2C60A 2GBJA 5DCNA 4FA6A 1Z5SB 1S3SG 1QZEA 3SHQA 2LGXA 4NJ6A 3TCAA 1P1AA 2Z59B 1TGZB 3KYCD 2K6DB 1WI0A 2KWVB 2VRRB 2MA9B 4MELA 3KUDB 3NY5A 2KFKA 2J0JA 1GJZA 2B3AA 1L2NA 1ZKHA 2KO3A 3QIJA 3A4SC 4WAAA 3WAMA 1Y8RC 1CMXB 1L7YA 1D3ZA 1GUAB 2IO2B 2RR9A 3PGEA 3IHPC 4P7IA 2DAJA 4HPLB 1WGYA 3EHVA 3U8ZA 3ENEA 2N7EA 4MSQB 2BKRB 1WR1A 3ECIA 4WWPA 4EOYA 1NDDA 2LVQA 3AULA 4KIKB 2N9EB 1WJ4A 2IO1B 2ZNVB 3B08A 4HDOA 2LGDA 4JLCA 4KV2A 3UQAA 2LXCA 2N9PC 1WX9A 2KWCA 2MCNB 2FNJB 2OJRA 1T0YA 1WX8A 2WYQA 2K39A 3DVGY 4DXAB 3X0WA 3PTFC 5AEKB 2CKHB 2CHXA 2MRPA 3EFUA 4I6PA 4DHZB 3A4RA 2JZ3B 1YX6B 4MSMB 4GXBA 4GDKA 5E6OA 3AXCA 2FIDA 2BWES 1GC6A 1E8ZA 4LDTB 3DBSA 3VXWA 4ANWA 3SU8X 2KMAA 1P3QU 2BYVE 3DOWA 4G50A 4BKSD 5LXIB 4ICUA 5J18A 4G3XB 5D7GA 2JXXA 3LJ3A 4E74A 3IVFA 2G4SA 1UBQA 1MG8A 2I1KA 3A9KA 2KXJA 3WAPA 4DWFA 3U30A 2IY0B 4BVUC 2ZCCA 3UGBB 2KDFB 1UBIA 1WXSA 4ANVA 3ZUNA 3DBHI 3W1SA 3ZDTA 2O6VD 5E6PA 4MGKE 3PSEB 2WWZA 3A9KB 1IPGA 1OGWA 1I42A 1V49A 5JH5C 1V5OA 4ZRKA 2KX0A 3N3KB 3CSTA 2N1WA 1R4MI 2O2VA 3K9PB 1UELA 2ZZPB 4HWIB 4MGIE 4AWJA 1E7VA 5TR5A 2NVUI 3VAWA 4WJQA 2K25A 2JY6A 4AUQC 2R2QA 4NNJB 4IM2A 4FBJB 1WJUA 3IFWB 2KTRA 2KC2A 2L8JA 5CHWA 3A33B 2KD0A 2MWSB 4JQWC 1C1YB 1WE6A 3V60A 2N9XA 2IO0B 3ZO5B 1WM2A 3PRMB 2IZVB 1LXDA 3APDA 2HD5B 2DAFA 4DHZE 4TQ1A 4ASWC 2J0MA 2KJ6A 1OTRB 4DDID 2MBBB 2DZIA 4W9HA 3RCZA 1R4NI 1WIAA 3HM6X 4W9CA 3RZFA 4JIOU 4NQKE 2GBRA 3UINB 3QK0A 2MBHA 4GMVA 4WJPA 3X23A 3VTVA 5DPWA 2CHWA 4NAWB 4EZLA 3V61A 4PS3A 5J17A 3M63B 1WXAA 2NPTB 1UZXB 1RLFA 3ONSA 3DCGA 2AYOB 2REXA 3OAWA 3LDZE 4M8MA 3DVNV 4HPMB 1IYFA 4LJPB 2XK5A 3RULA 2MBQA 3CSFA 4IWOA 2OOBB 2L76A 3N30A 2NCNA 4ZYNA 3OJ4B 3L54A 4M8NA 1H4RA 4N9F4 4FJZA 2BWFA 1F9JA 3TBLD 4GN1A 2K1FA 3NZUA 4BKTA 1FXTB 2FCQA 3DQVA 3L13A 3PHXB 4FULA 4F7ZA 1H8CA 3ZTCA 1WH3A 1WJNA 1WFYA 4MGYE 3M95A 3RD2A 2AEHA 2O6VB 1SGHA 2RGFA 3GOEA 4HXDA 4NQLB 2FCSA 1E7UA 5JHAA 1UH6A 3PZDA 3R7RA 2HE7A 1V5TA 2L7RA 2DYOA 2LVOA 2KC1A 2J7QB 3T9LA 1WGRA 2EMTA 2D2QA 2GMIC 4AOFA 4KIKA 1ZW7A 2BYEA 2C5LC 1E5WA 2MW5A 3DVNU 3H7SA 3NHEB 2M0XA 4MJSA 3QHTA 2BF8B 2LXAA 1WJ6A 4BOSC 2DENB 5CHVC 3PVLA 2LWPA 3QA8A 3ML9A 1P98A 3ZVVA 1V80A 1WR6E 2KX3A 4GB9A 3CMMB 2DYMA 4W9JA 4MJSB 1RRBA 1XD3B 2V4LA 3PLUA 3IBEA 5IA7A 2DX5B 5DPTA 1YD8U 2EKEC 5BO4B 4CYEA 3B1LX 3WALA 2GBMA 4B95A 2JRIB 3TMPB 1K8RB 3QWZB 4K7SA 1WF9A 3UF8A 3JW0X 5DPRA 3VUXA 2MX2A 5EDSA 2K8HA 3OLMD 4KSKC 3W1YA 4EUTA 3KW5B 4GIVA 3JYUA 4EFOA 3ZLZA 2D10A 3DVGX 4W9FA 3SDLC 4X57B 4KDLB 2C7NB 3PT2B 3L16A 4RMAA 2K8CA 3H7PA 3PV1A 3ZNGC 1LM8B 3WANA 1WZ0A 4RM8A 2GOWA 1KLVA 2CHZA 2FAZA 5C23A 4PS8A 4K7WA 2L3ZA 1TTNA 2KFJA 2ZEQA 3H7PB 3L17A 4ANUA 1Q0WB 4II2B 2JT4B 2QHOA 2HTHA 4FN2A 1VCBA 2JRHA 2KZRA 3NOBA 3NZSA 2M8SA 1JRUA 4ANXA 2Y5BB 1E90A 2G45B 3L0WB 2V3SA 4BKGA 2CR5A 4GGQA 2KLCA 2KVRA 4W9EA 2KOXA 2M4NA 3K9OB 3T8MA 4NJ7A 2WDTB 1ISNA 2XEWA 5E6NA 4IUMB 1NBFC 2NS5A 4JGHB 2JF5A 3S2AA 4CHKA 2BPSA 3ZW3A 1AARA 2RPQA 2NBVB 4B9KA 4BOZB 1WGDA 2R2OA 3ZRFA 3Q3FA 5CHFA 3QAQA 2KNBA 4J6IA 3PRZA 1PQSA 2NBUA 2MP2A 2UWQA 3AI5A 2M17A 1TZ1A 4MDKE 5L83A 4DK5A 3SD5A 4KZCA 3A9JA 4FJVB 4NAWA 1WMHB 4DHJD 3A1QA 3ZDMC 2AWTA 2N1VA 4WQOB 3M62B 1KM7A 3VTUA 2RSUA 2FCNA 2NPTA 2MLBA 2MP2B 4LJOB 1YIWA 2EMSA 4EEWA 2WX1A 2AL3A 3PHWB 3PREA 4DDGD 1V81A 2BKFA 3EECA 2LRWA 2IY1B 3A9JB 4FLHA 4WJOA 2V1YA 3PRPB 3A1QB 2FCMA 3QX1A 4ZDVA 2FUHB 3ALBA 1V9JA 2L0TA 2ZPNA 4K1RB 3VQIA 2ZNVC 4BKSA 3MJWA 3I3TB 3HHMA 3ZNID 1J19A 4OVUA 4BFRA 4GU2A 4EKUA 2KK8A 1UD7A 3QARA 2ZVOA 3Q3JA 5G2NA 3HM3A 1WY8A 4G0NB 3ZRCA 5C1ZA 3R66C 1XT9B 2FIFA 2XBBC 3UIPB 4EZKA 2O6VA 2RD0A 1WXVA 4HCNB 3TJPA 4I6NB 1Q5WB 2N7DA 5AZFA 4GOCA 1J8CA 4IW0A 1YQBA 3HK0A 1YJ1A 4AP4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQB A;  4HJK A;  2L00 B;  3EC8 A;  3VFK A;  1V6E A;  3TIX A;  2IBI B;  4DBG A;  2LGY A;  3O65 B;  4IC7 B;  2PE6 B;  4IM0 A;  1GG3 A;  2IO3 B;  3ZNH B;  3BIN A;  4TUU A;  4IM3 A;  5D2M B;  1X1M A;  1EO6 A;  3W1S C;  4HK2 A;  4NPN A;  3JSV A;  4TKN A;  3ZNZ B;  2C9W B;  4URK A;  5LXH A;  4TV3 A;  1UGM A;  5G55 A;  2IYD B;  4EZJ A;  3D32 A;  4I6L B;  4TQ0 A;  3MTN B;  3VH3 B;  1XQQ A;  1E8Y A;  1RFA A;  3PS6 A;  3JSV B;  3V62 A;  2LJ5 A;  2M1M A;  2KJR A;  3AU5 A;  4A20 A;  1G6J A;  2KFK B;  4DHJ B;  2C7H A;  1TBE A;  3B0A A;  1EUV B;  2K8B A;  2PJH A;  4W9G A;  4KDI C;  2JWZ A;  1WE7 A;  2KDE B;  3MHS D;  3QQ8 B;  5IAA C;  3L10 B;  5LLI A;  2JZZ A;  4MH0 E;  4PYZ A;  2GBK A;  2AL6 A;  4WWO A;  1E8W A;  2KHW B;  3JVZ X;  2I1J A;  2CU1 A;  2LZ6 A;  4KVG B;  1IP9 A;  5CX3 A;  4B6W A;  1WX7 A;  2DZJ A;  1C3T A;  4MEM A;  2KAN A;  2KMC A;  2WX0 A;  3U7D A;  2LD9 A;  4PYU A;  3DBR I;  1WGH A;  2JUO A;  4BBN F;  1OEY A;  3N32 A;  2D3G A;  2PE9 A;  3RT3 B;  3TL5 A;  5HKH A;  4IWQ A;  5CTR C;  4GDL A;  4GDK B;  5AZH A;  2HJ8 A;  4WWN A;  5L95 C;  3L08 A;  4XX5 A;  1NI2 A;  3WAO A;  5D94 A;  3DDC B;  4MGZ E;  4AJY B;  1BT0 A;  2L0F A;  3KVF B;  1GNU A;  4A3O A;  2PEA A;  4ICV A;  1A5R A;  2ZVN A;  4GDL B;  4WJN A;  2KLG A;  3PLV A;  5DPS A;  1SIF A;  1YX5 B;  3KYD D;  4CO7 A;  2JVC A;  4MM3 A;  3V6C B;  1VD2 A;  1OEY J;  2DZK A;  2MBE A;  1OQY A;  5FR6 A;  5AZG A;  1GC7 A;  1S1Q B;  1WMH A;  2C7M B;  3VH4 B;  2J0K A;  2MBO A;  3AU4 A;  4FJY A;  1WZ3 A;  2MSE D;  4AJW A;  2G3Q B;  1WGG A;  4KZ0 A;  3APC A;  5JZE B;  1SE9 A;  3H6N A;  2UYZ B;  2L05 A;  4NY0 A;  4XC2 A;  1V86 A;  2KWU B;  3CF6 E;  5D6J B;  1WYW B;  2GBN A;  4A3P A;  3ZKJ C;  4HCP B;  1U4A A;  1WRD B;  4LCD E;  2LRU A;  2O2V B;  3QCA A;  4ZRI A;  2A5U A;  3VTW A;  3R3M A;  3VVW B;  2NBW B;  2CS4 A;  1HE8 A;  1WXM A;  3GZN I;  3DPD A;  2ZPY A;  4ZRJ A;  3VUW A;  2KDB A;  4IG7 B;  4E3C A;  3DBL I;  4M0W B;  3H9D A;  1J0G A;  4II3 B;  2DHZ A;  3VUY A;  3VDZ A;  1V2Y A;  4YL8 A;  2D11 A;  4W9L A;  4K7U A;  3OJ3 A;  1LFD A;  2KJH B;  1Q1O A;  2A4Z A;  5KHQ A;  2W9N A;  2KTR B;  4HLE A;  2PPH A;  3QC8 B;  4FAD A;  3P2B A;  3C0R B;  4LDT D;  3WA0 A;  3KUZ A;  3RUI B;  1I35 A;  4RM9 A;  3KUC B;  1M94 A;  4W9D A;  3IG3 A;  2BYF A;  3VHT C;  2LVP A;  2KKC A;  4W9I A;  5J2R A;  3APF A;  2LI5 A;  2LUE A;  2KTF A;  3RZW C;  3ZTD A;  4KSL C;  2NR2 A;  4PS7 A;  3M3J A;  4G11 A;  4HDQ A;  4XZ4 A;  4BBN C;  2KN5 A;  2MQJ A;  2DZM A;  1EF5 A;  3HIZ A;  2KQS A;  3NS8 A;  1RAX A;  2YVC A;  4OVV A;  3RYT A;  2D07 B;  3ML8 A;  1P0R A;  1Z2M A;  4K81 A;  1WM3 A;  5JHB A;  1KJT A;  4GSW A;  4FHK A;  2DYB A;  4HVB A;  1KOT A;  3UIO B;  2Z0D B;  2BGF A;  3QJZ A;  3ZIM A;  2ZJD A;  4FHJ A;  4JL9 A;  3V6E B;  2G4D B;  4IWP A;  1EF1 A;  2XK5 B;  2LAS A;  3PPA A;  1P9D U;  2KQ7 A;  2N4F A;  5GMV A;  3R7Q A;  2YLM A;  3BY4 B;  2KDI A;  1ZGU B;  4F1S A;  2JPH A;  3WIM A;  2K6Q A;  2ASQ A;  2Z0E B;  2ZCB A;  3H1U A;  5KHO A;  1LQB A;  4E71 A;  1E8X A;  4F8C B;  4W9K A;  3KH0 A;  2C60 A;  2GBJ A;  5DCN A;  4FA6 A;  1Z5S B;  1S3S G;  1QZE A;  3SHQ A;  2LGX A;  4NJ6 A;  3TCA A;  1P1A A;  2Z59 B;  1TGZ B;  3KYC D;  2K6D B;  1WI0 A;  2KWV B;  2VRR B;  2MA9 B;  4MEL A;  3KUD B;  3NY5 A;  2KFK A;  2J0J A;  1GJZ A;  2B3A A;  1L2N A;  1ZKH A;  2KO3 A;  3QIJ A;  3A4S C;  4WAA A;  3WAM A;  1Y8R C;  1CMX B;  1L7Y A;  1D3Z A;  1GUA B;  2IO2 B;  2RR9 A;  3PGE A;  3IHP C;  4P7I A;  2DAJ A;  4HPL B;  1WGY A;  3EHV A;  3U8Z A;  3ENE A;  2N7E A;  4MSQ B;  2BKR B;  1WR1 A;  3ECI A;  4WWP A;  4EOY A;  1NDD A;  2LVQ A;  3AUL A;  4KIK B;  2N9E B;  1WJ4 A;  2IO1 B;  2ZNV B;  3B08 A;  4HDO A;  2LGD A;  4JLC A;  4KV2 A;  3UQA A;  2LXC A;  2N9P C;  1WX9 A;  2KWC A;  2MCN B;  2FNJ B;  2OJR A;  1T0Y A;  1WX8 A;  2WYQ A;  2K39 A;  3DVG Y;  4DXA B;  3X0W A;  3PTF C;  5AEK B;  2CKH B;  2CHX A;  2MRP A;  3EFU A;  4I6P A;  4DHZ B;  3A4R A;  2JZ3 B;  1YX6 B;  4MSM B;  4GXB A;  4GDK A;  5E6O A;  3AXC A;  2FID A;  2BWE S;  1GC6 A;  1E8Z A;  4LDT B;  3DBS A;  3VXW A;  4ANW A;  3SU8 X;  2KMA A;  1P3Q U;  2BYV E;  3DOW A;  4G50 A;  4BKS D;  5LXI B;  4ICU A;  5J18 A;  4G3X B;  5D7G A;  2JXX A;  3LJ3 A;  4E74 A;  3IVF A;  2G4S A;  1UBQ A;  1MG8 A;  2I1K A;  3A9K A;  2KXJ A;  3WAP A;  4DWF A;  3U30 A;  2IY0 B;  4BVU C;  2ZCC A;  3UGB B;  2KDF B;  1UBI A;  1WXS A;  4ANV A;  3ZUN A;  3DBH I;  3W1S A;  3ZDT A;  2O6V D;  5E6P A;  4MGK E;  3PSE B;  2WWZ A;  3A9K B;  1IPG A;  1OGW A;  1I42 A;  1V49 A;  5JH5 C;  1V5O A;  4ZRK A;  2KX0 A;  3N3K B;  3CST A;  2N1W A;  1R4M I;  2O2V A;  3K9P B;  1UEL A;  2ZZP B;  4HWI B;  4MGI E;  4AWJ A;  1E7V A;  5TR5 A;  2NVU I;  3VAW A;  4WJQ A;  2K25 A;  2JY6 A;  4AUQ C;  2R2Q A;  4NNJ B;  4IM2 A;  4FBJ B;  1WJU A;  3IFW B;  2KTR A;  2KC2 A;  2L8J A;  5CHW A;  3A33 B;  2KD0 A;  2MWS B;  4JQW C;  1C1Y B;  1WE6 A;  3V60 A;  2N9X A;  2IO0 B;  3ZO5 B;  1WM2 A;  3PRM B;  2IZV B;  1LXD A;  3APD A;  2HD5 B;  2DAF A;  4DHZ E;  4TQ1 A;  4ASW C;  2J0M A;  2KJ6 A;  1OTR B;  4DDI D;  2MBB B;  2DZI A;  4W9H A;  3RCZ A;  1R4N I;  1WIA A;  3HM6 X;  4W9C A;  3RZF A;  4JIO U;  4NQK E;  2GBR A;  3UIN B;  3QK0 A;  2MBH A;  4GMV A;  4WJP A;  3X23 A;  3VTV A;  5DPW A;  2CHW A;  4NAW B;  4EZL A;  3V61 A;  4PS3 A;  5J17 A;  3M63 B;  1WXA A;  2NPT B;  1UZX B;  1RLF A;  3ONS A;  3DCG A;  2AYO B;  2REX A;  3OAW A;  3LDZ E;  4M8M A;  3DVN V;  4HPM B;  1IYF A;  4LJP B;  2XK5 A;  3RUL A;  2MBQ A;  3CSF A;  4IWO A;  2OOB B;  2L76 A;  3N30 A;  2NCN A;  4ZYN A;  3OJ4 B;  3L54 A;  4M8N A;  1H4R A;  4N9F 4;  4FJZ A;  2BWF A;  1F9J A;  3TBL D;  4GN1 A;  2K1F A;  3NZU A;  4BKT A;  1FXT B;  2FCQ A;  3DQV A;  3L13 A;  3PHX B;  4FUL A;  4F7Z A;  1H8C A;  3ZTC A;  1WH3 A;  1WJN A;  1WFY A;  4MGY E;  3M95 A;  3RD2 A;  2AEH A;  2O6V B;  1SGH A;  2RGF A;  3GOE A;  4HXD A;  4NQL B;  2FCS A;  1E7U A;  5JHA A;  1UH6 A;  3PZD A;  3R7R A;  2HE7 A;  1V5T A;  2L7R A;  2DYO A;  2LVO A;  2KC1 A;  2J7Q B;  3T9L A;  1WGR A;  2EMT A;  2D2Q A;  2GMI C;  4AOF A;  4KIK A;  1ZW7 A;  2BYE A;  2C5L C;  1E5W A;  2MW5 A;  3DVN U;  3H7S A;  3NHE B;  2M0X A;  4MJS A;  3QHT A;  2BF8 B;  2LXA A;  1WJ6 A;  4BOS C;  2DEN B;  5CHV C;  3PVL A;  2LWP A;  3QA8 A;  3ML9 A;  1P98 A;  3ZVV A;  1V80 A;  1WR6 E;  2KX3 A;  4GB9 A;  3CMM B;  2DYM A;  4W9J A;  4MJS B;  1RRB A;  1XD3 B;  2V4L A;  3PLU A;  3IBE A;  5IA7 A;  2DX5 B;  5DPT A;  1YD8 U;  2EKE C;  5BO4 B;  4CYE A;  3B1L X;  3WAL A;  2GBM A;  4B95 A;  2JRI B;  3TMP B;  1K8R B;  3QWZ B;  4K7S A;  1WF9 A;  3UF8 A;  3JW0 X;  5DPR A;  3VUX A;  2MX2 A;  5EDS A;  2K8H A;  3OLM D;  4KSK C;  3W1Y A;  4EUT A;  3KW5 B;  4GIV A;  3JYU A;  4EFO A;  3ZLZ A;  2D10 A;  3DVG X;  4W9F A;  3SDL C;  4X57 B;  4KDL B;  2C7N B;  3PT2 B;  3L16 A;  4RMA A;  2K8C A;  3H7P A;  3PV1 A;  3ZNG C;  1LM8 B;  3WAN A;  1WZ0 A;  4RM8 A;  2GOW A;  1KLV A;  2CHZ A;  2FAZ A;  5C23 A;  4PS8 A;  4K7W A;  2L3Z A;  1TTN A;  2KFJ A;  2ZEQ A;  3H7P B;  3L17 A;  4ANU A;  1Q0W B;  4II2 B;  2JT4 B;  2QHO A;  2HTH A;  4FN2 A;  1VCB A;  2JRH A;  2KZR A;  3NOB A;  3NZS A;  2M8S A;  1JRU A;  4ANX A;  2Y5B B;  1E90 A;  2G45 B;  3L0W B;  2V3S A;  4BKG A;  2CR5 A;  4GGQ A;  2KLC A;  2KVR A;  4W9E A;  2KOX A;  2M4N A;  3K9O B;  3T8M A;  4NJ7 A;  2WDT B;  1ISN A;  2XEW A;  5E6N A;  4IUM B;  1NBF C;  2NS5 A;  4JGH B;  2JF5 A;  3S2A A;  4CHK A;  2BPS A;  3ZW3 A;  1AAR A;  2RPQ A;  2NBV B;  4B9K A;  4BOZ B;  1WGD A;  2R2O A;  3ZRF A;  3Q3F A;  5CHF A;  3QAQ A;  2KNB A;  4J6I A;  3PRZ A;  1PQS A;  2NBU A;  2MP2 A;  2UWQ A;  3AI5 A;  2M17 A;  1TZ1 A;  4MDK E;  5L83 A;  4DK5 A;  3SD5 A;  4KZC A;  3A9J A;  4FJV B;  4NAW A;  1WMH B;  4DHJ D;  3A1Q A;  3ZDM C;  2AWT A;  2N1V A;  4WQO B;  3M62 B;  1KM7 A;  3VTU A;  2RSU A;  2FCN A;  2NPT A;  2MLB A;  2MP2 B;  4LJO B;  1YIW A;  2EMS A;  4EEW A;  2WX1 A;  2AL3 A;  3PHW B;  3PRE A;  4DDG D;  1V81 A;  2BKF A;  3EEC A;  2LRW A;  2IY1 B;  3A9J B;  4FLH A;  4WJO A;  2V1Y A;  3PRP B;  3A1Q B;  2FCM A;  3QX1 A;  4ZDV A;  2FUH B;  3ALB A;  1V9J A;  2L0T A;  2ZPN A;  4K1R B;  3VQI A;  2ZNV C;  4BKS A;  3MJW A;  3I3T B;  3HHM A;  3ZNI D;  1J19 A;  4OVU A;  4BFR A;  4GU2 A;  4EKU A;  2KK8 A;  1UD7 A;  3QAR A;  2ZVO A;  3Q3J A;  5G2N A;  3HM3 A;  1WY8 A;  4G0N B;  3ZRC A;  5C1Z A;  3R66 C;  1XT9 B;  2FIF A;  2XBB C;  3UIP B;  4EZK A;  2O6V A;  2RD0 A;  1WXV A;  4HCN B;  3TJP A;  4I6N B;  1Q5W B;  2N7D A;  5AZF A;  4GOC A;  1J8C A;  4IW0 A;  1YQB A;  3HK0 A;  1YJ1 A;  4AP4 C; 
#chains in the Genus database with same CATH topology
 2WDR B;  4A55 A;  4HJK A;  3VFK A;  1V6E A;  4DBG A;  2LGY A;  4IC7 B;  2PE6 B;  4IM0 A;  4XYC A;  4K3B A;  2IO3 B;  1SBB B;  2I2Y A;  3VR8 B;  1X1M A;  1XCT L;  2BVC A;  2ZW0 A;  1D5X C;  4TKN A;  1HXY D;  5G55 A;  3LB8 C;  4EZJ A;  4I6L B;  3PS6 A;  1L0V B;  2M1M A;  2WS3 B;  4DHJ B;  2PJH A;  4W9G A;  4KDI C;  1I7H A;  1WE7 A;  2KDE B;  4YTN B;  2GBK A;  4HRS A;  2KHW B;  2CU1 A;  1IP9 A;  4WIP A;  5CX3 A;  3TEX A;  1WX7 A;  3SEB A;  4MEM A;  3W5U B;  3Q69 A;  2RMM A;  1T0S C;  3TL5 A;  4L2Y A;  2HJ8 A;  1JWM D;  5AUI A;  4AJY B;  1BT0 A;  1V8C A;  3AH7 A;  1KH0 A;  4N6E B;  2L0F A;  1FXA A;  1UWX A;  4WJN A;  2CJO A;  5DPS A;  1VD2 A;  2MBE A;  5FK9 C;  3VH4 B;  1XLN A;  1QIL A;  3AU4 A;  4AJW A;  4KZ0 A;  1SE9 A;  4DXG A;  2UYZ B;  4NY0 A;  2KWU B;  1L4D B;  3R8B A;  4HCP B;  3B9J A;  2BQQ A;  3C19 A;  3QCA A;  3R3M A;  3VVW B;  1C77 A;  2D3B A;  2V9H A;  3BYY B;  3DBL I;  4M0W B;  1HZ6 A;  4II3 B;  2DHZ A;  4YL8 A;  1NYQ A;  4M00 A;  5BMI A;  2KJH B;  1TS5 A;  1Q1O A;  4FAD A;  3AE6 B;  3WA0 A;  1I35 A;  2BYF A;  3VHT C;  2LVP A;  1SSN A;  5MPO A;  2LI5 A;  5T8I A;  2RDB C;  1CK1 A;  3HIZ A;  2MQJ A;  5H8Y E;  2KQS A;  1C76 A;  3FC4 A;  1Z2M A;  4K81 A;  2DYB A;  2KAJ A;  2KYW A;  1SE3 A;  3UIO B;  2Z0D B;  2BGF A;  1V1P B;  2WXG A;  4JL9 A;  3V6E B;  2N9K A;  1E7P B;  2LAS A;  2N4F A;  2WGS A;  3R7Q A;  1ZOY B;  3WIM A;  3I5J C;  5IOI A;  2WQY B;  1C79 A;  1RM6 C;  2WXH A;  2LGX A;  1FRR A;  1P1A A;  2Z59 B;  1WI0 A;  1PGB A;  2VRR B;  2QIE B;  1GJZ A;  2KO3 A;  1FM0 D;  3ZXR A;  5HFY A;  4WUR A;  3AEC B;  4MSQ B;  4XGA B;  2WXM A;  1N5X A;  5DCN A;  2LGD A;  4JLC A;  3NVV A;  2OJR A;  4DXA B;  4PK1 A;  2SAK A;  3X0W A;  4BZA A;  1SB3 C;  1YN3 A;  2ONQ A;  4MSM B;  2GI9 A;  1SE4 A;  4GDK A;  3W2D A;  3AXC A;  4OVZ A;  2BWE S;  4ANW A;  3RFZ B;  3E9S A;  2HDE A;  4BKS D;  4G3X B;  1F2R I;  2JXX A;  3LJ3 A;  3TSS A;  2IND C;  2KXJ A;  4DWF A;  1QLB B;  1UUP A;  2W82 A;  2KDF B;  2NTT A;  3ZDT A;  2O6V D;  5E6P A;  4MGK E;  4OZB A;  2WWZ A;  2QCZ A;  2PW9 A;  3N3K B;  1R4M I;  2QDF A;  3VAW A;  1SXT A;  4WJQ A;  2WXF A;  1C9F A;  2JY6 A;  4AUQ C;  4NNJ B;  4HPP A;  2L52 A;  2L8J A;  2KC2 A;  2R61 A;  3A33 B;  1C1Y B;  3BWU D;  3EA6 A;  2N9X A;  2W3R A;  2WXO A;  3V60 A;  1LXD A;  5EE1 A;  4DHZ E;  1N5W A;  4ASW C;  2J0M A;  2KJ6 A;  1OTR B;  4IDI A;  3HVZ A;  2MBB B;  3MJ5 A;  4ZOH C;  1R4N I;  2V0G A;  3AE9 B;  1MJD A;  1LGR A;  1DOY A;  4EZL A;  1VR9 A;  5LNK 1;  2NPT B;  1RLF A;  2REX A;  3NS1 A;  3T3N A;  2K22 A;  2XK5 A;  5EE3 A;  1SJE D;  4ZHO A;  3R2T A;  3LXF A;  3ABV B;  2Q5W D;  4ZYN A;  1I4P A;  2BS3 B;  1ZPS A;  4FJZ A;  2K1F A;  4ZYS A;  3ZTC A;  2D5G A;  3RD2 A;  3DHG C;  4JE3 B;  1T3Q A;  1SGH A;  2RGF A;  4L23 A;  3VRA B;  2FCS A;  4HKQ A;  2D3C A;  3FKY A;  2GLS A;  3T9L A;  1ZW7 A;  3NHE B;  2LXA A;  1D5M C;  1TJE A;  1WJ6 A;  2DEN B;  5CHV C;  4BOS C;  2LWP A;  1K50 A;  2JSV X;  1V80 A;  1IUE A;  1K53 A;  4GB9 A;  2D3A A;  1XD3 B;  4YSZ B;  3PLU A;  3IBE A;  2DX5 B;  5BO4 B;  2EKE C;  2LHD A;  3TMP B;  3VUX A;  2MX2 A;  3OLM D;  4EUT A;  3KW5 B;  1XLQ A;  3JYU A;  3ZLZ A;  2D10 A;  2OED A;  4X57 B;  1V1O A;  4RGT A;  3L16 A;  2K8C A;  3WAN A;  2JZP A;  2OHF A;  4LNK A;  2FAZ A;  4WAF A;  2MJ3 A;  3AN1 A;  1TTN A;  2KFJ A;  2FUG 1;  4YTM B;  3RI7 C;  2Y3A A;  2CR5 A;  1J7C A;  2QEJ C;  3NVW A;  4W9E A;  2M4N A;  1M4V A;  3GB1 A;  2NS5 A;  4JGH B;  2AQ1 B;  4MH8 A;  1AAR A;  1WGD A;  2R2O A;  1EWY C;  3AM9 A;  1GOZ A;  4OW0 A;  1T6B X;  3NVY A;  3A9J A;  4FJV B;  1QOA A;  1KM7 A;  2RSU A;  2MLB A;  2EMS A;  2AL3 A;  3PHW B;  3A9J B;  4FLH A;  1D5Z C;  1TY2 A;  1ENF A;  3ALB A;  2L0T A;  4K1R B;  3VQI A;  4BFR A;  4GU2 A;  2VH1 A;  4EKU A;  4ARC A;  1JQ4 A;  3HM3 A;  1WY8 A;  4EZK A;  3RMK C;  4JX1 C;  3TJP A;  1I4R A;  5AZF A;  1XLO A;  1F52 A;  3UQB A;  3EC8 A;  1DYQ A;  1OQQ A;  4LTU A;  1QOF A;  2IBI B;  3AE3 B;  1I4H A;  4NAM A;  3ZJU A;  2WDQ B;  3RNB C;  2MHJ A;  2WU5 B;  3DBL B;  1Q10 A;  5D2M B;  3RNG C;  1Y56 A;  3W1S C;  4HK2 A;  3RNC C;  1J7B A;  2IYD B;  1C4A A;  1IBX B;  5IO9 A;  1E8Y A;  1RFA A;  3AE1 B;  3V62 A;  1SEB D;  2LJ5 A;  2KJR A;  4A20 A;  4P6V F;  2N9L A;  2V3P A;  2K8B A;  3AB5 A;  2JWZ A;  2CJN A;  3MHS D;  5LLI A;  5IAA C;  2H88 B;  2JZZ A;  1E8W A;  1QF6 A;  3JVZ X;  1N61 A;  2I1J A;  4C7Y A;  1HEZ E;  1BML C;  2KMC A;  4PYU A;  3DBR I;  3RT3 B;  2PE9 A;  4IWQ A;  5CTR C;  4GDL A;  3MC0 B;  1HQR D;  4KKJ A;  2QSD A;  1NI2 A;  5D94 A;  3DDC B;  4RGN A;  4USA A;  4ICV A;  1A5R A;  4GDL B;  1WGK A;  2KLG A;  3IT4 B;  1YX5 B;  4CO7 A;  3AV8 A;  1OEY J;  2DZK A;  3O13 A;  3GE8 C;  1GC7 A;  1WMH A;  2MBO A;  2MEK A;  1KTK A;  1AWD A;  3APC A;  1F1H A;  3H6N A;  2AX5 A;  2L05 A;  4XC2 A;  4J3O D;  2RPV A;  5D6J B;  1WYW B;  4A3P A;  4LCD E;  2KMM A;  2LRU A;  2DLB A;  4DQO C;  1FXI A;  2A5U A;  3BVZ A;  3VTW A;  2NBW B;  2CS4 A;  1HE8 A;  2NMQ A;  1YMH E;  2ZPY A;  4ZRJ A;  2KDB A;  1PGA A;  3RNE C;  3KWV A;  4OZC A;  1UGJ A;  1MG4 A;  2JYT A;  2L1A A;  4W9L A;  4K7U A;  1LFD A;  1JRP A;  2A4Z A;  2KVZ A;  4XDD A;  4HLE A;  2PPH A;  3QC8 B;  2DNF A;  4RM9 A;  4W9D A;  2JXT A;  4W9I A;  1KRH A;  4ZRP A;  1YNT E;  2KTF A;  3RZW C;  3ZTD A;  4KSL C;  2NR2 A;  4G11 A;  2B76 B;  4BBN C;  5BMH A;  2DZM A;  1EF5 A;  3NS8 A;  4OVV A;  2L32 A;  3ML8 A;  5GXG B;  1P0R A;  1R4M B;  5JHB A;  2J52 A;  1TKE A;  2INC C;  4FHK A;  5BMG A;  3N1Y C;  4RGO S;  3ZIM A;  4TMA B;  2G4D B;  4C7Z A;  3PPA A;  1GPX A;  4F1S A;  1E8X A;  2PMV A;  4LNF A;  4S0R A;  1BXT A;  2FE8 A;  2JWU A;  4K3C A;  3KYC D;  4MEL A;  2K6D B;  2KWV B;  5IN7 A;  3KUD B;  2TSS A;  2J0J A;  2B3A A;  3QIJ A;  1FIQ A;  1GB1 A;  1SIJ A;  1Y8R C;  1CMX B;  1R4N B;  1GUA B;  3J9C A;  4P7I A;  3U8Z A;  3ENE A;  2MJD A;  3ECI A;  4WWP A;  4EOY A;  1NDD A;  2LVQ A;  4KIK B;  2ZNV B;  1D3Z A;  2IO1 B;  1TZO A;  2LXC A;  2ZW1 A;  1UWM A;  4P16 A;  5AEK B;  1FPY A;  2CHX A;  3EFU A;  1AW7 A;  3DHI C;  4GXB A;  1YN4 A;  3OWE B;  1GC6 A;  1E8Z A;  4LDT B;  1R7S A;  5LXI B;  5J18 A;  5D7G A;  1N60 A;  2DWQ A;  1FFV A;  4YTP B;  4BVU C;  3UGB B;  1WXS A;  3IAS 1;  1CJE A;  1J7A A;  1IPG A;  1GAQ B;  1OGW A;  1V5O A;  3AMZ A;  2N1W A;  3ZXV A;  4MGI E;  4B0E A;  1E7V A;  5TR5 A;  2NVU I;  4M0W A;  2K25 A;  2R2Q A;  1PFD A;  2FBW B;  4IM2 A;  5CHW A;  1E9M A;  2KD0 A;  1WE6 A;  3R2I A;  3ZO5 B;  1FCC C;  1WM2 A;  3PRM B;  3APD A;  2DAF A;  4EE2 A;  2X8X X;  2DZI A;  4W9H A;  3HM6 X;  3RZF A;  4JIO U;  4NQK E;  3UIN B;  3QK0 A;  1B1Z A;  4GMV A;  3X23 A;  2CHW A;  3DBH B;  4NAW B;  3AEB B;  1V1P A;  4ZHP A;  2AYO B;  3Q2A C;  4HPM B;  1E0Z A;  1TKG A;  3RUL A;  4IWO A;  2L76 A;  2W54 A;  3L54 A;  4KGT A;  4N9F 4;  3AED B;  2IJ0 A;  1FXT B;  2FCQ A;  1H8C A;  4FUL A;  1WH3 A;  1TT5 B;  3P42 A;  1WFY A;  3GOE A;  3GS2 A;  1UH6 A;  2HE7 A;  3AE2 B;  2J7Q B;  2BYE A;  2MW5 A;  1E5W A;  2M0X A;  4MJS A;  2BF8 B;  2VZK B;  3PVL A;  1VLB A;  2KX3 A;  1JAL A;  2DYM A;  4MJS B;  5IA7 A;  1YD8 U;  1YJI A;  3U4E G;  3WAL A;  2JRI B;  3E56 A;  4NJC A;  1L0X B;  2IGG A;  5EDS A;  2K8H A;  3BK1 A;  1WWT A;  1FNU A;  3BZD B;  4W9F A;  3SDL C;  1C4C A;  4RMA A;  1WZ0 A;  4RM8 A;  4PS8 A;  4K7W A;  3I63 C;  3SR6 A;  2JT4 B;  2JRH A;  2WXP A;  3NVZ A;  4FXC A;  1E90 A;  2IGD A;  2G45 B;  1L6V A;  2V3S A;  3L0W B;  3W5V B;  4BKG A;  4GGQ A;  3Q3N C;  2KLC A;  1MPE A;  3Q8B A;  2KVR A;  3T8M A;  3V05 A;  4IUM B;  2I38 A;  5EE0 A;  2JF5 A;  4CHK A;  3N1X C;  3ZW3 A;  3ZRF A;  3Q3F A;  5G5G A;  4J6I A;  5JXV A;  2UWQ A;  3AI5 A;  4MM3 B;  2M17 A;  1TZ1 A;  4A9A A;  5L83 A;  4DK5 A;  4DHJ D;  1C78 A;  4YSY B;  2AWT A;  3UI3 A;  2E6X A;  4WQO B;  2FCN A;  2NPT A;  4JWU C;  4LJO B;  1EU3 A;  3MP9 A;  1V81 A;  2MJE A;  3EEC A;  2LRW A;  2IY1 B;  3QX1 A;  4D2K A;  5BYS A;  4ZDV A;  2FUH B;  3DBR B;  1V9J A;  3T3O A;  3Q8F A;  1A70 A;  3I3T B;  3HHM A;  3ZNI D;  4OVU A;  2KK8 A;  4DXF A;  3FAH A;  1FO4 A;  5G2N A;  1VZ6 A;  1PUT A;  4G0N B;  1XT9 B;  1TY0 A;  2XBB C;  3UIP B;  2RD0 A;  2HJ1 A;  3LYY A;  1YQB A;  3HK0 A;  1YJ1 A;  1VRA B;  2L00 B;  4RF1 A;  1C4P A;  5H92 C;  1GB4 A;  3FIL A;  3O65 B;  3DWM A;  3BIN A;  3V3X A;  4HEA 1;  3GP7 A;  3FIL B;  1EO6 A;  2KT7 A;  3ZNZ B;  2C9W B;  4URK A;  5LXH A;  2LUM A;  4C4V A;  1MHH E;  3D32 A;  5C2T B;  3U7Z A;  3Q8C A;  1VZ8 A;  4C4V B;  3AU5 A;  1G6J A;  2KFK B;  3B0A A;  1VZ7 A;  1EUV B;  4LK0 M;  3QQ8 B;  3L4P A;  3VR9 B;  5HHD G;  4M01 A;  4MH0 E;  2JQR B;  2AL6 A;  4WWO A;  1FNV A;  1QKZ A;  2LZ6 A;  2J42 A;  4KVG B;  5E6J A;  3MC9 A;  3RN9 C;  4B6W A;  2DZJ A;  2YEP F;  2WX0 A;  1I4X A;  2LD9 A;  2JUO A;  2QMT A;  3PZ7 A;  1OEY A;  1XO3 A;  2D3G A;  4WWN A;  5L95 C;  3L08 A;  3HRD D;  3WAO A;  4MGZ E;  4L1B A;  3BYT B;  3N20 C;  4A3O A;  2PEA A;  3C8Y A;  3PLV A;  3KYD D;  3V6C B;  2WHI A;  3Q3O C;  2SEB D;  2QIL A;  1OQY A;  2H89 B;  2WXK A;  2J0K A;  1QQR A;  1FCL A;  5JZE B;  3TEY A;  2K9X A;  4QAY A;  3PZ8 A;  3CF6 E;  2GBN A;  1WRD B;  1SF0 A;  2W55 A;  2O2V B;  4ZRI A;  3ZJV A;  3AE8 B;  1RWS A;  4MAC A;  1WXM A;  3GZN I;  3VUW A;  4E3C A;  1J0G A;  3VDZ A;  5D3D A;  2IDY A;  4C80 A;  1YOV B;  2D11 A;  5IKC M;  5KHQ A;  1AN8 A;  2KTR B;  1JWA D;  3P2B A;  3C0R B;  1QT9 A;  3KUC B;  4R3D A;  1M94 A;  3IG3 A;  2W3S A;  1HA5 A;  3AEG B;  3TEZ A;  2KKC A;  2LUE A;  4YSX B;  1JWB D;  4PS7 A;  4XZ4 A;  2KN5 A;  3H8H A;  1L4Z B;  2ACZ B;  2IPK D;  3RYT A;  2D07 B;  4OHJ A;  4LNI A;  1KJT A;  4RH6 A;  4HVB A;  2G1E A;  2VH2 A;  3QJZ A;  3I57 A;  2ZJD A;  4FHJ A;  2LMC A;  4IWP A;  1TS3 A;  1EF1 A;  5GMV A;  1ESF A;  1P9D U;  5FR3 A;  2YLM A;  1ZGU B;  2JPH A;  1EU4 A;  2Z0E B;  5DPW A;  5KHO A;  4F8C B;  1IBX A;  3KH0 A;  2GBJ A;  4JWS C;  3VRB B;  2JYE A;  1Z5S B;  1QZE A;  2IGH A;  3W9C B;  1TGZ B;  2DBY A;  1XCQ L;  3CIR B;  1K52 A;  1AYF A;  1L2N A;  1NVI D;  4WAA A;  1N62 A;  1L7Y A;  1D4B A;  2DAJ A;  4REZ A;  3EHV A;  2N7E A;  3AUL A;  2N9E B;  3B08 A;  4HDO A;  3UQA A;  2N9P C;  1MI0 A;  1WX9 A;  2MCN B;  1KLU D;  2FNJ B;  1T0Y A;  2CKH B;  2MRP A;  4I6P A;  3TEW A;  2JZ3 B;  1YX6 B;  5E6O A;  2FID A;  3SU8 X;  1V97 A;  2KMA A;  1P3Q U;  1ET6 A;  2BYV E;  2WXL A;  3BK2 A;  4ICU A;  2LEK A;  4P1B C;  2PVG C;  4E74 A;  2G4S A;  1UBQ A;  1MG8 A;  3A9K A;  3HUI A;  2ZCC A;  1UBI A;  3ZUN A;  2KAC A;  3PSE B;  3A9K B;  1I42 A;  3AEA B;  2XN9 C;  2K0P A;  4Q2J A;  1XF5 L;  2KX0 A;  3CST A;  3N9Y C;  1UEL A;  2ZZP B;  3AE7 B;  1I4G A;  1IGD A;  2NTS A;  4A90 A;  3DWG C;  4AQ7 A;  4M02 A;  1NEN B;  2WU2 B;  1WJU A;  2MWS B;  4JQW C;  2IO0 B;  2RDH A;  5I4D A;  1CZP A;  2WNM A;  2WLB A;  4DDI D;  1WIA A;  4W9C A;  5G5H A;  2GBR A;  2MBH A;  4WJP A;  3AEE B;  3RPF C;  3V61 A;  5J17 A;  3M63 B;  2GRI A;  1WXA A;  3ONS A;  3DCG A;  3P4R B;  3OAW A;  1IYF A;  4LJP B;  3AE5 B;  1TKY A;  2MBQ A;  2OOB B;  2WXJ A;  4ITK A;  4O1N A;  2NCN A;  3OJ4 B;  1ZXI A;  2BWF A;  3TBL D;  4GN1 A;  4US9 A;  2V3N A;  4BKT A;  3N1Z C;  2BYT A;  3DQV A;  3L13 A;  3PHX B;  3IXS A;  5BYQ A;  3IAM 1;  2AQ2 B;  4MGY E;  2O6V B;  4RFB A;  5JHA A;  1ACC A;  3PZD A;  3R7R A;  2XNA C;  3Q6B A;  2PVO D;  3OG5 A;  1ZDV A;  4AOF A;  4XWW A;  1WGR A;  2EMT A;  2N0S B;  4KIK A;  3DVN U;  4ZRQ A;  3H7S A;  2ICI A;  3ZVV A;  2K5P A;  3CMM B;  3NG0 A;  4W9J A;  1RRB A;  2UU7 A;  3NUH B;  1WRI A;  5DPT A;  2E3T A;  3HVD A;  5AUK A;  3B1L X;  2GBM A;  3EUB 2;  4AS1 A;  1K8R B;  4K7S A;  5DPR A;  1NI3 A;  1K51 A;  2YEP B;  3P4P B;  4KSK C;  2X38 A;  1NYR A;  2EEL A;  1DOI A;  4KDL B;  1TS2 A;  2C7N B;  4B0M A;  4S17 A;  1HZ5 A;  2JX5 A;  4C56 C;  1MHX A;  3PV1 A;  3ZNG C;  1F2R C;  2GOW A;  2L3Z A;  4ANU A;  1Q0W B;  4II2 B;  2QHO A;  2HTH A;  2KZR A;  3NOB A;  2M8S A;  4ANX A;  4KGS A;  2LGS A;  1ET9 A;  4IKG A;  3B2F A;  3SFE B;  1FNW A;  2KOX A;  3K9O B;  2WDT B;  1NBF C;  3S2A A;  2LJI A;  2BPS A;  2NBV B;  3Q14 C;  4TSS A;  2EKI A;  2JU6 X;  3PRZ A;  1PQS A;  2MP2 A;  5D3I B;  3SD5 A;  4KZC A;  2N7J A;  4NAW A;  3A1Q A;  3ZDM C;  3VTU A;  2MP2 B;  3GE3 C;  3EGR A;  1YIW A;  2WX1 A;  2BKF A;  1IGC A;  1PDX A;  2V1Y A;  3U2S C;  3PRP B;  3A1Q B;  1CQV A;  3P4S B;  2ZPN A;  3MC8 A;  2ZNV C;  3MJW A;  4RCO A;  1J19 A;  1KF6 B;  1UD7 A;  4LNN A;  2KN4 A;  2Z8L A;  3KQ4 A;  3ZRC A;  3R66 C;  2FIF A;  1ROE A;  4HCN B;  4I6N B;  1Q5W B;  2N7D A;  1J8C A;  4IW0 A;  4RF0 A;  4ARI A;  2PTL A;  1FFU A;  4IOI E;  3TIX A;  4US8 A;  1GG3 A;  3ZNH B;  3GZN B;  4TUU A;  4IM3 A;  1QOG A;  4HKZ E;  1N6Z A;  4NPN A;  3JSV A;  2KWD A;  4TV3 A;  1UGM A;  4WWM A;  2WXI A;  2BBC A;  1L0Y B;  4TQ0 A;  1P7F A;  3MTN B;  3VH3 B;  1YN5 A;  1XQQ A;  4MT5 A;  2L83 A;  3JSV B;  2WXN A;  4YXD B;  2C7H A;  1TBE A;  2WXQ A;  4YWG G;  1ZE3 D;  3L10 B;  2INP E;  4PYZ A;  5TSS A;  1E6E B;  2BW2 A;  2QC8 A;  2WDV B;  3NJT A;  1C3T A;  2V4I B;  2KAN A;  3KWL A;  3U7D A;  1WGH A;  3I9V 1;  1KLG D;  4BBN F;  3N32 A;  5HKH A;  1HTQ A;  1BUI C;  4GDK B;  5AZH A;  1E10 A;  4XX5 A;  3AEF B;  1JRO A;  1TIF A;  3KVF B;  1GNU A;  1T0Q C;  2ZVN A;  1DOX A;  1SIF A;  3ZGZ A;  1PGX A;  2JVC A;  4MM3 A;  2BS4 B;  1MFW A;  5FR6 A;  5AZG A;  1S1Q B;  2C7M B;  4FJY A;  1WZ3 A;  3IT6 B;  2MSE D;  1UNS A;  2G3Q B;  1WGG A;  1SE2 A;  1TS4 A;  1V86 A;  3P4Q B;  3ZKJ C;  4A8X C;  1U4A A;  4LLG M;  3DPD A;  2INN E;  4IG7 B;  3H9D A;  4HRO A;  2LGI A;  3U52 E;  1FEH A;  3VUY A;  4BAX A;  1V2Y A;  3OJ3 A;  2BTE A;  3B2G A;  2W9N A;  4LDT D;  3KUZ A;  3RUI B;  5EE9 A;  2G9H D;  5FKA C;  3RNF C;  5J2R A;  3APF A;  2CU3 A;  3M3J A;  4HDQ A;  1WSP A;  3EFC A;  1RAX A;  2YVC A;  1WM3 A;  4GSW A;  1QOB A;  4HJG E;  3P63 A;  3SFD B;  1KOT A;  1KFY B;  3ZJT A;  5IP4 D;  2BB6 A;  2XK5 B;  1PYW D;  2KQ7 A;  1ZUD 2;  1D6E C;  3AE4 B;  3BY4 B;  2KDI A;  2K6Q A;  2ASQ A;  4E71 A;  2ZCB A;  3H1U A;  1LQB A;  4FA6 A;  3NZ3 A;  4W9K A;  2C60 A;  2ON8 A;  1S3S G;  3SHQ A;  1YQ4 B;  4NJ6 A;  3TCA A;  1RYJ A;  4ACF A;  2MA9 B;  1B9R A;  3NY5 A;  2KFK A;  4N58 A;  1ZKH A;  3A4S C;  3WAM A;  1FRD A;  4KGR A;  3DHH C;  1DGJ A;  2BB5 A;  2IO2 B;  2RR9 A;  3PGE A;  3IHP C;  1UF0 A;  1WGY A;  4HPL B;  1WXQ A;  1ZXH A;  2BKR B;  1WR1 A;  2KQ4 X;  4RGM A;  2Y5P A;  1WJ4 A;  4KV2 A;  2WXR A;  2KWC A;  1WX8 A;  3DVG Y;  2WYQ A;  2K39 A;  1FD6 A;  3PTF C;  4DHZ B;  1EM7 A;  3A4R A;  1XXG A;  4OZA A;  3VXW A;  3DBS A;  3TUO A;  3KLS X;  2M19 A;  3DOW A;  1RFK A;  4G50 A;  4A6Q A;  3IVF A;  2I1K A;  3MFG A;  3WAP A;  3ZYY X;  3U30 A;  2IY0 B;  4ANV A;  3ZQ4 A;  3DBH I;  3W1S A;  1V49 A;  5JH5 C;  4ZRK A;  3Q8E A;  1I4Q A;  2O2V A;  3K9P B;  1L6U A;  4HWI B;  4AWJ A;  2PKO A;  2VZK D;  4RNA A;  4N59 A;  4FBJ B;  3IFW B;  2KTR A;  2WP9 B;  1F77 A;  2IZV B;  2HD5 B;  1YJJ A;  4TQ1 A;  4KKI A;  3BVM A;  3RCZ A;  1JML A;  2BT6 A;  1T5X D;  1MVK A;  2KDM A;  1NEK B;  3VTV A;  2K3U A;  4PS3 A;  2J53 A;  1UZX B;  3Q8A A;  1F0Z A;  1JWU D;  3LDZ E;  4M8M A;  2HTM E;  3DVN V;  1YQ3 B;  3CSF A;  1LO5 D;  1P7E A;  3N30 A;  4M8N A;  1JCK B;  1H4R A;  1XEE A;  1F9J A;  4JPS A;  3NZU A;  1STE A;  3NRZ A;  4F7Z A;  2LFI A;  3BII D;  3BVG A;  1WJN A;  3M95 A;  2M56 B;  2AEH A;  4NQL B;  5BYR A;  4HXD A;  2M0A A;  1E7U A;  1V5T A;  2L7R A;  2DYO A;  2LVO A;  2AQ3 B;  2KC1 A;  2D2Q A;  2GMI C;  2C5L C;  1ZDX A;  1JWS D;  5C3J B;  1EWC A;  3QHT A;  4UDU C;  1VJK A;  3QA8 A;  3ML9 A;  1P98 A;  5HI1 A;  1WR6 E;  1HTO A;  2V4L A;  4XWT A;  4CYE A;  4B95 A;  3QWZ B;  1VDV A;  1WF9 A;  3UF8 A;  3JW0 X;  3W1Y A;  2QJL A;  4NZL B;  4GIV A;  4EFO A;  3DVG X;  1OQR A;  3CWI A;  3PT2 B;  3H7P A;  2LHE A;  1LM8 B;  1KLV A;  1FMA D;  1JW9 D;  2BS2 B;  2CHZ A;  1L5P A;  5C23 A;  2ZEQ A;  3H7P B;  3L17 A;  3P1M A;  4LNO A;  2J4X A;  2GB1 A;  4FN2 A;  1VCB A;  3NZS A;  1JRU A;  2Y5B B;  3MHZ A;  4C00 A;  1N63 A;  3PO0 A;  4NJ7 A;  1ISN A;  2XEW A;  5E6N A;  2RPQ A;  4B9K A;  4BOZ B;  5CHF A;  3QAQ A;  2KNB A;  2NBU A;  2Y5C A;  4P1C C;  4XE0 A;  4MDK E;  4PT5 A;  2RDG A;  2PIA A;  1ZP0 B;  1WMH B;  4H2A A;  2N1V A;  3M62 B;  3URY A;  4EEW A;  1WYG A;  3PRE A;  4DDG D;  4WJO A;  2FCM A;  4YT0 B;  4KX6 B;  4WH4 A;  3Q3M C;  3ETR A;  4BKS A;  2OJW A;  2MH7 A;  1XLP A;  3QAR A;  5HG2 A;  2ZVO A;  2PLP A;  3Q3J A;  4CQN A;  1SJH D;  5C1Z A;  3WCQ A;  4WQM A;  2O6V A;  4GLS C;  1T0R C;  1WXV A;  1OFF A;  1TYG B;  3RNA C;  4GOC A;  4XDC A;  4AP4 C; 
#chains in the Genus database with same CATH homology
 3UQB A;  4HJK A;  2L00 B;  3EC8 A;  3VFK A;  1V6E A;  3TIX A;  2IBI B;  4DBG A;  2LGY A;  3O65 B;  4IC7 B;  2PE6 B;  4IM0 A;  1GG3 A;  2IO3 B;  3ZNH B;  3BIN A;  4TUU A;  4IM3 A;  5D2M B;  1X1M A;  1EO6 A;  3W1S C;  4HK2 A;  4NPN A;  3JSV A;  4TKN A;  3ZNZ B;  2C9W B;  4URK A;  5LXH A;  4TV3 A;  1UGM A;  5G55 A;  2IYD B;  4EZJ A;  3D32 A;  4I6L B;  4TQ0 A;  3MTN B;  3VH3 B;  1XQQ A;  1E8Y A;  1RFA A;  3PS6 A;  3JSV B;  3V62 A;  2LJ5 A;  2M1M A;  2KJR A;  3AU5 A;  4A20 A;  1G6J A;  2KFK B;  4DHJ B;  2C7H A;  1TBE A;  3B0A A;  1EUV B;  2K8B A;  2PJH A;  4W9G A;  4KDI C;  2JWZ A;  1WE7 A;  2KDE B;  3MHS D;  3QQ8 B;  5IAA C;  3L10 B;  5LLI A;  2JZZ A;  4MH0 E;  4PYZ A;  2GBK A;  2AL6 A;  4WWO A;  1E8W A;  2KHW B;  3JVZ X;  2I1J A;  2CU1 A;  2LZ6 A;  4KVG B;  1IP9 A;  5CX3 A;  4B6W A;  1WX7 A;  2DZJ A;  1C3T A;  4MEM A;  2KAN A;  2KMC A;  2WX0 A;  3U7D A;  2LD9 A;  4PYU A;  3DBR I;  1WGH A;  2JUO A;  4BBN F;  1OEY A;  3N32 A;  2D3G A;  2PE9 A;  3RT3 B;  3TL5 A;  5HKH A;  4IWQ A;  5CTR C;  4GDL A;  4GDK B;  5AZH A;  2HJ8 A;  4WWN A;  5L95 C;  3L08 A;  4XX5 A;  1NI2 A;  3WAO A;  5D94 A;  3DDC B;  4MGZ E;  4AJY B;  1BT0 A;  2L0F A;  3KVF B;  1GNU A;  4A3O A;  2PEA A;  4ICV A;  1A5R A;  2ZVN A;  4GDL B;  4WJN A;  2KLG A;  3PLV A;  5DPS A;  1SIF A;  1YX5 B;  3KYD D;  4CO7 A;  2JVC A;  4MM3 A;  3V6C B;  1VD2 A;  1OEY J;  2DZK A;  2MBE A;  1OQY A;  5FR6 A;  5AZG A;  1GC7 A;  1S1Q B;  1WMH A;  2C7M B;  3VH4 B;  2J0K A;  2MBO A;  3AU4 A;  4FJY A;  1WZ3 A;  2MSE D;  4AJW A;  2G3Q B;  1WGG A;  4KZ0 A;  3APC A;  5JZE B;  1SE9 A;  3H6N A;  2UYZ B;  2L05 A;  4NY0 A;  4XC2 A;  1V86 A;  2KWU B;  3CF6 E;  5D6J B;  1WYW B;  2GBN A;  4A3P A;  3ZKJ C;  4HCP B;  1U4A A;  1WRD B;  4LCD E;  2LRU A;  2O2V B;  3QCA A;  4ZRI A;  2A5U A;  3VTW A;  3R3M A;  3VVW B;  2NBW B;  2CS4 A;  1HE8 A;  1WXM A;  3GZN I;  3DPD A;  2ZPY A;  4ZRJ A;  3VUW A;  2KDB A;  4IG7 B;  4E3C A;  3DBL I;  4M0W B;  3H9D A;  1J0G A;  4II3 B;  2DHZ A;  3VUY A;  3VDZ A;  1V2Y A;  4YL8 A;  2D11 A;  4W9L A;  4K7U A;  3OJ3 A;  1LFD A;  2KJH B;  1Q1O A;  2A4Z A;  5KHQ A;  2W9N A;  2KTR B;  4HLE A;  2PPH A;  3QC8 B;  4FAD A;  3P2B A;  3C0R B;  4LDT D;  3WA0 A;  3KUZ A;  3RUI B;  1I35 A;  4RM9 A;  3KUC B;  1M94 A;  4W9D A;  3IG3 A;  2BYF A;  3VHT C;  2LVP A;  2KKC A;  4W9I A;  5J2R A;  3APF A;  2LI5 A;  2LUE A;  2KTF A;  3RZW C;  3ZTD A;  4KSL C;  2NR2 A;  4PS7 A;  3M3J A;  4G11 A;  4HDQ A;  4XZ4 A;  4BBN C;  2KN5 A;  2MQJ A;  2DZM A;  1EF5 A;  3HIZ A;  2KQS A;  3NS8 A;  1RAX A;  2YVC A;  4OVV A;  3RYT A;  2D07 B;  3ML8 A;  1P0R A;  1Z2M A;  4K81 A;  1WM3 A;  5JHB A;  1KJT A;  4GSW A;  4FHK A;  2DYB A;  4HVB A;  1KOT A;  3UIO B;  2Z0D B;  2BGF A;  3QJZ A;  3ZIM A;  2ZJD A;  4FHJ A;  4JL9 A;  3V6E B;  2G4D B;  4IWP A;  1EF1 A;  2XK5 B;  2LAS A;  3PPA A;  1P9D U;  2KQ7 A;  2N4F A;  5GMV A;  3R7Q A;  2YLM A;  3BY4 B;  2KDI A;  1ZGU B;  4F1S A;  2JPH A;  3WIM A;  2K6Q A;  2ASQ A;  2Z0E B;  2ZCB A;  3H1U A;  5KHO A;  1LQB A;  4E71 A;  1E8X A;  4F8C B;  4W9K A;  3KH0 A;  2C60 A;  2GBJ A;  5DCN A;  4FA6 A;  1Z5S B;  1S3S G;  1QZE A;  3SHQ A;  2LGX A;  4NJ6 A;  3TCA A;  1P1A A;  2Z59 B;  1TGZ B;  3KYC D;  2K6D B;  1WI0 A;  2KWV B;  2VRR B;  2MA9 B;  4MEL A;  3KUD B;  3NY5 A;  2KFK A;  2J0J A;  1GJZ A;  2B3A A;  1L2N A;  1ZKH A;  2KO3 A;  3QIJ A;  3A4S C;  4WAA A;  3WAM A;  1Y8R C;  1CMX B;  1L7Y A;  1D3Z A;  1GUA B;  2IO2 B;  2RR9 A;  3PGE A;  3IHP C;  4P7I A;  2DAJ A;  4HPL B;  1WGY A;  3EHV A;  3U8Z A;  3ENE A;  2N7E A;  4MSQ B;  2BKR B;  1WR1 A;  3ECI A;  4WWP A;  4EOY A;  1NDD A;  2LVQ A;  3AUL A;  4KIK B;  2N9E B;  1WJ4 A;  2IO1 B;  2ZNV B;  3B08 A;  4HDO A;  2LGD A;  4JLC A;  4KV2 A;  3UQA A;  2LXC A;  2N9P C;  1WX9 A;  2KWC A;  2MCN B;  2FNJ B;  2OJR A;  1T0Y A;  1WX8 A;  2WYQ A;  2K39 A;  3DVG Y;  4DXA B;  3X0W A;  3PTF C;  5AEK B;  2CKH B;  2CHX A;  2MRP A;  3EFU A;  4I6P A;  4DHZ B;  3A4R A;  2JZ3 B;  1YX6 B;  4MSM B;  4GXB A;  4GDK A;  5E6O A;  3AXC A;  2FID A;  2BWE S;  1GC6 A;  1E8Z A;  4LDT B;  3DBS A;  3VXW A;  4ANW A;  3SU8 X;  2KMA A;  1P3Q U;  2BYV E;  3DOW A;  4G50 A;  4BKS D;  5LXI B;  4ICU A;  5J18 A;  4G3X B;  5D7G A;  2JXX A;  3LJ3 A;  4E74 A;  3IVF A;  2G4S A;  1UBQ A;  1MG8 A;  2I1K A;  3A9K A;  2KXJ A;  3WAP A;  4DWF A;  3U30 A;  2IY0 B;  4BVU C;  2ZCC A;  3UGB B;  2KDF B;  1UBI A;  1WXS A;  4ANV A;  3ZUN A;  3DBH I;  3W1S A;  3ZDT A;  2O6V D;  5E6P A;  4MGK E;  3PSE B;  2WWZ A;  3A9K B;  1IPG A;  1OGW A;  1I42 A;  1V49 A;  5JH5 C;  1V5O A;  4ZRK A;  2KX0 A;  3N3K B;  3CST A;  2N1W A;  1R4M I;  2O2V A;  3K9P B;  1UEL A;  2ZZP B;  4HWI B;  4MGI E;  4AWJ A;  1E7V A;  5TR5 A;  2NVU I;  3VAW A;  4WJQ A;  2K25 A;  2JY6 A;  4AUQ C;  2R2Q A;  4NNJ B;  4IM2 A;  4FBJ B;  1WJU A;  3IFW B;  2KTR A;  2KC2 A;  2L8J A;  5CHW A;  3A33 B;  2KD0 A;  2MWS B;  4JQW C;  1C1Y B;  1WE6 A;  3V60 A;  2N9X A;  2IO0 B;  3ZO5 B;  1WM2 A;  3PRM B;  2IZV B;  1LXD A;  3APD A;  2HD5 B;  2DAF A;  4DHZ E;  4TQ1 A;  4ASW C;  2J0M A;  2KJ6 A;  1OTR B;  4DDI D;  2MBB B;  2DZI A;  4W9H A;  3RCZ A;  1R4N I;  1WIA A;  3HM6 X;  4W9C A;  3RZF A;  4JIO U;  4NQK E;  2GBR A;  3UIN B;  3QK0 A;  2MBH A;  4GMV A;  4WJP A;  3X23 A;  3VTV A;  5DPW A;  2CHW A;  4NAW B;  4EZL A;  3V61 A;  4PS3 A;  5J17 A;  3M63 B;  1WXA A;  2NPT B;  1UZX B;  1RLF A;  3ONS A;  3DCG A;  2AYO B;  2REX A;  3OAW A;  3LDZ E;  4M8M A;  3DVN V;  4HPM B;  1IYF A;  4LJP B;  2XK5 A;  3RUL A;  2MBQ A;  3CSF A;  4IWO A;  2OOB B;  2L76 A;  3N30 A;  2NCN A;  4ZYN A;  3OJ4 B;  3L54 A;  4M8N A;  1H4R A;  4N9F 4;  4FJZ A;  2BWF A;  1F9J A;  3TBL D;  4GN1 A;  2K1F A;  3NZU A;  4BKT A;  1FXT B;  2FCQ A;  3DQV A;  3L13 A;  3PHX B;  4FUL A;  4F7Z A;  1H8C A;  3ZTC A;  1WH3 A;  1WJN A;  1WFY A;  4MGY E;  3M95 A;  3RD2 A;  2AEH A;  2O6V B;  1SGH A;  2RGF A;  3GOE A;  4HXD A;  4NQL B;  2FCS A;  1E7U A;  5JHA A;  1UH6 A;  3PZD A;  3R7R A;  2HE7 A;  1V5T A;  2L7R A;  2DYO A;  2LVO A;  2KC1 A;  2J7Q B;  3T9L A;  1WGR A;  2EMT A;  2D2Q A;  2GMI C;  4AOF A;  4KIK A;  1ZW7 A;  2BYE A;  2C5L C;  1E5W A;  2MW5 A;  3DVN U;  3H7S A;  3NHE B;  2M0X A;  4MJS A;  3QHT A;  2BF8 B;  2LXA A;  1WJ6 A;  4BOS C;  2DEN B;  5CHV C;  3PVL A;  2LWP A;  3QA8 A;  3ML9 A;  1P98 A;  3ZVV A;  1V80 A;  1WR6 E;  2KX3 A;  4GB9 A;  3CMM B;  2DYM A;  4W9J A;  4MJS B;  1RRB A;  1XD3 B;  2V4L A;  3PLU A;  3IBE A;  5IA7 A;  2DX5 B;  5DPT A;  1YD8 U;  2EKE C;  5BO4 B;  4CYE A;  3B1L X;  3WAL A;  2GBM A;  4B95 A;  2JRI B;  3TMP B;  1K8R B;  3QWZ B;  4K7S A;  1WF9 A;  3UF8 A;  3JW0 X;  5DPR A;  3VUX A;  2MX2 A;  5EDS A;  2K8H A;  3OLM D;  4KSK C;  3W1Y A;  4EUT A;  3KW5 B;  4GIV A;  3JYU A;  4EFO A;  3ZLZ A;  2D10 A;  3DVG X;  4W9F A;  3SDL C;  4X57 B;  4KDL B;  2C7N B;  3PT2 B;  3L16 A;  4RMA A;  2K8C A;  3H7P A;  3PV1 A;  3ZNG C;  1LM8 B;  3WAN A;  1WZ0 A;  4RM8 A;  2GOW A;  1KLV A;  2CHZ A;  2FAZ A;  5C23 A;  4PS8 A;  4K7W A;  2L3Z A;  1TTN A;  2KFJ A;  2ZEQ A;  3H7P B;  3L17 A;  4ANU A;  1Q0W B;  4II2 B;  2JT4 B;  2QHO A;  2HTH A;  4FN2 A;  1VCB A;  2JRH A;  2KZR A;  3NOB A;  3NZS A;  2M8S A;  1JRU A;  4ANX A;  2Y5B B;  1E90 A;  2G45 B;  3L0W B;  2V3S A;  4BKG A;  2CR5 A;  4GGQ A;  2KLC A;  2KVR A;  4W9E A;  2KOX A;  2M4N A;  3K9O B;  3T8M A;  4NJ7 A;  2WDT B;  1ISN A;  2XEW A;  5E6N A;  4IUM B;  1NBF C;  2NS5 A;  4JGH B;  2JF5 A;  3S2A A;  4CHK A;  2BPS A;  3ZW3 A;  1AAR A;  2RPQ A;  2NBV B;  4B9K A;  4BOZ B;  1WGD A;  2R2O A;  3ZRF A;  3Q3F A;  5CHF A;  3QAQ A;  2KNB A;  4J6I A;  3PRZ A;  1PQS A;  2NBU A;  2MP2 A;  2UWQ A;  3AI5 A;  2M17 A;  1TZ1 A;  4MDK E;  5L83 A;  4DK5 A;  3SD5 A;  4KZC A;  3A9J A;  4FJV B;  4NAW A;  1WMH B;  4DHJ D;  3A1Q A;  3ZDM C;  2AWT A;  2N1V A;  4WQO B;  3M62 B;  1KM7 A;  3VTU A;  2RSU A;  2FCN A;  2NPT A;  2MLB A;  2MP2 B;  4LJO B;  1YIW A;  2EMS A;  4EEW A;  2WX1 A;  2AL3 A;  3PHW B;  3PRE A;  4DDG D;  1V81 A;  2BKF A;  3EEC A;  2LRW A;  2IY1 B;  3A9J B;  4FLH A;  4WJO A;  2V1Y A;  3PRP B;  3A1Q B;  2FCM A;  3QX1 A;  4ZDV A;  2FUH B;  3ALB A;  1V9J A;  2L0T A;  2ZPN A;  4K1R B;  3VQI A;  2ZNV C;  4BKS A;  3MJW A;  3I3T B;  3HHM A;  3ZNI D;  1J19 A;  4OVU A;  4BFR A;  4GU2 A;  4EKU A;  2KK8 A;  1UD7 A;  3QAR A;  2ZVO A;  3Q3J A;  5G2N A;  3HM3 A;  1WY8 A;  4G0N B;  3ZRC A;  5C1Z A;  3R66 C;  1XT9 B;  2FIF A;  2XBB C;  3UIP B;  4EZK A;  2O6V A;  2RD0 A;  1WXV A;  4HCN B;  3TJP A;  4I6N B;  1Q5W B;  2N7D A;  5AZF A;  4GOC A;  1J8C A;  4IW0 A;  1YQB A;  3HK0 A;  1YJ1 A;  4AP4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...