3GE8C

Toluene 4-monooxygenase hd t201a diferric, resting state complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Role for threonine 201 in the catalytic cycle of the soluble diiron hydroxylase toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 25
structure length 82
sequence length 82
chains with identical sequence G
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2009-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3ge8C00
3RN9C 3DHIC 3RNGC 2INDC 1T0RC 3RNFC 3N1XC 3I5JC 3I63C 3N1YC 3RMKC 3Q3NC 4P1BC 3RNEC 1T0SC 3GE8C 3RNAC 3Q3OC 3N20C 3Q14C 3RNBC 3Q2AC 3N1ZC 3DHGC 3DHHC 3GE3C 1T0QC 3RNCC 4P1CC 3Q3MC 2INCC 3RI7C 2RDBC
chains in the Genus database with same CATH superfamily
4PK1A 2LD9A 3L10B 3PGEA 5LXIB 2K5PA 3H7SA 3Q8EA 1HA5A 1LQBA 4P6VF 4M8MA 1PFDA 2CU3A 2J7QB 2QC8A 4PS3A 2Q5WD 2WXMA 1YX6B 3Q8CA 1HZ5A 3A9JA 1AN8A 4YWGG 1I4XA 1HXYD 2OOBB 2C9WB 4ARCA 1J7AA 5AZFA 4BAXA 1VJKA 1EU4A 3ML8A 5H92C 3V61A 1FNWA 3A9JB 4AQ7A 2I1JA 4FA6A 4MH8A 4FBJB 1EM7A 2YEPB 3QCAA 4RMAA 1M94A 3UIOB 1ZE3D 1FD6A 4DHZB 2KWVB 2ZVOA 2KXJA 1C78A 3BVZA 5L95C 4KV2A 4ZOHC 2KQ4X 2MA9B 4MELA 4W9DA 5D6JB 1P0RA 1WXMA 1GC6A 2V9HA 3ZKJC 4NNJB 2M56B 2PKOA 2UU7A 3DVNV 3D32A 2M0XA 3EHVA 3Q3FA 2MW5A 3A9KB 3VVWB 3AE1B 1JW9D 2K8CA 1J19A 1EF5A 2MHJA 5IOIA 2PVOD 5EE9A 2LI5A 5CHWA 4TSSA 4JWUC 4XC2A 2KC2A 5DPSA 3DBRB 2YLMA 2NMQA 2QHOA 2MWSB 4NAWA 3HM3A 4ANVA 2DZKA 1T5XD 2GBMA 3KWVA 2PEAA 5AEKB 1OEYA 4W9IA 2LVPA 1P7FA 2ZNVC 1SJED 1RYJA 4P1CC 4NAWB 2N0SB 2G45B 1UBIA 3QX1A 2DLBA 2ZZPB 3IAM1 3R7RA 3OJ4B 3C8YA 4ZRIA 4ZYNA 4C4VA 3TCAA 1RFKA 1LFDA 3RZWC 1YQBA 3R2TA 3V3XA 5DPRA 4B9KA 1YX5B 1PQSA 2MJEA 2J52A 4LLGM 4DXFA 2L05A 3RFZB 2A5UA 2GMIC 1WJ6A 1WM3A 3IXSA 5JXVA 1UH6A 2PE6B 3U7ZA 3R66C 5C23A 2JXTA 4HROA 4K7UA 4C4VB 1VLBA 2FIFA 1V5TA 5HHDG 3UQAA 4LNFA 2WXNA 2AL6A 4FLHA 2JUOA 1ET9A 5E6JA 4IC7B 2KJRA 1I4GA 2L0FA 3DVGY 2B3AA 2FUG1 1Q0WB 3E9SA 3PTFC 1F52A 2MSED 3DDCB 4MSQB 1KH0A 4BBNF 2PTLA 3APDA 3T3OA 4US9A 3VAWA 3VUYA 3ONSA 4FHJA 3BZDB 4KVGB 3HIZA 4K3BA 2L8JA 3SR6A 1Z5SB 2HTHA 3BK1A 4DHJB 3R3MA 3ZUNA 1RWSA 2L3ZA 2JT4B 3UF8A 2L76A 1B1ZA 3OAWA 1FRRA 4AUQC 1DOIA 2NR2A 3I5JC 1QZEA 3DBLI 4NJ6A 1E8WA 1Q1OA 3EA6A 1D4BA 3L4PA 1C4CA 3ZJVA 1CQVA 2IJ0A 5JHBA 4DWFA 4YTMB 2D3AA 2JQRB 1LXDA 1YIWA 2WU5B 3ALBA 3ZDTA 1E7VA 3WAMA 2KMCA 2QSDA 2LGSA 3W9CB 1K51A 3JSVB 3UQBA 4TQ1A 2WNMA 2GBNA 3A1QA 1HTOA 2PLPA 3X0WA 1WJ4A 4ZRKA 2N1WA 3B08A 3Q3MC 3AEDB 2RPQA 1XQQA 2IYDB 2M0AA 3N1XC 4KSLC 1G6JA 4JPSA 3IT4B 1R4MB 4I6LB 1WE7A 2WQYB 1T6BX 1WWTA 1EF1A 3A1QB 2ZPYA 2O6VA 3RCZA 4YSZB 5J18A 2KC1A 3V6EB 4AJYB 2BQQA 2V3SA 4US8A 2FAZA 2K39A 4II3B 4NAMA 1FIQA 1L6VA 1SF0A 4MEMA 3GE8C 4OVUA 2N9PC 1XLOA 2WLBA 2KNBA 2ZEQA 3PLVA 4FXCA 1OQQA 3LJ3A 2Z0DB 1YD8U 3MHZA 1V81A 2K0PA 2NPTB 1TS5A 1WXVA 3PT2B 1E7PB 3KQ4A 2LGIA 3ZLZA 3L13A 1TKEA 2MLBA 3AEGB 3NRZA 1QLBB 1FXTB 3Q3OC 5G2NA 2N9XA 3WALA 2FIDA 3B2FA 1KTKA 3BYYB 3NS8A 4S0RA 1F1HA 2M4NA 4XZ4A 2C60A 4DDID 3IT6B 4GIVA 3QA8A 1VZ7A 4UDUC 4HRSA 2KFJA 1SJHD 4C80A 1WY8A 3M62B 5I4DA 2JRHA 3L0WB 2ZW1A 2HJ8A 1D5MC 1RM6C 1SE4A 2MBOA 3BY4B 4A20A 2CJOA 4WAAA 2E6XA 1K50A 2GOWA 3TMPB 3C0RB 1JWUD 3AEAB 1WSPA 1TY0A 3N1ZC 4NQLB 1ISNA 1MG8A 3VTVA 4MACA 5CTRC 2A4ZA 2KWUB 2N9KA 4EUTA 3AE8B 2JF5A 4N59A 2YEPF 3VH3B 1CMXB 1RLFA 1WH3A 3TSSA 3O65B 2D07B 4M00A 1IYFA 4RM8A 2BS4B 1QOFA 4ASWC 3IFWB 2KQ7A 2MBQA 1XXGA 3RN9C 1HTQA 1QILA 4A90A 3AE6B 3MHSD 4ZRJA 3HVZA 3TEYA 2BB5A 1UZXB 1J8CA 1UWXA 3SU8X 2D3CA 1WR6E 3B1LX 1WFYA 3OLMD 1IBXA 5H8YE 4WWMA 1T0YA 3GOEA 5C1ZA 3DBHB 4BKSA 2MJ3A 1D5XC 5IO9A 2M19A 2WP9B 2KDMA 3P4QB 3U2SC 4EZJA 2KTRA 1C3TA 3I3TB 3RMKC 3O13A 3DBLB 4YSXB 1YMHE 2Z59B 1VD2A 3ZTCA 3DPDA 4IM2A 5TR5A 2JRIB 3H9DA 4W9LA 1FEHA 2AL3A 3M3JA 2N9LA 3KWLA 4FHKA 4KZ0A 4AJWA 1TT5B 2GB1A 3C19A 4XDCA 4LK0M 1N6ZA 2KTRB 3R2IA 3L08A 1VR9A 3BWUD 3RNFC 1J7BA 3FAHA 2LHEA 4HKQA 2BVCA 2RDGA 1D6EC 3MJWA 1NYRA 4IM3A 3RNAC 4OVZA 2JZPA 1E7UA 1E90A 3AXCA 2XBBC 1NVID 4ZHPA 1WGKA 4MH0E 4RF0A 1WXAA 3NY5A 3ML9A 1A70A 2R2OA 4JIOU 2WXPA 2L00B 1T0RC 1GG3A 2DYMA 1DGJA 4DXAB 4IWOA 1L0VB 2IO0B 5T8IA 4YT0B 2D2QA 3HHMA 3WANA 1N60A 4W9FA 3WCQA 1FXIA 4OW0A 4NJ7A 4HDOA 3VH4B 2AYOB 2KMAA 2UYZB 2V4LA 3KW5B 3HVDA 1C77A 1YN3A 3WAOA 4GDLA 2XN9C 4AWJA 2K22A 4W9EA 2GRIA 2ZNVB 4G0NB 2KT7A 1F0ZA 2FCQA 4ZHOA 3AE3B 3P2BA 5C2TB 3OG5A 4AOFA 1VZ6A 4C00A 3MC9A 4FJZA 3NVZA 5DPTA 4LNNA 1SIFA 1P9DU 1UELA 1N62A 1H4RA 2Y5CA 3JYUA 3I9V1 3QJZA 4DHZE 3TEZA 3QHTA 1EWYC 5E6PA 1DYQA 2HE7A 1YJ1A 3K9OB 1F2RC 4HVBA 3P63A 3ZNGC 3MTNB 2J0MA 1ET6A 4B95A 1GOZA 1I4QA 3NVWA 2WXHA 4A3OA 2DZJA 4MT5A 3L16A 3ZXRA 2KWDA 2J53A 1PYWD 2JVCA 4A55A 2QILA 2Y5BB 3GZNI 5FR3A 2NBWB 3TL5A 3W5VB 4F1SA 3CSFA 2EMTA 1TYGB 2JX5A 3OWEB 1AWDA 3RT3B 5IKCM 3QAQA 4E3CA 2WDQB 5D7GA 2OJWA 5BMHA 4KKJA 4GU2A 3AU4A 2KACA 3BIID 3ETRA 4WWOA 3S2AA 4BOSC 2KDFB 4EEWA 2KO3A 1GB1A 2KOXA 4LTUA 3AH7A 5G55A 2B76B 3ZGZA 3IAS1 1TTNA 2K1FA 4FULA 4KGTA 1S1QB 5BYRA 3ZVVA 3P4SB 2LZ6A 4R3DA 3A33B 2WYQA 3U8ZA 2V4IB 1WJNA 1E10A 2BS3B 3H1UA 1P3QU 2WXJA 4HK2A 2DAFA 2BS2B 1IGDA 3T3NA 4XWTA 2KK8A 1R4MI 3A4RA 3UGBB 3PLUA 2GBKA 4KX6B 3TIXA 1STEA 3A9KA 4XYCA 3H7PA 1J0GA 3DHGC 2E3TA 1UGMA 2X8XX 3UIPB 2PPHA 2RDBC 4WJOA 4FADA 1F77A 4F8CB 4MGIE 3N1YC 4WAFA 2KFKA 4L23A 4BOZB 3H7PB 3U30A 2KVZA 3ZW3A 4A8XC 2EELA 2BYVE 1JRUA 3VHTC 4L1BA 4FJYA 3DOWA 1WZ0A 1TZ1A 4EE2A 4ZRQA 3P4RB 2H88B 2I2YA 4XGAB 1XCTL 2KFKB 3NZ3A 2D3BA 2CHZA 4KGSA 3VDZA 2BKRB 2VH1A 5GMVA 2JXXA 2WU2B 2IGDA 1XLQA 3LYYA 1V80A 1WX8A 2KDBA 2ASQA 4GGQA 1V5OA 5AZHA 2JPHA 2D3GA 3AE9B 1ZDVA 2BB6A 1C79A 2W55A 1V2YA 2PVGC 2W3RA 3VRBB 2KTFA 2ZPNA 4DXGA 3Q3JA 2ON8A 4IWPA 4USAA 1WF9A 3PO0A 4PS8A 3QQ8B 4M01A 2JSVX 4LCDE 5E6OA 5AZGA 1V1PA 2WHIA 5EE3A 3P1MA 4IW0A 2BYTA 4P7IA 1UNSA 3SDLC 4XDDA 4EZLA 4TUUA 3FC4A 3NHEB 4DK5A 1I4HA 1KM7A 2ICIA 1JMLA 2WXKA 2K3UA 5KHQA 2LMCA 2NS5A 1V1PB 2KANA 2MP2A 3SEBA 1F2RI 2MBBB 3ZRCA 4IOIE 2JZ3B 1I4RA 1MJDA 2EKIA 4YTNB 1ZGUB 4LDTB 2ACZB 3VR8B 1FPYA 2L0TA 4IM0A 1KRHA 3T9LA 3PHXB 2NBUA 1K8RB 2DYOA 4FJVB 1RRBA 2ONQA 2D10A 2MP2B 2Z8LA 1XLNA 2JY6A 3VXWA 3CIRB 2ZVNA 4P1BC 3DVGX 1YN4A 1SEBD 1A5RA 1P1AA 3KUDB 3DBHI 2KYWA 5BMGA 2V3PA 2NBVB 5DCNA 3AE7B 4RCOA 3IHPC 3WA0A 4EZKA 2W9NA 2N7DA 2DZIA 2XEWA 3GZNB 4KSKC 3UINB 1VDVA 3JSVA 2OJRA 1FNUA 1TJEA 3ZNZB 2LWPA 1WRDB 2VZKD 1V49A 1IUEA 4B0MA 2MCNB 2MRPA 2RDHA 3DQVA 5D3DA 2HTME 2DYBA 2NTTA 2XNAC 2BT6A 3PSEB 4N9F4 2QIEB 1V6EA 4G3XB 3KH0A 4GXBA 4ICVA 3ZO5B 3B2GA 1IPGA 2QMTA 5DPWA 2INDC 4RGMA 4S17A 4IUMB 4HLEA 1WR1A 1WZ3A 4MGKE 3NG0A 1U4AA 3H6NA 3LDZE 1NEKB 4M02A 3LXFA 4ZRPA 2INCC 2LASA 1L7YA 2KQSA 3VTWA 4A6QA 3N9YC 4BVUC 2NPTA 5JH5C 3IVFA 4EFOA 2X38A 1I4PA 4D2KA 1E8XA 2AEHA 2KN4A 2G4SA 4C7YA 3VR9B 2N7JA 4REZA 1SE9A 2HJ1A 1ZXHA 2INPE 2K25A 1UBQA 4JWSC 2IY1B 3PS6A 1L2NA 3DWMA 1IGCA 1ZPSA 3HK0A 3OJ3A 4CQNA 1TIFA 2FNJB 2IPKD 4AP4C 1FCCC 2HD5B 3RULA 1B9RA 4GB9A 2L7RA 2D11A 2LVQA 4BZAA 2WX1A 1BXTA 5LLIA 1TY2A 4W9KA 1HEZE 1D3ZA 2IDYA 3NZSA 1UD7A 4ICUA 4ANXA 3V05A 3X23A 3GS2A 4K81A 4Q2JA 2BYEA 4N58A 2O2VA 4GOCA 1V8CA 5FK9C 2JWUA 3DHHC 1OFFA 1LM8B 1KLVA 3BVGA 1TBEA 2I38A 2JZZA 1Y56A 2W3SA 2W82A 4WURA 3QWZB 3PZDA 2O2VB 4MM3A 1R4NI 2LJIA 3N32A 1K53A 1JROA 2LGXA 4OHJA 3EFCA 3QC8B 1MPEA 3H8HA 4MM3B 2FCSA 2K6DB 4P16A 4II2B 2C7HA 4W9HA 2MH7A 1BUIC 1XO3A 1TZOA 3J9CA 1UWMA 4ARIA 1I35A 2KDIA 4RNAA 1RFAA 1YJIA 4TV3A 1T0QC 2NCNA 4CYEA 3PREA 2R2QA 1NI3A 4B6WA 2YVCA 1P98A 1TS2A 1DOXA 3WIMA 3RZFA 3MP9A 4LNIA 2KD0A 2KZRA 2AX5A 1I42A 4NPNA 2LHDA 2BGFA 1V97A 2ZCBA 4H2AA 2MBHA 3RNBC 4BKTA 2LEKA 4IWQA 2DBYA 2REXA 4OZBA 2L52A 3AULA 4JE3B 5J17A 2AWTA 1ZP0B 4HWIB 4ANWA 2RGFA 2WDRB 1WGRA 4BKGA 3VUXA 1XCQL 1WM2A 1L0XB 1XT9B 1JWMD 2BBCA 2RMMA 1TGZB 1BMLC 3U52E 4HEA1 1WGDA 4HXDA 3B9JA 5EDSA 3ZQ4A 2IGGA 1FRDA 3MC8A 4WIPA 1KJTA 3BYTB 2WDTB 2WXLA 2XK5B 2FCMA 5L83A 4XX5A 3HM6X 4XWWA 3GP7A 2K8BA 1MVKA 3QIJA 4KIKA 2CS4A 3RD2A 1ZW7A 3DBSA 3EC8A 4RM9A 2G4DB 2KLGA 3EFUA 4TKNA 5D94A 3U7DA 4G11A 1LO5D 1EU3A 4KIKB 3IBEA 3AEFB 1YNTE 3FILA 3RNCC 1HQRD 4RFBA 3B0AA 1L4DB 4TMAB 1SGHA 3AN1A 3MFGA 4MGZE 2BWFA 2UWQA 3PRZA 3EECA 4K1RB 1Q10A 1ZKHA 2KX3A 2PMVA 2LRUA 2KJHB 1XLPA 3KLSX 2TSSA 3FILB 4MGYE 4JX1C 1EWCA 3AECB 1WRIA 4B0EA 3R8BA 2C7MB 3ZYYX 3V6CB 5AUKA 3JVZX 4FN2A 2BF8B 4L2YA 1FMAD 4LNKA 1QQRA 3SFDB 1WJUA 4M8NA 2RSUA 3KYDD 4EKUA 1N63A 1JWSD 2V3NA 2W54A 4PT5A 4ITKA 3W1SC 1AYFA 2VH2A 1FM0D 3ZTDA 1E5WA 5FKAC 1PGBA 4XE0A 2EKEC 2WGSA 3GB1A 3VRAB 3VUWA 5JHAA 5IP4D 1WMHA 3URYA 1XD3B 2LVOA 2NTSA 4AS1A 1R4NB 2KKCA 4URKA 2WXGA 3AM9A 4NJCA 2K8HA 4BBNC 2LGYA 1WMHB 2GBRA 2G9HD 1L0YB 1SE3A 1KF6B 1BT0A 2LUEA 2AQ3B 3ZXVA 5C3JB 3SD5A 3ZJTA 1JQ4A 1OEYJ 4ZDVA 1XF5L 2VRRB 4WH4A 1KLGD 2KVRA 1C1YB 2G3QB 2V1YA 1L5PA 2PJHA 3ENEA 3P42A 1K52A 3DCGA 2QDFA 5BO4B 3AE5B 4RGTA 4DBGA 1C9FA 3RUIB 1NBFC 1NYQA 1QKZA 1I7HA 4X57B 4I6PA 2O6VD 5BMIA 3RI7C 1FXAA 3DHIC 1X1MA 1AW7A 3PZ8A 2QJLA 3M95A 1F9JA 4GSWA 1UUPA 1QF6A 4RGOS 1FFUA 4E74A 1WYGA 3VFKA 4J3OD 2WWZA 4KZCA 3Q3NC 3AV8A 3CF6E 4M0WA 1J7CA 1VCBA 4HCPB 1LGRA 2R61A 4K7WA 1WX7A 1H8CA 2J0KA 4RGNA 4TQ0A 3Q69A 4K7SA 1R7SA 1IP9A 5IA7A 1OQYA 1OTRB 3FKYA 3ZNHB 4YXDB 3Q8FA 4C56C 4M0WB 2MX2A 3P4PB 2V0GA 1PUTA 1VZ8A 1Y8RC 4JLCA 3KVFB 1MFWA 4NZLB 2C5LC 5G5GA 2OHFA 2QEJC 1GC7A 1NENB 1SBBB 5D2MB 1SB3C 4PYUA 1GJZA 3AI5A 2CHXA 4ANUA 3ZIMA 1FO4A 1ENFA 1RAXA 2JYEA 1L4ZB 1YQ3B 2JWZA 3APFA 3AMZA 2J42A 2N4FA 2H89B 2WXOA 3N20C 2EMSA 1JCKB 1WIAA 2JYTA 2C7NB 3BVMA 1PGAA 2WXRA 2KMMA 1AARA 1V9JA 3K9PB 1MHXA 1HZ6A 3HUIA 2FE8A 2LUMA 3TJPA 2M8SA 5BYSA 3W1YA 1Q5WB 3ZDMC 4N6EB 1WXSA 3V62A 2FBWB 4A9AA 4BKSD 4KDLB 2KAJA 1WGYA 4HCNB 3A4SC 3LB8C 3NOBA 1V1OA 1YOVB 4WJNA 1FNVA 1GPXA 2IZVB 4MSMB 3Q8AA 1QOGA 2KWCA 2NVUI 4W9JA 2D5GA 3AE2B 1NI2A 2SEBD 4WWPA 1TKGA 1M4VA 2PIAA 3DVNU 3Q8BA 4JQWC 3RNEC 2IO1B 4CHKA 1QT9A 2KHWB 1V86A 1P7EA 2BKFA 3N3KB 4ACFA 4E71A 3BINA 1WI0A 2GBJA 5TSSA 2N1VA 5BYQA 4DDGD 1JALA 3E56A 3VQIA 1TS4A 4GLSC 1TS3A 4K3CA 4KKIA 1N61A 2BW2A 5HI1A 2I1KA 4GDKA 3N30A 3MJ5A 2MEKA 2IY0B 1SE2A 3AEEB 3NVYA 3VTUA 1FCLA 3NVVA 4NQKE 4YSYB 2CR5A 4HPMB 2GI9A 2K6QA 4PS7A 2MQJA 4GDKB 2O6VB 1MG4A 3PHWB 4PYZA 1PGXA 3HRDD 2CHWA 2Y5PA 3BK2A 5IAAC 2Y3AA 1E8YA 2L32A 5E6NA 2OEDA 5HG2A 2WS3B 4EOYA 2GLSA 3ABVB 4LJOB 5MPOA 2INNE 2PW9A 3JW0X 4HJGE 4WJPA 4WJQA 1MHHE 1CK1A 1C4PA 5LNK1 1S3SG 4BFRA 4JGHB 4WQMA 2IBIB 4OZCA 2DHZA 1UGJA 2QCZA 3WAPA 5CX3A 2HDEA 3GE3C 1GUAB 5KHOA 4HDQA 4RH6A 4O1NA 4OVVA 4WWNA 2WXFA 3ECIA 3AU5A 4JL9A 1C76A 2RPVA 1CJEA 2AQ2B 4LJPB 2LGDA 4MDKE 4GN1A 1ZOYB 1T0SC 4GMVA 1JWBD 3PVLA 1NDDA 1ACCA 1ZDXA 1SIJA 1WYWB 4CO7A 3W1SA 2MJDA 4J6IA 2BTEA 3IG3A 4DQOC 1WGHA 3L17A 3M63B 4YL8A 2L83A 2Z0EB 3MC0B 1GAQB 2BPSA 4KDIC 3NUHB 4HPLB 2K9XA 1E0ZA 3RYTA 1EUVB 4F7ZA 1ZUD2 4W9CA 1OGWA 4C7ZA 4I6NB 3EGRA 3I57A 3UI3A 3PRMB 2MBEA 3ZJUA 4NY0A 3TUOA 4A3PA 1QOAA 1TKYA 3U4EG 2FUHB 2DX5B 4HJKA 1N5XA 5LXHA 2N9EB 4G50A 4RF1A 1Z2MA 3AB5A 2RD0A 3CSTA 2IO3B 3I63C 1E6EB 1T3QA 4KGRA 3SHQA 1YJJA 5D3IB 1OQRA 3KUZA 5AUIA 1ZXIA 3R7QA 2CU1A 2JU6X 3SFEB 2DWQA 4OZAA 5HKHA 5EE1A 1HE8A 3Q6BA 1MI0A 1GNUA 1UF0A 1E9MA 2DENB 3NJTA 1PDXA 1KLUD 2SAKA 1IBXB 2VZKB 3PZ7A 2IO2B 5GXGB 4IG7B 2XK5A 2N7EA 5FR6A 3Q14C 2WX0A 1KOTA 1WXQA 3ZRFA 2LXAA 4ZYSA 3DBRI 1E8ZA 2LJ5A 3PRPB 2J4XA 3NZUA 4YTPB 3RNGC 2PE9A 1XEEA 2DAJA 3EUB2 1JWAD 3KUCB 4W9GA 3ZNID 1QOBA 1WX9A 2LXCA 3DWGC 2LFIA 2ZCCA 3Q2AC 2IGHA 1ROEA 4IKGA 1YQ4B 5IN7A 3TBLD 3PPAA 1WGGA 3QK0A 2KN5A 1YN5A 3AEBB 4HPPA 1SSNA 3AE4B 3TEWA 2L1AA 5CHFA 2RR9A 2ZW0A 1DOYA 4IDIA 4WQOB 2CJNA 4QAYA 1C4AA 1FFVA 3L54A 2KX0A 3CMMB 1ESFA 2WXQA 2ZJDA 2M17A 3QARA 3CWIA 1N5WA 3PV1A 3KYCD 3RPFC 1JRPA 4LDTD 2AQ1B 1SXTA 3APCA 2J0JA 3NS1A 5JZEB 1WE6A 4MJSA 3TEXA 5EE0A 1L6UA 2LRWA 2M1MA 4HKZE 2KLCA 4GDLB 2G1EA 2FCNA 5J2RA 1CZPA 1EO6A 2BWES 2KJ6A 2BYFA 3W2DA 1D5ZC 2CKHB 4MJSB 1KFYB 4DHJD 5CHVC 1GB4A 3V60A 2DNFA 2DZMA 3T8MA 1VRAB 2KDEB 2WDVB 5G5HA 2WXIA 3W5UB 4LNOA 5HFYA
chains in the Genus database with same CATH topology
3RN9C 3DHIC 3RNGC 2INDC 1T0RC 3RNFC 3N1XC 3I5JC 3I63C 3N1YC 3RMKC 3Q3NC 4P1BC 3RNEC 1T0SC 3GE8C 3RNAC 3Q3OC 3N20C 3Q14C 3RNBC 3Q2AC 3N1ZC 3DHGC 3DHHC 3GE3C 1T0QC 3RNCC 4P1CC 3Q3MC 2INCC 3RI7C 2RDBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RN9 C;  3DHI C;  3RNG C;  2IND C;  1T0R C;  3RNF C;  3N1X C;  3I5J C;  3I63 C;  3N1Y C;  3RMK C;  3Q3N C;  4P1B C;  3RNE C;  1T0S C;  3GE8 C;  3RNA C;  3Q3O C;  3N20 C;  3Q14 C;  3RNB C;  3Q2A C;  3N1Z C;  3DHG C;  3DHH C;  3GE3 C;  1T0Q C;  3RNC C;  4P1C C;  3Q3M C;  2INC C;  3RI7 C;  2RDB C; 
#chains in the Genus database with same CATH topology
 4PK1 A;  2LD9 A;  3L10 B;  3PGE A;  5LXI B;  2K5P A;  3H7S A;  3Q8E A;  1HA5 A;  1LQB A;  4P6V F;  4M8M A;  1PFD A;  2CU3 A;  2J7Q B;  2QC8 A;  4PS3 A;  2Q5W D;  2WXM A;  1YX6 B;  3Q8C A;  1HZ5 A;  3A9J A;  1AN8 A;  4YWG G;  1I4X A;  1HXY D;  2OOB B;  2C9W B;  4ARC A;  1J7A A;  5AZF A;  4BAX A;  1VJK A;  1EU4 A;  3ML8 A;  5H92 C;  3V61 A;  1FNW A;  3A9J B;  4AQ7 A;  2I1J A;  4FA6 A;  4MH8 A;  4FBJ B;  1EM7 A;  2YEP B;  3QCA A;  4RMA A;  1M94 A;  3UIO B;  1ZE3 D;  1FD6 A;  4DHZ B;  2KWV B;  2ZVO A;  2KXJ A;  1C78 A;  3BVZ A;  5L95 C;  4KV2 A;  4ZOH C;  2KQ4 X;  2MA9 B;  4MEL A;  4W9D A;  5D6J B;  1P0R A;  1WXM A;  1GC6 A;  2V9H A;  3ZKJ C;  4NNJ B;  2M56 B;  2PKO A;  2UU7 A;  3DVN V;  3D32 A;  2M0X A;  3EHV A;  3Q3F A;  2MW5 A;  3A9K B;  3VVW B;  3AE1 B;  1JW9 D;  2K8C A;  1J19 A;  1EF5 A;  2MHJ A;  5IOI A;  2PVO D;  5EE9 A;  2LI5 A;  5CHW A;  4TSS A;  4JWU C;  4XC2 A;  2KC2 A;  5DPS A;  3DBR B;  2YLM A;  2NMQ A;  2QHO A;  2MWS B;  4NAW A;  3HM3 A;  4ANV A;  2DZK A;  1T5X D;  2GBM A;  3KWV A;  2PEA A;  5AEK B;  1OEY A;  4W9I A;  2LVP A;  1P7F A;  2ZNV C;  1SJE D;  1RYJ A;  4P1C C;  4NAW B;  2N0S B;  2G45 B;  1UBI A;  3QX1 A;  2DLB A;  2ZZP B;  3IAM 1;  3R7R A;  3OJ4 B;  3C8Y A;  4ZRI A;  4ZYN A;  4C4V A;  3TCA A;  1RFK A;  1LFD A;  3RZW C;  1YQB A;  3R2T A;  3V3X A;  5DPR A;  4B9K A;  1YX5 B;  1PQS A;  2MJE A;  2J52 A;  4LLG M;  4DXF A;  2L05 A;  3RFZ B;  2A5U A;  2GMI C;  1WJ6 A;  1WM3 A;  3IXS A;  5JXV A;  1UH6 A;  2PE6 B;  3U7Z A;  3R66 C;  5C23 A;  2JXT A;  4HRO A;  4K7U A;  4C4V B;  1VLB A;  2FIF A;  1V5T A;  5HHD G;  3UQA A;  4LNF A;  2WXN A;  2AL6 A;  4FLH A;  2JUO A;  1ET9 A;  5E6J A;  4IC7 B;  2KJR A;  1I4G A;  2L0F A;  3DVG Y;  2B3A A;  2FUG 1;  1Q0W B;  3E9S A;  3PTF C;  1F52 A;  2MSE D;  3DDC B;  4MSQ B;  1KH0 A;  4BBN F;  2PTL A;  3APD A;  3T3O A;  4US9 A;  3VAW A;  3VUY A;  3ONS A;  4FHJ A;  3BZD B;  4KVG B;  3HIZ A;  4K3B A;  2L8J A;  3SR6 A;  1Z5S B;  2HTH A;  3BK1 A;  4DHJ B;  3R3M A;  3ZUN A;  1RWS A;  2L3Z A;  2JT4 B;  3UF8 A;  2L76 A;  1B1Z A;  3OAW A;  1FRR A;  4AUQ C;  1DOI A;  2NR2 A;  3I5J C;  1QZE A;  3DBL I;  4NJ6 A;  1E8W A;  1Q1O A;  3EA6 A;  1D4B A;  3L4P A;  1C4C A;  3ZJV A;  1CQV A;  2IJ0 A;  5JHB A;  4DWF A;  4YTM B;  2D3A A;  2JQR B;  1LXD A;  1YIW A;  2WU5 B;  3ALB A;  3ZDT A;  1E7V A;  3WAM A;  2KMC A;  2QSD A;  2LGS A;  3W9C B;  1K51 A;  3JSV B;  3UQB A;  4TQ1 A;  2WNM A;  2GBN A;  3A1Q A;  1HTO A;  2PLP A;  3X0W A;  1WJ4 A;  4ZRK A;  2N1W A;  3B08 A;  3Q3M C;  3AED B;  2RPQ A;  1XQQ A;  2IYD B;  2M0A A;  3N1X C;  4KSL C;  1G6J A;  4JPS A;  3IT4 B;  1R4M B;  4I6L B;  1WE7 A;  2WQY B;  1T6B X;  1WWT A;  1EF1 A;  3A1Q B;  2ZPY A;  2O6V A;  3RCZ A;  4YSZ B;  5J18 A;  2KC1 A;  3V6E B;  4AJY B;  2BQQ A;  2V3S A;  4US8 A;  2FAZ A;  2K39 A;  4II3 B;  4NAM A;  1FIQ A;  1L6V A;  1SF0 A;  4MEM A;  3GE8 C;  4OVU A;  2N9P C;  1XLO A;  2WLB A;  2KNB A;  2ZEQ A;  3PLV A;  4FXC A;  1OQQ A;  3LJ3 A;  2Z0D B;  1YD8 U;  3MHZ A;  1V81 A;  2K0P A;  2NPT B;  1TS5 A;  1WXV A;  3PT2 B;  1E7P B;  3KQ4 A;  2LGI A;  3ZLZ A;  3L13 A;  1TKE A;  2MLB A;  3AEG B;  3NRZ A;  1QLB B;  1FXT B;  3Q3O C;  5G2N A;  2N9X A;  3WAL A;  2FID A;  3B2F A;  1KTK A;  3BYY B;  3NS8 A;  4S0R A;  1F1H A;  2M4N A;  4XZ4 A;  2C60 A;  4DDI D;  3IT6 B;  4GIV A;  3QA8 A;  1VZ7 A;  4UDU C;  4HRS A;  2KFJ A;  1SJH D;  4C80 A;  1WY8 A;  3M62 B;  5I4D A;  2JRH A;  3L0W B;  2ZW1 A;  2HJ8 A;  1D5M C;  1RM6 C;  1SE4 A;  2MBO A;  3BY4 B;  4A20 A;  2CJO A;  4WAA A;  2E6X A;  1K50 A;  2GOW A;  3TMP B;  3C0R B;  1JWU D;  3AEA B;  1WSP A;  1TY0 A;  3N1Z C;  4NQL B;  1ISN A;  1MG8 A;  3VTV A;  4MAC A;  5CTR C;  2A4Z A;  2KWU B;  2N9K A;  4EUT A;  3AE8 B;  2JF5 A;  4N59 A;  2YEP F;  3VH3 B;  1CMX B;  1RLF A;  1WH3 A;  3TSS A;  3O65 B;  2D07 B;  4M00 A;  1IYF A;  4RM8 A;  2BS4 B;  1QOF A;  4ASW C;  3IFW B;  2KQ7 A;  2MBQ A;  1XXG A;  3RN9 C;  1HTQ A;  1QIL A;  4A90 A;  3AE6 B;  3MHS D;  4ZRJ A;  3HVZ A;  3TEY A;  2BB5 A;  1UZX B;  1J8C A;  1UWX A;  3SU8 X;  2D3C A;  1WR6 E;  3B1L X;  1WFY A;  3OLM D;  1IBX A;  5H8Y E;  4WWM A;  1T0Y A;  3GOE A;  5C1Z A;  3DBH B;  4BKS A;  2MJ3 A;  1D5X C;  5IO9 A;  2M19 A;  2WP9 B;  2KDM A;  3P4Q B;  3U2S C;  4EZJ A;  2KTR A;  1C3T A;  3I3T B;  3RMK C;  3O13 A;  3DBL B;  4YSX B;  1YMH E;  2Z59 B;  1VD2 A;  3ZTC A;  3DPD A;  4IM2 A;  5TR5 A;  2JRI B;  3H9D A;  4W9L A;  1FEH A;  2AL3 A;  3M3J A;  2N9L A;  3KWL A;  4FHK A;  4KZ0 A;  4AJW A;  1TT5 B;  2GB1 A;  3C19 A;  4XDC A;  4LK0 M;  1N6Z A;  2KTR B;  3R2I A;  3L08 A;  1VR9 A;  3BWU D;  3RNF C;  1J7B A;  3FAH A;  2LHE A;  4HKQ A;  2BVC A;  2RDG A;  1D6E C;  3MJW A;  1NYR A;  4IM3 A;  3RNA C;  4OVZ A;  2JZP A;  1E7U A;  1E90 A;  3AXC A;  2XBB C;  1NVI D;  4ZHP A;  1WGK A;  4MH0 E;  4RF0 A;  1WXA A;  3NY5 A;  3ML9 A;  1A70 A;  2R2O A;  4JIO U;  2WXP A;  2L00 B;  1T0R C;  1GG3 A;  2DYM A;  1DGJ A;  4DXA B;  4IWO A;  1L0V B;  2IO0 B;  5T8I A;  4YT0 B;  2D2Q A;  3HHM A;  3WAN A;  1N60 A;  4W9F A;  3WCQ A;  1FXI A;  4OW0 A;  4NJ7 A;  4HDO A;  3VH4 B;  2AYO B;  2KMA A;  2UYZ B;  2V4L A;  3KW5 B;  3HVD A;  1C77 A;  1YN3 A;  3WAO A;  4GDL A;  2XN9 C;  4AWJ A;  2K22 A;  4W9E A;  2GRI A;  2ZNV B;  4G0N B;  2KT7 A;  1F0Z A;  2FCQ A;  4ZHO A;  3AE3 B;  3P2B A;  5C2T B;  3OG5 A;  4AOF A;  1VZ6 A;  4C00 A;  3MC9 A;  4FJZ A;  3NVZ A;  5DPT A;  4LNN A;  1SIF A;  1P9D U;  1UEL A;  1N62 A;  1H4R A;  2Y5C A;  3JYU A;  3I9V 1;  3QJZ A;  4DHZ E;  3TEZ A;  3QHT A;  1EWY C;  5E6P A;  1DYQ A;  2HE7 A;  1YJ1 A;  3K9O B;  1F2R C;  4HVB A;  3P63 A;  3ZNG C;  3MTN B;  2J0M A;  1ET6 A;  4B95 A;  1GOZ A;  1I4Q A;  3NVW A;  2WXH A;  4A3O A;  2DZJ A;  4MT5 A;  3L16 A;  3ZXR A;  2KWD A;  2J53 A;  1PYW D;  2JVC A;  4A55 A;  2QIL A;  2Y5B B;  3GZN I;  5FR3 A;  2NBW B;  3TL5 A;  3W5V B;  4F1S A;  3CSF A;  2EMT A;  1TYG B;  2JX5 A;  3OWE B;  1AWD A;  3RT3 B;  5IKC M;  3QAQ A;  4E3C A;  2WDQ B;  5D7G A;  2OJW A;  5BMH A;  4KKJ A;  4GU2 A;  3AU4 A;  2KAC A;  3BII D;  3ETR A;  4WWO A;  3S2A A;  4BOS C;  2KDF B;  4EEW A;  2KO3 A;  1GB1 A;  2KOX A;  4LTU A;  3AH7 A;  5G55 A;  2B76 B;  3ZGZ A;  3IAS 1;  1TTN A;  2K1F A;  4FUL A;  4KGT A;  1S1Q B;  5BYR A;  3ZVV A;  3P4S B;  2LZ6 A;  4R3D A;  3A33 B;  2WYQ A;  3U8Z A;  2V4I B;  1WJN A;  1E10 A;  2BS3 B;  3H1U A;  1P3Q U;  2WXJ A;  4HK2 A;  2DAF A;  2BS2 B;  1IGD A;  3T3N A;  4XWT A;  2KK8 A;  1R4M I;  3A4R A;  3UGB B;  3PLU A;  2GBK A;  4KX6 B;  3TIX A;  1STE A;  3A9K A;  4XYC A;  3H7P A;  1J0G A;  3DHG C;  2E3T A;  1UGM A;  2X8X X;  3UIP B;  2PPH A;  2RDB C;  4WJO A;  4FAD A;  1F77 A;  4F8C B;  4MGI E;  3N1Y C;  4WAF A;  2KFK A;  4L23 A;  4BOZ B;  3H7P B;  3U30 A;  2KVZ A;  3ZW3 A;  4A8X C;  2EEL A;  2BYV E;  1JRU A;  3VHT C;  4L1B A;  4FJY A;  3DOW A;  1WZ0 A;  1TZ1 A;  4EE2 A;  4ZRQ A;  3P4R B;  2H88 B;  2I2Y A;  4XGA B;  1XCT L;  2KFK B;  3NZ3 A;  2D3B A;  2CHZ A;  4KGS A;  3VDZ A;  2BKR B;  2VH1 A;  5GMV A;  2JXX A;  2WU2 B;  2IGD A;  1XLQ A;  3LYY A;  1V80 A;  1WX8 A;  2KDB A;  2ASQ A;  4GGQ A;  1V5O A;  5AZH A;  2JPH A;  2D3G A;  3AE9 B;  1ZDV A;  2BB6 A;  1C79 A;  2W55 A;  1V2Y A;  2PVG C;  2W3R A;  3VRB B;  2KTF A;  2ZPN A;  4DXG A;  3Q3J A;  2ON8 A;  4IWP A;  4USA A;  1WF9 A;  3PO0 A;  4PS8 A;  3QQ8 B;  4M01 A;  2JSV X;  4LCD E;  5E6O A;  5AZG A;  1V1P A;  2WHI A;  5EE3 A;  3P1M A;  4IW0 A;  2BYT A;  4P7I A;  1UNS A;  3SDL C;  4XDD A;  4EZL A;  4TUU A;  3FC4 A;  3NHE B;  4DK5 A;  1I4H A;  1KM7 A;  2ICI A;  1JML A;  2WXK A;  2K3U A;  5KHQ A;  2LMC A;  2NS5 A;  1V1P B;  2KAN A;  2MP2 A;  3SEB A;  1F2R I;  2MBB B;  3ZRC A;  4IOI E;  2JZ3 B;  1I4R A;  1MJD A;  2EKI A;  4YTN B;  1ZGU B;  4LDT B;  2ACZ B;  3VR8 B;  1FPY A;  2L0T A;  4IM0 A;  1KRH A;  3T9L A;  3PHX B;  2NBU A;  1K8R B;  2DYO A;  4FJV B;  1RRB A;  2ONQ A;  2D10 A;  2MP2 B;  2Z8L A;  1XLN A;  2JY6 A;  3VXW A;  3CIR B;  2ZVN A;  4P1B C;  3DVG X;  1YN4 A;  1SEB D;  1A5R A;  1P1A A;  3KUD B;  3DBH I;  2KYW A;  5BMG A;  2V3P A;  2NBV B;  5DCN A;  3AE7 B;  4RCO A;  3IHP C;  3WA0 A;  4EZK A;  2W9N A;  2N7D A;  2DZI A;  2XEW A;  3GZN B;  4KSK C;  3UIN B;  1VDV A;  3JSV A;  2OJR A;  1FNU A;  1TJE A;  3ZNZ B;  2LWP A;  1WRD B;  2VZK D;  1V49 A;  1IUE A;  4B0M A;  2MCN B;  2MRP A;  2RDH A;  3DQV A;  5D3D A;  2HTM E;  2DYB A;  2NTT A;  2XNA C;  2BT6 A;  3PSE B;  4N9F 4;  2QIE B;  1V6E A;  4G3X B;  3KH0 A;  4GXB A;  4ICV A;  3ZO5 B;  3B2G A;  1IPG A;  2QMT A;  5DPW A;  2IND C;  4RGM A;  4S17 A;  4IUM B;  4HLE A;  1WR1 A;  1WZ3 A;  4MGK E;  3NG0 A;  1U4A A;  3H6N A;  3LDZ E;  1NEK B;  4M02 A;  3LXF A;  4ZRP A;  2INC C;  2LAS A;  1L7Y A;  2KQS A;  3VTW A;  4A6Q A;  3N9Y C;  4BVU C;  2NPT A;  5JH5 C;  3IVF A;  4EFO A;  2X38 A;  1I4P A;  4D2K A;  1E8X A;  2AEH A;  2KN4 A;  2G4S A;  4C7Y A;  3VR9 B;  2N7J A;  4REZ A;  1SE9 A;  2HJ1 A;  1ZXH A;  2INP E;  2K25 A;  1UBQ A;  4JWS C;  2IY1 B;  3PS6 A;  1L2N A;  3DWM A;  1IGC A;  1ZPS A;  3HK0 A;  3OJ3 A;  4CQN A;  1TIF A;  2FNJ B;  2IPK D;  4AP4 C;  1FCC C;  2HD5 B;  3RUL A;  1B9R A;  4GB9 A;  2L7R A;  2D11 A;  2LVQ A;  4BZA A;  2WX1 A;  1BXT A;  5LLI A;  1TY2 A;  4W9K A;  1HEZ E;  1D3Z A;  2IDY A;  3NZS A;  1UD7 A;  4ICU A;  4ANX A;  3V05 A;  3X23 A;  3GS2 A;  4K81 A;  4Q2J A;  2BYE A;  4N58 A;  2O2V A;  4GOC A;  1V8C A;  5FK9 C;  2JWU A;  3DHH C;  1OFF A;  1LM8 B;  1KLV A;  3BVG A;  1TBE A;  2I38 A;  2JZZ A;  1Y56 A;  2W3S A;  2W82 A;  4WUR A;  3QWZ B;  3PZD A;  2O2V B;  4MM3 A;  1R4N I;  2LJI A;  3N32 A;  1K53 A;  1JRO A;  2LGX A;  4OHJ A;  3EFC A;  3QC8 B;  1MPE A;  3H8H A;  4MM3 B;  2FCS A;  2K6D B;  4P16 A;  4II2 B;  2C7H A;  4W9H A;  2MH7 A;  1BUI C;  1XO3 A;  1TZO A;  3J9C A;  1UWM A;  4ARI A;  1I35 A;  2KDI A;  4RNA A;  1RFA A;  1YJI A;  4TV3 A;  1T0Q C;  2NCN A;  4CYE A;  3PRE A;  2R2Q A;  1NI3 A;  4B6W A;  2YVC A;  1P98 A;  1TS2 A;  1DOX A;  3WIM A;  3RZF A;  3MP9 A;  4LNI A;  2KD0 A;  2KZR A;  2AX5 A;  1I42 A;  4NPN A;  2LHD A;  2BGF A;  1V97 A;  2ZCB A;  4H2A A;  2MBH A;  3RNB C;  4BKT A;  2LEK A;  4IWQ A;  2DBY A;  2REX A;  4OZB A;  2L52 A;  3AUL A;  4JE3 B;  5J17 A;  2AWT A;  1ZP0 B;  4HWI B;  4ANW A;  2RGF A;  2WDR B;  1WGR A;  4BKG A;  3VUX A;  1XCQ L;  1WM2 A;  1L0X B;  1XT9 B;  1JWM D;  2BBC A;  2RMM A;  1TGZ B;  1BML C;  3U52 E;  4HEA 1;  1WGD A;  4HXD A;  3B9J A;  5EDS A;  3ZQ4 A;  2IGG A;  1FRD A;  3MC8 A;  4WIP A;  1KJT A;  3BYT B;  2WDT B;  2WXL A;  2XK5 B;  2FCM A;  5L83 A;  4XX5 A;  3HM6 X;  4XWW A;  3GP7 A;  2K8B A;  1MVK A;  3QIJ A;  4KIK A;  2CS4 A;  3RD2 A;  1ZW7 A;  3DBS A;  3EC8 A;  4RM9 A;  2G4D B;  2KLG A;  3EFU A;  4TKN A;  5D94 A;  3U7D A;  4G11 A;  1LO5 D;  1EU3 A;  4KIK B;  3IBE A;  3AEF B;  1YNT E;  3FIL A;  3RNC C;  1HQR D;  4RFB A;  3B0A A;  1L4D B;  4TMA B;  1SGH A;  3AN1 A;  3MFG A;  4MGZ E;  2BWF A;  2UWQ A;  3PRZ A;  3EEC A;  4K1R B;  1Q10 A;  1ZKH A;  2KX3 A;  2PMV A;  2LRU A;  2KJH B;  1XLP A;  3KLS X;  2TSS A;  3FIL B;  4MGY E;  4JX1 C;  1EWC A;  3AEC B;  1WRI A;  4B0E A;  3R8B A;  2C7M B;  3ZYY X;  3V6C B;  5AUK A;  3JVZ X;  4FN2 A;  2BF8 B;  4L2Y A;  1FMA D;  4LNK A;  1QQR A;  3SFD B;  1WJU A;  4M8N A;  2RSU A;  3KYD D;  4EKU A;  1N63 A;  1JWS D;  2V3N A;  2W54 A;  4PT5 A;  4ITK A;  3W1S C;  1AYF A;  2VH2 A;  1FM0 D;  3ZTD A;  1E5W A;  5FKA C;  1PGB A;  4XE0 A;  2EKE C;  2WGS A;  3GB1 A;  3VRA B;  3VUW A;  5JHA A;  5IP4 D;  1WMH A;  3URY A;  1XD3 B;  2LVO A;  2NTS A;  4AS1 A;  1R4N B;  2KKC A;  4URK A;  2WXG A;  3AM9 A;  4NJC A;  2K8H A;  4BBN C;  2LGY A;  1WMH B;  2GBR A;  2G9H D;  1L0Y B;  1SE3 A;  1KF6 B;  1BT0 A;  2LUE A;  2AQ3 B;  3ZXV A;  5C3J B;  3SD5 A;  3ZJT A;  1JQ4 A;  1OEY J;  4ZDV A;  1XF5 L;  2VRR B;  4WH4 A;  1KLG D;  2KVR A;  1C1Y B;  2G3Q B;  2V1Y A;  1L5P A;  2PJH A;  3ENE A;  3P42 A;  1K52 A;  3DCG A;  2QDF A;  5BO4 B;  3AE5 B;  4RGT A;  4DBG A;  1C9F A;  3RUI B;  1NBF C;  1NYQ A;  1QKZ A;  1I7H A;  4X57 B;  4I6P A;  2O6V D;  5BMI A;  3RI7 C;  1FXA A;  3DHI C;  1X1M A;  1AW7 A;  3PZ8 A;  2QJL A;  3M95 A;  1F9J A;  4GSW A;  1UUP A;  1QF6 A;  4RGO S;  1FFU A;  4E74 A;  1WYG A;  3VFK A;  4J3O D;  2WWZ A;  4KZC A;  3Q3N C;  3AV8 A;  3CF6 E;  4M0W A;  1J7C A;  1VCB A;  4HCP B;  1LGR A;  2R61 A;  4K7W A;  1WX7 A;  1H8C A;  2J0K A;  4RGN A;  4TQ0 A;  3Q69 A;  4K7S A;  1R7S A;  1IP9 A;  5IA7 A;  1OQY A;  1OTR B;  3FKY A;  3ZNH B;  4YXD B;  3Q8F A;  4C56 C;  4M0W B;  2MX2 A;  3P4P B;  2V0G A;  1PUT A;  1VZ8 A;  1Y8R C;  4JLC A;  3KVF B;  1MFW A;  4NZL B;  2C5L C;  5G5G A;  2OHF A;  2QEJ C;  1GC7 A;  1NEN B;  1SBB B;  5D2M B;  1SB3 C;  4PYU A;  1GJZ A;  3AI5 A;  2CHX A;  4ANU A;  3ZIM A;  1FO4 A;  1ENF A;  1RAX A;  2JYE A;  1L4Z B;  1YQ3 B;  2JWZ A;  3APF A;  3AMZ A;  2J42 A;  2N4F A;  2H89 B;  2WXO A;  3N20 C;  2EMS A;  1JCK B;  1WIA A;  2JYT A;  2C7N B;  3BVM A;  1PGA A;  2WXR A;  2KMM A;  1AAR A;  1V9J A;  3K9P B;  1MHX A;  1HZ6 A;  3HUI A;  2FE8 A;  2LUM A;  3TJP A;  2M8S A;  5BYS A;  3W1Y A;  1Q5W B;  3ZDM C;  4N6E B;  1WXS A;  3V62 A;  2FBW B;  4A9A A;  4BKS D;  4KDL B;  2KAJ A;  1WGY A;  4HCN B;  3A4S C;  3LB8 C;  3NOB A;  1V1O A;  1YOV B;  4WJN A;  1FNV A;  1GPX A;  2IZV B;  4MSM B;  3Q8A A;  1QOG A;  2KWC A;  2NVU I;  4W9J A;  2D5G A;  3AE2 B;  1NI2 A;  2SEB D;  4WWP A;  1TKG A;  1M4V A;  2PIA A;  3DVN U;  3Q8B A;  4JQW C;  3RNE C;  2IO1 B;  4CHK A;  1QT9 A;  2KHW B;  1V86 A;  1P7E A;  2BKF A;  3N3K B;  4ACF A;  4E71 A;  3BIN A;  1WI0 A;  2GBJ A;  5TSS A;  2N1V A;  5BYQ A;  4DDG D;  1JAL A;  3E56 A;  3VQI A;  1TS4 A;  4GLS C;  1TS3 A;  4K3C A;  4KKI A;  1N61 A;  2BW2 A;  5HI1 A;  2I1K A;  4GDK A;  3N30 A;  3MJ5 A;  2MEK A;  2IY0 B;  1SE2 A;  3AEE B;  3NVY A;  3VTU A;  1FCL A;  3NVV A;  4NQK E;  4YSY B;  2CR5 A;  4HPM B;  2GI9 A;  2K6Q A;  4PS7 A;  2MQJ A;  4GDK B;  2O6V B;  1MG4 A;  3PHW B;  4PYZ A;  1PGX A;  3HRD D;  2CHW A;  2Y5P A;  3BK2 A;  5IAA C;  2Y3A A;  1E8Y A;  2L32 A;  5E6N A;  2OED A;  5HG2 A;  2WS3 B;  4EOY A;  2GLS A;  3ABV B;  4LJO B;  5MPO A;  2INN E;  2PW9 A;  3JW0 X;  4HJG E;  4WJP A;  4WJQ A;  1MHH E;  1CK1 A;  1C4P A;  5LNK 1;  1S3S G;  4BFR A;  4JGH B;  4WQM A;  2IBI B;  4OZC A;  2DHZ A;  1UGJ A;  2QCZ A;  3WAP A;  5CX3 A;  2HDE A;  3GE3 C;  1GUA B;  5KHO A;  4HDQ A;  4RH6 A;  4O1N A;  4OVV A;  4WWN A;  2WXF A;  3ECI A;  3AU5 A;  4JL9 A;  1C76 A;  2RPV A;  1CJE A;  2AQ2 B;  4LJP B;  2LGD A;  4MDK E;  4GN1 A;  1ZOY B;  1T0S C;  4GMV A;  1JWB D;  3PVL A;  1NDD A;  1ACC A;  1ZDX A;  1SIJ A;  1WYW B;  4CO7 A;  3W1S A;  2MJD A;  4J6I A;  2BTE A;  3IG3 A;  4DQO C;  1WGH A;  3L17 A;  3M63 B;  4YL8 A;  2L83 A;  2Z0E B;  3MC0 B;  1GAQ B;  2BPS A;  4KDI C;  3NUH B;  4HPL B;  2K9X A;  1E0Z A;  3RYT A;  1EUV B;  4F7Z A;  1ZUD 2;  4W9C A;  1OGW A;  4C7Z A;  4I6N B;  3EGR A;  3I57 A;  3UI3 A;  3PRM B;  2MBE A;  3ZJU A;  4NY0 A;  3TUO A;  4A3P A;  1QOA A;  1TKY A;  3U4E G;  2FUH B;  2DX5 B;  4HJK A;  1N5X A;  5LXH A;  2N9E B;  4G50 A;  4RF1 A;  1Z2M A;  3AB5 A;  2RD0 A;  3CST A;  2IO3 B;  3I63 C;  1E6E B;  1T3Q A;  4KGR A;  3SHQ A;  1YJJ A;  5D3I B;  1OQR A;  3KUZ A;  5AUI A;  1ZXI A;  3R7Q A;  2CU1 A;  2JU6 X;  3SFE B;  2DWQ A;  4OZA A;  5HKH A;  5EE1 A;  1HE8 A;  3Q6B A;  1MI0 A;  1GNU A;  1UF0 A;  1E9M A;  2DEN B;  3NJT A;  1PDX A;  1KLU D;  2SAK A;  1IBX B;  2VZK B;  3PZ7 A;  2IO2 B;  5GXG B;  4IG7 B;  2XK5 A;  2N7E A;  5FR6 A;  3Q14 C;  2WX0 A;  1KOT A;  1WXQ A;  3ZRF A;  2LXA A;  4ZYS A;  3DBR I;  1E8Z A;  2LJ5 A;  3PRP B;  2J4X A;  3NZU A;  4YTP B;  3RNG C;  2PE9 A;  1XEE A;  2DAJ A;  3EUB 2;  1JWA D;  3KUC B;  4W9G A;  3ZNI D;  1QOB A;  1WX9 A;  2LXC A;  3DWG C;  2LFI A;  2ZCC A;  3Q2A C;  2IGH A;  1ROE A;  4IKG A;  1YQ4 B;  5IN7 A;  3TBL D;  3PPA A;  1WGG A;  3QK0 A;  2KN5 A;  1YN5 A;  3AEB B;  4HPP A;  1SSN A;  3AE4 B;  3TEW A;  2L1A A;  5CHF A;  2RR9 A;  2ZW0 A;  1DOY A;  4IDI A;  4WQO B;  2CJN A;  4QAY A;  1C4A A;  1FFV A;  3L54 A;  2KX0 A;  3CMM B;  1ESF A;  2WXQ A;  2ZJD A;  2M17 A;  3QAR A;  3CWI A;  1N5W A;  3PV1 A;  3KYC D;  3RPF C;  1JRP A;  4LDT D;  2AQ1 B;  1SXT A;  3APC A;  2J0J A;  3NS1 A;  5JZE B;  1WE6 A;  4MJS A;  3TEX A;  5EE0 A;  1L6U A;  2LRW A;  2M1M A;  4HKZ E;  2KLC A;  4GDL B;  2G1E A;  2FCN A;  5J2R A;  1CZP A;  1EO6 A;  2BWE S;  2KJ6 A;  2BYF A;  3W2D A;  1D5Z C;  2CKH B;  4MJS B;  1KFY B;  4DHJ D;  5CHV C;  1GB4 A;  3V60 A;  2DNF A;  2DZM A;  3T8M A;  1VRA B;  2KDE B;  2WDV B;  5G5H A;  2WXI A;  3W5U B;  4LNO A;  5HFY A; 
#chains in the Genus database with same CATH homology
 3RN9 C;  3DHI C;  3RNG C;  2IND C;  1T0R C;  3RNF C;  3N1X C;  3I5J C;  3I63 C;  3N1Y C;  3RMK C;  3Q3N C;  4P1B C;  3RNE C;  1T0S C;  3GE8 C;  3RNA C;  3Q3O C;  3N20 C;  3Q14 C;  3RNB C;  3Q2A C;  3N1Z C;  3DHG C;  3DHH C;  3GE3 C;  1T0Q C;  3RNC C;  4P1C C;  3Q3M C;  2INC C;  3RI7 C;  2RDB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...