3GE8C

Toluene 4-monooxygenase hd t201a diferric, resting state complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Toluene-4-monooxygenase system protein A
publication title Role for threonine 201 in the catalytic cycle of the soluble diiron hydroxylase toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
total genus 25
structure length 82
sequence length 82
chains with identical sequence G
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2009-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3ge8C00
3Q14C 4P1CC 3I5JC 3RMKC 3RNEC 3RNCC 3DHIC 3N1XC 3RNGC 3RNAC 1T0RC 3DHGC 3Q3NC 3GE3C 3RNFC 4P1BC 2INDC 3RN9C 1T0SC 3RNBC 3N1ZC 3DHHC 3Q3MC 3Q2AC 2INCC 3N1YC 1T0QC 3GE8C 3RI7C 3I63C 3Q3OC 2RDBC 3N20C
chains in the Genus database with same CATH superfamily
3NZ3A 1EF1A 5LLIA 4F7ZA 3BWUD 3L08A 1T0RC 1UELA 3N32A 4MM3B 2VH1A 1X1MA 1VR9A 2NTSA 4NAMA 3AEBB 2DNFA 3SFEB 3SDLC 3Q3MC 3EUB2 4IM3A 1Z2MA 3AEDB 2HJ1A 3GE8C 4OVUA 3K9PB 2A5UA 5IP4D 3HRDD 4XZ4A 3H8HA 4W9KA 3LDZE 1I7HA 2L7RA 3QK0A 4ZRJA 2KWVB 3H1UA 1E7UA 4M0WA 3ABVB 2D2QA 1Q0WB 1Q10A 2FCNA 3CWIA 3BK2A 4TKNA 1GPXA 3AV8A 3VRAB 5GXGB 1T5XD 2B76B 1U4AA 1V5OA 1DOIA 4US8A 3O65B 2FCSA 3OLMD 3WAMA 3PLUA 3OAWA 4IWPA 3MHSD 4ANWA 2N7DA 2KDBA 2AYOB 2CHZA 4HXDA 1SIJA 4K7UA 2K6DB 2PMVA 1TKEA 2BYTA 2CHXA 1TGZB 3ZRCA 4HEA1 2Z0DB 2WXQA 1NDDA 3CF6E 1FIQA 2N7EA 3AECB 4WIPA 1K8RB 3AMZA 4KIKB 4CQNA 1XT9B 4E74A 4M02A 3WCQA 3BINA 3C8YA 2WDTB 2MRPA 3MC8A 4DHZE 4N59A 2BYEA 1L7YA 4IWQA 2RPQA 4FHJA 2CU1A 4GSWA 3P4QB 4EZJA 3U8ZA 1V86A 4R3DA 3I57A 1TY0A 3RT3B 4JX1C 4XYCA 1F77A 3W1YA 5IOIA 3ML8A 2KVZA 3ONSA 4N58A 1ZPSA 3UQBA 3S2AA 1KF6B 5E6OA 3DHIC 2IO1B 1ZDVA 2EKEC 2D3AA 3EFCA 2BBCA 1CMXB 4LNKA 3VR9B 1WGYA 3HUIA 3ZJVA 3TEZA 1WX7A 1WGKA 2JZPA 2MBQA 3MC0B 1V81A 3VUXA 1ZOYB 2FE8A 1YN5A 2QCZA 2MBOA 4JLCA 2N9PC 3U30A 1WX9A 2BGFA 1SIFA 4HPMB 4WJQA 4DDGD 1E7PB 4RCOA 3KH0A 2AL3A 1UGMA 1FRDA 1QZEA 2ZNVC 3FILA 2PTLA 5H92C 1HEZE 3RCZA 5CTRC 3I5JC 5FKAC 2W9NA 1ISNA 5C3JB 5MPOA 3DBHI 2N0SB 4LDTD 1HA5A 2LXCA 1JCKB 1GOZA 1WI0A 2NMQA 1QOAA 4AUQC 1OQRA 3TBLD 1N5XA 3L4PA 2JXTA 2K8HA 4EE2A 4RNAA 3WA0A 1R4NB 4RGTA 1RLFA 5AUKA 4NJ7A 1V97A 4PT5A 3RULA 1TT5B 1IGCA 2K39A 1XLPA 1RFKA 4GDLB 2KLGA 1J8CA 2M17A 2NPTA 3A1QB 1C79A 2LUMA 3ZIMA 1I4QA 3ZKJC 1XCTL 2DAFA 1DOYA 1I4GA 2KX0A 3TIXA 3U7DA 3V05A 2JZ3B 3ZNHB 5HG2A 2V1YA 2LMCA 4MGIE 3CSTA 1D5ZC 1S3SG 4FJVB 1ACCA 1ZDXA 3VRBB 1MPEA 3WANA 1WGRA 2MBHA 2WU2B 4KVGB 4BKTA 2V0GA 4ZRKA 2GOWA 1WZ3A 3RFZB 4GU2A 2M19A 3TCAA 4EOYA 4USAA 1E6EB 2KMCA 3CIRB 5EE0A 4YSYB 4W9CA 2UU7A 2QIEB 2BF8B 3DWGC 2JF5A 2YEPB 3DHHC 1Q5WB 3PRMB 1UNSA 4L1BA 4G50A 1C78A 4NZLB 3NJTA 1A5RA 2WU5B 4BFRA 2PLPA 4ANUA 2KYWA 4HDOA 3DWMA 4LJOB 2LGIA 4HJKA 2O6VB 5BMHA 2KT7A 4GDKA 3PZ8A 3N3KB 4GOCA 2MEKA 3VUWA 2BB5A 2RDGA 3P4PB 2ZZPB 1NI2A 2IGDA 4W9GA 1V80A 4CYEA 3OJ4B 3MFGA 3LYYA 4ZRIA 1FXTB 1LO5D 3LXFA 1OQYA 2KANA 4NJ6A 2E3TA 1R4MB 4LNNA 3TEWA 4KDIC 3RNFC 2K1FA 2KJHB 3PREA 2WXHA 3N1ZC 1VZ8A 4HWIB 2L0TA 4FJYA 2JPHA 1D3ZA 3ZRFA 2KKCA 1EUVB 2RPVA 2KK8A 1WXSA 3X0WA 3VQIA 3KVFB 3AH7A 2LGXA 1YOVB 5CHFA 1UWXA 1GC6A 2LEKA 2IGGA 2PE9A 3ZYYX 3QCAA 3PRPB 2LHEA 4PS7A 2Z59B 3A4SC 3BZDB 2BVCA 3Q8CA 2AEHA 2DLBA 1GC7A 4IC7B 3MJ5A 2L32A 1JROA 1PYWD 4MM3A 3DHGC 4GB9A 1C4AA 2WDRB 2IO0B 4IDIA 1OEYA 3K9OB 4HKQA 3B2FA 4IKGA 4HPLB 3P4SB 2FNJB 1K52A 1FNVA 1WJUA 2M4NA 3LJ3A 4G11A 1XO3A 3RNEC 1FO4A 1VRAB 2BQQA 2NCNA 3KUCB 1OTRB 3UIPB 1FFVA 3ZDMC 3AE8B 1WXVA 1EF5A 1HE8A 2H88B 2LVPA 4FA6A 3IBEA 2L76A 3B1LX 3QAQA 1E8WA 2KD0A 3M3JA 3Q14C 1CZPA 1XLQA 2L3ZA 2GB1A 3C0RB 1EU3A 3VH3B 4TQ0A 1GG3A 2J7QB 1R4NI 3L0WB 2WXRA 3MJWA 2JVCA 2DENB 3PV1A 1C3TA 4KIKA 4QAYA 4RMAA 2KDFB 4ZRQA 3ZGZA 2IYDB 2I38A 1JRPA 1GAQB 2MH7A 3ZXRA 1WGGA 2C7HA 1J19A 2AWTA 1WM3A 3RNGC 1YN4A 2X8XX 3BVGA 4P1BC 2W55A 2O2VB 1LGRA 1WYGA 2ZCBA 5HFYA 1RYJA 2ON8A 2KJ6A 4GN1A 4JWUC 2PVOD 2K6QA 2KDIA 4C7YA 1WSPA 3GZNB 4URKA 4NAWB 2NTTA 3B9JA 1MG8A 2D10A 1MFWA 2KMAA 3DVNU 2FCMA 5BYSA 3SFDB 1TBEA 5AZFA 1TS2A 3NZUA 4RGOS 3ZLZA 1QILA 1VZ7A 2GBJA 2R2OA 2KWUB 3L17A 4HCNB 5LNK1 2A4ZA 3APCA 2WLBA 5IA7A 2X38A 2M8SA 1L5PA 1YX5B 4N6EB 2IDYA 3FC4A 4ACFA 5JHBA 2VZKD 5IAAC 3TUOA 3MHZA 1MJDA 1HTOA 2L52A 3RNBC 1EWCA 2KMMA 4MJSB 1V2YA 2N9LA 5D94A 1SSNA 4KSLC 4W9JA 2K3UA 1OGWA 1FPYA 1F52A 1JMLA 1S1QB 2GBNA 2LHDA 4M00A 3NZSA 1RRBA 1YN3A 3NVWA 1QOBA 2KDEB 1WE7A 2ZPNA 2YEPF 1R4MI 3A9KB 3R66C 1ZXIA 4JIOU 4PYZA 1CQVA 3WAOA 1N60A 3NVYA 3VTVA 4LDTB 1UF0A 2OJWA 1LQBA 4GDLA 3A1QA 4J6IA 3ZW3A 4NNJB 2KACA 2GRIA 4RGMA 4JE3B 5CHWA 5E6NA 2BS4B 3Q2AC 4DXFA 1BXTA 2ICIA 3I63C 4AOFA 3A33B 1FNUA 3T3NA 2ZEQA 2HDEA 3PTFC 4P16A 5CX3A 1TYGB 4AJYB 2BYFA 2IZVB 2BKFA 3T3OA 4JPSA 1LXDA 2KDMA 2DYOA 4HVBA 2H89B 3VXWA 1WZ0A 1C76A 2IBIB 2BT6A 2KC2A 2I2YA 4XGAB 5BYRA 1T0QC 2MSED 4GGQA 1NBFC 2M56B 4E71A 2K8CA 2W82A 4K81A 3B0AA 2DZIA 3EA6A 2AX5A 1WFYA 1E8XA 1QQRA 1MI0A 2RDHA 1C4PA 2D3GA 2DYMA 1L4ZB 4IM2A 1FXIA 3L16A 5TSSA 4FULA 4TUUA 2WX0A 2JU6X 1SJHD 3H7SA 2N7JA 1C1YB 4AP4C 4TMAB 2O6VA 3Q3NC 5J17A 4ZOHC 4HROA 2LUEA 3NHEB 1P7EA 3A4RA 3OWEB 3H7PB 4B0EA 4MELA 4YTMB 1LM8B 3DBRB 1BMLC 3M63B 2V4IB 1TZ1A 1VLBA 3DCGA 1N5WA 4ANXA 1E8YA 4K1RB 1KM7A 3M62B 3VVWB 1IYFA 5LXIB 4CO7A 1XF5L 4B95A 4YXDB 4MH0E 2RR9A 2KVRA 3Q8BA 1WGHA 1WMHB 3RUIB 1IUEA 3KUZA 3VAWA 4A55A 3IT4B 4PK1A 2K25A 3BIID 4G3XB 1M4VA 3NUHB 1WRDB 1IPGA 2QDFA 4WWOA 2MLBA 2Z8LA 1TTNA 3R3MA 3ZXVA 3BVMA 2UWQA 2NS5A 3GZNI 4W9EA 3GE3C 3VH4B 1V9JA 4WAAA 4OVVA 1SJED 2QSDA 2I1KA 1UD7A 1N63A 4FADA 2QC8A 3OJ3A 3A9JB 2KQSA 2LXAA 2WDQB 4WJPA 5J2RA 2JZZA 1E90A 4OZBA 2DHZA 2RD0A 3AEFB 5L95C 2CJNA 2HD5B 5DPTA 1WM2A 1MHXA 4BZAA 2KTRB 4D2KA 4XWTA 1XD3B 3E56A 1HXYD 2D11A 3HVDA 2JUOA 1WJNA 3H6NA 4F8CB 3N20C 1SXTA 2BB6A 3AULA 4M8NA 1YD8U 3WIMA 3AEEB 2SEBD 2LGYA 1E7VA 2FIDA 2WXIA 3AE2B 2XNAC 1ET6A 1V5TA 2W3SA 4I6PA 1WY8A 5JH5C 4WH4A 1E0ZA 4ICVA 2MW5A 4XC2A 5EE3A 3DVGY 2WHIA 2MP2B 2CR5A 5BYQA 3IHPC 1P98A 1KOTA 2V9HA 5AUIA 3Q3JA 3AE7B 2GBMA 2K22A 2LRWA 1F2RI 3PO0A 1N6ZA 3EGRA 1TIFA 2KNBA 1E5WA 3PRZA 1E10A 1STEA 3APDA 4H2AA 2BWES 1KH0A 4BKSD 1KLVA 1N61A 1FEHA 2K5PA 3VDZA 3N9YC 3GOEA 1FCCC 3RYTA 4EZKA 1FMAD 4YSZB 2XK5A 3PPAA 2O2VA 2MBEA 3BYTB 1UBQA 3DVNV 2PE6B 1JWSD 1GUAB 5L83A 2GBKA 3JVZX 4AWJA 1J7CA 2G1EA 1JW9D 3QX1A 3VR8B 1A70A 1NYRA 2KN4A 2LVQA 5C1ZA 3I9V1 4NAWA 1OQQA 4B0MA 3GP7A 2JX5A 1NVID 2R61A 1I4RA 1NI3A 4LLGM 2AL6A 2MX2A 2N9EB 3CSFA 2INDC 4MSQB 1ZXHA 5FR3A 1EO6A 3IAS1 3UIOB 4YWGG 4A6QA 4K3CA 2PEAA 3Q8FA 2QILA 2IGHA 2NBWB 3Q69A 4W9LA 1RAXA 1J0GA 4P1CC 2IO2B 5DPSA 4FXCA 3D32A 4TSSA 3B2GA 1Y56A 2DX5B 3BY4B 3JSVB 1HTQA 4MJSA 2KQ7A 1QT9A 2WXKA 3BK1A 4IM0A 2KX3A 2C5LC 4RM8A 5H8YE 1P0RA 1JRUA 2G9HD 3QIJA 4OW0A 3ETRA 4WJOA 1P7FA 3U4EG 3DBRI 2DZJA 2VZKB 2YLMA 3PS6A 1RWSA 3W2DA 3AE4B 4ZDVA 2XN9C 3T9LA 4EUTA 4BKGA 3QA8A 5HHDG 2VH2A 2Q5WD 3A9KA 4UDUC 1DYQA 2ZW0A 5HKHA 4MEMA 1QOGA 3Q6BA 3V3XA 3VFKA 4FHKA 4B6WA 4FN2A 1XLOA 5BO4B 4KKIA 3SEBA 2G4SA 2REXA 2EKIA 4A3PA 3UGBB 3KQ4A 2RDBC 4I6LB 1GB4A 5D3DA 2DZMA 5DPRA 2WQYB 3DQVA 4S17A 1F2RC 1PGBA 5KHQA 1V49A 4KGRA 1MVKA 2OHFA 1PGXA 1P3QU 2C60A 1UZXB 3KWLA 4LTUA 1I35A 4KV2A 1NEKB 3Q8AA 4K7SA 2Y5CA 1SEBD 2Y5BB 2ZCCA 5BMIA 1V1PB 1CJEA 1I42A 3ZTCA 1YQBA 1ZP0B 1T3QA 2J0KA 2B3AA 3PSEB 3EFUA 3KUDB 3PLVA 1NYQA 2LGSA 4BBNC 2FAZA 4BOSC 4ZHOA 3L10B 4YSXB 3ALBA 1IGDA 2QJLA 3MC9A 1FM0D 2KXJA 3VHTC 1RFAA 4IWOA 4KDLB 4EEWA 5C23A 5DCNA 1JWAD 1FRRA 1NENB 2XEWA 3TL5A 2JXXA 3DDCB 2M1MA 2L8JA 3H7PA 1YJIA 5J18A 1E9MA 1D6EC 4P6VF 2MCNB 2Y3AA 2I1JA 2EMSA 1SF0A 2WXGA 3VTWA 2GBRA 3RPFC 3V60A 1TJEA 2LJIA 3KYDD 2RSUA 4HK2A 3RZFA 2MHJA 2FUG1 3BYYB 4ZYSA 1CK1A 5BMGA 1YX6B 4C56C 2TSSA 3ZNID 5IO9A 2MBBB 4W9HA 4N9F4 2C7MB 1L0VB 1WGDA 2WX1A 2Z0EB 3ZJTA 3IVFA 2INNE 1WE6A 2L00B 3DOWA 4O1NA 4ASWC 1FFUA 4NQKE 1E8ZA 4HPPA 3PZDA 4II2B 2ZPYA 3A9JA 5D6JB 5DPWA 4MH8A 4XX5A 1WYWB 2LVOA 3ZO5B 2KWCA 3BVZA 1PFDA 1L0YB 2J4XA 2GI9A 3AN1A 4ZHPA 1P9DU 2LRUA 1ZE3D 4PS3A 4LNOA 4EZLA 2DBYA 3DVGX 1SB3C 3RI7C 3PT2B 4NJCA 1IBXB 4EKUA 1TS4A 4LK0M 2CHWA 4DHJD 2G45B 1BT0A 1G6JA 4ITKA 2LZ6A 1WX8A 1H4RA 3AE5B 2C9WB 4NPNA 3R2TA 3UQAA 4C00A 3TEYA 1H8CA 2DYBA 2WGSA 1ZUD2 1HQRD 2HE7A 2MP2A 2K9XA 5JZEB 4HJGE 2J52A 3NOBA 3H9DA 3P1MA 1B9RA 4GIVA 3L54A 2DAJA 5AZGA 4F1SA 3ZNZB 4MSMB 3HIZA 1WIAA 1VDVA 4WJNA 4RFBA 1L6VA 2OJRA 2LD9A 2M0XA 4WAFA 5JXVA 2G3QB 1WJ4A 3NVZA 5CHVC 4GMVA 4W9FA 1KRHA 2EMTA 5EE9A 1M94A 1WR6E 1KJTA 2BW2A 2HTME 3AI5A 1J7BA 3JW0X 2MJEA 1VJKA 1ZKHA 2XBBC 4KZCA 4MGZE 3P63A 3V6CB 1FCLA 2NR2A 1Q1OA 4C7ZA 3W1SA 2ACZB 4PS8A 5EDSA 4OVZA 4X57B 1EM7A 2YVCA 3NS1A 1TS3A 2DZKA 3E9SA 3U2SC 3JYUA 4US9A 1YQ4B 1KTKA 3RNCC 2KTFA 4KZ0A 1AARA 4C80A 3JSVA 1VD2A 2IY1B 3UINB 4ARIA 1WXQA 2OOBB 2INCC 3ZVVA 3W9CB 2HJ8A 4ICUA 4MGYE 3QQ8B 3Q3FA 2D3CA 3M95A 1KFYB 1D5MC 1UGJA 2WNMA 3R2IA 1QOFA 3KWVA 3W1SC 1V6EA 5D3IB 1L6UA 1SGHA 4ARCA 1C77A 4NQLB 2AQ1B 2JT4B 4A90A 3SR6A 2D5GA 4L2YA 4YT0B 3ECIA 3NRZA 3QC8B 5AZHA 2C7NB 3AU4A 3SU8X 1K51A 1F9JA 5G5HA 1PDXA 1F1HA 3RMKC 1MHHE 3IAM1 2PPHA 3FKYA 3IXSA 3CMMB 5E6JA 3N1XC 2JY6A 3EECA 1DOXA 2D07B 3DBSA 1L0XB 3IT6B 4FBJB 4P7IA 2LASA 2FUHB 3VUYA 3DBLB 1AN8A 1AYFA 2QEJC 3Q3OC 2OEDA 3HM3A 4J3OD 4C4VB 3IG3A 3V61A 2ZJDA 5IKCM 1J7AA 2NVUI 4AQ7A 4A20A 5T8IA 2EELA 2QHOA 3KYCD 1V1PA 2CS4A 4DHZB 1DGJA 1Y8RC 1RM6C 3GS2A 2JQRB 2HTHA 2BS2B 4XDDA 3ML9A 2BWFA 4BAXA 1GNUA 1OFFA 3HM6X 4MACA 4MGKE 2N1WA 4WWPA 2FCQA 2GMIC 2L1AA 2Y5PA 2JWZA 2CU3A 2BS3B 4RF0A 4WWNA 1ESFA 2J42A 4HRSA 1JQ4A 2IY0B 3MTNB 4WURA 4DXAB 3NG0A 1UUPA 2V3NA 3URYA 4IOIE 1YIWA 3V62A 4A3OA 4REZA 2RMMA 4XE0A 1WXAA 1AW7A 1YNTE 4FLHA 3I3TB 1KLGD 3NVVA 4OZAA 1YMHE 2WP9B 2WXFA 3MP9A 4XWWA 3UF8A 2UYZB 3AE1B 5I4DA 3U7ZA 4XDCA 2LI5A 2R2QA 2ZW1A 3P42A 1HZ5A 3QJZA 2KFKB 2NBUA 4YTNB 3B08A 2M0AA 1T6BX 1UWMA 3TMPB 3AE6B 5GMVA 4A8XC 2IJ0A 1TKGA 2L83A 5D2MB 3RNAC 1K50A 1WJ6A 2N9XA 5FK9C 1OEYJ 3AE9B 1FNWA 2KN5A 4LCDE 1I4XA 1WWTA 3O13A 4BBNF 3J9CA 4WWMA 3VTUA 4HKZE 3LB8C 4RM9A 4MT5A 3IFWB 2WDVB 4M0WB 4WQMA 1WH3A 3PHWB 2JYEA 2PKOA 1GB1A 2CJOA 2RGFA 4JL9A 2LFIA 3WALA 5G55A 2N9KA 1VZ6A 3AXCA 3KW5B 1IBXA 4B9KA 5G5GA 1KLUD 1ROEA 5FR6A 3V6EB 2MQJA 2WXOA 1MG4A 1BUIC 3X23A 2PIAA 1T0SC 1WF9A 5IN7A 5TR5A 3RD2A 1SE9A 4YTPB 4G0NB 2JRIB 1JWUD 1QLBB 4KGTA 4DHJB 2WXLA 2GLSA 3P4RB 4WQOB 4MDKE 1V1OA 2FBWB 3AE3B 4NY0A 3ZNGC 1VCBA 4II3B 3W5UB 1XEEA 3AU5A 5D7GA 1AWDA 1PGAA 3ZUNA 3L13A 3NS8A 1XCQL 3W5VB 1T0YA 2BYVE 4LJPB 2KJRA 3DBLI 1IP9A 4DK5A 4TV3A 4KX6B 4AJWA 2J53A 2ZNVB 3Q8EA 4HLEA 4BKSA 4E3CA 1YQ3B 3SD5A 1L4DB 3R7RA 3ZJUA 1C9FA 2AQ3B 3AM9A 2MJ3A 3NY5A 1WRIA 4YL8A 1P1AA 2JWUA 2KC1A 3N30A 2AQ2B 2D3BA 1SBBB 3QHTA 2LWPA 2JRHA 3T8MA 1K53A 3HVZA 1HZ6A 3AEAB 4JGHB 1GJZA 2KFJA 4L23A 4BOZB 1V8CA 3TSSA 1QF6A 4TQ1A 1WR1A 3N1YC 3GB1A 4RF1A 3SHQA 2BKRB 2KO3A 2LGDA 1TY2A 2N1VA 2INPE 3WAPA 1UH6A 4W9IA 4PYUA 3FILB 1JALA 2LJ5A 2G4DB 1QKZA 1I4PA 1YJ1A 5EE1A 1XXGA 2FIFA 2PJHA 1XLNA 2MA9B 4OZCA 1PQSA 2V3SA 3R7QA 5E6PA 4M01A 2ONQA 2SAKA 4ZYNA 2E6XA 4W9DA 2PW9A 5KHOA 1FXAA 3DPDA 2KOXA 3APFA 4IG7B 3EHVA 2J0MA 2QMTA 2PVGC 3AEGB 4AS1A 4KGSA 4HDQA 1FD6A 4JWSC 1ET9A 2WXNA 2NPTB 3PVLA 1EU4A 1WMHA 4DDID 4IW0A 4OHJA 3FAHA 4LNIA 2MWSB 3OG5A 2KAJA 2XK5B 2V4LA 4Q2JA 3RN9C 4S0RA 1UBIA 3HHMA 4RGNA 2MJDA 2WS3B 1WXMA 2ZVNA 2L05A 2IPKD 3UI3A 4DQOC 3AB5A 4C4VA 2WXPA 4K7WA 1L2NA 1N62A 3ZTDA 1JWBD 1ZW7A 1XQQA 5G2NA 1ENFA 1I4HA 2K0PA 4DBGA 1F0ZA 1B1ZA 1ZGUB 2CKHB 2KTRA 2O6VD 2WYQA 4A9AA 3TJPA 2KQ4X 2WXJA 5C2TB 3RZWC 1C4CA 3PHXB 4GXBA 4BVUC 3HK0A 4M8MA 2ZVOA 1SE2A 2VRRB 3QARA 2JSVX 3PZ7A 2WWZA 4GLSC 1TZOA 4HCPB 2KHWB 4CHKA 4KSKC 4IUMB 1R7SA 3R8BA 4GDKB 3PGEA 4I6NB 1D5XC 3QWZB 3DBHB 4DWFA 3KLSX 4LNFA 4FJZA 1JWMD 2IO3B 4DXGA 2KZRA 2W54A 2W3RA 1LFDA 4ZRPA 5HI1A 1TKYA 3ZDTA 2KLCA 2V3PA 2JYTA 3ENEA 3TEXA 3U52E 1SE3A 3EC8A 2L0FA 1PUTA 4KKJA 2ASQA 2K8BA 1YJJA 1EWYC 4RH6A 3C19A 2BTEA 2J0JA 1D4BA 3P2BA 2KFKA 2WXMA 2N4FA 2BPSA 4JQWC 4ANVA 1Z5SB 4K3BA 5JHAA 1SE4A 2DWQA 5LXHA 5AEKB 4EFOA 1TS5A 3ZQ4A 2NBVB 2KWDA
chains in the Genus database with same CATH topology
3Q14C 4P1CC 3I5JC 3RMKC 3RNEC 3RNCC 3DHIC 3N1XC 3RNGC 3RNAC 1T0RC 3DHGC 3Q3NC 3GE3C 3RNFC 4P1BC 2INDC 3RN9C 1T0SC 3RNBC 3N1ZC 3DHHC 3Q3MC 3Q2AC 2INCC 3N1YC 1T0QC 3GE8C 3RI7C 3I63C 3Q3OC 2RDBC 3N20C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q14 C;  4P1C C;  3I5J C;  3RMK C;  3RNE C;  3RNC C;  3DHI C;  3N1X C;  3RNG C;  3RNA C;  1T0R C;  3DHG C;  3Q3N C;  3GE3 C;  3RNF C;  4P1B C;  2IND C;  3RN9 C;  1T0S C;  3RNB C;  3N1Z C;  3DHH C;  3Q3M C;  3Q2A C;  2INC C;  3N1Y C;  1T0Q C;  3GE8 C;  3RI7 C;  3I63 C;  3Q3O C;  2RDB C;  3N20 C; 
#chains in the Genus database with same CATH topology
 3NZ3 A;  1EF1 A;  5LLI A;  4F7Z A;  3BWU D;  3L08 A;  1T0R C;  1UEL A;  3N32 A;  4MM3 B;  2VH1 A;  1X1M A;  1VR9 A;  2NTS A;  4NAM A;  3AEB B;  2DNF A;  3SFE B;  3SDL C;  3Q3M C;  3EUB 2;  4IM3 A;  1Z2M A;  3AED B;  2HJ1 A;  3GE8 C;  4OVU A;  3K9P B;  2A5U A;  5IP4 D;  3HRD D;  4XZ4 A;  3H8H A;  4W9K A;  3LDZ E;  1I7H A;  2L7R A;  3QK0 A;  4ZRJ A;  2KWV B;  3H1U A;  1E7U A;  4M0W A;  3ABV B;  2D2Q A;  1Q0W B;  1Q10 A;  2FCN A;  3CWI A;  3BK2 A;  4TKN A;  1GPX A;  3AV8 A;  3VRA B;  5GXG B;  1T5X D;  2B76 B;  1U4A A;  1V5O A;  1DOI A;  4US8 A;  3O65 B;  2FCS A;  3OLM D;  3WAM A;  3PLU A;  3OAW A;  4IWP A;  3MHS D;  4ANW A;  2N7D A;  2KDB A;  2AYO B;  2CHZ A;  4HXD A;  1SIJ A;  4K7U A;  2K6D B;  2PMV A;  1TKE A;  2BYT A;  2CHX A;  1TGZ B;  3ZRC A;  4HEA 1;  2Z0D B;  2WXQ A;  1NDD A;  3CF6 E;  1FIQ A;  2N7E A;  3AEC B;  4WIP A;  1K8R B;  3AMZ A;  4KIK B;  4CQN A;  1XT9 B;  4E74 A;  4M02 A;  3WCQ A;  3BIN A;  3C8Y A;  2WDT B;  2MRP A;  3MC8 A;  4DHZ E;  4N59 A;  2BYE A;  1L7Y A;  4IWQ A;  2RPQ A;  4FHJ A;  2CU1 A;  4GSW A;  3P4Q B;  4EZJ A;  3U8Z A;  1V86 A;  4R3D A;  3I57 A;  1TY0 A;  3RT3 B;  4JX1 C;  4XYC A;  1F77 A;  3W1Y A;  5IOI A;  3ML8 A;  2KVZ A;  3ONS A;  4N58 A;  1ZPS A;  3UQB A;  3S2A A;  1KF6 B;  5E6O A;  3DHI C;  2IO1 B;  1ZDV A;  2EKE C;  2D3A A;  3EFC A;  2BBC A;  1CMX B;  4LNK A;  3VR9 B;  1WGY A;  3HUI A;  3ZJV A;  3TEZ A;  1WX7 A;  1WGK A;  2JZP A;  2MBQ A;  3MC0 B;  1V81 A;  3VUX A;  1ZOY B;  2FE8 A;  1YN5 A;  2QCZ A;  2MBO A;  4JLC A;  2N9P C;  3U30 A;  1WX9 A;  2BGF A;  1SIF A;  4HPM B;  4WJQ A;  4DDG D;  1E7P B;  4RCO A;  3KH0 A;  2AL3 A;  1UGM A;  1FRD A;  1QZE A;  2ZNV C;  3FIL A;  2PTL A;  5H92 C;  1HEZ E;  3RCZ A;  5CTR C;  3I5J C;  5FKA C;  2W9N A;  1ISN A;  5C3J B;  5MPO A;  3DBH I;  2N0S B;  4LDT D;  1HA5 A;  2LXC A;  1JCK B;  1GOZ A;  1WI0 A;  2NMQ A;  1QOA A;  4AUQ C;  1OQR A;  3TBL D;  1N5X A;  3L4P A;  2JXT A;  2K8H A;  4EE2 A;  4RNA A;  3WA0 A;  1R4N B;  4RGT A;  1RLF A;  5AUK A;  4NJ7 A;  1V97 A;  4PT5 A;  3RUL A;  1TT5 B;  1IGC A;  2K39 A;  1XLP A;  1RFK A;  4GDL B;  2KLG A;  1J8C A;  2M17 A;  2NPT A;  3A1Q B;  1C79 A;  2LUM A;  3ZIM A;  1I4Q A;  3ZKJ C;  1XCT L;  2DAF A;  1DOY A;  1I4G A;  2KX0 A;  3TIX A;  3U7D A;  3V05 A;  2JZ3 B;  3ZNH B;  5HG2 A;  2V1Y A;  2LMC A;  4MGI E;  3CST A;  1D5Z C;  1S3S G;  4FJV B;  1ACC A;  1ZDX A;  3VRB B;  1MPE A;  3WAN A;  1WGR A;  2MBH A;  2WU2 B;  4KVG B;  4BKT A;  2V0G A;  4ZRK A;  2GOW A;  1WZ3 A;  3RFZ B;  4GU2 A;  2M19 A;  3TCA A;  4EOY A;  4USA A;  1E6E B;  2KMC A;  3CIR B;  5EE0 A;  4YSY B;  4W9C A;  2UU7 A;  2QIE B;  2BF8 B;  3DWG C;  2JF5 A;  2YEP B;  3DHH C;  1Q5W B;  3PRM B;  1UNS A;  4L1B A;  4G50 A;  1C78 A;  4NZL B;  3NJT A;  1A5R A;  2WU5 B;  4BFR A;  2PLP A;  4ANU A;  2KYW A;  4HDO A;  3DWM A;  4LJO B;  2LGI A;  4HJK A;  2O6V B;  5BMH A;  2KT7 A;  4GDK A;  3PZ8 A;  3N3K B;  4GOC A;  2MEK A;  3VUW A;  2BB5 A;  2RDG A;  3P4P B;  2ZZP B;  1NI2 A;  2IGD A;  4W9G A;  1V80 A;  4CYE A;  3OJ4 B;  3MFG A;  3LYY A;  4ZRI A;  1FXT B;  1LO5 D;  3LXF A;  1OQY A;  2KAN A;  4NJ6 A;  2E3T A;  1R4M B;  4LNN A;  3TEW A;  4KDI C;  3RNF C;  2K1F A;  2KJH B;  3PRE A;  2WXH A;  3N1Z C;  1VZ8 A;  4HWI B;  2L0T A;  4FJY A;  2JPH A;  1D3Z A;  3ZRF A;  2KKC A;  1EUV B;  2RPV A;  2KK8 A;  1WXS A;  3X0W A;  3VQI A;  3KVF B;  3AH7 A;  2LGX A;  1YOV B;  5CHF A;  1UWX A;  1GC6 A;  2LEK A;  2IGG A;  2PE9 A;  3ZYY X;  3QCA A;  3PRP B;  2LHE A;  4PS7 A;  2Z59 B;  3A4S C;  3BZD B;  2BVC A;  3Q8C A;  2AEH A;  2DLB A;  1GC7 A;  4IC7 B;  3MJ5 A;  2L32 A;  1JRO A;  1PYW D;  4MM3 A;  3DHG C;  4GB9 A;  1C4A A;  2WDR B;  2IO0 B;  4IDI A;  1OEY A;  3K9O B;  4HKQ A;  3B2F A;  4IKG A;  4HPL B;  3P4S B;  2FNJ B;  1K52 A;  1FNV A;  1WJU A;  2M4N A;  3LJ3 A;  4G11 A;  1XO3 A;  3RNE C;  1FO4 A;  1VRA B;  2BQQ A;  2NCN A;  3KUC B;  1OTR B;  3UIP B;  1FFV A;  3ZDM C;  3AE8 B;  1WXV A;  1EF5 A;  1HE8 A;  2H88 B;  2LVP A;  4FA6 A;  3IBE A;  2L76 A;  3B1L X;  3QAQ A;  1E8W A;  2KD0 A;  3M3J A;  3Q14 C;  1CZP A;  1XLQ A;  2L3Z A;  2GB1 A;  3C0R B;  1EU3 A;  3VH3 B;  4TQ0 A;  1GG3 A;  2J7Q B;  1R4N I;  3L0W B;  2WXR A;  3MJW A;  2JVC A;  2DEN B;  3PV1 A;  1C3T A;  4KIK A;  4QAY A;  4RMA A;  2KDF B;  4ZRQ A;  3ZGZ A;  2IYD B;  2I38 A;  1JRP A;  1GAQ B;  2MH7 A;  3ZXR A;  1WGG A;  2C7H A;  1J19 A;  2AWT A;  1WM3 A;  3RNG C;  1YN4 A;  2X8X X;  3BVG A;  4P1B C;  2W55 A;  2O2V B;  1LGR A;  1WYG A;  2ZCB A;  5HFY A;  1RYJ A;  2ON8 A;  2KJ6 A;  4GN1 A;  4JWU C;  2PVO D;  2K6Q A;  2KDI A;  4C7Y A;  1WSP A;  3GZN B;  4URK A;  4NAW B;  2NTT A;  3B9J A;  1MG8 A;  2D10 A;  1MFW A;  2KMA A;  3DVN U;  2FCM A;  5BYS A;  3SFD B;  1TBE A;  5AZF A;  1TS2 A;  3NZU A;  4RGO S;  3ZLZ A;  1QIL A;  1VZ7 A;  2GBJ A;  2R2O A;  2KWU B;  3L17 A;  4HCN B;  5LNK 1;  2A4Z A;  3APC A;  2WLB A;  5IA7 A;  2X38 A;  2M8S A;  1L5P A;  1YX5 B;  4N6E B;  2IDY A;  3FC4 A;  4ACF A;  5JHB A;  2VZK D;  5IAA C;  3TUO A;  3MHZ A;  1MJD A;  1HTO A;  2L52 A;  3RNB C;  1EWC A;  2KMM A;  4MJS B;  1V2Y A;  2N9L A;  5D94 A;  1SSN A;  4KSL C;  4W9J A;  2K3U A;  1OGW A;  1FPY A;  1F52 A;  1JML A;  1S1Q B;  2GBN A;  2LHD A;  4M00 A;  3NZS A;  1RRB A;  1YN3 A;  3NVW A;  1QOB A;  2KDE B;  1WE7 A;  2ZPN A;  2YEP F;  1R4M I;  3A9K B;  3R66 C;  1ZXI A;  4JIO U;  4PYZ A;  1CQV A;  3WAO A;  1N60 A;  3NVY A;  3VTV A;  4LDT B;  1UF0 A;  2OJW A;  1LQB A;  4GDL A;  3A1Q A;  4J6I A;  3ZW3 A;  4NNJ B;  2KAC A;  2GRI A;  4RGM A;  4JE3 B;  5CHW A;  5E6N A;  2BS4 B;  3Q2A C;  4DXF A;  1BXT A;  2ICI A;  3I63 C;  4AOF A;  3A33 B;  1FNU A;  3T3N A;  2ZEQ A;  2HDE A;  3PTF C;  4P16 A;  5CX3 A;  1TYG B;  4AJY B;  2BYF A;  2IZV B;  2BKF A;  3T3O A;  4JPS A;  1LXD A;  2KDM A;  2DYO A;  4HVB A;  2H89 B;  3VXW A;  1WZ0 A;  1C76 A;  2IBI B;  2BT6 A;  2KC2 A;  2I2Y A;  4XGA B;  5BYR A;  1T0Q C;  2MSE D;  4GGQ A;  1NBF C;  2M56 B;  4E71 A;  2K8C A;  2W82 A;  4K81 A;  3B0A A;  2DZI A;  3EA6 A;  2AX5 A;  1WFY A;  1E8X A;  1QQR A;  1MI0 A;  2RDH A;  1C4P A;  2D3G A;  2DYM A;  1L4Z B;  4IM2 A;  1FXI A;  3L16 A;  5TSS A;  4FUL A;  4TUU A;  2WX0 A;  2JU6 X;  1SJH D;  3H7S A;  2N7J A;  1C1Y B;  4AP4 C;  4TMA B;  2O6V A;  3Q3N C;  5J17 A;  4ZOH C;  4HRO A;  2LUE A;  3NHE B;  1P7E A;  3A4R A;  3OWE B;  3H7P B;  4B0E A;  4MEL A;  4YTM B;  1LM8 B;  3DBR B;  1BML C;  3M63 B;  2V4I B;  1TZ1 A;  1VLB A;  3DCG A;  1N5W A;  4ANX A;  1E8Y A;  4K1R B;  1KM7 A;  3M62 B;  3VVW B;  1IYF A;  5LXI B;  4CO7 A;  1XF5 L;  4B95 A;  4YXD B;  4MH0 E;  2RR9 A;  2KVR A;  3Q8B A;  1WGH A;  1WMH B;  3RUI B;  1IUE A;  3KUZ A;  3VAW A;  4A55 A;  3IT4 B;  4PK1 A;  2K25 A;  3BII D;  4G3X B;  1M4V A;  3NUH B;  1WRD B;  1IPG A;  2QDF A;  4WWO A;  2MLB A;  2Z8L A;  1TTN A;  3R3M A;  3ZXV A;  3BVM A;  2UWQ A;  2NS5 A;  3GZN I;  4W9E A;  3GE3 C;  3VH4 B;  1V9J A;  4WAA A;  4OVV A;  1SJE D;  2QSD A;  2I1K A;  1UD7 A;  1N63 A;  4FAD A;  2QC8 A;  3OJ3 A;  3A9J B;  2KQS A;  2LXA A;  2WDQ B;  4WJP A;  5J2R A;  2JZZ A;  1E90 A;  4OZB A;  2DHZ A;  2RD0 A;  3AEF B;  5L95 C;  2CJN A;  2HD5 B;  5DPT A;  1WM2 A;  1MHX A;  4BZA A;  2KTR B;  4D2K A;  4XWT A;  1XD3 B;  3E56 A;  1HXY D;  2D11 A;  3HVD A;  2JUO A;  1WJN A;  3H6N A;  4F8C B;  3N20 C;  1SXT A;  2BB6 A;  3AUL A;  4M8N A;  1YD8 U;  3WIM A;  3AEE B;  2SEB D;  2LGY A;  1E7V A;  2FID A;  2WXI A;  3AE2 B;  2XNA C;  1ET6 A;  1V5T A;  2W3S A;  4I6P A;  1WY8 A;  5JH5 C;  4WH4 A;  1E0Z A;  4ICV A;  2MW5 A;  4XC2 A;  5EE3 A;  3DVG Y;  2WHI A;  2MP2 B;  2CR5 A;  5BYQ A;  3IHP C;  1P98 A;  1KOT A;  2V9H A;  5AUI A;  3Q3J A;  3AE7 B;  2GBM A;  2K22 A;  2LRW A;  1F2R I;  3PO0 A;  1N6Z A;  3EGR A;  1TIF A;  2KNB A;  1E5W A;  3PRZ A;  1E10 A;  1STE A;  3APD A;  4H2A A;  2BWE S;  1KH0 A;  4BKS D;  1KLV A;  1N61 A;  1FEH A;  2K5P A;  3VDZ A;  3N9Y C;  3GOE A;  1FCC C;  3RYT A;  4EZK A;  1FMA D;  4YSZ B;  2XK5 A;  3PPA A;  2O2V A;  2MBE A;  3BYT B;  1UBQ A;  3DVN V;  2PE6 B;  1JWS D;  1GUA B;  5L83 A;  2GBK A;  3JVZ X;  4AWJ A;  1J7C A;  2G1E A;  1JW9 D;  3QX1 A;  3VR8 B;  1A70 A;  1NYR A;  2KN4 A;  2LVQ A;  5C1Z A;  3I9V 1;  4NAW A;  1OQQ A;  4B0M A;  3GP7 A;  2JX5 A;  1NVI D;  2R61 A;  1I4R A;  1NI3 A;  4LLG M;  2AL6 A;  2MX2 A;  2N9E B;  3CSF A;  2IND C;  4MSQ B;  1ZXH A;  5FR3 A;  1EO6 A;  3IAS 1;  3UIO B;  4YWG G;  4A6Q A;  4K3C A;  2PEA A;  3Q8F A;  2QIL A;  2IGH A;  2NBW B;  3Q69 A;  4W9L A;  1RAX A;  1J0G A;  4P1C C;  2IO2 B;  5DPS A;  4FXC A;  3D32 A;  4TSS A;  3B2G A;  1Y56 A;  2DX5 B;  3BY4 B;  3JSV B;  1HTQ A;  4MJS A;  2KQ7 A;  1QT9 A;  2WXK A;  3BK1 A;  4IM0 A;  2KX3 A;  2C5L C;  4RM8 A;  5H8Y E;  1P0R A;  1JRU A;  2G9H D;  3QIJ A;  4OW0 A;  3ETR A;  4WJO A;  1P7F A;  3U4E G;  3DBR I;  2DZJ A;  2VZK B;  2YLM A;  3PS6 A;  1RWS A;  3W2D A;  3AE4 B;  4ZDV A;  2XN9 C;  3T9L A;  4EUT A;  4BKG A;  3QA8 A;  5HHD G;  2VH2 A;  2Q5W D;  3A9K A;  4UDU C;  1DYQ A;  2ZW0 A;  5HKH A;  4MEM A;  1QOG A;  3Q6B A;  3V3X A;  3VFK A;  4FHK A;  4B6W A;  4FN2 A;  1XLO A;  5BO4 B;  4KKI A;  3SEB A;  2G4S A;  2REX A;  2EKI A;  4A3P A;  3UGB B;  3KQ4 A;  2RDB C;  4I6L B;  1GB4 A;  5D3D A;  2DZM A;  5DPR A;  2WQY B;  3DQV A;  4S17 A;  1F2R C;  1PGB A;  5KHQ A;  1V49 A;  4KGR A;  1MVK A;  2OHF A;  1PGX A;  1P3Q U;  2C60 A;  1UZX B;  3KWL A;  4LTU A;  1I35 A;  4KV2 A;  1NEK B;  3Q8A A;  4K7S A;  2Y5C A;  1SEB D;  2Y5B B;  2ZCC A;  5BMI A;  1V1P B;  1CJE A;  1I42 A;  3ZTC A;  1YQB A;  1ZP0 B;  1T3Q A;  2J0K A;  2B3A A;  3PSE B;  3EFU A;  3KUD B;  3PLV A;  1NYQ A;  2LGS A;  4BBN C;  2FAZ A;  4BOS C;  4ZHO A;  3L10 B;  4YSX B;  3ALB A;  1IGD A;  2QJL A;  3MC9 A;  1FM0 D;  2KXJ A;  3VHT C;  1RFA A;  4IWO A;  4KDL B;  4EEW A;  5C23 A;  5DCN A;  1JWA D;  1FRR A;  1NEN B;  2XEW A;  3TL5 A;  2JXX A;  3DDC B;  2M1M A;  2L8J A;  3H7P A;  1YJI A;  5J18 A;  1E9M A;  1D6E C;  4P6V F;  2MCN B;  2Y3A A;  2I1J A;  2EMS A;  1SF0 A;  2WXG A;  3VTW A;  2GBR A;  3RPF C;  3V60 A;  1TJE A;  2LJI A;  3KYD D;  2RSU A;  4HK2 A;  3RZF A;  2MHJ A;  2FUG 1;  3BYY B;  4ZYS A;  1CK1 A;  5BMG A;  1YX6 B;  4C56 C;  2TSS A;  3ZNI D;  5IO9 A;  2MBB B;  4W9H A;  4N9F 4;  2C7M B;  1L0V B;  1WGD A;  2WX1 A;  2Z0E B;  3ZJT A;  3IVF A;  2INN E;  1WE6 A;  2L00 B;  3DOW A;  4O1N A;  4ASW C;  1FFU A;  4NQK E;  1E8Z A;  4HPP A;  3PZD A;  4II2 B;  2ZPY A;  3A9J A;  5D6J B;  5DPW A;  4MH8 A;  4XX5 A;  1WYW B;  2LVO A;  3ZO5 B;  2KWC A;  3BVZ A;  1PFD A;  1L0Y B;  2J4X A;  2GI9 A;  3AN1 A;  4ZHP A;  1P9D U;  2LRU A;  1ZE3 D;  4PS3 A;  4LNO A;  4EZL A;  2DBY A;  3DVG X;  1SB3 C;  3RI7 C;  3PT2 B;  4NJC A;  1IBX B;  4EKU A;  1TS4 A;  4LK0 M;  2CHW A;  4DHJ D;  2G45 B;  1BT0 A;  1G6J A;  4ITK A;  2LZ6 A;  1WX8 A;  1H4R A;  3AE5 B;  2C9W B;  4NPN A;  3R2T A;  3UQA A;  4C00 A;  3TEY A;  1H8C A;  2DYB A;  2WGS A;  1ZUD 2;  1HQR D;  2HE7 A;  2MP2 A;  2K9X A;  5JZE B;  4HJG E;  2J52 A;  3NOB A;  3H9D A;  3P1M A;  1B9R A;  4GIV A;  3L54 A;  2DAJ A;  5AZG A;  4F1S A;  3ZNZ B;  4MSM B;  3HIZ A;  1WIA A;  1VDV A;  4WJN A;  4RFB A;  1L6V A;  2OJR A;  2LD9 A;  2M0X A;  4WAF A;  5JXV A;  2G3Q B;  1WJ4 A;  3NVZ A;  5CHV C;  4GMV A;  4W9F A;  1KRH A;  2EMT A;  5EE9 A;  1M94 A;  1WR6 E;  1KJT A;  2BW2 A;  2HTM E;  3AI5 A;  1J7B A;  3JW0 X;  2MJE A;  1VJK A;  1ZKH A;  2XBB C;  4KZC A;  4MGZ E;  3P63 A;  3V6C B;  1FCL A;  2NR2 A;  1Q1O A;  4C7Z A;  3W1S A;  2ACZ B;  4PS8 A;  5EDS A;  4OVZ A;  4X57 B;  1EM7 A;  2YVC A;  3NS1 A;  1TS3 A;  2DZK A;  3E9S A;  3U2S C;  3JYU A;  4US9 A;  1YQ4 B;  1KTK A;  3RNC C;  2KTF A;  4KZ0 A;  1AAR A;  4C80 A;  3JSV A;  1VD2 A;  2IY1 B;  3UIN B;  4ARI A;  1WXQ A;  2OOB B;  2INC C;  3ZVV A;  3W9C B;  2HJ8 A;  4ICU A;  4MGY E;  3QQ8 B;  3Q3F A;  2D3C A;  3M95 A;  1KFY B;  1D5M C;  1UGJ A;  2WNM A;  3R2I A;  1QOF A;  3KWV A;  3W1S C;  1V6E A;  5D3I B;  1L6U A;  1SGH A;  4ARC A;  1C77 A;  4NQL B;  2AQ1 B;  2JT4 B;  4A90 A;  3SR6 A;  2D5G A;  4L2Y A;  4YT0 B;  3ECI A;  3NRZ A;  3QC8 B;  5AZH A;  2C7N B;  3AU4 A;  3SU8 X;  1K51 A;  1F9J A;  5G5H A;  1PDX A;  1F1H A;  3RMK C;  1MHH E;  3IAM 1;  2PPH A;  3FKY A;  3IXS A;  3CMM B;  5E6J A;  3N1X C;  2JY6 A;  3EEC A;  1DOX A;  2D07 B;  3DBS A;  1L0X B;  3IT6 B;  4FBJ B;  4P7I A;  2LAS A;  2FUH B;  3VUY A;  3DBL B;  1AN8 A;  1AYF A;  2QEJ C;  3Q3O C;  2OED A;  3HM3 A;  4J3O D;  4C4V B;  3IG3 A;  3V61 A;  2ZJD A;  5IKC M;  1J7A A;  2NVU I;  4AQ7 A;  4A20 A;  5T8I A;  2EEL A;  2QHO A;  3KYC D;  1V1P A;  2CS4 A;  4DHZ B;  1DGJ A;  1Y8R C;  1RM6 C;  3GS2 A;  2JQR B;  2HTH A;  2BS2 B;  4XDD A;  3ML9 A;  2BWF A;  4BAX A;  1GNU A;  1OFF A;  3HM6 X;  4MAC A;  4MGK E;  2N1W A;  4WWP A;  2FCQ A;  2GMI C;  2L1A A;  2Y5P A;  2JWZ A;  2CU3 A;  2BS3 B;  4RF0 A;  4WWN A;  1ESF A;  2J42 A;  4HRS A;  1JQ4 A;  2IY0 B;  3MTN B;  4WUR A;  4DXA B;  3NG0 A;  1UUP A;  2V3N A;  3URY A;  4IOI E;  1YIW A;  3V62 A;  4A3O A;  4REZ A;  2RMM A;  4XE0 A;  1WXA A;  1AW7 A;  1YNT E;  4FLH A;  3I3T B;  1KLG D;  3NVV A;  4OZA A;  1YMH E;  2WP9 B;  2WXF A;  3MP9 A;  4XWW A;  3UF8 A;  2UYZ B;  3AE1 B;  5I4D A;  3U7Z A;  4XDC A;  2LI5 A;  2R2Q A;  2ZW1 A;  3P42 A;  1HZ5 A;  3QJZ A;  2KFK B;  2NBU A;  4YTN B;  3B08 A;  2M0A A;  1T6B X;  1UWM A;  3TMP B;  3AE6 B;  5GMV A;  4A8X C;  2IJ0 A;  1TKG A;  2L83 A;  5D2M B;  3RNA C;  1K50 A;  1WJ6 A;  2N9X A;  5FK9 C;  1OEY J;  3AE9 B;  1FNW A;  2KN5 A;  4LCD E;  1I4X A;  1WWT A;  3O13 A;  4BBN F;  3J9C A;  4WWM A;  3VTU A;  4HKZ E;  3LB8 C;  4RM9 A;  4MT5 A;  3IFW B;  2WDV B;  4M0W B;  4WQM A;  1WH3 A;  3PHW B;  2JYE A;  2PKO A;  1GB1 A;  2CJO A;  2RGF A;  4JL9 A;  2LFI A;  3WAL A;  5G55 A;  2N9K A;  1VZ6 A;  3AXC A;  3KW5 B;  1IBX A;  4B9K A;  5G5G A;  1KLU D;  1ROE A;  5FR6 A;  3V6E B;  2MQJ A;  2WXO A;  1MG4 A;  1BUI C;  3X23 A;  2PIA A;  1T0S C;  1WF9 A;  5IN7 A;  5TR5 A;  3RD2 A;  1SE9 A;  4YTP B;  4G0N B;  2JRI B;  1JWU D;  1QLB B;  4KGT A;  4DHJ B;  2WXL A;  2GLS A;  3P4R B;  4WQO B;  4MDK E;  1V1O A;  2FBW B;  3AE3 B;  4NY0 A;  3ZNG C;  1VCB A;  4II3 B;  3W5U B;  1XEE A;  3AU5 A;  5D7G A;  1AWD A;  1PGA A;  3ZUN A;  3L13 A;  3NS8 A;  1XCQ L;  3W5V B;  1T0Y A;  2BYV E;  4LJP B;  2KJR A;  3DBL I;  1IP9 A;  4DK5 A;  4TV3 A;  4KX6 B;  4AJW A;  2J53 A;  2ZNV B;  3Q8E A;  4HLE A;  4BKS A;  4E3C A;  1YQ3 B;  3SD5 A;  1L4D B;  3R7R A;  3ZJU A;  1C9F A;  2AQ3 B;  3AM9 A;  2MJ3 A;  3NY5 A;  1WRI A;  4YL8 A;  1P1A A;  2JWU A;  2KC1 A;  3N30 A;  2AQ2 B;  2D3B A;  1SBB B;  3QHT A;  2LWP A;  2JRH A;  3T8M A;  1K53 A;  3HVZ A;  1HZ6 A;  3AEA B;  4JGH B;  1GJZ A;  2KFJ A;  4L23 A;  4BOZ B;  1V8C A;  3TSS A;  1QF6 A;  4TQ1 A;  1WR1 A;  3N1Y C;  3GB1 A;  4RF1 A;  3SHQ A;  2BKR B;  2KO3 A;  2LGD A;  1TY2 A;  2N1V A;  2INP E;  3WAP A;  1UH6 A;  4W9I A;  4PYU A;  3FIL B;  1JAL A;  2LJ5 A;  2G4D B;  1QKZ A;  1I4P A;  1YJ1 A;  5EE1 A;  1XXG A;  2FIF A;  2PJH A;  1XLN A;  2MA9 B;  4OZC A;  1PQS A;  2V3S A;  3R7Q A;  5E6P A;  4M01 A;  2ONQ A;  2SAK A;  4ZYN A;  2E6X A;  4W9D A;  2PW9 A;  5KHO A;  1FXA A;  3DPD A;  2KOX A;  3APF A;  4IG7 B;  3EHV A;  2J0M A;  2QMT A;  2PVG C;  3AEG B;  4AS1 A;  4KGS A;  4HDQ A;  1FD6 A;  4JWS C;  1ET9 A;  2WXN A;  2NPT B;  3PVL A;  1EU4 A;  1WMH A;  4DDI D;  4IW0 A;  4OHJ A;  3FAH A;  4LNI A;  2MWS B;  3OG5 A;  2KAJ A;  2XK5 B;  2V4L A;  4Q2J A;  3RN9 C;  4S0R A;  1UBI A;  3HHM A;  4RGN A;  2MJD A;  2WS3 B;  1WXM A;  2ZVN A;  2L05 A;  2IPK D;  3UI3 A;  4DQO C;  3AB5 A;  4C4V A;  2WXP A;  4K7W A;  1L2N A;  1N62 A;  3ZTD A;  1JWB D;  1ZW7 A;  1XQQ A;  5G2N A;  1ENF A;  1I4H A;  2K0P A;  4DBG A;  1F0Z A;  1B1Z A;  1ZGU B;  2CKH B;  2KTR A;  2O6V D;  2WYQ A;  4A9A A;  3TJP A;  2KQ4 X;  2WXJ A;  5C2T B;  3RZW C;  1C4C A;  3PHX B;  4GXB A;  4BVU C;  3HK0 A;  4M8M A;  2ZVO A;  1SE2 A;  2VRR B;  3QAR A;  2JSV X;  3PZ7 A;  2WWZ A;  4GLS C;  1TZO A;  4HCP B;  2KHW B;  4CHK A;  4KSK C;  4IUM B;  1R7S A;  3R8B A;  4GDK B;  3PGE A;  4I6N B;  1D5X C;  3QWZ B;  3DBH B;  4DWF A;  3KLS X;  4LNF A;  4FJZ A;  1JWM D;  2IO3 B;  4DXG A;  2KZR A;  2W54 A;  2W3R A;  1LFD A;  4ZRP A;  5HI1 A;  1TKY A;  3ZDT A;  2KLC A;  2V3P A;  2JYT A;  3ENE A;  3TEX A;  3U52 E;  1SE3 A;  3EC8 A;  2L0F A;  1PUT A;  4KKJ A;  2ASQ A;  2K8B A;  1YJJ A;  1EWY C;  4RH6 A;  3C19 A;  2BTE A;  2J0J A;  1D4B A;  3P2B A;  2KFK A;  2WXM A;  2N4F A;  2BPS A;  4JQW C;  4ANV A;  1Z5S B;  4K3B A;  5JHA A;  1SE4 A;  2DWQ A;  5LXH A;  5AEK B;  4EFO A;  1TS5 A;  3ZQ4 A;  2NBV B;  2KWD A; 
#chains in the Genus database with same CATH homology
 3Q14 C;  4P1C C;  3I5J C;  3RMK C;  3RNE C;  3RNC C;  3DHI C;  3N1X C;  3RNG C;  3RNA C;  1T0R C;  3DHG C;  3Q3N C;  3GE3 C;  3RNF C;  4P1B C;  2IND C;  3RN9 C;  1T0S C;  3RNB C;  3N1Z C;  3DHH C;  3Q3M C;  3Q2A C;  2INC C;  3N1Y C;  1T0Q C;  3GE8 C;  3RI7 C;  3I63 C;  3Q3O C;  2RDB C;  3N20 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...