3GE8C

Toluene 4-monooxygenase hd t201a diferric, resting state complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
b'SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Role for threonine 201 in the catalytic cycle of the soluble diiron hydroxylase toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 25
structure length 82
sequence length 82
chains with identical sequence G
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2009-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3ge8C00
3RNEC 3RMKC 3DHIC 3N1YC 3N1XC 3RNAC 3RNCC 3Q2AC 3I63C 3RNGC 2RDBC 3I5JC 4P1BC 3Q14C 3Q3MC 3N1ZC 3RNFC 3DHHC 3GE3C 3DHGC 3RN9C 2INCC 1T0QC 3RI7C 3N20C 3RNBC 3GE8C 1T0RC 2INDC 3Q3NC 1T0SC 4P1CC 3Q3OC
chains in the Genus database with same CATH superfamily
4HCPB 3AH7A 2JX5A 1YJJA 1L2NA 4WWMA 4USAA 2IO2B 1C9FA 1F77A 1Q1OA 1NI3A 1I4RA 2AL6A 2WXNA 3MC9A 3W1SA 3ZIMA 3TIXA 1TTNA 2VRRB 4AWJA 1P7FA 1M94A 1JALA 4II2B 4HKQA 2Q5WD 2IO3B 4HVBA 3PT2B 1DOXA 2KQ4X 2LJIA 5EE9A 1KH0A 2LGIA 2HTME 2YEPB 1ZPSA 4OW0A 1K8RB 2WGSA 1T0QC 5EE0A 3JSVA 1XD3B 4WAFA 4M00A 1NVID 2KJHB 4HDQA 2IY0B 2NBWB 2A4ZA 3AE5B 4HPPA 1VZ6A 3AEDB 4OHJA 1WI0A 1WYGA 3ZLZA 3AEEB 2AEHA 1WJUA 3IVFA 2LXAA 4A8XC 4B0EA 2G3QB 2INPE 2ZVOA 1WGYA 4IUMB 2FCNA 5E6OA 4ZRKA 5DPWA 1RM6C 4QAYA 2GBJA 1FNWA 2LVPA 1ENFA 4KV2A 2Z59B 2QILA 4WWNA 2W54A 3BIID 1UZXB 2FBWB 5C1ZA 4IWQA 2D3CA 3HK0A 2JUOA 2TSSA 3HHMA 2DZJA 5L95C 2CR5A 3ZXRA 1L5PA 2WDRB 1D5ZC 2C7MB 2J0KA 3TL5A 3V6EB 2W82A 3QAQA 3RNCC 1B1ZA 1SGHA 3PLUA 4IC7B 1D5XC 3DBSA 1WR1A 1I35A 2IO1B 4GLSC 1YMHE 3C19A 2LZ6A 4MACA 2INDC 4HK2A 2RPVA 5HFYA 3HM3A 1C1YB 2L00B 4ZRJA 3GZNI 2G45B 1VJKA 2LRWA 3GZNB 4NQLB 2AL3A 1V1PB 4PT5A 2NPTB 3FKYA 3W1SC 1CMXB 1XT9B 3R7RA 1WWTA 1FFVA 3Q3OC 1YIWA 2A5UA 1KJTA 2PIAA 3QK0A 2RSUA 4W9CA 1LQBA 5FR3A 3VR8B 1N63A 3AN1A 1WE6A 2V3SA 3PV1A 1FRDA 4IKGA 5H92C 3DVNU 3B0AA 2JZ3B 2WYQA 3Q3NC 1XLNA 4YTNB 5TSSA 2L7RA 1WJ6A 3N1YC 2XK5A 2V4LA 1TS3A 3VHTC 3LJ3A 2Y5BB 3AI5A 3DBRI 2L8JA 2KNBA 3ZNZB 3SR6A 2QMTA 1QOAA 3DBRB 1GNUA 4W9IA 1CZPA 4IWOA 4HJKA 2KJ6A 1IGCA 1PYWD 3R2IA 2VH2A 5LLIA 4NNJB 2KANA 2KZRA 1MJDA 3RNGC 2C5LC 1L4DB 2GRIA 1QILA 4TQ1A 2GB1A 2NBUA 1UWMA 3V61A 3A9KB 2L83A 3MJ5A 2KTRB 1TYGB 4FJVB 2ZEQA 1EUVB 4WJPA 4P1CC 1ZP0B 1GB4A 4WQOB 5E6PA 4BOZB 2RPQA 3DWGC 4KGTA 2DAFA 1YD8U 5AZFA 3Q6BA 4YL8A 2QHOA 2B3AA 2WXIA 3AXCA 1SIJA 3DOWA 4F7ZA 1KM7A 2JYTA 2K9XA 3BYTB 2MBOA 3HVDA 1ZUD2 3AE1B 3SD5A 1IYFA 2M0XA 2KT7A 4MGZE 2Y5CA 3GOEA 4HDOA 3IG3A 2JRIB 4XGAB 4WJNA 3OWEB 4RF1A 4BOSC 5KHQA 2MJDA 1SXTA 4EKUA 2N9XA 1G6JA 1WH3A 2ZPYA 2HJ1A 2IGGA 2M8SA 1LGRA 1ZDXA 3JW0X 3TEYA 1Y56A 2PMVA 4C4VB 4W9EA 4MH8A 1V9JA 2M19A 4W9KA 4FBJB 1IBXB 4FN2A 2MBHA 2R61A 4DK5A 1P7EA 1WFYA 4FHJA 2KWDA 2CHWA 3RPFC 4ZDVA 1GAQB 1GC6A 2WXLA 4XE0A 4WAAA 1MHHE 1MVKA 4PS8A 2BKRB 2WWZA 5BO4B 2D3BA 1D4BA 3R7QA 5CHWA 3RT3B 2Y3AA 2LD9A 3N32A 4KZCA 4WWOA 4BKGA 5C3JB 3BVZA 3APFA 4OZAA 4ICUA 3EFCA 2KHWB 1C76A 1WXAA 3UF8A 2MBEA 1J7CA 5BYSA 4I6NB 3QA8A 3BK1A 2JT4B 4HXDA 1P9DU 3ML8A 2CHZA 3MHZA 2KOXA 2JRHA 2UYZB 3AU5A 3PS6A 1NI2A 2JWUA 3BWUD 1FNVA 1WIAA 1WYWB 3NZ3A 4OVUA 1FFUA 5D3IB 5JZEB 4TV3A 1LM8B 2NMQA 4JIOU 1H4RA 1QT9A 1F2RC 2WU2B 5CHFA 1UH6A 2EMTA 2WXHA 1E90A 4N58A 3VUWA 5J2RA 1GPXA 3N3KB 4IOIE 1I4GA 2MLBA 4B0MA 3MP9A 1V97A 3VTUA 1NBFC 1TKYA 2GBMA 2YVCA 2M4NA 2WDVB 4M8NA 1P1AA 3AE7B 1E9MA 4MH0E 2WXRA 4ZYNA 2N1VA 3LB8C 3RI7C 1SB3C 1YOVB 3MC8A 4RH6A 2BW2A 3UGBB 2RDGA 1GB1A 2BS2B 1Q5WB 3KYDD 4KIKB 2BGFA 1V5TA 1J8CA 4US9A 2WX0A 1FIQA 1WGHA 2LVOA 2BKFA 1EU3A 3UI3A 3ZW3A 2BTEA 1PGAA 4M0WB 1SBBB 4EFOA 2PVGC 3CIRB 5LXIB 3AECB 4KVGB 3BK2A 2MHJA 3AEBB 2V3NA 4LTUA 1UGJA 3GS2A 3VH3B 1MI0A 3QC8B 2KFJA 2JXTA 2LJ5A 3EHVA 5H8YE 1BXTA 3IT4B 3OAWA 1GOZA 3EFUA 4ZHOA 3OJ3A 2I1KA 1N5WA 3V3XA 2KDEB 3NVWA 4J3OD 1GUAB 4I6LB 5D6JB 1JW9D 1E10A 2K22A 3RULA 2XN9C 4DHZE 2ZNVC 2QSDA 2NCNA 1I4QA 2PJHA 1E8WA 3O65B 3VFKA 1ISNA 1D6EC 1TGZB 3NS8A 3AB5A 1WM3A 1NENB 2LXCA 1V8CA 5MPOA 4J6IA 4YSYB 2SAKA 3ZDTA 3N9YC 2N7DA 4LLGM 1KF6B 2G4DB 3Q3JA 3X0WA 2K25A 2WXKA 4MDKE 3QHTA 4AUQC 4OZBA 5J18A 3Q69A 2YEPF 4GDLB 4EUTA 2KAJA 2OHFA 4REZA 3WANA 3LDZE 4XDCA 2KWCA 4MM3A 1JQ4A 1MG4A 2JQRB 4A90A 3VDZA 1QZEA 3ZUNA 5LXHA 4CO7A 3VTVA 3BINA 1WXMA 4IWPA 1WZ3A 1WSPA 2L0TA 3H7PB 1WGDA 2RDBC 4AS1A 2RR9A 2L1AA 3K9OB 4ZRIA 1Q10A 3VTWA 1ZW7A 2FAZA 3UINB 1XCQL 2KX0A 2N9EB 1I4PA 2UU7A 3NZUA 3J9CA 3NOBA 4IDIA 3KWVA 3IT6B 2KXJA 4RM9A 2KK8A 2LUEA 3SDLC 2EKEC 4NZLB 1ET6A 1UWXA 3KUZA 3PPAA 3Q8BA 3CSFA 4IM3A 3Q3FA 2JWZA 3Q14C 4OZCA 2C7NB 1HZ5A 4PK1A 2MRPA 1C4CA 3AEFB 3GP7A 3L16A 3LYYA 4CHKA 3WAPA 3GE3C 1C77A 2MP2B 1C4AA 2LFIA 4K81A 5CHVC 1WZ0A 3A4RA 1WRIA 2B76B 1OQRA 2HTHA 1V81A 3NG0A 4P6VF 2N4FA 2NTSA 4WJQA 4BFRA 1TT5B 3P4QB 5IN7A 4WWPA 1NYRA 3ZTDA 4KGSA 2WNMA 3N1ZC 3B2FA 2LGSA 1JMLA 3DCGA 3FC4A 3PHXB 4NJCA 2EELA 2J4XA 1MG8A 1YX6B 3NZSA 4HEA1 4XWWA 4JWUC 3RZWC 3W1YA 4TKNA 3DVGX 1HEZE 5BMGA 3ZXVA 2I2YA 4JLCA 2XEWA 5IAAC 2LMCA 1NYQA 1Y8RC 2ZPNA 3PZDA 2KDFB 1FNUA 4G3XB 5FR6A 1SJHD 4M8MA 2FE8A 2MH7A 2JVCA 3X23A 3GE8C 2IDYA 1E6EB 4FJZA 4W9HA 2QCZA 4XC2A 3ZNGC 1OQQA 3ZRCA 3EECA 4BAXA 2KFKA 3NRZA 2ZZPB 4S17A 1F9JA 3ZRFA 3RUIB 3RZFA 1UUPA 4GU2A 3FILB 3UQBA 2BYTA 5IP4D 4AP4C 4W9JA 2KKCA 2QDFA 3ECIA 4E3CA 5DPTA 3JYUA 4BVUC 1CK1A 1A5RA 2RGFA 4NPNA 3ZGZA 3Q8AA 4C7YA 1EF1A 5JHBA 5CX3A 2JSVX 2D07B 3BY4B 1FEHA 5E6JA 2V4IB 5AUIA 3A9JB 3VQIA 3TMPB 2GOWA 2K6DB 4W9GA 2KYWA 3BYYB 1WX9A 3HM6X 4YT0B 2IJ0A 1L6VA 2O6VD 2W9NA 4IM0A 4GDKA 4PYUA 1AARA 3A1QA 5C23A 2ZW0A 1XO3A 1V80A 1C4PA 1E8XA 3APCA 3H1UA 2KDMA 3PRZA 3T9LA 3PLVA 1FXTB 4CQNA 3SFDB 2DYOA 4IG7B 5TR5A 2KC1A 2BS3B 2I38A 4WJOA 2KDBA 2J52A 1L0VB 3K9PB 3HRDD 4LJPB 2KMCA 2BWES 2PW9A 1FCLA 2IPKD 5AZGA 3QIJA 4Q2JA 1WMHB 4O1NA 4FLHA 4DHJB 4ITKA 2BWFA 1RFAA 5BMIA 2INNE 2BYVE 2L05A 4MGYE 1TS4A 1DYQA 1ZXIA 4JX1C 2HDEA 1KOTA 4HPMB 4MEMA 4PYZA 4TUUA 1KLGD 1JRUA 1ZGUB 2E3TA 1ROEA 2K1FA 3P2BA 4ASWC 4LNOA 1WGRA 3W5VB 2PTLA 4ZYSA 3HIZA 3NJTA 3EUB2 1XXGA 3R8BA 3GB1A 1VRAB 1QF6A 3SFEB 3DPDA 2MWSB 3HVZA 4G50A 3C8YA 1N62A 2JZZA 2K0PA 5KHOA 5FKAC 2AWTA 4P7IA 1P0RA 2N9KA 1RFKA 1T6BX 2AX5A 2KVZA 1N61A 4L2YA 2GMIC 3NVZA 3WALA 1ZOYB 1V1OA 1V86A 4RGMA 1T0RC 3KLSX 2MJ3A 3ONSA 4PS7A 2JF5A 4WIPA 2KJRA 3Q2AC 3C0RB 3PRPB 1ZE3D 2O2VB 5HG2A 4HWIB 3NVVA 5EE1A 3DBLI 2N1WA 2NBVB 3IXSA 1LXDA 3DBLB 3M95A 1N6ZA 4K3CA 2LASA 3DVNV 5G55A 4MJSB 2DZKA 2IBIB 4AOFA 1WRDB 2LUMA 4B9KA 2K3UA 4NAWB 3P4RB 1HZ6A 1M4VA 2KWVB 1N5XA 2KN5A 1YJ1A 2L32A 3A33B 1PFDA 3KH0A 3QQ8B 2DAJA 1JRPA 4MGIE 4EE2A 4XX5A 2FUHB 1WXQA 3ZVVA 3ZNHB 2M0AA 4LNFA 1SE2A 2FCSA 5FK9C 3I5JC 3DVGY 4I6PA 4JQWC 5EE3A 2RD0A 5GXGB 4B95A 4EZJA 1A70A 3AMZA 1V1PA 2FNJB 2NPTA 1TS2A 2ZVNA 2WHIA 2IGHA 1TY0A 1DGJA 5D7GA 4DDID 2J42A 4P16A 3P4PB 3WAMA 3M3JA 2LHDA 5G2NA 5BYRA 2GBNA 2WXOA 3TEWA 1FPYA 1WGGA 3Q3MC 4FHKA 1CJEA 3KVFB 2WLBA 4IW0A 1B9RA 3U52E 3CF6E 3PZ7A 2WU5B 2MBBB 1ZXHA 2O6VB 4F8CB 1N60A 3P63A 3RNEC 4C56C 2KTFA 1J19A 1BUIC 4H2AA 3UQAA 1SE9A 1UBIA 2JZPA 3U4EG 2IO0B 4BKTA 1TZOA 5L83A 4HPLB 1T5XD 3IBEA 1E5WA 3QX1A 2M1MA 4K1RB 3ZTCA 3ZO5B 1SSNA 3AU4A 4MM3B 5T8IA 1UF0A 4ICVA 1UBQA 4NQKE 3A9KA 3TEZA 2KTRA 2MW5A 3KYCD 3KQ4A 2BQQA 2ICIA 2BB5A 3MFGA 2G1EA 2PEAA 3RNBC 2N9LA 4S0RA 2KQ7A 2K6QA 3ALBA 4A3OA 4TMAB 4YXDB 1JCKB 4KGRA 2L76A 5I4DA 1QOGA 3H6NA 1I7HA 1JWUD 3RCZA 1XEEA 4N9F4 1YJIA 1PGXA 1SIFA 2J53A 1JWSD 3EA6A 4DQOC 1SF0A 2QIEB 2V9HA 4RNAA 2WX1A 3AE8B 4KSKC 4KKJA 1FXAA 1MFWA 2G9HD 2ZJDA 3P1MA 1CQVA 1D3ZA 3P42A 4XZ4A 2K8CA 5BYQA 5HKHA 3PRMB 3DHGC 4GXBA 2X38A 3PZ8A 1QOBA 2WDQB 1AN8A 1TKEA 5IOIA 1LFDA 1IBXA 2AQ1B 1WR6E 1RLFA 4K7WA 4E71A 3VRAB 4ZHPA 3N1XC 3I63C 2PPHA 2GI9A 3OJ4B 4X57B 2IGDA 1NEKB 3B1LX 2D3GA 1QLBB 3ZJVA 3U7ZA 2LHEA 4M01A 3JSVB 4NY0A 5G5GA 1F0ZA 1WM2A 4BKSA 2BYEA 2Z8LA 3AE3B 2KQSA 3VRBB 3WAOA 3L4PA 1XLOA 2OJRA 1C78A 3H7SA 2N0SB 1HTOA 2K5PA 1KRHA 2LVQA 4US8A 1WXSA 4XYCA 3O13A 3UIOB 1LO5D 3RN9C 3PGEA 2E6XA 1L0YB 1T3QA 4B6WA 4A9AA 4II3B 5J17A 2D5GA 4DXAB 4LCDE 5GMVA 3U8ZA 2LGXA 1J0GA 2KFKB 4UDUC 4YSXB 4P1BC 3ZJUA 3ZNID 2BB6A 3DHHC 2X8XX 1PUTA 1HXYD 1ESFA 2DYMA 3BVMA 1PGBA 2MX2A 2WXMA 2M56B 3I57A 4YTPB 3L08A 2JY6A 2NTTA 1TIFA 3WIMA 1VLBA 4OVVA 4C80A 4C00A 4HRSA 1UNSA 2L0FA 3H9DA 4LNKA 5EDSA 1IP9A 5G5HA 2BF8B 3Q8EA 3W2DA 2R2QA 3E56A 1EM7A 1GG3A 1F1HA 1XLQA 4BBNF 4KIKA 3V62A 3AULA 1YN3A 3VXWA 3B2GA 5LNK1 4M0WA 1KLUD 1X1MA 3MJWA 4ARCA 4WQMA 3BVGA 5D3DA 4LNIA 3NS1A 2V0GA 1Z2MA 2D11A 3W5UB 3R2TA 3ZKJC 1WY8A 1R4NI 3MTNB 2OOBB 2AQ2B 4ANUA 4K7UA 2LEKA 1R4NB 4DBGA 1UELA 1K51A 3DBHI 2ZCCA 2KD0A 3IHPC 2DYBA 3DBHB 2JU6X 2G4SA 1YQ3B 2WXFA 4LNNA 1E7VA 3MHSD 2PE9A 3KUCB 3ZQ4A 4A20A 4TSSA 1K53A 4KSLC 2WS3B 3N30A 3BZDB 4KX6B 2W3RA 2XK5B 1JWBD 4OVZA 1C79A 4HROA 3TEXA 1TS5A 5DPSA 3TBLD 1NDDA 2BYFA 4LJOB 2Z0DB 3AE2B 1ZKHA 1JROA 1VCBA 5E6NA 3IFWB 3EC8A 2NVUI 1I42A 1YQBA 1U4AA 2D3AA 4JL9A 3U2SC 4K7SA 1F2RI 4FA6A 2ONQA 2ACZB 4RF0A 4A55A 1YX5B 4A3PA 2K8HA 2MJEA 1HE8A 2Y5PA 2J7QB 2L3ZA 4TQ0A 3NVYA 4GDLA 1EF5A 1E7PB 2AYOB 4AJWA 3AM9A 4RFBA 3VUXA 1V49A 1HQRD 3RNFC 1S1QB 2KN4A 2KVRA 2OJWA 1TKGA 5AEKB 4L23A 3ML9A 1K52A 4KKIA 1VDVA 3NY5A 2DZMA 1IGDA 2J0JA 1FRRA 4EZLA 4R3DA 4LK0M 4KDIC 5D2MB 1RYJA 4BKSD 3H7PA 3RMKC 2PVOD 3KUDB 4GN1A 1JWAD 4L1BA 5IO9A 1VR9A 2BBCA 1GC7A 2CKHB 3L17A 2REXA 3KW5B 3QJZA 1KFYB 1YQ4B 2ZCBA 4DHZB 3R3MA 1FM0D 1I4HA 1OTRB 1L4ZB 1L7YA 1TBEA 2PKOA 1EWCA 2K39A 1S3SG 4GGQA 3DWMA 2C60A 4DDGD 4HKZE 2MP2A 4GB9A 5HHDG 1XCTL 2Z0EB 2KDIA 4CYEA 2OEDA 4RMAA 3E9SA 3QARA 4G0NB 2WP9B 2K8BA 2H89B 1PDXA 1T0YA 3PTFC 2ZNVB 4ZRPA 5AUKA 4KDLB 2HD5B 1WJ4A 3SEBA 1MHXA 4C7ZA 5JHAA 4ZOHC 1FO4A 2N7EA 4DWFA 2MCNB 4HJGE 3OG5A 2FUG1 4AQ7A 2L52A 3APDA 1TZ1A 2BPSA 2C9WB 2CJNA 2DWQA 1EU4A 3ETRA 2GBKA 1E8ZA 2QJLA 3OLMD 5CTRC 3PO0A 3RD2A 5C2TB 2FIDA 1C3TA 3V60A 3RFZB 2SEBD 3VVWB 2V1YA 4W9LA 5D94A 1ET9A 3RYTA 1OQYA 2JYEA 2V3PA 4ANWA 2NS5A 1QKZA 1R7SA 1RAXA 2ASQA 2QEJC 4FJYA 4G11A 2VZKD 1MPEA 3FILA 5JXVA 4MT5A 4XDDA 1WJNA 1GJZA 1L6UA 1V2YA 2C7HA 3U30A 3VR9B 1ZDVA 1ACCA 1UD7A 1T0SC 3T3OA 1HTQA 1WX7A 2H88B 2KLCA 4IM2A 4ANXA 1YN5A 3VH4B 2CS4A 2MQJA 2KX3A 2BT6A 3JVZX 2KWUB 2EKIA 1D5MC 4N59A 1EO6A 1QQRA 5HI1A 3A9JA 2VH1A 2JPHA 3TUOA 2FCQA 3AV8A 3N20C 3AEAB 1FCCC 3AEGB 2LGYA 2YLMA 1OEYA 2MA9B 3TJPA 1VZ8A 3H8HA 4K3BA 4EEWA 4URKA 4XWTA 4D2KA 3SHQA 4DXGA 4KZ0A 4FXCA 3VAWA 1FD6A 4A6QA 2KLGA 4EOYA 2PE6B 1Z5SB 2D10A 2W55A 3L10B 1UGMA 3I9V1 3Q8FA 1OEYJ 2RDHA 2M17A 2FCMA 3LXFA 3D32A 3P4SB 1WMHA 2BVCA 1XF5L 3A4SC 1VD2A 3PSEB 4ARIA 1OGWA 3B08A 3S2AA 4ZRQA 1WGKA 1J7BA 2CU1A 3DQVA 4LDTD 1BMLC 3URYA 1IUEA 2I1JA 3Q8CA 4AJYB 4JGHB 2LWPA 2INCC 1BT0A 2UWQA 3AE6B 3I3TB 2LI5A 3WA0A 2CHXA 2KC2A 1H8CA 1EWYC 1RRBA 1WF9A 2XNAC 4MSQB 2LGDA 4N6EB 1KTKA 2MEKA 2GBRA 4BBNC 1YN4A 2MSED 2DENB 3IAS1 4BZAA 1I4XA 2W3SA 4FULA 4MSMB 2NR2A 4GMVA 3ABVB 2WQYB 2KO3A 4NJ7A 2IZVB 1PQSA 1FXIA 4DXFA 5IA7A 2RMMA 1AYFA 2WXJA 1IPGA 5IKCM 1XQQA 2O2VA 2DHZA 3EGRA 1AW7A 3WCQA 2HE7A 3QWZB 1Q0WB 2CJOA 3R66C 4MJSA 1KLVA 4RM8A 5AZHA 2CU3A 4NAWA 4NJ6A 1WE7A 4HLEA 3FAHA 3VUYA 4RCOA 3SU8X 1SE4A 3ZYYX 3TSSA 4C4VA 2D2QA 2IYDB 1R4MI 2LRUA 3T3NA 3AE4B 3PREA 1WXVA 1J7AA 1R4MB 2VZKB 2KMMA 3ZDMC 1SJED 3B9JA 4NAMA 1HA5A 2N9PC 2WXQA 2AQ3B 2PLPA 1SEBD 1L0XB 1VZ7A 1WX8A 5DPRA 2KACA 4MELA 4ACFA 1DOIA 3HUIA 3T8MA 4F1SA 3IAM1 1QOFA 3V05A 1RWSA 3NHEB 4FADA 1TY2A 1E0ZA 4HCNB 2ON8A 4M02A 4RGTA 1YNTE 3AE9B 1V6EA 4PS3A 3KWLA 3CMMB 3QCAA 2O6VA 2IY1B 3V6CB 2EMSA 3W9CB 4EZKA 1F52A 3RNAC 3CWIA 2R2OA 4RGNA 4YTMB 1P98A 4WH4A 3NUHB 4JE3B 3TCAA 1OFFA 3M63B 1E7UA 3PVLA 2HJ8A 2DBYA 2J0MA 2ZW1A 3ZJTA 3L13A 2JXXA 2BS4B 4GSWA 2DLBA 1TJEA 5BMHA 2DNFA 2KMAA 2XBBC 1AWDA 3UIPB 2DZIA 3DHIC 4W9DA 4ANVA 4JWSC 4YWGG 1XLPA 4GIVA 4WURA 3MC0B 2FIFA 2WXGA 5DCNA 1DOYA 3CSTA 1E8YA 3L54A 4RGOS 1JWMD 4LDTB 4MGKE 3ENEA 4DHJD 2WDTB 3DDCB 2N7JA 2MBQA 1STEA 2DX5B 4GDKB 4YSZB 3PHWB 4W9FA 3A1QB 3M62B 1SE3A 2QC8A 1FMAD 1P3QU 3L0WB 1K50A 3U7DA 1V5OA 2GLSA 2WXPA 5JH5C 4JPSA 4E74A 4GOCA
chains in the Genus database with same CATH topology
3RNEC 3RMKC 3DHIC 3N1YC 3N1XC 3RNAC 3RNCC 3Q2AC 3I63C 3RNGC 2RDBC 3I5JC 4P1BC 3Q14C 3Q3MC 3N1ZC 3RNFC 3DHHC 3GE3C 3DHGC 3RN9C 2INCC 1T0QC 3RI7C 3N20C 3RNBC 3GE8C 1T0RC 2INDC 3Q3NC 1T0SC 4P1CC 3Q3OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNE C;  3RMK C;  3DHI C;  3N1Y C;  3N1X C;  3RNA C;  3RNC C;  3Q2A C;  3I63 C;  3RNG C;  2RDB C;  3I5J C;  4P1B C;  3Q14 C;  3Q3M C;  3N1Z C;  3RNF C;  3DHH C;  3GE3 C;  3DHG C;  3RN9 C;  2INC C;  1T0Q C;  3RI7 C;  3N20 C;  3RNB C;  3GE8 C;  1T0R C;  2IND C;  3Q3N C;  1T0S C;  4P1C C;  3Q3O C; 
#chains in the Genus database with same CATH topology
 4HCP B;  3AH7 A;  2JX5 A;  1YJJ A;  1L2N A;  4WWM A;  4USA A;  2IO2 B;  1C9F A;  1F77 A;  1Q1O A;  1NI3 A;  1I4R A;  2AL6 A;  2WXN A;  3MC9 A;  3W1S A;  3ZIM A;  3TIX A;  1TTN A;  2VRR B;  4AWJ A;  1P7F A;  1M94 A;  1JAL A;  4II2 B;  4HKQ A;  2Q5W D;  2IO3 B;  4HVB A;  3PT2 B;  1DOX A;  2KQ4 X;  2LJI A;  5EE9 A;  1KH0 A;  2LGI A;  2HTM E;  2YEP B;  1ZPS A;  4OW0 A;  1K8R B;  2WGS A;  1T0Q C;  5EE0 A;  3JSV A;  1XD3 B;  4WAF A;  4M00 A;  1NVI D;  2KJH B;  4HDQ A;  2IY0 B;  2NBW B;  2A4Z A;  3AE5 B;  4HPP A;  1VZ6 A;  3AED B;  4OHJ A;  1WI0 A;  1WYG A;  3ZLZ A;  3AEE B;  2AEH A;  1WJU A;  3IVF A;  2LXA A;  4A8X C;  4B0E A;  2G3Q B;  2INP E;  2ZVO A;  1WGY A;  4IUM B;  2FCN A;  5E6O A;  4ZRK A;  5DPW A;  1RM6 C;  4QAY A;  2GBJ A;  1FNW A;  2LVP A;  1ENF A;  4KV2 A;  2Z59 B;  2QIL A;  4WWN A;  2W54 A;  3BII D;  1UZX B;  2FBW B;  5C1Z A;  4IWQ A;  2D3C A;  3HK0 A;  2JUO A;  2TSS A;  3HHM A;  2DZJ A;  5L95 C;  2CR5 A;  3ZXR A;  1L5P A;  2WDR B;  1D5Z C;  2C7M B;  2J0K A;  3TL5 A;  3V6E B;  2W82 A;  3QAQ A;  3RNC C;  1B1Z A;  1SGH A;  3PLU A;  4IC7 B;  1D5X C;  3DBS A;  1WR1 A;  1I35 A;  2IO1 B;  4GLS C;  1YMH E;  3C19 A;  2LZ6 A;  4MAC A;  2IND C;  4HK2 A;  2RPV A;  5HFY A;  3HM3 A;  1C1Y B;  2L00 B;  4ZRJ A;  3GZN I;  2G45 B;  1VJK A;  2LRW A;  3GZN B;  4NQL B;  2AL3 A;  1V1P B;  4PT5 A;  2NPT B;  3FKY A;  3W1S C;  1CMX B;  1XT9 B;  3R7R A;  1WWT A;  1FFV A;  3Q3O C;  1YIW A;  2A5U A;  1KJT A;  2PIA A;  3QK0 A;  2RSU A;  4W9C A;  1LQB A;  5FR3 A;  3VR8 B;  1N63 A;  3AN1 A;  1WE6 A;  2V3S A;  3PV1 A;  1FRD A;  4IKG A;  5H92 C;  3DVN U;  3B0A A;  2JZ3 B;  2WYQ A;  3Q3N C;  1XLN A;  4YTN B;  5TSS A;  2L7R A;  1WJ6 A;  3N1Y C;  2XK5 A;  2V4L A;  1TS3 A;  3VHT C;  3LJ3 A;  2Y5B B;  3AI5 A;  3DBR I;  2L8J A;  2KNB A;  3ZNZ B;  3SR6 A;  2QMT A;  1QOA A;  3DBR B;  1GNU A;  4W9I A;  1CZP A;  4IWO A;  4HJK A;  2KJ6 A;  1IGC A;  1PYW D;  3R2I A;  2VH2 A;  5LLI A;  4NNJ B;  2KAN A;  2KZR A;  1MJD A;  3RNG C;  2C5L C;  1L4D B;  2GRI A;  1QIL A;  4TQ1 A;  2GB1 A;  2NBU A;  1UWM A;  3V61 A;  3A9K B;  2L83 A;  3MJ5 A;  2KTR B;  1TYG B;  4FJV B;  2ZEQ A;  1EUV B;  4WJP A;  4P1C C;  1ZP0 B;  1GB4 A;  4WQO B;  5E6P A;  4BOZ B;  2RPQ A;  3DWG C;  4KGT A;  2DAF A;  1YD8 U;  5AZF A;  3Q6B A;  4YL8 A;  2QHO A;  2B3A A;  2WXI A;  3AXC A;  1SIJ A;  3DOW A;  4F7Z A;  1KM7 A;  2JYT A;  2K9X A;  3BYT B;  2MBO A;  3HVD A;  1ZUD 2;  3AE1 B;  3SD5 A;  1IYF A;  2M0X A;  2KT7 A;  4MGZ E;  2Y5C A;  3GOE A;  4HDO A;  3IG3 A;  2JRI B;  4XGA B;  4WJN A;  3OWE B;  4RF1 A;  4BOS C;  5KHQ A;  2MJD A;  1SXT A;  4EKU A;  2N9X A;  1G6J A;  1WH3 A;  2ZPY A;  2HJ1 A;  2IGG A;  2M8S A;  1LGR A;  1ZDX A;  3JW0 X;  3TEY A;  1Y56 A;  2PMV A;  4C4V B;  4W9E A;  4MH8 A;  1V9J A;  2M19 A;  4W9K A;  4FBJ B;  1IBX B;  4FN2 A;  2MBH A;  2R61 A;  4DK5 A;  1P7E A;  1WFY A;  4FHJ A;  2KWD A;  2CHW A;  3RPF C;  4ZDV A;  1GAQ B;  1GC6 A;  2WXL A;  4XE0 A;  4WAA A;  1MHH E;  1MVK A;  4PS8 A;  2BKR B;  2WWZ A;  5BO4 B;  2D3B A;  1D4B A;  3R7Q A;  5CHW A;  3RT3 B;  2Y3A A;  2LD9 A;  3N32 A;  4KZC A;  4WWO A;  4BKG A;  5C3J B;  3BVZ A;  3APF A;  4OZA A;  4ICU A;  3EFC A;  2KHW B;  1C76 A;  1WXA A;  3UF8 A;  2MBE A;  1J7C A;  5BYS A;  4I6N B;  3QA8 A;  3BK1 A;  2JT4 B;  4HXD A;  1P9D U;  3ML8 A;  2CHZ A;  3MHZ A;  2KOX A;  2JRH A;  2UYZ B;  3AU5 A;  3PS6 A;  1NI2 A;  2JWU A;  3BWU D;  1FNV A;  1WIA A;  1WYW B;  3NZ3 A;  4OVU A;  1FFU A;  5D3I B;  5JZE B;  4TV3 A;  1LM8 B;  2NMQ A;  4JIO U;  1H4R A;  1QT9 A;  1F2R C;  2WU2 B;  5CHF A;  1UH6 A;  2EMT A;  2WXH A;  1E90 A;  4N58 A;  3VUW A;  5J2R A;  1GPX A;  3N3K B;  4IOI E;  1I4G A;  2MLB A;  4B0M A;  3MP9 A;  1V97 A;  3VTU A;  1NBF C;  1TKY A;  2GBM A;  2YVC A;  2M4N A;  2WDV B;  4M8N A;  1P1A A;  3AE7 B;  1E9M A;  4MH0 E;  2WXR A;  4ZYN A;  2N1V A;  3LB8 C;  3RI7 C;  1SB3 C;  1YOV B;  3MC8 A;  4RH6 A;  2BW2 A;  3UGB B;  2RDG A;  1GB1 A;  2BS2 B;  1Q5W B;  3KYD D;  4KIK B;  2BGF A;  1V5T A;  1J8C A;  4US9 A;  2WX0 A;  1FIQ A;  1WGH A;  2LVO A;  2BKF A;  1EU3 A;  3UI3 A;  3ZW3 A;  2BTE A;  1PGA A;  4M0W B;  1SBB B;  4EFO A;  2PVG C;  3CIR B;  5LXI B;  3AEC B;  4KVG B;  3BK2 A;  2MHJ A;  3AEB B;  2V3N A;  4LTU A;  1UGJ A;  3GS2 A;  3VH3 B;  1MI0 A;  3QC8 B;  2KFJ A;  2JXT A;  2LJ5 A;  3EHV A;  5H8Y E;  1BXT A;  3IT4 B;  3OAW A;  1GOZ A;  3EFU A;  4ZHO A;  3OJ3 A;  2I1K A;  1N5W A;  3V3X A;  2KDE B;  3NVW A;  4J3O D;  1GUA B;  4I6L B;  5D6J B;  1JW9 D;  1E10 A;  2K22 A;  3RUL A;  2XN9 C;  4DHZ E;  2ZNV C;  2QSD A;  2NCN A;  1I4Q A;  2PJH A;  1E8W A;  3O65 B;  3VFK A;  1ISN A;  1D6E C;  1TGZ B;  3NS8 A;  3AB5 A;  1WM3 A;  1NEN B;  2LXC A;  1V8C A;  5MPO A;  4J6I A;  4YSY B;  2SAK A;  3ZDT A;  3N9Y C;  2N7D A;  4LLG M;  1KF6 B;  2G4D B;  3Q3J A;  3X0W A;  2K25 A;  2WXK A;  4MDK E;  3QHT A;  4AUQ C;  4OZB A;  5J18 A;  3Q69 A;  2YEP F;  4GDL B;  4EUT A;  2KAJ A;  2OHF A;  4REZ A;  3WAN A;  3LDZ E;  4XDC A;  2KWC A;  4MM3 A;  1JQ4 A;  1MG4 A;  2JQR B;  4A90 A;  3VDZ A;  1QZE A;  3ZUN A;  5LXH A;  4CO7 A;  3VTV A;  3BIN A;  1WXM A;  4IWP A;  1WZ3 A;  1WSP A;  2L0T A;  3H7P B;  1WGD A;  2RDB C;  4AS1 A;  2RR9 A;  2L1A A;  3K9O B;  4ZRI A;  1Q10 A;  3VTW A;  1ZW7 A;  2FAZ A;  3UIN B;  1XCQ L;  2KX0 A;  2N9E B;  1I4P A;  2UU7 A;  3NZU A;  3J9C A;  3NOB A;  4IDI A;  3KWV A;  3IT6 B;  2KXJ A;  4RM9 A;  2KK8 A;  2LUE A;  3SDL C;  2EKE C;  4NZL B;  1ET6 A;  1UWX A;  3KUZ A;  3PPA A;  3Q8B A;  3CSF A;  4IM3 A;  3Q3F A;  2JWZ A;  3Q14 C;  4OZC A;  2C7N B;  1HZ5 A;  4PK1 A;  2MRP A;  1C4C A;  3AEF B;  3GP7 A;  3L16 A;  3LYY A;  4CHK A;  3WAP A;  3GE3 C;  1C77 A;  2MP2 B;  1C4A A;  2LFI A;  4K81 A;  5CHV C;  1WZ0 A;  3A4R A;  1WRI A;  2B76 B;  1OQR A;  2HTH A;  1V81 A;  3NG0 A;  4P6V F;  2N4F A;  2NTS A;  4WJQ A;  4BFR A;  1TT5 B;  3P4Q B;  5IN7 A;  4WWP A;  1NYR A;  3ZTD A;  4KGS A;  2WNM A;  3N1Z C;  3B2F A;  2LGS A;  1JML A;  3DCG A;  3FC4 A;  3PHX B;  4NJC A;  2EEL A;  2J4X A;  1MG8 A;  1YX6 B;  3NZS A;  4HEA 1;  4XWW A;  4JWU C;  3RZW C;  3W1Y A;  4TKN A;  3DVG X;  1HEZ E;  5BMG A;  3ZXV A;  2I2Y A;  4JLC A;  2XEW A;  5IAA C;  2LMC A;  1NYQ A;  1Y8R C;  2ZPN A;  3PZD A;  2KDF B;  1FNU A;  4G3X B;  5FR6 A;  1SJH D;  4M8M A;  2FE8 A;  2MH7 A;  2JVC A;  3X23 A;  3GE8 C;  2IDY A;  1E6E B;  4FJZ A;  4W9H A;  2QCZ A;  4XC2 A;  3ZNG C;  1OQQ A;  3ZRC A;  3EEC A;  4BAX A;  2KFK A;  3NRZ A;  2ZZP B;  4S17 A;  1F9J A;  3ZRF A;  3RUI B;  3RZF A;  1UUP A;  4GU2 A;  3FIL B;  3UQB A;  2BYT A;  5IP4 D;  4AP4 C;  4W9J A;  2KKC A;  2QDF A;  3ECI A;  4E3C A;  5DPT A;  3JYU A;  4BVU C;  1CK1 A;  1A5R A;  2RGF A;  4NPN A;  3ZGZ A;  3Q8A A;  4C7Y A;  1EF1 A;  5JHB A;  5CX3 A;  2JSV X;  2D07 B;  3BY4 B;  1FEH A;  5E6J A;  2V4I B;  5AUI A;  3A9J B;  3VQI A;  3TMP B;  2GOW A;  2K6D B;  4W9G A;  2KYW A;  3BYY B;  1WX9 A;  3HM6 X;  4YT0 B;  2IJ0 A;  1L6V A;  2O6V D;  2W9N A;  4IM0 A;  4GDK A;  4PYU A;  1AAR A;  3A1Q A;  5C23 A;  2ZW0 A;  1XO3 A;  1V80 A;  1C4P A;  1E8X A;  3APC A;  3H1U A;  2KDM A;  3PRZ A;  3T9L A;  3PLV A;  1FXT B;  4CQN A;  3SFD B;  2DYO A;  4IG7 B;  5TR5 A;  2KC1 A;  2BS3 B;  2I38 A;  4WJO A;  2KDB A;  2J52 A;  1L0V B;  3K9P B;  3HRD D;  4LJP B;  2KMC A;  2BWE S;  2PW9 A;  1FCL A;  2IPK D;  5AZG A;  3QIJ A;  4Q2J A;  1WMH B;  4O1N A;  4FLH A;  4DHJ B;  4ITK A;  2BWF A;  1RFA A;  5BMI A;  2INN E;  2BYV E;  2L05 A;  4MGY E;  1TS4 A;  1DYQ A;  1ZXI A;  4JX1 C;  2HDE A;  1KOT A;  4HPM B;  4MEM A;  4PYZ A;  4TUU A;  1KLG D;  1JRU A;  1ZGU B;  2E3T A;  1ROE A;  2K1F A;  3P2B A;  4ASW C;  4LNO A;  1WGR A;  3W5V B;  2PTL A;  4ZYS A;  3HIZ A;  3NJT A;  3EUB 2;  1XXG A;  3R8B A;  3GB1 A;  1VRA B;  1QF6 A;  3SFE B;  3DPD A;  2MWS B;  3HVZ A;  4G50 A;  3C8Y A;  1N62 A;  2JZZ A;  2K0P A;  5KHO A;  5FKA C;  2AWT A;  4P7I A;  1P0R A;  2N9K A;  1RFK A;  1T6B X;  2AX5 A;  2KVZ A;  1N61 A;  4L2Y A;  2GMI C;  3NVZ A;  3WAL A;  1ZOY B;  1V1O A;  1V86 A;  4RGM A;  1T0R C;  3KLS X;  2MJ3 A;  3ONS A;  4PS7 A;  2JF5 A;  4WIP A;  2KJR A;  3Q2A C;  3C0R B;  3PRP B;  1ZE3 D;  2O2V B;  5HG2 A;  4HWI B;  3NVV A;  5EE1 A;  3DBL I;  2N1W A;  2NBV B;  3IXS A;  1LXD A;  3DBL B;  3M95 A;  1N6Z A;  4K3C A;  2LAS A;  3DVN V;  5G55 A;  4MJS B;  2DZK A;  2IBI B;  4AOF A;  1WRD B;  2LUM A;  4B9K A;  2K3U A;  4NAW B;  3P4R B;  1HZ6 A;  1M4V A;  2KWV B;  1N5X A;  2KN5 A;  1YJ1 A;  2L32 A;  3A33 B;  1PFD A;  3KH0 A;  3QQ8 B;  2DAJ A;  1JRP A;  4MGI E;  4EE2 A;  4XX5 A;  2FUH B;  1WXQ A;  3ZVV A;  3ZNH B;  2M0A A;  4LNF A;  1SE2 A;  2FCS A;  5FK9 C;  3I5J C;  3DVG Y;  4I6P A;  4JQW C;  5EE3 A;  2RD0 A;  5GXG B;  4B95 A;  4EZJ A;  1A70 A;  3AMZ A;  1V1P A;  2FNJ B;  2NPT A;  1TS2 A;  2ZVN A;  2WHI A;  2IGH A;  1TY0 A;  1DGJ A;  5D7G A;  4DDI D;  2J42 A;  4P16 A;  3P4P B;  3WAM A;  3M3J A;  2LHD A;  5G2N A;  5BYR A;  2GBN A;  2WXO A;  3TEW A;  1FPY A;  1WGG A;  3Q3M C;  4FHK A;  1CJE A;  3KVF B;  2WLB A;  4IW0 A;  1B9R A;  3U52 E;  3CF6 E;  3PZ7 A;  2WU5 B;  2MBB B;  1ZXH A;  2O6V B;  4F8C B;  1N60 A;  3P63 A;  3RNE C;  4C56 C;  2KTF A;  1J19 A;  1BUI C;  4H2A A;  3UQA A;  1SE9 A;  1UBI A;  2JZP A;  3U4E G;  2IO0 B;  4BKT A;  1TZO A;  5L83 A;  4HPL B;  1T5X D;  3IBE A;  1E5W A;  3QX1 A;  2M1M A;  4K1R B;  3ZTC A;  3ZO5 B;  1SSN A;  3AU4 A;  4MM3 B;  5T8I A;  1UF0 A;  4ICV A;  1UBQ A;  4NQK E;  3A9K A;  3TEZ A;  2KTR A;  2MW5 A;  3KYC D;  3KQ4 A;  2BQQ A;  2ICI A;  2BB5 A;  3MFG A;  2G1E A;  2PEA A;  3RNB C;  2N9L A;  4S0R A;  2KQ7 A;  2K6Q A;  3ALB A;  4A3O A;  4TMA B;  4YXD B;  1JCK B;  4KGR A;  2L76 A;  5I4D A;  1QOG A;  3H6N A;  1I7H A;  1JWU D;  3RCZ A;  1XEE A;  4N9F 4;  1YJI A;  1PGX A;  1SIF A;  2J53 A;  1JWS D;  3EA6 A;  4DQO C;  1SF0 A;  2QIE B;  2V9H A;  4RNA A;  2WX1 A;  3AE8 B;  4KSK C;  4KKJ A;  1FXA A;  1MFW A;  2G9H D;  2ZJD A;  3P1M A;  1CQV A;  1D3Z A;  3P42 A;  4XZ4 A;  2K8C A;  5BYQ A;  5HKH A;  3PRM B;  3DHG C;  4GXB A;  2X38 A;  3PZ8 A;  1QOB A;  2WDQ B;  1AN8 A;  1TKE A;  5IOI A;  1LFD A;  1IBX A;  2AQ1 B;  1WR6 E;  1RLF A;  4K7W A;  4E71 A;  3VRA B;  4ZHP A;  3N1X C;  3I63 C;  2PPH A;  2GI9 A;  3OJ4 B;  4X57 B;  2IGD A;  1NEK B;  3B1L X;  2D3G A;  1QLB B;  3ZJV A;  3U7Z A;  2LHE A;  4M01 A;  3JSV B;  4NY0 A;  5G5G A;  1F0Z A;  1WM2 A;  4BKS A;  2BYE A;  2Z8L A;  3AE3 B;  2KQS A;  3VRB B;  3WAO A;  3L4P A;  1XLO A;  2OJR A;  1C78 A;  3H7S A;  2N0S B;  1HTO A;  2K5P A;  1KRH A;  2LVQ A;  4US8 A;  1WXS A;  4XYC A;  3O13 A;  3UIO B;  1LO5 D;  3RN9 C;  3PGE A;  2E6X A;  1L0Y B;  1T3Q A;  4B6W A;  4A9A A;  4II3 B;  5J17 A;  2D5G A;  4DXA B;  4LCD E;  5GMV A;  3U8Z A;  2LGX A;  1J0G A;  2KFK B;  4UDU C;  4YSX B;  4P1B C;  3ZJU A;  3ZNI D;  2BB6 A;  3DHH C;  2X8X X;  1PUT A;  1HXY D;  1ESF A;  2DYM A;  3BVM A;  1PGB A;  2MX2 A;  2WXM A;  2M56 B;  3I57 A;  4YTP B;  3L08 A;  2JY6 A;  2NTT A;  1TIF A;  3WIM A;  1VLB A;  4OVV A;  4C80 A;  4C00 A;  4HRS A;  1UNS A;  2L0F A;  3H9D A;  4LNK A;  5EDS A;  1IP9 A;  5G5H A;  2BF8 B;  3Q8E A;  3W2D A;  2R2Q A;  3E56 A;  1EM7 A;  1GG3 A;  1F1H A;  1XLQ A;  4BBN F;  4KIK A;  3V62 A;  3AUL A;  1YN3 A;  3VXW A;  3B2G A;  5LNK 1;  4M0W A;  1KLU D;  1X1M A;  3MJW A;  4ARC A;  4WQM A;  3BVG A;  5D3D A;  4LNI A;  3NS1 A;  2V0G A;  1Z2M A;  2D11 A;  3W5U B;  3R2T A;  3ZKJ C;  1WY8 A;  1R4N I;  3MTN B;  2OOB B;  2AQ2 B;  4ANU A;  4K7U A;  2LEK A;  1R4N B;  4DBG A;  1UEL A;  1K51 A;  3DBH I;  2ZCC A;  2KD0 A;  3IHP C;  2DYB A;  3DBH B;  2JU6 X;  2G4S A;  1YQ3 B;  2WXF A;  4LNN A;  1E7V A;  3MHS D;  2PE9 A;  3KUC B;  3ZQ4 A;  4A20 A;  4TSS A;  1K53 A;  4KSL C;  2WS3 B;  3N30 A;  3BZD B;  4KX6 B;  2W3R A;  2XK5 B;  1JWB D;  4OVZ A;  1C79 A;  4HRO A;  3TEX A;  1TS5 A;  5DPS A;  3TBL D;  1NDD A;  2BYF A;  4LJO B;  2Z0D B;  3AE2 B;  1ZKH A;  1JRO A;  1VCB A;  5E6N A;  3IFW B;  3EC8 A;  2NVU I;  1I42 A;  1YQB A;  1U4A A;  2D3A A;  4JL9 A;  3U2S C;  4K7S A;  1F2R I;  4FA6 A;  2ONQ A;  2ACZ B;  4RF0 A;  4A55 A;  1YX5 B;  4A3P A;  2K8H A;  2MJE A;  1HE8 A;  2Y5P A;  2J7Q B;  2L3Z A;  4TQ0 A;  3NVY A;  4GDL A;  1EF5 A;  1E7P B;  2AYO B;  4AJW A;  3AM9 A;  4RFB A;  3VUX A;  1V49 A;  1HQR D;  3RNF C;  1S1Q B;  2KN4 A;  2KVR A;  2OJW A;  1TKG A;  5AEK B;  4L23 A;  3ML9 A;  1K52 A;  4KKI A;  1VDV A;  3NY5 A;  2DZM A;  1IGD A;  2J0J A;  1FRR A;  4EZL A;  4R3D A;  4LK0 M;  4KDI C;  5D2M B;  1RYJ A;  4BKS D;  3H7P A;  3RMK C;  2PVO D;  3KUD B;  4GN1 A;  1JWA D;  4L1B A;  5IO9 A;  1VR9 A;  2BBC A;  1GC7 A;  2CKH B;  3L17 A;  2REX A;  3KW5 B;  3QJZ A;  1KFY B;  1YQ4 B;  2ZCB A;  4DHZ B;  3R3M A;  1FM0 D;  1I4H A;  1OTR B;  1L4Z B;  1L7Y A;  1TBE A;  2PKO A;  1EWC A;  2K39 A;  1S3S G;  4GGQ A;  3DWM A;  2C60 A;  4DDG D;  4HKZ E;  2MP2 A;  4GB9 A;  5HHD G;  1XCT L;  2Z0E B;  2KDI A;  4CYE A;  2OED A;  4RMA A;  3E9S A;  3QAR A;  4G0N B;  2WP9 B;  2K8B A;  2H89 B;  1PDX A;  1T0Y A;  3PTF C;  2ZNV B;  4ZRP A;  5AUK A;  4KDL B;  2HD5 B;  1WJ4 A;  3SEB A;  1MHX A;  4C7Z A;  5JHA A;  4ZOH C;  1FO4 A;  2N7E A;  4DWF A;  2MCN B;  4HJG E;  3OG5 A;  2FUG 1;  4AQ7 A;  2L52 A;  3APD A;  1TZ1 A;  2BPS A;  2C9W B;  2CJN A;  2DWQ A;  1EU4 A;  3ETR A;  2GBK A;  1E8Z A;  2QJL A;  3OLM D;  5CTR C;  3PO0 A;  3RD2 A;  5C2T B;  2FID A;  1C3T A;  3V60 A;  3RFZ B;  2SEB D;  3VVW B;  2V1Y A;  4W9L A;  5D94 A;  1ET9 A;  3RYT A;  1OQY A;  2JYE A;  2V3P A;  4ANW A;  2NS5 A;  1QKZ A;  1R7S A;  1RAX A;  2ASQ A;  2QEJ C;  4FJY A;  4G11 A;  2VZK D;  1MPE A;  3FIL A;  5JXV A;  4MT5 A;  4XDD A;  1WJN A;  1GJZ A;  1L6U A;  1V2Y A;  2C7H A;  3U30 A;  3VR9 B;  1ZDV A;  1ACC A;  1UD7 A;  1T0S C;  3T3O A;  1HTQ A;  1WX7 A;  2H88 B;  2KLC A;  4IM2 A;  4ANX A;  1YN5 A;  3VH4 B;  2CS4 A;  2MQJ A;  2KX3 A;  2BT6 A;  3JVZ X;  2KWU B;  2EKI A;  1D5M C;  4N59 A;  1EO6 A;  1QQR A;  5HI1 A;  3A9J A;  2VH1 A;  2JPH A;  3TUO A;  2FCQ A;  3AV8 A;  3N20 C;  3AEA B;  1FCC C;  3AEG B;  2LGY A;  2YLM A;  1OEY A;  2MA9 B;  3TJP A;  1VZ8 A;  3H8H A;  4K3B A;  4EEW A;  4URK A;  4XWT A;  4D2K A;  3SHQ A;  4DXG A;  4KZ0 A;  4FXC A;  3VAW A;  1FD6 A;  4A6Q A;  2KLG A;  4EOY A;  2PE6 B;  1Z5S B;  2D10 A;  2W55 A;  3L10 B;  1UGM A;  3I9V 1;  3Q8F A;  1OEY J;  2RDH A;  2M17 A;  2FCM A;  3LXF A;  3D32 A;  3P4S B;  1WMH A;  2BVC A;  1XF5 L;  3A4S C;  1VD2 A;  3PSE B;  4ARI A;  1OGW A;  3B08 A;  3S2A A;  4ZRQ A;  1WGK A;  1J7B A;  2CU1 A;  3DQV A;  4LDT D;  1BML C;  3URY A;  1IUE A;  2I1J A;  3Q8C A;  4AJY B;  4JGH B;  2LWP A;  2INC C;  1BT0 A;  2UWQ A;  3AE6 B;  3I3T B;  2LI5 A;  3WA0 A;  2CHX A;  2KC2 A;  1H8C A;  1EWY C;  1RRB A;  1WF9 A;  2XNA C;  4MSQ B;  2LGD A;  4N6E B;  1KTK A;  2MEK A;  2GBR A;  4BBN C;  1YN4 A;  2MSE D;  2DEN B;  3IAS 1;  4BZA A;  1I4X A;  2W3S A;  4FUL A;  4MSM B;  2NR2 A;  4GMV A;  3ABV B;  2WQY B;  2KO3 A;  4NJ7 A;  2IZV B;  1PQS A;  1FXI A;  4DXF A;  5IA7 A;  2RMM A;  1AYF A;  2WXJ A;  1IPG A;  5IKC M;  1XQQ A;  2O2V A;  2DHZ A;  3EGR A;  1AW7 A;  3WCQ A;  2HE7 A;  3QWZ B;  1Q0W B;  2CJO A;  3R66 C;  4MJS A;  1KLV A;  4RM8 A;  5AZH A;  2CU3 A;  4NAW A;  4NJ6 A;  1WE7 A;  4HLE A;  3FAH A;  3VUY A;  4RCO A;  3SU8 X;  1SE4 A;  3ZYY X;  3TSS A;  4C4V A;  2D2Q A;  2IYD B;  1R4M I;  2LRU A;  3T3N A;  3AE4 B;  3PRE A;  1WXV A;  1J7A A;  1R4M B;  2VZK B;  2KMM A;  3ZDM C;  1SJE D;  3B9J A;  4NAM A;  1HA5 A;  2N9P C;  2WXQ A;  2AQ3 B;  2PLP A;  1SEB D;  1L0X B;  1VZ7 A;  1WX8 A;  5DPR A;  2KAC A;  4MEL A;  4ACF A;  1DOI A;  3HUI A;  3T8M A;  4F1S A;  3IAM 1;  1QOF A;  3V05 A;  1RWS A;  3NHE B;  4FAD A;  1TY2 A;  1E0Z A;  4HCN B;  2ON8 A;  4M02 A;  4RGT A;  1YNT E;  3AE9 B;  1V6E A;  4PS3 A;  3KWL A;  3CMM B;  3QCA A;  2O6V A;  2IY1 B;  3V6C B;  2EMS A;  3W9C B;  4EZK A;  1F52 A;  3RNA C;  3CWI A;  2R2O A;  4RGN A;  4YTM B;  1P98 A;  4WH4 A;  3NUH B;  4JE3 B;  3TCA A;  1OFF A;  3M63 B;  1E7U A;  3PVL A;  2HJ8 A;  2DBY A;  2J0M A;  2ZW1 A;  3ZJT A;  3L13 A;  2JXX A;  2BS4 B;  4GSW A;  2DLB A;  1TJE A;  5BMH A;  2DNF A;  2KMA A;  2XBB C;  1AWD A;  3UIP B;  2DZI A;  3DHI C;  4W9D A;  4ANV A;  4JWS C;  4YWG G;  1XLP A;  4GIV A;  4WUR A;  3MC0 B;  2FIF A;  2WXG A;  5DCN A;  1DOY A;  3CST A;  1E8Y A;  3L54 A;  4RGO S;  1JWM D;  4LDT B;  4MGK E;  3ENE A;  4DHJ D;  2WDT B;  3DDC B;  2N7J A;  2MBQ A;  1STE A;  2DX5 B;  4GDK B;  4YSZ B;  3PHW B;  4W9F A;  3A1Q B;  3M62 B;  1SE3 A;  2QC8 A;  1FMA D;  1P3Q U;  3L0W B;  1K50 A;  3U7D A;  1V5O A;  2GLS A;  2WXP A;  5JH5 C;  4JPS A;  4E74 A;  4GOC A; 
#chains in the Genus database with same CATH homology
 3RNE C;  3RMK C;  3DHI C;  3N1Y C;  3N1X C;  3RNA C;  3RNC C;  3Q2A C;  3I63 C;  3RNG C;  2RDB C;  3I5J C;  4P1B C;  3Q14 C;  3Q3M C;  3N1Z C;  3RNF C;  3DHH C;  3GE3 C;  3DHG C;  3RN9 C;  2INC C;  1T0Q C;  3RI7 C;  3N20 C;  3RNB C;  3GE8 C;  1T0R C;  2IND C;  3Q3N C;  1T0S C;  4P1C C;  3Q3O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...