1FNWA

Crystal structure of streptococcal pyrogenic exotoxin a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
221
structure length
221
Chain Sequence
QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYTIDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDNKTSQIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of streptococcal pyrogenic exotoxin A reveals a novel metal cluster.
pubmed rcsb
molecule tags Toxin
molecule keywords EXOTOXIN TYPE A PRECURSOR (ALLELE 1)
total genus 54
structure length 221
sequence length 221
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fnwA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fnwA02
2WV6D 1RD9D 1KLGD 1B44D 5D3IB 1GOZA 4DXFA 1UNSA 4RGOS 2XN9C 2J4XA 2QEJC 1BCPC 1SJED 1QILA 1TS2A 5FKAC 1HQRD 3R8BA 1G8ZD 4L63B 1YN3A 1AN8A 1RDPD 1V1PA 1LLRD 1L0YB 2IJ0A 1S5BD 1LTTD 2RDHA 1RF2D 1XXGA 1TY2A 2O2LD 1SE4A 2IPKD 3BVGA 4RH6A 1SJHD 2AQ1B 4ZYSA 1LTID 1PRTF 1RCVD 1V1PB 1PZJD 1M4VA 1D5XC 1TY0A 1HTLD 1CT1D 1D5ZC 4K6LA 1LTGD 3BYTB 3EFXD 4RCOA 4RHSA 5ELBA 1PRTC 2G9HD 1XTCD 1BCPD 1LTBD 1BCPF 1LT4D 1SXTA 1HA5A 1D5MC 4TSSA 2NTTA 1DJRD 2Z8LA 1SBBB 1EWCA 1PTOC 1AW7A 1FGBD 1PYWD 1T5XD 1PRTD 2QILA 1PTOD 5ELCA 5I4DA 1CK1A 1HXYD 1CHQD 1JR0D 1I4GA 1LTAD 3DWAA 1LT5D 1TS3A 2RDGA 4C56C 4RHRA 1LTRD 1S5CD 3CHBD 4NZLB 1PTOH 2TSSA 4BWGB 2SEBD 1FNUA 2ICIA 1UUPA 1PZID 1KLUD 3EA6A 4RGTA 3BVMA 4L6TB 1BCPB 4Z9CB 2XNAC 1L0XB 3KLSX 1FD7D 4RGNA 1ENFA 1LO5D 1SE2A 1S5ED 3OWEB 1MD2D 5TSSA 2R61A 1I4HA 1JWUD 1KTKA 3GP7A 4RFBA 1FNWA 1DYQA 1EU3A 2AQ2B 3MFGA 5D3DA 1JCKB 1LT6D 1YN4A 2AQ3B 1S5FD 1I4QA 4O1NA 4DXGA 1SEBD 3BZDB 1PRTB 3URYA 3BYYB 1PTOF 1TS5A 1V1OA 3W2DA 4UDUC 1JQYD 1B1ZA 5ELEA 3BVZA 4RGMA 3O13A 1I4XA 1ESFA 1JWMD 1LTSD 3R2IA 3TSSA 1CHPD 1EEFD 3V05A 1YN5A 1EU4A 1JWSD 1D6EC 1PTOB 1STEA 4OHJA 2XRQD 3MC0B 1TS4A 1LT3D 5ELDA 1ET9A 1ET6A 2XRSD 1FNVA 1CQVA 3SEBA 1I4PA 1S5DD 3DWPA 1BXTA 1I4RA 2NTSA 1EEID 1SE3A 2CHBD 3DWQA 1F77A 5ELFA 1EFID 5FK9C 3R2TA 1PZKD
chains in the Genus database with same CATH superfamily
4PZ7A 3V62A 1HA6A 4A3GH 4FXGC 1MHXA 2XK5A 4XDDA 2E76C 4W9EA 3D3RA 4A3JB 4LTUA 3U7ZA 5BMGA 2M17A 1IKLA 3TS0A 4A3FB 3TL5A 4WIPA 3PO2G 4W9KA 1WGGA 3P42A 4ZUJA 3D0FA 5CV8A 3S1RH 1K8RB 2F52A 4B0MA 3LNNA 1YOVB 1HZAA 1RDPD 3VH4B 4OIKA 1V1PA 3GDEA 5EPKA 2XEWA 2R6GA 3VAWA 3PF4A 3RZOB 1E6EB 1PZJD 4PNYA 4DV5Q 1HTLD 1TU2B 1LTGD 4AYBE 4C1NI 1SYCA 1PRTC 2KBNA 1XPRA 2DNFA 2LGIA 1WI5A 3KOJA 1MI0A 2KEEA 5M3MH 1XMOL 4L5SA 4XT3B 5GROA 2YTYA 3AI5A 3PSIA 3RMHA 1SSNA 4B3SQ 3TEXA 3UF8A 3PO0A 3B6YA 4DV7L 4L5TA 3TMEA 3H0GG 3H91A 3JAMi 3VYSA 1Q81C 1UWVA 2IO0B 4IWQA 4N8FA 3RCZA 3STBC 4ZAIA 1I4GA 1E2VA 1TS3A 3OOCA 1JJ2A 2INCC 1WXMA 2MBQA 5IE8A 2EOTA 1ZXTA 2GVBA 1W6KA 3E0EA 5AJ3L 1JORA 3ZO5B 4A6QA 1L4ZB 4HCPB 1FNUA 4A3IB 1C3TA 1OXVA 1WTXA 2CKHB 4X66Q 1WY8A 3M3YH 4NDXA 3PF5A 3ZTCA 4KY5A 1KQSA 2Y5CA 4S17A 1UBQA 2WXGA 4RGTA 1DOIA 2K39A 1L7YA 4DGZA 4QIWB 2CS4A 5HGTA 4QGUA 1Q1OA 1PDQA 4P1BC 3FHWA 4HTHA 1C4PA 2D5DA 4I6PA 4MM3B 2L0FA 1C76A 4P2CB 5ELOA 2OT2A 1WF9A 1NCVA 5EJWA 3WOFA 4KMUC 3ITPA 3DUZA 1VQ7A 2MQJA 3NE5B 1L4DB 1LT6D 4C80A 2NS5A 5IGDA 4X3UA 3A54A 3CCJA 3CC2A 4B3MQ 3PZDA 4LDTB 1C9FA 1WTPA 4KV2A 1A6XA 2ZNVB 3EFCA 1PTOF 2V4DA 4GS3A 1QOBA 1EY8A 3ETRA 2KCMA 1SN8A 3TDQA 1J7BA 3L13A 3CPFA 2KHIA 1F1HA 2R2QA 1X1MA 3V05A 1A15A 3SDZA 3NTKA 2JA8B 1W2BA 2DZKA 3EROA 2GLSA 2IX1A 2LZ6A 4A3CH 2W55A 4JI4Q 3PIOA 2N78A 1W3SA 2K14A 1T9HA 2F0HA 3TBIB 4WWPA 4AIMA 2KJRA 3NVWA 2YTXA 4YTPB 1MG8A 2L4NA 3EBEA 2BPSA 1QE6A 4A3MH 1PHJA 4ZDVA 3E6ZX 2XGTA 4PG3A 3HEJA 4POFA 3HOWB 1EO6A 2V4IB 3C19A 3KH0A 5CHWA 1OQQA 4DV3Q 4GLAC 3H09A 2D10A 2YEPB 2D07B 3BS1A 5M3MG 2BKRB 3M85A 2JXMB 2OQ0A 2FJ2A 3MXUA 3KF6A 4X62Q 2IO3B 3KLRA 4W9JA 1ZP0B 1Q3LA 4LFBQ 2D3GA 5C2TB 5C3WA 3HG9A 4K2LA 3VUWA 1FO4A 3H0GH 3HVDA 5IIFA 1OO9B 1QILA 4LF8Q 2JA7B 2M4NA 1X3GA 5H92C 2R7FA 3HVZA 1VQLA 4WWNA 4X64Q 4DAPA 2JA6G 1HZ6A 1K51A 4K14A 1CZGA 1UE7A 1XXGA 3MXNB 1LM8B 4JL9A 2AQ1B 2LEKA 1C1YB 2MBOA 1C8CA 3R93A 5C4JH 1YHAA 5IGGA 1YI2A 4NP5A 2XTIA 1HRJA 2J0JA 3Q3NC 1CA6A 4JE3B 3BDLA 3OMCA 2D62A 2F3VA 4FF2A 3PREA 1A3VA 2HDEA 5NUCA 2MQHA 2F0IA 4P75A 2KHWB 4AQYL 5IKCM 4AUQC 1E1TA 4E74A 3JSVB 1NR4A 1QVCA 2BDNA 4G4KA 1Q5WB 4UPAA 3HOXB 2KTFA 2L05A 1ILQA 3L4PA 1D1KA 3Q6SA 1FGBD 2QA4A 2A69C 3PIPA 2AUKA 1X56A 4IWOA 1YJIA 2E5LL 1IKMA 4RWSC 1BNZA 4KHPL 2LMCA 3GE3C 4FXCA 1QOHA 2MBEA 2RDGA 4C56C 2H4OA 1PH3A 4OX9Q 3I4LA 4BBSG 5CGKA 1TZOA 3PQIA 3NY5A 4X57B 4A3OA 2N0SB 3WANA 3QG1A 4DKAC 1IYUA 2LXAA 3JYUA 3V6CB 3ZUNA 1II3A 1EM7A 1V43A 4M1UB 2QW7A 5KEEA 2BGFA 3AE2B 1UBIA 3I63C 4LJPB 3S2DH 1V5OA 3QOLA 1GC7A 3DHIC 1WZ3A 1SNQA 1V8CA 1ZXHA 1ZYRC 1EY0A 4GLSC 5C0XI 4A3MG 2KACA 3IBEA 2KFKB 1O7ZA 1XO3A 4K8IA 4J8QA 2K1BA 3GD7A 3Q24A 1STAA 1RL2A 3I5JC 3JAME 1FGUA 4IOCA 3UQAA 2JQRB 4TKNA 4JI3L 2MEKA 1N33Q 3FILA 3RMKC 5F2DA 4A3EH 1XF5L 4OZCA 2WXQA 1WTQA 2IO2B 3T9LA 1F2YA 1VQAA 2Z4IA 3GTPH 3W2DA 1UEBA 5LMNW 1X6OA 2NPTA 2JA9A 4HIDA 2K05A 1K83B 1TZ1A 1G6JA 2CVRA 4NJ7A 5EAYA 3K57A 3PCOB 2A4ZA 2ACZB 2IBIB 4Q2JA 4R1JA 1MBYA 3CXCA 4GMVA 2XRSD 5KIXA 4MDKE 5HURA 4BZAA 3RFZB 4CDDC 1NJIC 3DOWA 4G0NB 2E2JH 5FLMH 2K6DB 2B2VC 3ENEA 4AQYQ 4IG7B 1WX8A 1T3QA 2OEOA 1LGRA 4MT5A 3HM3A 1I35A 1ENAA 1VQEA 1JWAD 2DHZA 2O6VB 3MXGA 1A0IA 4MTNA 4MGYE 1VF7A 2H88B 4P7IA 5HHDG 5IO9A 3SK5A 4CQNA 2EMTA 5KNBA 3HOZG 3QQ8B 4Y7NB 2PLPA 4YCUA 3DXJC 3CCLA 4KN7C 1KAAA 3ND9A 1HHVA 1TWHB 1E8ZA 2CHWA 4DHZB 2L5TA 1PMRA 4OGQC 3ULPA 4PZ6A 2R7ZB 2DZIA 1YITA 5BYQA 4DUYQ 2IPKD 1EYAA 4MHEA 4QQBX 4LFBL 4A4IA 4HDQA 1SMXA 2NR2A 2YVCA 2L12A 1M4VA 2ZXPA 5LL6X 3PO3H 1IW7D 2I2YA 2M8SA 5M3MB 1MJDA 5ELBA 2EJFC 4FF1A 4BBSH 4XIGS 1HJPA 1Z6HA 1VMPA 4FHKA 5DPSA 1IP9A 2WIIB 4TSSA 2WWZA 1MKHA 3AU4A 2AWNA 2CHXA 1YNTE 1GNUA 2M0AA 1RODA 2D0PA 1EWCA 1L6VA 1NTGA 3KYCD 4IZ8A 2QHOA 2F4IA 4KDIC 1GJZA 2KCTA 1QOFA 1TWGB 3FP9A 2KO3A 5C3XA 2REXA 5CORA 3Q8CA 3SDLC 3HOXH 4MTKA 1YZ6A 4KI0A 1FJGQ 1N32Q 3PVLA 1YJWA 1LT5D 4YHHQ 4K0KL 2MRPA 5C23A 1H9SB 4P72A 1YX5B 4A20A 2KN5A 2CQAA 2K32A 3NBHA 2EYJA 1WJ4A 1SE9A 3NG0A 4IM2A 4LJOB 4NXML 4B9XA 4BS9A 2VZKB 1T0YA 1EY4A 3AEFB 4W9IA 1TWFB 4L8JA 2EQSA 2ZPNA 4DDGD 2B2YC 2MX2A 2N9EB 4KZCA 4AS1A 1EOTA 1XLQA 2ATWA 1Y8PB 3GTKB 2XVSA 4X65Q 5AUKA 2WXJA 4ZOHC 1JJCB 2NZHA 2OOBB 2WU5B 2EXZA 1N34Q 4K5XA 4S3SA 3F2CA 4GNXA 4JBJA 1Z47A 2YEPF 1F2LA 1NDDA 2QCPX 3Q23A 4XQNA 3RZDB 5KGUA 1NMFA 1PYSB 3W3AA 3NP8A 1RIPA 1SYGA 1HNWQ 5JXVA 2KQ3A 2R92H 4IO9A 4ALPA 5JPNC 2FNJB 2C5CA 2MBBB 3DVNV 4XWTA 3PRZA 2HDMA 3TZDA 3CCSA 3DLLA 3RN9C 1YN5A 3HK0A 4ZRJA 3T13A 4A9AA 1NEKB 3TZUA 2YU9B 1JWSD 1GXDC 1PTOB 1STEA 3TREA 1PH5A 1I42A 3CQZB 3QIJA 4B3ML 4JX1C 1CQFA 2WGSA 5FOBB 2K8HA 1I4RA 5M9OA 2IYDB 1XTDA 2RSOA 3B9JA 2BWFA 3O65B 5CV6A 4WURA 4C4VA 1GB4A 2E3TA 4FNFA 1JRUA 3QWZB 3S1MH 2KHJA 4ZRKA 2EKIA 1L0WA 3ZNZB 4K2KA 5G5HA 1B50A 2JRHA 3QWNA 2JF5A 1JMCA 3K58A 4U673 4LF7Q 1ZUD2 3DBRB 1O7IA 3SK4A 1E10A 1TWCB 4QMGA 1FRDA 1BDOA 1WTHA 2GRIA 2VQEQ 2Q8TA 3KYHC 2QGQA 2DX5B 4FBJB 4O42A 3SXHA 4TV3A 2BH8A 5IGCA 2EZVA 3HOXG 3N3KB 4XX5A 4BFRA 1WMHB 4A3FG 1I50B 4IUQA 3C8YA 1IYJB 2UXDL 1TY2A 4WJNA 1Z7TA 3X3MA 1AZQA 3R66C 5M5XH 3RPFC 3CRLC 4WJWA 4GB9A 4LMQD 3EFXD 4RCOA 4RHSA 4FF3A 4Q5VA 2IHEA 3GTLH 4JG2A 2I5HA 3S16H 1EY7A 2EKEC 4MN3A 1KRHA 1VJKA 2F0WA 2VQEL 3DEPA 1WIAA 4WQOB 1DJRD 3I72A 4R9WA 1HZBA 1Y14B 3EJIA 4B3RL 3D4WA 1WJUA 2D5GA 2KECA 4WQMA 3QR8A 2YYZA 2KENA 5C3EG 2FCQA 2CQOA 4WJ4A 5C3EB 2HD3A 1TWGH 1VQFA 2WB1G 1LUZA 4NQLB 4DBGA 4DWFA 3CU7A 3PUVA 1CHQD 1JR0D 4C2MB 1XNQQ 4A3LG 2GBJA 1C79A 1NVID 5DPRA 2IW3A 4LFAQ 2B63G 4A3MB 1YIWA 3GOEA 5CV4A 3DBHB 5IOIA 4US9A 2ICIA 4QJFA 2LFIA 3E56A 3WOEA 1FRRA 5I2YA 5M5WB 1Z2MA 4G7HC 3VDZA 3EA6A 4X3SA 1VR9A 3OWFA 5CHVC 3T1HL 2OXPA 1ZEQX 1KDAA 2VXWA 2VUMH 2C5LC 2KQSA 4NQKE 2ZXRA 1Q90A 1Y1VG 5GAGC 1QUQA 4A93H 5EGTA 1SE2A 3OLMD 3Q3FA 4WJPA 2BE5D 1ZXIA 1I4HA 1WYWB 2LSSA 2Y0SB 1QQRA 3C3LA 1XMQQ 2V3SA 1KFYB 2DJGC 4LLGM 4NXNL 2KOLA 4FF4A 4IQZA 1DXMA 1SFOB 1YN4A 2L76A 3VR2A 4GKKQ 4GU2A 1I3QB 1Y8OB 1KRSA 2JP1A 3J81i 4KK7A 2N7EA 2KDIA 4KKTA 4YWMA 3OHXC 1I7HA 4JI5L 1RFAA 1EYDA 3R7RA 4XC2A 4RCNA 1PUTA 3MTNB 1TTNA 1VQ5A 5E6PA 4ANWA 2SNMA 4GDKB 1VDZA 1ESRA 2IHFA 5BYSA 3T3OA 1AWDA 1P8LA 1R4QB 2A5HA 2VQFQ 4HKQA 2ZW0A 1BR9A 1B2TA 2JSVX 2JT4B 5JHBA 4WORA 2RQXA 3HOVH 4ZK9B 2EJMA 2X38A 1GPXA 4LFCL 1ENCA 1YJNA 4RM9A 5C4XG 4HMIA 4DUZL 5D7GA 4EUTA 3TP7A 2KCCA 1N60A 2RF4A 1RHPA 2B2VA 2PO4A 2WX0A 4KIKA 4MGIE 4GKJQ 4GKJL 4A3BH 2M0XA 1X3QA 3M4PA 3GTOB 1WTRA 1TGZB 5HI1A 4KKIA 2B63B 2AX5A 3U2SC 3AEEB 1GOZA 2PZUA 3TN2A 1GC6A 1CKMA 3Q8DA 2O5JC 5JJKA 1CZWA 1JC7A 1OEYA 4OXPA 4YWLA 5IP7G 1PH1A 3R8BA 1AP0A 4CKEA 4OZAA 4WWOA 4EZJA 5C44H 1YQ3B 3W5UB 1C7YA 2KFJA 1RWSA 1JE5A 3J7AV 2X6GA 3CPWA 3ZQ4A 4ZHPA 1LTTD 2PVOD 1S72A 3LYYA 1E7ZA 1RFKA 1RJTA 1PRTF 1RCVD 2EY1A 3MXNA 4K3CA 3RNEC 3W1BA 2W3RA 3VA5A 3DM1A 3BYTB 3K8AA 3GZNI 2A74C 3J7YW 2WACA 1TKEA 1IBXA 2BA1A 1HR0L 4DR1L 4JBKA 1TKYA 2F0EA 4HDOA 3VH3B 3A9KB 4TQ0A 2J7QB 1PFBA 3STBD 2VUMG 4IW0A 3A8IE 1UE6A 4LF8L 1KRTA 5G55A 4ZLTF 5IT9c 3PGEA 2WXHA 1AE2A 1BBWA 4REZA 2KQ4X 1BUIC 1UAPA 4H0LC 5I6WA 4XDXA 2O5IC 2QILA 1K8AC 3SGIA 3NRZA 2FINB 5ELCA 1Y1WG 2KZRA 4A93G 1AZPA 3LDZE 1Y1WB 5CYUA 1DOMA 1XLOA 4YCVA 2P5ZX 3TEHB 5GXGB 4FYDA 1JQ4A 2F0KA 2F0DA 2HCCA 3CF5A 2N7DA 1WJJA 4GN3B 4BWGB 2SEBD 1CA5A 2L9HA 1V80A 2WXMA 4EEWA 2F3WA 3PO3G 1EF1A 1PZID 4JCVE 3FAHA 4IOAA 1WSPA 3ZRFA 2UUAL 4KVGB 1VQHA 5JEAG 1FJGL 3OSOA 3I4NB 1TWAB 5J17A 1L1OC 1N61A 4P16A 3D4RA 3M95A 4OX9L 3AE6B 1IBLL 1FD7D 1S40A 1LFDA 4RGNA 3PMFA 3RZDH 2ZVOA 2MBHA 4KSKC 4DK3C 4MJSB 5JHAA 4KHPQ 3VTVA 4J6HA 2WXNA 4II2B 5JEAJ 4HJAA 3NQTA 1R7SA 4N9TA 1OGWA 1MI2A 5HG2A 3QCAA 3BJUA 1SYBA 3L0OA 1WJNA 1EUJA 3AFPA 4JWUC 2PW9A 1J8IA 2A1AA 1QOAA 1PDXA 5T8IA 2D3CA 5C5MA 5DPTA 4IWPA 2F4VQ 3GTQB 4QCLA 2FE8A 4WWMA 3IRBA 3BDCA 3TJPA 2FIFA 3OTOQ 5I9PA 2VY3A 3ZVVA 1B1ZA 5IP7H 3AEAB 1I3QH 3BIID 4DFAA 2CFMA 1JWMD 5A2QE 1PFDA 1VS0A 1IBLQ 4PYUA 4KX6B 2BTEA 2LHDA 2OF1A 2ZTDA 4I7AA 3NSWA 4IPCA 5J2RA 4DHJD 2H5XA 2J0TD 2WU2B 1YBYA 4JV5L 1AARA 2E74C 2O6VA 1QZEA 2QEXA 3RYTA 2PPHA 4X64L 4CYEA 1QVGA 1M1KC 4XWWA 3KBGA 1K8MA 1UE5A 3N6RA 1G6PA 2Q8RE 2JXXA 3U58A 3GZNB 3AE7B 1R4MB 2RHQB 3EN2A 2A68C 3HIZA 1PZKD 1FFUA 1PH2A 2OHFA 2BE5C 1TWCH 1KLGD 4HR7B 1WH3A 1E22A 2A5UA 2XN9C 2DN8A 4KIKB 4KY7A 4UAIA 5E7NA 1BCPC 2KLCA 4L2YA 2B2WA 1D3ZA 4HN7A 2EY5A 2HDLA 4PYZA 2NB0A 3OW7A 5IA7A 2RDFA 1IBKQ 1XMQL 1SNPA 1TBEA 3H94A 1V49A 2LRUA 1VQ4A 1S5BD 4DPGA 2HIVA 3BK2A 1J9OA 3HOZB 2MP2B 3S1NH 2NN6I 3AEBB 2KJXA 4YXDB 2EIFA 1LM0A 4IJHA 5AEKB 2WDVB 1JOKA 1ZOYB 4H02A 2V9HA 1PH6A 4DV6Q 2DBYA 1L1OA 1BBXC 1LTBD 3W1SC 2OJRA 3VXWA 3DM3A 1D5MC 3VQIA 2NTTA 1U0LA 4C3IG 3NHEB 3OMGA 3PV0A 1RAXA 1V1QA 2R92B 1C4CA 3X23A 5IT9L 3IFTA 4EQNA 3ECIA 2Q2HA 1ZW7A 3CC4A 4HEA1 2IY0B 4G50A 4KDLB 1H9SA 1T5XD 2LUEA 2GBNA 2I5LX 4LDTD 4HVBA 3I4MB 1D2BA 2L83A 2WX1A 1GKHA 1N32L 2EE1A 4OWXB 2BT6A 4XYCA 2JU6X 4JYAL 1V9PA 2GVAA 1QKZA 1K83H 1EWYC 2GB1A 1FCLA 3PT2B 1V5TA 3HP3A 2JQOA 4XXEA 3V96A 4AH6A 2RCFA 1CZPA 3NZUA 3ZLZA 2MW5A 1SYFA 2K6AA 5LL6S 3T4AC 2NVQB 2WB1E 4Z9CB 1L0XB 3A55A 1VF5C 3I70A 5BN4A 1WZ0A 4RA8A 2G9DA 2IL8A 3CCUA 1P3QU 3OWEB 2YV5A 1B7YB 5HGQA 1AH9A 3Q69A 3A8KE 2BS4B 2V3NA 5CTRC 2W9NA 3AH7A 1JWBD 3A5ZB 5D3DA 1M8AA 1A8VA 4YSZB 2AQ3B 1ML0D 1S5FD 3MVVA 4OO1G 1STNA 2FBWB 1E3PA 2NBWB 3U9OA 4PS8A 4B3TQ 5ELEA 4WAFA 4IFDH 3P4RB 1I4XA 1K3BC 4E3CA 2HE7A 4QIWE 2VNUD 2CU3A 1BVSA 2VRRB 3E9IA 2A6HC 1ILPA 4IOIE 2KVRA 2INNE 2KTRB 2PKOA 3ONAB 5I9OA 3IXSA 2SNSA 2FAZA 4F7XA 2AWTA 2C35B 2WXFA 4DF7A 1MFWA 3ALBA 2MSED 1X3EA 1WJ6A 2G1EA 3G7LA 5ELFA 1F77A 2M19A 4X62L 4PZ8A 4ME5A 4HRSA 1IYVA 2WAQB 2GMIC 2D9UA 4DR5L 4LF9L 2JYTA 3N1ZC 5JH5C 4LFAL 1KDCA 1STBA 1ICFB 5FO8B 5H1SE 2JE6I 3MEHA 4JW0A 4DNTB 3EIVA 4ID6A 3J81E 1EOVA 4TVAB 1R4NI 2KJHB 5D2MB 3ICEA 1VZ8A 5HKHA 3OG5A 1PA6A 2ZJQA 1YNNC 5IT9E 2E2HB 4N9F4 4QF4A 2JWZA 2ZJPA 3U30A 1K8OA 2NCNA 3UE1A 2IJ0A 1TWFH 3B0AA 1F2RI 1HR0W 1EUVB 3BVGA 4F8CB 5BN3A 4F1SA 4UY8C 5IYDH 4MJSA 1JMLA 1TY0A 3U4EG 4B95A 4DR6Q 4BKSD 1HUMA 3UI2A 1E7PB 1V8QA 1R4MI 3NQIA 3HOZH 4DV2Q 2JZPA 3B08A 4AOFA 3ZGZA 4UP7A 1WCMG 3CWIA 2DNCA 4A3JG 5M5YB 4CJ1B 5E6JA 2PMZE 2L55A 2WDQB 4G3XB 2FFKB 2RMMA 1KLVA 3HOUH 4JI0Q 4G57A 2NZ1D 4DV3L 1H9KA 4Q0FA 4XQJA 1WE6A 1N5XA 2Q8IB 1YQBA 4K7WA 2UU9L 1AW7A 4JV5Q 5C4JB 2BVCA 2JUOA 4ASWC 1IYFA 2K22A 1HTQA 1P1AA 2FMMA 3S1QB 3A4RA 2TMPA 2H1EA 2N7JA 4TKOB 1KDBA 4TUUA 1HXYD 2F0FA 3S15H 3D6CA 1WR6E 1EIYB 3GTJH 5BMIA 3K6OA 5IOCA 3T1YL 4TQUS 1JROA 2F0NA 1XCQL 1X55A 3L2PA 4P71A 1P7FA 1PTOH 3K0YA 2KTRA 4DXAB 2M00A 3CD6A 4A3DH 2QCZA 2F4VL 2IX3A 4XGAB 2AEHA 2PZTA 1ZE3D 4MGZE 2K5VA 2UU7A 3RNFC 4L6TB 1C9OA 4JQWC 4LK1C 3MXPA 1QNKA 1E8YA 3C0RB 1JOOA 2ZM6L 4JI2L 1TIFA 1JWUD 2KD0A 4MNOA 5CV7A 2NVQH 1T0RC 2K9XA 3VTUA 1J8CA 5JVH3 1WWTA 4DAMA 3TIXA 3QK0A 5IODA 2SAKA 3W1SA 1Q1EA 2F3IA 4H13C 2PW7A 4GDKA 3HFZB 2Y5PA 1LABA 5EKIA 5BR8L 1PRTB 4DNRB 3URYA 3BYYB 3A5UA 1GHKA 2UWQA 3PHWB 4BKTA 1TS5A 4CJ0B 4HCSA 2KLGA 4XYQA 1WYGA 2KHSA 1JQYD 1Q8KA 4PMWA 2F0TA 3PUZA 2UUCQ 2CCZA 1Y8NB 3BU2A 3GV6A 2JA7H 2NN6G 2DYOA 4JI2Q 3MC0B 5M5XB 4WJOA 3G71A 3M4OH 2BH2A 2L32A 1STYA 4OW0A 1CQVA 3SEBA 2R3ZA 2MPMA 4GLVB 4PQXA 2NTSA 1B9RA 2KA7A 3CCMA 1PH9A 4OWTB 3F1ZA 1AE3A 3R2TA 5D94A 1WCMH 3K59A 3D8GA 2B2YA 2ENBA 1RD9D 1EYGA 4I7ZC 3NVVA 3ZDMC 4AP4C 3WDNA 1UNSA 1DGJA 1EIHA 1FEHA 4LNFA 1UGMA 2OWOA 4IPDA 2E2JB 1WGHA 1L1OB 3L54A 4AYBG 2RA4A 5GMVA 4JI3Q 2LXCA 2UXBL 3SFDB 3VR3A 4JBWA 3HOUG 3AEDB 3S2DB 1D4BA 4LWCA 3HM6X 4M0WB 2KVZA 1PH8A 4BOSC 1G51A 4TQ1A 2MP2A 3DHGC 1SE4A 1W6JA 1SGHA 3VA7A 2HJ8A 4ANXA 3OIPA 4LJZC 3FPUB 1D5XC 4CGYB 3PPAA 1SAPA 3VR8B 2MHVA 3QAQA 2L1BA 4NAWA 4HIMA 3AN1A 3V61A 2BQQA 1Y1VB 1V6EA 1HA5A 2R7ZH 3HOYH 1CM9A 3ZJUA 2Z8LA 3T16A 2DNEA 4A75A 3L10B 4KKJA 4PK1A 4A3FH 2K1FA 3CCRA 3KF6B 1E2ZA 3GTPB 4LFCQ 4UP9A 4K8JA 2N3SA 4FLHA 3ZXRA 1S4ZA 5JVG3 2KC2A 1PTOD 3FRPB 5LNK1 5I4DA 2B29A 1NMGA 2JZ3B 4OVZA 3APFA 4C3JG 1LTAD 2JSOA 4MSMB 4DR5Q 4LF9Q 1HPCA 2PJHA 1JB3A 5AJ3Q 3SK8A 2LJIA 3UIOB 1Q1BA 3ZW3A 1QG7A 3CCVA 1B3AA 2K8BA 1YJ9A 3LWEA 2WXKA 1YVCA 2MJEA 3N1XC 1LTLA 1K28A 2C7HA 4IUNA 2WKCA 4D2KA 5DNFA 4PV1C 3AEVA 3DWMA 1OXXK 1NYQA 1WRIA 3P4QB 2O6VD 3CRKC 1LO5D 3AXCA 1S3OA 2GBKA 2L52A 4AYBB 4A3LH 1YX6B 2C7NB 1Q7YC 4IUUA 2DJFC 1UZXB 3QARA 3WAPA 3A33B 4F7ZA 2V3PA 4MH0E 2FHTA 2NWGA 4EQPA 4IDIA 2EPBA 4BXXG 3PZ7A 2E75C 4A3KH 4O1NA 2L7RA 4ANUA 1H9RA 4CKCA 3HUIA 3R7QA 5DCNA 4F8MA 2PI2E 2V1CC 2V4LA 1KD1C 2K52A 1R9TB 3DBLB 3GTGB 4OZBA 3Q8AA 4BVUC 5EDSA 2QDBA 4M01A 1K52A 1B70B 4RKLA 5DAUA 2PVGC 2AHOB 1TIID 1NENB 1BQQT 4DQOC 3DWGC 3Q2AC 3W1GA 2LY7A 2AYOB 2OTLA 5K36G 1ET6A 3K5LA 3OYYA 1BOSA 4RNAA 2KANA 2JY6A 3PTFC 3KBXA 4DK0A 2B2WC 4DUYL 3TRZA 3FKIG 1IGCA 4M02A 5FK9C 4JI4L 1HE8A 2LASA 4PS3A 3B1LX 2MGSA 2XWBB 2WYQA 1E2WA 4ME3A 2O4XA 3B2GA 5IYCG 4GLXA 4FA6A 3WWVA 5IN7A 4RG1A 3N32A 2HQLA 5D3IB 1EIFA 1GO3E 1VQ6A 4HJ7A 2A68D 4LNOA 3VUXA 3EVQA 2CJOA 3I3TB 1I6HH 4C3HH 4RMFA 1I5FA 2JA5G 4HIOA 1OEYJ 3AE4B 1IBXB 4KKSA 2Y5BB 2BS2B 4URKA 1X54A 2HQEA 3Q3OC 3PUXA 1WXSA 2W82A 3MJWA 4EZLA 1YN3A 2DLBA 2XSCA 3K7AB 4BBRH 5FLXc 1XNRL 1E7UA 1LLRD 2MJ3A 4LAAA 3WAMA 2PZWA 5TR5A 2ZTCA 5CV5A 1WFQA 3CMAA 1HNXQ 4BAXA 1PQSA 2Q2IA 3W5OA 4IFDJ 5FO9B 5A2QL 3VR4A 1N36L 1A3TA 4JI8L 5KHQA 4DK1A 1FPYA 3TUOA 3UQBA 2A69D 1GUSA 1XTCD 3SFEB 1C0AA 1UF0A 1BCPF 3ABVB 1P16A 2LS01 2E2IB 3J80c 1QJOA 3J80L 2KMMA 5G5GA 3J7AF 4QUFA 3F2DA 4DR2Q 2KJ6A 1KNEA 3T1HQ 1PFSA 2N9PC 3H0GB 5FR3A 2Z59B 2JA6H 1WM3A 1VQGA 2Z6KC 1RTOA 4HCNB 3SHLA 1PRTD 5AZFA 3PGZA 1HUNA 1QUQB 5LLIA 4JPSA 2XIWA 3OW2A 3UDGA 1XT9B 1RRBA 5J22A 2R92G 5EQ0A 1LTRD 3HKZB 4HPLB 3I4MG 1K8GA 3QX1A 2F0SA 3EECA 1VMCA 2ID0A 1XD3B 3Q6BA 4IURA 2FIDA 3AB9A 3CCQA 5GAHC 1E90A 4AJWA 3H3VI 1IBMQ 4BY7H 2QSDA 1V2YA 3IFDA 4EQ5A 2V0GA 3JSVA 1FM0D 4XYOA 1BCPB 1VQDA 1R4NB 4KJOA 1R4PB 1HZ5A 3EHVA 2CH4W 2K01A 3HHMA 5IY0A 3CP0A 1SRUA 4K7SA 3I55A 2IY1B 3SU8X 1HTOA 4FHJA 2CWPA 3AQQA 3CKIB 4LF6Q 1XCTL 1XLPA 3MJ5A 1XJVA 3Q3JA 4LK0M 1CSPA 1I94Q 1C4AA 1FNWA 2X69A 1S3SG 5KRUA 2AQ2B 4LUZA 2LUMA 5CBAE 1C78A 1FXTB 1XPOA 3VTWA 2E2DC 3G48A 3AYHB 2NVXH 1F2ZA 2JWUA 4MEMA 1MJCA 2K33A 2BCOA 3JAMc 3FKIH 1TWHH 1Q46A 3JAML 1FR3A 2MP1A 4HJKA 4OVVA 2BB5A 3P1HA 3EC8A 3N20C 1MG4A 3M9BA 2PCFB 3ZJYC 3QHTA 2HT1A 5BN5A 3PO2H 4A3DG 4AJYB 3BVZA 1I6VC 2PW5A 1LTSD 3O13A 3KW5B 4A3GG 5COYA 1EEFD 1CI3M 3AEGB 5KHOA 1EU4A 3ZTDA 3V3XA 2DGYA 1TKGA 4C7YA 2K5QA 3FVQA 4C3HG 2JA5H 2KFKA 1S5DD 2VW9A 4X66L 3I4NG 4HXDA 5EBDA 2EJGC 4BBRG 1SLJA 1OXUA 3TS2A 2ON8A 3CSTA 1PYBA 2F0UA 3K80C 4HIKA 2N9LA 3GTJB 5I6YA 3UDXA 1H8CA 1CKNB 5J18A 1ASYA 3I9V1 4DR7Q 2AMCB 2NVYH 4XDCA 4WJ3M 4DDID 1MPEA 2K6QA 4RGOS 2RKSA 3G4SA 2GA4B 4DR6L 2KMAA 1PFNA 4XTCS 2KK8A 1SF0A 1MHHE 1L2FA 2KWDA 4E71A 3BWUD 4HROA 5LMNL 2IY5B 3GTOH 4DR1Q 1L0YB 2Q2UA 1RF2D 3K7UC 4W9GA 3NS1A 4HSPA 5DM63 4ZRQA 1V1PB 2LXJA 3GTKH 5JJIA 1ZKHA 2RDBC 3M3JA 2I46A 1N36Q 3A9KA 4B3RQ 1IBKL 4FN2A 5CMDA 1YD8U 1CSQA 1DM0B 1SSOA 4R8NA 1PH7A 1GUWA 3DHHC 1IXRA 1KXLA 3NEMA 4OEMB 3M7NA 4NAMA 3NPPA 3RNUA 5BMHA 1RKNA 1BT0A 1WRDB 3FMCA 2QJLA 5CBEE 2DY7A 4DR4Q 4A93B 2R93H 1MSGA 2PEAA 4FADA 3IAS1 3BG3A 1WI0A 2JA8G 2GBRA 2WDTB 4F88A 2LMCB 2CW0C 3P20A 1SFOH 4BY1B 3DWAA 1I94L 3HOVB 2BKFA 1IL8A 5E1FA 2GBMA 3DVNU 4GOPB 3KWLA 3M62B 1MHWC 1Q86C 4K5WA 1JJGA 4BBNF 4RMAA 1A5RA 2KX0A 4GOCA 1D8LA 4C3IH 1UE1A 1OQYA 1Z5SB 4KD3A 2K25A 3QA8A 1UUPA 1YMHE 3NTIA 5KNDA 1WD1A 2JRIB 2EY2A 1FXAA 4TRDA 1KJTA 2WB1B 4DV4L 1E5WA 5GQOA 1WOCA 2UU9Q 2R7ZG 1WVLA 2D3BA 2G45B 4ICVA 4FO2A 2ZCBA 1KM7A 2OJWA 2HUGA 3I90A 4MH8A 3D6WA 4A3CG 4IM3A 1KTKA 3J81j 1YIJA 3P63A 1U4RA 1DYQA 1C48A 2B8FA 3MHBA 4HAEA 3VRAB 3AFQA 4UP8A 1GUAB 5IYBH 2A19A 1I4QA 4FXDA 1VDVA 1OTCA 5KNCA 2J53A 4USAA 4IFDI 4NJ6A 1GHJA 4JIOU 1EY6A 1AFPA 4JI7L 3OAWA 5D14A 1DOXA 3KYDD 3FKIB 2EDGA 4N9PA 4UDUC 3ULLA 4IUTA 3M63B 1XLNA 4KHVA 5FJ8G 1XMOQ 3HRDD 3ML9A 1Y56A 3KK7A 2L00B 1ZDXA 1F9JA 1F52A 4E6IA 4LUOA 1S1QB 1E8WA 1HFGA 3NBHB 2JN4A 2Y0SG 2XK5B 4O0AA 4MM3A 1VCIA 4M8MA 3PO2B 2CJNA 1HQMC 4BY1H 2ONQA 2ZVNA 3P4SB 3AMUA 2F0GA 1ZPSA 1NBFC 5ELNA 3SD5A 4TMAB 2EYOA 1BXTA 4GSWA 3ZNGC 5M5YH 4OO1H 4GN5A 2ZJDA 3IAYA 2CWAA 3IL8A 4YWGG 4RKBA 4GZYC 1QB5D 2WV6D 2AUJD 4JC0A 5EKKA 3R3OA 1YNND 3T51B 1B44D 1KAWA 4ZRZA 3J81L 4BXXH 3K5NA 4P73A 1SIFA 1WGKA 1CKOA 1J5EQ 2G4DB 4HCEA 3V60A 3F8TA 2R93G 3DPDA 2JEBI 2MLBA 2RPVA 2Z6BA 3U52E 1L6UA 1SJED 3I56A 3TBLD 1HQRD 3ERQA 4CDEC 5C4XB 5LMNQ 2PNHA 4YTNB 1N5WA 1N6ZA 4P6VF 3KF8B 1NI2A 5K36H 4RH6A 4FP5D 1F2RC 3HOWG 4ZYSA 2ZT9C 5EKLA 3CCEA 1QVFA 2NYZD 3ZDTA 2LKVA 1J6QA 3S2HB 1CT1D 2Z1CA 2LVQA 2X8XX 5DM73 5JEAH 2UXDQ 2CHZA 4UHVA 1ASZA 1LT4D 4JVZA 2V1YA 4U68A 3F2BA 1B3QA 2CW0D 1SROA 3DCGA 3NUHB 2WAQG 4I65A 4DK6C 4ZKBB 5LHY1 3DDCB 2ZXOA 1SBBB 2UXBQ 1FCCC 4GNXB 1UD7A 2KYWA 4DV4Q 3RUZA 5EPJA 1V97A 1QNUA 2L11A 2N88A 1DOKA 3RR5A 4LNQA 1GAQB 2K5PA 5LXIB 2M2LA 1E7VA 4C00A 4PT5A 1KIXA 2D2QA 1VQ9A 1YNJC 4HK2A 1CK1A 3MHZA 2WFWA 3A8JE 1A63A 2PTLA 4R4CA 3L0WB 2NZOA 3S17H 2Z0SA 2C60A 2NVTH 4HKZE 3U8ZA 3A9JB 1QWYA 1S5CD 2I1JA 3PUWA 3MP9A 1WTWA 1EQQA 1YJJA 1TT2A 4XQQA 4A3EB 3AULA 4C7ZA 3KUPA 1EYCA 5IYBG 4A3EG 1V81A 3OTOL 1J7CA 2IT1A 2D0OA 2CR5A 2NPTB 5LMUL 3Q8FA 5E4XA 3PHXB 4NKLA 3I3CA 3LX0A 2WAQE 3TP5A 5IGEA 1TXYA 2PQAA 4H2AA 3NWTA 5FJ8H 2WXIA 4LNNA 1WCMB 3FILB 5TSSA 3C46A 1MD2D 2NN6H 1A70A 1AYFA 4R4QA 1UWMA 3KLSA 2B63H 5C3EH 3GB1A 2D2CC 4NXNQ 1XPUA 3M4QA 3S9WA 1H4RA 4HWIB 4MSQB 3K7AH 4BBRB 2RCNA 3S14B 4HJGE 4IN3A 4JLCA 3I2ZA 3H3VC 3TEZA 3BZDB 2KEDA 1P98A 2WHIA 1SB3C 4K7UA 2A6HD 4CBVA 3NOBA 3MZ5A 3U4VA 5G2NA 4EE2A 3FPPA 1SNOA 4N58A 4OIJA 3UINB 1NUCA 2UUBQ 2JXTA 3KUCB 3HZXA 4GNXC 4ARIA 2EY6A 2R7DA 2C9WB 4KKUA 1NY4A 2NBFA 2BF8B 2MHJA 5EPLA 3ZJVA 2F0VA 2BYFA 2KAJA 4NY0A 1STGA 3K9OB 3MA2B 4EQOA 1KC8C 3GS2A 2NVUI 1EEID 4II3B 4ANVA 3I8ZA 3HOYB 2JA6B 4NMZA 1EFID 2LGSA 2BA0A 3H9DA 2K28A 2B76B 4YHHL 1IPGA 3I7FA 3EFUA 4APVA 3QO2A 3SK6A 4OO1I 3QIAA 3RI7C 3T3NA 4HMJA 3VRBB 4LF5Q 2UXCL 4NW2A 4DAYA 2LHEA 5FLXE 5JAVA 1C77A 1U4LA 2L15A 3FKYA 3H6MA 2Z0EB 1QLBB 3PIO3 3C2PA 3A56A 1VQ8A 1P7EA 3Q8BA 1G8ZD 1STHA 4POGA 4JOIA 2F0LA 1XNRQ 1AN8A 1NBWA 2SOBA 3N52A 4S0RA 2K75A 1F0ZA 2RDHA 3RUIB 4H7BA 3S2AA 1Q8IA 2CH4A 1G6ZA 3PZ8A 4JGHB 2VH1A 5C4XH 3V6EB 3I4NH 2I1KA 2MH7A 5BYRA 3PV1A 1JB7A 4DN4M 3UE0A 1PFMA 1VLBA 1TT5B 2DAFA 3G6JB 1GD7A 4WJQA 1BCPD 1PV4A 2WXRA 2EYHA 3Q3MC 1SMYC 2WP9B 3KFUA 1J0GA 2UUCL 1DCZA 2Q2TA 4BA2I 3WA0A 1MJEA 1O80A 2R93B 1JE4A 1WMHA 5IAAC 4OL7A 1WXVA 1CMXB 5J3BA 1PGBA 1TVXA 1U9RA 1UEAB 4JYAQ 4W9CA 1PH4A 2JYOA 2ALYB 3CC7A 3VYUA 5ISRA 2PPBC 2DYMA 4K1RB 2UUAQ 1KNAA 5IP9H 3UI3A 3S16B 3V2TA 1U4MA 4NB3A 4WRDA 1HNXL 3DVGX 4EGVA 2VL6A 1IUEA 2J42A 4C3IB 3MFYA 2LD9A 4A90A 4DV0L 4NZLB 2RBMA 3W5VB 1NSNS 1TR5A 1K53A 2FCNA 2N8NA 1GM5A 2BBCA 1NE3A 3KJPA 2I07B 1FD6A 1DZ1A 3S1QH 4HJ8A 2RVLA 1XYIA 1KLUD 2Y3AA 4C4VB 3IKJA 4CJ2C 5CC4A 1BMLC 3DBRI 2MFIA 2EYFA 2B39A 2K3UA 3DVGY 1L2NA 3T8MA 1C4QA 4JI1Q 2HTHA 4CKBA 4A3IG 1OXSC 4DNIA 3C1EA 2WINB 2R61A 1HNWL 2Q5WD 1ZDVA 3GP7A 3AMZA 3FC4A 4IC7B 4N59A 4RFBA 4KZ0A 5EE3A 2K04A 1HNZQ 1G2TA 4A55A 2KVMA 3KDFA 1K3RA 3SR6A 2JA8H 3CMMB 1JCKB 2KDBA 1KOTA 4KD4A 3D32A 4M00A 4R8IA 2IWHA 3ZJTA 3IAM1 1M90C 1IZ6A 2E6XA 1GUTA 1O7LA 4FJVB 4G7ZC 3A7LA 1B53A 4OWWB 2KN4A 4JPBW 1XX8A 2A6EC 2EXDA 3EQLC 3RULA 1HH2P 2OCEA 2FCMA 4BKGA 3A4SC 3P2BA 1E0BA 1DGSA 2AL3A 1Q82C 1BF4A 4KLKA 3H7PA 1FVIA 4QAYA 4L5QA 2KC1A 1B4OA 4MZ9A 5IGFA 1I4PA 2JK8A 4GIVA 3ZKJC 3QOJA 3DWPA 5IYDG 4YSXB 1SYEA 5LXHA 1OTRB 1YHQA 5J39A 2E2IH 2RGFA 2ASBA 4GDLA 3JVZX 1U5KA 2L1AA 1G291 4A3JH 1WTOA 3H7PB 1Q12A 5H8YE 4BKSA 1ZGUB 3KUZA 1J19A 1IBML 2HJ1A 2VB2X 3GTLB 2EYLA 4DUZQ 5M3FB 3NWSA 5C0XH 3S24A 3HS0C 4IUMB 2J0KA 2B3AA 1D1IA 2KDEB 4QL5A 5A35A 1JW9D 4ICUA 1YHBA 2B2UC 4L63B 2DZMA 2MO0A 2WQYB 1SNDA 4B08A 4DR4L 3APDA 1BUVT 4YL8A 1I6HB 2DUDA 1WM2A 1X32A 2VZAA 1UELA 3PLVA 4JBMA 4W9DA 2AWOA 1VQIA 2LVOA 5D65A 4CO7A 4EZKA 1LTID 5J1ZA 3NTHA 3J80i 3K5MA 1MVKA 1A2TA 2KMCA 3KQ4A 3OPOA 4HPPA 4R4OA 1D5ZC 4K6LA 1Q0WB 3NXWA 2IDYA 3SR1A 2BWES 1EQRA 3BINA 1HEZE 2G9HD 1Y69U 4LF7L 5C44B 1QZGA 1X3PA 5C1ZA 2K03A 5AZHA 4JI7Q 3MHSD 3DBLI 1DONA 5FR6A 3VUYA 4LF4L 1VQKA 2JX5A 3S1MB 4Y7NH 2A8VA 2VUMB 2IZVB 1PTOC 5EBCA 1N33L 3TP8A 4BY7G 4JWSC 2B3GA 1N34L 3QC8B 2HTME 4EOYA 2CU1A 4N8X1 3S1NB 4X65L 1ICWA 3RLFA 4DR3L 4W9LA 3E9SA 1XNQL 2WS3B 3VVWB 5L95C 4RHRA 2C7MB 3IG3A 3RZFA 4DAVA 1K0RA 3HKZE 3WIMA 4QB4A 5CHFA 2M56B 4MGKE 1ISNA 4NXMQ 1CUKA 4EVOA 4DV6L 4Y52H 5BR8Q 3RD2A 5HFYA 3P7JA 3ZRCA 4A76A 4KJNA 2YLMA 4K0KQ 4XT1B 3AE5B 1MSHA 1CFMA 1WTVA 3A74A 4ZRPA 1EL0A 4MIUA 2KWUB 3KLSX 4HJ9A 2EMSA 1QOGA 3KVFB 5IWAL 4R3DA 4YTMB 3ERSX 1O7YA 2AL6A 5EE1A 2ZM6Q 1EFWA 2B2TC 1SNCA 3RN5A 4K5VA 2E5LQ 4V190 3D4DA 2WLBA 2ZZPB 4CDCC 1G91A 1FL0A 1FFVA 2FCSA 4K81A 3CW2C 3GO5A 1EY5A 1F9SA 1BKBA 5E4WC 1BO0A 1TWAH 3VR5A 5EE9A 3A7AB 2DY8A 2OTJA 2E2HH 2KX3A 1JOQA 2J0MA 2N49A 5C6AA 1WE7A 5IGBA 4LF6L 3DEOA 2O2VA 4BBNC 4WH4A 3SVMA 3AU5A 3DQVA 5C44G 1MIUA 2MA9B 5IWAQ 2DWQA 3QB3A 1N62A 4JOIC 3U9SA 2N1VA 3SE0A 3QJZA 4FJYA 1D7QA 4RM8A 1RYJA 5AUIA 1U4PA 3VR9B 2SDFA 2B2TA 3RT3B 2F0PA 3M3YB 3NHHA 2FXQA 4KGSA 4L5RC 1SNMA 5KYLA 1QCBD 1N9WA 2IX0A 2M9VA 1WX9A 3AE1B 2XWJB 1JALA 3RNCC 4G7OC 5C5LA 1IGDA 2H89B 3DBHI 4WFN3 4R4IA 5KYIA 2VQFL 3KJOA 3H3VH 2K0PA 3CSFA 2DAJA 3TP6A 4ILWA 4IFDG 2ZW1A 2QKIC 4NPNA 4RAUC 5K5PA 2WXPA 2Z0DB 4MELA 3ZYYX 4MACA 1RTNA 4DXFA 3VYTA 2J4XA 4CHTB 3PIP3 1VQJA 3BZKA 3TEWA 2BYVE 2FUHB 3PO3B 2PE6B 2PIAA 2PMVA 3PSEB 1GB1A 4DR2L 4KSLC 4GKKL 2JYEA 1TS2A 2YU9H 2O2VB 2OQKA 2MUYA 2G3QB 2K5WA 3ONSA 4IPGA 4J1MA 1WYDA 2WDRB 1WFYA 1HNZL 5DPWA 3LWUA 3HRZC 3NENA 4B3SL 4W9HA 2O2LD 1U4AA 1XQQA 1SJHD 3GTMH 2LGDA 4F87A 1LXDA 2J52A 4C3HB 1FIQA 3ND8A 4IALA 1XEEA 4XE0A 1GVPA 3RN2A 4J15A 4PS7A 5DLQE 1OQRA 2WXLA 1J5EL 3CF6E 3Q22A 2C9OA 3AECB 5E6NA 1SXTA 2BS3B 4YIJA 1Q10A 1WD0A 3GQBA 4EX5A 3S14H 1X65A 4KGRA 1EY9A 4ZCKA 2BYEA 2BW2A 3AU7A 3LGJA 1B9NA 4DAYB 1R9TH 1SMYD 2L3ZA 3QJYA 4KN4C 2AKWB 3L16A 3RNBC 3A9JA 1PYWD 5C3JB 1K73C 2E8GA 3MWYW 4LNKA 2B2UA 5LMUQ 1TKWB 1VZ6A 2IO1B 3IHPC 3N30A 3MC9A 1EZ8A 1YJ1A 5EE0A 4A3PA 3PS6A 3CMEA 2RSNA 2LRWA 4FJZA 3APCA 3IT6B 4ZRIA 4FDBA 2PNRC 3VR6A 3T1YQ 2LFNA 1A3UA 3CHBD 5IP4D 3RLNA 1PVOA 3H8HA 4M8NA 4DHZE 2PE9A 5L83A 5C4HA 3EGRA 3GTGH 2EYMA 3J9CA 3J80E 1VRAB 4IKGA 2Z6KA 1K50A 4ZUIA 5HY6A 1T6BX 3UDFA 5JZEB 1TYGB 2DZJA 3E5SA 3BVMA 1HTPA 1X9NA 1KH0A 1NNXA 2XNAC 1QT9A 4C3JB 3MC8A 1ONLA 3J7A5 2VH2A 3ZXVA 1OFFA 2RR9A 4IUPA 5CV9A 2ASQA 5JOBA 5C4ZA 3RD4A 3MAQA 1GUNA 4NNJB 3MTSA 1OXTA 3A1QA 1EIGA 4KV6A 5T1IA 3DMUA 1T5EA 3KDFB 3MEFA 1KHIA 1EU3A 4DV1L 4DR3Q 3KF8A 2K8CA 1IHZA 3U7DA 2MWSB 4OELB 3D31A 1E8XA 1O78A 1KL9A 4A3DB 5E6OA 3N1YC 4DK5A 1BBUA 2ZEQA 2PQEA 5MPOA 1NI3A 2LI5A 1A62A 3CIRB 2MCNB 4LF5L 2UXCQ 3I73A 1WGRA 3TCAA 4NAWB 2IGDA 1LACA 3RLOA 3R2IA 3A1QB 1E0ZA 3TSSA 4X3KA 2KCNA 5M3FG 4DV5L 2A6ED 3TEYA 4C2MH 2XRQD 4J3OD 4HEDA 2XBBC 1ET9A 2VS1A 3FEWX 2KKCA 3K81C 1AEXA 5L37A 1L5PA 1FNVA 3NZSA 4DU9A 3ML8A 3P4PB 5G3LF 1EF5A 4IUVA 2CHBD 2KDFB 3R3MA 3RZWC 3I57A 4YY3Q 4YY3L 1G2SA 4RF1A 3U4ZA 3ZNID 1B8AA 2UUBL 4CHKA 3F2UA 1EWHA 2WP8J 3NBIA 3GE8C 4CDFC 3W1YA 1ACCA 2HCIA 1EQVA 2Z4HA 3ZIMA 2W54A 4IJLA 2JA7G 4JI6L 3KLWA 3RNAC 5DEHA 3HGBA 4FVMA 3WAOA 3NS8A 3E3XA 5FKAC 3M4OB 4W9FA 2LGXA 2I0QA 4ITKA 2HD5B 2FMCA 4HSVA 5FLMG 4BY7B 2LXKA 2F1MA 4JI1L 4EFOA 4NPSA 4B3TL 2D3AA 1FYCA 2GI9A 3T56B 2HHHQ 1NR2A 2F0MA 1RM6C 2EELA 3I4MH 4X6AH 4PMCA 4WAAA 1YNJD 4ARCA 1J7AA 3GTMB 4M0WA 4A3BB 3LJ3A 1VQBA 3U50C 2ZNVC 3AE8B 3L08A 4A3BG 3H1UA 1RLFA 2CKZB 1VD2A 2RPQA 4BOZB 3AB5A 4R4TA 4LNIA 2WNMA 3IT4B 4A8XC 4LUVA 5C0XG 2ICEC 4B0EA 1JICA 1VZ7A 4HPMB 2A73B 4GOPA 3K0XA 4QY7A 1GJXA 4ZYNA 1IW7C 2G4SA 3T53B 4HLEA 3CAMA 2NVXB 1K0SA 3S2HH 2NMQA 1LYLA 5C0XJ 2QF7A 4YCWA 3P1MA 3OIQA 2JVCA 2MJ8A 1ZYRD 4KGTA 3ZNHB 5CX3A 2F0OA 4JI6Q 4I6LB 1B9MA 5I2XA 5AFWA 1SR3A 2K4KA 2PMZB 4DA2A 4L1BA 2K5DA 3SHQA 3HKSA 4V0BA 5JJZA 5GADC 2KQ7A 1WGYA 2ZPYA 4GDLB 1Z9FA 3IFWB 3X3NA 3HOYG 3DHQA 3NELA 4FULA 1CJEA 3VHTC 3WALA 1ENFA 4DV0Q 4PMBA 5M3FH 4C3JH 2IGGA 4US8A 3G6EA 2OEDA 2K5NA 1P9DU 3AE3B 3K9PB 1PLFA 1CTMA 2GN5A 4FXKC 1VQOA 3S17B 3AV8A 3H6NA 2WKDA 1Y1WH 1N8RC 4LCDE 3Q14C 1V9JA 5BO4B 2N55A 4DXGA 3J7ZC 2MO1A 2NUCA 4IPHA 2W3SA 1ROEA 2NVYB 1F9PA 2PQAB 1FMAD 2QIEB 1L0VB 3KUDB 3NJTA 4KTAA 1H95A 1LQBA 3NZ3A 3RNGC 3H15A 1ESFA 2QMTA 5D6JB 5JPMC 4L23A 2IGHA 3NUCA 1CKNA 1VQCA 4OHJA 3UDIA 3IVFA 4OONA 2L0CA 5ELDA 1GUGA 1TS4A 1H9JA 1PXUA 3JC66 5FLXL 1WXQA 1WGDA 3TQYA 5E3FA 4K6DA 2D11A 1I50H 3NVYA 1SE3A 4C1NK 4A3KG 4IM0A 3VDYA 4YWKA 2Z9HA 2KOXA 4A3KB 3JW0X 1MGSA 1SYDA 3L9AX 1HFNA 3BK1A 4M8AA 1HZCA 1E1OA 3GTQH 3S1RB 2L8JA 2DENB 4G11A 2Y0SE 1FXIA 4YSYB 4B9KA 1SE8A 1PGAA 2GOWA 2QEJC 3BZCA 3VYRA 2LWPA 2JPHA 3L3OC 4JI8Q 5GAEC 1SDFA 3NK9A 4JI0L 3LB8C 1ZKOA 2PI2A 4JK1C 4ZQ3A 4BA1I 3HOUB 1QF6A 1N63A 3I91A 3RZOH 4NJCA 4AQ7A 2RSUA 3PLUA 3B2FA 1WR1A 2KDMA 3UGBB 3OJ3A 4P1CC 4DV2L 3S15B 2KUMA 2JEAI 1VQMA 2QC8A 1E9MA 1YEZA 1WXAA 3NVZA 3CQZH 2WXOA 2KWCA 1LV9A 3E0JA 3Q0AA 3ULJA 3GV3A 4HJ5A 1GG3A 2MNAA 2J7ZA 2HHHL 1UGJA 2I38A 2LGYA 4J6IA 4DHJB 1DOYA 4N6EB 2K5HA 5IYCH 5G3LD 4RF0A 1DOLA 4LF4Q 3M4YA 1KABA 5M5WH 3KWVA 5T1GA 2L0TA 2YTVA 4EKUA 2UYZB 4LW1A 3I4OA 4XZ4A 2VZKD 3FDTA 1T0SC 4ODGA 2FUG1 2EYPA 3X0WA 2N9XA 3K5OA 1EWIA 1JRPA 1M94A 2DYBA 2BDOA 3BY4B 1X3FA 1E24A 1NYRA 4H44C 1YNXA 1Y1VH 4A3IH 4GGQA 3VFKA 2BOSA 1DD2A 1F9RA 1XWEA 1VCBA 2R2OA 3PRPB 4OVUA 4KHZA 2B8GA 1JT8A 4X3TA 2M1MA 2QDFA 3DBSA 2TSSA 4P74A 2I5MX 2ES2A 3EUB2 1VQPA 2K50A 4JI5Q 3WCQA 4DV7Q 1Y8RC 2VB3X 2JA5B 3N9YC 4ACFA 2ZJRA 1GUOA 1VQNA 3PRMB 3AM9A 1T0QC 4A3GB 2N1WA 1HZ9A 1QZHA 4YT0B 2JJQA 2RHSB 4BY1G 1EZ6A 5IP9G 2NVTB 1P0RA 2N9KA 2ZCCA 3BDOA 2KNBA 2ZTEA 1S5ED 1F2MA 3P75A 1H9MA 1HR0Q 2F03A 3HOVG 2BB6A 4ABNA 1KF6B 2HIXA 4GN4B 1TJEA 3L17A 2INPE 3TMPB 2MJDA 3L7ZC 4BBSB 1F9QA 3OJ4B 3MFGA 2LJ5A 4B9WA 4QUCA 2LVPA 2BYTA 4I6NB 3Q8EA 2EVBA 2F0QA 2QDLA 5FO7B 4K3BA 1EQTA 1SEBD 1SIJA 4ULLA 2G5DA 3J81c 3C1FA 4GXBA 1V1OA 1UH6A 4DR7L 3AE9B 2X6LA 2RD0A 1A2UA 4KY6A 4RGMA 5JJLA 3M7GA 4DV1Q 1CHPD 1WX7A 2INDC 4B6WA 4GN1A 1D6EC 2KWVB 2N4FA 1YQ4B 5AZGA 2K7VA 1LT3D 5CR3A 2NBUA 4ZHOA 1V86A 3E9HA 3A0JA 1PGXA 1HCZA 4O2DA 3HOWH 3LXFA 3HKZG 1NAPA 2KT7A 3H7SA 3DWQA 3ER0A 3PUYA 1TQOA 1K9MC 4GOPC 2F0JA 2JZZA 4ZKCB 2PYKA 2NBVB 3UIPB 3W9CB 1UWXA 1IL2A 4AWJA 2KXJA
chains in the Genus database with same CATH topology
1HA6A 1MHXA 4FXGC 4XDDA 2E76C 3D3RA 4A3JB 4LTUA 3U7ZA 5BMGA 1IKLA 4A3FB 4WIPA 3P42A 4ZUJA 5CV8A 4B0MA 3LNNA 1RDPD 4OIKA 1V1PA 5EPKA 2R6GA 3RZOB 1E6EB 1PZJD 4PNYA 1HTLD 1TU2B 1LTGD 4C1NI 1SYCA 1PRTC 2LGIA 1MI0A 2KEEA 4XT3B 3RMHA 1SSNA 3TEXA 3PO0A 3TMEA 3H91A 3VYSA 4ZAIA 1I4GA 1E2VA 1TS3A 3OOCA 2EOTA 1ZXTA 4A6QA 1W6KA 1JORA 1L4ZB 1FNUA 4A3IB 1OXVA 1WTXA 4NDXA 4KY5A 2Y5CA 2WXGA 4RGTA 1DOIA 4DGZA 4QIWB 5HGTA 1PDQA 4HTHA 1C4PA 2D5DA 4MM3B 1C76A 4P2CB 2OT2A 1NCVA 5EJWA 3WOFA 4KMUC 3ITPA 3DUZA 3NE5B 1L4DB 1LT6D 4C80A 5IGDA 4X3UA 3A54A 1C9FA 1WTPA 1A6XA 1PTOF 2V4DA 1QOBA 3ETRA 1EY8A 3TDQA 1J7BA 3V05A 1A15A 3SDZA 3NTKA 2JA8B 3EROA 2IX1A 2W55A 2F0HA 3TBIB 3NVWA 4YTPB 2L4NA 1QE6A 3E6ZX 3HOWB 3HEJA 2V4IB 1OQQA 2YEPB 3H09A 3BS1A 3M85A 2JXMB 2FJ2A 3MXUA 3KLRA 1ZP0B 1Q3LA 5C2TB 5C3WA 3HG9A 4K2LA 1FO4A 3HVDA 5IIFA 1OO9B 1QILA 2JA7B 5H92C 3HVZA 4DAPA 1K51A 1HZ6A 4K14A 1CZGA 1XXGA 2AQ1B 2LEKA 1C8CA 3R93A 5IGGA 4NP5A 1HRJA 1CA6A 4JE3B 3BDLA 3OMCA 2D62A 2F3VA 4FF2A 1A3VA 2HDEA 5NUCA 2F0IA 1NR4A 2BDNA 4G4KA 3HOXB 1ILQA 3L4PA 1D1KA 3Q6SA 1FGBD 2A69C 2AUKA 1YJIA 1IKMA 4RWSC 1BNZA 2LMCA 4FXCA 1QOHA 2RDGA 4C56C 2H4OA 1TZOA 3I4LA 5CGKA 2N0SB 3QG1A 1IYUA 1II3A 1EM7A 1V43A 4M1UB 5KEEA 3AE2B 3QOLA 1SNQA 1V8CA 1ZXHA 1ZYRC 1EY0A 4GLSC 5C0XI 2KACA 1O7ZA 1XO3A 4K8IA 4J8QA 2K1BA 3Q24A 3GD7A 1STAA 3JAME 2JQRB 2MEKA 3FILA 5F2DA 1XF5L 4OZCA 2WXQA 1WTQA 1F2YA 2Z4IA 3W2DA 2K05A 1K83B 2CVRA 3K57A 2ACZB 4Q2JA 1MBYA 3RFZB 2XRSD 5KIXA 5HURA 2B2VC 1T3QA 2OEOA 4MT5A 1ENAA 1JWAD 3MXGA 1VF7A 2H88B 5HHDG 3SK5A 4CQNA 5KNBA 4Y7NB 2PLPA 3DXJC 4KN7C 1KAAA 3ND9A 1HHVA 1TWHB 2L5TA 1PMRA 4OGQC 2R7ZB 5BYQA 2IPKD 1EYAA 4MHEA 2L12A 1M4VA 2ZXPA 5LL6X 1IW7D 2I2YA 5M3MB 5ELBA 2EJFC 4FF1A 4XIGS 1Z6HA 1VMPA 2WIIB 4TSSA 2AWNA 1YNTE 2M0AA 1RODA 1EWCA 1L6VA 4IZ8A 2F4IA 1QOFA 1TWGB 5C3XA 3Q8CA 5CORA 4KI0A 1LT5D 1H9SB 2CQAA 2K32A 3NBHA 2EYJA 4B9XA 4BS9A 2VZKB 3AEFB 1EY4A 1TWFB 4L8JA 2B2YC 4AS1A 1EOTA 1XLQA 3GTKB 1Y8PB 2XVSA 5AUKA 2WXJA 4ZOHC 2WU5B 2EXZA 4K5XA 4S3SA 1Z47A 2YEPF 1F2LA 2QCPX 3Q23A 4XQNA 3RZDB 5KGUA 3W3AA 3NP8A 1SYGA 5JXVA 2KQ3A 5JPNC 2C5CA 4XWTA 2HDMA 3TZDA 1YN5A 4A9AA 3T13A 1NEKB 3TZUA 2YU9B 1JWSD 1GXDC 1PTOB 1STEA 3CQZB 4JX1C 1CQFA 5FOBB 1I4RA 5M9OA 3B9JA 2RSOA 4WURA 1GB4A 5CV6A 2E3TA 4FNFA 2EKIA 4K2KA 5G5HA 1B50A 3QWNA 3K58A 4U673 1ZUD2 1E10A 3SK4A 1TWCB 4QMGA 1FRDA 1BDOA 2GRIA 2Q8TA 4O42A 3SXHA 5IGCA 2EZVA 1I50B 4IUQA 3C8YA 1TY2A 1Z7TA 3X3MA 1AZQA 3RPFC 3CRLC 4WJWA 4LMQD 3EFXD 4RCOA 4RHSA 4FF3A 4Q5VA 1EY7A 4MN3A 1KRHA 1VJKA 2F0WA 3DEPA 1DJRD 3I72A 4R9WA 3EJIA 2D5GA 3D4WA 2KECA 4WQMA 2YYZA 5C3EB 3CU7A 3PUVA 1CHQD 1JR0D 4C2MB 1C79A 1NVID 2IW3A 4A3MB 5CV4A 4US9A 2ICIA 3E56A 2LFIA 3WOEA 1FRRA 5I2YA 5M5WB 4G7HC 3EA6A 4X3SA 1VR9A 3OWFA 2OXPA 1ZEQX 1KDAA 2VXWA 2ZXRA 1Q90A 5EGTA 1SE2A 2BE5D 1ZXIA 1I4HA 2Y0SB 1QQRA 3C3LA 1KFYB 4LLGM 2KOLA 4FF4A 4IQZA 1DXMA 1SFOB 1YN4A 3VR2A 1I3QB 1Y8OB 2JP1A 4KK7A 4KKTA 1I7HA 3OHXC 1EYDA 4RCNA 1PUTA 2SNMA 4GDKB 1VDZA 1ESRA 5BYSA 3T3OA 1AWDA 1R4QB 2A5HA 4HKQA 2ZW0A 1BR9A 1B2TA 2JSVX 4WORA 2RQXA 4ZK9B 2EJMA 2X38A 1GPXA 1ENCA 4HMIA 5D7GA 3TP7A 2KCCA 1N60A 1RHPA 2B2VA 2PO4A 1X3QA 3GTOB 1WTRA 5HI1A 4KKIA 2B63B 2AX5A 3U2SC 3AEEB 1GOZA 2PZUA 3TN2A 2O5JC 1CZWA 1JC7A 1AP0A 3R8BA 4OZAA 4CKEA 1YQ3B 3W5UB 1RWSA 3J7AV 3ZQ4A 2X6GA 4ZHPA 1LTTD 2PVOD 3LYYA 1RFKA 1RJTA 1PRTF 1RCVD 2EY1A 3MXNA 2W3RA 3VA5A 3DM1A 3BYTB 2A74C 3J7YW 2WACA 1TKEA 1IBXA 2BA1A 1TKYA 2F0EA 4TQ0A 1PFBA 3A8IE 4ZLTF 2WXHA 4REZA 2KQ4X 1BUIC 1UAPA 4H0LC 5I6WA 4XDXA 2O5IC 2QILA 3NRZA 2FINB 5ELCA 1AZPA 1Y1WB 5CYUA 1DOMA 1XLOA 5GXGB 4FYDA 1JQ4A 2F0KA 2F0DA 2HCCA 4BWGB 2SEBD 1CA5A 2L9HA 2WXMA 2F3WA 1PZID 3FAHA 1WSPA 5JEAG 3OSOA 3I4NB 1TWAB 1N61A 4P16A 3D4RA 3AE6B 1FD7D 4RGNA 3PMFA 4J6HA 2WXNA 5JEAJ 1R7SA 3NQTA 4N9TA 1MI2A 5HG2A 4JWUC 1SYBA 2PW9A 1J8IA 1QOAA 1PDXA 5T8IA 5C5MA 3GTQB 4QCLA 2FE8A 4WWMA 3BDCA 5I9PA 1B1ZA 3AEAB 3BIID 4DFAA 1JWMD 5A2QE 1PFDA 4KX6B 2BTEA 2LHDA 2OF1A 3NSWA 2J0TD 2WU2B 2E74C 4XWWA 3KBGA 1K8MA 3N6RA 2Q8RE 3AE7B 2A68C 1PZKD 1FFUA 2OHFA 2BE5C 1KLGD 4HR7B 2XN9C 2DN8A 4KY7A 4UAIA 1BCPC 4L2YA 2B2WA 4HN7A 2EY5A 2HDLA 2NB0A 3OW7A 2RDFA 1SNPA 3H94A 1S5BD 3BK2A 1J9OA 3HOZB 2NN6I 3AEBB 2KJXA 4YXDB 2WDVB 1JOKA 1ZOYB 2DBYA 1BBXC 1LTBD 1D5MC 3VQIA 2NTTA 4C3IG 3OMGA 3PV0A 2R92B 1C4CA 5IT9L 3IFTA 4EQNA 4HEA1 1H9SA 1T5XD 3I4MB 1D2BA 2L83A 2EE1A 2BT6A 2JU6X 1QKZA 1EWYC 2GB1A 1FCLA 3HP3A 4XXEA 3V96A 1CZPA 1SYFA 2K6AA 5LL6S 3T4AC 2NVQB 4Z9CB 1L0XB 3A55A 1VF5C 3I70A 5BN4A 4RA8A 2G9DA 2IL8A 3OWEB 3Q69A 3A8KE 2BS4B 2V3NA 3AH7A 1JWBD 5D3DA 1M8AA 4YSZB 2AQ3B 1ML0D 1S5FD 3MVVA 4OO1G 1STNA 2FBWB 3U9OA 5ELEA 4WAFA 4IFDH 3P4RB 1I4XA 2VNUD 2CU3A 2A6HC 1ILPA 4IOIE 2INNE 2PKOA 3ONAB 5I9OA 3IXSA 2SNSA 4F7XA 2WXFA 4DF7A 2G1EA 3G7LA 5ELFA 1F77A 2M19A 4ME5A 4HRSA 1IYVA 2WAQB 2D9UA 2JYTA 1KDCA 1STBA 5FO8B 2JE6I 3MEHA 4DNTB 4ID6A 3J81E 1VZ8A 1YNNC 5IT9E 2E2HB 4QF4A 1K8OA 2IJ0A 1F2RI 3BVGA 5BN3A 1JMLA 1TY0A 3U4EG 1HUMA 3UI2A 1E7PB 1V8QA 3NQIA 2JZPA 3ZGZA 3CWIA 2DNCA 5M5YB 4CJ1B 5E6JA 2L55A 2WDQB 2FFKB 2RMMA 4G57A 2NZ1D 1H9KA 4Q0FA 4XQJA 1N5XA 2Q8IB 1AW7A 5C4JB 2K22A 2FMMA 3S1QB 2TMPA 2H1EA 2N7JA 4TKOB 1KDBA 1HXYD 2F0FA 3D6CA 5BMIA 3K6OA 5IOCA 1JROA 4TQUS 1XCQL 2F0NA 1P7FA 1PTOH 3K0YA 2M00A 2IX3A 2PZTA 1ZE3D 4L6TB 4LK1C 3MXPA 1QNKA 1JOOA 1JWUD 5CV7A 2K9XA 5JVH3 1WWTA 5IODA 2SAKA 3W1SA 1Q1EA 4H13C 2PW7A 2Y5PA 1LABA 5EKIA 1PRTB 4DNRB 3URYA 3BYYB 1GHKA 1TS5A 4CJ0B 4HCSA 4XYQA 1WYGA 2KHSA 1JQYD 4PMWA 2F0TA 3PUZA 1Y8NB 3GV6A 2NN6G 2DYOA 5M5XB 3MC0B 2L32A 1STYA 4OW0A 1CQVA 3SEBA 2R3ZA 2MPMA 4PQXA 2NTSA 1B9RA 2KA7A 3R2TA 3K59A 3D8GA 2B2YA 2ENBA 1RD9D 4I7ZC 3NVVA 3WDNA 1UNSA 1DGJA 1EIHA 1FEHA 2E2JB 2RA4A 3SFDB 3VR3A 4JBWA 3AEDB 3S2DB 1D4BA 4TQ1A 1SE4A 1W6JA 3VA7A 3OIPA 4LJZC 3FPUB 1D5XC 4CGYB 1SAPA 3VR8B 2MHVA 2L1BA 3AN1A 1Y1VB 1HA5A 1CM9A 3ZJUA 2Z8LA 3T16A 2DNEA 4KKJA 1E2ZA 3GTPB 4K8JA 1S4ZA 5JVG3 1PTOD 3FRPB 5LNK1 5I4DA 4OVZA 4C3JG 1LTAD 2JSOA 1HPCA 1JB3A 3SK8A 2LJIA 1Q1BA 1QG7A 1B3AA 3LWEA 2WXKA 2MJEA 4IUNA 2WKCA 4D2KA 5DNFA 4PV1C 3DWMA 1OXXK 1NYQA 1WRIA 3P4QB 1LO5D 3CRKC 2L52A 4AYBB 4IUUA 2V3PA 2FHTA 2NWGA 4EQPA 4IDIA 2EPBA 3PZ7A 2E75C 4O1NA 1H9RA 4CKCA 3HUIA 4F8MA 1R9TB 4OZBA 3GTGB 3Q8AA 2QDBA 1K52A 5DAUA 4RKLA 2PVGC 1TIID 1NENB 1BQQT 4DQOC 3DWGC 2LY7A 5K36G 1ET6A 3K5LA 1BOSA 4RNAA 3KBXA 4DK0A 2B2WC 1IGCA 5FK9C 2MGSA 2XWBB 1E2WA 2O4XA 3B2GA 5D3IB 2A68D 3EVQA 2CJOA 3AE4B 1IBXB 4KKSA 2BS2B 2HQEA 3PUXA 2W82A 1YN3A 2DLBA 2XSCA 3K7AB 1LLRD 2MJ3A 4LAAA 2PZWA 5CV5A 4IFDJ 5FO9B 5A2QL 3VR4A 1A3TA 4DK1A 3TUOA 2A69D 1GUSA 1XTCD 3SFEB 1BCPF 3ABVB 2LS01 2E2IB 1QJOA 3J80L 2KMMA 5G5GA 3J7AF 4QUFA 1KNEA 3H0GB 5FR3A 1RTOA 3SHLA 1PRTD 1HUNA 4JPSA 2XIWA 5J22A 5EQ0A 1LTRD 3HKZB 2F0SA 1VMCA 2ID0A 4IURA 3AB9A 2QSDA 2V0GA 3IFDA 1FM0D 4XYOA 1BCPB 4KJOA 1R4PB 1HZ5A 2K01A 1XCTL 3CKIB 1XLPA 3MJ5A 4LK0M 1C4AA 1FNWA 2X69A 5KRUA 2AQ2B 2LUMA 5CBAE 1C78A 2E2DC 1F2ZA 2JWUA 2K33A 2BCOA 3JAML 1FR3A 2MP1A 2BB5A 3P1HA 2PCFB 5BN5A 3BVZA 1I6VC 2PW5A 1LTSD 3O13A 5COYA 1EEFD 1CI3M 3AEGB 1EU4A 3V3XA 1TKGA 4C7YA 2K5QA 3FVQA 4C3HG 1S5DD 5EBDA 2EJGC 1OXUA 2ON8A 2F0UA 2N9LA 3GTJB 5I6YA 3I9V1 4XDCA 1MPEA 4RGOS 2RKSA 2GA4B 1PFNA 4XTCS 1SF0A 1MHHE 2KWDA 3BWUD 4HROA 1L0YB 1RF2D 3NS1A 4HSPA 5DM63 4ZRQA 1V1PB 2I46A 5CMDA 1DM0B 1SSOA 4R8NA 1GUWA 3M7NA 4NAMA 3NPPA 5BMHA 1RKNA 3FMCA 2QJLA 5CBEE 2DY7A 4A93B 1MSGA 3IAS1 3BG3A 4F88A 2LMCB 2CW0C 3P20A 4BY1B 3HOVB 3DWAA 1IL8A 5E1FA 3KWLA 4K5WA 4KD3A 1UUPA 1YMHE 3NTIA 5KNDA 1WD1A 2EY2A 1FXAA 4TRDA 2WB1B 1WVLA 4FO2A 2HUGA 3I90A 4MH8A 3D6WA 1KTKA 3P63A 1U4RA 1DYQA 1C48A 2B8FA 3MHBA 4HAEA 3VRAB 1I4QA 4FXDA 1VDVA 5KNCA 2J53A 4USAA 4IFDI 1GHJA 1EY6A 1AFPA 5D14A 1DOXA 3FKIB 2EDGA 4N9PA 4UDUC 4IUTA 1XLNA 4KHVA 3HRDD 1Y56A 3KK7A 1ZDXA 4E6IA 1HFGA 1VCIA 3PO2B 2CJNA 1HQMC 2ONQA 3P4SB 3AMUA 2F0GA 1ZPSA 4TMAB 2EYOA 1BXTA 4OO1H 3IAYA 3IL8A 4YWGG 4RKBA 4GZYC 1QB5D 2AUJD 2WV6D 3J81L 3T51B 3R3OA 1YNND 5EKKA 1B44D 4ZRZA 3K5NA 1WGKA 4HCEA 2JEBI 3U52E 2RPVA 1L6UA 1SJED 1HQRD 3ERQA 5C4XB 4YTNB 1N5WA 4P6VF 5K36H 4RH6A 4FP5D 1F2RC 4ZYSA 2ZT9C 5EKLA 2NYZD 2LKVA 3S2HB 1CT1D 2Z1CA 5DM73 5JEAH 1LT4D 4U68A 2CW0D 3NUHB 4I65A 4ZKBB 5LHY1 2ZXOA 1SBBB 1FCCC 3RUZA 5EPJA 1V97A 1QNUA 2L11A 2N88A 1DOKA 1GAQB 2K5PA 2M2LA 4PT5A 1YNJC 1CK1A 3MHZA 3A8JE 2PTLA 4HKZE 3MP9A 1QWYA 1S5CD 3PUWA 1WTWA 1YJJA 1TT2A 4XQQA 4A3EB 4C7ZA 3KUPA 1EYCA 1J7CA 2IT1A 3Q8FA 5E4XA 4NKLA 3I3CA 3LX0A 3TP5A 5IGEA 4H2AA 3NWTA 2WXIA 1WCMB 3FILB 5TSSA 3C46A 1MD2D 2NN6H 1A70A 1AYFA 1UWMA 3KLSA 3GB1A 2D2CC 3S9WA 4BBRB 3S14B 4HJGE 4IN3A 3H3VC 3TEZA 3BZDB 2KEDA 1SB3C 2A6HD 4CBVA 3MZ5A 4EE2A 3FPPA 1SNOA 4N58A 4OIJA 1NUCA 2JXTA 3HZXA 4ARIA 2EY6A 4KKUA 2NBFA 3ZJVA 5EPLA 2F0VA 2KAJA 1STGA 3MA2B 4EQOA 3GS2A 1EEID 3I8ZA 3HOYB 2JA6B 4NMZA 1EFID 2BA0A 2K28A 2B76B 3QO2A 3SK6A 4OO1I 3QIAA 3T3NA 4HMJA 3VRBB 4NW2A 4DAYA 2LHEA 5FLXE 5JAVA 1C77A 1U4LA 3H6MA 1QLBB 3PIO3 3C2PA 3A56A 1P7EA 3Q8BA 1G8ZD 1STHA 2F0LA 1AN8A 2SOBA 3N52A 1F0ZA 2RDHA 4H7BA 1Q8IA 1G6ZA 3PZ8A 2MH7A 5BYRA 4DN4M 1PFMA 1VLBA 3G6JB 1BCPD 2WXRA 2EYHA 1SMYC 2WP9B 1DCZA 4BA2I 1O80A 2R93B 1JE4A 4OL7A 1PGBA 1TVXA 1U9RA 1UEAB 2JYOA 3VYUA 5ISRA 2PPBC 2DYMA 1KNAA 3UI3A 3S16B 3V2TA 1U4MA 4WRDA 4EGVA 1IUEA 2J42A 4C3IB 3MFYA 4A90A 4NZLB 2RBMA 3W5VB 1NSNS 1TR5A 1K53A 2BBCA 2I07B 1FD6A 1DZ1A 2RVLA 1XYIA 1KLUD 2Y3AA 3IKJA 4CJ2C 5CC4A 1BMLC 2EYFA 2B39A 2K3UA 1C4QA 4CKBA 2Q5WD 1OXSC 3C1EA 2WINB 2R61A 3AMZA 1ZDVA 3GP7A 3FC4A 4N59A 5EE3A 4RFBA 2K04A 1G2TA 4A55A 2KVMA 3SR6A 1JCKB 4KD4A 4R8IA 2IWHA 3ZJTA 3IAM1 2E6XA 1GUTA 1O7LA 4G7ZC 3A7LA 1B53A 2KN4A 1XX8A 2A6EC 3EQLC 1E0BA 1BF4A 1B4OA 5IGFA 1I4PA 4YSXB 3QOJA 3DWPA 1SYEA 5J39A 2L1AA 1G291 1WTOA 1Q12A 5H8YE 2VB2X 3GTLB 2EYLA 5M3FB 3NWSA 5C0XH 3HS0C 1D1IA 5A35A 1JW9D 2B2UC 4L63B 2WQYB 1SNDA 4B08A 1BUVT 1I6HB 1X32A 2AWOA 5D65A 1LTID 3K5MA 3NTHA 5J1ZA 1MVKA 1A2TA 3KQ4A 3OPOA 1D5ZC 4K6LA 2IDYA 3NXWA 3SR1A 1HEZE 2G9HD 1Y69U 5C44B 1X3PA 2K03A 1DONA 2JX5A 3S1MB 2VUMB 1PTOC 5EBCA 4JWSC 3TP8A 2HTME 3S1NB 1ICWA 3RLFA 3E9SA 2WS3B 4RHRA 4DAVA 4QB4A 2M56B 4EVOA 5HFYA 3P7JA 4KJNA 4XT1B 3AE5B 1MSHA 1CFMA 1WTVA 4ZRPA 1EL0A 4MIUA 3KLSX 4R3DA 4YTMB 1QOGA 1O7YA 5EE1A 2B2TC 1SNCA 4K5VA 4V190 2WLBA 3D4DA 1G91A 1FFVA 3GO5A 1EY5A 1F9SA 5E4WC 1BO0A 3VR5A 5EE9A 3A7AB 2DY8A 1JOQA 5C6AA 5IGBA 3DEOA 4WH4A 3SVMA 2DWQA 3QB3A 1N62A 3U9SA 3SE0A 5AUIA 1RYJA 3VR9B 1U4PA 2SDFA 2B2TA 2F0PA 3M3YB 3NHHA 4KGSA 1SNMA 5KYLA 1QCBD 2IX0A 2M9VA 3AE1B 2XWJB 1JALA 4G7OC 5C5LA 1IGDA 2H89B 4WFN3 5KYIA 2K0PA 3TP6A 4ILWA 4IFDG 2ZW1A 2QKIC 4RAUC 5K5PA 2WXPA 3ZYYX 4MACA 1RTNA 4DXFA 3VYTA 2J4XA 4CHTB 3PIP3 3TEWA 2PIAA 3PO3B 1GB1A 2PMVA 2JYEA 1TS2A 2MUYA 2K5WA 4J1MA 2WDRB 3LWUA 3HRZC 2O2LD 1SJHD 4F87A 2J52A 4C3HB 1FIQA 3ND8A 4IALA 1XEEA 4XE0A 1OQRA 2WXLA 3Q22A 2C9OA 3AECB 1SXTA 2BS3B 4YIJA 1Q10A 1WD0A 3GQBA 4KGRA 1EY9A 2BW2A 3AU7A 1B9NA 1SMYD 3QJYA 4KN4C 1PYWD 5C3JB 3MWYW 2B2UA 1TKWB 1VZ6A 1EZ8A 5EE0A 2RSNA 3IT6B 2PNRC 3VR6A 2LFNA 1A3UA 3CHBD 3H8HA 5C4HA 3EGRA 2EYMA 3J9CA 3J80E 1VRAB 4IKGA 1K50A 4ZUIA 1T6BX 1TYGB 3E5SA 3BVMA 1HTPA 1KH0A 2XNAC 1QT9A 4C3JB 1ONLA 1OFFA 4IUPA 5CV9A 5JOBA 5C4ZA 3RD4A 3MAQA 1GUNA 3MTSA 1OXTA 1EIGA 4KV6A 5T1IA 3DMUA 1T5EA 1EU3A 3KF8A 1IHZA 3D31A 1O78A 4A3DB 2PQEA 5MPOA 1NI3A 3CIRB 3I73A 4NAWB 2IGDA 1LACA 3R2IA 1E0ZA 3TSSA 4X3KA 2KCNA 2A6ED 3TEYA 2XRQD 4J3OD 4HEDA 1ET9A 3FEWX 1L5PA 1AEXA 1FNVA 4DU9A 3P4PB 5G3LF 4IUVA 2CHBD 3I57A 1G2SA 4RF1A 3F2UA 1EWHA 2WP8J 3NBIA 1ACCA 2HCIA 1EQVA 2Z4HA 2W54A 5DEHA 3HGBA 4FVMA 5FKAC 3M4OB 4ITKA 2FMCA 4HSVA 4BY7B 2F1MA 2GI9A 1FYCA 3T56B 1NR2A 2F0MA 1RM6C 2EELA 4PMCA 1YNJD 4ARCA 1J7AA 3GTMB 4M0WA 4A3BB 3AE8B 3AB5A 2WNMA 3IT4B 4A8XC 5C0XG 2ICEC 4B0EA 1JICA 1VZ7A 2A73B 1GJXA 1IW7C 3T53B 2NVXB 2NMQA 5C0XJ 2QF7A 3P1MA 3OIQA 2MJ8A 1ZYRD 4KGTA 2F0OA 1B9MA 5I2XA 5AFWA 2PMZB 4DA2A 4L1BA 2K5DA 4V0BA 5JJZA 4GDLB 3X3NA 3DHQA 1CJEA 1ENFA 4PMBA 2IGGA 4US8A 2OEDA 3AE3B 1PLFA 1CTMA 4FXKC 3S17B 3AV8A 2WKDA 2N55A 4DXGA 2NUCA 2W3SA 1ROEA 2NVYB 1F9PA 1FMAD 2QIEB 1L0VB 4KTAA 3NZ3A 1ESFA 2QMTA 5JPMC 4L23A 2IGHA 3NUCA 4OHJA 2L0CA 5ELDA 1GUGA 1TS4A 1H9JA 1PXUA 5FLXL 1WXQA 5E3FA 4K6DA 3NVYA 1SE3A 4C1NK 4A3KB 1MGSA 1SYDA 3L9AX 1HFNA 3BK1A 4M8AA 3S1RB 4YSYB 1FXIA 1PGAA 2QEJC 3VYRA 3L3OC 1SDFA 3NK9A 3LB8C 1ZKOA 4JK1C 4ZQ3A 4BA1I 1QF6A 3HOUB 1N63A 3I91A 4NJCA 4AQ7A 3B2FA 2KDMA 3S15B 2KUMA 2JEAI 1E9MA 3NVZA 2WXOA 1LV9A 3E0JA 3Q0AA 3GV3A 2J7ZA 1UGJA 2I38A 1DOYA 4N6EB 5G3LD 4RF0A 1DOLA 3M4YA 1KABA 3KWVA 5T1GA 2VZKD 3FDTA 2FUG1 4ODGA 2EYPA 3K5OA 1JRPA 2BDOA 1NYRA 4H44C 2BOSA 1DD2A 1F9RA 1XWEA 4KHZA 2B8GA 4X3TA 2TSSA