1FNWA

Crystal structure of streptococcal pyrogenic exotoxin a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
221
structure length
221
Chain Sequence
QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYTIDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDNKTSQIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords EXOTOXIN TYPE A PRECURSOR (ALLELE 1)
publication title Structure of streptococcal pyrogenic exotoxin A reveals a novel metal cluster.
pubmed rcsb
total genus 54
structure length 221
sequence length 221
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fnwA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fnwA02
2O2LD 1ESFA 1SXTA 3MC0B 5ELFA 5I4DA 1FNUA 3R8BA 3DWQA 1HQRD 2QILA 4O1NA 1JWMD 5FKAC 3EFXD 1I4QA 3GP7A 1LT3D 1LTGD 5FK9C 4RCOA 1EFID 1CHPD 3KLSX 1LTSD 4DXFA 1JWUD 1TS3A 1XXGA 2AQ1B 1YN5A 1AN8A 1PRTB 4C56C 1EWCA 1PTOD 1SBBB 1V1OA 1I4PA 3V05A 1LT6D 1FNVA 1I4XA 1PRTF 1LTAD 3DWPA 1MD2D 2G9HD 1BCPC 1BCPB 1QILA 1TS2A 3SEBA 1JCKB 1LT5D 1SE3A 1PTOH 2XN9C 1ET9A 1KLUD 1RDPD 3TSSA 1UUPA 1JQYD 4RH6A 1EEFD 1EU4A 1BCPF 1V1PB 1PYWD 2Z8LA 3BZDB 2SEBD 4K6LA 1DYQA 4OHJA 1B44D 1HXYD 3EA6A 1PRTC 3URYA 2XRSD 2CHBD 3BVGA 1S5FD 3MFGA 1D5MC 3BVZA 1L0XB 1D6EC 3R2IA 1LTRD 4RGOS 1D5XC 4DXGA 3BVMA 5ELBA 4RHSA 1TS4A 3OWEB 3DWAA 4L63B 2IJ0A 4UDUC 3W2DA 5TSSA 2AQ2B 2WV6D 1V1PA 1LO5D 3BYTB 2RDGA 2TSSA 1D5ZC 1STEA 3CHBD 2ICIA 1EU3A 1B1ZA 2QEJC 4RGTA 1I4HA 1PTOB 1CK1A 1RF2D 3O13A 1PZID 1HA5A 1JR0D 1LTTD 1PRTD 1FNWA 3R2TA 1S5ED 2R61A 4RHRA 4TSSA 1BXTA 1PTOF 5ELDA 2NTTA 1LTBD 4ZYSA 1FGBD 1CHQD 3BYYB 1YN4A 1T5XD 2XRQD 1CQVA 5D3DA 1DJRD 1I4RA 1BCPD 1TY2A 1SJED 2J4XA 1LT4D 1FD7D 2NTSA 1CT1D 1RCVD 5ELCA 1F77A 1GOZA 1SEBD 1SE2A 2RDHA 1S5DD 4NZLB 2IPKD 1LLRD 1ENFA 1TY0A 1I4GA 1PZKD 1SJHD 1EEID 1PTOC 1ET6A 1XTCD 1PZJD 1RD9D 4RGNA 1S5BD 1AW7A 1L0YB 1M4VA 4Z9CB 1JWSD 1G8ZD 2AQ3B 4BWGB 5D3IB 4L6TB 4RGMA 1KLGD 1KTKA 1YN3A 4RFBA 1S5CD 1TS5A 1SE4A 5ELEA 2XNAC 1LTID 1HTLD 1UNSA
chains in the Genus database with same CATH superfamily
4A3IB 5BN4A 4HPMB 3R8BA 1YNJC 1X32A 3U9OA 4LFBL 1VD2A 3Q8CA 3Q6BA 2F4IA 1QE6A 3HKSA 5H1SE 4GU2A 4XX5A 3RN9C 1KNAA 4HVBA 1P3QU 4GN3B 2DZKA 4HJ7A 2YU9H 4DV4Q 4S3SA 3VTVA 1GO3E 2F0GA 5CC4A 4Q5VA 2WACA 1AEXA 3RZOH 3LNNA 3L0WB 4KHPQ 2WDRB 2I07B 2BF8B 3I70A 4EZJA 4GDLB 3PTFC 2Z6BA 3J80L 2NBWB 3CC7A 4F8CB 4PK1A 2HTHA 4ZDVA 1I4XA 3I4MH 1ZKOA 3X3NA 4K5WA 2F0QA 2GI9A 1B2TA 4JVZA 1HTPA 2D5GA 2ZJDA 3QOLA 3NVZA 1YHAA 4LMQD 1C4PA 4PS3A 4PYZA 1NBWA 1UF0A 4HSPA 2K1BA 4N9PA 2PO4A 1N62A 1SMXA 2IDYA 1BMLC 1VQ7A 2BWFA 3M4YA 1J5EQ 1YIWA 3I73A 4GKJQ 4HKQA 4DV7Q 4DV0Q 1TWCH 4WAFA 2WAQE 5J2RA 2JWUA 3DQVA 3DEPA 2UXCL 4MN3A 2AWOA 3LWEA 1FXTB 3R2IA 3ZJYC 1ENCA 3DHQA 4DK3C 4OX9Q 1CSPA 1DOYA 3MP9A 1TZ1A 3S1RB 4FJVB 3TBLD 1NE3A 4R8IA 1WYDA 1HH2P 4POGA 3HG9A 2OTJA 4Q0FA 4DV6Q 3HOUB 3RNEC 3WA0A 2L4NA 4IALA 4Y7NB 2EYFA 3KUPA 5CORA 3TP8A 4BKSA 3T1HL 4OEMB 3OOCA 1B8AA 1TXYA 1P0RA 4J6IA 5CX3A 1KOTA 1PRTD 1N36Q 3ZDMC 2JA5G 1KRHA 4ILWA 4NPNA 1XLOA 3U4EG 4LF7Q 1PUTA 3V6CB 4OIKA 5CGKA 3KOJA 3ZXRA 3L2PA 4B3TL 1E2WA 5FLMH 2J4XA 1LT4D 3UQAA 4ITKA 2XWBB 1RKNA 4JV5Q 3K81C 3E6ZX 3B08A 3S2AA 2WXNA 1Y8PB 3CCJA 2ZVOA 3HOYG 1SYBA 4G7ZC 4IDIA 1IYFA 1I35A 1YZ6A 4B3SL 2K3UA 1K9MC 2GBMA 1PZKD 4MGYE 1SYEA 4X65Q 4AUQC 4IOCA 1S5BD 5J1ZA 2LSSA 1V5OA 2DYOA 5HY6A 4C3HG 4JBWA 2BGFA 1G8ZD 3MXUA 2L0FA 3PSEB 4ZRPA 1YJ9A 1YN3A 3BY4B 4LK0M 5DCNA 4JE3B 4DR6Q 2VRRB 1UWXA 2CHZA 1R4NB 3Q8AA 1RFKA 2ZW1A 3F1ZA 1KHIA 3DWQA 2GRIA 4O1NA 4DHZB 4UY8C 3LYYA 3H0GB 3AE1B 2ZCBA 2MPMA 1NYRA 4ZRZA 5JVH3 3T1YL 1AZQA 2NN6H 4OZBA 1CKNB 1L1OA 4RWSC 4XT3B 4URKA 4MTNA 1LV9A 4YIJA 2R92G 4WQMA 5L95C 5IE8A 1AN8A 5JPNC 1S40A 1PGAA 4QF4A 1F9SA 4JI7Q 2I0QA 1JOQA 1TJEA 3P7JA 4A3KH 3R7QA 2K8HA 2WKCA 2MA9B 2CCZA 3HOVH 3NQTA 4PZ8A 4CDCC 1RYJA 1PRTF 5M5WB 3LX0A 1BCPB 2K5WA 4JQWC 4P74A 4GKKQ 3L16A 4O0AA 1SE3A 4UP9A 1O80A 1NMFA 1XNRL 1A6XA 1Q5WB 3AEEB 3ITPA 2WP8J 2KK8A 3CCSA 4A3DH 4P7IA 2K4KA 1EEFD 1Z47A 3L08A 1HR0W 4W9FA 2KEEA 1VZ6A 2IO0B 2KMCA 2PW7A 5J22A 3TZDA 4B3MQ 1OQQA 3MA2B 4KD4A 4KKUA 1NCVA 2Z9HA 3MWYW 4ZK9B 1AWDA 4JL9A 3RNAC 3Q8DA 2BKFA 4WWMA 2DY7A 1X3PA 1C76A 4DUZL 5C3EG 2JZZA 2L0TA 4YWGG 2N1VA 5JJLA 1O7LA 1OXUA 1KC8C 1FFVA 2F1MA 3RLNA 3X23A 5JHAA 2N0SB 4DR5Q 2GN5A 2B2WC 2IZVB 3GS2A 1A8VA 1KQSA 5JVG3 2XWJB 2G5DA 2BT6A 2JA9A 2KDMA 4ICVA 4QJFA 3AE8B 4HTHA 2E8GA 3PIP3 3J7ZC 3D32A 3W5OA 2B2TA 2I5LX 1BUVT 2L15A 3T16A 1HA6A 4A3PA 4PZ6A 3T9LA 1VCBA 1TBEA 2X38A 3I4NB 4MZ9A 2WDTB 4NB3A 1EF1A 2WU2B 4IUNA 1R4PB 2M00A 1XWEA 4IUTA 2EZVA 1TWAH 2KTRA 1T9HA 2O5IC 2XSCA 5LHY1 3MZ5A 2C9OA 1U9RA 1ASYA 1II3A 3R66C 4BVUC 3KYHC 1WCMG 2JQOA 1HR0L 2Z1CA 2FCMA 4ZLTF 1EIFA 2MBQA 1LXDA 3K5OA 1DOMA 1LTBD 3C1FA 2NMQA 4X66Q 4DR2Q 1E9MA 2NVUI 1WXVA 4LUOA 5M3MH 2UXDQ 4C3JH 4ARIA 2ZJPA 4KKIA 2MQHA 3DHGC 3I91A 2A73B 5T8IA 5C4XB 3QC8B 2KEDA 2NTSA 2O5JC 1CT1D 1TU2B 5ELCA 1FJGQ 3RPFC 4FF4A 4GB9A 1JW9D 1SNQA 4A3JB 1CMXB 3I4MG 3ZNID 3O65B 5C4JB 2F0SA 3S14B 3PRZA 4BA1I 1ET6A 4X57B 5IWAL 3W1SA 3J80c 1KM7A 1WJUA 3DVGX 4HJKA 2JA8B 4K1RB 3WAOA 3N32A 2Z0SA 2RSOA 4N58A 4ANWA 1EOVA 2L5TA 4ACFA 2B2VC 4KHVA 4N8FA 5CV8A 2FUG1 2G4DB 2H89B 2N7JA 4OVUA 4B6WA 4EOYA 1A3UA 4L6TB 5FOBB 1KLGD 1GUNA 1YHQA 5M5YH 2KJ6A 2ZCCA 3L17A 5IA7A 4W9HA 1NNXA 2XNAC 3H09A 1HTLD 4OO1H 1TWGB 4X3UA 1F9JA 2WXLA 3IAS1 4HIMA 4JOIC 1VF5C 3H7PB 4U673 2KO3A 1A2TA 4DNTB 4MTKA 3GE8C 3TCAA 2KCCA 1C9OA 2LRUA 2K6QA 4HDQA 4NJCA 2QKIC 2PI2A 1E90A 5I6YA 1TKYA 2NR2A 1XPOA 1HQMC 4K2KA 2L1AA 2B2UC 3ERQA 4ALPA 4KSKC 1PTOD 1I4PA 2Q5WD 3OMCA 1RODA 4X3SA 1UGJA 3W3AA 4DDGD 4HJ8A 1P16A 4LFBQ 3E9HA 4HRSA 3DWPA 4QCLA 3BK2A 4ODGA 1TS2A 3DBRB 3RMHA 3RN5A 2LHDA 4KX6B 4A3EH 1JICA 4AYBB 1E7PB 2NN6I 2M0AA 4F8MA 3E9SA 3EHVA 3KF8B 3KQ4A 2K1FA 4DHJB 2B2YC 4JPBW 4RKLA 2KDBA 1VRAB 3CSFA 5CR3A 2SEBD 2E76C 1YOVB 1D3ZA 1DYQA 2PNHA 1WJ4A 3CRLC 1YNXA 3QA8A 1HUMA 1UE6A 2QEXA 2LMCA 2D10A 4ANVA 1EQVA 2ZPYA 5CBAE 2LUEA 2KACA 4JI4L 4DHZE 2MWSB 1XD3B 5A2QE 3T3OA 2M1MA 1E1TA 3N1YC 3KUZA 1E0BA 1WJJA 1EF5A 3ZRCA 3DWGC 4EZKA 2RBMA 2VUMB 1DGSA 1NENB 1G51A 2JQRB 1TT2A 1L0WA 3K80C 1H9RA 3HOWH 1WTPA 2W3SA 2N4FA 4XYQA 2ZPNA 3BDLA 4K7UA 2JE6I 2WXOA 1U4RA 2PQEA 4UPAA 3AU7A 2L76A 4HCPB 1BVSA 2RDFA 2UXCQ 1KNEA 1EYCA 4DR3L 4LFAL 1LFDA 1XTDA 2QDFA 5EKIA 5EPLA 1PFNA 3BDCA 1ZOYB 4L1BA 2Q8IB 4RM9A 3R2TA 3UDIA 4HSVA 2KLCA 2F0PA 1HZAA 2XVSA 4PG3A 1K8MA 2JEAI 2PE9A 1L2FA 3BK1A 1PTOF 2AX5A 1E22A 4DU9A 2NN6G 1QJOA 3Q23A 5BMGA 1WD1A 3CP0A 2XRQD 2MGSA 5C3JB 2KLGA 2R2QA 5IOIA 3VUXA 1AE2A 1KFYB 5EAYA 3FMCA 4A3KG 3AU5A 1HJPA 5M3FH 1SEBD 1EWHA 4CKBA 3CCVA 1OTRB 3KVFB 4FLHA 3W1YA 2KWDA 1C78A 5KHOA 2XIWA 2PQAA 4U68A 3TQYA 1VQ4A 2ZEQA 3IG3A 5M9OA 3IT6B 1IUEA 5M5XH 4G0NB 4QQBX 1SJHD 2WWZA 3GO5A 1V9PA 4ZRIA 5J3BA 3HGBA 5EQ0A 3MEFA 4KTAA 1PMRA 2HHHL 1FPYA 1A70A 4A3DG 1YBYA 4LWCA 3EIVA 3HOZH 1B53A 2F0EA 2AQ3B 3TEHB 4KGSA 3MXNB 2K5VA 1NYQA 3KF6B 1JB3A 5ELEA 1CI3M 2PZTA 2B29A 1KIXA 3QQ8B 4NQKE 1D2BA 3QCAA 3CCMA 5GADC 2B8GA 1WYWB 2L52A 2UUCL 2E6XA 1I4QA 4RCNA 3N1XC 1K8OA 4H02A 3U4ZA 3BG3A 1HTQA 1E7ZA 4K7SA 1G2SA 1GM5A 4PZ7A 3KLSX 5CHVC 2K5HA 1A0IA 4DXFA 5IKCM 1F52A 2BCOA 1YN5A 5JJZA 1L1OB 5KNCA 3PIPA 1RTOA 4CQNA 3B6YA 2FE8A 3EJIA 3OSOA 3PVLA 2J53A 4FA6A 1D7QA 2OT2A 1SYDA 4OO1I 4GN4B 2EJGC 1MJDA 1N32L 1OXTA 1LTAD 3RMKC 1MD2D 4HEA1 1OEYA 3T1YQ 1Q82C 4LF9L 2E2HB 1FRRA 3IBEA 5CHWA 3ZNZB 2Z59B 1R4QB 3E0JA 3U58A 1ET9A 2DY8A 2ZTCA 2B63H 4KHPL 2CHWA 3ZNGC 1UUPA 1H95A 1QT9A 2K5PA 3VUYA 2DAFA 1WX9A 3Q24A 2GBJA 4JYAL 3BZDB 1MI2A 3V62A 2Z6KA 1Q1OA 2Z4HA 5F2DA 1EQQA 2MO0A 4ANUA 3VFKA 2Q8TA 5M3MG 2F0UA 4C3JG 5BN3A 2VY3A 2JA5B 3HIZA 4ZYNA 3AMZA 2PMZB 5DPWA 4K2LA 1SMYC 4RMFA 4GDLA 1XNRQ 2CW0D 4JIOU 3EROA 4IOAA 3PMFA 1FO4A 5JJIA 2JT4B 1D5XC 4JC0A 1X1MA 1I6HH 2IBIB 5KIXA 4GKJL 1MSHA 4YCWA 1DONA 5KEEA 3DOWA 1DOXA 4DV0L 2EOTA 3TREA 3GTLB 2BKRB 5KHQA 5DPSA 2ZM6Q 2MJEA 5AUIA 3HOYB 3J81i 4K14A 2F0MA 3IRBA 5C5MA 4DUZQ 2K22A 5DPRA 4WJOA 3TP5A 1I7HA 3ZJVA 1LQBA 4K7WA 3K7AB 1CFMA 4P73A 1HE8A 3CCUA 2JYOA 4OO1G 2MJ8A 4G57A 4C3HB 1R9TH 2MP1A 4HIDA 3A8KE 1VQJA 4DFAA 2Q2TA 3S15B 2BS3B 2OJWA 4JPSA 2VZAA 1X3QA 4AYBE 5E6OA 1JQ4A 5HFYA 2A68D 1DOIA 3C2PA 2N88A 3GTPH 1I3QB 2IGDA 3DWMA 5EE0A 1JJ2A 4X3TA 5EPJA 4L5QA 4ZYSA 2RF4A 4WJWA 4ZHOA 1QOBA 3GB1A 3A1QB 1V81A 2I5HA 3L3OC 4PMCA 3SDZA 1C79A 2K05A 2N9LA 2ONQA 4PS8A 4BFRA 5GQOA 3CCLA 1KRSA 3KUDB 1WTRA 2R92B 1HR0Q 3J80E 2N78A 1WGYA 2KQSA 1BO0A 4EQOA 4LCDE 4XGAB 3TL5A 1VQEA 3A7LA 1C0AA 3J81L 1M94A 1EEID 4XIGS 4I6PA 2QMTA 4A3EG 3SXHA 1EUJA 4K5VA 3VA7A 2JY6A 4JV5L 1RIPA 4WWOA 2FINB 5HGTA 3AXCA 5E6JA 4FHKA 1WF9A 2KECA 1T0RC 2E2IH 4I7ZC 1UWVA 4JI1L 4W9KA 1RFAA 3HVZA 1SYGA 2D11A 4A75A 4A8XC 1EY4A 4X65L 2QIEB 1ESFA 3DXJC 5ELFA 1UAPA 1QVGA 2DHZA 4GGQA 2IWHA 4HDOA 4BS9A 1CA5A 5IWAQ 4GZYC 1MJEA 2VNUD 2MRPA 2N9XA 2D62A 4L5TA 1RAXA 3U50C 1YJIA 2INDC 4LK1C 3NRZA 3BWUD 4A3FH 3S1QH 5A2QL 1WIAA 1EFID 3NELA 1JE5A 4EQNA 4DR6L 1XXGA 4YWMA 2GB1A 3M4OB 3K0XA 2KD0A 1IP9A 2D0OA 2Y0SG 4C56C 4HEDA 4TUUA 3QR8A 5C3EB 3JVZX 4CKEA 3HOWG 2VH1A 1V80A 3S16H 4A3BH 4QB4A 2PE6B 2BQQA 2WDVB 5E6NA 4KJNA 3AE7B 1PHJA 4YWKA 4MJSA 3S1MB 1PTOH 3CKIB 2PZWA 4JI0Q 5G5HA 1L5PA 4YTMB 2HD5B 2ACZB 4USAA 1JWBD 2VB3X 3RLOA 1CKNA 4G4KA 1NDDA 4ZQ3A 3KLSA 2EMSA 3V60A 1VDVA 2F0IA 2PNRC 3E3XA 3DBLI 5AZGA 3F2BA 1NTGA 3AULA 4N9F4 4W9IA 4TVAB 2EY5A 2FNJB 4EQ5A 4OVVA 1WCMB 3HKZG 1IXRA 1EO6A 1K0SA 4V0BA 2EKIA 5M3FG 2B3GA 5JEAH 1N33L 1VLBA 2IO3B 4CJ2C 2HQLA 2D3AA 4BZAA 2YU9B 1LTRD 2C9WB 2KCMA 5E4XA 1UZXB 4PMWA 5DLQE 1NR4A 2CHXA 3OWEB 5TSSA 3C46A 3AEDB 2DAJA 3IVFA 1LACA 3I4MB 4C2MB 4KY6A 3N3KB 4I6NB 1XMQQ 3ZO5B 4MH0E 4MGKE 3CMAA 4PS7A 4GLSC 4WRDA 4ME3A 4KY5A 5JAVA 3I57A 3DEOA 2PW9A 3ZJUA 1OGWA 4XXEA 5BYRA 5LMNQ 1TKEA 3U7DA 2R61A 3RNCC 2ATWA 4FXCA 3U2SC 3ZLZA 1VQHA 3FHWA 4LLGM 1HNZL 2JSOA 3PRMB 3P63A 4DR3Q 4LFAQ 2JA7H 3ZW3A 1Q0WB 1TWCB 4FF1A 3ZUNA 2IY5B 2CH4W 1K53A 3KBXA 3H1UA 3HS0C 2KZRA 4BA2I 3M3JA 2PMZE 2K6DB 2N3SA 4X66L 4DR2L 5G3LD 2KMAA 4K3BA 2KX0A 4GSWA 2OCEA 3M4QA 5HI1A 4C4VA 4MSQB 5CMDA 5BN5A 2V3NA 3D31A 5AFWA 1OXXK 3P2BA 3QWNA 4RF0A 3VRBB 2N55A 3A5ZB 4AH6A 1FJGL 2K03A 2B63G 2BB5A 2WXJA 2RHSB 4HLEA 3DVNV 1SSOA 1QUQB 1YEZA 2X6GA 3RI7C 4LNKA 4LJOB 4P1BC 3QJZA 2BW2A 2QJLA 1W3SA 4M01A 1JB7A 2PEAA 2ASBA 4II3B 2L32A 4K5XA 3JC66 4CJ1B 3KFUA 2YEPF 4GXBA 2PPBC 3STBD 2C7MB 2KJHB 3S2DH 2HHHQ 1WZ3A 4G50A 4BKTA 2K01A 2P5ZX 3VVWB 4MNOA 1U0LA 1UEBA 2M2LA 4R3DA 2OEOA 2HD3A 3QIAA 4DAYB 5I9OA 1EYDA 4IQZA 1E6EB 3DM3A 5EJWA 3VR2A 5IO9A 4US9A 4ZRJA 1P8LA 2JXXA 2L1BA 1UBIA 4IN3A 5C0XI 2UUCQ 4DKAC 2RGFA 1IYUA 4P72A 1J7CA 5I2YA 3RNGC 4A93H 2N9KA 3OG5A 3H7PA 1IKLA 2NPTA 2NVYB 2FMCA 1J8IA 1O7IA 4XWTA 1BBUA 1WTHA 2GVBA 2X6LA 1GNUA 4PMBA 1QNUA 2O4XA 2AL6A 1CZGA 1AH9A 1SNCA 1EIGA 1N32Q 1YQ4B 1Q81C 3KYDD 5IYDH 5JHBA 2MBOA 3EA6A 1Y1VB 4IZ8A 2WXGA 2RQXA 5G3LF 4LF9Q 2HT1A 1DOLA 5IOCA 4DAVA 1ZW7A 2G1EA 2LWPA 3SU8X 1S5FD 1NR2A 2F4VL 3D8GA 2EMTA 2ZW0A 1WR6E 2KVRA 2B2WA 1Y8NB 3A4SC 3NWTA 3EFUA 3AM9A 2Z0EB 3UDFA 4JYAQ 1BUIC 3A55A 1NSNS 5I9PA 1S3SG 2BS4B 3AN1A 4LDTB 3KF8A 4A3KB 3W5UB 1JMCA 1HHVA 4TKOB 3ALBA 3IXSA 3PZ7A 5BMHA 4WORA 3VDYA 2CQOA 2PI2E 1DD2A 1HFNA 1DM0B 3UI2A 2JEBI 1VQ6A 3ZQ4A 1MSGA 4R4IA 3J81c 1QVFA 1B4OA 5FLXL 1BDOA 3CWIA 3H6NA 1BR9A 3NG0A 2KQ7A 3FC4A 2YTVA 3LGJA 4KVGB 1OQYA 5C0XG 1RF2D 1VQAA 2MBEA 4A3DB 3OHXC 3RUZA 4YWLA 2UUBQ 1SSNA 3ICEA 4JWSC 2JRHA 2YEPB 1GXDC 2RR9A 4TV3A 4TSSA 2MJDA 4BBSH 2X69A 1ZXHA 2NTTA 2K0PA 1U4MA 4A4IA 2DNFA 5D6JB 5IY0A 3CMEA 1FGBD 1WJ6A 2M17A 2AEHA 1SIFA 1DJRD 3K6OA 2KYWA 4KZCA 1C48A 4XDCA 2D07B 1FD7D 1U4AA 2J0KA 4GN5A 4A3BG 1I94L 1SE2A 3SDLC 5C44H 1QZHA 4QUCA 3WAPA 2E2JH 2FMMA 3ONAB 2FHTA 4KDLB 4UAIA 1E10A 4EQPA 4LW1A 1X6OA 2B2VA 3DPDA 3AEBB 1L0VB 1WJNA 1XF5L 3E9IA 2N7DA 5GMVA 3A9KB 2C60A 3NJTA 4GDKB 1TWAB 1Y1WH 1IKMA 2NCNA 3APFA 2D3GA 4W9CA 3LDZE 5EE3A 4XDDA 4HMJA 3TBIB 3CCEA 1K73C 4L5SA 5G2NA 2A5UA 2L3ZA 1EY6A 1QOFA 4C3IH 2JPHA 3QHTA 1LTGD 5FK9C 5JEAG 1MI0A 3PO2H 3MC9A 4F7XA 3N20C 5M3MB 3TMEA 4JI1Q 3FKIB 1ZE3D 2EKEC 2B2UA 4MEMA 1C1YB 1ZYRD 4QY7A 2EYLA 4J1MA 2RSUA 3HVDA 3Q22A 4TMAB 3E5SA 3F8TA 3CW2C 3S17B 1V1OA 1ZXIA 2LVOA 2HE7A 1QOHA 2MCNB 4XQQA 2KHSA 4A3LH 3ZDTA 2L12A 4ZCKA 3MXNA 3X3MA 2RKSA 4LF5L 2HJ1A 4UHVA 3KF6A 3DMUA 1VMCA 2OQKA 3D4RA 2KWVB 2EYMA 4KN7C 1PFSA 3A0JA 2G45B 1ZDXA 2K6AA 3WAMA 5IGDA 1VDZA 3DM1A 3FP9A 2DGYA 4YCVA 4BOSC 3HM6X 4MT5A 4DDID 3RNFC 1ZDVA 2B2YA 4IFDI 3PPAA 4MJSB 4XWWA 2SAKA 2MHVA 2BDNA 2WP9B 1J9OA 1Y56A 4WURA 4K6LA 4KJOA 3Q69A 4M8AA 4M8MA 3EQLC 1L6UA 1XPUA 1IW7D 1I50B 3NTHA 1EM7A 4EZLA 3ND8A 1WY8A 4P2CB 4JI6Q 2A69D 2N9EB 4FADA 1PRTC 2JA7G 2R93B 5KGUA 2CHBD 1OXVA 4CJ0B 3BVGA 4A3IH 1GPXA 3EGRA 3Q3OC 4ZKBB 2A6ED 2F3IA 2NBUA 1F2LA 1WMHA 3BVZA 3J7YW 1E8ZA 1PH8A 3WCQA 2AMCB 1TQOA 2L05A 2WQYB 1SE9A 1D6EC 3QOJA 3F2DA 3MTSA 4FO2A 4RGOS 2KXJA 4CHKA 4DXGA 2EXDA 1V97A 3I90A 4JI8L 1EWYC 1H4RA 3Q0AA 1WRDB 4RHSA 1WXMA 2F52A 5CV5A 1QF6A 2KBNA 2WXMA 3PV0A 1XMOQ 4F88A 2AUJD 1VQOA 2LGDA 4I65A 4AP4C 1B70B 4FF2A 2I38A 1IBKL 4H44C 4LFCQ 1PVOA 4WJNA 4FJZA 1N63A 1OEYJ 2VW9A 1N33Q 1STEA 1JOKA 3ABVB 1B1ZA 4YL8A 4A3EB 2OOBB 3IAYA 3GV3A 5AZHA 1ZGUB 2DLBA 1HA5A 2ZM6L 4JWUC 3R3OA 3X0WA 3RYTA 2O2VB 4RHRA 2F0NA 1WGKA 4AQYL 1ZPSA 2DJGC 2K04A 4IFDG 4LUVA 5AJ3L 2LVPA 1KABA 4OL7A 2PKOA 1EOTA 3PHWB 2DX5B 1T5XD 5T1GA 1RLFA 2RA4A 1X9NA 5KYLA 2INCC 4KV2A 3H8HA 3ERSX 3G6EA 2H1EA 2QDLA 2DZJA 3ZTDA 1DZ1A 4ME5A 2WX0A 1TWHB 3H94A 4YHHL 1D1IA 3E0EA 2Y0SB 1M90C 1IBXB 1V8QA 2WHIA 3AE9B 3U8ZA 1HNZQ 2EYOA 3S1RH 1RD9D 4K8JA 4MSMB 1GHJA 2L8JA 4C4VB 4CYEA 3G71A 3QK0A 4BKSD 3GTGB 3SK8A 1A62A 3SFDB 4NPSA 3W1GA 1E0ZA 4RGMA 4M1UB 4A3MB 3HOUH 3T13A 1TS5A 4FXDA 1STHA 1PH4A 4HJ5A 1LTID 5IYDG 3A1QA 1P1AA 3PGEA 4RF1A 3AFQA 3I5JC 1EZ8A 3K59A 2CWPA 1E2ZA 1N60A 5GAEC 2JYTA 2Q8RE 2HQEA 1LABA 2WGSA 3KJPA 1YNND 3CPFA 2IO2B 1KH0A 2MP2B 4KI0A 5GXGB 3IT4B 2F3VA 3APCA 2KKCA 1PRTB 1Q12A 2EJMA 5D14A 1JT8A 2QF7A 1X3GA 4CDFC 5M3FB 1T0YA 4XZ4A 4A3OA 3NXWA 2PYKA 1PFBA 3NE5B 1VQIA 5LL6S 3HZXA 3RZFA 5FR6A 1HZCA 2KC1A 2LUMA 3M63B 1O7ZA 5M5XB 3A8IE 4KKJA 4TKNA 3U4VA 4H13C 5L37A 4REZA 2NUCA 5KYIA 3NUHB 1YIJA 2NS5A 4LNOA 4GN1A 3TSSA 5FLXc 3OW2A 4HCEA 1BF4A 3MHBA 1EZ6A 3HM3A 3HEJA 2NPTB 1EU4A 4NXNQ 2M19A 3KH0A 4BKGA 4YSXB 4R4OA 3ZYYX 2EYPA 4BBSG 2ZXPA 1H9MA 1WH3A 3K9PB 4FBJB 2WFWA 2KENA 3QO2A 4FN2A 2AYOB 1Q10A 4R1JA 3EFCA 5KNDA 4JI0L 4WQOB 1AARA 2VZKD 3S24A 2B3AA 3APDA 5LMNW 1Z5SB 2JK8A 1VQGA 3EC8A 5IYCH 1SIJA 5C44G 1MG8A 5CV7A 4KGRA 1G291 2XEWA 3BVMA 1T6BX 1SN8A 3VH3B 3VYTA 1X56A 4LNQA 3DBLB 3J81E 4G3XB 2CWAA 2HDEA 2BDOA 2I1JA 4DV2L 2DJFC 2F4VQ 2Y5CA 1G6PA 1Q8IA 4DUYL 1I5FA 3AE2B 3Q3JA 3MEHA 2XK5B 5M5WH 1FCLA 3ER0A 1Y1WG 3S2HH 2B63B 4KKSA 4AIMA 5FLMG 1SLJA 1IBLL 2CR5A 2KWCA 3J9CA 4J3OD 1RL2A 5EKKA 4IJLA 4LF8L 5CV6A 4BXXH 4II2B 3I2ZA 4BBRH 4C3IG 2K52A 1XMQL 2BH8A 5C4ZA 3PO2G 3VHTC 3K8AA 3NTIA 2C7HA 1CHQD 1R4MI 3B2GA 2LGIA 3RLFA 3SE0A 2VS1A 1ROEA 4WWPA 2J7ZA 4KK7A 1IL8A 1HZBA 5LMNL 1AE3A 2NBVB 3U52E 2E2DC 1VS0A 3HOXH 1GOZA 1SFOB 2RDHA 4A3LG 1QOAA 1L4ZB 5H8YE 5BYSA 3CQZB 4DGZA 5K5PA 2G4SA 2E74C 2C5CA 4TQ0A 4HPPA 3OPOA 1PTOC 2L9HA 4R9WA 2HIVA 2PVGC 3VR5A 2DZMA 1CKMA 3FKYA 1WTXA 4E3CA 4X62L 2K28A 3A54A 2J7QB 5IGCA 5EBDA 3N1ZC 4I6LB 1HCZA 4I7AA 4LF6Q 1OFFA 1X3EA 4BWGB 4DV5L 1I94Q 1DOKA 2RPQA 3ENEA 1SE4A 3RZDH 1Y14B 1FM0D 1KF6B 3C3LA 3L4PA 4K0KL 1FNUA 5IP9H 2QILA 3IKJA 4A3IG 4YTPB 2IW3A 2ES2A 4JI5Q 5EGTA 3QX1A 3D6CA 4HWIB 3RCZA 3Q2AC 1B3QA 3GTPB 3HOVG 2LXKA 2M0XA 2Y5PA 4RCOA 3S9WA 4GLXA 1YD8U 2ZNVC 3OYYA 5DEHA 4NMZA 1HZ5A 2PIAA 2I5MX 3NZSA 1H8CA 2V4LA 4IJHA 1RJTA 3A7AB 2E5LQ 2ID0A 3ULLA 3SFEB 1ONLA 3ZIMA 5C4XH 2ZXOA 1QUQA 1MBYA 1C8CA 4YY3Q 1TR5A 4A3JH 2WU5B 5D94A 1JRPA 2LJIA 3VR3A 3GZNI 1QILA 1QKZA 4P16A 4A3GH 5E3FA 3QB3A 3S14H 3RD2A 3VTWA 5E4WC 2NVXB 2Y0SE 2NVQH 1E7UA 5HG2A 2EYJA 3TMPB 3VTUA 2E2IB 5IYBH 4KD3A 1IYVA 2NBFA 3CC4A 2MBBB 4QIWB 3H7SA 1GVPA 1CTMA 1FGUA 4OONA 1R7SA 1ZKHA 2KDFB 1Z7TA 3P75A 2HTME 5LXIB 2A74C 3FDTA 4LF5Q 1ACCA 2EQSA 4DAYA 2LI5A 1Y8RC 2K33A 2W82A 5LL6X 1XX8A 1WXSA 2F0DA 3S1NB 5C1ZA 3ML9A 2F0VA 2IY0B 4DN4M 1WMHB 3BIID 1N61A 1PFDA 1K3RA 1Q1EA 4C1NI 3HRZC 3GQBA 3CPWA 2VQEQ 3T53B 4FULA 3TIXA 1JJGA 2KDEB 3K9OB 2Y5BB 2VL6A 1YX6B 2CU3A 3SR1A 2Y3AA 4K81A 1KDBA 1R4NI 3RULA 2HDMA 3N30A 1W6KA 3KUCB 1PTOB 4TQ1A 1YI2A 4JI8Q 2JA6H 1V1QA 1PZID 4MIUA 2QC8A 1ICWA 1PXUA 1VQBA 3KWVA 1S5ED 1MPEA 1Y69U 1EWIA 1YITA 4NW2A 2IYDB 5JOBA 3UIOB 3VAWA 1EQTA 3L0OA 3PQIA 1IBKQ 2UU9Q 2LJ5A 4Q2JA 2MW5A 3UQBA 2WXHA 3VXWA 5IGBA 2C5LC 1CQVA 3BU2A 1TY2A 1EIHA 5GAGC 3NEMA 4GS3A 2UUBL 1PH1A 2AUKA 4HK2A 5IP4D 1S3OA 1KL9A 2MJ3A 4AQYQ 1RWSA 2JWZA 2LD9A 3ZRFA 3L7ZC 1DXMA 2EDGA 2R3ZA 3NWSA 3GDEA 5AJ3Q 2VUMH 1MG4A 1RHPA 4J15A 2BYFA 2JU6X 3CU7A 2WB1G 2WXKA 5IN7A 4IG7B 5FJ8H 2LASA 2Z0DB 1YQ3B 4N59A 5HGQA 2FJ2A 2W9NA 4V190 1Z9FA 2RD0A 2NVTH 1ESRA 1VF7A 4YHHQ 1V43A 2BA1A 4G7HC 5JJKA 1NVID 2WXRA 1F2ZA 3R93A 2BA0A 1PGBA 2VB2X 3SHLA 1IPGA 4IWQA 2SNSA 2H4OA 2PW5A 3GP7A 2LZ6A 2FIFA 4RMAA 1E8WA 1K3BC 1MHWC 4XYOA 5IYCG 2KQ4X 1RRBA 2JA7B 1JWUD 2FCQA 3TZUA 3OTOL 3GTOB 3DCGA 4IUMB 1O7YA 4HROA 4DV3L 4E74A 2NB0A 4PNYA 2K32A 1PYBA 2CW0C 4B0EA 3V05A 4KKTA 3NVYA 3PUVA 3A9KA 4JK1C 5L83A 3OW7A 1FNVA 2F03A 1FYCA 4A3CH 4GDKA 4IW0A 1J0GA 3PT2B 5FLXE 1F2RI 4GOPC 1J6QA 4M00A 1PH9A 1RDPD 1YJJA 5CV9A 3GTMB 1VQNA 4BXXG 4BBNF 2ZTEA 1V1PB 4BBRG 1HEZE 2K8CA 1UE1A 4FVMA 2F3WA 2LGYA 4OHJA 5C5LA 4HCSA 1C77A 2M4NA 3OAWA 4EE2A 3PCOB 2W55A 2F0FA 4IUQA 2HJ8A 2IHEA 3S2DB 2A68C 2L00B 3HOXG 1SRUA 2KVMA 1PYSB 2F0WA 2YYZA 1E1OA 3P20A 3C8YA 4JI6L 4HR7B 2QCPX 1CM9A 1F9PA 3ZVVA 3U9SA 2HCCA 3MFYA 4H7BA 2WV6D 1XYIA 2PZUA 1YMHE 5IGEA 1QQRA 1E3PA 4KV6A 3K7UC 2RDGA 2WXIA 3WANA 3ECIA 4B9KA 3M7NA 3Q8EA 2V1CC 3CXCA 2K8BA 1I4HA 3OJ4B 4CDDC 3Q3MC 3H3VH 5LMUL 1K51A 5DPTA 2A8VA 1XMOL 3HHMA 1JR0D 1LTTD 5IP9G 4LFCL 4XYCA 2KANA 4XE0A 2XTIA 5IT9L 1G91A 5C0XJ 4FJYA 1UE7A 4AQ7A 3NS1A 4DV2Q 4JBKA 3M9BA 5AZFA 4JLCA 4QIWE 2CS4A 2JXTA 1B9NA 3Q14C 3KYCD 3W9CB 4DUYQ 4C7ZA 4YSZB 1STBA 1VZ7A 3BDOA 3K57A 1UWMA 3RZOB 2YV5A 2JA5H 2V0GA 2KT7A 2MSED 4HIOA 3MJ5A 1X54A 5C4XG 4RNAA 1IBLQ 4R8NA 5J18A 1E2VA 1VQLA 2BB6A 4LF8Q 1S5DD 2OXPA 4R4CA 1Q46A 4A3JG 3HOZG 4QL5A 2A6HD 4HXDA 1NMGA 4IO9A 1QNKA 3EUB2 4W9LA 1EIYB 1XTCD 2QW7A 4A3GG 3DDCB 3D0FA 4KSLC 1LYLA 2F0HA 1Q8KA 1XCQL 2R6GA 4D2KA 2O2VA 2OF1A 2L7RA 3B9JA 1K83H 2GBRA 3QG1A 2MEKA 3A4RA 3M3YH 4L23A 2D2QA 4ZAIA 2MUYA 4GOPB 4NJ7A 1XNQL 1WYGA 2HIXA 4PYUA 3A56A 1Q3LA 3HP3A 4RKBA 2N49A 2RDBC 5DM63 2M56B 4YCUA 4AWJA 4RAUC 5NUCA 1JWMD 2PLPA 3UF8A 3S15H 1XPRA 3G6JB 1GHKA 4BBSB 4IKGA 4X62Q 2VXWA 5COYA 3LB8C 4BY7H 1IBXA 1A3VA 1I3QH 4DV5Q 4DK1A 2FUHB 1FXIA 1P98A 1VR9A 5JXVA 1H9SB 1MHXA 2OEDA 3T8MA 2NWGA 3V96A 1EWCA 3JAMi 1SBBB 4APVA 1TWFH 1GB1A 5EE1A 2I2YA 3NK9A 5CYUA 4K0KQ 5C44B 2CJNA 5BO4B 1NI2A 1TIID 2KVZA 4LNNA 3ZXVA 1IYJB 4GNXC 1WGHA 1E5WA 2R92H 1TGZB 5DNFA 3VQIA 2PTLA 4EEWA 4C80A 4G7OC 3CC2A 4PT5A 2D3CA 4OZAA 1XLPA 2A4ZA 1A3TA 3BJUA 2BPSA 1KLUD 1N9WA 3P1HA 4OWXB 4AYBG 2JA6G 3H91A 4F1SA 2IX3A 3H15A 1YX5B 1YNJD 2MP2A 4ICUA 3PZ8A 4MHEA 1P9DU 3AE6B 4ULLA 1QZEA 3ONSA 1B44D 1YJ1A 1AZPA 4FHJA 4IWOA 2YTYA 5HHDG 1PFMA 4CO7A 2A5HA 2B39A 5JPMC 1WTWA 1WGRA 2TMPA 4OGQC 2INPE 3GTKH 1WGDA 4NXNL 3PO2B 2UWQA 2LXJA 3MHZA 3SVMA 2AHOB 3FPUB 3G7LA 4KHZA 3JAML 3NHEB 3R7RA 4UP8A 3HRDD 4QMGA 3ZNHB 3K58A 3AYHB 3QIJA 3M4OH 3JYUA 1NY4A 4IPCA 4WJPA 3DWAA 2JP1A 4L63B 3W2DA 5IGFA 5C3EH 2BS2B 3TJPA 3LJ3A 3QAQA 1EY9A 4OZCA 3F2CA 5FJ8G 3Q8FA 5JH5C 4KN4C 3BYTB 4L5RC 4DQOC 3B1LX 2TSSA 3NBIA 3CHBD 2CH4A 1ZUD2 3Q8BA 1VQMA 2RCFA 2R7DA 1CK1A 3KDFB 3S1MH 4XT1B 1TYGB 1D8LA 1E24A 1HNXQ 1GUWA 2B8FA 2J0JA 4CKCA 1FNWA 4BY1H 1Z2MA 1C9FA 3A9JA 2IHFA 1CJEA 3NY5A 2IT1A 2F0TA 2ZVNA 2VQFL 2IGGA 5LXHA 4IM2A 1BNZA 1TZOA 2LXAA 2F0JA 4DNRB 4XDXA 1BCPD 4RA8A 2BYEA 2YVCA 3STBC 4IFDJ 1TVXA 1F9QA 1G6ZA 1WCMH 1L7YA 5T1IA 3HOVB 2GBNA 2GOWA 2M8SA 3FILB 3VR4A 3WIMA 1EL0A 2CKHB 3H3VI 1IL2A 2XK5A 2OTLA 4A3CG 3L10B 1U4LA 3TUOA 3V61A 2D0PA 1LLRD 2PMVA 1UGMA 4L2YA 4JX1C 3VR9B 2G9DA 2R7ZH 2JX5A 2KHWB 4S0RA 2G3QB 5I2XA 5DAUA 5CBEE 1R4MB 1VQ8A 4LUZA 5DM73 5E1FA 3MJWA 4QAYA 2H5XA 2KMMA 4XTCS 4C2MH 1EY7A 4GNXB 4A3FG 2QSDA 3WOFA 3G4SA 3ULJA 1EYAA 4L8JA 4ZUJA 1QOGA 2DENB 1SXTA 2EE1A 3IL8A 5A35A 3K5MA 1IGCA 1A15A 3HFZB 2FIDA 1J7AA 4CDEC 2JYEA 2KCNA 1TKGA 4LF6L 1F0ZA 1PDQA 1JROA 2SNMA 3PLUA 5E7NA 5MPOA 1SGHA 5C3WA 2H88B 1K28A 3CRKC 1GC7A 4X6AH 4M0WA 1M8AA 1GC6A 3CF5A 2K14A 1F1HA 3VR6A 4O2DA 4TRDA 4IUUA 1J19A 3NVWA 1JWAD 2A19A 2KUMA 3BZKA 4JI5L 3T51B 2K39A 2WX1A 1KJTA 3GTJH 1WR1A 2EJFC 2AKWB 5K36H 3L13A 4WAAA 2KTFA 3UGBB 4X3KA 2NZHA 3PO3H 1BCPC 4FNFA 4YTNB 3PIO3 2O6VD 3OTOQ 1WI5A 2E5LL 1IHZA 3K0YA 4DV3Q 4JOIA 3GOEA 1B9RA 1FEHA 3DLLA 5KRUA 2KOXA 2KHIA 4YY3L 2JZPA 3IHPC 1BCPF 3RNUA 2Z4IA 1V86A 4K3CA 1SROA 4C3JB 2KFKB 3DHIC 2D3BA 4MM3A 1JC7A 2GLSA 1W2BA 5IT9c 2XRSD 4S17A 4B3RL 3GZNB 3C0RB 1ICFB 3DBHI 3IFWB 1BBWA 3I9V1 1L0XB 2HDLA 4JCVE 2D5DA 1FR3A 4B08A 3AFPA 5EPKA 1QB5D 4CHTB 1V8CA 1WTOA 4N9TA 3ML8A 1WXAA 2UU7A 1YVCA 1U4PA 1JRUA 3N9YC 4GOCA 1JORA 1BKBA 3BZCA 2V1YA 5FO7B 3J7AV 1EQRA 4G11A 3DVNU 4W9JA 3BINA 2CVRA 3AV8A 5M5YB 2C7NB 2F0LA 3GTQH 2W54A 1N34L 3F2UA 4PQXA 4A76A 4C7YA 3O13A 2WB1B 2VQEL 3CAMA 1RTNA 3NBHB 1RM6C 1SR3A 1F2RC 3JW0X 4HIKA 1VJKA 2NVYH 1WRIA 2LGXA 2ON8A 2ZJQA 2MLBA 2WNMA 1FD6A 3P1MA 2M9VA 2EIFA 3AEVA 3OMGA 4BY7G 3FVQA 1V49A 2QGQA 1STYA 1LGRA 3AB9A 1K50A 2HCIA 3PGZA 4F87A 2KAJA 4AJWA 1Y1VH 4WFN3 1I4RA 4NKLA 1IBMQ 5HKHA 1GAQB 2GVAA 3DUZA 5LMUQ 2KJRA 4DHJD 2D9UA 1SF0A 5JZEB 2UU9L 4IPHA 4DR4Q 2DYBA 3NUCA 4NDXA 2MH7A 3HUIA 1ZYRC 1ENFA 2WXFA 1XQQA 1NAPA 1B50A 3JSVB 1KXLA 1E8YA 3P4QB 1GUTA 2LXCA 1X65A 3VUWA 1JALA 3Q3NC 1L0YB 1YHBA 3D4WA 2XGTA 1D4BA 1MKHA 3RUIB 1JWSD 4OIJA 3D6WA 2F0KA 4KMUC 2UUAQ 1KTKA 1XEEA 2OQ0A 4DBGA 1FVIA 4RFBA 3PF5A 3S2HB 5C4HA 1NI3A 4KDIC 5G5GA 2KX3A 1QG7A 1UNSA 3LXFA 3A33B 4KIKA 3MC0B 4IM3A 2R2OA 1WI0A 2AL3A 1QWYA 4ANXA 4BBRB 5FKAC 3OLMD 3AH7A 2KN5A 1SNDA 5FO8B 1LT3D 3CCRA 1IW7C 2V9HA 4OVZA 4DR1L 2GBKA 2L83A 2A69C 2FFKB 2L11A 5EE9A 3I3TB 3RR5A 3WWVA 1SYCA 3HOWB 4A93G 2A6EC 1Q86C 1SNOA 1XNQQ 4YT0B 4IPDA 1CKOA 1JOOA 3JAMc 1S72A 3HOXB 3PF4A 2MQJA 3RFZB 2JN4A 2L0CA 4W9GA 1V9JA 4MGIE 3D4DA 1STAA 2K50A 1AYFA 1OO9B 5BR8L 1H9KA 3K5NA 1FFUA 1DCZA 2VH2A 5G55A 2FAZA 4Y7NH 1Y8OB 3PUYA 3SEBA 1E7VA 2IX0A 2OJRA 2Q2HA 2FBWB 2Q2UA 2WAQG 4DAPA 3AEAB 4A20A 2AWTA 2N8NA 1WE6A 4AJYB 1JQYD 4BY1G 4DAMA 3NHHA 3RZDB 1GUSA 1TT5B 3KLWA 3SK6A 1Q1BA 4DPGA 1OQRA 5BYQA 1VQ5A 1XCTL 1AP0A 1TTNA 3MXGA 4E71A 3HKZB 1PLFA 2IO1B 4DWFA 4IUPA 3FEWX 1D5MC 2ZT9C 1C4AA 2V3SA 1YNTE 4GLVB 1KD1C 4IC7B 2DBYA 2O6VB 5CV4A 2EXZA 1QCBD 4CBVA 1ML0D 3EVQA 1CA6A 3C19A 1FMAD 4JI2L 3FKIH 3PUZA 1GB4A 4IOIE 3CSTA 1TS4A 4GIVA 4NAMA 4IURA 2R7ZG 4FYDA 4EUTA 4UDUC 2IJ0A 2SDFA 3LWUA 3Q3FA 3S17H 3T56B 2AQ2B 1BBXC 1V1PA 5IAAC 3HOZB 3CF6E 4JI3L 3VYRA 1LO5D 3U7ZA 5EBCA 3P42A 4A3GB 1HRJA 2K5NA 4DR7L 2ICIA 1J7BA 4J8QA 3MXPA 2NVQB 1UH6A 4NAWB 2LFNA 2EPBA 3UE0A 2RHQB 1PH3A 4WJQA 1ISNA 2LHEA 5IODA 1WOCA 2JJQA 2KNBA 1VQ9A 3UIPB 4EX5A 4IUVA 5D2MB 4N8X1 3AB5A 4HKZE 3H0GH 3A9JB 3I72A 5LNK1 2KN4A 5ELNA 3TS0A 1I50H 1GG3A 2LKVA 1C7YA 2KJXA 1A63A 3NVVA 3TEWA 2UXBL 3I7FA 4HPLB 2REXA 4C1NK 2R93H 4MGZE 3VRAB 1B9MA 4MACA 3TP7A 3AE4B 3TS2A 1WM2A 5TR5A 1F77A 1YNNC 2L55A 4DNIA 1FXAA 4HCNB 4ZRQA 5K36G 3ETRA 4NP5A 3OIPA 2BOSA 3PO3G 3PIOA 2VQFQ 1I4GA 2EYHA 4R4QA 4TQUS 2YTXA 1VQKA 1ENAA 1DGJA 4KGTA 4AOFA 3I55A 3T4AC 1UEAB 2JSVX 4HJ9A 1MHHE 3I4OA 2KFJA 2PPHA 5GAHC 4ABNA 3K5LA 4P1CC 1LM0A 5BMIA 1IGDA 4HJAA 4LF4L 3DVGY 2QCZA 3KJOA 2WINB 4B95A 1SYFA 2JA6B 3IFTA 3PUXA 2O2LD 4EFOA 5D65A 5IIFA 5I4DA 4MELA 1BT0A 3UDXA 1A5RA 3EFXD 2WB1E 2R7FA 4F7ZA 3OWFA 1S4ZA 1K8RB 3NQIA 3KW5B 1T0SC 1CHPD 3I3CA 3DHHC 3ZGZA 2DZIA 1I6HB 1L1OC 1EYGA 1K52A 1SB3C 4NXML 3KBGA 4DK6C 4M0WB 1XJVA 5ELOA 1UELA 2BWES 2DWQA 2GMIC 2W3RA 4PV1C 3SD5A 2K25A 1TWHH 3SHQA 4GOPA 1K8AC 1PGXA 3I4NH 3H3VC 2ZZPB 1XLQA 4OW0A 1LT5D 1V5TA 2XN9C 1R9TB 1CZPA 1G6JA 2N7EA 4HMIA 4JBJA 4K8IA 4RH6A 2EVBA 3GV6A 3GTGH 4FDBA 3IAM1 2NVTB 1PDXA 1MFWA 4JGHB 5GROA 2DNEA 5IT9E 2KQ3A 4A3MH 5HURA 1H9SA 4Y52H 5C2TB 2K9XA 4W9EA 3URYA 1Y1VG 4MM3B 3IFDA 3PUWA 3FRPB 3MFGA 4X64L 1HNWL 2JVCA 5IP7H 4ARCA 5EKLA 1KDAA 1X55A 1ZEQX 2BVCA 1FCCC 3AE5B 2FCNA 4DV1L 4WWNA 3TEYA 2V3PA 3SGIA 2JZ3B 3V3XA 3T1HQ 1EY8A 4OWWB 5C4JH 1KDCA 3TEZA 4O42A 4JBMA 2WLBA 2BE5D 2SOBA 5ISRA 3BS1A 2JA8H 1VQCA 4B3RQ 3PHXB 1UE5A 3OJ3A 3ND9A 1MIUA 2B2TC 4KLKA 3WOEA 2K75A 1AFPA 1M1KC 1HZ6A 1LM8B 2LFIA 2WKDA 3NSWA 4RGTA 1SAPA 4WH4A 4WJ3M 4B3TQ 2ASQA 4UP7A 1TWGH 1JJCB 1QLBB 3P4RB 1L4DB 3I4LA 5D7GA 3PS6A 3U30A 2QHOA 1VZ8A 1XT9B 1SMYD 3C1EA 3UDGA 4A3FB 3S1QB 1GUAB 4H2AA 4BAXA 1HTOA 2MFIA 4XQJA 1GKHA 1YN4A 1SNPA 1WTVA 1GD7A 4B3SQ 2CJOA 4MDKE 1HPCA 2I1KA 1HNXL 5E6PA 1ZP0B 2LGSA 1SJED 3OIQA 1N34Q 2BH2A 2J42A 3S16B 4A3BB 4DA2A 2WXPA 1N5WA 3EBEA 5AEKB 1VQPA 3HK0A 5CHFA 3A5UA 2CQAA 3HKZE 2HUGA 4B9XA 1EFWA 1UBQA 1WXQA 4J6HA 4NZLB 3PV1A 1CQFA 3HOUG 1X3FA 2V4DA 3KDFA 2V4IB 1QVCA 2VZKB 1PZJD 2BYTA 3W1SC 1T3QA 4NY0A 3NENA 3PZDA 1C3TA 1AW7A 3J7A5 4OWTB 3NP8A 2KA7A 4XQNA 3J81j 2KWUB 1BQQT 3WALA 1D1KA 3W1BA 5D3IB 4DV4L 3M85A 4FF3A 1H9JA 4A90A 3NPPA 2NYZD 3M62B 3GD7A 2BE5C 4LJZC 1MGSA 1E8XA 1WE7A 2N1WA 3FILA 3RT3B 4KIKB 1WWTA 3ZTCA 1U5KA 4IPGA 4RM8A 3Q6SA 1KAWA 3VYSA 1LTSD 2MBHA 1TS3A 3AEFB 3JAME 2LY7A 2AQ1B 1A2UA 1G2TA 2ZNVB 4BOZB 5LLIA 4EKUA 3FKIG 2ZTDA 2BTEA 2GA4B 4DK5A 1T5EA 4GNXA 3RNBC 3VDZA 1SFOH 3VA5A 1XO3A 3NOBA 2IL8A 4K6DA 4P6VF 2G9HD 1YQBA 3CQZH 2WIIB 4DR1Q 1J5EL 2CFMA 3T3NA 1FRDA 4DV7L 4GMVA 1OXSC 1JCKB 4IWPA 4ZUIA 2CU1A 3AQQA 3MTNB 1EUVB 1K83B 4MH8A 2JRIB 3M3YB 1WGGA 2WS3B 1YJWA 2KHJA 3UINB 5J17A 3H0GG 1JMLA 1SNMA 5C23A 4QGUA 4OX9L 4LAAA 2JUOA 1HXYD 1PH6A 2JF5A 3M95A 5BR8Q 3TDQA 4N6EB 5I6WA 5C3XA 2KTRB 1SE8A 1NJIC 2R93G 1FIQA 1LUZA 4ID6A 4DV6L 1HUNA 1GUOA 3PREA 4ZOHC 1WZ0A 1YJNA 4BY7B 4ZHPA 3H6MA 1WFYA 3B2FA 3TP6A 1PH5A 4YSYB 4BBNC 2C35B 1N36L 4LJPB 1TWFB 2MNAA 3MHSD 1WX8A 1N6ZA 4LF7L 2ZXRA 3KLRA 3NZ3A 2A1AA 3TN2A 3E56A 3DBHB 4ZKCB 4LTUA 2KFKA 3I63C 3QARA 1N8RC 3A74A 1MVKA 3UI3A 1EU3A 1HZ9A 1GUGA 4H0LC 4OELB 1C4CA 1LTLA 1PA6A 3KWLA 4JI2Q 2NVXH 2AWNA 1ASZA 4WIPA 2E75C 1VCIA 4OXPA 2PJHA 3ZKJC 4LNFA 3RD4A 3RN2A 2ICEC 3CD6A 4JI3Q 4IM0A 3CMMB 5C0XH 4A55A 2RSNA 5D3DA 3GTKB 4DR7Q 4EGVA 4NQLB 2BYVE 1T0QC 4A6QA 4RG1A 1P7FA 2LEKA 3CIRB 5EDSA 3H9DA 1RCVD 2EY2A 2K5DA 2INNE 4NJ6A 3S1NH 3P4SB 2EY1A 3SK5A 1KRTA 1JE4A 2IPKD 1W6JA 3N52A 3SK4A 5AUKA 3AE3B 3I8ZA 1WVLA 2IX1A 4A93B 3I4NG 3VYUA 3NBHA 4FP5D 2ZJRA 1SDFA 1IBML 2E2HH 1QZGA 2RPVA 2UYZB 3FAHA 2CKZB 2UXBQ 3EECA 3KK7A 3NZUA 4Z9CB 4DR4L 3PRPB 3R3MA 2BBCA 4JW0A 2PCFB 1K8GA 4A3MG 1C4QA 1S5CD 3AI5A 4JI7L 2WAQB 2JXMB 4BY1B 1Q90A 4LNIA 4LDTD 1ILPA 1HQRD 2J52A 2KDIA 3W5VB 4DXAB 2QA4A 4EVOA 5FO9B 4ASWC 1F2YA 2UUAL 5IP7G 2E3TA 3DBRI 1KAAA 1EY5A 4GKKL 3AU4A 1Q7YC 2KC2A 3JSVA 5CTRC 3VH4B 4AS1A 1L6VA 4LF4Q 3B0AA 2OWOA 2X8XX 4M8NA 1ZXTA 4GLAC 4FXGC 3I56A 3L9AX 2B76B 4US8A 1WX7A 2LMCB 3GTLH 3AMUA 3PSIA 2RCNA 2ENBA 1MJCA 1LT6D 3WDNA 5IYBG 2JA8G 2YLMA 2K7VA 3HOYH 1V6EA 3TEXA 4YXDB 1GJXA 4M02A 4B3ML 4HAEA 2MHJA 2LVQA 3ZJTA 4A9AA 2R7ZB 3L54A 3MC8A 3M7GA 4JG2A 2WDQB 3RZWC 1GJZA 3K7AH 1FL0A 1STGA 3G48A 4NXMQ 2OHFA 1F2MA 4C3HH 5H92C 4KZ0A 2DN8A 4DR5L 2Z8LA 1PYWD 2FCSA 1B3AA 1I6VC 4JI4Q 4P71A 2K5QA 1P7EA 1I42A 2Z6KC 1NUCA 3SR6A 1BOSA 2LRWA 4KY7A 2NZ1D 4HN7A 1CZWA 5JEAJ 3VR8B 2KOLA 2IGHA 3NTKA 5J39A 1PV4A 3MVVA 2MO1A 1STNA 1CUKA 3AECB 4FXKC 4XC2A 3J7AF 4QUFA 4E6IA 2E2JB 4DF7A 1TKWB 3GTOH 1WTQA 1ILQA 2J0MA 5ELBA 5FR3A 2MX2A 2WXQA 1Z6HA 1UD7A 4HJGE 3QWZB 2RMMA 3PO0A 3GTJB 2D2CC 1HFGA 1VQFA 1S1QB 1L2NA 1TIFA 3PO3B 5IGGA 2A6HC 4X64Q 1HNWQ 1IZ6A 2UXDL 1EY0A 2KCTA 1D5ZC 3FPPA 3N6RA 1Y1WB 3P4PB 2QEJC 2PQAB 4R4TA 4POFA 1VMPA 1V2YA 2J0TD 4DV1Q 5C6AA 1PH7A 2ALYB 5KNBA 1B7YB 1VQDA 2RVLA 4C3IB 3GTMH 3M4PA 2O6VA 1BXTA 5ELDA 1WSPA 1N5XA 4W9DA 2NZOA 1K0RA 1WM3A 2FXQA 3BYYB 3GE3C 4NNJB 3NS8A 2IY1B 2EY6A 1PH2A 1CSQA 1WFQA 1KLVA 1OTCA 3UE1A 3CCQA 2DNCA 2VUMG 1NBFC 1J8CA 2I46A 3V6EB 2QDBA 2Q2IA 3EN2A 3V2TA 4IFDH 2F0OA 3A8JE 3ULPA 3DBSA 4NAWA 2EELA 4B9WA 1TY0A 3MAQA 2N9PC 2WYQA 2PVOD 1WD0A 3J80i 1PQSA 3AEGB 3TRZA 4RGNA 1O78A 3D3RA 1NEKB 1M4VA 4B0MA 4CGYB 2LS01 4ZRKA 4WJ4A 1XLNA 4P75A 4C00A 3PLVA 4DK0A 3GTQB 2DYMA 3QJYA 1F9RA 2DUDA 2XBBC
chains in the Genus database with same CATH topology
4A3IB 5BN4A 3R8BA 1YNJC 1X32A 3U9OA 3Q8CA 2F4IA 1QE6A 1KNAA 4S3SA 2F0GA 5CC4A 4Q5VA 2WACA 1AEXA 3LNNA 2WDRB 2I07B 3I70A 4GDLB 3J80L 1I4XA 1ZKOA 3X3NA 4K5WA 2F0QA 2GI9A 1B2TA 1HTPA 2D5GA 3QOLA 3NVZA 4LMQD 1C4PA 4HSPA 2K1BA 4N9PA 2PO4A 1N62A 2IDYA 1BMLC 3M4YA 3I73A 4HKQA 4WAFA 2JWUA 3DEPA 4MN3A 2AWOA 3LWEA 3R2IA 1ENCA 3DHQA 1DOYA 3MP9A 3S1RB 4R8IA 3HG9A 4Q0FA 3HOUB 2L4NA 4IALA 4Y7NB 2EYFA 3KUPA 5CORA 3TP8A 3OOCA 1PRTD 1KRHA 4ILWA 3U4EG 1XLOA 1PUTA 4OIKA 5CGKA 1E2WA 2J4XA 1LT4D 4ITKA 2XWBB 1RKNA 3E6ZX 1Y8PB 1SYBA 4G7ZC 4IDIA 2K3UA 1PZKD 1SYEA 1S5BD 5J1ZA 2DYOA 4C3HG 4JBWA 1G8ZD 3MXUA 4ZRPA 1YN3A 4LK0M 4JE3B 1UWXA 3Q8AA 1RFKA 2ZW1A 3DWQA 2GRIA 4O1NA 3LYYA 3H0GB 3AE1B 2MPMA 1NYRA 4ZRZA 5JVH3 1AZQA 2NN6H 4OZBA 4RWSC 4XT3B 1LV9A 4YIJA 4WQMA 1AN8A 5JPNC 1PGAA 4QF4A 1F9SA 1JOQA 1TJEA 3P7JA 2WKCA 3NQTA 1RYJA 1PRTF 5M5WB 3LX0A 1BCPB 2K5WA 1SE3A 1O80A 3AEEB 1A6XA 3ITPA 2WP8J 1EEFD 1Z47A 2KEEA 1VZ6A 2PW7A 5J22A 3TZDA 1OQQA 3MA2B 4KD4A 4KKUA 1NCVA 3MWYW 4ZK9B 1AWDA 4WWMA 2DY7A 1X3PA 1C76A 4YWGG 1O7LA 1OXUA 1FFVA 2F1MA 2N0SB 2B2WC 3GS2A 5JVG3 2XWJB 2BT6A 2KDMA 3AE8B 4HTHA 3PIP3 2B2TA 3T16A 1BUVT 1HA6A 2X38A 3I4NB 2WU2B 4IUNA 1R4PB 2M00A 1XWEA 4IUTA 2EZVA 2O5IC 2XSCA 5LHY1 3MZ5A 2C9OA 1U9RA 1II3A 2Z1CA 4ZLTF 3K5OA 1DOMA 1LTBD 3C1FA 2NMQA 1E9MA 4ARIA 4KKIA 5T8IA 3I91A 2A73B 5C4XB 2KEDA 2NTSA 2O5JC 1CT1D 1TU2B 5ELCA 3RPFC 4FF4A 1JW9D 1SNQA 4A3JB 5C4JB 2F0SA 3S14B 4BA1I 1ET6A 3W1SA 2JA8B 2RSOA 4N58A 2L5TA 2B2VC 4KHVA 2FUG1 5CV8A 2H89B 2N7JA 1A3UA 4L6TB 5FOBB 1KLGD 1GUNA 2XNAC 3H09A 1HTLD 4OO1H 1TWGB 4X3UA 2WXLA 3IAS1 1VF5C 4U673 1A2TA 4DNTB 2KCCA 4NJCA 2QKIC 1TKYA 5I6YA 1HQMC 4K2KA 2L1AA 2B2UC 3ERQA 1PTOD 1I4PA 2Q5WD 3OMCA 1RODA 4X3SA 1UGJA 3W3AA 4HRSA 3DWPA 4QCLA 3BK2A 4ODGA 1TS2A 3RMHA 2LHDA 4KX6B 1E7PB 1JICA 4AYBB 2M0AA 2NN6I 3E9SA 4F8MA 3KQ4A 2B2YC 4RKLA 1VRAB 5CR3A 2SEBD 2E76C 1DYQA 3CRLC 1HUMA 2LMCA 1EQVA 5CBAE 2KACA 5A2QE 3T3OA 1E0BA 3DWGC 2RBMA 2VUMB 1NENB 2JQRB 1TT2A 1H9RA 1WTPA 2W3SA 4XYQA 3BDLA 2JE6I 2WXOA 1U4RA 2PQEA 3AU7A 2RDFA 1KNEA 1EYCA 5EKIA 5EPLA 1PFNA 3BDCA 1ZOYB 4L1BA 2Q8IB 3R2TA 4HSVA 5G5GA 2F0PA 2XVSA 2JEAI 3BK1A 1K8MA 1PTOF 2AX5A 4DU9A 2NN6G 1QJOA 3Q23A 5BMGA 1WD1A 2XRQD 2MGSA 5C3JB 1KFYB 3FMCA 1SEBD 1EWHA 4CKBA 2KWDA 1C78A 2XIWA 4U68A 3IT6B 5M9OA 1IUEA 1SJHD 3GO5A 3HGBA 5EQ0A 4KTAA 1PMRA 1A70A 1B53A 2F0EA 2AQ3B 4KGSA 1NYQA 1JB3A 5ELEA 1CI3M 2PZTA 1D2BA 2B8GA 2L52A 2E6XA 1I4QA 4RCNA 1K8OA 3BG3A 1G2SA 3KLSX 4DXFA 2BCOA 1YN5A 5JJZA 5KNCA 4CQNA 1RTOA 2FE8A 3EJIA 3OSOA 2J53A 2OT2A 1SYDA 4OO1I 2EJGC 1OXTA 1LTAD 1MD2D 4HEA1 2E2HB 1FRRA 1R4QB 3E0JA 1ET9A 2DY8A 1UUPA 1QT9A 2K5PA 3Q24A 3BZDB 1MI2A 2Z4HA 5F2DA 2Q8TA 2F0UA 4C3JG 5BN3A 2JA5B 3AMZA 2PMZB 4K2LA 1SMYC 2CW0D 3EROA 3PMFA 1FO4A 1D5XC 5KIXA 1MSHA 1DONA 5KEEA 1DOXA 2EOTA 3GTLB 2MJEA 5AUIA 3HOYB 4K14A 2F0MA 5C5MA 2K22A 3ZJVA 3TP5A 1I7HA 3K7AB 1CFMA 2JYOA 4OO1G 2MJ8A 4G57A 4C3HB 2MP1A 3A8KE 4DFAA 3S15B 2BS3B 4JPSA 1JQ4A 1X3QA 5HFYA 2A68D 1DOIA 3C2PA 2N88A 3DWMA 1I3QB 2IGDA 5EE0A 4X3TA 5EPJA 4ZYSA 4WJWA 4ZHOA 1QOBA 3GB1A 3L3OC 4PMCA 3SDZA 1C79A 2K05A 2N9LA 2ONQA 1WTRA 2R92B 3J80E 1BO0A 4EQOA 3A7LA 3J81L 1EEID 4XIGS 2QMTA 3SXHA 4K5VA 3VA7A 5E6JA 5HGTA 2FINB 2KECA 4I7ZC 3HVZA 1SYGA 4A8XC 1EY4A 2QIEB 1ESFA 3DXJC 5ELFA 1UAPA 2IWHA 4BS9A 1CA5A 4GZYC 2VNUD 2WXNA 3NRZA 2D62A 1YJIA 4LK1C 3BWUD 5A2QL 1EFID 4EQNA 1XXGA 2GB1A 3M4OB 4C56C 4HEDA 5C3EB 4CKEA 4QB4A 2WDVB 4KJNA 3AE7B 3S1MB 1PTOH 3CKIB 2PZWA 5G5HA 1L5PA 4YTMB 2ACZB 4USAA 1JWBD 2VB3X 4G4KA 4ZQ3A 3KLSA 1VDVA 2F0IA 2PNRC 2EY5A 1WCMB 4V0BA 2EKIA 5JEAH 1VLBA 4CJ2C 2YU9B 1LTRD 5E4XA 4PMWA 1NR4A 3OWEB 5TSSA 3C46A 3AEDB 1LACA 3I4MB 4C2MB 4KY6A 4GLSC 4WRDA 4KY5A 5JAVA 3I57A 3DEOA 2PW9A 3ZJUA 4XXEA 5BYRA 1TKEA 2R61A 4FXCA 3U2SC 4LLGM 2JSOA 3P63A 1TWCB 4FF1A 1K53A 3KBXA 3HS0C 4BA2I 5G3LD 5HI1A 5CMDA 5BN5A 2V3NA 3D31A 5AFWA 1OXXK 3QWNA 4RF0A 3VRBB 2N55A 2BB5A 2K03A 2WXJA 1SSOA 2X6GA 2BW2A 2QJLA 2L32A 4K5XA 4CJ1B 2YEPF 2PPBC 2K01A 2M2LA 4R3DA 2OEOA 3QIAA 5I9OA 1EYDA 4IQZA 1E6EB 5EJWA 3VR2A 4US9A 2L1BA 4IN3A 5C0XI 1IYUA 1J7CA 5I2YA 2N9KA 1IKLA 2NVYB 2FMCA 1J8IA 4XWTA 2X6LA 4PMBA 1QNUA 2O4XA 1CZGA 1SNCA 1EIGA 1YQ4B 3EA6A 1Y1VB 4IZ8A 2WXGA 2RQXA 5G3LF 1DOLA 5IOCA 4DAVA 2G1EA 1S5FD 1NR2A 3D8GA 2ZW0A 2B2WA 1Y8NB 3NWTA 3AM9A 1BUIC 3A55A 1NSNS 5I9PA 2BS4B 3AN1A 3W5UB 3KF8A 4A3KB 1HHVA 4TKOB 3IXSA 3PZ7A 5BMHA 4WORA 3ZQ4A 1HFNA 1DD2A 1DM0B 3UI2A 2JEBI 1MSGA 1B4OA 5FLXL 1BDOA 3CWIA 1BR9A 3FC4A 5C0XG 1RF2D 4A3DB 3OHXC 3RUZA 1SSNA 4JWSC 2YEPB 1GXDC 4TSSA 2MJDA 2X69A 1ZXHA 2NTTA 2K0PA 1U4MA 1FGBD 1DJRD 3K6OA 4XDCA 1C48A 1FD7D 1SE2A 4QUCA 2FMMA 3ONAB 2FHTA 1E10A 4UAIA 4EQPA 2B2VA 3AEBB 1L0VB 1XF5L 4GDKB 1TWAB 1IKMA 5EE3A 4XDDA 4HMJA 3TBIB 1EY6A 1QOFA 1LTGD 5FK9C 5JEAG 1MI0A 4F7XA 5M3MB 3TMEA 3FKIB 1ZE3D 2B2UA 1ZYRD 2EYLA 4J1MA 3HVDA 3Q22A 4TMAB 3E5SA 3S17B 1V1OA 1ZXIA 1QOHA 4XQQA 2KHSA 2L12A 3MXNA 3X3MA 2RKSA 3DMUA 1VMCA 3D4RA 2EYMA 4KN7C 1ZDXA 2K6AA 5IGDA 1VDZA 3DM1A 4MT5A 1ZDVA 2B2YA 4IFDI 4XWWA 2SAKA 2MHVA 2BDNA 2WP9B 1J9OA 1Y56A 4WURA 4K6LA 4KJOA 3Q69A 4M8AA 3EQLC 1L6UA 1IW7D 1I50B 3NTHA 1EM7A 3ND8A 4P2CB 2A69D 1PRTC 2R93B 5KGUA 2CHBD 1OXVA 4CJ0B 3BVGA 1GPXA 3EGRA 4ZKBB 2A6ED 1F2LA 3BVZA 3J7YW 3WCQA 2WQYB 1TQOA 1D6EC 3QOJA 3MTSA 4FO2A 4RGOS 4DXGA 1V97A 3I90A 1EWYC 3Q0AA 4RHSA 5CV5A 1QF6A 2WXMA 3PV0A 4F88A 2AUJD 4I65A 4FF2A 2I38A 4H44C 1N63A 1STEA 1JOKA 3ABVB 1B1ZA 4A3EB 3IAYA 3GV3A 2DLBA 1HA5A 4JWUC 3R3OA 4RHRA 2F0NA 1WGKA 1ZPSA 2K04A 4IFDG 1KABA 4OL7A 2PKOA 1EOTA 1T5XD 5T1GA 2RA4A 5KYLA 3H8HA 2H1EA 1DZ1A 4ME5A 1TWHB 3H94A 1D1IA 2Y0SB 1IBXB 1V8QA 3AE9B 2EYOA 1RD9D 4K8JA 1GHJA 3GTGB 3SK8A 3SFDB 1E0ZA 4RGMA 4M1UB 4A3MB 3T13A 1TS5A 4FXDA 1STHA 1LTID 4RF1A 1EZ8A 3K59A 1E2ZA 1N60A 2JYTA 2Q8RE 2HQEA 1LABA 1YNND 1KH0A 4KI0A 5GXGB 3IT4B 2F3VA 1PRTB 1Q12A 2EJMA 5D14A 2QF7A 5M3FB 3NXWA 2PYKA 1PFBA 3NE5B 5LL6S 3HZXA 2LUMA 1O7ZA 5M5XB 3A8IE 4KKJA 4H13C 4REZA 2NUCA 5KYIA 3NUHB 3TSSA 4HCEA 1BF4A 3MHBA 1EZ6A 3HEJA 1EU4A 2M19A 4YSXB 3ZYYX 2EYPA 2ZXPA 1H9MA 3QO2A 1Q10A 5KNDA 2VZKD 1SIJA 5CV7A 4KGRA 1G291 3BVMA 1T6BX 3VYTA 3J81E 2HDEA 2BDOA 2Y5CA 1Q8IA 3AE2B 3MEHA 1FCLA 2B63B 4KKSA 3J9CA 4J3OD 5EKKA 5CV6A 4C3IG 5C4ZA 3NTIA 1CHQD 3B2GA 2LGIA 3RLFA 3SE0A 1ROEA 2J7ZA 4KK7A 1IL8A 3U52E 2E2DC 1GOZA 1SFOB 2RDHA 1QOAA 1L4ZB 5H8YE 5BYSA 3CQZB 4DGZA 5K5PA 2E74C 2C5CA 4TQ0A 3OPOA 1PTOC 2L9HA 4R9WA 2PVGC 3VR5A 1WTXA 2K28A 3A54A 5IGCA 5EBDA 1HCZA 1OFFA 4BWGB 1DOKA 1SE4A 1FM0D 1KF6B 3C3LA 3L4PA 1FNUA 2QILA 3IKJA 4YTPB 2IW3A 5EGTA 3D6CA 3GTPB 2Y5PA 4RCOA 3S9WA 5DEHA 4NMZA 1HZ5A 2PIAA 1RJTA 3A7AB 3SFEB 2ID0A 1ONLA 2ZXOA 1MBYA 1C8CA 1TR5A 2WU5B 1JRPA 2LJIA 3VR3A 1QILA 1QKZA 4P16A 5E3FA 3QB3A 5E4WC 2NVXB 5HG2A 2EYJA 2E2IB 4KD3A 1IYVA 2NBFA 4QIWB 1CTMA 1R7SA 1Z7TA 3P75A 2HTME 2A74C 3FDTA 1ACCA 4DAYA 2K33A 2W82A 5LL6X 1XX8A 2F0DA 3S1NB 2F0VA 4DN4M 3BIID 1N61A 1PFDA 1Q1EA 4C1NI 3HRZC 3GQBA 3T53B 2CU3A 3SR1A 2Y3AA 1KDBA 2HDMA 1W6KA 1PTOB 4TQ1A 1PZID 4MIUA 1ICWA 1PXUA 3KWVA 1S5ED 1MPEA 1Y69U 4NW2A 5JOBA 1EQTA 4Q2JA 2WXHA 5IGBA 1CQVA 1TY2A 1EIHA 2AUKA 2MJ3A 1RWSA 3L7ZC 1DXMA 2EDGA 2R3ZA 3NWSA 1RHPA 2JU6X 2WXKA 3CU7A 1YQ3B 4N59A 2FJ2A 4V190 1ESRA 1VF7A 2WXRA 1V43A 2BA1A 4G7HC 1NVID 1F2ZA 3R93A 2BA0A 1PGBA 2VB2X 3SHLA 2SNSA 2H4OA 2PW5A 3GP7A 4XYOA 2KQ4X 2JA7B 1JWUD 3TZUA 3GTOB 1O7YA 4HROA 2NB0A 4PNYA 2K32A 2CW0C 4B0EA 3V05A 4KKTA 3NVYA 3PUVA 4JK1C 3OW7A 1FNVA 2F03A 1FYCA 5FLXE 1F2RI 1RDPD 1YJJA 5CV9A 3GTMB 1V1PB 1HEZE 4FVMA 2F3WA 4OHJA 5C5LA 4HCSA 1C77A 4EE2A 2W55A 2F0FA 4IUQA 3S2DB 2A68C 2KVMA 2F0WA 2YYZA 3P20A 3C8YA 4HR7B 2QCPX 1CM9A 1F9PA 3U9SA 2HCCA 3MFYA 4H7BA 2WV6D 1XYIA 2PZUA 1YMHE 5IGEA 1QQRA 4KV6A 2RDGA 2WXIA 3M7NA 3Q8EA 1I4HA 1K51A 1JR0D 1LTTD 4XE0A 5IT9L 1G91A 5C0XJ 4AQ7A 3NS1A 2JXTA 4YSZB 1B9NA 3W9CB 4C7ZA 1STBA 1VZ7A 3BDOA 3K57A 1UWMA 3RZOB 2V0GA 3MJ5A 4RNAA 4R8NA 1E2VA 2BB6A 1S5DD 2OXPA 2A6HD 1QNKA 3EUB2 1XTCD 2F0HA 1XCQL 2R6GA 4D2KA 2OF1A 3B9JA 3QG1A 2MEKA 4L23A 4ZAIA 2MUYA 1WYGA 3A56A 1Q3LA 3HP3A 4RKBA 5DM63 2M56B 4RAUC 5NUCA 1JWMD 2PLPA 3G6JB 1GHKA 4BBSB 4IKGA 2VXWA 5COYA 3LB8C 1IBXA 1A3VA 4DK1A 1FXIA 1VR9A 5JXVA 1H9SB 1MHXA 2OEDA 2NWGA 3V96A 1EWCA 1SBBB 1GB1A 5EE1A 2I2YA 3NK9A 5CYUA 2CJNA 5C44B 1TIID 5DNFA 3VQIA 2PTLA 4C80A 4G7OC 4PT5A 4OZAA 1XLPA 1A3TA 1KLUD 3P1HA 3H91A 2IX3A 1YNJD 3PZ8A 4MHEA 3AE6B 4ULLA 1B44D 1AZPA 5HHDG 1PFMA 2A5HA 2B39A 5JPMC 1WTWA 2INPE 2TMPA 4OGQC 3PO2B 3MHZA 3SVMA 3G7LA 3FPUB 4KHZA 3JAML 3HRDD 4QMGA 3K58A 3DWAA 2JP1A 4L63B 3W2DA 5IGFA 2BS2B 1EY9A 4OZCA 3Q8FA 4KN4C 3BYTB 4DQOC 2TSSA 3NBIA 3CHBD 1ZUD2 3Q8BA 1CK1A 4XT1B 1TYGB 1GUWA 2B8FA 1C9FA 4CKCA 1FNWA 1CJEA 2IT1A 2F0TA 2IGGA 1BNZA 1TZOA 2F0JA 4DNRB 4XDXA 1BCPD 4RA8A 4IFDJ 1TVXA 1F9QA 1G6ZA 5T1IA 3HOVB 3FILB 3VR4A 1EL0A 1U4LA 1LLRD 2PMVA 4L2YA 4JX1C 3VR9B 2G9DA 2JX5A 5I2XA 5DAUA 5CBEE 5DM73 5E1FA 2KMMA 4XTCS 1EY7A 2QSDA 3WOFA 1EYAA 4L8JA 4ZUJA 1QOGA 1SXTA 2EE1A 3IL8A 5A35A 3K5MA 1IGCA 1A15A 2JYEA 1J7AA 2KCNA 1TKGA 1F0ZA 1PDQA 1JROA 2SNMA 5MPOA 5C3WA 2H88B 3CRKC 4M0WA 1M8AA 3VR6A 4TRDA 4IUUA 3NVWA 1JWAD 2KUMA 3T51B 2EJFC 5K36H 4X3KA 1BCPC 4FNFA 4YTNB 3PIO3 1IHZA 3K0YA 1B9RA 1FEHA 5KRUA 2JZPA 1BCPF 2Z4IA 4C3JB 1JC7A 2XRSD 3I9V1 1L0XB 2HDLA 4B08A 2D5DA 1FR3A 5EPKA 1QB5D 4CHTB 1V8CA 1WTOA 4N9TA 1U4PA 3N9YC 1JORA 5FO7B 3J7AV 2CVRA 3AV8A 5M5YB 2F0LA 2W54A 3F2UA 4PQXA 4C7YA 3O13A 2WB1B 1RTNA 1RM6C 1F2RC 1VJKA 1WRIA 2ON8A 2WNMA 1FD6A 3P1MA 2M9VA 3OMGA 3FVQA 1STYA 3AB9A 1K50A 2HCIA 4F87A 2KAJA 4WFN3 1I4RA 4NKLA 1GAQB 3DUZA 2D9UA 1SF0A 3NUCA 4NDXA 2MH7A 3HUIA 1ZYRC 1ENFA 2WXFA 1NAPA 1B50A 3P4QB 1GUTA 1JALA 1L0YB 3D4WA 1D4BA 1JWSD 4OIJA 3D6WA 2F0KA 4KMUC 1XEEA 1KTKA 4RFBA 1NI3A 3S2HB 5C4HA 1QG7A 1UNSA 3LXFA 3MC0B 1QWYA 4BBRB 5FKAC 3AH7A 1SNDA 5FO8B 1LT3D 1IW7C 4OVZA 2L83A 2A69C 2FFKB 2L11A 5EE9A 1SYCA 3HOWB 2A6EC 1SNOA 4YT0B 3HOXB 1JOOA 3RFZB 2L0CA 3D4DA 1STAA 1AYFA 1OO9B 3K5NA 1H9KA 1FFUA 1DCZA 1Y8OB 3PUYA 3SEBA 2IX0A 2FBWB 4DAPA 3AEAB 1JQYD 3NHHA 3RZDB 1GUSA 3SK6A 1Q1BA 1OQRA 5BYQA 1XCTL 1AP0A 3MXGA 3HKZB 1PLFA 4IUPA 3FEWX 1D5MC 2ZT9C 1C4AA 1YNTE 2DBYA 5CV4A 2EXZA 1QCBD 4CBVA 1ML0D 3EVQA 1CA6A 1GB4A 1FMAD 3PUZA 4IOIE 1TS4A 4NAMA 4IURA 4FYDA 4UDUC 2IJ0A 2SDFA 3LWUA 3T56B 2AQ2B 1BBXC 1V1PA 3HOZB 3VYRA 1LO5D 3U7ZA 5EBCA 3P42A 4A3GB 1HRJA 1J7BA 2ICIA 4J8QA 3MXPA 2NVQB 4NAWB 2LFNA 2EPBA 2LHEA 5IODA 4IUVA 3AB5A 4HKZE 3I72A 5LNK1 2KN4A 2LKVA 2KJXA 3NVVA 3TEWA 4C1NK 3VRAB 1B9MA 4MACA 3TP7A 3AE4B 1F77A 1YNNC 2L55A 1FXAA 4ZRQA 5K36G 3ETRA 4NP5A 3OIPA 2BOSA 1I4GA 2EYHA 4TQUS 1ENAA 1DGJA 4KGTA 3T4AC 1UEAB 2JSVX 1MHHE 4ABNA 3K5LA 5BMIA 1IGDA 2WINB 1SYFA 2JA6B 3IFTA 3PUXA 2O2LD 5D65A 5IIFA 5I4DA 3EFXD 3OWFA 1S4ZA 3NQIA 1CHPD 3I3CA 3ZGZA 1I6HB 1SB3C 1K52A 3KBGA 2W3RA 2DWQA 4PV1C 1PGXA 3H3VC 1XLQA 4OW0A 1LT5D 2XN9C 1R9TB 1CZPA 4HMIA 4K8IA 4RH6A 2EVBA 3GV6A 3IAM1 2NVTB 1PDXA 2DNEA 5IT9E 2KQ3A 5HURA 1H9SA 5C2TB 2K9XA 3URYA 4MM3B 3IFDA 3PUWA 3FRPB 3MFGA 4ARCA 5EKLA 1KDAA 1ZEQX 1FCCC 3AE5B 3TEYA 2V3PA 3V3XA 1EY8A 1KDCA 3TEZA 4O42A 2WLBA 2BE5D 2SOBA 5ISRA 3BS1A 3ND9A 2B2TC 3WOEA 1AFPA 1HZ6A 2LFIA 2WKDA 3NSWA 4RGTA 1SAPA 4WH4A 1QLBB 3P4RB 5D7GA 1L4DB 3I4LA 1VZ8A 1SMYD 3C1EA 4A3FB 3S1QB 4H2AA 4XQJA 1YN4A 1SNPA 1WTVA 2CJOA 1HPCA 1ZP0B 1SJED 3OIQA 2J42A 3S16B 4A3BB 4DA2A 2WXPA 1N5WA 2CQAA 4B9XA 2HUGA 1WXQA 4J6HA 4NZLB 1CQFA 2V4DA 2V4IB 2VZKB 1PZJD 2BYTA 1T3QA 1AW7A 3NP8A 2KA7A 4XQNA 1BQQT 1D1KA 5D3IB 3M85A 4FF3A 1H9JA 4A90A 3NPPA 2NYZD 3GD7A 2BE5C 4LJZC 1MGSA 3FILA 1WWTA 3Q6SA 3VYSA 1LTSD 1TS3A 3AEFB 3JAME 2LY7A 2AQ1B 1A2UA 1G2TA 2BTEA 2GA4B 1T5EA 1XO3A 3VA5A 2IL8A 4K6DA 4P6VF 2G9HD 2WIIB 3T3NA 1FRDA 1OXSC 1JCKB 4ZUIA 1K83B 4MH8A 3M3YB 2WS3B 1JMLA 1SNMA 4LAAA 1HXYD 3TDQA 4N6EB 5I6WA 5C3XA 1FIQA 4ID6A 1HUNA 4ZOHC 1GUOA 4BY7B 4ZHPA 3H6MA 3B2FA 3TP6A 4YSYB 1TWFB 2ZXRA 3KLRA 3NZ3A 3TN2A 3E56A 4ZKCB 4LTUA 1MVKA 3UI3A 1EU3A 4H0LC 1GUGA 1C4CA 3KWLA 2AWNA 4WIPA 2E75C 1VCIA 3RD4A 2ICEC 5C0XH 4A55A 2RSNA 5D3DA 3GTKB 4EGVA 4A6QA 1P7FA 2LEKA 3CIRB 1RCVD 2EY2A 2K5DA 2INNE 3P4SB 2EY1A 3SK5A 1JE4A 2IPKD 1W6JA 3N52A 3SK4A 5AUKA 3AE3B 3I8ZA 1WVLA 2IX1A 4A93B 3VYUA 3NBHA 4FP5D 1SDFA 2RPVA 3FAHA 3KK7A 4Z9CB 2BBCA 2PCFB 1C4QA 1S5CD 2WAQB 2JXMB 4BY1B 1Q90A 1ILPA 1HQRD 2J52A 3W5VB 4EVOA 5FO9B 1F2YA 2E3TA 1KAAA 1EY5A 4AS1A 1L6VA 1ZXTA 4FXGC 3L9AX 2B76B 4US8A 2LMCB 3AMUA 2ENBA 3TUOA 3WDNA 1LT6D 2K7VA 3TEXA 4YXDB 1GJXA 4HAEA 3ZJTA 4A9AA 2R7ZB 3M7GA 2WDQB 1STGA 2OHFA 1F2MA 5H92C 2DN8A 2Z8LA 1PYWD 1B3AA 1I6VC 2K5QA 1P7EA 1NUCA 3SR6A 1BOSA 4KY7A 2NZ1D 4HN7A 1CZWA 5JEAJ 3VR8B 2KOLA 2IGHA 3NTKA 5J39A 3MVVA 1STNA 3AECB 4FXKC 3J7AF