1FNWA

Crystal structure of streptococcal pyrogenic exotoxin a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
221
structure length
221
Chain Sequence
b'QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYTIDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDNKTSQIEVYLTTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOTOXIN TYPE A PRECURSOR (ALLELE 1)
publication title Structure of streptococcal pyrogenic exotoxin A reveals a novel metal cluster.
pubmed rcsb
molecule tags Toxin
total genus 54
structure length 221
sequence length 221
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fnwA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fnwA02
1KTKA 4RCOA 1D6EC 1TS4A 1FD7D 1CHQD 1SXTA 1JWSD 1L0XB 1ET9A 3TSSA 5TSSA 4RGTA 2CHBD 1D5MC 3DWQA 4UDUC 1XTCD 4RH6A 1PTOB 1BCPB 1RDPD 5D3DA 3URYA 1I4HA 3CHBD 2J4XA 1ESFA 1PTOF 1BCPF 4RHRA 1B44D 1HQRD 1GOZA 2RDGA 1PRTC 2NTTA 4RGNA 4BWGB 5ELCA 4DXFA 1V1PB 1CHPD 1I4PA 1LT6D 2QEJC 3O13A 1SE3A 1TY2A 3DWAA 2WV6D 1KLGD 1SJHD 4Z9CB 5ELBA 1LTRD 2IPKD 1TS2A 1UUPA 1HTLD 1LT3D 1MD2D 1RD9D 2AQ1B 2QILA 3R8BA 4NZLB 1F77A 4RFBA 3KLSX 2R61A 1DJRD 2SEBD 1S5FD 4O1NA 1UNSA 4DXGA 2NTSA 3BYYB 1HXYD 1JWUD 1SE2A 1AN8A 1D5XC 1ET6A 1RF2D 2XRSD 2G9HD 4OHJA 2AQ2B 4ZYSA 2Z8LA 3GP7A 1STEA 3EA6A 3BYTB 4L6TB 1FNWA 4RGOS 1I4QA 1PRTD 1BXTA 3BVGA 1LLRD 1TY0A 1I4RA 1L0YB 4K6LA 5ELEA 3MC0B 3SEBA 1LT5D 1B1ZA 1S5DD 1EEID 1PZID 4RGMA 1S5CD 1FNVA 1SEBD 1SBBB 1DYQA 1EU4A 1YN4A 1AW7A 1EWCA 3BVMA 2RDHA 1EFID 1S5ED 2IJ0A 1LT4D 1EU3A 1FNUA 1CQVA 1BCPC 1JR0D 1LTGD 1T5XD 1PRTB 5D3IB 1PZKD 1ENFA 1V1OA 3BZDB 1PRTF 1JQYD 1CT1D 4TSSA 4L63B 5I4DA 2XN9C 1I4XA 1YN3A 1RCVD 1LTBD 1M4VA 1SJED 1JWMD 1S5BD 5FKAC 4C56C 1V1PA 3MFGA 1CK1A 1KLUD 2O2LD 3DWPA 2TSSA 3W2DA 5ELDA 1G8ZD 1PZJD 1D5ZC 1TS3A 1PYWD 1EEFD 3OWEB 1PTOH 1LTSD 1HA5A 1LTID 1XXGA 1SE4A 1YN5A 3V05A 3EFXD 2ICIA 1PTOC 3BVZA 1I4GA 5FK9C 4RHSA 1PTOD 1BCPD 5ELFA 1LTTD 1QILA 2AQ3B 1JCKB 1LO5D 1FGBD 3R2IA 1LTAD 2XNAC 3R2TA 2XRQD 1TS5A
chains in the Genus database with same CATH superfamily
1VCBA 4A3BH 3VR5A 2VNUD 3F2UA 2JRHA 4N58A 3A5UA 2B63H 1WJUA 1FCCC 2Y0SB 1K83H 2L05A 2KOXA 1T5EA 3A9KB 4WQMA 3PUXA 5TSSA 3FPPA 5I9OA 3CCJA 3DWQA 1XTCD 2N9XA 1RDPD 3AV8A 1I4HA 4YIJA 2JA8B 1CFMA 3HOXB 3QWNA 3OW7A 1WSPA 5IP4D 3IFTA 4JI1Q 5GAGC 3F2CA 1WGKA 2QJLA 2NTTA 2D5GA 4E6IA 3IVFA 5EBDA 4CDFC 1EQVA 1R4MB 1Q81C 3VR3A 1UGJA 4E74A 2HHHL 1YJWA 2F4VQ 4H44C 2LXJA 2Y5BB 3WCQA 4WAAA 3AEDB 5ELBA 1ZPSA 1S4ZA 1XPRA 4NQKE 1DOKA 1NMGA 2VB2X 1K8MA 2QILA 2XGTA 1Q86C 1Z7TA 3L08A 4QJFA 1YVCA 3DHIC 2QA4A 1GHJA 4K3BA 4BA1I 4XYOA 1UNSA 3RZDH 2Q8RE 1WIAA 3Q3MC 4ABNA 2NTSA 4WFN3 5H1SE 1DGSA 2B2WA 3IKJA 2CJOA 2IO2B 2KJHB 1TZOA 4KV2A 2LGYA 1N61A 4JX1C 2JYEA 3A8IE 2KTRA 5CORA 4BBNF 4UP9A 3EA6A 2JK8A 4GSWA 4KDIC 4FHKA 3I4NG 3X3NA 1YX5B 2J0MA 2XWBB 1KAAA 5LNK1 5E7NA 1HNWL 3AECB 1LLRD 2K32A 4IUTA 4HKZE 3EQLC 3VUXA 4LFCL 2E76C 3PIOA 3PT2B 5IOIA 1KFYB 2TMPA 1X55A 1WYDA 1YJ1A 2KACA 5JXVA 3G6EA 3N30A 2F0LA 4HEDA 2Q8TA 1GHKA 3C1FA 3S1MB 3RZOB 1QCBD 3A9KA 1CQVA 1BCPC 1JR0D 3TN2A 3ZO5B 3I55A 5E6OA 4TKNA 2GBNA 3T3OA 3BZDB 1WD0A 4DV5L 1Q1BA 1UBQA 1UWXA 5HG2A 2N0SB 1IBXB 3PGZA 2LVQA 4GDLB 5C0XJ 2EYFA 3IAYA 1CSPA 3QOJA 1R9TH 2KC2A 4BY1G 2FCMA 1X65A 5IE8A 2K33A 1A63A 3H1UA 2KK8A 4A93G 1O78A 1S5BD 2KFKB 3NVYA 4B0EA 3RN5A 5GADC 5J39A 1NBWA 5LMUL 3M4OH 4ZRPA 1L6UA 2YU9B 1PZJD 1CZGA 4KZCA 4MTKA 1HEZE 3KVFB 2K1BA 2PKOA 5TR5A 3Q0AA 3A8JE 1N34L 1FXTB 1X1MA 1YN5A 3EFXD 4W9DA 3FKIG 1UE7A 4A3GG 4JK1C 5FOBB 4KGTA 2Y0SE 3BDOA 5ELFA 5IP9G 3KLRA 2LEKA 2WYQA 1F9QA 4ODGA 4WWPA 3GO5A 3VYRA 3AEEB 1HNXQ 2R2QA 4W9KA 3SHQA 1WZ3A 1DZ1A 1YOVB 2MQJA 4G7OC 1FCLA 1H9JA 2RCNA 4NDXA 1P1AA 3PO3H 4C3HB 2ZEQA 4PMWA 3AEAB 2MWSB 3DVNV 1TTNA 4Y7NH 3B2FA 3JYUA 2BGFA 1A62A 4YCWA 3CCRA 1U4MA 5EKKA 1D5MC 2KEDA 4ZAIA 5GROA 1Y69U 1KF6B 4LF9Q 2RGFA 2KN5A 4FXCA 4KKIA 1BCPB 3M7NA 4EZLA 2WFWA 1Y1VB 5DCNA 2L9HA 1KRSA 2ZTEA 3R7RA 5J1ZA 1UF0A 2JPHA 2LJ5A 4JI7Q 3W1GA 1NNXA 2KLCA 1PRTC 1QZHA 1DXMA 1TJEA 4ILWA 5C3EB 4WJNA 4OVVA 1MSHA 3K7AB 4HMIA 5FLXL 4LF8Q 4FF1A 5BYRA 4MTNA 3I56A 2MH7A 2MBHA 3H8HA 1F2ZA 2BKRB 2WLBA 4W9LA 2V3NA 1LTRD 2REXA 4GDLA 5HI1A 2I5MX 3P63A 1P8LA 1STAA 4DR5L 2JP1A 2MLBA 3HKSA 3I91A 4V190 1OQYA 3P4PB 2Z0EB 4B0MA 1SRUA 4DNRB 2W55A 4LDTB 1IYJB 5LMNL 5CBAE 1K8AC 1IKMA 4TV3A 3GDEA 3CPWA 4OZBA 4DR1L 2VH2A 2EY1A 2GVBA 3KF6B 2K5QA 4A3FH 1F2RI 1EWHA 4PS8A 4DHJB 1HR0L 4AH6A 4ZUJA 5M9OA 2L4NA 3MZ5A 1W6KA 2GOWA 2G4SA 4J6HA 5CYUA 3VA5A 1IUEA 4EE2A 3A55A 2ATWA 4KIKB 4QL5A 1OXXK 1SAPA 3MTSA 4LNIA 3MTNB 3S1RB 2PEAA 2ZXPA 2JXXA 4A3KH 1SMXA 3KJOA 3UDGA 3MC9A 2JF5A 4X66Q 4AYBB 2E75C 5JZEB 2K6DB 1V9PA 2E5LQ 1E2VA 1HA6A 1VR9A 3CIRB 3DQVA 3S2DH 2B2VA 4LK1C 3DHGC 2RBMA 1AW7A 4A3BG 1FYCA 3BVMA 5E3FA 3N6RA 2WS3B 2F0TA 3BDCA 2IJ0A 4JI8Q 4C3IH 1I94Q 1E8ZA 2FCNA 2GBMA 5HURA 1PRTB 3NBHB 1PZKD 4BXXH 2ZCBA 3AE5B 4JIOU 4A9AA 2IX3A 2LUEA 3KF8B 2EKIA 4X65L 4ANWA 2BKFA 2C60A 3NTKA 4P6VF 1OXVA 3EN2A 2KENA 4L63B 4C7YA 3ZQ4A 3SR6A 4QGUA 3OTOQ 3HOUG 4I7ZC 5C3XA 3PSIA 5C0XG 1S3SG 4KY6A 1K8OA 4MGKE 4BBRB 3R93A 2LXCA 4J6IA 4GGQA 3SK6A 1JOOA 4BA2I 2CQAA 3OAWA 1MSGA 3MWYW 1G8ZD 1N6ZA 2AEHA 4GKKQ 5KHOA 4CJ0B 1KJTA 2KHSA 4F7ZA 1ICWA 4G7ZC 1QWYA 3ZDMC 2EIFA 1SNMA 4DV0L 2QDFA 3BZKA 4C2MB 4KJNA 3MXNB 3E9IA 3HP3A 4NKLA 5F2DA 5J3BA 4LF6L 1HTOA 3KF6A 1X3PA 2J7ZA 4B3RL 4HAEA 1Q8IA 4DV7Q 1J8IA 4OZCA 2GA4B 2D62A 4JV5Q 2E6XA 1DOLA 3RPFC 3H6NA 1LUZA 2VXWA 4I6NB 4A3PA 3QOLA 2KQ7A 4KIKA 3W1YA 1OEYA 4YHHQ 2PZWA 4A3MH 4IJHA 1XMOL 4HJGE 2CHBD 3S16B 5BYSA 3K81C 2RSUA 2F0SA 2PVOD 2K6AA 1NSNS 1NAPA 3RT3B 2J4XA 4IUVA 1P7EA 2KA7A 4H02A 4BZAA 3DWMA 3SU8X 4RF0A 1MGSA 5CHFA 1PHJA 3I4MB 1OFFA 2D07B 1WI0A 4RGNA 1YITA 4K6DA 4MDKE 1GB4A 3DHHC 1Y14B 2UUBQ 4QMGA 5C4JH 3JAML 4CGYB 3NBHA 3H7PB 4HDOA 2IGGA 5KNCA 3RMHA 5KYIA 4JYAL 1NTGA 4DR6L 1BDOA 3MA2B 2K0PA 2PYKA 1AH9A 2EZVA 4EKUA 2KECA 3OMGA 1RD9D 2VRRB 2N88A 1F77A 3C1EA 4IKGA 2XTIA 1WXMA 3K9PB 3EBEA 1A0IA 2ES2A 1Q8KA 3KUZA 2JA5G 4A3JG 2HJ1A 2K5HA 2WDRB 4W9EA 2O4XA 1U4RA 2NUCA 3RYTA 4FA6A 1ICFB 5M5XB 2KXJA 4BKGA 4TKOB 3RNAC 1VZ7A 5GQOA 4DR7L 4PYUA 1X6OA 3FHWA 4KHPQ 1FRRA 2I1JA 3BYTB 4AYBE 2YLMA 3WDNA 3GTOB 3A56A 1A2UA 4KV6A 2JA7B 2BYTA 1WJ4A 2MBQA 1LV9A 5K5PA 3CCLA 3MXNA 4KTAA 4QY7A 4LNNA 1TWHB 1L6VA 2BS3B 2IYDB 1A3VA 1V80A 3DBLB 1E0BA 1S72A 3TP7A 3R7QA 5KRUA 1MVKA 1YN4A 3QB3A 1D2BA 2DNCA 4KN4C 2DN8A 1EFID 1WTHA 4OL7A 1BT0A 2EY2A 3PO3G 1PVOA 4FADA 2LVOA 3E5SA 4K14A 1U9RA 1BMLC 1JJ2A 5D3IB 3J80E 2CH4W 3A8KE 1SNOA 1V1OA 2ZM6Q 2K22A 1WOCA 1B70B 2MBBB 2ZW1A 4FJZA 1D1KA 2AKWB 2L32A 1IBLQ 2R7ZH 4HROA 1VRAB 2LMCA 2E2HH 2J0JA 3CWIA 3LJ3A 3WAPA 3N1ZC 5FJ8G 3KJPA 4MT5A 1TR5A 4YT0B 1ACCA 4C00A 2XIWA 5AJ3L 3T3NA 2FMMA 4URKA 1PH3A 3OLMD 1E8XA 4WWMA 1RKNA 3H7PA 3PRZA 3SK8A 1F9JA 1FFVA 3VH3B 2L1BA 1I50H 4C7ZA 1EIGA 1PTOH 1SLJA 4OELB 2G9DA 2WB1E 5T1IA 2KCCA 2B3AA 5IT9c 5EKIA 1EWYC 2MSED 1HZBA 2M19A 2N49A 5FR6A 2UXDQ 2XVSA 3Q8FA 1A5RA 2R2OA 3C19A 1BCPD 2F0QA 3KBGA 2D3BA 5D14A 3CMMB 5EJWA 5J18A 1C3TA 2E8GA 1LO5D 3K8AA 1B2TA 4MIUA 3L9AX 2XRQD 3R2TA 2A6HD 2KCNA 3LWUA 3ND9A 1BKBA 1JE5A 1YEZA 2YTXA 1SFOH 1MJEA 4QIWB 3HOYB 3R3MA 5AZFA 1CUKA 5K36H 3L10B 3U58A 4EZKA 1YNND 3QK0A 5KHQA 2ICEC 4FNFA 2Q2IA 4A3KG 1Y8RC 2EELA 3VUWA 2Q2TA 2JZPA 2MJ3A 3SFDB 4WURA 5G2NA 5JEAJ 1BCPF 5CHWA 3J9CA 4A3EG 5EDSA 4AQYQ 1Y1WH 2NPTB 4IFDH 3QX1A 4LDTD 4G11A 2W3SA 2OEOA 3FILB 2ON8A 2WQYB 4DHJD 3A7AB 4POFA 2IGHA 2IY1B 4GU2A 4CHTB 1SJHD 2DZMA 2MJDA 4XT3B 5M3MH 3SGIA 2ZJRA 2PJHA 3Q6BA 4NJ7A 3E0JA 2A8VA 3CCMA 2OTJA 4NZLB 4MEMA 4DR3Q 1EUJA 1K53A 5JHAA 2LFNA 4LF4L 1N5XA 4CDCC 4ZKCB 4RMFA 4NJCA 4W9JA 1B9RA 1Q12A 3MHBA 3VHTC 2WINB 2R93H 5C1ZA 2KDMA 2PIAA 1E3PA 1ASZA 1FXIA 2AQ2B 2K8CA 3RD2A 2RDFA 3LX0A 1STEA 3HOWB 2JA9A 1E5WA 5T8IA 1C7YA 4DV2L 2KWVB 1I6HH 2I1KA 4GN3B 2C9OA 1PRTD 4LK0M 1VDVA 1C77A 1L0YB 1CZWA 4K6LA 4DAPA 3W9CB 3H3VC 5CHVC 4C80A 4X3KA 3CC4A 1EY4A 1TT2A 2VQFQ 4H13C 2V0GA 3NTIA 1EU4A 4IWQA 4USAA 1KOTA 5IGGA 2I07B 2N55A 4L5TA 4C1NK 4YY3L 4GKJQ 2JZ3B 3ALBA 3ML8A 1WTXA 1QOFA 3NOBA 1LT4D 2K1FA 4FULA 4LJPB 1OXTA 1SYBA 3J81L 3UE0A 3OYYA 4A3MG 4HJ7A 2N9PC 1V43A 2JE6I 5T1GA 5I6WA 3CKIB 1PRTF 2UU9L 1C78A 2NWGA 2VW9A 1OXUA 3I72A 3RUIB 2MFIA 4R4TA 2BTEA 1JQYD 2CHZA 5IO9A 5DPRA 1IGDA 2OJWA 1NENB 1A2TA 4DUYL 1E1TA 1PFSA 2NVQH 1JT8A 2J42A 2B8GA 4IUNA 1GUTA 3TMEA 4A3IG 5MPOA 1RTOA 4B3TQ 1CK1A 3FILA 3TIXA 2BYFA 3NELA 1BBWA 3MXGA 1K3RA 4RG1A 4YWKA 3S1NB 1HFGA 3IXSA 4GIVA 3T8MA 3HOZG 3PCOB 2OOBB 1KXLA 5JJZA 1VQJA 4F7XA 3Q23A 1HUMA 3I7FA 4JI0L 5JJIA 3J7AV 1MHXA 1YJJA 4K3CA 2VQEQ 3W1SC 2DUDA 3DHQA 3BVZA 4ZRJA 1MJCA 4RHSA 3A7LA 1B9NA 1RJTA 4QIWE 1GG3A 2J7QB 4IPHA 1PLFA 2OT2A 1SIJA 5HFYA 2AQ3B 3R2IA 5GXGB 3V6CB 1PGXA 1XMQL 2GBJA 3T1YQ 1Z6HA 4NXML 2J53A 2QMTA 1HR0W 4A3DB 3LB8C 2PE6B 1JWSD 5FLXE 1N33L 4AJWA 3C46A 5IYCG 4EUTA 4GOCA 4TQ0A 1IL2A 3DVGX 2VB3X 5C2TB 3RN2A 3A9JB 2G45B 3A4SC 1GUGA 2R92B 3NWTA 2L1AA 4DK1A 4LF7L 3D4WA 1AZQA 4P75A 4BS9A 5JEAG 1C0AA 2OTLA 4DV1L 2WAQG 5CV5A 5JPMC 4B3MQ 1NE3A 4K2LA 1N36Q 3GTQB 3ABVB 1FD6A 1LT6D 1U4PA 3U4ZA 4BKSD 2MPMA 2FHTA 3V3XA 1EF5A 2LUMA 1WM3A 3RCZA 2BVCA 3BU2A 2R7ZG 1QOBA 4IWOA 1EY5A 2B63B 1V81A 1NR2A 3KLSA 1K83B 3L0OA 4FVMA 1ENAA 2Z6BA 4GS3A 5AFWA 5M5WH 2W3RA 3V61A 4LUOA 2KZRA 1KC8C 4KGSA 1VQ9A 4DBGA 2V1YA 1SE2A 1V49A 3TJPA 4ITKA 1FO4A 3U30A 1YIWA 2F03A 5CR3A 3MEHA 3TEHB 3HVZA 1LABA 2D3CA 1TWAB 4A93H 4AWJA 3AEGB 4PNYA 4X62Q 4XDXA 2IBIB 1FNWA 2KVZA 4DA2A 4KZ0A 3AU4A 1XNRQ 2F0WA 4RGOS 3KK7A 4L5RC 4ZHPA 3K58A 4EOYA 4IUMB 3O65B 2X6GA 3MC0B 3DUZA 1LT5D 4IOAA 1N32L 4A3OA 3FKIH 2B2WC 4A3GH 2AUJD 1VQPA 3GZNI 3RZDB 5IP9H 3AXCA 1FNUA 2DNEA 3M9BA 5K36G 4JI6L 1F1HA 1VDZA 2K5NA 1WF9A 2W9NA 4ZLTF 3I57A 4K7WA 4WH4A 3NS8A 3K5LA 2CKZB 4BY7H 4H2AA 2IWHA 2K5WA 2AWTA 3S9WA 1ZYRD 1P9DU 2BE5D 4HCPB 2XN9C 1IBKQ 4FLHA 4U673 4APVA 1PDQA 5FKAC 2KDBA 4YSXB 2VS1A 2UUCQ 1K28A 1XCQL 1LTLA 2BWFA 2IHEA 5C4XG 2JY6A 4GNXC 2D9UA 1A6XA 1LQBA 5FO9B 2JRIB 1D4BA 2N1VA 4DKAC 4R4IA 1NEKB 2KYWA 2ACZB 3CCSA 1E8YA 1SF0A 3K0YA 2KTFA 3GD7A 3CCEA 5M3MG 2B2TC 1HZCA 1EYGA 2EOTA 4HPMB 3B9JA 1X56A 4MACA 3Q8BA 4JBWA 2WU5B 3W1SA 3ZGZA 3EJIA 5I2XA 3NEMA 5E6PA 1MG8A 3TBIB 2XK5B 1WTWA 1G6JA 3K5MA 4RM9A 4IUUA 3DEPA 3JAME 4ID6A 4W9GA 1SNDA 2OCEA 4IM3A 5AZGA 2IHFA 2MW5A 3OSOA 5IKCM 3IBEA 4A8XC 4EZJA 4TVAB 5DAUA 2KOLA 2L7RA 1E6EB 4MM3B 3EVQA 4HKQA 4X64Q 3PQIA 1K52A 4P71A 4FN2A 3F1ZA 1TQOA 2BCOA 4GN4B 1G6ZA 4IPDA 3QO2A 4RHRA 3CXCA 2KX3A 1L4ZB 1GNUA 2B2YA 2MA9B 2JA6G 5BR8Q 4K8JA 1UELA 1H9KA 2RDGA 2LFIA 1UD7A 5CV9A 1EQQA 3AMUA 1RIPA 2B2UA 3D3RA 1SE3A 4JI5L 2JXTA 1K73C 2O6VB 3AE2B 2WXHA 3NZUA 4GN1A 1PFNA 3OW2A 3RZFA 2VUMB 1SN8A 4ZRIA 3NQIA 5G3LF 5J22A 2EYHA 1KABA 4DUZL 4GNXB 3ZJVA 4ZK9B 3ERSX 4JBKA 2HD5B 2ZJDA 2WWZA 4DFAA 1CI3M 2Z1CA 3NWSA 3QAQA 1NDDA 1KNAA 2CCZA 2KBNA 4Y7NB 3CCUA 3Q3JA 3ZNID 2XSCA 4LF9L 2UXCL 3ETRA 3VR6A 4R8IA 5L37A 2PPHA 2FINB 4J1MA 1BOSA 4B08A 4OWTB 1KQSA 1EZ6A 4XWTA 3GTPH 2BDOA 4DV6Q 4DV3Q 1EIFA 3AYHB 4JI7L 2E2JB 3HOUH 5C0XH 4YTMB 1F9SA 3Q2AC 3ULLA 5DLQE 3L16A 1ZKOA 3WANA 2A5HA 4L6TB 4DXAB 2NBWB 3MHZA 4LF8L 2NS5A 3D6CA 4R9WA 2PE9A 1JALA 5A35A 2KC1A 4A76A 3FEWX 3H0GG 1I4RA 2BH2A 3OIQA 4C1NI 5IIFA 4EVOA 1Z47A 2F0MA 3ZJTA 5DM63 1OXSC 1ZDVA 1PH9A 4YTNB 2FXQA 3IFDA 4XQNA 3ZRCA 3SHLA 1GXDC 1PZID 3HKZG 5ISRA 1CTMA 3GTJH 5DPWA 1YNJC 1EQTA 3VTVA 3DBRI 2XK5A 4WJWA 2NVYH 5KGUA 1E7VA 3CQZB 1CM9A 4FDBA 4A3FB 1WX8A 3NBIA 4ULLA 2WXPA 3VH4B 3RN9C 1L0VB 1P98A 3AB9A 4OONA 3DDCB 1Q10A 4MM3A 1Z9FA 4C4VB 1CT1D 4PZ8A 1HQMC 4HN7A 4LUVA 4EQNA 3S2HB 1Q1OA 3AE8B 3VRAB 1M90C 4CYEA 4FF3A 2LKVA 1J5EQ 4HXDA 4TMAB 1YJ9A 1VQNA 2O6VA 1FEHA 4WJPA 5DPSA 4LMQD 3ZTDA 2BB6A 3VQIA 2B2VC 2E5LL 4BKTA 4KY7A 3W2DA 2K04A 3DM1A 2DNFA 2HT1A 3S2DB 1XPUA 4GNXA 4DQOC 2A68D 2EPBA 1KDBA 1TWFH 4MH0E 1JC7A 4C3IB 3K7UC 1X3FA 1RYJA 3M4YA 4HSPA 3AFQA 4ME5A 2NR2A 3M3YH 4JL9A 2B2TA 1K3BC 1WD1A 2GBRA 2JQOA 2O2VB 4AIMA 2ZVOA 1UGMA 4XT1B 4GLXA 2A6HC 3OMCA 1T0RC 1LTAD 1WCMB 2JJQA 3OTOL 2V4IB 3U7DA 2Q5WD 1II3A 4XDCA 1TS5A 5E1FA 3P1MA 5EKLA 5LL6S 3AE1B 3NS1A 1YNNC 2HE7A 2JA5H 3HK0A 4A3JH 3J80i 1TIFA 4I7AA 1WJJA 3S15H 2Q8IB 2BB5A 3VA7A 2KO3A 2SAKA 3EECA 1UZXB 1Z2MA 3HS0C 1GAQB 3URYA 1A8VA 4LFBQ 3G48A 1TXYA 2Q2UA 1C48A 4IFDI 2DJFC 5JPNC 1HQRD 5M3FH 2DZIA 1GPXA 4KD3A 5IYDG 2HQLA 2GRIA 1V1PB 2WKDA 3BWUD 1ASYA 1L7YA 4G0NB 2K52A 4DV7L 1EY6A 3I63C 3S17H 1Y8OB 3PO2B 1HNZQ 4NAMA 2WKCA 4C4VA 3IAS1 3NY5A 4BY7G 1KDAA 2QW7A 1VQ8A 1NCVA 3DMUA 3PUWA 1Q5WB 4BAXA 1MD2D 4ARIA 4TUUA 3AQQA 3NTHA 2PMVA 2DZKA 3GOEA 4DU9A 1Q82C 5GAHC 3L54A 2OF1A 3ONSA 2NB0A 1EFWA 5FJ8H 2AMCB 4KY5A 2GN5A 1SMYD 5GAEC 3CMAA 5FO8B 1XYIA 1GUAB 1EF1A 1BVSA 1SYFA 3HEJA 4DK6C 2UUBL 1MPEA 1SSNA 2ZW0A 4IOCA 3J81E 2EYJA 2WU2B 3QHTA 3NUHB 4XC2A 1TY0A 4GOPB 4MSQB 1O7YA 4BBSB 1S1QB 2J0KA 1ISNA 1AP0A 5IGCA 2O2VA 3M3JA 3I4OA 1A3TA 2FNJB 1E8WA 3N32A 4KD4A 3K9OB 3TCAA 1AEXA 4AP4C 4JBMA 3WWVA 5DEHA 1K50A 3R66C 3W5VB 2ZCCA 4LW1A 4N8X1 2JA8H 3QC8B 3HOXH 3SD5A 3L7ZC 1G6PA 1VQMA 5EAYA 1OGWA 2K03A 3D8GA 4YWMA 1FRDA 2L55A 1ENFA 4IUQA 2F0FA 3RNUA 4HR7B 1JW9D 1WE6A 4KHPL 3G6JB 3PZ7A 5D7GA 1E0ZA 5IGEA 3ZDTA 3TL5A 1S40A 4FF4A 2HHHQ 1XTDA 2RHSB 1XQQA 2MP2B 1WJNA 3RMKC 5IY0A 4IJLA 1G291 1WGDA 4DR2L 4IM0A 3RNBC 1V1PA 2BA1A 2ENBA 1PXUA 1L0WA 1E9MA 2AUKA 4DR4Q 1QZEA 1DD2A 3BS1A 1UWVA 5C3JB 4A3EH 3ULPA 2XBBC 2D2QA 1NVID 4NJ6A 2NBUA 4PS7A 5C44G 1QVFA 3H7SA 2N4FA 4A20A 1TIID 4EEWA 3DBRB 3IT4B 1Q7YC 1EYAA 2K25A 1J6QA 2K4KA 1EM7A 2GB1A 1L4DB 2ZNVC 4EGVA 2H88B 1TKYA 4DGZA 4JGHB 2KCTA 2CFMA 3HOVG 3KUCB 1VMCA 2XEWA 3KQ4A 1IBLL 5HGTA 1V5TA 3UINB 3N9YC 1VCIA 5J2RA 1QKZA 1XNQQ 2X8XX 3U50C 3EC8A 4BOSC 4DAMA 4YTPB 4XTCS 2YV5A 1TS4A 3H09A 3TS2A 1WH3A 2O6VD 4HIKA 3VVWB 4D2KA 3KH0A 1X3EA 5LLIA 3AE7B 2NVTB 1X3GA 3HUIA 2F0EA 4GOPA 4E71A 3B1LX 3RZOH 3CF5A 2JYOA 2PNRC 4F8MA 1WTVA 4XGAB 1PTOB 3P2BA 2R7FA 5BO4B 4ANVA 2QCPX 2UUAL 4X6AH 4BVUC 1SYDA 4GDKB 5BMIA 1ZXHA 1JROA 1CKOA 1SIFA 1SGHA 2CWAA 5IOCA 2UXDL 2EXDA 1Q90A 3D6WA 4R8NA 4ZQ3A 3T53B 1FMAD 1L2NA 2L0CA 5ELCA 3Q8DA 1SYCA 2CKHB 1IL8A 1QQRA 4N9TA 4WJQA 1YIJA 5I6YA 2RPQA 3I70A 1JB3A 2WB1B 5EPLA 1KLGD 4IN3A 2PMZE 2KWCA 4RAUC 1WGGA 1W3SA 2JQRB 3M62B 2VH1A 1IYUA 1TWCH 5LMUQ 1CMXB 2WXFA 2YU9H 1EUVB 1IW7D 3KYDD 2MP2A 2C7NB 2L0TA 2R61A 3UE1A 2X6LA 2DY8A 3TREA 3MAQA 3ICEA 4O1NA 4O2DA 2ZNVB 1T3QA 4CDDC 1XT9B 2PW9A 2ZPYA 4JI3L 1STGA 5JJKA 4C3JB 5IYBG 4OO1G 1O7IA 2BYEA 2LMCB 3RNCC 1RF2D 3J80c 2LXKA 4AQYL 3TUOA 1ZEQX 4MSMB 1Y1WB 3CMEA 2F0HA 1VD2A 4RF1A 1F2RC 1N5WA 5CTRC 4OEMB 4FBJB 4HWIB 1H8CA 4A3IH 1IXRA 3ND8A 1B7YB 4REZA 1WTQA 2VY3A 1WGRA 2K8BA 2K8HA 3S24A 1EOVA 2EY5A 5ELNA 2F3VA 4OX9Q 2X38A 3KUDB 1S5DD 2CS4A 2KUMA 3HOZH 4AS1A 1WXVA 2BS2B 2YEPB 4M01A 3H94A 1IGCA 3CSTA 5KNBA 1ILPA 1IPGA 1P0RA 1MJDA 2GVAA 1EU3A 2R93B 3KUPA 1T5XD 4BFRA 1OTRB 2V1CC 4OXPA 1E7PB 1ZYRC 4IZ8A 3STBD 5C4HA 3M63B 2BE5C 3K7AH 5BN3A 2KD0A 4TQ1A 3P75A 4RA8A 4LJOB 4GDKA 1X54A 2LASA 2YTVA 4CDEC 5IYCH 2N9KA 2F0DA 1PUTA 4WWNA 3CAMA 5M3FG 3X3MA 4HSVA 1C4QA 1I5FA 1FJGL 3SVMA 1YNTE 1QE6A 2VQFL 2W54A 1KNEA 1EYCA 2O2LD 2RCFA 3HRZC 2N78A 4IUPA 4DR5Q 3GTMB 3PIP3 2DX5B 4FJVB 5ELDA 4F1SA 3BG3A 5JEAH 1SSOA 2R3ZA 4UP8A 3J7ZC 1EY9A 3M85A 3A54A 4LLGM 3HGBA 3N1YC 1YNJD 3DEOA 1E22A 5BYQA 1NR4A 1HR0Q 1WRDB 4LTUA 3CW2C 4DF7A 4EQPA 2HIXA 4LFAQ 1VQFA 2QEXA 5G5HA 1WTRA 2RMMA 1F2YA 2E2IH 4LAAA 4QF4A 2PZTA 4NXNL 3U9OA 3CU7A 4JI2L 1V86A 3S1RH 4WJ4A 4HEA1 2DY7A 4HCNB 4N59A 1Z5SB 4RKLA 3WAMA 1PFBA 3P4QB 4IW0A 3L4PA 3ZNZB 2RD0A 4ICUA 3DM3A 2NBVB 4ZRQA 4KLKA 5JVG3 2CHXA 1GKHA 2N9EB 1BBUA 1FR3A 1FL0A 2NBFA 4EFOA 1V9JA 1I7HA 2DYMA 3M4PA 2Y0SG 4CQNA 2SNMA 3FP9A 1XLQA 1B44D 4NAWB 2HCCA 4P74A 2AWNA 4GN5A 3CRLC 4XIGS 3SE0A 3IFWB 3OOCA 4ICVA 2ZXOA 4ZHOA 2JA8G 1NI3A 3RI7C 4M02A 3HOXG 4JI4Q 5EPJA 4K0KQ 2OXPA 2LWPA 1VQCA 2ZT9C 1OO9B 3RR5A 3K6OA 3T1YL 3UGBB 4S17A 1UE5A 2LS01 5CBEE 1UUPA 4DK3C 4M1UB 1L1OA 3CPFA 3I9V1 1IP9A 2SEBD 2L15A 4DNTB 3E9SA 3KWVA 1R4NI 2MJ8A 1EZ8A 2F0VA 4A75A 1RL2A 2EKEC 4C2MH 3I4NB 4LNKA 2EMTA 4KHVA 4B3ML 5C0XI 2DGYA 3EGRA 5CX3A 1N36L 3LDZE 1DOXA 4R4CA 1JWBD 1R4QB 1IBMQ 5EE3A 1EWIA 4IQZA 4UPAA 3TEWA 3TQYA 5C4XH 2D3GA 5J17A 3GTKB 3BVGA 4P16A 2AX5A 4IPCA 1OEYJ 4MGYE 2AYOB 2AWOA 1WXAA 3K80C 3ZLZA 1C9FA 3HFZB 4JG2A 3GTGB 4FF2A 4I6LB 3VR8B 3UDXA 4II3B 4AUQC 3VTWA 1SNQA 2D5DA 2A74C 3T1HQ 3BK1A 2A73B 2M17A 4PS3A 1EY7A 4BY1B 3BIID 4WORA 1PA6A 2R7DA 3C8YA 4A93B 1WXSA 4KJOA 3SDLC 2GBKA 3A0JA 4PMBA 4NAWA 2IO1B 1GUOA 1XWEA 4JYAQ 1ZDXA 4ZRZA 3B0AA 1SB3C 3VTUA 3CC2A 1JWMD 1QZGA 4DR6Q 1J0GA 2DWQA 1SYGA 3PVLA 1YMHE 3LGJA 5FLXc 2OWOA 2A68C 4Q0FA 1WX7A 1SNPA 2PQAB 4QB4A 1V1QA 1D5ZC 5LXHA 3FKIB 2C9WB 4KSKC 3OWEB 2JA6H 4A3GB 3SK4A 1S3OA 1FGUA 2HCIA 4O0AA 1JWAD 1WR1A 2V9HA 3DPDA 2JUOA 5L83A 3ENEA 5IT9E 3Q22A 4HJ8A 3TRZA 3ZRFA 1J7CA 2KNBA 2W82A 2ID0A 4DR7Q 1V8CA 3T9LA 1PTOD 5JAVA 2JA7H 1M8AA 2JX5A 3NHHA 4F8CB 1STYA 1IBKL 3PO0A 1TWHH 2LD9A 1SE9A 3BJUA 5A2QL 2PCFB 3Q3NC 2A19A 4GMVA 1L0XB 5DNFA 2BH8A 4Y52H 2Y5CA 2MBOA 3DCGA 3GS2A 2NMQA 3NK9A 4C3HG 3CHBD 1PH4A 1PTOF 4XZ4A 5H8YE 3TEXA 4MH8A 2NCNA 2K75A 3H0GH 4N9F4 3ONAB 1MI0A 3PGEA 1IYFA 3HG9A 4H0LC 2N8NA 2PW5A 4R4QA 1Y1VG 4RM8A 3O13A 4LF5L 1U0LA 3J7AF 5LMNW 3P4SB 2UXBQ 2KMMA 1XJVA 5AJ3Q 2MQHA 4JOIA 1DM0B 2YTYA 1ZGUB 5C3EG 1KHIA 2VZKB 1E2ZA 4JPSA 4UY8C 1VMPA 4XYQA 3PREA 4G3XB 4AJYB 1UAPA 5CC4A 1HRJA 3H9DA 1WYGA 3MP9A 4RFBA 2ZJQA 1XCTL 1FM0D 1XF5L 2K50A 1DJRD 5I9PA 1WX9A 2C35B 4X64L 2L83A 3VAWA 2B2YC 2XRSD 5M5YB 1SMYC 2G9HD 2PQAA 2DAJA 2F52A 4MNOA 2WX0A 2B2UC 1EIYB 5KIXA 5BN4A 1VQHA 1PH5A 2MP1A 4NB3A 2N7JA 1RHPA 3J81j 1JE4A 2IY5B 2JWUA 5BN5A 4JWSC 2L12A 3RULA 4CKEA 3AEVA 4S0RA 1G2SA 3PS6A 4QAYA 2CW0D 4A3BB 4K1RB 1LACA 2MCNB 1WTPA 5IGBA 3K5NA 3AE6B 1SBBB 5FLMG 4QCLA 4X3SA 2X69A 4IOIE 1EWCA 2N9LA 2LHEA 4AYBG 1O80A 2BS4B 2R6GA 1VQDA 3PZDA 3NHEB 3GTPB 3APFA 4YCVA 4JI1L 2UWQA 5C23A 3U52E 1KLVA 4UAIA 3HOUB 4HCEA 3APDA 1B3AA 2F0KA 3PPAA 3WALA 1L2FA 2I2YA 1J19A 3D32A 4P7IA 1WJ6A 2D2CC 2P5ZX 3E0EA 4HK2A 2Z59B 2N3SA 3NG0A 5BMGA 5AEKB 4E3CA 2K6QA 2LSSA 2F4VL 4WAFA 4DAVA 2H89B 1M4VA 1AZPA 2PVGC 2VZAA 1VQLA 3SXHA 1T0QC 4HVBA 2GI9A 3ERQA 1WGHA 3AE3B 3GTJB 4M00A 2G3QB 4BBRG 3UQBA 1ML0D 4LF4Q 5HHDG 1TS3A 1R4PB 1EEFD 2PI2A 3CCVA 2QDBA 5IYDH 2NVYB 1OQQA 1XXGA 2A69C 1BF4A 2WDTB 4CJ1B 2QC8A 1QOGA 4NMZA 3HOWH 1B53A 2ALYB 4YCUA 3ZJUA 1BR9A 1LTTD 1QILA 4DV2Q 2K3UA 1FGBD 4FP5D 2KDEB 2RVLA 1J5EL 4A90A 3QCAA 3ZNHB 2B29A 4M0WB 1MHWC 4MZ9A 1AARA 1TVXA 3MFYA 1MG4A 1Y8PB 3KDFB 1PFDA 3NXWA 1PH7A 2KFJA 3UQAA 2UU7A 3UDIA 1TU2B 3NENA 1LFDA 4YY3Q 3AB5A 3HRDD 3ULJA 1TWFB 4S3SA 1VQ5A 2JYTA 3PHXB 2MHVA 4DHZE 4FYDA 4KK7A 3I5JC 2FJ2A 1PYSB 2KQ4X 2PI2E 3P1HA 1XD3B 1EY0A 3M3YB 2K05A 1RFKA 3TDQA 3AEFB 2PTLA 4W9HA 1VQ4A 4XQQA 3E56A 2EYOA 1HJPA 4PMCA 1R9TB 1TY2A 3D0FA 3RD4A 3I4MG 1E7UA 2WV6D 4JCVE 2F0UA 4POGA 2J0TD 1IW7C 4ACFA 3IT6B 2C5CA 3D4RA 2L0FA 2JA5B 3NZSA 4A3JB 3C3LA 4ASWC 2SOBA 1IKLA 3FKYA 3CRKC 3S15B 3M4OB 1QNUA 1B4OA 1N62A 1ZE3D 2BDNA 2BBCA 2M4NA 3P4RB 3PV0A 1GB1A 3DWGC 2RF4A 3VYUA 2M0AA 2I5LX 4LFBL 1TT5B 3KFUA 5AUIA 1QUQB 3BDLA 3TP8A 4GZYC 4G57A 3PLUA 1R7SA 5D2MB 2EXZA 4ZYSA 1ONLA 4XE0A 3GP7A 2D11A 3WAOA 1H9RA 2Y5PA 3H3VH 2LY7A 1HNXL 3DLLA 2Z0DB 1C4PA 1RRBA 4NXMQ 1P7FA 1HNZL 4A3DH 3V60A 5C44H 3MEFA 3SEBA 2JA7G 2F0JA 3F8TA 4JPBW 3G4SA 3PO3B 1FNVA 3MXPA 2EYLA 4EQOA 1VJKA 4MJSB 1CA5A 4DV4Q 1EYDA 2JEAI 2ZVNA 2HDMA 4M0WA 3HOVH 3HHMA 3TMPB 4DDGD 3JC66 2INPE 1IHZA 5EE1A 1UEAB 3KDFA 2AHOB 3STBC 4L2YA 1K0RA 1V6EA 4DV1Q 3ER0A 1XLOA 4P1BC 1P16A 3I8ZA 2L8JA 4YWGG 4B6WA 4LJZC 2Y3AA 3HM6X 3NRZA 4TSSA 2WP8J 5HY6A 1LTBD 2B8FA 3C2PA 1ROEA 3L13A 4HJKA 1SE8A 1SJED 1HZ6A 3Q6SA 1M1KC 4OIKA 1WRIA 1VQGA 3QWZB 3NVVA 4DAYA 2ZZPB 3AEBB 1J7BA 1MKHA 3DWPA 1YQBA 2KWUB 4PYZA 4ZKBB 2M00A 2KJ6A 4K5WA 4EX5A 3PSEB 4R4OA 1JOQA 3X0WA 5KYLA 2WP9B 4YL8A 2LRUA 3QG1A 1XPOA 1NMFA 4KKTA 2WGSA 4HIMA 4M8MA 4O42A 5L95C 2FUG1 2RQXA 4H7BA 3B08A 1TWAH 2WXLA 1B8AA 4OWWB 2NVUI 3E9HA 4HJAA 3AU5A 1B50A 2IL8A 1QOHA 5CV4A 1RM6C 2E74C 1JQ4A 1QUQA 3M4QA 2LVPA 2MO1A 1KRTA 1GJZA 2QSDA 5C5LA 1KTKA 2FIFA 3B2GA 1DGJA 2NZ1D 3F2BA 3GTLH 4A3KB 4DR4L 4IM2A 1GVPA 4X66L 2WXMA 2BW2A 4OO1H 5IYBH 1ET9A 1N32Q 4A3EB 3G7LA 2M2LA 2WXKA 4LNOA 3QARA 5I2YA 1U4LA 3HOYG 2VZKD 4JI8L 4JW0A 1I94L 3J7A5 3GZNB 1M94A 2K28A 4JI6Q 1GUSA 1ENCA 2M56B 1PYBA 4MJSA 1CZPA 1E2WA 4HPPA 3N3KB 4NPSA 3RLNA 4DXFA 2KWDA 2QEJC 2HJ8A 4PK1A 1XNQL 3J81c 4K2KA 1YI2A 3T16A 3ZUNA 3A5ZB 5KNDA 1YHQA 2G4DB 2FBWB 3MC8A 3Q3OC 4A4IA 4YSZB 2IPKD 1IYVA 1LM8B 4LCDE 3FVQA 4GOPC 4K5VA 1CQFA 2AQ1B 3PIPA 1QOAA 5IT9L 1I3QH 4CO7A 5C5MA 1C1YB 5IGDA 1EO6A 3AN1A 2A6EC 4GKKL 2IY0B 2ZTCA 2QDLA 4DXGA 4HIOA 3S1QH 3S14H 1AFPA 2D10A 1J8CA 2DYOA 2BQQA 2HDEA 4OHJA 5H92C 1A15A 4KKJA 1JORA 3NVWA 5LL6X 3UF8A 3P20A 3K59A 4P1CC 2CU3A 2PW7A 5E4XA 1JMCA 2IDYA 4UHVA 1BXTA 2KT7A 2F0GA 3EHVA 4B3SQ 1TWGH 4FXGC 3HOWG 1TYGB 5AZHA 4HTHA 4N9PA 1GUWA 3SFEB 4NY0A 4JV5L 2HTME 3APCA 4KSLC 4WWOA 2KMCA 3H15A 2CWPA 1JJCB 1TWCB 4YHHL 1WI5A 4A3MB 1V5OA 1RODA 4KI0A 2HDLA 2F0PA 5IWAQ 2BYVE 3NUCA 1WE7A 5EGTA 4KN7C 1G51A 2PMZB 3CCQA 2CU1A 1WFYA 4A3CG 1XLPA 2I0QA 1FVIA 3CC7A 1PH1A 1C9OA 3GV6A 3ITPA 1NY4A 1LGRA 2NVXH 2H5XA 5EQ0A 4JI5Q 4A3IB 3PF4A 1YD8U 2VUMH 3N1XC 4JQWC 3B6YA 3TBLD 2DHZA 1ILQA 2RSOA 1YN3A 5C4JB 3FC4A 4ZOHC 4DUZQ 4N8FA 1RAXA 3FMCA 1STNA 4OX9L 2K39A 1WVLA 3MFGA 3DXJC 4CKCA 2NN6H 4ZDVA 4F87A 3HOZB 3ZXVA 2RHQB 1T0SC 2N7EA 1V8QA 5HGQA 4RKBA 4K8IA 2UXCQ 1HCZA 4OVZA 5NUCA 4LWCA 1HA5A 5A2QE 1LTID 2PLPA 2E2JH 2IZVB 1EQRA 2ZTDA 1X3QA 3Q69A 3TEZA 4KMUC 1SROA 1PTOC 2ICIA 1PFMA 4PZ7A 2KX0A 4PT5A 2DBYA 3MJWA 3N20C 3U4EG 1CKMA 3DBHI 2HUGA 1ZKHA 5JJLA 2Q2HA 4TQUS 1IBXA 2D0OA 4I65A 3E6ZX 1P3QU 1D6EC 3DBLI 2C7HA 1G2TA 1PGBA 1F9RA 2OHFA 4GLVB 4WQOB 3K57A 1N63A 2M1MA 4A55A 2VL6A 2QKIC 4A3DG 2KFKA 2L11A 2WAQB 1EOTA 2RA4A 3CQZH 2MX2A 3KYHC 3I3CA 3VXWA 3KLWA 4IALA 3VDZA 2H1EA 2Z0SA 2ZM6L 4LFAL 1F9PA 3PHWB 2A69D 3S2HH 2O5JC 1VLBA 1GO3E 2R92G 1I4PA 2DAFA 5CV7A 1HH2P 2E2IB 3H91A 1G91A 2DJGC 1HPCA 2R7ZB 3W3AA 3OG5A 1A3UA 3DVGY 3MJ5A 2E2HB 1HNWQ 1NJIC 2FAZA 3WIMA 2I5HA 1F52A 1WWTA 4LFCQ 1MHHE 4P72A 4GB9A 1HTLD 5ELOA 1H9SB 4KKSA 3PRPB 3VUYA 3QA8A 4L5QA 4J3OD 1PH6A 2WXIA 3ZNGC 4ZCKA 3S1MH 1GC6A 3OJ3A 5LXIB 1STBA 1I50B 2B63G 2LHDA 4HJ9A 4KDLB 1AN8A 3IHPC 2F0OA 2Z4HA 5FR3A 1D3ZA 1B9MA 1WMHB 3QR8A 3SDZA 3U8ZA 3U2SC 2Z4IA 4DV5Q 1LYLA 1WCMH 3QJYA 4EQ5A 4JI4L 2EVBA 3VYSA 4K0KL 1FXAA 4K7UA 4B9KA 1MBYA 2WXGA 2CW0C 1CSQA 5FO7B 4HPLB 4L8JA 2JVCA 1EY8A 1SDFA 1WXQA 1L1OC 1B1ZA 1D8LA 5IN7A 3BZCA 4ANXA 4WJ3M 4RGMA 4ME3A 1S5CD 4K5XA 4ZUIA 5IP7H 1SFOB 1VZ6A 5JH5C 2NYZD 3HM3A 4DK5A 5DPTA 2H4OA 3K0XA 1S5ED 2V3SA 4JE3B 1U5KA 1C79A 1XLNA 1N34Q 2MBEA 2MEKA 1UBIA 1H95A 1I42A 1NUCA 1IBML 2BPSA 3OPOA 5E4WC 1HZAA 1YQ3B 2F4IA 1TKWB 1YHAA 4MHEA 1FFUA 1YQ4B 2RKSA 1E10A 5D94A 3IG3A 5C4XB 1PH2A 3PO2H 2HIVA 3JW0X 1NYQA 3AFPA 1C76A 1WYWB 2MHJA 2IGDA 1DOMA 1GD7A 1D1IA 4C3HH 1TBEA 2EQSA 2RSNA 2INCC 2CR5A 2K5PA 1X9NA 5M3MB 4DR3L 2L52A 2DENB 4OGQC 1PYWD 2BT6A 3VRBB 1YJIA 3AULA 1LTSD 3T1HL 4NQLB 1Y1VH 1H9SA 1WFQA 2EYPA 2A5UA 4I6PA 1DOYA 2F0IA 4OIJA 2ASBA 3U7ZA 2CQOA 1K8GA 3DBSA 3WA0A 5EPKA 1I4GA 4US8A 4CBVA 2KHIA 5C3EH 1QT9A 1XEEA 1JCKB 3U9SA 1TKEA 1XO3A 1KL9A 2B76B 1OTCA 1WMHA 2XNAC 1I6HB 3ZIMA 1L1OB 3KF8A 3M7GA 2WAQE 1AE3A 4BBSH 4Q5VA 4RCOA 4KHZA 3PUVA 2K7VA 1UH6A 1FD7D 1MI2A 3PIO3 1SXTA 1STHA 2KCMA 2CVRA 3CP0A 5DM73 1J7AA 2QIEB 2ZPNA 3PRMB 1PDXA 4XX5A 4DWFA 2F1MA 4B95A 2EMSA 3DVNU 2ZXRA 1WR6E 1QB5D 2KQ3A 5LMNQ 2JA6B 1I35A 4GKJL 3AH7A 4DR1Q 2J52A 2JXMB 1BUIC 1QNKA 1MFWA 3D4DA 1JOKA 1VQ6A 5CMDA 1QLBB 2O5IC 1HE8A 2BF8B 2QCZA 3TP5A 4A3LH 2JN4A 4BWGB 2INNE 3HIZA 3KWLA 4LNFA 3IL8A 4PQXA 3DBHB 3WOFA 3PLVA 3T56B 3IRBA 3CSFA 2KJRA 2PO4A 2KKCA 1HTPA 5FLMH 4DR2Q 2XWJB 4J8QA 4Z9CB 2NVQB 1FPYA 3JSVB 4RCNA 4B3TL 3UDFA 2CH4A 2VUMG 3PZ8A 3R8BA 3IAM1 4OVUA 1JMLA 3I73A 4IPGA 1SYEA 3NVZA 1S5FD 2IW3A 3E3XA 4YXDB 2KANA 1JWUD 2NN6G 1JRUA 4A6QA 1D5XC 1ET6A 2OEDA 3OWFA 3OJ4B 4CKBA 3QIJA 2VQEL 2F3WA 4XQJA 3H0GB 3RLOA 2JEBI 4HMJA 4X3UA 1EIHA 1W2BA 4X65Q 3ZKJC 1K0SA 3VFKA 2F0NA 3H3VI 3GE8C 1I4QA 4JOIC 4NP5A 2UXBL 2D3AA 3T13A 2JWZA 3HKZB 4RNAA 3NQTA 4BBRH 2FIDA 3D31A 4DPGA 2LGXA 2V4LA 2IT1A 4GLSC 2HTHA 4AOFA 1BUVT 3RUZA 4M8NA 2FCQA 1UE6A 4LUZA 2NVTH 2N7DA 3NPPA 4OWXB 2WDQB 1K9MC 2I38A 5IAAC 4QQBX 3NE5B 2K01A 1TGZB 1YNXA 4MN3A 2PNHA 2RDHA 4IURA 4K81A 2Z6KC 4GXBA 2UUAQ 1QF6A 2LGIA 3RNFC 5JVH3 3FAHA 1E1OA 2A6ED 3NP8A 4DV0Q 1ZXTA 1N8RC 1E90A 3AE9B 2KMAA 2E2DC 2MNAA 4KVGB 2AL6A 2KDFB 2PPBC 3U4VA 4A3FG 4BKSA 1OQRA 2F3IA 3JAMi 1AE2A 3OIPA 4PZ6A 4LF6Q 2WXQA 3HVDA 3VR4A 4WRDA 4B3RQ 1I4XA 1QG7A 3FPUB 2HD3A 5IODA 1VQKA 1ZP0B 3RFZB 2MGSA 4GLAC 1RFAA 2YVCA 3WOEA 1HZ5A 1PQSA 4QUFA 3QQ8B 1KD1C 1KLUD 2CJNA 2GLSA 4HJ5A 1VQAA 2IX1A 2TSSA 4KGRA 2JU6X 1XMOQ 3S16H 1Y8NB 3Q8CA 3JSVA 4R3DA 5M5WB 4C3JH 1LXDA 1QVCA 4JI3Q 2L5TA 4HRSA 5CV6A 2FE8A 1WGYA 4U68A 2L3ZA 3V05A 1N9WA 3TP6A 4XXEA 4ZRKA 5CGKA 1PMRA 3I4MH 3T51B 2L00B 1JJGA 4C3IG 4BBNC 4X62L 1XNRL 4RMAA 3HZXA 1K8RB 2WHIA 4BXXG 4P73A 1A70A 3FRPB 4BOZB 5JOBA 1AWDA 2A1AA 3Q8EA 1WCMG 5C6AA 3GQBA 4OO1I 4W9CA 3ZXRA 2NZOA 1VQEA 3N52A 1GJXA 3A33B 1YBYA 3LWEA 2MO0A 1VF5C 4WJOA 1KH0A 1F2MA 1WTOA 1ESFA 2ASQA 1RTNA 2QGQA 5M5XH 4FXDA 5IP7G 3Q14C 1NYRA 4M8AA 5KEEA 1GOZA 3NJTA 4W9IA 2RDBC 1J9OA 2V4DA 2RPVA 1CHPD 1PH8A 1D7QA 3GTOH 4AQ7A 3A74A 4BY7B 5E6JA 1JICA 4ANUA 2A4ZA 2KQSA 4L1BA 1XX8A 4JVZA 1IZ6A 2EE1A 3KOJA 1GC7A 3DWAA 4G4KA 1GUNA 4PV1C 1GM5A 1NBFC 3AM9A 4JLCA 4MGIE 4MGZE 4OZAA 4WIPA 1CJEA 1FJGQ 3PTFC 4K7SA 1H9MA 3KBXA 1DCZA 3H6MA 2UUCL 1YZ6A 3L0WB 3GTMH 3LXFA 1YX6B 1HFNA 2C5LC 1LT3D 1Y56A 2LI5A 2JSVX 3PO2G 3SK5A 3RNEC 4HIDA 2WDVB 4KKUA 3EFUA 3J7YW 1ZW7A 3L17A 1BQQT 2C7MB 3RNGC 3ECIA 4MELA 1HXYD 5LHY1 4W9FA 2EDGA 3V6EB 2QF7A 3HKZE 3PF5A 1VQIA 3W1BA 3C0RB 4II2B 4US9A 3P7JA 3RLFA 2FMCA 1T0YA 4DNIA 4JI2Q 4NXNQ 4IFDJ 5JHBA 2PZUA 2WX1A 3EIVA 4J15A 2JT4B 3I2ZA 2D0PA 2NPTA 5G5GA 1B3QA 2PQEA 1LM0A 4DHZB 1ZXIA 1O7LA 1WY8A 1Q0WB 4DN4M 4JWUC 1F2LA 5EBCA 1ZOYB 3ML9A 3VDYA 1T9HA 1VQ7A 2LXAA 4BBSG 5D6JB 2WNMA 4NW2A 3MVVA 2DLBA 2M0XA 1V97A 2WXNA 4X3TA 3K5OA 3I3TB 4JC0A 3NSWA 3S2AA 1LTGD 5CV8A 4FO2A 2Z6KA 2ZJPA 3VR2A 3PUZA 1VS0A 1WM2A 5BR8L 1ESRA 1KRHA 1ZUD2 2GMIC 3V2TA 2B39A 3OHXC 2ONQA 4G50A 5I4DA 4ZYNA 4L5SA 5IGFA 3AI5A 3UIOB 2MUYA 3R3OA 4A3LG 4C56C 2EJMA 5C44B 3LYYA 3LNNA 1PGAA 2NN6I 3HOYH 3CF6E 1DONA 2AL3A 1C4AA 3NZ3A 3ZVVA 3V62A 4DV4L 2KLGA 3A1QB 3KW5B 2B3GA 1T6BX 1HUNA 2YEPF 3HOVB 4G7HC 1SNCA 2INDC 4N6EB 1HZ9A 3I4NH 2IO0B 1SE4A 1R4NB 2K14A 4B9XA 1RLFA 2N1WA 4CHKA 3UI3A 4DV6L 1SR3A 2EJFC 2EYMA 4DV3L 1UWMA 1FIQA 5FK9C 1VQOA 1R4MI 2MJEA 1VQBA 4IC7B 3GTKH 1RWSA 1N60A 4RWSC 3A4RA 3ZTCA 1H4RA 3VR9B 5COYA 2BOSA 3PUYA 3GTGH 1CHQD 4L23A 2KHWB 2LGSA 4HDQA 2YYZA 1F0ZA 4HCSA 3TEYA 2EY6A 4ARCA 4X57B 4XDDA 4IG7B 3AU7A 3TSSA 3JAMc 4B9WA 4RGTA 2LZ6A 2WXJA 2EJGC 3CD6A 4R1JA 1DOIA 4UDUC 2IO3B 3PV1A 4RH6A 4UP7A 5D3DA 3W5UB 1Q46A 5D65A 4F88A 3J81i 1YHBA 4PG3A 4BY1H 4XYCA 2IX0A 2KDIA 2Z9HA 1K51A 3Q24A 3ZYYX 3GB1A 3EUB2 2JZZA 3Q3FA 3T4AC 2G1EA 1UE1A 2UYZB 3GV3A 3QIAA 1VF7A 3I4LA 1JB7A 3GE3C 2OQ0A 3I90A 1QVGA 1CKNB 3Q8AA 3TZDA 4IO9A 4LNQA 3EROA 1C4CA 2KN4A 3GTLB 1TS2A 3P42A 4FJYA 2WXRA 1L5PA 4V0BA 1BNZA 5E6NA 4XWWA 2DYBA 3L3OC 2WB1G 2MRPA 2WIIB 3KLSX 4A3CH 4TRDA 4OW0A 5GMVA 1TZ1A 2SNSA 1V2YA 3BYYB 3M95A 4DDID 1KAWA 1PV4A 5EE0A 3A1QA 2OJRA 1MIUA 5C3WA 3PMFA 4FXKC 2M8SA 3UI2A 2KAJA 2UU9Q 2Z8LA 3A9JA 3QJZA 3AMZA 5EE9A 4QUCA 3VYTA 4C3JG 1EL0A 2QHOA 3MXUA 2OQKA 1Q1EA 3ZW3A 3V96A 4DAYB 1Y1WG 2JSOA 4DUYQ 4IFDG 4YSYB 4NNJB 2WACA 5ELEA 4YWLA 4KX6B 1KIXA 2KHJA 2K5VA 2RR9A 1Q3LA 2BA0A 1EEID 1SEBD 2KJXA 1I3QB 5BMHA 1DYQA 2CHWA 2KEEA 3S1NH 2SDFA 3EFCA 3S1QB 3S14B 1KM7A 1X32A 1VZ8A 3L2PA 1O7ZA 4JI0Q 1HTQA 1C8CA 2LGDA 1BO0A 3FDTA 2K9XA 3BINA 4FHJA 5AUKA 4Q2JA 2DZJA 1NI2A 5M3FB 2E3TA 2R93G 2LRWA 4LF5Q 4P2CB 2WXOA 2G5DA 1E24A 2KVMA 1CA6A 3KYCD 4B3SL 3G71A 1XMQQ 1RCVD 4HLEA 5HKHA 2NZHA 1TWGB 3F2DA 1E7ZA 4ALPA 3MHSD 3S17B 3RZWC 3DOWA 1WZ0A 3JVZX 3SR1A 1JRPA 2FCSA 5G3LD 4NPNA 2HQEA 1YJNA 2M9VA 1N33Q 1CKNA 1I6VC 1QJOA 3J80L 2L76A 3UIPB 3TZUA 5IWAL 3TS0A 4IDIA 2KTRB 4JBJA 2BWES 5G55A 5C4ZA 2FUHB 2R92H 4IWPA 5M5YH 2I46A 4CJ2C 1KDCA 2FFKB 1TKGA 1UEBA 5IA7A 4LF7Q 3GTQH 2V3PA 2K5DA 3BY4B 1W6JA 3X23A 4DK0A 2NVXB 3ZJYC 1HHVA 3W5OA 1U4AA 2KVRA 3BK2A 2LJIA 3AE4B 1BBXC 1AYFA
chains in the Genus database with same CATH topology
3VR5A 2VNUD 3F2UA 4N58A 1FCCC 2Y0SB 1T5EA 4WQMA 3PUXA 5TSSA 3FPPA 5I9OA 3DWQA 1XTCD 1RDPD 3AV8A 1I4HA 4YIJA 2JA8B 1CFMA 3HOXB 3QWNA 3OW7A 1WSPA 3IFTA 1WGKA 2QJLA 2NTTA 2D5GA 4E6IA 5EBDA 1EQVA 3VR3A 1UGJA 4H44C 3WCQA 3AEDB 5ELBA 1ZPSA 1S4ZA 1DOKA 2VB2X 1K8MA 2QILA 1Z7TA 1GHJA 4BA1I 4XYOA 1UNSA 2Q8RE 4ABNA 2NTSA 4WFN3 2CJOA 2B2WA 3IKJA 1TZOA 1N61A 4JX1C 2JYEA 3A8IE 5CORA 3EA6A 3X3NA 2XWBB 1KAAA 5LNK1 3AECB 1LLRD 2K32A 4IUTA 4HKZE 3EQLC 2E76C 1KFYB 2TMPA 2KACA 5JXVA 2F0LA 4HEDA 2Q8TA 1GHKA 3C1FA 3S1MB 3RZOB 1QCBD 1CQVA 1BCPC 1JR0D 3TN2A 3T3OA 3BZDB 1WD0A 5HG2A 1Q1BA 1UWXA 1IBXB 2N0SB 4GDLB 5C0XJ 2EYFA 3IAYA 3QOJA 2K33A 1O78A 1S5BD 3NVYA 4B0EA 5J39A 4ZRPA 1L6UA 2YU9B 1PZJD 1CZGA 1HEZE 2K1BA 2PKOA 3Q0AA 3A8JE 1YN5A 3EFXD 4JK1C 5FOBB 4KGTA 3BDOA 5ELFA 2LEKA 3KLRA 1F9QA 4ODGA 3GO5A 3VYRA 3AEEB 1DZ1A 4G7OC 1FCLA 1H9JA 4NDXA 4C3HB 3AEAB 4PMWA 3B2FA 1KF6B 1U4MA 5EKKA 1D5MC 2KEDA 4ZAIA 1Y69U 4KKIA 4FXCA 1BCPB 3M7NA 1Y1VB 2L9HA 5J1ZA 1PRTC 1DXMA 1TJEA 4ILWA 5C3EB 1MSHA 3K7AB 4HMIA 5FLXL 4FF1A 5BYRA 2MH7A 3H8HA 1F2ZA 2WLBA 2V3NA 1LTRD 5HI1A 3P63A 1STAA 2JP1A 3I91A 4V190 3P4PB 4B0MA 4DNRB 2W55A 5CBAE 1IKMA 4OZBA 2EY1A 1F2RI 2K5QA 1EWHA 5M9OA 4ZUJA 2L4NA 3MZ5A 1W6KA 4J6HA 5CYUA 3VA5A 1IUEA 4EE2A 3A55A 1OXXK 1SAPA 3MTSA 3S1RB 2ZXPA 4AYBB 2E75C 1VR9A 1E2VA 1HA6A 3CIRB 2B2VA 4LK1C 2RBMA 1AW7A 1FYCA 3BVMA 5E3FA 3N6RA 2WS3B 2F0TA 3BDCA 2IJ0A 5HURA 1PRTB 1PZKD 3AE5B 4A9AA 2IX3A 2EKIA 3NTKA 4P6VF 1OXVA 4L63B 4C7YA 3ZQ4A 3SR6A 4I7ZC 5C3XA 5C0XG 4KY6A 1K8OA 4BBRB 3R93A 3SK6A 1JOOA 4BA2I 2CQAA 1MSGA 3MWYW 1G8ZD 4CJ0B 2KHSA 1ICWA 4G7ZC 1QWYA 1SNMA 4C2MB 4KJNA 3HP3A 4NKLA 5F2DA 1X3PA 2J7ZA 4HAEA 1Q8IA 1J8IA 4OZCA 2GA4B 2D62A 2E6XA 1DOLA 3RPFC 2VXWA 3QOLA 2PZWA 4HJGE 2CHBD 3S16B 5BYSA 2F0SA 2PVOD 2K6AA 1NSNS 1NAPA 2J4XA 4IUVA 1P7EA 2KA7A 3DWMA 4RF0A 1MGSA 3I4MB 1OFFA 4RGNA 4K6DA 1GB4A 4QMGA 3JAML 4CGYB 3NBHA 2IGGA 5KNCA 3RMHA 5KYIA 1BDOA 3MA2B 2K0PA 2PYKA 2EZVA 2KECA 3OMGA 1RD9D 2N88A 1F77A 3C1EA 4IKGA 2WDRB 2O4XA 1U4RA 2NUCA 5M5XB 4TKOB 1VZ7A 1FRRA 3BYTB 3WDNA 3GTOB 3A56A 1A2UA 4KV6A 2JA7B 2BYTA 1LV9A 5K5PA 3MXNA 4KTAA 1TWHB 1L6VA 2BS3B 1A3VA 1E0BA 3TP7A 5KRUA 1MVKA 1YN4A 3QB3A 1D2BA 2DNCA 4KN4C 2DN8A 1EFID 4OL7A 2EY2A 3E5SA 4K14A 1U9RA 1BMLC 5D3IB 3J80E 3A8KE 1SNOA 1V1OA 2K22A 2ZW1A 1D1KA 2L32A 4HROA 1VRAB 2LMCA 3CWIA 4YT0B 4MT5A 1TR5A 1ACCA 2XIWA 3T3NA 2FMMA 4WWMA 1RKNA 3SK8A 1FFVA 2L1BA 4C7ZA 1EIGA 1PTOH 2G9DA 5T1IA 2KCCA 5EKIA 1EWYC 2M19A 3Q8FA 2XVSA 1BCPD 2F0QA 3KBGA 5D14A 5EJWA 1LO5D 1B2TA 4MIUA 3L9AX 2XRQD 3R2TA 2A6HD 2KCNA 3LWUA 3ND9A 3HOYB 4QIWB 5K36H 1YNND 2ICEC 4FNFA 2EELA 2JZPA 2MJ3A 3SFDB 4WURA 5JEAJ 1BCPF 3J9CA 4IFDH 2W3SA 2OEOA 3FILB 2ON8A 2WQYB 3A7AB 2IGHA 4CHTB 1SJHD 2MJDA 4XT3B 3E0JA 4NZLB 1K53A 2LFNA 1N5XA 4NJCA 4ZKCB 1B9RA 1Q12A 3MHBA 2WINB 2KDMA 2PIAA 1FXIA 2AQ2B 2RDFA 3LX0A 1STEA 3HOWB 5T8IA 2C9OA 1PRTD 4LK0M 1VDVA 1C77A 1L0YB 1CZWA 4K6LA 4DAPA 3W9CB 3H3VC 4C80A 4X3KA 1EY4A 1TT2A 4H13C 2V0GA 3NTIA 1EU4A 4USAA 5IGGA 2I07B 2N55A 4C1NK 1WTXA 1QOFA 1LT4D 1OXTA 1SYBA 3J81L 1V43A 2JE6I 5T1GA 5I6WA 3CKIB 1PRTF 1C78A 2NWGA 1OXUA 3I72A 2BTEA 1JQYD 1IGDA 1NENB 1A2TA 2J42A 2B8GA 4IUNA 1GUTA 3TMEA 5MPOA 1RTOA 1CK1A 3FILA 3MXGA 3S1NB 1HFGA 3IXSA 5JJZA 4F7XA 3Q23A 1HUMA 3J7AV 1MHXA 1YJJA 3DHQA 3BVZA 4RHSA 3A7LA 1B9NA 1RJTA 1SIJA 1PLFA 2OT2A 2AQ3B 3R2IA 5GXGB 1PGXA 1Z6HA 2J53A 2QMTA 4A3DB 3LB8C 1JWSD 5FLXE 3C46A 4TQ0A 2VB3X 5C2TB 1GUGA 2R92B 3NWTA 2L1AA 4DK1A 3D4WA 1AZQA 4BS9A 5JEAG 2KAJA 3GTQB 5CV5A 5JPMC 1FD6A 4K2LA 3ABVB 1LT6D 1U4PA 2MPMA 2FHTA 3V3XA 2LUMA 1QOBA 1EY5A 2B63B 1NR2A 3KLSA 1K83B 4FVMA 1ENAA 5AFWA 2W3RA 4KGSA 1SE2A 4ITKA 1FO4A 2F03A 5CR3A 3MEHA 3HVZA 1LABA 1TWAB 3AEGB 4PNYA 4XDXA 1FNWA 4DA2A 2F0WA 4RGOS 3KK7A 4ZHPA 3K58A 2X6GA 3MC0B 3DUZA 1LT5D 2B2WC 2AUJD 3RZDB 1FNUA 2DNEA 5K36G 1VDZA 3I57A 4ZLTF 4WH4A 3K5LA 4H2AA 2IWHA 2K5WA 3S9WA 1ZYRD 2BE5D 2XN9C 4U673 1PDQA 5FKAC 4YSXB 1XCQL 2D9UA 1A6XA 5FO9B 1D4BA 1NEKB 2ACZB 1SF0A 3K0YA 3GD7A 2B2TC 2EOTA 3B9JA 4MACA 3Q8BA 4JBWA 2WU5B 3W1SA 3ZGZA 3EJIA 5I2XA 3TBIB 1WTWA 3K5MA 4IUUA 3DEPA 3JAME 4ID6A 1SNDA 3OSOA 4A8XC 5DAUA 4MM3B 2KOLA 4HKQA 1E6EB 3EVQA 1K52A 1TQOA 2BCOA 1G6ZA 3QO2A 4RHRA 1L4ZB 2B2YA 4K8JA 2LFIA 1H9KA 2RDGA 5CV9A 3AMUA 3AE2B 3D3RA 2B2UA 2JXTA 1SE3A 2WXHA 1PFNA 2VUMB 3NQIA 5G3LF 5J22A 2EYHA 1KABA 3ZJVA 4ZK9B 4DFAA 1CI3M 2Z1CA 3NWSA 1KNAA 4Y7NB 2XSCA 3ETRA 3VR6A 4R8IA 2FINB 4J1MA 1BOSA 4B08A 1EZ6A 4XWTA 2E2JB 2BDOA 5C0XH 4YTMB 1F9SA 1ZKOA 2A5HA 4L6TB 3MHZA 3D6CA 4R9WA 1JALA 5A35A 3FEWX 1I4RA 3OIQA 4C1NI 5IIFA 4EVOA 1Z47A 2F0MA 3ZJTA 5DM63 1OXSC 1ZDVA 4YTNB 3IFDA 4XQNA 3SHLA 1GXDC 1PZID 5ISRA 1CTMA 1YNJC 1EQTA 4WJWA 5KGUA 3CQZB 1CM9A 4A3FB 2WXPA 3NBIA 4ULLA 1L0VB 3AB9A 1Q10A 1CT1D 1HQMC 4HN7A 3S2HB 4EQNA 3AE8B 3VRAB 4FF3A 2LKVA 4TMAB 1FEHA 4LMQD 2BB6A 3VQIA 2B2VC 4KY7A 3W2DA 2K04A 3DM1A 4DQOC 3S2DB 2A68D 2EPBA 1KDBA 1JC7A 4C3IB 1RYJA 3M4YA 4HSPA 4ME5A 2B2TA 1WD1A 4XT1B 2A6HC 3OMCA 1LTAD 1WCMB 2V4IB 2Q5WD 1II3A 4XDCA 1TS5A 5E1FA 3P1MA 5EKLA 5LL6S 3AE1B 3NS1A 1YNNC 2Q8IB 2BB5A 3VA7A 2SAKA 3HS0C 1GAQB 3URYA 4IFDI 1C48A 5JPNC 1HQRD 1GPXA 4KD3A 2GRIA 1V1PB 2WKDA 3BWUD 1EY6A 1Y8OB 3PO2B 4NAMA 2WKCA 3IAS1 1KDAA 1NCVA 3DMUA 3PUWA 1MD2D 4ARIA 3NTHA 2PMVA 4DU9A 2OF1A 2NB0A 4KY5A 1XYIA 1SMYD 5FO8B 1MPEA 1SSNA 5EE3A 1SYFA 3HEJA 5HFYA 2ZW0A 3J81E 2EYJA 2WU2B 3NUHB 1TY0A 1O7YA 4BBSB 1AP0A 5IGCA 1A3TA 4KD4A 1AEXA 1K50A 5DEHA 3W5VB 3L7ZC 2K03A 3D8GA 1FRDA 2L55A 1ENFA 4IUQA 2F0FA 5D7GA 4HR7B 1JW9D 3PZ7A 1E0ZA 3G6JB 5IGEA 4FF4A 1G291 1V1PA 2BA1A 2ENBA 1PXUA 1E9MA 2AUKA 1DD2A 3BS1A 5C3JB 1NVID 1TIID 3IT4B 1EYAA 1EM7A 2GB1A 1L4DB 4EGVA 2H88B 1TKYA 4DGZA 1VMCA 3KQ4A 5HGTA 3N9YC 1VCIA 1QKZA 4YTPB 4XTCS 1TS4A 3H09A 4D2KA 3AE7B 2NVTB 3HUIA 2F0EA 2JYOA 2PNRC 4F8MA 1WTVA 1PTOB 2QCPX 1SYDA 4GDKB 5BMIA 1ZXHA 1JROA 5IOCA 1Q90A 3D6WA 4R8NA 4ZQ3A 3T53B 1FMAD 2L0CA 5ELCA 1SYCA 1IL8A 1QQRA 4N9TA 5I6YA 3I70A 1JB3A 2WB1B 5EPLA 1KLGD 4IN3A 4RAUC 2JQRB 1IYUA 2WXFA 1IW7D 2R61A 2X6LA 2DY8A 3MAQA 4O1NA 1T3QA 2PW9A 1STGA 4C3JB 4OO1G 2LMCB 1RF2D 3TUOA 1ZEQX 1Y1WB 2F0HA 4RF1A 1F2RC 1N5WA 3ND8A 4REZA 1WTQA 2EY5A 2X38A 2F3VA 1S5DD 2KUMA 4AS1A 2BS2B 2YEPB 3H94A 1IGCA 5KNBA 1ILPA 1EU3A 2R93B 3KUPA 1T5XD 1E7PB 1ZYRC 4IZ8A 5C4HA 2BE5C 5BN3A 4TQ1A 3P75A 4RA8A 2N9KA 2F0DA 1PUTA 3X3MA 4HSVA 1C4QA 1YNTE 3SVMA 1QE6A 2W54A 1KNEA 1EYCA 2O2LD 4IUPA 3HRZC 3GTMB 3PIP3 5ELDA 3BG3A 5JEAH 1SSOA 2R3ZA 1EY9A 3M85A 3A54A 4LLGM 3HGBA 1YNJD 3DEOA 5BYQA 1NR4A 4LTUA 4DF7A 4EQPA 5G5HA 1WTRA 2RMMA 1F2YA 4LAAA 4QF4A 2PZTA 3U9OA 3CU7A 4HEA1 4N59A 2DY7A 4RKLA 1PFBA 3P4QB 3L4PA 4ZRQA 5JVG3 1FR3A 2NBFA 1I7HA 2DYMA 4CQNA 2SNMA 1XLQA 1B44D 4NAWB 2HCCA 2AWNA 3CRLC 4XIGS 3SE0A 3OOCA 4ZHOA 2ZXOA 1NI3A 5EPJA 2OXPA 2ZT9C 1OO9B 3K6OA 2LS01 5CBEE 1UUPA 4M1UB 3I9V1 2SEBD 4DNTB 3E9SA 3KWVA 2MJ8A 1EZ8A 2F0VA 3I4NB 4KHVA 5C0XI 3EGRA 1DOXA 1JWBD 1R4QB 4IQZA 3TEWA 3GTKB 3BVGA 4P16A 2AX5A 2AWOA 1C9FA 3GTGB 4FF2A 3VR8B 1SNQA 2D5DA 2A74C 3BK1A 2A73B 1EY7A 4BY1B 3BIID 4WORA 3C8YA 4A93B 4KJOA 4PMBA 1GUOA 1XWEA 1ZDXA 4ZRZA 1SB3C 1JWMD 2DWQA 1SYGA 1YMHE 2A68C 4Q0FA 1SNPA 4QB4A 1D5ZC 3FKIB 3OWEB 4A3GB 3SK4A 2HCIA 1JWAD 5IT9E 3Q22A 1J7CA 2W82A 2ID0A 1V8CA 1PTOD 5JAVA 1M8AA 2JX5A 3NHHA 1STYA 3PO0A 5A2QL 2PCFB 1L0XB 5DNFA 2Y5CA 3GS2A 2NMQA 3NK9A 4C3HG 3CHBD 1PTOF 5H8YE 3TEXA 4MH8A 3ONAB 1MI0A 3HG9A 4H0LC 2PW5A 3O13A 3J7AF 3P4SB 2KMMA 1DM0B 4JPSA 2VZKB 1E2ZA 1VMPA 4XYQA 1UAPA 5CC4A 1HRJA 3MP9A 1WYGA 4RFBA 1XCTL 1FM0D 1XF5L 1DJRD 5I9PA 2L83A 2B2YC 2XRSD 5M5YB 1SMYC 2G9HD 2B2UC 5KIXA 5BN4A 2MP1A 2N7JA 1RHPA 1JE4A 2JWUA 5BN5A 4JWSC 2L12A 4CKEA 1G2SA 2CW0D 4A3BB 1LACA 1WTPA 5IGBA 3K5NA 3AE6B 1SBBB 4QCLA 4X3SA 2X69A 4IOIE 1EWCA 2N9LA 2LHEA 1O80A 2BS4B 2R6GA 3GTPB 3U52E 4UAIA 3HOUB 4HCEA 1B3AA 2F0KA 2I2YA 2D2CC 5BMGA 4WAFA 4DAVA 2H89B 1M4VA 1AZPA 2PVGC 3SXHA 2GI9A 3ERQA 3AE3B 3GTJB 1ML0D 5HHDG 1TS3A 1R4PB 1EEFD 2QDBA 2NVYB 1OQQA 1XXGA 2A69C 1BF4A 4CJ1B 1QOGA 4NMZA 1B53A 3ZJUA 1BR9A 1LTTD 1QILA 2K3UA 1FGBD 4FP5D 2RVLA 4A90A 1TVXA 3MFYA 1Y8PB 1PFDA 3NXWA 1TU2B 3AB5A 3HRDD 1TWFB 4S3SA 2JYTA 2MHVA 4FYDA 4KK7A 2FJ2A 2KQ4X 3P1HA 1EY0A 3M3YB 2K05A 1RFKA 3TDQA 3AEFB 2PTLA 4XQQA 3E56A 2EYOA 1R9TB 4PMCA 1TY2A 3RD4A 2WV6D 2F0UA 2J0TD 1IW7C 3IT6B 2C5CA 3D4RA 2JA5B 4A3JB 3C3LA 2SOBA 1IKLA 3CRKC 3S15B 3M4OB 1QNUA 1B4OA 1N62A 1ZE3D 2BDNA 2BBCA 3P4RB 3PV0A 1GB1A 3DWGC 3VYUA 2M0AA 5AUIA 3BDLA 3TP8A 4GZYC 4G57A 1R7SA 2EXZA 4ZYSA 1ONLA 4XE0A 3GP7A 1H9RA 2Y5PA 2LY7A 1C4PA 1P7FA 3SEBA 2F0JA 3PO3B 1VJKA 1FNVA 3MXPA 2EYLA 4EQOA 1CA5A 1EYDA 2JEAI 2HDMA 4M0WA 2INPE 1IHZA 5EE1A 1UEAB 4L2YA 1XLOA 3I8ZA 4YWGG 4LJZC 2Y3AA 3NRZA 4TSSA 2WP8J 1LTBD 2B8FA 3C2PA 1ROEA 1SJED 1HZ6A 3Q6SA 1WRIA 4OIKA 3NVVA 4DAYA 3AEBB 1J7BA 3DWPA 4ZKBB 2M00A 4K5WA 1JOQA 5KYLA 2WP9B 3QG1A 4KKTA 4O42A 2FUG1 2RQXA 4H7BA 2WXLA 1B50A 2IL8A 1QOHA 5CV4A 1RM6C 2E74C 1JQ4A 2QSDA 5C5LA 1KTKA 3B2GA 1DGJA 2NZ1D 4A3KB 2WXMA 2BW2A 4OO1H 1ET9A 4A3EB 3G7LA 2M2LA 2WXKA 5I2YA 1U4LA 2VZKD 2M56B 2K28A 1GUSA 1ENCA 1CZPA 1E2WA 4DXFA 2KWDA 2QEJC 4K2KA 3T16A 5KNDA 2FBWB 4YSZB 2IPKD 1IYVA 3FVQA 4K5VA 1CQFA 2AQ1B 1QOAA 5IT9L 5C5MA 5IGDA 3AN1A 2A6EC 4DXGA 1AFPA 2DYOA 2HDEA 4OHJA 5H92C 1A15A 4KKJA 1JORA 3NVWA 5LL6X 3P20A 3K59A 2CU3A 2PW7A 5E4XA 2IDYA 1BXTA 2F0GA 4FXGC 1TYGB 3SFEB 4HTHA 4N9PA 1GUWA 2HTME 1TWCB 4A3MB 1RODA 4KI0A 2HDLA 2F0PA 3NUCA 5EGTA 4KN7C 2PMZB 1XLPA 3GV6A 3ITPA 5EQ0A 4A3IB 1ILQA 2RSOA 1YN3A 5C4JB 3FC4A 4ZOHC 3FMCA 1STNA 1WVLA 3MFGA 3DXJC 4CKCA 2NN6H 4F87A 3HOZB 1V8QA 4RKBA 4K8IA 1HCZA 4OVZA 5NUCA 1HA5A 5A2QE 1LTID 2PLPA 3TEZA 1X3QA 3Q69A 4KMUC 2ICIA 1PTOC 1PFMA 4PT5A 2DBYA 3U4EG 2HUGA 4TQUS 1IBXA 4I65A 3E6ZX 1D6EC 1G2TA 1PGBA 1F9RA 2OHFA 3K57A 1N63A 4A55A 2QKIC 2L11A 2WAQB 1EOTA 2RA4A 3I3CA 4IALA 2H1EA 1F9PA 2A69D 2O5JC 1VLBA 1I4PA 5CV7A 2E2IB 1G91A 3H91A 2R7ZB 1HPCA 3W3AA 1A3UA 3MJ5A 2E2HB 1WWTA 1MHHE 1HTLD 1H9SB 4KKSA 4J3OD 2WXIA 1STBA 1I50B 2LHDA 1AN8A 2F0OA 2Z4HA 5FR3A 1B9MA 3SDZA 3U2SC 2Z4IA 3QJYA 1FXAA 2EVBA 3VYSA 1MBYA 2WXGA 2CW0C 5FO7B 4L8JA 1EY8A 1SDFA 1WXQA 1B1ZA 4RGMA 4ZUIA 1S5CD 4K5XA 1SFOB 1VZ6A 2NYZD 2H4OA 1S5ED 4JE3B 1C79A 1XLNA 2MEKA 1NUCA 3OPOA 5E4WC 1YQ3B 2F4IA 1TKWB 4MHEA 1FFUA 1YQ4B 2RKSA 1E10A 5C4XB 1NYQA 1C76A 2IGDA 1DOMA 1D1IA 2RSNA 2K5PA 5M3MB 2L52A 4OGQC 1PYWD 2BT6A 3VRBB 1YJIA 1LTSD 1DOYA 1H9SA 2EYPA 2F0IA 4OIJA 3U7ZA 5EPKA 1I4GA 4US8A 4CBVA 1QT9A 1XEEA 1JCKB 3U9SA 1TKEA 1XO3A 2B76B 2XNAC 1I6HB 3M7GA 3KF8A 4Q5VA 4RCOA 4KHZA 3PUVA 2K7VA 1FD7D 1MI2A 3PIO3 1SXTA 1STHA 5DM73 2CVRA 1J7AA 2QIEB 1PDXA 2F1MA 2ZXRA 1QB5D 2KQ3A 2JA6B 3AH7A 2J52A 2JXMB 1BUIC 1QNKA 3D4DA 1JOKA 5CMDA 1QLBB 2O5IC 3KWLA 3TP5A 2INNE 4BWGB 3IL8A 4PQXA 3WOFA 3T56B 2PO4A 1HTPA 2NVQB 2XWJB 4J8QA 4Z9CB 4RCNA 3PZ8A 3R8BA 3IAM1 1JMLA 3I73A 1SYEA 3NVZA 1S5FD 2IW3A 4YXDB 4A6QA 1JWUD 2NN6G 1D5XC 1ET6A 2OEDA 3OWFA 4CKBA 2F3WA 4XQJA 3H0GB 1EIHA 2JEBI 4HMJA 4X3UA 2F0NA 1I4QA 4NP5A 3T13A 3HKZB 4RNAA 3NQTA 3D31A 4GLSC 2IT1A 1BUVT 3RUZA 3NPPA 2WDQB 2I38A 3NE5B 2K01A 4MN3A 2RDHA 4IURA 1QF6A 2LGIA 5JVH3 3FAHA 2A6ED 3NP8A 3AE9B 1ZXTA 2E2DC 2PPBC 1OQRA 2WXQA 3OIPA 3HVDA 3VR4A 4WRDA 1I4XA 1QG7A 3FPUB 5IODA 1ZP0B 3RFZB 2MGSA 3WOEA 1HZ5A 4QUFA 1KLUD 2CJNA 2IX1A 4KGRA 2TSSA 2JU6X 1Y8NB 3Q8CA 4R3DA 5M5WB 4HRSA 2L5TA 5CV6A 2FE8A 4U68A 3V05A 3TP6A 4XXEA 5CGKA 1PMRA 3T51B 4C3IG 3HZXA 1A70A 3FRPB 5JOBA 1AWDA 3Q8EA 5C6AA 3GQBA 4OO1I 3N52A 1GJXA 3LWEA 1VF5C 1KH0A 1F2MA 1WTOA 1ESFA 1RTNA 4FXDA 1NYRA 4M8AA 5KEEA 1GOZA 1J9OA 2V4DA 2RPVA 1CHPD 4AQ7A 4BY7B 5E6JA 1JICA 4L1BA 1XX8A 2EE1A 3AM9A 3DWAA 4G4KA 1GUNA 4PV1C 4OZAA 4WIPA 1CJEA 1H9MA 3KBXA 1DCZA 3H6MA 3LXFA 1HFNA 1LT3D 1Y56A 2JSVX 3SK5A 2WDVB 4KKUA 3J7YW 1BQQT 1HXYD 5LHY1 2EDGA 2QF7A 4US9A 3P7JA 3RLFA 2FMCA 4IFDJ 2PZUA 5G5GA 2PQEA 1ZXIA 1O7LA 4DN4M 4JWUC 1F2LA 5EBCA 1ZOYB 2WNMA 4NW2A 3MVVA 2DLBA 1V97A 2WXNA 4X3TA 3K5OA 3NSWA 1LTGD 5CV8A 4FO2A 3VR2A 3PUZA 1ZUD2 1ESRA 1KRHA 3V2TA 2B39A 3OHXC 2ONQA 5I4DA 5IGFA 2MUYA 3R3OA 4C56C 2EJMA 5C44B 3LYYA 3LNNA 1PGAA 2NN6I 1DONA 1C4AA 3NZ3A 1T6BX 1HUNA 2YEPF 3HOVB 4G7HC 1SNCA 4N6EB 1SE4A 4B9XA 3UI3A 2EJFC 2EYMA 1UWMA 1FIQA 5FK9C 2MJEA 1RWSA 1N60A 4RWSC 3VR9B 5COYA 2BOSA 3PUYA 1CHQD 4L23A 2YYZA 1F0ZA 4HCSA 3TEYA 2EY6A 4ARCA 4XDDA 3AU7A 3TSSA 2WXJA 4B9WA 4RGTA 2EJGC 1DOIA 4UDUC 4RH6A 5D3DA 3W5UB 5D65A 4F88A 2IX0A 1K51A 3Q24A 3ZYYX 3GB1A 3EUB2 3T4AC 2G1EA 3GV3A 3QIAA 1VF7A 3I4LA 3I90A 3Q8AA 3TZDA 1C4CA 3EROA 2KN4A 3P42A 3GTLB 1TS2A 2WXRA 1L5PA 4V0BA 1BNZA 4XWWA 3L3OC 2WIIB 3KLSX 4TRDA 4OW0A 2SNSA 3BYYB 5EE0A 5C3WA 3PMFA 4FXKC 3UI2A 5EE9A 2Z8LA 3AMZA 4QUCA 3VYTA 4C3JG