1FNWA

Crystal structure of streptococcal pyrogenic exotoxin a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
221
structure length
221
Chain Sequence
QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYTIDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDNKTSQIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of streptococcal pyrogenic exotoxin A reveals a novel metal cluster.
pubmed rcsb
molecule tags Toxin
molecule keywords EXOTOXIN TYPE A PRECURSOR (ALLELE 1)
total genus 54
structure length 221
sequence length 221
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fnwA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fnwA02
1LTBD 2XRQD 3BVMA 1PTOD 1LT6D 1V1PB 1CHQD 3W2DA 1PZID 2NTTA 4RHSA 2AQ3B 3MFGA 1TS3A 2R61A 1TY2A 2XN9C 4RCOA 1LTRD 5ELEA 1D5XC 1BCPF 3BYTB 4RGMA 1TS5A 1JCKB 1SBBB 5D3DA 5ELCA 1JWMD 1TS2A 1SEBD 1LTTD 4DXGA 1ET9A 1UUPA 2J4XA 1HTLD 1PYWD 1SJHD 4DXFA 4ZYSA 1PRTD 1UNSA 1S5DD 4Z9CB 4C56C 4RGOS 1JR0D 3GP7A 2O2LD 1BCPD 3MC0B 5ELDA 1L0YB 1I4XA 1LTAD 3R2IA 1YN4A 1PZKD 1RF2D 1B1ZA 1LTID 4RFBA 1T5XD 4RGNA 3R2TA 3EA6A 1QILA 4K6LA 5D3IB 1EFID 2ICIA 1ESFA 1YN5A 2XRSD 4RH6A 1PTOF 1PTOC 1FNWA 3CHBD 2QEJC 4L6TB 3EFXD 1CQVA 3R8BA 1BCPB 3OWEB 1YN3A 1D5ZC 3BZDB 1ET6A 5I4DA 1LT3D 1I4RA 3BVZA 1DJRD 1JQYD 4RHRA 4OHJA 2SEBD 1STEA 2G9HD 1PTOB 1LT5D 1RDPD 2RDHA 4BWGB 3BVGA 1SXTA 3DWAA 1I4GA 1S5ED 1CHPD 1FD7D 1L0XB 1S5FD 3TSSA 2AQ1B 1KTKA 1LT4D 1BXTA 1SJED 2XNAC 1ENFA 2IJ0A 1V1OA 4NZLB 2NTSA 1PRTF 3BYYB 1TY0A 3V05A 1CK1A 1HQRD 1M4VA 1MD2D 1B44D 1FNUA 4RGTA 1G8ZD 1EEID 1TS4A 3KLSX 1D6EC 1JWUD 1LTGD 1SE2A 1XTCD 2Z8LA 1FNVA 5ELFA 1RD9D 4L63B 2WV6D 5FK9C 5FKAC 1HXYD 2AQ2B 2CHBD 1JWSD 1V1PA 4O1NA 1I4QA 1LO5D 1PZJD 1DYQA 3O13A 1I4HA 4TSSA 1EU4A 3SEBA 1EWCA 1AW7A 1S5CD 1XXGA 1GOZA 1KLUD 4UDUC 2RDGA 1I4PA 1RCVD 1LTSD 5TSSA 1KLGD 1BCPC 1EU3A 1LLRD 1FGBD 1PTOH 1PRTC 3DWQA 2TSSA 1AN8A 1EEFD 1S5BD 3DWPA 1PRTB 1SE4A 1F77A 1SE3A 2IPKD 2QILA 5ELBA 3URYA 1D5MC 1CT1D 1HA5A
chains in the Genus database with same CATH superfamily
1P3QU 1P0RA 1PTOD 1Q8IA 4N9TA 5E1FA 5IOCA 4JI2L 1OEYA 4OVVA 4KKIA 1IKLA 3TP8A 2DBYA 4BBRG 4AWJA 2N1VA 4R4QA 2ZTCA 1E22A 3ABVB 2FBWB 3JSVB 1IBMQ 4OZCA 3OJ4B 1SAPA 3BINA 4XDCA 4MJSA 4DHJB 5T8IA 2YTVA 3UDIA 1HTLD 3M95A 4WIPA 3Q3NC 2V0GA 1BVSA 5IP9G 1KLVA 1PRTD 1C4AA 3SK6A 2O2VA 3H0GH 4RGOS 4WJWA 2GBMA 3VDYA 3NELA 5KYIA 2KZRA 1C9OA 4OX9Q 1N32L 1MI0A 3EBEA 3Q0AA 1WXVA 4NMZA 1ACCA 5EDSA 2BKFA 3IAS1 4EE2A 4KIKB 2D07B 1IKMA 2RDBC 2B2UC 4IOAA 3EIVA 5C4XG 2GVBA 2KDEB 5GXGB 3Q8CA 5DPTA 3M3YH 3CCQA 2AMCB 4OEMB 1S40A 4IPHA 1UELA 2WXKA 1L4ZB 4KKTA 4WAAA 3MVVA 4USAA 2SEBD 3PMFA 3TP7A 2HTME 2KDMA 1WXQA 2MGSA 1L0VB 1NDDA 4D2KA 3HGBA 4C3IG 2LVPA 3GZNI 1ZP0B 4GOPA 3GDEA 4CJ0B 1KDAA 1WGYA 5LLIA 1HNZL 1CHPD 1OEYJ 4EZKA 1T3QA 4YXDB 2PPBC 3HP3A 4FXDA 2OTJA 4G11A 1EIFA 2RDFA 1KABA 2B63G 1XCQL 3UQBA 1VR9A 3PF5A 3L0OA 1U4AA 3K5OA 4ODGA 1SB3C 5A2QE 4FF1A 1F52A 5JAVA 2KJXA 2WXJA 3D4WA 5IGFA 2JWZA 4LUZA 3NTIA 1MFWA 3ZKJC 3E0JA 3HHMA 2AWOA 3R3OA 4DV7L 4BBSB 1H4RA 2FIDA 2HHHQ 3PZDA 5JHBA 4G0NB 1SYFA 5CV7A 2INCC 4BAXA 3S24A 2HCCA 3P4SB 3ML9A 1SNMA 2PNHA 2RSUA 2N9LA 3WAMA 4DWFA 3NWTA 5C3XA 3U9SA 2A6HC 5J17A 4P74A 5EPJA 4AYBB 2V9HA 1I94L 3K0YA 4BVUC 4A3DH 4TRDA 1WTHA 4W9HA 1B7YB 3LWUA 1EY8A 1EQVA 3R7RA 1QB5D 2JJQA 2L0CA 4APVA 1S5CD 4HMJA 4DAPA 2L05A 4DAVA 5M3MB 4A3FG 4BY7H 3FEWX 1YQ4B 4XTCS 3NBHA 2B39A 2FUHB 4G50A 4QCLA 3SHQA 5DM73 1ZGUB 1WCMB 2TSSA 3NQTA 3CCSA 4H2AA 2JY6A 1KAWA 4K7WA 1WM2A 3OW7A 2QDFA 4K0KL 1HNWQ 3IHPC 1A8VA 1R4NB 3KJPA 3MJ5A 3VR9B 1VQJA 2ZW0A 4LNIA 4A3GH 4OVUA 2WB1B 3W2DA 2X6LA 4RHSA 3STBD 1JT8A 4X6AH 1XCTL 1JJGA 2SDFA 2AL3A 4FADA 2Z0EB 3KLSA 1N5WA 3BJUA 3AQQA 3I73A 4JI3Q 4FA6A 3S15B 1EUJA 2F0TA 1M94A 2EYLA 4WJPA 1JWMD 3PT2B 4X57B 1B3AA 4II2B 1SEBD 1VQAA 3J81c 2Y5PA 2QIEB 5M5XB 4JBMA 3PSEB 1Z47A 2LXKA 1TU2B 3TZDA 4FHKA 1R7SA 2L12A 2K9XA 2KBNA 3C46A 1OXTA 1GNUA 4CQNA 3WAOA 1G6ZA 2JT4B 2V4DA 1G2TA 1I4XA 2QC8A 3V3XA 2E2HH 5EJWA 5HGTA 2EJFC 4DU9A 3R2IA 2KJ6A 5E4XA 1ZW7A 5CV8A 4O2DA 3B1LX 1DOYA 4W9CA 4PV1C 4K6LA 1IYVA 3U30A 4LFAQ 1TWHB 5D6JB 3GTKB 4JI8Q 5ISRA 1C7YA 3VA7A 1YD8U 3GTOB 4EVOA 1IUEA 4A76A 2F4VQ 3GTQH 4UY8C 1AZQA 2RDHA 4K6DA 1I94Q 2HE7A 2YLMA 3OG5A 5HURA 1UBQA 4AQYL 1YNJC 4P1BC 2PKOA 3GO5A 2XVSA 4O0AA 2OCEA 4WORA 4CDDC 4KSLC 3P20A 3HOUH 2PI2E 2HIXA 1B2TA 1HE8A 3NVYA 4NZLB 2UXDQ 4DK0A 1AEXA 4DR5L 3QARA 2F3IA 3RNBC 1JROA 1PUTA 5CHVC 1C3TA 2VH2A 4HIKA 3W5UB 3UQAA 1IHZA 1V6EA 2EMSA 1EYDA 1E0ZA 3ER0A 3PREA 1FNVA 5BMIA 4ZCKA 3UE1A 5GAGC 1RD9D 1ZDVA 2Z1CA 4K0KQ 1HNWL 1T0RC 4M0WB 4JPSA 3CCVA 3P75A 5AUKA 3TL5A 1XMQQ 2BGFA 1V1PA 2X8XX 4G7ZC 3IXSA 2X6GA 3SK5A 3UDFA 1WGHA 1Y8PB 3H6NA 4C3HG 1I4HA 2UUAQ 2R2QA 4J15A 3M85A 2EE1A 4PS8A 3SDLC 2NVYB 2JA8H 4JBWA 2LGIA 2R92G 3S16H 3AE6B 2KCTA 5LMUL 4LUOA 2UUCL 1C4CA 4EKUA 4DV3L 2Z9HA 3BDOA 4HAEA 4US9A 3ERQA 4YSYB 2PE9A 3C8YA 2KJHB 4KDLB 2K28A 3OSOA 1G2SA 1HR0W 2WX0A 3BY4B 2KCNA 4LFBQ 1KXLA 1Z9FA 3M63B 1HA5A 2M0XA 2KWCA 2KQ4X 4GNXA 2OHFA 4OL7A 1Q1EA 3H15A 2PVOD 4ZYNA 2DNEA 4HPMB 3M62B 1CM9A 2CU3A 1V1QA 2JA6B 1Z2MA 2L15A 3NS1A 5IP9H 3A4RA 3PSIA 3RNEC 3MXUA 2TMPA 2ZTDA 4GKJL 4ZHOA 3AE4B 5FLXc 1STGA 4JI5L 1SN8A 4KX6B 4A3BH 2LVOA 2SAKA 4MGZE 2ZJDA 1SNPA 2VB3X 1W6KA 2K04A 3IT4B 2B2WA 4UP7A 4CO7A 5L95C 1HEZE 5LNK1 3PIP3 1KD1C 1KH0A 3ZTDA 2E6XA 4TKNA 1Z6HA 2VQFL 1W6JA 3RNGC 1PDXA 5E4WC 1NEKB 2UUBQ 3Q8DA 1TIID 1PH5A 3TMEA 4KZ0A 3I7FA 2E74C 2JA5B 1V86A 2K1BA 2KK8A 3HK0A 1LTAD 3QG1A 1P7EA 1WE6A 5KNDA 3MTNB 1WX9A 2RR9A 2GBJA 1LUZA 2BB5A 4CGYB 1MHHE 3Q8BA 4DHJD 3RNUA 1WGGA 3EA6A 4JI6L 4FJYA 4DHZB 2ZXOA 2L5TA 4DGZA 3ZDMC 4RH6A 3P4RB 5JZEB 3G7LA 4A90A 3KDFB 1DM0B 1A2TA 4RCNA 4JI5Q 3N3KB 4AJWA 1HNXQ 2C7NB 4KKUA 2EXZA 2EYJA 1PTOB 3EN2A 3HOVH 4X3KA 2BS4B 3APDA 3WWVA 2CKZB 2EYPA 5IT9E 3A8JE 3CF6E 4LW1A 5COYA 1YHQA 1I4GA 1YJ9A 4BBNF 1H9MA 4DV0Q 3DWGC 2F0LA 2GMIC 1FD7D 1L0XB 3C0RB 4FJVB 3WCQA 3R93A 1X3GA 1GHJA 1LT4D 1MIUA 4WFN3 2MX2A 4WQMA 3UI2A 4LNNA 5G3LF 4C7ZA 1PFNA 3NBIA 1EY7A 1FRDA 2R2OA 2OXPA 3RLNA 3AE7B 1VQNA 1PMRA 4B08A 1H9JA 1XJVA 2PCFB 1IYUA 1HQRD 3AH7A 4J6IA 4X3TA 2A73B 4Q0FA 3NTHA 4BKSD 3FPPA 5CMDA 4IWPA 1GUWA 5M3FB 2KFKA 2INPE 3P4QB 3T56B 3MEHA 3J80E 4IFDG 4XWTA 5DPSA 1CKMA 1S1QB 5LMNL 1TIFA 2H5XA 1CMXB 3EVQA 1C79A 4EGVA 1XNRQ 2JUOA 3PO2H 5EBDA 3W5OA 4JL9A 2QEXA 1G6PA 3OTOL 1NI3A 2XBBC 4JI3L 5C3JB 3IFWB 3T13A 1I6HH 1DYQA 5J3BA 3PO2B 1ENAA 3SEBA 1WZ3A 2FNJB 2LWPA 1CJEA 4OGQC 3CCEA 3P42A 1A0IA 1QZHA 4JW0A 2FE8A 1KLGD 1NMGA 2F0SA 3ZO5B 1NTGA 3TN2A 2LGSA 2LJIA 2JA6G 3ZNGC 1E2WA 3PTFC 5E6NA 1KJTA 1Y69U 4A93B 3A9KA 3ZJTA 1IBML 5IWAQ 1F2ZA 2K52A 4XQNA 1C76A 3PZ7A 1ASYA 5JJKA 5DAUA 2ZTEA 1WE7A 2KOLA 1FCCC 4GN3B 1V1PB 2EY1A 1ZXHA 2XWJB 1GC6A 2JRIB 2KACA 2IHEA 5T1GA 1XNRL 3VH3B 4TUUA 1T9HA 1LTRD 1MGSA 1EY6A 1EY4A 1Q5WB 3P2BA 1TWCH 2FMMA 1HH2P 4C3JG 1EM7A 3LDZE 2MO1A 1PH9A 2VQEL 2I38A 4JV5Q 1LGRA 3H7PB 2HDEA 2AWTA 1SYDA 1XPOA 2PNRC 2CHXA 3AMZA 3H7PA 1XNQQ 5KRUA 2BYEA 1H8CA 3FRPB 2B2VC 1E10A 2N3SA 4K5XA 1L5PA 1DZ1A 2BYFA 2LRWA 4UAIA 2LFIA 4B0EA 4N9PA 3CRKC 2N7EA 4B95A 4HCEA 1II3A 2IGDA 2WACA 3A8IE 3CW2C 4DDGD 1UE1A 4OWWB 2KLCA 2WXRA 3S1MH 1Q1BA 1WCMH 5D3IB 3CPWA 2YVCA 3S1NH 1H9KA 4KY5A 5C3EH 3M4OB 2K25A 4AJYB 2QEJC 5M5YB 4O42A 2F0KA 1YJWA 1UE5A 5I6WA 1E24A 3W5VB 5EPKA 3NY5A 2DZMA 3NSWA 3B6YA 4AYBG 1ET6A 1WTVA 3LX0A 1HZ9A 3GTKH 4HXDA 2JQRB 2L32A 2PMVA 5IP4D 4UPAA 2W55A 5J2RA 1ZPSA 1M8AA 4BZAA 1I35A 3A8KE 2JA7H 1IBKL 3J80i 1L4DB 5G55A 4BWGB 1NJIC 1CZPA 4IZ8A 4FULA 3QHTA 2F3WA 3E9SA 5BMHA 1XLOA 2L4NA 3OPOA 4W9GA 4WWOA 4C3IH 3I4MB 3E5SA 1ENFA 4XGAB 2I5MX 2K5HA 1CTMA 4DV7Q 2NTSA 4POFA 3PV0A 2VXWA 1ZDXA 2V3NA 2F0JA 3RYTA 1WX8A 3PF4A 2E2DC 5CHFA 3GV3A 4A3CG 2LXCA 4F87A 4GS3A 2YV5A 4C3HH 4S17A 2MH7A 1FFUA 4JIOU 4K2LA 3P1MA 1WTRA 5JHAA 3ZXRA 4CJ1B 1YX5B 1TWAB 3CRLC 2O6VB 1B4OA 5LXHA 3AFQA 2R92H 4HCSA 1MJEA 3Q6BA 1OQYA 2MO0A 5BMGA 3ULJA 5EE9A 2R7DA 4A3LH 1PFDA 4BKGA 1VZ8A 2BDNA 2R92B 2J42A 1KOTA 4YHHQ 2C5CA 1QUQA 4ANWA 3AFPA 5IYCG 3NZUA 2ID0A 2WP8J 4YTMB 1GOZA 3WDNA 3GTLH 1KLUD 2J53A 3K57A 2L1AA 4L1BA 1J6QA 3ETRA 1WWTA 3ML8A 3D4RA 2EELA 4KN7C 1WX7A 1EOTA 2JVCA 3TMPB 3X3NA 2XTIA 4IFDI 4RAUC 4A3FH 3GTPH 1TGZB 2WDQB 4P72A 3DWMA 2D0PA 1P8LA 3OIPA 1UGMA 1F2RC 5JEAJ 3TEYA 3GE3C 5I6YA 2Z4IA 1FJGQ 4MN3A 4M02A 4FDBA 4L23A 3RZOB 3AV8A 3I4MH 3BVMA 5K36G 1FEHA 1VF7A 2KNBA 1QVFA 4R4OA 4CHKA 3CF5A 2N78A 1JE4A 1SNOA 4GLVB 5CV4A 3N1XC 2F0WA 2ZNVB 4M01A 1MG8A 4F1SA 4GOPC 2WINB 1QJOA 4IUQA 4A4IA 2K75A 3JC66 4X62L 2BVCA 3PO3H 1U4LA 2R93H 4YY3Q 2KEEA 3PLVA 5FLMH 4ZAIA 2IZVB 4MTKA 4DXGA 1N36L 2R93B 1N33L 1B3QA 2PLPA 3HVZA 2C7MB 1KFYB 5BN5A 2Q2TA 4FXCA 2F4VL 1WTOA 1FD6A 1SYCA 4PZ6A 1UNSA 1PV4A 5IGEA 3FPUB 3J81L 2CWAA 2O2LD 4EQ5A 4DK5A 2JEAI 1K8AC 3Q3OC 4AQYQ 2JF5A 1OFFA 1GJZA 1Q3LA 3S2DB 3EQLC 2KHWB 3A4SC 1B1ZA 5CBEE 3HOVG 4NPNA 1Q7YC 3W1SC 2QGQA 1WMHA 2AKWB 3KWLA 4REZA 3HOWB 2N55A 3BU2A 1B9RA 1C9FA 1P98A 2K05A 3L16A 4MH8A 1N61A 2LZ6A 1CUKA 1WJJA 3PUXA 4K5VA 4BY7B 5JPMC 2B3AA 1E7ZA 1YX6B 2M8SA 5AFWA 1GUOA 1D1KA 4HIDA 4IPGA 2UXDL 1R4MB 1TQOA 4NAMA 4ZRIA 2IWHA 1IGCA 3RMKC 4P6VF 2H4OA 3S2AA 4C1NK 1AH9A 3KUZA 3F2CA 3DBLB 3ZGZA 2E5LL 2ASBA 4ILWA 4MM3A 3TSSA 1H95A 4PMBA 2GOWA 4BBRB 4YT0B 1X56A 2BA0A 1QUQB 5H8YE 2ZXRA 3ULLA 4DR6L 2UXCL 4LMQD 1CK1A 3MHSD 4KZCA 3T51B 2O6VD 3SD5A 2DYOA 5EPLA 2GBNA 1ROEA 4JE3B 1TS4A 4EQOA 2D3AA 2FUG1 3AE1B 2GBRA 3NP8A 3MWYW 3ZJVA 2V4IB 2AL6A 2Y0SE 4JG2A 4IUNA 4A20A 4C80A 3A33B 1JORA 1ZXTA 4ZHPA 1OXSC 1TWGH 3L3OC 5FKAC 1VQDA 4JBKA 2KXJA 1P9DU 1S3SG 4A6QA 2MWSB 1JWSD 4HRSA 3RLFA 4OVZA 4NPSA 2IW3A 4KGRA 1X3PA 1YHBA 1W3SA 2QJLA 1LO5D 1V43A 4DBGA 4DV4Q 1UWXA 1SMYD 5AEKB 1EIYB 4A3MG 4TSSA 1F9PA 2KJRA 1EWCA 2E2IH 4XZ4A 3FVQA 1WMHB 2N8NA 1GUAB 4ZRZA 4DK3C 2DHZA 1YJ1A 5JEAG 4AS1A 3AEFB 2WXIA 3G6EA 3DDCB 1TKYA 3SHLA 4C00A 4IG7B 3STBC 5EE3A 4HDOA 1NVID 2PYKA 1WR1A 4FP5D 2NS5A 2RHQB 2OJWA 3J81i 1E1OA 2MNAA 3LXFA 3VTUA 4QUFA 1BMLC 1JOKA 1QG7A 1VMPA 2WXGA 1XPUA 4HWIB 1C48A 3VR6A 3HKZG 1CFMA 4LDTD 2DN8A 4WJ4A 2IT1A 4KJNA 3H94A 2L1BA 1AE2A 3U4VA 1CQFA 2G1EA 2F03A 4LF8L 4XDDA 5IY0A 1PH7A 2LXAA 2KCCA 1GB4A 2FCQA 4A3IH 4M8NA 4ZRQA 1EIGA 2RCFA 1EOVA 1R4PB 2BCOA 2OQ0A 5K5PA 2NBWB 5FLXL 3TBIB 3RN9C 3HOZB 1FIQA 4POGA 2BB6A 3U7ZA 1NR2A 2O5JC 2L00B 4V190 3L17A 5JPNC 5EE1A 3AI5A 2AUKA 4A75A 1E8YA 2UU9Q 5A2QL 1X32A 3D8GA 3VA5A 4BY1H 4LFBL 2UUBL 2NVQH 5C3EB 2FAZA 2E3TA 1X54A 1TWHH 1EY0A 1IPGA 1SR3A 3CC7A 4GXBA 2VUMG 5LL6X 1FVIA 4K3CA 2YTXA 2R3ZA 5EGTA 1PTOF 4LAAA 4E6IA 2C9WB 3B2GA 4K7UA 2KWDA 4K8JA 1VCBA 3KYCD 2MHJA 4KK7A 3VR5A 2JP1A 5BN3A 4YWGG 3BVZA 3P7JA 5BYQA 1KL9A 1Q81C 3PGZA 2HJ1A 4KMUC 4HCPB 3GB1A 4LJZC 4XXEA 2K5VA 2B63H 2ZPYA 1FMAD 5IP7G 4ULLA 3IFTA 2YU9H 4BXXG 1VJKA 4K2KA 2UWQA 2I1KA 4KY7A 1N63A 1RL2A 3CSTA 2ZPNA 4GNXC 4LF8Q 1V8QA 2D2QA 5G5GA 2W3SA 3BS1A 4LF6Q 3HOYG 3RZFA 1LV9A 3ONSA 1L6VA 3N1YC 2PEAA 4S0RA 4XC2A 2JE6I 3U52E 2BTEA 3VXWA 1K51A 2WB1E 2O4XA 1RODA 4GDLB 4LJOB 4KTAA 1LTGD 5M3FG 2KHSA 2WIIB 4DV5Q 2K5QA 4A3BB 4JWSC 1DOMA 4LF9L 3ZNZB 2K33A 5AJ3L 1RLFA 1TXYA 2PMZE 1VQIA 4IJLA 4JI2Q 2GRIA 3EC8A 5C2TB 3OMGA 1SNCA 2V1CC 3FKIH 2KDIA 1KNEA 4Y52H 3BIID 4I6NB 3R3MA 4NB3A 1KM7A 1GUSA 2BPSA 3FDTA 3Q8EA 4ICUA 3O13A 3RT3B 2DYBA 1KDCA 2KD0A 2HQEA 1LACA 3AEGB 3C19A 1RJTA 2JA5H 2LJ5A 2FIFA 3CCRA 5K36H 1ILPA 2R6GA 2PIAA 2FJ2A 2RDGA 1I4PA 3TS2A 2L55A 1K8MA 1VF5C 1AARA 4LF4Q 2PPHA 5CYUA 2WKCA 1IGDA 1V49A 1YJNA 2KC1A 2QCZA 3KQ4A 3J7AF 4IWOA 2JYOA 4GLXA 1Y1VH 3DWPA 4X66L 3CCLA 4JLCA 3BK1A 1PRTB 1F77A 3CP0A 4ZKBB 4A3GG 2Q8RE 3NRZA 5ELBA 4MGYE 3KOJA 4E3CA 4DKAC 2WGSA 3HOXH 4YL8A 2JA6H 1U4PA 1B9MA 2D9UA 3HOUB 3B08A 1JQ4A 2Q2UA 1LT6D 5C44B 5I2YA 2QKIC 4HKZE 4EUTA 1OO9B 3D31A 5LMUQ 1PXUA 3GTJB 3MFGA 3ZJYC 5C0XH 2K5PA 4K7SA 3NXWA 5ELEA 3X3MA 5IT9L 5T1IA 1ZYRC 4CKCA 1UF0A 3DM3A 3VUWA 3LJ3A 3CQZH 1EUVB 2NZOA 4KI0A 2K8BA 2G45B 3T9LA 4BFRA 4RMAA 1STHA 3IAM1 1SYEA 3G4SA 1NBFC 3OLMD 2M19A 4C3JH 1PH1A 2FFKB 4BS9A 3E9HA 4DAYB 5HY6A 4LCDE 1NY4A 4H7BA 3MA2B 1QVGA 4FHJA 4R4IA 3K80C 2L0FA 3RPFC 4X66Q 1ZOYB 4HSVA 1WYDA 3M7GA 3V96A 3H3VH 1SFOB 2KO3A 3UDGA 1KRHA 2GI9A 3I91A 3FILA 4IWQA 3APCA 1SMXA 3DBHB 3KYDD 2XGTA 5BR8Q 5CBAE 1SRUA 5CX3A 3OYYA 2L9HA 3CXCA 4HKQA 2PTLA 2K4KA 1D3ZA 3V60A 2HT1A 1F2YA 3NVWA 1DXMA 1QWYA 1XWEA 2JXXA 1ZE3D 2CH4A 2N9XA 2DLBA 4NKLA 1NYQA 1BCPB 1YN3A 2RMMA 5F2DA 3S1QB 2BYVE 4I6PA 4L5RC 3J7A5 3K81C 3M3YB 2SOBA 1O7ZA 2G3QB 5BYSA 1PGAA 5IGCA 2LHDA 2IX1A 2DAFA 3U2SC 1LT5D 1P1AA 1JB3A 2EYMA 2ENBA 2C35B 4BKSA 3WOFA 2F0QA 2IO1B 1SXTA 1SYGA 4YWLA 1L7YA 1I3QH 4JYAQ 2LI5A 1UD7A 3N1ZC 3QJZA 1TWFH 4IURA 3DCGA 5FO9B 3NEMA 2PQAB 2JA7G 3E3XA 3A55A 3CU7A 3PCOB 4LK0M 2CWPA 5CGKA 1ZKOA 2MP2B 1V1OA 1L6UA 1I6VC 4JOIA 2RQXA 2OJRA 4FJZA 4JQWC 4FNFA 4FF3A 1TBEA 3A1QA 3DBSA 1M4VA 2GA4B 2LXJA 4JI1L 4FLHA 5J22A 2INDC 1G8ZD 4DAYA 4LUVA 1PH6A 3S1RH 3IVFA 1TT5B 4JI4Q 1V5TA 2XK5A 1XX8A 1IP9A 2JSOA 1WTPA 1TT2A 1VQLA 4RKBA 1DONA 1HNXL 4BKTA 2AQ2B 5M3MG 4A3EB 3AU5A 3VTWA 3FILB 4HSPA 3VAWA 1E3PA 1I4QA 2HDMA 1XQQA 3KLWA 5KYLA 3EJIA 4OELB 2JRHA 1GXDC 2WU2B 2RHSB 4DR1L 1PA6A 5LXIB 2CJOA 1VQ6A 4NXNQ 5DLQE 4MZ9A 2BH2A 3KLRA 1WYWB 4ZK9B 3DXJC 2DJFC 1I50H 5C5MA 1WTQA 1EY5A 3RZDB 2MBOA 4IUPA 2ZEQA 4NAWA 3F1ZA 5EQ0A 2JWUA 1VQMA 2RBMA 4XIGS 5CV6A 4MEMA 4LNOA 4QF4A 1HRJA 2RGFA 1WD0A 1EY9A 2IDYA 4DHZE 4ZOHC 4GN4B 2R7FA 4OXPA 4YCUA 2QMTA 4KGSA 2JYEA 1ESRA 2F0IA 4GN5A 5E6JA 4LLGM 4FBJB 1PZID 1YIWA 2KT7A 4IM3A 2XN9C 2K01A 2FXQA 5D14A 1K53A 2Q8IB 4BOZB 4YSXB 2MA9B 3A1QB 5M5XH 3RLOA 1PYSB 1SBBB 4C4VA 3KF6B 1AFPA 1AWDA 2B2WC 5C44G 2KOXA 2V3SA 3DHHC 3RNFC 3A9JB 4J1MA 2R93G 4HJ9A 2IBIB 3U9OA 2IY0B 4K1RB 2HTHA 3NS8A 1PYWD 4GLSC 4L2YA 4DV2Q 5FLMG 3U58A 1VQBA 1WRDB 1VDVA 2HJ8A 2RD0A 4UP8A 3B0AA 5IN7A 4DV3Q 4DK6C 3AEAB 1HR0Q 1L0YB 1LYLA 1UE6A 2K7VA 1HFGA 3VH4B 2CH4W 2DX5B 2RSNA 2WXFA 1HTPA 1HTQA 3DMUA 2I07B 1XD3B 4E71A 1JJCB 4W9JA 2WP9B 4A3KB 4BXXH 2A5UA 2WHIA 1E9MA 1QOFA 2KAJA 3AEDB 5G5HA 3MXPA 3GTQB 2XK5B 4A3MB 4NAWB 2PW5A 4E74A 1G51A 1QOAA 1U9RA 1Q12A 3HOYH 1B8AA 2DJGC 5M5YH 3NZSA 1V97A 4AQ7A 4OO1G 4X64Q 1TKGA 2RA4A 2JXTA 1HJPA 1HZAA 1GUNA 4ID6A 3ZRCA 2NB0A 4OONA 4DR6Q 3CMEA 4G4KA 4KDIC 3PPAA 3TS0A 3ZXVA 1M90C 1OXVA 5KIXA 3TRZA 3E56A 1V9JA 3TP6A 4B9WA 2NBUA 2NBVB 3G6JB 1FFVA 3MHZA 4Y7NB 2CHWA 5FR6A 2Q8TA 3VRAB 2UXCQ 3NZ3A 1XTCD 3WOEA 3QCAA 4C2MB 3A0JA 3GTMB 4ZUJA 4Y7NH 4ZDVA 3HOUG 1WR6E 3L4PA 1MSGA 4IUMB 3I63C 2YYZA 4ZRPA 4BY1B 2FCMA 4IW0A 4JPBW 1JALA 2KTRB 3EECA 1RWSA 1F9SA 4GOPB 1JICA 4HIOA 1YVCA 3AULA 1LM8B 2PQAA 1PZJD 4J8QA 2PZUA 2NPTA 1FYCA 1K3RA 3Q3MC 3OMCA 2NPTB 4YIJA 2M17A 4KIKA 5C4XB 2A69C 1GG3A 4P71A 3AEBB 3ND9A 1T0SC 1H9SA 2A19A 2Q2IA 1YMHE 5TSSA 4CKBA 3I2ZA 5C0XG 3CD6A 1KRSA 1UEAB 1FGBD 4PMWA 2MPMA 3LYYA 2BE5C 5L83A 2C5LC 4II3B 4JOIC 2EDGA 2UU7A 4WQOB 4A9AA 2B2YA 1YEZA 2ICEC 5G3LD 1SE4A 4KN4C 2IPKD 3MTSA 1T6BX 1A3VA 4DDID 1J8CA 1YNXA 1PVOA 4B0MA 1WJ4A 1VLBA 1CT1D 3HKZB 1X55A 2NVUI 3BZKA 1LTBD 2KUMA 4LTUA 4G7HC 1PGXA 3TCAA 4QL5A 2L76A 3ZIMA 4RG1A 1QE6A 2EY6A 4JI6Q 1LFDA 2MW5A 1TS3A 3KUPA 1P16A 4QQBX 1MPEA 1NBWA 4US8A 4RGMA 1SNQA 5ELNA 1K83B 1JCKB 2JQOA 2Q2HA 2JXMB 2E75C 3A5ZB 3BDCA 1STNA 4KD3A 1WD1A 2IHFA 1AZPA 1NYRA 2K5WA 3CAMA 1TKWB 1AP0A 2YEPF 4GLAC 1HHVA 5HI1A 3I4NH 2ZZPB 2WXOA 1WI5A 3J81j 4TV3A 3S1RB 4N8X1 2NVXH 2MJDA 1IXRA 2E2JB 3Q23A 2JSVX 3L54A 1S5DD 1UWMA 2OQKA 1O80A 1IBLQ 2MLBA 5KHOA 3QA8A 1KDBA 2CW0C 1OTCA 2QCPX 3L2PA 2QDBA 3QR8A 2ALYB 1UE7A 3R2TA 3SK8A 2KDBA 3UINB 2I5LX 3EROA 2VUMB 2ICIA 1ESFA 1F2LA 1YNND 1D4BA 4GKKQ 1O7LA 1XEEA 3JW0X 2G4SA 2PVGC 3ND8A 4X3SA 4HROA 3NK9A 5M5WH 1GC7A 1S3OA 4QUCA 2VUMH 5HHDG 4KLKA 1LT3D 1I4RA 1FO4A 3VYRA 3WALA 1LXDA 1RDPD 3DEOA 5EKKA 4YSZB 3D6CA 3NUCA 5IYBH 4EZJA 2ATWA 1RFKA 4ARCA 2K3UA 1EWIA 2E8GA 4FXGC 1K0SA 3BWUD 3DHGC 2NN6G 4MHEA 2UXBQ 1WRIA 3AEEB 2YTYA 1BXTA 3VYUA 2UUAL 2LRUA 3RZWC 1I3QB 2N4FA 2NZHA 5IP7H 3IRBA 1WI0A 2W3RA 1ZKHA 3ZVVA 1K0RA 3WANA 4DFAA 1H9RA 1J7CA 2LASA 4RGTA 1XPRA 1VCIA 1IYJB 1VQKA 2LGXA 2KCMA 3N6RA 4R1JA 4EQNA 1DD2A 5ELFA 4GKKL 2KN5A 4I7ZC 1ML0D 4R8NA 4B3MQ 4P73A 4DR1Q 3H1UA 3C1FA 3QAQA 5C6AA 1BF4A 2HD5B 2UYZB 2D3BA 3NJTA 1DOKA 3NQIA 4MDKE 2P5ZX 2E2IB 5IYCH 3RR5A 2H1EA 3NVZA 3T8MA 1VQ9A 2PO4A 2VQFQ 3I4OA 1E2ZA 3DHQA 1EU4A 5GADC 1KAAA 3NENA 3PUZA 1WVLA 2D5DA 3K5LA 4KHZA 4GKJQ 1G91A 5IT9c 1J5EL 2DNFA 3UGBB 4LF7L 3HEJA 4GDKA 1ISNA 4XX5A 3D4DA 1WSPA 3K58A 2JA5G 1WFYA 2B8GA 1X1MA 2IL8A 2VL6A 2K8CA 3M4QA 3MZ5A 2WQYB 3ZLZA 3FKYA 1Y8OB 1V81A 2N88A 4A3PA 5IYDG 1L1OC 1WXSA 4HJAA 1Y1VG 3QIAA 3I55A 2F0FA 2KVRA 2WFWA 1SSNA 2KVZA 5I9PA 2DNCA 3EFUA 2L0TA 3KYHC 4S3SA 3PO3G 2RVLA 1BOSA 1SE9A 2DAJA 2J7QB 3M3JA 4IM2A 1PYBA 1P7FA 3L0WB 3TEXA 2PI2A 4JI7L 1XTDA 2N49A 4JK1C 3TJPA 3FC4A 3ZDTA 1T5EA 4WJNA 3ZW3A 2Z0DB 2L11A 5D3DA 3CCMA 1MVKA 1EWHA 2DZIA 1C8CA 1LTTD 2K5NA 3DVGY 1HUNA 2VY3A 1IW7C 3U4ZA 2N7DA 1E7PB 3GOEA 5C1ZA 4HDQA 1N60A 1PLFA 1XLPA 3ZJUA 4RWSC 1L0WA 2OOBB 2Z6KC 4DXFA 2B76B 4C56C 2Z4HA 2ZNVC 1FXIA 3RN5A 2LGYA 2W54A 4HK2A 2WDVB 3GTMH 1NAPA 2F0HA 3KK7A 4GNXB 1MKHA 2ACZB 2WX1A 4WWMA 3NG0A 3SFEB 2MBBB 2FMCA 2PZTA 2MP2A 1IBXB 4IN3A 4DR4Q 1DGJA 2MHVA 2KFJA 2B8FA 2REXA 2M0AA 1JB7A 1BBUA 3NVVA 2XRSD 4MH0E 1FNWA 4L5SA 4L6TB 3DM1A 1FJGL 1C0AA 1FXAA 4DQOC 2EYFA 5C4HA 2GVAA 5E7NA 4DR3L 1J5EQ 1Y8NB 3IAYA 1YITA 1E1TA 2DWQA 4RHRA 4OZBA 4OHJA 5KGUA 3RCZA 3L13A 2O2VB 2A1AA 2A69D 4HMIA 3F2UA 4DNIA 4B3RL 1WCMG 3QOLA 3VUYA 3L7ZC 3SGIA 3JAML 4DUYQ 4DAMA 2EKEC 2AQ1B 3W9CB 5KNBA 3D6WA 3AXCA 2B2TC 2L8JA 1OGWA 1LTLA 2WAQB 2M4NA 3P1HA 3G48A 3HRZC 2KQ7A 1C1YB 1LABA 2B2VA 4HTHA 3AE5B 3Q24A 2CR5A 3K7AB 3X0WA 3PIPA 5MPOA 3AB5A 2J0KA 1UBIA 3TREA 1Y1WG 3RN2A 1TR5A 1TZOA 5JJIA 2FCNA 3K5MA 2VRRB 1WOCA 2H88B 3UF8A 2CVRA 1T0YA 3HRDD 3VYTA 3I3TB 4CJ2C 4BBSG 2IO2B 3J7AV 3GZNB 4IOCA 1UWVA 2VNUD 2L83A 4XWWA 3TEHB 2BF8B 2EIFA 2CHBD 4HCNB 1HNZQ 4JC0A 4LFCL 2RCNA 4XT1B 4O1NA 3A5UA 3KW5B 4FN2A 2HD3A 4MM3B 1N34Q 4HEA1 2XWBB 1TTNA 2XIWA 3D0FA 3AEVA 4HJ7A 1BR9A 2MP1A 5GQOA 5AJ3Q 1K9MC 2QHOA 2WYQA 2LUMA 3OHXC 4XQJA 2CJNA 2EKIA 4A3KG 2C9OA 1IL8A 3GQBA 3ONAB 3IG3A 1ENCA 3E0EA 1Y1WB 2KANA 5AZFA 1SLJA 3HUIA 4NP5A 2KKCA 5HGQA 3S2HB 1GKHA 1WZ0A 3I9V1 4JWUC 1EO6A 4WWNA 4KJOA 2B63B 4A3LG 3K9OB 3N52A 4KGTA 4N6EB 4DV2L 2AUJD 4DXAB 4DV1Q 3IT6B 2KVMA 5KNCA 1C4PA 3QX1A 2KN4A 2JPHA 1DOXA 1YNNC 1L1OA 2H89B 2D2CC 1KNAA 2F0EA 4YTNB 2NTTA 2BOSA 4CBVA 3DHIC 4PK1A 1IBXA 3VUXA 2BBCA 3RNAC 4JI0L 2HIVA 3TZUA 1VZ7A 4R8IA 2CFMA 2LSSA 1XT9B 1JRUA 3SK4A 1IBLL 3Q14C 4M8MA 4HLEA 1R4NI 1YZ6A 1UZXB 3H7SA 1X3FA 3K6OA 5C5LA 3I4MG 2E2JH 2G4DB 4YTPB 1EFWA 2MSED 2KA7A 2M9VA 3AB9A 3I8ZA 3C3LA 4C1NI 4B3TQ 2M2LA 2LGDA 1UEBA 2AEHA 4I65A 3QWNA 1IZ6A 3H3VI 1Q90A 3S2DH 1Z5SB 4W9IA 3T3OA 4BY1G 4IJHA 3HG9A 2Y5BB 3GTGH 1JR0D 3GP7A 4HIMA 1NCVA 3AN1A 1LM0A 3NPPA 4K14A 4FXKC 3W1SA 3QOJA 3ZTCA 5BYRA 1XF5L 3LGJA 2JA8B 4B9XA 3H0GB 3VTVA 1FL0A 3AE8B 1AE3A 1T5XD 1VQ4A 5J18A 3BZCA 2A4ZA 1QILA 2X69A 1EFID 3S1QH 4N59A 3KF8A 3S2HH 1N34L 1AYFA 3EFCA 4GDKB 4NQLB 1N8RC 3NBHB 3EFXD 3I4LA 4OX9L 5H1SE 1N32Q 1WGDA 1FCLA 3MAQA 3CMMB 2KLGA 5CV9A 3KVFB 5D2MB 5I4DA 4DUZQ 1QT9A 5EAYA 2ZCCA 3AU4A 4TKOB 5CTRC 3IFDA 1GPXA 1L1OB 1E8WA 1BDOA 5G2NA 4A8XC 3H6MA 1X6OA 5IE8A 5IODA 1HPCA 1SJED 4RKLA 3V2TA 4WJQA 1VD2A 1OTRB 2ZJQA 1SMYC 3HS0C 2N9EB 3N20C 3UE0A 1WGKA 4MACA 4A3OA 3LB8C 1YI2A 5M3FH 4F8MA 2D0OA 1VZ6A 1B44D 1WF9A 4QAYA 5C0XI 4JYAL 2R7ZG 3TDQA 2GB1A 2BH8A 4IQZA 4OW0A 1SE2A 2J0MA 5E3FA 3F8TA 4M8AA 3CMAA 1CKOA 4MT5A 2LMCB 3PUYA 1HXYD 1Z7TA 3I57A 4DF7A 4Q2JA 2A5HA 2AYOB 4EEWA 2OT2A 1KHIA 4U68A 1G291 5IGGA 2CHZA 2N9PC 5IYDH 3PO0A 4DR2Q 2JU6X 1Q86C 1U4RA 3QQ8B 4DR5Q 1J8IA 1A70A 2BT6A 4PS3A 3NWSA 2D10A 2PW7A 2YEPB 3AM9A 1SGHA 1PRTC 3OOCA 1KF6B 4GIVA 1RTOA 2J0TD 1N9WA 4DUZL 4W9LA 1JC7A 1RIPA 4DV6L 1Y8RC 1PH8A 4JBJA 4QJFA 4A3MH 1BNZA 2WXPA 1D5MC 3K9PB 4PQXA 3RZDH 1VQ7A 1K8OA 1XMOQ 4B3SQ 1YQBA 2WU5B 2I1JA 3P4PB 2EVBA 1K3BC 5JEAH 4PG3A 2BE5D 4N9F4 1VDZA 5D94A 3VQIA 3S15H 2OEDA 5ELOA 4EZLA 2FHTA 5D7GA 2EZVA 4A3JH 4ME3A 3RNCC 4AUQC 1KIXA 2N9KA 1RAXA 1N36Q 1WH3A 4EOYA 4DR3Q 1U0LA 1TS2A 1CA6A 3KFUA 2K14A 1WTXA 5HG2A 4YY3L 1GAQB 1E90A 1E5WA 2J4XA 1QOBA 3M7NA 2WDRB 5JH5C 3S17B 4DR4L 1SJHD 2LHEA 4HJGE 2KTFA 5JXVA 1D7QA 3QB3A 3AE2B 2Q5WD 4MGIE 1VQCA 3MC0B 2CQOA 2K22A 5ELDA 3O65B 2R7ZB 3S14H 2JN4A 1QLBB 1MSHA 1L2NA 1CSQA 4IPDA 1RFAA 4K5WA 4A3IG 1KQSA 2IGHA 2GN5A 2CU1A 4HJ5A 1HZ6A 1SIFA 2W82A 3HM6X 3L10B 4K3BA 2AHOB 1YN5A 2LY7A 4EFOA 4F88A 5JJLA 3CHBD 1HR0L 3DPDA 5C4XH 3DVNV 1CQVA 1FPYA 2JA7B 1I7HA 3PZ8A 3M4OH 3S1NB 2B29A 1BUIC 2VW9A 1DJRD 2ZCBA 4B3ML 2G9HD 3PIO3 2HUGA 3GTOH 4DR7Q 5A35A 3A7AB 1K8GA 3BVGA 1E8ZA 2LMCA 3N9YC 3HIZA 2N1WA 1F9JA 2VB2X 5EBCA 1WGRA 1GUTA 3T53B 4L8JA 5FO8B 4NXML 1JRPA 2PW9A 1FRRA 1MHWC 5KHQA 5NUCA 3K8AA 3JAMc 1ASZA 5IOIA 4F7XA 2NUCA 2JX5A 2NZ1D 3N30A 2ASQA 3Q3FA 2D62A 2MQHA 4K81A 4C3IB 1EF5A 2CS4A 4LF5Q 3V62A 1SROA 3T1HQ 4KHPQ 2V1YA 2NMQA 4FF2A 1EZ6A 2KX0A 1J9OA 5TR5A 2B2UA 1YNJD 2M1MA 2ONQA 1D6EC 5CC4A 4DV1L 2BQQA 4L5TA 5DM63 2NVTH 2HDLA 5CORA 2PE6B 4WJ3M 3LNNA 1PH3A 2BWFA 2WLBA 4M0WA 1G6JA 1C77A 3GD7A 2EY5A 4ACFA 1V9PA 5GAEC 1A6XA 1HA6A 2KHIA 2DY8A 2NVXB 4X3UA 3KBGA 3GTLB 4RM9A 3KWVA 2K6QA 3B9JA 3ZUNA 1WIAA 1HZCA 2QSDA 1SDFA 3J7ZC 4LNFA 3ZNID 4ALPA 4UDUC 4CKEA 3E9IA 2JA9A 1RCVD 4R4CA 4RNAA 3Q3JA 4WRDA 3NUHB 3A56A 4MELA 3TQYA 3F2DA 5E6OA 2NVYH 5FO7B 1S5BD 3KDFA 5FJ8G 4BY7G 2KWUB 1JW9D 3QJYA 5IA7A 1A3UA 2EXDA 1WTWA 4JX1C 3RD2A 2KENA 1CI3M 4G3XB 2WXHA 3AU7A 4RFBA 1Y1VB 4JI4L 1D2BA 2Y5CA 1QOGA 3L08A 4WURA 2LVQA 1HZBA 2A68C 3CCUA 2KMAA 1W2BA 3H09A 4QGUA 1CA5A 2XEWA 3RZOH 1GD7A 2J7ZA 1JOQA 2I46A 5C44H 1ZEQX 2L3ZA 4W9KA 3V6CB 2EJMA 4AIMA 3Q8FA 4HN7A 3MC9A 4ANUA 1E2VA 4C2MH 2VZKD 1WJNA 1O7YA 3HVDA 3KUDB 4GDLA 4AYBE 5AZHA 3NHHA 1SYBA 2VQEQ 3AMUA 3G71A 4IC7B 3J80L 1MJDA 4ZLTF 3DBRI 3W1BA 2KFKB 5EE0A 2D3GA 2WAQG 1F9QA 3D3RA 3U50C 2JZZA 2JYTA 4Z9CB 2OTLA 1NSNS 4KKJA 2K03A 4QIWB 2K0PA 1KC8C 1PDQA 2DY7A 2OF1A 4PYUA 5BO4B 1ZYRD 4JI1Q 3PRZA 3C1EA 2M56B 4WH4A 2KEDA 1MI2A 1CSPA 5J39A 1GB1A 1WXAA 3NTKA 4NDXA 1JWAD 4PYZA 2IX0A 1PQSA 5HFYA 1XNQL 3VFKA 2VZAA 3KF6A 3Q2AC 1A63A 3M9BA 3I3CA 3HOXB 3A54A 1UH6A 3SFDB 2Y0SB 3BZDB 5DNFA 2J52A 4JV5L 2D3CA 2O6VA 3VDZA 4QY7A 3M4PA 4A55A 4A93H 2OWOA 4PMCA 1S5ED 2MJEA 2OEOA 3I56A 3AE3B 2K32A 3KH0A 3MFYA 1VRAB 4IUTA 4AOFA 2A68D 3D32A 3CC2A 4HPPA 4A3GB 1HFNA 4G7OC 1Q46A 1Q0WB 1TWFB 2B2YC 3PO2G 3CIRB 4GU2A 3IKJA 4B9KA 1TY0A 1D1IA 2KMMA 1J19A 1J0GA 3Q8AA 1FNUA 3MXGA 1CKNA 1EEID 2BDOA 4MNOA 1B53A 4UP9A 4A3JB 3TBLD 4L5QA 2Z8LA 2KYWA 4RA8A 3S9WA 2WS3B 4KVGB 3ERSX 2F0NA 5C4JB 3T1YQ 3K5NA 3PUWA 2EYHA 4DPGA 3PIOA 5C4JH 3J7YW 3KJOA 1XYIA 3V61A 4X64L 2Z6KA 3ZYYX 4IPCA 1QCBD 4P75A 1XLQA 2EPBA 4B6WA 1NUCA 3PRPB 2F1MA 1E8XA 3IL8A 3ECIA 3PV1A 1R4MI 1FR3A 3HKSA 2L52A 3HOWG 2MUYA 1BCPC 1Y14B 1TVXA 3S1MB 4CYEA 1STYA 3HOVB 2KQSA 5AZGA 3K7UC 5M3MH 2AWNA 5JOBA 4A3KH 2CKHB 3A9KB 3PRMB 1I50B 1X3QA 1NE3A 3HOZG 1NR4A 4XE0A 1TJEA 4HJKA 2WKDA 1A62A 3PS6A 3VVWB 1XO3A 4BBRH 1YJIA 2XRQD 1JE5A 3CC4A 3MHBA 1RYJA 1RHPA 4V0BA 1QZEA 4GZYC 2ZM6L 2AQ3B 1EQTA 4X62Q 4RCOA 4YHHL 1EYGA 1VQ8A 1NENB 3BYTB 4B3TL 1O7IA 3MEFA 3I4NG 3EHVA 1B9NA 1D8LA 3KBXA 3W1GA 4DNRB 2BKRB 2ES2A 1STAA 4GB9A 1WYGA 1B50A 1JMLA 2NR2A 1CZGA 1TWCB 3H9DA 2NYZD 4BA2I 5I2XA 1GM5A 1ET9A 4I7AA 4GOCA 1TWGB 1E0BA 1UUPA 2EOTA 2G5DA 2F0PA 2SNSA 5CHWA 3K7AH 3ENEA 3SU8X 4A3EH 1MJCA 3SVMA 4A3BG 5C3EG 2LEKA 1NMFA 4CDEC 2Y3AA 4ZYSA 2QF7A 4NXMQ 2KDFB 1QVCA 3BDLA 1RKNA 2F3VA 4H13C 4P7IA 4J3OD 3W3AA 2IO0B 3J80c 1EQRA 1GUGA 2NVTB 3JVZX 3AE9B 2IY5B 4M00A 4NQKE 2A6ED 2EMTA 2LUEA 1YN4A 3GE8C 3SR6A 3FHWA 1BUVT 1SF0A 3NOBA 1EQQA 4NXNL 4GGQA 2RSOA 4ABNA 2ZM6Q 2E2HB 1IL2A 4ME5A 3JSVA 5LL6S 4RM8A 2K6DB 3VR4A 2NVQB 2WWZA 1R9TB 2ON8A 3H8HA 4JVZA 2UU9L 3DOWA 1CKNB 3OWFA 3R8BA 4TQ1A 2MRPA 2N0SB 2KECA 2NCNA 3JYUA 4UHVA 4W9DA 1A15A 1STEA 2PMZB 4A3CH 1DCZA 5EKIA 2QDLA 3T3NA 1F9RA 4XYQA 2WXQA 4ARIA 2MBEA 3H3VC 4JI0Q 1T0QC 3DWAA 4XQQA 1BO0A 5C0XJ 4OWTB 4LF5L 4FF4A 2K1FA 3I70A 3T1HL 4OIKA 5IGBA 4KHPL 1FM0D 3Q69A 1QOHA 1KTKA 5GROA 2XNAC 1PGBA 3QIJA 3HZXA 3MP9A 4ASWC 4G57A 1A2UA 1BT0A 2YU9B 2CQAA 4KD4A 1JMCA 1HQMC 1F1HA 3N32A 4OO1I 1YHAA 1WJ6A 2PJHA 4ANVA 1F2MA 4H02A 4OO1H 4XYOA 3ZRFA 1TWAH 3I72A 4ANXA 2RKSA 2LD9A 2CW0D 3ULPA 5JVG3 1K52A 4KV6A 1V5OA 4KV2A 2INNE 1JOOA 3RUZA 3B2FA 1VQFA 1OQQA 4MIUA 4P16A 2R7ZH 2WV6D 4C3HB 1Q1OA 4XDXA 5C23A 3APFA 4A3DG 4W9EA 2D11A 3DEPA 1K50A 5J1ZA 4WJOA 1GO3E 2KTRA 3R66C 1ILQA 1EZ8A 2FCSA 2F0VA 2FINB 4TMAB 5H92C 2K8HA 1EL0A 4R9WA 3WA0A 2F0GA 4KKSA 3DVGX 1HTOA 2MCNB 3S16B 1BBXC 4YCWA 2E5LQ 1VQHA 4DN4M 5FLXE 1MBYA 1LTSD 1TZ1A 3WIMA 1LLRD 4LFCQ 5LHY1 2LKVA 1O78A 3DWQA 5E6PA 4XT3B 1EWYC 3OAWA 4IM0A 3A9JA 4FO2A 1SE3A 4DR2L 2QILA 2NWGA 1DGSA 4R4TA 4NJ6A 4M1UB 3ITPA 2MFIA 4HJ8A 5M9OA 2MEKA 4LF4L 1WFQA 1GVPA 3J9CA 3WAPA 3A74A 4DUYL 2K39A 1K83H 4TVAB 3R7QA 3I5JC 3H91A 5GMVA 1STBA 3SE0A 1TY2A 1XMOL 4JGHB 1MG4A 3TEWA 1DOLA 1D5XC 1V2YA 2BWES 1VQGA 4YCVA 1TS5A 2L7RA 4BA1I 1U4MA 1XLNA 2B3GA 5ELCA 1U5KA 4C7YA 2AX5A 4A3JG 2EY2A 2HQLA 2F52A 2JK8A 3CQZB 5D65A 2ZVOA 1JWBD 3ZNHB 4PNYA 3GTGB 4TQ0A 1F0ZA 5C3WA 1UGJA 4DV6Q 4OIJA 4GMVA 3RI7C 3FP9A 3E6ZX 1Y56A 1QF6A 1RRBA 3OIQA 2WDTB 4IUUA 2B2TA 1E7VA 3F2BA 4DV4L 1F2RI 1K73C 3I4NB 1Q10A 2IY1B 4PS7A 4BOSC 2O5IC 1BCPD 4JI8L 3ICEA 5GAHC 4FYDA 1N6ZA 1V8CA 3QK0A 3OTOQ 4ZKCB 1N5XA 2BS2B 5JJZA 1SFOH 1LTID 1BQQT 1WY8A 2GLSA 4P2CB 5DEHA 3RULA 3EGRA 2K5DA 3HFZB 1SE8A 3MXNA 4IDIA 2ZXPA 3UDXA 2F0OA 3TUOA 2PQEA 3QWZB 3VR2A 3AECB 4DA2A 2WB1G 4AH6A 2MJ8A 3H0GG 5IGDA 1J7BA 2D5GA 3BG3A 2WXNA 3P63A 4H44C 4URKA 3PGEA 1JJ2A 2N7JA 1YQ3B 4B3SL 1ZUD2 2X38A 3RFZB 1X9NA 1GHKA 4RMFA 2EJGC 3PQIA 2CCZA 1V80A 1N33Q 1FGUA 4WWPA 2E76C 1E7UA 1NNXA 2Z0SA 1RM6C 1BBWA 1VQEA 4H0LC 5HKHA 5C4ZA 1S5FD 3K59A 4IO9A 5DCNA 4J6HA 4N8FA 1KRTA 2IJ0A 1WXMA 4MGKE 1E6EB 5IKCM 1ICFB 4IUVA 5LMNW 4JI7Q 4OWXB 5FOBB 3Q22A 2DUDA 1ZXIA 1I5FA 1PRTF 2QW7A 3BYYB 2BS3B 3VRBB 3V05A 1NI2A 2IGGA 2HCIA 1MD2D 1EF1A 3V6EB 2JEBI 4IOIE 4BBSH 1QQRA 1QKZA 1SIJA 4X65L 2ZW1A 3KLSX 5IYBG 3PLUA 4LF6L 2PZWA 3SXHA 1JWUD 2NN6I 5CV5A 4CDCC 4Q5VA 4QB4A 4LNQA 4IFDJ 2NN6H 4YWKA 4ITKA 4LDTB 4FVMA 1PFBA 4NNJB 2WNMA 4NY0A 2BW2A 5FR3A 3A7LA 4P1CC 3RD4A 1I6HB 4MSQB 4DV5L 2WAQE 1SSOA 2F0MA 2M00A 1FXTB 3T16A 1VMCA 2KWVB 1HUMA 3HOZH 5IIFA 4LJPB 3VR3A 2JA8G 4RF1A 4RF0A 4DR7L 1S4ZA 3J81E 3KUCB 3VR8B 2HHHL 1AW7A 1XXGA 4LF9Q 1X65A 4A3DB 2RPQA 2MJ3A 2KMCA 1GJXA 3FAHA 1K28A 1PTOH 4EX5A 2KQ3A 4MJSB 1EEFD 1PFMA 2K50A 2Y0SG 4KHVA 3DBRB 3QC8B 2Z59B 1C78A 4I6LB 1TYGB 4W9FA 3C2PA 2A6HD 4CHTB 4CDFC 2UUCQ 2DZJA 1OQRA 4XYCA 5FJ8H 1WJUA 4NJ7A 3DBHI 3HOYB 2LFNA 1XMQL 1CHQD 3DQVA 1A5RA 2MBHA 2XSCA 3OW2A 2UXBL 4U673 1YBYA 4A3EG 2RPVA 4R3DA 2R61A 3VYSA 2GBKA 3T4AC 2V3PA 3DVNU 5KEEA 3OJ3A 2J0JA 1HCZA 1BCPF 2DZKA 3TIXA 4F7ZA 3MXNB 4K8IA 3SR1A 4A3IB 5I9OA 1CZWA 1H9SB 3K0XA 5L37A 3CCJA 1PH2A 1IYFA 2G9DA 3I90A 2JZPA 5DPWA 2QA4A 1I42A 1IBKQ 4ZRJA 3EUB2 5IAAC 5IO9A 3S14B 3BK2A 4NJCA 1N62A 1R4QB 1RTNA 2F0UA 3Q6SA 5JVH3 1UAPA 3TP5A 1OXXK 4IKGA 3TEZA 2C7HA 3S17H 2DGYA 4GSWA 3CWIA 1PZKD 1RF2D 3GV6A 1ONLA 4PT5A 1R9TH 4RGNA 3GS2A 4AP4C 2EYOA 4DK1A 3L9AX 2EQSA 2F0DA 3JAMi 1QZGA 2ZJPA 1EYCA 2KX3A 1LQBA 1PTOC 4B3RQ 1OXUA 3PVLA 3UIPB 1Q8KA 4LWCA 3CSFA 1IW7D 4MSMB 5DPRA 4ZRKA 4X65Q 2MBQA 1D5ZC 1X3EA 1EYAA 3RMHA 2A8VA 1TKEA 1WM3A 2C60A 4ZUIA 1K8RB 3NE5B 2K6AA 2IYDB 1JQYD 1C4QA 4LK1C 3ZQ4A 2A6EC 3T1YL 1VQPA 1HZ5A 3MJWA 2ZT9C 3W1YA 1BKBA 3DLLA 2VH1A 4F8CB 4ZQ3A 1ICWA 4LFAL 1QNKA 2Z6BA 3DBLI 1PFSA 2ZJRA 2I5HA 1VQOA 5AUIA 4TQUS 3ALBA 4GN1A 2WXMA 3VHTC 1S72A 1J7AA 2W9NA 2JZ3B 3UIOB 4PZ7A 4A93G 2MQJA 4QMGA 3IBEA 3UI3A 1YJJA 1QNUA 3FKIG 4EQPA 1YIJA 1PHJA 3GTJH 3U7DA 4BBNC 4HPLB 1YOVB 2LS01 3KF8B 4QIWE 1SNDA 4IFDH 4IALA 3X23A 3MC8A 1PH4A 3DUZA 4WAFA 5LMNQ 3PO3B 2NBFA 3PHXB 3PUVA 1YNTE 3CPFA 4L63B 3PHWB 2KC2A 4KSKC 3AYHB 4C3JB 5IWAL 3HKZE 2VS1A 4JCVE 3M4YA 2I0QA 5BR8L 2I2YA 3U8ZA 5FK9C 1MHXA 4DV0L 2BYTA 2DYMA 4MTNA 4DNTB 3NHEB 3JAME 4N58A 5CR3A 2IX3A 1VQ5A 4KY6A 2F4IA 2V4LA 3HOXG 3FKIB 4LNKA 1Y1WH 2KHJA 4ICVA 1B70B 1VS0A 2BA1A 2IO3B 2VZKB 3RUIB 2RF4A 4YWMA 3LWEA 4HEDA 4A3FB 3GTPB 4C4VB 4HVBA 2WXLA 4HR7B 5BN4A 1A3TA 1EU3A 3QO2A 4PZ8A 3HM3A 3SDZA 3U4EG 1EIHA 2ZVNA 2DENB 1AN8A 1DOIA 4LF7Q 4OZAA 3HOWH 1Q82C 4NW2A 3FMCA 2A74C 1L2FA 5EKLA 1M1KC 3CKIB 3URYA 5M5WB 2SNMA 3OWEB
chains in the Genus database with same CATH topology
1PTOD 1Q8IA 4N9TA 5E1FA 5IOCA 4KKIA 1IKLA 3TP8A 2DBYA 3ABVB 2FBWB 4OZCA 1SAPA 4XDCA 5T8IA 1HTLD 4WIPA 2V0GA 1PRTD 1C4AA 3SK6A 4RGOS 4WJWA 5KYIA 1MI0A 3Q0AA 4NMZA 1ACCA 3IAS1 4EE2A 1IKMA 2B2UC 5GXGB 3Q8CA 2WXKA 1L4ZB 4KKTA 3MVVA 4USAA 2SEBD 3PMFA 3TP7A 2HTME 2KDMA 1WXQA 2MGSA 1L0VB 4D2KA 3HGBA 4C3IG 1ZP0B 4CJ0B 1KDAA 1CHPD 4YXDB 1T3QA 2PPBC 3HP3A 4FXDA 2RDFA 1KABA 1XCQL 1VR9A 3K5OA 4ODGA 1SB3C 5A2QE 4FF1A 5JAVA 2KJXA 2WXJA 3D4WA 5IGFA 3NTIA 3E0JA 2AWOA 3R3OA 4BBSB 1SYFA 5CV7A 2HCCA 3P4SB 1SNMA 2N9LA 3NWTA 5C3XA 3U9SA 2A6HC 5EPJA 4AYBB 3K0YA 4TRDA 3LWUA 1EY8A 1EQVA 1QB5D 2L0CA 4DAPA 1S5CD 4HMJA 4DAVA 5M3MB 3FEWX 1YQ4B 4XTCS 3NBHA 2B39A 4QCLA 5DM73 1WCMB 2TSSA 3NQTA 4H2AA 3OW7A 3MJ5A 3VR9B 2ZW0A 2WB1B 3W2DA 2X6LA 4RHSA 1XCTL 2SDFA 3KLSA 1N5WA 3I73A 3S15B 2F0TA 2EYLA 1JWMD 1B3AA 1SEBD 2Y5PA 2QIEB 5M5XB 1Z47A 1TU2B 3TZDA 1R7SA 2L12A 2K9XA 3C46A 1OXTA 4CQNA 1G6ZA 2V4DA 1G2TA 1I4XA 3V3XA 5EJWA 5HGTA 2EJFC 4DU9A 3R2IA 5E4XA 5CV8A 1DOYA 4PV1C 4K6LA 1IYVA 1TWHB 3GTKB 5ISRA 3VA7A 3GTOB 4EVOA 1IUEA 1AZQA 2RDHA 4K6DA 5HURA 1YNJC 2PKOA 3GO5A 2XVSA 4WORA 3P20A 1B2TA 3NVYA 4NZLB 4DK0A 1AEXA 1JROA 1PUTA 3W5UB 1IHZA 1EYDA 1E0ZA 1FNVA 5BMIA 1RD9D 1ZDVA 2Z1CA 4JPSA 3P75A 5AUKA 1V1PA 3IXSA 4G7ZC 2X6GA 3SK5A 1Y8PB 4C3HG 1I4HA 3M85A 2EE1A 2NVYB 4JBWA 2LGIA 3AE6B 1C4CA 3BDOA 4HAEA 4US9A 3ERQA 4YSYB 3C8YA 2K28A 3OSOA 1G2SA 2KCNA 1HA5A 2KQ4X 2OHFA 4OL7A 1Q1EA 2PVOD 2DNEA 1CM9A 2CU3A 2JA6B 3NS1A 3MXUA 2TMPA 4ZHOA 3AE4B 1STGA 4KX6B 2SAKA 1SNPA 2VB3X 1W6KA 2K04A 3IT4B 2B2WA 1HEZE 5LNK1 3PIP3 1KH0A 2E6XA 1Z6HA 1W6JA 1PDXA 5E4WC 1NEKB 1TIID 3TMEA 2JA5B 2E74C 2K1BA 1LTAD 3QG1A 1P7EA 5KNDA 2BB5A 3Q8BA 4CGYB 1MHHE 3EA6A 2ZXOA 2L5TA 4DGZA 4RH6A 3P4RB 3G7LA 4A90A 1DM0B 1A2TA 4RCNA 4KKUA 2EXZA 2EYJA 1PTOB 4X3KA 2BS4B 2EYPA 5IT9E 3A8JE 5COYA 1I4GA 1H9MA 1QF6A 3DWGC 2F0LA 1FD7D 1L0XB 3WCQA 3R93A 1GHJA 1LT4D 4WFN3 4WQMA 3UI2A 5G3LF 4C7ZA 1PFNA 3NBIA 1EY7A 1FRDA 2OXPA 3AE7B 1PMRA 4B08A 1H9JA 2PCFB 1IYUA 1HQRD 3AH7A 4X3TA 2A73B 4Q0FA 3NTHA 3FPPA 5CMDA 1GUWA 5M3FB 2INPE 3P4QB 3T56B 3MEHA 3J80E 4IFDG 4XWTA 3EVQA 1C79A 4EGVA 5EBDA 1NI3A 5C3JB 3T13A 1DYQA 3PO2B 1ENAA 3SEBA 3ZJUA 1CJEA 4OGQC 3P42A 2FE8A 1KLGD 2F0SA 3TN2A 2LJIA 1E2WA 1Y69U 4A93B 3ZJTA 1F2ZA 4XQNA 3PZ7A 1C76A 5DAUA 2KOLA 1FCCC 1V1PB 2EY1A 1ZXHA 2XWJB 2KACA 5T1GA 1LTRD 1MGSA 1EY6A 1EY4A 2FMMA 4C3JG 1EM7A 2I38A 2HDEA 1SYDA 2PNRC 3AMZA 5KRUA 3FRPB 2B2VC 1E10A 1L5PA 4K5XA 1DZ1A 4UAIA 2LFIA 4B0EA 4N9PA 3CRKC 4HCEA 1II3A 2IGDA 2WACA 3A8IE 2WXRA 1Q1BA 5D3IB 3M4OB 1H9KA 4KY5A 2QEJC 5M5YB 4O42A 2F0KA 5I6WA 3W5VB 5EPKA 3NSWA 1ET6A 1WTVA 3LX0A 2JQRB 2L32A 2PMVA 2W55A 1ZPSA 1M8AA 3A8KE 1L4DB 4BWGB 1CZPA 4IZ8A 2F3WA 3E9SA 5BMHA 1XLOA 2L4NA 3OPOA 3I4MB 3E5SA 1ENFA 1CTMA 2NTSA 3PV0A 2VXWA 1ZDXA 2V3NA 2F0JA 2E2DC 3GV3A 4F87A 2MH7A 1FFUA 4K2LA 3P1MA 1WTRA 4CJ1B 1TWAB 3CRLC 1B4OA 4HCSA 5BMGA 5EE9A 1PFDA 1VZ8A 2BDNA 2R92B 2J42A 2C5CA 2ID0A 2WP8J 4YTMB 1GOZA 3WDNA 2J53A 1KLUD 4L1BA 3K57A 2L1AA 3ETRA 1WWTA 3D4RA 2EELA 4KN7C 1EOTA 3X3NA 4IFDI 4RAUC 2WDQB 3DWMA 3OIPA 1F2RC 5JEAJ 3TEYA 5I6YA 2Z4IA 4MN3A 4L23A 3RZOB 3AV8A 3BVMA 5K36G 1FEHA 1VF7A 1JE4A 1SNOA 5CV4A 2F0WA 2WINB 1QJOA 4IUQA 1U4LA 2KEEA 4ZAIA 4DXGA 2R93B 2PLPA 3HVZA 1KFYB 5BN5A 4FXCA 1WTOA 1FD6A 1SYCA 1UNSA 5IGEA 3FPUB 3J81L 2O2LD 2JEAI 1OFFA 1Q3LA 3S2DB 3EQLC 1B1ZA 5CBEE 3KWLA 4REZA 3HOWB 2N55A 1B9RA 1C9FA 4MH8A 2K05A 1N61A 3PUXA 4K5VA 4BY7B 5JPMC 5AFWA 1GUOA 1D1KA 4NAMA 1TQOA 2IWHA 1IGCA 4P6VF 2H4OA 4C1NK 3ZGZA 4ILWA 3TSSA 4PMBA 4BBRB 4YT0B 2BA0A 5H8YE 2ZXRA 4LMQD 1CK1A 3T51B 2DYOA 5EPLA 1ROEA 4JE3B 1TS4A 4EQOA 2FUG1 3AE1B 3NP8A 3MWYW 3ZJVA 2V4IB 4C80A 4IUNA 1JORA 1ZXTA 4ZHPA 1OXSC 3L3OC 5FKAC 4A6QA 1JWSD 4HRSA 3RLFA 4OVZA 2IW3A 4KGRA 1X3PA 2QJLA 1LO5D 1V43A 1UWXA 1SMYD 4TSSA 1F9PA 1EWCA 3FVQA 4ZRZA 5JEAG 4AS1A 3AEFB 2WXIA 1TKYA 3SHLA 5EE3A 1NVID 2PYKA 4FP5D 3LXFA 4QUFA 1BMLC 1JOKA 1QG7A 1VMPA 2WXGA 1C48A 3VR6A 1CFMA 2DN8A 2IT1A 4KJNA 3H94A 2L1BA 1CQFA 2G1EA 2F03A 4XDDA 2KCCA 1GB4A 4ZRQA 1EIGA 1R4PB 2BCOA 5K5PA 5FLXL 3TBIB 3HOZB 1FIQA 2BB6A 3U7ZA 1NR2A 2O5JC 4V190 5JPNC 5EE1A 2AUKA 5A2QL 1X32A 3D8GA 3VA5A 2E3TA 5C3EB 1EY0A 5LL6X 2R3ZA 5EGTA 1PTOF 4LAAA 4E6IA 3B2GA 2KWDA 4K8JA 4KK7A 3VR5A 2JP1A 5BN3A 4YWGG 3BVZA 3P7JA 5BYQA 4KMUC 3GB1A 4LJZC 4XXEA 1FMAD 4ULLA 3IFTA 1VJKA 4K2KA 4KY7A 1N63A 1V8QA 5G5GA 2W3SA 3BS1A 1LV9A 1L6VA 2JE6I 3U52E 2BTEA 1K51A 2O4XA 1RODA 4GDLB 4KTAA 1LTGD 2KHSA 2WIIB 2K5QA 4A3BB 4JWSC 1DOMA 2K33A 2GRIA 5C2TB 3OMGA 1SNCA 1KNEA 3BIID 1GUSA 3Q8EA 3FDTA 3O13A 3AEGB 1KDCA 4WWMA 2HQEA 1LACA 1RJTA 5K36H 1ILPA 2PIAA 2R6GA 2FJ2A 2RDGA 1I4PA 2L55A 1K8MA 1VF5C 5CYUA 2WKCA 1IGDA 3KQ4A 3J7AF 2JYOA 3DWPA 3BK1A 1PRTB 1F77A 4ZKBB 2Q8RE 3NRZA 5ELBA 1U4PA 1B9MA 2D9UA 3HOUB 1JQ4A 1LT6D 5C44B 5I2YA 2QKIC 4HKZE 1OO9B 3D31A 1PXUA 3GTJB 3MFGA 5C0XH 2K5PA 3NXWA 5ELEA 3X3MA 5IT9L 5T1IA 1ZYRC 4CKCA 4KI0A 1STHA 3IAM1 1SYEA 2M19A 2FFKB 4BS9A 4H7BA 3MA2B 3RPFC 1ZOYB 4HSVA 3V96A 3M7GA 1SFOB 1KRHA 2GI9A 3I91A 3FILA 5CBAE 2L9HA 4HKQA 2PTLA 1F2YA 3NVWA 1DXMA 1QWYA 1XWEA 1ZE3D 2DLBA 4NKLA 1NYQA 1BCPB 1YN3A 2RMMA 5F2DA 3S1QB 3M3YB 2SOBA 1O7ZA 5BYSA 1PGAA 5IGCA 2LHDA 2IX1A 3U2SC 1LT5D 1JB3A 2EYMA 2ENBA 3WOFA 2F0QA 1SXTA 1SYGA 4IURA 5FO9B 4LK0M 3CU7A 3A55A 5CGKA 1ZKOA 1V1OA 1L6UA 1I6VC 2RQXA 4FNFA 4FF3A 1M4VA 2GA4B 5J22A 1G8ZD 4DAYA 1XX8A 2JSOA 1WTPA 1TT2A 4RKBA 1DONA 2AQ2B 4A3EB 3FILB 4HSPA 1I4QA 2HDMA 5KYLA 3EJIA 2WU2B 1GXDC 2CJOA 3KLRA 4ZK9B 3DXJC 5C5MA 1WTQA 1EY5A 3RZDB 4IUPA 5EQ0A 2JWUA 2RBMA 4XIGS 5CV6A 4QF4A 1HRJA 1WD0A 1EY9A 2IDYA 4ZOHC 2QMTA 4KGSA 2JYEA 1ESRA 2F0IA 5E6JA 4LLGM 1PZID 2XN9C 2K01A 5D14A 1K53A 2Q8IB 4YSXB 1SBBB 1AFPA 1AWDA 2B2WC 4J1MA 3U9OA 4L2YA 4GLSC 1PYWD 1VDVA 3AEAB 1L0YB 2K7VA 1HFGA 2RSNA 2WXFA 1HTPA 3DMUA 2I07B 2WP9B 4A3KB 3AEDB 1E9MA 1QOFA 2KAJA 5G5HA 3MXPA 3GTQB 4A3MB 4NAWB 2PW5A 1QOAA 1U9RA 1Q12A 1V97A 4AQ7A 4OO1G 1TKGA 2RA4A 2JXTA 1GUNA 4ID6A 2NB0A 4G4KA 1OXVA 5KIXA 3E56A 3TP6A 4B9WA 3G6JB 1FFVA 3MHZA 4Y7NB 2Q8TA 3VRAB 3NZ3A 1XTCD 3WOEA 4C2MB 3GTMB 4ZUJA 3L4PA 1MSGA 2YYZA 4ZRPA 4BY1B 1JALA 1RWSA 1F9SA 1JICA 1PZJD 4J8QA 2PZUA 1FYCA 3OMCA 4YIJA 5C4XB 2A69C 3AEBB 3ND9A 1H9SA 1YMHE 5TSSA 4CKBA 5C0XG 1UEAB 1FGBD 4PMWA 2MPMA 2BE5C 2EDGA 4A9AA 2B2YA 2ICEC 5G3LD 1SE4A 2IPKD 3MTSA 4KN4C 1T6BX 1A3VA 4B0MA 1VLBA 1CT1D 3HKZB 1LTBD 2KUMA 4LTUA 4G7HC 1PGXA 1QE6A 2EY6A 1TS3A 3KUPA 1MPEA 4US8A 4RGMA 1SNQA 1K83B 1JCKB 2JXMB 2E75C 3BDCA 1STNA 4KD3A 1WD1A 1AZPA 1NYRA 2K5WA 2YEPF 1TKWB 1AP0A 5HI1A 1HHVA 2WXOA 3S1RB 2MJDA 2E2JB 2JSVX 3Q23A 1S5DD 1UWMA 1O80A 1KDBA 2CW0C 2QCPX 2QDBA 3SK8A 3R2TA 3EROA 2VUMB 2ICIA 1ESFA 1F2LA 1YNND 1D4BA 1O7LA 1XEEA 2PVGC 3ND8A 4X3SA 4HROA 3NK9A 4QUCA 5HHDG 1LT3D 1I4RA 1FO4A 3VYRA 1RDPD 3DEOA 5EKKA 4YSZB 3D6CA 3NUCA 1RFKA 4ARCA 2K3UA 4FXGC 3BWUD 2NN6G 4MHEA 1WRIA 3AEEB 1BXTA 3VYUA 1I3QB 2W3RA 4DFAA 1H9RA 1J7CA 4RGTA 1VCIA 3N6RA 4EQNA 1DD2A 5ELFA 4I7ZC 1ML0D 4R8NA 3C1FA 5C6AA 1BF4A 1DOKA 3NQIA 2E2IB 2H1EA 3NVZA 2PO4A 1E2ZA 3DHQA 1EU4A 1KAAA 3PUZA 1WVLA 2D5DA 3K5LA 4KHZA 1G91A 3HEJA 3D4DA 1WSPA 3K58A 2B8GA 2IL8A 3MZ5A 2WQYB 1Y8OB 2N88A 3QIAA 2F0FA 1SSNA 5I9PA 2DNCA 4S3SA 2RVLA 1BOSA 1P7FA 3TEXA 4JK1C 3FC4A 1T5EA 2L11A 5D3DA 1MVKA 1EWHA 1C8CA 1LTTD 1HUNA 1IW7C 1E7PB 1N60A 1PLFA 1XLPA 4RWSC 2B76B 4DXFA 4C56C 2Z4HA 1FXIA 2W54A 2WDVB 1NAPA 2F0HA 3KK7A 2ACZB 3SFEB 2FMCA 2PZTA 1IBXB 4IN3A 1DGJA 2MHVA 2B8FA 2M0AA 3NVVA 2XRSD 1FNWA 4L6TB 3DM1A 4DQOC 1FXAA 2EYFA 5C4HA 1Y8NB 3IAYA 4OZBA 2DWQA 4RHRA 4OHJA 5KGUA 2A69D 4HMIA 3F2UA 3QOLA 3L7ZC 3JAML 3W9CB 2AQ1B 5KNBA 3D6WA 2B2TC 2WAQB 3P1HA 3HRZC 1LABA 2B2VA 4HTHA 3AE5B 3Q24A 3K7AB 5MPOA 3AB5A 1TR5A 1TZOA 3K5MA 2H88B 2CVRA 3HRDD 3VYTA 4CJ2C 3J7AV 2L83A 4XWWA 2VNUD 2CHBD 4XT1B 4O1NA 4MM3B 4HEA1 2XWBB 2XIWA 1BR9A 2MP1A 2LUMA 3OHXC 4XQJA 2CJNA 2EKIA 2C9OA 1IL8A 3GQBA 3ONAB 1ENCA 1Y1WB 3HUIA 4NP5A 3S2HB 4JWUC 3I9V1 4KJOA 2B63B 4KGTA 3N52A 4N6EB 2AUJD 3IT6B 2KVMA 5KNCA 1C4PA 2KN4A 1DOXA 1YNNC 2H89B 2D2CC 1KNAA 2F0EA 4YTNB 2NTTA 2BOSA 4CBVA 1IBXA 2BBCA 3TZUA 1VZ7A 4R8IA 3SK4A 5C5LA 3K6OA 4YTPB 2KA7A 2M9VA 3AB9A 3I8ZA 3C3LA 4C1NI 2M2LA 4I65A 3QWNA 3T3OA 1Q90A 3HG9A 1JR0D 3GP7A 1NCVA 3AN1A 3NPPA 4K14A 4FXKC 3W1SA 3QOJA 5BYRA 1XF5L 2JA8B 4B9XA 3H0GB 3AE8B 1T5XD 1QILA 2X69A 1EFID 4N59A 3KF8A 1AYFA 4GDKB 3EFXD 3I4LA 1FCLA 3MAQA 5CV9A 5I4DA 1QT9A 4TKOB 3IFDA 1GPXA 1BDOA 4A8XC 3H6MA 5IODA 1HPCA 1SJED 4RKLA 3V2TA 1SMYC 3HS0C 1WGKA 4MACA 3LB8C 4F8MA 1VZ6A 1B44D 5C0XI 3TDQA 2GB1A 4IQZA 4OW0A 1SE2A 5E3FA 4M8AA 4MT5A 2LMCB 3PUYA 1HXYD 1Z7TA 3I57A 4DF7A 4Q2JA 2A5HA 2OT2A 4U68A 1G291 5IGGA 3PO0A 2JU6X 1U4RA 1J8IA 1A70A 2BT6A 3NWSA 2PW7A 2YEPB 3AM9A 1PRTC 3OOCA 1KF6B 1RTOA 2J0TD 1JC7A 1BNZA 2WXPA 1D5MC 4PQXA 1K8OA 2WU5B 3P4PB 2EVBA 5JEAH 2BE5D 3VQIA 1VDZA 2OEDA 2FHTA 5D7GA 2EZVA 2N9KA 1TS2A 1CA6A 1WTXA 5HG2A 1GAQB 2J4XA 1QOBA 3M7NA 2WDRB 3S17B 4HJGE 1SJHD 2LHEA 5JXVA 3QB3A 3AE2B 2Q5WD 3MC0B 2K22A 5ELDA 2R7ZB 1QLBB 1MSHA 4K5WA 2IGHA 1HZ6A 2W82A 1YN5A 2LY7A 4F88A 3CHBD 1CQVA 2JA7B 1I7HA 3PZ8A 3S1NB 1BUIC 1DJRD 2G9HD 3PIO3 2HUGA 5A35A 3A7AB 3BVGA 2LMCA 3N9YC 2VB2X 5EBCA 1GUTA 3T53B 4L8JA 5FO8B 1JRPA 2PW9A 1FRRA 5NUCA 4F7XA 2NUCA 2JX5A 2NZ1D 2D62A 4C3IB 2NMQA 4FF2A 1EZ6A 1J9OA 2B2UA 1YNJD 2ONQA 1D6EC 5CC4A 5DM63 2HDLA 5CORA 4M0WA 3LNNA 2WLBA 1C77A 3GD7A 2EY5A 1A6XA 1HA6A 2DY8A 2NVXB 4X3UA 3KBGA 3GTLB 3KWVA 3B9JA 2QSDA 1SDFA 4UDUC 4CKEA 1RCVD 4RNAA 4WRDA 3NUHB 3A56A 5FO7B 1S5BD 1JW9D 3QJYA 1A3UA 1WTWA 4JX1C 1CI3M 2WXHA 4RFBA 3AU7A 1Y1VB 1D2BA 2Y5CA 4WURA 1QOGA 2A68C 3H09A 1CA5A 2J7ZA 1JOQA 2I46A 1ZEQX 2EJMA 3Q8FA 4HN7A 1E2VA 2VZKD 1O7YA 3HVDA 3NHHA 1SYBA 3AMUA 3J80L 4ZLTF 5EE0A 3D3RA 1F9QA 2JYTA 4Z9CB 1NSNS 4KKJA 2K03A 4QIWB 2K0PA 1PDQA 2DY7A 2OF1A 1ZYRD 4WH4A 3C1EA 2M56B 2KEDA 1MI2A 5J39A 1GB1A 3NTKA 4NDXA 1JWAD 2IX0A 5HFYA 3SFDB 3I3CA 3HOXB 3A54A 2Y0SB 3BZDB 5DNFA 2J52A 4A55A 4PMCA 1S5ED 2MJEA 2OEOA 3AE3B 2K32A 3MFYA 1VRAB 4IUTA 2A68D 4A3GB 1HFNA 4G7OC 3CIRB 1TWFB 2B2YC 3IKJA 1TY0A 1D1IA 2KMMA 3Q8AA 1FNUA 3MXGA 1EEID 2BDOA 4A3JB 1B53A 2Z8LA 4RA8A 3S9WA 2WS3B 2F0NA 5C4JB 3K5NA 3PUWA 2EYHA 3J7YW 1XYIA 3ZYYX 1XLQA 1QCBD 2EPBA 1NUCA 2F1MA 3IL8A 1FR3A 2L52A 2MUYA 1BCPC 1TVXA 3S1MB 1STYA 3HOVB 2AWNA 5JOBA 4XE0A 1I50B 1X3QA 1NR4A 1TJEA 2WKDA 1XO3A 1YJIA 2XRQD 3MHBA 1RYJA 1RHPA 4V0BA 4GZYC 2AQ3B 1EQTA 4RCOA 1NENB 3BYTB 1B9NA 4DNRB 3KBXA 1STAA 1WYGA 1B50A 1JMLA 1CZGA 1TWCB 2NYZD 4BA2I 5I2XA 1ET9A 1TWGB 1E0BA 1UUPA 2EOTA 2SNSA 2F0PA 3SVMA 2LEKA 2Y3AA 4ZYSA 2QF7A 3BDLA 1RKNA 2F3VA 4H13C 4J3OD 3W3AA 1GUGA 2NVTB 3AE9B 2A6ED 1YN4A 3SR6A 1BUVT 1SF0A 2RSOA 4ABNA 2E2HB 4ME5A 5LL6S 3VR4A 2NVQB 1R9TB 2ON8A 3H8HA 3OWFA 3R8BA 4TQ1A 2N0SB 2KECA 1A15A 1STEA 2PMZB 1DCZA 5EKIA 3T3NA 1F9RA 4XYQA 2WXQA 4ARIA 3H3VC 3DWAA 4XQQA 1BO0A 5C0XJ 4FF4A 3I70A 4OIKA 5IGBA 1FM0D 3Q69A 1QOHA 1KTKA 2XNAC 1PGBA 3HZXA 3MP9A 4G57A 1A2UA 2YU9B 2CQAA 4KD4A 1HQMC 4OO1I 1F2MA 4OO1H 4XYOA 3I72A 2RKSA 2CW0D 5JVG3 1K52A 4KV6A 2INNE 1JOOA 3RUZA 3B2FA 1OQQA 4MIUA 4P16A 2WV6D 4C3HB 4XDXA 3DEPA 1K50A 5J1ZA 1ILQA 1EZ8A 2F0VA 2FINB 4TMAB 5H92C 1EL0A 4R9WA 2F0GA 4KKSA 3S16B 1BBXC 4DN4M 5FLXE 1MBYA 1LTSD 1LLRD 5LHY1 2LKVA 1O78A 3DWQA 4XT3B 1EWYC 4FO2A 1SE3A 2QILA 2NWGA 4M1UB 3ITPA 5M9OA 2MEKA 3J9CA 3H91A 1STBA 3SE0A 1TY2A 3TEWA 1DOLA 1D5XC 1TS5A 4BA1I 1U4MA 1XLNA 5ELCA 4C7YA 2AX5A 2EY2A 3CQZB 5D65A 1JWBD 1F0ZA 4PNYA 3GTGB 4TQ0A 5C3WA 1UGJA 4OIJA 1Y56A 3E6ZX 3OIQA 4IUUA 2B2TA 1F2RI 3I4NB 1Q10A 2O5IC 1BCPD 4FYDA 1V8CA 4ZKCB 1N5XA 2BS2B 5JJZA 1LTID 1BQQT 4P2CB 5DEHA 3EGRA 2K5DA 4IDIA 3MXNA 2ZXPA 3TUOA 2F0OA 2PQEA 3VR2A 3AECB 4DA2A 1J7BA 2MJ8A 5IGDA 3P63A 2D5GA 2WXNA 3BG3A 4H44C 2N7JA 1YQ3B 1ZUD2 2X38A 3RFZB 1GHKA 2EJGC 2E76C 1RM6C 4H0LC 5C4ZA 1S5FD 3K59A 4J6HA 2IJ0A 1E6EB 4IUVA 3LYYA 5FOBB 3Q22A 1ZXIA 2BS3B 1PRTF 3BYYB 3VRBB 3V05A 2IGGA 2HCIA 1MD2D 2JEBI 4IOIE 1QQRA 1SIJA 1QKZA 2ZW1A 3KLSX 2PZWA 3SXHA 1JWUD 2NN6I 5CV5A 4Q5VA 4QB4A 4IFDJ 2NN6H 4ITKA 4FVMA 1PFBA 2WNMA 2BW2A 5FR3A 3A7LA 3RD4A 1I6HB 1SSOA 2F0MA 2M00A 3T16A 1VMCA 1HUMA 5IIFA 3VR3A 4RF1A 4RF0A 1S4ZA 3J81E 3VR8B 1AW7A 1XXGA 4A3DB 2MJ3A 1GJXA 3FAHA 1PTOH 2KQ3A 1EEFD 1PFMA 4KHVA 1C78A 1TYGB 3C2PA 2A6HD 4CHTB 1OQRA 3HOYB 2LFNA 1CHQD 2XSCA 4U673 2RPVA 4R3DA 2R61A 3VYSA 3T4AC 2V3PA 5KEEA 1HCZA 1BCPF 4K8IA 3SR1A 4A3IB 5I9OA 1CZWA 1H9SB 2G9DA 3I90A 2JZPA 3EUB2 3S14B 3BK2A 4NJCA 1N62A 1R4QB 1RTNA 2F0UA 3Q6SA 5JVH3 1UAPA 3TP5A 1OXXK 4IKGA 3TEZA 3CWIA 1PZKD 1RF2D 3GV6A 1ONLA 4PT5A 4RGNA 3GS2A 2EYOA 4DK1A 3L9AX 2F0DA 1EYCA 1PTOC 1OXUA 1IW7D 1D5ZC 3RMHA 1EYAA 1TKEA 4ZUIA 3NE5B 2K6AA 1JQYD 1C4QA 4LK1C 3ZQ4A 2A6EC 1HZ5A