1FNWA

Crystal structure of streptococcal pyrogenic exotoxin a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
221
structure length
221
Chain Sequence
QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYTIDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDNKTSQIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOTOXIN TYPE A PRECURSOR (ALLELE 1)
publication title Structure of streptococcal pyrogenic exotoxin A reveals a novel metal cluster.
pubmed rcsb
molecule tags Toxin
total genus 54
structure length 221
sequence length 221
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fnwA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fnwA02
1CT1D 1JCKB 2R61A 2NTTA 1FNVA 4RGMA 1M4VA 1SXTA 3MFGA 1HA5A 3TSSA 1CHPD 1JR0D 5TSSA 1S5BD 4DXGA 1SBBB 1SEBD 1ESFA 1PTOD 2SEBD 3BZDB 1PTOB 1D5MC 1BCPC 1YN3A 4L63B 4RHSA 3OWEB 1G8ZD 1PTOF 1I4PA 1PZJD 3EA6A 5ELDA 4NZLB 1EWCA 4K6LA 1LTBD 1QILA 2IPKD 1FD7D 1XTCD 3BVGA 1D5ZC 1SJHD 1RD9D 4Z9CB 1JQYD 5ELEA 1RDPD 1RCVD 3CHBD 1TS5A 1EFID 2TSSA 5ELBA 1HXYD 1PRTD 1PRTB 1LTRD 1LT4D 3W2DA 2QEJC 1LTSD 4RCOA 3MC0B 2ICIA 1PZID 1GOZA 1SE4A 1V1PB 1PRTF 3R8BA 1HQRD 1DYQA 3BVZA 1LT3D 1TS2A 4RGNA 1EU4A 2WV6D 1FGBD 2Z8LA 4RGOS 4RHRA 1S5ED 1FNWA 1AW7A 1LTAD 4RFBA 3V05A 2XN9C 5ELFA 1D5XC 2XRSD 1B1ZA 1ET6A 1I4XA 2AQ3B 1BXTA 1FNUA 3DWAA 1I4GA 1LT5D 1LTGD 5I4DA 3DWQA 3KLSX 1L0XB 1S5DD 4RGTA 1T5XD 3GP7A 1TS4A 2G9HD 4OHJA 4TSSA 1HTLD 1DJRD 2XRQD 3BVMA 1CK1A 2O2LD 1PZKD 1TS3A 1PYWD 4BWGB 2J4XA 1UNSA 2IJ0A 1LO5D 1PTOH 1PTOC 1EEFD 1BCPD 1KTKA 2NTSA 3R2IA 1AN8A 1XXGA 1CQVA 4UDUC 2RDHA 1YN4A 2AQ1B 1I4HA 1JWSD 1CHQD 1BCPF 1KLUD 3URYA 1YN5A 1S5CD 1D6EC 1LT6D 1KLGD 1V1PA 1EEID 3BYYB 1JWUD 3BYTB 5D3IB 1S5FD 1STEA 5ELCA 4DXFA 3O13A 1JWMD 5FKAC 1MD2D 3R2TA 1I4QA 1PRTC 2RDGA 1EU3A 3DWPA 5FK9C 2QILA 1I4RA 1F77A 1V1OA 4O1NA 1LTTD 1BCPB 1UUPA 1LLRD 1L0YB 1ENFA 1TY0A 2CHBD 1LTID 1ET9A 1SE2A 1SJED 3EFXD 1SE3A 4RH6A 2XNAC 4C56C 4ZYSA 4L6TB 1RF2D 1TY2A 2AQ2B 1B44D 3SEBA 5D3DA
chains in the Genus database with same CATH superfamily
1VD2A 2AUJD 1U9RA 3NWSA 1U4PA 2EY1A 3Q0AA 2NYZD 4C1NK 4FF2A 3M3YH 4K81A 4X6AH 1HFGA 3PO0A 4BBSB 1F9RA 2CKZB 1S5BD 3EROA 3AEEB 4K7WA 2VS1A 4IQZA 3F1ZA 4RA8A 4OVUA 2CVRA 1Q46A 4TUUA 3EECA 4L63B 3VFKA 2YTVA 1HUMA 3L08A 2WDQB 1WJ4A 1A3UA 2K1BA 2NBVB 2CH4A 1OEYJ 2IO3B 3QG1A 2L00B 1JB7A 5D6JB 3J7AF 3DBHI 4EFOA 1E90A 3EIVA 3BVGA 4A93H 3C0RB 3WANA 4BBNC 1SLJA 1VDZA 4IUVA 4L5RC 1CM9A 2E5LL 1TS5A 4X3TA 3P1MA 2HHHL 3N52A 1PV4A 2K1FA 2Y0SE 3ONSA 3UDGA 1FCCC 2UUCQ 3CCEA 2LEKA 2C9WB 1QOAA 1YD8U 3AEGB 2WAQB 3ETRA 1X55A 2BBCA 3DHIC 3Q2AC 5EPJA 3VTUA 3JSVB 3U50C 2R93H 4ZQ3A 4AIMA 4GMVA 1E8XA 2WIIB 2M8SA 4QUFA 2DUDA 4FP5D 5GAEC 1YIJA 4X3SA 5M3MH 1I6HB 4A3MB 2KC2A 2MBOA 5DPTA 1B1ZA 3SHQA 2N55A 4BAXA 1I4XA 3UE0A 1F9JA 1N62A 2JX5A 4HCNB 4K7UA 1I4GA 1IW7D 3MEHA 3DHGC 2HCCA 4ZYSA 3KH0A 4BKSA 4L5SA 2KFKA 4OHJA 2BH8A 4HMIA 4EQNA 1O80A 1S3SG 2IX0A 1K28A 1TIID 2QSDA 5AZGA 2DZJA 3K58A 4TV3A 1G291 1KH0A 1PZKD 1D3ZA 2CKHB 4P1BC 4PT5A 1H9KA 3VR5A 2NBUA 5AJ3L 2MSED 2M17A 4GKJL 1ZYRC 4B3TQ 2BWFA 1T5EA 2VUMH 1IBKL 1E2VA 1A6XA 1Z5SB 5KHQA 1CHQD 2PEAA 2X69A 3URYA 2ZCCA 3STBD 1K8RB 3QB3A 5J1ZA 4APVA 1IBXB 2WXGA 4DV0L 3VR4A 3KJPA 4A3LG 2F0IA 5C44G 4O2DA 2FIDA 2J53A 3BYTB 3AEFB 4IPDA 1B70B 1Z47A 3I5JC 2W54A 4YY3Q 2L4NA 4A3FG 5CGKA 1Q90A 2MHVA 4B3SL 3DWPA 1UWMA 1JRUA 3RCZA 3MWYW 2ZXOA 4K5WA 4NJ7A 1BBWA 1WR6E 3M4OB 3GTJB 3B1LX 5KNDA 5C3JB 1C4QA 5IYBG 5CBEE 2IO0B 5C0XJ 2FMMA 2I38A 3E0JA 3FKIH 1JROA 2K3UA 3V61A 3ZO5B 4FBJB 1WE6A 3PIP3 3KUDB 1PFNA 2KFJA 4YTPB 3DM3A 3PO3G 1UBIA 4JI2Q 2L1AA 2PI2A 4R8NA 4WJOA 2WX1A 3GQBA 5D3DA 2N88A 1CT1D 2R7ZG 4DBGA 3GTOB 5JHAA 1Q1OA 2EZVA 1ZKHA 2LVPA 4PYZA 3TSSA 1AZQA 1GXDC 3IAM1 3V96A 1F2RC 2DZKA 4HJ9A 2DGYA 2GVBA 3UDIA 5K36G 1WZ3A 3J7ZC 2NVUI 2CHWA 2BYTA 4J15A 1L0WA 1PH5A 1BCPC 2MJDA 2W55A 1WM2A 1QNUA 3A8KE 3I70A 4DNTB 1G8ZD 4WRDA 1DOYA 2EELA 1K8OA 3AE3B 4K6LA 3ALBA 4IUNA 3PIOA 4ZDVA 3EC8A 4OWXB 1E1OA 4WJ3M 4GDKA 1L1OA 3TBLD 2KJXA 2Z6BA 1L0VB 2LJIA 3HOVB 2JA6B 3S17B 3A1QB 4IKGA 1SJHD 5I9PA 3CXCA 4YWMA 2FIFA 3BK2A 2C7HA 3L0WB 1RCVD 4NY0A 1H4RA 3ZUNA 1KHIA 4F8MA 1YNTE 1N34Q 2EYOA 3CP0A 4P6VF 3RNBC 1DOXA 4MGYE 2VQEL 4A3KG 5BMIA 1LTSD 2HDLA 5IO9A 2Y5PA 2JEBI 1BKBA 2ZPYA 4X64Q 1TWAH 1Y14B 4C3HH 2F0MA 1L4DB 1LV9A 2EMTA 2LGXA 1CFMA 2HQLA 2K5NA 1V5OA 1TWHH 1KAAA 4TQUS 3RNUA 4IWOA 1XO3A 2O5IC 3BINA 3S16B 4IURA 1HHVA 4KKTA 4RFBA 4IFDG 3MHSD 5D94A 2IZVB 2KHIA 3HG9A 1VRAB 3UQAA 1WVLA 3ZJUA 2XRSD 3L0OA 2YLMA 3Q3JA 1K3RA 2LKVA 4ODGA 5I4DA 4A3EB 2JYEA 3NVWA 2RHSB 5AUKA 4AJYB 5D65A 1YNND 5IIFA 2H88B 4K1RB 2KVRA 1SROA 1Q82C 4PQXA 5E1FA 1VCBA 4ZRPA 2LZ6A 1IPGA 4A3CG 3DMUA 1OTRB 2LMCA 3VR6A 4ZRZA 4JOIA 2UXDQ 5JJLA 1WH3A 5BO4B 3VTVA 1JB3A 1M90C 4QMGA 2JXTA 3AECB 3QA8A 1XXGA 4JBKA 2D3CA 1A3VA 3CIRB 3W1SA 3M85A 4EZKA 2IO2B 1O7ZA 1B3QA 3D6WA 3QIJA 2K6QA 1S5CD 3SFEB 1D1KA 4WURA 4ZYNA 2CWPA 4ZCKA 2MP2B 4HPPA 1YBYA 4GLXA 2I46A 1IBML 2N8NA 1STEA 1QOGA 1E5WA 3K0YA 1XNQQ 3HOZB 4JBMA 2IWHA 2OCEA 1XT9B 4IWPA 5CBAE 5JAVA 2EY5A 1FFUA 1N32L 1HTOA 4HKZE 4JC0A 2NB0A 2QILA 4AQYL 1C77A 2KCCA 2CU3A 5DM73 1Y1WH 1FJGQ 2BT6A 4GDKB 1STGA 1V1OA 4IUMB 4OWWB 4TKOB 4BKSD 1J7AA 4KSLC 3RZWC 4I6NB 3AXCA 3GTGH 4JVZA 1F9SA 1L0YB 3QQ8B 2I07B 2M56B 1XPUA 3DM1A 3KYHC 3UINB 5E7NA 1V8CA 2PPHA 1N34L 1JOOA 4OO1I 2XGTA 2F0SA 4HCEA 3B2GA 1BOSA 3P2BA 2GBJA 2B2TC 3AU7A 4KHPL 3NVZA 3NE5B 1EUVB 1YNJC 4X64L 3KBXA 1SNOA 3H3VC 1F2MA 1JR0D 2I5LX 3U52E 1ONLA 3CC7A 2BKFA 4LUOA 2RSUA 2SEBD 3BZDB 4DK1A 1P0RA 3W1BA 4XE0A 2IHEA 4USAA 2L1BA 3ZXVA 2NVYB 3CC4A 4HSPA 4KD4A 2F0EA 1I35A 4IUTA 2KTRB 1D8LA 1WTHA 4H0LC 2BYVE 5L83A 5FLMG 1TU2B 3R7QA 1LQBA 2LGYA 3ZTCA 4R4IA 5C5MA 1HUNA 1TYGB 4C3JG 4PG3A 2JWZA 3N3KB 3R3MA 1D5ZC 2LMCB 2L0CA 2NWGA 3U7DA 2I2YA 4DQOC 1EZ6A 2LSSA 1T0SC 2TSSA 2UXDL 2WXNA 5HKHA 5D14A 2G45B 1PGAA 1VR9A 2WXMA 1VZ6A 1HZ9A 4DK3C 3J80E 1XLOA 4X57B 3V60A 4CYEA 2NVQB 3AU5A 4GNXC 1R4NI 5BMHA 1SNPA 4P72A 3QWNA 3P4SB 1VQFA 3GZNI 4X3UA 1LT3D 1TS2A 4ACFA 3LWEA 5I6WA 1R4PB 1AW7A 4XYCA 2W9NA 1U4LA 2A5UA 2KJ6A 2IHFA 1KXLA 2CU1A 5FLXE 2ZM6Q 3QWZB 3DWAA 4CDCC 1CJEA 2B2VA 3PLVA 4K0KQ 1AFPA 1GUTA 4TSSA 4HJ8A 3A9JA 5G5GA 4B08A 1FJGL 1TKEA 4JW0A 5DPRA 2Y3AA 2A69D 2QCPX 5ISRA 3TEZA 2OTJA 4JI3L 1M8AA 1E8ZA 3RT3B 3AFPA 1UNSA 1WCMB 4UP9A 4A90A 1EO6A 4J6HA 1I50B 4N6EB 3A5UA 3TBIB 3CCLA 2MLBA 3KQ4A 4GLSC 2R92G 5CHWA 2PIAA 3PREA 3KUZA 4OWTB 3U9SA 3APDA 2MBEA 2OQ0A 3J81i 4KV6A 1BCPF 3NJTA 3NUHB 1IYFA 2M0AA 1WFYA 3Q14C 1ZUD2 2QDLA 4LAAA 4JIOU 1XCQL 2K5HA 1PGXA 1S5FD 2R2OA 3MTNB 5E6JA 4GOPA 2LXAA 4LNFA 2F0HA 4W9GA 1K0RA 4GLVB 4JPBW 1AARA 1MD2D 3R2TA 3M3YB 4DR6Q 3CPWA 4U68A 5CV5A 4ZHPA 1UD7A 5HHDG 3DQVA 1MJCA 1JMLA 1CSQA 1U4AA 5G5HA 2WFWA 4A3LH 5C44H 2KANA 2X38A 1TXYA 3H7SA 1ENFA 3A7AB 2NN6I 4WJNA 4ANVA 4XQQA 1PH9A 1SE2A 1WCMG 2KD0A 4XQNA 4A3FH 2HQEA 3H7PA 1UE7A 4BOZB 4KSKC 2LFIA 3MA2B 3RMHA 2K6AA 1Q10A 4HMJA 3BK1A 4A93B 4MTNA 3FPPA 2P5ZX 1QE6A 2WX0A 3TS0A 1IXRA 4LF7Q 2MNAA 4AUQC 1GAQB 3AYHB 4KGRA 4TQ1A 5IYBH 1UGJA 4AH6A 1WY8A 4NJCA 3D8GA 1SBBB 1G6PA 1FEHA 4M0WA 3T1HL 1ENAA 1FIQA 3WA0A 4NAWA 1QVCA 4GKKL 3PO3H 2ASQA 2F0UA 3GE8C 4L1BA 3AB9A 3HOWG 1PDQA 3ZJVA 2R93B 3JYUA 3VA5A 4C7ZA 4JLCA 2R7ZH 3A9JB 1KABA 4NZLB 2D3BA 2ZTCA 4K0KL 3F2BA 1P1AA 4NMZA 2JJQA 1GUNA 2B2WA 2KCNA 2CR5A 3KWLA 5EBDA 2J0TD 5M3MB 1SYDA 2DY7A 4ULLA 4UP7A 4DV1Q 3LGJA 2OXPA 3VUYA 3PIPA 4DWFA 4RAUC 1IGCA 3NENA 5K36H 4JI4L 3TZDA 1VQHA 3J80i 2INDC 1MHWC 2RVLA 4FNFA 4DN4M 4EGVA 1EIFA 4DV2Q 1J7CA 3QCAA 4ANUA 1O7YA 3PUZA 4O0AA 5H92C 1V86A 1ZDVA 4A3GG 2BF8B 3Q6BA 4KHVA 4E74A 1ISNA 2JF5A 4ZRKA 4LF5L 4HXDA 3T3OA 2NR2A 2MJ3A 5GROA 3BIID 4XGAB 4RGNA 4ZHOA 4RGOS 1WYDA 5KIXA 2VUMB 4OVZA 4GOPB 4DV5L 4TMAB 3JC66 3L17A 1GHKA 4HJGE 3SK4A 3H9DA 2K5VA 4FF3A 5LMNQ 4HAEA 1N63A 3A8IE 1RRBA 3ND8A 3HOXG 1C79A 4A3KH 3PT2B 4LNKA 2EY6A 1XWEA 1LTGD 3KLSX 3JAMc 4Q5VA 3F8TA 5AZHA 2NBWB 1BVSA 4JI8Q 1BMLC 4N58A 5EBCA 2IX3A 3I55A 2GLSA 2KDBA 2KXJA 3A9KA 4YXDB 1VJKA 4DV4L 4JV5Q 4IFDH 3VYSA 5IT9c 3H7PB 4ICVA 2KO3A 2Z4IA 4I65A 4EUTA 1S72A 1EY0A 4L23A 3VTWA 1AN8A 1CQVA 3ERSX 1C7YA 4LF6Q 5FR6A 4A8XC 4DK5A 2AQ1B 3W3AA 5EQ0A 4MTKA 1VQ4A 1VQBA 4W9KA 3T3NA 4B9KA 2I1JA 1X32A 3FKIB 2A68C 3HKZB 3DVNV 3VA7A 4A3CH 1KFYB 1VLBA 4NAWB 4F8CB 1EYDA 4J1MA 2KX0A 3SR1A 5HGQA 1VQDA 2NVTH 2L11A 1TWGH 3OOCA 1SN8A 1MFWA 3VR9B 2K5QA 4B0MA 5M3FG 1WYWB 4C3IG 3ZNID 4DDGD 1SNMA 1B3AA 1WE7A 1L5PA 2A6ED 3WCQA 2N0SB 1QZHA 1FRDA 3RUZA 3G4SA 4PYUA 3N6RA 5C4ZA 3R7RA 3I91A 4X62L 1IZ6A 4DV2L 3PGEA 3VR3A 2DJGC 3QAQA 3RPFC 3EFUA 2F0KA 2NZ1D 5J22A 1B44D 1SYGA 4HIOA 2SDFA 2KCMA 2RHQB 1VDVA 2A74C 3T53B 1FFVA 2DZMA 1M4VA 2L52A 3IFTA 4WWNA 3E9HA 1ZPSA 4TQ0A 3HRZC 4YCVA 1FRRA 1ESFA 1EYCA 1EOVA 1QT9A 3SR6A 3IFDA 2D3GA 4WWOA 4MN3A 3MHBA 3BS1A 2REXA 3KLWA 4RHSA 4C3HB 3OG5A 2HTHA 1GKHA 3EA6A 3UDXA 2PCFB 1ZDXA 1JORA 1TWHB 2IPKD 2CFMA 3FRPB 3TP6A 2EMSA 1FD7D 5GAHC 2GB1A 4KGSA 5C6AA 3A9KB 1Q86C 4ARCA 3ULPA 3V62A 2Q5WD 4JV5L 5E4WC 2Q8TA 1RYJA 4IZ8A 1SDFA 3TEYA 4I6LB 1WRDB 1LTLA 2F0PA 3WWVA 4DR1L 3UI2A 1XJVA 4LFBL 3LXFA 4FLHA 4LF6L 2M1MA 4AOFA 3J81c 2PE6B 1PGBA 5FLMH 2XK5A 4ITKA 1PQSA 1VQEA 2WP8J 4CJ0B 5EPKA 4IN3A 4UHVA 2EKEC 3TN2A 2IY1B 2KOLA 4PK1A 4IPGA 1CUKA 2Z1CA 4C3JH 1B50A 1TTNA 2KQ4X 1HZCA 4A3BG 2EYMA 2EXDA 3BVZA 1XEEA 1VQGA 2GN5A 2K50A 2EYHA 1X9NA 1EIGA 5JVH3 1FXTB 4NKLA 1YJNA 4PZ7A 5AFWA 5A2QE 4HK2A 5G3LD 4W9CA 3MJ5A 1XNRL 1SYFA 3K8AA 3KFUA 1HNWL 2F03A 3VUWA 1EQRA 2N7EA 1CTMA 2N9KA 3P4PB 4ANXA 2LD9A 4DU9A 1OTCA 2IGHA 4K6DA 2JXMB 2V3SA 1HEZE 1SAPA 3B6YA 2INPE 1VQNA 3RYTA 1D2BA 4B3MQ 2B63G 1HR0Q 3FPUB 3S1QH 5CC4A 1L2NA 1PTOC 1Z2MA 2G3QB 1RM6C 5J2RA 2KDMA 2KDFB 1Y1WB 3I4NB 3ECIA 1K50A 1OXSC 5IP7G 3UE1A 3X3NA 3PS6A 2BDNA 2GBMA 4RF0A 1W2BA 3EVQA 3GTGB 2BVCA 2LS01 1KM7A 4DR3L 1W6KA 2DYBA 1PYBA 1UAPA 1D6EC 2IO1B 3QIAA 5J17A 4R4QA 2OWOA 2D11A 4LFAQ 5CV6A 1CZGA 3RNAC 2N49A 2RPVA 4IOAA 2JZ3B 2G1EA 2R92H 4CQNA 2PZUA 3KWVA 3H6NA 2OF1A 1I4QA 1VMCA 2AX5A 1PRTC 1OQYA 2I0QA 3FKYA 3HM3A 4WIPA 5FK9C 1V8QA 2J7QB 1F77A 5BN5A 4R8IA 4GLAC 2Q2HA 2AL3A 1U0LA 1B9NA 2WXHA 5TR5A 4M8NA 2UU9L 1QCBD 5CR3A 3PHXB 4RKBA 2ZJQA 2WXPA 3CW2C 2HJ8A 1LTID 4HJ5A 1DGJA 3EFXD 3KF8B 2D62A 4LTUA 4YTNB 1IYUA 3I4NG 4B3RL 1YQBA 1WGYA 1WXVA 3NQIA 1YITA 5IWAL 4HCPB 4IFDJ 4QL5A 3V6CB 4RGMA 3C3LA 4Y52H 2WB1E 1A70A 1CHPD 5IKCM 4M8MA 4DXGA 1C78A 1A62A 2ZW1A 1WCMH 3MP9A 5DCNA 3A0JA 1GC6A 1PTOB 3PMFA 2WNMA 1QG7A 4OVVA 1YN3A 4II2B 5BYSA 3HEJA 1JQ4A 2HCIA 4A3DG 2ZT9C 4CJ2C 3AE6B 3UQBA 4KN4C 1I4PA 3M3JA 2JA8G 4KV2A 1JC7A 4MEMA 5KNBA 4M02A 2CJOA 4QIWE 4W9JA 2L9HA 3MXUA 4GGQA 3KLSA 1WM3A 5DM63 4FHKA 4QUCA 3TS2A 4ZLTF 4BY7B 3MEFA 2N9EB 3E0EA 1JQYD 2DZIA 2JVCA 1MI2A 3AULA 1EFID 1KDAA 4K8IA 3HOWH 2BGFA 4AYBE 2WDVB 3ZVVA 2DY8A 5IAAC 1G51A 1PRTB 5AUIA 2LFNA 3AE4B 1IBXA 2A8VA 3VYRA 1M94A 2Y0SG 1WJNA 3CSFA 1EQVA 2J52A 2XWBB 2V3NA 2PQEA 1ILPA 2HDEA 4MGZE 3VDZA 1WJUA 4BXXG 3RD2A 1YJ9A 2M00A 4LFAL 3JVZX 4IM2A 3TL5A 2ZNVC 4F88A 2D07B 4N9TA 1LTAD 1CQFA 2BE5C 2MQHA 1YNXA 4LK1C 1F52A 2FINB 2QC8A 4N8X1 1D5XC 4L5TA 2LGSA 4A3GH 2F0GA 2A6HC 2F0VA 2ONQA 5JHBA 1NJIC 4OX9L 2LI5A 1Z7TA 4XXEA 1WJ6A 3C1FA 4KKUA 3ABVB 3ZNZB 5BYRA 3C19A 3W1GA 4GXBA 2EPBA 2UUBQ 3P1HA 2ZZPB 1TWFB 2V1YA 4BY7G 5M9OA 4XQJA 3S1NH 3NK9A 2RSOA 5C0XI 2ZJPA 5M5WH 3HOXH 1CKMA 1TKWB 2FCQA 3T8MA 5C44B 4FJZA 3OTOL 4XYOA 1JWSD 3FMCA 1WGRA 3Q3FA 4LLGM 3M62B 5JEAG 2NS5A 1IYVA 3HVZA 2FHTA 3FDTA 2KMMA 4A3FB 1N33L 3VAWA 3BZCA 4TVAB 1V1PA 2K01A 1CSPA 2EYPA 2F0LA 2G5DA 3TZUA 1VQ6A 1WSPA 1OQRA 2MRPA 1MKHA 5NUCA 4HWIB 3CCRA 2ZW0A 1STNA 1EFWA 2MX2A 1JWMD 4DUYQ 4ZAIA 4LF4Q 1U4RA 3T56B 4B95A 4JI0Q 1MGSA 1GUGA 4QQBX 3G6JB 1QVFA 3L3OC 2GBNA 1KLVA 3IXSA 4MDKE 1V9JA 2INNE 2KQSA 2NPTA 1H9RA 1I4RA 3VRBB 2Z59B 3NSWA 3L10B 1ZXHA 3BDOA 3A1QA 3SVMA 4FXDA 4O1NA 3PO3B 1UUPA 1FXIA 3NPPA 2PQAA 5HFYA 3H3VI 2GVAA 2ZNVB 2AUKA 1JJCB 1EY8A 4A4IA 3HM6X 3NHEB 3K5OA 2R7ZB 5IGBA 1AZPA 4US8A 1EL0A 2E76C 4IPHA 1I7HA 3RMKC 5EDSA 3G7LA 2RCFA 4AJWA 3NXWA 2JP1A 4DHZE 5IP4D 2ZCBA 3N20C 1TJEA 5M3FH 2N7DA 5IN7A 2OJWA 4YIJA 5J39A 3EJIA 4C3IH 2OEOA 2QDFA 3MXNA 1JCKB 3GV6A 5EAYA 2EXZA 3Q8BA 4FA6A 2JN4A 3S1RH 2KBNA 1K0SA 4ZKCB 3RZOH 2QCZA 1VCIA 2MW5A 3K9OB 3JAML 3QO2A 4KKIA 4HTHA 1LACA 3N9YC 2D0OA 1XX8A 3K81C 1CMXB 2G4DB 3DCGA 1VS0A 1OEYA 5IT9L 1PTOF 4M8AA 2D2CC 2B76B 4NQKE 1YJWA 3NBHB 2ZEQA 5IYCG 2DWQA 4MGIE 3F2CA 1WFQA 4BVUC 4LCDE 1ZOYB 1R9TB 3CF5A 3IG3A 2KC1A 4X3KA 1KOTA 2F3IA 1NBWA 4A3KB 3PZ8A 2UUCL 1HNZQ 5JXVA 2K8CA 4HIKA 1X56A 4KD3A 3AE1B 1HNXQ 4YWGG 2JSOA 3E9IA 2F4VQ 2QA4A 1Y8RC 3H09A 2M19A 3K0XA 1LTRD 3SE0A 3OWFA 5DPWA 1QF6A 5C3EG 3V2TA 1ACCA 4ANWA 2MWSB 2MP2A 2F0DA 2WAQE 1V1PB 2AKWB 1PRTF 2KA7A 3NUCA 4RCNA 2OOBB 2DJFC 2CW0D 3RUIB 1Q1EA 3TREA 1NI2A 1NR4A 1DOIA 2N9XA 3DWGC 1SRUA 4DUYL 4LF4L 1NYRA 5C1ZA 4I7ZC 4P71A 2AWNA 2NPTB 1SYCA 4RGTA 1QB5D 4JI1Q 1TS4A 2AL6A 3HHMA 3DBLB 1IUEA 3AE8B 4A3BH 4LFCQ 2PQAB 2NVTB 1K83H 2JPHA 1R4MI 3ICEA 4B3TL 1HZ6A 4KDLB 3I90A 1TWGB 1PYWD 2LVQA 4CDEC 3MAQA 5T1IA 1RODA 3ZJTA 4DNIA 3AE2B 4LNNA 1A0IA 1PFMA 4DV3Q 5C3WA 1J19A 1DM0B 1E2WA 3SDZA 5JVG3 3W5VB 1AEXA 3MXNB 1J8IA 4FHJA 3K80C 1I4HA 3NQTA 1WMHA 2J7ZA 3LDZE 4RMFA 1Q8IA 4G0NB 4PV1C 3VXWA 4OW0A 1G2SA 4YY3L 3OHXC 3T13A 2B63H 1GB1A 5IE8A 2CQOA 3OYYA 2CH4W 3I9V1 2PW5A 4GSWA 2QW7A 3PUVA 2KTRA 4BFRA 4LNQA 1BO0A 4DXFA 5IP7H 4PS3A 4DR2Q 2PW7A 1A63A 4IWQA 3C8YA 3CMMB 1EIHA 2CS4A 5I9OA 3CCMA 1L1OC 4JI7Q 2BS4B 4XZ4A 1NYQA 1GM5A 3EQLC 3I3CA 1BCPB 3J81L 3A7LA 1VF5C 3A5ZB 2AHOB 4H13C 4GDLA 5J18A 1L4ZB 4GIVA 1EYGA 4JI2L 2Z9HA 4IJLA 1DCZA 1HNZL 4MIUA 1WD0A 1V49A 1VQLA 1HNXL 2F4VL 5FO7B 4DKAC 5LLIA 3U4EG 4G7OC 2MPMA 5DNFA 4QY7A 1F2ZA 4ZK9B 4JBJA 3HIZA 2KWCA 2KCTA 2JQOA 4WFN3 4A55A 2UWQA 2NTTA 2K8BA 2YEPB 4CKEA 1EY6A 1HFNA 3E9SA 2QMTA 3OIPA 2KJHB 1H9MA 3KUCB 4MH8A 1J6QA 1PDXA 4BBNF 3M4YA 1BDOA 4G11A 3N30A 2EE1A 1ZYRD 2IDYA 2B2TA 3I4NH 3TEXA 3ZTDA 4IUPA 4NDXA 5M5YH 3IBEA 4C3JB 2ES2A 2WU2B 3J9CA 4H02A 2KWDA 2PVOD 3J7AV 3T1YQ 1L7YA 3OLMD 2MH7A 1TBEA 3S15H 1UZXB 4ZKBB 2PYKA 2J0JA 4N59A 2KN5A 3BY4B 3MVVA 3LWUA 2KNBA 4B9XA 1PFBA 3P75A 1E9MA 3OSOA 2VQFQ 1BUIC 4A3DH 2C7MB 2KVMA 4DV3L 4NAMA 1XPRA 4WWPA 2IYDB 4EZLA 1QJOA 1LT4D 3E5SA 3PGZA 1WMHB 3SD5A 2JA8H 2F0FA 3RLNA 1R4QB 4HIMA 3WALA 3S1QB 4MNOA 4CKBA 1HJPA 1LM0A 1PZID 1Q3LA 1S3OA 2SNMA 4RWSC 4DF7A 1L6VA 3U9OA 1V6EA 2PMZB 1A15A 2HJ1A 2O6VB 1O7IA 3ER0A 1V43A 2Z8LA 1YJ1A 1S5ED 4HIDA 2BH2A 2WKCA 2M9VA 3Q69A 3H1UA 3NELA 3MC8A 2MJ8A 2VB2X 4BBRG 1DXMA 4AP4C 2KX3A 5FO9B 3GS2A 3ZLZA 1V97A 1WI5A 2ZJRA 3B0AA 4HJKA 3HOYG 4KVGB 1PH4A 2PE9A 3PV0A 4ILWA 5DLQE 3RNGC 4DR7Q 1E6EB 4BXXH 2R92B 4GDLB 1CK1A 3PRZA 4X65Q 4OIKA 2QDBA 4ALPA 4LW1A 4V190 2XEWA 4JK1C 1PH6A 2K5DA 4ABNA 1X3PA 1WGKA 1T0YA 1PTOH 3DEOA 4FADA 1BCPD 1A5RA 2NTSA 3RN9C 1ESRA 4NXMQ 1N9WA 1I3QH 4OL7A 1O78A 2JY6A 3S1MH 3K5NA 4IDIA 2VB3X 1MVKA 2PI2E 2D10A 3NG0A 4YT0B 2WDRB 3CC2A 3W5OA 2EIFA 4F1SA 1EQQA 1IBLQ 2RDFA 1XNQL 2AWOA 4JGHB 3DOWA 2D0PA 3HS0C 4BY7H 1LYLA 1OXTA 4OEMB 5GAGC 1VQ5A 1WGDA 3OMCA 3AEAB 1B4OA 4BZAA 3Q24A 1E7VA 1WTVA 4MM3B 1EU3A 2M2LA 4CHTB 4I7AA 5JEAH 3DVGY 5KYLA 3T16A 1FM0D 3HRDD 2FJ2A 5FOBB 2EQSA 2JEAI 4OZAA 1UE6A 1GUSA 4FULA 2R6GA 4MHEA 3JW0X 2H5XA 3IAYA 1WF9A 2Q8IB 2K8HA 2BS3B 3RNEC 3ULLA 2B2YC 4BOSC 2KACA 3CWIA 4L6TB 1RF2D 2IGDA 1J8CA 3SEBA 5C4HA 2WS3B 1SXTA 3H15A 4IO9A 3HOWB 4DV7Q 4E3CA 3HUIA 1XTDA 1N36Q 2GBKA 1TWFH 1VQPA 1K73C 4I6PA 3BDLA 1NSNS 1TVXA 4IW0A 2YEPF 3OW2A 3TQYA 3OJ4B 4LK0M 2KTFA 4GNXB 2DYMA 1HTQA 3V6EB 4DAVA 2UUAQ 3APCA 4XWWA 4N9F4 4S0RA 1X3QA 5ELDA 3A55A 1JJ2A 1GJXA 5JPMC 4LF8Q 4C7YA 1TZ1A 4LMQD 2WXQA 4X65L 4A3GB 4FN2A 4JBWA 2RGFA 1OO9B 3H94A 3PUWA 4AWJA 5BMGA 2BA0A 4DXAB 1C4AA 2DX5B 2WXJA 4EEWA 4IUQA 1UGMA 3G71A 5LXIB 4BS9A 2QEJC 2E3TA 5CMDA 1U4MA 5IYCH 1SMYC 2XWJB 1VQ8A 2KMCA 4G3XB 2ICIA 1U5KA 3ZQ4A 1SE4A 3R8BA 3S1NB 1GB4A 3ZGZA 1HQRD 1PH2A 2WHIA 4YSXB 2CQAA 5M5WB 3HOXB 2A5HA 1TKYA 4A3JG 4P16A 1II3A 1FGBD 1FL0A 2ZM6L 3CQZB 2FMCA 1UBQA 1E0BA 2JSVX 2KWUB 5T1GA 1ML0D 2K39A 2HDMA 2K75A 5C3EH 3SFDB 1WI0A 3N1XC 2PO4A 1C4CA 1SE9A 5LL6X 3GP7A 3ZW3A 2F3WA 1HZAA 1YNJD 3FHWA 1JWBD 3I4OA 3IRBA 2B29A 4G50A 3RNFC 3C1EA 3K5MA 3CSTA 2KHSA 3NOBA 1NCVA 1FCLA 1C0AA 1SSOA 3D4DA 1H95A 3I7FA 1KF6B 4RNAA 1W3SA 2L15A 2ACZB 4POFA 3NTIA 3R2IA 3LNNA 5IGFA 4JWUC 1EWYC 2EDGA 2WGSA 1VQMA 2VW9A 2E2HH 4YCWA 1IKMA 1NENB 3QK0A 4REZA 4P7IA 3SK5A 1Y1VG 1SB3C 4BY1G 1R9TH 3AE5B 3OAWA 4KY5A 2PNRC 3QOLA 3BYYB 4LUVA 4DV7L 3C46A 2B2UC 4DR6L 1JJGA 4G4KA 5M3FB 3K7UC 4C3IB 5IP9G 5C4JH 5ELCA 2C35B 2KFKB 1LXDA 3S1RB 1XLPA 2FAZA 1WWTA 3RZOB 4MSQB 2PLPA 4IOIE 3S14H 3R3OA 2UXCQ 2MO0A 2DBYA 3PO2G 4PS7A 5KEEA 2JUOA 4DPGA 4LF9Q 1SNCA 1E7PB 5EGTA 1LTTD 1V2YA 3SU8X 4NXNQ 3PRPB 1UE5A 3NHHA 1EY9A 4HVBA 1G2TA 1LLRD 2CHBD 3HFZB 3Q8FA 1G6ZA 4KZ0A 2YTYA 2W3RA 1WTOA 3RZDB 4R4TA 4G7HC 1UH6A 4A3PA 4LF7L 1XPOA 1T3QA 4A9AA 3I4LA 3KDFB 1NY4A 1FVIA 1C4PA 2W3SA 2NBFA 2L8JA 2E2IH 1XD3B 2PMVA 3FILA 2FXQA 1SFOH 3GTPH 2ICEC 4OGQC 1TT5B 5COYA 3QR8A 5TSSA 1QNKA 1QVGA 3BU2A 1C3TA 1EY5A 3L7ZC 2KDIA 4CJ1B 1UF0A 3N1YC 1UELA 3PVLA 1Q1BA 2E75C 4FF4A 2E2JH 2JU6X 3D31A 4AS1A 5IYDG 1MG8A 3ONAB 4DGZA 4DV1L 3K7AH 2DAJA 5IA7A 1NUCA 3HOUG 4H44C 1ZE3D 2KWVB 4KHZA 3Q8EA 5G2NA 3PSEB 1ZXTA 2K14A 3CAMA 3H91A 4DR5Q 4Q2JA 1PH7A 1NMGA 4X66Q 5IGEA 1G91A 2BQQA 4J3OD 5EE9A 4WH4A 2PZWA 3UIOB 2EJMA 5JEAJ 4LNOA 1ASYA 3PF5A 1MSGA 3L4PA 1W6JA 1IHZA 2M4NA 4A3BB 1K83B 3O65B 5AEKB 5IODA 3CRKC 4PS8A 3ENEA 2RBMA 3TDQA 4JI5Q 4IM0A 3SGIA 1GG3A 2D5GA 1UEAB 1J9OA 5T8IA 3KF6B 4F7XA 1QZGA 5LMNL 2A1AA 2X8XX 3ZXRA 1HQMC 2K52A 2OQKA 2K6DB 2K32A 2G9DA 2HD3A 1KC8C 2ZJDA 1JALA 2KLGA 4B6WA 3EBEA 4HDQA 2C60A 1FMAD 4JI8L 1HH2P 1C76A 2VL6A 2EOTA 4DR4Q 2MHJA 3OJ3A 3WOFA 2B63B 1P7FA 3BWUD 5LMUQ 1T5XD 5M5XH 1ZP0B 3P63A 3I4MG 1ICWA 4LF9L 1ZGUB 5F2DA 2EYFA 1Q12A 1NE3A 4NXNL 3KF8A 4BWGB 2B3AA 2J4XA 2YTXA 1CZWA 3MTSA 4A75A 3QHTA 3AV8A 4XDCA 1E22A 4BBRH 5E6OA 3LJ3A 1LFDA 1MSHA 3CCQA 1A8VA 1H9SB 5IGCA 5C4XG 3HOYH 1N61A 2WXOA 1N8RC 3FILB 2Y5CA 1JT8A 3NTHA 1SE8A 3PUXA 1HCZA 4AQ7A 1PHJA 5ELOA 4IFDI 3AI5A 2H1EA 4OO1G 1RWSA 3X3MA 4A6QA 4FXGC 3PZDA 1E8YA 3M63B 4BA1I 1JWUD 3QOJA 4EQPA 5D3IB 4IG7B 1SF0A 4K2LA 4DK6C 3F2DA 4YL8A 3TP5A 2ATWA 3P4QB 1B8AA 3NWTA 3ZYYX 2KYWA 2N1VA 3AH7A 3DBRB 5H1SE 2KJRA 4OZBA 1YHAA 3S2HH 1Q0WB 5GQOA 1XYIA 3QC8B 1LM8B 2IX1A 3NP8A 2INCC 4JI6Q 3DBLI 4DR5L 3OMGA 4X66L 3MJWA 3APFA 5M5YB 4QIWB 3G6EA 1NVID 1SJED 3F2UA 3DEPA 2X6GA 3S15B 1WTXA 1J5EQ 1FXAA 5BN3A 4C2MH 3KBGA 1V1QA 3AMUA 1IW7C 1SNQA 3KUPA 4B9WA 3DVNU 1GJZA 2R7FA 3LYYA 1RLFA 5JJIA 1ILQA 4KY6A 3GDEA 2VRRB 3CKIB 4ZRIA 3QJYA 4TRDA 2J42A 2H4OA 3Q8CA 4DV6Q 4A3DB 2L32A 1XMQQ 2ZVNA 4NNJB 2JA8B 1Q81C 1EUJA 4OIJA 2WB1G 1E10A 1MPEA 4HJAA 1F9PA 1X3EA 4HLEA 1F2LA 3PQIA 3OIQA 1QZEA 2KT7A 4R1JA 3J80c 4V0BA 1LTBD 1F2RI 1VQJA 4A76A 3STBC 1HA6A 3NVVA 1KNEA 2A68D 2AEHA 3WAOA 4HROA 4WQMA 5GMVA 2VNUD 1B9MA 3DUZA 1ZKOA 2Y0SB 2WINB 1X3GA 5BYQA 2L0FA 2FNJB 1MIUA 3NS1A 2VH2A 3D0FA 5FLXc 2MEKA 1PH1A 3KYCD 2Z6KC 2KHWB 2KK8A 2E5LQ 1JWAD 1YIWA 4AYBG 2QJLA 5EKIA 3K9PB 2QF7A 5CV9A 2GBRA 4PNYA 2WQYB 1I3QB 4S3SA 3GTMH 1GC7A 3S1MB 4UPAA 3CPFA 3OW7A 3KJOA 2IBIB 3EHVA 4P75A 1QOFA 1SYEA 5CYUA 4EZJA 3J7A5 1ET6A 2AQ3B 1Y69U 4YCUA 2Z0SA 1N60A 1S5DD 4B3ML 3I56A 1QKZA 5KHOA 3IL8A 1HR0L 5HURA 3A33B 5DPSA 3ZDMC 3I57A 4P1CC 2ZXPA 4A3JH 3AFQA 4NB3A 2YU9H 3Q22A 4IOCA 1Q7YC 4GN1A 4DK0A 2FFKB 2JZZA 3SK6A 1JICA 2IL8A 3RR5A 4JCVE 4W9FA 1F9QA 2NN6G 4MSMB 1RFKA 4QCLA 1VQ9A 4MGKE 5EE1A 2QIEB 1H8CA 1TWCH 2VZAA 1BR9A 5I2XA 4QF4A 2K33A 2IY5B 4FXCA 1LT6D 2LHDA 3U7ZA 1IBKQ 1PH8A 1EEID 1RIPA 3H0GG 1VZ7A 1XMQL 1E7UA 3U30A 4DV0Q 5D7GA 1P98A 2L76A 2OJRA 2W82A 2BB5A 2EY2A 4C80A 3NBHA 1TR5A 1PFSA 1E8WA 3AN1A 1JE4A 1Y1VH 2DNEA 4C1NI 5FJ8G 4BY1H 4GOCA 2BA1A 3M7GA 3M7NA 4B3SQ 3MC9A 3ZRCA 1WTRA 2V3PA 4FJVB 3IHPC 3Q8AA 4MACA 4M00A 3CQZH 2O2VB 5IP9H 1DOKA 4OELB 2WXIA 2BKRB 3I8ZA 4KJOA 1ZXIA 1WXAA 4BA2I 2JA5G 1WTWA 3ZNGC 2R3ZA 3TEWA 4ME5A 2KDEB 3T9LA 3PO2H 1MHXA 3WIMA 1Q5WB 4QJFA 3A8JE 2XBBC 4HCSA 1YNNC 1O7LA 3CCSA 1AP0A 4LJPB 1FNVA 4HEDA 3GTQH 4HKQA 2QGQA 4TKNA 3I2ZA 1WX8A 2K03A 2RA4A 4A3IG 1WRIA 4OXPA 4EQ5A 2JE6I 1PTOD 3L16A 4G57A 1S4ZA 1WX9A 2PKOA 5IGGA 1NI3A 5CTRC 1AYFA 2BYFA 4ZRJA 3OWEB 4BBSG 1CKOA 2LXCA 4KX6B 1YVCA 2DAFA 2KN4A 1V80A 2WYQA 3B2FA 3TMPB 1JW9D 1DONA 3DLLA 1XLNA 3TP7A 4K7SA 3W1YA 1WGGA 3ZKJC 4YWKA 2J0MA 4FVMA 1XMOQ 2KLCA 4KKJA 4NJ6A 4PMCA 1AH9A 5C3EB 3EGRA 5JZEB 2JYOA 1EF5A 1RD9D 2PNHA 3PSIA 5JJZA 2GI9A 3DVGX 1RDPD 2CJNA 1J0GA 3GE3C 3FP9A 3A54A 4HSVA 4XTCS 1STYA 5IYDH 1PRTD 3TJPA 2E2DC 3HOUH 2QHOA 4EQOA 4YHHQ 2D5DA 2PVGC 2VQEQ 4ZRQA 2FBWB 1CI3M 3CCVA 2WAQG 2DNFA 3WOEA 3RZDH 5HGTA 2E2HB 5ELFA 1RJTA 4DUZQ 2V4LA 1L2FA 2WXFA 4C4VA 1JOKA 2UUBL 2PJHA 2ON8A 3KK7A 4A3MG 1JOQA 1J7BA 2J0KA 1TT2A 4CGYB 1DD2A 5CX3A 5C4JB 1I6VC 1X3FA 5L37A 2O2LD 2H89B 3ZIMA 3CMAA 1EEFD 1STBA 3S14B 1Y8OB 1KL9A 1T0QC 3GTLH 1WGHA 2I1KA 3KW5B 2JYTA 2K05A 3N32A 2MBQA 4KJNA 1YN4A 3JAME 4KK7A 1EWIA 3S2DH 3FC4A 3EFCA 1Z9FA 3I4MH 1MI0A 3E3XA 1KD1C 2Y5BB 3KVFB 2NVXH 1TKGA 4XYQA 1AWDA 3I3TB 4JI0L 4C00A 2BTEA 2KQ7A 1ICFB 4OONA 5IT9E 4B0EA 4RKLA 2K22A 3IT6B 4WAFA 1T0RC 1SMXA 4IALA 2E2IB 5C4XH 1SFOB 3NVYA 3T4AC 3GTPB 4KKSA 3ZJYC 1IBMQ 1UEBA 2F4IA 4LJZC 4II3B 4CBVA 4CKCA 4M1UB 1N32Q 2RDBC 3K5LA 4OO1H 3AB5A 4IC7B 1FO4A 3NY5A 1XMOL 1BUVT 4U673 2K0PA 1VQCA 4UAIA 3R93A 1TZOA 3KLRA 4AQYQ 2E2JB 1E1TA 1YEZA 1N5WA 2MQJA 2RMMA 3NS8A 4JQWC 3K7AB 5EJWA 2BE5D 2KECA 2LHEA 4F87A 4GS3A 3E56A 1FGUA 1GHJA 2A6HD 1QUQA 4R3DA 2E6XA 1BQQT 4JPSA 1WYGA 4ASWC 1I5FA 2O6VA 4HPMB 2ZTDA 4YHHL 2CHZA 3MFGA 4POGA 2A69C 4K5VA 4KHPQ 5D2MB 2D3AA 2BYEA 4K14A 4D2KA 2HD5B 4WJ4A 1KAWA 4NPSA 3IVFA 1V9PA 3RLFA 2KMAA 4DUZL 3SXHA 3N1ZC 2JXXA 2DNCA 4C4VB 1A3TA 2V0GA 1EY7A 1YZ6A 5EKKA 2XIWA 1K52A 3AQQA 4QAYA 2R2QA 1BBXC 4M01A 4E71A 4FF1A 4EOYA 4DAYA 4K3CA 3VDYA 4EKUA 3Q6SA 3QX1A 3OPOA 1OXXK 4K5XA 3K57A 2L7RA 3WAPA 5JH5C 1XCTL 2BCOA 5LXHA 1FD6A 1KRTA 3Q23A 3GB1A 5ELEA 5M5XB 2AWTA 1KDCA 1OQQA 2F52A 1HXYD 3D3RA 4KZCA 2F3VA 2HTME 1PMRA 1G6JA 3HOVG 2EVBA 2JA6G 2XSCA 4Y7NH 2KVZA 4UP8A 3NTKA 1NDDA 1RKNA 4KLKA 4RCOA 2RSNA 3DPDA 4MELA 3TUOA 3B08A 1X54A 3X23A 1GOZA 3WDNA 2PW9A 2MUYA 1D7QA 2WXLA 1T6BX 3TCAA 4BBRB 1DYQA 4WAAA 2OHFA 2WV6D 4GN5A 1CKNA 3Q3NC 3I63C 1QOBA 4NW2A 1ASZA 4MM3A 3T51B 2SNSA 3TMEA 3V05A 3HOYB 3P4RB 4PZ6A 4JI1L 2LXKA 3MFYA 2LASA 3AU4A 4WJQA 4LFCL 5EE3A 3HP3A 4JOIC 3J81E 3PLUA 1XF5L 5E6NA 2LRUA 3DWQA 4OZCA 1L0XB 2ASBA 5A35A 2EYJA 1HTLD 2IGGA 2Z0EB 1I94Q 1Y8NB 1MJEA 3W1SC 2JRIB 3MXGA 2LY7A 1XLQA 2N7JA 5EKLA 4IPCA 4A3EG 3S2HB 2JZPA 3X0WA 4G7ZC 1IL8A 1WXSA 4FO2A 1L1OB 3JAMi 3VVWB 5FR3A 2KQ3A 3IAS1 2BB6A 1KTKA 1YQ4B 1QUQB 3AEDB 2C9OA 4JI3Q 1OGWA 2CCZA 1NEKB 2RDHA 2BPSA 2ZPNA 4DNRB 5HG2A 1K8AC 1AE2A 4CO7A 4DAMA 1KLUD 3EN2A 1X65A 1HE8A 2LWPA 3NBIA 4DR2L 1KRHA 4KDIC 3J80L 5G55A 4GNXA 4C2MB 4QGUA 2BW2A 3NRZA 1X1MA 1F0ZA 4JI7L 4P2CB 2MBHA 3O13A 2FCNA 1TQOA 4KIKA 2NN6H 1VMPA 1RHPA 2A4ZA 1TIFA 3DWMA 1B53A 4XDXA 3AMZA 4ZUJA 3HVDA 3E6ZX 4MZ9A 4KN7C 1KQSA 2F0QA 2K28A 4DAYB 1EM7A 3HOZG 3VR2A 2DN8A 5FLXL 3DBHB 3GTKH 2JA7B 2WWZA 2BDOA 3DHHC 3H0GH 1PLFA 4LNIA 1E7ZA 5JPNC 3U2SC 1WXMA 3VUXA 2I5HA 4K8JA 2MP1A 2N4FA 1SE3A 4RH6A 2D9UA 3G48A 3Q8DA 4WORA 1QLBB 3HK0A 3FEWX 1BT0A 3PZ7A 4MT5A 4BKGA 3FAHA 1P8LA 1TY2A 4JG2A 2JRHA 3QARA 4ARIA 5FJ8H 5K5PA 1VQAA 2C5LC 4PMBA 4DFAA 3J81j 4JL9A 3CCUA 1YJIA 1HA5A 1VQOA 1CKNB 1EQTA 5LHY1 2B2YA 3DHQA 2ENBA 5L95C 1SEBD 4XDDA 2F0OA 2RQXA 3M4QA 4W9HA 1D5MC 2JA5H 5H8YE 3S2AA 3T1YL 3HKSA 1PVOA 2B8GA 2L5TA 2BS2B 2L3ZA 3UGBB 4P74A 1DOMA 3DBRI 1UE1A 3T1HQ 3D4WA 4HEA1 3GO5A 3GTMB 2K7VA 2N3SA 4GKKQ 1EWCA 2FUHB 1QILA 3D4RA 3TEHB 3D32A 3K59A 4KGTA 2I5MX 1CA5A 1JRPA 3P42A 3PTFC 4W9LA 4KI0A 5IY0A 3RN5A 4A3IH 4R4OA 1I94L 5BN4A 2VQFL 4ICUA 3B9JA 1WZ0A 4F7ZA 4O42A 2JA7G 5E4XA 2Z0DB 3ULJA 2BOSA 2L0TA 1KNAA 2YYZA 1KJTA 3CHBD 1LABA 1B2TA 2LUMA 4R4CA 4EX5A 1D4BA 4BBSH 1L6UA 1YJJA 2LVOA 4JI4Q 4XX5A 4A3JB 3A4SC 1T9HA 2YU9B 2RD0A 3MC0B 5C0XG 2WP9B 4HRSA 3RFZB 2N1WA 5C3XA 2B2VC 1SR3A 2RCNA 2O6VD 3A56A 1F1HA 3Q3OC 4RHRA 2A6EC 3UF8A 4LF5Q 1GPXA 2PMZE 4JE3B 3W9CB 3PCOB 1FNWA 4KIKB 2LGDA 3H8HA 1TWCB 1F2YA 1SIJA 1EIYB 4DR7L 4DV5Q 2DLBA 2V1CC 2IT1A 3BZKA 3PHWB 2AYOB 4FDBA 1RAXA 2K4KA 1QWYA 4PZ8A 1LGRA 4J8QA 4ZOHC 1IKLA 5E6PA 1K53A 3BJUA 2VH1A 4KMUC 5DAUA 5KYIA 4NXML 3MZ5A 1TS3A 1BNZA 3DDCB 2IJ0A 1WX7A 3KYDD 4WQOB 5CV7A 4ME3A 3TRZA 1Y1VB 4N9PA 1MJDA 3KDFA 2PPBC 4BY1B 4W9IA 1NAPA 5EE0A 4UDUC 4DV4Q 5HI1A 3LX0A 2IY0B 4GOPC 5BR8Q 2NZHA 1IBLL 2YV5A 1KIXA 3ITPA 3UIPB 1I6HH 2NUCA 4A3MH 1PH3A 1QQRA 4NP5A 2KZRA 3EUB2 4IM3A 2Q8RE 2GMIC 3HGBA 1S40A 2EKIA 4IUUA 4DA2A 4K3BA 1NTGA 3PO2B 5EPLA 5I6YA 4FJYA 1Y8PB 1XQQA 3U58A 3GTQB 2RDGA 5CV8A 1C1YB 3SHLA 1NMFA 1P7EA 1VQIA 1YQ3B 2B2UA 2K5WA 1GNUA 2N78A 1YI2A 3ML8A 2YVCA 2MGSA 3W5UB 1P16A 1TY0A 2UYZB 4YTMB 1WR1A 4HJ7A 3VYUA 1R4MB 2M0XA 5C2TB 4C56C 1WTPA 2AMCB 2Q2IA 3RZFA 4LDTB 4DHJB 2OTLA 4CHKA 2NZOA 1K3BC 3P20A 3HZXA 1GO3E 4GN4B 4J6IA 3GD7A 3KF6A 1N36L 1K8MA 2C5CA 2R61A 3K6OA 4X62Q 2UXBQ 1STAA 1YX6B 1NBFC 3VHTC 3VH3B 5J3BA 4L5QA 2OEDA 2EYLA 2B2WC 3DXJC 2UUAL 4L2YA 4URKA 2K04A 4P73A 1VQ7A 3HOUB 4A93G 2DENB 1BBUA 1RFAA 3D6CA 3M4OH 3GTJH 1PFDA 3KOJA 4JX1C 1UWXA 2GA4B 4LF8L 1TGZB 2GRIA 5JJKA 3RD4A 4E6IA 4DAPA 4FYDA 1MHHE 2MBBB 4MJSA 1MBYA 1RTOA 3VR8B 1MG4A 4RG1A 3VH4B 2ZXRA 2R93G 3VRAB 1SSNA 5CHVC 4NPNA 3GTOH 4CDDC 1ZEQX 5GADC 2DYOA 1H9SA 2FE8A 4HR7B 5ELBA 2VXWA 3GOEA 5M3MG 1K8GA 5DEHA 2HE7A 3J7YW 4YSZB 3LB8C 1SGHA 5CORA 2FUG1 3NZ3A 3W2DA 5BR8L 1QOHA 3M4PA 3I73A 5KNCA 2K25A 2ZVOA 1K51A 3PF4A 4CDFC 4DR1Q 4LFBQ 4FXKC 5E3FA 1NR2A 4ID6A 3M95A 2CHXA 2IW3A 5CHFA 4W9DA 2K9XA 3ZDTA 3GTLB 2LRWA 1EF1A 4XWTA 4A3OA 3L13A 1EU4A 2E8GA 3CRLC 1WXQA 1YX5B 2KOXA 3L9AX 3H6MA 3U4ZA 3ERQA 2JQRB 4MH0E 3S2DB 3TP8A 3DBSA 1GD7A 2CWAA 3I4MB 3NZUA 4M0WB 1PA6A 5I2YA 3HOVH 2JA6H 3S17H 1Q8KA 2PTLA 1BXTA 2VUMG 1LT5D 1A2UA 4JYAQ 2NVXB 1JE5A 4XT1B 2KAJA 3RI7C 2X6LA 4S17A 1LUZA 3L2PA 1DJRD 2XRQD 3RN2A 1XNRQ 1HNWQ 3NZSA 3BVMA 4H2AA 3M9BA 5HY6A 5CV4A 1M1KC 1ENCA 5C4XB 2V9HA 3Q3MC 2B39A 4RMAA 2WU5B 5MPOA 2F0NA 4BKTA 1PYSB 2ID0A 3SK8A 1I42A 5IGDA 3SDLC 2XVSA 2SAKA 1VF7A 5FO8B 5C23A 3S16H 1KDBA 4ZUIA 1AE3A 1IYJB 3IFWB 5LL6S 2F1MA 2UXBL 4DHJD 4LDTD 2R7DA 2D2QA 1KLGD 1E2ZA 4GN3B 4KTAA 1SNDA 1EY4A 4IJHA 4A3EH 2O4XA 1WIAA 1ROEA 4NQLB 4DR3Q 4RF1A 3A74A 1HZBA 2NCNA 3PV1A 2V4DA 2UXCL 3FKIG 5KRUA 5FKAC 4DDID 4WJWA 2SOBA 1DOLA 2K5PA 3HKZG 1GUAB 2L83A 4K2KA 3VYTA 1V81A 1SYBA 1Z6HA 4R9WA 2O5JC 4MJSB 1OXVA 3PPAA 1SMYD 2HUGA 1IGDA 2F0JA 1FPYA 2QKIC 4KY7A 5A2QL 1TWAB 2EJFC 2MCNB 2FCMA 1C9OA 5LMNW 2BWES 1UWVA 3PIO3 1EOTA 3CU7A 2HT1A 4EE2A 3BDCA 2L12A 3AE7B 2RR9A 1ET9A 4GB9A 3UDFA 2WACA 3U8ZA 3U4VA 2LUEA 2UU9Q 4XT3B 1JMCA 1GVPA 2AQ2B 1YHBA 4A20A 3HOZH 2ALYB 3HKZE 3PUYA 1R4NB 1YMHE 3AEVA 2N9LA 3GV3A 2WB1B 1IL2A 3CD6A 3NEMA 4B3RQ 3GZNB 2WKDA 5IOIA 5IWAQ 4JWSC 2HIXA 1HPCA 2HIVA 2JK8A 4L8JA 4Y7NB 2QEXA 1FR3A 1D1IA 2UU7A 3A4RA 1OFFA 4GU2A 5LNK1 2PZTA 3IKJA 1PXUA 4HN7A 1WTQA 3ZRFA 1PZJD 1GUOA 4JYAL 1V5TA 2OT2A 2EJGC 2F0WA 1KRSA 1XTCD 3P7JA 2FCSA 3ZNHB 3RLOA 1FYCA 4HDOA 4C3HG 2WLBA 2KKCA 2VZKB 3R66C 1E24A 2LXJA 5C5LA 1HRJA 1X6OA 4Z9CB 2JA9A 1WOCA 4AYBB 5IOCA 1PUTA 2WXKA 4WWMA 2B8FA 3BG3A 4JI5L 4US9A 2RPQA 3VQIA 1C9FA 3AE9B 1YOVB 4LJOB 4WJPA 4HPLB 1Y56A 2MJEA 2NVYH 3CCJA 4GZYC 1ZW7A 2TMPA 1K9MC 1B7YB 1VQKA 2JA7H 4EVOA 1NNXA 2B3GA 1P3QU 1WD1A 5KGUA 4DR4L 1HTPA 3PRMB 4RM8A 4RM9A 2XN9C 5LMUL 2RKSA 3I72A 2Z6KA 2Q2TA 2A19A 1RL2A 2KEEA 1DZ1A 3RULA 3TIXA 2NMQA 4YSYB 1FNUA 5C0XH 2MA9B 4LUZA 3CMEA 2L05A 2WDTB 2G9HD 5AZFA 5GXGB 1C48A 2LGIA 3V3XA 1EWHA 2O2VA 5G3LF 3UI3A 4OX9Q 3IT4B 4YWLA 1E0ZA 3S24A 1P9DU 4UY8C 2WXRA 3C2PA 2KENA 1R7SA 2NVQH 1N5XA 1VZ8A 4XC2A 1LO5D 4LWCA 2KEDA 3QJZA 3CF6E 2HHHQ 1EZ8A 3ND9A 2MO1A 4PMWA 1H9JA 3GTKB 2JWUA 2N9PC 3FVQA 3WAMA 4Q0FA 3H0GB 1GUWA 2C7NB 3MHZA 3ML9A 1E3PA 3AM9A 3S9WA 1YN5A 2A73B 2XK5B 2L55A 1Y1WG 2KUMA 3OTOQ 3JSVA 1OXUA 4H7BA 5JOBA 1C8CA 1STHA 1EYAA 2G4SA 2GOWA 1N33Q 3H3VH 2JT4B 1CA6A 2LJ5A 1RTNA 1YHQA 2Z4HA 4JI6L 1DGSA 4XIGS 2F0TA 4QB4A 1I50H 2MFIA 3AEBB 3MXPA 1WJJA 1N6ZA 2DHZA 1BF4A 3L54A 2VY3A 2V4IB 2KHJA 2RF4A 2JA5B 3RNCC 1CZPA 2ZTEA 2CW0C 2XTIA 1J5EL 5ELNA 2Q2UA 5AJ3Q 1S1QB 1B9RA 1HZ5A 4GKJQ 4DHZB 2XNAC 1SIFA 2VZKD 4A3IB 1IP9A 4W9EA 1A2TA 4DV6L 4N8FA 2E74C 1HR0W
chains in the Genus database with same CATH topology
2AUJD 1U9RA 3NWSA 1U4PA 2EY1A 3Q0AA 2NYZD 4C1NK 4FF2A 1HFGA 3PO0A 4BBSB 1F9RA 1S5BD 3EROA 3AEEB 4IQZA 4RA8A 2CVRA 4L63B 1HUMA 2WDQB 1A3UA 2K1BA 3QG1A 3J7AF 3BVGA 1VDZA 4IUVA 1CM9A 3P1MA 1TS5A 4X3TA 3N52A 1FCCC 2LEKA 3AEGB 1QOAA 3ETRA 2WAQB 2BBCA 5EPJA 4ZQ3A 2WIIB 4QUFA 4FP5D 4X3SA 1I6HB 4A3MB 1B1ZA 2N55A 1I4XA 1N62A 2JX5A 1I4GA 1IW7D 3MEHA 2HCCA 4ZYSA 4OHJA 4HMIA 4EQNA 1O80A 2IX0A 1TIID 2QSDA 3K58A 1G291 1KH0A 1PZKD 4PT5A 1H9KA 3VR5A 1ZYRC 1T5EA 1E2VA 1A6XA 1CHQD 2X69A 3URYA 3QB3A 5J1ZA 1IBXB 2WXGA 3VR4A 2F0IA 2J53A 3BYTB 3AEFB 1Z47A 2W54A 2L4NA 5CGKA 1Q90A 2MHVA 3DWPA 1UWMA 3MWYW 2ZXOA 4K5WA 3M4OB 3GTJB 5KNDA 5C3JB 1C4QA 5CBEE 5C0XJ 2FMMA 2I38A 3E0JA 1JROA 2K3UA 3PIP3 1PFNA 4YTPB 2L1AA 4R8NA 3GQBA 5D3DA 2N88A 1CT1D 3GTOB 2EZVA 3TSSA 1AZQA 1GXDC 3IAM1 3V96A 1F2RC 5K36G 2BYTA 1BCPC 2MJDA 2W55A 1QNUA 3A8KE 3I70A 4DNTB 1G8ZD 4WRDA 1DOYA 2EELA 1K8OA 3AE3B 4K6LA 4IUNA 2KJXA 1L0VB 2LJIA 3HOVB 2JA6B 3S17B 4IKGA 1SJHD 5I9PA 3BK2A 1RCVD 4F8MA 1YNTE 2EYOA 4P6VF 1DOXA 5BMIA 1LTSD 2HDLA 2Y5PA 2JEBI 1L4DB 2F0MA 1LV9A 1CFMA 1KAAA 4TQUS 1XO3A 2O5IC 3S16B 4IURA 1HHVA 4KKTA 4RFBA 4IFDG 3HG9A 3ZJUA 1VRAB 1WVLA 2XRSD 2LKVA 4ODGA 5I4DA 4A3EB 2JYEA 3NVWA 5AUKA 5D65A 1YNND 5IIFA 2H88B 4PQXA 5E1FA 4ZRPA 3DMUA 2LMCA 3VR6A 4ZRZA 1JB3A 2JXTA 4QMGA 3AECB 1XXGA 1A3VA 3CIRB 3W1SA 3M85A 1O7ZA 3D6WA 1S5CD 3SFEB 1D1KA 4WURA 2I46A 1QOGA 1STEA 3K0YA 3HOZB 2IWHA 5CBAE 5JAVA 2EY5A 1FFUA 4HKZE 2NB0A 2QILA 1C77A 2KCCA 2CU3A 5DM73 2BT6A 4GDKB 1STGA 1V1OA 4TKOB 1J7AA 1F9SA 1L0YB 2I07B 2M56B 3DM1A 1V8CA 1JOOA 4OO1I 4HCEA 2F0SA 3B2GA 1BOSA 3NVZA 2B2TC 3AU7A 3NE5B 1YNJC 3KBXA 1SNOA 3H3VC 1F2MA 1JR0D 3U52E 1ONLA 4XE0A 2SEBD 3BZDB 4DK1A 4USAA 2L1BA 2NVYB 4HSPA 4KD4A 2F0EA 4IUTA 4H0LC 1TU2B 5C5MA 1HUNA 1TYGB 4C3JG 1D5ZC 2LMCB 2L0CA 2NWGA 2I2YA 4DQOC 1EZ6A 2TSSA 2WXNA 5D14A 1PGAA 1VR9A 2WXMA 1VZ6A 3J80E 1XLOA 2NVQB 5BMHA 1SNPA 3QWNA 3P4SB 4X3UA 1LT3D 1TS2A 3LWEA 5I6WA 1R4PB 1AW7A 1U4LA 5FLXE 3DWAA 1CJEA 2B2VA 1AFPA 1GUTA 4TSSA 5G5GA 4B08A 1TKEA 2Y3AA 2A69D 2QCPX 5ISRA 3TEZA 1M8AA 1UNSA 1WCMB 4A90A 4J6HA 1I50B 4N6EB 3KQ4A 3TBIB 4GLSC 2PIAA 3U9SA 4KV6A 1BCPF 3NUHB 2M0AA 1ZUD2 4LAAA 1XCQL 1PGXA 1S5FD 5E6JA 2F0HA 1MD2D 3R2TA 3M3YB 4U68A 5CV5A 4ZHPA 5HHDG 1JMLA 5G5HA 2X38A 1ENFA 3A7AB 2NN6I 4XQQA 1SE2A 4XQNA 2HQEA 2LFIA 3MA2B 3RMHA 2K6AA 1Q10A 4HMJA 3BK1A 4A93B 3FPPA 1QE6A 1GAQB 4KGRA 4TQ1A 1UGJA 4NJCA 3D8GA 1SBBB 1FEHA 4M0WA 1ENAA 1FIQA 2F0UA 4L1BA 3AB9A 1PDQA 3ZJVA 2R93B 3VA5A 4C7ZA 4NZLB 1KABA 4NMZA 1GUNA 2B2WA 2KCNA 3KWLA 5EBDA 2J0TD 5M3MB 1SYDA 2DY7A 4ULLA 2OXPA 4RAUC 1IGCA 5K36H 3TZDA 4EGVA 4DN4M 2RVLA 4FNFA 1J7CA 1O7YA 3PUZA 5H92C 1ZDVA 4KHVA 3T3OA 2MJ3A 3BIID 4RGNA 4ZHOA 4RGOS 5KIXA 2VUMB 4OVZA 4TMAB 1GHKA 4HJGE 3SK4A 4FF3A 4HAEA 1N63A 3A8IE 3ND8A 1C79A 2EY6A 1XWEA 1LTGD 3KLSX 4Q5VA 1BMLC 4N58A 5EBCA 2IX3A 4YXDB 1VJKA 4IFDH 3VYSA 2Z4IA 4I65A 4L23A 1EY0A 1AN8A 1CQVA 4A8XC 2AQ1B 3W3AA 5EQ0A 3T3NA 1X32A 3FKIB 2A68C 3HKZB 3VA7A 1KFYB 1VLBA 4NAWB 1EYDA 4J1MA 3SR1A 2L11A 3OOCA 3VR9B 2K5QA 4B0MA 4C3IG 1SNMA 1B3AA 1L5PA 2A6ED 3WCQA 2N0SB 1FRDA 3RUZA 3N6RA 5C4ZA 3I91A 3RPFC 3VR3A 2F0KA 2NZ1D 5J22A 1B44D 1SYGA 2SDFA 1VDVA 2A74C 3T53B 1FFVA 1M4VA 2L52A 3IFTA 4TQ0A 1ZPSA 3HRZC 1FRRA 1ESFA 1EYCA 1QT9A 3SR6A 3IFDA 4MN3A 3MHBA 3BS1A 4RHSA 4C3HB 3EA6A 2PCFB 1ZDXA 1JORA 1TWHB 2IPKD 3FRPB 3TP6A 1FD7D 2GB1A 4KGSA 5C6AA 4ARCA 2Q5WD 5E4WC 2Q8TA 1RYJA 4IZ8A 1SDFA 3TEYA 2F0PA 3UI2A 3LXFA 4ITKA 1PGBA 2WP8J 4CJ0B 5EPKA 4IN3A 3TN2A 2KOLA 2Z1CA 1B50A 2KQ4X 2EYMA 3BVZA 1XEEA 2EYHA 1EIGA 5JVH3 4NKLA 5AFWA 5A2QE 5G3LD 3MJ5A 1SYFA 2F03A 3P4PB 2N9KA 1CTMA 4DU9A 2IGHA 4K6DA 2JXMB 1HEZE 1SAPA 2INPE 1D2BA 3FPUB 5CC4A 1PTOC 1RM6C 2KDMA 1Y1WB 3I4NB 1K50A 1OXSC 3X3NA 4RF0A 2BDNA 3EVQA 3GTGB 2LS01 1W6KA 1UAPA 1D6EC 3QIAA 5CV6A 1CZGA 2RPVA 2G1EA 4CQNA 2PZUA 3KWVA 2OF1A 1I4QA 1VMCA 2AX5A 1PRTC 4WIPA 5FK9C 1V8QA 1F77A 5BN5A 4R8IA 1B9NA 2WXHA 1QCBD 5CR3A 4RKBA 2WXPA 1LTID 1DGJA 3EFXD 4LTUA 2D62A 4YTNB 1IYUA 3NQIA 4IFDJ 4RGMA 3C3LA 1A70A 1CHPD 4DXGA 1C78A 2ZW1A 3MP9A 1PTOB 3PMFA 2WNMA 1QG7A 1YN3A 1JQ4A 3HEJA 2HCIA 2ZT9C 4CJ2C 3AE6B 4KN4C 1I4PA 1JC7A 5KNBA 2CJOA 2L9HA 3MXUA 3KLSA 5DM63 4QUCA 4ZLTF 4BY7B 1JQYD 1MI2A 1EFID 1KDAA 4K8IA 2WDVB 2DY8A 1PRTB 5AUIA 2LFNA 3AE4B 1IBXA 3VYRA 1EQVA 2J52A 2XWBB 2V3NA 2PQEA 1ILPA 2HDEA 2M00A 4F88A 4N9TA 1LTAD 1CQFA 2BE5C 4LK1C 2FINB 1D5XC 2F0GA 2A6HC 2F0VA 2ONQA 1Z7TA 4XXEA 3C1FA 4KKUA 3ABVB 2EPBA 3P1HA 1TWFB 5M9OA 4XQJA 3NK9A 2RSOA 5C0XI 1TKWB 5C44B 4XYOA 1JWSD 3FMCA 4LLGM 5JEAG 1IYVA 3HVZA 2FHTA 3FDTA 2KMMA 4A3FB 1V1PA 2K01A 2EYPA 2F0LA 3TZUA 1WSPA 1OQRA 5NUCA 2ZW0A 1STNA 1JWMD 4ZAIA 1U4RA 3T56B 1MGSA 1GUGA 3G6JB 3L3OC 3IXSA 2INNE 1H9RA 1I4RA 3VRBB 3NSWA 1ZXHA 3BDOA 3SVMA 4FXDA 4O1NA 3PO3B 1UUPA 1FXIA 3NPPA 5HFYA 2AUKA 1EY8A 3K5OA 2R7ZB 5IGBA 1AZPA 4US8A 1EL0A 2E76C 1I7HA 3G7LA 3NXWA 2JP1A 1TJEA 4YIJA 5J39A 3EJIA 2OEOA 3MXNA 1JCKB 3GV6A 2EXZA 3Q8BA 4ZKCB 1VCIA 3JAML 3QO2A 4KKIA 4HTHA 1LACA 3N9YC 1XX8A 5IT9L 1PTOF 4M8AA 2D2CC 2B76B 2DWQA 1ZOYB 1R9TB 4X3KA 4A3KB 3PZ8A 5JXVA 3AE1B 4KD3A 4YWGG 2JSOA 3H09A 2M19A 1LTRD 3SE0A 3OWFA 1QF6A 3V2TA 1ACCA 2F0DA 1V1PB 3NUCA 1PRTF 2KA7A 4RCNA 2CW0D 1Q1EA 1NR4A 1DOIA 3DWGC 1NYRA 4I7ZC 2AWNA 1SYCA 4RGTA 1QB5D 1TS4A 1IUEA 3AE8B 2NVTB 1HZ6A 3I90A 1TWGB 1PYWD 3MAQA 5T1IA 1RODA 3ZJTA 3AE2B 1PFMA 5C3WA 1DM0B 1E2WA 3SDZA 5JVG3 3W5VB 1AEXA 1J8IA 1I4HA 3NQTA 2J7ZA 1Q8IA 4PV1C 4OW0A 1G2SA 3OHXC 3T13A 1GB1A 3I9V1 2PW5A 3PUVA 1BO0A 4DXFA 2PW7A 3C8YA 1EIHA 5I9OA 2BS4B 1NYQA 3EQLC 3I3CA 1BCPB 3J81L 3A7LA 1VF5C 4H13C 1L4ZB 1DCZA 4MIUA 1WD0A 5FO7B 3U4EG 4G7OC 2MPMA 5DNFA 1F2ZA 4ZK9B 4WFN3 4A55A 2NTTA 2YEPB 4CKEA 1EY6A 1HFNA 3E9SA 2QMTA 3OIPA 1H9MA 4MH8A 1PDXA 3M4YA 1BDOA 2EE1A 1ZYRD 2IDYA 2B2TA 3TEXA 4IUPA 4NDXA 4C3JB 2WU2B 3J9CA 2KWDA 2PVOD 3J7AV 2MH7A 4ZKBB 2PYKA 4N59A 3MVVA 3LWUA 4B9XA 1PFBA 3P75A 1E9MA 3OSOA 1BUIC 4NAMA 2KVMA 1QJOA 1LT4D 3E5SA 2F0FA 1R4QB 3S1QB 4CKBA 1PZID 1Q3LA 2SNMA 4RWSC 4DF7A 1L6VA 3U9OA 2PMZB 1A15A 1V43A 2Z8LA 1S5ED 2WKCA 2M9VA 3Q69A 2MJ8A 2VB2X 1DXMA 5FO9B 3GS2A 1V97A 3PV0A 4ILWA 1E6EB 2R92B 4GDLB 1CK1A 4OIKA 2QDBA 4V190 4JK1C 2K5DA 4ABNA 1X3PA 1WGKA 1PTOH 3DEOA 1BCPD 2NTSA 1ESRA 4OL7A 1O78A 3K5NA 4IDIA 2VB3X 1MVKA 4YT0B 2WDRB 2RDFA 2AWOA 3HS0C 1OXTA 3OMCA 3AEAB 1B4OA 3Q24A 1WTVA 4MM3B 1EU3A 2M2LA 4CHTB 5JEAH 5KYLA 3T16A 1FM0D 3HRDD 2FJ2A 5FOBB 2JEAI 4OZAA 1GUSA 2R6GA 4MHEA 3IAYA 2Q8IB 2BS3B 2B2YC 2KACA 3CWIA 4L6TB 1RF2D 2IGDA 3SEBA 5C4HA 2WS3B 1SXTA 3HOWB 3HUIA 3BDLA 1NSNS 1TVXA 2YEPF 4LK0M 2DYMA 4DAVA 4XWWA 1X3QA 5ELDA 3A55A 1GJXA 5JPMC 4C7YA 4LMQD 2WXQA 4A3GB 4JBWA 1OO9B 3H94A 3PUWA 5BMGA 2BA0A 1C4AA 2WXJA 4IUQA 4BS9A 2QEJC 2E3TA 5CMDA 1U4MA 1SMYC 2XWJB 2ICIA 3ZQ4A 1SE4A 3R8BA 3S1NB 1GB4A 3ZGZA 1HQRD 4YSXB 5BYSA 2CQAA 5M5WB 3HOXB 2A5HA 1TKYA 4P16A 1II3A 1FGBD 3CQZB 2FMCA 1E0BA 2JSVX 5T1GA 1ML0D 2HDMA 3SFDB 2PO4A 1C4CA 5LL6X 3GP7A 2F3WA 1YNJD 1JWBD 3C1EA 3K5MA 2KHSA 1NCVA 1FCLA 1SSOA 3D4DA 1KF6B 4RNAA 2ACZB 3NTIA 3R2IA 3LNNA 5IGFA 4JWUC 1EWYC 2EDGA 4REZA 1NENB 1IKMA 3SK5A 1SB3C 3AE5B 4KY5A 2PNRC 3QOLA 3BYYB 3C46A 2B2UC 4G4KA 5M3FB 4C3IB 5ELCA 3S1RB 1XLPA 1WWTA 3RZOB 2PLPA 4IOIE 3R3OA 2DBYA 5KEEA 1SNCA 1E7PB 5EGTA 1LTTD 3NHHA 1EY9A 1G2TA 1LLRD 2CHBD 3Q8FA 1G6ZA 2W3RA 1WTOA 3RZDB 4G7HC 1T3QA 4A9AA 3I4LA 1C4PA 2W3SA 2NBFA 2PMVA 3FILA 2ICEC 4OGQC 5COYA 5TSSA 1QNKA 1EY5A 3L7ZC 4CJ1B 1Q1BA 2E75C 4FF4A 2JU6X 3D31A 4AS1A 3ONAB 4DGZA 1NUCA 1ZE3D 4H44C 3Q8EA 4KHZA 1ZXTA 3H91A 4Q2JA 5IGEA 1G91A 4J3OD 5EE9A 4WH4A 2PZWA 2EJMA 5JEAJ 1MSGA 3L4PA 1W6JA 1IHZA 4A3BB 1K83B 5IODA 3CRKC 2RBMA 3TDQA 2D5GA 1UEAB 1J9OA 5T8IA 4F7XA 1HQMC 2K32A 2G9DA 1JALA 1FMAD 1C76A 2EOTA 3WOFA 2B63B 1P7FA 3BWUD 1T5XD 1ZP0B 3P63A 1ICWA 5F2DA 2EYFA 1Q12A 3KF8A 4BWGB 2J4XA 1CZWA 3MTSA 3AV8A 4XDCA 1MSHA 1H9SB 5IGCA 1N61A 2WXOA 3FILB 2Y5CA 3NTHA 4AQ7A 3PUXA 1HCZA 4IFDI 2H1EA 4OO1G 1RWSA 3X3MA 4A6QA 4FXGC 4BA1I 1JWUD 3QOJA 4EQPA 5D3IB 1SF0A 4K2LA 3TP5A 3P4QB 3ZYYX 3NWTA 3AH7A 4OZBA 1XYIA 2IX1A 3NP8A 3OMGA 5M5YB 4QIWB 1NVID 1SJED 3F2UA 3DEPA 2X6GA 3S15B 1WTXA 1FXAA 5BN3A 3KBGA 3AMUA 1IW7C 1SNQA 4B9WA 3KUPA 3LYYA 1ILQA 4KY6A 3CKIB 3QJYA 4TRDA 2J42A 2H4OA 3Q8CA 4A3DB 2L32A 2JA8B 4OIJA 1E10A 1MPEA 1F9PA 1F2LA 3OIQA 4V0BA 1LTBD 1F2RI 1HA6A 3NVVA 1KNEA 2A68D 4HROA 4WQMA 2VNUD 1B9MA 3DUZA 1ZKOA 2Y0SB 2WINB 5BYQA 3NS1A 2MEKA 1JWAD 2QJLA 5EKIA 2QF7A 5CV9A 4PNYA 2WQYB 1I3QB 4S3SA 3S1MB 3OW7A 1QOFA 1SYEA 5CYUA 1ET6A 2AQ3B 1Y69U 1N60A 1S5DD 1QKZA 3IL8A 5HURA 3I57A 2ZXPA 3Q22A 4DK0A 2FFKB 3SK6A 1JICA 2IL8A 1F9QA 2NN6G 1RFKA 4QCLA 5EE1A 2QIEB 1BR9A 5I2XA 4QF4A 2K33A 4FXCA 1LT6D 2LHDA 3U7ZA 1EEID 1VZ7A 5D7GA 2W82A 2BB5A 2EY2A 4C80A 3NBHA 1TR5A 3AN1A 1JE4A 2DNEA 4C1NI 2BA1A 3M7GA 3M7NA 1WTRA 2V3PA 4MACA 3Q8AA 1DOKA 2WXIA 3I8ZA 4KJOA 1ZXIA 4BA2I 1WTWA 3TEWA 2R3ZA 4ME5A 1MHXA 3A8JE 4HCSA 1YNNC 1O7LA 1AP0A 1FNVA 4HEDA 4HKQA 2K03A 2RA4A 1WRIA 2JE6I 1PTOD 4G57A 1S4ZA 2PKOA 5IGGA 1NI3A 1AYFA 3OWEB 4KX6B 2KN4A 3B2FA 1JW9D 1DONA 1XLNA 3TP7A 4FVMA 4KKJA 4PMCA 5C3EB 3EGRA 2JYOA 1RD9D 5JJZA 2GI9A 1RDPD 2CJNA 3A54A 4HSVA 4XTCS 1STYA 1PRTD 2E2DC 4EQOA 2D5DA 2PVGC 2FBWB 1CI3M 3WOEA 2E2HB 5HGTA 5ELFA 1RJTA 2WXFA 1JOKA 2ON8A 3KK7A 1JOQA 1J7BA 1TT2A 4CGYB 1DD2A 5C4JB 1I6VC 2O2LD 2H89B 1EEFD 1STBA 3S14B 1Y8OB 2JYTA 2K05A 4KJNA 1YN4A 3JAME 4KK7A 3FC4A 1MI0A 1TKGA 4XYQA 1AWDA 2BTEA 5IT9E 4B0EA 4RKLA 2K22A 3IT6B 4WAFA 4IALA 2E2IB 1SFOB 3NVYA 3T4AC 3GTPB 4KKSA 2F4IA 4LJZC 4CBVA 4CKCA 4M1UB 3K5LA 4OO1H 3AB5A 1FO4A 1BUVT 4U673 2K0PA 4UAIA 3R93A 1TZOA 3KLRA 2E2JB 2RMMA 1N5WA 3K7AB 5EJWA 2BE5D 2KECA 2LHEA 4F87A 3E56A 2A6HD 1GHJA 4R3DA 2E6XA 1BQQT 4JPSA 1WYGA 3MFGA 2A69C 4K5VA 4K14A 4D2KA 3RLFA 3SXHA 2DNCA 1A3TA 2V0GA 1EY7A 5EKKA 2XIWA 1K52A 1BBXC 4FF1A 4DAYA 3Q6SA 3OPOA 1OXXK 4K5XA 3K57A 1XCTL 2BCOA 1FD6A 3Q23A 3GB1A 5ELEA 5M5XB 1KDCA 1OQQA 1HXYD 3D3RA 2F3VA 2HTME 1PMRA 2EVBA 2XSCA 3NTKA 1RKNA 4RCOA 3TUOA 2RSNA 1GOZA 3WDNA 2PW9A 2MUYA 2WXLA 1T6BX 4BBRB 1DYQA 2OHFA 2WV6D 1QOBA 4NW2A 3T51B 2SNSA 3TMEA 3V05A 3HOYB 3P4RB 3MFYA 5EE3A 3HP3A 3J81E 1XF5L 3DWQA 4OZCA 1L0XB 5A35A 2EYJA 1HTLD 2IGGA 1Y8NB 3MXGA 2LY7A 1XLQA 2N7JA 5EKLA 3S2HB 2JZPA 4G7ZC 1IL8A 4FO2A 5FR3A 2KQ3A 3IAS1 2BB6A 1KTKA 1YQ4B 3AEDB 2C9OA 1NEKB 2RDHA 5HG2A 4DNRB 1KLUD 3NBIA 1KRHA 3J80L 4C2MB 2BW2A 3NRZA 1F0ZA 4P2CB 3O13A 1TQOA 2NN6H 1VMPA 1RHPA 3DWMA 1B53A 4XDXA 3AMZA 4ZUJA 3HVDA 3E6ZX 4KN7C 2F0QA 2K28A 1EM7A 3VR2A 2DN8A 5FLXL 2JA7B 2BDOA 1PLFA 5JPNC 3U2SC 4K8JA 2MP1A 1SE3A 4RH6A 2D9UA 4WORA 1QLBB 3FEWX 3PZ7A 4MT5A 3FAHA 1TY2A 4ARIA 5K5PA 4PMBA 4DFAA 1YJIA 1HA5A 1EQTA 5LHY1 2B2YA 3DHQA 2ENBA 1SEBD 4XDDA 2F0OA 2RQXA 1D5MC 5H8YE 2B8GA 2L5TA 2BS2B 1DOMA 4HEA1 3D4WA 3GO5A 3GTMB 2K7VA 1EWCA 1QILA 3D4RA 4KGTA 3K59A 1JRPA 1CA5A 3P42A 4KI0A 4ZRQA 5BN4A 3B9JA 4O42A 5E4XA 2BOSA 1KNAA 2YYZA 3CHBD 1LABA 1B2TA 2LUMA 1D4BA 1L6UA 1YJJA 4A3JB 2YU9B 3MC0B 5C0XG 2WP9B 4HRSA 3RFZB 5C3XA 2B2VC 3A56A 4RHRA 2A6EC 1GPXA 4JE3B 3W9CB 1FNWA 3H8HA 1TWCB 1F2YA 1SIJA 2DLBA 2IT1A 1QWYA 4J8QA 4ZOHC 1IKLA 1K53A 4KMUC 5DAUA 5KYIA 3MZ5A 1TS3A 1BNZA 2IJ0A 5CV7A 1Y1VB 4N9PA 2PPBC 4BY1B 5EE0A 1NAPA 4UDUC 5HI1A 3LX0A 3ITPA 2NUCA 1QQRA 4NP5A 3EUB2 2Q8RE 3HGBA 2EKIA 4IUUA 4DA2A 3PO2B 5EPLA 5I6YA 1Y8PB 3GTQB 2RDGA 5CV8A 3SHLA 1P7EA 1YQ3B 2B2UA 2K5WA 2MGSA 3W5UB 1TY0A 4YTMB 3VYUA 5C2TB 4C56C 1WTPA 3P20A 3HZXA 3GD7A 1K8MA 2C5CA 2R61A 3K6OA 1STAA 2OEDA 4L2YA 2EYLA 2B2WC 3DXJC 2K04A 3HOUB 3D6CA 1PFDA 4JX1C 1UWXA 2GA4B 2GRIA 3RD4A 4E6IA 4DAPA 4FYDA 1MHHE 1MBYA 1RTOA 3VR8B 2ZXRA 3VRAB 1SSNA 1ZEQX 2DYOA 1H9SA 2FE8A 4HR7B 5ELBA 2VXWA 5DEHA 3J7YW 4YSZB 3LB8C 2FUG1 5CORA 3NZ3A 3W2DA 1QOHA 5KNCA 3I73A 1K51A 4FXKC 5E3FA 1NR2A 4ID6A 2IW3A 2K9XA 3GTLB 4XWTA 1EU4A 1WXQA 3CRLC 3L9AX 3H6MA 3ERQA 2JQRB 3S2DB 3TP8A 3I4MB 5I2YA 2PTLA 1BXTA 1LT5D 1A2UA 2NVXB 2KAJA 4XT1B 2X6LA 1DJRD 2XRQD 3BVMA 4H2AA 5CV4A 1ENCA 5C4XB 2B39A 2WU5B 5MPOA 2F0NA 2ID0A 3SK8A 5IGDA 2XVSA 2SAKA 1VF7A 5FO8B 1KDBA 4ZUIA 5LL6S 2F1MA 1KLGD 1E2ZA 4KTAA 1SNDA 1EY4A 2O4XA 1ROEA 4RF1A 2V4DA 5KRUA 5FKAC 4WJWA 2SOBA 1DOLA 2K5PA 2L83A 4K2KA 3VYTA 1SYBA 1Z6HA 4R9WA 2O5JC 5BYRA 1OXVA 1SMYD 2HUGA 1IGDA 2F0JA 2QKIC 4KY7A 5A2QL 1TWAB 2EJFC 3PIO3 1EOTA 3CU7A 4EE2A 3BDCA 2L12A 3AE7B 1ET9A 2WACA 4XT3B 2AQ2B 3PUYA 1YMHE 2N9LA 3GV3A 2WB1B 2WKDA 4JWSC 1HPCA 4L8JA 4Y7NB 1FR3A 1D1IA 1OFFA 5LNK1 2PZTA 3IKJA 1PXUA 4HN7A 1WTQA 1PZJD 1GUOA 2OT2A 2EJGC 2F0WA 1XTCD 3P7JA 1FYCA 4C3HG 2WLBA 2VZKB 5C5LA 1HRJA 4Z9CB 4AYBB 5IOCA 1PUTA 2WXKA 4WWMA 2B8FA 3BG3A 4US9A 3VQIA 1C9FA 3AE9B 1Y56A 2MJEA 4GZYC 2TMPA 4EVOA 1WD1A 5KGUA 1HTPA 2XN9C 2RKSA <