1FNWA

Crystal structure of streptococcal pyrogenic exotoxin a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
221
structure length
221
Chain Sequence
QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYTIDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDNKTSQIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOTOXIN TYPE A PRECURSOR (ALLELE 1)
publication title Structure of streptococcal pyrogenic exotoxin A reveals a novel metal cluster.
pubmed rcsb
molecule tags Toxin
total genus 54
structure length 221
sequence length 221
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fnwA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fnwA02
1B1ZA 1HQRD 4RGMA 4DXFA 2NTTA 1EEID 1PTOB 2R61A 1M4VA 1I4QA 1FNVA 1S5FD 1AW7A 5D3IB 1EWCA 1S5ED 4RGOS 1XXGA 3R8BA 2IPKD 1PTOD 1AN8A 2XN9C 1LTID 4BWGB 3KLSX 1L0YB 1PZJD 1LT3D 1B44D 3EFXD 1SJHD 5FK9C 1TS5A 1ET6A 1LT4D 1LTBD 2XRSD 1QILA 4RCOA 1FD7D 1JWMD 1FNWA 3W2DA 1LT6D 1JWSD 1UNSA 2J4XA 1BCPF 1SE4A 4DXGA 1SJED 1D5MC 1MD2D 5ELDA 4K6LA 1EFID 1D5ZC 2IJ0A 1PRTB 2XRQD 3BYTB 3SEBA 1I4HA 1SE3A 3BVGA 1YN4A 1LTTD 3DWPA 2TSSA 1TS2A 1PRTD 1TY2A 5ELCA 2CHBD 1PYWD 1JQYD 4RGTA 1PRTC 1D6EC 1PTOC 3CHBD 3BZDB 1S5DD 4NZLB 3URYA 4OHJA 5ELFA 1JWUD 5TSSA 1L0XB 4O1NA 1SXTA 1RCVD 2AQ1B 1CHPD 1EU4A 1HTLD 1KLGD 1PTOH 1I4XA 1PZKD 1S5BD 3DWQA 3O13A 5D3DA 1TY0A 4L6TB 5ELBA 3BVZA 2WV6D 1GOZA 2G9HD 1LTGD 4ZYSA 1EEFD 1D5XC 5ELEA 4RGNA 1RD9D 1I4GA 1HA5A 1CT1D 4Z9CB 1BXTA 3DWAA 3OWEB 1ET9A 2ICIA 1S5CD 5I4DA 2QEJC 1CK1A 1UUPA 2AQ2B 4UDUC 1F77A 1RDPD 1DJRD 3MFGA 1BCPB 3R2IA 1V1PA 1KLUD 4C56C 2RDHA 4L63B 1LTSD 1TS3A 1BCPD 1V1OA 3BYYB 1TS4A 1YN5A 1LTAD 1BCPC 1YN3A 1G8ZD 3TSSA 4RHRA 3MC0B 1SEBD 2RDGA 4RH6A 3R2TA 4RHSA 2AQ3B 1I4PA 1CQVA 1SE2A 1LO5D 1LT5D 5FKAC 1V1PB 1RF2D 3EA6A 1XTCD 1JCKB 2QILA 1PRTF 2Z8LA 1T5XD 1PTOF 1EU3A 2SEBD 1ESFA 1HXYD 3GP7A 1STEA 2NTSA 1LTRD 1I4RA 3V05A 1FGBD 1DYQA 1SBBB 1CHQD 2XNAC 1LLRD 4RFBA 3BVMA 1ENFA 1PZID 1KTKA 1JR0D 4TSSA 2O2LD 1FNUA
chains in the Genus database with same CATH superfamily
5JJLA 2R92H 4LF9L 5ELNA 3SK5A 1I4QA 2L0TA 4TKNA 2AHOB 1A62A 4B3SL 2MCNB 5D3IB 1N32L 5COYA 1DOLA 1HTOA 3F2BA 2I5MX 1MG4A 5BYRA 3PCOB 2A6HC 2JZ3B 3NP8A 3NSWA 4B0MA 2OEDA 3W3AA 2Q5WD 1OXTA 2R6GA 4S17A 5CTRC 5G5HA 1UZXB 1STNA 4URKA 2FAZA 3GTOB 3NXWA 4AIMA 4LNNA 3OHXC 3ZNZB 5EBDA 4DK1A 4K2KA 5BN3A 2LVOA 2WXFA 4DV3Q 1R4MB 2KMCA 2BT6A 3OIPA 1W6JA 1FJGQ 3RZDH 3I3CA 4BBNF 2GVAA 4GU2A 1IBLQ 1JMCA 4OVUA 2LHEA 2Y0SE 3BZCA 2K32A 3JAML 1P3QU 3SGIA 1QOFA 4TQ1A 2VQFQ 2TSSA 2K03A 1HA6A 2C9OA 1HQMC 5ELCA 1C7YA 4JV5L 2R93H 2SNSA 3MXNA 5I9PA 5FLMG 1ZKOA 1H9SA 3DM1A 2C5CA 3GDEA 4P74A 2CS4A 4RM8A 2CH4W 5IY0A 4LF4Q 4HMIA 5EE0A 1EL0A 5AJ3Q 2AWTA 2NN6G 2KVZA 3GTLB 2QMTA 1E7ZA 1F9QA 2NVQH 2RPVA 2ZJDA 4ZOHC 4M1UB 3DBLI 1RCVD 3TIXA 2I5LX 1EU4A 1FRDA 4AYBG 2DZMA 1S5BD 4HJ7A 3ECIA 1STGA 3T13A 2CJNA 3P4PB 4FADA 2R7DA 3D6CA 1A6XA 2KWVB 4HR7B 5E4WC 1J7BA 2N7JA 1WWTA 2VH2A 1V81A 2UU9L 4AQYQ 4A3GB 2NVUI 2MP2A 4Z9CB 5JJZA 4Y7NH 1JB3A 4KY7A 1HPCA 2Z6KA 3HKZB 4RA8A 2RR9A 5HKHA 4GNXB 2O5IC 1Q0WB 1B3AA 1H9MA 4C3IH 5FLXE 4A3JH 4K6DA 2W82A 5AZGA 1P1AA 4LMQD 1WRDB 3Q69A 3NVVA 2OF1A 1AZQA 4M8MA 2N55A 4A3DG 1X3FA 1UGMA 3UI3A 1V8QA 3ZUNA 4PYZA 4YL8A 3UIPB 5M5YB 2F4VQ 4IOAA 1MHHE 2WDQB 4FHJA 5M9OA 1P98A 2O2VA 3HOUG 2RBMA 4R4QA 2G5DA 2Z0EB 4IALA 3VUXA 1GD7A 1GC7A 1RTNA 5C23A 1QVFA 1EUVB 5IAAC 5M3MH 2KXJA 2A8VA 1I4PA 3F2UA 2LXJA 1SMXA 2NZHA 2EJFC 1OO9B 3J7ZC 1U5KA 1F2LA 1WTRA 1HR0L 3IKJA 4FLHA 1I35A 5M3FH 3B9JA 2KHSA 2LWPA 3ZNHB 3TZUA 1KC8C 2VB2X 4FF4A 3T51B 3G6EA 1EU3A 2SEBD 2EXDA 1ESFA 1ZGUB 1TWCH 4GDKA 3NK9A 1BUIC 3EVQA 4NW2A 4EQOA 3CCEA 3IAS1 4YIJA 3NWSA 3W1SA 3S1QB 2DHZA 4A93G 4C3JH 4DUYQ 4N6EB 3T53B 3P4SB 5BN4A 4DDID 3MZ5A 1YHQA 4JI0Q 4R8NA 2R7ZG 4WWPA 1VR9A 3KF8A 5JEAG 2KAJA 4NDXA 3I4MB 3EUB2 2EKIA 1VQGA 1SFOH 3IXSA 1RYJA 4WORA 5D7GA 3RNFC 2F03A 1M4VA 2IHEA 2OXPA 2F0KA 1UWMA 1U0LA 4CDCC 4K7WA 2O6VD 2MFIA 1PUTA 5IGGA 2L8JA 3J81L 5EAYA 5FOBB 4J8QA 1AN8A 4II2B 3RPFC 4UHVA 4BOZB 4C00A 3I55A 3DWGC 2EYMA 4YTMB 1G6JA 2PMZB 4M8AA 1A2UA 3VYRA 3WOFA 4A3IB 2INCC 2A5HA 2MBOA 2B63B 1IGDA 2WQYB 1YD8U 1A3TA 3K5MA 3CRLC 4GOCA 2BDOA 5LXHA 2RA4A 5CMDA 3A7AB 1UEBA 1SDFA 4ZLTF 2QDBA 1LT6D 3RCZA 1WGYA 1W6KA 1K52A 4E74A 3CCMA 1WF9A 3AE2B 4EUTA 5CV7A 1WOCA 3Q3NC 4PS8A 3RLOA 4EZKA 3SEBA 2L5TA 1QKZA 3D0FA 1XPRA 1YN4A 2K5VA 3WCQA 5JEAJ 1P16A 2KECA 5JVG3 2NUCA 1PGAA 3AE5B 1I3QB 4JBWA 3N9YC 4KKTA 4WWNA 4FBJB 2V4IB 1SYDA 1VMPA 1JQYD 3PO3B 3Q24A 2K5DA 2L7RA 2A4ZA 2WFWA 2KJRA 2RQXA 3R93A 3OYYA 4DV5Q 3R3MA 4DHZE 1JQ4A 1XX8A 2YLMA 1J8IA 3VHTC 3A8JE 3GTJB 2BBCA 2CHZA 4G7ZC 4S0RA 1PGXA 4QY7A 3MFYA 4HTHA 4IPDA 1PH5A 2FUHB 4DAYB 1V97A 3UDXA 2N49A 4W9IA 3K5NA 1RD9D 2QDFA 4JQWC 1HZCA 4FDBA 3QJZA 1QE6A 4XQJA 1HNWL 2KFJA 2KQ3A 1ET9A 4HJ8A 1HR0W 1ZXHA 3FKYA 2ZM6Q 1E7VA 4GN1A 1ZW7A 2RMMA 4ZRKA 4DV3L 1E8WA 1IGCA 1LM8B 4L5SA 1Q1OA 1V80A 4P6VF 2EMSA 3IG3A 1IBXB 4A76A 2IYDB 1K8AC 3QK0A 3RNAC 1UGJA 1FJGL 1K53A 2Y3AA 1B9RA 1C4PA 2WYQA 1IBLL 4GOPA 3DCGA 1KAWA 3U9OA 4A6QA 2C60A 3EQLC 4EQNA 2CWAA 3UE0A 4DA2A 2VQFL 3HOXG 3QIJA 3CMAA 2WXKA 3K0XA 4OZBA 2VB3X 4B3RL 3R2TA 4RHSA 1WTXA 4IPCA 2J53A 1F2MA 1DOKA 1ZPSA 2HIXA 2V1YA 3VRBB 5AJ3L 5HY6A 2VH1A 1RF2D 3DVGY 3TL5A 2M8SA 3A1QB 3HOYG 1GUSA 4DXAB 2B2WA 1PRTF 4A8XC 2YYZA 1R9TH 3UDGA 4W9CA 2X6LA 4C4VA 4W9LA 3SXHA 1GKHA 2UXDQ 1Y8OB 2QDLA 5BMIA 1I4RA 4CGYB 3F1ZA 3D4WA 5C6AA 5C4XG 2PJHA 3VR8B 1ENFA 1U4AA 5D94A 4DK6C 5HGTA 5KEEA 4AQYL 2L0FA 3T16A 1WTVA 4RKLA 3A9JB 2F0HA 1HQRD 3I7FA 2ZJPA 3ABVB 4E71A 2L11A 5C1ZA 2R61A 3JAMi 3Q8DA 4IWPA 1YI2A 2JEAI 3J80L 4HRSA 2K50A 4XDCA 3L0OA 4HEDA 5HG2A 1X55A 4KN4C 1NBFC 1S5ED 3C3LA 2NBUA 1WGDA 4G3XB 4R9WA 1RRBA 1UE5A 1I7HA 4A3MB 4AYBE 4CDFC 4R3DA 4JK1C 4IW0A 4J6IA 1I50H 2F0EA 3AQQA 2JYOA 5NUCA 1B44D 1YOVB 2F4VL 4IWOA 1K8MA 2ICEC 2VY3A 1RWSA 3I9V1 5EDSA 2ZTCA 3ZGZA 4PS7A 2RKSA 2L1BA 2KDFB 4LUVA 4NPNA 3VYSA 3VUYA 2PVGC 4C80A 1J9OA 2WS3B 3ENEA 4K7UA 5FJ8H 1EY6A 4DR2L 4IUTA 1HNXQ 2W3RA 4YTPB 1C4CA 1R4QB 1D5ZC 4ITKA 1PRTB 3W5UB 2PI2E 1WX7A 1TWGB 3CWIA 1XCQL 4A3PA 2W54A 1SE3A 1D4BA 1EY9A 2MJ3A 4CQNA 5LHY1 1FPYA 3DBRB 3Q8FA 1A15A 3U58A 2N1VA 2IL8A 3TJPA 1DGSA 2VS1A 4DUYL 2Y0SB 5KYLA 4BY1G 3A9KB 4JI0L 2LEKA 5AUKA 1Z47A 3K5OA 4R4OA 1FR3A 5F2DA 2ONQA 4O1NA 5GAHC 1VZ6A 2KACA 2IWHA 2A69D 2AQ1B 4NJCA 2FFKB 5J39A 5G55A 2ASBA 3J81j 5BMGA 1WI5A 5ELBA 2B2VC 5EPJA 4IM2A 2RVLA 2NS5A 3ND9A 2ZPNA 1FRRA 4C1NI 1V5OA 2HHHQ 1XQQA 3AV8A 3AEDB 2E2IB 1ENCA 3HVZA 5K5PA 2K7VA 3VA5A 3CRKC 5CV8A 4ME5A 1B9NA 4TVAB 5C0XJ 5C3EB 4A3EG 1WGKA 1STYA 2BYVE 1Z6HA 3AE7B 4QF4A 2BWFA 4HXDA 4QL5A 3CU7A 1JJ2A 4HIDA 4YY3Q 1K8GA 2JQRB 1Y8PB 2N0SB 3ONSA 4C56C 2KFKA 4XWTA 2K14A 4FXDA 1TS3A 1NYQA 2WGSA 2DLBA 2A6ED 4GSWA 4KGRA 2V4DA 2JRHA 3CD6A 3M4QA 4X65Q 1YN3A 1F2RC 3VYTA 1WX8A 3NPPA 1ZXIA 3MWYW 3DWMA 3TP6A 2ON8A 4TUUA 3N30A 1IYJB 3J81i 1D1KA 4BBSG 1T6BX 1TT5B 5T1IA 4A3FG 2IO0B 1LO5D 4E6IA 4DV5L 3R7QA 2NN6H 4II3B 1S72A 4LUOA 2R92G 1SIFA 1L6UA 3MXGA 4KLKA 2EY1A 2E3TA 1CSPA 4X64Q 3CAMA 4ZQ3A 3AE1B 1FXTB 5H92C 1CMXB 1YJIA 4IUPA 5ELOA 4USAA 1IBMQ 4N9PA 5G2NA 4FA6A 3VR4A 1W2BA 4ZHOA 4IUQA 3QOLA 3CSFA 3HOWB 2OJWA 1FVIA 2H1EA 1EIYB 2RD0A 4WWMA 1PDQA 5AFWA 1ENAA 2ZM6L 3MAQA 3GTQH 1HH2P 2HDMA 1E8YA 1LV9A 2PIAA 1JWBD 3LJ3A 1D3ZA 2KMAA 4BKGA 4HKQA 3Q3OC 1TZ1A 4DGZA 3Q23A 4AOFA 1EQTA 4F8MA 1V9PA 4IDIA 5JPMC 5JZEB 1V49A 4A3DH 1RTOA 4IC7B 5DPWA 3CW2C 1LT3D 1RHPA 1P7EA 1R4MI 3AU5A 3RNEC 2O4XA 1QUQB 2JQOA 3M62B 4D2KA 4GNXA 4W9DA 3KBGA 5EGTA 5LL6X 4B0EA 2R93G 2Z9HA 3VTUA 1QNUA 3K81C 4K3BA 2VZKD 2LSSA 3S2AA 2KANA 4JOIC 1EY8A 1RJTA 3E9HA 4DV0Q 1EQQA 3L16A 2LJIA 2VW9A 1UNSA 2VXWA 3ALBA 1XNQQ 1H9RA 3NTIA 3NQIA 3M7NA 3ZXRA 3P7JA 1N63A 1VCIA 3K58A 2PYKA 3M9BA 3WA0A 4H44C 1R4NB 2AX5A 2I46A 2CKZB 1Y1VB 2UXDL 4DR6Q 2NBWB 1EF5A 1PLFA 5C44B 1E8ZA 2X8XX 4TQ0A 3N6RA 3VH3B 1WTQA 4A3KH 2LMCB 1GXDC 2CFMA 1STBA 2B2YA 3CC7A 1C1YB 1RKNA 3BDCA 3N1ZC 1NMGA 3PIPA 2K0PA 3EHVA 4HPMB 5DCNA 1J7AA 2ASQA 2CW0D 1WE6A 2NPTA 4J6HA 3QARA 5C0XI 3I4NH 4C3IG 4DHZB 4A3JG 4LF6Q 4BS9A 4UY8C 4OVZA 3ZQ4A 1E1TA 2INDC 1EEFD 3V3XA 2OCEA 1V8CA 4RGNA 3ZKJC 3KUPA 1EYAA 4JI1Q 2ZXRA 1SRUA 4CDDC 1J6QA 2ZTEA 5JJKA 4IOCA 5M3MG 4NXNQ 4JI3Q 4K3CA 3VR3A 2KCTA 1T0QC 4AP4C 2AMCB 2MUYA 1LFDA 1D2BA 1HNXL 1ASZA 1PH7A 1VQFA 5M3FG 3OTOQ 2E2JB 4XYCA 5BO4B 4L63B 2HDEA 3QR8A 3GTMB 4A3BB 1CJEA 1I6HB 2L0CA 5GQOA 1WGHA 1BCPC 3J80i 5CGKA 5LNK1 4RHRA 2BB5A 2QW7A 2RDGA 3AE8B 1EY4A 4C3JG 2AQ3B 5IOCA 3KUCB 2E74C 2HJ1A 1EWIA 1CQVA 2KN4A 4WJPA 2RSOA 2UUBQ 5I6YA 3JW0X 1EYCA 3K59A 1WFYA 2HTHA 2X6GA 1OXUA 3KLSA 2IY5B 2BDNA 4KSLC 5JJIA 4LK1C 4IFDI 1HXYD 1B3QA 3GP7A 2N9EB 4C7YA 3S17B 3ICEA 1JC7A 2PNHA 3CF6E 2AKWB 1ZKHA 2HHHL 3ZRCA 1WXAA 2D3CA 2LRWA 1PZID 4GKJQ 2L32A 1Q3LA 4KV6A 1FNUA 1RLFA 2B8GA 1T0SC 3IT6B 4AUQC 1NENB 4EKUA 2BPSA 3KLWA 1M94A 2IY0B 4ID6A 1QB5D 4M8NA 4W9FA 1S5FD 3LGJA 3A55A 4H0LC 4DNTB 2C5LC 3DBSA 4F8CB 4DAYA 3ZRFA 2NVYH 1SE8A 4XQQA 4MDKE 1EYDA 1LTID 4YY3L 3KDFA 4BWGB 1SNDA 3IAYA 3S1NB 2LRUA 5IGEA 2MH7A 4R8IA 1OXSC 2LHDA 3DDCB 3HOVH 5L83A 4XQNA 1KABA 2JEBI 1S4ZA 4DR7Q 3HOXH 4X65L 4AYBB 2AYOB 4LNFA 1V6EA 1TWHB 3HRZC 4C3HH 3J7AV 3I5JC 3S1MB 2JT4B 1VQNA 1EWYC 1C0AA 4CKEA 2BOSA 1DM0B 3JAMc 2Q2TA 2UXCQ 2EDGA 2JWUA 3HOYH 3I3TB 1WMHA 3CQZB 2LUMA 5CYUA 4X64L 2BE5C 2QIEB 2LGYA 3I90A 3VR6A 2ALYB 1SR3A 1KRHA 1TKYA 4NPSA 1IBML 2BS4B 2FNJB 2K5HA 1ZEQX 2V1CC 3HM3A 3K8AA 3F2DA 3I91A 4DN4M 1K3BC 2IO1B 4FXGC 1B70B 1L0XB 4QMGA 4C2MB 1XT9B 1HZ9A 1Q86C 4NKLA 4IPGA 4MZ9A 3HOUB 5H8YE 5D3DA 4XT3B 1FXAA 1AH9A 4L6TB 4WQOB 5DPSA 3TN2A 1TR5A 4MSQB 2G9HD 2I07B 2EIFA 3A8IE 1YIJA 2X38A 5KHOA 3WAMA 5EBCA 1L7YA 2KQSA 3AI5A 4W9KA 2SOBA 2M19A 2ZCCA 4GDLB 5IO9A 3VFKA 2JE6I 3ITPA 3A9JA 4YCVA 5E4XA 3TREA 3PHXB 4G11A 3S14B 4M00A 3RNGC 4US9A 4M0WB 3V2TA 1NUCA 3QWZB 4FXKC 2WHIA 3QA8A 4HCSA 4IM3A 3ZW3A 2L9HA 1BVSA 1PH4A 1IZ6A 1XLNA 2J7ZA 2KVRA 5EE1A 3WWVA 1XNQL 4RNAA 2BKFA 3FP9A 1UF0A 4NQKE 3U4EG 5IGDA 4MGKE 3RI7C 2R7ZB 2LFIA 4LNOA 4AJWA 1PFMA 1WR1A 2DZKA 4IQZA 5C0XH 1MHWC 1O7IA 2YV5A 1N60A 1L4DB 3BYYB 1OGWA 2ZW1A 2UUAQ 3TBLD 4IUVA 4DR6L 3N1YC 1N33Q 3WANA 3U7DA 1GG3A 2BB6A 3UIOB 2L83A 4OXPA 3UGBB 2IW3A 3FKIH 3W1YA 3IFDA 3CPWA 2DGYA 1TWFH 4JCVE 4HJ9A 3AU7A 3TCAA 3PRMB 1F2YA 3TMPB 1SYGA 4P71A 3T1HQ 4AH6A 4B95A 1YJWA 2K1FA 4ME3A 2KZRA 2HJ8A 1P8LA 4QAYA 5JPNC 4LF6L 1UWXA 1CKOA 2DNEA 3VR5A 3OPOA 1I94Q 1EIGA 4KK7A 4RFBA 2L05A 1Q81C 3A9KA 3BK2A 3S2DH 4I6PA 2R2QA 4JI1L 3S2HB 3AB5A 3NEMA 3PLUA 2LGDA 4RGMA 1XEEA 3NVZA 1TU2B 1CTMA 1YEZA 3OJ3A 2RSUA 4A3EH 3J81c 2KD0A 1L0WA 4RCNA 1SF0A 2KHIA 3H3VH 4NXNL 4XGAB 4JI3L 4JPBW 2CU1A 4HIOA 2CHWA 4DR1Q 2WDTB 2B2UA 4KSKC 2CCZA 2QCZA 1GO3E 3OTOL 4JVZA 3S15H 4PMCA 2K33A 3P42A 1IP9A 3L54A 3H0GG 2SNMA 1WXVA 2BTEA 5DAUA 2WB1B 2JY6A 3PUVA 2M56B 4ILWA 3MTSA 3NVWA 4ZCKA 3ZTDA 1LTBD 2N78A 3ERQA 1KF6B 1M90C 1KDBA 1N5XA 1YQBA 1FD7D 3SDZA 4FO2A 1FNWA 1WE7A 4DHJD 4BBSH 2UUBL 1SJED 2ZTDA 3A74A 1AE2A 3PQIA 2NB0A 3RZWC 2BVCA 1JOKA 2K5QA 1QNKA 4RMAA 1JOQA 1VQCA 2AWNA 4A90A 2C35B 1JALA 1HUMA 4XXEA 1VDVA 2Z4IA 1MSHA 2CHBD 1V1QA 2F0QA 4V0BA 2JA5B 4PZ7A 5JVH3 1WGRA 5C5LA 5LMNQ 2LJ5A 1PTOC 3T56B 1Q90A 1RM6C 5E7NA 4NZLB 4GKJL 1CA6A 3U50C 3L13A 1LM0A 1TIID 2JA8H 1HFNA 2H4OA 2Z4HA 3V6EB 1GPXA 3D31A 1WYDA 1YHAA 3H6NA 3JAME 3TP5A 1A0IA 4NJ7A 3GZNB 3U9SA 2WV6D 1E7PB 1GOZA 1UWVA 1B53A 1A3VA 2QGQA 1Y14B 1JE5A 4X3SA 2EQSA 3KVFB 4KHVA 2KCMA 1PDXA 1MFWA 2OQKA 1HA5A 3PO3H 4JL9A 1PFBA 3HM6X 2KMMA 1VQEA 3HOZH 4DR7L 1MJDA 2WLBA 4EQ5A 2PCFB 2E8GA 2F0VA 2JA6H 1RDPD 1LTLA 1ZE3D 2LXCA 3TP8A 3AB9A 3KYCD 3R7RA 1RIPA 1V1PA 1WJNA 5C4XB 1SYEA 2PQAA 3FILA 2UXCL 4WAAA 4ARCA 1OQRA 1WY8A 2RDHA 2FCQA 1V1OA 2KO3A 3M4OH 4O2DA 5KNDA 3BINA 4K7SA 4CHKA 4HLEA 5HHDG 2NBFA 2MQHA 1IYUA 2V9HA 4GB9A 3KQ4A 3MTNB 3TEXA 4KHZA 1EF1A 3B6YA 4KVGB 4OWTB 3GB1A 5IODA 3DM3A 4B08A 1WVLA 2INPE 2KNBA 2IBIB 5C2TB 1D7QA 3TUOA 1TWAB 4LF7Q 1JWAD 2DYMA 4UP9A 3SU8X 1WCMH 2LUEA 4B9KA 2B2TA 2FINB 3B0AA 2VL6A 5LMUQ 1YNNC 1BO0A 2LKVA 2MJEA 2F0IA 3A56A 5CBEE 2XNAC 4QUCA 1TKGA 3PSEB 1QG7A 1GC6A 4XC2A 4YXDB 1L1OA 1KTKA 3J80c 2F0MA 3RNUA 2FBWB 1C48A 1S3OA 3PO2H 2MNAA 1CKMA 1CZGA 1PTOB 3AEFB 1E24A 1AFPA 2LXAA 3AMUA 1ZUD2 3ERSX 5KRUA 3K7AH 1EWCA 1O78A 4RGOS 1G2TA 1XLQA 3H7PB 4P7IA 5C4ZA 1J0GA 2HCCA 4MHEA 4NAWB 2XN9C 3TMEA 3HHMA 4G7OC 1N62A 2VRRB 2KC2A 3TDQA 4RM9A 4O0AA 2MBQA 1AE3A 1OEYJ 4LJOB 2FCSA 2YEPB 3UDIA 1T0YA 2MBHA 4NNJB 3PGZA 2W55A 1VQKA 1N33L 3Q2AC 4YWLA 4A3KG 1VDZA 4OONA 3RN2A 1PH1A 1R4NI 2MO0A 3J81E 1NY4A 4JG2A 2D62A 2LD9A 3T1HL 1GJXA 1Y8RC 1BNZA 3BVGA 1R7SA 1NE3A 2GOWA 3I4NG 1L4ZB 4ZK9B 3AE6B 2LFNA 1F2RI 4TMAB 4OIKA 4L5QA 1SAPA 2N9PC 2QA4A 1TY2A 4ICVA 1XYIA 2DN8A 4LAAA 4DFAA 3T9LA 1I94L 4RGTA 2E75C 4P1BC 1O7LA 1NNXA 2A74C 1Q10A 3QC8B 1DCZA 3JC66 2A68D 5D14A 2NVXB 1VF7A 1UBIA 5CV4A 3KJPA 3EBEA 4IKGA 4IWQA 1G51A 1SXTA 3T4AC 4WURA 1FXIA 1TWGH 2JYEA 1TY0A 4HJAA 2KK8A 3HUIA 4LW1A 1CI3M 2WXQA 4ANUA 2PEAA 2XTIA 4IPHA 5I9OA 4DR1L 4DR4Q 2MBEA 4N8FA 1E2WA 1AWDA 1GAQB 4BBRH 4A3FB 1C8CA 3RN9C 2F0NA 2M0AA 3DHIC 1MG8A 3N52A 2R92B 5CORA 3K0YA 1ZDVA 2K8HA 3JSVB 3BZKA 3RULA 3SFEB 1CK1A 5EPLA 4MT5A 1PH9A 3VTVA 1K0RA 3IT4B 2WDRB 3MJ5A 1BF4A 4DV7Q 2J0KA 1OEYA 4KTAA 1YNTE 3NS1A 1JICA 1FFUA 2JU6X 3RFZB 1MPEA 3I57A 4FP5D 2DNFA 3PRPB 4YSYB 5IA7A 1SNQA 1LTSD 2D3BA 4MJSB 2OEOA 3AN1A 2DY7A 3U7ZA 4UP8A 3KBXA 4H02A 1U4LA 1F1HA 1F9RA 4GN3B 2A6HD 3CCRA 1CZPA 5CHVC 5LMNL 2PW7A 1LGRA 1PA6A 4IJHA 3RZDB 4CJ2C 1LT5D 5JAVA 3WOEA 4GXBA 4DKAC 3BJUA 4XZ4A 3AEAB 5EJWA 4R4TA 4X57B 3E3XA 3C46A 1Z2MA 2KLCA 2KCCA 1VMCA 3GTPB 2R93B 3OG5A 3Q14C 1BOSA 4KD4A 4OGQC 3CXCA 3ZLZA 4F88A 2KC1A 1WD0A 4WQMA 1HTQA 3B2GA 2EPBA 3A5UA 3BVMA 2IX0A 5IP7G 3C8YA 1CKNA 2NVQB 3LX0A 3HOVG 3H7SA 4XE0A 2O2LD 2E2HB 4W9GA 2DYBA 1XMOQ 2F0WA 3KYDD 3QQ8B 5IOIA 1T5EA 4C3HG 2RDFA 1CUKA 1FMAD 1NYRA 5GROA 1U4PA 1B9MA 2K39A 4Q5VA 4LF4L 3MP9A 2CR5A 4TRDA 4BOSC 2H88B 3DBHI 4EZJA 2C9WB 1Q82C 2EXZA 3PIO3 3L3OC 4JI2Q 4Y7NB 3DEOA 4DNRB 1QZHA 1A2TA 4M0WA 1HZAA 1UE1A 3U8ZA 2F0PA 2GI9A 4XDXA 3J80E 4RCOA 4C3IB 2ZT9C 3MVVA 1E1OA 4A3JB 5IYDH 1JWMD 2KN5A 4I65A 3S24A 3GTGH 3H91A 3P20A 4DXGA 1G6PA 2XWBB 4LF7L 4XTCS 3EN2A 2IJ0A 3EIVA 4CBVA 2XK5B 3QHTA 2WXRA 2ATWA 2ZCBA 1EIFA 1LABA 4FNFA 4DF7A 2BYEA 2PE6B 4FJVB 3H8HA 5LMUL 4MTNA 3OOCA 5BYQA 4A9AA 2JA7B 5M3MB 1F2ZA 4WJ4A 1EIHA 3GE8C 5E6JA 2KHJA 3RLNA 3DVNV 3PO0A 4N9F4 2KTRB 2XWJB 3TP7A 5M5WH 1VQOA 1YVCA 4XT1B 2KWCA 4IUUA 2EOTA 2VUMH 4X3UA 2JA9A 4GGQA 1JOOA 1HTLD 1I4XA 1TWCB 4ZUIA 1EY0A 1KDAA 2CW0C 1F0ZA 4PG3A 3LWUA 4C3JB 4ZYSA 4X66Q 3UINB 2DNCA 2Q8IB 4MEMA 1GUOA 3SR1A 3KF6A 3H0GH 1PXUA 5LMNW 5C0XG 1SFOB 2P5ZX 1DGJA 1TQOA 3DWAA 4A3GG 4KHPQ 3PUYA 2ICIA 1WI0A 4HCEA 3M3YH 5KGUA 1UUPA 3HKZG 1MHXA 4PMWA 5IP9H 2G3QB 3AFPA 4OVVA 1I42A 2YTVA 2F0LA 4X3TA 4DR3Q 2WXOA 5AUIA 1KXLA 1SGHA 3FKIG 1LQBA 2KQ4X 4IO9A 1IW7C 2M9VA 2NYZD 2F3IA 4JGHB 4LFCQ 2RPQA 2MRPA 5GMVA 1Y1WB 1E8XA 1TKEA 3H1UA 1ZYRC 1PFDA 4EZLA 2NCNA 2PMVA 3C19A 4LNIA 2RSNA 2YU9H 2N9LA 1KNEA 1TT2A 1YJNA 5J17A 3MXPA 1XJVA 2M1MA 1PH6A 1X6OA 4Y52H 5EPKA 1SE2A 1PH3A 1GVPA 2Q2HA 2FMCA 1YX6B 2CU3A 4GN4B 1ILQA 1F9SA 1FCCC 3VXWA 4DDGD 2BF8B 1HCZA 1YJ1A 3IL8A 2XGTA 3TEHB 1MI0A 4KY6A 1YNJC 4K8JA 4JBMA 2KHWB 3D3RA 2RDBC 3LWEA 2L76A 2H5XA 1X9NA 1J7CA 4ZAIA 4S3SA 5LLIA 3EJIA 3K80C 4DR4L 4AWJA 3IAM1 3AH7A 3MEHA 3A8KE 2I5HA 5BR8Q 4CDEC 4O42A 4IFDG 3LXFA 4LDTB 5EE3A 3CCJA 1PYBA 3FAHA 3DPDA 5L37A 2D5DA 5IYCG 1GB4A 4BY7H 1T9HA 3NZSA 2I38A 5FO9B 3PHWB 3IVFA 3AEBB 1QJOA 3TS2A 4DV7L 3OJ4B 2EJMA 1WTOA 2IPKD 3F2CA 1V86A 3W5VB 5CHFA 4DV6Q 3S17H 4YT0B 1HEZE 1C4AA 2ZZPB 3CCQA 1HE8A 1DOYA 3GTKH 2Z6KC 4WRDA 4GZYC 4A3LH 3AE3B 3ZXVA 1NAPA 2L1AA 2LGIA 3CMMB 4OWWB 3E0JA 5IIFA 3E9SA 5K36G 1GB1A 3PF5A 2B63G 2WU2B 1BBXC 1XF5L 2K5NA 1YMHE 1WD1A 3P75A 3N1XC 2GN5A 4X3KA 3Q3JA 1H8CA 2JA8G 1E10A 2DWQA 5HGQA 1X32A 1MBYA 4IFDJ 1U4RA 3RR5A 2ZJQA 2M00A 2D11A 2UYZB 3KUZA 2CQAA 3D8GA 1F9JA 3TQYA 1XLOA 4ZDVA 1PRTD 3APCA 1EQRA 3V96A 4DV2Q 2INNE 4LNKA 1TWHH 3NOBA 1BBUA 1SMYD 3EGRA 3AE9B 2V3SA 3PO3G 2IZVB 2K28A 3W9CB 2FCMA 3X3MA 3HOZG 1XMOL 4K0KQ 1R9TB 1JORA 2N7EA 2NR2A 3AEGB 1CHPD 1K83H 4OWXB 3AE4B 4HKZE 2JA6G 2BYFA 3DWQA 3G6JB 4KJNA 4LFAQ 3W1SC 4U68A 4FHKA 3UI2A 4HPPA 2WX1A 2ACZB 2IT1A 3RUZA 1LTGD 3S1RB 1VQ5A 4C1NK 4J1MA 1WTPA 3MXNB 4ZRJA 2REXA 1B7YB 2GBMA 1H9SB 2DX5B 3HFZB 4JI2L 1SSNA 2LASA 1IKLA 2Y5BB 4IUNA 3L08A 1TZOA 4FVMA 5FR6A 2K5WA 2F3WA 1KIXA 2H89B 3RZFA 4HJKA 3A7LA 2Z0DB 1DD2A 1BKBA 3L10B 5GAEC 2K1BA 2K5PA 1VQMA 4DV1Q 4JX1C 1GHJA 4A3OA 1ISNA 3MHZA 3OAWA 4N58A 1I50B 1UEAB 1O7YA 5TR5A 1VQAA 1WCMG 1CA5A 2LS01 4K2LA 1RODA 1B50A 3MEFA 1KD1C 3PZDA 4GLXA 4DNIA 2MP2B 3VDZA 3M85A 4P72A 1ESRA 2BCOA 5IKCM 4JI5Q 3MXUA 5HFYA 3BDOA 1XMQQ 1WYWB 4KX6B 4QQBX 4ZHPA 4L2YA 4I7ZC 1S3SG 1WX9A 1EOVA 2I1JA 3PO2G 2YVCA 3Q8CA 3PVLA 1FCLA 4E3CA 2O2VB 2N4FA 1LTRD 3RMKC 4X66L 1J5EQ 2DUDA 4MACA 1W3SA 3ML8A 3M63B 2X69A 4OEMB 2MA9B 2DJGC 2FMMA 1VQ4A 1SE9A 3CCSA 3T8MA 3P1MA 2M2LA 4KGTA 1JRPA 4F87A 1C79A 2LGSA 4NMZA 4OIJA 2FIFA 4DR3L 4PQXA 3RLFA 3B1LX 3NJTA 3CCVA 4PZ6A 4NAMA 4GDKB 1STAA 4L5TA 3CF5A 4W9JA 2EY5A 1VQIA 2JPHA 3P63A 4HWIB 4XX5A 4LFCL 1KFYB 4JW0A 3C1FA 4A3MG 2NZOA 3KLSX 1L0YB 5J22A 4G50A 4A3CH 4EEWA 3ULJA 5FK9C 2RCNA 3S2HH 3JSVA 2W9NA 3KF8B 5EKKA 4ODGA 4FF2A 4XIGS 2KX0A 1SN8A 1M1KC 4DU9A 3NHEB 1SNPA 4WIPA 3GD7A 1WRIA 5DEHA 1FD6A 3OLMD 4POGA 1BCPF 4GOPC 2BH8A 1K3RA 3EFCA 1D5MC 2AWOA 2FHTA 3HKZE 1K50A 3N20C 1SROA 5T1GA 2JX5A 3QCAA 3DVGX 5CHWA 2QSDA 4ZRPA 3U2SC 4MJSA 3OMCA 1I4HA 2RF4A 3OIQA 1MKHA 4KD3A 1H95A 1VRAB 1HNZQ 1OFFA 3HIZA 1E22A 3HZXA 1EWHA 1FYCA 1PYWD 4OW0A 1QZGA 2ZEQA 2KVMA 4BBRG 1WJUA 1F9PA 2MP1A 5IP7H 1U9RA 2B2WC 4L5RC 1S5DD 5BR8L 4IN3A 1AP0A 1TBEA 3BS1A 2JRIB 4PYUA 2KJXA 2CH4A 2WDVB 5G3LF 3O13A 4MIUA 2Q2UA 2F52A 4IURA 2L4NA 3PLVA 3PT2B 2F0JA 1IBXA 3FDTA 4UPAA 2PZWA 3X3NA 1Q46A 4DV6L 5D2MB 2EYOA 3FMCA 1V5TA 1IPGA 1I4GA 3CC2A 3GS2A 2K8CA 1Z7TA 1EUJA 3GTQB 3CKIB 2K01A 2JJQA 1Q12A 3GTOH 5C5MA 3PRZA 5H1SE 2WP9B 1F77A 2DENB 3ML9A 4ACFA 1BCPB 2NMQA 5EKIA 1JW9D 4WJNA 4A3DB 3A1QA 1EO6A 2XIWA 4MGZE 5EQ0A 3RNBC 2EYPA 2D0OA 2YTXA 2PZUA 1KH0A 3VYUA 1Y69U 2A73B 4Q0FA 2MW5A 5T8IA 5IE8A 3QJYA 1I6VC 3VDYA 5CR3A 2VNUD 2LVQA 4HCNB 3BIID 4EGVA 1VJKA 3DMUA 4DV2L 3KFUA 2SAKA 1EM7A 1E90A 1CQFA 5MPOA 4KIKB 1GM5A 2XK5A 5E6NA 1WJ6A 4K0KL 3SHLA 1MJCA 1OTCA 3GTLH 4M02A 3KUDB 4GOPB 3KYHC 5M5XB 3KH0A 1IBKQ 4LFAL 5JXVA 4DV0L 3WIMA 1BR9A 2IX1A 3GOEA 2AEHA 4A93B 2Z6BA 3DHHC 1ROEA 2GB1A 4K8IA 3TEWA 3SR6A 3PUZA 4A75A 2IGHA 1JR0D 3HOWG 4KZCA 4A3GH 3RT3B 1TWAH 1GUTA 4NB3A 2F0GA 3I4NB 1HFGA 3W1BA 1L2FA 5IYDG 4P1CC 4C4VB 1E3PA 3K5LA 1XXGA 5ISRA 2CQOA 2KUMA 4POFA 3L4PA 4NXMQ 1ZDXA 3GO5A 1WM2A 2LGXA 4LUZA 1K8RB 4JI6Q 2MEKA 1VQ6A 5M5YH 2QHOA 5FLXc 2HT1A 2XRSD 1FL0A 4FYDA 2DAFA 4KY5A 2KENA 1L2NA 4OL7A 3RD4A 3EROA 1XMQL 4B3TQ 2B29A 1CSQA 1HUNA 1PHJA 1MD2D 3SE0A 2VUMG 3ULPA 2K22A 2K3UA 1UE6A 1ICFB 3HRDD 2J0MA 1T3QA 3HG9A 4XYQA 5C3JB 1OXXK 2OTJA 1EQVA 2WU5B 3UQBA 1TJEA 2KEEA 1XWEA 2GA4B 3I56A 1J5EL 3SHQA 4IZ8A 2BA1A 4IJLA 1R4PB 3S1QH 2M4NA 2DJFC 2EY6A 2F0DA 4OHJA 5ELFA 4IFDH 1K0SA 3ZJTA 5C4JB 3NBHB 2KWUB 1ZXTA 5IYCH 3I4MH 2A68C 3K6OA 5IP9G 3PZ7A 1GUNA 2WAQG 2WXLA 2PW9A 1KDCA 3NVYA 3IHPC 3BVZA 1ACCA 2HUGA 4MNOA 3VVWB 3K7UC 5IT9L 3DBRI 1ZOYB 2AL3A 5JOBA 2HQEA 4DUZQ 2OJRA 3R66C 3FHWA 1UH6A 4N9TA 1F52A 4KDLB 3AFQA 4YWGG 2BA0A 3FVQA 2JVCA 2ZJRA 4A3IH 3H9DA 4B3MQ 2JXMB 1S5CD 4WFN3 3F8TA 5K36H 3L0WB 3VAWA 2B63H 2R2OA 3TEZA 3SK8A 1MGSA 4UDUC 1N6ZA 5DM63 1FGUA 1G2SA 3I73A 4DAPA 3L17A 2J0JA 3Q6SA 5G3LD 4CJ1B 3MJWA 1C3TA 1N36Q 4MM3B 3OW2A 3ND8A 4QJFA 1PV4A 4GNXC 4HN7A 2D2CC 2MJ8A 3NE5B 4LF8Q 3HOXB 1HNZL 1RFKA 2JUOA 4BA1I 5A2QL 4ZRZA 1NJIC 2VQEQ 3HK0A 4C3HB 3M95A 3I2ZA 2JYTA 4L1BA 3KJOA 2UUCQ 1IYVA 2BS2B 1I3QH 3V62A 4BBNC 4DAVA 4OX9Q 3O65B 3RZOB 2J42A 3Q8EA 4DK3C 4DPGA 2K6QA 4QCLA 2M17A 1Q7YC 3WAPA 3HOYB 2B3GA 3BK1A 4PMBA 1WIAA 3BY4B 1YJJA 2QILA 2BQQA 4BY7G 1SYCA 2KFKB 3U4ZA 1PTOF 3PIOA 2KTFA 2MBBB 1HNWQ 1FM0D 3GTJH 3CP0A 1UELA 1VQDA 3ER0A 4WWOA 1KOTA 2NTSA 1D8LA 1N61A 1VQBA 3CCLA 2B2YC 1DYQA 1VQLA 2B2VA 2B39A 4NP5A 3IFTA 3CMEA 4PNYA 4A3LG 1E5WA 3H3VC 1Z9FA 1X1MA 2HDLA 2UWQA 3I63C 4I6NB 5E6PA 1QUQA 4HJGE 2BE5D 2O6VB 2K04A 2K9XA 2K75A 1DOIA 2GBRA 4G7HC 2YEPF 2E2DC 3T1YQ 1HJPA 1UD7A 1IXRA 2J0TD 2MHVA 4OO1I 1G91A 3STBD 2NVTB 1DOMA 1SNCA 2HCIA 3M3JA 3R8BA 3GTPH 2K4KA 5CX3A 4LK0M 3L2PA 5I2XA 4B3RQ 2QKIC 1G291 3UQAA 2G4SA 1M8AA 3EFXD 3G7LA 5IGBA 1WM3A 4NQLB 4EFOA 1XD3B 2D3AA 1SNOA 2E2HH 3PSIA 2XEWA 4W9EA 4IOIE 4A4IA 4KGSA 1E2VA 2KQ7A 1WZ0A 4JI7Q 4LJZC 2LMCA 3TBIB 1J19A 2WX0A 4HSPA 2M0XA 2HD3A 1SE4A 2J4XA 1UE7A 4LLGM 4GIVA 3TZDA 2PVOD 1DXMA 3DHGC 1KHIA 2EYHA 1EOTA 2GRIA 1WJJA 1BUVT 1QVGA 1IBKL 3B08A 1X65A 2PNRC 3N32A 4GKKQ 1DOXA 3MC8A 3DUZA 3PTFC 1WZ3A 4AJYB 2EY2A 2RCFA 1V2YA 1OTRB 3FKIB 4BY1B 2C7NB 1PYSB 1HZBA 3HEJA 4FF3A 3DVNU 5L95C 1GUGA 1TWFB 2KEDA 3CHBD 1FIQA 2ZXPA 2IO3B 3URYA 2IX3A 4YTNB 1VQPA 5A35A 2UUAL 3S16B 2QC8A 4KMUC 3C2PA 5FLXL 3E5SA 3GQBA 5E3FA 3ZVVA 2G45B 4MTKA 1N8RC 3P4QB 4NXML 4JE3B 2JSOA 2JA7H 3S2DB 4F7ZA 5JH5C 5ELEA 4DR2Q 4A3MH 4HIKA 2MJDA 1OXVA 2C7HA 4JI6L 1XPUA 4A3EB 5IYBH 2D5GA 4ASWC 2ZXOA 3LYYA 2GBNA 4K81A 3A4RA 1VQ7A 1N34Q 3UF8A 1JB7A 1G6ZA 2NPTB 1SB3C 4I6LB 5J3BA 2F0OA 2WP8J 4B3TL 4MH8A 4M01A 3S15B 3AXCA 4BAXA 4JOIA 2KOXA 4MN3A 2EYLA 4OELB 3ZYYX 1IUEA 2OT2A 4A20A 4FN2A 1JT8A 4DR5Q 3H94A 1TS4A 2A69C 3DHQA 3ZDMC 4CJ0B 3TRZA 2J52A 2Z59B 3MC0B 2D2QA 2DYOA 1L5PA 3J9CA 3VR9B 3AULA 2C7MB 4BBSB 3KWLA 3SFDB 2KKCA 4WJQA 2AUJD 2KYWA 3EECA 4PV1C 4JPSA 2E6XA 3CIRB 4CHTB 3Q8BA 1E6EB 2Z8LA 1Y1WH 4MH0E 1A3UA 2HQLA 3NTHA 2D07B 5AEKB 2K6DB 3VA7A 2BH2A 3PPAA 2KDBA 3DOWA 2KDIA 4BKSD 3AU4A 3PUXA 1IL8A 3VUWA 2L55A 5HURA 1L6VA 1N5WA 1CHQD 1EY7A 4W9HA 1JMLA 4DUZL 1RAXA 1ZP0B 4A3CG 3B2FA 2JA8B 3PZ8A 1XNRQ 3PMFA 2E2IH 1C76A 4B3ML 2NTTA 3HGBA 1NDDA 1BDOA 2FE8A 2A6EC 1OQYA 4BA2I 2KLGA 2L12A 2WNMA 4MSMB 4Q2JA 5G5GA 4YWKA 3PGEA 5C3EH 4DBGA 1S40A 4RG1A 4HPLB 3NY5A 2EVBA 1I5FA 5IP4D 1SYBA 3BDLA 3X0WA 1PTOD 2N8NA 2RHQB 4WJ3M 3ETRA 5KHQA 3ZJYC 3OMGA 2IY1B 2L00B 4KI0A 2WAQE 1N36L 2WWZA 2WXIA 3EFUA 1BQQT 4QIWE 3K57A 3FPUB 1KQSA 3U30A 5EKLA 4LF8L 3HOZB 3LDZE 1TS5A 4ICUA 3RNCC 1ET6A 1LT4D 2WB1G 4YCUA 4L8JA 3ULLA 1O80A 3D4DA 2VQEL 2JA6B 2LI5A 2PI2A 2MHJA 3K9OB 2UUCL 2JF5A 1WJ4A 2PPHA 4H2AA 4PK1A 1VCBA 4OX9L 4BXXG 2KJ6A 3ZTCA 3QG1A 3DQVA 4WJWA 3M4YA 5ELDA 2KBNA 4K6LA 1WXMA 1WXQA 2LZ6A 2K52A 1HZ6A 1RL2A 2EZVA 3M4OB 3KDFB 1KNAA 3CPFA 4OO1H 1WSPA 2Y5PA 2BWES 3ZNGC 3GV3A 2NN6I 3QAQA 2FJ2A 4H7BA 1HRJA 4GDLA 1PRTC 3M4PA 3S9WA 2JA5G 4LNQA 1QOHA 2V0GA 2MQJA 1QCBD 4KV2A 2ID0A 4KIKA 1VZ8A 3FC4A 1K51A 2BKRB 1WCMB 5TSSA 4APVA 3HOWH 4DQOC 1SMYC 1MVKA 2AL6A 2JWZA 3A4SC 3A5ZB 2QEXA 2B8FA 3I72A 4HIMA 4HVBA 3KOJA 1WMHB 3T1YL 4R1JA 4JI8Q 1TVXA 3G48A 4UP7A 4EVOA 1YX5B 3BU2A 4RF1A 3CC4A 2LXKA 3ZJVA 2CWPA 4CKBA 3U52E 3KK7A 3P1HA 4GLAC 3VR2A 4YWMA 1KLVA 1XLPA 5IGCA 2EYJA 5I2YA 3PO2B 3DLLA 1BXTA 4JIOU 4F7XA 3VRAB 4ALPA 2QEJC 1QF6A 1YNND 3K7AB 2MX2A 3GE3C 1X3QA 2B2UC 4JI7L 3ZIMA 3MFGA 2WKCA 3R2IA 2G9DA 4JBJA 1PVOA 5M3FB 1UBQA 4L23A 4DWFA 3S1RH 3OW7A 3I70A 4JYAQ 1AEXA 4EQPA 4K1RB 3Q3MC 1X54A 3HKSA 1JROA 4K14A 4GKKL 1VZ7A 2XBBC 4ZKCB 5C4HA 1S1QB 1MIUA 1Y1VH 4C7ZA 4IG7B 5C44H 4P2CB 4ANXA 3NS8A 3W5OA 4HSVA 1GNUA 1VD2A 5D6JB 4TQUS 1X56A 1B2TA 2EE1A 4HJ5A 4DV4Q 2WXHA 1QOAA 4JLCA 1XTCD 2PZTA 2JP1A 1DONA 1YQ4B 1PFSA 1T5XD 4ZRQA 1K9MC 3KWVA 1HTPA 2D9UA 2KCNA 1WR6E 1STEA 3M7GA 1NR4A 4DK0A 3HVDA 3V05A 4BZAA 1SBBB 3BWUD 3NG0A 5DPTA 3PUWA 3MHBA 3U4VA 2MSED 1PFNA 2KX3A 4NJ6A 2BS3B 3NBHA 2JXTA 2BYTA 5CV6A 1Q8KA 1HZ5A 4DXFA 1EEID 3APFA 4HDQA 2HIVA 5FO7B 1N34L 1FNVA 4WH4A 1Q8IA 2PQEA 1FEHA 4K5WA 1Z5SB 2N9KA 4TKOB 1T0RC 2WXPA 3RN5A 1Q5WB 2A1AA 3NWTA 1WTWA 5KIXA 3P4RB 3D4RA 4BBRB 4LFBQ 4BFRA 4HAEA 1NEKB 2DY8A 4RKBA 2E2JH 3MHSD 1PZJD 2VZKB 1LYLA 1GUAB 1EZ6A 2ZVOA 4DR5L 4GLVB 3GTMH 4A3BH 1SIJA 1I6HH 5IGFA 1Q1BA 4LF5Q 2PO4A 5C3WA 2NZ1D 4PZ8A 1NI2A 4HEA1 3PV1A 3W2DA 4HCPB 3NELA 2WIIB 5GADC 4JWUC 4MM3A 1CM9A 2KOLA 2XRQD 1XCTL 2DZIA 3I4MG 3BYTB 1C77A 2BW2A 3VQIA 5IN7A 2GBKA 3RMHA 3L9AX 1LXDA 3DEPA 1YHBA 1IHZA 3WALA 3NTKA 1SYFA 5DNFA 2FCNA 3BG3A 2CHXA 4ABNA 5E1FA 4KKSA 4FULA 3BZDB 4XWWA 1VQ9A 1E2ZA 3IRBA 2KJHB 2B2TC 5KYIA 2PPBC 1XNRL 1O7ZA 4A3IG 2KT7A 2V3NA 2EELA 2ZW0A 4H13C 2FUG1 3NRZA 4IM0A 1VQJA 4ZRIA 1QT9A 1KLGD 2JZPA 5J2RA 3FPPA 1RFAA 2E5LQ 3ONAB 1ILPA 4JBKA 2EYFA 1QLBB 3V6CB 2OOBB 2R3ZA 2L52A 3DBLB 4HROA 1A70A 1L1OC 5DLQE 1WXSA 4CO7A 5FLMH 3SDLC 4ULLA 2IGDA 4AQ7A 1YIWA 1VF5C 3S1NH 1LUZA 2O6VA 4HK2A 1CT1D 4JI4Q 2OWOA 3SD5A 1KRSA 3OWFA 5IWAQ 2AQ2B 4QB4A 5HI1A 1MI2A 4RMFA 3NUCA 2FXQA 5LL6S 1AARA 4FXCA 2EJGC 4MGYE 3S1MH 1K73C 1GJZA 4BKSA 1YNXA 3I8ZA 3GZNI 2K25A 1K28A 3QX1A 4JC0A 3WDNA 2DZJA 4U673 3I4OA 3Q0AA 3CQZH 2XVSA 1BMLC 4CYEA 4DK5A 1LTAD 1G8ZD 2GLSA 3AM9A 4LWCA 4RH6A 1JE4A 2F4IA 3FEWX 2FIDA 1TKWB 2K05A 3GTGB 2WB1E 2N3SA 2JXXA 1V1PB 2NWGA 2PQAB 4QUFA 3FILB 4C2MH 2WXJA 5BN5A 5FR3A 4JI8L 3H7PA 3HOUH 2WXNA 5CC4A 1H4RA 2B76B 4NAWA 1FGBD 5M5WB 1LLRD 3QOJA 1AYFA 4I7AA 2CVRA 2Q2IA 3G71A 3PREA 1PH2A 3QIAA 1PH8A 2VUMB 3PS6A 5E6OA 1SNMA 1B1ZA 2NBVB 3S14H 1J8CA 1QVCA 5AZHA 4UAIA 1PMRA 1C9OA 4LDTD 4EX5A 1NMFA 5M5XH 4V190 2UXBQ 3ZJUA 1VQ8A 4RWSC 1VLBA 2N1WA 4A93H 3E9IA 4JYAL 3H0GB 2IDYA 1B8AA 3E6ZX 1ASYA 1B4OA 1SLJA 1E7UA 2R7ZH 1L1OB 3TS0A 5JEAH 3M3YB 4KZ0A 2JK8A 4LJPB 1VQHA 2MPMA 2WAQB 3T3NA 4HMJA 3AEVA 1CFMA 1ONLA 4QIWB 4OZAA 1A5RA 1STHA 2WINB 4REZA 2GVBA 1JWSD 1CZWA 1UAPA 4DV4L 3G4SA 4KHPL 1E9MA 2G1EA 1EFID 4F1SA 1EFWA 1X3PA 1QOBA 4JWSC 2YU9B 4PS3A 1A8VA 3DWPA 2D0PA 1EYGA 1GHKA 1TS2A 2W3SA 3A0JA 3Q6BA 2I1KA 2JA7G 1BT0A 2KA7A 1IW7D 2DBYA 1D6EC 1V9JA 1X3GA 4FJYA 3NHHA 1JJGA 2MGSA 2N7DA 1ZYRD 4A55A 1BBWA 5KNBA 4X62Q 5IYBG 2EMTA 1WTHA 2MWSB 3SVMA 2J7QB 1DZ1A 4KKUA 2V3PA 1H9KA 5IT9c 2UU7A 2V4LA 1KJTA 1EY5A 4YHHQ 4FJZA 4KDIC 2PTLA 2XSCA 3H09A 2QF7A 2KDEB 4LFBL 1D5XC 4WJOA 3H3VI 4YSXB 1II3A 2WACA 3SK6A 5JHBA 2LY7A 3E0EA 4N59A 2Y5CA 3UE1A 2L3ZA 2Z0SA 2QJLA 4R4CA 2F0SA 3OWEB 3V61A 2YTYA 4BY7B 3N3KB 4P75A 3QB3A 1YNJD 5C4JH 4LF9Q 3Q3FA 3H6MA 4HDOA 1XTDA 4LF5L 4G57A 3WAOA 4B3SQ 2E76C 1N32Q 4GLSC 2ZNVC 4BXXH 2Y0SG 3E56A 1FFVA 4K5XA 1MSGA 1JRUA 3GTKB 2PE9A 3TEYA 2Q8TA 1C9FA 1Y1WG 4J3OD 4XDDA 3HP3A 2MLBA 1YN5A 1YQ3B 2N88A 4ZKBB 2SDFA 3TSSA 3EC8A 2AUKA 4ANVA 4EE2A 2DAJA 3HS0C 1IL2A 2IO2B 5GXGB 2QCPX 1AZPA 3J7A5 2JA5H 4YSZB 4J15A 1NI3A 5FKAC 2ZPYA 1EZ8A 4MELA 4BVUC 4ZUJA 4PT5A 3R3OA 5KNCA 3VH4B 1NSNS 3CSTA 2ES2A 2F0FA 3A54A 5C3EG 2E5LL 4B9WA 3DBHB 3AMZA 2CJOA 2OQ0A 4JV5Q 1E0BA 1NTGA 4US8A 1FO4A 1P7FA 1A63A 2D10A 3NUHB 5GAGC 2WXMA 3AYHB 4GS3A 3RZOH 2EKEC 4RF0A 4TSSA 3Q8AA 4XYOA 4JI4L 3ZDTA 1PGBA 1K83B 3NZUA 1L0VB 2KDMA 3IFWB 5IWAL 4GMVA 2K8BA 1GUWA 3A33B 4WAFA 4GN5A 3ZNID 1AW7A 2PMZE 1QZEA 3RD2A 2HTME 1KRTA 3STBC 2MO1A 3NBIA 1XPOA 1SSOA 2LVPA 3NZ3A 2I2YA 5C4XH 1MJEA 4EOYA 3I4LA 1H9JA 4OO1G 2UU9Q 3SK4A 3P2BA 3NQTA 1TYGB 2ENBA 1CKNB 1SJHD 4N8X1 3NENA 3J7AF 4DHJB 4X6AH 2WXGA 5FO8B 3CCUA 1IKMA 3RUIB 2IHFA 4LTUA 5C3XA 4A3KB 1HHVA 1QILA 5DPRA 1ICWA 3GV6A 3J7YW 1YITA 2KTRA 3APDA 2F3VA 2WKDA 2O5JC 2OHFA 3PV0A 5D65A 2NVTH 5BYSA 1X3EA 4ANWA 3L7ZC 1P0RA 1XO3A 1JJCB 1ML0D 1NCVA 5EE9A 4ZYNA 2ZNVB 5J18A 1WGGA 4LCDE 5DM73 1LTTD 1KM7A 3KLRA 1WYGA 2PLPA 2G4DB 2RGFA 2K6AA 3D6WA 3QO2A 1WFQA 4DV1L 1P9DU 3V60A 2JN4A 1OQQA 4R4IA 3T3OA 2BGFA 5CV5A 2JZZA 1YZ6A 1HR0Q 1JWUD 4P16A 5CV9A 2D3GA 3H15A 1YJ9A 1TGZB 1Q1EA 1NBWA 2A5UA 1V43A 1PTOH 1PZKD 4JI5L 1KL9A 1VS0A 2PW5A 2UXBL 3AEEB 4OZCA 2RHSB 5J1ZA 3IBEA 3K9PB 1WH3A 2Q8RE 4DAMA 2JSVX 1TTNA 1YBYA 2R7FA 2F0UA 4RAUC 3VTWA 4BY1H 4ARIA 4BKTA 1D1IA 1NR2A 5JHAA 2F1MA 1N9WA 1E0ZA 3KW5B 2TMPA 5I4DA 1TXYA 1TIFA 4KKIA 4YCWA 1Y1VG 4KJOA 1QOGA 3W1GA 4KKJA 5C44G 3S16H 1DJRD 2B3AA 3LNNA 1QWYA 3PIP3 4AS1A 3FRPB 4G4KA 5IT9E 2HD5B 3JVZX 1KLUD 3PF4A 5I6WA 1BCPD 3QWNA 1QQRA 4NY0A 3KF6B 5LXIB 1NVID 3JYUA 1C78A 5CBAE 1C4QA 2L15A 3UDFA 1SEBD 1U4MA 3D32A 5FJ8G 1Y56A 2IGGA 1PQSA 3ZO5B 3C1EA 2OTLA 3X23A 3EA6A 4B9XA 4X62L 3C0RB 2NVXH 1JCKB 5AZFA 4FF1A 3OSOA 4KN7C 2GBJA 1K8OA 3Q22A 2HE7A 2ZVNA 4B6WA 3AECB 1IYFA 4YHHL 3LB8C 4K5VA 1KAAA 2NVYB 4QGUA 5A2QE 2PKOA 4G0NB 5BMHA 2N9XA 3DXJC 4IUMB 2GMIC 2I0QA 1LACA 2KWDA 2A19A 4P73A 4CKCA 4MGIE 3MA2B 2VZAA 2Z1CA 1Y8NB 3MC9A 2CKHB 3HOVB 4A3FH 2F0TA 3RYTA 4TV3A 4A3BG
chains in the Genus database with same CATH topology
3SK5A 1I4QA 5D3IB 5COYA 1DOLA 5BYRA 2A6HC 3NP8A 3NSWA 4B0MA 2OEDA 3W3AA 2Q5WD 1OXTA 2R6GA 5G5HA 1STNA 3GTOB 3NXWA 3OHXC 5EBDA 4DK1A 4K2KA 5BN3A 2WXFA 2BT6A 3OIPA 1W6JA 3I3CA 2LHEA 3JAML 2K32A 1QOFA 4TQ1A 2TSSA 2K03A 1HA6A 2C9OA 1HQMC 5ELCA 2SNSA 3MXNA 5I9PA 1ZKOA 1H9SA 3DM1A 2C5CA 5EE0A 4HMIA 1EL0A 2NN6G 2RPVA 3GTLB 2QMTA 4ZOHC 1F9QA 4M1UB 1RCVD 1EU4A 1FRDA 1S5BD 1STGA 3T13A 2CJNA 3P4PB 3D6CA 1A6XA 4HR7B 5E4WC 1J7BA 2N7JA 1WWTA 4A3GB 4Z9CB 5JJZA 1JB3A 4KY7A 1HPCA 3HKZB 4RA8A 2O5IC 1B3AA 1H9MA 5FLXE 4K6DA 2W82A 4LMQD 3Q69A 3NVVA 2OF1A 1AZQA 2N55A 3UI3A 1V8QA 5M5YB 1MHHE 2WDQB 5M9OA 2RBMA 4IALA 1RTNA 1I4PA 3F2UA 2EJFC 1OO9B 1F2LA 1WTRA 3IKJA 3B9JA 2KHSA 3TZUA 2VB2X 4FF4A 3T51B 1EU3A 2SEBD 1ESFA 3NK9A 1BUIC 4EQOA 3EVQA 4NW2A 3IAS1 4YIJA 3NWSA 3W1SA 3S1QB 4N6EB 3T53B 3P4SB 5BN4A 3MZ5A 4R8NA 1VR9A 3KF8A 5JEAG 2KAJA 4NDXA 3I4MB 3EUB2 2EKIA 3IXSA 1RYJA 4WORA 5D7GA 2F03A 1M4VA 2OXPA 2F0KA 1UWMA 1PUTA 5IGGA 3J81L 5FOBB 4J8QA 1AN8A 3RPFC 3DWGC 2EYMA 4YTMB 2PMZB 4M8AA 1A2UA 3VYRA 3WOFA 4A3IB 2A5HA 2B63B 1IGDA 2WQYB 1A3TA 3K5MA 3CRLC 2BDOA 2RA4A 5CMDA 3A7AB 1SDFA 4ZLTF 2QDBA 1LT6D 1W6KA 1K52A 3AE2B 5CV7A 3SEBA 2L5TA 1QKZA 1YN4A 3WCQA 5JEAJ 5JVG3 2KECA 1PGAA 2NUCA 3AE5B 1I3QB 4JBWA 3N9YC 4KKTA 2V4IB 1SYDA 1VMPA 1JQYD 3PO3B 3Q24A 2K5DA 1JQ4A 2RQXA 3R93A 1XX8A 1J8IA 3A8JE 3GTJB 2BBCA 4G7ZC 1PGXA 3MFYA 4HTHA 1V97A 3K5NA 1RD9D 1QE6A 4XQJA 2KQ3A 1ET9A 1ZXHA 2RMMA 1IGCA 4P6VF 1IBXB 1UGJA 1K53A 2Y3AA 1B9RA 1C4PA 3U9OA 4A6QA 3EQLC 4EQNA 4DA2A 2WXKA 4OZBA 2VB3X 3R2TA 4RHSA 1WTXA 2J53A 1F2MA 1DOKA 1ZPSA 3VRBB 1RF2D 1GUSA 2B2WA 1PRTF 4A8XC 2YYZA 2X6LA 3SXHA 1Y8OB 5BMIA 1I4RA 4CGYB 3D4WA 5C6AA 3VR8B 1ENFA 5HGTA 5KEEA 3T16A 1WTVA 4RKLA 2F0HA 1HQRD 3ABVB 2L11A 2R61A 2JEAI 3J80L 4HRSA 4XDCA 4HEDA 5HG2A 4KN4C 1S5ED 3C3LA 4R9WA 1I7HA 4A3MB 4R3DA 4JK1C 2F0EA 2JYOA 5NUCA 1B44D 5T8IA 1K8MA 2ICEC 3I9V1 1RWSA 3ZGZA 2RKSA 2L1BA 3VYSA 2PVGC 4C80A 1J9OA 2WS3B 1EY6A 4IUTA 2W3RA 4YTPB 1C4CA 1R4QB 1D5ZC 4ITKA 1PRTB 3W5UB 3CWIA 1TWGB 1XCQL 2W54A 1SE3A 1D4BA 1EY9A 2MJ3A 4CQNA 5LHY1 3Q8FA 1A15A 2IL8A 2Y0SB 5KYLA 2LEKA 5AUKA 1Z47A 3K5OA 1FR3A 5F2DA 2ONQA 4O1NA 1VZ6A 2KACA 2IWHA 2A69D 2AQ1B 4NJCA 2FFKB 5J39A 5EPJA 5ELBA 2B2VC 2RVLA 3ND9A 1FRRA 4C1NI 3AV8A 3AEDB 2E2IB 1ENCA 3HVZA 5K5PA 2K7VA 3VA5A 3CRKC 5CV8A 4ME5A 1B9NA 5C0XJ 1WGKA 5C3EB 1STYA 3AE7B 1Z6HA 4QF4A 3CU7A 2JQRB 1Y8PB 2N0SB 4C56C 4XWTA 4FXDA 1TS3A 1NYQA 2DLBA 2A6ED 4KGRA 2V4DA 1YN3A 1F2RC 3VYTA 3NPPA 1ZXIA 3MWYW 3DWMA 3TP6A 2ON8A 1D1KA 1T6BX 5T1IA 1LO5D 4E6IA 2NN6H 1L6UA 3MXGA 2E3TA 2EY1A 4ZQ3A 3AE1B 5H92C 1YJIA 4IUPA 4USAA 4N9PA 3VR4A 4ZHOA 4IUQA 3QOLA 3HOWB 2H1EA 4WWMA 1PDQA 5AFWA 1ENAA 3MAQA 2HDMA 1LV9A 2PIAA 1JWBD 4HKQA 4DGZA 3Q23A 1EQTA 4F8MA 4IDIA 5JPMC 1RTOA 1LT3D 1RHPA 1P7EA 2O4XA 4D2KA 3KBGA 5EGTA 5LL6X 4B0EA 1QNUA 2VZKD 1EY8A 1RJTA 2LJIA 1UNSA 2VXWA 1H9RA 3NQIA 3NTIA 3M7NA 3P7JA 1N63A 1VCIA 3K58A 2PYKA 4H44C 2AX5A 2I46A 1Y1VB 4TQ0A 1PLFA 5C44B 3N6RA 1WTQA 2LMCB 1GXDC 1STBA 2B2YA 1RKNA 3BDCA 2K0PA 1J7AA 2CW0D 4J6HA 5C0XI 4C3IG 4BS9A 4OVZA 3ZQ4A 1EEFD 3V3XA 1V8CA 4RGNA 3KUPA 1EYAA 2ZXRA 3VR3A 2MUYA 1D2BA 2E2JB 4L63B 2HDEA 4A3BB 3GTMB 1CJEA 1I6HB 2L0CA 1BCPC 5CGKA 5LNK1 4RHRA 2BB5A 2RDGA 3AE8B 1EY4A 4C3JG 2AQ3B 5IOCA 2E74C 1CQVA 2KN4A 2RSOA 5I6YA 1EYCA 3K59A 2X6GA 1OXUA 3KLSA 2BDNA 4LK1C 4IFDI 1HXYD 3GP7A 4C7YA 3S17B 1JC7A 1PZID 2L32A 4KV6A 1Q3LA 1FNUA 3IT6B 2B8GA 1NENB 4ID6A 1QB5D 1S5FD 4H0LC 3A55A 4DNTB 4DAYA 4XQQA 1EYDA 1LTID 4BWGB 3S1NB 1SNDA 3IAYA 2MH7A 5IGEA 4R8IA 1OXSC 2LHDA 4XQNA 1KABA 2JEBI 1S4ZA 4AYBB 1TWHB 3HRZC 3J7AV 3S1MB 1EWYC 4CKEA 2BOSA 1DM0B 2EDGA 2JWUA 2LUMA 3CQZB 5CYUA 2BE5C 2QIEB 3I90A 3VR6A 1KRHA 1TKYA 2BS4B 1ZEQX 3I91A 4DN4M 4FXGC 4C2MB 1L0XB 4QMGA 4NKLA 3HOUB 5H8YE 5D3DA 4XT3B 1FXAA 4L6TB 3TN2A 1TR5A 2G9HD 2I07B 2X38A 3A8IE 5EBCA 2SOBA 2M19A 4GDLB 2JE6I 3ITPA 5E4XA 3S14B 4US9A 3V2TA 1NUCA 4FXKC 4HCSA 2L9HA 1XLNA 2J7ZA 5EE1A 4RNAA 3U4EG 5IGDA 2R7ZB 2LFIA 1PFMA 4IQZA 5C0XH 2ZW1A 1N60A 1L4DB 3BYYB 4IUVA 2BB6A 2L83A 2IW3A 3IFDA 3AU7A 1F2YA 1SYGA 5JPNC 1UWXA 2DNEA 3VR5A 3OPOA 1EIGA 4KK7A 4RFBA 3BK2A 3S2HB 3AB5A 4RGMA 1XEEA 3NVZA 1TU2B 1CTMA 4RCNA 1SF0A 2B2UA 3P42A 4PMCA 2K33A 2SNMA 2BTEA 5DAUA 2WB1B 3PUVA 2M56B 4ILWA 3MTSA 3NVWA 1LTBD 3ERQA 1KF6B 1KDBA 1N5XA 1FD7D 3SDZA 4FO2A 1FNWA 1SJED 2NB0A 1JOKA 2K5QA 1QNKA 1JOQA 2AWNA 4A90A 1JALA 1HUMA 4XXEA 1VDVA 2Z4IA 1MSHA 2CHBD 2F0QA 4V0BA 2JA5B 5JVH3 5C5LA 1PTOC 3T56B 1Q90A 1RM6C 4NZLB 1CA6A 1TIID 1HFNA 2H4OA 2Z4HA 1GPXA 3D31A 3JAME 3TP5A 3U9SA 2WV6D 1E7PB 1GOZA 1B53A 1A3VA 4X3SA 4KHVA 1PDXA 1HA5A 1PFBA 2KMMA 2WLBA 2PCFB 2F0VA 1RDPD 1ZE3D 3TP8A 3AB9A 1V1PA 5C4XB 1SYEA 3FILA 4ARCA 1OQRA 2RDHA 1V1OA 5KNDA 5HHDG 2NBFA 1IYUA 3KQ4A 3TEXA 4KHZA 3GB1A 5IODA 2INPE 4B08A 1WVLA 5C2TB 3TUOA 1TWAB 1JWAD 2DYMA 2B2TA 2FINB 1YNNC 1BO0A 2LKVA 2MJEA 2F0IA 3A56A 5CBEE 2XNAC 4QUCA 1TKGA 1QG7A 4YXDB 1KTKA 2F0MA 2FBWB 1C48A 1CZGA 1PTOB 3AEFB 1AFPA 3AMUA 1ZUD2 5KRUA 1EWCA 1O78A 4RGOS 1G2TA 1XLQA 5C4ZA 2HCCA 4MHEA 4NAWB 2XN9C 3TMEA 4G7OC 1N62A 3TDQA 2YEPB 2W55A 1VDZA 3J81E 2D62A 1GJXA 1BNZA 3BVGA 1R7SA 1L4ZB 3AE6B 4ZK9B 2LFNA 1F2RI 4TMAB 4OIKA 1SAPA 1TY2A 1XYIA 2DN8A 4LAAA 4DFAA 4RGTA 2E75C 1O7LA 2A74C 1Q10A 5D14A 1DCZA 2A68D 2NVXB 4IKGA 1VF7A 5CV4A 4WURA 1SXTA 3T4AC 1FXIA 2JYEA 1TY0A 3HUIA 1CI3M 2WXQA 5I9OA 1E2WA 1AWDA 1GAQB 4A3FB 1C8CA 2F0NA 2M0AA 3N52A 2R92B 5CORA 3K0YA 1ZDVA 3SFEB 1CK1A 5EPLA 4MT5A 3IT4B 2WDRB 3MJ5A 1BF4A 4KTAA 1YNTE 3NS1A 1JICA 1FFUA 2JU6X 3RFZB 1MPEA 3I57A 4FP5D 4YSYB 1SNQA 1LTSD 2OEOA 3AN1A 2DY7A 3U7ZA 3KBXA 1U4LA 1F9RA 2A6HD 1CZPA 2PW7A 3RZDB 4CJ2C 1LT5D 5JAVA 3WOEA 3AEAB 5EJWA 3C46A 2KCCA 1VMCA 3GTPB 2R93B 1BOSA 4KD4A 4OGQC 4F88A 1WD0A 4WQMA 3B2GA 2EPBA 3BVMA 2IX0A 3C8YA 2NVQB 3LX0A 4XE0A 2O2LD 2E2HB 2F0WA 1T5EA 4C3HG 2RDFA 1FMAD 1NYRA 1U4PA 1B9MA 4Q5VA 3MP9A 4TRDA 2H88B 2EXZA 3PIO3 3L3OC 4Y7NB 3DEOA 4DNRB 1A2TA 4M0WA 2F0PA 2GI9A 4XDXA 3J80E 4RCOA 4C3IB 2ZT9C 3MVVA 4A3JB 1JWMD 4I65A 3H91A 4DXGA 3P20A 2XWBB 4XTCS 2IJ0A 4CBVA 2WXRA 4DF7A 1LABA 4FNFA 3H8HA 3OOCA 5BYQA 4A9AA 2JA7B 5M3MB 1F2ZA 1EIHA 5E6JA 3PO0A 2XWJB 3TP7A 4XT1B 4IUUA 2EOTA 4X3UA 1JOOA 1HTLD 1I4XA 1TWCB 4ZUIA 1EY0A 1KDAA 2CW0C 1F0ZA 3LWUA 4C3JB 4ZYSA 2DNCA 2Q8IB 1GUOA 3SR1A 1PXUA 5C0XG 1SFOB 1DGJA 1TQOA 3DWAA 3PUYA 2ICIA 4HCEA 5KGUA 1UUPA 1MHXA 4PMWA 4X3TA 2F0LA 2WXOA 5AUIA 2KQ4X 1IW7C 2M9VA 2NYZD 1Y1WB 1TKEA 1ZYRC 1PFDA 2PMVA 2RSNA 2N9LA 1KNEA 1TT2A 3MXPA 5EPKA 1SE2A 2FMCA 2CU3A 1ILQA 1F9SA 1FCCC 1HCZA 3IL8A 1MI0A 4KY6A 1YNJC 4K8JA 3D3RA 3LWEA 1J7CA 4ZAIA 4S3SA 3EJIA 3IAM1 3AH7A 3MEHA 3A8KE 5EE3A 4O42A 4IFDG 3LXFA 3FAHA 2D5DA 1GB4A 2I38A 5FO9B 3AEBB 1QJOA 2EJMA 1WTOA 2IPKD 3W5VB 4YT0B 1HEZE 1C4AA 1DOYA 4GZYC 4WRDA 3AE3B 1NAPA 2L1AA 2LGIA 3E0JA 5IIFA 3E9SA 5K36G 1GB1A 2WU2B 1BBXC 1XF5L 1YMHE 1WD1A 3P75A 4X3KA 1E10A 2DWQA 1X32A 1MBYA 4IFDJ 1U4RA 2M00A 2CQAA 3D8GA 1XLOA 1PRTD 3V96A 2INNE 1SMYD 3EGRA 3AE9B 3W9CB 2K28A 3X3MA 3AEGB 1JORA 1R9TB 1CHPD 4HKZE 3AE4B 3DWQA 3G6JB 4KJNA 4U68A 3UI2A 2ACZB 2IT1A 3RUZA 1LTGD 3S1RB 4C1NK 4J1MA 1WTPA 1H9SB 1SSNA 1IKLA 4IUNA 1TZOA 4FVMA 2K5WA 2F3WA 2H89B 3A7LA 1DD2A 2K1BA 2K5PA 4JX1C 1GHJA 3MHZA 4N58A 1I50B 1UEAB 1O7YA 1CA5A 2LS01 4K2LA 1RODA 1B50A 3M85A 1ESRA 2BCOA 3MXUA 5HFYA 3BDOA 4KX6B 4ZHPA 4L2YA 4I7ZC 3Q8CA 1FCLA 1LTRD 4MACA 2X69A 2FMMA 3P1MA 2M2LA 4KGTA 1JRPA 4F87A 1C79A 4NMZA 4OIJA 4PQXA 3RLFA 4NAMA 4GDKB 1STAA 2EY5A 3P63A 1KFYB 3C1FA 3KLSX 1L0YB 5J22A 5FK9C 5EKKA 4ODGA 4FF2A 4XIGS 4DU9A 1SNPA 4WIPA 3GD7A 1WRIA 5DEHA 1FD6A 1BCPF 1D5MC 2AWOA 2FHTA 1K50A 3U2SC 5T1GA 2JX5A 4ZRPA 2QSDA 3OMCA 1I4HA 3OIQA 4KD3A 1VRAB 1OFFA 3HZXA 1EWHA 1FYCA 1PYWD 4OW0A 2KVMA 1F9PA 2MP1A 1U9RA 2B2WC 1AP0A 1S5DD 4IN3A 3BS1A 2KJXA 2WDVB 5G3LF 3O13A 4MIUA 4IURA 2L4NA 2F0JA 1IBXA 3FDTA 2PZWA 3X3NA 2EYOA 3FMCA 3GS2A 1I4GA 1Z7TA 3GTQB 3CKIB 2K01A 1Q12A 5C5MA 2WP9B 1F77A 1BCPB 2NMQA 5EKIA 1JW9D 4A3DB 2XIWA 5EQ0A 2EYPA 1KH0A 2PZUA 3VYUA 1Y69U 2A73B 4Q0FA 3QJYA 1I6VC 2VNUD 5CR3A 3BIID 4EGVA 1VJKA 3DMUA 2SAKA 1EM7A 1CQFA 5MPOA 3SHLA 5M5XB 5JXVA 1BR9A 2IX1A 4A93B 1ROEA 2GB1A 4K8IA 3TEWA 3SR6A 3PUZA 2IGHA 1JR0D 1GUTA 2F0GA 3I4NB 1HFGA 3K5LA 1XXGA 5ISRA 2KUMA 3L4PA 1ZDXA 3GO5A 2MEKA 2XRSD 4FYDA 4KY5A 4OL7A 3RD4A 3EROA 1HUNA 1MD2D 3SE0A 2K22A 2K3UA 3HRDD 1T3QA 3HG9A 4XYQA 5C3JB 1OXXK 2WU5B 1EQVA 1TJEA 2KEEA 1XWEA 2GA4B 4IZ8A 2BA1A 1R4PB 2EY6A 5ELFA 2F0DA 4OHJA 4IFDH 3ZJTA 5C4JB 1ZXTA 2A68C 3K6OA 3PZ7A 1GUNA 2WXLA 2PW9A 1KDCA 3NVYA 3BVZA 1ACCA 2HUGA 5IT9L 1ZOYB 5JOBA 2HQEA 4N9TA 4YWGG 2BA0A 3FVQA 2JXMB 1S5CD 4WFN3 5K36H 3TEZA 3SK8A 1MGSA 4UDUC 5DM63 3I73A 1G2SA 4DAPA 3Q6SA 5G3LD 4CJ1B 4MM3B 3ND8A 4HN7A 2D2CC 2MJ8A 3NE5B 3HOXB 1RFKA 4BA1I 5A2QL 4ZRZA 4L1BA 4C3HB 2JYTA 1IYVA 2BS2B 4DAVA 3Q8EA 3RZOB 2J42A 4QCLA 3HOYB 3BK1A 4PMBA 1YJJA 2QILA 1SYCA 1PTOF 1FM0D 2NTSA 1N61A 2B2YC 1DYQA 2B2VA 2B39A 4NP5A 3IFTA 4PNYA 3H3VC 2HDLA 4HJGE 2BE5D 2K04A 2K9XA 1DOIA 4G7HC 2YEPF 2E2DC 5BMGA 2J0TD 4OO1I 2MHVA 1G91A 2NVTB 1DOMA 1SNCA 2HCIA 3R8BA 4LK0M 5I2XA 2QKIC 1G291 1M8AA 3EFXD 3G7LA 5IGBA 1SNOA 4IOIE 4KGSA 1E2VA 2LMCA 4LJZC 3TBIB 4HSPA 2J4XA 1SE4A 4LLGM 3TZDA 2PVOD 1DXMA 2EYHA 1EOTA 2GRIA 1BUVT 2PNRC 1DOXA 3DUZA 2EY2A 3FKIB 4BY1B 3HEJA 4FF3A 1GUGA 1TWFB 2KEDA 3CHBD 1FIQA 2ZXPA 3URYA 2IX3A 4YTNB 5A35A 3S16B 4KMUC 3C2PA 5FLXL 3E5SA 3GQBA 5E3FA 3P4QB 4JE3B 2JSOA 3S2DB 5ELEA 2MJDA 1OXVA 4A3EB 2D5GA 2ZXOA 3LYYA 1G6ZA 1SB3C 4MH8A 2F0OA 2WP8J 3S15B 4MN3A 2EYLA 3ZYYX 1IUEA 2OT2A 3H94A 1TS4A 2A69C 3DHQA 4CJ0B 2J52A 3MC0B 2DYOA 3J9CA 1L5PA 3VR9B 4BBSB 3KWLA 3SFDB 2AUJD 4PV1C 4JPSA 2E6XA 3CIRB 4CHTB 3Q8BA 1E6EB 2Z8LA 1A3UA 3NTHA 3VA7A 3PUXA 1IL8A 2L55A 5HURA 1L6VA 1N5WA 1CHQD 1EY7A 1JMLA 1ZP0B 3B2FA 2JA8B 3PZ8A 3PMFA 1C76A 2FE8A 2NTTA 3HGBA 1BDOA 2A6EC 2WNMA 4BA2I 2L12A 4Q2JA 5G5GA 2EVBA 1SYBA 3BDLA 1PTOD 3ETRA 3OMGA 4KI0A 2WXIA 1BQQT 3K57A 3FPUB 5EKLA 3HOZB 1TS5A 1ET6A 1LT4D 4L8JA 1O80A 3D4DA 2JA6B 4H2AA 3QG1A 4WJWA 3M4YA 5ELDA 4K6LA 1WXQA 1HZ6A 2EZVA 3M4OB 1KNAA 4OO1H 1WSPA 2Y5PA 3GV3A 2NN6I 2FJ2A 4H7BA 1HRJA 1PRTC 3S9WA 2V0GA 1QOHA 1QCBD 2ID0A 1VZ8A 3FC4A 1K51A 1WCMB 5TSSA 4DQOC 1SMYC 1MVKA 2B8FA 3I72A 1TVXA 4EVOA 4RF1A 3ZJVA 4CKBA 3U52E 3KK7A 3P1HA 3VR2A 1XLPA 5IGCA 2EYJA 5I2YA 3PO2B 1BXTA 4F7XA 3VRAB 2QEJC 1QF6A 1YNND 3K7AB 1X3QA 2B2UC 3MFGA 2WKCA 3R2IA 2G9DA 4L23A 5M3FB 3OW7A 3I70A 1AEXA 4EQPA 1JROA 4K14A 1VZ7A 4ZKCB 5C4HA 4C7ZA 4P2CB 4HSVA 4TQUS 1B2TA 2EE1A 2WXHA 1QOAA 1XTCD 2PZTA 2JP1A 1DONA 1YQ4B 1T5XD 4ZRQA 3KWVA 1HTPA 2D9UA 2KCNA 1STEA 3M7GA 1NR4A 4DK0A 3HVDA 3V05A 1SBBB 3BWUD 3PUWA 3MHBA 1PFNA 2BS3B 3NBHA 2JXTA 2BYTA 5CV6A 1HZ5A 4DXFA 1EEID 5FO7B 1FNVA 4WH4A 1Q8IA 2PQEA 1FEHA 4K5WA 2N9KA 2WXPA 4TKOB 3NWTA 1WTWA 5KIXA 3P4RB 3D4RA 4BBRB 4HAEA 1NEKB 2DY8A 4RKBA 1PZJD 2VZKB 1EZ6A 1SIJA 5IGFA 1Q1BA 2PO4A 5C3WA 2NZ1D 4HEA1 3W2DA 2WIIB 4JWUC 1CM9A 2KOLA 2XRQD 1XCTL 3BYTB 1C77A 2BW2A 3VQIA 3RMHA 3L9AX 3DEPA 1IHZA 3NTKA 1SYFA 5DNFA 3BG3A 4ABNA 5E1FA 4KKSA 4XWWA 3BZDB 1E2ZA 2B2TC 5KYIA 2PPBC 1O7ZA 2V3NA 2EELA 2ZW0A 4H13C 2FUG1 3NRZA 1QT9A 1KLGD 2JZPA 3FPPA 3ONAB 1ILPA 1QLBB 2EYFA 2R3ZA 2L52A 4HROA 1A70A 4ULLA 2IGDA 4AQ7A 1VF5C 1CT1D 3OWFA 2AQ2B 4QB4A 5HI1A 1MI2A 3NUCA 5LL6S 4FXCA 2EJGC 3I8ZA 3WDNA 4U673 3Q0AA 2XVSA 1BMLC 1LTAD 1G8ZD 3AM9A 4RH6A 1JE4A 2F4IA 3FEWX 1TKWB 2K05A 3GTGB 1V1PB 2NWGA 4QUFA 3FILB 2WXJA 5BN5A 5FR3A 2WXNA 5CC4A 2B76B 1FGBD 5M5WB 1LLRD 3QOJA 1AYFA 2CVRA 2VUMB 3QIAA 1SNMA 1B1ZA 4UAIA 1PMRA 4V190 3ZJUA 4RWSC 1VLBA 3H0GB 2IDYA 3E6ZX 1B4OA 5JEAH 3M3YB 2MPMA 2WAQB 3T3NA 4HMJA 1CFMA 1ONLA 4QIWB 4OZAA 1STHA 2WINB 4REZA 1JWSD 1CZWA 1UAPA 1E9MA 2G1EA 1EFID 1X3PA 1QOBA 4JWSC 2YU9B 3DWPA 1GHKA 1TS2A 2W3SA 2KA7A 1IW7D 2DBYA 1D6EC 3NHHA 2MGSA 1ZYRD 4A55A 5KNBA 3SVMA 1DZ1A 4KKUA 2V3PA 1H9KA 1EY5A 2PTLA 2XSCA 3H09A 2QF7A 1D5XC 4YSXB 1II3A 2WACA 3SK6A 2LY7A 4N59A 2Y5CA 2QJLA 2F0SA 3OWEB 4BY7B 3QB3A 1YNJD 3H6MA 4G57A 2E76C 4GLSC 3E56A 1FFVA 4K5XA 1MSGA 3TEYA 3GTKB 2Q8TA 1C9FA 4J3OD 4XDDA 3HP3A 1YN5A 1YQ3B 2N88A 4ZKBB 2SDFA 3TSSA 2AUKA 4EE2A 3HS0C 5GXGB 2QCPX 1AZPA 4YSZB 1NI3A 5FKAC 1EZ8A 4ZUJA 4PT5A 3R3OA 5KNCA 1NSNS 2F0FA 3A54A 3AMZA 4B9WA 2CJOA 1E0BA 4US8A 1FO4A 1P7FA 3NUHB 2WXMA 4RF0A 4TSSA 3Q8AA 4XYOA 1PGBA 1K83B 1L0VB 2KDMA 1GUWA 4WAFA 1AW7A 2HTME 3NBIA 1SSOA 3NZ3A 2I2YA 3I4LA 1H9JA 4OO1G 3SK4A 3NQTA 1TYGB 2ENBA 1SJHD 3J7AF 2WXGA 5FO8B 1IKMA 4LTUA 5C3XA 4A3KB 1HHVA 1QILA 1ICWA 3GV6A 3J7YW 2F3VA 2WKDA 2O5JC 2OHFA 3PV0A 5D65A 5BYSA 3L7ZC 1XO3A 1ML0D 1NCVA 5EE9A 5DM73 1LTTD 1WYGA 3KLRA 2PLPA 2K6AA 3D6WA 3QO2A 1OQQA 3T3OA 5CV5A 1JWUD 4P16A 5CV9A 1Q1EA 1V43A 1PTOH <