1LM8B

Structure of a hif-1a-pvhl-elonginb-elonginc complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELONGIN B
publication title Structure of an HIF-1alpha -pVHL complex: hydroxyproline recognition in signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 28
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2002-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1lm8B00
3RULA 2C60A 3R7QA 1Q0WB 5IA7A 2BKFA 2L0TA 2MRPA 3SD5A 3DPDA 2Z59B 4XX5A 1UBIA 3OJ3A 3AU5A 4DDGD 5LXIB 4FJYA 2QHOA 1OTRB 1P98A 1WX8A 2UYZB 2ZVNA 2CU1A 3PHXB 3H7PA 4IM0A 4WWPA 4JL9A 1GC7A 2REXA 4PS8A 1K8RB 2LGDA 4RMAA 4TQ1A 2PE6B 3H1UA 2DHZA 4BKSA 2KTRB 2NPTB 1UGMA 3L08A 1V86A 2NCNA 3JSVB 4XC2A 3W1SC 3IFWB 3ZLZA 4LCDE 3SU8X 1I42A 1E8YA 2K8BA 2KKCA 2GBRA 3UIPB 2I1JA 3H7SA 1UD7A 2V3SA 1S1QB 1WJ6A 1XQQA 2KXJA 4JLCA 4WJOA 1V81A 3PRPB 4W9JA 3VTWA 1WF9A 1WX7A 5J17A 4HCPB 2VRRB 3DVGY 3B08A 1H4RA 1KJTA 1OGWA 2ZCCA 4ZDVA 1NI2A 4MDKE 3ZNGC 3PSEB 4DK5A 4WAAA 2PJHA 2MP2B 3RZWC 3RZFA 1WMHB 2C9WB 2DENB 3KVFB 4ICUA 2WYQA 4BOSC 4A3OA 5E6PA 1Q5WB 1WJ4A 1H8CA 5E6NA 2N4FA 3PLUA 2EMSA 2KWCA 3MHSD 3QAQA 4K7SA 4FULA 4EUTA 1RRBA 2WX1A 3M95A 2AL3A 3PZDA 4E74A 3GZNI 3QCAA 3ZNHB 2J7QB 4JGHB 2Z0EB 2K8CA 3B1LX 1P9DU 2IO0B 4BBNC 3WALA 1M94A 3NZUA 3QHTA 4WQOB 4FBJB 2KN5A 3V60A 4II3B 1L7YA 4ICVA 2KFKA 2KLCA 5GMVA 4HPLB 3RD2A 3ZUNA 1L2NA 1YX5B 2LGXA 2O2VA 3PGEA 4G11A 1YD8U 3U7DA 2ZCBA 2RPQA 3DCGA 3UIOB 4N9F4 4LJPB 2DX5B 2KK8A 4MGKE 2IY0B 2YLMA 4GU2A 1LXDA 3PS6A 2AYOB 2KMCA 2V1YA 3DVGX 4HPMB 2LWPA 2HTHA 5CX3A 1V49A 3L0WB 1Z5SB 5AZGA 1GC6A 1WM3A 4JQWC 4XZ4A 1GUAB 4KDIC 2MWSB 1EUVB 4G50A 1R4NI 3HM6X 4IM2A 3N32A 3WIMA 2MX2A 3ZTDA 1LM8B 2FIFA 3PT2B 2CHZA 2UWQA 4GIVA 1GNUA 3JYUA 1E8XA 1WJUA 4I6NB 4CO7A 2NR2A 3A1QA 4GDKB 3MTNB 3DVNV 4I6PA 4BKTA 4K81A 5DCNA 4AUQC 5AEKB 1P0RA 2DZKA 4ZRJA 2K1FA 2PE9A 2K8HA 4BOZB 3L13A 3VHTC 2N9XA 1TTNA 2IYDB 2FCMA 5HKHA 3IBEA 2M8SA 3A9JA 5DPSA 4GMVA 2A5UA 1SE9A 4KV2A 4MEMA 4DWFA 4IWPA 4AP4C 1P1AA 2JF5A 3NS8A 1LFDA 3LDZE 2G4SA 2B3AA 1QZEA 2ZJDA 3AU4A 2N1WA 2N7EA 4B9KA 2EMTA 5CHFA 2KDBA 3L16A 3IG3A 2K39A 4ANWA 4EZKA 4GN1A 2MBQA 4KDLB 3RCZA 2XK5B 2LASA 4GB9A 3AULA 1U4AA 2PEAA 2MLBA 3W1YA 3GOEA 3ONSA 3APFA 3X0WA 4G0NB 3EC8A 3KYDD 3DOWA 1RLFA 1GG3A 2KWUB 4YL8A 1WGGA 2G4DB 2O6VB 3ALBA 4II2B 2JWZA 2R2OA 4FJZA 4ZYNA 2JUOA 4ZRIA 3PRMB 3VTVA 4ZRKA 3M63B 2LD9A 2KX0A 2JT4B 1WH3A 2IZVB 3CMMB 2NBVB 2RR9A 4FLHA 4HJKA 2KO3A 5J18A 3ZRFA 1V80A 4NNJB 3VUXA 2D11A 4BKSD 3ECIA 3X23A 4BVUC 1MG8A 2ASQA 4W9HA 4A3PA 1V5OA 1Y8RC 3KUCB 3N3KB 2IO2B 1KLVA 2JVCA 1WXAA 4IUMB 4BBNF 3NOBA 3O65B 5G2NA 5LLIA 1T0YA 2L8JA 4J6IA 3ZNZB 1AARA 2KDFB 4M8NA 1UBQA 1C3TA 2MCNB 2J0MA 2MBOA 3Q3FA 3UQAA 1TZ1A 2KFKB 2O6VD 1ISNA 2O2VB 2IO3B 2M4NA 4HDOA 3TJPA 1UZXB 4IM3A 5L95C 3SDLC 2NBUA 3H9DA 3DDCB 3QWZB 1C1YB 2IY1B 2LUEA 3AXCA 3VVWB 5DPRA 4E71A 2KLGA 4AJYB 2MSED 4EZJA 3UQBA 4F1SA 3PVLA 1WGHA 3TIXA 2NBWB 3R7RA 2GMIC 2YVCA 4NY0A 3KUDB 2Z0DB 5G55A 2MBHA 3A9KA 1XT9B 3DBSA 5J2RA 2LGYA 2JZ3B 4CHKA 2BGFA 2KC1A 2OOBB 3CSTA 4X57B 1WIAA 5KHOA 3VQIA 1YQBA 4DHJB 1P3QU 3DVNU 3IVFA 5D2MB 2RSUA 2MBEA 2NS5A 4KIKB 5JHBA 2LJ5A 2N7DA 3NY5A 4M0WB 4RM8A 2L05A 2CHXA 2FUHB 2R2QA 1OQYA 2ZZPB 4NAWB 5C23A 1X1MA 4TV3A 1WX9A 4HWIB 4WWNA 4FHKA 1WE6A 2FNJB 2BKRB 5JH5C 2DZJA 3QX1A 3ZNID 3VXWA 1J19A 3OAWA 3VUWA 4KSKC 1ZW7A 3A9JB 2GOWA 1WR1A 2HJ8A 3CF6E 2BF8B 2HD5B 5D6JB 3ZVVA 2AL6A 1V6EA 3V6EB 4W9EA 2M17A 2AWTA 3EECA 4GDLA 3UGBB 3PRZA 1E90A 1WFYA 1IPGA 3H6NA 4NJ6A 2FAZA 1Z2MA 1OEYJ 2EKEC 4DHJD 5JZEB 1V5TA 3ZW3A 3ENEA 3UF8A 3IHPC 3S2AA 3R3MA 3RUIB 4B95A 3JVZX 1OEYA 1ZGUB 2L3ZA 2WDTB 4K1RB 4F8CB 3D32A 1Q1OA 3TCAA 2MW5A 1WMHA 1WRDB 4PS7A 3VDZA 3QARA 5CHWA 1I35A 2K6QA 2KX3A 3VFKA 2CR5A 4EFOA 3QA8A 2JXXA 2MBBB 3RYTA 3ZIMA 4EEWA 4NJ7A 2WWZA 4M8MA 4EZLA 3L17A 1E7UA 2DAFA 4DBGA 3H7PB 4AOFA 1FXTB 2BYEA 2K6DB 4W9IA 2IO1B 2N1VA 3JW0X 4E3CA 3KYCD 1WXVA 4HDQA 1SGHA 2D2QA 4WJPA 5CHVC 2ZPNA 1WM2A 1WXMA 2LRWA 2LVOA 4K7UA 5IAAC 5AZHA 1WY8A 4HLEA 3N30A 3VUYA 1S3SG 3QK0A 2HE7A 5BO4B 1UH6A 2WX0A 2DZMA 2LZ6A 5D7GA 2OJRA 5FR6A 2GBMA 1J0GA 5EDSA 2IBIB 2JPHA 3K9OB 5LXHA 1WZ0A 1YJ1A 2GBNA 5L83A 1BT0A 1EF5A 2DZIA 2L76A 4MSMB 3A33B 4K7WA 2KJRA 3CSFA 5AZFA 3HK0A 2BYFA 4DXAB 4HVBA 4PS3A 1WZ3A 2LI5A 2L00B 4MH0E 3ZRCA 4PYZA 1SIFA 2KFJA 4GOCA 3W1SA 2KJ6A 4GDKA 1J8CA 2JZZA 1E7VA 1PQSA 3KUZA 5C1ZA 2KANA 2MA9B 2KHWB 3TBLD 1IYFA 2ZVOA 4FHJA 2C7NB 3L54A 4F7ZA 4W9KA 4BKGA 2K25A 4KVGB 3ZTCA 2KOXA 4MGIE 2M1MA 3DBLI 3HIZA 2KDEB 3M62B 4OVUA 3V62A 3ZKJC 5E6OA 1WGYA 4BFRA 1NDDA 3U30A 5D94A 2KQ7A 4JIOU 4W9LA 1WR6E 3NHEB 1KM7A 2KTFA 4W9DA 4GDLB 2KWVB 3PV1A 2XK5A 2ZNVC 4URKA 3MJWA 2L7RA 2LVQA 4ANXA 3ZDMC 3QJZA 4ANVA 3U8ZA 3SHQA 2KDIA 3BINA 2G45B 1YIWA 2DYOA 3HM3A 1JRUA 3ML9A 4MJSA 2NVUI 4DHZE 3WAPA 2BYVE 2KVRA 2LVPA 2O6VA 4W9FA 1F9JA 3UINB 3OJ4B 4MGZE 3BY4B 2DYBA 3A1QB 4P7IA 3ZO5B 1UELA 4TQ0A 3QC8B 3PPAA 1LQBA 4AWJA 2KMAA 2PPHA 2LXAA 4NQLB 3A4RA 2I1KA 4IWOA 2D3GA 4KZ0A 1IP9A 3T8MA 2J0JA 2RD0A 4WJQA 3LJ3A 2A4ZA 4ASWC 1VCBA 3R66C 3NZSA 1EO6A 2BWFA 2KJHB 3M3JA 3PHWB 2CHWA 1WYWB 2KTRA 2NPTA 3EFUA 2GBKA 3B0AA 3EHVA 3V6CB 1WE7A 3JSVA 2BPSA 2KQSA 2BWES 4FA6A 1ZKHA 2C7MB 4LJOB 4OVVA 1GJZA 4KSLC 4W9CA 3V61A 1E8ZA 1XD3B 3ZDTA 1RFAA 3RT3B 5JHAA 2FIDA 3PLVA 4TKNA 2MQJA 3PTFC 4IG7B 2RGFA 2V4LA 4CYEA 2FCSA 4TUUA 4FADA 5KHQA 1WGDA 1EF1A 3DBHI 1V2YA 4ANUA 3K9PB 3VTUA 2KD0A 4MM3A 3WA0A 3VH3B 1KOTA 2MP2A 1V9JA 3QIJA 4IWQA 4DHZB 3PREA 4MGYE 2XEWA 1WI0A 1WGRA 2M0XA 4MSQB 1A5RA 5TR5A 3QQ8B 1G6JA 2D10A 1NBFC 2L0FA 1RAXA 3WAMA 3WAOA 1YX6B 1CMXB 4GGQA 4WWOA 3TL5A 1TGZB 2G3QB 4LDTB 4RM9A 3C0RB 4KIKA 4FN2A 5DPTA 4HXDA 1WJNA 2ZNVB 4A20A 4NAWA 2XBBC 3VH4B 4AJWA 2J0KA 3I3TB 2GBJA 4DDID 3AI5A 3OLMD 2ZEQA 1D3ZA 2KC2A 2Y5BB 2FCQA 2FCNA 2N9EB 1TBEA 3L10B 4EOYA 4NPNA 3APDA 4PYUA 2W9NA 3VAWA 3KH0A 4NQKE 4GXBA 4I6LB 2JRIB 1R4MI 1E8WA 1WXSA 3TMPB 4GSWA 3Q3JA 2N9PC 2DAJA 1VD2A 4HCNB 3KW5B 4FJVB 4IW0A 2DYMA 5DPWA 2D07B 4G3XB 3APCA 1E5WA 4LDTD 5CTRC 4KZCA 1HE8A 2LRUA 4B6WA 2CS4A 2KNBA 3DQVA 3HHMA 2LXCA 2JRHA 3ML8A 2C5LC 2KZRA 2C7HA 2CKHB 4HK2A 3A9KB 3T9LA 4MELA 4W9GA 4EKUA 2JY6A 4IC7B 2AEHA 3A4SC 3DBRI 4WJNA 4MJSB 2ZPYA 3WANA 3P2BA
chains in the Genus database with same CATH superfamily
4MT5A 2QC8A 1Q0WB 2BKFA 1JWBD 3MJ5A 3SD5A 3U2SC 1SJED 3AU5A 4DDGD 1FNUA 4IM0A 1KFYB 1GC7A 2KTRB 1NYQA 5IOIA 4XC2A 3JSVB 1I42A 1PFDA 2KKCA 2GBRA 2QEJC 3H7SA 2R61A 1UD7A 3GB1A 2V3SA 4JLCA 1TS5A 2QIEB 2ONQA 2ZCCA 4MDKE 4WAAA 1TKYA 3KVFB 5E6PA 2N4FA 1HEZE 2K3UA 4OW0A 1N5XA 3URYA 2EMSA 2WX1A 3QCAA 2J7QB 4TSSA 4LTUA 2WDQB 2Z0EB 4BBNC 3WALA 4C7YA 1M94A 3BK1A 5G5GA 1SJHD 1JMLA 4II3B 4ICVA 5GMVA 1F1HA 1YX5B 4BZAA 3PGEA 2LGIA 2ZCBA 2RPQA 1SIJA 4N9F4 2KK8A 2MHJA 2IY0B 1LXDA 3PS6A 1DGJA 2KMCA 2LWPA 1Z5SB 3I9V1 1VLBA 4KDIC 1KH0A 4G50A 2WDVB 1R4NI 2N9LA 2DLBA 4IM2A 3N32A 2CHZA 4I6NB 4CO7A 3I63C 3A1QA 1QOGA 4K81A 5DCNA 5AUKA 1P0RA 2BS3B 4OZAA 3T3OA 2K1FA 4BOZB 4HEA1 1V97A 2BS4B 4RGTA 2BB5A 1R7SA 1UGJA 2INDC 4DWFA 4IWPA 1N62A 2JF5A 2G4SA 1QZEA 2ICIA 2N7EA 2VH1A 3KQ4A 1FXAA 2KDBA 1QT9A 2JSVX 3IG3A 2K39A 2AQ1B 2L1AA 2LASA 1U4AA 3U7ZA 2PEAA 3ONSA 3X0WA 1A70A 1XLNA 3ETRA 2LUMA 4LK0M 2LD9A 4WWMA 2GLSA 1WH3A 4HJKA 3N9YC 2KQ4X 3IAS1 1J7AA 1V80A 2OHFA 3X23A 4XE0A 1MHHE 2IO2B 1KLVA 2JVCA 3P1MA 4BBNF 3O65B 3N1XC 5LLIA 2L8JA 5BMHA 2O6VD 4L2YA 3TJPA 5L95C 3SDLC 1C1YB 4KX6B 3AXCA 4E71A 1ZE3D 1FRRA 1PGXA 2MSED 4EE2A 3PVLA 3TIXA 3R7RA 4RF1A 2Z0DB 4CHKA 1PYWD 1WIAA 5KHOA 3ZGZA 1YJIA 5JHBA 3BIID 1UF0A 4RM8A 2L05A 1K52A 1OQYA 2ZZPB 3LB8C 1RYJA 1X1MA 1WX9A 2WXJA 4FHKA 1WE6A 3ZNID 3VXWA 1J19A 2V9HA 3Q2AC 2HJ8A 1WR1A 3PRZA 3NS1A 2GRIA 1L4ZB 3MHZA 1VDVA 1WYGA 2H89B 1Z2MA 1OEYJ 4DHJD 5JZEB 1P7EA 1P7FA 1STEA 4B95A 4BAXA 1ZGUB 2L3ZA 3D32A 3TCAA 2MW5A 1IUEA 1WMHA 1WRDB 4PS7A 4DXFA 3VFKA 4EFOA 3AE4B 4HPPA 4L1BA 3ZIMA 4NJ7A 4EEWA 4EZLA 3L17A 3H7PB 1FXTB 3JW0X 1CJEA 3BVZA 4WJPA 1WM2A 2LRWA 4K7UA 3N30A 1S3SG 2HE7A 4YT0B 2LZ6A 2IDYA 1SB3C 2GBMA 2NMQA 4ITKA 1M4VA 5LXHA 1WZ0A 3RNFC 2NTTA 2GBNA 1BT0A 2L76A 2WXHA 3BK2A 5AZFA 4DXAB 4HVBA 4PS3A 1WZ3A 2L00B 3ZRCA 4PYZA 4GOCA 3W1SA 4WAFA 4GDKA 3SEBA 3KUZA 5HG2A 4M00A 2KANA 1EM7A 1D5MC 4FHJA 4W9KA 4KVGB 2PTLA 2NTSA 3NHEB 4CQNA 2KTFA 4W9DA 2KWVB 2D3BA 2XK5A 3SHQA 5C3JB 4MH8A 1YIWA 2G45B 4MJSA 2J52A 4OZBA 4DHZE 3WAPA 1ZPSA 3UINB 3ZO5B 2INPE 3PPAA 2PPHA 2LXAA 3AN1A 4IWOA 2LEKA 1I4RA 1IP9A 3T8MA 4WJQA 3LJ3A 3NZSA 2KJHB 2BWFA 2CHWA 2NPTA 2GBKA 3B0AA 3U52E 4HKQA 1L4DB 4YSYB 2W54A 4OVVA 2WNMA 2JWUA 2WP9B 1XD3B 1FD6A 2FIDA 3PLVA 4TKNA 1VZ8A 1ACCA 4TUUA 2E3TA 3DBHI 3WA0A 4MM3A 4DHZB 3W2DA 3PREA 2XEWA 1E6EB 2D10A 3WAMA 4YTNB 3PO0A 1FMAD 3DHIC 3VH4B 2KDMA 2J0KA 2ZEQA 4KGRA 2KC2A 2Y5PA 4ARIA 1TBEA 4EOYA 4PYUA 2W9NA 3VAWA 1F0ZA 2XNAC 2JRIB 1E8WA 3WCQA 4GSWA 3Q3JA 2QJLA 2N9PC 1VD2A 4FJVB 2PIAA 4IOIE 4LDTD 4KZCA 1YQ3B 1SEBD 2CS4A 2PVOD 3ML8A 4W9GA 1TS2A 2QILA 3A4SC 4WJNA 5IN7A 3RULA 3GP7A 4XX5A 1I4QA 1UBIA 3OJ3A 3IXSA 1OTRB 1P98A 3TEXA 2CU1A 1AWDA 2REXA 1K8RB 4TQ1A 2PE6B 4BKSA 2K9XA 1UWMA 1ROEA 3L08A 2L52A 1UWXA 4LCDE 3SU8X 1E8YA 2K8BA 3OG5A 3O13A 1F77A 3AEGB 4W9JA 1WF9A 2QMTA 4DXGA 5J17A 3B08A 1IGDA 1H4RA 1JWSD 3PSEB 4DK5A 2MP2B 3RZWC 3RZFA 2DENB 4ICUA 2WYQA 4RH6A 4BOSC 4A3OA 1WJ4A 3AM9A 1H8CA 1CK1A 4XDDA 3DHHC 4N6EB 1V1PA 3M95A 1ET6A 4E74A 2HJ1A 3B1LX 2IO0B 1TZOA 1RWSA 3NZUA 5D3DA 4FBJB 2KN5A 1YN3A 3V60A 2KFKA 2TSSA 4LJPB 2DX5B 2WS3B 3NVWA 3Q8CA 4GU2A 3R8BA 3R2TA 3NVYA 1UNSA 1GC6A 4JQWC 3FILA 3WIMA 1NVID 1LM8B 3PT2B 4ZOHC 1GNUA 4M0WA 5BYQA 2NR2A 3TSSA 4BKTA 2OJWA 5AEKB 2MJEA 1AYFA 2DZKA 2UU7A 4ZRJA 1I4HA 1OQRA 2PE9A 5HKHA 2PKOA 5BMGA 2X8XX 1I7HA 4GMVA 1QLBB 2A5UA 2CU3A 1SE9A 1KTKA 4KV2A 1P1AA 1FIQA 3NS8A 3LDZE 2B3AA 3AU4A 2N1WA 1T0RC 2EMTA 3EGRA 4AS1A 2EELA 3L16A 4GN1A 2AQ3B 3W5VB 3AULA 3GOEA 4G0NB 3EC8A 3DOWA 1RLFA 1WGGA 2JYEA 2G4DB 2O6VB 2JWZA 2R2OA 2JUOA 3Q8AA 1GOZA 1JQ4A 1JWMD 1DYQA 2JT4B 5EE1A 2IZVB 2KO3A 3ZRFA 2V3NA 2EKIA 4BKSD 3DBLB 3MC8A 1MG8A 1D5XC 2J42A 1V5OA 3KUCB 3NOBA 2QDFA 1T0YA 4J6IA 1C3TA 3RPFC 3Q3FA 3UQAA 1TZ1A 3AE2B 2INCC 5BYRA 4IM3A 3H9DA 3P4RB 1JWUD 3QWZB 2IY1B 4OZCA 5DPRA 5T8IA 4EZJA 2BBCA 3EFCA 2K5PA 5G55A 3A9KA 3AH7A 1XT9B 2RDHA 3DBSA 2BGFA 3GE8C 3VQIA 4DHJB 4A55A 1P3QU 1FO4A 3HVZA 1OFFA 2RSUA 2LJ5A 3NY5A 4ACFA 4NAWB 5C23A 4NJCA 2LHEA 2DZJA 2WGSA 1GPXA 1IBXA 5BYSA 2AQ2B 2HD5B 3ZVVA 3KWVA 3C8YA 2D5GA 3UGBB 1WFYA 3Q69A 1IPGA 3H6NA 3ZYYX 2FAZA 3AE1B 5HI1A 1E10A 3ZW3A 3UF8A 1FM0D 1HZ6A 3IHPC 3Q3OC 1T6BX 3JVZX 2L83A 3NRZA 4K1RB 1C77A 1Q1OA 2Q5WD 4YSZB 2CR5A 1SBBB 3QA8A 2JXXA 3RI7C 1ZDVA 3RYTA 4P1BC 4M8MA 2BVCA 2DAFA 4XWWA 1MHXA 1LGRA 1HQRD 2N1VA 4HDQA 1SGHA 3U7DA 2ZPNA 3NUHB 4HLEA 3UI3A 3QK0A 1ZXHA 5BO4B 4RF0A 5D7GA 3AMZA 5EDSA 2IBIB 2JPHA 3RNAC 5HFYA 1VJKA 3U4EG 5L83A 4LNIA 2DZIA 4KGTA 3Q14C 2BYFA 4LNKA 2JU6X 2LI5A 2SEBD 2VH2A 2KAJA 2KHWB 3FC4A 5HHDG 2C7NB 3BYYB 4DQOC 3BVMA 3AE5B 4BKGA 3HIZA 4OVUA 2KDEB 1WGYA 1NDDA 1ZP0B 4W9LA 2M56B 1KM7A 5H92C 2ZNVC 4URKA 4ANXA 3QJZA 4ANVA 4JWUC 3BINA 2DYOA 1JRUA 1PGAA 2NVUI 1SE4A 1VRAB 3IAM1 2LVPA 2WXLA 3OJ4B 4MGZE 1AW7A 3BY4B 1V1OA 2KMAA 4NQLB 1L0XB 3AEBB 2J0JA 2A4ZA 4ASWC 4YTMB 1EO6A 4H2AA 1BXTA 3EFUA 3RNEC 1WE7A 2BPSA 2BWES 3VRBB 1GJZA 1DOYA 1YOVB 3V61A 3ZDTA 3CIRB 4JX1C 2MQJA 1E0ZA 3PTFC 2G9HD 4IG7B 2WXRA 2V4LA 3BZDB 2PLPA 4ANUA 1R4NB 1V9JA 1FCCC 1QILA 3QIJA 4MGYE 1WGRA 4MSQB 1A5RA 2K0PA 5FR3A 2L0FA 3P4PB 2G3QB 4LDTB 2IGGA 5DPTA 4HXDA 1WJNA 2ZNVB 1FFVA 4C4VB 4AJWA 2GBJA 2V4IB 3OLMD 1D3ZA 2DNFA 2FCQA 2FCNA 1MFWA 1CQVA 1MJDA 4NPNA 3KH0A 4NQKE 4GXBA 1R4MI 1WXSA 5GXGB 3TMPB 1OQQA 2DAJA 4HCNB 3KW5B 4FXCA 2DYMA 5DPWA 2D07B 5E6JA 4B6WA 3Q8FA 2LFIA 1JWAD 2C5LC 4HK2A 4MELA 3NZ3A 3DBRI 1QKZA 4MJSB 1ZOYB 3WANA 1D5ZC 3VR8B 2L0TA 1SXTA 1L6UA 4FJYA 2QHOA 3PHXB 3H7PA 1FFUA 4OVZA 2LGDA 4PS8A 3H1UA 2DHZA 2NPTB 4YWGG 1UGMA 2WXQA 1T3QA 1V86A 2NCNA 1TIFA 1TT5B 1B1ZA 2YEPB 3UIPB 2I1JA 1S1QB 1WJ6A 3C19A 1JROA 3VTWA 2XN9C 1WX7A 3T3NA 4HCPB 2VRRB 3DVGY 1KJTA 1OGWA 4ZDVA 1NI2A 1C4CA 1DOXA 1AN8A 3V3XA 4HROA 1Q5WB 3V05A 3PLUA 3QAQA 4FULA 4EUTA 1RRBA 1ZUD2 2AL3A 1XCQL 3GZNI 2D3AA 1TS4A 2K8CA 1F2RC 1BUIC 3QHTA 4WQOB 2H88B 1XLOA 4ZRPA 1L7YA 3RD2A 4HPLB 2O2VA 4G11A 1YD8U 3DCGA 3UIOB 4XWTA 2HDEA 5H8YE 3CWIA 3TEWA 3DVGX 5CX3A 4TMAB 3L0WB 5AZGA 4LNOA 4XZ4A 1GUAB 1EUVB 4C80A 4IKGA 3HM6X 2MX2A 3ZTDA 3J9CA 2ACZB 1VZ7A 2CJOA 1XLPA 4YTPB 3I57A 2K8HA 1KLGD 3VHTC 2IYDB 2FCMA 3IBEA 1TKGA 3A9JA 4PK1A 1RM6C 2MEKA 3Q6BA 4AP4C 1XF5L 3RN9C 2BTEA 2N0SB 2ZJDA 4B9KA 5CHFA 2BS2B 2JYTA 2MBQA 1WGKA 3RCZA 2WXGA 2IJ0A 1T5XD 1L6VA 2MLBA 1TS3A 1EWCA 3IT6B 3APFA 1MPEA 3FAHA 1NI3A 3P63A 3AEEB 4ZYNA 4ZRIA 1SE3A 3Q8EA 2W3RA 3VTVA 4ZRKA 3M63B 5EE0A 3HRDD 4FLHA 2NBVB 2RR9A 2LJIA 4NNJB 4O1NA 4KKJA 3VUXA 2D11A 1N61A 2ASQA 1Y8RC 4WH4A 1HTQA 3OWEB 3TUOA 1AARA 4A6QA 4M01A 1MVKA 2KFKB 2M4NA 4HDOA 2WXIA 1UZXB 2NBUA 3N1YC 1I4XA 3DDCB 3EUB2 3VVWB 2KLGA 4F1SA 2E6XA 1WGHA 1N63A 1CZPA 2GMIC 4US8A 3ABVB 4NY0A 4PT5A 2LGYA 2JZ3B 3AB5A 2KC1A 3CSTA 4X57B 3RNBC 3AE6B 3IVFA 4KIKB 2NS5A 2N7DA 4M0WB 4KKIA 2FUHB 4HWIB 4WWNA 2LMCA 4ZRQA 3W5UB 4REZA 1ZW7A 1FCLA 3CF6E 5D6JB 4HJGE 2AL6A 3AE3B 1V6EA 4W9EA 4GDLA 3DBHB 4NJ6A 1N6ZA 2INNE 2EKEC 4RFBA 3ENEA 1FNVA 3RUIB 1LO5D 1OEYA 1NEKB 1EU3A 2KMMA 1N60A 3VDZA 3QARA 1I35A 2K6QA 3L4PA 4A9AA 1JCKB 1T0SC 2WWZA 1QOBA 3DHGC 1L0VB 1E7UA 4DBGA 5LNK1 2IO1B 3RMKC 4E3CA 3KYCD 1WXVA 1TY2A 2IPKD 2QSDA 2D2QA 5BMIA 1EU4A 2LVOA 5IAAC 3AECB 1C78A 5AZHA 1WY8A 4A8XC 3VUYA 4NZLB 1EWYC 1YNTE 2DZMA 2FBWB 2OJRA 5FR6A 2J53A 2WXFA 3KWLA 1WRIA 1ZXIA 4MSMB 1EF5A 3A33B 4K7WA 2KJRA 3CSFA 2WXNA 3KLSX 2BB6A 3HK0A 4MH0E 3PZ7A 4QAYA 1SIFA 1L0YB 1PUTA 5D3IB 2KJ6A 2DBYA 1PQSA 3Q3NC 4S0RA 1N5WA 3LXFA 1SF0A 1IYFA 2IGHA 3L54A 4F7ZA 4USAA 2K25A 3ZTCA 2KOXA 3R2IA 2M1MA 1I4GA 3M62B 1IBXB 4AQ7A 5E6OA 3U30A 2KQ7A 4JIOU 1WR6E 3TEZA 4LNFA 4NAMA 3P42A 2WU2B 3MJWA 2L7RA 4RGNA 3ZJUA 2KWDA 3U8ZA 2KDIA 2CJNA 3MFGA 2MH7A 1ESFA 1RFKA 3ML9A 1FPYA 1NENB 5TSSA 5IP4D 2BYVE 3W9CB 2O6VA 4W9FA 1F9JA 4JE3B 3A1QB 4P7IA 3ZXRA 4WIPA 3VR9B 4TQ0A 1FNWA 4K3BA 1LQBA 2I1KA 2D3GA 4KZ0A 1D6EC 2ZW1A 3R66C 3M3JA 3PHWB 1WYWB 2KTRA 1HTOA 3V6CB 5MPOA 4IDIA 3JSVA 3DWGC 2KQSA 1ZKHA 2MJDA 2C7MB 2PVGC 2KACA 2M19A 4KSLC 1E8ZA 2JXTA 2AX5A 1XLQA 2KVZA 4ZHOA 4CYEA 2FCSA 4FADA 4B0EA 1EF1A 1JW9D 1E7PB 1V2YA 1QOFA 3K9PB 3VTUA 4XYCA 2L32A 3SFEB 4IWQA 4XDCA 4US9A 1GB1A 1WI0A 5TR5A 1G6JA 1HA5A 1NBFC 1RAXA 1GAQB 3B2GA 1CMXB 1PGBA 3C0RB 4FN2A 4A20A 4NAWA 2XBBC 3I3TB 1D4BA 3AI5A 1L5PA 4JWSC 4JPSA 1C76A 2QCZA 2JX5A 4I6LB 1GB4A 2BQQA 4ZHPA 3ZXVA 1BMLC 1UUPA 2I2YA 4G3XB 1E5WA 5CTRC 1HE8A 1FRDA 3TEYA 3DQVA 2PW9A 3HHMA 2KYWA 2CKHB 4IC7B 2AEHA 3HVDA 2ZPYA 4ZYSA 1F52A 2C60A 3R7QA 5IA7A 2MRPA 3DPDA 2Z59B 4YXDB 5LXIB 1XCTL 2UYZB 1WX8A 2ZVNA 4WWPA 4JL9A 1WWTA 1ET9A 4RMAA 3AE9B 5I4DA 2WXKA 1C79A 2ZW0A 4C56C 2N9KA 3W1SC 3IFWB 3ZLZA 2VZKD 3AEDB 5FK9C 4C7ZA 4B0MA 4WJOA 1XQQA 2KXJA 2G1EA 1V81A 3PRPB 4XGAB 1JRPA 4HKZE 2RMMA 4LLGM 3ZNGC 4RGMA 2PJHA 1WMHB 2C9WB 3AV8A 1J7CA 3IT4B 5E6NA 1HZ5A 2KWCA 3MHSD 4K7SA 3PZDA 3GS2A 3ZNHB 4JGHB 1P9DU 3BYTB 5G5HA 1J7BA 2KLCA 3ZUNA 1L2NA 4HRSA 2LGXA 5IO9A 2BW2A 4MGKE 2YLMA 2AYOB 2V1YA 2B76B 4HPMB 2K22A 2HTHA 1V49A 1WM3A 3NVVA 2MWSB 2J4XA 2WHIA 4GIVA 2FIFA 1T0QC 2UWQA 2WDRB 3JYUA 1E8XA 1WJUA 2FUG1 4GDKB 3MTNB 3DVNV 4I6PA 4AUQC 4RNAA 3AEFB 3L13A 2N9XA 1TTNA 2M8SA 5DPSA 2WXMA 3BWUD 1Q10A 3MC9A 3B2FA 3I5JC 4MEMA 2I38A 2WLBA 4YSXB 1LFDA 2GB1A 1KRHA 2BYTA 2X38A 2V0GA 2D3CA 2IGDA 4ANWA 3DWMA 4EZKA 4KDLB 4GLSC 2XK5B 1FEHA 3MC0B 4GB9A 3W1YA 1MG4A 1K50A 3KYDD 4YL8A 1GG3A 2KWUB 3ALBA 5EE9A 1V8CA 4II2B 4FJZA 3GE3C 3PRMB 3ZJTA 1YQ4B 2SAKA 2KX0A 1YN5A 3CMMB 1F2RI 5J18A 4MACA 4C4VA 2DWQA 3BVGA 3ECIA 4BVUC 4W9HA 5FKAC 4A3PA 2LHDA 3N3KB 1JALA 1DOIA 1C4PA 2V3PA 1WXAA 1NYRA 4IUMB 5G2NA 3NVZA 2KDFB 4M8NA 1UBQA 1TJEA 2MCNB 2J0MA 2MBOA 2GI9A 1ISNA 4N58A 2O2VB 2IO3B 4MM3B 2LUEA 1FXIA 3UQBA 4AJYB 2NBWB 2YVCA 2PMVA 3KUDB 5J2RA 2MBHA 1YJJA 4K3CA 4RGOS 2OOBB 4Q2JA 4S17A 1YQBA 3DVNU 5D2MB 2YEPF 1SE2A 1Y56A 2MBEA 5AUIA 2CHXA 2R2QA 1HXYD 4TV3A 3ZJVA 2FNJB 2BKRB 5JH5C 1C9FA 3QX1A 2W82A 3OAWA 3VUWA 4KSKC 2JZPA 3A9JB 2GOWA 3B9JA 2BF8B 3V6EB 2M17A 2AWTA 3EECA 1E9MA 1E90A 1IGCA 1QQRA 4J3OD 4D2KA 2N7JA 1TYGB 4KGSA 3RFZB 1ZDXA 1V5TA 3S2AA 3R3MA 1PDXA 2WDTB 4F8CB 4M02A 2HTME 1QF6A 5CHWA 2KX3A 1XO3A 5IKCM 2MBBB 2M0AA 2LGSA 3RNCC 4N59A 4AOFA 2BYEA 1QOAA 2K6DB 4LNNA 4W9IA 1R4MB 1XEEA 3PZ8A 3AEAB 5CHVC 1WXMA 1K53A 2KN4A 1UH6A 2WX0A 2JQRB 4P1CC 1J0GA 2RDBC 3K9OB 4WURA 1YJ1A 4P16A 1K51A 3DBRB 1KF6B 3SFDB 4R3DA 4WQMA 1KLUD 2KFJA 2Y5CA 1J8CA 2JZZA 1E7VA 4A90A 5C1ZA 1V1PB 3LYYA 3NJTA 2WU5B 3NG0A 2MA9B 3TBLD 2ZVOA 3P4QB 4MGIE 3V62A 3DBLI 1C4AA 1XXGA 3E9SA 3ZKJC 4BFRA 5D94A 2BT6A 3P4SB 4C00A 4GDLB 3PV1A 2LVQA 3MP9A 3ZDMC 4UDUC 3H8HA 3Q8BA 3HM3A 3FILB 1WXQA 4P6VF 2KVRA 1TKEA 2DYBA 1UELA 3QC8B 3GZNB 4AWJA 3A4RA 2RD0A 1VCBA 2RDGA 2W3SA 3AE7B 3Q3MC 3EHVA 2WQYB 2WXOA 3HUIA 4FA6A 4LJOB 4W9CA 3EA6A 1RFAA 3RT3B 5JHAA 2RGFA 1B9RA 5KHQA 1WGDA 1KOTA 2KD0A 2Y3AA 3VH3B 3VRAB 2KT7A 2MP2A 4L23A 2W55A 2OEDA 2M0XA 1YMHE 3QQ8B 3ZQ4A 1VZ6A 3WAOA 1I4PA 4OHJA 1YX6B 4GGQA 4WWOA 3TL5A 1TGZB 4RM9A 2MJ3A 3RNGC 4KIKA 4DDID 2Y5BB 2N9EB 4RCOA 3L10B 1VR9A 3APDA 1SSNA 2FE8A 2ON8A 4ARCA 1TY0A 3SR6A 2WXPA 2RPVA 2Z8LA 3AE8B 5C2TB 3N20C 4IW0A 3APCA 2LRUA 5EE3A 1YN4A 2KNBA 2LXCA 2JRHA 3ZNZB 2C7HA 2KZRA 2VZKB 3T9LA 3A9KB 4EKUA 3N1ZC 2JY6A 1MI0A 3E56A 5JXVA 1WSPA 3FKYA 1ENFA 3P2BA
chains in the Genus database with same CATH topology
3RULA 2C60A 3R7QA 1Q0WB 5IA7A 2BKFA 2L0TA 2MRPA 3SD5A 3DPDA 2Z59B 4XX5A 1UBIA 3OJ3A 3AU5A 4DDGD 5LXIB 4FJYA 2QHOA 1OTRB 1P98A 1WX8A 2UYZB 2ZVNA 2CU1A 3PHXB 3H7PA 4IM0A 4WWPA 4JL9A 1GC7A 2REXA 4PS8A 1K8RB 2LGDA 4RMAA 4TQ1A 2PE6B 3H1UA 2DHZA 4BKSA 2KTRB 2NPTB 1UGMA 3L08A 1V86A 2NCNA 3JSVB 4XC2A 3W1SC 3IFWB 3ZLZA 4LCDE 3SU8X 1I42A 1E8YA 2K8BA 2KKCA 2GBRA 3UIPB 2I1JA 3H7SA 1UD7A 2V3SA 1S1QB 1WJ6A 1XQQA 2KXJA 4JLCA 4WJOA 1V81A 3PRPB 4W9JA 3VTWA 1WF9A 1WX7A 5J17A 4HCPB 2VRRB 3DVGY 3B08A 1H4RA 1KJTA 1OGWA 2ZCCA 4ZDVA 1NI2A 4MDKE 3ZNGC 3PSEB 4DK5A 4WAAA 2PJHA 2MP2B 3RZWC 3RZFA 1WMHB 2C9WB 2DENB 3KVFB 4ICUA 2WYQA 4BOSC 4A3OA 5E6PA 1Q5WB 1WJ4A 1H8CA 5E6NA 2N4FA 3PLUA 2EMSA 2KWCA 3MHSD 3QAQA 4K7SA 4FULA 4EUTA 1RRBA 2WX1A 3M95A 2AL3A 3PZDA 4E74A 3GZNI 3QCAA 3ZNHB 2J7QB 4JGHB 2Z0EB 2K8CA 3B1LX 1P9DU 2IO0B 4BBNC 3WALA 1M94A 3NZUA 3QHTA 4WQOB 4FBJB 2KN5A 3V60A 4II3B 1L7YA 4ICVA 2KFKA 2KLCA 5GMVA 4HPLB 3RD2A 3ZUNA 1L2NA 1YX5B 2LGXA 2O2VA 3PGEA 4G11A 1YD8U 3U7DA 2ZCBA 2RPQA 3DCGA 3UIOB 4N9F4 4LJPB 2DX5B 2KK8A 4MGKE 2IY0B 2YLMA 4GU2A 1LXDA 3PS6A 2AYOB 2KMCA 2V1YA 3DVGX 4HPMB 2LWPA 2HTHA 5CX3A 1V49A 3L0WB 1Z5SB 5AZGA 1GC6A 1WM3A 4JQWC 4XZ4A 1GUAB 4KDIC 2MWSB 1EUVB 4G50A 1R4NI 3HM6X 4IM2A 3N32A 3WIMA 2MX2A 3ZTDA 1LM8B 2FIFA 3PT2B 2CHZA 2UWQA 4GIVA 1GNUA 3JYUA 1E8XA 1WJUA 4I6NB 4CO7A 2NR2A 3A1QA 4GDKB 3MTNB 3DVNV 4I6PA 4BKTA 4K81A 5DCNA 4AUQC 5AEKB 1P0RA 2DZKA 4ZRJA 2K1FA 2PE9A 2K8HA 4BOZB 3L13A 3VHTC 2N9XA 1TTNA 2IYDB 2FCMA 5HKHA 3IBEA 2M8SA 3A9JA 5DPSA 4GMVA 2A5UA 1SE9A 4KV2A 4MEMA 4DWFA 4IWPA 4AP4C 1P1AA 2JF5A 3NS8A 1LFDA 3LDZE 2G4SA 2B3AA 1QZEA 2ZJDA 3AU4A 2N1WA 2N7EA 4B9KA 2EMTA 5CHFA 2KDBA 3L16A 3IG3A 2K39A 4ANWA 4EZKA 4GN1A 2MBQA 4KDLB 3RCZA 2XK5B 2LASA 4GB9A 3AULA 1U4AA 2PEAA 2MLBA 3W1YA 3GOEA 3ONSA 3APFA 3X0WA 4G0NB 3EC8A 3KYDD 3DOWA 1RLFA 1GG3A 2KWUB 4YL8A 1WGGA 2G4DB 2O6VB 3ALBA 4II2B 2JWZA 2R2OA 4FJZA 4ZYNA 2JUOA 4ZRIA 3PRMB 3VTVA 4ZRKA 3M63B 2LD9A 2KX0A 2JT4B 1WH3A 2IZVB 3CMMB 2NBVB 2RR9A 4FLHA 4HJKA 2KO3A 5J18A 3ZRFA 1V80A 4NNJB 3VUXA 2D11A 4BKSD 3ECIA 3X23A 4BVUC 1MG8A 2ASQA 4W9HA 4A3PA 1V5OA 1Y8RC 3KUCB 3N3KB 2IO2B 1KLVA 2JVCA 1WXAA 4IUMB 4BBNF 3NOBA 3O65B 5G2NA 5LLIA 1T0YA 2L8JA 4J6IA 3ZNZB 1AARA 2KDFB 4M8NA 1UBQA 1C3TA 2MCNB 2J0MA 2MBOA 3Q3FA 3UQAA 1TZ1A 2KFKB 2O6VD 1ISNA 2O2VB 2IO3B 2M4NA 4HDOA 3TJPA 1UZXB 4IM3A 5L95C 3SDLC 2NBUA 3H9DA 3DDCB 3QWZB 1C1YB 2IY1B 2LUEA 3AXCA 3VVWB 5DPRA 4E71A 2KLGA 4AJYB 2MSED 4EZJA 3UQBA 4F1SA 3PVLA 1WGHA 3TIXA 2NBWB 3R7RA 2GMIC 2YVCA 4NY0A 3KUDB 2Z0DB 5G55A 2MBHA 3A9KA 1XT9B 3DBSA 5J2RA 2LGYA 2JZ3B 4CHKA 2BGFA 2KC1A 2OOBB 3CSTA 4X57B 1WIAA 5KHOA 3VQIA 1YQBA 4DHJB 1P3QU 3DVNU 3IVFA 5D2MB 2RSUA 2MBEA 2NS5A 4KIKB 5JHBA 2LJ5A 2N7DA 3NY5A 4M0WB 4RM8A 2L05A 2CHXA 2FUHB 2R2QA 1OQYA 2ZZPB 4NAWB 5C23A 1X1MA 4TV3A 1WX9A 4HWIB 4WWNA 4FHKA 1WE6A 2FNJB 2BKRB 5JH5C 2DZJA 3QX1A 3ZNID 3VXWA 1J19A 3OAWA 3VUWA 4KSKC 1ZW7A 3A9JB 2GOWA 1WR1A 2HJ8A 3CF6E 2BF8B 2HD5B 5D6JB 3ZVVA 2AL6A 1V6EA 3V6EB 4W9EA 2M17A 2AWTA 3EECA 4GDLA 3UGBB 3PRZA 1E90A 1WFYA 1IPGA 3H6NA 4NJ6A 2FAZA 1Z2MA 1OEYJ 2EKEC 4DHJD 5JZEB 1V5TA 3ZW3A 3ENEA 3UF8A 3IHPC 3S2AA 3R3MA 3RUIB 4B95A 3JVZX 1OEYA 1ZGUB 2L3ZA 2WDTB 4K1RB 4F8CB 3D32A 1Q1OA 3TCAA 2MW5A 1WMHA 1WRDB 4PS7A 3VDZA 3QARA 5CHWA 1I35A 2K6QA 2KX3A 3VFKA 2CR5A 4EFOA 3QA8A 2JXXA 2MBBB 3RYTA 3ZIMA 4EEWA 4NJ7A 2WWZA 4M8MA 4EZLA 3L17A 1E7UA 2DAFA 4DBGA 3H7PB 4AOFA 1FXTB 2BYEA 2K6DB 4W9IA 2IO1B 2N1VA 3JW0X 4E3CA 3KYCD 1WXVA 4HDQA 1SGHA 2D2QA 4WJPA 5CHVC 2ZPNA 1WM2A 1WXMA 2LRWA 2LVOA 4K7UA 5IAAC 5AZHA 1WY8A 4HLEA 3N30A 3VUYA 1S3SG 3QK0A 2HE7A 5BO4B 1UH6A 2WX0A 2DZMA 2LZ6A 5D7GA 2OJRA 5FR6A 2GBMA 1J0GA 5EDSA 2IBIB 2JPHA 3K9OB 5LXHA 1WZ0A 1YJ1A 2GBNA 5L83A 1BT0A 1EF5A 2DZIA 2L76A 4MSMB 3A33B 4K7WA 2KJRA 3CSFA 5AZFA 3HK0A 2BYFA 4DXAB 4HVBA 4PS3A 1WZ3A 2LI5A 2L00B 4MH0E 3ZRCA 4PYZA 1SIFA 2KFJA 4GOCA 3W1SA 2KJ6A 4GDKA 1J8CA 2JZZA 1E7VA 1PQSA 3KUZA 5C1ZA 2KANA 2MA9B 2KHWB 3TBLD 1IYFA 2ZVOA 4FHJA 2C7NB 3L54A 4F7ZA 4W9KA 4BKGA 2K25A 4KVGB 3ZTCA 2KOXA 4MGIE 2M1MA 3DBLI 3HIZA 2KDEB 3M62B 4OVUA 3V62A 3ZKJC 5E6OA 1WGYA 4BFRA 1NDDA 3U30A 5D94A 2KQ7A 4JIOU 4W9LA 1WR6E 3NHEB 1KM7A 2KTFA 4W9DA 4GDLB 2KWVB 3PV1A 2XK5A 2ZNVC 4URKA 3MJWA 2L7RA 2LVQA 4ANXA 3ZDMC 3QJZA 4ANVA 3U8ZA 3SHQA 2KDIA 3BINA 2G45B 1YIWA 2DYOA 3HM3A 1JRUA 3ML9A 4MJSA 2NVUI 4DHZE 3WAPA 2BYVE 2KVRA 2LVPA 2O6VA 4W9FA 1F9JA 3UINB 3OJ4B 4MGZE 3BY4B 2DYBA 3A1QB 4P7IA 3ZO5B 1UELA 4TQ0A 3QC8B 3PPAA 1LQBA 4AWJA 2KMAA 2PPHA 2LXAA 4NQLB 3A4RA 2I1KA 4IWOA 2D3GA 4KZ0A 1IP9A 3T8MA 2J0JA 2RD0A 4WJQA 3LJ3A 2A4ZA 4ASWC 1VCBA 3R66C 3NZSA 1EO6A 2BWFA 2KJHB 3M3JA 3PHWB 2CHWA 1WYWB 2KTRA 2NPTA 3EFUA 2GBKA 3B0AA 3EHVA 3V6CB 1WE7A 3JSVA 2BPSA 2KQSA 2BWES 4FA6A 1ZKHA 2C7MB 4LJOB 4OVVA 1GJZA 4KSLC 4W9CA 3V61A 1E8ZA 1XD3B 3ZDTA 1RFAA 3RT3B 5JHAA 2FIDA 3PLVA 4TKNA 2MQJA 3PTFC 4IG7B 2RGFA 2V4LA 4CYEA 2FCSA 4TUUA 4FADA 5KHQA 1WGDA 1EF1A 3DBHI 1V2YA 4ANUA 3K9PB 3VTUA 2KD0A 4MM3A 3WA0A 3VH3B 1KOTA 2MP2A 1V9JA 3QIJA 4IWQA 4DHZB 3PREA 4MGYE 2XEWA 1WI0A 1WGRA 2M0XA 4MSQB 1A5RA 5TR5A 3QQ8B 1G6JA 2D10A 1NBFC 2L0FA 1RAXA 3WAMA 3WAOA 1YX6B 1CMXB 4GGQA 4WWOA 3TL5A 1TGZB 2G3QB 4LDTB 4RM9A 3C0RB 4KIKA 4FN2A 5DPTA 4HXDA 1WJNA 2ZNVB 4A20A 4NAWA 2XBBC 3VH4B 4AJWA 2J0KA 3I3TB 2GBJA 4DDID 3AI5A 3OLMD 2ZEQA 1D3ZA 2KC2A 2Y5BB 2FCQA 2FCNA 2N9EB 1TBEA 3L10B 4EOYA 4NPNA 3APDA 4PYUA 2W9NA 3VAWA 3KH0A 4NQKE 4GXBA 4I6LB 2JRIB 1R4MI 1E8WA 1WXSA 3TMPB 4GSWA 3Q3JA 2N9PC 2DAJA 1VD2A 4HCNB 3KW5B 4FJVB 4IW0A 2DYMA 5DPWA 2D07B 4G3XB 3APCA 1E5WA 4LDTD 5CTRC 4KZCA 1HE8A 2LRUA 4B6WA 2CS4A 2KNBA 3DQVA 3HHMA 2LXCA 2JRHA 3ML8A 2C5LC 2KZRA 2C7HA 2CKHB 4HK2A 3A9KB 3T9LA 4MELA 4W9GA 4EKUA 2JY6A 4IC7B 2AEHA 3A4SC 3DBRI 4WJNA 4MJSB 2ZPYA 3WANA 3P2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RUL A;  2C60 A;  3R7Q A;  1Q0W B;  5IA7 A;  2BKF A;  2L0T A;  2MRP A;  3SD5 A;  3DPD A;  2Z59 B;  4XX5 A;  1UBI A;  3OJ3 A;  3AU5 A;  4DDG D;  5LXI B;  4FJY A;  2QHO A;  1OTR B;  1P98 A;  1WX8 A;  2UYZ B;  2ZVN A;  2CU1 A;  3PHX B;  3H7P A;  4IM0 A;  4WWP A;  4JL9 A;  1GC7 A;  2REX A;  4PS8 A;  1K8R B;  2LGD A;  4RMA A;  4TQ1 A;  2PE6 B;  3H1U A;  2DHZ A;  4BKS A;  2KTR B;  2NPT B;  1UGM A;  3L08 A;  1V86 A;  2NCN A;  3JSV B;  4XC2 A;  3W1S C;  3IFW B;  3ZLZ A;  4LCD E;  3SU8 X;  1I42 A;  1E8Y A;  2K8B A;  2KKC A;  2GBR A;  3UIP B;  2I1J A;  3H7S A;  1UD7 A;  2V3S A;  1S1Q B;  1WJ6 A;  1XQQ A;  2KXJ A;  4JLC A;  4WJO A;  1V81 A;  3PRP B;  4W9J A;  3VTW A;  1WF9 A;  1WX7 A;  5J17 A;  4HCP B;  2VRR B;  3DVG Y;  3B08 A;  1H4R A;  1KJT A;  1OGW A;  2ZCC A;  4ZDV A;  1NI2 A;  4MDK E;  3ZNG C;  3PSE B;  4DK5 A;  4WAA A;  2PJH A;  2MP2 B;  3RZW C;  3RZF A;  1WMH B;  2C9W B;  2DEN B;  3KVF B;  4ICU A;  2WYQ A;  4BOS C;  4A3O A;  5E6P A;  1Q5W B;  1WJ4 A;  1H8C A;  5E6N A;  2N4F A;  3PLU A;  2EMS A;  2KWC A;  3MHS D;  3QAQ A;  4K7S A;  4FUL A;  4EUT A;  1RRB A;  2WX1 A;  3M95 A;  2AL3 A;  3PZD A;  4E74 A;  3GZN I;  3QCA A;  3ZNH B;  2J7Q B;  4JGH B;  2Z0E B;  2K8C A;  3B1L X;  1P9D U;  2IO0 B;  4BBN C;  3WAL A;  1M94 A;  3NZU A;  3QHT A;  4WQO B;  4FBJ B;  2KN5 A;  3V60 A;  4II3 B;  1L7Y A;  4ICV A;  2KFK A;  2KLC A;  5GMV A;  4HPL B;  3RD2 A;  3ZUN A;  1L2N A;  1YX5 B;  2LGX A;  2O2V A;  3PGE A;  4G11 A;  1YD8 U;  3U7D A;  2ZCB A;  2RPQ A;  3DCG A;  3UIO B;  4N9F 4;  4LJP B;  2DX5 B;  2KK8 A;  4MGK E;  2IY0 B;  2YLM A;  4GU2 A;  1LXD A;  3PS6 A;  2AYO B;  2KMC A;  2V1Y A;  3DVG X;  4HPM B;  2LWP A;  2HTH A;  5CX3 A;  1V49 A;  3L0W B;  1Z5S B;  5AZG A;  1GC6 A;  1WM3 A;  4JQW C;  4XZ4 A;  1GUA B;  4KDI C;  2MWS B;  1EUV B;  4G50 A;  1R4N I;  3HM6 X;  4IM2 A;  3N32 A;  3WIM A;  2MX2 A;  3ZTD A;  1LM8 B;  2FIF A;  3PT2 B;  2CHZ A;  2UWQ A;  4GIV A;  1GNU A;  3JYU A;  1E8X A;  1WJU A;  4I6N B;  4CO7 A;  2NR2 A;  3A1Q A;  4GDK B;  3MTN B;  3DVN V;  4I6P A;  4BKT A;  4K81 A;  5DCN A;  4AUQ C;  5AEK B;  1P0R A;  2DZK A;  4ZRJ A;  2K1F A;  2PE9 A;  2K8H A;  4BOZ B;  3L13 A;  3VHT C;  2N9X A;  1TTN A;  2IYD B;  2FCM A;  5HKH A;  3IBE A;  2M8S A;  3A9J A;  5DPS A;  4GMV A;  2A5U A;  1SE9 A;  4KV2 A;  4MEM A;  4DWF A;  4IWP A;  4AP4 C;  1P1A A;  2JF5 A;  3NS8 A;  1LFD A;  3LDZ E;  2G4S A;  2B3A A;  1QZE A;  2ZJD A;  3AU4 A;  2N1W A;  2N7E A;  4B9K A;  2EMT A;  5CHF A;  2KDB A;  3L16 A;  3IG3 A;  2K39 A;  4ANW A;  4EZK A;  4GN1 A;  2MBQ A;  4KDL B;  3RCZ A;  2XK5 B;  2LAS A;  4GB9 A;  3AUL A;  1U4A A;  2PEA A;  2MLB A;  3W1Y A;  3GOE A;  3ONS A;  3APF A;  3X0W A;  4G0N B;  3EC8 A;  3KYD D;  3DOW A;  1RLF A;  1GG3 A;  2KWU B;  4YL8 A;  1WGG A;  2G4D B;  2O6V B;  3ALB A;  4II2 B;  2JWZ A;  2R2O A;  4FJZ A;  4ZYN A;  2JUO A;  4ZRI A;  3PRM B;  3VTV A;  4ZRK A;  3M63 B;  2LD9 A;  2KX0 A;  2JT4 B;  1WH3 A;  2IZV B;  3CMM B;  2NBV B;  2RR9 A;  4FLH A;  4HJK A;  2KO3 A;  5J18 A;  3ZRF A;  1V80 A;  4NNJ B;  3VUX A;  2D11 A;  4BKS D;  3ECI A;  3X23 A;  4BVU C;  1MG8 A;  2ASQ A;  4W9H A;  4A3P A;  1V5O A;  1Y8R C;  3KUC B;  3N3K B;  2IO2 B;  1KLV A;  2JVC A;  1WXA A;  4IUM B;  4BBN F;  3NOB A;  3O65 B;  5G2N A;  5LLI A;  1T0Y A;  2L8J A;  4J6I A;  3ZNZ B;  1AAR A;  2KDF B;  4M8N A;  1UBQ A;  1C3T A;  2MCN B;  2J0M A;  2MBO A;  3Q3F A;  3UQA A;  1TZ1 A;  2KFK B;  2O6V D;  1ISN A;  2O2V B;  2IO3 B;  2M4N A;  4HDO A;  3TJP A;  1UZX B;  4IM3 A;  5L95 C;  3SDL C;  2NBU A;  3H9D A;  3DDC B;  3QWZ B;  1C1Y B;  2IY1 B;  2LUE A;  3AXC A;  3VVW B;  5DPR A;  4E71 A;  2KLG A;  4AJY B;  2MSE D;  4EZJ A;  3UQB A;  4F1S A;  3PVL A;  1WGH A;  3TIX A;  2NBW B;  3R7R A;  2GMI C;  2YVC A;  4NY0 A;  3KUD B;  2Z0D B;  5G55 A;  2MBH A;  3A9K A;  1XT9 B;  3DBS A;  5J2R A;  2LGY A;  2JZ3 B;  4CHK A;  2BGF A;  2KC1 A;  2OOB B;  3CST A;  4X57 B;  1WIA A;  5KHO A;  3VQI A;  1YQB A;  4DHJ B;  1P3Q U;  3DVN U;  3IVF A;  5D2M B;  2RSU A;  2MBE A;  2NS5 A;  4KIK B;  5JHB A;  2LJ5 A;  2N7D A;  3NY5 A;  4M0W B;  4RM8 A;  2L05 A;  2CHX A;  2FUH B;  2R2Q A;  1OQY A;  2ZZP B;  4NAW B;  5C23 A;  1X1M A;  4TV3 A;  1WX9 A;  4HWI B;  4WWN A;  4FHK A;  1WE6 A;  2FNJ B;  2BKR B;  5JH5 C;  2DZJ A;  3QX1 A;  3ZNI D;  3VXW A;  1J19 A;  3OAW A;  3VUW A;  4KSK C;  1ZW7 A;  3A9J B;  2GOW A;  1WR1 A;  2HJ8 A;  3CF6 E;  2BF8 B;  2HD5 B;  5D6J B;  3ZVV A;  2AL6 A;  1V6E A;  3V6E B;  4W9E A;  2M17 A;  2AWT A;  3EEC A;  4GDL A;  3UGB B;  3PRZ A;  1E90 A;  1WFY A;  1IPG A;  3H6N A;  4NJ6 A;  2FAZ A;  1Z2M A;  1OEY J;  2EKE C;  4DHJ D;  5JZE B;  1V5T A;  3ZW3 A;  3ENE A;  3UF8 A;  3IHP C;  3S2A A;  3R3M A;  3RUI B;  4B95 A;  3JVZ X;  1OEY A;  1ZGU B;  2L3Z A;  2WDT B;  4K1R B;  4F8C B;  3D32 A;  1Q1O A;  3TCA A;  2MW5 A;  1WMH A;  1WRD B;  4PS7 A;  3VDZ A;  3QAR A;  5CHW A;  1I35 A;  2K6Q A;  2KX3 A;  3VFK A;  2CR5 A;  4EFO A;  3QA8 A;  2JXX A;  2MBB B;  3RYT A;  3ZIM A;  4EEW A;  4NJ7 A;  2WWZ A;  4M8M A;  4EZL A;  3L17 A;  1E7U A;  2DAF A;  4DBG A;  3H7P B;  4AOF A;  1FXT B;  2BYE A;  2K6D B;  4W9I A;  2IO1 B;  2N1V A;  3JW0 X;  4E3C A;  3KYC D;  1WXV A;  4HDQ A;  1SGH A;  2D2Q A;  4WJP A;  5CHV C;  2ZPN A;  1WM2 A;  1WXM A;  2LRW A;  2LVO A;  4K7U A;  5IAA C;  5AZH A;  1WY8 A;  4HLE A;  3N30 A;  3VUY A;  1S3S G;  3QK0 A;  2HE7 A;  5BO4 B;  1UH6 A;  2WX0 A;  2DZM A;  2LZ6 A;  5D7G A;  2OJR A;  5FR6 A;  2GBM A;  1J0G A;  5EDS A;  2IBI B;  2JPH A;  3K9O B;  5LXH A;  1WZ0 A;  1YJ1 A;  2GBN A;  5L83 A;  1BT0 A;  1EF5 A;  2DZI A;  2L76 A;  4MSM B;  3A33 B;  4K7W A;  2KJR A;  3CSF A;  5AZF A;  3HK0 A;  2BYF A;  4DXA B;  4HVB A;  4PS3 A;  1WZ3 A;  2LI5 A;  2L00 B;  4MH0 E;  3ZRC A;  4PYZ A;  1SIF A;  2KFJ A;  4GOC A;  3W1S A;  2KJ6 A;  4GDK A;  1J8C A;  2JZZ A;  1E7V A;  1PQS A;  3KUZ A;  5C1Z A;  2KAN A;  2MA9 B;  2KHW B;  3TBL D;  1IYF A;  2ZVO A;  4FHJ A;  2C7N B;  3L54 A;  4F7Z A;  4W9K A;  4BKG A;  2K25 A;  4KVG B;  3ZTC A;  2KOX A;  4MGI E;  2M1M A;  3DBL I;  3HIZ A;  2KDE B;  3M62 B;  4OVU A;  3V62 A;  3ZKJ C;  5E6O A;  1WGY A;  4BFR A;  1NDD A;  3U30 A;  5D94 A;  2KQ7 A;  4JIO U;  4W9L A;  1WR6 E;  3NHE B;  1KM7 A;  2KTF A;  4W9D A;  4GDL B;  2KWV B;  3PV1 A;  2XK5 A;  2ZNV C;  4URK A;  3MJW A;  2L7R A;  2LVQ A;  4ANX A;  3ZDM C;  3QJZ A;  4ANV A;  3U8Z A;  3SHQ A;  2KDI A;  3BIN A;  2G45 B;  1YIW A;  2DYO A;  3HM3 A;  1JRU A;  3ML9 A;  4MJS A;  2NVU I;  4DHZ E;  3WAP A;  2BYV E;  2KVR A;  2LVP A;  2O6V A;  4W9F A;  1F9J A;  3UIN B;  3OJ4 B;  4MGZ E;  3BY4 B;  2DYB A;  3A1Q B;  4P7I A;  3ZO5 B;  1UEL A;  4TQ0 A;  3QC8 B;  3PPA A;  1LQB A;  4AWJ A;  2KMA A;  2PPH A;  2LXA A;  4NQL B;  3A4R A;  2I1K A;  4IWO A;  2D3G A;  4KZ0 A;  1IP9 A;  3T8M A;  2J0J A;  2RD0 A;  4WJQ A;  3LJ3 A;  2A4Z A;  4ASW C;  1VCB A;  3R66 C;  3NZS A;  1EO6 A;  2BWF A;  2KJH B;  3M3J A;  3PHW B;  2CHW A;  1WYW B;  2KTR A;  2NPT A;  3EFU A;  2GBK A;  3B0A A;  3EHV A;  3V6C B;  1WE7 A;  3JSV A;  2BPS A;  2KQS A;  2BWE S;  4FA6 A;  1ZKH A;  2C7M B;  4LJO B;  4OVV A;  1GJZ A;  4KSL C;  4W9C A;  3V61 A;  1E8Z A;  1XD3 B;  3ZDT A;  1RFA A;  3RT3 B;  5JHA A;  2FID A;  3PLV A;  4TKN A;  2MQJ A;  3PTF C;  4IG7 B;  2RGF A;  2V4L A;  4CYE A;  2FCS A;  4TUU A;  4FAD A;  5KHQ A;  1WGD A;  1EF1 A;  3DBH I;  1V2Y A;  4ANU A;  3K9P B;  3VTU A;  2KD0 A;  4MM3 A;  3WA0 A;  3VH3 B;  1KOT A;  2MP2 A;  1V9J A;  3QIJ A;  4IWQ A;  4DHZ B;  3PRE A;  4MGY E;  2XEW A;  1WI0 A;  1WGR A;  2M0X A;  4MSQ B;  1A5R A;  5TR5 A;  3QQ8 B;  1G6J A;  2D10 A;  1NBF C;  2L0F A;  1RAX A;  3WAM A;  3WAO A;  1YX6 B;  1CMX B;  4GGQ A;  4WWO A;  3TL5 A;  1TGZ B;  2G3Q B;  4LDT B;  4RM9 A;  3C0R B;  4KIK A;  4FN2 A;  5DPT A;  4HXD A;  1WJN A;  2ZNV B;  4A20 A;  4NAW A;  2XBB C;  3VH4 B;  4AJW A;  2J0K A;  3I3T B;  2GBJ A;  4DDI D;  3AI5 A;  3OLM D;  2ZEQ A;  1D3Z A;  2KC2 A;  2Y5B B;  2FCQ A;  2FCN A;  2N9E B;  1TBE A;  3L10 B;  4EOY A;  4NPN A;  3APD A;  4PYU A;  2W9N A;  3VAW A;  3KH0 A;  4NQK E;  4GXB A;  4I6L B;  2JRI B;  1R4M I;  1E8W A;  1WXS A;  3TMP B;  4GSW A;  3Q3J A;  2N9P C;  2DAJ A;  1VD2 A;  4HCN B;  3KW5 B;  4FJV B;  4IW0 A;  2DYM A;  5DPW A;  2D07 B;  4G3X B;  3APC A;  1E5W A;  4LDT D;  5CTR C;  4KZC A;  1HE8 A;  2LRU A;  4B6W A;  2CS4 A;  2KNB A;  3DQV A;  3HHM A;  2LXC A;  2JRH A;  3ML8 A;  2C5L C;  2KZR A;  2C7H A;  2CKH B;  4HK2 A;  3A9K B;  3T9L A;  4MEL A;  4W9G A;  4EKU A;  2JY6 A;  4IC7 B;  2AEH A;  3A4S C;  3DBR I;  4WJN A;  4MJS B;  2ZPY A;  3WAN A;  3P2B A; 
#chains in the Genus database with same CATH topology
 4MT5 A;  2QC8 A;  1Q0W B;  2BKF A;  1JWB D;  3MJ5 A;  3SD5 A;  3U2S C;  1SJE D;  3AU5 A;  4DDG D;  1FNU A;  4IM0 A;  1KFY B;  1GC7 A;  2KTR B;  1NYQ A;  5IOI A;  4XC2 A;  3JSV B;  1I42 A;  1PFD A;  2KKC A;  2GBR A;  2QEJ C;  3H7S A;  2R61 A;  1UD7 A;  3GB1 A;  2V3S A;  4JLC A;  1TS5 A;  2QIE B;  2ONQ A;  2ZCC A;  4MDK E;  4WAA A;  1TKY A;  3KVF B;  5E6P A;  2N4F A;  1HEZ E;  2K3U A;  4OW0 A;  1N5X A;  3URY A;  2EMS A;  2WX1 A;  3QCA A;  2J7Q B;  4TSS A;  4LTU A;  2WDQ B;  2Z0E B;  4BBN C;  3WAL A;  4C7Y A;  1M94 A;  3BK1 A;  5G5G A;  1SJH D;  1JML A;  4II3 B;  4ICV A;  5GMV A;  1F1H A;  1YX5 B;  4BZA A;  3PGE A;  2LGI A;  2ZCB A;  2RPQ A;  1SIJ A;  4N9F 4;  2KK8 A;  2MHJ A;  2IY0 B;  1LXD A;  3PS6 A;  1DGJ A;  2KMC A;  2LWP A;  1Z5S B;  3I9V 1;  1VLB A;  4KDI C;  1KH0 A;  4G50 A;  2WDV B;  1R4N I;  2N9L A;  2DLB A;  4IM2 A;  3N32 A;  2CHZ A;  4I6N B;  4CO7 A;  3I63 C;  3A1Q A;  1QOG A;  4K81 A;  5DCN A;  5AUK A;  1P0R A;  2BS3 B;  4OZA A;  3T3O A;  2K1F A;  4BOZ B;  4HEA 1;  1V97 A;  2BS4 B;  4RGT A;  2BB5 A;  1R7S A;  1UGJ A;  2IND C;  4DWF A;  4IWP A;  1N62 A;  2JF5 A;  2G4S A;  1QZE A;  2ICI A;  2N7E A;  2VH1 A;  3KQ4 A;  1FXA A;  2KDB A;  1QT9 A;  2JSV X;  3IG3 A;  2K39 A;  2AQ1 B;  2L1A A;  2LAS A;  1U4A A;  3U7Z A;  2PEA A;  3ONS A;  3X0W A;  1A70 A;  1XLN A;  3ETR A;  2LUM A;  4LK0 M;  2LD9 A;  4WWM A;  2GLS A;  1WH3 A;  4HJK A;  3N9Y C;  2KQ4 X;  3IAS 1;  1J7A A;  1V80 A;  2OHF A;  3X23 A;  4XE0 A;  1MHH E;  2IO2 B;  1KLV A;  2JVC A;  3P1M A;  4BBN F;  3O65 B;  3N1X C;  5LLI A;  2L8J A;  5BMH A;  2O6V D;  4L2Y A;  3TJP A;  5L95 C;  3SDL C;  1C1Y B;  4KX6 B;  3AXC A;  4E71 A;  1ZE3 D;  1FRR A;  1PGX A;  2MSE D;  4EE2 A;  3PVL A;  3TIX A;  3R7R A;  4RF1 A;  2Z0D B;  4CHK A;  1PYW D;  1WIA A;  5KHO A;  3ZGZ A;  1YJI A;  5JHB A;  3BII D;  1UF0 A;  4RM8 A;  2L05 A;  1K52 A;  1OQY A;  2ZZP B;  3LB8 C;  1RYJ A;  1X1M A;  1WX9 A;  2WXJ A;  4FHK A;  1WE6 A;  3ZNI D;  3VXW A;  1J19 A;  2V9H A;  3Q2A C;  2HJ8 A;  1WR1 A;  3PRZ A;  3NS1 A;  2GRI A;  1L4Z B;  3MHZ A;  1VDV A;  1WYG A;  2H89 B;  1Z2M A;  1OEY J;  4DHJ D;  5JZE B;  1P7E A;  1P7F A;  1STE A;  4B95 A;  4BAX A;  1ZGU B;  2L3Z A;  3D32 A;  3TCA A;  2MW5 A;  1IUE A;  1WMH A;  1WRD B;  4PS7 A;  4DXF A;  3VFK A;  4EFO A;  3AE4 B;  4HPP A;  4L1B A;  3ZIM A;  4NJ7 A;  4EEW A;  4EZL A;  3L17 A;  3H7P B;  1FXT B;  3JW0 X;  1CJE A;  3BVZ A;  4WJP A;  1WM2 A;  2LRW A;  4K7U A;  3N30 A;  1S3S G;  2HE7 A;  4YT0 B;  2LZ6 A;  2IDY A;  1SB3 C;  2GBM A;  2NMQ A;  4ITK A;  1M4V A;  5LXH A;  1WZ0 A;  3RNF C;  2NTT A;  2GBN A;  1BT0 A;  2L76 A;  2WXH A;  3BK2 A;  5AZF A;  4DXA B;  4HVB A;  4PS3 A;  1WZ3 A;  2L00 B;  3ZRC A;  4PYZ A;  4GOC A;  3W1S A;  4WAF A;  4GDK A;  3SEB A;  3KUZ A;  5HG2 A;  4M00 A;  2KAN A;  1EM7 A;  1D5M C;  4FHJ A;  4W9K A;  4KVG B;  2PTL A;  2NTS A;  3NHE B;  4CQN A;  2KTF A;  4W9D A;  2KWV B;  2D3B A;  2XK5 A;  3SHQ A;  5C3J B;  4MH8 A;  1YIW A;  2G45 B;  4MJS A;  2J52 A;  4OZB A;  4DHZ E;  3WAP A;  1ZPS A;  3UIN B;  3ZO5 B;  2INP E;  3PPA A;  2PPH A;  2LXA A;  3AN1 A;  4IWO A;  2LEK A;  1I4R A;  1IP9 A;  3T8M A;  4WJQ A;  3LJ3 A;  3NZS A;  2KJH B;  2BWF A;  2CHW A;  2NPT A;  2GBK A;  3B0A A;  3U52 E;  4HKQ A;  1L4D B;  4YSY B;  2W54 A;  4OVV A;  2WNM A;  2JWU A;  2WP9 B;  1XD3 B;  1FD6 A;  2FID A;  3PLV A;  4TKN A;  1VZ8 A;  1ACC A;  4TUU A;  2E3T A;  3DBH I;  3WA0 A;  4MM3 A;  4DHZ B;  3W2D A;  3PRE A;  2XEW A;  1E6E B;  2D10 A;  3WAM A;  4YTN B;  3PO0 A;  1FMA D;  3DHI C;  3VH4 B;  2KDM A;  2J0K A;  2ZEQ A;  4KGR A;  2KC2 A;  2Y5P A;  4ARI A;  1TBE A;  4EOY A;  4PYU A;  2W9N A;  3VAW A;  1F0Z A;  2XNA C;  2JRI B;  1E8W A;  3WCQ A;  4GSW A;  3Q3J A;  2QJL A;  2N9P C;  1VD2 A;  4FJV B;  2PIA A;  4IOI E;  4LDT D;  4KZC A;  1YQ3 B;  1SEB D;  2CS4 A;  2PVO D;  3ML8 A;  4W9G A;  1TS2 A;  2QIL A;  3A4S C;  4WJN A;  5IN7 A;  3RUL A;  3GP7 A;  4XX5 A;  1I4Q A;  1UBI A;  3OJ3 A;  3IXS A;  1OTR B;  1P98 A;  3TEX A;  2CU1 A;  1AWD A;  2REX A;  1K8R B;  4TQ1 A;  2PE6 B;  4BKS A;  2K9X A;  1UWM A;  1ROE A;  3L08 A;  2L52 A;  1UWX A;  4LCD E;  3SU8 X;  1E8Y A;  2K8B A;  3OG5 A;  3O13 A;  1F77 A;  3AEG B;  4W9J A;  1WF9 A;  2QMT A;  4DXG A;  5J17 A;  3B08 A;  1IGD A;  1H4R A;  1JWS D;  3PSE B;  4DK5 A;  2MP2 B;  3RZW C;  3RZF A;  2DEN B;  4ICU A;  2WYQ A;  4RH6 A;  4BOS C;  4A3O A;  1WJ4 A;  3AM9 A;  1H8C A;  1CK1 A;  4XDD A;  3DHH C;  4N6E B;  1V1P A;  3M95 A;  1ET6 A;  4E74 A;  2HJ1 A;  3B1L X;  2IO0 B;  1TZO A;  1RWS A;  3NZU A;  5D3D A;  4FBJ B;  2KN5 A;  1YN3 A;  3V60 A;  2KFK A;  2TSS A;  4LJP B;  2DX5 B;  2WS3 B;  3NVW A;  3Q8C A;  4GU2 A;  3R8B A;  3R2T A;  3NVY A;  1UNS A;  1GC6 A;  4JQW C;  3FIL A;  3WIM A;  1NVI D;  1LM8 B;  3PT2 B;  4ZOH C;  1GNU A;  4M0W A;  5BYQ A;  2NR2 A;  3TSS A;  4BKT A;  2OJW A;  5AEK B;  2MJE A;  1AYF A;  2DZK A;  2UU7 A;  4ZRJ A;  1I4H A;  1OQR A;  2PE9 A;  5HKH A;  2PKO A;  5BMG A;  2X8X X;  1I7H A;  4GMV A;  1QLB B;  2A5U A;  2CU3 A;  1SE9 A;  1KTK A;  4KV2 A;  1P1A A;  1FIQ A;  3NS8 A;  3LDZ E;  2B3A A;  3AU4 A;  2N1W A;  1T0R C;  2EMT A;  3EGR A;  4AS1 A;  2EEL A;  3L16 A;  4GN1 A;  2AQ3 B;  3W5V B;  3AUL A;  3GOE A;  4G0N B;  3EC8 A;  3DOW A;  1RLF A;  1WGG A;  2JYE A;  2G4D B;  2O6V B;  2JWZ A;  2R2O A;  2JUO A;  3Q8A A;  1GOZ A;  1JQ4 A;  1JWM D;  1DYQ A;  2JT4 B;  5EE1 A;  2IZV B;  2KO3 A;  3ZRF A;  2V3N A;  2EKI A;  4BKS D;  3DBL B;  3MC8 A;  1MG8 A;  1D5X C;  2J42 A;  1V5O A;  3KUC B;  3NOB A;  2QDF A;  1T0Y A;  4J6I A;  1C3T A;  3RPF C;  3Q3F A;  3UQA A;  1TZ1 A;  3AE2 B;  2INC C;  5BYR A;  4IM3 A;  3H9D A;  3P4R B;  1JWU D;  3QWZ B;  2IY1 B;  4OZC A;  5DPR A;  5T8I A;  4EZJ A;  2BBC A;  3EFC A;  2K5P A;  5G55 A;  3A9K A;  3AH7 A;  1XT9 B;  2RDH A;  3DBS A;  2BGF A;  3GE8 C;  3VQI A;  4DHJ B;  4A55 A;  1P3Q U;  1FO4 A;  3HVZ A;  1OFF A;  2RSU A;  2LJ5 A;  3NY5 A;  4ACF A;  4NAW B;  5C23 A;  4NJC A;  2LHE A;  2DZJ A;  2WGS A;  1GPX A;  1IBX A;  5BYS A;  2AQ2 B;  2HD5 B;  3ZVV A;  3KWV A;  3C8Y A;  2D5G A;  3UGB B;  1WFY A;  3Q69 A;  1IPG A;  3H6N A;  3ZYY X;  2FAZ A;  3AE1 B;  5HI1 A;  1E10 A;  3ZW3 A;  3UF8 A;  1FM0 D;  1HZ6 A;  3IHP C;  3Q3O C;  1T6B X;  3JVZ X;  2L83 A;  3NRZ A;  4K1R B;  1C77 A;  1Q1O A;  2Q5W D;  4YSZ B;  2CR5 A;  1SBB B;  3QA8 A;  2JXX A;  3RI7 C;  1ZDV A;  3RYT A;  4P1B C;  4M8M A;  2BVC A;  2DAF A;  4XWW A;  1MHX A;  1LGR A;  1HQR D;  2N1V A;  4HDQ A;  1SGH A;  3U7D A;  2ZPN A;  3NUH B;  4HLE A;  3UI3 A;  3QK0 A;  1ZXH A;  5BO4 B;  4RF0 A;  5D7G A;  3AMZ A;  5EDS A;  2IBI B;  2JPH A;  3RNA C;  5HFY A;  1VJK A;  3U4E G;  5L83 A;  4LNI A;  2DZI A;  4KGT A;  3Q14 C;  2BYF A;  4LNK A;  2JU6 X;  2LI5 A;  2SEB D;  2VH2 A;  2KAJ A;  2KHW B;  3FC4 A;  5HHD G;  2C7N B;  3BYY B;  4DQO C;  3BVM A;  3AE5 B;  4BKG A;  3HIZ A;  4OVU A;  2KDE B;  1WGY A;  1NDD A;  1ZP0 B;  4W9L A;  2M56 B;  1KM7 A;  5H92 C;  2ZNV C;  4URK A;  4ANX A;  3QJZ A;  4ANV A;  4JWU C;  3BIN A;  2DYO A;  1JRU A;  1PGA A;  2NVU I;  1SE4 A;  1VRA B;  3IAM 1;  2LVP A;  2WXL A;  3OJ4 B;  4MGZ E;  1AW7 A;  3BY4 B;  1V1O A;  2KMA A;  4NQL B;  1L0X B;  3AEB B;  2J0J A;  2A4Z A;  4ASW C;  4YTM B;  1EO6 A;  4H2A A;  1BXT A;  3EFU A;  3RNE C;  1WE7 A;  2BPS A;  2BWE S;  3VRB B;  1GJZ A;  1DOY A;  1YOV B;  3V61 A;  3ZDT A;  3CIR B;  4JX1 C;  2MQJ A;  1E0Z A;  3PTF C;  2G9H D;  4IG7 B;  2WXR A;  2V4L A;  3BZD B;  2PLP A;  4ANU A;  1R4N B;  1V9J A;  1FCC C;  1QIL A;  3QIJ A;  4MGY E;  1WGR A;  4MSQ B;  1A5R A;  2K0P A;  5FR3 A;  2L0F A;  3P4P B;  2G3Q B;  4LDT B;  2IGG A;  5DPT A;  4HXD A;  1WJN A;  2ZNV B;  1FFV A;  4C4V B;  4AJW A;  2GBJ A;  2V4I B;  3OLM D;  1D3Z A;  2DNF A;  2FCQ A;  2FCN A;  1MFW A;  1CQV A;  1MJD A;  4NPN A;  3KH0 A;  4NQK E;  4GXB A;  1R4M I;  1WXS A;  5GXG B;  3TMP B;  1OQQ A;  2DAJ A;  4HCN B;  3KW5 B;  4FXC A;  2DYM A;  5DPW A;  2D07 B;  5E6J A;  4B6W A;  3Q8F A;  2LFI A;  1JWA D;  2C5L C;  4HK2 A;  4MEL A;  3NZ3 A;  3DBR I;  1QKZ A;  4MJS B;  1ZOY B;  3WAN A;  1D5Z C;  3VR8 B;  2L0T A;  1SXT A;  1L6U A;  4FJY A;  2QHO A;  3PHX B;  3H7P A;  1FFU A;  4OVZ A;  2LGD A;  4PS8 A;  3H1U A;  2DHZ A;  2NPT B;  4YWG G;  1UGM A;  2WXQ A;  1T3Q A;  1V86 A;  2NCN A;  1TIF A;  1TT5 B;  1B1Z A;  2YEP B;  3UIP B;  2I1J A;  1S1Q B;  1WJ6 A;  3C19 A;  1JRO A;  3VTW A;  2XN9 C;  1WX7 A;  3T3N A;  4HCP B;  2VRR B;  3DVG Y;  1KJT A;  1OGW A;  4ZDV A;  1NI2 A;  1C4C A;  1DOX A;  1AN8 A;  3V3X A;  4HRO A;  1Q5W B;  3V05 A;  3PLU A;  3QAQ A;  4FUL A;  4EUT A;  1RRB A;  1ZUD 2;  2AL3 A;  1XCQ L;  3GZN I;  2D3A A;  1TS4 A;  2K8C A;  1F2R C;  1BUI C;  3QHT A;  4WQO B;  2H88 B;  1XLO A;  4ZRP A;  1L7Y A;  3RD2 A;  4HPL B;  2O2V A;  4G11 A;  1YD8 U;  3DCG A;  3UIO B;  4XWT A;  2HDE A;  5H8Y E;  3CWI A;  3TEW A;  3DVG X;  5CX3 A;  4TMA B;  3L0W B;  5AZG A;  4LNO A;  4XZ4 A;  1GUA B;  1EUV B;  4C80 A;  4IKG A;  3HM6 X;  2MX2 A;  3ZTD A;  3J9C A;  2ACZ B;  1VZ7 A;  2CJO A;  1XLP A;  4YTP B;  3I57 A;  2K8H A;  1KLG D;  3VHT C;  2IYD B;  2FCM A;  3IBE A;  1TKG A;  3A9J A;  4PK1 A;  1RM6 C;  2MEK A;  3Q6B A;  4AP4 C;  1XF5 L;  3RN9 C;  2BTE A;  2N0S B;  2ZJD A;  4B9K A;  5CHF A;  2BS2 B;  2JYT A;  2MBQ A;  1WGK A;  3RCZ A;  2WXG A;  2IJ0 A;  1T5X D;  1L6V A;  2MLB A;  1TS3 A;  1EWC A;  3IT6 B;  3APF A;  1MPE A;  3FAH A;  1NI3 A;  3P63 A;  3AEE B;  4ZYN A;  4ZRI A;  1SE3 A;  3Q8E A;  2W3R A;  3VTV A;  4ZRK A;  3M63 B;  5EE0 A;  3HRD D;  4FLH A;  2NBV B;  2RR9 A;  2LJI A;  4NNJ B;  4O1N A;  4KKJ A;  3VUX A;  2D11 A;  1N61 A;  2ASQ A;  1Y8R C;  4WH4 A;  1HTQ A;  3OWE B;  3TUO A;  1AAR A;  4A6Q A;  4M01 A;  1MVK A;  2KFK B;  2M4N A;  4HDO A;  2WXI A;  1UZX B;  2NBU A;  3N1Y C;  1I4X A;  3DDC B;  3EUB 2;  3VVW B;  2KLG A;  4F1S A;  2E6X A;  1WGH A;  1N63 A;  1CZP A;  2GMI C;  4US8 A;  3ABV B;  4NY0 A;  4PT5 A;  2LGY A;  2JZ3 B;  3AB5 A;  2KC1 A;  3CST A;  4X57 B;  3RNB C;  3AE6 B;  3IVF A;  4KIK B;  2NS5 A;  2N7D A;  4M0W B;  4KKI A;  2FUH B;  4HWI B;  4WWN A;  2LMC A;  4ZRQ A;  3W5U B;  4REZ A;  1ZW7 A;  1FCL A;  3CF6 E;  5D6J B;  4HJG E;  2AL6 A;  3AE3 B;  1V6E A;  4W9E A;  4GDL A;  3DBH B;  4NJ6 A;  1N6Z A;  2INN E;  2EKE C;  4RFB A;  3ENE A;  1FNV A;  3RUI B;  1LO5 D;  1OEY A;  1NEK B;  1EU3 A;  2KMM A;  1N60 A;  3VDZ A;  3QAR A;  1I35 A;  2K6Q A;  3L4P A;  4A9A A;  1JCK B;  1T0S C;  2WWZ A;  1QOB A;  3DHG C;  1L0V B;  1E7U A;  4DBG A;  5LNK 1;  2IO1 B;  3RMK C;  4E3C A;  3KYC D;  1WXV A;  1TY2 A;  2IPK D;  2QSD A;  2D2Q A;  5BMI A;  1EU4 A;  2LVO A;  5IAA C;  3AEC B;  1C78 A;  5AZH A;  1WY8 A;  4A8X C;  3VUY A;  4NZL B;  1EWY C;  1YNT E;  2DZM A;  2FBW B;  2OJR A;  5FR6 A;  2J53 A;  2WXF A;  3KWL A;  1WRI A;  1ZXI A;  4MSM B;  1EF5 A;  3A33 B;  4K7W A;  2KJR A;  3CSF A;  2WXN A;  3KLS X;  2BB6 A;  3HK0 A;  4MH0 E;  3PZ7 A;  4QAY A;  1SIF A;  1L0Y B;  1PUT A;  5D3I B;  2KJ6 A;  2DBY A;  1PQS A;  3Q3N C;  4S0R A;  1N5W A;  3LXF A;  1SF0 A;  1IYF A;  2IGH A;  3L54 A;  4F7Z A;  4USA A;  2K25 A;  3ZTC A;  2KOX A;  3R2I A;  2M1M A;  1I4G A;  3M62 B;  1IBX B;  4AQ7 A;  5E6O A;  3U30 A;  2KQ7 A;  4JIO U;  1WR6 E;  3TEZ A;  4LNF A;  4NAM A;  3P42 A;  2WU2 B;  3MJW A;  2L7R A;  4RGN A;  3ZJU A;  2KWD A;  3U8Z A;  2KDI A;  2CJN A;  3MFG A;  2MH7 A;  1ESF A;  1RFK A;  3ML9 A;  1FPY A;  1NEN B;  5TSS A;  5IP4 D;  2BYV E;  3W9C B;  2O6V A;  4W9F A;  1F9J A;  4JE3 B;  3A1Q B;  4P7I A;  3ZXR A;  4WIP A;  3VR9 B;  4TQ0 A;  1FNW A;  4K3B A;  1LQB A;  2I1K A;  2D3G A;  4KZ0 A;  1D6E C;  2ZW1 A;  3R66 C;  3M3J A;  3PHW B;  1WYW B;  2KTR A;  1HTO A;  3V6C B;  5MPO A;  4IDI A;  3JSV A;  3DWG C;  2KQS A;  1ZKH A;  2MJD A;  2C7M B;  2PVG C;  2KAC A;  2M19 A;  4KSL C;  1E8Z A;  2JXT A;  2AX5 A;  1XLQ A;  2KVZ A;  4ZHO A;  4CYE A;  2FCS A;  4FAD A;  4B0E A;  1EF1 A;  1JW9 D;  1E7P B;  1V2Y A;  1QOF A;  3K9P B;  3VTU A;  4XYC A;  2L32 A;  3SFE B;  4IWQ A;  4XDC A;  4US9 A;  1GB1 A;  1WI0 A;  5TR5 A;  1G6J A;  1HA5 A;  1NBF C;  1RAX A;  1GAQ B;  3B2G A;  1CMX B;  1PGB A;  3C0R B;  4FN2 A;  4A20 A;  4NAW A;  2XBB C;  3I3T B;  1D4B A;  3AI5 A;  1L5P A;  4JWS C;  4JPS A;  1C76 A;  2QCZ A;  2JX5 A;  4I6L B;  1GB4 A;  2BQQ A;  4ZHP A;  3ZXV A;  1BML C;  1UUP A;  2I2Y A;  4G3X B;  1E5W A;  5CTR C;  1HE8 A;  1FRD A;  3TEY A;  3DQV A;  2PW9 A;  3HHM A;  2KYW A;  2CKH B;  4IC7 B;  2AEH A;  3HVD A;  2ZPY A;  4ZYS A;  1F52 A;  2C60 A;  3R7Q A;  5IA7 A;  2MRP A;  3DPD A;  2Z59 B;  4YXD B;  5LXI B;  1XCT L;  2UYZ B;  1WX8 A;  2ZVN A;  4WWP A;  4JL9 A;  1WWT A;  1ET9 A;  4RMA A;  3AE9 B;  5I4D A;  2WXK A;  1C79 A;  2ZW0 A;  4C56 C;  2N9K A;  3W1S C;  3IFW B;  3ZLZ A;  2VZK D;  3AED B;  5FK9 C;  4C7Z A;  4B0M A;  4WJO A;  1XQQ A;  2KXJ A;  2G1E A;  1V81 A;  3PRP B;  4XGA B;  1JRP A;  4HKZ E;  2RMM A;  4LLG M;  3ZNG C;  4RGM A;  2PJH A;  1WMH B;  2C9W B;  3AV8 A;  1J7C A;  3IT4 B;  5E6N A;  1HZ5 A;  2KWC A;  3MHS D;  4K7S A;  3PZD A;  3GS2 A;  3ZNH B;  4JGH B;  1P9D U;  3BYT B;  5G5H A;  1J7B A;  2KLC A;  3ZUN A;  1L2N A;  4HRS A;  2LGX A;  5IO9 A;  2BW2 A;  4MGK E;  2YLM A;  2AYO B;  2V1Y A;  2B76 B;  4HPM B;  2K22 A;  2HTH A;  1V49 A;  1WM3 A;  3NVV A;  2MWS B;  2J4X A;  2WHI A;  4GIV A;  2FIF A;  1T0Q C;  2UWQ A;  2WDR B;  3JYU A;  1E8X A;  1WJU A;  2FUG 1;  4GDK B;  3MTN B;  3DVN V;  4I6P A;  4AUQ C;  4RNA A;  3AEF B;  3L13 A;  2N9X A;  1TTN A;  2M8S A;  5DPS A;  2WXM A;  3BWU D;  1Q10 A;  3MC9 A;  3B2F A;  3I5J C;  4MEM A;  2I38 A;  2WLB A;  4YSX B;  1LFD A;  2GB1 A;  1KRH A;  2BYT A;  2X38 A;  2V0G A;  2D3C A;  2IGD A;  4ANW A;  3DWM A;  4EZK A;  4KDL B;  4GLS C;  2XK5 B;  1FEH A;  3MC0 B;  4GB9 A;  3W1Y A;  1MG4 A;  1K50 A;  3KYD D;  4YL8 A;  1GG3 A;  2KWU B;  3ALB A;  5EE9 A;  1V8C A;  4II2 B;  4FJZ A;  3GE3 C;  3PRM B;  3ZJT A;  1YQ4 B;  2SAK A;  2KX0 A;  1YN5 A;  3CMM B;  1F2R I;  5J18 A;  4MAC A;  4C4V A;  2DWQ A;  3BVG A;  3ECI A;  4BVU C;  4W9H A;  5FKA C;  4A3P A;  2LHD A;  3N3K B;  1JAL A;  1DOI A;  1C4P A;  2V3P A;  1WXA A;  1NYR A;  4IUM B;  5G2N A;  3NVZ A;  2KDF B;  4M8N A;  1UBQ A;  1TJE A;  2MCN B;  2J0M A;  2MBO A;  2GI9 A;  1ISN A;  4N58 A;  2O2V B;  2IO3 B;  4MM3 B;  2LUE A;  1FXI A;  3UQB A;  4AJY B;  2NBW B;  2YVC A;  2PMV A;  3KUD B;  5J2R A;  2MBH A;  1YJJ A;  4K3C A;  4RGO S;  2OOB B;  4Q2J A;  4S17 A;  1YQB A;  3DVN U;  5D2M B;  2YEP F;  1SE2 A;  1Y56 A;  2MBE A;  5AUI A;  2CHX A;  2R2Q A;  1HXY D;  4TV3 A;  3ZJV A;  2FNJ B;  2BKR B;  5JH5 C;  1C9F A;  3QX1 A;  2W82 A;  3OAW A;  3VUW A;  4KSK C;  2JZP A;  3A9J B;  2GOW A;  3B9J A;  2BF8 B;  3V6E B;  2M17 A;  2AWT A;  3EEC A;  1E9M A;  1E90 A;  1IGC A;  1QQR A;  4J3O D;  4D2K A;  2N7J A;  1TYG B;  4KGS A;  3RFZ B;  1ZDX A;  1V5T A;  3S2A A;  3R3M A;  1PDX A;  2WDT B;  4F8C B;  4M02 A;  2HTM E;  1QF6 A;  5CHW A;  2KX3 A;  1XO3 A;  5IKC M;  2MBB B;  2M0A A;  2LGS A;  3RNC C;  4N59 A;  4AOF A;  2BYE A;  1QOA A;  2K6D B;  4LNN A;  4W9I A;  1R4M B;  1XEE A;  3PZ8 A;  3AEA B;  5CHV C;  1WXM A;  1K53 A;  2KN4 A;  1UH6 A;  2WX0 A;  2JQR B;  4P1C C;  1J0G A;  2RDB C;  3K9O B;  4WUR A;  1YJ1 A;  4P16 A;  1K51 A;  3DBR B;  1KF6 B;  3SFD B;  4R3D A;  4WQM A;  1KLU D;  2KFJ A;  2Y5C A;  1J8C A;  2JZZ A;  1E7V A;  4A90 A;  5C1Z A;  1V1P B;  3LYY A;  3NJT A;  2WU5 B;  3NG0 A;  2MA9 B;  3TBL D;  2ZVO A;  3P4Q B;  4MGI E;  3V62 A;  3DBL I;  1C4A A;  1XXG A;  3E9S A;  3ZKJ C;  4BFR A;  5D94 A;  2BT6 A;  3P4S B;  4C00 A;  4GDL B;  3PV1 A;  2LVQ A;  3MP9 A;  3ZDM C;  4UDU C;  3H8H A;  3Q8B A;  3HM3 A;  3FIL B;  1WXQ A;  4P6V F;  2KVR A;  1TKE A;  2DYB A;  1UEL A;  3QC8 B;  3GZN B;  4AWJ A;  3A4R A;  2RD0 A;  1VCB A;  2RDG A;  2W3S A;  3AE7 B;  3Q3M C;  3EHV A;  2WQY B;  2WXO A;  3HUI A;  4FA6 A;  4LJO B;  4W9C A;  3EA6 A;  1RFA A;  3RT3 B;  5JHA A;  2RGF A;  1B9R A;  5KHQ A;  1WGD A;  1KOT A;  2KD0 A;  2Y3A A;  3VH3 B;  3VRA B;  2KT7 A;  2MP2 A;  4L23 A;  2W55 A;  2OED A;  2M0X A;  1YMH E;  3QQ8 B;  3ZQ4 A;  1VZ6 A;  3WAO A;  1I4P A;  4OHJ A;  1YX6 B;  4GGQ A;  4WWO A;  3TL5 A;  1TGZ B;  4RM9 A;  2MJ3 A;  3RNG C;  4KIK A;  4DDI D;  2Y5B B;  2N9E B;  4RCO A;  3L10 B;  1VR9 A;  3APD A;  1SSN A;  2FE8 A;  2ON8 A;  4ARC A;  1TY0 A;  3SR6 A;  2WXP A;  2RPV A;  2Z8L A;  3AE8 B;  5C2T B;  3N20 C;  4IW0 A;  3APC A;  2LRU A;  5EE3 A;  1YN4 A;  2KNB A;  2LXC A;  2JRH A;  3ZNZ B;  2C7H A;  2KZR A;  2VZK B;  3T9L A;  3A9K B;  4EKU A;  3N1Z C;  2JY6 A;  1MI0 A;  3E56 A;  5JXV A;  1WSP A;  3FKY A;  1ENF A;  3P2B A; 
#chains in the Genus database with same CATH homology
 3RUL A;  2C60 A;  3R7Q A;  1Q0W B;  5IA7 A;  2BKF A;  2L0T A;  2MRP A;  3SD5 A;  3DPD A;  2Z59 B;  4XX5 A;  1UBI A;  3OJ3 A;  3AU5 A;  4DDG D;  5LXI B;  4FJY A;  2QHO A;  1OTR B;  1P98 A;  1WX8 A;  2UYZ B;  2ZVN A;  2CU1 A;  3PHX B;  3H7P A;  4IM0 A;  4WWP A;  4JL9 A;  1GC7 A;  2REX A;  4PS8 A;  1K8R B;  2LGD A;  4RMA A;  4TQ1 A;  2PE6 B;  3H1U A;  2DHZ A;  4BKS A;  2KTR B;  2NPT B;  1UGM A;  3L08 A;  1V86 A;  2NCN A;  3JSV B;  4XC2 A;  3W1S C;  3IFW B;  3ZLZ A;  4LCD E;  3SU8 X;  1I42 A;  1E8Y A;  2K8B A;  2KKC A;  2GBR A;  3UIP B;  2I1J A;  3H7S A;  1UD7 A;  2V3S A;  1S1Q B;  1WJ6 A;  1XQQ A;  2KXJ A;  4JLC A;  4WJO A;  1V81 A;  3PRP B;  4W9J A;  3VTW A;  1WF9 A;  1WX7 A;  5J17 A;  4HCP B;  2VRR B;  3DVG Y;  3B08 A;  1H4R A;  1KJT A;  1OGW A;  2ZCC A;  4ZDV A;  1NI2 A;  4MDK E;  3ZNG C;  3PSE B;  4DK5 A;  4WAA A;  2PJH A;  2MP2 B;  3RZW C;  3RZF A;  1WMH B;  2C9W B;  2DEN B;  3KVF B;  4ICU A;  2WYQ A;  4BOS C;  4A3O A;  5E6P A;  1Q5W B;  1WJ4 A;  1H8C A;  5E6N A;  2N4F A;  3PLU A;  2EMS A;  2KWC A;  3MHS D;  3QAQ A;  4K7S A;  4FUL A;  4EUT A;  1RRB A;  2WX1 A;  3M95 A;  2AL3 A;  3PZD A;  4E74 A;  3GZN I;  3QCA A;  3ZNH B;  2J7Q B;  4JGH B;  2Z0E B;  2K8C A;  3B1L X;  1P9D U;  2IO0 B;  4BBN C;  3WAL A;  1M94 A;  3NZU A;  3QHT A;  4WQO B;  4FBJ B;  2KN5 A;  3V60 A;  4II3 B;  1L7Y A;  4ICV A;  2KFK A;  2KLC A;  5GMV A;  4HPL B;  3RD2 A;  3ZUN A;  1L2N A;  1YX5 B;  2LGX A;  2O2V A;  3PGE A;  4G11 A;  1YD8 U;  3U7D A;  2ZCB A;  2RPQ A;  3DCG A;  3UIO B;  4N9F 4;  4LJP B;  2DX5 B;  2KK8 A;  4MGK E;  2IY0 B;  2YLM A;  4GU2 A;  1LXD A;  3PS6 A;  2AYO B;  2KMC A;  2V1Y A;  3DVG X;  4HPM B;  2LWP A;  2HTH A;  5CX3 A;  1V49 A;  3L0W B;  1Z5S B;  5AZG A;  1GC6 A;  1WM3 A;  4JQW C;  4XZ4 A;  1GUA B;  4KDI C;  2MWS B;  1EUV B;  4G50 A;  1R4N I;  3HM6 X;  4IM2 A;  3N32 A;  3WIM A;  2MX2 A;  3ZTD A;  1LM8 B;  2FIF A;  3PT2 B;  2CHZ A;  2UWQ A;  4GIV A;  1GNU A;  3JYU A;  1E8X A;  1WJU A;  4I6N B;  4CO7 A;  2NR2 A;  3A1Q A;  4GDK B;  3MTN B;  3DVN V;  4I6P A;  4BKT A;  4K81 A;  5DCN A;  4AUQ C;  5AEK B;  1P0R A;  2DZK A;  4ZRJ A;  2K1F A;  2PE9 A;  2K8H A;  4BOZ B;  3L13 A;  3VHT C;  2N9X A;  1TTN A;  2IYD B;  2FCM A;  5HKH A;  3IBE A;  2M8S A;  3A9J A;  5DPS A;  4GMV A;  2A5U A;  1SE9 A;  4KV2 A;  4MEM A;  4DWF A;  4IWP A;  4AP4 C;  1P1A A;  2JF5 A;  3NS8 A;  1LFD A;  3LDZ E;  2G4S A;  2B3A A;  1QZE A;  2ZJD A;  3AU4 A;  2N1W A;  2N7E A;  4B9K A;  2EMT A;  5CHF A;  2KDB A;  3L16 A;  3IG3 A;  2K39 A;  4ANW A;  4EZK A;  4GN1 A;  2MBQ A;  4KDL B;  3RCZ A;  2XK5 B;  2LAS A;  4GB9 A;  3AUL A;  1U4A A;  2PEA A;  2MLB A;  3W1Y A;  3GOE A;  3ONS A;  3APF A;  3X0W A;  4G0N B;  3EC8 A;  3KYD D;  3DOW A;  1RLF A;  1GG3 A;  2KWU B;  4YL8 A;  1WGG A;  2G4D B;  2O6V B;  3ALB A;  4II2 B;  2JWZ A;  2R2O A;  4FJZ A;  4ZYN A;  2JUO A;  4ZRI A;  3PRM B;  3VTV A;  4ZRK A;  3M63 B;  2LD9 A;  2KX0 A;  2JT4 B;  1WH3 A;  2IZV B;  3CMM B;  2NBV B;  2RR9 A;  4FLH A;  4HJK A;  2KO3 A;  5J18 A;  3ZRF A;  1V80 A;  4NNJ B;  3VUX A;  2D11 A;  4BKS D;  3ECI A;  3X23 A;  4BVU C;  1MG8 A;  2ASQ A;  4W9H A;  4A3P A;  1V5O A;  1Y8R C;  3KUC B;  3N3K B;  2IO2 B;  1KLV A;  2JVC A;  1WXA A;  4IUM B;  4BBN F;  3NOB A;  3O65 B;  5G2N A;  5LLI A;  1T0Y A;  2L8J A;  4J6I A;  3ZNZ B;  1AAR A;  2KDF B;  4M8N A;  1UBQ A;  1C3T A;  2MCN B;  2J0M A;  2MBO A;  3Q3F A;  3UQA A;  1TZ1 A;  2KFK B;  2O6V D;  1ISN A;  2O2V B;  2IO3 B;  2M4N A;  4HDO A;  3TJP A;  1UZX B;  4IM3 A;  5L95 C;  3SDL C;  2NBU A;  3H9D A;  3DDC B;  3QWZ B;  1C1Y B;  2IY1 B;  2LUE A;  3AXC A;  3VVW B;  5DPR A;  4E71 A;  2KLG A;  4AJY B;  2MSE D;  4EZJ A;  3UQB A;  4F1S A;  3PVL A;  1WGH A;  3TIX A;  2NBW B;  3R7R A;  2GMI C;  2YVC A;  4NY0 A;  3KUD B;  2Z0D B;  5G55 A;  2MBH A;  3A9K A;  1XT9 B;  3DBS A;  5J2R A;  2LGY A;  2JZ3 B;  4CHK A;  2BGF A;  2KC1 A;  2OOB B;  3CST A;  4X57 B;  1WIA A;  5KHO A;  3VQI A;  1YQB A;  4DHJ B;  1P3Q U;  3DVN U;  3IVF A;  5D2M B;  2RSU A;  2MBE A;  2NS5 A;  4KIK B;  5JHB A;  2LJ5 A;  2N7D A;  3NY5 A;  4M0W B;  4RM8 A;  2L05 A;  2CHX A;  2FUH B;  2R2Q A;  1OQY A;  2ZZP B;  4NAW B;  5C23 A;  1X1M A;  4TV3 A;  1WX9 A;  4HWI B;  4WWN A;  4FHK A;  1WE6 A;  2FNJ B;  2BKR B;  5JH5 C;  2DZJ A;  3QX1 A;  3ZNI D;  3VXW A;  1J19 A;  3OAW A;  3VUW A;  4KSK C;  1ZW7 A;  3A9J B;  2GOW A;  1WR1 A;  2HJ8 A;  3CF6 E;  2BF8 B;  2HD5 B;  5D6J B;  3ZVV A;  2AL6 A;  1V6E A;  3V6E B;  4W9E A;  2M17 A;  2AWT A;  3EEC A;  4GDL A;  3UGB B;  3PRZ A;  1E90 A;  1WFY A;  1IPG A;  3H6N A;  4NJ6 A;  2FAZ A;  1Z2M A;  1OEY J;  2EKE C;  4DHJ D;  5JZE B;  1V5T A;  3ZW3 A;  3ENE A;  3UF8 A;  3IHP C;  3S2A A;  3R3M A;  3RUI B;  4B95 A;  3JVZ X;  1OEY A;  1ZGU B;  2L3Z A;  2WDT B;  4K1R B;  4F8C B;  3D32 A;  1Q1O A;  3TCA A;  2MW5 A;  1WMH A;  1WRD B;  4PS7 A;  3VDZ A;  3QAR A;  5CHW A;  1I35 A;  2K6Q A;  2KX3 A;  3VFK A;  2CR5 A;  4EFO A;  3QA8 A;  2JXX A;  2MBB B;  3RYT A;  3ZIM A;  4EEW A;  4NJ7 A;  2WWZ A;  4M8M A;  4EZL A;  3L17 A;  1E7U A;  2DAF A;  4DBG A;  3H7P B;  4AOF A;  1FXT B;  2BYE A;  2K6D B;  4W9I A;  2IO1 B;  2N1V A;  3JW0 X;  4E3C A;  3KYC D;  1WXV A;  4HDQ A;  1SGH A;  2D2Q A;  4WJP A;  5CHV C;  2ZPN A;  1WM2 A;  1WXM A;  2LRW A;  2LVO A;  4K7U A;  5IAA C;  5AZH A;  1WY8 A;  4HLE A;  3N30 A;  3VUY A;  1S3S G;  3QK0 A;  2HE7 A;  5BO4 B;  1UH6 A;  2WX0 A;  2DZM A;  2LZ6 A;  5D7G A;  2OJR A;  5FR6 A;  2GBM A;  1J0G A;  5EDS A;  2IBI B;  2JPH A;  3K9O B;  5LXH A;  1WZ0 A;  1YJ1 A;  2GBN A;  5L83 A;  1BT0 A;  1EF5 A;  2DZI A;  2L76 A;  4MSM B;  3A33 B;  4K7W A;  2KJR A;  3CSF A;  5AZF A;  3HK0 A;  2BYF A;  4DXA B;  4HVB A;  4PS3 A;  1WZ3 A;  2LI5 A;  2L00 B;  4MH0 E;  3ZRC A;  4PYZ A;  1SIF A;  2KFJ A;  4GOC A;  3W1S A;  2KJ6 A;  4GDK A;  1J8C A;  2JZZ A;  1E7V A;  1PQS A;  3KUZ A;  5C1Z A;  2KAN A;  2MA9 B;  2KHW B;  3TBL D;  1IYF A;  2ZVO A;  4FHJ A;  2C7N B;  3L54 A;  4F7Z A;  4W9K A;  4BKG A;  2K25 A;  4KVG B;  3ZTC A;  2KOX A;  4MGI E;  2M1M A;  3DBL I;  3HIZ A;  2KDE B;  3M62 B;  4OVU A;  3V62 A;  3ZKJ C;  5E6O A;  1WGY A;  4BFR A;  1NDD A;  3U30 A;  5D94 A;  2KQ7 A;  4JIO U;  4W9L A;  1WR6 E;  3NHE B;  1KM7 A;  2KTF A;  4W9D A;  4GDL B;  2KWV B;  3PV1 A;  2XK5 A;  2ZNV C;  4URK A;  3MJW A;  2L7R A;  2LVQ A;  4ANX A;  3ZDM C;  3QJZ A;  4ANV A;  3U8Z A;  3SHQ A;  2KDI A;  3BIN A;  2G45 B;  1YIW A;  2DYO A;  3HM3 A;  1JRU A;  3ML9 A;  4MJS A;  2NVU I;  4DHZ E;  3WAP A;  2BYV E;  2KVR A;  2LVP A;  2O6V A;  4W9F A;  1F9J A;  3UIN B;  3OJ4 B;  4MGZ E;  3BY4 B;  2DYB A;  3A1Q B;  4P7I A;  3ZO5 B;  1UEL A;  4TQ0 A;  3QC8 B;  3PPA A;  1LQB A;  4AWJ A;  2KMA A;  2PPH A;  2LXA A;  4NQL B;  3A4R A;  2I1K A;  4IWO A;  2D3G A;  4KZ0 A;  1IP9 A;  3T8M A;  2J0J A;  2RD0 A;  4WJQ A;  3LJ3 A;  2A4Z A;  4ASW C;  1VCB A;  3R66 C;  3NZS A;  1EO6 A;  2BWF A;  2KJH B;  3M3J A;  3PHW B;  2CHW A;  1WYW B;  2KTR A;  2NPT A;  3EFU A;  2GBK A;  3B0A A;  3EHV A;  3V6C B;  1WE7 A;  3JSV A;  2BPS A;  2KQS A;  2BWE S;  4FA6 A;  1ZKH A;  2C7M B;  4LJO B;  4OVV A;  1GJZ A;  4KSL C;  4W9C A;  3V61 A;  1E8Z A;  1XD3 B;  3ZDT A;  1RFA A;  3RT3 B;  5JHA A;  2FID A;  3PLV A;  4TKN A;  2MQJ A;  3PTF C;  4IG7 B;  2RGF A;  2V4L A;  4CYE A;  2FCS A;  4TUU A;  4FAD A;  5KHQ A;  1WGD A;  1EF1 A;  3DBH I;  1V2Y A;  4ANU A;  3K9P B;  3VTU A;  2KD0 A;  4MM3 A;  3WA0 A;  3VH3 B;  1KOT A;  2MP2 A;  1V9J A;  3QIJ A;  4IWQ A;  4DHZ B;  3PRE A;  4MGY E;  2XEW A;  1WI0 A;  1WGR A;  2M0X A;  4MSQ B;  1A5R A;  5TR5 A;  3QQ8 B;  1G6J A;  2D10 A;  1NBF C;  2L0F A;  1RAX A;  3WAM A;  3WAO A;  1YX6 B;  1CMX B;  4GGQ A;  4WWO A;  3TL5 A;  1TGZ B;  2G3Q B;  4LDT B;  4RM9 A;  3C0R B;  4KIK A;  4FN2 A;  5DPT A;  4HXD A;  1WJN A;  2ZNV B;  4A20 A;  4NAW A;  2XBB C;  3VH4 B;  4AJW A;  2J0K A;  3I3T B;  2GBJ A;  4DDI D;  3AI5 A;  3OLM D;  2ZEQ A;  1D3Z A;  2KC2 A;  2Y5B B;  2FCQ A;  2FCN A;  2N9E B;  1TBE A;  3L10 B;  4EOY A;  4NPN A;  3APD A;  4PYU A;  2W9N A;  3VAW A;  3KH0 A;  4NQK E;  4GXB A;  4I6L B;  2JRI B;  1R4M I;  1E8W A;  1WXS A;  3TMP B;  4GSW A;  3Q3J A;  2N9P C;  2DAJ A;  1VD2 A;  4HCN B;  3KW5 B;  4FJV B;  4IW0 A;  2DYM A;  5DPW A;  2D07 B;  4G3X B;  3APC A;  1E5W A;  4LDT D;  5CTR C;  4KZC A;  1HE8 A;  2LRU A;  4B6W A;  2CS4 A;  2KNB A;  3DQV A;  3HHM A;  2LXC A;  2JRH A;  3ML8 A;  2C5L C;  2KZR A;  2C7H A;  2CKH B;  4HK2 A;  3A9K B;  3T9L A;  4MEL A;  4W9G A;  4EKU A;  2JY6 A;  4IC7 B;  2AEH A;  3A4S C;  3DBR I;  4WJN A;  4MJS B;  2ZPY A;  3WAN A;  3P2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...