1LM8B

Structure of a hif-1a-pvhl-elonginb-elonginc complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords ELONGIN B
publication title Structure of an HIF-1alpha -pVHL complex: hydroxyproline recognition in signaling.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2002-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1lm8B00
2D07B 1YQBA 3ZKJC 3DVNV 3L54A 1WX8A 3L17A 3OJ3A 4TQ0A 5J17A 3DVGX 2LGYA 3LDZE 2KLCA 2D10A 3A9JA 4MDKE 4DHJB 3CSFA 3DOWA 3DBRI 2IYDB 1KM7A 3A33B 1WJ6A 3HK0A 3DDCB 1WXAA 2LGDA 3NZUA 2KJRA 4K7WA 1C3TA 4FN2A 4ICVA 1IYFA 3CF6E 2Y5BB 3R66C 5E6PA 1WR1A 1WJUA 3PPAA 3H9DA 2K25A 2WX1A 3NY5A 3PRZA 4P7IA 2YLMA 3Q3FA 3QJZA 3CSTA 3SHQA 3HIZA 3L08A 3N32A 4FULA 2K6DB 4GN1A 4CO7A 2VRRB 3JSVB 3RULA 1WX7A 3ZNZB 1G6JA 4AJYB 2FIFA 2GBKA 3APDA 3UINB 2LVPA 1SGHA 3DBHI 2KJ6A 1V5OA 4IM2A 2ASQA 2KFKB 3WANA 2LVOA 3DPDA 4EZKA 2DAJA 2G4SA 4K7UA 1F9JA 2KTFA 1RLFA 3M3JA 4MGKE 4BOSC 1VD2A 3IG3A 1Q5WB 5G2NA 2FCQA 4GDLB 1YJ1A 4W9GA 4LCDE 4ZYNA 4BKSD 1WGYA 2KMCA 4NQLB 3CMMB 3ECIA 4W9EA 1A5RA 4TQ1A 1IPGA 3EECA 4HWIB 2CS4A 1WJ4A 3MHSD 1P1AA 2J0KA 3ZDTA 3A1QB 3DQVA 3IHPC 4W9FA 1Y8RC 1WE6A 3QQ8B 2JF5A 1UBIA 3SD5A 1YX5B 2MBBB 2PE6B 1JRUA 5CHVC 4RMAA 3QCAA 2LXAA 3U7DA 2MW5A 4EOYA 3ZO5B 1GNUA 2C9WB 2N7DA 4F1SA 4KZCA 2JZZA 2KANA 2M8SA 3S2AA 3WAPA 2K8HA 4RM8A 5JH5C 2KQ7A 2NR2A 3QC8B 5D94A 2MP2B 4HPMB 1WYWB 2XBBC 4JQWC 2KD0A 4N9F4 3PRPB 2NCNA 4WWNA 4ZDVA 5DPRA 1ZKHA 4W9KA 3AULA 3V6EB 3DVNU 2LRUA 4II2B 4W9DA 1TTNA 1QZEA 2MX2A 3IFWB 3VVWB 4FBJB 4MGZE 4EEWA 4MJSB 3VHTC 2O6VA 2LRWA 5TR5A 5JHBA 1NDDA 3AI5A 2KC2A 2KHWB 3A1QA 4HXDA 4II3B 1WXMA 4M8NA 3N3KB 3KYDD 2KX0A 3EC8A 4WJQA 2JXXA 4I6LB 1HE8A 4GB9A 5CX3A 3SDLC 3ZW3A 3DBSA 2R2OA 4NPNA 2MBHA 3VUXA 3DCGA 3R7QA 3W1SA 1FXTB 3T9LA 1E90A 3JW0X 4WJNA 1KOTA 1WZ0A 4DXAB 4AP4C 4WWOA 2RGFA 4DK5A 2WWZA 2L3ZA 3Q3JA 2GBNA 2BKFA 2O6VD 2GMIC 1E7UA 1ZGUB 2FCMA 3PHXB 3A4RA 1ZW7A 2MRPA 1UELA 3L0WB 2V1YA 3APFA 2MP2A 3VDZA 4A3PA 4BBNC 2NS5A 2RD0A 4HPLB 3WAMA 3QHTA 5E6NA 1WGDA 2CHWA 2NVUI 4WAAA 3HHMA 1WIAA 3PLUA 2N1WA 1WJNA 4B6WA 3NHEB 1S1QB 4EKUA 2HJ8A 3KUZA 1EUVB 3M63B 2ZCBA 3PLVA 3O65B 4MJSA 4KDLB 2N9EB 3GOEA 4WWPA 2D3GA 2FUHB 4W9IA 2JRHA 4E71A 3QX1A 2EMSA 1E8WA 1P98A 4GIVA 4EUTA 3ENEA 4KSLC 1VCBA 2FCSA 4TKNA 1WGHA 1GC6A 2OJRA 2KX3A 4KSKC 2G45B 3KW5B 2LWPA 4IWQA 2MBEA 4IWPA 4NAWB 4ANXA 2R2QA 3LJ3A 2I1KA 3I3TB 1GUAB 1AARA 3ZUNA 2ZNVC 5GMVA 2ZPYA 4MEMA 2LGXA 2C60A 1TZ1A 2AL6A 2IO2B 2WDTB 4ZRJA 3EHVA 1BT0A 5D2MB 3ZVVA 5L83A 1RFAA 2CKHB 4WQOB 1WM2A 1WZ3A 5DPWA 2MSED 4MELA 2PEAA 3PVLA 1V80A 2JUOA 3UIPB 2CR5A 3UQAA 4DHZB 1D3ZA 1CMXB 2DZMA 1H4RA 3ZNGC 4E74A 2KKCA 2KDEB 4K1RB 3VAWA 2AEHA 2BYEA 2ZEQA 2MCNB 1WY8A 2J0MA 2FIDA 2L00B 1YX6B 3PT2B 3ZNHB 3HM6X 2UWQA 2DHZA 3QARA 2NPTB 1EF1A 3JYUA 1RAXA 4NNJB 3OAWA 3UGBB 2KDIA 4PYZA 1ISNA 4KIKB 2AYOB 4FJVB 2KXJA 2K8BA 3PTFC 3MTNB 5LXIB 1E7VA 4GOCA 2MBQA 4GDKB 5J18A 3ALBA 5LLIA 4IM0A 4NAWA 2MA9B 2XEWA 1WGRA 1E8YA 2O2VB 2C7NB 4RM9A 1SE9A 3VTUA 4LDTD 2L7RA 2MLBA 3RCZA 1WR6E 2BWES 3UIOB 2GBMA 3QK0A 3JSVA 3SU8X 3H7PB 1WX9A 2MBOA 2ZVOA 4A3OA 1XD3B 4IWOA 2IY1B 1V9JA 2JT4B 3BINA 3H6NA 4HVBA 4DHJD 3KYCD 2KFKA 4TUUA 2JY6A 2KN5A 2DZJA 4G0NB 3K9OB 3WIMA 2M17A 2BWFA 3BY4B 1SIFA 3RUIB 4AOFA 4FA6A 2KNBA 4IG7B 3H1UA 1L2NA 2JPHA 4X57B 2L05A 2PPHA 5L95C 2K1FA 1OEYJ 3KUDB 3PRMB 4GDLA 2G3QB 2NPTA 4HDOA 1L7YA 2KMAA 3HM3A 1UBQA 2L8JA 2LD9A 2LASA 3RYTA 4KVGB 1WXSA 3KUCB 2JZ3B 4NQKE 3PV1A 2A4ZA 3VQIA 2M0XA 4GDKA 3T8MA 5J2RA 3PSEB 2N4FA 4FLHA 3ZNID 2CHZA 2O2VA 1V2YA 3UF8A 2V3SA 4XZ4A 3AU4A 1UH6A 2L76A 1UD7A 2KOXA 1P9DU 3A9KB 1RRBA 4DDID 1WRDB 2KC1A 3H7PA 3QIJA 4I6NB 4PS8A 4ZRIA 1Z5SB 4OVUA 3EFUA 1OTRB 5E6OA 4HK2A 3PGEA 2GBJA 1GG3A 4IC7B 3V61A 3DVGY 2RR9A 2IO0B 2PJHA 4HLEA 4GSWA 1EF5A 1T0YA 4HDQA 3R3MA 2L0TA 2MQJA 4MH0E 5FR6A 3W1SC 3WAOA 2BYVE 2WYQA 4IW0A 4GU2A 2J7QB 4JLCA 1YIWA 5AZHA 3AU5A 3L10B 1I35A 3QAQA 2Z0EB 3KVFB 1J8CA 4W9LA 2N7EA 5CHWA 1TBEA 2A5UA 2OOBB 1Q0WB 2DAFA 2IY0B 2KQSA 4BFRA 4MSQB 5HKHA 1Z2MA 3RZWC 2G4DB 2IO1B 4PS3A 4M8MA 2ZJDA 3UQBA 4F8CB 3VUYA 4W9JA 2JVCA 3OLMD 2C7MB 4LJPB 3TIXA 4B9KA 4PS7A 4NJ7A 4XX5A 3L13A 3RZFA 2L0FA 1R4MI 2DZKA 2CU1A 4M0WB 4TV3A 4FHJA 2XK5B 2V4LA 2RSUA 3A9KA 1V49A 2NBVB 2LJ5A 2GOWA 2JWZA 5D7GA 5DPSA 2REXA 4CHKA 3AXCA 2DYBA 1NI2A 1E8ZA 4ZRKA 3V62A 4ANWA 1LQBA 2N9XA 1LFDA 3B08A 4W9CA 5BO4B 3TMPB 4ICUA 1WE7A 3M95A 4GMVA 4J6IA 1UGMA 2J0JA 4AUQC 1WI0A 2DX5B 4JL9A 4K81A 2C5LC 4PYUA 3ONSA 4MM3A 2NBWB 4MGIE 1WMHB 3PREA 2N1VA 3MJWA 2AWTA 3NOBA 4WJPA 1I42A 5D6JB 2ZCCA 3V6CB 4GXBA 4BKSA 4HCNB 4G3XB 4WJOA 3X23A 2LZ6A 4FJYA 4A20A 4FADA 4I6PA 4EZLA 5LXHA 1H8CA 4FJZA 3P2BA 1GJZA 5DCNA 3ML9A 1K8RB 1NBFC 5DPTA 2FAZA 2M1MA 3ZDMC 4HJKA 3B1LX 2ZPNA 4NY0A 2QHOA 4GGQA 1V86A 2FCNA 3N30A 4BKGA 1WF9A 3X0WA 3JVZX 3ZRCA 2AL3A 4FHKA 4G50A 3VH4B 2KZRA 2KDFB 3D32A 2KWUB 4AJWA 4MSMB 3NZSA 2XK5A 2BGFA 4JGHB 4YL8A 4F7ZA 2KVRA 5IAAC 3B0AA 3IVFA 2M4NA 2KTRB 2EKEC 2HD5B 2IBIB 2O6VB 5JHAA 3VXWA 3ZTDA 3WALA 3OJ4B 3PZDA 4BVUC 1S3SG 2PE9A 5AEKB 5C1ZA 1J19A 1Q1OA 3C0RB 5KHQA 1UZXB 3IBEA 4DBGA 1LM8B 5CHFA 2HTHA 3A4SC 2JRIB 4LJOB 4NJ6A 4EFOA 1TGZB 1WMHA 3H7SA 5C23A 3VUWA 2HE7A 5CTRC 3VTVA 1IP9A 1GC7A 2YVCA 3KH0A 1E5WA 3QA8A 5EDSA 2KJHB 3VH3B 3DBLI 2K39A 2KK8A 2Z59B 1LXDA 2LUEA 1XT9B 3W1YA 4KIKA 2IZVB 1P0RA 3TBLD 2MWSB 4CYEA 4DWFA 3VFKA 4HCPB 3PS6A 3M62B 1E8XA 4BOZB 1XQQA 4IM3A 1V6EA 1PQSA 2DYOA 3ZRFA 2KO3A 1WM3A 5KHOA 4G11A 4W9HA 4AWJA 3GZNI 2DENB 1MG8A 2ZNVB 3QWZB 4K7SA 4ANVA 4BBNF 1X1MA 3V60A 4E3CA 2DZIA 2ZVNA 4BKTA 3VTWA 1M94A 2BYFA 2K8CA 3APCA 3K9PB 3TJPA 3WA0A 3ZIMA 2RPQA 4ANUA 1KLVA 3A9JB 2GBRA 2KTRA 2W9NA 4EZJA 3RT3B 1WFYA 2LI5A 2UYZB 3U8ZA 4OVVA 2FNJB 2KFJA 2N9PC 1KJTA 1R4NI 3ZTCA 1OEYA 1YD8U 2KWCA 5G55A 2I1JA 2LXCA 3RD2A 3TL5A 1P3QU 2D11A 4KV2A 4DHZE 2KWVB 4XC2A 1V5TA 1WGGA 1C1YB 4IUMB 5AZFA 1OQYA 4MGYE 2KLGA 2KDBA 2BKRB 3ZLZA 1J0GA 1V81A 2IO3B 2D2QA 2C7HA 2K6QA 1WXVA 3R7RA 2BPSA 2LVQA 3ML8A 3TCAA 2CHXA 4B95A 2B3AA 3PHWB 4DDGD 5IA7A 2Z0DB 2BF8B 2ZZPB 1WH3A 1OGWA 2WX0A 5AZGA 4KZ0A 5JZEB 4KDIC 2DYMA 2EMTA 3U30A 2NBUA 1U4AA 3L16A 4ASWC 4JIOU 4URKA 4LDTB 3NS8A 1EO6A
chains in the Genus database with same CATH superfamily
4JWUC 1YQBA 3IT4B 1WX8A 3L17A 2KLCA 3A9JA 3CSFA 1QLBB 2MJDA 3A33B 1WJ6A 3HK0A 3DDCB 3NZUA 4K7WA 1FXIA 4FN2A 1B1ZA 3PPAA 2BW2A 3H9DA 2K25A 4P7IA 2YLMA 2ZW0A 5FKAC 4S17A 3SHQA 3CSTA 3L08A 2VRRB 3ZJVA 3ZNZB 1G6JA 2Q5WD 3P4PB 2GBKA 3UINB 1DGJA 2KFKB 2LUMA 3WANA 4EZKA 1TS3A 2G4SA 4K7UA 3AE5B 2BT6A 1N5XA 4GDLB 2DBYA 1ENFA 1XEEA 1IPGA 3HUIA 3KQ4A 4DQOC 3DQVA 4W9FA 2XN9C 1WE6A 3QQ8B 1UBIA 2PVGC 2MBBB 1R4MB 4KGSA 3ZO5B 1DOXA 4KZCA 3Q8BA 2Y5PA 5JH5C 5D94A 5LNK1 2MP2B 1WYWB 2KD0A 2D5GA 4W9KA 4II2B 2LRUA 1QZEA 4YSXB 4WWMA 2LRWA 5JHBA 1NDDA 1C4AA 3MHZA 1SB3C 1QOGA 1NEKB 2KWDA 2JXXA 3NVVA 2QIEB 2YEPF 3JW0X 3VR9B 1KOTA 3SFDB 4A8XC 2GBNA 2MHJA 3PHXB 1E7UA 4IKGA 1ZW7A 1UELA 3VDZA 3APFA 2EKIA 2MP2A 1ET9A 3WAMA 3QHTA 5E6NA 3KWLA 2I2YA 5IO9A 4B6WA 3NHEB 1EUVB 4LNOA 3PLVA 4KDLB 4W9IA 2JRHA 3QX1A 3DBLB 2EMSA 1E8WA 1P98A 1IGDA 1WXQA 3P4RB 1WGHA 2OJRA 4KSKC 2G45B 2LWPA 4IWQA 4IWPA 2R2QA 5GMVA 1JMLA 2ZPYA 4MEMA 2MH7A 1TZ1A 2IO2B 2WDTB 4ZRJA 3GZNB 1BT0A 4LLGM 2CKHB 4PT5A 1DOIA 3BIID 1IBXB 5DPWA 4MELA 4XYCA 2PEAA 4A55A 3AMZA 3PVLA 3T3NA 4P16A 1V80A 1N5WA 3AECB 3UQAA 1PGBA 2DZMA 4CQNA 2INCC 3ZNGC 4E74A 2KDEB 3VAWA 2AEHA 2BYEA 2ZEQA 1ZUD2 1YX6B 2UWQA 2DHZA 4N58A 1RAXA 1C79A 2WXNA 3UGBB 4PYZA 1ISNA 4KIKB 5LXIB 2WXPA 1SXTA 1N6ZA 4C7YA 3H8HA 1YJJA 2WDRB 3RCZA 2BWES 2GBMA 3QK0A 3SU8X 1IBXA 1EU4A 1M4VA 4OHJA 2IJ0A 3RNCC 1GPXA 1FEHA 3WIMA 2M17A 1TKEA 3NS1A 4KX6B 1SIFA 4KKJA 1L2NA 3VR8B 1VZ8A 2KACA 3PRMB 2RDGA 2JYEA 4HDOA 1L7YA 5EE9A 2KMAA 2LD9A 2LASA 4NQKE 2SAKA 3PV1A 2A4ZA 3VQIA 2M0XA 5D3DA 2CHZA 1HZ5A 2V3SA 4XZ4A 5G5HA 1IUEA 2INDC 3Q6BA 1RWSA 1C77A 4I6NB 2ONQA 2WXJA 1PFDA 3HVDA 3EFUA 4HK2A 3DVGY 4XWWA 2CU3A 2IO0B 3AE8B 3NG0A 1D5MC 1C76A 3UI3A 3W1SC 2VH1A 4RGMA 1YIWA 1ZDXA 3L10B 1J8CA 2PLPA 2IY0B 2KQSA 5EE3A 3RZWC 2IO1B 1PDXA 3TIXA 2W82A 4NJ7A 3RZFA 2CU1A 2KDMA 2REXA 4CHKA 1VR9A 1E8ZA 3B08A 1LFDA 4W9CA 2W3RA 3M95A 1F77A 2WXQA 3ONSA 2N1VA 3NOBA 3N20C 5T8IA 3X23A 4I6PA 2XNAC 3B1LX 4GGQA 1V86A 2G1EA 2FCNA 4BKGA 1KRHA 2AL3A 5GXGB 4G50A 2KWUB 2D3AA 3Q8FA 1JWBD 4YL8A 2KVRA 5IAAC 3IVFA 2KTRB 3VXWA 1HTOA 3ZTDA 3OJ4B 5AEKB 5C1ZA 1Q1OA 3C0RB 2BTEA 3IBEA 2HTHA 2PW9A 2HE7A 1JROA 2OEDA 1LXDA 2X8XX 2IZVB 4JWSC 4YSZB 4CYEA 1FNUA 4BOZB 1WM3A 1PGAA 3NVZA 4W9HA 2DENB 2WHIA 2WXMA 2J52A 1CZPA 1X1MA 4XDDA 2YEPB 1T6BX 4BKTA 2X38A 3TJPA 3APCA 4ANUA 3WA0A 1KLVA 3TEXA 3DHIC 2KTRA 3MC9A 2FNJB 1KJTA 3ZTCA 4NZLB 3SFEB 1RYJA 4LNNA 4D2KA 1V5TA 5E6JA 2CJNA 3RNEC 1OQYA 2KLGA 1J0GA 2BKRB 2D2QA 2K6QA 4B95A 2BPSA 4DDGD 5IA7A 1N61A 1JWUD 2ZZPB 1WH3A 4WURA 1OGWA 2WX0A 3AEDB 5AZGA 5I4DA 4KDIC 2DYMA 2EMTA 1AW7A 1U4AA 4ASWC 5BYRA 1SF0A 2D07B 3L54A 3AEEB 3DVGX 5FK9C 1D4BA 3LDZE 2KYWA 3DOWA 3DBRI 1NENB 2L32A 2WXHA 1WXAA 4WQMA 4ICVA 2FUG1 2JXTA 4C7ZA 1WJUA 2RMMA 4NJCA 1FRRA 3NY5A 3RN9C 3Q3FA 2JSVX 3QJZA 3HIZA 3N32A 4CO7A 3JSVB 3RULA 1WX7A 3PZ7A 1IGCA 1HXYD 1UWXA 3WCQA 1SGHA 3BK1A 4IM2A 2ASQA 1I4QA 3DPDA 1F9JA 2KTFA 3VRBB 3M3JA 2JYTA 2ACZB 5HHDG 3IG3A 3RNAC 1JWAD 4BKSD 2KMCA 4TQ1A 3EECA 1ZXHA 1P1AA 2J0KA 4USAA 1V1PA 3IHPC 3SD5A 2GI9A 2PE6B 1JRUA 1OQQA 4RGOS 3QCAA 3ZJUA 1GB1A 4M01A 3U7DA 4KGRA 1K52A 2N7DA 3IXSA 2JZZA 2KANA 2K8HA 3AE2B 3QC8B 2XBBC 2BB5A 4ZDVA 3AULA 3VVWB 4Q2JA 2J4XA 2NTTA 4RNAA 2KC2A 4EE2A 4HXDA 4NAMA 4C80A 5IP4D 2N0SB 1WXMA 3ZQ4A 3P1MA 4WJQA 2IDYA 4I6LB 1TT5B 3DBSA 4NPNA 3VUXA 2MBHA 3DCGA 4RGTA 3W1SA 2LGIA 1FXTB 3BVGA 3Q8CA 1SE4A 1WZ0A 3V05A 2LHDA 4DK5A 2BKFA 2O6VD 2GMIC 2FCMA 1F0ZA 1TS2A 4A3PA 5HG2A 4HPLB 3AE1B 3B2FA 4YWGG 1FIQA 1NI3A 2HJ8A 3M63B 1PGXA 3O65B 3GOEA 3W5UB 2D3GA 2LJIA 3ENEA 1QOBA 3I9V1 4TKNA 1GC6A 1T0QC 2KX3A 2MBEA 2RDHA 3HVZA 4ANXA 3LJ3A 1AARA 2ZNVC 2LGXA 4OZBA 2AQ1B 3EHVA 1ACCA 5L83A 1RFAA 4WQOB 2WU5B 2MSED 1EM7A 1HQRD 1N63A 1XLPA 3NRZA 1QQRA 3PZ8A 1FM0D 1E9MA 1D3ZA 2B76B 1AWDA 1TKGA 2MCNB 3Q3MC 2FIDA 3PT2B 3ZNHB 1FPYA 2Y5CA 2NPTB 3OAWA 2KDIA 1KFYB 4FJVB 2KXJA 3LB8C 3I5JC 2KAJA 2MBQA 4QAYA 5J18A 1OQRA 1WGRA 4LNIA 2O2VB 1SE9A 4LTUA 2MLBA 1NVID 1WR6E 2Y3AA 3L4PA 4YTPB 1F1HA 3AM9A 2MBOA 1XD3B 4IWOA 2IY1B 2JT4B 1UWMA 2KFKA 2LFIA 3RNBC 1GB4A 2GRIA 2ZW1A 2BWFA 3RUIB 4C56C 2KNBA 4IG7B 3H1UA 3IT6B 2JPHA 2L05A 5L95C 3AEGB 1OEYJ 4GDLA 2NPTA 4ARCA 1QF6A 3R2IA 4REZA 2INPE 3DBHB 2N4FA 3ZNID 2O2VA 1V2YA 1TKYA 3Q2AC 1UH6A 3FC4A 2INNE 1ZDVA 5C2TB 4DDID 2KC1A 1XCQL 3GE3C 2KT7A 4B0EA 1OTRB 1GG3A 1EWYC 1EF5A 5D3IB 1T0YA 2L0TA 1QT9A 2V3PA 5C3JB 4JLCA 1HZ6A 3AU5A 5AZHA 4ZRQA 4W9LA 1JWSD 2DAFA 1Z2MA 1PYWD 2J53A 2WXKA 3BK2A 2ZJDA 3E9SA 4LJPB 2KMMA 1R4MI 1FMAD 2KVZA 2DZKA 3J9CA 4FHJA 1UUPA 2V4LA 3NZ3A 2NBVB 3NVWA 3AXCA 4ANWA 2N9XA 1WYGA 4J6IA 4GMVA 4YTNB 2J0JA 4AUQC 4JL9A 1FNVA 1C4CA 4PYUA 1R4NB 3SR6A 3TEZA 2AQ3B 1TS4A 3PREA 4BKSA 2LEKA 4HCNB 1A70A 2LZ6A 4A20A 2N9LA 1H8CA 5DPTA 1K8RB 3AEFB 3RI7C 1VDVA 4HJKA 2ZPNA 4NY0A 5H8YE 4A90A 3RMKC 3JVZX 3ZRCA 3VH4B 2KZRA 2KDFB 4AJWA 2ICIA 2J42A 2E3TA 4F7ZA 1L4ZB 2O6VB 2EKEC 2HD5B 2OHFA 1GAQB 2K0PA 3WALA 4BVUC 1S3SG 2PE9A 1F2RC 2WU2B 1HTQA 2JRIB 4NJ6A 4EFOA 2QCZA 5C23A 1ET6A 1IP9A 2YVCA 1XXGA 3KH0A 3ZXVA 2W55A 3IAS1 5EDSA 3VH3B 3DBLI 2KK8A 4LNKA 3ETRA 4KIKA 1F52A 1FCCC 2MWSB 4DWFA 3VFKA 4HCPB 3PS6A 1XQQA 1V6EA 2DYOA 1KTKA 3ZRFA 2KO3A 1JW9D 3GZNI 1MG8A 3P42A 2ZNVB 4BBNF 4C00A 4E3CA 2ZVNA 1FFUA 2RPQA 2GBRA 2BQQA 2W9NA 1FD6A 4EZJA 2H89B 2KFJA 2WXFA 5FR3A 1R4NI 4IDIA 1YD8U 4HROA 5G55A 3AE4B 2I1JA 2LXCA 4OZCA 2HJ1A 5AUIA 2KWVB 2WDQB 1C1YB 1YOVB 1XCTL 4MGYE 2KDBA 2IO3B 2C7HA 4XE0A 3R7RA 1I4HA 2LVQA 2LMCA 4C4VB 2Z0DB 1I4RA 2WP9B 1VLBA 5JZEB 3BVMA 3U30A 2VZKD 3L16A 2QC8A 1JRPA 2FE8A 3ZKJC 4TQ0A 5J17A 2LGYA 4MDKE 2D10A 3TEWA 3E56A 1TY2A 2LGDA 3T3OA 1WSPA 2OJWA 4WH4A 1V8CA 3CF6E 3AE9B 2Y5BB 3R66C 5E6PA 4WAFA 2QILA 2WX1A 2BS4B 1YN4A 5JXVA 4GN1A 4C4VA 1I4PA 2FIFA 3BZDB 3DWGC 1YJIA 2KJ6A 1V5OA 5BMIA 2LVOA 1V1OA 3GP7A 1YNTE 1RLFA 4P1CC 3P63A 4MGKE 4LNFA 1VD2A 2FCQA 2D3BA 1STEA 4ZYNA 4LCDE 1WGYA 1ZP0B 4NQLB 2PIAA 3ECIA 4W9EA 1WJ4A 3AE7B 3A1QB 2LHEA 1Y8RC 4OVZA 4DXGA 1DYQA 1E6EB 1YX5B 4KKIA 4TSSA 2AX5A 3FKYA 3BVZA 3OWEB 2KN4A 2LXAA 1D6EC 4EOYA 1T5XD 2UU7A 1GNUA 2C9WB 1LGRA 2M8SA 3S2AA 3WAPA 4RM8A 2KQ7A 1JALA 2IGHA 2NCNA 1MHHE 2I38A 3B2GA 3DVNU 3AV8A 3IFWB 4FBJB 3VHTC 3C8YA 5TR5A 4XWTA 1NYRA 3W2DA 1JQ4A 3A1QA 3ZYYX 3R2TA 4II3B 5IKCM 4M8NA 3N3KB 2KX0A 3EC8A 5CX3A 3SDLC 1CJEA 3T9LA 4A9AA 1JCKB 1T0SC 4WJNA 3U52E 4AP4C 2RGFA 2WWZA 2L3ZA 3Q3JA 4ZOHC 1ZGUB 3L0WB 4RGNA 2NS5A 1WGDA 2CHWA 4MM3B 2IGGA 2NVUI 5BMHA 1WIAA 2N1WA 3GB1A 5BYQA 3MJ5A 4EKUA 3KUZA 3RFZB 3RNFC 2ZCBA 1XO3A 1ZXIA 1BMLC 2N9EB 1I7HA 4YT0B 4GIVA 2WXOA 2WXGA 2FCSA 3FILB 1A5RA 4N59A 4NAWB 1ROEA 1GUAB 3ZUNA 2L1AA 2AL6A 5D2MB 3ZVVA 2WLBA 2L83A 2FBWB 1WZ3A 4P1BC 1MFWA 1TY0A 1K53A 1H4RA 2KKCA 4K1RB 3R8BA 1J7CA 3EA6A 3HM6X 3QARA 1L5PA 1T0RC 2AYOB 2K8BA 3MTNB 3SEBA 3FILA 1QOAA 4ACFA 5LLIA 4IM0A 4NAWA 2MA9B 1E8YA 2C7NB 4RM9A 3VTUA 2L7RA 4R3DA 3UIOB 2GLSA 3JSVA 4HPPA 3H7PB 2ZVOA 1V9JA 4HVBA 4DHJD 3KYCD 2M19A 2KN5A 2MJ3A 3K9OB 2VH2A 3NUHB 1TZOA 5EE1A 2N9KA 1R7SA 4FA6A 1N60A 1FXAA 4X57B 1UF0A 2DNFA 2K1FA 1I4GA 1E10A 3HM3A 1UBQA 2L8JA 4P6VF 3RYTA 1L6UA 2ON8A 1WXSA 3KUCB 4KVGB 4LK0M 3N1XC 3BWUD 3C19A 3T8MA 3PSEB 4HEA1 4FLHA 2WGSA 3UF8A 2L76A 1UD7A 2KOXA 2W54A 4KGTA 1WRDB 3H7PA 3RNGC 1VJKA 4PS8A 4ZRIA 3P4SB 2QJLA 4WIPA 2GBJA 3V61A 4HLEA 2WXRA 1L6VA 4US9A 4HKZE 1DOYA 3WAOA 2BYVE 2WYQA 4IW0A 4RCOA 1I35A 2EELA 2Z0EB 2N7EA 3ZJTA 1VZ6A 3Q3NC 4MSQB 4BFRA 5HKHA 1HEZE 2G4DB 2PVOD 3BYTB 4PS3A 4F8CB 1SSNA 3OLMD 2C7MB 4B9KA 4PS7A 2HTME 4XX5A 1ZOYB 1YMHE 2M0AA 1RM6C 2RSUA 5D7GA 2LJ5A 1L0XB 2DYBA 3V62A 1LQBA 5BO4B 3TMPB 1WE7A 1UGMA 2M56B 1WI0A 2DX5B 2C5LC 1BUIC 2PMVA 4MGIE 2NBWB 2AWTA 1FRDA 5D6JB 4GXBA 4G3XB 4WJOA 3TSSA 2N7JA 1J7AA 4XDCA 4FADA 1QKZA 1K50A 1GJZA 2FAZA 4ZHOA 2QHOA 1LO5D 1YQ4B 1XLQA 3X0WA 2K22A 4FHKA 4YXDB 4MSMB 2K3UA 3KLSX 4JGHB 3B0AA 5JHAA 2IBIB 3W5VB 4YSYB 1J7BA 3U2SC 1J19A 4OW0A 1UZXB 4DBGA 1LM8B 3A4SC 1TGZB 1FO4A 3VUWA 2D3CA 2BS3B 3QA8A 2KJHB 1SIJA 2K39A 2Z59B 2LUEA 1VZ7A 2RDBC 1E8XA 4IM3A 3FAHA 4G11A 2K9XA 4AWJA 1TS5A 3QWZB 4ANVA 3V60A 4M02A 4ZHPA 2PTLA 3VTWA 2BYFA 1WFYA 2LI5A 2UYZB 4OVVA 4RF1A 2N9PC 1OEYA 3BYYB 1OFFA 2QDFA 4DHZE 1WGGA 4IUMB 3ZLZA 1TJEA 2BB6A 4MH8A 1IYFA 1WXVA 3TCAA 2B3AA 3PHWB 1CK1A 3I63C 4KZ0A 2JU6X 2WXIA 1PUTA 2NBUA 2V3NA 1KLUD 3NS8A 5IN7A 3W9CB 3DVNV 3OJ3A 1SE2A 3TEYA 4DHJB 3TUOA 2IYDB 1KM7A 1XLNA 2GB1A 2KJRA 4TMAB 1C3TA 4HKQA 4IOIE 1WR1A 3PRZA 2QEJC 4FULA 2K6DB 4AJYB 3APDA 2LVPA 3DBHI 3V3XA 2DAJA 4S0RA 2JQRB 3DHGC 2QSDA 2PKOA 2RPVA 2BBCA 4BOSC 2CJOA 1Q5WB 5G2NA 1YJ1A 4W9GA 1SBBB 1WWTA 4K3CA 3CMMB 4HWIB 1YQ3B 1NYQA 2CS4A 3MHSD 3ZDTA 5MPOA 3B9JA 1KLGD 2JF5A 1WRIA 3PO0A 5CHVC 4RMAA 2MW5A 4RF0A 1HA5A 4F1SA 2NR2A 3Q3OC 4HPMB 3DHHC 3AH7A 4JQWC 4N9F4 3PRPB 4WWNA 2QMTA 5DPRA 1ZKHA 3V6EB 4PK1A 4W9DA 1TTNA 3NVYA 2MX2A 4MGZE 4EEWA 4MJSB 4RH6A 2O6VA 2WQYB 3AI5A 2KHWB 3U7ZA 5HI1A 3MC8A 3KYDD 2DLBA 1I4XA 1HE8A 4GB9A 3ZW3A 2R2OA 3R7QA 1E90A 2JWUA 2LGSA 2BYTA 5G5GA 4MT5A 1K51A 4DXAB 4WWOA 3LXFA 2TSSA 3A4RA 1MI0A 2MRPA 2V1YA 4BBNC 2RD0A 2W3SA 4WAAA 3HHMA 3PLUA 1WJNA 1S1QB 1ESFA 2WDVB 4J3OD 3CWIA 1VRAB 4MJSA 4UDUC 4N6EB 4WWPA 2FUHB 2NTSA 4HJGE 4E71A 3ABVB 4EUTA 4KSLC 1VCBA 4JX1C 3KW5B 2V9HA 4OZAA 3IAM1 2I1KA 3I3TB 1ZPSA 4DXFA 4AQ7A 1L4DB 2C60A 2Z8LA 1UGJA 1P7EA 1BXTA 1WM2A 4JE3B 3N1ZC 4GLSC 2JX5A 1SJED 2JUOA 3UIPB 2CR5A 3EFCA 4DHZB 1CMXB 5IOIA 3AE6B 2K5PA 1MVKA 2WS3B 1WY8A 2J0MA 2L00B 1XLOA 1KH0A 1D5XC 1EF1A 3JYUA 2NMQA 4NNJB 3AE3B 4B0MA 3PTFC 1E7VA 4HRSA 1Y56A 4GOCA 2MJEA 4GDKB 3ALBA 2XEWA 4L2YA 4LDTD 1V97A 5H92C 1RFKA 3AEBB 1MG4A 1EU3A 1WX9A 4A3OA 1QOFA 5EE0A 4MACA 3BINA 3H6NA 3U4EG 3GE8C 3DBRB 4ITKA 4TUUA 2JY6A 2DZJA 4A6QA 4G0NB 3BY4B 4AOFA 1FCLA 2V4IB 2PPHA 3KUDB 2JZPA 1SE3A 2G3QB 3AEAB 1T3QA 4AS1A 1GOZA 5BMGA 1E7PB 3DWMA 2JZ3B 1JWMD 4ARIA 5BYSA 1C9FA 4GDKA 5J2RA 1SJHD 1Q10A 3EUB2 3O13A 3AU4A 2V0GA 3KWVA 1P9DU 1SEBD 3A9KB 1RRBA 3QIJA 4ZRPA 1Z5SB 4OVUA 4M00A 5E6OA 3PGEA 4IC7B 5HFYA 2RR9A 2PJHA 2WXLA 3P4QB 2MEKA 4GSWA 3Q14C 1YN3A 4HDQA 3R3MA 2MQJA 4MH0E 2BS2B 5FR6A 4GU2A 2J7QB 4JPSA 3QAQA 3KVFB 4US8A 5CHWA 1FNWA 2R61A 1TBEA 2A5UA 2OOBB 1Q0WB 4K3BA 1XF5L 4M8MA 3UQBA 3VUYA 4W9JA 2JVCA 3ZGZA 3Q69A 2L52A 3L13A 2L0FA 3N9YC 3Q8AA 4M0WB 4TV3A 2XK5B 3A9KA 1V49A 5DPSA 3ZXRA 2GOWA 2JWZA 2SEBD 1FFVA 1E0ZA 1MJDA 1NI2A 4ZRKA 4ICUA 1V1PB 4K81A 1MHXA 4MM3A 3Q8EA 1WMHB 4YTMB 4WJPA 4ZYSA 3MJWA 1I42A 1UNSA 5AUKA 2ZCCA 3V6CB 4FJYA 1P7FA 2BVCA 4EZLA 5LXHA 4FJZA 3P2BA 5DCNA 3ML9A 1NBFC 3AB5A 3N1YC 2M1MA 5TSSA 3ZDMC 3N30A 1WF9A 4BAXA 3MC0B 3D32A 3RPFC 1TYGB 2HDEA 3MFGA 4M0WA 2IPKD 3NZSA 2XK5A 2BGFA 3URYA 2M4NA 2AQ2B 1AYFA 3PZDA 2VZKB 5KHQA 1CQVA 4XGAB 1WGKA 5CHFA 3MP9A 4LJOB 1WMHA 3H7SA 2E6XA 5CTRC 1EWCA 3CIRB 4L1BA 3VTVA 1GC7A 1E5WA 2KQ4X 3I57A 3LYYA 1F2RI 1XT9B 3EGRA 3W1YA 2WNMA 1P0RA 1C4PA 3TBLD 1L0YB 1ZE3D 3M62B 4O1NA 1PQSA 5KHOA 3OG5A 3NJTA 1B9RA 4K7SA 4RFBA 1AN8A 2DZIA 2G9HD 1C78A 1M94A 2K8CA 3K9PB 3ZIMA 2DWQA 3A9JB 1D5ZC 3HRDD 3RT3B 3U8ZA 4BZAA 2H88B 2KWCA 1L0VB 3RD2A 3TL5A 1P3QU 2D11A 4KV2A 4XC2A 1TIFA 5AZFA 4H2AA 1V81A 4L23A 1QILA 3AN1A 3VRAB 2IGDA 1N62A 3ML8A 2CHXA 1KF6B 1MPEA 2BF8B 4FXCA 3GS2A 4JIOU 4URKA 1YN5A 4LDTB 1EO6A
chains in the Genus database with same CATH topology
2D07B 1YQBA 3ZKJC 3DVNV 3L54A 1WX8A 3L17A 3OJ3A 4TQ0A 5J17A 3DVGX 2LGYA 3LDZE 2KLCA 2D10A 3A9JA 4MDKE 4DHJB 3CSFA 3DOWA 3DBRI 2IYDB 1KM7A 3A33B 1WJ6A 3HK0A 3DDCB 1WXAA 2LGDA 3NZUA 2KJRA 4K7WA 1C3TA 4FN2A 4ICVA 1IYFA 3CF6E 2Y5BB 3R66C 5E6PA 1WR1A 1WJUA 3PPAA 3H9DA 2K25A 2WX1A 3NY5A 3PRZA 4P7IA 2YLMA 3Q3FA 3QJZA 3CSTA 3SHQA 3HIZA 3L08A 3N32A 4FULA 2K6DB 4GN1A 4CO7A 2VRRB 3JSVB 3RULA 1WX7A 3ZNZB 1G6JA 4AJYB 2FIFA 2GBKA 3APDA 3UINB 2LVPA 1SGHA 3DBHI 2KJ6A 1V5OA 4IM2A 2ASQA 2KFKB 3WANA 2LVOA 3DPDA 4EZKA 2DAJA 2G4SA 4K7UA 1F9JA 2KTFA 1RLFA 3M3JA 4MGKE 4BOSC 1VD2A 3IG3A 1Q5WB 5G2NA 2FCQA 4GDLB 1YJ1A 4W9GA 4LCDE 4ZYNA 4BKSD 1WGYA 2KMCA 4NQLB 3CMMB 3ECIA 4W9EA 1A5RA 4TQ1A 1IPGA 3EECA 4HWIB 2CS4A 1WJ4A 3MHSD 1P1AA 2J0KA 3ZDTA 3A1QB 3DQVA 3IHPC 4W9FA 1Y8RC 1WE6A 3QQ8B 2JF5A 1UBIA 3SD5A 1YX5B 2MBBB 2PE6B 1JRUA 5CHVC 4RMAA 3QCAA 2LXAA 3U7DA 2MW5A 4EOYA 3ZO5B 1GNUA 2C9WB 2N7DA 4F1SA 4KZCA 2JZZA 2KANA 2M8SA 3S2AA 3WAPA 2K8HA 4RM8A 5JH5C 2KQ7A 2NR2A 3QC8B 5D94A 2MP2B 4HPMB 1WYWB 2XBBC 4JQWC 2KD0A 4N9F4 3PRPB 2NCNA 4WWNA 4ZDVA 5DPRA 1ZKHA 4W9KA 3AULA 3V6EB 3DVNU 2LRUA 4II2B 4W9DA 1TTNA 1QZEA 2MX2A 3IFWB 3VVWB 4FBJB 4MGZE 4EEWA 4MJSB 3VHTC 2O6VA 2LRWA 5TR5A 5JHBA 1NDDA 3AI5A 2KC2A 2KHWB 3A1QA 4HXDA 4II3B 1WXMA 4M8NA 3N3KB 3KYDD 2KX0A 3EC8A 4WJQA 2JXXA 4I6LB 1HE8A 4GB9A 5CX3A 3SDLC 3ZW3A 3DBSA 2R2OA 4NPNA 2MBHA 3VUXA 3DCGA 3R7QA 3W1SA 1FXTB 3T9LA 1E90A 3JW0X 4WJNA 1KOTA 1WZ0A 4DXAB 4AP4C 4WWOA 2RGFA 4DK5A 2WWZA 2L3ZA 3Q3JA 2GBNA 2BKFA 2O6VD 2GMIC 1E7UA 1ZGUB 2FCMA 3PHXB 3A4RA 1ZW7A 2MRPA 1UELA 3L0WB 2V1YA 3APFA 2MP2A 3VDZA 4A3PA 4BBNC 2NS5A 2RD0A 4HPLB 3WAMA 3QHTA 5E6NA 1WGDA 2CHWA 2NVUI 4WAAA 3HHMA 1WIAA 3PLUA 2N1WA 1WJNA 4B6WA 3NHEB 1S1QB 4EKUA 2HJ8A 3KUZA 1EUVB 3M63B 2ZCBA 3PLVA 3O65B 4MJSA 4KDLB 2N9EB 3GOEA 4WWPA 2D3GA 2FUHB 4W9IA 2JRHA 4E71A 3QX1A 2EMSA 1E8WA 1P98A 4GIVA 4EUTA 3ENEA 4KSLC 1VCBA 2FCSA 4TKNA 1WGHA 1GC6A 2OJRA 2KX3A 4KSKC 2G45B 3KW5B 2LWPA 4IWQA 2MBEA 4IWPA 4NAWB 4ANXA 2R2QA 3LJ3A 2I1KA 3I3TB 1GUAB 1AARA 3ZUNA 2ZNVC 5GMVA 2ZPYA 4MEMA 2LGXA 2C60A 1TZ1A 2AL6A 2IO2B 2WDTB 4ZRJA 3EHVA 1BT0A 5D2MB 3ZVVA 5L83A 1RFAA 2CKHB 4WQOB 1WM2A 1WZ3A 5DPWA 2MSED 4MELA 2PEAA 3PVLA 1V80A 2JUOA 3UIPB 2CR5A 3UQAA 4DHZB 1D3ZA 1CMXB 2DZMA 1H4RA 3ZNGC 4E74A 2KKCA 2KDEB 4K1RB 3VAWA 2AEHA 2BYEA 2ZEQA 2MCNB 1WY8A 2J0MA 2FIDA 2L00B 1YX6B 3PT2B 3ZNHB 3HM6X 2UWQA 2DHZA 3QARA 2NPTB 1EF1A 3JYUA 1RAXA 4NNJB 3OAWA 3UGBB 2KDIA 4PYZA 1ISNA 4KIKB 2AYOB 4FJVB 2KXJA 2K8BA 3PTFC 3MTNB 5LXIB 1E7VA 4GOCA 2MBQA 4GDKB 5J18A 3ALBA 5LLIA 4IM0A 4NAWA 2MA9B 2XEWA 1WGRA 1E8YA 2O2VB 2C7NB 4RM9A 1SE9A 3VTUA 4LDTD 2L7RA 2MLBA 3RCZA 1WR6E 2BWES 3UIOB 2GBMA 3QK0A 3JSVA 3SU8X 3H7PB 1WX9A 2MBOA 2ZVOA 4A3OA 1XD3B 4IWOA 2IY1B 1V9JA 2JT4B 3BINA 3H6NA 4HVBA 4DHJD 3KYCD 2KFKA 4TUUA 2JY6A 2KN5A 2DZJA 4G0NB 3K9OB 3WIMA 2M17A 2BWFA 3BY4B 1SIFA 3RUIB 4AOFA 4FA6A 2KNBA 4IG7B 3H1UA 1L2NA 2JPHA 4X57B 2L05A 2PPHA 5L95C 2K1FA 1OEYJ 3KUDB 3PRMB 4GDLA 2G3QB 2NPTA 4HDOA 1L7YA 2KMAA 3HM3A 1UBQA 2L8JA 2LD9A 2LASA 3RYTA 4KVGB 1WXSA 3KUCB 2JZ3B 4NQKE 3PV1A 2A4ZA 3VQIA 2M0XA 4GDKA 3T8MA 5J2RA 3PSEB 2N4FA 4FLHA 3ZNID 2CHZA 2O2VA 1V2YA 3UF8A 2V3SA 4XZ4A 3AU4A 1UH6A 2L76A 1UD7A 2KOXA 1P9DU 3A9KB 1RRBA 4DDID 1WRDB 2KC1A 3H7PA 3QIJA 4I6NB 4PS8A 4ZRIA 1Z5SB 4OVUA 3EFUA 1OTRB 5E6OA 4HK2A 3PGEA 2GBJA 1GG3A 4IC7B 3V61A 3DVGY 2RR9A 2IO0B 2PJHA 4HLEA 4GSWA 1EF5A 1T0YA 4HDQA 3R3MA 2L0TA 2MQJA 4MH0E 5FR6A 3W1SC 3WAOA 2BYVE 2WYQA 4IW0A 4GU2A 2J7QB 4JLCA 1YIWA 5AZHA 3AU5A 3L10B 1I35A 3QAQA 2Z0EB 3KVFB 1J8CA 4W9LA 2N7EA 5CHWA 1TBEA 2A5UA 2OOBB 1Q0WB 2DAFA 2IY0B 2KQSA 4BFRA 4MSQB 5HKHA 1Z2MA 3RZWC 2G4DB 2IO1B 4PS3A 4M8MA 2ZJDA 3UQBA 4F8CB 3VUYA 4W9JA 2JVCA 3OLMD 2C7MB 4LJPB 3TIXA 4B9KA 4PS7A 4NJ7A 4XX5A 3L13A 3RZFA 2L0FA 1R4MI 2DZKA 2CU1A 4M0WB 4TV3A 4FHJA 2XK5B 2V4LA 2RSUA 3A9KA 1V49A 2NBVB 2LJ5A 2GOWA 2JWZA 5D7GA 5DPSA 2REXA 4CHKA 3AXCA 2DYBA 1NI2A 1E8ZA 4ZRKA 3V62A 4ANWA 1LQBA 2N9XA 1LFDA 3B08A 4W9CA 5BO4B 3TMPB 4ICUA 1WE7A 3M95A 4GMVA 4J6IA 1UGMA 2J0JA 4AUQC 1WI0A 2DX5B 4JL9A 4K81A 2C5LC 4PYUA 3ONSA 4MM3A 2NBWB 4MGIE 1WMHB 3PREA 2N1VA 3MJWA 2AWTA 3NOBA 4WJPA 1I42A 5D6JB 2ZCCA 3V6CB 4GXBA 4BKSA 4HCNB 4G3XB 4WJOA 3X23A 2LZ6A 4FJYA 4A20A 4FADA 4I6PA 4EZLA 5LXHA 1H8CA 4FJZA 3P2BA 1GJZA 5DCNA 3ML9A 1K8RB 1NBFC 5DPTA 2FAZA 2M1MA 3ZDMC 4HJKA 3B1LX 2ZPNA 4NY0A 2QHOA 4GGQA 1V86A 2FCNA 3N30A 4BKGA 1WF9A 3X0WA 3JVZX 3ZRCA 2AL3A 4FHKA 4G50A 3VH4B 2KZRA 2KDFB 3D32A 2KWUB 4AJWA 4MSMB 3NZSA 2XK5A 2BGFA 4JGHB 4YL8A 4F7ZA 2KVRA 5IAAC 3B0AA 3IVFA 2M4NA 2KTRB 2EKEC 2HD5B 2IBIB 2O6VB 5JHAA 3VXWA 3ZTDA 3WALA 3OJ4B 3PZDA 4BVUC 1S3SG 2PE9A 5AEKB 5C1ZA 1J19A 1Q1OA 3C0RB 5KHQA 1UZXB 3IBEA 4DBGA 1LM8B 5CHFA 2HTHA 3A4SC 2JRIB 4LJOB 4NJ6A 4EFOA 1TGZB 1WMHA 3H7SA 5C23A 3VUWA 2HE7A 5CTRC 3VTVA 1IP9A 1GC7A 2YVCA 3KH0A 1E5WA 3QA8A 5EDSA 2KJHB 3VH3B 3DBLI 2K39A 2KK8A 2Z59B 1LXDA 2LUEA 1XT9B 3W1YA 4KIKA 2IZVB 1P0RA 3TBLD 2MWSB 4CYEA 4DWFA 3VFKA 4HCPB 3PS6A 3M62B 1E8XA 4BOZB 1XQQA 4IM3A 1V6EA 1PQSA 2DYOA 3ZRFA 2KO3A 1WM3A 5KHOA 4G11A 4W9HA 4AWJA 3GZNI 2DENB 1MG8A 2ZNVB 3QWZB 4K7SA 4ANVA 4BBNF 1X1MA 3V60A 4E3CA 2DZIA 2ZVNA 4BKTA 3VTWA 1M94A 2BYFA 2K8CA 3APCA 3K9PB 3TJPA 3WA0A 3ZIMA 2RPQA 4ANUA 1KLVA 3A9JB 2GBRA 2KTRA 2W9NA 4EZJA 3RT3B 1WFYA 2LI5A 2UYZB 3U8ZA 4OVVA 2FNJB 2KFJA 2N9PC 1KJTA 1R4NI 3ZTCA 1OEYA 1YD8U 2KWCA 5G55A 2I1JA 2LXCA 3RD2A 3TL5A 1P3QU 2D11A 4KV2A 4DHZE 2KWVB 4XC2A 1V5TA 1WGGA 1C1YB 4IUMB 5AZFA 1OQYA 4MGYE 2KLGA 2KDBA 2BKRB 3ZLZA 1J0GA 1V81A 2IO3B 2D2QA 2C7HA 2K6QA 1WXVA 3R7RA 2BPSA 2LVQA 3ML8A 3TCAA 2CHXA 4B95A 2B3AA 3PHWB 4DDGD 5IA7A 2Z0DB 2BF8B 2ZZPB 1WH3A 1OGWA 2WX0A 5AZGA 4KZ0A 5JZEB 4KDIC 2DYMA 2EMTA 3U30A 2NBUA 1U4AA 3L16A 4ASWC 4JIOU 4URKA 4LDTB 3NS8A 1EO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D07 B;  1YQB A;  3ZKJ C;  3DVN V;  3L54 A;  1WX8 A;  3L17 A;  3OJ3 A;  4TQ0 A;  5J17 A;  3DVG X;  2LGY A;  3LDZ E;  2KLC A;  2D10 A;  3A9J A;  4MDK E;  4DHJ B;  3CSF A;  3DOW A;  3DBR I;  2IYD B;  1KM7 A;  3A33 B;  1WJ6 A;  3HK0 A;  3DDC B;  1WXA A;  2LGD A;  3NZU A;  2KJR A;  4K7W A;  1C3T A;  4FN2 A;  4ICV A;  1IYF A;  3CF6 E;  2Y5B B;  3R66 C;  5E6P A;  1WR1 A;  1WJU A;  3PPA A;  3H9D A;  2K25 A;  2WX1 A;  3NY5 A;  3PRZ A;  4P7I A;  2YLM A;  3Q3F A;  3QJZ A;  3CST A;  3SHQ A;  3HIZ A;  3L08 A;  3N32 A;  4FUL A;  2K6D B;  4GN1 A;  4CO7 A;  2VRR B;  3JSV B;  3RUL A;  1WX7 A;  3ZNZ B;  1G6J A;  4AJY B;  2FIF A;  2GBK A;  3APD A;  3UIN B;  2LVP A;  1SGH A;  3DBH I;  2KJ6 A;  1V5O A;  4IM2 A;  2ASQ A;  2KFK B;  3WAN A;  2LVO A;  3DPD A;  4EZK A;  2DAJ A;  2G4S A;  4K7U A;  1F9J A;  2KTF A;  1RLF A;  3M3J A;  4MGK E;  4BOS C;  1VD2 A;  3IG3 A;  1Q5W B;  5G2N A;  2FCQ A;  4GDL B;  1YJ1 A;  4W9G A;  4LCD E;  4ZYN A;  4BKS D;  1WGY A;  2KMC A;  4NQL B;  3CMM B;  3ECI A;  4W9E A;  1A5R A;  4TQ1 A;  1IPG A;  3EEC A;  4HWI B;  2CS4 A;  1WJ4 A;  3MHS D;  1P1A A;  2J0K A;  3ZDT A;  3A1Q B;  3DQV A;  3IHP C;  4W9F A;  1Y8R C;  1WE6 A;  3QQ8 B;  2JF5 A;  1UBI A;  3SD5 A;  1YX5 B;  2MBB B;  2PE6 B;  1JRU A;  5CHV C;  4RMA A;  3QCA A;  2LXA A;  3U7D A;  2MW5 A;  4EOY A;  3ZO5 B;  1GNU A;  2C9W B;  2N7D A;  4F1S A;  4KZC A;  2JZZ A;  2KAN A;  2M8S A;  3S2A A;  3WAP A;  2K8H A;  4RM8 A;  5JH5 C;  2KQ7 A;  2NR2 A;  3QC8 B;  5D94 A;  2MP2 B;  4HPM B;  1WYW B;  2XBB C;  4JQW C;  2KD0 A;  4N9F 4;  3PRP B;  2NCN A;  4WWN A;  4ZDV A;  5DPR A;  1ZKH A;  4W9K A;  3AUL A;  3V6E B;  3DVN U;  2LRU A;  4II2 B;  4W9D A;  1TTN A;  1QZE A;  2MX2 A;  3IFW B;  3VVW B;  4FBJ B;  4MGZ E;  4EEW A;  4MJS B;  3VHT C;  2O6V A;  2LRW A;  5TR5 A;  5JHB A;  1NDD A;  3AI5 A;  2KC2 A;  2KHW B;  3A1Q A;  4HXD A;  4II3 B;  1WXM A;  4M8N A;  3N3K B;  3KYD D;  2KX0 A;  3EC8 A;  4WJQ A;  2JXX A;  4I6L B;  1HE8 A;  4GB9 A;  5CX3 A;  3SDL C;  3ZW3 A;  3DBS A;  2R2O A;  4NPN A;  2MBH A;  3VUX A;  3DCG A;  3R7Q A;  3W1S A;  1FXT B;  3T9L A;  1E90 A;  3JW0 X;  4WJN A;  1KOT A;  1WZ0 A;  4DXA B;  4AP4 C;  4WWO A;  2RGF A;  4DK5 A;  2WWZ A;  2L3Z A;  3Q3J A;  2GBN A;  2BKF A;  2O6V D;  2GMI C;  1E7U A;  1ZGU B;  2FCM A;  3PHX B;  3A4R A;  1ZW7 A;  2MRP A;  1UEL A;  3L0W B;  2V1Y A;  3APF A;  2MP2 A;  3VDZ A;  4A3P A;  4BBN C;  2NS5 A;  2RD0 A;  4HPL B;  3WAM A;  3QHT A;  5E6N A;  1WGD A;  2CHW A;  2NVU I;  4WAA A;  3HHM A;  1WIA A;  3PLU A;  2N1W A;  1WJN A;  4B6W A;  3NHE B;  1S1Q B;  4EKU A;  2HJ8 A;  3KUZ A;  1EUV B;  3M63 B;  2ZCB A;  3PLV A;  3O65 B;  4MJS A;  4KDL B;  2N9E B;  3GOE A;  4WWP A;  2D3G A;  2FUH B;  4W9I A;  2JRH A;  4E71 A;  3QX1 A;  2EMS A;  1E8W A;  1P98 A;  4GIV A;  4EUT A;  3ENE A;  4KSL C;  1VCB A;  2FCS A;  4TKN A;  1WGH A;  1GC6 A;  2OJR A;  2KX3 A;  4KSK C;  2G45 B;  3KW5 B;  2LWP A;  4IWQ A;  2MBE A;  4IWP A;  4NAW B;  4ANX A;  2R2Q A;  3LJ3 A;  2I1K A;  3I3T B;  1GUA B;  1AAR A;  3ZUN A;  2ZNV C;  5GMV A;  2ZPY A;  4MEM A;  2LGX A;  2C60 A;  1TZ1 A;  2AL6 A;  2IO2 B;  2WDT B;  4ZRJ A;  3EHV A;  1BT0 A;  5D2M B;  3ZVV A;  5L83 A;  1RFA A;  2CKH B;  4WQO B;  1WM2 A;  1WZ3 A;  5DPW A;  2MSE D;  4MEL A;  2PEA A;  3PVL A;  1V80 A;  2JUO A;  3UIP B;  2CR5 A;  3UQA A;  4DHZ B;  1D3Z A;  1CMX B;  2DZM A;  1H4R A;  3ZNG C;  4E74 A;  2KKC A;  2KDE B;  4K1R B;  3VAW A;  2AEH A;  2BYE A;  2ZEQ A;  2MCN B;  1WY8 A;  2J0M A;  2FID A;  2L00 B;  1YX6 B;  3PT2 B;  3ZNH B;  3HM6 X;  2UWQ A;  2DHZ A;  3QAR A;  2NPT B;  1EF1 A;  3JYU A;  1RAX A;  4NNJ B;  3OAW A;  3UGB B;  2KDI A;  4PYZ A;  1ISN A;  4KIK B;  2AYO B;  4FJV B;  2KXJ A;  2K8B A;  3PTF C;  3MTN B;  5LXI B;  1E7V A;  4GOC A;  2MBQ A;  4GDK B;  5J18 A;  3ALB A;  5LLI A;  4IM0 A;  4NAW A;  2MA9 B;  2XEW A;  1WGR A;  1E8Y A;  2O2V B;  2C7N B;  4RM9 A;  1SE9 A;  3VTU A;  4LDT D;  2L7R A;  2MLB A;  3RCZ A;  1WR6 E;  2BWE S;  3UIO B;  2GBM A;  3QK0 A;  3JSV A;  3SU8 X;  3H7P B;  1WX9 A;  2MBO A;  2ZVO A;  4A3O A;  1XD3 B;  4IWO A;  2IY1 B;  1V9J A;  2JT4 B;  3BIN A;  3H6N A;  4HVB A;  4DHJ D;  3KYC D;  2KFK A;  4TUU A;  2JY6 A;  2KN5 A;  2DZJ A;  4G0N B;  3K9O B;  3WIM A;  2M17 A;  2BWF A;  3BY4 B;  1SIF A;  3RUI B;  4AOF A;  4FA6 A;  2KNB A;  4IG7 B;  3H1U A;  1L2N A;  2JPH A;  4X57 B;  2L05 A;  2PPH A;  5L95 C;  2K1F A;  1OEY J;  3KUD B;  3PRM B;  4GDL A;  2G3Q B;  2NPT A;  4HDO A;  1L7Y A;  2KMA A;  3HM3 A;  1UBQ A;  2L8J A;  2LD9 A;  2LAS A;  3RYT A;  4KVG B;  1WXS A;  3KUC B;  2JZ3 B;  4NQK E;  3PV1 A;  2A4Z A;  3VQI A;  2M0X A;  4GDK A;  3T8M A;  5J2R A;  3PSE B;  2N4F A;  4FLH A;  3ZNI D;  2CHZ A;  2O2V A;  1V2Y A;  3UF8 A;  2V3S A;  4XZ4 A;  3AU4 A;  1UH6 A;  2L76 A;  1UD7 A;  2KOX A;  1P9D U;  3A9K B;  1RRB A;  4DDI D;  1WRD B;  2KC1 A;  3H7P A;  3QIJ A;  4I6N B;  4PS8 A;  4ZRI A;  1Z5S B;  4OVU A;  3EFU A;  1OTR B;  5E6O A;  4HK2 A;  3PGE A;  2GBJ A;  1GG3 A;  4IC7 B;  3V61 A;  3DVG Y;  2RR9 A;  2IO0 B;  2PJH A;  4HLE A;  4GSW A;  1EF5 A;  1T0Y A;  4HDQ A;  3R3M A;  2L0T A;  2MQJ A;  4MH0 E;  5FR6 A;  3W1S C;  3WAO A;  2BYV E;  2WYQ A;  4IW0 A;  4GU2 A;  2J7Q B;  4JLC A;  1YIW A;  5AZH A;  3AU5 A;  3L10 B;  1I35 A;  3QAQ A;  2Z0E B;  3KVF B;  1J8C A;  4W9L A;  2N7E A;  5CHW A;  1TBE A;  2A5U A;  2OOB B;  1Q0W B;  2DAF A;  2IY0 B;  2KQS A;  4BFR A;  4MSQ B;  5HKH A;  1Z2M A;  3RZW C;  2G4D B;  2IO1 B;  4PS3 A;  4M8M A;  2ZJD A;  3UQB A;  4F8C B;  3VUY A;  4W9J A;  2JVC A;  3OLM D;  2C7M B;  4LJP B;  3TIX A;  4B9K A;  4PS7 A;  4NJ7 A;  4XX5 A;  3L13 A;  3RZF A;  2L0F A;  1R4M I;  2DZK A;  2CU1 A;  4M0W B;  4TV3 A;  4FHJ A;  2XK5 B;  2V4L A;  2RSU A;  3A9K A;  1V49 A;  2NBV B;  2LJ5 A;  2GOW A;  2JWZ A;  5D7G A;  5DPS A;  2REX A;  4CHK A;  3AXC A;  2DYB A;  1NI2 A;  1E8Z A;  4ZRK A;  3V62 A;  4ANW A;  1LQB A;  2N9X A;  1LFD A;  3B08 A;  4W9C A;  5BO4 B;  3TMP B;  4ICU A;  1WE7 A;  3M95 A;  4GMV A;  4J6I A;  1UGM A;  2J0J A;  4AUQ C;  1WI0 A;  2DX5 B;  4JL9 A;  4K81 A;  2C5L C;  4PYU A;  3ONS A;  4MM3 A;  2NBW B;  4MGI E;  1WMH B;  3PRE A;  2N1V A;  3MJW A;  2AWT A;  3NOB A;  4WJP A;  1I42 A;  5D6J B;  2ZCC A;  3V6C B;  4GXB A;  4BKS A;  4HCN B;  4G3X B;  4WJO A;  3X23 A;  2LZ6 A;  4FJY A;  4A20 A;  4FAD A;  4I6P A;  4EZL A;  5LXH A;  1H8C A;  4FJZ A;  3P2B A;  1GJZ A;  5DCN A;  3ML9 A;  1K8R B;  1NBF C;  5DPT A;  2FAZ A;  2M1M A;  3ZDM C;  4HJK A;  3B1L X;  2ZPN A;  4NY0 A;  2QHO A;  4GGQ A;  1V86 A;  2FCN A;  3N30 A;  4BKG A;  1WF9 A;  3X0W A;  3JVZ X;  3ZRC A;  2AL3 A;  4FHK A;  4G50 A;  3VH4 B;  2KZR A;  2KDF B;  3D32 A;  2KWU B;  4AJW A;  4MSM B;  3NZS A;  2XK5 A;  2BGF A;  4JGH B;  4YL8 A;  4F7Z A;  2KVR A;  5IAA C;  3B0A A;  3IVF A;  2M4N A;  2KTR B;  2EKE C;  2HD5 B;  2IBI B;  2O6V B;  5JHA A;  3VXW A;  3ZTD A;  3WAL A;  3OJ4 B;  3PZD A;  4BVU C;  1S3S G;  2PE9 A;  5AEK B;  5C1Z A;  1J19 A;  1Q1O A;  3C0R B;  5KHQ A;  1UZX B;  3IBE A;  4DBG A;  1LM8 B;  5CHF A;  2HTH A;  3A4S C;  2JRI B;  4LJO B;  4NJ6 A;  4EFO A;  1TGZ B;  1WMH A;  3H7S A;  5C23 A;  3VUW A;  2HE7 A;  5CTR C;  3VTV A;  1IP9 A;  1GC7 A;  2YVC A;  3KH0 A;  1E5W A;  3QA8 A;  5EDS A;  2KJH B;  3VH3 B;  3DBL I;  2K39 A;  2KK8 A;  2Z59 B;  1LXD A;  2LUE A;  1XT9 B;  3W1Y A;  4KIK A;  2IZV B;  1P0R A;  3TBL D;  2MWS B;  4CYE A;  4DWF A;  3VFK A;  4HCP B;  3PS6 A;  3M62 B;  1E8X A;  4BOZ B;  1XQQ A;  4IM3 A;  1V6E A;  1PQS A;  2DYO A;  3ZRF A;  2KO3 A;  1WM3 A;  5KHO A;  4G11 A;  4W9H A;  4AWJ A;  3GZN I;  2DEN B;  1MG8 A;  2ZNV B;  3QWZ B;  4K7S A;  4ANV A;  4BBN F;  1X1M A;  3V60 A;  4E3C A;  2DZI A;  2ZVN A;  4BKT A;  3VTW A;  1M94 A;  2BYF A;  2K8C A;  3APC A;  3K9P B;  3TJP A;  3WA0 A;  3ZIM A;  2RPQ A;  4ANU A;  1KLV A;  3A9J B;  2GBR A;  2KTR A;  2W9N A;  4EZJ A;  3RT3 B;  1WFY A;  2LI5 A;  2UYZ B;  3U8Z A;  4OVV A;  2FNJ B;  2KFJ A;  2N9P C;  1KJT A;  1R4N I;  3ZTC A;  1OEY A;  1YD8 U;  2KWC A;  5G55 A;  2I1J A;  2LXC A;  3RD2 A;  3TL5 A;  1P3Q U;  2D11 A;  4KV2 A;  4DHZ E;  2KWV B;  4XC2 A;  1V5T A;  1WGG A;  1C1Y B;  4IUM B;  5AZF A;  1OQY A;  4MGY E;  2KLG A;  2KDB A;  2BKR B;  3ZLZ A;  1J0G A;  1V81 A;  2IO3 B;  2D2Q A;  2C7H A;  2K6Q A;  1WXV A;  3R7R A;  2BPS A;  2LVQ A;  3ML8 A;  3TCA A;  2CHX A;  4B95 A;  2B3A A;  3PHW B;  4DDG D;  5IA7 A;  2Z0D B;  2BF8 B;  2ZZP B;  1WH3 A;  1OGW A;  2WX0 A;  5AZG A;  4KZ0 A;  5JZE B;  4KDI C;  2DYM A;  2EMT A;  3U30 A;  2NBU A;  1U4A A;  3L16 A;  4ASW C;  4JIO U;  4URK A;  4LDT B;  3NS8 A;  1EO6 A; 
#chains in the Genus database with same CATH topology
 4JWU C;  1YQB A;  3IT4 B;  1WX8 A;  3L17 A;  2KLC A;  3A9J A;  3CSF A;  1QLB B;  2MJD A;  3A33 B;  1WJ6 A;  3HK0 A;  3DDC B;  3NZU A;  4K7W A;  1FXI A;  4FN2 A;  1B1Z A;  3PPA A;  2BW2 A;  3H9D A;  2K25 A;  4P7I A;  2YLM A;  2ZW0 A;  5FKA C;  4S17 A;  3SHQ A;  3CST A;  3L08 A;  2VRR B;  3ZJV A;  3ZNZ B;  1G6J A;  2Q5W D;  3P4P B;  2GBK A;  3UIN B;  1DGJ A;  2KFK B;  2LUM A;  3WAN A;  4EZK A;  1TS3 A;  2G4S A;  4K7U A;  3AE5 B;  2BT6 A;  1N5X A;  4GDL B;  2DBY A;  1ENF A;  1XEE A;  1IPG A;  3HUI A;  3KQ4 A;  4DQO C;  3DQV A;  4W9F A;  2XN9 C;  1WE6 A;  3QQ8 B;  1UBI A;  2PVG C;  2MBB B;  1R4M B;  4KGS A;  3ZO5 B;  1DOX A;  4KZC A;  3Q8B A;  2Y5P A;  5JH5 C;  5D94 A;  5LNK 1;  2MP2 B;  1WYW B;  2KD0 A;  2D5G A;  4W9K A;  4II2 B;  2LRU A;  1QZE A;  4YSX B;  4WWM A;  2LRW A;  5JHB A;  1NDD A;  1C4A A;  3MHZ A;  1SB3 C;  1QOG A;  1NEK B;  2KWD A;  2JXX A;  3NVV A;  2QIE B;  2YEP F;  3JW0 X;  3VR9 B;  1KOT A;  3SFD B;  4A8X C;  2GBN A;  2MHJ A;  3PHX B;  1E7U A;  4IKG A;  1ZW7 A;  1UEL A;  3VDZ A;  3APF A;  2EKI A;  2MP2 A;  1ET9 A;  3WAM A;  3QHT A;  5E6N A;  3KWL A;  2I2Y A;  5IO9 A;  4B6W A;  3NHE B;  1EUV B;  4LNO A;  3PLV A;  4KDL B;  4W9I A;  2JRH A;  3QX1 A;  3DBL B;  2EMS A;  1E8W A;  1P98 A;  1IGD A;  1WXQ A;  3P4R B;  1WGH A;  2OJR A;  4KSK C;  2G45 B;  2LWP A;  4IWQ A;  4IWP A;  2R2Q A;  5GMV A;  1JML A;  2ZPY A;  4MEM A;  2MH7 A;  1TZ1 A;  2IO2 B;  2WDT B;  4ZRJ A;  3GZN B;  1BT0 A;  4LLG M;  2CKH B;  4PT5 A;  1DOI A;  3BII D;  1IBX B;  5DPW A;  4MEL A;  4XYC A;  2PEA A;  4A55 A;  3AMZ A;  3PVL A;  3T3N A;  4P16 A;  1V80 A;  1N5W A;  3AEC B;  3UQA A;  1PGB A;  2DZM A;  4CQN A;  2INC C;  3ZNG C;  4E74 A;  2KDE B;  3VAW A;  2AEH A;  2BYE A;  2ZEQ A;  1ZUD 2;  1YX6 B;  2UWQ A;  2DHZ A;  4N58 A;  1RAX A;  1C79 A;  2WXN A;  3UGB B;  4PYZ A;  1ISN A;  4KIK B;  5LXI B;  2WXP A;  1SXT A;  1N6Z A;  4C7Y A;  3H8H A;  1YJJ A;  2WDR B;  3RCZ A;  2BWE S;  2GBM A;  3QK0 A;  3SU8 X;  1IBX A;  1EU4 A;  1M4V A;  4OHJ A;  2IJ0 A;  3RNC C;  1GPX A;  1FEH A;  3WIM A;  2M17 A;  1TKE A;  3NS1 A;  4KX6 B;  1SIF A;  4KKJ A;  1L2N A;  3VR8 B;  1VZ8 A;  2KAC A;  3PRM B;  2RDG A;  2JYE A;  4HDO A;  1L7Y A;  5EE9 A;  2KMA A;  2LD9 A;  2LAS A;  4NQK E;  2SAK A;  3PV1 A;  2A4Z A;  3VQI A;  2M0X A;  5D3D A;  2CHZ A;  1HZ5 A;  2V3S A;  4XZ4 A;  5G5H A;  1IUE A;  2IND C;  3Q6B A;  1RWS A;  1C77 A;  4I6N B;  2ONQ A;  2WXJ A;  1PFD A;  3HVD A;  3EFU A;  4HK2 A;  3DVG Y;  4XWW A;  2CU3 A;  2IO0 B;  3AE8 B;  3NG0 A;  1D5M C;  1C76 A;  3UI3 A;  3W1S C;  2VH1 A;  4RGM A;  1YIW A;  1ZDX A;  3L10 B;  1J8C A;  2PLP A;  2IY0 B;  2KQS A;  5EE3 A;  3RZW C;  2IO1 B;  1PDX A;  3TIX A;  2W82 A;  4NJ7 A;  3RZF A;  2CU1 A;  2KDM A;  2REX A;  4CHK A;  1VR9 A;  1E8Z A;  3B08 A;  1LFD A;  4W9C A;  2W3R A;  3M95 A;  1F77 A;  2WXQ A;  3ONS A;  2N1V A;  3NOB A;  3N20 C;  5T8I A;  3X23 A;  4I6P A;  2XNA C;  3B1L X;  4GGQ A;  1V86 A;  2G1E A;  2FCN A;  4BKG A;  1KRH A;  2AL3 A;  5GXG B;  4G50 A;  2KWU B;  2D3A A;  3Q8F A;  1JWB D;  4YL8 A;  2KVR A;  5IAA C;  3IVF A;  2KTR B;  3VXW A;  1HTO A;  3ZTD A;  3OJ4 B;  5AEK B;  5C1Z A;  1Q1O A;  3C0R B;  2BTE A;  3IBE A;  2HTH A;  2PW9 A;  2HE7 A;  1JRO A;  2OED A;  1LXD A;  2X8X X;  2IZV B;  4JWS C;  4YSZ B;  4CYE A;  1FNU A;  4BOZ B;  1WM3 A;  1PGA A;  3NVZ A;  4W9H A;  2DEN B;  2WHI A;  2WXM A;  2J52 A;  1CZP A;  1X1M A;  4XDD A;  2YEP B;  1T6B X;  4BKT A;  2X38 A;  3TJP A;  3APC A;  4ANU A;  3WA0 A;  1KLV A;  3TEX A;  3DHI C;  2KTR A;  3MC9 A;  2FNJ B;  1KJT A;  3ZTC A;  4NZL B;  3SFE B;  1RYJ A;  4LNN A;  4D2K A;  1V5T A;  5E6J A;  2CJN A;  3RNE C;  1OQY A;  2KLG A;  1J0G A;  2BKR B;  2D2Q A;  2K6Q A;  4B95 A;  2BPS A;  4DDG D;  5IA7 A;  1N61 A;  1JWU D;  2ZZP B;  1WH3 A;  4WUR A;  1OGW A;  2WX0 A;  3AED B;  5AZG A;  5I4D A;  4KDI C;  2DYM A;  2EMT A;  1AW7 A;  1U4A A;  4ASW C;  5BYR A;  1SF0 A;  2D07 B;  3L54 A;  3AEE B;  3DVG X;  5FK9 C;  1D4B A;  3LDZ E;  2KYW A;  3DOW A;  3DBR I;  1NEN B;  2L32 A;  2WXH A;  1WXA A;  4WQM A;  4ICV A;  2FUG 1;  2JXT A;  4C7Z A;  1WJU A;  2RMM A;  4NJC A;  1FRR A;  3NY5 A;  3RN9 C;  3Q3F A;  2JSV X;  3QJZ A;  3HIZ A;  3N32 A;  4CO7 A;  3JSV B;  3RUL A;  1WX7 A;  3PZ7 A;  1IGC A;  1HXY D;  1UWX A;  3WCQ A;  1SGH A;  3BK1 A;  4IM2 A;  2ASQ A;  1I4Q A;  3DPD A;  1F9J A;  2KTF A;  3VRB B;  3M3J A;  2JYT A;  2ACZ B;  5HHD G;  3IG3 A;  3RNA C;  1JWA D;  4BKS D;  2KMC A;  4TQ1 A;  3EEC A;  1ZXH A;  1P1A A;  2J0K A;  4USA A;  1V1P A;  3IHP C;  3SD5 A;  2GI9 A;  2PE6 B;  1JRU A;  1OQQ A;  4RGO S;  3QCA A;  3ZJU A;  1GB1 A;  4M01 A;  3U7D A;  4KGR A;  1K52 A;  2N7D A;  3IXS A;  2JZZ A;  2KAN A;  2K8H A;  3AE2 B;  3QC8 B;  2XBB C;  2BB5 A;  4ZDV A;  3AUL A;  3VVW B;  4Q2J A;  2J4X A;  2NTT A;  4RNA A;  2KC2 A;  4EE2 A;  4HXD A;  4NAM A;  4C80 A;  5IP4 D;  2N0S B;  1WXM A;  3ZQ4 A;  3P1M A;  4WJQ A;  2IDY A;  4I6L B;  1TT5 B;  3DBS A;  4NPN A;  3VUX A;  2MBH A;  3DCG A;  4RGT A;  3W1S A;  2LGI A;  1FXT B;  3BVG A;  3Q8C A;  1SE4 A;  1WZ0 A;  3V05 A;  2LHD A;  4DK5 A;  2BKF A;  2O6V D;  2GMI C;  2FCM A;  1F0Z A;  1TS2 A;  4A3P A;  5HG2 A;  4HPL B;  3AE1 B;  3B2F A;  4YWG G;  1FIQ A;  1NI3 A;  2HJ8 A;  3M63 B;  1PGX A;  3O65 B;  3GOE A;  3W5U B;  2D3G A;  2LJI A;  3ENE A;  1QOB A;  3I9V 1;  4TKN A;  1GC6 A;  1T0Q C;  2KX3 A;  2MBE A;  2RDH A;  3HVZ A;  4ANX A;  3LJ3 A;  1AAR A;  2ZNV C;  2LGX A;  4OZB A;  2AQ1 B;  3EHV A;  1ACC A;  5L83 A;  1RFA A;  4WQO B;  2WU5 B;  2MSE D;  1EM7 A;  1HQR D;  1N63 A;  1XLP A;  3NRZ A;  1QQR A;  3PZ8 A;  1FM0 D;  1E9M A;  1D3Z A;  2B76 B;  1AWD A;  1TKG A;  2MCN B;  3Q3M C;  2FID A;  3PT2 B;  3ZNH B;  1FPY A;  2Y5C A;  2NPT B;  3OAW A;  2KDI A;  1KFY B;  4FJV B;  2KXJ A;  3LB8 C;  3I5J C;  2KAJ A;  2MBQ A;  4QAY A;  5J18 A;  1OQR A;  1WGR A;  4LNI A;  2O2V B;  1SE9 A;  4LTU A;  2MLB A;  1NVI D;  1WR6 E;  2Y3A A;  3L4P A;  4YTP B;  1F1H A;  3AM9 A;  2MBO A;  1XD3 B;  4IWO A;  2IY1 B;  2JT4 B;  1UWM A;  2KFK A;  2LFI A;  3RNB C;  1GB4 A;  2GRI A;  2ZW1 A;  2BWF A;  3RUI B;  4C56 C;  2KNB A;  4IG7 B;  3H1U A;  3IT6 B;  2JPH A;  2L05 A;  5L95 C;  3AEG B;  1OEY J;  4GDL A;  2NPT A;  4ARC A;  1QF6 A;  3R2I A;  4REZ A;  2INP E;  3DBH B;  2N4F A;  3ZNI D;  2O2V A;  1V2Y A;  1TKY A;  3Q2A C;  1UH6 A;  3FC4 A;  2INN E;  1ZDV A;  5C2T B;  4DDI D;  2KC1 A;  1XCQ L;  3GE3 C;  2KT7 A;  4B0E A;  1OTR B;  1GG3 A;  1EWY C;  1EF5 A;  5D3I B;  1T0Y A;  2L0T A;  1QT9 A;  2V3P A;  5C3J B;  4JLC A;  1HZ6 A;  3AU5 A;  5AZH A;  4ZRQ A;  4W9L A;  1JWS D;  2DAF A;  1Z2M A;  1PYW D;  2J53 A;  2WXK A;  3BK2 A;  2ZJD A;  3E9S A;  4LJP B;  2KMM A;  1R4M I;  1FMA D;  2KVZ A;  2DZK A;  3J9C A;  4FHJ A;  1UUP A;  2V4L A;  3NZ3 A;  2NBV B;  3NVW A;  3AXC A;  4ANW A;  2N9X A;  1WYG A;  4J6I A;  4GMV A;  4YTN B;  2J0J A;  4AUQ C;  4JL9 A;  1FNV A;  1C4C A;  4PYU A;  1R4N B;  3SR6 A;  3TEZ A;  2AQ3 B;  1TS4 A;  3PRE A;  4BKS A;  2LEK A;  4HCN B;  1A70 A;  2LZ6 A;  4A20 A;  2N9L A;  1H8C A;  5DPT A;  1K8R B;  3AEF B;  3RI7 C;  1VDV A;  4HJK A;  2ZPN A;  4NY0 A;  5H8Y E;  4A90 A;  3RMK C;  3JVZ X;  3ZRC A;  3VH4 B;  2KZR A;  2KDF B;  4AJW A;  2ICI A;  2J42 A;  2E3T A;  4F7Z A;  1L4Z B;  2O6V B;  2EKE C;  2HD5 B;  2OHF A;  1GAQ B;  2K0P A;  3WAL A;  4BVU C;  1S3S G;  2PE9 A;  1F2R C;  2WU2 B;  1HTQ A;  2JRI B;  4NJ6 A;  4EFO A;  2QCZ A;  5C23 A;  1ET6 A;  1IP9 A;  2YVC A;  1XXG A;  3KH0 A;  3ZXV A;  2W55 A;  3IAS 1;  5EDS A;  3VH3 B;  3DBL I;  2KK8 A;  4LNK A;  3ETR A;  4KIK A;  1F52 A;  1FCC C;  2MWS B;  4DWF A;  3VFK A;  4HCP B;  3PS6 A;  1XQQ A;  1V6E A;  2DYO A;  1KTK A;  3ZRF A;  2KO3 A;  1JW9 D;  3GZN I;  1MG8 A;  3P42 A;  2ZNV B;  4BBN F;  4C00 A;  4E3C A;  2ZVN A;  1FFU A;  2RPQ A;  2GBR A;  2BQQ A;  2W9N A;  1FD6 A;  4EZJ A;  2H89 B;  2KFJ A;  2WXF A;  5FR3 A;  1R4N I;  4IDI A;  1YD8 U;  4HRO A;  5G55 A;  3AE4 B;  2I1J A;  2LXC A;  4OZC A;  2HJ1 A;  5AUI A;  2KWV B;  2WDQ B;  1C1Y B;  1YOV B;  1XCT L;  4MGY E;  2KDB A;  2IO3 B;  2C7H A;  4XE0 A;  3R7R A;  1I4H A;  2LVQ A;  2LMC A;  4C4V B;  2Z0D B;  1I4R A;  2WP9 B;  1VLB A;  5JZE B;  3BVM A;  3U30 A;  2VZK D;  3L16 A;  2QC8 A;  1JRP A;  2FE8 A;  3ZKJ C;  4TQ0 A;  5J17 A;  2LGY A;  4MDK E;  2D10 A;  3TEW A;  3E56 A;  1TY2 A;  2LGD A;  3T3O A;  1WSP A;  2OJW A;  4WH4 A;  1V8C A;  3CF6 E;  3AE9 B;  2Y5B B;  3R66 C;  5E6P A;  4WAF A;  2QIL A;  2WX1 A;  2BS4 B;  1YN4 A;  5JXV A;  4GN1 A;  4C4V A;  1I4P A;  2FIF A;  3BZD B;  3DWG C;  1YJI A;  2KJ6 A;  1V5O A;  5BMI A;  2LVO A;  1V1O A;  3GP7 A;  1YNT E;  1RLF A;  4P1C C;  3P63 A;  4MGK E;  4LNF A;  1VD2 A;  2FCQ A;  2D3B A;  1STE A;  4ZYN A;  4LCD E;  1WGY A;  1ZP0 B;  4NQL B;  2PIA A;  3ECI A;  4W9E A;  1WJ4 A;  3AE7 B;  3A1Q B;  2LHE A;  1Y8R C;  4OVZ A;  4DXG A;  1DYQ A;  1E6E B;  1YX5 B;  4KKI A;  4TSS A;  2AX5 A;  3FKY A;  3BVZ A;  3OWE B;  2KN4 A;  2LXA A;  1D6E C;  4EOY A;  1T5X D;  2UU7 A;  1GNU A;  2C9W B;  1LGR A;  2M8S A;  3S2A A;  3WAP A;  4RM8 A;  2KQ7 A;  1JAL A;  2IGH A;  2NCN A;  1MHH E;  2I38 A;  3B2G A;  3DVN U;  3AV8 A;  3IFW B;  4FBJ B;  3VHT C;  3C8Y A;  5TR5 A;  4XWT A;  1NYR A;  3W2D A;  1JQ4 A;  3A1Q A;  3ZYY X;  3R2T A;  4II3 B;  5IKC M;  4M8N A;  3N3K B;  2KX0 A;  3EC8 A;  5CX3 A;  3SDL C;  1CJE A;  3T9L A;  4A9A A;  1JCK B;  1T0S C;  4WJN A;  3U52 E;  4AP4 C;  2RGF A;  2WWZ A;  2L3Z A;  3Q3J A;  4ZOH C;  1ZGU B;  3L0W B;  4RGN A;  2NS5 A;  1WGD A;  2CHW A;  4MM3 B;  2IGG A;  2NVU I;  5BMH A;  1WIA A;  2N1W A;  3GB1 A;  5BYQ A;  3MJ5 A;  4EKU A;  3KUZ A;  3RFZ B;  3RNF C;  2ZCB A;  1XO3 A;  1ZXI A;  1BML C;  2N9E B;  1I7H A;  4YT0 B;  4GIV A;  2WXO A;  2WXG A;  2FCS A;  3FIL B;  1A5R A;  4N59 A;  4NAW B;  1ROE A;  1GUA B;  3ZUN A;  2L1A A;  2AL6 A;  5D2M B;  3ZVV A;  2WLB A;  2L83 A;  2FBW B;  1WZ3 A;  4P1B C;  1MFW A;  1TY0 A;  1K53 A;  1H4R A;  2KKC A;  4K1R B;  3R8B A;  1J7C A;  3EA6 A;  3HM6 X;  3QAR A;  1L5P A;  1T0R C;  2AYO B;  2K8B A;  3MTN B;  3SEB A;  3FIL A;  1QOA A;  4ACF A;  5LLI A;  4IM0 A;  4NAW A;  2MA9 B;  1E8Y A;  2C7N B;  4RM9 A;  3VTU A;  2L7R A;  4R3D A;  3UIO B;  2GLS A;  3JSV A;  4HPP A;  3H7P B;  2ZVO A;  1V9J A;  4HVB A;  4DHJ D;  3KYC D;  2M19 A;  2KN5 A;  2MJ3 A;  3K9O B;  2VH2 A;  3NUH B;  1TZO A;  5EE1 A;  2N9K A;  1R7S A;  4FA6 A;  1N60 A;  1FXA A;  4X57 B;  1UF0 A;  2DNF A;  2K1F A;  1I4G A;  1E10 A;  3HM3 A;  1UBQ A;  2L8J A;  4P6V F;  3RYT A;  1L6U A;  2ON8 A;  1WXS A;  3KUC B;  4KVG B;  4LK0 M;  3N1X C;  3BWU D;  3C19 A;  3T8M A;  3PSE B;  4HEA 1;  4FLH A;  2WGS A;  3UF8 A;  2L76 A;  1UD7 A;  2KOX A;  2W54 A;  4KGT A;  1WRD B;  3H7P A;  3RNG C;  1VJK A;  4PS8 A;  4ZRI A;  3P4S B;  2QJL A;  4WIP A;  2GBJ A;  3V61 A;  4HLE A;  2WXR A;  1L6V A;  4US9 A;  4HKZ E;  1DOY A;  3WAO A;  2BYV E;  2WYQ A;  4IW0 A;  4RCO A;  1I35 A;  2EEL A;  2Z0E B;  2N7E A;  3ZJT A;  1VZ6 A;  3Q3N C;  4MSQ B;  4BFR A;  5HKH A;  1HEZ E;  2G4D B;  2PVO D;  3BYT B;  4PS3 A;  4F8C B;  1SSN A;  3OLM D;  2C7M B;  4B9K A;  4PS7 A;  2HTM E;  4XX5 A;  1ZOY B;  1YMH E;  2M0A A;  1RM6 C;  2RSU A;  5D7G A;  2LJ5 A;  1L0X B;  2DYB A;  3V62 A;  1LQB A;  5BO4 B;  3TMP B;  1WE7 A;  1UGM A;  2M56 B;  1WI0 A;  2DX5 B;  2C5L C;  1BUI C;  2PMV A;  4MGI E;  2NBW B;  2AWT A;  1FRD A;  5D6J B;  4GXB A;  4G3X B;  4WJO A;  3TSS A;  2N7J A;  1J7A A;  4XDC A;  4FAD A;  1QKZ A;  1K50 A;  1GJZ A;  2FAZ A;  4ZHO A;  2QHO A;  1LO5 D;  1YQ4 B;  1XLQ A;  3X0W A;  2K22 A;  4FHK A;  4YXD B;  4MSM B;  2K3U A;  3KLS X;  4JGH B;  3B0A A;  5JHA A;  2IBI B;  3W5V B;  4YSY B;  1J7B A;  3U2S C;  1J19 A;  4OW0 A;  1UZX B;  4DBG A;  1LM8 B;  3A4S C;  1TGZ B;  1FO4 A;  3VUW A;  2D3C A;  2BS3 B;  3QA8 A;  2KJH B;  1SIJ A;  2K39 A;  2Z59 B;  2LUE A;  1VZ7 A;  2RDB C;  1E8X A;  4IM3 A;  3FAH A;  4G11 A;  2K9X A;  4AWJ A;  1TS5 A;  3QWZ B;  4ANV A;  3V60 A;  4M02 A;  4ZHP A;  2PTL A;  3VTW A;  2BYF A;  1WFY A;  2LI5 A;  2UYZ B;  4OVV A;  4RF1 A;  2N9P C;  1OEY A;  3BYY B;  1OFF A;  2QDF A;  4DHZ E;  1WGG A;  4IUM B;  3ZLZ A;  1TJE A;  2BB6 A;  4MH8 A;  1IYF A;  1WXV A;  3TCA A;  2B3A A;  3PHW B;  1CK1 A;  3I63 C;  4KZ0 A;  2JU6 X;  2WXI A;  1PUT A;  2NBU A;  2V3N A;  1KLU D;  3NS8 A;  5IN7 A;  3W9C B;  3DVN V;  3OJ3 A;  1SE2 A;  3TEY A;  4DHJ B;  3TUO A;  2IYD B;  1KM7 A;  1XLN A;  2GB1 A;  2KJR A;  4TMA B;  1C3T A;  4HKQ A;  4IOI E;  1WR1 A;  3PRZ A;  2QEJ C;  4FUL A;  2K6D B;  4AJY B;  3APD A;  2LVP A;  3DBH I;  3V3X A;  2DAJ A;  4S0R A;  2JQR B;  3DHG C;  2QSD A;  2PKO A;  2RPV A;  2BBC A;  4BOS C;  2CJO A;  1Q5W B;  5G2N A;  1YJ1 A;  4W9G A;  1SBB B;  1WWT A;  4K3C A;  3CMM B;  4HWI B;  1YQ3 B;  1NYQ A;  2CS4 A;  3MHS D;  3ZDT A;  5MPO A;  3B9J A;  1KLG D;  2JF5 A;  1WRI A;  3PO0 A;  5CHV C;  4RMA A;  2MW5 A;  4RF0 A;  1HA5 A;  4F1S A;  2NR2 A;  3Q3O C;  4HPM B;  3DHH C;  3AH7 A;  4JQW C;  4N9F 4;  3PRP B;  4WWN A;  2QMT A;  5DPR A;  1ZKH A;  3V6E B;  4PK1 A;  4W9D A;  1TTN A;  3NVY A;  2MX2 A;  4MGZ E;  4EEW A;  4MJS B;  4RH6 A;  2O6V A;  2WQY B;  3AI5 A;  2KHW B;  3U7Z A;  5HI1 A;  3MC8 A;  3KYD D;  2DLB A;  1I4X A;  1HE8 A;  4GB9 A;  3ZW3 A;  2R2O A;  3R7Q A;  1E90 A;  2JWU A;  2LGS A;  2BYT A;  5G5G A;  4MT5 A;  1K51 A;  4DXA B;  4WWO A;  3LXF A;  2TSS A;  3A4R A;  1MI0 A;  2MRP A;  2V1Y A;  4BBN C;  2RD0 A;  2W3S A;  4WAA A;  3HHM A;  3PLU A;  1WJN A;  1S1Q B;  1ESF A;  2WDV B;  4J3O D;  3CWI A;  1VRA B;  4MJS A;  4UDU C;  4N6E B;  4WWP A;  2FUH B;  2NTS A;  4HJG E;  4E71 A;  3ABV B;  4EUT A;  4KSL C;  1VCB A;  4JX1 C;  3KW5 B;  2V9H A;  4OZA A;  3IAM 1;  2I1K A;  3I3T B;  1ZPS A;  4DXF A;  4AQ7 A;  1L4D B;  2C60 A;  2Z8L A;  1UGJ A;  1P7E A;  1BXT A;  1WM2 A;  4JE3 B;  3N1Z C;  4GLS C;  2JX5 A;  1SJE D;  2JUO A;  3UIP B;  2CR5 A;  3EFC A;  4DHZ B;  1CMX B;  5IOI A;  3AE6 B;  2K5P A;  1MVK A;  2WS3 B;  1WY8 A;  2J0M A;  2L00 B;  1XLO A;  1KH0 A;  1D5X C;  1EF1 A;  3JYU A;  2NMQ A;  4NNJ B;  3AE3 B;  4B0M A;  3PTF C;  1E7V A;  4HRS A;  1Y56 A;  4GOC A;  2MJE A;  4GDK B;  3ALB A;  2XEW A;  4L2Y A;  4LDT D;  1V97 A;  5H92 C;  1RFK A;  3AEB B;  1MG4 A;  1EU3 A;  1WX9 A;  4A3O A;  1QOF A;  5EE0 A;  4MAC A;  3BIN A;  3H6N A;  3U4E G;  3GE8 C;  3DBR B;  4ITK A;  4TUU A;  2JY6 A;  2DZJ A;  4A6Q A;  4G0N B;  3BY4 B;  4AOF A;  1FCL A;  2V4I B;  2PPH A;  3KUD B;  2JZP A;  1SE3 A;  2G3Q B;  3AEA B;  1T3Q A;  4AS1 A;  1GOZ A;  5BMG A;  1E7P B;  3DWM A;  2JZ3 B;  1JWM D;  4ARI A;  5BYS A;  1C9F A;  4GDK A;  5J2R A;  1SJH D;  1Q10 A;  3EUB 2;  3O13 A;  3AU4 A;  2V0G A;  3KWV A;  1P9D U;  1SEB D;  3A9K B;  1RRB A;  3QIJ A;  4ZRP A;  1Z5S B;  4OVU A;  4M00 A;  5E6O A;  3PGE A;  4IC7 B;  5HFY A;  2RR9 A;  2PJH A;  2WXL A;  3P4Q B;  2MEK A;  4GSW A;  3Q14 C;  1YN3 A;  4HDQ A;  3R3M A;  2MQJ A;  4MH0 E;  2BS2 B;  5FR6 A;  4GU2 A;  2J7Q B;  4JPS A;  3QAQ A;  3KVF B;  4US8 A;  5CHW A;  1FNW A;  2R61 A;  1TBE A;  2A5U A;  2OOB B;  1Q0W B;  4K3B A;  1XF5 L;  4M8M A;  3UQB A;  3VUY A;  4W9J A;  2JVC A;  3ZGZ A;  3Q69 A;  2L52 A;  3L13 A;  2L0F A;  3N9Y C;  3Q8A A;  4M0W B;  4TV3 A;  2XK5 B;  3A9K A;  1V49 A;  5DPS A;  3ZXR A;  2GOW A;  2JWZ A;  2SEB D;  1FFV A;  1E0Z A;  1MJD A;  1NI2 A;  4ZRK A;  4ICU A;  1V1P B;  4K81 A;  1MHX A;  4MM3 A;  3Q8E A;  1WMH B;  4YTM B;  4WJP A;  4ZYS A;  3MJW A;  1I42 A;  1UNS A;  5AUK A;  2ZCC A;  3V6C B;  4FJY A;  1P7F A;  2BVC A;  4EZL A;  5LXH A;  4FJZ A;  3P2B A;  5DCN A;  3ML9 A;  1NBF C;  3AB5 A;  3N1Y C;  2M1M A;  5TSS A;  3ZDM C;  3N30 A;  1WF9 A;  4BAX A;  3MC0 B;  3D32 A;  3RPF C;  1TYG B;  2HDE A;  3MFG A;  4M0W A;  2IPK D;  3NZS A;  2XK5 A;  2BGF A;  3URY A;  2M4N A;  2AQ2 B;  1AYF A;  3PZD A;  2VZK B;  5KHQ A;  1CQV A;  4XGA B;  1WGK A;  5CHF A;  3MP9 A;  4LJO B;  1WMH A;  3H7S A;  2E6X A;  5CTR C;  1EWC A;  3CIR B;  4L1B A;  3VTV A;  1GC7 A;  1E5W A;  2KQ4 X;  3I57 A;  3LYY A;  1F2R I;  1XT9 B;  3EGR A;  3W1Y A;  2WNM A;  1P0R A;  1C4P A;  3TBL D;  1L0Y B;  1ZE3 D;  3M62 B;  4O1N A;  1PQS A;  5KHO A;  3OG5 A;  3NJT A;  1B9R A;  4K7S A;  4RFB A;  1AN8 A;  2DZI A;  2G9H D;  1C78 A;  1M94 A;  2K8C A;  3K9P B;  3ZIM A;  2DWQ A;  3A9J B;  1D5Z C;  3HRD D;  3RT3 B;  3U8Z A;  4BZA A;  2H88 B;  2KWC A;  1L0V B;  3RD2 A;  3TL5 A;  1P3Q U;  2D11 A;  4KV2 A;  4XC2 A;  1TIF A;  5AZF A;  4H2A A;  1V81 A;  4L23 A;  1QIL A;  3AN1 A;  3VRA B;  2IGD A;  1N62 A;  3ML8 A;  2CHX A;  1KF6 B;  1MPE A;  2BF8 B;  4FXC A;  3GS2 A;  4JIO U;  4URK A;  1YN5 A;  4LDT B;  1EO6 A; 
#chains in the Genus database with same CATH homology
 2D07 B;  1YQB A;  3ZKJ C;  3DVN V;  3L54 A;  1WX8 A;  3L17 A;  3OJ3 A;  4TQ0 A;  5J17 A;  3DVG X;  2LGY A;  3LDZ E;  2KLC A;  2D10 A;  3A9J A;  4MDK E;  4DHJ B;  3CSF A;  3DOW A;  3DBR I;  2IYD B;  1KM7 A;  3A33 B;  1WJ6 A;  3HK0 A;  3DDC B;  1WXA A;  2LGD A;  3NZU A;  2KJR A;  4K7W A;  1C3T A;  4FN2 A;  4ICV A;  1IYF A;  3CF6 E;  2Y5B B;  3R66 C;  5E6P A;  1WR1 A;  1WJU A;  3PPA A;  3H9D A;  2K25 A;  2WX1 A;  3NY5 A;  3PRZ A;  4P7I A;  2YLM A;  3Q3F A;  3QJZ A;  3CST A;  3SHQ A;  3HIZ A;  3L08 A;  3N32 A;  4FUL A;  2K6D B;  4GN1 A;  4CO7 A;  2VRR B;  3JSV B;  3RUL A;  1WX7 A;  3ZNZ B;  1G6J A;  4AJY B;  2FIF A;  2GBK A;  3APD A;  3UIN B;  2LVP A;  1SGH A;  3DBH I;  2KJ6 A;  1V5O A;  4IM2 A;  2ASQ A;  2KFK B;  3WAN A;  2LVO A;  3DPD A;  4EZK A;  2DAJ A;  2G4S A;  4K7U A;  1F9J A;  2KTF A;  1RLF A;  3M3J A;  4MGK E;  4BOS C;  1VD2 A;  3IG3 A;  1Q5W B;  5G2N A;  2FCQ A;  4GDL B;  1YJ1 A;  4W9G A;  4LCD E;  4ZYN A;  4BKS D;  1WGY A;  2KMC A;  4NQL B;  3CMM B;  3ECI A;  4W9E A;  1A5R A;  4TQ1 A;  1IPG A;  3EEC A;  4HWI B;  2CS4 A;  1WJ4 A;  3MHS D;  1P1A A;  2J0K A;  3ZDT A;  3A1Q B;  3DQV A;  3IHP C;  4W9F A;  1Y8R C;  1WE6 A;  3QQ8 B;  2JF5 A;  1UBI A;  3SD5 A;  1YX5 B;  2MBB B;  2PE6 B;  1JRU A;  5CHV C;  4RMA A;  3QCA A;  2LXA A;  3U7D A;  2MW5 A;  4EOY A;  3ZO5 B;  1GNU A;  2C9W B;  2N7D A;  4F1S A;  4KZC A;  2JZZ A;  2KAN A;  2M8S A;  3S2A A;  3WAP A;  2K8H A;  4RM8 A;  5JH5 C;  2KQ7 A;  2NR2 A;  3QC8 B;  5D94 A;  2MP2 B;  4HPM B;  1WYW B;  2XBB C;  4JQW C;  2KD0 A;  4N9F 4;  3PRP B;  2NCN A;  4WWN A;  4ZDV A;  5DPR A;  1ZKH A;  4W9K A;  3AUL A;  3V6E B;  3DVN U;  2LRU A;  4II2 B;  4W9D A;  1TTN A;  1QZE A;  2MX2 A;  3IFW B;  3VVW B;  4FBJ B;  4MGZ E;  4EEW A;  4MJS B;  3VHT C;  2O6V A;  2LRW A;  5TR5 A;  5JHB A;  1NDD A;  3AI5 A;  2KC2 A;  2KHW B;  3A1Q A;  4HXD A;  4II3 B;  1WXM A;  4M8N A;  3N3K B;  3KYD D;  2KX0 A;  3EC8 A;  4WJQ A;  2JXX A;  4I6L B;  1HE8 A;  4GB9 A;  5CX3 A;  3SDL C;  3ZW3 A;  3DBS A;  2R2O A;  4NPN A;  2MBH A;  3VUX A;  3DCG A;  3R7Q A;  3W1S A;  1FXT B;  3T9L A;  1E90 A;  3JW0 X;  4WJN A;  1KOT A;  1WZ0 A;  4DXA B;  4AP4 C;  4WWO A;  2RGF A;  4DK5 A;  2WWZ A;  2L3Z A;  3Q3J A;  2GBN A;  2BKF A;  2O6V D;  2GMI C;  1E7U A;  1ZGU B;  2FCM A;  3PHX B;  3A4R A;  1ZW7 A;  2MRP A;  1UEL A;  3L0W B;  2V1Y A;  3APF A;  2MP2 A;  3VDZ A;  4A3P A;  4BBN C;  2NS5 A;  2RD0 A;  4HPL B;  3WAM A;  3QHT A;  5E6N A;  1WGD A;  2CHW A;  2NVU I;  4WAA A;  3HHM A;  1WIA A;  3PLU A;  2N1W A;  1WJN A;  4B6W A;  3NHE B;  1S1Q B;  4EKU A;  2HJ8 A;  3KUZ A;  1EUV B;  3M63 B;  2ZCB A;  3PLV A;  3O65 B;  4MJS A;  4KDL B;  2N9E B;  3GOE A;  4WWP A;  2D3G A;  2FUH B;  4W9I A;  2JRH A;  4E71 A;  3QX1 A;  2EMS A;  1E8W A;  1P98 A;  4GIV A;  4EUT A;  3ENE A;  4KSL C;  1VCB A;  2FCS A;  4TKN A;  1WGH A;  1GC6 A;  2OJR A;  2KX3 A;  4KSK C;  2G45 B;  3KW5 B;  2LWP A;  4IWQ A;  2MBE A;  4IWP A;  4NAW B;  4ANX A;  2R2Q A;  3LJ3 A;  2I1K A;  3I3T B;  1GUA B;  1AAR A;  3ZUN A;  2ZNV C;  5GMV A;  2ZPY A;  4MEM A;  2LGX A;  2C60 A;  1TZ1 A;  2AL6 A;  2IO2 B;  2WDT B;  4ZRJ A;  3EHV A;  1BT0 A;  5D2M B;  3ZVV A;  5L83 A;  1RFA A;  2CKH B;  4WQO B;  1WM2 A;  1WZ3 A;  5DPW A;  2MSE D;  4MEL A;  2PEA A;  3PVL A;  1V80 A;  2JUO A;  3UIP B;  2CR5 A;  3UQA A;  4DHZ B;  1D3Z A;  1CMX B;  2DZM A;  1H4R A;  3ZNG C;  4E74 A;  2KKC A;  2KDE B;  4K1R B;  3VAW A;  2AEH A;  2BYE A;  2ZEQ A;  2MCN B;  1WY8 A;  2J0M A;  2FID A;  2L00 B;  1YX6 B;  3PT2 B;  3ZNH B;  3HM6 X;  2UWQ A;  2DHZ A;  3QAR A;  2NPT B;  1EF1 A;  3JYU A;  1RAX A;  4NNJ B;  3OAW A;  3UGB B;  2KDI A;  4PYZ A;  1ISN A;  4KIK B;  2AYO B;  4FJV B;  2KXJ A;  2K8B A;  3PTF C;  3MTN B;  5LXI B;  1E7V A;  4GOC A;  2MBQ A;  4GDK B;  5J18 A;  3ALB A;  5LLI A;  4IM0 A;  4NAW A;  2MA9 B;  2XEW A;  1WGR A;  1E8Y A;  2O2V B;  2C7N B;  4RM9 A;  1SE9 A;  3VTU A;  4LDT D;  2L7R A;  2MLB A;  3RCZ A;  1WR6 E;  2BWE S;  3UIO B;  2GBM A;  3QK0 A;  3JSV A;  3SU8 X;  3H7P B;  1WX9 A;  2MBO A;  2ZVO A;  4A3O A;  1XD3 B;  4IWO A;  2IY1 B;  1V9J A;  2JT4 B;  3BIN A;  3H6N A;  4HVB A;  4DHJ D;  3KYC D;  2KFK A;  4TUU A;  2JY6 A;  2KN5 A;  2DZJ A;  4G0N B;  3K9O B;  3WIM A;  2M17 A;  2BWF A;  3BY4 B;  1SIF A;  3RUI B;  4AOF A;  4FA6 A;  2KNB A;  4IG7 B;  3H1U A;  1L2N A;  2JPH A;  4X57 B;  2L05 A;  2PPH A;  5L95 C;  2K1F A;  1OEY J;  3KUD B;  3PRM B;  4GDL A;  2G3Q B;  2NPT A;  4HDO A;  1L7Y A;  2KMA A;  3HM3 A;  1UBQ A;  2L8J A;  2LD9 A;  2LAS A;  3RYT A;  4KVG B;  1WXS A;  3KUC B;  2JZ3 B;  4NQK E;  3PV1 A;  2A4Z A;  3VQI A;  2M0X A;  4GDK A;  3T8M A;  5J2R A;  3PSE B;  2N4F A;  4FLH A;  3ZNI D;  2CHZ A;  2O2V A;  1V2Y A;  3UF8 A;  2V3S A;  4XZ4 A;  3AU4 A;  1UH6 A;  2L76 A;  1UD7 A;  2KOX A;  1P9D U;  3A9K B;  1RRB A;  4DDI D;  1WRD B;  2KC1 A;  3H7P A;  3QIJ A;  4I6N B;  4PS8 A;  4ZRI A;  1Z5S B;  4OVU A;  3EFU A;  1OTR B;  5E6O A;  4HK2 A;  3PGE A;  2GBJ A;  1GG3 A;  4IC7 B;  3V61 A;  3DVG Y;  2RR9 A;  2IO0 B;  2PJH A;  4HLE A;  4GSW A;  1EF5 A;  1T0Y A;  4HDQ A;  3R3M A;  2L0T A;  2MQJ A;  4MH0 E;  5FR6 A;  3W1S C;  3WAO A;  2BYV E;  2WYQ A;  4IW0 A;  4GU2 A;  2J7Q B;  4JLC A;  1YIW A;  5AZH A;  3AU5 A;  3L10 B;  1I35 A;  3QAQ A;  2Z0E B;  3KVF B;  1J8C A;  4W9L A;  2N7E A;  5CHW A;  1TBE A;  2A5U A;  2OOB B;  1Q0W B;  2DAF A;  2IY0 B;  2KQS A;  4BFR A;  4MSQ B;  5HKH A;  1Z2M A;  3RZW C;  2G4D B;  2IO1 B;  4PS3 A;  4M8M A;  2ZJD A;  3UQB A;  4F8C B;  3VUY A;  4W9J A;  2JVC A;  3OLM D;  2C7M B;  4LJP B;  3TIX A;  4B9K A;  4PS7 A;  4NJ7 A;  4XX5 A;  3L13 A;  3RZF A;  2L0F A;  1R4M I;  2DZK A;  2CU1 A;  4M0W B;  4TV3 A;  4FHJ A;  2XK5 B;  2V4L A;  2RSU A;  3A9K A;  1V49 A;  2NBV B;  2LJ5 A;  2GOW A;  2JWZ A;  5D7G A;  5DPS A;  2REX A;  4CHK A;  3AXC A;  2DYB A;  1NI2 A;  1E8Z A;  4ZRK A;  3V62 A;  4ANW A;  1LQB A;  2N9X A;  1LFD A;  3B08 A;  4W9C A;  5BO4 B;  3TMP B;  4ICU A;  1WE7 A;  3M95 A;  4GMV A;  4J6I A;  1UGM A;  2J0J A;  4AUQ C;  1WI0 A;  2DX5 B;  4JL9 A;  4K81 A;  2C5L C;  4PYU A;  3ONS A;  4MM3 A;  2NBW B;  4MGI E;  1WMH B;  3PRE A;  2N1V A;  3MJW A;  2AWT A;  3NOB A;  4WJP A;  1I42 A;  5D6J B;  2ZCC A;  3V6C B;  4GXB A;  4BKS A;  4HCN B;  4G3X B;  4WJO A;  3X23 A;  2LZ6 A;  4FJY A;  4A20 A;  4FAD A;  4I6P A;  4EZL A;  5LXH A;  1H8C A;  4FJZ A;  3P2B A;  1GJZ A;  5DCN A;  3ML9 A;  1K8R B;  1NBF C;  5DPT A;  2FAZ A;  2M1M A;  3ZDM C;  4HJK A;  3B1L X;  2ZPN A;  4NY0 A;  2QHO A;  4GGQ A;  1V86 A;  2FCN A;  3N30 A;  4BKG A;  1WF9 A;  3X0W A;  3JVZ X;  3ZRC A;  2AL3 A;  4FHK A;  4G50 A;  3VH4 B;  2KZR A;  2KDF B;  3D32 A;  2KWU B;  4AJW A;  4MSM B;  3NZS A;  2XK5 A;  2BGF A;  4JGH B;  4YL8 A;  4F7Z A;  2KVR A;  5IAA C;  3B0A A;  3IVF A;  2M4N A;  2KTR B;  2EKE C;  2HD5 B;  2IBI B;  2O6V B;  5JHA A;  3VXW A;  3ZTD A;  3WAL A;  3OJ4 B;  3PZD A;  4BVU C;  1S3S G;  2PE9 A;  5AEK B;  5C1Z A;  1J19 A;  1Q1O A;  3C0R B;  5KHQ A;  1UZX B;  3IBE A;  4DBG A;  1LM8 B;  5CHF A;  2HTH A;  3A4S C;  2JRI B;  4LJO B;  4NJ6 A;  4EFO A;  1TGZ B;  1WMH A;  3H7S A;  5C23 A;  3VUW A;  2HE7 A;  5CTR C;  3VTV A;  1IP9 A;  1GC7 A;  2YVC A;  3KH0 A;  1E5W A;  3QA8 A;  5EDS A;  2KJH B;  3VH3 B;  3DBL I;  2K39 A;  2KK8 A;  2Z59 B;  1LXD A;  2LUE A;  1XT9 B;  3W1Y A;  4KIK A;  2IZV B;  1P0R A;  3TBL D;  2MWS B;  4CYE A;  4DWF A;  3VFK A;  4HCP B;  3PS6 A;  3M62 B;  1E8X A;  4BOZ B;  1XQQ A;  4IM3 A;  1V6E A;  1PQS A;  2DYO A;  3ZRF A;  2KO3 A;  1WM3 A;  5KHO A;  4G11 A;  4W9H A;  4AWJ A;  3GZN I;  2DEN B;  1MG8 A;  2ZNV B;  3QWZ B;  4K7S A;  4ANV A;  4BBN F;  1X1M A;  3V60 A;  4E3C A;  2DZI A;  2ZVN A;  4BKT A;  3VTW A;  1M94 A;  2BYF A;  2K8C A;  3APC A;  3K9P B;  3TJP A;  3WA0 A;  3ZIM A;  2RPQ A;  4ANU A;  1KLV A;  3A9J B;  2GBR A;  2KTR A;  2W9N A;  4EZJ A;  3RT3 B;  1WFY A;  2LI5 A;  2UYZ B;  3U8Z A;  4OVV A;  2FNJ B;  2KFJ A;  2N9P C;  1KJT A;  1R4N I;  3ZTC A;  1OEY A;  1YD8 U;  2KWC A;  5G55 A;  2I1J A;  2LXC A;  3RD2 A;  3TL5 A;  1P3Q U;  2D11 A;  4KV2 A;  4DHZ E;  2KWV B;  4XC2 A;  1V5T A;  1WGG A;  1C1Y B;  4IUM B;  5AZF A;  1OQY A;  4MGY E;  2KLG A;  2KDB A;  2BKR B;  3ZLZ A;  1J0G A;  1V81 A;  2IO3 B;  2D2Q A;  2C7H A;  2K6Q A;  1WXV A;  3R7R A;  2BPS A;  2LVQ A;  3ML8 A;  3TCA A;  2CHX A;  4B95 A;  2B3A A;  3PHW B;  4DDG D;  5IA7 A;  2Z0D B;  2BF8 B;  2ZZP B;  1WH3 A;  1OGW A;  2WX0 A;  5AZG A;  4KZ0 A;  5JZE B;  4KDI C;  2DYM A;  2EMT A;  3U30 A;  2NBU A;  1U4A A;  3L16 A;  4ASW C;  4JIO U;  4URK A;  4LDT B;  3NS8 A;  1EO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...