1LM8B

Structure of a hif-1a-pvhl-elonginb-elonginc complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELONGIN B
publication title Structure of an HIF-1alpha -pVHL complex: hydroxyproline recognition in signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 28
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2002-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1lm8B00
5LLIA 3QJZA 5E6PA 2MP2B 2LRWA 3O65B 1WX9A 3ECIA 2JY6A 2KWCA 2L76A 3LDZE 1TGZB 1WR6E 2L05A 2K25A 3VVWB 3DBRI 2KDFB 2LGDA 4BKSD 2KQ7A 3ZDMC 3IG3A 2Z0EB 4DWFA 2MBOA 2YLMA 2K6QA 1EUVB 4TQ0A 2ZPNA 3DOWA 3H7SA 1V2YA 3PHXB 2Z59B 4ZRIA 1QZEA 2GOWA 3EHVA 4KDLB 1YIWA 4GGQA 3M63B 3PPAA 2DX5B 4EZKA 1RAXA 3AXCA 4NJ6A 2KJRA 2LD9A 3TJPA 2C9WB 2I1KA 3ENEA 3U30A 4AOFA 2UYZB 3PT2B 2PE9A 2R2QA 2ZJDA 4BOSC 1OGWA 1HE8A 2A5UA 2C60A 4MGZE 2MQJA 2M4NA 2FCNA 4ASWC 4XZ4A 3VDZA 3V6EB 2IY0B 3V6CB 1P9DU 2DYOA 3OJ3A 1F9JA 2LASA 4GXBA 4PS7A 2VRRB 2LVQA 3S2AA 3WAMA 4ANXA 4IWOA 3R66C 3K9PB 4RMAA 2KOXA 1E8WA 3PZDA 2KFJA 2NVUI 2WWZA 4A20A 2LGXA 1RRBA 2FCQA 2NBWB 2DYBA 1LM8B 1D3ZA 2CHXA 2ZEQA 2MBBB 1EF1A 3ALBA 5J17A 4GIVA 2N1WA 3WA0A 4YL8A 3U7DA 1EF5A 3N32A 3QIJA 2NPTA 1ZW7A 4OVVA 3UIPB 4BBNC 1A5RA 4FJZA 3RD2A 3APFA 4TV3A 3UQBA 4EZJA 1M94A 3KYCD 2GBKA 1LXDA 4E3CA 2CS4A 4I6PA 2BYEA 1E5WA 4DHZE 4LCDE 2N4FA 2WDTB 4ICUA 2RD0A 2NPTB 4MSMB 2KLGA 3CSFA 3PLUA 2BKRB 4MELA 1PQSA 3HHMA 4KDIC 4A3OA 3ZNGC 2GBRA 1AARA 3SU8X 2KFKA 2AYOB 1WX7A 3PS6A 3M95A 2C5LC 2MBHA 2MBEA 4FN2A 1OTRB 5IAAC 2J0MA 2KFKB 2WYQA 5E6NA 3WAPA 2O2VA 1OEYJ 2KJHB 4HDQA 3ZLZA 3QHTA 1WMHA 3X23A 1UBIA 4E71A 3IBEA 4ZDVA 4I6LB 3NS8A 3GOEA 2CHZA 2EMTA 2IO0B 4HCPB 3N30A 2Z0DB 4MGKE 3RULA 3V62A 4BVUC 1VD2A 1Y8RC 2MLBA 4W9LA 1WMHB 2JXXA 4JGHB 5GMVA 1WR1A 5TR5A 3VQIA 4AUQC 4KZCA 3SDLC 2JT4B 2N7EA 4KIKA 3DVNV 2XEWA 2GMIC 3AU5A 2G3QB 3KYDD 4NJ7A 2DENB 2CHWA 2XK5A 2GBMA 4G0NB 1WGHA 3VTWA 3PGEA 2I1JA 4ANUA 1OEYA 1WJNA 4KIKB 1UGMA 3RZFA 1I35A 4HCNB 2KXJA 5J18A 2NS5A 4M8NA 1VCBA 2BGFA 1NDDA 2NBVB 3KVFB 1WXVA 2HJ8A 4WJQA 4MGIE 3NZUA 4W9EA 3RUIB 4JLCA 1GG3A 3T8MA 3WANA 2K39A 4FHKA 2MRPA 1SIFA 3ZW3A 2KDIA 4AJWA 4B9KA 4HVBA 5AEKB 2KZRA 2ZNVC 3Q3JA 3UGBB 5D7GA 1ZKHA 3NOBA 4JL9A 2ZVNA 4EFOA 1WY8A 5CHVC 2K1FA 3QCAA 4KZ0A 3X0WA 2KHWB 1E7UA 3A9JA 1UH6A 5DPTA 1V81A 2D2QA 2KK8A 1UBQA 2KDEB 2EKEC 2C7NB 3DCGA 3L54A 2DZJA 1SGHA 2KLCA 2IZVB 2L3ZA 2MW5A 3PRPB 3A9JB 1WF9A 4WJPA 1WJ6A 3ZKJC 5EDSA 3L17A 2AL6A 4GOCA 2AWTA 3EFUA 3A9KA 3KW5B 1L2NA 1P98A 3RZWC 2RPQA 4WAAA 1UD7A 2L00B 4IG7B 2FNJB 4FBJB 2JVCA 1WGRA 2K8HA 4W9GA 2AEHA 5LXHA 3CMMB 1CMXB 3A9KB 4IUMB 4DDID 4IWQA 2QHOA 3ML9A 4PYUA 4GSWA 3RYTA 2PJHA 3GZNI 1WJ4A 2PEAA 1R4NI 2D07B 3QQ8B 4MJSA 2KANA 2KVRA 1UELA 4KSLC 2G4DB 4NAWA 4IW0A 4E74A 1EO6A 1TTNA 2DHZA 1UZXB 4F7ZA 4BKGA 2CKHB 3TIXA 1WM3A 4ICVA 3W1SA 1XT9B 3HM3A 3H6NA 4I6NB 4EEWA 3M3JA 4NAWB 3UINB 2DZIA 3H1UA 3U8ZA 3VUWA 1WFYA 2BYFA 4WJNA 3DVGX 5CTRC 1IP9A 3PRMB 2AL3A 1V49A 4NY0A 4CYEA 4IM2A 3VTUA 1U4AA 3DQVA 2BF8B 3VUXA 3OJ4B 1Z2MA 4EUTA 2KX3A 4MM3A 3W1YA 1T0YA 2V1YA 3ZNHB 4NNJB 2LGYA 4AWJA 2PE6B 3PV1A 1P0RA 1WJUA 2M17A 3B0AA 2A4ZA 1KM7A 2IO2B 4ZRKA 3L13A 2BKFA 1ZGUB 3ZDTA 1NBFC 2M8SA 3MHSD 4MGYE 1YX5B 2D11A 5KHOA 2WX1A 3V61A 3ZRFA 1IPGA 1I42A 4II2B 3JW0X 2KNBA 3BY4B 5DCNA 2BYVE 1H8CA 1V86A 4GDLA 3LJ3A 1V5TA 2JRHA 3DVNU 2KKCA 4JQWC 1RLFA 4AJYB 4K7WA 5DPRA 2K8BA 1WM2A 2JUOA 1E7VA 4OVUA 4BBNF 4LJPB 4GDLB 1LQBA 2J7QB 1C3TA 2CU1A 1E8XA 3VFKA 4FA6A 4MSQB 3QX1A 2O2VB 3OAWA 4LJOB 4W9CA 4ZYNA 4AP4C 2N9EB 5JHBA 2NCNA 4PS8A 1E8YA 2C7MB 2O6VA 4F1SA 2XBBC 4K7UA 5J2RA 3AI5A 3VTVA 4K81A 4A3PA 3PREA 2DYMA 3H7PA 5DPWA 3ZNZB 2KN5A 3N3KB 5CHWA 2O6VB 2LWPA 1GC7A 4HDOA 2L8JA 1YJ1A 2MA9B 3Q3FA 4EKUA 5C1ZA 2LVOA 2IY1B 4W9HA 3H7PB 1JRUA 2XK5B 2G45B 3A4RA 3ONSA 3NY5A 4MDKE 2LVPA 5L83A 1ISNA 2JPHA 5FR6A 3TBLD 2DZMA 1WZ3A 3PSEB 2BPSA 2MSED 4GDKA 5HKHA 1WYWB 2DAFA 2N9PC 1C1YB 2KWUB 1TBEA 3ZUNA 4IC7B 4GDKB 1KLVA 4KVGB 3AULA 3BINA 3OLMD 2O6VD 3HM6X 4K7SA 3D32A 2N9XA 3R7RA 4DXAB 2REXA 4KSKC 4HJKA 1K8RB 2WX0A 4DHJB 4LDTB 4M8MA 5DPSA 5JZEB 2IBIB 3VAWA 1E90A 3QARA 5AZGA 2G4SA 3VHTC 1V80A 4KV2A 3WALA 2JZZA 3APDA 5BO4B 2L0FA 3A1QA 3P2BA 2KMAA 4N9F4 1KJTA 2OJRA 4DHZB 2MWSB 4FHJA 3L08A 1Q1OA 2HE7A 3T9LA 2DZKA 2D10A 3KUZA 3PLVA 2KTRA 1GJZA 4EOYA 2KTFA 5JHAA 2YVCA 4NPNA 3VH4B 2JRIB 2EMSA 1MG8A 2KTRB 2ASQA 2MBQA 3JYUA 3NZSA 4IM3A 4W9JA 5C23A 3PVLA 4W9IA 4DHJD 4LDTD 2V4LA 4FADA 1GUAB 2BWES 1Q5WB 3R3MA 1S3SG 2KD0A 4URKA 5AZFA 2KMCA 2LXAA 4IM0A 4TQ1A 3AU4A 2J0JA 4G50A 2JWZA 1P1AA 1WE6A 3R7QA 3SHQA 2ZNVB 5D2MB 2IO3B 2CR5A 2MX2A 4TKNA 3HK0A 4WWNA 4DBGA 3QA8A 4HPMB 4FLHA 4MJSB 1WI0A 4WQOB 3TMPB 1R4MI 5D94A 5KHQA 3WIMA 4CHKA 3PHWB 1TZ1A 2JF5A 2K6DB 4X57B 2K8CA 2M1MA 4HWIB 1E8ZA 3QC8B 4G3XB 2KX0A 3V60A 3EC8A 4M0WB 4WJOA 4HK2A 1BT0A 2D3GA 2LXCA 1V6EA 1XQQA 3JVZX 4GMVA 2ZZPB 4W9FA 3MJWA 2RGFA 3ZIMA 2FAZA 1OQYA 2FUHB 2W9NA 1J0GA 3JSVA 3DBHI 3APCA 2HD5B 2UWQA 2PPHA 3HIZA 4GN1A 3UIOB 2KJ6A 1YD8U 3WAOA 1WRDB 3JSVB 3K9OB 4WWOA 2ZCBA 2ZCCA 3KUCB 1WGGA 4RM8A 4XC2A 1WGDA 3DPDA 3PTFC 3PRZA 4ZRJA 5D6JB 3I3TB 1X1MA 2L0TA 3KH0A 4ANWA 3ZO5B 1WX8A 5G2NA 1L7YA 1RFAA 2Y5BB 2GBNA 1NI2A 4DK5A 2ZPYA 3VUYA 3ZRCA 4PYZA 4EZLA 5IA7A 1WXMA 2NR2A 4TUUA 2BWFA 2L7RA 2LI5A 3ZTDA 3NHEB 4W9KA 1J19A 5E6OA 2IO1B 4GB9A 3C0RB 3IHPC 4CO7A 3IFWB 2KC1A 1Z5SB 4RM9A 2KQSA 3CSTA 4HPLB 1WXAA 1P3QU 4MEMA 2LZ6A 3ZTCA 4ANVA 5CX3A 4DDGD 2HTHA 3L16A 3QWZB 4FJYA 1FXTB 1WGYA 2KWVB 2ZVOA 4B6WA 1WZ0A 2NBUA 1GNUA 1GC6A 5G55A 2RR9A 4MH0E 5JH5C 3ZNID 1WIAA 3EECA 3UQAA 4J6IA 3KUDB 1LFDA 1YQBA 2GBJA 2MCNB 1WE7A 2IYDB 3W1SC 1Q0WB 3B1LX 2KC2A 2R2OA 3H9DA 4II3B 4JIOU 4K1RB 3L10B 4NQLB 3A4SC 2V3SA 3A33B 4HXDA 2RSUA 2N7DA 1SE9A 3SD5A 4F8CB 4FJVB 3ML8A 4GU2A 4G11A 4BOZB 2N1VA 1IYFA 4W9DA 3DBSA 1WXSA 2JZ3B 1V9JA 1V5OA 2FCMA 4BFRA 4HLEA 1XD3B 2LRUA 2LJ5A 3L0WB 3MTNB 3QK0A 4BKTA 2B3AA 4BKSA 2C7HA 2FIDA 3VXWA 2KO3A 4NQKE 4WWPA 3DVGY 2LUEA 5L95C 1S1QB 4XX5A 1G6JA 3RCZA 2DAJA 2FIFA 2M0XA 4IWPA 3RT3B 3TCAA 5LXIB 3QAQA 4PS3A 5AZHA 3IVFA 2OOBB 2KDBA 1WH3A 3M62B 5CHFA 2FCSA 4FULA 3VH3B 1J8CA 3A1QB 1H4RA 1KOTA 4P7IA 2J0KA 3CF6E 2MP2A 1YX6B 3B08A 3UF8A 3DDCB 3DBLI 4B95A 3ZVVA 3TL5A
chains in the Genus database with same CATH superfamily
5LLIA 2SAKA 2MP2B 2D3BA 3LDZE 1YJJA 4LLGM 1TGZB 3VVWB 2KDFB 1VLBA 2KAJA 2KQ7A 2Z0EB 2MBOA 1DOYA 1FPYA 1V8CA 3DOWA 2Y5CA 3P4PB 3M63B 2DX5B 1T5XD 2LD9A 2C9WB 3DHGC 1JW9D 1E7PB 2R2QA 4MGZE 3VDZA 4YSXB 2IY0B 3V6CB 2BS3B 3OJ3A 4PS7A 2LVQA 3WAMA 1FFVA 2KOXA 1E8WA 3PZDA 1RYJA 3Q3MC 3ZYYX 5BYRA 1RRBA 4O1NA 2DNFA 5J17A 2N1WA 3WA0A 3QIJA 2J53A 3UIPB 4WURA 3HRDD 4EZJA 4E3CA 4YXDB 5FR3A 2CS4A 2WDQB 1E5WA 4DHZE 2RD0A 4MSMB 1ZXHA 3ZNGC 2GBRA 2KFKA 3Q69A 1QOAA 3PS6A 2J0MA 2WYQA 4C80A 2O2VA 1OEYJ 3AEEB 4HDQA 2WGSA 4WH4A 1WMHA 4I6LB 1HA5A 2CHZA 2JXTA 4BVUC 1ACCA 1TJEA 3AE7B 5GMVA 4WWMA 1AWDA 3SDLC 1V1PB 3DVNV 2XEWA 2G3QB 3KYDD 2XK5A 1J7BA 2JQRB 2I1JA 4KIKB 3RZFA 4HCNB 3ZJTA 5D3DA 2M0AA 2BGFA 1ZXIA 5G5HA 2HJ8A 4MGIE 1GG3A 2KN4A 2K39A 2MRPA 4QAYA 1SIFA 1HTQA 2LHEA 2KDIA 2Y5PA 2D3CA 1FNUA 2ZNVC 2BQQA 2X38A 3V3XA 4JL9A 2ZVNA 2K1FA 3MC0B 2KHWB 5DPTA 2SEBD 3GZNB 2KDEB 2XN9C 4WQMA 2C7NB 2I38A 2K0PA 3DCGA 3A9JB 3ZKJC 1RM6C 4M01A 4GOCA 3RZWC 3NVVA 3U4EG 5LXHA 4L1BA 1E6EB 2IGDA 4IUMB 1P7EA 3R8BA 3SFDB 2PJHA 2RDGA 3GZNI 1QF6A 1VZ6A 2ACZB 1UELA 2G4DB 4ZRPA 3FILA 4ICVA 1C4AA 1XT9B 3HM3A 3H6NA 4EEWA 3M3JA 4NAWB 3UINB 1IBXA 2DZIA 3U8ZA 1V97A 3VUWA 3DVGX 3MC8A 1ET6A 2J52A 1UNSA 2PLPA 3VUXA 5T8IA 2PE6B 2M17A 2ICIA 3V05A 3ZDTA 2M8SA 1K51A 4MGYE 5KHOA 2WX1A 3V61A 2JX5A 5DCNA 2BYVE 3Q8FA 1V86A 4GDLA 2HDEA 2WXNA 2KKCA 3KQ4A 1ROEA 4K7WA 5DPRA 2AQ1B 2E6XA 4LJPB 1C3TA 1SSNA 2RDBC 2O2VB 4ZYNA 2NCNA 3TEWA 5J2RA 3VTVA 4A3PA 2DYMA 3N1YC 3N3KB 1DYQA 2O6VB 2LWPA 1GC7A 3Q3FA 3I5JC 2LVOA 4LNNA 1AW7A 2XK5B 3BK1A 3A4RA 3ONSA 4YWGG 2KYWA 1ISNA 2IDYA 2DZMA 4GDKA 2MSED 2DAFA 2N9PC 1FRDA 4IC7B 1QQRA 1J7CA 2V3PA 3AULA 3OLMD 1ENFA 4KSKC 1AN8A 3KLSX 5BMHA 2GI9A 4M8MA 2W3SA 2QILA 4KV2A 1UUPA 1JROA 5MPOA 4ACFA 2HE7A 2KTRA 4EOYA 2YVCA 1FCCC 2QJLA 3VH4B 1TT5B 4ITKA 3RI7C 2EMSA 1MG8A 4W9JA 1SE4A 1ZE3D 2LGIA 2KD0A 1ESFA 1JWMD 1YN3A 4IM0A 3Q3NC 4TQ1A 4LK0M 2J0JA 4G50A 1FEHA 1XLNA 4IOIE 2CR5A 4TMAB 4IKGA 4TKNA 4HPMB 3TMPB 4FLHA 2AX5A 3WIMA 1KRHA 2K6DB 1E9MA 4KX6B 3QC8B 4REZA 1C9FA 3HVDA 4PT5A 1IBXB 3JVZX 4HKQA 4MH8A 1FRRA 3UIOB 1FXIA 3MHZA 2WHIA 3JSVB 3KUCB 4XC2A 4FXCA 3PRZA 3I3TB 2N9LA 1L7YA 2WDRB 3R2TA 1MPEA 5E6JA 4NZLB 3ZRCA 4EZLA 2WXLA 5LNK1 5IA7A 1GB1A 2LI5A 2OEDA 2K22A 2HTME 4CQNA 3O13A 1C4PA 4CO7A 4AS1A 1ZDVA 2KC1A 3AECB 2Q5WD 1P3QU 2R61A 1JQ4A 2LMCA 3ZTCA 4ANVA 1BXTA 4RF0A 1KH0A 3L16A 2V0GA 1FXTB 4P1CC 1GNUA 3AEAB 4MH0E 3ZNID 4LNFA 1LFDA 1YQBA 2IYDB 3B1LX 4II3B 4K1RB 1TKYA 3L10B 4HXDA 2INPE 2RSUA 2N7DA 2WU5B 2JYTA 1FFUA 1L5PA 4FJVB 3AE1B 2PVGC 1V9JA 1F77A 2LJ5A 3QK0A 4BKSA 1NYQA 1I7HA 3DVGY 1JWSD 1S1QB 3URYA 3RT3B 5AUIA 3QAQA 2WLBA 3VH3B 2GLSA 4Q2JA 3CF6E 2MP2A 1VR9A 3LB8C 3B08A 5HHDG 3DDCB 1PFDA 3AE9B 1JWBD 2IGHA 3W1SC 3QJZA 1ZDXA 2LRWA 3BVZA 4MACA 2JY6A 2L76A 4ZYSA 2LGDA 3ZGZA 3KWLA 1CQVA 2YLMA 2K6QA 2ZPNA 1V2YA 3PHXB 4YT0B 4XWTA 2GOWA 1D4BA 2PVOD 4GGQA 3AE5B 4EZKA 4LNKA 4NJ6A 1F2RC 2KJRA 3SR6A 2I1KA 2WXMA 3PT2B 1XCTL 2MQJA 5AUKA 4ZOHC 2DYOA 4GXBA 2VRRB 3S2AA 3B2GA 3R66C 2NVUI 1I4GA 2WWZA 2LGXA 5C3JB 1B1ZA 2FCQA 1D3ZA 1P7FA 2CHXA 1TS5A 1M4VA 3AE3B 4ARIA 3U7DA 1R7SA 3N32A 4BBNC 4N58A 2INNE 3APFA 5I4DA 4TV3A 3ZXVA 3KYCD 1LXDA 3TUOA 1N62A 2KLGA 4MELA 4RGTA 1AARA 3Q8CA 2MBEA 2OJWA 4XYCA 1HZ5A 3BWUD 1N61A 5C2TB 3X23A 3RFZB 4ZDVA 4XWWA 2UU7A 3RULA 1V1PA 1IGDA 1XO3A 1VD2A 4W9LA 5IO9A 5TR5A 3VQIA 4AUQC 1B9RA 4KIKA 2MJEA 3AU5A 2DENB 4RF1A 1WRIA 4ANUA 3AV8A 5J18A 2GRIA 4M8NA 1VCBA 3VRAB 3PZ8A 1NDDA 2NBVB 3KVFB 3NZUA 4W9EA 2LGSA 4D2KA 4HVBA 5AEKB 3Q3JA 5D7GA 1E7UA 3A9JA 1UH6A 2JZPA 2D2QA 2KK8A 4P1BC 2WXPA 1UBQA 2JYEA 2EKEC 1KTKA 3L54A 4WAFA 1SGHA 1WF9A 1WJ6A 3AE8B 2AL6A 3RN9C 3TEZA 3KW5B 4WAAA 4IG7B 2FNJB 4FBJB 2JVCA 1WGRA 4W9GA 4XGAB 3RPFC 3ML9A 4PYUA 4GSWA 3RYTA 1Y56A 2H88B 3P1MA 4EE2A 3Q8BA 5BYSA 2PEAA 1R4NI 3QQ8B 2KVRA 5IOIA 4NAWA 1EO6A 3BVMA 4BKGA 2CKHB 2E3TA 1YOVB 1D5MC 2K3UA 2BYFA 3AEGB 2AL3A 2N7JA 3ABVB 4NY0A 1T0RC 3IT4B 2K5PA 3VTUA 1U4AA 1DGJA 3OJ4B 5HG2A 3W1YA 1FO4A 1T0YA 2V1YA 1MFWA 1P0RA 4P16A 2B76B 1KM7A 3L13A 4MM3B 1ZGUB 1NBFC 1YX5B 2D11A 2TSSA 3ZRFA 5IP4D 1I42A 3JW0X 1V5TA 4ZRQA 4AJYB 1N60A 1RWSA 1VRAB 3P42A 3NUHB 3QX1A 4LJOB 3GP7A 5JHBA 3HVZA 2C7MB 2O6VA 3AI5A 3PREA 3ZNZB 2KN5A 2MA9B 4EKUA 5C1ZA 1K52A 2LVPA 5L83A 1EU4A 1DOXA 1XLOA 3PSEB 2BPSA 3I9V1 5GXGB 2KWUB 3AN1A 3RNEC 1LGRA 2IJ0A 1K50A 1JWAD 1V1OA 4K7SA 2N9XA 2PMVA 4DXAB 3BK2A 4ZHOA 1E90A 1STEA 2VZKD 1V80A 2JZZA 2WXOA 4RGOS 1A70A 3A1QA 2KMAA 3Q8EA 4OVZA 2MWSB 2ZW1A 3L08A 4KGRA 2DZKA 3KUZA 1GJZA 2JRIB 3PO0A 2MBQA 4ARCA 3NZSA 3FC4A 4IM3A 3BVGA 4DHJD 3N1ZC 4FADA 1GUAB 1Q5WB 1FNVA 1S3SG 5AZFA 3NVWA 3DWMA 1HTOA 3AU4A 2BB5A 3R7QA 2ZNVB 5D2MB 1QOFA 3HK0A 4WWNA 1WI0A 3B2FA 3TSSA 5D94A 3R2IA 1TIFA 4L2YA 3EUB2 4NAMA 2ONQA 2XNAC 2KX0A 3OG5A 4HK2A 2LXCA 2CU3A 4W9FA 2RGFA 3ZIMA 1N5WA 3JSVA 1SE3A 3TEYA 3HIZA 4GN1A 1XCQL 1YD8U 1BMLC 3N1XC 2MHJA 4AQ7A 4WWOA 3MFGA 2ZCBA 2ZCCA 1WGGA 4RM8A 2WP9B 3PTFC 1Q10A 4BZAA 4ZRJA 3RNAC 1ZP0B 2L0TA 4RFBA 3KH0A 4ANWA 5G2NA 1RFAA 2Y5BB 2GBNA 1TKGA 1VJKA 1NI2A 3VUYA 1AYFA 4PYZA 1YN4A 2INDC 2NR2A 3ZTDA 3IHPC 2BS2B 2BTEA 1L0XB 3FAHA 3KWVA 2KQSA 4HPLB 2RDHA 4TSSA 1WXAA 4UDUC 4A55A 3ZXRA 1ET9A 1XXGA 3QWZB 1WGYA 1FXAA 1WZ0A 5G55A 5BMIA 1C79A 1UWMA 4A9AA 4J6IA 3KUDB 2GBJA 3OWEB 2MCNB 1Q0WB 3BIID 1GB4A 3A4SC 1EWCA 3A33B 3NS1A 1IYFA 2N1VA 2FE8A 4W9DA 2YEPF 4HLEA 2LHDA 2B3AA 2C7HA 1XLQA 3ZJVA 1G6JA 3GB1A 3TCAA 2YEPB 3W5VB 3A1QB 2LUMA 4USAA 2VH1A 4YTPB 1WWTA 4ZHPA 3UF8A 2LJIA 4B95A 3TL5A 1D6EC 1WX9A 1E10A 3ECIA 1I4QA 2KWCA 3GS2A 2K25A 5G5GA 3ZDMC 3IG3A 4OZCA 4DWFA 3WCQA 4TQ0A 3H7SA 2Z59B 4ZRIA 1NENB 2ON8A 1YIWA 3W2DA 3AXCA 3AEDB 3ENEA 4AOFA 4US8A 4B0MA 2PE9A 1JALA 2ZJDA 4XDDA 3Q6BA 2A5UA 2M4NA 4KKJA 2J4XA 3V6EB 3EFCA 1SJED 4ANXA 3K9PB 2JSVX 1LM8B 2ZEQA 3IAM1 3RD2A 2AQ2B 2OHFA 2GBKA 1MJDA 1SEBD 4LCDE 4ICUA 2MH7A 2NPTB 1PQSA 2J42A 1VDVA 3HHMA 4KDIC 4A3OA 3SU8X 2AYOB 3T3NA 3M95A 2C5LC 2MBHA 4FN2A 2N9KA 1OTRB 2WXKA 1GOZA 5E6NA 3WAPA 3C19A 3QHTA 3NS8A 3GOEA 2KACA 2IO0B 4HCPB 3N30A 2Z0DB 4MGKE 3V62A 1RFKA 1Y8RC 3NZ3A 2D3AA 2MJDA 4OZBA 2JT4B 2N7EA 1XF5L 2GMIC 1VZ7A 3P4QB 2BYTA 2GBMA 1WGHA 1QOGA 3VTWA 3PGEA 5BMGA 1I35A 1WJNA 3E9SA 3NVZA 2NMQA 3W9CB 5HI1A 3MJ5A 3NJTA 1VZ8A 2L1AA 1T3QA 3Q8AA 4WJQA 1GPXA 3WANA 4JLCA 3T8MA 3Q14C 1HEZE 2JWUA 3ZW3A 5EE3A 4B9KA 2KZRA 3AEBB 2WXRA 2IPKD 1ZKHA 3P4RB 1WY8A 5CHVC 3QCAA 4KZ0A 3X0WA 2WU2B 1UWXA 1KLGD 2DZJA 2WS3B 2IZVB 2L3ZA 3DWGC 1TKEA 3PRPB 4P6VF 5EDSA 2QC8A 2AWTA 2L83A 4L23A 1L2NA 4HEA1 1P98A 1UD7A 2L00B 3AE6B 2WXIA 1CMXB 3A9KB 4IWQA 2QHOA 1L6UA 2M19A 4R3DA 2D07B 2W54A 4MJSA 2KANA 1WSPA 1L0YB 5HFYA 4KSLC 4HPPA 2W55A 1TTNA 4RH6A 1UZXB 4F7ZA 3TIXA 3B9JA 4I6NB 2AQ3B 1LO5D 4DXGA 5FKAC 3H1UA 2WXQA 4WJNA 3RNFC 2BW2A 5CTRC 3NG0A 1IP9A 3PRMB 1XLPA 4B0EA 1V49A 1SJHD 3DQVA 1Z2MA 4EUTA 2KX3A 2N0SB 4MM3A 4OHJA 3ZNHB 2A4ZA 1ZUD2 2IO2B 2VH2A 4ZRKA 3MHSD 1N6ZA 4II2B 2KNBA 3BY4B 2GB1A 1H8CA 3E56A 1HQRD 1PYWD 2JRHA 2K8BA 1WM2A 3I63C 2JUOA 1E7VA 4OVUA 4BBNF 1F1HA 1LQBA 2J7QB 3SFEB 2CU1A 1E8XA 3VFKA 3OAWA 4N59A 3VR9B 2BB6A 2KVZA 4JWSC 4F1SA 4K7UA 4RNAA 1YMHE 5DPWA 1YJIA 2EKIA 1F2RI 2HJ1A 2L8JA 4JE3B 1GAQB 2BVCA 1JRUA 3H7PB 3NY5A 2INCC 2VZKB 5FR6A 5HKHA 1C1YB 5BYQA 1TBEA 3ZUNA 2V9HA 3HUIA 3EA6A 3HM6X 1K8RB 2WX0A 1T0SC 4DHJB 5DPSA 2MEKA 1R4NB 2G4SA 2L0FA 3P2BA 2QDFA 2OJRA 4DHZB 4FHJA 3PLVA 1QILA 4A8XC 1NVID 1F52A 5JHAA 4NJCA 4C4VA 3JYUA 5C23A 3PVLA 4W9IA 4LDTD 1SB3C 2BWES 3R3MA 1OFFA 2JWZA 3UI3A 1NYRA 3SHQA 1FMAD 1TYGB 2IO3B 1KLUD 3QA8A 4MJSB 4WQOB 3RNBC 1R4MI 1TZ1A 3IT6B 1QOBA 3U52E 2M56B 4M0WB 3Q2AC 3PZ7A 1BT0A 2D3GA 2I2YA 1XQQA 4GMVA 3MJWA 2Y3AA 1OQYA 2W9NA 3APCA 1SIJA 2HD5B 3DHIC 2PPHA 2KT7A 3K9OB 4M00A 3DPDA 5D6JB 2Z8LA 1X1MA 1WX8A 1YNTE 2DLBA 2QMTA 4DXFA 1YN5A 1WXMA 4TUUA 1L4DB 2V4IB 4W9KA 1J19A 3C8YA 2MJ3A 2X8XX 1Z5SB 4RM9A 1FIQA 5CX3A 2HTHA 1JMLA 2KWVB 4B6WA 1GC6A 5JH5C 1FNWA 1WIAA 3MC9A 3EECA 3UQAA 1N5XA 2PW9A 2W82A 2KC2A 2R2OA 4JIOU 1XEEA 2BT6A 1QKZA 2KQ4X 2FBWB 4G11A 4BOZB 3DBSA 4HROA 2L32A 2JZ3B 5IKCM 1XD3B 2LRUA 4RCOA 3DBRB 3VXWA 4WWPA 3Q3OC 2LUEA 5L95C 3NVYA 1MVKA 4XX5A 2DAJA 2M0XA 4IWPA 3IVFA 3ZJUA 5CHFA 3M62B 3U2SC 2FCSA 4FULA 4XDCA 5FK9C 2NTSA 2J0KA 1YX6B 5IN7A 3ZVVA 1UGJA 3I57A 5E6PA 1IGCA 3O65B 3MP9A 1MI0A 4C4VB 1WR6E 2L05A 3DBRI 4BKSD 1CK1A 2BBCA 1EUVB 1EWYC 3GE8C 2CJOA 1QZEA 2KDMA 2LFIA 3EHVA 4KDLB 4C00A 3PPAA 1HXYD 1RAXA 3TJPA 3CIRB 3U30A 2UYZB 3AB5A 4BOSC 1OGWA 2FUG1 4RGMA 1HE8A 2C60A 4ASWC 2FCNA 4XZ4A 4YSYB 3DHHC 1P9DU 1F9JA 2LASA 4IWOA 4RMAA 1TZOA 2KWDA 2KFJA 5EE0A 4A20A 2D5GA 1PGAA 2NBWB 2DYBA 2H89B 2MBBB 1EF1A 3ALBA 4GIVA 4M02A 4YL8A 1EF5A 2NPTA 1ZW7A 4OVVA 1A5RA 1HZ6A 4FJZA 3UQBA 1M94A 4I6PA 2BYEA 2N4FA 2WDTB 1SE2A 4YSZB 1WXQA 3AE2B 3CSFA 3PLUA 1PGXA 2BKRB 1WX7A 2G1EA 1I4PA 2PKOA 1YQ4B 5IAAC 1YQ3B 2KFKB 1JWUD 5H92C 3J9CA 2KJHB 3ZLZA 4E71A 1UBIA 3IBEA 3IXSA 2EMTA 2MLBA 1WMHB 2JXXA 4JGHB 2BS4B 1WR1A 1UF0A 4KZCA 2EELA 4J3OD 2PIAA 4NJ7A 3BYYB 3AEFB 4G0NB 2CHWA 3BZDB 1ZOYB 4OZAA 1OQQA 1OEYA 1UGMA 3L4PA 2KXJA 2NS5A 1F0ZA 1MG4A 3AH7A 1WXVA 1PDXA 3TEXA 4WIPA 3RUIB 4FHKA 3AM9A 4JPSA 4AJWA 1TS2A 3RNGC 2CJNA 3UGBB 2KMMA 3NOBA 3P4SB 4EFOA 4DQOC 2G9HD 1V81A 4YTMB 1T0QC 1JRPA 5JXVA 2KLCA 2MW5A 4WJPA 3T3OA 3L17A 3EFUA 3A9KA 4HKZE 2RPQA 1PGBA 1I4RA 2K8HA 4MT5A 1KFYB 2AEHA 4C56C 3CMMB 1FM0D 4DDID 1QLBB 3U7ZA 1NEKB 1WJ4A 2DWQA 2WXFA 5H8YE 1C77A 4IW0A 4E74A 4JWUC 2DHZA 4XE0A 3W1SA 1WM3A 4N6EB 5EE1A 3FILB 1WFYA 3NRZA 4CYEA 4IM2A 1CJEA 2BF8B 4NNJB 2LGYA 4H2AA 2RPVA 4HJGE 4AWJA 3PV1A 1WJUA 3B0AA 1DOIA 3RNCC 4OW0A 2BKFA 1IPGA 1L0VB 2WQYB 3LJ3A 3DVNU 4JQWC 1RLFA 4K3BA 4GDLB 4YTNB 4FA6A 4MSQB 4AP4C 4W9CA 2N9EB 1K53A 1MHXA 1E8YA 4PS8A 2XBBC 4KGTA 4K81A 3H7PA 4S17A 5CHWA 2PTLA 2LEKA 4HDOA 1YJ1A 4JX1C 4PK1A 5TSSA 4W9HA 2IY1B 4IDIA 1N63A 2G45B 4MDKE 4GLSC 4LNIA 2JPHA 3TBLD 1EM7A 1WZ3A 2WXGA 3ZQ4A 1WYWB 1CZPA 1WYGA 3RMKC 3IAS1 1EU3A 4GDKB 1KLVA 4KVGB 3BINA 3SEBA 1SXTA 2O6VD 3D32A 3R7RA 2REXA 4HJKA 1T6BX 4LDTB 5D3IB 5JZEB 2IBIB 3VAWA 3QARA 4HRSA 5AZGA 3VHTC 3H8HA 3WALA 3APDA 5BO4B 1C4CA 4N9F4 1KJTA 3LYYA 1I4HA 1Q1OA 3T9LA 2D10A 2KTFA 1TY2A 4NPNA 1PUTA 2WXJA 2KTRB 2ASQA 4K3CA 2QCZA 4S0RA 2V4LA 3LXFA 4BAXA 4RGNA 1JCKB 4URKA 3DBHB 2KMCA 2IGGA 2LXAA 1L4ZB 2QEJC 1P1AA 1WE6A 2MX2A 4DBGA 4LNOA 5KHQA 4M0WA 4CHKA 3PHWB 2JF5A 4X57B 2K8CA 1MHHE 2M1MA 4HWIB 1E8ZA 4G3XB 4US9A 3V60A 3EC8A 4WJOA 1V6EA 2RMMA 3GE3C 1C76A 1ZPSA 2K9XA 2ZZPB 3N20C 2FAZA 2FUHB 4C7YA 1J0GA 4C7ZA 3DBHI 3AMZA 2UWQA 2QIEB 3W5UB 2KJ6A 4KGSA 3WAOA 3N9YC 1WRDB 2V3NA 1C78A 1I4XA 4A6QA 1WGDA 2ZW0A 3AE4B 5EE9A 3ZO5B 1L6VA 1NI3A 4DK5A 2ZPYA 1OQRA 1TS4A 3FKYA 1E0ZA 2BWFA 2L7RA 3NHEB 5E6OA 2IO1B 4GB9A 3C0RB 3IFWB 2L52A 3CSTA 1D5ZC 2DBYA 1SF0A 1SBBB 4MEMA 2LZ6A 2WDVB 1WGKA 4LTUA 4DDGD 4FJYA 2ZVOA 2NBUA 2RR9A 3BYTB 1WE7A 3H9DA 4NQLB 2WXHA 1BUIC 2NTTA 2V3SA 3CWIA 3ETRA 1SE9A 3SD5A 4F8CB 3DBLB 3ML8A 4GU2A 2JU6X 1WXSA 1V5OA 2FCMA 4BFRA 3L0WB 1IUEA 3MTNB 2W3RA 4BKTA 2FIDA 2KO3A 2QSDA 4NQKE 1FD6A 3RCZA 2FIFA 1FCLA 5LXIB 1D5XC 4PS3A 5AZHA 2OOBB 1QT9A 1R4MB 2KDBA 1KF6B 1WH3A 3P63A 4KKIA 1TS3A 1J8CA 4A90A 1H4RA 1KOTA 1J7AA 4P7IA 1TY0A 3EGRA 2WNMA 3DBLI 3VRBB 3VR8B
chains in the Genus database with same CATH topology
5LLIA 3QJZA 5E6PA 2MP2B 2LRWA 3O65B 1WX9A 3ECIA 2JY6A 2KWCA 2L76A 3LDZE 1TGZB 1WR6E 2L05A 2K25A 3VVWB 3DBRI 2KDFB 2LGDA 4BKSD 2KQ7A 3ZDMC 3IG3A 2Z0EB 4DWFA 2MBOA 2YLMA 2K6QA 1EUVB 4TQ0A 2ZPNA 3DOWA 3H7SA 1V2YA 3PHXB 2Z59B 4ZRIA 1QZEA 2GOWA 3EHVA 4KDLB 1YIWA 4GGQA 3M63B 3PPAA 2DX5B 4EZKA 1RAXA 3AXCA 4NJ6A 2KJRA 2LD9A 3TJPA 2C9WB 2I1KA 3ENEA 3U30A 4AOFA 2UYZB 3PT2B 2PE9A 2R2QA 2ZJDA 4BOSC 1OGWA 1HE8A 2A5UA 2C60A 4MGZE 2MQJA 2M4NA 2FCNA 4ASWC 4XZ4A 3VDZA 3V6EB 2IY0B 3V6CB 1P9DU 2DYOA 3OJ3A 1F9JA 2LASA 4GXBA 4PS7A 2VRRB 2LVQA 3S2AA 3WAMA 4ANXA 4IWOA 3R66C 3K9PB 4RMAA 2KOXA 1E8WA 3PZDA 2KFJA 2NVUI 2WWZA 4A20A 2LGXA 1RRBA 2FCQA 2NBWB 2DYBA 1LM8B 1D3ZA 2CHXA 2ZEQA 2MBBB 1EF1A 3ALBA 5J17A 4GIVA 2N1WA 3WA0A 4YL8A 3U7DA 1EF5A 3N32A 3QIJA 2NPTA 1ZW7A 4OVVA 3UIPB 4BBNC 1A5RA 4FJZA 3RD2A 3APFA 4TV3A 3UQBA 4EZJA 1M94A 3KYCD 2GBKA 1LXDA 4E3CA 2CS4A 4I6PA 2BYEA 1E5WA 4DHZE 4LCDE 2N4FA 2WDTB 4ICUA 2RD0A 2NPTB 4MSMB 2KLGA 3CSFA 3PLUA 2BKRB 4MELA 1PQSA 3HHMA 4KDIC 4A3OA 3ZNGC 2GBRA 1AARA 3SU8X 2KFKA 2AYOB 1WX7A 3PS6A 3M95A 2C5LC 2MBHA 2MBEA 4FN2A 1OTRB 5IAAC 2J0MA 2KFKB 2WYQA 5E6NA 3WAPA 2O2VA 1OEYJ 2KJHB 4HDQA 3ZLZA 3QHTA 1WMHA 3X23A 1UBIA 4E71A 3IBEA 4ZDVA 4I6LB 3NS8A 3GOEA 2CHZA 2EMTA 2IO0B 4HCPB 3N30A 2Z0DB 4MGKE 3RULA 3V62A 4BVUC 1VD2A 1Y8RC 2MLBA 4W9LA 1WMHB 2JXXA 4JGHB 5GMVA 1WR1A 5TR5A 3VQIA 4AUQC 4KZCA 3SDLC 2JT4B 2N7EA 4KIKA 3DVNV 2XEWA 2GMIC 3AU5A 2G3QB 3KYDD 4NJ7A 2DENB 2CHWA 2XK5A 2GBMA 4G0NB 1WGHA 3VTWA 3PGEA 2I1JA 4ANUA 1OEYA 1WJNA 4KIKB 1UGMA 3RZFA 1I35A 4HCNB 2KXJA 5J18A 2NS5A 4M8NA 1VCBA 2BGFA 1NDDA 2NBVB 3KVFB 1WXVA 2HJ8A 4WJQA 4MGIE 3NZUA 4W9EA 3RUIB 4JLCA 1GG3A 3T8MA 3WANA 2K39A 4FHKA 2MRPA 1SIFA 3ZW3A 2KDIA 4AJWA 4B9KA 4HVBA 5AEKB 2KZRA 2ZNVC 3Q3JA 3UGBB 5D7GA 1ZKHA 3NOBA 4JL9A 2ZVNA 4EFOA 1WY8A 5CHVC 2K1FA 3QCAA 4KZ0A 3X0WA 2KHWB 1E7UA 3A9JA 1UH6A 5DPTA 1V81A 2D2QA 2KK8A 1UBQA 2KDEB 2EKEC 2C7NB 3DCGA 3L54A 2DZJA 1SGHA 2KLCA 2IZVB 2L3ZA 2MW5A 3PRPB 3A9JB 1WF9A 4WJPA 1WJ6A 3ZKJC 5EDSA 3L17A 2AL6A 4GOCA 2AWTA 3EFUA 3A9KA 3KW5B 1L2NA 1P98A 3RZWC 2RPQA 4WAAA 1UD7A 2L00B 4IG7B 2FNJB 4FBJB 2JVCA 1WGRA 2K8HA 4W9GA 2AEHA 5LXHA 3CMMB 1CMXB 3A9KB 4IUMB 4DDID 4IWQA 2QHOA 3ML9A 4PYUA 4GSWA 3RYTA 2PJHA 3GZNI 1WJ4A 2PEAA 1R4NI 2D07B 3QQ8B 4MJSA 2KANA 2KVRA 1UELA 4KSLC 2G4DB 4NAWA 4IW0A 4E74A 1EO6A 1TTNA 2DHZA 1UZXB 4F7ZA 4BKGA 2CKHB 3TIXA 1WM3A 4ICVA 3W1SA 1XT9B 3HM3A 3H6NA 4I6NB 4EEWA 3M3JA 4NAWB 3UINB 2DZIA 3H1UA 3U8ZA 3VUWA 1WFYA 2BYFA 4WJNA 3DVGX 5CTRC 1IP9A 3PRMB 2AL3A 1V49A 4NY0A 4CYEA 4IM2A 3VTUA 1U4AA 3DQVA 2BF8B 3VUXA 3OJ4B 1Z2MA 4EUTA 2KX3A 4MM3A 3W1YA 1T0YA 2V1YA 3ZNHB 4NNJB 2LGYA 4AWJA 2PE6B 3PV1A 1P0RA 1WJUA 2M17A 3B0AA 2A4ZA 1KM7A 2IO2B 4ZRKA 3L13A 2BKFA 1ZGUB 3ZDTA 1NBFC 2M8SA 3MHSD 4MGYE 1YX5B 2D11A 5KHOA 2WX1A 3V61A 3ZRFA 1IPGA 1I42A 4II2B 3JW0X 2KNBA 3BY4B 5DCNA 2BYVE 1H8CA 1V86A 4GDLA 3LJ3A 1V5TA 2JRHA 3DVNU 2KKCA 4JQWC 1RLFA 4AJYB 4K7WA 5DPRA 2K8BA 1WM2A 2JUOA 1E7VA 4OVUA 4BBNF 4LJPB 4GDLB 1LQBA 2J7QB 1C3TA 2CU1A 1E8XA 3VFKA 4FA6A 4MSQB 3QX1A 2O2VB 3OAWA 4LJOB 4W9CA 4ZYNA 4AP4C 2N9EB 5JHBA 2NCNA 4PS8A 1E8YA 2C7MB 2O6VA 4F1SA 2XBBC 4K7UA 5J2RA 3AI5A 3VTVA 4K81A 4A3PA 3PREA 2DYMA 3H7PA 5DPWA 3ZNZB 2KN5A 3N3KB 5CHWA 2O6VB 2LWPA 1GC7A 4HDOA 2L8JA 1YJ1A 2MA9B 3Q3FA 4EKUA 5C1ZA 2LVOA 2IY1B 4W9HA 3H7PB 1JRUA 2XK5B 2G45B 3A4RA 3ONSA 3NY5A 4MDKE 2LVPA 5L83A 1ISNA 2JPHA 5FR6A 3TBLD 2DZMA 1WZ3A 3PSEB 2BPSA 2MSED 4GDKA 5HKHA 1WYWB 2DAFA 2N9PC 1C1YB 2KWUB 1TBEA 3ZUNA 4IC7B 4GDKB 1KLVA 4KVGB 3AULA 3BINA 3OLMD 2O6VD 3HM6X 4K7SA 3D32A 2N9XA 3R7RA 4DXAB 2REXA 4KSKC 4HJKA 1K8RB 2WX0A 4DHJB 4LDTB 4M8MA 5DPSA 5JZEB 2IBIB 3VAWA 1E90A 3QARA 5AZGA 2G4SA 3VHTC 1V80A 4KV2A 3WALA 2JZZA 3APDA 5BO4B 2L0FA 3A1QA 3P2BA 2KMAA 4N9F4 1KJTA 2OJRA 4DHZB 2MWSB 4FHJA 3L08A 1Q1OA 2HE7A 3T9LA 2DZKA 2D10A 3KUZA 3PLVA 2KTRA 1GJZA 4EOYA 2KTFA 5JHAA 2YVCA 4NPNA 3VH4B 2JRIB 2EMSA 1MG8A 2KTRB 2ASQA 2MBQA 3JYUA 3NZSA 4IM3A 4W9JA 5C23A 3PVLA 4W9IA 4DHJD 4LDTD 2V4LA 4FADA 1GUAB 2BWES 1Q5WB 3R3MA 1S3SG 2KD0A 4URKA 5AZFA 2KMCA 2LXAA 4IM0A 4TQ1A 3AU4A 2J0JA 4G50A 2JWZA 1P1AA 1WE6A 3R7QA 3SHQA 2ZNVB 5D2MB 2IO3B 2CR5A 2MX2A 4TKNA 3HK0A 4WWNA 4DBGA 3QA8A 4HPMB 4FLHA 4MJSB 1WI0A 4WQOB 3TMPB 1R4MI 5D94A 5KHQA 3WIMA 4CHKA 3PHWB 1TZ1A 2JF5A 2K6DB 4X57B 2K8CA 2M1MA 4HWIB 1E8ZA 3QC8B 4G3XB 2KX0A 3V60A 3EC8A 4M0WB 4WJOA 4HK2A 1BT0A 2D3GA 2LXCA 1V6EA 1XQQA 3JVZX 4GMVA 2ZZPB 4W9FA 3MJWA 2RGFA 3ZIMA 2FAZA 1OQYA 2FUHB 2W9NA 1J0GA 3JSVA 3DBHI 3APCA 2HD5B 2UWQA 2PPHA 3HIZA 4GN1A 3UIOB 2KJ6A 1YD8U 3WAOA 1WRDB 3JSVB 3K9OB 4WWOA 2ZCBA 2ZCCA 3KUCB 1WGGA 4RM8A 4XC2A 1WGDA 3DPDA 3PTFC 3PRZA 4ZRJA 5D6JB 3I3TB 1X1MA 2L0TA 3KH0A 4ANWA 3ZO5B 1WX8A 5G2NA 1L7YA 1RFAA 2Y5BB 2GBNA 1NI2A 4DK5A 2ZPYA 3VUYA 3ZRCA 4PYZA 4EZLA 5IA7A 1WXMA 2NR2A 4TUUA 2BWFA 2L7RA 2LI5A 3ZTDA 3NHEB 4W9KA 1J19A 5E6OA 2IO1B 4GB9A 3C0RB 3IHPC 4CO7A 3IFWB 2KC1A 1Z5SB 4RM9A 2KQSA 3CSTA 4HPLB 1WXAA 1P3QU 4MEMA 2LZ6A 3ZTCA 4ANVA 5CX3A 4DDGD 2HTHA 3L16A 3QWZB 4FJYA 1FXTB 1WGYA 2KWVB 2ZVOA 4B6WA 1WZ0A 2NBUA 1GNUA 1GC6A 5G55A 2RR9A 4MH0E 5JH5C 3ZNID 1WIAA 3EECA 3UQAA 4J6IA 3KUDB 1LFDA 1YQBA 2GBJA 2MCNB 1WE7A 2IYDB 3W1SC 1Q0WB 3B1LX 2KC2A 2R2OA 3H9DA 4II3B 4JIOU 4K1RB 3L10B 4NQLB 3A4SC 2V3SA 3A33B 4HXDA 2RSUA 2N7DA 1SE9A 3SD5A 4F8CB 4FJVB 3ML8A 4GU2A 4G11A 4BOZB 2N1VA 1IYFA 4W9DA 3DBSA 1WXSA 2JZ3B 1V9JA 1V5OA 2FCMA 4BFRA 4HLEA 1XD3B 2LRUA 2LJ5A 3L0WB 3MTNB 3QK0A 4BKTA 2B3AA 4BKSA 2C7HA 2FIDA 3VXWA 2KO3A 4NQKE 4WWPA 3DVGY 2LUEA 5L95C 1S1QB 4XX5A 1G6JA 3RCZA 2DAJA 2FIFA 2M0XA 4IWPA 3RT3B 3TCAA 5LXIB 3QAQA 4PS3A 5AZHA 3IVFA 2OOBB 2KDBA 1WH3A 3M62B 5CHFA 2FCSA 4FULA 3VH3B 1J8CA 3A1QB 1H4RA 1KOTA 4P7IA 2J0KA 3CF6E 2MP2A 1YX6B 3B08A 3UF8A 3DDCB 3DBLI 4B95A 3ZVVA 3TL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LLI A;  3QJZ A;  5E6P A;  2MP2 B;  2LRW A;  3O65 B;  1WX9 A;  3ECI A;  2JY6 A;  2KWC A;  2L76 A;  3LDZ E;  1TGZ B;  1WR6 E;  2L05 A;  2K25 A;  3VVW B;  3DBR I;  2KDF B;  2LGD A;  4BKS D;  2KQ7 A;  3ZDM C;  3IG3 A;  2Z0E B;  4DWF A;  2MBO A;  2YLM A;  2K6Q A;  1EUV B;  4TQ0 A;  2ZPN A;  3DOW A;  3H7S A;  1V2Y A;  3PHX B;  2Z59 B;  4ZRI A;  1QZE A;  2GOW A;  3EHV A;  4KDL B;  1YIW A;  4GGQ A;  3M63 B;  3PPA A;  2DX5 B;  4EZK A;  1RAX A;  3AXC A;  4NJ6 A;  2KJR A;  2LD9 A;  3TJP A;  2C9W B;  2I1K A;  3ENE A;  3U30 A;  4AOF A;  2UYZ B;  3PT2 B;  2PE9 A;  2R2Q A;  2ZJD A;  4BOS C;  1OGW A;  1HE8 A;  2A5U A;  2C60 A;  4MGZ E;  2MQJ A;  2M4N A;  2FCN A;  4ASW C;  4XZ4 A;  3VDZ A;  3V6E B;  2IY0 B;  3V6C B;  1P9D U;  2DYO A;  3OJ3 A;  1F9J A;  2LAS A;  4GXB A;  4PS7 A;  2VRR B;  2LVQ A;  3S2A A;  3WAM A;  4ANX A;  4IWO A;  3R66 C;  3K9P B;  4RMA A;  2KOX A;  1E8W A;  3PZD A;  2KFJ A;  2NVU I;  2WWZ A;  4A20 A;  2LGX A;  1RRB A;  2FCQ A;  2NBW B;  2DYB A;  1LM8 B;  1D3Z A;  2CHX A;  2ZEQ A;  2MBB B;  1EF1 A;  3ALB A;  5J17 A;  4GIV A;  2N1W A;  3WA0 A;  4YL8 A;  3U7D A;  1EF5 A;  3N32 A;  3QIJ A;  2NPT A;  1ZW7 A;  4OVV A;  3UIP B;  4BBN C;  1A5R A;  4FJZ A;  3RD2 A;  3APF A;  4TV3 A;  3UQB A;  4EZJ A;  1M94 A;  3KYC D;  2GBK A;  1LXD A;  4E3C A;  2CS4 A;  4I6P A;  2BYE A;  1E5W A;  4DHZ E;  4LCD E;  2N4F A;  2WDT B;  4ICU A;  2RD0 A;  2NPT B;  4MSM B;  2KLG A;  3CSF A;  3PLU A;  2BKR B;  4MEL A;  1PQS A;  3HHM A;  4KDI C;  4A3O A;  3ZNG C;  2GBR A;  1AAR A;  3SU8 X;  2KFK A;  2AYO B;  1WX7 A;  3PS6 A;  3M95 A;  2C5L C;  2MBH A;  2MBE A;  4FN2 A;  1OTR B;  5IAA C;  2J0M A;  2KFK B;  2WYQ A;  5E6N A;  3WAP A;  2O2V A;  1OEY J;  2KJH B;  4HDQ A;  3ZLZ A;  3QHT A;  1WMH A;  3X23 A;  1UBI A;  4E71 A;  3IBE A;  4ZDV A;  4I6L B;  3NS8 A;  3GOE A;  2CHZ A;  2EMT A;  2IO0 B;  4HCP B;  3N30 A;  2Z0D B;  4MGK E;  3RUL A;  3V62 A;  4BVU C;  1VD2 A;  1Y8R C;  2MLB A;  4W9L A;  1WMH B;  2JXX A;  4JGH B;  5GMV A;  1WR1 A;  5TR5 A;  3VQI A;  4AUQ C;  4KZC A;  3SDL C;  2JT4 B;  2N7E A;  4KIK A;  3DVN V;  2XEW A;  2GMI C;  3AU5 A;  2G3Q B;  3KYD D;  4NJ7 A;  2DEN B;  2CHW A;  2XK5 A;  2GBM A;  4G0N B;  1WGH A;  3VTW A;  3PGE A;  2I1J A;  4ANU A;  1OEY A;  1WJN A;  4KIK B;  1UGM A;  3RZF A;  1I35 A;  4HCN B;  2KXJ A;  5J18 A;  2NS5 A;  4M8N A;  1VCB A;  2BGF A;  1NDD A;  2NBV B;  3KVF B;  1WXV A;  2HJ8 A;  4WJQ A;  4MGI E;  3NZU A;  4W9E A;  3RUI B;  4JLC A;  1GG3 A;  3T8M A;  3WAN A;  2K39 A;  4FHK A;  2MRP A;  1SIF A;  3ZW3 A;  2KDI A;  4AJW A;  4B9K A;  4HVB A;  5AEK B;  2KZR A;  2ZNV C;  3Q3J A;  3UGB B;  5D7G A;  1ZKH A;  3NOB A;  4JL9 A;  2ZVN A;  4EFO A;  1WY8 A;  5CHV C;  2K1F A;  3QCA A;  4KZ0 A;  3X0W A;  2KHW B;  1E7U A;  3A9J A;  1UH6 A;  5DPT A;  1V81 A;  2D2Q A;  2KK8 A;  1UBQ A;  2KDE B;  2EKE C;  2C7N B;  3DCG A;  3L54 A;  2DZJ A;  1SGH A;  2KLC A;  2IZV B;  2L3Z A;  2MW5 A;  3PRP B;  3A9J B;  1WF9 A;  4WJP A;  1WJ6 A;  3ZKJ C;  5EDS A;  3L17 A;  2AL6 A;  4GOC A;  2AWT A;  3EFU A;  3A9K A;  3KW5 B;  1L2N A;  1P98 A;  3RZW C;  2RPQ A;  4WAA A;  1UD7 A;  2L00 B;  4IG7 B;  2FNJ B;  4FBJ B;  2JVC A;  1WGR A;  2K8H A;  4W9G A;  2AEH A;  5LXH A;  3CMM B;  1CMX B;  3A9K B;  4IUM B;  4DDI D;  4IWQ A;  2QHO A;  3ML9 A;  4PYU A;  4GSW A;  3RYT A;  2PJH A;  3GZN I;  1WJ4 A;  2PEA A;  1R4N I;  2D07 B;  3QQ8 B;  4MJS A;  2KAN A;  2KVR A;  1UEL A;  4KSL C;  2G4D B;  4NAW A;  4IW0 A;  4E74 A;  1EO6 A;  1TTN A;  2DHZ A;  1UZX B;  4F7Z A;  4BKG A;  2CKH B;  3TIX A;  1WM3 A;  4ICV A;  3W1S A;  1XT9 B;  3HM3 A;  3H6N A;  4I6N B;  4EEW A;  3M3J A;  4NAW B;  3UIN B;  2DZI A;  3H1U A;  3U8Z A;  3VUW A;  1WFY A;  2BYF A;  4WJN A;  3DVG X;  5CTR C;  1IP9 A;  3PRM B;  2AL3 A;  1V49 A;  4NY0 A;  4CYE A;  4IM2 A;  3VTU A;  1U4A A;  3DQV A;  2BF8 B;  3VUX A;  3OJ4 B;  1Z2M A;  4EUT A;  2KX3 A;  4MM3 A;  3W1Y A;  1T0Y A;  2V1Y A;  3ZNH B;  4NNJ B;  2LGY A;  4AWJ A;  2PE6 B;  3PV1 A;  1P0R A;  1WJU A;  2M17 A;  3B0A A;  2A4Z A;  1KM7 A;  2IO2 B;  4ZRK A;  3L13 A;  2BKF A;  1ZGU B;  3ZDT A;  1NBF C;  2M8S A;  3MHS D;  4MGY E;  1YX5 B;  2D11 A;  5KHO A;  2WX1 A;  3V61 A;  3ZRF A;  1IPG A;  1I42 A;  4II2 B;  3JW0 X;  2KNB A;  3BY4 B;  5DCN A;  2BYV E;  1H8C A;  1V86 A;  4GDL A;  3LJ3 A;  1V5T A;  2JRH A;  3DVN U;  2KKC A;  4JQW C;  1RLF A;  4AJY B;  4K7W A;  5DPR A;  2K8B A;  1WM2 A;  2JUO A;  1E7V A;  4OVU A;  4BBN F;  4LJP B;  4GDL B;  1LQB A;  2J7Q B;  1C3T A;  2CU1 A;  1E8X A;  3VFK A;  4FA6 A;  4MSQ B;  3QX1 A;  2O2V B;  3OAW A;  4LJO B;  4W9C A;  4ZYN A;  4AP4 C;  2N9E B;  5JHB A;  2NCN A;  4PS8 A;  1E8Y A;  2C7M B;  2O6V A;  4F1S A;  2XBB C;  4K7U A;  5J2R A;  3AI5 A;  3VTV A;  4K81 A;  4A3P A;  3PRE A;  2DYM A;  3H7P A;  5DPW A;  3ZNZ B;  2KN5 A;  3N3K B;  5CHW A;  2O6V B;  2LWP A;  1GC7 A;  4HDO A;  2L8J A;  1YJ1 A;  2MA9 B;  3Q3F A;  4EKU A;  5C1Z A;  2LVO A;  2IY1 B;  4W9H A;  3H7P B;  1JRU A;  2XK5 B;  2G45 B;  3A4R A;  3ONS A;  3NY5 A;  4MDK E;  2LVP A;  5L83 A;  1ISN A;  2JPH A;  5FR6 A;  3TBL D;  2DZM A;  1WZ3 A;  3PSE B;  2BPS A;  2MSE D;  4GDK A;  5HKH A;  1WYW B;  2DAF A;  2N9P C;  1C1Y B;  2KWU B;  1TBE A;  3ZUN A;  4IC7 B;  4GDK B;  1KLV A;  4KVG B;  3AUL A;  3BIN A;  3OLM D;  2O6V D;  3HM6 X;  4K7S A;  3D32 A;  2N9X A;  3R7R A;  4DXA B;  2REX A;  4KSK C;  4HJK A;  1K8R B;  2WX0 A;  4DHJ B;  4LDT B;  4M8M A;  5DPS A;  5JZE B;  2IBI B;  3VAW A;  1E90 A;  3QAR A;  5AZG A;  2G4S A;  3VHT C;  1V80 A;  4KV2 A;  3WAL A;  2JZZ A;  3APD A;  5BO4 B;  2L0F A;  3A1Q A;  3P2B A;  2KMA A;  4N9F 4;  1KJT A;  2OJR A;  4DHZ B;  2MWS B;  4FHJ A;  3L08 A;  1Q1O A;  2HE7 A;  3T9L A;  2DZK A;  2D10 A;  3KUZ A;  3PLV A;  2KTR A;  1GJZ A;  4EOY A;  2KTF A;  5JHA A;  2YVC A;  4NPN A;  3VH4 B;  2JRI B;  2EMS A;  1MG8 A;  2KTR B;  2ASQ A;  2MBQ A;  3JYU A;  3NZS A;  4IM3 A;  4W9J A;  5C23 A;  3PVL A;  4W9I A;  4DHJ D;  4LDT D;  2V4L A;  4FAD A;  1GUA B;  2BWE S;  1Q5W B;  3R3M A;  1S3S G;  2KD0 A;  4URK A;  5AZF A;  2KMC A;  2LXA A;  4IM0 A;  4TQ1 A;  3AU4 A;  2J0J A;  4G50 A;  2JWZ A;  1P1A A;  1WE6 A;  3R7Q A;  3SHQ A;  2ZNV B;  5D2M B;  2IO3 B;  2CR5 A;  2MX2 A;  4TKN A;  3HK0 A;  4WWN A;  4DBG A;  3QA8 A;  4HPM B;  4FLH A;  4MJS B;  1WI0 A;  4WQO B;  3TMP B;  1R4M I;  5D94 A;  5KHQ A;  3WIM A;  4CHK A;  3PHW B;  1TZ1 A;  2JF5 A;  2K6D B;  4X57 B;  2K8C A;  2M1M A;  4HWI B;  1E8Z A;  3QC8 B;  4G3X B;  2KX0 A;  3V60 A;  3EC8 A;  4M0W B;  4WJO A;  4HK2 A;  1BT0 A;  2D3G A;  2LXC A;  1V6E A;  1XQQ A;  3JVZ X;  4GMV A;  2ZZP B;  4W9F A;  3MJW A;  2RGF A;  3ZIM A;  2FAZ A;  1OQY A;  2FUH B;  2W9N A;  1J0G A;  3JSV A;  3DBH I;  3APC A;  2HD5 B;  2UWQ A;  2PPH A;  3HIZ A;  4GN1 A;  3UIO B;  2KJ6 A;  1YD8 U;  3WAO A;  1WRD B;  3JSV B;  3K9O B;  4WWO A;  2ZCB A;  2ZCC A;  3KUC B;  1WGG A;  4RM8 A;  4XC2 A;  1WGD A;  3DPD A;  3PTF C;  3PRZ A;  4ZRJ A;  5D6J B;  3I3T B;  1X1M A;  2L0T A;  3KH0 A;  4ANW A;  3ZO5 B;  1WX8 A;  5G2N A;  1L7Y A;  1RFA A;  2Y5B B;  2GBN A;  1NI2 A;  4DK5 A;  2ZPY A;  3VUY A;  3ZRC A;  4PYZ A;  4EZL A;  5IA7 A;  1WXM A;  2NR2 A;  4TUU A;  2BWF A;  2L7R A;  2LI5 A;  3ZTD A;  3NHE B;  4W9K A;  1J19 A;  5E6O A;  2IO1 B;  4GB9 A;  3C0R B;  3IHP C;  4CO7 A;  3IFW B;  2KC1 A;  1Z5S B;  4RM9 A;  2KQS A;  3CST A;  4HPL B;  1WXA A;  1P3Q U;  4MEM A;  2LZ6 A;  3ZTC A;  4ANV A;  5CX3 A;  4DDG D;  2HTH A;  3L16 A;  3QWZ B;  4FJY A;  1FXT B;  1WGY A;  2KWV B;  2ZVO A;  4B6W A;  1WZ0 A;  2NBU A;  1GNU A;  1GC6 A;  5G55 A;  2RR9 A;  4MH0 E;  5JH5 C;  3ZNI D;  1WIA A;  3EEC A;  3UQA A;  4J6I A;  3KUD B;  1LFD A;  1YQB A;  2GBJ A;  2MCN B;  1WE7 A;  2IYD B;  3W1S C;  1Q0W B;  3B1L X;  2KC2 A;  2R2O A;  3H9D A;  4II3 B;  4JIO U;  4K1R B;  3L10 B;  4NQL B;  3A4S C;  2V3S A;  3A33 B;  4HXD A;  2RSU A;  2N7D A;  1SE9 A;  3SD5 A;  4F8C B;  4FJV B;  3ML8 A;  4GU2 A;  4G11 A;  4BOZ B;  2N1V A;  1IYF A;  4W9D A;  3DBS A;  1WXS A;  2JZ3 B;  1V9J A;  1V5O A;  2FCM A;  4BFR A;  4HLE A;  1XD3 B;  2LRU A;  2LJ5 A;  3L0W B;  3MTN B;  3QK0 A;  4BKT A;  2B3A A;  4BKS A;  2C7H A;  2FID A;  3VXW A;  2KO3 A;  4NQK E;  4WWP A;  3DVG Y;  2LUE A;  5L95 C;  1S1Q B;  4XX5 A;  1G6J A;  3RCZ A;  2DAJ A;  2FIF A;  2M0X A;  4IWP A;  3RT3 B;  3TCA A;  5LXI B;  3QAQ A;  4PS3 A;  5AZH A;  3IVF A;  2OOB B;  2KDB A;  1WH3 A;  3M62 B;  5CHF A;  2FCS A;  4FUL A;  3VH3 B;  1J8C A;  3A1Q B;  1H4R A;  1KOT A;  4P7I A;  2J0K A;  3CF6 E;  2MP2 A;  1YX6 B;  3B08 A;  3UF8 A;  3DDC B;  3DBL I;  4B95 A;  3ZVV A;  3TL5 A; 
#chains in the Genus database with same CATH topology
 5LLI A;  2SAK A;  2MP2 B;  2D3B A;  3LDZ E;  1YJJ A;  4LLG M;  1TGZ B;  3VVW B;  2KDF B;  1VLB A;  2KAJ A;  2KQ7 A;  2Z0E B;  2MBO A;  1DOY A;  1FPY A;  1V8C A;  3DOW A;  2Y5C A;  3P4P B;  3M63 B;  2DX5 B;  1T5X D;  2LD9 A;  2C9W B;  3DHG C;  1JW9 D;  1E7P B;  2R2Q A;  4MGZ E;  3VDZ A;  4YSX B;  2IY0 B;  3V6C B;  2BS3 B;  3OJ3 A;  4PS7 A;  2LVQ A;  3WAM A;  1FFV A;  2KOX A;  1E8W A;  3PZD A;  1RYJ A;  3Q3M C;  3ZYY X;  5BYR A;  1RRB A;  4O1N A;  2DNF A;  5J17 A;  2N1W A;  3WA0 A;  3QIJ A;  2J53 A;  3UIP B;  4WUR A;  3HRD D;  4EZJ A;  4E3C A;  4YXD B;  5FR3 A;  2CS4 A;  2WDQ B;  1E5W A;  4DHZ E;  2RD0 A;  4MSM B;  1ZXH A;  3ZNG C;  2GBR A;  2KFK A;  3Q69 A;  1QOA A;  3PS6 A;  2J0M A;  2WYQ A;  4C80 A;  2O2V A;  1OEY J;  3AEE B;  4HDQ A;  2WGS A;  4WH4 A;  1WMH A;  4I6L B;  1HA5 A;  2CHZ A;  2JXT A;  4BVU C;  1ACC A;  1TJE A;  3AE7 B;  5GMV A;  4WWM A;  1AWD A;  3SDL C;  1V1P B;  3DVN V;  2XEW A;  2G3Q B;  3KYD D;  2XK5 A;  1J7B A;  2JQR B;  2I1J A;  4KIK B;  3RZF A;  4HCN B;  3ZJT A;  5D3D A;  2M0A A;  2BGF A;  1ZXI A;  5G5H A;  2HJ8 A;  4MGI E;  1GG3 A;  2KN4 A;  2K39 A;  2MRP A;  4QAY A;  1SIF A;  1HTQ A;  2LHE A;  2KDI A;  2Y5P A;  2D3C A;  1FNU A;  2ZNV C;  2BQQ A;  2X38 A;  3V3X A;  4JL9 A;  2ZVN A;  2K1F A;  3MC0 B;  2KHW B;  5DPT A;  2SEB D;  3GZN B;  2KDE B;  2XN9 C;  4WQM A;  2C7N B;  2I38 A;  2K0P A;  3DCG A;  3A9J B;  3ZKJ C;  1RM6 C;  4M01 A;  4GOC A;  3RZW C;  3NVV A;  3U4E G;  5LXH A;  4L1B A;  1E6E B;  2IGD A;  4IUM B;  1P7E A;  3R8B A;  3SFD B;  2PJH A;  2RDG A;  3GZN I;  1QF6 A;  1VZ6 A;  2ACZ B;  1UEL A;  2G4D B;  4ZRP A;  3FIL A;  4ICV A;  1C4A A;  1XT9 B;  3HM3 A;  3H6N A;  4EEW A;  3M3J A;  4NAW B;  3UIN B;  1IBX A;  2DZI A;  3U8Z A;  1V97 A;  3VUW A;  3DVG X;  3MC8 A;  1ET6 A;  2J52 A;  1UNS A;  2PLP A;  3VUX A;  5T8I A;  2PE6 B;  2M17 A;  2ICI A;  3V05 A;  3ZDT A;  2M8S A;  1K51 A;  4MGY E;  5KHO A;  2WX1 A;  3V61 A;  2JX5 A;  5DCN A;  2BYV E;  3Q8F A;  1V86 A;  4GDL A;  2HDE A;  2WXN A;  2KKC A;  3KQ4 A;  1ROE A;  4K7W A;  5DPR A;  2AQ1 B;  2E6X A;  4LJP B;  1C3T A;  1SSN A;  2RDB C;  2O2V B;  4ZYN A;  2NCN A;  3TEW A;  5J2R A;  3VTV A;  4A3P A;  2DYM A;  3N1Y C;  3N3K B;  1DYQ A;  2O6V B;  2LWP A;  1GC7 A;  3Q3F A;  3I5J C;  2LVO A;  4LNN A;  1AW7 A;  2XK5 B;  3BK1 A;  3A4R A;  3ONS A;  4YWG G;  2KYW A;  1ISN A;  2IDY A;  2DZM A;  4GDK A;  2MSE D;  2DAF A;  2N9P C;  1FRD A;  4IC7 B;  1QQR A;  1J7C A;  2V3P A;  3AUL A;  3OLM D;  1ENF A;  4KSK C;  1AN8 A;  3KLS X;  5BMH A;  2GI9 A;  4M8M A;  2W3S A;  2QIL A;  4KV2 A;  1UUP A;  1JRO A;  5MPO A;  4ACF A;  2HE7 A;  2KTR A;  4EOY A;  2YVC A;  1FCC C;  2QJL A;  3VH4 B;  1TT5 B;  4ITK A;  3RI7 C;  2EMS A;  1MG8 A;  4W9J A;  1SE4 A;  1ZE3 D;  2LGI A;  2KD0 A;  1ESF A;  1JWM D;  1YN3 A;  4IM0 A;  3Q3N C;  4TQ1 A;  4LK0 M;  2J0J A;  4G50 A;  1FEH A;  1XLN A;  4IOI E;  2CR5 A;  4TMA B;  4IKG A;  4TKN A;  4HPM B;  3TMP B;  4FLH A;  2AX5 A;  3WIM A;  1KRH A;  2K6D B;  1E9M A;  4KX6 B;  3QC8 B;  4REZ A;  1C9F A;  3HVD A;  4PT5 A;  1IBX B;  3JVZ X;  4HKQ A;  4MH8 A;  1FRR A;  3UIO B;  1FXI A;  3MHZ A;  2WHI A;  3JSV B;  3KUC B;  4XC2 A;  4FXC A;  3PRZ A;  3I3T B;  2N9L A;  1L7Y A;  2WDR B;  3R2T A;  1MPE A;  5E6J A;  4NZL B;  3ZRC A;  4EZL A;  2WXL A;  5LNK 1;  5IA7 A;  1GB1 A;  2LI5 A;  2OED A;  2K22 A;  2HTM E;  4CQN A;  3O13 A;  1C4P A;  4CO7 A;  4AS1 A;  1ZDV A;  2KC1 A;  3AEC B;  2Q5W D;  1P3Q U;  2R61 A;  1JQ4 A;  2LMC A;  3ZTC A;  4ANV A;  1BXT A;  4RF0 A;  1KH0 A;  3L16 A;  2V0G A;  1FXT B;  4P1C C;  1GNU A;  3AEA B;  4MH0 E;  3ZNI D;  4LNF A;  1LFD A;  1YQB A;  2IYD B;  3B1L X;  4II3 B;  4K1R B;  1TKY A;  3L10 B;  4HXD A;  2INP E;  2RSU A;  2N7D A;  2WU5 B;  2JYT A;  1FFU A;  1L5P A;  4FJV B;  3AE1 B;  2PVG C;  1V9J A;  1F77 A;  2LJ5 A;  3QK0 A;  4BKS A;  1NYQ A;  1I7H A;  3DVG Y;  1JWS D;  1S1Q B;  3URY A;  3RT3 B;  5AUI A;  3QAQ A;  2WLB A;  3VH3 B;  2GLS A;  4Q2J A;  3CF6 E;  2MP2 A;  1VR9 A;  3LB8 C;  3B08 A;  5HHD G;  3DDC B;  1PFD A;  3AE9 B;  1JWB D;  2IGH A;  3W1S C;  3QJZ A;  1ZDX A;  2LRW A;  3BVZ A;  4MAC A;  2JY6 A;  2L76 A;  4ZYS A;  2LGD A;  3ZGZ A;  3KWL A;  1CQV A;  2YLM A;  2K6Q A;  2ZPN A;  1V2Y A;  3PHX B;  4YT0 B;  4XWT A;  2GOW A;  1D4B A;  2PVO D;  4GGQ A;  3AE5 B;  4EZK A;  4LNK A;  4NJ6 A;  1F2R C;  2KJR A;  3SR6 A;  2I1K A;  2WXM A;  3PT2 B;  1XCT L;  2MQJ A;  5AUK A;  4ZOH C;  2DYO A;  4GXB A;  2VRR B;  3S2A A;  3B2G A;  3R66 C;  2NVU I;  1I4G A;  2WWZ A;  2LGX A;  5C3J B;  1B1Z A;  2FCQ A;  1D3Z A;  1P7F A;  2CHX A;  1TS5 A;  1M4V A;  3AE3 B;  4ARI A;  3U7D A;  1R7S A;  3N32 A;  4BBN C;  4N58 A;  2INN E;  3APF A;  5I4D A;  4TV3 A;  3ZXV A;  3KYC D;  1LXD A;  3TUO A;  1N62 A;  2KLG A;  4MEL A;  4RGT A;  1AAR A;  3Q8C A;  2MBE A;  2OJW A;  4XYC A;  1HZ5 A;  3BWU D;  1N61 A;  5C2T B;  3X23 A;  3RFZ B;  4ZDV A;  4XWW A;  2UU7 A;  3RUL A;  1V1P A;  1IGD A;  1XO3 A;  1VD2 A;  4W9L A;  5IO9 A;  5TR5 A;  3VQI A;  4AUQ C;  1B9R A;  4KIK A;  2MJE A;  3AU5 A;  2DEN B;  4RF1 A;  1WRI A;  4ANU A;  3AV8 A;  5J18 A;  2GRI A;  4M8N A;  1VCB A;  3VRA B;  3PZ8 A;  1NDD A;  2NBV B;  3KVF B;  3NZU A;  4W9E A;  2LGS A;  4D2K A;  4HVB A;  5AEK B;  3Q3J A;  5D7G A;  1E7U A;  3A9J A;  1UH6 A;  2JZP A;  2D2Q A;  2KK8 A;  4P1B C;  2WXP A;  1UBQ A;  2JYE A;  2EKE C;  1KTK A;  3L54 A;  4WAF A;  1SGH A;  1WF9 A;  1WJ6 A;  3AE8 B;  2AL6 A;  3RN9 C;  3TEZ A;  3KW5 B;  4WAA A;  4IG7 B;  2FNJ B;  4FBJ B;  2JVC A;  1WGR A;  4W9G A;  4XGA B;  3RPF C;  3ML9 A;  4PYU A;  4GSW A;  3RYT A;  1Y56 A;  2H88 B;  3P1M A;  4EE2 A;  3Q8B A;  5BYS A;  2PEA A;  1R4N I;  3QQ8 B;  2KVR A;  5IOI A;  4NAW A;  1EO6 A;  3BVM A;  4BKG A;  2CKH B;  2E3T A;  1YOV B;  1D5M C;  2K3U A;  2BYF A;  3AEG B;  2AL3 A;  2N7J A;  3ABV B;  4NY0 A;  1T0R C;  3IT4 B;  2K5P A;  3VTU A;  1U4A A;  1DGJ A;  3OJ4 B;  5HG2 A;  3W1Y A;  1FO4 A;  1T0Y A;  2V1Y A;  1MFW A;  1P0R A;  4P16 A;  2B76 B;  1KM7 A;  3L13 A;  4MM3 B;  1ZGU B;  1NBF C;  1YX5 B;  2D11 A;  2TSS A;  3ZRF A;  5IP4 D;  1I42 A;  3JW0 X;  1V5T A;  4ZRQ A;  4AJY B;  1N60 A;  1RWS A;  1VRA B;  3P42 A;  3NUH B;  3QX1 A;  4LJO B;  3GP7 A;  5JHB A;  3HVZ A;  2C7M B;  2O6V A;  3AI5 A;  3PRE A;  3ZNZ B;  2KN5 A;  2MA9 B;  4EKU A;  5C1Z A;  1K52 A;  2LVP A;  5L83 A;  1EU4 A;  1DOX A;  1XLO A;  3PSE B;  2BPS A;  3I9V 1;  5GXG B;  2KWU B;  3AN1 A;  3RNE C;  1LGR A;  2IJ0 A;  1K50 A;  1JWA D;  1V1O A;  4K7S A;  2N9X A;  2PMV A;  4DXA B;  3BK2 A;  4ZHO A;  1E90 A;  1STE A;  2VZK D;  1V80 A;  2JZZ A;  2WXO A;  4RGO S;  1A70 A;  3A1Q A;  2KMA A;  3Q8E A;  4OVZ A;  2MWS B;  2ZW1 A;  3L08 A;  4KGR A;  2DZK A;  3KUZ A;  1GJZ A;  2JRI B;  3PO0 A;  2MBQ A;  4ARC A;  3NZS A;  3FC4 A;  4IM3 A;  3BVG A;  4DHJ D;  3N1Z C;  4FAD A;  1GUA B;  1Q5W B;  1FNV A;  1S3S G;  5AZF A;  3NVW A;  3DWM A;  1HTO A;  3AU4 A;  2BB5 A;  3R7Q A;  2ZNV B;  5D2M B;  1QOF A;  3HK0 A;  4WWN A;  1WI0 A;  3B2F A;  3TSS A;  5D94 A;  3R2I A;  1TIF A;  4L2Y A;  3EUB 2;  4NAM A;  2ONQ A;  2XNA C;  2KX0 A;  3OG5 A;  4HK2 A;  2LXC A;  2CU3 A;  4W9F A;  2RGF A;  3ZIM A;  1N5W A;  3JSV A;  1SE3 A;  3TEY A;  3HIZ A;  4GN1 A;  1XCQ L;  1YD8 U;  1BML C;  3N1X C;  2MHJ A;  4AQ7 A;  4WWO A;  3MFG A;  2ZCB A;  2ZCC A;  1WGG A;  4RM8 A;  2WP9 B;  3PTF C;  1Q10 A;  4BZA A;  4ZRJ A;  3RNA C;  1ZP0 B;  2L0T A;  4RFB A;  3KH0 A;  4ANW A;  5G2N A;  1RFA A;  2Y5B B;  2GBN A;  1TKG A;  1VJK A;  1NI2 A;  3VUY A;  1AYF A;  4PYZ A;  1YN4 A;  2IND C;  2NR2 A;  3ZTD A;  3IHP C;  2BS2 B;  2BTE A;  1L0X B;  3FAH A;  3KWV A;  2KQS A;  4HPL B;  2RDH A;  4TSS A;  1WXA A;  4UDU C;  4A55 A;  3ZXR A;  1ET9 A;  1XXG A;  3QWZ B;  1WGY A;  1FXA A;  1WZ0 A;  5G55 A;  5BMI A;  1C79 A;  1UWM A;  4A9A A;  4J6I A;  3KUD B;  2GBJ A;  3OWE B;  2MCN B;  1Q0W B;  3BII D;  1GB4 A;  3A4S C;  1EWC A;  3A33 B;  3NS1 A;  1IYF A;  2N1V A;  2FE8 A;  4W9D A;  2YEP F;  4HLE A;  2LHD A;  2B3A A;  2C7H A;  1XLQ A;  3ZJV A;  1G6J A;  3GB1 A;  3TCA A;  2YEP B;  3W5V B;  3A1Q B;  2LUM A;  4USA A;  2VH1 A;  4YTP B;  1WWT A;  4ZHP A;  3UF8 A;  2LJI A;  4B95 A;  3TL5 A;  1D6E C;  1WX9 A;  1E10 A;  3ECI A;  1I4Q A;  2KWC A;  3GS2 A;  2K25 A;  5G5G A;  3ZDM C;  3IG3 A;  4OZC A;  4DWF A;  3WCQ A;  4TQ0 A;  3H7S A;  2Z59 B;  4ZRI A;  1NEN B;  2ON8 A;  1YIW A;  3W2D A;  3AXC A;  3AED B;  3ENE A;  4AOF A;  4US8 A;  4B0M A;  2PE9 A;  1JAL A;  2ZJD A;  4XDD A;  3Q6B A;  2A5U A;  2M4N A;  4KKJ A;  2J4X A;  3V6E B;  3EFC A;  1SJE D;  4ANX A;  3K9P B;  2JSV X;  1LM8 B;  2ZEQ A;  3IAM 1;  3RD2 A;  2AQ2 B;  2OHF A;  2GBK A;  1MJD A;  1SEB D;  4LCD E;  4ICU A;  2MH7 A;  2NPT B;  1PQS A;  2J42 A;  1VDV A;  3HHM A;  4KDI C;  4A3O A;  3SU8 X;  2AYO B;  3T3N A;  3M95 A;  2C5L C;  2MBH A;  4FN2 A;  2N9K A;  1OTR B;  2WXK A;  1GOZ A;  5E6N A;  3WAP A;  3C19 A;  3QHT A;  3NS8 A;  3GOE A;  2KAC A;  2IO0 B;  4HCP B;  3N30 A;  2Z0D B;  4MGK E;  3V62 A;  1RFK A;  1Y8R C;  3NZ3 A;  2D3A A;  2MJD A;  4OZB A;  2JT4 B;  2N7E A;  1XF5 L;  2GMI C;  1VZ7 A;  3P4Q B;  2BYT A;  2GBM A;  1WGH A;  1QOG A;  3VTW A;  3PGE A;  5BMG A;  1I35 A;  1WJN A;  3E9S A;  3NVZ A;  2NMQ A;  3W9C B;  5HI1 A;  3MJ5 A;  3NJT A;  1VZ8 A;  2L1A A;  1T3Q A;  3Q8A A;  4WJQ A;  1GPX A;  3WAN A;  4JLC A;  3T8M A;  3Q14 C;  1HEZ E;  2JWU A;  3ZW3 A;  5EE3 A;  4B9K A;  2KZR A;  3AEB B;  2WXR A;  2IPK D;  1ZKH A;  3P4R B;  1WY8 A;  5CHV C;  3QCA A;  4KZ0 A;  3X0W A;  2WU2 B;  1UWX A;  1KLG D;  2DZJ A;  2WS3 B;  2IZV B;  2L3Z A;  3DWG C;  1TKE A;  3PRP B;  4P6V F;  5EDS A;  2QC8 A;  2AWT A;  2L83 A;  4L23 A;  1L2N A;  4HEA 1;  1P98 A;  1UD7 A;  2L00 B;  3AE6 B;  2WXI A;  1CMX B;  3A9K B;  4IWQ A;  2QHO A;  1L6U A;  2M19 A;  4R3D A;  2D07 B;  2W54 A;  4MJS A;  2KAN A;  1WSP A;  1L0Y B;  5HFY A;  4KSL C;  4HPP A;  2W55 A;  1TTN A;  4RH6 A;  1UZX B;  4F7Z A;  3TIX A;  3B9J A;  4I6N B;  2AQ3 B;  1LO5 D;  4DXG A;  5FKA C;  3H1U A;  2WXQ A;  4WJN A;  3RNF C;  2BW2 A;  5CTR C;  3NG0 A;  1IP9 A;  3PRM B;  1XLP A;  4B0E A;  1V49 A;  1SJH D;  3DQV A;  1Z2M A;  4EUT A;  2KX3 A;  2N0S B;  4MM3 A;  4OHJ A;  3ZNH B;  2A4Z A;  1ZUD 2;  2IO2 B;  2VH2 A;  4ZRK A;  3MHS D;  1N6Z A;  4II2 B;  2KNB A;  3BY4 B;  2GB1 A;  1H8C A;  3E56 A;  1HQR D;  1PYW D;  2JRH A;  2K8B A;  1WM2 A;  3I63 C;  2JUO A;  1E7V A;  4OVU A;  4BBN F;  1F1H A;  1LQB A;  2J7Q B;  3SFE B;  2CU1 A;  1E8X A;  3VFK A;  3OAW A;  4N59 A;  3VR9 B;  2BB6 A;  2KVZ A;  4JWS C;  4F1S A;  4K7U A;  4RNA A;  1YMH E;  5DPW A;  1YJI A;  2EKI A;  1F2R I;  2HJ1 A;  2L8J A;  4JE3 B;  1GAQ B;  2BVC A;  1JRU A;  3H7P B;  3NY5 A;  2INC C;  2VZK B;  5FR6 A;  5HKH A;  1C1Y B;  5BYQ A;  1TBE A;  3ZUN A;  2V9H A;  3HUI A;  3EA6 A;  3HM6 X;  1K8R B;  2WX0 A;  1T0S C;  4DHJ B;  5DPS A;  2MEK A;  1R4N B;  2G4S A;  2L0F A;  3P2B A;  2QDF A;  2OJR A;  4DHZ B;  4FHJ A;  3PLV A;  1QIL A;  4A8X C;  1NVI D;  1F52 A;  5JHA A;  4NJC A;  4C4V A;  3JYU A;  5C23 A;  3PVL A;  4W9I A;  4LDT D;  1SB3 C;  2BWE S;  3R3M A;  1OFF A;  2JWZ A;  3UI3 A;  1NYR A;  3SHQ A;  1FMA D;  1TYG B;  2IO3 B;  1KLU D;  3QA8 A;  4MJS B;  4WQO B;  3RNB C;  1R4M I;  1TZ1 A;  3IT6 B;  1QOB A;  3U52 E;  2M56 B;  4M0W B;  3Q2A C;  3PZ7 A;  1BT0 A;  2D3G A;  2I2Y A;  1XQQ A;  4GMV A;  3MJW A;  2Y3A A;  1OQY A;  2W9N A;  3APC A;  1SIJ A;  2HD5 B;  3DHI C;  2PPH A;  2KT7 A;  3K9O B;  4M00 A;  3DPD A;  5D6J B;  2Z8L A;  1X1M A;  1WX8 A;  1YNT E;  2DLB A;  2QMT A;  4DXF A;  1YN5 A;  1WXM A;  4TUU A;  1L4D B;  2V4I B;  4W9K A;  1J19 A;  3C8Y A;  2MJ3 A;  2X8X X;  1Z5S B;  4RM9 A;  1FIQ A;  5CX3 A;  2HTH A;  1JML A;  2KWV B;  4B6W A;  1GC6 A;  5JH5 C;  1FNW A;  1WIA A;  3MC9 A;  3EEC A;  3UQA A;  1N5X A;  2PW9 A;  2W82 A;  2KC2 A;  2R2O A;  4JIO U;  1XEE A;  2BT6 A;  1QKZ A;  2KQ4 X;  2FBW B;  4G11 A;  4BOZ B;  3DBS A;  4HRO A;  2L32 A;  2JZ3 B;  5IKC M;  1XD3 B;  2LRU A;  4RCO A;  3DBR B;  3VXW A;  4WWP A;  3Q3O C;  2LUE A;  5L95 C;  3NVY A;  1MVK A;  4XX5 A;  2DAJ A;  2M0X A;  4IWP A;  3IVF A;  3ZJU A;  5CHF A;  3M62 B;  3U2S C;  2FCS A;  4FUL A;  4XDC A;  5FK9 C;  2NTS A;  2J0K A;  1YX6 B;  5IN7 A;  3ZVV A;  1UGJ A;  3I57 A;  5E6P A;  1IGC A;  3O65 B;  3MP9 A;  1MI0 A;  4C4V B;  1WR6 E;  2L05 A;  3DBR I;  4BKS D;  1CK1 A;  2BBC A;  1EUV B;  1EWY C;  3GE8 C;  2CJO A;  1QZE A;  2KDM A;  2LFI A;  3EHV A;  4KDL B;  4C00 A;  3PPA A;  1HXY D;  1RAX A;  3TJP A;  3CIR B;  3U30 A;  2UYZ B;  3AB5 A;  4BOS C;  1OGW A;  2FUG 1;  4RGM A;  1HE8 A;  2C60 A;  4ASW C;  2FCN A;  4XZ4 A;  4YSY B;  3DHH C;  1P9D U;  1F9J A;  2LAS A;  4IWO A;  4RMA A;  1TZO A;  2KWD A;  2KFJ A;  5EE0 A;  4A20 A;  2D5G A;  1PGA A;  2NBW B;  2DYB A;  2H89 B;  2MBB B;  1EF1 A;  3ALB A;  4GIV A;  4M02 A;  4YL8 A;  1EF5 A;  2NPT A;  1ZW7 A;  4OVV A;  1A5R A;  1HZ6 A;  4FJZ A;  3UQB A;  1M94 A;  4I6P A;  2BYE A;  2N4F A;  2WDT B;  1SE2 A;  4YSZ B;  1WXQ A;  3AE2 B;  3CSF A;  3PLU A;  1PGX A;  2BKR B;  1WX7 A;  2G1E A;  1I4P A;  2PKO A;  1YQ4 B;  5IAA C;  1YQ3 B;  2KFK B;  1JWU D;  5H92 C;  3J9C A;  2KJH B;  3ZLZ A;  4E71 A;  1UBI A;  3IBE A;  3IXS A;  2EMT A;  2MLB A;  1WMH B;  2JXX A;  4JGH B;  2BS4 B;  1WR1 A;  1UF0 A;  4KZC A;  2EEL A;  4J3O D;  2PIA A;  4NJ7 A;  3BYY B;  3AEF B;  4G0N B;  2CHW A;  3BZD B;  1ZOY B;  4OZA A;  1OQQ A;  1OEY A;  1UGM A;  3L4P A;  2KXJ A;  2NS5 A;  1F0Z A;  1MG4 A;  3AH7 A;  1WXV A;  1PDX A;  3TEX A;  4WIP A;  3RUI B;  4FHK A;  3AM9 A;  4JPS A;  4AJW A;  1TS2 A;  3RNG C;  2CJN A;  3UGB B;  2KMM A;  3NOB A;  3P4S B;  4EFO A;  4DQO C;  2G9H D;  1V81 A;  4YTM B;  1T0Q C;  1JRP A;  5JXV A;  2KLC A;  2MW5 A;  4WJP A;  3T3O A;  3L17 A;  3EFU A;  3A9K A;  4HKZ E;  2RPQ A;  1PGB A;  1I4R A;  2K8H A;  4MT5 A;  1KFY B;  2AEH A;  4C56 C;  3CMM B;  1FM0 D;  4DDI D;  1QLB B;  3U7Z A;  1NEK B;  1WJ4 A;  2DWQ A;  2WXF A;  5H8Y E;  1C77 A;  4IW0 A;  4E74 A;  4JWU C;  2DHZ A;  4XE0 A;  3W1S A;  1WM3 A;  4N6E B;  5EE1 A;  3FIL B;  1WFY A;  3NRZ A;  4CYE A;  4IM2 A;  1CJE A;  2BF8 B;  4NNJ B;  2LGY A;  4H2A A;  2RPV A;  4HJG E;  4AWJ A;  3PV1 A;  1WJU A;  3B0A A;  1DOI A;  3RNC C;  4OW0 A;  2BKF A;  1IPG A;  1L0V B;  2WQY B;  3LJ3 A;  3DVN U;  4JQW C;  1RLF A;  4K3B A;  4GDL B;  4YTN B;  4FA6 A;  4MSQ B;  4AP4 C;  4W9C A;  2N9E B;  1K53 A;  1MHX A;  1E8Y A;  4PS8 A;  2XBB C;  4KGT A;  4K81 A;  3H7P A;  4S17 A;  5CHW A;  2PTL A;  2LEK A;  4HDO A;  1YJ1 A;  4JX1 C;  4PK1 A;  5TSS A;  4W9H A;  2IY1 B;  4IDI A;  1N63 A;  2G45 B;  4MDK E;  4GLS C;  4LNI A;  2JPH A;  3TBL D;  1EM7 A;  1WZ3 A;  2WXG A;  3ZQ4 A;  1WYW B;  1CZP A;  1WYG A;  3RMK C;  3IAS 1;  1EU3 A;  4GDK B;  1KLV A;  4KVG B;  3BIN A;  3SEB A;  1SXT A;  2O6V D;  3D32 A;  3R7R A;  2REX A;  4HJK A;  1T6B X;  4LDT B;  5D3I B;  5JZE B;  2IBI B;  3VAW A;  3QAR A;  4HRS A;  5AZG A;  3VHT C;  3H8H A;  3WAL A;  3APD A;  5BO4 B;  1C4C A;  4N9F 4;  1KJT A;  3LYY A;  1I4H A;  1Q1O A;  3T9L A;  2D10 A;  2KTF A;  1TY2 A;  4NPN A;  1PUT A;  2WXJ A;  2KTR B;  2ASQ A;  4K3C A;  2QCZ A;  4S0R A;  2V4L A;  3LXF A;  4BAX A;  4RGN A;  1JCK B;  4URK A;  3DBH B;  2KMC A;  2IGG A;  2LXA A;  1L4Z B;  2QEJ C;  1P1A A;  1WE6 A;  2MX2 A;  4DBG A;  4LNO A;  5KHQ A;  4M0W A;  4CHK A;  3PHW B;  2JF5 A;  4X57 B;  2K8C A;  1MHH E;  2M1M A;  4HWI B;  1E8Z A;  4G3X B;  4US9 A;  3V60 A;  3EC8 A;  4WJO A;  1V6E A;  2RMM A;  3GE3 C;  1C76 A;  1ZPS A;  2K9X A;  2ZZP B;  3N20 C;  2FAZ A;  2FUH B;  4C7Y A;  1J0G A;  4C7Z A;  3DBH I;  3AMZ A;  2UWQ A;  2QIE B;  3W5U B;  2KJ6 A;  4KGS A;  3WAO A;  3N9Y C;  1WRD B;  2V3N A;  1C78 A;  1I4X A;  4A6Q A;  1WGD A;  2ZW0 A;  3AE4 B;  5EE9 A;  3ZO5 B;  1L6V A;  1NI3 A;  4DK5 A;  2ZPY A;  1OQR A;  1TS4 A;  3FKY A;  1E0Z A;  2BWF A;  2L7R A;  3NHE B;  5E6O A;  2IO1 B;  4GB9 A;  3C0R B;  3IFW B;  2L52 A;  3CST A;  1D5Z C;  2DBY A;  1SF0 A;  1SBB B;  4MEM A;  2LZ6 A;  2WDV B;  1WGK A;  4LTU A;  4DDG D;  4FJY A;  2ZVO A;  2NBU A;  2RR9 A;  3BYT B;  1WE7 A;  3H9D A;  4NQL B;  2WXH A;  1BUI C;  2NTT A;  2V3S A;  3CWI A;  3ETR A;  1SE9 A;  3SD5 A;  4F8C B;  3DBL B;  3ML8 A;  4GU2 A;  2JU6 X;  1WXS A;  1V5O A;  2FCM A;  4BFR A;  3L0W B;  1IUE A;  3MTN B;  2W3R A;  4BKT A;  2FID A;  2KO3 A;  2QSD A;  4NQK E;  1FD6 A;  3RCZ A;  2FIF A;  1FCL A;  5LXI B;  1D5X C;  4PS3 A;  5AZH A;  2OOB B;  1QT9 A;  1R4M B;  2KDB A;  1KF6 B;  1WH3 A;  3P63 A;  4KKI A;  1TS3 A;  1J8C A;  4A90 A;  1H4R A;  1KOT A;  1J7A A;  4P7I A;  1TY0 A;  3EGR A;  2WNM A;  3DBL I;  3VRB B;  3VR8 B; 
#chains in the Genus database with same CATH homology
 5LLI A;  3QJZ A;  5E6P A;  2MP2 B;  2LRW A;  3O65 B;  1WX9 A;  3ECI A;  2JY6 A;  2KWC A;  2L76 A;  3LDZ E;  1TGZ B;  1WR6 E;  2L05 A;  2K25 A;  3VVW B;  3DBR I;  2KDF B;  2LGD A;  4BKS D;  2KQ7 A;  3ZDM C;  3IG3 A;  2Z0E B;  4DWF A;  2MBO A;  2YLM A;  2K6Q A;  1EUV B;  4TQ0 A;  2ZPN A;  3DOW A;  3H7S A;  1V2Y A;  3PHX B;  2Z59 B;  4ZRI A;  1QZE A;  2GOW A;  3EHV A;  4KDL B;  1YIW A;  4GGQ A;  3M63 B;  3PPA A;  2DX5 B;  4EZK A;  1RAX A;  3AXC A;  4NJ6 A;  2KJR A;  2LD9 A;  3TJP A;  2C9W B;  2I1K A;  3ENE A;  3U30 A;  4AOF A;  2UYZ B;  3PT2 B;  2PE9 A;  2R2Q A;  2ZJD A;  4BOS C;  1OGW A;  1HE8 A;  2A5U A;  2C60 A;  4MGZ E;  2MQJ A;  2M4N A;  2FCN A;  4ASW C;  4XZ4 A;  3VDZ A;  3V6E B;  2IY0 B;  3V6C B;  1P9D U;  2DYO A;  3OJ3 A;  1F9J A;  2LAS A;  4GXB A;  4PS7 A;  2VRR B;  2LVQ A;  3S2A A;  3WAM A;  4ANX A;  4IWO A;  3R66 C;  3K9P B;  4RMA A;  2KOX A;  1E8W A;  3PZD A;  2KFJ A;  2NVU I;  2WWZ A;  4A20 A;  2LGX A;  1RRB A;  2FCQ A;  2NBW B;  2DYB A;  1LM8 B;  1D3Z A;  2CHX A;  2ZEQ A;  2MBB B;  1EF1 A;  3ALB A;  5J17 A;  4GIV A;  2N1W A;  3WA0 A;  4YL8 A;  3U7D A;  1EF5 A;  3N32 A;  3QIJ A;  2NPT A;  1ZW7 A;  4OVV A;  3UIP B;  4BBN C;  1A5R A;  4FJZ A;  3RD2 A;  3APF A;  4TV3 A;  3UQB A;  4EZJ A;  1M94 A;  3KYC D;  2GBK A;  1LXD A;  4E3C A;  2CS4 A;  4I6P A;  2BYE A;  1E5W A;  4DHZ E;  4LCD E;  2N4F A;  2WDT B;  4ICU A;  2RD0 A;  2NPT B;  4MSM B;  2KLG A;  3CSF A;  3PLU A;  2BKR B;  4MEL A;  1PQS A;  3HHM A;  4KDI C;  4A3O A;  3ZNG C;  2GBR A;  1AAR A;  3SU8 X;  2KFK A;  2AYO B;  1WX7 A;  3PS6 A;  3M95 A;  2C5L C;  2MBH A;  2MBE A;  4FN2 A;  1OTR B;  5IAA C;  2J0M A;  2KFK B;  2WYQ A;  5E6N A;  3WAP A;  2O2V A;  1OEY J;  2KJH B;  4HDQ A;  3ZLZ A;  3QHT A;  1WMH A;  3X23 A;  1UBI A;  4E71 A;  3IBE A;  4ZDV A;  4I6L B;  3NS8 A;  3GOE A;  2CHZ A;  2EMT A;  2IO0 B;  4HCP B;  3N30 A;  2Z0D B;  4MGK E;  3RUL A;  3V62 A;  4BVU C;  1VD2 A;  1Y8R C;  2MLB A;  4W9L A;  1WMH B;  2JXX A;  4JGH B;  5GMV A;  1WR1 A;  5TR5 A;  3VQI A;  4AUQ C;  4KZC A;  3SDL C;  2JT4 B;  2N7E A;  4KIK A;  3DVN V;  2XEW A;  2GMI C;  3AU5 A;  2G3Q B;  3KYD D;  4NJ7 A;  2DEN B;  2CHW A;  2XK5 A;  2GBM A;  4G0N B;  1WGH A;  3VTW A;  3PGE A;  2I1J A;  4ANU A;  1OEY A;  1WJN A;  4KIK B;  1UGM A;  3RZF A;  1I35 A;  4HCN B;  2KXJ A;  5J18 A;  2NS5 A;  4M8N A;  1VCB A;  2BGF A;  1NDD A;  2NBV B;  3KVF B;  1WXV A;  2HJ8 A;  4WJQ A;  4MGI E;  3NZU A;  4W9E A;  3RUI B;  4JLC A;  1GG3 A;  3T8M A;  3WAN A;  2K39 A;  4FHK A;  2MRP A;  1SIF A;  3ZW3 A;  2KDI A;  4AJW A;  4B9K A;  4HVB A;  5AEK B;  2KZR A;  2ZNV C;  3Q3J A;  3UGB B;  5D7G A;  1ZKH A;  3NOB A;  4JL9 A;  2ZVN A;  4EFO A;  1WY8 A;  5CHV C;  2K1F A;  3QCA A;  4KZ0 A;  3X0W A;  2KHW B;  1E7U A;  3A9J A;  1UH6 A;  5DPT A;  1V81 A;  2D2Q A;  2KK8 A;  1UBQ A;  2KDE B;  2EKE C;  2C7N B;  3DCG A;  3L54 A;  2DZJ A;  1SGH A;  2KLC A;  2IZV B;  2L3Z A;  2MW5 A;  3PRP B;  3A9J B;  1WF9 A;  4WJP A;  1WJ6 A;  3ZKJ C;  5EDS A;  3L17 A;  2AL6 A;  4GOC A;  2AWT A;  3EFU A;  3A9K A;  3KW5 B;  1L2N A;  1P98 A;  3RZW C;  2RPQ A;  4WAA A;  1UD7 A;  2L00 B;  4IG7 B;  2FNJ B;  4FBJ B;  2JVC A;  1WGR A;  2K8H A;  4W9G A;  2AEH A;  5LXH A;  3CMM B;  1CMX B;  3A9K B;  4IUM B;  4DDI D;  4IWQ A;  2QHO A;  3ML9 A;  4PYU A;  4GSW A;  3RYT A;  2PJH A;  3GZN I;  1WJ4 A;  2PEA A;  1R4N I;  2D07 B;  3QQ8 B;  4MJS A;  2KAN A;  2KVR A;  1UEL A;  4KSL C;  2G4D B;  4NAW A;  4IW0 A;  4E74 A;  1EO6 A;  1TTN A;  2DHZ A;  1UZX B;  4F7Z A;  4BKG A;  2CKH B;  3TIX A;  1WM3 A;  4ICV A;  3W1S A;  1XT9 B;  3HM3 A;  3H6N A;  4I6N B;  4EEW A;  3M3J A;  4NAW B;  3UIN B;  2DZI A;  3H1U A;  3U8Z A;  3VUW A;  1WFY A;  2BYF A;  4WJN A;  3DVG X;  5CTR C;  1IP9 A;  3PRM B;  2AL3 A;  1V49 A;  4NY0 A;  4CYE A;  4IM2 A;  3VTU A;  1U4A A;  3DQV A;  2BF8 B;  3VUX A;  3OJ4 B;  1Z2M A;  4EUT A;  2KX3 A;  4MM3 A;  3W1Y A;  1T0Y A;  2V1Y A;  3ZNH B;  4NNJ B;  2LGY A;  4AWJ A;  2PE6 B;  3PV1 A;  1P0R A;  1WJU A;  2M17 A;  3B0A A;  2A4Z A;  1KM7 A;  2IO2 B;  4ZRK A;  3L13 A;  2BKF A;  1ZGU B;  3ZDT A;  1NBF C;  2M8S A;  3MHS D;  4MGY E;  1YX5 B;  2D11 A;  5KHO A;  2WX1 A;  3V61 A;  3ZRF A;  1IPG A;  1I42 A;  4II2 B;  3JW0 X;  2KNB A;  3BY4 B;  5DCN A;  2BYV E;  1H8C A;  1V86 A;  4GDL A;  3LJ3 A;  1V5T A;  2JRH A;  3DVN U;  2KKC A;  4JQW C;  1RLF A;  4AJY B;  4K7W A;  5DPR A;  2K8B A;  1WM2 A;  2JUO A;  1E7V A;  4OVU A;  4BBN F;  4LJP B;  4GDL B;  1LQB A;  2J7Q B;  1C3T A;  2CU1 A;  1E8X A;  3VFK A;  4FA6 A;  4MSQ B;  3QX1 A;  2O2V B;  3OAW A;  4LJO B;  4W9C A;  4ZYN A;  4AP4 C;  2N9E B;  5JHB A;  2NCN A;  4PS8 A;  1E8Y A;  2C7M B;  2O6V A;  4F1S A;  2XBB C;  4K7U A;  5J2R A;  3AI5 A;  3VTV A;  4K81 A;  4A3P A;  3PRE A;  2DYM A;  3H7P A;  5DPW A;  3ZNZ B;  2KN5 A;  3N3K B;  5CHW A;  2O6V B;  2LWP A;  1GC7 A;  4HDO A;  2L8J A;  1YJ1 A;  2MA9 B;  3Q3F A;  4EKU A;  5C1Z A;  2LVO A;  2IY1 B;  4W9H A;  3H7P B;  1JRU A;  2XK5 B;  2G45 B;  3A4R A;  3ONS A;  3NY5 A;  4MDK E;  2LVP A;  5L83 A;  1ISN A;  2JPH A;  5FR6 A;  3TBL D;  2DZM A;  1WZ3 A;  3PSE B;  2BPS A;  2MSE D;  4GDK A;  5HKH A;  1WYW B;  2DAF A;  2N9P C;  1C1Y B;  2KWU B;  1TBE A;  3ZUN A;  4IC7 B;  4GDK B;  1KLV A;  4KVG B;  3AUL A;  3BIN A;  3OLM D;  2O6V D;  3HM6 X;  4K7S A;  3D32 A;  2N9X A;  3R7R A;  4DXA B;  2REX A;  4KSK C;  4HJK A;  1K8R B;  2WX0 A;  4DHJ B;  4LDT B;  4M8M A;  5DPS A;  5JZE B;  2IBI B;  3VAW A;  1E90 A;  3QAR A;  5AZG A;  2G4S A;  3VHT C;  1V80 A;  4KV2 A;  3WAL A;  2JZZ A;  3APD A;  5BO4 B;  2L0F A;  3A1Q A;  3P2B A;  2KMA A;  4N9F 4;  1KJT A;  2OJR A;  4DHZ B;  2MWS B;  4FHJ A;  3L08 A;  1Q1O A;  2HE7 A;  3T9L A;  2DZK A;  2D10 A;  3KUZ A;  3PLV A;  2KTR A;  1GJZ A;  4EOY A;  2KTF A;  5JHA A;  2YVC A;  4NPN A;  3VH4 B;  2JRI B;  2EMS A;  1MG8 A;  2KTR B;  2ASQ A;  2MBQ A;  3JYU A;  3NZS A;  4IM3 A;  4W9J A;  5C23 A;  3PVL A;  4W9I A;  4DHJ D;  4LDT D;  2V4L A;  4FAD A;  1GUA B;  2BWE S;  1Q5W B;  3R3M A;  1S3S G;  2KD0 A;  4URK A;  5AZF A;  2KMC A;  2LXA A;  4IM0 A;  4TQ1 A;  3AU4 A;  2J0J A;  4G50 A;  2JWZ A;  1P1A A;  1WE6 A;  3R7Q A;  3SHQ A;  2ZNV B;  5D2M B;  2IO3 B;  2CR5 A;  2MX2 A;  4TKN A;  3HK0 A;  4WWN A;  4DBG A;  3QA8 A;  4HPM B;  4FLH A;  4MJS B;  1WI0 A;  4WQO B;  3TMP B;  1R4M I;  5D94 A;  5KHQ A;  3WIM A;  4CHK A;  3PHW B;  1TZ1 A;  2JF5 A;  2K6D B;  4X57 B;  2K8C A;  2M1M A;  4HWI B;  1E8Z A;  3QC8 B;  4G3X B;  2KX0 A;  3V60 A;  3EC8 A;  4M0W B;  4WJO A;  4HK2 A;  1BT0 A;  2D3G A;  2LXC A;  1V6E A;  1XQQ A;  3JVZ X;  4GMV A;  2ZZP B;  4W9F A;  3MJW A;  2RGF A;  3ZIM A;  2FAZ A;  1OQY A;  2FUH B;  2W9N A;  1J0G A;  3JSV A;  3DBH I;  3APC A;  2HD5 B;  2UWQ A;  2PPH A;  3HIZ A;  4GN1 A;  3UIO B;  2KJ6 A;  1YD8 U;  3WAO A;  1WRD B;  3JSV B;  3K9O B;  4WWO A;  2ZCB A;  2ZCC A;  3KUC B;  1WGG A;  4RM8 A;  4XC2 A;  1WGD A;  3DPD A;  3PTF C;  3PRZ A;  4ZRJ A;  5D6J B;  3I3T B;  1X1M A;  2L0T A;  3KH0 A;  4ANW A;  3ZO5 B;  1WX8 A;  5G2N A;  1L7Y A;  1RFA A;  2Y5B B;  2GBN A;  1NI2 A;  4DK5 A;  2ZPY A;  3VUY A;  3ZRC A;  4PYZ A;  4EZL A;  5IA7 A;  1WXM A;  2NR2 A;  4TUU A;  2BWF A;  2L7R A;  2LI5 A;  3ZTD A;  3NHE B;  4W9K A;  1J19 A;  5E6O A;  2IO1 B;  4GB9 A;  3C0R B;  3IHP C;  4CO7 A;  3IFW B;  2KC1 A;  1Z5S B;  4RM9 A;  2KQS A;  3CST A;  4HPL B;  1WXA A;  1P3Q U;  4MEM A;  2LZ6 A;  3ZTC A;  4ANV A;  5CX3 A;  4DDG D;  2HTH A;  3L16 A;  3QWZ B;  4FJY A;  1FXT B;  1WGY A;  2KWV B;  2ZVO A;  4B6W A;  1WZ0 A;  2NBU A;  1GNU A;  1GC6 A;  5G55 A;  2RR9 A;  4MH0 E;  5JH5 C;  3ZNI D;  1WIA A;  3EEC A;  3UQA A;  4J6I A;  3KUD B;  1LFD A;  1YQB A;  2GBJ A;  2MCN B;  1WE7 A;  2IYD B;  3W1S C;  1Q0W B;  3B1L X;  2KC2 A;  2R2O A;  3H9D A;  4II3 B;  4JIO U;  4K1R B;  3L10 B;  4NQL B;  3A4S C;  2V3S A;  3A33 B;  4HXD A;  2RSU A;  2N7D A;  1SE9 A;  3SD5 A;  4F8C B;  4FJV B;  3ML8 A;  4GU2 A;  4G11 A;  4BOZ B;  2N1V A;  1IYF A;  4W9D A;  3DBS A;  1WXS A;  2JZ3 B;  1V9J A;  1V5O A;  2FCM A;  4BFR A;  4HLE A;  1XD3 B;  2LRU A;  2LJ5 A;  3L0W B;  3MTN B;  3QK0 A;  4BKT A;  2B3A A;  4BKS A;  2C7H A;  2FID A;  3VXW A;  2KO3 A;  4NQK E;  4WWP A;  3DVG Y;  2LUE A;  5L95 C;  1S1Q B;  4XX5 A;  1G6J A;  3RCZ A;  2DAJ A;  2FIF A;  2M0X A;  4IWP A;  3RT3 B;  3TCA A;  5LXI B;  3QAQ A;  4PS3 A;  5AZH A;  3IVF A;  2OOB B;  2KDB A;  1WH3 A;  3M62 B;  5CHF A;  2FCS A;  4FUL A;  3VH3 B;  1J8C A;  3A1Q B;  1H4R A;  1KOT A;  4P7I A;  2J0K A;  3CF6 E;  2MP2 A;  1YX6 B;  3B08 A;  3UF8 A;  3DDC B;  3DBL I;  4B95 A;  3ZVV A;  3TL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...