2OJRA

Structure of ubiquitin solved by sad using the lanthanide-binding tag
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
GPGYIDTNNDGWIEGDELYIDTNNDGWIEGDELLAMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Double-Lanthanide-Binding Tags for Macromolecular Crystallographic Structure Determination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 21
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2007-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ojrA02
2N7EA 2JY6A 1OTRB 3L13A 1Z2MA 4WWNA 1Z5SB 2LI5A 3H7SA 5J18A 5G55A 4FA6A 2O2VA 1UGMA 3PT2B 4A20A 2FCSA 2BPSA 3WANA 1WZ3A 3HK0A 4HVBA 3VUYA 4PS7A 3TBLD 3ZKJC 1NBFC 3PRPB 2WX0A 3PS6A 2BWES 5AEKB 4FJZA 4WWPA 3U30A 3IBEA 4HDOA 4ANVA 2KTRB 4K7WA 3L16A 3DPDA 1VD2A 3W1SA 2KO3A 3APCA 3OAWA 3R7QA 3GZNI 4GGQA 1RRBA 2KC2A 2C7MB 2M0XA 1V80A 3DDCB 5C1ZA 2PEAA 3KYCD 3ZRCA 3H7PA 4F8CB 2CS4A 2KKCA 2V4LA 5AZFA 3U7DA 1WXAA 4HDQA 2UYZB 3ZIMA 2KDIA 2CHXA 2ZZPB 2IY1B 3HHMA 3UIPB 3ML8A 4ZRKA 1UELA 4I6PA 4AOFA 4OVVA 4W9HA 1YQBA 2AEHA 1E8YA 1WGDA 4XZ4A 1NDDA 3DBSA 1WXSA 1UBIA 3V62A 2KMCA 2IYDB 4HPMB 4EZLA 1GNUA 3QIJA 4IM0A 3VDZA 2KLCA 3A1QA 2DZKA 1NI2A 5D7GA 2RSUA 3M3JA 1OEYJ 3BY4B 2XBBC 3TMPB 1EO6A 4MJSB 3SDLC 2C9WB 5GMVA 2KN5A 4WQOB 1TBEA 3RT3B 3PTFC 1S1QB 3RULA 2Z0DB 4FBJB 1WX9A 3KW5B 2K8CA 4MDKE 2WYQA 2LVPA 1V86A 1V5OA 2MBHA 2MLBA 2EMSA 1SE9A 3JSVA 3RD2A 3V6EB 1R4MI 2A5UA 3A9JB 4KDIC 4PYUA 2ZPNA 2XK5A 3A4SC 3WA0A 4NQKE 4HXDA 1WR6E 3CSTA 4FLHA 3DOWA 2PE6B 3JW0X 4WWOA 3ONSA 2RD0A 2J0JA 3TJPA 4GU2A 3HM3A 4DK5A 1J0GA 4IW0A 2ASQA 3OJ3A 1WFYA 4W9IA 3VTUA 2N9XA 2JVCA 3M62B 4I6NB 3VVWB 4K7SA 3ZDTA 3NHEB 5EDSA 3UQBA 4IM2A 4MGYE 4E74A 1LM8B 4RM9A 2O6VA 3A9KB 3AXCA 3H6NA 3EECA 3V60A 5D94A 4NJ7A 4CYEA 4EEWA 4M0WB 4II3B 5JZEB 2JT4B 4FJVB 4G11A 1FXTB 2DYMA 2N4FA 4HK2A 1K8RB 2CKHB 2KDFB 3TL5A 4NY0A 2D10A 2AL6A 4ASWC 4EUTA 3WIMA 2KD0A 2N9PC 5KHOA 5LLIA 2GBKA 3ZUNA 1C1YB 3RZWC 4F1SA 3JYUA 1U4AA 2M1MA 4OVUA 4HPLB 4TQ0A 4DDGD 4GOCA 4FHKA 1GJZA 3D32A 2DZIA 4GDKB 4KIKB 2DZMA 2CU1A 1KM7A 3VAWA 4RM8A 1MG8A 3W1YA 4MJSA 1OGWA 2KANA 1WX8A 4NJ6A 1WGGA 4ANXA 1H4RA 3WAPA 5IAAC 2YLMA 4JL9A 1WXMA 3AU5A 2R2QA 3L10B 1EUVB 1WXVA 4W9DA 4DBGA 1WH3A 5CHWA 4WJQA 1WE7A 2NPTB 3V61A 3QHTA 3VTWA 4NQLB 3H9DA 2BKFA 2WWZA 3A9JA 5CHVC 3EC8A 1G6JA 3P2BA 3ZRFA 3DVGX 2EKEC 1YX6B 3DBRI 1L7YA 2K6DB 4AWJA 1YJ1A 1V81A 2MBEA 2A4ZA 5LXIB 2JRIB 1LXDA 2KVRA 1OEYA 2G4SA 4N9F4 2KFKB 2NCNA 2KK8A 5IA7A 4W9GA 4LCDE 1TTNA 3PVLA 5TR5A 2O6VB 2K1FA 2KZRA 4GB9A 2J0KA 1RAXA 1V6EA 3VHTC 1WM2A 3ZNID 2K8HA 4IWQA 1I42A 4TV3A 3KVFB 2FNJB 3EFUA 4FN2A 3NZUA 4K7UA 3SU8X 3SHQA 5DCNA 3A9KA 2KDEB 4MGZE 1WMHB 2WX1A 2JZ3B 4IC7B 4J6IA 3N30A 2KHWB 4AP4C 3Q3FA 4IWPA 4DHJD 1CMXB 2KLGA 1E8WA 2MQJA 3IHPC 2K8BA 2NBWB 2FIDA 3ZVVA 3QQ8B 4BVUC 2LVQA 4MGIE 3LJ3A 2JWZA 3QWZB 3WAOA 5J2RA 1XQQA 4LDTD 1SIFA 2DYBA 1RFAA 2REXA 4GDLB 2Z59B 3DCGA 4IM3A 5D2MB 1P0RA 3QAQA 3UIOB 1WJUA 2D07B 2YVCA 3HM6X 1P9DU 2NR2A 2MA9B 4W9KA 4BKSA 1HE8A 2FCNA 1ZKHA 4KIKA 2BKRB 4GDKA 4ZRIA 5G2NA 5E6NA 4RMAA 4A3PA 3K9PB 1V9JA 2KJ6A 1P1AA 2HD5B 3PRZA 4NPNA 1WI0A 4ANUA 2B3AA 3RUIB 3DVNV 1WIAA 3VFKA 2K25A 1RLFA 2HJ8A 3PLUA 5CHFA 4W9LA 2NPTA 3APDA 3C0RB 4WJNA 3UGBB 4WAAA 5CX3A 2G45B 2JUOA 4NAWB 4EOYA 4IUMB 4G3XB 3B08A 3ZLZA 3PLVA 5DPWA 1PQSA 1E7VA 2HE7A 2ZNVB 3PPAA 3Q3JA 2BYEA 3QX1A 4HCNB 2ZJDA 2CHZA 4TKNA 2JRHA 2OJRA 3RCZA 2ZEQA 3N32A 3X23A 2JXXA 3T8MA 2GOWA 2RPQA 4K81A 2KFKA 5AZHA 4WJOA 3UF8A 3ZO5B 3AI5A 2WDTB 3MTNB 3QCAA 2L8JA 3PREA 4HWIB 3PV1A 2RR9A 2M4NA 3PHWB 4W9JA 3B0AA 2V3SA 3BINA 3DBLI 3QA8A 1J8CA 3PZDA 2LUEA 4E3CA 2KNBA 4KV2A 2KJHB 2MBBB 1WJNA 3L17A 4PYZA 1S3SG 2XEWA 4LJPB 4W9FA 4NNJB 1BT0A 1WMHA 2C60A 2GBNA 1GG3A 2DAFA 2KC1A 2VRRB 3MJWA 4LJOB 2OOBB 3ZNHB 4MEMA 4F7ZA 3N3KB 3CMMB 1F9JA 2DX5B 1WJ4A 2KTFA 3UINB 3PSEB 2C7HA 4B9KA 1A5RA 1IYFA 3SD5A 4GDLA 2L05A 1M94A 1Q5WB 4KDLB 2V1YA 4XC2A 3AULA 3PGEA 4K1RB 2N7DA 3R7RA 3ZDMC 2LASA 2CR5A 1EF1A 2LXCA 4HLEA 3KYDD 4ZYNA 3U8ZA 2MP2B 2L3ZA 1WYWB 2KDBA 4KSLC 2FIFA 2EMTA 5BO4B 2DYOA 2NBVB 4DXAB 3DVNU 2K39A 4BKGA 3TCAA 1QZEA 3CSFA 4KSKC 3WALA 4I6LB 2L0FA 2MBOA 3QK0A 1WGRA 4M8NA 2KQSA 1V5TA 2C7NB 2GBJA 3VQIA 3ZNGC 5HKHA 3MHSD 3DBHI 3LDZE 3H1UA 5J17A 1ZW7A 2W9NA 4KZCA 4MH0E 1LQBA 4HCPB 3HIZA 2KXJA 5JH5C 3R66C 3KUZA 2IO3B 4NAWA 3O65B 3PRMB 2DAJA 2LJ5A 3VH3B 4MSQB 1VCBA 4GXBA 4DHZB 1KOTA 4JIOU 1V2YA 1KLVA 1UZXB 4KVGB 2BYVE 3RZFA 1OQYA 3VUWA 1WJ6A 1R4NI 3V6CB 3ALBA 3ZTDA 1UH6A 2I1JA 1P3QU 3RYTA 4E71A 4PS8A 4FADA 1Q1OA 2JZZA 2IO0B 1EF5A 5L83A 2AWTA 3I3TB 4FULA 3EHVA 4B6WA 3L08A 3UQAA 1WE6A 2I1KA 2L00B 1WZ0A 4IWOA 4ICUA 4JLCA 2QHOA 3A4RA 3TIXA 4MSMB 3ZNZB 1GC6A 2C5LC 2J0MA 3KH0A 1E90A 3R3MA 1GC7A 4FHJA 1X1MA 2DZJA 2D2QA 4A3OA 3B1LX 3ML9A 4URKA 2GBRA 3APFA 3IFWB 1KJTA 1IPGA 4BBNC 5JHBA 5JHAA 2R2OA 4ANWA 5AZGA 1J19A 5L95C 4AJYB 4ZRJA 1XT9B 2HTHA 1E5WA 1T0YA 3ENEA 2CHWA 2MP2A 4TUUA 4MELA 3IVFA 2G3QB 3VTVA 1I35A 1GUAB 2M8SA 4DHJB 1YX5B 2D11A 4EZJA 4X57B 2JF5A 3CF6E 3OLMD 3QJZA 4MM3A 2BGFA 2JPHA 4MGKE 4AJWA 4IG7B 3DVGY 1TGZB 3NS8A 1UD7A 4LDTB 5E6PA 4CHKA 4HJKA 2FAZA 2NVUI 2J7QB 1SGHA 3NZSA 5DPTA 5DPSA 2IBIB 2M17A 4B95A 1WGYA 1WX7A 3VH4B 2MWSB 3A33B 2ZVOA 4JGHB 1WRDB 2N1VA 2NBUA 4TQ1A 2O2VB 2ZNVC 2MW5A 2LRWA 1TZ1A 2N1WA 2KOXA 4M8MA 3W1SC 2FCQA 2KWUB 3QC8B 2ZCCA 2UWQA 4W9CA 2GBMA 3ECIA 1P98A 4XX5A 1WGHA 3KUDB 4GN1A 1ISNA 2LZ6A 4BKSD 1D3ZA 3IG3A 3JVZX 3M95A 3PHXB 5FR6A 4BOZB 5E6OA 2L7RA 4AUQC 1JRUA 3ZW3A 3X0WA 4YL8A 1WY8A 3S2AA 4EKUA 2IY0B 2KMAA 2DENB 3OJ4B 4PS3A 5D6JB 5KHQA 5LXHA 1IP9A 2IO2B 1L2NA 3H7PB 2AL3A 2KTRA 2KX0A 3WAMA 4ZDVA 3K9OB 4BBNF 1AARA 3M63B 2ZPYA 1E8XA 1WM3A 1XD3B 2FUHB 2DHZA 2IO1B 4EFOA 4DHZE 4BOSC 2BYFA 4WJPA 2BWFA 1YIWA 4GSWA 2FCMA 2LVOA 2N9EB 2BF8B 2PE9A 2AYOB 4GIVA 1WR1A 3ZTCA 4BFRA 1C3TA 3VUXA 2IZVB 2MBQA 2L76A 3T9LA 4JQWC 2LWPA 2KX3A 2PPHA 3A1QB 3NY5A 4FJYA 2Y5BB 4G50A 5CTRC 4EZKA 2G4DB 2MRPA 2KJRA 3GOEA 1YD8U 3L0WB 1Q0WB 3DQVA 1ZGUB 2LGDA 1H8CA 2O6VD 1UBQA 1Y8RC 2ZVNA 2ZCBA 4CO7A 4DDID 1V49A 4ICVA 2GMIC 1E8ZA 2RGFA 1LFDA 3NOBA 1E7UA 2Z0EB 2MX2A 2KFJA 4BKTA 4G0NB 2K6QA 3JSVB 2PJHA 2LRUA 2MSED 4II2B 5C23A 1WF9A 3KUCB 3L54A 3QARA 5DPRA 2NS5A 4W9EA 2LD9A 2LGXA 2D3GA 2XK5B 4DWFA 2KWCA 3AU4A 4KZ0A 2LXAA 2MCNB 2LGYA 4GMVA 3VXWA 4P7IA 2KWVB 2L0TA 2KQ7A
chains in the Genus database with same CATH superfamily
3L13A 2BB5A 1NENB 3PT2B 4LNFA 3MC9A 4ZHOA 1I4GA 3HVZA 1QOAA 3ZKJC 3PRPB 1HA5A 4FJZA 2WQYB 2M0AA 3IBEA 3L16A 1D5XC 2KO3A 3R7QA 1XLOA 2M0XA 1PGAA 3H7PA 1FD6A 5AZFA 1VDVA 5HG2A 1C79A 4HDQA 2WXLA 1STEA 2CHXA 3ML8A 4ZRKA 2L32A 2AEHA 4XZ4A 2KMCA 2BS3B 1GNUA 4C4VB 3AM9A 1HZ6A 2J4XA 4L2YA 3PTFC 1QOBA 3KW5B 4MDKE 1L0XB 1QKZA 1V5OA 3VR8B 2INDC 3V6EB 1XLPA 2NMQA 3P4RB 4KDIC 2V9HA 2XK5A 2ZW0A 2WXKA 1F77A 1WR6E 3FC4A 1FFVA 4N6EB 2N7JA 2V0GA 1RFKA 2ASQA 3OG5A 1WFYA 3VTUA 4I6NB 2JVCA 3M62B 1XF5L 4YSZB 1FEHA 3BK1A 4E74A 2WDQB 4RM9A 2IGHA 3H6NA 3V60A 1K53A 2XNAC 5TSSA 4II3B 5G5GA 4G11A 4C80A 2N4FA 2KDFB 1JCKB 1XLNA 1ROEA 3WIMA 1VR9A 2N9PC 1AWDA 1VJKA 3ZUNA 2EELA 1KRHA 1SIJA 3DBHB 4C4VA 4FHKA 1GJZA 4C56C 3VAWA 1LO5D 1MG8A 1UGJA 1WX8A 1JMLA 1PFDA 5IAAC 2WHIA 3GS2A 1WXVA 3MHZA 3KQ4A 2MJEA 3QHTA 3O13A 4YSYB 2EKIA 3EC8A 3FILB 3P2BA 1C78A 3RN9C 1L7YA 2K6DB 1YJ1A 2MBEA 2TSSA 4W9GA 1K52A 3PVLA 5TR5A 2O6VB 3AEEB 2K1FA 3VRAB 1TY0A 1C77A 3VHTC 1FNWA 3B2FA 4TV3A 4K7UA 2FNJB 4YTNB 4FN2A 1K50A 2G9HD 4J6IA 2JZ3B 3P4QB 2XN9C 1XCTL 2AQ1B 4IWPA 1IUEA 3EUB2 1SJED 2K8BA 2LHDA 2PVOD 2JWZA 3SFEB 3AEDB 3WAOA 4OZAA 1JROA 1CZPA 2ON8A 5HHDG 3DHGC 3NG0A 1OQQA 5D2MB 1T6BX 2YVCA 1OQRA 2MA9B 4W9KA 4HJGE 4KKIA 4OZCA 1MI0A 1T5XD 1IBXB 3PRZA 4ANUA 1WI0A 3Q8FA 2K25A 2HJ8A 3PLUA 5H8YE 1ZXHA 4W9LA 3C0RB 3UGBB 4Q2JA 5CX3A 2JUOA 2H88B 3ZLZA 3B08A 3FILA 5H92C 2LHEA 1K51A 3Q3JA 3QX1A 5BMHA 2JRHA 2OJWA 2OJRA 2ZEQA 2JXXA 1F2RI 1ZDVA 4XE0A 3QCAA 4JPSA 3PREA 2RR9A 2M4NA 4R3DA 3PHWB 2V3SA 4IKGA 3QA8A 1ZDXA 1D5ZC 1SXTA 4KKJA 4KV2A 1KF6B 4PYZA 4YWGG 1S3SG 3NUHB 4LJPB 2C60A 2N0SB 3CMMB 1I7HA 1A5RA 3LYYA 1M94A 3KYDD 1JWAD 2RDGA 4AS1A 1WYWB 3AN1A 5BO4B 4KSLC 3DVNU 2K5PA 1BUIC 1I35A 2LGIA 2QEJC 3DHHC 3TUOA 1ZW7A 1LQBA 3IAS1 4HCPB 2IDYA 5LNK1 2WXMA 5JH5C 2IO3B 3PRMB 1J7CA 3VH3B 3IT6B 4GXBA 2PMVA 3RI7C 4ZHPA 1UZXB 2H89B 4KVGB 1OQYA 1EWYC 1R4NI 3V6CB 1I4XA 3BYYB 1UH6A 5HI1A 2JZZA 2AWTA 4B6WA 1L5PA 1WE6A 1DOXA 4P6VF 4JLCA 3PZ8A 1GC6A 3KH0A 1L6UA 3R3MA 1YNTE 2LJIA 1B9RA 1P7FA 1KJTA 1IPGA 1FCLA 5AZGA 3BVMA 1ZXIA 1XT9B 3VRBB 1XLQA 1T0YA 3ENEA 4TUUA 3VTVA 1YX5B 2X38A 3BVGA 3QJZA 3SEBA 2JPHA 4AJWA 1QILA 2LUMA 5E6PA 4CHKA 2KAJA 1F2RC 2Z8LA 2PIAA 2NVUI 3NZSA 5DPTA 4FXCA 2M17A 1WGYA 4A8XC 1QT9A 1WRDB 1N60A 4TQ1A 2KWDA 2O2VB 1DYQA 3Q69A 3B2GA 4W9CA 2Q5WD 2GBMA 3KUDB 2LZ6A 1D3ZA 3IG3A 1HXYD 1C4PA 2MHJA 5E6OA 1FCCC 4AUQC 5I4DA 2DENB 4PS3A 1SSNA 2IO2B 1N6ZA 3K9OB 1ZP0B 5BYRA 4BBNF 3LB8C 1WM3A 1JQ4A 2FUHB 2RDHA 2IO1B 1F52A 4DHZE 4ZYSA 4WJPA 1TT5B 2FCMA 4TSSA 3ZTCA 2JXTA 1R7SA 2IZVB 4YXDB 2L76A 3T9LA 4JQWC 3I63C 4G50A 1ENFA 2LGDA 2QDFA 5G5HA 2KDMA 2O6VD 2N9LA 2ZCBA 2RGFA 1LFDA 3NOBA 5IO9A 1E7UA 2Z0EB 2MX2A 2KFJA 3KLSX 3JSVB 2J53A 1ET6A 2LRUA 1MJDA 3KUCB 2LD9A 1Z2MA 4WWNA 2DLBA 5J18A 4RH6A 2O2VA 1UGMA 3ZXRA 2ACZB 1UNSA 3EA6A 1ESFA 4YT0B 2WX0A 2BWES 2INCC 4ANVA 2KTRB 3DPDA 1XCQL 3OAWA 2GLSA 1SEBD 2C7MB 3DDCB 3ZRCA 4F8CB 1YOVB 2Y5PA 2KDIA 2QJLA 2D3AA 4I6PA 4AOFA 4O1NA 1N5XA 2IPKD 1NDDA 1UBIA 3AEAB 3QIJA 4IM0A 4N58A 3M3JA 2GRIA 1OEYJ 1T3QA 3ZXVA 4XDDA 3NJTA 2C9WB 2KN5A 2PLPA 3RT3B 1S1QB 3BZDB 2K8CA 2MLBA 3JSVA 4DXFA 1TKGA 1KTKA 3H8HA 2BB6A 1ZUD2 3WA0A 2IGDA 3CSTA 4FLHA 3DOWA 2PE6B 3JW0X 3R2IA 3TJPA 4W9IA 2QIEB 4IM2A 5EE1A 4S17A 2WP9B 4JWUC 1NYRA 2OHFA 2M19A 1YQ3B 3A9KB 1FIQA 4HKZE 5D94A 4NJ7A 2QSDA 4C7YA 1FXTB 4HK2A 3TL5A 2D10A 4TMAB 4ASWC 4EUTA 4WH4A 2WU2B 5IOIA 5EE0A 2GBKA 3C8YA 4F1SA 1U4AA 2M1MA 3I5JC 1FXAA 4AQ7A 4TQ0A 4WAFA 2DZMA 2CU1A 2KANA 4ANXA 2VZKB 2YLMA 4JL9A 3T3NA 4IDIA 3AU5A 3L10B 4W9DA 1WH3A 3ZYYX 4HROA 4KGSA 3V61A 3VTWA 4ARCA 2BTEA 2JQRB 5CHVC 4IOIE 1G6JA 3DVGX 3DBRI 3ZGZA 2BBCA 1V81A 4OVZA 1OFFA 4ZRQA 5AUIA 3E56A 2G4SA 4N9F4 2KK8A 4GB9A 2J0KA 1V6EA 1WM2A 2KN4A 2ICIA 5DCNA 3A9KA 2W54A 3N30A 3Q3FA 1FXIA 3Q3MC 3IHPC 3QQ8B 4S0RA 4BVUC 4RFBA 1WGKA 3LJ3A 3RNAC 2DYBA 1FFUA 2DBYA 1P0RA 2E3TA 1FNVA 4ACFA 3AE2B 2D07B 1P9DU 2NR2A 3RMKC 5BMGA 4YTPB 1V97A 1ZKHA 4ZRIA 5G2NA 3AEBB 2KJ6A 4WQMA 3IAM1 2HD5B 3RUIB 3DVNV 2JX5A 1RLFA 2WXIA 4M02A 4WAAA 2VH1A 1PQSA 3ETRA 2ZNVB 3FAHA 5GXGB 3PPAA 4TKNA 1L0YB 2GOWA 4K81A 3AI5A 1C9FA 2WDTB 3MTNB 1HEZE 4HWIB 1Y56A 1ZE3D 2K22A 3DBLI 3RPFC 1MPEA 1GB1A 3MJ5A 2KJHB 5C2TB 2XEWA 3MFGA 4B0EA 1GG3A 4WWMA 4USAA 1J7AA 4F7ZA 2MJ3A 3N3KB 1F9JA 4B9KA 2L05A 1Q5WB 4KDLB 2V1YA 3W9CB 1I4HA 4L23A 2LASA 2LXCA 4HRSA 2MP2B 4JX1C 2FIFA 2W55A 4DXAB 1FPYA 4BKGA 3TCAA 3CSFA 3HVDA 1FRDA 2MBOA 3QK0A 3ZNGC 3VQIA 2C7NB 3Q2AC 3P4PB 3MHSD 2AQ2B 1SF0A 2I38A 2J42A 2KXJA 2L1AA 2JZPA 2WDRB 1IGDA 1P7EA 1ZOYB 3KUZA 2DAJA 4MSQB 1QLBB 1KOTA 3AH7A 3RNCC 3LXFA 2BYVE 1P3QU 3RYTA 2IO0B 1EF5A 5L83A 3I3TB 4HEA1 2L83A 1WZ0A 3U52E 2FBWB 4MSMB 3ZNZB 1E90A 4XDCA 4FHJA 1X1MA 1VZ8A 4A3OA 2GBRA 3APFA 1AN8A 2R2OA 4LNOA 1J19A 1I4PA 5L95C 4AJYB 1DOYA 2Y3AA 3CIRB 2HTHA 4MT5A 2MP2A 1V8CA 4MELA 2G3QB 2M8SA 4EZJA 3BK2A 3CF6E 4OHJA 2BGFA 4MGKE 3R8BA 4IG7B 1FRRA 4P1CC 1UD7A 1RYJA 1RM6C 3P1MA 3MC8A 2WDVB 3VH4B 2ZVOA 2N1VA 2NBUA 3TEZA 3PZ7A 1F1HA 2N1WA 2BVCA 1KLUD 3W1SC 2KWUB 2ZCCA 1P98A 2Y5CA 1ISNA 2L7RA 1EU3A 3AB5A 2IY0B 2KMAA 4YSXB 5KHQA 2VZKD 1L2NA 2KX0A 4ZDVA 1AARA 3M63B 1XD3B 4BOSC 1TS4A 1YQ4B 2BWFA 3Q8EA 1YIWA 2N9EB 4BFRA 2BF8B 2JU6X 1N62A 1AW7A 3VUXA 2Y5BB 4EZKA 3L0WB 3DQVA 3N1XC 2X8XX 1H8CA 1Y8RC 1ET9A 2GMIC 4A55A 2HTME 4RGNA 4BKTA 2K6QA 2WU5B 5C23A 4II2B 1MVKA 1WF9A 4C7ZA 2LGXA 2D3GA 4DWFA 2KWCA 2JSVX 2LXAA 2LGYA 3GZNB 2N7EA 1OTRB 2KACA 4A20A 1V1OA 2KMMA 2BPSA 1HTQA 3N1ZC 4US8A 3VUYA 3RNFC 3VR9B 1NBFC 3PS6A 3U30A 3CWIA 4HDOA 2CJOA 1D5MC 1VD2A 4RCOA 3W1SA 2KC2A 5C1ZA 3KYCD 2V4LA 3U7DA 4B0MA 1WXAA 1JRPA 2UYZB 2WXJA 3HHMA 1UELA 3PO0A 4W9HA 1YQBA 1WXSA 3V62A 4HPMB 5EDSA 4LNNA 2KLCA 2DZKA 5D7GA 2ZW1A 3BY4B 3N1YC 3T3OA 4MJSB 3N9YC 5GMVA 5D3DA 5E6JA 3RULA 2Z0DB 4FBJB 3NZ3A 4HPPA 3BWUD 4MACA 1V86A 2EMSA 1SE9A 2LEKA 3RD2A 2JWUA 5MPOA 1R4MI 2A5UA 3A9JB 1GAQB 1KLGD 2ZPNA 4NQKE 1FNUA 1MHHE 4WWOA 4GU2A 4ZRPA 4DK5A 1J0GA 1TS3A 1Q10A 2PTLA 4K7SA 2W3SA 3Q8AA 3NHEB 3UQBA 1PYWD 2MEKA 3EGRA 2BQQA 3AXCA 3U4EG 4CYEA 2BYTA 4M0WB 5JZEB 2JT4B 3N20C 1K8RB 2YEPF 5JXVA 2KD0A 4DXGA 1C1YB 3RZWC 2BS2B 3JYUA 1NVID 1HQRD 4OVUA 4DDGD 4GOCA 2M56B 3D32A 2DZIA 4GDKB 4MJSA 1WGGA 1H4RA 3WAPA 4LK0M 2W3RA 1WXMA 1SE4A 4UDUC 3NVZA 1QOGA 1WE7A 2NPTB 1GOZA 1R4NB 5D3IB 3URYA 2BKFA 2WWZA 3A9JA 3P4SB 3ZRFA 3ZJUA 2EKEC 5BMIA 1CK1A 4AWJA 4J3OD 1E9MA 4P1BC 1OEYA 1J7BA 2KFKB 2NCNA 5IA7A 2AX5A 2BS4B 3Q3NC 4KGTA 2WNMA 3ABVB 4IWQA 1I42A 4MH8A 2KDEB 4MGZE 2JYEA 1YN3A 1WMHB 2WXOA 2KHWB 4M0WA 4WURA 1KFYB 4OZBA 2LVQA 5J2RA 4ZOHC 1XQQA 2G1EA 5EE9A 4GDLB 1CJEA 2KYWA 2FE8A 3DCGA 3QAQA 2YEPB 3RNEC 3MP9A 2FUG1 4LNKA 4BKSA 1XXGA 1HZ5A 1T0RC 2BKRB 1YN4A 4GDKA 5E6NA 2WXGA 4RMAA 4A3PA 1V9JA 1NI3A 1P1AA 4N59A 2B3AA 1WIAA 3VFKA 2JYTA 5CHFA 1QQRA 3FKYA 2NPTA 3APDA 5FR3A 2QILA 1TIFA 3PLVA 4RNAA 2HE7A 5T8IA 1T0SC 1I4QA 2BYEA 3RCZA 3N32A 2RPQA 1N63A 2KFKA 4WJOA 2E6XA 5AZHA 1SB3C 3UF8A 2L8JA 4RGOS 3PV1A 4LLGM 1J8CA 2LUEA 2V4IB 1WJNA 3L17A 4W9FA 2BT6A 4NNJB 1BT0A 1WMHA 4LJOB 2DX5B 2C7HA 3SD5A 4GDLA 4XC2A 2KVZA 3AULA 3PGEA 3DWMA 4ITKA 2N7DA 3RNBC 3R7RA 3ZDMC 1TY2A 1E10A 4HLEA 4ZYNA 3U8ZA 2L3ZA 3HRDD 1F0ZA 3BYTB 2EMTA 3DHIC 1QZEA 1YJIA 4KSKC 1WGRA 2KQSA 2GBJA 5J17A 3DBHI 1C4CA 3HIZA 3P63A 5IKCM 3R66C 4A90A 2WXHA 1EM7A 3O65B 5IN7A 1VZ6A 1VCBA 2DNFA 4DHZB 1V2YA 1KLVA 2WXQA 3RZFA 4HKQA 3VUWA 1WJ6A 3NVVA 3ALBA 3ZTDA 1V1PB 2HJ1A 2I1JA 2RPVA 4E71A 4FADA 1Q1OA 1FM0D 2GI9A 3L08A 4IWOA 1I4RA 2QHOA 3A4RA 3TIXA 2C5LC 1GC7A 1C76A 2DZJA 3ZQ4A 3ML9A 4URKA 1JWSD 2LGSA 1B1ZA 5JHAA 3TEYA 2RDBC 2IGGA 1PDXA 2D5GA 1E5WA 2VH2A 2CHWA 3IVFA 1GUAB 4DHJB 2D11A 2JF5A 3OLMD 1UUPA 3U7ZA 4GLSC 1TGZB 3NS8A 4LDTB 4BAXA 2IBIB 4B95A 2MWSB 3KWVA 4KX6B 2ZNVC 2MW5A 3SR6A 2KOXA 3QC8B 2KQ4X 3IT4B 1V1PA 2UWQA 1WRIA 3ECIA 1WGHA 4BKSD 3JVZX 3PHXB 2K9XA 5FR6A 4BOZB 1JRUA 3X0WA 3AE3B 4YL8A 3OJ4B 5LXHA 5D6JB 1PGXA 3Q6BA 3P42A 1GPXA 3C19A 2ONQA 1AYFA 1TS2A 3WAMA 2PE9A 4DQOC 1C3TA 4RGTA 1DGJA 2MBQA 3NY5A 3A1QB 4PT5A 2KJRA 4H2AA 3V3XA 1YD8U 1Q0WB 2ZVNA 1UBQA 3DBRB 3NVWA 2WXPA 1BMLC 4ICVA 1E8ZA 4KGRA 1UF0A 1SE3A 4G0NB 2PJHA 1UWXA 2MSED 3L54A 2D3BA 5DPRA 1E0ZA 4W9EA 2GB1A 2INNE 4LNIA 3R2TA 4KZ0A 2MCNB 2K3UA 3HUIA 3VXWA 2KWVB 2KQ7A 1A70A 2JY6A 1C4AA 1XO3A 1Z5SB 2LI5A 3H7SA 5G55A 4FA6A 2FCSA 3B9JA 3WANA 1WZ3A 2CU3A 3HK0A 4HVBA 4ARIA 4PS7A 3TBLD 1JW9D 1BXTA 5AEKB 1JALA 4WWPA 1D4BA 4K7WA 2UU7A 3APCA 3GZNI 1MG4A 4GGQA 1RRBA 1V80A 2W82A 1HTOA 1QOFA 2PEAA 2N9KA 2CS4A 2KKCA 3ZIMA 1N61A 2ZZPB 3UIPB 2IY1B 1CQVA 4RF0A 4NAMA 4OVVA 3AMZA 1E8YA 1WGDA 3DBSA 4EZLA 1TZOA 2IYDB 3VDZA 3A1QA 1NI2A 2RSUA 2NTSA 2XBBC 2PVGC 1EO6A 3TMPB 1EU4A 3SDLC 4WQOB 1TBEA 3IXSA 3MC0B 4US9A 1WX9A 1VZ7A 2RMMA 2WYQA 2LVPA 1MHXA 3U2SC 2DWQA 2MBHA 1PGBA 3Q14C 3L4PA 2HDEA 1QF6A 3KWLA 4PYUA 4QAYA 3A4SC 1SBBB 4HXDA 2CJNA 3DBLB 3ONSA 2RD0A 2J0JA 3BVZA 2WS3B 2I2YA 3HM3A 1WWTA 4IW0A 3OJ3A 2N9XA 3VVWB 3ZDTA 3AE4B 4MGYE 1M4VA 1LM8B 1IGCA 1YJJA 1RWSA 2O6VA 3EECA 1D6EC 4EEWA 2WXNA 5C3JB 4FJVB 2DYMA 5FKAC 2CKHB 4NY0A 2AL6A 3W5UB 2WXRA 5KHOA 5LLIA 3OWEB 3WCQA 2WXFA 4HPLB 4KIKB 1KM7A 4RM8A 3W1YA 1OGWA 4NJ6A 1WXQA 3RNGC 1L6VA 1YMHE 2R2QA 1EUVB 4M00A 2MH7A 4DBGA 5CHWA 1IBXA 4WJQA 2IJ0A 4NQLB 3H9DA 4K3BA 1YX6B 1ACCA 4CQNA 5LXIB 2A4ZA 2JRIB 1LXDA 2KVRA 3SFDB 3AEGB 3BIID 4LCDE 1TTNA 2KZRA 2D3CA 3Q8BA 1RAXA 2L52A 3ZNID 2K8HA 3KVFB 3EFUA 3SU8X 3NZUA 3SHQA 3NS1A 4NJCA 2WX1A 4IC7B 4AP4C 4DHJD 3V05A 4JWSC 1CMXB 2KLGA 1E8WA 2MQJA 2NBWB 2FIDA 3NVYA 3ZVVA 4MGIE 3QWZB 4LDTD 1SIFA 1RFAA 1NEKB 2REXA 2Z59B 4IM3A 3UIOB 1WJUA 3HM6X 5BYQA 2WGSA 3GE8C 1HE8A 1JWBD 2FCNA 4KIKA 3AE7B 3EFCA 3K9PB 1TKEA 1L4DB 4YTMB 4NPNA 4XGAB 3ZJVA 3AE1B 3AECB 3AEFB 4WJNA 2INPE 2G45B 4NAWB 4EOYA 4IUMB 4G3XB 5DPWA 4LTUA 1E7VA 1XEEA 4RF1A 4HCNB 2ZJDA 1ZPSA 2CHZA 3I57A 1MFWA 3NRZA 3X23A 3T8MA 2LMCA 3ZO5B 1YN5A 2QC8A 4W9JA 3B0AA 3BINA 3PZDA 1VRAB 1KH0A 2KNBA 4E3CA 1LGRA 2MBBB 1FO4A 4NZLB 2GBNA 2DAFA 2KC1A 2VRRB 3MJWA 4EE2A 1TKYA 2OOBB 3ZNHB 4MEMA 3RFZB 1TYGB 1WJ4A 3Q3OC 2KTFA 2NTTA 5AUKA 3UINB 3PSEB 1IYFA 1NYQA 2B76B 4D2KA 1PUTA 2LFIA 3AV8A 1WYGA 4K1RB 4OW0A 1SE2A 2CR5A 1EF1A 2KDBA 2DYOA 2NBVB 2K39A 4MM3B 5BYSA 4RGMA 3WALA 4I6LB 2L0FA 5EE3A 4M8NA 1V5TA 4XWWA 3E9SA 5HKHA 4C00A 3LDZE 3H1UA 3GB1A 2W9NA 4KZCA 4MH0E 2SAKA 2J52A 3J9CA 1E6EB 4NAWA 1VLBA 1WSPA 2LJ5A 1EWCA 4JIOU 3AE5B 2MJDA 4XWTA 2WLBA 4PS8A 4FULA 3EHVA 3Q8CA 4JE3B 3AE8B 3UQAA 2BW2A 2I1KA 2L00B 4ICUA 1FMAD 4A6QA 2J0MA 2D2QA 2K0PA 3B1LX 4M01A 3IFWB 1JWUD 4REZA 4BBNC 5JHBA 4ANWA 4ZRJA 3AE6B 1R4MB 3ZJTA 5HFYA 1UWMA 4X57B 4XYCA 4MM3A 3GP7A 3DVGY 3TEXA 3TSSA 1L0VB 2R61A 2KT7A 4HJKA 3AE9B 3I9V1 2FAZA 4L1BA 2J7QB 1SGHA 5DPSA 1WX7A 2PKOA 3A33B 1N5WA 2PW9A 4JGHB 4K3CA 3W5VB 1L4ZB 2LRWA 1E7PB 1TZ1A 4M8MA 2FCQA 4P16A 2V3NA 3UI3A 4XX5A 4GN1A 1GB4A 3M95A 3ZW3A 1JWMD 3S2AA 1WY8A 4EKUA 2QCZA 1IP9A 2V3PA 3W2DA 1T0QC 3H7PB 2AL3A 2KTRA 4WIPA 2ZPYA 1E8XA 2DHZA 4PK1A 4EFOA 2BYFA 4BZAA 2SEBD 4GSWA 2OEDA 2LVOA 4GIVA 2AYOB 1WR1A 2QMTA 1TS5A 2LWPA 2KX3A 2PPHA 4FJYA 1SJHD 5CTRC 2G4DB 2MRPA 5FK9C 3GOEA 1DOIA 1ZGUB 3DWGC 3TEWA 4CO7A 4DDID 1V49A 4A9AA 2AQ3B 5IP4D 1TJEA 3QARA 2NS5A 2XK5B 3AU4A 4GMVA 3GE3C 4P7IA 2L0TA
chains in the Genus database with same CATH topology
2N7EA 2JY6A 1OTRB 3L13A 1Z2MA 4WWNA 1Z5SB 2LI5A 3H7SA 5J18A 5G55A 4FA6A 2O2VA 1UGMA 3PT2B 4A20A 2FCSA 2BPSA 3WANA 1WZ3A 3HK0A 4HVBA 3VUYA 4PS7A 3TBLD 3ZKJC 1NBFC 3PRPB 2WX0A 3PS6A 2BWES 5AEKB 4FJZA 4WWPA 3U30A 3IBEA 4HDOA 4ANVA 2KTRB 4K7WA 3L16A 3DPDA 1VD2A 3W1SA 2KO3A 3APCA 3OAWA 3R7QA 3GZNI 4GGQA 1RRBA 2KC2A 2C7MB 2M0XA 1V80A 3DDCB 5C1ZA 2PEAA 3KYCD 3ZRCA 3H7PA 4F8CB 2CS4A 2KKCA 2V4LA 5AZFA 3U7DA 1WXAA 4HDQA 2UYZB 3ZIMA 2KDIA 2CHXA 2ZZPB 2IY1B 3HHMA 3UIPB 3ML8A 4ZRKA 1UELA 4I6PA 4AOFA 4OVVA 4W9HA 1YQBA 2AEHA 1E8YA 1WGDA 4XZ4A 1NDDA 3DBSA 1WXSA 1UBIA 3V62A 2KMCA 2IYDB 4HPMB 4EZLA 1GNUA 3QIJA 4IM0A 3VDZA 2KLCA 3A1QA 2DZKA 1NI2A 5D7GA 2RSUA 3M3JA 1OEYJ 3BY4B 2XBBC 3TMPB 1EO6A 4MJSB 3SDLC 2C9WB 5GMVA 2KN5A 4WQOB 1TBEA 3RT3B 3PTFC 1S1QB 3RULA 2Z0DB 4FBJB 1WX9A 3KW5B 2K8CA 4MDKE 2WYQA 2LVPA 1V86A 1V5OA 2MBHA 2MLBA 2EMSA 1SE9A 3JSVA 3RD2A 3V6EB 1R4MI 2A5UA 3A9JB 4KDIC 4PYUA 2ZPNA 2XK5A 3A4SC 3WA0A 4NQKE 4HXDA 1WR6E 3CSTA 4FLHA 3DOWA 2PE6B 3JW0X 4WWOA 3ONSA 2RD0A 2J0JA 3TJPA 4GU2A 3HM3A 4DK5A 1J0GA 4IW0A 2ASQA 3OJ3A 1WFYA 4W9IA 3VTUA 2N9XA 2JVCA 3M62B 4I6NB 3VVWB 4K7SA 3ZDTA 3NHEB 5EDSA 3UQBA 4IM2A 4MGYE 4E74A 1LM8B 4RM9A 2O6VA 3A9KB 3AXCA 3H6NA 3EECA 3V60A 5D94A 4NJ7A 4CYEA 4EEWA 4M0WB 4II3B 5JZEB 2JT4B 4FJVB 4G11A 1FXTB 2DYMA 2N4FA 4HK2A 1K8RB 2CKHB 2KDFB 3TL5A 4NY0A 2D10A 2AL6A 4ASWC 4EUTA 3WIMA 2KD0A 2N9PC 5KHOA 5LLIA 2GBKA 3ZUNA 1C1YB 3RZWC 4F1SA 3JYUA 1U4AA 2M1MA 4OVUA 4HPLB 4TQ0A 4DDGD 4GOCA 4FHKA 1GJZA 3D32A 2DZIA 4GDKB 4KIKB 2DZMA 2CU1A 1KM7A 3VAWA 4RM8A 1MG8A 3W1YA 4MJSA 1OGWA 2KANA 1WX8A 4NJ6A 1WGGA 4ANXA 1H4RA 3WAPA 5IAAC 2YLMA 4JL9A 1WXMA 3AU5A 2R2QA 3L10B 1EUVB 1WXVA 4W9DA 4DBGA 1WH3A 5CHWA 4WJQA 1WE7A 2NPTB 3V61A 3QHTA 3VTWA 4NQLB 3H9DA 2BKFA 2WWZA 3A9JA 5CHVC 3EC8A 1G6JA 3P2BA 3ZRFA 3DVGX 2EKEC 1YX6B 3DBRI 1L7YA 2K6DB 4AWJA 1YJ1A 1V81A 2MBEA 2A4ZA 5LXIB 2JRIB 1LXDA 2KVRA 1OEYA 2G4SA 4N9F4 2KFKB 2NCNA 2KK8A 5IA7A 4W9GA 4LCDE 1TTNA 3PVLA 5TR5A 2O6VB 2K1FA 2KZRA 4GB9A 2J0KA 1RAXA 1V6EA 3VHTC 1WM2A 3ZNID 2K8HA 4IWQA 1I42A 4TV3A 3KVFB 2FNJB 3EFUA 4FN2A 3NZUA 4K7UA 3SU8X 3SHQA 5DCNA 3A9KA 2KDEB 4MGZE 1WMHB 2WX1A 2JZ3B 4IC7B 4J6IA 3N30A 2KHWB 4AP4C 3Q3FA 4IWPA 4DHJD 1CMXB 2KLGA 1E8WA 2MQJA 3IHPC 2K8BA 2NBWB 2FIDA 3ZVVA 3QQ8B 4BVUC 2LVQA 4MGIE 3LJ3A 2JWZA 3QWZB 3WAOA 5J2RA 1XQQA 4LDTD 1SIFA 2DYBA 1RFAA 2REXA 4GDLB 2Z59B 3DCGA 4IM3A 5D2MB 1P0RA 3QAQA 3UIOB 1WJUA 2D07B 2YVCA 3HM6X 1P9DU 2NR2A 2MA9B 4W9KA 4BKSA 1HE8A 2FCNA 1ZKHA 4KIKA 2BKRB 4GDKA 4ZRIA 5G2NA 5E6NA 4RMAA 4A3PA 3K9PB 1V9JA 2KJ6A 1P1AA 2HD5B 3PRZA 4NPNA 1WI0A 4ANUA 2B3AA 3RUIB 3DVNV 1WIAA 3VFKA 2K25A 1RLFA 2HJ8A 3PLUA 5CHFA 4W9LA 2NPTA 3APDA 3C0RB 4WJNA 3UGBB 4WAAA 5CX3A 2G45B 2JUOA 4NAWB 4EOYA 4IUMB 4G3XB 3B08A 3ZLZA 3PLVA 5DPWA 1PQSA 1E7VA 2HE7A 2ZNVB 3PPAA 3Q3JA 2BYEA 3QX1A 4HCNB 2ZJDA 2CHZA 4TKNA 2JRHA 2OJRA 3RCZA 2ZEQA 3N32A 3X23A 2JXXA 3T8MA 2GOWA 2RPQA 4K81A 2KFKA 5AZHA 4WJOA 3UF8A 3ZO5B 3AI5A 2WDTB 3MTNB 3QCAA 2L8JA 3PREA 4HWIB 3PV1A 2RR9A 2M4NA 3PHWB 4W9JA 3B0AA 2V3SA 3BINA 3DBLI 3QA8A 1J8CA 3PZDA 2LUEA 4E3CA 2KNBA 4KV2A 2KJHB 2MBBB 1WJNA 3L17A 4PYZA 1S3SG 2XEWA 4LJPB 4W9FA 4NNJB 1BT0A 1WMHA 2C60A 2GBNA 1GG3A 2DAFA 2KC1A 2VRRB 3MJWA 4LJOB 2OOBB 3ZNHB 4MEMA 4F7ZA 3N3KB 3CMMB 1F9JA 2DX5B 1WJ4A 2KTFA 3UINB 3PSEB 2C7HA 4B9KA 1A5RA 1IYFA 3SD5A 4GDLA 2L05A 1M94A 1Q5WB 4KDLB 2V1YA 4XC2A 3AULA 3PGEA 4K1RB 2N7DA 3R7RA 3ZDMC 2LASA 2CR5A 1EF1A 2LXCA 4HLEA 3KYDD 4ZYNA 3U8ZA 2MP2B 2L3ZA 1WYWB 2KDBA 4KSLC 2FIFA 2EMTA 5BO4B 2DYOA 2NBVB 4DXAB 3DVNU 2K39A 4BKGA 3TCAA 1QZEA 3CSFA 4KSKC 3WALA 4I6LB 2L0FA 2MBOA 3QK0A 1WGRA 4M8NA 2KQSA 1V5TA 2C7NB 2GBJA 3VQIA 3ZNGC 5HKHA 3MHSD 3DBHI 3LDZE 3H1UA 5J17A 1ZW7A 2W9NA 4KZCA 4MH0E 1LQBA 4HCPB 3HIZA 2KXJA 5JH5C 3R66C 3KUZA 2IO3B 4NAWA 3O65B 3PRMB 2DAJA 2LJ5A 3VH3B 4MSQB 1VCBA 4GXBA 4DHZB 1KOTA 4JIOU 1V2YA 1KLVA 1UZXB 4KVGB 2BYVE 3RZFA 1OQYA 3VUWA 1WJ6A 1R4NI 3V6CB 3ALBA 3ZTDA 1UH6A 2I1JA 1P3QU 3RYTA 4E71A 4PS8A 4FADA 1Q1OA 2JZZA 2IO0B 1EF5A 5L83A 2AWTA 3I3TB 4FULA 3EHVA 4B6WA 3L08A 3UQAA 1WE6A 2I1KA 2L00B 1WZ0A 4IWOA 4ICUA 4JLCA 2QHOA 3A4RA 3TIXA 4MSMB 3ZNZB 1GC6A 2C5LC 2J0MA 3KH0A 1E90A 3R3MA 1GC7A 4FHJA 1X1MA 2DZJA 2D2QA 4A3OA 3B1LX 3ML9A 4URKA 2GBRA 3APFA 3IFWB 1KJTA 1IPGA 4BBNC 5JHBA 5JHAA 2R2OA 4ANWA 5AZGA 1J19A 5L95C 4AJYB 4ZRJA 1XT9B 2HTHA 1E5WA 1T0YA 3ENEA 2CHWA 2MP2A 4TUUA 4MELA 3IVFA 2G3QB 3VTVA 1I35A 1GUAB 2M8SA 4DHJB 1YX5B 2D11A 4EZJA 4X57B 2JF5A 3CF6E 3OLMD 3QJZA 4MM3A 2BGFA 2JPHA 4MGKE 4AJWA 4IG7B 3DVGY 1TGZB 3NS8A 1UD7A 4LDTB 5E6PA 4CHKA 4HJKA 2FAZA 2NVUI 2J7QB 1SGHA 3NZSA 5DPTA 5DPSA 2IBIB 2M17A 4B95A 1WGYA 1WX7A 3VH4B 2MWSB 3A33B 2ZVOA 4JGHB 1WRDB 2N1VA 2NBUA 4TQ1A 2O2VB 2ZNVC 2MW5A 2LRWA 1TZ1A 2N1WA 2KOXA 4M8MA 3W1SC 2FCQA 2KWUB 3QC8B 2ZCCA 2UWQA 4W9CA 2GBMA 3ECIA 1P98A 4XX5A 1WGHA 3KUDB 4GN1A 1ISNA 2LZ6A 4BKSD 1D3ZA 3IG3A 3JVZX 3M95A 3PHXB 5FR6A 4BOZB 5E6OA 2L7RA 4AUQC 1JRUA 3ZW3A 3X0WA 4YL8A 1WY8A 3S2AA 4EKUA 2IY0B 2KMAA 2DENB 3OJ4B 4PS3A 5D6JB 5KHQA 5LXHA 1IP9A 2IO2B 1L2NA 3H7PB 2AL3A 2KTRA 2KX0A 3WAMA 4ZDVA 3K9OB 4BBNF 1AARA 3M63B 2ZPYA 1E8XA 1WM3A 1XD3B 2FUHB 2DHZA 2IO1B 4EFOA 4DHZE 4BOSC 2BYFA 4WJPA 2BWFA 1YIWA 4GSWA 2FCMA 2LVOA 2N9EB 2BF8B 2PE9A 2AYOB 4GIVA 1WR1A 3ZTCA 4BFRA 1C3TA 3VUXA 2IZVB 2MBQA 2L76A 3T9LA 4JQWC 2LWPA 2KX3A 2PPHA 3A1QB 3NY5A 4FJYA 2Y5BB 4G50A 5CTRC 4EZKA 2G4DB 2MRPA 2KJRA 3GOEA 1YD8U 3L0WB 1Q0WB 3DQVA 1ZGUB 2LGDA 1H8CA 2O6VD 1UBQA 1Y8RC 2ZVNA 2ZCBA 4CO7A 4DDID 1V49A 4ICVA 2GMIC 1E8ZA 2RGFA 1LFDA 3NOBA 1E7UA 2Z0EB 2MX2A 2KFJA 4BKTA 4G0NB 2K6QA 3JSVB 2PJHA 2LRUA 2MSED 4II2B 5C23A 1WF9A 3KUCB 3L54A 3QARA 5DPRA 2NS5A 4W9EA 2LD9A 2LGXA 2D3GA 2XK5B 4DWFA 2KWCA 3AU4A 4KZ0A 2LXAA 2MCNB 2LGYA 4GMVA 3VXWA 4P7IA 2KWVB 2L0TA 2KQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N7E A;  2JY6 A;  1OTR B;  3L13 A;  1Z2M A;  4WWN A;  1Z5S B;  2LI5 A;  3H7S A;  5J18 A;  5G55 A;  4FA6 A;  2O2V A;  1UGM A;  3PT2 B;  4A20 A;  2FCS A;  2BPS A;  3WAN A;  1WZ3 A;  3HK0 A;  4HVB A;  3VUY A;  4PS7 A;  3TBL D;  3ZKJ C;  1NBF C;  3PRP B;  2WX0 A;  3PS6 A;  2BWE S;  5AEK B;  4FJZ A;  4WWP A;  3U30 A;  3IBE A;  4HDO A;  4ANV A;  2KTR B;  4K7W A;  3L16 A;  3DPD A;  1VD2 A;  3W1S A;  2KO3 A;  3APC A;  3OAW A;  3R7Q A;  3GZN I;  4GGQ A;  1RRB A;  2KC2 A;  2C7M B;  2M0X A;  1V80 A;  3DDC B;  5C1Z A;  2PEA A;  3KYC D;  3ZRC A;  3H7P A;  4F8C B;  2CS4 A;  2KKC A;  2V4L A;  5AZF A;  3U7D A;  1WXA A;  4HDQ A;  2UYZ B;  3ZIM A;  2KDI A;  2CHX A;  2ZZP B;  2IY1 B;  3HHM A;  3UIP B;  3ML8 A;  4ZRK A;  1UEL A;  4I6P A;  4AOF A;  4OVV A;  4W9H A;  1YQB A;  2AEH A;  1E8Y A;  1WGD A;  4XZ4 A;  1NDD A;  3DBS A;  1WXS A;  1UBI A;  3V62 A;  2KMC A;  2IYD B;  4HPM B;  4EZL A;  1GNU A;  3QIJ A;  4IM0 A;  3VDZ A;  2KLC A;  3A1Q A;  2DZK A;  1NI2 A;  5D7G A;  2RSU A;  3M3J A;  1OEY J;  3BY4 B;  2XBB C;  3TMP B;  1EO6 A;  4MJS B;  3SDL C;  2C9W B;  5GMV A;  2KN5 A;  4WQO B;  1TBE A;  3RT3 B;  3PTF C;  1S1Q B;  3RUL A;  2Z0D B;  4FBJ B;  1WX9 A;  3KW5 B;  2K8C A;  4MDK E;  2WYQ A;  2LVP A;  1V86 A;  1V5O A;  2MBH A;  2MLB A;  2EMS A;  1SE9 A;  3JSV A;  3RD2 A;  3V6E B;  1R4M I;  2A5U A;  3A9J B;  4KDI C;  4PYU A;  2ZPN A;  2XK5 A;  3A4S C;  3WA0 A;  4NQK E;  4HXD A;  1WR6 E;  3CST A;  4FLH A;  3DOW A;  2PE6 B;  3JW0 X;  4WWO A;  3ONS A;  2RD0 A;  2J0J A;  3TJP A;  4GU2 A;  3HM3 A;  4DK5 A;  1J0G A;  4IW0 A;  2ASQ A;  3OJ3 A;  1WFY A;  4W9I A;  3VTU A;  2N9X A;  2JVC A;  3M62 B;  4I6N B;  3VVW B;  4K7S A;  3ZDT A;  3NHE B;  5EDS A;  3UQB A;  4IM2 A;  4MGY E;  4E74 A;  1LM8 B;  4RM9 A;  2O6V A;  3A9K B;  3AXC A;  3H6N A;  3EEC A;  3V60 A;  5D94 A;  4NJ7 A;  4CYE A;  4EEW A;  4M0W B;  4II3 B;  5JZE B;  2JT4 B;  4FJV B;  4G11 A;  1FXT B;  2DYM A;  2N4F A;  4HK2 A;  1K8R B;  2CKH B;  2KDF B;  3TL5 A;  4NY0 A;  2D10 A;  2AL6 A;  4ASW C;  4EUT A;  3WIM A;  2KD0 A;  2N9P C;  5KHO A;  5LLI A;  2GBK A;  3ZUN A;  1C1Y B;  3RZW C;  4F1S A;  3JYU A;  1U4A A;  2M1M A;  4OVU A;  4HPL B;  4TQ0 A;  4DDG D;  4GOC A;  4FHK A;  1GJZ A;  3D32 A;  2DZI A;  4GDK B;  4KIK B;  2DZM A;  2CU1 A;  1KM7 A;  3VAW A;  4RM8 A;  1MG8 A;  3W1Y A;  4MJS A;  1OGW A;  2KAN A;  1WX8 A;  4NJ6 A;  1WGG A;  4ANX A;  1H4R A;  3WAP A;  5IAA C;  2YLM A;  4JL9 A;  1WXM A;  3AU5 A;  2R2Q A;  3L10 B;  1EUV B;  1WXV A;  4W9D A;  4DBG A;  1WH3 A;  5CHW A;  4WJQ A;  1WE7 A;  2NPT B;  3V61 A;  3QHT A;  3VTW A;  4NQL B;  3H9D A;  2BKF A;  2WWZ A;  3A9J A;  5CHV C;  3EC8 A;  1G6J A;  3P2B A;  3ZRF A;  3DVG X;  2EKE C;  1YX6 B;  3DBR I;  1L7Y A;  2K6D B;  4AWJ A;  1YJ1 A;  1V81 A;  2MBE A;  2A4Z A;  5LXI B;  2JRI B;  1LXD A;  2KVR A;  1OEY A;  2G4S A;  4N9F 4;  2KFK B;  2NCN A;  2KK8 A;  5IA7 A;  4W9G A;  4LCD E;  1TTN A;  3PVL A;  5TR5 A;  2O6V B;  2K1F A;  2KZR A;  4GB9 A;  2J0K A;  1RAX A;  1V6E A;  3VHT C;  1WM2 A;  3ZNI D;  2K8H A;  4IWQ A;  1I42 A;  4TV3 A;  3KVF B;  2FNJ B;  3EFU A;  4FN2 A;  3NZU A;  4K7U A;  3SU8 X;  3SHQ A;  5DCN A;  3A9K A;  2KDE B;  4MGZ E;  1WMH B;  2WX1 A;  2JZ3 B;  4IC7 B;  4J6I A;  3N30 A;  2KHW B;  4AP4 C;  3Q3F A;  4IWP A;  4DHJ D;  1CMX B;  2KLG A;  1E8W A;  2MQJ A;  3IHP C;  2K8B A;  2NBW B;  2FID A;  3ZVV A;  3QQ8 B;  4BVU C;  2LVQ A;  4MGI E;  3LJ3 A;  2JWZ A;  3QWZ B;  3WAO A;  5J2R A;  1XQQ A;  4LDT D;  1SIF A;  2DYB A;  1RFA A;  2REX A;  4GDL B;  2Z59 B;  3DCG A;  4IM3 A;  5D2M B;  1P0R A;  3QAQ A;  3UIO B;  1WJU A;  2D07 B;  2YVC A;  3HM6 X;  1P9D U;  2NR2 A;  2MA9 B;  4W9K A;  4BKS A;  1HE8 A;  2FCN A;  1ZKH A;  4KIK A;  2BKR B;  4GDK A;  4ZRI A;  5G2N A;  5E6N A;  4RMA A;  4A3P A;  3K9P B;  1V9J A;  2KJ6 A;  1P1A A;  2HD5 B;  3PRZ A;  4NPN A;  1WI0 A;  4ANU A;  2B3A A;  3RUI B;  3DVN V;  1WIA A;  3VFK A;  2K25 A;  1RLF A;  2HJ8 A;  3PLU A;  5CHF A;  4W9L A;  2NPT A;  3APD A;  3C0R B;  4WJN A;  3UGB B;  4WAA A;  5CX3 A;  2G45 B;  2JUO A;  4NAW B;  4EOY A;  4IUM B;  4G3X B;  3B08 A;  3ZLZ A;  3PLV A;  5DPW A;  1PQS A;  1E7V A;  2HE7 A;  2ZNV B;  3PPA A;  3Q3J A;  2BYE A;  3QX1 A;  4HCN B;  2ZJD A;  2CHZ A;  4TKN A;  2JRH A;  2OJR A;  3RCZ A;  2ZEQ A;  3N32 A;  3X23 A;  2JXX A;  3T8M A;  2GOW A;  2RPQ A;  4K81 A;  2KFK A;  5AZH A;  4WJO A;  3UF8 A;  3ZO5 B;  3AI5 A;  2WDT B;  3MTN B;  3QCA A;  2L8J A;  3PRE A;  4HWI B;  3PV1 A;  2RR9 A;  2M4N A;  3PHW B;  4W9J A;  3B0A A;  2V3S A;  3BIN A;  3DBL I;  3QA8 A;  1J8C A;  3PZD A;  2LUE A;  4E3C A;  2KNB A;  4KV2 A;  2KJH B;  2MBB B;  1WJN A;  3L17 A;  4PYZ A;  1S3S G;  2XEW A;  4LJP B;  4W9F A;  4NNJ B;  1BT0 A;  1WMH A;  2C60 A;  2GBN A;  1GG3 A;  2DAF A;  2KC1 A;  2VRR B;  3MJW A;  4LJO B;  2OOB B;  3ZNH B;  4MEM A;  4F7Z A;  3N3K B;  3CMM B;  1F9J A;  2DX5 B;  1WJ4 A;  2KTF A;  3UIN B;  3PSE B;  2C7H A;  4B9K A;  1A5R A;  1IYF A;  3SD5 A;  4GDL A;  2L05 A;  1M94 A;  1Q5W B;  4KDL B;  2V1Y A;  4XC2 A;  3AUL A;  3PGE A;  4K1R B;  2N7D A;  3R7R A;  3ZDM C;  2LAS A;  2CR5 A;  1EF1 A;  2LXC A;  4HLE A;  3KYD D;  4ZYN A;  3U8Z A;  2MP2 B;  2L3Z A;  1WYW B;  2KDB A;  4KSL C;  2FIF A;  2EMT A;  5BO4 B;  2DYO A;  2NBV B;  4DXA B;  3DVN U;  2K39 A;  4BKG A;  3TCA A;  1QZE A;  3CSF A;  4KSK C;  3WAL A;  4I6L B;  2L0F A;  2MBO A;  3QK0 A;  1WGR A;  4M8N A;  2KQS A;  1V5T A;  2C7N B;  2GBJ A;  3VQI A;  3ZNG C;  5HKH A;  3MHS D;  3DBH I;  3LDZ E;  3H1U A;  5J17 A;  1ZW7 A;  2W9N A;  4KZC A;  4MH0 E;  1LQB A;  4HCP B;  3HIZ A;  2KXJ A;  5JH5 C;  3R66 C;  3KUZ A;  2IO3 B;  4NAW A;  3O65 B;  3PRM B;  2DAJ A;  2LJ5 A;  3VH3 B;  4MSQ B;  1VCB A;  4GXB A;  4DHZ B;  1KOT A;  4JIO U;  1V2Y A;  1KLV A;  1UZX B;  4KVG B;  2BYV E;  3RZF A;  1OQY A;  3VUW A;  1WJ6 A;  1R4N I;  3V6C B;  3ALB A;  3ZTD A;  1UH6 A;  2I1J A;  1P3Q U;  3RYT A;  4E71 A;  4PS8 A;  4FAD A;  1Q1O A;  2JZZ A;  2IO0 B;  1EF5 A;  5L83 A;  2AWT A;  3I3T B;  4FUL A;  3EHV A;  4B6W A;  3L08 A;  3UQA A;  1WE6 A;  2I1K A;  2L00 B;  1WZ0 A;  4IWO A;  4ICU A;  4JLC A;  2QHO A;  3A4R A;  3TIX A;  4MSM B;  3ZNZ B;  1GC6 A;  2C5L C;  2J0M A;  3KH0 A;  1E90 A;  3R3M A;  1GC7 A;  4FHJ A;  1X1M A;  2DZJ A;  2D2Q A;  4A3O A;  3B1L X;  3ML9 A;  4URK A;  2GBR A;  3APF A;  3IFW B;  1KJT A;  1IPG A;  4BBN C;  5JHB A;  5JHA A;  2R2O A;  4ANW A;  5AZG A;  1J19 A;  5L95 C;  4AJY B;  4ZRJ A;  1XT9 B;  2HTH A;  1E5W A;  1T0Y A;  3ENE A;  2CHW A;  2MP2 A;  4TUU A;  4MEL A;  3IVF A;  2G3Q B;  3VTV A;  1I35 A;  1GUA B;  2M8S A;  4DHJ B;  1YX5 B;  2D11 A;  4EZJ A;  4X57 B;  2JF5 A;  3CF6 E;  3OLM D;  3QJZ A;  4MM3 A;  2BGF A;  2JPH A;  4MGK E;  4AJW A;  4IG7 B;  3DVG Y;  1TGZ B;  3NS8 A;  1UD7 A;  4LDT B;  5E6P A;  4CHK A;  4HJK A;  2FAZ A;  2NVU I;  2J7Q B;  1SGH A;  3NZS A;  5DPT A;  5DPS A;  2IBI B;  2M17 A;  4B95 A;  1WGY A;  1WX7 A;  3VH4 B;  2MWS B;  3A33 B;  2ZVO A;  4JGH B;  1WRD B;  2N1V A;  2NBU A;  4TQ1 A;  2O2V B;  2ZNV C;  2MW5 A;  2LRW A;  1TZ1 A;  2N1W A;  2KOX A;  4M8M A;  3W1S C;  2FCQ A;  2KWU B;  3QC8 B;  2ZCC A;  2UWQ A;  4W9C A;  2GBM A;  3ECI A;  1P98 A;  4XX5 A;  1WGH A;  3KUD B;  4GN1 A;  1ISN A;  2LZ6 A;  4BKS D;  1D3Z A;  3IG3 A;  3JVZ X;  3M95 A;  3PHX B;  5FR6 A;  4BOZ B;  5E6O A;  2L7R A;  4AUQ C;  1JRU A;  3ZW3 A;  3X0W A;  4YL8 A;  1WY8 A;  3S2A A;  4EKU A;  2IY0 B;  2KMA A;  2DEN B;  3OJ4 B;  4PS3 A;  5D6J B;  5KHQ A;  5LXH A;  1IP9 A;  2IO2 B;  1L2N A;  3H7P B;  2AL3 A;  2KTR A;  2KX0 A;  3WAM A;  4ZDV A;  3K9O B;  4BBN F;  1AAR A;  3M63 B;  2ZPY A;  1E8X A;  1WM3 A;  1XD3 B;  2FUH B;  2DHZ A;  2IO1 B;  4EFO A;  4DHZ E;  4BOS C;  2BYF A;  4WJP A;  2BWF A;  1YIW A;  4GSW A;  2FCM A;  2LVO A;  2N9E B;  2BF8 B;  2PE9 A;  2AYO B;  4GIV A;  1WR1 A;  3ZTC A;  4BFR A;  1C3T A;  3VUX A;  2IZV B;  2MBQ A;  2L76 A;  3T9L A;  4JQW C;  2LWP A;  2KX3 A;  2PPH A;  3A1Q B;  3NY5 A;  4FJY A;  2Y5B B;  4G50 A;  5CTR C;  4EZK A;  2G4D B;  2MRP A;  2KJR A;  3GOE A;  1YD8 U;  3L0W B;  1Q0W B;  3DQV A;  1ZGU B;  2LGD A;  1H8C A;  2O6V D;  1UBQ A;  1Y8R C;  2ZVN A;  2ZCB A;  4CO7 A;  4DDI D;  1V49 A;  4ICV A;  2GMI C;  1E8Z A;  2RGF A;  1LFD A;  3NOB A;  1E7U A;  2Z0E B;  2MX2 A;  2KFJ A;  4BKT A;  4G0N B;  2K6Q A;  3JSV B;  2PJH A;  2LRU A;  2MSE D;  4II2 B;  5C23 A;  1WF9 A;  3KUC B;  3L54 A;  3QAR A;  5DPR A;  2NS5 A;  4W9E A;  2LD9 A;  2LGX A;  2D3G A;  2XK5 B;  4DWF A;  2KWC A;  3AU4 A;  4KZ0 A;  2LXA A;  2MCN B;  2LGY A;  4GMV A;  3VXW A;  4P7I A;  2KWV B;  2L0T A;  2KQ7 A; 
#chains in the Genus database with same CATH topology
 3L13 A;  2BB5 A;  1NEN B;  3PT2 B;  4LNF A;  3MC9 A;  4ZHO A;  1I4G A;  3HVZ A;  1QOA A;  3ZKJ C;  3PRP B;  1HA5 A;  4FJZ A;  2WQY B;  2M0A A;  3IBE A;  3L16 A;  1D5X C;  2KO3 A;  3R7Q A;  1XLO A;  2M0X A;  1PGA A;  3H7P A;  1FD6 A;  5AZF A;  1VDV A;  5HG2 A;  1C79 A;  4HDQ A;  2WXL A;  1STE A;  2CHX A;  3ML8 A;  4ZRK A;  2L32 A;  2AEH A;  4XZ4 A;  2KMC A;  2BS3 B;  1GNU A;  4C4V B;  3AM9 A;  1HZ6 A;  2J4X A;  4L2Y A;  3PTF C;  1QOB A;  3KW5 B;  4MDK E;  1L0X B;  1QKZ A;  1V5O A;  3VR8 B;  2IND C;  3V6E B;  1XLP A;  2NMQ A;  3P4R B;  4KDI C;  2V9H A;  2XK5 A;  2ZW0 A;  2WXK A;  1F77 A;  1WR6 E;  3FC4 A;  1FFV A;  4N6E B;  2N7J A;  2V0G A;  1RFK A;  2ASQ A;  3OG5 A;  1WFY A;  3VTU A;  4I6N B;  2JVC A;  3M62 B;  1XF5 L;  4YSZ B;  1FEH A;  3BK1 A;  4E74 A;  2WDQ B;  4RM9 A;  2IGH A;  3H6N A;  3V60 A;  1K53 A;  2XNA C;  5TSS A;  4II3 B;  5G5G A;  4G11 A;  4C80 A;  2N4F A;  2KDF B;  1JCK B;  1XLN A;  1ROE A;  3WIM A;  1VR9 A;  2N9P C;  1AWD A;  1VJK A;  3ZUN A;  2EEL A;  1KRH A;  1SIJ A;  3DBH B;  4C4V A;  4FHK A;  1GJZ A;  4C56 C;  3VAW A;  1LO5 D;  1MG8 A;  1UGJ A;  1WX8 A;  1JML A;  1PFD A;  5IAA C;  2WHI A;  3GS2 A;  1WXV A;  3MHZ A;  3KQ4 A;  2MJE A;  3QHT A;  3O13 A;  4YSY B;  2EKI A;  3EC8 A;  3FIL B;  3P2B A;  1C78 A;  3RN9 C;  1L7Y A;  2K6D B;  1YJ1 A;  2MBE A;  2TSS A;  4W9G A;  1K52 A;  3PVL A;  5TR5 A;  2O6V B;  3AEE B;  2K1F A;  3VRA B;  1TY0 A;  1C77 A;  3VHT C;  1FNW A;  3B2F A;  4TV3 A;  4K7U A;  2FNJ B;  4YTN B;  4FN2 A;  1K50 A;  2G9H D;  4J6I A;  2JZ3 B;  3P4Q B;  2XN9 C;  1XCT L;  2AQ1 B;  4IWP A;  1IUE A;  3EUB 2;  1SJE D;  2K8B A;  2LHD A;  2PVO D;  2JWZ A;  3SFE B;  3AED B;  3WAO A;  4OZA A;  1JRO A;  1CZP A;  2ON8 A;  5HHD G;  3DHG C;  3NG0 A;  1OQQ A;  5D2M B;  1T6B X;  2YVC A;  1OQR A;  2MA9 B;  4W9K A;  4HJG E;  4KKI A;  4OZC A;  1MI0 A;  1T5X D;  1IBX B;  3PRZ A;  4ANU A;  1WI0 A;  3Q8F A;  2K25 A;  2HJ8 A;  3PLU A;  5H8Y E;  1ZXH A;  4W9L A;  3C0R B;  3UGB B;  4Q2J A;  5CX3 A;  2JUO A;  2H88 B;  3ZLZ A;  3B08 A;  3FIL A;  5H92 C;  2LHE A;  1K51 A;  3Q3J A;  3QX1 A;  5BMH A;  2JRH A;  2OJW A;  2OJR A;  2ZEQ A;  2JXX A;  1F2R I;  1ZDV A;  4XE0 A;  3QCA A;  4JPS A;  3PRE A;  2RR9 A;  2M4N A;  4R3D A;  3PHW B;  2V3S A;  4IKG A;  3QA8 A;  1ZDX A;  1D5Z C;  1SXT A;  4KKJ A;  4KV2 A;  1KF6 B;  4PYZ A;  4YWG G;  1S3S G;  3NUH B;  4LJP B;  2C60 A;  2N0S B;  3CMM B;  1I7H A;  1A5R A;  3LYY A;  1M94 A;  3KYD D;  1JWA D;  2RDG A;  4AS1 A;  1WYW B;  3AN1 A;  5BO4 B;  4KSL C;  3DVN U;  2K5P A;  1BUI C;  1I35 A;  2LGI A;  2QEJ C;  3DHH C;  3TUO A;  1ZW7 A;  1LQB A;  3IAS 1;  4HCP B;  2IDY A;  5LNK 1;  2WXM A;  5JH5 C;  2IO3 B;  3PRM B;  1J7C A;  3VH3 B;  3IT6 B;  4GXB A;  2PMV A;  3RI7 C;  4ZHP A;  1UZX B;  2H89 B;  4KVG B;  1OQY A;  1EWY C;  1R4N I;  3V6C B;  1I4X A;  3BYY B;  1UH6 A;  5HI1 A;  2JZZ A;  2AWT A;  4B6W A;  1L5P A;  1WE6 A;  1DOX A;  4P6V F;  4JLC A;  3PZ8 A;  1GC6 A;  3KH0 A;  1L6U A;  3R3M A;  1YNT E;  2LJI A;  1B9R A;  1P7F A;  1KJT A;  1IPG A;  1FCL A;  5AZG A;  3BVM A;  1ZXI A;  1XT9 B;  3VRB B;  1XLQ A;  1T0Y A;  3ENE A;  4TUU A;  3VTV A;  1YX5 B;  2X38 A;  3BVG A;  3QJZ A;  3SEB A;  2JPH A;  4AJW A;  1QIL A;  2LUM A;  5E6P A;  4CHK A;  2KAJ A;  1F2R C;  2Z8L A;  2PIA A;  2NVU I;  3NZS A;  5DPT A;  4FXC A;  2M17 A;  1WGY A;  4A8X C;  1QT9 A;  1WRD B;  1N60 A;  4TQ1 A;  2KWD A;  2O2V B;  1DYQ A;  3Q69 A;  3B2G A;  4W9C A;  2Q5W D;  2GBM A;  3KUD B;  2LZ6 A;  1D3Z A;  3IG3 A;  1HXY D;  1C4P A;  2MHJ A;  5E6O A;  1FCC C;  4AUQ C;  5I4D A;  2DEN B;  4PS3 A;  1SSN A;  2IO2 B;  1N6Z A;  3K9O B;  1ZP0 B;  5BYR A;  4BBN F;  3LB8 C;  1WM3 A;  1JQ4 A;  2FUH B;  2RDH A;  2IO1 B;  1F52 A;  4DHZ E;  4ZYS A;  4WJP A;  1TT5 B;  2FCM A;  4TSS A;  3ZTC A;  2JXT A;  1R7S A;  2IZV B;  4YXD B;  2L76 A;  3T9L A;  4JQW C;  3I63 C;  4G50 A;  1ENF A;  2LGD A;  2QDF A;  5G5H A;  2KDM A;  2O6V D;  2N9L A;  2ZCB A;  2RGF A;  1LFD A;  3NOB A;  5IO9 A;  1E7U A;  2Z0E B;  2MX2 A;  2KFJ A;  3KLS X;  3JSV B;  2J53 A;  1ET6 A;  2LRU A;  1MJD A;  3KUC B;  2LD9 A;  1Z2M A;  4WWN A;  2DLB A;  5J18 A;  4RH6 A;  2O2V A;  1UGM A;  3ZXR A;  2ACZ B;  1UNS A;  3EA6 A;  1ESF A;  4YT0 B;  2WX0 A;  2BWE S;  2INC C;  4ANV A;  2KTR B;  3DPD A;  1XCQ L;  3OAW A;  2GLS A;  1SEB D;  2C7M B;  3DDC B;  3ZRC A;  4F8C B;  1YOV B;  2Y5P A;  2KDI A;  2QJL A;  2D3A A;  4I6P A;  4AOF A;  4O1N A;  1N5X A;  2IPK D;  1NDD A;  1UBI A;  3AEA B;  3QIJ A;  4IM0 A;  4N58 A;  3M3J A;  2GRI A;  1OEY J;  1T3Q A;  3ZXV A;  4XDD A;  3NJT A;  2C9W B;  2KN5 A;  2PLP A;  3RT3 B;  1S1Q B;  3BZD B;  2K8C A;  2MLB A;  3JSV A;  4DXF A;  1TKG A;  1KTK A;  3H8H A;  2BB6 A;  1ZUD 2;  3WA0 A;  2IGD A;  3CST A;  4FLH A;  3DOW A;  2PE6 B;  3JW0 X;  3R2I A;  3TJP A;  4W9I A;  2QIE B;  4IM2 A;  5EE1 A;  4S17 A;  2WP9 B;  4JWU C;  1NYR A;  2OHF A;  2M19 A;  1YQ3 B;  3A9K B;  1FIQ A;  4HKZ E;  5D94 A;  4NJ7 A;  2QSD A;  4C7Y A;  1FXT B;  4HK2 A;  3TL5 A;  2D10 A;  4TMA B;  4ASW C;  4EUT A;  4WH4 A;  2WU2 B;  5IOI A;  5EE0 A;  2GBK A;  3C8Y A;  4F1S A;  1U4A A;  2M1M A;  3I5J C;  1FXA A;  4AQ7 A;  4TQ0 A;  4WAF A;  2DZM A;  2CU1 A;  2KAN A;  4ANX A;  2VZK B;  2YLM A;  4JL9 A;  3T3N A;  4IDI A;  3AU5 A;  3L10 B;  4W9D A;  1WH3 A;  3ZYY X;  4HRO A;  4KGS A;  3V61 A;  3VTW A;  4ARC A;  2BTE A;  2JQR B;  5CHV C;  4IOI E;  1G6J A;  3DVG X;  3DBR I;  3ZGZ A;  2BBC A;  1V81 A;  4OVZ A;  1OFF A;  4ZRQ A;  5AUI A;  3E56 A;  2G4S A;  4N9F 4;  2KK8 A;  4GB9 A;  2J0K A;  1V6E A;  1WM2 A;  2KN4 A;  2ICI A;  5DCN A;  3A9K A;  2W54 A;  3N30 A;  3Q3F A;  1FXI A;  3Q3M C;  3IHP C;  3QQ8 B;  4S0R A;  4BVU C;  4RFB A;  1WGK A;  3LJ3 A;  3RNA C;  2DYB A;  1FFU A;  2DBY A;  1P0R A;  2E3T A;  1FNV A;  4ACF A;  3AE2 B;  2D07 B;  1P9D U;  2NR2 A;  3RMK C;  5BMG A;  4YTP B;  1V97 A;  1ZKH A;  4ZRI A;  5G2N A;  3AEB B;  2KJ6 A;  4WQM A;  3IAM 1;  2HD5 B;  3RUI B;  3DVN V;  2JX5 A;  1RLF A;  2WXI A;  4M02 A;  4WAA A;  2VH1 A;  1PQS A;  3ETR A;  2ZNV B;  3FAH A;  5GXG B;  3PPA A;  4TKN A;  1L0Y B;  2GOW A;  4K81 A;  3AI5 A;  1C9F A;  2WDT B;  3MTN B;  1HEZ E;  4HWI B;  1Y56 A;  1ZE3 D;  2K22 A;  3DBL I;  3RPF C;  1MPE A;  1GB1 A;  3MJ5 A;  2KJH B;  5C2T B;  2XEW A;  3MFG A;  4B0E A;  1GG3 A;  4WWM A;  4USA A;  1J7A A;  4F7Z A;  2MJ3 A;  3N3K B;  1F9J A;  4B9K A;  2L05 A;  1Q5W B;  4KDL B;  2V1Y A;  3W9C B;  1I4H A;  4L23 A;  2LAS A;  2LXC A;  4HRS A;  2MP2 B;  4JX1 C;  2FIF A;  2W55 A;  4DXA B;  1FPY A;  4BKG A;  3TCA A;  3CSF A;  3HVD A;  1FRD A;  2MBO A;  3QK0 A;  3ZNG C;  3VQI A;  2C7N B;  3Q2A C;  3P4P B;  3MHS D;  2AQ2 B;  1SF0 A;  2I38 A;  2J42 A;  2KXJ A;  2L1A A;  2JZP A;  2WDR B;  1IGD A;  1P7E A;  1ZOY B;  3KUZ A;  2DAJ A;  4MSQ B;  1QLB B;  1KOT A;  3AH7 A;  3RNC C;  3LXF A;  2BYV E;  1P3Q U;  3RYT A;  2IO0 B;  1EF5 A;  5L83 A;  3I3T B;  4HEA 1;  2L83 A;  1WZ0 A;  3U52 E;  2FBW B;  4MSM B;  3ZNZ B;  1E90 A;  4XDC A;  4FHJ A;  1X1M A;  1VZ8 A;  4A3O A;  2GBR A;  3APF A;  1AN8 A;  2R2O A;  4LNO A;  1J19 A;  1I4P A;  5L95 C;  4AJY B;  1DOY A;  2Y3A A;  3CIR B;  2HTH A;  4MT5 A;  2MP2 A;  1V8C A;  4MEL A;  2G3Q B;  2M8S A;  4EZJ A;  3BK2 A;  3CF6 E;  4OHJ A;  2BGF A;  4MGK E;  3R8B A;  4IG7 B;  1FRR A;  4P1C C;  1UD7 A;  1RYJ A;  1RM6 C;  3P1M A;  3MC8 A;  2WDV B;  3VH4 B;  2ZVO A;  2N1V A;  2NBU A;  3TEZ A;  3PZ7 A;  1F1H A;  2N1W A;  2BVC A;  1KLU D;  3W1S C;  2KWU B;  2ZCC A;  1P98 A;  2Y5C A;  1ISN A;  2L7R A;  1EU3 A;  3AB5 A;  2IY0 B;  2KMA A;  4YSX B;  5KHQ A;  2VZK D;  1L2N A;  2KX0 A;  4ZDV A;  1AAR A;  3M63 B;  1XD3 B;  4BOS C;  1TS4 A;  1YQ4 B;  2BWF A;  3Q8E A;  1YIW A;  2N9E B;  4BFR A;  2BF8 B;  2JU6 X;  1N62 A;  1AW7 A;  3VUX A;  2Y5B B;  4EZK A;  3L0W B;  3DQV A;  3N1X C;  2X8X X;  1H8C A;  1Y8R C;  1ET9 A;  2GMI C;  4A55 A;  2HTM E;  4RGN A;  4BKT A;  2K6Q A;  2WU5 B;  5C23 A;  4II2 B;  1MVK A;  1WF9 A;  4C7Z A;  2LGX A;  2D3G A;  4DWF A;  2KWC A;  2JSV X;  2LXA A;  2LGY A;  3GZN B;  2N7E A;  1OTR B;  2KAC A;  4A20 A;  1V1O A;  2KMM A;  2BPS A;  1HTQ A;  3N1Z C;  4US8 A;  3VUY A;  3RNF C;  3VR9 B;  1NBF C;  3PS6 A;  3U30 A;  3CWI A;  4HDO A;  2CJO A;  1D5M C;  1VD2 A;  4RCO A;  3W1S A;  2KC2 A;  5C1Z A;  3KYC D;  2V4L A;  3U7D A;  4B0M A;  1WXA A;  1JRP A;  2UYZ B;  2WXJ A;  3HHM A;  1UEL A;  3PO0 A;  4W9H A;  1YQB A;  1WXS A;  3V62 A;  4HPM B;  5EDS A;  4LNN A;  2KLC A;  2DZK A;  5D7G A;  2ZW1 A;  3BY4 B;  3N1Y C;  3T3O A;  4MJS B;  3N9Y C;  5GMV A;  5D3D A;  5E6J A;  3RUL A;  2Z0D B;  4FBJ B;  3NZ3 A;  4HPP A;  3BWU D;  4MAC A;  1V86 A;  2EMS A;  1SE9 A;  2LEK A;  3RD2 A;  2JWU A;  5MPO A;  1R4M I;  2A5U A;  3A9J B;  1GAQ B;  1KLG D;  2ZPN A;  4NQK E;  1FNU A;  1MHH E;  4WWO A;  4GU2 A;  4ZRP A;  4DK5 A;  1J0G A;  1TS3 A;  1Q10 A;  2PTL A;  4K7S A;  2W3S A;  3Q8A A;  3NHE B;  3UQB A;  1PYW D;  2MEK A;  3EGR A;  2BQQ A;  3AXC A;  3U4E G;  4CYE A;  2BYT A;  4M0W B;  5JZE B;  2JT4 B;  3N20 C;  1K8R B;  2YEP F;  5JXV A;  2KD0 A;  4DXG A;  1C1Y B;  3RZW C;  2BS2 B;  3JYU A;  1NVI D;  1HQR D;  4OVU A;  4DDG D;  4GOC A;  2M56 B;  3D32 A;  2DZI A;  4GDK B;  4MJS A;  1WGG A;  1H4R A;  3WAP A;  4LK0 M;  2W3R A;  1WXM A;  1SE4 A;  4UDU C;  3NVZ A;  1QOG A;  1WE7 A;  2NPT B;  1GOZ A;  1R4N B;  5D3I B;  3URY A;  2BKF A;  2WWZ A;  3A9J A;  3P4S B;  3ZRF A;  3ZJU A;  2EKE C;  5BMI A;  1CK1 A;  4AWJ A;  4J3O D;  1E9M A;  4P1B C;  1OEY A;  1J7B A;  2KFK B;  2NCN A;  5IA7 A;  2AX5 A;  2BS4 B;  3Q3N C;  4KGT A;  2WNM A;  3ABV B;  4IWQ A;  1I42 A;  4MH8 A;  2KDE B;  4MGZ E;  2JYE A;  1YN3 A;  1WMH B;  2WXO A;  2KHW B;  4M0W A;  4WUR A;  1KFY B;  4OZB A;  2LVQ A;  5J2R A;  4ZOH C;  1XQQ A;  2G1E A;  5EE9 A;  4GDL B;  1CJE A;  2KYW A;  2FE8 A;  3DCG A;  3QAQ A;  2YEP B;  3RNE C;  3MP9 A;  2FUG 1;  4LNK A;  4BKS A;  1XXG A;  1HZ5 A;  1T0R C;  2BKR B;  1YN4 A;  4GDK A;  5E6N A;  2WXG A;  4RMA A;  4A3P A;  1V9J A;  1NI3 A;  1P1A A;  4N59 A;  2B3A A;  1WIA A;  3VFK A;  2JYT A;  5CHF A;  1QQR A;  3FKY A;  2NPT A;  3APD A;  5FR3 A;  2QIL A;  1TIF A;  3PLV A;  4RNA A;  2HE7 A;  5T8I A;  1T0S C;  1I4Q A;  2BYE A;  3RCZ A;  3N32 A;  2RPQ A;  1N63 A;  2KFK A;  4WJO A;  2E6X A;  5AZH A;  1SB3 C;  3UF8 A;  2L8J A;  4RGO S;  3PV1 A;  4LLG M;  1J8C A;  2LUE A;  2V4I B;  1WJN A;  3L17 A;  4W9F A;  2BT6 A;  4NNJ B;  1BT0 A;  1WMH A;  4LJO B;  2DX5 B;  2C7H A;  3SD5 A;  4GDL A;  4XC2 A;  2KVZ A;  3AUL A;  3PGE A;  3DWM A;  4ITK A;  2N7D A;  3RNB C;  3R7R A;  3ZDM C;  1TY2 A;  1E10 A;  4HLE A;  4ZYN A;  3U8Z A;  2L3Z A;  3HRD D;  1F0Z A;  3BYT B;  2EMT A;  3DHI C;  1QZE A;  1YJI A;  4KSK C;  1WGR A;  2KQS A;  2GBJ A;  5J17 A;  3DBH I;  1C4C A;  3HIZ A;  3P63 A;  5IKC M;  3R66 C;  4A90 A;  2WXH A;  1EM7 A;  3O65 B;  5IN7 A;  1VZ6 A;  1VCB A;  2DNF A;  4DHZ B;  1V2Y A;  1KLV A;  2WXQ A;  3RZF A;  4HKQ A;  3VUW A;  1WJ6 A;  3NVV A;  3ALB A;  3ZTD A;  1V1P B;  2HJ1 A;  2I1J A;  2RPV A;  4E71 A;  4FAD A;  1Q1O A;  1FM0 D;  2GI9 A;  3L08 A;  4IWO A;  1I4R A;  2QHO A;  3A4R A;  3TIX A;  2C5L C;  1GC7 A;  1C76 A;  2DZJ A;  3ZQ4 A;  3ML9 A;  4URK A;  1JWS D;  2LGS A;  1B1Z A;  5JHA A;  3TEY A;  2RDB C;  2IGG A;  1PDX A;  2D5G A;  1E5W A;  2VH2 A;  2CHW A;  3IVF A;  1GUA B;  4DHJ B;  2D11 A;  2JF5 A;  3OLM D;  1UUP A;  3U7Z A;  4GLS C;  1TGZ B;  3NS8 A;  4LDT B;  4BAX A;  2IBI B;  4B95 A;  2MWS B;  3KWV A;  4KX6 B;  2ZNV C;  2MW5 A;  3SR6 A;  2KOX A;  3QC8 B;  2KQ4 X;  3IT4 B;  1V1P A;  2UWQ A;  1WRI A;  3ECI A;  1WGH A;  4BKS D;  3JVZ X;  3PHX B;  2K9X A;  5FR6 A;  4BOZ B;  1JRU A;  3X0W A;  3AE3 B;  4YL8 A;  3OJ4 B;  5LXH A;  5D6J B;  1PGX A;  3Q6B A;  3P42 A;  1GPX A;  3C19 A;  2ONQ A;  1AYF A;  1TS2 A;  3WAM A;  2PE9 A;  4DQO C;  1C3T A;  4RGT A;  1DGJ A;  2MBQ A;  3NY5 A;  3A1Q B;  4PT5 A;  2KJR A;  4H2A A;  3V3X A;  1YD8 U;  1Q0W B;  2ZVN A;  1UBQ A;  3DBR B;  3NVW A;  2WXP A;  1BML C;  4ICV A;  1E8Z A;  4KGR A;  1UF0 A;  1SE3 A;  4G0N B;  2PJH A;  1UWX A;  2MSE D;  3L54 A;  2D3B A;  5DPR A;  1E0Z A;  4W9E A;  2GB1 A;  2INN E;  4LNI A;  3R2T A;  4KZ0 A;  2MCN B;  2K3U A;  3HUI A;  3VXW A;  2KWV B;  2KQ7 A;  1A70 A;  2JY6 A;  1C4A A;  1XO3 A;  1Z5S B;  2LI5 A;  3H7S A;  5G55 A;  4FA6 A;  2FCS A;  3B9J A;  3WAN A;  1WZ3 A;  2CU3 A;  3HK0 A;  4HVB A;  4ARI A;  4PS7 A;  3TBL D;  1JW9 D;  1BXT A;  5AEK B;  1JAL A;  4WWP A;  1D4B A;  4K7W A;  2UU7 A;  3APC A;  3GZN I;  1MG4 A;  4GGQ A;  1RRB A;  1V80 A;  2W82 A;  1HTO A;  1QOF A;  2PEA A;  2N9K A;  2CS4 A;  2KKC A;  3ZIM A;  1N61 A;  2ZZP B;  3UIP B;  2IY1 B;  1CQV A;  4RF0 A;  4NAM A;  4OVV A;  3AMZ A;  1E8Y A;  1WGD A;  3DBS A;  4EZL A;  1TZO A;  2IYD B;  3VDZ A;  3A1Q A;  1NI2 A;  2RSU A;  2NTS A;  2XBB C;  2PVG C;  1EO6 A;  3TMP B;  1EU4 A;  3SDL C;  4WQO B;  1TBE A;  3IXS A;  3MC0 B;  4US9 A;  1WX9 A;  1VZ7 A;  2RMM A;  2WYQ A;  2LVP A;  1MHX A;  3U2S C;  2DWQ A;  2MBH A;  1PGB A;  3Q14 C;  3L4P A;  2HDE A;  1QF6 A;  3KWL A;  4PYU A;  4QAY A;  3A4S C;  1SBB B;  4HXD A;  2CJN A;  3DBL B;  3ONS A;  2RD0 A;  2J0J A;  3BVZ A;  2WS3 B;  2I2Y A;  3HM3 A;  1WWT A;  4IW0 A;  3OJ3 A;  2N9X A;  3VVW B;  3ZDT A;  3AE4 B;  4MGY E;  1M4V A;  1LM8 B;  1IGC A;  1YJJ A;  1RWS A;  2O6V A;  3EEC A;  1D6E C;  4EEW A;  2WXN A;  5C3J B;  4FJV B;  2DYM A;  5FKA C;  2CKH B;  4NY0 A;  2AL6 A;  3W5U B;  2WXR A;  5KHO A;  5LLI A;  3OWE B;  3WCQ A;  2WXF A;  4HPL B;  4KIK B;  1KM7 A;  4RM8 A;  3W1Y A;  1OGW A;  4NJ6 A;  1WXQ A;  3RNG C;  1L6V A;  1YMH E;  2R2Q A;  1EUV B;  4M00 A;  2MH7 A;  4DBG A;  5CHW A;  1IBX A;  4WJQ A;  2IJ0 A;  4NQL B;  3H9D A;  4K3B A;  1YX6 B;  1ACC A;  4CQN A;  5LXI B;  2A4Z A;  2JRI B;  1LXD A;  2KVR A;  3SFD B;  3AEG B;  3BII D;  4LCD E;  1TTN A;  2KZR A;  2D3C A;  3Q8B A;  1RAX A;  2L52 A;  3ZNI D;  2K8H A;  3KVF B;  3EFU A;  3SU8 X;  3NZU A;  3SHQ A;  3NS1 A;  4NJC A;  2WX1 A;  4IC7 B;  4AP4 C;  4DHJ D;  3V05 A;  4JWS C;  1CMX B;  2KLG A;  1E8W A;  2MQJ A;  2NBW B;  2FID A;  3NVY A;  3ZVV A;  4MGI E;  3QWZ B;  4LDT D;  1SIF A;  1RFA A;  1NEK B;  2REX A;  2Z59 B;  4IM3 A;  3UIO B;  1WJU A;  3HM6 X;  5BYQ A;  2WGS A;  3GE8 C;  1HE8 A;  1JWB D;  2FCN A;  4KIK A;  3AE7 B;  3EFC A;  3K9P B;  1TKE A;  1L4D B;  4YTM B;  4NPN A;  4XGA B;  3ZJV A;  3AE1 B;  3AEC B;  3AEF B;  4WJN A;  2INP E;  2G45 B;  4NAW B;  4EOY A;  4IUM B;  4G3X B;  5DPW A;  4LTU A;  1E7V A;  1XEE A;  4RF1 A;  4HCN B;  2ZJD A;  1ZPS A;  2CHZ A;  3I57 A;  1MFW A;  3NRZ A;  3X23 A;  3T8M A;  2LMC A;  3ZO5 B;  1YN5 A;  2QC8 A;  4W9J A;  3B0A A;  3BIN A;  3PZD A;  1VRA B;  1KH0 A;  2KNB A;  4E3C A;  1LGR A;  2MBB B;  1FO4 A;  4NZL B;  2GBN A;  2DAF A;  2KC1 A;  2VRR B;  3MJW A;  4EE2 A;  1TKY A;  2OOB B;  3ZNH B;  4MEM A;  3RFZ B;  1TYG B;  1WJ4 A;  3Q3O C;  2KTF A;  2NTT A;  5AUK A;  3UIN B;  3PSE B;  1IYF A;  1NYQ A;  2B76 B;  4D2K A;  1PUT A;  2LFI A;  3AV8 A;  1WYG A;  4K1R B;  4OW0 A;  1SE2 A;  2CR5 A;  1EF1 A;  2KDB A;  2DYO A;  2NBV B;  2K39 A;  4MM3 B;  5BYS A;  4RGM A;  3WAL A;  4I6L B;  2L0F A;  5EE3 A;  4M8N A;  1V5T A;  4XWW A;  3E9S A;  5HKH A;  4C00 A;  3LDZ E;  3H1U A;  3GB1 A;  2W9N A;  4KZC A;  4MH0 E;  2SAK A;  2J52 A;  3J9C A;  1E6E B;  4NAW A;  1VLB A;  1WSP A;  2LJ5 A;  1EWC A;  4JIO U;  3AE5 B;  2MJD A;  4XWT A;  2WLB A;  4PS8 A;  4FUL A;  3EHV A;  3Q8C A;  4JE3 B;  3AE8 B;  3UQA A;  2BW2 A;  2I1K A;  2L00 B;  4ICU A;  1FMA D;  4A6Q A;  2J0M A;  2D2Q A;  2K0P A;  3B1L X;  4M01 A;  3IFW B;  1JWU D;  4REZ A;  4BBN C;  5JHB A;  4ANW A;  4ZRJ A;  3AE6 B;  1R4M B;  3ZJT A;  5HFY A;  1UWM A;  4X57 B;  4XYC A;  4MM3 A;  3GP7 A;  3DVG Y;  3TEX A;  3TSS A;  1L0V B;  2R61 A;  2KT7 A;  4HJK A;  3AE9 B;  3I9V 1;  2FAZ A;  4L1B A;  2J7Q B;  1SGH A;  5DPS A;  1WX7 A;  2PKO A;  3A33 B;  1N5W A;  2PW9 A;  4JGH B;  4K3C A;  3W5V B;  1L4Z B;  2LRW A;  1E7P B;  1TZ1 A;  4M8M A;  2FCQ A;  4P16 A;  2V3N A;  3UI3 A;  4XX5 A;  4GN1 A;  1GB4 A;  3M95 A;  3ZW3 A;  1JWM D;  3S2A A;  1WY8 A;  4EKU A;  2QCZ A;  1IP9 A;  2V3P A;  3W2D A;  1T0Q C;  3H7P B;  2AL3 A;  2KTR A;  4WIP A;  2ZPY A;  1E8X A;  2DHZ A;  4PK1 A;  4EFO A;  2BYF A;  4BZA A;  2SEB D;  4GSW A;  2OED A;  2LVO A;  4GIV A;  2AYO B;  1WR1 A;  2QMT A;  1TS5 A;  2LWP A;  2KX3 A;  2PPH A;  4FJY A;  1SJH D;  5CTR C;  2G4D B;  2MRP A;  5FK9 C;  3GOE A;  1DOI A;  1ZGU B;  3DWG C;  3TEW A;  4CO7 A;  4DDI D;  1V49 A;  4A9A A;  2AQ3 B;  5IP4 D;  1TJE A;  3QAR A;  2NS5 A;  2XK5 B;  3AU4 A;  4GMV A;  3GE3 C;  4P7I A;  2L0T A; 
#chains in the Genus database with same CATH homology
 2N7E A;  2JY6 A;  1OTR B;  3L13 A;  1Z2M A;  4WWN A;  1Z5S B;  2LI5 A;  3H7S A;  5J18 A;  5G55 A;  4FA6 A;  2O2V A;  1UGM A;  3PT2 B;  4A20 A;  2FCS A;  2BPS A;  3WAN A;  1WZ3 A;  3HK0 A;  4HVB A;  3VUY A;  4PS7 A;  3TBL D;  3ZKJ C;  1NBF C;  3PRP B;  2WX0 A;  3PS6 A;  2BWE S;  5AEK B;  4FJZ A;  4WWP A;  3U30 A;  3IBE A;  4HDO A;  4ANV A;  2KTR B;  4K7W A;  3L16 A;  3DPD A;  1VD2 A;  3W1S A;  2KO3 A;  3APC A;  3OAW A;  3R7Q A;  3GZN I;  4GGQ A;  1RRB A;  2KC2 A;  2C7M B;  2M0X A;  1V80 A;  3DDC B;  5C1Z A;  2PEA A;  3KYC D;  3ZRC A;  3H7P A;  4F8C B;  2CS4 A;  2KKC A;  2V4L A;  5AZF A;  3U7D A;  1WXA A;  4HDQ A;  2UYZ B;  3ZIM A;  2KDI A;  2CHX A;  2ZZP B;  2IY1 B;  3HHM A;  3UIP B;  3ML8 A;  4ZRK A;  1UEL A;  4I6P A;  4AOF A;  4OVV A;  4W9H A;  1YQB A;  2AEH A;  1E8Y A;  1WGD A;  4XZ4 A;  1NDD A;  3DBS A;  1WXS A;  1UBI A;  3V62 A;  2KMC A;  2IYD B;  4HPM B;  4EZL A;  1GNU A;  3QIJ A;  4IM0 A;  3VDZ A;  2KLC A;  3A1Q A;  2DZK A;  1NI2 A;  5D7G A;  2RSU A;  3M3J A;  1OEY J;  3BY4 B;  2XBB C;  3TMP B;  1EO6 A;  4MJS B;  3SDL C;  2C9W B;  5GMV A;  2KN5 A;  4WQO B;  1TBE A;  3RT3 B;  3PTF C;  1S1Q B;  3RUL A;  2Z0D B;  4FBJ B;  1WX9 A;  3KW5 B;  2K8C A;  4MDK E;  2WYQ A;  2LVP A;  1V86 A;  1V5O A;  2MBH A;  2MLB A;  2EMS A;  1SE9 A;  3JSV A;  3RD2 A;  3V6E B;  1R4M I;  2A5U A;  3A9J B;  4KDI C;  4PYU A;  2ZPN A;  2XK5 A;  3A4S C;  3WA0 A;  4NQK E;  4HXD A;  1WR6 E;  3CST A;  4FLH A;  3DOW A;  2PE6 B;  3JW0 X;  4WWO A;  3ONS A;  2RD0 A;  2J0J A;  3TJP A;  4GU2 A;  3HM3 A;  4DK5 A;  1J0G A;  4IW0 A;  2ASQ A;  3OJ3 A;  1WFY A;  4W9I A;  3VTU A;  2N9X A;  2JVC A;  3M62 B;  4I6N B;  3VVW B;  4K7S A;  3ZDT A;  3NHE B;  5EDS A;  3UQB A;  4IM2 A;  4MGY E;  4E74 A;  1LM8 B;  4RM9 A;  2O6V A;  3A9K B;  3AXC A;  3H6N A;  3EEC A;  3V60 A;  5D94 A;  4NJ7 A;  4CYE A;  4EEW A;  4M0W B;  4II3 B;  5JZE B;  2JT4 B;  4FJV B;  4G11 A;  1FXT B;  2DYM A;  2N4F A;  4HK2 A;  1K8R B;  2CKH B;  2KDF B;  3TL5 A;  4NY0 A;  2D10 A;  2AL6 A;  4ASW C;  4EUT A;  3WIM A;  2KD0 A;  2N9P C;  5KHO A;  5LLI A;  2GBK A;  3ZUN A;  1C1Y B;  3RZW C;  4F1S A;  3JYU A;  1U4A A;  2M1M A;  4OVU A;  4HPL B;  4TQ0 A;  4DDG D;  4GOC A;  4FHK A;  1GJZ A;  3D32 A;  2DZI A;  4GDK B;  4KIK B;  2DZM A;  2CU1 A;  1KM7 A;  3VAW A;  4RM8 A;  1MG8 A;  3W1Y A;  4MJS A;  1OGW A;  2KAN A;  1WX8 A;  4NJ6 A;  1WGG A;  4ANX A;  1H4R A;  3WAP A;  5IAA C;  2YLM A;  4JL9 A;  1WXM A;  3AU5 A;  2R2Q A;  3L10 B;  1EUV B;  1WXV A;  4W9D A;  4DBG A;  1WH3 A;  5CHW A;  4WJQ A;  1WE7 A;  2NPT B;  3V61 A;  3QHT A;  3VTW A;  4NQL B;  3H9D A;  2BKF A;  2WWZ A;  3A9J A;  5CHV C;  3EC8 A;  1G6J A;  3P2B A;  3ZRF A;  3DVG X;  2EKE C;  1YX6 B;  3DBR I;  1L7Y A;  2K6D B;  4AWJ A;  1YJ1 A;  1V81 A;  2MBE A;  2A4Z A;  5LXI B;  2JRI B;  1LXD A;  2KVR A;  1OEY A;  2G4S A;  4N9F 4;  2KFK B;  2NCN A;  2KK8 A;  5IA7 A;  4W9G A;  4LCD E;  1TTN A;  3PVL A;  5TR5 A;  2O6V B;  2K1F A;  2KZR A;  4GB9 A;  2J0K A;  1RAX A;  1V6E A;  3VHT C;  1WM2 A;  3ZNI D;  2K8H A;  4IWQ A;  1I42 A;  4TV3 A;  3KVF B;  2FNJ B;  3EFU A;  4FN2 A;  3NZU A;  4K7U A;  3SU8 X;  3SHQ A;  5DCN A;  3A9K A;  2KDE B;  4MGZ E;  1WMH B;  2WX1 A;  2JZ3 B;  4IC7 B;  4J6I A;  3N30 A;  2KHW B;  4AP4 C;  3Q3F A;  4IWP A;  4DHJ D;  1CMX B;  2KLG A;  1E8W A;  2MQJ A;  3IHP C;  2K8B A;  2NBW B;  2FID A;  3ZVV A;  3QQ8 B;  4BVU C;  2LVQ A;  4MGI E;  3LJ3 A;  2JWZ A;  3QWZ B;  3WAO A;  5J2R A;  1XQQ A;  4LDT D;  1SIF A;  2DYB A;  1RFA A;  2REX A;  4GDL B;  2Z59 B;  3DCG A;  4IM3 A;  5D2M B;  1P0R A;  3QAQ A;  3UIO B;  1WJU A;  2D07 B;  2YVC A;  3HM6 X;  1P9D U;  2NR2 A;  2MA9 B;  4W9K A;  4BKS A;  1HE8 A;  2FCN A;  1ZKH A;  4KIK A;  2BKR B;  4GDK A;  4ZRI A;  5G2N A;  5E6N A;  4RMA A;  4A3P A;  3K9P B;  1V9J A;  2KJ6 A;  1P1A A;  2HD5 B;  3PRZ A;  4NPN A;  1WI0 A;  4ANU A;  2B3A A;  3RUI B;  3DVN V;  1WIA A;  3VFK A;  2K25 A;  1RLF A;  2HJ8 A;  3PLU A;  5CHF A;  4W9L A;  2NPT A;  3APD A;  3C0R B;  4WJN A;  3UGB B;  4WAA A;  5CX3 A;  2G45 B;  2JUO A;  4NAW B;  4EOY A;  4IUM B;  4G3X B;  3B08 A;  3ZLZ A;  3PLV A;  5DPW A;  1PQS A;  1E7V A;  2HE7 A;  2ZNV B;  3PPA A;  3Q3J A;  2BYE A;  3QX1 A;  4HCN B;  2ZJD A;  2CHZ A;  4TKN A;  2JRH A;  2OJR A;  3RCZ A;  2ZEQ A;  3N32 A;  3X23 A;  2JXX A;  3T8M A;  2GOW A;  2RPQ A;  4K81 A;  2KFK A;  5AZH A;  4WJO A;  3UF8 A;  3ZO5 B;  3AI5 A;  2WDT B;  3MTN B;  3QCA A;  2L8J A;  3PRE A;  4HWI B;  3PV1 A;  2RR9 A;  2M4N A;  3PHW B;  4W9J A;  3B0A A;  2V3S A;  3BIN A;  3DBL I;  3QA8 A;  1J8C A;  3PZD A;  2LUE A;  4E3C A;  2KNB A;  4KV2 A;  2KJH B;  2MBB B;  1WJN A;  3L17 A;  4PYZ A;  1S3S G;  2XEW A;  4LJP B;  4W9F A;  4NNJ B;  1BT0 A;  1WMH A;  2C60 A;  2GBN A;  1GG3 A;  2DAF A;  2KC1 A;  2VRR B;  3MJW A;  4LJO B;  2OOB B;  3ZNH B;  4MEM A;  4F7Z A;  3N3K B;  3CMM B;  1F9J A;  2DX5 B;  1WJ4 A;  2KTF A;  3UIN B;  3PSE B;  2C7H A;  4B9K A;  1A5R A;  1IYF A;  3SD5 A;  4GDL A;  2L05 A;  1M94 A;  1Q5W B;  4KDL B;  2V1Y A;  4XC2 A;  3AUL A;  3PGE A;  4K1R B;  2N7D A;  3R7R A;  3ZDM C;  2LAS A;  2CR5 A;  1EF1 A;  2LXC A;  4HLE A;  3KYD D;  4ZYN A;  3U8Z A;  2MP2 B;  2L3Z A;  1WYW B;  2KDB A;  4KSL C;  2FIF A;  2EMT A;  5BO4 B;  2DYO A;  2NBV B;  4DXA B;  3DVN U;  2K39 A;  4BKG A;  3TCA A;  1QZE A;  3CSF A;  4KSK C;  3WAL A;  4I6L B;  2L0F A;  2MBO A;  3QK0 A;  1WGR A;  4M8N A;  2KQS A;  1V5T A;  2C7N B;  2GBJ A;  3VQI A;  3ZNG C;  5HKH A;  3MHS D;  3DBH I;  3LDZ E;  3H1U A;  5J17 A;  1ZW7 A;  2W9N A;  4KZC A;  4MH0 E;  1LQB A;  4HCP B;  3HIZ A;  2KXJ A;  5JH5 C;  3R66 C;  3KUZ A;  2IO3 B;  4NAW A;  3O65 B;  3PRM B;  2DAJ A;  2LJ5 A;  3VH3 B;  4MSQ B;  1VCB A;  4GXB A;  4DHZ B;  1KOT A;  4JIO U;  1V2Y A;  1KLV A;  1UZX B;  4KVG B;  2BYV E;  3RZF A;  1OQY A;  3VUW A;  1WJ6 A;  1R4N I;  3V6C B;  3ALB A;  3ZTD A;  1UH6 A;  2I1J A;  1P3Q U;  3RYT A;  4E71 A;  4PS8 A;  4FAD A;  1Q1O A;  2JZZ A;  2IO0 B;  1EF5 A;  5L83 A;  2AWT A;  3I3T B;  4FUL A;  3EHV A;  4B6W A;  3L08 A;  3UQA A;  1WE6 A;  2I1K A;  2L00 B;  1WZ0 A;  4IWO A;  4ICU A;  4JLC A;  2QHO A;  3A4R A;  3TIX A;  4MSM B;  3ZNZ B;  1GC6 A;  2C5L C;  2J0M A;  3KH0 A;  1E90 A;  3R3M A;  1GC7 A;  4FHJ A;  1X1M A;  2DZJ A;  2D2Q A;  4A3O A;  3B1L X;  3ML9 A;  4URK A;  2GBR A;  3APF A;  3IFW B;  1KJT A;  1IPG A;  4BBN C;  5JHB A;  5JHA A;  2R2O A;  4ANW A;  5AZG A;  1J19 A;  5L95 C;  4AJY B;  4ZRJ A;  1XT9 B;  2HTH A;  1E5W A;  1T0Y A;  3ENE A;  2CHW A;  2MP2 A;  4TUU A;  4MEL A;  3IVF A;  2G3Q B;  3VTV A;  1I35 A;  1GUA B;  2M8S A;  4DHJ B;  1YX5 B;  2D11 A;  4EZJ A;  4X57 B;  2JF5 A;  3CF6 E;  3OLM D;  3QJZ A;  4MM3 A;  2BGF A;  2JPH A;  4MGK E;  4AJW A;  4IG7 B;  3DVG Y;  1TGZ B;  3NS8 A;  1UD7 A;  4LDT B;  5E6P A;  4CHK A;  4HJK A;  2FAZ A;  2NVU I;  2J7Q B;  1SGH A;  3NZS A;  5DPT A;  5DPS A;  2IBI B;  2M17 A;  4B95 A;  1WGY A;  1WX7 A;  3VH4 B;  2MWS B;  3A33 B;  2ZVO A;  4JGH B;  1WRD B;  2N1V A;  2NBU A;  4TQ1 A;  2O2V B;  2ZNV C;  2MW5 A;  2LRW A;  1TZ1 A;  2N1W A;  2KOX A;  4M8M A;  3W1S C;  2FCQ A;  2KWU B;  3QC8 B;  2ZCC A;  2UWQ A;  4W9C A;  2GBM A;  3ECI A;  1P98 A;  4XX5 A;  1WGH A;  3KUD B;  4GN1 A;  1ISN A;  2LZ6 A;  4BKS D;  1D3Z A;  3IG3 A;  3JVZ X;  3M95 A;  3PHX B;  5FR6 A;  4BOZ B;  5E6O A;  2L7R A;  4AUQ C;  1JRU A;  3ZW3 A;  3X0W A;  4YL8 A;  1WY8 A;  3S2A A;  4EKU A;  2IY0 B;  2KMA A;  2DEN B;  3OJ4 B;  4PS3 A;  5D6J B;  5KHQ A;  5LXH A;  1IP9 A;  2IO2 B;  1L2N A;  3H7P B;  2AL3 A;  2KTR A;  2KX0 A;  3WAM A;  4ZDV A;  3K9O B;  4BBN F;  1AAR A;  3M63 B;  2ZPY A;  1E8X A;  1WM3 A;  1XD3 B;  2FUH B;  2DHZ A;  2IO1 B;  4EFO A;  4DHZ E;  4BOS C;  2BYF A;  4WJP A;  2BWF A;  1YIW A;  4GSW A;  2FCM A;  2LVO A;  2N9E B;  2BF8 B;  2PE9 A;  2AYO B;  4GIV A;  1WR1 A;  3ZTC A;  4BFR A;  1C3T A;  3VUX A;  2IZV B;  2MBQ A;  2L76 A;  3T9L A;  4JQW C;  2LWP A;  2KX3 A;  2PPH A;  3A1Q B;  3NY5 A;  4FJY A;  2Y5B B;  4G50 A;  5CTR C;  4EZK A;  2G4D B;  2MRP A;  2KJR A;  3GOE A;  1YD8 U;  3L0W B;  1Q0W B;  3DQV A;  1ZGU B;  2LGD A;  1H8C A;  2O6V D;  1UBQ A;  1Y8R C;  2ZVN A;  2ZCB A;  4CO7 A;  4DDI D;  1V49 A;  4ICV A;  2GMI C;  1E8Z A;  2RGF A;  1LFD A;  3NOB A;  1E7U A;  2Z0E B;  2MX2 A;  2KFJ A;  4BKT A;  4G0N B;  2K6Q A;  3JSV B;  2PJH A;  2LRU A;  2MSE D;  4II2 B;  5C23 A;  1WF9 A;  3KUC B;  3L54 A;  3QAR A;  5DPR A;  2NS5 A;  4W9E A;  2LD9 A;  2LGX A;  2D3G A;  2XK5 B;  4DWF A;  2KWC A;  3AU4 A;  4KZ0 A;  2LXA A;  2MCN B;  2LGY A;  4GMV A;  3VXW A;  4P7I A;  2KWV B;  2L0T A;  2KQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...