2OJRA

Structure of ubiquitin solved by sad using the lanthanide-binding tag
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
GPGYIDTNNDGWIEGDELYIDTNNDGWIEGDELLAMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ubiquitin
publication title Double-Lanthanide-Binding Tags for Macromolecular Crystallographic Structure Determination.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2007-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ojrA02
1L2NA 3IG3A 3PVLA 4KIKB 1G6JA 1OTRB 2DYBA 5D7GA 3I3TB 3V62A 1A5RA 1XQQA 2O6VD 4A3PA 1VD2A 2KHWB 2Y5BB 2MCNB 2NS5A 3TIXA 4WJOA 3PREA 1XT9B 3UIPB 3HIZA 2AWTA 3T9LA 4EKUA 2RSUA 1WF9A 2I1JA 3PSEB 3WALA 3RT3B 4CHKA 5D94A 2KTFA 3AULA 2K8HA 3PLVA 3PTFC 1WE7A 3L13A 3QA8A 1V81A 2WX0A 3VUXA 2KO3A 1Z2MA 3M3JA 1FXTB 4WQOB 1R4MI 1WXSA 3L54A 3U30A 3ZRCA 1SGHA 5AZFA 2RD0A 3RD2A 3ZO5B 3K9PB 4XX5A 3A9JA 1MG8A 2KQ7A 2K6QA 4NQKE 2PEAA 1ISNA 4BKSD 3L08A 1WGHA 4MEMA 2L7RA 4K7SA 5HKHA 4MGZE 5AZHA 3MTNB 2J0JA 3W1SA 2LI5A 3L10B 2XK5A 4AJYB 1IYFA 2PE6B 4FJYA 2LRUA 4N9F4 1P1AA 2WWZA 3KUDB 4F8CB 4ZRJA 4G3XB 4B95A 2EMSA 4W9CA 2IO2B 3PZDA 1I35A 2LWPA 4FHJA 3H1UA 2NVUI 3ECIA 4IG7B 1E8XA 4W9HA 1V6EA 5CHWA 4I6NB 4II2B 1P3QU 2JY6A 3DBHI 1ZKHA 2W9NA 3O65B 3EFUA 5J17A 2KMAA 2G3QB 4OVUA 1V5TA 3Q3JA 2FIDA 3GZNI 4RMAA 3VTUA 2L0TA 2ZCCA 3PPAA 1S1QB 4KIKA 3DOWA 5J2RA 2KWVB 4W9KA 3QQ8B 1RRBA 2LVOA 2IBIB 4DK5A 3A9KB 4EZKA 3NHEB 4MELA 2KWCA 4FADA 3B1LX 4NQLB 4TQ0A 2PPHA 2NBUA 3AU4A 5CHFA 2LGYA 1V86A 1HE8A 4IW0A 2MBHA 3M63B 2FUHB 2CS4A 2UWQA 2M8SA 3QARA 3DVNV 4HCNB 4FN2A 1NBFC 1WR6E 3ML9A 5DPWA 3NZUA 4TQ1A 2J0MA 2MBBB 5AZGA 3RCZA 4WWNA 3OLMD 1C1YB 2IYDB 4NY0A 1QZEA 2ZNVC 4LDTB 4BKGA 4K81A 3R7QA 3WAOA 2D07B 3JSVB 1WX9A 2KN5A 2KX0A 4ICVA 5IAAC 1E8ZA 1GC6A 4ANXA 3A33B 2D2QA 2N1WA 2KFKB 2N4FA 2FNJB 3QC8B 1WYWB 3UQBA 4GIVA 1V49A 3IFWB 4E74A 4PYUA 2V3SA 4YL8A 5FR6A 2VRRB 1J8CA 2GBKA 3H7SA 3QIJA 2R2QA 1WJNA 1LFDA 1V5OA 3JVZX 4NNJB 1SIFA 2REXA 2OJRA 2XBBC 1D3ZA 2KX3A 2N7DA 3TBLD 4DHZE 3HK0A 2G45B 1WRDB 2KXJA 2RGFA 1SE9A 3V61A 3WAPA 3PHXB 3ZUNA 2ASQA 1AARA 2LVPA 2NPTB 1UBQA 2AL3A 2MBQA 2D10A 4K7UA 4MJSB 4EOYA 1OEYA 4GMVA 3VUYA 1E90A 3A9KA 1YX5B 2KFJA 3CF6E 4AWJA 2AYOB 4KV2A 1UH6A 2GOWA 2KDBA 2GBJA 2Z0EB 1Q5WB 4M8NA 3WANA 2FIFA 4MDKE 4PS3A 2JZ3B 2CHWA 5E6OA 4AUQC 2JXXA 3IVFA 1EF5A 4KSLC 2BYVE 1M94A 2IZVB 2MP2B 3VXWA 4CO7A 2GBNA 2BYEA 1E5WA 2C9WB 1KOTA 2K8CA 1WGYA 4BFRA 1U4AA 4FLHA 4A3OA 1WGRA 1WX7A 2MA9B 3JSVA 4FJZA 4WJNA 1OEYJ 3RULA 1E8WA 2J7QB 1J19A 2KOXA 2KFKA 4KDIC 1KLVA 2ZVOA 4JIOU 3ZDTA 1JRUA 1WM2A 3IHPC 1I42A 5DCNA 3NY5A 2C5LC 4BOSC 2JRIB 3UINB 1BT0A 2YVCA 3APFA 4WWPA 2KZRA 2UYZB 2LGXA 3X0WA 4BKTA 2HD5B 2CR5A 2KWUB 4WAAA 1P9DU 3VUWA 4AOFA 4AJWA 2O2VB 4KSKC 5L95C 1F9JA 1P98A 5DPRA 3WA0A 2JWZA 4G0NB 2ZEQA 2A5UA 2NPTA 4W9LA 1YX6B 4MJSA 4IC7B 3PHWB 4DDGD 4MSQB 1CMXB 3AXCA 2L8JA 3QHTA 2LUEA 1P0RA 1WJUA 5KHQA 2GMIC 1WJ4A 2MX2A 3KW5B 4EUTA 3EHVA 1K8RB 4ANVA 2L3ZA 2N9PC 2D11A 4TV3A 3DVGX 4F1SA 2KKCA 2DAJA 1C3TA 1YQBA 5EDSA 1LQBA 2ZPNA 1E7UA 3QCAA 2DZKA 3ZTDA 4ZRKA 1RFAA 2MP2A 4DXAB 2J0KA 3ONSA 4GB9A 2YLMA 5LLIA 2WDTB 2ZPYA 3HHMA 1X1MA 1KJTA 3ZIMA 3QX1A 2CHXA 5CHVC 2ZNVB 4WWOA 1WXVA 1WZ3A 1YIWA 3DBRI 2N9EB 2BKRB 3X23A 5JH5C 1Q0WB 3A1QB 2KMCA 3ZNHB 5LXHA 3OJ3A 4GOCA 2IY0B 3QJZA 3IBEA 4PS7A 1ZGUB 1WGDA 1T0YA 3DBLI 3RZWC 2MSED 3MHSD 4DHJB 2LGDA 3PV1A 2WX1A 5DPTA 2LD9A 4BBNC 1NI2A 1H8CA 4ANWA 1UGMA 2L05A 3DVGY 4E3CA 2O2VA 2HE7A 4ZYNA 4RM8A 1UBIA 2CHZA 2LVQA 2V4LA 2KANA 4MGIE 2C60A 4MH0E 4B9KA 4GSWA 2RR9A 5CX3A 1IPGA 4I6LB 4KDLB 3KUZA 2JRHA 2Z59B 3PS6A 3MJWA 4MSMB 3H7PB 2O6VB 4NAWB 2DZIA 4BBNF 1EF1A 3A4RA 3SU8X 2GBMA 2KC1A 3LDZE 2LJ5A 3KH0A 1WR1A 3P2BA 2M0XA 1PQSA 1WGGA 4JGHB 1J0GA 4HXDA 2RPQA 1TBEA 4IM0A 3JYUA 2L76A 5D6JB 3TMPB 5GMVA 3S2AA 2DENB 3EECA 4DHZB 3ZW3A 3AI5A 3L17A 3ALBA 4K1RB 3SD5A 2ZCBA 5JZEB 3RZFA 4XC2A 2K8BA 1OGWA 1GC7A 2LZ6A 2PJHA 3VFKA 4EEWA 2N7EA 2DHZA 4HPMB 1WXAA 4LDTD 1WMHA 3APDA 4F7ZA 4P7IA 1WH3A 3L16A 4HVBA 2KLGA 2ZJDA 1WZ0A 4KZ0A 3W1SC 3H6NA 3VQIA 5C23A 2KC2A 4DHJD 4X57B 2K39A 4E71A 3ML8A 1UZXB 3QAQA 2LXAA 3BY4B 3V6CB 4LCDE 2WYQA 2G4SA 2Z0DB 3DVNU 3ZVVA 4XZ4A 3ZNID 2KTRB 1VCBA 2NBWB 2KVRA 3ZLZA 3ZNGC 3VAWA 2IO0B 1WIAA 4FJVB 2BWFA 4ASWC 2M4NA 5KHOA 3A1QA 4J6IA 2EMTA 2CU1A 4ICUA 4W9IA 4B6WA 1Y8RC 3VHTC 2JUOA 4GGQA 5G2NA 1S3SG 4DDID 5AEKB 2DX5B 4WJPA 4EFOA 1GJZA 3M62B 1TTNA 4BVUC 4OVVA 2FAZA 5G55A 2AEHA 3RYTA 2FCNA 2PE9A 2KJHB 4IM3A 3VH4B 5BO4B 2KK8A 3Q3FA 2FCQA 2N1VA 1WFYA 2DYMA 2IO3B 2GBRA 1TZ1A 4W9FA 3H7PA 2O6VA 4NAWA 2MQJA 2DAFA 3V60A 4NJ6A 3CSTA 3N3KB 3TL5A 4HPLB 1GG3A 1EUVB 3ZTCA 2C7NB 3V6EB 3SHQA 5D2MB 4DWFA 2C7MB 5TR5A 2K6DB 4IWPA 2NR2A 2D3GA 1WY8A 2KJRA 3ZNZB 2JT4B 2LXCA 5LXIB 2K25A 3DQVA 4HCPB 4GDLB 4PYZA 1GUAB 2IY1B 3BINA 3HM3A 4EZLA 5L83A 4GU2A 2MBOA 4IWQA 2KQSA 2A4ZA 1V2YA 2KJ6A 3R66C 3VDZA 1TGZB 4GDKB 2R2OA 3QWZB 3R7RA 4JQWC 2AL6A 1LM8B 2DYOA 1H4RA 1NDDA 4TKNA 3ZRFA 2MW5A 2FCMA 2LASA 3C0RB 2JZZA 1KM7A 3KVFB 2KDEB 3RUIB 4W9JA 3EC8A 3D32A 1WMHB 3JW0X 1RAXA 4W9GA 3K9OB 3ZKJC 1GNUA 2L00B 4BKSA 5JHAA 2G4DB 2XEWA 1UELA 2KDFB 3VVWB 3NZSA 3UQAA 3R3MA 2KTRA 3PT2B 2NBVB 4HDQA 3AU5A 3QK0A 1V9JA 4W9DA 3VH3B 2EKEC 3SDLC 4URKA 4GXBA 3NOBA 1LXDA 2M1MA 2JPHA 3PGEA 4DBGA 3PLUA 4M8MA 4IWOA 2BKFA 2LRWA 4HJKA 1Q1OA 2OOBB 3ENEA 2C7HA 1YD8U 5DPSA 3VTVA 2HTHA 4MGYE 4WJQA 4HWIB 2CKHB 4G11A 3LJ3A 1WE6A 4W9EA 3DCGA 2N9XA 3PRZA 2BWES 3PRPB 3UF8A 4G50A 1Z5SB 3APCA 2BGFA 3PRMB 2ZVNA 3DBSA 2FCSA 2MWSB 2NCNA 3W1YA 1ZW7A 4I6PA 4ANUA 3L0WB 1UD7A 2B3AA 4JL9A 1RLFA 4HLEA 2BPSA 2BF8B 5E6PA 1EO6A 3H9DA 3KYCD 5JHBA 3UGBB 2MBEA 3B0AA 4ZDVA 4NPNA 3U8ZA 4HK2A 3M95A 1E7VA 4HDOA 4GDLA 1R4NI 3U7DA 2DZMA 1XD3B 2KD0A 3B08A 2JVCA 3VTWA 2KDIA 3A9JB 2KLCA 4FULA 1WJ6A 4KZCA 2M17A 3TCAA 2BYFA 3OJ4B 4GDKA 4FBJB 3GOEA 3UIOB 3DDCB 1E8YA 3A4SC 4RM9A 3KUCB 3WIMA 4JLCA 2I1KA 2HJ8A 4K7WA 4II3B 1OQYA 4PS8A 5CTRC 3CSFA 2L0FA 1WXMA 3HM6X 3T8MA 5IA7A 1V80A 3OAWA 2QHOA 2ZZPB 3N32A 4KVGB 2V1YA 4AP4C 2KNBA 1YJ1A 2MRPA 2XK5B 4IUMB 2IO1B 5C1ZA 3DPDA 3KYDD 3ZDMC 4FHKA 2K1FA 4A20A 5J18A 1WM3A 4NJ7A 4LJPB 4LJOB 3N30A 1L7YA 4M0WB 5E6NA 2MLBA 4TUUA 3WAMA 4IM2A 4BOZB 3CMMB 4CYEA 4EZJA 4MM3A 2JF5A 3TJPA 3NS8A 1WI0A 1WX8A 4FA6A 4GN1A 1IP9A 2DZJA 4MGKE 4ZRIA
chains in the Genus database with same CATH superfamily
4B0EA 4KIKB 1OTRB 1FRDA 3TIXA 3PREA 3SEBA 1WF9A 4HROA 4CHKA 1ZXIA 5D94A 4OZBA 5C2TB 4L2YA 2K8HA 2GB1A 3PLVA 1V81A 3M3JA 5IN7A 1WYGA 2E6XA 5AZFA 3NVVA 3ZO5B 5EE3A 1MG8A 2KQ7A 1JWMD 4Q2JA 2PEAA 3RMKC 1WGHA 2L7RA 3P4QB 1QLBB 4MGZE 4AJYB 1L6VA 4US8A 1C77A 3KUDB 1YQ3B 2EMSA 3LXFA 2IO2B 4W9HA 4FHJA 3ECIA 1V6EA 5CHWA 3I5JC 1TS4A 1ZKHA 4JPSA 3O65B 2BS3B 3GZNI 2WXLA 4KIKA 5J2RA 1ACCA 2J52A 2BS4B 4XYCA 4EZKA 4TQ0A 2FUG1 4KGRA 5CHFA 3NS1A 2LHDA 2JU6X 3QARA 2J53A 3NZUA 1UNSA 3OLMD 1XEEA 2WXNA 4RNAA 3AE7B 3GE8C 4YWGG 5EE0A 1WX9A 2KX0A 1PGAA 1E8ZA 4ANXA 5AUKA 1K51A 2KFKB 2N4FA 1EU4A 1XCTL 4E74A 2V3SA 5G5HA 1YOVB 2M0AA 2ICIA 2VRRB 1WRIA 1FFUA 3AE5B 3QIJA 4KKJA 1WJNA 1SIFA 1L0VB 2OJRA 3TBLD 4JWUC 2QC8A 1VZ6A 2WXOA 2KXJA 3C19A 4AQ7A 3DBHB 1FNWA 2NPTB 1UBQA 4WWMA 3ZJUA 1C78A 2IJ0A 1Q5WB 2CHWA 1C76A 2B76B 2IZVB 1DYQA 3VRAB 2MP2B 1KOTA 1RFKA 1C4PA 4FJZA 1JRPA 1J19A 2AX5A 2ZW0A 3RN9C 2KFKA 4KDIC 1N5XA 1FO4A 3ZDTA 2Y3AA 4YT0B 3BVZA 4RGMA 1R4NB 2C5LC 1OQRA 2JRIB 1BT0A 2CJNA 1N63A 1IGDA 1TYGB 2LGXA 3X0WA 3RI7C 3SR6A 4AOFA 1C79A 1P98A 2INCC 1JWUD 2HTME 3WA0A 1TZOA 2NPTA 4IC7B 4DDGD 2WS3B 1PYWD 4YSYB 3QHTA 2L8JA 2LUEA 1P0RA 5KHQA 1HA5A 1WJ4A 4EUTA 3EHVA 2W55A 4XWWA 5D3DA 2D11A 3RNFC 1EU3A 2DAJA 2WLBA 1L5PA 4RGTA 3ZTDA 1RFAA 2MP2A 3ONSA 3Q6BA 2PVGC 2RDBC 2WDTB 2MH7A 2CHXA 5CHVC 4WWOA 1WXVA 1WZ3A 1YIWA 1NYRA 2BKRB 3PZ8A 1NEKB 2KQ4X 5LXHA 1D5MC 4GOCA 2IY0B 3QJZA 3DHGC 1T0YA 5BMIA 3RZWC 2LGDA 1N62A 2WXMA 3GB1A 4MH0E 2BT6A 5CX3A 3IAM1 4MSMB 4NAWB 2NTSA 1MHHE 1MI0A 1AW7A 2GBMA 2LJ5A 2M0XA 1PQSA 4IM0A 3JYUA 1J7AA 4PT5A 4DHZB 3EECA 1I4XA 3ETRA 3GZNB 4EEWA 2N7EA 3EGRA 4ZYSA 4LDTD 1QKZA 3AE4B 1WH3A 3L16A 4KZ0A 5C23A 4DHJD 1L4DB 3ML8A 1UZXB 1F52A 2JSVX 2WYQA 2G4SA 4WQMA 3ZNID 2WXFA 3N20C 3KLSX 1VCBA 2NBWB 3FILB 3ZNGC 1N61A 1WIAA 3RNEC 2BWFA 4OVZA 4ICUA 4XDCA 4B6WA 4GGQA 5AEKB 2DX5B 4EFOA 2DBYA 1TTNA 4OVVA 2FAZA 5G55A 2AEHA 3RYTA 1TY2A 4IM3A 1R7SA 3RFZB 1CQVA 2N1VA 1WGKA 2IO3B 2GBRA 1E0ZA 4W9FA 4NAWA 3V60A 2DAFA 3CSTA 3N3KB 1EUVB 2OEDA 1SE2A 1QILA 3W5VB 5LXIB 2BQQA 4GDLB 3BINA 2MBOA 4IWQA 2KQSA 1V2YA 1FEHA 3R66C 1TGZB 3VR9B 3R7RA 1NDDA 4TKNA 1V97A 4HEA1 2MW5A 2FCMA 4LLGM 3KVFB 2KDEB 3RUIB 4W9JA 4AS1A 1RAXA 4DQOC 3K9OB 3ZKJC 1GNUA 2G4DB 3HUIA 3L4PA 3FILA 3SDLC 4GXBA 1LXDA 2JPHA 2PKOA 4DBGA 4IWOA 2BKFA 4HJKA 1Q1OA 2PVOD 2C7HA 1YD8U 2QDFA 3VTVA 2HTHA 4MGYE 2ONQA 1DOYA 3LJ3A 4W9EA 2N9XA 3WCQA 2BW2A 2FE8A 4HJGE 4JE3B 3PRPB 1MHXA 3PRMB 3Q2AC 4I6PA 4QAYA 1UD7A 2BF8B 5E6PA 1EO6A 3H9DA 1K52A 1JWAD 1M4VA 1ESFA 4GDLA 2DZMA 2KDIA 3A9JB 1P7EA 2KLCA 2G1EA 4FULA 3DDCB 5BYSA 3A4SC 3HVDA 2HJ8A 4K7WA 1OQYA 5CTRC 3CSFA 2L0FA 4KVGB 2KNBA 1YJ1A 2WNMA 2IO1B 2KAJA 1UF0A 1JWBD 4FHKA 2K1FA 1FPYA 3IT4B 2JXTA 5MPOA 5E6NA 2JF5A 5HI1A 4LNIA 2DLBA 4WURA 2PJHA 1FM0D 2PTLA 4MGKE 4P7IA 4ZRIA 4OHJA 1G6JA 4P6VF 5D7GA 3PO0A 1A5RA 2O6VD 3ZYYX 3AECB 3AE2B 3AE6B 2KHWB 2NS5A 2WXQA 1YNTE 3UIPB 3HIZA 2AWTA 1ENFA 1SXTA 3PSEB 3RNBC 2KTFA 4KGSA 3PTFC 3ZJVA 1PGXA 3L54A 3U30A 3ZRCA 3N1ZC 3A9JA 1KLGD 2K6QA 1ISNA 4MEMA 4ZOHC 1XLOA 1DOIA 3MTNB 2J0JA 2JWUA 1P1AA 2UU7A 3AEEB 4B95A 3PZDA 4O1NA 1SEBD 4I6NB 2JY6A 3DBHI 2VZKB 1I4RA 2JYEA 2BB6A 3Q3JA 2BS2B 3VTUA 3NVZA 3NG0A 4W9KA 2LFIA 1D6EC 3QQ8B 4DK5A 3A9KB 3NHEB 2WXKA 2KWCA 4FADA 3B1LX 2PPHA 2NBUA 3BK1A 2WU5B 1B1ZA 2LGYA 2ACZB 3ZXVA 2FUHB 2K9XA 5FKAC 4FN2A 5DPWA 1QOFA 2WQYB 3BYTB 2WXGA 2J0MA 2MBBB 3DHHC 3RCZA 4WWNA 4A55A 3Q3MC 2KWDA 4ZRQA 3N9YC 4BKGA 3R7QA 3WAOA 2WDVB 2KN5A 5IAAC 1FNUA 4HRSA 2N1WA 2FNJB 3UQBA 4GIVA 3IFWB 3CIRB 4PYUA 1J8CA 3H7SA 2J4XA 1V5OA 2XN9C 3KQ4A 2XBBC 2KX3A 2K22A 3URYA 1SE9A 5HHDG 2V4IB 2QCZA 2KACA 2LVPA 4MJSB 4K7UA 1TS5A 4GMVA 3A9KA 2INDC 2KFJA 1VLBA 1UH6A 2GBJA 2Z0EB 1RWSA 2FIFA 4MDKE 1AYFA 2PW9A 4L23A 1T0SC 2MJEA 3GP7A 5IO9A 2BTEA 4CO7A 2GBNA 2BYEA 1E5WA 2C9WB 1LO5D 2PMVA 1WGYA 2L1AA 2J42A 4BFRA 4N58A 1U4AA 1OFFA 1WX7A 2MA9B 4YSXB 4C80A 3RULA 2KOXA 1E6EB 1I42A 5DCNA 4YXDB 1KRHA 5EE9A 4WWPA 2KZRA 2WGSA 4HKQA 5IOIA 4KKIA 4BKTA 2CR5A 2KWUB 1P9DU 3BWUD 5L95C 2QJLA 4ITKA 5DPRA 4KX6B 1SBBB 2I38A 2CU3A 4G0NB 1XO3A 1QT9A 1ZPSA 2ZEQA 2IDYA 4XGAB 4W9LA 1YX6B 4MJSA 3PZ7A 3BIID 2BB5A 2MX2A 3ABVB 3BK2A 2K0PA 2N9PC 5EE1A 2KKCA 2NMQA 1SE4A 1FXAA 1C3TA 4RF1A 2E3TA 1LQBA 1E7UA 1FCLA 4A8XC 2W54A 4GB9A 3OG5A 2K5PA 2X8XX 2INNE 1KJTA 5T8IA 3R8BA 4ARCA 2N9EB 2KVZA 1Q0WB 3N1XC 4M01A 1GB1A 2WDRB 3IBEA 1ZGUB 2MSED 3MHSD 1BMLC 2LD9A 1UGMA 1V1PB 2L05A 3BYYB 3J9CA 4RM8A 2LVQA 2KANA 4GSWA 2RR9A 1UGJA 4KDLB 2R61A 2Z59B 3H7PB 3SFEB 1QQRA 1EF1A 3DHIC 2KC1A 3LDZE 2N9KA 3P2BA 4JGHB 4HXDA 1TBEA 1QOAA 2L76A 4KGTA 3ALBA 2MJ3A 4K1RB 2ZCBA 3SD5A 3RZFA 2K8BA 2RDGA 1GC7A 3SFDB 4OZCA 5LNK1 3W1SC 1BUIC 3H6NA 3VQIA 2KC2A 2LGIA 1SF0A 2WXRA 2K39A 1VZ8A 3N1YC 2LXAA 1KH0A 1WXQA 3V6CB 3DVNU 3ZVVA 4XZ4A 2CJOA 2KVRA 1UWXA 4J6IA 2EMTA 2GLSA 2WXJA 1Y8RC 3VHTC 4DDID 4WJPA 3MHZA 1GJZA 3M62B 4P16A 1HXYD 2KJHB 3P42A 2NTTA 1V1PA 3TEYA 1SJHD 2DNFA 2PIAA 4CQNA 1HTOA 2Q5WD 3H7PA 2KMMA 5D3IB 2MQJA 4NJ6A 1XXGA 2ZW1A 4HPLB 1GG3A 1HZ6A 3ZTCA 2BVCA 3SHQA 2D3GA 3ZNZB 2JT4B 2LXCA 3DQVA 4HCPB 1GUAB 4GU2A 2A4ZA 3VDZA 4GDKB 2R2OA 3QWZB 2AL6A 3LYYA 1ZP0B 2DYOA 3TSSA 2IGHA 1QF6A 4K3BA 1KM7A 1ZOYB 4GLSC 4OZAA 4W9GA 3Q8AA 4IKGA 1JROA 3PT2B 2NBVB 1CJEA 3QK0A 2EKEC 2MEKA 2M19A 3PLUA 2OOBB 3ENEA 5DPSA 4WAFA 4HWIB 2CKHB 4IDIA 3AEDB 3DCGA 3FKYA 3U7ZA 1L0YB 1TIFA 1Z5SB 4HKZE 2BGFA 1V8CA 2PLPA 3RPFC 2B3AA 4JL9A 4HLEA 3KYCD 5JHBA 2HDEA 5E6JA 1AN8A 4ZDVA 4NPNA 3U8ZA 4HK2A 3M95A 4HDOA 4LNFA 3P1MA 1N6ZA 2JVCA 4KZCA 3TCAA 1VZ7A 4GDKA 3GOEA 1E8YA 3TEZA 4RM9A 3IT6B 3KUCB 4PS8A 3OWEB 1WXMA 3T8MA 2QHOA 2W3RA 2KN4A 1NVID 3BVMA 5C1ZA 2VH1A 5J18A 3N30A 4BOZB 2YEPF 3P63A 4EZJA 1WI0A 1WX8A 1XLPA 5GXGB 4LTUA 2I2YA 2DYBA 3I3TB 1MPEA 1YN4A 1VD2A 2MCNB 3CWIA 3W2DA 1XT9B 4EKUA 3AMZA 4RCOA 4EE2A 2RSUA 3WALA 2VH2A 1WE7A 2QEJC 3VUXA 2EELA 2KO3A 1FXTB 3KWVA 4WQOB 3U52E 1R4MI 1NYQA 1WXSA 2N9LA 1SGHA 1P7FA 2TSSA 3RD2A 2BYTA 5HG2A 4BKSD 4C4VB 2KT7A 2QIEB 4K7SA 2W82A 5HKHA 4YTPB 4S0RA 3W1SA 3L10B 4P1CC 2PE6B 1RM6C 4FJYA 2LRUA 4N9F4 2WWZA 4F8CB 4ZRJA 3NVYA 1I35A 3H1UA 2NVUI 2MHJA 4II2B 1L6UA 2LHEA 1SJED 2KYWA 1V5TA 2FIDA 2L0TA 2ZCCA 1WWTA 3NJTA 2LVOA 2IBIB 1ET6A 4BAXA 4MELA 3V05A 4NQLB 3AU4A 1ROEA 1FMAD 2V3PA 4WIPA 1DOXA 2SAKA 2UWQA 1JW9D 2M8SA 3DVNV 4HCNB 2XNAC 1NBFC 1WR6E 4TQ1A 4C56C 1TS2A 5AZGA 1C1YB 3R2IA 4NY0A 1QZEA 1YN5A 4LDTB 4C4VA 2VZKD 3JSVB 4ICVA 2V3NA 1HQRD 2L52A 3IAS1 5FR3A 3QC8B 1V49A 4C7ZA 1OQQA 4YL8A 5FR6A 1WSPA 2GBKA 3JVZX 4NNJB 3B9JA 3MJ5A 3HK0A 4ZHOA 3BZDB 3V61A 2D10A 1E90A 4C7YA 3CF6E 3DWGC 4AWJA 2EKIA 2GOWA 2KDBA 1JWSD 3WANA 2JZ3B 3T3NA 3IVFA 1GB4A 1EF5A 1EM7A 4ACFA 1K53A 2WXHA 2LJIA 1MJDA 2K8CA 5BMHA 1CZPA 4FLHA 3JSVA 2LMCA 4WJNA 2J7QB 3GE3C 1KF6B 4JIOU 1JRUA 3IHPC 2JYTA 1UWMA 1LGRA 4BOSC 1PUTA 3APFA 2WU2B 2HD5B 4WAAA 3VUWA 4AJWA 2MJDA 2O2VB 1F2RC 4US9A 2JWZA 1HEZE 1TKGA 1XLNA 3PHWB 1CMXB 1PGBA 3FAHA 3AXCA 3MC8A 2WXPA 1FXIA 2D3AA 1K8RB 4ANVA 5BMGA 2L3ZA 3DVGX 1T6BX 1ZE3D 1EWCA 4LK0M 1YQBA 2ZPNA 1NI3A 4ZRKA 4DXAB 2FBWB 2J0KA 2YLMA 3ZIMA 3DBRI 4B0MA 3AE1B 5JH5C 1R4MB 3A1QB 3ZNHB 1MVKA 3DBLI 1TKEA 4DXFA 2WX1A 1NI2A 1H8CA 4E3CA 2O2VA 2HE7A 4ZYNA 2CHZA 4MGIE 2V4LA 2C60A 1IPGA 2GI9A 4I6LB 3KUZA 2JRHA 3MJWA 2O6VB 2DZIA 4BBNF 3Q8EA 1YJJA 3SU8X 1SSNA 1WR1A 3KH0A 1J0GA 2BBCA 5D6JB 5GMVA 3S2AA 1HTQA 2DENB 2ON8A 3ZW3A 5FK9C 4JX1C 3AI5A 2V0GA 5JZEB 3VFKA 2DHZA 4HPMB 1WXAA 1WMHA 3APDA 4DXGA 3RNAC 2ZJDA 1WZ0A 3H8HA 2OJWA 4BZAA 4XWTA 2Z0DB 4REZA 3NZ3A 4MT5A 3W9CB 4FJVB 1D5XC 4ASWC 5KHOA 3A1QA 1I4QA 1SB3C 2CU1A 3GS2A 4ZRPA 5HFYA 2JUOA 5G2NA 1S3SG 4XE0A 4BVUC 2D3CA 3VH4B 3Q3FA 2DYMA 3AB5A 3FC4A 5BYRA 2O6VA 5JXVA 1N5WA 3AV8A 3V6EB 2WP9B 5D2MB 1FFVA 1BXTA 2C7MB 4IWPA 2NR2A 2KJRA 3HVZA 4UDUC 4PYZA 2IY1B 3Q69A 4EZLA 5L83A 1YMHE 2KJ6A 5H92C 1H4RA 4M02A 3C0RB 3EC8A 3D32A 3E9SA 5IKCM 3AEFB 1UELA 2KDFB 4D2KA 3NZSA 1TS3A 3R3MA 4HDQA 4YTMB 4URKA 3Q8FA 2M1MA 2INPE 1F0ZA 5IP4D 4M8MA 5G5GA 5I4DA 2LRWA 4S17A 1WE6A 2D5GA 4RF0A 2N7JA 3PRZA 2BWES 1MFWA 3UF8A 1Q10A 3APCA 1SIJA 2QSDA 2ZVNA 2MWSB 4ANUA 3DWMA 1RLFA 4R3DA 2OHFA 3EUB2 2GRIA 1E7VA 3VTWA 1WJ6A 2WDQB 3UIOB 3WIMA 1I7HA 4II3B 3P4RB 3NUHB 3OAWA 2V1YA 2XK5B 4IUMB 4NJ7A 1IP9A 4M0WB 2MLBA 3WAMA 4IM2A 4CYEA 3B2GA 2RPVA 3TJPA 3NS8A 4FA6A 1E9MA 3P4SB 2DZJA 1T5XD 1JCKB 1L2NA 3IG3A 3PVLA 3I63C 3V62A 1XQQA 4A3PA 2Y5BB 4WJOA 3DBRB 3T9LA 1N60A 1ZUD2 2I1JA 3RT3B 2D3BA 3AULA 3DBLB 1Y56A 1KLUD 3L13A 3QA8A 1YN3A 2WX0A 2Z8LA 1Z2MA 3MP9A 3RNCC 3E56A 2RD0A 4NZLB 3K9PB 2V9HA 4XX5A 4NQKE 3AE9B 1VR9A 2K3UA 1ZDXA 3L08A 1J7BA 4YTNB 5AZHA 3U2SC 2LI5A 1YQ4B 2XK5A 1IYFA 4G3XB 4W9CA 2LWPA 4MH8A 4IG7B 4M0WA 1E8XA 4XDDA 1P3QU 2W9NA 2WXIA 3EFUA 5J17A 2KMAA 2G3QB 4OVUA 2LGSA 3NVWA 1L0XB 4RMAA 3PPAA 4A90A 1S1QB 3DOWA 1TY0A 2KWVB 1KTKA 1RRBA 1PDXA 1FCCC 4FXCA 1TKYA 1ZDVA 1V86A 1XCQL 1HE8A 4IW0A 2MBHA 3M63B 2CS4A 3V3XA 3HRDD 3TEWA 1E10A 3ML9A 4P1BC 2IYDB 2ZNVC 3AEGB 4K81A 1HZ5A 1K50A 2D07B 1B9RA 1GC6A 4WH4A 5AUIA 2Y5CA 3A33B 2D2QA 2YEPB 1WYWB 2DWQA 2AQ2B 3EFCA 2R2QA 1LFDA 4RH6A 2REXA 1D3ZA 2N7DA 1J7CA 4DHZE 2G45B 4N59A 1WRDB 3Q8BA 2RGFA 2IPKD 3WAPA 3PHXB 3ZUNA 3VRBB 2ASQA 4K3CA 1AARA 2AL3A 2MBQA 3R2TA 4EOYA 4HPPA 1OEYA 1ZXHA 3VUYA 1YX5B 1YJIA 1E7PB 2AYOB 4KV2A 4C00A 1I4HA 1QOBA 1D4BA 4M8NA 1GPXA 4PS3A 4AUQC 5E6OA 2Y5PA 1XF5L 2JXXA 4LNOA 1T0QC 4KSLC 1PFDA 3MC9A 2BYVE 1M94A 3VXWA 1D5ZC 1C9FA 1C4CA 1IGCA 2QILA 1EWYC 3I9V1 4A3OA 1WGRA 3VR8B 3UI3A 1CK1A 1OEYJ 1E8WA 1MG4A 1KLVA 2ZVOA 3MFGA 3T3OA 1WM2A 4PK1A 1V1OA 1VJKA 3NY5A 3BVGA 2RDHA 3UINB 2YVCA 2UYZB 3P4PB 3TEXA 2M56B 4KSKC 1F9JA 4J3OD 1IBXB 2H88B 4A6QA 2A5UA 2KDMA 2H89B 4MSQB 2JZPA 1WJUA 3B2FA 2GMIC 3AE3B 4M00A 3KW5B 4TV3A 3ZQ4A 4F1SA 2G9HD 4IOIE 1KFYB 5EDSA 4MACA 2QMTA 3QCAA 2DZKA 4USAA 5LLIA 2ZPYA 3HHMA 1X1MA 2IGDA 2X38A 3QX1A 2WHIA 2ZNVB 3X23A 1I4PA 1JQ4A 2KMCA 3Q8CA 3OJ3A 4PS7A 3AEBB 1WGDA 1DGJA 1QOGA 3O13A 4DHJB 5DPTA 1JMLA 3PV1A 4BBNC 3KWLA 1F2RI 4ANWA 3DVGY 5BYQA 1UBIA 4B9KA 1IBXA 4OW0A 3TUOA 3PS6A 1L4ZB 3IXSA 1I4GA 3A4RA 2JQRB 1FNVA 1WGGA 2RPQA 3TMPB 1GAQB 3L17A 4JWSC 4XC2A 1OGWA 2LZ6A 3MC0B 4F7ZA 4HVBA 2KLGA 3NRZA 1ET9A 2L83A 3LB8C 4X57B 4E71A 4LNNA 3AN1A 3QAQA 3BY4B 4L1BA 4LCDE 2KTRB 3ZLZA 3VAWA 2IO0B 5C3JB 2M4NA 4W9IA 1VRAB 2SEBD 1VDVA 3AM9A 1JALA 1STEA 2FCNA 2PE9A 2LUMA 4ARIA 5BO4B 2KK8A 1FD6A 2FCQA 1WFYA 1TZ1A 1XLQA 5H8YE 3RNGC 2N0SB 1F77A 3TL5A 3ZGZA 2C7NB 3AH7A 4DWFA 5TR5A 2K6DB 1WY8A 1IUEA 2K25A 3AE8B 2RMMA 3HM3A 2W3SA 1FIQA 2LEKA 1SE3A 4JQWC 1LM8B 3ZRFA 2AQ3B 2LASA 3W5UB 2JZZA 1FRRA 3JW0X 1WMHB 4TMAB 2L32A 1AWDA 4N6EB 2L00B 4BKSA 5JHAA 2XEWA 3UQAA 3VVWB 2KTRA 4W9DA 3AU5A 3VH3B 1V9JA 3NOBA 3ZXRA 3PGEA 4MM3B 1UUPA 2AQ1B 4WJQA 4G11A 4NAMA 1T0RC 4RGNA 3I57A 4G50A 3U4EG 3C8YA 3DBSA 4NJCA 4RGOS 2FCSA 2NCNA 1NENB 3W1YA 4ZHPA 1ZW7A 3L0WB 1T3QA 3AEAB 2BPSA 4YSZB 3UGBB 2MBEA 3ZJTA 1F1HA 3B0AA 4H2AA 1RYJA 1R4NI 3Q3NC 3U7DA 2KD0A 1XD3B 3B08A 3EA6A 2M17A 2BYFA 3OJ4B 4FBJB 2HJ1A 4JLCA 2I1KA 4A9AA 2IGGA 5TSSA 3HM6X 5IA7A 1V80A 2ZZPB 3N32A 4AP4C 1TJEA 2MRPA 1GOZA 3DPDA 3KYDD 3ZDMC 1A70A 1C4AA 4A20A 2JX5A 1WM3A 4LJPB 4LJOB 4LNKA 1L7YA 4TSSA 4TUUA 3Q14C 3CMMB 4MM3A 3Q3OC 1TT5B 4RFBA 4GN1A
chains in the Genus database with same CATH topology
1L2NA 3IG3A 3PVLA 4KIKB 1G6JA 1OTRB 2DYBA 5D7GA 3I3TB 3V62A 1A5RA 1XQQA 2O6VD 4A3PA 1VD2A 2KHWB 2Y5BB 2MCNB 2NS5A 3TIXA 4WJOA 3PREA 1XT9B 3UIPB 3HIZA 2AWTA 3T9LA 4EKUA 2RSUA 1WF9A 2I1JA 3PSEB 3WALA 3RT3B 4CHKA 5D94A 2KTFA 3AULA 2K8HA 3PLVA 3PTFC 1WE7A 3L13A 3QA8A 1V81A 2WX0A 3VUXA 2KO3A 1Z2MA 3M3JA 1FXTB 4WQOB 1R4MI 1WXSA 3L54A 3U30A 3ZRCA 1SGHA 5AZFA 2RD0A 3RD2A 3ZO5B 3K9PB 4XX5A 3A9JA 1MG8A 2KQ7A 2K6QA 4NQKE 2PEAA 1ISNA 4BKSD 3L08A 1WGHA 4MEMA 2L7RA 4K7SA 5HKHA 4MGZE 5AZHA 3MTNB 2J0JA 3W1SA 2LI5A 3L10B 2XK5A 4AJYB 1IYFA 2PE6B 4FJYA 2LRUA 4N9F4 1P1AA 2WWZA 3KUDB 4F8CB 4ZRJA 4G3XB 4B95A 2EMSA 4W9CA 2IO2B 3PZDA 1I35A 2LWPA 4FHJA 3H1UA 2NVUI 3ECIA 4IG7B 1E8XA 4W9HA 1V6EA 5CHWA 4I6NB 4II2B 1P3QU 2JY6A 3DBHI 1ZKHA 2W9NA 3O65B 3EFUA 5J17A 2KMAA 2G3QB 4OVUA 1V5TA 3Q3JA 2FIDA 3GZNI 4RMAA 3VTUA 2L0TA 2ZCCA 3PPAA 1S1QB 4KIKA 3DOWA 5J2RA 2KWVB 4W9KA 3QQ8B 1RRBA 2LVOA 2IBIB 4DK5A 3A9KB 4EZKA 3NHEB 4MELA 2KWCA 4FADA 3B1LX 4NQLB 4TQ0A 2PPHA 2NBUA 3AU4A 5CHFA 2LGYA 1V86A 1HE8A 4IW0A 2MBHA 3M63B 2FUHB 2CS4A 2UWQA 2M8SA 3QARA 3DVNV 4HCNB 4FN2A 1NBFC 1WR6E 3ML9A 5DPWA 3NZUA 4TQ1A 2J0MA 2MBBB 5AZGA 3RCZA 4WWNA 3OLMD 1C1YB 2IYDB 4NY0A 1QZEA 2ZNVC 4LDTB 4BKGA 4K81A 3R7QA 3WAOA 2D07B 3JSVB 1WX9A 2KN5A 2KX0A 4ICVA 5IAAC 1E8ZA 1GC6A 4ANXA 3A33B 2D2QA 2N1WA 2KFKB 2N4FA 2FNJB 3QC8B 1WYWB 3UQBA 4GIVA 1V49A 3IFWB 4E74A 4PYUA 2V3SA 4YL8A 5FR6A 2VRRB 1J8CA 2GBKA 3H7SA 3QIJA 2R2QA 1WJNA 1LFDA 1V5OA 3JVZX 4NNJB 1SIFA 2REXA 2OJRA 2XBBC 1D3ZA 2KX3A 2N7DA 3TBLD 4DHZE 3HK0A 2G45B 1WRDB 2KXJA 2RGFA 1SE9A 3V61A 3WAPA 3PHXB 3ZUNA 2ASQA 1AARA 2LVPA 2NPTB 1UBQA 2AL3A 2MBQA 2D10A 4K7UA 4MJSB 4EOYA 1OEYA 4GMVA 3VUYA 1E90A 3A9KA 1YX5B 2KFJA 3CF6E 4AWJA 2AYOB 4KV2A 1UH6A 2GOWA 2KDBA 2GBJA 2Z0EB 1Q5WB 4M8NA 3WANA 2FIFA 4MDKE 4PS3A 2JZ3B 2CHWA 5E6OA 4AUQC 2JXXA 3IVFA 1EF5A 4KSLC 2BYVE 1M94A 2IZVB 2MP2B 3VXWA 4CO7A 2GBNA 2BYEA 1E5WA 2C9WB 1KOTA 2K8CA 1WGYA 4BFRA 1U4AA 4FLHA 4A3OA 1WGRA 1WX7A 2MA9B 3JSVA 4FJZA 4WJNA 1OEYJ 3RULA 1E8WA 2J7QB 1J19A 2KOXA 2KFKA 4KDIC 1KLVA 2ZVOA 4JIOU 3ZDTA 1JRUA 1WM2A 3IHPC 1I42A 5DCNA 3NY5A 2C5LC 4BOSC 2JRIB 3UINB 1BT0A 2YVCA 3APFA 4WWPA 2KZRA 2UYZB 2LGXA 3X0WA 4BKTA 2HD5B 2CR5A 2KWUB 4WAAA 1P9DU 3VUWA 4AOFA 4AJWA 2O2VB 4KSKC 5L95C 1F9JA 1P98A 5DPRA 3WA0A 2JWZA 4G0NB 2ZEQA 2A5UA 2NPTA 4W9LA 1YX6B 4MJSA 4IC7B 3PHWB 4DDGD 4MSQB 1CMXB 3AXCA 2L8JA 3QHTA 2LUEA 1P0RA 1WJUA 5KHQA 2GMIC 1WJ4A 2MX2A 3KW5B 4EUTA 3EHVA 1K8RB 4ANVA 2L3ZA 2N9PC 2D11A 4TV3A 3DVGX 4F1SA 2KKCA 2DAJA 1C3TA 1YQBA 5EDSA 1LQBA 2ZPNA 1E7UA 3QCAA 2DZKA 3ZTDA 4ZRKA 1RFAA 2MP2A 4DXAB 2J0KA 3ONSA 4GB9A 2YLMA 5LLIA 2WDTB 2ZPYA 3HHMA 1X1MA 1KJTA 3ZIMA 3QX1A 2CHXA 5CHVC 2ZNVB 4WWOA 1WXVA 1WZ3A 1YIWA 3DBRI 2N9EB 2BKRB 3X23A 5JH5C 1Q0WB 3A1QB 2KMCA 3ZNHB 5LXHA 3OJ3A 4GOCA 2IY0B 3QJZA 3IBEA 4PS7A 1ZGUB 1WGDA 1T0YA 3DBLI 3RZWC 2MSED 3MHSD 4DHJB 2LGDA 3PV1A 2WX1A 5DPTA 2LD9A 4BBNC 1NI2A 1H8CA 4ANWA 1UGMA 2L05A 3DVGY 4E3CA 2O2VA 2HE7A 4ZYNA 4RM8A 1UBIA 2CHZA 2LVQA 2V4LA 2KANA 4MGIE 2C60A 4MH0E 4B9KA 4GSWA 2RR9A 5CX3A 1IPGA 4I6LB 4KDLB 3KUZA 2JRHA 2Z59B 3PS6A 3MJWA 4MSMB 3H7PB 2O6VB 4NAWB 2DZIA 4BBNF 1EF1A 3A4RA 3SU8X 2GBMA 2KC1A 3LDZE 2LJ5A 3KH0A 1WR1A 3P2BA 2M0XA 1PQSA 1WGGA 4JGHB 1J0GA 4HXDA 2RPQA 1TBEA 4IM0A 3JYUA 2L76A 5D6JB 3TMPB 5GMVA 3S2AA 2DENB 3EECA 4DHZB 3ZW3A 3AI5A 3L17A 3ALBA 4K1RB 3SD5A 2ZCBA 5JZEB 3RZFA 4XC2A 2K8BA 1OGWA 1GC7A 2LZ6A 2PJHA 3VFKA 4EEWA 2N7EA 2DHZA 4HPMB 1WXAA 4LDTD 1WMHA 3APDA 4F7ZA 4P7IA 1WH3A 3L16A 4HVBA 2KLGA 2ZJDA 1WZ0A 4KZ0A 3W1SC 3H6NA 3VQIA 5C23A 2KC2A 4DHJD 4X57B 2K39A 4E71A 3ML8A 1UZXB 3QAQA 2LXAA 3BY4B 3V6CB 4LCDE 2WYQA 2G4SA 2Z0DB 3DVNU 3ZVVA 4XZ4A 3ZNID 2KTRB 1VCBA 2NBWB 2KVRA 3ZLZA 3ZNGC 3VAWA 2IO0B 1WIAA 4FJVB 2BWFA 4ASWC 2M4NA 5KHOA 3A1QA 4J6IA 2EMTA 2CU1A 4ICUA 4W9IA 4B6WA 1Y8RC 3VHTC 2JUOA 4GGQA 5G2NA 1S3SG 4DDID 5AEKB 2DX5B 4WJPA 4EFOA 1GJZA 3M62B 1TTNA 4BVUC 4OVVA 2FAZA 5G55A 2AEHA 3RYTA 2FCNA 2PE9A 2KJHB 4IM3A 3VH4B 5BO4B 2KK8A 3Q3FA 2FCQA 2N1VA 1WFYA 2DYMA 2IO3B 2GBRA 1TZ1A 4W9FA 3H7PA 2O6VA 4NAWA 2MQJA 2DAFA 3V60A 4NJ6A 3CSTA 3N3KB 3TL5A 4HPLB 1GG3A 1EUVB 3ZTCA 2C7NB 3V6EB 3SHQA 5D2MB 4DWFA 2C7MB 5TR5A 2K6DB 4IWPA 2NR2A 2D3GA 1WY8A 2KJRA 3ZNZB 2JT4B 2LXCA 5LXIB 2K25A 3DQVA 4HCPB 4GDLB 4PYZA 1GUAB 2IY1B 3BINA 3HM3A 4EZLA 5L83A 4GU2A 2MBOA 4IWQA 2KQSA 2A4ZA 1V2YA 2KJ6A 3R66C 3VDZA 1TGZB 4GDKB 2R2OA 3QWZB 3R7RA 4JQWC 2AL6A 1LM8B 2DYOA 1H4RA 1NDDA 4TKNA 3ZRFA 2MW5A 2FCMA 2LASA 3C0RB 2JZZA 1KM7A 3KVFB 2KDEB 3RUIB 4W9JA 3EC8A 3D32A 1WMHB 3JW0X 1RAXA 4W9GA 3K9OB 3ZKJC 1GNUA 2L00B 4BKSA 5JHAA 2G4DB 2XEWA 1UELA 2KDFB 3VVWB 3NZSA 3UQAA 3R3MA 2KTRA 3PT2B 2NBVB 4HDQA 3AU5A 3QK0A 1V9JA 4W9DA 3VH3B 2EKEC 3SDLC 4URKA 4GXBA 3NOBA 1LXDA 2M1MA 2JPHA 3PGEA 4DBGA 3PLUA 4M8MA 4IWOA 2BKFA 2LRWA 4HJKA 1Q1OA 2OOBB 3ENEA 2C7HA 1YD8U 5DPSA 3VTVA 2HTHA 4MGYE 4WJQA 4HWIB 2CKHB 4G11A 3LJ3A 1WE6A 4W9EA 3DCGA 2N9XA 3PRZA 2BWES 3PRPB 3UF8A 4G50A 1Z5SB 3APCA 2BGFA 3PRMB 2ZVNA 3DBSA 2FCSA 2MWSB 2NCNA 3W1YA 1ZW7A 4I6PA 4ANUA 3L0WB 1UD7A 2B3AA 4JL9A 1RLFA 4HLEA 2BPSA 2BF8B 5E6PA 1EO6A 3H9DA 3KYCD 5JHBA 3UGBB 2MBEA 3B0AA 4ZDVA 4NPNA 3U8ZA 4HK2A 3M95A 1E7VA 4HDOA 4GDLA 1R4NI 3U7DA 2DZMA 1XD3B 2KD0A 3B08A 2JVCA 3VTWA 2KDIA 3A9JB 2KLCA 4FULA 1WJ6A 4KZCA 2M17A 3TCAA 2BYFA 3OJ4B 4GDKA 4FBJB 3GOEA 3UIOB 3DDCB 1E8YA 3A4SC 4RM9A 3KUCB 3WIMA 4JLCA 2I1KA 2HJ8A 4K7WA 4II3B 1OQYA 4PS8A 5CTRC 3CSFA 2L0FA 1WXMA 3HM6X 3T8MA 5IA7A 1V80A 3OAWA 2QHOA 2ZZPB 3N32A 4KVGB 2V1YA 4AP4C 2KNBA 1YJ1A 2MRPA 2XK5B 4IUMB 2IO1B 5C1ZA 3DPDA 3KYDD 3ZDMC 4FHKA 2K1FA 4A20A 5J18A 1WM3A 4NJ7A 4LJPB 4LJOB 3N30A 1L7YA 4M0WB 5E6NA 2MLBA 4TUUA 3WAMA 4IM2A 4BOZB 3CMMB 4CYEA 4EZJA 4MM3A 2JF5A 3TJPA 3NS8A 1WI0A 1WX8A 4FA6A 4GN1A 1IP9A 2DZJA 4MGKE 4ZRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2N A;  3IG3 A;  3PVL A;  4KIK B;  1G6J A;  1OTR B;  2DYB A;  5D7G A;  3I3T B;  3V62 A;  1A5R A;  1XQQ A;  2O6V D;  4A3P A;  1VD2 A;  2KHW B;  2Y5B B;  2MCN B;  2NS5 A;  3TIX A;  4WJO A;  3PRE A;  1XT9 B;  3UIP B;  3HIZ A;  2AWT A;  3T9L A;  4EKU A;  2RSU A;  1WF9 A;  2I1J A;  3PSE B;  3WAL A;  3RT3 B;  4CHK A;  5D94 A;  2KTF A;  3AUL A;  2K8H A;  3PLV A;  3PTF C;  1WE7 A;  3L13 A;  3QA8 A;  1V81 A;  2WX0 A;  3VUX A;  2KO3 A;  1Z2M A;  3M3J A;  1FXT B;  4WQO B;  1R4M I;  1WXS A;  3L54 A;  3U30 A;  3ZRC A;  1SGH A;  5AZF A;  2RD0 A;  3RD2 A;  3ZO5 B;  3K9P B;  4XX5 A;  3A9J A;  1MG8 A;  2KQ7 A;  2K6Q A;  4NQK E;  2PEA A;  1ISN A;  4BKS D;  3L08 A;  1WGH A;  4MEM A;  2L7R A;  4K7S A;  5HKH A;  4MGZ E;  5AZH A;  3MTN B;  2J0J A;  3W1S A;  2LI5 A;  3L10 B;  2XK5 A;  4AJY B;  1IYF A;  2PE6 B;  4FJY A;  2LRU A;  4N9F 4;  1P1A A;  2WWZ A;  3KUD B;  4F8C B;  4ZRJ A;  4G3X B;  4B95 A;  2EMS A;  4W9C A;  2IO2 B;  3PZD A;  1I35 A;  2LWP A;  4FHJ A;  3H1U A;  2NVU I;  3ECI A;  4IG7 B;  1E8X A;  4W9H A;  1V6E A;  5CHW A;  4I6N B;  4II2 B;  1P3Q U;  2JY6 A;  3DBH I;  1ZKH A;  2W9N A;  3O65 B;  3EFU A;  5J17 A;  2KMA A;  2G3Q B;  4OVU A;  1V5T A;  3Q3J A;  2FID A;  3GZN I;  4RMA A;  3VTU A;  2L0T A;  2ZCC A;  3PPA A;  1S1Q B;  4KIK A;  3DOW A;  5J2R A;  2KWV B;  4W9K A;  3QQ8 B;  1RRB A;  2LVO A;  2IBI B;  4DK5 A;  3A9K B;  4EZK A;  3NHE B;  4MEL A;  2KWC A;  4FAD A;  3B1L X;  4NQL B;  4TQ0 A;  2PPH A;  2NBU A;  3AU4 A;  5CHF A;  2LGY A;  1V86 A;  1HE8 A;  4IW0 A;  2MBH A;  3M63 B;  2FUH B;  2CS4 A;  2UWQ A;  2M8S A;  3QAR A;  3DVN V;  4HCN B;  4FN2 A;  1NBF C;  1WR6 E;  3ML9 A;  5DPW A;  3NZU A;  4TQ1 A;  2J0M A;  2MBB B;  5AZG A;  3RCZ A;  4WWN A;  3OLM D;  1C1Y B;  2IYD B;  4NY0 A;  1QZE A;  2ZNV C;  4LDT B;  4BKG A;  4K81 A;  3R7Q A;  3WAO A;  2D07 B;  3JSV B;  1WX9 A;  2KN5 A;  2KX0 A;  4ICV A;  5IAA C;  1E8Z A;  1GC6 A;  4ANX A;  3A33 B;  2D2Q A;  2N1W A;  2KFK B;  2N4F A;  2FNJ B;  3QC8 B;  1WYW B;  3UQB A;  4GIV A;  1V49 A;  3IFW B;  4E74 A;  4PYU A;  2V3S A;  4YL8 A;  5FR6 A;  2VRR B;  1J8C A;  2GBK A;  3H7S A;  3QIJ A;  2R2Q A;  1WJN A;  1LFD A;  1V5O A;  3JVZ X;  4NNJ B;  1SIF A;  2REX A;  2OJR A;  2XBB C;  1D3Z A;  2KX3 A;  2N7D A;  3TBL D;  4DHZ E;  3HK0 A;  2G45 B;  1WRD B;  2KXJ A;  2RGF A;  1SE9 A;  3V61 A;  3WAP A;  3PHX B;  3ZUN A;  2ASQ A;  1AAR A;  2LVP A;  2NPT B;  1UBQ A;  2AL3 A;  2MBQ A;  2D10 A;  4K7U A;  4MJS B;  4EOY A;  1OEY A;  4GMV A;  3VUY A;  1E90 A;  3A9K A;  1YX5 B;  2KFJ A;  3CF6 E;  4AWJ A;  2AYO B;  4KV2 A;  1UH6 A;  2GOW A;  2KDB A;  2GBJ A;  2Z0E B;  1Q5W B;  4M8N A;  3WAN A;  2FIF A;  4MDK E;  4PS3 A;  2JZ3 B;  2CHW A;  5E6O A;  4AUQ C;  2JXX A;  3IVF A;  1EF5 A;  4KSL C;  2BYV E;  1M94 A;  2IZV B;  2MP2 B;  3VXW A;  4CO7 A;  2GBN A;  2BYE A;  1E5W A;  2C9W B;  1KOT A;  2K8C A;  1WGY A;  4BFR A;  1U4A A;  4FLH A;  4A3O A;  1WGR A;  1WX7 A;  2MA9 B;  3JSV A;  4FJZ A;  4WJN A;  1OEY J;  3RUL A;  1E8W A;  2J7Q B;  1J19 A;  2KOX A;  2KFK A;  4KDI C;  1KLV A;  2ZVO A;  4JIO U;  3ZDT A;  1JRU A;  1WM2 A;  3IHP C;  1I42 A;  5DCN A;  3NY5 A;  2C5L C;  4BOS C;  2JRI B;  3UIN B;  1BT0 A;  2YVC A;  3APF A;  4WWP A;  2KZR A;  2UYZ B;  2LGX A;  3X0W A;  4BKT A;  2HD5 B;  2CR5 A;  2KWU B;  4WAA A;  1P9D U;  3VUW A;  4AOF A;  4AJW A;  2O2V B;  4KSK C;  5L95 C;  1F9J A;  1P98 A;  5DPR A;  3WA0 A;  2JWZ A;  4G0N B;  2ZEQ A;  2A5U A;  2NPT A;  4W9L A;  1YX6 B;  4MJS A;  4IC7 B;  3PHW B;  4DDG D;  4MSQ B;  1CMX B;  3AXC A;  2L8J A;  3QHT A;  2LUE A;  1P0R A;  1WJU A;  5KHQ A;  2GMI C;  1WJ4 A;  2MX2 A;  3KW5 B;  4EUT A;  3EHV A;  1K8R B;  4ANV A;  2L3Z A;  2N9P C;  2D11 A;  4TV3 A;  3DVG X;  4F1S A;  2KKC A;  2DAJ A;  1C3T A;  1YQB A;  5EDS A;  1LQB A;  2ZPN A;  1E7U A;  3QCA A;  2DZK A;  3ZTD A;  4ZRK A;  1RFA A;  2MP2 A;  4DXA B;  2J0K A;  3ONS A;  4GB9 A;  2YLM A;  5LLI A;  2WDT B;  2ZPY A;  3HHM A;  1X1M A;  1KJT A;  3ZIM A;  3QX1 A;  2CHX A;  5CHV C;  2ZNV B;  4WWO A;  1WXV A;  1WZ3 A;  1YIW A;  3DBR I;  2N9E B;  2BKR B;  3X23 A;  5JH5 C;  1Q0W B;  3A1Q B;  2KMC A;  3ZNH B;  5LXH A;  3OJ3 A;  4GOC A;  2IY0 B;  3QJZ A;  3IBE A;  4PS7 A;  1ZGU B;  1WGD A;  1T0Y A;  3DBL I;  3RZW C;  2MSE D;  3MHS D;  4DHJ B;  2LGD A;  3PV1 A;  2WX1 A;  5DPT A;  2LD9 A;  4BBN C;  1NI2 A;  1H8C A;  4ANW A;  1UGM A;  2L05 A;  3DVG Y;  4E3C A;  2O2V A;  2HE7 A;  4ZYN A;  4RM8 A;  1UBI A;  2CHZ A;  2LVQ A;  2V4L A;  2KAN A;  4MGI E;  2C60 A;  4MH0 E;  4B9K A;  4GSW A;  2RR9 A;  5CX3 A;  1IPG A;  4I6L B;  4KDL B;  3KUZ A;  2JRH A;  2Z59 B;  3PS6 A;  3MJW A;  4MSM B;  3H7P B;  2O6V B;  4NAW B;  2DZI A;  4BBN F;  1EF1 A;  3A4R A;  3SU8 X;  2GBM A;  2KC1 A;  3LDZ E;  2LJ5 A;  3KH0 A;  1WR1 A;  3P2B A;  2M0X A;  1PQS A;  1WGG A;  4JGH B;  1J0G A;  4HXD A;  2RPQ A;  1TBE A;  4IM0 A;  3JYU A;  2L76 A;  5D6J B;  3TMP B;  5GMV A;  3S2A A;  2DEN B;  3EEC A;  4DHZ B;  3ZW3 A;  3AI5 A;  3L17 A;  3ALB A;  4K1R B;  3SD5 A;  2ZCB A;  5JZE B;  3RZF A;  4XC2 A;  2K8B A;  1OGW A;  1GC7 A;  2LZ6 A;  2PJH A;  3VFK A;  4EEW A;  2N7E A;  2DHZ A;  4HPM B;  1WXA A;  4LDT D;  1WMH A;  3APD A;  4F7Z A;  4P7I A;  1WH3 A;  3L16 A;  4HVB A;  2KLG A;  2ZJD A;  1WZ0 A;  4KZ0 A;  3W1S C;  3H6N A;  3VQI A;  5C23 A;  2KC2 A;  4DHJ D;  4X57 B;  2K39 A;  4E71 A;  3ML8 A;  1UZX B;  3QAQ A;  2LXA A;  3BY4 B;  3V6C B;  4LCD E;  2WYQ A;  2G4S A;  2Z0D B;  3DVN U;  3ZVV A;  4XZ4 A;  3ZNI D;  2KTR B;  1VCB A;  2NBW B;  2KVR A;  3ZLZ A;  3ZNG C;  3VAW A;  2IO0 B;  1WIA A;  4FJV B;  2BWF A;  4ASW C;  2M4N A;  5KHO A;  3A1Q A;  4J6I A;  2EMT A;  2CU1 A;  4ICU A;  4W9I A;  4B6W A;  1Y8R C;  3VHT C;  2JUO A;  4GGQ A;  5G2N A;  1S3S G;  4DDI D;  5AEK B;  2DX5 B;  4WJP A;  4EFO A;  1GJZ A;  3M62 B;  1TTN A;  4BVU C;  4OVV A;  2FAZ A;  5G55 A;  2AEH A;  3RYT A;  2FCN A;  2PE9 A;  2KJH B;  4IM3 A;  3VH4 B;  5BO4 B;  2KK8 A;  3Q3F A;  2FCQ A;  2N1V A;  1WFY A;  2DYM A;  2IO3 B;  2GBR A;  1TZ1 A;  4W9F A;  3H7P A;  2O6V A;  4NAW A;  2MQJ A;  2DAF A;  3V60 A;  4NJ6 A;  3CST A;  3N3K B;  3TL5 A;  4HPL B;  1GG3 A;  1EUV B;  3ZTC A;  2C7N B;  3V6E B;  3SHQ A;  5D2M B;  4DWF A;  2C7M B;  5TR5 A;  2K6D B;  4IWP A;  2NR2 A;  2D3G A;  1WY8 A;  2KJR A;  3ZNZ B;  2JT4 B;  2LXC A;  5LXI B;  2K25 A;  3DQV A;  4HCP B;  4GDL B;  4PYZ A;  1GUA B;  2IY1 B;  3BIN A;  3HM3 A;  4EZL A;  5L83 A;  4GU2 A;  2MBO A;  4IWQ A;  2KQS A;  2A4Z A;  1V2Y A;  2KJ6 A;  3R66 C;  3VDZ A;  1TGZ B;  4GDK B;  2R2O A;  3QWZ B;  3R7R A;  4JQW C;  2AL6 A;  1LM8 B;  2DYO A;  1H4R A;  1NDD A;  4TKN A;  3ZRF A;  2MW5 A;  2FCM A;  2LAS A;  3C0R B;  2JZZ A;  1KM7 A;  3KVF B;  2KDE B;  3RUI B;  4W9J A;  3EC8 A;  3D32 A;  1WMH B;  3JW0 X;  1RAX A;  4W9G A;  3K9O B;  3ZKJ C;  1GNU A;  2L00 B;  4BKS A;  5JHA A;  2G4D B;  2XEW A;  1UEL A;  2KDF B;  3VVW B;  3NZS A;  3UQA A;  3R3M A;  2KTR A;  3PT2 B;  2NBV B;  4HDQ A;  3AU5 A;  3QK0 A;  1V9J A;  4W9D A;  3VH3 B;  2EKE C;  3SDL C;  4URK A;  4GXB A;  3NOB A;  1LXD A;  2M1M A;  2JPH A;  3PGE A;  4DBG A;  3PLU A;  4M8M A;  4IWO A;  2BKF A;  2LRW A;  4HJK A;  1Q1O A;  2OOB B;  3ENE A;  2C7H A;  1YD8 U;  5DPS A;  3VTV A;  2HTH A;  4MGY E;  4WJQ A;  4HWI B;  2CKH B;  4G11 A;  3LJ3 A;  1WE6 A;  4W9E A;  3DCG A;  2N9X A;  3PRZ A;  2BWE S;  3PRP B;  3UF8 A;  4G50 A;  1Z5S B;  3APC A;  2BGF A;  3PRM B;  2ZVN A;  3DBS A;  2FCS A;  2MWS B;  2NCN A;  3W1Y A;  1ZW7 A;  4I6P A;  4ANU A;  3L0W B;  1UD7 A;  2B3A A;  4JL9 A;  1RLF A;  4HLE A;  2BPS A;  2BF8 B;  5E6P A;  1EO6 A;  3H9D A;  3KYC D;  5JHB A;  3UGB B;  2MBE A;  3B0A A;  4ZDV A;  4NPN A;  3U8Z A;  4HK2 A;  3M95 A;  1E7V A;  4HDO A;  4GDL A;  1R4N I;  3U7D A;  2DZM A;  1XD3 B;  2KD0 A;  3B08 A;  2JVC A;  3VTW A;  2KDI A;  3A9J B;  2KLC A;  4FUL A;  1WJ6 A;  4KZC A;  2M17 A;  3TCA A;  2BYF A;  3OJ4 B;  4GDK A;  4FBJ B;  3GOE A;  3UIO B;  3DDC B;  1E8Y A;  3A4S C;  4RM9 A;  3KUC B;  3WIM A;  4JLC A;  2I1K A;  2HJ8 A;  4K7W A;  4II3 B;  1OQY A;  4PS8 A;  5CTR C;  3CSF A;  2L0F A;  1WXM A;  3HM6 X;  3T8M A;  5IA7 A;  1V80 A;  3OAW A;  2QHO A;  2ZZP B;  3N32 A;  4KVG B;  2V1Y A;  4AP4 C;  2KNB A;  1YJ1 A;  2MRP A;  2XK5 B;  4IUM B;  2IO1 B;  5C1Z A;  3DPD A;  3KYD D;  3ZDM C;  4FHK A;  2K1F A;  4A20 A;  5J18 A;  1WM3 A;  4NJ7 A;  4LJP B;  4LJO B;  3N30 A;  1L7Y A;  4M0W B;  5E6N A;  2MLB A;  4TUU A;  3WAM A;  4IM2 A;  4BOZ B;  3CMM B;  4CYE A;  4EZJ A;  4MM3 A;  2JF5 A;  3TJP A;  3NS8 A;  1WI0 A;  1WX8 A;  4FA6 A;  4GN1 A;  1IP9 A;  2DZJ A;  4MGK E;  4ZRI A; 
#chains in the Genus database with same CATH topology
 4B0E A;  4KIK B;  1OTR B;  1FRD A;  3TIX A;  3PRE A;  3SEB A;  1WF9 A;  4HRO A;  4CHK A;  1ZXI A;  5D94 A;  4OZB A;  5C2T B;  4L2Y A;  2K8H A;  2GB1 A;  3PLV A;  1V81 A;  3M3J A;  5IN7 A;  1WYG A;  2E6X A;  5AZF A;  3NVV A;  3ZO5 B;  5EE3 A;  1MG8 A;  2KQ7 A;  1JWM D;  4Q2J A;  2PEA A;  3RMK C;  1WGH A;  2L7R A;  3P4Q B;  1QLB B;  4MGZ E;  4AJY B;  1L6V A;  4US8 A;  1C77 A;  3KUD B;  1YQ3 B;  2EMS A;  3LXF A;  2IO2 B;  4W9H A;  4FHJ A;  3ECI A;  1V6E A;  5CHW A;  3I5J C;  1TS4 A;  1ZKH A;  4JPS A;  3O65 B;  2BS3 B;  3GZN I;  2WXL A;  4KIK A;  5J2R A;  1ACC A;  2J52 A;  2BS4 B;  4XYC A;  4EZK A;  4TQ0 A;  2FUG 1;  4KGR A;  5CHF A;  3NS1 A;  2LHD A;  2JU6 X;  3QAR A;  2J53 A;  3NZU A;  1UNS A;  3OLM D;  1XEE A;  2WXN A;  4RNA A;  3AE7 B;  3GE8 C;  4YWG G;  5EE0 A;  1WX9 A;  2KX0 A;  1PGA A;  1E8Z A;  4ANX A;  5AUK A;  1K51 A;  2KFK B;  2N4F A;  1EU4 A;  1XCT L;  4E74 A;  2V3S A;  5G5H A;  1YOV B;  2M0A A;  2ICI A;  2VRR B;  1WRI A;  1FFU A;  3AE5 B;  3QIJ A;  4KKJ A;  1WJN A;  1SIF A;  1L0V B;  2OJR A;  3TBL D;  4JWU C;  2QC8 A;  1VZ6 A;  2WXO A;  2KXJ A;  3C19 A;  4AQ7 A;  3DBH B;  1FNW A;  2NPT B;  1UBQ A;  4WWM A;  3ZJU A;  1C78 A;  2IJ0 A;  1Q5W B;  2CHW A;  1C76 A;  2B76 B;  2IZV B;  1DYQ A;  3VRA B;  2MP2 B;  1KOT A;  1RFK A;  1C4P A;  4FJZ A;  1JRP A;  1J19 A;  2AX5 A;  2ZW0 A;  3RN9 C;  2KFK A;  4KDI C;  1N5X A;  1FO4 A;  3ZDT A;  2Y3A A;  4YT0 B;  3BVZ A;  4RGM A;  1R4N B;  2C5L C;  1OQR A;  2JRI B;  1BT0 A;  2CJN A;  1N63 A;  1IGD A;  1TYG B;  2LGX A;  3X0W A;  3RI7 C;  3SR6 A;  4AOF A;  1C79 A;  1P98 A;  2INC C;  1JWU D;  2HTM E;  3WA0 A;  1TZO A;  2NPT A;  4IC7 B;  4DDG D;  2WS3 B;  1PYW D;  4YSY B;  3QHT A;  2L8J A;  2LUE A;  1P0R A;  5KHQ A;  1HA5 A;  1WJ4 A;  4EUT A;  3EHV A;  2W55 A;  4XWW A;  5D3D A;  2D11 A;  3RNF C;  1EU3 A;  2DAJ A;  2WLB A;  1L5P A;  4RGT A;  3ZTD A;  1RFA A;  2MP2 A;  3ONS A;  3Q6B A;  2PVG C;  2RDB C;  2WDT B;  2MH7 A;  2CHX A;  5CHV C;  4WWO A;  1WXV A;  1WZ3 A;  1YIW A;  1NYR A;  2BKR B;  3PZ8 A;  1NEK B;  2KQ4 X;  5LXH A;  1D5M C;  4GOC A;  2IY0 B;  3QJZ A;  3DHG C;  1T0Y A;  5BMI A;  3RZW C;  2LGD A;  1N62 A;  2WXM A;  3GB1 A;  4MH0 E;  2BT6 A;  5CX3 A;  3IAM 1;  4MSM B;  4NAW B;  2NTS A;  1MHH E;  1MI0 A;  1AW7 A;  2GBM A;  2LJ5 A;  2M0X A;  1PQS A;  4IM0 A;  3JYU A;  1J7A A;  4PT5 A;  4DHZ B;  3EEC A;  1I4X A;  3ETR A;  3GZN B;  4EEW A;  2N7E A;  3EGR A;  4ZYS A;  4LDT D;  1QKZ A;  3AE4 B;  1WH3 A;  3L16 A;  4KZ0 A;  5C23 A;  4DHJ D;  1L4D B;  3ML8 A;  1UZX B;  1F52 A;  2JSV X;  2WYQ A;  2G4S A;  4WQM A;  3ZNI D;  2WXF A;  3N20 C;  3KLS X;  1VCB A;  2NBW B;  3FIL B;  3ZNG C;  1N61 A;  1WIA A;  3RNE C;  2BWF A;  4OVZ A;  4ICU A;  4XDC A;  4B6W A;  4GGQ A;  5AEK B;  2DX5 B;  4EFO A;  2DBY A;  1TTN A;  4OVV A;  2FAZ A;  5G55 A;  2AEH A;  3RYT A;  1TY2 A;  4IM3 A;  1R7S A;  3RFZ B;  1CQV A;  2N1V A;  1WGK A;  2IO3 B;  2GBR A;  1E0Z A;  4W9F A;  4NAW A;  3V60 A;  2DAF A;  3CST A;  3N3K B;  1EUV B;  2OED A;  1SE2 A;  1QIL A;  3W5V B;  5LXI B;  2BQQ A;  4GDL B;  3BIN A;  2MBO A;  4IWQ A;  2KQS A;  1V2Y A;  1FEH A;  3R66 C;  1TGZ B;  3VR9 B;  3R7R A;  1NDD A;  4TKN A;  1V97 A;  4HEA 1;  2MW5 A;  2FCM A;  4LLG M;  3KVF B;  2KDE B;  3RUI B;  4W9J A;  4AS1 A;  1RAX A;  4DQO C;  3K9O B;  3ZKJ C;  1GNU A;  2G4D B;  3HUI A;  3L4P A;  3FIL A;  3SDL C;  4GXB A;  1LXD A;  2JPH A;  2PKO A;  4DBG A;  4IWO A;  2BKF A;  4HJK A;  1Q1O A;  2PVO D;  2C7H A;  1YD8 U;  2QDF A;  3VTV A;  2HTH A;  4MGY E;  2ONQ A;  1DOY A;  3LJ3 A;  4W9E A;  2N9X A;  3WCQ A;  2BW2 A;  2FE8 A;  4HJG E;  4JE3 B;  3PRP B;  1MHX A;  3PRM B;  3Q2A C;  4I6P A;  4QAY A;  1UD7 A;  2BF8 B;  5E6P A;  1EO6 A;  3H9D A;  1K52 A;  1JWA D;  1M4V A;  1ESF A;  4GDL A;  2DZM A;  2KDI A;  3A9J B;  1P7E A;  2KLC A;  2G1E A;  4FUL A;  3DDC B;  5BYS A;  3A4S C;  3HVD A;  2HJ8 A;  4K7W A;  1OQY A;  5CTR C;  3CSF A;  2L0F A;  4KVG B;  2KNB A;  1YJ1 A;  2WNM A;  2IO1 B;  2KAJ A;  1UF0 A;  1JWB D;  4FHK A;  2K1F A;  1FPY A;  3IT4 B;  2JXT A;  5MPO A;  5E6N A;  2JF5 A;  5HI1 A;  4LNI A;  2DLB A;  4WUR A;  2PJH A;  1FM0 D;  2PTL A;  4MGK E;  4P7I A;  4ZRI A;  4OHJ A;  1G6J A;  4P6V F;  5D7G A;  3PO0 A;  1A5R A;  2O6V D;  3ZYY X;  3AEC B;  3AE2 B;  3AE6 B;  2KHW B;  2NS5 A;  2WXQ A;  1YNT E;  3UIP B;  3HIZ A;  2AWT A;  1ENF A;  1SXT A;  3PSE B;  3RNB C;  2KTF A;  4KGS A;  3PTF C;  3ZJV A;  1PGX A;  3L54 A;  3U30 A;  3ZRC A;  3N1Z C;  3A9J A;  1KLG D;  2K6Q A;  1ISN A;  4MEM A;  4ZOH C;  1XLO A;  1DOI A;  3MTN B;  2J0J A;  2JWU A;  1P1A A;  2UU7 A;  3AEE B;  4B95 A;  3PZD A;  4O1N A;  1SEB D;  4I6N B;  2JY6 A;  3DBH I;  2VZK B;  1I4R A;  2JYE A;  2BB6 A;  3Q3J A;  2BS2 B;  3VTU A;  3NVZ A;  3NG0 A;  4W9K A;  2LFI A;  1D6E C;  3QQ8 B;  4DK5 A;  3A9K B;  3NHE B;  2WXK A;  2KWC A;  4FAD A;  3B1L X;  2PPH A;  2NBU A;  3BK1 A;  2WU5 B;  1B1Z A;  2LGY A;  2ACZ B;  3ZXV A;  2FUH B;  2K9X A;  5FKA C;  4FN2 A;  5DPW A;  1QOF A;  2WQY B;  3BYT B;  2WXG A;  2J0M A;  2MBB B;  3DHH C;  3RCZ A;  4WWN A;  4A55 A;  3Q3M C;  2KWD A;  4ZRQ A;  3N9Y C;  4BKG A;  3R7Q A;  3WAO A;  2WDV B;  2KN5 A;  5IAA C;  1FNU A;  4HRS A;  2N1W A;  2FNJ B;  3UQB A;  4GIV A;  3IFW B;  3CIR B;  4PYU A;  1J8C A;  3H7S A;  2J4X A;  1V5O A;  2XN9 C;  3KQ4 A;  2XBB C;  2KX3 A;  2K22 A;  3URY A;  1SE9 A;  5HHD G;  2V4I B;  2QCZ A;  2KAC A;  2LVP A;  4MJS B;  4K7U A;  1TS5 A;  4GMV A;  3A9K A;  2IND C;  2KFJ A;  1VLB A;  1UH6 A;  2GBJ A;  2Z0E B;  1RWS A;  2FIF A;  4MDK E;  1AYF A;  2PW9 A;  4L23 A;  1T0S C;  2MJE A;  3GP7 A;  5IO9 A;  2BTE A;  4CO7 A;  2GBN A;  2BYE A;  1E5W A;  2C9W B;  1LO5 D;  2PMV A;  1WGY A;  2L1A A;  2J42 A;  4BFR A;  4N58 A;  1U4A A;  1OFF A;  1WX7 A;  2MA9 B;  4YSX B;  4C80 A;  3RUL A;  2KOX A;  1E6E B;  1I42 A;  5DCN A;  4YXD B;  1KRH A;  5EE9 A;  4WWP A;  2KZR A;  2WGS A;  4HKQ A;  5IOI A;  4KKI A;  4BKT A;  2CR5 A;  2KWU B;  1P9D U;  3BWU D;  5L95 C;  2QJL A;  4ITK A;  5DPR A;  4KX6 B;  1SBB B;  2I38 A;  2CU3 A;  4G0N B;  1XO3 A;  1QT9 A;  1ZPS A;  2ZEQ A;  2IDY A;  4XGA B;  4W9L A;  1YX6 B;  4MJS A;  3PZ7 A;  3BII D;  2BB5 A;  2MX2 A;  3ABV B;  3BK2 A;  2K0P A;  2N9P C;  5EE1 A;  2KKC A;  2NMQ A;  1SE4 A;  1FXA A;  1C3T A;  4RF1 A;  2E3T A;  1LQB A;  1E7U A;  1FCL A;  4A8X C;  2W54 A;  4GB9 A;  3OG5 A;  2K5P A;  2X8X X;  2INN E;  1KJT A;  5T8I A;  3R8B A;  4ARC A;  2N9E B;  2KVZ A;  1Q0W B;  3N1X C;  4M01 A;  1GB1 A;  2WDR B;  3IBE A;  1ZGU B;  2MSE D;  3MHS D;  1BML C;  2LD9 A;  1UGM A;  1V1P B;  2L05 A;  3BYY B;  3J9C A;  4RM8 A;  2LVQ A;  2KAN A;  4GSW A;  2RR9 A;  1UGJ A;  4KDL B;  2R61 A;  2Z59 B;  3H7P B;  3SFE B;  1QQR A;  1EF1 A;  3DHI C;  2KC1 A;  3LDZ E;  2N9K A;  3P2B A;  4JGH B;  4HXD A;  1TBE A;  1QOA A;  2L76 A;  4KGT A;  3ALB A;  2MJ3 A;  4K1R B;  2ZCB A;  3SD5 A;  3RZF A;  2K8B A;  2RDG A;  1GC7 A;  3SFD B;  4OZC A;  5LNK 1;  3W1S C;  1BUI C;  3H6N A;  3VQI A;  2KC2 A;  2LGI A;  1SF0 A;  2WXR A;  2K39 A;  1VZ8 A;  3N1Y C;  2LXA A;  1KH0 A;  1WXQ A;  3V6C B;  3DVN U;  3ZVV A;  4XZ4 A;  2CJO A;  2KVR A;  1UWX A;  4J6I A;  2EMT A;  2GLS A;  2WXJ A;  1Y8R C;  3VHT C;  4DDI D;  4WJP A;  3MHZ A;  1GJZ A;  3M62 B;  4P16 A;  1HXY D;  2KJH B;  3P42 A;  2NTT A;  1V1P A;  3TEY A;  1SJH D;  2DNF A;  2PIA A;  4CQN A;  1HTO A;  2Q5W D;  3H7P A;  2KMM A;  5D3I B;  2MQJ A;  4NJ6 A;  1XXG A;  2ZW1 A;  4HPL B;  1GG3 A;  1HZ6 A;  3ZTC A;  2BVC A;  3SHQ A;  2D3G A;  3ZNZ B;  2JT4 B;  2LXC A;  3DQV A;  4HCP B;  1GUA B;  4GU2 A;  2A4Z A;  3VDZ A;  4GDK B;  2R2O A;  3QWZ B;  2AL6 A;  3LYY A;  1ZP0 B;  2DYO A;  3TSS A;  2IGH A;  1QF6 A;  4K3B A;  1KM7 A;  1ZOY B;  4GLS C;  4OZA A;  4W9G A;  3Q8A A;  4IKG A;  1JRO A;  3PT2 B;  2NBV B;  1CJE A;  3QK0 A;  2EKE C;  2MEK A;  2M19 A;  3PLU A;  2OOB B;  3ENE A;  5DPS A;  4WAF A;  4HWI B;  2CKH B;  4IDI A;  3AED B;  3DCG A;  3FKY A;  3U7Z A;  1L0Y B;  1TIF A;  1Z5S B;  4HKZ E;  2BGF A;  1V8C A;  2PLP A;  3RPF C;  2B3A A;  4JL9 A;  4HLE A;  3KYC D;  5JHB A;  2HDE A;  5E6J A;  1AN8 A;  4ZDV A;  4NPN A;  3U8Z A;  4HK2 A;  3M95 A;  4HDO A;  4LNF A;  3P1M A;  1N6Z A;  2JVC A;  4KZC A;  3TCA A;  1VZ7 A;  4GDK A;  3GOE A;  1E8Y A;  3TEZ A;  4RM9 A;  3IT6 B;  3KUC B;  4PS8 A;  3OWE B;  1WXM A;  3T8M A;  2QHO A;  2W3R A;  2KN4 A;  1NVI D;  3BVM A;  5C1Z A;  2VH1 A;  5J18 A;  3N30 A;  4BOZ B;  2YEP F;  3P63 A;  4EZJ A;  1WI0 A;  1WX8 A;  1XLP A;  5GXG B;  4LTU A;  2I2Y A;  2DYB A;  3I3T B;  1MPE A;  1YN4 A;  1VD2 A;  2MCN B;  3CWI A;  3W2D A;  1XT9 B;  4EKU A;  3AMZ A;  4RCO A;  4EE2 A;  2RSU A;  3WAL A;  2VH2 A;  1WE7 A;  2QEJ C;  3VUX A;  2EEL A;  2KO3 A;  1FXT B;  3KWV A;  4WQO B;  3U52 E;  1R4M I;  1NYQ A;  1WXS A;  2N9L A;  1SGH A;  1P7F A;  2TSS A;  3RD2 A;  2BYT A;  5HG2 A;  4BKS D;  4C4V B;  2KT7 A;  2QIE B;  4K7S A;  2W82 A;  5HKH A;  4YTP B;  4S0R A;  3W1S A;  3L10 B;  4P1C C;  2PE6 B;  1RM6 C;  4FJY A;  2LRU A;  4N9F 4;  2WWZ A;  4F8C B;  4ZRJ A;  3NVY A;  1I35 A;  3H1U A;  2NVU I;  2MHJ A;  4II2 B;  1L6U A;  2LHE A;  1SJE D;  2KYW A;  1V5T A;  2FID A;  2L0T A;  2ZCC A;  1WWT A;  3NJT A;  2LVO A;  2IBI B;  1ET6 A;  4BAX A;  4MEL A;  3V05 A;  4NQL B;  3AU4 A;  1ROE A;  1FMA D;  2V3P A;  4WIP A;  1DOX A;  2SAK A;  2UWQ A;  1JW9 D;  2M8S A;  3DVN V;  4HCN B;  2XNA C;  1NBF C;  1WR6 E;  4TQ1 A;  4C56 C;  1TS2 A;  5AZG A;  1C1Y B;  3R2I A;  4NY0 A;  1QZE A;  1YN5 A;  4LDT B;  4C4V A;  2VZK D;  3JSV B;  4ICV A;  2V3N A;  1HQR D;  2L52 A;  3IAS 1;  5FR3 A;  3QC8 B;  1V49 A;  4C7Z A;  1OQQ A;  4YL8 A;  5FR6 A;  1WSP A;  2GBK A;  3JVZ X;  4NNJ B;  3B9J A;  3MJ5 A;  3HK0 A;  4ZHO A;  3BZD B;  3V61 A;  2D10 A;  1E90 A;  4C7Y A;  3CF6 E;  3DWG C;  4AWJ A;  2EKI A;  2GOW A;  2KDB A;  1JWS D;  3WAN A;  2JZ3 B;  3T3N A;  3IVF A;  1GB4 A;  1EF5 A;  1EM7 A;  4ACF A;  1K53 A;  2WXH A;  2LJI A;  1MJD A;  2K8C A;  5BMH A;  1CZP A;  4FLH A;  3JSV A;  2LMC A;  4WJN A;  2J7Q B;  3GE3 C;  1KF6 B;  4JIO U;  1JRU A;  3IHP C;  2JYT A;  1UWM A;  1LGR A;  4BOS C;  1PUT A;  3APF A;  2WU2 B;  2HD5 B;  4WAA A;  3VUW A;  4AJW A;  2MJD A;  2O2V B;  1F2R C;  4US9 A;  2JWZ A;  1HEZ E;  1TKG A;  1XLN A;  3PHW B;  1CMX B;  1PGB A;  3FAH A;  3AXC A;  3MC8 A;  2WXP A;  1FXI A;  2D3A A;  1K8R B;  4ANV A;  5BMG A;  2L3Z A;  3DVG X;  1T6B X;  1ZE3 D;  1EWC A;  4LK0 M;  1YQB A;  2ZPN A;  1NI3 A;  4ZRK A;  4DXA B;  2FBW B;  2J0K A;  2YLM A;  3ZIM A;  3DBR I;  4B0M A;  3AE1 B;  5JH5 C;  1R4M B;  3A1Q B;  3ZNH B;  1MVK A;  3DBL I;  1TKE A;  4DXF A;  2WX1 A;  1NI2 A;  1H8C A;  4E3C A;  2O2V A;  2HE7 A;  4ZYN A;  2CHZ A;  4MGI E;  2V4L A;  2C60 A;  1IPG A;  2GI9 A;  4I6L B;  3KUZ A;  2JRH A;  3MJW A;  2O6V B;  2DZI A;  4BBN F;  3Q8E A;  1YJJ A;  3SU8 X;  1SSN A;  1WR1 A;  3KH0 A;  1J0G A;  2BBC A;  5D6J B;  5GMV A;  3S2A A;  1HTQ A;  2DEN B;  2ON8 A;  3ZW3 A;  5FK9 C;  4JX1 C;  3AI5 A;  2V0G A;  5JZE B;  3VFK A;  2DHZ A;  4HPM B;  1WXA A;  1WMH A;  3APD A;  4DXG A;  3RNA C;  2ZJD A;  1WZ0 A;  3H8H A;  2OJW A;  4BZA A;  4XWT A;  2Z0D B;  4REZ A;  3NZ3 A;  4MT5 A;  3W9C B;  4FJV B;  1D5X C;  4ASW C;  5KHO A;  3A1Q A;  1I4Q A;  1SB3 C;  2CU1 A;  3GS2 A;  4ZRP A;  5HFY A;  2JUO A;  5G2N A;  1S3S G;  4XE0 A;  4BVU C;  2D3C A;  3VH4 B;  3Q3F A;  2DYM A;  3AB5 A;  3FC4 A;  5BYR A;  2O6V A;  5JXV A;  1N5W A;  3AV8 A;  3V6E B;  2WP9 B;  5D2M B;  1FFV A;  1BXT A;  2C7M B;  4IWP A;  2NR2 A;  2KJR A;  3HVZ A;  4UDU C;  4PYZ A;  2IY1 B;  3Q69 A;  4EZL A;  5L83 A;  1YMH E;  2KJ6 A;  5H92 C;  1H4R A;  4M02 A;  3C0R B;  3EC8 A;  3D32 A;  3E9S A;  5IKC M;  3AEF B;  1UEL A;  2KDF B;  4D2K A;  3NZS A;  1TS3 A;  3R3M A;  4HDQ A;  4YTM B;  4URK A;  3Q8F A;  2M1M A;  2INP E;  1F0Z A;  5IP4 D;  4M8M A;  5G5G A;  5I4D A;  2LRW A;  4S17 A;  1WE6 A;  2D5G A;  4RF0 A;  2N7J A;  3PRZ A;  2BWE S;  1MFW A;  3UF8 A;  1Q10 A;  3APC A;  1SIJ A;  2QSD A;  2ZVN A;  2MWS B;  4ANU A;  3DWM A;  1RLF A;  4R3D A;  2OHF A;  3EUB 2;  2GRI A;  1E7V A;  3VTW A;  1WJ6 A;  2WDQ B;  3UIO B;  3WIM A;  1I7H A;  4II3 B;  3P4R B;  3NUH B;  3OAW A;  2V1Y A;  2XK5 B;  4IUM B;  4NJ7 A;  1IP9 A;  4M0W B;  2MLB A;  3WAM A;  4IM2 A;  4CYE A;  3B2G A;  2RPV A;  3TJP A;  3NS8 A;  4FA6 A;  1E9M A;  3P4S B;  2DZJ A;  1T5X D;  1JCK B;  1L2N A;  3IG3 A;  3PVL A;  3I63 C;  3V62 A;  1XQQ A;  4A3P A;  2Y5B B;  4WJO A;  3DBR B;  3T9L A;  1N60 A;  1ZUD 2;  2I1J A;  3RT3 B;  2D3B A;  3AUL A;  3DBL B;  1Y56 A;  1KLU D;  3L13 A;  3QA8 A;  1YN3 A;  2WX0 A;  2Z8L A;  1Z2M A;  3MP9 A;  3RNC C;  3E56 A;  2RD0 A;  4NZL B;  3K9P B;  2V9H A;  4XX5 A;  4NQK E;  3AE9 B;  1VR9 A;  2K3U A;  1ZDX A;  3L08 A;  1J7B A;  4YTN B;  5AZH A;  3U2S C;  2LI5 A;  1YQ4 B;  2XK5 A;  1IYF A;  4G3X B;  4W9C A;  2LWP A;  4MH8 A;  4IG7 B;  4M0W A;  1E8X A;  4XDD A;  1P3Q U;  2W9N A;  2WXI A;  3EFU A;  5J17 A;  2KMA A;  2G3Q B;  4OVU A;  2LGS A;  3NVW A;  1L0X B;  4RMA A;  3PPA A;  4A90 A;  1S1Q B;  3DOW A;  1TY0 A;  2KWV B;  1KTK A;  1RRB A;  1PDX A;  1FCC C;  4FXC A;  1TKY A;  1ZDV A;  1V86 A;  1XCQ L;  1HE8 A;  4IW0 A;  2MBH A;  3M63 B;  2CS4 A;  3V3X A;  3HRD D;  3TEW A;  1E10 A;  3ML9 A;  4P1B C;  2IYD B;  2ZNV C;  3AEG B;  4K81 A;  1HZ5 A;  1K50 A;  2D07 B;  1B9R A;  1GC6 A;  4WH4 A;  5AUI A;  2Y5C A;  3A33 B;  2D2Q A;  2YEP B;  1WYW B;  2DWQ A;  2AQ2 B;  3EFC A;  2R2Q A;  1LFD A;  4RH6 A;  2REX A;  1D3Z A;  2N7D A;  1J7C A;  4DHZ E;  2G45 B;  4N59 A;  1WRD B;  3Q8B A;  2RGF A;  2IPK D;  3WAP A;  3PHX B;  3ZUN A;  3VRB B;  2ASQ A;  4K3C A;  1AAR A;  2AL3 A;  2MBQ A;  3R2T A;  4EOY A;  4HPP A;  1OEY A;  1ZXH A;  3VUY A;  1YX5 B;  1YJI A;  1E7P B;  2AYO B;  4KV2 A;  4C00 A;  1I4H A;  1QOB A;  1D4B A;  4M8N A;  1GPX A;  4PS3 A;  4AUQ C;  5E6O A;  2Y5P A;  1XF5 L;  2JXX A;  4LNO A;  1T0Q C;  4KSL C;  1PFD A;  3MC9 A;  2BYV E;  1M94 A;  3VXW A;  1D5Z C;  1C9F A;  1C4C A;  1IGC A;  2QIL A;  1EWY C;  3I9V 1;  4A3O A;  1WGR A;  3VR8 B;  3UI3 A;  1CK1 A;  1OEY J;  1E8W A;  1MG4 A;  1KLV A;  2ZVO A;  3MFG A;  3T3O A;  1WM2 A;  4PK1 A;  1V1O A;  1VJK A;  3NY5 A;  3BVG A;  2RDH A;  3UIN B;  2YVC A;  2UYZ B;  3P4P B;  3TEX A;  2M56 B;  4KSK C;  1F9J A;  4J3O D;  1IBX B;  2H88 B;  4A6Q A;  2A5U A;  2KDM A;  2H89 B;  4MSQ B;  2JZP A;  1WJU A;  3B2F A;  2GMI C;  3AE3 B;  4M00 A;  3KW5 B;  4TV3 A;  3ZQ4 A;  4F1S A;  2G9H D;  4IOI E;  1KFY B;  5EDS A;  4MAC A;  2QMT A;  3QCA A;  2DZK A;  4USA A;  5LLI A;  2ZPY A;  3HHM A;  1X1M A;  2IGD A;  2X38 A;  3QX1 A;  2WHI A;  2ZNV B;  3X23 A;  1I4P A;  1JQ4 A;  2KMC A;  3Q8C A;  3OJ3 A;  4PS7 A;  3AEB B;  1WGD A;  1DGJ A;  1QOG A;  3O13 A;  4DHJ B;  5DPT A;  1JML A;  3PV1 A;  4BBN C;  3KWL A;  1F2R I;  4ANW A;  3DVG Y;  5BYQ A;  1UBI A;  4B9K A;  1IBX A;  4OW0 A;  3TUO A;  3PS6 A;  1L4Z B;  3IXS A;  1I4G A;  3A4R A;  2JQR B;  1FNV A;  1WGG A;  2RPQ A;  3TMP B;  1GAQ B;  3L17 A;  4JWS C;  4XC2 A;  1OGW A;  2LZ6 A;  3MC0 B;  4F7Z A;  4HVB A;  2KLG A;  3NRZ A;  1ET9 A;  2L83 A;  3LB8 C;  4X57 B;  4E71 A;  4LNN A;  3AN1 A;  3QAQ A;  3BY4 B;  4L1B A;  4LCD E;  2KTR B;  3ZLZ A;  3VAW A;  2IO0 B;  5C3J B;  2M4N A;  4W9I A;  1VRA B;  2SEB D;  1VDV A;  3AM9 A;  1JAL A;  1STE A;  2FCN A;  2PE9 A;  2LUM A;  4ARI A;  5BO4 B;  2KK8 A;  1FD6 A;  2FCQ A;  1WFY A;  1TZ1 A;  1XLQ A;  5H8Y E;  3RNG C;  2N0S B;  1F77 A;  3TL5 A;  3ZGZ A;  2C7N B;  3AH7 A;  4DWF A;  5TR5 A;  2K6D B;  1WY8 A;  1IUE A;  2K25 A;  3AE8 B;  2RMM A;  3HM3 A;  2W3S A;  1FIQ A;  2LEK A;  1SE3 A;  4JQW C;  1LM8 B;  3ZRF A;  2AQ3 B;  2LAS A;  3W5U B;  2JZZ A;  1FRR A;  3JW0 X;  1WMH B;  4TMA B;  2L32 A;  1AWD A;  4N6E B;  2L00 B;  4BKS A;  5JHA A;  2XEW A;  3UQA A;  3VVW B;  2KTR A;  4W9D A;  3AU5 A;  3VH3 B;  1V9J A;  3NOB A;  3ZXR A;  3PGE A;  4MM3 B;  1UUP A;  2AQ1 B;  4WJQ A;  4G11 A;  4NAM A;  1T0R C;  4RGN A;  3I57 A;  4G50 A;  3U4E G;  3C8Y A;  3DBS A;  4NJC A;  4RGO S;  2FCS A;  2NCN A;  1NEN B;  3W1Y A;  4ZHP A;  1ZW7 A;  3L0W B;  1T3Q A;  3AEA B;  2BPS A;  4YSZ B;  3UGB B;  2MBE A;  3ZJT A;  1F1H A;  3B0A A;  4H2A A;  1RYJ A;  1R4N I;  3Q3N C;  3U7D A;  2KD0 A;  1XD3 B;  3B08 A;  3EA6 A;  2M17 A;  2BYF A;  3OJ4 B;  4FBJ B;  2HJ1 A;  4JLC A;  2I1K A;  4A9A A;  2IGG A;  5TSS A;  3HM6 X;  5IA7 A;  1V80 A;  2ZZP B;  3N32 A;  4AP4 C;  1TJE A;  2MRP A;  1GOZ A;  3DPD A;  3KYD D;  3ZDM C;  1A70 A;  1C4A A;  4A20 A;  2JX5 A;  1WM3 A;  4LJP B;  4LJO B;  4LNK A;  1L7Y A;  4TSS A;  4TUU A;  3Q14 C;  3CMM B;  4MM3 A;  3Q3O C;  1TT5 B;  4RFB A;  4GN1 A; 
#chains in the Genus database with same CATH homology
 1L2N A;  3IG3 A;  3PVL A;  4KIK B;  1G6J A;  1OTR B;  2DYB A;  5D7G A;  3I3T B;  3V62 A;  1A5R A;  1XQQ A;  2O6V D;  4A3P A;  1VD2 A;  2KHW B;  2Y5B B;  2MCN B;  2NS5 A;  3TIX A;  4WJO A;  3PRE A;  1XT9 B;  3UIP B;  3HIZ A;  2AWT A;  3T9L A;  4EKU A;  2RSU A;  1WF9 A;  2I1J A;  3PSE B;  3WAL A;  3RT3 B;  4CHK A;  5D94 A;  2KTF A;  3AUL A;  2K8H A;  3PLV A;  3PTF C;  1WE7 A;  3L13 A;  3QA8 A;  1V81 A;  2WX0 A;  3VUX A;  2KO3 A;  1Z2M A;  3M3J A;  1FXT B;  4WQO B;  1R4M I;  1WXS A;  3L54 A;  3U30 A;  3ZRC A;  1SGH A;  5AZF A;  2RD0 A;  3RD2 A;  3ZO5 B;  3K9P B;  4XX5 A;  3A9J A;  1MG8 A;  2KQ7 A;  2K6Q A;  4NQK E;  2PEA A;  1ISN A;  4BKS D;  3L08 A;  1WGH A;  4MEM A;  2L7R A;  4K7S A;  5HKH A;  4MGZ E;  5AZH A;  3MTN B;  2J0J A;  3W1S A;  2LI5 A;  3L10 B;  2XK5 A;  4AJY B;  1IYF A;  2PE6 B;  4FJY A;  2LRU A;  4N9F 4;  1P1A A;  2WWZ A;  3KUD B;  4F8C B;  4ZRJ A;  4G3X B;  4B95 A;  2EMS A;  4W9C A;  2IO2 B;  3PZD A;  1I35 A;  2LWP A;  4FHJ A;  3H1U A;  2NVU I;  3ECI A;  4IG7 B;  1E8X A;  4W9H A;  1V6E A;  5CHW A;  4I6N B;  4II2 B;  1P3Q U;  2JY6 A;  3DBH I;  1ZKH A;  2W9N A;  3O65 B;  3EFU A;  5J17 A;  2KMA A;  2G3Q B;  4OVU A;  1V5T A;  3Q3J A;  2FID A;  3GZN I;  4RMA A;  3VTU A;  2L0T A;  2ZCC A;  3PPA A;  1S1Q B;  4KIK A;  3DOW A;  5J2R A;  2KWV B;  4W9K A;  3QQ8 B;  1RRB A;  2LVO A;  2IBI B;  4DK5 A;  3A9K B;  4EZK A;  3NHE B;  4MEL A;  2KWC A;  4FAD A;  3B1L X;  4NQL B;  4TQ0 A;  2PPH A;  2NBU A;  3AU4 A;  5CHF A;  2LGY A;  1V86 A;  1HE8 A;  4IW0 A;  2MBH A;  3M63 B;  2FUH B;  2CS4 A;  2UWQ A;  2M8S A;  3QAR A;  3DVN V;  4HCN B;  4FN2 A;  1NBF C;  1WR6 E;  3ML9 A;  5DPW A;  3NZU A;  4TQ1 A;  2J0M A;  2MBB B;  5AZG A;  3RCZ A;  4WWN A;  3OLM D;  1C1Y B;  2IYD B;  4NY0 A;  1QZE A;  2ZNV C;  4LDT B;  4BKG A;  4K81 A;  3R7Q A;  3WAO A;  2D07 B;  3JSV B;  1WX9 A;  2KN5 A;  2KX0 A;  4ICV A;  5IAA C;  1E8Z A;  1GC6 A;  4ANX A;  3A33 B;  2D2Q A;  2N1W A;  2KFK B;  2N4F A;  2FNJ B;  3QC8 B;  1WYW B;  3UQB A;  4GIV A;  1V49 A;  3IFW B;  4E74 A;  4PYU A;  2V3S A;  4YL8 A;  5FR6 A;  2VRR B;  1J8C A;  2GBK A;  3H7S A;  3QIJ A;  2R2Q A;  1WJN A;  1LFD A;  1V5O A;  3JVZ X;  4NNJ B;  1SIF A;  2REX A;  2OJR A;  2XBB C;  1D3Z A;  2KX3 A;  2N7D A;  3TBL D;  4DHZ E;  3HK0 A;  2G45 B;  1WRD B;  2KXJ A;  2RGF A;  1SE9 A;  3V61 A;  3WAP A;  3PHX B;  3ZUN A;  2ASQ A;  1AAR A;  2LVP A;  2NPT B;  1UBQ A;  2AL3 A;  2MBQ A;  2D10 A;  4K7U A;  4MJS B;  4EOY A;  1OEY A;  4GMV A;  3VUY A;  1E90 A;  3A9K A;  1YX5 B;  2KFJ A;  3CF6 E;  4AWJ A;  2AYO B;  4KV2 A;  1UH6 A;  2GOW A;  2KDB A;  2GBJ A;  2Z0E B;  1Q5W B;  4M8N A;  3WAN A;  2FIF A;  4MDK E;  4PS3 A;  2JZ3 B;  2CHW A;  5E6O A;  4AUQ C;  2JXX A;  3IVF A;  1EF5 A;  4KSL C;  2BYV E;  1M94 A;  2IZV B;  2MP2 B;  3VXW A;  4CO7 A;  2GBN A;  2BYE A;  1E5W A;  2C9W B;  1KOT A;  2K8C A;  1WGY A;  4BFR A;  1U4A A;  4FLH A;  4A3O A;  1WGR A;  1WX7 A;  2MA9 B;  3JSV A;  4FJZ A;  4WJN A;  1OEY J;  3RUL A;  1E8W A;  2J7Q B;  1J19 A;  2KOX A;  2KFK A;  4KDI C;  1KLV A;  2ZVO A;  4JIO U;  3ZDT A;  1JRU A;  1WM2 A;  3IHP C;  1I42 A;  5DCN A;  3NY5 A;  2C5L C;  4BOS C;  2JRI B;  3UIN B;  1BT0 A;  2YVC A;  3APF A;  4WWP A;  2KZR A;  2UYZ B;  2LGX A;  3X0W A;  4BKT A;  2HD5 B;  2CR5 A;  2KWU B;  4WAA A;  1P9D U;  3VUW A;  4AOF A;  4AJW A;  2O2V B;  4KSK C;  5L95 C;  1F9J A;  1P98 A;  5DPR A;  3WA0 A;  2JWZ A;  4G0N B;  2ZEQ A;  2A5U A;  2NPT A;  4W9L A;  1YX6 B;  4MJS A;  4IC7 B;  3PHW B;  4DDG D;  4MSQ B;  1CMX B;  3AXC A;  2L8J A;  3QHT A;  2LUE A;  1P0R A;  1WJU A;  5KHQ A;  2GMI C;  1WJ4 A;  2MX2 A;  3KW5 B;  4EUT A;  3EHV A;  1K8R B;  4ANV A;  2L3Z A;  2N9P C;  2D11 A;  4TV3 A;  3DVG X;  4F1S A;  2KKC A;  2DAJ A;  1C3T A;  1YQB A;  5EDS A;  1LQB A;  2ZPN A;  1E7U A;  3QCA A;  2DZK A;  3ZTD A;  4ZRK A;  1RFA A;  2MP2 A;  4DXA B;  2J0K A;  3ONS A;  4GB9 A;  2YLM A;  5LLI A;  2WDT B;  2ZPY A;  3HHM A;  1X1M A;  1KJT A;  3ZIM A;  3QX1 A;  2CHX A;  5CHV C;  2ZNV B;  4WWO A;  1WXV A;  1WZ3 A;  1YIW A;  3DBR I;  2N9E B;  2BKR B;  3X23 A;  5JH5 C;  1Q0W B;  3A1Q B;  2KMC A;  3ZNH B;  5LXH A;  3OJ3 A;  4GOC A;  2IY0 B;  3QJZ A;  3IBE A;  4PS7 A;  1ZGU B;  1WGD A;  1T0Y A;  3DBL I;  3RZW C;  2MSE D;  3MHS D;  4DHJ B;  2LGD A;  3PV1 A;  2WX1 A;  5DPT A;  2LD9 A;  4BBN C;  1NI2 A;  1H8C A;  4ANW A;  1UGM A;  2L05 A;  3DVG Y;  4E3C A;  2O2V A;  2HE7 A;  4ZYN A;  4RM8 A;  1UBI A;  2CHZ A;  2LVQ A;  2V4L A;  2KAN A;  4MGI E;  2C60 A;  4MH0 E;  4B9K A;  4GSW A;  2RR9 A;  5CX3 A;  1IPG A;  4I6L B;  4KDL B;  3KUZ A;  2JRH A;  2Z59 B;  3PS6 A;  3MJW A;  4MSM B;  3H7P B;  2O6V B;  4NAW B;  2DZI A;  4BBN F;  1EF1 A;  3A4R A;  3SU8 X;  2GBM A;  2KC1 A;  3LDZ E;  2LJ5 A;  3KH0 A;  1WR1 A;  3P2B A;  2M0X A;  1PQS A;  1WGG A;  4JGH B;  1J0G A;  4HXD A;  2RPQ A;  1TBE A;  4IM0 A;  3JYU A;  2L76 A;  5D6J B;  3TMP B;  5GMV A;  3S2A A;  2DEN B;  3EEC A;  4DHZ B;  3ZW3 A;  3AI5 A;  3L17 A;  3ALB A;  4K1R B;  3SD5 A;  2ZCB A;  5JZE B;  3RZF A;  4XC2 A;  2K8B A;  1OGW A;  1GC7 A;  2LZ6 A;  2PJH A;  3VFK A;  4EEW A;  2N7E A;  2DHZ A;  4HPM B;  1WXA A;  4LDT D;  1WMH A;  3APD A;  4F7Z A;  4P7I A;  1WH3 A;  3L16 A;  4HVB A;  2KLG A;  2ZJD A;  1WZ0 A;  4KZ0 A;  3W1S C;  3H6N A;  3VQI A;  5C23 A;  2KC2 A;  4DHJ D;  4X57 B;  2K39 A;  4E71 A;  3ML8 A;  1UZX B;  3QAQ A;  2LXA A;  3BY4 B;  3V6C B;  4LCD E;  2WYQ A;  2G4S A;  2Z0D B;  3DVN U;  3ZVV A;  4XZ4 A;  3ZNI D;  2KTR B;  1VCB A;  2NBW B;  2KVR A;  3ZLZ A;  3ZNG C;  3VAW A;  2IO0 B;  1WIA A;  4FJV B;  2BWF A;  4ASW C;  2M4N A;  5KHO A;  3A1Q A;  4J6I A;  2EMT A;  2CU1 A;  4ICU A;  4W9I A;  4B6W A;  1Y8R C;  3VHT C;  2JUO A;  4GGQ A;  5G2N A;  1S3S G;  4DDI D;  5AEK B;  2DX5 B;  4WJP A;  4EFO A;  1GJZ A;  3M62 B;  1TTN A;  4BVU C;  4OVV A;  2FAZ A;  5G55 A;  2AEH A;  3RYT A;  2FCN A;  2PE9 A;  2KJH B;  4IM3 A;  3VH4 B;  5BO4 B;  2KK8 A;  3Q3F A;  2FCQ A;  2N1V A;  1WFY A;  2DYM A;  2IO3 B;  2GBR A;  1TZ1 A;  4W9F A;  3H7P A;  2O6V A;  4NAW A;  2MQJ A;  2DAF A;  3V60 A;  4NJ6 A;  3CST A;  3N3K B;  3TL5 A;  4HPL B;  1GG3 A;  1EUV B;  3ZTC A;  2C7N B;  3V6E B;  3SHQ A;  5D2M B;  4DWF A;  2C7M B;  5TR5 A;  2K6D B;  4IWP A;  2NR2 A;  2D3G A;  1WY8 A;  2KJR A;  3ZNZ B;  2JT4 B;  2LXC A;  5LXI B;  2K25 A;  3DQV A;  4HCP B;  4GDL B;  4PYZ A;  1GUA B;  2IY1 B;  3BIN A;  3HM3 A;  4EZL A;  5L83 A;  4GU2 A;  2MBO A;  4IWQ A;  2KQS A;  2A4Z A;  1V2Y A;  2KJ6 A;  3R66 C;  3VDZ A;  1TGZ B;  4GDK B;  2R2O A;  3QWZ B;  3R7R A;  4JQW C;  2AL6 A;  1LM8 B;  2DYO A;  1H4R A;  1NDD A;  4TKN A;  3ZRF A;  2MW5 A;  2FCM A;  2LAS A;  3C0R B;  2JZZ A;  1KM7 A;  3KVF B;  2KDE B;  3RUI B;  4W9J A;  3EC8 A;  3D32 A;  1WMH B;  3JW0 X;  1RAX A;  4W9G A;  3K9O B;  3ZKJ C;  1GNU A;  2L00 B;  4BKS A;  5JHA A;  2G4D B;  2XEW A;  1UEL A;  2KDF B;  3VVW B;  3NZS A;  3UQA A;  3R3M A;  2KTR A;  3PT2 B;  2NBV B;  4HDQ A;  3AU5 A;  3QK0 A;  1V9J A;  4W9D A;  3VH3 B;  2EKE C;  3SDL C;  4URK A;  4GXB A;  3NOB A;  1LXD A;  2M1M A;  2JPH A;  3PGE A;  4DBG A;  3PLU A;  4M8M A;  4IWO A;  2BKF A;  2LRW A;  4HJK A;  1Q1O A;  2OOB B;  3ENE A;  2C7H A;  1YD8 U;  5DPS A;  3VTV A;  2HTH A;  4MGY E;  4WJQ A;  4HWI B;  2CKH B;  4G11 A;  3LJ3 A;  1WE6 A;  4W9E A;  3DCG A;  2N9X A;  3PRZ A;  2BWE S;  3PRP B;  3UF8 A;  4G50 A;  1Z5S B;  3APC A;  2BGF A;  3PRM B;  2ZVN A;  3DBS A;  2FCS A;  2MWS B;  2NCN A;  3W1Y A;  1ZW7 A;  4I6P A;  4ANU A;  3L0W B;  1UD7 A;  2B3A A;  4JL9 A;  1RLF A;  4HLE A;  2BPS A;  2BF8 B;  5E6P A;  1EO6 A;  3H9D A;  3KYC D;  5JHB A;  3UGB B;  2MBE A;  3B0A A;  4ZDV A;  4NPN A;  3U8Z A;  4HK2 A;  3M95 A;  1E7V A;  4HDO A;  4GDL A;  1R4N I;  3U7D A;  2DZM A;  1XD3 B;  2KD0 A;  3B08 A;  2JVC A;  3VTW A;  2KDI A;  3A9J B;  2KLC A;  4FUL A;  1WJ6 A;  4KZC A;  2M17 A;  3TCA A;  2BYF A;  3OJ4 B;  4GDK A;  4FBJ B;  3GOE A;  3UIO B;  3DDC B;  1E8Y A;  3A4S C;  4RM9 A;  3KUC B;  3WIM A;  4JLC A;  2I1K A;  2HJ8 A;  4K7W A;  4II3 B;  1OQY A;  4PS8 A;  5CTR C;  3CSF A;  2L0F A;  1WXM A;  3HM6 X;  3T8M A;  5IA7 A;  1V80 A;  3OAW A;  2QHO A;  2ZZP B;  3N32 A;  4KVG B;  2V1Y A;  4AP4 C;  2KNB A;  1YJ1 A;  2MRP A;  2XK5 B;  4IUM B;  2IO1 B;  5C1Z A;  3DPD A;  3KYD D;  3ZDM C;  4FHK A;  2K1F A;  4A20 A;  5J18 A;  1WM3 A;  4NJ7 A;  4LJP B;  4LJO B;  3N30 A;  1L7Y A;  4M0W B;  5E6N A;  2MLB A;  4TUU A;  3WAM A;  4IM2 A;  4BOZ B;  3CMM B;  4CYE A;  4EZJ A;  4MM3 A;  2JF5 A;  3TJP A;  3NS8 A;  1WI0 A;  1WX8 A;  4FA6 A;  4GN1 A;  1IP9 A;  2DZJ A;  4MGK E;  4ZRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...