2OJRA

Structure of ubiquitin solved by sad using the lanthanide-binding tag
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
GPGYIDTNNDGWIEGDELYIDTNNDGWIEGDELLAMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Double-Lanthanide-Binding Tags for Macromolecular Crystallographic Structure Determination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ubiquitin
total genus 21
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2007-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ojrA02
4URKA 2DAJA 2CR5A 3JVZX 3PT2B 4HDOA 3M63B 2AEHA 3OAWA 4FJZA 1F9JA 3DDCB 2D10A 3K9PB 2KN5A 4BFRA 1TTNA 3U7DA 1I42A 3N30A 2LZ6A 2ZCCA 1YQBA 4NQKE 3R7RA 3PSEB 2KWUB 2LASA 1J0GA 5D7GA 2LRUA 2MCNB 1YX5B 2KMCA 4RM9A 5E6NA 4ZRKA 5CX3A 4IG7B 1Q1OA 4GDLA 3PVLA 3K9OB 4AWJA 1P98A 2J7QB 4EZLA 1LQBA 1JRUA 1R4MI 2BPSA 4JGHB 4LJPB 2K8HA 5DCNA 4GN1A 2L3ZA 4GB9A 1RLFA 2MP2B 4G0NB 2DAFA 2DHZA 1C3TA 2YVCA 1YX6B 3APCA 3NZSA 2M4NA 4EZJA 2XEWA 2N7DA 1UGMA 3ZNHB 4W9IA 2K8BA 2KC2A 2HJ8A 1X1MA 4ANXA 3SD5A 3ONSA 1H4RA 2FUHB 3IG3A 4XC2A 2D11A 2XBBC 2O6VD 1T0YA 2REXA 3ZRFA 3B0AA 4KDLB 1WGGA 4GXBA 4E74A 3H9DA 1YJ1A 1WM2A 1H8CA 3H7PA 2KQSA 3A4SC 3VDZA 1L7YA 5G55A 2I1KA 4MJSA 2C60A 4FHJA 3ZNID 2KLCA 4K7SA 2ZNVB 1KLVA 2K6DB 4EUTA 1WRDB 2L05A 2G4SA 3RT3B 1EO6A 2MP2A 2UWQA 2WYQA 3APDA 1WXSA 4HWIB 4GDKB 1WX8A 2IO2B 3H1UA 1WX7A 4IWQA 1U4AA 4EZKA 3VAWA 3NY5A 3PLVA 4PS7A 2MW5A 4E3CA 2ZCBA 3DVGX 4M8NA 1E8XA 1V9JA 3ZNGC 2A4ZA 2C9WB 2J0MA 1E8ZA 4FBJB 5JHBA 2G3QB 4K81A 1WXMA 2FCQA 4KZCA 2K8CA 3JSVA 1HE8A 3RZFA 4B6WA 2KDEB 2HTHA 2LXCA 3H7PB 3KUDB 3MHSD 1WE6A 4WJQA 2HD5B 2K6QA 3HIZA 4BVUC 3QIJA 4GGQA 1KJTA 3Q3JA 1WXVA 4PYUA 2NBUA 3HM6X 2L76A 1OTRB 3L0WB 2KNBA 2KJRA 3H6NA 4DDID 4ZYNA 2N1WA 1WE7A 4KSLC 1A5RA 1EF1A 3L10B 1P1AA 2OOBB 2LGYA 5IAAC 1RFAA 4B95A 2KJHB 4ICUA 3R7QA 3KW5B 3UQAA 2MLBA 1IYFA 1V80A 3KH0A 3ML9A 5CHWA 3KYCD 4AOFA 2KFKA 4DWFA 3VUYA 2N9EB 1C1YB 3ECIA 4GDKA 1WIAA 3VTWA 1WFYA 3N3KB 2KD0A 2NR2A 1AARA 5KHQA 3H7SA 3DBRI 3NZUA 4MGKE 2ZNVC 4TKNA 2XK5B 2R2OA 1E8YA 2WX0A 2MSED 1Q0WB 2BYEA 1LFDA 2KDIA 2HE7A 3EC8A 3IBEA 2RD0A 1CMXB 1GUAB 4GSWA 2LGXA 2D3GA 3PTFC 3NS8A 4M0WB 1V5TA 2CHWA 2O6VA 2PJHA 2C7NB 2PE6B 2MBEA 3HHMA 2ZEQA 1WJUA 5IA7A 4FHKA 4PYZA 2IBIB 1WMHA 3ML8A 2BKRB 3PZDA 1L2NA 3WIMA 4BKGA 1J8CA 1WF9A 4PS3A 3RZWC 2KDBA 2IYDB 2RPQA 4RM8A 3IVFA 5FR6A 2KWCA 4FJVB 5CHFA 3X0WA 4OVUA 4IM2A 2JF5A 3QJZA 2BGFA 3ZDTA 2KC1A 2RSUA 3M62B 2BWFA 2JZZA 2GBNA 2CHZA 2MX2A 4KZ0A 3VUWA 3L08A 4HCPB 2MRPA 2C5LC 4WQOB 3ZUNA 4A3PA 1V2YA 2M8SA 5LXHA 4LDTB 1RRBA 2BKFA 4HJKA 4I6PA 4P7IA 1J19A 4HPLB 3M3JA 2AWTA 3UF8A 3C0RB 1GJZA 2L0FA 2LWPA 4G50A 5KHOA 5DPRA 1KM7A 3NOBA 4TQ1A 2IO1B 1YD8U 1NDDA 3IHPC 1E5WA 2FCMA 3GOEA 4HVBA 5AEKB 3N32A 2LI5A 2N4FA 2QHOA 4OVVA 4HDQA 5TR5A 2ZVOA 4IM3A 2MWSB 3KYDD 4AJYB 4JIOU 2K25A 4G11A 1LXDA 1V6EA 2N9XA 2VRRB 3A9KB 5E6OA 3V6EB 1M94A 3VUXA 1UBQA 4DHZE 1OEYA 5DPWA 4KIKA 3IFWB 2L8JA 3TCAA 3ZIMA 2KKCA 2ZZPB 4FADA 4ZDVA 3AI5A 5AZGA 2DYBA 1QZEA 3PPAA 3WAMA 2DZJA 4HPMB 3LDZE 3RUIB 3APFA 2GOWA 1VCBA 2CHXA 3OLMD 4TV3A 3ALBA 2KJ6A 3QWZB 2JT4B 3BY4B 4BKTA 4DBGA 3VFKA 2N9PC 4IUMB 1G6JA 3UIPB 3V62A 4TQ0A 1Q5WB 1P3QU 3GZNI 2LVQA 4KDIC 1ZW7A 4GU2A 3WALA 5EDSA 4MGZE 4BOZB 2MQJA 1UBIA 4TUUA 2LGDA 3PLUA 4KVGB 3ZTCA 4HK2A 2RR9A 3A4RA 3QARA 4CHKA 2G45B 1WR6E 1EUVB 1WH3A 1UZXB 1WY8A 4NNJB 4MSQB 4MGIE 4NAWB 1V81A 1FXTB 4KIKB 3A9KA 3X23A 3QCAA 3QK0A 5E6PA 2WWZA 1E8WA 5DPTA 3TJPA 4RMAA 4IWOA 4JQWC 3DBLI 3WA0A 4DDGD 3DBHI 5LLIA 3VHTC 3QHTA 1IP9A 2L0TA 3OJ3A 1WGDA 3AU4A 4NJ6A 5G2NA 2FIFA 4A3OA 5J2RA 3VH3B 2KX3A 3TMPB 2JXXA 4HCNB 1ISNA 2IY0B 3U8ZA 1E7UA 1ZKHA 4MEMA 5AZHA 1LM8B 4ANVA 1WR1A 2M17A 2FCSA 2DYOA 2ASQA 2DX5B 2KTRA 2YLMA 3ZRCA 4EOYA 2W9NA 1MG8A 2L00B 3PREA 2KO3A 2KQ7A 3MTNB 4XZ4A 2MA9B 1WJNA 2CS4A 3PS6A 3B08A 4A20A 5JZEB 3EECA 3UQBA 2K1FA 5LXIB 3DVNU 3TL5A 5C23A 2GBKA 4W9JA 3ZLZA 3KUCB 3RULA 4WWPA 3ZNZB 4MELA 4I6LB 1WI0A 1IPGA 3NHEB 3UIOB 2LUEA 4AJWA 4CO7A 1WJ6A 2CKHB 2I1JA 2IO3B 3VH4B 2KANA 4AUQC 5DPSA 5BO4B 3BINA 4JL9A 3L54A 3WAOA 2BYVE 2KFJA 4NAWA 2M0XA 4ICVA 3KUZA 3TBLD 2BYFA 3ZDMC 1SE9A 2MBQA 2B3AA 1BT0A 3LJ3A 4M8MA 4FA6A 3DPDA 4W9DA 3A33B 1UH6A 2KK8A 1S1QB 3A1QB 5JH5C 2D07B 5AZFA 5HKHA 4BBNC 2DZMA 2DYMA 3I3TB 4K7WA 2GBJA 2JUOA 2KLGA 4NQLB 4K1RB 4WJNA 1Z2MA 2V3SA 4MJSB 2LVOA 4FULA 2GBRA 4LCDE 3D32A 4MDKE 3RD2A 2DZIA 1GG3A 1ZGUB 5J17A 4EEWA 3JSVB 4LJOB 3U30A 3AU5A 4AP4C 1SGHA 2AL3A 3A9JA 3DVGY 3V61A 5JHAA 2JVCA 3CSTA 4W9KA 4XX5A 2M1MA 4I6NB 4WAAA 2L7RA 3DOWA 1WJ4A 2GBMA 2NPTB 2LXAA 2AL6A 2JZ3B 1S3SG 1WX9A 5CHVC 4G3XB 1V49A 4W9FA 4WJPA 4ANUA 3L16A 4F1SA 1PQSA 3EHVA 1E7VA 2ZJDA 1WZ0A 4E71A 4J6IA 2J0JA 3HM3A 1SIFA 5CTRC 1V86A 4NJ7A 1GC7A 1WYWB 1UELA 4YL8A 3PGEA 3A1QA 1KOTA 2ZVNA 2JRIB 3PV1A 1I35A 2WX1A 3W1SA 2ZPYA 3CSFA 3VVWB 2O2VA 1UD7A 3QQ8B 4W9HA 2C7MB 2FCNA 4ANWA 2XK5A 1YIWA 4PS8A 2EKEC 2JY6A 4FLHA 2EMSA 3CF6E 3UINB 3RCZA 3PRMB 1WXAA 4KSKC 3O65B 1TZ1A 3PRPB 3A9JB 3W1YA 2MBOA 2NCNA 3Q3FA 2Z0DB 2V4LA 2KOXA 3T9LA 2KFKB 4MGYE 1WGYA 5D2MB 2GMIC 2O6VB 3ZTDA 2NPTA 3VTVA 4BKSD 1TBEA 2WDTB 4WWNA 3V6CB 3ZVVA 2KZRA 4ASWC 2V1YA 3B1LX 2K39A 3QC8B 4IM0A 4B9KA 3PHWB 1TGZB 2BF8B 5D94A 4DHZB 4IWPA 1RAXA 2MBHA 3DBSA 4II2B 4BBNF 4ZRJA 2BWES 2J0KA 4DHJB 1WGRA 2KTFA 2KWVB 2ZPNA 2NBWB 1WM3A 1EF5A 4GIVA 1OQYA 2O2VB 2C7HA 1Z5SB 4DK5A 4N9F4 3S2AA 4DHJD 3P2BA 4BKSA 1NBFC 2KMAA 3CMMB 3M95A 4WJOA 2JWZA 4GMVA 2JPHA 3SDLC 1D3ZA 3TIXA 3UGBB 1WMHB 2KTRB 4CYEA 4EFOA 3QX1A 2IO0B 3SHQA 1NI2A 4F8CB 5C1ZA 2G4DB 2KXJA 2NVUI 2PE9A 3MJWA 4KV2A 1V5OA 2PPHA 4W9LA 5D6JB 3T8MA 4W9GA 2JRHA 4HLEA 5J18A 3WANA 3ZO5B 2Y5BB 2KVRA 3VXWA 1WGHA 3PHXB 4MSMB 2NS5A 4GOCA 3L13A 2A5UA 2LRWA 3ZW3A 2N1VA 3HK0A 2Z0EB 1XQQA 2IY1B 2AYOB 3JYUA 3KVFB 3VTUA 4W9CA 4MH0E 2NBVB 2DENB 3DVNV 1XT9B 4IW0A 1GC6A 3DQVA 3RYTA 1XD3B 3R3MA 4JLCA 4FJYA 2CU1A 3JW0X 1R4NI 3AULA 2DZKA 3ZKJC 3WAPA 4II3B 1WZ3A 1VD2A 3EFUA 4NPNA 2UYZB 1Y8RC 2KX0A 2OJRA 3OJ4B 5L95C 4F7ZA 2FIDA 2FNJB 3ENEA 3DCGA 3VQIA 5L83A 4GDLB 4DXAB 2FAZA 2IZVB 1OGWA 3QA8A 4LDTD 2KDFB 4IC7B 3QAQA 4MM3A 4ZRIA 1P0RA 2N7EA 3SU8X 1GNUA 4X57B 2LD9A 4HXDA 2KHWB 1P9DU 5GMVA 2D2QA 3V60A 2R2QA 4NY0A 3W1SC 2Z59B 4W9EA 2PEAA 1K8RB 1E90A 2RGFA 3AXCA 4BOSC 4EKUA 2MBBB 4K7UA 1OEYJ 3L17A 3R66C 4FN2A 4WWOA 3PRZA 2LVPA 2LJ5A 2EMTA
chains in the Genus database with same CATH superfamily
4URKA 1N61A 4C7ZA 3M63B 3FAHA 1F9JA 3DDCB 4BFRA 1YQBA 3PSEB 2MCNB 5E6NA 1I4HA 4MT5A 1F1HA 3GE3C 2J7QB 1B9RA 4JGHB 1R4MI 3IT4B 5DCNA 2YEPF 1RLFA 3Q2AC 5AUIA 4G0NB 2B76B 1UGMA 3BYYB 3N1XC 3IG3A 4XC2A 1FIQA 1T0YA 3FC4A 2IJ0A 3W9CB 2K9XA 1H8CA 1AWDA 2C60A 2FE8A 3ZNID 4K7SA 1KLVA 4EUTA 4QAYA 1VLBA 1EO6A 1P7EA 2UWQA 4GDKB 1QOAA 3H1UA 1WX7A 4PS7A 3HVZA 1HEZE 3ZNGC 2C9WB 3P4QB 1E8ZA 1VZ8A 4K81A 1WXMA 4KZCA 3ZYYX 2LFIA 4B6WA 1BMLC 2LXCA 4JWUC 1PFDA 3IXSA 3ZJVA 3P4RB 4PYUA 3HM6X 2KNBA 1L4DB 4DDID 3I57A 4YTPB 3W2DA 1A5RA 5IAAC 4KGSA 3KW5B 3URYA 4ZHOA 3PZ8A 3VUYA 2N9EB 2Y5PA 3R2IA 2NR2A 1AARA 2XK5B 4LNOA 3SR6A 4RNAA 2MSED 1LFDA 4M00A 1FNWA 4B0EA 1TS5A 2D3BA 3H8HA 1CMXB 1R4MB 2DNFA 2LGXA 4HPPA 2MBEA 1WJUA 4PYZA 3AE3B 2BKRB 3PZDA 2SAKA 3WIMA 1J8CA 4KKIA 1GOZA 1AN8A 3IT6B 4IM2A 2BGFA 2MJDA 2CHZA 3VUWA 4HCPB 2C5LC 3IAS1 4WQOB 1V2YA 5LXHA 4LDTB 1PDXA 2QMTA 3GP7A 4LLGM 3UF8A 2N9KA 4G50A 5KHOA 1KM7A 3NOBA 4TQ1A 2IO1B 1NI3A 1T3QA 3N32A 4RGTA 2FUG1 2Q5WD 4WAFA 4IM3A 1LXDA 2N9XA 2VRRB 3A9KB 5DPWA 3IFWB 1SE2A 2L8JA 3TCAA 2ZZPB 1WSPA 3AI5A 5AZGA 1QZEA 4HPMB 3LDZE 4RFBA 2GOWA 1XLNA 1UGJA 2OJWA 4B0MA 3QWZB 4DXFA 4DBGA 2N9PC 4IUMB 1G6JA 3UIPB 4TQ0A 5IOIA 2LVQA 4KDIC 1ZW7A 3WALA 3NJTA 4BOZB 3AM9A 4TUUA 3W5VB 2LGDA 5I4DA 4HK2A 2RR9A 4CHKA 1UZXB 3AEDB 4MH8A 4MSQB 1V81A 4KIKB 3HVDA 5E6PA 4C7YA 3WA0A 3DBHI 3VHTC 2L0TA 1WGDA 2PVOD 4NJ6A 5G2NA 2G9HD 4A3OA 2WP9B 5J2RA 3VH3B 2KX3A 1ZKHA 1XF5L 2YLMA 2KTRA 2ASQA 2DX5B 4D2KA 2KO3A 2KQ7A 2MA9B 4A20A 5LXIB 3DVNU 1TS2A 3ZNZB 1FO4A 2J52A 3ZXVA 4CO7A 4NAMA 2IO3B 2NTTA 3VH4B 1JMLA 2AQ1B 4OZAA 5DPSA 3BINA 3WAOA 1F0ZA 4A9AA 4ARIA 1SE9A 2MBQA 5EE0A 1BT0A 3DPDA 4W9DA 1UH6A 2KK8A 1S1QB 2VZKD 3B9JA 4P1BC 2DYMA 3I3TB 2WXPA 2KLGA 4MJSB 2V3SA 1TT5B 1WRIA 3PZ7A 4XE0A 4EEWA 5D3IB 3AU5A 3A9JA 5JHAA 3CSTA 1K50A 4I6NB 4GLSC 2AL6A 3AEFB 1V49A 4W9FA 4WJPA 4ANUA 3DHIC 3L16A 1WZ0A 2W54A 4E71A 4IOIE 3HM3A 1XO3A 1UELA 1ZDVA 2JXTA 1XCTL 3A1QA 1KOTA 2ZVNA 1I35A 1ROEA 4BZAA 2WX1A 3CSFA 3OG5A 1SE4A 3RNAC 4ZOHC 2FCNA 2XK5A 3ZJTA 1PUTA 2JY6A 4FLHA 3TEXA 1JROA 1TZ1A 2WLBA 3P4PB 1QKZA 2K22A 3V6CB 4WWNA 3U2SC 3B1LX 1A70A 1E9MA 4IM0A 4MACA 1R7SA 1MVKA 5D94A 4DHZB 1RAXA 1UNSA 1J7CA 4HEA1 2BWES 1CK1A 1WGRA 4TSSA 1T0RC 3M95A 3VR8B 1D3ZA 1WMHB 2KWDA 1D5MC 2K3UA 1STEA 1PYWD 1DGJA 3BZDB 2INDC 4RGNA 5C1ZA 2KXJA 1V5OA 3P4SB 4HLEA 3WANA 1WGHA 2NS5A 2LRWA 2WU2B 5BYQA 2AYOB 3DBLB 4RF0A 2NBVB 2DENB 1XT9B 1GC6A 4US8A 1EWYC 1XD3B 1EU4A 2CJOA 1SE3A 3JW0X 1DOYA 3ZKJC 1K51A 4HKQA 2UYZB 1SF0A 1Y8RC 2JX5A 1C76A 4F7ZA 2FIDA 1ZOYB 3DCGA 4GDLB 1ZPSA 2MJ3A 3QA8A 1K52A 4ZHPA 4IC7B 3SU8X 3BVMA 1P0RA 2N7EA 2LD9A 1N60A 2KHWB 3AV8A 1JW9D 2D2QA 3AECB 3W1SC 1TJEA 1K8RB 3Q14C 3R66C 4FN2A 4WWOA 2DAJA 4RGMA 5HI1A 3RNBC 3K9PB 2D10A 2BQQA 1TTNA 1TS4A 2Y5CA 2ZCCA 2LASA 4WIPA 4NZLB 5D7GA 4O1NA 4RM9A 4ZRKA 4IG7B 3K9OB 1LQBA 2BPSA 2K8HA 4GB9A 2DHZA 1YX6B 2M4NA 4K3BA 1CZPA 2BS3B 5HFYA 5MPOA 2N7JA 2V4IB 3SD5A 3ONSA 1XLQA 4H2AA 1H4RA 5G5HA 3AE8B 2D11A 1L6UA 4GXBA 4E74A 2KN4A 3H9DA 4FXCA 1F2RC 2KVZA 2KQSA 3VDZA 2W3RA 1L7YA 2QDFA 3VRAB 3NS1A 1WYGA 4MJSA 3N1YC 1D6EC 2SEBD 2K6DB 1JQ4A 3AE5B 2L05A 2G4SA 3RT3B 5C3JB 1N6ZA 2I38A 3J9CA 3Q3NC 2IO2B 2WXHA 3PO0A 4EZKA 3VAWA 3PLVA 1QILA 1YQ4B 4M8NA 3NVYA 2A4ZA 4FBJB 1J7AA 2K8CA 1HE8A 2ON8A 2V3NA 2KDEB 2QCZA 3H7PB 3KUDB 3MHSD 1WE6A 4WJQA 3HIZA 4BVUC 1YN5A 3QIJA 2NBUA 1OTRB 3L0WB 2X8XX 2N1WA 4KSLC 4ZYNA 3GE8C 3Q3OC 1EF1A 3AE4B 1L5PA 5CHWA 3T3NA 1V1PA 4AOFA 1ZE3D 2KFKA 2IGDA 1T0SC 3ECIA 2BT6A 3VTWA 4USAA 4P16A 1WFYA 4NJCA 4OW0A 2KD0A 3Q6BA 3H7SA 4TKNA 1RWSA 4N59A 4EE2A 4OHJA 2JWUA 4YSYB 1VJKA 4A8XC 2GLSA 2O6VA 4PT5A 3RFZB 3MHZA 5IA7A 4DXGA 4IDIA 1I4GA 3SFEB 3W5UB 3AMZA 1L2NA 2LMCA 4PS3A 2WHIA 1V1PB 2RPQA 4RM8A 5IN7A 3Q3MC 2JF5A 2H88B 3Q8FA 1KFYB 3V05A 4KZ0A 2MRPA 2M8SA 1D5XC 2BKFA 3C8YA 1J19A 5BMIA 4HPLB 3M3JA 2AWTA 3IHPC 2FCMA 3GOEA 2LI5A 1FMAD 3FILB 2E6XA 1AYFA 3KYDD 4AJYB 4G11A 4DHZE 1ET6A 3TEZA 4BAXA 1N5XA 3ZIMA 2EELA 2K0PA 3GS2A 2DZJA 1VZ6A 5FR3A 1VCBA 1HZ5A 1XEEA 4BKTA 1C79A 3GZNB 1YN4A 2LGSA 1P3QU 3GZNI 2QJLA 3HUIA 4MGZE 3I63C 2MQJA 2L52A 4LK0M 3EA6A 1JCKB 4XGAB 4XDCA 2INPE 2G45B 1YOVB 1WY8A 4NNJB 4NAWB 1FXTB 3LYYA 5FK9C 3X23A 2WWZA 4ITKA 2LUMA 4N6EB 2J4XA 4IWOA 2BVCA 4C00A 4DDGD 1IP9A 1IUEA 1TIFA 2W3SA 3FKYA 1OFFA 5FKAC 3TMPB 2WQYB 1ESFA 1LM8B 2PMVA 3ZRCA 1E6EB 4EOYA 3TUOA 4JE3B 1MG8A 3PREA 2L00B 3MTNB 5JZEB 1LGRA 3EECA 1RFKA 2K1FA 2KQ4X 5C23A 4W9JA 3KUCB 4WWPA 1F2RI 4MELA 4XWWA 3NHEB 1IPGA 2LUEA 2CKHB 3ZJUA 4AUQC 1MHXA 5C2TB 1L4ZB 3N9YC 2BYVE 4ICVA 3KUZA 1XXGA 5H8YE 2B3AA 2OEDA 4M8MA 4FA6A 2PVGC 3A33B 1ET9A 3A1QB 2D07B 4YSZB 4BBNC 2DZMA 4K7WA 3AEGB 2RDGA 4NQLB 4WJNA 4FULA 1CJEA 2DZIA 4RGOS 4ACFA 4LJOB 4AP4C 4C4VB 1SGHA 3V61A 4WQMA 4W9KA 4XX5A 1DOXA 2M1MA 3KWLA 2L7RA 3DOWA 2NPTB 2LXAA 5CHVC 4F1SA 2MEKA 4J6IA 5CTRC 4NJ7A 1GC7A 4YL8A 4REZA 5TSSA 3W1SA 2ZPYA 3VVWB 2O2VA 1FEHA 4YXDB 4ANWA 1UWXA 2BBCA 2EMSA 3RCZA 3PRMB 3W1YA 4HKZE 3Q3FA 2QILA 2KOXA 4MGYE 4C56C 2O6VB 2NPTA 2V1YA 3KQ4A 3AE2B 3QC8B 2M0AA 4RF1A 1TGZB 4IWPA 2MBHA 3DBSA 3LB8C 4N58A 2H89B 2V9HA 3BVZA 2ZPNA 1GB1A 1ZP0B 4GIVA 2O2VB 1Z5SB 4DK5A 4DHJD 4WJOA 1KRHA 3AE1B 2XN9C 2KTRB 4EFOA 4XDDA 3SHQA 1JALA 4F8CB 5GXGB 2G4DB 3MJWA 4YTNB 4ZRQA 1V97A 2D5GA 3ZO5B 4A90A 5D3DA 1L0XB 4GOCA 2MH7A 3L13A 2KT7A 4RH6A 2N1VA 2PKOA 1TZOA 1XQQA 2WNMA 4MH0E 1OQQA 1KLGD 3R3MA 4FJYA 2CU1A 1R4NI 2INNE 1QF6A 3WAPA 2J53A 3EFUA 1I4RA 2ACZB 2GI9A 2J42A 3VQIA 3L4PA 4DXAB 2IZVB 1OGWA 2KACA 4MM3A 3QAQA 4KKJA 2BW2A 2R2QA 2CU3A 2PEAA 4EKUA 1OEYJ 3L17A 2WXIA 2LJ5A 2EMTA 1SIJA 1FNUA 3PT2B 2QC8A 3OAWA 2ZW1A 2KN5A 2L83A 3U7DA 2AQ2B 3N30A 4NQKE 2KMCA 5CX3A 3T3OA 4GDLA 4AWJA 1UF0A 1JRUA 4LJPB 2L3ZA 2YVCA 4A55A 3APCA 5HG2A 4EZJA 2N7DA 2PW9A 3ZNHB 2LEKA 2K8BA 2KC2A 1X1MA 4ANXA 3ETRA 3DWGC 2WU5B 2O6VD 2REXA 3B0AA 1WGGA 3MC8A 5E6JA 5BYRA 1NENB 1NVID 5G55A 2KLCA 3U7ZA 3DBRB 4XWTA 2WYQA 3MFGA 1WXSA 1I7HA 1FFUA 4IWQA 1QLBB 1VRAB 1HA5A 2AX5A 2RPVA 1MPEA 2ZCBA 3DVGX 1E8XA 2J0MA 3BWUD 2G3QB 2JU6X 1WXQA 2FCQA 4HJGE 4C80A 5EE9A 4M0WA 3RZFA 1YMHE 2HTHA 3TSSA 2G1EA 3NRZA 2HD5B 4ARCA 4UDUC 4S0RA 1KJTA 3Q3JA 3U4EG 3H6NA 1N63A 1P1AA 2OOBB 2LGYA 3AE6B 4B95A 2AQ3B 4HROA 2MLBA 3P63A 3KH0A 1OQRA 5JXVA 4DWFA 2WXFA 2ZW0A 3N3KB 3DBRI 3NZUA 4MGKE 3NZ3A 2R2OA 3RNCC 1SEBD 1Q0WB 3NG0A 2BYEA 3AEAB 1RYJA 2HE7A 2I2YA 3EC8A 1R4NB 3PTFC 4LTUA 4ZYSA 1V5TA 4LNIA 5IP4D 3Q8CA 2CHWA 2PJHA 2TSSA 2C7NB 2ZEQA 3GB1A 4FHKA 1TKEA 1JWUD 2JYEA 4BKGA 1WF9A 1TS3A 2KDBA 5FR6A 3X0WA 2QIEB 3QJZA 2RSUA 2BWFA 2EKIA 3L08A 3OWEB 4A3PA 1QOFA 1TY0A 4P7IA 4I6PA 1FNVA 1JWMD 1GJZA 2L0FA 2ONQA 2LWPA 5DPRA 1NDDA 1E5WA 2IDYA 2N4FA 4CQNA 4OVVA 4HDQA 2ZVOA 1FFVA 4JIOU 2K25A 4OZCA 3V6EB 5E6OA 4KIKA 2XNAC 2KKCA 1QOGA 3WAMA 4R3DA 3RUIB 4TV3A 3ALBA 2KJ6A 3BY4B 2R61A 2LHEA 1GB4A 3V62A 3AEEB 5EDSA 3CWIA 3KLSX 3ZTCA 2Z8LA 2WXGA 3QARA 1WR6E 3P1MA 1WH3A 3U52E 1L6VA 3TEYA 4KX6B 4MGIE 3A9KA 3QCAA 3QK0A 1DOIA 4JQWC 3ABVB 2JQRB 4IKGA 4LNNA 3OJ3A 1M4VA 2FIFA 3RNGC 2JXXA 4HCNB 1E7UA 1EWCA 4MEMA 5AZHA 4ANVA 1WR1A 3MJ5A 2M17A 2DYOA 2WXKA 1XLOA 1F77A 2CS4A 3DWMA 3PS6A 1C77A 1I4PA 3TL5A 3ZLZA 3RULA 4I6LB 4WH4A 3SFDB 3B2GA 1MFWA 1BUIC 2I1JA 4HRSA 1ACCA 2BS2B 4JL9A 3L54A 2M0XA 1MG4A 3TBLD 1P7FA 1GAQB 2OHFA 2JYTA 3Q8EA 2LJIA 5JH5C 5AZFA 5HKHA 2KMMA 3B2FA 2GBJA 2JUOA 1Z2MA 2GBRA 4LCDE 3D32A 4MDKE 1ZGUB 5J17A 3RN9C 3JSVB 3U30A 3DVGY 1I4XA 2DWQA 1WJ4A 2GBMA 2MHJA 3EGRA 2JZ3B 4YSXB 1WX9A 1I4QA 1E7VA 3EHVA 2VH2A 2J0JA 5BYSA 1SIFA 2Y3AA 5T8IA 1PGAA 1AW7A 5AUKA 1UD7A 3QQ8B 3P42A 4PS8A 2EKEC 1C9FA 3CF6E 3UINB 1WXAA 2WDRB 3O65B 3PRPB 3A9JB 2MBOA 2NCNA 2Z0DB 3WCQA 3T9LA 1WGYA 5D2MB 3ZTDA 3VTVA 4BKSD 3DBHB 1TBEA 2NMQA 2BS4B 3ZVVA 4ASWC 1KF6B 2IGHA 1EU3A 1FRRA 2L32A 5EE3A 2J0KA 2KWVB 1NEKB 2NBWB 1WM3A 1EF5A 2DLBA 1OQYA 2C7HA 1ZXHA 4N9F4 4BKSA 1NBFC 2KMAA 3CMMB 1VZ7A 1JWAD 2JPHA 4YWGG 3UGBB 1HTOA 1IBXA 3QX1A 1N5WA 4YTMB 1NI2A 1JWBD 2WGSA 2FBWB 2V0GA 2PPHA 1C78A 1L0YB 4W9GA 3MP9A 2JRHA 5J18A 1GPXA 2Y5BB 2PLPA 1C4PA 3VXWA 3PHXB 2GB1A 1T0QC 2A5UA 3RMKC 3ZW3A 3RPFC 3HK0A 2Z0EB 3DVNV 3ZXRA 4IW0A 3DQVA 4JLCA 3UI3A 1F52A 2L1AA 4US9A 2YEPB 3AULA 5G5GA 4II3B 1WZ3A 1IBXB 2PIAA 2KX0A 2OJRA 2HTME 3OJ4B 5L95C 5L83A 1YJIA 1FD6A 2W82A 4LDTD 4ZRIA 2WXRA 5GMVA 4NY0A 1YNTE 2RGFA 3AXCA 3RI7C 2MBBB 4K7UA 4P1CC 3PRZA 2LVPA 4GMVA 2CR5A 3JVZX 2N0SB 4HDOA 2AEHA 4FJZA 5BMHA 2KAJA 1I42A 1JWSD 2LZ6A 3R7RA 1J0GA 2KWUB 2LRUA 1YX5B 1BXTA 1Q1OA 1K53A 3PVLA 1P98A 4EZLA 3NUHB 4GN1A 2MP2B 2DAFA 1C3TA 1ZXIA 3AN1A 3NZSA 4YT0B 2KYWA 2XEWA 1NYRA 3IAM1 1YJJA 4W9IA 1J7BA 2HJ8A 1DYQA 2FUHB 2XBBC 3R2TA 3ZRFA 4KDLB 4Q2JA 1ZDXA 1YJ1A 1WM2A 1Y56A 3H7PA 3A4SC 1FPYA 2I1KA 4FHJA 3SEBA 3BIID 2ZNVB 1E0ZA 1QOBA 3N1ZC 2DBYA 1WRDB 1PGBA 2MP2A 3APDA 3NVVA 2VZKB 1LO5D 4HWIB 1WX8A 1KH0A 1U4AA 3NY5A 2MW5A 4E3CA 2LGIA 3RNFC 1V9JA 1V8CA 2WDQB 5JHBA 4ZRPA 1UUPA 2BTEA 1B1ZA 2KDMA 3JSVA 4RCOA 2K6QA 1EM7A 4GGQA 3I9V1 1XLPA 3LXFA 1WXVA 5H92C 2L76A 2KJRA 3AEBB 1WE7A 3L10B 1RFAA 2KJHB 4ICUA 3R7QA 3Q69A 3UQAA 1IYFA 1V80A 2M19A 3ML9A 3KYCD 1JRPA 1C1YB 4GDKA 1WIAA 3RNEC 5KHQA 2ZNVC 2M56B 4LNFA 1E8YA 2WX0A 2KDIA 2W55A 3IBEA 3BVGA 2RD0A 3E56A 1GUAB 4GSWA 2D3GA 3NS8A 4M0WB 3FILA 2LHDA 2PE6B 3HHMA 4XYCA 1QQRA 2IBIB 1WMHA 3ML8A 2RDBC 3RZWC 2IYDB 2NTSA 3IVFA 1MI0A 2KWCA 3MC9A 4FJVB 5CHFA 4OVUA 1SJHD 3ZDTA 2KC1A 1YN3A 3M62B 2JZZA 2GBNA 2MX2A 3BK2A 3DHGC 1SXTA 3Q8BA 3ZUNA 2WXOA 1RRBA 4HJKA 3AE7B 3C0RB 3AB5A 3BK1A 4C4VA 1YD8U 4WURA 4HVBA 5AEKB 3O13A 4LNKA 2QHOA 1UWMA 1Q10A 5TR5A 4WWMA 2MWSB 1ENFA 1V6EA 1M94A 3VUXA 1UBQA 1OEYA 5IKCM 4FADA 4ZDVA 2INCC 2DYBA 3PPAA 3APFA 2CHXA 3OLMD 4M01A 2JT4B 2RMMA 3VFKA 3ZGZA 1Q5WB 4GU2A 2JZPA 3BYTB 2K5PA 4M02A 1UBIA 1KLUD 3E9SA 3PLUA 4KVGB 2BYTA 4MM3B 5LNK1 3A4RA 5IO9A 1EUVB 4K3CA 2V3PA 2WXQA 4AS1A 2ICIA 1E8WA 5DPTA 3TJPA 4RMAA 4JPSA 2BB6A 3DBLI 5LLIA 3QHTA 3AU4A 1WGKA 3MC0B 4OVZA 3U8ZA 1SJED 1ISNA 2IY0B 1V1OA 1TYGB 2FCSA 2BB5A 2W9NA 2WXMA 4XZ4A 1WJNA 3B08A 3UQBA 5HHDG 2GBKA 1WI0A 2WXLA 3UIOB 4AJWA 1WJ6A 2GRIA 2KANA 3I5JC 2CJNA 3Q8AA 3EUB2 5BO4B 2KFJA 4NAWA 3ZDMC 2BYFA 3LJ3A 1SSNA 1ZUD2 1RM6C 2QSDA 1HXYD 3VR9B 3N20C 2QEJC 4K1RB 1HQRD 2WS3B 2LVOA 1E7PB 3VRBB 3RD2A 1GG3A 3V3XA 4L23A 2AL3A 3HRDD 1T5XD 1E10A 2JVCA 1PGXA 1SB3C 1D5ZC 4WAAA 1NYQA 2D3CA 1QT9A 1S3SG 2IGGA 1IGCA 4G3XB 1PQSA 2ZJDA 1TKGA 1V86A 1WYWB 1KTKA 1TKYA 3PGEA 2JRIB 3PV1A 4KGRA 4W9HA 2C7MB 2HDEA 2JSVX 2D3AA 1VR9A 1TY2A 3AH7A 1YIWA 4A6QA 2IPKD 1HTQA 4KSKC 1L0VB 2HJ1A 2V4LA 2KFKB 3EFCA 4L1BA 2GMIC 1WWTA 1FCCC 3C19A 2WDTB 2KZRA 2K39A 4B9KA 3NVWA 3PHWB 4P6VF 2BF8B 3CIRB 1FXIA 3KWVA 1N62A 4II2B 4BBNF 4ZRJA 2WXNA 4JWSC 4DHJB 2KTFA 3TEWA 3S2AA 3P2BA 2JWZA 3SDLC 3R8BA 3TIXA 1VDVA 4CYEA 1D4BA 1MJDA 2IO0B 1SBBB 1IGDA 1HZ6A 3ZQ4A 2PE9A 2NVUI 5D6JB 3T8MA 4KV2A 4W9LA 1YQ3B 4JX1C 2MJEA 1FCLA 2UU7A 5BMGA 2KVRA 1FXAA 4MSMB 2WXJA 4AQ7A 4DQOC 4S17A 1C4CA 2IY1B 3JYUA 1MHHE 3KVFB 1C4AA 4TMAB 4W9CA 3VTUA 4L2YA 2RDHA 5EE1A 2WDVB 3RYTA 1T6BX 2X38A 2DZKA 1CQVA 4NPNA 1VD2A 2PTLA 2N9LA 2FNJB 4OZBA 3ENEA 2FAZA 3NVZA 4J3OD 2KDFB 1FRDA 1GNUA 4X57B 4HXDA 2VH1A 2E3TA 1P9DU 3V60A 4KGTA 2Z59B 4W9EA 4BOSC 1E90A 1XCQL 3AE9B 4PK1A 3DHHC 1FM0D
chains in the Genus database with same CATH topology
4URKA 2DAJA 2CR5A 3JVZX 3PT2B 4HDOA 3M63B 2AEHA 3OAWA 4FJZA 1F9JA 3DDCB 2D10A 3K9PB 2KN5A 4BFRA 1TTNA 3U7DA 1I42A 3N30A 2LZ6A 2ZCCA 1YQBA 4NQKE 3R7RA 3PSEB 2KWUB 2LASA 1J0GA 5D7GA 2LRUA 2MCNB 1YX5B 2KMCA 4RM9A 5E6NA 4ZRKA 5CX3A 4IG7B 1Q1OA 4GDLA 3PVLA 3K9OB 4AWJA 1P98A 2J7QB 4EZLA 1LQBA 1JRUA 1R4MI 2BPSA 4JGHB 4LJPB 2K8HA 5DCNA 4GN1A 2L3ZA 4GB9A 1RLFA 2MP2B 4G0NB 2DAFA 2DHZA 1C3TA 2YVCA 1YX6B 3APCA 3NZSA 2M4NA 4EZJA 2XEWA 2N7DA 1UGMA 3ZNHB 4W9IA 2K8BA 2KC2A 2HJ8A 1X1MA 4ANXA 3SD5A 3ONSA 1H4RA 2FUHB 3IG3A 4XC2A 2D11A 2XBBC 2O6VD 1T0YA 2REXA 3ZRFA 3B0AA 4KDLB 1WGGA 4GXBA 4E74A 3H9DA 1YJ1A 1WM2A 1H8CA 3H7PA 2KQSA 3A4SC 3VDZA 1L7YA 5G55A 2I1KA 4MJSA 2C60A 4FHJA 3ZNID 2KLCA 4K7SA 2ZNVB 1KLVA 2K6DB 4EUTA 1WRDB 2L05A 2G4SA 3RT3B 1EO6A 2MP2A 2UWQA 2WYQA 3APDA 1WXSA 4HWIB 4GDKB 1WX8A 2IO2B 3H1UA 1WX7A 4IWQA 1U4AA 4EZKA 3VAWA 3NY5A 3PLVA 4PS7A 2MW5A 4E3CA 2ZCBA 3DVGX 4M8NA 1E8XA 1V9JA 3ZNGC 2A4ZA 2C9WB 2J0MA 1E8ZA 4FBJB 5JHBA 2G3QB 4K81A 1WXMA 2FCQA 4KZCA 2K8CA 3JSVA 1HE8A 3RZFA 4B6WA 2KDEB 2HTHA 2LXCA 3H7PB 3KUDB 3MHSD 1WE6A 4WJQA 2HD5B 2K6QA 3HIZA 4BVUC 3QIJA 4GGQA 1KJTA 3Q3JA 1WXVA 4PYUA 2NBUA 3HM6X 2L76A 1OTRB 3L0WB 2KNBA 2KJRA 3H6NA 4DDID 4ZYNA 2N1WA 1WE7A 4KSLC 1A5RA 1EF1A 3L10B 1P1AA 2OOBB 2LGYA 5IAAC 1RFAA 4B95A 2KJHB 4ICUA 3R7QA 3KW5B 3UQAA 2MLBA 1IYFA 1V80A 3KH0A 3ML9A 5CHWA 3KYCD 4AOFA 2KFKA 4DWFA 3VUYA 2N9EB 1C1YB 3ECIA 4GDKA 1WIAA 3VTWA 1WFYA 3N3KB 2KD0A 2NR2A 1AARA 5KHQA 3H7SA 3DBRI 3NZUA 4MGKE 2ZNVC 4TKNA 2XK5B 2R2OA 1E8YA 2WX0A 2MSED 1Q0WB 2BYEA 1LFDA 2KDIA 2HE7A 3EC8A 3IBEA 2RD0A 1CMXB 1GUAB 4GSWA 2LGXA 2D3GA 3PTFC 3NS8A 4M0WB 1V5TA 2CHWA 2O6VA 2PJHA 2C7NB 2PE6B 2MBEA 3HHMA 2ZEQA 1WJUA 5IA7A 4FHKA 4PYZA 2IBIB 1WMHA 3ML8A 2BKRB 3PZDA 1L2NA 3WIMA 4BKGA 1J8CA 1WF9A 4PS3A 3RZWC 2KDBA 2IYDB 2RPQA 4RM8A 3IVFA 5FR6A 2KWCA 4FJVB 5CHFA 3X0WA 4OVUA 4IM2A 2JF5A 3QJZA 2BGFA 3ZDTA 2KC1A 2RSUA 3M62B 2BWFA 2JZZA 2GBNA 2CHZA 2MX2A 4KZ0A 3VUWA 3L08A 4HCPB 2MRPA 2C5LC 4WQOB 3ZUNA 4A3PA 1V2YA 2M8SA 5LXHA 4LDTB 1RRBA 2BKFA 4HJKA 4I6PA 4P7IA 1J19A 4HPLB 3M3JA 2AWTA 3UF8A 3C0RB 1GJZA 2L0FA 2LWPA 4G50A 5KHOA 5DPRA 1KM7A 3NOBA 4TQ1A 2IO1B 1YD8U 1NDDA 3IHPC 1E5WA 2FCMA 3GOEA 4HVBA 5AEKB 3N32A 2LI5A 2N4FA 2QHOA 4OVVA 4HDQA 5TR5A 2ZVOA 4IM3A 2MWSB 3KYDD 4AJYB 4JIOU 2K25A 4G11A 1LXDA 1V6EA 2N9XA 2VRRB 3A9KB 5E6OA 3V6EB 1M94A 3VUXA 1UBQA 4DHZE 1OEYA 5DPWA 4KIKA 3IFWB 2L8JA 3TCAA 3ZIMA 2KKCA 2ZZPB 4FADA 4ZDVA 3AI5A 5AZGA 2DYBA 1QZEA 3PPAA 3WAMA 2DZJA 4HPMB 3LDZE 3RUIB 3APFA 2GOWA 1VCBA 2CHXA 3OLMD 4TV3A 3ALBA 2KJ6A 3QWZB 2JT4B 3BY4B 4BKTA 4DBGA 3VFKA 2N9PC 4IUMB 1G6JA 3UIPB 3V62A 4TQ0A 1Q5WB 1P3QU 3GZNI 2LVQA 4KDIC 1ZW7A 4GU2A 3WALA 5EDSA 4MGZE 4BOZB 2MQJA 1UBIA 4TUUA 2LGDA 3PLUA 4KVGB 3ZTCA 4HK2A 2RR9A 3A4RA 3QARA 4CHKA 2G45B 1WR6E 1EUVB 1WH3A 1UZXB 1WY8A 4NNJB 4MSQB 4MGIE 4NAWB 1V81A 1FXTB 4KIKB 3A9KA 3X23A 3QCAA 3QK0A 5E6PA 2WWZA 1E8WA 5DPTA 3TJPA 4RMAA 4IWOA 4JQWC 3DBLI 3WA0A 4DDGD 3DBHI 5LLIA 3VHTC 3QHTA 1IP9A 2L0TA 3OJ3A 1WGDA 3AU4A 4NJ6A 5G2NA 2FIFA 4A3OA 5J2RA 3VH3B 2KX3A 3TMPB 2JXXA 4HCNB 1ISNA 2IY0B 3U8ZA 1E7UA 1ZKHA 4MEMA 5AZHA 1LM8B 4ANVA 1WR1A 2M17A 2FCSA 2DYOA 2ASQA 2DX5B 2KTRA 2YLMA 3ZRCA 4EOYA 2W9NA 1MG8A 2L00B 3PREA 2KO3A 2KQ7A 3MTNB 4XZ4A 2MA9B 1WJNA 2CS4A 3PS6A 3B08A 4A20A 5JZEB 3EECA 3UQBA 2K1FA 5LXIB 3DVNU 3TL5A 5C23A 2GBKA 4W9JA 3ZLZA 3KUCB 3RULA 4WWPA 3ZNZB 4MELA 4I6LB 1WI0A 1IPGA 3NHEB 3UIOB 2LUEA 4AJWA 4CO7A 1WJ6A 2CKHB 2I1JA 2IO3B 3VH4B 2KANA 4AUQC 5DPSA 5BO4B 3BINA 4JL9A 3L54A 3WAOA 2BYVE 2KFJA 4NAWA 2M0XA 4ICVA 3KUZA 3TBLD 2BYFA 3ZDMC 1SE9A 2MBQA 2B3AA 1BT0A 3LJ3A 4M8MA 4FA6A 3DPDA 4W9DA 3A33B 1UH6A 2KK8A 1S1QB 3A1QB 5JH5C 2D07B 5AZFA 5HKHA 4BBNC 2DZMA 2DYMA 3I3TB 4K7WA 2GBJA 2JUOA 2KLGA 4NQLB 4K1RB 4WJNA 1Z2MA 2V3SA 4MJSB 2LVOA 4FULA 2GBRA 4LCDE 3D32A 4MDKE 3RD2A 2DZIA 1GG3A 1ZGUB 5J17A 4EEWA 3JSVB 4LJOB 3U30A 3AU5A 4AP4C 1SGHA 2AL3A 3A9JA 3DVGY 3V61A 5JHAA 2JVCA 3CSTA 4W9KA 4XX5A 2M1MA 4I6NB 4WAAA 2L7RA 3DOWA 1WJ4A 2GBMA 2NPTB 2LXAA 2AL6A 2JZ3B 1S3SG 1WX9A 5CHVC 4G3XB 1V49A 4W9FA 4WJPA 4ANUA 3L16A 4F1SA 1PQSA 3EHVA 1E7VA 2ZJDA 1WZ0A 4E71A 4J6IA 2J0JA 3HM3A 1SIFA 5CTRC 1V86A 4NJ7A 1GC7A 1WYWB 1UELA 4YL8A 3PGEA 3A1QA 1KOTA 2ZVNA 2JRIB 3PV1A 1I35A 2WX1A 3W1SA 2ZPYA 3CSFA 3VVWB 2O2VA 1UD7A 3QQ8B 4W9HA 2C7MB 2FCNA 4ANWA 2XK5A 1YIWA 4PS8A 2EKEC 2JY6A 4FLHA 2EMSA 3CF6E 3UINB 3RCZA 3PRMB 1WXAA 4KSKC 3O65B 1TZ1A 3PRPB 3A9JB 3W1YA 2MBOA 2NCNA 3Q3FA 2Z0DB 2V4LA 2KOXA 3T9LA 2KFKB 4MGYE 1WGYA 5D2MB 2GMIC 2O6VB 3ZTDA 2NPTA 3VTVA 4BKSD 1TBEA 2WDTB 4WWNA 3V6CB 3ZVVA 2KZRA 4ASWC 2V1YA 3B1LX 2K39A 3QC8B 4IM0A 4B9KA 3PHWB 1TGZB 2BF8B 5D94A 4DHZB 4IWPA 1RAXA 2MBHA 3DBSA 4II2B 4BBNF 4ZRJA 2BWES 2J0KA 4DHJB 1WGRA 2KTFA 2KWVB 2ZPNA 2NBWB 1WM3A 1EF5A 4GIVA 1OQYA 2O2VB 2C7HA 1Z5SB 4DK5A 4N9F4 3S2AA 4DHJD 3P2BA 4BKSA 1NBFC 2KMAA 3CMMB 3M95A 4WJOA 2JWZA 4GMVA 2JPHA 3SDLC 1D3ZA 3TIXA 3UGBB 1WMHB 2KTRB 4CYEA 4EFOA 3QX1A 2IO0B 3SHQA 1NI2A 4F8CB 5C1ZA 2G4DB 2KXJA 2NVUI 2PE9A 3MJWA 4KV2A 1V5OA 2PPHA 4W9LA 5D6JB 3T8MA 4W9GA 2JRHA 4HLEA 5J18A 3WANA 3ZO5B 2Y5BB 2KVRA 3VXWA 1WGHA 3PHXB 4MSMB 2NS5A 4GOCA 3L13A 2A5UA 2LRWA 3ZW3A 2N1VA 3HK0A 2Z0EB 1XQQA 2IY1B 2AYOB 3JYUA 3KVFB 3VTUA 4W9CA 4MH0E 2NBVB 2DENB 3DVNV 1XT9B 4IW0A 1GC6A 3DQVA 3RYTA 1XD3B 3R3MA 4JLCA 4FJYA 2CU1A 3JW0X 1R4NI 3AULA 2DZKA 3ZKJC 3WAPA 4II3B 1WZ3A 1VD2A 3EFUA 4NPNA 2UYZB 1Y8RC 2KX0A 2OJRA 3OJ4B 5L95C 4F7ZA 2FIDA 2FNJB 3ENEA 3DCGA 3VQIA 5L83A 4GDLB 4DXAB 2FAZA 2IZVB 1OGWA 3QA8A 4LDTD 2KDFB 4IC7B 3QAQA 4MM3A 4ZRIA 1P0RA 2N7EA 3SU8X 1GNUA 4X57B 2LD9A 4HXDA 2KHWB 1P9DU 5GMVA 2D2QA 3V60A 2R2QA 4NY0A 3W1SC 2Z59B 4W9EA 2PEAA 1K8RB 1E90A 2RGFA 3AXCA 4BOSC 4EKUA 2MBBB 4K7UA 1OEYJ 3L17A 3R66C 4FN2A 4WWOA 3PRZA 2LVPA 2LJ5A 2EMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4URK A;  2DAJ A;  2CR5 A;  3JVZ X;  3PT2 B;  4HDO A;  3M63 B;  2AEH A;  3OAW A;  4FJZ A;  1F9J A;  3DDC B;  2D10 A;  3K9P B;  2KN5 A;  4BFR A;  1TTN A;  3U7D A;  1I42 A;  3N30 A;  2LZ6 A;  2ZCC A;  1YQB A;  4NQK E;  3R7R A;  3PSE B;  2KWU B;  2LAS A;  1J0G A;  5D7G A;  2LRU A;  2MCN B;  1YX5 B;  2KMC A;  4RM9 A;  5E6N A;  4ZRK A;  5CX3 A;  4IG7 B;  1Q1O A;  4GDL A;  3PVL A;  3K9O B;  4AWJ A;  1P98 A;  2J7Q B;  4EZL A;  1LQB A;  1JRU A;  1R4M I;  2BPS A;  4JGH B;  4LJP B;  2K8H A;  5DCN A;  4GN1 A;  2L3Z A;  4GB9 A;  1RLF A;  2MP2 B;  4G0N B;  2DAF A;  2DHZ A;  1C3T A;  2YVC A;  1YX6 B;  3APC A;  3NZS A;  2M4N A;  4EZJ A;  2XEW A;  2N7D A;  1UGM A;  3ZNH B;  4W9I A;  2K8B A;  2KC2 A;  2HJ8 A;  1X1M A;  4ANX A;  3SD5 A;  3ONS A;  1H4R A;  2FUH B;  3IG3 A;  4XC2 A;  2D11 A;  2XBB C;  2O6V D;  1T0Y A;  2REX A;  3ZRF A;  3B0A A;  4KDL B;  1WGG A;  4GXB A;  4E74 A;  3H9D A;  1YJ1 A;  1WM2 A;  1H8C A;  3H7P A;  2KQS A;  3A4S C;  3VDZ A;  1L7Y A;  5G55 A;  2I1K A;  4MJS A;  2C60 A;  4FHJ A;  3ZNI D;  2KLC A;  4K7S A;  2ZNV B;  1KLV A;  2K6D B;  4EUT A;  1WRD B;  2L05 A;  2G4S A;  3RT3 B;  1EO6 A;  2MP2 A;  2UWQ A;  2WYQ A;  3APD A;  1WXS A;  4HWI B;  4GDK B;  1WX8 A;  2IO2 B;  3H1U A;  1WX7 A;  4IWQ A;  1U4A A;  4EZK A;  3VAW A;  3NY5 A;  3PLV A;  4PS7 A;  2MW5 A;  4E3C A;  2ZCB A;  3DVG X;  4M8N A;  1E8X A;  1V9J A;  3ZNG C;  2A4Z A;  2C9W B;  2J0M A;  1E8Z A;  4FBJ B;  5JHB A;  2G3Q B;  4K81 A;  1WXM A;  2FCQ A;  4KZC A;  2K8C A;  3JSV A;  1HE8 A;  3RZF A;  4B6W A;  2KDE B;  2HTH A;  2LXC A;  3H7P B;  3KUD B;  3MHS D;  1WE6 A;  4WJQ A;  2HD5 B;  2K6Q A;  3HIZ A;  4BVU C;  3QIJ A;  4GGQ A;  1KJT A;  3Q3J A;  1WXV A;  4PYU A;  2NBU A;  3HM6 X;  2L76 A;  1OTR B;  3L0W B;  2KNB A;  2KJR A;  3H6N A;  4DDI D;  4ZYN A;  2N1W A;  1WE7 A;  4KSL C;  1A5R A;  1EF1 A;  3L10 B;  1P1A A;  2OOB B;  2LGY A;  5IAA C;  1RFA A;  4B95 A;  2KJH B;  4ICU A;  3R7Q A;  3KW5 B;  3UQA A;  2MLB A;  1IYF A;  1V80 A;  3KH0 A;  3ML9 A;  5CHW A;  3KYC D;  4AOF A;  2KFK A;  4DWF A;  3VUY A;  2N9E B;  1C1Y B;  3ECI A;  4GDK A;  1WIA A;  3VTW A;  1WFY A;  3N3K B;  2KD0 A;  2NR2 A;  1AAR A;  5KHQ A;  3H7S A;  3DBR I;  3NZU A;  4MGK E;  2ZNV C;  4TKN A;  2XK5 B;  2R2O A;  1E8Y A;  2WX0 A;  2MSE D;  1Q0W B;  2BYE A;  1LFD A;  2KDI A;  2HE7 A;  3EC8 A;  3IBE A;  2RD0 A;  1CMX B;  1GUA B;  4GSW A;  2LGX A;  2D3G A;  3PTF C;  3NS8 A;  4M0W B;  1V5T A;  2CHW A;  2O6V A;  2PJH A;  2C7N B;  2PE6 B;  2MBE A;  3HHM A;  2ZEQ A;  1WJU A;  5IA7 A;  4FHK A;  4PYZ A;  2IBI B;  1WMH A;  3ML8 A;  2BKR B;  3PZD A;  1L2N A;  3WIM A;  4BKG A;  1J8C A;  1WF9 A;  4PS3 A;  3RZW C;  2KDB A;  2IYD B;  2RPQ A;  4RM8 A;  3IVF A;  5FR6 A;  2KWC A;  4FJV B;  5CHF A;  3X0W A;  4OVU A;  4IM2 A;  2JF5 A;  3QJZ A;  2BGF A;  3ZDT A;  2KC1 A;  2RSU A;  3M62 B;  2BWF A;  2JZZ A;  2GBN A;  2CHZ A;  2MX2 A;  4KZ0 A;  3VUW A;  3L08 A;  4HCP B;  2MRP A;  2C5L C;  4WQO B;  3ZUN A;  4A3P A;  1V2Y A;  2M8S A;  5LXH A;  4LDT B;  1RRB A;  2BKF A;  4HJK A;  4I6P A;  4P7I A;  1J19 A;  4HPL B;  3M3J A;  2AWT A;  3UF8 A;  3C0R B;  1GJZ A;  2L0F A;  2LWP A;  4G50 A;  5KHO A;  5DPR A;  1KM7 A;  3NOB A;  4TQ1 A;  2IO1 B;  1YD8 U;  1NDD A;  3IHP C;  1E5W A;  2FCM A;  3GOE A;  4HVB A;  5AEK B;  3N32 A;  2LI5 A;  2N4F A;  2QHO A;  4OVV A;  4HDQ A;  5TR5 A;  2ZVO A;  4IM3 A;  2MWS B;  3KYD D;  4AJY B;  4JIO U;  2K25 A;  4G11 A;  1LXD A;  1V6E A;  2N9X A;  2VRR B;  3A9K B;  5E6O A;  3V6E B;  1M94 A;  3VUX A;  1UBQ A;  4DHZ E;  1OEY A;  5DPW A;  4KIK A;  3IFW B;  2L8J A;  3TCA A;  3ZIM A;  2KKC A;  2ZZP B;  4FAD A;  4ZDV A;  3AI5 A;  5AZG A;  2DYB A;  1QZE A;  3PPA A;  3WAM A;  2DZJ A;  4HPM B;  3LDZ E;  3RUI B;  3APF A;  2GOW A;  1VCB A;  2CHX A;  3OLM D;  4TV3 A;  3ALB A;  2KJ6 A;  3QWZ B;  2JT4 B;  3BY4 B;  4BKT A;  4DBG A;  3VFK A;  2N9P C;  4IUM B;  1G6J A;  3UIP B;  3V62 A;  4TQ0 A;  1Q5W B;  1P3Q U;  3GZN I;  2LVQ A;  4KDI C;  1ZW7 A;  4GU2 A;  3WAL A;  5EDS A;  4MGZ E;  4BOZ B;  2MQJ A;  1UBI A;  4TUU A;  2LGD A;  3PLU A;  4KVG B;  3ZTC A;  4HK2 A;  2RR9 A;  3A4R A;  3QAR A;  4CHK A;  2G45 B;  1WR6 E;  1EUV B;  1WH3 A;  1UZX B;  1WY8 A;  4NNJ B;  4MSQ B;  4MGI E;  4NAW B;  1V81 A;  1FXT B;  4KIK B;  3A9K A;  3X23 A;  3QCA A;  3QK0 A;  5E6P A;  2WWZ A;  1E8W A;  5DPT A;  3TJP A;  4RMA A;  4IWO A;  4JQW C;  3DBL I;  3WA0 A;  4DDG D;  3DBH I;  5LLI A;  3VHT C;  3QHT A;  1IP9 A;  2L0T A;  3OJ3 A;  1WGD A;  3AU4 A;  4NJ6 A;  5G2N A;  2FIF A;  4A3O A;  5J2R A;  3VH3 B;  2KX3 A;  3TMP B;  2JXX A;  4HCN B;  1ISN A;  2IY0 B;  3U8Z A;  1E7U A;  1ZKH A;  4MEM A;  5AZH A;  1LM8 B;  4ANV A;  1WR1 A;  2M17 A;  2FCS A;  2DYO A;  2ASQ A;  2DX5 B;  2KTR A;  2YLM A;  3ZRC A;  4EOY A;  2W9N A;  1MG8 A;  2L00 B;  3PRE A;  2KO3 A;  2KQ7 A;  3MTN B;  4XZ4 A;  2MA9 B;  1WJN A;  2CS4 A;  3PS6 A;  3B08 A;  4A20 A;  5JZE B;  3EEC A;  3UQB A;  2K1F A;  5LXI B;  3DVN U;  3TL5 A;  5C23 A;  2GBK A;  4W9J A;  3ZLZ A;  3KUC B;  3RUL A;  4WWP A;  3ZNZ B;  4MEL A;  4I6L B;  1WI0 A;  1IPG A;  3NHE B;  3UIO B;  2LUE A;  4AJW A;  4CO7 A;  1WJ6 A;  2CKH B;  2I1J A;  2IO3 B;  3VH4 B;  2KAN A;  4AUQ C;  5DPS A;  5BO4 B;  3BIN A;  4JL9 A;  3L54 A;  3WAO A;  2BYV E;  2KFJ A;  4NAW A;  2M0X A;  4ICV A;  3KUZ A;  3TBL D;  2BYF A;  3ZDM C;  1SE9 A;  2MBQ A;  2B3A A;  1BT0 A;  3LJ3 A;  4M8M A;  4FA6 A;  3DPD A;  4W9D A;  3A33 B;  1UH6 A;  2KK8 A;  1S1Q B;  3A1Q B;  5JH5 C;  2D07 B;  5AZF A;  5HKH A;  4BBN C;  2DZM A;  2DYM A;  3I3T B;  4K7W A;  2GBJ A;  2JUO A;  2KLG A;  4NQL B;  4K1R B;  4WJN A;  1Z2M A;  2V3S A;  4MJS B;  2LVO A;  4FUL A;  2GBR A;  4LCD E;  3D32 A;  4MDK E;  3RD2 A;  2DZI A;  1GG3 A;  1ZGU B;  5J17 A;  4EEW A;  3JSV B;  4LJO B;  3U30 A;  3AU5 A;  4AP4 C;  1SGH A;  2AL3 A;  3A9J A;  3DVG Y;  3V61 A;  5JHA A;  2JVC A;  3CST A;  4W9K A;  4XX5 A;  2M1M A;  4I6N B;  4WAA A;  2L7R A;  3DOW A;  1WJ4 A;  2GBM A;  2NPT B;  2LXA A;  2AL6 A;  2JZ3 B;  1S3S G;  1WX9 A;  5CHV C;  4G3X B;  1V49 A;  4W9F A;  4WJP A;  4ANU A;  3L16 A;  4F1S A;  1PQS A;  3EHV A;  1E7V A;  2ZJD A;  1WZ0 A;  4E71 A;  4J6I A;  2J0J A;  3HM3 A;  1SIF A;  5CTR C;  1V86 A;  4NJ7 A;  1GC7 A;  1WYW B;  1UEL A;  4YL8 A;  3PGE A;  3A1Q A;  1KOT A;  2ZVN A;  2JRI B;  3PV1 A;  1I35 A;  2WX1 A;  3W1S A;  2ZPY A;  3CSF A;  3VVW B;  2O2V A;  1UD7 A;  3QQ8 B;  4W9H A;  2C7M B;  2FCN A;  4ANW A;  2XK5 A;  1YIW A;  4PS8 A;  2EKE C;  2JY6 A;  4FLH A;  2EMS A;  3CF6 E;  3UIN B;  3RCZ A;  3PRM B;  1WXA A;  4KSK C;  3O65 B;  1TZ1 A;  3PRP B;  3A9J B;  3W1Y A;  2MBO A;  2NCN A;  3Q3F A;  2Z0D B;  2V4L A;  2KOX A;  3T9L A;  2KFK B;  4MGY E;  1WGY A;  5D2M B;  2GMI C;  2O6V B;  3ZTD A;  2NPT A;  3VTV A;  4BKS D;  1TBE A;  2WDT B;  4WWN A;  3V6C B;  3ZVV A;  2KZR A;  4ASW C;  2V1Y A;  3B1L X;  2K39 A;  3QC8 B;  4IM0 A;  4B9K A;  3PHW B;  1TGZ B;  2BF8 B;  5D94 A;  4DHZ B;  4IWP A;  1RAX A;  2MBH A;  3DBS A;  4II2 B;  4BBN F;  4ZRJ A;  2BWE S;  2J0K A;  4DHJ B;  1WGR A;  2KTF A;  2KWV B;  2ZPN A;  2NBW B;  1WM3 A;  1EF5 A;  4GIV A;  1OQY A;  2O2V B;  2C7H A;  1Z5S B;  4DK5 A;  4N9F 4;  3S2A A;  4DHJ D;  3P2B A;  4BKS A;  1NBF C;  2KMA A;  3CMM B;  3M95 A;  4WJO A;  2JWZ A;  4GMV A;  2JPH A;  3SDL C;  1D3Z A;  3TIX A;  3UGB B;  1WMH B;  2KTR B;  4CYE A;  4EFO A;  3QX1 A;  2IO0 B;  3SHQ A;  1NI2 A;  4F8C B;  5C1Z A;  2G4D B;  2KXJ A;  2NVU I;  2PE9 A;  3MJW A;  4KV2 A;  1V5O A;  2PPH A;  4W9L A;  5D6J B;  3T8M A;  4W9G A;  2JRH A;  4HLE A;  5J18 A;  3WAN A;  3ZO5 B;  2Y5B B;  2KVR A;  3VXW A;  1WGH A;  3PHX B;  4MSM B;  2NS5 A;  4GOC A;  3L13 A;  2A5U A;  2LRW A;  3ZW3 A;  2N1V A;  3HK0 A;  2Z0E B;  1XQQ A;  2IY1 B;  2AYO B;  3JYU A;  3KVF B;  3VTU A;  4W9C A;  4MH0 E;  2NBV B;  2DEN B;  3DVN V;  1XT9 B;  4IW0 A;  1GC6 A;  3DQV A;  3RYT A;  1XD3 B;  3R3M A;  4JLC A;  4FJY A;  2CU1 A;  3JW0 X;  1R4N I;  3AUL A;  2DZK A;  3ZKJ C;  3WAP A;  4II3 B;  1WZ3 A;  1VD2 A;  3EFU A;  4NPN A;  2UYZ B;  1Y8R C;  2KX0 A;  2OJR A;  3OJ4 B;  5L95 C;  4F7Z A;  2FID A;  2FNJ B;  3ENE A;  3DCG A;  3VQI A;  5L83 A;  4GDL B;  4DXA B;  2FAZ A;  2IZV B;  1OGW A;  3QA8 A;  4LDT D;  2KDF B;  4IC7 B;  3QAQ A;  4MM3 A;  4ZRI A;  1P0R A;  2N7E A;  3SU8 X;  1GNU A;  4X57 B;  2LD9 A;  4HXD A;  2KHW B;  1P9D U;  5GMV A;  2D2Q A;  3V60 A;  2R2Q A;  4NY0 A;  3W1S C;  2Z59 B;  4W9E A;  2PEA A;  1K8R B;  1E90 A;  2RGF A;  3AXC A;  4BOS C;  4EKU A;  2MBB B;  4K7U A;  1OEY J;  3L17 A;  3R66 C;  4FN2 A;  4WWO A;  3PRZ A;  2LVP A;  2LJ5 A;  2EMT A; 
#chains in the Genus database with same CATH topology
 4URK A;  1N61 A;  4C7Z A;  3M63 B;  3FAH A;  1F9J A;  3DDC B;  4BFR A;  1YQB A;  3PSE B;  2MCN B;  5E6N A;  1I4H A;  4MT5 A;  1F1H A;  3GE3 C;  2J7Q B;  1B9R A;  4JGH B;  1R4M I;  3IT4 B;  5DCN A;  2YEP F;  1RLF A;  3Q2A C;  5AUI A;  4G0N B;  2B76 B;  1UGM A;  3BYY B;  3N1X C;  3IG3 A;  4XC2 A;  1FIQ A;  1T0Y A;  3FC4 A;  2IJ0 A;  3W9C B;  2K9X A;  1H8C A;  1AWD A;  2C60 A;  2FE8 A;  3ZNI D;  4K7S A;  1KLV A;  4EUT A;  4QAY A;  1VLB A;  1EO6 A;  1P7E A;  2UWQ A;  4GDK B;  1QOA A;  3H1U A;  1WX7 A;  4PS7 A;  3HVZ A;  1HEZ E;  3ZNG C;  2C9W B;  3P4Q B;  1E8Z A;  1VZ8 A;  4K81 A;  1WXM A;  4KZC A;  3ZYY X;  2LFI A;  4B6W A;  1BML C;  2LXC A;  4JWU C;  1PFD A;  3IXS A;  3ZJV A;  3P4R B;  4PYU A;  3HM6 X;  2KNB A;  1L4D B;  4DDI D;  3I57 A;  4YTP B;  3W2D A;  1A5R A;  5IAA C;  4KGS A;  3KW5 B;  3URY A;  4ZHO A;  3PZ8 A;  3VUY A;  2N9E B;  2Y5P A;  3R2I A;  2NR2 A;  1AAR A;  2XK5 B;  4LNO A;  3SR6 A;  4RNA A;  2MSE D;  1LFD A;  4M00 A;  1FNW A;  4B0E A;  1TS5 A;  2D3B A;  3H8H A;  1CMX B;  1R4M B;  2DNF A;  2LGX A;  4HPP A;  2MBE A;  1WJU A;  4PYZ A;  3AE3 B;  2BKR B;  3PZD A;  2SAK A;  3WIM A;  1J8C A;  4KKI A;  1GOZ A;  1AN8 A;  3IT6 B;  4IM2 A;  2BGF A;  2MJD A;  2CHZ A;  3VUW A;  4HCP B;  2C5L C;  3IAS 1;  4WQO B;  1V2Y A;  5LXH A;  4LDT B;  1PDX A;  2QMT A;  3GP7 A;  4LLG M;  3UF8 A;  2N9K A;  4G50 A;  5KHO A;  1KM7 A;  3NOB A;  4TQ1 A;  2IO1 B;  1NI3 A;  1T3Q A;  3N32 A;  4RGT A;  2FUG 1;  2Q5W D;  4WAF A;  4IM3 A;  1LXD A;  2N9X A;  2VRR B;  3A9K B;  5DPW A;  3IFW B;  1SE2 A;  2L8J A;  3TCA A;  2ZZP B;  1WSP A;  3AI5 A;  5AZG A;  1QZE A;  4HPM B;  3LDZ E;  4RFB A;  2GOW A;  1XLN A;  1UGJ A;  2OJW A;  4B0M A;  3QWZ B;  4DXF A;  4DBG A;  2N9P C;  4IUM B;  1G6J A;  3UIP B;  4TQ0 A;  5IOI A;  2LVQ A;  4KDI C;  1ZW7 A;  3WAL A;  3NJT A;  4BOZ B;  3AM9 A;  4TUU A;  3W5V B;  2LGD A;  5I4D A;  4HK2 A;  2RR9 A;  4CHK A;  1UZX B;  3AED B;  4MH8 A;  4MSQ B;  1V81 A;  4KIK B;  3HVD A;  5E6P A;  4C7Y A;  3WA0 A;  3DBH I;  3VHT C;  2L0T A;  1WGD A;  2PVO D;  4NJ6 A;  5G2N A;  2G9H D;  4A3O A;  2WP9 B;  5J2R A;  3VH3 B;  2KX3 A;  1ZKH A;  1XF5 L;  2YLM A;  2KTR A;  2ASQ A;  2DX5 B;  4D2K A;  2KO3 A;  2KQ7 A;  2MA9 B;  4A20 A;  5LXI B;  3DVN U;  1TS2 A;  3ZNZ B;  1FO4 A;  2J52 A;  3ZXV A;  4CO7 A;  4NAM A;  2IO3 B;  2NTT A;  3VH4 B;  1JML A;  2AQ1 B;  4OZA A;  5DPS A;  3BIN A;  3WAO A;  1F0Z A;  4A9A A;  4ARI A;  1SE9 A;  2MBQ A;  5EE0 A;  1BT0 A;  3DPD A;  4W9D A;  1UH6 A;  2KK8 A;  1S1Q B;  2VZK D;  3B9J A;  4P1B C;  2DYM A;  3I3T B;  2WXP A;  2KLG A;  4MJS B;  2V3S A;  1TT5 B;  1WRI A;  3PZ7 A;  4XE0 A;  4EEW A;  5D3I B;  3AU5 A;  3A9J A;  5JHA A;  3CST A;  1K50 A;  4I6N B;  4GLS C;  2AL6 A;  3AEF B;  1V49 A;  4W9F A;  4WJP A;  4ANU A;  3DHI C;  3L16 A;  1WZ0 A;  2W54 A;  4E71 A;  4IOI E;  3HM3 A;  1XO3 A;  1UEL A;  1ZDV A;  2JXT A;  1XCT L;  3A1Q A;  1KOT A;  2ZVN A;  1I35 A;  1ROE A;  4BZA A;  2WX1 A;  3CSF A;  3OG5 A;  1SE4 A;  3RNA C;  4ZOH C;  2FCN A;  2XK5 A;  3ZJT A;  1PUT A;  2JY6 A;  4FLH A;  3TEX A;  1JRO A;  1TZ1 A;  2WLB A;  3P4P B;  1QKZ A;  2K22 A;  3V6C B;  4WWN A;  3U2S C;  3B1L X;  1A70 A;  1E9M A;  4IM0 A;  4MAC A;  1R7S A;  1MVK A;  5D94 A;  4DHZ B;  1RAX A;  1UNS A;  1J7C A;  4HEA 1;  2BWE S;  1CK1 A;  1WGR A;  4TSS A;  1T0R C;  3M95 A;  3VR8 B;  1D3Z A;  1WMH B;  2KWD A;  1D5M C;  2K3U A;  1STE A;  1PYW D;  1DGJ A;  3BZD B;  2IND C;  4RGN A;  5C1Z A;  2KXJ A;  1V5O A;  3P4S B;  4HLE A;  3WAN A;  1WGH A;  2NS5 A;  2LRW A;  2WU2 B;  5BYQ A;  2AYO B;  3DBL B;  4RF0 A;  2NBV B;  2DEN B;  1XT9 B;  1GC6 A;  4US8 A;  1EWY C;  1XD3 B;  1EU4 A;  2CJO A;  1SE3 A;  3JW0 X;  1DOY A;  3ZKJ C;  1K51 A;  4HKQ A;  2UYZ B;  1SF0 A;  1Y8R C;  2JX5 A;  1C76 A;  4F7Z A;  2FID A;  1ZOY B;  3DCG A;  4GDL B;  1ZPS A;  2MJ3 A;  3QA8 A;  1K52 A;  4ZHP A;  4IC7 B;  3SU8 X;  3BVM A;  1P0R A;  2N7E A;  2LD9 A;  1N60 A;  2KHW B;  3AV8 A;  1JW9 D;  2D2Q A;  3AEC B;  3W1S C;  1TJE A;  1K8R B;  3Q14 C;  3R66 C;  4FN2 A;  4WWO A;  2DAJ A;  4RGM A;  5HI1 A;  3RNB C;  3K9P B;  2D10 A;  2BQQ A;  1TTN A;  1TS4 A;  2Y5C A;  2ZCC A;  2LAS A;  4WIP A;  4NZL B;  5D7G A;  4O1N A;  4RM9 A;  4ZRK A;  4IG7 B;  3K9O B;  1LQB A;  2BPS A;  2K8H A;  4GB9 A;  2DHZ A;  1YX6 B;  2M4N A;  4K3B A;  1CZP A;  2BS3 B;  5HFY A;  5MPO A;  2N7J A;  2V4I B;  3SD5 A;  3ONS A;  1XLQ A;  4H2A A;  1H4R A;  5G5H A;  3AE8 B;  2D11 A;  1L6U A;  4GXB A;  4E74 A;  2KN4 A;  3H9D A;  4FXC A;  1F2R C;  2KVZ A;  2KQS A;  3VDZ A;  2W3R A;  1L7Y A;  2QDF A;  3VRA B;  3NS1 A;  1WYG A;  4MJS A;  3N1Y C;  1D6E C;  2SEB D;  2K6D B;  1JQ4 A;  3AE5 B;  2L05 A;  2G4S A;  3RT3 B;  5C3J B;  1N6Z A;  2I38 A;  3J9C A;  3Q3N C;  2IO2 B;  2WXH A;  3PO0 A;  4EZK A;  3VAW A;  3PLV A;  1QIL A;  1YQ4 B;  4M8N A;  3NVY A;  2A4Z A;  4FBJ B;  1J7A A;  2K8C A;  1HE8 A;  2ON8 A;  2V3N A;  2KDE B;  2QCZ A;  3H7P B;  3KUD B;  3MHS D;  1WE6 A;  4WJQ A;  3HIZ A;  4BVU C;  1YN5 A;  3QIJ A;  2NBU A;  1OTR B;  3L0W B;  2X8X X;  2N1W A;  4KSL C;  4ZYN A;  3GE8 C;  3Q3O C;  1EF1 A;  3AE4 B;  1L5P A;  5CHW A;  3T3N A;  1V1P A;  4AOF A;  1ZE3 D;  2KFK A;  2IGD A;  1T0S C;  3ECI A;  2BT6 A;  3VTW A;  4USA A;  4P16 A;  1WFY A;  4NJC A;  4OW0 A;  2KD0 A;  3Q6B A;  3H7S A;  4TKN A;  1RWS A;  4N59 A;  4EE2 A;  4OHJ A;  2JWU A;  4YSY B;  1VJK A;  4A8X C;  2GLS A;  2O6V A;  4PT5 A;  3RFZ B;  3MHZ A;  5IA7 A;  4DXG A;  4IDI A;  1I4G A;  3SFE B;  3W5U B;  3AMZ A;  1L2N A;  2LMC A;  4PS3 A;  2WHI A;  1V1P B;  2RPQ A;  4RM8 A;  5IN7 A;  3Q3M C;  2JF5 A;  2H88 B;  3Q8F A;  1KFY B;  3V05 A;  4KZ0 A;  2MRP A;  2M8S A;  1D5X C;  2BKF A;  3C8Y A;  1J19 A;  5BMI A;  4HPL B;  3M3J A;  2AWT A;  3IHP C;  2FCM A;  3GOE A;  2LI5 A;  1FMA D;  3FIL B;  2E6X A;  1AYF A;  3KYD D;  4AJY B;  4G11 A;  4DHZ E;  1ET6 A;  3TEZ A;  4BAX A;  1N5X A;  3ZIM A;  2EEL A;  2K0P A;  3GS2 A;  2DZJ A;  1VZ6 A;  5FR3 A;  1VCB A;  1HZ5 A;  1XEE A;  4BKT A;  1C79 A;  3GZN B;  1YN4 A;  2LGS A;  1P3Q U;  3GZN I;  2QJL A;  3HUI A;  4MGZ E;  3I63 C;  2MQJ A;  2L52 A;  4LK0 M;  3EA6 A;  1JCK B;  4XGA B;  4XDC A;  2INP E;  2G45 B;  1YOV B;  1WY8 A;  4NNJ B;  4NAW B;  1FXT B;  3LYY A;  5FK9 C;  3X23 A;  2WWZ A;  4ITK A;  2LUM A;  4N6E B;  2J4X A;  4IWO A;  2BVC A;  4C00 A;  4DDG D;  1IP9 A;  1IUE A;  1TIF A;  2W3S A;  3FKY A;  1OFF A;  5FKA C;  3TMP B;  2WQY B;  1ESF A;  1LM8 B;  2PMV A;  3ZRC A;  1E6E B;  4EOY A;  3TUO A;  4JE3 B;  1MG8 A;  3PRE A;  2L00 B;  3MTN B;  5JZE B;  1LGR A;  3EEC A;  1RFK A;  2K1F A;  2KQ4 X;  5C23 A;  4W9J A;  3KUC B;  4WWP A;  1F2R I;  4MEL A;  4XWW A;  3NHE B;  1IPG A;  2LUE A;  2CKH B;  3ZJU A;  4AUQ C;  1MHX A;  5C2T B;  1L4Z B;  3N9Y C;  2BYV E;  4ICV A;  3KUZ A;  1XXG A;  5H8Y E;  2B3A A;  2OED A;  4M8M A;  4FA6 A;  2PVG C;  3A33 B;  1ET9 A;  3A1Q B;  2D07 B;  4YSZ B;  4BBN C;  2DZM A;  4K7W A;  3AEG B;  2RDG A;  4NQL B;  4WJN A;  4FUL A;  1CJE A;  2DZI A;  4RGO S;  4ACF A;  4LJO B;  4AP4 C;  4C4V B;  1SGH A;  3V61 A;  4WQM A;  4W9K A;  4XX5 A;  1DOX A;  2M1M A;  3KWL A;  2L7R A;  3DOW A;  2NPT B;  2LXA A;  5CHV C;  4F1S A;  2MEK A;  4J6I A;  5CTR C;  4NJ7 A;  1GC7 A;  4YL8 A;  4REZ A;  5TSS A;  3W1S A;  2ZPY A;  3VVW B;  2O2V A;  1FEH A;  4YXD B;  4ANW A;  1UWX A;  2BBC A;  2EMS A;  3RCZ A;  3PRM B;  3W1Y A;  4HKZ E;  3Q3F A;  2QIL A;  2KOX A;  4MGY E;  4C56 C;  2O6V B;  2NPT A;  2V1Y A;  3KQ4 A;  3AE2 B;  3QC8 B;  2M0A A;  4RF1 A;  1TGZ B;  4IWP A;  2MBH A;  3DBS A;  3LB8 C;  4N58 A;  2H89 B;  2V9H A;  3BVZ A;  2ZPN A;  1GB1 A;  1ZP0 B;  4GIV A;  2O2V B;  1Z5S B;  4DK5 A;  4DHJ D;  4WJO A;  1KRH A;  3AE1 B;  2XN9 C;  2KTR B;  4EFO A;  4XDD A;  3SHQ A;  1JAL A;  4F8C B;  5GXG B;  2G4D B;  3MJW A;  4YTN B;  4ZRQ A;  1V97 A;  2D5G A;  3ZO5 B;  4A90 A;  5D3D A;  1L0X B;  4GOC A;  2MH7 A;  3L13 A;  2KT7 A;  4RH6 A;  2N1V A;  2PKO A;  1TZO A;  1XQQ A;  2WNM A;  4MH0 E;  1OQQ A;  1KLG D;  3R3M A;  4FJY A;  2CU1 A;  1R4N I;  2INN E;  1QF6 A;  3WAP A;  2J53 A;  3EFU A;  1I4R A;  2ACZ B;  2GI9 A;  2J42 A;  3VQI A;  3L4P A;  4DXA B;  2IZV B;  1OGW A;  2KAC A;  4MM3 A;  3QAQ A;  4KKJ A;  2BW2 A;  2R2Q A;  2CU3 A;  2PEA A;  4EKU A;  1OEY J;  3L17 A;  2WXI A;  2LJ5 A;  2EMT A;  1SIJ A;  1FNU A;  3PT2 B;  2QC8 A;  3OAW A;  2ZW1 A;  2KN5 A;  2L83 A;  3U7D A;  2AQ2 B;  3N30 A;  4NQK E;  2KMC A;  5CX3 A;  3T3O A;  4GDL A;  4AWJ A;  1UF0 A;  1JRU A;  4LJP B;  2L3Z A;  2YVC A;  4A55 A;  3APC A;  5HG2 A;  4EZJ A;  2N7D A;  2PW9 A;  3ZNH B;  2LEK A;  2K8B A;  2KC2 A;  1X1M A;  4ANX A;  3ETR A;  3DWG C;  2WU5 B;  2O6V D;  2REX A;  3B0A A;  1WGG A;  3MC8 A;  5E6J A;  5BYR A;  1NEN B;  1NVI D;  5G55 A;  2KLC A;  3U7Z A;  3DBR B;  4XWT A;  2WYQ A;  3MFG A;  1WXS A;  1I7H A;  1FFU A;  4IWQ A;  1QLB B;  1VRA B;  1HA5 A;  2AX5 A;  2RPV A;  1MPE A;  2ZCB A;  3DVG X;  1E8X A;  2J0M A;  3BWU D;  2G3Q B;  2JU6 X;  1WXQ A;  2FCQ A;  4HJG E;  4C80 A;  5EE9 A;  4M0W A;  3RZF A;  1YMH E;  2HTH A;  3TSS A;  2G1E A;  3NRZ A;  2HD5 B;  4ARC A;  4UDU C;  4S0R A;  1KJT A;  3Q3J A;  3U4E G;  3H6N A;  1N63 A;  1P1A A;  2OOB B;  2LGY A;  3AE6 B;  4B95 A;  2AQ3 B;  4HRO A;  2MLB A;  3P63 A;  3KH0 A;  1OQR A;  5JXV A;  4DWF A;  2WXF A;  2ZW0 A;  3N3K B;  3DBR I;  3NZU A;  4MGK E;  3NZ3 A;  2R2O A;  3RNC C;  1SEB D;  1Q0W B;  3NG0 A;  2BYE A;  3AEA B;  1RYJ A;  2HE7 A;  2I2Y A;  3EC8 A;  1R4N B;  3PTF C;  4LTU A;  4ZYS A;  1V5T A;  4LNI A;  5IP4 D;  3Q8C A;  2CHW A;  2PJH A;  2TSS A;  2C7N B;  2ZEQ A;  3GB1 A;  4FHK A;  1TKE A;  1JWU D;  2JYE A;  4BKG A;  1WF9 A;  1TS3 A;  2KDB A;  5FR6 A;  3X0W A;  2QIE B;  3QJZ A;  2RSU A;  2BWF A;  2EKI A;  3L08 A;  3OWE B;  4A3P A;  1QOF A;  1TY0 A;  4P7I A;  4I6P A;  1FNV A;  1JWM D;  1GJZ A;  2L0F A;  2ONQ A;  2LWP A;  5DPR A;  1NDD A;  1E5W A;  2IDY A;  2N4F A;  4CQN A;  4OVV A;  4HDQ A;  2ZVO A;  1FFV A;  4JIO U;  2K25 A;  4OZC A;  3V6E B;  5E6O A;  4KIK A;  2XNA C;  2KKC A;  1QOG A;  3WAM A;  4R3D A;  3RUI B;  4TV3 A;  3ALB A;  2KJ6 A;  3BY4 B;  2R61 A;  2LHE A;  1GB4 A;  3V62 A;  3AEE B;  5EDS A;  3CWI A;  3KLS X;  3ZTC A;  2Z8L A;  2WXG A;  3QAR A;  1WR6 E;  3P1M A;  1WH3 A;  3U52 E;  1L6V A;  3TEY A;  4KX6 B;  4MGI E;  3A9K A;  3QCA A;  3QK0 A;  1DOI A;  4JQW C;  3ABV B;  2JQR B;  4IKG A;  4LNN A;  3OJ3 A;  1M4V A;  2FIF A;  3RNG C;  2JXX A;  4HCN B;  1E7U A;  1EWC A;  4MEM A;  5AZH A;  4ANV A;  1WR1 A;  3MJ5 A;  2M17 A;  2DYO A;  2WXK A;  1XLO A;  1F77 A;  2CS4 A;  3DWM A;  3PS6 A;  1C77 A;  1I4P A;  3TL5 A;  3ZLZ A;  3RUL A;  4I6L B;  4WH4 A;  3SFD B;  3B2G A;  1MFW A;  1BUI C;  2I1J A;  4HRS A;  1ACC A;  2BS2 B;  4JL9 A;  3L54 A;  2M0X A;  1MG4 A;  3TBL D;  1P7F A;  1GAQ B;  2OHF A;  2JYT A;  3Q8E A;  2LJI A;  5JH5 C;  5AZF A;  5HKH A;  2KMM A;  3B2F A;  2GBJ A;  2JUO A;  1Z2M A;  2GBR A;  4LCD E;  3D32 A;  4MDK E;  1ZGU B;  5J17 A;  3RN9 C;  3JSV B;  3U30 A;  3DVG Y;  1I4X A;  2DWQ A;  1WJ4 A;  2GBM A;  2MHJ A;  3EGR A;  2JZ3 B;  4YSX B;  1WX9 A;  1I4Q A;  1E7V A;  3EHV A;  2VH2 A;  2J0J A;  5BYS A;  1SIF A;  2Y3A A;  5T8I A;  1PGA A;  1AW7 A;  5AUK A;  1UD7 A;  3QQ8 B;  3P42 A;  4PS8 A;  2EKE C;  1C9F A;  3CF6 E;  3UIN B;  1WXA A;  2WDR B;  3O65 B;  3PRP B;  3A9J B;  2MBO A;  2NCN A;  2Z0D B;  3WCQ A;  3T9L A;  1WGY A;  5D2M B;  3ZTD A;  3VTV A;  4BKS D;  3DBH B;  1TBE A;  2NMQ A;  2BS4 B;  3ZVV A;  4ASW C;  1KF6 B;  2IGH A;  1EU3 A;  1FRR A;  2L32 A;  5EE3 A;  2J0K A;  2KWV B;  1NEK B;  2NBW B;  1WM3 A;  1EF5 A;  2DLB A;  1OQY A;  2C7H A;  1ZXH A;  4N9F 4;  4BKS A;  1NBF C;  2KMA A;  3CMM B;  1VZ7 A;  1JWA D;  2JPH A;  4YWG G;  3UGB B;  1HTO A;  1IBX A;  3QX1 A;  1N5W A;  4YTM B;  1NI2 A;  1JWB D;  2WGS A;  2FBW B;  2V0G A;  2PPH A;  1C78 A;  1L0Y B;  4W9G A;  3MP9 A;  2JRH A;  5J18 A;  1GPX A;  2Y5B B;  2PLP A;  1C4P A;  3VXW A;  3PHX B;  2GB1 A;  1T0Q C;  2A5U A;  3RMK C;  3ZW3 A;  3RPF C;  3HK0 A;  2Z0E B;  3DVN V;  3ZXR A;  4IW0 A;  3DQV A;  4JLC A;  3UI3 A;  1F52 A;  2L1A A;  4US9 A;  2YEP B;  3AUL A;  5G5G A;  4II3 B;  1WZ3 A;  1IBX B;  2PIA A;  2KX0 A;  2OJR A;  2HTM E;  3OJ4 B;  5L95 C;  5L83 A;  1YJI A;  1FD6 A;  2W82 A;  4LDT D;  4ZRI A;  2WXR A;  5GMV A;  4NY0 A;  1YNT E;  2RGF A;  3AXC A;  3RI7 C;  2MBB B;  4K7U A;  4P1C C;  3PRZ A;  2LVP A;  4GMV A;  2CR5 A;  3JVZ X;  2N0S B;  4HDO A;  2AEH A;  4FJZ A;  5BMH A;  2KAJ A;  1I42 A;  1JWS D;  2LZ6 A;  3R7R A;  1J0G A;  2KWU B;  2LRU A;  1YX5 B;  1BXT A;  1Q1O A;  1K53 A;  3PVL A;  1P98 A;  4EZL A;  3NUH B;  4GN1 A;  2MP2 B;  2DAF A;  1C3T A;  1ZXI A;  3AN1 A;  3NZS A;  4YT0 B;  2KYW A;  2XEW A;  1NYR A;  3IAM 1;  1YJJ A;  4W9I A;  1J7B A;  2HJ8 A;  1DYQ A;  2FUH B;  2XBB C;  3R2T A;  3ZRF A;  4KDL B;  4Q2J A;  1ZDX A;  1YJ1 A;  1WM2 A;  1Y56 A;  3H7P A;  3A4S C;  1FPY A;  2I1K A;  4FHJ A;  3SEB A;  3BII D;  2ZNV B;  1E0Z A;  1QOB A;  3N1Z C;  2DBY A;  1WRD B;  1PGB A;  2MP2 A;  3APD A;  3NVV A;  2VZK B;  1LO5 D;  4HWI B;  1WX8 A;  1KH0 A;  1U4A A;  3NY5 A;  2MW5 A;  4E3C A;  2LGI A;  3RNF C;  1V9J A;  1V8C A;  2WDQ B;  5JHB A;  4ZRP A;  1UUP A;  2BTE A;  1B1Z A;  2KDM A;  3JSV A;  4RCO A;  2K6Q A;  1EM7 A;  4GGQ A;  3I9V 1;  1XLP A;  3LXF A;  1WXV A;  5H92 C;  2L76 A;  2KJR A;  3AEB B;  1WE7 A;  3L10 B;  1RFA A;  2KJH B;  4ICU A;  3R7Q A;  3Q69 A;  3UQA A;  1IYF A;  1V80 A;  2M19 A;  3ML9 A;  3KYC D;  1JRP A;  1C1Y B;  4GDK A;  1WIA A;  3RNE C;  5KHQ A;  2ZNV C;  2M56 B;  4LNF A;  1E8Y A;  2WX0 A;  2KDI A;  2W55 A;  3IBE A;  3BVG A;  2RD0 A;  3E56 A;  1GUA B;  4GSW A;  2D3G A;  3NS8 A;  4M0W B;  3FIL A;  2LHD A;  2PE6 B;  3HHM A;  4XYC A;  1QQR A;  2IBI B;  1WMH A;  3ML8 A;  2RDB C;  3RZW C;  2IYD B;  2NTS A;  3IVF A;  1MI0 A;  2KWC A;  3MC9 A;  4FJV B;  5CHF A;  4OVU A;  1SJH D;  3ZDT A;  2KC1 A;  1YN3 A;  3M62 B;  2JZZ A;  2GBN A;  2MX2 A;  3BK2 A;  3DHG C;  1SXT A;  3Q8B A;  3ZUN A;  2WXO A;  1RRB A;  4HJK A;  3AE7 B;  3C0R B;  3AB5 A;  3BK1 A;  4C4V A;  1YD8 U;  4WUR A;  4HVB A;  5AEK B;  3O13 A;  4LNK A;  2QHO A;  1UWM A;  1Q10 A;  5TR5 A;  4WWM A;  2MWS B;  1ENF A;  1V6E A;  1M94 A;  3VUX A;  1UBQ A;  1OEY A;  5IKC M;  4FAD A;  4ZDV A;  2INC C;  2DYB A;  3PPA A;  3APF A;  2CHX A;  3OLM D;  4M01 A;  2JT4 B;  2RMM A;  3VFK A;  3ZGZ A;  1Q5W B;  4GU2 A;  2JZP A;  3BYT B;  2K5P A;  4M02 A;  1UBI A;  1KLU D;  3E9S A;  3PLU A;  4KVG B;  2BYT A;  4MM3 B;  5LNK 1;  3A4R A;  5IO9 A;  1EUV B;  4K3C A;  2V3P A;  2WXQ A;  4AS1 A;  2ICI A;  1E8W A;  5DPT A;  3TJP A;  4RMA A;  4JPS A;  2BB6 A;  3DBL I;  5LLI A;  3QHT A;  3AU4 A;  1WGK A;  3MC0 B;  4OVZ A;  3U8Z A;  1SJE D;  1ISN A;  2IY0 B;  1V1O A;  1TYG B;  2FCS A;  2BB5 A;  2W9N A;  2WXM A;  4XZ4 A;  1WJN A;  3B08 A;  3UQB A;  5HHD G;  2GBK A;  1WI0 A;  2WXL A;  3UIO B;  4AJW A;  1WJ6 A;  2GRI A;  2KAN A;  3I5J C;  2CJN A;  3Q8A A;  3EUB 2;  5BO4 B;  2KFJ A;  4NAW A;  3ZDM C;  2BYF A;  3LJ3 A;  1SSN A;  1ZUD 2;  1RM6 C;  2QSD A;  1HXY D;  3VR9 B;  3N20 C;  2QEJ C;  4K1R B;  1HQR D;  2WS3 B;  2LVO A;  1E7P B;  3VRB B;  3RD2 A;  1GG3 A;  3V3X A;  4L23 A;  2AL3 A;  3HRD D;  1T5X D;  1E10 A;  2JVC A;  1PGX A;  1SB3 C;  1D5Z C;  4WAA A;  1NYQ A;  2D3C A;  1QT9 A;  1S3S G;  2IGG A;  1IGC A;  4G3X B;  1PQS A;  2ZJD A;  1TKG A;  1V86 A;  1WYW B;  1KTK A;  1TKY A;  3PGE A;  2JRI B;  3PV1 A;  4KGR A;  4W9H A;  2C7M B;  2HDE A;  2JSV X;  2D3A A;  1VR9 A;  1TY2 A;  3AH7 A;  1YIW A;  4A6Q A;  2IPK D;  1HTQ A;  4KSK C;  1L0V B;  2HJ1 A;  2V4L A;  2KFK B;  3EFC A;  4L1B A;  2GMI C;  1WWT A;  1FCC C;  3C19 A;  2WDT B;  2KZR A;  2K39 A;  4B9K A;  3NVW A;  3PHW B;  4P6V F;  2BF8 B;  3CIR B;  1FXI A;  3KWV A;  1N62 A;  4II2 B;  4BBN F;  4ZRJ A;  2WXN A;  4JWS C;  4DHJ B;  2KTF A;  3TEW A;  3S2A A;  3P2B A;  2JWZ A;  3SDL C;  3R8B A;  3TIX A;  1VDV A;  4CYE A;  1D4B A;  1MJD A;  2IO0 B;  1SBB B;  1IGD A;  1HZ6 A;  3ZQ4 A;  2PE9 A;  2NVU I;  5D6J B;  3T8M A;  4KV2 A;  4W9L A;  1YQ3 B;  4JX1 C;  2MJE A;  1FCL A;  2UU7 A;  5BMG A;  2KVR A;  1FXA A;  4MSM B;  2WXJ A;  4AQ7 A;  4DQO C;  4S17 A;  1C4C A;  2IY1 B;  3JYU A;  1MHH E;  3KVF B;  1C4A A;  4TMA B;  4W9C A;  3VTU A;  4L2Y A;  2RDH A;  5EE1 A;  2WDV B;  3RYT A;  1T6B X;  2X38 A;  2DZK A;  1CQV A;  4NPN A;  1VD2 A;  2PTL A;  2N9L A;  2FNJ B;  4OZB A;  3ENE A;  2FAZ A;  3NVZ A;  4J3O D;  2KDF B;  1FRD A;  1GNU A;  4X57 B;  4HXD A;  2VH1 A;  2E3T A;  1P9D U;  3V60 A;  4KGT A;  2Z59 B;  4W9E A;  4BOS C;  1E90 A;  1XCQ L;  3AE9 B;  4PK1 A;  3DHH C;  1FM0 D; 
#chains in the Genus database with same CATH homology
 4URK A;  2DAJ A;  2CR5 A;  3JVZ X;  3PT2 B;  4HDO A;  3M63 B;  2AEH A;  3OAW A;  4FJZ A;  1F9J A;  3DDC B;  2D10 A;  3K9P B;  2KN5 A;  4BFR A;  1TTN A;  3U7D A;  1I42 A;  3N30 A;  2LZ6 A;  2ZCC A;  1YQB A;  4NQK E;  3R7R A;  3PSE B;  2KWU B;  2LAS A;  1J0G A;  5D7G A;  2LRU A;  2MCN B;  1YX5 B;  2KMC A;  4RM9 A;  5E6N A;  4ZRK A;  5CX3 A;  4IG7 B;  1Q1O A;  4GDL A;  3PVL A;  3K9O B;  4AWJ A;  1P98 A;  2J7Q B;  4EZL A;  1LQB A;  1JRU A;  1R4M I;  2BPS A;  4JGH B;  4LJP B;  2K8H A;  5DCN A;  4GN1 A;  2L3Z A;  4GB9 A;  1RLF A;  2MP2 B;  4G0N B;  2DAF A;  2DHZ A;  1C3T A;  2YVC A;  1YX6 B;  3APC A;  3NZS A;  2M4N A;  4EZJ A;  2XEW A;  2N7D A;  1UGM A;  3ZNH B;  4W9I A;  2K8B A;  2KC2 A;  2HJ8 A;  1X1M A;  4ANX A;  3SD5 A;  3ONS A;  1H4R A;  2FUH B;  3IG3 A;  4XC2 A;  2D11 A;  2XBB C;  2O6V D;  1T0Y A;  2REX A;  3ZRF A;  3B0A A;  4KDL B;  1WGG A;  4GXB A;  4E74 A;  3H9D A;  1YJ1 A;  1WM2 A;  1H8C A;  3H7P A;  2KQS A;  3A4S C;  3VDZ A;  1L7Y A;  5G55 A;  2I1K A;  4MJS A;  2C60 A;  4FHJ A;  3ZNI D;  2KLC A;  4K7S A;  2ZNV B;  1KLV A;  2K6D B;  4EUT A;  1WRD B;  2L05 A;  2G4S A;  3RT3 B;  1EO6 A;  2MP2 A;  2UWQ A;  2WYQ A;  3APD A;  1WXS A;  4HWI B;  4GDK B;  1WX8 A;  2IO2 B;  3H1U A;  1WX7 A;  4IWQ A;  1U4A A;  4EZK A;  3VAW A;  3NY5 A;  3PLV A;  4PS7 A;  2MW5 A;  4E3C A;  2ZCB A;  3DVG X;  4M8N A;  1E8X A;  1V9J A;  3ZNG C;  2A4Z A;  2C9W B;  2J0M A;  1E8Z A;  4FBJ B;  5JHB A;  2G3Q B;  4K81 A;  1WXM A;  2FCQ A;  4KZC A;  2K8C A;  3JSV A;  1HE8 A;  3RZF A;  4B6W A;  2KDE B;  2HTH A;  2LXC A;  3H7P B;  3KUD B;  3MHS D;  1WE6 A;  4WJQ A;  2HD5 B;  2K6Q A;  3HIZ A;  4BVU C;  3QIJ A;  4GGQ A;  1KJT A;  3Q3J A;  1WXV A;  4PYU A;  2NBU A;  3HM6 X;  2L76 A;  1OTR B;  3L0W B;  2KNB A;  2KJR A;  3H6N A;  4DDI D;  4ZYN A;  2N1W A;  1WE7 A;  4KSL C;  1A5R A;  1EF1 A;  3L10 B;  1P1A A;  2OOB B;  2LGY A;  5IAA C;  1RFA A;  4B95 A;  2KJH B;  4ICU A;  3R7Q A;  3KW5 B;  3UQA A;  2MLB A;  1IYF A;  1V80 A;  3KH0 A;  3ML9 A;  5CHW A;  3KYC D;  4AOF A;  2KFK A;  4DWF A;  3VUY A;  2N9E B;  1C1Y B;  3ECI A;  4GDK A;  1WIA A;  3VTW A;  1WFY A;  3N3K B;  2KD0 A;  2NR2 A;  1AAR A;  5KHQ A;  3H7S A;  3DBR I;  3NZU A;  4MGK E;  2ZNV C;  4TKN A;  2XK5 B;  2R2O A;  1E8Y A;  2WX0 A;  2MSE D;  1Q0W B;  2BYE A;  1LFD A;  2KDI A;  2HE7 A;  3EC8 A;  3IBE A;  2RD0 A;  1CMX B;  1GUA B;  4GSW A;  2LGX A;  2D3G A;  3PTF C;  3NS8 A;  4M0W B;  1V5T A;  2CHW A;  2O6V A;  2PJH A;  2C7N B;  2PE6 B;  2MBE A;  3HHM A;  2ZEQ A;  1WJU A;  5IA7 A;  4FHK A;  4PYZ A;  2IBI B;  1WMH A;  3ML8 A;  2BKR B;  3PZD A;  1L2N A;  3WIM A;  4BKG A;  1J8C A;  1WF9 A;  4PS3 A;  3RZW C;  2KDB A;  2IYD B;  2RPQ A;  4RM8 A;  3IVF A;  5FR6 A;  2KWC A;  4FJV B;  5CHF A;  3X0W A;  4OVU A;  4IM2 A;  2JF5 A;  3QJZ A;  2BGF A;  3ZDT A;  2KC1 A;  2RSU A;  3M62 B;  2BWF A;  2JZZ A;  2GBN A;  2CHZ A;  2MX2 A;  4KZ0 A;  3VUW A;  3L08 A;  4HCP B;  2MRP A;  2C5L C;  4WQO B;  3ZUN A;  4A3P A;  1V2Y A;  2M8S A;  5LXH A;  4LDT B;  1RRB A;  2BKF A;  4HJK A;  4I6P A;  4P7I A;  1J19 A;  4HPL B;  3M3J A;  2AWT A;  3UF8 A;  3C0R B;  1GJZ A;  2L0F A;  2LWP A;  4G50 A;  5KHO A;  5DPR A;  1KM7 A;  3NOB A;  4TQ1 A;  2IO1 B;  1YD8 U;  1NDD A;  3IHP C;  1E5W A;  2FCM A;  3GOE A;  4HVB A;  5AEK B;  3N32 A;  2LI5 A;  2N4F A;  2QHO A;  4OVV A;  4HDQ A;  5TR5 A;  2ZVO A;  4IM3 A;  2MWS B;  3KYD D;  4AJY B;  4JIO U;  2K25 A;  4G11 A;  1LXD A;  1V6E A;  2N9X A;  2VRR B;  3A9K B;  5E6O A;  3V6E B;  1M94 A;  3VUX A;  1UBQ A;  4DHZ E;  1OEY A;  5DPW A;  4KIK A;  3IFW B;  2L8J A;  3TCA A;  3ZIM A;  2KKC A;  2ZZP B;  4FAD A;  4ZDV A;  3AI5 A;  5AZG A;  2DYB A;  1QZE A;  3PPA A;  3WAM A;  2DZJ A;  4HPM B;  3LDZ E;  3RUI B;  3APF A;  2GOW A;  1VCB A;  2CHX A;  3OLM D;  4TV3 A;  3ALB A;  2KJ6 A;  3QWZ B;  2JT4 B;  3BY4 B;  4BKT A;  4DBG A;  3VFK A;  2N9P C;  4IUM B;  1G6J A;  3UIP B;  3V62 A;  4TQ0 A;  1Q5W B;  1P3Q U;  3GZN I;  2LVQ A;  4KDI C;  1ZW7 A;  4GU2 A;  3WAL A;  5EDS A;  4MGZ E;  4BOZ B;  2MQJ A;  1UBI A;  4TUU A;  2LGD A;  3PLU A;  4KVG B;  3ZTC A;  4HK2 A;  2RR9 A;  3A4R A;  3QAR A;  4CHK A;  2G45 B;  1WR6 E;  1EUV B;  1WH3 A;  1UZX B;  1WY8 A;  4NNJ B;  4MSQ B;  4MGI E;  4NAW B;  1V81 A;  1FXT B;  4KIK B;  3A9K A;  3X23 A;  3QCA A;  3QK0 A;  5E6P A;  2WWZ A;  1E8W A;  5DPT A;  3TJP A;  4RMA A;  4IWO A;  4JQW C;  3DBL I;  3WA0 A;  4DDG D;  3DBH I;  5LLI A;  3VHT C;  3QHT A;  1IP9 A;  2L0T A;  3OJ3 A;  1WGD A;  3AU4 A;  4NJ6 A;  5G2N A;  2FIF A;  4A3O A;  5J2R A;  3VH3 B;  2KX3 A;  3TMP B;  2JXX A;  4HCN B;  1ISN A;  2IY0 B;  3U8Z A;  1E7U A;  1ZKH A;  4MEM A;  5AZH A;  1LM8 B;  4ANV A;  1WR1 A;  2M17 A;  2FCS A;  2DYO A;  2ASQ A;  2DX5 B;  2KTR A;  2YLM A;  3ZRC A;  4EOY A;  2W9N A;  1MG8 A;  2L00 B;  3PRE A;  2KO3 A;  2KQ7 A;  3MTN B;  4XZ4 A;  2MA9 B;  1WJN A;  2CS4 A;  3PS6 A;  3B08 A;  4A20 A;  5JZE B;  3EEC A;  3UQB A;  2K1F A;  5LXI B;  3DVN U;  3TL5 A;  5C23 A;  2GBK A;  4W9J A;  3ZLZ A;  3KUC B;  3RUL A;  4WWP A;  3ZNZ B;  4MEL A;  4I6L B;  1WI0 A;  1IPG A;  3NHE B;  3UIO B;  2LUE A;  4AJW A;  4CO7 A;  1WJ6 A;  2CKH B;  2I1J A;  2IO3 B;  3VH4 B;  2KAN A;  4AUQ C;  5DPS A;  5BO4 B;  3BIN A;  4JL9 A;  3L54 A;  3WAO A;  2BYV E;  2KFJ A;  4NAW A;  2M0X A;  4ICV A;  3KUZ A;  3TBL D;  2BYF A;  3ZDM C;  1SE9 A;  2MBQ A;  2B3A A;  1BT0 A;  3LJ3 A;  4M8M A;  4FA6 A;  3DPD A;  4W9D A;  3A33 B;  1UH6 A;  2KK8 A;  1S1Q B;  3A1Q B;  5JH5 C;  2D07 B;  5AZF A;  5HKH A;  4BBN C;  2DZM A;  2DYM A;  3I3T B;  4K7W A;  2GBJ A;  2JUO A;  2KLG A;  4NQL B;  4K1R B;  4WJN A;  1Z2M A;  2V3S A;  4MJS B;  2LVO A;  4FUL A;  2GBR A;  4LCD E;  3D32 A;  4MDK E;  3RD2 A;  2DZI A;  1GG3 A;  1ZGU B;  5J17 A;  4EEW A;  3JSV B;  4LJO B;  3U30 A;  3AU5 A;  4AP4 C;  1SGH A;  2AL3 A;  3A9J A;  3DVG Y;  3V61 A;  5JHA A;  2JVC A;  3CST A;  4W9K A;  4XX5 A;  2M1M A;  4I6N B;  4WAA A;  2L7R A;  3DOW A;  1WJ4 A;  2GBM A;  2NPT B;  2LXA A;  2AL6 A;  2JZ3 B;  1S3S G;  1WX9 A;  5CHV C;  4G3X B;  1V49 A;  4W9F A;  4WJP A;  4ANU A;  3L16 A;  4F1S A;  1PQS A;  3EHV A;  1E7V A;  2ZJD A;  1WZ0 A;  4E71 A;  4J6I A;  2J0J A;  3HM3 A;  1SIF A;  5CTR C;  1V86 A;  4NJ7 A;  1GC7 A;  1WYW B;  1UEL A;  4YL8 A;  3PGE A;  3A1Q A;  1KOT A;  2ZVN A;  2JRI B;  3PV1 A;  1I35 A;  2WX1 A;  3W1S A;  2ZPY A;  3CSF A;  3VVW B;  2O2V A;  1UD7 A;  3QQ8 B;  4W9H A;  2C7M B;  2FCN A;  4ANW A;  2XK5 A;  1YIW A;  4PS8 A;  2EKE C;  2JY6 A;  4FLH A;  2EMS A;  3CF6 E;  3UIN B;  3RCZ A;  3PRM B;  1WXA A;  4KSK C;  3O65 B;  1TZ1 A;  3PRP B;  3A9J B;  3W1Y A;  2MBO A;  2NCN A;  3Q3F A;  2Z0D B;  2V4L A;  2KOX A;  3T9L A;  2KFK B;  4MGY E;  1WGY A;  5D2M B;  2GMI C;  2O6V B;  3ZTD A;  2NPT A;  3VTV A;  4BKS D;  1TBE A;  2WDT B;  4WWN A;  3V6C B;  3ZVV A;  2KZR A;  4ASW C;  2V1Y A;  3B1L X;  2K39 A;  3QC8 B;  4IM0 A;  4B9K A;  3PHW B;  1TGZ B;  2BF8 B;  5D94 A;  4DHZ B;  4IWP A;  1RAX A;  2MBH A;  3DBS A;  4II2 B;  4BBN F;  4ZRJ A;  2BWE S;  2J0K A;  4DHJ B;  1WGR A;  2KTF A;  2KWV B;  2ZPN A;  2NBW B;  1WM3 A;  1EF5 A;  4GIV A;  1OQY A;  2O2V B;  2C7H A;  1Z5S B;  4DK5 A;  4N9F 4;  3S2A A;  4DHJ D;  3P2B A;  4BKS A;  1NBF C;  2KMA A;  3CMM B;  3M95 A;  4WJO A;  2JWZ A;  4GMV A;  2JPH A;  3SDL C;  1D3Z A;  3TIX A;  3UGB B;  1WMH B;  2KTR B;  4CYE A;  4EFO A;  3QX1 A;  2IO0 B;  3SHQ A;  1NI2 A;  4F8C B;  5C1Z A;  2G4D B;  2KXJ A;  2NVU I;  2PE9 A;  3MJW A;  4KV2 A;  1V5O A;  2PPH A;  4W9L A;  5D6J B;  3T8M A;  4W9G A;  2JRH A;  4HLE A;  5J18 A;  3WAN A;  3ZO5 B;  2Y5B B;  2KVR A;  3VXW A;  1WGH A;  3PHX B;  4MSM B;  2NS5 A;  4GOC A;  3L13 A;  2A5U A;  2LRW A;  3ZW3 A;  2N1V A;  3HK0 A;  2Z0E B;  1XQQ A;  2IY1 B;  2AYO B;  3JYU A;  3KVF B;  3VTU A;  4W9C A;  4MH0 E;  2NBV B;  2DEN B;  3DVN V;  1XT9 B;  4IW0 A;  1GC6 A;  3DQV A;  3RYT A;  1XD3 B;  3R3M A;  4JLC A;  4FJY A;  2CU1 A;  3JW0 X;  1R4N I;  3AUL A;  2DZK A;  3ZKJ C;  3WAP A;  4II3 B;  1WZ3 A;  1VD2 A;  3EFU A;  4NPN A;  2UYZ B;  1Y8R C;  2KX0 A;  2OJR A;  3OJ4 B;  5L95 C;  4F7Z A;  2FID A;  2FNJ B;  3ENE A;  3DCG A;  3VQI A;  5L83 A;  4GDL B;  4DXA B;  2FAZ A;  2IZV B;  1OGW A;  3QA8 A;  4LDT D;  2KDF B;  4IC7 B;  3QAQ A;  4MM3 A;  4ZRI A;  1P0R A;  2N7E A;  3SU8 X;  1GNU A;  4X57 B;  2LD9 A;  4HXD A;  2KHW B;  1P9D U;  5GMV A;  2D2Q A;  3V60 A;  2R2Q A;  4NY0 A;  3W1S C;  2Z59 B;  4W9E A;  2PEA A;  1K8R B;  1E90 A;  2RGF A;  3AXC A;  4BOS C;  4EKU A;  2MBB B;  4K7U A;  1OEY J;  3L17 A;  3R66 C;  4FN2 A;  4WWO A;  3PRZ A;  2LVP A;  2LJ5 A;  2EMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...